3CF5Q

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cf5Q00
3Q2SC 4TLQA 2DNRA 2YTCA 2CQ3A 2N3OA 2CPYA 1U1LA 2CQ1A 2N7CA 3TO8A 2MQQA 1FO1A 3CULA 3CCES 3CCMS 2AD9A 1N88A 3MD1A 4LJMA 5H1SV 2B0GA 3NS6A 2EK1A 3D2WA 3CUNA 1VBZA 2LKZA 2MYFA 3MUTP 2HGNA 1S72S 2RQCA 2CQDA 1DHMA 2BOPA 1DZ5A 2M4MA 3MXHP 2F9DA 1A7GE 1HD0A 2L41A 3N9UC 2EK6A 1KC8T 2J0SD 4WFBQ 1WWHA 2DO0A 2PE8A 3CCSS 2OTJS 4C4WA 5EN1A 2KXHA 2DGVA 2X1GA 1G2EA 1U6BA 2CPDA 1H2TZ 1U1PA 1VQKS 1OWXA 2YKAA 2N82B 2OIHA 5GADU 1U6FA 5DETA 2DHXA 3NS5A 3PIOQ 2KG0A 3EGZA 3UE2A 3UCGA 4UQTA 2M9KA 1WELA 3SDEA 3VAKA 3CCRS 2RUGA 3VAJA 2M88A 4F25A 2LQ5A 4CQ1A 4OZ1A 3CF5Q 1F9FA 4TU8A 2DGXA 1URNA 3B4DA 2MZTA 5IM0A 3CMAS 4U67Q 3EX7B 2YH1A 2MJUA 2XNQA 1M5KC 1WI8A 5JVHQ 2MZJA 3B4MA 2ADCA 3NNAA 4WCEQ 2DGUA 3DLLQ 3VF0B 1M5OC 2LECA 2KM8C 2LYVA 4PKDB 2RRAA 3V4MA 1WI6A 3I56S 1X4BA 2JVRA 3LQVA 2CPFA 3HI9A 2F9JA 1CVJA 4QU6A 3TYTA 1YJ9S 4Y0FA 1UP1A 2KRRA 5CYJA 2DNMA 3THPA 2QFJA 2BZ2A 3BEGB 2DNPA 2FY1A 5ITHA 2HYIB 3EGNA 4J5OA 1W2BR 4PRFA 1U2FA 1YITS 2E5IA 4WFNQ 2MQOA 4Z2XA 2Q79A 3S6EA 2DNNA 1X4DA 1WHVA 5CA5A 2QA4S 2DGOA 3CPWR 1SXLA 2VOPA 2JX2A 2MZRA 4YOEA 1OPIA 2XNRA 1U1KA 3CCLS 2YH0A 2CQ0A 1WTBA 4FXWA 5DDPC 1R8HA 2D9OA 2MGZA 3S7RA 2FPHX 2YWKA 1U1QA 1OO0B 2DGSA 2PEHA 4WIIA 4OZ0A 2F3JA 1X4EA 2KN4A 2MSTA 2LCWA 4C7QA 3VAGA 1X5TA 2E5GA 3CCQS 3VAIA 2FC8A 5DM6Q 2DITA 1FNXH 3RW6A 2DH8A 2M7SA 2MMYA 1VC6A 4QQBA 2LEBA 2DHSA 1VQOS 2DNZA 3MUVP 2DNKA 3CC2S 1VQPS 1U1MA 1FHTA 2RS8A 1X4AA 5JVGQ 1B7FA 1WG4A 2MQLA 2DGWA 3SMZA 4LMZA 4CH0S 1O0PA 3VAFA 2DO4A 2SXLA 2KFYA 2RS2A 2CQBA 2DIUA 1WG5A 2KHCA 3J7YU 1UAWA 2KU7A 2RU3A 4WF9Q 2MKKA 1YIJS 2CQ2A 2LXUA 1WG1A 5DM7Q 3CTRA 2LA4A 2FC9A 1VBYA 3NMRA 1ZH5A 2MQNA 2MY7A 2DNOA 1HA1A 3UD3P 2CPJA 3TP2A 2MKHA 1VQ7S 1JJ4A 2KT5A 2EVZA 3ZZYA 1PGZA 2D9PA 3I55S 5GMKa 2DHGA 1YJNS 2DISA 4IO9Q 1FXLA 2AYMA 2MKSA 3MI7X 5HL7Q 3CC4S 2MSSA 3UD4P 3IWNC 1ZZFA 5LJ3Y 1U1RA 1H2VZ 1KD1T 1AUDA 3NNCA 3G9CA 1WEZA 2XSFA 3G71S 2OSQA 1YJWS 5FJ4A 1WEYA 2DHAA 1XN9A 2CPXA 2KYXA 1DRZA 1VC5A 4V19X 1VQMS 2KVIA 5BJRA 2DH7A 3BS9A 1VQ5S 1BY9A 2M8HA 3G4SS 1P1TA 1HD1A 2KH9A 3R1LA 1WHYA 1VQLS 2JRSA 2G0CA 2CQCA 4QPTA 2LXIA 1YI2S 1H6KX 2ADBA 3U1LA 2MZ1A 3G8SA 1ZZNA 3JB9k 3P49B 3IRWP 2HGLA 2OSRA 5DDQC 3PIPQ 2DNGA 4YUDA 3VALA 2M8DB 2CQIA 2MXYA 1VQ6S 1X0FA 1SJ4P 4ED5A 1YHQS 2J8AA 2HVZA 5DDRC 1X5SA 4IOCQ 3MUMP 2JVOA 4IOAQ 3CMES 1FT8A 2GO9A 1X5PA 4Y00A 4F26A 1A9NB 3SXLA 3BO2A 4QU7A 3DXBA 1VQNS 2DGTA 2E5HA 3S01A 1HL6A 2M2BA 2X1FA 1JJ2R 3LPYA 3VAHA 3CD6S 2JWNA 3FEYB 2X1AA 2VOOA 1SJ3P 1X4GA 1X4CA 2HZCA 5CXTA 3ZZZA 1D8ZA 2CJKA 2DB1A 1FJ7A 1YWXA 2MKJA 1FJCA 4F02A 2ZJPQ 4FXVA 4CIOA 2MHNA 2MPUA 1SJRA 2MQPA 2LA6A 3RW7A 5GVQA 3BO4A 2RVJA 2LEAA 1M5VC 1H2UX 1P27B 2MQMA 4CH1A 3G96A 2CPHA 4LIRA 3NNHA 1R8PA 2DNQA 5LJ5Y 2MJNA 2MGZB 1FJEB 5LXYA 2KXNB 1WHWA 1UFWA 4TU7A 5IM0B 3G8TA 1VC0A 2LMIA 1M90T 2QEXS 2G4BA 3UWTA 4RU2A 2CQGA 3R27A 1M1KT 3ULHA 5IQQA 1K8AT 5GAHU 1KOOA 3L3CA 4BS2A 5MLCV 3J7ZT 2M52A 1U1NA 1RK8A 2U1AA 3BO3A 4ERDA 2MZQA 2KXFA 3U1MA 2V94A 1WEXA 1YTYA 2KM8B 5HO4A 1QM9A 1QVFR 1U1OA 1SJQA 1S79A 1VQ9S 2CPZA 1N54B 1VQ4S 1RKJA 2X1BA 1SJFA 1K9MT 3CCVS 2MB0B 4WKRA 4TU9A 1X5OA 3P6YC 3MOJB 2MKCA 2M0GB 1PO6A 2M70A 2E5JA 2AYEA 2MY8A 1Q81T 2XS2A 5LSOA 1WF2A 2MZSA 2KG1A 1M5PC 3MURP 2DNLA 2E44A 1KOHA 1L3KA 2DIVA 2CQ4A 2L08A 2I38A 2ZJRQ 2VONA 2CPIA 2RT3A 1X4FA 1N52B 2ZJQQ 2A3JA 4A8XA 3G6ES 3CC7S 3R1HA 2ERRA 2DNYA 4PR6A 1JJHA 1Q7YT 3P5TL 2XS7A 1NO8A 2L9WA 1K73T 1WF1A 3UCUP 1WHXA 1Q86T 1N8RT 3CXCR 1KQSR 3Q2TC 2KI2A 2OTLS 5GAEU 2RRBA 3OW2R 1X4HA 1D9AA 2NZ4A 2O3DA 2DH9A 2DGQA 2RQ4A 5D77A 2VODA 3HHNB 2DNHA 2XB2D 1DBDA 2AYGA 2XS5A 2MKIA 1NU4A 2DK2A 3S8SA 4WFAQ 2K8GA 3CCJS 1UW4A 2KRBA 4UY8T 2NLWA 2U2FA 3MD3A 5GAGU 3SDEB 2WBRA 2FHOB 3H2UB 2N3LA 2UP1A 2G1DA 2D3OR 2CQPA 2AYBA 1VQ8S 4EGLA 3THTA 2RNEA 4ZKAA 1VBXA 2GHPA 2I2YA 4IUFA 4P6QA 3US5A 1JMTA 3H2VE 1QVGR 1IQTA 3MDFA 1Q82T 4C0OC 2J0QD 4YB1P 4M5DB 3VAMA 3UCZP 5DDOC 1WF0A 1OIAA 5D78A 5IFMA 5LXRA 4W92B 3P3DA 2CQHA 2K3KA 3FEXB 2HGMA 2CPEA 2J76E 5LSLA 2OJ3A 4W90B 3K0JA 1NJIT 3CCUS
chains in the Genus database with same CATH superfamily
1M5SA 1KQFB 2ZZNA 4TLQA 3R8YA 4USIA 1WACA 2ROGA 4EWTA 3QJJA 1TKZA 1VYAA 3HHLC 4LT6A 2HK3A 4A46A 2CQ3A 3ET6B 2CKWA 2FVQA 1VDHA 2DR6A 4JI5J 1JB0C 2PC6A 4NXMJ 1MW7A 2F63A 3KJNB 5KFNA 4RW6B 3TO8A 3LOUA 2K7KA 1HNIB 2LU1A 4USVA 3CCMS 4EUVA 3GPAA 3TANA 2IY5B 3BKFA 3MD1A 5H1SV 3KMSA 1MNEA 2HVEA 3CJ0A 5E41A 4CO3A 3AT1B 3D2WA 3ZTPA 3TQ1A 1HNZF 3DLHA 4B9NA 4JI3J 2MYFA 2HGNA 4IFVA 4M5MA 1S9EB 4OI3A 2ZOMA 2DTJA 3TX0A 2IDEA 4M5DA 4X66J 4NRUA 3ZTRA 4X2BA 3DNCA 2F9DA 1A7GE 1IKXA 1H3DA 2CRLA 3H90A 2FVPA 4B3RF 3KHRA 1XTZA 2QV6A 4PUOB 3AD7C 1KDNA 2B5JA 5EUHA 4QWBA 2PE8A 4EMDA 4XDCA 1TU0B 3LW5C 4C4WA 3TA0A 4ZCIA 5F0UA 2CPDA 2K06A 1NH8A 3QSYB 4KPCA 1T9YA 1MMLA 2VF3A 1J5OB 2QT7A 1WKJA 1JLCA 4UUWA 2DEJA 3LF0A 1AZSA 1D09B 4HDGA 2HBYB 1FFSB 2H9ZA 4ZITA 5DZ7A 2FJEB 1W7WA 3AOBA 1QJHA 2B4UA 4CLTA 4DV4J 5KFKA 4NYZA 4QIFA 1N6QB 5D4PA 5FDLA 3VAKA 5HLFA 4KY3A 1UPMB 3HKWA 2WTFA 3PW5A 1S97A 3CCWA 3PR4A 3LALA 2OD4A 3VAJA 1U7LA 1IJFB 2O5DA 3GJSB 4F3QA 4K0KF 2ASJA 2WVEA 2BACA 4DSKA 1S1WA 3M8ZA 5L39A 3KJVB 1SC4B 2ZC4A 4LF7F 5IT9U 1UETA 1ZPWX 4P10A 2LQJA 1YQHA 1FESA 3EX7B 2J6UA 4OYZA 4E2FB 2LP4A 2ZM6J 2ASLA 4ZPCA 3U1NA 1NK8A 2MZJA 2KFZA 1HNVA 1UEKA 1DARA 2EFOA 2LXFA 3NGUA 4TLRA 4NX9A 3LWLA 4MKYA 1QD1A 4IG0A 5E2QA 4ITSA 2LDIA 3DOKA 1TAUA 1NJYA 2C2OB 3HF5A 4QYRA 3CDEA 4PKDB 1NDCA 4RNNA 2BXJA 1TFYA 1UWBA 1WI6A 2VD3A 3I56S 3HXMA 1X9MA 1F2HA 2CPFA 2BANB 3MM8B 2GVDB 4K2JA 3RJMB 1ZYQA 1CVJA 4QU6A 3TJ8A 4DV7F 4X4NA 2YNFB 2HNZB 1RT5B 9ATCB 1BLUA 4RLEA 4Y0FA 1QUVA 5HI7A 1UP1A 5HP1A 5CYJA 3PXGa 4IO1A 1SC3B 2F8HA 2V4JB 1DY3A 2D3UA 3J80Y 3M32B 4PQUB 2DNPA 3WQPA 2XG8A 1UTAA 3JAMY 7FD1A 3D67A 4RZRA 1HFEL 4PRFA 4NA1A 1YITS 1KHWA 4WFNQ 2R7RA 1Q7YT 3BKTA 2Q79A 3CC7S 2DNNA 1RT6B 4JI8J 3PW0A 2VHGA 4U8YA 1TKXA 1QY7A 5C2CA 5CA5A 3BB5A 4NLWA 5ETNA 5CQGA 3QBCA 1U2RA 3PYDA 2XBPA 3GV7B 2HNDA 3MM6A 3TR5A 3DGPB 1S1TA 2KT2A 3EZUA 2MZRA 1OPIA 5K14A 1C2PA 3K7RA 2RDIA 4DV2J 2JSXA 4JI1F 2XNRA 2C3OA 4ED8A 1C4AA 1NHVA 1U1KA 4O4RA 4LVOP 3THVA 3K58A 4K0KJ 4NPOA 2YH0A 2YX1A 2CQ0A 4OYOA 1WTBA 2UVRA 2B8QA 2PDAA 4OJ1A 2HMIA 3U02A 1NHKL 1R8HA 1H38A 2AHOB 1XMBA 2NYHA 2MGZA 2FLPA 2BW7A 3Q86A 1YJUA 2V2KA 4YS2A 2DGSA 1FRXA 1V5IB 2EKNA 2PEHA 4OX8A 3C6UB 4KC5A 5F3ZA 1N8RT 4OZ0A 3PY8A 1X4EA 3PRVA 2OFGX 1ELOA 2C2RA 5I4MA 4FNHA 1JLFB 1RWVB 2DXDA 1SH0A 5KFEA 4KO0B 2QYCA 3ZZRA 3VAIA 5EWFA 1VQ4S 4DL0C 3VVUA 3EE3A 1UVMA 4Y2CA 3DLEB 3RW6A 2ATLA 1D9DA 3AA8A 4I7FA 2I6WA 4C8YA 2YPYA 5ETTA 5CYMB 3V6DA 3GMGA 2UUCF 5LMUJ 2V50A 3KJVA 2QTWA 2LEBA 3CJSA 3EYZA 1C1BA 4FYXB 4MFBA 2JDJA 2RS8A 1N0VC 3H8YA 4RW8B 5G0RA 4YR3A 1LEOA 2GC8A 1JLQA 4PG6A 1RTIA 2HHUA 2UUAJ 4PXBA 1DTTB 1GAOA 3WC0A 5J2NB 4YY3F 1Q95G 1O0PA 3VAFA 1HYSB 2W2NP 1YJWS 2ZD1A 2KJVA 2NYIA 4NMLA 5HMWA 5L8RC 3BQ2A 2QLBB 2RS2A 3JSRA 3EVMA 4ILRA 1I6JA 2AJQA 2VPYB 4IDKA 1WG5A 1Q78A 2V9WA 4AYBD 4ZJQA 4OX9J 2J6SA 3TA2A 1WTFA 4R25A 1YIJS 2LXUA 1R89A 4OJGA 1P6TA 3GILA 1RTDA 2YPZA 3C3LA 1LFWA 3CTRA 2VFUA 3NMRA 2XY7A 2RDJA 1ZH5A 1X60A 4GVLA 4KHMA 4O3PA 3T9NA 1GXTA 1YVFA 4JI0F 3MPVA 3QT6A 2BOAA 1VQ7S 4NLOA 5D3GB 5DZ6A 2D9PA 2HKEA 2Y0BB 1GMWA 2HLUA 1HBUA 3I55S 4ID8A 4NLTA 3OXLA 2AYMA 2DT9A 2MKSA 3HVTA 5A6WA 1RISA 3MI7X 3NGRA 5HL7Q 4HKQA 2MSSA 2F40A 1Y7PA 3VQSA 3CJQA 3MEEB 3GP9A 3GYGA 2XO7A 3FQKA 1RT6A 3CGIA 2GA7A 4UT4A 1H2VZ 3KLHA 1KD1T 2CNLB 2YNGB 5A8KA 1CSJA 2JH3A 3GJRB 3KG0A 3NNCA 3GSIA 2OEKA 3LP0B 3G9CA 1WEZA 2ZBPA 4ICLB 4EU0A 2ZH5A 1N32F 1UCNA 2ZZTA 3MPYA 2IJRA 4P2XA 1CJKB 5KFYA 1Q5YA 5HROB 5D3GA 3VCDA 3VGSA 4YHHJ 5K8PA 2CPXA 2C42A 3MOZA 1IR1A 3PKMA 1RT1A 3EZOA 3EVWA 3M30B 3QYYA 3MR2A 3NAHA 3WX4A 2QL7B 2AWZA 3HHLA 4LF7J 1E6YB 2KVIA 2EKYA 1EETB 5H9FK 2WCXA 4GO5X 4ECYA 4KFBB 3BS9A 3D66A 2I8EA 1EZZB 2ZITA 1RU1A 3M2RB 4LR9A 3OQ2A 3G4SS 4K8RA 4IQMA 1N5YB 1T7PA 1QAJA 1UL3A 4KGZB 3ZNUA 3KTQA 1V9OA 3QO9B 2OD6A 2KH9A 3M9NB 4B9LA 1TVRB 1VQLS 3UNGC 3MMJA 4KO0A 4CO1A 1T02A 3LO3A 1P9YA 2C2MB 3PEHA 2FVCA 2R8HA 2P9CA 2LXIA 4PWWA 2VJUA 1YI2S 1HBMA 2N4CA 3SSQA 3W7BA 5HQLA 3QLHB 4X64F 4OHVA 3O5TB 3G8SA 3R5JB 5CYMA 5HK4A 4LRAA 3PX0A 3BPDA 3KLGB 3IRWP 2EPIA 1S0VA 1X9WA 1EP4B 1Q1KA 2PI4A 3I31A 4P2MA 3RR7A 4NCBA 1HNXJ 1RWUA 3OXFA 1QTNB 4HLBA 3VALA 4DLEA 4IRKA 2HK2A 1Q4RA 3KNGA 3M6VA 1X0FA 1JLGA 3GJTB 3OFEA 3G6XA 3O8WA 5IWAJ 3T1YJ 2RU9A 3FEZA 3OR1B 1YHQS 2HVZA 4JI6J 4FXDA 4KYZA 1X7VA 3AOAA 3BDPA 2A0FB 2XGQA 4TYBA 2EFGA 3W8PA 3CMES 4IOAQ 1QAXA 3V5RA 1DURA 3QT5A 4NYPA 1ZAVA 1FT8A 5RUBA 4AL5A 3MM9B 3W2VB 1RTJA 1FDNA 1MMDA 1S1XA 2ZE2B 3M8PA 4DR1F 2G2YA 4FVCA 1APSA 1UFKA 3HSGA 3E8OA 5ETQA 3SXLA 2YXLA 2UUAF 1MLAA 3D1OA 4QU7A 2VICA 1SI9A 4OX6A 3T1YF 1XNQJ 4WXOA 1MN7A 2M2BA 2PGCA 4FYYB 3FSIA 4WFXA 4B9VA 1QAYA 3R5DA 1EKSA 3HJFA 3OV7A 5B0FA 2YKOA 3GFZA 2K1RA 2L48A 3GYXB 4OHXA 3R7SB 1HWJA 2FYXA 2VFRA 2YNHB 4RL1A 1SJ3P 2HZCA 1JXLA 3HFKA 4C8ZA 2BX6A 3GFHA 1TMJA 3GG0A 4OMFG 3ZZZA 5CXTA 4B9UA 1PYTA 5ADZA 1FJ7A 3CJTA 2MDAA 2MKJA 4HEA9 1CEZA 1FJCA 3QRQA 2WBMA 4N47A 2BA9A 5J2PA 1VRQC 5KFQA 4O0IA 2XMVA 1OQ3A 1U09A 2R8IA 2CWXA 2V0NA 1U4BA 4CO2A 4Q45A 4DV5J 2D69A 2W01A 2MPUA 3TA1A 2VFSA 8ATCB 5L38A 4A8YA 3FC9A 2CJXB 2E1MC 2AX0A 4OZLA 3VZHA 2ZNZA 2JEJA 2PEBA 1M5VC 1S6OA 4DQRA 4IRDA 1C0TA 3M2UB 2C2EA 4X4QA 2HS4A 5HLFB 5A2QY 1BGXT 5HN0A 4LIRA 1N32J 1U47A 3NNHA 2ZUAA 4PPZA 3NS7B 2DNQA 1C1BB 4HACA 4RWXA 4QWDA 1S6QB 4GKKF 4Y6IA 2C3YA 3ZZUA 3SV4A 3T5LA 5G0RB 4P72A 2DPIA 2KXNB 1AZSB 1NK4A 1XNRF 1UFWA 4QR2A 2OPQB 4L72B 1HHTP 1PJ6A 1T0TV 4B3TJ 1JJ2R 2RSQA 3BR8A 3AJ2A 1RT4B 2OGUA 3KK3B 4IDKB 3ULHA 4LFBF 2YKNB 1HWLA 5ETSA 5C42B 2F1FA 2IHR1 2ROEA 4NA3A 4O3NA 1MG7A 2GJFA 5MLCV 3W5YA 2M52A 3J7ZT 3JXOA 2GVZA 2RF2A 1EJ7L 5D15A 4FS2A 3WIUA 3ONQA 3BV8A 3BO3A 2HHPA 2RDDA 4NLGA 3P5BP 1NSQA 3FSYA 1F5BA 4WTYA 3R6GB 2LVWA 3BSCA 2GW8A 2K3IA 4BWMA 2DKOB 4U7UD 1VLOA 3H98A 1RTHA 3EGWB 4MIAA 4ECQA 3PX4A 3CT9A 3L7UA 5HJXA 3J80U 3MM5A 1FTRA 1SJQA 3W2WA 1GXLA 1Z2LA 3LWMA 3H4BA 3ZZ0A 1BQMA 1VQ9S 2HQ3A 2WAQD 4ATNA 6FD1A 4LFBJ 4DOZA 2DY9A 2E1RA 1N54B 1RT4A 4P75A 5D0EA 3HZGA 3DM2B 2X1BA 4LF9F 2OPRA 3FK4A 4CTAA 3CCVS 1AYEA 3H5XA 1NPPA 3TJAA 1KFDA 4I67A 4WKRA 1LW0A 1QE1A 4LVNP 3CDUA 3VR1A 1WSRA 2MKYA 5HVGA 4AXIA 3GYNA 3C46A 2VQFF 1YK9A 3IWLA 1PIEA 1CS4B 3OXGA 3IMQJ 1PO6A 2FLNA 3TRGA 1K1SA 2AJFE 3KLFB 4KQZA 1M5PC 3L7PA 5KT6A 2IBOA 4JOUA 3ILJA 2DNLA 1L3KA 4N56A 2FGOA 4RNHA 2BJ1A 4FS1A 1VIXA 3CVKA 5KFAA 4JI7J 2I38A 2ZJRQ 4LF5J 2J5AA 4J7CA 2WW8A 3MPDA 1L3SA 2VONA 3IG1A 1ICEB 3M8QA 2NXEA 1RWOB 1FF2A 1M1HA 3FGVA 1Y0HA 1PJ5A 4EZ6A 4DV1J 2E29A 1FRKA 2F4VJ 1UFLA 1JJHA 2BRLA 2Y0SD 3P5TL 2GJIA 1NO8A 2RMLA 3D4JA 4PG7A 3F56A 1K73T 4JV2A 4D3GA 4KHRA 3VGVA 2XCPA 1Y00A 1B99A 1W25A 3OL7A 1MWYA 4KR0B 4ZVEA 2ZH8A 3CXCR 4CZCA 1T03A 4LSLA 4USJC 3T3FA 3IO1A 4HVZA 3ZNJ1 5BR8F 2OTLS 2CUYA 2DXEA 4WU3A 1D9AA 3HT3A 4MJKA 1SKSA 1JLFA 3MR7A 1U6ZA 3J81Y 3POTA 2IAJB 3KHGA 4ZVQB 4DV7J 5BXIA 2BABA 5D77A 1MU2A 1MMNA 3PCOB 4P9SA 2A6MA 3OPKA 2X3GA 2DNHA 4B17A 3HHNB 2AT1B 4TVAB 3NLCA 3HT0A 5LOQA 3MFHA 1NK7A 4NXNJ 1XNQF 1UVNA 2XS5A 2WSEC 1QSSA 4DX5A 1RAAB 3NOCA 1PSDA 1T11A 4MK9A 4NEYA 4I69A 4ZVOB 3L95X 1T3NA 3IRXB 2NLWA 1DTQA 3D6FB 4DX6A 4ECRA 3MD3A 5BYRA 1LKZA 3MAAA 4USUA 4CM2A 1HR0J 3Q8YA 4I7FB 1HWKA 2FHOB 2YWHA 2OEMA 5T41A 3Q22A 2WZ1A 4O44A 2D3OR 2CQPA 2J9DE 2BQRA 3N4WA 2BYCA 3OHBA 3THTA 1VQ8S 1T95A 2CWKA 3US5A 2F8MA 3M8RA 1SV5B 3RGIA 3H5SA 3VV2B 5A6PA 3MDFA 2W9AA 1IQTA 4WFYA 3MPUB 2J9EA 1HYSA 2AZ3A 2DY1A 2JNJA 3TWZA 4E98A 5L9NA 3EXYA 1FX2A 4J9PA 4DR3F 5HMYA 1NDPA 5A0YA 2ZDOA 3NWRA 3IS9B 4F0MA 1S9FA 3NOGA 1RWKB 1BWEA 2XLKA 4NWBA 4AQYJ 1GTEA 1IR0A 3SFGA 1Q0NA 1SIWB 1WF0A 1OIAA 2MHEA 3ET6A 3P8BB 5DDOC 2Z0GA 5D78A 4DV5F 4ED2A 1RTDB 3T5JA 5A2QU 4LSNB 1YJTA 5E3RA 4FZVA 1FJGJ 5IT9Y 3T5HA 3V4IB 4WTOB 2HGMA 2J76E 3PRDA 4URGA 2IMWP 4DWIA 3LTOA 3M1VA 3MF5A 4ZPVR 3BH7B 3G87A 4M5KA 1OY8A 2UXBJ 2WW4A 3Q2SC 4L76A 1XR6A 1X8DA 4A8WA 2HBZB 2Z58B 3M6UA 2DNRA 1YDLA 1S6UA 5KOXA 1WC1A 5LMUF 2PMHA 2YTCA 3WHIA 2N3OA 1K0TA 3IP0A 1HBNA 1D9FA 3UO0A 1NKEA 2KJWA 1N48A 1JLEA 2CPYA 2R9LA 3IS9A 3O44A 4CO4A 1U1LA 2R7XA 1AROP 5C5JA 4YQWA 3AHPA 1S0NA 2C3MA 5KT3A 3V6HA 3CULA 2Y8YA 3QMQA 3GIJA 1T9UA 2AD9A 2IC3A 2NUUG 1LWEA 4P2FA 1N88A 4DEZA 4LJMA 4ICLA 5BYSA 3NS6A 4O3RA 3DDNA 4RW7B 2KT3A 3D3BJ 2OPQA 2EI5A 2HAFA 4OV1A 1G7CB 3T19A 2WVDA 1S72S 1BUXA 4BWJA 3KLEA 2J8SA 4F4KA 2XGPA 1UWAA 4MYTA 2M4MA 2Y1IA 3BZQA 1E6YA 1H73A 1Y5NB 4KTQA 1S12A 4QYZJ 1HQ2A 1T3OA 1OY9A 2Z2MA 1HBMB 3AY0A 2PMWA 3N9UC 1KC8T 1N34F 1NUEA 3A13A 4ZN3A 4KJIA 2VG5B 5KG4A 4QPXA 3KUEA 2W9CA 1G2EA 2X1GA 2FVRA 4WK3A 1HWUA 4OYXA 1U1PA 4NZ0A 2XEXA 1OWXA 3D3CJ 3QWUA 4OLPA 1R8AA 2RUSA 5BR8J 5KT2A 3RBXA 2JHEA 4YN3B 4H54A 1S1UA 1U6FA 3C6UA 4NA2A 2FJAB 1FRHA 3MM5B 3SSRA 1SKRA 3VQTA 3OL9A 3PIOQ 2FIUA 2FJWA 3P45B 2EFNA 1KTQA 4DSIA 2HFNA 3UCGA 3MEDB 3QFHA 3DKDA 2M9KA 1WELA 3SDEA 2RUGA 1HHSA 4IQXA 1HI8A 3MEGA 5BYQA 4Y2MA 2DVIA 1YJVA 4FDFA 3ETMA 5F3TA 4ZDNA 4CQ1A 1IKYA 4F25A 2IM3A 1RTJB 1F9FA 2MLYA 3LP1A 1NK5A 3OLBA 5KFFA 2R8GA 3B4DA 2NXUA 5IM0A 4F4YA 2LLZA 5AJ3F 1CULB 2W9BB 3CMAS 4U67Q 4WF9Q 1XMOF 2YH1A 4N8OA 1UWBB 1NSPA 3PX6A 2B9XA 2FJVA 1M5KC 3HKZD 2P2CB 1GEHA 4W4MA 1IBLF 3JYTB 1VRTA 1HQUB 1X0PA 4M8LA 4DV3F 2WSCC 2OFHX 2XYHB 4BHQA 4XO0A 3VF0B 5H9EK 4M63A 3HMJG 3TNVA 3K8VA 1SJ1A 4P73A 4DCJB 4AXJA 1YKWA 3KG1A 3RBDA 2HHXA 4G1QA 1XBWA 4DN0A 4IR9A 2RRAA 4Y28C 2DR7A 2PSZA 2C1EB 1X4BA 5U47A 4JI4F 2CFXA 4Q8FA 4EBDA 4DN9A 3IAS9 2K7JA 4UW2A 4X4OA 1BMQB 4DSFA 2KRRA 2VFVA 2VPXB 1UVIA 4I2PA 3HPOA 5K8OA 1VK3A 2BZ2A 3ZTOA 1TL7B 2WONA 4ENOA 4LQ3A 2R7OA 1G6BA 4ANCA 3IR5B 5THWA 3DLBA 1W2BR 1U8SA 4M5HA 3DU6A 4NLRA 5IV4A 3I0SB 2MQOA 4Z2XA 3HX9A 4DR5F 3E2EA 3AQOA 3RRKA 4B3OA 4J9QA 4KB7A 2XZWA 3OSNA 3FBEA 3BREA 4ES1A 5KG2A 4F3OA 1S9GB 1PYSB 2MEWA 3MR5A 2O01C 1LXJA 2WSFC 1SXLA 5HROA 2C28A 1KSPA 2VOPA 1FERA 1YRTA 2AW0A 2VKRA 4CO0A 4YOEA 1IWAA 4DPUA 4EK2A 2QIFA 4DQPA 3DLGB 3GB0A 1HMVA 2OPPA 3GR0A 3R2DJ 1FX4A 4U6PA 1P1LA 4DPXA 2ZEJA 5A8WA 2GFFA 4FXWA 4ED4A 2N7YA 2E9TA 3N6MA 5DDPC 4Y2AA 1Y4ZB 2GJ2A 1MSWD 4YFUA 2CIMA 2HEKA 2BE2B 3DYAA 2CG4A 5I3PA 3VGUA 1OO0B 2GVZB 1VK8A 2QLFB 3EVOA 2IYGA 3W65A 3FBBA 5KFWA 3TUJC 3ENWA 3JQJA 3R5CA 2X3DA 2IM2A 4KGKA 3IM9A 4ZCLA 3VAGA 1Q8KA 3W5XA 4IG0B 5F8GA 2E5GA 4KV8A 1FJGF 3GLJA 2PFDA 2VDHA 1J27A 3PJ9A 1DTTA 5ETMA 1O5JA 3BR9A 5C42A 4ID5B 3TJ9A 4QWAA 3RAXA 1FNXH 1BC6A 2G1HA 4J9MA 1B7YB 1ULRA 3KUGA 1FTCA 3RZAA 3BKUA 4ES3A 2Z2ZA 2X51A 2MMYA 4C8MA 3W8GA 1VC6A 2XY5A 2AJ2A 3D6TB 2D1CA 2KB2A 3L4BC 2XMWA 4ALZA 4LF8F 2DNKA 3CC2S 3H59A 5A8RB 2EC2A 1U1MA 1Y9OA 1B7FA 5JVGQ 1QAIA 1RP5A 1JLGB 4LMZA 1JLAB 4FKXA 2E9RX 1CPZA 3OJUA 2KYZA 1B3TA 2KFNA 4CH0S 3BF4A 2HHTA 4A8FA 2DO4A 3OR2B 2SXLA 4M5GA 3OUYA 1YG0A 2JJ4D 4G1IA 1QLNA 2DIUA 3M8YA 2B6AB 3C6TA 3PNIA 4KGVB 3VWSA 1UAWA 2KU7A 4WIQA 2ZH6A 4DI6A 3GCXP 4NLUA 1HNZJ 3NCQA 3MMAA 1WG1A 2ZH2A 4AL6A 5HVHA 3NL0A 1VJQA 2ZOFA 2NSBA 2PA3A 3OSPA 3I32A 3GV8B 2D3ZA 3M2VA 2MQNA 2MY7A 2J7UA 3UD3P 2Z57B 3H40A 2PD1A 4YB5A 3MGJA 3MAHA 5HBMA 1JLBB 1RAEB 3DLJA 3LUYA 5CAAA 2V8PA 1PGZA 2C2NA 3I0RA 3CE8A 4MYUA 2DHGA 2OHDA 5H9EJ 1VOMA 4L6V3 2J7KA 2XQCA 2V5HG 4EYIB 4M1KA 4DZ6A 4K4XA 3CC4S 3UD4P 3M8QB 1RWMB 2GIRA 3MCMA 4B3MF 2HVDA 3HSDA 1U1RA 1F2GA 5LT5A 1KLNA 1VHFA 3BGUA 3MMBB 5EX3A 2XSFA 1HPZA 5F8LA 3ELHA 5CH7B 1F9EB 4Q2LA 2KHDA 5IV3A 4YDXA 4I2QB 3KK2A 3O3LA 3TI0A 4PWDB 3BSNA 4OLOA 2XI3A 3X3UA 5K20B 5J2NA 2DHAA 1TL4A 3D6MB 2FHJA 2YKMA 4X84A 4YR2A 4DL7A 2XWYA 4V1Ak 2VG6B 3VZIA 1BQNB 1C0UA 3I4HX 2NSCA 4KHPF 1VC5A 1GFWB 4LBPA 3ENAA 3H20A 1MU2B 3MZIA 3JTNA 4MKVA 5DS7A 4FVMA 4PCQA 2HQCA 5BJRA 1VRUA 4R5PB 2DH7A 4PYDA 3KKFA 2YQ0A 3E01B 3L09A 2FQQB 3S1TA 4F0KA 2QLXA 1SH2A 2XMAA 3QZ7A 3TUZC 3CW2C 1HD1A 5CYQA 1P8GA 2BMBA 2V2ZA 4MIBA 4ZPWR 4JI1J 1CC8A 5D0HA 3FCHA 3CCZA 5IC6B 1RSCA 4GC6A 4DL6A 3QRRA 4RNOA 4RJVA 2DBBA 5J2MB 2G0CA 3I5AA 4J9KA 2UU9F 4IR1A 3KXDA 4X62J 4B08A 2W4DA 4KHPJ 1NEEA 3G82B 3U1LA 3U27A 3QSIA 1C0UB 1XERA 2WVCA 2BKPA 4UOGA 4O0NA 2PI5A 2HSEB 2ZUGA 4WK1A 3GU0A 2RILA 5KAKA 1SVDA 2B8PA 4FYVB 4RR5A 2WHOA 3DOLA 2Q66A 4F0HA 1L3TA 2HHVA 2M5YA 3WZ0A 4DSJA 1KS2A 1SV5A 2HWIA 2CQIA 3R5GA 4DU8A 3BGFA 4DF4A 4R8UB 2J8AA 1VI7A 3BH6B 2UU9J 2HW3A 2PMZD 3A8IA 4ECSA 3NBPA 2HZAA 5DDRC 3RG6A 3HSJA 1S6PA 4IOCQ 2CNNB 3OT9A 1RWPB 5EDWA 3CIMA 3JSBA 4UQGA 3Q0AA 4PXDA 1LNQA 1MWQA 3G82A 4URQU 3OVBA 1FWLA 2N4DA 1XQIA 4I6AA 1CJTA 4C48A 3MEKA 2QLWA 3I0SA 1UA0A 2R8JA 2F8EX 4Y3CA 4OV6A 1A9NB 5B0EA 3OFHA 3ITHA 4K4WA 2QE5A 3DOLB 1CBKA 2DGTA 4NLVA 4JB8B 3EXCX 4AUKA 1UVLA 2HNDB 5HVFA 2QSWA 4QW9A 5KFUA 1IUJA 2AEJA 1S1TB 2CJ9A 4N7TA 5KFBA 2B3TB 2ZBQA 3DCAA 1Q53A 1Y3KA 2CADA 2J0XA 3AJDA 3LPYA 4K5RA 3T1AA 3FEYB 5B08A 4WJBA 2X1AA 4DL2A 2HQDA 3Q23A 2W25A 2CJYB 1TK5A 1FNMA 2ZHBA 4J9RA 3BJYA 2DJWA 2HG4A 2IVYA 2A2CA 1VIOA 1NPRA 4ES2A 1N0UA 4RWWA 1YWXA 2FHJD 4R0JA 4DL5A 3QO9A 4I68A 1CG2A 1RA7A 2EG1A 4F02A 2QGFB 4KKOB 3SV3A 4ZN1A 3T9ZA 2NZCA 3SBMA 3CJ4A 3TX8A 2BDPA 3OL6A 2XMKA 4LF6F 2DHHA 3R7NB 2GGPB 3OTEA 5ETPA 2YX7A 4CIOA 5KT4A 4RKUC 3TVYA 1YTYA 1VJWA 4NE9C 3KMQA 1FKOA 3DDIA 4B3TF 5KFTA 3RW7A 1KKHA 3C15A 5DQGA 4C11B 5L46A 2R7UA 3KOAA 3W3SA 1K44A 1P27B 3JTOA 3HULA 2XMMA 5E3CA 4Z7CA 3LAMA 2HVHA 4GC7A 1FD2A 2YKNA 5K9FA 4QYZK 2V67A 4RU9A 3N28A 5LJ5Y 3JAMU 1TKTA 2V8VA 2MJNA 1NPKA 1XJWB 1V3RA 5IC4B 4F36A 3PVXA 1FJEB 4N41A 3HK2A 1RJJA 3RRGA 1S1UB 2QMUB 1FFWB 2XSJB 4A8SA 1TL1B 2P8IA 4DV6F 1NZAA 5IM0B 1B64A 3MECB 3IBWA 2QEXS 2UVVA 1UMJA 1SB6A 1TV6A 2AV5A 4RU2A 1RI7A 4LFAF 3M8PB 2IM1A 2B6AA 2XTJP 3DOMA 5IQQA 2FZCB 3SCKE 3TQEA 1TK8A 4ZS6A 1BQMB 1R7IA 1IBCB 1KWMA 4LF9J 2V2VA 1KRPA 5KG3A 3NMAA 3M8SA 4ZJLA 1U1NA 3DI6A 4A8QA 5KTQA 1RK8A 4PG8A 4XIUA 4OYPA 3M2VB 1IBKJ 3QRPA 2MZQA 3K17A 1R6YA 3IGNA 4B3RJ 4ANDA 2ZOGA 4FF1A 5KFSA 3U1MA 1SQEA 2H5JB 1WEXA 2BQUA 5KG6A 1S6PB 1QVFR 1QM9A 2COLA 2CZ4A 1F60B 2B9WA 4FYWB 1YZ6A 5K14B 1DLOA 1IKWB 4L75A 4OZ3A 2V63A 3PKYA 1PKUA 2HFVA 1FDBA 3PO5A 2RJZA 4X4PA 2ZVSA 1XMQF 4IOBA 5A8KB 5L1JA 4OJHA 1R0AA 3L9ZA 2B9EA 3MM9A 3W2VA 3IR7B 3QT8A 1S99A 4DMZA 1Q79A 4FYDA 2M0GB 4UOHA 2MY8A 4JV0A 4DSEA 1NKBA 2B7BB 3M1VB 3BPSP 2MZSA 4F3MA 4ZVSB 5T7LA 1DQ8A 2C3PA 3M2UA 3CO0P 3OVAA 5JMNA 2YBVA 4N76A 4H4OA 3IA0A 2QO3A 3ILOA 2FVSA 1KOHA 4DJBA 1RQ0A 3B78A 2CQ4A 5DQHA 4Z37A 2C2KB 1EETA 1XMQJ 2E9ZA 2B5JB 2BJEA 1GT8A 5CZVA 1TL3A 4GKKJ 1X4FA 3MAQA 2ZJQQ 2A2DA 1HARA 4C6AA 2CG8A 2ZH3A 1S5ZA 1UEVA 1Q8BA 1IR2A 1WOOA 3AQPA 3DLKB 2HS3A 1O51A 3QGGA 4TN2A 3ISNC 4ZA1A 2ZDPA 3HHEA 3R1HA 2AGOA 1RWXB 4RUHA 2XS7A 3CJRA 2PFFB 3CSKA 4CH7A 4QCLA 3LH2S 2HFSA 5J2MA 5GAEU 1S7IA 2RRBA 4I6YA 4U9RA 3W1YC 3OW2R 1MWZA 1U49A 2RRNA 3DRSB 3FBFA 3P96A 3EICA 4K2XA 4FNIA 1I3OB 2GO8A 2I5JA 2ACYA 2BM0A 1RWNB 2Z8QA 2CNKB 4LR8A 2V69A 3BYRA 1SL2A 4Q0BA 4C97A 3BM7A 4ZVTB 1BE4A 4OX7A 3TZZA 2KO1A 2AYGA 2I0XA 5J1EA 1UPPA 3EWGA 2W4CA 4P74A 3J7A1 5F9NA 2HRYA 4NI2A 3S8SA 4WFAQ 2K8GA 3BGRB 4ZVPB 2H3EB 3SYZA 2KRBA 3I9V9 3PHTA 1I94J 4K59A 1VS3A 3OFGA 3DRRB 2OMOA 2U2FA 1C4CA 4OFZA 1JX4A 5GAGU 2BEFA 4I6WA 3SDEB 2IVFB 2EBEA 2WBRA 4WBFA 3H2UB 1QDUB 3UN2A 4YR0A 2H51B 2IPOB 3SCIE 2G1DA 2EEYA 2ZHOA 2B9YA 4MKAA 4C2MA 2FD2A 1WDTA 3D1HA 4DV3J 2HWTA 2OO4A 4DCPB 2AYBA 4WWSA 1XR7A 4QIWD 2DCUB 1NAQA 4EGLA 2GHPA 1H7XA 1RUSA 1YLXA 4ZKAA 1PCAA 2I2YA 4JYAF 1AFJA 3NGKA 3BDEA 3H2VE 1SH3A 4ZVRB 4CCHA 2KDOA 3AXMA 5D8HB 3KLIB 4JV1A 4LFCJ 3J81j 2J0QD 2HFUA 1YX2A 2LQBA 5HBMB 2Y1JA 1RTHB 3I82A 2VBZA 5J2QA 1KP6A 2D41A 4UY85 3AB4B 4DZDA 1LXNA 5IFMA 1EQ0A 1C1CA 1V3SA 1NK0A 1WSVA 2FJBB 3K2YA 5CABA 1FKAF 3NCPA 4W92B 4J9OA 2AIRB 3PJWA 4JYAJ 4LSZB 3ZFVA 4WP8A 1REVB 3MM7A 4CLUA 3HFZB 4EEYA 2V8HA 4M5LA 1JLBA 3CCUS 2E7VA 1F6TA 2OKQA 2E5LF 1CS4A 2UXDF 1HW8A 3TAMA 2FZKB 2ZNYA 1NNDA 3LAKA 3CCTA 1QSYA 3DRPA 4K4TA 2WVBA 4USHA 2YKMB 3O6QA 4YB7A 4C8OA 1OYDA 1RXOB 2P6SA 1RAFB 3QGIA 2CQ1A 4LRBA 4RW4A 2MQQA 4B9TA 4ZP8A 3PM9A 1REGX 1S59A 1TR0A 2HMIB 1H72C 2XYGB 4NZ6A 1VISA 1FI4A 5KG1A 3UW1A 2GCFA 3J7YI 4DPOA 1HPZB 1R8CA 4WP9A 2JEIA 2B0GA 2GAHC 5KG7A 5LMNF 2W9CB 1VBZA 4ZMMA 2LKZA 1NLKL 4YP3A 1TL1A 2A10A 3M4XA 5LSRA 5AXMA 1JNZB 2XM3A 2RQCA 2HLTA 3AJ1A 3NXZA 4HDHA 1YBTA 1BQXA 1RAOA 2H5EA 1BQNA 3LPEA 5ETVA 4A8OA 5A0YB 1AUSL 1DHMA 2E66A 3HHKA 3R5AA 1ZTWA 2BOPA 3MXHP 2C3UA 1XWLA 5HAOA 2B51A 2HURA 2L41A 1SC6A 3ICLA 1N5SA 5F8HA 1RT3A 2HHHJ 3OVSA 2R8KA 2F4VF 3M9MB 3CCSS 1RZMA 3IN5A 2GAGC 3FMWA 1AA1B 1CJUB 1D0EA 1VQKS 1RT5A 2QL5B 2YKAA 2N82B 2AGQA 2MLZA 2OIHA 4ZPBA 1MN9A 3FJ2A 5GADU 4CLWA 5DETA 3W2WB 1Y5LB 2DHXA 2YKQA 4ZVGA 3DDKA 1S7HA 1V3ZA 3NS5A 6AT1B 4X66F 2NR0A 2KG0A 1HBNB 2OLWA 3EGZA 2R7SA 3GTYX 3NGDA 3SZ2A 1J5EF 2HHHF 1T94A 1F1BB 1RAJA 2ZWPA 1NCLA 1B4SA 3HVTB 4F2RA 1HNVB 2M88A 2KL8A 4IH7A 3CF5Q 3EZ5A 3D0IE 4ED0A 3HJVA 1CJTB 5D6GA 2ZKUA 4U7CA 4QR0A 3MCNA 4CLSA 1URNA 4R0EA 1HKAA 3I5BA 1HNIA 2W2MP 1ZOTA 3CJ3A 3RAQA 3EM1A 2AJ1A 2ZH9A 3K5PA 3W62A 1JLEB 2HZVA 5B0CA 2XNQA 2GVDA 2F7VA 2H1YA 1WI8A 5JVHQ 3B4MA 4O3QA 5GMDA 2ADCA 3NNAA 1R43A 2LQ8A 3KWMA 1LWCB 4BC7A 1L3UA 2DGUA 2A18A 4KGMA 3DLLQ 1GTHA 5IT4A 3GIRA 4DX8H 5F8MA 1NDKA 3MCSA 1REVA 2GMLA 4HHJA 3TOQA 4JI3F 2B4PA 2IRUA 2V34A 2AJ4A 2LYVA 2POKA 3LP0A 2RHSB 1LW2B 4LR7A 3V4MA 2Q6CA 4KFBA 3C2PA 3FFIB 5JXSA 3CD6S 2GIQA 5GAEI 2ABYA 3LQVA 3HI9A 2F9JA 3Q8UA 2GGPA 4TQRA 3TYTA 2CXEA 3T6BA 3QAEA 1YJ9S 1TZ0A 2DXFA 4G65A 1XC9A 3OTDA 1IBLJ 2DNMA 4O23A 2QFJA 4NXNF 2VG5A 5KFPA 1HI0P 2Z56B 3BEGB 1FXRA 4E8UA 4DU7A 4JI6F 5ITHA 3A4TA 2HYIB 3EGNA 4J5OA 3W9JA 2I9SA 1IKYB 1U2FA 3IBFB 5GAHI 3H25A 2CNOB 2E5IA 5FD1A 4AD6A 1X4DA 5C7PA 4G3IA 2AX1A 1WHVA 4F8RA 4WP3A 1YBUA 3AH6A 3QWPA 3A3PB 4NLYA 2MLXA 2W8LA 4RW7A 4QBUA 5IXUA 2LU2A 4Q7AA 3CPWR 4MIWA 2AMCB 4B02A 2JX2A 3H0PA 3DRRA 2BR0A 2CAJA 4M5NA 4I0WA 3ZZTA 3HZEA 1Q7LB 3KLVA 1D3WA 3M6WA 6FDRA 2G2ZA 4CLLA 2CVEA 1PAUB 3EDQB 4ECVA 4ED1A 4DF8A 1OMSA 1TKXB 4WYLA 3TAQA 3O2IA 1U24A 3S7RA 4F2SA 2Q6BA 2FPHX 2MTLA 2YWKA 3ETOA 3DI6B 2LDYA 4WIIA 1SC1B 1VFJA 3KLIA 2F3JA 3NRBA 3EUNA 3ZO7A 3EGVA 3KHHA 1RBLA 1S9EA 1ZA1B 2LCWA 2MSTA 4CLZA 3AXKA 1KONA 1NM2A 3UR3C 1RTIB 2JLEA 1T9TA 4HTJA 2Q3PA 3CCQS 2FC8A 1K0VA 2YNGA 5J1PA 2QLJB 3W66A 1G1XA 3MEDA 5EWEA 4ELUA 1GX5A 3I96A 3K5MA 4PUOA 2YQ1A 3C16A 3WDOA 4ZK7M 1CQMA 2Z4PA 3NP5A 3MCOA 3FQLA 1FK9B 2DNZA 1RT7A 3A1YG 3G6YA 1FHTA 1FFGB 4NASA 3TUIC 3B6BA 4G6VB 1RABB 1T9XA 1X4AA 1WG4A 2MQLA 2DGWA 3M30A 4HL9A 4UTGA 3U7JA 5J2PB 4AL7A 2HHQA 3KK1A 3TAMB 3RTVA 5I42A 1XEZA 4USWA 3OLAA 1LOUA 4NLDA 4RW9A 1NB7A 1CJVA 2RH3A 2YNHA 2KFYA 3J7AN 3OTOF 2HRTA 1RBAA 3V6KA 3MM6B 1HI1A 2RU3A 3J7YU 2BQ3A 1TUGB 2XWXA 3EMTA 3GFYA 3QATA 2IAJA 3OHAA 1DQAA 1WC3A 3VVTA 4PZVA 3TEGA 3V81A 4DFJA 3WC2A 2HBQB 3AFGA 3BBBA 3DN9A 2LA4A 3I5CA 1YSJA 2ZBRA 2D3O1 4DDFA 1HA1A 5L9XA 2P9GA 3QIPB 2CPJA 1RE1B 2MKHA 3N5BA 4C0HA 3PJXA 2HWHA 2FDNA 5B0BA 1YJ7A 5J1NA 5T7LB 3RRHA 1RACB 1Q5VA 5FDLB 4CLPA 1CJKA 1YJNS 2R3VA 2DISA 4GO7X 4DL3A 4DR7J 1Q16B 1Y11A 5I3UA 4QIVA 3H2LA 4URSA 2QA4G 1WC6A 4ECUA 2LFVA 5DLGA 2GQQA 1N5VA 1TL3B 2BE2A 2BJ8A 2Y1LB 1NSKL 3DYAB 1JKHA 4QJVA 4DXLA 4DR7F 1I1GA 1ZZFA 3HHLB 5LJ3Y 2EG2A 3Q8RB 4DV0J 1SPBP 1AUDA 1W26A 4FKYA 4FF4A 4KE5A 5KFLA 1GXUA 4OHWA 2IA0A 2G2OA 1GK8A 4USKA 4JI0J 3G71S 1SQGA 5AE3A 1GNKA 2W4PA 4PEOA 4BBYA 5FJ4A 2J0WA 3R6LB 1WEYA 2JZ5A 3H42A 4NI2B 3RAMA 1NJWA 1TAQA 5DGAA 1IN0A 4A4JA 1S9GA 4ECXA 2VQFJ 3Q83A 3D68A 3G8QA 1JLQB 2KYXA 4X62F 1FKOB 2GV1A 3QAUA 4M5IA 3D0GE 1DRZA 2UXCJ 3ISND 4C98A 4V19X 1VQMS 4OYBA 1B0PA 3AD8C 3CD5A 4JI8F 3AD9C 3GJQB 1V5VA 4BC9A 4K50A 1HMVB 5CD4A 1NDLA 4RUAA 2HIQA 5IS2A 2KKHA 2YNIB 4OYIA 3T5KA 2I1RA 1Y10A 1EP4A 2KVQE 3BSAA 3DU5A 4ZCKA 5C25B 2DRDA 2VQEF 4JI7F 1FWKA 3MWBA 3BSOA 2CZ9A 3OR2A 3OUYB 3R1LA 5F8NA 1WHYA 3SQGA 3WBZA 5E3AA 2V4RA 3CJKA 2GMJA 3GV5B 3OTOJ 3D1QA 1KN6A 2VA3A 2CQCA 1H0HB 4QPTA 4LF1A 3RB0A 2ZWOA 1RHRB 2NXNA 2R42A 2W24A 5L1KA 2ADBA 2FUG9 2UV8A 5KOWA 2QN6B 5F8JA 5AXLA 3BN4A 2E7WA 3X1LB 1ZZNA 3IM8A 3C16B 4L3KA 2OPRB 3PACA 2QA2A 4CTAB 3FZ2A 3JB9k 2IJNA 2FGCA 2Y9HA 2GQCA 4DPTA 4OZ5A 2HGLA 2OSRA 4DR1J 2YVSA 3ISZA 4HI2A 5T14A 4NRTA 4USTA 2EFQA 3A8EA 2M8DB 4PYAA 1VLYA 2M3DA 5F9LA 3KK1B 1VQ6S 5FLXU 5C25A 1SJ4P 3MM7B 3GIIA 1VQYA 1IBMJ 2IMOA 4ZCMA 2AQ4A 1RCOB 1S1VB 4F50A 1XNRJ 2H4YB 2XMJA 3SEOA 3MUMP 4WXWA 3BQ1A 4OI6A 2R2RA 2OH2A 3NY0A 4LFAJ 1QUPA 1UJ5A 3J7Z5 2HQGA 1ROFA 3DRPB 2NPFA 3R97A 4JI2J 2GO9A 2YX4A 4CRJA 3M8WA 1RT1B 4ZLPA 4PPDA 3KK2B 4CYUB 1JXEA 2F4FA 1AXQA 4Y00A 5GMEA 3QIPA 1B0VA 1NJZA 4A8MP 4NYOA 1VGYA 2JEFA 1T9VA 1FWPA 4K4YA 3D28A 4F67A 1SKWA 4QR1A 1VQNS 2E5HA 2J7WA 1HBOB 4MFBB 1IBKF 1HL6A 2IJFA 3PW4A 1FE0A 2VL1A 3RBZA 5KFRA 2VA2A 2X1FA 2EFPA 4OYAA 3MMCB 5LL6d 3TEHB 5I3UB 5HSPA 3VAHA 1K1QA 1S1VA 2AKWB 1VHIA 1ZAXA 2HBRB 3LGHA 5DLFA 1RYSA 1LV5A 2UXCF 1X4GA 2V68A 2RF2B 1IJEB 3P4UB 4JBCA 3HD1A 2CJKA 4DL4A 4LRCA 3DXSX 2HHSA 4F04B 3T1HF 1E6VA 1WC5A 2IRYA 4RW8A 4A47A 3K59A 2VQEJ 1WNEA 2UVWA 4Y34A 3DHWC 1ZM4A 2O1PA 4OYMA 2HVIA 2BW2A 3KLGA 3SCJE 2NXCA 3CDBA 3MMBA 1VCTA 2B4OA 2MHNA 3QIDA 4EBEA 2C2ZB 2DR5A 2ILZA 5AT1B 3NBPB 1KQGB 1TFWA 1RLCL 2HHWA 1EIYB 2CJQA 2LA6A 4PQAA 2XSJA 3JS9A 2BM1A 1X9SA 2QX0A 1TKZB 5K5MA 3RU0A 1PJ7A 4Q44A 4RX6A 2RVJA 3LA0A 1FA0A 2FHMA 2LEAA 1H2UX 4CH1A 2MQ8A 2CPHA 1UEUA 1HW9A 4YEAA 1E6VB 3LGMA 1HWIA 1FK9A 3NGTA 5CCLA 2G9OA 4UZCA 2NREA 1GMWD 3UVJA 5HANA 3W9HA 2WRMA 1ZM3A 3O1LA 3VGTA 4D3HA 2XHWA 4HYKA 4K4ZA 1NB2A 2E7XA 3N79A 1WHWA 4OZNA 4PG4A 3MM8A 3UFCX 5J1EB 4RNMA 2DRBA 4PABA 2GHWA 4G1PA 5A76A 2L9DA 2ZHAA 5E5NA 2J6TA 1YRUA 1VC0A 5KFOA 3TAPA 4YDDB 4EYHB 1RWWB 3CB4A 2W7OA 3IG1B 2CQGA 2G4BA 1M1KT 4OHYA 2UVUA 2ZKTA 4OL8A 4QWEA 4E0DA 2FLOA 1KOOA 1OY6A 2L9NA 3ITHB 3L3CA 4LF2A 2ZVIA 2GZOA 3H7HB 4FPIA 3PW2A 1UVKA 4JUZA 3QZ8A 4UUXA 2HNYA 1R31A 1RU2A 5SZTA 4LUBA 2QC3A 2BJ9A 3M6XA 2UV8G 3N0VA 4MMOA 1I5OB 5L1LA 2KXFA 1SIZA 4I56A 4ECTA 1TUVA 2G13A 5HQ8A 1Q8LA 2O66A 3NCRA 4ECWA 1U8WA 1SQFA 2BV3A 2V2QA 2YKPA 4ZPDA 2KM8B 4ECZA 5HO4A 1JLCB 3HHLD 2HFZA 3GSDA 1R8BA 1U1OA 1S79A 3T41A 3SI8A 4JV5F 1RT2A 3WX8A 1F5CA 3PW7A 4OZJA 1TQLA 4ELVA 4IG3A 3UN3A 5F0WA 1LWCA 4DG1A 1HNWF 4CWBA 1BWVA 2QZ8A 3DLGA 1JK9B 4OHZA 4CYUA 1RKJA 1SJFA 1R0CB 1K9MT 1HNXF 1Z4UA 1SUQA 3I9ZA 4DV4F 2QSFA 2VBYA 4F4ZA 3EPGA 3P6YC 3JSMB 1UJ4A 1F9HA 4JP8A 2BRKA 3IR6B 1CC7A 2OEJA 4TKTA 2AYEA 1DTQB 4ETZA 3D0HE 4HACB 1R27B 4YMEA 4DQQA 3OR1A 4I4BA 3J81U 4NCGA 3RB3A 1WF2A 2XS2A 1KVJA 2KG1A 4GRSA 3HVWA 2FZGB 4HHHA 1OQ6A 1X31C 2QA1A 2V9KA 3DM2A 3FBCA 4KV8B 2E44A 2DIVA 3IAM9 3KJQB 4O44B 5D4NA 2L08A 3Q8PB 1R6VA 4DG1B 3TARA 4QIGA 3NGSA 2Y8WA 2XHCA 1IKVA 4F4XA 4RW4B 3E01A 4IH6A 1N52B 4BLGA 1UA1A 1WKLA 2A3JA 1OPZA 1S4EA 2RE1A 4A8XA 1NK6A 2DR8A 1NMEB 2JL9A 1UZHA 1IQZA 4WU2A 4EI2A 2BJ7A 2WB4A 1N34J 4HTIA 2ZH7A 1L5UA 2L9WA 4KH1B 1WF1A 3MTJA 2UUBF 1R0BG 4P2SA 4OI1A 3N5FA 4WE1B 4RUCA 3Q2TC 2KI2A 3QPIA 1MROB 3PV8A 3UDCA 3TZWA 1IKWA 5IZHA 1X4HA 2JFDA 5D4OA 3GIMA 2O3DA 4LSNA 3UN5A 4ANEA 2BBEA 2V4QA 4HT5A 1HR0F 1AT1B 4F4AA 4X65F 5KFGA 1U02A 1LWXA 4C11A 3K8WA 1UJ6A 4DPYA 3K57A 2JC1A 5DRKA 1RHJB 4ZIWA 1J5OA 1DBDA 1JNRB 1CJUA 3G6VA 1NU4A 1RHUB 4J37A 4K4UA 4G1QB 1U48A 3IXQA 1NKCA 5LMNJ 2XYPB 1EAYC 1UW4A 2X7IA 4TY8B 4UY8T 1HBUB 3C8YA 4LRDA 1N6QA 4DR6J 2VH7A 4DBQA 2RHQB 5AJ3J 1VRTB 4J9UE 4IRCA 9RUBA 2R7TA 2W2QP 2L3MA 5KG0A 2UUTA 2UP1A 4NOHA 4ZP6A 2EWHA 3KLHB 2VIHA 5J2QB 4WZQA 2W2PP 5KFXA 4HH0A 2HS0A 4DFMA 1VBXA 4Q8EA 4P6QA 4UOCA 1HBOA 5EX0A 2RKIB 1JMTA 3R9LA 1UW9A 4DS5A 5C24A 4OYWA 4DR4J 2DCLA 4C0OC 3A3NB 4TY8A 5H9FJ 4YB1P 3FCVA 4M5DB 3ZC4A 2H48B 4DLGA 1RB0A 3VAMA 3UCZP 4LF4F 1SUQB 3W61A 3W60A 2B4VA 3V81B 5KFZA 2ZC3A 1O8BA 2NUHA 1LFPA 1S6QA 3I87A 3KG4A 3MTKA 3OTCA 4HH1A 5LXRA 4Q0BB 2Z30B 4YB6A 2HRUA 2CQHA 2CDQA 2K3KA 3FEXB 2OJ3A 1LWEB 5LSLA 2PIIA 5CYQB 3UI3A 5B0DA 3K0JA 4JV5J 1NJIT 2ZZMA 4RPFA 1T8EA 4DR4F 5HP1B 2CJBA 1S49A 3QGPA 1NK9A 1FKPA 2KZMA 4ZLJA 2CA9A 3C15B 4PG5A 2BE7D 2VU5A 3ZXWA 4X65J 2BJDA 3NWGA 4DUYF 2YY3A 1Q8IA 1HLWA 2Z2LA 2PA8D 2N7CA 4C8NA 3IRXA 3M9OB 4O4GB 1FO1A 3L7OA 3CCES 2HPUA 4TQSA 1QE1B 4CT8A 2ZFHA 2ILYA 4MK8A 2XY6A 3BGRA 3WIVA 5HJYA 5E0OA 4AE5A 1M0SA 2EK1A 3KDNA 2NPIA 1P9QC 4K7QA 3BQ0A 2IIHA 3CUNA 4FF2A 3MUTP 4M95A 5JUMA 3CO9A 3Q8QB 5A8RA 3W5ZA 4QWCA 4IFYA 2CQDA 4WPAA 2IM0A 1FRJA 5K8MA 4HT7A 5ETRA 3SIPB 5HQMA 1YRXA 1DZ5A 4K4VA 1HD0A 5C2GA 3GONA 3CD7A 3HP6A 2CJAA 2EK6A 2QG9B 1BD6A 4ZLNA 2J0SD 4WFBQ 1WWHA 2DO0A 2YQ3A 2OTJS 2GNKA 4XK8C 5EN1A 2KXHA 3KYLA 1AFIA 2DGVA 2NCKL 3OBIA 1U6BA 1H7WA 1N36F 1H2TZ 2WOMA 2J9DA 1UZDA 2D74B 4OI2A 2R7WA 2IA6A 3KLFA 3G2XA 3ENQA 1RADB 4DPWA 4I2PB 5AXNA 3A3OB 4KRWA 4ED3A 1L3VA 1DFDA 1H74A 1EARA 2HNZA 2ZBIA 2OPSB 4H4MB 4KPYA 3C19A 2ASDA 1U0SA 3UE2A 3UQSA 1DAXA 1WUUA 2VBWA 3GZ7A 3I6PA 4J9VA 4UQTA 3CCRS 3FUYA 1WKKA 3QJLA 5B09A 4W98A 4YHHF 3FDSA 1HQUA 3A12A 1BXNA 2LQ5A 4I1TA 4FN5A 4OZ1A 3M05A 4QW8A 2AEMA 2EBGA 1TMMA 2JLFA 2RAQA 4TU8A 5DO2A 2P5VA 3CJ2A 1T9WA 2DGXA 1S10A 3C14A 3HVAA 2E5LJ 2MZTA 4HR2A 3RYLA 2VZ9A 2C2DA 4LF5F 4J9SA 2H4WB 4P7TA 1N5YA 4JI5F 1G4CA 3FFIA 3K5OA 1TP7A 2MJUA 3Q89A 2HQIA 5MAOA 3K5NA 4ZVUB 3TVZA 4RW9B 4TYAA 4DV1F 1KLMA 4OJ3A 2R2SA 1ZTTA 4B3SJ 4WCEQ 5FIIA 5KT5A 2IYIA 5M2UA 1KNZA 2DPJA 1TUWA 4J90A 5SUHA 1KBRA 5E3PA 5M2RA 2ZH1A 2LECA 1M5OC 4NEZA 1RTZA 1XR5A 4MTPA 2NQPA 4CNYA 2KM8C 1C1CB 2H54B 2VPZB 1RA6A 4R5PA 1KEKA 3F41A 3N6NA 4LIWA 2JVRA 4PWUA 4LF8J 2RQMA 5F41A 5GAGI 4I64A 4KSEB 2H65B 3KJFB 4ID5A 3OL8A 1S77D 1FVQA 3MAAB 4P71A 1UKUA 4IH5A 5KFCA 3DFEA 1DJ0A 3THPA 1ITPA 1ACMB 1U0HB 3QGHA 2Q43A 1RGVA 1B70B 3CDWA 3DOMB 4S0MA 4Y65A 7AT1B 4CI0B 4DR2J 1M1GA 1PC5A 2FY1A 3F0NA 2QL9B 5E3QA 2VB6A 4NLXA 3TZYA 4ILMA 3IGVA 5ETKA 2VJVA 3S6EA 1AB8A 4X4SA 2BANA 2EW9A 1S0MA 4K4SA 2RQKA 1F3VA 1GX6A 3PFEA 3ILLA 4ELTA 5CCMA 2CVIA 5KFVA 3KDOA 2QA4S 1HIYA 1OS5A 2OI2A 3DC2A 3LGNA 3KHLA 4LRFA 2DGOA 3C6TB 1S0OA 3IC1A 3AOCA 3M32A 4PQUA 1TL7A 2ACMA 2VG7B 2JOQA 2WONB 2W8KA 4Q43A 3GWCA 2ZD1B 3IWXA 1S4FA 4TY9A 3V2UC 1AW0A 2JFKA 1IWGA 1KTVA 3CCLS 1WORA 1RBOB 2W2OP 1U25A 4TNOA 4X4TA 4GKJF 3MR3A 2D9OA 3K5LA 1A0OB 1GQEA 1VBKA 5I3QA 4B9MA 2GX8A 1OJ4A 1U1QA 4OI4A 2BKNA 3D6HB 3ZTQA 4N8NA 3AODA 3PEJA 5CHCB 3VTIA 4CP5A 5C24B 4XDDA 2KN4A 5DQIA 4C7QA 2LQ9A 2P6TA 3LP2B 1HNWJ 1LK5A 3CJKB 3UNYA 2Q1LA 3SFUA 1JLAA 1X5TA 4EO8A 4YY3J 4C8LA 2OPPB 5IWAF 4P7VA 1FE4A 3NG8A 2DITA 4NZ7A 4RO0A 2IC3B 5DM6Q 3EPIA 2B7CB 4C3LA 2UXBF 5KFIA 2DH8A 4ZHRA 2M7SA 3FMBA 1HQEA 3OTBA 3PTWA 2UXDJ 3PDNA 1RHQB 1YBAA 3MMAB 4QQBA 2APOA 2DHSA 3DLKA 2ATCB 1NRKA 3W9IA 5KT7A 4XPEA 3RB6A 3MUVP 1VQOS 2E1CA 2HFOA 2B56A 1VQPS 4RUBA 2OUGA 3DMJB 4DQIA 2AZ1A 4WFZA 1U2CA 1LK7A 2B43A 4MAKA 3SMZA 2K2PA 5KFMA 2LEPA 2UUWA 5LM7E 4V19J 4U7UK 1KLMB 3UDEA 1TELA 1KHVA 4IG3B 2AP6A 3BBFA 4NCGB 5E33A 8RUCA 1WDDA 1LQ9A 3NKYA 2CQBA 2YWGA 3B82A 3C66A 3HLUA 4C3KA 4XTTA 1RAIB 2KHCA 4WYWA 4DFPA 2MKKA 3HSZA 2I5JB 2CQ2A 2AJ0A 4DV6J 1EB0A 1XK8A 7FDRA 4DS4A 1T05A 4B3MJ 5DM7Q 2HIYA 2EFVA 2W1BA 4DV0F 4OI0A 2JEGA 3RUBL 2FC9A 4CM0A 1VBYA 1JKHB 3LP1B 1XMOJ 4UZBA 1RYRA 2DNOA 1FDAA 3ILIA 5A8WB 3TP2A 5IT0A 3FCWA 1S57A 1N5TA 1TKTB 3HFVA 5HMXA 1TVRA 2EVZA 2KT5A 4UF4A 1JJ4A 4B3SF 4EZ9A 3ZZYA 3SQOP 3KNAA 4I2QA 5GMKa 1U0HA 4IO9Q 3R5BA 4DHVA 1NSAA 3R3TA 1FXLA 4H4KC 2CYYA 4A8KA 4OX9F 2F65A 1EKRA 4NMXA 5AXKA 1IKVB 1DQ9A 4PXEA 3GIKA 4NCAA 3IWNC 1YJRA 3A8JA 3UDVA 3LANA 4QOTA 1PILA 4TXSA 2WVFA 3MPWA 2OP5A 2WOMB 2ZH4A 3GG1A 4DX7A 2W9BA 2G0JA 3UDLA 3HD2A 3D9BA 1S1XB 2ZE2A 4LQ9A 4NLPA 1WC0A 1PYOB 3I0RB 4GVBA 4QIEA 5B0AA 3UR0A 1ZETA 4ETXA 2OSQA 1VR6A 1TTHB 2VG7A 3CDAA 3FRYA 3A8KA 1MROA 2BE9B 3CWJA 4ZVFA 1SKUB 1ZS6A 5I42B 3MFIA 1XN9A 1N56A 3DHXA 5KFHA 1TV6B 2XC9A 2XCAA 2R2TA 2BJ3A 4RW6A 3GQCA 4ED6A 3PFOA 1FRIA 4KAIA 3ZZPA 3AAWB 5JJBA 4X64J 1IKXB 1PG5B 1YZ7A 1RT7B 1KVKA 4B9SA 2AEFA 2K1RB 4N77A 2DRAA 4KBIA 1VQ5S 4CNZA 1NH7A 1BY9A 1K47A 1ZM2A 2XMUA 2YWFA 5M2PA 2M8HA 2ZM6F 4ZP9A 3V4IA 1P1TA 4PWDA 3K89A 5DG9A 4DUZJ 5CZXA 2DR9A 5D4LA 1G3OA 1F0XA 3RB4A 1CJVB 2O67A 2DD8S 4USMA 4H4KA 4MKBA 5F8IA 2JRSA 1FVSA 1T03B 2AF6A 4F4WA 3GR1A 3PYEA 4M5JA 5EWGA 2AU0A 1H6KX 2FTRA 4Z7YA 4BDPA 4FBUA 1B0TA 3Q8VA 4RBUA 1PC4A 1RAHB 3GFXA 2H5IB 1HQEB 2MZ1A 2FJXA 5D0GA 2VPWB 3NAIA 4JI2F 5K8NA 3P49B 4HHUA 4F7VA 3GE9A 3JSYA 3EDRB 4ZJOA 1R0AB 2R7QA 3N01A 4ZPAA 2CZVC 3D7SB 5DDQC 3PIPQ 4M94A 1CLFA 5DGBA 2OAUA 1C0TB 4C0BA 4DUZF 3D5MA 2RKIA 2DNGA 4YUDA 2IBKA 2MXYA 2V8DA 2RIJA 4ED5A 4KH0B 4J9LA 2P9EA 4ZPTR 1IM4A 2XLIA 4DR2F 1UVJA 1V6HA 1X5SA 4U8VA 5DG7A 4NL5A 2PT0A 2JVOA 4AFFA 1EX8A 2FHKA 4DR5J 3M7VA 1KQKA 2UZAA 3MMCA 3TZXA 5E7OB 1LW0B 4FBTA 3W64A 1I94F 1A6LA 2FB0A 1X5PA 2R7VA 2VG6A 3OFFA 2OELA 2J9CA 2QJ3A 5HMZA 3TUPA 3KK3A 3DGVA 3PO4A 4F26A 1Z2ZA 1S48A 3KFWX 1YGYA 3KUHA 2VASA 4U95A 5DG8A 1WOPA 3BO2A 5KFJA 3DXBA 1TKDA 2VV5A 1HHQA 3CEDA 3S01A 1URRA 1NBEB 4C8KA 1RDRA 2EXUA 1EHWA 2RB7A 3PRBA 2IDLA 4XAKA 4CO5A 2NXJA 4ILLA 2CDRB 1Z1ZA 4MT1A 5KG5A 4C3MA 1NJXA 2JWNA 4Q5VA 4GKJJ 2YWEA 1N33J 1ZPVA 2ALYB 2XMTA 4IFYB 4IYQA 1X4CA 3DRSA 1WJ9A 2VOOA 4OIXA 3DOKB 3AA9A 4ED7A 1U26A 1D8ZA 2DB1A 3FNNA 3BGLA 2R4FA 1WD6A 4CT9A 5FLXY 4DR3J 2ALZA 2FLLA 4CLKA 4FF3A 2QMWA 2ZJPQ 3HO1A 4EBCA 1FEHA 1JJCB 4GVBB 1JIHA 4FXVA 4K5SA 1FEEA 3CD0A 3PYFA 1RHKB 2YNFA 1CULA 1CQNA 1XIQA 2KZZA 3G86A 2V8GA 1SJRA 2HQFA 1J2VA 3HCXA 4N5SA 3CJ8A 2MQPA 3DRXA 3VHQA 4FPRA 4ZIVA 1ZBTA 1QSLA 2UUCJ 3UD5A 4R8UA 1KFSA 5GADI 2DEIA 3POTB 5GVQA 2QMXA 3BO4A 2XLJA 2MQMA 3BYPA 4KIAA 3PR5B 3G96A 1PBUA 4KKOA 1OSCA 3M2RA 1ZA2B 2QRRA 3R7BB 5B0GA 1R3NA 1SL0A 1R8PA 5EGYA 1T05B 2GHVC 1N5QA 4EO6A 2MGZB 1LWFB 2JLGA 3H5UA 3DMJA 5LXYA 2HAIA 3FKBA 4NLSA 4P52A 1OYEA 1JWWA 4TU7A 3Q24A 4IFVB 4RBVA 1FXDA 2VFTA 2OPSA 4H4MA 1D8YA 4AT1B 2GQ2A 3G8TA 4CLYA 3PYGA 2LMIA 1M90T 3SQGB 4DQSA 3NEKA 3UWTA 3R27A 2XZDB 1VMBA 5KFDA 2FY8A 4ZOSA 3W63A 1TL5A 1K8AT 1ZM9A 1DLOB 1W2IA 5GAHU 1RT2B 2RD5C 1SBRA 2IRXA 4X4UA 5IQ6A 4BS2A 3MHYA 1VRUB 3QJPA 3BN7A 4ZVHA 3QNWB 3HM9A 3HHDA 4Y2KA 5L1IA 2QYGA 1SL1A 1BHNA 2U1AA 3HDSA 4LBIA 2Z2YB 1S76D 4ERDA 4LREA 2GIFA 3CIZA 1GH8A 1LWFA 2GMHA 3FVYA 4MH8A 2V94A 3UPFA 3JSMA 2FJDB 3GCWP 4XPCA 3RR8A 1IVZA 2XO6A 1F3FA 3QQCD 4DCOB 4MK7A 2XULA 2CPZA 2XZTB 1GMVA 4PAAA 3AB2B 2BKOA 4H4OB 4LBHA 3TVKA 5AE1A 1N4LA 1FCAA 3MEGB 3SCLE 2MB0B 4O3OA 1IM6A 4Q2MA 3HVRA 4LF6J 3Q8SB 5IOLA 3RBEA 3E3XA 2GS8A 1RT3B 3FZBA 4TU9A 1X5OA 2BUNA 3UVJB 2ASYA 3F73A 2VDIA 3MOJB 2MKCA 4QZVB 1KR4A 1O6XA 1RAGB 2E5JA 2M70A 3B8HA 2JC0A 3PHEA 4KT0C 4L74A 2WB1D 5LSOA 4X4RA 1Q81T 4C9DA 3E51A 2W7AA 3SSSA 1FD8A 3QFWA 1FKPB 2E1AA 5CD4H 1JQGA 3MURP 1PBAA 3FRZA 4WE1A 3TW0A 1TK0A 2VUGA 4X4VA 2F5GA 2G0IA 2IFXA 2NS1B 4J9NA 3I4PA 4L3NA 2CPIA 2RT3A 3MEEA 4AQYF 5B7WA 1NHUA 4O4GA 3G6ES 8AT1B 1M5HA 2ZBCA 2ERRA 2DNYA 2WK4A 4PR6A 2Y1RI 4GMKA 2PO4A 1N33F 3UCUP 3BGOP 1WHXA 4CLFA 1JXVA 3MR6A 1Q86T 3N6LA 4U96A 1KQSR 1SCJB 1WOSA 1WC4A 1Y5IB 1VQSA 4PXCA 4Y2IA 4FP9A 3T1HJ 4DR6F 2VKZG 3LP2A 1D1UA 1RCXB 2DH9A 2NZ4A 1KVIA 3BBCA 2V4JA 1NXIA 4JI4J 4L73A 1OSDA 1I51B 2Y3YA 1ZAWA 2DGQA 2RQ4A 4OZ2A 4DUTA 2A1BA 1IBMF 2VODA 5AE2A 1QTMA 1RHMB 3T6JA 4ZHRB 2XB2D 4EFAC 3OJSA 4ER8A 3PZPA 3JQKA 4B3OB 2V6AA 4IKAA 2MKIA 1RKIA 3FSXA 2VC0A 4LSLB 4RBTA 4BCAA 2A6OA 4DSLA 2DK2A 3IFEA 4CDIA 2QFIA 3CCJS 5HATA 4OQJA 2YWWA 4KGXB 3V6JA 2XI2A 3DGPA 5G4DA 1FNOA 2D7SA 3D54A 2W7PA 2R2UA 4A48A 1NZ8A 1FRMA 3H5YA 3DRYA 5D0RA 1RLDA 2E1PA 4LF4J 3KLEB 1H98A 2N3LA 1F5AA 3B54A 3CJ5A 3IBCB 4O3SA 1FRLA 5EHHA 5DJBA 4DV2F 2BVZA 4UOFA 1LW2A 5ETLA 2RNEA 2VBXA 4ZP7A 2HNYB 4IUFA 3CNQP 1Y3JA 1N36J 2AGPA 3C14B 3JTPA 1S1WB 2DYAA 1QVGR 1U45A 1PAEX 1Q82T 3H4DA 1GMUA 3ZTSA 1FDDA 4HI1A 3R2CJ 3MECA 3JYTA 3QLHA 3ZZOA 4RNFA 3QT7A 1EQMA 2VC1A 3ENVA 3EJMA 3PG9A 4DUYJ 5ETOA 4NLQA 4NXMF 3DLEA 3CMQA 1J5EJ 4J91A 3V6DB 2ROPA 3ADAC 3P3DA 2KTQA 2OMLA 2IVMA 2YNIA 3F44A 3OD2A 2CPEA 4ZLLA 4DFKA 2C22A 4WZMA 2UUBJ 1IXKA 4W90B 2PN6A 4WKYA 2EC0A 4LFCF 3JQMA
chains in the Genus database with same CATH topology
1M5SA 1KQFB 2ZZNA 4TLQA 4USIA 1WACA 2ROGA 4EWTA 3QJJA 1TKZA 3HHLC 4LT6A 2FVQA 4A46A 2CQ3A 2CKWA 1JB0C 2PC6A 1MW7A 5KFNA 4RW6B 3TO8A 3LOUA 2K7KA 1HNIB 2LU1A 3CCMS 4EUVA 3TANA 3MD1A 5H1SV 3KMSA 1MNEA 3CJ0A 5E41A 3TQ1A 4CO3A 3D2WA 3DLHA 4B9NA 2MYFA 2HGNA 4IFVA 1S9EB 4OI3A 2ZOMA 2DTJA 4M5DA 4X2BA 4NRUA 3DNCA 2F9DA 1A7GE 1IKXA 1H3DA 2CRLA 2FVPA 4B3RF 3KHRA 1XTZA 2QV6A 4PUOB 2B5JA 4QWBA 5EUHA 2PE8A 4XDCA 3LW5C 4C4WA 3TA0A 4ZCIA 5F0UA 2CPDA 1NH8A 1MMLA 1J5OB 2QT7A 1JLCA 4UUWA 3LF0A 4HDGA 2H9ZA 2FJEB 1QJHA 2B4UA 5KFKA 4NYZA 4QIFA 1N6QB 5D4PA 5FDLA 3VAKA 5HLFA 3HKWA 2WTFA 3PW5A 1S97A 3CCWA 3PR4A 3LALA 2OD4A 3VAJA 1U7LA 1IJFB 2O5DA 4F3QA 4K0KF 2ASJA 2BACA 4DSKA 1S1WA 5L39A 3KJVB 4LF7F 2ZC4A 1UETA 1ZPWX 2LQJA 1YQHA 1FESA 3EX7B 2J6UA 2ASLA 4ZPCA 3U1NA 1NK8A 2MZJA 2KFZA 1HNVA 1DARA 2EFOA 2LXFA 4TLRA 3LWLA 4NX9A 4MKYA 5E2QA 4IG0A 4ITSA 2LDIA 3DOKA 1TAUA 1NJYA 3HF5A 4QYRA 3CDEA 4PKDB 4RNNA 2BXJA 1TFYA 1UWBA 1WI6A 2VD3A 3I56S 3HXMA 1X9MA 2CPFA 2BANB 3MM8B 1ZYQA 4X4NA 1CVJA 4QU6A 4DV7F 2YNFB 2HNZB 1RT5B 1BLUA 4RLEA 4Y0FA 1QUVA 5HI7A 1UP1A 5HP1A 5CYJA 3PXGa 4IO1A 2F8HA 2V4JB 3J80Y 2D3UA 3M32B 4PQUB 2DNPA 2XG8A 3JAMY 7FD1A 4RZRA 1HFEL 4PRFA 4NA1A 1YITS 1KHWA 4WFNQ 2R7RA 3CC7S 2Q79A 2DNNA 1RT6B 3PW0A 1TKXA 1QY7A 5CA5A 3BB5A 4NLWA 5CQGA 1U2RA 2XBPA 3GV7B 2HNDA 3MM6A 3TR5A 1S1TA 2KT2A 3EZUA 2MZRA 1OPIA 5K14A 1C2PA 3K7RA 2RDIA 4JI1F 2JSXA 2XNRA 2C3OA 1C4AA 1NHVA 1U1KA 4O4RA 4LVOP 3THVA 3K58A 4NPOA 2YH0A 2YX1A 2CQ0A 1WTBA 2UVRA 2PDAA 4OJ1A 2HMIA 3U02A 1R8HA 1H38A 2MGZA 1XMBA 2FLPA 2FVSA 1YJUA 2V2KA 2DGSA 1FRXA 2PEHA 4OX8A 3C6UB 4KC5A 5F3ZA 1N8RT 4OZ0A 3PY8A 1X4EA 2OFGX 1ELOA 2C2RA 5I4MA 4FNHA 1JLFB 1SH0A 5KFEA 4KO0B 2QYCA 3ZZRA 3VAIA 5EWFA 4DL0C 1UVMA 4Y2CA 3DLEB 3RW6A 2ATLA 1D9DA 3AA8A 4I7FA 4C8YA 5CYMB 3V6DA 3GMGA 2UUCF 3KJVA 2LEBA 3EYZA 1C1BA 4MFBA 2JDJA 2RS8A 1N0VC 3H8YA 4RW8B 5G0RA 4YR3A 2GC8A 1JLQA 4PG6A 1RTIA 2HHUA 4PXBA 1DTTB 1GAOA 3WC0A 5J2NB 4YY3F 1HYSB 1O0PA 3VAFA 2ZD1A 2KJVA 2NYIA 4NMLA 5HMWA 5L8RC 3BQ2A 2RS2A 1I6JA 3JSRA 4ILRA 4Q8FA 2AJQA 2VPYB 4IDKA 1WG5A 1Q78A 2V9WA 4AYBD 2J6SA 3TA2A 1WTFA 4R25A 1YIJS 2LXUA 1R89A 4OJGA 1P6TA 3GILA 1RTDA 3C3LA 1LFWA 3CTRA 2VFUA 3NMRA 2XY7A 2RDJA 1ZH5A 4O3PA 4KHMA 3T9NA 1GXTA 1YVFA 4JI0F 3MPVA 1VQ7S 4NLOA 5D3GB 2D9PA 3I55S 2HLUA 1HBUA 4ID8A 4NLTA 3OXLA 2AYMA 2DT9A 2MKSA 3HVTA 5A6WA 1RISA 3MI7X 5HL7Q 4HKQA 2MSSA 2F40A 1Y7PA 3VQSA 3MEEB 2XO7A 3FQKA 1RT6A 3CGIA 2GA7A 1H2VZ 3KLHA 1KD1T 2YNGB 5A8KA 3NNCA 1CSJA 2JH3A 3KG0A 3G9CA 3LP0B 1WEZA 4ICLB 4EU0A 2ZH5A 1N32F 3MPYA 5KFYA 5HROB 5D3GA 3VCDA 5K8PA 2CPXA 2C42A 3MOZA 3PKMA 1RT1A 3M30B 3QYYA 3MR2A 3NAHA 3WX4A 2AWZA 3HHLA 1E6YB 2KVIA 2EKYA 1EETB 2WCXA 4GO5X 4ECYA 4KFBB 3BS9A 2ZITA 2I8EA 3M2RB 3OQ2A 3G4SS 4IQMA 1N5YB 1T7PA 1QAJA 1UL3A 3KTQA 1V9OA 3QO9B 2OD6A 2KH9A 3M9NB 4B9LA 1TVRB 1VQLS 3UNGC 3MMJA 4KO0A 4CO1A 1T02A 3LO3A 3PEHA 2FVCA 2R8HA 2P9CA 2LXIA 1YI2S 1HBMA 2N4CA 3SSQA 3W7BA 3QLHB 4X64F 4OHVA 3O5TB 3G8SA 5CYMA 3PX0A 3KLGB 3IRWP 1S0VA 2EPIA 1X9WA 1EP4B 1Q1KA 2PI4A 3I31A 3RR7A 4NCBA 1RWUA 3OXFA 4HLBA 3VALA 4DLEA 4IRKA 1X0FA 1Q4RA 3KNGA 3M6VA 1JLGA 3OFEA 3G6XA 1XNQF 3O8WA 4FXDA 1YHQS 2RU9A 3FEZA 3OR1B 2HVZA 1X7VA 3BDPA 2XGQA 4TYBA 2EFGA 4IOAQ 3CMES 1QAXA 3V5RA 1DURA 4NYPA 1ZAVA 1FT8A 4AL5A 3MM9B 3W2VB 1RTJA 1FDNA 1MMDA 1S1XA 2ZE2B 3M8PA 4DR1F 1APSA 4FVCA 3E8OA 3SXLA 2UUAF 3D1OA 4QU7A 1SI9A 4OX6A 3T1YF 4WXOA 2M2BA 2PGCA 3FSIA 4WFXA 4B9VA 1QAYA 3R5DA 3HJFA 3OV7A 5B0FA 2YKOA 3GFZA 2K1RA 2L48A 3GYXB 4OHXA 1ZETA 1HWJA 3CD6S 2VFRA 2YNHB 1JXLA 1SJ3P 2HZCA 4C8ZA 3HFKA 3GFHA 3GG0A 4OMFG 3ZZZA 5CXTA 4B9UA 5ADZA 1FJ7A 2MDAA 2MKJA 4HEA9 1CEZA 1FJCA 2WBMA 4N47A 2BA9A 5J2PA 5KFQA 4O0IA 2XMVA 1OQ3A 1U09A 2R8IA 2V0NA 1U4BA 4CO2A 4Q45A 2MPUA 3TA1A 2VFSA 5L38A 4A8YA 2E1MC 4OZLA 2AX0A 3VZHA 2ZNZA 2JEJA 1M5VC 1S6OA 4DQRA 4IRDA 1C0TA 3M2UB 2C2EA 4X4QA 2HS4A 5HLFB 5A2QY 1BGXT 5HN0A 4LIRA 1U47A 3NNHA 4PPZA 4RWXA 2DNQA 1C1BB 4QWDA 1S6QB 4GKKF 4Y6IA 2C3YA 3ZZUA 3SV4A 3T5LA 5G0RB 2DPIA 2KXNB 1NK4A 1XNRF 1UFWA 4QR2A 2OPQB 4L72B 1HHTP 2RSQA 3BR8A 3AJ2A 1RT4B 3KK3B 4IDKB 3ULHA 4LFBF 2YKNB 1HWLA 5C42B 2F1FA 2IHR1 2ROEA 4NA3A 4O3NA 5MLCV 3J7ZT 2M52A 2RF2A 4FS2A 3ONQA 4NLGA 3BO3A 2HHPA 3FSYA 1F5BA 4WTYA 3BSCA 2LVWA 2GW8A 2K3IA 4BWMA 3H98A 1RTHA 3EGWB 4MIAA 4ECQA 3PX4A 3CT9A 1YTYA 1T3NA 3LWMA 3MM5A 1FTRA 1SJQA 3W2WA 1GXLA 1Z2LA 3H4BA 3ZZ0A 1BQMA 1VQ9S 2HQ3A 2WAQD 4ATNA 6FD1A 4DOZA 2E1RA 1N54B 1RT4A 3HZGA 3DM2B 2X1BA 4LF9F 2OPRA 4CTAA 3CCVS 3H5XA 4I67A 1KFDA 4WKRA 1LW0A 1QE1A 4LVNP 3CDUA 3VR1A 3C46A 4AXIA 3GYNA 2VQFF 3IWLA 3OXGA 1PO6A 2FLNA 3TRGA 1K1SA 2AJFE 3KLFB 4KQZA 1M5PC 3L7PA 5KT6A 2IBOA 4JOUA 2DNLA 1L3KA 4N56A 2FGOA 4RNHA 4FS1A 1VIXA 3CVKA 5KFAA