4W98A

Acinetobacter baumannii sdf ndk
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
145
structure length
145
Chain Sequence
EFMAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Structural and Functional Characterization of Acinetobacter baumannii Nucleoside Diphosphate Kinase
doi rcsb
source organism Acinetobacter baumannii sdf
total genus 45
structure length 145
sequence length 145
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4w98A00
1NHKL 4UOFA 1NPKA 3NGRA 4W98A 1B99A 1JXVA 2DXFA 5CAAA 1WKKA 3VGVA 4ANEA 1F3FA 3BH6B 3JS9A 3VGUA 4F4AA 3ZTSA 2HVDA 1VYAA 2B8PA 2DXEA 3VGSA 3Q8YA 1NDLA 3Q83A 2AZ1A 4WBFA 1BE4A 1NSPA 4UOGA 1S57A 3FBCA 1UCNA 3ELHA 4O0NA 3FBBA 3BH7B 4F36A 3FBEA 1MN9A 3PRVA 1XQIA 1NB2A 3FC9A 4S0MA 1ZS6A 2BX6A 3Q89A 4FKXA 4C6AA 3ZTQA 5CABA 4DI6A 3ENAA 1PAEX 2HVEA 5BXIA 2DXDA 4EK2A 3EM1A 1MN7A 3EVWA 3BBBA 3VVTA 2AZ3A 3ZTPA 1NSQA 1HLWA 1NLKL 3BBFA 1LEOA 3Q8VA 1B4SA 4ANDA 3L7UA 3EICA 4ANCA 3GPAA 1NDKA 1BUXA 3EJMA 4HR2A 4ENOA 3EE3A 1K44A 1WKLA 2CWKA 3DDIA 2B8QA 1HHQA 2NCKL 3EMTA 1NDCA 3GP9A 3ZTOA 1U8WA 4DUTA 1HIYA 1W7WA 3B6BA 1LWXA 3ETMA 2VU5A 1WKJA 3FBFA 1KDNA 5IOLA 3WX8A 4CP5A 3G2XA 5C7PA 1PKUA 3MPDA 1BHNA 2DYAA 3BBCA 3FCWA 1F6TA 3NGTA 3FKBA 3FCVA 3PJ9A 2BEFA 1NSKL 3VVUA 4UOHA 1NDPA 3NGUA 4KPCA 3VGTA 1XIQA 2ZUAA 3NGSA 4DZ6A 3B54A 2DY9A 1S5ZA 2HURA 3EVMA 3Q8UA 4FKYA 1NUEA 1EHWA 1S59A 1NCLA 3EVOA 3R9LA 3Q86A 3DKDA 3ZTRA
chains in the Genus database with same CATH superfamily
1WF1A 3VAJA 1WORA 2VF3A 4DFPA 2XO7A 2MGZB 2LQJA 1CQNA 4OI3A 1XERA 2QLBB 4JI2F 4MIBA 3W9IA 4WBFA 1L3UA 3N6LA 2C3OA 4H4MB 3D2WA 1RGVA 4CLLA 3CCSS 5F0WA 4NEZA 4A8MP 4DQSA 3QWPA 1F60B 2V4RA 3G6ES 4WTYA 2ZWOA 4ES1A 3Q23A 3TA2A 2ASJA 3T9ZA 3HJVA 3HSZA 1U4BA 2YKNB 1VRUA 1PBUA 5RUBA 1E6YA 2KN4A 2MQMA 1VQYA 1H72C 2NZCA 2Q6BA 4IG0A 2XSFA 4CLZA 3I32A 3ILJA 3R5GA 3C6UB 3HZEA 1RT3A 2HLUA 2ZJPQ 1HBUB 4DSKA 4NXMF 3H0PA 4LF6J 2GJ2A 3FCWA 3OPKA 4LR8A 1RT1A 2W4DA 5H9FJ 2XMMA 3B8HA 4USMA 1UVJA 4RNHA 3DI6A 1BY9A 1JLQA 3H7HB 4QR2A 1HYSA 2CXEA 4UOFA 2JVOA 2W2QP 1S9EB 5ETMA 2BE9B 2PEBA 4DXLA 1OYEA 4AL5A 3HT0A 2HQCA 2V6AA 3VAKA 2FLOA 3HVTA 1Y5LB 1FCAA 4EO8A 5J2QB 1I94J 3I56S 3N01A 2DPIA 2VICA 3TRGA 1EP4B 1HNIB 1MMNA 1KLMB 1VQ5S 2ERRA 3W7BA 2RRNA 4ERDA 3QO9A 5HBMB 2YH0A 3OXFA 3FEZA 4C8YA 2HRYA 3X1LB 1N48A 4NLVA 1MU2B 3R7NB 1P9YA 3P3DA 4FNHA 4RW4A 5GAHU 3I0SA 4F04B 2PE8A 4QJVA 5C42A 4CDIA 1NB7A 4JI3F 3PRDA 3UCGA 2PI4A 1VQ4S 2LU2A 1G1XA 4F8RA 1FKPA 2DR5A 2ACMA 3W5YA 3BQ2A 1FK9B 3CEDA 4K4XA 3JB9k 2KT3A 1WDDA 1T03A 2OKQA 1FRKA 1Q8LA 5KG3A 3SSRA 3PJXA 2YQ3A 1WTBA 3CWJA 1HBNA 3AB2B 2OPQB 3A12A 4KJIA 2N3LA 2YX7A 1KR4A 3MM7A 3TI0A 3QQCD 5H1SV 4JI7J 3CCLS 1ZETA 1X9SA 4OMFG 3NNCA 5FD1A 3MMBB 2VIHA 2DCLA 3NMRA 1L3SA 3LF0A 3D0GE 4HH0A 2CQPA 3O3LA 4EBDA 1S49A 1KVJA 5KFZA 1RB0A 1PC4A 1KTQA 4QR1A 2IVFB 1UFLA 4UY85 1GTHA 4M63A 5IV4A 2RS2A 4TNOA 1EHWA 2LVWA 1GXTA 2BRKA 4K7QA 4W98A 2V94A 2JLEA 2FQQB 2B7BB 2CADA 2HHXA 1HQUB 4K4YA 1X4FA 4M5DA 4ZCKA 1NK4A 2YKMB 1U2FA 5F8HA 2MKCA 3CVKA 2OTLS 4FXVA 2FHOB 1RTDB 5B7WA 4F25A 4QR0A 5KFVA 3KK3B 1X9WA 1WG1A 1UVNA 2MKKA 1BC6A 2RQ4A 2EW9A 1LV5A 2E5IA 2UUWA 4QWDA 2KG1A 2CPZA 5LXYA 2DEIA 1HHQA 4KB7A 3UQSA 1D9FA 1MNEA 1DFDA 3C66A 2HHWA 3I55S 3DM2B 3IGNA 5IC4B 5FIIA 4RKUC 1HHTP 3Q8PB 2HVZA 1UA0A 2HNZB 1TKXB 1KQFB 2DJWA 4EZ6A 3BDEA 1SJRA 3DMJB 4TKTA 1RBLA 3R5DA 2DR9A 1OQ3A 3MCOA 1SJ3P 3JQKA 3T6BA 1F5CA 4ETXA 2ZDOA 2ZD1A 3AH6A 4G1IA 5GADU 4AQYF 1QE1A 3M9OB 1KOHA 4AE5A 3MR6A 4WIQA 1TAQA 4DR3F 2BBEA 2LQ8A 2DD8S 3QGPA 3RZAA 1T7PA 3CD5A 4O3PA 1OO0B 1GQEA 4PKDB 2AW0A 2P8IA 2HFVA 3T3FA 3M8SA 3BGRA 3DRPB 4DG1B 2RT3A 1W2IA 1SBRA 2HHVA 1RWUA 4ED8A 1D9AA 1T9YA 2K3KA 2E9RX 1AZSB 1S0VA 3P49B 3AT1B 3SCIE 4USUA 4IRDA 1UPMB 2ZOFA 3BKFA 4DFMA 4B3OA 4NOHA 2X1GA 3KJQB 2GCFA 2GIQA 1B0VA 3QGIA 2BE2B 4DQQA 3IRXB 2IJFA 2MSTA 4I56A 3KKFA 3R6GB 5D3GA 2YPZA 3MM9B 1NJXA 2DXEA 2QV6A 3TA0A 3H5XA 4V19X 4J9NA 5HMZA 1O8BA 4DV5F 1JLAB 1CPZA 4L72B 3CJRA 2JC1A 2R7SA 1N32J 1FKOA 4LQ9A 1TL1B 2ZJQQ 1W2BR 4WE1B 1C4AA 4F4WA 2AEMA 1LNQA 1C1CA 2E7VA 3M2RB 3MMAA 2ZC4A 4MKYA 4J9UE 1SL2A 4C48A 1V6HA 1S72S 2IM0A 1YRXA 5IM0B 1N5QA 4YMEA 5K8OA 1RHUB 4KHRA 1S6OA 1VQ7S 1IM4A 1RADB 2GW8A 3CCJS 3BSCA 4KHPJ 3L4BC 4ZLJA 2EBEA 2RF2A 5KFPA 4LF5F 2R4FA 3WX4A 2C3MA 2MDAA 4FYWB 5IXUA 2X51A 3ZZZA 1JLCA 4B9MA 2QN6B 3VAMA 5LSLA 4DR6J 2R7TA 4DFJA 5KG7A 3BEGB 4B3SJ 1S76D 1Q7LB 2LA6A 1N88A 2CG4A 1UVIA 4C8KA 1M1HA 1NJZA 4N8OA 2PT0A 2AEFA 4RW9A 1RA6A 3MEEB 3CF5Q 3MOZA 1PO6A 3I4HX 3VAIA 1RT5A 1WOSA 1T9WA 3MEGB 2A2DA 1URRA 3GMGA 5CYMB 3R2CJ 2VJUA 3N9UC 1OY9A 1U1MA 4WFBQ 4KTQA 1MW7A 3JTPA 4IQMA 2KHDA 1RQ0A 3U1NA 5DDQC 4U7UD 1B0PA 1SV5B 1TL4A 1WSVA 3D1HA 4OLPA 3F41A 4LRCA 4ZHRB 3TJ9A 1RWWB 4LFCJ 3M32A 4B3TJ 1RAOA 3AD9C 2P9GA 4CYUA 1F9EB 1YVFA 1BQMB 3DOLA 1BWEA 1N54B 2F63A 3CT9A 2CKWA 3UWTA 3MAAB 3CJ3A 4BDPA 4KHMA 4WXOA 2FD2A 2VC1A 2HPUA 3ITHA 2RHQB 2V67A 1NKEA 2CQ3A 3I5AA 1RAJA 4FBTA 3AODA 5DM6Q 4PWDA 5J2PA 4WZQA 2YWWA 3BR8A 1M1GA 4C7QA 1H2TZ 2F9JA 2H4WB 4G6VB 2HQDA 4NE9C 5HROB 4KY3A 1BQXA 1SKRA 4OHZA 3NP5A 2ADCA 4USHA 4DUTA 4Y0FA 3US5A 2AYBA 3SDEB 2XLKA 1YZ7A 2VA3A 2W9AA 3IWNC 4ETZA 3FZ2A 3R8YA 4KQZA 1NCLA 2D3OR 3HZGA 4EMDA 4A8WA 1PYTA 4KKOA 1NK0A 2FVRA 2ZC3A 3WQPA 3RRHA 3SXLA 2O3DA 2JLFA 3OL8A 2PSZA 3HHLA 3EGVA 3M8ZA 1VC5A 4ZPDA 2OD4A 1K1QA 3LP2A 2XNQA 1UZHA 2HLTA 4NLWA 1MN9A 2O67A 5HAOA 4QCLA 3PKYA 1U1OA 1ZZNA 4WFZA 5BXIA 1X31C 2WOMB 4C8MA 2ASLA 5KFRA 1SC6A 4QWBA 2IVMA 3PX4A 1N8RT 5A8WA 2HFZA 3QIPA 4C11A 3C19A 2M8HA 1X5SA 3AJ1A 1FDAA 2VQFJ 2MLZA 1A9NB 2KFYA 4WU3A 2J9EA 1K1SA 2BABA 1APSA 1RU2A 2DNOA 4URSA 4CLUA 1PKUA 2BKOA 2F8EX 2CQBA 4OHYA 2M9KA 4JI5J 4YFUA 1AFJA 4A46A 1XC9A 2DGXA 3D4JA 2J7KA 4M5KA 5K14B 4YB6A 2FYXA 2XI2A 3GQCA 1HNVA 3M6WA 2POKA 5DLFA 4B9UA 1JKHB 1YJRA 3CTRA 4FZVA 3TZXA 3IFEA 3I9ZA 2AYGA 2LDIA 1IR2A 3PM9A 2BQRA 4LF4F 6FD1A 2CDRB 2HAFA 2E5LF 1U7LA 4NWBA 2RQMA 3M8QB 4USTA 5CABA 4LT6A 4OX9F 3MEDA 2XS2A 2GC8A 2WBMA 1H38A 5L39A 1NSQA 1YBAA 1WC6A 4FVCA 4NLQA 1RTZA 3ZFVA 4JI7F 3LAMA 5E3CA 3GV5B 3JXOA 2AX1A 1W7WA 3TUPA 2F65A 1WKJA 2PEHA 1UWBA 4PABA 4FS1A 4IOAQ 4I1TA 2A6OA 2YVSA 2YKAA 4OI4A 1TZ0A 3M8PB 4BWJA 1V9OA 3V6DB 4G1QB 3QNWB 1JLGA 5IFMA 4OZ2A 4U6PA 3G87A 3GSIA 2HQGA 3TZWA 1ZM9A 2WVCA 4U8YA 1BGXT 2AV5A 2YKOA 3PDNA 3BGFA 1FVSA 2UV8G 2KKHA 3OL7A 4A48A 1YQHA 1HI8A 1N6QA 1XR7A 5ETSA 3GG1A 4C6AA 2DGTA 1OY6A 4OYWA 2DNHA 2XO6A 4M95A 4DSEA 5KT7A 1B70B 3ZNUA 1QUVA 4A8YA 1B4SA 4ELTA 3TVKA 2R7VA 3CMQA 1M5KC 1UL3A 4HEA9 4L74A 3CJKB 4AXIA 1HBOA 3VCDA 2XULA 1FA0A 4ED0A 4WXWA 1SVDA 4OZ3A 4ED1A 2OO4A 4RW7A 3D66A 3GR1A 2W9BB 3TVZA 5AE1A 3FCVA 4FYVB 2K8GA 3CCTA 2QRRA 5A8KA 4FYYB 1Y4ZB 3GIRA 1XMQF 5DDOC 5C5JA 5HN0A 3KYLA 2HNDB 3VGVA 1J27A 3SCJE 4X65J 2G2ZA 4DR2J 1LWFB 3FGVA 4ZVHA 2ZZMA 1YJWS 2MXYA 1SCJB 3HD2A 4NZ6A 2ZEJA 3W61A 5FDLB 2KM8B 1TQLA 3Q8QB 4PCQA 1WF2A 2IRUA 1PAUB 2CDQA 4RW8B 2W9CA 2G0CA 2DNMA 1JMTA 2KT5A 5JUMA 3PX6A 4MK7A 3GPAA 2PD1A 1FJ7A 2KI2A 4HR2A 4M5JA 3KLEA 2C2DA 3V81A 4IYQA 3V4IA 4U7CA 1FTRA 2BXJA 1C0UB 3M2VA 3MWBA 2HS3A 3CD7A 2WAQD 4ED2A 2KRBA 1CJUB 3E01B 3QRPA 1ZBTA 2GGPB 5IS2A 2W1BA 3CIMA 4P52A 1BMQB 2VBZA 4ZKAA 5KT2A 2D3O1 4YDXA 4DUZF 2IJRA 3W63A 4F2RA 3AA9A 3G86A 2MZQA 1SJ1A 1U8SA 2ZDPA 4DV1F 4OZNA 1BE4A 1NSPA 4OI0A 4Q45A 4HACB 5BYQA 1EARA 3LANA 3LGHA 1FI4A 4JV2A 3I4PA 4MKAA 1RKJA 3EGWB 1CEZA 1KONA 5M2UA 1RHMB 1QAIA 4NMXA 5F41A 3K5LA 3MPVA 2QMXA 1TVRA 4DV4F 4AXJA 2XLJA 2YNFB 3QFWA 1U1KA 3VQTA 3IRWP 4DPOA 2HYIB 3EZ5A 3NOCA 2OFGX 4K4VA 4QYZJ 4I68A 4C9DA 3GP9A 3IC1A 4O4GA 4I64A 4EYHB 2F5GA 2NYIA 4WP9A 3PNIA 4YP3A 4E8UA 4NLRA 2LA4A 3FQKA 4CO1A 3VQSA 2HK3A 4FKYA 3DKDA 3THTA 1TKDA 1IXKA 4TY8B 4J9SA 5HQLA 2WTFA 1R6VA 3J7A1 4JI6F 4DHVA 1C1BA 2DO0A 4DR6F 2YNIA 2UXCF 2W2MP 1OJ4A 4WF9Q 2VPYB 1Y7PA 4PUOB 5HMYA 4OYAA 3K0JA 1H7WA 5EX0A 4B3SF 1CJVA 1X8DA 2AGOA 3DLLQ 2HHHJ 1TUVA 1YGYA 3MPUB 2V68A 2CJXB 4B9VA 2V50A 4WYWA 3DFEA 2ZZNA 4B9TA 4YHHF 4OZLA 1RLDA 1RYRA 2JEJA 3HHNB 2EK1A 4URQU 1ICEB 2P6TA 2HGMA 3CMAS 2UUAJ 3NNHA 1BD6A 3H5UA 4LSZB 1YJ7A 5LMNJ 5HMWA 4R5PA 2BANA 3TYTA 2C2NA 4K4SA 2CJBA 2IHR1 3WX8A 4LSLB 3LP1B 4F4XA 1DTTB 2ROPA 2YKQA 4TYBA 4ZOSA 3JQJA 2GVDB 2W7OA 3HULA 4MH8A 4LFCF 3BS9A 1KNZA 2ROGA 3GIKA 1WEXA 3D1OA 1Q0NA 2DRDA 2PA3A 5LXRA 3CC7S 4RO0A 3KWMA 2LKZA 2FDNA 5EHHA 4L75A 5B0AA 1R31A 4LR7A 2ZBRA 1SIZA 3L9ZA 2K7KA 2JEIA 1RAIB 2HMIB 3RW6A 2M5YA 4CM2A 3BSAA 4S0MA 2EC2A 2A1BA 2WHOA 2ZNYA 2LECA 4P72A 5A0YB 4ECUA 1KN6A 1TK0A 3Q8VA 3C6TA 2CZVC 2AIRB 1HI0P 1TR0A 3QGHA 5D4PA 1HNXJ 2VDHA 1XR6A 3TR5A 1K44A 4DU7A 3G71S 3BO3A 1DQ9A 3AOBA 3LAKA 3CC4S 1Q82T 4AUKA 3OXGA 1LWEB 4Z7YA 4XIUA 1S7IA 5D8HB 1P27B 5GAEI 1Q95G 2CFXA 4RNNA 4OJ3A 2RAQA 4CO0A 2HW3A 1NUEA 3MMCB 1RUSA 3W64A 4DSIA 3KLGB 2MB0B 1VJQA 1UW9A 5CHCB 3SQGA 2XHCA 5DG8A 5HJYA 2C3UA 5HANA 4OX8A 1RCXB 3GLJA 3NOGA 2UUTA 2BJDA 3UN2A 4UTGA 1QDUB 2BX6A 5DQGA 2FC8A 1AW0A 3PTWA 3SCLE 3KK2A 3RR8A 4USIA 2V9KA 2HGLA 4J9MA 5KG6A 5EDWA 2XLIA 5D15A 3KXDA 3W5ZA 4E98A 1FD2A 1RHRB 3FDSA 4ZCIA 2XTJP 3RB6A 2UUCF 3OJSA 4JB8B 5IT4A 3PW0A 5HI7A 1VRUB 2MQ8A 3IGVA 3E51A 3SZ2A 1E6YB 4L3KA 2A6MA 4IG0B 1K8AT 2OLWA 2VB6A 1RT3B 2BACA 2HFOA 4R0JA 4JI5F 1RAGB 1XTZA 3MCNA 4RJVA 3TAMA 1MSWD 4IDKA 4KYZA 1RT1B 3A8JA 3N5BA 1SB6A 3GV8B 1YTYA 2GNKA 4NA2A 3DI6B 1JLQB 1HYSB 1N0VC 3R27A 1HPZA 2QC3A 1ZTWA 3IR5B 3R3TA 1UCNA 5F8IA 1WD6A 4NPOA 2XEXA 1I51B 1VQ6S 2GVZA 4JI4J 4KH0B 3D0IE 3QT6A 2M4MA 3K8WA 3HVTB 5M2PA 1U1LA 4WP8A 1M5VC 2ATLA 4PRFA 3MTJA 2DGUA 1MWZA 2PMWA 3O44A 5D0HA 2UZAA 4KFBA 1R6YA 3NCPA 1JK9B 1HR0J 4Y65A 1ZA2B 2VODA 8RUCA 2RU9A 5G0RA 1MLAA 4LF7F 2Z2YB 4KGXB 2OSRA 3QO9B 1ZPVA 3DRSA 2ILYA 4NRTA 5CCLA 4EI2A 3QMQA 1ULRA 4RPFA 4O3OA 4XTTA 1X4HA 2R2UA 1G3OA 4QIFA 1JLEA 2UVVA 3OBIA 1UFWA 4RW4B 2V8VA 5I4MA 3GILA 3I0SB 5C42B 2BMBA 2VG6A 4RUAA 1KKHA 2DGVA 2GIRA 1VQLS 3UW1A 5J2NA 5E7OB 2FVPA 2OP5A 2B9WA 3R7SB 1FKPB 2XSJB 5B0GA 3PR4A 1IBMJ 3VWSA 2R7QA 4DSJA 1T03B 1RT2A 4GC6A 3MM5B 3CDUA 2XWYA 4LRDA 1IBKJ 1RP5A 3EM1A 2ALYB 1DZ5A 1RE1B 4I67A 2KXNB 3CSKA 4I2PA 4FYXB 3Q24A 1HBNB 4ES3A 1N5SA 4O3QA 5KFHA 4DSLA 3TEHB 2U1AA 3MM7B 3DRRA 4CT8A 1SI9A 1IVZA 4NLUA 4DV3F 5DZ7A 2KDOA 5IWAJ 2WONB 4IFVA 1Q79A 3ZNJ1 3SQOP 4CT9A 2R42A 1KQKA 1K0VA 3T1AA 3K89A 3J7YI 3BBCA 5LSOA 1VBZA 4YS2A 2LFVA 2Z2MA 1F0XA 1PG5B 1N36J 4ZMMA 2E1AA 1FDBA 3ZZ0A 1HNZJ 4IUFA 4F3OA 3TOQA 1T9TA 4TYAA 3M05A 1LXNA 2AU0A 1PYSB 1RTIA 3M6XA 2I9SA 4KO0A 3WZ0A 2YPYA 3ETOA 1NDLA 3WC0A 1HMVA 5J2MA 4DV7F 4ECTA 2RH3A 4Q8EA 2CNLB 2OMLA 2DGWA 4IG3A 4ZPCA 1FXRA 2MQLA 2HBQB 3QAEA 1Q16B 4O3NA 4HTJA 4NI2A 1FNOA 2GZOA 2NXEA 4KPYA 4ZVSB 4K4TA 1HLWA 4M5DB 4ZP7A 2N4CA 2VV5A 1VIOA 7AT1B 2ATCB 1IBLJ 3GTYX 2CVEA 2BYCA 3V2UC 5K20B 2WW4A 3QJJA 4WJBA 2W2NP 3FBFA 5E41A 4MKBA 1O5JA 3ENWA 5A6PA 2LEAA 3HD1A 1JJ4A 1HWLA 2Y3YA 1UP1A 3T5LA 2RRAA 4F0MA 5E3PA 4RU2A 3TEGA 1S1TA 2X7IA 3CULA 2Z57B 3HFVA 3G4SS 2Q43A 3UDCA 4ZLLA 3L95X 4OYPA 1VQ9S 4B3MF 1B99A 3D7SB 4ICLA 2QTWA 3OJUA 2VFUA 1TAUA 4DL6A 4K0KJ 3D6TB 3OTCA 4KGMA 1R43A 1GXUA 2FVQA 4JUZA 5L1IA 3IO1A 3HHLC 2J9CA 1AUDA 4R8UA 2F4VF 1WC5A 4KE5A 4OJHA 3T1YF 2ZD1B 4GVBA 5H9FK 4USVA 1IKXA 1QE1B 3HFZB 4DX7A 2AKWB 2SXLA 3WC2A 2RS8A 5KOXA 2VBYA 3I6PA 4X4UA 1XNQJ 3IN5A 2LMIA 2QMUB 2MPUA 3DDIA 5AE2A 3H5SA 1HIYA 2MZRA 2RIJA 2WVDA 2ZBQA 4LRFA 2DITA 3BGRB 3CW2C 2UXBF 4Q44A 1FXDA 1FRMA 2GMHA 2E44A 3KOAA 5IV3A 1S4FA 3DGVA 1PYOB 2YWKA 1ELOA 4X66F 2HURA 3OHAA 5CQGA 2DY1A 1MG7A 4B3OB 2LQ9A 2ZBIA 1DURA 1KBRA 4NMLA 5C2CA 3G8SA 1S1WA 2R7UA 1H2VZ 1IM6A 4ID5A 4DCOB 3C15A 2NSBA 3EDQB 5F3TA 3TJ8A 4TU7A 4A8QA 3KDOA 5D3GB 2HK2A 4ZS6A 1NU4A 3SFUA 4LF9J 3TAPA 3NS7B 2X3DA 4K2XA 5FLXU 2P9CA 4QBUA 1OSCA 4EO6A 2DR7A 2HRTA 4WWSA 1VK8A 1FKOB 3AB4B 3CNQP 1YBUA 3DNCA 1MROB 4AYBD 3GE9A 3JSYA 3GV7B 2VJVA 1C1CB 2UUAF 1NNDA 2RQCA 3MMAB 2CQDA 3G2XA 1H3DA 2UVWA 3QZ8A 1LFWA 3AHPA 4DMZA 2W01A 4UUWA 3FVYA 2YNGA 5ETOA 4WPAA 1S59A 1RABB 4KGZB 1LQ9A 3NS5A 2RF2B 2B7CB 1DTQA 1QLNA 1LW0A 1JLCB 6FDRA 1R7IA 5AXKA 4Y34A 1QSYA 4DCJB 1M1KT 4CLYA 1N34J 4MIWA 3RGIA 1D3WA 4TQRA 3QT7A 1P1LA 2KYXA 1AT1B 2ZH9A 3EDRB 5KFLA 2QGFB 2OJ3A 4CNZA 4ZLNA 4RW9B 1VHIA 3EUNA 3UPFA 1VDHA 4PEOA 1T0TV 3T5JA 5GMKa 2UXDF 1YKWA 1T95A 4G65A 4NLDA 2KHCA 3WIUA 4M5LA 3I0RA 1R0BG 5DS7A 2HAIA 3VGTA 3PO5A 3N5FA 1A7GE 4A8KA 2RRBA 3HHEA 1JX4A 1FD8A 4DR4F 3M32B 4CYUB 4HDGA 4F67A 3UFCX 2YWFA 3DOLB 2JFKA 2IRXA 2M70A 2PIIA 4LBIA 3CJTA 1HW8A 2VG5A 2W24A 3HSJA 4ES2A 1UEUA 2DVIA 4GO5X 2VC0A 4GO7X 4NXNF 3ITHB 2J7UA 1RWOB 1EB0A 4HT5A 1RLCL 3TWZA 4PWDB 2F4FA 3B4MA 3GR0A 1AROP 5J2PB 4B17A 5EN1A 2VUGA 3FEXB 4LFBJ 4B3RJ 5GAEU 3LPYA 4F0KA 4W90B 1ZAXA 1VBKA 3H42A 3HT3A 1HBMA 4ZCMA 2FY1A 1ZTTA 4MAKA 4NLSA 2G4BA 2CNKB 4ZIVA 3OFEA 2HZCA 1TKZA 3ZZOA 3LP0A 1KTVA 4TY9A 3RU0A 2FLPA 1L3TA 3HHKA 2RKIB 2ABYA 5GVQA 1HNWJ 1LK7A 1NK9A 4KKOB 3ELHA 1TFWA 2QFIA 3KLFA 4M8LA 4EZ9A 2KFNA 3HHLB 1N33F 3BREA 4DL7A 1WTFA 1F1BB 3LP2B 3OXLA 2RVJA 2JNJA 2FTRA 2J9DA 4I4BA 4W92B 3POTA 3J80Y 4PAAA 4YDDB 1YJVA 5I3UA 2HFUA 4WFYA 4YR0A 5A8WB 1PGZA 2A10A 3QIPB 4C11B 1SH0A 2HSEB 1IUJA 2B4OA 2ZNZA 1RWPB 1FEHA 2BQ3A 5KT6A 2RNEA 1WC4A 2Y1JA 1VLOA 1DLOA 1NSKL 5EGYA 1BWVA 1XIQA 4QIVA 2YTCA 2FC9A 2VQEJ 4D3GA 2HFSA 3HFKA 4C97A 2FPHX 2D3ZA 3P5BP 4K59A 2CAJA 4ER8A 1HNVB 2EC0A 3H90A 3OTDA 4X4PA 3CJ4A 4A47A 2Z58B 2IBKA 3PYGA 3NGDA 4FP9A 1SJ4P 2Y1RI 1ZM3A 1CS4A 2G9OA 3N79A 4DUYF 1V5VA 2HWTA 3HVAA 2QO3A 1VIXA 2GHWA 1K47A 5DM7Q 4Q7AA 2CJQA 2DR8A 1B7FA 1VQNS 1D8ZA 3PVXA 4HHUA 1ROFA 2ZVIA 1GNKA 3ADAC 2HBRB 1W26A 5IWAF 5C7PA 3KHRA 2DRAA 5THWA 2DR6A 5KFNA 1T3OA 4KR0B 3NG8A 1Z1ZA 2KT2A 4DV0F 2B3TB 4JI1F 4PQUA 3UNGC 2E5HA 1UWBB 2A3JA 1N36F 4ELUA 2FGOA 2RHSB 4L6V3 3S6EA 3EZUA 1JLGB 2I2YA 4DR1F 4NZ0A 1REVA 1H6KX 2GHVC 3CCQS 1UMJA 1CSJA 2XY7A 2HQFA 2DGQA 4JV5J 4X4NA 1NB2A 3IWXA 4C3KA 1FJEB 1S79A 4CLKA 2FIUA 3R1HA 1XBWA 3NKYA 1N6QB 1PJ6A 3M6UA 1J5OA 1NZAA 4OYBA 3U27A 1UKUA 2MQPA 2MQQA 4U96A 5SUHA 2HBZB 2H5EA 2BUNA 3P45B 2C28A 2Q3PA 2IM1A 1NRKA 5BR8J 3J7YU 3EPGA 3H4BA 1E6VA 2VU5A 2ZUGA 2XQCA 1J5EF 2IJNA 3LGMA 1VRQC 3KLHA 1HBOB 3OVBA 4JOUA 3FCHA 2BRLA 2Z56B 4RW7B 2HHUA 2LXUA 2XWXA 4OL8A 5D4OA 2YH1A 3IR7B 2R2TA 3R9LA 4KAIA 2HHQA 2VFTA 5E5NA 5A8KB 4I69A 2BA9A 3IS9A 2BDPA 3IM9A 3CCRS 3TQ1A 3G82A 3A3NB 1F9FA 1FVQA 4ECQA 4M94A 5J1EA 4QU6A 2HVHA 1T11A 1FE0A 3ZC4A 3MPYA 3I82A 1QTMA 2VHGA 4X84A 1QAJA 1KRPA 1G2EA 3ULHA 4ZJOA 2OH2A 3HMJG 4I7FA 2DPJA 2ZH7A 5KFFA 3M8WA 4RWXA 3O1LA 1Y10A 4B08A 1Y11A 3W3SA 2J9DE 3M2UA 3RW7A 4U7UK 2AJ2A 3KJVA 5CCMA 2QYCA 2J5AA 1KP6A 1WHYA 1A0OB 2W9CB 3EPIA 4QYRA 3EZOA 1VK3A 1NDCA 5KOWA 4AD6A 3NY0A 2UP1A 4KSEB 4RNOA 2AGPA 1H0HB 4IFYA 2BOPA 2VASA 2AWZA 3N6NA 3EYZA 2HHPA 1LK5A 3V81B 3V4IB 4Y6IA 2G2YA 1FFWB 2RD5C 2Y0SD 3M2VB 1GMUA 1CULA 1VISA 2KH9A 2EWHA 4C8NA 3N4WA 3VTIA 5F8JA 3KLIA 2YXLA 3G6VA 1OS5A 3KUHA 4RBVA 3KHLA 2FHKA 3T1HJ 4DQIA 4P2XA 4IR9A 2ADBA 4Z7CA 1WOPA 3NXZA 2AHOB 2ROEA 4JI0J 3Q89A 3FFIA 3GG0A 1IKVA 4FBUA 4OYOA 3KK1A 4EK2A 2OGUA 3RAQA 3DN9A 4J9LA 1B0TA 3LUYA 3SV4A 1Z4UA 3V4MA 2CQ0A 1QM9A 4EYIB 3UNYA 5ETNA 1YHQS 2EG1A 3OFGA 4LJMA 3JYTA 5AXMA 3N6MA 1U8WA 4DL0C 1TVRB 3MECA 1O51A 2EFVA 2J0WA 4PR6A 3FSXA 3FK4A 3VZHA 4O4GB 2J0QD 1NDPA 2LLZA 1NKBA 1RWVB 2LDYA 4DR7J 2BV3A 2JEGA 1U1QA 1EZZB 3ZZYA 3MD1A 3NGRA 1WKKA 3H59A 2FLLA 1S1VA 3A8IA 4UZBA 1URNA 2RDIA 2M0GB 5KG2A 3R5AA 4NASA 2FJBB 1SH2A 1C1BB 1NKCA 2NZ4A 1D0EA 1GK8A 2BJ9A 1F3VA 1TMMA 1S10A 5CYQA 4U8VA 1MWQA 4ZPAA 1CJVB 1NXIA 1U6BA 3QYYA 3TJAA 2FGCA 2FLNA 3H8YA 1S4EA 2Q1LA 1SKWA 1GMWA 3BM7A 3FSYA 5HVHA 1WKLA 4OI2A 2DH7A 2CWKA 1FEEA 5GMEA 2YQ0A 1LWXA 1FF2A 4OHWA 1RWNB 3VZIA 1V5IB 2E1MC 2BANB 7FDRA 5D78A 4OYZA 4ZN1A 3UDEA 3Q0AA 3Q86A 4J9OA 4DU8A 3TUZC 4ZVEA 3CIZA 3OW2R 4LRAA 4OI6A 2RILA 3PRVA 4C98A 2C2KB 2QL9B 2RMLA 3OTOJ 4F4KA 3CE8A 3PCOB 3R97A 4DX6A 4LFAJ 2C2RA 3R5BA 2GJFA 3KLVA 4Q5VA 1XWLA 2KRRA 1FFGB 4Y3CA 4X64F 2GIFA 3OLAA 3CC2S 1X4BA 4GKKJ 1RT7A 2HS4A 5KFGA 1GAOA 3AXKA 3GU0A 2H9ZA 3C6TB 1KQSR 4LSNA 4EUVA 4ECWA 3BO4A 3OL9A 2AJFE 3NEKA 3A13A 5ETLA 4LVOP 2XYPB 2C42A 5A2QY 4B3RF 3TANA 1VS3A 3PRBA 2ZKUA 2ASYA 4M5HA 1SKUB 2MMYA 4C3LA 4GKJJ 4JV0A 1QVGR 4P2MA 3ZZRA 4F4AA 3KDNA 3DHWC 2HIQA 3MGJA 2CWXA 2VKZG 3D28A 4LRBA 2DNYA 3F44A 5ADZA 4MIAA 2OEKA 3SQGB 4K2JA 4JI2J 3HKZD 2OEJA 3K5NA 1HD0A 4PG7A 3DCAA 1O0PA 4CLWA 3TW0A 2Y1LB 5AJ3J 2EFGA 4KGKA 2I1RA 4EBCA 1S7HA 4WK1A 4H4OA 3KK2B 1BUXA 4ENOA 4ILRA 1ZAVA 2RQKA 4LIRA 1UJ4A 2KG0A 1F2HA 2KU7A 4H4KA 2P2CB 3W9JA 2Z2LA 4DZDA 2PC6A 2E7XA 4YB1P 1TUGB 1Q5YA 2Z0GA 2QSFA 1BHNA 1WEZA 3NCRA 1QSSA 2QG9B 1ZM4A 4NXMJ 2DO4A 4TU8A 4AL7A 1S48A 2P6SA 2Z30B 3GCXP 1R3NA 3I5CA 1T05A 2HS0A 3BSNA 4ANEA 3LPEA 5K8PA 2VQEF 3H4DA 4QYZK 4CIOA 3TAMB 2W2OP 5AT1B 4Q8FA 4YN3B 4ZJQA 4IDKB 4J9QA 5L9NA 1HQEA 5CD4A 1KFSA 3MCMA 3DLEA 1JJ2R 3FMBA 1KOOA 1CC7A 5IT9Y 1HPZB 1SL1A 2R8IA 3MMJA 3PEHA 4ZLPA 3RB0A 4DDFA 1U2CA 2GVZB 1XR5A 2WW8A 3BQ1A 1DQAA 1S9GA 2OI2A 2IM2A 1BXNA 4FF2A 4FS2A 5T14A 1RWXB 3RG6A 1VLYA 4O44A 4LVNP 2FHMA 4Y2AA 3L7OA 4X4RA 5G0RB 2MHNA 3M1VA 3MAHA 4DOZA 2VFVA 2L9DA 3DRSB 3V6DA 3T5HA 2JOQA 3GYXB 1ITPA 4DR5F 4Q2MA 3ZZTA 2MKHA 3UVJA 4G1PA 1FJGF 4JI3J 3NLCA 1JLEB 3Q8YA 3I96A 3G8TA 1YJUA 3FBCA 5U47A 3CD0A 4UZCA 3UCUP 3D9BA 2VOPA 2B9EA 3FC9A 3MUTP 2VG6B 2DH8A 2KB2A 5SZTA 4CLTA 1XMBA 2UUBF 1XMOJ 4DV2F 3LWMA 5J2NB 1TP7A 4ED6A 1MN7A 2XCAA 1FXLA 3SMZA 2V8GA 2MTLA 4ECRA 1RA7A 1TL5A 2BKPA 5HO4A 2R8JA 3IXQA 1RT2B 4QWAA 3VHQA 4EFAC 2MZSA 4I2PB 2BJ1A 3BQ0A 3K17A 1RSCA 1F6TA 3DRRB 3QZ7A 2CA9A 1S0MA 1I3OB 1T94A 2NPFA 3O5TB 5MAOA 1CQMA 2D1CA 3VF0B 5L8RC 3QPIA 4M5IA 4PXEA 4FDFA 1VGYA 2CQHA 1NEEA 3TX8A 1N5VA 3IBWA 4ZPVR 3WBZA 1YSJA 4A8OA 5HP1A 2JJ4D 1JJHA 4Y00A 3RUBL 1WC3A 3FJ2A 2W7AA 4N5SA 2DT9A 2VG7A 1KHWA 3HX9A 2VA2A 5HVGA 5KFKA 2UU9F 2LXFA 1RTIB 4F0HA 5D0EA 4KO0B 5KG4A 3S7RA 1LW2A 2OIHA 1YLXA 1HMVB 4RBTA 5J2MB 5KFEA 4J7CA 3ILLA 2DH9A 5KFWA 4I0WA 1KLNA 4IG3B 2FVSA 4FPRA 2ZM6F 5KFOA 3MM6A 4ANCA 1YITS 5IC6B 3EJMA 4P9SA 1L5UA 3KMSA 5K5MA 1JWWA 3HCXA 4ZPBA 1UPPA 2COLA 1JXEA 3PY8A 1QAYA 2NLWA 3K58A 2HIYA 2L9NA 2FJXA 1TK8A 2J8SA 1V3SA 4KGVB 2IY5B 1IQTA 3JTNA 5I42A 4HL9A 4O4RA 1YDLA 3MUMP 1R8PA 2IDLA 4L73A 4NLTA 4P73A 2KM8C 5C24A 2AEJA 3BO2A 3EWGA 1S1TB 2D7SA 3DDKA 2B8PA 2DHGA 4M5MA 2KFZA 5H9EJ 3FRZA 2FJEB 5E0OA 2AZ1A 3PEJA 1UVMA 1N5YA 4F36A 4ICLB 2CPXA 3AOCA 1ACMB 2D41A 1ZPWX 4AQYJ 3DYAA 3NGKA 1M90T 4R8UB 1FTCA 5KT3A 3BBFA 2MQOA 4GVBB 2XY5A 3UD4P 1NM2A 2UVUA 1P9QC 4HKQA 3MZIA 1FHTA 1WG4A 1IKXB 4IH7A 3OR1A 2UVRA 1N0UA 3EE3A 2H54B 2H48B 4PXBA 4OZ0A 4LF6F 3W2WA 3G8QA 2BE7D 2BJ3A 4Q0BA 5KG5A 2XMVA 2WVBA 3KNAA 5DG7A 3HM9A 3K57A 1U45A 3PJ9A 3IAS9 4HDHA 3AJDA 3J80U 5ETPA 2DISA 1Y3JA 5C25A 1NPKA 3BR9A 2KVQE 4DFKA 3TP2A 5IQ6A 3CDWA 4NX9A 1LWCA 1X9MA 2DNNA 4G3IA 2ZH1A 1I94F 4ZP9A 1HA1A 4MYUA 3K59A 4O0NA 1FX2A 1HFEL 3Q2TC 4HHHA 1S1WB 4ECXA 2KL8A 2LQ5A 4ID5B 1DY3A 3C15B 3ZXWA 1U47A 2QA1A 4XDDA 4QZVB 2AZ3A 4DV5J 2G1HA 1TL3A 1NLKL 4OZ1A 2DHAA 1TKTA 2XG8A 1WSRA 2ZITA 2N4DA 1KD1T 3P96A 1U0SA 4IOCQ 2ZOGA 3GSDA 4LQ3A 3PHTA 1SKSA 2AMCB 2VFRA 5GMDA 2E1CA 3OUYA 1ZA1B 3ETMA 4LF1A 3M8RA 1X4DA 4UQGA 5FLXY 1M5OC 3MAQA 2BQUA 3FKBA 1K0TA 2NXCA 3LP1A 2X1AA 2IRYA 2Y8WA 1KVIA 2HNYA 4X4QA 3CO0P 4LF5J 2VDIA 2DNLA 4F4ZA 2MKJA 4KIAA 1B64A 2H51B 2YNGB 2XI3A 2MQNA 3MPWA 2AJ0A 1LW0B 2VPWB 3K2YA 1CVJA 5KFQA 2MKIA 3CUNA 3X3UA 2DIUA 1H2UX 1MMLA 3DGPA 4RX6A 5T7LA 3ENQA 3J81U 1FNMA 3PG9A 5A0YA 1S9FA 2Z8QA 3OHBA 1GEHA 4QW9A 2QT7A 4TLQA 5CYJA 3GIJA 4OZ5A 1DAXA 3IAM9 2R8HA 3JSRA 4J37A 3DLGA 2GAGC 1RBOB 3CJ5A 1VI7A 4DBQA 2AJ1A 3IMQJ 4FN5A 2XGQA 1N4LA 3W1YC 4IRKA 1S12A 1X5PA 2YY3A 2CPJA 3MR3A 1VQ8S 1SL0A 4EGLA 2DCUB 4E2FB 3LGNA 3I0RB 4KT0C 2NXJA 4ZITA 2R2RA 3OD2A 5CH7B 1RYSA 3KLGA 2FZKB 3O6QA 2C2ZB 4Y2IA 3UE2A 4U9RA 2AYEA 3GIMA 1WG5A 2E5GA 5IQQA 2DBBA 1FWPA 2WSCC 4RNMA 2W8KA 2L41A 2MLXA 4JYAJ 4UQTA 1G6BA 5KFXA 3CCZA 3KTQA 2CPYA 4KV8A 1EKSA 5JMNA 4LMZA 2VG5B 4DEZA 5AJ3F 1CJTA 4NCGA 3W8PA 3RB3A 2EVZA 2NREA 1GTEA 2JL9A 1JLFA 4NYZA 4NZ7A 1RHQB 2DNGA 4DF8A 1RAFB 2D74B 4CWBA 2J7WA 4HLBA 4TVAB 2MSSA 4NLXA 1FRLA 1J2VA 2YWHA 2MZ1A 4NA3A 1M5PC 1FNXH 3ISND 4ZVUB 3ISNC 3D67A 2CQIA 2QA4S 5HLFA 4YEAA 2PI5A 4OV6A 1HBMB 1HL6A 2H65B 4P71A 3FZBA 2L9WA 4FVMA 1Y3KA 5D77A 5B0CA 1FRXA 2FJDB 5KAKA 3PFOA 3Q2SC 1NHVA 1TKZB 5CA5A 1R8BA 2GQCA 3LP0B 5T41A 3KG4A 2MZJA 1S1XA 2MEWA 4NYPA 2E66A 2QEXS 4NCBA 1S6QA 2VONA 4J9KA 5KFMA 1RT4B 1UFKA 2ZOMA 1S6PA 1NJWA 1EX8A 5D4NA 3KLFB 4P2SA 2QLWA 1NJYA 1JQGA 2EFOA 1T9VA 4IRCA 2JLGA 3HPOA 3CDAA 2Z2ZA 4C3MA 2B0GA 2E1PA 1VQSA 1R0AB 1UJ5A 2QLXA 4LF2A 3M6VA 2QA2A 4DJBA 2AQ4A 4ED3A 3POTB 2XYGB 5L1JA 1KVKA 2L3MA 2XNRA 4W4MA 5I3UB 3NGTA 2L48A 5B0DA 3C2PA 2IC3A 1X0FA 5KFDA 2NUHA 2K7JA 1X7VA 2LEBA 3VR1A 5ITHA 4DSFA 2V69A 1SQGA 1DLOB 1JXVA 3QWUA 4HTIA 5D0RA 4LBPA 2XS7A 1S99A 2VBXA 5LT5A 3PYDA 2EI5A 3H20A 3E3XA 1IWAA 1S97A 2EBGA 3V6HA 3CCWA 4RUHA 1N32F 2IVYA 2G13A 3TNVA 2OMOA 3BPSP 3C3LA 4ZVRB 3W2VA 2XSJA 1ZS6A 1IKYA 4LF4J 2E5LJ 2VL1A 3MM5A 1XMOF 3MM8A 4OX9J 4K50A 3QLHA 1CS4B 4OX7A 4RBUA 3PJWA 2EFNA 5LJ3Y 4KHPF 5ETKA 3QAUA 3PXGa 2CNOB 1GMWD 4DWIA 2QA4G 5JVHQ 2WONA 2GFFA 4ED4A 3PX0A 1WC0A 3NAHA 2H3EB 5JJBA 4IR1A 3SBMA 5LOQA 3JSBA 2IFXA 1NK8A 3I9V9 2CPEA 1BQNA 2VD3A 4PPZA 3KMQA 2ZBCA 4KBIA 1XEZA 5LM7E 3W60A 4N8NA 2V0NA 2G0JA 4WCEQ 4PQUB 4O3RA 1CBKA 3SCKE 3CPWR 2G2OA 3VAGA 4UUXA 1K73T 1U26A 2EK6A 5EWEA 3CXCR 8ATCB 2AJ4A 4BCAA 5KT4A 1REVB 2V2QA 3ENAA 1PAEX 4YUDA 2OSQA 4MK8A 3MR7A 3EVWA 1SUQA 3DXSX 3DU5A 4XPCA 2CYYA 1YX2A 2I38A 5KFCA 3D3CJ 4NLPA 4DL3A 3UN3A 4RNFA 5LMUJ 1PJ7A 3HXMA 3GONA 2OELA 3ONQA 1J5OB 2EPIA 4K5SA 5L1LA 4MYTA 4ZDNA 4I2QA 2DHXA 1Y9OA 3F0NA 4B3TF 4A8FA 1AUSL 3RAMA 4I6YA 1NPPA 2A0FB 2V4QA 3CO9A 5BYRA 2MLYA 3VVUA 2ZH5A 1E6VB 8AT1B 4XDCA 4EU0A 2CPIA 4QU7A 1IBCB 1VC6A 1SC4B 2KO1A 3GZ7A 3KLHB 3E8OA 3BF4A 3ET6A 3I31A 2B5JA 5FJ4A 1M5HA 2WRMA 2ZBPA 3HDSA 1XMQJ 1FKAF 4DS5A 1IN0A 2YKPA 2E9TA 2KJVA 1PIEA 3FQLA 5A2QU 3B78A 2C1EB 4TN2A 5AXLA 4YB5A 4DLEA 3IS9B 4PYAA 1UEKA 3G82B 3ILOA 3DLHA 1OSDA 5J1EB 1RTJA 2V8DA 3K5MA 2XZTB 2OAUA 3TO8A 2C2OB 2YNHB 1B7YB 3LH2S 2DNZA 2JZ5A 1GMVA 1RTHA 1RWKB 4I7FB 4V19J 3PHEA 2FJVA 1DQ8A 4OHXA 1EKRA 2QSWA 4ZJLA 1FRIA 3OVAA 4I6AA 3M2UB 1RDRA 1KDNA 4QW8A 3KJVB 2OFHX 4H4KC 1MWYA 1K9MT 2PFFB 1YK9A 5LJ5Y 2XYHB 1YG0A 1N56A 3NGUA 2B9XA 1MMDA 2DY9A 4IFYB 1KEKA 3U1MA 1DARA 3UR0A 3MEKA 2N7CA 1CULB 3JS9A 4B9LA 4MMOA 2PGCA 3DLKA 4GMKA 3IM8A 1GFWB 4DUZJ 5D0GA 2I5JA 3RB4A 2MJNA 3DOMA 4DV1J 3KLIB 1D8YA 4PG8A 2R7XA 4I6WA 4IOBA 1S0OA 3L09A 3TA1A 5EWFA 2VQFF 3UR3C 4HT7A 2FJWA 2W8LA 3FFIB 5IZHA 4J9PA 1IKVB 3KK1B 1JLBA 2HQ3A 3CB4A 3U02A 4DV4J 5IT9U 1MROA 5L46A 4F2SA 4A8SA 4LBHA 2XMJA 3GFHA 4AFFA 2ZFHA 1R8HA 2B4VA 3JYTB 2E9ZA 2K1RA 4DV6J 2O01C 3MECB 4C2MA 5B08A 2VH7A 2RJZA 3HJFA 1WDTA 2GO8A 4LF8J 2QL7B 2NR0A 1X5TA 2PDAA 1VRTA 1IWGA 2IA0A 2XS5A 1RT6A 3GFZA 3A3OB 4WFAQ 4MK9A 2A2CA 1ZZFA 5IT0A 4CLPA 3HSDA 4NRUA 1IR0A 4Q2LA 4JI6J 2RUGA 3CJ0A 2PMZD 4TU9A 9RUBA 2UXCJ 5LL6d 1S1VB 2DGSA 2MJUA 1F2GA 2YQ1A 3FNNA 1LEOA 3B82A 1V3ZA 1C0TA 4RUCA 2Q6CA 4AL6A 3BYRA 5CYQB 9ATCB 4YHHJ 5C2GA 2JVRA 1QTNB 3PZPA 4F3MA 2XMAA 4P7TA 5KFUA 1IKWA 3TZYA 3M9NB 2ZE2A 5KFIA 2FHJA 4QPXA 2DNPA 3OLBA 2EFQA 1F9HA 3A8KA 2ZHBA 1RI7A 2I6WA 2C3PA 3OFHA 3DLBA 2OUGA 1YRTA 3QFHA 3M7VA 4DQRA 5L9XA 2BJ7A 1NHKL 3SSSA 1Y5NB 2KZMA 5DQIA 4EBEA 4BWMA 3MR5A 2MY7A 3AD7C 1OWXA 1TV6A 2J6SA 2CPDA 5ETVA 1PBAA 1RISA 2OPRA 4DCPB 2ZH4A 4X4SA 1A6LA 3JQMA 5M2RA 2OPSA 3H5YA 3FSIA 1QVFR 5EWGA 1UEVA 2HZVA 1VBXA 4BC9A 1FDDA 4WU2A 4JYAF 1QJHA 5CZVA 3RBEA 3H98A 3KUGA 5AE3A 3LO3A 1VQPS 3SYZA 2CZ4A 3F73A 5G4DA 4RWWA 1F5AA 4C8ZA 2MKSA 2IA6A 4IH5A 2HWIA 1CJKA 4IKAA 2GA7A 1SH3A 4CTAA 4OX6A 1RT7B 4CO4A 4V1Ak 2O1PA 2WB4A 2HHTA 2JC0A 4LSNB 1X4GA 3SIPB 1LOUA 4X65F 4DR2F 4D3HA 1SC1B 3PR5B 5DGBA 4F7VA 3O8WA 4J9RA 4QWEA 1LXJA 4EWTA 4WIIA 4HVZA 5DDRC 4OJ1A 3PFEA 3UO0A 3IBFB 1P6TA 2RKIA 3BGLA 3CGIA 4GVLA 3PV8A 5KFAA 3NCQA 1YI2S 5DETA 3CJ2A 3GJTB 1JIHA 3D6HB 4X62J 2IBOA 4PG4A 5L1KA 4WYLA 4QQBA 4KRWA 4O23A 3BSOA 3MI7X 5HQ8A 4B9NA 3C46A 1P8GA 1TU0B 4Y2CA 4H54A 4HI1A 4LREA 4CH1A 4OFZA 3JSMA 1FE4A 2XCPA 3B6BA 4YR3A 2V9WA 4H4OB 1U6ZA 3IG1A 3R5JB 4NEYA 3SSQA 2U2FA 2UUCJ 2CQ2A 2HEKA 3ZZPA 4DX8H 3HSGA 1WUUA 3IWLA 5F0UA 1YBTA 1KFDA 2QLJB 1UVLA 3FUYA 1Y00A 2IDEA 4WP3A 3D68A 1N5TA 3OTBA 1RXOB 1HWUA 4OYMA 3JAMU 2OPPA 3MFHA 2DHSA 3TQEA 4TQSA 1T05B 3MHYA 3BN4A 2XB2D 1Q8KA 4N7TA 1VJWA 1NAQA 1HQEB 4PZVA 3DLEB 2F9DA 4RU9A 3L7UA 1U25A 2LP4A 4OQJA 1TMJA 2J0SD 4MFBA 1DJ0A 3EXYA 3DOKA 4J90A 1S9GB 4ATNA 3RRKA 5B0EA 2CQGA 1FESA 4LF7J 5F9NA 4X2BA 3QSIA 5F8MA 1S5ZA 2JRSA 5HQMA 3EVMA 1R8AA 4DPXA 1PCAA 3UN5A 4O44B 2ZHOA 2I0XA 1Q7YT 3SI8A 3NWGA 3OR2A 2VZ9A 1M0SA 3M1VB 2QFJA 4WZMA 2F1FA 2HHHF 1OY8A 4CCHA 2VFSA 3M30A 3C16A 2QE5A 1TL7A 3UVJB 4JV1A 4RW6A 2ZH8A 3CCES 5EUHA 1U2RA 1XNRJ 3TUJC 4C4WA 4RLEA 3G96A 3MDFA 5MLCV 2B6AA 4OI1A 3CJSA 3UD5A 5LMNF 4A4JA 2XMKA 4N77A 4MKVA 1GXLA 1KS2A 3RBZA 5A8RA 1PC5A 3EGNA 2M52A 3DRYA 1VQOS 1S0NA 2E1RA 5LMUF 4KC5A 3D54A 1WOOA 2B9YA 3E2EA 2GX8A 4GRSA 4DV3J 1Z2LA 3NRBA 1EETA 1U0HA 3J7AN 4USKA 5HK4A 2OEMA 1S1UA 3AQPA 3EVOA 2D9PA 2KXFA 4A8XA 4B02A 1NMEB 1X60A 2H5JB 3HO1A 2WCXA 2PFDA 1M5SA 3VAHA 1WNEA 1KSPA 3CDBA 3FBBA 5HP1B 3FBEA 4X4VA 1Z2ZA 5GAGI 4DPTA 5A6WA 1ZH5A 4WFNQ 1JJCB 4Z37A 3AD8C 4P6QA 2VG7B 1RT5B 4DV7J 4FNIA 5E3RA 1HNXF 3L7PA 1UW4A 1YZ6A 3T6JA 1C4CA 3MTKA 2IAJA 3C14A 1LW2B 1O6XA 1OMSA 4ECVA 2OD6A 2NXUA 3NBPA 3MM6B 4AT1B 2E7WA 2V4JA 3CMES 5K8MA 1RU1A 2ALZA 6AT1B 2CJYB 2KXHA 5A76A 1DRZA 1U49A 1VQMS 5F9LA 3AFGA 5HL7Q 2CZ9A 2MGZA 4QPTA 4C0BA 3ZZUA 2E29A 1U1NA 2QL5B 2IYGA 1X4AA 4OV1A 4ZVGA 4H4MA 3EGZA 2N7YA 3Q8SB 4BLGA 5I42B 3KHGA 2Y0BB 3BGUA 4C0OC 3MXHP 4B3MJ 5C24B 3KHHA 3BH7B 5E3QA 2E5JA 1R27B 2NXNA 2APOA 2YKNA 1JB0C 3VAFA 2ZWPA 3BYPA 3WHIA 3K7RA 2F4VJ 3CCUS 3T1YJ 1N5YB 3BN7A 5DGAA 3C6UA 1D09B 2KZZA 2QMWA 3DYAB 1T8EA 1HBUA 1EAYC 3OFFA 5DLGA 3LA0A 1JNRB 4RZRA 1NPRA 3I87A 2NPIA 5K9FA 3OR1B 3OTEA 3BJYA 1TK5A 3S01A 2DK2A 3J7ZT 3OVSA 1S9EA 3W2WB 1XN9A 3DXBA 2HHSA 3UCZP 4Q0BB 2UXBJ 4ZPTR 4L3NA 3SEOA 2FVCA 4DV6F 2BM1A 2F7VA 5ETQA 3P5TL 2EKNA 3W8GA 4X66J 5J2QA 3HF5A 4CZCA 4LF8F 5C25B 2MYFA 4JI4F 4P74A 3UDVA 1EP4A 1HNIA 1QD1A 3NL0A 3QT5A 3R6LB 1KLMA 1LWCB 2PA8D 2H4YB 5HATA 3HVWA 3RAXA 2BKNA 2C2MB 5HBMA 3DDNA 1HR0F 1RCOB 1SQEA 1PJ5A 4K5RA 5D6GA 1MU2A 3D3BJ 1C2PA 2F8MA 2CIMA 4ILMA 3WIVA 1TL3B 2NCKL 4IO9Q 3RJMB 2HQIA 1TKTB 1VR6A 3PACA 4P7VA 2XC9A 1H73A 5DZ6A 1TELA 3QATA 3BPDA 3GFYA 1JNZB 5B0FA 2DNKA 1NH7A 3OUYB 1FK9A 3Q8UA 2MY8A 4Q43A 3MOJB 3P4UB 1EQMA 4KH1B 3TVYA 3D5MA 3BH6B 3R5CA 2CJKA 3QJLA 1WJ9A 3D6FB 2OPQA 2HNYB 3OL6A 2NUUG 2FZCB 1IBMF 5AXNA 2M2BA 3NWRA 1IBKF 3LQVA 1UJ6A 2CJ9A 1XQIA 1FRHA 3MEDB 4ILLA 3MMBA 2B43A 3ZTQA 4LIWA 2DXDA 4B9SA 2JFDA 1H7XA 1Q1KA 5L38A 2R8GA 1ZYQA 2HRUA 4F50A 2NSCA 3DGPB 4C0HA 1SC3B 3ICLA 1R8CA 4K4ZA 3MF5A 1RJJA 5T7LB 3RBXA 1U02A 4ZVFA 1UWAA 2AD9A 3A3PB 4ECSA 3K5OA 1U1RA 3ISZA 4WFXA 2W2PP 3DRXA 1HNZF 2R7RA 3DLGB 3VALA 2UXDJ 3IP0A 3J81Y 4DPWA 2WBRA 3GJRB 1UAWA 2B56A 4MT1A 5DJBA 5KFSA 3CCMS 3NMAA 1HQUA 3AQOA 3KJFB 2XM3A 3EXCX 1UETA 2YKMA 4YY3J 3ZO7A 4DR4J 3Q83A 4TLRA 1L3VA 2JX2A 1RTDA 4WTOB 2N82B 1VOMA 3GJSB 3T41A 3KK3A 1Q8IA 5E2QA 1T9UA 4ZA1A 1IBLF 4JI8J 2L08A 4PYDA 2PMHA 4X62F 4UF4A 3FMWA 1OQ6A 2R8KA 3W65A 1RZMA 3EICA 2GO9A 1ZAWA 1YRUA 2MZTA 4O3SA 4ED7A 4NXNJ 5H9EK 3DM2A 1NK5A 4X4OA 2DEJA 4K4UA 4KV8B 4HYKA 3OV7A 2JHEA 2V8HA 5DG9A 1UTAA 2HNZA 3O2IA 1CJTB 1KHVA 1TKXA 4NCGB 1PILA 3DMJA 4DF4A 2CRLA 1Y5IB 3H2UB 2BZ2A 1JLFB 3ILIA 1I1GA 1I6JA 4LR9A 3H2LA 3H25A 2ZJRQ 3P6YC 5KFJA 5JXSA 3D1QA 4K0KF 3W62A 3W9HA 2BM0A 3BZQA 3KJNB 1EQ0A 3TAQA 1S77D 3W5XA 4O0IA 1SXLA 2DIVA 3KG0A 4ECZA 3QIDA 5HLFB 4CO3A 1QY7A 2M88A 4DL2A 4HI2A 3AAWB 3KNGA 2FZGB 1KWMA 3DRPA 3HP6A 4DG1A 1XNQF 2AX0A 3ZTPA 3T19A 1S1XB 2HKEA 4RR5A 3K5PA 1N33J 1AZSA 3KLEB 4ECYA 4URGA 1VMBA 1S6QB 1YJ9S 2R2SA 5B09A 1S6PB 4IH6A 2VPXB 2J0XA 2BE2A 5J1NA 1TTHB 1LFPA 3IRXA 3SV3A 1T3NA 1RHJB 2DYAA 2DRBA 5E3AA 1Q8BA 3HHDA 3THPA 3CD6S 3MM9A 4FXDA 1NSAA 1TFYA 3C8YA 5I3PA 1WEYA 2HG4A 1TUWA 4U95A 2IC3B 4DLGA 5CAAA 4ZVPB 4K4WA 2GS8A 1VBYA 3ZTSA 1JLAA 1W25A 3G6YA 4LF9F 3PW2A 2MHEA 1TL1A 4UOGA 1U6FA 4WE1A 4OYXA 4ZVTB 3V6JA 1WC1A 5CZXA 4U67Q 2B4PA 2R7OA 3M2RA 2LQBA 2W7PA 1XNRF 5IM0A 4NLYA 2C2EA 5J1PA 4ANDA 3NAIA 3W2VB 2GHPA 1WI6A 1IKYB 2FUG9 4DUYJ 4N76A 3RTVA 4RUBA 1B3TA 5HSPA 4WKYA 3EMTA 2KJWA 1FO1A 1U48A 3MM8B 1YWXA 2RE1A 3QLHB 4XAKA 1EJ7L 1GX6A 1RK8A 2XMTA 2K2PA 4F3QA 2FHJD 1R89A 4ZP6A 2PN6A 2CQ4A 1HKAA 5F8NA 1CLFA 4F26A 3BKUA 2ZVSA 4ZCLA 3MCSA 2YNIB 4NLGA 4DV0J 1N34F 3GYGA 1QSLA 2P9EA 4JI1J 5CD4H 5ETRA 3KUEA 1BQNB 3LALA 4BS2A 1V3RA 3MEEA 2EEYA 1YJTA 4DX5A 2K3IA 4ZN3A 4DR1J 3MEGA 4P10A 5CYMA 4BC7A 2YX4A 1YJNS 2A18A 3PW4A 4N56A 1P1TA 2BW7A 4MTPA 3GIIA 1Q86T 5HMXA 2FB0A 3DHXA 1SV5A 3K8VA 1WHXA 4ZHRA 2ZH2A 1G7CB 3TARA 1SUQB 4R5PB 2B8QA 3OSPA 2AF6A 2OHDA 2DNRA 1JXLA 2V5HG 5K8NA 1BQMA 3Q22A 4QIEA 4CQ1A 1CC8A 4EEYA 2ILZA 4CNYA 4J9VA 4OHVA 4I2QB 4UOHA 4KPCA 1VHFA 1REGX 3NGSA 1J5EJ 3MAAA 1FDNA 2CQCA 4DQPA 1VQKS 3N0VA 1S6UA 3SFGA 1AA1B 4UW2A 2WK4A 1CG2A 1HQ2A 2JH3A 3VGUA 3HKWA 3M4XA 2IM3A 3ET6B 5GAGU 2B5JB 3R1LA 2EFPA 4ZVOB 2LYVA 4QWCA 2Y1IA 4BBYA 5I3QA 1Q4RA 2P5VA 5KTQA 2I8EA 2CUYA 5DDPC 1VCTA 1RWMB 4ZP8A 5HROA 4F02A 3BBBA 3R7BB 4USJC 1AYEA 4C8LA 1SQFA 3A1YG 3I5BA 4CI0B 3HHLD 4PG5A 4NA1A 4HH1A 3SDEA 3QSYB 1RTJB 3NS6A 4LFBF 2AGQA 2F3JA 4N47A 4Z2XA 4FXWA 3V5RA 4JP8A 2F8HA 1RTHB 2R7WA 3HK2A 4FF3A 1OIAA 2YWGA 2XZDB 3S1TA 1HW9A 3PW7A 3CDEA 1UVKA 1Q78A 3T5KA 4YOEA 4M5NA 4N41A 1IR1A 1HNWF 1AFIA 2LCWA 4NL5A 1RAHB 3LWLA 4DN0A 3AXMA 1VYAA 2B51A 2WOMA 1IQZA 2OTJS 1FJCA 2NQPA 4K8RA 2EKYA 3QBCA 3UDLA 3F56A 4ELVA 3DLKB 1NBEB 2IYIA 4CLFA 2I5JB 5E33A 1RAAB 4XK8C 3VVTA 3DOMB 1FWKA 2QIFA 3LTOA 1YIJS 2DGOA 2QJ3A 5EX3A 2DKOB 1Y0HA 4C8OA 2WZ1A 2CVIA 5K14A 4CP5A 4IQXA 3MPDA 1JLBB 1FFSB 2BJEA 2BJ8A 1GH8A 1JKHA 3AJ2A 4NCAA 4DZ6A 3J7Z5 2XMWA 2RU3A 2H1YA 5GAHI 2HZAA 1Q53A 3ZTRA 1U1PA 2G0IA 3DU6A 3MURP 2ZH6A 2GJIA 3LOUA 2K1RB 2AYMA 4J91A 4FF1A 4CO5A 2R3VA 3S8SA 2JWNA 3MUVP 2WSEC 1FX4A 3BKTA 1NHUA 1WELA 2D69A 2X1FA 4WKRA 1Q5VA 3QRQA 3OQ2A 3M8QA 3HI9A 1VRTB 1FT8A 1RT6B 1RACB 3G9CA 1NK6A 1ZM2A 1RBAA 2ASDA 1GX5A 2VPZB 1HD1A 2BR0A 4OZJA 4KFBB 5BJRA 2PO4A 3W66A 1IJEB 5B0BA 2BOAA 3AY0A 3V6KA 2QYGA 3LW5C 5HJXA 2YWEA 3PIPQ 4YB7A 3M8PA 1C0TB 1OYDA 3TX0A 4G1QA 3RYLA 5BYSA 4X4TA 2R9LA 4UY8T 1FWLA 3BDPA 1SIWB 2WB1D 2ACYA 2IMWP 2WSFC 3TUIC 2BEFA 2HWHA 1IKWB 4NYOA 3RR7A 2W25A 3CCVS 3NNAA 2ZE2B 1NZ8A 3BGOP 4OYIA 2X3GA 2XZWA 4L76A 3U1LA 1QUPA 2Q79A 4JV5F 3J81j 3N28A 4P2FA 4NLOA 1XK8A 1NK7A 5F8LA 4CLSA 4YY3F 2UV8A 2HBYB 2KVIA 1H98A 4MJKA 4FPIA 1TV6B 3QJPA 2GMLA 4RL1A 4F4YA 1X4EA 2OPRB 4OJGA 3CJKA 4ID8A 2OPSB 2CG8A 3RBDA 5KG1A 5BR8F 3IA0A 4CH7A 4JI8F 2W9BA 2GQQA 1EIYB 4IFVB 4LUBA 2AP6A 3HLUA 2Y9HA 3GB0A 3A8EA 4PQAA 2EG2A 3KFWX 1KQGB 3D6MB 4X64J 2V63A 3WDOA 4CRJA 1WHWA 2EXUA 4TXSA 4PPDA 2GAHC 2HNDA 3M8YA 1UZDA 1LWFA 3B54A 2B4UA 2J76E 1CJKB 3QRRA 2DHHA 2O5DA 2GQ2A 2O66A 4CTAB 1DHMA 5KFYA 1FERA 2DXFA 2J6TA 2Y8YA 1D9DA 5FDLA 3VGSA 4ZIWA 2XGPA 3UI3A 1AB8A 3PYEA 1F5BA 4R25A 4UT4A 2QX0A 2M3DA 3THVA 3EX7B 4RW8A 1HWKA 1SPBP 5GADI 4NI2B 2HVIA 1I5OB 4PWWA 2M8DB 4USWA 2DB1A 1NJIT 1RT4A 1C0UA 4GC7A 1NDKA 3IBCB 3P8BB 2K06A 5KG0A 3T9NA 4R0EA 2V8PA 4CM0A 3CJQA 2D9OA 2WVFA 3JTOA 1CJUA 3CJ8A 1L3KA 3E01A 1R0AA 2GGPA 3OSNA 5DRKA 2NS1B 4DPYA 4M5GA 3MR2A 3MD3A 1WF0A 5IOLA 3D0HE 1WI8A 2D3UA 2ZH3A 3BV8A 4J5OA 4PXDA 3JSMB 3VV2B 7FD1A 2BVZA 1U24A 4ED5A 3IG1B 4IO1A 5HVFA 2C22A 1X0PA 1HWIA 4HACA 2FJAB 3T1HF 3DLJA 2Z4PA 5DQHA 5KFBA 4QIWD 3QGGA 2RDJA 5JVGQ 2QLFB 3TZZA 4DR3J 4JI0F 1XJWB 1WHVA 2LEPA 1RKIA 3DC2A 4CH0S 3KG1A 3H40A 2C3YA 2RUSA 4JBCA 2IIHA 1T02A 3GCWP 4FKXA 2GV1A 2YNFA 1HI1A 3B4DA 2OPPB 2HVEA 4ZPWR 2XMUA 1NH8A 3G6XA 5F8GA 2KTQA 2JSXA 1HWJA 1HHSA 5ETTA 1SJFA 4M1KA 3JAMY 4FF4A 2DNQA 5KT5A 3UD3P 2F40A 2IPOB 3ZTOA 2N3OA 2NYHA 2H5IB 4XPEA 1SJQA 4HHJA 2BW2A 2VOOA 2V2ZA 3PKMA 2M7SA 4DN9A 4DR7F 1DBDA 1T9XA 1QAXA 4UOCA 4ZK7M 4MFBB 4TY8A 3L3CA 1X4CA 1LKZA 4E0DA 3DOKB 2Q66A 2V2VA 3Q8RB 4QOTA 1VC0A 4OIXA 4ALZA 4PUOA 2W4CA 1AXQA 5CXTA 4Y2KA 1KC8T 2CPFA 2ZKTA 2ZZTA 2HVDA 1BLUA 1VFJA 2LXIA 4DR5J 5LSRA 3PW5A 4WK3A 1FJGJ 3MFIA 2LU1A 3OR2B 4Y28C 4DPUA 2WVEA 2DTJA 2IMOA 3PIOQ 1WWHA 3M30B 1RAEB 3GFXA 4DI6A 3C16B 4YR2A 4DS4A 1TL7B 4RW6B 3HVRA 1ZOTA 2UUBJ 2CPHA 1FRJA 4DV2J 2VBWA 3QT8A 2GMJA 4PG6A 4LSLA 2B6AB 1IJFB 1DTTA 3RRGA 4XO0A 3FEYB 3R2DJ 2RB7A 2XHWA 2GVDA 2J6UA 5KFTA 4DL5A 2JDJA 4FYDA 2ZHAA 5A8RB 1HARA 3A4TA 3H2VE 4QIGA 3IR6B 2G1DA 1G4CA 2CQ1A 2J8AA 1Q81T 2KYZA 2ZUAA 1DTQB 1N52B 4ZVQB 2YX1A 3PYFA 1OPZA 1PSDA 2QZ8A 2V34A 3FRYA 4YQWA 4CO2A 1EETB 1U0HB 1F3FA 1WACA 2V2KA 3AA8A 1RHKB 2HMIA 1S1UB 5D4LA 2AT1B 2HFNA 4PWUA 3OTOF 2CJAA 1S57A 5DO2A 3GYNA 2VKRA 2HGNA 1U09A 4LFAF 4Y2MA 1OPIA 4OLOA 2JEFA 2UU9J 2RDDA 3PO4A 3BB5A 4GKKF 2CNNB 3GJQB 2YNHA 3M9MB 1X5OA 2FY8A 1LWEA 1R0CB 4BHQA 2X1BA 1H74A 2ZM6J 3OT9A 4ITSA 4PXCA 2W4PA 2XY6A 2IAJB 3C14B 4P75A 1UA1A 3MMCA 5F3ZA 2YBVA 3ENVA 2AJQA 2XBPA 2RSQA 1GT8A 3GWCA 3NBPB 1NO8A 4GKJF 3U7JA 2MKYA 3AOAA 2V4JB 1D1UA 4DL4A
chains in the Genus database with same CATH topology
1NHKL 4UOFA 1NPKA 3NGRA 4W98A 1B99A 1JXVA 2DXFA 5CAAA 1WKKA 3VGVA 4ANEA 1F3FA 3BH6B 3JS9A 3VGUA 4F4AA 3ZTSA 2HVDA 1VYAA 2B8PA 2DXEA 3VGSA 3Q8YA 1NDLA 3Q83A 2AZ1A 4WBFA 1BE4A 1NSPA 4UOGA 1S57A 3FBCA 1UCNA 3ELHA 4O0NA 3FBBA 3BH7B 4F36A 3FBEA 1MN9A 3PRVA 1XQIA 1NB2A 3FC9A 4S0MA 1ZS6A 2BX6A 3Q89A 4FKXA 4C6AA 3ZTQA 5CABA 4DI6A 3ENAA 1PAEX 2HVEA 5BXIA 2DXDA 4EK2A 3EM1A 1MN7A 3EVWA 3BBBA 3VVTA 2AZ3A 3ZTPA 1NSQA 1HLWA 1NLKL 3BBFA 1LEOA 3Q8VA 1B4SA 4ANDA 3L7UA 3EICA 4ANCA 3GPAA 1NDKA 1BUXA 3EJMA 4HR2A 4ENOA 3EE3A 1K44A 1WKLA 2CWKA 3DDIA 2B8QA 1HHQA 2NCKL 3EMTA 1NDCA 3GP9A 3ZTOA 1U8WA 4DUTA 1HIYA 1W7WA 3B6BA 1LWXA 3ETMA 2VU5A 1WKJA 3FBFA 1KDNA 5IOLA 3WX8A 4CP5A 3G2XA 5C7PA 1PKUA 3MPDA 1BHNA 2DYAA 3BBCA 3FCWA 1F6TA 3NGTA 3FKBA 3FCVA 3PJ9A 2BEFA 1NSKL 3VVUA 4UOHA 1NDPA 3NGUA 4KPCA 3VGTA 1XIQA 2ZUAA 3NGSA 4DZ6A 3B54A 2DY9A 1S5ZA 2HURA 3EVMA 3Q8UA 4FKYA 1NUEA 1EHWA 1S59A 1NCLA 3EVOA 3R9LA 3Q86A 3DKDA 3ZTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHK L;  4UOF A;  1NPK A;  3NGR A;  4W98 A;  1B99 A;  1JXV A;  2DXF A;  5CAA A;  1WKK A;  3VGV A;  4ANE A;  1F3F A;  3BH6 B;  3JS9 A;  3VGU A;  4F4A A;  3ZTS A;  2HVD A;  1VYA A;  2B8P A;  2DXE A;  3VGS A;  3Q8Y A;  1NDL A;  3Q83 A;  2AZ1 A;  4WBF A;  1BE4 A;  1NSP A;  4UOG A;  1S57 A;  3FBC A;  1UCN A;  3ELH A;  4O0N A;  3FBB A;  3BH7 B;  4F36 A;  3FBE A;  1MN9 A;  3PRV A;  1XQI A;  1NB2 A;  3FC9 A;  4S0M A;  1ZS6 A;  2BX6 A;  3Q89 A;  4FKX A;  4C6A A;  3ZTQ A;  5CAB A;  4DI6 A;  3ENA A;  1PAE X;  2HVE A;  5BXI A;  2DXD A;  4EK2 A;  3EM1 A;  1MN7 A;  3EVW A;  3BBB A;  3VVT A;  2AZ3 A;  3ZTP A;  1NSQ A;  1HLW A;  1NLK L;  3BBF A;  1LEO A;  3Q8V A;  1B4S A;  4AND A;  3L7U A;  3EIC A;  4ANC A;  3GPA A;  1NDK A;  1BUX A;  3EJM A;  4HR2 A;  4ENO A;  3EE3 A;  1K44 A;  1WKL A;  2CWK A;  3DDI A;  2B8Q A;  1HHQ A;  2NCK L;  3EMT A;  1NDC A;  3GP9 A;  3ZTO A;  1U8W A;  4DUT A;  1HIY A;  1W7W A;  3B6B A;  1LWX A;  3ETM A;  2VU5 A;  1WKJ A;  3FBF A;  1KDN A;  5IOL A;  3WX8 A;  4CP5 A;  3G2X A;  5C7P A;  1PKU A;  3MPD A;  1BHN A;  2DYA A;  3BBC A;  3FCW A;  1F6T A;  3NGT A;  3FKB A;  3FCV A;  3PJ9 A;  2BEF A;  1NSK L;  3VVU A;  4UOH A;  1NDP A;  3NGU A;  4KPC A;  3VGT A;  1XIQ A;  2ZUA A;  3NGS A;  4DZ6 A;  3B54 A;  2DY9 A;  1S5Z A;  2HUR A;  3EVM A;  3Q8U A;  4FKY A;  1NUE A;  1EHW A;  1S59 A;  1NCL A;  3EVO A;  3R9L A;  3Q86 A;  3DKD A;  3ZTR A; 
#chains in the Genus database with same CATH topology
 1WF1 A;  3VAJ A;  1WOR A;  2VF3 A;  4DFP A;  2XO7 A;  2MGZ B;  2LQJ A;  1CQN A;  4OI3 A;  1XER A;  2QLB B;  4JI2 F;  4MIB A;  3W9I A;  4WBF A;  1L3U A;  3N6L A;  2C3O A;  4H4M B;  3D2W A;  1RGV A;  4CLL A;  3CCS S;  5F0W A;  4NEZ A;  4A8M P;  4DQS A;  3QWP A;  1F60 B;  2V4R A;  3G6E S;  4WTY A;  2ZWO A;  4ES1 A;  3Q23 A;  3TA2 A;  2ASJ A;  3T9Z A;  3HJV A;  3HSZ A;  1U4B A;  2YKN B;  1VRU A;  1PBU A;  5RUB A;  1E6Y A;  2KN4 A;  2MQM A;  1VQY A;  1H72 C;  2NZC A;  2Q6B A;  4IG0 A;  2XSF A;  4CLZ A;  3I32 A;  3ILJ A;  3R5G A;  3C6U B;  3HZE A;  1RT3 A;  2HLU A;  2ZJP Q;  1HBU B;  4DSK A;  4NXM F;  3H0P A;  4LF6 J;  2GJ2 A;  3FCW A;  3OPK A;  4LR8 A;  1RT1 A;  2W4D A;  5H9F J;  2XMM A;  3B8H A;  4USM A;  1UVJ A;  4RNH A;  3DI6 A;  1BY9 A;  1JLQ A;  3H7H B;  4QR2 A;  1HYS A;  2CXE A;  4UOF A;  2JVO A;  2W2Q P;  1S9E B;  5ETM A;  2BE9 B;  2PEB A;  4DXL A;  1OYE A;  4AL5 A;  3HT0 A;  2HQC A;  2V6A A;  3VAK A;  2FLO A;  3HVT A;  1Y5L B;  1FCA A;  4EO8 A;  5J2Q B;  1I94 J;  3I56 S;  3N01 A;  2DPI A;  2VIC A;  3TRG A;  1EP4 B;  1HNI B;  1MMN A;  1KLM B;  1VQ5 S;  2ERR A;  3W7B A;  2RRN A;  4ERD A;  3QO9 A;  5HBM B;  2YH0 A;  3OXF A;  3FEZ A;  4C8Y A;  2HRY A;  3X1L B;  1N48 A;  4NLV A;  1MU2 B;  3R7N B;  1P9Y A;  3P3D A;  4FNH A;  4RW4 A;  5GAH U;  3I0S A;  4F04 B;  2PE8 A;  4QJV A;  5C42 A;  4CDI A;  1NB7 A;  4JI3 F;  3PRD A;  3UCG A;  2PI4 A;  1VQ4 S;  2LU2 A;  1G1X A;  4F8R A;  1FKP A;  2DR5 A;  2ACM A;  3W5Y A;  3BQ2 A;  1FK9 B;  3CED A;  4K4X A;  3JB9 k;  2KT3 A;  1WDD A;  1T03 A;  2OKQ A;  1FRK A;  1Q8L A;  5KG3 A;  3SSR A;  3PJX A;  2YQ3 A;  1WTB A;  3CWJ A;  1HBN A;  3AB2 B;  2OPQ B;  3A12 A;  4KJI A;  2N3L A;  2YX7 A;  1KR4 A;  3MM7 A;  3TI0 A;  3QQC D;  5H1S V;  4JI7 J;  3CCL S;  1ZET A;  1X9S A;  4OMF G;  3NNC A;  5FD1 A;  3MMB B;  2VIH A;  2DCL A;  3NMR A;  1L3S A;  3LF0 A;  3D0G E;  4HH0 A;  2CQP A;  3O3L A;  4EBD A;  1S49 A;  1KVJ A;  5KFZ A;  1RB0 A;  1PC4 A;  1KTQ A;  4QR1 A;  2IVF B;  1UFL A;  4UY8 5;  1GTH A;  4M63 A;  5IV4 A;  2RS2 A;  4TNO A;  1EHW A;  2LVW A;  1GXT A;  2BRK A;  4K7Q A;  4W98 A;  2V94 A;  2JLE A;  2FQQ B;  2B7B B;  2CAD A;  2HHX A;  1HQU B;  4K4Y A;  1X4F A;  4M5D A;  4ZCK A;  1NK4 A;  2YKM B;  1U2F A;  5F8H A;  2MKC A;  3CVK A;  2OTL S;  4FXV A;  2FHO B;  1RTD B;  5B7W A;  4F25 A;  4QR0 A;  5KFV A;  3KK3 B;  1X9W A;  1WG1 A;  1UVN A;  2MKK A;  1BC6 A;  2RQ4 A;  2EW9 A;  1LV5 A;  2E5I A;  2UUW A;  4QWD A;  2KG1 A;  2CPZ A;  5LXY A;  2DEI A;  1HHQ A;  4KB7 A;  3UQS A;  1D9F A;  1MNE A;  1DFD A;  3C66 A;  2HHW A;  3I55 S;  3DM2 B;  3IGN A;  5IC4 B;  5FII A;  4RKU C;  1HHT P;  3Q8P B;  2HVZ A;  1UA0 A;  2HNZ B;  1TKX B;  1KQF B;  2DJW A;  4EZ6 A;  3BDE A;  1SJR A;  3DMJ B;  4TKT A;  1RBL A;  3R5D A;  2DR9 A;  1OQ3 A;  3MCO A;  1SJ3 P;  3JQK A;  3T6B A;  1F5C A;  4ETX A;  2ZDO A;  2ZD1 A;  3AH6 A;  4G1I A;  5GAD U;  4AQY F;  1QE1 A;  3M9O B;  1KOH A;  4AE5 A;  3MR6 A;  4WIQ A;  1TAQ A;  4DR3 F;  2BBE A;  2LQ8 A;  2DD8 S;  3QGP A;  3RZA A;  1T7P A;  3CD5 A;  4O3P A;  1OO0 B;  1GQE A;  4PKD B;  2AW0 A;  2P8I A;  2HFV A;  3T3F A;  3M8S A;  3BGR A;  3DRP B;  4DG1 B;  2RT3 A;  1W2I A;  1SBR A;  2HHV A;  1RWU A;  4ED8 A;  1D9A A;  1T9Y A;  2K3K A;  2E9R X;  1AZS B;  1S0V A;  3P49 B;  3AT1 B;  3SCI E;  4USU A;  4IRD A;  1UPM B;  2ZOF A;  3BKF A;  4DFM A;  4B3O A;  4NOH A;  2X1G A;  3KJQ B;  2GCF A;  2GIQ A;  1B0V A;  3QGI A;  2BE2 B;  4DQQ A;  3IRX B;  2IJF A;  2MST A;  4I56 A;  3KKF A;  3R6G B;  5D3G A;  2YPZ A;  3MM9 B;  1NJX A;  2DXE A;  2QV6 A;  3TA0 A;  3H5X A;  4V19 X;  4J9N A;  5HMZ A;  1O8B A;  4DV5 F;  1JLA B;  1CPZ A;  4L72 B;  3CJR A;  2JC1 A;  2R7S A;  1N32 J;  1FKO A;  4LQ9 A;  1TL1 B;  2ZJQ Q;  1W2B R;  4WE1 B;  1C4A A;  4F4W A;  2AEM A;  1LNQ A;  1C1C A;  2E7V A;  3M2R B;  3MMA A;  2ZC4 A;  4MKY A;  4J9U E;  1SL2 A;  4C48 A;  1V6H A;  1S72 S;  2IM0 A;  1YRX A;  5IM0 B;  1N5Q A;  4YME A;  5K8O A;  1RHU B;  4KHR A;  1S6O A;  1VQ7 S;  1IM4 A;  1RAD B;  2GW8 A;  3CCJ S;  3BSC A;  4KHP J;  3L4B C;  4ZLJ A;  2EBE A;  2RF2 A;  5KFP A;  4LF5 F;  2R4F A;  3WX4 A;  2C3M A;  2MDA A;  4FYW B;  5IXU A;  2X51 A;  3ZZZ A;  1JLC A;  4B9M A;  2QN6 B;  3VAM A;  5LSL A;  4DR6 J;  2R7T A;  4DFJ A;  5KG7 A;  3BEG B;  4B3S J;  1S76 D;  1Q7L B;  2LA6 A;  1N88 A;  2CG4 A;  1UVI A;  4C8K A;  1M1H A;  1NJZ A;  4N8O A;  2PT0 A;  2AEF A;  4RW9 A;  1RA6 A;  3MEE B;  3CF5 Q;  3MOZ A;  1PO6 A;  3I4H X;  3VAI A;  1RT5 A;  1WOS A;  1T9W A;  3MEG B;  2A2D A;  1URR A;  3GMG A;  5CYM B;  3R2C J;  2VJU A;  3N9U C;  1OY9 A;  1U1M A;  4WFB Q;  4KTQ A;  1MW7 A;  3JTP A;  4IQM A;  2KHD A;  1RQ0 A;  3U1N A;  5DDQ C;  4U7U D;  1B0P A;  1SV5 B;  1TL4 A;  1WSV A;  3D1H A;  4OLP A;  3F41 A;  4LRC A;  4ZHR B;  3TJ9 A;  1RWW B;  4LFC J;  3M32 A;  4B3T J;  1RAO A;  3AD9 C;  2P9G A;  4CYU A;  1F9E B;  1YVF A;  1BQM B;  3DOL A;  1BWE A;  1N54 B;  2F63 A;  3CT9 A;  2CKW A;  3UWT A;  3MAA B;  3CJ3 A;  4BDP A;  4KHM A;  4WXO A;  2FD2 A;  2VC1 A;  2HPU A;  3ITH A;  2RHQ B;  2V67 A;  1NKE A;  2CQ3 A;  3I5A A;  1RAJ A;  4FBT A;  3AOD A;  5DM6 Q;  4PWD A;  5J2P A;  4WZQ A;  2YWW A;  3BR8 A;  1M1G A;  4C7Q A;  1H2T Z;  2F9J A;  2H4W B;  4G6V B;  2HQD A;  4NE9 C;  5HRO B;  4KY3 A;  1BQX A;  1SKR A;  4OHZ A;  3NP5 A;  2ADC A;  4USH A;  4DUT A;  4Y0F A;  3US5 A;  2AYB A;  3SDE B;  2XLK A;  1YZ7 A;  2VA3 A;  2W9A A;  3IWN C;  4ETZ A;  3FZ2 A;  3R8Y A;  4KQZ A;  1NCL A;  2D3O R;  3HZG A;  4EMD A;  4A8W A;  1PYT A;  4KKO A;  1NK0 A;  2FVR A;  2ZC3 A;  3WQP A;  3RRH A;  3SXL A;  2O3D A;  2JLF A;  3OL8 A;  2PSZ A;  3HHL A;  3EGV A;  3M8Z A;  1VC5 A;  4ZPD A;  2OD4 A;  1K1Q A;  3LP2 A;  2XNQ A;  1UZH A;  2HLT A;  4NLW A;  1MN9 A;  2O67 A;  5HAO A;  4QCL A;  3PKY A;  1U1O A;  1ZZN A;  4WFZ A;  5BXI A;  1X31 C;  2WOM B;  4C8M A;  2ASL A;  5KFR A;  1SC6 A;  4QWB A;  2IVM A;  3PX4 A;  1N8R T;  5A8W A;  2HFZ A;  3QIP A;  4C11 A;  3C19 A;  2M8H A;  1X5S A;  3AJ1 A;  1FDA A;  2VQF J;  2MLZ A;  1A9N B;  2KFY A;  4WU3 A;  2J9E A;  1K1S A;  2BAB A;  1APS A;  1RU2 A;  2DNO A;  4URS A;  4CLU A;  1PKU A;  2BKO A;  2F8E X;  2CQB A;  4OHY A;  2M9K A;  4JI5 J;  4YFU A;  1AFJ A;  4A46 A;  1XC9 A;  2DGX A;  3D4J A;  2J7K A;  4M5K A;  5K14 B;  4YB6 A;  2FYX A;  2XI2 A;  3GQC A;  1HNV A;  3M6W A;  2POK A;  5DLF A;  4B9U A;  1JKH B;  1YJR A;  3CTR A;  4FZV A;  3TZX A;  3IFE A;  3I9Z A;  2AYG A;  2LDI A;  1IR2 A;  3PM9 A;  2BQR A;  4LF4 F;  6FD1 A;  2CDR B;  2HAF A;  2E5L F;  1U7L A;  4NWB A;  2RQM A;  3M8Q B;  4UST A;  5CAB A;  4LT6 A;  4OX9 F;  3MED A;  2XS2 A;  2GC8 A;  2WBM A;  1H38 A;  5L39 A;  1NSQ A;  1YBA A;  1WC6 A;  4FVC A;  4NLQ A;  1RTZ A;  3ZFV A;  4JI7 F;  3LAM A;  5E3C A;  3GV5 B;  3JXO A;  2AX1 A;  1W7W A;  3TUP A;  2F65 A;  1WKJ A;  2PEH A;  1UWB A;  4PAB A;  4FS1 A;  4IOA Q;  4I1T A;  2A6O A;  2YVS A;  2YKA A;  4OI4 A;  1TZ0 A;  3M8P B;  4BWJ A;  1V9O A;  3V6D B;  4G1Q B;  3QNW B;  1JLG A;  5IFM A;  4OZ2 A;  4U6P A;  3G87 A;  3GSI A;  2HQG A;  3TZW A;  1ZM9 A;  2WVC A;  4U8Y A;  1BGX T;  2AV5 A;  2YKO A;  3PDN A;  3BGF A;  1FVS A;  2UV8 G;  2KKH A;  3OL7 A;  4A48 A;  1YQH A;  1HI8 A;  1N6Q A;  1XR7 A;  5ETS A;  3GG1 A;  4C6A A;  2DGT A;  1OY6 A;  4OYW A;  2DNH A;  2XO6 A;  4M95 A;  4DSE A;  5KT7 A;  1B70 B;  3ZNU A;  1QUV A;  4A8Y A;  1B4S A;  4ELT A;  3TVK A;  2R7V A;  3CMQ A;  1M5K C;  1UL3 A;  4HEA 9;  4L74 A;  3CJK B;  4AXI A;  1HBO A;  3VCD A;  2XUL A;  1FA0 A;  4ED0 A;  4WXW A;  1SVD A;  4OZ3 A;  4ED1 A;  2OO4 A;  4RW7 A;  3D66 A;  3GR1 A;  2W9B B;  3TVZ A;  5AE1 A;  3FCV A;  4FYV B;  2K8G A;  3CCT A;  2QRR A;  5A8K A;  4FYY B;  1Y4Z B;  3GIR A;  1XMQ F;  5DDO C;  5C5J A;  5HN0 A;  3KYL A;  2HND B;  3VGV A;  1J27 A;  3SCJ E;  4X65 J;  2G2Z A;  4DR2 J;  1LWF B;  3FGV A;  4ZVH A;  2ZZM A;  1YJW S;  2MXY A;  1SCJ B;  3HD2 A;  4NZ6 A;  2ZEJ A;  3W61 A;  5FDL B;  2KM8 B;  1TQL A;  3Q8Q B;  4PCQ A;  1WF2 A;  2IRU A;  1PAU B;  2CDQ A;  4RW8 B;  2W9C A;  2G0C A;  2DNM A;  1JMT A;  2KT5 A;  5JUM A;  3PX6 A;  4MK7 A;  3GPA A;  2PD1 A;  1FJ7 A;  2KI2 A;  4HR2 A;  4M5J A;  3KLE A;  2C2D A;  3V81 A;  4IYQ A;  3V4I A;  4U7C A;  1FTR A;  2BXJ A;  1C0U B;  3M2V A;  3MWB A;  2HS3 A;  3CD7 A;  2WAQ D;  4ED2 A;  2KRB A;  1CJU B;  3E01 B;  3QRP A;  1ZBT A;  2GGP B;  5IS2 A;  2W1B A;  3CIM A;  4P52 A;  1BMQ B;  2VBZ A;  4ZKA A;  5KT2 A;  2D3O 1;  4YDX A;  4DUZ F;  2IJR A;  3W63 A;  4F2R A;  3AA9 A;  3G86 A;  2MZQ A;  1SJ1 A;  1U8S A;  2ZDP A;  4DV1 F;  4OZN A;  1BE4 A;  1NSP A;  4OI0 A;  4Q45 A;  4HAC B;  5BYQ A;  1EAR A;  3LAN A;  3LGH A;  1FI4 A;  4JV2 A;  3I4P A;  4MKA A;  1RKJ A;  3EGW B;  1CEZ A;  1KON A;  5M2U A;  1RHM B;  1QAI A;  4NMX A;  5F41 A;  3K5L A;  3MPV A;  2QMX A;  1TVR A;  4DV4 F;  4AXJ A;  2XLJ A;  2YNF B;  3QFW A;  1U1K A;  3VQT A;  3IRW P;  4DPO A;  2HYI B;  3EZ5 A;  3NOC A;  2OFG X;  4K4V A;  4QYZ J;  4I68 A;  4C9D A;  3GP9 A;  3IC1 A;  4O4G A;  4I64 A;  4EYH B;  2F5G A;  2NYI A;  4WP9 A;  3PNI A;  4YP3 A;  4E8U A;  4NLR A;  2LA4 A;  3FQK A;  4CO1 A;  3VQS A;  2HK3 A;  4FKY A;  3DKD A;  3THT A;  1TKD A;  1IXK A;  4TY8 B;  4J9S A;  5HQL A;  2WTF A;  1R6V A;  3J7A 1;  4JI6 F;  4DHV A;  1C1B A;  2DO0 A;  4DR6 F;  2YNI A;  2UXC F;  2W2M P;  1OJ4 A;  4WF9 Q;  2VPY B;  1Y7P A;  4PUO B;  5HMY A;  4OYA A;  3K0J A;  1H7W A;  5EX0 A;  4B3S F;  1CJV A;  1X8D A;  2AGO A;  3DLL Q;  2HHH J;  1TUV A;  1YGY A;  3MPU B;  2V68 A;  2CJX B;  4B9V A;  2V50 A;  4WYW A;  3DFE A;  2ZZN A;  4B9T A;  4YHH F;  4OZL A;  1RLD A;  1RYR A;  2JEJ A;  3HHN B;  2EK1 A;  4URQ U;  1ICE B;  2P6T A;  2HGM A;  3CMA S;  2UUA J;  3NNH A;  1BD6 A;  3H5U A;  4LSZ B;  1YJ7 A;  5LMN J;  5HMW A;  4R5P A;  2BAN A;  3TYT A;  2C2N A;  4K4S A;  2CJB A;  2IHR 1;  3WX8 A;  4LSL B;  3LP1 B;  4F4X A;  1DTT B;  2ROP A;  2YKQ A;  4TYB A;  4ZOS A;  3JQJ A;  2GVD B;  2W7O A;  3HUL A;  4MH8 A;  4LFC F;  3BS9 A;  1KNZ A;  2ROG A;  3GIK A;  1WEX A;  3D1O A;  1Q0N A;  2DRD A;  2PA3 A;  5LXR A;  3CC7 S;  4RO0 A;  3KWM A;  2LKZ A;  2FDN A;  5EHH A;  4L75 A;  5B0A A;  1R31 A;  4LR7 A;  2ZBR A;  1SIZ A;  3L9Z A;  2K7K A;  2JEI A;  1RAI B;  2HMI B;  3RW6 A;  2M5Y A;  4CM2 A;  3BSA A;  4S0M A;  2EC2 A;  2A1B A;  2WHO A;  2ZNY A;  2LEC A;  4P72 A;  5A0Y B;  4ECU A;  1KN6 A;  1TK0 A;  3Q8V A;  3C6T A;  2CZV C;  2AIR B;  1HI0 P;  1TR0 A;  3QGH A;  5D4P A;  1HNX J;  2VDH A;  1XR6 A;  3TR5 A;  1K44 A;  4DU7 A;  3G71 S;  3BO3 A;  1DQ9 A;  3AOB A;  3LAK A;  3CC4 S;  1Q82 T;  4AUK A;  3OXG A;  1LWE B;  4Z7Y A;  4XIU A;  1S7I A;  5D8H B;  1P27 B;  5GAE I;  1Q95 G;  2CFX A;  4RNN A;  4OJ3 A;  2RAQ A;  4CO0 A;  2HW3 A;  1NUE A;  3MMC B;  1RUS A;  3W64 A;  4DSI A;  3KLG B;  2MB0 B;  1VJQ A;  1UW9 A;  5CHC B;  3SQG A;  2XHC A;  5DG8 A;  5HJY A;  2C3U A;  5HAN A;  4OX8 A;  1RCX B;  3GLJ A;  3NOG A;  2UUT A;  2BJD A;  3UN2 A;  4UTG A;  1QDU B;  2BX6 A;  5DQG A;  2FC8 A;  1AW0 A;  3PTW A;  3SCL E;  3KK2 A;  3RR8 A;  4USI A;  2V9K A;  2HGL A;  4J9M A;  5KG6 A;  5EDW A;  2XLI A;  5D15 A;  3KXD A;  3W5Z A;  4E98 A;  1FD2 A;  1RHR B;  3FDS A;  4ZCI A;  2XTJ P;  3RB6 A;  2UUC F;  3OJS A;  4JB8 B;  5IT4 A;  3PW0 A;  5HI7 A;  1VRU B;  2MQ8 A;  3IGV A;  3E51 A;  3SZ2 A;  1E6Y B;  4L3K A;  2A6M A;  4IG0 B;  1K8A T;  2OLW A;  2VB6 A;  1RT3 B;  2BAC A;  2HFO A;  4R0J A;  4JI5 F;  1RAG B;  1XTZ A;  3MCN A;  4RJV A;  3TAM A;  1MSW D;  4IDK A;  4KYZ A;  1RT1 B;  3A8J A;  3N5B A;  1SB6 A;  3GV8 B;  1YTY A;  2GNK A;  4NA2 A;  3DI6 B;  1JLQ B;  1HYS B;  1N0V C;  3R27 A;  1HPZ A;  2QC3 A;  1ZTW A;  3IR5 B;  3R3T A;  1UCN A;  5F8I A;  1WD6 A;  4NPO A;  2XEX A;  1I51 B;  1VQ6 S;  2GVZ A;  4JI4 J;  4KH0 B;  3D0I E;  3QT6 A;  2M4M A;  3K8W A;  3HVT B;  5M2P A;  1U1L A;  4WP8 A;  1M5V C;  2ATL A;  4PRF A;  3MTJ A;  2DGU A;  1MWZ A;  2PMW A;  3O44 A;  5D0H A;  2UZA A;  4KFB A;  1R6Y A;  3NCP A;  1JK9 B;  1HR0 J;  4Y65 A;  1ZA2 B;  2VOD A;  8RUC A;  2RU9 A;  5G0R A;  1MLA A;  4LF7 F;  2Z2Y B;  4KGX B;  2OSR A;  3QO9 B;  1ZPV A;  3DRS A;  2ILY A;  4NRT A;  5CCL A;  4EI2 A;  3QMQ A;  1ULR A;  4RPF A;  4O3O A;  4XTT A;  1X4H A;  2R2U A;  1G3O A;  4QIF A;  1JLE A;  2UVV A;  3OBI A;  1UFW A;  4RW4 B;  2V8V A;  5I4M A;  3GIL A;  3I0S B;  5C42 B;  2BMB A;  2VG6 A;  4RUA A;  1KKH A;  2DGV A;  2GIR A;  1VQL S;  3UW1 A;  5J2N A;  5E7O B;  2FVP A;  2OP5 A;  2B9W A;  3R7S B;  1FKP B;  2XSJ B;  5B0G A;  3PR4 A;  1IBM J;  3VWS A;  2R7Q A;  4DSJ A;  1T03 B;  1RT2 A;  4GC6 A;  3MM5 B;  3CDU A;  2XWY A;  4LRD A;  1IBK J;  1RP5 A;  3EM1 A;  2ALY B;  1DZ5 A;  1RE1 B;  4I67 A;  2KXN B;  3CSK A;  4I2P A;  4FYX B;  3Q24 A;  1HBN B;  4ES3 A;  1N5S A;  4O3Q A;  5KFH A;  4DSL A;  3TEH B;  2U1A A;  3MM7 B;  3DRR A;  4CT8 A;  1SI9 A;  1IVZ A;  4NLU A;  4DV3 F;  5DZ7 A;  2KDO A;  5IWA J;  2WON B;  4IFV A;  1Q79 A;  3ZNJ 1;  3SQO P;  4CT9 A;  2R42 A;  1KQK A;  1K0V A;  3T1A A;  3K89 A;  3J7Y I;  3BBC A;  5LSO A;  1VBZ A;  4YS2 A;  2LFV A;  2Z2M A;  1F0X A;  1PG5 B;  1N36 J;  4ZMM A;  2E1A A;  1FDB A;  3ZZ0 A;  1HNZ J;  4IUF A;  4F3O A;  3TOQ A;  1T9T A;  4TYA A;  3M05 A;  1LXN A;  2AU0 A;  1PYS B;  1RTI A;  3M6X A;  2I9S A;  4KO0 A;  3WZ0 A;  2YPY A;  3ETO A;  1NDL A;  3WC0 A;  1HMV A;  5J2M A;  4DV7 F;  4ECT A;  2RH3 A;  4Q8E A;  2CNL B;  2OML A;  2DGW A;  4IG3 A;  4ZPC A;  1FXR A;  2MQL A;  2HBQ B;  3QAE A;  1Q16 B;  4O3N A;  4HTJ A;  4NI2 A;  1FNO A;  2GZO A;  2NXE A;  4KPY A;  4ZVS B;  4K4T A;  1HLW A;  4M5D B;  4ZP7 A;  2N4C A;  2VV5 A;  1VIO A;  7AT1 B;  2ATC B;  1IBL J;  3GTY X;  2CVE A;  2BYC A;  3V2U C;  5K20 B;  2WW4 A;  3QJJ A;  4WJB A;  2W2N P;  3FBF A;  5E41 A;  4MKB A;  1O5J A;  3ENW A;  5A6P A;  2LEA A;  3HD1 A;  1JJ4 A;  1HWL A;  2Y3Y A;  1UP1 A;  3T5L A;  2RRA A;  4F0M A;  5E3P A;  4RU2 A;  3TEG A;  1S1T A;  2X7I A;  3CUL A;  2Z57 B;  3HFV A;  3G4S S;  2Q43 A;  3UDC A;  4ZLL A;  3L95 X;  4OYP A;  1VQ9 S;  4B3M F;  1B99 A;  3D7S B;  4ICL A;  2QTW A;  3OJU A;  2VFU A;  1TAU A;  4DL6 A;  4K0K J;  3D6T B;  3OTC A;  4KGM A;  1R43 A;  1GXU A;  2FVQ A;  4JUZ A;  5L1I A;  3IO1 A;  3HHL C;  2J9C A;  1AUD A;  4R8U A;  2F4V F;  1WC5 A;  4KE5 A;  4OJH A;  3T1Y F;  2ZD1 B;  4GVB A;  5H9F K;  4USV A;  1IKX A;  1QE1 B;  3HFZ B;  4DX7 A;  2AKW B;  2SXL A;  3WC2 A;  2RS8 A;  5KOX A;  2VBY A;  3I6P A;  4X4U A;  1XNQ J;  3IN5 A;  2LMI A;  2QMU B;  2MPU A;  3DDI A;  5AE2 A;  3H5S A;  1HIY A;  2MZR A;  2RIJ A;  2WVD A;  2ZBQ A;  4LRF A;  2DIT A;  3BGR B;  3CW2 C;  2UXB F;  4Q44 A;  1FXD A;  1FRM A;  2GMH A;  2E44 A;  3KOA A;  5IV3 A;  1S4F A;  3DGV A;  1PYO B;  2YWK A;  1ELO A;  4X66 F;  2HUR A;  3OHA A;  5CQG A;  2DY1 A;  1MG7 A;  4B3O B;  2LQ9 A;  2ZBI A;  1DUR A;  1KBR A;  4NML A;  5C2C A;  3G8S A;  1S1W A;  2R7U A;  1H2V Z;  1IM6 A;  4ID5 A;  4DCO B;  3C15 A;  2NSB A;  3EDQ B;  5F3T A;  3TJ8 A;  4TU7 A;  4A8Q A;  3KDO A;  5D3G B;  2HK2 A;  4ZS6 A;  1NU4 A;  3SFU A;  4LF9 J;  3TAP A;  3NS7 B;  2X3D A;  4K2X A;  5FLX U;  2P9C A;  4QBU A;  1OSC A;  4EO6 A;  2DR7 A;  2HRT A;  4WWS A;  1VK8 A;  1FKO B;  3AB4 B;  3CNQ P;  1YBU A;  3DNC A;  1MRO B;  4AYB D;  3GE9 A;  3JSY A;  3GV7 B;  2VJV A;  1C1C B;  2UUA F;  1NND A;  2RQC A;  3MMA B;  2CQD A;  3G2X A;  1H3D A;  2UVW A;  3QZ8 A;  1LFW A;  3AHP A;  4DMZ A;  2W01 A;  4UUW A;  3FVY A;  2YNG A;  5ETO A;  4WPA A;  1S59 A;  1RAB B;  4KGZ B;  1LQ9 A;  3NS5 A;  2RF2 B;  2B7C B;  1DTQ A;  1QLN A;  1LW0 A;  1JLC B;  6FDR A;  1R7I A;  5AXK A;  4Y34 A;  1QSY A;  4DCJ B;  1M1K T;  4CLY A;  1N34 J;  4MIW A;  3RGI A;  1D3W A;  4TQR A;  3QT7 A;  1P1L A;  2KYX A;  1AT1 B;  2ZH9 A;  3EDR B;  5KFL A;  2QGF B;  2OJ3 A;  4CNZ A;  4ZLN A;  4RW9 B;  1VHI A;  3EUN A;  3UPF A;  1VDH A;  4PEO A;  1T0T V;  3T5J A;  5GMK a;  2UXD F;  1YKW A;  1T95 A;  4G65 A;  4NLD A;  2KHC A;  3WIU A;  4M5L A;  3I0R A;  1R0B G;  5DS7 A;  2HAI A;  3VGT A;  3PO5 A;  3N5F A;  1A7G E;  4A8K A;  2RRB A;  3HHE A;  1JX4 A;  1FD8 A;  4DR4 F;  3M32 B;  4CYU B;  4HDG A;  4F67 A;  3UFC X;  2YWF A;  3DOL B;  2JFK A;  2IRX A;  2M70 A;  2PII A;  4LBI A;  3CJT A;  1HW8 A;  2VG5 A;  2W24 A;  3HSJ A;  4ES2 A;  1UEU A;  2DVI A;  4GO5 X;  2VC0 A;  4GO7 X;  4NXN F;  3ITH B;  2J7U A;  1RWO B;  1EB0 A;  4HT5 A;  1RLC L;  3TWZ A;  4PWD B;  2F4F A;  3B4M A;  3GR0 A;  1ARO P;  5J2P B;  4B17 A;  5EN1 A;  2VUG A;  3FEX B;  4LFB J;  4B3R J;  5GAE U;  3LPY A;  4F0K A;  4W90 B;  1ZAX A;  1VBK A;  3H42 A;  3HT3 A;  1HBM A;  4ZCM A;  2FY1 A;  1ZTT A;  4MAK A;  4NLS A;  2G4B A;  2CNK B;  4ZIV A;  3OFE A;  2HZC A;  1TKZ A;  3ZZO A;  3LP0 A;  1KTV A;  4TY9 A;  3RU0 A;  2FLP A;  1L3T A;  3HHK A;  2RKI B;  2ABY A;  5GVQ A;  1HNW J;  1LK7 A;  1NK9 A;  4KKO B;  3ELH A;  1TFW A;  2QFI A;  3KLF A;  4M8L A;  4EZ9 A;  2KFN A;  3HHL B;  1N33 F;  3BRE A;  4DL7 A;  1WTF A;  1F1B B;  3LP2 B;  3OXL A;  2RVJ A;  2JNJ A;  2FTR A;  2J9D A;  4I4B A;  4W92 B;  3POT A;  3J80 Y;  4PAA A;  4YDD B;  1YJV A;  5I3U A;  2HFU A;  4WFY A;  4YR0 A;  5A8W B;  1PGZ A;  2A10 A;  3QIP B;  4C11 B;  1SH0 A;  2HSE B;  1IUJ A;  2B4O A;  2ZNZ A;  1RWP B;  1FEH A;  2BQ3 A;  5KT6 A;  2RNE A;  1WC4 A;  2Y1J A;  1VLO A;  1DLO A;  1NSK L;  5EGY A;  1BWV A;  1XIQ A;  4QIV A;  2YTC A;  2FC9 A;  2VQE J;  4D3G A;  2HFS A;  3HFK A;  4C97 A;  2FPH X;  2D3Z A;  3P5B P;  4K59 A;  2CAJ A;  4ER8 A;  1HNV B;  2EC0 A;  3H90 A;  3OTD A;  4X4P A;  3CJ4 A;  4A47 A;  2Z58 B;  2IBK A;  3PYG A;  3NGD A;  4FP9 A;  1SJ4 P;  2Y1R I;  1ZM3 A;  1CS4 A;  2G9O A;  3N79 A;  4DUY F;  1V5V A;  2HWT A;  3HVA A;  2QO3 A;  1VIX A;  2GHW A;  1K47 A;  5DM7 Q;  4Q7A A;  2CJQ A;  2DR8 A;  1B7F A;  1VQN S;  1D8Z A;  3PVX A;  4HHU A;  1ROF A;  2ZVI A;  1GNK A;  3ADA C;  2HBR B;  1W26 A;  5IWA F;  5C7P A;  3KHR A;  2DRA A;  5THW A;  2DR6 A;  5KFN A;  1T3O A;  4KR0 B;  3NG8 A;  1Z1Z A;  2KT2 A;  4DV0 F;  2B3T B;  4JI1 F;  4PQU A;  3UNG C;  2E5H A;  1UWB B;  2A3J A;  1N36 F;  4ELU A;  2FGO A;  2RHS B;  4L6V 3;  3S6E A;  3EZU A;  1JLG B;  2I2Y A;  4DR1 F;  4NZ0 A;  1REV A;  1H6K X;  2GHV C;  3CCQ S;  1UMJ A;  1CSJ A;  2XY7 A;  2HQF A;  2DGQ A;  4JV5 J;  4X4N A;  1NB2 A;  3IWX A;  4C3K A;  1FJE B;  1S79 A;  4CLK A;  2FIU A;  3R1H A;  1XBW A;  3NKY A;  1N6Q B;  1PJ6 A;  3M6U A;  1J5O A;  1NZA A;  4OYB A;  3U27 A;  1UKU A;  2MQP A;  2MQQ A;  4U96 A;  5SUH A;  2HBZ B;  2H5E A;  2BUN A;  3P45 B;  2C28 A;  2Q3P A;  2IM1 A;  1NRK A;  5BR8 J;  3J7Y U;  3EPG A;  3H4B A;  1E6V A;  2VU5 A;  2ZUG A;  2XQC A;  1J5E F;  2IJN A;  3LGM A;  1VRQ C;  3KLH A;  1HBO B;  3OVB A;  4JOU A;  3FCH A;  2BRL A;  2Z56 B;  4RW7 B;  2HHU A;  2LXU A;  2XWX A;  4OL8 A;  5D4O A;  2YH1 A;  3IR7 B;  2R2T A;  3R9L A;  4KAI A;  2HHQ A;  2VFT A;  5E5N A;  5A8K B;  4I69 A;  2BA9 A;  3IS9 A;  2BDP A;  3IM9 A;  3CCR S;  3TQ1 A;  3G82 A;  3A3N B;  1F9F A;  1FVQ A;  4ECQ A;  4M94 A;  5J1E A;  4QU6 A;  2HVH A;  1T11 A;  1FE0 A;  3ZC4 A;  3MPY A;  3I82 A;  1QTM A;  2VHG A;  4X84 A;  1QAJ A;  1KRP A;  1G2E A;  3ULH A;  4ZJO A;  2OH2 A;  3HMJ G;  4I7F A;  2DPJ A;  2ZH7 A;  5KFF A;  3M8W A;  4RWX A;  3O1L A;  1Y10 A;  4B08 A;  1Y11 A;  3W3S A;  2J9D E;  3M2U A;  3RW7 A;  4U7U K;  2AJ2 A;  3KJV A;  5CCM A;  2QYC A;  2J5A A;  1KP6 A;  1WHY A;  1A0O B;  2W9C B;  3EPI A;  4QYR A;  3EZO A;  1VK3 A;  1NDC A;  5KOW A;  4AD6 A;  3NY0 A;  2UP1 A;  4KSE B;  4RNO A;  2AGP A;  1H0H B;  4IFY A;  2BOP A;  2VAS A;  2AWZ A;  3N6N A;  3EYZ A;  2HHP A;  1LK5 A;  3V81 B;  3V4I B;  4Y6I A;  2G2Y A;  1FFW B;  2RD5 C;  2Y0S D;  3M2V B;  1GMU A;  1CUL A;  1VIS A;  2KH9 A;  2EWH A;  4C8N A;  3N4W A;  3VTI A;  5F8J A;  3KLI A;  2YXL A;  3G6V A;  1OS5 A;  3KUH A;  4RBV A;  3KHL A;  2FHK A;  3T1H J;  4DQI A;  4P2X A;  4IR9 A;  2ADB A;  4Z7C A;  1WOP A;  3NXZ A;  2AHO B;  2ROE A;  4JI0 J;  3Q89 A;  3FFI A;  3GG0 A;  1IKV A;  4FBU A;  4OYO A;  3KK1 A;  4EK2 A;  2OGU A;  3RAQ A;  3DN9 A;  4J9L A;  1B0T A;  3LUY A;  3SV4 A;  1Z4U A;  3V4M A;  2CQ0 A;  1QM9 A;  4EYI B;  3UNY A;  5ETN A;  1YHQ S;  2EG1 A;  3OFG A;  4LJM A;  3JYT A;  5AXM A;  3N6M A;  1U8W A;  4DL0 C;  1TVR B;  3MEC A;  1O51 A;  2EFV A;  2J0W A;  4PR6 A;  3FSX A;  3FK4 A;  3VZH A;  4O4G B;  2J0Q D;  1NDP A;  2LLZ A;  1NKB A;  1RWV B;  2LDY A;  4DR7 J;  2BV3 A;  2JEG A;  1U1Q A;  1EZZ B;  3ZZY A;  3MD1 A;  3NGR A;  1WKK A;  3H59 A;  2FLL A;  1S1V A;  3A8I A;  4UZB A;  1URN A;  2RDI A;  2M0G B;  5KG2 A;  3R5A A;  4NAS A;  2FJB B;  1SH2 A;  1C1B B;  1NKC A;  2NZ4 A;  1D0E A;  1GK8 A;  2BJ9 A;  1F3V A;  1TMM A;  1S10 A;  5CYQ A;  4U8V A;  1MWQ A;  4ZPA A;  1CJV B;  1NXI A;  1U6B A;  3QYY A;  3TJA A;  2FGC A;  2FLN A;  3H8Y A;  1S4E A;  2Q1L A;  1SKW A;  1GMW A;  3BM7 A;  3FSY A;  5HVH A;  1WKL A;  4OI2 A;  2DH7 A;  2CWK A;  1FEE A;  5GME A;  2YQ0 A;  1LWX A;  1FF2 A;  4OHW A;  1RWN B;  3VZI A;  1V5I B;  2E1M C;  2BAN B;  7FDR A;  5D78 A;  4OYZ A;  4ZN1 A;  3UDE A;  3Q0A A;  3Q86 A;  4J9O A;  4DU8 A;  3TUZ C;  4ZVE A;  3CIZ A;  3OW2 R;  4LRA A;  4OI6 A;  2RIL A;  3PRV A;  4C98 A;  2C2K B;  2QL9 B;  2RML A;  3OTO J;  4F4K A;  3CE8 A;  3PCO B;  3R97 A;  4DX6 A;  4LFA J;  2C2R A;  3R5B A;  2GJF A;  3KLV A;  4Q5V A;  1XWL A;  2KRR A;  1FFG B;  4Y3C A;  4X64 F;  2GIF A;  3OLA A;  3CC2 S;  1X4B A;  4GKK J;  1RT7 A;  2HS4 A;  5KFG A;  1GAO A;  3AXK A;  3GU0 A;  2H9Z A;  3C6T B;  1KQS R;  4LSN A;  4EUV A;  4ECW A;  3BO4 A;  3OL9 A;  2AJF E;  3NEK A;  3A13 A;  5ETL A;  4LVO P;  2XYP B;  2C42 A;  5A2Q Y;  4B3R F;  3TAN A;  1VS3 A;  3PRB A;  2ZKU A;  2ASY A;  4M5H A;  1SKU B;  2MMY A;  4C3L A;  4GKJ J;  4JV0 A;  1QVG R;  4P2M A;  3ZZR A;  4F4A A;  3KDN A;  3DHW C;  2HIQ A;  3MGJ A;  2CWX A;  2VKZ G;  3D28 A;  4LRB A;  2DNY A;  3F44 A;  5ADZ A;  4MIA A;  2OEK A;  3SQG B;  4K2J A;  4JI2 J;  3HKZ D;  2OEJ A;  3K5N A;  1HD0 A;  4PG7 A;  3DCA A;  1O0P A;  4CLW A;  3TW0 A;  2Y1L B;  5AJ3 J;  2EFG A;  4KGK A;  2I1R A;  4EBC A;  1S7H A;  4WK1 A;  4H4O A;  3KK2 B;  1BUX A;  4ENO A;  4ILR A;  1ZAV A;  2RQK A;  4LIR A;  1UJ4 A;  2KG0 A;  1F2H A;  2KU7 A;  4H4K A;  2P2C B;  3W9J A;  2Z2L A;  4DZD A;  2PC6 A;  2E7X A;  4YB1 P;  1TUG B;  1Q5Y A;  2Z0G A;  2QSF A;  1BHN A;  1WEZ A;  3NCR A;  1QSS A;  2QG9 B;  1ZM4 A;  4NXM J;  2DO4 A;  4TU8 A;  4AL7 A;  1S48 A;  2P6S A;  2Z30 B;  3GCX P;  1R3N A;  3I5C A;  1T05 A;  2HS0 A;  3BSN A;  4ANE A;  3LPE A;  5K8P A;  2VQE F;  3H4D A;  4QYZ K;  4CIO A;  3TAM B;  2W2O P;  5AT1 B;  4Q8F A;  4YN3 B;  4ZJQ A;  4IDK B;  4J9Q A;  5L9N A;  1HQE A;  5CD4 A;  1KFS A;  3MCM A;  3DLE A;  1JJ2 R;  3FMB A;  1KOO A;  1CC7 A;  5IT9 Y;  1HPZ B;  1SL1 A;  2R8I A;  3MMJ A;  3PEH A;  4ZLP A;  3RB0 A;  4DDF A;  1U2C A;  2GVZ B;  1XR5 A;  2WW8 A;  3BQ1 A;  1DQA A;  1S9G A;  2OI2 A;  2IM2 A;  1BXN A;  4FF2 A;  4FS2 A;  5T14 A;  1RWX B;  3RG6 A;  1VLY A;  4O44 A;  4LVN P;  2FHM A;  4Y2A A;  3L7O A;  4X4R A;  5G0R B;  2MHN A;  3M1V A;  3MAH A;  4DOZ A;  2VFV A;  2L9D A;  3DRS B;  3V6D A;  3T5H A;  2JOQ A;  3GYX B;  1ITP A;  4DR5 F;  4Q2M A;  3ZZT A;  2MKH A;  3UVJ A;  4G1P A;  1FJG F;  4JI3 J;  3NLC A;  1JLE B;  3Q8Y A;  3I96 A;  3G8T A;  1YJU A;  3FBC A;  5U47 A;  3CD0 A;  4UZC A;  3UCU P;  3D9B A;  2VOP A;  2B9E A;  3FC9 A;  3MUT P;  2VG6 B;  2DH8 A;  2KB2 A;  5SZT A;  4CLT A;  1XMB A;  2UUB F;  1XMO J;  4DV2 F;  3LWM A;  5J2N B;  1TP7 A;  4ED6 A;  1MN7 A;  2XCA A;  1FXL A;  3SMZ A;  2V8G A;  2MTL A;  4ECR A;  1RA7 A;  1TL5 A;  2BKP A;  5HO4 A;  2R8J A;  3IXQ A;  1RT2 B;  4QWA A;  3VHQ A;  4EFA C;  2MZS A;  4I2P B;  2BJ1 A;  3BQ0 A;  3K17 A;  1RSC A;  1F6T A;  3DRR B;  3QZ7 A;  2CA9 A;  1S0M A;  1I3O B;  1T94 A;  2NPF A;  3O5T B;  5MAO A;  1CQM A;  2D1C A;  3VF0 B;  5L8R C;  3QPI A;  4M5I A;  4PXE A;  4FDF A;  1VGY A;  2CQH A;  1NEE A;  3TX8 A;  1N5V A;  3IBW A;  4ZPV R;  3WBZ A;  1YSJ A;  4A8O A;  5HP1 A;  2JJ4 D;  1JJH A;  4Y00 A;  3RUB L;  1WC3 A;  3FJ2 A;  2W7A A;  4N5S A;  2DT9 A;  2VG7 A;  1KHW A;  3HX9 A;  2VA2 A;  5HVG A;  5KFK A;  2UU9 F;  2LXF A;  1RTI B;  4F0H A;  5D0E A;  4KO0 B;  5KG4 A;  3S7R A;  1LW2 A;  2OIH A;  1YLX A;  1HMV B;  4RBT A;  5J2M B;  5KFE A;  4J7C A;  3ILL A;  2DH9 A;  5KFW A;  4I0W A;  1KLN A;  4IG3 B;  2FVS A;  4FPR A;  2ZM6 F;  5KFO A;  3MM6 A;  4ANC A;  1YIT S;  5IC6 B;  3EJM A;  4P9S A;  1L5U A;  3KMS A;  5K5M A;  1JWW A;  3HCX A;  4ZPB A;  1UPP A;  2COL A;  1JXE A;  3PY8 A;  1QAY A;  2NLW A;  3K58 A;  2HIY A;  2L9N A;  2FJX A;  1TK8 A;  2J8S A;  1V3S A;  4KGV B;  2IY5 B;  1IQT A;  3JTN A;  5I42 A;  4HL9 A;  4O4R A;  1YDL A;  3MUM P;  1R8P A;  2IDL A;  4L73 A;  4NLT A;  4P73 A;  2KM8 C;  5C24 A;  2AEJ A;  3BO2 A;  3EWG A;  1S1T B;  2D7S A;  3DDK A;  2B8P A;  2DHG A;  4M5M A;  2KFZ A;  5H9E J;  3FRZ A;  2FJE B;  5E0O A;  2AZ1 A;  3PEJ A;  1UVM A;  1N5Y A;  4F36 A;  4ICL B;  2CPX A;  3AOC A;  1ACM B;  2D41 A;  1ZPW X;  4AQY J;  3DYA A;  3NGK A;  1M90 T;  4R8U B;  1FTC A;  5KT3 A;  3BBF A;  2MQO A;  4GVB B;  2XY5 A;  3UD4 P;  1NM2 A;  2UVU A;  1P9Q C;  4HKQ A;  3MZI A;  1FHT A;  1WG4 A;  1IKX B;  4IH7 A;  3OR1 A;  2UVR A;  1N0U A;  3EE3 A;  2H54 B;  2H48 B;  4PXB A;  4OZ0 A;  4LF6 F;  3W2W A;  3G8Q A;  2BE7 D;  2BJ3 A;  4Q0B A;  5KG5 A;  2XMV A;  2WVB A;  3KNA A;  5DG7 A;  3HM9 A;  3K57 A;  1U45 A;  3PJ9 A;  3IAS 9;  4HDH A;  3AJD A;  3J80 U;  5ETP A;  2DIS A;  1Y3J A;  5C25 A;  1NPK A;  3BR9 A;  2KVQ E;  4DFK A;  3TP2 A;  5IQ6 A;  3CDW A;  4NX9 A;  1LWC A;  1X9M A;  2DNN A;  4G3I A;  2ZH1 A;  1I94 F;  4ZP9 A;  1HA1 A;  4MYU A;  3K59 A;  4O0N A;  1FX2 A;  1HFE L;  3Q2T C;  4HHH A;  1S1W B;  4ECX A;  2KL8 A;  2LQ5 A;  4ID5 B;  1DY3 A;  3C15 B;  3ZXW A;  1U47 A;  2QA1 A;  4XDD A;  4QZV B;  2AZ3 A;  4DV5 J;  2G1H A;  1TL3 A;  1NLK L;  4OZ1 A;  2DHA A;  1TKT A;  2XG8 A;  1WSR A;  2ZIT A;  2N4D A;  1KD1 T;  3P96 A;  1U0S A;  4IOC Q;  2ZOG A;  3GSD A;  4LQ3 A;  3PHT A;  1SKS A;  2AMC B;  2VFR A;  5GMD A;  2E1C A;  3OUY A;  1ZA1 B;  3ETM A;  4LF1 A;  3M8R A;  1X4D A;  4UQG A;  5FLX Y;  1M5O C;  3MAQ A;  2BQU A;  3FKB A;  1K0T A;  2NXC A;  3LP1 A;  2X1A A;  2IRY A;  2Y8W A;  1KVI A;  2HNY A;  4X4Q A;  3CO0 P;  4LF5 J;  2VDI A;  2DNL A;  4F4Z A;  2MKJ A;  4KIA A;  1B64 A;  2H51 B;  2YNG B;  2XI3 A;  2MQN A;  3MPW A;  2AJ0 A;  1LW0 B;  2VPW B;  3K2Y A;  1CVJ A;  5KFQ A;  2MKI A;  3CUN A;  3X3U A;  2DIU A;  1H2U X;  1MML A;  3DGP A;  4RX6 A;  5T7L A;  3ENQ A;  3J81 U;  1FNM A;  3PG9 A;  5A0Y A;  1S9F A;  2Z8Q A;  3OHB A;  1GEH A;  4QW9 A;  2QT7 A;  4TLQ A;  5CYJ A;  3GIJ A;  4OZ5 A;  1DAX A;  3IAM 9;  2R8H A;  3JSR A;  4J37 A;  3DLG A;  2GAG C;  1RBO B;  3CJ5 A;  1VI7 A;  4DBQ A;  2AJ1 A;  3IMQ J;  4FN5 A;  2XGQ A;  1N4L A;  3W1Y C;  4IRK A;  1S12 A;  1X5P A;  2YY3 A;  2CPJ A;  3MR3 A;  1VQ8 S;  1SL0 A;  4EGL A;  2DCU B;  4E2F B;  3LGN A;  3I0R B;  4KT0 C;  2NXJ A;  4ZIT A;  2R2R A;  3OD2 A;  5CH7 B;  1RYS A;  3KLG A;  2FZK B;  3O6Q A;  2C2Z B;  4Y2I A;  3UE2 A;  4U9R A;  2AYE A;  3GIM A;  1WG5 A;  2E5G A;  5IQQ A;  2DBB A;  1FWP A;  2WSC C;  4RNM A;  2W8K A;  2L41 A;  2MLX A;  4JYA J;  4UQT A;  1G6B A;  5KFX A;  3CCZ A;  3KTQ A;  2CPY A;  4KV8 A;  1EKS A;  5JMN A;  4LMZ A;  2VG5 B;  4DEZ A;  5AJ3 F;  1CJT A;  4NCG A;  3W8P A;  3RB3 A;  2EVZ A;  2NRE A;  1GTE A;  2JL9 A;  1JLF A;  4NYZ A;  4NZ7 A;  1RHQ B;  2DNG A;  4DF8 A;  1RAF B;  2D74 B;  4CWB A;  2J7W A;  4HLB A;  4TVA B;  2MSS A;  4NLX A;  1FRL A;  1J2V A;  2YWH A;  2MZ1 A;  4NA3 A;  1M5P C;  1FNX H;  3ISN D;  4ZVU B;  3ISN C;  3D67 A;  2CQI A;  2QA4 S;  5HLF A;  4YEA A;  2PI5 A;  4OV6 A;  1HBM B;  1HL6 A;  2H65 B;  4P71 A;  3FZB A;  2L9W A;  4FVM A;  1Y3K A;  5D77 A;  5B0C A;  1FRX A;  2FJD B;  5KAK A;  3PFO A;  3Q2S C;  1NHV A;  1TKZ B;  5CA5 A;  1R8B A;  2GQC A;  3LP0 B;  5T41 A;  3KG4 A;  2MZJ A;  1S1X A;  2MEW A;  4NYP A;  2E66 A;  2QEX S;  4NCB A;  1S6Q A;  2VON A;  4J9K A;  5KFM A;  1RT4 B;  1UFK A;  2ZOM A;  1S6P A;  1NJW A;  1EX8 A;  5D4N A;  3KLF B;  4P2S A;  2QLW A;  1NJY A;  1JQG A;  2EFO A;  1T9V A;  4IRC A;  2JLG A;  3HPO A;  3CDA A;  2Z2Z A;  4C3M A;  2B0G A;  2E1P A;  1VQS A;  1R0A B;  1UJ5 A;  2QLX A;  4LF2 A;  3M6V A;  2QA2 A;  4DJB A;  2AQ4 A;  4ED3 A;  3POT B;  2XYG B;  5L1J A;  1KVK A;  2L3M A;  2XNR A;  4W4M A;  5I3U B;  3NGT A;  2L48 A;  5B0D A;  3C2P A;  2IC3 A;  1X0F A;  5KFD A;  2NUH A;  2K7J A;  1X7V A;  2LEB A;  3VR1 A;  5ITH A;  4DSF A;  2V69 A;  1SQG A;  1DLO B;  1JXV A;  3QWU A;  4HTI A;  5D0R A;  4LBP A;  2XS7 A;  1S99 A;  2VBX A;  5LT5 A;  3PYD A;  2EI5 A;  3H20 A;  3E3X A;  1IWA A;  1S97 A;  2EBG A;  3V6H A;  3CCW A;  4RUH A;  1N32 F;  2IVY A;  2G13 A;  3TNV A;  2OMO A;  3BPS P;  3C3L A;  4ZVR B;  3W2V A;  2XSJ A;  1ZS6 A;  1IKY A;  4LF4 J;  2E5L J;  2VL1 A;  3MM5 A;  1XMO F;  3MM8 A;  4OX9 J;  4K50 A;  3QLH A;  1CS4 B;  4OX7 A;  4RBU A;  3PJW A;  2EFN A;  5LJ3 Y;  4KHP F;  5ETK A;  3QAU A;  3PXG a;  2CNO B;  1GMW D;  4DWI A;  2QA4 G;  5JVH Q;  2WON A;  2GFF A;  4ED4 A;  3PX0 A;  1WC0 A;  3NAH A;  2H3E B;  5JJB A;  4IR1 A;  3SBM A;  5LOQ A;  3JSB A;  2IFX A;  1NK8 A;  3I9V 9;  2CPE A;  1BQN A;  2VD3 A;  4PPZ A;  3KMQ A;  2ZBC A;  4KBI A;  1XEZ A;  5LM7 E;  3W60 A;  4N8N A;  2V0N A;  2G0J A;  4WCE Q;  4PQU B;  4O3R A;  1CBK A;  3SCK E;  3CPW R;  2G2O A;  3VAG A;  4UUX A;  1K73 T;  1U26 A;  2EK6 A;  5EWE A;  3CXC R;  8ATC B;  2AJ4 A;  4BCA A;  5KT4 A;  1REV B;  2V2Q A;  3ENA A;  1PAE X;  4YUD A;  2OSQ A;  4MK8 A;  3MR7 A;  3EVW A;  1SUQ A;  3DXS X;  3DU5 A;  4XPC A;  2CYY A;  1YX2 A;  2I38 A;  5KFC A;  3D3C J;  4NLP A;  4DL3 A;  3UN3 A;  4RNF A;  5LMU J;  1PJ7 A;  3HXM A;  3GON A;  2OEL A;  3ONQ A;  1J5O B;  2EPI A;  4K5S A;  5L1L A;  4MYT A;  4ZDN A;  4I2Q A;  2DHX A;  1Y9O A;  3F0N A;  4B3T F;  4A8F A;  1AUS L;  3RAM A;  4I6Y A;  1NPP A;  2A0F B;  2V4Q A;  3CO9 A;  5BYR A;  2MLY A;  3VVU A;  2ZH5 A;  1E6V B;  8AT1 B;  4XDC A;  4EU0 A;  2CPI A;  4QU7 A;  1IBC B;  1VC6 A;  1SC4 B;  2KO1 A;  3GZ7 A;  3KLH B;  3E8O A;  3BF4 A;  3ET6 A;  3I31 A;  2B5J A;  5FJ4 A;  1M5H A;  2WRM A;  2ZBP A;  3HDS A;  1XMQ J;  1FKA F;  4DS5 A;  1IN0 A;  2YKP A;  2E9T A;  2KJV A;  1PIE A;  3FQL A;  5A2Q U;  3B78 A;  2C1E B;  4TN2 A;  5AXL A;  4YB5 A;  4DLE A;  3IS9 B;  4PYA A;  1UEK A;  3G82 B;  3ILO A;  3DLH A;  1OSD A;  5J1E B;  1RTJ A;  2V8D A;  3K5M A;  2XZT B;  2OAU A;  3TO8 A;  2C2O B;  2YNH B;  1B7Y B;  3LH2 S;  2DNZ A;  2JZ5 A;  1GMV A;  1RTH A;  1RWK B;  4I7F B;  4V19 J;  3PHE A;  2FJV A;  1DQ8 A;  4OHX A;  1EKR A;  2QSW A;  4ZJL A;  1FRI A;  3OVA A;  4I6A A;  3M2U B;  1RDR A;  1KDN A;  4QW8 A;  3KJV B;  2OFH X;  4H4K C;  1MWY A;  1K9M T;  2PFF B;  1YK9 A;  5LJ5 Y;  2XYH B;  1YG0 A;  1N56 A;  3NGU A;  2B9X A;  1MMD A;  2DY9 A;  4IFY B;  1KEK A;  3U1M A;  1DAR A;  3UR0 A;  3MEK A;  2N7C A;  1CUL B;  3JS9 A;  4B9L A;  4MMO A;  2PGC A;  3DLK A;  4GMK A;  3IM8 A;  1GFW B;  4DUZ J;  5D0G A;  2I5J A;  3RB4 A;  2MJN A;  3DOM A;  4DV1 J;  3KLI B;  1D8Y A;  4PG8 A;  2R7X A;  4I6W A;  4IOB A;  1S0O A;  3L09 A;  3TA1 A;  5EWF A;  2VQF F;  3UR3 C;  4HT7 A;  2FJW A;  2W8L A;  3FFI B;  5IZH A;  4J9P A;  1IKV B;  3KK1 B;  1JLB A;  2HQ3 A;  3CB4 A;  3U02 A;  4DV4 J;  5IT9 U;  1MRO A;  5L46 A;  4F2S A;  4A8S A;  4LBH A;  2XMJ A;  3GFH A;  4AFF A;  2ZFH A;  1R8H A;  2B4V A;  3JYT B;  2E9Z A;  2K1R A;  4DV6 J;  2O01 C;  3MEC B;  4C2M A;  5B08 A;  2VH7 A;  2RJZ A;  3HJF A;  1WDT A;  2GO8 A;  4LF8 J;  2QL7 B;  2NR0 A;  1X5T A;  2PDA A;  1VRT A;  1IWG A;  2IA0 A;  2XS5 A;  1RT6 A;  3GFZ A;  3A3O B;  4WFA Q;  4MK9 A;  2A2C A;  1ZZF A;  5IT0 A;  4CLP A;  3HSD A;  4NRU A;  1IR0 A;  4Q2L A;  4JI6 J;  2RUG A;  3CJ0 A;  2PMZ D;  4TU9 A;  9RUB A;  2UXC J;  5LL6 d;  1S1V B;  2DGS A;  2MJU A;  1F2G A;  2YQ1 A;  3FNN A;  1LEO A;  3B82 A;  1V3Z A;  1C0T A;  4RUC A;  2Q6C A;  4AL6 A;  3BYR A;  5CYQ B;  9ATC B;  4YHH J;  5C2G A;  2JVR A;  1QTN B;  3PZP A;  4F3M A;  2XMA A;  4P7T A;  5KFU A;  1IKW A;  3TZY A;  3M9N B;  2ZE2 A;  5KFI A;  2FHJ A;  4QPX A;  2DNP A;  3OLB A;  2EFQ A;  1F9H A;  3A8K A;  2ZHB A;  1RI7 A;  2I6W A;  2C3P A;  3OFH A;  3DLB A;  2OUG A;  1YRT A;  3QFH A;  3M7V A;  4DQR A;  5L9X A;  2BJ7 A;  1NHK L;  3SSS A;  1Y5N B;  2KZM A;  5DQI A;  4EBE A;  4BWM A;  3MR5 A;  2MY7 A;  3AD7 C;  1OWX A;  1TV6 A;  2J6S A;  2CPD A;  5ETV A;  1PBA A;  1RIS A;  2OPR A;  4DCP B;  2ZH4 A;  4X4S A;  1A6L A;  3JQM A;  5M2R A;  2OPS A;  3H5Y A;  3FSI A;  1QVF R;  5EWG A;  1UEV A;  2HZV A;  1VBX A;  4BC9 A;  1FDD A;  4WU2 A;  4JYA F;  1QJH A;  5CZV A;  3RBE A;  3H98 A;  3KUG A;  5AE3 A;  3LO3 A;  1VQP S;  3SYZ A;  2CZ4 A;  3F73 A;  5G4D A;  4RWW A;  1F5A A;  4C8Z A;  2MKS A;  2IA6 A;  4IH5 A;  2HWI A;  1CJK A;  4IKA A;  2GA7 A;  1SH3 A;  4CTA A;  4OX6 A;  1RT7 B;  4CO4 A;  4V1A k;  2O1P A;  2WB4 A;  2HHT A;  2JC0 A;  4LSN B;  1X4G A;  3SIP B;  1LOU A;  4X65 F;  4DR2 F;  4D3H A;  1SC1 B;  3PR5 B;  5DGB A;  4F7V A;  3O8W A;  4J9R A;  4QWE A;  1LXJ A;  4EWT A;  4WII A;  4HVZ A;  5DDR C;  4OJ1 A;  3PFE A;  3UO0 A;  3IBF B;  1P6T A;  2RKI A;  3BGL A;  3CGI A;  4GVL A;  3PV8 A;  5KFA A;  3NCQ A;  1YI2 S;  5DET A;  3CJ2 A;  3GJT B;  1JIH A;  3D6H B;  4X62 J;  2IBO A;  4PG4 A;  5L1K A;  4WYL A;  4QQB A;  4KRW A;  4O23 A;  3BSO A;  3MI7 X;  5HQ8 A;  4B9N A;  3C46 A;  1P8G A;  1TU0 B;  4Y2C A;  4H54 A;  4HI1 A;  4LRE A;  4CH1 A;  4OFZ A;  3JSM A;  1FE4 A;  2XCP A;  3B6B A;  4YR3 A;  2V9W A;  4H4O B;  1U6Z A;  3IG1 A;  3R5J B;  4NEY A;  3SSQ A;  2U2F A;  2UUC J;  2CQ2 A;  2HEK A;  3ZZP A;  4DX8 H;  3HSG A;  1WUU A;  3IWL A;  5F0U A;  1YBT A;  1KFD A;  2QLJ B;  1UVL A;  3FUY A;  1Y00 A;  2IDE A;  4WP3 A;  3D68 A;  1N5T A;  3OTB A;  1RXO B;  1HWU A;  4OYM A;  3JAM U;  2OPP A;  3MFH A;  2DHS A;  3TQE A;  4TQS A;  1T05 B;  3MHY A;  3BN4 A;  2XB2 D;  1Q8K A;  4N7T A;  1VJW A;  1NAQ A;  1HQE B;  4PZV A;  3DLE B;  2F9D A;  4RU9 A;  3L7U A;  1U25 A;  2LP4 A;  4OQJ A;  1TMJ A;  2J0S D;  4MFB A;  1DJ0 A;  3EXY A;  3DOK A;  4J90 A;  1S9G B;  4ATN A;  3RRK A;  5B0E A;  2CQG A;  1FES A;  4LF7 J;  5F9N A;  4X2B A;  3QSI A;  5F8M A;  1S5Z A;  2JRS A;  5HQM A;  3EVM A;  1R8A A;  4DPX A;  1PCA A;  3UN5 A;  4O44 B;  2ZHO A;  2I0X A;  1Q7Y T;  3SI8 A;  3NWG A;  3OR2 A;  2VZ9 A;  1M0S A;  3M1V B;  2QFJ A;  4WZM A;  2F1F A;  2HHH F;  1OY8 A;  4CCH A;  2VFS A;  3M30 A;  3C16 A;  2QE5 A;  1TL7 A;  3UVJ B;  4JV1 A;  4RW6 A;  2ZH8 A;  3CCE S;  5EUH A;  1U2R A;  1XNR J;  3TUJ C;  4C4W A;  4RLE A;  3G96 A;  3MDF A;  5MLC V;  2B6A A;  4OI1 A;  3CJS A;  3UD5 A;  5LMN F;  4A4J A;  2XMK A;  4N77 A;  4MKV A;  1GXL A;  1KS2 A;  3RBZ A;  5A8R A;  1PC5 A;  3EGN A;  2M52 A;  3DRY A;  1VQO S;  1S0N A;  2E1R A;  5LMU F;  4KC5 A;  3D54 A;  1WOO A;  2B9Y A;  3E2E A;  2GX8 A;  4GRS A;  4DV3 J;  1Z2L A;  3NRB A;  1EET A;  1U0H A;  3J7A N;  4USK A;  5HK4 A;  2OEM A;  1S1U A;  3AQP A;  3EVO A;  2D9P A;  2KXF A;  4A8X A;  4B02 A;  1NME B;  1X60 A;  2H5J B;  3HO1 A;  2WCX A;  2PFD A;  1M5S A;  3VAH A;  1WNE A;  1KSP A;  3CDB A;  3FBB A;  5HP1 B;  3FBE A;  4X4V A;  1Z2Z A;  5GAG I;  4DPT A;  5A6W A;  1ZH5 A;  4WFN Q;  1JJC B;  4Z37 A;  3AD8 C;  4P6Q A;  2VG7 B;  1RT5 B;  4DV7 J;  4FNI A;  5E3R A;  1HNX F;  3L7P A;  1UW4 A;  1YZ6 A;  3T6J A;  1C4C A;  3MTK A;  2IAJ A;  3C14 A;  1LW2 B;  1O6X A;  1OMS A;  4ECV A;  2OD6 A;  2NXU A;  3NBP A;  3MM6 B;  4AT1 B;  2E7W A;  2V4J A;  3CME S;  5K8M A;  1RU1 A;  2ALZ A;  6AT1 B;  2CJY B;  2KXH A;  5A76 A;  1DRZ A;  1U49 A;  1VQM S;  5F9L A;  3AFG A;  5HL7 Q;  2CZ9 A;  2MGZ A;  4QPT A;  4C0B A;  3ZZU A;  2E29 A;  1U1N A;  2QL5 B;  2IYG A;  1X4A A;  4OV1 A;  4ZVG A;  4H4M A;  3EGZ A;  2N7Y A;  3Q8S B;  4BLG A;  5I42 B;  3KHG A;  2Y0B B;  3BGU A;  4C0O C;  3MXH P;  4B3M J;  5C24 B;  3KHH A;  3BH7 B;  5E3Q A;  2E5J A;  1R27 B;  2NXN A;  2APO A;  2YKN A;  1JB0 C;  3VAF A;  2ZWP A;  3BYP A;  3WHI A;  3K7R A;  2F4V J;  3CCU S;  3T1Y J;  1N5Y B;  3BN7 A;  5DGA A;  3C6U A;  1D09 B;  2KZZ A;  2QMW A;  3DYA B;  1T8E A;  1HBU A;  1EAY C;  3OFF A;  5DLG A;  3LA0 A;  1JNR B;  4RZR A;  1NPR A;  3I87 A;  2NPI A;  5K9F A;  3OR1 B;  3OTE A;  3BJY A;  1TK5 A;  3S01 A;  2DK2 A;  3J7Z T;  3OVS A;  1S9E A;  3W2W B;  1XN9 A;  3DXB A;  2HHS A;  3UCZ P;  4Q0B B;  2UXB J;  4ZPT R;  4L3N A;  3SEO A;  2FVC A;  4DV6 F;  2BM1 A;  2F7V A;  5ETQ A;  3P5T L;  2EKN A;  3W8G A;  4X66 J;  5J2Q A;  3HF5 A;  4CZC A;  4LF8 F;  5C25 B;  2MYF A;  4JI4 F;  4P74 A;  3UDV A;  1EP4 A;  1HNI A;  1QD1 A;  3NL0 A;  3QT5 A;  3R6L B;  1KLM A;  1LWC B;  2PA8 D;  2H4Y B;  5HAT A;  3HVW A;  3RAX A;  2BKN A;  2C2M B;  5HBM A;  3DDN A;  1HR0 F;  1RCO B;  1SQE A;  1PJ5 A;  4K5R A;  5D6G A;  1MU2 A;  3D3B J;  1C2P A;  2F8M A;  2CIM A;  4ILM A;  3WIV A;  1TL3 B;  2NCK L;  4IO9 Q;  3RJM B;  2HQI A;  1TKT B;  1VR6 A;  3PAC A;  4P7V A;  2XC9 A;  1H73 A;  5DZ6 A;  1TEL A;  3QAT A;  3BPD A;  3GFY A;  1JNZ B;  5B0F A;  2DNK A;  1NH7 A;  3OUY B;  1FK9 A;  3Q8U A;  2MY8 A;  4Q43 A;  3MOJ B;  3P4U B;  1EQM A;  4KH1 B;  3TVY A;  3D5M A;  3BH6 B;  3R5C A;  2CJK A;  3QJL A;  1WJ9 A;  3D6F B;  2OPQ A;  2HNY B;  3OL6 A;  2NUU G;  2FZC B;  1IBM F;  5AXN A;  2M2B A;  3NWR A;  1IBK F;  3LQV A;  1UJ6 A;  2CJ9 A;  1XQI A;  1FRH A;  3MED B;  4ILL A;  3MMB A;  2B43 A;  3ZTQ A;  4LIW A;  2DXD A;  4B9S A;  2JFD A;  1H7X A;  1Q1K A;  5L38 A;  2R8G A;  1ZYQ A;  2HRU A;  4F50 A;  2NSC A;  3DGP B;  4C0H A;  1SC3 B;  3ICL A;  1R8C A;  4K4Z A;  3MF5 A;  1RJJ A;  5T7L B;  3RBX A;  1U02 A;  4ZVF A;  1UWA A;  2AD9 A;  3A3P B;  4ECS A;  3K5O A;  1U1R A;  3ISZ A;  4WFX A;  2W2P P;  3DRX A;  1HNZ F;  2R7R A;  3DLG B;  3VAL A;  2UXD J;  3IP0 A;  3J81 Y;  4DPW A;  2WBR A;  3GJR B;  1UAW A;  2B56 A;  4MT1 A;  5DJB A;  5KFS A;  3CCM S;  3NMA A;  1HQU A;  3AQO A;  3KJF B;  2XM3 A;  3EXC X;  1UET A;  2YKM A;  4YY3 J;  3ZO7 A;  4DR4 J;  3Q83 A;  4TLR A;  1L3V A;  2JX2 A;  1RTD A;  4WTO B;  2N82 B;  1VOM A;  3GJS B;  3T41 A;  3KK3 A;  1Q8I A;  5E2Q A;  1T9U A;  4ZA1 A;  1IBL F;  4JI8 J;  2L08 A;  4PYD A;  2PMH A;  4X62 F;  4UF4 A;  3FMW A;  1OQ6 A;  2R8K A;  3W65 A;  1RZM A;  3EIC A;  2GO9 A;  1ZAW A;  1YRU A;  2MZT A;  4O3S A;  4ED7 A;  4NXN J;  5H9E K;  3DM2 A;  1NK5 A;  4X4O A;  2DEJ A;  4K4U A;  4KV8 B;  4HYK A;  3OV7 A;  2JHE A;  2V8H A;  5DG9 A;  1UTA A;  2HNZ A;  3O2I A;  1CJT B;  1KHV A;  1TKX A;  4NCG B;  1PIL A;  3DMJ A;  4DF4 A;  2CRL A;  1Y5I B;  3H2U B;  2BZ2 A;  1JLF B;  3ILI A;  1I1G A;  1I6J A;  4LR9 A;  3H2L A;  3H25 A;  2ZJR Q;  3P6Y C;  5KFJ A;  5JXS A;  3D1Q A;  4K0K F;  3W62 A;  3W9H A;  2BM0 A;  3BZQ A;  3KJN B;  1EQ0 A;  3TAQ A;  1S77 D;  3W5X A;  4O0I A;  1SXL A;  2DIV A;  3KG0 A;  4ECZ A;  3QID A;  5HLF B;  4CO3 A;  1QY7 A;  2M88 A;  4DL2 A;  4HI2 A;  3AAW B;  3KNG A;  2FZG B;  1KWM A;  3DRP A;  3HP6 A;  4DG1 A;  1XNQ F;  2AX0 A;  3ZTP A;  3T19 A;  1S1X B;  2HKE A;  4RR5 A;  3K5P A;  1N33 J;  1AZS A;  3KLE B;  4ECY A;  4URG A;  1VMB A;  1S6Q B;  1YJ9 S;  2R2S A;  5B09 A;  1S6P B;  4IH6 A;  2VPX B;  2J0X A;  2BE2 A;  5J1N A;  1TTH B;  1LFP A;  3IRX A;  3SV3 A;  1T3N A;  1RHJ B;  2DYA A;  2DRB A;  5E3A A;  1Q8B A;  3HHD A;  3THP A;  3CD6 S;  3MM9 A;  4FXD A;  1NSA A;  1TFY A;  3C8Y A;  5I3P A;  1WEY A;  2HG4 A;  1TUW A;  4U95 A;  2IC3 B;  4DLG A;  5CAA A;  4ZVP B;  4K4W A;  2GS8 A;  1VBY A;  3ZTS A;  1JLA A;  1W25 A;  3G6Y A;  4LF9 F;  3PW2 A;  2MHE A;  1TL1 A;  4UOG A;  1U6F A;  4WE1 A;  4OYX A;  4ZVT B;  3V6J A;  1WC1 A;  5CZX A;  4U67 Q;  2B4P A;  2R7O A;  3M2R A;  2LQB A;  2W7P A;  1XNR F;  5IM0 A;  4NLY A;  2C2E A;  5J1P A;  4AND A;  3NAI A;  3W2V B;  2GHP A;  1WI6 A;  1IKY B;  2FUG 9;  4DUY J;  4N76 A;  3RTV A;  4RUB A;  1B3T A;  5HSP A;  4WKY A;  3EMT A;  2KJW A;  1FO1 A;  1U48 A;  3MM8 B;  1YWX A;  2RE1 A;  3QLH B;  4XAK A;  1EJ7 L;  1GX6 A;  1RK8 A;  2XMT A;  2K2P A;  4F3Q A;  2FHJ D;  1R89 A;  4ZP6 A;  2PN6 A;  2CQ4 A;  1HKA A;  5F8N A;  1CLF A;  4F26 A;  3BKU A;  2ZVS A;  4ZCL A;  3MCS A;  2YNI B;  4NLG A;  4DV0 J;  1N34 F;  3GYG A;  1QSL A;  2P9E A;  4JI1 J;  5CD4 H;  5ETR A;  3KUE A;  1BQN B;  3LAL A;  4BS2 A;  1V3R A;  3MEE A;  2EEY A;  1YJT A;  4DX5 A;  2K3I A;  4ZN3 A;  4DR1 J;  3MEG A;  4P10 A;  5CYM A;  4BC7 A;  2YX4 A;  1YJN S;  2A18 A;  3PW4 A;  4N56 A;  1P1T A;  2BW7 A;  4MTP A;  3GII A;  1Q86 T;  5HMX A;  2FB0 A;  3DHX A;  1SV5 A;  3K8V A;  1WHX A;  4ZHR A;  2ZH2 A;  1G7C B;  3TAR A;  1SUQ B;  4R5P B;  2B8Q A;  3OSP A;  2AF6 A;  2OHD A;  2DNR A;  1JXL A;  2V5H G;  5K8N A;  1BQM A;  3Q22 A;  4QIE A;  4CQ1 A;  1CC8 A;  4EEY A;  2ILZ A;  4CNY A;  4J9V A;  4OHV A;  4I2Q B;  4UOH A;  4KPC A;  1VHF A;  1REG X;  3NGS A;  1J5E J;  3MAA A;  1FDN A;  2CQC A;  4DQP A;  1VQK S;  3N0V A;  1S6U A;  3SFG A;  1AA1 B;  4UW2 A;  2WK4 A;  1CG2 A;  1HQ2 A;  2JH3 A;  3VGU A;  3HKW A;  3M4X A;  2IM3 A;  3ET6 B;  5GAG U;  2B5J B;  3R1L A;  2EFP A;  4ZVO B;  2LYV A;  4QWC A;  2Y1I A;  4BBY A;  5I3Q A;  1Q4R A;  2P5V A;  5KTQ A;  2I8E A;  2CUY A;  5DDP C;  1VCT A;  1RWM B;  4ZP8 A;  5HRO A;  4F02 A;  3BBB A;  3R7B B;  4USJ C;  1AYE A;  4C8L A;  1SQF A;  3A1Y G;  3I5B A;  4CI0 B;  3HHL D;  4PG5 A;  4NA1 A;  4HH1 A;  3SDE A;  3QSY B;  1RTJ B;  3NS6 A;  4LFB F;  2AGQ A;  2F3J A;  4N47 A;  4Z2X A;  4FXW A;  3V5R A;  4JP8 A;  2F8H A;  1RTH B;  2R7W A;  3HK2 A;  4FF3 A;  1OIA A;  2YWG A;  2XZD B;  3S1T A;  1HW9 A;  3PW7 A;  3CDE A;  1UVK A;  1Q78 A;  3T5K A;  4YOE A;  4M5N A;  4N41 A;  1IR1 A;  1HNW F;  1AFI A;  2LCW A;  4NL5 A;  1RAH B;  3LWL A;  4DN0 A;  3AXM A;  1VYA A;  2B51 A;  2WOM A;  1IQZ A;  2OTJ S;  1FJC A;  2NQP A;  4K8R A;  2EKY A;  3QBC A;  3UDL A;  3F56 A;  4ELV A;  3DLK B;  1NBE B;  2IYI A;  4CLF A;  2I5J B;  5E33 A;  1RAA B;  4XK8 C;  3VVT A;  3DOM B;  1FWK A;  2QIF A;  3LTO A;  1YIJ S;  2DGO A;  2QJ3 A;  5EX3 A;  2DKO B;  1Y0H A;  4C8O A;  2WZ1 A;  2CVI A;  5K14 A;  4CP5 A;  4IQX A;  3MPD A;  1JLB B;  1FFS B;  2BJE A;  2BJ8 A;  1GH8 A;  1JKH A;  3AJ2 A;  4NCA A;  4DZ6 A;  3J7Z 5;  2XMW A;  2RU3 A;  2H1Y A;  5GAH I;  2HZA A;  1Q53 A;  3ZTR A;  1U1P A;  2G0I A;  3DU6 A;  3MUR P;  2ZH6 A;  2GJI A;  3LOU A;  2K1R B;  2AYM A;  4J91 A;  4FF1 A;  4CO5 A;  2R3V A;  3S8S A;  2JWN A;  3MUV P;  2WSE C;  1FX4 A;  3BKT A;  1NHU A;  1WEL A;  2D69 A;  2X1F A;  4WKR A;  1Q5V A;  3QRQ A;  3OQ2 A;  3M8Q A;  3HI9 A;  1VRT B;  1FT8 A;  1RT6 B;  1RAC B;  3G9C A;  1NK6 A;  1ZM2 A;  1RBA A;  2ASD A;  1GX5 A;  2VPZ B;  1HD1 A;  2BR0 A;  4OZJ A;  4KFB B;  5BJR A;  2PO4 A;  3W66 A;  1IJE B;  5B0B A;  2BOA A;  3AY0 A;  3V6K A;  2QYG A;  3LW5 C;  5HJX A;  2YWE A;  3PIP Q;  4YB7 A;  3M8P A;  1C0T B;  1OYD A;  3TX0 A;  4G1Q A;  3RYL A;  5BYS A;  4X4T A;  2R9L A;  4UY8 T;  1FWL A;  3BDP A;  1SIW B;  2WB1 D;  2ACY A;  2IMW P;  2WSF C;  3TUI C;  2BEF A;  2HWH A;  1IKW B;  4NYO A;  3RR7 A;  2W25 A;  3CCV S;  3NNA A;  2ZE2 B;  1NZ8 A;  3BGO P;  4OYI A;  2X3G A;  2XZW A;  4L76 A;  3U1L A;  1QUP A;  2Q79 A;  4JV5 F;  3J81 j;  3N28 A;  4P2F A;  4NLO A;  1XK8 A;  1NK7 A;  5F8L A;  4CLS A;  4YY3 F;  2UV8 A;  2HBY B;  2KVI A;  1H98 A;  4MJK A;  4FPI A;  1TV6 B;  3QJP A;  2GML A;  4RL1 A;  4F4Y A;  1X4E A;  2OPR B;  4OJG A;  3CJK A;  4ID8 A;  2OPS B;  2CG8 A;  3RBD A;  5KG1 A;  5BR8 F;  3IA0 A;  4CH7 A;  4JI8 F;  2W9B A;  2GQQ A;  1EIY B;  4IFV B;  4LUB A;  2AP6 A;  3HLU A;  2Y9H A;  3GB0 A;  3A8E A;  4PQA A;  2EG2 A;  3KFW X;  1KQG B;  3D6M B;  4X64 J;  2V63 A;  3WDO A;  4CRJ A;  1WHW A;  2EXU A;  4TXS A;  4PPD A;  2GAH C;  2HND A;  3M8Y A;  1UZD A;  1LWF A;  3B54 A;  2B4U A;  2J76 E;  1CJK B;  3QRR A;  2DHH A;  2O5D A;  2GQ2 A;  2O66 A;  4CTA B;  1DHM A;  5KFY A;  1FER A;  2DXF A;  2J6T A;  2Y8Y A;  1D9D A;  5FDL A;  3VGS A;  4ZIW A;  2XGP A;  3UI3 A;  1AB8 A;  3PYE A;  1F5B A;  4R25 A;  4UT4 A;  2QX0 A;  2M3D A;  3THV A;  3EX7 B;  4RW8 A;  1HWK A;  1SPB P;  5GAD I;  4NI2 B;  2HVI A;  1I5O B;  4PWW A;  2M8D B;  4USW A;  2DB1 A;  1NJI T;  1RT4 A;  1C0U A;  4GC7 A;  1NDK A;  3IBC B;  3P8B B;  2K06 A;  5KG0 A;  3T9N A;  4R0E A;  2V8P A;  4CM0 A;  3CJQ A;  2D9O A;  2WVF A;  3JTO A;  1CJU A;  3CJ8 A;  1L3K A;  3E01 A;  1R0A A;  2GGP A;  3OSN A;  5DRK A;  2NS1 B;  4DPY A;  4M5G A;  3MR2 A;  3MD3 A;  1WF0 A;  5IOL A;  3D0H E;  1WI8 A;  2D3U A;  2ZH3 A;  3BV8 A;  4J5O A;  4PXD A;  3JSM B;  3VV2 B;  7FD1 A;  2BVZ A;  1U24 A;  4ED5 A;  3IG1 B;  4IO1 A;  5HVF A;  2C22 A;  1X0P A;  1HWI A;  4HAC A;  2FJA B;  3T1H F;  3DLJ A;  2Z4P A;  5DQH A;  5KFB A;  4QIW D;  3QGG A;  2RDJ A;  5JVG Q;  2QLF B;  3TZZ A;  4DR3 J;  4JI0 F;  1XJW B;  1WHV A;  2LEP A;  1RKI A;  3DC2 A;  4CH0 S;  3KG1 A;  3H40 A;  2C3Y A;  2RUS A;  4JBC A;  2IIH A;  1T02 A;  3GCW P;  4FKX A;  2GV1 A;  2YNF A;  1HI1 A;  3B4D A;  2OPP B;  2HVE A;  4ZPW R;  2XMU A;  1NH8 A;  3G6X A;  5F8G A;  2KTQ A;  2JSX A;  1HWJ A;  1HHS A;  5ETT A;  1SJF A;  4M1K A;  3JAM Y;  4FF4 A;  2DNQ A;  5KT5 A;  3UD3 P;  2F40 A;  2IPO B;  3ZTO A;  2N3O A;  2NYH A;  2H5I B;  4XPE A;  1SJQ A;  4HHJ A;  2BW2 A;  2VOO A;  2V2Z A;  3PKM A;  2M7S A;  4DN9 A;  4DR7 F;  1DBD A;  1T9X A;  1QAX A;  4UOC A;  4ZK7 M;  4MFB B;  4TY8 A;  3L3C A;  1X4C A;  1LKZ A;  4E0D A;  3DOK B;  2Q66 A;  2V2V A;  3Q8R B;  4QOT A;  1VC0 A;  4OIX A;  4ALZ A;  4PUO A;  2W4C A;  1AXQ A;  5CXT A;  4Y2K A;  1KC8 T;  2CPF A;  2ZKT A;  2ZZT A;  2HVD A;  1BLU A;  1VFJ A;  2LXI A;  4DR5 J;  5LSR A;  3PW5 A;  4WK3 A;  1FJG J;  3MFI A;  2LU1 A;  3OR2 B;  4Y28 C;  4DPU A;  2WVE A;  2DTJ A;  2IMO A;  3PIO Q;  1WWH A;  3M30 B;  1RAE B;  3GFX A;  4DI6 A;  3C16 B;  4YR2 A;  4DS4 A;  1TL7 B;  4RW6 B;  3HVR A;  1ZOT A;  2UUB J;  2CPH A;  1FRJ A;  4DV2 J;  2VBW A;  3QT8 A;  2GMJ A;  4PG6 A;  4LSL A;  2B6A B;  1IJF B;  1DTT A;  3RRG A;  4XO0 A;  3FEY B;  3R2D J;  2RB7 A;  2XHW A;  2GVD A;  2J6U A;  5KFT A;  4DL5 A;  2JDJ A;  4FYD A;  2ZHA A;  5A8R B;  1HAR A;  3A4T A;  3H2V E;  4QIG A;  3IR6 B;  2G1D A;  1G4C A;  2CQ1 A;  2J8A A;  1Q81 T;  2KYZ A;  2ZUA A;  1DTQ B;  1N52 B;  4ZVQ B;  2YX1 A;  3PYF A;  1OPZ A;  1PSD A;  2QZ8 A;  2V34 A;  3FRY A;  4YQW A;  4CO2 A;  1EET B;  1U0H B;  1F3F A;  1WAC A;  2V2K A;  3AA8 A;  1RHK B;  2HMI A;  1S1U B;  5D4L A;  2AT1 B;  2HFN A;  4PWU A;  3OTO F;  2CJA A;  1S57 A;  5DO2 A;  3GYN A;  2VKR A;  2HGN A;  1U09 A;  4LFA F;  4Y2M A;  1OPI A;  4OLO A;  2JEF A;  2UU9 J;  2RDD A;  3PO4 A;  3BB5 A;  4GKK F;  2CNN B;  3GJQ B;  2YNH A;  3M9M B;  1X5O A;  2FY8 A;  1LWE A;  1R0C B;  4BHQ A;  2X1B A;  1H74 A;  2ZM6 J;  3OT9 A;  4ITS A;  4PXC A;  2W4P A;  2XY6 A;  2IAJ B;  3C14 B;  4P75 A;  1UA1 A;  3MMC A;  5F3Z A;  2YBV A;  3ENV A;  2AJQ A;  2XBP A;  2RSQ A;  1GT8 A;  3GWC A;  3NBP B;  1NO8 A;  4GKJ F;  3U7J A;  2MKY A;  3AOA A;  2V4J B;  1D1U A;  4DL4 A; 
#chains in the Genus database with same CATH homology
 1NHK L;  4UOF A;  1NPK A;  3NGR A;  4W98 A;  1B99 A;  1JXV A;  2DXF A;  5CAA A;  1WKK A;  3VGV A;  4ANE A;  1F3F A;  3BH6 B;  3JS9 A;  3VGU A;  4F4A A;  3ZTS A;  2HVD A;  1VYA A;  2B8P A;  2DXE A;  3VGS A;  3Q8Y A;  1NDL A;  3Q83 A;  2AZ1 A;  4WBF A;  1BE4 A;  1NSP A;  4UOG A;  1S57 A;  3FBC A;  1UCN A;  3ELH A;  4O0N A;  3FBB A;  3BH7 B;  4F36 A;  3FBE A;  1MN9 A;  3PRV A;  1XQI A;  1NB2 A;  3FC9 A;  4S0M A;  1ZS6 A;  2BX6 A;  3Q89 A;  4FKX A;  4C6A A;  3ZTQ A;  5CAB A;  4DI6 A;  3ENA A;  1PAE X;  2HVE A;  5BXI A;  2DXD A;  4EK2 A;  3EM1 A;  1MN7 A;  3EVW A;  3BBB A;  3VVT A;  2AZ3 A;  3ZTP A;  1NSQ A;  1HLW A;  1NLK L;  3BBF A;  1LEO A;  3Q8V A;  1B4S A;  4AND A;  3L7U A;  3EIC A;  4ANC A;  3GPA A;  1NDK A;  1BUX A;  3EJM A;  4HR2 A;  4ENO A;  3EE3 A;  1K44 A;  1WKL A;  2CWK A;  3DDI A;  2B8Q A;  1HHQ A;  2NCK L;  3EMT A;  1NDC A;  3GP9 A;  3ZTO A;  1U8W A;  4DUT A;  1HIY A;  1W7W A;  3B6B A;  1LWX A;  3ETM A;  2VU5 A;  1WKJ A;  3FBF A;  1KDN A;  5IOL A;  3WX8 A;  4CP5 A;  3G2X A;  5C7P A;  1PKU A;  3MPD A;  1BHN A;  2DYA A;  3BBC A;  3FCW A;  1F6T A;  3NGT A;  3FKB A;  3FCV A;  3PJ9 A;  2BEF A;  1NSK L;  3VVU A;  4UOH A;  1NDP A;  3NGU A;  4KPC A;  3VGT A;  1XIQ A;  2ZUA A;  3NGS A;  4DZ6 A;  3B54 A;  2DY9 A;  1S5Z A;  2HUR A;  3EVM A;  3Q8U A;  4FKY A;  1NUE A;  1EHW A;  1S59 A;  1NCL A;  3EVO A;  3R9L A;  3Q86 A;  3DKD A;  3ZTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...