3CF5Q

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cf5Q00
2DIUA 1FT8A 1D8ZA 1SJRA 1K8AT 3G9CA 1N54B 2DGXA 2CPXA 2E5HA 1FXLA 3H2UB 1U1OA 2PE8A 1VQPS 2XS5A 2X1AA 2OJ3A 4ZKAA 2AYMA 3EGZA 2MSSA 2M2BA 4WIIA 3CD6S 2JVOA 2LMIA 2PEHA 2LYVA 2I2YA 1ZH5A 2DO0A 3OW2R 1VQKS 1JJHA 1JJ4A 2KFYA 3MI7X 1VQ6S 2MZ1A 4F26A 2DGSA 2J0SD 1UFWA 1QVFR 2UP1A 4Z2XA 3CCSS 1X4CA 1FO1A 1WEXA 3NNAA 2L41A 3TO8A 2V94A 4W90B 1DHMA 2XNQA 4CH0S 2E5GA 2MKSA 3CCQS 2DO4A 1U1KA 1SJQA 2RRBA 1N52B 2CPHA 2RRAA 2XS2A 2U1AA 2ERRA 1HL6A 2MGZB 2MQOA 2ZJQQ 1Q81T 2DGUA 2KXNB 4TU7A 1JMTA 2QFJA 2MPUA 4J5OA 2CQCA 1BY9A 2LECA 2LA4A 2E5JA 4LIRA 5IFMA 2MQPA 4P6QA 4C0OC 3EGNA 1X4GA 1PGZA 1YHQS 2KHCA 5IM0A 3V4MA 2MJUA 3UCUP 2DNLA 3P49B 2LQ5A 2MZRA 4IOCQ 1WG5A 4W92B 2MKHA 1YJWS 4YUDA 3MOJB 5BJRA 3BO3A 2K3KA 4LJMA 2QEXS 2CPJA 1H2UX 5CXTA 2DGTA 4UY8T 2X1FA 3MUTP 2FPHX 1A9NB 2GHPA 2MQMA 4WCEQ 2M0GB 5GVQA 4WKRA 1PO6A 2Q79A 3BO4A 2LCWA 3ZZYA 2RQ4A 1VQ7S 1H2VZ 2M7SA 2CQIA 4F25A 2JX2A 1SXLA 2FHOB 5DDPC 3R1HA 1W2BR 1U6BA 2YH0A 1KD1T 2M70A 2O3DA 4WF9Q 3Q2TC 3S01A 1ZZNA 3UCGA 2AYEA 5DDOC 5HO4A 2KRRA 1FJCA 3S8SA 1HA1A 1X4HA 1X4FA 2YKAA 2MQQA 4V19X 1YWXA 2HZCA 4EGLA 2HYIB 4IUFA 1WELA 2RUGA 3DXBA 2D9OA 1X5SA 3H2VE 4CQ1A 4QU6A 1VQ4S 1UW4A 3G6ES 3CCVS 2MZJA 2KG1A 3RW7A 3I56S 2MJNA 3VALA 1U1PA 2KYXA 1M5PC 2CQGA 4F02A 2DNYA 2BOPA 1WHYA 3MXHP 4WFNQ 1WI6A 4CIOA 2LEAA 3FEYB 2DHXA 1M1KT 4OZ0A 1VC5A 4C7QA 2OSQA 2E5IA 1WI8A 2BZ2A 2DHSA 2DNKA 4YB1P 2OTJS 2EK1A 4YOEA 5HL7Q 3HHNB 2J8AA 2KN4A 1D9AA 1QVGR 2E44A 1VQNS 2NZ4A 2MYFA 1VQLS 2J76E 1QM9A 2F3JA 3VAGA 5EN1A 3MUMP 3CCLS 2MQNA 5LXRA 3UWTA 5GAEU 3RW6A 1A7GE 3P3DA 2M88A 2M4MA 1K9MT 2M8HA 3S7RA 2MGZA 1YI2S 2CQ1A 4Y0FA 2HGMA 1SJFA 2OIHA 3LPYA 2JWNA 2XS7A 2AD9A 3US5A 1VC0A 2X1GA 2I38A 5H1SV 2KM8B 1U1QA 3G8SA 2MSTA 1WF1A 2FC8A 3R1LA 1RKJA 3CCRS 2AYBA 2KI2A 1Q7YT 3JB9k 1NU4A 1S72S 2MKCA 2MKKA 3CC4S 1YJ9S 2RT3A 4IO9Q 2N3LA 3VAIA 2HVZA 2RU3A 1F9FA 2N7CA 3NS6A 5GADU 2VOPA 2CQ3A 1U1LA 1YITS 2MY8A 4QPTA 1U6FA 2D3OR 2F9DA 2GO9A 3B4DA 4WFAQ 3IRWP 1Q82T 2MHNA 1WWHA 2DH9A 2DNNA 2CQHA 1FNXH 2VONA 3LQVA 3TYTA 2YWKA 2SXLA 1NJIT 2DNRA 3NNHA 1VQOS 3VAHA 3MD3A 1U1MA 3VAMA 3CTRA 5LJ3Y 2LEBA 5LSLA 3SMZA 2DNZA 3U1LA 3J7ZT 2ZJRQ 1OPIA 1X4DA 2KXHA 2RNEA 2CPIA 2DHAA 3S6EA 2LXUA 2DGOA 3P6YC 2KU7A 4WFBQ 4PKDB 3PIOQ 1H6KX 5CYJA 2D9PA 3UD3P 2L9WA 5D78A 1M90T 1L3KA 1WG1A 4TU8A 1X5PA 1B7FA 4PRFA 1S79A 2CQ0A 2K8GA 2EVZA 3VAJA 1U1RA 1KQSR 5FJ4A 2DNMA 2CPDA 2CQDA 3G4SS 1NO8A 3CPWR 3MUVP 5JVGQ 1U2FA 2HGNA 5GMKa 1N88A 1OIAA 3CCUS 2RVJA 3HI9A 2AYGA 2KH9A 3CULA 2F9JA 1UAWA 1KOHA 4A8XA 4FXWA 2MB0B 1UP1A 1P27B 2MMYA 2MY7A 5CA5A 3FEXB 3CXCR 3CCJS 2MZQA 2QA4S 4QQBA 2VODA 2DNPA 5GAGU 2DH7A 5LJ5Y 1VBXA 1HD0A 1WG4A 2M52A 4RU2A 1YTYA 2OTLS 1WHVA 2CQ2A 2ADCA 3CC2S 3J7YU 1K73T 3BEGB 1O0PA 2N82B 4TLQA 2CPFA 3NS5A 4LMZA 1WEYA 3THTA 2CQPA 2JRSA 2G1DA 2N3OA 1CVJA 2XNRA 3U1MA 3BS9A 3I55S 1H2TZ 2FC9A 1VQ8S 1X4EA 3VF0B 3L3CA 3CMES 3NMRA 5LSOA 1VBYA 2EK6A 3SXLA 5LXYA 1VC6A 2XSFA 3MD1A 2DNOA 2J0QD 1Q86T 1G2EA 1FHTA 2B0GA 5GAHU 3BO2A 3THPA 3D2WA 3UCZP 3UE2A 2DGWA 2DITA 2KXFA 3CF5Q 1WHWA 4ERDA 1SJ3P 2KG0A 4C4WA 2CQ4A 2RS8A 1FJEB 1YIJS 5IQQA 3K0JA 2MXYA 3VAKA 3P5TL 1YJNS 2LA6A 4Y00A 2WBRA 2KM8C 1DBDA 1X4BA 2YH1A 1WF2A 2CPEA 2RS2A 2DK2A 2XB2D 1IQTA 2G4BA 3ZZZA 3G8TA 1N8RT 1M5KC 1VQ5S 4FXVA 2CQBA 2CJKA 1WTBA 3B4MA 2DIVA 3MDFA 3UD4P 4ED5A 2LXIA 2ADBA 2MZTA 2DB1A 1AUDA 3N9UC 1RK8A 2KT5A 3VAFA 1R8HA 2HGLA 3SDEB 2KRBA 5DDQC 4BS2A 1OO0B 2CPZA 2X1BA 2G0CA 5DM6Q 1M5VC 3SDEA 2YTCA 1WF0A 2MZSA 3PIPQ 2U2FA 4PR6A 1X5TA 1X4AA 1VQ9S 1WEZA 2M8DB 1SJ4P 5IM0B 1XN9A 4QU7A 3G71S 2FY1A 1ZZFA 2OSRA 1M5OC 3CCES 4U67Q 1KC8T 2DISA 2DGQA 1VBZA 3IWNC 2JVRA 1WHXA 2VOOA 4CH1A 1R8PA 2DGVA 2RQCA 2DNGA 4M5DB 3NNCA 5DM7Q 2DNQA 3TP2A 2NLWA 1FJ7A 1P1TA 3R27A 5MLCV 1OWXA 2L08A 5DETA 3CMAS 1JJ2R 2MKIA 2DH8A 1URNA 2A3JA 2CPYA 2DNHA 3EX7B 1HD1A 1X0FA 5ITHA 2KVIA 1VQMS 4OZ1A 2DHGA 3DLLQ 3CCMS 3CUNA 4TU9A 2LKZA 5DDRC 1X5OA 1KOOA 3Q2SC 2ZJPQ 2M9KA 1DRZA 1DZ5A 5D77A 2MQLA 3CC7S 2MKJA 1U1NA 4UQTA 3MURP 5JVHQ 4IOAQ 3ULHA 3G96A
chains in the Genus database with same CATH superfamily
1PYTA 5D0HA 2HWHA 3KJVA 2DIUA 1FT8A 2HURA 4X4SA 2XYPB 1N5QA 2E5HA 1FXLA 5E0OA 2HHHF 1F5BA 2DT9A 4TLRA 2PE8A 1UMJA 3EPGA 4U96A 3TR5A 3D1HA 2Y1JA 1RCOB 4LF8F 1R0AB 2NXUA 1CJTA 4USUA 4ZKAA 1UKUA 4ATNA 4A8MP 1EARA 3W61A 3CD6S 3AJDA 1O51A 3TAQA 4KT0C 2I2YA 2DO0A 3SSSA 4URGA 1HWLA 5CD4A 4KYZA 4DUYJ 3W5XA 3ZTPA 1U26A 4CLTA 4WFXA 1JLFA 2QA4G 2JHEA 2GJIA 3MI7X 1B70B 3I96A 4GVLA 4DV1F 4O4RA 1VQ6S 1RT7B 3DDIA 2J0SD 1DY3A 3N0VA 4ICLB 4K4WA 4ELUA 1QVFR 2F5GA 2ZBCA 3V5RA 4LFAJ 4Z2XA 1X4CA 3CCSS 1PCAA 5CYQA 1VDHA 1FO1A 2A2CA 2BJ7A 2QA2A 1QE1B 2BE2A 3MM9A 4N7TA 5E3QA 3UR0A 4F8RA 1TKDA 3TO8A 2V2ZA 2OUGA 2XNQA 5GMEA 2RMLA 2Y1RI 1XR6A 2CWKA 1B7YB 2DO4A 2GQCA 2MKSA 3FVYA 4K8RA 4ZJLA 3CCQS 5IQ6A 4DR3J 2BVZA 1HNXJ 2W2OP 2IFXA 2NSBA 3PRDA 3CJTA 3K5NA 4WP3A 1HL6A 4Y6IA 4OJHA 5DZ7A 4C8YA 2JOQA 2HHTA 1HW9A 2R4FA 2KXNB 3FQKA 4DJBA 4NXMJ 3R7NB 1HQ2A 1NDLA 1XR7A 4ILLA 3I0RA 2IJNA 4KAIA 1T05B 2Y9HA 1GMWD 5I3UB 5F8NA 1S9EA 4ZVTB 4LBIA 5DG8A 1S1WB 1B0TA 1KEKA 4ILRA 1FE4A 3GYNA 3SV4A 1RBLA 4RW4B 2XS2A 2ZC4A 1KQKA 5JMNA 1UEVA 2E1MC 1X4GA 2CNKB 2P2CB 3GFZA 3ISNC 2C2OB 3P49B 2ROPA 5AE1A 2LQ5A 4BBYA 1WG5A 5IT0A 4YB6A 4E98A 3PR5B 1YJWS 2NQPA 1PBAA 3O3LA 1NMEB 3SFGA 1F9EB 1YBTA 4JV5F 3R7SB 1S48A 4PUOA 3FCVA 5D3GA 3MOJB 4N76A 3MM8B 3GE9A 3I9V9 3BO3A 2K3KA 2DR6A 1FESA 1XTZA 4FF1A 3IGNA 1C0UA 1H2UX 4WK3A 5C2GA 3MAQA 3H40A 2DGTA 3DMJA 3PW7A 5HATA 1HMVA 3R2CJ 2VKRA 2FPHX 4JYAJ 2YKMB 2HQGA 1FDAA 3G6VA 1RT2A 1N5VA 2NREA 1LFPA 3BDEA 2GV1A 3PYEA 3KJQB 4CLUA 1PC4A 4RW8B 5GVQA 4WKRA 1S1XB 2Q79A 3GYXB 3SZ2A 1TELA 1VRQC 1IBKF 5IC4B 3OBIA 4JI2F 2CVEA 2M7SA 1IWAA 4QW8A 5HQMA 2YWHA 1X0PA 2BKNA 3HXMA 3BGUA 4MMOA 5KFBA 5KFFA 4WP8A 4LFCJ 3JQJA 4ANEA 1J27A 1W2BR 5A8WB 1RT5A 2YH0A 2XTJP 3JTOA 3OD2A 2M70A 3RG6A 1PYOB 2HS3A 1NB2A 2HNDA 4I2PA 3LP1A 1MN7A 3T9NA 5C5JA 3AH6A 4DV0J 5DDOC 4WF9Q 4FDFA 4UW2A 4O44A 1V3SA 1H73A 1FWPA 2V8HA 4HTJA 2KRRA 3DYAB 5CH7B 1NPPA 1FF2A 2HHQA 1XC9A 1N56A 3R5BA 4URSA 3KLFA 2QO3A 4RW8A 2BV3A 2CJAA 2R7OA 4ANCA 4JI7F 4V19X 2OMLA 2V8GA 1MMLA 3KK1A 1S6PB 2A10A 5CYMA 4BDPA 1LWFB 3LGMA 2IJRA 3MMCA 4DV2J 4EGLA 2HPUA 2G0JA 3GJTB 1VLYA 2GQQA 3M2VB 3H2VE 5B0BA 1IM4A 3BH7B 4KO0B 3CD0A 3E01A 4LSLA 1T94A 4ECVA 1VQ4S 4JV1A 3ZTRA 4C2MA 4M5DA 4IR1A 2IRYA 2JEGA 4R0EA 4DSKA 2KKHA 2BE9B 3D3BJ 1CC7A 3EMTA 2ROGA 4P72A 3I32A 3H2LA 3QIPA 1X9MA 4DN0A 2Z4PA 5B0FA 4EMDA 3DYAA 3VALA 1WSRA 2WVCA 2B7BB 3TA2A 1SB6A 3C6TB 5CZXA 3PVXA 1FKPB 3BGRA 1VHIA 4ZCMA 2UUBJ 1DQ8A 1FFGB 1S6OA 2DNYA 2CADA 3DCAA 4XIUA 2WRMA 4NLTA 5FLXY 3OVSA 3UDCA 4J9QA 2QN6B 2LEAA 3FEYB 2HVHA 1RAOA 2VFTA 5LOQA 2KL8A 1CS4B 3V6KA 5IWAJ 2CZ4A 3CD7A 1FRKA 3LP2B 4NLYA 4N77A 2FVCA 4ECTA 1J5EF 4YOEA 2AHOB 4LF5F 2PIIA 3DMJB 2RRNA 2KN4A 2JJ4D 1RZMA 1AW0A 3JSYA 2ZBPA 4A8QA 3RBDA 1VQLS 3GLJA 5EN1A 1XMQJ 1TFWA 1FXRA 1TKXB 4FKYA 4XPEA 4LQ3A 2ZH2A 3CCLS 2R7QA 4P2MA 5G4DA 5I3PA 1LFWA 3UWTA 5GAEU 1C1BB 2ZZTA 4OYAA 3FC9A 3P3DA 4USIA 1EZZB 3FRZA 4X4QA 3T6BA 2HAFA 2R8HA 4B3TF 5KFNA 3BBFA 4TVAB 1EQMA 3S7RA 4F0HA 1R6VA 2NS1B 2BUNA 4OZNA 1O8BA 4PXEA 4BWMA 5J2MB 3LP2A 2E7VA 3LPYA 4RBVA 4LSLB 2QG9B 4CZCA 4YR0A 2XS7A 4WE1B 3IRXA 4WJBA 3E2EA 4FBUA 3M6WA 4KB7A 3HD1A 2VFVA 1Z2ZA 4DV0F 5J2PA 2I38A 5HMWA 1KVJA 3QAUA 1XK8A 1R0CB 2ZH5A 2MHEA 1NCLA 3VGVA 1WNEA 1JKHB 4WTOB 1JK9B 1S9EB 3Q24A 4N56A 1NU4A 1TL7B 4B3SJ 3FRYA 2FJVA 2CXEA 1IVZA 1HARA 2NPIA 3PM9A 3TARA 1T9XA 2N3LA 3CDUA 1F5AA 1JLAA 5LL6d 5JVHQ 1HNWJ 4GKJJ 2LU1A 4OHYA 1UTAA 4QWAA 1F9FA 2HRTA 5B0EA 2C2EA 4KFBA 2N7CA 1YZ7A 3I31A 2VOPA 3M2UA 1XJWB 5LMUJ 2ASJA 2YPZA 3OL6A 5CYMB 4DX8H 3JYTA 3OL8A 5KFGA 3CDEA 2E66A 4E8UA 3JXOA 4ZLPA 1V5VA 4XDDA 1SQFA 2GX8A 2FVRA 2VA2A 4NLOA 2E9ZA 1Q82T 2GO9A 4WFAQ 1YZ6A 2HK3A 4Y28C 1ZPWX 3N6NA 3OL9A 1CJUB 2W2MP 2CQHA 3ILJA 3HO1A 2EBGA 3V4IB 2PI5A 4OMFG 5EDWA 4ED2A 4Z37A 1NJIT 1ZM4A 3D6HB 4IFVB 3DI6B 3OXLA 4B9LA 1SH0A 3K8WA 3K5OA 2C22A 4K4TA 4KHRA 4KHMA 3MCNA 5KAKA 3VAMA 3CTRA 5LJ3Y 4UQGA 4O3RA 2ZOMA 4Y65A 3RJMB 2LEBA 3CO0P 2KT2A 4GC7A 1FNMA 3OV7A 1HNXF 1N0UA 2RDIA 3QT7A 1WSVA 1RWKB 3ZO7A 3KHGA 2FB0A 3SMZA 2N4DA 5DZ6A 4O44B 1SL1A 2XO6A 1TVRB 4ZVFA 5KG7A 5F9NA 3OTDA 2XYGB 4EUVA 1YJVA 1VISA 5D4OA 2RSQA 3IAS9 2PMZD 3KLEB 3T3FA 4HDHA 2KZMA 3IA0A 3K5PA 2DHAA 1HNZF 4HT7A 4K59A 4TXSA 5D3GB 3BREA 2DGOA 3AAWB 1H3DA 2IDLA 1S1WA 4OHZA 2GZOA 3PIOQ 2R7WA 4FS1A 2W9CA 1IUJA 2XGQA 3IC1A 1HNVB 1RT3B 3HJVA 2XWXA 4OYBA 3LOUA 5CYJA 3EGWB 4X64F 5A8KB 4X65F 3UD3P 2A6OA 1M90T 1L3KA 1RE1B 2V8PA 1TKZB 4H4KA 5EX0A 2M3DA 4DLGA 1OYEA 1B7FA 3QAEA 4HLBA 3G2XA 1A0OB 3OFEA 3OTCA 3PO5A 2AKWB 2QC3A 1KQSR 1CJVA 3MEDA 4OJ1A 2WAQD 3SIPB 5HBMB 2HRYA 3NKYA 2WSFC 4LF2A 1RT1B 2BMBA 3I4PA 2W01A 3MM8A 2CPDA 4LSNA 1J2VA 1QAJA 3PFEA 4YFUA 4DUZF 1GNKA 2F40A 4YQWA 3G4SS 3IR7B 1UA1A 3V4IA 1Z1ZA 1DTQA 2Z0GA 4LREA 3CPWR 5JVGQ 2XY7A 1T03B 1UVNA 3NWRA 1NB7A 1ZBTA 3PJXA 2VG5B 3TZYA 5KFOA 3QRRA 3NBPA 2XMTA 4M95A 4CLPA 1VIOA 1JLEA 1UAWA 4ZHRB 1CC8A 2PA8D 2AMCB 1FTRA 1WKKA 2GS8A 5IOLA 4BCAA 1KOHA 3D0GE 2JFDA 3UO0A 2MLYA 3QGIA 4DCJB 1H72C 2V34A 3C19A 3RZAA 2BXJA 2XYHB 1N36F 4NYOA 5H9EJ 2HFVA 3PDNA 1JXLA 2ZNYA 3RAMA 2QA4S 2MZQA 3V6DA 2DNPA 3FCHA 4KGZB 4MH8A 3QSYB 2LP4A 4LFCF 4Q2MA 1MWZA 3NGDA 1FX4A 2CQ2A 2NCKL 1OJ4A 4OX6A 2ADCA 5E3CA 4PQUB 4ED0A 2XMVA 5KFSA 2VD3A 4PYDA 2GVZB 1RA6A 1R0AA 4B9VA 4DQPA 5ETNA 3BJYA 3J7YU 2V4JA 1K73T 2HMIA 3N4WA 3Q8VA 2N82B 4IDKB 1IBMF 1WEYA 4QIGA 2ZC3A 3W60A 4ECQA 4DR4F 2AJQA 3DLGA 1KSPA 2J6UA 2B9XA 2G1DA 2OD4A 4WFYA 5C7PA 1KTVA 1CVJA 4G1PA 2V8DA 1J5OB 2C42A 1DTTB 1RBAA 2DXFA 2ZITA 2AEFA 1TKTB 1S12A 1H2TZ 2BJ8A 2YQ0A 2K1RA 3N28A 3TUZC 4USKA 2XBPA 4EWTA 1WJ9A 1N4LA 5L9XA 5CD4H 3D54A 3KUEA 4X62J 1HNZJ 5HP1A 1WDTA 3CE8A 5LSOA 2I6WA 5CCLA 3RRHA 1TQLA 4KHPF 2EK6A 2RQMA 3ZTQA 1FK9A 4AL5A 4JI6F 4QYZK 2OMOA 5E3RA 2DYAA 4ZPTR 3KLEA 1D9FA 4UUWA 5AXLA 3V81B 4F0MA 4X65J 2J0QD 2R7UA 2VDHA 3DRRA 3PW0A 4K2XA 3FNNA 2RU9A 2FGOA 4RW6B 5K9FA 1Q79A 2YX1A 4C0HA 5CABA 5IWAF 3BO2A 4ED8A 2ACYA 2Z58B 4DQSA 3RB3A 1NEEA 1QDUB 2YKQA 2YNGA 3D7SB 4M5LA 4EI2A 2P6SA 4ZPVR 2RAQA 4ZVRB 3SQOP 2ZH7A 1FDDA 1WHWA 4ERDA 3I5BA 1SJ3P 1MN9A 5LMUF 1LV5A 2ASLA 2C3PA 1SL0A 4OI0A 3RAXA 3W64A 2MXYA 5J2NB 3MR3A 4ID5B 3V6DB 1N32J 2JLGA 4DUZJ 3P5TL 1WC1A 3BSCA 2UVUA 1YJNS 2LA6A 2B51A 3TQEA 2XMWA 4Y00A 4LF6F 1U48A 1V6HA 1RLCL 4NLVA 3EZ5A 5HSPA 1TL3B 2CG4A 2IAJA 3AOCA 1SCJB 4ZPWR 4ZA1A 3M8PB 4YP3A 4DUTA 4B9SA 3GIMA 4UZBA 4RW9B 3G8TA 2G4BA 5HK4A 2BJEA 1RWMB 1IR1A 1VRTA 2GMLA 4FYWB 1M5KC 3D5MA 5BYQA 4U7UK 4EK2A 1VQ5S 1HYSB 2P9EA 4RL1A 5CZVA 1RP5A 1VCTA 3WHIA 3OUYB 1WTBA 2DIVA 3CWJA 4NI2A 4AQYF 3DLGB 2NR0A 3MGJA 3KUGA 1EP4B 4GC6A 1SUQB 3M05A 3EUNA 4UZCA 1Q16B 1RK8A 2RUSA 3BN4A 3P5BP 2ZDPA 3JS9A 4QW9A 2COLA 3DOKA 1R0BG 1NSAA 3HFZB 4UUXA 2AGQA 2QYCA 2ZH6A 1Y00A 3NCRA 2HAIA 4RLEA 4UF4A 1M5VC 1PJ5A 3QJLA 2HS4A 2CA9A 3PIPQ 2JH3A 4IKAA 2U2FA 3M8PA 4UOHA 1NH8A 1TUWA 1JKHA 4PR6A 3V6HA 1FERA 4B3SF 3W1YC 5DO2A 4WK1A 2R3VA 2ATCB 2HK2A 2M8DB 2Y3YA 1LEOA 1YBAA 3QYYA 4QWEA 3T5JA 2D3UA 3PX4A 1T02A 1SJ4P 4CLKA 2W9BB 2Q66A 4QU7A 2FY1A 1PYSB 2FQQB 3H5XA 2GHWA 3KHRA 3KLVA 1C1CB 2IVMA 4CT9A 2D3O1 1T9WA 3D0HE 2DISA 4ZPAA 2XMUA 1I94J 2MLXA 4M5HA 2UXCF 3PKYA 4RWXA 2CDQA 3H8YA 4ED7A 3IWNC 4XTTA 2LQJA 1X31C 1PSDA 1NUEA 4J9VA 3R7BB 4JI8J 2X3GA 5T7LA 5A8RA 3CJQA 4ECRA 2CKWA 3Q8RB 1HPZA 2UV8G 1RTHA 3R27A 5T14A 2XSJB 1OWXA 3G86A 5E41A 3Q8UA 3CMAS 2UUAF 4C11A 1NXIA 2FJXA 3I5AA 4JI1J 4M5GA 4USMA 1WKLA 2OPRB 2Y1LB 5E5NA 2DNHA 3EX7B 4J9KA 2HHHJ 2HMIB 2CNLB 1RWUA 3SYZA 1HD1A 4JI0F 3T41A 2B4OA 2V69A 3G87A 2LKZA 4EYHB 1NJWA 2CUYA 5L38A 3QT6A 1VHFA 3M8QA 4NLGA 1X5OA 1JLCA 5F3TA 7FD1A 3QGPA 4C9DA 2WCXA 5BXIA 2OHDA 1NK8A 2YKNA 2B5JB 1RTDA 2KFZA 4DUYF 1VK3A 3ONQA 2CVIA 4WBFA 2BDPA 2MQLA 2GFFA 1LWCB 2A18A 2JC0A 4ZVEA 1TV6A 3JTPA 4IG3B 2HFNA 5IXUA 1NLKL 3M6VA 1ROFA 1HQEB 1MWQA 5L39A 3MURP 1PAEX 3DRPB 5J1NA 4RW4A 3C6TA 1S6QB 4IOAQ 2C2MB 4L3KA 5HLFB 3BN7A 2ZWOA 4RNNA 5J1EA 3EPIA 1K8AT 1WC0A 2W2NP 3KK3A 3CEDA 2CPXA 2EWHA 3FBCA 3HHLD 5KFUA 4JV5J 1YJTA 2K7KA 2LQ9A 1GXUA 2Y0SD 3H2UB 1U1OA 4GO5X 2IRUA 3SQGA 2XS5A 3AXMA 3QO9B 1ZAVA 4Z7CA 3A1YG 3DDKA 5THWA 2X1AA 3DLKA 5MAOA 1XMOF 2OJ3A 4HKQA 4DPYA 2MSSA 5B08A 2M2BA 2HQFA 2VG6B 1T9UA 2G13A 2LMIA 2PEHA 3KNGA 3M4XA 2LYVA 5BYSA 3OUYA 1DAXA 2FJWA 1WC3A 1OY9A 3FZBA 3QT8A 2YQ3A 4I68A 4MKBA 1KWMA 4LRCA 1VQKS 1JJ4A 3TA1A 5KFMA 2GMHA 3HZGA 2KFYA 2MZ1A 2XY6A 1B64A 4V1Ak 2CFXA 5IV4A 2W25A 2V50A 4HYKA 2ZOFA 1RWOB 1KRPA 2FY8A 2V9KA 1RWVB 2Q3PA 4N47A 2L41A 2VG5A 3LO3A 5DQHA 4CH7A 2JEFA 1RQ0A 4A8OA 5EWEA 4W90B 1MLAA 2J6SA 1RAEB 2VBYA 3OR2A 4K4UA 3OFHA 3TUIC 1LKZA 4O0NA 1BWEA 1XMOJ 4LF8J 2UXCJ 1H74A 1Y0HA 2P6TA 2CPHA 4HHUA 5U47A 4B17A 2YNGB 3TUJC 3LWMA 2ERRA 4A8FA 4IRCA 1IKVA 2MGZB 1G4CA 1HPZB 1TZ0A 2DGUA 3H98A 4L3NA 3HHLA 3JSBA 1K1QA 2W7OA 2XWYA 4A4JA 4C3KA 1L3TA 5DS7A 4TY9A 3W2WB 4TU7A 3C6UA 3DHXA 1JMTA 3EICA 3LGHA 4KGMA 3PEJA 3J80Y 2ZH9A 3O44A 2QFJA 2UU9J 4J5OA 3M2RB 1AA1B 1YJRA 2DXEA 1SQGA 2E5JA 4LIRA 1AYEA 1EKRA 3LWLA 1NKCA 2Q6CA 4CI0B 4R25A 2E1AA 2NXCA 2WONA 3EGNA 4NI2B 4ZLNA 3M9OB 5DG9A 1YHQS 5E2QA 5A0YB 2B9EA 2XI2A 3ISZA 4X66J 2MJUA 5K8MA 3NOGA 2MZRA 2EFOA 1LW0A 4LIWA 5K14B 4ANDA 3K7RA 4H4MB 1QAIA 2MKHA 4I69A 2QL9B 2W2PP 1RAHB 3GFXA 5GAGI 3E01B 2PO4A 4D3GA 3PV8A 3L7PA 2Y8WA 2V2KA 5K8OA 4DFMA 1IXKA 5E33A 1OSDA 3GIKA 4DL2A 3KLIA 4CO5A 2IBKA 1EETB 1RWWB 2P8IA 4DX6A 4FZVA 5EWFA 2AU0A 1H7XA 1MU2B 3WX8A 3BGRB 4C97A 4DV3J 4DL0C 2KT3A 4OX9F 3CD5A 1FD2A 3MUTP 5KFYA 5FIIA 1TKXA 1XNQF 3CDWA 3Q83A 1C0UB 2ALZA 3W3SA 5KFCA 3PY8A 3QLHB 2GHPA 3SQGB 4WCEQ 3UR3C 1TAQA 2J7KA 2M0GB 4U9RA 1VMBA 2QL5B 1NPKA 1PO6A 4K2JA 4RBTA 3B8HA 3OTBA 2B9WA 4PG5A 2HS0A 5J1EB 1HNVA 1S1VA 4NASA 3U27A 2G9OA 1ZM2A 2GJFA 1H2VZ 4PEOA 1VQ7S 1CS4A 4PWUA 1H0HB 5A2QY 1NHKL 2CQIA 2JDJA 2FHKA 1S99A 4F25A 3H4DA 1SXLA 2FHOB 2RHQB 5H9EK 4WWSA 3MEGB 4DLEA 1T3OA 4ILMA 4PAAA 4ZK7M 4ZDNA 4LF6J 2O3DA 4MT1A 2AYEA 1M1KT 2OO4A 4KJIA 1P1LA 1FDNA 3S8SA 5KG6A 1S57A 2KTQA 2GAHC 2XZTB 1IKWA 2XMMA 2ZE2B 4RW7B 2WHOA 2K7JA 4OFZA 1X4FA 4ECSA 4KE5A 1S1XA 3NWGA 4RW6A 5A0YA 3NLCA 4C8NA 4YEAA 2Q1LA 5KFXA 2RF2B 3MR7A 1BQNB 4X4TA 1CJVB 3MEDB 2QL7B 5HBMA 4IUFA 3CT9A 4OI4A 1WELA 2RUGA 1CJTB 4LRBA 5AE2A 1J5EJ 3GB0A 4OZ5A 4CQ1A 1UA0A 1UW4A 3HSGA 3D28A 1RADB 2DPJA 3DN9A 4G1IA 1RT1A 1KP6A 3CCVS 1S77D 1R8AA 3AD8C 2VICA 2FHMA 3IBWA 2IC3B 2GA7A 2WVFA 2ZNZA 3RW7A 4J91A 3WIUA 4PWWA 5ETKA 3GIRA 1RWPB 3LANA 1U7LA 3D66A 4RO0A 5K20B 3I56S 3BH6B 2RQKA 2IM2A 1EAYC 2AJ1A 1YBUA 2CQGA 2PD1A 1G7CB 2RH3A 1YGYA 1VOMA 3IXQA 3LH2S 3MAAB 3UD5A 2D74B 2BOPA 3ZZOA 2W24A 3MPWA 2ZHOA 2F65A 3W9IA 4ZHRA 1RXOB 5L8RC 2VA3A 4K0KF 2VC1A 1I1GA 3PEHA 2OI2A 1WKJA 2ASDA 2R7XA 1N34J 2RKIB 5IZHA 4YDXA 2OSQA 4CLYA 5C42B 3MTJA 1NK6A 1VS3A 1NAQA 1WI8A 2HLTA 3JQMA 2DNKA 3VGSA 1HWUA 3MM7A 2OTJS 4OJ3A 2PFDA 2EK1A 1SBRA 2HW3A 3MECB 1JXVA 2J8AA 2IC3A 4DR5J 2B8QA 3RAQA 1NSKL 1QVGR 1Q1KA 3CVKA 2HIQA 2EG1A 1YJUA 2P9CA 1C0TB 2O67A 2VPWB 1WUUA 3C15A 4YS2A 3DOMB 2KDOA 4RNOA 1U49A 1WC5A 1Y11A 3MR5A 4J9PA 4ZVHA 1ACMB 2MQNA 3GZ7A 8RUCA 4RBUA 4QR2A 3AQPA 1NJZA 3TJ8A 4DV2F 3RW6A 2DBBA 2M88A 1K9MT 1QUPA 4JI0J 2O5DA 3C66A 4H54A 4GKJF 1C4CA 3OTEA 4IH7A 4NLRA 2IHR1 1R8CA 1RDRA 2CQ1A 3OTOJ 1YI2S 2JEIA 2OIHA 3CB4A 4QOTA 2AF6A 1QY7A 1FWLA 4ZMMA 2V8VA 4OZLA 3DU6A 3MEKA 1JX4A 3QRQA 1NH7A 3KJFB 4NCGA 4CYUB 2IRXA 4H4KC 3TUPA 2YNIA 1ZM3A 4CDIA 2H48B 3RRKA 4LF4F 4NMXA 2KM8B 1HWIA 2CRLA 1U1QA 4C3LA 1Q8BA 4DOZA 3M8SA 3ET6A 2VBXA 4R8UA 3HJFA 4JV0A 3R1LA 3N5FA 3CCRS 1MNEA 1REVA 4YY3F 3HM9A 4AL6A 2H5EA 1MG7A 2AZ1A 1TKZA 2MKCA 2O66A 2FJBB 2YNFA 3D68A 3OLBA 2RT3A 3KK3B 3CC4S 4IO9Q 1TL7A 3ILLA 2N4CA 4U95A 2XLJA 4F4ZA 4ELVA 2UUCF 1P9YA 1GMUA 5KT6A 1C4AA 1NDCA 5F3ZA 3QJPA 1GMWA 2OPSB 3NEKA 4IQMA 4M5MA 1UFKA 4JB8B 1O6XA 2D3OR 3B4DA 3IRWP 1WWHA 4RNHA 4I1TA 3UQSA 4RKUC 4AXIA 4CNYA 3UPFA 2DNNA 3TRGA 3ZC4A 4DV3F 2VONA 4QIEA 2R9LA 3LQVA 2R7TA 2CJYB 3H5UA 2BQRA 4B3RF 2XCPA 2SXLA 1LQ9A 1RHMB 1EKSA 2QRRA 5KG2A 1JNRB 3TNVA 4QR1A 3VAHA 1L3VA 2VV5A 2VC0A 3BSOA 3H90A 2C2DA 3DI6A 3BR9A 4P10A 4DR2J 4J7CA 1WC4A 4U8YA 1Y5LB 1Z2LA 3ENAA 4DR5F 2R7VA 1U4BA 3CSKA 1SQEA 4I6AA 1F3VA 3U7JA 1XMBA 1GTHA 1PJ6A 2UU9F 5ETSA 1GAOA 3QSIA 1FFSB 1OPIA 1KLMB 1HBOB 2KXHA 4OYZA 3JTNA 2LECA 1FWKA 3ZZRA 3QZ7A 5DGAA 1FI4A 3F0NA 1Q95G 4PKDB 2GAGC 3JSMB 4X66F 1R3NA 1UCNA 1KN6A 2VFUA 5BR8J 3Q8SB 1S0OA 1SKRA 3NMAA 1FFWB 1X5PA 3ISND 2IM3A 3MM6B 5D15A 4DS5A 1FVSA 1GT8A 3DFEA 2J7WA 3CCWA 3THVA 1G1XA 1S79A 2CQ0A 2EVZA 3LP0A 3VAJA 1U1RA 4FPRA 1N33F 4R0JA 4IR9A 5J2QB 2BW7A 2L9NA 3KLIB 3AHPA 4DV4J 1IBLF 3EDRB 4MK8A 3UW1A 2NZCA 3IRXB 2HNYB 2EBEA 2DCLA 3HKZD 3IR5B 3M30B 1S9GA 1Q0NA 2VL1A 3QGGA 4NCAA 3RB0A 3MUVP 2IMOA 1QAXA 3KJVB 1HBUA 4CLZA 1U2FA 2ZM6F 1RTJB 4FYDA 5GMKa 4LFAF 2RVJA 4XK8C 2KHDA 1KDNA 3HK2A 4C6AA 3VQTA 4TY8A 3F73A 3CULA 3PW4A 3R2DJ 3KLGA 2BJ1A 5K8PA 2V4QA 4OV1A 2H5JB 4FF2A 4ENOA 1CJKB 2PC6A 3ILOA 1Q7LB 1HHQA 2FIUA 5EHHA 2E29A 4ECWA 4MYUA 4F4KA 1SIWB 3MPDA 4HEA9 4A8XA 5A76A 4Q44A 1UP1A 1IKYA 3RGIA 4BC9A 3LAKA 1NJYA 4M94A 4QQBA 1LWEB 3R6LB 4C8ZA 4C8LA 3QWPA 2WB1D 5LJ5Y 1XWLA 1S5ZA 2XY5A 4NCBA 4NZ6A 1YTYA 2XC9A 1WHVA 3M8ZA 2YVSA 2FYXA 3CC2S 1Y3KA 4HDGA 4LRFA 3W65A 3HKWA 3DNCA 2Y0BB 2ZHBA 2GVDB 4FP9A 1IR2A 2DR8A 3MOZA 1YLXA 1O0PA 4NYZA 3EZUA 4K4YA 1SUQA 2LFVA 2WSEC 2VBWA 3BPDA 4PXBA 1AROP 2BKOA 2CDRB 1VLOA 2YKOA 4ZIVA 2WVDA 3PCOB 3MMBA 5K8NA 1RT7A 1Y5IB 3FFIB 2NXNA 3R5GA 4C48A 1Y9OA 2BACA 3VF0B 3L3CA 3TW0A 1FRIA 2XZDB 2CJQA 3OPKA 4ALZA 5F0UA 1GMVA 3L7UA 2FVPA 2GHVC 3VWSA 1QSSA 3RRGA 5JXSA 3SXLA 1KLMA 4FNHA 1VC6A 4JI3J 1KQFB 2XSFA 3MD1A 4N41A 2DNOA 2J9EA 3SV3A 1FKAF 3QIDA 3M1VA 1N34F 1ULRA 1G2EA 2IBOA 2BM0A 2EFGA 2B0GA 5GAHU 5ETRA 1U0HA 2ZD1A 4RUAA 4KKOB 3BKUA 4OJGA 2J6TA 4P9SA 3UCZP 1RJJA 3GIJA 2W7AA 3IG1A 2VUGA 2LDYA 1TL1B 1GX5A 2B4VA 4MKYA 4DQIA 1MROA 2C2KB 2KVQE 2CQ4A 1SV5A 3E3XA 5C24A 5IQQA 2KG0A 1YIJS 1FJEB 2W4DA 1PAUB 3D9BA 3UFCX 2R42A 5IS2A 4P74A 3R5DA 2V2QA 1VIXA 4C11B 4QZVB 4CLWA 4A8SA 2HHXA 1X4BA 2YH1A 2DRAA 2UXBJ 1FRLA 2CPEA 5HJXA 2XQCA 4F2RA 4DV6F 2NUHA 3KLGB 2XB2D 1FJGJ 1K0TA 4I7FA 1ELOA 3ZZZA 2HNYA 3BSNA 2HQIA 5KFWA 1N8RT 1RT3A 4BC7A 3M6XA 4KIAA 2YNHA 2CJKA 1T9VA 3NGKA 3P4UB 3K59A 2CJ9A 1T11A 4X4NA 3EJMA 1AZSB 3GG0A 3MDFA 2H4WB 4IFYA 4NLDA 4R5PA 3QWUA 2ASYA 2OEMA 1TL1A 2FJAB 2DB1A 2MZTA 2WW4A 1AUDA 4B9UA 2YX7A 4DFPA 2FLPA 2KT5A 4CCHA 1R8HA 3HSZA 3SDEB 5KG0A 1RKIA 4U6PA 5DDQC 3KMQA 5F8HA 1JNZB 1R89A 2CPZA 2DCUB 2X1BA 3UN5A 4YMEA 1I6JA 3EGVA 1BHNA 3ILIA 1PJ7A 1RSCA 3JSMA 1S1TA 3GSIA 1EJ7L 4QIWD 4F04B 3M9NB 1S9GB 3A8JA 2QZ8A 1IM6A 3SFUA 4MYTA 4KPYA 2DD8S 4B02A 4ZVPB 3CO9A 3KHLA 1IBKJ 1U8SA 1F0XA 2FGCA 2LLZA 3PACA 1XN9A 2OSRA 3O5TB 1M5OC 2GVZA 2VG6A 2Z2MA 4M5NA 4ES3A 1CJKA 3KG0A 2EFVA 4HHHA 2PT0A 2HNZB 2HFUA 3MM6A 3RBZA 5KT4A 2DPIA 5F9LA 2BYCA 2L48A 3Q86A 4ZVSB 3OJUA 3QFHA 2VIHA 2K2PA 4GO7X 3D6FB 1KBRA 4WFZA 1KFSA 1TVRA 2VOOA 1FRXA 4ZP8A 2DNGA 4M5DB 3B6BA 4CNZA 5DM7Q 3TWZA 5L1JA 3NCPA 2WVEA 1S1UB 3QQCD 1BE4A 4O3NA 1FJ7A 5ETVA 3GYGA 5DETA 4JI3F 3W8PA 1F3FA 2H3EB 1LWFA 5IC6B 1VRUB 2DH8A 1URNA 1JLAB 5GAHI 1D3WA 3MCOA 5AXMA 2ZVIA 5KTQA 2V4JB 5KFPA 3G6YA 1NZ8A 1RISA 4IFVA 1RLDA 5ITHA 1F2HA 2FLLA 1AUSL 4OZ1A 5A8KA 3AFGA 3CCMS 1XEZA 4MFBA 2C2ZB 3CUNA 3B82A 4NEYA 5DDRC 3CGIA 3CJ5A 4CLSA 1ZOTA 3M7VA 1UVJA 4FF3A 1MMDA 3NRBA 4OYMA 4DPXA 1WDDA 5T41A 1RCXB 5AJ3J 3CC7S 1AFJA 4UT4A 5B0GA 4Q7AA 1Q4RA 1B99A 1UWBA 4QYRA 5B0AA 4UOFA 4DPOA 3KWMA 3G96A 1SV5B 5DRKA 4PG7A 3C15B 2VPXB 2ZUGA 4NEZA 2ZH4A 4ECZA 4EEYA 4QCLA 1D8ZA 5G0RA 3C2PA 2DGXA 4DSLA 4IH6A 1CG2A 3DRRB 2OH2A 1RU1A 4NLSA 3HVTA 3UN2A 2HRUA 2ZH8A 1J5OA 4RUBA 3PKMA 2HVIA 4I7FB 5HJYA 4FNIA 3TA0A 3CW2C 4NA2A 3EGZA 1Q5VA 2MDAA 3BGLA 3GR1A 3QPIA 2EC2A 4JI2J 4NL5A 4O3QA 2JVOA 5CAAA 4ZPBA 2VASA 2G1HA 1UVIA 3Q23A 4F50A 3RR8A 1UWBB 2HZAA 3A8EA 3X1LB 3OW2R 1JJHA 1KS2A 3KJNB 3M32A 2QLBB 2YKPA 2BE7D 3O1LA 1SC6A 2J5AA 5FDLA 4PABA 4EBEA 4JI4F 2DGSA 2AWZA 2XMAA 2J9CA 2WOMA 1YSJA 2QLFB 1QUVA 2QT7A 2VFSA 1XR5A 5CQGA 1WEXA 4B3TJ 2QLWA 5SZTA 2KJVA 1F5CA 3GQCA 1NK4A 1H7WA 1Y4ZB 2J9DA 3F56A 4JI7J 1DHMA 2IVYA 4C8MA 1Y7PA 1RTIB 2BJ3A 2CIMA 4LUBA 2XCAA 4KFBB 1IWGA 1SJQA 3HVRA 1RABB 4GMKA 1N52B 3S1TA 2J9DE 2RRAA 3BPSP 2U1AA 2RF2A 1S1UA 2XM3A 3DKDA 3H0PA 3L9ZA 1HKAA 2XZWA 3QBCA 3X3UA 4TYAA 5ETMA 2PI4A 1KTQA 1HI1A 2JLEA 2MPUA 2B56A 1XERA 5DLGA 4J9LA 1REVB 3Q8PB 2Y1IA 1CJUA 2JFKA 2ROEA 4NYPA 5IFMA 2MQPA 4P6QA 2NYHA 1RWNB 4ZP6A 3M8WA 4QWBA 2UXBF 4YR2A 2DEIA 1AZSA 4R5PB 3SSRA 5F8GA 4GRSA 1PGZA 1HBMA 2B4PA 3VZIA 2KHCA 2RE1A 3FDSA 3ZZTA 5IM0A 3FMWA 1YJ7A 4WYLA 2DNLA 3SCLE 4M5KA 2VQEJ 4IOCQ 4RUCA 2BKPA 3P96A 1ITPA 4N5SA 1WTFA 3H5YA 5C42A 4S0MA 4YUDA 1D1UA 3KDOA 2BBEA 1BLUA 2F63A 3BF4A 1KQGB 5HMXA 1H98A 3V2UC 1XNRF 3GSDA 3ZTSA 2OLWA 4OZJA 1V3ZA 4F3MA 1S59A 2W4CA 3AB2B 4L74A 3OR1A 5BJRA 2KB2A 4LJMA 2W7PA 5LSRA 2DRBA 3CNQP 1Q53A 3AQOA 4G1QA 4F67A 2AGOA 5CXTA 1WOOA 4ZCKA 2Z2YB 3GILA 1NSPA 3TEHB 4OIXA 4UY8T 3PG9A 4DSEA 1UJ5A 1K0VA 3SSQA 2AIRB 1A9NB 3CJ4A 3AY0A 3DRXA 4I56A 2OEJA 2XHCA 4K5RA 4L6V3 3HFKA 2W4PA 2MQMA 3R5CA 1EHWA 4ZPDA 5JJBA 2EKNA 3D6TB 1K1SA 4OZ2A 3AD7C 3J7Z5 4DV7F 1LXJA 5DLFA 2CJBA 3DRSA 1PBUA 4HVZA 2EXUA 3PXGa 3MM7B 3PZPA 2AQ4A 2UXDF 4WPAA 3JQKA 4CO4A 2CZ9A 1TL5A 4DZDA 5L9NA 4P7VA 3T1HF 5ETTA 1L5UA 4P2XA 2V2VA 3OLAA 3R1HA 1RBOB 3EDQB 5DDPC 3HD2A 3GJRB 4F2SA 4ZJQA 2BM1A 4JI5J 4CO1A 1KNZA 3OR1B 3OXGA 3A12A 4Y2MA 3MTKA 2V67A 5F0WA 2C2RA 3Q2TC 4B3MJ 3ZZUA 1ZZNA 5KG1A 3UCGA 3W5ZA 2ZHAA 3J81U 4K4ZA 4XO0A 3M8RA 4Q0BA 1HA1A 3QLHA 4O4GA 1S7IA 2XHWA 3W7BA 1NBEB 2AGPA 4KGVB 3K57A 3JSRA 1U47A 2LXFA 2YKAA 5J1PA 4F4WA 2MQQA 3C14A 3D0IE 3MMCB 4FYVB 2F4VF 2AJ4A 2YNFB 2WK4A 1IKXB 4ZVOB 2XLIA 1HHTP 3K17A 4KQZA 4AUKA 2UVWA 3D6MB 4OYIA 1YWXA 2HZCA 1LXNA 2WVBA 3W5YA 1T3NA 2HYIB 3DXBA 4WE1A 4Z7YA 2D9OA 2QA1A 5LMNJ 2R2SA 3HHKA 2AEJA 3NS7B 3J7AN 3P45B 3QMQA 2N7YA 1AXQA 1CBKA 3A4TA 3O6QA 5M2RA 5HQLA 5K5MA 3FCWA 4NXMF 1SH2A 2MZJA 1CEZA 1Q78A 1Y5NB 2VB6A 1IJEB 4J9OA 1Q8KA 3VHQA 4DBQA 2QFIA 4MKAA 3DOLA 2MJNA 4CRJA 2HFSA 2HKEA 3SBMA 2DXDA 2FHJA 4X62F 5KFZA 1SKWA 1CULA 4KBIA 1ZYQA 1M5PC 3QIPB 4KPCA 5B0DA 2B43A 4A8WA 4FYYB 2WBMA 3A8KA 3PYFA 3DU5A 2HHUA 3RB6A 2F8HA 3G82B 4YHHF 1WHYA 4U7UD 3FEZA 4OI6A 4EU0A 1RA7A 3BB5A 1KKHA 5AXNA 1WI6A 5DGBA 5KFIA 4WFNQ 4CIOA 3IS9B 2UZAA 4RPFA 3H59A 2WONB 2GCFA 2JC1A 2BABA 4OZ0A 2R2UA 2R8IA 3TI0A 4IG0A 1VC5A 1HQUA 4ELTA 2E5IA 2BZ2A 4GKKF 2A6MA 4CO0A 4YB1P 4TKTA 4TYBA 3W9HA 4NRTA 3QJJA 4HHJA 1Q8LA 1VQNS 2GO8A 3MECA 2NZ4A 3IWXA 4C98A 2MYFA 3VZHA 4A8YA 1QM9A 2F3JA 2V6AA 2I5JA 1RAGB 4HR2A 4OYXA 3TVYA 3GFHA 2DR7A 3MUMP 1S6QA 1SJ1A 1ICEB 3H5SA 3GCXP 4X4RA 1RTHB 1K47A 5KT2A 4CM2A 3I82A 3LGNA 5HP1B 5IT9U 4ZPCA 1A7GE 2QV6A 2M4MA 4ZP9A 5J2MA 2PEBA 1FXDA 2O1PA 4FKXA 1Y3JA 3CIMA 3IS9A 4OLPA 2UUCJ 4QJVA 1S76D 3VQSA 5HAOA 4WP9A 5D4PA 4DU7A 3L95X 3SCIE 1X7VA 3HFVA 2MGZA 4OYWA 1GX6A 1SJFA 4H4MA 5AT1B 5K14A 5KFDA 3QZ8A 4C8KA 3HULA 4LSZB 2B6AB 4DCPB 4AQYJ 2H4YB 2ATLA 4LQ9A 2AEMA 1ZETA 3US5A 4FN5A 4ZVUB 8AT1B 4ECXA 1VC0A 2X1GA 4AFFA 2Z2LA 3LAMA 2QIFA 2B4UA 3AT1B 3G8SA 4OYOA 5J2QA 1OS5A 2C3UA 4BLGA 3HT0A 1WF1A 1S4FA 5HN0A 4DHVA 3J7YI 2FZKB 1F9HA 1RU2A 1LOUA 2CG8A 2C28A 2AYBA 4B3RJ 4DPWA 1OY6A 5KFQA 4LF9J 4NE9C 3CIZA 2F4VJ 4KY3A 3LF0A 1FRMA 2ZKUA 1TUGB 1FRJA 1HFEL 2VH7A 4ZLLA 1T05A 2HWIA 3MZIA 1RAJA 2MKKA 4J9SA 3T5HA 1YJ9S 1S6PA 2J8SA 3NXZA 3A13A 3U02A 3SCKE 2Z56B 2RU3A 4KV8A 4KC5A 1KONA 2YY3A 3TJ9A 5LMNF 4M5IA 1U09A 5EWGA 3TX8A 3NS6A 5GADU 3VTIA 4DZ6A 4L73A 4CTAA 2DR9A 1HI8A 5H9FK 2ZEJA 4DL6A 3SI8A 1DURA 2BRKA 2MLZA 3OFFA 1YITS 4QPTA 4Y2IA 4IO1A 2ZH1A 4DFJA 3OVAA 4RZRA 1U8WA 4JI8F 4HI2A 3VCDA 3KMSA 3BBCA 3OXFA 2BR0A 4Y2CA 2AX1A 2DH9A 2EFNA 2V68A 3N01A 1N6QA 4P2SA 1I3OB 4J9UE 4ED4A 3TYTA 1HI0P 3MWBA 3R3TA 2C3OA 4K50A 4NLPA 1UW9A 3MEEA 2NXJA 3CDBA 3KXDA 2P5VA 1VQOS 4USHA 4JI1F 2GIFA 4ZJOA 3TVZA 4DX5A 2AT1B 4B08A 2RDDA 1U1MA 3N6MA 1NSQA 3D4JA 5KG5A 3DLJA 3MAAA 4GKKJ 3M2VA 4LR8A 2Z2ZA 1RT4A 3GV7B 1V9OA 2YQ1A 5LSLA 2B6AA 4F36A 2UXDJ 3GFYA 4ZOSA 1TUVA 4TN2A 2RKIA 4LRAA 3RUBL 1IBLJ 3ENQA 8ATCB 2FDNA 2F7VA 5DJBA 4P52A 1X4DA 2CPIA 1Z4UA 1RT2B 1RT5B 4NMLA 2G2ZA 4PXDA 3A3OB 2NYIA 4Q45A 2HHVA 1HMVB 1OQ3A 2LQ8A 1FKPA 4YR3A 4B9MA 2KU7A 3LP1B 4ZIWA 4WFBQ 3CJKB 3P6YC 3I9ZA 2OFHX 1H38A 2J0WA 1HIYA 1H6KX 3CJRA 4RNMA 1SIZA 2L9WA 5D78A 2I9SA 1QTMA 1BQMA 1OYDA 1HWJA 2XI3A 1KVKA 4FXDA 3W66A 1SI9A 1IKVB 9ATCB 3M8QB 5AE3A 3MFHA 4CLLA 2HLUA 1U25A 1R7IA 4DF8A 1EP4A 4RNFA 4OI1A 1W25A 3C6UB 3KK2B 3KG4A 4P73A 3PYDA 3UNGC 2DNMA 3DDNA 1IBCB 2B7CB 1TTHB 3QATA 1VRUA 5KFJA 1N32F 2CAJA 4F4YA 2F8MA 1HR0F 3POTB 2ZWPA 4JOUA 3RB4A 3KLFB 2ZBQA 1NO8A 3GG1A 1UJ4A 4X4PA 5I3UA 1SC1B 1TL3A 2IAJB 4PQAA 7FDRA 1N88A 2OPPA 3KHHA 2X51A 2V0NA 3MAHA 4X84A 4TQSA 3CCUS 1HNWF 1UPMB 2KH9A 2F9JA 1VR6A 2OKQA 4URQU 3FBBA 1M5SA 3T1HJ 4WZQA 2QE5A 4WXWA 3M2UB 3VR1A 3ITHB 1LK7A 4DSFA 3PW5A 2R2TA 1S49A 4ITSA 2PGCA 2P9GA 3DOMA 5LT5A 5ETPA 4I2QA 2RILA 1LW2B 4DG1B 5CA5A 3CXCR 3BQ0A 3I0RB 3CCJS 4NLQA 4LF5J 4AE5A 3K2YA 5GAGU 3BM7A 2DH7A 1VBXA 1HD0A 2OPQA 4AL7A 2M52A 2VJVA 1RYSA 1TP7A 4AXJA 1D8YA 3TAMA 3J80U 4ICLA 1XMQF 1P9QC 1S1TB 4KGXB 5A6PA 4G6VB 3R8YA 2PFFB 3PTWA 1BUXA 4M8LA 4JUZA 1BGXT 3I0SA 3BEGB 2A1BA 3HVTB 1XIQA 4MK7A 4TLQA 3J81Y 3NS5A 4F4XA 1D0EA 4DSIA 4LMZA 2GMJA 3PHTA 1EX8A 3THTA 3KLHB 2CQPA 3HSDA 1QSYA 1KLNA 1E6VA 4PG4A 5D0GA 1RTIA 2NPFA 2C3YA 3D67A 2W8KA 2XNRA 4L75A 5L1LA 3U1MA 3NL0A 4ZLJA 1FEHA 1R6YA 1LWCA 1SPBP 2FC9A 2OPSA 3M32B 3LALA 2BX6A 1DTTA 2WOMB 4KRWA 5KT3A 3CJKA 3HHLB 4J90A 1PKUA 3EE3A 1RUSA 1C1BA 1BC6A 4DV6J 1GQEA 1UWAA 1VBYA 3QRPA 2XSJA 3MFIA 2JLFA 3I87A 2UUBF 5LXYA 2UUAJ 4OI2A 2W9BA 1BQNA 2D7SA 1DJ0A 3HLUA 4O3SA 1N33J 2OPRA 1Q86T 4EO6A 2RDJA 4CT8A 1FHTA 1GTEA 2IYGA 2VKZG 3TVKA 4AYBD 2KJWA 3KNAA 1E6VB 2G2OA 3U1NA 3D2WA 4ED6A 1RT4B 2DGWA 2DITA 4YN3B 2M5YA 1NHVA 3R97A 3UVJA 1U0HB 2ZD1B 4MFBB 2ZZNA 1HHSA 3C16A 3Q89A 4HACB 4DEZA 4K4XA 3K0JA 4PWDB 4C4WA 3FGVA 4V19J 5D4LA 2YNIB 2IDEA 3ZZPA 1B3TA 1HR0J 3MPVA 1T95A 1JLBB 1TV6B 1LWXA 2YWEA 1B0PA 2OPPB 1SVDA 1DBDA 1QTNB 5HI7A 1SH3A 2E7XA 3G8QA 2RS2A 3R6GB 1UPPA 2DK2A 1YQHA 1CPZA 3CJ0A 3KKFA 1IQTA 4DFKA 1OY8A 3AB4B 1ZAWA 1LW0B 4P71A 1NK0A 2FVQA 3M6UA 4WXOA 3TZZA 4HI1A 3M8YA 1VQYA 2O01C 5L46A 1M1HA 1L3UA 1ZTWA 2CQBA 4MJKA 9RUBA 1HBUB 3T5LA 3AODA 2MKYA 1UZHA 3H20A 3I6PA 2BOAA 3B4MA 1D09B 2BA9A 3K5LA 2E1CA 2YWGA 4KH1B 4E0DA 3D1OA 5ADZA 4HH1A 3DLKB 4NZ7A 4Y2KA 3N9UC 2QSFA 1RTJA 2NSCA 2HGLA 1HWKA 2GIQA 2LEPA 3K58A 2IM0A 4H4OB 2PSZA 3DLEB 3TOQA 4LFBJ 1OO0B 5EX3A 2DRDA 1RT6B 2HFOA 2GGPA 2G0CA 3FSYA 3SDEA 2YTCA 1WF0A 2MZSA 3DGPB 1IKYB 4A8KA 3GU0A 3HVAA 1X5TA 1REGX 1VQ9S 2UVRA 3CJ3A 3KFWX 1HNIB 1WEZA 3DHWC 4GVBA 2JEJA 2I1RA 4LBPA 3OSPA 4ECUA 2RIJA 4MIAA 1S4EA 3NGUA 4TY8B 3GPAA 4Q8FA 2IPOB 4I6YA 4P75A 2CJXB 3G71S 1ZZFA 5DG7A 4X64J 2W2QP 3AD9C 3HP6A 3ZFVA 3MMJA 4DQRA 4HL9A 1RYRA 3F44A 4U67Q 1RGVA 1OPZA 1BD6A 3UVJB 1KC8T 4K4VA 1KVIA 3CJ2A 1VBZA 2HQ3A 4UY85 2OP5A 2XO7A 1I5OB 1WHXA 4C0BA 1FX2A 3KLHA 1LWEA 3FZ2A 4DS4A 3NNCA 1IN0A 3UN3A 2DNQA 3IAM9 4LRDA 3OHBA 3MM5B 1V3RA 5D0EA 5MLCV 3J7A1 4KHPJ 3POTA 4TNOA 3VGTA 1FKOA 2YKMA 1JJ2R 3E8OA 2HQDA 2MKIA 1N5YB 2Z8QA 2H5IB 1RI7A 1S6UA 2CPYA 2GVDA 3FUYA 3D1QA 2POKA 3I4HX 2DR5A 3TX0A 4RUHA 3DLLQ 1N5TA 1VRTB 5KG3A 3GV8B 4I2QB 4B9TA 1F2GA 4QIFA 3KTQA 5D8HB 5DQIA 1C2PA 3NGRA 1KOOA 2BJDA 4DDFA 1Q5YA 4DL3A 1N48A 2ZJPQ 3ITHA 4F7VA 2HG4A 2M9KA 2OPQB 1DRZA 4NZ0A 4A46A 3HT3A 4B9NA 2VJUA 1VFJA 1N36J 1HQEA 4PWDA 1UJ6A 3OHAA 1LW2A 4DG1A 3JYTB 4WU3A 5C24B 3PR4A 5I42A 1P6TA 3M30A 2EFPA 3UNYA 2QMXA 2WSCC 5C2CA 4J9NA 4MIBA 1T03A 5L1IA 2ALYB 4UOCA 3T5KA 1SJRA 1JLEB 1KHWA 1ZA1B 1N54B 1E6YA 3G9CA 3QFWA 1NZAA 5D6GA 3NBPB 3ZNUA 1SL2A 3M1VB 1IQZA 1RHJB 1TL4A 1RB0A 1DQ9A 1VQPS 4HH0A 5KFRA 3NAIA 3AOBA 1S9FA 1TR0A 1IBMJ 4IH5A 1GH8A 1JLQA 2CNOB 2AYMA 2R2RA 1EQ0A 4OL8A 5LM7E 4WIIA 3OSNA 4Y34A 1UVKA 2R7SA 4K7QA 4CP5A 1TAUA 4DL7A 1HBOA 1ZH5A 1CQMA 1VI7A 2CZVC 1YRXA 3ETOA 3NCQA 1XQIA 4NCGB 4CYUA 4PYAA 3FSIA 4FVCA 4C8OA 4F26A 1L3SA 3TANA 1AT1B 5CHCB 3ENWA 4U8VA 2LQBA 1V5IB 2ACMA 1KHVA 1UFWA 2LVWA 5M2PA 5IT4A 2GW8A 2UP1A 2UVVA 6FDRA 3PHEA 3NG8A 3NNAA 1RACB 2X3DA 2KZZA 2V94A 3OTOF 3PW2A 4DN9A 1DQAA 2CYYA 1OQ6A 1S7HA 3HHDA 1ZM9A 3NOCA 3AA9A 3T9ZA 3BSAA 3ZNJ1 1B0VA 2E5GA 1G3OA 2VF3A 3BBBA 4CH0S 4QPXA 1MSWD 3LP0B 1U1KA 2HHWA 2RRBA 3DXSX 4ZN3A 4DR2F 1JLBA 1RHUB 4MK9A 2ABYA 5AXKA 2MQOA 2ZJQQ 1Q81T 1WC6A 4R8UB 4LF4J 4NOHA 5KFTA 4J9MA 3ENVA 5T7LB 2V5HG 4RWWA 2XULA 2ZBIA 3DLEA 3EZOA 4QIVA 4KH0B 3MF5A 2NUUG 4O4GB 3W2VB 2CQCA 1BY9A 4NLXA 2XGPA 2AW0A 2LA4A 1O5JA 3CDAA 4HTIA 4OI3A 3UDVA 4DV1J 4EZ6A 3B54A 4C0OC 2EW9A 3JAMY 4JI4J 5HROA 1TU0B 4N8OA 1N6QB 2FJDB 3DOLB 3RYLA 4RU9A 2VFRA 3FQLA 2H1YA 5HVGA 3PX0A 1X60A 3V4MA 3SCJE 3I0SB 1RHKB 3AXKA 3KG1A 3UCUP 4K0KJ 3RBXA 2Q43A 1U2RA 3NAHA 3BQ1A 2FLNA 4RW9A 4ZVGA 1T7PA 2I8EA 4DSJA 4W92B 1HLWA 1M1GA 2E9RX 4CTAB 3IG1B 3GR0A 1JQGA 4IRDA 2EI5A 3DGPA 4LT6A 4EBCA 2D69A 3I5CA 3BYRA 3H7HB 2QTWA 2YPYA 2FUG9 2DY9A 4QWCA 2QEXS 2CPJA 3GONA 1FEEA 2DHHA 4DV4F 2X1FA 1S0VA 5HMZA 4USWA 1IJFB 2APOA 4LF7F 3FK4A 1BMQB 1NDKA 4MTPA 3WC0A 3ZZ0A 4FS2A 2F1FA 3W62A 5GADI 4MIWA 3GP9A 2H51B 1UEUA 4L76A 2IA6A 3MCSA 3BO4A 2FZCB 4IOBA 2LCWA 3TAPA 3ZZYA 2RQ4A 2AJFE 3BKTA 4KR0B 5A8WA 1HQUB 5L1KA 4J37A 1IR0A 3DM2B 3TQ1A 1LK5A 3HZEA 2JX2A 2FD2A 3FBFA 4OHXA 4CM0A 4I2PB 4E2FB 1KD1T 1I94F 1NK7A 1C0TA 1U6BA 2YWWA 2ZBRA 1R8BA 1U02A 2VPZB 5KT5A 1HBNA 2QMWA 3EM1A 4NA3A 3S01A 3OQ2A 5CYQB 3O2IA 1F6TA 2GIRA 4QBUA 4HT5A 2VG7B 1NDPA 4NPOA 5HO4A 1FJCA 2HIYA 5KFEA 4ES1A 1DTQB 3RBEA 1CLFA 1X4HA 4YHHJ 1S10A 2W1BA 4Y3CA 2R8JA 5KFKA 3LW5C 2VDIA 2IM1A 3KDNA 4USVA 1VQSA 4DV7J 1WOSA 3BYPA 5B09A 5M2UA 1GK8A 3WQPA 1X5SA 3GTYX 4QU6A 4ZVQB 1OSCA 5SUHA 1K44A 5D4NA 3EXCX 4LR7A 3Q8YA 3EVWA 5H9FJ 1A6LA 1W7WA 5A8RB 3G6ES 2BANB 4FBTA 1VBKA 2JSXA 3W2WA 4AD6A 2E5LF 2EKYA 4TQRA 2KG1A 4LFBF 4DQQA 2A0FB 2Z57B 2PMHA 4B3MF 1U1PA 1EIYB 3EVMA 1X8DA 2KYXA 2QJ3A 3MMAA 3HSJA 4P7TA 2BW2A 3MHYA 4W98A 3PNIA 5F8LA 2BQ3A 1QSLA 2WW8A 3QGHA 6AT1B 5KT7A 3UDLA 5KFAA 2HHSA 1RHRB 4F02A 1TK8A 5E3AA 4IYQA 3MXHP 5GMDA 3VV2B 5RUBA 2DHXA 5HROB 2GQ2A 1M5HA 1WORA 3MR2A 4C7QA 1YVFA 4X2BA 4FYXB 2DHSA 1FCAA 1MMNA 1S1VB 1U24A 5HL7Q 3HHNB 2FLOA 3R5AA 2IVFB 4F0KA 2EFQA 1D9AA 1YKWA 5HMYA 2E44A 4LSNB 5F41A 2AV5A 1FVQA 2J76E 2RJZA 1R27B 2RHSB 3IGVA 4I0WA 5B7WA 3VAGA 2R8GA 3HX9A 4LF9F 3GCWP 5LXRA 3DLBA 1B4SA 2DEJA 4JBCA 2QYGA 4M5JA 3WIVA 2FZGB 2D3ZA 2XMJA 1BQXA 1HYSA 1FJGF 4YB7A 3K5MA 3BKFA 2M8HA 2C1EB 1FTCA 3HVWA 3LPEA 1CSJA 5IV3A 1YDLA 2HGMA 4AT1B 4Y0FA 4NXNF 4EFAC 4KO0A 1R43A 1KFDA 2JWNA 4DPUA 3TZWA 2AD9A 2UV8A 3LTOA 1MW7A 3K8VA 3AA8A 4PZVA 4DR6J 5J2NA 5IT9Y 1GFWB 2H9ZA 3WBZA 5H1SV 1X9WA 3AJ2A 3OL7A 4PPZA 1ZAXA 2MSTA 3C16B 3GIIA 4UOGA 2VHGA 3CJ8A 2FC8A 3Q0AA 1S0NA 1RWXB 4WKYA 1RKJA 4OX8A 3C46A 2KI2A 1IKWB 1JLGA 2ZE2A 4RW7A 3H4BA 2K3IA 3EYZA 3JB9k 1Q7YT 4QYZJ 3IBCB 1BXNA 1NPRA 4FF4A 2YXLA 2Z30B 4NX9A 5ETQA 1S72S 2EC0A 2QMUB 1BWVA 2ZM6J 2JZ5A 3OR2B 3E51A 1AFIA 4M63A 4LBHA 3AJ1A 4ES2A 4ZCIA 4OHWA 3VAIA 2HVZA 1WD6A 2B3TB 4DXLA 3PRBA 4NA1A 4XAKA 2BRLA 1NK5A 1NRKA 4WTYA 1SKUB 2QX0A 3UDEA 2XEXA 2CQ3A 3CJSA 4G1QB 2OAUA 1U1LA 5F8JA 1JJCB 2AJ2A 4P2FA 2K1RB 2MY8A 3HF5A 2V63A 1AB8A 4F3OA 1HBNB 1U6FA 2GJ2A 4J9RA 2F9DA 4ED3A 4Q43A 2MHNA 2IA0A 1NNDA 3T1YF 5F8MA 3OT9A 4MKVA 1ZPVA 3A3PB 1FNXH 4K5SA 5HQ8A 4OX9J 3ZTOA 1XNQJ 2HZVA 1S97A 2BJ9A 2YWKA 2EG2A 4B3OB 1YRUA 2HBZB 2DNRA 1URRA 2JL9A 4LF7J 1CQNA 3NNHA 1ZS6A 1TK5A 3MD3A 5EUHA 1IKXA 4Q2LA 1HNIA 4GVBB 3IO1A 1NKEA 3MEEB 4DMZA 3TEGA 4Q8EA 1T9YA 2F4FA 2RD5C 2XG8A 3QT5A 3IWLA 5JUMA 3HPOA 3M9MB 1UZDA 4D3HA 4DR7F 4LVNP 3QO9A 2GC8A 1YG0A 3FJ2A 2GGPB 2DNZA 1TMMA 3ETMA 4DR1J 2HFZA 2NXEA 6FD1A 5DQGA 2HBQB 4H4OA 1MU2A 3U1LA 2QLXA 3J7ZT 3Q22A 4DF4A 4I6WA 5AJ3F 2X7IA 1SC4B 1EETA 2ZJRQ 4N8NA 2Y8YA 1DARA 1PG5B 1T9TA 2RNEA 3WDOA 3MEGA 5J2PB 2ILZA 4USJC 2OFGX 5HLFA 4DPTA 3S6EA 2LXUA 2VG7A 4CWBA 2PDAA 2ZOGA 1CULB 1PILA 2L3MA 3MMAB 2K06A 3MPUB 4ZP7A 3DC2A 3EXYA 4LF1A 3EVOA 2PA3A 5F8IA 3G82A 2LDIA 2D9PA 2BEFA 1MWYA 3OJSA 3WC2A 3MM9B 4OZ3A 1WG1A 1NKBA 4TU8A 4DL5A 3TJAA 2IMWP 1VK8A 2BANA 1UVMA 2B9YA 3DRYA 4KKOA 2ZFHA 4PPDA 4KTQA 4ZN1A 3C3LA 4PRFA 1VJQA 2K8GA 4EO8A 4DR6F 2FTRA 2QSWA 1U2CA 3W2VA 3DOKB 2OELA 4O3OA 5FJ4A 2MQ8A 2PMWA 5FLXU 3W8GA 3MPYA 2J7UA 2ZVSA 3KK2A 2E5LJ 4NXNJ 1FRHA 2XMKA 5I4MA 4XPCA 1N5YA 3L09A 2CQDA 4K4SA 1FKOB 3AOAA 4DX7A 2OEKA 4YY3J 4JV2A 4O3PA 3M2RA 3FMBA 2FJEB 1S0MA 2AX0A 3L7OA 3KK1B 3IBFB 1FNOA 2HGNA 4RR5A 2Q6BA 1OIAA 4IG0B 3CMQA 3G6XA 4NWBA 3C14B 3GV5B 3HI9A 2J0XA 3L4BC 5HANA 2AYGA 4G3IA 1LNQA 1DFDA 5G0RB 3PFOA 3WX4A 1U6ZA 3R5JB 3IP0A 4BHQA 3B78A 3SEOA 1MROB 4X4VA 1F60B 5KOWA 1GEHA 4ED1A 3H25A 4X4UA 3GJQB 1JB0C 3DM2A 3FBEA 2ZKTA 4YDDB 4FXWA 2MB0B 1RTZA 1FE0A 1VYAA 1P27B 2I5JB 2KYZA 2MMYA 2QLJB 4KSEB 2MY7A 2W8LA 3FEXB 3RTVA 1SKSA 3BDPA 4DU8A 1N5SA 2VODA 2VBZA 5C25B 2RB7A 4IRKA 3T1YJ 2DTJA 3ADAC 1T0TV 1WG4A 3MCMA 1E6YB 4RU2A 2WZ1A 3FSXA 2OTLS 1QLNA 1T8EA 1NM2A 2EEYA 1UVLA 1JLGB 1DLOA 1NJXA 1G6BA 4OV6A 1I51B 1RT6A 3DRSB 2YWFA 1R31A 4BWJA 2W9AA 1F1BB 3DRPA 3VVUA 2LU2A 3QNWB 4DV5F 1NHUA 2E7WA 3BQ2A 3IN5A 2CPFA 3TZXA 2R8KA 4U7CA 3PJWA 4DR7J 2OD6A 1JXEA 3KYLA 2VQEF 2JRSA 5KG4A 4Q5VA 2HHPA 3PX6A 2N3OA 1KR4A 2HNZA 5A6WA 1N0VC 1FA0A 3BS9A 3GWCA 4ZS6A 2UUTA 4ID8A 5FDLB 3I55S 1VQ8S 1X4EA 1UL3A 3Q8QB 2HVDA 4IG3A 2HWTA 2QGFB 3MMBB 4ID5A 5EGYA 4UTGA 3CMES 4RX6A 3NMRA 4LVOP 3P8BB 3IM8A 3T6JA 4JI6J 4PG6A 1QAYA 2WB4A 4KGKA 4KV8B 3N6LA 2PN6A 1FD8A 3RR7A 3MM5A 1W2IA 1HBMB 4ETXA 5BR8F 3VVTA 3C8YA 4XDCA 3A3NB 2BQUA 2D41A 3N5BA 4O23A 2B5JA 3IFEA 4FPIA 3RU0A 4A47A 2DY1A 3EWGA 4USTA 4DR3F 1YK9A 3GMGA 3THPA 3VGUA 2VQFF 2ZZMA 3UE2A 4IQXA 4MAKA 4DWIA 2XLKA 2KXFA 4ETZA 5B0CA 3J81j 4DR4J 2CWXA 1GXTA 4DI6A 3CF5Q 1VGYA 3GJSB 5KOXA 2RS8A 4F4AA 2HEKA 5KFHA 1WOPA 4M1KA 2FVSA 2HNDB 3VAKA 3KUHA 1Y10A 4DL4A 4JI5F 3KOAA 3UI3A 3HHEA 2H54B 1QD1A 1WACA 2VZ9A 5GAEI 1TFYA 3LA0A 4I4BA 2F8EX 2WBRA 1UFLA 3OFGA 4NLUA 2KM8C 3HDSA 1TMJA 4EYIB 1WF2A 5I42B 4ER8A 4Y2AA 4ED5A 3W63A 1U45A 3V6JA 4CO2A 2YNHB 4DCOB 4CO3A 2L9DA 2R7RA 1JIHA 2AJ0A 2B8PA 2JNJA 3K89A 5D0RA 1D9DA 3NGSA 3PYGA 4FXVA 4B3OA 7AT1B 4F3QA 4ZITA 3NP5A 4JP8A 2ZH3A 2LXIA 3UD4P 1P8GA 2G0IA 5BYRA 3W9JA 1C1CA 4NRUA 4QWDA 2ADBA 4I64A 1JLFB 1JLQB 1RAIB 2DJWA 4IFYB 4Q0BB 2ILYA 3ZXWA 1RAFB 1W26A 3BV8A 3IR6B 1NK9A 3VAFA 2V9WA 1M0SA 3NGTA 2KRBA 4DR1F 4BS2A 1JWWA 1FDBA 3BZQA 1XBWA 4CLFA 1TKTA 2MEWA 2G2YA 2ZUAA 5DM6Q 4PUOB 4JYAF 1RAAB 2A2DA 3HMJG 3DLHA 4YB5A 4EZ9A 4PQUA 4W4MA 4ZCLA 2DKOB 1X4AA 1TK0A 1BQMB 2H65B 5C25A 3PJ9A 4OQJA 2KFNA 5FD1A 4O0IA 4DV5J 5E3PA 3WZ0A 2D1CA 2EPIA 4OYPA 2HQCA 3BGFA 4IDKA 5HVFA 2W9CB 2DVIA 5IM0B 2WTFA 1SC3B 1RHQB 4OLOA 2C2NA 3HHLC 3V81A 1QE1A 2BE2B 1PC5A 2IIHA 3CCES 3F41A 3R9LA 5KFLA 3BGOP 3A8IA 3FKBA 2E1RA 2DGQA 1JLCB 2IYIA 2CNNB 4WYWA 2FHJD 5I3QA 3DGVA 2ZDOA 4A48A 2JVRA 4EBDA 1APSA 1PIEA 4X4OA 3OVBA 2E1PA 4OHVA 4CH1A 2OGUA 1R8PA 4L72B 2DGVA 2RQCA 3ICLA 1OMSA 2HSEB 2VU5A 2NLWA 1UETA 3D3CJ 4NLWA 1P1TA 3CCZA 3IM9A 3TAMB 3TP2A 2L08A 4OX7A 1FK9B 3PRVA 2E9TA 2HVEA 1DLOB 3ET6B 3NY0A 3HCXA 4LR9A 3T1AA 2A3JA 2HBRB 2YX4A 2V4RA 1GXLA 2I0XA 1X0FA 5KFVA 2KVIA 1VQMS 2DHGA 2VPYB 4FVMA 3MR6A 2VQFJ 1UEKA 1HW8A 1QJHA 3LUYA 4TU9A 3JAMU 3ELHA 2YKNB 4PCQA 4ECYA 5HVHA 1RTDB 1Q8IA 2IJFA 5A2QU 3H42A 3Q2SC 4PXCA 4WZMA 1YX2A 5E7OB 5ETOA 1ZTTA 4G65A 2IY5B 3O8WA 3CCTA 4WIQA 5D77A 4PG8A 1DZ5A 3FFIA 2C3MA 2MKJA 3T19A 1U1NA 3PO4A 4RJVA 5CCMA 1XNRJ 1VJWA 2MTLA 4WU2A 2KO1A 5ETLA 4I67A 4UQTA 2HBYB 1U0SA 2AP6A 3BR8A 1ZA2B 1YRTA 2UUWA 3N79A 4HACA 2GNKA 3ULHA 4C3MA 2AZ3A 1X9SA 1EB0A 2YBVA 4QR0A 3IMQJ
chains in the Genus database with same CATH topology
2HWHA 3KJVA 2DIUA 1FT8A 4X4SA 1N5QA 2E5HA 1FXLA 5E0OA 2HHHF 1F5BA 2DT9A 4TLRA 2PE8A 1UMJA 3EPGA 2Y1JA 3TR5A 3D1HA 4LF8F 1R0AB 2NXUA 4ZKAA 1UKUA 4ATNA 4A8MP 3CD6S 1O51A 3TAQA 4KT0C 2I2YA 2DO0A 3SSSA 4URGA 1HWLA 1U26A 4WFXA 1JLFA 2QA4G 2JHEA 2GJIA 3MI7X 3I96A 4DV1F 1VQ6S 4O4RA 1RT7B 2J0SD 3N0VA 4ICLB 4K4WA 4ELUA 1QVFR 2ZBCA 3V5RA 4Z2XA 3CCSS 1X4CA 5CYQA 1FO1A 2A2CA 3MM9A 2QA2A 1QE1B 2BE2A 5E3QA 3UR0A 4F8RA 1TKDA 3TO8A 2XNQA 2RMLA 2Y1RI 1XR6A 2MKSA 3CCQS 2DO4A 2GQCA 3FVYA 5IQ6A 2BVZA 2IFXA 2NSBA 3PRDA 3K5NA 4Y6IA 1HL6A 4OJHA 4C8YA 2JOQA 2HHTA 1HW9A 2R4FA 2KXNB 3FQKA 4DJBA 1XR7A 4ILLA 3I0RA 2IJNA 4KAIA 1T05B 5I3UB 5F8NA 1S9EA 5DG8A 1S1WB 1B0TA 1KEKA 4ILRA 1FE4A 3GYNA 3SV4A 4RW4B 2ZC4A 1KQKA 1UEVA 2E1MC 1X4GA 3GFZA 3ISNC 3P49B 2ROPA 5AE1A 2LQ5A 4BBYA 1WG5A 5IT0A 4YB6A 4E98A 3PR5B 1YJWS 2NQPA 3O3LA 3SFGA 1S48A 3MOJB 4N76A 3MM8B 3GE9A 3I9V9 3BO3A 2K3KA 1FESA 1XTZA 4FF1A 3IGNA 1C0UA 1H2UX 4WK3A 3MAQA 3H40A 2DGTA 3DMJA 3PW7A 1HMVA 2VKRA 2FPHX 2YKMB 1FDAA 3G6VA 1RT2A 1N5VA 2NREA 1LFPA 3BDEA 2GV1A 1PC4A 4RW8B 5GVQA 4WKRA 1S1XB 2Q79A 3GYXB 3SZ2A 1IBKF 3OBIA 4JI2F 2CVEA 2M7SA 4QW8A 3HXMA 2YWHA 1X0PA 3BGUA 4MMOA 5KFBA 5KFFA 1W2BR 5A8WB 1RT5A 2YH0A 3JTOA 2M70A 2HS3A 2HNDA 4I2PA 3LP1A 3T9NA 5C5JA 4WF9Q 3AH6A 5DDOC 4UW2A 4O44A 1V3SA 2V8HA 4HTJA 2KRRA 3DYAB 5CH7B 2HHQA 1FF2A 1XC9A 1N56A 3R5BA 4URSA 3KLFA 2QO3A 4RW8A 2BV3A 2CJAA 2R7OA 4JI7F 4V19X 2OMLA 2V8GA 1MMLA 3KK1A 1S6PB 2A10A 5CYMA 4BDPA 1LWFB 3LGMA 3MMCA 4EGLA 2HPUA 1VLYA 2GQQA 3M2VB 3H2VE 5B0BA 1IM4A 4KO0B 3CD0A 3E01A 4LSLA 1T94A 4ECVA 1VQ4S 4JV1A 4C2MA 4M5DA 4IR1A 2IRYA 2JEGA 4R0EA 4DSKA 2KKHA 1CC7A 2ROGA 3I32A 3H2LA 3QIPA 1X9MA 4DN0A 2Z4PA 5B0FA 3DYAA 3VALA 2B7BB 3TA2A 1SB6A 3C6TB 5CZXA 3PVXA 1FKPB 3BGRA 4ZCMA 1DQ8A 1S6OA 2DNYA 4XIUA 3DCAA 4J9QA 2WRMA 4NLTA 5FLXY 3OVSA 3UDCA 2LEAA 3FEYB 2HVHA 2VFTA 3V6KA 2CZ4A 3CD7A 1FRKA 3LP2B 4NLYA 4N77A 2FVCA 4ECTA 1J5EF 4YOEA 4LF5F 2PIIA 3DMJB 2RRNA 2KN4A 2JJ4D 1AW0A 3JSYA 4A8QA 3RBDA 1VQLS 5EN1A 1TFWA 1FXRA 1TKXB 4XPEA 4LQ3A 2ZH2A 3CCLS 2R7QA 5G4DA 5I3PA 1LFWA 3UWTA 5GAEU 1C1BB 3P3DA 4USIA 3FRZA 4X4QA 3T6BA 2R8HA 4B3TF 5KFNA 3S7RA 2NS1B 2BUNA 4OZNA 1O8BA 4PXEA 4BWMA 5J2MB 3LP2A 3LPYA 4RBVA 4LSLB 4CZCA 4YR0A 2XS7A 4WE1B 3IRXA 4WJBA 3E2EA 4FBUA 3M6WA 4KB7A 2VFVA 1Z2ZA 4DV0F 5J2PA 2I38A 5HMWA 1KVJA 3QAUA 1XK8A 2ZH5A 2MHEA 1WNEA 1JKHB 3Q24A 1JK9B 1S9EB 4N56A 1NU4A 3FRYA 2FJVA 1HARA 2NPIA 3PM9A 3TARA 3CDUA 2N3LA 5LL6d 1F5AA 1JLAA 2LU1A 4OHYA 4QWAA 1F9FA 5B0EA 2C2EA 4KFBA 2N7CA 3I31A 2VOPA 3M2UA 2ASJA 3OL6A 5CYMB 4DX8H 3JYTA 3OL8A 5KFGA 3CDEA 2E66A 4E8UA 4ZLPA 2FVRA 4XDDA 2VA2A 2GX8A 4NLOA 2E9ZA 1Q82T 2GO9A 4WFAQ 4Y28C 1ZPWX 3N6NA 3OL9A 2CQHA 3HO1A 2EBGA 3V4IB 2PI5A 4OMFG 5EDWA 4ED2A 4Z37A 1NJIT 1ZM4A 4IFVB 4B9LA 3DI6B 3OXLA 1SH0A 3K8WA 3K5OA 2C22A 4K4TA 4KHRA 4KHMA 5KAKA 3VAMA 3CTRA 5LJ3Y 4UQGA 4O3RA 2ZOMA 4Y65A 2LEBA 2KT2A 4GC7A 1FNMA 3OV7A 1HNXF 1N0UA 2RDIA 3KHGA 2FB0A 3SMZA 2N4DA 4O44B 1SL1A 1TVRB 4ZVFA 5KG7A 5F9NA 3OTDA 4EUVA 1YJVA 5D4OA 2PMZD 2RSQA 3IAS9 3KLEB 3T3FA 2KZMA 4HDHA 3IA0A 3K5PA 2DHAA 1HNZF 4HT7A 4K59A 4TXSA 5D3GB 3BREA 2DGOA 3AAWB 1H3DA 1S1WA 4OHZA 3PIOQ 2R7WA 4FS1A 2W9CA 1IUJA 2XGQA 3IC1A 1HNVB 1RT3B 2XWXA 5CYJA 3LOUA 4X64F 3EGWB 3UD3P 5A8KB 4X65F 1M90T 1L3KA 1TKZB 4H4KA 5EX0A 2M3DA 4DLGA 1B7FA 3QAEA 4HLBA 3OFEA 3OTCA 3PO5A 1KQSR 3MEDA 4OJ1A 5HBMB 2WAQD 2HRYA 3NKYA 2WSFC 1RT1B 4LSNA 3I4PA 1QAJA 3MM8A 2CPDA 1J2VA 3PFEA 4YFUA 4DUZF 1GNKA 2F40A 4YQWA 3G4SS 3IR7B 1UA1A 3V4IA 1Z1ZA 1DTQA 2Z0GA 3CPWR 5JVGQ 2XY7A 1T03B 1UVNA 1NB7A 1ZBTA 3PJXA 2VG5B 5KFOA 3NBPA 2XMTA 4M95A 1VIOA 1JLEA 1UAWA 4ZHRB 1CC8A 2PA8D 1FTRA 4BCAA 1KOHA 3D0GE 2JFDA 3QGIA 3RZAA 2BXJA 1N36F 4NYOA 5H9EJ 3PDNA 2ZNYA 3RAMA 2QA4S 2MZQA 3V6DA 2DNPA 3FCHA 4MH8A 4LFCF 4Q2MA 1MWZA 3NGDA 2CQ2A 4OX6A 2ADCA 5E3CA 4PQUB 4ED0A 2XMVA 5KFSA 2VD3A 1RA6A 1R0AA 4B9VA 4DQPA 3BJYA 3J7YU 2V4JA 1K73T 2HMIA 3N4WA 2N82B 4IDKB 1IBMF 1WEYA 4QIGA 2ZC3A 4ECQA 4DR4F 2AJQA 3DLGA 1KSPA 2J6UA 2B9XA 2G1DA 2OD4A 4WFYA 1CVJA 1KTVA 4G1PA 2V8DA 1J5OB 2C42A 1DTTB 2ZITA 3N28A 1T7PA 1TKTB 4PUOA 1H2TZ 1N4LA 2K1RA 3TUZC 4EWTA 2XBPA 5L9XA 5CD4H 3D54A 5HP1A 3CE8A 5LSOA 5CCLA 3RRHA 1TQLA 4KHPF 2EK6A 2RQMA 1FK9A 4AL5A 4JI6F 2OMOA 5E3RA 4ZPTR 3KLEA 1D9FA 4UUWA 5AXLA 3V81B 2J0QD 2R7UA 3DRRA 3PW0A 4K2XA 3FNNA 2RU9A 2FGOA 4RW6B 5K9FA 1Q79A 2YX1A 4C0HA 5IWAF 3BO2A 4ED8A 4DQSA 2ACYA 3RB3A 1NEEA 2YKQA 2YNGA 2P6SA 4ZPVR 2ZH7A 1FDDA 1WHWA 4ERDA 3I5BA 1SJ3P 5LMUF 1LV5A 2ASLA 2C3PA 1SL0A 4OI0A 3RAXA 2MXYA 3MR3A 5J2NB 3V6DB 4ID5B 2JLGA 3P5TL 3BSCA 2UVUA 1YJNS 2LA6A 2B51A 4LF6F 2XMWA 4Y00A 1U48A 1V6HA 4NLVA 3EZ5A 1TL3B 2CG4A 2IAJA 4ZPWR 4ZA1A 3M8PB 4YP3A 4B9SA 3GIMA 2G4BA 4RW9B 3G8TA 2BJEA