4CO0A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
109
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
total genus 23
structure length 109
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co0A00
1PILA 4IYQA 3N5BA 1UFLA 3NCPA 2GX8A 4WK1A 2Z0GA 1UMJA 4R25A 1V3RA 2EG1A 1V6HA 2J9DE 2NUUG 3TA1A 1VFJA 3AH6A 1KR4A 3OPKA 1H3DA 3AA8A 1HWUA 4RX6A 3NCRA 1UL3A 4CO1A 2XBPA 3L7PA 2XZWA 3BZQA 3O5TB 4RWXA 1QY7A 1UKUA 4C3LA 3AHPA 5DRKA 2GW8A 1VHFA 4OZLA 2GNKA 3O8WA 4AFFA 4CNZA 4D3HA 4CO4A 4YB7A 4Y65A 1NH8A 5D4OA 5L9NA 3TA2A 4USIA 2O66A 5D4NA 4YB5A 2CZ4A 4RWWA 2J9DA 2DCLA 1NZAA 4USHA 4ZK7M 1GNKA 3DFEA 4WK3A 2RD5C 2JJ4D 1V3SA 1NH7A 4Y6IA 2ZOMA 3M05A 2VD3A 5D4PA 4E98A 1O51A 3HLUA 2E66A 3X3UA 2PIIA 3TA0A 3NCQA 4D3GA 3CE8A 4NYOA 1OSCA 4OZJA 2NUHA 3T9ZA 4CO3A 4USJC 1O5JA 3AA9A 4RLEA 5DS7A 4C3MA 5D4LA 1V9OA 2J9EA 1NAQA 3LF0A 4C3KA 1P1LA 4OZNA 4CO0A 2O67A 3MHYA 2NS1B 4YB6A 2V5HG 1J2VA 1XK8A 4CO5A 4CNYA 4CO2A 2J9CA 2ZFHA 1Q1KA 3GSDA 2XG8A 2XULA 4NYPA 2EG2A
chains in the Genus database with same CATH superfamily
2RRNA 3KLGA 3QAUA 4MAKA 5HLFA 2HHPA 2NUUG 4HH1A 3GJRB 2RRBA 2WVBA 4QPXA 2BQ3A 3CB4A 3PX6A 1K0VA 1NBEB 2VODA 1D1UA 1IKWB 4F7VA 2DIUA 3EVOA 3KNGA 2DXEA 4GVLA 4A48A 1XNQF 1MROB 4OYBA 4N47A 3EXYA 4L3KA 4JI0J 3CDBA 5MAOA 4LIRA 4U67Q 5DO2A 3QPIA 1HNIB 3W5ZA 3TOQA 3FBEA 2WB1D 2KKHA 4X4VA 3A3NB 3UDVA 3PYDA 4OX6A 2XMJA 4ZVOB 5DS7A 3GIIA 3W63A 4QW8A 1N5YA 4N56A 2XM3A 1R31A 1BE4A 2UXCJ 1FJCA 2XMWA 3DOKB 5HMWA 5ETKA 2OPQA 4BBYA 5KFYA 2R7RA 1HW9A 5HP1A 4PABA 3FGVA 3HVTA 1D8YA 2UXDJ 1SQEA 3FRZA 2WVCA 3MGJA 1S77D 5F9NA 3R7BB 5BR8F 1JB0C 2V4JA 1EP4B 2PN6A 4RW6A 4ZVFA 2H5EA 5KG0A 3KHGA 1H6KX 2VDHA 3ZZ0A 4MKAA 2DR8A 5C42B 3ETOA 1Q82T 3WDOA 2FHJD 4NL5A 1NLKL 1KONA 3PM9A 4PG6A 3HKWA 4JI7F 5A6PA 2M52A 2X1BA 4FPIA 2V67A 1HBOB 4CO3A 4PAAA 2Z2MA 2W9AA 3H25A 4I6YA 4M95A 3Q2SC 1RT5A 4UQGA 3P5TL 1DLOA 3TZZA 3MM5B 3RYLA 1S1VB 2KB2A 3DU5A 3BBBA 1JJCB 3MAAB 1C0UA 3TX0A 5KG6A 4G1QA 2XULA 1AT1B 3IRXB 1X4BA 1KOHA 5IQ6A 1RB0A 1E6VA 2GC8A 3CCTA 2BKNA 1VI7A 4DMZA 2CJXB 2KFYA 1F6TA 3CCMS 2RKIB 1SKRA 4K4YA 1GXTA 2MQ8A 3G6ES 1RE1B 5FDLA 3RRGA 1O8BA 1J27A 4PXCA 2MGZB 1KBRA 3RB4A 3D67A 1Z1ZA 2GZOA 2UZAA 4CLTA 2V8PA 1ZBTA 2JJ4D 3OT9A 3QGHA 5IWAJ 2W4DA 1NSKL 4K8RA 2HIYA 4M63A 2C3YA 3I0RA 2VC0A 2BOAA 3TVZA 2XSJA 3D1HA 2RMLA 4JV5J 2JOQA 3H59A 2VUGA 1XJWB 2ASLA 3WZ0A 2XC9A 3A8JA 5J1EB 1XC9A 4ECXA 2QJ3A 4EO8A 5A2QY 4YB6A 4M1KA 2ZZTA 5CD4H 4XPCA 3J81j 3GSDA 1QAIA 2HNYA 4ZLPA 1H2VZ 2MXYA 1FERA 5ETMA 3MM7B 1RJJA 3FMWA 2CRLA 3FEXB 2M2BA 5KAKA 3MI7X 1W7WA 4RX6A 4DZDA 2V9KA 3AD9C 1IXKA 2J8AA 5LMNJ 1OJ4A 4Y3CA 4J9OA 4CLPA 1P9QC 4NMXA 1TL3A 1EHWA 3QNWB 2QLBB 4HTIA 4LR8A 3W5XA 4MH8A 1TZ0A 3J80Y 1DBDA 3RTVA 4EBCA 2UUCJ 1KD1T 4KV8A 1QSLA 4TQRA 4EK2A 3W2VB 4EU0A 2Q79A 3H5XA 1RU2A 3CO0P 1N6QB 4J9VA 4B3SF 3W5YA 2D9PA 2AJ0A 4ECZA 3JSMA 4YMEA 4RPFA 4HKQA 2HZCA 3S6EA 2V5HG 1NZ8A 3GCWP 3D0GE 4LRDA 4NI2B 5AE3A 4MKYA 4KAIA 4TLRA 4PWWA 3U1MA 2KU7A 3BYPA 2XQCA 1QJHA 3VGSA 3PIPQ 3RG6A 2MQMA 3FZBA 3W2WA 3TUJC 3POTA 4P2SA 1HNXJ 3AB4B 5CYMA 4J91A 4PR6A 4WBFA 4OI1A 1QDUB 1RWPB 5KFHA 1MMDA 2VG7A 3Q8VA 2MHEA 1URNA 4Q8EA 2AX0A 3CCZA 4B3RJ 3T5JA 2HHTA 3HHLC 3TZYA 2MKIA 1H2TZ 1S9EA 1KNZA 1SV5A 4EI2A 3PYFA 3M8SA 1ZZNA 2YTCA 2FJAB 4URGA 4OJGA 1ACMB 1JK9B 2EKNA 4KRWA 1HA1A 6FDRA 3MPVA 5D4LA 2CPZA 2OIHA 3EVMA 2I5JB 4LSNB 5EDWA 4DOZA 1HFEL 1ZAVA 3OTEA 2Q43A 2IY5B 2NZCA 2QZ8A 4G1PA 5KT5A 4J9QA 5JVGQ 3BGFA 3MEKA 4P71A 4Q5VA 1B3TA 2LA4A 2FC8A 2N4DA 3LP2A 1IM6A 4EYIB 5T7LB 1EQMA 3OPKA 1HWUA 5L1JA 4HI1A 4UTGA 1ZPVA 1BD6A 3T1AA 3US5A 2W4PA 3DLHA 3CCUS 4DQSA 1EQ0A 3OJSA 2YKAA 3JTNA 4ZVPB 1NPPA 5A8WA 2ACYA 2ZDOA 1FVSA 5IV4A 2OAUA 1RAHB 4CDIA 1Q79A 2B9WA 3LP1B 5IC6B 4HVZA 1NPRA 2DR6A 5I3UA 1KLNA 1TL7B 3BF4A 4ZS6A 5KT7A 4F4AA 5LXYA 3CE8A 1CJUA 2B5JB 4B3MF 5ETRA 1C1BB 3MAHA 3CCSS 2IC3A 2MZSA 2NZ4A 1IQZA 4KYZA 4F3OA 2OEMA 3VHQA 1B70B 1HYSB 5B0EA 3GR1A 3QGPA 3QRQA 2NXNA 2XO7A 2AU0A 4M5DA 1GH8A 3E51A 3T5LA 3OLAA 4ZJQA 1JLAB 5IFMA 4NLRA 2MQNA 4MMOA 3LALA 4LF9J 3HP6A 2ALYB 1HR0F 1RWMB 2ZWPA 1TL5A 4YFUA 1FRMA 3TNVA 1FRXA 3L7PA 2XZWA 4NCGB 1QSYA 2HFVA 3IC1A 2GW8A 3H0PA 1VHFA 4OZLA 2YKNB 5KT4A 4NLTA 4EYHB 4WTOB 4GVBA 4DX6A 3AY0A 2Z2YB 3PRVA 4FXWA 1RT3B 1S5ZA 1XNRJ 2EFVA 2AYBA 4PYAA 4Q2MA 1XQIA 3M8YA 4YDDB 1KHWA 1PG5B 2A0FB 1V5IB 3NBPA 4B9NA 3FC9A 3O44A 1RGVA 4CP5A 3PIOQ 3PY8A 4XDDA 1N34F 5ETNA 1M5SA 3MPDA 2VQEJ 1GMWA 1RT2B 1X8DA 3OVBA 2LXFA 2FVSA 1TL1A 1NDPA 1GFWB 1U1PA 4OHYA 1CJVA 1TKZA 4KHPJ 2RS8A 1TVRA 3M8PB 4ZIVA 1S6QB 4NZ6A 1NK4A 4JI1J 1NDKA 8AT1B 3LWMA 4DI6A 3KWMA 2XMUA 1Y9OA 2G4BA 2CNNB 2M5YA 4H54A 2WW8A 1VQMS 3KYLA 4Y0FA 1VK3A 1UKUA 1LQ9A 3F41A 1H7XA 2XI3A 3AXKA 2D9OA 1WF2A 2B4VA 1S4FA 4F2SA 4OZ1A 5FIIA 2F9DA 2ROEA 1APSA 1NB7A 2OPPB 1CQNA 1YRTA 3C15A 3HXMA 4TNOA 1IKXB 4ED5A 3GPAA 1R0AB 3D2WA 3HM9A 2DNHA 2VHGA 3P49B 3I87A 3V81B 3NGTA 4NLQA 1SIWB 4CTAA 3QSYB 2CNLB 2E5LF 3DM2A 4C0OC 5B0GA 1HWJA 5KFLA 2OSQA 1T11A 4ECTA 1RKIA 3JTOA 3AOAA 3ZC4A 4ZVTB 1NKBA 1URRA 2OGUA 4K4ZA 3BGUA 3HKZD 1NJWA 5KT3A 4X4TA 2F3JA 4OYWA 1GMVA 4R8UA 1GXLA 2RHSB 5DDPC 2KH9A 4Z2XA 3DLLQ 1A7GE 2BMBA 2B9XA 3DI6A 2KZZA 1RTDA 3D7SB 2BKOA 2WCXA 1PAEX 4MTPA 2B43A 1HQEA 5IQQA 2RT3A 2R7VA 1H2UX 4ANEA 1P1TA 1EKRA 2X1AA 1H74A 2IBOA 2V2ZA 4WXWA 2CPEA 3M2UA 4USHA 2YX4A 1WWHA 2QSWA 3C66A 2C28A 4YOEA 2FGOA 2ZOMA 4I0WA 3ITHB 4ILRA 3DOLB 5C7PA 4B02A 4DEZA 1HPZA 1TR0A 1IKWA 1RDRA 2KG0A 2YNIB 4ZP8A 1MROA 2IHR1 3HK2A 3MPUB 4EBEA 2MMYA 4ZMMA 4ZDNA 4RUBA 4JI8F 4DN9A 4LF8F 1HNIA 2QA1A 1UFKA 4DR2J 4DCOB 1NDLA 5B0DA 1RADB 1SJ3P 3CJ2A 1WF1A 3U02A 4JI6F 2KXHA 2HNZB 3V6HA 1KFDA 1U48A 1KWMA 3HHKA 3KJFB 3G4SS 1W26A 3AOCA 4J7CA 2CNOB 8ATCB 4PPDA 3BSCA 1ZM4A 4NLGA 4GO5X 4BWMA 2YXLA 3OFEA 3DOKA 1VJWA 4DR1F 4U9RA 3GQCA 5KG5A 4WPAA 4G6VB 1PYOB 3J7ZT 4O3PA 1YK9A 1YVFA 1F9FA 4L3NA 3L3CA 4BHQA 2KYXA 1EP4A 3H5YA 2J7UA 1BUXA 4OYAA 2JX2A 3N4WA 1V9OA 1S1UB 5C42A 1NK8A 5KFOA 4DPTA 3FUYA 4UUWA 3PYEA 4B17A 1HBNB 2JH3A 1ZA1B 3NMRA 5E5NA 2R8HA 3G6YA 1FDAA 4B9LA 1HBOA 4H4OB 2Z2ZA 3MCOA 1QAYA 1PYTA 1S79A 5C2GA 4DFPA 5LM7E 4DF8A 3RJMB 4DSLA 3Q8UA 2LXUA 2V8HA 3MM5A 1WHYA 2CAJA 1S1VA 5DRKA 3UDCA 2XO6A 2MKSA 4A8FA 3MAAA 4LIWA 5BR8J 3IRXA 2GIFA 2L9WA 4N8NA 2AJFE 1H73A 5I3PA 1SI9A 5B08A 2YKMB 4OX9F 1ZTWA 1NZAA 3NNHA 2BW7A 5GMEA 2R7UA 5KFKA 2WTFA 2RKIA 3PCOB 4DPUA 4MK9A 3ZZRA 4URQU 3EDRB 4B9SA 1QSSA 2L41A 1NJZA 4ANCA 4DX8H 5E33A 1FA0A 2FJBB 4ZVSB 3NS6A 2AJ1A 2MGZA 3C8YA 5FD1A 2ZNZA 3MXHP 3BM7A 2IRXA 3QGIA 2KXFA 2GAHC 2BQRA 3PW7A 2ASJA 3ULHA 3K5NA 1AYEA 4ELVA 1NJXA 1N8RT 2CADA 3QIDA 2M3DA 4KT0C 4PZVA 1WORA 5DGAA 1LW2A 2QLJB 4A4JA 3AB2B 3FMBA 3KK2B 3HSZA 1P9YA 2G1HA 5ETPA 4DCPB 5J1EA 2CJ9A 4NEZA 2NYIA 3K0JA 2VFUA 4C3LA 4ZJLA 3CCJS 4ECVA 2I38A 5AXKA 3D9BA 4IG3B 3IFEA 2C3PA 2QLFB 2O66A 3MM7A 3GJSB 2AMCB 3AT1B 4ZK7M 4AL7A 4TKTA 1FJGF 1K73T 4JYAF 1W2IA 3H4DA 1BLUA 2YBVA 5D0HA 2XHWA 2L9DA 4D3GA 4RR5A 4J9PA 5L39A 3ISNC 1S0OA 4FYVB 5K8NA 2F8HA 3AD8C 1X4HA 2A2DA 1LWFB 2E5GA 2XHCA 5F0UA 1JLEB 3W2VA 1AROP 5HQLA 4CO5A 3RAMA 4CO2A 3PZPA 3VAIA 4QIEA 2MHNA 5B0CA 1R8BA 2XZTB 4FBTA 4R25A 4IQMA 4UOGA 1DTQB 1PC4A 2UUWA 1N6QA 2BV3A 1T9UA 1BQXA 3H7HB 2OP5A 1K9MT 2RDJA 3G2XA 3TVKA 2NXEA 1WI6A 5K9FA 3QO9B 3ZZPA 3EJMA 2DRBA 3Q23A 2J0WA 4NI2A 2XCAA 3ELHA 5BXIA 4LF5J 4RW7B 5J1NA 1HI1A 2ERRA 2QV6A 1UVLA 3PEJA 1FKOB 3MR5A 2CA9A 2PEHA 2RQ4A 3T1YJ 1QE1B 1JLGB 1TKXB 1WEZA 2BDPA 3RAXA 1U4BA 4RJVA 4S0MA 4ZPDA 3M6XA 4A8XA 2J9EA 1CULB 4DU7A 4HT7A 4ZPBA 1LKZA 3CCWA 4B3SJ 2XNRA 4Y2MA 2J6SA 2DO0A 2HWHA 1BC6A 4H4KA 1UJ5A 4ECQA 3FSIA 1EKSA 1RHJB 4YHHF 4P75A 1NHUA 3GJTB 2BJ1A 4C8KA 4PQAA 1WHWA 2A3JA 5J2QB 3TA1A 1JXEA 2I5JA 4LSNA 5HSPA 2FLPA 3JAMY 2DNGA 2D74B 1EARA 5HATA 3UPFA 4JBCA 2LVWA 4OFZA 3D68A 3W8GA 4USMA 3MEDB 1WOPA 4PEOA 2WBMA 3HJVA 4CLLA 3MMAB 2PA8D 3KK3B 2MKYA 5T7LA 3DFEA 3FQKA 3W61A 1VHIA 4DPYA 3TJAA 1OO0B 2CG8A 4U8VA 2H3EB 3SDEB 2RDDA 4IR1A 3QFWA 1LFWA 1O6XA 2G0JA 2CDRB 3LP0B 3JQKA 4UOCA 1ZETA 2BE9B 2IDLA 2MKHA 1YJWS 1KTQA 2KJVA 4TN2A 5ITHA 3LP1A 3IWXA 3SI8A 2KZMA 1ZH5A 3SSQA 1DRZA 3GLJA 3T19A 1EETB 1TL7A 2A1BA 2BACA 2V8DA 2B5JA 4DL5A 4A8SA 4AL6A 1C1BA 5GMKa 4OZ2A 2F9JA 3L7OA 3UO0A 4Y2CA 5J2PB 1NDCA 2GGPA 3HHLB 1XR7A 3T41A 4X4PA 1UEUA 4K59A 2WZ1A 1HYSA 1RAIB 2WAQD 2YPZA 1S6UA 5BYRA 1AA1B 2OFHX 1HIYA 1JLAA 1AFJA 4Y00A 2BM0A 5DDRC 2OTJS 4DR4F 4TXSA 2YWGA 1T94A 4NCGA 2DCUB 2B56A 4R0JA 2YKNA 5L1LA 1MLAA 1X4EA 1AXQA 2MZJA 1S76D 4N41A 5B0FA 4AXIA 2H48B 1RT3A 3CC4S 4Y2IA 4CO0A 2B8PA 1U47A 3SFGA 5ETSA 1ROFA 4DQRA 3PR5B 1CS4B 5E3AA 1TFWA 3KLEB 3I32A 4OLOA 3MD1A 1KFSA 3SQGB 2ZH8A 1NRKA 2VFTA 3AXMA 1RUSA 3R2DJ 3M4XA 3VGTA 2K3IA 3R6LB 2C22A 2N4CA 2V2VA 5KFJA 5E3CA 2C2EA 1RT2A 4NZ0A 1V5VA 1HR0J 4UZCA 1S1TB 4XTTA 3THTA 2MJNA 5JVHQ 3HF5A 2HQDA 3M8PA 4WTYA 1S6QA 3TA2A 2HHUA 2OO4A 5LJ3Y 1U1NA 1K8AT 3W65A 2OPRB 3P5BP 1WC4A 5KT6A 2JVOA 4IUFA 4HT5A 2VIHA 2CJQA 3HJFA 3NCQA 4YP3A 5DJBA 2LQ9A 3N6MA 3A4TA 2PFDA 2OPPA 3ZTOA 4DV6J 2BX6A 1IKXA 5EWGA 2HMIB 1R0AA 3ZZYA 2BJ7A 3NAIA 5F8HA 3V81A 3VWSA 4LVOP 2DNZA 4FF3A 2MSTA 4OYMA 3NGSA 3UI3A 4RU2A 3PFEA 3D6HB 2IVFB 4XPEA 4Q7AA 1FE4A 3ENWA 1B64A 3C2PA 2QO3A 4IRKA 4W92B 2UU9J 3NGUA 2E1RA 2YNFB 4DR3F 2D1CA 2RQKA 3F0NA 3MTJA 3G96A 3LWLA 3C16B 2HQGA 2V68A 3FCHA 2ZH3A 4WP3A 1G3OA 3TAMB 4ELTA 5DG8A 1RLDA 2GCFA 1KDNA 6FD1A 2D7SA 2CQ3A 2UVUA 1SC6A 1M5PC 2YY3A 1WHVA 1LWCB 2W1BA 1RTJB 3T9NA 3O6QA 4NXMF 1Y3KA 1Q16B 4MIBA 3MAQA 2HHVA 1VRUB 4IRCA 1H72C 3ITHA 5KFXA 2IVYA 4U6PA 3DOLA 3NWGA 2HVIA 2KN4A 5HN0A 5I3QA 1PJ7A 3B8HA 3CJRA 2DGOA 2WVFA 4WK1A 2YNIA 3CDUA 2BJ8A 1L3UA 1X4DA 4E8UA 1Y10A 3K17A 3FJ2A 1YX2A 3NCRA 2VC1A 4P52A 4DL2A 2JLGA 2H1YA 1T7PA 2E5JA 3DNCA 3LQVA 1XR6A 2P9CA 2CWXA 4M94A 2HQIA 2HBZB 1L3SA 2ABYA 3SBMA 4OJHA 2HNZA 3DLJA 1QAJA 1WOSA 3AQOA 4OYPA 3EE3A 1YJRA 3MM9B 2YH0A 5AT1B 2NXUA 4XDCA 4HL9A 1NEEA 4A8OA 2F1FA 4Z7CA 1FF2A 1DARA 3HD1A 3M7VA 3JYTB 1UCNA 2WVDA 2OEJA 4CYUB 3B6BA 1S48A 3MHYA 4BCAA 4LF8J 4F25A 1Q53A 4CNYA 1HHSA 3CJ8A 4OHWA 3D1QA 3GB0A 3VAFA 2J9DE 3BBCA 4QZVB 1S1UA 4QR0A 5E3QA 4F36A 3L9ZA 4QIFA 4IQXA 3CC2S 1IKVB 2AZ3A 9ATCB 1HBNA 1Q4RA 1T3OA 3CD0A 4M5KA 2FC9A 4H4OA 4P9SA 3HFZB 2ROGA 3W62A 3QT5A 3TI0A 1VQ6S 2Q6BA 2MEWA 1CJTB 3G8TA 2OMLA 5KFRA 3HCXA 1HWIA 1F60B 2A10A 2DITA 3DRYA 2BUNA 2ZBIA 5FLXU 1RHMB 2QL5B 2FZGB 4QIGA 4ER8A 2L3MA 5D77A 3FK4A 1N88A 4DUYF 2NSCA 1Q0NA 2YH1A 2YKMA 3C14B 3LGMA 2FJVA 1G7CB 4NCAA 2CQ0A 1I3OB 1D9FA 3K5LA 2Z57B 1WDTA 2V63A 4NA3A 1PIEA 5CH7B 2M88A 3KLHB 5B0BA 1K44A 2HQ3A 5HJXA 1U2CA 2BJDA 4DR7F 3M8WA 1Q8IA 2VDIA 2H9ZA 1C1CB 4O0NA 2ZOFA 4GC6A 4IH6A 4DV2J 3DRRB 2QLWA 3IAS9 5AJ3J 1HNZF 2AHOB 1VQ7S 2FZCB 1WG1A 5D4OA 1FESA 1JJ4A 1DQ9A 4JI3J 1YQHA 3V4IB 3PJXA 4FDFA 3TX8A 3GV8B 3KK2A 2DGWA 1F3FA 2HW3A 2QFIA 4ZVQB 1UVJA 3CSKA 3OFFA 1HKAA 5HROB 4QR1A 3TUPA 3SIPB 1L5UA 3LGNA 2LEPA 4DSKA 1U1QA 4LFAF 1JNZB 2DIVA 1T9WA 2FLOA 1QD1A 3IBCB 4IG3A 3CJKB 1RKJA 3I96A 3RUBL 4QWCA 2DNLA 1TMMA 3RB0A 1NAQA 4HACB 4O44B 2HS3A 4RW9B 2KRRA 4R0EA 5KOXA 5BYQA 3QLHB 3C19A 4LFBF 2H54B 2HGLA 3WC2A 1YBTA 1IWGA 1E6YB 2DEIA 1SCJB 4NZ7A 3BQ1A 4RL1A 3UNGC 2CPFA 3BPSP 1RHUB 4WYLA 3CJQA 1NHVA 5F8GA 3HT3A 5IT9Y 3SSSA 3KNAA 3RRHA 1LWFA 4U96A 2DHHA 1Q86T 3FEZA 1JLEA 4WFZA 1WEXA 4PQUB 2AGQA 4DV0J 3VVUA 4YQWA 1NKEA 4DR6J 1DTQA 2FJDB 4C9DA 5MLCV 2FTRA 2HFSA 4O4RA 4AT1B 3KUGA 3UD5A 1FTCA 3LAKA 3QATA 3QO9A 1FJGJ 2UVWA 3HZEA 1BWVA 4JYAJ 4IKAA 4ES1A 2RDIA 3MM8B 4DQPA 3M9NB 2YNGB 5F8LA 1NK0A 3CDAA 1Q81T 3ETMA 2CJBA 4PWUA 1FKOA 2BOPA 3GP9A 5LOQA 3IM9A 1F5BA 1QE1A 1JLGA 4MIWA 3R5JB 1M1GA 5A8KB 1GEHA 2Y1LB 2ZBPA 1YI2S 2MQPA 2YKQA 3UNYA 4K2XA 1EX8A 4ID8A 1NK5A 1CULA 4X4RA 2AX1A 3UDLA 3ZZUA 1S99A 2AZ1A 5EX0A 1KS2A 1ZTTA 5CQGA 2HHHF 3QYYA 4ES3A 3MR3A 2C2DA 1ZAXA 3KMSA 4K4SA 3ILOA 4I2PB 1Y5IB 1YG0A 5J2QA 3EGNA 2J9DA 2XNQA 3DC2A 3EGVA 2ZHBA 5SZTA 3Q8SB 2KRBA 2UXBJ 3EX7B 2MTLA 4EBDA 2RQCA 3WIUA 1RXOB 3VR1A 3MEDA 4BC7A 4F3QA 1K1QA 3MMAA 3KK3A 2ALZA 2FVCA 1K1SA 3D3CJ 3I5BA 1FXLA 5CZXA 2YQ3A 4ILLA 2F4VJ 2BKPA 2QEXS 3SDEA 2W8LA 3MMCB 3FDSA 2J6UA 2YPYA 3RB6A 1RWKB 3HO1A 4F4WA 3WQPA 3QJPA 1RWNB 2IPOB 1U2FA 3BGRB 3DHWC 2E1CA 1OWXA 5A6WA 5A2QU 4LBHA 3LP0A 4KGZB 2M4MA 2VG6B 8RUCA 2PDAA 3DMJB 2RJZA 3T5KA 3G8QA 4KKOB 5HBMB 2LU1A 1EETA 2HFNA 3HHEA 3G9CA 1HW8A 4EO6A 4MFBB 5D3GB 2CQBA 1PCAA 3GYNA 1FNMA 1Z2ZA 3H98A 3HSJA 3K58A 5KFIA 3HHLA 2J7KA 1SXLA 1R8CA 3FZ2A 3J7YI 3J80U 4G3IA 1EB0A 3D6TB 1KVIA 3C6TB 1UA1A 4AYBD 1WHXA 3WBZA 1VQOS 3I55S 4I69A 2N3LA 3K2YA 1GX6A 1U26A 1B0PA 3M8QB 1YSJA 5G4DA 4ALZA 4X64J 2YWKA 1R89A 2W4CA 3LPYA 1JLQB 1VLYA 4RBVA 4NYPA 2DNRA 4LRAA 2EFPA 3H5UA 3AQPA 3BYRA 4KSEB 1TTHB 3TQEA 3GR0A 1V6HA 3MR7A 3NP5A 4QWBA 2P6TA 1I1GA 1GX5A 3PG9A 2XBPA 3MMBB 4JI4F 2KO1A 1X4AA 3PKYA 4O0IA 1CS4A 2XWYA 1EIYB 3KLEA 1SPBP 5LSLA 2B7CB 2Y1RI 3SQGA 2FDNA 4LJMA 2CPHA 1WC3A 2HFOA 3SSRA 2AQ4A 5F8MA 2I2YA 1O0PA 1S49A 4DU8A 3TEGA 4QCLA 2X3DA 3IBFB 4ZPVR 2M8DB 2KT5A 4ZVRB 5HVHA 4YN3B 1PJ5A 1S1TA 4F0MA 3CULA 4HTJA 1FT8A 3KLIB 4FS1A 4N7TA 3LH2S 4UQTA 1U0HB 4KJIA 4ATNA 2QA2A 2IA0A 4QU7A 4M5LA 2OPRA 1X0FA 4YDXA 5K8MA 2D3OR 2KI2A 1I51B 4A8KA 1OSDA 4WF9Q 2CZ9A 4EFAC 2OJ3A 2YWWA 3HHLD 3ZFVA 4B9MA 3NNAA 3PW4A 2PI5A 4OI4A 1UA0A 3W9JA 3HDSA 2HMIA 3FQLA 5CCMA 2VU5A 2GQQA 2ZKTA 1WSRA 3MR2A 1NUEA 1WD6A 2U2FA 5CCLA 2E1PA 3OW2R 4IDKB 1AB8A 1GNKA 2M0GB 2MZRA 9RUBA 2GHWA 3CMQA 4OZ5A 5C5JA 2KT2A 2ZH7A 2HRYA 2JZ5A 4TU9A 3KG0A 3W9IA 4H4MB 7FD1A 2YNFA 4QWAA 1TUVA 1EZZB 4JI5J 2GJFA 5KFGA 2HLTA 3UVJB 3VAKA 3C16A 2LQ8A 2MY7A 1IR0A 3BEGB 3GZ7A 4P10A 4DSEA 2HVEA 2WONB 5E3PA 2Y8YA 4WCEQ 4I68A 2C2MB 1B7FA 1Y00A 3JQMA 3TAMA 3OR2B 1FD2A 5J2MB 4FXDA 2FY1A 4DV4F 1IBKJ 2V34A 4DUZF 1J2VA 1AUSL 4C11B 4OQJA 4YB1P 2VASA 1FX4A 4KGKA 1LWCA 2GQ2A 2EG1A 1RTJA 3R5GA 3NNCA 2AEJA 2QMUB 1M5HA 3JS9A 2AYMA 3UCGA 4DFMA 1VRUA 4ECWA 3AAWB 3UN2A 3DCAA 1JXVA 5IXUA 1IBLJ 2G1DA 2EI5A 4ZLLA 3BN7A 4RUAA 4DR3J 3QRPA 1N32F 3TUIC 4YUDA 3HVRA 3Q8QB 2DCLA 2X1GA 4CQ1A 3UE2A 4RW8B 4R5PB 4Q0BB 1OYEA 1M1KT 1XMBA 4C8ZA 1N33F 2EW9A 1CJKB 3VAJA 3U1NA 5IM0B 2ZM6J 5CYJA 1RA7A 3MM6B 1SJ1A 1DY3A 1NKCA 3I5AA 3NS7B 5LSRA 2XMKA 2BE7D 3QWUA 2H4WB 3MM9A 1VLOA 4ZLJA 4ZIWA 4FBUA 1PYSB 5F8IA 2YQ0A 1SKSA 2ASYA 3JYTA 1OY9A 3VV2B 2OMOA 1WNEA 3EWGA 5HVGA 4CYUA 2G2ZA 2YKPA 1SVDA 3R5DA 1RCOB 1YJ9S 1UPPA 3KJNB 2CIMA 1T05B 2HZAA 4LQ9A 2RU9A 2K06A 2E7VA 3NS5A 1VC6A 4CIOA 3L7UA 4NOHA 2ZUGA 1BQMA 4YB7A 2Z2LA 2H65B 1P27B 2MLYA 3F44A 4WZQA 3QRRA 4ED2A 1HMVB 2UVRA 2FJEB 3HI9A 3GMGA 5KG4A 2GVDB 1IKVA 1UEKA 2ZJRQ 2R8KA 3D0HE 2HS4A 3IR5B 1T9TA 2JL9A 3JXOA 3LAMA 2RE1A 2YVSA 1M0SA 2XY7A 5K8PA 4LF7F 3D1OA 4C0HA 1CJTA 3OTOF 1WTFA 1KN6A 2IFXA 3OBIA 4ECYA 2PMZD 4ED7A 3MPYA 3BR9A 2AYEA 1NSAA 1R0BG 4J37A 1UP1A 1HHTP 2ZH6A 2XGPA 4O3SA 4KC5A 4YY3F 3NEKA 3OTBA 3DDIA 4M5GA 4M5JA 3C14A 2OPSB 1MG7A 4DCJB 2JNJA 3GTYX 4K4TA 2VB6A 4PUOB 3PJ9A 1YJ7A 1YLXA 2DXFA 2ZZMA 2P6SA 5K14B 2VA3A 4DJBA 2KFZA 2DR9A 2A2CA 1YZ7A 3KLHA 3MECB 3V6JA 1KVJA 2ILYA 4TVAB 5GAGU 3MMJA 2H4YB 3HHDA 1C1CA 1U25A 1S97A 1IN0A 2QLXA 2FHMA 2H5IB 3PX4A 1HNWF 4YR0A 4ZPAA 2UV8A 3NKYA 3CO9A 2DYAA 3MDFA 1NCLA 1VGYA 3H2LA 2LDIA 3JSYA 3V4IA 1UJ6A 5L9XA 4C3KA 2HRTA 3CPWR 1FFWB 4NLOA 4DUYJ 5HROA 2X7IA 2B4PA 3KHRA 3KUHA 4NA2A 1TAQA 5HJYA 2HK2A 3N01A 4L76A 1WDDA 3GYGA 4V19X 3CJKA 1IJFB 1XWLA 1T03B 3CTRA 4HACA 4O44A 4RW9A 1RT7B 4OI3A 4TLQA 2XS5A 3EGZA 1SL2A 2DHAA 4N76A 1YZ6A 3QLHA 2FJWA 4KQZA 1YITS 2OTLS 4PCQA 3R7SB 1U24A 5D15A 4HEA9 1S9FA 4EGLA 3PXGa 1VJQA 5HMZA 2NXJA 2XYGB 3CCES 3Q8PB 3OUYB 2V8GA 4WK3A 1VIXA 3I82A 4OZ3A 3CD6S 3CWJA 2VBZA 3M2VB 1NNDA 4KGXB 1HQUB 4PQUA 1MN7A 4JI0F 4NPOA 4K4UA 2FPHX 4C3MA 1RYSA 1TKDA 4OZNA 4QR2A 1ZM9A 3EUNA 2HHQA 2O67A 4AD6A 2QE5A 3A1YG 4MKVA 3V5RA 1ZM2A 2IDEA 2W7OA 4BS2A 4V1Ak 3D3BJ 3MM8A 2YNGA 2LQJA 3IR6B 2KVQE 1S7IA 2A6MA 5CAAA 4RKUC 1IR2A 5CABA 2EBGA 2MQOA 4RWXA 2LMIA 5SUHA 1XMQF 5A8KA 3Q86A 2XMTA 3HVWA 3JSBA 1WEYA 2CZ4A 1U45A 4ZCIA 2VQFJ 2I0XA 1DJ0A 4MYUA 4J9SA 1RACB 2IMOA 3EVWA 2VKZG 4KH1B 3TA0A 3CD7A 2W7AA 3IR7B 3ILIA 3GSIA 2CJAA 1S7HA 3N5FA 4FNIA 2Y8WA 4I2PA 3FSYA 4KFBB 2B4UA 3UW1A 3A3OB 3IGVA 4O23A 5HO4A 2P9EA 3CJ5A 2OPQB 1IR1A 4LF6F 4FF4A 1VMBA 1AUDA 2E7WA 3RGIA 1F9EB 3M6UA 2DGUA 1R27B 3RW7A 1MN9A 3CJTA 2CQHA 4CT8A 4LBIA 4YS2A 4OHXA 3D0IE 4XK8C 4ZVHA 1FK9A 1VQPS 1PGZA 1X5SA 3MMCA 4F4ZA 4LFCF 1RTZA 3T6JA 1TK5A 2ZITA 4U7UK 1VYAA 7FDRA 2HGMA 3UN3A 3BGRA 2NXCA 3EM1A 3UFCX 1GTHA 2ZH9A 3CCLS 3CUNA 2VG6A 4NEYA 3DMJA 2ZH5A 5HAOA 2R2TA 1S10A 3PW5A 4KKOA 5HBMA 3OSPA 3ZZTA 3FKBA 3M9OB 2B8QA 2ZBRA 4MFBA 5GAEU 5D3GA 3TJ9A 3MOJB 1TFYA 3K89A 1ZZFA 2X3GA 3THVA 3TEHB 1FE0A 3ILJA 4JOUA 2ZJPQ 5IWAF 1X4CA 1UPMB 3IS9B 4AE5A 5DQHA 2M7SA 2E7XA 3C6TA 1C0TB 1Q1KA 2GIRA 3FSXA 4DX5A 5KFFA 2LP4A 3RR8A 3DRPB 2H51B 3M8QA 1UVKA 4I67A 4FVCA 4C48A 1MMNA 4QOTA 3GIKA 4QIWD 1TV6B 1RWWB 3ISND 4K4WA 1JQGA 1VQKS 4FYYB 1RT6B 3DOMB 2MKKA 5ETVA 4LRBA 3TANA 3SCKE 5KFNA 1D9AA 3SCLE 1KC8T 1PC5A 4OV6A 3MMBA 3BSOA 2GHPA 2ZH2A 2EPIA 1AFIA 1X0PA 3B4DA 4K5RA 2BJEA 4V19J 2VKRA 4ECUA 4HHJA 2R3VA 1HHQA 1ZA2B 4LSZB 1S6PB 2R7WA 2UUCF 2MB0B 1R8PA 2FHKA 2W8KA 3H20A 4HDGA 3H90A 3BV8A 3NRBA 1S72S 4KHMA 1CVJA 1T02A 3I5CA 4L6V3 4OYZA 2XY5A 3BKUA 1UMJA 2AYGA 2AV5A 3KLIA 3D4JA 1U0HA 1FDDA 3AH6A 4DV5J 2C2KB 2CPYA 1UL3A 3DRXA 3CCRS 3SV3A 3OTDA 3D6FB 4NA1A 4RUHA 1XIQA 3JAMU 1FDNA 2NPFA 4Y65A 3W60A 1H7WA 4C6AA 2K3KA 2XS7A 4G65A 1HNXF 1VC5A 3RBXA 4WFAQ 5LSOA 5IC4B 3GILA 1U49A 2G2YA 2R8IA 1UW4A 2EWHA 1QTMA 3VVTA 3AD7C 2VOOA 2RU3A 5KFMA 1OSCA 4ED4A 3QQCD 4DR5J 1S1XB 3GJQB 4ED8A 5KFQA 1X4GA 3WX4A 3P3DA 1X9SA 1FWPA 3MD3A 2NREA 3BKTA 4IDKA 4X62F 3BDEA 1X9MA 4P7TA 3KHLA 1DQAA 1XK8A 4U7UD 3HZGA 4H4MA 1P6TA 1CLFA 3OD2A 3OQ2A 3UVJA 2KYZA 5J2NB 4RNNA 3FEYB 2WONA 2V2KA 4FPRA 3OR2A 4WZMA 5J2MA 3GU0A 1UAWA 2IM3A 3UDEA 4EUVA 4C11A 1M1HA 3EXCX 1CG2A 4DL4A 1Y0HA 2JC0A 1LW0B 3MUTP 2DNNA 1AZSA 3JQJA 4OYOA 1XMOJ 1VRQC 2F40A 2Z58B 3EICA 1GQEA 1RTIB 4DV1J 2OUGA 2HBRB 3PW2A 2VBYA 2EFOA 2QL7B 4USUA 3X1LB 3LOUA 2UUAF 4C4WA 2PEBA 3CGIA 4L73A 4RW8A 4WE1B 4R5PA 4FNHA 2JLEA 2QG9B 4Q0BA 2V4QA 3TZWA 2GJ2A 5LXRA 4MK7A 2G13A 1UETA 4DSFA 1SKUB 1CJKA 3RU0A 4DG1B 4ZPCA 5IM0A 1U6BA 3PV8A 1Q8BA 3MM6A 2Z30B 3CJ3A 2P5VA 3ZTPA 2FD2A 2LDYA 2JEJA 4TYBA 3I31A 2YWFA 2XY6A 2V9WA 1FEEA 4HHUA 3MCMA 5GVQA 3UN5A 5DQGA 2YQ1A 2QMXA 2DHXA 2UUBF 2ZJQQ 5AE2A 5DETA 1N32J 4JV0A 5JJBA 5EGYA 2LFVA 3QT6A 2XLJA 1TK0A 4TU8A 1T05A 2AWZA 2DNOA 5J1PA 1FRLA 1N36F 1ZPWX 3S1TA 1SJFA 3R5AA 4LR9A 1MMLA 1Y5NB 5KFPA 1LWEB 1XNRF 1HQ2A 2DH8A 5L1KA 4WJBA 2MJUA 4PXBA 3IRWP 2LXIA 2DEJA 2GVZB 3VCDA 1HMVA 2B7BB 1WELA 4RU9A 2GVDA 1U2RA 2P2CB 4LR7A 2VQEF 2MZQA 1TMJA 3VAHA 1GMWD 4USTA 2VJUA 3QSIA 2VICA 1TUWA 2KHDA 1WKKA 3IP0A 5K5MA 5GAGI 2J7WA 2OD4A 4KHPF 1T9YA 2Y9HA 4ID5B 3ZTSA 1U1RA 1JLBB 4J9MA 3I0SB 4CLWA 1XTZA 3IM8A 2O1PA 1TU0B 4NCBA 2R7SA 4BLGA 5F8JA 4OL8A 2BQUA 4LREA 1X7VA 1M5OC 3BQ2A 1VQ9S 4ZCKA 4ZPWR 1LK7A 2OPSA 2MYFA 1I94F 3UCUP 4PUOA 3PKMA 3NLCA 3PFOA 3O2IA 5K14A 5C24B 2JC1A 4BC9A 4GKJJ 3MECA 1M5KC 3PRDA 4LF4J 3R8YA 4O3RA 2HQFA 2DPIA 4CLUA 1ZYQA 2E9TA 4Q2LA 1IUJA 4TY9A 2EFNA 3KG4A 4ED0A 1RT1B 5D8HB 1BXNA 1HL6A 2FLLA 2WOMB 1PBUA 3OXGA 3DU6A 5L1IA 3DKDA 3P8BB 4USWA 3V2UC 1KRPA 3Q83A 5GMDA 1Q5VA 1XNQJ 1S0NA 2D3ZA 5B0AA 2C3OA 4WFBQ 5D0RA 1NK9A 1UJ4A 2FZKB 1FCAA 4UOHA 1W2BR 1M5VC 3CJ0A 3PO4A 4NX9A 2VV5A 1RT7A 4GRSA 1H98A 1RBAA 3HX9A 2VOPA 1UEVA 1HNWJ 3MCNA 2WB4A 4EZ9A 4ZLNA 1HWLA 1U6ZA 2CJYB 5FLXY 5D0EA 4ZKAA 4PG5A 3OUYA 2YNHB 4JV1A 4ED1A 2J76E 3R1HA 2J0XA 2ILZA 1RTHB 1FEHA 3M2VA 2ZFHA 4R8UB 1H38A 1HQUA 4IR9A 5I42B 2DXDA 2C3MA 4P6QA 1FX2A 3DI6B 3NWRA 2JFKA 4FYXB 4DR2F 3GV5B 2FJXA 2F63A 5CA5A 4ZITA 3H4BA 1GXUA 4K4VA 4DBQA 2ATLA 3G82B 1U0SA 4ZN1A 2IM2A 3TQ1A 4IH5A 1OPIA 4NLWA 2KM8C 3GFHA 3M2UB 2ZD1B 2DNPA 4JI7J 2ZZNA 3KMQA 3BH7B 4CRJA 2DHGA 3C6UB 3M1VB 3C46A 1TUGB 2NSBA 4P72A 2PA3A 4WFYA 2R2RA 1HPZB 4RBUA 4ED6A 1QVGR 2E9RX 4J9KA 4QYZJ 3BSNA 4B9VA 1JKHB 4L74A 1O5JA 1RABB 3H2UB 2DBBA 4Y2AA 1S9GB 2XGQA 4CH0S 3OJUA 3CNQP 5IOLA 1FKPB 3M9MB 2Y0BB 2FIUA 2N7YA 2DJWA 2V0NA 4QW9A 3M32B 3IBWA 4ZPTR 3BDPA 3HFKA 4KFBA 5HVFA 2W2PP 1CC7A 4JP8A 4ZCLA 2L48A 2AEFA 1XMQJ 5HMYA 4IFYB 4O4GB 5GAEI 1OY8A 3EGWB 2AGOA 3J81Y 1R43A 4ZP6A 2GMHA 2IM1A 2BYCA 2BABA 1RHKB 2LCWA 2V6AA 1ZS6A 7AT1B 1W25A 2R42A 4WIQA 3ZO7A 1NPKA 5H9EK 5CYQB 5H9FK 2LLZA 3GV7B 1JLFB 3DHXA 3LF0A 3O1LA 1RI7A 2VBWA 1VOMA 1UVIA 2A18A 3CVKA 1VBXA 3A8IA 2C2OB 2I9SA 3GIRA 1XR5A 2BR0A 1FNXH 1CC8A 4LF6J 4FXVA 4ERDA 3GFYA 4FN5A 3GIJA 4HI2A 4CZCA 3CIMA 2ZHAA 4ZOSA 3KJVB 1N56A 4A47A 1WC6A 1F2HA 2IIHA 3K7RA 5KFCA 4UZBA 4EEYA 1FXDA 5F3ZA 2BRLA 2HVDA 2J5AA 3PX0A 2RIJA 5IT9U 2MSSA 1WUUA 3IS9A 2VL1A 3NY0A 2U1AA 5DM7Q 2QX0A 2DPJA 1OIAA 1R8AA 4LFCJ 1C0TA 2DGSA 1RISA 1YJVA 1U02A 5ETLA 4WU3A 1CQMA 3DRPA 2DH7A 4ELUA 1NO8A 3MTKA 4L75A 1TV6A 2JEFA 1UWBB 2RILA 5DGBA 1H0HB 2HK3A 1RT6A 3DOMA 4GO7X 4DFKA 3MEGB 1P1LA 4Q45A 1WSVA 4CCHA 5EWFA 2NYHA 1VBKA 3DLGB 5LJ5Y 4OX8A 1BY9A 1IKYB 2HQCA 2Y0SD 2R2UA 2AD9A 2XG8A 1LW2B 2FLNA 4ZP9A 3N5BA 1S6PA 2Q1LA 3Q0AA 4IG0B 2AP6A 2B51A 2XWXA 4J9UE 2E5IA 3BO4A 1V3ZA 4ECSA 4F02A 3K59A 2CQ1A 4P7VA 1HWKA 3D66A 1SIZA 4Q8FA 2BANB 5ETOA 2LYVA 4ZP7A 4DPOA 2VPWB 4PWDB 1IVZA 3G6VA 1HD1A 1FJEB 1ELOA 1QTNB 2BRKA 4RBTA 3UD4P 4PXEA 3AJDA 1J5EF 4UOFA 1FDBA 3UR3C 1F9HA 1L3KA 3R7NB 2YWEA 4MKBA 4LF5F 2AKWB 3X3UA 2PMHA 2Y3YA 1JIHA 4OV1A 3LPEA 4OYIA 4O3NA 2J0SD 1B4SA 1KVKA 1D8ZA 3T1YF 4MJKA 4MK8A 1YIJS 3SMZA 4F2RA 4I6AA 2IRYA 1SJ4P 3AJ2A 4F67A 4HH0A 1R0CB 2CPJA 4KO0B 1S1XA 1X9WA 1RT4B 1RP5A 4OJ3A 4KGMA 1YDLA 1MU2B 1WC5A 3PNIA 1EAYC 1TL4A 3Q8RB 1S6OA 1OMSA 3ZZZA 3FNNA 4AQYF 1CEZA 3AOBA 1T8EA 1HD0A 4C8MA 2B9YA 4W4MA 1LXJA 2XB2D 5L9NA 2CQ4A 3TAPA 3QIPB 5J2NA 1IJEB 5HI7A 2E1AA 3G87A 4YR2A 3H8YA 2IJFA 3DGVA 4PPZA 4B3MJ 1JXLA 2QC3A 2O01C 3J7YU 4NLVA 3C3LA 1UVNA 2LECA 5EN1A 3UWTA 2CQCA 2NUHA 2KTQA 2R7QA 3R6GB 2NCKL 3MWBA 2DR5A 4QWEA 3D5MA 1LW0A 1U7LA 1VRTB 3CMAS 1FO1A 1UFWA 1MWZA 4NXNF 4X62J 3A12A 2DD8S 2BBEA 1RTIA 3EPIA 5U47A 3OXFA 2IYIA 4UY8T 3DN9A 4WE1A 5KG1A 2FB0A 1HARA 5DG7A 4OHZA 4CO1A 5T14A 4X4UA 4C2MA 3KLFB 2WHOA 4LVNP 2MKCA 1MW7A 3G71S 4DG1A 3HSGA 1ZM3A 2C1EB 1S0MA 4KTQA 2W2NP 3I6PA 4MT1A 4DFJA 1NHKL 3MPWA 1LWXA 2HSEB 4NWBA 3ZZOA 2GAGC 1X5PA 4FF2A 1N34J 3R5CA 3P45B 4RW4B 1G4CA 2FY8A 1RLCL 2CUYA 2GO9A 3QAEA 3T9ZA 1N0UA 2VPXB 2ATCB 2K2PA 1Z4UA 2UUAJ 2F65A 4KHRA 2XMVA 5DDQC 2Z56B 4ZHRB 1SH2A 2FUG9 2PO4A 2I8EA 4FZVA 3KDOA 3QJLA 3IWNC 4FF1A 3JSRA 5CZVA 4K7QA 1LWEA 2GGPB 3U27A 3WIVA 5C25B 1VFJA 3PJWA 3RBDA 4KY3A 2C3UA 1KHVA 2GVZA 4NASA 2F7VA 5K8OA 5KFUA 1C2PA 1QY7A 1B0TA 3D54A 4LBPA 1N52B 2JSXA 4HHHA 2VH7A 3BGOP 3EMTA 2AGPA 1TKTB 1BMQB 3BB5A 3U1LA 2J8SA 4Q44A 4C8OA 5KT2A 4A8QA 4F4YA 2UUBJ 2E5LJ 4JUZA 4DSIA 1I5OB 4DLGA 2RUSA 5A0YB 2W2OP 1WF0A 5JMNA 4ID5A 4KGVB 1JLBA 3EZ5A 3PYGA 2PIIA 3BKFA 1U6FA 3I0SA 3R97A 3OHBA 1N36J 1QUPA 2IJRA 3EPGA 3UQSA 3DRSB 2VPYB 3J7AN 1U8SA 2FQQB 4K50A 2RH3A 2XCPA 4OI2A 2WRMA 2EK6A 5AXLA 4DV6F 2BZ2A 2GX8A 3VZIA 5C24A 3F56A 3VQTA 4F4XA 3FFIB 5KOWA 2DVIA 4JV2A 5THWA 4JI2F 4NLDA 1GMUA 3DLKB 1SC4B 3K5PA 5E3RA 1MNEA 3KHHA 2BVZA 2HNDB 1RT1A 2LQ5A 1XEZA 2BM1A 2VFSA 3L95X 1N5TA 3NXZA 4BWJA 2WOMA 3PHTA 2P8IA 4IRDA 3UD3P 2CPXA 2UU9F 3CJSA 4FVMA 4NE9C 4IH7A 2W9CB 2RD5C 2JHEA 1LEOA 2C42A 4K5SA 2MLZA 4K4XA 2HFZA 1NK6A 4TYAA 3VZHA 1I94J 4U95A 4JI8J 1NSQA 1QM9A 1Q5YA 3AA9A 2EEYA 1NK7A 3G6XA 4JI6J 2WW4A 2HWIA 2Q66A 2XYPB 1LXNA 2CPDA 4B3OB 1CBKA 3L4BC 2QA4G 5H9EJ 2XI2A 4P74A 4M5IA 4DR1J 5H9FJ 2EC2A 2RVJA 2YNHA 3N79A 4IOAQ 3SV4A 2AF6A 3LUYA 2L9NA 3O5TB 4AXJA 3CC7S 2KDOA 2DGQA 3OL8A 1Q7LB 1RTHA 1VC0A 4QQBA 5I42A 1DQ8A 3Q2TC 3FBBA 2POKA 3SZ2A 3BH6B 1LK5A 1VQ8S 3P6YC 3A13A 1QLNA 3CIZA 4PYDA 1SKWA 3M05A 2KVIA 3G82A 4LRCA 2ZD1A 3T1HF 1S4EA 1FFGB 4E0DA 2M9KA 2CQ2A 1P8GA 3C6UA 4C8NA 3M1VA 2WSCC 2HFUA 3NGKA 1SH0A 1S57A 5M2RA 2IA6A 1NSPA 2HIQA 3PVXA 5E0OA 4ETXA 3IA0A 2EG2A 5JXSA 1JKHA 3FBFA 3PDNA 2QA4S 1S0VA 4WKYA 3CXCR 5CXTA 1BQNB 1U1KA 3TRGA 1SUQB 1S9GA 3M6WA 2FGCA 2PC6A 1Y7PA 5DLGA 2B9EA 3S8SA 4OX9J 4OJ1A 3TARA 3CCQS 1VQNS 3KFWX 2UUTA 4ZVGA 1YRXA 4YR3A 1D3WA 3OV7A 3N9UC 2JEIA 4XIUA 2CG4A 1FKPA 4K0KF 4USIA 2ASDA 1TQLA 3M32A 3DGPB 4NLPA 3NGRA 2E5HA 4CH1A 1RBLA 4LF1A 3PW0A 1JWWA 3M6VA 2V50A 3K57A 2P9GA 3E3XA 1R3NA 1REVB 2DRAA 1JLCB 1K47A 4IFYA 4UF4A 5G0RB 3IN5A 4USJC 4O4GA 1RK8A 2ZC3A 2ZBQA 2RNEA 1KLMB 2MPUA 2QRRA 4A46A 2F8MA 1D9DA 4HYKA 1VQ4S 3SCJE 1BGXT 4CT9A 2VJVA 4RZRA 2DY1A 3F73A 4NRTA 3J7A1 4PRFA 4CWBA 2KM8B 4FP9A 5CYQA 2MZ1A 2UV8G 1JLFA 4UW2A 2OI2A 2OLWA 2HAIA 4B08A 2RAQA 1UZHA 3AHPA 2CFXA 2CZVC 1DTTB 4D3HA 2CXEA 1VS3A 5HQ8A 2DB1A 4HLBA 1FD8A 2PI4A 3KJQB 1JJHA 4DV2F 3KJVA 5D78A 3OTCA 4ANDA 3SFUA 4RW7A 1YWXA 5AJ3F 3W7BA 5D6GA 1SBRA 2HAFA 4ED3A 3CCVS 4DWIA 1Q8LA 2LEAA 2HLUA 5IT0A 5GAHU 4B9UA 1HNVB 1O51A 4JI3F 3BO2A 2DH9A 2C2RA 2R7XA 1TKXA 5GADU 2CNKB 3TP2A 4RNOA 2IMWP 3HSDA 4X65F 2GQCA 2AIRB 2I6WA 1VBYA 1I6JA 1YBAA 1RAEB 1X5TA 4RNMA 3FVYA 1UWBA 4E2FB 2UP1A 4DN0A 4IYQA 3I9ZA 4LRFA 2AT1B 1FI4A 1FXRA 1F1BB 4C98A 2VG5B 3MEGA 3QFHA 4ETZA 3M30B 3KOAA 4YEAA 2DNQA 5T41A 3DLGA 3CMES 5IS2A 3LO3A 4DS5A 1RHQB 1IKYA 4PG4A 1OS5A 1OY6A 1SC1B 1T0TV 1U1OA 1YTYA 3W8PA 4Z37A 4P2XA 2N7CA 4IG0A 3SYZA 3MCSA 1ICEB 5HANA 2DR7A 2LU2A 2DKOB 2OELA 4DV0F 2OH2A 2FVQA 2BANA 4J9RA 4DR6F 4EWTA 2WBRA 3M2RB 2E66A 2HPUA 2V69A 5DQIA 4PWDA 4DHVA 2KJWA 1REGX 3NMAA 2W25A 2QSFA 4CLYA 2EVZA 1FKAF 3ET6B 4YHHJ 4TU7A 3Q24A 1RYRA 3KK1B 5HK4A 2XSFA 3BREA 4KIAA 2ZKUA 3DYAB 3QGGA 5F3TA 4DV3F 4B3TF 2XMMA 4EMDA 4ICLB 2GV1A 5EWEA 1Y3JA 3CF5Q 3NCPA 1VQLS 4F8RA 1EJ7L 2Z0GA 4USKA 1RAFB 2R2SA 1PSDA 3B4MA 3M8RA 1G2EA 2W01A 5J2PA 5EX3A 1SJRA 3TAQA 4OI6A 3EYZA 2W2MP 1RWUA 4KO0A 1TELA 3N6LA 3O8WA 2G9OA 2DRDA 5HQMA 2W2QP 1F5CA 2CQGA 3SXLA 2MY8A 3VF0B 4QJVA 2IVMA 1ULRA 1RT4A 4P2MA 4IOBA 3MUVP 1MU2A 2CKWA 1J5EJ 5BYSA 3HVAA 2BXJA 1UZDA 4ZCMA 1WC0A 1R8HA 3MOZA 1JX4A 1T9XA 3QJJA 5KFSA 3HFVA 3QIPA 2BA9A 3ADAC 2UXBF 1Z2LA 3GIMA 2NPIA 2W9BB 4CM0A 1RWXB 2G0CA 2B3TB 1TP7A 2NS1B 1VR6A 3CEDA 1N48A 2JRSA 2ACMA 3N6NA 2G2OA 6AT1B 2EKYA 3HHNB 2LQBA 2HURA 2F4VF 5E41A 1ZOTA 4M5MA 2E1MC 3K8WA 2QYCA 1VRTA 4K2JA 1YRUA 2ZNYA 2CQDA 4IFVB 3RBZA 3ENQA 4ITSA 4DR4J 4AQYJ 2M8HA 1C4CA 1BWEA 2OEKA 4RWWA 1OQ3A 2VA2A 3G8SA 1DFDA 1YHQS 5EHHA 1DAXA 4I7FB 2QFJA 2EFQA 4M5NA 2ZVSA 1TK8A 3KLFA 3KUEA 1F3VA 2K7KA 4X4QA 1S59A 2WK4A 4X4OA 5AXNA 2JDJA 1S12A 2XEXA 4DQIA 4IO9Q 2K1RB 1FTRA 2JLFA 2LKZA 3BO3A 2AJ4A 4NXNJ 3GE9A 4X4SA 4CLZA 3E8OA 2ZUAA 1DZ5A 4RW4A 4QBUA 4DDFA 2R7TA 2KFNA 2B6AB 4X64F 2Y1IA 3MUMP 5E2QA 2R7OA 4WWSA 4ZHRA 4G1IA 3IGNA 4I1TA 3BZQA 2BJ3A 4TY8B 4W90B 4XO0A 1VK8A 3P96A 3V6DB 3TJ8A 4C0BA 2NR0A 4Q43A 4DV7F 4J90A 5C25A 1B7YB 2W7PA 2BE2B 4U8YA 3CJ4A 1VQSA 1NH7A 3EDQB 4QYRA 4QU6A 5IT4A 1L3TA 1RWOB 3WX8A 1JNRB 2ADCA 4BDPA 3OXLA 1TKTA 3LA0A 2OFGX 2AJQA 4UY85 2JWNA 2XMAA 1T3NA 1M90T 5A0YA 4DS4A 2D41A 2CPIA 2Z8QA 1NU4A 3PHEA 1RSCA 2PD1A 1FNOA 1WOOA 5KG3A 1TAUA 2IAJB 4LMZA 5F9LA 4OX7A 1FVQA 2D3UA 1J5OB 3DRSA 3VTIA 2E29A 3GONA 1QVFR 3AA8A 1T9VA 2HBYB 3R9LA 2KT3A 3JTPA 1L3VA 3ZNUA 3VAGA 1A0OB 2V4RA 1U8WA 4LSLB 4CNZA 3R5BA 2DY9A 2CDQA 2VBXA 3FFIA 5HL7Q 4PKDB 2V8VA 1BHNA 1PKUA 3A8EA 1SL1A 3DLKA 4NXMJ 4O3QA 2HNDA 3HLUA 3HT0A 1IQTA 3KG1A 3KDNA 3PEHA 2RF2B 2N82B 3IG1B 3ZTRA 1IBMF 3R27A 3LANA 1SJQA 1D09B 2HBQB 3HMJG 5DM6Q 2RSQA 3ONQA 3O3LA 1VBZA 3SQOP 2LA6A 2W9CA 3BR8A 2PSZA 2OHDA 4B9TA 4JI5F 4F0KA 4PXDA 3BN4A 1N0VC 3KXDA 3DDNA 1X60A 1IBKF 5ETQA 3BQ0A 3MF5A 2IM0A 3FCVA 4ZVEA 4JI2J 2AEMA 2DO4A 4ZA1A 2EC0A 1YJTA 3MEEB 1RU1A 3QZ8A 4B3OA 3GCXP 3LW5C 4ES2A 1IBLF 1KEKA 2R8JA 2PMWA 3IMQJ 1GTEA 3PRBA 1LNQA 5A8RB 3H5SA 3MFIA 3E01B 4DL3A 3W9HA 2XS2A 2OSRA 3HULA 3PO5A 4ENOA 5AE1A 1KSPA 3WC0A 2ZM6F 3B82A 3I4HX 2ZEJA 3OVSA 1NJYA 3EZUA 4KE5A 4I4BA 3WHIA 4ZJOA 4WFXA 1UFLA 3FRYA 4OYXA 5F0WA 3ENVA 5AXMA 4X66F 1N54B 5KG7A 2HVHA 4GKKF 3S01A 5KFWA 1HBMB 2XLKA 3OSNA 2OD6A 2A6OA 3B78A 4DUTA 1WJ9A 5F8NA 2ZDPA 4C8YA 4WU2A 4PG7A 3DRRA 3AJ1A 4QIVA 3TR5A 3VGVA 1DURA 4KBIA 1HBUB 2QIFA 2MLXA 5KFAA 2GMJA 4N77A 1BQNA 1MWYA 2GO8A 3OR1B 1SUQA 4FYWB 4ZN3A 4DPWA 4F4KA 4OHVA 2VD3A 2JEGA 1WACA 2HRUA 5LMUF 2H5JB 3QT7A 1GAOA 4I56A 1LFPA 3U7JA 3TYTA 1SQGA 2O3DA 2XTJP 2FYXA 4CLFA 5IV3A 1FRHA 3DGPA 4NLUA 5KFEA 3T1HJ 3H42A 2L08A 3TW0A 3GFZA 4NRUA 2K7JA 4F0HA 4DR7J 2HKEA 1N5VA 5JUMA 1Q8KA 4I2QB 1X31C 3B54A 1REVA 4GC7A 5A76A 1GT8A 4GMKA 1JLCA 1A9NB 4C8LA 5I4MA 1E6YA 2DGTA 5G0RA 4NLXA 2PE8A 1HNZJ 4O3OA 4N5SA 2IRUA 2FVPA 1KR4A 3OFGA 1KLMA 3SCIE 1VIOA 4N8OA 1PBAA 2DNMA 1NJIT 2F8EX 3ZNJ1 2ZE2B 4CLKA 1F5AA 1BQMB 2JVRA 1JJ2R 1Y5LB 2XLIA 3FCWA 5GAHI 3R3TA 1HI0P 4LFAJ 4DF4A 3SEOA 2R8GA 3OHAA 1CSJA 1IBCB 4K0KJ 5GADI 1VQ5S 2HGNA 1RCXB 1S1WB 3BPDA 1V3SA 3QT8A 1N5SA 1XN9A 4P2FA 2HG4A 4AUKA 5ADZA 3GYXB 1FHTA 4OI0A 4MIAA 3DLEB 3IWLA 3HPOA 1DTTA 2XYHB 3TZXA 3RRKA 4WXOA 1KQGB 3KLGB 4LFBJ 1XBWA 1YGYA 2RQMA 3ILLA 4UT4A 3AFGA 5HLFB 1OPZA 2W24A 2GJIA 4DL6A 1RAGB 4M8LA 2K8GA 4DL0C 3KTQA 2UXCF 5DZ7A 3OVAA 4U7CA 1HNVA 3L09A 4M5HA 1R7IA 3OFHA 3K5MA 2EFGA 4WFNQ 1RQ0A 4F26A 1WC1A 1RAJA 2E44A 5F41A 2EK1A 2UXDF 4URSA 3MFHA 2MQQA 4A8YA 2ZOGA 3ZTQA 3DXBA 1XERA 3MR6A 4WP8A 1OYDA 1UVMA 2DISA 2PT0A 2HEKA 2HS0A 3NOGA 3J7Z5 4CO4A 4AL5A 2ZH4A 1ZAWA 1FJ7A 2CQIA 2VG5A 3GG0A 1QAXA 1N5YB 3M30A 5D4PA 3PACA 3GWCA 2HWTA 3GG1A 3IAM9 2HYIB 3RW6A 3T5HA 5KFDA 1F2GA 4FKXA 4X65J 5HP1B 3HVTB 3KKFA 1DHMA 1R6YA 4DXLA 3BJYA 3D6MB 3BS9A 2VFRA 3D28A 3M2RA 3TO8A 2Y1JA 4J9LA 2V4JB 2QGFB 5B09A 2HZVA 2HHWA 3W64A 1NB2A 4RW6B 2FHOB 2HHHJ 5KFBA 3QMQA 4WP9A 4TQSA 3ET6A 4OMFG 1T95A 3V6KA 1RA6A 2VF3A 2GMLA 3KK1A 2B4OA 2F4FA 2G0IA 2YWHA 1F0XA 3Q8YA 3DYAA 1G1XA 1FRIA 4MYTA 1KKHA 4KR0B 4ICLA 5BJRA 2X51A 2F5GA 4QWDA 1NH8A 4RUCA 2BEFA 3W3SA 4LT6A 3V4MA 4I64A 4WKRA 2CYYA 1RT5B 3AODA 2GS8A 2HHSA 1DLOB 3QWPA 3J81U 3K5OA 5DLFA 1C0UB 5DG9A 4G1QB 2QTWA 3I4PA 4DL7A 2RS2A 2GHVC 2EXUA 4JV5F 2VZ9A 4USVA 1E6VB 3I56S 2VQFF 4A8MP 4DSJA 1VCTA 1WTBA 4I6WA 2CVEA 5L8RC 3R1LA 1Y4ZB 4CH7A 2IJNA 3N28A 1WG5A 3TUZC 1LOUA 2J9CA 4QYZK 1JLQA 1NMEB 5FDLB 4DV3J 3P4UB 1NXIA 4B3TJ 1PO6A 1Q95G 2M70A 5DZ6A 5HMXA 1C4AA 2CWKA 2W9BA 5KTQA 3UCZP 5LMNF 2KL8A 2YX7A 4OZ0A 1KQSR 2XZDB 5M2PA 1FRKA 3DXSX 1YBUA 3I0RB 5B7WA 2XSJB 5K20B 3A3PB 1D0EA 1IM4A 5D4NA 4FYDA 5CHCB 2GA7A 3BBFA 4IFVA 3OL6A 2EBEA 3R2CJ 3OLBA 2FVRA 2V2QA 2R9LA 4NYOA 4OZJA 4WYWA 2HNYB 4IO1A 2MQLA 4LQ3A 4DX7A 4RLEA 3JB9k 1MSWD 4HDHA 1KP6A 4I7FA 3DDKA 4DZ6A 4ILMA 5DDOC 4H4KC 2DTJA 5CD4A 4Y2KA 5L46A 4JI4J 3KLVA 1TL3B 2GIQA 2UVVA 2N3OA 2K1RA 4X4NA 1FK9B 4Y28C 2LEBA 3H2VE 4KV8B 4F50A 5KFTA 4RNHA 2NLWA 4DLEA 2MZTA 4RNFA 3IXQA 1HI8A 2IBKA 2ADBA 2B6AA 4B3RF 1Y11A 4NMLA 2C2NA 3PTWA 5KG2A 2RUGA 5FJ4A 1RBOB 1MWQA 2Q3PA 3RB3A 3JSMB 2RB7A 2RRAA 1WG4A 3GFXA 1QUVA 1LV5A 4TY8A 3T6BA 3V6DA 2C2ZB 1RWVB 3MZIA 4LF2A 3W2WB 1YJNS 1UTAA 2BE2A 2DHSA 4NLSA 3POTB 2ZH1A 4Z7YA 3CT9A 5CYMB 3T3FA 3ENAA 3RAQA 4P73A 4JB8B 2KG1A 1PJ6A 1U09A 2WVEA 2VONA 2VG7B 2HHXA 1G6BA 2RHQB 2CVIA 1VQYA 4X2BA 3Q22A 2D69A 5IZHA 4J5OA 2CJKA 1S9EB 1AW0A 1SV5B 2MKJA 2KXNB 3VQSA 3N0VA 4WIIA 4J9NA 2ZBCA 2GNKA 2BJ9A 5E7OB 2IAJA 4DV5F 2PFFB 1J5OA 4DV7J 3NOCA 2BW2A 4NLYA 1SQFA 2HVZA 2QYGA 4OIXA 4DPXA 1FFSB 4RO0A 3FBCA 3UR0A 2YX1A 4ECRA 2O5DA 2AW0A 4LSLA 4DV4J 5LL6d 4DUZJ 2OKQA 3LP2B 5C2CA 2DNKA 1OQ6A 1N5QA 1SC3B 4DR5F 2ROPA 2WSFC 5L38A 2VFVA 3CDWA 2KHCA 1RZMA 1KQFB 1U1LA 2RF2A 5EUHA 1PILA 1NM2A 3IG1A 2J6TA 5A8WB 4LF9F 2CQPA 1YKWA 2D3O1 5RUBA 1YJUA 1H3DA 2ZWOA 3QBCA 4IOCQ 5I3UB 3ICLA 4LUBA 1PAUB 3TVYA 3IO1A 2R4FA 4KB7A 1CJUB 1RHRB 1B99A 1N33J 2IYGA 3NL0A 2IC3B 2DGXA 3BSAA 4YB5A 4KPYA 3DLBA 1KOOA 1X5OA 4QPTA 2SXLA 1RAOA 2J0QD 3MEEA 3K8VA 5H1SV 3W1YC 4M5DB 1XMOF 3H40A 2DK2A 5KFVA 1VDHA 1IBMJ 3OL7A 3VAMA 2DT9A 3VGUA 4DV1F 3MURP 4ZVUB 1FRJA 4XAKA 3S7RA 5A8RA 2GFFA 4JI1F 4GVBB 2E9ZA 3E01A 1N4LA 5ETTA 1RAAB 3NAHA 2NQPA 5KFZA 3RBEA 4Y34A 3CW2C 1U1MA 5D0GA 1SB6A 2QL9B 1FWKA 1FWLA 5LT5A 4L72B 4CM2A 2QMWA 4FKYA 2JFDA 4F3MA 1SL0A 3NBPB 4KH0B 3OL9A 3BGLA 1AZSB 1HBMA 4CI0B 2COLA 2I1RA 4CLSA 1VISA 3ISZA 1X4FA 2X1FA 4LF7J 4Y6IA 1TL1B 4C7QA 3HD2A 3RZAA 3OTOJ 4X84A 1CJVB 1TKZB 4PG8A 2APOA 1UW9A 1TVRB 4C97A 4FS2A 1HBUA 2DGVA 4DQQA 1UWAA 1A6LA 2Z4PA 3Q89A 3OR1A 4W98A 4YY3J 3QZ7A 4KPCA 1GK8A 1KQKA 3E2EA 1V3RA 2MDAA 3CDEA 1ITPA 3C15B 2ZVIA 4X66J 1KTVA 1Q7YT 4GKKJ 3M8ZA 1T03A 1SH3A 2QT7A 2Q6CA 3CD5A 4UUXA 2QN6B 4I2QA 3VALA 4CTAB 3W66A 4EZ6A 4AFFA 3NG8A 3NGDA 3DM2B 4OLPA 3I9V9 3LGHA 1CPZA 5M2UA 3ZXWA 2B0GA 3PR4A 4F04B 2PGCA 2YKOA 1K0TA 1B0VA 3EZOA 2ZE2A 2V94A 4E98A 1WKLA 1Q78A 3TWZA 5LMUJ 1HLWA 4NYZA 2WSEC 4HR2A 4A8WA 3RR7A 3G86A 2DNYA 1WKJA 3A8KA 2ZHOA 2ZC4A 2AJ2A 3THPA 1R6VA 1WI8A 1S1WA 1RTDB 1IWAA 1HQEB 4GKJF 2FHJA 3LTOA 3DLEA 2VPZB 4LF4F 1JMTA
chains in the Genus database with same CATH topology
4IYQA 2XY5A 3I9ZA 2RRNA 3KLGA 1UMJA 2MSTA 3QAUA 4FF3A 2AYGA 2AV5A 4MAKA 3KLIA 1FXRA 5HLFA 2HHPA 2NUUG 4C98A 1FDDA 3AH6A 3UI3A 2VG5B 3PFEA 3MEGA 4RU2A 4HH1A 2IVFB 4XPEA 4ETZA 2RRBA 3M30B 4Q7AA 4QPXA 3KOAA 4YEAA 1FE4A 2DNQA 3ENWA 5T41A 1B64A 2BQ3A 2CPYA 3CB4A 3DLGA 3C2PA 1UL3A 3CMES 3DRXA 5IS2A 3CCRS 3SV3A 2QO3A 3OTDA 3PX6A 3LO3A 4IRKA 4DS5A 4W92B 1IKYA 4NA1A 4RUHA 1K0VA 4PG4A 1OS5A 1FDNA 2VODA 2E1RA 2YNFB 1D1UA 4DR3F 2D1CA 2RQKA 2NPFA 1IKWB 3MTJA 4Y65A 3G96A 3LWLA 1H7WA 2DIUA 2K3KA 3KNGA 1U1OA 2XS7A 1YTYA 4Z37A 1HNXF 3FCHA 4A48A 1XNQF 2N7CA 4IG0A 1VC5A 1MROB 4WFAQ 3SYZA 3MCSA 5LSOA 4N47A 3EXYA 2ZH3A 3CDBA 2DR7A 1G3OA 3TAMB 5MAOA 3GILA 2LU2A 1U49A 4ELTA 5DG8A 4DV0F 2GCFA 4LIRA 4U67Q 2OH2A 5DO2A 3QPIA 2R8IA 1HNIB 2FVQA 1UW4A 2BANA 2EWHA 4J9RA 3TOQA 6FD1A 1QTMA 2D7SA 4DR6F 2VOOA 4EWTA 2RU3A 2WBRA 3M2RB 2WB1D 2E66A 2KKHA 2HPUA 4X4VA 2CQ3A 5DQIA 2UVUA 1SC6A 1OSCA 5KFMA 4PWDA 4DHVA 2KJWA 1S1XB 4ED8A 1M5PC 5KFQA 4OX6A 2YY3A 1WHVA 1LWCB 1X4GA 2XMJA 3NMAA 2W25A 1RTJB 5DS7A 3T9NA 3GIIA 2QSFA 3P3DA 3WX4A 3O6QA 4NXMF 1X9SA 1Y3KA 3MD3A 1Q16B 2NREA 4IDKA 2EVZA 4X62F 4MIBA 1FKAF 3BDEA 4QW8A 4TU7A 3Q24A 1N5YA 4N56A 1RYRA 3KK1B 3MAQA 1R31A 2HHVA 1VRUB 1X9MA 2XSFA 4IRCA 3BREA 4P7TA 4KIAA 2ZKUA 3DYAB 3QGGA 5F3TA 1FJCA 4DV3F 2XMWA 1DQAA 3ITHA 5KFXA 1XK8A 3KHLA 2IVYA 4U6PA 3DOKB 4B3TF 3DOLA 2XMMA 3NWGA 5HMWA 3HZGA 2OPQA 4H4MA 2KN4A 5HN0A 2HVIA 4ICLB 5I3QA 4BBYA 2GV1A 3B8HA 5EWEA 1P6TA 1Y3JA 2DGOA 3NCPA 3OQ2A 3CF5Q 1VQLS 4F8RA 5KFYA 4WK1A 2KYZA 2Z0GA 2R7RA 2YNIA 1HW9A 3CDUA 5J2NB 4RNNA 1L3UA 2R2SA 1PSDA 5HP1A 3B4MA 3FEYB 2WONA 3M8RA 3FGVA 3HVTA 1D8YA 1X4DA 4E8UA 1G2EA 2V2KA 1SQEA 3FJ2A 4FPRA 3FRZA 5J2PA 3OR2A 5EX3A 3NCRA 4WZMA 1SJRA 2VC1A 3MGJA 5J2MA 3TAQA 1UAWA 4OI6A 1S77D 4DL2A 3EYZA 2JLGA 2IM3A 1T7PA 4EUVA 5F9NA 1RWUA 2E5JA 4C11A 3DNCA 5BR8F 3LQVA 1XR6A 2P9CA 3N6LA 4KO0A 3EXCX 3O8WA 4M94A 1JB0C 2V4JA 1EP4B 2G9OA 1CG2A 2HQIA 2PN6A 4RW6A 1F5CA 4DL4A 2CQGA 3SXLA 4ZVFA 2H5EA 2MY8A 5KG0A 1Y0HA 3VF0B 3KHGA 1L3SA 4QJVA 1H6KX 2JC0A 3ZZ0A 2IVMA 4MKAA 1LW0B 1ULRA 1RT4A 2ABYA 4OJHA 2DR8A 2HNZA 4IOBA 2DNNA 5C42B 3DLJA 3ETOA 1MU2A 3WDOA 3MUVP 3MUTP 1Q82T 1QAJA 2FHJD 3AQOA 4NL5A 2CKWA 5BYSA 1YJRA 2F40A 2BXJA 3HVAA 3MM9B 4ZCMA 1KONA 2YH0A 3PM9A 2NXUA 1GQEA 4PG6A 1RTIB 4XDCA 4HL9A 1NEEA 4A8OA 1R8HA 3PW2A 3HKWA 4JI7F 3MOZA 2F1FA 2VBYA 1JX4A 2EFOA 2M52A 5A6PA 2X1BA 1FF2A 1DARA 3QJJA 5KFSA 3X1LB 1HBOB 3LOUA 3JYTB 4CO3A 2UUAF 3QIPA 4C4WA 2BA9A 2UXBF 3CGIA 1Z2LA 2Z2MA 3GIMA 2W9AA 2NPIA 2W9BB 4I6YA 3H25A 4RW8A 4WE1B 4R5PA 4M95A 3Q2SC 2G0CA 2JLEA 4FNHA 1RT5A 4UQGA 1S48A 4Q0BA 3P5TL 2B3TB 2V4QA 1DLOA 3MM5B 3MHYA 1TP7A 2GJ2A 2NS1B 3CEDA 3RYLA 1S1VB 4MK7A 5LXRA 1N48A 4BCAA 2JRSA 2KB2A 2G13A 3DU5A 1UETA 4DSFA 4F25A 1Q53A 3N6NA 4CNYA 1C0UA 5KG6A 4G1QA 3RU0A 4DG1B 1HHSA 4ZPCA 2XULA 5IM0A 1U6BA 3PV8A 3IRXB 2EKYA 1Q8BA 1X4BA 1KOHA 3MM6A 4OHWA 3CJ3A 3HHNB 2LQBA 3D1QA 3GB0A 2F4VF 5E41A 5IQ6A 1ZOTA 1E6VA 2E1MC 3K8WA 3VAFA 2QYCA 2GC8A 2J9DE 1VRTA 4QZVB 1YRUA 2P5VA 1S1UA 2ZNYA 3CCTA 2FD2A 2CQDA 1VI7A 4DMZA 4QR0A 5E3QA 2LDYA 2JEJA 4TYBA 2KFYA 3CCMS 3I31A 2RKIB 4IFVB 4QIFA 4IQXA 1SKRA 4K4YA 1GXTA 2YWFA 3ENQA 1IKVB 3CC2S 2XY6A 1HBNA 2V9WA 1FEEA 4ITSA 1Q4RA 3G6ES 5GVQA 1T3OA 3CD0A 2M8HA 5FDLA 3RRGA 1O8BA 5DQGA 4PXCA 2MGZB 2FC9A 2QMXA 4H4OA 2DHXA 2UUBF 1C4CA 5AE2A 2ZJQQ 1BWEA 2ROGA 4RWWA 1OQ3A 2VA2A 5DETA 3G8SA 3TI0A 3RB4A 1VQ6S 1DFDA 2Q6BA 1YHQS 4JV0A 1Z1ZA 3G8TA 5EHHA 1DAXA 2UZAA 2OMLA 4I7FB 2QFJA 5KFRA 5JJBA 2EFQA 1HWIA 1F60B 1ZBTA 2A10A 2JJ4D 2ZVSA 2DITA 5EGYA 1TK8A 3QGHA 3DRYA 2XLJA 1TK0A 4TU8A 1T05A 2AWZA 2DNOA 3KLFA 2BUNA 5J1PA 2ZBIA 1FRLA 2W4DA 2K7KA 1N36F 1ZPWX 3S1TA 1SJFA 3R5AA 4X4QA 4M63A 2WK4A 4QIGA 1MMLA 1Y5NB 2C3YA 3I0RA 5KFPA 2VC0A 1LWEB 1XNRF 3TVZA 2XSJA 4X4OA 2DH8A 5L1KA 4WJBA 3D1HA 2MJUA 2RMLA 5AXNA 2JDJA 2L3MA 5D77A 4PXBA 1N88A 4DUYF 2JOQA 3IRWP 2XEXA 2NSCA 3H59A 2YH1A 2LXIA 2VUGA 4DQIA 2YKMA 2ASLA 4IO9Q 2K1RB 1FTRA 3WZ0A 2JLFA 2XC9A 3LGMA 5J1EB 1XC9A 4ECXA 2LKZA 2FJVA 3VCDA 3BO3A 1HMVA 1G7CB 4NCAA 2AJ4A 2B7BB 3GE9A 2CQ0A 4X4SA 4EO8A 1WELA 4RU9A 3E8OA 5A2QY 4YB6A 4M1KA 1D9FA 1U2RA 5CD4H 1DZ5A 4RW4A 4XPCA 4QBUA 3K5LA 3GSDA 1QAIA 4DDFA 2R7TA 2VQEF 4NA3A 2HNYA 4ZLPA 1H2VZ 2KFNA 2MZQA 2B6AB 2MXYA 5CH7B 1FERA 2M88A 4X64F 3KLHB 5B0BA 3MM7B 1RJJA 3VAHA 2HQ3A 2BJDA 2Y1IA 3FMWA 2CRLA 4DR7F 3FEXB 2M2BA 1Q8IA 2KHDA 3MUMP 2PI5A 5E2QA 2H9ZA 2R7OA 1C1CB 4ZHRA 5KAKA 3MI7X 5K5MA 2ZOFA 4RX6A 5GAGI 4G1IA 2J7WA 2OD4A 3IGNA 4IH6A 4GC6A 4I1TA 3BZQA 3DRRB 4KHPF 2V9KA 2QLWA 4ID5B 4TY8B 1IXKA 2J8AA 4W90B 3IAS9 4XO0A 1VK8A 3P96A 1HNZF 1U1RA 1JLBB 1VQ7S 4J9MA 3V6DB 4Y3CA 4J9OA 3I0SB 1XTZA 4C0BA 1P9QC 2O1PA 2NR0A 4Q43A 4NCBA 2R7SA 1WG1A 5D4OA 1FESA 4DV7F 1JJ4A 1TL3A 1DQ9A 5F8JA 1YQHA 4HTIA 3V4IB 3PJXA 2BQUA 4OL8A 1X7VA 3TX8A 3GV8B 4MH8A 5C25A 3KK2A 1M5OC 1TZ0A 2DGWA 3BQ2A 2HW3A 1VQ9S 4ZCKA 3J80Y 1DBDA 2W7PA 1UVJA 3CSKA 2BE2B 3OFFA 5HROB 3RTVA 4EBCA 4QR1A 4ZPWR 3CJ4A 1LK7A 2OPSA 1KD1T 4KV8A 1VQSA 1NH7A 1QSLA 4TQRA 1L5UA 3LGNA 2MYFA 3W2VB 2LEPA 1I94F 4DSKA 1U1QA 3UCUP 4LFAF 4PUOA 4QYRA 4QU6A 4EU0A 1JNZB 2DIVA 2Q79A 2FLOA 5IT4A 1L3TA 3PKMA 3NLCA 1JNRB 3PFOA 2ADCA 3H5XA 4BDPA 3OXLA 1TKTA 3O2IA 4IG3A 5K14A 3CJKB 1RKJA 5C24B 2JC1A 3I96A 4BC9A 1N6QB 2OFGX 4QWCA 2AJQA 2DNLA 4UY85 3MECA 1M5KC 3PRDA 2JWNA 3RB0A 4B3SF 1NAQA 1T3NA 4O44B 2HS3A 4RW9B 4O3RA 2D9PA 2DPIA 1ZYQA 2AJ0A 2KRRA 1M90T 2E9TA 4R0EA 5A0YA 4DS4A 2D41A 4Q2LA 5BYQA 5KOXA 3QLHB 4YMEA 3JSMA 2CPIA 4ECZA 2Z8QA 1NU4A 1IUJA 2HZCA 4TY9A 4HKQA 4LFBF 3S6EA 2EFNA 2V5HG 3PHEA 2HGLA 3WC2A 3KG4A 4ED0A 1RT1B 3D0GE 2PD1A 1FNOA 1E6YB 5AE3A 4MKYA 4KAIA 4NZ7A 5D8HB 4TLRA 3BQ1A 5KG3A 1TAUA 3U1MA 2KU7A 3UNGC 2IAJB 1HL6A 2CPFA 1QJHA 2FLLA 4LMZA 5F9LA 4OX7A 1FVQA 2WOMB 3PIPQ 2D3UA 4WYLA 3OXGA 2MQMA 1NHVA 3DU6A 5F8GA 1J5OB 3FZBA 5L1IA 3W2WA 3DRSA 3HT3A 5IT9Y 3TUJC 3VTIA 3SSSA 2E29A 3KNAA 1QVFR 3AA8A 3V2UC 1KRPA 3RRHA 3POTA 4P2SA 1LWFA 3AB4B 5CYMA 1Q86T 1S0NA 3FEZA 2D3ZA 5B0AA 2KT3A 1JLEA 2C3OA 3JTPA 1L3VA 4PR6A 4WFZA 4WFBQ 3VAGA 4OI1A 2V4RA 1NK9A 5KFHA 1WEXA 4LSLB 1UJ4A 1MMDA 4CNZA 4PQUB 2AGQA 2VG7A 3R5BA 1FCAA 2MHEA 4YQWA 1NKEA 2CDQA 2VBXA 1W2BR 1URNA 4Q8EA 3FFIA 5HL7Q 1DTQA 1M5VC 2FJDB 4C9DA 2AX0A 3CCZA 5MLCV 3T5JA 4PKDB 3CJ0A 3PO4A 2FTRA 2V8VA 4NX9A 2HHTA 2VV5A 4O4RA 3HHLC 1RT7A 3A8EA 1SL1A 2MKIA 1H2TZ 3DLKA 1H98A 1S9EA 1KNZA 1SV5A 3HX9A 3M8SA 1ZZNA 1FTCA 3LAKA 2YTCA 2FJAB 3QO9A 2UVWA 4O3QA 4URGA 3HZEA 2HNDA 3HLUA 4OJGA 2VOPA 1JK9B 4IKAA 1UEVA 4ES1A 4KRWA 1IQTA 3KG1A 2RDIA 3MM8B 3PEHA 4DQPA 2RF2B 2WB4A 3M9NB 2YNGB 1HA1A 5F8LA 2N82B 3IG1B 1NK0A 6FDRA 4EZ9A 1IBMF 3CDAA 1Q81T 3R27A 3LANA 1HWLA 2CJBA 1SJQA 1U6ZA 4PWUA 3HMJG 5DM6Q 3MPVA 5FLXY 5D4LA 2CPZA 4ZKAA 2RSQA 3ONQA 2OIHA 3O3LA 2I5JB 1FKOA 1VBZA 2BOPA 4LSNB 4PG5A 5EDWA 4DOZA 2YNHB 3OUYA 2LA6A 4JV1A 2W9CA 1HFEL 3BR8A 2PSZA 1ZAVA 3OTEA 4ED1A 2Q43A 4B9TA 2J76E 1F5BA 4JI5F 1QE1A 1JLGA 3R1HA 4MIWA 2J0XA 2ILZA 1RTHB 5A8KB 1FEHA 3M2VA 2QZ8A 4G1PA 5KT5A 2ZFHA 4J9QA 4R8UB 4PXDA 1HQUA 5JVGQ 1H38A 4IR9A 3BGFA 3BN4A 3MEKA 1YI2S 2MQPA 1N0VC 5I42B 2YKQA 4Q5VA 4K2XA 2C3MA 4P6QA 2LA4A 2FC8A 3DDNA 2N4DA 3LP2A 1IBKF 4ID8A 4EYIB 5T7LB 1NK5A 4X4RA 3DI6B 2AX1A 2JFKA 3UDLA 3ZZUA 3OPKA 3BQ0A 1S99A 4DR2F 3GV5B 3MF5A 1HWUA 5EX0A 1KS2A 2FJXA 5L1JA 2IM0A 5CA5A 4HI1A 4ZVEA 1ZTTA 5CQGA 1ZPVA 2DO4A 3H4BA 4ZA1A 1GXUA 4K4VA 2EC0A 2HHHF 1BD6A 4DBQA 1YJTA 3T1AA 3US5A 3QYYA 3MEEB 2ATLA 2W4PA 3DLHA 4ES3A 3CCUS 3MR3A 3QZ8A 2IM2A 4DQSA 3TQ1A 2C2DA 3OJSA 2YKAA 1ZAXA 3JTNA 4IH5A 1OPIA 4NLWA 2KM8C 4B3OA 3GFHA 5A8WA 3M2UB 2ZD1B 2DNPA 3KMSA 4K4SA 2ACYA 4I2PB 1Y5IB 2ZDOA 1FVSA 1YG0A 2ZZNA 5J2QA 3EGNA 3LW5C 2J9DA 2OAUA 2XNQA 3DC2A 4ES2A 3KMQA 2DHGA 3C6UB 3M1VB 1IBLF 1Q79A 2B9WA 3LP1B 3C46A 1KEKA 2ZHBA 2R8JA 2NSBA 4HVZA 5SZTA 3Q8SB 2KRBA 5I3UA 2PA3A 4WFYA 1KLNA 3PRBA 1GTEA 2R2RA 1HPZB 3BF4A 4RBUA 4ZS6A 4ED6A 1QVGR 5KT7A 3EX7B 2E9RX 4J9KA 4QYZJ 4EBDA 2RQCA 5A8RB 5LXYA 3H5SA 3VR1A 3CE8A 3MEDA</