3CF5Q

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
b'SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cf5Q00
4WFNQ 3L3CA 2DNZA 2JVRA 3BO3A 2MKCA 2DHAA 4J5OA 4IO9Q 3MI7X 2ADBA 1WTBA 2OJ3A 5LJ3Y 1N8RT 2XS2A 3MD3A 1U1PA 1M5OC 3K0JA 3G6ES 2XB2D 2XNQA 4F02A 1X4DA 3NNAA 2ZJPQ 4WKRA 4P6QA 3G4SS 1NJIT 2DNRA 2BZ2A 2DHGA 3VAKA 2DNLA 1X4AA 1HD1A 4RU2A 3CCMS 1FNXH 2J76E 2RS8A 3CCVS 5GVQA 2MZJA 3NNCA 4TU9A 2HZCA 3SXLA 3J7ZT 3H2UB 1SJFA 1WG4A 3TO8A 1DZ5A 2KFYA 2N82B 1K8AT 1KQSR 2J0SD 3OW2R 3H2VE 2M52A 2DIVA 2CPIA 3B4MA 1U1RA 3UWTA 2AYMA 3CC2S 2DISA 4IUFA 3UD3P 2RQCA 1K9MT 2FPHX 2KXNB 3NS5A 2AYEA 2RNEA 1FT8A 1YI2S 2VOOA 1WG5A 2RRAA 1SJ4P 2MGZB 1M5VC 2M88A 3D2WA 1WF0A 2DO0A 3U1LA 1R8PA 2DNGA 2MKHA 1WI8A 1D9AA 2XSFA 2DNOA 2CQ3A 2G0CA 2QA4S 1HL6A 2MZ1A 2LA4A 1VQ7S 2LXIA 3Q2SC 3VAFA 2J8AA 2CQDA 5ITHA 2LYVA 3G96A 1U1LA 2RRBA 2AYGA 1DHMA 4C4WA 1YITS 3VALA 3MUVP 5CYJA 1YJNS 1AUDA 5IM0B 2KG0A 5DDQC 3S01A 2DNMA 4FXVA 3NMRA 2F9DA 3FEYB 2E5GA 2EK6A 4LIRA 4YUDA 1Q81T 2DNKA 1VQ6S 3ZZZA 2KXFA 2OSQA 1M1KT 1N52B 5LJ5Y 1VQLS 2KT5A 2UP1A 1X4FA 2DNHA 2CQ2A 2OSRA 3THTA 1U1KA 2DH7A 2RU3A 2EK1A 2L41A 2MQOA 2BOPA 4W90B 1X4GA 1X0FA 5EN1A 2RUGA 3VAIA 2MZTA 4W92B 3PIPQ 1M5PC 2MJNA 4F26A 2MXYA 3UCUP 1WF1A 2DGSA 2SXLA 3CCQS 2DGUA 1X5PA 4C0OC 2MZQA 5DDRC 2RT3A 4IOAQ 2CPJA 1DBDA 2EVZA 3MDFA 4ZKAA 5LSOA 5DETA 1B7FA 1R8HA 2DGVA 2WBRA 1Q7YT 4ERDA 1X4HA 2M7SA 5HO4A 5GADU 1NO8A 5JVHQ 3R1HA 1K73T 1H2TZ 2LEAA 1X5TA 2RS2A 3U1MA 4CH0S 2KRRA 1VQ4S 4PRFA 2OIHA 2DITA 3R1LA 1A9NB 4ED5A 4U67Q 3CC7S 1Q86T 1UP1A 2DGQA 1VBYA 2HGNA 1VQPS 1YWXA 4F25A 4CIOA 2JRSA 1UAWA 2KN4A 1L3KA 2M8HA 4OZ1A 1WHVA 1JJ2R 3EX7B 1OIAA 2CQ1A 1YHQS 1RK8A 1WELA 2LA6A 1CVJA 4Y00A 4YB1P 3P6YC 2XNRA 5MLCV 2A3JA 3G71S 5DM6Q 1YJWS 3UE2A 3MXHP 4BS2A 1VBZA 4Y0FA 1H6KX 2CQ0A 2M9KA 4WFBQ 3LQVA 3CCUS 2PEHA 4QPTA 2DNPA 5IFMA 4WF9Q 4TU7A 3BEGB 1M90T 3CXCR 3JB9k 3SMZA 1N88A 1VC0A 5GAHU 2OTJS 2MPUA 2ADCA 2KU7A 2KYXA 2M0GB 4TU8A 3MUTP 2CPHA 2CPXA 2X1GA 3VAHA 4LMZA 2DHSA 3LPYA 1WHXA 5BJRA 2K8GA 3CD6S 1H2VZ 3CULA 3CCJS 1S72S 2RVJA 2U1AA 2VODA 1WEXA 2MQPA 2I2YA 2MB0B 2DO4A 2ERRA 2N3LA 1WEYA 5GAEU 1YJ9S 1QVFR 1X4BA 3BS9A 1ZZFA 2M4MA 2F3JA 2MSSA 2O3DA 1VC5A 3HI9A 2XS5A 5GMKa 1RKJA 3CMES 2DH9A 3RW7A 2ZJRQ 1U2FA 2MKJA 4C7QA 3IWNC 2V94A 3VAGA 3DXBA 2YH0A 1ZH5A 3CUNA 3PIOQ 1WHWA 1S79A 3SDEA 1P1TA 4PR6A 2DH8A 5DDPC 2LMIA 1UFWA 2KM8C 5DM7Q 3ULHA 2L08A 2HYIB 2I38A 1M5KC 1FJCA 3UCZP 4CQ1A 1VQ8S 1U6BA 3TP2A 2QEXS 2YTCA 3IRWP 1KOHA 1X5SA 3VAJA 2MZSA 1QM9A 2CQIA 5DDOC 2LXUA 1FXLA 3I55S 2CPYA 2AYBA 2MSTA 2KH9A 4OZ0A 2MYFA 2KRBA 2CQPA 1VQKS 2M2BA 2HGLA 2D3OR 3P5TL 2CQBA 1ZZNA 4QQBA 4WFAQ 2LKZA 4V19X 1NU4A 2KG1A 3P3DA 2E5HA 2X1AA 1X4EA 2CPFA 2LECA 1WF2A 5LXRA 1VQNS 2E5IA 4UQTA 2E44A 2MY8A 1WEZA 2GHPA 2FY1A 2NZ4A 2DGTA 3US5A 3MOJB 1YTYA 3S6EA 2MHNA 2DK2A 2CJKA 2KI2A 2KVIA 3VAMA 1W2BR 1N54B 2LCWA 2MQQA 2KM8B 3P49B 4QU6A 1P27B 1XN9A 2N3OA 2AD9A 2MQLA 1URNA 1OPIA 2CQHA 3G8SA 1X4CA 4WCEQ 1YIJS 5GAGU 3R27A 1WWHA 3THPA 4LJMA 3NS6A 5LSLA 2MMYA 3CCES 2G1DA 1U1MA 1U1NA 2MGZA 2CPZA 2B0GA 3MUMP 1FO1A 1WG1A 3ZZYA 3J7YU 5CXTA 3CF5Q 2YWKA 3MURP 2CQGA 2JX2A 3CPWR 2YH1A 2MKSA 4YOEA 2J0QD 2MQMA 3FEXB 1FHTA 1VC6A 2MQNA 1KD1T 2X1FA 3CCRS 1SJRA 2FHOB 2YKAA 1VQOS 2KHCA 3G8TA 2DIUA 1WI6A 3I56S 2D9PA 2LQ5A 1BY9A 1DRZA 3UD4P 1HA1A 4CH1A 3CC4S 2N7CA 1OO0B 2X1BA 2K3KA 3TYTA 5LXYA 3Q2TC 1F9FA 2DNYA 1X5OA 4PKDB 4WIIA 5IM0A 2OTLS 3EGZA 2RQ4A 5IQQA 2HGMA 1JJ4A 1O0PA 3CMAS 3RW6A 2CQ4A 1KOOA 3B4DA 4EGLA 3BO2A 1QVGR 2LEBA 2MKKA 2M70A 1VQMS 4QU7A 2E5JA 2XS7A 2MKIA 1OWXA 2Q79A 1U6FA 2D9OA 1G2EA 1WHYA 5D78A 2FC8A 3VF0B 2CPEA 2FC9A 2DGXA 1VQ5S 3V4MA 2CPDA 2CQCA 2ZJQQ 3N9UC 5JVGQ 2PE8A 2U2FA 4FXWA 1FJEB 1SJQA 5H1SV 3CCLS 3G9CA 5FJ4A 2MY7A 1KC8T 1VQ9S 1Q82T 1SJ3P 1PO6A 2F9JA 5D77A 2L9WA 2G4BA 2NLWA 3EGNA 4Z2XA 1U1QA 4M5DB 2KXHA 2M8DB 1UW4A 2JVOA 1PGZA 2DB1A 1VBXA 3HHNB 2DNNA 2DNQA 1A7GE 3UCGA 2DGWA 3S8SA 1JJHA 2JWNA 1H2UX 2MZRA 2VONA 3NNHA 1JMTA 1D8ZA 4IOCQ 3CTRA 1SXLA 2MJUA 4A8XA 3BO4A 3DLLQ 5HL7Q 3SDEB 3S7RA 1U1OA 2VOPA 4TLQA 4UY8T 2GO9A 2DGOA 5CA5A 1HD0A 2QFJA 2DHXA 1IQTA 3CCSS 2HVZA 1FJ7A 3MD1A
chains in the Genus database with same CATH superfamily
2VKZG 3DU5A 4ZP6A 4OLPA 1TU0B 1IWGA 1WTBA 2XMJA 1CG2A 3C14B 1DLOA 4OJHA 4TY8B 4L76A 5GAEI 5DG7A 4ZS6A 1BQMB 5KFUA 3A13A 3CCMS 3OR2A 1RAIB 2B4VA 4I68A 4TU9A 1MN7A 5IQ6A 2VG7A 4JI0F 3VQTA 8RUCA 2GVDA 3GSIA 5CYQA 4N77A 1N6QA 2AYEA 1FFSB 1S9EB 1UVKA 2P5VA 2VV5A 1FDNA 4MIBA 2DNGA 3A3OB 3MM9A 2G0JA 1XMBA 3Q2SC 1K47A 2Z2MA 4PG6A 4NRTA 4PXEA 5IM0B 2KG0A 2AU0A 2DNMA 3CJKA 4TLRA 4QWDA 1HNVA 2EK6A 4DR2F 2QC3A 3LWMA 3NWRA 2KXFA 2OSQA 4NXMJ 1TVRA 4DV7J 2CKWA 2LQ8A 1DQAA 4DR6F 2RE1A 2DH7A 2QA1A 2O5DA 3J7YI 3PIPQ 2BABA 4CYUA 1F5BA 4HHUA 1KQGB 5E0OA 2FY8A 5LSOA 4H4KC 2F5GA 3GIJA 4NI2A 3LP0A 5JVHQ 2NPFA 4DUZJ 3TJ9A 4ZIVA 2B56A 2DR9A 4Q43A 4GO5X 1BWVA 1C1BB 5E3AA 1WC6A 1RKIA 3MGJA 2HGNA 2R9LA 4BWJA 2FB0A 4HKQA 1UAWA 1TUVA 4OZ1A 4L75A 1OY6A 1OIAA 1T03B 1WELA 1X9SA 4DFMA 4B3SF 4Y00A 1NDLA 1G6BA 4NMXA 3VHQA 1S12A 2H3EB 1XR6A 4KT0C 3B6BA 3D1HA 4DL3A 2VBZA 2ATLA 3CCUS 4JI2F 5KG2A 1E6YA 1M90T 2CUYA 1JLBB 4WU3A 4MK7A 4EBDA 3VTIA 4RUCA 3CD6S 3UFCX 5L9NA 4QWBA 2MQPA 2DO4A 1EJ7L 2C2MB 2BANA 3OVAA 2WTFA 1HPZB 2M4MA 1U25A 1VC5A 4HH0A 4QWAA 2GX8A 1HQ2A 4K4XA 2XG8A 1BHNA 1TV6B 2B7BB 3KMQA 4PR6A 2BW7A 1ZAWA 4JV2A 3QRPA 1FRJA 4M5IA 2EFVA 1SB6A 1ZM4A 2YNFA 2WVCA 1V5VA 3VAJA 1WTFA 2MZSA 2ZZNA 1QM9A 2ZOGA 2LXUA 2HKEA 4DR6J 3V4IB 2FJDB 4J9OA 3GLJA 4ED6A 2ZWPA 1WEZA 3NG8A 2EBGA 2QMWA 3OT9A 5M2RA 1GNKA 2LCWA 3C2PA 5EDWA 4DWIA 3RRGA 2BBEA 3X1LB 5K20B 4RW8A 4IO1A 1RWUA 2B43A 1JXLA 3N6NA 4HI2A 4NZ7A 1NRKA 3V81A 4CO1A 5HJYA 1FX4A 4WK3A 4Q5VA 2NXUA 5BR8F 2MQMA 5I3PA 4ZK7M 2QSWA 3J7AN 1BWEA 5KFHA 4I64A 2X1FA 2FHOB 2WCXA 4DR7F 1WI6A 2BJ8A 5KG5A 2VQEJ 2DNYA 3W8PA 2K1RB 4IFYA 2R2RA 5DQIA 2XZWA 1RT6B 3CJQA 3BN7A 2QTWA 4B9TA 5KFWA 1JLAA 2N7YA 1NK8A 5GADI 3HT3A 1U0SA 2D3UA 5M2UA 3V6DA 3G9CA 3ZZUA 1S6OA 4FPIA 3OD2A 4IRKA 1RI7A 1Z4UA 3UN5A 2DB1A 2MZRA 3MR6A 1ULRA 3HHLD 4PPZA 3H5UA 5K8PA 1PJ6A 2UUCJ 1TL1B 3IBWA 3AXKA 3D67A 1HQEB 5JXSA 2FD2A 2ZC4A 1KLMB 3PX0A 3K0JA 4HHJA 3NGKA 2OELA 4XPCA 2EC0A 3MMAA 2EKNA 3CIMA 1OY9A 2DR8A 1HWLA 2DT9A 2VD3A 2CG8A 1FFGB 1BE4A 2ZH1A 1VK8A 4ZLJA 1RUSA 2V50A 1MWQA 1IBMF 4LSLB 4USJC 4N7TA 4USWA 1TUGB 3EE3A 1RTDA 3CC2S 4N5SA 3QZ7A 4IFVA 2WB1D 5BR8J 1N5QA 3CJ4A 3VVUA 2LP4A 2RH3A 2V34A 2QA4S 2LA4A 3MAHA 2Q43A 2FQQB 4ZPBA 4DV2F 5F8LA 1D0EA 2F4VJ 2KTQA 3NMRA 1RCOB 2R7XA 4P52A 2DNKA 5HBMA 2GAGC 3BKFA 2IAJB 3KG4A 1FF2A 4X4UA 2HHQA 3IAM9 1U1KA 2FJEB 3FBCA 2VBWA 3MM7B 4P72A 2E1AA 4LFBF 5D0GA 4Y3CA 3M7VA 2MZQA 3UQSA 3EZ5A 2RT3A 5DETA 3W66A 4X4SA 3R1HA 2LEAA 5KFCA 1Q5VA 4CH0S 4CNZA 4NCGA 3DRRA 2ROGA 2OIHA 4PRFA 2ZZMA 3HSZA 3D6MB 4YY3J 2FVRA 4KYZA 2DGQA 2V2ZA 1VS3A 4K7QA 4FS2A 2W4CA 3EX7B 2ZH4A 1U0HA 3KLFB 4F8RA 1X9MA 3G71S 4ILRA 1HYSB 1BQNA 3UE2A 4BS2A 4I7FA 2OFGX 1S9GB 3Q8RB 3OLBA 3R2DJ 4NXNJ 1FEEA 1Z1ZA 4QPTA 2R7WA 2ZD1B 5IWAF 4C8YA 4DF4A 3WDOA 2CADA 1IBCB 1EZZB 4MFBB 1SC4B 3I32A 3M30A 3KK1B 1WEYA 1YK9A 3KUHA 3HZEA 2V9KA 3KHGA 4GVLA 3CMES 3IWNC 2W9AA 1RTIA 2YKMB 1K44A 4NLRA 3R5JB 3DGPB 3BB5A 5F0UA 2J9DE 3ULHA 2POKA 2BKNA 5DJBA 4ETXA 1VYAA 3UCZP 4O3PA 2YWEA 2V8GA 3CNQP 4KV8B 3GR0A 2OPPB 1X5SA 3QT5A 5C24A 3I55S 2VFRA 4B08A 4DV0F 3ZO7A 2HGLA 3N5BA 5J2PB 4ES2A 2X7IA 4WFXA 1YKWA 2UVVA 4K2XA 1C4CA 1RHQB 2ILZA 2E44A 1VIOA 2MY8A 2XY5A 2DK2A 4LFBJ 3IGNA 3VAMA 2QYCA 1S6QA 4NYZA 4XO0A 3V2UC 4ID5B 5D4LA 1Y0HA 3ZZRA 4RNHA 3MMBA 2LEPA 2Z58B 2HZVA 4ENOA 4DV3F 3HFZB 1TP7A 1TKXB 5E41A 4RNNA 2QMXA 2W1BA 3DHXA 2H65B 3CO0P 1NKBA 4ELTA 3CCRS 2V6AA 4DS4A 5SZTA 4I69A 3Q2TC 4F3OA 4HT5A 2F40A 5CAAA 4JI7J 2ZFHA 1JNZB 2E5JA 4LSNB 3ZZ0A 1CJUB 3IS9B 1AFJA 4GKJF 1HW9A 2OPQA 2N4DA 1T94A 4JB8B 3IFEA 5H1SV 1MMNA 1KNZA 2R7TA 5KT2A 1AZSB 3FCVA 2WOMB 3GG1A 4A8KA 4Z2XA 2RAQA 3T5HA 2H51B 4M5DB 3L7PA 2KXHA 5H9EK 5FLXU 4H4OB 4P7TA 5HSPA 3ENVA 3HD2A 3PVXA 1QE1B 4ZCMA 4TLQA 2GO9A 1IQTA 1X60A 3KXDA 2XHCA 2J8SA 1U7LA 1Z2LA 4WYLA 5LJ3Y 5ETLA 4DSFA 2BR0A 4OZ2A 1PC5A 4USVA 3E01B 4FF3A 2EG1A 1T0TV 2WW4A 3KJVB 2PO4A 1EP4B 5D0RA 3QWUA 3JXOA 1RABB 2HAIA 1JK9B 2FDNA 4I67A 1PAEX 4DS5A 3H59A 3SXLA 4USUA 3KMSA 2HBQB 2YX1A 1TKTB 4ZVPB 2HVIA 4I2QB 3ZTSA 4DV3J 4DL7A 1T11A 4CM2A 5D0EA 3UWTA 4U7UK 2OPRB 4UQGA 2XSJB 1S97A 1RU2A 4UOHA 1DTTB 4MJKA 1HHQA 1R8PA 4F50A 2CQ3A 4YQWA 1HQUB 2UV8A 4Z37A 5CCLA 2IMOA 3B78A 2LYVA 4LIWA 2VFVA 1YRUA 5DRKA 2NR0A 4G1PA 1IVZA 1DURA 2GV1A 4GKJJ 5ETRA 1HNXF 4OI2A 3MOZA 4QIEA 4X4PA 5HAOA 1QSYA 4LFCJ 2IY5B 1VQYA 4F4XA 1S1VB 2IRUA 3DDKA 3BZQA 4JI3F 1MMLA 4ZMMA 4PWDA 3KK3B 1Q7LB 4RUBA 2DGUA 3DKDA 1IN0A 2CPJA 3M8WA 3PTWA 1U8WA 2UXDF 4TXSA 2LU2A 3HCXA 3TZXA 4KKOA 1U8SA 2VDIA 3CD7A 1RSCA 2LVWA 2DVIA 3PCOB 3QGPA 3QSIA 3CDWA 2VFUA 1XC9A 2UUAJ 1C1CB 3NS7B 5LMUJ 2RIJA 3OL9A 2LA6A 3SEOA 3HLUA 2V8PA 4ZPWR 3SQGA 3FFIA 1T9WA 3M6XA 3HJVA 4GKKJ 1OQ3A 1HI8A 4I2PA 4JI4J 2VBXA 4H4MB 4CLWA 9ATCB 2XMAA 1WEXA 2E29A 3CJSA 1Q78A 5KG7A 2UXCF 3HI9A 2Q66A 3RW7A 1UVNA 1YZ7A 4M5MA 4WKYA 4K4UA 3LGMA 4CDIA 3HVTB 1V6HA 3SDEA 2BQUA 2DH8A 4Y2IA 4WTYA 4M5KA 3QPIA 1HHTP 3DLKA 2I9SA 3NP5A 1NEEA 4ELUA 2XMWA 4OQJA 3HJFA 2CQIA 1O51A 2IJRA 2A2CA 5I4MA 4QQBA 5A8WB 4ZP9A 3M8SA 2MLYA 2J7UA 1I1GA 1IXKA 2CJKA 5E3PA 1T02A 3TZWA 1SL2A 2XI3A 2VBYA 4ZLPA 3SFGA 1FRIA 2CQHA 2KHDA 4FYYB 4OI0A 4RR5A 1SQFA 3RB3A 1CJKA 4LJMA 2HS4A 3OQ2A 4L6V3 3GV5B 2PGCA 2YNGA 4I6AA 5A0YA 4Q8EA 3CPWR 4UT4A 3M6WA 5C5JA 4V19J 2P8IA 1KD1T 3R7SB 4KPCA 1DARA 4CO4A 1KLNA 1Y10A 4JI1J 4Q2MA 1UJ6A 1GAOA 2LU1A 3TYTA 1QSLA 4HL9A 2XCAA 2ALZA 2AEMA 2AJ0A 1REGX 5KFDA 2Q1LA 2O66A 1KEKA 2HRTA 3WX4A 5T14A 2OLWA 3D4JA 1O6XA 5L1LA 4P75A 3CVKA 1KC8T 2HIYA 4DXLA 2UXCJ 3WIUA 2V4RA 1T9UA 1RTJB 3GFXA 8ATCB 1H2UX 1JMTA 3QO9A 1C2PA 2YWGA 3M9NB 2ZKTA 5A8RA 2PFFB 2Z30B 4B9SA 4CT8A 2V2QA 2DBBA 1HI0P 3R6LB 2DHXA 4KBIA 4G3IA 3CCSS 2DNZA 2JVRA 3OPKA 1DAXA 4J91A 2DR7A 3TA2A 4X66F 1N8RT 3MD3A 3PW5A 2AIRB 4NA2A 3NRBA 4HDHA 1S1WA 2V69A 1CPZA 2XNQA 4WE1A 4LFAJ 2JC0A 2OHDA 5KG6A 1GMVA 3JS9A 1IR1A 5L9XA 5I3UB 4QW9A 1NJIT 3K17A 1ZM3A 1FRKA 2J76E 1Y7PA 2B9YA 5AXKA 1NM2A 4FF2A 1WG4A 5EX0A 4PXBA 1K8AT 1RBLA 2FHMA 4ZJOA 4DPXA 2Y9HA 3TWZA 1QUVA 2RQCA 1XNRJ 2W9CB 1MWZA 4JV0A 1RHKB 4ES3A 2W9BB 3EVMA 3KJFB 4HACA 1RT5A 3MTKA 4P71A 1YITS 4JYAF 4PG5A 4ZLLA 2V8HA 1LV5A 1E6VA 1FFWB 2KKHA 3ZZZA 3QJLA 5B0FA 5DGBA 3EXCX 2L9NA 5FDLA 2YNHB 4U6PA 3QZ8A 3OSNA 4UTGA 4W92B 1TFWA 2ZVIA 5C2CA 4DPTA 2K2PA 2EVZA 3MDFA 1Q7YT 3C46A 1S6PB 3NBPB 3MM8B 3QQCD 3OXGA 5J2NA 4RW6B 2RMLA 1Y9OA 2GJIA 3SCKE 4JV5J 3M6VA 4UF4A 2B5JB 5F8IA 3KUGA 3HHDA 2QE5A 1JJ2R 3DCAA 1KTVA 1YHQS 3KHHA 4A46A 3NWGA 4F0KA 4WXOA 3DLGB 4AQYF 1IUJA 2E7VA 3CJ0A 4J9UE 4NA1A 4NLOA 1FK9A 4OHVA 1XBWA 1MROB 4P10A 2V8DA 1KHWA 4D3HA 3MEDA 1LW0A 3M32A 4TU8A 3QAEA 1Q16B 3DMJA 3CULA 2D1CA 1YZ6A 3OFFA 1T3NA 3NKYA 2MB0B 5IXUA 2I5JA 1FA0A 2WW8A 1GT8A 1RKJA 2H5JB 2BV3A 1KVKA 2HQFA 2IM3A 5HJXA 4C7QA 3AT1B 3OR1B 4GO7X 3NLCA 1N5SA 5HQ8A 5CD4H 3LTOA 4K4WA 2F7VA 2GMLA 2HYIB 3TQEA 1BLUA 4WK1A 1KTQA 2PEBA 4ZPAA 4R0EA 3TAQA 3ILIA 1Q8LA 3W9IA 1YRTA 4DG1B 1KRPA 4R8UB 3HZGA 2E5HA 3VR1A 4RWWA 2A6OA 4FYXB 1PJ5A 1FE4A 3HO1A 2KI2A 1TELA 1W2BR 2CNLB 4M5NA 6FD1A 1KP6A 1DTQB 3IGVA 5GAGU 1NSPA 3ZC4A 1R8BA 1T9YA 1F5CA 3KJNB 4O44B 2HNDA 2H1YA 5CXTA 4ER8A 3TEHB 5T7LB 3K5OA 4ZPCA 5HATA 1SH3A 3IR6B 2Y1IA 3OSPA 3U1NA 2XMKA 2YKAA 4DF8A 1HA1A 4CH1A 1ZTWA 4AQYJ 3EXYA 1UFKA 2HGMA 2HVDA 2NYHA 2F8EX 1H7XA 2FVSA 4C8ZA 2DJWA 4B17A 2MQ8A 3I4HX 2QL9B 4KIAA 1UWBA 1FNOA 1RU1A 1KN6A 4JV1A 3EVWA 2MHEA 4IG0A 2CZ4A 2CPEA 2YXLA 4A8MP 3UDLA 2R8IA 1LKZA 1UL3A 5JVGQ 2HBZB 3I96A 3D1QA 4ECYA 1WC5A 2QRRA 1VJQA 5FJ4A 1R27B 3Q8PB 4M5LA 4P2MA 2M8DB 2GIRA 3FJ2A 3HHNB 5AE2A 2Q6BA 3S8SA 1JJHA 4IOCQ 2J7WA 5IS2A 3H20A 3NGTA 4QYRA 3HPOA 2CFXA 2B4OA 1B7YB 1UPPA 2R7OA 3ZTOA 1CS4A 5CA5A 5IT0A 2FJXA 3PYDA 1IBKF 4I0WA 3KNAA 5ETTA 3GPAA 2J9CA 4I56A 2ADBA 4K5SA 2WVFA 1NKEA 4HTIA 1HHSA 2VG6A 2EFPA 3G6ES 3TJAA 4FKXA 1SV5B 3G4SS 2LQBA 1H38A 3C16A 2IVYA 3JSRA 2DY1A 2R8KA 4ECSA 1B3TA 4DZ6A 4QIFA 1OMSA 2O1PA 1S4FA 3MEGB 4O0IA 2P6SA 3PEHA 4IR9A 2WB4A 2X51A 3OW2R 3H2VE 4MIAA 4MKBA 4B9LA 4LRAA 2DISA 1V3RA 1CULB 5K9FA 2LDIA 3CE8A 1L3TA 1YBUA 3PR4A 2YX4A 3LGNA 1AROP 1R43A 4AL7A 4ZJQA 1VQ7S 2GA7A 1VQSA 2FHJA 2J8AA 5K14A 1YBAA 4K59A 1WD6A 3AFGA 1ELOA 3DOKB 3OVSA 4C4WA 2HK3A 4RW4B 3PDNA 4A8FA 3S01A 3LP2B 2ZHAA 1RHRB 1YRXA 1NDKA 4OX7A 4B9UA 1M1KT 2Z8QA 3IG1A 1FESA 2J6SA 2PMWA 4W90B 1X4GA 3PO4A 2VKRA 1XWLA 2MJNA 5H9FJ 5K8NA 1HBUA 2XMUA 2YX7A 1N32F 2YQ3A 3LW5C 4AT1B 1N56A 4IOAQ 2MKYA 4TYBA 3WIVA 5HO4A 3QATA 1NSQA 3R6GB 2CJ9A 3BGFA 1EETB 2RDIA 4J9KA 2O01C 1NK6A 3E51A 4G1IA 1RTHA 2XWXA 1S76D 4DX5A 2A6MA 1VBYA 3JYTA 4XIUA 2ZUAA 1WHVA 2GVZA 1RK8A 1FD8A 2QA4G 3P6YC 4PXDA 5ETNA 3GV8B 3QIPA 1YJWS 1DLOB 3G82A 1TMMA 5KFGA 3TAMA 5AXLA 3D6TB 3DN9A 1T9TA 2VPXB 3V5RA 4PUOA 3OR2B 4PQUA 5L1IA 2HHXA 1TKDA 3UDEA 3HSJA 2CPHA 5KFVA 3G6XA 2AEJA 3GJRB 2COLA 2RVJA 2VG7B 3P8BB 4FBTA 3LUYA 4TVAB 2WVBA 1QVFR 2HHUA 1NHKL 2GVDB 2IBOA 5CYQB 5GMKa 1N6QB 4OYMA 1MN9A 1ZM2A 3O5TB 1ZH5A 1P1TA 2CG4A 2AJFE 1D09B 4OHWA 4MK9A 1NK0A 3MM9B 1W25A 1RGVA 1REVA 4NLTA 3PJXA 3IRWP 3W1YC 4YP3A 3PX6A 2W2OP 2AJQA 2F63A 3CJKB 3KLGA 2OPSA 1HNVB 2X1AA 1NPKA 3PYEA 1TVRB 3MPWA 1MSWD 5CABA 4X64F 3MOJB 2IYGA 4PEOA 5K5MA 1N32J 4P73A 2XI2A 2C2EA 1I51B 5B0CA 3PG9A 3J80U 4ZPDA 4CYUB 2I8EA 1X4CA 4C2MA 2BM1A 5CZXA 3H90A 1YDLA 4NI2B 1WC3A 3LP0B 4KTQA 2E9ZA 1RBAA 1T05A 1HNIA 4KO0A 3KJQB 4D3GA 4BC9A 3BF4A 4IH6A 3CSKA 1KWMA 2AKWB 1VQOS 3G8TA 5ETVA 2GO8A 1VK3A 2HMIA 2X1BA 4CO0A 1X5OA 4WIIA 2BQRA 4AUKA 5F8NA 2H5IB 2MTLA 5THWA 3CMAS 3ET6A 3RW6A 4ILMA 1KOOA 1SIZA 1VQMS 4KH0B 2RF2A 2ZH6A 1WHYA 1RXOB 2CQCA 1XR5A 5C2GA 5KG1A 4NYPA 2K7KA 2FUG9 2BKOA 3HP6A 2OMOA 2G4BA 4LBPA 1G7CB 1U1QA 2BANB 1BGXT 2F1FA 3HX9A 1XMOF 1NB2A 2BJ1A 3T5LA 3W63A 5KT3A 2CZ9A 2P9CA 4J9SA 1KQKA 3HVAA 1QDUB 1NJXA 1TZ0A 1FJ7A 1RAFB 3Q83A 4DR5F 1JLQA 2YNFB 4PAAA 2C3UA 1NHUA 4DSKA 2ZBCA 2H4WB 2XB2D 1X7VA 4O3NA 3A1YG 2BOAA 4F02A 3NNAA 2GC8A 4OI1A 4NYOA 4LF9F 3EDQB 3C66A 2NQPA 4C9DA 3LP1A 4YMEA 2GW8A 1U47A 2FVPA 1R0BG 4JI6F 4FYVB 1LQ9A 1Y5NB 2I1RA 4RW8B 1T95A 4E2FB 5B0AA 2RNEA 1WG5A 2RRAA 1KS2A 2WONA 1S1XA 3K89A 3IN5A 3V81B 3W65A 4F0HA 4URGA 4RKUC 4CLTA 3G6YA 1D9AA 1OYEA 4YEAA 2BYCA 2HWTA 2C1EB 3VAFA 3OUYB 1HIYA 3IM9A 1IWAA 5E2QA 2R42A 4HHHA 2C2NA 4IFYB 2GCFA 2F9DA 1LK7A 1SCJB 4OI6A 1JLAB 1H73A 2CQ2A 4RW9A 1TR0A 1I94F 1G4CA 3R5BA 3NMAA 3V6DB 2MXYA 2ZH5A 1RWPB 1UZDA 3W8GA 2V8VA 1XMOJ 3H5SA 2OEJA 1X4HA 4B3TF 1CBKA 4WFYA 1ZAXA 2KRRA 1VQ4S 5E33A 5D6GA 2HHSA 1T9VA 1F2HA 4A8OA 2CWXA 2IIHA 5HP1A 3WC2A 1JKHA 3TR5A 1PG5B 1LWFA 4LF9J 4J9LA 3TUPA 4F3MA 3V6JA 3KYLA 2M9KA 1RHUB 4DCJB 4CM0A 3MMAB 5F3TA 2NUUG 3H2LA 3Q86A 1Y4ZB 3DLJA 2M0GB 4C8LA 5J2MA 2KT2A 3LAKA 4CO3A 1S7IA 3LA0A 4OYIA 2C2DA 5GAEU 5ETSA 1RTDB 4LF8J 1GMUA 2FJVA 2ZNYA 1XNQF 2HFUA 4IFVB 1WSRA 2J6TA 5KFPA 3Q8SB 4MYUA 5A76A 2Z2LA 1M5KC 2R2TA 3J81U 1U6BA 2QEXS 4ECZA 4ED0A 4ATNA 2ZHBA 4Y2MA 3VCDA 2XZTB 2GNKA 2WVEA 3GFHA 3ENAA 1NU4A 2W8KA 5HBMB 3H8YA 1LWEA 1KVIA 3MPDA 3AJ1A 3I9ZA 2GHPA 2H9ZA 3QFWA 4DEZA 1NHVA 2AGOA 3ETMA 4QU6A 1XN9A 2MQLA 4B3TJ 3U02A 3OFHA 4GMKA 3AD8C 4CH7A 3O3LA 4KPYA 2DXFA 3NS6A 2MMYA 4WXWA 1VLOA 4FP9A 3OXFA 1F0XA 1RT1A 3J7YU 4KY3A 3CF5Q 4PWUA 3AAWB 4YOEA 1SPBP 1ZPWX 4NCGB 3BQ2A 3DRRB 2B9WA 3D0IE 1FHTA 2OMLA 3LF0A 1FKPA 1EQMA 2CVEA 5C25A 1OO0B 2PT0A 3KLIA 1U0HB 2Z0GA 1BQNB 3A3PB 4I7FB 4F2SA 1QVGR 4FNIA 7FDRA 1WUUA 1RB0A 2XBPA 4YR0A 1U6FA 5D78A 3FSXA 2ABYA 3C6UA 2E9TA 1H98A 2W4DA 3M2UA 3UI3A 1Q82T 1RYSA 3M30B 2XM3A 1UEUA 4HT7A 3H4BA 3CCZA 2NLWA 1XNQJ 1AB8A 4LREA 1NKCA 3FZ2A 2HURA 2DNQA 2W7AA 2JWNA 2B9XA 3EPGA 4PYAA 1RTIB 1V3SA 5A6PA 5IV4A 5CQGA 5F8JA 5C7PA 1KFSA 4LF6F 1KONA 2IC3A 1S10A 2EEYA 4WFNQ 3L3CA 1EQ0A 2CYYA 5HMZA 4X4RA 1GFWB 4KGZB 2A10A 3N4WA 1U1PA 5C24B 5BXIA 4E0DA 3QGIA 2QYGA 3CDEA 3VAKA 1N4LA 1KDNA 4IR1A 1GX6A 3PJ9A 2BE2A 2X3GA 3TO8A 1S6QB 2J0SD 4OYZA 2HLUA 2CPIA 3MMBB 1UETA 1ZBTA 1FT8A 3ILOA 4MYTA 1UKUA 2M88A 1WF0A 4K4SA 1IM4A 1IR2A 2FZCB 1VLYA 5DG8A 2IMWP 3HXMA 3G96A 1AXQA 2BKPA 4C8KA 2JSXA 3KK2A 2OD6A 4QOTA 4DI6A 3TJ8A 1AFIA 1HFEL 4B3RJ 1UEKA 1URRA 1VQLS 3AOAA 2OPQB 4ZHRA 4DLEA 5EWFA 2H4YB 5EN1A 3I31A 3VAIA 3F0NA 1RAGB 1RWNB 1W2IA 1HBNA 1GMWD 3PYFA 2C3PA 3PKMA 4DN9A 4AXIA 2DGVA 1ACMB 2ZH3A 1RT3A 1D9FA 5GADU 3C8YA 1BMQB 2RS2A 2VA3A 4WZMA 3DM2A 2YQ1A 4LF6J 4USTA 4M5HA 1UCNA 2OO4A 3JSMA 1ZAVA 1JNRB 1UP1A 3Q0AA 1VJWA 4F25A 2JRSA 2WK4A 4ZVUB 3LALA 4DMZA 3N5FA 3RRHA 2VH7A 2CQ1A 4MFBA 1CVJA 1NH7A 3WHIA 2XY7A 1RT7A 3PNIA 1CLFA 2V5HG 2ZDPA 1JJCB 1VHIA 3GYXB 3G2XA 4N8OA 2OTJS 3SSSA 4DZDA 2PMHA 4DQIA 2DHSA 2AP6A 3GFYA 1TK0A 2AGQA 2VODA 2I2YA 1Q4RA 2UXBJ 1TAQA 1YJ9S 5A8KA 2O3DA 4Y2CA 3I0SA 5JMNA 3DXBA 3BDEA 2CNKB 4DQQA 4NXMF 4DV7F 1NPRA 3CJ3A 5AXNA 2L08A 2UV8G 1NMEB 1XJWB 3SZ2A 1GX5A 4OX9J 1IKVA 2XQCA 2W8LA 4E8UA 1NZ8A 2IRYA 5DDOC 4HLBA 2E1RA 4N76A 3IR5B 1U09A 1U24A 2KH9A 2OI2A 3OLAA 1X0PA 3J80Y 4V19X 3UVJA 1TL4A 2W7OA 2LECA 2GGPA 2VPWB 2HNZA 2RD5C 4UQTA 4QIVA 3GP9A 5BYSA 3W2WA 4ZOSA 1JQGA 3DFEA 4U8VA 4LF7F 1WSVA 2JC1A 4PWDB 1VR6A 1QY7A 1O5JA 3G8SA 1VGYA 4X4OA 4ZPVR 2XYGB 2G1DA 2NUHA 1U1MA 1F9HA 3NCPA 2KFNA 1YQHA 4K4VA 2ASJA 4OYXA 2ILYA 2MKSA 4KKOB 5ETOA 2IA0A 1WC0A 2F4FA 5LMNF 3OL6A 3JQJA 1BY9A 3HSDA 3RB0A 1EAYC 5LXYA 2PFDA 2YKNA 2RQ4A 3HT0A 3EYZA 2IYIA 4QU7A 3SQGB 3FFIB 4LSZB 5F41A 1G2EA 1FKOA 4J37A 4X84A 2EPIA 4O23A 4I2PB 3DRPA 4O4RA 3QGHA 4ZJLA 2LLZA 4NA3A 3PW2A 3CIZA 1U6ZA 3CCLS 4DV5J 4L3NA 2ASLA 3MR5A 1SJ3P 1Q8IA 1HKAA 2ZVSA 3DLBA 4ZP7A 1QAIA 5AE3A 1IBLF 2FYXA 3BV8A 1TK5A 3F44A 2DNNA 2J0XA 4QPXA 3C3LA 2ZNZA 2EWHA 2EC2A 5LT5A 1Q79A 3FMWA 3SDEB 3BH6B 1NK7A 3KG0A 4IOBA 3DLKB 3QJJA 5KFJA 1NDCA 2OJ3A 2QIFA 2UVUA 3HSGA 2VIHA 5DQGA 3OFEA 4DV6F 4DFPA 2WSFC 2VFSA 5HVGA 3QAUA 3AOBA 5D4NA 3R9LA 1FNXH 2RS8A 4LF7J 2HEKA 4MK8A 4CTAA 2FLPA 3FMBA 3H2UB 4A48A 4U8YA 1DZ5A 1DFDA 2KFYA 2V4QA 4TYAA 3IWXA 2K3IA 3ZNUA 2VQEF 3NCRA 1CJKB 1JLCA 4MTPA 1T3OA 2FPHX 3VQSA 5H9FK 3JSBA 2YNGB 5A0YB 5LMNJ 1F3VA 3M2RA 4TQSA 3KLEA 1QLNA 4ICLA 4QCLA 4BHQA 3KG1A 4A47A 4MAKA 4AXJA 4IRDA 4LF1A 3GIIA 3OFGA 3HD1A 4YUDA 4DCOB 3MEEA 1NK4A 1Y3JA 1UPMB 4DV1J 1FVSA 5LJ5Y 3VZIA 3MMJA 2KT5A 2DNHA 1RISA 2OSRA 2FVQA 5AE1A 2BOPA 2UUCF 1NK5A 4IRCA 5CD4A 1IBLJ 4FYDA 3GJTB 1L5UA 4M63A 4RNMA 4LRDA 2WSEC 4B9NA 4WYWA 1R8HA 4ERDA 1ZETA 1H2TZ 2HAFA 2XCPA 2BJDA 3QO9B 4NE9C 5I42A 3KDNA 4GVBA 4F4ZA 1LWCA 5A8RB 2DXDA 2RDJA 2B4PA 3N01A 3IM8A 1IKWA 1UMJA 4MH8A 3H40A 1Q1KA 1X31C 4CIOA 3QSYB 3EWGA 4DU7A 4DV6J 2RSQA 4NCBA 2XULA 5C42A 1H72C 3GMGA 2E1CA 1VBZA 4IQMA 1S1WB 2HQCA 5AJ3F 2DHHA 4WE1B 5L1KA 3M8PA 1MU2B 2DNPA 4TU7A 2UUBJ 3CXCR 2OKQA 3CD5A 2KFZA 4NX9A 4B3MF 3CJRA 1X4BA 1NDPA 3N79A 3J81Y 3K58A 4M1KA 4C3KA 3HM9A 4DL0C 2XS5A 2DCUB 2F4VF 2ZJRQ 3MMCA 3VVTA 4Q0BA 2HLTA 2YH0A 4UOCA 2CAJA 1PYTA 4LF2A 1XIQA 2J9DA 1SI9A 4U95A 1FXRA 1FEHA 1FVQA 3D0HE 4C0HA 3RUBL 4HACB 1RT5B 3I9V9 4JUZA 2AYBA 4CCHA 1I6JA 1CC8A 3BKUA 1E6VB 4F3QA 3ZTRA 2KG1A 5ETPA 1ZM9A 2NSCA 4P7VA 3US5A 5FDLB 1VIXA 2MHNA 3MAAA 4YY3F 2IJFA 5BYRA 2AZ3A 4OIXA 2VFTA 1U48A 1URNA 1UEVA 3QLHA 3W61A 4LQ3A 4LF5J 1RHMB 3UNYA 1YJTA 4P9SA 2E5LJ 5DZ7A 4NXNF 1QJHA 3WZ0A 5J2NB 5HMYA 1S6UA 4M95A 4C11A 2W2MP 2HSEB 5E3RA 3BQ0A 1P9YA 2WAQD 4FN5A 3NEKA 1KR4A 3CC4S 5L1JA 1U2RA 1XR7A 3OTEA 1Q5YA 3W3SA 4ZVFA 5AJ3J 3MR7A 3VWSA 2B3TB 2VL1A 3R7BB 3AA8A 2QGFB 1VRTA 2BJEA 4G6VB 5L39A 4ZVQB 1FK9B 1QD1A 2N4CA 3K5NA 2RILA 3MEDB 4B3MJ 1F3FA 1LW0B 1QUPA 3RAMA 3M32B 4ECVA 2AV5A 3DMJB 3KDOA 1D9DA 4EK2A 1NH8A 2I5JB 3I82A 4B02A 2GHVC 3DGVA 4CT9A 3DLLQ 5J2QB 3S7RA 4N8NA 1H0HB 2CNNB 4KFBA 2D74B 3T3FA 2EBEA 3DXSX 4O3OA 4IO9Q 4WWSA 3EMTA 4HDGA 3MPUB 2HHTA 2DKOB 3RRKA 4DPUA 2HQIA 2JEIA 1U4BA 1DQ8A 4OL8A 2CNOB 1U49A 5HROA 3QRQA 1HWIA 4OZNA 1S59A 3HKZD 3CCVS 2H48B 3W9JA 4QW8A 4C3LA 4O3RA 2JLEA 5HLFA 1LK5A 3M9MB 3L9ZA 1WC4A 2NYIA 3KHRA 3CD0A 3VV2B 3PW7A 3GJSB 3UD3P 1FX2A 2VHGA 2FTRA 3CEDA 4JI7F 4M5JA 2HNDB 4N47A 3G8QA 5IC4B 4FXDA 4OFZA 2MKHA 1WI8A 1FNMA 3QWPA 5J1NA 3ETOA 3U27A 3RB6A 1RJJA 3T9ZA 2CQDA 2IVFB 3ZFVA 2AYGA 4DJBA 1AUDA 1J2VA 1VRQC 2D7SA 4USKA 5F9NA 1S6PA 1VQ6S 4CLPA 2E7WA 1UWBB 2JNJA 2UP1A 3M05A 4IG0B 3A8KA 2ZH9A 2L41A 2MQOA 3VGSA 3R5AA 4DPOA 1PJ7A 3Q22A 2SXLA 4EYHB 1RT2A 4KSEB 2RU9A 1X8DA 1JLFA 5G4DA 3GSDA 1K73T 1P9QC 4J9VA 2UVWA 3ISZA 3E3XA 3VZHA 1OQ6A 4DL2A 4NLYA 1PIEA 1I5OB 3W64A 2NPIA 1CS4B 2KZZA 4EI2A 2L48A 1FDDA 1Q8BA 3R5DA 3HMJG 3J7A1 1S1TA 2YNIA 2JOQA 2AX0A 2A3JA 2VG6B 1N5VA 4Y0FA 2VU5A 1KFDA 4DR1F 1MG7A 4XK8C 4TKTA 2HIQA 3LQVA 1XERA 2PEHA 3C16B 1WOOA 3CT9A 1S0MA 3CO9A 4NLGA 1IJEB 3LPYA 1LEOA 1S4EA 2WVDA 3BGLA 4ZIWA 3NAIA 2PC6A 2R2SA 4QJVA 3DHWC 1VBKA 4DUYF 2MKJA 1YBTA 3VAGA 5B7WA 3SQOP 1H3DA 4LFCF 2HRYA 1R0AA 4RBVA 3GB0A 3TQ1A 1Q0NA 4CQ1A 5K14B 3MPYA 3FRZA 4ECWA 1C0TA 3QFHA 2F8MA 2ZBQA 3TAPA 1PAUB 5IV3A 4TNOA 2IRXA 5DLGA 3K5PA 4NMLA 4UUXA 2G13A 4NLDA 4ANCA 1RHJB 1XQIA 3IG1B 2DGTA 4L72B 5T7LA 2VC1A 3MR3A 5FIIA 3ZNJ1 2QT7A 1IKYB 2AD9A 1UFLA 2HRUA 3PM9A 2KYZA 3O6QA 1HBUB 3SCJE 5B0DA 2UUAF 4ECUA 3ZTQA 5LMUF 3CDUA 2APOA 2B8QA 3NCQA 3EDRB 4IH7A 3MUMP 3ZZYA 4UOGA 2B51A 1S48A 4G1QA 1ZTTA 4GKKF 2ZC3A 2W24A 4JI4F 1RTHB 1M5HA 4EO8A 2KHCA 4YS2A 3JYTB 1JLEA 4AFFA 5F9LA 2GVZB 3UW1A 2HNYA 5KFLA 2CRLA 4DR1J 1FWKA 4ZVHA 4Q45A 3SI8A 3QIPB 5J1EA 2JDJA 3G82B 4K0KJ 3SV4A 2LEBA 1N5YA 1SQGA 4G65A 3ITHA 1D8YA 3TAMB 1PBUA 1WORA 1RA6A 4ILLA 4PG8A 2VICA 4PUOB 3N9UC 4PQUB 1NUEA 4QR2A 1RDRA 4DHVA 1PYSB 2MY7A 2KL8A 4E98A 1JXVA 3ENWA 4DUYJ 3H4DA 1A7GE 4ZN3A 3NNHA 5G0RA 2BVZA 1CJVA 3SFUA 4RUAA 4WTOB 4NPOA 3MZIA 1WKJA 4LRFA 3IWLA 4UY8T 2VZ9A 3QT6A 3TA1A 1REVB 3MD1A 3M1VA 4ZN1A 2QA2A 1N0VC 4NLVA 1G1XA 1LXJA 3KLGB 3BYRA 1F6TA 3VGTA 1TL3A 2HFVA 2DHGA 1EX8A 3LANA 4RBTA 1X4AA 3PV8A 1HNWJ 2Q6CA 2XHWA 3QT7A 2QLJB 1LW2A 3BR8A 4MKAA 4JOUA 2Y8WA 4JI1F 4X4VA 3A4TA 2YKQA 2DIVA 1F9EB 3EZUA 2DY9A 1IKXA 4X4TA 4LT6A 2KXNB 1YI2S 1TKZA 2JLGA 4KHRA 1HNIB 4KO0B 3BR9A 3ADAC 3K59A 5RUBA 2NZCA 1FE0A 2PA3A 4YHHJ 1U2CA 4Y34A 2LXIA 2GFFA 3I5AA 3AOCA 2FIUA 1B0VA 2NXEA 2HMIB 3KLHA 2BMBA 3MUVP 5CYJA 5U47A 4K4ZA 2Y1RI 3FEYB 3ET6B 4KRWA 2P9GA 4DR3F 4DL4A 4HR2A 5JJBA 2QFIA 2ZWOA 2RF2B 2AJ1A 2RU3A 4ECRA 5CCMA 2VG5A 2NREA 3CCTA 3CCQS 4HEA9 5KFBA 2JH3A 5KG3A 4CI0B 1HMVB 2WBRA 1PBAA 3H5YA 2HW3A 1SH0A 4PCQA 3B54A 4FBUA 3H7HB 2XGQA 4R25A 3U1MA 4LFAF 2AX1A 1AUSL 3R1LA 7FD1A 3MHYA 4BDPA 1FWLA 3TUZC 3MCSA 2CA9A 1YWXA 2DRBA 3T19A 1EB0A 2V4JB 1JLQB 5EUHA 1JIHA 1KQFB 1N36J 4OZLA 3K7RA 4Z7CA 5DM6Q 2NXNA 1FCAA 4JI5J 4B3OA 1XNRF 3AJDA 4F4KA 3KKFA 3T1HF 2C2ZB 4KQZA 2E66A 4IQXA 5ETQA 2CJXB 2KU7A 1WKLA 2KYXA 4WPAA 1M5SA 3LP1B 2Y3YA 1KBRA 4DPYA 1PC4A 3Q8YA 1NJZA 1S9FA 2HFZA 3FSYA 2DH9A 3UN3A 4FVMA 4DL6A 2WONB 1S1XB 3W2VA 4YB7A 1B70B 1WHWA 2VQFJ 5HQMA 2I38A 3TW0A 1VQ8S 2RUSA 2YBVA 3ISNC 3DYAA 5LOQA 4DN0A 4NL5A 4DR3J 5CYMA 3GIMA 2BQ3A 4F4AA 3J7Z5 3B8HA 3IXQA 1OJ4A 1VQKS 2CQPA 3A3NB 4Y2AA 1F1BB 4DV4J 2G2OA 2MLXA 4KGKA 1WOSA 4YR2A 5LXRA 2E5IA 4K8RA 4Q44A 2VDHA 2UUWA 4RW9B 4WJBA 1YTYA 3GILA 5KT5A 2KVIA 4ES1A 3DLHA 1VOMA 3P49B 1C0UA 3BM7A 4RW7A 4JV5F 2V67A 4Y28C 3PY8A 6FDRA 1FXDA 1T9XA 1WWHA 2B0GA 1FO1A 3MM5A 4ED7A 2J0QD 1MWYA 3FEXB 3LGHA 4J9NA 3IRXA 3T6BA 3MCOA 3HHLA 2XO7A 2Y1JA 3QJPA 2Y0BB 4I6WA 5HP1B 2ALYB 2FGOA 3PXGa 2D9PA 3M2VA 4JI0J 3UD4P 1JKHB 1S1UA 4OV6A 4C97A 1W26A 4ALZA 2G2YA 2IM0A 1LWFB 3T1HJ 2OGUA 4JP8A 3BYPA 2GS8A 3U7JA 4ZPTR 1FRXA 3JAMY 1GTEA 3AB4B 2B8PA 2J5AA 5KFSA 2HS3A 1VQ5S 2OFHX 2ZJQQ 2PIIA 3G6VA 1Y5IB 2U2FA 4PZVA 1FJEB 5J2MB 4FPRA 3OL7A 4BLGA 2PA8D 5K8MA 2ZDOA 3NOCA 3L95X 1LXNA 4L3KA 1VBXA 3R3TA 3UCGA 4DR2J 1YSJA 2NS1B 4AD6A 1SXLA 3JTNA 4ZITA 2NXCA 4A8XA 3BO4A 4C98A 3PO5A 2DR5A 4OZ5A 3DDIA 1RA7A 2J6UA 4K4YA 2HHHF 2R7VA 5D0HA 4IG3A 4CNYA 3HKWA 4GC6A 2M5YA 5HVHA 5HMXA 4RU9A 4ECTA 3IMQJ 2KZMA 4J9MA 4DX6A 2R7UA 1G3OA 3DOMA 1ROFA 2XTJP 3GG0A 1X4DA 3SCIE 2BZ2A 1LWEB 3UO0A 5GVQA 3T5JA 3R97A 5L46A 3LAMA 1ICEB 1Q95G 1HARA 4A4JA 3OUYA 3OHBA 2BRKA 3EICA 4B3SJ 2PSZA 1U1RA 3DLEA 5GMDA 4ED3A 1S77D 1GEHA 1K9MT 4CRJA 4DX7A 5K8OA 4B9VA 1RT1B 1SJ4P 2Z2YB 4JI2J 4UZCA 1L3VA 2K06A 2DD8S 5KOWA 2YPZA 4P2SA 1FKPB 2EFQA 2B6AA 3D7SB 3GWCA 1U1LA 2GMHA 3MFIA 4EYIB 3KOAA 5E3QA 5C25B 2R8HA 3ZZOA 1YJNS 4DOZA 3FRYA 3KLIB 4JBCA 1R89A 3CJTA 4Z7YA 1EKSA 5KFYA 2VB6A 3LH2S 1FRHA 4CO5A 3THTA 3C6UB 1LFWA 3WC0A 1SC1B 2KO1A 2MZTA 3GONA 3M2UB 1JB0C 5IC6B 5KG4A 2MEWA 2AW0A 4O4GA 2NXJA 4DUTA 4NLXA 1RT4A 5KT7A 4U67Q 4ID8A 2HHHJ 1L3SA 4QIGA 1Q86T 2HFNA 4XDCA 4J90A 2PD1A 2IC3B 2VF3A 3HVRA 4A8YA 2VPYB 3NL0A 2C3MA 2E9RX 1XK8A 1LFPA 3I5CA 4ZP8A 1NXIA 3MF5A 1SKSA 1RWOB 4P2FA 1OY8A 2ZH8A 1YJUA 3A12A 2CQ0A 4WP9A 1FI4A 2RJZA 3KHLA 2XYPB 2ZHOA 3NGDA 4URQU 1D3WA 2BJ3A 1VC0A 5GAHU 4MMOA 3NOGA 4DR7J 2CPXA 2ZBIA 2BE2B 3VAHA 3BPSP 3CGIA 4C8MA 4BBYA 3CCJS 4ED2A 3C15A 2ERRA 2V68A 2MSSA 3CJ2A 4QYZJ 2E7XA 4P74A 4W4MA 2C2RA 4F67A 2CXEA 1BUXA 4R5PA 3I0RA 1SKUB 3DRXA 3DOLA 2FLNA 2HZAA 2LMIA 1UFWA 2GHWA 1FJCA 1UWAA 2IJNA 3IAS9 4LF4F 1CQMA 3BBBA 5BYQA 5KFTA 3KK2B 4MIWA 2OUGA 2R4FA 3MCMA 2H5EA 2MSTA 2RKIA 1XTZA 2MYFA 4AE5A 2ATCB 4J7CA 2ZH7A 1VQNS 2R7RA 3PYGA 1R7IA 4ZHRB 3MR2A 2GIQA 2HQGA 2KVQE 2JHEA 1HBMA 4Y6IA 1HBNB 4WCEQ 4U7CA 3BGRB 4EFAC 1RT3B 3DI6A 2XMTA 4DSEA 2MGZA 2AWZA 2C28A 1SUQB 3AQPA 3DM2B 5F8MA 3A8EA 1RCXB 1W7WA 2V9WA 2ACYA 4OX6A 3JSMB 5HQLA 1IBMJ 2EFGA 2DCLA 1R6YA 2GQ2A 2N7CA 2DXEA 2K3KA 1JLGA 4RNFA 1RT7B 2D69A 4FDFA 5IQQA 3I5BA 1QAJA 2W7PA 3B4DA 2IM1A 2MKIA 2IDEA 3VF0B 3C6TA 4X2BA 3TZYA 2RQKA 3R5GA 3QT8A 3IC1A 3MEKA 3GR1A 2DEIA 2ZE2A 3NXZA 4DV2J 4ANEA 1Q53A 3DRYA 1A0OB 3F73A 1PGZA 4DSLA 5A8KB 3POTA 1J5OA 4KHMA 3I0SB 4KC5A 4GC7A 2VJUA 4IDKA 3AB2B 4UZBA 4NLPA 3RYLA 4LF4J 4CO2A 3PRBA 1PKUA 2HVZA 4FVCA 4X62F 3D5MA 2MKCA 1IKVB 3SBMA 2QLBB 1UZHA 3OBIA 1M5OC 1NNDA 1RZMA 1KHVA 3AA9A 4KGVB 4A8WA 2OEKA 3TNVA 3UVJB 4OHYA 2ZJPQ 2GGPB 2HNZB 2DNRA 4YR3A 4QWEA 2D41A 3OVBA 4RU2A 3W2WB 3VGUA 3M8QA 5D3GA 4DPWA 1CQNA 5CHCB 1SJFA 2ZH2A 4URSA 1RWWB 4NZ0A 5KFIA 1K1QA 4L74A 1WNEA 1I3OB 4DU8A 1RWVB 1SJ1A 3NS5A 4ZVRB 2A0FB 2FLLA 3M6UA 1V3ZA 3D6FB 1TL7A 3KLVA 5IWAJ 3FQLA 3BDPA 2KT3A 4ZVGA 2IA6A 1OPZA 2C22A 2XSFA 2V2VA 4DSJA 1TAUA 2G0CA 5B0BA 3BGUA 3JQMA 2MZ1A 2VC0A 1YJRA 2R3VA 1K0VA 3FUYA 4I4BA 1DHMA 2HBRB 3D68A 2YKNB 3LWLA 2V0NA 4C3MA 2JFDA 4NLUA 2AQ4A 2WRMA 1N52B 2WSCC 3QYYA 4Q2LA 1FKOB 3DRPB 2I0XA 4DLGA 3TARA 3UNGC 4PABA 4WU2A 2DGSA 1UVLA 1OYDA 3PRDA 5DDRC 1H7WA 5DGAA 2YKOA 4DV0J 7AT1B 2ROEA 3MECA 4H54A 3MTJA 3FVYA 3I4PA 1AA1B 1M1HA 1ZOTA 2FHJD 3W7BA 4X62J 2FHKA 1TK8A 1NCLA 5ETKA 4TY9A 1OS5A 1VRUA 2CJBA 1R3NA 1V9OA 1SL1A 1N33F 1LOUA 1H6KX 3TX0A 1ITPA 3K8WA 5IFMA 2JEJA 2BXJA 2RHQB 3SMZA 4DR4F 1GQEA 1S0VA 2ADCA 4LR7A 4ECQA 1FWPA 1HBOA 4CTAB 3MM6A 4LMZA 3BGOP 5D4OA 3BSOA 1LNQA 3KWMA 4CP5A 4QZVB 2OEMA 4YB6A 3BS9A 1JLCB 2CZVC 3DRSA 4CLKA 2W4PA 1S0OA 2CDQA 3N6LA 1CJTA 3HULA 1E6YB 1N5TA 5DZ6A 5A6WA 5DM7Q 3M2RB 2Y1LB 3KLEB 4ICLB 3TP2A 1FERA 2YTCA 1A6LA 3C14A 3ILLA 3CDAA 4OZ0A 3BQ1A 4ZVTB 1F60B 2CQBA 1ZZNA 4OMFG 4TY8A 1X4EA 3MEEB 2CPFA 3TUJC 3RBDA 2FVCA 4ANDA 1BQMA 4PXCA 1R6VA 2NZ4A 3AJ2A 2QLXA 5KFAA 4IYQA 1NBEB 1HWUA 4QBUA 4WFZA 3NGSA 2ZOFA 3FEZA 1YIJS 3R27A 1SH2A 4YDXA 5LSLA 1TL5A 5D15A 4ITSA 2RRNA 2OD4A 2CPZA 3O44A 1S9EA 2GAHC 5I42B 2JX2A 1FRLA 4GVBB 1IJFB 1LWCB 2BJ9A 1XMQF 2FGCA 1IKWB 1SJRA 2C42A 2ZBPA 3FBFA 4M8LA 3IP0A 3GU0A 2QO3A 1N33J 3TOQA 5IM0A 3EGZA 4ELVA 2HQDA 5C42B 5T41A 4LF8F 2M70A 1HWJA 4CZCA 3M8RA 4DR4J 2HPUA 4EO6A 3SYZA 5IZHA 4PG7A 1OWXA 2Q79A 3D0GE 2D9OA 3M8PB 5KFKA 1K1SA 3N28A 4K2JA 2OAUA 3TA0A 3OTCA 3G87A 2OH2A 1NJWA 3BSNA 2F9JA 4CLUA 4X65F 4LVOP 3EGNA 3PFOA 3BREA 3L7OA 3HHKA 2DGWA 2WZ1A 4FF1A 1HNXJ 3PRVA 3PEJA 3MMCB 4Q0BB 5E3CA 2MJUA 2XWYA 1C1BA 4KB7A 1U1OA 4JI3J 2DGOA 1ZPVA 3RBXA 3OV7A 4RO0A 2P6TA 1T03A 2XS2A 3D6HB 2UXDJ 4DDFA 2XY6A 2DNLA 3HHLC 3K5MA 4F4YA 1JLBA 5MAOA 3MAAB 3J7ZT 2E1PA 1C4AA 1NK9A 3FZBA 4OYPA 1KQSR 1HPZA 4UUWA 5KFQA 4EBEA 3QLHB 1JWWA 2EW9A 1TV6A 1XMQJ 3HVWA 3THVA 4X4NA 2YPYA 3WX8A 1WDDA 3LOUA 2BACA 4C11B 2F8HA 5ITHA 4NWBA 4AL6A 3D3BJ 3GTYX 3VALA 4Q8FA 5DDQC 2XMMA 2IBKA 1SKRA 4EZ9A 3O8WA 3M8ZA 3V4IA 2PI5A 1GH8A 2R2UA 4PYDA 2A2DA 2ZBRA 5IOLA 2UVRA 1J27A 1VRTB 5B0GA 2EK1A 3PKYA 3JQKA 2G2ZA 2AGPA 3ICLA 4X65J 1M5PC 3FGVA 1S57A 3NGUA 3N6MA 2XLIA 1X5PA 4C0OC 3FDSA 2QG9B 1DBDA 4ZKAA 4WZQA 2P2CB 2HFOA 3NAHA 5HMWA 4NLWA 4YDDB 2AF6A 3GIRA 3UD5A 2DITA 1MU2A 3VGVA 3E2EA 1U02A 4KFBB 4WBFA 4ZVOB 3MAQA 2ASYA 5A2QU 1L3KA 2J7KA 2K1RA 2CJYB 2B4UA 1R8CA 3EPIA 1SL0A 5F3ZA 1YX2A 2YKPA 1RT6A 5IT9U 2NSBA 3GYGA 1MW7A 3UPFA 1BQXA 2H54B 5HROB 3RAXA 3BEGB 4LRCA 1B0PA 4GRSA 2Z2ZA 4USHA 2HHVA 3GZ7A 5HI7A 2V2KA 2MPUA 2X1GA 2K8GA 5L8RC 5DLFA 1ZYQA 5HLFB 1GXUA 4DSIA 1VDHA 3M4XA 2LQ9A 4OZJA 5EGYA 3TZZA 3Q8VA 3EUNA 4B3RF 2YWWA 3CUNA 2OP5A 2JFKA 4EUVA 1HLWA 1TL1A 2KM8C 4U96A 2BEFA 1FDAA 1SBRA 2QZ8A 3RR8A 1Z2ZA 3GCXP 3P4UB 1HQEA 1PILA 2AEFA 3EVOA 3V6HA 3X3UA 1KOHA 1EARA 3ZXWA 3OTBA 4A8QA 3F56A 3PACA 1KLMA 2YVSA 2GQQA 4QWCA 2KRBA 2PMZD 1UA0A 1S49A 2XLKA 3HDSA 2XEXA 3UR0A 4CLFA 2ZZTA 6AT1B 2O67A 2QMUB 3RB4A 2FJAB 4LSLA 1QAYA 2VPZB 3CW2C 4X66J 2BE7D 3R8YA 2YWHA 4O0NA 1RT2B 4R0JA 2GMJA 3ELHA 2CDRB 4NZ6A 1JLFB 4PG4A 4OI3A 3GFZA 3G86A 4IH5A 2A18A 4KE5A 1FDBA 2DEJA 5EX3A 2MQNA 3O1LA 2ZM6F 4WP3A 2YQ0A 4OZ3A 1RTZA 1GXTA 3I56S 3R5CA 1PCAA 2BRLA 1DRZA 1NB7A 3T1AA 2BW2A 3HF5A 1S1TB 2YNIB 2P9EA 2OTLS 2BJ7A 2UXBF 5F8HA 3K57A 2CQ4A 2FZGB 3BO2A 1FRMA 3RG6A 1D1UA 2IAJA 4HTJA 2G0IA 2CPDA 5DG9A 5J2QA 1TUWA 3MM7A 3IBFB 2D3O1 4O3QA 2WBMA 5L38A 4EWTA 4OX9F 4JYAJ 3TVZA 5KFNA 5CH7B 5KFXA 2JVOA 5KOXA 5AT1B 1HW8A 2XLJA 1D8ZA 1JXEA 4S0MA 4C8NA 1IR0A 2W2PP 3PHEA 1OSCA 4C8OA 1R0AB 5B08A 2XO6A 3CJ8A 1C0TB 2DR6A 3KLFA 3FC9A 1HYSA 3IBCB 2R8JA 1S9GA 5LM7E 1BXNA 4OYWA 1Y00A 2ZD1A 1HD1A 3FCHA 1ZA2B 2MZJA 3Q24A 4LR8A 4NOHA 5F0WA 3KK1A 1RBOB 2M52A 2XMVA 2AYMA 1UA1A 1X9WA 2JZ5A 3AXMA 2EFOA 2VOOA 1M5VC 3D2WA 4OYOA 2YKMA 2QLFB 2DO0A 3DGPA 2ZM6J 1SC3B 3TX8A 4ED8A 4G1QB 3B82A 5KFZA 1N0UA 3H0PA 2XZDB 2RQMA 8AT1B 2HFSA 3T6JA 5FLXY 5KT4A 1BC6A 1J5EF 4RX6A 4I1TA 4DV5F 4KV8A 3R2CJ 2OPPA 1JLEB 3T1YF 1PSDA 2HNYB 3DDNA 3UR3C 3L7UA 4FXVA 4NEYA 5J1EB 5J2PA 3TRGA 3I6PA 1Q81T 4DQRA 2PN6A 1N5YB 3J81j 3OHAA 3ITHB 4ECXA 4QR0A 4X4QA 1U26A 2MDAA 3D3CJ 2RUGA 3FKBA 4NLSA 1AYEA 2J0WA 3UCUP 4ID5A 3MFHA 4KR0B 3PHTA 3IO1A 1OSDA 3CDBA 2M7SA 1QTMA 3H98A 1TKXA 1UW9A 5G0RB 5FD1A 3T41A 1CJVB 2W01A 4ED5A 3CC7S 2HWIA 2B7CB 1M0SA 4QYZK 3M1VB 5F8GA 4FS1A 2UUTA 1YJVA 3K8VA 3Q89A 4OJ1A 5MLCV 4KAIA 1WKKA 3W62A 3RU0A 4LSNA 1ZS6A 1TL3B 1CJUA 4QIWD 3IS9A 4WF9Q 2Z57B 3P45B 5EWGA 1N88A 1MNEA 5KTQA 2UU9F 3MUTP 1WHXA 5BJRA 4OHXA 1LW2B 1AZSA 2WOMA 1S72S 4BWMA 2U1AA 4MT1A 4M5DA 2IPOB 3D54A 4L73A 2XGPA 4H4OA 2F3JA 1L3UA 3D1OA 1IKXB 3FQKA 1N34F 1QE1A 4P2XA 2RB7A 4NRUA 4DCPB 3JTOA 1TKZB 3LO3A 4TN2A 4DV1F 5I3QA 3PIOQ 1V5IB 4B9MA 1J5EJ 3FBEA 5DDPC 3TUIC 3HK2A 3T1YJ 4KGMA 2Z56B 3TI0A 3RBZA 2QN6B 1IKYA 3KLHB 3H42A 4RNOA 2Z4PA 4LUBA 2JJ4D 2HHWA 4F0MA 4DX8H 2M2BA 3E01A 2D3OR 3P5TL 2EI5A 2LKZA 3MWBA 3KJVA 5GMEA 1SIWB 1EP4A 4KHPF 2YY3A 2FY1A 2HWHA 3D66A 3FBBA 1N54B 2VG5B 2EFNA 3CMQA 4YN3B 3SSRA 1IBKJ 1TKTA 4OHZA 4RLEA 4I2QA 3WBZA 2FJWA 3BPDA 4CWBA 4F04B 2OPRA 3THPA 4PPDA 2XSJA 1U1NA 2R7QA 5M2PA 2YWKA 1DTTA 2CQGA 4ED4A 1HWKA 3AHPA 3W60A 4OYBA 3GCWP 5DS7A 4F2RA 2UUBF 5SUHA 1HQUA 4KH1B 3SSQA 4PWWA 2DIUA 2RHSB 5KFFA 1FKAF 3RR7A 2JEFA 1VCTA 4LVNP 4F4WA 1B0TA 4HVZA 1B4SA 2JLFA 4B3OB 2ACMA 4RWXA 3L09A 2UU9J 4V1Ak 3ONQA 3Q8QB 2FC9A 2ZUGA 1FD2A 2L3MA 1S1VA 2ASDA 2EKYA 3KK3A 1VQ9S 4DQPA 2B9EA 1N34J 5B09A 2HS0A 1NAQA 1WJ9A 3RBEA 2VONA 2HHPA 3BBCA 3W2VB 3QNWB 2QL7B 4F7VA 1HD0A 4O3SA 4FYWB 2G9OA 1T8EA 3BO3A 1C1CA 2DHAA 3DYAB 4J5OA 3MI7X 3L4BC 5E7OB 1Y3KA 1F5AA 3CJ5A 5CYMB 2DRAA 4XAKA 4H4KA 3Q23A 4KHPJ 1CC7A 2E1MC 2ZITA 4LF5F 4NCAA 3RTVA 2E5LF 3AODA 4C48A 3AQOA 4CLLA 1U45A 4H4MA 1VMBA 3O2IA 3WQPA 3NNCA 2HZCA 2UZAA 3FK4A 1FJGF 1C0UB 4RW7B 2N82B 3P5BP 4YB5A 1RYRA 2A1BA 3Q8UA 2HQ3A 3GYNA 5HANA 4EZ6A 2AMCB 1PYOB 4AL5A 1HI1A 3M9OB 1RAJA 3MM5B 2BUNA 3U1LA 3HVTA 5HVFA 4U7UD 3FNNA 1BD6A 2DNOA 3IRXB 3K5LA 4DFKA 4K4TA 1HL6A 3HHLB 1CEZA 3M2VB 1NSAA 4ZLNA 1F2GA 2GJ2A 1S1UB 1HMVA 1UVJA 1DJ0A 2E5GA 4F36A 5A8WA 1R0CB 4LIRA 3BJYA 1DQ9A 1UTAA 2GZOA 4ED1A 2LDYA 5GAGI 3IA0A 1B64A 3W5ZA 3LPEA 2LFVA 3E8OA 4A8SA 2JL9A 5HN0A 4F26A 4XPEA 1EHWA 1WF1A 2LQJA 4ZCKA 4NEZA 1H74A 1NSKL 2C2KB 1P8GA 2V4JA 1NZAA 2WHOA 5GAHI 5A2QY 1NO8A 3BBFA 2AHOB 2C2OB 4C0BA 4RZRA 4X64J 3DU6A 1A9NB 4OV1A 2ZKUA 1VISA 3HFKA 2Y8YA 5IT9Y 3H5XA 4ZVSB 5JUMA 4IG3B 3M8YA 1GXLA 5KT6A 3BKTA 3W5YA 1YLXA 2I6WA 3DOMB 2CIMA 5J1PA 1TTHB 5LL6d 3QBCA 4UW2A 4OJ3A 4FNHA 3AD9C 5KG0A 4EU0A 2M3DA 1YJ7A 5KAKA 1FJGJ 3ZZTA 2FZKB 3ISND 4EBCA 4RPFA 2N3LA 2CVIA 1RTJA 4M5GA 4UOFA 3DLEB 3HFVA 3QRRA 4W98A 4LBHA 4FKYA 3PJWA 3ZZPA 3QMQA 3JTPA 5HK4A 3BSAA 3KFWX 1WDTA 2B6AB 1TQLA 2QLWA 3JAMU 3GV7B 4RBUA 2LXFA 3GQCA 4JI8F 1K0TA 1RP5A 2IHR1 1FXLA 2CPYA 2XYHB 4QR1A 2PI4A 2KJVA 2W25A 4WFAQ 3P3DA 2KJWA 4ZCLA 4PQAA 1WF2A 4USIA 5I3UA 2Y0SD 3R7NB 3W9HA 3A8JA 1HNZF 4ZA1A 5B0EA 1GK8A 2KM8B 4TQRA 1RLCL 4U9RA 4DR5J 4WP8A 2IFXA 1P27B 2ROPA 3ILJA 3P96A 1EKRA 1UJ5A 1OPIA 4RL1A 5EHHA 4O4GB 3D28A 1SKWA 4LQ9A 2BA9A 2G1HA 3BH7B 2W9CA 5KFMA 2EXUA 1WG1A 1HR0F 1RT4B 3N0VA 3EGVA 4OJGA 1VC6A 3PX4A 1SC6A 2W9BA 3NGRA 1JX4A 5AXMA 5LSRA 2QJ3A 2FJBB 2GIFA 4C6AA 4JI6J 3RAQA 2LQ5A 1RAEB 1F9FA 4PKDB 5EWEA 4Q7AA 2FLOA 1S7HA 1VFJA 4EGLA 2NCKL 2MKKA 5ETMA 2QSFA 2FC8A 3OL8A 4DL5A 4OLOA 2YNHA 3PW4A 3V4MA 3SIPB 3DC2A 2VJVA 2PE8A 4KJIA 4FXWA 4CLSA 1IM6A 2QX0A 5D77A 3C15B 1RWXB 2DPIA 1KKHA 1UW4A 1O8BA 1DY3A 3NBPA 2AT1B 2HBYB 1QSSA 3MM8A 3EJMA 4LRBA 4N56A 4YFUA 4RW6A 2IDLA 4R5PB 3I0RB 5HL7Q 4LR9A 3PR5B 3DOLB 1I94J 2VOPA 3W5XA 1S0NA 3DNCA 1GTHA 4JI8J 3NY0A 1YVFA 3T9NA 2KDOA 3PFEA 2B5JA 1RADB 2K7JA 4MKYA 3EZOA 1NPPA 2CJAA 5KFEA 4HYKA 2C3OA 1AW0A 5KFRA 3CWJA 2RKIB 3OXLA 4NASA 2PDAA 3DLGA 1NLKL 2AZ1A 2AJ2A 1HNZJ 4WKRA 4P6QA 5D8HB 1MROA 3OJSA 5H9EJ 1UJ4A 4ZCIA 2HG4A 3GE9A 4OYAA 2BE9B 4EMDA 1NJYA 2YWFA 3EGWB 1RLDA 2IM2A 5DQHA 1HBMB 5DO2A 3GJQB 3B4MA 1HR0J 4IUFA 4OX8A 1RQ0A 1P6TA 1GMWA 4J9QA 3DI6B 3H25A 2MGZB 4K0KF 2D3ZA 3OR1A 1B99A 4CLYA 3PW0A 3OTOF 2F65A 4BC7A 3AY0A 4RJVA 1XEZA 4Y65A 2C3YA 2RRBA 3BN4A 3MCNA 2Q3PA 1JLGB 9RUBA 5KFOA 1KVJA 4DG1A 4R8UA 1RWKB 3CCWA 3FSIA 4IKAA 4DBQA 1RWMB 1X4FA 2ZOMA 4AYBD 3C6TB 4DQSA 1S5ZA 4USMA 4FZVA 4KGXB 1X0FA 4K5RA 1T7PA 2R8GA 3SV3A 4ZVEA 1DTQA 2ZE2B 2QV6A 3I87A 1B7FA 2XC9A 3AH6A 2IVMA 3QGGA 3POTB 4O44A 1J5OB 1YGYA 1VI7A 1X5TA 3A8IA 4RUHA 3EM1A 3KUEA 4XDDA 4IDKB 1RAAB 2AJ4A 3S1TA 3UDVA 1HNWF 3QIDA 1VQPS 1N48A 3OTDA 2KN4A 3T5KA 1TMJA 1LWXA 2M8HA 2L9DA 2GQCA 4YB1P 1VHFA 2XNRA 2JEGA 3MXHP 2J9EA 4WFBQ 4OI4A 2X3DA 1MMDA 1SQEA 2BX6A 4EEYA 3JB9k 3AD7C 4M94A 3M8QB 4YHHF 5D3GB 2GJFA 1WACA 1H2VZ 2VASA 3RGIA 2QL5B 1R8AA 4DFJA 1ZZFA 4FF4A 3RZAA 1U2FA 2KB2A 3OTOJ 2DTJA 2V94A 2EG2A 2DYAA 2HVEA 1TL7B 3K2YA 1RE1B 1S79A 1AT1B 3GIKA 2VA2A 2BM0A 4LBIA 1UVIA 3JSYA 5ADZA 4J9PA 1QAXA 2VUGA 1Y5LB 4Y2KA 2HVHA 5IT4A 3BGRA 1SV5A 1KSPA 1YG0A 2DRDA 3IR7B 1FTRA 1SUQA 3S6EA 5D4PA 4ZDNA 3UN2A 2W2NP 3MEGA 2MQQA 1EIYB 3MPVA 1Y11A 2N3OA 3FCWA 3ZTPA 3D9BA 1N36F 1SVDA 1WOPA 3V6KA 2BDPA 1CULA 2OPSB 3UDCA 3CCES 1S99A 3MECB 2HK2A 4JI5F 3C19A 1IQZA 4I6YA 3MURP 2YH1A 4K50A 1MLAA 1WC1A 3BSCA 2CWKA 1Q8KA 3TEGA 3F41A 2R7SA 3DOKA 1VRUB 3PZPA 2MLZA 3TVYA 2ZEJA 1P1LA 4RW4A 1JJ4A 3OJUA 1O0PA 1T05B 4UY85 3LP2A 4NLQA 1CSJA 2W2QP 2XS7A 4HI1A 4BCAA 1UVMA 2DGXA 3TANA 2VQFF 4MKVA 3KNGA 1RAHB 4ETZA 1SJQA 3ENQA 2DPJA 1HBOB 2RDDA 3MM6B 1R31A 3KTQA 1PO6A 1APSA 2L9WA 1TFYA 2V63A 5CZVA 3SCLE 3DRSB 4N41A 1RACB 3CB4A 4XTTA 1EETA 3RJMB 2CJQA 3CTRA 4DV4F 1CJTB 4J9RA 4WIQA 3TVKA 1FTCA 1M1GA 4DUZF 1ZA1B 5E5NA 1RAOA 2QFJA 1QTNB 4HH1A 3HHEA 4CLZA
chains in the Genus database with same CATH topology
2VKZG 3DU5A 3DXSX 4O3OA 4I0WA 1IBKF 4ZP6A 3KNAA 4IO9Q 2P6TA 4OLPA 4HDGA 1T03A 2J9CA 4I56A 2ADBA 1WTBA 2HHTA 4K5SA 2XS2A 2XMJA 1CG2A 3RRKA 1NKEA 2HQIA 4HTIA 1HHSA 2VG6A 1DLOA 2JEIA 1U4BA 2EFPA 3G6ES 4DDFA 4OJHA 1DQ8A 4TY8B 1SV5B 5GAEI 5DG7A 4OL8A 3G4SS 4ZS6A 1U49A 2LQBA 5HROA 1H38A 2XY6A 1BQMB 2DNLA 1HWIA 5KFUA 3HHLC 3K5MA 2IVYA 1JLBA 3JSRA 4OZNA 3CCMS 4F4YA 3OR2A 3HKZD 5MAOA 3CCVS 2R8KA 4ECSA 2B4VA 4I68A 4TU9A 4QIFA 2O1PA 1S4FA 4QW8A 3J7ZT 3MEGB 4O0IA 1C4AA 4C3LA 5IQ6A 1NK9A 2JLEA 2P6SA 3PEHA 3FZBA 2VG7A 4O3RA 5HLFA 4IR9A 2WB4A 1KQSR 1LK5A 2X51A 3M9MB 3OW2R 4JI0F 3H2VE 2NYIA 4MIAA 4MKBA 3VQTA 3KHRA 4B9LA 1HPZA 4UUWA 5KFQA 3CD0A 2DISA 3PW7A 1V3RA 4EBEA 5CYQA 3UD3P 3QLHB 4N77A 2FTRA 2LDIA 3CEDA 5K9FA 1N6QA 1JWWA 2AYEA 2EW9A 3CE8A 4JI7F 1L3TA 1S9EB 1UVKA 2P5VA 2HNDB 1TV6A 3PR4A 3HVWA 4N47A 2YX4A 3THVA 3LGNA 2VV5A 3G8QA 1AROP 1FDNA 4MIBA 4X4NA 4FXDA 2DNGA 4OFZA 2MKHA 1WI8A 1R43A 4AL7A 3LOUA 1FNMA 3QWPA 5J1NA 3ETOA 3MM9A 2BACA 3U27A 4C11B 3RB6A 1VQ7S 2F8HA 1XMBA 1RJJA 2GA7A 3Q2SC 1VQSA 2FHJA 2CQDA 2J8AA 4NWBA 5K14A 3T9ZA 1YBAA 5ITHA 4K59A 4AL6A 1WD6A 2IVFB 1ELOA 3DOKB 3ZFVA 2Z2MA 3OVSA 2AYGA 4C4WA 3VALA 4Q8FA 4DJBA 4RW4B 3PDNA 1AUDA 4PG6A 4NRTA 4PXEA 5IM0B 1J2VA 5DDQC 2XMMA 2KG0A 2IBKA 2D7SA 1SKRA 3O8WA 4A8FA 4EZ9A 3S01A 2AU0A 2DNMA 3CJKA 3V4IA 4TLRA 4QWDA 3LP2B 1HNVA 2PI5A 2EK6A 5F9NA 2ZHAA 4DR2F 2R2UA 1GH8A 3LWMA 1S6PA 1VQ6S 2KXFA 1YRXA 2OSQA 4OX7A 4B9UA 2A2DA 2Z8QA 1M1KT 1TVRA 2UVRA 2E7WA 2CKWA 1DQAA 1UWBB 4DR6F 1VRTB 2RE1A 2UP1A 3M05A 4IG0B 3IG1A 2DH7A 2QA1A 1FESA 5B0GA 2EK1A 2O5DA 2J6SA 2ZH9A 3PKYA 2L41A 2MQOA 4W90B 1X4GA 3PO4A 2AGPA 3J7YI 3R5AA 2VKRA 3ICLA 4DPOA 3PIPQ 1XWLA 1M5PC 2BABA 2MJNA 3FGVA 5H9FJ 5K8NA 3Q22A 2SXLA 4EYHB 1F5BA 1HBUA 2XMUA 3N6MA 2YX7A 2XLIA 1N32F 1X5PA 1KQGB 4C0OC 1RT2A 4KSEB 2RU9A 2YQ3A 3FDSA 3LW5C 5E0OA 1N56A 1DBDA 4IOAQ 4ZKAA 5LSOA 4WZQA 1X8DA 1JLFA 4H4KC 4TYBA 5G4DA 3GIJA 3GSDA 2HFOA 3NAHA 5HMWA 3LP0A 4NLWA 5HO4A 5JVHQ 1K73T 2NPFA 1P9QC 4YDDB 2AF6A 2CJ9A 3BGFA 1EETB 2RDIA 4J9KA 2UVWA 2B56A 3ISZA 2DR9A 4Q43A 3E3XA 3VZHA 1OQ6A 2O01C 4GO5X 1C1BB 4DL2A 4NLYA 2DITA 5E3AA 1NK6A 3E51A 4G1IA 1MU2A 1RTHA 2XWXA 1S76D 3E2EA 1RKIA 2NPIA 4KFBB 3MGJA 3MAQA 1VBYA 2ASYA 2HGNA 2L48A 1FDDA 2KZZA 1Q8BA 3R5DA 3HMJG 2R9LA 4BWJA 2FB0A 4HKQA 3JYTA 1UAWA 3J7A1 1TUVA 4XIUA 1L3KA 4OZ1A 1WHVA 1OIAA 1S1TA 2J7KA 2YNIA 1RK8A 1T03B 1WELA 1FD8A 2K1RA 2QA4G 4DFMA 1X9SA 2B4UA 4Y00A 4PXDA 2JOQA 1R8CA 4B3SF 3P6YC 1G6BA 2AX0A 2A3JA 3GV8B 3QIPA 1YJWS 2VG6B 3EPIA 1DLOB 1XR6A 1SL0A 1N5VA 5F3ZA 4KT0C 5KFGA 4Y0FA 3D1HA 4DL3A 2YKPA 2VBZA 1RT6A 1KFDA 4DR1F 4XK8C 4TKTA 2NSBA 2ATLA 2HIQA 3LQVA 1MW7A 3TAMA 3UPFA 5AXLA 3CCUS 1XERA 2PEHA 1BQXA 4JI2F 5KG2A 5HROB 3RAXA 1E6YA 3BEGB 1M90T 1B0PA 3DN9A 3V5RA 2VPXB 1JLBB 4USHA 2HHVA 3GZ7A 3CT9A 3OR2B 5HI7A 2V2KA 2MPUA 1S0MA 4PUOA 4PQUA 5L1IA 2HHXA 3CO9A 1TKDA 4WU3A 4NLGA 4MK7A 2CPHA 4EBDA 2X1GA 5KFVA 3VTIA 1IJEB 3LPYA 4RUCA 3G6XA 2K8GA 5L8RC 3CD6S 3UFCX 5DLFA 2COLA 3BGLA 2RVJA 2VG7B 5L9NA 1ZYQA 4QWBA 5HLFB 2MQPA 4FBTA 2DO4A 3LUYA 3NAIA 1GXUA 4DSIA 2BANA 3OVAA 2WTFA 1QVFR 2PC6A 2HHUA 1HPZB 2M4MA 1U25A 1VC5A 3M4XA 4HH0A 2R2SA 2IBOA 2LQ9A 5CYQB 4QWAA 5GMKa 2GX8A 4OZJA 4QJVA 3DHWC 1N6QB 5EGYA 2MKJA 4DUYF 4K4XA 3VAGA 3EUNA 2XG8A 4B3RF 5B7WA 1TV6B 1ZM2A 3O5TB 1ZH5A 1H3DA 3CUNA 2B7BB 2OP5A 3KMQA 1P1TA 2JFKA 4PR6A 2CG4A 4EUVA 4LFCF 1TL1A 2HRYA 2KM8C 2AJFE 1ZAWA 4OHWA 1R0AA 1FDAA 4JV2A 1SBRA 4MK9A 4RBVA 3GB0A 2QZ8A 1FRJA 3MM9B 1W25A 1Z2ZA 3TQ1A 1RGVA 1NK0A 1REVA 4CQ1A 3RR8A 2EFVA 1SB6A 1HQEA 1PILA 4NLTA 5K14B 3MPYA 1ZM4A 2YNFA 3FRZA 3V6HA 3PJXA 3X3UA 3IRWP 1KOHA 1C0TA 4ECWA 3VAJA 2F8MA 1WTFA 2MZSA 3OTBA 2ZZNA 4A8QA 1QM9A 3F56A 4YP3A 2ZOGA 2LXUA 3TAPA 3PACA 1KLMA 2YVSA 3PX6A 2GQQA 4QWCA 2AJQA 2KRBA 3CJKB 3V4IB 4TNOA 2IRXA 5DLGA 3K5PA 4NMLA 3KLGA 2OPSA 2FJDB 4UUXA 1HNVB 2G13A 2X1AA 4J9OA 4NLDA 2PMZD 1UA0A 1S49A 1TVRB 3MPWA 4ED6A 2XLKA 1MSWD 3HDSA 2XEXA 3UR0A 1WEZA 3NG8A 3IG1B 2DGTA 4X64F 4L72B 3MOJB 2EBGA 2IYGA 2O67A 5K5MA 2QMWA 5T7LA 3RB4A 2VC1A 5M2RA 1GNKA 3MR3A 2LCWA 2FJAB 3C2PA 5EDWA 5FIIA 4LSLA 2QT7A 2XI2A 4DWIA 1IKYB 2C2EA 5B0CA 1QAYA 2VPZB 2AD9A 3RRGA 2BBEA 1UFLA 2HRUA 2YWHA 2KYZA 3O6QA 1HBUB 3PM9A 4ZPDA 3SCJE 2I8EA 5B0DA 1X4CA 2UUAF 4C2MA 2BM1A 1RT2B 4R0JA 5CZXA 5LMUF 3CDUA 4RW8A 2APOA 2GMJA 4IO1A 4NZ6A 1JLFB 4PG4A 1RWUA 2B43A 4OI3A 3GFZA 1JXLA 3N6NA 3G86A 3NCQA 4HI2A 4NZ7A 3LP0B 4KTQA 2E9ZA 1NRKA 4IH7A 3MUMP 1T05A 3V81A 4CO1A 1HNIA 4KO0A 3ZZYA 4IH5A 4D3GA 4WK3A 4Q5VA 2A18A 4KE5A 2B51A 1FDBA 2NXUA 1S48A 4G1QA 4BC9A 1ZTTA 3BF4A 5BR8F 4GKKF 2ZC3A 2MQMA 5I3PA 4ZK7M 5EX3A 4IH6A 2W24A 2MQNA 4JI4F 2QSWA 1RTHB 3O1LA 2ZM6F 1BWEA 5KFHA 1M5HA 3CSKA 4I64A 2X1FA 2FHOB 4EO8A 1VQOS