2PIIA

Pii, glnb product
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the signal transduction protein from Escherichia coli at 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal transduction protein
molecule keywords PII
total genus 21
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1995-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2piiA00
2GNKA 1HWUA 4USJC 1Q1KA 3NCRA 3NCPA 4NYPA 2O67A 3TA0A 4RX6A 3TA2A 1UKUA 1O51A 1QY7A 4YB7A 1UMJA 2J9CA 1NH7A 3X3UA 2ZOMA 4IYQA 1NZAA 1O5JA 3TA1A 1NH8A 3M05A 2V5HG 1OSCA 2NUUG 4USHA 4YB6A 4C3LA 4C3KA 4WK3A 5D4LA 4D3GA 4D3HA 2GX8A 4RLEA 2ZFHA 1NAQA 4CO3A 3AH6A 5D4OA 2GW8A 3AA8A 4USIA 3T9ZA 2XBPA 1VFJA 4CO1A 3GSDA 2EG1A 3CE8A 4CNZA 4YB5A 2O66A 3L7PA 3BZQA 4CO5A 3AHPA 2XZWA 1P1LA 2J9DE 1XK8A 2RD5C 2NUHA 2XULA 1V3SA 1KR4A 2VD3A 2CZ4A 4WK1A 4C3MA 1UFLA 4OZNA 4RWWA 4CO4A 5L9NA 5D4PA 4Y6IA 1V9OA 1PILA 5D4NA 2NS1B 3LF0A 1VHFA 2Z0GA 3O5TB 4CO2A 1H3DA 4Y65A 3NCQA 3MHYA 4OZJA 1UL3A 2J9EA 2JJ4D 1V6HA 2J9DA 3HLUA 2DCLA 2PIIA 3N5BA 3O8WA 4OZLA 4E98A 2E66A 3AA9A 4RWXA 5DS7A 2EG2A 4NYOA 4CO0A 4CNYA 1GNKA 1J2VA 1V3RA 4ZK7M 4AFFA 3DFEA 2XG8A 4R25A 3OPKA 5DRKA
chains in the Genus database with same CATH superfamily
3FZ2A 3ETOA 3J80U 1KN6A 2YNFA 1FVQA 3QO9B 1TZ0A 3NCRA 2KJVA 5CYJA 2ZJRQ 4UOHA 1RA6A 4C8LA 4KE5A 1ZAWA 2NXEA 3DRRA 1U1RA 2AQ4A 5CXTA 3PIPQ 4IH6A 2QMXA 5J1NA 2G0JA 5DQIA 5KG3A 3W9HA 5U47A 1VRQC 2XNQA 4NXMF 3KG4A 3EM1A 4RJVA 3TARA 2HZVA 1W25A 4MKVA 4NLPA 5M2UA 3VAJA 2HW3A 3UI3A 1NEEA 1YRUA 2VBYA 1M5KC 2J9CA 3UD5A 2YWFA 3VAGA 2RE1A 4LMZA 2UXCJ 4B08A 2Y8YA 1HPZB 3KK2A 3Q22A 2PT0A 1WEYA 1SJ1A 5CQGA 5HQMA 2RDDA 4FZVA 2H54B 3M9OB 4USHA 4JI2J 3H5XA 4C8MA 2BE2B 2VF3A 2VFUA 3W65A 3EYZA 1HBOB 3OVBA 2ROPA 3LWLA 2FUG9 2KFYA 3DU6A 5KOWA 1U8WA 2HHQA 3QO9A 4KGKA 2IJRA 2PMWA 1NNDA 3NNAA 4DHVA 3D6HB 3BO2A 1OPZA 4B3OA 2FLOA 2BJEA 4Y28C 1KOHA 3HDSA 2P9GA 3IMQJ 4C0OC 1NK8A 1DFDA 4JI0J 1Y9OA 1S7HA 2ASDA 3D1HA 1L3VA 4FXWA 4I4BA 4L3NA 3DI6A 3B4MA 3GSDA 3QWUA 3H0PA 3FFIB 4LF4J 1SIWB 1SBRA 1VK3A 3RW7A 5FIIA 4KTQA 1ZPVA 2RB7A 1HPZA 2HIQA 3KHGA 2E5LF 3ZZTA 3N5FA 5KG2A 2E9ZA 2BKPA 3V6DB 4P75A 3JSBA 3T5LA 2EKYA 1UZHA 2DGXA 4J9UE 1AW0A 3GP9A 3IXQA 1VS3A 2BE2A 4RW9A 1RAOA 2AYBA 4LF6F 3W66A 3T1HF 4HHHA 3T6BA 2L9NA 3LP1A 3R5DA 4WJBA 2XY6A 3Q8YA 4K0KJ 1B0VA 3IA0A 4U7CA 2CPHA 5CABA 1RAEB 4NA3A 4GKKF 2PI5A 5IT9U 3D5MA 1HQEB 2N3LA 4Y2AA 2RHSB 1RZMA 4I68A 3OTCA 3C8YA 4ZVRB 2NS1B 3ENWA 3DI6B 2GO9A 4M5HA 2V63A 3GFHA 3O1LA 4NA1A 1IKYA 4G6VB 3DOMA 4I6WA 1F3FA 2YX7A 3O5TB 4A8MP 1YVFA 4GVLA 2JOQA 3CCTA 4HH0A 2DR9A 1K1SA 3M1VB 3V4IA 2FHJA 1DQ9A 2DGUA 2XTJP 3SFUA 4DX5A 2R2SA 2BJDA 2JJ4D 1RXOB 3CDWA 2K1RB 4RW9B 2F3JA 4JV0A 4J9QA 4ZJLA 4HLBA 2YTCA 1Q5VA 2Q6CA 1LXJA 3EVWA 4G3IA 3IM9A 4IH5A 4LF5F 2GGPB 3UQSA 3AA9A 3EE3A 2QA4S 1PC4A 2CPEA 4B9LA 1JLEA 3K5LA 2WVBA 3RRKA 3M2UA 1F6TA 4PG6A 2DHHA 4JV5F 4OLOA 4IRCA 1GQEA 1RACB 4N76A 3TZZA 1JJCB 3VZIA 2FZGB 3GTYX 5HI7A 3RB4A 3CDUA 2P5VA 2G2ZA 5KFBA 1XBWA 4ZVGA 3DOMB 4PXCA 4RX6A 4F50A 3EGZA 1DQAA 1BUXA 1PYTA 1QAXA 2PI4A 4QR1A 3V4IB 3PX0A 4ZVQB 3ZZYA 1I94F 2IYIA 5A0YB 4ZIVA 1KHVA 4WP8A 5C2GA 1B64A 3EGVA 4OJHA 4AQYF 4CLTA 5KFGA 1YTYA 5AT1B 1NSQA 1FTCA 4WF9Q 4CRJA 2G0IA 1S1WA 2JFKA 4DQQA 2HS4A 1RT2A 2HRYA 3PZPA 1HMVB 5KFLA 4UTGA 2DH8A 5THWA 4ECSA 3BPDA 4JI6J 4ZCIA 4PWWA 3CULA 5KFCA 4OFZA 1RDRA 4F67A 1LFPA 1SC4B 3PJWA 4WFZA 4ZLJA 4ETZA 3N01A 4J9SA 3DNCA 4EBDA 4DSEA 1ZTWA 2MLXA 2R8HA 4EU0A 5EX0A 1WHWA 3QJJA 3M8YA 2HHUA 1FK9B 1HBNA 2ZEJA 4ID8A 2GMJA 4LF1A 3CXCR 2RUGA 5D4OA 1LWFB 1UP1A 2HFZA 5C2CA 2IAJB 3W7BA 2CQHA 2DD8S 2EBGA 2G1HA 2F4VF 2HK3A 1P27B 4IO1A 1KDNA 3LGMA 4KGVB 1XJWB 2MJUA 1VFJA 4OYAA 4QIFA 3T9ZA 3RTVA 2MPUA 5GMDA 4Z37A 3H5YA 1EHWA 4IFYB 3SYZA 3G71S 3R1LA 3BBCA 4WP3A 1UCNA 1HWLA 1NCLA 1IBLJ 2D74B 3EZ5A 3CCWA 1S1WB 1GAOA 3GE9A 2CG8A 5IQQA 3IC1A 5HMZA 4FYDA 4PXBA 2H5JB 1C0TA 2V2QA 3CCES 1MWZA 2A6OA 4M5NA 4F8RA 5KFZA 4ANDA 1B99A 1T02A 3TQEA 4URSA 4QZVB 5L39A 1FDAA 1FDBA 2RRBA 1UETA 2NCKL 1BLUA 3VAFA 3NOCA 3CO0P 1SJRA 4FYVB 3DM2A 4C98A 2H5IB 3ZFVA 3M30A 2XY7A 4OHZA 3PKMA 3DXSX 2IFXA 4URQU 5DQHA 1LWFA 2CNKB 2V67A 5HROB 4LRAA 3BBBA 2KTQA 2MKJA 3UCUP 3BGUA 3TOQA 5AXNA 4U7UD 4NYZA 1RKJA 4HI1A 4IFYA 2GS8A 3MM8B 4R8UA 1BE4A 2GHWA 3MR6A 2IDEA 3P5TL 4TN2A 4TQRA 1MN7A 3PR4A 2GHVC 4DFKA 2LECA 1FNOA 2AT1B 2DR8A 2J6UA 3P6YC 4K4SA 4GKKJ 1RHRB 2HFSA 1JLGB 3I9V9 3JTNA 5LL6d 3W63A 4J9MA 1NK5A 1WJ9A 1RBAA 5IC4B 2DNMA 3L7UA 5E33A 5ETSA 2KI2A 1DARA 2KYZA 3QT8A 2XQCA 3LANA 2RS2A 2EFPA 3BR8A 1G2EA 4XAKA 1ITPA 4BC7A 1QE1A 1SH0A 3ISZA 3IR7B 5IQ6A 2CPJA 4OI6A 2POKA 1JLQA 4X64F 1NKEA 1M1GA 2MKCA 3N5BA 3H4DA 2A10A 1M0SA 1X4FA 2QLFB 3VGVA 4CI0B 5DS7A 4F26A 5IS2A 3E01A 1VC0A 4ZPAA 3VHQA 3MDFA 4IG0A 2FB0A 2XB2D 5DZ7A 4DR2F 4J9VA 4M5MA 3T5JA 3WHIA 4C97A 4TYAA 4TNOA 1H7XA 4EUVA 4K4VA 1U2FA 2HWTA 4W92B 1TKXB 2AJ0A 4J9OA 1WWHA 3KJQB 2LQBA 3TR5A 2HHHJ 1Z1ZA 2HMIA 3Q8QB 1MMLA 1GXUA 5H1SV 4JI7J 3OFEA 4ED8A 3HK2A 1RWUA 1R8AA 3MM8A 5LOQA 4FF4A 2DNQA 3TVKA 4HVZA 2H65B 5K20B 3Q0AA 4UT4A 3RUBL 1CS4B 2DNKA 1L3UA 2DHSA 1JLGA 3R6GB 3GYGA 4GO5X 1SC1B 2LEBA 3HSGA 2OPRB 3NGKA 1PJ7A 1S1VA 4I67A 3I5BA 5EWFA 1HHQA 4DL7A 2X3DA 4QYZK 1H2UX 3NRBA 4YR0A 2DJWA 3A1YG 4X4VA 1FCAA 1UMJA 1UJ5A 2XSJA 2V68A 3NNHA 4DR7J 2E7XA 1UVNA 4HKQA 1C4CA 5K8MA 3PX4A 4E0DA 1RADB 3IRWP 4FYWB 4OZ3A 1X9MA 2JEJA 3DLHA 4MTPA 2YPYA 1TMMA 4DPOA 4Q7AA 4YFUA 3RB0A 2VA2A 3TUPA 1SI9A 5KT4A 1TKXA 2VQEJ 2ZUGA 3DRPB 4A4JA 2GZOA 3OJUA 1RBLA 2B4VA 1S72S 1F5CA 2MKYA 3KKFA 4YQWA 2IM0A 2AGPA 1XMOJ 3SQOP 4RU9A 4RUAA 1TK5A 1S59A 4DS5A 2P6SA 5E3CA 5K5MA 1VOMA 3E3XA 1WOPA 3FBBA 3PW2A 2ATLA 2C28A 1YDLA 2GW8A 2P2CB 3AJ1A 4ZVOB 4I2QB 5HN0A 3MEKA 4OYOA 2VQFF 2OPRA 1U1LA 2ZBPA 2MKKA 2NR0A 1B70B 1NSPA 1HLWA 2PDAA 5ITHA 4WTYA 1FJCA 1NLKL 1FX2A 1U24A 3D0IE 2ZITA 3KUHA 4I6YA 5ETKA 3ZZRA 2DISA 2F4FA 3GIKA 4GC7A 3NG8A 4B3MJ 2FHJD 4R5PA 1VQ7S 1U6ZA 1UWBA 2UZAA 5GAEI 5CCMA 4DOZA 1ACMB 2L9WA 1P1LA 4YUDA 3G8TA 4HACB 2ZHBA 3NMRA 5KFHA 2VOPA 3TYTA 3GJTB 1HNVA 3Q8SB 1QSLA 2LXFA 4PG5A 2R2TA 2WB4A 1LNQA 2YWKA 4B9SA 4O4RA 1HNWJ 1RHMB 5LXYA 1QUVA 3IG1A 4LREA 4CM2A 2KHDA 4LF5J 3DRPA 5HATA 2C2DA 1UJ4A 2R4FA 3C2PA 2WK4A 2NZ4A 2LFVA 3RGIA 1VQPS 2QEXS 2G9OA 1LK7A 4C3MA 9ATCB 4PUOB 1UFLA 4YDXA 2W2NP 3W5XA 3HFKA 5J2MA 1L3TA 5L9NA 2X1BA 1URNA 4M5DA 3PFEA 4EO6A 5LM7E 3GR0A 4LSNB 5FDLB 3GCXP 4CCHA 4DEZA 3ENAA 3G82B 3RBXA 5LMUF 1EETA 1RT3B 2Z57B 4H4KA 2YH0A 2BANA 3SSRA 3UCZP 2ZOFA 1YITS 1IKXA 2YKMA 3MECA 3JSYA 3MPVA 2VKRA 4R5PB 3UPFA 1N4LA 2YNIA 3MEGB 1CULB 1RHKB 4X4PA 2VUGA 3A8IA 4HACA 3IBWA 1KLNA 2BJ1A 1KHWA 1HNVB 2HAIA 4KKOB 1RUSA 4ES1A 5A8WA 5DETA 3W9JA 3P4UB 4M8LA 4F3QA 3L4BC 2A18A 3GFZA 1PG5B 3MPUB 4PXDA 2HWIA 4CLYA 1H7WA 3ZTPA 3ZZ0A 2VHGA 1NK4A 2WB1D 1W7WA 1VQ9S 5G0RA 3D6MB 2J6SA 1RYSA 2FGOA 2ZNZA 1NDPA 3EPGA 2CPDA 1YBAA 2V2ZA 4WU2A 1TK8A 4JI1F 2Y1LB 2Y9HA 3MR3A 4OX9F 2OPQB 2W2QP 4C0BA 4M5DB 2DPJA 3FBEA 2ZKTA 2E5IA 1C4AA 2G2OA 2MGZA 3A3OB 3MCMA 3NS5A 4AFFA 1KWMA 2E9RX 1ZAVA 2MEWA 4V19J 3QAUA 4WYWA 5B0AA 3EPIA 1VQOS 4B3SF 4IFVB 1HBMA 2B5JB 5E41A 3CJ8A 4OMFG 3W2WA 3MUTP 5D3GB 4DG1B 4USKA 4ED5A 3P3DA 2HBQB 2QMWA 3DMJB 2ZBRA 1UVJA 5AXMA 4PRFA 3RRHA 4DR2J 3BGRA 3MAAA 1CULA 4I64A 4LF6J 4FF3A 1M5PC 1TKTA 1PC5A 1HNXJ 1WNEA 2KU7A 3GJRB 2XSFA 2V69A 3GYNA 4KPYA 1XERA 3Q83A 1KC8T 3FDSA 5A8WB 1FWKA 3I87A 1SJ4P 3OR2B 4DV3J 3FC9A 2BKNA 2RRAA 4NLUA 1N5SA 4QIGA 2CQPA 4XPEA 1VMBA 1GMWD 1SUQA 1JLAA 3K57A 5DDQC 3W61A 4DS4A 3KXDA 1REVA 1IQZA 2DY1A 3HI9A 4WWSA 2CQBA 4AD6A 4C7QA 3UVJB 3GV8B 3IAS9 4OYZA 3KUEA 3PM9A 2PN6A 3MCOA 4IFVA 1G4CA 1HBMB 2B5JA 3SCIE 3R9LA 3DHWC 3W2WB 3JAMU 4DG1A 2EWHA 2RIJA 3GB0A 2OHDA 3DMJA 1RSCA 2FQQB 2FJAB 3HHKA 2CPZA 5ETRA 4AYBD 4C2MA 3MAAB 2H4YB 3A12A 3UCGA 3G8QA 4TU8A 3J7ZT 3MFHA 1SL1A 1RHJB 2L48A 2OJ3A 5EDWA 5C25A 1RCXB 3OR2A 1XTZA 1FVSA 1UA1A 3KHRA 1U7LA 4ZPBA 1LV5A 1S1UA 3HXMA 5KFFA 1WI8A 3QIPA 2D3O1 1U1NA 4USMA 3EWGA 4CO5A 4ELTA 4LF2A 1IWGA 1SUQB 2HEKA 3E8OA 3NS7B 5AXKA 3H4BA 1X4DA 4ELUA 4RW7B 1JXEA 3DLEA 4LVNP 1Y5IB 1REVB 3A13A 2V4JA 3D1QA 2YKNB 3ELHA 2HKEA 2B4UA 2FIUA 5IT0A 5KFXA 4QWDA 5C24A 4LR9A 4ZN3A 5HQ8A 3H40A 3GQCA 2BUNA 2I5JB 2KVIA 3FSXA 3JQJA 4L75A 4A48A 3Q8PB 4NPOA 4NXMJ 3DXBA 4P2XA 1B7FA 2LLZA 2ZH2A 2XM3A 2LEAA 2N3OA 1NK0A 2LA6A 2CZVC 5D4PA 2G1DA 4QQBA 2RDJA 4P2MA 1F3VA 1OY9A 3MMAB 1X4GA 3IGNA 3EXYA 2QE5A 1YQHA 2V94A 2J5AA 4CLWA 3JTPA 3CD0A 1VHFA 4ICLA 2A3JA 1N5YB 2JSXA 3DOKB 1OO0B 4OX7A 3JSMB 3NWGA 1T9XA 3M8QB 4CYUB 3OBIA 2LQ8A 5B7WA 2QL9B 3PJ9A 4OYXA 4ALZA 2R7WA 1CJTB 1VC5A 2M5YA 1FRJA 1HHTP 3AQOA 4DCPB 2W7PA 1M5VC 2VA3A 3EICA 1RTIA 3LGHA 1GMVA 3KLEB 5C24B 2IJNA 2PIIA 1UFWA 2EXUA 2MSSA 1YLXA 3FRZA 3LAKA 1EZZB 3AY0A 4O3NA 4X4RA 3CCSS 2B8QA 3K0JA 3PRBA 1KNZA 1LWCB 3DRYA 5ETTA 3UDEA 3MFIA 4PWDB 5EGYA 1WHYA 3R5GA 4HH1A 2DIUA 3AODA 2YNGA 3OTOJ 4C9DA 5J2NA 1A6LA 1TP7A 1FEHA 4DSKA 3DFEA 3KLGB 3D6FB 4DQSA 1BMQB 3V5RA 2E5LJ 3D54A 3ET6B 4ECZA 2GNKA 4NASA 1HARA 2MDAA 3RB3A 1UA0A 1N34J 2B56A 1U26A 2IA0A 1K47A 1YK9A 5BXIA 3W9IA 1TV6A 2D9PA 4K5RA 1BD6A 3I0SA 1YZ6A 4OX9J 3G6VA 1HW9A 3JSMA 2MY7A 1HWJA 3NGUA 3SDEB 2XS5A 3CJTA 1S1XA 2F9DA 2E1CA 1X4CA 1U09A 4U96A 1GX6A 1S7IA 2W01A 4ES3A 3PG9A 5F8HA 3WIUA 4ECVA 4B9VA 2OPSA 2W8KA 2E5GA 1KKHA 3TRGA 1HI8A 2YQ3A 2VPZB 4UUWA 5B0GA 4PPDA 3TAMB 4EI2A 2MZJA 5FLXY 1R0AA 2XYHB 1NPKA 3RG6A 2YH1A 5HVGA 1NJXA 2Q6BA 3BSNA 5A8RA 4PWDA 1RTHB 1SXLA 2M7SA 3CO9A 3QLHA 4OI3A 5GAGU 3Q8UA 5JJBA 3BQ1A 3CMAS 1ZM9A 5J2NB 2EW9A 4C3KA 4ECQA 2UU9F 1UFKA 2RT3A 4X84A 5LSLA 1UPPA 4MK8A 3VTIA 4WK3A 3MGJA 3K58A 2MKSA 3E51A 6AT1B 1FJ7A 2OFGX 4ZVFA 1RLDA 3L95X 1L3SA 2O1PA 4LF7J 2BRKA 1AROP 3I0SB 5HMYA 1WD6A 5KT7A 1U1MA 2HYIB 4WE1B 4FBTA 4AL5A 1XMQJ 2V8PA 3OT9A 4KC5A 4Y2CA 4O3OA 3SDEA 5AE3A 1T11A 2FY8A 2QA1A 4DUZJ 5D15A 4CO1A 3GU0A 4LFCF 3MR2A 4PWUA 3HHLD 4NLOA 2OPSB 2EG1A 3VVUA 2UVWA 1Q81T 2V9KA 3ZXWA 1LW2A 4CWBA 5DG9A 3KMSA 4NRUA 1KTVA 2AYMA 1XNQF 2O66A 3CJKB 5KT6A 5CZXA 2B0GA 4DWIA 3AHPA 4YHHJ 3CTRA 1N52B 1OIAA 5A8RB 1VQMS 4ELVA 2PFFB 2P6TA 2WONA 3QLHB 3UO0A 2W9AA 2C2MB 4FYYB 1VQ8S 2BZ2A 3TZXA 4A46A 2IM1A 1KOOA 2G13A 2AX0A 3HCXA 4DSIA 1HWIA 4P2FA 3RBZA 1XWLA 1J5EJ 2FLPA 2CQ0A 5AJ3F 1IXKA 2JNJA 2E5HA 1XR7A 3HZGA 3V6KA 2X3GA 1MMDA 3NBPB 3CJ2A 4OYWA 3C14B 2SXLA 1YI2S 3KLIA 1RISA 4N8NA 1PIEA 3BH6B 3I4HX 2A1BA 2FJDB 1KQFB 7FDRA 4C8NA 4EMDA 4ED2A 1KRPA 3E2EA 3FQLA 1N5QA 1RCOB 2B9YA 2CPIA 1H2VZ 4F0HA 5KAKA 1WF0A 3CJ3A 3PYFA 3IFEA 3QZ8A 1M5SA 2QFIA 5KFWA 3OVSA 4U8YA 3S01A 5MAOA 1R0CB 1SV5B 4A8WA 1KFDA 1RAIB 3PRVA 4A8KA 1F2GA 5DLGA 3OD2A 3OL9A 3BSCA 2XWYA 4QPXA 1YSJA 1IUJA 4QIVA 2BEFA 2YX4A 1J5OB 4PQUA 4EYHB 3AAWB 1UL3A 4A8YA 2QL7B 4DR1J 5LT5A 3I55S 4KR0B 2LKZA 1RWOB 4OLPA 1X31C 3G4SS 2CKWA 1TL7B 2E44A 4FVMA 4NL5A 2DGVA 4FS2A 1WOSA 4LVOP 2IRUA 2PA8D 1R3NA 2GVZB 4J7CA 1EARA 2WTFA 1XNRF 3K5PA 4XTTA 4WZQA 4OYBA 2B9EA 2DYAA 2MXYA 2FYXA 1JJ2R 4O23A 1CC7A 1KONA 3KLIB 3LP2A 4UZBA 1IBMF 3OFFA 1GXTA 1WEXA 3HM9A 5F9LA 1V3RA 2KVQE 3RZAA 5KG6A 4BBYA 1E6VB 5H9EK 3HMJG 4DSJA 2DK2A 2WVFA 2EK6A 4MFBA 3CJQA 4ZCMA 2RNEA 2V50A 5L1KA 4WP9A 1ELOA 1VQSA 1AUSL 3PHEA 4JOUA 1EB0A 4CZCA 5CYMA 3SSSA 3OTOF 4LRDA 3THPA 4UY8T 3M2RA 1UTAA 3PIOQ 5D8HB 4X4OA 2ROGA 5A2QY 1K0TA 1VQ4S 3K7RA 1ROFA 2IRXA 2VPWB 2AIRB 3J80Y 4X65J 3AQPA 4PXEA 5KFPA 3F0NA 4DLEA 3PXGa 1YIJS 4BWMA 2ERRA 1Y10A 2HVHA 3C19A 3LUYA 2DR6A 3HPOA 2PE8A 4MT1A 5KFIA 1S4EA 3FMBA 2QA2A 1Y3JA 5LMNJ 3GLJA 2C22A 3HKZD 3TJ8A 1GMUA 4WTOB 1TK0A 3OXFA 2B7BB 2LP4A 3LP0A 4C0HA 2GCFA 3CVKA 2BDPA 5FJ4A 3NGDA 2E7WA 2E9TA 4WCEQ 1ULRA 1RT5B 5J1EA 2Y8WA 3CT9A 4OI0A 2AP6A 2J0XA 1N32F 1KSPA 1S9EA 2UU9J 3CC4S 2LDYA 5I3UA 5HK4A 3FVYA 1IBKF 4E8UA 4RU2A 4KV8A 3NMAA 4NLXA 3CCVS 4Y2MA 4FVCA 3ZTOA 2Z2LA 2DKOB 1DTTB 1KBRA 2DNRA 3PW7A 2YKAA 2YWHA 3R5CA 3UN5A 4C6AA 1Y5NB 4YB5A 3ZTQA 4DFPA 4C8KA 1RT4A 3KG0A 1CVJA 3I6PA 3G87A 2IIHA 5KG0A 4HT7A 4IO9Q 3AXMA 4ECUA 3TX0A 2MQPA 3PO5A 1GEHA 1XK8A 4X4UA 1PYOB 1NK7A 4KSEB 5HVFA 4C8ZA 2NXJA 2W9CB 4K50A 3BV8A 1S6QA 4OYMA 1NK9A 3U1LA 1MMNA 4OQJA 1HR0J 4U9RA 4P9SA 4ZVHA 1X9SA 1Q5YA 3A4TA 3GFXA 4RNHA 5IWAJ 4FBUA 3J7Z5 3CIMA 5M2PA 1FESA 2HNZB 1NSKL 4DZ6A 3K5MA 3IBCB 5J1EB 2JHEA 2K8GA 3VAMA 2KZZA 1UVMA 4L76A 3OHBA 4I2PA 4ANCA 3D9BA 1PKUA 4KGXB 2VG5A 3SCKE 1LEOA 7FD1A 4K4XA 1J5EF 1JLCB 3PYGA 2RKIB 4P7VA 4YEAA 2ZM6F 4PAAA 1T05B 2AKWB 2KB2A 4KV8B 4OZ0A 3OTDA 2QV6A 2VODA 5E2QA 1DTTA 3AJ2A 3NP5A 3QPIA 4Q45A 3CCZA 1E6YB 2KM8B 2VJVA 1RT4B 4ITSA 4OI2A 1IR0A 2ZHAA 1RAAB 3BPSP 4RW6A 1U48A 2X1FA 3FJ2A 1F0XA 3UFCX 4TKTA 2W9CA 4WFNQ 2DT9A 5ETQA 1NPRA 4M94A 1HKAA 1NU4A 2CUYA 1S9GA 4TY8A 5I3QA 5JMNA 3HJFA 2R7VA 2NSBA 3H42A 3O8WA 2D41A 2OEKA 2EBEA 3OLBA 1KTQA 3C15A 1ZOTA 2HNZA 3I5CA 3N9UC 1HBUA 2DY9A 1LW0B 4PEOA 3ULHA 4DV0F 2XZDB 1T3OA 4AL6A 1Q86T 4NCBA 2YX1A 4X4TA 2W4CA 4RO0A 2MKHA 2Q43A 2A6MA 2DH7A 3K89A 5D0EA 1KLMB 3W8PA 1WKKA 2N82B 5FLXU 1CPZA 2DXFA 1VJWA 2C3MA 4ECRA 2OELA 3ZO7A 3HVTB 5J2QA 4NYPA 1VIOA 5LSOA 3GWCA 1H73A 2DCUB 1IBMJ 3M8ZA 4X62J 1VQLS 2C3PA 3QGIA 5I4MA 2VBXA 5KG5A 3FQKA 2WBMA 3B8HA 4DU8A 1PYSB 2YXLA 2KRBA 3NS6A 2KXNB 1B3TA 4CTAB 1KVJA 1U0HB 3ZNJ1 1U1KA 3M8PB 1YHQS 4DN0A 2HIYA 1KVKA 1T0TV 4RPFA 3CC7S 1QVFR 3GIJA 2ZOMA 5LMUJ 1R6VA 4LQ9A 3R2DJ 4WBFA 3NXZA 2HWHA 4RNMA 1ZETA 2NLWA 5GMKa 4QWAA 4UOFA 1BY9A 2C2KB 1YKWA 2F40A 2MSTA 2RS8A 1S48A 2V5HG 2HQ3A 1GXLA 3AD7C 4KPCA 4YB6A 3PX6A 2V9WA 1IVZA 2N7CA 4DL5A 3M6UA 2ZZTA 2ZHOA 2HHXA 1HQUB 3POTB 4O0IA 2BQRA 4EBCA 3TNVA 3M8RA 2DB1A 1OYEA 5JUMA 4B9MA 1O6XA 4LRFA 2R7XA 3D0HE 4DCJB 2CVIA 1NRKA 5D6GA 5LJ5Y 2UVVA 3MM7B 3TP2A 3HZEA 4MAKA 3NNCA 4QU6A 1NO8A 2HBYB 3AA8A 4N41A 2VBZA 2HAFA 4A47A 2DVIA 2XBPA 4RW4A 4KHPF 1QJHA 1N0VC 1RT1A 2CQDA 2RU3A 4JI1J 2CQGA 4ED3A 1X60A 3M8PA 2VFSA 3KYLA 2OUGA 1RTDB 1PBAA 3DCAA 1UEUA 2F63A 4DV7J 1MROB 3FRYA 3JAMY 3EVOA 1N32J 2W2PP 3BZQA 4J9PA 2KXFA 4B3SJ 3VAIA 2ASJA 1N34F 1VIXA 3AB2B 2WRMA 4TYBA 3VQTA 2R7RA 1NHUA 1RWMB 5LJ3Y 2NXUA 1IBKJ 1DTQB 2MJNA 2OD6A 2QX0A 1V3SA 2V2VA 2W1BA 3KG1A 3ILLA 2GQ2A 3QFWA 4OJGA 3BREA 4CH7A 2V34A 2B3TB 3POTA 5F3ZA 4QR0A 4LF8F 4KQZA 4JYAJ 1U45A 1TFWA 1TTHB 1UVKA 1SL2A 2ZE2B 1WTBA 5E3AA 3WBZA 3MEDB 1AA1B 5H9FK 1WSRA 3ZZUA 4CH1A 5LXRA 3CB4A 1JX4A 1TVRB 2VFRA 4FXVA 5CA5A 3PTWA 2OPPA 1T9UA 4DV2J 2ALZA 4LIWA 3KK2B 2CZ9A 1FRLA 2IHR1 1RT1B 3F41A 2ADBA 2VB6A 1IBCB 1HD0A 4YB1P 1WKLA 1LK5A 1TL4A 1H74A 4BWJA 2XMTA 2ZWOA 3H7HB 3OR1A 3GV7B 1V3ZA 2VH7A 2P8IA 1MROA 3PR5B 4KH1B 4OZ2A 5I3PA 5IV3A 2ATCB 3N79A 2FDNA 1RBOB 3HP6A 3MM6A 3JYTA 1A0OB 1Y3KA 1DQ8A 2MB0B 2E1MC 3AOBA 4F36A 1OYDA 4B3OB 3GIMA 4A8QA 1XC9A 3HLUA 2Z2MA 2IJFA 2CWKA 2VPXB 4WFXA 1XEZA 1QTNB 5KFVA 1X4EA 3W5ZA 5M2RA 3IN5A 5IT9Y 2DXDA 2JL9A 2JC0A 2AX1A 2EG2A 2AZ3A 3FFIA 4ILRA 1TUWA 2EFGA 4QWBA 1FRIA 3DLLQ 4YOEA 3MD3A 3MUVP 2KG1A 4B9TA 3J7AN 4HL9A 1BXNA 4ZK7M 1D0EA 4DSLA 4RWWA 3HSZA 4Z2XA 4LF9F 2UUWA 3CJ0A 3V6DA 1MN9A 1Q53A 2NYHA 3AT1B 4O3RA 2NZCA 3UNYA 1FJGJ 4DXLA 3KWMA 4LR7A 2HZAA 3BBFA 4DR3F 2R8JA 2GFFA 2W4DA 3LALA 3LP1B 1Q95G 3PFOA 3CD7A 3JYTB 1PJ6A 2WOMA 3MM6B 4RR5A 3WQPA 4ZITA 4USTA 3RAXA 3D1OA 1AZSB 1QLNA 1JNZB 4YB7A 1VBKA 4V1Ak 2R7QA 1S57A 4JV2A 2M0GB 3ISNC 1YJWS 3MUMP 1OQ3A 2CVEA 3CSKA 2AEFA 1IM6A 2JDJA 3CJ4A 3ZTSA 2J6TA 4LBIA 3L9ZA 4DV1F 2DH9A 4CQ1A 3ZZPA 1LWXA 2HQCA 4PYAA 2NUUG 2D69A 3CGIA 4ZPWR 1ZZNA 2WSCC 1FD8A 1FKPB 2DGSA 4NWBA 5HANA 3O3LA 4F4XA 1MNEA 5CHCB 1PJ5A 4K4TA 1P6TA 2DTJA 2WVEA 2V8VA 4ILMA 5HLFB 3IM8A 2K1RA 1N48A 2RF2B 3U1MA 2W24A 1T7PA 2EPIA 2UXDJ 1NAQA 2YKPA 1EIYB 1N33F 4MK9A 4TQSA 2VC1A 4CM0A 1FRMA 2GGPA 4IH7A 2LU1A 3C16A 4NE9C 1XNRJ 5F0UA 4WFAQ 4WXWA 1PAUB 2XMMA 3KFWX 2GIFA 3H2UB 3M2UB 3QFHA 3MWBA 3M2VA 5IT4A 1G1XA 5C7PA 3I31A 5E3RA 1XNQJ 3R97A 2PO4A 3MCNA 2MLZA 3GONA 1T9WA 2GQCA 4HR2A 3QWPA 3W2VB 4K4ZA 1YJTA 4CLLA 4P73A 4IUFA 4KRWA 1HFEL 2Q79A 3V2UC 4RBVA 2XZWA 3AOAA 2W7OA 2YBVA 4ANEA 2ZC4A 2HHWA 2IDLA 1D8ZA 4A8SA 2VG7A 1Q16B 2HVZA 4B02A 4LF4F 1U2RA 2ZWPA 1WC1A 1R8HA 1Q7LB 1EAYC 4Q8EA 4N56A 1NKBA 3NGTA 4YDDB 3OUYB 1CQMA 1NM2A 1S6PA 3CF5Q 4FF2A 4NLRA 3RR7A 1WTFA 4P7TA 2RAQA 4I6AA 3RBEA 4DDFA 4AXJA 3W3SA 1WORA 2AZ1A 2XS7A 3H59A 4C48A 4DV5F 5T14A 1RT2B 2HS3A 2CIMA 2NPFA 3LWMA 2HNDA 1HMVA 4ID5B 3SEOA 4ZKAA 5KFNA 2U2FA 3QT6A 3M2VB 4OV6A 4OHYA 3JTOA 4EFAC 1D8YA 1Q0NA 4DUYF 2I38A 2R8KA 3D6TB 2Z0GA 5RUBA 2H4WB 3I32A 2HNYB 2I6WA 3KK3B 2GJFA 1TL3A 2LVWA 1FK9A 1HBNB 1P9YA 4DZDA 4X4SA 2B43A 2VG7B 4K2JA 1NKCA 4KGMA 3EUNA 1V6HA 3U27A 5DLFA 3PYEA 3T1AA 1UVIA 3OTEA 2F8HA 4O3PA 2FHKA 2LYVA 1WC3A 2A0FB 2GMLA 3DLJA 1JIHA 4ENOA 3OUYA 4DUZF 1S6PB 1T9YA 3KHHA 4LFCJ 2F8MA 4JI8F 1SH2A 5A76A 1SQFA 2M52A 5B0CA 2GJ2A 5L1LA 1TKDA 4Y2IA 4WIIA 3TEGA 2BJ8A 2M8HA 4GMKA 1S0OA 2IA6A 3MTKA 2DPIA 4DUTA 1AUDA 4WKRA 3CJ5A 2XMAA 4CLZA 1CJUA 2BJ7A 1ZS6A 1C0TB 1UAWA 3MTJA 4YHHF 1KFSA 1EKRA 5HJXA 4Q43A 3X1LB 1NJYA 4IDKA 4RBUA 3ICLA 3IRXA 4DFMA 4CDIA 3G9CA 1YJUA 1QD1A 4KHRA 3TJ9A 2W8LA 1ZZFA 1HNIB 2IM2A 3QQCD 2EI5A 1RWNB 4NEYA 2B6AA 2XWXA 3MI7X 4EEYA 1NUEA 1RAJA 1OJ4A 1S6UA 3B4DA 3DM2B 4JB8B 5L46A 3M30B 5F8IA 4GVBB 4DL6A 2DHGA 3TI0A 1K8AT 2OTJS 2UXBJ 2EFOA 3JQKA 4ZP6A 1A9NB 3CMES 2FVPA 2Q1LA 1FJGF 2RILA 4PKDB 4Y0FA 3M9NB 2RSQA 3O6QA 3NL0A 3UW1A 3FCWA 3KJNB 3H25A 3PW4A 3QRPA 3GSIA 2BVZA 3HD2A 4ZP8A 4IYQA 1IR2A 4PQAA 4H54A 4Q5VA 4F4ZA 2KDOA 3VAKA 3R6LB 3QSYB 1NH8A 4AT1B 1YJNS 1URRA 1OSCA 1UEVA 4S0MA 5ETPA 1T95A 1SVDA 3T19A 5HBMB 5B09A 3IS9B 4AQYJ 2VIHA 1U6BA 1CJUB 1R89A 1NJZA 1I1GA 3CCJS 4MYTA 1DZ5A 3NGRA 3G6ES 3DRXA 4IDKB 4JI5J 2GX8A 1WELA 1YJVA 4OHVA 3FEZA 3Q2TC 1R27B 3GG1A 3CPWR 4F2RA 5CD4A 3NGSA 3PRDA 4U8VA 4Y34A 3MR7A 4JI6F 2B6AB 4QWEA 4O4GB 2ZH4A 2M3DA 3FEXB 3TEHB 2OKQA 5B0EA 3KLHB 1RT6B 3PJXA 3E01B 2E1RA 4GVBA 2HQDA 4OX6A 1T9VA 4IG0B 3HT0A 3W64A 3OVAA 1G6BA 5IM0A 4RNNA 2FJEB 1F9EB 3M6VA 3KOAA 4MYUA 4H4MA 1JB0C 3TW0A 4DV0J 4DPTA 2HMIB 1WHVA 1FRKA 2O01C 5A8KB 3OLAA 4HTJA 3VAHA 5F8MA 2F4VJ 3HJVA 1VISA 3AD8C 3JQMA 2Y1JA 2HVDA 2MQNA 1HYSB 2RU9A 2X7IA 2AHOB 1TL1A 2R7SA 5KT5A 3IS9A 3QZ7A 4LSLA 3C6TB 2PMHA 2VD3A 5GMEA 4KBIA 1CJKB 2NPIA 2C2ZB 3MAQA 1ZAXA 2YWEA 5B0DA 2OEMA 1SQEA 4K2XA 3L3CA 1SKWA 4F04B 4X4QA 3I9ZA 3QMQA 4MIAA 4X65F 1H2TZ 2B7CB 2I0XA 5D78A 3KLHA 2K3KA 4JI4F 4JI3J 1MWYA 2B9XA 1R7IA 1PAEX 1TKZB 1ZM2A 2DO0A 2PD1A 4NZ7A 2NXNA 4EZ9A 2VBWA 5KFMA 2C2NA 4H4MB 3VCDA 3I0RA 4XK8C 1TL5A 1WC0A 1RJJA 5A8KA 4G1QA 3W8GA 5LMNF 1H3DA 1UEKA 2I2YA 4PG7A 2C3OA 4OZJA 4P52A 3OL6A 4M5IA 2FJBB 1S79A 2MY8A 2RMLA 1VJQA 1HYSA 1S5ZA 1K44A 1WDTA 1TL1B 3BKUA 4G1PA 1NMEB 2H48B 1H38A 1B0TA 1EQMA 4EZ6A 2DHAA 1SKSA 5EX3A 1DLOB 4V19X 1Q7YT 5DG8A 1CJKA 3DDNA 1H98A 4DUYJ 2I9SA 4OZLA 4NLSA 4LBHA 1RAHB 2GIRA 2PEBA 1RAFB 2AMCB 5ETLA 4KHPJ 4QW8A 2IY5B 1GK8A 1SJFA 2KYXA 4RNOA 1FFSB 4RW8A 2QL5B 3P5BP 1U8SA 3SXLA 1UWBB 1YWXA 5BR8J 5J2PB 2RJZA 3SZ2A 4G1IA 1J27A 3FUYA 1XMQF 1ZM3A 3TZWA 2FJVA 2DNHA 3D3BJ 4KHMA 5A6WA 2DRDA 4ZJQA 4XPCA 1Q8LA 3Q8RB 1GTHA 3IG1B 4FXDA 3J81j 4P2SA 5K14A 5CAAA 2DNOA 2J8SA 3ZTRA 4OI4A 3AB4B 1FKOA 5CH7B 4ECXA 3ZZZA 1Y0HA 1W2IA 3IWNC 1AFIA 3R7BB 2YQ1A 4WFBQ 2HGMA 4MH8A 4P72A 1WF2A 1WG1A 4GKJF 4LFBF 5BYRA 1X5PA 5DQGA 5J2MB 1FJEB 3HFZB 3R8YA 3GZ7A 2QA4G 5FDLA 1DLOA 2ZH7A 3QT5A 1SH3A 3QT7A 2QT7A 2WAQD 3H2VE 4MIBA 3G82A 3R7SB 3UDCA 1JLFA 1F9HA 1X0FA 2ZM6J 1EETB 4WFYA 2GMHA 2LXUA 4NOHA 4ZVUB 2WSEC 3MM5B 5DGBA 2LQJA 3CCRS 1NZAA 2KFZA 1O5JA 3TA1A 1WC4A 1IKXB 4DR6J 1MU2A 3HHLB 2CPXA 3MECB 4ZLPA 4KGZB 4ED0A 1K73T 1F5AA 4RW8B 4QOTA 2MZQA 1NB2A 2DITA 1YZ7A 4DI6A 3SCLE 5J2PA 4DN9A 3AFGA 1MG7A 2NXCA 2LQ5A 1F2HA 1NXIA 2AYGA 4O44A 2CDRB 3LPEA 4KKOA 2BYCA 4CLUA 1XMBA 2CQ2A 2F65A 2RRNA 4D3HA 5L9XA 3J81U 1C1CA 4ZPCA 1P8GA 5K14B 3OHAA 3KK1B 5EWEA 3BSOA 2QFJA 4B9UA 1VK8A 3K2YA 1NSAA 1TUVA 1I51B 3HHDA 4TVAB 5G0RB 3UDVA 2V8HA 3TWZA 4USIA 1FHTA 4QCLA 3PNIA 4ED6A 1X5SA 2OMLA 3BJYA 4HDHA 1FE4A 1WKJA 2VU5A 3F56A 4IOBA 3BB5A 4USVA 4PABA 1NDLA 3RBDA 1FDNA 3G6YA 3IBFB 1KQKA 1XMOF 1M1KT 5J1PA 3T1HJ 3QJPA 2F8EX 3CE8A 4CNZA 1C0UB 3IWXA 1A7GE 4K0KF 1S12A 4LUBA 5D3GA 4LF9J 1VRTA 4DF4A 4K5SA 2J9DE 1RWXB 5GVQA 1UPMB 1W2BR 2ZZNA 1S0VA 1QAYA 4DV4J 1G7CB 3QRRA 3BGRB 2PMZD 1CQNA 3EZUA 1TKTB 2ZVSA 4USUA 3VWSA 4J9NA 4ED1A 4B3RF 1AB8A 3RRGA 2PEHA 1RWPB 4HT5A 1U25A 3U1NA 4MJKA 1JXVA 2ROEA 1C1CB 1QM9A 2ASLA 3FNNA 4B17A 2EFQA 3KK1A 2GAHC 1SCJB 3FMWA 3L09A 2L9DA 3T3FA 2ZBIA 3VALA 1QAJA 1JLAB 1R6YA 1Q8KA 2ZVIA 4ZMMA 1SKRA 2UVUA 4AXIA 3V6JA 2HHTA 1ZM4A 3KTQA 2DNZA 1C0UA 2QLWA 4JUZA 2APOA 2HQGA 3TAQA 1NZ8A 5IXUA 1HBOA 3D2WA 3BDPA 3HULA 4DLGA 4QYZJ 2DNLA 2K2PA 3OFHA 2PFDA 3W5YA 3UR0A 3MOJB 2LDIA 2ZDPA 2MQMA 1DAXA 2MQOA 3KDNA 2CJQA 2XO6A 3UE2A 3M4XA 3IGVA 2ZNYA 3M6XA 4Y00A 3DLBA 2N4DA 4PG4A 1YBTA 1S1UB 5L1IA 1DRZA 2BOAA 2OP5A 3QIPB 5BYSA 1N54B 2JH3A 3GIRA 2MZRA 2HVIA 3N6MA 2ZKUA 1F5BA 4I56A 3VF0B 3CJRA 1JJHA 4RW7A 1I94J 2AV5A 2H51B 3DLEB 1HD1A 1HWUA 4USJC 2HK2A 2FVSA 2V4JB 1RP5A 1KQSR 3I5AA 4H4KC 5KFYA 1YJ7A 1PO6A 1Q8IA 1DURA 1M5OC 2FLLA 5HMWA 1TAUA 2RUSA 5HAOA 3ILJA 5HL7Q 1O51A 4HDGA 2ZD1B 3QGGA 2XGPA 4JYAF 2AWZA 1S9FA 3SI8A 4B3TJ 1IWAA 3US5A 4NLWA 3TUZC 2FY1A 3VR1A 3EXCX 4RZRA 2J7KA 2J0QD 3MMJA 3MMCB 2COLA 2KM8C 3MMAA 1HQEA 1YX2A 3LQVA 3V4MA 1D3WA 2LMIA 2QSFA 4RKUC 4DV2F 1EQ0A 2ZJQQ 1WDDA 5EWGA 3A8KA 1PBUA 3OFGA 1ICEB 2L3MA 4RBTA 4ICLB 1S10A 2A2CA 3JB9k 1N5YA 1WACA 2YWGA 1KVIA 1IKYB 3RAQA 1RYRA 2KHCA 4CYUA 2UUAF 2WW8A 4L73A 1DBDA 4DX7A 3HVRA 2OSRA 1CJTA 2DGQA 1SKUB 4QIEA 5EUHA 2BQUA 1S0MA 1QTMA 4NLGA 3M1VA 3Q89A 4TU9A 2ZFHA 3DGVA 4DR6F 4K4YA 1RQ0A 5B0FA 4ETXA 2MKIA 2AJ2A 1LQ9A 3FZBA 3BO3A 5KTQA 2ZD1A 3LOUA 4FKXA 2KH9A 1U02A 4RL1A 1LWCA 3DRSB 8AT1B 2J8AA 4CP5A 2FVRA 3J7A1 5T41A 2W25A 3KLFA 4ZVSB 2YNGB 1JLEB 4OHXA 4U67Q 2OMOA 2MZ1A 3MMCA 2BJ3A 1FE0A 1FRHA 2BM0A 2FGCA 4FN5A 3KLGA 2CXEA 2XMKA 3ET6A 3THVA 2HRTA 1TU0B 2Z2YB 3I96A 3UDLA 4YMEA 4GKJJ 1RABB 4KJIA 1TV6B 2HG4A 2DO4A 1TQLA 2E1AA 2VICA 4CT8A 4DV6F 2F7VA 2OIHA 3BH7B 3FSYA 3ADAC 1NJWA 1TMJA 2W9BB 1S1XB 2D9OA 2C2OB 2KKHA 4QPTA 4NI2A 2KRRA 5KFAA 1JNRB 1DY3A 4ED7A 1YGYA 3EGWB 1IJEB 5A0YA 1FKAF 4WU3A 2UXBF 4ECTA 5F41A 3TAMA 4Q2LA 2U1AA 4GC6A 4M5LA 3R2CJ 3EZOA 4TXSA 2A2DA 5GAEU 4ECYA 5KFUA 2WVCA 1Q79A 3BN7A 3C6UB 2QO3A 5D0RA 1HW8A 3DRSA 3TZYA 4XIUA 2R9LA 4B3RJ 3KLFB 4PYDA 3LF0A 1CJVB 1W26A 1ZBTA 3TO8A 3VQSA 4DL2A 2BW2A 2EC0A 1JWWA 4I0WA 1HQ2A 1TR0A 3VV2B 1N0UA 3A3NB 4CO2A 1GH8A 1SPBP 2IM3A 2W7AA 4Y65A 2R7UA 1X5TA 3NCQA 1FNXH 4KT0C 3CIZA 5KG4A 5D77A 4BS2A 3GR1A 3K5NA 1U1PA 3D7SB 3W62A 2ZJPQ 1L5UA 1N33J 1VBYA 2ASYA 5GADU 5KOXA 1Y4ZB 2ZH6A 2AW0A 1NHKL 2W9BA 2IAJA 2BJ9A 4NI2B 4ZPTR 4RWXA 5KFEA 1QAIA 1JKHA 4FNHA 5ETVA 5KFDA 1K0VA 4CNYA 4C4WA 3LPYA 1Z2ZA 2QMUB 3SCJE 2HURA 2B51A 4MKBA 4F3OA 4NCAA 4Q2MA 4HI2A 1AFJA 1YJ9S 3K5OA 3OSPA 3C6UA 5DRKA 2WONB 1RWVB 4LR8A 4FYXB 2XLIA 5SZTA 1I5OB 1CJVA 1OSDA 4PCQA 3PEJA 1X4BA 3NCPA 2AJ4A 1K1QA 2VDHA 2M2BA 5JVGQ 4DR7F 3NAIA 4KB7A 3KNAA 3HFVA 4RUBA 1BQXA 4OZ1A 5SUHA 3Q23A 3QATA 1RK8A 2OGUA 3C14A 1OY6A 3GV5B 3GYXB 4O3QA 3VVTA 4QW9A 2ZH3A 2CYYA 1QSYA 3OTBA 2BW7A 3QYYA 4A8OA 4FPRA 2V8DA 2ABYA 4F4AA 4Q8FA 2ZH9A 1PGZA 4OJ1A 3PVXA 3QRQA 5A6PA 2UUTA 1IKWA 3CWJA 3H98A 4AE5A 2R2RA 2H5EA 3T1YJ 4JI3F 1VRUB 2VV5A 4FKYA 5HMXA 1JKHB 1NBEB 1NDKA 4B3TF 3KHLA 2HFVA 3P8BB 2KN4A 2XCAA 4OJ3A 3UR3C 4R8UB 1RE1B 4N47A 1D09B 3PKYA 1JJ4A 3NY0A 2RVJA 2GO8A 2HFUA 2CJAA 2OSQA 4NCGA 5HSPA 2WSFC 2QLBB 3HO1A 2VC0A 4LFAJ 1N8RT 3C66A 3QJLA 5D4LA 4D3GA 5HROA 4DX6A 2CFXA 1TL7A 4RUCA 1WF1A 3THTA 4B3MF 4MIWA 2GVZA 1U6FA 1QE1B 3NKYA 4LQ3A 3SFGA 3MR5A 1T3NA 2M88A 1MW7A 1JLQB 2VFTA 4JI8J 3LP2B 4F3MA 4C8YA 1LFWA 4P10A 1Q82T 2CQ4A 2HBRB 5B0BA 2ZH8A 1VC6A 4O3SA 3GILA 1T9TA 2BV3A 4F0MA 1IKWB 2GVDB 2ZDOA 4MK7A 4MFBB 5BR8F 4DL4A 3I82A 2X1AA 4F4WA 2JC1A 3NOGA 1NJIT 3PO4A 1VRUA 4B9NA 2W2OP 3TANA 2MZSA 8ATCB 4LFBJ 2M4MA 3GCWP 3M6WA 4CIOA 5KFTA 2Q3PA 4XDCA 5D0GA 2R2UA 3R1HA 1GTEA 2BABA 3FCVA 3M2RB 3V6HA 4NCGB 1CS4A 4J37A 4WK1A 1UW4A 1XR5A 3A8EA 5DO2A 4DPYA 4UQGA 1IM4A 2ILYA 2OD4A 3IWLA 3DOLB 5E3PA 3H5UA 2HPUA 2IVFB 1FDDA 1QDUB 1Z2LA 2CRLA 2XEXA 4ZVPB 1S1VB 3P49B 4DR4J 3B82A 4PZVA 3BF4A 1F1BB 5CZVA 4AUKA 1VI7A 3RB6A 2UP1A 2R8IA 3S6EA 2EFVA 4Y6IA 4J9RA 1I3OB 2Y0BB 2XSJB 4IRDA 2IMWP 2MQLA 2VG6B 2IVYA 2W4PA 4NLTA 4DF8A 1EX8A 4MKAA 2R42A 3BR9A 3PEHA 1R8CA 2EFNA 2WBRA 4M63A 2GVDA 3ENVA 4NLQA 5KG1A 3HX9A 2RQMA 2E29A 4EK2A 4EBEA 1JQGA 2V6AA 3OJSA 4TLRA 2BA9A 4JI5F 2VONA 2DR7A 2I8EA 4QU7A 3BGFA 4Z7YA 4QIWD 1WC5A 3ZC4A 4DMZA 3P96A 4ES2A 3CUNA 4Q0BA 1Y7PA 4IQXA 1S9EB 1LOUA 3QBCA 2X1GA 3CC2S 2FJWA 2JEGA 2AF6A 1M5HA 4I2QA 3WIVA 2B4PA 5F9NA 3BQ0A 1ZTTA 2E66A 3DOLA 2UV8G 3EMTA 3K59A 1V5VA 2DHXA 1NDCA 2QG9B 4GO7X 4ZOSA 3TAPA 5K9FA 3B54A 1CSJA 1ZYQA 3EGNA 4LSZB 2C2EA 2AGQA 2UVRA 3CDAA 1HNXF 1LXNA 2MQ8A 3AD9C 2UUCJ 2C42A 1HL6A 2XG8A 3HKWA 3R27A 3GJSB 4URGA 2D3OR 1PSDA 2LCWA 2W2MP 2VG6A 4P71A 4W98A 4ZCLA 2V4QA 1SIZA 2DRAA 2PSZA 2BBEA 5K8PA 3DYAB 1UVLA 1LWEB 1B7YB 2DR5A 3ZZOA 2V4RA 2O5DA 2LEPA 1U2CA 3PACA 6FD1A 5L1JA 2JRSA 4NMXA 2EC2A 1F9FA 3D66A 1BHNA 1Y5LB 1XR6A 3JXOA 4JBCA 3TVYA 1QVGR 5ETMA 3OV7A 4PUOA 5KFOA 4ED4A 1RKIA 1X7VA 1X0PA 3PW5A 4Q0BB 2GJIA 4WYLA 3R7NB 3TJAA 2VG5B 1WG5A 3N28A 2RKIA 4HYKA 1BGXT 4JI4J 1NH7A 4CT9A 1T05A 4F4YA 4LSNA 2BOPA 3C3LA 1RT7A 2QJ3A 1RWKB 2Z58B 4XDDA 3QGHA 4ILLA 2MZTA 3BSAA 4NA2A 1SJQA 2AYEA 3BEGB 2RH3A 2FLNA 1RT3A 4J90A 4FF1A 2BANB 2CPYA 5F8NA 1N5VA 2YPZA 2YKMB 5AE2A 2AJQA 1SC3B 2R7OA 1BWVA 2PC6A 2WW4A 2ZBQA 5HO4A 2YNIB 3MEGA 4PR6A 1N6QA 1CLFA 4IQMA 3ONQA 5KFJA 1RTJB 2FC9A 3DYAA 4CH0S 1LWEA 1OPIA 5LSRA 2DXEA 1OS5A 4TY8B 2KO1A 4A8XA 2BKOA 1U1QA 4OX8A 2DRBA 2V8GA 2Q66A 4LRBA 1QUPA 2B9WA 3AJDA 3D4JA 4KH0B 4DX8H 5DDPC 2JZ5A 2RQKA 3GG0A 4DQIA 4OL8A 3ISND 3MURP 4TU7A 1LW0A 3G6XA 2J7UA 5L38A 4HEA9 2UV8A 5EN1A 2MHNA 3LTOA 2GQQA 4PPZA 2OPQA 3UWTA 1B0PA 4HTIA 4KO0A 1SQGA 5AE1A 5JXSA 3T9NA 3VGTA 1H6KX 3KJVA 2UUBF 2C3UA 1KLMA 1RT7B 3BM7A 3EVMA 2HS0A 3MM9B 4UZCA 3N4WA 3R5JB 3MD1A 2MGZB 4DQRA 2L41A 2ZH1A 4UQTA 3G8SA 3HVTA 5J2QB 2H9ZA 4DCOB 2YVSA 2Y1IA 2LU2A 2NUHA 3JSRA 2PGCA 1FERA 4MMOA 2QGFB 1U4BA 2C2RA 1N6QB 3MPWA 4ZVEA 3TUIC 1APSA 2CQ1A 2G0CA 2CQIA 2DIVA 5A2QU 1U0HA 1FD2A 1RTJA 2M9KA 4K8RA 4F7VA 3OL7A 4OZNA 4YS2A 3I56S 4BCAA 3DDKA 3LAMA 1HNZJ 2FD2A 3P45B 1LKZA 3DHXA 3MCSA 3WDOA 2IVMA 1R8PA 1V9OA 1PILA 1UW9A 1PCAA 3BS9A 3L7OA 1AXQA 2LA4A 4R0EA 3T6JA 4TY9A 5IWAF 2MLYA 4NEZA 4ZDNA 5E7OB 3TUJC 2Z8QA 4KO0B 4JI2F 2OI2A 3KJVB 3KLVA 2UUAJ 3MM9A 2QRRA 5IOLA 3MHYA 4FS1A 1RB0A 3V81A 3MXHP 3UVJA 3M9MB 3FKBA 1Q8BA 4NRTA 1RHQB 4K59A 1IJFB 1UJ6A 1FWPA 3BDEA 3MM7A 2J9DA 1TELA 3BKFA 3UN2A 2DGWA 5HJYA 5DJBA 2ZOGA 1X4AA 2DNPA 1KS2A 1VYAA 3MPYA 3V81B 4RW4B 4M5GA 3W60A 4NMLA 1H0HB 2IPOB 1RI7A 4KIAA 4DL0C 4E98A 2OH2A 3EJMA 5HP1B 3IR5B 4N5SA 1FXRA 1YG0A 1RTDA 5C25B 3LW5C 4X2BA 1ZPWX 2YNHB 2CJXB 1RU1A 1FI4A 3SBMA 4TLQA 4J9LA 1J2VA 1EP4B 3Q2SC 2CAJA 1WC6A 2BQ3A 1CG2A 3H5SA 2XMWA 3RAMA 3QIDA 3N6NA 1WI6A 4IKAA 3U02A 3UD3P 1U49A 1NK6A 1WOOA 2MYFA 3T5KA 1Q1KA 4DR5J 1YBUA 1VQKS 4DV4F 2ACYA 2E5JA 3R3TA 1DTQA 1C1BB 1FFGB 3BYRA 5E5NA 3ZNUA 2ILZA 5BYQA 2AJFE 1BQNA 2O67A 3FBFA 3FGVA 3CCLS 2YKNA 4C11A 2UUCF 2FTRA 1VR6A 4IG3B 2ZE2A 5CD4H 2NYIA 2PA3A 1U47A 2I5JA 3KJFB 3MEDA 2C3YA 5B08A 3K8WA 1TVRA 1Q78A 2Y0SD 3ITHB 4L72B 1HHSA 2MTLA 4NXNF 2OPPB 4ZP7A 5ETNA 3J7YU 1R8BA 2RQ4A 2HBZB 3B6BA 1RTZA 2VZ9A 2QLXA 4QYRA 1VBXA 5HP1A 1KP6A 4LF7F 2HHVA 2EEYA 2R3VA 2KG0A 2FVQA 3OR1B 5ETOA 5IZHA 4WZMA 3GMGA 2YNHA 3M05A 1RHUB 3D28A 1FFWB 3HSJA 3N6LA 4YR3A 1EP4A 2VJUA 3FCHA 5F0WA 1FTRA 2CADA 1MWQA 2XZTB 4C3LA 2IMOA 2VPYB 1ZA2B 4NLYA 2OTLS 2LXIA 4DBQA 3MPDA 2AJ1A 3DOKA 1HWKA 1FXDA 3M8QA 4RLEA 2JLGA 1C1BA 1VDHA 2CNNB 3CMQA 4ATNA 4EO8A 4QWCA 1R43A 1BQNB 1R31A 2QZ8A 3AH6A 2AEMA 3J7YI 2ADCA 1IKVA 4JP8A 5D0HA 4C11B 2N4CA 1RTIB 1FX4A 3WX4A 3WC2A 2K7KA 4I1TA 3SQGB 6FDRA 4IG3A 3GJQB 3K8VA 3QNWB 4KYZA 4ECWA 2B4OA 1N5TA 2YWWA 4FDFA 3ITHA 1N36F 2AU0A 4Q44A 3EDRB 2O3DA 4ZP9A 5AJ3J 1C2PA 4W90B 2BE9B 2HFOA 4NLVA 2JVOA 1WHXA 2OLWA 3L7PA 5DZ6A 3TQ1A 2GIQA 4CLSA 2DNYA 1B4SA 2FVCA 1T03A 2D7SA 4FPIA 2V0NA 2F5GA 1DHMA 3FK4A 4IOCQ 1AYEA 2QLJB 3MF5A 3B78A 1WUUA 3PHTA 1O8BA 3PDNA 5E3QA 1EKSA 5F8GA 4OYPA 1AT1B 3MZIA 2JVRA 1S99A 2WOMB 5F3TA 1FXLA 3HSDA 4L74A 1BQMA 2UUBJ 4ZVTB 5I42A 4F0KA 1AZSA 2K3IA 3O2IA 3VZHA 3QGPA 1RAGB 5AXLA 1UZDA 2KT3A 3WZ0A 4ZHRB 1QSSA 3AXKA 1IKVB 4A8FA 2BE7D 2KZMA 3PYDA 1TUGB 1WEZA 5KFSA 2UXCF 2VASA 2JLEA 3BKTA 3SQGA 3WX8A 4DU7A 5EHHA 1R0AB 4I7FA 2XYPB 3HF5A 4DR1F 2Z30B 3UNGC 2HQFA 3M8WA 4CLFA 3DLKA 1GMWA 1RA7A 4O0NA 4J9KA 4UF4A 1RGVA 1RTHA 1FKPA 4X4NA 2J7WA 5L8RC 2Y3YA 1O0PA 2XYGB 4NZ0A 4OV1A 2XO7A 2MHEA 4KAIA 4P74A 5HLFA 3A3PB 1S97A 2RF2A 2OEJA 5T7LB 3CD5A 1T03B 3CD6S 2J9EA 2YKQA 2JEIA 3H20A 3KMQA 1ZH5A 2VDIA 2CQ3A 4J5OA 3C16B 4JI0F 1YRTA 5G4DA 4LRCA 1L3KA 1BQMB 4WE1A 4CLKA 4ZLLA 5I42B 3EDQB 1Q4RA 4NYOA 4WIQA 5E0OA 3W1YC 4DPUA 4ZHRA 4MKYA 3KLEA 3W2VA 2N7YA 4J91A 1SJ3P 5GAHU 3SV4A 1IBLF 2QYCA 1VQYA 2F1FA 4I69A 3CW2C 1GFWB 4N8OA 5K8OA 2YQ0A 1LW2B 5DDOC 4I7FB 4R25A 5CYQA 3T5HA 5F8JA 4DPXA 3CJKA 3DLKB 1SL0A 3PW0A 2ZBCA 3QSIA 5H9EJ 4DV6J 4F25A 5C5JA 2OAUA 2QSWA 3M32A 2ZUAA 4FP9A 1CC8A 4ZPDA 3S8SA 4YR2A 2XC9A 3DGPA 2DNGA 3OSNA 4F2SA 3JS9A 1OMSA 3MEEB 3NAHA 4OIXA 2AGOA 5T7LA 1VCTA 3BYPA 4P6QA 3NBPA 4BDPA 1QY7A 2JWNA 2BX6A 2WCXA 5GAHI 2YY3A 4LT6A 1T94A 1JXLA 2BACA 5IFMA 2HNDB 1FF2A 4ID5A 2H3EB 3OW2R 5KFQA 3X3UA 4K4WA 4X66F 4F4KA 5HQLA 2B8PA 4K7QA 1IR1A 1V5IB 4WPAA 4BLGA 2KFNA 2MMYA 2QTWA 2Z56B 5KFRA 2HLUA 2CJ9A 1SV5A 2VKZG 2NSCA 4DFJA 3DKDA 3GFYA 1G3OA 2HSEB 2M70A 3H90A 4N77A 2HNYA 3RYLA 3KK3A 1RWWB 1VLOA 2BMBA 3HHEA 1TL3B 5CYQB 3UN3A 1KEKA 1M90T 2CWXA 2HVEA 1JMTA 3ILIA 3H8YA 4EYIB 3KNGA 1J5OA 2NREA 2HGNA 4PQUB 4DV1J 3CCQS 1U0SA 3M32B 3CDEA 3CCMS 2CA9A 2XMJA 3DGPB 1X8DA 2GA7A 1XIQA 3MEEA 1WG4A 2QN6B 1XQIA 3Q86A 1JLBB 1JK9B 5DDRC 4X64J 4IR9A 1FRXA 2CDQA 5MLCV 1D9AA 1WSVA 1SC6A 5GADI 3SIPB 4LIRA 3RJMB 2UXDF 2BRLA 3HVWA 2BXJA 3LH2S 4OZ5A 2XGQA 3J81Y 1HR0F 3KDOA 4ERDA 4IRKA 3Q24A 3BGOP 2HHHF 1E6VA 4XO0A 4U6PA 3S7RA 3IRXB 1S0NA 4QBUA 2WHOA 3UD4P 1S6OA 3BN4A 4H4OA 2XLJA 3K17A 1VBZA 1HIYA 1NPPA 2RD5C 1HNIA 2XULA 4L3KA 4PG8A 5JVHQ 4DL3A 1VLYA 4YY3J 5CYMB 2CZ4A 3NEKA 3G86A 2R8GA 3NWRA 3D68A 1HI0P 2G4BA 2FC8A 2VL1A 2JX2A 2ZC3A 4L6V3 3TVZA 2HHSA 2J0WA 2C1EB 2WVDA 2CQCA 4GRSA 4CO4A 5DM7Q 1M1HA 3NLCA 3PV8A 4RUHA 1DJ0A 2GHPA 4YP3A 5DGAA 1FA0A 4W4MA 3T1YF 1JLBA 4M1KA 2XNRA 4K4UA 4UUXA 1FEEA 3KUGA 4ZCKA 2XY5A 1HI1A 1S1TB 1CEZA 4EWTA 1VQNS 3DC2A 1KD1T 1GX5A 2G2YA 5HBMA 4UOGA 3GIIA 3LO3A 3ETMA 1VQ5S 1FWLA 4U95A 3CJSA 1BC6A 4DV5J 4LFAF 2GAGC 2ZH5A 3GPAA 3C46A 2XS2A 2F9JA 2KT2A 2ACMA 3I4PA 4H4OB 3ILOA 3SV3A 3OXGA 5F8LA 2JFDA 3F44A 3IAM9 4M95A 3LP0B 3BGLA 1MSWD 2IYGA 4M5KA 2WZ1A 1P9QC 4O4GA 1RT5A 2DEJA 1RT6A 2DCLA 2VQFJ 4Y3CA 2XMUA 4DPWA 2Y1RI 1P1TA 5IM0B 1KQGB 5I3UB 4QJVA 2KL8A 3OXLA 4CO0A 1FNMA 3FEYB 1Y11A 4EGLA 3U7JA 5KT2A 3HHNB 2K06A 5HVHA 4X62F 2BM1A 1REGX 2HLTA 1GNKA 2EK1A 4YN3B 4QR2A 2JEFA 4G65A 1N88A 4BHQA 4R0JA 1GT8A 4KY3A 3S1TA 2I1RA 1S1TA 2J0SD 4ZA1A 2HZCA 2P9CA 3D3CJ 3N0VA 4LSLB 3C6TA 3IP0A 4USWA 3TA0A 1HNWF 4IOAQ 3LA0A 5K8NA 8RUCA 3TA2A 5C42B 2XLKA 1S4FA 1UKUA 1S49A 1S6QB 4IR1A 2XHCA 2AEJA 2KT5A 3D0GE 2GC8A 2KXHA 2E7VA 3DLGB 4DJBA 1Y00A 4C8OA 4HHUA 4LJMA 1S76D 4DR4F 3AOCA 4ZPVR 3R5BA 1HNZF 3G96A 1NB7A 5IV4A 2L08A 2HRUA 3HHLC 3O44A 2FZCB 3DDIA 4I2PB 2VFVA 4WXOA 5ADZA 2RHQB 1TKZA 2RQCA 4NX9A 5FD1A 1X9WA 2IRYA 1JLCA 3A8JA 2XI2A 2DBBA 2HGLA 1F60B 3FSIA 3I0RB 3HVAA 4UOCA 3OQ2A 2D3ZA 3PCOB 4ZIWA 5DM6Q 4G1QB 1NHVA 2OO4A 2M8DB 5BJRA 2JLFA 2QYGA 3RR8A 2R7TA 1Z4UA 3QAEA 1E6YA 5H9FJ 2CJBA 2HHPA 4X66J 2BR0A 2FJXA 2FPHX 1HA1A 3D67A 3RW6A 2EKNA 2FHOB 3RU0A 3VGSA 2P9EA 4RW6B 3VGUA 5DG7A 4CO3A 4DV7F 3Q8VA 2IBOA 1D9DA 5C42A 2XI3A 4ZN1A 2IBKA 4F02A 3DLGA 1K9MT 2X51A 1S9GB 3MMBB 1N56A 1H72C 2KJWA 3IR6B 4WKYA 5CCLA 5GAGI 4OI1A 3TX8A 4RNFA 3C15B 3G2XA 4OHWA 4OYIA 4ZJOA 1HBUB 4DSFA 3CDBA 2IC3B 3DN9A 3MAHA 3OL8A 3H2LA 4LF8J 2NQPA 1OQ6A 2V2KA 1RU2A 4JI7F 4FNIA 4DQPA 4DR5F 2Z4PA 5KG7A 1FKOB 1KR4A 1MLAA 2CNLB 2Z2ZA 2LQ9A 4ER8A 2GV1A 1EJ7L 1VGYA 2QC3A 3FBCA 1XN9A 4KFBB 2E1PA 3HT3A 3BO4A 1D9FA 3MOZA 1X4HA 1R0BG 3M8SA 3F73A 1TFYA 4DV3F 2J76E 4CTAA 3CCUS 5KT3A 1UWAA 1JLFB 4U7UK 4NXNJ 3SSQA 4Z7CA 1IQTA 2XMVA 2YKOA 1TAQA 2CG4A 3MM5A 4YY3F 1FO1A 1YRXA 3MMBA 5D4NA 2HQIA 1MU2B 3HHLA 1VHIA 1ZA1B 2ZZMA 1RLCL 3CEDA 2YNFB 3T41A 1YJRA 3LGNA 2ALYB 2D1CA 3M7VA 4ZS6A 1U1OA 2FHMA 2IC3A 3CNQP 4HHJA 2VQEF 3DU5A 4O44B 2CNOB 2RDIA 3DRRB 1VQ6S 2OFHX 4M5JA 3WC0A 9RUBA 3EX7B 3HD1A 2DGTA 2DGOA 1HQUA 1SB6A 2EVZA 4AL7A 2AD9A 1FT8A 4NZ6A 2MQQA 5IC6B 4N7TA 1I6JA 2HFNA 3PY8A 1CBKA 3R5AA 1X5OA 1S77D 4JV5J 4ZLNA 3ENQA 1D1UA 4Y2KA 4CLPA 5KFKA 2DNNA 1IN0A 2K7JA 4KFBA 4BC9A 2XCPA 4NLDA 1OY8A 7AT1B 1OWXA 4UY85 3SMZA 1BWEA 4DR3J 3BQ2A 1N36J 4UW2A 2CJKA 4JV1A 2QIFA 2XHWA 3IO1A 2FZKB 4LBPA 2CPFA 1T8EA 2DEIA 1VRTB 2D3UA 2CJYB 2VOOA 3OPKA 2H1YA 4E2FB
chains in the Genus database with same CATH topology
3FZ2A 3ETOA 1KN6A 2YNFA 1FVQA 3QO9B 1TZ0A 3NCRA 2KJVA 5CYJA 2ZJRQ 4C8LA 1RA6A 4KE5A 1ZAWA 3DRRA 1U1RA 2AQ4A 5CXTA 3PIPQ 4IH6A 2QMXA 5J1NA 5DQIA 5KG3A 5U47A 2XNQA 4NXMF 3KG4A 3TARA 1W25A 5M2UA 4NLPA 3VAJA 2HW3A 3UI3A 1NEEA 1YRUA 2VBYA 1M5KC 2J9CA 2YWFA 3VAGA 2RE1A 4LMZA 4B08A 1HPZB 3KK2A 3Q22A 2PT0A 1WEYA 1SJ1A 5CQGA 4FZVA 3M9OB 4USHA 3H5XA 4C8MA 2BE2B 3OVBA 2VFUA 3EYZA 1HBOB 2ROPA 3LWLA 2FUG9 2KFYA 3DU6A 5KOWA 2HHQA 3QO9A 4KGKA 1NNDA 3NNAA 3BO2A 1OPZA 4B3OA 2FLOA 2BJEA 4Y28C 1KOHA 3HDSA 2P9GA 4C0OC 1NK8A 1DFDA 1Y9OA 1S7HA 2ASDA 3D1HA 1L3VA 4FXWA 4I4BA 4L3NA 3DI6A 3B4MA 3GSDA 3QWUA 3FFIB 1SIWB 1SBRA 1VK3A 3RW7A 5FIIA 4KTQA 1ZPVA 2RB7A 1HPZA 2HIQA 3KHGA 2E5LF 3ZZTA 3N5FA 5KG2A 2E9ZA 3V6DB 3JSBA 3T5LA 2EKYA 2DGXA 1AW0A 3IXQA 4RW9A 1VS3A 2BE2A 4LF6F 2AYBA 3T1HF 3T6BA 2L9NA 3LP1A 3R5DA 4WJBA 2XY6A 1B0VA 3IA0A 4U7CA 2CPHA 4NA3A 4GKKF 2PI5A 3D5MA 1HQEB 2N3LA 4Y2AA 4I68A 3OTCA 3C8YA 2NS1B 3ENWA 3DI6B 2GO9A 3GFHA 3O1LA 4NA1A 1IKYA 4G6VB 3DOMA 4I6WA 2YX7A 3O5TB 4A8MP 1YVFA 2JOQA 3CCTA 4HH0A 2DR9A 1K1SA 3M1VB 3V4IA 2FHJA 1DQ9A 2DGUA 3SFUA 2R2SA 2BJDA 2JJ4D 3CDWA 2K1RB 4RW9B 2F3JA 4JV0A 4J9QA 4HLBA 2YTCA 2Q6CA 1LXJA 4G3IA 4IH5A 4LF5F 2GGPB 3UQSA 3AA9A 2QA4S 4B9LA 1PC4A 2CPEA 1JLEA 3RRKA 3M2UA 4PG6A 4JV5F 4OLOA 4IRCA 1GQEA 4N76A 3VZIA 5HI7A 3RB4A 3CDUA 2P5VA 5KFBA 1XBWA 4ZVGA 4PXCA 4RX6A 4F50A 3EGZA 1DQAA 1QAXA 2PI4A 4QR1A 3V4IB 3PX0A 3ZZYA 1I94F 2IYIA 5A0YB 1B64A 1KHVA 4OJHA 4AQYF 5KFGA 1YTYA 1FTCA 4WF9Q 1S1WA 2JFKA 4DQQA 2HS4A 1RT2A 2HRYA 3PZPA 1HMVB 5KFLA 2DH8A 5THWA 4ECSA 3CULA 4ZCIA 5KFCA 4OFZA 1RDRA 4F67A 1LFPA 3PJWA 4WFZA 4J9SA 4ETZA 3N01A 4EBDA 3DNCA 1ZTWA 4DSEA 2R8HA 4EU0A 5EX0A 1WHWA 3QJJA 2HHUA 1FK9B 1HBNA 4ID8A 3CXCR 2GMJA 2RUGA 5D4OA 1LWFB 1UP1A 2HFZA 2IAJB 3W7BA 2CQHA 2DD8S 2EBGA 2F4VF 1P27B 4IO1A 4QIFA 3LGMA 3T9ZA 1AUDA 2MJUA 1VFJA 3RTVA 2MPUA 4Z37A 3H5YA 4IFYB 3SYZA 3G71S 3R1LA 1HWLA 2D74B 3EZ5A 3CCWA 1S1WB 1GAOA 3GE9A 5IQQA 3IC1A 5HMZA 4FYDA 4PXBA 1C0TA 3CCES 1MWZA 4F8RA 5KFZA 1T02A 4URSA 4QZVB 5L39A 1FDAA 1FDBA 2RRBA 1UETA 3VAFA 1BLUA 1SJRA 3DM2A 4C98A 2XY7A 3ZFVA 3M30A 3PKMA 4OHZA 3DXSX 2IFXA 4URQU 5DQHA 1LWFA 5HROB 2KTQA 2MKJA 3UCUP 3BGUA 3TOQA 5AXNA 4NYZA 1RKJA 4HI1A 4IFYA 3MM8B 4R8UA 2GHWA 3MR6A 3PR4A 3P5TL 4TN2A 2LECA 4DFKA 2GHVC 2J6UA 1FNOA 2DR8A 4K4SA 4J9MA 1JLGB 3I9V9 3JTNA 5LL6d 1NK5A 2DNMA 5E33A 2KI2A 1DARA 2KYZA 1G2EA 3LANA 2RS2A 2EFPA 3BR8A 4XAKA 4BC7A 1QE1A 1SH0A 3ISZA 3IR7B 5IQ6A 2CPJA 4OI6A 2POKA 1JLQA 4X64F 1NKEA 2MKCA 3N5BA 3H4DA 2A10A 1M0SA 1X4FA 4CI0B 4F26A 5IS2A 5DS7A 1VC0A 3E01A 4ZPAA 3MDFA 4IG0A 2FB0A 2XB2D 4DR2F 3T5JA 5HROA 4C97A 4TYAA 4TNOA 1H7XA 4EUVA 4K4VA 1U2FA 2HWTA 4W92B 1TKXB 2AJ0A 4J9OA 1WWHA 3TR5A 2LQBA 2HMIA 1Z1ZA 3Q8QB 1MMLA 1GXUA 5H1SV 3HK2A 3OFEA 4ED8A 1RWUA 1R8AA 3MM8A 4FF4A 2DNQA 3TVKA 4HVZA 3Q0AA 2DNKA 1L3UA 2DHSA 1JLGA 4GO5X 2LEBA 2OPRB 3NGKA 1S1VA 4I67A 3I5BA 5EWFA 4DL7A 1H2UX 3NRBA 4YR0A 2DJWA 3A1YG 4X4VA 1FCAA 1UMJA 1UJ5A 2XSJA 3NNHA 2E7XA 1UVNA 4HKQA 1C4CA 5K8MA 3PX4A 4E0DA 3IRWP 1X9MA 2JEJA 4MTPA 4DPOA 4Q7AA 4YFUA 3RB0A 2VA2A 1SI9A 5KT4A 1TKXA 2ZUGA 3DRPB 4A4JA 3OJUA 1S72S 2B4VA 1F5CA 3KKFA 4YQWA 2AGPA 2IM0A 4RU9A 4RUAA 1TK5A 4DS5A 2P6SA 5E3CA 5K5MA 1VOMA 3E3XA 3PW2A 2ATLA 2C28A 3P6YC 2GW8A 3AJ1A 4I2QB 5HN0A 3MEKA 2VQFF 2OPRA 1U1LA 2MKKA 2NR0A 2PDAA 5ITHA 4WTYA 1FJCA 1U24A 3D0IE 4I6YA 2ZITA 3ZZRA 2DISA 3GIKA 4GC7A 3NG8A 2FHJD 4R5PA 1VQ7S 1U6ZA 1UWBA 2UZAA 5GAEI 5CCMA 4DOZA 2L9WA 4YUDA 1P1LA 3G8TA 2ZHBA 3NMRA 5KFHA 2VOPA 3TYTA 3Q8SB 1HNVA 1QSLA 2LXFA 4PG5A 2R2TA 2YWKA 2WB4A 4B9SA 4O4RA 5LXYA 1QUVA 3IG1A 2KHDA 3DRPA 2C2DA 1UJ4A 2R4FA 3C2PA 2WK4A 2NZ4A 1VQPS 2QEXS 2G9OA 1LK7A 4C3MA 4PUOB 1UFLA 4YDXA 3HFKA 5J2MA 1L3TA 5L9NA 2X1BA 1URNA 4M5DA 3PFEA 4EO6A 3GR0A 4LSNB 5FDLB 4CCHA 4DEZA 5LMUF 1EETA 1RT3B 4H4KA 2YH0A 2BANA 3SSRA 3UCZP 2ZOFA 1YITS 1IKXA 2YKMA 3MECA 3JSYA 3MPVA 2VKRA 4R5PB 3UPFA 1N4LA 2YNIA 3MEGB 4X4PA 2VUGA 3IBWA 1KLNA 4KKOB 1KHWA 1HNVB 2HAIA 4ES1A 5A8WA 5DETA 4M8LA 4F3QA 4DHVA 2A18A 3GFZA 1NK4A 4PXDA 2HWIA 1H7WA 3ZZ0A 2WB1D 1VQ9S 5G0RA 2J6SA 1RYSA 2ZNZA 2FGOA 3EPGA 2CPDA 1YBAA 4WU2A 1TK8A 4JI1F 3MR3A 4OX9F 2OPQB 4C0BA 4M5DB 2DPJA 2ZKTA 2E5IA 1C4AA 2MGZA 3NS5A 4AFFA 2E9RX 1ZAVA 4V19J 3QAUA 4WYWA 5B0AA 3EPIA 1VQOS 4B3SF 4IFVB 1HBMA 2B5JB 5E41A 3MUTP 4OMFG 3W2WA 5D3GB 4DG1B 4ED5A 3P3DA 2QMWA 3DMJB 1UVJA 4PRFA 5AXMA 3RRHA 3BGRA 4I64A 4FF3A 1M5PC 1TKTA 1PC5A 1WNEA 2KU7A 2XSFA 3GYNA 4KPYA 1XERA 1KC8T 3FDSA 5A8WB 3I87A 3OR2B 2RRAA 4NLUA 1N5SA 4QIGA 2CQPA 4XPEA 1VMBA 3K57A 1SUQA 1JLAA 5DDQC 4DS4A 1REVA 1IQZA 3HI9A 2CQBA 4C7QA 3GV8B 3IAS9 3PM9A 2PN6A 4IFVA 1HBMB 2B5JA 3SCIE 3DHWC 3W2WB 4DG1A 2EWHA 2RIJA 3GB0A 3DMJA 2FJAB 3HHKA 2CPZA 4AYBD 4C2MA 3J7ZT 4TU8A 3UCGA 3G8QA 3MFHA 1SL1A 2L48A 2OJ3A 5EDWA 5C25A 3OR2A 1XTZA 1FVSA 1UA1A 3KHRA 1U7LA 4ZPBA 1LV5A 1S1UA 3HXMA 5KFFA 1WI8A 3QIPA 1U1NA 4CO5A 4ELTA 1SUQB 3H4BA 3E8OA 1X4DA 4ELUA 4RW7B 1JXEA 3DLEA 4LVNP 1Y5IB 1REVB 2V4JA 3D1QA 2YKNB 2B4UA 2FIUA 5IT0A 5KFXA 4QWDA 5C24A 5HQ8A 3H40A 3GQCA 2BUNA 2I5JB 2KVIA 3FSXA 4A48A 3Q8PB 4NPOA 3DXBA 1B7FA 2LLZA 2ZH2A 1NK0A 2LEAA 2N3OA 2LA6A 2CZVC 5D4PA 2G1DA 4QQBA 2RDJA 3MMAB 1X4GA 3IGNA 3EXYA 2QE5A 1YQHA 2V94A 2J5AA 3JTPA 3CD0A 1VHFA 4ICLA 2A3JA 1N5YB 2JSXA 3DOKB 1OO0B 4OX7A 3JSMB 3NWGA 3M8QB 2R7WA 3OBIA 1VC5A 5B7WA 4ALZA 2M5YA 1FRJA 1HHTP 3AQOA 2W7PA 2VA3A 1M5VC 1RTIA 3KLEB 5C24B 2IJNA 2PIIA 1UFWA 2MSSA 4O3NA 3FRZA 3LAKA 3AY0A 4X4RA 3CCSS 3K0JA 3PRBA 1KNZA 1LWCB 3DRYA 3MFIA 4PWDB 2HHXA 5EGYA 1WHYA 4HH1A 2DIUA 2YNGA 4C9DA 5J2NA 1A6LA 1TP7A 1FEHA 4DSKA 3DFEA 3KLGB 4DQSA 3V5RA 2OTJS 3D54A 4ECZA 1UA0A 2GNKA 3RB3A 1HARA 2MDAA 2B56A 1U26A 2IA0A 1TV6A 2D9PA 4K5RA 1BD6A 3I0SA 3G6VA 1HW9A 3JSMA 2MY7A 1HWJA 3SDEB 2XS5A 1S1XA 2F9DA 2E1CA 1X4CA 1U09A 4ECVA 1GX6A 4B9VA 4ES3A 5F8HA 2OPSA 2W8KA 2E5GA 3TRGA 1HI8A 2YQ3A 2VPZB 4UUWA 5B0GA 4PPDA 3TAMB 5FLXY 2MZJA 3KLEA 1R0AA 2YH1A 1NJXA 2Q6BA 3BSNA 5A8RA 4PWDA 1RTHB 1SXLA 2M7SA 3CO9A 3QLHA 4OI3A 5GAGU 5JJBA 3BQ1A 3CMAS 1ZM9A 5J2NB 2EW9A 4C3KA 4ECQA 2UU9F 2RT3A 4X84A 5LSLA 4MK8A 3VTIA 4WK3A 3MGJA 3K58A 2MKSA 3E51A 1FJ7A 2OFGX 4ZVFA 3L95X 1L3SA 2O1PA 3MXHP 2BRKA 1AROP 3I0SB 5HMYA 1WD6A 5KT7A 1U1MA 2HYIB 4WE1B 4FBTA 4AL5A 4KC5A 4Y2CA 3SDEA 4O3OA 5AE3A 3IWNC 2QA1A 4LFCF 4CO1A 3MR2A 4PWUA 3HHLD 4NLOA 2OPSB 2EG1A 2UVWA 1Q81T 2V9KA 1LW2A 5DG9A 3KMSA 4NRUA 1KTVA 2AYMA 1XNQF 2O66A 3CJKB 5KT6A 5CZXA 2B0GA 4DWIA 3AHPA 4ELVA 3CTRA 1N52B 1OIAA 5A8RB 1VQMS 2PFFB 2P6TA 2WONA 3QLHB 2W9AA 1VQ8S 2BZ2A 4A46A 2IM1A 1KOOA 2G13A 2AX0A 4DSIA 1HWIA 1XWLA 2FLPA 2CQ0A 5AJ3F 1IXKA 2E5HA 1XR7A 3HZGA 3V6KA 2X3GA 1MMDA 3NBPB 3CJ2A 2SXLA 1YI2S 3KLIA 1RISA 4N8NA 7FDRA 3I4HX 2A1BA 2FJDB 1KQFB 4C8NA 1KRPA 4ED2A 3E2EA 3FQLA 1N5QA 2B9YA 2CPIA 1H2VZ 5KAKA 1WF0A 3CJ3A 3IFEA 3QZ8A 1M5SA 5KFWA 3OVSA 4A8WA 3DLHA 3S01A 5MAOA 1SV5B 1F2GA 1KFDA 4A8KA 5DLGA 3OL9A 3BSCA 2XWYA 4QPXA 1YSJA 1IUJA 4QIVA 2YX4A 1J5OB 4PQUA 4EYHB 3AAWB 1UL3A 4A8YA 5LT5A 3I55S 4KR0B 2LKZA 4OLPA 3G4SS 2CKWA 2E44A 4FVMA 4NL5A 2DGVA 4FS2A 4LVOP 2IRUA 2PA8D 1R3NA 2WTFA 4WZQA 1XNRF 3K5PA 2MXYA 1JJ2R 4O23A 1CC7A 1KONA 3KLIB 3LP2A 1IBMF 3OFFA 1GXTA 1WEXA 3HM9A 5F9LA 1V3RA 3RZAA 5KG6A 4BBYA 1E6VB 3HMJG 4DSJA 2DK2A 2EK6A 4MFBA 4ZCMA 2RNEA 5L1KA 1ELOA 1VQSA 3PHEA 4JOUA 4CZCA 5CYMA 3SSSA 3OTOF 4UY8T 3THPA 5D8HB 3M2RA 3PIOQ 4X4OA 2ROGA 5A2QY 1K0TA 1VQ4S 3K7RA 1ROFA 2IRXA 2VPWB 3J80Y 3AQPA 4PXEA 5KFPA 4DLEA 3PXGa 1YIJS 4BWMA 2ERRA 2HVHA 3LUYA 3HPOA 2PE8A 5KFIA 3FMBA 2QA2A 1Y3JA 2C22A 3HKZD 1TK0A 3OXFA 2B7BB 3LP0A 4C0HA 2GCFA 3CVKA 2BDPA 5FJ4A 3NGDA 2E7WA 2E9TA 4WCEQ 1ULRA 1RT5B 5J1EA 3CT9A 4OI0A 2AP6A 2J0XA 1N32F 1KSPA 1S9EA 3CC4S 2LDYA 5I3UA 3FVYA 1IBKF 4E8UA 4RU2A 4KV8A 3NMAA 4NLXA 3CCVS 4Y2MA 4FVCA 2Z2LA 1DTTB 3PW7A 2DNRA 2YKAA 2YWHA 3R5CA 1Y5NB 4YB5A 4DFPA 4C8KA 1RT4A 3KG0A 1CVJA 3I6PA 5KG0A 4IO9Q 4HT7A 4ECUA 2MQPA 3PO5A 1XK8A 4X4UA 1NK7A 4KSEB 4C8ZA 2W9CB 4K50A 1S6QA 1NK9A 3U1LA 1MMNA <