4CO0A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
109
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords PII-LIKE PROTEIN PZ
total genus 23
structure length 109
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co0A00
4CO4A 2O66A 3AA9A 3NCRA 3CE8A 3TA1A 4CO5A 1QY7A 4YB7A 2XBPA 1NZAA 2NS1B 5D4LA 4E98A 1VFJA 1H3DA 2J9DA 1V3RA 3OPKA 1UMJA 4RLEA 3GSDA 1VHFA 2V5HG 4RWWA 4CO3A 4CO1A 1V9OA 1V3SA 1XK8A 4CO0A 2JJ4D 4C3LA 4CNZA 2XULA 4CNYA 4USIA 3AH6A 4OZNA 3LF0A 3DFEA 3TA2A 1Q1KA 4IYQA 4RWXA 5L9NA 3AA8A 2E66A 2VD3A 1PILA 1KR4A 2ZFHA 4C3KA 4ZK7M 4YB6A 3NCPA 1HWUA 3NCQA 4OZLA 2O67A 3X3UA 2Z0GA 5DS7A 5D4OA 2J9CA 4NYPA 1GNKA 1NAQA 2J9DE 3HLUA 4OZJA 2NUHA 3MHYA 3O5TB 5D4NA 4NYOA 1J2VA 1UL3A 1OSCA 3L7PA 3TA0A 4Y65A 1O5JA 1P1LA 4Y6IA 4R25A 2DCLA 3M05A 1UFLA 4CO2A 2GNKA 2GX8A 2ZOMA 2XZWA 4YB5A 2XG8A 2EG2A 1NH7A 1V6HA 5DRKA 4AFFA 2RD5C 3AHPA 3N5BA 2NUUG 5D4PA 4D3HA 2J9EA 3BZQA 4USHA 4WK1A 2CZ4A 2GW8A 3T9ZA 4RX6A 3O8WA 4WK3A 2PIIA 1UKUA 1O51A 2EG1A 4USJC 4C3MA 4D3GA 1NH8A
chains in the Genus database with same CATH superfamily
5B7WA 2RUGA 1ZS6A 2KHCA 4TYBA 1G2EA 2BRKA 2BBEA 2LVWA 3EDRB 3QBCA 1PYTA 1TUVA 3D6MB 2XZDB 3M2UB 3CCES 1P1TA 3SFGA 2V9WA 1N34F 2HGNA 1FF2A 5ETTA 3N0VA 4QWEA 2V4RA 5DM7Q 1XQIA 2VA3A 2G0IA 2OAUA 5KFIA 2OPRB 4ED2A 4GKKJ 4B02A 1H7XA 1TP7A 1NSPA 2MGZA 2XY5A 2DH8A 4P7VA 3R9LA 3H98A 1MU2B 2CJBA 2HBQB 1XIQA 1NKEA 1HHTP 2CIMA 3EM1A 3FQLA 3DCAA 4KV8A 4O3QA 5E41A 3M9NB 4ZOSA 4QIGA 1WC0A 4J9VA 2HFNA 3LQVA 2A18A 1WC1A 1VRUA 2AP6A 1D09B 4DV1J 1M0SA 1S1WB 2DH7A 2DY9A 2M52A 2QLWA 2BW2A 2WVFA 4HACB 4Q8FA 3D2WA 2FZGB 4USTA 4ECTA 5A8RB 4RW9A 2D74B 4KJIA 3PKMA 1RHRB 4PCQA 4C8NA 3HT3A 1EETA 3HO1A 1RLDA 4EMDA 1DZ5A 1TU0B 2AX1A 2QMXA 3G82B 1T05A 4ILLA 2MKSA 1HQUB 4CLPA 3CNQP 1S1UA 3UVJB 1B99A 2CQ1A 1DTQA 4EO6A 1FX2A 3H5YA 1NK8A 1NLKL 1X4HA 4BDPA 4UY85 4HKQA 3SSRA 2LKZA 2QTWA 3UR3C 3UR0A 1X4DA 1MW7A 1RTIB 4BBYA 5KOXA 3MR2A 2ZD1B 3B78A 3H0PA 3R5BA 2CVEA 1LWEA 2H48B 5H9EJ 3HVRA 3J81Y 3K5NA 1HNZF 4C0BA 4CLUA 1IR0A 2CPEA 2FIUA 1YIJS 1KKHA 4HACA 1ZTWA 1T94A 1F2GA 2RMLA 2R7WA 1ZZNA 3PR4A 2ILZA 2MKCA 1ZZFA 4ZLJA 2DPJA 2CUYA 4TNOA 2FJVA 2P6TA 3OXGA 1RWKB 3T5KA 3CTRA 4LFAF 2G2YA 3RRGA 3V4MA 3T5HA 2BV3A 1WSRA 2HVIA 3JQKA 4IR9A 2R7TA 1AYEA 2FHJA 3MM8A 2YKQA 4ZCKA 3WC0A 5IV3A 5KFMA 3SIPB 1N56A 2GQCA 4DX5A 4WCEQ 2VC0A 4RW8B 4O3RA 1GT8A 3A8JA 3FNNA 1X60A 2HK2A 5IS2A 3OV7A 3BO4A 4LF7F 4YR2A 3OL9A 1FJGF 2IRXA 1KQSR 2DISA 3RB4A 4J9QA 3G8QA 2W4CA 2RT3A 4XPCA 1VQ9S 4U96A 1NJYA 1U1RA 2AJ1A 2NXJA 3KLHA 1IR1A 4M8LA 4OLOA 3JSMB 3CCVS 4X4UA 2UUCF 4ID5B 1OY9A 4G1IA 1S59A 1KQKA 2K7JA 2RQMA 2CZ4A 4CWBA 4DLGA 4O3SA 4RW4A 3TJ9A 2E7XA 2OEJA 5ETOA 3ZC4A 3J80Y 1H0HB 1MG7A 2PIIA 4ZP9A 3IG1A 2LA4A 2LP4A 1N0UA 1UKUA 2Z56B 4HH0A 4K7QA 5EWEA 3J81U 3R2DJ 3KNGA 1E6VB 4YN3B 3OTCA 5GAHU 2W9BA 1FJCA 2CA9A 2HNZB 4C3MA 2VIHA 1C4AA 3BYRA 3FVYA 1MN9A 1EB0A 3L4BC 3I0SA 1HL6A 1SQGA 2XHWA 1TK0A 2R2TA 5A0YA 4NLSA 3DDKA 1OYDA 2IYIA 2GGPA 2Z2LA 2WVEA 3QGGA 3U27A 4X64J 5ETRA 1XMQJ 1HNWJ 1OIAA 5KT5A 1RAFB 3TA1A 1I3OB 2YNFA 1FE0A 4DL5A 3AQPA 3OXFA 3DOMB 4XIUA 3GIKA 2AKWB 2BJ8A 4DS5A 2VOPA 2M0GB 5KOWA 5DO2A 2XMTA 5L46A 2HMIB 1XWLA 3R1HA 1RT3B 1HLWA 3MWBA 4ID5A 5IT4A 5C5JA 4A8QA 1D9DA 4Q0BA 1H3DA 3PRDA 2ZH3A 2J9DA 1FCAA 4J91A 5KFWA 1ZAWA 2CWKA 1UMJA 3G82A 3GSIA 4CIOA 4DFPA 3DOKA 4G65A 5DQGA 2DRDA 2VFSA 3TI0A 2C3YA 4ALZA 1VRTB 2OMLA 2M70A 4O4GB 4EK2A 4C8OA 3HHDA 4IOAQ 5KT6A 2R7VA 2FQQB 2DT9A 3KXDA 2VBWA 4RWWA 5BXIA 4C7QA 2F4VF 1LWEB 3ZNUA 3MOJB 3NGTA 2JJ4D 1WG4A 5HI7A 3FC9A 3C15A 3VHQA 3SEOA 2VICA 5HROA 2E9ZA 3SZ2A 3L9ZA 2DHGA 3AJ1A 1X5SA 3DLEA 3LP0B 2IMOA 4OJHA 4B3MJ 1T11A 1K9MT 1RT2B 2QMUB 4NLUA 2ZOFA 3GYGA 3MEEA 2VQFJ 4C11B 3D66A 2I1RA 2F4FA 3CVKA 3EPIA 2V8VA 2ZEJA 3QT6A 5L9NA 3DOLB 2NXEA 5B09A 3N4WA 1KN6A 2DHHA 1KR4A 3ISNC 3OTBA 2BX6A 4DX6A 5F9LA 4DV2J 4FS2A 2WB1D 4TU8A 4AL5A 1X4BA 3DM2B 1FXRA 3ILOA 4M5JA 1C0TB 2AGOA 4X65J 1JLAB 4RZRA 2QE5A 3OFHA 1U1OA 5IWAF 1AB8A 2A2DA 3G96A 3CF5Q 4IH6A 4OX9F 5K8PA 5LSRA 1UPMB 5FD1A 2VA2A 1ICEB 4NXMF 5F8MA 2JDJA 2R2RA 3ZO7A 3PIOQ 4X2BA 1REGX 2GVZB 2L9DA 2MQOA 5B0DA 4EGLA 3C8YA 3OR1B 3VGTA 4B3SJ 1W26A 1XMBA 2DITA 2L48A 4V19J 1REVA 3GFZA 2KN4A 1S7IA 1X4EA 4DPXA 1Q0NA 2F7VA 2XGQA 4MH8A 3PACA 4EBDA 4TU7A 1UZDA 4FBUA 1WKJA 1YDLA 3EVOA 3GU0A 2MKKA 4X66F 4QW9A 5LMNF 2FHKA 3NOCA 5DDPC 1FWPA 3HVAA 4AQYF 4LQ3A 4OIXA 1UWAA 3PNIA 3TA0A 5CQGA 1Q7YT 3DU5A 1Q86T 1DQ9A 4DR3F 1T7PA 5IT9U 1F5BA 3AY0A 5EHHA 3CJKB 1A6LA 4RUAA 4WF9Q 1VYAA 1FFWB 1VS3A 4ID8A 4X84A 4B3SF 2JEGA 4JYAF 1CJUB 2L3MA 4K5SA 2ZOMA 2FVRA 1SJRA 2F8EX 5IOLA 4MIAA 2ALZA 3BGFA 1S0NA 4MAKA 1JLFB 2DHXA 2CVIA 2Y0SD 3H25A 1WHVA 2EG2A 2XMUA 2ZBQA 4DL3A 1NH7A 3C14B 2KO1A 1OO0B 1MNEA 5LMUF 4ZP7A 3AHPA 3MR7A 3GR0A 2J0QD 2W2OP 3OVBA 5M2PA 2P9CA 4JP8A 4MIWA 3BN4A 2VDIA 1H7WA 4C0HA 1B64A 4JV0A 2F9JA 2RDDA 3CCTA 2C3OA 3D6HB 1OY6A 4CYUA 4ETXA 3CCMS 2F3JA 1N5VA 3BPDA 3NGDA 1H38A 4CH7A 5ETNA 1VBZA 3PZPA 5HP1B 4JI4F 1CJTA 2F65A 3DXSX 4USJC 1RHUB 2OMOA 5D0HA 1PG5B 3ZZZA 1YJTA 4ED8A 2ZE2B 1FRKA 5I4MA 2RDJA 1JMTA 2R2UA 2O66A 5HMWA 2FVSA 1VQLS 4Y00A 1GMVA 4HL9A 2QN6B 1HBUB 5BR8J 4YQWA 5GMDA 1RT1B 2LU1A 1U8SA 2YWHA 3VALA 3V6DB 3NCRA 4NCGA 3HHKA 3PX0A 1TKDA 4I7FB 1HIYA 1M1GA 3C14A 5BYSA 3B8HA 4YB1P 3TUPA 5HMXA 3Q24A 3MMCA 4NLOA 3HDSA 5EGYA 4TYAA 2VPXB 4AUKA 1XMOJ 3TAQA 4B9MA 3TJ8A 4IRDA 2AJ0A 4KY3A 4LF2A 3LW5C 3GMGA 5LJ5Y 2OSRA 2W8LA 2DBBA 1V3RA 3EYZA 5H9FK 3IGNA 3K89A 4ILRA 3DGPA 5T14A 2LECA 1BWEA 1SJQA 2YX1A 2CQPA 2RF2B 3CDAA 1HQEA 1U1PA 4ENOA 1WI6A 3P5BP 4JI5F 4O3NA 2GMJA 5AJ3J 2QZ8A 1JK9B 1RT5A 2OSQA 3US5A 5DQHA 2XI2A 4HHUA 1OY8A 3K59A 1O6XA 4QOTA 4QJVA 3D6TB 1KC8T 5KFRA 4NL5A 2YBVA 1S7HA 3D28A 4LJMA 3CJ2A 3OFGA 5KFOA 1KLMB 4IFYA 2OP5A 2VQEF 2Y1IA 1WC6A 4CQ1A 3T1HF 3B82A 4G3IA 2AGQA 2VD3A 5LXRA 2J0WA 2EK6A 1IM6A 1C1CB 4PYDA 3CC7S 3G2XA 3KUEA 3KMSA 2O1PA 2PT0A 2WAQD 2DGVA 1SUQB 4OI0A 4N47A 2MY7A 4KSEB 1VRQC 3NGSA 1S4FA 3PKYA 4ZITA 1SPBP 2IDLA 2PFFB 2BOPA 1KVIA 4DCOB 1PBUA 2ABYA 5KFCA 5BR8F 4NZ0A 2IPOB 2IYGA 3N01A 2JLEA 3IP0A 3PO5A 1KP6A 3PRVA 3PYFA 3NWRA 3OHAA 4CLWA 5DM6Q 4LF5J 3IWLA 1KLNA 2K06A 3KJQB 3MHYA 3M6UA 1SJ3P 2UVRA 2UUAJ 1LW2B 3FZBA 4ECYA 1WSVA 1NUEA 1T03A 1E6YB 4OHWA 2V68A 3G6YA 1Q16B 5I3QA 4NPOA 2XCAA 3FRZA 3SCIE 1RWVB 1P1LA 3BREA 3VCDA 4JV5F 2OPPA 1UW9A 1N54B 2IA6A 2UXDF 1HNVB 4LVOP 2I38A 3V81A 1IM4A 1TUGB 2RIJA 3P8BB 1HFEL 3M32B 3N5FA 1KSPA 4WZMA 3IC1A 4F36A 3DHXA 4PXBA 4DR3J 1R0AB 2BM0A 2FGOA 4OLPA 2UU9F 3CXCR 2XG8A 2YX7A 4IH5A 1FJGJ 3L95X 2DGSA 4M1KA 4I56A 1T9YA 4PXDA 2MKIA 4Y2MA 2NLWA 2OUGA 1WORA 5JUMA 3V6DA 3CC4S 1IKVB 1PJ7A 2VPYB 3H2LA 4PABA 3VGVA 1Y5LB 2WRMA 2HRYA 3BZQA 3M7VA 2FLNA 1KS2A 2RSQA 4WK1A 3RTVA 1J5EJ 2AEJA 1PGZA 1SVDA 4RX6A 3OT9A 4WPAA 1HI8A 2FPHX 2PDAA 4IFVB 5G0RB 1S5ZA 4OYWA 3UN3A 2DHSA 2UU9J 4LSNB 4K4TA 1NDPA 2WK4A 3Q23A 4DV3F 3EGWB 3KUHA 2D41A 1HNIA 1RT5B 2C2OB 1K47A 1WDTA 1U6FA 1KWMA 2YNHA 3NP5A 5CD4H 2XM3A 3OR2B 5J2QB 4UY8T 1X4GA 1Q8IA 2Y9HA 4M5LA 1AROP 2XSJA 3Q8PB 2HIYA 3GG0A 3QSIA 3HD1A 4IO1A 5J1EA 1C4CA 1RT7B 1CULA 3MM7A 4HT5A 1FKPB 4M5MA 5SZTA 1FRXA 4LIRA 2C2EA 4LF7J 2YKMB 2C2DA 2J7WA 1Q82T 2QV6A 1U09A 5D4LA 3LP2B 5J2PB 2DPIA 4C0OC 3KLIB 4C11A 1VQMS 1FESA 2VH7A 3TVYA 3JQJA 2ZC4A 3DLEB 3TANA 3BDPA 1RTDB 5KFXA 3M8SA 1LK5A 3ITHB 3M30B 2DNYA 2PD1A 1NB2A 1JKHB 4IFVA 3F73A 1R31A 1LWCA 1LW0B 1IBMF 4F04B 2I9SA 1RWWB 3JSBA 1R27B 8RUCA 3GV5B 2MHNA 1B70B 5MAOA 1V9OA 3KMQA 4WKRA 3MEGB 4HLBA 1RT4B 4QYRA 5IFMA 3IWNC 5BYRA 3NAIA 3NLCA 5HSPA 1T0TV 2UXBJ 2HQCA 4L74A 1NHVA 4KHMA 5GMKa 4DU7A 2RAQA 1VJQA 3AH6A 1CJVA 5HVHA 5GAGI 1IBKJ 5H9EK 3H4DA 2HFSA 1FTRA 2BEFA 2IRUA 3MDFA 5LOQA 2J6TA 2OJ3A 3M6XA 2FJBB 2LQJA 2VC1A 2BDPA 1B7FA 1TL3A 2DGUA 3E8OA 1DHMA 5IM0B 2ZZNA 5HMZA 4ZCMA 3R5AA 1HD0A 1SH3A 3RBZA 3V4IB 3A3PB 3LO3A 3P4UB 4JYAJ 2BMBA 2DR5A 4PUOA 1P8GA 3FRYA 2KH9A 1JJHA 2C2ZB 3AXKA 2AYBA 1FDAA 4ECRA 4DX8H 4KGMA 2CDRB 2VF3A 4MJKA 4DFJA 1RZMA 2IA0A 2DD8S 4IR1A 1AXQA 2GMHA 2HWHA 4Q2LA 5D77A 3M2RA 2HLUA 2HVEA 2N7YA 3MEGA 4BLGA 2DK2A 4I6AA 2FLPA 1NHUA 3CJKA 3VAJA 1JLFA 5IV4A 1M5SA 3HLUA 1I94J 1Q8LA 1Q8KA 1WOOA 1YLXA 4DS4A 2JOQA 1Q5YA 3PIPQ 2IBOA 2V67A 1CJKB 3IXQA 1TL7B 2GJIA 3JXOA 1S1WA 4ICLA 2F5GA 2R3VA 3ILJA 5D78A 5JXSA 2BQRA 5F8IA 1TL4A 2ZDPA 1YJRA 3HXMA 4TKTA 3SV3A 3V6JA 1AW0A 5HVGA 2E1MC 1K0VA 5KAKA 5A8RA 3E01B 4NX9A 1JB0C 1OJ4A 3UW1A 2VB6A 2DCLA 2HLTA 4F4XA 3FQKA 2D9PA 1RAGB 4PG6A 4LT6A 2ACYA 2L9WA 2XZWA 2UUTA 4A8XA 2MKJA 2RU3A 3EDQB 3WX4A 1VBYA 2HYIB 3Q8UA 1WELA 4S0MA 2JC1A 3AJDA 3MAAA 4QPXA 3FBEA 4DUZF 4DR4J 2ZH4A 2VG6B 3N6NA 1RP5A 3OTEA 3KDOA 3OQ2A 3HFVA 1CULB 1TVRB 2R7QA 3MURP 2XO7A 1XNRF 2J9EA 3PEJA 4FXWA 3CCUS 3BBFA 1U6ZA 2AU0A 1VHIA 4JI2F 4UQGA 5CYQA 4DQQA 1IWGA 4I64A 1IBLF 3M9MB 2MQNA 3ZTPA 1PCAA 2LMIA 3CO9A 2E7WA 1LEOA 3M2UA 3N6LA 1G6BA 5F3TA 1X5TA 4LR9A 4PKDB 1RT3A 3RR8A 1RISA 3GONA 1UJ4A 4R0JA 4F0KA 3DGVA 1WC4A 1R8CA 1W2BR 4LSLB 1CC7A 2MJNA 4DR2J 2ZWOA 2CNKB 4WIQA 3GG1A 4U7UK 5D0EA 1RACB 2PSZA 3CSKA 3MCOA 3VGSA 2ASDA 4QU6A 5KG0A 2QT7A 3R1LA 4ZP6A 4M63A 1H2TZ 3CE8A 5A8KB 4EEYA 2OTJS 4C8LA 1OQ6A 3MAAB 5HQLA 4F3MA 3GJRB 3HZGA 5E3RA 4YR0A 1VLYA 1SH2A 2AHOB 2VFRA 4RNMA 1Z2LA 3AQOA 2V34A 1U2RA 3I6PA 3IMQJ 3DLJA 4G1PA 1H98A 4IH7A 3J7ZT 2NQPA 3NBPA 2KM8C 3IAM9 2W4DA 3VAHA 1F60B 3S7RA 4F26A 2GVDB 3CMAS 4K4YA 5F8NA 2VV5A 3R3TA 2B9YA 3M8YA 2CNOB 3MTKA 3KK1B 1UEUA 3QMQA 3SDEB 1HHQA 2BKNA 4G1QA 4ANEA 4IFYB 9ATCB 2V5HG 3RBXA 3LH2S 1R6VA 2KHDA 4GKJF 3MD3A 3IFEA 4CO1A 1A7GE 1V3SA 4MKAA 2DGXA 4N7TA 3WIVA 4F4WA 3EE3A 4QR1A 4PG8A 4OJ1A 5KG2A 2RJZA 5GAGU 4KKOB 1EJ7L 2PA3A 1YJ7A 3DLKB 3W2VA 4A4JA 4OI3A 4Q8EA 1BY9A 1NXIA 2ZZMA 1JLAA 1WHXA 3SI8A 2AQ4A 2H1YA 5J2MA 1UVJA 2I8EA 4UOCA 4HTIA 3JB9k 3C2PA 1WEZA 2B9EA 2BRLA 3O44A 1CS4B 1VDHA 4RWXA 1HI0P 1TAUA 1BQXA 5ETLA 1SB6A 4R5PB 2ZM6F 1BQMB 1RYSA 2ZITA 1ELOA 1W2IA 4OQJA 1S6OA 3MM9A 2BOAA 3QT5A 2WW4A 4I1TA 1R7IA 3OTOJ 1KFSA 2HHHJ 3FKBA 4RW6B 1QTMA 1Q8BA 2B4PA 3IBFB 3KLGB 3DRRB 2AW0A 2JX2A 2D3ZA 1BHNA 2Z8QA 4F8RA 3K8VA 2K1RA 3ADAC 3C6TA 4M5DB 2HQGA 1KD1T 1ZM4A 2UXCF 3X3UA 4KR0B 4U7UD 1JX4A 3KK3A 1ZA1B 2J9CA 1YSJA 4LF4F 2KJWA 3PJWA 2XNQA 1X9MA 5CA5A 3D9BA 1FRJA 5KFDA 1OS5A 5J1PA 2Y3YA 4OZJA 1ZM3A 1ZAVA 2CPHA 3TJAA 2RQ4A 1QSSA 4J9LA 1R0AA 1S72S 2IFXA 4PG4A 1N48A 4M95A 1NK5A 2K2PA 4DUZJ 3RG6A 8AT1B 2CZ9A 2MLZA 1SV5A 2ZBPA 4P52A 2XGPA 3D0IE 5EWGA 2ACMA 3JAMU 4DQSA 1N0VC 2VPWB 4AL6A 3AD8C 3ENVA 3MPDA 1NEEA 3NEKA 3JS9A 4IG3A 2CNNB 4Y28C 4J7CA 5CZXA 4OI1A 3I4HX 2VPZB 1Q4RA 5B0GA 2HWIA 1OPIA 3EICA 4K8RA 4FP9A 3X1LB 2JWNA 1TL1B 5C42B 2RQCA 1TELA 4KGXB 1AUDA 2HFUA 1LOUA 1JLQA 3VGUA 4QYZK 2KFNA 1DFDA 3UNGC 1FVQA 3GZ7A 2ZVIA 1LV5A 1FRMA 2HNDA 2R7OA 4FXVA 1NHKL 4RUHA 1HQUA 1FKPA 2LYVA 6FDRA 2NUUG 1RWUA 1J5OB 3R7NB 1W25A 4ZS6A 4ED5A 4NLYA 1X8DA 3CW2C 4USHA 1NDCA 2WONB 5KG1A 4CTAB 4E8UA 1FKOB 3KKFA 4N8OA 4R8UB 2U2FA 3MR5A 4BS2A 2VKZG 4PXCA 3PVXA 2V4JA 1RTDA 4A8YA 2B8PA 3KJFB 5DG8A 1GXUA 5LXYA 3SQGA 1NH8A 2A2CA 1WEYA 4ZDNA 1HNXF 3DLHA 2PI4A 5GADU 2PE8A 2YTCA 3D3BJ 5E3CA 3PYEA 4NI2A 4DSKA 4K5RA 4B3TF 2DNRA 1HBMA 4PQAA 3D1HA 4J9NA 1FNOA 4DV4J 1R43A 1MSWD 3W60A 2KDOA 2YWWA 3MM5B 2D7SA 2C42A 5B0BA 2IJNA 2K8GA 3QLHA 1YK9A 2QLBB 2HAIA 2LLZA 3CO0P 2ZJRQ 4WJBA 2Y1LB 1R3NA 2IHR1 4QWCA 4DV7J 2D1CA 2DNPA 4ECSA 3ENAA 1OYEA 1BQMA 3J7YU 2ZM6J 5AJ3F 3ZNJ1 3AAWB 3T6JA 2BJ9A 3PY8A 3PFEA 5EX0A 1RAIB 5L8RC 4NA3A 3MGJA 2V94A 1RT2A 3HHLA 4KIAA 1O0PA 2CQGA 3BV8A 4PWWA 4DV2F 1XK8A 3KLHB 2LFVA 2LQ8A 1J27A 1WJ9A 2VG7A 2VJUA 4YDXA 1XC9A 3G4SS 2L08A 4ER8A 3C6TB 4J9SA 2KG1A 4LF8J 4F2RA 4X4VA 1EP4A 4ZPWR 3QRPA 4OHZA 2EK1A 4X4OA 2HG4A 1N4LA 3G8SA 5KFGA 4DL0C 2XS2A 3TA2A 1FX4A 4JI1F 3M2RB 2V8PA 1YX2A 3OUYA 2H5IB 3R5DA 4KQZA 2M2BA 3D0GE 3GV8B 5D6GA 4DU8A 3P6YC 2LDYA 4NCGB 1RCXB 3H4BA 4J9KA 5J2QA 4Y0FA 4LFCJ 4YY3J 3H7HB 2COLA 2EWHA 2G0CA 1KNZA 4MT1A 1M5OC 5DG7A 4TN2A 3OTDA 1TL1A 2W4PA 3DNCA 1JIHA 3J80U 2YNFB 2IMWP 4GO7X 4C97A 4QBUA 4ZJQA 2BR0A 4ZVHA 2LEPA 2HNDB 5IQ6A 1GNKA 2UUWA 2RNEA 5HJYA 2VOOA 2U1AA 4ZJLA 2RDIA 1HQEB 5KT3A 4RU2A 2AYEA 2QMWA 2B9XA 4KBIA 3V5RA 1X5OA 5KFEA 3DOKB 2XY6A 1T9VA 2YNGA 2IBKA 2A10A 1FTCA 2E1AA 2GHPA 3KFWX 1UWBB 3MM6A 4LRFA 2DGWA 1KTQA 2V0NA 1IBLJ 1N5TA 5CAAA 1LNQA 5I3UB 2V2KA 1L3SA 2CPDA 2V9KA 3ZTSA 1RCOB 1OSCA 1WOSA 2BE9B 5CYQB 2WONA 3MEEB 3KHLA 3TQ1A 1RTZA 3HMJG 2H5EA 3RR7A 2QC3A 3K7RA 1SJFA 1WHWA 1DTTA 5I3PA 3JYTA 3T3FA 3DOLA 2DHAA 5EUHA 3BO3A 3MMBB 2IM3A 4NI2B 3UWTA 2HWTA 3BGRB 3E3XA 1NM2A 1BD6A 3PW0A 1SL2A 1EARA 3QIPA 3GCXP 3M9OB 1LFPA 3C46A 2PMZD 3UVJA 9RUBA 1KQGB 2XTJP 3Q83A 2ASLA 2CAJA 1IQTA 5HAOA 3PW4A 1U49A 4X4NA 1RAAB 3OVAA 2FZCB 3Q8YA 3UDEA 3D68A 2C2MB 3ENQA 5AXKA 4U6PA 1TR0A 2CPIA 2Q6BA 5ETSA 5I3UA 1S6UA 1VLOA 4H4KA 3QGHA 6FD1A 1KEKA 3L3CA 3VAGA 1PAUB 2HIQA 4QPTA 1ZPWX 4KHRA 3PCOB 3WIUA 3KDNA 2ZDOA 4I2PB 4KH1B 4LR7A 1WTFA 3RJMB 5F8GA 5T7LB 1SC1B 1X4CA 3A12A 1EX8A 2FJXA 1N5SA 4EWTA 4RW7A 3PO4A 1XBWA 1JLBB 1LWCB 3N28A 5K5MA 3QGPA 2RRNA 2XMKA 3QJPA 5AXLA 2VG7B 4B9TA 3P5TL 1IKXB 3ZZRA 5ETVA 1M1KT 1BQNB 3ZZOA 5K8NA 2VQFF 4DHVA 2B8QA 3C6UB 3H90A 2CPJA 4DG1A 2ZUAA 4B3MF 2M9KA 1U7LA 2LQ5A 4NLVA 3IN5A 5L1JA 3UCZP 3A8EA 4DUYJ 2KFYA 3BGUA 5CH7B 4E98A 2QEXS 2HHTA 1QTNB 1PJ6A 2QYCA 1XN9A 3K2YA 3TR5A 4V19X 2MPUA 4ERDA 2D3UA 2GQQA 3HVWA 4HHJA 4CLTA 4JI6F 2YPYA 2MY8A 1ROFA 4YR3A 4ZVRB 4CO3A 1RTHB 2EBGA 2XWXA 1N32F 3JSMA 5K20B 4FVMA 2XI3A 1HYSB 2HVHA 3MEDB 4WYLA 4DZ6A 5KFKA 1HR0J 2XS7A 4EBCA 4NZ7A 4DR1J 4X4QA 2KRBA 2N4CA 2BM1A 4GC7A 1UVMA 3GJTB 3QJLA 1SUQA 2LQ9A 1IQZA 1DTQB 1HQ2A 1R8PA 2CQ3A 1R8AA 4OZ2A 3GV7B 3A4TA 2E66A 2L41A 4E0DA 2BANB 2X1GA 2HURA 2IDEA 3OL8A 3T5LA 4HI2A 3EZUA 2KFZA 3CMES 1UFWA 4Y3CA 3O2IA 4JI1J 2GGPB 2EFNA 3TZWA 4DZDA 5L9XA 3NS7B 1IVZA 4PZVA 3RB3A 4WZQA 3M6WA 1QSYA 4A8MP 4JI7F 1WNEA 2QL9B 3OW2R 1WUUA 2PGCA 3FFIA 3JQMA 2B5JB 2CJ9A 2AZ3A 1IBCB 2W01A 2XMWA 3R5GA 1IKWA 4JBCA 1UAWA 5GVQA 3TUIC 2Q43A 3WHIA 2UP1A 2GIQA 3BSOA 2VONA 1KOHA 1NAQA 1NPKA 2BE2A 2C3PA 2A6OA 4ZCIA 1JLQB 2R8IA 1D8ZA 1P9QC 2QA4G 2DGTA 2ZOGA 5CZVA 4P71A 4C8KA 3LALA 3PEHA 4ZVGA 4LRBA 4ZVPB 3HHEA 1NZ8A 1YGYA 4P75A 3D4JA 1RLCL 5BJRA 4AL7A 2C22A 4OHYA 5ETKA 5HN0A 3T5JA 1U1QA 1XNQF 2DO0A 3ISZA 3ILLA 2DGQA 2E5IA 4F3OA 4ILMA 2AJ4A 1RBOB 2VG6A 2UVUA 4B3RJ 4B3OB 1S9GA 1Y5IB 2CPYA 3OVSA 3PX6A 1X0FA 1O5JA 2JC0A 3HPOA 4M94A 3BB5A 2RS2A 3CJQA 4R25A 3S01A 4W92B 3LP0A 2VJVA 1SKRA 2DNGA 1YRUA 2KJVA 4HEA9 2ILYA 2DH9A 2HRUA 4B3TJ 2LEAA 2HHSA 4XPEA 1FDDA 4USUA 1FJEB 1S0VA 1HBOA 1ZOTA 2K7KA 3BPSP 1BMQB 3K8WA 3A3OB 4MK8A 1BQNA 4OJGA 5T7LA 3BR9A 4TQSA 4UZCA 2G9OA 3DRSA 4A8WA 2NCKL 3W8PA 1TKTB 3RBEA 4GKJJ 3M8WA 3ZFVA 4D3HA 4ED3A 3HHLC 4U9RA 1SQFA 4JV2A 4I2QB 5CXTA 4JV5J 4A48A 1F9HA 2VBZA 4Y2IA 1ZBTA 4YHHJ 4WE1B 2V8GA 3TZYA 2IJFA 4P72A 1NDKA 1ZPVA 2IRYA 2QLFB 3PYGA 4USWA 5LSOA 2XQCA 4B17A 4F0MA 4A8SA 4ECQA 2XNRA 2Y1RI 2FY8A 1VOMA 4FF2A 5D3GA 4DX7A 3SSQA 1FE4A 3I5BA 5CYMB 1RDRA 3UFCX 2XWYA 4KAIA 4PWDB 4JI6J 2CJXB 1Y10A 2JH3A 5A6WA 3NBPB 1S1XA 5MLCV 4QYZJ 3K5LA 5D8HB 3NS5A 4D3GA 4EUVA 1QE1B 3HVTB 1HW8A 3MMAA 3HHLB 2GVZA 1EIYB 1VBKA 2GFFA 5AE2A 4P2MA 5DDOC 2GO8A 1VIXA 4G1QB 4YHHF 3AA9A 4DOZA 3FMWA 4BWJA 1AFJA 3GP9A 5DETA 1IJEB 4EBEA 2V63A 4YB7A 2O3DA 2M8DB 2YKPA 2CNLB 3QIDA 2DJWA 4KO0B 4L72B 3SXLA 4DEZA 5B08A 3FEYB 4WTYA 2IAJB 3WQPA 1VRTA 2KXHA 2YPZA 4TVAB 1IJFB 2ADBA 5FDLB 1RA6A 4ZP8A 1IKVA 3D1OA 5HQMA 4K4SA 3W5ZA 1CS4A 7FDRA 3J7A1 2B43A 4KRWA 3QWUA 3LWLA 3WBZA 1S10A 1N6QB 1KVKA 3GFXA 2D3OR 2OLWA 2BE2B 3AB2B 1F5CA 1LXNA 2NSBA 3GYNA 4P74A 2MYFA 1YRTA 1U0HA 3ZXWA 1GX6A 4PYAA 4YFUA 4CNZA 3I56S 1HNXJ 2FHMA 1IXKA 2DKOB 1L3UA 1KFDA 5G0RA 5KFUA 3IR6B 3B54A 2Q3PA 1UJ5A 1NPPA 3LANA 3LF0A 3OR2A 3DM2A 1S79A 5KTQA 1TKXA 2PFDA 4IYQA 5F9NA 3OHBA 2V6AA 1TK5A 2HHHF 4BC7A 1HD1A 3NGKA 2Q1LA 5IQQA 4LF9F 2FVPA 4I6WA 2E9RX 1G4CA 4DR6J 2HHVA 2NPFA 1TKZA 2XSJB 7AT1B 3QAEA 3TAPA 1JNZB 3LP2A 4B3OA 3NXZA 1BXNA 1OPZA 4OZ5A 4ZVQB 2V69A 2ZE2A 3NCPA 3WX8A 2W8KA 3M4XA 1X9SA 1RT1A 3NL0A 3W65A 3G87A 2ROEA 3BDEA 2J9DE 4OX8A 4X62J 2WOMB 2W2MP 3U1NA 5L38A 3CB4A 2J76E 1FT8A 3BQ1A 3M2VB 3J7Z5 2JVRA 3AOAA 3DGPB 3KLFB 4QU7A 2I2YA 2FVQA 4P6QA 3IO1A 3T1YF 4JOUA 4NYOA 4OV1A 3TRGA 3OTOF 1UJ6A 1W7WA 3LPEA 4X64F 3TAMB 4TU9A 1JLGA 4NLXA 2BKOA 3QRRA 4KH0B 4X66J 4FXDA 2Y1JA 1S0MA 2OI2A 2JNJA 3EPGA 1PKUA 2GHWA 1QAJA 3NOGA 1TL3B 4MTPA 3UN2A 2ALYB 1RGVA 3BM7A 3CD7A 4UUWA 5HROB 4RBUA 3T41A 1T3OA 5KFVA 3I55S 4K4XA 1KLMA 2H5JB 2OPQA 3TX8A 5C24B 2R9LA 2EC0A 3RW7A 1N52B 3GIRA 2YH1A 2HHUA 2DNHA 2CZVC 4WFNQ 4HDGA 1FK9A 2E5GA 5BYQA 1ITPA 3SQOP 4F25A 1OSDA 1VK3A 2C3UA 3EZOA 1YKWA 2MQMA 3PW2A 1RHKB 2NSCA 1HKAA 2IM1A 4FYVB 5E3QA 4OYBA 4YMEA 4K4UA 4CH0S 1SC6A 1HWKA 2F8HA 2AT1B 1O51A 4ICLB 1EHWA 2KT5A 4CI0B 4ES3A 4JI4J 1YBAA 2G1HA 2MKYA 5F41A 2QIFA 1DY3A 3PHTA 5A0YB 1VC5A 1NK9A 1M5PC 1D9FA 1MWQA 1MN7A 5CCMA 4C8ZA 3DDIA 4LRDA 1SC4B 1NDLA 1YTYA 3VTIA 5E0OA 4Y2CA 3GLJA 3MEDA 2LXUA 4MKVA 1K44A 5D15A 2G4BA 1RTHA 2UXDJ 2Q79A 1KDNA 3E01A 3U1LA 4DQPA 4H4MB 2CRLA 1WC3A 3AXMA 3O6QA 5J2NB 1HHSA 5C42A 2J0SD 1YQHA 4ZMMA 2QGFB 2J6SA 2CQ2A 1GFWB 1X4FA 2L9NA 2E5HA 4K0KF 2MZSA 2OH2A 3LGHA 5DZ7A 2OPPB 2JLGA 4V1Ak 1NSQA 1F6TA 5IC4B 5LJ3Y 1WHYA 5AT1B 2WVDA 3Q8QB 3MAQA 3WDOA 3QQCD 3UE2A 3W5YA 4J9RA 2MXYA 4WFAQ 4F4ZA 1IKWB 1UETA 4IG0A 4C3LA 4DI6A 2XMAA 2ZHOA 1RQ0A 4OYOA 3GIIA 4NLRA 3ETMA 4XTTA 3G8TA 2B7BB 2Y8YA 2WOMA 4PXEA 4ES1A 2FYXA 4ZN3A 2BYCA 4QR0A 5ETMA 4B9LA 1RWMB 1HNIB 2MQ8A 4YY3F 1FRHA 3FCWA 4BHQA 4F2SA 2HNYA 1S76D 2EEYA 2HS4A 5GMEA 3PDNA 4PEOA 1Y11A 3HSDA 4QR2A 3W61A 1R0BG 5E3PA 5DLGA 3KLEA 1BE4A 4DV1F 4EYIB 1ZH5A 2F4VJ 1VQ8S 5KG4A 4C2MA 1S1UB 4RO0A 1N36F 2ZD1A 3AOBA 5HVFA 2ATCB 3IRXB 5ETQA 1HA1A 1YJVA 2KTQA 1RT7A 3MM7B 2MZRA 1MROB 4NYPA 3I31A 4PWUA 5KFNA 3THTA 2RE1A 1WF2A 5AXNA 2ZH9A 4LMZA 3ISND 4GRSA 4QWBA 1D1UA 3T9NA 2UUAF 4KYZA 1X4AA 3HZEA 3D1QA 4PG5A 2HHWA 5F0WA 4PR6A 2HVDA 1JKHA 1JQGA 2DTJA 2HSEB 3CCJS 2R7UA 3PYDA 4NLGA 1RI7A 4O23A 1B3TA 4KB7A 4XDDA 1SCJB 2B51A 1HW9A 2V2VA 4H54A 5HK4A 2YWKA 3S1TA 4DL7A 3Q89A 3ET6A 3VAIA 4DR5F 4DV7F 3NWGA 4MYTA 4BWMA 2ASYA 1LW0A 3GQCA 3T1YJ 4EO8A 5IWAJ 1YJUA 3GB0A 4I2QA 1A0OB 3F56A 4B9SA 2ZWPA 2MZJA 3M8QB 3QO9B 4CLZA 5IT0A 1CEZA 4TLQA 5B0FA 1QAXA 1Z4UA 5E3AA 2X1FA 2G2OA 3UN5A 5ADZA 3MF5A 3NNAA 2APOA 2GJ2A 3CCWA 3GCWP 3MMAB 2HKEA 4ECVA 1FVSA 3VWSA 4TQRA 3V4IA 3C16A 4FKYA 1Y5NB 1C2PA 5EN1A 2V4JB 3FBBA 4RW7B 4WWSA 4DR4F 3BSCA 3DRRA 2XMJA 4M5GA 2FHJD 5G4DA 2CG4A 4ZJOA 2W2NP 4NXNJ 2QL5B 2IAJA 2BA9A 4NLTA 4H4MA 3T9ZA 1VMBA 3TVZA 5LMNJ 4DQRA 2VUGA 1Y0HA 4UF4A 4WK3A 1FD2A 2POKA 4Z7YA 3RZAA 2BJEA 4DSLA 2XO6A 2JEIA 4A46A 1AZSB 4PQUB 1SJ1A 2LCWA 2EKYA 3POTA 1B7YB 3H20A 1WG1A 2ZNZA 1JLEB 2ADCA 3BKUA 1FWLA 1RWNB 3SMZA 3HSZA 3T6BA 1F0XA 3CCRS 3RUBL 4M5KA 3CDEA 1GAOA 2CQBA 2QJ3A 4XK8C 3DU6A 3E2EA 1KVJA 1XMOF 1A9NB 1U0HB 2AJQA 1UZHA 2WBRA 2XC9A 1LWXA 3N6MA 2XMMA 1H2VZ 1SH0A 2VBYA 4KGKA 2CPFA 4IG3B 2XBPA 2YKAA 3MUVP 4LF1A 3DLLQ 3BGRA 3VV2B 2WTFA 4ZVOB 1YVFA 2RRAA 4J5OA 2XS5A 1VFJA 3DXBA 2HS0A 3K57A 5DG9A 4L3NA 1J5OA 1PC4A 3EGZA 2H4YB 4Q0BB 2YKNA 3EX7B 3TO8A 2JEJA 4ELVA 4GKKF 5U47A 1TKXB 2NPIA 1RBLA 3Q8VA 4WFZA 3RRKA 4BC9A 4RUBA 2PC6A 3MR3A 3CCSS 4URGA 4O4GA 3QSYB 5C2CA 2I0XA 1S9FA 1RHQB 4P9SA 5IC6B 2QRRA 4R8UA 2GIFA 3HT0A 3LAMA 4CLYA 2XEXA 3DFEA 2F8MA 1KBRA 3LGMA 4LQ9A 4JI0F 1Q1KA 2G0JA 4JI8F 2W7AA 2D69A 5B0AA 1KRPA 3R5CA 1C1CA 1WKKA 2OGUA 4NE9C 2MZQA 4TXSA 2Y8WA 2OFHX 3BKTA 4DR5J 1QJHA 3CDBA 2ZFHA 3QT7A 4YB6A 3M2VA 4J90A 3WC2A 3HHNB 2OEKA 3QLHB 1WF1A 3S6EA 4P7TA 3BKFA 2FC9A 2QX0A 5F8LA 2WSEC 2G13A 2QYGA 2LQBA 3JSRA 4OFZA 4KT0C 1UA1A 4DCJB 2CJAA 1I6JA 3NCQA 4FZVA 2ZJQQ 3QO9A 1FFGB 4OZ3A 2M8HA 2GV1A 1N5QA 3CDWA 2AYMA 2MZTA 3QFWA 4RNNA 3DLBA 2KVIA 1XNQJ 5A2QU 1ULRA 4TLRA 4NLWA 4WXOA 3HSGA 1URRA 3H59A 3W8GA 2FJDB 2Q6CA 3MECB 3MFHA 1NJWA 1DRZA 5HMYA 1LFWA 2QSFA 4RJVA 3OJUA 5IXUA 1U1LA 4NLPA 3JYTB 1DLOA 1GQEA 3LTOA 4BCAA 4ZCLA 4IO9Q 3UDCA 4FF4A 1RB0A 1Y7PA 3FCHA 4I7FA 3UPFA 5KFQA 2NXUA 2ZZTA 2CJQA 3I4PA 3PM9A 4RNOA 4OX9J 3AOCA 3L7PA 2YWGA 2SXLA 2CQ4A 1K1SA 2HZAA 4AXIA 4YDDB 1MLAA 1FDBA 2R7RA 2VG5B 1EP4B 1JLCB 2D9OA 2DR8A 3DRPA 1U26A 2AIRB 2IM2A 3ZZUA 1YITS 1U1MA 3MM8B 3NS6A 4NEYA 2HHQA 3MD1A 5A6PA 3QRQA 2X51A 3CD6S 4ZPDA 1R6YA 1DQ8A 2PMWA 2EFPA 2EFGA 3M1VA 3LAKA 4J9MA 4OX6A 1O8BA 2HZCA 1S1XB 1LKZA 2C1EB 2P9GA 4NA1A 1S49A 2O01C 2KVQE 3FMBA 4O44B 3H5SA 3N5BA 4KHPJ 2B6AA 2B5JA 1VQ4S 3W9HA 5KFZA 1V5IB 4G6VB 3MUMP 2A6MA 4W98A 4CYUB 1YI2S 3DMJA 1U2FA 1YZ7A 4X4TA 4CRJA 5GAHI 4GC6A 2DYAA 5J2NA 2DO4A 4QIWD 3NGUA 3O8WA 4P2XA 4AYBD 5KFBA 4JI2J 2H4WB 1VIOA 1U1KA 1CBKA 2H65B 3GTYX 2J7UA 3KYLA 3IG1B 4O3OA 4CZCA 2ZNYA 2PI5A 2K1RB 3HKWA 4M5DA 3EVMA 4N5SA 2MJUA 2AYGA 4OL8A 2CKWA 3PTWA 3I0RB 1F1BB 4ELTA 3RU0A 1BLUA 4Z37A 1P6TA 5HJXA 3I87A 5KT7A 2P8IA 3O3LA 4CO5A 3ZZ0A 1HBUA 5K14B 5FLXY 3JSYA 2B4OA 3DC2A 1RA7A 2RKIA 4QW8A 3D6FB 4ELUA 3QFHA 2DIVA 2HVZA 2JL9A 2NS1B 4CH1A 4DV0F 2AGPA 2HQFA 2H9ZA 2WVCA 2DRBA 1HNWF 4AQYJ 1L5UA 3KJVB 3MCSA 4E2FB 2N82B 1S1VB 2ZH6A 4ZLNA 1C0UB 4B9NA 3UDLA 1UW4A 3R6LB 2KI2A 1TKTA 3ONQA 3TP2A 4OYZA 2M5YA 4KKOA 4KPYA 4IQMA 3UNYA 1EAYC 3CD0A 5HANA 3KHHA 1NSAA 2YNIB 3CWJA 3TW0A 4B08A 4DDFA 1NMEB 5D0RA 1T9WA 1TAQA 1FRIA 4QQBA 5J2MB 3R2CJ 3SFUA 4EFAC 3RGIA 1NJZA 1NK6A 1RUSA 3H2VE 2XSFA 3ZTQA 5ETPA 5DGBA 1HMVB 1M5HA 5I42B 2UVWA 3Q86A 4DN0A 3IS9B 4YS2A 2BJ7A 3ZZYA 4NCBA 3HJFA 1WKLA 3VR1A 4ZN1A 4DF8A 2RRBA 4IKAA 4QIVA 4ECXA 1RSCA 2AMCB 2PEHA 1RWXB 1CVJA 1YG0A 3AT1B 4DN9A 1WDDA 2FUG9 4OYMA 1RAJA 4WFYA 3D0HE 3PJXA 1T05B 2CWXA 4B9UA 3G71S 3KJVA 1WD6A 4FPRA 4RW4B 5EWFA 5KFLA 3EJMA 2WSFC 3ENWA 4FN5A 4K2JA 4UT4A 5M2RA 1GXLA 4LSLA 2BVZA 3EMTA 2OEMA 3W1YC 1SKSA 3RAXA 4FDFA 2QL7B 4KC5A 4OZLA 3KLVA 3BSNA 2O67A 2QFIA 2EFOA 3MPYA 2QSWA 3GFHA 2O5DA 3PXGa 1ZAXA 2WZ1A 4LR8A 1HBNA 2BKPA 1GMWD 3CJRA 2NUHA 2GQ2A 3Q22A 1RTJA 2W2PP 3LP1B 1B0PA 2GVDA 2B6AB 1LW2A 2NREA 5B0EA 1VJWA 3C66A 3P96A 1RXOB 2BXJA 3G6VA 2HMIA 3FUYA 2QFJA 4L73A 3MPVA 5LMUJ 1ZYQA 1VK8A 2HEKA 2RVJA 1IBMJ 1H74A 2B56A 4ZVSB 3UCUP 3UD3P 3RW6A 4W4MA 4O4RA 3M6VA 4CO2A 1B4SA 1HNVA 2B3TB 1U2CA 3HX9A 5H1SV 3V81B 4YB5A 4K0KJ 4N41A 1VC6A 3BQ2A 1P27B 1IR2A 2RKIB 1HPZA 4I0WA 1WC5A 2R7SA 1NRKA 2EW9A 4F4AA 4Q45A 2FB0A 1UVKA 3CULA 1RK8A 2MSSA 1FI4A 2E1CA 1XERA 3I9ZA 1VRUB 3QZ8A 3OUYB 2HZVA 4CCHA 4IRKA 5F8JA 1UEVA 2B0GA 1VQPS 1ZA2B 4R5PA 2PA8D 4F0HA 2DNQA 2CQIA 2GW8A 2KT3A 2AEFA 2YQ1A 3I5CA 2C2NA 3KWMA 4I4BA 4HR2A 4MYUA 3TYTA 1QDUB 2C3MA 3MCNA 5D0GA 1VQOS 2MB0B 1F2HA 2KZZA 2KT2A 2DEJA 4L76A 4C98A 1YBUA 1YRXA 3A8KA 2B9WA 4J37A 2HFOA 5LM7E 4Z2XA 3H40A 3U1MA 1HBMB 1OMSA 1T9XA 3MEKA 2X1BA 3UDVA 2DXEA 2BACA 1VR6A 5T41A 2VFVA 4LF8F 1XMQF 5F0UA 1NNDA 2YNHB 2XCPA 3HM9A 2YKMA 3QT8A 5RUBA 1RTIA 4WXWA 4O0NA 4OJ3A 5LT5A 2ZH5A 3CPWR 1TUWA 3DYAA 4HDHA 1V3ZA 3J7YI 3HD2A 2CQHA 2DNLA 3IBCB 5J1EB 3JTPA 1IKYA 1X0PA 4WBFA 3K5MA 3HSJA 2KB2A 2OKQA 2MGZB 5EDWA 2KG0A 1FEHA 2V4QA 4KTQA 4LFCF 3DRXA 3I96A 1NO8A 1Q78A 4C48A 5KT4A 3D3CJ 4GVLA 2JRSA 2BJ1A 3IBWA 3CGIA 2KRRA 2DY1A 3HFZB 3NMRA 4AE5A 2YWFA 4RLEA 3SCJE 4U67Q 1S9EA 3BH6B 4J9PA 1L3VA 4NCAA 3PG9A 1VHFA 1FJ7A 2E29A 1S0OA 1N33J 1H6KX 2CYYA 1Y4ZB 2EXUA 4NA2A 3OL7A 3LUYA 4URSA 4RW8A 5E2QA 3R97A 3HK2A 3HCXA 3DRYA 5IZHA 4YEAA 3D54A 5CYMA 1KHVA 1QAYA 1RT4A 3Q2SC 4CLLA 1N32J 4ED6A 4USIA 4XO0A 4FKXA 4NEZA 1RABB 4RBTA 1GX5A 3BR8A 1KQFB 4DSJA 2ZBIA 3RAMA 2W9CB 3C3LA 3G9CA 1C1BB 1UP1A 4JI3J 4DV5F 3BGOP 4DR7J 1QSLA 3I9V9 4DUTA 3BJYA 3W9IA 4USKA 1XR5A 3AA8A 3MM9B 3PHEA 1XTZA 1DLOB 1FXLA 1M5VC 3G86A 2V2QA 5DZ6A 4O0IA 1SJ4P 3VAMA 3KLGA 1ACMB 2KXFA 2MEWA 4RKUC 6AT1B 4WP8A 3EZ5A 2YQ3A 3HULA 3GIMA 2LEBA 1URNA 2NXNA 3PW5A 3H5UA 1T3NA 2QO3A 5E33A 2ZHBA 1G7CB 1TV6B 2LXIA 2DR9A 1QD1A 1HWUA 4FBTA 2KKHA 3DRPB 2RH3A 3DLGB 4FVCA 1U45A 2UUBF 1KTVA 2VZ9A 4LF6J 3VAKA 3NY0A 3CIMA 1G3OA 2CG8A 2GZOA 3R6GB 1TMMA 5E5NA 1UTAA 1EQ0A 3BSAA 3W63A 1QVFR 2N3LA 2NYIA 1YJWS 3M8PA 3J81j 5GAEI 4PPDA 4MIBA 3TEHB 2XMVA 3H5XA 2AF6A 2MZ1A 4DLEA 5DDQC 1QVGR 1DTTB 2QA4S 2J7KA 2M88A 2K3IA 1CJKA 2ZVSA 4WP3A 4WKYA 1PYOB 1CQMA 2E7VA 4YUDA 2XYPB 1OQ3A 4H4OA 1NK4A 2YXLA 2HHPA 5C24A 3TWZA 3DOMA 5HBMA 3ZTRA 1N8RT 1XEZA 2ZUGA 1H2UX 4ZPBA 2DGOA 4RPFA 1WEXA 2PN6A 3G6XA 5CABA 1K73T 4N8NA 1TFWA 1DARA 2PEBA 2FJAB 2ROPA 3FK4A 4Y2KA 2OPRA 3CUNA 4C8MA 5JMNA 3IM8A 3N79A 2G2ZA 4NXMJ 5K8OA 3TUZC 3GILA 4KV8B 3LWMA 4GMKA 4IUFA 3ULHA 4I68A 3POTB 3R7BB 1J5EF 1CJUA 4JI3F 4FF3A 4DR7F 2VFUA 3W3SA 3GYXB 5K9FA 2K3KA 3NNCA 4OHVA 3BEGB 5F3ZA 2ZH7A 1YBTA 4NASA 1QAIA 1PSDA 1R8HA 2MKHA 3CD5A 4I2PA 3SCLE 4AT1B 1S9EB 2VKRA 5B0CA 5HO4A 4ECUA 2F9DA 3EXYA 1C0UA 3QPIA 1VBXA 3KOAA 2E44A 1RYRA 3CJ8A 2DVIA 1EKSA 4ZVTB 3RRHA 1QLNA 4R0EA 4WTOB 3KK2A 4HT7A 2DXDA 2UUBJ 4LF6F 2B7CB 1HARA 1EKRA 4FYYB 1T9UA 3K58A 4WP9A 2HBZB 2CQCA 1OWXA 4JV1A 1CJTB 1U02A 2RHSB 1CG2A 1NKCA 2FTRA 2OD4A 5L39A 4LRAA 2DR6A 1S97A 1IBKF 4X4SA 1PIEA 2R8JA 2VODA 4HYKA 2QG9B 3HFKA 1VQ7S 2EC2A 4F02A 4WU2A 3QATA 1VGYA 2W9CA 1UVIA 4CP5A 2LDIA 5LSLA 3GR1A 4ES2A 2YQ0A 4LF9J 4ZVEA 4PG7A 1NSKL 4ETZA 2P6SA 2Z58B 2XLIA 4DUYF 4DR2F 5A2QY 3ICLA 3THVA 4ANCA 3MFIA 3VZHA 4W90B 2GO9A 5CD4A 2CQDA 2FDNA 1ZM2A 4LBIA 3L7UA 2H51B 1FDNA 2CJKA 5EX3A 4UTGA 4ECZA 2VU5A 4K59A 4P2SA 4RNHA 4J9OA 2FLOA 3GWCA 1S1TB 5THWA 1SQEA 4CO0A 1GMWA 4QWDA 2IC3B 2ROGA 2XLKA 3LGNA 3M8PB 4NWBA 2HFVA 2XULA 4USMA 4WIIA 5FLXU 4ZHRA 1Q53A 1WWHA 4DFKA 3CJ0A 2FJWA 1U6BA 1XNRJ 4NLQA 2YWEA 1AA1B 1TL5A 1JLEA 2GAHC 1TMJA 1JWWA 4DPTA 2KM8B 1I94F 2M3DA 4CT9A 2UV8G 3A13A 2HGLA 3IR5B 3LP1A 4FS1A 3IWXA 3FCVA 5D3GB 2RQKA 2CQ0A 2IVYA 1SI9A 4KGVB 3THPA 1NBEB 1VISA 3CJ5A 3TARA 1T9TA 5KFSA 3UCGA 2QA1A 1QE1A 3HVTA 2AX0A 2RHQB 3KK3B 2BUNA 4DR6F 3FSXA 3D67A 3CT9A 3TVKA 2P9EA 1D8YA 1XR6A 1Q5VA 2YH0A 2ZJPQ 3K17A 3QZ7A 4F50A 2DIUA 4TY8B 1PJ5A 2E9TA 1FO1A 3ELHA 5DQIA 4FYXB 2MQLA 1UCNA 5KT2A 3VQTA 1RKJA 3MOZA 3SBMA 4EU0A 2MMYA 5L1IA 3UO0A 3RAQA 5FIIA 3M8QA 2HBRB 2C28A 4WFBQ 1XR7A 4X4PA 1FA0A 1WOPA 1N6QA 2QLXA 1U24A 2HGMA 1FXDA 2HW3A 2HBYB 3RB6A 3BBBA 2CJYB 1CC8A 1JXLA 2GMLA 1FERA 2R8GA 1TK8A 4DV6J 3NMAA 2V8DA 3M05A 5DDRC 5KG6A 1HWJA 1MWYA 3ITHA 3VVTA 3IM9A 4DCPB 3Q2TC 3T19A 3MMBA 2HNYB 1UFLA 3DRSB 2BQUA 4DL6A 1LQ9A 2FGCA 3HJVA 1WF0A 2UV8A 3CCQS 3KK2B 2HS3A 3JTOA 5IT9Y 1V6HA 2H3EB 5DRKA 4F67A 1FWKA 1KONA 3KLEB 2E5JA 3JAMY 3FSYA 4CM2A 3AD7C 1KHWA 2BANA 1S77D 4LF5F 2Z4PA 2W9AA 4KFBB 2MSTA 3ZZPA 1YHQS 2KYZA 2JHEA 1S99A 4WU3A 2BJDA 2IVMA 4K4WA 3OBIA 3U02A 1UPPA 1PYSB 1PBAA 1Z2ZA 1IKYB 2N4DA 1MROA 1N33F 2F63A 1N36J 3PV8A 4NMLA 4H4KC 4DPUA 1FFSB 4MFBA 1HWLA 3AB4B 1S1TA 3HKZD 5H9FJ 1JXVA 2JZ5A 2W7OA 2JFKA 4UOFA 2NR0A 3ILIA 4ED0A 4FNHA 3SQGB 2QLJB 2VHGA 1NK7A 1IKXA 1VCTA 3H8YA 2OPSA 3M8ZA 3UD4P 1Q81T 4NXNF 1E6VA 2HQDA 4DPWA 1GXTA 2DEIA 2LU2A 3P3DA 2CADA 2ZKTA 3KG4A 4JI7J 4KHPF 1T8EA 3W2WB 1C1BA 4IQXA 1S9GB 3KG1A 1JLGB 1DAXA 4LFAJ 1FHTA 1F3VA 4Q2MA 2BW7A 4UQTA 1B0VA 3VQSA 1Y9OA 5A8WA 1JNRB 3HI9A 1GMUA 3D7SB 5KFFA 1D3WA 2NZCA 4Y2AA 1Q7LB 1TZ0A 3GSDA 4HHHA 4MK9A 3KLIA 1U25A 3F0NA 3DMJB 1RAHB 1S6PA 2W25A 4LSZB 1HBOB 4QIEA 7FD1A 3FSIA 4OYAA 4TY8A 4X62F 4EZ6A 2A3JA 2WHOA 4DSFA 4KE5A 4EZ9A 1IN0A 2A0FB 2E5LF 1FK9B 1CSJA 4ZVFA 3TZZA 2UXCJ 1GH8A 1S57A 4Y34A 2F1FA 1NJIT 2W2QP 2EKNA 4DV5J 4OI4A 3UQSA 4CLKA 3OLAA 4O3PA 1TTHB 3NNHA 5KFAA 3R27A 5HLFA 4HI1A 4OYPA 1CPZA 3BS9A 2ZC3A 3DLGA 4PQUA 2V8HA 4OMFG 2WB4A 4DSIA 2J5AA 3G6ES 4CLSA 2X3GA 1BWVA 2P2CB 5JVHQ 1SKWA 1PC5A 2N7CA 4ZPCA 3DDNA 3B6BA 3NAHA 4NZ6A 2F40A 2MTLA 3TQEA 4P73A 3PX4A 1QUPA 2J8AA 5KFJA 4ZPVR 1S4EA 2GC8A 2XB2D 4U8YA 4DV6F 4YP3A 1P9YA 4LRCA 4DR1F 4A8FA 1RT6A 3DI6A 3KLFA 2WCXA 2W7PA 5DS7A 3CCLS 3OXLA 4LSNA 4EI2A 4K50A 1XJWB 5HBMB 4IOCQ 2ZBRA 3BN7A 2EFVA 3I5AA 2DNKA 2YNIA 3TNVA 4FF1A 1SBRA 4JI5J 4FPIA 3K5PA 3O5TB 4A47A 4CLFA 2YKNB 3PW7A 5D4NA 1UVLA 2OIHA 1JLCA 1S48A 1J2VA 1LXJA 3A1YG 3EVWA 4LBPA 4RNFA 5SUHA 3W62A 1YJNS 4X4RA 1AFIA 3GFYA 3FJ2A 1RU1A 2HK3A 2OHDA 4LBHA 4HH1A 1I5OB 2VDHA 3TEGA 3BGLA 2IIHA 2CPXA 3I32A 1D9AA 3M1VB 2Y0BB 3AD9C 3MMCB 2JLFA 4IOBA 4ZVUB 5AE3A 3M30A 3JTNA 3R7SB 2VASA 4DJBA 3IR7B 2M7SA 3TUJC 5KG5A 4TY9A 2GHVC 4ZA1A 2ZBCA 4JUZA 2C2KB 3QIPB 4ZLPA 4RUCA 3B4DA 2E5LJ 3QAUA 4Q7AA 3U7JA 4DF4A 1WI8A 2AJ2A 2V2ZA 4ED1A 1RHJB 2FHOB 4NLDA 2EI5A 2RF2A 2LA6A 3P45B 4AFFA 3W5XA 4PRFA 1IUJA 3UI3A 1ZM9A 2RD5C 4LUBA 4JI8J 2OPSB 4GO5X 4U7CA 4DV4F 1T95A 2CPZA 1SKUB 2G1DA 4RR5A 5CCLA 3KHGA 3CEDA 1S6QB 1TKZB 5L1KA 4CT8A 4QZVB 1RE1B 2IJRA 4OZ1A 4WYWA 2JSXA 3V2UC 2UUCJ 2V50A 4NRUA 1MMDA 5A8WB 4X65F 4DV0J 4OHXA 1U1NA 2I6WA 4MMOA 2XY7A 5GADI 2EVZA 5DGAA 1MMLA 4HVZA 4IRCA 4UOGA 2VL1A 3T1AA 4MKBA 2R4FA 4CO4A 3MCMA 2RILA 4IDKA 1VI7A 2HQIA 4NRTA 3I82A 1FEEA 2OTLS 1CQNA 4ZIWA 2IC3A 1F9FA 3F44A 5HP1A 2W24A 3F41A 1FKAF 1JLBA 4DL2A 4ED7A 1X5PA 3K5OA 2UVVA 3RB0A 1C0TA 5HATA 4A8KA 2HQ3A 1SC3B 3ET6B 4LIWA 2W9BB 3DN9A 2YVSA 3C6UA 1UFKA 4DG1B 3Q0AA 1FNXH 1HR0F 3P49B 3Q8SB 4QWAA 1SV5B 3W66A 3LPYA 2AV5A 3GPAA 3QGIA 3MUTP 3CJSA 3MTJA 2VQEJ 2VFTA 3TOQA 4OX7A 2RS8A 3OR1A 5DJBA 4DSEA 2DR7A 1B0TA 3MAHA 5L1LA 2CXEA 1DBDA 4ZKAA 4ZPTR 2OELA 3FBFA 1X7VA 3R8YA 4QCLA 1I1GA 4I67A 3SDEA 4Z7CA 3K0JA 2ZH8A 3SV4A 2M4MA 1K1QA 1U8WA 4IDKB 1MU2A 1M5KC 1TFYA 3DKDA 1YJ9S 5KFYA 4OZNA 3I0RA 5JJBA 1F3FA 1D0EA 4UZBA 3KNAA 4ATNA 2GS8A 4RBVA 3BQ0A 1N34J 3OD2A 5A76A 2GJFA 2UZAA 1QUVA 4RU9A 2OFGX 2WW8A 3S8SA 5FJ4A 4AXJA 4KPCA 2ASJA 4CM0A 1R8BA 1GTEA 4OI2A 2CFXA 4DMZA 1UEKA 5F8HA 1VQ5S 1NK0A 3MZIA 4L75A 4DV3J 5ITHA 1LWFA 1BUXA 2A1BA 2PMHA 3MPWA 4URQU 5K14A 2HFZA 2UXBF 5HL7Q 1RTJB 4LF4J 4WFXA 3LOUA 1S12A 4M5HA 4OYXA 2GCFA 5D4OA 4ANDA 3FFIB 3KHRA 4LFBF 2IY5B 1RWPB 1Y00A 3IGVA 3RYLA 4JB8B 3T1HJ 1U4BA 2PO4A 3H2UB 2DCUB 1SIWB 3MMJA 4KGZB 2IM0A 1H72C 1K8AT 2ATLA 1N88A 4MKYA 2KZMA 3HF5A 3OFFA 4RL1A 2J0XA 2KL8A 2YNGB 2ZHAA 2BABA 2ZKUA 3QNWB 4C6AA 5KG7A 1NKBA 1M1HA 2WBMA 3W64A 4UUXA 3VF0B 1WACA 1RHMB 3VVUA 1NCLA 1ZTTA 1F5AA 2R8KA 3W9JA 1IWAA 2DNNA 4Y6IA 2C2RA 2KYXA 1HMVA 3LA0A 1E6YA 4L3KA 3M8RA 2ZH1A 3BO2A 1TQLA 4B9VA 1WG5A 1X31C 3C16B 2GNKA 2GX8A 1SXLA 1PAEX 1REVB 3NGRA 4LREA 4OV6A 1LWFB 3L7OA 4DPOA 4U95A 4XAKA 4AD6A 5J2PA 2R2SA 3KUGA 3FGVA 2RUSA 3EUNA 2B4VA 3OL6A 1MMNA 2QA2A 4MK7A 4PPZA 4FYDA 4MFBB 2GIRA 4QIFA 2N3OA 1L3KA 3M32A 2BJ3A 2X7IA 4UW2A 5D4PA 1TV6A 4DWIA 2R8HA 2DB1A 4Q5VA 4K4ZA 1HNZJ 1G1XA 1VC0A 3NG8A 2I5JB 1DQAA 5M2UA 2WVBA 1HI1A 1Y3JA 5C25B 3W2WA 2AD9A 4DQIA 1HBNB 1K0TA 1FD8A 2X1AA 3A8IA 2EFQA 4PWDA 2E1RA 1VQSA 1YZ6A 1Z1ZA 1DJ0A 2EG1A 4DPYA 2GA7A 1EQMA 2AEMA 3DYAB 2XYGB 3IRXA 1SL1A 4DFMA 1VQ6S 5LL6d 3UD5A 3MECA 4CTAA 3GE9A 1CJVB 3IAS9 1RAOA 2B4UA 2DNMA 1S6PB 2MHEA 3A3NB 2MQPA 3DHWC 3J7AN 3FDSA 5JVGQ 1N5YA 4RW6A 5AE1A 5KFPA 3H42A 4EYHB 1LK7A 3QYYA 3V6HA 1QY7A 3BBCA 1RKIA 2MLXA 1GTHA 3L09A 4GVBA 8ATCB 4Q43A 4M5IA 1GK8A 4L6V3 4F4YA 5E7OB 1NZAA 3PRBA 5K8MA 3TX0A 4K4VA 4F3QA 1NJXA 2R7XA 4DBQA 3TZXA 2HNZA 4I69A 3CIZA 3QJJA 4KO0A 2XLJA 1VQKS 2I5JA 1Y3KA 2DXFA 2RB7A 4NOHA 4ZHRB 2X3DA 2D3O1 1JJ2R 1JXEA 4ZLLA 4OYIA 3OPKA 2OD6A 3EGNA 3OSPA 3FEZA 5KFTA 5FDLA 4CDIA 1RU2A 1NB7A 5CYJA 3AFGA 1F9EB 2AJFE 2MQQA 5HLFB 1HPZB 2HPUA 3IA0A 1QM9A 2JFDA 3R5JB 1PO6A 2FVCA 3MPUB 1GEHA 3I0SB 4C4WA 3GJQB 3CJ3A 3KG0A 2LXFA 3CCZA 3FZ2A 4FNIA 4K2XA 5KFHA 4Q44A 1UVNA 1T03B 4IG0B 3HHLD 1TL7A 3KTQA 1RT6B 1I51B 2FD2A 2MDAA 2J8SA 3D5MA 3DI6B 4A8OA 1HYSA 3EXCX 2YY3A 1N5YB 4N76A 4CNYA 3FEXB 2Z30B 2JEFA 4JI0J 1AUSL 3SCKE 3ZTOA 1U48A 1AT1B 2NYHA 3PFOA 3W7BA 1SL0A 2CDQA 1U0SA 2YX4A 1RAEB 2E1PA 3NKYA 4XDCA 4C9DA 2KU7A 4I6YA 1Q79A 5C7PA 4B3RF 3BYPA 1PILA 4C3KA 1T02A 5HQ8A 4ZK7M 3MI7X 1RADB 1FKOA 1FNMA 1BGXT 1YWXA 2DNOA 4J9UE 4NMXA 2DNZA 3OSNA 3SYZA 2R42A 1L3TA 3ZZTA 1NU4A 4DL4A 2ERRA 5AXMA 3KJNB 3CC2S 5IM0A 2HAFA 2Z57B 1TVRA 4F4KA 3C15B 1V5VA 1VQYA 5GAEU 2Z0GA 1SIZA 4DXLA 4RW9B 3BH7B 3QWPA 3SSSA 3OJSA 3PJ9A 3CJTA 2MLYA 3EWGA 2YKOA 3C19A 4H4OB 4OI6A 4OZ0A 3MR6A 2WSCC 2BZ2A 4PAAA 2HRTA 4YOEA 3OLBA 2FY1A 1VQNS 2HHXA 2VG5A 1BC6A 1HWIA 1S1VA 3AJ2A 1UL3A 3E51A 3HP6A 3ETOA 1FRLA 1EETB 2FZKB 3CMQA 2IVFB 1S6QA 1R0CB 5C25A 4Y65A 2AZ1A 2Z2ZA 2BQ3A 3TAMA 4N77A 3MM5A 2EPIA 3PR5B 4KFBA 1WTBA 3EGVA 5I42A 1U47A 1UWBA 2JVOA 1NPRA 3MM6B 2FC8A 4HTJA 3Q8RB 5A8KA 4F7VA 4M5NA 1H73A 3VZIA 3FBCA 4O44A 4P10A 2DRAA 4ITSA 3B4MA 3CDUA 4FYWB 4UOHA 2ZH2A 5KG3A 2OO4A 2AWZA 3V6KA 2NZ4A 5CHCB 1Q95G 1RJJA 2RU9A 3N9UC 3IS9A 2Z2MA 1JJCB 2EBEA 2OPQB 4GVBB 4ZPAA 3VAFA 4NYZA 2GAGC 3RBDA 2NXCA 1R89A 2FLLA 1JJ4A 3KK1A 2BE7D 4ECWA 4U8VA 1CLFA 1RWOB 5J1NA 3GJSB 4LVNP 2XHCA 2XZTB 4ZIVA 4C8YA 3NRBA 3GIJA 1APSA 2H54B 4PUOB 2FJEB 3O1LA 4P2FA 2P5VA 1EZZB 1UA0A 2J6UA 1KOOA 4WE1A 4LFBJ 2XYHB 1RBAA 5DLFA 1ZETA 5C2GA 1X9WA 2Q66A 1AZSA 3AODA 4N56A 1MWZA 4ED4A 3IRWP 3CJ4A 3DLKA 2VBXA 1DURA 2W1BA 3W2VB 2KXNB 1M90T 2Z2YB 3OFEA 3BF4A 3WZ0A 4USVA 3MXHP
chains in the Genus database with same CATH topology
5B7WA 2RUGA 4TYBA 2KHCA 1G2EA 2BRKA 2BBEA 2LVWA 1TUVA 2V9WA 3M2UB 3CCES 1P1TA 3SFGA 1N34F 2HGNA 1FF2A 3N0VA 4QWEA 2V4RA 5DM7Q 2VA3A 2OAUA 5KFIA 2OPRB 4ED2A 4B02A 1H7XA 1TP7A 2MGZA 2XY5A 2DH8A 4P7VA 3H98A 1MU2B 2CJBA 1HHTP 2CIMA 3FQLA 3DCAA 4KV8A 4O3QA 5E41A 3M9NB 4ZOSA 4QIGA 2HFNA 3LQVA 2A18A 1VRUA 2AP6A 1M0SA 1S1WB 2DH7A 2M52A 2QLWA 2BW2A 4Q8FA 3D2WA 4ECTA 5A8RB 4RW9A 2D74B 4KJIA 3PKMA 4PCQA 4C8NA 3HT3A 1EETA 3HO1A 1DZ5A 2AX1A 2QMXA 1T05A 4ILLA 2MKSA 1HQUB 1S1UA 2CQ1A 4EO6A 1DTQA 3H5YA 1NK8A 4BDPA 1X4HA 4UY85 3SSRA 2LKZA 3UR3C 3UR0A 1X4DA 1MW7A 1RTIB 4BBYA 5KOXA 3MR2A 2ZD1B 3B78A 3R5BA 2CVEA 1LWEA 5H9EJ 3HVRA 3J81Y 3K5NA 1HNZF 4C0BA 1IR0A 2CPEA 2FIUA 1YIJS 1ZTWA 1T94A 2RMLA 2R7WA 1ZZNA 3PR4A 2ILZA 2MKCA 1ZZFA 2DPJA 4TNOA 2FJVA 2P6TA 3OXGA 3T5KA 3CTRA 4LFAF 3RRGA 3V4MA 3T5HA 2BV3A 2HVIA 4IR9A 2R7TA 2FHJA 1NJXA 3MM8A 2YKQA 4ZCKA 3WC0A 5KFMA 1N56A 4O3RA 2GQCA 4WCEQ 2VC0A 4RW8B 1GT8A 3FNNA 5IS2A 4LF7F 3BO4A 3OL9A 1FJGF 4YR2A 2IRXA 1KQSR 2DISA 3RB4A 4J9QA 3G8QA 2W4CA 2RT3A 4XPCA 1VQ9S 1NJYA 1U1RA 2AJ1A 3KLHA 4X4UA 4M8LA 4OLOA 3JSMB 3CCVS 2UUCF 4ID5B 4G1IA 1KQKA 2K7JA 2RQMA 2CZ4A 4DLGA 4O3SA 4RW4A 2E7XA 3J80Y 3ZC4A 1H0HB 4ZP9A 2PIIA 3IG1A 2LA4A 4HH0A 1N0UA 1UKUA 5EWEA 4AL6A 3KNGA 1E6VB 3OTCA 5GAHU 2W9BA 1FJCA 4C3MA 2HNZB 1C4AA 3FVYA 1TK0A 3I0SA 1HL6A 2XHWA 2R2TA 5A0YA 4NLSA 3DDKA 2IYIA 2Z2LA 2GGPA 3QGGA 1NKEA 3U27A 4FXDA 1OIAA 5KT5A 3TA1A 2YNFA 1FE0A 4DL5A 3AQPA 3OXFA 4XIUA 3GIKA 4DS5A 2VOPA 2M0GB 5KOWA 5DO2A 2XMTA 2HMIB 1XWLA 3R1HA 1RT3B 3MWBA 4ID5A 5IT4A 5C5JA 4A8QA 1D9DA 4Q0BA 1H3DA 3PRDA 2ZH3A 2J9DA 1FCAA 5KFWA 1ZAWA 1T05B 1UMJA 1VQ5S 4CIOA 3DOKA 5DQGA 2VFSA 3TI0A 2C3YA 4ALZA 1VRTB 2OMLA 2M70A 4O4GB 4C8OA 2R7VA 3HHDA 4IOAQ 5KT6A 2F4VF 2DT9A 4RWWA 2VBWA 4C7QA 1LWEB 3MOJB 2JJ4D 1WG4A 5HI7A 5HROA 3SEOA 2E9ZA 3SZ2A 2DHGA 3AJ1A 1X5SA 3DLEA 3LP0B 2IMOA 4OJHA 1K9MT 1RT2B 4NLUA 2ZOFA 3MEEA 4C11B 2I1RA 3CVKA 3EPIA 2V8VA 5L9NA 3DOLB 5B09A 3N4WA 1KN6A 1KR4A 3ISNC 3OTBA 4FS2A 5F9LA 2WB1D 4TU8A 4AL5A 1X4BA 3DM2B 1FXRA 1C0TB 2AGOA 1JLAB 4RZRA 2QE5A 3OFHA 1U1OA 5IWAF 2A2DA 3G96A 3CF5Q 4IH6A 4OX9F 5K8PA 5LSRA 5FD1A 2VA2A 4NXMF 5F8MA 2JDJA 2R2RA 3PIOQ 4X2BA 2L9DA 2MQOA 5B0DA 4EGLA 3C8YA 3OR1B 4V19J 1XMBA 2DITA 2L48A 1REVA 3GFZA 2KN4A 2XGQA 1X4EA 2F7VA 4EBDA 4MH8A 3PACA 4TU7A 4FBUA 2MKKA 4QW9A 4X66F 5LMNF 2FHKA 5DDPC 3HVAA 4LQ3A 4AQYF 4OIXA 1T7PA 3PNIA 3TA0A 5CQGA 1Q7YT 3DU5A 1Q86T 1DQ9A 4DR3F 4PUOB 1F5BA 3AY0A 5EHHA 3CJKB 1A6LA 4RUAA 4WF9Q 4X84A 1VS3A 4ID8A 4B3SF 2JEGA 4JYAF 2L3MA 4K5SA 2ZOMA 2FVRA 1SJRA 2F8EX 4MIAA 2ALZA 3BGFA 1S0NA 4MAKA 1JLFB 2DHXA 2Y0SD 2CVIA 4DL3A 1WHVA 2EG2A 2XMUA 1NH7A 2KO1A 1OO0B 1MNEA 5LMUF 4ZP7A 3AHPA 2J0QD 3GR0A 3OVBA 5M2PA 2P9CA 4MIWA 3BN4A 1H7WA 4C0HA 1B64A 4JV0A 2F9JA 3CCTA 2C3OA 4ETXA 3CCMS 2F3JA 1N5VA 3NGDA 1H38A 4CH7A 1VBZA 3PZPA 5HP1B 4JI4F 3DXSX 4USJC 2OMOA 4ED8A 3ZZZA 1YJTA 2ZE2B 1FRKA 5I4MA 2RDJA 1JMTA 2R2UA 2O66A 5HMWA 2FVSA 1VQLS 4Y00A 4HL9A 4YQWA 1HBUB 1RT1B 2LU1A 1U8SA 2YWHA 3VALA 3V6DB 3NCRA 4NCGA 3HHKA 3PX0A 1TKDA 4I7FB 5BYSA 3B8HA 4YB1P 5HMXA 3Q24A 3MMCA 4NLOA 3HDSA 5EGYA 4TYAA 2VPXB 4AUKA 3TAQA 4B9MA 4IRDA 2AJ0A 3LW5C 3GMGA 5LJ5Y 2OSRA 2W8LA 2DBBA 1V3RA 3EYZA 3IGNA 4ILRA 3DGPA 5T14A 2LECA 1BWEA 1SJQA 2YX1A 2CQPA 2RF2B 3CDAA 1HQEA 1U1PA 1WI6A 4JI5F 4O3NA 2GMJA 2QZ8A 1JK9B 1RT5A 2OSQA 3US5A 5DQHA 2XI2A 3K59A 4QOTA 4QJVA 1KC8T 5KFRA 4NL5A 1S7HA 3D28A 4LJMA 3CJ2A 3OFGA 5KFOA 1KLMB 4IFYA 2OP5A 2VQEF 2Y1IA 4CQ1A 3T1HF 3B82A 4G3IA 2AGQA 2VD3A 5LXRA 2J0WA 2EK6A 1C1CB 3CC7S 3KMSA 2O1PA 2PT0A 2WAQD 2DGVA 1SUQB 4OI0A 4N47A 2MY7A 4KSEB 1S4FA 3PKYA 2PFFB 2BOPA 1KVIA 2ABYA 5KFCA 5BR8F 4NZ0A 2IYGA 3N01A 2JLEA 3PO5A 3OHAA 5DM6Q 3IWLA 1KLNA 1SJ3P 3MHYA 3M6UA 2UVRA 1LW2B 3FZBA 4ECYA 1T03A 1E6YB 4OHWA 3G6YA 1Q16B 5I3QA 4NPOA 2XCAA 3FRZA 3SCIE 1P1LA 3BREA 3VCDA 4JV5F 2OPPA 2IA6A 1N54B 2UXDF 1HNVB 4LVOP 2I38A 3V81A 1IM4A 2RIJA 2R8KA 1KSPA 1HFEL 3M32B 3N5FA 4WZMA 3IC1A 1R0AB 3DHXA 4PXBA 2BM0A 2FGOA 4OLPA 2UU9F 3CXCR 2XG8A 2YX7A 4IH5A 3L95X 2DGSA 4M1KA 4I56A 4PXDA 2MKIA 4Y2MA 2NLWA 5JUMA 3V6DA 3CC4S 1IKVB 2VPYB 3H2LA 1Y5LB 2WRMA 2HRYA 3BZQA 2FLNA 1KS2A 2RSQA 4WK1A 3RTVA 1PGZA 4RX6A 1HI8A 2FPHX 2PDAA 4IFVB 5G0RB 2DHSA 4LSNB 4K4TA 2WK4A 3Q23A 4DV3F 3EGWB 2D41A 1HNIA 1RT5B 3NP5A 1U6FA 2YNHA 5CD4H 4UY8T 3OR2B 5J2QB 1X4GA 1Q8IA 1AROP 2XSJA 3Q8PB 3GG0A 5J1EA 4IO1A 1C4CA 1RT7B 3MM7A 4HT5A 2C2EA 1FKPB 5SZTA 1J5EF 1FRXA 4LIRA 2YKMB 2C2DA 2J7WA 1Q82T 2QV6A 1U09A 5D4LA 3LP2B 5J2PB 2DPIA 4C0OC 3KLIB 4C11A 1VQMS 1FESA 2VH7A 3TVYA 2ZC4A 3DLEB 3TANA 3BDPA 1RTDB 5KFXA 3M8SA 1LK5A 3ITHB 3M30B 2DNYA 2PD1A 4IFVA 1JKHB 3F73A 1R31A 1LWCA 1LW0B 1IBMF 2I9SA 3JSBA 1R27B 3GV5B 2MHNA 5MAOA 3KMQA 1V9OA 4WKRA 3MEGB 4HLBA 1RT4B 4QYRA 5IFMA 3IWNC 5BYRA 3NAIA 3NLCA 1NHVA 4KHMA 5GMKa 5GAGI 3AH6A 3H4DA 1FTRA 2IRUA 3MDFA 2J6TA 2OJ3A 3M6XA 2FJBB 2LQJA 2VC1A 2BDPA 1B7FA 1TL3A 2DGUA 3E8OA 1DHMA 5IM0B 5HMZA 4ZCMA 3R5AA 1HD0A 1SH3A 3V4IB 3LO3A 4PUOA 2DR5A 1P8GA 3FRYA 2KH9A 1JJHA 2AYBA 1FDAA 4ECRA 4DX8H 4KGMA 4MJKA 4DFJA 4IR1A 2IA0A 2DD8S 1AXQA 2GMHA 2HWHA 4Q2LA 5D77A 3M2RA 2HLUA 2N7YA 3MEGA 2DK2A 4I6AA 2FLPA 1NHUA 3CJKA 3VAJA 1JLFA 1M5SA 3HLUA 1Q8LA 4DS4A 2JOQA 3PIPQ 2IBOA 3IXQA 2GJIA 4ICLA 1S1WA 5D78A 2BQRA 5JXSA 5F8IA 1TL4A 2ZDPA 1YJRA 3HXMA 4TKTA 3SV3A 3V6JA 1AW0A 2E1MC 1K0VA 5KAKA 5A8RA 3E01B 4NX9A 1JB0C 3UW1A 2VB6A 2DCLA 2HLTA 4F4XA 3FQKA 2D9PA 4PG6A 4LT6A 2ACYA 2L9WA 2XZWA 2UUTA 4A8XA 2MKJA 2RU3A 3WX4A 1VBYA 2HYIB 1WELA 2JC1A 4QPXA 4DUZF 2ZH4A 2VG6B 3N6NA 1RP5A 3OTEA 3OQ2A 1TVRB 2R7QA 3MURP 2XO7A 1XNRF 2J9EA 3PEJA 4FXWA 3CCUS 1U6ZA 2AU0A 4JI2F 4UQGA 5CYQA 4DQQA 4I64A 1IBLF 3M9MB 2MQNA 2LMIA 3CO9A 2E7WA 3M2UA 3N6LA 1G6BA 5F3TA 1X5TA 4PKDB 3RR8A 1RT3A 1RISA 4R0JA 1UJ4A 1R8CA 1W2BR 4LSLB 1CC7A 2MJNA 3GG1A 4U7UK 4QU6A 3CSKA 2PSZA 2ASDA 5KG0A 2QT7A 3R1LA 4ZP6A 4M63A 1H2TZ 3CE8A 5A8KB 4EEYA 2OTJS 4C8LA 1OQ6A 4F3MA 3HZGA 5E3RA 4YR0A 1VLYA 1SH2A 2VFRA 4RNMA 2OH2A 1Z2LA 3AQOA 3I6PA 1U2RA 3J7ZT 4G1PA 3DLJA 2NQPA 1H98A 4IH7A 3NBPA 2KM8C 3IAM9 2W4DA 3VAHA 1F60B 3S7RA 4F26A 3CMAS 4K4YA 2VV5A 3R3TA 2B9YA 3KK1B 3MTKA 1UEUA 3QMQA 3SDEB 4G1QA 4IFYB 2V5HG 3LH2S 2KHDA 4GKJF 3MD3A 3IFEA 4CO1A 1A7GE 1V3SA 4MKAA 2DGXA 4F4WA 4QR1A 4PG8A 5KG2A 4OJ1A 2RJZA 5GAGU 4KKOB 2PA3A 3DLKB 3W2VA 4A4JA 4OI3A 4Q8EA 1BY9A 2ZZMA 1JLAA 1WHXA 3SI8A 2AQ4A 5J2MA 1UVJA 2I8EA 4UOCA 4HTIA 3JB9k 3C2PA 1WEZA 2BRLA 3O44A 4RWXA 1HI0P 1TAUA 1BQXA 2ZM6F 1SB6A 4R5PB 1BQMB 1RYSA 2ZITA 1ELOA 1W2IA 4OQJA 1S6OA 3MM9A 4I1TA 1R7IA 1KFSA 4RW6B 1QTMA 1Q8BA 2B4PA 3KLGB 3DRRB 2AW0A 2JX2A 2D3ZA 2Z8QA 4F8RA 3K8VA 2K1RA 4M5DB 3C6TA 2UXCF 1KD1T 1ZM4A 3X3UA 4KR0B 1JX4A 3KK3A 2J9CA 1YSJA 4LF4F 2KJWA 3PJWA 2XNQA 1X9MA 5CA5A 1FRJA 5KFDA 1OS5A 5J1PA 4OZJA 1ZM3A 1ZAVA 2CPHA 2RQ4A 1QSSA 4J9LA 1R0AA 1S72S 2IFXA 4PG4A 1N48A 4M95A 1NK5A 2K2PA 1SV5A 2XGPA 3D0IE 5EWGA 4DQSA 1N0VC 2VPWB 3ENVA 1NEEA 4IG3A 4Y28C 5CZXA 4OI1A 3I4HX 2VPZB 1Q4RA 5B0GA 2HWIA 1OPIA 4FP9A 3X1LB 2JWNA 1TL1B 5C42B 2RQCA 1DFDA 1AUDA 2KFNA 1LOUA 1JLQA 3UNGC 1FVQA 3GZ7A 1LV5A 1FRMA 2HNDA 2R7OA 4FXVA 4RUHA 6FDRA 1HQUA 1FKPA 2LYVA 2NUUG 1RWUA 1J5OB 1W25A 4ZS6A 4ED5A 4NLYA 1X8DA 4USHA 2WONB 5KG1A 4CTAB 4E8UA 1FKOB 3KKFA 4N8OA 2U2FA 3MR5A 4BS2A 2VKZG 4PXCA 3PVXA 2V4JA 1RTDA 4A8YA 5DG8A 1GXUA 5LXYA 3SQGA 1NH8A 2A2CA 1WEYA 4ZDNA 1HNXF 3DLHA 2PI4A 5GADU 2PE8A 2YTCA 5E3CA 4DSKA 4K5RA 4B3TF 2DNRA 1HBMA 4PQAA 3D1HA 4J9NA 1FNOA 1R43A 1MSWD 2KDOA 3MM5B 2D7SA 2C42A 5B0BA 2IJNA 2K8GA 3QLHA 2HAIA 2LLZA 2ZJRQ 4WJBA 4ECSA 1R3NA 2IHR1 4QWCA 2D1CA 2DNPA 1BQMA 3J7YU 5AJ3F 3AAWB 3T6JA 3PY8A 3PFEA 5EX0A 5L8RC 4NA3A 3MGJA 2V94A 1RT2A 3HHLA 4KIAA 1O0PA 2CQGA 4DV2F 1XK8A 3KLHB 2VG7A 1XC9A 4YDXA 3G4SS 2L08A 3C6TB 4J9SA 2KG1A 4F2RA 4X4VA 1EP4A 4ZPWR 4OHZA 2EK1A 4X4OA 2HG4A 1N4LA 3G8SA 5KFGA 4DL0C 2XS2A 3TA2A 4JI1F 3M2RB 3OUYA 3R5DA 4KQZA 2M2BA 3D0GE 3GV8B 5D6GA 3P6YC 2LDYA 4NCGB 3H4BA 4J9KA 5J2QA 4Y0FA 2COLA 2EWHA 2G0CA 1KNZA