4CO0A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
109
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
total genus 23
structure length 109
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co0A00
4YB5A 4RLEA 1UKUA 2RD5C 3AA9A 4ZK7M 1Q1KA 3L7PA 4R25A 4YB6A 1UFLA 5D4PA 2DCLA 1O51A 1VHFA 4CO2A 2NUHA 4RX6A 4YB7A 4CO5A 4CNYA 2GW8A 2J9DE 4E98A 1UL3A 4RWXA 2O67A 3AH6A 3GSDA 2GNKA 1P1LA 2XBPA 4C3LA 5DRKA 4CO0A 1QY7A 4WK3A 1NH8A 3AHPA 2O66A 2XG8A 3T9ZA 1GNKA 1J2VA 3TA0A 2GX8A 2E66A 4CO4A 1O5JA 4D3HA 3LF0A 4OZJA 4RWWA 5D4NA 1NZAA 4CO1A 3O5TB 1V9OA 1XK8A 5D4OA 4IYQA 2V5HG 4Y65A 4USJC 2J9CA 4OZLA 3NCPA 4WK1A 3X3UA 1V3SA 1KR4A 2CZ4A 4USIA 4OZNA 1PILA 2JJ4D 3MHYA 2J9EA 3N5BA 1HWUA 2EG2A 4NYPA 1VFJA 1V6HA 2ZOMA 4C3KA 2Z0GA 3TA2A 3CE8A 4D3GA 1V3RA 3NCQA 2XULA 3M05A 2PIIA 4AFFA 3BZQA 5DS7A 1UMJA 1NAQA 3OPKA 4NYOA 4CNZA 1NH7A 2NUUG 4Y6IA 1H3DA 2EG1A 3DFEA 2J9DA 2NS1B 2VD3A 2XZWA 4USHA 5D4LA 3AA8A 1OSCA 2ZFHA 3O8WA 4C3MA 5L9NA 3NCRA 4CO3A 3HLUA 3TA1A
chains in the Genus database with same CATH superfamily
3K17A 1JLBB 4DV1F 2AF6A 2ILYA 4NE9C 2MKHA 4WZMA 3CJSA 1NB2A 3SZ2A 1DQ9A 3RR8A 4A4JA 3CUNA 4IKAA 1P1LA 2XS5A 1S7IA 1WC0A 4B9UA 2IA6A 3ICLA 2HFUA 3HK2A 2QMWA 4NA3A 1X60A 4M5DB 4YP3A 2HNZB 2K3IA 3L95X 5A8RB 1BQMB 3B4MA 1RAIB 5IQ6A 3W9IA 2ZH4A 3QQCD 3V4IA 3U27A 5ETOA 1JLCB 4DS4A 5J2NA 1RT2A 1N34F 4D3GA 5JJBA 2M5YA 4JV2A 2CG4A 4PYDA 3E01A 3KLFB 2DNPA 4NXNF 3TZXA 1CJVB 4L76A 1RWVB 1U2CA 4OYMA 2ZC4A 1WHVA 2XY6A 4JI0J 4BWMA 1CPZA 2HVDA 4LBHA 2HIQA 4U8YA 4YB6A 3QO9B 3A12A 2ZD1A 3HFZB 1FEEA 1FRIA 2C2OB 3AXMA 4CLSA 3GSDA 1SIZA 2VG6A 1S4FA 2ZBPA 4ED2A 5LT5A 3QFHA 2JHEA 2AEMA 1F6TA 4ANEA 2E7WA 3DRSA 2GIFA 3GJSB 2VJUA 3KMSA 2C2NA 3KG0A 1ZH5A 3DLKA 3VQSA 5DQHA 4ZMMA 3EZ5A 3PNIA 6AT1B 3D28A 3MM9A 1S6PA 1ZAXA 4QIFA 2WHOA 5HBMB 2KJWA 3H20A 1B0PA 3QT7A 1VQ5S 1BC6A 3C6TB 3KLEB 4DFPA 1CVJA 4Q43A 2WW4A 1SXLA 5HROB 2HPUA 4KYZA 1RU2A 3ENVA 2L9WA 1SJFA 4YEAA 1G2EA 3VVUA 1HA1A 2X51A 1QE1A 2PI4A 2QMXA 3VVTA 1N0VC 1P8GA 1BLUA 2FHKA 3T19A 2RAQA 4N8OA 5HATA 4JI5J 5H1SV 2GQCA 3NKYA 2OJ3A 4P10A 3MAHA 3U7JA 5J2PB 2IBKA 1XC9A 5JVGQ 2Y8WA 3LUYA 1MWYA 2R7WA 2DISA 3CGIA 4DL4A 1L3TA 3A13A 2J0SD 3HDSA 2E1CA 3X1LB 4QW8A 3H4BA 1F2GA 5AE2A 3AD7C 4NCAA 3SV4A 1Q8KA 1T95A 1W26A 2XCAA 2UP1A 3JAMU 3UN3A 4URSA 2JZ5A 3O2IA 4RUBA 1VJWA 1RAOA 4ZJOA 4ZS6A 3DGPA 3CD7A 1XMBA 3PYFA 4DSJA 2HQDA 4IFYB 3RBZA 5F9NA 1TKXB 3M9NB 3DOMA 3IS9A 2E5JA 1FJGF 1Q1KA 2X1GA 1BY9A 3J7A1 5KFKA 2QMUB 3DDKA 3KXDA 1IR0A 3B54A 5AXMA 4MK9A 3HT0A 2BRKA 2CNOB 3MEDA 3IR5B 1RHJB 3W2WB 4OJHA 2GO8A 2X1BA 1YITS 5F8NA 3POTB 3JSYA 1I94J 3ZFVA 5HLFB 4J90A 2AP6A 2DNHA 2MDAA 2MHEA 1WJ9A 2KM8C 3AB2B 3TZYA 3CTRA 3HP6A 4UW2A 1EETB 4N7TA 1HW8A 1X0PA 5I42B 1N6QA 1S1XB 1OYEA 4QWBA 2X3GA 1VGYA 2CJKA 5F3ZA 1GFWB 1H7XA 3MR5A 3MHYA 2YNGA 3J81Y 3MAAA 3R1LA 1FWKA 1YZ7A 2HZAA 2D3ZA 3HHLC 5J2QB 4NCGB 2DNMA 1JJ4A 3J81j 4EGLA 4RBUA 4TNOA 3HHLA 3HSZA 2VL1A 2RD5C 3MPUB 1H73A 1RT3B 1VBZA 1RB0A 4EK2A 4LR8A 2QA4S 3CCUS 4PPDA 3FMWA 2LCWA 2VG7B 4H4MB 2YNHA 3EMTA 1RHUB 3MI7X 3AJ2A 3HHDA 1V3ZA 1B3TA 3GFYA 4B3MJ 1HD0A 3EVOA 1D3WA 3OXLA 4CLTA 2IVYA 2IYIA 2IM2A 4LSZB 2OEJA 5HJXA 4KKOA 2V6AA 5IOLA 4WK1A 4JI8J 3RW7A 2V4JA 2R2SA 1L3VA 1TR0A 3W9JA 4NMXA 5DQIA 2ZZNA 4OZ2A 2DBBA 1RADB 4CLPA 4HACB 2XWYA 2ZM6F 3JTPA 2BACA 2HK2A 3AJ1A 1IQZA 1SC4B 1JMTA 2AYEA 1PAUB 2GA7A 3AOCA 5IM0B 2RQCA 3GR1A 4OI6A 1N0UA 1S10A 4WE1A 4C11A 4EYIB 4LMZA 5KG0A 4KHMA 3WX8A 4NLGA 2KZMA 1F60B 1J5OA 1FFWB 3G8QA 2XYGB 2EC2A 4GKJJ 1UZDA 3TEGA 5KFZA 1NBEB 2R8KA 1FX2A 1X4DA 2FJDB 3THTA 4DR7F 2IRYA 3UDCA 1QY7A 2MLXA 2O01C 1NJYA 2B9WA 5KFXA 2GX8A 3T3FA 4A47A 4ES2A 5KFVA 4AQYJ 2J7UA 4OHYA 1TTHB 2DVIA 3H2LA 5B0GA 1VQOS 4Y34A 2IA0A 4C0BA 1JX4A 2EKNA 3NAIA 3BH6B 3ENWA 2K7JA 2OKQA 1PIEA 1RAGB 4W92B 4L3NA 5AT1B 2HNDB 4OX7A 2UVVA 3W5ZA 4RPFA 4U9RA 3MOJB 2ZH8A 5LJ5Y 1CJKB 3NNHA 3ET6A 2NXUA 3M30B 2E1RA 1ZOTA 5CQGA 5GAGI 2H9ZA 3CJ8A 5ETKA 3H98A 2I9SA 1CJUB 1RLDA 3Q8PB 3ETMA 2HVZA 4WIQA 4F4YA 4UOGA 2FDNA 1LQ9A 4ED4A 1BGXT 4DSLA 4ZVOB 1S48A 4CO2A 4CO5A 3DHWC 5GAGU 2YKNB 1UA1A 3N9UC 4B9LA 4KQZA 4TKTA 3LF0A 1DFDA 4MKBA 3FQLA 2B4PA 5GMEA 3OL8A 4F25A 2XGQA 2XCPA 2ZBCA 1ACMB 2MQNA 4OI3A 5C24A 2F40A 5KFMA 1S6QA 3QIPB 1FT8A 3CW2C 2KI2A 1MWQA 3D66A 2ZVSA 1Q7LB 2MYFA 3AD8C 2YKOA 1LWEB 1WF0A 2EK1A 2OELA 3DKDA 1CQMA 2DXEA 2R9LA 4LRAA 4FN5A 1HNXJ 1RCXB 1XJWB 2JEGA 3N28A 4C4WA 1FE4A 1YG0A 4F7VA 2EKYA 4I67A 3TZZA 3IG1A 2D3O1 2G2ZA 2KXHA 2WONA 1FF2A 8AT1B 4CZCA 2XNRA 1WEXA 2RUSA 1NK6A 2UXCJ 1T9WA 1N8RT 4X84A 4RBVA 2CIMA 4JYAJ 5FD1A 2WVFA 1XMOJ 3LPYA 2R2UA 3SV3A 2VF3A 4CO4A 4AD6A 4DPWA 1HNZF 4LF8J 1S9EB 4PR6A 1MU2A 1WG5A 3I4PA 2A3JA 1JK9B 1UJ6A 4CQ1A 1S1TA 3H42A 1RA7A 2YPZA 1FKPA 4X65F 4OYOA 1VI7A 5D0RA 2ATCB 2QA2A 5KTQA 3TJAA 1D8YA 3M4XA 1LKZA 1AB8A 2MQLA 4DX8H 4OYPA 1HR0J 1U2FA 3LOUA 2FY1A 2H5EA 2N4CA 1R8BA 1WG4A 3CXCR 4CT8A 2HGMA 1YBAA 4KFBA 2CDQA 2A2DA 4DQQA 2MY8A 2BDPA 3R97A 2JFDA 1EP4A 3R5DA 3OTDA 1VBXA 1Y00A 2E7VA 3FRZA 4LIWA 1Y3KA 3FGVA 4IH6A 1FX4A 1J5EJ 1RAFB 1RU1A 1SL2A 1ZZFA 1T9VA 3A3NB 2OTJS 1QAXA 2UXBJ 2UUAJ 3OUYA 4LT6A 1V9OA 1KLMA 1U25A 4AYBD 2HLTA 4LFAJ 2JH3A 3VAFA 2AJ2A 2BRLA 3ILJA 3OV7A 3MM5B 2CFXA 5L38A 3HULA 4PYAA 1WHWA 1N5QA 1Q5YA 4I4BA 1BD6A 2LXFA 1WHXA 3HVRA 4CNZA 5LSOA 4OLOA 1WELA 2OGUA 4DX7A 3I4HX 4ETZA 1KEKA 2V8HA 4ALZA 2B4VA 1RTJA 3AFGA 1SQFA 1RE1B 2QN6B 4LSLB 2YNFA 3NNCA 2CXEA 2ZJQQ 1FK9B 1R0AA 2IC3B 1H74A 4FP9A 2CQBA 1S77D 4Z37A 1RWKB 1H98A 3JSBA 5LOQA 2I5JB 2ROGA 3NMRA 2JDJA 4USKA 1Q86T 1HHSA 3FSYA 5CAAA 2PMWA 2DR6A 2YTCA 4NCBA 2NSBA 1FFGB 2J7KA 4ECZA 4LVNP 3MR3A 2K7KA 4P52A 5CCLA 2SXLA 2ADCA 2C3UA 2CYYA 1Q7YT 1N5YA 2RS8A 1JLAB 1EQMA 4ILMA 3PRVA 1WF2A 3PCOB 4ANDA 3Q2SC 3DLEA 4JOUA 5DS7A 1S99A 4DR5J 2QYCA 1RKJA 2XHWA 1NEEA 3I6PA 4DL6A 2UU9F 1MROB 1YBUA 4ICLB 4M5JA 1C4AA 4WKRA 4RU2A 2HS0A 3W62A 3BSCA 2MY7A 3RBEA 3I56S 2FVRA 2B7CB 1JXVA 4PG4A 3SCJE 2HWIA 2VBWA 4U95A 4MIAA 4TXSA 5LL6d 4G3IA 2G4BA 5C5JA 1AFIA 3D3CJ 3W8PA 1NDLA 4HH0A 3BREA 3FCVA 2HFSA 5K20B 1LW2A 5JMNA 3DLBA 1XNQJ 3OFEA 4JI7J 1SBRA 3D2WA 1B64A 1PBAA 4WWSA 4DSEA 3CMAS 1ZAVA 3QFWA 2BM0A 4Y2KA 4OX9F 4I69A 2PA3A 3ZTOA 4DLGA 5K8MA 3SI8A 2BQ3A 4ZHRB 4MAKA 3SSQA 2B5JA 1HBUA 4AL6A 3FBCA 4U7UD 2ZBRA 2XZTB 1DHMA 1S1UB 1UZHA 2X7IA 2HZVA 1WC5A 3PXGa 3GFXA 5CD4A 1UKUA 3ZZYA 2E9ZA 3ZTPA 4DV1J 4ZVSB 3MMAA 3QGHA 1A7GE 4M5HA 5EWEA 2E9RX 2N3OA 1F9HA 3WIUA 2EI5A 2BKPA 4ZCMA 2J9DE 2YVSA 3K58A 1DARA 3AH6A 1QAJA 4B3TF 4R8UB 1JQGA 5E7OB 1WWHA 3M8YA 5KG3A 1UW9A 2XO6A 2Q66A 1VHIA 3D67A 5HI7A 1KFDA 3H90A 1QAIA 2B9XA 2MSSA 1PO6A 1S7HA 1Y5NB 1UVNA 1IKVA 2DNGA 1KDNA 3M6XA 3AJDA 3R9LA 4P2FA 1KTVA 4DUZF 1RUSA 4FF2A 2RIJA 1REVB 2AV5A 3UCUP 1N34J 2XMAA 3CO9A 1X5TA 2XYPB 5FLXU 4NXNJ 3MCMA 4GO7X 4RW9B 4OYBA 3PKYA 5KFBA 3FVYA 4F4ZA 2ZNZA 4L72B 2H4WB 4RKUC 2V69A 5IT9U 4N8NA 4ZK7M 4Z7YA 3OL6A 4DQPA 1AA1B 4E0DA 1ZA1B 3R7NB 1S9GA 2K1RA 1M5HA 2BKNA 5KFWA 2ZKTA 1SUQB 1RAJA 2V2ZA 1LFWA 3LPEA 4NLDA 4CTAA 2LQ9A 4NLUA 2NYIA 2Q3PA 5CZXA 4Q0BA 4ED8A 4ECWA 2HMIA 5EN1A 2VASA 4A8KA 3CULA 1P1TA 4YUDA 1TL7A 4FF4A 2Y1LB 2HVHA 3MR2A 1UWBA 1U8WA 1SQEA 2BYCA 2A10A 1T03A 1F9FA 4TY8A 4DU7A 1ZZNA 1ZPVA 4KHRA 4BHQA 3IWLA 3M2VB 1UEVA 4LRBA 4U8VA 3TR5A 3D1QA 1EQ0A 5BJRA 2FC8A 1ZA2B 1C1CB 4EWTA 4RW6A 3LP1A 3W2VA 2VBZA 1XR5A 3LANA 1FXDA 3BGRB 3T9NA 1VQ8S 2ADBA 1RDRA 2GV1A 2YXLA 4IRKA 2JL9A 3G96A 1NSQA 3GV5B 1SC1B 4J5OA 2BANA 2P9EA 2HWHA 3TQEA 3KJQB 3LTOA 2UUBF 2M52A 5FIIA 4MFBA 5T7LA 2B8QA 4RZRA 1CLFA 3CDEA 3KWMA 2XG8A 2M2BA 1FVQA 2EK6A 5HMYA 2DNRA 3IC1A 3BSOA 4OI0A 1XK8A 4LREA 4N76A 2HHHF 1KVIA 1JKHA 3JSMA 8RUCA 1F3VA 3GIRA 3T5KA 3C14A 2CPXA 4DL2A 1S4EA 1F2HA 2AJFE 1JLBA 2J9EA 5DETA 3K5LA 1Y3JA 4J9UE 2I8EA 2OLWA 1R27B 5KFUA 5RUBA 2YWKA 4R0EA 5K8NA 2J9DA 2QG9B 2R4FA 4A46A 1XN9A 4WFAQ 4O4GB 4P75A 2QO3A 1M0SA 4RLEA 3GONA 1FJGJ 4K4WA 1NB7A 1F5CA 1NUEA 3NS5A 1IKWA 2DYAA 2AGPA 4WYWA 1NRKA 3CDWA 5KOXA 3BQ0A 1BQMA 4Y28C 1HNIB 1R0BG 2HW3A 1RTIB 2I6WA 1T05B 4LRFA 2DXDA 3DM2B 4OYXA 1M1KT 3J80Y 2R7XA 1PYSB 1RZMA 1RAEB 1EKSA 3IWXA 3QJLA 2OD6A 4DR3F 3MMCB 3T1YF 3RJMB 3DRRB 1ZAWA 2ZITA 2WSCC 1FEHA 3OTCA 2CQ3A 3IXQA 3AOAA 2I2YA 3X3UA 3VGUA 2HKEA 4ES1A 5H9EJ 1VBKA 4WYLA 3QO9A 1NNDA 2YKPA 4M95A 2V63A 1BWVA 1KS2A 4GVLA 1MLAA 1EAYC 3OT9A 3TVKA 2YQ1A 5KG5A 1Q8BA 2JVRA 4UUXA 1D9DA 4DCPB 1ZPWX 3E3XA 2UVUA 2MSTA 4MK7A 3MM7B 1RT7B 2F4VF 2B9EA 1KKHA 4XPEA 2C2MB 4DPUA 3FEXB 3SCIE 1DRZA 1X5PA 3TP2A 1T9YA 2JSXA 2YWHA 2A6MA 2YH0A 3I31A 2XGPA 2XM3A 3MWBA 2OPSB 1EB0A 4KO0B 3MEGB 4DF4A 3NOCA 3LP0A 3C6TA 3QWPA 5SZTA 2K3KA 4Y2IA 1NSPA 1RWUA 3CCTA 5HROA 1DTQB 5IWAF 2AW0A 4P72A 1VRTB 3QT6A 2RKIA 1KQSR 1FRJA 2M8HA 2Y0BB 2V4QA 4PCQA 2ZM6J 4IOCQ 2BUNA 4QU7A 3G8TA 3CE8A 2W8LA 4UY85 4KB7A 5B7WA 3M8SA 1NAQA 2GQ2A 3ELHA 2EBEA 2I1RA 2VODA 3GV8B 2VD3A 3EDQB 2BZ2A 1TV6B 3NBPB 4W90B 3GFHA 1VQ6S 4N5SA 1UFLA 4G1PA 1HPZB 5KG2A 5HAOA 2U2FA 2FLLA 1YJ7A 2RU3A 5I3UB 4ZVRB 2WK4A 2DGSA 4DR7J 5LJ3Y 1PC4A 4RUHA 4XIUA 3I0RA 4PUOB 2PO4A 3NGDA 1ULRA 5DLFA 2Z56B 3OL9A 2P6TA 2KL8A 2LEPA 5HMZA 2J9CA 3LW5C 5E41A 4CLKA 1H0HB 4EI2A 1QSSA 3CD6S 3GPAA 4UF4A 5C42B 2DH9A 4CH7A 2AZ3A 2PIIA 4DUYF 3UE2A 1TL3B 5HL7Q 2D69A 3LO3A 3VAIA 4DQRA 2P2CB 3BDPA 5D8HB 1F9EB 4F3QA 3VGVA 2DO4A 1OSCA 2WBRA 4TY9A 2FHJD 3FCHA 1U8SA 3I32A 3POTA 3UDEA 3PJWA 1U48A 2FVQA 4OX6A 1C1BA 2RE1A 5I42A 4CLUA 5F8JA 3VWSA 2J0XA 4X4QA 2DCUB 2GNKA 1SI9A 4H4OB 2VFVA 1LOUA 2XI2A 4A8YA 5G4DA 1NMEB 1K1QA 1NPPA 4O3NA 5KFHA 2YWGA 4H4KC 3I87A 3U1LA 1X9SA 2RF2B 4AL7A 4Y2AA 3B4DA 4NCGA 2MZTA 1DZ5A 4H4KA 4CLWA 4ATNA 2WB1D 2PDAA 4I6YA 4NA1A 1PJ6A 3KHHA 3H7HB 1QM9A 4OZNA 1NU4A 3BKFA 1UJ5A 2VFSA 2KDOA 5KG4A 2FZCB 1WUUA 2VG7A 4H4MA 4O0NA 5IV3A 4G1QB 4DJBA 1SL1A 1SJRA 3JB9k 3G2XA 4ZPTR 5F3TA 5F8HA 3BYPA 4OI4A 4JV0A 4LF1A 4NZ7A 2GC8A 4BBYA 2KRRA 1Z2ZA 4URQU 2LDIA 4QR1A 5LM7E 3W60A 4LIRA 4B3RF 1RWPB 1IKYA 5LXYA 4N77A 1X0FA 3M6VA 1WI8A 5F0UA 4IQXA 3GG1A 4HACA 1HNZJ 4B02A 1X4EA 2CJ9A 2GVDA 3FZ2A 5H9EK 3HSJA 2VC1A 1EHWA 3IR7B 4PQUA 1RWWB 5IZHA 1S59A 3V5RA 3J81U 4X65J 3G4SS 1N33F 4AUKA 1HWLA 4C8MA 4U96A 4JI3F 3ZO7A 4PEOA 1T94A 1HHTP 4ID5A 1DY3A 2DR9A 3FRYA 2OSRA 4LVOP 4HYKA 1MMLA 4J9KA 2A6OA 4CLFA 4DFMA 3EWGA 1D9AA 2XMKA 1ELOA 3DMJB 2LECA 1YRXA 5GMDA 5IS2A 2XI3A 4RNOA 3VALA 3NS6A 4JP8A 2HHXA 3GV7B 2UVWA 2LQJA 3CWJA 3EVWA 3OXFA 2GZOA 2PA8D 5L9XA 4V1Ak 1TL4A 1S79A 2HNDA 5DRKA 1WEZA 2VUGA 3HSGA 4IDKB 1CJKA 1U1QA 2DGUA 1HWKA 1YI2S 2R7RA 1NSKL 2HNYB 2EEYA 1OWXA 3KK2B 2HQ3A 4I0WA 2Z4PA 2JFKA 2JEFA 5HANA 2WVCA 4IYQA 4PAAA 3OJUA 3BR9A 1OPZA 3VR1A 4USJC 4USMA 1NK0A 1FTCA 2OTLS 3QRRA 3PX6A 2W2QP 4OZ5A 2M7SA 3V81B 2R7QA 4XDDA 5LSLA 3TX8A 2CAJA 4MK8A 4OJGA 1S72S 4KV8B 2ZZMA 3H8YA 2B6AA 3CCJS 4DG1A 1SJQA 1BQNA 2XZWA 1HD1A 3CT9A 4L6V3 3DU5A 1UEKA 2V4RA 3JQMA 4J9MA 1HI8A 4DI6A 5J2MB 1Q16B 1BXNA 5T41A 5KFDA 1RABB 2DH8A 3E8OA 1P9YA 2RVJA 4GVBB 2QFIA 3RB4A 3HHEA 1FD2A 4ILLA 1LWEA 4F67A 2F5GA 4YN3B 4FYDA 2QSWA 5AE1A 1NZAA 3M9MB 3J7ZT 4OZ3A 3QNWB 1TK8A 5HO4A 5G0RB 3LWLA 2QGFB 3H5YA 2ZE2B 1U0HB 2YWEA 3Q86A 2DJWA 2X1AA 1S12A 4K8RA 1YK9A 4K5SA 1VQ7S 4QYZJ 1UVMA 4MH8A 1URNA 2DGTA 2DNNA 2HS4A 3TUZC 1NH7A 1VOMA 4ZP7A 1Z1ZA 3PFOA 2OD4A 2WTFA 5IQQA 2BJ1A 2UU9J 3PYDA 2LKZA 2QA1A 4FZVA 2Z58B 1FDAA 4DX6A 4J9RA 2NR0A 2XHCA 3W3SA 2V9WA 1X5SA 3K57A 2NUHA 2KN4A 2BEFA 2GMJA 4FXVA 2ALZA 3MCOA 4U67Q 3R7BB 3TWZA 3FBEA 3DXSX 1YHQS 3TRGA 4NXMF 2FTRA 4ZPCA 2GAGC 3M2UA 2OH2A 1U7LA 2ZHBA 2E66A 2IBOA 1RTHB 2WAQD 5ETNA 2VA3A 5J1EA 3PZPA 4K4XA 2V5HG 3QSIA 4ZVQB 3R2DJ 2F3JA 2FGOA 3GILA 4OX9J 1NJWA 3WHIA 4RNNA 2IRUA 4KAIA 3BYRA 1Y9OA 4E8UA 2BW7A 1ZTWA 2HURA 2GHVC 4KSEB 1RYRA 2BE2A 3A8IA 1REGX 4UZBA 1JLGB 1FESA 3BB5A 4DSIA 2FJWA 1HBMB 4MJKA 1FI4A 3L7PA 3M1VA 3CIZA 2BM1A 4RX6A 1G6BA 5ETTA 3NGSA 3KJFB 2FPHX 3P96A 4B3TJ 2PFFB 3MM5A 3CDBA 2R7SA 4CO0A 5THWA 3MF5A 2XLIA 4J7CA 4UQGA 1QSLA 1Q53A 4AXJA 4EZ6A 3MD1A 4F3MA 1LW0B 3FFIA 3KHGA 2ACYA 1WD6A 2D1CA 2GHPA 3ITHA 5F41A 1KHWA 1XEZA 4DFKA 1GEHA 3PY8A 3T6JA 4LSLA 5F8IA 2HIYA 4LF7F 4UQTA 3UN5A 5L46A 4ED3A 3ZC4A 2PI5A 1UTAA 2IMOA 1G4CA 4C3KA 4DUZJ 1U47A 3G9CA 2WSEC 3CCES 2DY9A 3BGOP 5D6GA 2LA4A 4R5PB 3RZAA 4X4SA 2LVWA 2JX2A 3OPKA 2X3DA 1U2RA 2DHGA 2G1HA 4LFCF 3OFHA 4USWA 1TFWA 3ISZA 4C98A 3PW2A 3ZNUA 3H2VE 2MB0B 5DQGA 3W65A 2CWXA 3CVKA 4MMOA 2BE7D 5M2UA 1YGYA 3D0GE 3Q89A 2O67A 1HFEL 1UA0A 4RNMA 1CULB 3IBFB 3UNYA 3N79A 4CRJA 1GXLA 3FK4A 1VK8A 2FYXA 1SV5B 3HVWA 1K0TA 4MYTA 2AIRB 1WHYA 5KG6A 1YJTA 2MKSA 1HR0F 2CZ9A 1BMQB 4K4YA 3ETOA 3MD3A 4ICLA 1S1VA 3G82A 5GADI 5FLXY 3SIPB 3BGFA 1MMDA 2CJAA 3TA2A 2HBZB 3C2PA 4GC7A 2DHSA 2V2QA 3SFUA 4I68A 1RT1A 4NEYA 3BBBA 4EMDA 5IT9Y 1L3UA 1VQ4S 3CJQA 4FF3A 2RQKA 4HT5A 5GADU 1KBRA 4C8LA 4H54A 3R8YA 5LMNF 5F8GA 2RT3A 1GT8A 1IUJA 5BXIA 4XO0A 3OW2R 1JJ2R 3KFWX 4Y0FA 2FJBB 2J0WA 2CPDA 4CH1A 2UUBJ 1K44A 3G6ES 2DR5A 1Q5VA 4UTGA 2OPQA 4LFAF 2IY5B 3P5TL 4RW8A 1QD1A 1FNXH 3V4IB 3BO3A 4FYYB 4ZHRA 3IMQJ 4ZA1A 5J2NB 1RT2B 2OEMA 4XTTA 2FB0A 1RT4A 2Q6BA 3CJ3A 2OUGA 3E01B 2HHHJ 2B4UA 1FKAF 2X1FA 1S1UA 4OHWA 2MZSA 5M2PA 2R7VA 3Q8RB 3Q2TC 1YJUA 1FVSA 2FQQB 4OHVA 2V2VA 1UPPA 2ZD1B 1UFKA 1VQMS 4C8OA 4R8UA 3CSKA 2QL5B 3TW0A 4Z7CA 2HS3A 2M70A 2Q6CA 2W7AA 3CCQS 2UVRA 2KT3A 2Z8QA 2YX7A 3KDNA 4AE5A 3DRSB 2DIUA 2ZJPQ 2DTJA 2QA4G 2BA9A 5HN0A 2V8VA 4P2SA 4A8XA 2XS7A 4BLGA 3DLKB 2FLPA 3KOAA 3C66A 2ZWPA 2JC1A 2D9PA 3ILOA 3LAMA 2VFRA 2ZEJA 1S6PB 3D68A 2MQ8A 3W9HA 4KGZB 1M1HA 4C2MA 4CO1A 1RT6A 4DR3J 4DX5A 3T1YJ 2L08A 3C6UA 1YJVA 2R7TA 4FYWB 1GXUA 1CG2A 2ZDPA 3BN7A 3MR6A 3AY0A 2ILZA 4USTA 1BWEA 4B9NA 4K4SA 2V8DA 5ETVA 1JJHA 1RBOB 1YSJA 2XMJA 2KYXA 2HHQA 3QRPA 2RMLA 2B56A 1KOHA 1QE1B 4QYRA 3QGGA 1KD1T 1K73T 3I82A 4IG0A 4DV7F 3T1HF 4QWDA 4NLSA 3CJ4A 3OQ2A 1PG5B 2G0IA 2M0GB 5J1PA 1M1GA 3PHEA 2YKMB 4ENOA 2MZRA 4NZ0A 2F4VJ 2KB2A 5CYQA 1WKJA 2RJZA 4W4MA 4YR3A 1Y7PA 5ADZA 4K0KF 2BJ3A 3GLJA 5JUMA 1HBOA 3TI0A 2ALYB 4F2RA 4R0JA 2ZDOA 3OSPA 1YTYA 5I4MA 1NPKA 2CPZA 1B0TA 1S1WA 4FPIA 4KE5A 3M2VA 2R7OA 2OSQA 4MKAA 1S0VA 3QPIA 3D5MA 3PKMA 3KYLA 1C1CA 2AEFA 5B0EA 4JI6F 4I2QB 1GMWD 4OV1A 2AJQA 4WXWA 1IR1A 3BGRA 1OY9A 3BBFA 5IWAJ 3HVTB 1UCNA 5CD4H 2KJVA 4Q44A 3FUYA 4RBTA 4LFBF 3H0PA 2HEKA 4J9SA 3DGPB 1X9WA 2DO0A 3OR2B 1J27A 3DOMB 3IS9B 3GIJA 3TQ1A 2DB1A 3JTNA 2WVDA 2PSZA 3T6BA 3W63A 2QFJA 4DDFA 2RDDA 5A8KB 2NYHA 4WCEQ 4NWBA 3OFGA 5BR8F 3ZTRA 1GX5A 3NWGA 1P9QC 3GE9A 2H1YA 5E3QA 3R5AA 5DG7A 4A48A 4DV0F 4RW7A 3NY0A 2FHJA 1CJTB 2W2NP 2G2YA 2L9DA 1N6QB 4ECSA 2KM8B 4J9QA 5H9FJ 1P27B 1LK5A 2W7OA 2QLFB 4CYUA 3DOKB 2DEJA 3MM8A 3IM9A 1JLEA 3MAAB 2A2CA 3RU0A 2RH3A 2VDIA 4LQ9A 3O5TB 2BE9B 3T41A 3K8VA 4M5LA 1VBYA 2R8GA 2EFNA 3G86A 2R2TA 4WFBQ 3GFZA 4QOTA 1D8ZA 4WXOA 3TUPA 3I0SB 3DLLQ 3RTVA 1RHKB 4DR1F 3HHLB 1VQPS 4MIBA 2Z0GA 4BC9A 2KYZA 4Y2MA 1PYOB 4DUYJ 2DT9A 2KO1A 3DLJA 5AE3A 1GXTA 1HNIA 1GTEA 4Y6IA 4X66F 2BX6A 2P5VA 2YNHB 1B70B 2CJQA 1FDNA 3DM2A 3G6VA 5CHCB 4FPRA 1VRUA 4ZOSA 2E7XA 1S0OA 5IC4B 1QVGR 3PYGA 2CPEA 1T8EA 3ENQA 3MXHP 3CEDA 2B43A 2W9CA 2V4JB 2BJ9A 4DN9A 2UUTA 4OZJA 2ZH7A 3T5LA 1HQ2A 4CCHA 2B3TB 2MPUA 3KNAA 1JLQA 2NREA 3K0JA 2E44A 1GX6A 3IM8A 2N7YA 1U1NA 2CQ0A 4DV4F 4C11B 4DL5A 2V0NA 1JJCB 2JJ4D 1WOOA 4NLQA 2DD8S 2EXUA 1UEUA 1J5OB 4UOCA 2YNIA 2H65B 4K5RA 2R8HA 2ACMA 1XWLA 3IRXA 2ROEA 4B9SA 2JEJA 5FDLA 3UDLA 1JXEA 1FXRA 1JLFB 4TQSA 3RGIA 3MEGA 1EJ7L 5I3PA 2BKOA 4NYZA 5KFAA 1DJ0A 4IR9A 3LA0A 4B3OA 3KG1A 1DTQA 3W1YC 4CI0B 2H5IB 1TKTB 3KTQA 3QZ8A 2O5DA 4B3RJ 3J80U 5KAKA 1ZBTA 3NXZA 2BJDA 1H2TZ 2IM3A 3ET6B 3JYTB 4ZVEA 2MZ1A 5KG7A 1SL0A 4DR4F 1I6JA 2YQ0A 1HQUA 3D54A 2YX4A 5KFEA 2RU9A 1K1SA 4OZLA 4X4UA 3BQ1A 1FNMA 3QWUA 3QRQA 1RLCL 1T02A 4QIGA 2HHVA 2MEWA 1N33J 1SJ4P 3CNQP 3QGPA 3UNGC 3G6YA 3Q83A 2QLXA 4NYPA 1XMQF 4JI3J 5LSRA 1HPZA 2AX1A 1VK3A 5BYSA 3KHRA 2VPWB 2ASLA 3ZZPA 2CJBA 2HBQB 4J9PA 4PKDB 5KT5A 3GYNA 1F0XA 4MKYA 4ELUA 3ZZUA 5EHHA 2DITA 3NP5A 4LUBA 3P6YC 2RDIA 3MGJA 3QLHA 1TUWA 5C24B 4J91A 1S6QB 4F4WA 3TJ8A 3K59A 1MSWD 5DGAA 2CQGA 4A8MP 4BCAA 4U7CA 5D3GB 4CH0S 3A8EA 3R5CA 2CNLB 1FXLA 1W25A 3PX4A 3PIPQ 4ECRA 1C2PA 1E6YB 4LR9A 3SDEB 3VQTA 4MKVA 4DOZA 5A2QY 3MFIA 3D9BA 5DDOC 2QEXS 1KVJA 2WONB 3EPIA 1FJ7A 1VQLS 3M05A 3BZQA 5CXTA 3KG4A 2F1FA 3OVAA 3VV2B 3C8YA 4KRWA 1IR2A 1Y5LB 5EGYA 1HYSA 4WPAA 2BJ7A 5H9FK 4HLBA 1HQEB 2RF2A 4OZ1A 1RK8A 1MU2B 3D6MB 2LQ5A 1QLNA 4YB7A 2Q43A 1F1BB 2CQ1A 4TLQA 1HMVA 2E9TA 3OSNA 1IM4A 3A4TA 1UETA 1S1TB 1HIYA 4C0OC 2F9JA 1FKPB 3M2RA 1RISA 1GNKA 3N6NA 3NEKA 2CUYA 1HWIA 4G1QA 5HMWA 3PW7A 3BQ2A 3CF5Q 2V67A 1M5SA 2G0JA 3QSYB 3AQPA 4KFBB 3SCKE 3AQOA 3D4JA 1N36F 2W2MP 1DLOB 1X4HA 1NJZA 3FBBA 2IMWP 4ZVGA 5DG9A 2LU1A 4TYAA 2QL7B 2J8AA 3A3PB 2APOA 2DHHA 5HP1A 3C46A 4X4NA 1Q81T 5E3CA 3TARA 1S9FA 1EP4B 3D6TB 2LQBA 2MZQA 1X4GA 3ZTSA 1P6TA 4K4VA 3MZIA 2OPPA 1C0TA 3IGNA 3QJPA 2WOMB 2RQMA 1KWMA 1NLKL 3VGTA 1PC5A 3EDRB 4LF2A 2AYGA 1DAXA 2F8MA 3Q8SB 4JBCA 4CLYA 4ES3A 4EBEA 1N5SA 1AW0A 2DKOB 5DLGA 5D78A 5EDWA 2AU0A 2GW8A 4RL1A 4ZVUB 1VIXA 2CG8A 3BM7A 4OQJA 2B0GA 1NZ8A 2FJAB 4NXMJ 1N5VA 4ZCKA 2O66A 1ZS6A 3Q0AA 3V6KA 2W1BA 2Z2LA 3DNCA 4IH7A 2ZH3A 2KT2A 1SH3A 4UOFA 4YMEA 2W25A 1NDKA 4HKQA 3QZ7A 3WC2A 3M8RA 2J0QD 2QYGA 4LBPA 3NCPA 3VCDA 4RNHA 4WP8A 1RTJB 2D41A 2CQCA 4AT1B 4JB8B 3S8SA 2YNFB 2HVIA 2MJUA 2W7PA 5CH7B 2C22A 1VFJA 4URGA 1TVRB 3UCGA 2RDJA 2B51A 1CSJA 2WCXA 5L8RC 3BV8A 3D7SB 3I5AA 1R7IA 2EFOA 3FZBA 2C2RA 4IDKA 3SXLA 4HH1A 4P2XA 3TAMA 2FJXA 4V19J 3CCLS 2ZH5A 2YBVA 4DV5F 4NZ6A 1M5KC 4WJBA 1XQIA 1N5YB 4B9MA 1KTQA 1TKZA 2CQPA 2G2OA 3UPFA 3CDUA 3V81A 4LBIA 1NK9A 2F63A 4M5NA 3QGIA 4F8RA 3C15B 3DYAA 2EBGA 4DZDA 2VPZB 1KQGB 1I51B 1NDPA 3KJNB 4KV8A 1WACA 1X4AA 3PACA 2ZH2A 3C3LA 3H5XA 2IM1A 3THVA 3KLIA 4GRSA 1DBDA 1HNWF 1IBMF 1RTDA 4LF7J 3I5BA 3O3LA 3MTKA 2QSFA 4KY3A 2LDYA 2EVZA 3JQJA 2NXCA 2NPFA 2OMOA 4J9VA 4NOHA 1EARA 3DRPB 4GVBA 1S57A 1IQTA 3IRWP 5E33A 4ED6A 4G65A 3AD9C 4LFCJ 4KHPF 2QLBB 2IDEA 4P2MA 1WDDA 4WBFA 3W64A 4NI2B 1GK8A 4DMZA 3PR4A 3CD5A 4FF1A 4UOHA 3HM9A 1LW2B 2IFXA 3MR7A 5KOWA 2C1EB 4JI2F 2HZCA 1D09B 1U0HA 4WIIA 1VLOA 1UAWA 5K14A 3HXMA 1MNEA 2MQQA 4X4VA 2E5LF 3QAEA 4K2XA 5D4OA 2B5JB 3PRDA 1HBUB 5LXRA 3V6DA 2DNOA 3NNAA 1NJIT 4QIVA 3H40A 4Q8EA 2YKQA 4ZP8A 3G87A 3KLGB 3HD2A 3M8PA 4DXLA 3N5BA 3UD5A 1ZETA 3MMAB 2KVQE 3ADAC 4RUAA 5K8OA 2IYGA 2W4DA 5C25A 4ZJQA 1AUSL 4KGMA 4ZPVR 4I2PB 4ZP9A 4QPTA 1SQGA 2P8IA 2KKHA 4JI4F 4OL8A 2P9CA 3ISND 5LMNJ 2RSQA 2GO9A 3LP2A 1HW9A 2DGOA 2QLJB 2K2PA 4PWWA 1LWCB 2J76E 1ROFA 3FDSA 4C3LA 1HBNB 4QWCA 4HR2A 4I1TA 3US5A 3PFEA 2XMVA 3CC7S 3ZZ0A 3LALA 1G1XA 2WVBA 1TK5A 3CJRA 1LNQA 3AXKA 4DV3F 1PBUA 2IAJA 4FYXB 4A8SA 3VAGA 2XY7A 1HI1A 2W9BA 1G3OA 2CADA 7AT1B 3OTOF 1PJ5A 3HJFA 4HHHA 2FVSA 2KTQA 4IRDA 1HWJA 4LF4F 1JLGA 3FSIA 1UFWA 3IP0A 2F8EX 2VU5A 1Q8LA 3OLBA 3UVJA 1OPIA 1QUVA 2JWNA 3GMGA 2HAIA 1S9GB 3RAXA 2VPYB 4EBDA 4GMKA 2ZBIA 4BS2A 1SPBP 2GJIA 1PSDA 4QIWD 2JRSA 4M5GA 4M63A 5T14A 4Q0BB 2J6UA 4Y00A 1LW0A 2HMIB 1RSCA 3BEGB 1B7YB 4N47A 3JXOA 4F3OA 4C8ZA 4L75A 4R25A 3GU0A 1TL7B 2XMTA 5KFIA 1ICEB 4X64F 2OAUA 3OD2A 4RUCA 5KFPA 2E5IA 4QU6A 2QRRA 4XDCA 2M88A 2MQOA 3BKTA 1SKRA 4LR7A 4TY8B 2FVPA 3EGVA 1YJRA 4N41A 2AX0A 2OPRA 3HHKA 3W5XA 1U1RA 4L74A 3BPSP 4N56A 1U6ZA 1R89A 2C3PA 4RW6B 3DLGA 2QLWA 3LP1B 3W2VB 3KUEA 4DCOB 4OFZA 2R2RA 1TMJA 1T3OA 1IBKF 2YQ3A 1T7PA 4LRCA 1RHRB 1LWFB 2G1DA 2OFHX 1GMWA 2M8DB 3TJ9A 4DZ6A 3MECB 7FD1A 2C2ZB 3EUNA 3KDOA 1F5BA 5T7LB 4DV7J 3T1HJ 2NZ4A 1CS4A 1MW7A 3KLHB 3O6QA 4GC6A 1IKXA 1FJCA 4F26A 1SV5A 2W2PP 2MGZA 4WFXA 3ZZZA 5B08A 1URRA 4K0KJ 2ZUAA 3MUVP 1UVKA 3HFKA 2KG0A 2RB7A 1JKHB 2F4FA 2UZAA 1VR6A 3PO4A 3C14B 4WFZA 1ZTTA 4ZPAA 4C8NA 4GO5X 1SH0A 2H48B 4A8OA 2ZKUA 3TA0A 2DGVA 4RWWA 5D4NA 5HQ8A 1JXLA 5CYMB 4JI6J 4ZPDA 1HKAA 3LWMA 3ILIA 1WG1A 1VC0A 2YY3A 5K9FA 3IWNC 1FFSB 2AHOB 1VISA 2DNZA 5CABA 4LFBJ 4IH5A 4LQ3A 3TVZA 2M9KA 3RBXA 1WF1A 5A0YA 3SQGB 4OI1A 3J7Z5 3IBWA 1IKWB 3OJSA 4PRFA 1ITPA 2WRMA 3F56A 4USHA 1IJEB 2CKWA 1DTTB 2NSCA 5BR8J 3UCZP 3MCNA 3VAHA 4LSNA 4FBUA 3OVBA 3QT8A 4DV0J 5LMUF 3RB6A 2HRTA 2KZZA 1VRQC 3GJTB 4NMLA 5IT4A 3CJKA 1XNRF 1X5OA 1Q82T 1B4SA 4OLPA 3WZ0A 3NWRA 2HWTA 2CVIA 4ED1A 3M8QB 5HSPA 3UD3P 2MKYA 2E29A 4QWAA 1LV5A 3VAJA 3I9V9 3FBFA 1FKOB 4PXEA 3M9OB 1PAEX 3EXYA 4Y3CA 2KG1A 4FNIA 5F8MA 2FVCA 2CPHA 1B0VA 5DG8A 1RBLA 4WU3A 3S1TA 4O3OA 4O0IA 3MAQA 3EJMA 2MQMA 1RI7A 5B0DA 4DR1J 2J5AA 2H3EB 2RS2A 1WNEA 2P9GA 1NKBA 1AZSA 1GTHA 1RAHB 3P5BP 4X66J 4Q45A 4ZLJA 3MPYA 4HTIA 1RBAA 4OHZA 1NHVA 5DDRC 2VG5A 1S6UA 4K4UA 1KOOA 2Y1RI 4YHHF 1T3NA 1VQKS 3PHTA 1WSRA 3LP0B 4YB1P 3DOLA 3RB3A 3GIMA 4ZN3A 1NKCA 1T11A 1SJ1A 1U1LA 1NDCA 2MKKA 2RKIB 3BS9A 4UUWA 2CZVC 8ATCB 3CB4A 3PEJA 3W61A 3UW1A 4OYWA 4X62F 1FJEB 4NRUA 4NASA 4TQRA 2AJ4A 3KNGA 4NLTA 4PWDB 1UVLA 5A6PA 1Q95G 3OR1A 2YKMA 1CC8A 4WTYA 1K9MT 2QT7A 1VS3A 1H2VZ 4DV4J 3TZWA 3K5MA 2GVZB 3R6LB 5D0HA 3W8GA 4OYZA 4DPTA 3MPVA 3C16A 1LK7A 1AUDA 3FEYB 3VZIA 3MMBA 1WC4A 3DFEA 3J7AN 5A8WA 2XLJA 3F0NA 3MMJA 5J1NA 4X4OA 4ZCIA 3I0RB 2ERRA 2FJEB 3DI6B 2HFVA 3AA9A 2VQFF 4I2QA 2KH9A 2R42A 1M5OC 4IFVB 1O51A 1D0EA 1WC6A 3Q8QB 2V94A 2GJ2A 5BYRA 3UQSA 3HVTA 4I7FB 3VTIA 1I5OB 1SB6A 1XIQA 4P7TA 2B7BB 5D0EA 3OR2A 1J2VA 4WU2A 3Q23A 2FGCA 1Y10A 3U02A 4DR4J 3A8JA 5JVHQ 1AFJA 1T9XA 2RQ4A 1C0UB 2DGQA 1YIJS 1N4LA 1TUGB 5A8KA 2GHWA 2H51B 2R3VA 1LEOA 2U1AA 1NHUA 1XERA 1VDHA 5C7PA 3PEHA 5HMXA 4K50A 3SQOP 3H25A 1XMQJ 1C1BB 3TVYA 2YH1A 1CJTA 1RACB 5DM6Q 2B4OA 4M5DA 2PGCA 2HNZA 1SC6A 5A8RA 3O8WA 3DOKA 2DH7A 1VC6A 3K5PA 4YDXA 4F2SA 3RRGA 2JEIA 1JLCA 1VCTA 2HHPA 1ZM4A 2DCLA 3E2EA 3UD4P 3U1NA 4M5KA 4ED7A 3KLFA 3I0SA 4ANCA 1CJVA 1QSYA 2IRXA 1V5IB 4WK3A 5DJBA 4U6PA 5I3QA 2V8GA 2BABA 4PZVA 3KK1B 1U1KA 5DM7Q 2VHGA 2BQUA 5DZ7A 1RP5A 1U09A 4YR0A 4ZPWR 4I6AA 1YJ9S 3GG0A 1UW4A 2HVEA 2GMLA 4IO9Q 3HPOA 4OMFG 3SCLE 2ROPA 2ASJA 4IR1A 3SSSA 4X2BA 3MFHA 2ZVIA 4MT1A 3P8BB 4J37A 4PWUA 4NX9A 3ZNJ1 1IKYB 3D6HB 4JV5F 3NCRA 3HMJG 1VLYA 2CNKB 2WBMA 2GAHC 3OVSA 2NXJA 3UDVA 3EICA 3EPGA 1GMUA 2GGPB 1QVFR 4MYUA 5HBMA 4ZCLA 1QDUB 1SJ3P 4DCJB 4DV2F 1X4BA 2GCFA 2GVDB 2Q79A 2BOAA 1VIOA 1FWPA 2Z2MA 3KLEA 2PC6A 4PQUB 4ECVA 3NS7B 5CZVA 2ZH9A 1UVIA 1RHQB 2W24A 3JTOA 1B7FA 4FKYA 4FKXA 1FA0A 4QR2A 1S76D 4ID5B 5F0WA 4RU9A 4QIEA 4ERDA 2DPIA 4DUTA 4TYBA 4PG8A 2KXNB 1X31C 2LQ8A 1BE4A 2ZWOA 2W4CA 1OS5A 1JLFA 3VF0B 1N36J 2LXUA 1GH8A 4YQWA 1WEYA 2RRAA 3MURP 1N5TA 3OHBA 3NGKA 2ZC3A 3CJ2A 2FIUA 2HQIA 3BSNA 1VYAA 3NCQA 3TYTA 1TKTA 3DC2A 6FD1A 3UR0A 2VQEF 5J2PA 3L7OA 1UVJA 3N01A 2FHMA 4NLYA 1JNRB 4B9VA 3D3BJ 1QAYA 4KGVB 3QMQA 5B0FA 2C2KB 2VONA 2KFZA 3OHAA 3M8WA 1NO8A 1VQ9S 3JYTA 2XMWA 3EGZA 2KHDA 3KK3B 3H4DA 4PXDA 1MG7A 4ECTA 4IOBA 1KQKA 2K8GA 2AD9A 2LXIA 4WKYA 1VJQA 2WZ1A 5C2GA 2ZH6A 3B82A 2OHDA 1O8BA 2G0CA 1FRLA 2DK2A 1AT1B 2AKWB 4YS2A 2XSFA 4QPXA 4JUZA 1RCOB 4IFYA 1EZZB 1TKXA 3HKWA 1H38A 1Q8IA 1Q78A 4M1KA 3ZZOA 2B6AB 4DG1B 3P49B 4RW4B 1BQNB 5B0AA 3GWCA 1TQLA 2QE5A 3IN5A 4IOAQ 3W2WA 4CP5A 5HLFA 1FD8A 3L7UA 1YJNS 1R8AA 2WB4A 4ITSA 4PQAA 4DEZA 4DN0A 1KNZA 1EETA 3OLAA 2NZCA 3R6GB 9ATCB 5KFYA 2D3OR 1S1XA 3OTEA 4ZP6A 2E1AA 5D3GA 2E1MC 2AYBA 2LLZA 2FY8A 1H6KX 1WKKA 2YKAA 4LF5F 3QYYA 4HTJA 4DV5J 4DSFA 1E6YA 3TUJC 2ZBQA 1YQHA 2QC3A 1CBKA 2KXFA 3CC4S 3SDEA 2GMHA 5J2QA 3MEKA 3GSIA 5FJ4A 4NEZA 3EZUA 3TEHB 2IHR1 1R8HA 1IWAA 2QL9B 3IFEA 1WOPA 5L39A 4B17A 1RT3A 1CC7A 3V2UC 1D9FA 1RKIA 1QJHA 1VQYA 3MEEB 1NK8A 2DNKA 3SSRA 3CD0A 1I3OB 1HNWJ 3HCXA 4K2JA 5BYQA 1IBMJ 2VC0A 5CA5A 1HQEA 5KT4A 2XY5A 2KFNA 2CRLA 4NA2A 3U1MA 1S5ZA 3NG8A 1UMJA 2RNEA 1Q0NA 2NS1B 4B08A 2HHTA 2QX0A 2FZGB 4KHPJ 2W4PA 3KLVA 4QR0A 3BO4A 3M2UB 2YPYA 3FSXA 2MQPA 2V34A 1Q79A 4YY3F 1FRHA 3ISNC 5J1EB 4F4AA 3F44A 3TUIC 1BHNA 1UWAA 2PEHA 4NPOA 2AGOA 4EO8A 5IM0A 4JI2J 1S6OA 3KUHA 1DLOA 4KJIA 2DY1A 4M5MA 4OJ1A 3EXCX 3AHPA 2I38A 3VZHA 2L41A 1HNVB 2E5LJ 2DNYA 1UPMB 2XO7A 4LF6F 4TLRA 2HBRB 3N5FA 1IVZA 2KU7A 2VBYA 3Q22A 1IN0A 4DR6J 4FVMA 2LMIA 1U1OA 2HK3A 2WOMA 1TELA 3CMQA 3RRKA 3O1LA 1WOSA 2BE2B 5A2QU 4EFAC 1E6VB 1U45A 4CWBA 1NK7A 3AT1B 5KFTA 5B0CA 1ZM3A 3PW0A 2MKJA 5KFCA 2ZOMA 4X4RA 2KHCA 2HQGA 4FS2A 3M1VB 4ELVA 5HK4A 2XSJB 4NYOA 4KH0B 2PMZD 3OFFA 4ELTA 3BGUA 2OFGX 2UUCF 4JI4J 1U0SA 3GB0A 1NK5A 4P7VA 1TUVA 1R8PA 4V19X 3FFIB 5DDQC 2XWXA 5D4PA 3M30A 3GJQB 2CA9A 1R6VA 3ITHB 3CO0P 3G71S 4TN2A 1FE0A 3CCSS 4YFUA 4DPOA 3IAS9 1N32F 2B9YA 1WTFA 2ZOFA 1OY6A 2C3OA 3A3OB 1WC1A 1CJUA 1TVRA 4DV3J 1RT5B 5SUHA 4QQBA 1JB0C 2M3DA 4Y2CA 4IO1A 2D74B 3BH7B 2LA6A 3OTOJ 2YKNA 3THPA 2MLYA 3ONQA 2XMMA 5AXKA 1V3SA 4LF4J 2Z57B 1WC3A 2VDHA 3ZTQA 4IG3B 1PILA 3PW4A 2D7SA 3C19A 1HWUA 3KJVB 3UI3A 4AXIA 4TU8A 4DWIA 4RR5A 3RAMA 2XYHB 4NLOA 5MAOA 4FXDA 4O4RA 1OSDA 3QIPA 3R5JB 3C15A 4DL3A 2DIVA 1KRPA 4JV1A 5K8PA 2JLFA 3HZEA 2NQPA 2PMHA 4X64J 1IBLF 1NPRA 4F36A 1LXJA 2OP5A 3M32B 3OTBA 4HI1A 5IC6B 2FHOB 2MKCA 1S1VB 3G82B 2R8JA 4QW9A 3UN2A 4DL0C 4WFNQ 1N88A 3DRPA 2CPJA 4O44B 3R7SB 1RT1B 2HAFA 4ECXA 2HQCA 3NGRA 1RA6A 2J7WA 2NLWA 2VIHA 1IBKJ 1TL1B 1OO0B 1JIHA 5A76A 4NI2A 2EW9A 1T9TA 2OEKA 4K7QA 2HFZA 2RILA 4X4TA 1N56A 2P6SA 3MCSA 4F4XA 1S9EA 5F9LA 2NUUG 4YR2A 1YX2A 2GQQA 4DLEA 4L73A 3D0IE 2OPQB 2AWZA 4RW8B 1LFPA 3H5UA 1TAQA 5GAEI 2AJ1A 1YJWS 3TO8A 3R5GA 2HG4A 4EU0A 4FYVB 1RT4B 1KFSA 2XZDB 4W98A 4DQIA 2UV8G 3AAWB 3MM6B 2W2OP 1TFYA 1R43A 3KLGA 3HF5A 4JI1F 5GAEU 2PFDA 1NCLA 1HI0P 3WQPA 2R8IA 5KFQA 3BO2A 4LF9F 5KFOA 1PKUA 4I2PA 2F7VA 4OV6A 3HX9A 3NLCA 1Q4RA 2ZOGA 2OMLA 3ENAA 2CPYA 3DRYA 1KR4A 4USIA 2UXDF 1NSAA 3ZZRA 1NHKL 2NCKL 2XEXA 1OJ4A 1K0VA 3OL7A 1NJXA 4WF9Q 1LWCA 1O6XA 1HBNA 2ZHAA 7FDRA 3FNNA 2MHNA 3WC0A 3FKBA 2HGLA 1IJFB 4DV6F 1NM2A 1DQAA 3R27A 2MZJA 1YDLA 3RAQA 3KMQA 3A1YG 3AODA 1DQ8A 4DU8A 3PYEA 1RT6B 3C6UB 5LMUJ 1AXQA 4DR2F 3DLHA 3GZ7A 1WORA 2Y8YA 2HSEB 2GS8A 3AOBA 2VFTA 1XNRJ 2L48A 1NH8A 4P71A 5ETMA 3CCZA 2J6SA 1WSVA 4NLPA 2EPIA 3R2CJ 1FK9A 1FO1A 2IC3A 3TAPA 4ZLPA 4NLWA 3CCMS 2I5JA 2DR8A 1UJ4A 4Y65A 4IG0B 3JQKA 1IBCB 5L1JA 2MLZA 3DXBA 4WP3A 2A18A 1U1MA 2CZ4A 2PEBA 3O44A 4ECYA 4MIWA 5CYQB 4EZ9A 3B6BA 1Y5IB 1T0TV 3R5BA 3QT5A 4ZDNA 2HRYA 3K5NA 1HBOB 4YDDB 1KLNA 2GIRA 5EWFA 3BN4A 2RUGA 3MTJA 2DR7A 1JLAA 2ZFHA 2DNLA 4KPYA 1S1WB 4XAKA 2VZ9A 3S7RA 4YHHJ 3GP9A 3E51A 1CQNA 3V6JA 3J7YI 1W2BR 1U24A 1NK4A 4NRTA 2OI2A 1U26A 1GQEA 5DDPC 4ECUA 1LWFA 3WBZA 2LP4A 1MROA 3D0HE 4QZVB 4DHVA 2BJ8A 4X62J 4GKKF 1PGZA 2HBYB 2IJRA 3MECA 5ITHA 3NGTA 3J7YU 3N0VA 5AJ3F 3DDNA 1XBWA 3KLHA 4FS1A 4BWJA 1RWXB 2VBXA 1A0OB 2HYIB 2C28A 3PG9A 3JS9A 4OZ0A 1VMBA 2VA2A 1U6FA 3OXGA 2QV6A 1XTZA 1X7VA 4HT7A 4F04B 4RW7B 1Y4ZB 4KGKA 5E3RA 1Z2LA 2CQHA 3SYZA 4IRCA 3RW6A 1EX8A 4XK8C 3EVMA 4F4KA 3FJ2A 4YB5A 3HD1A 4CYUB 3MM8B 4P73A 3PDNA 1JLEB 1FCAA 5CYMA 2VQFJ 3HI9A 4NLXA 3ULHA 3CCVS 1N52B 2Y3YA 4CNYA 1FDDA 1RQ0A 4AL5A 4QYZK 2VKZG 5ETLA 3TOQA 4Q7AA 3UFCX 2XS2A 1Y11A 3SQGA 3K8WA 5F8LA 4D3HA 2JLEA 3SFGA 1T9UA 5KFNA 2CJYB 2COLA 3DRXA 5B0BA 2Y9HA 1HHQA 3KHLA 2DGWA 1ZYQA 1DTTA 2VG6B 3F73A 3GR0A 1VRUB 1X4CA 2BR0A 2MTLA 3L4BC 4KPCA 4WFYA 3FEZA 2ZJRQ 1I1GA 1HARA 4L3KA 3QIDA 3M8QA 4ZIVA 2W9CB 4ZPBA 3IR6B 1OQ3A 3JAMY 4G1IA 2IPOB 4S0MA 2XTJP 1JNZB 4BC7A 1FKOA 2JLGA 3MM9B 2IJNA 1RWOB 1REVA 3K5OA 2V50A 2WSFC 4KTQA 4HDHA 1JLQB 1SIWB 4EUVA 4RW9A 2XBPA 1QTNB 5E3AA 2O1PA 3VHQA 1CEZA 1OQ6A 3GTYX 1FTRA 2IDLA 5HJYA 1OMSA 2YNIB 4B3SF 2M4MA 3IRXB 1R3NA 3B78A 3MPWA 4RO0A 3BGLA 5FDLB 1SUQA 1OY8A 3L9ZA 2XB2D 3EGNA 5E3PA 2VFUA 1LWXA 1MMNA 4B3OB 5EX3A 3HZGA 4PABA 2KT5A 2VV5A 2V9KA 4ED5A 4JV5J 3B8HA 3IO1A 3TNVA 1O0PA 4DS5A 3F41A 2ABYA 1AYEA 1FRMA 4PG5A 4DV2J 2YWWA 1HQUB 4DSKA 3CJ5A 4KT0C 4PWDA 3S01A 3HFVA 2Y0SD 3OBIA 1UL3A 2DRAA 3EYZA 3T5HA 4F0HA 1HLWA 3DHXA 4ED0A 2HHUA 4KR0B 2CDRB 2AJ0A 2GVZA 2LYVA 2ZH1A 3AB4B 2IJFA 2N4DA 4I64A 2JOQA 3CCWA 5CCMA 4F0KA 1APSA 4KGXB 1GAOA 3VAKA 1S0MA 2FJVA 4NLRA 4ZVFA 3PO5A 3P45B 3MEDB 3DI6A 2AEJA 4EEYA 2WVEA 4O23A 4IUFA 4IFVA 5D0GA 2XULA 4WZQA 3D1HA 4I7FA 2VQEJ 4CM0A 3QJJA 3QLHB 3HT3A 3GCWP 1RAAB 4C97A 3CMES 1W7WA 2Q1LA 2LEAA 2B8PA 4C3MA 3M7VA 4JI0F 2J8SA 2AZ1A 2YNGB 1KONA 1C0UA 5KFGA 2BBEA 3V6HA 1TAUA 1FWLA 3HKZD 2CQDA 1FHTA 1GMVA 2MKIA 3IA0A 1QTMA 1WTBA 4EYHB 4O4GA 5E0OA 2CQIA 3K89A 1PJ7A 3NRBA 2AMCB 2DXFA 1FRKA 3MPDA 4QWEA 2C3YA 1EKRA 2F9DA 1V5VA 2UV8A 1RTIA 4HDGA 3LH2S 1T05A 3ILLA 5D15A 2JNJA 1HYSB 1N48A 2H4YB 3MMCA 2VKRA 3DRRA 2A0FB 2BV3A 1B99A 1U49A 1HMVB 3K2YA 1UP1A 4KKOB 5HQMA 3M2RB 1R31A 4BDPA 3KK1A 1SH2A 4LF5J 4NL5A 5IXUA 1VHFA 5KT7A 2HQFA 4E2FB 5KFSA 1FNOA 4F0MA 2BQRA 2FC9A 1G7CB 3G6XA 1Y0HA 3CJTA 4J9LA 2C2DA 4JI5F 5EX0A 2E5GA 4RJVA 4WE1B 3MM7A 1RT7A 5HP1B 5KFFA 2J6TA 5CYJA 4ER8A 3LQVA 2OPPB 2HLUA 1C0TB 1WDTA 1H72C 2Y1JA 3M6UA 3PV8A 1R6YA 2RRNA 3W5YA 3IAM9 5L1LA 2H54B 4KH1B 2KRBA 2GGPA 3GIIA 2OPSA 3RG6A 1X9MA 2CVEA 4CLLA 3DU6A 4KO0A 1RTZA 3RRHA 3SEOA 4DL7A 2QIFA 4HI2A 2ZUGA 4ZITA 3VAMA 4ZIWA 2MJNA 2W9AA 2MMYA 3JSRA 2EG1A 4X4PA 1U4BA 3BJYA 1VRTA 3P3DA 4C8KA 1XR6A 4Z2XA 3RUBL 2NXEA 1HL6A 1YRTA 4CLZA 4YY3J 4O3RA 1KP6A 1KQFB 2RHQB 3H59A 2IIHA 2VOPA 4WTOB 2HHWA 2DNQA 1YLXA 1RJJA 4HHJA 2F65A 4ZVHA 3L09A 5DGBA 3FMBA 4LRDA 1TV6A 3M8ZA 3NBPA 2DHXA 1I94F 4LF6J 3NMAA 2DEIA 4ZN1A 5E2QA 2VJVA 1Z4UA 1ZM2A 4USUA 5GMKa 2CWKA 4J9NA 1S49A 1YBTA 1YRUA 5I3UA 4K59A 2N7CA 2DPJA 3TAMB 3HHNB 3NAHA 3GJRB 2VICA 3UWTA 3KK3A 4PUOA 1YWXA 3RYLA 5DZ6A 4QCLA 2BVZA 3W7BA 4FDFA 2HGNA 4TU7A 1KC8T 1TKZB 5L1IA 3PTWA 1N54B 5ETPA 3P4UB 2L3MA 5KFLA 3I5CA 3UO0A 4HVZA 2UUCJ 5HVGA 4TU9A 3BSAA 5ETSA 2VB6A 3DYAB 4C0HA 1FERA 5C42A 1TMMA 1X8DA 3R1HA 4M5IA 2QZ8A 4RW4A 4ETXA 1TL3A 4EBCA 2IVMA 4UZCA 5A6WA 4OYAA 3D6FB 3KLIB 1A9NB 1N32J 2HRUA 3RBDA 4OYIA 1RTDB 5L1KA 2EFQA 3CJ0A 4B3MF 2YWFA 4FNHA 3IG1B 3I96A 4HEA9 3H5SA 4H4OA 5IFMA 4JI8F 3PIOQ 1AROP 3Q8VA 1RYSA 3EZOA 2AYMA 4O3QA 4HL9A 2YX1A 4ECQA 4G6VB 3BDEA 3HHLD 5B09A 3KKFA 1VQNS 2XMUA 4NLVA 3QATA 2XC9A 1MWZA 3DDIA 3AA8A 3CCRS 2LU2A 3WX4A 5U47A 5L9NA 2XQCA 1BQXA 5K14B 4PXBA 4KBIA 5HQLA 4K4ZA 2CJXB 3QAUA 4UT4A 1D1UA 4KC5A 2HFOA 2E5HA 3NGUA 2ZNYA 4I56A 2D9OA 1IBLJ 5D77A 3MEEA 1LXNA 2XNQA 4GKJF 3V6DB 1FDBA 2Z2ZA 1M90T 4C9DA 3WIVA 1PYTA 2N3LA 1KSPA 2Z30B 5KFJA 3LAKA 3M8PB 5AXNA 2EWHA 2EFGA 4AQYF 5C25B 3NL0A 2AGQA 3HO1A 3MUMP 3HSDA 4HHUA 2IM0A 3RB0A 2W8KA 3W66A 2H5JB 5IV4A 1R0CB 2DHAA 3DCAA 3LP2B 2DGXA 5KG1A 3OUYB 2POKA 2IVFB 4AFFA 3L3CA 4PPZA 1IM6A 1KLMB 5KFRA 3M6WA 2V68A 4C6AA 4ZKAA 1HNVA 3TA1A 1A6LA 4RNFA 1YZ6A 3WDOA 2IAJB 3CPWR 1RWMB 2JVOA 1TK0A 3S6EA 4PG6A 2VPXB 4OJ3A 3HVAA 4OX8A 2VOOA 2W9BB 4IQMA 3FC9A 3LGNA 1U6BA 2W01A 5JXSA 1TP7A 4QBUA 1E6VA 4MTPA 2EFPA 3GCXP 1H2UX 2EFVA 4JI1J 3DMJA 3DGVA 1M5VC 3UVJB 1H7WA 2D3UA 2XSJA 4LF9J 2I0XA 1RXOB 1R0AB 1RWNB 4Q5VA 4I6WA 5KT2A 3QBCA 1SC3B 4CDIA 4LJMA 4DQSA 4DFJA 3TX0A 2UXDJ 1ZM9A 5ETQA 2XLKA 2EG2A 2CPFA 1IXKA 1IWGA 4TVAB 2HNYA 3VGSA 1V3RA 3KK2A 3IBCB 1TZ0A 2VH7A 4F50A 1HNXF 2BMBA 4U7UK 5GVQA 4ILRA 4J9OA 2A1BA 4DV6J 3PRBA 4FBTA 4QJVA 2OPRB 3HLUA 1RT5A 3KUGA 1RGVA 4C8YA 2KFYA 3N6LA 4ZJLA 2GJFA 2CQ4A 3DLEB 3DLGB 3V4MA 3CDAA 2CPIA 4DR2J 2UXCF 2DRDA 2PD1A 3BF4A 4P9SA 4RWXA 2C3MA 4JYAF 2NXNA 2Y1IA 4IG3A 5EWGA 1XMOF 4OI2A 3KJVA 4EO6A 2ZZTA 3TANA 5J2MA 3GYGA 2PT0A 1S97A 4LF8F 4C48A 4FXWA 4CT9A 3BBCA 5M2RA 5KT3A 3CC2S 3SBMA 2EC0A 1CS4B 2C42A 2FD2A 2BXJA 1IKXB 1C4CA 2GFFA 2MGZB 1V6HA 2HHSA 1VQSA 2K06A 3M32A 1YVFA 4A8QA 5G0RA 6FDRA 1W2IA 2ZE2A 1L3KA 3Q8UA 1KHVA 3R3TA 4Q2MA 4O44A 1JWWA 2O3DA 2WW8A 4B9TA 1TL5A 3GIKA 2CQ2A 2JC0A 1TL1A 2LFVA 2CNNB 2ZHOA 2ATLA 2PE8A 5E5NA 4DR6F 1EIYB 1J5EF 2RHSB 2KVIA 3TAQA 5AXLA 3I55S 3I9ZA 1L5UA 2UXBF 4XPCA 2UUAF 4GKKJ 5A0YB 3IGVA 2G13A 5EUHA 1SCJB 5AJ3J 3Q8YA 4ZVTB 4DPYA 4Q8FA 2DRBA 2ASDA 3LGMA 4ZLNA 1NKEA 2ASYA 2AQ4A 3PJXA 5K5MA 5IT0A 2OIHA 1U02A 3G8SA 4LSNB 5HVHA 3MUTP 1RTHA 2BOPA 2MXYA 1SKUB 3BKUA 3MM6A 3HJVA 2F8HA 3CJKB 5D4LA 4O3PA 3FCWA 2AT1B 1IKVB 1WKLA 3K7RA 5DO2A 2PN6A 3RR7A 2BJEA 3N4WA 5HVFA 3BR8A 3PX0A 1SKWA 2FLNA 4ZLLA 4OIXA 4CM2A 3LGHA 4A8FA 1OIAA 3D1OA 4ZVPB 1M5PC 4FVCA 3T9ZA 3Q24A 4PG7A 1O5JA 2FZKB 3EE3A 3PR5B 4F02A 3UR3C 1AZSB 1HBMA 5MLCV 3PM9A 4P74A 4OHXA 2V2KA 5ETRA 4UY8T 3ZXWA 4WP9A 1TKDA 1OYDA 2K1RB 4M8LA 3CIMA 1K8AT 3PJ9A 1TU0B 3NOGA 2VG5B 3T5JA 4CTAB 3GQCA 1SVDA 4A8WA 4DF8A 1NXIA 3EM1A 3DOLB 1FRXA 1S0NA 1SKSA 1F3FA 1K47A 2G9OA 1U1PA 1PCAA 4CIOA 4DR5F 1KVKA 4C7QA 1QUPA 1YKWA 1UWBB 4K4TA 1RHMB 2QJ3A 4KIAA 3MOZA 2NPIA 1T03B 3SMZA 3PW5A 3BPDA 3EGWB 4R5PA 4DBQA 2C2EA 3T1AA 2L9NA 5C2CA 4E98A 1L3SA 5KT6A 3OR1B 5GAHI 2E1PA 1F5AA 2FUG9 2RRBA 3PVXA 4PXCA 1VC5A 1XR7A 1MN7A 4ID8A 1WI6A 1MN9A 3ZZTA 3GYXB 2BW2A 3C16B 4B3SJ 2BANB 1XNQF 2HFNA 3MMBB 3A8KA 4JI7F 4M94A 5GAHU 5A8WB 4MFBB 1CULA 9RUBA 2Z2YB 2LEBA 3MDFA 2N82B 1X4FA 1R8CA 4P6QA 1BUXA 1KN6A 4USVA 2V8PA 4YOEA 2GIQA 4O3SA 3FQKA 3EX7B 2FLOA 1DURA 4Q2LA 1H3DA 4DPXA 2OO4A 2R7UA 2UUWA 3DN9A 4CO3A 3N6MA 3JSMB 3H2UB 2QTWA
chains in the Genus database with same CATH topology
2AYGA 1DAXA 1TV6B 2F8MA 2AJ1A 3Q8SB 3NBPB 1YJWS 4JBCA 3TO8A 4W90B 3GFHA 1JLBB 4DV1F 2AF6A 2HG4A 4EU0A 4ES3A 1VQ6S 2ILYA 4EBEA 1N5SA 4N5SA 1UFLA 2MKHA 1KFSA 1RT4B 4G1PA 1AW0A 1HPZB 5DLGA 5KG2A 4WZMA 5D78A 5EDWA 2U2FA 2AU0A 2GW8A 3SZ2A 1DQ9A 3RR8A 4DQIA 1VIXA 3BM7A 2FLLA 4OQJA 4A4JA 3CUNA 2B0GA 2UV8G 4IKAA 1P1LA 2XS5A 2RU3A 5I3UB 3AAWB 3MM6B 2WK4A 2DGSA 5LJ3Y 1TFYA 1PC4A 1R43A 2FJAB 4B9UA 3KLGA 3HF5A 4RUHA 4JI1F 1N5VA 5GAEU 2IA6A 4ZCKA 2O66A 4XIUA 3I0RA 4PUOB 3ICLA 2PO4A 3Q0AA 3V6KA 1HI0P 2R8IA 5KFQA 3NGDA 3BO2A 4LF9F 1ULRA 3HK2A 5KFOA 2QMWA 4NA3A 5DLFA 2Z2LA 3DNCA 4I2PA 4IH7A 2ZH3A 2F7VA 2KT2A 4M5DB 3OL9A 1SH3A 2P6TA 3HX9A 2W25A 4YMEA 2LEPA 4YP3A 3NLCA 2HNZB 4HKQA 3QZ7A 3WC2A 3M8RA 5HMZA 2J0QD 1Q4RA 2J9CA 2K3IA 3NCPA 3VCDA 2ZOGA 3L95X 3LW5C 4RNHA 5A8RB 2OMLA 5E41A 2CPYA 1H0HB 1RTJB 2D41A 1BQMB 2CQCA 3DRYA 3B4MA 1QSSA 1KR4A 4USIA 2UXDF 5IQ6A 3CD6S 3S8SA 2ZH4A 2YNFB 3ZZRA 3V4IA 3U27A 2HVIA 2MJUA 5C42B 2XEXA 2W7PA 5CH7B 2C22A 1VFJA 2DH9A 4URGA 1JLCB 4DS4A 1TVRB 1RT2A 5J2NA 1K0VA 3OL7A 4CH7A 3UCGA 1N34F 4D3GA 5JJBA 2M5YA 1NJXA 2RDJA 2B51A 2PIIA 1CSJA 2WCXA 4DUYF 3UE2A 4JV2A 1TL3B 5HL7Q 4WF9Q 5L8RC 3LO3A 2CG4A 1LWCA 3VAIA 4DQRA 3I5AA 3KLFB 3E01A 2DNPA 3BDPA 1HBNA 4NXNF 1R7IA 5D8HB 2ZHAA 7FDRA 4F3QA 2EFOA 2DO4A 3FNNA 3FZBA 4IDKA 3SXLA 2C2RA 4HH1A 2MHNA 1OSCA 3WC0A 2WBRA 2ZC4A 4TY9A 1WHVA 2XY6A 2HGLA 2FHJD 3FCHA 1IJFB 4DV6F 3TAMA 1U8SA 3I32A 3POTA 2FJXA 1DQAA 4V19J 4BWMA 3CCLS 3R27A 1CPZA 2MZJA 3PJWA 1U48A 3RAQA 3KMQA 2FVQA 3A1YG 2ZH5A 1DQ8A 4OX6A 2HIQA 4DV5F 4YB6A 1C1BA 1RT6B 3QO9B 2ZD1A 3C6UB 2RE1A 1AXQA 1FEEA 4NZ6A 4DR2F 5I42A 3DLHA 3GZ7A 1M5KC 5F8JA 1FRIA 3VWSA 4WJBA 2J0XA 4X4QA 1N5YB 2DCUB 3GSDA 1KTQA 1TKZA 2CQPA 2GNKA 4B9MA 1SI9A 4H4OB 1SIZA 3UPFA 2VFTA 3CDUA 2VG6A 1S4FA 2VFVA 3V81A 1LOUA 2L48A 4ED2A 2XI2A 1NK9A 4A8YA 1NH8A 5G4DA 5LT5A 3QGIA 4F8RA 3CCZA 1K1QA 2J6SA 4NLPA 2JHEA 3DYAA 2EBGA 2EPIA 4O3NA 2VPZB 5KFHA 1KQGB 2YWGA 4H4KC 1FK9A 1FO1A 2E7WA 4KV8A 3I87A 3DRSA 2IC3A 3U1LA 3TAPA 1X9SA 1WACA 1X4AA 4ZLPA 3PACA 2RF2B 2ZH2A 4AL7A 4Y2AA 3B4DA 4NCGA 4NLWA 3CCMS 2MZTA 2I5JA 3KMSA 3C3LA 2DR8A 3H5XA 1UJ4A 2IM1A 4IG0B 4Y65A 3THVA 1DZ5A 4H4KA 3KG0A 3KLIA 4ATNA 1ZH5A 3DLKA 2WB1D 5L1JA 1DBDA 3VQSA 5DQHA 1HNWF 4ZMMA 2PDAA 3DXBA 2A18A 4I6YA 4NA1A 3EZ5A 1U1MA 1IBMF 1RTDA 3PNIA 2CZ4A 3KHHA 3O44A 1QM9A 4OZNA 3D28A 3I5BA 3MM9A 1NU4A 3O3LA 3MTKA 4MIWA 2QSFA 4ECYA 1S6PA 5CYQB 2LDYA 1ZAXA 4EZ9A 4QIFA 1Y5IB 1UJ5A 2VFSA 2EVZA 2WHOA 3R5BA 2KDOA 5KG4A 2KJWA 5HBMB 3H20A 1B0PA 4ZDNA 2VG7A 4H4MA 2HRYA 2NPFA 3K5NA 1VQ5S 2OMOA 4G1QB 4NOHA 1BC6A 3C6TB 3KLEB 1HBOB 4DJBA 3DRPB 4Q43A 4DFPA 1SL1A 4YDDB 1CVJA 1KLNA 1SJRA 2GIRA 1IQTA 1SXLA 3JB9k 5EWFA 3IRWP 4ZPTR 5E33A 4ED6A 3BN4A 2RUGA 3MTJA 2DR7A 5HROB 2HPUA 5F3TA 5F8HA 1JLAA 2ZFHA 2DNLA 4KHPF 4KPYA 1S1WB 3ENVA 4OI4A 4XAKA 2VZ9A 4JV0A 2L9WA 4NZ7A 1SJFA 2GC8A 4YEAA 4DMZA 3S7RA 1G2EA 3PR4A 4BBYA 1HA1A 3CD5A 4FF1A 2X51A 2KRRA 3E51A 1Z2ZA 1CQNA 3HM9A 3V6JA 1QE1A 4URQU 2PI4A 1LW2B 2IFXA 3J7YI 2QMXA 1W2BR 1N0VC 2LDIA 1U24A 4QR1A 1NK4A 1P8GA 4NRTA 5KOWA 1BLUA 2FHKA 4LIRA 4B3RF 4JI2F 2HZCA 1U26A 3T19A 1GQEA 1IKYA 5DDPC 4WIIA 5LXYA 4N8OA 1UAWA 4ECUA 1LWFA 3WBZA 4N77A 1X0FA 3M6VA 5K14A 1WI8A 5F0UA 3HXMA 1MROA 5H1SV 4IQXA 3GG1A 3D0HE 1MNEA 2MQQA 4X4VA 4QZVB 4DHVA 2GQCA 3NKYA 2OJ3A 4GKKF 2E5LF 1PGZA 3QAEA 3MAHA 4B02A 1X4EA 3MECA 3U7JA 2CJ9A 4K2XA 5J2PB 3FZ2A 5ITHA 2IBKA 5D4OA 3J7YU 2B5JB 3N0VA 2VC1A 5AJ3F 5JVGQ 1XC9A 3DDNA 3PRDA 1HBUB 1XBWA 3LUYA 1MWYA 5LXRA 3KLHA 3IR7B 2R7WA 3V6DA 4FS1A 2DNOA 4BWJA 3NNAA 2DISA 4PQUA 5IZHA 3CGIA 1NJIT 4DL4A 1L3TA 4QIVA 3H40A 2J0SD 3V5RA 4Q8EA 2VBXA 2YKQA 3HDSA 2HYIB 2C28A 2E1CA 3G4SS 4ZP8A 1N33F 3X1LB 4QW8A 4AUKA 1HWLA 4C8MA 3KLGB 4OZ0A 3H4BA 3M8PA 1F2GA 1VMBA 3N5BA 5AE2A 4NCAA 3SV4A 1ZETA 4JI3F 2VA2A 3MMAB 1U6FA 1HHTP 1T94A 3OXGA 2QV6A 4RUAA 5K8OA 1XTZA 2IYGA 4ID5A 1X7VA 2W4DA 5C25A 2DR9A 4HT7A 3FRYA 1T95A 2OSRA 4LVOP 4RW7B 1MMLA 4HYKA 4KGMA 1Y4ZB 4KGKA 4ZPVR 2XCAA 4I2PB 2UP1A 4ZP9A 4QPTA 5E3RA 1Z2LA 2CQHA 4J9KA 3SYZA 4IRCA 3RW6A 4DFMA 4XK8C 4URSA 4F4KA 2JZ5A 3O2IA 1D9AA 1VJWA 2XMKA 1ELOA 3KTQA 2KKHA 3DMJB 4JI4F 3FJ2A 4YB5A 4OL8A 2P9CA 3DGPA 3ISND 1YRXA 4ZS6A 2LECA 3CD7A 5IS2A 1XMBA 4DSJA 3MM8B 4IFYB 2XI3A 3PDNA 1JLEB 5F9NA 1FCAA 5CYMA 4RNOA 3VALA 1TKXB 2RSQA 3M9NB 3NS6A 3DOMA 2HHXA 3IS9A 2GO9A 2E5JA 3GV7B 1FJGF 1Q1KA 2X1GA 3LP2A 2UVWA 3HI9A 2LQJA 1BY9A 1HW9A 3CWJA 2DGOA 3J7A1 5KFKA 4NLXA 3OXFA 3ULHA 3DDKA 3CCVS 1N52B 4CNYA 1IR0A 5AXMA 2PA8D 1FDDA 4MK9A 1RQ0A 2K2PA 4AL5A 5L9XA 1LWCB 2BRKA 2J76E 1ROFA 3FDSA 4C3LA 1TL4A 1S79A 2HNDA 1HBNB 3MEDA 5DRKA 4QWCA 4I1TA 3US5A 1WEZA 2XMVA 2VKZG 2VUGA 3IR5B 3PFEA 4Q7AA 3TOQA 3UFCX 3W2WB 3CC7S 4IDKB 1U1QA 3ZZ0A 4OJHA 2DGUA 3LALA 2XS2A 1G1XA 1TK5A 1HWKA 1YI2S 2GO8A 2R7RA 2X1BA 3SQGA 3K8WA 1YITS 4DV3F 5F8NA 3POTB 3JSYA 2IAJA 3ZFVA 5F8LA 4D3HA 5HLFB 2JLEA 3SFGA 2HNYB 4A8SA 2AP6A 1OWXA 2DNHA 3VAGA 2MDAA 2MHEA 5KFNA 2KM8C 3KK2B 2HQ3A 3AB2B 4I0WA 2Z4PA 2XY7A 2COLA 2JFKA 3CTRA 2JEFA 1HI1A 3DRXA 2W9BA 5B0BA 3HP6A 4UW2A 1EETB 4IYQA 1G3OA 1HW8A 3OJUA 3BR9A 1OPZA 3VR1A 3OTOF 1X0PA 4USJC 3KHLA 1NK0A 5I42B 1FTCA 1N6QA 1S1XB 2OTLS 3HJFA 3PX6A 2FVSA 2KTQA 4QWBA 2DGWA 2X3GA 1ZYQA 1DTTA 4IRDA 1VGYA 1HWJA 4LF4F 4OZ5A 1JLGA 2CJKA 2VG6B 3FSIA 3F73A 5F3ZA 3GR0A 1UFWA 2M7SA 3V81B 1H7XA 2F8EX 1VRUB 3MR5A 3MHYA 2R7QA 1Q8LA 1X4CA 2YNGA 3OLBA 2BR0A 3J81Y 4XDDA 5LSLA 1OPIA 1QUVA 2JWNA 4WFYA 3GMGA 3TX8A 2HAIA 4MK8A 4OJGA 1S9GB 3FEZA 3RAXA 2VPYB 1S72S 4KV8B 4EBDA 3R1LA 4GMKA 2ZZMA 2ZBIA 3H8YA 4BS2A 2B6AA 2ZJRQ 3CCJS 4DG1A 2GJIA 1SJQA 1BQNA 2D3ZA 1I1GA 1PSDA 3HHLC 4NCGB 4QIWD 5J2QB 2JRSA 1HARA 2XZWA 2DNMA 3H2UB 3QIDA 3M8QA 2W9CB 1HD1A 3CT9A 4ZPBA 3IR6B 4M63A 4L6V3 1OQ3A 1JJ4A 3JAMY 3DU5A 5T14A 4EGLA 4G1IA 4Q0BB 4RBUA 2J6UA 2V4RA 4J9MA 1HI8A 4Y00A 5J2MB 1JNZB 1LW0A 4TNOA 4BC7A 2HMIB 1FKOA 3BEGB 3HHLA 2VL1A 1Q16B 2JLGA 2RD5C 4N47A 3MM9B 1RT3B 1VBZA 4F3OA 2IJNA 4C8ZA 1REVA 3K5OA 4R25A 2XMTA 5KFIA 2WSFC 4X64F 5T41A 5KFDA 2QA4S 2OAUA 3CCUS 4PPDA 4KTQA 4HDHA 2DH8A 3FMWA 2LCWA 2VG7B 2E5IA 4H4MB 5KFPA 1JLQB 1SIWB 4EUVA 4QU6A 2QRRA 4XDCA 2M88A 3E8OA 2MQOA 1SKRA 2RVJA 2YNHA 4RW9A 4TY8B 2XBPA 2FVPA 3MI7X 3AJ2A 5E3AA 2O1PA 1YJRA 3HHDA 4N41A 1V3ZA 3RB4A 2AX0A 2OPRA 3GFYA 3HHEA 3HHKA 1FD2A 4ILLA 1U1RA 1LWEA 4F67A 1CEZA 1HD0A 4FYDA 1OQ6A 2QSWA 1FTRA 1D3WA 5AE1A 4N56A 3OXLA 1NZAA 3M9MB 1U6ZA 2IVYA 2IYIA 3J7ZT 2IM2A 1R89A 2C3PA 4RW6B 1TK8A 2YNIB 2QLWA 2M4MA 3DLGA 4KKOA 3LP1B 3W2VB 5HO4A 4B3SF 3IRXB 4OFZA 5G0RB 1R3NA 3B78A 2R2RA 3LWLA 1T3OA 3MPWA 3BGLA 1IBKF 4WK1A 1SUQA 5FDLB 2YQ3A 3RW7A 2V4JA 3H5YA 2XB2D 2ZE2B 2R2SA 1T7PA 2YWEA 1L3VA 2DJWA 3EGNA 1TR0A 2X1AA 5E3PA 2VFUA 1LWFB 5DQIA 2ZZNA 4K5SA 1VQ7S 4QYZJ 2DBBA 2G1DA 1MMNA 1UVMA 2OFHX 2XWYA 4MH8A 2ZM6F 3JTPA 4B3OB 5EX3A 3HZGA 1URNA 2M8DB 2BACA 2DGTA 2DNNA 2KT5A 2HS4A 3AJ1A 1IQZA 3TUZC 2VV5A 3MECB 7FD1A 1JMTA 2AYEA 1NH7A 2GA7A 3EUNA 1VOMA 4ZP7A 1F5BA 1Z1ZA 3PFOA 5T7LB 5IM0B 2V9KA 4ED5A 2NZ4A 2OD4A 1MW7A 2RQCA 3GR1A 3KLHB 4OI6A 1N0UA 3O6QA 4GC6A 1IKXA 2WTFA 1S10A 5IQQA 3B8HA 1FJCA 4WE1A 3IO1A 3TNVA 1O0PA 4C11A 4EYIB 4F26A 2LKZA 2QA1A 4DS5A 1SV5A 3F41A 4FZVA 5KG0A 4LMZA 2ABYA 1FDAA 2MGZA 1FRMA 4WFXA 4PG5A 4J9RA 4KHMA 2NR0A 4NLGA 2V9WA 3W3SA 1HQUB 3ZZZA 5B08A 4DSKA 1F60B 1X5SA 1URRA 3CJ5A 3K57A 2KZMA 4KT0C 2NUHA 1J5OA 4PWDA 3G8QA 3S01A 3MUVP 1UVKA 2Y0SD 3HFKA 2KG0A 3OBIA 2RB7A 2KN4A 1JKHB 1UL3A 5KFZA 2GMJA 2UZAA 2R8KA 2DRAA 3EYZA 4FXVA 3T5HA 2ALZA 4U67Q 1X4DA 3PO4A 2FJDB 3THTA 3DXSX 2IRYA 4WFZA 3UDCA 1YHQS 1QY7A 4DR7F 1ZTTA 3TRGA 4NXMF 3DHXA 4ED0A 2FTRA 2HHUA 2O01C 4KR0B 1NJYA 4ZPCA 4ZPAA 4C8NA 2AJ0A 4GO5X 1SH0A 4A8OA 2ZKUA 2LYVA 3M2UA 2B9WA 2OH2A 5KFXA 3TA0A 2ZH1A 1U7LA 2GX8A 2ZHBA 2E66A 2IBOA 3AB4B 2DGVA 1RTHB 2WAQD 2IJFA 2VA3A 4RWWA 3T3FA 4A47A 4ES2A 5D4NA 5KFVA 5HQ8A 2N4DA 1JXLA 5CYMB 2J7UA 4ZPDA 5GAEI 5J1EA 3PZPA 4I64A 2JOQA 3LWMA 4OHYA 4K4XA 1WG1A 3CCWA 3H2LA 5CCMA 2V5HG 1VC0A 2DVI