2PIIA

Pii, glnb product
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction protein
molecule keywords PII
publication title X-ray structure of the signal transduction protein from Escherichia coli at 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1995-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2piiA00
1HWUA 1V3SA 4RWXA 1UL3A 4WK3A 3L7PA 2V5HG 4D3HA 2GW8A 4USJC 1NAQA 1Q1KA 2GNKA 4WK1A 5DRKA 3LF0A 4E98A 4OZJA 1V3RA 2ZOMA 1XK8A 1NH8A 5D4LA 1O51A 3M05A 4C3MA 3DFEA 4CNZA 2VD3A 2O67A 2PIIA 2J9DE 1UKUA 2O66A 4IYQA 2XULA 3AHPA 4CNYA 1VFJA 3GSDA 4USIA 4YB7A 1GNKA 4CO5A 3NCRA 3AH6A 3NCQA 4OZLA 4OZNA 4D3GA 1P1LA 3AA8A 2EG2A 2DCLA 5DS7A 1O5JA 2J9DA 3T9ZA 4CO4A 1UMJA 2NS1B 3HLUA 2EG1A 4USHA 2CZ4A 2XBPA 2Z0GA 4CO3A 4YB6A 3CE8A 2E66A 3N5BA 3MHYA 4C3KA 3O8WA 5D4NA 1UFLA 3X3UA 3TA1A 3TA0A 2NUUG 3NCPA 4Y65A 2RD5C 1VHFA 4Y6IA 4C3LA 4CO1A 4CO0A 1J2VA 2ZFHA 4RLEA 4CO2A 5D4OA 4R25A 4NYPA 4YB5A 5L9NA 5D4PA 4RWWA 2XZWA 1OSCA 4AFFA 2J9CA 2XG8A 4RX6A 2GX8A 1NH7A 1H3DA 1PILA 4ZK7M 2J9EA 2JJ4D 3TA2A 4NYOA 1V9OA 3AA9A 1KR4A 1NZAA 3BZQA 3OPKA 2NUHA 3O5TB 1V6HA 1QY7A
chains in the Genus database with same CATH superfamily
2GMJA 2YH0A 1ULRA 4CLLA 3CT9A 2J0XA 2R7VA 2G2ZA 1RTJB 4IRDA 5GAEI 2ZOMA 3AXKA 2JHEA 4AL6A 3A3OB 4O3RA 2DH8A 3QAEA 2JC1A 4BWJA 4JYAF 1RTIB 3NY0A 3IR5B 1S1VB 3IP0A 4K4UA 1FJGJ 2KT3A 3GR0A 2VFTA 4F50A 1A0OB 4PPDA 3I0RA 1UMJA 2C2KB 1H38A 4CO3A 3MEDB 3M2UB 4KR0B 1CC8A 2GGPB 3M8SA 4DR6F 2W8LA 2JLGA 2CPEA 5MLCV 1K1SA 4RW7A 1T03A 4LBHA 1G6BA 3MEEA 2IAJB 5L9NA 1NJXA 4LRCA 5D4PA 1FDDA 3J7ZT 3GWCA 4I0WA 2J76E 4IFVB 5A8WA 1C1CB 3AOBA 4DCOB 2MKYA 1AA1B 3VGTA 4LRAA 2K1RA 1OY8A 3HVWA 4MK9A 4WTOB 1QAXA 3Q23A 3J7YU 3RB3A 1Q4RA 2F1FA 2AJ0A 3ZTPA 1YJVA 1Z1ZA 1C2PA 2B8QA 3K5LA 3TZXA 4AUKA 1S4EA 2XYHB 3NMRA 4FF2A 3MR2A 4ED1A 4U96A 5A8KB 3AAWB 4DCPB 3M8PB 4NCAA 3T3FA 2HW3A 3MOJB 1IKVB 2P9EA 1S59A 4F0MA 2KFZA 4WP3A 4X4RA 2CPDA 3FBEA 3JXOA 4J9PA 2HFSA 2XTJP 1J27A 2X1GA 4XIUA 2GQCA 4P9SA 3MEGB 4I7FA 3CTRA 1K1QA 2YKNB 2AZ3A 5HK4A 1LQ9A 3TX8A 5DZ6A 3W1YC 4Y2MA 1RT4B 1HW9A 4DV4J 1SVDA 4ELUA 3DCAA 3GV7B 2W7PA 4ICLB 4DSKA 1AT1B 3T6BA 3M6UA 4K8RA 4C3MA 1KNZA 3CJKA 2UVUA 4FF4A 2A10A 4ZA1A 1MLAA 1SKSA 2AEFA 3NOCA 3H4BA 2DGTA 2CZ9A 3UNGC 1YLXA 2BE9B 3S7RA 1R0AA 4USWA 2MB0B 3ZZYA 4GO7X 4NLVA 4CO4A 4AT1B 2FY8A 1AUDA 2GVDA 2ZNZA 2RS8A 3DM2B 3WBZA 1FHTA 1PC5A 4P6QA 4K4VA 1KONA 3HVAA 3LGHA 4J9SA 1C4CA 2KKHA 1N36F 4GC6A 3UVJB 3MCNA 1L3KA 1NKEA 2RQMA 4RWWA 3QGHA 1OMSA 3M9NB 2DRAA 4HYKA 1FNXH 2CNLB 2I8EA 5DQGA 1Z2ZA 1JJCB 3I4HX 4Q8FA 2CPJA 4USJC 4HDHA 5KFJA 3BBFA 3IC1A 2POKA 3C14A 1P27B 2Z2LA 4WKRA 3MGJA 1NJIT 5KFDA 1ZPWX 1L5UA 1EHWA 1VQ6S 2ILZA 3MR6A 3BBCA 5AT1B 2AKWB 2W25A 2XMJA 2UUBJ 4OJ1A 5IQQA 4WPAA 3EVOA 2LXIA 1OO0B 2XMUA 1NPKA 2CG8A 2V94A 2W2OP 3OFFA 4OJHA 3DLJA 3E3XA 3OFHA 4KJIA 4WFXA 2MKJA 2XS2A 2AJQA 2ZJRQ 1SJQA 5JUMA 1KDNA 3P45B 4RKUC 4A8KA 4DXLA 4C8OA 1M1KT 2KXFA 2XO6A 4Q0BB 3DN9A 5IM0A 2AYGA 4UQGA 2E9TA 3RUBL 5CXTA 4M5IA 1SB6A 1VHIA 4DL7A 3R5CA 3QGGA 3TR5A 4I1TA 1QDUB 1SC4B 3I55S 2PE8A 3CCLS 3T9NA 4ECXA 3LAKA 3OHBA 3C66A 3QGPA 4LQ9A 3GSIA 3KJVA 4E0DA 4DBQA 5KG3A 4NYOA 1N5YB 1VQKS 1T9TA 4OYOA 2PI4A 4LBIA 2OIHA 1BD6A 3I5BA 3B4MA 4OYMA 1U47A 1JLGB 2FHKA 3D3CJ 1XBWA 2CYYA 1KLMB 3DXSX 2GAHC 4ZJLA 5D77A 2RDDA 5D4LA 3G2XA 5DLFA 3OFEA 3CCUS 3GIJA 5FLXU 2MTLA 1AFJA 2YWKA 3NBPB 5BXIA 2YNIA 3QLHA 4IO1A 3NXZA 3U1NA 4CO5A 2Y8WA 4JYAJ 3T19A 5B08A 2XLKA 4LSZB 1UEVA 4ZLJA 3JTPA 1RLDA 2ZWOA 2E66A 4I67A 4HACA 1F3FA 2HFUA 4IDKB 4IOCQ 4DR6J 3TZZA 2VG5A 1VBXA 1VDHA 2FVQA 3DGPB 5L1IA 3PX0A 2Z58B 2OTJS 4NMLA 3UO0A 3UNYA 2ZD1A 3GCXP 3M6WA 2OFGX 5D0EA 2GMLA 2AJ1A 2ZKTA 4EMDA 2UU9F 1T9WA 4PXDA 2IYGA 4DU7A 1XR7A 3HULA 4HH0A 5DLGA 3V6DA 1X31C 3HFKA 1NSPA 1EAYC 3ZXWA 3NGUA 2A0FB 4DSLA 3FQKA 1NK9A 2FJXA 2NXJA 2VBXA 1T7PA 3KNGA 2QLXA 1ZOTA 2LLZA 2W2NP 2K2PA 2HQIA 2PFDA 4QW9A 2HK2A 3G8SA 4DQPA 1GMWA 4ZP9A 1LWXA 4FKYA 3I0RB 1KBRA 3UPFA 3PW0A 3PIOQ 2ZVSA 3U1LA 1HI0P 1O6XA 1T05A 3BPSP 2EC0A 3EZOA 1TL1A 1KEKA 2KG0A 3OQ2A 2L9DA 3IA0A 5EWEA 4DV1J 4RW7B 1T03B 4BBYA 2ZBRA 2DCUB 3MEEB 3SCIE 4ZHRA 5GAHU 3CB4A 3RYLA 1TUVA 4TQSA 4F4KA 3DRXA 5A8WB 2UUAF 4LRDA 4PG5A 3SCKE 4TYAA 3G96A 2ZOGA 4NXMF 2JEFA 2GZOA 2K1RB 2CPFA 4DR7J 5B0GA 4ZVHA 3TAQA 3G86A 5BJRA 4P72A 4C8MA 3KHGA 5AXMA 1NXIA 4DPOA 4PG7A 1WELA 4X4QA 4HHHA 3EGNA 3HSZA 4KHPF 5KT5A 2BMBA 1FKOB 4UZBA 1VQPS 2OELA 1FWPA 4KH1B 2OLWA 3ISZA 3GV8B 1WG4A 5H9FK 2VBYA 1NO8A 3D7SB 4G1QA 1IKWA 1SJ1A 2OSQA 4M95A 2CPYA 3Q0AA 4OQJA 2H9ZA 4ZPBA 3I87A 2QYCA 3ZTQA 5EHHA 2JEGA 5KFTA 1U8WA 1X5TA 4PABA 3NAIA 3PRDA 1V3ZA 4OI6A 1S7HA 3I4PA 2APOA 4I7FB 3RGIA 4NCBA 3C8YA 2M4MA 3VAFA 2HWIA 2VG7A 4S0MA 2HNZA 3GV5B 2VC0A 3VVUA 1FK9A 1WC5A 2D3OR 4QIEA 3O44A 1X5OA 3HXMA 2CNOB 2GNKA 3TUIC 1W7WA 1NKCA 3SSRA 3PW7A 2Y8YA 1KKHA 2R3VA 4FNHA 3IBFB 4ECRA 3CCWA 4YR3A 5ETTA 3PW2A 2UVWA 5M2RA 8AT1B 2GQ2A 1ROFA 4OI4A 2O1PA 1VK8A 2AU0A 2QL7B 3CF5Q 3BR9A 4NOHA 2VJVA 3CJKB 4MYUA 5KG6A 2GJFA 2JEIA 2JOQA 2BABA 4V19J 1VIOA 1PAUB 1CJKA 3R2CJ 1UVLA 2MZQA 1Z4UA 2VPYB 1R0AB 3TUPA 2LA6A 2OPRA 2DEJA 4FBUA 2GVDB 4ECUA 3DGVA 4NE9C 2DRBA 2C3OA 3BH7B 2LEPA 1X9MA 5E3QA 2RRBA 3GZ7A 2V2QA 4DSIA 1FTRA 2AIRB 1FRJA 4R0EA 3CULA 1F5AA 1SH2A 4O23A 5IFMA 3L7PA 2QO3A 5ETVA 1KOOA 2A2CA 1UA0A 4ZCMA 3B8HA 3C14B 3IG1A 2VQFF 4NLDA 4ZCLA 1HMVA 2Y3YA 2IJFA 4HTIA 5HBMB 3OR2A 3R7NB 5I3UA 2QIFA 5DGAA 4JV2A 2VASA 4CLFA 1KQGB 3M8RA 1RSCA 3Q8PB 1JNZB 2CDQA 2XM3A 1RAGB 1T02A 1KOHA 4Z7CA 3C46A 3GMGA 3AT1B 5ADZA 4ZPAA 1I3OB 1NPPA 4JOUA 1K9MT 2N3LA 2DGSA 3ZZUA 2OTLS 4V1Ak 5HLFA 5IM0B 4NEZA 3RBDA 3Q8VA 1X9WA 3CUNA 2PMZD 3T1YF 1RISA 2BM1A 1URNA 1NK4A 4W92B 4USVA 3DXBA 4DI6A 4W4MA 2UU9J 3KJVB 1BUXA 4J5OA 2V68A 2E9ZA 2EFPA 3CMAS 2V9WA 2W9AA 5B0AA 1HKAA 4MK8A 2R2SA 5GAGI 3Q8UA 3EYZA 2OP5A 2R4FA 3HF5A 4KE5A 2ZH7A 2K3KA 4CIOA 2YNIB 3QLHB 3TUJC 1LW2A 3DLHA 3D66A 1Q7LB 3MEKA 2D9PA 4X4OA 4HHJA 1HBMA 4N8OA 3EVMA 3BN4A 2HFNA 2VUGA 3TWZA 3RW6A 4BWMA 4HACB 5C2CA 5EGYA 1D9DA 4YB5A 1I51B 3NMAA 2RDJA 2B9YA 2HMIA 5J2PA 2VG5B 3CIZA 3OPKA 5F8MA 1CULA 3D6TB 4IRCA 5C42A 2ZD1B 2A6MA 3MTJA 5FDLB 1RJJA 5IT0A 3LF0A 1IVZA 1UW4A 2V69A 2VBWA 1OQ6A 2V2ZA 2Z57B 2NPIA 2L9WA 2J0QD 4DL3A 2MKKA 3NAHA 4F26A 4N7TA 3RG6A 4O4RA 3CJ4A 1Q8KA 3ILJA 1GH8A 4CYUA 4A47A 4KHPJ 2WAQD 1P9YA 4NLTA 2OMLA 4A8QA 1HD1A 3D1QA 3TA1A 1M5OC 2PEBA 4ANEA 4CO0A 1UWBA 4DQQA 2EKNA 2YPZA 3RU0A 5I4MA 2K8GA 2GO8A 3P4UB 4DV7F 2ZH9A 2HVZA 2QMUB 2VKRA 2XZWA 5M2PA 4DR2F 5KFAA 3TI0A 2HVEA 2IC3A 2EWHA 2XG8A 1T94A 1S1XA 4KHMA 3W9HA 3F41A 1FEEA 3ONQA 1T05B 4F4YA 1WUUA 1TL1B 2HNDA 1DBDA 1OYEA 4HEA9 2QZ8A 2HBZB 2WBRA 4ZHRB 2R8GA 1L3VA 1YZ7A 4HI1A 4TY8A 2R7TA 3JYTA 1R8BA 4R0JA 2V4RA 1VBZA 1GTEA 3PRBA 2IJNA 2BANA 5T7LA 1YITS 1WC3A 2DGOA 4P7VA 3NNAA 4J91A 1OPZA 2EVZA 4LF8F 2RH3A 2J7WA 3DLGA 1Q78A 3HLUA 3GIKA 2H4WB 2WOMB 4MK7A 4Q45A 2LEBA 4EUVA 3R5DA 3MMAA 4CO1A 1VJWA 1RT7A 3IM8A 1ZZFA 3PKYA 1MW7A 2F9DA 5HVHA 4UZCA 4G1QB 1GMWD 1IKWB 1RHQB 3FRZA 3PJXA 1GQEA 3BV8A 1B7YB 3QT6A 2ZE2B 3ZZRA 2MYFA 2L9NA 3PACA 1NHVA 1DZ5A 3H5SA 3G6VA 3D4JA 2YXLA 1QLNA 3BSAA 4L76A 1CSJA 3VAKA 2B0GA 2VG7B 1WHXA 5KFKA 3R5BA 2IYIA 3KLEA 1FK9B 2NZCA 2HS4A 2ZBPA 1FRKA 2BJ8A 4P7TA 2HHTA 2VQFJ 3WQPA 2BJ3A 1HI1A 2GAGC 3AXMA 3BGRA 1PGZA 2HAFA 3BS9A 2KYXA 1CVJA 1C0TB 1KQKA 1TR0A 3P8BB 2FLLA 5A0YA 1APSA 2O01C 2MHNA 2IMOA 2ZJQQ 1YRTA 1H7XA 3IGVA 3H2VE 1CJKB 2V4QA 1ZA2B 3SXLA 3TEHB 3HVTA 1N0UA 4JI5F 1KP6A 2FPHX 2OPRB 1CQNA 2WB1D 3D0HE 5LJ5Y 2OGUA 1U1OA 4QQBA 5B7WA 1GXLA 4FDFA 3SSSA 2LQ8A 3KNAA 5HJXA 4PCQA 3OL6A 4JI0F 4E2FB 3RAQA 3NGSA 3J80Y 3TUZC 1U2FA 2ZOFA 5K20B 1UVJA 3R2DJ 3KJNB 5HMWA 1AXQA 3SSQA 4RJVA 5KOXA 1WJ9A 1WC0A 2VFUA 4KGKA 4GKKF 1VFJA 3NGKA 3EGZA 5DDRC 3G6XA 3LO3A 4RL1A 3IG1B 4LF5F 3JS9A 4RW6A 1GEHA 1RGVA 3GG0A 2ZBQA 4RUAA 3PRVA 3FGVA 1SC3B 2DO4A 1HMVB 1UJ5A 2G0CA 5U47A 1FESA 2C2EA 3OR2B 2Z0GA 5I3UB 3PNIA 2AGPA 2EFGA 2BZ2A 3IR7B 2B9WA 3CGIA 3CJRA 3FSXA 2DXFA 1SJ3P 3PKMA 2DIUA 4IG3A 5E2QA 1UJ4A 2RQKA 1RHUB 4UY8T 1WWHA 3R5JB 3ILLA 4QBUA 3KHHA 5D0HA 1XN9A 4MKAA 1LWEA 4Y0FA 4FYWB 2NXNA 5HLFB 4AE5A 5E3PA 3MM9A 1U09A 2D3O1 2DHSA 2B5JA 5IV3A 4RUHA 4QWDA 3NWGA 2WW8A 5CZXA 2AF6A 2G0JA 4UTGA 4CLZA 4DSFA 5KAKA 5BYSA 3KK2A 3RZAA 1Q86T 1IXKA 2P2CB 3Q83A 2D69A 2GHWA 1TKDA 3DLEA 3QMQA 3NCRA 4Y34A 5DDQC 2KZZA 2C3YA 4PZVA 2CQHA 2UXCJ 3L09A 3PYFA 4CLWA 1RT5A 2HQ3A 5C2GA 1JLAA 2QGFB 2DR5A 1XNQF 2PA8D 3OSPA 3I96A 5KFHA 4ED5A 1R3NA 4ZMMA 4URSA 1UZHA 2XMTA 4DR4F 1F1BB 4B02A 1QM9A 5KOWA 3LGNA 1HBMB 2XWXA 2HBRB 3FZBA 3ILIA 5BR8F 1A9NB 3OBIA 3PW4A 4DR2J 4PUOB 1WC6A 1S1UA 4JV0A 4FXDA 3CO9A 2HMIB 5J2PB 2N7YA 5F41A 1EQMA 1CULB 3QSYB 5KFWA 4WFNQ 4M5HA 2R42A 2KHDA 5C42B 1YDLA 2G13A 3GP9A 4OMFG 5D6GA 3PZPA 3BEGB 4C6AA 2H48B 4CRJA 4J9OA 3SDEB 3A4TA 4KKOA 2JVRA 1D3WA 2H51B 5DQIA 2BR0A 1DFDA 2FDNA 5K8PA 1KC8T 2OPQA 2VV5A 4NPOA 2BW2A 5F9NA 4LF8J 1FE4A 2P6TA 3ISND 3AJ2A 1PKUA 1Q8LA 5BYRA 3N5BA 2FLNA 4OHYA 4GRSA 4CQ1A 1PJ7A 2CG4A 1UCNA 4CYUB 1P1TA 1FX2A 5HO4A 4QOTA 2HHVA 4H4KC 1REVA 5D78A 2W4PA 3MCMA 4CT8A 1M5VC 4KYZA 3T1AA 2C3MA 1UWBB 2ZDOA 1R27B 4QPTA 2MJUA 2HRYA 3BZQA 1QVFR 1HI8A 5LSRA 4Q2LA 2D7SA 2QSFA 2IC3B 1S1XB 5E0OA 4FBTA 1RWXB 3DI6A 1TUWA 5E3CA 5GAEU 2HNDB 1W2IA 2BBEA 1IBCB 4USKA 5F8HA 4DEZA 1T8EA 1TL4A 3AHPA 4EK2A 1FJEB 4TY8B 2BV3A 1S1WA 4YB1P 4LR9A 2WTFA 3JYTB 2CQ0A 2P9GA 2V9KA 3WZ0A 2QMWA 2W1BA 2BANB 5T7LB 3PXGa 3PVXA 2FTRA 3FRYA 1VYAA 2HZAA 1T3OA 4KSEB 1Q8IA 4KO0A 2C42A 2W01A 3M1VA 1B3TA 3RBXA 4PEOA 3PJWA 5A8RA 1IN0A 1WKJA 1IKXA 3M9OB 3ZZZA 4OI2A 2R7WA 2DVIA 4NYPA 5H9FJ 1R89A 2XY7A 3ELHA 3OUYA 2D41A 3MMAB 2HYIB 4P73A 4JI5J 4CLTA 1RT7B 3K2YA 3IRWP 1DQ8A 1LEOA 3N6NA 5F3TA 3CCMS 1WF2A 4F8RA 5L39A 2J7UA 3VTIA 3D2WA 1YGYA 1UTAA 3G82A 4DX7A 1HD0A 5CZVA 4JI0J 1YJUA 1Q95G 4R5PA 2AMCB 3PJ9A 2XB2D 2ZH1A 2HHQA 3SQGA 1SL2A 4JI3J 2BJDA 4GKKJ 5ETNA 2E1PA 5KFCA 3ETOA 3RB0A 4NMXA 4DPUA 3ITHA 1E6VA 3T41A 4TY9A 3BGRB 3QT5A 4LFCF 4IR1A 4G3IA 3PTWA 4IQMA 1S0MA 3I6PA 1WD6A 4OYXA 1T9UA 5A0YB 2LP4A 1F60B 2BKPA 2H5JB 4RLEA 4P10A 3EGVA 2MKHA 1PG5B 4GVLA 1MU2A 4BDPA 4K4ZA 2VJUA 1IBKJ 3CJTA 3HVTB 1Q5YA 2O3DA 2WVCA 1KFDA 1UPMB 2MZRA 2RDIA 2KFNA 2DGQA 2H1YA 1VISA 4DR1F 3ETMA 4ZVPB 1NK8A 2VZ9A 4DWIA 2RKIA 2AEMA 3BREA 1RLCL 1W2BR 3ISNC 2FJDB 1PJ6A 4C8KA 4OZ1A 1U1RA 4F2SA 4ALZA 2VICA 2HWHA 2FVPA 2IM1A 1R6VA 1SJRA 3MR3A 5LMUF 5FD1A 1HNVA 3CD7A 1RHRB 2AW0A 2FJEB 4RW6B 5IS2A 1FFGB 1NSQA 5D4NA 2EFQA 3PEJA 1XNQJ 5KFIA 3HJFA 2MZJA 4OYZA 5DZ7A 4JI4F 1X0FA 1PCAA 4O3NA 3P49B 2F4VJ 4NA3A 3TQ1A 2D74B 4DR4J 1BWEA 3CC2S 2I9SA 3O3LA 3ULHA 1PILA 4OX9F 4IG3B 1N33F 5BR8J 3MWBA 3QT8A 1M1GA 3FSYA 3M4XA 2HHSA 2GIRA 2LFVA 1RUSA 1KHWA 1U6ZA 2CQIA 1LWEB 2MLZA 3BR8A 4X4PA 1CLFA 3P5BP 4DQIA 2JC0A 3MM9B 3FUYA 4WZQA 1C1BA 1RBOB 2B5JB 4DV2F 3W62A 1NM2A 1GXTA 4Y2IA 3WIUA 2KJWA 2FC8A 3KFWX 2NPFA 4L74A 1NSKL 3AB2B 4NLGA 4AQYJ 3KK2B 1LNQA 4C8ZA 2Z2ZA 2IRXA 4HVZA 3QGIA 2HHHF 2FVCA 3DLEB 4EBEA 4DN9A 3G6YA 2I6WA 2J6UA 2GO9A 5ETLA 1N32F 4K0KF 2FJAB 4K5RA 3KLHA 3G6ES 3CC4S 1RT5B 1JLAB 4URGA 1U2CA 4ER8A 1JLCA 3CD5A 2FD2A 1YK9A 2Y1LB 3HZGA 3ZC4A 2RHQB 1T9XA 4YP3A 2HVDA 3MPDA 1S6UA 2KJVA 2F9JA 3O1LA 2YX1A 5KFGA 3M6VA 3GIMA 5F8NA 2R8JA 3CJQA 3C3LA 2YH1A 7FDRA 1RB0A 2ABYA 4OZ2A 4ZVUB 4DS4A 2DH9A 1S1UB 4QIFA 5KG2A 2FZGB 4IUFA 3GFXA 3M32A 4F4AA 1H2UX 4NLWA 4QJVA 4U9RA 1HWIA 3HT0A 2U2FA 4UQTA 4ID8A 1SC6A 4ES1A 2DNLA 1P1LA 3D67A 3DC2A 3LOUA 3OR1A 1XMQF 2LQ5A 4J9MA 2BYCA 1R0BG 1RKIA 4KKOB 3HM9A 1XJWB 2HWTA 5A6WA 4EZ9A 1VQ7S 2WK4A 1Q0NA 3KDOA 4ZLPA 2XSFA 1TUGB 2BUNA 2OPQB 2XMWA 3G4SS 3QO9A 1IWGA 5I3QA 4ANDA 4PG6A 3A8IA 3T1HF 2CJ9A 4KHRA 3CDEA 4L73A 2HNYA 2V50A 1Q8BA 5KFUA 1REVB 4PYAA 1ZAXA 3DOKA 1FWLA 3RAMA 2EC2A 5FIIA 5F8LA 2QJ3A 2NSBA 2RILA 3L4BC 2M52A 3H98A 5DG9A 2ZH6A 5HVFA 5IOLA 4ZS6A 2JFKA 1NB7A 2WVEA 1HIYA 3IS9A 1MWZA 1FKAF 3CJ3A 2CPZA 3DI6B 3ENWA 3GONA 5KT4A 4RZRA 3MCOA 4DV5J 4OZLA 3TYTA 1Q7YT 2NYHA 3NGDA 2YKMB 2HURA 3FEYB 3AD9C 1S1WB 1F3VA 2CZ4A 1NK0A 3W8GA 4P52A 5HSPA 1IM4A 1NMEB 5GMKa 4EU0A 2ACYA 1DAXA 2R8IA 4LFCJ 4AYBD 4J37A 4KO0B 4U8VA 3M1VB 3MDFA 5EDWA 3DRSA 5A8RB 2UUTA 1RA6A 2NXEA 4XAKA 1S1VA 4QR0A 2VG6A 5CABA 4UUXA 3FCHA 3OUYB 2QLFB 1U0HA 1RDRA 5HMYA 4L3NA 2LMIA 3E01B 2XYGB 2DGWA 4FPIA 3JQJA 1RE1B 4ITSA 3IAS9 2I38A 2L48A 4NI2A 2ZC3A 2IM2A 3MAAA 3G82B 3A1YG 3MTKA 4R5PB 2HS3A 3GSDA 4UOFA 3VAMA 4PQUA 1KN6A 2BRKA 4DL0C 4M5LA 2J6SA 4LFAF 1UP1A 1VQYA 2EI5A 2LYVA 4UOGA 1Y10A 2X3GA 1S6QA 3IR6B 1Y3JA 3J81Y 4B3TF 5IC6B 1TQLA 3R1HA 4USHA 3BSOA 1SIWB 5LMUJ 1IR0A 5KFYA 1DARA 1O8BA 1RKJA 4DL5A 1YQHA 2YTCA 3ITHB 4N47A 2XO7A 3FEXB 3F44A 1UA1A 1S1TA 3MMCA 4MMOA 1ZM2A 4ED7A 3X1LB 1S77D 2ZHOA 4X4NA 3NEKA 5L1LA 4JI4J 2DNZA 4WZMA 2F8MA 1VMBA 1HPZA 3KMSA 4OZ5A 2QRRA 3VWSA 3WIVA 2JJ4D 3KUEA 2QA4S 4BLGA 4OX9J 2IPOB 2Z56B 4ZVRB 4FF1A 3N28A 1V3SA 5A8KA 1N33J 1AROP 3PY8A 4UY85 3RTVA 1MU2B 1YBTA 1FJGF 3OTDA 2ADBA 5JXSA 4MIAA 3PV8A 3R5AA 3VQTA 4LF6F 4CT9A 4QW8A 4K4YA 3KKFA 4WWSA 3MEGA 1X60A 1WC1A 3BM7A 4DV2J 1ZS6A 1R31A 4KC5A 1KQSR 1HQ2A 2RKIB 1YJ9S 1RCXB 4L3KA 3SZ2A 1YIJS 3IBWA 3LH2S 5ETQA 2EG2A 4PWDA 4OJ3A 3W2WA 1F2GA 3FSIA 1MG7A 3I5CA 3VF0B 3TJ8A 1S79A 3CSKA 4A4JA 3DLBA 1RAEB 1N32J 1HNVB 2KFYA 4K0KJ 2LU2A 1OIAA 2ATCB 4TLQA 1HA1A 4I68A 4OHVA 1BXNA 2OEKA 4DPWA 1HFEL 3QIDA 4U95A 3CD6S 3TA2A 4U67Q 3C2PA 3UR0A 4IQXA 1FERA 1VQSA 3OFGA 2M0GB 4HDGA 1F0XA 4AL5A 5LM7E 2IY5B 2W9CA 1MMNA 4EYIB 1N5SA 1QSYA 1WACA 5JVHQ 4H4OA 5K9FA 2HFZA 1WEZA 4CNYA 3AY0A 4C0BA 2GC8A 1IUJA 1KD1T 3BYRA 1C1BB 3PO4A 1IQZA 2E1AA 4CLYA 1NBEB 2Y1JA 4ZPCA 2QC3A 2XCAA 2KTQA 1XMQJ 2N82B 5K8OA 5B0BA 2RIJA 4TU7A 4M5DA 3J81j 3PO5A 2F8HA 4ELTA 4KBIA 1J2VA 1RA7A 1U0SA 1TL3B 1E6YA 1RWPB 2JL9A 5L38A 5KG4A 3KLHB 4V19X 1EIYB 3T1HJ 1JLCB 3AA9A 5J2NB 1XNRJ 2XS5A 1N5QA 2EBEA 1HW8A 1QUVA 1FXDA 1Q1KA 3V6HA 1TK8A 1WF0A 3HVRA 5HQMA 3PR5B 4X64F 2HZCA 1YTYA 3E8OA 1IJEB 1RT1A 2GJ2A 2M9KA 3G8QA 2MY8A 4PR6A 4Y2KA 2A6OA 1PBAA 2O66A 5GVQA 1RCOB 3PFOA 3W3SA 2F7VA 4KT0C 3ZZTA 4ECZA 4DL4A 3M32B 3FEZA 4N77A 4JV5F 3BQ1A 3BJYA 3UDCA 4HKQA 4XPCA 1RBLA 3K5MA 5ETRA 3OR1B 3GYXB 2QL5B 3LP0A 4MFBA 4O44A 4MH8A 1KLMA 5J2MB 4WFAQ 2BKNA 2M70A 3QBCA 2W7AA 4P2SA 3VAJA 3DU6A 4M5KA 2NQPA 1X4FA 2V6AA 2DHHA 3QO9B 3K5OA 3MMJA 4RPFA 2FVSA 4YEAA 2DGXA 1SIZA 3K57A 1U1PA 4RBUA 3V81A 3KG1A 2K3IA 1S6OA 1TFYA 3DOKB 2WVBA 2MJNA 1U25A 1RTZA 2KYZA 1FDBA 1ZAWA 3MM5A 4MKBA 3ENQA 3IS9B 4ZPWR 3QPIA 1J5OA 2GS8A 5DS7A 3OTEA 4LFAJ 4ZJOA 2EFOA 3PHEA 3N6MA 4CZCA 2IM3A 1WOOA 4B3TJ 3FK4A 1FXRA 1S0NA 2EBGA 5HP1B 4Y65A 2NSCA 1WI8A 1EP4A 2OKQA 2AV5A 2AJ2A 2AGOA 1JLQA 1WTFA 4EBDA 1T11A 1F5BA 2Q79A 1F9FA 2CQ4A 2NUHA 2X7IA 3DRSB 4PRFA 1EB0A 1L3UA 3T6JA 3TOQA 2GW8A 3FFIA 3PYGA 1FEHA 2VG6B 4OFZA 4E98A 1U8SA 5LOQA 1U0HB 3P6YC 4NRTA 1QSSA 2V8PA 2GFFA 4HTJA 1VLOA 1QAJA 2M3DA 2M88A 3HMJG 5BYQA 1VBYA 4LF6J 1TVRA 3SV4A 4Q7AA 3JAMY 3A3NB 4NI2B 2BX6A 1NRKA 2MKCA 5EX3A 1RT2A 2B9XA 3MAAB 4DV3J 1CBKA 4O3PA 5AJ3F 4GMKA 4MKYA 2J9DA 2EFVA 1V5IB 4PQUB 5LSLA 2RQCA 4YDXA 1XQIA 4EFAC 1S6QB 5LT5A 5F0UA 3D9BA 1SQGA 1VHFA 4H54A 2RVJA 1NKBA 4TNOA 4YFUA 3D6HB 4DS5A 2C2DA 4WYLA 3KYLA 3S8SA 1ITPA 4J9RA 2L41A 2IM0A 2JH3A 1S1TB 3MMCB 3KTQA 2HHWA 4WBFA 3AQPA 5DM7Q 4TYBA 3F73A 2CJBA 3GYNA 1HPZB 3RR8A 1DLOA 1FKOA 3BYPA 2HEKA 1NSAA 1OS5A 4LRBA 8ATCB 2DR6A 2RHSB 4RNHA 4DSJA 1BQMA 2GV1A 1RADB 5HATA 1MWQA 3M2VA 1N0VC 2IVFB 3RAXA 2PDAA 4P74A 3QNWB 3M30A 2EPIA 1Q82T 2OSRA 2HGLA 4F0KA 1U1LA 3U7JA 2EEYA 2FIUA 4DV1F 3LTOA 2W4CA 4MJKA 3DOMA 4PWDB 1D09B 1RAOA 2R8KA 3CJ2A 3UDLA 3WX4A 3KOAA 3W2WB 2W2QP 3MUTP 4ZN3A 4PXCA 4FXVA 2CIMA 1TL5A 2CXEA 4DV0F 3K5NA 2K06A 5HN0A 4IOAQ 3AOAA 3JSRA 3CJ0A 4DR7F 2KU7A 3CDWA 1OY9A 3JQMA 2G1HA 4F36A 1HARA 2RQ4A 4P71A 3JSMA 1S5ZA 1K47A 3KG4A 3OXLA 1UL3A 5KFMA 5E3AA 1NDLA 1YKWA 4W90B 1X4DA 2DJWA 1TKTA 3MXHP 4O0NA 3N0VA 3RBEA 3QFHA 4KGVB 1WHWA 2PEHA 3HHLA 2HFVA 1FDAA 4X64J 5K14A 4F67A 5THWA 2W9CB 1GNKA 1X5SA 1LKZA 2JZ5A 1FT8A 3KHRA 2P9CA 2HGNA 2DNRA 1N48A 3RRKA 3W5YA 3MPVA 4H4OB 2MY7A 1VLYA 3A8EA 3EVWA 2J0SD 2XSJA 1S10A 4FPRA 2DBBA 1W25A 5CA5A 4JV5J 3MUVP 3IMQJ 4GC7A 3Q24A 2R7OA 2W4DA 4ZLNA 4QU6A 5DG8A 5KFXA 4JP8A 2J0WA 3N9UC 3CCJS 4M5DB 1FCAA 3TRGA 3HSDA 3GCWP 1UWAA 2UP1A 1GXUA 3W7BA 2R2UA 1JXLA 2V34A 2M7SA 1WDDA 2A2DA 2R7QA 5HBMA 4HLBA 1E6YB 3L3CA 1JB0C 1VR6A 2ZWPA 2RAQA 1RI7A 1N56A 2OPPA 1U1MA 1YJTA 1RZMA 2P5VA 4ZPDA 2N4DA 1XWLA 1BWVA 1RHJB 1IR1A 3CMQA 1UEKA 2F8EX 3DDNA 2X1BA 2VBZA 2E29A 2HHXA 4NZ7A 4HI2A 3SI8A 1RT1B 4ES3A 3CW2C 3EZUA 1HYSA 1S99A 4DL6A 2MQPA 3L7OA 3NLCA 3HCXA 2OH2A 4NA2A 3KWMA 1K0TA 3C16A 1QE1A 3VALA 1JMTA 5L1JA 4ECWA 1TP7A 1R6YA 2G0IA 3W65A 1ZM4A 2FJWA 4DR5F 1RABB 1HBOA 1VOMA 2B8PA 2XY6A 3LP0B 3HHDA 4MFBB 4O44B 3HKZD 3ADAC 4ID5A 4QYZK 4U6PA 4YR2A 1WOPA 5F3ZA 3UWTA 5LJ3Y 3O5TB 4C11A 2VPZB 2CFXA 4LUBA 3HD2A 4JI1F 2XMMA 2BW7A 3DFEA 3V81B 2XULA 1A7GE 1RWOB 2WW4A 3QJLA 2VA3A 2KVQE 5A6PA 1VC0A 3UR3C 1QAYA 2AQ4A 3EDQB 4CLSA 5CYMA 5AJ3J 3CD0A 3MM5B 2XNQA 4ETXA 4YB6A 2VDHA 1LWCA 3FMBA 4WXWA 3QWPA 4LIRA 1J5OB 2EKYA 6FDRA 7AT1B 5FDLA 3N79A 2B4UA 4ZP8A 1H98A 5GADU 1X4GA 4B9UA 5CYJA 1U45A 2ALYB 4QWEA 2LCWA 2BQUA 2BACA 1EP4B 4KQZA 4J9UE 2AJ4A 1Q79A 1YSJA 5E7OB 2KZMA 3D6MB 3ZTOA 3IBCB 4AXIA 4RBTA 1JLQB 3VR1A 1JX4A 2ZC4A 4IH7A 5DRKA 1IR2A 4OZJA 4IH5A 4K5SA 4OX7A 4QYRA 1K8AT 4B3SF 4ECVA 4FS1A 2CPIA 4CNZA 3FFIB 1SV5A 3W9IA 2GVZA 5IQ6A 4I2PA 4Z37A 5ETSA 3I31A 4RBVA 9RUBA 1IQTA 2CVIA 1XR6A 2GIFA 1YRUA 3MURP 1TVRB 4OI0A 2VFSA 3H5UA 3KG0A 3FCVA 1RT2B 3TNVA 1WNEA 1X4CA 1H2TZ 2XI3A 5CHCB 3EXCX 4LT6A 5HANA 4UOHA 3BKTA 4FVCA 1IWAA 2JRSA 1FF2A 3QATA 4K50A 4TVAB 1UEUA 4WTYA 4LF4J 2DNPA 1EJ7L 4NXNJ 4DV0J 1RWWB 1H7WA 2UXDF 1Z2LA 7FD1A 3K89A 2KXNB 2XGQA 3LQVA 4B9VA 3TVZA 2F4FA 2RT3A 3UN3A 3JSYA 4PQAA 3QRPA 3ZTSA 2VQEF 1HNXF 3MFHA 5AXKA 2WOMA 2MSTA 3GLJA 4CH0S 3VAIA 1MN9A 1DLOB 3UFCX 1EKSA 3UD5A 3R6GB 1P8GA 2NZ4A 2PMWA 3T5JA 5J1EA 2PGCA 4WXOA 4G1IA 1VS3A 1PYTA 3IM9A 3S01A 2UVRA 3V4IA 1BQMB 1H2VZ 2I0XA 3UN2A 3M2VB 4NYZA 2ZE2A 3CO0P 1RAFB 3BPDA 2B7BB 2WBMA 5H9EJ 4WFZA 1R8HA 2AWZA 5H1SV 2MMYA 3M30B 2E5LJ 1YWXA 5KG7A 2AT1B 3JTOA 3NCPA 3UN5A 5F8GA 3M8ZA 1B7FA 4ZPTR 1TKZA 3IWNC 5KFZA 5ETMA 3DOMB 2EFNA 3T5LA 2KL8A 1Y5LB 4EWTA 3HSGA 3W8PA 1NJWA 1FJCA 4Y00A 4CTAA 2L08A 4ZVSB 1XERA 4C2MA 1X8DA 3HFZB 3I0SB 3W60A 4NCGA 5G0RA 1HR0J 1C0TA 1D1UA 3TVKA 3CVKA 4K4TA 4Q5VA 2WSCC 3JSMB 3QZ7A 3EJMA 2CKWA 2QN6B 2XCPA 4LQ3A 3KDNA 4WF9Q 1TKTB 1X9SA 1GMUA 1TAQA 2JFDA 2WONA 2FZKB 3HHLB 4K4SA 5K14B 3W66A 2J7KA 4LFBJ 1JQGA 2FVRA 2HQFA 2QFJA 3GE9A 2ZH2A 2AYBA 5F8JA 3H5XA 4C3KA 1UVIA 2HVIA 3QT7A 2ACMA 2ZZMA 2HQDA 3H42A 4OYIA 4B3RF 2XSJB 1CJVA 4ZITA 4KIAA 4DR5J 2DISA 1G7CB 1L3SA 4U7UD 1WHVA 3HHKA 3DRRA 2BOAA 3BGFA 2D3ZA 4WKYA 5HL7Q 4ZK7M 2VF3A 3TW0A 1V5VA 1BHNA 5T41A 3LA0A 3CC7S 2HG4A 5KFLA 1KVJA 2HBQB 3B54A 4LR8A 3QSIA 2H4YB 4RNFA 2DHAA 2KVIA 4JI1J 2YQ1A 2OPPB 3GFZA 1HBNA 4LIWA 3CDAA 3V6JA 2VD3A 3NG8A 4AL7A 1IM6A 1SI9A 2UV8A 3VHQA 4ED3A 4OLOA 4U7UK 2R2TA 1FDNA 3HHLD 1HWJA 3Q8SB 4ZVGA 3QQCD 2ADCA 2LKZA 3J80U 3HHNB 1RWVB 1HYSB 1WKLA 3MMBA 1ZA1B 3TA0A 3TAPA 3TO8A 1VQMS 2BE7D 4WP9A 3EICA 3C16B 1QE1B 2ASLA 1FTCA 3FVYA 1CJTA 5D3GA 1FD8A 3HPOA 2VL1A 2DHXA 1HBOB 3D28A 2QL9B 3CCES 1KR4A 5HVGA 2D1CA 3MCSA 2UVVA 4I6WA 4ID5B 2WB4A 2DNHA 1LV5A 1FVSA 1AUSL 2YWGA 2PFFB 3KLGA 2Q43A 2DXEA 4QU7A 3FBFA 4C11B 4B9TA 2LVWA 3E51A 5RUBA 2C2MB 3OTBA 4B3SJ 3C15B 2MGZA 3PYEA 3TANA 2VB6A 4J9QA 1XMBA 1I6JA 4NEYA 1KHVA 5B0DA 4PUOA 1QUPA 3BDPA 2M5YA 4DX8H 1KFSA 5CYMB 2Y1RI 5J1PA 1LXJA 5C25A 2IA0A 4DR3F 1FWKA 1RU2A 1LWCB 3J7Z5 2XWYA 1S9FA 4TU9A 3AJDA 2DXDA 2XZTB 3CCVS 2DNYA 2PC6A 3SDEA 2XHWA 4IFYB 4X2BA 1FI4A 4F7VA 5CD4H 2UXDJ 4CM0A 1Y5NB 1UW9A 4O0IA 2DRDA 5I3PA 2UXCF 3AB4B 2VQEJ 3HP6A 1FRMA 1HNXJ 2C2NA 3OV7A 1ZZNA 2C2RA 4A8FA 2Z2MA 3AODA 3V5RA 1GTHA 4FS2A 2J8SA 3IO1A 1PYSB 2OFHX 2NXUA 2SXLA 5K8NA 1S9GA 1SV5B 2GVZB 3IN5A 4I2PB 2DPJA 1NZ8A 3ZTRA 4LRFA 4J9KA 2DNNA 5EX0A 2G4BA 4DG1A 1JKHA 4IG0A 3N5FA 3EE3A 4DLEA 4ZKAA 5CAAA 2BKOA 5E5NA 2B6AA 5K5MA 2F40A 4LF9F 2YKQA 5D0GA 1HHQA 2JWNA 2YNHA 4HL9A 1NK5A 2ZBIA 2ZEJA 4JI8F 4RX6A 2GX8A 1Y5IB 1HNWF 3AOCA 2C1EB 2W9BB 4ZOSA 2XMVA 2R8HA 1UAWA 2RU9A 1HQEA 4L75A 1CS4A 3CIMA 1JJ4A 3HHLC 3NNHA 2X3DA 2FJBB 3BH6B 3QIPA 2WHOA 2IHR1 4ZIVA 3I9ZA 4ILRA 2H5IB 1NUEA 5AE1A 3MAQA 2GJIA 2VA2A 3Q89A 2RUSA 4KPYA 1MMLA 3R5GA 5J1EB 2CQGA 2HK3A 5GMDA 2BOPA 4NLPA 3V4IB 4YUDA 5ITHA 3K58A 4NA1A 4BHQA 3T5KA 5KFFA 3VGSA 2PD1A 1SPBP 3QJPA 1SUQA 2XMAA 4B3RJ 2P6SA 2KN4A 3HDSA 4C4WA 4OL8A 2OAUA 4K2JA 3BKFA 1TKZB 2XHCA 2KXHA 3EM1A 4P2FA 4QWAA 2J9EA 4KAIA 1S0VA 2ILYA 3V2UC 1YVFA 4RW8B 3DYAA 4M5MA 4C98A 5DQHA 1IBLJ 1AZSA 4CTAB 1X4BA 1T9YA 4DX5A 3A12A 1TMJA 1ZYQA 4NCGB 2BA9A 5G0RB 3RR7A 2DGVA 1KVIA 4W98A 3UCUP 1ZM3A 4LREA 4NLXA 3UI3A 1J5EF 4DQRA 3SEOA 4OYPA 1NU4A 3IWLA 1OWXA 4I64A 4KV8A 3UW1A 2JEJA 5IT9Y 3K8VA 4KGMA 2WONB 5CYQA 5DDOC 5KFOA 2WVFA 5DG7A 2DNGA 3O8WA 1FRXA 1SH3A 3Q8YA 5KFVA 3DDKA 4TN2A 1S48A 4I2QA 2UZAA 4XTTA 1FKPA 4B3MJ 4J9VA 5B0CA 2QLWA 3DKDA 4USTA 3Q22A 1BGXT 4I6AA 4X4UA 1CJVB 2Z30B 4JI3F 1CC7A 2N3OA 2BM0A 2MPUA 4UW2A 3DRRB 1A6LA 4WK3A 1FX4A 1HBUA 4EI2A 4Z7YA 4PPZA 2NYIA 1VIXA 1P6TA 1JXEA 4FNIA 4IRKA 1D8ZA 5L8RC 2XC9A 5J2QA 1UVKA 2VFRA 2VH7A 3HX9A 1VQNS 2C2OB 4ZIWA 4USIA 1O0PA 1LXNA 4KTQA 4DZDA 4R8UA 1I94F 3CPWR 5MAOA 3TJAA 1HBNB 3VGUA 3B6BA 4OYWA 2CJYB 3VAGA 5KFRA 3EPGA 4DZ6A 2HQCA 5KFQA 4CCHA 1IBKF 4JUZA 1QVGR 1YZ6A 4OIXA 3PG9A 2Y0BB 3EDRB 1KVKA 5ETOA 4F4ZA 5AE3A 3MZIA 3RB4A 4DR3J 3MMBB 1FJ7A 4YMEA 4PKDB 1R8CA 1GAOA 4DF4A 3FBCA 2RU3A 2QTWA 2XS7A 1CJTB 2QEXS 5D3GB 4QYZJ 3HK2A 4DFMA 1RU1A 4WP8A 4C8NA 3WDOA 2HAIA 3B82A 3E2EA 1WDTA 2H3EB 2NREA 2O67A 4KFBA 3KLGB 3MPWA 1Q81T 4YB7A 4OHZA 1N5TA 1RT3A 1K73T 4QIWD 5KT6A 2QFIA 3SQOP 1FD2A 3DNCA 2F4VF 1RK8A 1RAHB 1TZ0A 2MGZB 3J7AN 3GQCA 1MN7A 1VRUA 4X65F 1N34F 4NWBA 4B9LA 2ZUAA 1Y11A 2FLPA 4C8LA 3OLBA 1LK7A 2NXCA 4M63A 4LF9J 5C25B 1KTQA 2DD8S 2UV8G 4LVNP 4JI8J 1RACB 3GIIA 3R6LB 1HNWJ 4OX6A 4RUBA 3D5MA 1OSDA 1NEEA 2A1BA 4A46A 1JJ2R 1G1XA 4ERDA 3MR7A 1GK8A 4AQYF 3H2UB 2VONA 3LP1A 4ZLLA 2NR0A 2WSEC 5HROA 1RWUA 2RS2A 4FF3A 2DGUA 4LSLA 1B4SA 5G4DA 3D1OA 4DCJB 1XEZA 1QJHA 3CMES 1OY6A 1HHTP 3GJSB 1K44A 2CUYA 4G1PA 4ZN1A 2BEFA 2GHVC 3MHYA 4ZCIA 1S9GB 2CJKA 4NLUA 1SC1B 5KFEA 3X3UA 1QTMA 1S4FA 1PO6A 1PAEX 4DG1B 1JKHB 4IG0B 3K8WA 1HNIA 4DU8A 3IGNA 2B6AB 4JB8B 5F9LA 3RJMB 3UCGA 5DDPC 4ENOA 4RU9A 4M8LA 3BBBA 1HWKA 1RHKB 2YNHB 4AXJA 2IMWP 2MQ8A 5LXRA 2V2VA 2YKMA 3BF4A 4X66F 2JX2A 5C5JA 3CXCR 4CWBA 2MKSA 3IWXA 4WFYA 3WC2A 4O4GA 3WX8A 2UUWA 1YJ7A 1H73A 4WIQA 1HQEB 1CS4B 4DQSA 4JV1A 2HS0A 2E5HA 1GX6A 2PI5A 2RF2A 2YBVA 2KDOA 3I32A 5HI7A 3R27A 1J5EJ 1K0VA 4B08A 3NCQA 3QIPB 3MFIA 4FYVB 1B0PA 2W24A 4ELVA 2X1AA 1YJNS 3GR1A 3N6LA 4OZ3A 2EG1A 5A2QU 3HSJA 3I56S 3CCSS 4OV1A 4PYDA 3NS5A 3LWLA 2YPYA 5I42A 3L95X 3PEHA 3GILA 3E01A 3GJRB 4C3LA 1U7LA 3K7RA 1FO1A 5B0FA 3OVBA 2JSXA 3BN7A 2CA9A 2C3PA 4ES2A 1H72C 4C8YA 1TV6A 1LOUA 1SUQB 1VQ4S 4NRUA 1V9OA 2KM8B 4PAAA 1DTTA 1XMOF 3KXDA 4DV5F 1N36J 2QG9B 2V5HG 2HGMA 2IRYA 4ILLA 4H4KA 2LECA 4L72B 1PC4A 1AW0A 1B70B 4EEYA 2BJEA 3BO4A 3DYAB 1O51A 2H54B 3TP2A 1AZSB 4FVMA 2A18A 4XK8C 1UVMA 2D3UA 2FJVA 4BCAA 4PG8A 4RNNA 3H59A 1U02A 1VJQA 2OO4A 1I94J 3FQLA 1F5CA 4OV6A 2J6TA 3JB9k 3T9ZA 4DFKA 3VZHA 4DN0A 2VU5A 2G1DA 3RRGA 2ZVIA 3H25A 4DJBA 4KV8B 3F0NA 3M7VA 4B3OA 5EUHA 3MM6A 2G9OA 3M9MB 2FGCA 2NUUG 2CRLA 4F0HA 1Y3KA 3FDSA 2MQOA 2F63A 5CYQB 3KUGA 3FKBA 3DLKA 4URQU 4ZPVR 2OD4A 4YS2A 4I2QB 3KLFA 1FKPB 3U27A 3J81U 4XO0A 1RWMB 3L7UA 5KT7A 2KG1A 4QR2A 3BB5A 2IDLA 2FC9A 4X4TA 1TL7A 4LMZA 3H0PA 2XGPA 3DOLA 4G65A 2BRLA 1V3RA 4KY3A 5HAOA 1TFWA 5KFPA 1QTNB 3VV2B 4CM2A 1HBUB 4CH1A 3BGOP 1G4CA 2CVEA 3OD2A 3N01A 4ZVQB 3Q8RB 5J2QB 4J90A 2L3MA 4TXSA 1F9EB 2LDYA 4ZDNA 1MROA 4NZ0A 4WU3A 3FNNA 1L3TA 4R8UB 1NJYA 1H74A 1WORA 3KUHA 2HLTA 4X65J 1N34J 4MYTA 3VQSA 4ZJQA 4CLKA 2K7KA 2OEJA 1HNZF 1B64A 3TJ9A 1N5VA 1KTVA 4Y3CA 5FLXY 3VAHA 4R25A 4BS2A 5D0RA 3J7A1 2DHGA 3EX7B 2CJAA 5L46A 2I1RA 2QA4G 1VC5A 3R3TA 3K5PA 4F04B 1NZAA 3GJQB 5CCLA 3QFWA 3PX6A 3BDEA 3O6QA 4U7CA 3Q2TC 3LAMA 4PG4A 5DO2A 2FB0A 3OTCA 3R8YA 4ZP7A 5A76A 4KGZB 5T14A 2Q66A 3C6UA 2YQ3A 3NS6A 4NLYA 2OMOA 1TU0B 2CDRB 1RAAB 2AX0A 1TL3A 2R7SA 1HHSA 1U48A 3B78A 1RTDA 5CD4A 3NRBA 5JJBA 4KFBB 4N56A 1X5PA 1B0TA 2YY3A 3PM9A 2OD6A 3NP5A 1X4HA 5J2NA 1YJRA 1RT3B 4J7CA 4HT5A 2DY9A 3GJTB 4RW9A 1HQUA 1U2RA 5IXUA 4HT7A 2DY1A 2FHOB 3HFVA 1VRUB 3W9JA 3DLLQ 1ACMB 1JLFA 2E9RX 1R43A 2RRNA 3M6XA 3RBZA 2XQCA 3HJVA 2AGQA 1PYOB 4N76A 2RJZA 2X1FA 1GMVA 5GMEA 3UD3P 3MM8A 2DK2A 1ZM9A 2JLEA 2LQ9A 4X66J 3KHLA 1FA0A 2Z2YB 2QT7A 3PCOB 1NDCA 2OEMA 2Y1IA 4Y2AA 5J2MA 2YX4A 3NKYA 1JIHA 3LP1B 1DTQA 4YHHF 2DB1A 3MUMP 2H65B 5HROB 3A3PB 1SH0A 2UUAJ 5KG1A 2IRUA 3KJQB 4LSLB 4RNOA 4JI7F 3BSCA 2ZH3A 4NXMJ 3H4DA 4YDDB 1S72S 3IAM9 4ZVEA 1MSWD 2DKOB 2N7CA 3G87A 3AD7C 3CEDA 3V6DB 4QZVB 3W63A 1XTZA 1XNRF 2KM8C 1U1QA 2FQQB 2V8DA 5E33A 1X4AA 3BO3A 2YNFA 4TU8A 2Z4PA 2BVZA 5A2QY 1IKYA 4DL2A 4WU2A 1WC4A 1YBAA 1U49A 4WCEQ 2DH7A 4DF8A 4ECYA 1DURA 1HNIB 3WC0A 2QA2A 2J5AA 1V6HA 4QPXA 1HWUA 1SQFA 2O5DA 3G9CA 4WJBA 3K59A 1XMOJ 4B9NA 3Q86A 4WK1A 2B4PA 1WOSA 1XC9A 2RSQA 3W2VA 1UFKA 5JVGQ 3M05A 5HP1A 2HIYA 4LR7A 4X62F 2CQDA 2E5IA 4LF7F 3SFUA 2V4JA 1Y0HA 2B56A 2ZUGA 3U02A 4HR2A 4O4GB 2MQLA 1N4LA 4RW4A 4A8SA 3BGLA 1LFWA 4DX6A 2AJFE 2RF2B 4P2XA 1S57A 2B9EA 2W7OA 1D9AA 3BSNA 1JLEA 1VGYA 3M8YA 1NJZA 1S0OA 4RU2A 1NK6A 2AYEA 3EUNA 4PXBA 2IIHA 1JNRB 4M5GA 5DETA 5I42B 1ZPVA 3N4WA 3OW2R 6AT1B 1NH7A 4NLRA 3JQKA 1ICEB 4Q8EA 1QY7A 4OI3A 1TTHB 1TV6B 1JJHA 2WRMA 3J7YI 3QRRA 1R0CB 2WVDA 2BJ7A 3I82A 1NPRA 1DTTB 1DHMA 4P2MA 4YQWA 2CPXA 3W5ZA 1C4AA 3QZ8A 4ED6A 1RXOB 4BC7A 2GQQA 3AQOA 4IR9A 1CEZA 3UCZP 4DSEA 2CQCA 3NNCA 5F8IA 2HNZB 2DCLA 1VQ5S 3FC9A 2PMHA 1NHUA 3H40A 3NL0A 5C24A 2CQ2A 2W8KA 3P3DA 4B9MA 1TELA 1NK7A 2OPSA 1VK3A 4Y6IA 3OHAA 2QX0A 4LBPA 1YX2A 4B3OB 2AYMA 3MM6B 5D4OA 5AXNA 3GTYX 1HNZJ 5D8HB 3JAMU 4GKJF 1KQFB 1KS2A 1RTHA 3FBBA 3M8QA 4WFBQ 1KLNA 2DNMA 4QR1A 2V2KA 1VCTA 4MKVA 4TKTA 3DLKB 2ZHAA 5H9EK 2IA6A 4RWXA 4A8MP 4ED2A 1GX5A 4KB7A 3WHIA 4DV3F 3LP2A 3H5YA 3KLFB 3JSBA 4C9DA 5KG5A 1YG0A 4UOCA 2CWKA 5L1KA 2ZDPA 1TL7B 4CDIA 2DNOA 2CJXB 3DOLB 5ETKA 3Q8QB 4F4XA 3T1YJ 3H2LA 3TARA 4ECQA 2F5GA 3AH6A 1S9EA 3S1TA 1X0PA 2MDAA 5DM6Q 2HLUA 4DV6F 4GO5X 1M0SA 1MROB 3GYGA 4QCLA 3NS7B 6FD1A 2COLA 1FRLA 2E5JA 4EZ6A 1VRTA 1NNDA 1EX8A 2R7RA 3ZO7A 4NX9A 3LALA 1TKXA 2MEWA 3CCRS 2YQ0A 4H4MA 4DFJA 2B4VA 2KRBA 2ZM6F 1IBMF 5CQGA 4E8UA 2MZSA 3GFHA 3PIPQ 3THPA 3DMJA 2XY5A 1RAJA 1HLWA 4K59A 1QSLA 3R7SB 2FGOA 3ET6A 5KT3A 4CH7A 4FYXB 2YWEA 1XK8A 2E1CA 1RP5A 3CDBA 1URRA 3KK1A 3UE2A 1IJFB 5M2UA 4EYHB 3R9LA 4J9LA 2AP6A 1RWKB 4YHHJ 1WG5A 2LXFA 5HQLA 3OVAA 3C6UB 5HMZA 2CNNB 4GVBA 4JBCA 2LQJA 1F9HA 4L6V3 4JI7J 2DR8A 2YX7A 4A8XA 1RTDB 4MTPA 3OVSA 5FJ4A 4O3OA 1SJFA 3AFGA 4DHVA 5B0EA 3MM7A 3U1MA 3M2RA 2HRTA 2QLBB 1BE4A 1HQUB 4RW9B 3RB6A 2PO4A 3QJJA 3OXFA 4AFFA 3CNQP 4K2XA 1JLFB 4CI0B 1LW2B 1M5PC 1BQXA 2VC1A 4K4WA 3P5TL 1UETA 4P75A 4ED8A 3D6FB 2YNGA 2E1MC 2HHPA 5GAGU 4DMZA 4DV7J 1Y9OA 4PWWA 1PIEA 4OHXA 3MM8B 1FRHA 3VGVA 2CQ1A 3ENVA 1S97A 4IYQA 3W64A 4Q2MA 1YI2S 4X62J 4C97A 4LF7J 2XYPB 4FXWA 4A8OA 1T0TV 1DTQB 3NOGA 4EO6A 4IO9Q 1HWLA 3MOZA 1SKUB 3QRQA 4OX8A 4DPTA 2E1RA 2KHCA 4B17A 4I69A 1I5OB 2KT2A 3OTOF 2F3JA 1GFWB 2IDEA 5ETPA 1UJ6A 4RR5A 4A8WA 1VI7A 4Q44A 1S7IA 3BKUA 2BE2A 2M8HA 3L9ZA 1VQOS 1T3NA 3US5A 3HO1A 5CH7B 1M5HA 3FZ2A 3P96A 3ZNUA 1LWFA 2J9CA 1LFPA 2BJ1A 2I5JA 3G71S 4EBCA 2YNFB 4M1KA 5KFSA 1IKYB 1REGX 1FNOA 1AFIA 1DY3A 2B51A 5GADI 3SCJE 1ELOA 4F3QA 5D15A 3TVYA 4EO8A 1WEYA 5LMNF 1JWWA 3D3BJ 3BO2A 1NLKL 3ICLA 1ZBTA 2MLYA 4N5SA 5K8MA 3D0GE 3ZFVA 3KMQA 1Y4ZB 1WSVA 2VOPA 3ZZPA 3W2VB 4OI1A 1ZAVA 1AYEA 1SL0A 3NGRA 2DO0A 2V4JB 2ZH5A 1CQMA 4RW4B 1N8RT 4X4SA 2OI2A 1W26A 5KTQA 1S49A 2MHEA 3OL8A 1BLUA 1SQEA 4FZVA 1JLEB 3MI7X 2XMKA 2B43A 1SKRA 4HHUA 5J1NA 3DLGB 1JK9B 1T9VA 4GKJJ 1HL6A 1D8YA 5GAHI 3PW5A 2LXUA 4WYWA 4ECTA 4WE1A 1SJ4P 3T5HA 3KK3A 2KT5A 3C19A 3OL9A 2KRRA 3PR4A 1NH8A 3KLIA 3PHTA 2Q6BA 5C7PA 3H20A 2ASJA 4OLPA 1ZETA 1R8AA 4JI6F 5HQ8A 3GIRA 3S6EA 2K7JA 2LA4A 3GB0A 1OYDA 4ECSA 2FHJA 4TLRA 4UF4A 2ASYA 2HQGA 3V6KA 1ZH5A 4ILMA 4RO0A 3UDEA 3KLEB 4DV6J 2C3UA 4KH0B 4N41A 3HI9A 1M5SA 3KJFB 2PSZA 3LPEA 3OXGA 5C24B 2IBKA 4LF5J 4USMA 1GT8A 2OPSB 3R97A 1RQ0A 5EN1A 4IKAA 2PA3A 1H3DA 4MIWA 3SYZA 1B99A 2ZM6J 1IBMJ 4DUTA 1Y00A 4QIGA 1CG2A 1RTHB 3M8QB 2ZITA 3VVTA 3EGWB 3M8WA 3QAUA 1CJUA 2XEXA 3Q2SC 3LP2B 2ZKUA 1R7IA 1XIQA 1N88A 3HHEA 2JNJA 3OL7A 3CWJA 4UT4A 4OYBA 4ZVFA 1LW0A 3ZZ0A 1N6QA 3IRXA 1NB2A 4MT1A 4LF4F 4YR0A 4LVOP 4I6YA 4NXNF 1QD1A 3W61A 1NHKL 1S9EB 2VDIA 1ZTWA 3I0SA 2W2PP 2AEJA 4JI2F 1YJWS 2MLXA 1U4BA 3RW7A 1F2HA 4YY3F 1UPPA 3DRPA 3VZIA 2V67A 1VRTB 3TZYA 1CPZA 3D0IE 2DYAA 4A48A 3PX4A 2YKPA 3V4MA 2VPXB 4LJMA 4DUZF 2CNKB 2V0NA 4F4WA 1TKXB 4H4MB 1NAQA 3H8YA 3IXQA 1PSDA 3MPUB 3POTA 1U6FA 4KGXB 3DMJB 4NL5A 5SZTA 3TX0A 2M2BA 2E5LF 1TK0A 4N8NA 1WSRA 3CJ8A 1S6PA 2AHOB 1YRXA 4ED4A 3ET6B 5IC4B 3I9V9 1MMDA 1SCJB 2CPHA 1RT6A 1S76D 3KK1B 5KFNA 2RE1A 2IVMA 3A13A 3THTA 2F65A 4PXEA 1DJ0A 2DNKA 4DUYF 2R2RA 4ZVTB 1VQ9S 5AXLA 4OZ0A 2GCFA 2ZH4A 1VRQC 2FY1A 3DDIA 1EKRA 3CE8A 2ROEA 1FRIA 2DEIA 4GVBB 1TAUA 2VKZG 2Y0SD 3C6TA 1NCLA 3OTOJ 2YKAA 4FP9A 1HR0F 3SMZA 3LPYA 4XPEA 2C2ZB 1M5KC 2Q1LA 3AD8C 1WKKA 4NASA 3DHXA 1SBRA 3UDVA 3EZ5A 3GPAA 3MM7B 2JLFA 2LDIA 1I1GA 3M2RB 2DPIA 3RRHA 3EMTA 2KH9A 1JXVA 3OJSA 1UFWA 4U8YA 2LQBA 1LK5A 2KO1A 4LFBF 3HT3A 2HVHA 5LMNJ 2YNGB 2ALZA 3MAHA 2AZ1A 1D0EA 1FVQA 5CCMA 3LW5C 1WEXA 1RYSA 9ATCB 2Q6CA 3TQEA 2B3TB 1FE0A 1JLBA 2G2OA 3R1LA 4UUWA 1Q16B 4I56A 2CAJA 2NCKL 3TAMA 2EK1A 4DOZA 2QA1A 2RD5C 5IWAF 4F02A 2ROPA 2V63A 2JDJA 2KB2A 3SIPB 2ZFHA 4CO2A 1Q5VA 2CWXA 1BQNA 1EETA 1B0VA 3C15A 4TQRA 2CQ3A 2BE2B 3A8KA 2HPUA 2VPWB 4RNMA 1YBUA 1PJ5A 1LWFB 4D3HA 2I5JB 2QV6A 4LSNA 3CCQS 2PT0A 4FKXA 2MZTA 2AD9A 3AJ1A 4OJGA 2Q3PA 2EW9A 3MECA 2R7UA 4CLUA 1D9FA 1DQ9A 1X4EA 4X84A 1WF1A 1UKUA 5E3RA 5EWGA 1RAIB 2YWFA 2DIVA 1AB8A 2HFOA 3SFGA 2E7WA 4JI6J 4PWUA 4YOEA 1O5JA 4IFYA 2E44A 1U1NA 2IFXA 2XBPA 2HBYB 3PFEA 2WSFC 2LEAA 5KT2A 3HZEA 3MPYA 1C0UA 4J9NA 3O2IA 3ZZOA 3D1HA 2XI2A 2QLJB 1WTBA 1U26A 2CZVC 3DRYA 1NDPA 1S12A 3GU0A 2EXUA 4QWCA 1BMQB 2Y9HA 1VC6A 1OPIA 1RTJA 3D68A 2BDPA 2V8VA 4Q43A 1VBKA 3MR5A 2UUCF 2AX1A 2DNQA 4C7QA 2HSEB 4Z2XA 3BQ2A 3H90A 4K4XA 4C0HA 3FMWA 2R7XA 4MIBA 1RTIA 1IKXB 2ZBCA 2R9LA 3NWRA 2VFVA 1FFSB 3PYDA 4C48A 4WE1B 1NDKA 4XDDA 2J9DE 3KK3B 2XNRA 2EK6A 4ED0A 3CCTA 4NZ6A 4WIIA 4DFPA 3KLIB 4D3GA 3MEDA 3M2UA 4DR1J 4F2RA 4LF1A 2GGPA 2ZJPQ 4BC9A 3OJUA 3DHWC 1R8PA 2W9BA 4I4BA 4CLPA 1UVNA 2IAJA 3SQGB 1XR5A 1TMMA 2UXBF 4JI2J 4IFVA 4KRWA 3OT9A 1C1CA 5DJBA 4YY3J 3D54A 4IH6A 5LXYA 1MNEA 3THVA 1EZZB 2FHMA 2H5EA 1BY9A 2V8HA 1DQAA 1E6VB 4DDFA 3UD4P 1SXLA 3GFYA 4DUZJ 1KSPA 4ZP6A 4DLGA 2VOOA 2CQPA 1DRZA 5AE2A 3LWMA 2DITA 1KWMA 4O3SA 5DGBA 2RB7A 1TK5A 5JMNA 2VHGA 1UZDA 3H7HB 1WI6A 2MZ1A 3OLAA 4FYDA 4IOBA 5IZHA 5KFBA 2GMHA 1WHYA 3M8PA 2VIHA 2GA7A 2KI2A 1IKVA 2FYXA 2QYGA 4OZNA 1CJUB 3B4DA 3EWGA 1U1KA 2BJ9A 1M1HA 1KRPA 2YWWA 3MD3A 1T95A 3HD1A 2NS1B 4RW8A 2E7XA 3MF5A 4DUYJ 1LW0B 1N6QB 3IRXB 1FFWB 5IT4A 1UFLA 5KG0A 2ZZTA 2YKNA 1H6KX 3QWUA 4ANCA 3I5AA 4HH1A 4B9SA 4NLOA 2FHJD 2VODA 2A3JA 2N4CA 3CJSA 4XDCA 2MQQA 3JTNA 4YN3B 2WZ1A 2Z8QA 2HHHJ 1SKWA 2ROGA 1RT4A 2MKIA 1OSCA 2ZH8A 3QYYA 2HKEA 3DRPB 4ICLA 2C28A 4ETZA 3LGMA 3ZNJ1 1Q53A 4DPXA 3FJ2A 4QIVA 4ZVOB 4F25A 1EQ0A 2IJRA 1ZTTA 1MWYA 1RHMB 4EGLA 2YKOA 2DT9A 3SV3A 2LU1A 3G8TA 1FXLA 5LL6d 3POTB 3UQSA 2DTJA 1YHQS 2E5GA 3DM2A 5IV4A 3AA8A 2RNEA 2M8DB 1FNMA 1S6PB 2FLOA 1RT6B 5HJYA 5EWFA 2RMLA 3UVJA 2C22A 2XLIA 1EARA 2PN6A 2GIQA 3W5XA 1RWNB 5IWAJ 2B4OA 1IBLF 2HIQA 2W2MP 1OQ3A 3ILOA 1PBUA 2IVYA 2YVSA 2HHUA 3C6TB 2MXYA 2G2YA 2DR7A 2GHPA 2D9OA 2IBOA 4USUA 2XZDB 5IT9U 2ASDA 2OJ3A 4DV4F 1X7VA 2JVOA 3PDNA 2YWHA 4Y2CA 4M5JA 5HMXA 2QMXA 3BGUA 2RRAA 2FUG9 2CQBA 4F3MA 2MSSA 1SL1A 3TEGA 2RUGA 4ZCKA 1F6TA 1OJ4A 2PIIA 3CCZA 3VCDA 2I2YA 3NGTA 4F3OA 3EPIA 4OYAA 4FN5A 2B7CB 2NLWA 3TZWA 4B3MF 1N54B 1H0HB 5B09A 4Q0BA 3A8JA 2ZNYA 2J8AA 2WCXA 3LUYA 3BQ0A 1Y7PA 4K7QA 3IFEA 2BQ3A 2CJQA 1JLBB 2CADA 1VQLS 2ZZNA 1G2EA 2X51A 1N5YA 1VQ8S 3TAMB 2HZVA 4NLQA 1JLGA 4CP5A 2BXJA 4QWBA 3K17A 4G6VB 3MD1A 2ERRA 4OHWA 1BQNB 2DR9A 1EETB 1RBAA 1WG1A 4X4VA 2ATLA 3KLVA 4FYYB 4MAKA 5LSOA 2UUCJ 3NBPA 4KPCA 5SUHA 3SCLE 3SBMA 2MQMA 2UUBF 4M94A 3CDUA 3FCWA 4LSNB 4O3QA 4LF2A 3LANA 2HNYB 1N52B 3MECB 2FZCB 5E41A 3F56A 8RUCA 4AD6A 3CJ5A 3GG1A 1P9QC 2QE5A 4IDKA 2XLJA 1QAIA 2MQNA 2P8IA 4C0OC 3DGPA 1U6BA 2U1AA 1G3OA 3OSNA 4DPYA 3ENAA 1M90T 2V8GA 2UXBJ 4Y28C 5F0WA 2QSWA 4ATNA 3K0JA 3R7BB 2E7VA 5L9XA 4A8YA 1C0UB 3DU5A 4NLSA 1BC6A 1RYRA 2BQRA 4RUCA 2OHDA 2OUGA 3HKWA 2ZHBA 1U24A 3EXYA 4M5NA 2HRUA
chains in the Genus database with same CATH topology
1HWUA 2GMJA 2YH0A 4Q2LA 4AXIA 2O5DA 1ULRA 4RBTA 2D7SA 1JLQB 2QSFA 3VR1A 2IC3B 3G9CA 3CT9A 2J0XA 4WJBA 1JX4A 1S1XB 2ZC4A 4IH7A 3K59A 5E0OA 4FBTA 4B9NA 2R7VA 4WK1A 2B4PA 5DRKA 1XC9A 2RSQA 1RTJB 3DI6A 4OZJA 4IH5A 4K5SA 4OX7A 4QYRA 5E3CA 3W2VA 5GAEI 1K8AT 4B3SF 5GAEU 2HNDB 4IRDA 2ZOMA 4AL6A 2JHEA 1W2IA 2BBEA 5JVGQ 4ECVA 4FS1A 3M05A 5HP1A 4O3RA 2DH8A 2CPIA 3QAEA 4CNZA 3FFIB 1SV5A 4X62F 2CQDA 5IQ6A 4I2PA 5F8HA 2E5IA 4DEZA 4Z37A 1T8EA 1TL4A 4LF7F 3AHPA 3SFUA 2JC1A 4BWJA 4JYAF 2V4JA 1Y0HA 2B56A 1RTIB 2ZUGA 3U02A 3IR5B 1FJEB 1S1VB 4O4GB 4TY8B 2MQLA 2BV3A 1S1WA 1N4LA 4RW4A 4YB1P 2WTFA 4A8SA 3BGLA 3JYTB 3I31A 1LFWA 2CQ0A 2AJFE 4K4UA 2P9GA 2KT3A 2V9KA 3GR0A 4RBVA 1IQTA 2VFTA 2CVIA 1XR6A 3WZ0A 2RF2B 4F50A 2QMWA 4PPDA 1YRUA 3MURP 1TVRB 2BANB 3I0RA 5T7LB 3PXGa 3PVXA 1UMJA 2FTRA 4OI0A 2VFSA 3H5UA 3KG0A 1H38A 2W7OA 1D9AA 3BSNA 3FRYA 1JLEA 1VGYA 4CO3A 1RT2B 3MEDB 3TNVA 1WNEA 1X4CA 3M2UB 1NJZA 4KR0B 1CC8A 1H2TZ 2XI3A 1S0OA 2GGPB 1T3OA 4KSEB 5CHCB 3M8SA 1Q8IA 3EXCX 4KO0A 4LT6A 2C42A 4RU2A 3M1VA 4DR6F 1NK6A 2W8LA 2AYEA 3PJWA 5A8RA 4FVCA 3EUNA 1IN0A 4PXBA 2JLGA 2CPEA 1IKXA 5MLCV 1K1SA 4RW7A 1T03A 1JNRB 2JRSA 1FF2A 3M9OB 4K50A 3ZZZA 4OI2A 2R7WA 2DVIA 1G6BA 5DETA 4NYPA 5I42B 3MEEA 1UEUA 4WTYA 5H9FJ 1R89A 2DNPA 2IAJB 1ZPVA 2XY7A 5L9NA 1NJXA 3OUYA 5D4PA 1FDDA 3J7ZT 2D41A 3GWCA 4I0WA 2J76E 3MMAB 3N4WA 2HYIB 4IFVB 5A8WA 1H7WA 1RT7B 3K2YA 3OW2R 3IRWP 1C1CB 2UXDF 1DQ8A 1NH7A 1Z2LA 7FD1A 2KXNB 3N6NA 5F3TA 3CCMS 1WF2A 4NLRA 4F8RA 2XGQA 4Q8EA 1QY7A 2J7UA 3VTIA 5L39A 2K1RA 3D2WA 3LQVA 4B9VA 1YGYA 3TVZA 4OI3A 2RT3A 3JSYA 4PQAA 3HVWA 4MK9A 2VQEF 1QAXA 1TV6B 1JJHA 2WRMA 3J7YI 3J7YU 3MFHA 3Q23A 1HNXF 5AXKA 1HD0A 2WOMA 5CZVA 2MSTA 1YJUA 4R5PA 3RB3A 1Q4RA 2XB2D 2F1FA 2AJ0A 3I82A 4CH0S 1YJVA 1Z1ZA 1DTTB 2ZH1A 3VAIA 2HHQA 1DHMA 1DLOB 1C2PA 3UFCX 3SQGA 4YQWA 1SL2A 1P8GA 3K5LA 4AUKA 2CPXA 2NZ4A 2BJDA 3T5JA 5J1EA 1C4AA 3NMRA 2PGCA 4WXOA 3QZ8A 4ED6A 4FF2A 4BC7A 2GQQA 5KFCA 3AQOA 3MR2A 4IR9A 4G1IA 4ED1A 1CEZA 1VS3A 3S01A 2UVRA 3UCZP 3V4IA 4DSEA 1BQMB 3ETOA 1H2VZ 2CQCA 3NNCA 5F8IA 2I0XA 2HNZB 5A8KB 2DCLA 3AAWB 3RB0A 1VQ5S 3M2VB 4NYZA 2ZE2A 2B7BB 2PMHA 2WBMA 1NHUA 5H9EJ 3ITHA 1R8HA 4WFZA 2AWZA 3M8PB 1E6VA 4NCAA 3H40A 3T3FA 5H1SV 2HW3A 3NL0A 5C24A 2CQ2A 3MOJB 4TY9A 2MMYA 1IKVB 2P9EA 3M30B 2W8KA 3P3DA 4B9MA 3BGRB 2KFZA 1YWXA 1NK7A 5KG7A 4X4RA 2OPSA 3JTOA 2CPDA 3NCPA 4IR1A 4LFCF 1VK3A 5F8GA 4Y6IA 4J9PA 4G3IA 1B7FA 3OHAA 4IQMA 4ZPTR 1S0MA 1TKZA 3I6PA 2X1GA 4XIUA 2GQCA 1WD6A 3IWNC 5KFZA 5A0YB 3MEGB 1F60B 4I7FA 2AYMA 4B3OB 3CTRA 3MM6B 4RLEA 5D4OA 2EFNA 3T5LA 4E0DA 5AXNA 1K1QA 5D8HB 1Y5LB 4EWTA 2YKNB 1NJWA 4GKJF 1KQFB 1FJCA 2MKHA 1KS2A 1RTHA 4Y00A 3M8QA 4CTAA 2L08A 1MU2A 4WFBQ 1KLNA 4BDPA 2DNMA 4K4ZA 4QR1A 1XERA 2V2KA 4C2MA 3TX8A 3HVTB 4TKTA 2O3DA 1X8DA 3DLKB 2ZHAA 1KFDA 4Y2MA 2IA6A 4RWXA 1RT4B 3I0SB 2MZRA 2RDIA 4NCGA 5G0RA 4A8MP 4ED2A 1GX5A 1HW9A 2KFNA 4KB7A 1C0TA 1D1UA 2DGQA 4ELUA 4DV3F 3TVKA 3DCAA 3LP2A 3CVKA 4DR1F 3H5YA 3KLFB 2W7PA 3GV7B 4K4TA 4ICLB 4Q5VA 3JSBA 4DSKA 4C9DA 2WSCC 5KG5A 3T6BA 1NK8A 3JSMB 1YG0A 4UOCA 3QZ7A 2VZ9A 3M6UA 2CKWA 4DWIA 2RKIA 5L1KA 2ZDPA 4C3MA 3BREA 2XCPA 4LQ3A 1KNZA 1W2BR 3ISNC 2FJDB 3CJKA 2UVUA 4WF9Q 4FF4A 2DNOA 4C8KA 3DOLB 2A10A 3Q8QB 4F4XA 4OZ1A 1TKTB 1U1RA 3H2LA 4ZA1A 3TARA 1X9SA 4F2SA 1TAQA 4ALZA 2JFDA 2WONA 1SKSA 3H4BA 4ECQA 2DGTA 2HHWA 2HWHA 1S9EA 3AH6A 2FVPA 2IM1A 3HHLB 3S1TA 3UNGC 4K4SA 1X0PA 5K14B 2MDAA 3S7RA 1SJRA 1R0AA 2MB0B 3ZZYA 3MR3A 5DM6Q 4GO7X 5LMUF 2J7KA 4NLVA 5FD1A 4CO4A 2FVRA 1AUDA 1HNVA 2QFJA 2ZNZA 3GE9A 3CD7A 2HLUA 2AW0A 2RS8A 3DM2B 2ZH2A 3WBZA 4DV6F 2AYBA 4GO5X 1FHTA 1M0SA 1MROB 2FJEB 5F8JA 4RW6B 5IS2A 3H5XA 4C3KA 1UVIA 4QCLA 2HVIA 5D4NA 6FD1A 2COLA 2EFQA 3PEJA 1PC5A 4P6QA 2ZZMA 4K4VA 1FRLA 4B3RF 2E5JA 1KONA 3HVAA 5KFIA 3HJFA 2XSJB 4EZ6A 2MZJA 4J9SA 1C4CA 1VRTA 2KKHA 1N36F 4GC6A 1NNDA 4JI4F 4KIAA 1X0FA 2R7RA 1L3KA 4O3NA 3P49B 2DISA 4NA3A 1G7CB 4NX9A 1L3SA 3LALA 1NKEA 3TQ1A 2RQMA 2D74B 1WHVA 3HHKA 1TKXA 3DRRA 1BWEA 4RWWA 3CC2S 3BGFA 3CCRS 2D3ZA 3QGHA 4WKYA 3M9NB 4H4MA 4DFJA 2B4VA 2I9SA 2KRBA 2ZM6F 5HL7Q 1IBMF 2DRAA 4HYKA 3O3LA 3ULHA 1PILA 4ZK7M 4OX9F 1FNXH 5CQGA 2I8EA 3TW0A 4IG3B 4E8UA 5DQGA 1Z2ZA 2MZSA 1N33F 5T41A 3MWBA 3I4HX 3GFHA 3FSYA 4Q8FA 3PIPQ 3THPA 3DMJA 2XY5A 2CPJA 1RAJA 3M4XA 4USJC 4HDHA 3CC7S 5KFJA 3IC1A 2HHSA 2GIRA 2POKA 2HG4A 1P27B 1KHWA 4K59A 2Z2LA 4WKRA 3MGJA 5KFLA 1KVJA 1NJIT 1QSLA 1U6ZA 2CQIA 1LWEB 2FGOA 5KFDA 3BR8A 1ZPWX 4X4PA 4RNFA 1L5UA 2DHAA 5KT3A 2KVIA 4CH7A 1CLFA 1VQ6S 4DQIA 2YWEA 1XK8A 2JC0A 3MM9B 2E1CA 1RP5A 3CDBA 4WZQA 1URRA 2ILZA 2OPPB 3MR6A 1C1BA 1IJFB 3GFZA 3UE2A 2B5JB 5M2UA 1HBNA 4LIWA 3CDAA 4EYHB 2VD3A 4DV2F 3V6JA 3NG8A 4AL7A 4J9LA 1SI9A 2UV8A 1GXTA 2AP6A 2W25A 4Y2IA 2XMJA 4ED3A 4OJ1A 2KJWA 4OLOA 2FC8A 3KFWX 5IQQA 2NPFA 1WG5A 2LXFA 2LXIA 1OO0B 4U7UK 2R2TA 1FDNA 3AB2B 3HHLD 4NLGA 3OVAA 2XMUA 3C6UB 1HWJA 3KK2B 3Q8SB 2V94A 5HMZA 4ZVGA 3OFFA 4OJHA 3DLJA 3E3XA 3OFHA 4JBCA 4KJIA 4WFXA 4C8ZA 2LQJA 2IRXA 4HVZA 3QGIA 2HHHF 2MKJA 2ADCA 2FVCA 4L6V3 2XS2A 3DLEB 2LKZA 3HHNB 2AJQA 2DR8A 2ZJRQ 2YX7A 4A8XA 1SJQA 5JUMA 4EBEA 1RTDB 4MTPA 4DN9A 3OVSA 1HYSB 4RKUC 4A8KA 3G6YA 2J6UA 2GO9A 4C8OA 1N32F 3MMBA 4K0KF 3TA0A 5FJ4A 1M1KT 2FJAB 2KXFA 4K5RA 4O3OA 3KLHA 1SJFA 3G6ES 4Q0BB 3DN9A 3CC4S 5IM0A 2AYGA 3TAPA 1RT5B 4UQGA 2E9TA 4DHVA 5B0EA 5CXTA 3TO8A 1VQMS 3MM7A 1SB6A 4DL7A 1JLAB 3R5CA 1QE1B 3QGGA 3U1MA 3M2RA 3TR5A 4URGA 4I1TA 4RW9B 1HQUB 2ASLA 1JLCA 1FTCA 3CD5A 2FD2A 3FVYA 3I55S 2PE8A 3RB6A 3CCLS 2PO4A 3T9NA 3HZGA 4ECXA 5D3GA 3QJJA 3LAKA 3OXFA 1FD8A 3ZC4A 3OHBA 3C66A 4YP3A 3HPOA 4AFFA 2VL1A 3QGPA 4LQ9A 2DHXA 1HBOB 3D28A 1S6UA 1U24A 4K2XA 3KJVA 2KJVA 1JLFB 2F9JA 3O1LA 5KG3A 2YX1A 4CI0B 4DBQA 1LW2B 4NYOA 5KFGA 1N5YB 3CCES 1KR4A 1VQKS 2PI4A 2D1CA 1M5PC 2OIHA 1BQXA 1BD6A 3M6VA 3MCSA 3I5BA 3GIMA 2UVVA 2VC1A 4I6WA 5F8NA 3B4MA 4ID5B 2R8JA 1U47A 4K4WA 1JLGB 2FHKA 3P5TL 3C3LA 1XBWA 2CYYA 2WB4A 7FDRA 2ABYA 2DNHA 2YH1A 1FVSA 1LV5A 1UETA 2YWGA 2PFFB 1KLMB 4ED8A 3KLGA 2YNGA 2E1MC 2Q43A 2HHPA 5GAGU 4DMZA 1Y9OA 3DXSX 4QU7A 4DS4A 4C11B 2DH9A 1S1UB 4OHXA 4QIFA 4B9TA 3MM8B 5D77A 1FRHA 2LVWA 5D4LA 5KG2A 2CQ1A 3E51A 3OFEA 5DLFA 3ENVA 4IUFA 3GFXA 3OTBA 3CCUS 3GIJA 1AFJA 1S97A 2YWKA 3NBPB 4IYQA 4Q2MA 3M32A 2YNIA 3QLHA 2MGZA 1H2UX 1YI2S 4NLWA 4QJVA 4IO1A 4C97A 4U9RA 1HWIA 3U1NA 2U2FA 4CO5A 2VB6A 4UQTA 3TANA 4J9QA 1XMBA 4ID8A 1SC6A 4FXWA 4ES1A 2DNLA 4A8OA 1P1LA 3T19A 1I6JA 3DC2A 3LOUA 3OR1A 1DTQB 1XMQF 2LQ5A 4EO6A 4J9MA 1KHVA 2BYCA 4IO9Q 1HWLA 5B0DA 5B08A 2XLKA 3MOZA 1RKIA 4PUOA 1UEVA 4KKOB 4OX8A 1QUPA 2E1RA 3HM9A 3JTPA 2HWTA 2KHCA 5A6WA 4EZ9A 1VQ7S 3BDPA 4B17A 2WK4A 4I69A 2M5YA 2E66A 4I67A 4DX8H 4ZLPA 2KT2A 3OTOF 2XSFA 2F3JA 1KFSA 2BUNA 2OPQB 5CYMB 2Y1RI 5J1PA 1LXJA 5C25A 1UJ6A 2XMWA 4A8WA 4IDKB 1VI7A 4Q44A 3G4SS 4IOCQ 2IA0A 4DR3F 2BE2A 1LWCB 2VG5A 1VBXA 2M8HA 3QO9A 1VQOS 3J7Z5 5I3QA 2FVQA 2XWYA 1T3NA 1S9FA 3US5A 4TU9A 3HO1A 5L1IA 3PX0A 4PG6A 5CH7B 2OTJS 1M5HA 3T1HF 3FZ2A 4NMLA 3P96A 2CJ9A 3CCVS 2DNYA 4KHRA 3CDEA 2PC6A 3SDEA 1LWFA 2HNYA 2J9CA 2XHWA 2ZD1A 1LFPA 3M6WA 4IFYB 1Q8BA 5KFUA 4X2BA 2OFGX 1REVB 2I5JA 3G71S 2GMLA 4EBCA 2YNFB 2AJ1A 4M1KA 2ZKTA 5CD4H 5KFSA 1IKYB 1FNOA 1Y5NB 1AFIA 1ZAXA 3DOKA 2UU9F 3RAMA 5FIIA 4O0IA 5F8LA 4PXDA 2B51A 5GADI 2IYGA 3SCJE 1XR7A 1ELOA 5I3PA 2UXCF 2NSBA 3AB4B 4HH0A 2RILA 4F3QA 2M52A 3HP6A 1FRMA 5DLGA 3H98A 3TVYA 3V6DA 4EO8A 5DG9A 3HFKA 1WEYA 5LMNF 1JWWA 2ZH6A 3BO2A 4ZS6A 3OV7A 2JFKA 3ICLA 1ZBTA 1NB7A 1ZZNA 2C2RA 4A8FA 2Z2MA 4N5SA 5K8MA 3V5RA 1GTHA 3IS9A 1MWZA 4DSLA 3D0GE 3FQKA 3ZFVA 3KMQA 1Y4ZB 1NK9A 4FS2A 1FKAF 2VOPA 3CJ3A 2CPZA 3ZZPA 3DI6B 3IO1A 2OFHX 3ENWA 2FJXA 3W2VB 2NXUA 5KT4A 2VBXA 4OI1A 1T7PA 4RZRA 1ZAVA 4OZLA 1SL0A 3KNGA 2QLXA 2SXLA 1ZOTA 5K8NA 2LLZA 3TYTA 1S9GA 1SV5B 1Q7YT 2DO0A 3IN5A 4I2PB 3NGDA 2DPJA 2V4JB 2YKMB 2K2PA 2HQIA 4QW9A 3FEYB 2ZH5A 1S1WB 4J9KA 1CQMA 2DNNA 4RW4B 2CZ4A 5EX0A 4X4SA 3G8SA 1NK0A 1N8RT 2G4BA 4DQPA 4DG1A 1JKHA 1IM4A 4IG0A 5GMKa