4CO0A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
109
Chain Sequence
b'MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
total genus 23
structure length 109
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co0A00
1V3RA 4NYOA 1NZAA 4CO4A 2EG2A 1VFJA 5D4OA 4CO1A 5D4PA 4USJC 2E66A 2RD5C 2GNKA 1J2VA 2EG1A 4IYQA 3TA1A 5DRKA 2VD3A 4CO0A 1O5JA 1V9OA 4YB6A 3TA2A 4RWXA 3CE8A 3AA8A 1UL3A 3BZQA 2O66A 2XBPA 4WK1A 2J9CA 5D4LA 4AFFA 4D3GA 3NCRA 1V3SA 3AA9A 4Y6IA 1P1LA 3HLUA 4D3HA 1NH7A 4Y65A 3TA0A 1QY7A 2NS1B 3O5TB 4CO3A 4CNYA 2GW8A 3OPKA 2ZOMA 4OZLA 5DS7A 3GSDA 3AHPA 1VHFA 5L9NA 4YB5A 3NCPA 4C3KA 4NYPA 4ZK7M 2V5HG 1UMJA 4C3LA 3M05A 1HWUA 4CO5A 1NAQA 4CO2A 1Q1KA 2CZ4A 2DCLA 2GX8A 3O8WA 2J9EA 2O67A 4OZNA 5D4NA 4WK3A 1V6HA 1GNKA 1XK8A 1UFLA 2XZWA 3N5BA 4RX6A 2J9DE 3AH6A 1PILA 1UKUA 1H3DA 3MHYA 4E98A 4C3MA 2XG8A 1KR4A 2JJ4D 2J9DA 4USHA 3T9ZA 2ZFHA 3NCQA 1O51A 3DFEA 4RWWA 3LF0A 2NUHA 4OZJA 4USIA 4CNZA 2Z0GA 2NUUG 4YB7A 1NH8A 1OSCA 2PIIA 3L7PA 3X3UA 4RLEA 2XULA 4R25A
chains in the Genus database with same CATH superfamily
3VAGA 3BKUA 4J9NA 2GO9A 1XEZA 4WP8A 1NDPA 5ETQA 4OZ2A 4USWA 1RTJA 4FPRA 4OYPA 3GJTB 4DG1B 1ACMB 5GAHU 5KOXA 1R27B 3FSYA 1TFYA 4IOBA 3A12A 3WIUA 5D6GA 3B4DA 4WJBA 5SUHA 1LWFA 3AB4B 3KLVA 3CJRA 2KDOA 3N6MA 2LQBA 2NLWA 1XNQJ 2Q6BA 1U1RA 1KLNA 1HL6A 1RAJA 4RNMA 1TVRB 1FDBA 5L1KA 3QMQA 1UFLA 2CQCA 3EWGA 3GMGA 1QLNA 1H3DA 2M70A 3H2VE 4WP3A 3MD3A 1IWAA 2GMLA 4BS2A 2RRNA 1SQEA 1NK5A 3UDCA 1T9TA 3CCJS 2YPZA 4LRDA 2FY1A 2OPRA 1JLQB 2UU9J 2XMAA 3JYTA 3W62A 4XTTA 2KG0A 2YKNB 5BR8F 1Q8KA 4ED0A 1XTZA 1KONA 1TL3A 4F0HA 2G2ZA 4U7UK 1HHQA 2IDLA 2XMWA 1VI7A 4TLRA 2HGLA 4I64A 2NPIA 2EK6A 3VV2B 4UOGA 4QWBA 3BO3A 3KJQB 2JEIA 2KM8C 3HJFA 3QSIA 1FKAF 5T7LA 4NA2A 4PRFA 2ZEJA 4WE1A 2G2YA 3W63A 4QWEA 3P96A 4ZVGA 1EQMA 3JAMY 3T1YJ 4BLGA 2WBRA 1QM9A 7AT1B 3GIRA 2R3VA 2K06A 3B54A 1JKHB 3MFIA 2HVIA 2E7VA 4TY9A 4I7FA 1U0HA 1HNZF 3EE3A 3I0RB 1RB0A 4B9UA 5KFRA 5I3QA 1LW0B 1VRUA 2ZBRA 3K7RA 3OSNA 4UOFA 1KQGB 3BO4A 1IQTA 1RU2A 2VQEJ 4WWSA 3IC1A 3HX9A 1RT7A 3DLLQ 1NPKA 2BYCA 2CZ9A 4ZP9A 3NS5A 4UOHA 3K0JA 1R0BG 1SC6A 4DSEA 4RU9A 2HW3A 2YKOA 5E0OA 1TKDA 1VQ9S 1MU2A 1HW8A 4N41A 2W9BA 3CMES 1FERA 4OJHA 2NZCA 4DU8A 2ZOFA 4FNIA 1OSDA 4QOTA 2IMOA 4I6AA 4NLUA 2FGOA 1CC8A 3TZZA 3TJ8A 3UNGC 5HMXA 1B7FA 2XMJA 2I8EA 1IVZA 2RQMA 3HF5A 4ZJOA 1URNA 2WVDA 4OX7A 2BV3A 1IR1A 1YJUA 1RI7A 3MMAB 1GFWB 2LA4A 4OZJA 4B3SJ 2IC3A 3DLEA 2MKCA 3C6UA 3C6TB 5HLFA 2WSCC 2DJWA 3MGJA 1X31C 4O3NA 3OFHA 2E5GA 4KC5A 2DHSA 3MCOA 4PR6A 1X4HA 1N34F 1AUDA 3MMBB 4LT6A 1Q0NA 2ZDPA 3FMWA 1IM4A 4RR5A 4LUBA 2RB7A 3PACA 3OXGA 4CNYA 3M6UA 4ZVTB 3HCXA 2C2ZB 1U1QA 1O8BA 1T9XA 3KJNB 1DLOA 4U67Q 2NCKL 3EVOA 1BQNA 1JB0C 3V6HA 4KV8B 4TNOA 1NHKL 2BE9B 4B9TA 4MKBA 2MKSA 2WK4A 4ALZA 3RAXA 5LJ5Y 5GMDA 5DETA 4EWTA 2R8KA 4R5PB 3TUIC 2FJAB 4K4WA 2XMTA 2BABA 1VRTA 3G8TA 5EGYA 3PR4A 4Y2MA 1S1XB 3VF0B 2G1HA 2G0IA 5CZXA 1UAWA 5ITHA 4RU2A 1RWKB 5L1JA 2IJRA 3NGUA 4KPYA 3TX0A 3SSSA 2D9OA 4QR1A 2IM3A 1M1GA 4OZ1A 2MZSA 1YSJA 2MLYA 5F9LA 2KB2A 2HGMA 2OTJS 5DDQC 1L3KA 2E7XA 5KG1A 1UVNA 2FHJD 4J5OA 1H98A 5FD1A 5CCLA 3CCUS 4O44A 1C1BA 2EBGA 4OX9J 3A8EA 4Y0FA 1HNVA 1FESA 5DG7A 5KFNA 1H2VZ 2Q43A 2WVEA 2NYHA 2HWIA 4YN3B 3UCGA 4QU7A 4OLOA 2FJVA 2APOA 4CQ1A 2FC8A 5CYMA 1SC1B 3NGKA 3PX4A 2BOPA 1JNZB 2DO0A 3TNVA 2CFXA 3DLKB 1M1KT 1IKYA 2X1BA 1UEVA 4WP9A 2W8LA 3HVTB 3KNAA 2OD6A 2RIJA 3FSXA 1RAAB 5D0EA 1TL1A 5KFJA 2RDDA 2MQLA 1N5TA 3JQKA 2AJFE 4KE5A 1XNRF 1NK0A 5C25B 2QZ8A 3V2UC 3QAUA 4A8QA 5J1EB 4F25A 4NCGB 5K20B 3K17A 1FHTA 2F1FA 2GCFA 1N5VA 1VLOA 4NZ7A 4OHYA 3KLEB 2NXEA 3T41A 1RE1B 2OSQA 4QIGA 2F4FA 3L9ZA 1X9WA 2OFGX 1SPBP 5LT5A 5ETLA 3C14A 1QUPA 4CO2A 1UA0A 2GX8A 2HQCA 3FCVA 5GAGU 3EZUA 4X4RA 4K4YA 1AUSL 2Z57B 8ATCB 1FJGJ 2F4VF 2DITA 4N47A 4DV6F 1SL2A 4KHPF 3Q23A 4USHA 2AJ4A 4ECXA 2Z2MA 3MPVA 1YJVA 4U96A 4BC7A 2VKRA 2XCAA 1ITPA 3BQ0A 1R8BA 3DGPB 2A2DA 3DM2A 2A6OA 4LVOP 5B0CA 1N5QA 4DFMA 3QGHA 4KGZB 4ZPAA 3W8GA 5HANA 2XMKA 3PYDA 5LMNJ 2UV8A 3DMJA 4ZN3A 4JI3J 2KT5A 3W2WB 4HR2A 5DM7Q 2PFDA 1G2EA 4LSNA 2Y8YA 5A8RB 3NP5A 4P7TA 3H59A 4RUBA 1F0XA 1YBTA 3T5KA 1EQ0A 1FFWB 1EHWA 3L09A 4X4SA 4LBIA 2ACYA 2GVZA 4UY8T 2DIUA 3M32B 4PG6A 4GVLA 2Y1JA 4RUCA 1IKWA 1F2GA 3SXLA 2DY9A 3DI6B 3M8PA 1K0TA 4MK7A 3LGHA 4KKOA 4A8YA 5E3QA 4PPZA 3Q22A 3TWZA 1QSSA 4CLKA 4CCHA 5F0WA 2HAIA 2YNIA 5JVHQ 2HHQA 2GC8A 1N88A 2J8AA 5J2NB 4H4OB 3SQGB 2KXNB 1WELA 5A8KB 2ZBCA 3KNGA 1YITS 4XDDA 3CEDA 1IR2A 3C16B 4HI1A 2ZC3A 3RTVA 3CC2S 1FE4A 3CJ2A 5IM0A 3CD5A 1U45A 1RA6A 3HI9A 5H1SV 1U24A 4DX7A 4YB6A 5CAAA 4FF2A 3T6JA 3X1LB 2HQGA 2ROEA 4CM2A 3BQ2A 2YXLA 1K1QA 2VFUA 1HHSA 3FC9A 1TKTA 1ZM3A 4JUZA 2OEMA 1GMWD 3F44A 2BQUA 3UR3C 2ZH3A 1Q8IA 4OLPA 2HVDA 2CQ1A 1Q53A 2ASYA 3EGNA 1RU1A 3TAPA 2OAUA 3ITHB 1BD6A 2XM3A 3JXOA 2YWHA 3M1VB 4LF6F 3RR8A 1X4GA 4WFNQ 2RDJA 3THPA 4F4AA 3DNCA 3I5AA 2FHOB 2ZITA 3LWLA 3CNQP 3U27A 3GQCA 2CIMA 3AJDA 4LSLB 4J9SA 1JLQA 3MR7A 2NREA 3Q24A 2UUAF 2NXJA 3HDSA 4M5HA 1ZETA 3OT9A 4QZVB 1N32F 2XLIA 4DLEA 3H4BA 2C2EA 2LXFA 3IFEA 2N82B 1VCTA 3UN3A 3HD2A 3HHLB 1XMQJ 3ZTQA 1QSLA 4TQSA 4WPAA 1N56A 3TA2A 3JQMA 4J9LA 4LBPA 1VISA 2CPZA 5LSOA 1KN6A 4L73A 5J2QB 2KFNA 3R5JB 1A9NB 3UDLA 4Q7AA 2AEFA 4ZVOB 2ZWOA 2CJBA 5DLFA 4O4GA 4PG8A 1LEOA 4YB5A 4ZHRA 2CZVC 1T8EA 2ZE2B 4J7CA 2ZOGA 1D9AA 1I3OB 2AV5A 5KFYA 1AROP 2CZ4A 2DCLA 4JV5F 1TL5A 3FQLA 1Y5NB 1RISA 5KFBA 1JLEA 4FBTA 4F0KA 3R7SB 1FDDA 1ZOTA 2HKEA 2VU5A 3J80U 3L95X 1WHXA 2QA4G 3UWTA 1UJ5A 3E01B 3Q0AA 3MPDA 4FXDA 4RZRA 2DGUA 2Q1LA 4C0HA 3ETOA 4ED2A 4JI5J 4R25A 3BDPA 1UVIA 3DDIA 5I42A 4A8WA 4JI1J 1RWPB 2DB1A 1DHMA 4CLSA 5DGAA 8AT1B 3N79A 2N3OA 2VB6A 2YY3A 4WTYA 5M2RA 1Y3JA 2GJFA 4MAKA 4ZVRB 4K4TA 4PKDB 2XHCA 5DZ6A 4NPOA 2BJ9A 3KMSA 4IFVA 2Z58B 1NEEA 3ICLA 1TFWA 4C3KA 3K5MA 3QWUA 2E1RA 3Q8SB 3CCVS 1B0TA 3BBCA 3M05A 1FRLA 3PYGA 4DBQA 2C2OB 2ATCB 5A6WA 1S1TB 1YG0A 1RXOB 4IG3B 1M5PC 4LVNP 1KS2A 3PXGa 2DO4A 3MMAA 1AXQA 3LWMA 4EBEA 2OPPB 3KK3B 2VIHA 2CPHA 2L08A 5HSPA 4WFYA 5L8RC 4A8MP 2GQCA 2KU7A 2ZHOA 4AQYJ 1U7LA 3C6TA 4K8RA 3FBBA 5GMKa 1FI4A 3CJKB 5E3CA 2OJ3A 1S6OA 3KOAA 1VC6A 4B3MF 1I94J 4UUXA 3GJRB 3BR8A 2EEYA 2EVZA 2F5GA 1OMSA 4ZCLA 4EBDA 4RUHA 4DF8A 4K0KF 2XS5A 2XHWA 3CW2C 4XPEA 4DQRA 4L3KA 1OWXA 3GFZA 2BKOA 3I55S 2JEJA 2VASA 1Z2ZA 3FBEA 2YVSA 4M5LA 4B3TJ 2JVRA 5EWEA 2GV1A 3R8YA 3FFIB 2D1CA 1X9SA 4YOEA 2J7UA 5CYQA 4NLWA 3JSMB 2ZWPA 1X4EA 1NO8A 3GIIA 4R0JA 1B7YB 2XY6A 4R5PA 3QQCD 2GO8A 1RTHA 1V5IB 2KHDA 1XN9A 1JLCA 5FDLB 2WSEC 2W4CA 1UW4A 5F3TA 4U95A 3MEDB 1REGX 1UETA 3G6XA 3LP1B 2XCPA 1YDLA 3QLHA 4U9RA 3MEEB 2LQJA 1S1XA 3R1LA 1AA1B 2HMIB 4JI2J 5DO2A 1FF2A 4C6AA 2E66A 3GIKA 4EGLA 4ZJLA 3QIPB 5IZHA 5KFZA 4IR9A 5BYQA 2AD9A 1PAUB 3Q83A 3N5FA 1BMQB 5HP1A 1L3SA 3OTEA 1YZ7A 2BJ3A 2HRYA 1S1VB 2QMWA 5EN1A 2KRBA 4L75A 1P9QC 2RS2A 4DCJB 4MYUA 1NZ8A 4ILRA 5DDRC 1Q82T 2BE7D 4BC9A 1WJ9A 1F3FA 4GVBB 2H9ZA 1U1PA 2AU0A 4ED5A 3PYEA 3R6LB 1QUVA 4B9NA 3MF5A 3ULHA 4NLPA 3UVJB 1QE1B 3CMAS 4EZ6A 2ACMA 3R5DA 2BVZA 2NQPA 5IT0A 4YEAA 1ZM9A 2CRLA 2NSBA 2V69A 1IQZA 5AE2A 1HBOB 1NXIA 2JSXA 4UT4A 3KK2B 3T3FA 5H9EJ 3KLIA 4NCBA 2P9EA 3UDVA 4JI0J 3M6VA 2C28A 4M94A 3AQOA 2ZVIA 4I6YA 1OY9A 2JFDA 5G4DA 1PO6A 4NCGA 3FJ2A 2M8DB 5AJ3J 2FZGB 4ECYA 1A6LA 5BXIA 3JS9A 3MI7X 4WZQA 3KLEA 1VRQC 4ATNA 4NASA 3GZ7A 3UCUP 1X4CA 4ERDA 3KLGB 3TUJC 3C8YA 5ETNA 1HWUA 1H2TZ 4DUZJ 4P72A 3W5YA 3NWGA 4NXNJ 2ZH5A 3D2WA 3PFOA 2MLXA 2HEKA 1BLUA 4G1PA 1L5UA 2DR7A 4ILLA 4CNZA 1WKLA 5KFUA 2VFSA 4C0OC 3HD1A 1H0HB 1WKJA 2N4DA 4USJC 3W2WA 2BDPA 2ZKTA 2HSEB 2BBEA 4QIFA 4DJBA 2B4OA 4DN0A 2LCWA 4DV2J 5C42A 2CPIA 5CD4A 1VQPS 1RHRB 3SFGA 1JLGB 2J7KA 1S76D 4RKUC 2CJAA 2UUCF 2UVUA 3M32A 3ZZTA 4FYXB 5C24B 2N3LA 4ZCKA 4A8SA 3TX8A 4KGVB 3DI6A 3OR1B 1HBUA 2RHSB 3MM9B 2V9KA 4LF7F 3CCMS 3RRKA 4DV1F 1X7VA 1GNKA 2M9KA 3DOKB 2QO3A 2JRSA 3LALA 4OQJA 2ZM6J 4H4OA 2JVOA 5D0RA 4AE5A 3BREA 2MXYA 1VQKS 2P5VA 3SCLE 3B8HA 3C16A 4HH1A 2MB0B 1M90T 2RHQB 4PXBA 1APSA 2BJEA 4CT8A 4DX8H 2VQFJ 3UI3A 4O3SA 4F4KA 5DQIA 4ED1A 1S99A 2B9WA 1XQIA 3SDEB 1SL1A 5M2PA 4DR5J 4N8OA 4ZLJA 1VGYA 2FJWA 1RWNB 1XC9A 4DR2F 2XMMA 5D8HB 3V4IA 4OHVA 4JI7F 4HH0A 2Y1RI 2MJUA 3TQEA 4C8ZA 2E5LJ 2IVFB 4R8UB 3EYZA 3ZXWA 3T19A 1JLFB 1ZS6A 5KFIA 3ITHA 2FPHX 3RW6A 1TMJA 1AT1B 1CJTA 3KLHB 3C15A 3DLGB 2KTQA 4I56A 5E7OB 1NJZA 3M1VA 3PKYA 4USKA 1HQUA 1M5HA 3F73A 3N0VA 5KTQA 3G96A 2Z56B 1N0UA 2XTJP 5D78A 4MKAA 1KSPA 3W5ZA 4X4VA 3VVTA 4DV6J 2YH0A 1ZAXA 3SIPB 3MDFA 1NKBA 4TYAA 3JTNA 3JAMU 1W2BR 3W60A 4X62F 4ED4A 1M5OC 5HO4A 3IM8A 4NA1A 3CCTA 1WTFA 1RQ0A 3AA8A 1HYSA 4ENOA 1VQLS 4P2MA 1Q7YT 1N0VC 3TZXA 4WBFA 4QYZK 3R2DJ 2CA9A 3QGGA 4LQ3A 2ZE2A 2YX1A 1T03B 3ZFVA 5FLXY 4MK8A 3AD9C 2JDJA 2GVDB 3R1HA 4EO8A 2WRMA 5ADZA 3E51A 1X9MA 3MM6B 2AZ3A 2C2MB 5EWGA 2GGPB 3RJMB 1HFEL 4B3RJ 4ELVA 1VJWA 3TI0A 3E01A 5KG2A 1I6JA 2DNLA 1RT1A 5HVHA 3R27A 2V2KA 3KWMA 1ZTWA 2IY5B 1LWEB 1S9GA 3RAQA 4P2XA 3R97A 1O5JA 3SCJE 4NLRA 3HHEA 4PZVA 4J9PA 4L6V3 1AZSA 2DNKA 4CH7A 2IRXA 4CLLA 4WK1A 3SZ2A 5GADI 2YKAA 4OJGA 4DV5J 3EGVA 2V63A 2HPUA 2JFKA 1NJXA 1IBMJ 3LPYA 2OPQB 3TAQA 3MM8A 4DPUA 1BE4A 3CD6S 1R8CA 1DY3A 3LW5C 3D54A 1VQYA 4DQSA 2HRUA 1S1TA 1BWEA 2J9EA 3ETMA 1VQNS 3H2LA 3FZ2A 1KVIA 5B0BA 1QVFR 1X0PA 3FNNA 3AT1B 4AYBD 1KTVA 2MHEA 1YJRA 2R42A 1LNQA 4NWBA 4DR7F 4RNHA 3NOGA 4KGKA 3PDNA 2WBMA 2FIUA 4X64J 4EO6A 4KFBA 3BGRB 3HHNB 4OJ1A 2H54B 3GG0A 3CJKA 1FRXA 1SXLA 4WXOA 1S4EA 1RAHB 3JQJA 4Z2XA 1WD6A 3ISZA 4CLTA 3DHWC 3RRHA 1N32J 2VDHA 1Y5IB 2J0WA 1S9FA 2FJBB 2CQGA 2A10A 2C3MA 2BW2A 5CYJA 3KKFA 3G8SA 4DR1F 3PYFA 2L9NA 4DSFA 1HARA 4W4MA 3KMQA 1KLMA 2M88A 5C7PA 3R5BA 4PYDA 1HWIA 2BOAA 4AD6A 2XY5A 4ED7A 4MMOA 3PCOB 4C8OA 3ZTOA 1OYEA 3T1AA 4ZPBA 2LEBA 4CTAB 3EXYA 5HVFA 4O3PA 1U6ZA 5FDLA 4FVMA 1MNEA 2WCXA 4YB1P 4FF1A 3MEDA 2B5JB 1Q79A 2WVCA 5AXKA 4EFAC 1R8HA 3RB0A 3IXQA 2IYIA 3ET6A 4M5IA 4LRAA 1IUJA 2AMCB 4ZVHA 3EXCX 2QLBB 2YNGB 1KQFB 4ZIVA 2LECA 1JJ2R 3MCSA 2KFZA 1I5OB 4O4RA 1H7XA 1XNQF 2RAQA 3WX8A 4AL7A 4DI6A 1PJ7A 1TAQA 1SL0A 2EW9A 2VBWA 3VAHA 2YNFA 4P10A 1S1VA 3NS7B 2GW8A 3M2VB 4C48A 4LR8A 3LH2S 2XI3A 2CJKA 3BH6B 4F2RA 1RHQB 1R0AA 1FJCA 2UU9F 2NSCA 1WC3A 4LJMA 5D4NA 5KFTA 3NL0A 2HWHA 1WEXA 3JSBA 3NGDA 4WIQA 2PEHA 1GT8A 1QE1A 1JJHA 5GAEU 4F8RA 3QJPA 4EU0A 2R7UA 3GJQB 3T9ZA 2ROPA 2GIQA 3KK2A 2R7QA 2R8IA 1S6QB 1QAJA 3M2UB 5IV3A 1S48A 1GTHA 1ZZNA 5AE3A 2AGPA 4AL5A 1LWCB 3DRSA 5D4PA 1XMOJ 2W9AA 2MHNA 1K8AT 4CO0A 2ZUAA 1D0EA 2QEXS 2AEMA 1TU0B 3VVUA 1UWBB 3BBBA 3SV3A 2YKMB 5D4LA 1S49A 3IR6B 2P9GA 1SKRA 1KBRA 2F9DA 4LIRA 4OMFG 4URGA 2HVEA 1K47A 1UPMB 2G0JA 4F50A 4CLYA 2FHJA 4URQU 3K5NA 5K5MA 4R0EA 3W61A 4DV7J 1V6HA 3SQOP 2FDNA 2VPYB 3NGRA 4O3RA 1NPPA 4ECQA 2HRTA 3MUTP 1WWHA 3AXMA 3MOJB 1YBUA 4JV0A 3MEGB 3L7OA 2VQEF 1JXVA 2DRBA 1X4BA 1T95A 3H5YA 2OEJA 4RWWA 3LOUA 2RQKA 1RTJB 1R6YA 2PIIA 3J7YU 3ADAC 3CB4A 5LMUF 2HBYB 3L3CA 1NZAA 5KG5A 2X51A 5EX3A 4CO1A 2D7SA 1Q5VA 5M2UA 3EVMA 1WTBA 5HN0A 2R7SA 1SJ1A 1LWFB 3G6ES 1BXNA 1K9MT 3GU0A 1RHMB 4WU3A 4IR1A 1TUWA 5C24A 2J6TA 2N7CA 2E9ZA 4ZVEA 4DV4F 3ZC4A 3EZOA 1TKZB 1MG7A 4AXIA 1NLKL 5CCMA 3MM9A 4ZK7M 2R7OA 2CQPA 2QL5B 2CAJA 2MGZA 3CJ0A 1Q1KA 5HROA 2HNYA 3DOKA 4OHWA 3D28A 3BN7A 2VPXB 1DTQB 2ZBPA 2J9DE 2OPRB 3DKDA 1Q8BA 2XEXA 1DRZA 1UWAA 1WI8A 2J9DA 1PJ5A 2DK2A 4NI2A 4V19X 1TAUA 1JXLA 2BEFA 4ILMA 3UE2A 2IJNA 2CG8A 4C8NA 1GMUA 2KT3A 2F63A 1U09A 2QYCA 2MMYA 1VBKA 4A8KA 4ICLA 1QAYA 1RBAA 3TUPA 2ZUGA 1FRMA 2DEJA 1HMVB 1ZH5A 1Q16B 4TYBA 4FF3A 3NCRA 1JJCB 4FXVA 2DNPA 4R8UA 4YR3A 2IYGA 2F65A 1CS4A 5T7LB 1U1OA 4ED3A 2A18A 3P45B 4S0MA 2QT7A 1U8WA 4WE1B 3US5A 1NK9A 1NDCA 1T11A 4M5KA 3N28A 1OIAA 2N4CA 1RWMB 3QGIA 1GX6A 2HVHA 3AQPA 2IJFA 4DR6J 2BJ1A 1P8GA 3H5XA 1RTZA 2PC6A 3G8QA 4K7QA 5EHHA 3Q8QB 2HQ3A 4I7FB 2YKQA 2CQDA 4B3OA 3NMRA 2HFVA 4J9QA 5DGBA 4ZVFA 1LW2A 4LSZB 1J5OA 3J7ZT 5IV4A 1QVGR 2B4PA 1XIQA 1RT7B 1EB0A 4OX9F 4HYKA 4OFZA 1U49A 2F7VA 5HK4A 3ZZZA 3BBFA 3E2EA 1KKHA 1MU2B 2J6UA 2IM1A 4RPFA 3KUHA 2ZC4A 2W9BB 4TU7A 2V6AA 2I5JB 1UFWA 2HFZA 3CDAA 3RG6A 2RE1A 5AXNA 1MROA 1F9HA 4WFZA 4RBVA 3TEHB 2E44A 2NS1B 3BN4A 3HMJG 1M5VC 5EWFA 1D8ZA 4DCOB 1WC6A 1NMEB 2H48B 2GVDA 1U48A 1GMWA 3PNIA 2CPEA 4IQMA 2LLZA 4FYWB 4E0DA 4PWWA 4WK3A 4ZLNA 4WFAQ 4DSKA 3LUYA 1U4BA 2IC3B 3NNHA 5DDPC 2E5IA 3P6YC 3DLEB 4RW4B 1FRHA 3C6UB 4F2SA 3PJ9A 1YKWA 2OKQA 2VC1A 2KN4A 3KUGA 4V19J 1P6TA 1LWEA 4UF4A 2EI5A 3BO2A 5BYRA 2WB1D 2WSFC 2IDEA 4I4BA 4L3NA 3IAM9 3IWXA 1DLOB 4ZCIA 5IC6B 3AJ2A 1BQNB 4DF4A 1FJGF 4U7CA 2W2MP 1DARA 1OPIA 3ZZ0A 1F6TA 5AE1A 1J5EJ 2DGWA 5K14A 1N33J 5KFWA 2DR5A 1S57A 1YJ7A 2WONB 3CCQS 2I2YA 3M6WA 4DHVA 2ZJQQ 1S7IA 5LMNF 4KTQA 4YY3J 1B3TA 4NEZA 2B7BB 3I96A 4JI3F 1VRTB 3ISNC 3NY0A 3SCKE 3D0GE 1U2CA 1UCNA 1Q95G 1LKZA 3LP0A 1PKUA 3IRWP 5KG3A 2UUWA 4BBYA 5CZVA 4QWAA 2V0NA 5JUMA 3KG4A 5KG0A 1F5CA 1Q5YA 1P9YA 3CPWR 1PAEX 5IS2A 1LQ9A 3TYTA 3OHBA 2H3EB 2ZBQA 2W4PA 2DHHA 1C1BB 2W2QP 1DQAA 5F8LA 4ZP7A 4FS1A 1B64A 5KFMA 1HNVB 1OYDA 2DGOA 4H4KA 2R4FA 4IRDA 2G1DA 3AA9A 2QE5A 1N4LA 2H5EA 2ASDA 1LK5A 2QA4S 1IM6A 1S59A 4KB7A 2FLOA 2AHOB 1WORA 3HJVA 5CYMB 3JSYA 2PO4A 1TELA 5JJBA 2QJ3A 1N6QB 4IH6A 1Y0HA 5E3AA 1WOSA 2B7CB 4WIIA 2ILYA 4WZMA 3K89A 3TW0A 2P6TA 5KT4A 2XZWA 2UXDJ 3IR5B 4QYRA 1TUGB 2F8MA 1JLBA 3G82A 3KG1A 4A8XA 5C2GA 1KWMA 1KQKA 3P8BB 2ZFHA 2VFVA 4EYHB 2ZH9A 4YB7A 4ZCMA 4MFBA 2HHUA 2UZAA 4USVA 4X4OA 2YNGA 2BJDA 3KLFA 1CJUA 4LFAJ 2MEWA 4DOZA 2CPXA 4G6VB 3GFXA 3CJQA 2QFJA 2IBKA 5KFVA 2DXEA 2ZVSA 2B9EA 1FRIA 2PN6A 4ZPCA 3RZAA 2B6AA 1YK9A 1CVJA 4I67A 1YZ6A 2EBEA 2EC0A 1YJWS 3C14B 3RBXA 4KPCA 4FYDA 3CCRS 4RBUA 2LU1A 3GP9A 2R2RA 3QO9A 1VC0A 5B0GA 5LSRA 2RUGA 2Z8QA 3GFYA 4RNOA 4IKAA 3D66A 2V9WA 2LU2A 3FDSA 5K9FA 4PUOA 2AIRB 1U1NA 3DM2B 5KFLA 2IVMA 1CJKB 1S6QA 1AYEA 4PXCA 1NSPA 1SIWB 3DFEA 3Q8PB 1KFDA 4B9LA 2ALYB 3DMJB 1ZYQA 2UXBF 5D3GB 4DR7J 1KVJA 3FVYA 4LF9J 1R8AA 4ES1A 4LSNB 4F04B 2JEFA 4KR0B 4OYMA 1U02A 1ICEB 2ILZA 5BYSA 2OI2A 3UD3P 2OD4A 1U1MA 1UWBA 1V5VA 3HSGA 1WG5A 2F9JA 1TZ0A 2MTLA 4HTIA 3OTOJ 4DPYA 3PTWA 2R7XA 1P1TA 3V81A 4P7VA 2I6WA 5KOWA 3M8PB 1FD8A 4WYLA 4KKOB 3T5JA 1RYSA 2MQPA 1RAEB 1DFDA 3PW2A 2Y1IA 2CPYA 4RW9B 3WC0A 1EX8A 1B0PA 4NMXA 4C3LA 1TV6A 4ITSA 4JI5F 2WHOA 4C8YA 1ZPVA 1ZA2B 2NXUA 4JI1F 1R3NA 1TUVA 2EFVA 3MEGA 4YDDB 2IHR1 1SQFA 5RUBA 4NE9C 5ETSA 3QZ8A 3DOLA 1VBXA 4DMZA 5IM0B 5K8NA 4NEYA 1LOUA 2ATLA 4C8KA 3G2XA 1RP5A 1SJFA 5B08A 4ZMMA 3MMCA 1TKTB 2UUTA 2DGVA 3M9NB 2XYHB 1YRTA 2GJ2A 1WHWA 3HPOA 2PI5A 3GLJA 2HFSA 1SVDA 3G6YA 2VODA 2X1FA 3FMBA 1PBUA 1KHVA 3VGSA 2BACA 2Y8WA 3OW2R 3OFEA 2XB2D 4F3MA 3EICA 3K58A 3PEHA 2JLEA 3OPKA 3TVZA 1TKZA 2GHPA 1QSYA 4ZVQB 5KG7A 4G1QB 4KSEB 2KKHA 1K0VA 2MDAA 1IKVA 3FBCA 1XMBA 2FJXA 3TVYA 1BWVA 4AQYF 2CNNB 3HK2A 2AF6A 1R6VA 4FXWA 2ZHBA 1DTQA 4HACA 2VJUA 1I94F 2FGCA 1DQ8A 2DY1A 2CNLB 2B56A 1WDDA 2L3MA 1SH2A 1O51A 3BJYA 3OUYA 3POTB 1FKPB 3HFVA 4M1KA 1WI6A 2K3KA 1E6YA 2VBYA 2Z2LA 3VAFA 4RW8A 1UEKA 2BM1A 3GE9A 2BX6A 3IM9A 4X2BA 4B3TF 2CWKA 4BDPA 3MR3A 4QYZJ 4DFKA 4K5SA 3VTIA 2RVJA 1HMVA 3IS9A 4O4GB 4ANEA 1Y4ZB 2QYGA 4ZHRB 5LJ3Y 4PXEA 4P2SA 1R31A 3Q8YA 4D3HA 4K2XA 3AXKA 2VA3A 1XR7A 5KT2A 3G4SS 1VHFA 1U26A 3G9CA 2HHPA 1JLEB 3FBFA 4NYZA 4WF9Q 4DSIA 3GFHA 3OTBA 5LXYA 2DGQA 1HNXF 1SJ3P 1CJVA 2VUGA 5D15A 4CO5A 3OFFA 4N77A 3ZNJ1 4JI2F 2HIQA 3KJVA 2DXFA 2ZH6A 2FVPA 5MAOA 3OFGA 3UNYA 1S9EB 4IOAQ 1RT4A 1EZZB 5FLXU 3QGPA 5I42B 2DISA 4H4MA 1U1LA 4P6QA 2BM0A 2V67A 2GMJA 3OJSA 1R89A 1PBAA 2YH1A 2VHGA 4F3OA 1GAOA 1UVMA 2LMIA 3RBZA 4NLOA 4PABA 5ETPA 2WVBA 1GK8A 1PJ6A 2JNJA 2AZ1A 1WF2A 5LMUJ 2I5JA 3NLCA 2XO6A 3MR5A 3LGMA 2M0GB 4IFVB 1UL3A 3A3OB 1X5PA 4DUYF 1TMMA 3MUVP 4CLZA 1TK5A 2BANA 3BM7A 4MKYA 2FY8A 3VGUA 1QY7A 2F3JA 2KG1A 2J7WA 5K8OA 3GSDA 4C98A 3GG1A 3MD1A 3SSRA 4NRTA 2KYZA 1HKAA 3KUEA 4DV4J 1HQEA 3BB5A 3CSKA 4JI0F 4PQAA 2W4DA 3HULA 9RUBA 4RW4A 2DNOA 1HR0J 3MHYA 2HZVA 4WYWA 2JJ4D 3U1NA 1R43A 1SC3B 3UFCX 2XZTB 1QAXA 5AJ3F 4ZA1A 2PE8A 5G0RA 1NJIT 4G1IA 1REVB 1NDKA 4LMZA 2V8GA 2BKNA 3DC2A 2Q66A 5EX0A 2R7TA 3NBPA 4DR3J 1VFJA 4I68A 5D4OA 5EUHA 2DRAA 2WW8A 5KFCA 1SJ4P 2DR6A 3PO5A 2WVFA 3J81U 4YP3A 4DUZF 2IA0A 4NXNF 4K4XA 2NZ4A 4Z7YA 2DXDA 2MY7A 2LDYA 3NKYA 2EFNA 2M5YA 4OJ3A 1H72C 4MIBA 2ZBIA 1VK3A 2RRBA 3FUYA 5CYQB 2B4VA 3MAQA 1SUQB 2DH8A 2V4QA 1AFIA 2WONA 1KQSR 3MPYA 3CULA 1NAQA 1RTHB 2MSTA 3R5CA 3VAJA 1JLCB 2D74B 3TO8A 4B9VA 2HQFA 3F56A 4F3QA 5HQLA 1DZ5A 3QLHB 2HBZB 3E8OA 3WZ0A 1TK8A 3PRDA 3Q2TC 2CPFA 2HHTA 4FN5A 3CJ3A 3MECA 4DV2F 2O1PA 3TARA 3CD7A 1UP1A 4OHXA 4AL6A 4DL0C 1WC4A 2BQRA 1NRKA 1NK4A 4C11B 2FTRA 1GX5A 2OUGA 3CO0P 2B9XA 1YRXA 2AEJA 3R6GB 5HP1B 4CYUB 2Z4PA 4O3OA 2JC1A 4JYAJ 3D6MB 3H40A 3ZO7A 3CCWA 1Q8LA 2KL8A 2XQCA 4DPXA 4N5SA 5HMWA 1IKXA 3BPDA 1HBNA 3CCLS 2ZM6F 1CSJA 2WB4A 2DTJA 3PY8A 3OD2A 1MN7A 1N6QA 2B0GA 4LR9A 4DPWA 3GYNA 1IR0A 3LANA 4HKQA 2OMLA 5ETKA 2VQFF 4MJKA 1QTMA 3EDQB 4B08A 3NRBA 1Q78A 1F5AA 3KLIB 4Y2KA 3G87A 3FEYB 4X4PA 1FK9B 4EMDA 4DR5F 3CCZA 5ETVA 4F67A 5GVQA 4EEYA 4NCAA 1URRA 3J81j 2W2OP 3UW1A 2E29A 2E5LF 4DL2A 2OMOA 4ID8A 1RT6A 3EUNA 3TJAA 2C3OA 3D4JA 1UTAA 3GV8B 5HATA 4M5JA 3U02A 4PG5A 2ABYA 4LF5J 4MH8A 1R8PA 2MSSA 3BZQA 1DTTA 2DGSA 4IFYB 1FWKA 4OZ3A 3L4BC 2AYGA 1T7PA 4DQPA 1X4FA 4J37A 1KHWA 2ZOMA 1LFWA 3VGVA 1OY8A 3QATA 3C66A 4PAAA 3R7BB 1IJFB 3I9V9 1BUXA 2X1AA 1FDAA 3DDKA 3IRXA 3KJFB 1CJKA 1RWOB 4YR0A 3A3NB 3NOCA 1S79A 4PQUB 2CPJA 3B78A 5D3GA 4ECVA 1HW9A 4B9SA 4MK9A 2NYIA 4LF8F 3B82A 3HHLC 1WC5A 2HNDA 5CXTA 5B09A 3HSJA 5IOLA 1RT3B 2XMUA 3CCSS 3D1OA 3HSZA 4RW7A 5C42B 2W9CA 2ROGA 5HJYA 2FZKB 1JMTA 3MCNA 1C4AA 4KY3A 5E33A 1JJ4A 3GCWP 2VDIA 2KZZA 3ZNUA 1HBUB 4B3RF 5DM6Q 2XC9A 1NH7A 2HHVA 2VF3A 2PA8D 4U6PA 1D9DA 3TJ9A 4FF4A 1SBRA 4RW9A 3KHLA 5A6PA 3PO4A 3BR9A 3OBIA 1RWWB 2HBQB 5J2MA 1ULRA 4JB8B 2KFYA 1FWLA 1RLCL 3FCWA 2MZTA 4WU2A 4Q5VA 3BQ1A 3SI8A 1VHIA 1I1GA 3A8KA 4JBCA 3IAS9 3IGVA 4C2MA 3J7Z5 1C0UB 4DV5F 2C42A 2AJ0A 5IQQA 2PI4A 4USMA 1IBMF 5C5JA 3BEGB 1T9VA 3V4IB 4CO4A 4KHRA 2W7AA 1OQ6A 2JC0A 2N7YA 2QL7B 2HFOA 3MUMP 5F8GA 2EXUA 4RWXA 3PRBA 1IBLJ 4F36A 1G4CA 5B0EA 3ELHA 4WFBQ 1CJTB 5JVGQ 2CJXB 3C15B 2W1BA 2QSWA 3W9JA 2RKIB 4G1QA 3TVKA 4OYWA 1HQUB 2IIHA 2B8PA 5A0YA 4X64F 4C8LA 1RHJB 3A4TA 1WHYA 1NK8A 1HLWA 2RRAA 1JWWA 1XK8A 2GHWA 3N5BA 5LM7E 1SJQA 4DQQA 3QBCA 4KO0A 3POTA 1FKPA 1PC4A 1VS3A 4LFCJ 4N76A 5GAHI 3RBDA 2WOMA 5AT1B 5I3UA 2MQMA 2VFTA 2ZZNA 5KFFA 1HYSB 1VQ6S 2UXBJ 3VAMA 1HPZA 3MM5A 3BYRA 1MWZA 4ES3A 1SV5A 2LYVA 2HWTA 1ZAWA 2HHWA 3LPEA 3TANA 4W92B 2X7IA 1S0VA 3IP0A 5A2QY 3MWBA 3FK4A 3AODA 3QSYB 5KT5A 2ASLA 1S77D 1HD1A 2G2OA 3VALA 2WAQD 2O5DA 1SKSA 3EJMA 4KBIA 3MAHA 1RAOA 3NEKA 3A8JA 2P6SA 3C3LA 1S5ZA 2MY8A 2VKZG 1LWXA 3WHIA 1RT1B 4H54A 1WEYA 1S9EA 3NCQA 1VQSA 3C19A 1S9GB 4USIA 4DQIA 1YJ9S 2C2RA 3L7PA 2GMHA 2FLLA 1I51B 1AZSB 2OTLS 1M0SA 2OIHA 2Y1LB 4KH0B 2X3DA 5J1PA 2FYXA 3CDWA 3TA1A 2R2SA 1N5YA 4Q2MA 3QPIA 5I3PA 1RAFB 2E5JA 3MM8B 4NLQA 4K4UA 1AFJA 2H1YA 2BE2A 3GJSB 3UDEA 1D9FA 2MQQA 4Y2AA 5L1IA 3P4UB 4X66J 1P1LA 1FFGB 4DWIA 3G71S 4MTPA 5DQGA 1F60B 2LDIA 2YQ3A 3OTCA 3ILLA 2DD8S 1VQMS 2KXFA 4FP9A 3W9IA 5F8NA 3VGTA 1EJ7L 1RTIB 1NJWA 2A0FB 3CTRA 2KJWA 1UVKA 2V68A 3PEJA 2J0QD 1WC1A 4QR2A 2AJ2A 1HNWJ 2DNGA 4KFBB 1XMOF 2DT9A 4FZVA 4RW6A 2VPZB 2M7SA 4J9VA 2XO7A 5LSLA 1MMLA 1REVA 2SXLA 4Q2LA 5HVGA 2XS7A 2BUNA 4ECUA 2R2UA 3X3UA 4YR2A 1TK0A 2HYIB 4ER8A 3PM9A 2OPSB 1RJJA 2DNMA 1UVLA 1RADB 4M8LA 4LREA 5E3PA 1KLMB 3EX7B 5CABA 4DL3A 3IO1A 2ALZA 4QIVA 1JNRB 2FC9A 2YNHB 1PG5B 3T5HA 4L76A 4DV7F 2R7VA 3R5AA 2YPYA 2PA3A 1FA0A 3CJTA 2YWKA 3HVAA 1MMNA 3NNCA 3BGOP 1N8RT 1SUQA 3D67A 4Y65A 2P2CB 1EKSA 2UUBJ 3B6BA 4OYIA 3V6DB 2LP4A 2MKHA 4NXMJ 1GTEA 2CNKB 4J9UE 1S1WA 1GXTA 4OV6A 2HNZA 1F5BA 3N9UC 1HNXJ 4F7VA 1NNDA 3RR7A 3ET6B 1R7IA 4PG7A 5A8WA 2VZ9A 2NUHA 3TRGA 2OSRA 4C11A 2V8PA 4RLEA 5JXSA 1DURA 3VAKA 2NXNA 4Z7CA 4CYUA 4KYZA 2YNFB 3BSCA 4IYQA 2VD3A 2ZH8A 4M5MA 2DVIA 1FKOA 2PDAA 1T9WA 1G3OA 4RBTA 2W24A 2XSJB 3M30B 1R0AB 3GILA 1RA7A 4CLFA 3MAAA 3TA0A 4FKXA 1S97A 2D9PA 4NA3A 1FXDA 4DUYJ 4K5RA 4CLPA 3O2IA 2DH7A 5HBMA 4CP5A 1Y5LB 4NYPA 3I87A 1N36F 2QFIA 4QIWD 3CO9A 1FE0A 1JLAB 3GV7B 1WDTA 3AFGA 4NLSA 3DLBA 4ECRA 2E1MC 1UJ4A 7FD1A 1G7CB 1NU4A 1FK9A 2V4JB 2QA2A 1TQLA 2MPUA 3W64A 3RAMA 2ZKUA 3DRSB 4HVZA 3I31A 4TVAB 2F40A 2MZ1A 4PYAA 1BGXT 3UCZP 1VIOA 2XWXA 1MN9A 4OYZA 1HBMB 2XLKA 2Q79A 3RB3A 4PEOA 3FQKA 1HNIA 2ZD1B 1ZM4A 4IO1A 1Y10A 4YQWA 3M8YA 3CJ8A 4KHMA 2IVYA 4DR6F 1HI1A 2Y0SD 3QT6A 4DZ6A 3ENAA 4IFYA 2IFXA 5D77A 1NSAA 1SC4B 2YWEA 3AOBA 1LV5A 1N5SA 1L3VA 5B7WA 1T05A 4QW8A 1NB2A 3C46A 2J6SA 1Y00A 2HVZA 2KT2A 1UMJA 2UXCJ 2QL9B 1ZBTA 3Q8RB 1IBCB 4ZPWR 1R0CB 2AGOA 3HZGA 3KDNA 4DPTA 3UR0A 1RT2A 2XLJA 4PQUA 1TKXB 2COLA 4PG4A 4EUVA 4HHHA 1C1CA 3BKTA 1O0PA 1RT3A 4ZPTR 2V2QA 1OSCA 3OQ2A 2YKPA 3N6LA 4OI6A 3HHKA 2E5HA 2OH2A 5GMEA 4YUDA 3K2YA 4DU7A 2A3JA 1ELOA 1VR6A 1WACA 2D3O1 2QIFA 1V9OA 5GAGI 1VLYA 4DV3J 3BDEA 1LFPA 1FJEB 5MLCV 3DN9A 3ZZPA 2MGZB 2DBBA 4TY8A 5HROB 3FCHA 4XDCA 2HNYB 2BJ7A 4NLVA 4Y2CA 4MYTA 3TQ1A 1RSCA 4ZPVR 1S6PA 3K59A 1S10A 4ZKAA 1FTRA 4NLTA 5DQHA 2XYGB 3BGLA 4QIEA 2BXJA 3MR6A 2GA7A 3BSAA 3W65A 1TP7A 1G6BA 2LQ8A 4NI2B 4LFBJ 2CDQA 3PHEA 1FX4A 3PKMA 2KM8B 2FVSA 4DR4J 4Q0BA 3W2VB 1XWLA 4K59A 3TZYA 2V2VA 1S1UA 4C3MA 2CQ3A 5ETRA 5ETTA 1C0TB 1C0UA 4CLUA 2JLGA 3ZTRA 2DEIA 2G4BA 4ICLB 2XNQA 1NHUA 4LF2A 1SI9A 1CQNA 1E6VA 4X65J 3GB0A 4JI8J 1J5EF 4IH5A 1N33F 4C4WA 2J0XA 1CS4B 1FRKA 4LBHA 3NNAA 1HA1A 3D5MA 5B0FA 3T5LA 2E1AA 3T1HJ 6AT1B 4YY3F 2HGNA 3S01A 2RKIA 2LFVA 4AT1B 1N52B 4JI4J 2QG9B 2HBRB 3OL7A 3PG9A 4CH0S 1VJQA 3JTOA 4KGMA 2BRKA 2VG6A 1RHUB 3G6VA 1J27A 4ZITA 3FGVA 3MM7B 4K2JA 4B3OB 3Q2SC 1D1UA 2PMHA 2P8IA 1LW2B 1J5OB 5L46A 2AX1A 4HI2A 1EP4A 1WOOA 2C1EB 1S12A 4LIWA 2A1BA 2M52A 2YQ0A 2VV5A 3FRZA 1TL7B 4PWUA 4IDKB 1MWYA 2CQ0A 1RAGB 3O3LA 4JV1A 2LQ5A 3PX0A 1V3RA 4BHQA 3QNWB 3OTDA 2DIVA 5L9XA 2MYFA 4EK2A 4FKYA 4LF8J 1MROB 2PD1A 1CULA 4CZCA 2VONA 2L48A 1PYOB 1SQGA 1YHQS 3J7A1 4H4KC 1VC5A 4F0MA 2UXDF 4HDHA 2BA9A 2NR0A 4QR0A 3QT5A 3DRPA 4Q43A 1RGVA 3ONQA 1U8SA 2DHXA 1OO0B 3MPWA 3IG1B 1BQMB 3D6FB 3PIPQ 3S6EA 2YWGA 2DNHA 2QLJB 4BWMA 1WSVA 3OR2A 5SZTA 3V6KA 4JOUA 3S7RA 3KTQA 4LFAF 3N4WA 3K5LA 5IQ6A 2W25A 2HS4A 4C0BA 3HFZB 3D1QA 4P74A 1W26A 3PRVA 1A7GE 3HKWA 1RKIA 4FYYB 4KT0C 4GKKJ 2H4WB 3U7JA 1RWVB 1VK8A 1CBKA 1VIXA 3W7BA 3HSDA 3SYZA 3H2UB 4DV0J 3M9MB 2CDRB 1WKKA 3ZZYA 1TL4A 1HWJA 1FTCA 3QRQA 2BMBA 2QN6B 4GKJJ 2LEAA 5K14B 2LEPA 1U1KA 1HIYA 2MKYA 1K1SA 2D3ZA 2FHMA 2UVRA 3ZTSA 1Q4RA 2E1CA 4NLYA 2VBXA 3GV5B 1TTHB 5E3RA 1LXNA 1RTIA 4TLQA 3G86A 2ZZMA 3DXSX 4LF9F 2PMWA 2ZHAA 3LP0B 2VOOA 3PZPA 2KI2A 4RUAA 4U8YA 2K7KA 2J5AA 2V94A 4YHHJ 4UQTA 1WUUA 5H9FK 3NG8A 3OTOF 3ZZUA 4JI6J 4W98A 3IR7B 2ASJA 4QW9A 1BHNA 2Z2YB 4X84A 3D68A 1Z1ZA 2A2CA 4AXJA 4J9KA 3QT8A 1PYTA 2OPSA 2CNOB 5IWAJ 5CHCB 3M8RA 4WFXA 5DRKA 2YNHA 3M2RA 2VG7B 4UUWA 1RHKB 1GXUA 1ZZFA 1JQGA 2VL1A 4B02A 1JIHA 2OELA 2VC0A 3JSRA 5U47A 4OZLA 9ATCB 3V6DA 5KT6A 3NCPA 4DG1A 3KK1B 5JMNA 1JLBB 3G82B 3M8SA 3EVWA 1FXLA 3H4DA 2Z2ZA 3VR1A 2UP1A 5F8JA 3H90A 4G3IA 2LQ9A 1VBZA 5BJRA 3OLBA 2DKOB 1GXLA 3A1YG 4IH7A 4MFBB 4E98A 4YFUA 5CD4H 3DRRB 2ZJRQ 2K1RB 3BS9A 1TVRA 3KLFB 1CJUB 2VJVA 3DLHA 1D3WA 2FVQA 1WNEA 3CVKA 4BWJA 4O0IA 3BH7B 2RILA 1KFSA 2FJDB 3A3PB 2FLNA 4UOCA 1RWXB 4EYIB 2EKNA 3ENWA 1P27B 2B6AB 4A4JA 2HHSA 1FXRA 3DXBA 2RD5C 3MOZA 2GFFA 2YQ1A 4UQGA 1NDLA 3I5BA 4WKRA 3SV4A 2XSJA 2JLFA 3M30A 1OJ4A 2VG5B 5HJXA 4UY85 2YKNA 2XBPA 2AYBA 2EPIA 2Y0BB 3RRGA 1YBAA 2YWWA 3QYYA 2EC2A 4KGXB 3QO9B 4CO3A 2QSFA 2CKWA 4ECTA 1N54B 4WXWA 3S1TA 4RNNA 2VBZA 1JK9B 2ZZTA 4PUOB 3AAWB 1JLAA 2KYXA 4OI3A 3N6NA 2LXIA 3PVXA 3IWNC 1QD1A 2JEGA 3QJJA 3EMTA 2V4JA 1CLFA 3OL6A 3DGVA 2DRDA 3D3BJ 3RB4A 5GADU 3AH6A 2DYAA 3QRPA 2HK3A 4F4XA 3LA0A 4JP8A 1WHVA 2RH3A 3ZZOA 2QA1A 2C3UA 3W8PA 4ZDNA 1UPPA 2ADCA 1FFSB 4HTJA 1HBMA 1EKRA 2AJ1A 4J9OA 2GIRA 1WEZA 3V81B 2ZD1A 2XWYA 5KFDA 3VHQA 2RDIA 4OL8A 1JKHA 3DYAB 4RO0A 2V34A 3D3CJ 4NLDA 5IT9Y 3HKZD 3BSOA 2B8QA 2EFQA 2D69A 2DNZA 1SIZA 3I0RA 1MSWD 1YI2S 1PGZA 1LW0A 5F8HA 3RBEA 3Q86A 2VA2A 5L39A 1TV6B 2DPIA 3HO1A 1QAIA 4K50A 1HI8A 5J1NA 2R2TA 4P71A 2Q6CA 1Q81T 3Q8UA 2UVWA 2C22A 4QJVA 4ZIWA 3VCDA 4DL4A 4M5GA 3VZIA 1D8YA 1VYAA 3DOLB 2HHHF 5T41A 3UQSA 4MIAA 3AJ1A 2CQ2A 1PILA 4OYBA 5CQGA 3QAEA 2RQCA 1WG4A 1TKXA 1H2UX 2L41A 3RUBL 4V1Ak 4IUFA 2C2NA 2LXUA 3K57A 3MMCB 3BYPA 5LOQA 4UTGA 5DG8A 1NSKL 1PSDA 1FEEA 4FS2A 4DCPB 4ELUA 1VQ4S 5J2PB 1FDNA 3LGNA 2J0SD 2ZNZA 3GYXB 2HZAA 3DLJA 3WQPA 2IM0A 1IKVB 2XMVA 1F1BB 1HR0F 3FSIA 2MZRA 3RYLA 2KH9A 5HMZA 5DS7A 2M8HA 4HACB 2R8HA 4ZVUB 3MMBA 5BR8J 4I69A 3HVRA 1LXJA 1IWGA 1K44A 3MMJA 1NK6A 4ES2A 4OX6A 3OUYB 3DOMB 4DR3F 3W2VA 1N36J 1HHTP 1E6YB 3QJLA 4MKVA 2BR0A 3I9ZA 3D0HE 4USTA 4DEZA 4ED6A 4RW8B 4KV8A 2R9LA 1C0TA 1WOPA 2HFNA 4Y00A 3BF4A 1BQXA 1HI0P 1ZTTA 2AW0A 2IAJB 4J9RA 3E3XA 4O3QA 3SFUA 5IC4B 3MTJA 5KFKA 3IS9B 1U25A 1YVFA 3THVA 7FDRA 3A8IA 2OFHX 3CUNA 3D6HB 4I2PB 1QTNB 2CVEA 2CG4A 4HHJA 4WTOB 5B0DA 4X4UA 1CJVB 2IRUA 2DPJA 2EK1A 1PCAA 1OY6A 1HNZJ 3OLAA 3KJVB 3MM7A 2W8KA 4DXLA 1SB6A 3MTKA 1RT4B 5A2QU 2MJNA 4CH1A 4CLWA 4H4MB 5LL6d 3UO0A 2DGTA 4RX6A 2R7WA 2MQNA 3QFWA 4IRKA 2XZDB 1FNMA 3KYLA 4JYAF 4FPIA 4E8UA 1TL7A 5HAOA 4IDKA 1YLXA 4TU9A 1SKUB 3FEXB 4OYXA 2LKZA 3TR5A 1B0VA 3LO3A 1M1HA 3GR0A 5KFHA 3DLKA 1OPZA 3HZEA 4E2FB 2CQ4A 4HT7A 2VH7A 3HVTA 2BANB 5C2CA 5AXMA 3AOCA 5E2QA 5F3ZA 1MW7A 3TUZC 5I4MA 2I1RA 2EFGA 5C25A 1S0NA 2ZH1A 1S72S 5CA5A 1HQEB 3D0IE 4OHZA 5J1EA 3OL9A 3IN5A 3IG1A 1BQMA 3W5XA 3IBCB 1XR6A 4KQZA 2MKIA 3NWRA 3U1MA 1EIYB 2QMXA 2XGQA 2ZJPQ 1N34J 3DU6A 3DDNA 3L7UA 2G13A 2LA6A 1NBEB 3D1HA 5G0RB 2D41A 2Y3YA 1KDNA 4LF5F 1DJ0A 5IFMA 3NBPB 4DS5A 1N48A 3ZZRA 2DCUB 4DL7A 3A13A 2ZNYA 2PMZD 4N56A 2K3IA 1F9EB 2E7WA 3HVWA 2H51B 2EG2A 1ROFA 2ZH2A 4FYVB 2QLXA 2VOPA 3DGPA 3ILJA 2GAGC 4NZ6A 3CJ4A 1H38A 1KVKA 1U2RA 5L1LA 3P5BP 2FHKA 1A0OB 5KFAA 2C3PA 2QX0A 4N7TA 2CQIA 1RACB 2IBOA 4F02A 3ENVA 4Y28C 4QU6A 1F3VA 1FVQA 5A8RA 3W9HA 2FVRA 1M5KC 3D6TB 1JX4A 4ZPDA 3ENQA 1FO1A 5HQMA 3K5PA 2AT1B 2W7OA 3CDBA 1X8DA 2HS0A 1VMBA 4FNHA 5E5NA 5KFGA 2V2ZA 3MECB 2FJEB 2CWXA 1RTDB 3EPGA 4LF1A 5KT3A 4Q8FA 1KR4A 4WKYA 2B43A 1Q7LB 1GMVA 4DUTA 4KH1B 3LF0A 1NSQA 2QGFB 3C2PA 1FD2A 5J2NA 1NCLA 5F8IA 3SQGA 1B70B 3CC4S 4DZDA 5A8KA 3KHGA 2GZOA 1IKXB 3T6BA 1HBNB 2VG7A 3CIMA 4ZLPA 2WTFA 5DZ7A 4QWCA 2FD2A 4IG0B 2W7PA 4F4YA 3OSPA 4Y6IA 2ADBA 4ID5B 1NPRA 3O5TB 2K8GA 3J7AN 3NAHA 1CQMA 2HHXA 3AHPA 3FKBA 3KK1A 1XNRJ 4KRWA 2DGXA 2EKYA 4Q8EA 1CPZA 1KNZA 1Y11A 3V4MA 1RUSA 3IBFB 2O67A 4K4VA 3MCMA 4OI2A 4JV2A 2NPFA 1MWQA 2MQ8A 3I0SB 3LP2B 3DRRA 3Q89A 5KFEA 2K1RA 1RT6B 3I56S 1MMDA 2C3YA 1IBLF 1X60A 3NGSA 1U6BA 2U1AA 2BRLA 5KT7A 3O6QA 2FB0A 4Y3CA 3GPAA 1FNXH 3VZHA 2HLTA 4OX8A 2V8DA 3RGIA 4A46A 1VQOS 1HQ2A 2W2PP 2K7JA 4QCLA 3EGZA 1DTTB 4LSLA 3BGFA 2F4VJ 2ZH7A 4QPTA 4CT9A 2R8GA 2JOQA 2VG5A 4KHPJ 2AJQA 3F41A 2L9WA 4ANDA 4U8VA 2I0XA 3CMQA 1YJNS 3OXFA 3HHLA 1C4CA 1RAIB 2HFUA 2YX4A 4DFJA 2M3DA 3IA0A 1L3UA 3LAMA 5KG6A 4OZ0A 3W3SA 4LFCF 2CPDA 3UPFA 3IRXB 1SH0A 1WF0A 2KZMA 2V5HG 1T3OA 5J2QA 1Q86T 2RF2B 1KTQA 2C2DA 1S0MA 5DG9A 4USUA 4LRFA 2POKA 1CC7A 1BY9A 2M4MA 2MLZA 2HNDB 1B4SA 2KVQE 2XY7A 2QC3A 2IMWP 2CYYA 1OQ3A 4FBUA 4RW7B 2CJQA 3SBMA 2OEKA 2W9CB 3R7NB 4HL9A 2AP6A 2YWFA 3GWCA 3EZ5A 3MPUB 4F26A 2CJYB 1VQ5S 4HDGA 3M7VA 1IBKF 4ZS6A 4FDFA 2D3OR 4DL5A 3DYAA 2L9DA 2IPOB 1K73T 2AWZA 2EG1A 4TQRA 1KEKA 1RWUA 4NX9A 4MT1A 1FNOA 1GEHA 3H5UA 4YS2A 4M5DB 4EI2A 3FRYA 2O66A 1KOHA 4TU8A 3QZ7A 3CIZA 5GAEI 2V8HA 4D3GA 4M5NA 5K8MA 4C7QA 2B4UA 2H5IB 5J2MB 3AY0A 4IO9Q 3OJUA 5KFOA 2QRRA 2QTWA 3UN2A 4KJIA 2WW4A 2RU3A 1D09B 3AB2B 4HEA9 4LRCA 4OIXA 1O6XA 3TEGA 1XERA 3R9LA 2M2BA 4CRJA 3W1YC 2GIFA 1FVSA 1RT5B 5AXLA 2PEBA 2Q3PA 4DSLA 1KRPA 3RB6A 3P3DA 4M63A 2YTCA 2AGQA 2VFRA 4HT5A 3FEZA 1NKEA 2Z0GA 3N01A 4IG3A 4GC6A 4X66F 2FQQB 2MKJA 2FZCB 3HFKA 1VOMA 4CM0A 1WC0A 2HURA 3GIJA 4Z37A 1S4FA 3NS6A 4ED8A 2OPPA 3GR1A 3KK3A 2DR9A 4ZOSA 4LF6J 2QV6A 3P5TL 2GAHC 5J2PA 3J81Y 1KP6A 1CEZA 1S7HA 3OL8A 3I82A 4G65A 1FCAA 2AKWB 4ELTA 3EPIA 3MURP 4LF4F 3VQSA 5A0YB 1HNWF 4YMEA 4RJVA 5CH7B 2AYEA 4ZVSB 1S6UA 2UUAJ 4RNFA 1ZAVA 3HLUA 2UV8G 3DRXA 4ANCA 1ZA1B 4KIAA 1AW0A 2K2PA 2X3GA 4UZCA 4L72B 2HK2A 2UVVA 4X4QA 2AQ4A 3HXMA 2IA6A 2LVWA 3J7YI 3H5SA 4KO0B 3DOMA 5FIIA 4OZNA 3RU0A 2KO1A 3K5OA 2GHVC 2R8JA 2WOMB 3ISND 5I3UB 4DX6A 3FFIA 2RQ4A 3W66A 3OV7A 2IAJA 2HQIA 5D0HA 2F8EX 1T3NA 1RKJA 4J91A 3JSMA 1HPZB 2V8VA 4AUKA 2NUUG 3MM5B 3P49B 2RUSA 3H0PA 1NH8A 2HZCA 1SV5B 4DS4A 4QQBA 3HP6A 4JV5J 4CDIA 2JX2A 2UUBF 2GQ2A 3CD0A 3ILOA 4XO0A 3I4PA 1SKWA 4NXMF 4I2PA 1HWKA 3LP1A 3MEEA 4FVCA 3GONA 4NOHA 1NM2A 4X4TA 2HMIA 4XIUA 1T02A 4AFFA 4M95A 3MZIA 3QIPA 4UZBA 3TAMB 5EDWA 1UEUA 1EETB 4YDXA 3H98A 4ZLLA 3UN5A 4PWDB 1NKCA 4NLXA 1WF1A 1RZMA 5IXUA 4IQXA 5F9NA 3BGUA 2DNYA 2HG4A 4L74A 2VPWB 5HL7Q 3R5GA 2HHHJ 4I0WA 3TOQA 2JHEA 3AD8C 4K4ZA 3O1LA 6FD1A 4GVBA 1X5SA 4Q44A 1RDRA 4DSJA 1W7WA 3M8QB 4QWDA 2DNRA 1N5YB 2ERRA 1X5OA 1RABB 3WDOA 3UVJA 1KOOA 4TKTA 5E41A 1YWXA 2JL9A 4ZP6A 2BE2B 3VQTA 3V6JA 1HBOA 2AX0A 2OLWA 4XK8C 1YJTA 4I2QB 3U1LA 1DBDA 2MZQA 2GQQA 2I9SA 3MFHA 4P75A 1RCXB 2E1PA 3OVSA 4J90A 4DFPA 1T9YA 4ZJQA 1U47A 1RYRA 1UJ6A 4P73A 4I1TA 1GQEA 1SJRA 1C2PA 4B3MJ 2H65B 3TZWA 1WSRA 1VQ7S 3OVBA 5H9FJ 4RW6B 3T1YF 3CF5Q 3GTYX 1YQHA 1AB8A 1FJ7A 1V3ZA 1XBWA 2CXEA 3KLGA 4K0KJ 3NMAA 2RJZA 3GSIA 5THWA 4QPXA 1H74A 2CJ9A 3EGWB 1VQ8S 6FDRA 2JH3A 2EFOA 3NGTA 4UW2A 5A76A 3HT0A 4F4WA 2B51A 4GO5X 4IRCA 2HIYA 2G9OA 4OI1A 3KFWX 1T9UA 5L38A 2CVIA 2EFPA 4OYAA 2UXCF 3CJ5A 8RUCA 3H20A 2R7RA 1ZM2A 1FEHA 4QBUA 1BC6A 3PW7A 3I5CA 2MKKA 2KHCA 1QJHA 3CGIA 4GRSA 1S1WB 2YX7A 4URSA 1PIEA 2QMUB 2KXHA 4LR7A 2HNZB 4DDFA 4HHUA 1RLDA 3WIVA 2CADA 2J76E 1JLGA 1DQ9A 2FUG9 5A8WB 4EZ9A 3NAIA 1RTDA 4HLBA 3LTOA 3THTA 3OR1A 4B3SF 2XYPB 2V50A 3KHRA 4B9MA 3SSQA 1UA1A 1KD1T 4DV3F 3CXCR 2OP5A 2RMLA 1FKOB 2CQBA 1RBLA 4GC7A 1FX2A 1YX2A 3FZBA 2OO4A 3ILIA 3JYTB 4C9DA 4Y34A 1H6KX 3MAAB 4EBCA 4IOCQ 4NL5A 5FJ4A 3PV8A 3CE8A 3PR5B 1KC8T 1TL3B 4LFBF 4IG0A 1VDHA 4OI0A 5HBMB 1ZPWX 2G0CA 1XJWB 4ID5A 4DR4F 2OHDA 1RBOB 3SDEA 3PW0A 3M9OB 5T14A 2V4RA 2BW7A 5KFQA 3V5RA 3KG0A 3CT9A 3I6PA 1FT8A 3K8WA 3LQVA 1LK7A 3BPSP 2IRYA 4X65F 2I38A 1G1XA 1JLFA 4JI8F 3I0SA 3LP2A 4OZ5A 1EARA 2X1GA 3D9BA 2GS8A 2KVIA 2DHAA 3I32A 4A8FA 1YTYA 2RS8A 4N8NA 3KLHA 3DLGA 3IMQJ 3WC2A 4RL1A 3IBWA 3T1HF 1Y7PA 1HNIB 5HI7A 3AOAA 2H5JB 5ETMA 4BCAA 2Y9HA 3PJWA 4OI4A 1T0TV 3GIMA 5D0GA 4JI4F 2XGPA 1U0HB 1FRJA 3CJSA 1VRUB 5IT4A 5HMYA 3IGNA 5DJBA 3UD5A 1T05B 3PIOQ 1W25A 2WZ1A 1L3TA 1CG2A 1MLAA 3SCIE 3DRYA 1NK7A 3PX6A 5DLGA 2JWNA 4DPOA 1NHVA 3J80Y 5DDOC 5IT9U 3K8VA 3WBZA 3BV8A 2RF2A 4LRBA 3KHHA 1RT2B 4DX5A 1TR0A 1X0FA 1PC5A 2D3UA 3SMZA 3DCAA 4X4NA 1T03A 3S8SA 2O3DA 1C1CB 1YRUA 1W2IA 4A47A 2UUCJ 3MEKA 3MM6A 2BQ3A 1NB7A 4DLGA 4XPCA 3QWPA 2GGPA 3VWSA 3H42A 4C8MA 1Y9OA 1U6FA 3QIDA 5F0UA 5KFXA 4LF7J 4DV1J 5KAKA 3AD7C 1U2FA 2DHGA 3WX4A 4ZVPB 4OYOA 5B0AA 2PT0A 4P52A 2GNKA 1J2VA 5HLFB 2W2NP 4M5DA 4TY8B 4P2FA 3CC7S 3F0NA 5KFSA 1S6PB 3MXHP 5ETOA 1V3SA 2CUYA 4TXSA 3I4HX 2RSQA 1U0SA 4ETXA 1H73A 4K4SA 2IM2A 3GCXP 4Q0BB 4GKKF 1NUEA 2FVCA 3BSNA 1S1UB 2OPQA 4DR2J 1RT5A 4JI7J 3NXZA 2XSFA 4DV0F 2PSZA 1HD0A 2E9RX 2W01A 4NRUA 4NZ0A 4DN9A 3KXDA 1Z4UA 1E6VB 4GKJF 2VICA 3BKFA 3PW4A 3M8WA 3OVAA 1H7WA 2OGUA 2BKPA 4OV1A 4XAKA 4MIWA 3HT3A 4Y2IA 1PYSB 3BGRA 2CQHA 1F9FA 4Q45A 4ETZA 3QT7A 2VG6B 4CIOA 3UD4P 4YHHF 4CI0B 1UFKA 2MQOA 4JI6F 2JZ5A 4X62J 2Z30B 4O44B 3H8YA 5L9NA 2QLFB 4TN2A 1FWPA 1EP4B 3CDEA 3M6XA 4O0NA 1B99A 1UZDA 3VAIA 3JB9k 5IWAF 4ZP8A 3RW7A 1IJEB 1WG1A 1UKUA 1X5TA 2XG8A 3CDUA 1IKYB 2U2FA 3JTPA 4PPDA 3EM1A 3HM9A 3T9NA 3TP2A 1YGYA 1CULB 2GJIA 2KRRA 4CTAA 2O01C 2P9CA 2KJVA 5KG4A 4PXDA 2XULA 1QDUB 3O44A 4P9SA 1NJYA 1TL1B 2B3TB 3DHXA 4KAIA 4W90B 3PFEA 2H4YB 2RT3A 1IBKJ 2DH9A 3PJXA 2B5JA 3DRPB 3B4MA 4B17A 4J9MA 4F4ZA 2QLWA 1X4DA 5LXRA 2NXCA 3MR2A 3SEOA 2J9CA 2E9TA 4GMKA 4WCEQ 2ZDOA 5K8PA 4ZN1A 3OR2B 3TAMA 2DR8A 1EETA 3R2CJ 4O23A 1IXKA 1JXEA 4PWDA 1DAXA 1S0OA 1RK8A 2HLUA 3DU5A 3EDRB 2A6MA 1Z2LA 1M5SA 3O8WA 3CCES 3M2VA 4A8OA 3M4XA 2PGCA 4CWBA 4NMLA 1RCOB 3H25A 2B9YA 1UZHA 3OHAA 4ECZA 2HS3A 2DNQA 2J8SA 4I6WA 2DNNA 3M8QA 5HQ8A 4PCQA 4GO7X 1UVJA 3CWJA 1Y3KA 3PHTA 1X4AA 5F8MA 1T94A 2RU9A 1GH8A 2ZH4A 1XMQF 1VBYA 2F8HA 4NYOA 1SH3A 2XNRA 1YIJS 3R3TA 4ECSA 3M2UA 4I2QA 5H9EK 2YBVA 2RNEA 1OS5A 1IN0A 2BZ2A 3HHDA 5F41A 1LWCA 2HAFA 3QRRA 3KDOA 4U7UD 4C97A 4LF4J 3IWLA 3D7SB 4ECWA 1UW9A 2AYMA 3QFHA 4DL6A 2YKMA 2GVZB 3PW5A 3GYGA 2FLPA 2XI2A 2MZJA 1EAYC 4NLGA 4LQ9A 1IKWB 3OXLA 4DR1J 1HWLA 2PFFB 3H7HB 2BJ8A 1SCJB 2YNIB 5KFPA 1XR5A 3Q8VA 1F2HA 4A48A 2XS2A 2HQDA 3HHLD 3M8ZA 3LAKA 3M2RB 2C2KB 3ZTPA 2EWHA
chains in the Genus database with same CATH topology
2C3OA 1YVFA 3THVA 1LWEB 3VAGA 7FDRA 3GV8B 4J9NA 2GO9A 1S9GA 1XEZA 3RAQA 2OFHX 3U02A 4PG5A 3CUNA 2ABYA 1O5JA 3SCJE 4NLRA 3HHEA 1RTJA 4J9PA 4FPRA 4I2PB 4MH8A 4L6V3 2CVEA 2DNKA 2CG4A 4CH7A 1R8PA 2MSSA 3BZQA 2IRXA 4WK1A 4HHJA 1DTTA 4DG1B 3SZ2A 3NNHA 2DGSA 5GADI 5KOXA 4IFYB 5B0DA 5GAHU 2YKAA 4OJGA 4X4UA 1R27B 2IRUA 2AYGA 1T7PA 2DPJA 2EK1A 2HPUA 2JFKA 3FSYA 4DQPA 1X4FA 1NJXA 3LPYA 4J37A 2OPQB 1TFYA 4IOBA 1KHWA 3TAQA 2ZOMA 3MM8A 3OLAA 5D6GA 1LFWA 3B4DA 4WJBA 5SUHA 3KJVB 1LWFA 3AB4B 3CD6S 3KLVA 1R8CA 2KDOA 3MM7A 2W8KA 3LW5C 3N6MA 2LQBA 2NLWA 3D54A 1VQYA 1SB6A 3C66A 2Q6BA 3MTKA 4DQSA 1U1RA 1RT4B 2HRUA 1KLNA 1S1TA 1BWEA 2MJNA 1HL6A 2J9EA 1RAJA 4RNMA 1TVRB 1FDBA 1VQNS 3H2LA 1IJFB 3I9V9 4CH1A 5L1KA 4H4MB 3QMQA 5LL6d 2X1AA 1UFLA 2CQCA 3FZ2A 1FDAA 3DDKA 2DGTA 1KVIA 4RX6A 2R7WA 2MQNA 3GMGA 3IRXA 5B0BA 1QVFR 1QLNA 4IRKA 1FNMA 3KYLA 1H3DA 1X0PA 4JYAF 2M70A 3FNNA 3H2VE 4E8UA 4AYBD 3MD3A 4YR0A 4IDKA 1KTVA 2MHEA 1YJRA 2GMLA 4BS2A 1S79A 2RRNA 1SQEA 4DR7F 4NWBA 4RNHA 1NK5A 3UDCA 4TU9A 3FEXB 4KGKA 3PDNA 2WBMA 3CCJS 4PQUB 2CPJA 2FIUA 3B78A 5D3GA 4EO6A 4KFBA 3BGRB 4ECVA 1HW9A 3HHNB 2FY1A 4B9SA 2OPRA 1JLQB 2LKZA 4MK9A 2NYIA 4OJ1A 3GG0A 1B0VA 3TR5A 4LF8F 3B82A 3HHLC 3CJKA 2HNDA 3LO3A 5CXTA 3GR0A 5B09A 1FRXA 1SXLA 5KFHA 3DLKA 1RT3B 3JYTA 4WXOA 2XMUA 3CCSS 3D1OA 2KG0A 4Z2XA 2YKNB 1WD6A 4RW7A 3ISZA 5BR8F 5C42B 2W9CA 1OPZA 3DHWC 3RRHA 3HZEA 2CQ4A 2ROGA 1Y5IB 4HT7A 2VH7A 3HVTA 2BANB 2J0WA 4ED0A 1XTZA 1S9FA 1KONA 1JMTA 5AXMA 2FJBB 2CQGA 2A10A 2C3MA 1C4AA 1TL3A 2BW2A 5E2QA 5E33A 5F3ZA 5CYJA 1JJ4A 4U7UK 3KKFA 3G8SA 1MW7A 4DR1F 2KZZA 3TUZC 5I4MA 2I1RA 2EFGA 2L9NA 4DSFA 1HARA 1HBUB 2XMWA 1VI7A 5C25A 3KMQA 1S0NA 4B3RF 4TLRA 1KLMA 2HGLA 4I64A 2ZH1A 1S72S 5DM6Q 2NPIA 5CA5A 1HQEB 2M88A 3D0IE 2XC9A 1NH7A 2HHVA 3R5BA 1HWIA 2PA8D 2EK6A 4OHZA 5J1EA 3OL9A 4QWBA 4U6PA 3IN5A 3IG1A 1D9DA 1BQMA 1XR6A 4KQZA 2MKIA 1SBRA 4RW9A 3BO3A 4FF4A 3U1MA 2XY5A 2JEIA 4ED7A 4MMOA 3KHLA 2KM8C 3HJFA 5A6PA 3PO4A 2QMXA 3BR9A 1FKAF 4C8OA 3OBIA 5T7LA 2XGQA 4NA2A 2ZJPQ 4PRFA 5J2MA 1ULRA 3DU6A 3DDNA 2G13A 4WE1A 2KFYA 2LA6A 3T1AA 4QWEA 3P96A 4ZVGA 3D1HA 3JAMY 4ZPBA 2LEBA 5G0RB 2D41A 2MZTA 4WU2A 4Q5VA 4CTAB 4LF5F 3EXYA 1DJ0A 3BQ1A 3SI8A 4O3PA 1U6ZA 2WBRA 1QM9A 5FDLA 5IFMA 4FVMA 3NBPB 1I1GA 1MNEA 4DS5A 2WCXA 4YB1P 4JBCA 4FF1A 3IAS9 3MEDA 1N48A 3ZZRA 3IGVA 2DCUB 4C2MA 1JKHB 2B5JB 1Q79A 3MFIA 3J7Z5 2HVIA 1C0UB 5AXKA 2C42A 4DV5F 2AJ0A 4TY9A 5IQQA 4EFAC 4I7FA 4DL7A 2PI4A 1R8HA 2ZNYA 3RB0A 3IXQA 1IBMF 2PMZD 2IYIA 4N56A 2K3IA 5C5JA 1HNZF 2E7WA 1IUJA 3BEGB 3HVWA 3V4IB 4CO4A 2EG2A 1ROFA 4ZVHA 4KHRA 3I0RB 4B9UA 3EXCX 2YNGB 2W7AA 1KQFB 1OQ6A 5KFRA 2ZH2A 2LECA 1JJ2R 5I3QA 1LW0B 3MCSA 2JC0A 2N7YA 1VRUA 3K7RA 2QLXA 4O4RA 3OSNA 1KQGB 1H7XA 2KFZA 2VOPA 3BO4A 1XNQF 2HFOA 3DGPA 3MUMP 4NZ6A 1IQTA 3CJ4A 5F8GA 1H38A 5L1LA 1U2RA 3IC1A 3HX9A 1RT7A 3DLLQ 4RWXA 3PRBA 2BYCA 4AL7A 4ZP9A 2FHKA 5B0EA 3NS5A 1TAQA 5KFAA 1SL0A 2C3PA 3K0JA 1SC6A 4DSEA 2EW9A 2CQIA 2VBWA 4RU9A 2HW3A 3VAHA 2YNFA 2YKOA 4WFBQ 5E0OA 1TKDA 1S1VA 2IBOA 4F02A 1VQ9S 1MU2A 1HW8A 5JVGQ 4N41A 2GW8A 2W9BA 2QSWA 3CMES 3ENVA 1FERA 2RKIB 4Y28C 3M2VB 4OJHA 4QU6A 4G1QA 3LH2S 2XI3A 3TVKA 1FVQA 1HQUB 5A8RA 2CJKA 2FVRA 1M5KC 5A0YA 4F2RA 4X64F 1JX4A 4ZPDA 2ZOFA 3ENQA 4FNIA 1FO1A 1R0AA 3K5PA 4C8LA 1FJCA 2UU9F 1OSDA 2NSCA 4QOTA 1WHYA 2IMOA 4I6AA 1NK8A 2W7OA 3CDBA 4NLUA 2FGOA 1CC8A 1X8DA 4LJMA 5D4NA 2HS0A 1VMBA 4FNHA 5KFTA 5E5NA 5KFGA 2RRAA 3NL0A 3UNGC 1JWWA 1XK8A 3MECB 2HWHA 1WEXA 3JSBA 5HMXA 2FJEB 1B7FA 2XMJA 2GHWA 3N5BA 3NGDA 1RTDB 2PEHA 3EPGA 1GT8A 1SJQA 2I8EA 4DQQA 1QE1A 1JJHA 5GAEU 4F8RA 3QJPA 4EU0A 2RQMA 2R7UA 3HF5A 5KT3A 1URNA 4Q8FA 1KR4A 4KO0A 4WKYA 2B43A 3POTA 4OX7A 1FKPA 1Q7LB 1PC4A 3T9ZA 2BV3A 1YJUA 2ROPA 1VS3A 2GIQA 1RI7A 2R7QA 3KK2A 4N76A 3MMAB 2R8IA 5GAHI 1S6QB 1QAJA 2LA4A 3LF0A 4OZJA 3RBDA 2WOMA 3M2UB 1S48A 2MQMA 5I3UA 2VFTA 2IC3A 3C2PA 1GTHA 1FD2A 3DLEA 5J2NA 5F8IA 2ZZNA 2MKCA 3C6UA 5KFFA 1HYSB 3SQGA 1VQ6S 1ZZNA 3C6TB 3CC4S 5A8KA 5AE3A 3KHGA 2AGPA 4AL5A 1IKXB 1LWCB 3DRSA 5D4PA 3T6BA 2WSCC 1HBNB 5HLFA 3VAMA 1HPZA 2DJWA 2W9AA 2MHNA 2VG7A 3MM5A 3MGJA 1K8AT 3CIMA 4O3NA 3OFHA 4CO0A 2E5GA 4KC5A 4ZLPA 1NB7A 1MWZA 2DHSA 4PR6A 4ES3A 1SV5A 2LYVA 2HWTA 1D0EA 1ZAWA 2WTFA 1X4HA 3TANA 1N34F 2HHWA 1AUDA 2QEXS 4W92B 3MMBB 1UWBB 1S0VA 4LT6A 3SV3A 4QWCA 5A2QY 2ZDPA 3FMWA 1IM4A 2FD2A 2YKMB 5D4LA 4IG0B 2W7PA 4F4YA 3MWBA 1S49A 3OSPA 4Y6IA 4LUBA 3IR6B 2ADBA 2RB7A 2P9GA 4ID5B 3PACA 3O5TB 1SKRA 3OXGA 4CNYA 2K8GA 3M6UA 5KT5A 2ASLA 1S77D 1HD1A 2F9DA 3NAHA 4LIRA 1CQMA 1U1QA 2HHXA 4OMFG 1O8BA 3AHPA 4URGA 3KK1A 3VALA 2WAQD 2O5DA 4F50A 1SKSA 1DLOA 4KRWA 4U67Q 2DGXA 3MAHA 2EKYA 4KBIA 4Q8EA 1CPZA 1KNZA 3V4MA 1BQNA 1JB0C 2FHJA 4URQU 3V6HA 4KV8B 3K5NA 2P6SA 3C3LA 4TNOA 5K5MA 2O67A 4R0EA 4K4VA 4B9TA 1V6HA 4MKBA 2FDNA 2VPYB 2MY8A 4OI2A 4JV2A 2VKZG 4O3RA 2MKSA 2WK4A 4ECQA 4ALZA 2NPFA 1RT1B 3RAXA 4H54A 3I0SB 1WEYA 3MUTP 1S9EA 1WWHA 3LP2B 3DRRA 5LJ5Y 5KFEA 2K1RA 3MOJB 1RT6B 4JV0A 3MEGB 3L7OA 2VQEF 3I56S 2DRBA 1MMDA 5DETA 2C3YA 4EWTA 1IBLF 1X4BA 2R8KA 4R5PB 3NCQA 1T95A 1VQSA 3H5YA 3TUIC 1U6BA 2U1AA 1S9GB 2BRLA 4RWWA 3LOUA 2FJAB 5KT7A 3O6QA 4USIA 2RQKA 2FB0A 4Y3CA 4DQIA 4K4WA 1FNXH 3VZHA 1YJ9S 2XMTA 2BABA 2HLTA 4OX8A 1RTJB 1VRTA 1R6YA 2PIIA 2V8DA 5EGYA 3J7YU 3G8TA 2C2RA 3L7PA 4A46A 1VQOS 2GMHA 3CB4A 5LMUF 2FLLA 3PR4A 4Y2MA 1S1XB 3L3CA 3VF0B 2OTLS 1M0SA 1NZAA 5KG5A 2OIHA 2K7JA 2X51A 4QCLA 3EGZA 1DTTB 4LSLA 1UAWA 5CZXA 5EX3A 5ITHA 4RU2A 4CO1A 3BGFA 5L1JA 2D7SA 4KPYA 3SSSA 3CDWA 3TA1A 2D9OA 4QR1A 5M2UA 4Q2MA 5J1PA 3QPIA 2R2SA 1N5YA 2ZH7A 5I3PA 4QPTA 4CT9A 2R8GA 1WTBA 2JOQA 2VG5A 2IM3A 2AJQA 3F41A 2E5JA 5HN0A 4OZ1A 2L9WA 2R7SA 3MM8B 2MZSA 1YSJA 4NLQA 4K4UA 5F9LA 1AFJA 1SJ1A 1LWFB 2BE2A 2I0XA 2KB2A 2HGMA 1D9FA 3G6ES 2OTJS 2MQQA 5DDQC 1YJNS 1L3KA 2E7XA 3OXFA 4Y2AA 1K9MT 3HHLA 5L1IA 1C4CA 5KG1A 1UVNA 2FHJD 4WU3A 4IR1A 1P1LA 4J5OA 1H98A 4DWIA 5C24A 2J6TA 5FD1A 5CCLA 2YX4A 2N7CA 3CCUS 4DFJA 4O44A 3G71S 4ZVEA 1C1BA 3ZC4A 4MTPA 4DV4F 2E9ZA 2M3DA 3IA0A 2EBGA 5DQGA 1L3UA 3LAMA 5KG6A 4OZ0A 3W3SA 1F60B 3A8EA 4LFCF 4Y0FA 2CPDA 2LDIA 2YQ3A 3OTCA 1HNVA 1TKZB 2DD8S 3UPFA 4AXIA 1VQMS 2KXFA 1FESA 4FP9A 3IRXB 5F8NA 1SH0A 1WF0A 1H2VZ 2Q43A 5CCMA 5KFNA 5DG7A 3MM9A 2V5HG 4ZK7M 2KZMA 1T3OA 2R7OA 2CQPA 4QU7A 2HWIA 3UCGA 5J2QA 1Q86T 2MGZA 1RTIB 3CJ0A 1NJWA 1Q1KA 2RF2B 1KTQA 5HROA 2C2DA 5DG9A 4OLOA 1S0MA 2FJVA 3CTRA 2HNYA 2APOA 2KJWA 4CQ1A 1UVKA 3DOKA 4OHWA 3D28A 3PEJA 2J0QD 4QR2A 2POKA 2FC8A 5CYMA 3BN7A 2VPXB 1CC7A 1DTQB 2DNGA 3NGKA 3PX4A 4KFBB 1XMOF 2BOPA 2J9DE 1BY9A 2OPRB 1JNZB 1Q8BA 2XEXA 2M4MA 1DRZA 2DO0A 3TNVA 2HNDB 2DT9A 2CFXA 3DLKB 1M1KT 2XY7A 4FZVA 1IKYA 1WI8A 4RW6A 2X1BA 2J9DA 2CYYA 2IMWP 2VPZB 1OQ3A 4FBUA 2DK2A 2M7SA 1UEVA 4RW7B 4V19X 2CJQA 1TAUA 2W9CB 1JXLA 4HL9A 1YI2S 2AP6A 2YWFA 3GWCA 2W8LA 3EZ5A 4F26A 3HVTB 5LSLA 2XO7A 3KNAA 2OD6A 1VQ5S 4HDGA 4ILMA 3UE2A 2RIJA 1MMLA 1REVA 2IJNA 2SXLA 4Q2LA 2XS7A 2BUNA 3FSXA 4ECUA 2R2UA 1IBKF 4C8NA 4ZS6A 1TL1A 3X3UA 5KFJA 4YR2A 1TK0A 2HYIB 2KT3A 2MQLA 1N5TA 2AJFE 3PM9A 2D3OR 2OPSB 4DL5A 1RJJA 2DNMA 1UVLA 1U09A 3DYAA 4M8LA 2QYCA 4KE5A 2L9DA 1XNRF 2MMYA 1NK0A 5C25B 2QZ8A 4A8KA 1K73T 5E3PA 1KLMB 2AWZA 2EG1A 4TQRA 3EX7B 4ICLA 3V2UC 1QAYA 1KEKA 1RWUA 3QAUA 4DL3A 3IO1A 4NX9A 2ALZA 1FNOA 4A8QA 4QIVA 3H5UA 2ZUGA 5J1EB 1FRMA 4M5DB 2YNHB 1JNRB 2FC9A 3T5HA 3FRYA 4DV7F 2R7VA 3R5AA 4F25A 2O66A 2PA3A 1HMVB 1ZH5A 1FA0A 1KOHA 2YWKA 4NCGB 4TU8A 3QZ7A 1Q16B 3CIZA 3HVAA 1MMNA 4TYBA 5GAEI 3NNCA 4FF3A 2V8HA 3NCRA 4D3GA 1N8RT 4FXVA 2DNPA 4R8UA 1FHTA 2F1FA 5K8MA 2IYGA 4YR3A 1SUQA 5T7LB 4Y65A 2GCFA 1N5VA 1U1OA 4C7QA 2B4UA 5J2MB 4ED3A 2A18A 3AY0A 4IO9Q 2QT7A 3OJUA 4WE1B 5KFOA 2QRRA 4NZ7A 4OHYA 3KLEB 4KJIA 2OSQA 4QIGA 3US5A 1NK9A 1X9WA 3V6DB 2OFGX 2RU3A 5LT5A 2MKHA 1GTEA 3N28A 1OIAA 3AB2B 4HEA9 4OIXA 2N4CA 1QUPA 4CO2A 1UA0A 2GX8A 3QGIA 1GX6A 1XERA 2HVHA 1S1WA 3AQPA 2M2BA 2IJFA 5GAGU 3EZUA 1GXTA 2HNZA 1F5BA 3N9UC 1P8GA 1FVSA 3H5XA 4X4RA 1RT5