4W98A

Acinetobacter baumannii sdf ndk
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
145
structure length
145
Chain Sequence
EFMAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Acinetobacter baumannii Nucleoside Diphosphate Kinase
doi rcsb
source organism Acinetobacter baumannii sdf
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 45
structure length 145
sequence length 145
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4w98A00
3EJMA 2HVEA 1K44A 1NSPA 1BUXA 1NDKA 5CAAA 1HHQA 5IOLA 1XIQA 3EE3A 4CP5A 3Q86A 1HIYA 1UCNA 4KPCA 1MN7A 4C6AA 3BBFA 3FKBA 1NDCA 3B6BA 1NHKL 3VGVA 4ENOA 2DXFA 2B8QA 1W7WA 3NGSA 1EHWA 4ANDA 1B4SA 4W98A 1WKKA 2DXEA 4UOHA 5BXIA 1U8WA 3BH6B 3FBCA 4HR2A 3ZTRA 3G2XA 1LWXA 3JS9A 1KDNA 3VVUA 3EM1A 2BEFA 3ENAA 1NDLA 3PJ9A 3L7UA 1S59A 3WX8A 1S57A 1XQIA 4UOFA 3FBBA 2DYAA 4EK2A 2B8PA 4UOGA 3EICA 3NGTA 4FKXA 1NSQA 3ETMA 3FBEA 1BE4A 3Q89A 1NB2A 3Q8VA 2CWKA 3VVTA 2DY9A 1F3FA 3Q8YA 3ZTQA 3R9LA 1ZS6A 3ELHA 3FBFA 4F4AA 3EVOA 3EVMA 4WBFA 4ANCA 3Q83A 1BHNA 1NSKL 3GPAA 4O0NA 1PAEX 4S0MA 3EVWA 1VYAA 1JXVA 2HURA 4DI6A 2DXDA 3VGSA 3BH7B 1B99A 3ZTOA 3NGRA 2AZ3A 2NCKL 1PKUA 3VGTA 3ZTPA 2BX6A 3DDIA 1NPKA 1NUEA 3NGUA 1S5ZA 1NCLA 3VGUA 3EMTA 1F6TA 3Q8UA 3BBCA 3FCWA 3FC9A 4DUTA 3BBBA 4F36A 3FCVA 1WKLA 3ZTSA 5C7PA 1WKJA 2ZUAA 2HVDA 2AZ1A 1HLWA 1NDPA 4DZ6A 1NLKL 3MPDA 5CABA 2VU5A 3DKDA 4ANEA 1MN9A 3GP9A 4FKYA 1LEOA 3PRVA 3B54A
chains in the Genus database with same CATH superfamily
3MFIA 1QUPA 5F9LA 2ZEJA 1LK5A 2IM1A 2V4JA 3LP2B 3U27A 3V2UC 5DETA 1SJ3P 5J1EA 5E3AA 2DB1A 2IYGA 3MTJA 4M5HA 2Z2LA 5AE2A 4ZITA 4KBIA 5B0AA 1UCNA 2OMLA 4USMA 3TW0A 4DBQA 5K8OA 1TELA 4NXNJ 2YPYA 1XMOJ 4F0KA 4F4YA 1S9GA 4M95A 1U2FA 2BM0A 2DHAA 4OQJA 5KFXA 3K59A 5J2QB 1YKWA 2AP6A 4OZ1A 1DHMA 2MLZA 4LFBF 5DQHA 2VJUA 3FJ2A 4KKOA 1NK7A 1SVDA 4IH6A 2ZZMA 4RWWA 2MLXA 4IRCA 4X66F 2HS4A 2FTRA 4O4GA 1DLOA 4QR1A 1Y5IB 2WVDA 1C1BB 4B9LA 1VMBA 3DDKA 3PNIA 1SCJB 3M2UA 4IDKA 4KO0A 3EM1A 4PWUA 3W5YA 3CCLS 3I9V9 5FIIA 2BOAA 1B0VA 1J27A 4NOHA 5ETRA 5F0UA 3A8JA 2F1FA 4RW7B 4DV6F 3CJ5A 2HGMA 1Z4UA 2CNNB 3AD9C 3IG1A 4O23A 4OFZA 5DDOC 1I6JA 4CO4A 3KLFB 2L48A 1C0UB 2VFUA 4LRBA 4E2FB 1XNQF 1QJHA 2D7SA 1YHQS 4ILRA 3CCSS 2U1AA 1RBAA 4M8LA 3DHWC 1RHKB 2LDIA 4TU8A 2VASA 2EPIA 4OYIA 1HR0F 2DVIA 3O8WA 4JI5F 4QU6A 4NLSA 2C2ZB 4NZ6A 1HKAA 3HKZD 2HLTA 1GXTA 3GSDA 4TKTA 2N82B 3I9ZA 3KLIA 2LEAA 5GAHI 3QZ7A 4DR4F 4ELUA 3EZUA 2I6WA 2LA6A 1JLBB 3R5JB 1S49A 1X5TA 2CWXA 2GJ2A 2NPIA 5HANA 1FVSA 4Q44A 2IMWP 1WC5A 4KGMA 1KQGB 3R1HA 1L3SA 3D6HB 1CVJA 4F4XA 2ZH2A 1RT3B 2R2UA 2XMWA 1WDDA 2XHCA 5KTQA 2VQEJ 2HFZA 1R0AB 2E5IA 3FGVA 1N5TA 2QRRA 2AEFA 2XYPB 4OLOA 2OTJS 4S0MA 1V5IB 3EVWA 1SH3A 3HHEA 2FY1A 4KV8A 5G4DA 4QIVA 2CG4A 3OXFA 3VAGA 2DGUA 2VKRA 3OTOF 1IJFB 5KFFA 4YDDB 2GJIA 3AJ2A 4JI2J 4U96A 4L75A 2B5JA 1OSDA 2ZH3A 1X8DA 3GFXA 1VQ9S 2IDLA 4M1KA 5AJ3F 3O1LA 5KFOA 1HNVB 3TQ1A 3OVBA 4QIGA 5BYSA 3KMQA 2CQ4A 4FZVA 1YZ7A 3T3FA 4X65J 2R2RA 3CT9A 5EX3A 2RH3A 2DNKA 3CCMS 3TO8A 1B7FA 1GMUA 1UWBB 1K8AT 2B6AB 3DM2B 3OR2A 4AD6A 2A18A 3IMQJ 4Y2IA 3D54A 1HBMA 1YK9A 3TX0A 4HH0A 1NPPA 5AE1A 4P2SA 2HNZA 4Z7CA 4A8SA 5DLFA 5AXLA 1RT6B 3ITHA 3M1VB 3CJ8A 4DV5F 2YKQA 1CULA 1F2GA 2KB2A 1LW0A 2ZUAA 2AGPA 4PZVA 3KYLA 4CLKA 4FS1A 3OFHA 2G1HA 3PYGA 5K8MA 2UUAJ 4Q8FA 2DNOA 2J9DE 3D4JA 5J1PA 5CABA 1FE0A 1M1GA 4MIAA 3DKDA 3JQMA 3ZZUA 2DRBA 2IY5B 1N0UA 2BRLA 1Y3JA 4K4SA 3ZZ0A 1VLOA 4FF1A 2HVEA 4ZCLA 4ECRA 1QE1A 1P9YA 2VQFF 2BJEA 2D3UA 2RNEA 3I0RA 5CYMA 1AXQA 4KB7A 2M70A 4MKYA 1RHQB 1KTQA 1RAOA 3IXQA 3MEEB 2W7OA 2ACMA 3R5BA 1HBOB 4LR7A 1WEXA 2XSFA 1YDLA 1IKXA 1E6VB 3GE9A 4LF4J 3M8PB 4DR7J 4OX9J 3KDNA 2FQQB 1A6LA 4ENOA 3SQGA 1EP4B 1UAWA 3H90A 3ILIA 3E8OA 4P71A 4RW8B 3RYLA 3SIPB 4QBUA 5H9EJ 2GIRA 2BZ2A 1R8HA 2EFGA 3DU5A 3DMJB 4B9VA 1EHWA 1S6QB 1NU4A 1RWNB 3LP1B 2KTQA 4A8YA 1XMBA 1YJRA 3CCTA 3D66A 3V6KA 1JKHB 3NWGA 3QLHA 1C0TA 4M5NA 1H2VZ 3BREA 1U8WA 4DQSA 2OH2A 7AT1B 4J5OA 3V81A 3GIRA 3NS6A 2CPXA 3ZTRA 3J7ZT 2XQCA 2WK4A 2HZVA 2QL9B 2OPSA 1YJVA 1Q53A 2HHPA 3IRXA 4G65A 3NCRA 5ITHA 3DI6A 2L9DA 1R6YA 4X65F 1GTEA 4Y65A 3OL7A 4RR5A 1Y7PA 4DR1J 4ES3A 4X62F 2KL8A 2Q79A 4P73A 2LXFA 4B3MF 1XQIA 2I38A 4JI6J 1JLGB 2UUAF 2RHQB 3OLAA 4TQSA 2CQPA 2DTJA 2CQ2A 3FDSA 4BHQA 5E41A 1X9SA 4CLUA 2QYCA 2YVSA 3RBDA 5GADU 4ECWA 1C1CA 3BKUA 3C6UB 3DCAA 1HWJA 1S9EA 1DBDA 3KJFB 3LUYA 3MMAA 4OYZA 4Q2MA 3FSIA 1IBLJ 1FRJA 2R8HA 2OHDA 3HT0A 1S0MA 2JEGA 1OPZA 5ETPA 3C16B 4N76A 1RHMB 3LP0B 2B4UA 4NCGA 1YVFA 4DFPA 1NRKA 1RBLA 2AYMA 3TEGA 2B9XA 1HNIB 1NM2A 1WORA 2W2MP 3NS7B 1D0EA 4KIAA 4I0WA 3TJAA 4JI3J 4NMXA 1VHFA 5DZ6A 2MLYA 4X66J 4FF2A 3NNAA 4JV5J 1T9XA 2CZVC 3EVMA 4G1QB 1C2PA 3JXOA 4BWMA 3IBFB 1FO1A 3VALA 3BSNA 1FDDA 2A0FB 2DNLA 1S1TA 3DU6A 3N01A 4Q43A 2BOPA 2HS3A 4LRDA 3M6WA 2RRBA 4DV2F 3VZIA 2D74B 5B0EA 1SL0A 1B70B 2Z56B 3PX4A 2V68A 1RAGB 2B4VA 5L9NA 5K9FA 2DXDA 5C2GA 2Q66A 1IBKJ 2NPFA 2C42A 4EO8A 3NGRA 3MMBA 2BUNA 5LSRA 1VK3A 5J2PB 4DSFA 2AZ3A 3BR8A 5CCMA 2PFFB 3FUYA 2R8JA 3FFIB 9RUBA 4TU9A 1U4BA 3BSAA 2HHXA 2XG8A 2VPXB 4RKUC 4KHPJ 1NPKA 4E8UA 4A8XA 3K8VA 2YNHA 1H6KX 5ETVA 1FEEA 1JJCB 1NCLA 4YY3F 2OAUA 4JI0J 2RQ4A 4F7VA 3BGRB 1JWWA 1FX4A 2KN4A 2QIFA 4RW6A 4AL7A 1VHIA 2DRDA 3FC9A 1H98A 4DUTA 4J9PA 2DNQA 4WTOB 1J5OB 4UOCA 3R7SB 1RHRB 1RWPB 2XI3A 4JI5J 1JJ4A 2VBWA 4GKJF 2EI5A 2DPJA 2BR0A 1JLFB 1T02A 2O1PA 5GAEI 3GYGA 4EUVA 4DUYF 4FXDA 1RACB 1DTQA 1RT7B 3KLHA 1PYSB 1TR0A 2DT9A 2JVOA 3Q2SC 2GQQA 3RJMB 4DZ6A 3CULA 5KFNA 3QT5A 1RTJB 1GTHA 3R27A 5J2NB 3KJVA 1FDNA 4ECZA 3BYRA 1X5SA 2EFPA 2YQ3A 3IFEA 2BA9A 2E66A 4J91A 4KGKA 4RW9A 3W2WA 2KG1A 3MEDA 1IXKA 3CGIA 5A8RB 4BC9A 3KG0A 5IWAJ 1GX6A 1JLEA 2HIYA 4H4OA 5CXTA 3L7PA 3UVJB 1RTZA 5AXNA 3DLGB 1QSYA 3IBCB 4OIXA 1IKWA 3M8QA 4CO2A 3I0SA 4K5SA 2B8QA 1ZYQA 2N3LA 4DL2A 3Q23A 1X4HA 4CDIA 5AT1B 2EK6A 2HHTA 4KFBB 5K14A 2G13A 1WNEA 1G7CB 1RB0A 2V6AA 6FDRA 3GG1A 2HQFA 4W98A 1UEKA 4ZIWA 2XS5A 1FD8A 2DHSA 2JVRA 4M5MA 2G0JA 4XAKA 5D0RA 4WF9Q 3H2LA 1N54B 3B8HA 5HLFB 3P3DA 2KYZA 4ZVQB 5KFDA 3DYAA 2G2OA 2IPOB 2PDAA 3BSCA 4PPZA 3KNGA 3C46A 1XR7A 1HMVB 3BEGB 3H7HB 3QO9B 1RYRA 2HW3A 3MPVA 3M9OB 3PEHA 3MM7A 3K5MA 3CXCR 3J7YI 3K5LA 4C4WA 2RU9A 3GJSB 1PJ7A 3TUZC 2GMHA 2FC8A 1JMTA 1PBUA 2NXUA 4X4QA 2FVQA 2HHHF 3MOZA 2M8DB 4UOFA 2XTJP 1LWEB 1M1HA 4A8OA 3UN5A 3OTOJ 2UVWA 2B8PA 3SSRA 3L7OA 3MEGA 4OZ5A 2UUWA 4WFAQ 2LECA 1GMVA 1W26A 3KFWX 1Y10A 4P2MA 1U0SA 5GVQA 3TI0A 3JTOA 3RB3A 4M5DB 4O44A 1FD2A 5E3RA 1UTAA 2B9WA 4LF7J 2I5JB 2ZD1A 4CI0B 2P2CB 4J9KA 1QSLA 3W5ZA 2HBZB 3HHDA 4LREA 2I2YA 5ETOA 1VBXA 1F2HA 2BVZA 4C48A 4URSA 5ETKA 4M94A 2VBZA 2RD5C 1T11A 4K50A 4P7VA 2Z57B 1AFIA 1FHTA 2M9KA 3KG1A 2Z30B 3TVYA 2G9OA 3POTB 5B0GA 2ILYA 2Q6CA 3NP5A 1F3FA 1UVKA 4TU7A 2HQDA 3V81B 4X2BA 4K0KF 1I5OB 4QOTA 3SCLE 2GO9A 3CC7S 2DH7A 2YNFA 3Q83A 4X4SA 1Q82T 2ZOFA 1ZOTA 2HSEB 3DGVA 4FDFA 2FB0A 2OFHX 5IS2A 2BBEA 1RTIB 3BS9A 3JQKA 2WRMA 1FESA 2LXIA 1FJGJ 3VGSA 1HQUB 1S48A 5KFTA 2QA4G 2RUSA 1UEUA 2XS2A 1FNMA 1T94A 3KK2A 1X5PA 3T1HJ 1EIYB 1REGX 4ZP6A 1CS4A 1TL7A 2QLXA 3W8PA 4EWTA 1RTHB 3CJKB 4R5PA 3JYTA 2H54B 4DV1F 3SSSA 1AW0A 4HTJA 1BQMB 3VAJA 4UQTA 1NUEA 1TAUA 3IBWA 5MLCV 2JX2A 2W1BA 4WKYA 2R7OA 4LQ3A 2KRBA 3H98A 4WIIA 5LL6d 2PMWA 6AT1B 4QWCA 1V3ZA 4K4VA 2R3VA 2FYXA 1YLXA 4KPYA 1BC6A 2AJFE 5HQ8A 2KT2A 4GRSA 2KRRA 2GGPA 2G2YA 2VFSA 1S0OA 2ZWPA 4OZLA 2CRLA 1UPMB 2EKNA 2LQ8A 4OX7A 3C15B 5DG7A 1U24A 3JSBA 4YB6A 2RS8A 4WIQA 3GG0A 4CLSA 4U6PA 1IM4A 5F8MA 2G0CA 2AW0A 1S0VA 1WTFA 3HFVA 2ASDA 4NLPA 3UWTA 1RAEB 4JI7F 2EG2A 3IM9A 5IM0A 4JI3F 3CDWA 2PI4A 2MZ1A 2Y1JA 1X7VA 5E3CA 4ZN1A 2C22A 2V4JB 5HP1B 5JUMA 4ED2A 1NDKA 2W24A 3R5AA 3THVA 1IBMF 5BYRA 1IKVB 2CUYA 2DH8A 2QMUB 3PYEA 1X4GA 3MAHA 1IN0A 5CD4A 2AYGA 2VONA 3BO2A 4L72B 4F50A 1NKEA 1LNQA 2YH0A 1ITPA 5H9FJ 2E44A 1S9GB 1HHSA 3OV7A 2AJ4A 4MYUA 3UDVA 4DS4A 4NLQA 2DNHA 1RT4B 1NK6A 1B4SA 4ILLA 4GC7A 2ZH7A 4PQUA 4K5RA 4RUBA 4CLPA 4FP9A 4KKOB 1U2RA 5F3ZA 1YI2S 2H48B 4C8MA 2EXUA 5F41A 2MQQA 3MOJB 2IDEA 4X4TA 3T1HF 1DZ5A 5EHHA 1DLOB 4B9TA 1DURA 4AE5A 1HWKA 1C1BA 4YS2A 4ZPWR 5HAOA 3OUYB 4PPDA 1RP5A 3NOCA 1V5VA 1SQGA 1I94J 3T1YJ 3GJTB 1M0SA 1H2TZ 4HDHA 4RW7A 5EX0A 3KLEA 2ZHBA 3PJWA 2JJ4D 5H1SV 2R7UA 4OX9F 2ZH1A 3GYNA 2J0SD 2B7BB 3IR6B 4N8OA 1A0OB 2XWXA 1FI4A 1V3RA 1P6TA 3NRBA 3CE8A 2QFJA 4R0EA 4XDDA 4P10A 3BPSP 4Y2MA 2R2SA 4ZCKA 2D9OA 3UO0A 1MSWD 3LO3A 3QIPA 5KT6A 3DLKA 3ET6A 1SBRA 1LWFB 2EBGA 4F3MA 4NXMJ 2OFGX 3CJTA 3W8GA 2DHHA 3HT3A 5IV3A 1DTTB 2DIVA 3Q89A 4ECYA 1YBTA 1RT1A 4I67A 2OGUA 3D7SB 3Q8VA 5D4PA 2PO4A 2V69A 2DY9A 4NLXA 4GKJJ 1RWOB 4LUBA 2VF3A 4HT7A 2ZNYA 2LCWA 4P74A 4NLYA 2QO3A 1R0AA 2E7XA 3EXCX 4C8OA 1X4DA 3C19A 5HK4A 2VV5A 1J5EJ 3NG8A 3OXLA 4H4KA 4R8UA 3IWLA 1T05B 4UY85 1WUUA 4DG1A 1NK5A 2JL9A 2Z8QA 4QIFA 3L09A 3ADAC 1JB0C 4HHHA 4FBUA 4FF3A 4ECQA 3R7NB 3NNCA 3QJPA 1WTBA 3JQJA 2ZDPA 4O3OA 5EUHA 2XSJB 1U1PA 3OJUA 2CJ9A 1HNVA 3PV8A 4CIOA 4I7FB 4C11A 3BR9A 3MR2A 3CSKA 2LYVA 3CCES 1O5JA 5FDLB 3H20A 3JB9k 4ELTA 3GIKA 4D3HA 1KQSR 3OR2B 2XLIA 4IG3B 4MFBA 2HVIA 2UVRA 3PO5A 2UZAA 2YX1A 1WWHA 4J9NA 3M1VA 1PYTA 3GZ7A 4EYHB 1U48A 3D1QA 4DX5A 2Y8WA 1LW0B 4YR3A 2CYYA 1BD6A 2FJAB 2MQPA 2OO4A 3HPOA 4Y2KA 1JJ2R 1VC5A 1F9HA 1FRMA 3MZIA 5AXMA 4ATNA 2Y1RI 4DR5F 3OL8A 3AFGA 3GQCA 4J37A 4WTYA 4DQPA 2HQCA 3MPDA 1O51A 5DGBA 4J9LA 1DARA 4B3RF 2J5AA 3RW7A 1VC6A 5AXKA 1RYSA 1U25A 1YGYA 3EJMA 4JP8A 1QE1B 2FHKA 3GCWP 2I1RA 3IR7B 1HWUA 3EGVA 5HATA 5EGYA 2G1DA 2GIQA 2OP5A 1U09A 1QLNA 3EE3A 2WCXA 2C2DA 1HBOA 2CPIA 3DC2A 3KHGA 2FY8A 4C6AA 4ZJOA 1IKXB 1BGXT 1E6VA 3HHLC 3M8PA 2PMZD 1NDCA 1QD1A 4NLRA 4QWAA 1NHKL 4LBPA 3FSYA 4KR0B 5LXYA 1EP4A 2Z58B 4USIA 5KG3A 2HHVA 4F04B 3H5SA 3GLJA 3UW1A 4YR0A 3O3LA 1KHVA 4Q7AA 3DMJA 2FHJA 4OI3A 2CG8A 4P7TA 3AQOA 2XLJA 5LMUJ 1N5SA 2NZ4A 4YHHF 2CQBA 2L08A 2FUG9 1JKHA 4C7QA 1C0TB 3HKWA 2N4DA 1N36F 2MYFA 4YUDA 1N52B 5RUBA 3MMCB 4YEAA 2OJ3A 2UXBJ 2XGQA 2GCFA 3P8BB 2CADA 3QGHA 4DXLA 1A9NB 4EZ6A 4DPTA 2OPSB 2IJFA 3IRXB 1VLYA 1RU2A 3DI6B 3VVUA 4JI8J 1YX2A 2BW7A 1VBZA 2KHDA 2U2FA 3Q24A 4FVMA 4WWSA 5DDRC 5BR8F 4F4WA 2HWHA 2QC3A 3KUGA 3SFGA 1QAIA 3CJRA 3A8KA 5GMKa 4YB1P 3RAXA 1JLGA 2VG6A 1RWUA 2W9CB 1RAAB 2DNRA 1N34J 4OYAA 5IT4A 5HN0A 2YWGA 4FKXA 4USVA 2DR8A 2HS0A 3C6UA 3HD1A 1ZAXA 2UU9J 3MDFA 4DV1J 4JV2A 5JXSA 5F9NA 2VOPA 1FFGB 3T9ZA 2KFZA 3R6LB 1SIZA 1RJJA 4IOCQ 3UN2A 1ZM9A 2HHQA 4NCGB 2RUGA 1XTZA 1Y11A 2HQGA 2BJ3A 1FNOA 2A6OA 3ZO7A 2VB6A 1FTCA 3G87A 1HNIA 1U6FA 1WG1A 2XO6A 1KOHA 2IM2A 3V4MA 3NEKA 4ED0A 2DGQA 3FBFA 3W63A 3U1NA 2KZZA 2ZUGA 1URNA 3LALA 5LSOA 2CNLB 4ANCA 4G1QA 5L39A 1TMJA 3IP0A 4WKRA 1S1TB 2IC3A 3ICLA 2W9AA 1T0TV 1B3TA 1VYAA 4IQXA 1XR5A 4MH8A 2XMTA 4NL5A 3KJNB 1M5SA 2K3KA 2IM3A 2J7KA 2I8EA 3DOKB 3ENVA 1E6YA 1YSJA 4DPXA 1OSCA 3MMBB 8ATCB 5A2QY 1HI8A 4DMZA 1F9FA 1IWAA 1LFWA 3PTWA 1OJ4A 3RR8A 2V8HA 4LR8A 1OWXA 1TL3A 5KFBA 1VQOS 3DDNA 2YNHB 3SCKE 1EETB 4BDPA 4DS5A 1IWGA 4MYTA 4DR6F 4EGLA 5F8JA 2H4YB 1OPIA 3CMES 4TN2A 3BGRA 4K7QA 1PCAA 3B4DA 3FQLA 3PW5A 2NZCA 1VQ7S 3KK1A 2WW4A 3G6YA 1J5OA 4IFYB 1WDTA 3ISZA 4LIRA 2PEHA 3B4MA 3KUHA 1S1WB 5D77A 2GZOA 3TAMB 3TZYA 3HVRA 2DKOB 2F9DA 2IAJA 2CJYB 3AT1B 2XGPA 3OTCA 2PT0A 4DEZA 1VQPS 5EDWA 5D8HB 2YXLA 1DTQB 1RT7A 2WB1D 3PRBA 3KLHB 3CC4S 2WAQD 2AF6A 4TYBA 3ZZZA 3AD8C 1RTJA 5J2NA 1DRZA 5BYQA 3UI3A 4OI4A 5KT2A 3KJVB 4RX6A 2R9LA 4EYIB 3ZC4A 2DGWA 2BJ1A 3MM6B 4F0MA 4AFFA 3M9MB 5A8RA 3M9NB 4F2RA 1AFJA 2J7WA 1FFSB 5ETSA 5E7OB 5BJRA 1H74A 1BWEA 3FEXB 4H4OB 1UJ6A 4DV5J 4C9DA 3DLGA 3AA8A 1F9EB 1TUVA 4OLPA 3LOUA 2WTFA 3CMAS 5A2QU 2IA6A 1PJ5A 3VGVA 2J6SA 4OHYA 3BV8A 1S97A 2V0NA 1T7PA 4DQIA 3V4IB 3GFYA 1S10A 4Q45A 1UVMA 3TQEA 4ER8A 2PC6A 1VQKS 2GAHC 1DFDA 1TAQA 2CQCA 2H65B 2DITA 5D0GA 1D9FA 2AMCB 2RIJA 1RE1B 2PEBA 2WSCC 3UDCA 1QAXA 3K57A 1VQYA 2FJVA 5DGAA 4C0OC 3KG4A 1ULRA 1UFLA 3A1YG 1LW2A 1GT8A 2HVZA 3JSYA 2KXHA 3DYAB 3LF0A 4LRCA 4OYXA 2N4CA 4RNMA 3H25A 3EZ5A 1QSSA 4B3SJ 1HMVA 3QO9A 2V4RA 1MU2A 2X1FA 3QRPA 4HDGA 3KWMA 1RU1A 1XMQF 2H51B 4ECSA 1M5VC 4RWXA 1R89A 4IO1A 2RRAA 3CMQA 4LF8J 1M1KT 2VC1A 4QJVA 3VHQA 1X4CA 3RBEA 4CLYA 1V6HA 2QX0A 4DR2J 4UY8T 4KGVB 2FLOA 5HQLA 3KNAA 4FYYB 1BLUA 5I3UA 3NGDA 4M5DA 3RBZA 4O44B 2P9CA 3UCUP 2HBRB 2WZ1A 2I5JA 4OYWA 5GADI 2UV8G 1RA6A 4DFMA 5E33A 1K1SA 3M2RA 3MMJA 5LT5A 4J9MA 2OIHA 5CYQA 2OPQA 3J7A1 1GMWD 1TV6A 2IMOA 4WE1B 1XBWA 2BACA 5U47A 3POTA 4PYDA 1NH8A 1L5UA 2CDRB 2VDIA 3UD4P 4F4AA 1K47A 1FX2A 2R7QA 4K4ZA 5A0YA 2EC2A 5B08A 3J81U 2CVEA 4OMFG 2FJWA 1BY9A 1S7HA 4H4MA 4OI1A 3QAUA 2CQ0A 3CJ2A 4Q5VA 3C3LA 3I6PA 3W9IA 3MTKA 2DO0A 4FXVA 1RTIA 2BJ7A 2HBYB 1EX8A 3TP2A 1P8GA 1SC3B 2DR6A 4P52A 1RGVA 1UJ5A 1HQUA 3K7RA 3MPYA 1O8BA 1HD1A 2OD6A 4DU8A 3D0IE 1U1RA 2MXYA 1OY6A 4TQRA 2XCPA 1CS4B 1F5AA 1PAUB 1TL7B 2DCLA 1RTHA 2NCKL 4N77A 4WYLA 1ELOA 3CJKA 2C28A 1Q7YT 3ZTPA 4AT1B 4J9VA 4LF7F 3Q2TC 1BQMA 2HFNA 3JAMU 4PQAA 2ROPA 2CNOB 3VGUA 5L38A 1UA1A 1G1XA 2V2KA 3GCXP 4USJC 2FJEB 4UUXA 3SV3A 3FCWA 2E29A 5HI7A 4JI6F 2QJ3A 2OEMA 3OHBA 4C8NA 3UNYA 4B3MJ 1H73A 2CQ1A 4DR1F 3KLGB 1VCTA 2H1YA 1VOMA 2GGPB 1RXOB 2LMIA 3M2VB 3BKFA 3TRGA 4DV3J 3PCOB 4USUA 2OEKA 1GNKA 3R97A 2ASLA 3C15A 5M2PA 1IKYB 2VUGA 3QT8A 4O0IA 3BQ2A 3IA0A 4UF4A 3BDPA 3FRYA 3HVWA 3ZXWA 5HVHA 3CD0A 4JUZA 1VRUB 2F63A 5IM0B 4ZJLA 2QLJB 4NA1A 3MI7X 1NSPA 4L6V3 5DQIA 2O3DA 5C2CA 1VK8A 3H4DA 5HP1A 4LF5J 3PY8A 5DM7Q 1IKVA 4DDFA 3QAEA 3C66A 2PMHA 4YMEA 3ZZOA 4ICLA 5IT9Y 4IR9A 3AD7C 4DLEA 4LF9F 4LF4F 2ADBA 3T5KA 1KS2A 4CNZA 1RISA 4NWBA 1IR0A 4BLGA 1K0TA 3FZ2A 3M6UA 5IWAF 3H2UB 4C3LA 5A76A 4V19J 3MM9B 2IVFB 2EBEA 3MGJA 5KFYA 5J2MB 1HA1A 1RT4A 2MKHA 4DL5A 1CQMA 3G4SS 4PQUB 1FF2A 2ILZA 3AA9A 3EGZA 2Q43A 4UOHA 1QTMA 3NGKA 1KP6A 4I2QA 3SSQA 3CPWR 4LMZA 2WONB 3EDRB 2IRUA 2MZJA 3OQ2A 2ZE2B 1UVIA 5DG8A 3OPKA 2QFIA 3OUYA 5LM7E 4U95A 3JS9A 2XZDB 2ZZTA 4ED6A 3MF5A 2V67A 3AY0A 1YG0A 3K0JA 1JLAA 3JTNA 2AJ1A 2WVCA 2BKOA 1WHXA 3KLEB 2IVYA 4J9SA 3IWNC 3UCGA 2ZH6A 2HAIA 2AT1B 1D9DA 2EG1A 3QSYB 1CBKA 3LW5C 1N8RT 4PUOB 4B3OB 2AIRB 1CC8A 3K17A 4FYXB 2M2BA 5ETNA 3PDNA 4UOGA 2ROEA 2DR9A 4DV3F 1KNZA 1H7XA 3N5BA 3OR1B 3QMQA 1QTNB 3MM8B 1BQXA 3DLKB 3ET6B 1Q1KA 1LWFA 1VRTA 3QIPB 3QGIA 3ETMA 1MMNA 2HNDA 2M88A 2D3O1 1Q95G 4HI1A 3PHTA 4YB7A 4QPXA 1GK8A 2HK3A 2LA4A 3QGGA 2KVIA 1KVJA 2V8DA 1DTTA 2NXCA 3VWSA 4LVNP 1RT1B 1Y4ZB 2PA8D 1ZETA 1HD0A 4OYMA 4LSLB 5KFZA 1UA0A 1KONA 3F44A 4K4YA 2FGCA 5E0OA 2QYGA 2MKYA 3TWZA 2DHXA 2FDNA 4RW4B 2J76E 4DCJB 1MROA 5HMWA 3Q8PB 3CUNA 1M5KC 1Q0NA 5CQGA 3GPAA 2NR0A 1RT2A 3N28A 4ZP9A 2FVCA 2VFVA 3AHPA 3DRPA 2X51A 3I5BA 4QZVB 3U1MA 4XTTA 2BQUA 1T05A 2XI2A 1FDBA 1FCAA 4C8LA 4DG1B 3MECB 1JXVA 1AT1B 2JLEA 4ZVGA 5KFUA 3DGPB 1I51B 4RU2A 3HM9A 2VG5B 3MAAB 1VQ5S 1S0NA 1B99A 5IT9U 2CJAA 3KKFA 1X4BA 1VBYA 2J9CA 2UUCF 2XSJA 5E2QA 3HVTA 1PKUA 1UKUA 5A6WA 1AZSA 1HQ2A 2VFTA 1FXLA 2KYXA 2FJBB 1PILA 1OO0B 1T3OA 4I7FA 3HFKA 4C11B 5HMZA 2L3MA 3RAQA 1UFKA 5FDLA 3TARA 3KK2B 4RZRA 2MMYA 1PG5B 4DV7F 2D9PA 5D0HA 2RQCA 2ZH8A 4DOZA 1S1XB 2ZHAA 3CIMA 4IG3A 4MFBB 4NA2A 2IBKA 1H2UX 3N9UC 1TFWA 3QPIA 1YJTA 2DISA 3BBBA 2V2VA 1VI7A 4NRTA 2EK1A 3HD2A 2VIHA 1GAOA 5D4OA 5L1KA 2H3EB 3O2IA 3TNVA 2YWFA 3N4WA 4O3NA 3PG9A 3WX4A 4ZLJA 1CJKA 2FHOB 5I42B 4DSIA 2RT3A 3IS9A 4OHVA 3DLEA 2E5HA 2WVEA 4FF4A 1Z2ZA 1CC7A 3JTPA 4GKKJ 2HGLA 2PA3A 2YKMB 2KT3A 1DQ9A 5CZVA 4V19X 4B3TJ 3UNGC 1UP1A 3GP9A 1HNXJ 4OJHA 3ISNC 4PXCA 5G0RB 1KC8T 1S76D 2YNIA 4MK8A 3HO1A 3Q0AA 1GFWB 4WXOA 1GQEA 2F65A 1HWLA 4NLUA 4DL6A 1RSCA 5K8PA 1SV5A 1FKOB 2Y3YA 3OTBA 1OQ6A 3CD5A 2IHR1 1TKXB 1CSJA 2YWEA 3CWJA 2RJZA 1AA1B 2VPZB 2B4OA 2MGZA 3GV5B 3ZFVA 2AGQA 1F1BB 1ZM4A 1HFEL 3M05A 3AJ1A 4IRKA 3T1AA 3FEZA 4M5GA 3G9CA 2BDPA 2UXDJ 4X64J 1N56A 3MMCA 1GMWA 3C2PA 2EC0A 2SXLA 5KG6A 3BH6B 3QBCA 2PSZA 2XHWA 1QVFR 2MKJA 1WHYA 2ZVIA 3DLJA 1LWXA 1W2BR 3EPGA 3CJ3A 2HZCA 2YKAA 1WOPA 4IH7A 4MJKA 5F3TA 4IKAA 3GV7B 4GO7X 5KG2A 2CPYA 4ED5A 2D69A 3FMWA 4DL0C 3PJ9A 2QGFB 1OYDA 5T7LB 3K2YA 1SPBP 4NLWA 1VR6A 2VG6B 3D9BA 5THWA 5CH7B 2W9CA 2NYIA 2A2DA 2GX8A 1S6OA 4QW9A 4Y28C 3Q8RB 1N34F 4QYZJ 2AWZA 1KN6A 2HG4A 3O44A 3ZZPA 5A6PA 1K1QA 3TJ8A 4NASA 1TKTA 2KFNA 5K8NA 3GIJA 3I56S 1VJWA 3BGFA 4AL6A 4ED8A 2AU0A 1SC6A 2N7CA 3RB6A 4J7CA 3I31A 2D41A 3QYYA 2R7VA 2B3TB 3WZ0A 1FKPB 3NY0A 4DUZJ 1S77D 2XWYA 3TOQA 5CA5A 5T41A 4LR9A 3R9LA 3BO4A 3LTOA 3KMSA 3TANA 1HQEA 3TA0A 5C24B 1SKSA 1HNWJ 3DOMB 3H4BA 3R2CJ 1NSKL 1S6PB 2QLBB 2IC3B 4WP8A 4LJMA 4O4RA 1S4FA 4IYQA 4DCOB 4OX6A 3T6JA 4YFUA 2E5JA 2Q6BA 4ED3A 2E7VA 2VHGA 2ZJPQ 1XK8A 2F8EX 3AODA 3QNWB 4DI6A 1S99A 4N56A 2UVUA 5T14A 2QTWA 2L9NA 3ULHA 4ECTA 3DOKA 1R8AA 1E6YB 1TL4A 2MGZB 3ISND 4FS2A 4AXJA 2FHMA 5DQGA 2DGTA 4PXEA 1EKSA 3VAHA 2CAJA 2BMBA 4LFAJ 1TL3B 4JOUA 3VGTA 5IFMA 3P49B 4KJIA 1D9AA 3M30B 3IRWP 4OJGA 4QWEA 1EETA 2XMUA 3V6JA 3UE2A 2XULA 2BQ3A 4K2XA 4RU9A 4HT5A 1RDRA 2ZBPA 1FRXA 3O5TB 3KK1B 5LMNF 2HWTA 2O01C 2BJDA 4OI2A 1UETA 5IC6B 5B0DA 3FCVA 2J9DA 4DR3F 4NE9C 2P5VA 4IFYA 1REVA 4DV6J 4HYKA 1NK4A 1RLCL 3IGNA 1S1WA 2CJBA 3TAMA 3ZTSA 5C7PA 3MFHA 2IAJB 4EMDA 1B0PA 1KR4A 3C6TB 2W2PP 2X3DA 4RBVA 1TKZB 3TZXA 5D6GA 5KT4A 1NB7A 1M5HA 3BKTA 2V9WA 4MKBA 7FD1A 4WFYA 5K5MA 6FD1A 2HMIA 1KQFB 4HHJA 2WOMA 4F8RA 4Q8EA 2RAQA 4WP9A 3KHHA 2VU5A 4RUCA 3H40A 2A2CA 4URGA 4DPYA 1BXNA 1U47A 4NYPA 4USKA 5IQ6A 1VQ6S 2NXEA 3MM6A 4JB8B 2P9GA 2R42A 2HFUA 4DHVA 1KD1T 4FYDA 4YN3B 1R8PA 2MSSA 2MY7A 3H0PA 4KAIA 1HHQA 4MIBA 3W3SA 2WBRA 3CJ4A 3FVYA 5IOLA 2NQPA 2MY8A 1YBUA 4IH5A 2LU1A 1D3WA 1YJUA 3OHAA 2DNYA 3D1HA 3W61A 3K5NA 3A3OB 2F3JA 3B6BA 2VQEF 4NI2A 3RG6A 1IR2A 3HSDA 3V4IA 3CJQA 1LQ9A 2VKZG 4FBTA 2XYHB 2QA4S 4XPEA 3GJRB 4ZK7M 5HBMA 1V9OA 4A8QA 3S01A 1Y0HA 1TVRB 2LVWA 4MKVA 2Z0GA 2J9EA 2HRTA 2C3YA 4OHWA 4CLTA 1EARA 4EI2A 4M5IA 1JXLA 5BXIA 4FYWB 3HSZA 5F8LA 1M5PC 1LW2B 3PVXA 1N48A 4QYRA 2CQGA 4K4TA 3CJ0A 4W90B 1MU2B 1FJEB 1RWMB 3EDQB 3BPDA 5JJBA 3AB2B 5IZHA 2Y1IA 3D1OA 4WK3A 2FJDB 1T9TA 3GU0A 1Q86T 2ZC3A 2Q3PA 4GVBA 3QQCD 4O3PA 2BEFA 4Y6IA 5HO4A 2JLGA 2R8KA 1FWPA 3L7UA 4LF9J 3OW2R 2YBVA 3DRSA 1EQ0A 3FBBA 4CTAB 5IT0A 5HROB 1MMLA 2P9EA 4PG4A 3GV8B 3FQKA 4LVOP 4TY9A 2K7KA 3NGTA 5I3UB 1FWLA 1W25A 3DRRA 3BJYA 2RILA 4DF4A 3FBEA 4J9OA 2XNQA 3M2RB 5EWGA 1F5BA 2YY3A 5CYQB 4JV0A 2OPQB 3U7JA 1YJ9S 1TV6B 4WE1A 1U45A 3H5YA 1ZZNA 2PFDA 4NYOA 3VAKA 2ZOGA 1RBOB 4NEYA 4ZN3A 1RCOB 5IV4A 3O6QA 4UW2A 3D6TB 8AT1B 7FDRA 3WC2A 2JFKA 2F40A 2R7SA 4EFAC 3EVOA 4P2XA 5A0YB 3PM9A 2VL1A 1BHNA 1Y5LB 4B9NA 4H4MB 2VG7A 1YTYA 3KXDA 3LH2S 1TUGB 1U1NA 2HEKA 2BJ9A 1IUJA 3U02A 3M32B 2ZM6J 1BMQB 4DR3J 4F2SA 1R0BG 2PE8A 3DXBA 3UD3P 1NKCA 3H59A 1FE4A 2UUTA 2IYIA 3VZHA 3UPFA 3JSMA 2UP1A 3QSIA 4OL8A 4B9UA 3B82A 5J1NA 1F60B 1WF1A 1ZZFA 3C14A 2WSEC 1TK8A 2V2ZA 1X9MA 1V3SA 3S8SA 3SI8A 4WZQA 2ZDOA 2KO1A 3PRDA 4U67Q 1YITS 2K2PA 4ZVUB 4LF6J 2WSFC 2QL7B 1NO8A 4ZLPA 2DHGA 2PD1A 5IXUA 3P45B 5GAGI 4LSNB 5B0FA 3KLGA 2UU9F 1XMQJ 4NXMF 3SFUA 2BABA 3M2VA 4LFBJ 1RWVB 3RB0A 4IFVA 3BB5A 3FSXA 3D3CJ 2K1RA 1KWMA 3F0NA 2XBPA 5LXRA 1N33F 1IKYA 3PX6A 4I68A 2QMXA 3M4XA 1U6ZA 2R7XA 1HNXF 1LWCB 1RA7A 4ANEA 2G0IA 1MN9A 3NWRA 4PRFA 1VRUA 2HFOA 4FKYA 4EBEA 3B54A 2W2OP 2W7AA 4JI8F 2IBOA 2AQ4A 2IVMA 3MHYA 4ITSA 2GA7A 1IJEB 2HQ3A 2UV8A 2XY6A 2GVDA 4KHPF 1HARA 2B0GA 1R8CA 3TA2A 1MN7A 2QL5B 4ICLB 3BBFA 3FKBA 4A47A 2C2RA 1VRQC 1FJ7A 1X60A 2OPRB 4KT0C 1CJVB 4MT1A 4PG8A 1RZMA 2BM1A 1NMEB 1W7WA 2BKPA 1ICEB 2JH3A 2RDDA 4NZ0A 3MXHP 2JEIA 3THPA 2AGOA 1L3VA 3MM9A 1SJ1A 2NUHA 3AJDA 4HI2A 2DNGA 3A8EA 3G6ES 5GAHU 1Y5NB 5J2MA 1KTVA 3ONQA 5GAEU 1AUSL 3BQ0A 5HQMA 4K59A 4J9UE 4X84A 3VAIA 4ZVPB 4XK8C 1S72S 4I2QB 3EXYA 2WONA 3GWCA 4F4ZA 1YRTA 2YX7A 2ZE2A 4P6QA 4DPWA 4ELVA 2QZ8A 3MR3A 2VA3A 2VJVA 4ED7A 2VBXA 1NKBA 1EB0A 1MNEA 1JLQA 4Z2XA 4WCEQ 1VQSA 2LDYA 1JLAB 1NAQA 3I4HX 5D3GB 1FKAF 4BCAA 2V34A 4KQZA 3NCPA 1P27B 3MCOA 3G96A 2BANA 2NSBA 2C3UA 2CFXA 3LWLA 3HHLD 1RTDA 4PUOA 1ROFA 1WOSA 4G6VB 3W64A 4RBTA 5L1IA 4DFJA 1R7IA 4LBIA 4B3OA 1N33J 4ES1A 1TL1A 2R7WA 3RB4A 4ZPAA 2FLNA 2FC9A 3DN9A 5L1JA 3OR1A 3QATA 3MM8A 1S1VB 2GQCA 4DX6A 4TY8A 1VRTB 4RNOA 2RDIA 4OHXA 2E1MC 2HNDB 4FVCA 1Q8BA 3K89A 4RJVA 5I4MA 2AYBA 4O3RA 2QEXS 2YTCA 4CH0S 5A8KA 2KI2A 2GHPA 2O5DA 2CXEA 4HH1A 1ZTTA 4ETXA 5KFJA 2DY1A 3B78A 1ZTWA 8RUCA 4I6YA 2KH9A 2AHOB 3T5JA 3QJJA 2IA0A 1QDUB 2Y0BB 3E01B 4LSLA 3BO3A 4LFCJ 1APSA 2Z2YB 4ID5B 1EQMA 1O0PA 2C2KB 4RW4A 4WBFA 1TTHB 1MROB 1D8YA 1Q5YA 3HDSA 1B7YB 4DX8H 4A8WA 3CCRS 1RT2B 4O0NA 1PC4A 4JBCA 3DRPB 4W4MA 5DRKA 3TUIC 4HTIA 3DNCA 3LGHA 4DCPB 5L1LA 1H0HB 3GIIA 2KJVA 2KXFA 3MECA 3OD2A 4OV6A 4ZVFA 3IGVA 3S7RA 2YKNA 1NBEB 3DGPA 3JAMY 4RNFA 5MAOA 4RPFA 4IO9Q 2VG5A 3BH7B 3MAAA 2P8IA 4TVAB 2EFVA 3OTDA 2JFDA 4B08A 2MQMA 1VGYA 4OYBA 3UR0A 4NXNF 1UVNA 3GFHA 3HVTB 2AJ2A 3T6BA 1AZSB 4M63A 2DRAA 2JZ5A 1S1UB 3S6EA 4ZVSB 2J8AA 3DDIA 3QFWA 4LFCF 1CJUB 3NGUA 2OSRA 2I9SA 1YZ6A 2E5GA 5D78A 2H5JB 2B7CB 2CDQA 2COLA 3EMTA 3FNNA 3US5A 5DDPC 2RKIB 3TAQA 1SC1B 1S1XA 3NL0A 2F4VJ 3OLBA 5KOXA 2KFYA 3CDBA 3FCHA 2AD9A 1KLMA 1N5YA 4DSLA 1WKLA 2MQLA 2VH7A 2RMLA 3GYXB 3HSJA 4I2PB 3AOCA 3G8SA 5I42A 5KG1A 3D67A 1CJKB 1LXJA 2HVDA 3FRZA 3OXGA 4P2FA 2ROGA 1HBUB 3M7VA 2ZVSA 3IS9B 4K2JA 2RRNA 2W2NP 2ZBIA 3DLEB 3TJ9A 2UXBF 3MD1A 1ACMB 4WYWA 3C8YA 4NLVA 4WJBA 4DX7A 2XMKA 4B3TF 3SZ2A 2YKMA 3PW7A 5I3QA 3FMBA 1G2EA 4CT9A 4RO0A 3ETOA 5G0RA 2W7PA 4EEYA 2YNIB 1PC5A 2G2ZA 4OZNA 4UT4A 3OVSA 4FXWA 3UQSA 4XIUA 1YJNS 4MAKA 3DOLA 3SCJE 3R7BB 4ZHRB 1NH7A 2RQKA 2GNKA 3Q86A 3PYDA 2XZTB 1SV5B 3HX9A 4I56A 1FKOA 4ZPCA 1MW7A 4LRFA 3G6VA 3H5UA 1TKXA 4HLBA 2ZITA 5FJ4A 2LP4A 2RHSB 1HR0J 4BBYA 2IIHA 3D28A 4O3SA 1HPZA 1ZPVA 1EKRA 4ZPBA 4DV2J 5KFLA 2B56A 3AOBA 4Q2LA 3S1TA 4GC6A 1UZDA 2BXJA 2Z2ZA 2XS7A 2QT7A 1TK5A 1EAYC 2XO7A 1K9MT 4CCHA 2GS8A 1Z2LA 3GB0A 4MIWA 4DWIA 4QU7A 4Y00A 3AOAA 3BDEA 3WHIA 1A7GE 4R8UB 4MK7A 1KDNA 2XB2D 3MCNA 4IOBA 1ZA1B 4BC7A 1IBMJ 4LF1A 1R43A 3TUJC 3BZQA 2OELA 3AB4B 1XWLA 4UUWA 4LFAF 4FYVB 2AYEA 2CPFA 4IOAQ 4Y2CA 3HXMA 3H5XA 1SL2A 2UUBJ 1FJCA 1U02A 4QR0A 4K4WA 2XZWA 4DJBA 1S59A 2WHOA 1S57A 5T7LA 5BR8J 1PO6A 2D3OR 1FRHA 5ETLA 2POKA 4QR2A 2K8GA 2VPYB 1VQLS 1P1TA 4ECXA 1SXLA 1FTRA 2YQ0A 3W66A 3W60A 4IG0A 3EICA 4DL4A 2VBYA 3CCUS 2LKZA 3PW2A 2GJFA 4KH1B 1TKTB 3HVAA 5D0EA 4A48A 1N36J 3KLVA 4ZPVR 2GVZB 4LF6F 3WIVA 3KK3B 2W4DA 3NCQA 4V1Ak 2KU7A 1NPRA 1NXIA 4PKDB 2CWKA 4I64A 3KUEA 4M5LA 1D09B 1FKPA 2FHJD 3D0HE 4NMLA 4OJ3A 4I6AA 4ZPTR 3P5BP 4JI0F 2F4FA 2IJNA 1DQAA 1H7WA 1D8ZA 4ED1A 1HQEB 1SH0A 2V94A 5C24A 4C97A 5HMXA 2HHUA 3DOMA 2NS1B 2KJWA 1CQNA 1S6PA 3I5AA 2F4VF 1PAEX 3CDUA 4GVLA 5L9XA 1RAHB 2DK2A 4I4BA 2XYGB 4CO0A 3VTIA 2HURA 3X3UA 2V63A 1CJTB 1WC1A 1XJWB 2J0XA 3M8ZA 4Y3CA 1KEKA 2CJQA 4DV4F 2E1CA 5K20B 1FXRA 1QVGR 1YJ7A 2MJNA 4LSZB 4A4JA 4X4RA 2MHNA 1T03B 1JLCA 4UQGA 2AEMA 1NNDA 2ACYA 2BV3A 1UMJA 3DRXA 3TR5A 3M30A 1PSDA 2EKYA 3DFEA 5HVGA 2E1PA 2W25A 2FD2A 1NJYA 2FZCB 4F0HA 2J0WA 4YDXA 4LIWA 2QA2A 2UVVA 2HRUA 3EX7B 3M8YA 3H42A 2WW8A 1L3TA 2V4QA 1TU0B 2QG9B 1HW8A 2LLZA 1REVB 2M52A 4AQYJ 4ZA1A 4DV0J 2HIQA 2R4FA 4DF8A 3C6TA 2HNYA 1HNZF 2JNJA 1TKZA 4DN9A 5IC4B 4K4UA 3DLLQ 3OTEA 2HMIB 3JSRA 4CWBA 2WOMB 2JSXA 2X3GA 4P75A 1WI8A 2GO8A 3OL6A 3I55S 2ASJA 1VDHA 1U1QA 1ZBTA 1MWYA 1R27B 4B17A 3HI9A 4NX9A 1SKUB 3R5GA 2E9RX 4W92B 3GIMA 1YRUA 2ZOMA 5KFWA 1K44A 1SUQA 1TL5A 2FZKB 4CO1A 1T9UA 1N32F 2HVHA 1VQ8S 3VQTA 1R8BA 3KJQB 3ZNJ1 3ILOA 2BW2A 3TEHB 3DRYA 2J6TA 4M5JA 1RUSA 2LQ9A 2CPJA 4PR6A 4CP5A 4Y0FA 4AQYF 1HBNA 4KPCA 5B0CA 4WFBQ 2UUBF 2IM0A 1U0HA 2VD3A 3PACA 2DR7A 2DD8S 4IRDA 4NI2B 2LXUA 1YWXA 2C2MB 4XO0A 1KQKA 4QIWD 3BQ1A 3NGSA 4MTPA 1T9YA 5HBMB 2Q1LA 4BWJA 4F67A 1JXEA 1TVRA 3CW2C 2HLUA 3LGMA 4DU7A 2VFRA 2CJXB 2DR5A 3TA1A 1UWAA 2EWHA 1DAXA 4WK1A 3M8SA 2CQDA 2E5LJ 3A13A 4DV7J 2HK2A 1WJ9A 4USWA 2ZH4A 1KRPA 3LPYA 4L3KA 1B0TA 4WZMA 2F8HA 1OIAA 4A8KA 4GVBB 2DH9A 2CQ3A 1VIOA 2CKWA 2YX4A 3P96A 5ETMA 5HMYA 5DG9A 1FA0A 3LWMA 3R1LA 4DR4J 1NDLA 1B64A 4DQRA 1Q4RA 3DRSB 1G4CA 1Q8IA 2X1BA 1QM9A 4OJ1A 3D6MB 5CZXA 4CTAA 3MURP 5HROA 2FVRA 4OI6A 1AUDA 2GHWA 4LF5F 3HJVA 2D3ZA 2WVBA 4F25A 3CD7A 2XY5A 1SQEA 3RUBL 3DRRB 1RKIA 2VC0A 3UN3A 2OLWA 2KDOA 1NSQA 4K4XA 3TUPA 4B3RJ 2L9WA 2YQ1A 3MM5B 4JI4J 2ZKUA 3HCXA 4KYZA 3N5FA 2NXNA 3R3TA 4FPIA 1HYSB 1NB2A 3PIOQ 3GSIA 2V8GA 3AXMA 3W65A 3M6VA 4USHA 4CLLA 4X4OA 4CH1A 2MEWA 4EO6A 1WHVA 2DCUB 3ELHA 4O3QA 2XCAA 4A8MP 2ZZNA 1WG5A 3OFEA 3I5CA 1ZM3A 4LF8F 5KOWA 3IWXA 2VG7B 2N7YA 3W62A 1F3VA 5GMEA 3HZGA 2CVIA 3HHLA 3HHNB 5B0BA 3M32A 1R6VA 3BGOP 4RBUA 1S9FA 3RR7A 2BE9B 4LQ9A 4N41A 4JYAJ 1TUWA 2DEJA 3GTYX 4PG7A 2E5LF 4U8VA 3DHXA 4KTQA 2RF2A 1KSPA 2HFSA 3SDEB 3JSMB 1S12A 1FWKA 4OV1A 1P1LA 2MSTA 4G1IA 4DFKA 2NXJA 3FK4A 1C4AA 3VR1A 1IBLF 2QA1A 2MKIA 2FJXA 3C14B 5KT7A 3G71S 1WACA 2BJ8A 3M8WA 1S5ZA 1U26A 1OS5A 1WF2A 4PWWA 1SKWA 1T95A 5CCLA 1XNRF 1J5EF 1X0FA 1M90T 3NMAA 1RT5B 2AKWB 2DNNA 3HSGA 2YWHA 3WQPA 4LSNA 5IQQA 3WIUA 4J9RA 4DL7A 3T9NA 2YKPA 4AXIA 3CO9A 1U1LA 5GAGU 1EZZB 3PJXA 4IFVB 1D1UA 2ADCA 2AZ1A 1RQ0A 2K1RB 2UXCJ 1K0VA 1HWIA 2Y8YA 5F0WA 3KOAA 1NLKL 2XMAA 2F9JA 4FN5A 5AJ3J 3G86A 2MZTA 2XLKA 1X4EA 2JWNA 3CCVS 3MPUB 1LWCA 4HHUA 2HHWA 1NZAA 3Q8SB 1LV5A 3F41A 1SIWB 2JOQA 4WP3A 4C2MA 1SH2A 1F0XA 1N88A 1LEOA 2EFOA 3MEKA 5DLGA 3T1YF 4DV4J 2JLFA 3P6YC 2RB7A 2F5GA 5HJYA 1BQNA 3UDEA 1SC4B 1AB8A 4I69A 4IR1A 2MQNA 2F7VA 2GVDB 2VDHA 4NZ7A 2XMVA 3A3NB 5DM6Q 4H4KC 2KM8C 4PXDA 5JMNA 3D2WA 1RAFB 5KFVA 3RTVA 5M2UA 3L3CA 1C4CA 3LPEA 2OPRA 5C42B 3DLHA 1CJVA 2V5HG 2DBBA 3QWUA 3Q8QB 1SJ4P 1RHUB 1WEYA 2GAGC 3EZOA 2CZ4A 2QV6A 2RSQA 3SXLA 1GH8A 5LJ3Y 3PO4A 1MLAA 1IR1A 2D1CA 2ZBQA 4ANDA 4CLZA 5LJ5Y 5DJBA 2RS2A 2OD4A 1CG2A 2HWIA 3PR4A 1FEHA 1WKKA 3R5DA 5FLXY 3W2VA 1KLNA 4U7UD 4U7CA 3MUTP 3J80U 1Q7LB 1FRIA 4JI4F 3MCMA 1XNRJ 5KFSA 2M3DA 3PR5B 2KKHA 2J0QD 2MPUA 2VQFJ 1JQGA 3PKMA 3CJSA 1JLQB 3TVZA 3PIPQ 3VAFA 2AJQA 1KKHA 5A8WA 1KOOA 2XEXA 1WELA 2AX1A 5D3GA 1FT8A 4KHMA 2W8KA 2KHCA 3T41A 2UXDF 4NLTA 4HACB 4AUKA 5KAKA 1L3KA 1RTDB 2BANB 3J7Z5 1FK9A 4RNNA 2VPWB 1X0PA 4C8YA 2DJWA 4N8NA 4WU3A 3G82B 1TL1B 5KG4A 4JYAF 4C0HA 2E1AA 2HQIA 2I0XA 5KFGA 1U7LA 2ZH9A 1S1VA 3BSOA 3CDAA 4TY8B 3CNQP 2DNMA 2FVSA 2YWKA 2HZAA 4TLQA 4CZCA 5C5JA 3T5LA 2FLPA 5JVGQ 4CLFA 5A8KB 4JI2F 4ZVEA 3J81j 1M5OC 1BWVA 4ZPDA 2NYHA 4CYUA 1NK0A 5EWFA 4ID8A 4ALZA 1SJFA 1I3OB 1ZPWX 1JNZB 3NOGA 3ZTQA 3E01A 3TZWA 1QAJA 4ZS6A 4PWDB 2ZJQQ 4TXSA 3V6DA 5EN1A 4ID5A 1Q81T 2A3JA 2CQHA 1JK9B 3UFCX 3G8TA 3WDOA 3CD6S 3QRRA 1GEHA 2E7WA 4F3QA 1G6BA 1NJZA 4Z37A 2WB4A 5LMUF 5JVHQ 4E98A 1LXNA 3MUVP 1S79A 2BKNA 1Y9OA 3D3BJ 2QSWA 4CRJA 1RI7A 2ZFHA 1I94F 4A8FA 3D6FB 1FNXH 2JEFA 2YKNB 3L4BC 3ILLA 2E9TA 3R2DJ 3F73A 1RAIB 2V8VA 2A6MA 3HP6A 3IAM9 3CCZA 4PCQA 1GX5A 2YPZA 1IQZA 2YNGB 3NBPA 4NRUA 1AROP 1H72C 1WEZA 4OZJA 1S1UA 3M6XA 4ZVTB 2A1BA 2ABYA 2HRYA 2ZJRQ 1Q78A 1CJUA 1SJRA 2GC8A 2GV1A 2ZM6F 3PW4A 1VFJA 3N6NA 1R31A 4YP3A 5H9EK 1FVQA 2CPEA 2ZKTA 2RKIA 3NAHA 1N0VC 1RCXB 2LEPA 3QWPA 4WU2A 3SBMA 4LBHA 2HKEA 1OY9A 2BE2B 4HEA9 4MMOA 4OZ3A 1KLMB 1RWWB 5C25B 3IR5B 4NEZA 2XM3A 1N5YB 3ILJA 2FLLA 4I2PA 3DLBA 4K0KJ 2IFXA 3V5RA 4ZMMA 4LT6A 4MK9A 3NLCA 5KG0A 1ZH5A 1IM6A 3CIZA 2CQIA 1T9VA 1P9QC 1WF0A 1WG4A 1HBUA 1EJ7L 4Q0BB 3CC2S 3BN7A 1NDPA 2CZ9A 5M2RA 4N7TA 2O67A 3NS5A 5HJXA 4ZVOB 4PXBA 1N6QB 4JI7J 4R0JA 2GMLA 3HULA 4F02A 1T3NA 4N5SA 2W9BB 3I32A 1N4LA 4DPOA 4QYZK 3PRVA 2OPPB 3EGNA 2LQBA 1NK9A 2H9ZA 2ZBCA 2AJ0A 1BUXA 3BM7A 3LP2A 1G3OA 4J90A 4PEOA 4CM0A 4DN0A 1DY3A 5CAAA 3DOLB 2RU3A 3KHRA 2ZC4A 5J1EB 5D15A 2VOOA 1XIQA 4ZHRA 4R25A 1FXDA 2GQ2A 3CCWA 3W5XA 4PG6A 3HLUA 1J2VA 2DXFA 4C0BA 4HKQA 4FNHA 5LSLA 1KHWA 4F26A 2K06A 1HPZB 2QLFB 5J2QA 1NSAA 5D4NA 1R0CB 4ERDA 1DJ0A 1QY7A 4NLOA 4CLWA 5KT5A 4X4PA 3OSNA 2XC9A 4DLGA 4LRAA 4X4UA 3RGIA 5FD1A 1OYEA 4X64F 2HPUA 3N0VA 4CNYA 1Y00A 4KHRA 4O4GB 1KFDA 1QUVA 2DEIA 4HR2A 5GMDA 4CT8A 2FZGB 5KG5A 4NYZA 1WC6A 3KDOA 2W4PA 2MZQA 4KO0B 4OZ0A 3M2UB 1FDAA 4IDKB 4YR2A 4I6WA 3V6HA 1SQFA 3AAWB 4P9SA 4Y34A 4Z7YA 3MR6A 2JDJA 3SEOA 2MJUA 2R2TA 3VAMA 2HHSA 4ES2A 1OY8A 3IG1B 1UW9A 1RHJB 3ENAA 3LAMA 4K8RA 4QIEA 3RRKA 4GO5X 2ZNZA 4PABA 3KLFA 1C0UA 3MPWA 3F56A 3SYZA 2GW8A 1YIJS 1RWXB 5DO2A 4WFZA 1X4FA 2OSQA 4QW8A 3CB4A 4IG0B 4RUAA 1WOOA 2Y1LB 4D3GA 2ASYA 3I87A 2C3PA 4DQQA 1WI6A 3PZPA 5CYJA 4JV1A 3KLIB 1FFWB 4KY3A 2GFFA 1TKDA 4XDCA 2GVZA 3ZNUA 2MHEA 4NA3A 5KFRA 3KK3A 4AL5A 1KVKA 1JLBA 2JHEA 2RVJA 3AH6A 1Q8LA 3HHKA 2KM8B 5KFKA 3LA0A 2GIFA 3KHLA 3SV4A 4PWDA 1XERA 5F8NA 2DIUA 1TMMA 2LQ5A 4KC5A 1RT3A 3Q8YA 3T5HA 1XC9A 1F5CA 4WFXA 3I4PA 5DZ7A 2HHHJ 2MZSA 2MKCA 4EBDA 4DR7F 1RADB 2WBMA 3OBIA 2C1EB 4U9RA 3NXZA 4ZP7A 1O6XA 2LQJA 3W7BA 2DGXA 4KV8B 1HI1A 4YY3J 1Q5VA 1WC4A 1CJTA 5E5NA 4B9MA 3QT7A 4WPAA 3IN5A 2MQOA 1X5OA 4RL1A 1UEVA 3E51A 2B5JB 1T03A 1L3UA 1PJ6A 4DPUA 3HMJG 1JLCB 2JEJA 2X1AA 2AEJA 1H38A 1PGZA 1CEZA 5KFMA 2NLWA 2YWWA 2BX6A 2ALZA 3UR3C 3TX8A 1WC3A 2BYCA 4Y2AA 3CCJS 2XNRA 1KFSA 1U8SA 3TZZA 3FEYB 1YRXA 1UWBA 2P6TA 2L41A 1VC0A 2B6AA 3DM2A 1YQHA 3BYPA 3Q8UA 4YQWA 4DSKA 2V9KA 4ZOSA 1HNWF 1HBMB 4XPCA 2JC0A 2C2EA 1K73T 2HNZB 5F8GA 3J7AN 1RT6A 3ITHB 3K8WA 1CULB 4FNIA 1WKJA 2MKKA 1S6UA 1LK7A 2HNYB 3AXKA 1HLWA 3SCIE 4ZLLA 2DPIA 3RAMA 3HJFA 4KSEB 1IBCB 3CVKA 3E3XA 3HZEA 1SL1A 4F3OA 2ZHOA 4OX8A 5KFHA 4HL9A 1TFYA 1RK8A 1U2CA 3EYZA 1R3NA 3LAKA 2H5EA 3OJSA 5DDQC 1QAYA 1ZM2A 2M7SA 5L46A 2YH1A 5I3PA 1SUQB 4U8YA 2QMWA 5ADZA 2RQMA 3RRGA 2ALYB 3I0RB 5CYMB 4CQ1A 3RRHA 2ATLA 3MUMP 2ERRA 3MEEA 5KFPA 1H3DA 3QIDA 1XNQJ 2LU2A 1HIYA 1HBNB 1NEEA 2CPZA 5SUHA 1U1MA 3D0GE 2EFNA 4YB5A 4X62J 3A3PB 1U0HB 5CHCB 2B9EA 1YBAA 2X1GA 3PX0A 3SQGB 3OT9A 2OUGA 4RW8A 3Q22A 1GXUA 2E1RA 1XN9A 3D5MA 3HF5A 4WXWA 1HW9A 4DL3A 1FJGF 1Z1ZA 3G6XA 2FIUA 4QWDA 2V8PA 2EEYA 1S6QA 2NSCA 3LP1A 1GXLA 2H4WB 1XEZA 2RE1A 4AYBD 5B09A 4DV0F 3A12A 3W9HA 2DXEA 2HGNA 4ZCIA 4DSEA 1NZ8A 3IC1A 3QLHB 2JC1A 3LQVA 5ETTA 2APOA 3X1LB 1SKRA 3UD5A 3OSPA 1ZAVA 3CDEA 5KFIA 2R7TA 4EZ9A 1LOUA 2C3MA 3OL9A 4QCLA 3IAS9 4L3NA 2M0GB 3HK2A 4X4VA 2B51A 4L74A 1VISA 2K3IA 3G2XA 2OI2A 3VV2B 2QSFA 2HYIB 4B3SF 4X4NA 2IRYA 4IUFA 2QLWA 4NLDA 1WSRA 2HAFA 2R8GA 2AX0A 2OEJA 1AYEA 2V2QA 4QWBA 3ZZYA 4B9SA 3J80Y 2H5IB 3BN4A 1XMOF 1DQ8A 3MWBA 2J7UA 3CF5Q 4UZBA 2HBQB 4JV5F 2DYAA 4E0DA 2OKQA 2YKOA 3THTA 3NMRA 1S4EA 1WHWA 1X31C 3NAIA 1UVLA 3CEDA 1S7IA 1C1CB 4RNHA 3MMAB 2FGOA 1S9EB 2GHVC 3L9ZA 2DGSA 2W2QP 3LGNA 3RBXA 3UDLA 1X9WA 4NCAA 2M5YA 2R7RA 4CM2A 2O66A 4KGXB 3MM5A 3C16A 2W4CA 1I1GA 3LP0A 2KVQE 1YJWS 4NLGA 4QQBA 1HYSA 1VJQA 2KG0A 4PG5A 1WC0A 3RU0A 3N6LA 3SQOP 4ZKAA 1MWZA 2KXNB 1OQ3A 1PBAA 1VBKA 2HFVA 2ZH5A 1CPZA 1RABB 2CNKB 3ZZRA 1RKJA 3A4TA 3EGWB 5FLXU 4ECVA 5L8RC 3GR1A 4OYPA 2PIIA 3QFHA 3PXGa 1HL6A 5SZTA 2PN6A 1FRKA 3VQSA 3MR5A 3HHLB 2EW9A 4BS2A 4C8KA 3E2EA 3K58A 4CO3A 4F4KA 1T9WA 2DNPA 2XMJA 5E3QA 3TVKA 1UW4A 4EBCA 4H54A 2RF2B 5AE3A 3SDEA 5J2PA 3CO0P 1JX4A 1N5QA 3I82A 4C98A 3D68A 2VICA 2XY7A 1NK8A 3FFIA 2Z2MA 4OHZA 4WFNQ 4FPRA 4NCBA 1VS3A 2MDAA 3W9JA 1MMDA 3N79A 2N3OA 3WBZA 5H9FK 4ZCMA 4KE5A 3MAQA 4A46A 4M5KA 2MTLA 1F6TA 3GR0A 5HL7Q 2Z4PA 4OYOA 2CIMA 4RW6B 3CTRA 4PAAA 1KBRA 3LANA 1RT5A 1LKZA 2DGVA 4F36A 4IQMA 4CH7A 2VA2A 4YHHJ 5KFCA 1SJQA 1UZHA 3UCZP 1HI0P 2KZMA 4JI1J 5KFAA 2Y9HA 3PFEA 2CA9A 2WVFA 2VZ9A 4NPOA 1MWQA 1JLFA 2ZWOA 3ZZTA 2UXCF 1JNRB 2W01A 3I96A 4L76A 1TQLA 2PI5A 2ZBRA 5F8IA 3H2VE 2QE5A 2CPDA 2BQRA 3W2WB 4RUHA 4RW9B 3MEDB 1WD6A 4G1PA 4URQU 4UZCA 4ZDNA 3P5TL 3AQPA 1BQNB 4LF2A 4U7UK 2AV5A 1MG7A 1Q16B 3MD3A 1JLEB 4TNOA 4C3KA 3SMZA 4ZIVA 4DR2F 1NJWA 5HVFA 3UVJA 3FZBA 3PKYA 1PIEA 3PYFA 2MKSA 3NNHA 4HVZA 1IKWB 3M8QB 2G4BA 5C42A 3I0SB 5DS7A 4USTA 2NREA 1IBKF 5KFQA 1VIXA 5ETQA 3PHEA 4L73A 4KFBA 5K14B 1U1KA 3PEJA 1PYOB 3GILA 2XMMA 3A8IA 4ECUA 1WSVA 2JRSA 4P72A 2A10A 1UFWA 1TK0A 4UTGA 2C2NA 4N47A 3VF0B 3W2VB 4GMKA 3VCDA 2DO4A 4I1TA 3U1LA 3TAPA 2P6SA 1TZ0A 2V50A 5F8HA 4TYAA 5HLFA 1SB6A 2UUCJ 2F8MA 3FBCA 2C2OB 4ETZA 2BRKA 4ZLNA 3P4UB 3OFFA 3J7YU 2RDJA 1U6BA 1Q79A 1UJ4A 3KTQA 1UPPA 3EUNA 3MM7B 5A8WB 4JI1F 1NHUA 3T19A 3G8QA 3L95X 3RZAA 4ILMA 3QZ8A 3HFZB 2IJRA 3BGUA 3GONA 4KGZB 4HACA 3WX8A 5LMNJ 3K5OA 1LWEA 1FK9B 5D4LA 3OVAA 3J81Y 4EK2A 2MB0B 1VQNS 4DR5J 4ZP8A 3MEGB 2IRXA 3G82A 1X4AA 1FRLA 1LFPA 2B43A 1IVZA 2E9ZA 1TP7A 3R6GB 3RW6A 3M8RA 1NJXA 1CLFA 2ZD1B 1BE4A 2QN6B 3OFGA 4KRWA 4PYAA 3H8YA 5HSPA 1NHVA 3QT6A 1UVJA 1ZA2B 1RWKB 3GFZA 4KH0B 4CYUB 4OI0A 4C8ZA 3VVTA 2VODA 4B02A 4G3IA 1N32J 3WC0A 3BF4A 2C3OA 2LFVA 3PFOA 1ZS6A 5KFEA 1FERA 1ZAWA 3ENWA 1URRA 2K7JA 3V6DB 1HHTP 5KG7A 1W2IA 2DGOA 2YNFB 2FVPA 3IM8A 4MKAA 1U49A 5CD4H 2EFQA 2M8HA 2LEBA 3QRQA 4DZDA 2B9YA 3MR7A 2BE7D 3CCQS 3K5PA 2J8SA 1HNZJ 1RLDA 4DR6J 1NJIT 3EWGA 3QGPA 1IQTA 2KT5A 3IO1A 3NKYA 4OZ2A 3W1YC 2W8LA 4ZVRB 4YOEA 2ATCB 3ZTOA 4CO5A 3MCSA 2MZRA 3GMGA 4J9QA 2YNGA 4R5PB 2MQ8A 3NBPB 1T8EA 3ENQA 3GJQB 2NUUG 2FPHX 5EWEA 3JYTB 3R5CA 1VQMS 4RLEA 1RAJA 9ATCB 1U1OA 2CPHA 4DSJA 4ZVHA 3QJLA 1SI9A 1XR6A 2J6UA 4TLRA 4ZJQA 4C3MA 3BBCA 2GMJA 2R8IA 2BE2A 2EVZA 2OMOA 5C25A 5KT3A 2Y0SD 3EPIA 2X7IA 2OTLS 4DUYJ 3DXSX 3PW0A 1Q8KA 1OMSA 4Q0BA 1KVIA 4DUZF 1VQ4S 5LOQA 2B4PA 2PGCA 3TYTA 1JJHA 1N5VA 1Y3KA 2DNZA 3N6MA 5E3PA 5B7WA 1N6QA 2CJKA 3R8YA 2W9BA 4GKKF 4QPTA 4ED4A 3BGLA 4EU0A 1UL3A 2OPPA 2M4MA 1JIHA
chains in the Genus database with same CATH topology
3EJMA 2HVEA 1K44A 1NSPA 1BUXA 1NDKA 5CAAA 1HHQA 5IOLA 1XIQA 3EE3A 4CP5A 3Q86A 1HIYA 1UCNA 4KPCA 1MN7A 4C6AA 3BBFA 3FKBA 1NDCA 3B6BA 1NHKL 3VGVA 4ENOA 2DXFA 2B8QA 1W7WA 3NGSA 1EHWA 4ANDA 1B4SA 4W98A 1WKKA 2DXEA 4UOHA 5BXIA 1U8WA 3BH6B 3FBCA 4HR2A 3ZTRA 3G2XA 1LWXA 3JS9A 1KDNA 3VVUA 3EM1A 2BEFA 3ENAA 1NDLA 3PJ9A 3L7UA 1S59A 3WX8A 1S57A 1XQIA 4UOFA 3FBBA 2DYAA 4EK2A 2B8PA 4UOGA 3EICA 3NGTA 4FKXA 1NSQA 3ETMA 3FBEA 1BE4A 3Q89A 1NB2A 3Q8VA 2CWKA 3VVTA 2DY9A 1F3FA 3Q8YA 3ZTQA 3R9LA 1ZS6A 3ELHA 3FBFA 4F4AA 3EVOA 3EVMA 4WBFA 4ANCA 3Q83A 1BHNA 1NSKL 3GPAA 4O0NA 1PAEX 4S0MA 3EVWA 1VYAA 1JXVA 2HURA 4DI6A 2DXDA 3VGSA 3BH7B 1B99A 3ZTOA 3NGRA 2AZ3A 2NCKL 1PKUA 3VGTA 3ZTPA 2BX6A 3DDIA 1NPKA 1NUEA 3NGUA 1S5ZA 1NCLA 3VGUA 3EMTA 1F6TA 3Q8UA 3BBCA 3FCWA 3FC9A 4DUTA 3BBBA 4F36A 3FCVA 1WKLA 3ZTSA 5C7PA 1WKJA 2ZUAA 2HVDA 2AZ1A 1HLWA 1NDPA 4DZ6A 1NLKL 3MPDA 5CABA 2VU5A 3DKDA 4ANEA 1MN9A 3GP9A 4FKYA 1LEOA 3PRVA 3B54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJM A;  2HVE A;  1K44 A;  1NSP A;  1BUX A;  1NDK A;  5CAA A;  1HHQ A;  5IOL A;  1XIQ A;  3EE3 A;  4CP5 A;  3Q86 A;  1HIY A;  1UCN A;  4KPC A;  1MN7 A;  4C6A A;  3BBF A;  3FKB A;  1NDC A;  3B6B A;  1NHK L;  3VGV A;  4ENO A;  2DXF A;  2B8Q A;  1W7W A;  3NGS A;  1EHW A;  4AND A;  1B4S A;  4W98 A;  1WKK A;  2DXE A;  4UOH A;  5BXI A;  1U8W A;  3BH6 B;  3FBC A;  4HR2 A;  3ZTR A;  3G2X A;  1LWX A;  3JS9 A;  1KDN A;  3VVU A;  3EM1 A;  2BEF A;  3ENA A;  1NDL A;  3PJ9 A;  3L7U A;  1S59 A;  3WX8 A;  1S57 A;  1XQI A;  4UOF A;  3FBB A;  2DYA A;  4EK2 A;  2B8P A;  4UOG A;  3EIC A;  3NGT A;  4FKX A;  1NSQ A;  3ETM A;  3FBE A;  1BE4 A;  3Q89 A;  1NB2 A;  3Q8V A;  2CWK A;  3VVT A;  2DY9 A;  1F3F A;  3Q8Y A;  3ZTQ A;  3R9L A;  1ZS6 A;  3ELH A;  3FBF A;  4F4A A;  3EVO A;  3EVM A;  4WBF A;  4ANC A;  3Q83 A;  1BHN A;  1NSK L;  3GPA A;  4O0N A;  1PAE X;  4S0M A;  3EVW A;  1VYA A;  1JXV A;  2HUR A;  4DI6 A;  2DXD A;  3VGS A;  3BH7 B;  1B99 A;  3ZTO A;  3NGR A;  2AZ3 A;  2NCK L;  1PKU A;  3VGT A;  3ZTP A;  2BX6 A;  3DDI A;  1NPK A;  1NUE A;  3NGU A;  1S5Z A;  1NCL A;  3VGU A;  3EMT A;  1F6T A;  3Q8U A;  3BBC A;  3FCW A;  3FC9 A;  4DUT A;  3BBB A;  4F36 A;  3FCV A;  1WKL A;  3ZTS A;  5C7P A;  1WKJ A;  2ZUA A;  2HVD A;  2AZ1 A;  1HLW A;  1NDP A;  4DZ6 A;  1NLK L;  3MPD A;  5CAB A;  2VU5 A;  3DKD A;  4ANE A;  1MN9 A;  3GP9 A;  4FKY A;  1LEO A;  3PRV A;  3B54 A; 
#chains in the Genus database with same CATH topology
 3MFI A;  1QUP A;  5F9L A;  2ZEJ A;  1LK5 A;  2IM1 A;  2V4J A;  3LP2 B;  3U27 A;  3V2U C;  5DET A;  1SJ3 P;  5J1E A;  5E3A A;  2DB1 A;  2IYG A;  3MTJ A;  4M5H A;  2Z2L A;  5AE2 A;  4ZIT A;  4KBI A;  5B0A A;  1UCN A;  2OML A;  4USM A;  3TW0 A;  4DBQ A;  5K8O A;  1TEL A;  4NXN J;  2YPY A;  1XMO J;  4F0K A;  4F4Y A;  1S9G A;  4M95 A;  1U2F A;  2BM0 A;  2DHA A;  4OQJ A;  5KFX A;  3K59 A;  5J2Q B;  1YKW A;  2AP6 A;  4OZ1 A;  1DHM A;  2MLZ A;  4LFB F;  5DQH A;  2VJU A;  3FJ2 A;  4KKO A;  1NK7 A;  1SVD A;  4IH6 A;  2ZZM A;  4RWW A;  2MLX A;  4IRC A;  4X66 F;  2HS4 A;  2FTR A;  4O4G A;  1DLO A;  4QR1 A;  1Y5I B;  2WVD A;  1C1B B;  4B9L A;  1VMB A;  3DDK A;  3PNI A;  1SCJ B;  3M2U A;  4IDK A;  4KO0 A;  3EM1 A;  4PWU A;  3W5Y A;  3CCL S;  3I9V 9;  5FII A;  2BOA A;  1B0V A;  1J27 A;  4NOH A;  5ETR A;  5F0U A;  3A8J A;  2F1F A;  4RW7 B;  4DV6 F;  3CJ5 A;  2HGM A;  1Z4U A;  2CNN B;  3AD9 C;  3IG1 A;  4O23 A;  4OFZ A;  5DDO C;  1I6J A;  4CO4 A;  3KLF B;  2L48 A;  1C0U B;  2VFU A;  4LRB A;  4E2F B;  1XNQ F;  1QJH A;  2D7S A;  1YHQ S;  4ILR A;  3CCS S;  2U1A A;  1RBA A;  4M8L A;  3DHW C;  1RHK B;  2LDI A;  4TU8 A;  2VAS A;  2EPI A;  4OYI A;  1HR0 F;  2DVI A;  3O8W A;  4JI5 F;  4QU6 A;  4NLS A;  2C2Z B;  4NZ6 A;  1HKA A;  3HKZ D;  2HLT A;  1GXT A;  3GSD A;  4TKT A;  2N82 B;  3I9Z A;  3KLI A;  2LEA A;  5GAH I;  3QZ7 A;  4DR4 F;  4ELU A;  3EZU A;  2I6W A;  2LA6 A;  1JLB B;  3R5J B;  1S49 A;  1X5T A;  2CWX A;  2GJ2 A;  2NPI A;  5HAN A;  1FVS A;  4Q44 A;  2IMW P;  1WC5 A;  4KGM A;  1KQG B;  3R1H A;  1L3S A;  3D6H B;  1CVJ A;  4F4X A;  2ZH2 A;  1RT3 B;  2R2U A;  2XMW A;  1WDD A;  2XHC A;  5KTQ A;  2VQE J;  2HFZ A;  1R0A B;  2E5I A;  3FGV A;  1N5T A;  2QRR A;  2AEF A;  2XYP B;  4OLO A;  2OTJ S;  4S0M A;  1V5I B;  3EVW A;  1SH3 A;  3HHE A;  2FY1 A;  4KV8 A;  5G4D A;  4QIV A;  2CG4 A;  3OXF A;  3VAG A;  2DGU A;  2VKR A;  3OTO F;  1IJF B;  5KFF A;  4YDD B;  2GJI A;  3AJ2 A;  4JI2 J;  4U96 A;  4L75 A;  2B5J A;  1OSD A;  2ZH3 A;  1X8D A;  3GFX A;  1VQ9 S;  2IDL A;  4M1K A;  5AJ3 F;  3O1L A;  5KFO A;  1HNV B;  3TQ1 A;  3OVB A;  4QIG A;  5BYS A;  3KMQ A;  2CQ4 A;  4FZV A;  1YZ7 A;  3T3F A;  4X65 J;  2R2R A;  3CT9 A;  5EX3 A;  2RH3 A;  2DNK A;  3CCM S;  3TO8 A;  1B7F A;  1GMU A;  1UWB B;  1K8A T;  2B6A B;  3DM2 B;  3OR2 A;  4AD6 A;  2A18 A;  3IMQ J;  4Y2I A;  3D54 A;  1HBM A;  1YK9 A;  3TX0 A;  4HH0 A;  1NPP A;  5AE1 A;  4P2S A;  2HNZ A;  4Z7C A;  4A8S A;  5DLF A;  5AXL A;  1RT6 B;  3ITH A;  3M1V B;  3CJ8 A;  4DV5 F;  2YKQ A;  1CUL A;  1F2G A;  2KB2 A;  1LW0 A;  2ZUA A;  2AGP A;  4PZV A;  3KYL A;  4CLK A;  4FS1 A;  3OFH A;  2G1H A;  3PYG A;  5K8M A;  2UUA J;  4Q8F A;  2DNO A;  2J9D E;  3D4J A;  5J1P A;  5CAB A;  1FE0 A;  1M1G A;  4MIA A;  3DKD A;  3JQM A;  3ZZU A;  2DRB A;  2IY5 B;  1N0U A;  2BRL A;  1Y3J A;  4K4S A;  3ZZ0 A;  1VLO A;  4FF1 A;  2HVE A;  4ZCL A;  4ECR A;  1QE1 A;  1P9Y A;  2VQF F;  2BJE A;  2D3U A;  2RNE A;  3I0R A;  5CYM A;  1AXQ A;  4KB7 A;  2M70 A;  4MKY A;  1RHQ B;  1KTQ A;  1RAO A;  3IXQ A;  3MEE B;  2W7O A;  2ACM A;  3R5B A;  1HBO B;  4LR7 A;  1WEX A;  2XSF A;  1YDL A;  1IKX A;  1E6V B;  3GE9 A;  4LF4 J;  3M8P B;  4DR7 J;  4OX9 J;  3KDN A;  2FQQ B;  1A6L A;  4ENO A;  3SQG A;  1EP4 B;  1UAW A;  3H90 A;  3ILI A;  3E8O A;  4P71 A;  4RW8 B;  3RYL A;  3SIP B;  4QBU A;  5H9E J;  2GIR A;  2BZ2 A;  1R8H A;  2EFG A;  3DU5 A;  3DMJ B;  4B9V A;  1EHW A;  1S6Q B;  1NU4 A;  1RWN B;  3LP1 B;  2KTQ A;  4A8Y A;  1XMB A;  1YJR A;  3CCT A;  3D66 A;  3V6K A;  1JKH B;  3NWG A;  3QLH A;  1C0T A;  4M5N A;  1H2V Z;  3BRE A;  1U8W A;  4DQS A;  2OH2 A;  7AT1 B;  4J5O A;  3V81 A;  3GIR A;  3NS6 A;  2CPX A;  3ZTR A;  3J7Z T;  2XQC A;  2WK4 A;  2HZV A;  2QL9 B;  2OPS A;  1YJV A;  1Q53 A;  2HHP A;  3IRX A;  4G65 A;  3NCR A;  5ITH A;  3DI6 A;  2L9D A;  1R6Y A;  4X65 F;  1GTE A;  4Y65 A;  3OL7 A;  4RR5 A;  1Y7P A;  4DR1 J;  4ES3 A;  4X62 F;  2KL8 A;  2Q79 A;  4P73 A;  2LXF A;  4B3M F;  1XQI A;  2I38 A;  4JI6 J;  1JLG B;  2UUA F;  2RHQ B;  3OLA A;  4TQS A;  2CQP A;  2DTJ A;  2CQ2 A;  3FDS A;  4BHQ A;  5E41 A;  1X9S A;  4CLU A;  2QYC A;  2YVS A;  3RBD A;  5GAD U;  4ECW A;  1C1C A;  3BKU A;  3C6U B;  3DCA A;  1HWJ A;  1S9E A;  1DBD A;  3KJF B;  3LUY A;  3MMA A;  4OYZ A;  4Q2M A;  3FSI A;  1IBL J;  1FRJ A;  2R8H A;  2OHD A;  3HT0 A;  1S0M A;  2JEG A;  1OPZ A;  5ETP A;  3C16 B;  4N76 A;  1RHM B;  3LP0 B;  2B4U A;  4NCG A;  1YVF A;  4DFP A;  1NRK A;  1RBL A;  2AYM A;  3TEG A;  2B9X A;  1HNI B;  1NM2 A;  1WOR A;  2W2M P;  3NS7 B;  1D0E A;  4KIA A;  4I0W A;  3TJA A;  4JI3 J;  4NMX A;  1VHF A;  5DZ6 A;  2MLY A;  4X66 J;  4FF2 A;  3NNA A;  4JV5 J;  1T9X A;  2CZV C;  3EVM A;  4G1Q B;  1C2P A;  3JXO A;  4BWM A;  3IBF B;  1FO1 A;  3VAL A;  3BSN A;  1FDD A;  2A0F B;  2DNL A;  1S1T A;  3DU6 A;  3N01 A;  4Q43 A;  2BOP A;  2HS3 A;  4LRD A;  3M6W A;  2RRB A;  4DV2 F;  3VZI A;  2D74 B;  5B0E A;  1SL0 A;  1B70 B;  2Z56 B;  3PX4 A;  2V68 A;  1RAG B;  2B4V A;  5L9N A;  5K9F A;  2DXD A;  5C2G A;  2Q66 A;  1IBK J;  2NPF A;  2C42 A;  4EO8 A;  3NGR A;  3MMB A;  2BUN A;  5LSR A;  1VK3 A;  5J2P B;  4DSF A;  2AZ3 A;  3BR8 A;  5CCM A;  2PFF B;  3FUY A;  2R8J A;  3FFI B;  9RUB A;  4TU9 A;  1U4B A;  3BSA A;  2HHX A;  2XG8 A;  2VPX B;  4RKU C;  4KHP J;  1NPK A;  4E8U A;  4A8X A;  3K8V A;  2YNH A;  1H6K X;  5ETV A;  1FEE A;  1JJC B;  1NCL A;  4YY3 F;  2OAU A;  4JI0 J;  2RQ4 A;  4F7V A;  3BGR B;  1JWW A;  1FX4 A;  2KN4 A;  2QIF A;  4RW6 A;  4AL7 A;  1VHI A;  2DRD A;  3FC9 A;  1H98 A;  4DUT A;  4J9P A;  2DNQ A;  4WTO B;  1J5O B;  4UOC A;  3R7S B;  1RHR B;  1RWP B;  2XI3 A;  4JI5 J;  1JJ4 A;  2VBW A;  4GKJ F;  2EI5 A;  2DPJ A;  2BR0 A;  1JLF B;  1T02 A;  2O1P A;  5GAE I;  3GYG A;  4EUV A;  4DUY F;  4FXD A;  1RAC B;  1DTQ A;  1RT7 B;  3KLH A;  1PYS B;  1TR0 A;  2DT9 A;  2JVO A;  3Q2S C;  2GQQ A;  3RJM B;  4DZ6 A;  3CUL A;  5KFN A;  3QT5 A;  1RTJ B;  1GTH A;  3R27 A;  5J2N B;  3KJV A;  1FDN A;  4ECZ A;  3BYR A;  1X5S A;  2EFP A;  2YQ3 A;  3IFE A;  2BA9 A;  2E66 A;  4J91 A;  4KGK A;  4RW9 A;  3W2W A;  2KG1 A;  3MED A;  1IXK A;  3CGI A;  5A8R B;  4BC9 A;  3KG0 A;  5IWA J;  1GX6 A;  1JLE A;  2HIY A;  4H4O A;  5CXT A;  3L7P A;  3UVJ B;  1RTZ A;  5AXN A;  3DLG B;  1QSY A;  3IBC B;  4OIX A;  1IKW A;  3M8Q A;  4CO2 A;  3I0S A;  4K5S A;  2B8Q A;  1ZYQ A;  2N3L A;  4DL2 A;  3Q23 A;  1X4H A;  4CDI A;  5AT1 B;  2EK6 A;  2HHT A;  4KFB B;  5K14 A;  2G13 A;  1WNE A;  1G7C B;  1RB0 A;  2V6A A;  6FDR A;  3GG1 A;  2HQF A;  4W98 A;  1UEK A;  4ZIW A;  2XS5 A;  1FD8 A;  2DHS A;  2JVR A;  4M5M A;  2G0J A;  4XAK A;  5D0R A;  4WF9 Q;  3H2L A;  1N54 B;  3B8H A;  5HLF B;  3P3D A;  2KYZ A;  4ZVQ B;  5KFD A;  3DYA A;  2G2O A;  2IPO B;  2PDA A;  3BSC A;  4PPZ A;  3KNG A;  3C46 A;  1XR7 A;  1HMV B;  3BEG B;  3H7H B;  3QO9 B;  1RYR A;  2HW3 A;  3MPV A;  3M9O B;  3PEH A;  3MM7 A;  3K5M A;  3CXC R;  3J7Y I;  3K5L A;  4C4W A;  2RU9 A;  3GJS B;  1PJ7 A;  3TUZ C;  2GMH A;  2FC8 A;  1JMT A;  1PBU A;  2NXU A;  4X4Q A;  2FVQ A;  2HHH F;  3MOZ A;  2M8D B;  4UOF A;  2XTJ P;  1LWE B;  1M1H A;  4A8O A;  3UN5 A;  3OTO J;  2UVW A;  2B8P A;  3SSR A;  3L7O A;  3MEG A;  4OZ5 A;  2UUW A;  4WFA Q;  2LEC A;  1GMV A;  1W26 A;  3KFW X;  1Y10 A;  4P2M A;  1U0S A;  5GVQ A;  3TI0 A;  3JTO A;  3RB3 A;  4M5D B;  4O44 A;  1FD2 A;  5E3R A;  1UTA A;  2B9W A;  4LF7 J;  2I5J B;  2ZD1 A;  4CI0 B;  2P2C B;  4J9K A;  1QSL A;  3W5Z A;  2HBZ B;  3HHD A;  4LRE A;  2I2Y A;  5ETO A;  1VBX A;  1F2H A;  2BVZ A;  4C48 A;  4URS A;  5ETK A;  4M94 A;  2VBZ A;  2RD5 C;  1T11 A;  4K50 A;  4P7V A;  2Z57 B;  1AFI A;  1FHT A;  2M9K A;  3KG1 A;  2Z30 B;  3TVY A;  2G9O A;  3POT B;  5B0G A;  2ILY A;  2Q6C A;  3NP5 A;  1F3F A;  1UVK A;  4TU7 A;  2HQD A;  3V81 B;  4X2B A;  4K0K F;  1I5O B;  4QOT A;  3SCL E;  2GO9 A;  3CC7 S;  2DH7 A;  2YNF A;  3Q83 A;  4X4S A;  1Q82 T;  2ZOF A;  1ZOT A;  2HSE B;  3DGV A;  4FDF A;  2FB0 A;  2OFH X;  5IS2 A;  2BBE A;  1RTI B;  3BS9 A;  3JQK A;  2WRM A;  1FES A;  2LXI A;  1FJG J;  3VGS A;  1HQU B;  1S48 A;  5KFT A;  2QA4 G;  2RUS A;  1UEU A;  2XS2 A;  1FNM A;  1T94 A;  3KK2 A;  1X5P A;  3T1H J;  1EIY B;  1REG X;  4ZP6 A;  1CS4 A;  1TL7 A;  2QLX A;  3W8P A;  4EWT A;  1RTH B;  3CJK B;  4R5P A;  3JYT A;  2H54 B;  4DV1 F;  3SSS A;  1AW0 A;  4HTJ A;  1BQM B;  3VAJ A;  4UQT A;  1NUE A;  1TAU A;  3IBW A;  5MLC V;  2JX2 A;  2W1B A;  4WKY A;  2R7O A;  4LQ3 A;  2KRB A;  3H98 A;  4WII A;  5LL6 d;  2PMW A;  6AT1 B;  4QWC A;  1V3Z A;  4K4V A;  2R3V A;  2FYX A;  1YLX A;  4KPY A;  1BC6 A;  2AJF E;  5HQ8 A;  2KT2 A;  4GRS A;  2KRR A;  2GGP A;  2G2Y A;  2VFS A;  1S0O A;  2ZWP A;  4OZL A;  2CRL A;  1UPM B;  2EKN A;  2LQ8 A;  4OX7 A;  3C15 B;  5DG7 A;  1U24 A;  3JSB A;  4YB6 A;  2RS8 A;  4WIQ A;  3GG0 A;  4CLS A;  4U6P A;  1IM4 A;  5F8M A;  2G0C A;  2AW0 A;  1S0V A;  1WTF A;  3HFV A;  2ASD A;  4NLP A;  3UWT A;  1RAE B;  4JI7 F;  2EG2 A;  3IM9 A;  5IM0 A;  4JI3 F;  3CDW A;  2PI4 A;  2MZ1 A;  2Y1J A;  1X7V A;  5E3C A;  4ZN1 A;  2C22 A;  2V4J B;  5HP1 B;  5JUM A;  4ED2 A;  1NDK A;  2W24 A;  3R5A A;  3THV A;  1IBM F;  5BYR A;  1IKV B;  2CUY A;  2DH8 A;  2QMU B;  3PYE A;  1X4G A;  3MAH A;  1IN0 A;  5CD4 A;  2AYG A;  2VON A;  3BO2 A;  4L72 B;  4F50 A;  1NKE A;  1LNQ A;  2YH0 A;  1ITP A;  5H9F J;  2E44 A;  1S9G B;  1HHS A;  3OV7 A;  2AJ4 A;  4MYU A;  3UDV A;  4DS4 A;  4NLQ A;  2DNH A;  1RT4 B;  1NK6 A;  1B4S A;  4ILL A;  4GC7 A;  2ZH7 A;  4PQU A;  4K5R A;  4RUB A;  4CLP A;  4FP9 A;  4KKO B;  1U2R A;  5F3Z A;  1YI2 S;  2H48 B;  4C8M A;  2EXU A;  5F41 A;  2MQQ A;  3MOJ B;  2IDE A;  4X4T A;  3T1H F;  1DZ5 A;  5EHH A;  1DLO B;  4B9T A;  1DUR A;  4AE5 A;  1HWK A;  1C1B A;  4YS2 A;  4ZPW R;  5HAO A;  3OUY B;  4PPD A;  1RP5 A;  3NOC A;  1V5V A;  1SQG A;  1I94 J;  3T1Y J;  3GJT B;  1M0S A;  1H2T Z;  4HDH A;  4RW7 A;  5EX0 A;  3KLE A;  2ZHB A;  3PJW A;  2JJ4 D;  5H1S V;  2R7U A;  4OX9 F;  2ZH1 A;  3GYN A;  2J0S D;  2B7B B;  3IR6 B;  4N8O A;  1A0O B;  2XWX A;  1FI4 A;  1V3R A;  1P6T A;  3NRB A;  3CE8 A;  2QFJ A;  4R0E A;  4XDD A;  4P10 A;  3BPS P;  4Y2M A;  2R2S A;  4ZCK A;  2D9O A;  3UO0 A;  1MSW D;  3LO3 A;  3QIP A;  5KT6 A;  3DLK A;  3ET6 A;  1SBR A;  1LWF B;  2EBG A;  4F3M A;  4NXM J;  2OFG X;  3CJT A;  3W8G A;  2DHH A;  3HT3 A;  5IV3 A;  1DTT B;  2DIV A;  3Q89 A;  4ECY A;  1YBT A;  1RT1 A;  4I67 A;  2OGU A;  3D7S B;  3Q8V A;  5D4P A;  2PO4 A;  2V69 A;  2DY9 A;  4NLX A;  4GKJ J;  1RWO B;  4LUB A;  2VF3 A;  4HT7 A;  2ZNY A;  2LCW A;  4P74 A;  4NLY A;  2QO3 A;  1R0A A;  2E7X A;  3EXC X;  4C8O A;  1X4D A;  3C19 A;  5HK4 A;  2VV5 A;  1J5E J;  3NG8 A;  3OXL A;  4H4K A;  4R8U A;  3IWL A;  1T05 B;  4UY8 5;  1WUU A;  4DG1 A;  1NK5 A;  2JL9 A;  2Z8Q A;  4QIF A;  3L09 A;  3ADA C;  1JB0 C;  4HHH A;  4FBU A;  4FF3 A;  4ECQ A;  3R7N B;  3NNC A;  3QJP A;  1WTB A;  3JQJ A;  2ZDP A;  4O3O A;  5EUH A;  2XSJ B;  1U1P A;  3OJU A;  2CJ9 A;  1HNV A;  3PV8 A;  4CIO A;  4I7F B;  4C11 A;  3BR9 A;  3MR2 A;  3CSK A;  2LYV A;  3CCE S;  1O5J A;  5FDL B;  3H20 A;  3JB9 k;  4ELT A;  3GIK A;  4D3H A;  1KQS R;  3OR2 B;  2XLI A;  4IG3 B;  4MFB A;  2HVI A;  2UVR A;  3PO5 A;  2UZA A;  2YX1 A;  1WWH A;  4J9N A;  3M1V A;  1PYT A;  3GZ7 A;  4EYH B;  1U48 A;  3D1Q A;  4DX5 A;  2Y8W A;  1LW0 B;  4YR3 A;  2CYY A;  1BD6 A;  2FJA B;  2MQP A;  2OO4 A;  3HPO A;  4Y2K A;  1JJ2 R;  1VC5 A;  1F9H A;  1FRM A;  3MZI A;  5AXM A;  4ATN A;  2Y1R I;  4DR5 F;  3OL8 A;  3AFG A;  3GQC A;  4J37 A;  4WTY A;  4DQP A;  2HQC A;  3MPD A;  1O51 A;  5DGB A;  4J9L A;  1DAR A;  4B3R F;  2J5A A;  3RW7 A;  1VC6 A;  5AXK A;  1RYS A;  1U25 A;  1YGY A;  3EJM A;  4JP8 A;  1QE1 B;  2FHK A;  3GCW P;  2I1R A;  3IR7 B;  1HWU A;  3EGV A;  5HAT A;  5EGY A;  2G1D A;  2GIQ A;  2OP5 A;  1U09 A;  1QLN A;  3EE3 A;  2WCX A;  2C2D A;  1HBO A;  2CPI A;  3DC2 A;  3KHG A;  2FY8 A;  4C6A A;  4ZJO A;  1IKX B;  1BGX T;  1E6V A;  3HHL C;  3M8P A;  2PMZ D;  1NDC A;  1QD1 A;  4NLR A;  4QWA A;  1NHK L;  4LBP A;  3FSY A;  4KR0 B;  5LXY A;  1EP4 A;  2Z58 B;  4USI A;  5KG3 A;  2HHV A;  4F04 B;  3H5S A;  3GLJ A;  3UW1 A;  4YR0 A;  3O3L A;  1KHV A;  4Q7A A;  3DMJ A;  2FHJ A;  4OI3 A;  2CG8 A;  4P7T A;  3AQO A;  2XLJ A;  5LMU J;  1N5S A;  2NZ4 A;  4YHH F;  2CQB A;  2L08 A;  2FUG 9;  1JKH A;  4C7Q A;  1C0T B;  3HKW A;  2N4D A;  1N36 F;  2MYF A;  4YUD A;  1N52 B;  5RUB A;  3MMC B;  4YEA A;  2OJ3 A;  2UXB J;  2XGQ A;  2GCF A;  3P8B B;  2CAD A;  3QGH A;  4DXL A;  1A9N B;  4EZ6 A;  4DPT A;  2OPS B;  2IJF A;  3IRX B;  1VLY A;  1RU2 A;  3DI6 B;  3VVU A;  4JI8 J;  1YX2 A;  2BW7 A;  1VBZ A;  2KHD A;  2U2F A;  3Q24 A;  4FVM A;  4WWS A;  5DDR C;  5BR8 F;  4F4W A;  2HWH A;  2QC3 A;  3KUG A;  3SFG A;  1QAI A;  3CJR A;  3A8K A;  5GMK a;  4YB1 P;  3RAX A;  1JLG A;  2VG6 A;  1RWU A;  2W9C B;  1RAA B;  2DNR A;  1N34 J;  4OYA A;  5IT4 A;  5HN0 A;  2YWG A;  4FKX A;  4USV A;  2DR8 A;  2HS0 A;  3C6U A;  3HD1 A;  1ZAX A;  2UU9 J;  3MDF A;  4DV1 J;  4JV2 A;  5JXS A;  5F9N A;  2VOP A;  1FFG B;  3T9Z A;  2KFZ A;  3R6L B;  1SIZ A;  1RJJ A;  4IOC Q;  3UN2 A;  1ZM9 A;  2HHQ A;  4NCG B;  2RUG A;  1XTZ A;  1Y11 A;  2HQG A;  2BJ3 A;  1FNO A;  2A6O A;  3ZO7 A;  2VB6 A;  1FTC A;  3G87 A;  1HNI A;  1U6F A;  1WG1 A;  2XO6 A;  1KOH A;  2IM2 A;  3V4M A;  3NEK A;  4ED0 A;  2DGQ A;  3FBF A;  3W63 A;  3U1N A;  2KZZ A;  2ZUG A;  1URN A;  3LAL A;  5LSO A;  2CNL B;  4ANC A;  4G1Q A;  5L39 A;  1TMJ A;  3IP0 A;  4WKR A;  1S1T B;  2IC3 A;  3ICL A;  2W9A A;  1T0T V;  1B3T A;  1VYA A;  4IQX A;  1XR5 A;  4MH8 A;  2XMT A;  4NL5 A;  3KJN B;  1M5S A;  2K3K A;  2IM3 A;  2J7K A;  2I8E A;  3DOK B;  3ENV A;  1E6Y A;  1YSJ A;  4DPX A;  1OSC A;  3MMB B;  8ATC B;  5A2Q Y;  1HI8 A;  4DMZ A;  1F9F A;  1IWA A;  1LFW A;  3PTW A;  1OJ4 A;  3RR8 A;  2V8H A;  4LR8 A;  1OWX A;  1TL3 A;  5KFB A;  1VQO S;  3DDN A;  2YNH B;  3SCK E;  1EET B;  4BDP A;  4DS5 A;  1IWG A;  4MYT A;  4DR6 F;  4EGL A;  5F8J A;  2H4Y B;  1OPI A;  3CME S;  4TN2 A;  3BGR A;  4K7Q A;  1PCA A;  3B4D A;  3FQL A;  3PW5 A;  2NZC A;  1VQ7 S;  3KK1 A;  2WW4 A;  3G6Y A;  1J5O A;  4IFY B;  1WDT A;  3ISZ A;  4LIR A;  2PEH A;  3B4M A;  3KUH A;  1S1W B;  5D77 A;  2GZO A;  3TAM B;  3TZY A;  3HVR A;  2DKO B;  2F9D A;  2IAJ A;  2CJY B;  3AT1 B;  2XGP A;  3OTC A;  2PT0 A;  4DEZ A;  1VQP S;  5EDW A;  5D8H B;  2YXL A;  1DTQ B;  1RT7 A;  2WB1 D;  3PRB A;  3KLH B;  3CC4 S;  2WAQ D;  2AF6 A;  4TYB A;  3ZZZ A;  3AD8 C;  1RTJ A;  5J2N A;  1DRZ A;  5BYQ A;  3UI3 A;  4OI4 A;  5KT2 A;  3KJV B;  4RX6 A;  2R9L A;  4EYI B;  3ZC4 A;  2DGW A;  2BJ1 A;  3MM6 B;  4F0M A;  4AFF A;  3M9M B;  5A8R A;  3M9N B;  4F2R A;  1AFJ A;  2J7W A;  1FFS B;  5ETS A;  5E7O B;  5BJR A;  1H74 A;  1BWE A;  3FEX B;  4H4O B;  1UJ6 A;  4DV5 J;  4C9D A;  3DLG A;  3AA8 A;  1F9E B;  1TUV A;  4OLP A;  3LOU A;  2WTF A;  3CMA S;  5A2Q U;  2IA6 A;  1PJ5 A;  3VGV A;  2J6S A;  4OHY A;  3BV8 A;  1S97 A;  2V0N A;  1T7P A;  4DQI A;  3V4I B;  3GFY A;  1S10 A;  4Q45 A;  1UVM A;  3TQE A;  4ER8 A;  2PC6 A;  1VQK S;  2GAH C;  1DFD A;  1TAQ A;  2CQC A;  2H65 B;  2DIT A;  5D0G A;  1D9F A;  2AMC B;  2RIJ A;  1RE1 B;  2PEB A;  2WSC C;  3UDC A;  1QAX A;  3K57 A;  1VQY A;  2FJV A;  5DGA A;  4C0O C;  3KG4 A;  1ULR A;  1UFL A;  3A1Y G;  1LW2 A;  1GT8 A;  2HVZ A;  3JSY A;  2KXH A;  3DYA B;  3LF0 A;  4LRC A;  4OYX A;  2N4C A;  4RNM A;  3H25 A;  3EZ5 A;  1QSS A;  4B3S J;  1HMV A;  3QO9 A;  2V4R A;  1MU2 A;  2X1F A;  3QRP A;  4HDG A;  3KWM A;  1RU1 A;  1XMQ F;  2H51 B;  4ECS A;  1M5V C;  4RWX A;  1R89 A;  4IO1 A;  2RRA A;  3CMQ A;  4LF8 J;  1M1K T;  2VC1 A;  4QJV A;  3VHQ A;  1X4C A;  3RBE A;  4CLY A;  1V6H A;  2QX0 A;  4DR2 J;  4UY8 T;  4KGV B;  2FLO A;  5HQL A;  3KNA A;  4FYY B;  1BLU A;  5I3U A;  3NGD A;  4M5D A;  3RBZ A;  4O44 B;  2P9C A;  3UCU P;  2HBR B;  2WZ1 A;  2I5J A;  4OYW A;  5GAD I;  2UV8 G;  1RA6 A;  4DFM A;  5E33 A;  1K1S A;  3M2R A;  3MMJ A;  5LT5 A;  4J9M A;  2OIH A;  5CYQ A;  2OPQ A;  3J7A 1;  1GMW D;  1TV6 A;  2IMO A;  4WE1 B;  1XBW A;  2BAC A;  5U47 A;  3POT A;  4PYD A;  1NH8 A;  1L5U A;  2CDR B;  2VDI A;  3UD4 P;  4F4A A;  1K47 A;  1FX2 A;  2R7Q A;  4K4Z A;  5A0Y A;  2EC2 A;  5B08 A;  3J81 U;  2CVE A;  4OMF G;  2FJW A;  1BY9 A;  1S7H A;  4H4M A;  4OI1 A;  3QAU A;  2CQ0 A;  3CJ2 A;  4Q5V A;  3C3L A;  3I6P A;  3W9I A;  3MTK A;  2DO0 A;  4FXV A;  1RTI A;  2BJ7 A;  2HBY B;  1EX8 A;  3TP2 A;  1P8G A;  1SC3 B;  2DR6 A;  4P52 A;  1RGV A;  1UJ5 A;  1HQU A;  3K7R A;  3MPY A;  1O8B A;  1HD1 A;  2OD6 A;  4DU8 A;  3D0I E;  1U1R A;  2MXY A;  1OY6 A;  4TQR A;  2XCP A;  1CS4 B;  1F5A A;  1PAU B;  1TL7 B;  2DCL A;  1RTH A;  2NCK L;  4N77 A;  4WYL A;  1ELO A;  3CJK A;  2C28 A;  1Q7Y T;  3ZTP A;  4AT1 B;  4J9V A;  4LF7 F;  3Q2T C;  1BQM A;  2HFN A;  3JAM U;  4PQA A;  2ROP A;  2CNO B;  3VGU A;  5L38 A;  1UA1 A;  1G1X A;  2V2K A;  3GCX P;  4USJ C;  2FJE B;  4UUX A;  3SV3 A;  3FCW A;  2E29 A;  5HI7 A;  4JI6 F;  2QJ3 A;  2OEM A;  3OHB A;  4C8N A;  3UNY A;  4B3M J;  1H73 A;  2CQ1 A;  4DR1 F;  3KLG B;  1VCT A;  2H1Y A;  1VOM A;  2GGP B;  1RXO B;  2LMI A;  3M2V B;  3BKF A;  3TRG A;  4DV3 J;  3PCO B;  4USU A;  2OEK A;  1GNK A;  3R97 A;  2ASL A;  3C15 A;  5M2P A;  1IKY B;  2VUG A;  3QT8 A;  4O0I A;  3BQ2 A;  3IA0 A;  4UF4 A;  3BDP A;  3FRY A;  3HVW A;  3ZXW A;  5HVH A;  3CD0 A;  4JUZ A;  1VRU B;  2F63 A;  5IM0 B;  4ZJL A;  2QLJ B;  4NA1 A;  3MI7 X;  1NSP A;  4L6V 3;  5DQI A;  2O3D A;  5C2C A;  1VK8 A;  3H4D A;  5HP1 A;  4LF5 J;  3PY8 A;  5DM7 Q;  1IKV A;  4DDF A;  3QAE A;  3C66 A;  2PMH A;  4YME A;  3ZZO A;  4ICL A;  5IT9 Y;  4IR9 A;  3AD7 C;  4DLE A;  4LF9 F;  4LF4 F;  2ADB A;  3T5K A;  1KS2 A;  4CNZ A;  1RIS A;  4NWB A;  1IR0 A;  4BLG A;  1K0T A;  3FZ2 A;  3M6U A;  5IWA F;  3H2U B;  4C3L A;  5A76 A;  4V19 J;  3MM9 B;  2IVF B;  2EBE A;  3MGJ A;  5KFY A;  5J2M B;  1HA1 A;  1RT4 A;  2MKH A;  4DL5 A;  1CQM A;  3G4S S;  4PQU B;  1FF2 A;  2ILZ A;  3AA9 A;  3EGZ A;  2Q43 A;  4UOH A;  1QTM A;  3NGK A;  1KP6 A;  4I2Q A;  3SSQ A;  3CPW R;  4LMZ A;  2WON B;  3EDR B;  2IRU A;  2MZJ A;  3OQ2 A;  2ZE2 B;  1UVI A;  5DG8 A;  3OPK A;  2QFI A;  3OUY A;  5LM7 E;  4U95 A;  3JS9 A;  2XZD B;  2ZZT A;  4ED6 A;  3MF5 A;  2V67 A;  3AY0 A;  1YG0 A;  3K0J A;  1JLA A;  3JTN A;  2AJ1 A;  2WVC A;  2BKO A;  1WHX A;  3KLE B;  2IVY A;  4J9S A;  3IWN C;  3UCG A;  2ZH6 A;  2HAI A;  2AT1 B;  1D9D A;  2EG1 A;  3QSY B;  1CBK A;  3LW5 C;  1N8R T;  4PUO B;  4B3O B;  2AIR B;  1CC8 A;  3K17 A;  4FYX B;  2M2B A;  5ETN A;  3PDN A;  4UOG A;  2ROE A;  2DR9 A;  4DV3 F;  1KNZ A;  1H7X A;  3N5B A;  3OR1 B;  3QMQ A;  1QTN B;  3MM8 B;  1BQX A;  3DLK B;  3ET6 B;  1Q1K A;  1LWF A;  1VRT A;  3QIP B;  3QGI A;  3ETM A;  1MMN A;  2HND A;  2M88 A;  2D3O 1;  1Q95 G;  4HI1 A;  3PHT A;  4YB7 A;  4QPX A;  1GK8 A;  2HK3 A;  2LA4 A;  3QGG A;  2KVI A;  1KVJ A;  2V8D A;  1DTT A;  2NXC A;  3VWS A;  4LVN P;  1RT1 B;  1Y4Z B;  2PA8 D;  1ZET A;  1HD0 A;  4OYM A;  4LSL B;  5KFZ A;  1UA0 A;  1KON A;  3F44 A;  4K4Y A;  2FGC A;  5E0O A;  2QYG A;  2MKY A;  3TWZ A;  2DHX A;  2FDN A;  4RW4 B;  2J76 E;  4DCJ B;  1MRO A;  5HMW A;  3Q8P B;  3CUN A;  1M5K C;  1Q0N A;  5CQG A;  3GPA A;  2NR0 A;  1RT2 A;  3N28 A;  4ZP9 A;  2FVC A;  2VFV A;  3AHP A;  3DRP A;  2X51 A;  3I5B A;  4QZV B;  3U1M A;  4XTT A;  2BQU A;  1T05 A;  2XI2 A;  1FDB A;  1FCA A;  4C8L A;  4DG1 B;  3MEC B;  1JXV A;  1AT1 B;  2JLE A;  4ZVG A;  5KFU A;  3DGP B;  1I51 B;  4RU2 A;  3HM9 A;  2VG5 B;  3MAA B;  1VQ5 S;  1S0N A;  1B99 A;  5IT9 U;  2CJA A;  3KKF A;  1X4B A;  1VBY A;  2J9C A;  2UUC F;  2XSJ A;  5E2Q A;  3HVT A;  1PKU A;  1UKU A;  5A6W A;  1AZS A;  1HQ2 A;  2VFT A;  1FXL A;  2KYX A;  2FJB B;  1PIL A;  1OO0 B;  1T3O A;  4I7F A;  3HFK A;  4C11 B;  5HMZ A;  2L3M A;  3RAQ A;  1UFK A;  5FDL A;  3TAR A;  3KK2 B;  4RZR A;  2MMY A;  1PG5 B;  4DV7 F;  2D9P A;  5D0H A;  2RQC A;  2ZH8 A;  4DOZ A;  1S1X B;  2ZHA A;  3CIM A;  4IG3 A;  4MFB B;  4NA2 A;  2IBK A;  1H2U X;  3N9U C;  1TFW A;  3QPI A;  1YJT A;  2DIS A;  3BBB A;  2V2V A;  1VI7 A;  4NRT A;  2EK1 A;  3HD2 A;  2VIH A;  1GAO A;  5D4O A;  5L1K A;  2H3E B;  3O2I A;  3TNV A;  2YWF A;  3N4W A;  4O3N A;  3PG9 A;  3WX4 A;  4ZLJ A;  1CJK A;  2FHO B;  5I42 B;  4DSI A;  2RT3 A;  3IS9 A;  4OHV A;  3DLE A;  2E5H A;  2WVE A;  4FF4 A;  1Z2Z A;  1CC7 A;  3JTP A;  4GKK J;  2HGL A;  2PA3 A;  2YKM B;  2KT3 A;  1DQ9 A;  5CZV A;  4V19 X;  4B3T J;  3UNG C;  1UP1 A;  3GP9 A;  1HNX J;  4OJH A;  3ISN C;  4PXC A;  5G0R B;  1KC8 T;  1S76 D;  2YNI A;  4MK8 A;  3HO1 A;  3Q0A A;  1GFW B;  4WXO A;  1GQE A;  2F65 A;  1HWL A;  4NLU A;  4DL6 A;  1RSC A;  5K8P A;  1SV5 A;  1FKO B;  2Y3Y A;  3OTB A;  1OQ6 A;  3CD5 A;  2IHR 1;  1TKX B;  1CSJ A;  2YWE A;  3CWJ A;  2RJZ A;  1AA1 B;  2VPZ B;  2B4O A;  2MGZ A;  3GV5 B;  3ZFV A;  2AGQ A;  1F1B B;  1ZM4 A;  1HFE L;  3M05 A;  3AJ1 A;  4IRK A;  3T1A A;  3FEZ A;  4M5G A;  3G9C A;  2BDP A;  2UXD J;  4X64 J;  1N56 A;  3MMC A;  1GMW A;  3C2P A;  2EC0 A;  2SXL A;  5KG6 A;  3BH6 B;  3QBC A;  2PSZ A;  2XHW A;  1QVF R;  2MKJ A;  1WHY A;  2ZVI A;  3DLJ A;  1LWX A;  1W2B R;  3EPG A;  3CJ3 A;  2HZC A;  2YKA A;  1WOP A;  4IH7 A;  4MJK A;  5F3T A;  4IKA A;  3GV7 B;  4GO7 X;  5KG2 A;  2CPY A;  4ED5 A;  2D69 A;  3FMW A;  4DL0 C;  3PJ9 A;  2QGF B;  1OYD A;  5T7L B;  3K2Y A;  1SPB P;  4NLW A;  1VR6 A;  2VG6 B;  3D9B A;  5THW A;  5CH7 B;  2W9C A;  2NYI A;  2A2D A;  2GX8 A;  1S6O A;  4QW9 A;  4Y28 C;  3Q8R B;  1N34 F;  4QYZ J;  2AWZ A;  1KN6 A;  2HG4 A;  3O44 A;  3ZZP A;  5A6P A;  1K1Q A;  3TJ8 A;  4NAS A;  1TKT A;  2KFN A;  5K8N A;  3GIJ A;  3I56 S;  1VJW A;  3BGF A;  4AL6 A;  4ED8 A;  2AU0 A;  1SC6 A;  2N7C A;  3RB6 A;  4J7C A;  3I31 A;  2D41 A;  3QYY A;  2R7V A;  2B3T B;  3WZ0 A;  1FKP B;  3NY0 A;  4DUZ J;  1S77 D;  2XWY A;  3TOQ A;  5CA5 A;  5T41 A;  4LR9 A;  3R9L A;  3BO4 A;  3LTO A;  3KMS A;  3TAN A;  1HQE A;  3TA0 A;  5C24 B;  1SKS A;  1HNW J;  3DOM B;  3H4B A;  3R2C J;  1NSK L;  1S6P B;  2QLB B;  2IC3 B;  4WP8 A;  4LJM A;  4O4R A;  1S4F A;  4IYQ A;  4DCO B;  4OX6 A;  3T6J A;  4YFU A;  2E5J A;  2Q6B A;  4ED3 A;  2E7V A;  2VHG A;  2ZJP Q;  1XK8 A;  2F8E X;  3AOD A;  3QNW B;  4DI6 A;  1S99 A;  4N56 A;  2UVU A;  5T14 A;  2QTW A;  2L9N A;  3ULH A;  4ECT A;  3DOK A;  1R8A A;  1E6Y B;  1TL4 A;  2MGZ B;  3ISN D;  4FS2 A;  4AXJ A;  2FHM A;  5DQG A;  2DGT A;  4PXE A;  1EKS A;  3VAH A;  2CAJ A;  2BMB A;  4LFA J;  1TL3 B;  4JOU A;  3VGT A;  5IFM A;  3P49 B;  4KJI A;  1D9A A;  3M30 B;  3IRW P;  4OJG A;  4QWE A;  1EET A;  2XMU A;  3V6J A;  3UE2 A;  2XUL A;  2BQ3 A;  4K2X A;  4RU9 A;  4HT5 A;  1RDR A;  2ZBP A;  1FRX A;  3O5T B;  3KK1 B;  5LMN F;  2HWT A;  2O01 C;  2BJD A;  4OI2 A;  1UET A;  5IC6 B;  5B0D A;  3FCV A;  2J9D A;  4DR3 F;  4NE9 C;  2P5V A;  4IFY A;  1REV A;  4DV6 J;  4HYK A;  1NK4 A;  1RLC L;  3IGN A;  1S1W A;  2CJB A;  3TAM A;  3ZTS A;  5C7P A;  3MFH A;  2IAJ B;  4EMD A;  1B0P A;  1KR4 A;  3C6T B;  2W2P P;  2X3D A;  4RBV A;  1TKZ B;  3TZX A;  5D6G A;  5KT4 A;  1NB7 A;  1M5H A;  3BKT A;  2V9W A;  4MKB A;  7FD1 A;  4WFY A;  5K5M A;  6FD1 A;  2HMI A;  1KQF B;  4HHJ A;  2WOM A;  4F8R A;  4Q8E A;  2RAQ A;  4WP9 A;  3KHH A;  2VU5 A;  4RUC A;  3H40 A;  2A2C A;  4URG A;  4DPY A;  1BXN A;  1U47 A;  4NYP A;  4USK A;  5IQ6 A;  1VQ6 S;  2NXE A;  3MM6 A;  4JB8 B;  2P9G A;  2R42 A;  2HFU A;  4DHV A;  1KD1 T;  4FYD A;  4YN3 B;  1R8P A;  2MSS A;  2MY7 A;  3H0P A;  4KAI A;  1HHQ A;  4MIB A;  3W3S A;  2WBR A;  3CJ4 A;  3FVY A;  5IOL A;  2NQP A;  2MY8 A;  1YBU A;  4IH5 A;  2LU1 A;  1D3W A;  1YJU A;  3OHA A;  2DNY A;  3D1H A;  3W61 A;  3K5N A;  3A3O B;  2F3J A;  3B6B A;  2VQE F;  4NI2 A;  3RG6 A;  1IR2 A;  3HSD A;  3V4I A;  3CJQ A;  1LQ9 A;  2VKZ G;  4FBT A;  2XYH B;  2QA4 S;  4XPE A;  3GJR B;  4ZK7 M;  5HBM A;  1V9O A;  4A8Q A;  3S01 A;  1Y0H A;  1TVR B;  2LVW A;  4MKV A;  2Z0G A;  2J9E A;  2HRT A;  2C3Y A;  4OHW A;  4CLT A;  1EAR A;  4EI2 A;  4M5I A;  1JXL A;  5BXI A;  4FYW B;  3HSZ A;  5F8L A;  1M5P C;  1LW2 B;  3PVX A;  1N48 A;  4QYR A;  2CQG A;  4K4T A;  3CJ0 A;  4W90 B;  1MU2 B;  1FJE B;  1RWM B;  3EDQ B;  3BPD A;  5JJB A;  3AB2 B;  5IZH A;  2Y1I A;  3D1O A;  4WK3 A;  2FJD B;  1T9T A;  3GU0 A;  1Q86 T;  2ZC3 A;  2Q3P A;  4GVB A;  3QQC D;  4O3P A;  2BEF A;  4Y6I A;  5HO4 A;  2JLG A;  2R8K A;  1FWP A;  3L7U A;  4LF9 J;  3OW2 R;  2YBV A;  3DRS A;  1EQ0 A;  3FBB A;  4CTA B;  5IT0 A;  5HRO B;  1MML A;  2P9E A;  4PG4 A;  3GV8 B;  3FQK A;  4LVO P;  4TY9 A;  2K7K A;  3NGT A;  5I3U B;  1FWL A;  1W25 A;  3DRR A;  3BJY A;  2RIL A;  4DF4 A;  3FBE A;  4J9O A;  2XNQ A;  3M2R B;  5EWG A;  1F5B A;  2YY3 A;  5CYQ B;  4JV0 A;  2OPQ B;  3U7J A;  1YJ9 S;  1TV6 B;  4WE1 A;  1U45 A;  3H5Y A;  1ZZN A;  2PFD A;  4NYO A;  3VAK A;  2ZOG A;  1RBO B;  4NEY A;  4ZN3 A;  1RCO B;  5IV4 A;  3O6Q A;  4UW2 A;  3D6T B;  8AT1 B;  7FDR A;  3WC2 A;  2JFK A;  2F40 A;  2R7S A;  4EFA C;  3EVO A;  4P2X A;  5A0Y B;  3PM9 A;  2VL1 A;  1BHN A;  1Y5L B;  4B9N A;  4H4M B;  2VG7 A;  1YTY A;  3KXD A;  3LH2 S;  1TUG B;  1U1N A;  2HEK A;  2BJ9 A;  1IUJ A;  3U02 A;  3M32 B;  2ZM6 J;  1BMQ B;  4DR3 J;  4F2S A;  1R0B G;  2PE8 A;  3DXB A;  3UD3 P;  1NKC A;  3H59 A;  1FE4 A;  2UUT A;  2IYI A;  3VZH A;  3UPF A;  3JSM A;  2UP1 A;  3QSI A;  4OL8 A;  4B9U A;  3B82 A;  5J1N A;  1F60 B;  1WF1 A;  1ZZF A;  3C14 A;  2WSE C;  1TK8 A;  2V2Z A;  1X9M A;  1V3S A;  3S8S A;  3SI8 A;  4WZQ A;  2ZDO A;  2KO1 A;  3PRD A;  4U67 Q;  1YIT S;  2K2P A;  4ZVU B;  4LF6 J;  2WSF C;  2QL7 B;  1NO8 A;  4ZLP A;  2DHG A;  2PD1 A;  5IXU A;  3P45 B;  5GAG I;  4LSN B;  5B0F A;  3KLG A;  2UU9 F;  1XMQ J;  4NXM F;  3SFU A;  2BAB A;  3M2V A;  4LFB J;  1RWV B;  3RB0 A;  4IFV A;  3BB5 A;  3FSX A;  3D3C J;  2K1R A;  1KWM A;  3F0N A;  2XBP A;  5LXR A;  1N33 F;  1IKY A;  3PX6 A;  4I68 A;  2QMX A;  3M4X A;  1U6Z A;  2R7X A;  1HNX F;  1LWC B;  1RA7 A;  4ANE A;  2G0I A;  1MN9 A;  3NWR A;  4PRF A;  1VRU A;  2HFO A;  4FKY A;  4EBE A;  3B54 A;  2W2O P;  2W7A A;  4JI8 F;  2IBO A;  2AQ4 A;  2IVM A;  3MHY A;  4ITS A;  2GA7 A;  1IJE B;  2HQ3 A;  2UV8 A;  2XY6 A;  2GVD A;  4KHP F;  1HAR A;  2B0G A;  1R8C A;  3TA2 A;  1MN7 A;  2QL5 B;  4ICL B;  3BBF A;  3FKB A;  4A47 A;  2C2R A;  1VRQ C;  1FJ7 A;  1X60 A;  2OPR B;  4KT0 C;  1CJV B;  4MT1 A;  4PG8 A;  1RZM A;  2BM1 A;  1NME B;  1W7W A;  2BKP A;  1ICE B;  2JH3 A;  2RDD A;  4NZ0 A;  3MXH P;  2JEI A;  3THP A;  2AGO A;  1L3V A;  3MM9 A;  1SJ1 A;  2NUH A;  3AJD A;  4HI2 A;  2DNG A;  3A8E A;  3G6E S;  5GAH U;  1Y5N B;  5J2M A;  1KTV A;  3ONQ A;  5GAE U;  1AUS L;  3BQ0 A;  5HQM A;  4K59 A;  4J9U E;  4X84 A;  3VAI A;  4ZVP B;  4XK8 C;  1S72 S;  4I2Q B;  3EXY A;  2WON A;  3GWC A;  4F4Z A;  1YRT A;  2YX7 A;  2ZE2 A;  4P6Q A;  4DPW A;  4ELV A;  2QZ8 A;  3MR3 A;  2VA3 A;  2VJV A;  4ED7 A;  2VBX A;  1NKB A;  1EB0 A;  1MNE A;  1JLQ A;  4Z2X A;  4WCE Q;  1VQS A;  2LDY A;  1JLA B;  1NAQ A;  3I4H X;  5D3G B;  1FKA F;  4BCA A;  2V34 A;  4KQZ A;  3NCP A;  1P27 B;  3MCO A;  3G96 A;  2BAN A;  2NSB A;  2C3U A;  2CFX A;  3LWL A;  3HHL D;  1RTD A;  4PUO A;  1ROF A;  1WOS A;  4G6V B;  3W64 A;  4RBT A;  5L1I A;  4DFJ A;  1R7I A;  4LBI A;  4B3O A;  1N33 J;  4ES1 A;  1TL1 A;  2R7W A;  3RB4 A;  4ZPA A;  2FLN A;  2FC9 A;  3DN9 A;  5L1J A;  3OR1 A;  3QAT A;  3MM8 A;  1S1V B;  2GQC A;  4DX6 A;  4TY8 A;  1VRT B;  4RNO A;  2RDI A;  4OHX A;  2E1M C;  2HND B;  4FVC A;  1Q8B A;  3K89 A;  4RJV A;  5I4M A;  2AYB A;  4O3R A;  2QEX S;  2YTC A;  4CH0 S;  5A8K A;  2KI2 A;  2GHP A;  2O5D A;  2CXE A;  4HH1 A;  1ZTT A;  4ETX A;  5KFJ A;  2DY1 A;  3B78 A;  1ZTW A;  8RUC A;  4I6Y A;  2KH9 A;  2AHO B;  3T5J A;  3QJJ A;  2IA0 A;  1QDU B;  2Y0B B;  3E01 B;  4LSL A;  3BO3 A;  4LFC J;  1APS A;  2Z2Y B;  4ID5 B;  1EQM A;  1O0P A;  2C2K B;  4RW4 A;  4WBF A;  1TTH B;  1MRO B;  1D8Y A;  1Q5Y A;  3HDS A;  1B7Y B;  4DX8 H;  4A8W A;  3CCR S;  1RT2 B;  4O0N A;  1PC4 A;  4JBC A;  3DRP B;  4W4M A;  5DRK A;  3TUI C;  4HTI A;  3DNC A;  3LGH A;  4DCP B;  5L1L A;  1H0H B;  3GII A;  2KJV A;  2KXF A;  3MEC A;  3OD2 A;  4OV6 A;  4ZVF A;  3IGV A;  3S7R A;  2YKN A;  1NBE B;  3DGP A;  3JAM Y;  4RNF A;  5MAO A;  4RPF A;  4IO9 Q;  2VG5 A;  3BH7 B;  3MAA A;  2P8I A;  4TVA B;  2EFV A;  3OTD A;  2JFD A;  4B08 A;  2MQM A;  1VGY A;  4OYB A;  3UR0 A;  4NXN F;  1UVN A;  3GFH A;  3HVT B;  2AJ2 A;  3T6B A;  1AZS B;  4M63 A;  2DRA A;  2JZ5 A;  1S1U B;  3S6E A;  4ZVS B;  2J8A A;  3DDI A;  3QFW A;  4LFC F;  1CJU B;  3NGU A;  2OSR A;  2I9S A;  1YZ6 A;  2E5G A;  5D78 A;  2H5J B;  2B7C B;  2CDQ A;  2COL A;  3EMT A;  3FNN A;  3US5 A;  5DDP C;  2RKI B;  3TAQ A;  1SC1 B;  1S1X A;  3NL0 A;  2F4V J;  3OLB A;  5KOX A;  2KFY A;  3CDB A;  3FCH A;  2AD9 A;  1KLM A;  1N5Y A;  4DSL A;  1WKL A;  2MQL A;  2VH7 A;  2RML A;  3GYX B;  3HSJ A;  4I2P B;  3AOC A;  3G8S A;  5I42 A;  5KG1 A;  3D67 A;  1CJK B;  1LXJ A;  2HVD A;  3FRZ A;  3OXG A;  4P2F A;  2ROG A;  1HBU B;  3M7V A;  2ZVS A;  3IS9 B;  4K2J A;  2RRN A;  2W2N P;  2ZBI A;  3DLE B;  3TJ9 A;  2UXB F;  3MD1 A;  1ACM B;  4WYW A;  3C8Y A;  4NLV A;  4WJB A;  4DX7 A;  2XMK A;  4B3T F;  3SZ2 A;  2YKM A;  3PW7 A;  5I3Q A;  3FMB A;  1G2E A;  4CT9 A;  4RO0 A;  3ETO A;  5G0R A;  2W7P A;  4EEY A;  2YNI B;  1PC5 A;  2G2Z A;  4OZN A;  4UT4 A;  3OVS A;  4FXW A;  3UQS A;  4XIU A;  1YJN S;  4MAK A;  3DOL A;  3SCJ E;  3R7B B;  4ZHR B;  1NH7 A;  2RQK A;  2GNK A;  3Q86 A;  3PYD A;  2XZT B;  1SV5 B;  3HX9 A;  4I56 A;  1FKO A;  4ZPC A;  1MW7 A;  4LRF A;  3G6V A;  3H5U A;  1TKX A;  4HLB A;  2ZIT A;  5FJ4 A;  2LP4 A;  2RHS B;  1HR0 J;  4BBY A;  2IIH A;  3D28 A;  4O3S A;  1HPZ A;  1ZPV A;  1EKR A;  4ZPB A;  4DV2 J;  5KFL A;  2B56 A;  3AOB A;  4Q2L A;  3S1T A;  4GC6 A;  1UZD A;  2BXJ A;  2Z2Z A;  2XS7 A;  2QT7 A;  1TK5 A;  1EAY C;  2XO7 A;  1K9M T;  4CCH A;  2GS8 A;  1Z2L A;  3GB0 A;  4MIW A;  4DWI A;  4QU7 A;  4Y00 A;  3AOA A;  3BDE A;  3WHI A;  1A7G E;  4R8U B;  4MK7 A;  1KDN A;  2XB2 D;  3MCN A;  4IOB A;  1ZA1 B;  4BC7 A;  1IBM J;  4LF1 A;  1R43 A;  3TUJ C;  3BZQ A;  2OEL A;  3AB4 B;  1XWL A;  4UUW A;  4LFA F;  4FYV B;  2AYE A;  2CPF A;  4IOA Q;  4Y2C A;  3HXM A;  3H5X A;  1SL2 A;  2UUB J;  1FJC A;  1U02 A;  4QR0 A;  4K4W A;  2XZW A;  4DJB A;  1S59 A;  2WHO A;  1S57 A;  5T7L A;  5BR8 J;  1PO6 A;  2D3O R;  1FRH A;  5ETL A;  2POK A;  4QR2 A;  2K8G A;  2VPY B;  1VQL S;  1P1T A;  4ECX A;  1SXL A;  1FTR A;  2YQ0 A;  3W66 A;  3W60 A;  4IG0 A;  3EIC A;  4DL4 A;  2VBY A;  3CCU S;  2LKZ A;  3PW2 A;  2GJF A;  4KH1 B;  1TKT B;  3HVA A;  5D0E A;  4A48 A;  1N36 J;  3KLV A;  4ZPV R;  2GVZ B;  4LF6 F;  3WIV A;  3KK3 B;  2W4D A;  3NCQ A;  4V1A k;  2KU7 A;  1NPR A;  1NXI A;  4PKD B;  2CWK A;  4I64 A;  3KUE A;  4M5L A;  1D09 B;  1FKP A;  2FHJ D;  3D0H E;  4NML A;  4OJ3 A;  4I6A A;  4ZPT R;  3P5B P;  4JI0 F;  2F4F A;  2IJN A;  1DQA A;  1H7W A;  1D8Z A;  4ED1 A;  1HQE B;  1SH0 A;  2V94 A;  5C24 A;  4C97 A;  5HMX A;  2HHU A;  3DOM A;  2NS1 B;  2KJW A;  1CQN A;  1S6P A;  3I5A A;  2F4V F;  1PAE X;  3CDU A;  4GVL A;  5L9X A;  1RAH B;  2DK2 A;  4I4B A;  2XYG B;  4CO0 A;  3VTI A;  2HUR A;  3X3U A;  2V63 A;  1CJT B;  1WC1 A;  1XJW B;  2J0X A;  3M8Z A;  4Y3C A;  1KEK A;  2CJQ A;  4DV4 F;  2E1C A;  5K20 B;  1FXR A;  1QVG R;  1YJ7 A;  2MJN A;  4LSZ B;  4A4J A;  4X4R A;  2MHN A;  1T03 B;  1JLC A;  4UQG A;  2AEM A;  1NND A;  2ACY A;  2BV3 A;  1UMJ A;  3DRX A;  3TR5 A;  3M30 A;  1PSD A;  2EKY A;  3DFE A;  5HVG A;  2E1P A;  2W25 A;  2FD2 A;  1NJY A;  2FZC B;  4F0H A;  2J0W A;  4YDX A;  4LIW A;  2QA2 A;  2UVV A;  2HRU A;  3EX7 B;  3M8Y A;  3H42 A;  2WW8 A;  1L3T A;  2V4Q A;  1TU0 B;  2QG9 B;  1HW8 A;  2LLZ A;  1REV B;  2M52 A;  4AQY J;  4ZA1 A;  4DV0 J;  2HIQ A;  2R4F A;  4DF8 A;  3C6T A;  2HNY A;  1HNZ F;  2JNJ A;  1TKZ A;  4DN9 A;  5IC4 B;  4K4U A;  3DLL Q;  3OTE A;  2HMI B;  3JSR A;  4CWB A;  2WOM B;  2JSX A;  2X3G A;  4P75 A;  1WI8 A;  2GO8 A;  3OL6 A;  3I55 S;  2ASJ A;  1VDH A;  1U1Q A;  1ZBT A;  1MWY A;  1R27 B;  4B17 A;  3HI9 A;  4NX9 A;  1SKU B;  3R5G A;  2E9R X;  4W92 B;  3GIM A;  1YRU A;  2ZOM A;  5KFW A;  1K44 A;  1SUQ A;  1TL5 A;  2FZK B;  4CO1 A;  1T9U A;  1N32 F;  2HVH A;  1VQ8 S;  3VQT A;  1R8B A;  3KJQ B;  3ZNJ 1;  3ILO A;  2BW2 A;  3TEH B;  3DRY A;  2J6T A;  4M5J A;  1RUS A;  2LQ9 A;  2CPJ A;  4PR6 A;  4CP5 A;  4Y0F A;  4AQY F;  1HBN A;  4KPC A;  5B0C A;  4WFB Q;  2UUB F;  2IM0 A;  1U0H A;  2VD3 A;  3PAC A;  2DR7 A;  2DD8 S;  4IRD A;  4NI2 B;  2LXU A;  1YWX A;  2C2M B;  4XO0 A;  1KQK A;  4QIW D;  3BQ1 A;  3NGS A;  4MTP A;  1T9Y A;  5HBM B;  2Q1L A;  4BWJ A;  4F67 A;  1JXE A;  1TVR A;  3CW2 C;  2HLU A;  3LGM A;  4DU7 A;  2VFR A;  2CJX B;  2DR5 A;  3TA1 A;  1UWA A;  2EWH A;  1DAX A;  4WK1 A;  3M8S A;  2CQD A;  2E5L J;  3A13 A;  4DV7 J;  2HK2 A;  1WJ9 A;  4USW A;  2ZH4 A;  1KRP A;  3LPY A;  4L3K A;  1B0T A;  4WZM A;  2F8H A;  1OIA A;  4A8K A;  4GVB B;  2DH9 A;  2CQ3 A;  1VIO A;  2CKW A;  2YX4 A;  3P96 A;  5ETM A;  5HMY A;  5DG9 A;  1FA0 A;  3LWM A;  3R1L A;  4DR4 J;  1NDL A;  1B64 A;  4DQR A;  1Q4R A;  3DRS B;  1G4C A;  1Q8I A;  2X1B A;  1QM9 A;  4OJ1 A;  3D6M B;  5CZX A;  4CTA A;  3MUR P;  5HRO A;  2FVR A;  4OI6 A;  1AUD A;  2GHW A;  4LF5 F;  3HJV A;  2D3Z A;  2WVB A;  4F25 A;  3CD7 A;  2XY5 A;  1SQE A;  3RUB L;  3DRR B;  1RKI A;  2VC0 A;  3UN3 A;  2OLW A;  2KDO A;  1NSQ A;  4K4X A;  3TUP A;  4B3R J;  2L9W A;  2YQ1 A;  3MM5 B;  4JI4 J;  2ZKU A;  3HCX A;  4KYZ A;  3N5F A;  2NXN A;  3R3T A;  4FPI A;  1HYS B;  1NB2 A;  3PIO Q;  3GSI A;  2V8G A;  3AXM A;  3W65 A;  3M6V A;  4USH A;  4CLL A;  4X4O A;  4CH1 A;  2MEW A;  4EO6 A;  1WHV A;  2DCU B;  3ELH A;  4O3Q A;  2XCA A;  4A8M P;  2ZZN A;  1WG5 A;  3OFE A;  3I5C A;  1ZM3 A;  4LF8 F;  5KOW A;  3IWX A;  2VG7 B;  2N7Y A;  3W62 A;  1F3V A;  5GME A;  3HZG A;  2CVI A;  3HHL A;  3HHN B;  5B0B A;  3M32 A;  1R6V A;  3BGO P;  4RBU A;  1S9F A;  3RR7 A;  2BE9 B;  4LQ9 A;  4N41 A;  4JYA J;  1TUW A;  2DEJ A;  3GTY X;  4PG7 A;  2E5L F;  4U8V A;  3DHX A;  4KTQ A;  2RF2 A;  1KSP A;  2HFS A;  3SDE B;  3JSM B;  1S12 A;  1FWK A;  4OV1 A;  1P1L A;  2MST A;  4G1I A;  4DFK A;  2NXJ A;  3FK4 A;  1C4A A;  3VR1 A;  1IBL F;  2QA1 A;  2MKI A;  2FJX A;  3C14 B;  5KT7 A;  3G71 S;  1WAC A;  2BJ8 A;  3M8W A;  1S5Z A;  1U26 A;  1OS5 A;  1WF2 A;  4PWW A;  1SKW A;  1T95 A;  5CCL A;  1XNR F;  1J5E F;  1X0F A;  1M90 T;  3NMA A;  1RT5 B;  2AKW B;  2DNN A;  3HSG A;  2YWH A;  3WQP A;  4LSN A;  5IQQ A;  3WIU A;  4J9R A;  4DL7 A;  3T9N A;  2YKP A;  4AXI A;  3CO9 A;  1U1L A;  5GAG U;  1EZZ B;  3PJX A;  4IFV B;  1D1U A;  2ADC A;  2AZ1 A;  1RQ0 A;  2K1R B;  2UXC J;  1K0V A;  1HWI A;  2Y8Y A;  5F0W A;  3KOA A;  1NLK L;  2XMA A;  2F9J A;  4FN5 A;  5AJ3 J;  3G86 A;  2MZT A;  2XLK A;  1X4E A;  2JWN A;  3CCV S;  3MPU B;  1LWC A;  4HHU A;  2HHW A;  1NZA A;  3Q8S B;  1LV5 A;  3F41 A;  1SIW B;  2JOQ A;  4WP3 A;  4C2M A;  1SH2 A;  1F0X A;  1N88 A;  1LEO A;  2EFO A;  3MEK A;  5DLG A;  3T1Y F;  4DV4 J;  2JLF A;  3P6Y C;  2RB7 A;  2F5G A;  5HJY A;  1BQN A;  3UDE A;  1SC4 B;  1AB8 A;  4I69 A;  4IR1 A;  2MQN A;  2F7V A;  2GVD B;  2VDH A;  4NZ7 A;  2XMV A;  3A3N B;  5DM6 Q;  4H4K C;  2KM8 C;  4PXD A;  5JMN A;  3D2W A;  1RAF B;  5KFV A;  3RTV A;  5M2U A;  3L3C A;  1C4C A;  3LPE A;  2OPR A;  5C42 B;  3DLH A;  1CJV A;  2V5H G;  2DBB A;  3QWU A;  3Q8Q B;  1SJ4 P;  1RHU B;  1WEY A;  2GAG C;  3EZO A;  2CZ4 A;  2QV6 A;  2RSQ A;  3SXL A;  1GH8 A;  5LJ3 Y;  3PO4 A;  1MLA A;  1IR1 A;  2D1C A;  2ZBQ A;  4AND A;  4CLZ A;  5LJ5 Y;  5DJB A;  2RS2 A;  2OD4 A;  1CG2 A;  2HWI A;  3PR4 A;  1FEH A;  1WKK A;  3R5D A;  5FLX Y;  3W2V A;  1KLN A;  4U7U D;  4U7C A;  3MUT P;  3J80 U;  1Q7L B;  1FRI A;  4JI4 F;  3MCM A;  1XNR J;  5KFS A;  2M3D A;  3PR5 B;  2KKH A;  2J0Q D;  2MPU A;  2VQF J;  1JQG A;  3PKM A;  3CJS A;  1JLQ B;  3TVZ A;  3PIP Q;  3VAF A;  2AJQ A;  1KKH A;  5A8W A;  1KOO A;  2XEX A;  1WEL A;  2AX1 A;  5D3G A;  1FT8 A;  4KHM A;  2W8K A;  2KHC A;  3T41 A;  2UXD F;  4NLT A;  4HAC B;  4AUK A;  5KAK A;  1L3K A;  1RTD B;  2BAN B;  3J7Z 5;  1FK9 A;  4RNN A;  2VPW B;  1X0P A;  4C8Y A;  2DJW A;  4N8N A;  4WU3 A;  3G82 B;  1TL1 B;  5KG4 A;  4JYA F;  4C0H A;  2E1A A;  2HQI A;  2I0X A;  5KFG A;  1U7L A;  2ZH9 A;  1S1V A;  3BSO A;  3CDA A;  4TY8 B;  3CNQ P;  2DNM A;  2FVS A;  2YWK A;  2HZA A;  4TLQ A;  4CZC A;  5C5J A;  3T5L A;  2FLP A;  5JVG Q;  4CLF A;  5A8K B;  4JI2 F;  4ZVE A;  3J81 j;  1M5O C;  1BWV A;  4ZPD A;  2NYH A;  4CYU A;  1NK0 A;  5EWF A;  4ID8 A;  4ALZ A;  1SJF A;  1I3O B;  1ZPW X;  1JNZ B;  3NOG A;  3ZTQ A;  3E01 A;  3TZW A;  1QAJ A;  4ZS6 A;  4PWD B;  2ZJQ Q;  4TXS A;  3V6D A;  5EN1 A;  4ID5 A;  1Q81 T;  2A3J A;  2CQH A;  1JK9 B;  3UFC X;  3G8T A;  3WDO A;  3CD6 S;  3QRR A;  1GEH A;  2E7W A;  4F3Q A;  1G6B A;  1NJZ A;  4Z37 A;  2WB4 A;  5LMU F;  5JVH Q;  4E98 A;  1LXN A;  3MUV P;  1S79 A;  2BKN A;  1Y9O A;  3D3B J;  2QSW A;  4CRJ A;  1RI7 A;  2ZFH A;  1I94 F;  4A8F A;  3D6F B;  1FNX H;  2JEF A;  2YKN B;  3L4B C;  3ILL A;  2E9T A;  3R2D J;  3F73 A;  1RAI B;  2V8V A;  2A6M A;  3HP6 A;  3IAM 9;  3CCZ A;  4PCQ A;  1GX5 A;  2YPZ A;  1IQZ A;  2YNG B;  3NBP A;  4NRU A;  1ARO P;  1H72 C;  1WEZ A;  4OZJ A;  1S1U A;  3M6X A;  4ZVT B;  2A1B A;  2ABY A;  2HRY A;  2ZJR Q;  1Q78 A;  1CJU A;  1SJR A;  2GC8 A;  2GV1 A;  2ZM6 F;  3PW4 A;  1VFJ A;  3N6N A;  1R31 A;  4YP3 A;  5H9E K;  1FVQ A;  2CPE A;  2ZKT A;  2RKI A;  3NAH A;  1N0V C;  1RCX B;  2LEP A;  3QWP A;  4WU2 A;  3SBM A;  4LBH A;  2HKE A;  1OY9 A;  2BE2 B;  4HEA 9;  4MMO A;  4OZ3 A;  1KLM B;  1RWW B;  5C25 B;  3IR5 B;  4NEZ A;  2XM3 A;  1N5Y B;  3ILJ A;  2FLL A;  4I2P A;  3DLB A;  4K0K J;  2IFX A;  3V5R A;  4ZMM A;  4LT6 A;  4MK9 A;  3NLC A;  5KG0 A;  1ZH5 A;  1IM6 A;  3CIZ A;  2CQI A;  1T9V A;  1P9Q C;  1WF0 A;  1WG4 A;  1HBU A;  1EJ7 L;  4Q0B B;  3CC2 S;  3BN7 A;  1NDP A;  2CZ9 A;  5M2R A;  4N7T A;  2O67 A;  3NS5 A;  5HJX A;  4ZVO B;  4PXB A;  1N6Q B;  4JI7 J;  4R0J A;  2GML A;  3HUL A;  4F02 A;  1T3N A;  4N5S A;  2W9B B;  3I32 A;  1N4L A;  4DPO A;  4QYZ K;  3PRV A;  2OPP B;  3EGN A;  2LQB A;  1NK9 A;  2H9Z A;  2ZBC A;  2AJ0 A;  1BUX A;  3BM7 A;  3LP2 A;  1G3O A;  4J90 A;  4PEO A;  4CM0 A;  4DN0 A;  1DY3 A;  5CAA A;  3DOL B;  2RU3 A;  3KHR A;  2ZC4 A;  5J1E B;  5D15 A;  2VOO A;  1XIQ A;  4ZHR A;  4R25 A;  1FXD A;  2GQ2 A;  3CCW A;  3W5X A;  4PG6 A;  3HLU A;  1J2V A;  2DXF A;  4C0B A;  4HKQ A;  4FNH A;  5LSL A;  1KHW A;  4F26 A;  2K06 A;  1HPZ B;  2QLF B;  5J2Q A;  1NSA A;  5D4N A;  1R0C B;  4ERD A;  1DJ0 A;  1QY7 A;  4NLO A;  4CLW A;  5KT5 A;  4X4P A;  3OSN A;  2XC9 A;  4DLG A;  4LRA A;  4X4U A;  3RGI A;  5FD1 A;  1OYE A;  4X64 F;  2HPU A;  3N0V A;  4CNY A;  1Y00 A;  4KHR A;  4O4G B;  1KFD A;  1QUV A;  2DEI A;  4HR2 A;  5GMD A;  4CT8 A;  2FZG B;  5KG5 A;  4NYZ A;  1WC6 A;  3KDO A;  2W4P A;  2MZQ A;  4KO0 B;  4OZ0 A;  3M2U B;  1FDA A;  4IDK B;  4YR2 A;  4I6W A;  3V6H A;  1SQF A;  3AAW B;  4P9S A;  4Y34 A;  4Z7Y A;  3MR6 A;  2JDJ A;  3SEO A;  2MJU A;  2R2T A;  3VAM A;  2HHS A;  4ES2 A;  1OY8 A;  3IG1 B;  1UW9 A;  1RHJ B;  3ENA A;  3LAM A;  4K8R A;  4QIE A;  3RRK A;  4GO5 X;  2ZNZ A;  4PAB A;  3KLF A;  1C0U A;  3MPW A;  3F56 A;  3SYZ A;  2GW8 A;  1YIJ S;  1RWX B;  5DO2 A;  4WFZ A;  1X4F A;  2OSQ A;  4QW8 A;  3CB4 A;  4IG0 B;  4RUA A;  1WOO A;  2Y1L B;  4D3G A;  2ASY A;  3I87 A;  2C3P A;  4DQQ A;  1WI6 A;  3PZP A;  5CYJ A;  4JV1 A;  3KLI B;  1FFW B;  4KY3 A;  2GFF A;  1TKD A;  4XDC A;  2GVZ A;  3ZNU A;  2MHE A;  4NA3 A;  5KFR A;  3KK3 A;  4AL5 A;  1KVK A;  1JLB A;  2JHE A;  2RVJ A;  3AH6 A;  1Q8L A;  3HHK A;  2KM8 B;  5KFK A;  3LA0 A;  2GIF A;  3KHL A;  3SV4 A;  4PWD A;  1XER A;  5F8N A;  2DIU A;  1TMM A;  2LQ5 A;  4KC5 A;  1RT3 A;  3Q8Y A;  3T5H A;  1XC9 A;  1F5C A;  4WFX A;  3I4P A;  5DZ7 A;  2HHH J;  2MZS A;  2MKC A;  4EBD A;  4DR7 F;  1RAD B;  2WBM A;  3OBI A;  2C1E B;  4U9R A;  3NXZ A;  4ZP7 A;  1O6X A;  2LQJ A;  3W7B A;  2DGX A;  4KV8 B;  1HI1 A;  4YY3 J;  1Q5V A;  1WC4 A;  1CJT A;  5E5N A;  4B9M A;  3QT7 A;  4WPA A;  3IN5 A;  2MQO A;  1X5O A;  4RL1 A;  1UEV A;  3E51 A;  2B5J B;  1T03 A;  1L3U A;  1PJ6 A;  4DPU A;  3HMJ G;  1JLC B;  2JEJ A;  2X1A A;  2AEJ A;  1H38 A;  1PGZ A;  1CEZ A;  5KFM A;  2NLW A;  2YWW A;  2BX6 A;  2ALZ A;  3UR3 C;  3TX8 A;  1WC3 A;  2BYC A;  4Y2A A;  3CCJ S;  2XNR A;  1KFS A;  1U8S A;  3TZZ A;  3FEY B;  1YRX A;  1UWB A;  2P6T A;  2L41 A;  1VC0 A;  2B6A A;  3DM2 A;  1YQH A;  3BYP A;  3Q8U A;  4YQW A;  4DSK A;  2V9K A;  4ZOS A;  1HNW F;  1HBM B;  4XPC A;  2JC0 A;  2C2E A;  1K73 T;  2HNZ B;  5F8G A;  3J7A N;  1RT6 A;  3ITH B;  3K8W A;  1CUL B;  4FNI A;  1WKJ A;  2MKK A;  1S6U A;  1LK7 A;  2HNY B;  3AXK A;  1HLW A;  3SCI E;  4ZLL A;  2DPI A;  3RAM A;  3HJF A;  4KSE B;  1IBC B;  3CVK A;  3E3X A;  3HZE A;  1SL1 A;  4F3O A;  2ZHO A;  4OX8 A;  5KFH A;  4HL9 A;  1TFY A;  1RK8 A;  1U2C A;  3EYZ A;  1R3N A;  3LAK A;  2H5E A;  3OJS A;  5DDQ C;  1QAY A;  1ZM2 A;  2M7S A;  5L46 A;  2YH1 A;  5I3P A;  1SUQ B;  4U8Y A;  2QMW A;  5ADZ A;  2RQM A;  3RRG A;  2ALY B;  3I0R B;  5CYM B;  4CQ1 A;  3RRH A;  2ATL A;  3MUM P;  2ERR A;  3MEE A;  5KFP A;  1H3D A;  3QID A;  1XNQ J;  2LU2 A;  1HIY A;  1HBN B;  1NEE A;  2CPZ A;  5SUH A;  1U1M A;  3D0G E;  2EFN A;  4YB5 A;  4X62 J;  3A3P B;  1U0H B;  5CHC B;  2B9E A;  1YBA A;  2X1G A;  3PX0 A;  3SQG B;  3OT9 A;  2OUG A;  4RW8 A;  3Q22 A;  1GXU A;  2E1R A;  1XN9 A;  3D5M A;  3HF5 A;  4WXW A;  1HW9 A;  4DL3 A;  1FJG F;  1Z1Z A;  3G6X A;  2FIU A;  4QWD A;  2V8P A;  2EEY A;  1S6Q A;  2NSC A;  3LP1 A;  1GXL A;  2H4W B;  1XEZ A;  2RE1 A;  4AYB D;  5B09 A;  4DV0 F;  3A12 A;  3W9H A;  2DXE A;  2HGN A;  4ZCI A;  4DSE A;  1NZ8 A;  3IC1 A;  3QLH B;  2JC1 A;  3LQV A;  5ETT A;  2APO A;  3X1L B;  1SKR A;  3UD5 A;  3OSP A;  1ZAV A;  3CDE A;  5KFI A;  2R7T A;  4EZ9 A;  1LOU A;  2C3M A;  3OL9 A;  4QCL A;  3IAS 9;  4L3N A;  2M0G B;  3HK2 A;  4X4V A;  2B51 A;  4L74 A;  1VIS A;  2K3I A;  3G2X A;  2OI2 A;  3VV2 B;  2QSF A;  2HYI B;  4B3S F;  4X4N A;  2IRY A;  4IUF A;  2QLW A;  4NLD A;  1WSR A;  2HAF A;  2R8G A;  2AX0 A;  2OEJ A;  1AYE A;  2V2Q A;  4QWB A;  3ZZY A;  4B9S A;  3J80 Y;  2H5I B;  3BN4 A;  1XMO F;  1DQ8 A;  3MWB A;  2J7U A;  3CF5 Q;  4UZB A;  2HBQ B;  4JV5 F;  2DYA A;  4E0D A;  2OKQ A;  2YKO A;  3THT A;  3NMR A;  1S4E A;  1WHW A;  1X31 C;  3NAI A;  1UVL A;  3CED A;  1S7I A;  1C1C B;  4RNH A;  3MMA B;  2FGO A;  1S9E B;  2GHV C;  3L9Z A;  2DGS A;  2W2Q P;  3LGN A;  3RBX A;  3UDL A;  1X9W A;  4NCA A;  2M5Y A;  2R7R A;  4CM2 A;  2O66 A;  4KGX B;  3MM5 A;  3C16 A;  2W4C A;  1I1G A;  3LP0 A;  2KVQ E;  1YJW S;  4NLG A;  4QQB A;  1HYS A;  1VJQ A;  2KG0 A;  4PG5 A;  1WC0 A;  3RU0 A;  3N6L A;  3SQO P;  4ZKA A;  1MWZ A;  2KXN B;  1OQ3 A;  1PBA A;  1VBK A;  2HFV A;  2ZH5 A;  1CPZ A;  1RAB B;  2CNK B;  3ZZR A;  1RKJ A;  3A4T A;  3EGW B;  5FLX U;  4ECV A;  5L8R C;  3GR1 A;  4OYP A;  2PII A;  3QFH A;  3PXG a;  1HL6 A;  5SZT A;  2PN6 A;  1FRK A;  3VQS A;  3MR5 A;  3HHL B;  2EW9 A;  4BS2 A;  4C8K A;  3E2E A;  3K58 A;  4CO3 A;  4F4K A;  1T9W A;  2DNP A;  2XMJ A;  5E3Q A;  3TVK A;  1UW4 A;  4EBC A;  4H54 A;  2RF2 B;  5AE3 A;  3SDE A;  5J2P A;  3CO0 P;  1JX4 A;  1N5Q A;  3I82 A;  4C98 A;  3D68 A;  2VIC A;  2XY7 A;  1NK8 A;  3FFI A;  2Z2M A;  4OHZ A;  4WFN Q;  4FPR A;  4NCB A;  1VS3 A;  2MDA A;  3W9J A;  1MMD A;  3N79 A;  2N3O A;  3WBZ A;  5H9F K;  4ZCM A;  4KE5 A;  3MAQ A;  4A46 A;  4M5K A;  2MTL A;  1F6T A;  3GR0 A;  5HL7 Q;  2Z4P A;  4OYO A;  2CIM A;  4RW6 B;  3CTR A;  4PAA A;  1KBR A;  3LAN A;  1RT5 A;  1LKZ A;  2DGV A;  4F36 A;  4IQM A;  4CH7 A;  2VA2 A;  4YHH J;  5KFC A;  1SJQ A;  1UZH A;  3UCZ P;  1HI0 P;  2KZM A;  4JI1 J;  5KFA A;  2Y9H A;  3PFE A;  2CA9 A;  2WVF A;  2VZ9 A;  4NPO A;  1MWQ A;  1JLF A;  2ZWO A;  3ZZT A;  2UXC F;  1JNR B;  2W01 A;  3I96 A;  4L76 A;  1TQL A;  2PI5 A;  2ZBR A;  5F8I A;  3H2V E;  2QE5 A;  2CPD A;  2BQR A;  3W2W B;  4RUH A;  4RW9 B;  3MED B;  1WD6 A;  4G1P A;  4URQ U;  4UZC A;  4ZDN A;  3P5T L;  3AQP A;  1BQN B;  4LF2 A;  4U7U K;  2AV5 A;  1MG7 A;  1Q16 B;  3MD3 A;  1JLE B;  4TNO A;  4C3K A;  3SMZ A;  4ZIV A;  4DR2 F;  1NJW A;  5HVF A;  3UVJ A;  3FZB A;  3PKY A;  1PIE A;  3PYF A;  2MKS A;  3NNH A;  4HVZ A;  1IKW B;  3M8Q B;  2G4B A;  5C42 A;  3I0S B;  5DS7 A;  4UST A;  2NRE A;  1IBK F;  5KFQ A;  1VIX A;  5ETQ A;  3PHE A;  4L73 A;  4KFB A;  5K14 B;  1U1K A;  3PEJ A;  1PYO B;  3GIL A;  2XMM A;  3A8I A;  4ECU A;  1WSV A;  2JRS A;  4P72 A;  2A10 A;  1UFW A;  1TK0 A;  4UTG A;  2C2N A;  4N47 A;  3VF0 B;  3W2V B;  4GMK A;  3VCD A;  2DO4 A;  4I1T A;  3U1L A;  3TAP A;  2P6S A;  1TZ0 A;  2V50 A;  5F8H A;  4TYA A;  5HLF A;  1SB6 A;  2UUC J;  2F8M A;  3FBC A;  2C2O B;  4ETZ A;  2BRK A;  4ZLN A;  3P4U B;  3OFF A;  3J7Y U;  2RDJ A;  1U6B A;  1Q79 A;  1UJ4 A;  3KTQ A;  1UPP A;  3EUN A;  3MM7 B;  5A8W B;  4JI1 F;  1NHU A;  3T19 A;  3G8Q A;  3L95 X;  3RZA A;  4ILM A;  3QZ8 A;  3HFZ B;  2IJR A;  3BGU A;  3GON A;  4KGZ B;  4HAC A;  3WX8 A;  5LMN J;  3K5O A;  1LWE A;  1FK9 B;  5D4L A;  3OVA A;  3J81 Y;  4EK2 A;  2MB0 B;  1VQN S;  4DR5 J;  4ZP8 A;  3MEG B;  2IRX A;  3G82 A;  1X4A A;  1FRL A;  1LFP A;  2B43 A;  1IVZ A;  2E9Z A;  1TP7 A;  3R6G B;  3RW6 A;  3M8R A;  1NJX A;  1CLF A;  2ZD1 B;  1BE4 A;  2QN6 B;  3OFG A;  4KRW A;  4PYA A;  3H8Y A;  5HSP A;  1NHV A;  3QT6 A;  1UVJ A;  1ZA2 B;  1RWK B;  3GFZ A;  4KH0 B;  4CYU B;  4OI0 A;  4C8Z A;  3VVT A;  2VOD A;  4B02 A;  4G3I A;  1N32 J;  3WC0 A;  3BF4 A;  2C3O A;  2LFV A;  3PFO A;  1ZS6 A;  5KFE A;  1FER A;  1ZAW A;  3ENW A;  1URR A;  2K7J A;  3V6D B;  1HHT P;  5KG7 A;  1W2I A;  2DGO A;  2YNF B;  2FVP A;  3IM8 A;  4MKA A;  1U49 A;  5CD4 H;  2EFQ A;  2M8H A;  2LEB A;  3QRQ A;  4DZD A;  2B9Y A;  3MR7 A;  2BE7 D;  3CCQ S;  3K5P A;  2J8S A;  1HNZ J;  1RLD A;  4DR6 J;  1NJI T;  3EWG A;  3QGP A;  1IQT A;  2KT5 A;  3IO1 A;  3NKY A;  4OZ2 A;  3W1Y C;  2W8L A;  4ZVR B;  4YOE A;  2ATC B;  3ZTO A;  4CO5 A;  3MCS A;  2MZR A;  3GMG A;  4J9Q A;  2YNG A;  4R5P B;  2MQ8 A;  3NBP B;  1T8E A;  3ENQ A;  3GJQ B;  2NUU G;  2FPH X;  5EWE A;  3JYT B;  3R5C A;  1VQM S;  4RLE A;  1RAJ A;  9ATC B;  1U1O A;  2CPH A;  4DSJ A;  4ZVH A;  3QJL A;  1SI9 A;  1XR6 A;  2J6U A;  4TLR A;  4ZJQ A;  4C3M A;  3BBC A;  2GMJ A;  2R8I A;  2BE2 A;  2EVZ A;  2OMO A;  5C25 A;  5KT3 A;  2Y0S D;  3EPI A;  2X7I A;  2OTL S;  4DUY J;  3DXS X;  3PW0 A;  1Q8K A;  1OMS A;  4Q0B A;  1KVI A;  4DUZ F;  1VQ4 S;  5LOQ A;  2B4P A;  2PGC A;  3TYT A;  1JJH A;  1N5V A;  1Y3K A;  2DNZ A;  3N6M A;  5E3P A;  5B7W A;  1N6Q A;  2CJK A;  3R8Y A;  2W9B A;  4GKK F;  4QPT A;  4ED4 A;  3BGL A;  4EU0 A;  1UL3 A;  2OPP A;  2M4M A;  1JIH A; 
#chains in the Genus database with same CATH homology
 3EJM A;  2HVE A;  1K44 A;  1NSP A;  1BUX A;  1NDK A;  5CAA A;  1HHQ A;  5IOL A;  1XIQ A;  3EE3 A;  4CP5 A;  3Q86 A;  1HIY A;  1UCN A;  4KPC A;  1MN7 A;  4C6A A;  3BBF A;  3FKB A;  1NDC A;  3B6B A;  1NHK L;  3VGV A;  4ENO A;  2DXF A;  2B8Q A;  1W7W A;  3NGS A;  1EHW A;  4AND A;  1B4S A;  4W98 A;  1WKK A;  2DXE A;  4UOH A;  5BXI A;  1U8W A;  3BH6 B;  3FBC A;  4HR2 A;  3ZTR A;  3G2X A;  1LWX A;  3JS9 A;  1KDN A;  3VVU A;  3EM1 A;  2BEF A;  3ENA A;  1NDL A;  3PJ9 A;  3L7U A;  1S59 A;  3WX8 A;  1S57 A;  1XQI A;  4UOF A;  3FBB A;  2DYA A;  4EK2 A;  2B8P A;  4UOG A;  3EIC A;  3NGT A;  4FKX A;  1NSQ A;  3ETM A;  3FBE A;  1BE4 A;  3Q89 A;  1NB2 A;  3Q8V A;  2CWK A;  3VVT A;  2DY9 A;  1F3F A;  3Q8Y A;  3ZTQ A;  3R9L A;  1ZS6 A;  3ELH A;  3FBF A;  4F4A A;  3EVO A;  3EVM A;  4WBF A;  4ANC A;  3Q83 A;  1BHN A;  1NSK L;  3GPA A;  4O0N A;  1PAE X;  4S0M A;  3EVW A;  1VYA A;  1JXV A;  2HUR A;  4DI6 A;  2DXD A;  3VGS A;  3BH7 B;  1B99 A;  3ZTO A;  3NGR A;  2AZ3 A;  2NCK L;  1PKU A;  3VGT A;  3ZTP A;  2BX6 A;  3DDI A;  1NPK A;  1NUE A;  3NGU A;  1S5Z A;  1NCL A;  3VGU A;  3EMT A;  1F6T A;  3Q8U A;  3BBC A;  3FCW A;  3FC9 A;  4DUT A;  3BBB A;  4F36 A;  3FCV A;  1WKL A;  3ZTS A;  5C7P A;  1WKJ A;  2ZUA A;  2HVD A;  2AZ1 A;  1HLW A;  1NDP A;  4DZ6 A;  1NLK L;  3MPD A;  5CAB A;  2VU5 A;  3DKD A;  4ANE A;  1MN9 A;  3GP9 A;  4FKY A;  1LEO A;  3PRV A;  3B54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...