3CF5Q

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cf5Q00
4PKDB 1Q81T 2MKJA 2LQ5A 2OTLS 2CPIA 1WHYA 3NNHA 3VF0B 5LSOA 2E44A 2DO0A 1YTYA 1VQ8S 2OSRA 2CQDA 2WBRA 1RKJA 3V4MA 3CCUS 5LJ3Y 2ADBA 1U1PA 1NO8A 2KU7A 2JWNA 2PEHA 1WI6A 2EVZA 2KXFA 2BZ2A 3CCRS 3MOJB 2CPDA 2QFJA 5IFMA 3G6ES 3EX7B 4QU7A 2LXIA 3ULHA 2M4MA 1YJWS 2VONA 1FXLA 1X5SA 5GADU 1S72S 2DGTA 4QQBA 2MZRA 1SJQA 3CCES 3CD6S 1WF0A 2DNMA 4YOEA 2KT5A 3HI9A 2RS2A 4BS2A 2MHNA 1P1TA 3VAHA 1K8AT 4V19X 2MKSA 2HGNA 2DGQA 2L08A 1G2EA 4J5OA 2LCWA 1URNA 1H2UX 2J0QD 5LSLA 5DDOC 2MZQA 2MJUA 3I56S 1NJIT 5IQQA 1HA1A 2LYVA 3BS9A 2X1AA 1FT8A 2CQCA 2LKZA 5GAHU 2LXUA 4Z2XA 2DNNA 4OZ1A 3R27A 3HHNB 2RVJA 2RNEA 1WHXA 2MKKA 2XSFA 4CIOA 1WHWA 2KN4A 3SMZA 1XN9A 2J76E 3MD1A 3ZZYA 2MGZA 3BO2A 2BOPA 4ERDA 2DGVA 2GHPA 2AYMA 1WG5A 1WG1A 2K3KA 1WWHA 3UCUP 2DGSA 1M5PC 2CPHA 1KQSR 2YH0A 1SXLA 3VALA 2MKHA 3FEXB 2E5HA 3OW2R 3VAMA 4LIRA 3VAFA 2KG1A 3THTA 2D3OR 1QVGR 1IQTA 5DDPC 3NS5A 2L41A 1U1KA 3NMRA 2U2FA 2GO9A 5FJ4A 1Q82T 2NLWA 5CYJA 2KM8B 5GVQA 2CQIA 2LA6A 1SJ4P 2V94A 2F9JA 2M2BA 1DZ5A 2M7SA 2MQLA 1YHQS 1N52B 3MI7X 1YI2S 1ZZFA 3CC2S 3IWNC 1U6BA 3PIPQ 1O0PA 1D9AA 2CQ0A 2DNPA 2KVIA 3B4DA 4FXWA 5EN1A 2B0GA 4ZKAA 1YIJS 3BO4A 2CPZA 2MZ1A 1VQ4S 1QVFR 5DM7Q 1WHVA 2DIUA 4IOAQ 2DNRA 2DHXA 5LJ5Y 2MSSA 1P27B 2MKCA 3RW6A 5GAGU 1SJFA 2D9OA 3EGNA 2N82B 2KHCA 2KM8C 3MXHP 1VBYA 1OO0B 2KXNB 2N3OA 1BY9A 2OIHA 1JJ2R 2DH9A 4LJMA 5DDQC 1X4DA 5JVGQ 1OIAA 2YWKA 5BJRA 2CQBA 4YUDA 2MJNA 2OTJS 3K0JA 4Y00A 1PGZA 1CVJA 3H2VE 2ZJPQ 1UP1A 2X1BA 2MMYA 3CCQS 2CPXA 2A3JA 2F9DA 2LEAA 1VBXA 2CQHA 3BEGB 3CULA 3PIOQ 2DISA 2OSQA 2HYIB 3G9CA 1VQOS 4WF9Q 3UD4P 2J0SD 4OZ0A 3JB9k 3Q2TC 4ED5A 3TYTA 2LEBA 2M8HA 3MUVP 2DNHA 2MB0B 5JVHQ 4WIIA 1YJ9S 3I55S 3CMAS 5DDRC 2DNYA 4F25A 1SJ3P 2LECA 2YH1A 2X1FA 2DIVA 1VQKS 2JVOA 1AUDA 3N9UC 5ITHA 2RU3A 2L9WA 2FY1A 1FJ7A 4W92B 1VQLS 1M5VC 1L3KA 1X4GA 1X4BA 2J8AA 4CQ1A 3Q2SC 1N88A 2M52A 4W90B 2MYFA 2SXLA 1A9NB 2KRRA 5IM0B 2XB2D 4TU8A 2E5JA 1K9MT 4EGLA 5LXYA 5HO4A 1M90T 1FO1A 2CJKA 1ZH5A 2DO4A 2VOPA 3J7ZT 2N7CA 2CPYA 2Q79A 2DNQA 3S01A 2MSTA 3DLLQ 5DM6Q 3UWTA 1Q7YT 4YB1P 2DHSA 2HGMA 4F02A 1KOHA 2VOOA 1FHTA 1KC8T 4CH1A 1VC0A 2CQ3A 5H1SV 3S7RA 4WFNQ 3CUNA 2MQQA 4UQTA 3G8SA 3BO3A 3LPYA 2JVRA 5GAEU 1N8RT 3CCLS 1R8PA 3CF5Q 2RS8A 2KG0A 3SXLA 1H6KX 2CPEA 1X4CA 3CMES 1VQ6S 3CXCR 2NZ4A 1H2TZ 3CC7S 3UE2A 1VC5A 2XS5A 3EGZA 4WCEQ 2M0GB 2LMIA 1WF2A 4IO9Q 1WTBA 4TU7A 2MQPA 5D77A 2RRBA 1K73T 2E5IA 1NU4A 3LQVA 4C4WA 1DRZA 3R1HA 1D8ZA 2AYBA 2YTCA 4M5DB 1WG4A 2MZSA 2G4BA 1JJHA 3TO8A 4FXVA 2DK2A 5CXTA 2G0CA 2DNLA 2QA4S 1X5OA 2D9PA 3R1LA 3CC4S 1U6FA 3P5TL 5CA5A 1FNXH 1X0FA 1YITS 3CCMS 2AD9A 2DB1A 2FC9A 2OJ3A 1UFWA 1JMTA 3US5A 3CCJS 2M70A 2MQNA 5LXRA 4WFBQ 1WI8A 2HGLA 2DHAA 1M1KT 2M8DB 3B4MA 1U1NA 1N54B 3MUMP 1UW4A 1PO6A 1HD1A 2FPHX 1S79A 3VAKA 1KD1T 1U1QA 2DNZA 2MPUA 4QU6A 2M9KA 3SDEB 1X4AA 3UCZP 4Y0FA 2RT3A 1X4FA 3SDEA 2VODA 2MZJA 2DNGA 2HVZA 1ZZNA 2CQ1A 1Q86T 1VQ7S 2DNKA 3H2UB 1X4HA 4P6QA 2RUGA 2MQMA 2KXHA 1X4EA 1WELA 4WKRA 3IRWP 2LA4A 3L3CA 2ERRA 4RU2A 2CQGA 2XNQA 1A7GE 2DNOA 2RQ4A 2MY7A 1WEYA 1F9FA 1X5PA 4PRFA 2CQ2A 4PR6A 3P49B 3S6EA 2KYXA 2UP1A 3U1MA 1FJEB 1U1RA 1H2VZ 4WFAQ 1SJRA 5IM0A 2EK1A 3G8TA 2KH9A 4UY8T 2FC8A 2QEXS 2DH7A 1DHMA 4TU9A 4F26A 4CH0S 2EK6A 2U1AA 3VAJA 2XNRA 2KRBA 1VQMS 5MLCV 1YJNS 1WEXA 3G71S 1B7FA 3RW7A 1HL6A 1U1OA 3NNCA 3UD3P 3VAIA 3VAGA 2M88A 2CQ4A 3CCSS 3D2WA 2F3JA 1VC6A 3U1LA 3MUTP 2PE8A 2HZCA 5GMKa 2KFYA 2E5GA 1VQ9S 2MGZB 2G1DA 3P6YC 1VQ5S 1VBZA 3TP2A 2I38A 1RK8A 3DXBA 1W2BR 3P3DA 2DHGA 1WF1A 3THPA 1HD0A 2XS7A 4TLQA 3G96A 1R8HA 2FHOB 2N3LA 2X1GA 2RRAA 2DGOA 2CPJA 4C7QA 2XS2A 1U2FA 4A8XA 2DGXA 1M5KC 5D78A 2DGUA 1OPIA 2JX2A 3CCVS 2MY8A 1OWXA 3NNAA 2ADCA 3CPWR 1FJCA 2AYEA 3MD3A 1KOOA 2CPFA 2MZTA 4QPTA 2I2YA 1M5OC 1JJ4A 1DBDA 5HL7Q 4LMZA 1QM9A 3ZZZA 3CTRA 1UAWA 2JRSA 2KI2A 3UCGA 4IOCQ 2DH8A 2DITA 3MDFA 3MURP 3NS6A 2DGWA 1VQNS 2YKAA 3S8SA 4U67Q 3J7YU 5DETA 1WEZA 2K8GA 2MXYA 4C0OC 2ZJRQ 1U1MA 1YWXA 1VQPS 1U1LA 3FEYB 1X5TA 2MKIA 2ZJQQ 3G4SS 2MQOA 2AYGA 2RQCA 2O3DA 2CQPA 4IUFA
chains in the Genus database with same CATH superfamily
4YY3J 3K17A 2LQ5A 2ZOMA 3EE3A 3VF0B 4DV0F 2QRRA 1NAQA 1YTYA 1GTHA 2QIFA 2OELA 3I5AA 1HNVA 5B09A 3JQJA 2BJ3A 1OMSA 1F3FA 4YB6A 2MLZA 4M5HA 1T03B 4ICLB 2LXIA 1X5SA 3GLJA 5BXIA 1QY7A 1SJQA 4WE1A 1IKWB 6AT1B 4JI7J 4FPRA 2EBGA 1MMDA 1TP7A 1S7IA 1JB0C 3GYGA 3BKTA 1DAXA 1SKSA 1LXNA 5KFXA 3C8YA 3QATA 3RUBL 4ENOA 5IT9U 4TN2A 2G13A 4N7TA 1FD8A 2FYXA 2RJZA 2K3KA 1CG2A 1WWHA 2CPHA 1HNXF 3VALA 3BKFA 4ZVEA 4DL4A 2E5HA 3VAFA 2WBMA 4KHMA 1E6VA 1IJEB 2CWKA 2FUG9 5GVQA 3U02A 2V50A 1M1GA 4KH0B 4HKQA 1T02A 2M2BA 1RJJA 3IO1A 3GYNA 3QLHA 1T9UA 1W26A 3NRBA 3PHEA 2KKHA 2H1YA 4QR1A 4X64J 3BREA 4USJC 3C15B 1LWCA 2CPZA 4ELUA 1IR1A 1VQ4S 4O3PA 2IRXA 2W8LA 3DDNA 1GT8A 4B3RJ 5HVHA 3TAMA 1ZAVA 2BV3A 1BY9A 2QL9B 2VJVA 1UP1A 2MMYA 3DOKB 3PX0A 4ED5A 5F8NA 4EZ6A 2VASA 3DYAB 4N56A 2ZH4A 4F36A 2ZD1A 3LANA 1GXTA 3G87A 4F25A 1RHKB 2J7UA 2QJ3A 1AUDA 1Q79A 5ITHA 2J6UA 4XPEA 1TVRA 5E7OB 1S7HA 3VV2B 2XI2A 2Z2MA 2ROGA 2XYHB 4NEYA 5D6GA 2RUSA 2BE9B 2DD8S 1S77D 2SXLA 3QIDA 3OXLA 2KL8A 2E5JA 4EBDA 3MPDA 5MAOA 4B08A 3KHRA 1UVIA 5C5JA 3ZNJ1 3S01A 1HWIA 1EKSA 3J7Z5 1WDDA 3IAS9 1C4CA 3D0HE 4Q7AA 2OD6A 2CVIA 4L75A 1S9GB 1N48A 2VZ9A 2IJNA 1H6KX 3QIPA 2V69A 1H2TZ 3UE2A 5A8WA 3PJ9A 3D1QA 3BGOP 1N32J 4P9SA 3KUHA 3ISND 1BUXA 1K73T 5C2GA 3HMJG 1FJGJ 2MZSA 3IP0A 3U7JA 2VH7A 1X5OA 2F4VJ 2RH3A 1VGYA 1RU2A 1U6FA 4DV3F 3M6XA 1I6JA 4WU3A 3CCJS 2XG8A 3D3CJ 4DV7F 4MK8A 4HTJA 1JWWA 3MUMP 4O23A 2FPHX 5KFDA 3THVA 5G0RA 3MR6A 1DTQA 2P9EA 3NMAA 4B9SA 1RP5A 4UT4A 1Q8KA 1SV5A 1RWPB 3BGLA 2IRYA 1S0MA 4F2SA 3MM5B 3HP6A 1RLCL 3NBPA 1BWEA 1RAEB 1KQGB 2GS8A 4NEZA 3VR1A 3GSDA 3HHDA 2HWIA 2XO7A 4URSA 2FJBB 3D0IE 4ED8A 4AXJA 4ECVA 4AUKA 2W1BA 1DHMA 4CP5A 2LQ9A 3CJTA 3UDVA 3VAJA 3NGRA 5BYSA 3M2RA 3C6TB 1XMQJ 3TAPA 1HR0F 2C3MA 1URRA 4LSNB 2HZCA 5GMKa 2KFYA 2QE5A 3R97A 2GIFA 5HSPA 4P73A 2HFVA 8ATCB 3C66A 4NMLA 1B0TA 3W9JA 2XBPA 3MM8B 4OZ3A 3HDSA 3VVTA 2F5GA 2YX1A 5H9EK 1U02A 3QBCA 3MECB 4K4YA 1HYSB 4WTYA 1KHWA 2W24A 3R5BA 1OSCA 2C3PA 1S1XB 3MDFA 4DX8H 1MU2B 1VQNS 5F9NA 4UUXA 3BYRA 4C0OC 2N4DA 4X62F 1VHIA 3C19A 3TA1A 1D1UA 5D15A 4K5RA 4CWBA 2R8JA 3DI6B 2O3DA 2ZH9A 3RGIA 2BANB 3E01A 2NXEA 3K5PA 2RU9A 8RUCA 2C3UA 1YVFA 4K0KF 2C2RA 3AQOA 2BQRA 3PO5A 3W64A 1N5VA 1LK5A 2EVZA 3MTJA 2CPDA 1B7YB 4UZCA 3EX7B 1N4LA 2O67A 3DRSA 1R0BG 3X3UA 4M8LA 4J9QA 4DUYJ 2UUWA 2RS2A 1IBLF 4NPOA 3W62A 5AXMA 2DGQA 1VOMA 4CLUA 4OYWA 1URNA 2VFTA 1FVSA 4JI3J 3I56S 2OFGX 3D1OA 4BWMA 1DTTA 4CRJA 2IYIA 1T0TV 1IKYA 1MMNA 5LMUJ 3KLIA 3MD1A 2BMBA 2MGZA 1WG5A 3UCUP 1SXLA 1SVDA 2HNYB 4LIRA 5GADI 2D3OR 1IQTA 1EAYC 5DDPC 3NS5A 3NMRA 2QSWA 4OX9J 4M63A 4L3KA 2CQIA 1JLEB 2WVDA 1RABB 4JI6J 1ZYQA 1HKAA 4JP8A 5J2QB 2B4VA 3CJ8A 3I32A 1O51A 3B4DA 4DR3F 5EN1A 3I96A 2AZ1A 1D9FA 4KKOA 2WK4A 4DQSA 5ETTA 5J1NA 1WHVA 1XBWA 5ETKA 2DHXA 2RILA 4NLGA 2IM2A 4KSEB 1N34F 2V8DA 1UTAA 2KHCA 3P8BB 2ZBIA 3DLJA 1X4DA 2YWKA 3PXGa 1FDBA 5J2MB 2X1BA 3V6KA 4ID5B 2UXCJ 5F3ZA 2HHVA 3G9CA 5T7LB 1TUGB 3HPOA 3TYTA 4U8VA 1JLFA 1ZA1B 2VG7B 2GVDB 2OO4A 3CMAS 4OI4A 2B7CB 2H48B 1YJVA 3FRYA 4KJIA 1EP4A 4PWDA 1WD6A 3CB4A 5FDLA 3HM9A 3QMQA 3RAQA 2XB2D 4DPXA 5LXYA 3KTQA 2WOMA 4YY3F 4F4AA 1ZH5A 2HHPA 4PXDA 2Q79A 3DLBA 3TEGA 2G1HA 1U0HA 1J5OA 4DV4J 4OI1A 1Q7YT 3LGNA 2VOOA 4C11A 2HFSA 2GNKA 3QRRA 5K20B 2VBZA 4M5NA 2FLLA 2HFNA 3MEGA 3UDLA 2CPEA 1HW8A 1GNKA 5C42B 4CLWA 2M5YA 2PIIA 4P2SA 2HBQB 3OTCA 3BSNA 1AW0A 3NGTA 2XMUA 1AXQA 3UDEA 4DLGA 3F44A 2V8VA 1NMEB 3R7NB 3KLFB 3TO8A 2P9CA 4DF4A 5CZVA 2H9ZA 1REVB 4Z7YA 3P5TL 4FYWB 2KB2A 4B3OA 3CJ4A 4CT8A 1WACA 4AXIA 2ZNZA 2V9KA 1FNOA 2HK2A 5C25B 2WB1D 3D0GE 4I67A 2WONB 1OS5A 2QV6A 4IH5A 4F4YA 5HVGA 3M2VB 5J2NB 5DS7A 2OKQA 2MZJA 2N7YA 2GVZA 4X64F 3OFGA 3HSDA 1X5PA 2BE2B 5F9LA 5DG7A 1U1RA 9RUBA 2ZDPA 1FEHA 2YKOA 2AJQA 4NI2A 2G2ZA 1CS4B 3OL9A 4G1PA 4ZHRB 1RACB 3HXMA 1Y11A 1YJNS 4UW2A 1L5UA 3VAIA 2CVEA 2VIHA 4WBFA 1UVLA 1VQ9S 4OZ5A 2WCXA 3Q83A 1WF1A 2HZVA 2GJ2A 1VLOA 4IDKB 1M0SA 4LRFA 1OYDA 1RQ0A 3Q8QB 3IGNA 2QT7A 4OJHA 2BABA 4DL3A 8AT1B 1KOOA 2BJEA 4LFAJ 2DEIA 1DBDA 1UFKA 1HQEA 4DX6A 1IBKJ 1U4BA 4CNZA 2K8GA 4KYZA 1H73A 5F8HA 4KPCA 3K5MA 2GMLA 1ZPVA 2VL1A 2YQ3A 2AKWB 2VC1A 2W8KA 2LDIA 2GHWA 2NZCA 5KFUA 2DY9A 1R6YA 2W4DA 1LK7A 3WX8A 3CCUS 3UVJB 2UUTA 1FJGF 3Q23A 2PEHA 2DR8A 1NH8A 3W1YC 2ALYB 3HHEA 3G6ES 1LW0A 2F4VF 1RT3A 2QLJB 4YP3A 2DNMA 1S6PB 1XNRF 2IM3A 3DC2A 1TELA 2J0QD 3KJNB 4F67A 3R5CA 1ZM2A 1UA1A 3CJ0A 1QJHA 4FBTA 2J9DA 2GO8A 2M3DA 2ZNYA 4Y2AA 5KFNA 4KV8A 3P4UB 3O44A 2BJ9A 4CZCA 4RNOA 3CCWA 2L41A 3OHAA 1X9SA 4MK7A 2GCFA 1WSVA 2XQCA 3BDPA 2QA2A 2IAJA 3ZZOA 5CABA 3N01A 4IG3B 1CBKA 4QJVA 4OJ3A 1TKZB 3PIPQ 4X65J 2XZWA 3QFHA 2BW2A 4DV1J 2XLJA 1RGVA 2F65A 1N6QB 4IOAQ 2DKOB 3PDNA 1S6UA 3EZUA 1KN6A 4N8OA 5CYMA 2KM8C 2JZ5A 3PR5B 3HHKA 1EZZB 1ZBTA 3K0JA 4UOGA 4MJKA 1S6QB 2CPXA 4F4WA 2CQHA 4ZJQA 2HYIB 3C16B 2XMWA 3IFEA 1O8BA 3TEHB 2R7OA 5J2PA 2DCLA 4TNOA 1T03A 3D68A 4ICLA 3KLEA 2FJAB 5D4OA 2ROPA 2JVOA 4NCAA 2RU3A 1Q8IA 1APSA 2P2CB 1S10A 2P6TA 1X4BA 5FLXY 1TFWA 1FTRA 1VQYA 3HHLD 2PA8D 1B99A 3DU6A 3WX4A 3BJYA 1JQGA 2HGMA 3BPSP 4FN5A 1C4AA 5IT0A 2UXDJ 3AOCA 1RU1A 1ITPA 4RNMA 2V67A 3MEDB 1OSDA 4B3TJ 2H4YB 1UW9A 3PACA 3ZTSA 3MMAA 4ED2A 2E9ZA 2B9YA 3DRRB 4HEA9 1X4CA 4DUYF 2NZ4A 3TZXA 3CGIA 2QA4G 2WW4A 3MCMA 1U48A 1WTBA 2PMHA 3HHLB 2W9CA 5HJXA 1LWEB 1Q78A 1FWPA 1FEEA 1GMWD 1DRZA 3M6VA 1GH8A 2V34A 2ZEJA 1U6ZA 2E7VA 3N4WA 1KONA 3G2XA 2HHUA 5LMUF 2XO6A 3GIMA 1X0FA 2HFZA 1HQUB 2ZH8A 2MLYA 2Z30B 3BSAA 2MQNA 1RCOB 2R7UA 1U8WA 4USIA 1FWKA 2DJWA 3LPEA 1R8BA 4OX9F 2M9KA 3DOKA 1C0UA 4I6YA 1SH2A 4JI6F 4Y0FA 3OUYB 3VQSA 4O3OA 3DYAA 3H59A 2GFFA 3AFGA 1WELA 2CJ9A 2VU5A 2I5JB 4EEYA 4PR6A 3S6EA 2QMXA 3HT0A 2GA7A 3FNNA 3BBFA 2R8IA 2DRAA 2HNDB 3CCTA 2VQEF 2DH7A 2LQBA 4NZ7A 3A8JA 2AMCB 2PMWA 4KGVB 1LV5A 4E8UA 1QUVA 3G71S 4ZPWR 1C0TB 1U1OA 4CLLA 1HBUB 3CCSS 3GJSB 3MPVA 5B7WA 3LP1B 3P6YC 4HI1A 3QGIA 1VDHA 3KJVA 3KK1B 3THPA 4YR2A 4JI1J 4NA3A 1XEZA 3QAUA 4RBVA 1U2FA 4NYZA 2RMLA 4KGZB 4ZJLA 2V5HG 3C46A 3V6JA 2HVHA 3MMBB 2HS3A 2I2YA 1VI7A 3K2YA 1N5QA 3I82A 3UD5A 3IXQA 4DV4F 4FXDA 3PJXA 5E3QA 2ASDA 2C2DA 3R5JB 3SCKE 2AJFE 5D0EA 1K1SA 1LXJA 5JXSA 5HMXA 3OTBA 3M8SA 1EB0A 5IOLA 4C8MA 2RQCA 1M5SA 1FRXA 1H7XA 4I1TA 1WHYA 3KHHA 2DT9A 1ZPWX 2BJDA 4WPAA 2CQDA 3GFYA 4K7QA 2YKNB 3EDQB 3HZGA 3DRXA 3MOJB 4QYZJ 3MR2A 4W98A 2ZVSA 4TY8B 2M4MA 4C97A 1YJWS 4X66J 2AJ2A 5BR8F 3GFXA 3TVKA 4I2PB 2OEMA 1FTCA 1K8AT 1Y9OA 4FYXB 4R8UB 1H2UX 2OP5A 2MJUA 3QZ8A 3DRPB 3BS9A 3C6TA 3FRZA 4Z2XA 2NXNA 2R7QA 3M8ZA 4LSNA 1XNQF 3BO2A 2HBYB 4F3OA 4EI2A 3HD2A 4ILRA 3T1YJ 1BC6A 2YH0A 2WTFA 4M5JA 3C6UA 5ETMA 4IFVB 4M5LA 1UPPA 1QVGR 4XDCA 1Q8BA 5B0DA 4AFFA 1U26A 2UUAF 2R7RA 1P9QC 1WC0A 5EX3A 3OVBA 4DXLA 2W4PA 4LRBA 4Q0BB 1N52B 4NLTA 2HG4A 1HNZJ 1AT1B 3DFEA 1HYSA 3RYLA 2AX0A 4WZMA 1S1XA 1MU2A 3KHLA 2QMWA 1S9EB 5KFJA 4DPOA 1BQMB 3K5NA 2E7XA 3LW5C 4OI3A 5GAGU 3MAAB 5KFYA 5KT7A 4NXMJ 2N3OA 2BX6A 5KT3A 1D0EA 2XY5A 2OAUA 4KT0C 4P2FA 2G2OA 2ALZA 4JOUA 4F8RA 4ZLPA 1X7VA 4H4OB 4X4TA 3MUVP 3A12A 4LFAF 3GONA 3CD0A 1CQNA 1T8EA 3A3PB 4LR8A 4EWTA 1KLMA 3POTA 4GC6A 3T6BA 3GJTB 2BBEA 1Y5IB 5IM0B 1Y3KA 4ZVQB 5CQGA 1YBTA 5D8HB 3V6DA 1WOOA 2Z0GA 4OI6A 1S59A 4DV5J 4MKBA 1CEZA 5CCMA 2J5AA 5DM6Q 4DU8A 5DJBA 2DHSA 2GMHA 3NCPA 5H1SV 1B0VA 4PWWA 2ASLA 4DUZJ 1WOSA 1XIQA 3FGVA 3JTPA 1TZ0A 2ZM6J 2FJWA 3RB0A 4ZCMA 2E29A 4DU7A 1JLGB 2C2EA 3MZIA 5KFAA 3W63A 2M0GB 1JLEA 3VVUA 3DDKA 5J2QA 4C4WA 3X1LB 4B9UA 2HIYA 3A8KA 4GKJJ 3NGUA 1RT1B 1JK9B 3KJFB 4OYBA 1FKPA 2UZAA 1N33J 1B3TA 1MWYA 1S6OA 1HPZB 4EMDA 3ZZUA 4I56A 5J2MA 1WC3A 2DCUB 5KG5A 4QU6A 4ID5A 4CT9A 5T7LA 2DNGA 3AY0A 4ANDA 3EMTA 4HL9A 4ER8A 3R5GA 2VQFF 4I69A 5D0GA 4QPXA 4DV1F 4PXBA 1RT4B 1PC4A 2KO1A 2YNGB 3ZZTA 2AX1A 1UVMA 3QGPA 2KH9A 2FC8A 2I6WA 1W2IA 5FD1A 1X31C 2KRBA 1XTZA 1TK8A 1DQ8A 1EQ0A 5K5MA 2HRUA 2M88A 4DCPB 2C3YA 2R2RA 5H9EJ 2YNFA 2ZH7A 4AYBD 4RW7A 3AXKA 4P72A 1PIEA 1R8HA 4C0BA 4AL6A 1ZETA 4JBCA 2V9WA 3ZO7A 4XTTA 2WB4A 1S57A 2JX2A 1OWXA 2BM0A 3BSCA 4QYRA 3PRVA 1JJ4A 3NWRA 1FDDA 1WUUA 4LVNP 1JLBA 2H4WB 2DH8A 4H4MB 4J37A 5K8OA 3TQ1A 1U49A 4B3TF 2ZJRQ 4IRDA 1WC1A 1QTNB 3W65A 5C25A 5K14A 2WSEC 3PYDA 4IUFA 2ZKTA 4ZP8A 4PKDB 1K0TA 4K4UA 3JS9A 3M2VA 1NBEB 1KHVA 3R6GB 1TMMA 1LFPA 3BH6B 1EJ7L 1R43A 3PCOB 1RWUA 2BZ2A 3DGPB 4DR2J 4LSZB 4TQSA 4UOCA 1B70B 4CLPA 3H0PA 1T9WA 3H5YA 3TAQA 3VAHA 1JXEA 4OYIA 1CS4A 4K8RA 4ZHRA 4P7VA 3DLGB 1ELOA 1FT8A 1XMBA 3EZ5A 5EHHA 2V68A 4OYOA 4NLQA 4RNNA 1WHWA 4NWBA 3ZZYA 2B4PA 4FPIA 2V4QA 1B0PA 1CJKB 3D1HA 2VKRA 3QGHA 2FDNA 2GC8A 4RL1A 4IDKA 1TL7B 3Q89A 3LALA 2HHSA 1KVJA 3KNGA 3KFWX 2JEJA 1YI2S 1RTHB 1V3RA 4ECYA 4QIWD 4DFJA 4LBHA 2R2TA 1D9AA 4GC7A 3UR3C 1XR6A 4OHYA 4URGA 3ILOA 2A18A 2UV8A 3CJQA 4I0WA 2DNRA 3DKDA 4FS1A 3IMQJ 4GRSA 4M5IA 3IG1B 1CULB 5SUHA 3PYFA 1OIAA 4FS2A 2MJNA 2OTJS 4ZA1A 4LQ9A 3MCNA 2F9DA 5DQGA 5KFOA 3UVJA 4CYUB 4ZN1A 2DNHA 4F4XA 1YJ9S 4OFZA 1TK0A 1DURA 4DPWA 4KHPF 1UPMB 5IXUA 5KFIA 3EGWB 5I3UB 1FJ7A 4YEAA 2WRMA 1S6PA 4NLXA 3HJVA 3Q2SC 4IKAA 1RTJB 4GVBA 4TU8A 3EGVA 1FO1A 1MN9A 2N7CA 2R8GA 1YX2A 4OL8A 5F8LA 1RT5B 3ONQA 1BWVA 4F02A 1KOHA 4BC9A 4ZOSA 2GAHC 1SIZA 1TL1B 4X66F 3J81j 4A48A 2HAFA 2ZE2A 3PKYA 4CM0A 2K2PA 1S1WB 1HHQA 4JV2A 3L09A 2VBYA 1T05B 1NU4A 1ZTTA 3R1HA 1WG4A 3FVYA 1IKXB 5EGYA 2ACMA 4JV1A 4MYTA 4M5DA 2QA4S 1BMQB 3RU0A 2WZ1A 1UVKA 4K4TA 2R2UA 1N6QA 2D3ZA 3JXOA 4ANCA 3GCXP 2M70A 3T1YF 5KFKA 3OSNA 2R2SA 3W2WA 2PFFB 2PI4A 1R0CB 2YKQA 4OX8A 1MROB 1HD1A 1S79A 2RF2B 3NCQA 4I7FA 3C16A 4Q2LA 2VODA 3IM8A 5HAOA 2EXUA 2CQ1A 3TJAA 4C8NA 1HNZF 4JYAJ 4BWJA 2RUGA 3HKZD 5KG7A 3T5HA 3TA0A 1SKRA 4WKRA 2JJ4D 3HD1A 4B9MA 1PAUB 2E5LJ 1S1TB 4DSEA 2ZHOA 4PRFA 4FKYA 1HBOB 4NXMF 1ULRA 3VCDA 3GSIA 4HHHA 3JTOA 2YWGA 4CLKA 3RBXA 4PG5A 5M2PA 2ZC3A 5E3PA 1S1VB 4LF2A 3UD3P 1VC6A 3MEDA 5IV3A 5F8JA 4USVA 3V4IB 2CNLB 4ZP9A 4UQGA 1RWMB 2CPJA 4AL5A 3SCIE 2XHCA 2DGXA 4DL6A 2XY6A 4QIVA 4F7VA 1LWEA 3H40A 4F3QA 1RISA 3OTDA 1DQAA 2FZGB 1X9MA 4DV5F 3VZHA 1QM9A 2CJYB 1YRTA 2CZ9A 4ZP7A 1S0VA 4M1KA 1RT6B 4DUZF 1NLKL 4PG4A 2ZM6F 4WFYA 1AZSA 2MKIA 5B08A 3IA0A 5DZ7A 2MKJA 1GMWA 2FIUA 4FF1A 3FSXA 2C2OB 1R0AB 3ELHA 4KR0B 3F0NA 1RDRA 2HHTA 3RZAA 1HMVA 4DS4A 3CSKA 3CCRS 1HHSA 1VRQC 4NLDA 2AJ1A 2HPUA 5HVFA 2GAGC 4GKJF 3IBFB 5AE1A 3IGVA 3JYTA 2ILZA 4ILLA 1S72S 4Z7CA 2DGTA 2D3O1 3H5SA 4KFBB 4JI5J 1N33F 2HNDA 3PVXA 3PNIA 3NAIA 2ZH2A 1KLNA 2OD4A 3FMBA 5IQQA 1C0TA 1WKKA 3VZIA 1HBUA 5ETOA 3PY8A 3TJ9A 1YRUA 4DR7J 4J9KA 4E98A 2GHPA 1JLCA 1WG1A 1V5IB 3KK1A 2FZCB 2MKHA 3OW2R 3P5BP 4L72B 2R8HA 1IWAA 1EX8A 5FJ4A 1TTHB 3DOLA 2V94A 2F9JA 3MEKA 4DV0J 1ZZFA 1HI8A 2HKEA 3MMBA 2OHDA 3DHWC 1HNIB 3WZ0A 2DNPA 1WJ9A 3BO4A 4K4SA 4LR9A 1NZAA 1U2RA 4ZIVA 3KMQA 1SJFA 3EGNA 5SZTA 2HQGA 1TL5A 1LQ9A 2OIHA 2DH9A 3I0SB 5E3CA 5DG9A 2HMIA 4WWSA 1WDTA 1RTIB 1K44A 2FY8A 1BGXT 2R8KA 5HBMA 2YKNA 1XR7A 2OPSB 1LKZA 2LLZA 5HN0A 2QN6B 3I5BA 1QE1B 4CM2A 2DIVA 4TY8A 2A0FB 3SSSA 5IT4A 4W92B 4OYPA 4W90B 3BN7A 2HQ3A 2MYFA 2KRRA 3KNAA 4R8UA 4Y2KA 3PEJA 4U7CA 3NXZA 2DHHA 5HMYA 3DRPA 2XMVA 1I3OB 2BRLA 4OZNA 1JKHA 3CDAA 1C1BA 4C0HA 1SL2A 5HATA 3HSJA 4DR2F 3TR5A 1CJUA 2ZBPA 1FXDA 3EZOA 1XR5A 5IQ6A 3EGZA 2PO4A 4WCEQ 1HBNA 2W2NP 5DGBA 4TU7A 5KFSA 4CLFA 1V6HA 2RQMA 3KG1A 4WP8A 3BM7A 4I68A 2PGCA 4WP3A 1V3SA 5L1LA 3UQSA 4LFCF 2R7TA 3NP5A 1S9EA 1R7IA 3ZZ0A 1BQMA 4NLUA 1T3OA 1RBOB 2K7KA 1RYRA 3OT9A 3H7HB 2WVFA 2ZWOA 1N54B 1PG5B 3MFIA 3TI0A 1H74A 3SDEB 2ZBRA 4TVAB 3EWGA 3K7RA 1BLUA 4HVZA 4ZPTR 4DFMA 5ETPA 4H4OA 4MAKA 3GG0A 1NK9A 2DNKA 3H2UB 3IRWP 1VISA 2F1FA 2LQ8A 4HHUA 3MR7A 1SQGA 3MM6A 3M2UB 3U1MA 5IM0A 2BQUA 3AD7C 4CI0B 2V8HA 1FRLA 4OQJA 3SI8A 5HP1A 1YZ6A 3TX8A 1TL3B 2XNRA 3WC2A 3KYLA 3NLCA 2Z8QA 2UVRA 2NYHA 2YWFA 2HQIA 2CQ4A 2K06A 1QAXA 2JEFA 1QD1A 1PJ6A 1NUEA 4N76A 3G96A 3M32B 4OZ2A 3M1VB 4KQZA 1QUPA 1GX5A 1MSWD 4C6AA 1JLGA 2RRAA 4FYYB 1WKLA 4NLOA 1FFSB 3MF5A 1FD2A 1N5SA 3AOBA 5HK4A 1REGX 3CCVS 3CWJA 1FERA 1RTDA 2IMWP 5HL7Q 3R2CJ 3FBCA 3R6LB 2DEJA 1RT1A 3D4JA 3OQ2A 5HI7A 2J6SA 1YWXA 2XZTB 2C28A 5A2QU 4ECUA 4PWUA 4PXEA 2VA2A 3AT1B 3GV8B 3G82B 3UI3A 4OX6A 1VQ8S 3H2LA 5RUBA 3AXMA 3TZZA 4YMEA 5IFMA 3HFKA 1RUSA 4I64A 4QU7A 3ULHA 4CTAB 1FXLA 1MMLA 3BQ0A 2V2QA 2YNGA 3HI9A 5HROB 2J9DE 4WYLA 4DR6J 1F3VA 1NEEA 2GJIA 2BUNA 2BKPA 4RR5A 2XSJB 3T1HF 3MOZA 1UMJA 2F40A 4OMFG 4RO0A 1HA1A 4K2XA 5GAHU 2AF6A 3CE8A 1D09B 3KK3A 4K4ZA 4RW8B 5K8MA 2XLIA 4JYAF 3NEKA 2F8HA 3ICLA 2E1AA 1VHFA 4DV6J 5HLFA 4F50A 1L3SA 1RZMA 2E5LF 3VAMA 2EBEA 1NSPA 3PW4A 4RW4A 2HNZA 2P8IA 1HBMB 3TA2A 4DG1B 4EBEA 3QSYB 5IV4A 1T3NA 5J1PA 3N5BA 4KIAA 3R5AA 4C8KA 3GTYX 1A6LA 3P96A 2RDDA 4C8ZA 3FCHA 4FNHA 4FVMA 2Z2ZA 3FFIB 4H4MA 4OLOA 2NPIA 1LNQA 3HZEA 4OYAA 4TYAA 2DIUA 2HRTA 1P27B 4UUWA 1TFYA 1ZA2B 2N82B 1LW2B 4QBUA 3RAXA 2H65B 1AA1B 2KXNB 3V5RA 4U7UK 1IBLJ 4LJMA 5KFLA 4QIEA 5JVGQ 3LO3A 4HACB 4YUDA 1Y0HA 3LAMA 2RE1A 3PR4A 3KK2B 2A3JA 2LQJA 2DISA 3R9LA 2IM1A 2WSCC 2WHOA 5KFVA 1DLOB 1DFDA 2DNYA 2X1FA 4J9UE 3M9OB 3L7PA 2IC3B 2YKMB 2M52A 2ZDOA 3L7UA 3HVTB 4EGLA 3ITHB 4OV6A 3J7ZT 2HHHJ 2CPYA 1H0HB 2DNQA 3DLLQ 4CNYA 1FRMA 2HRYA 2HVIA 2HQFA 1BQNB 3ILIA 4K4VA 3PV8A 1CJKA 1JNRB 4C2MA 4M95A 1TMJA 5KOXA 5KAKA 4UQTA 2PT0A 1VJQA 4EUVA 1TL7A 3SXLA 5A6WA 1U25A 1VC5A 3MEEA 1U0SA 3ETMA 3A3OB 4LF5J 2BJ7A 4R5PB 1X60A 2F7VA 2UUCF 3GE9A 3SV4A 4Y2MA 2ACYA 4NLPA 3SBMA 5M2UA 3GIKA 1FNXH 1BXNA 4I2QA 2XMJA 4DR7F 3IS9B 1T11A 4ZJOA 4DSLA 1QDUB 2FC9A 3EYZA 3FQKA 1CULA 3IM9A 1ZS6A 3CJKB 1Q0NA 1JLQB 4ZVSB 1U1QA 2UUBJ 2DNZA 3GYXB 3RBDA 1NB7A 4CYUA 2D7SA 3JAMY 5L38A 2ZH3A 2FTRA 1H7WA 3PHTA 5E0OA 1FKAF 1VQ7S 1X4HA 4LVOP 1FESA 4WFXA 3AAWB 2BDPA 4NZ0A 2A6OA 2UP1A 3V2UC 1RTJA 1SJRA 3OV7A 1SI9A 3BBBA 3AJDA 3DHXA 5JMNA 1C1CB 2FJEB 2NXCA 4DCJB 1RT5A 2NUUG 2JH3A 3QWUA 5CD4H 1UEUA 1N5YA 3TP2A 3QRQA 2O5DA 1KVIA 2RKIB 4DBQA 4Y34A 1RAJA 4PAAA 1SQEA 2B5JB 2Y0BB 2DRBA 2DXFA 3FBBA 3KDOA 4LBIA 2KT3A 3QSIA 4IR1A 3W3SA 2QA1A 1KSPA 2RD5C 2B56A 1S1UB 5C24B 5K8PA 3DLKB 1B64A 4CO3A 3NS6A 3S8SA 3LP2A 1U1MA 3IBCB 3G4SS 1TU0B 2IDLA 1MROA 4OI0A 1Q5VA 4DL5A 4NLRA 2OTLS 2AEJA 2VHGA 1NXIA 3L7OA 1HNVB 2ADBA 1SIWB 2YX7A 2Y0SD 4F0MA 5I42A 1JLAB 5FIIA 1I51B 5IC4B 4WE1B 2H5EA 1S1TA 3GR0A 2VONA 1KNZA 3ETOA 2HGNA 2D3UA 3PTWA 5GMDA 3W5XA 3LH2S 2N4CA 3BDEA 1IJFB 3TOQA 2ZITA 1S1VA 2VFVA 1NM2A 4DLEA 2FVCA 5AE2A 3I0RA 4CIOA 5LMNJ 3UR0A 1KQSR 3V4IA 4O4RA 4HH1A 4TKTA 3QFWA 1FX2A 2QYGA 3NWGA 3QYYA 4C8YA 4Y28C 1DZ5A 5IS2A 2CZVC 2ZUAA 4EU0A 4RUHA 1Z1ZA 4RUCA 4U6PA 3RB4A 4JI0J 2OPRA 4G1IA 3RW6A 2D9OA 5B0BA 1PBUA 1XNRJ 1OO0B 1JJ2R 4ELTA 2ZHBA 4U7UD 3E8OA 2NSCA 3CCQS 1R0AA 5L1KA 1BHNA 1YG0A 1CPZA 5JJBA 2J0SD 2V2VA 2ZD1B 4F4KA 3R3TA 2IVYA 1F1BB 4YQWA 4HT7A 2K7JA 1TVRB 1KBRA 3PFEA 4MTPA 4QOTA 2J8AA 3JTNA 1IVZA 1IWGA 3TVYA 1VK3A 3J81U 4U8YA 1FXRA 4QWBA 4EFAC 2C2ZB 3H20A 2BKOA 1SBRA 2FLPA 3HJFA 2MSTA 2VPZB 3WC0A 3JQMA 2ZFHA 2QLFB 4RWWA 4NL5A 4NLYA 3ENQA 2NCKL 1S97A 4DL2A 1FX4A 2HHQA 3G8SA 3QIPB 2HLTA 5KFCA 2KG0A 3L4BC 5A8WB 2V4JB 2CJQA 4PG8A 3UW1A 4CO5A 3UDCA 4DR6F 2LMIA 5KG4A 2Y1RI 3DM2B 4R0JA 2UXBJ 4X4RA 4KGMA 2VB6A 4FKXA 1HNIA 2G2YA 2XEXA 1NK7A 1LOUA 4GO7X 2W2QP 1TK5A 4DV6F 4RNHA 2DXDA 4Q8FA 3I0SA 5A2QY 4XO0A 2C3OA 4XPCA 2Q6CA 4FYVB 1SV5B 2NYIA 2OPSA 2IRUA 1YJ7A 3U1NA 2HVEA 1QE1A 2VUGA 3MR5A 4P6QA 2BM1A 3G6YA 3MHYA 3L3CA 4RU2A 5E5NA 2RQ4A 5KTQA 1F9FA 4DPYA 2CQ2A 3CO0P 2VICA 2JC1A 4ANEA 1E6YB 4J9SA 2E9RX 3J7YI 4IRCA 3GIJA 5KFWA 2L48A 4F26A 4UY85 2FHMA 1S9FA 3Q86A 3SQGB 2F4FA 1UFLA 4ZPCA 2ABYA 3BH7B 2E5GA 2I38A 1YLXA 2W9BA 2X1GA 2JFDA 2ZVIA 4QZVB 4USKA 2VPYB 4NOHA 4C7QA 1RHMB 5BYRA 1NK5A 3VTIA 5I3QA 2HZAA 4A8SA 2ZOFA 1Q1KA 2VBXA 2AYEA 4C3LA 2L9DA 2HHHF 2FJVA 4WU2A 5THWA 3ZZZA 4Q2MA 4P52A 1KTVA 3ZTQA 2Z56B 2JEGA 1S4EA 3QGGA 1RWNB 3LWLA 2ZJQQ 1RWKB 2QFIA 3WIUA 4KPYA 4IRKA 1Q81T 5KFMA 4CO0A 2VQEJ 2CPIA 4F4ZA 4DWIA 4LF5F 4X2BA 2EG1A 2RIJA 5KG3A 2HHWA 5D3GA 4JV5J 1RHUB 1ZM4A 5CHCB 3DRSB 2PFDA 3TARA 2Q1LA 4NYPA 1U24A 1H72C 1T94A 3D7SB 3QT8A 2UU9J 5EWEA 3M2UA 2W7OA 4BDPA 1F9EB 1GXLA 2UUBF 1DTTB 1TL3A 1SCJB 3HLUA 3CDEA 3T1AA 4JB8B 3VWSA 2KZZA 4HDGA 1IKYB 3TNVA 3KLIB 4V1Ak 5CD4A 1FRHA 2RNEA 5ETLA 1CJTB 2G0JA 1SC4B 3VHQA 2AYMA 3HSZA 4XDDA 1KP6A 5E3RA 4B02A 3M1VA 1HI0P 4KHRA 3THTA 2OPPB 5D4LA 1FCAA 1RKIA 1RAAB 3D9BA 3KHGA 4DOZA 2Q66A 1U6BA 1O0PA 4HT5A 4KKOB 2KVIA 1UETA 3LGMA 2WAQD 4IH7A 1QVFR 1KQKA 2LU2A 1PKUA 2FD2A 5BR8J 5KG0A 3W60A 5LT5A 4J7CA 2CQBA 4QWAA 3I9V9 2OPQA 2FQQB 1RT2A 3UD4P 2A6MA 1JLFB 3CVKA 2LEBA 4NCGA 1RWOB 4PABA 3OR1B 1TAQA 3KMSA 5KFHA 1EP4B 4PWDB 2GQCA 3J7A1 1XNQJ 4MMOA 4CTAA 1V3ZA 2W7AA 1FRIA 2NXUA 5FDLB 2QLBB 3P45B 2HLUA 1M5VC 4PYAA 5GAGI 2WOMB 2XSJA 5KG6A 1M90T 2UUAJ 3LF0A 5KT2A 3B82A 1J5OB 2DO4A 2K1RA 4C11B 4RW8A 5A6PA 2PN6A 1Q16B 1X8DA 3BN4A 3CUNA 3G8QA 1DJ0A 1I94J 3LPYA 1SC6A 1N8RT 3EVOA 5F8IA 1R27B 5IT9Y 1HBMA 3OL7A 4DG1A 5HQ8A 1RSCA 1MLAA 3FEZA 5LL6d 4UF4A 3T19A 5LM7E 4IO9Q 4MIAA 2PEBA 2QYCA 4Y3CA 3VGSA 3N79A 4FXVA 4N77A 1RE1B 3OFEA 1VR6A 5F8MA 4B3OB 3NOCA 3RTVA 5LMNF 2CRLA 4KGKA 3FCVA 4ZCLA 4WFBQ 2KJVA 1LW2A 2LXFA 2H54B 1U1NA 1EETA 4MH8A 5K9FA 3IRXB 2HQDA 4B3MF 2LFVA 4YB7A 2KVQE 3KK2A 2P5VA 2VFUA 3TWZA 1A0OB 2VG6B 3KLGA 2A2DA 3BYPA 3KLVA 4ZK7M 2GVZB 2MTLA 5LOQA 1NB2A 1X4EA 2HWHA 3GZ7A 4K4XA 4ZITA 3D28A 2XNQA 2IC3A 2YKMA 5L46A 1WEYA 2B6AA 2EPIA 1TV6B 5KT5A 4JI0F 3NL0A 3HVTA 3H98A 3EXYA 4FP9A 2W25A 3C3LA 1ZM9A 1NHKL 3DGVA 1NCLA 3DLEA 3ITHA 3JSMB 1MN7A 1UVNA 1JNZB 5AE3A 4FF4A 4R0EA 1B4SA 1RADB 1VQ5S 2GIQA 1VBZA 1TKXB 2NS1B 2XS7A 3O6QA 4PPDA 2FHOB 4IR9A 1HWKA 2DGOA 2AEMA 1NK0A 2XS2A 2OEJA 4A8XA 4YN3B 2IY5B 2Y1LB 1QLNA 4O3SA 2ADCA 3KLHB 1HQEB 2J9CA 4J9MA 3CDBA 1FK9B 4DSIA 1R8CA 4LF4F 2VQFJ 1HI1A 4WYWA 1QSSA 3NG8A 3FBEA 2F8EX 1X5TA 4OHVA 1VRUB 3CJKA 4KTQA 4G3IA 4QR2A 4IH6A 4RJVA 2X51A 2V2ZA 3NNHA 2CIMA 2Y1JA 2E44A 2RQKA 5KFTA 2UXBF 1L3VA 2PA3A 1LW0B 1RT3B 2QFJA 4NYOA 4KE5A 4NLVA 2UVWA 3D6HB 2YWWA 3OD2A 3CO9A 4QW9A 4Q44A 1IKWA 1P1TA 2OGUA 3JSYA 1NK4A 2LCWA 2IM0A 5LSLA 5AT1B 1C1CA 4LRAA 1VBKA 3AA8A 1N5TA 3ZC4A 2LYVA 2CQCA 2ZBQA 1J27A 1TR0A 4OZ1A 2RVJA 1FVQA 3CEDA 3SMZA 3I4PA 2J76E 3DLHA 3W5ZA 2BOPA 2R9LA 3WBZA 2AP6A 1NJWA 3FK4A 2CZ4A 2RKIA 2YQ1A 3K8WA 4OJ1A 4NLWA 1Y7PA 4TYBA 1YQHA 2Y9HA 4DR1J 2IAJB 4YHHJ 5CYJA 4ZPAA 5DQIA 4GVLA 4LSLB 3PW5A 1FDAA 1OPZA 3MAHA 2W9AA 5C24A 3DLKA 4ZVRB 3PRBA 2BEFA 4RPFA 3C15A 5DM7Q 2ATCB 2CG4A 2Z58B 2VBWA 2IHR1 3ZTPA 2DTJA 1VBYA 5KFPA 1UJ6A 5JUMA 1SUQB 3Q8SB 4J9PA 1RAOA 4RBUA 2CADA 2OSQA 3JQKA 1FI4A 5J2PB 5HQMA 3C2PA 3T6JA 4HYKA 1JIHA 2BW7A 3A3NB 3KLEB 1JLAA 1O5JA 2RB7A 4B17A 4DZDA 3UFCX 3N9UC 4KBIA 1DY3A 4ZIWA 1PSDA 4UZBA 2HK3A 3GCWP 2JDJA 1UEKA 3NGSA 4QYZK 3D6TB 1KKHA 3DRYA 5HO4A 3V81B 3PW2A 3BGRB 2ZUGA 2BE7D 1F5BA 1U8SA 2QZ8A 1AUSL 3M8WA 3UWTA 4DR5J 3BQ2A 2CQ3A 4OLPA 3G86A 4JV5F 3EDRB 3MMAB 2YPZA 2DR6A 5GAEU 3CCLS 1S9GA 2UU9F 3I4HX 2W2OP 2W9CB 2CNKB 1RWWB 1OQ6A 2MQPA 1YK9A 2RRBA 5KFQA 1Y5LB 2R7XA 1VIXA 5A76A 3N6MA 1D8ZA 1JJHA 4LRCA 1S5ZA 3W66A 3MGJA 2MLXA 3J7AN 3TQEA 3AODA 5CA5A 1PCAA 3B6BA 1QTMA 2DB1A 4KHPJ 4DZ6A 2GHVC 1ZTWA 3CJ2A 2DHAA 1PO6A 1OY9A 2NQPA 1C0UB 4X4NA 2MPUA 2COLA 2AZ3A 1Q7LB 1VJWA 1Q86T 1U45A 4ZLNA 1X9WA 2C1EB 1G6BA 3MM5A 3MM7B 2DNOA 3TUZC 1VRTB 2ZH5A 2IMOA 1TKTB 2EK1A 2VPWB 3WDOA 5A8KB 4ZVUB 2QEXS 2CJAA 4RW9B 2ZH1A 4NRTA 1YBUA 3D67A 1VQMS 1AFIA 2J0XA 2BJ8A 1S0OA 3RW7A 3QO9B 4RUBA 5L8RC 3NAHA 4WZQA 5B0CA 4Q45A 4A8WA 2D1CA 3KJVB 3RBZA 4WK1A 1IBCB 1U2CA 4NASA 9ATCB 3RJMB 1J5EJ 2V4JA 3T3FA 4LF8F 3MM8A 1BQXA 3DM2A 2DGUA 1WORA 2IJFA 1RT7B 4CLYA 2OI2A 3D6MB 3MD3A 4USWA 2Z2YB 2XMKA 2VG5B 3CTRA 3MECA 3H4BA 1ROFA 4UOHA 4QWEA 2DITA 1SC3B 3LP0B 5T14A 1RAIB 3BB5A 4EO6A 4DSKA 4X4SA 1LWFB 4X4OA 1VQPS 1I94F 2LDYA 3M8YA 3GU0A 3W7BA 1HNWJ 2IYGA 4U9RA 2R4FA 3DI6A 3LA0A 3KXDA 2BANA 1QAYA 3FCWA 1RKJA 2OMOA 1NO8A 1TUWA 2YPYA 2VFRA 4RKUC 1Y4ZB 5FLXU 3GIIA 3FBFA 1CQMA 2ZZNA 1E6YA 5B0AA 5C7PA 4AQYJ 4YFUA 4O3NA 3GJRB 3EPGA 4J5OA 3DOMB 2R7SA 3V6HA 5HMWA 2AT1B 2JL9A 3SQGA 3NCRA 4C48A 1K1QA 2PC6A 2JLFA 3TRGA 1XN9A 4CO1A 2B43A 2DGVA 3C6UB 4GKKF 4OHXA 2KT2A 3MMCB 4RW6B 3N28A 5KFEA 4LBPA 2HNYA 2BACA 4X4UA 1U47A 5KFFA 1M1HA 4ED3A 4L74A 5DGAA 4HTIA 4DFPA 2MQLA 1KEKA 1YHQS 3CIMA 4WFZA 3S1TA 4FXWA 2RSQA 2RHQB 3PZPA 3T5LA 1HLWA 1C2PA 2QGFB 4X4VA 2YVSA 2KJWA 4NLSA 2P9GA 3M8RA 2CXEA 4DX5A 3CJRA 2LP4A 4B9TA 1Q4RA 2XYPB 4ECWA 3FSYA 4J90A 4O44B 1VQOS 1T9VA 4D3HA 3W8PA 4IFYB 2AGPA 3MMJA 1RHJB 1KLMB 3POTB 3PRDA 2VG7A 2GVDA 2V2KA 2HQCA 1JX4A 4RZRA 1FWLA 2EWHA 1VQLS 4CQ1A 2HS4A 2GJFA 3J80U 3ISNC 3V6DB 2E1CA 1GK8A 4A8KA 4KO0B 2XWXA 5D4NA 3TANA 1Z4UA 1PJ5A 1R8AA 1RBLA 3JSRA 1JJCB 2HHXA 4FF2A 2YNIB 1OJ4A 1CJTA 3S7RA 4WFNQ 4DI6A 2JVRA 3ZNUA 1R8PA 3CF5Q 2CWXA 2OPPA 4L6V3 4DPTA 3BKUA 1WF2A 3QJPA 4ZLJA 5D77A 5C42A 3IR5B 3BR8A 3LQVA 1UZDA 2G0CA 3KLFA 3HKWA 7FD1A 1REVA 3CDUA 3IBWA 1FKPB 3W2VB 1F2GA 2BKNA 3HCXA 3RR8A 4NCBA 2OJ3A 4IG0B 4IOBA 3SEOA 3D3BJ 4ZPVR 2X7IA 2AEFA 4HHJA 1M1KT 2XTJP 3T41A 3FZ2A 1AROP 1PC5A 2B9EA 4DR1F 4DF8A 4D3GA 2Q6BA 2B4UA 2NSBA 2WONA 3F56A 4YHHF 4HH0A 1X4FA 1ZZNA 4KB7A 5J2NA 3OR1A 2PI5A 3QRPA 3GFHA 2CDRB 4J91A 3CJ5A 2CQGA 3CJSA 2MKYA 2Y8WA 3AA9A 2XI3A 2BE2A 3GJQB 4WFAQ 1YRXA 4ATNA 4ED0A 1PBAA 5K8NA 1PILA 3O1LA 3LGHA 1S76D 3T5KA 4PXCA 4LREA 2NREA 2CNNB 1UKUA 5MLCV 2XWYA 1WEXA 3OJSA 3QNWB 1HL6A 4PPZA 5A8RB 2B9WA 1CJVB 2YNFB 2WVBA 3D2WA 1XQIA 4LFCJ 2G9OA 4RW7B 3DXBA 1W2BR 3P3DA 4OHZA 2DHGA 2VV5A 3KG0A 3G6XA 3R2DJ 2N3LA 4JI7F 1IM6A 2Q3PA 4G1QB 3A8IA 3BR9A 4FDFA 3PEHA 4ZVTB 1NJXA 1NSAA 2BA9A 2MY8A 2EW9A 3TVZA 3CDWA 2AW0A 1JLBB 4LMZA 1AFJA 2JRSA 4DR5F 1NK8A 2EFVA 5L1IA 5A0YB 2KDOA 2JFKA 2YKAA 3GB0A 1EIYB 3FMWA 3HK2A 4PQUB 5K14B 3FEYB 4MKVA 3IRXA 3I5CA 2MQOA 2CQPA 4CO2A 4TQRA 2A1BA 2VG6A 2R3VA 2V63A 4NA1A 4ECZA 5HANA 5LJ3Y 4O3QA 3H4DA 1P8GA 1YGYA 3O3LA 4M5MA 2YKPA 2ZBCA 2XYGB 3PFOA 3HVWA 1RYSA 2HURA 1TV6A 2MZRA 4B3RF 3AHPA 1GAOA 4NA2A 3TUPA 3UNYA 3H5XA 4OZJA 2JC0A 3JSMA 2O66A 4WJBA 3UNGC 3PJWA 2FZKB 1N56A 3FUYA 4BHQA 2XSFA 7AT1B 3H42A 4L3NA 4P2MA 3SFGA 4LT6A 4PUOB 2IJRA 4OJGA 1TKXA 4USUA 3C14B 2DGSA 4DCOB 4KH1B 4Y65A 2AWZA 5CCLA 2FLOA 2CDQA 2UVUA 2GO9A 1F5AA 3ZZRA 3OL6A 2NLWA 5CAAA 1F60B 2LA6A 5HMZA 5ETSA 1RXOB 2KTQA 1GX6A 3KLHA 1YZ7A 2VKZG 4IG3A 1R3NA 3AB2B 1TKZA 1FK9A 5GAHI 3HVRA 5DQHA 2UV8G 1LEOA 2MZ1A 4N41A 2LU1A 2ZZTA 3A4TA 3CT9A 2MKCA 4F0HA 1VRUA 4M5GA 3ET6B 3FJ2A 1H3DA 1J5EF 1N32F 4DQRA 2Z2LA 3UN3A 5BJRA 3D5MA 3R7BB 3Q22A 2E9TA 2Y1IA 3T1HJ 2LEAA 2XHWA 3CULA 3FC9A 1S6QA 2FVQA 4DEZA 4ZVHA 2M8HA 1D9DA 2MB0B 3I55S 2IBOA 4DS5A 6FDRA 3MFHA 1I1GA 2L9WA 3UPFA 3HFVA 3W8GA 3EPIA 4GVBB 4YR3A 4ZCIA 2DY1A 1A9NB 3QJLA 2E7WA 2PD1A 2C2NA 3AOAA 3SCLE 1IKVB 1HNWF 4J9RA 2D41A 3K8VA 1NSKL 5B0FA 1FF2A 5AJ3J 1RA6A 5L9NA 2YX4A 4NX9A 4B3SJ 4YDDB 2HBZB 4ZVFA 1NRKA 3UO0A 3OTOJ 3MM9B 1KWMA 3BGFA 2CJXB 4UOFA 1VQSA 1YSJA 4P10A 3KDNA 1RWVB 3NGKA 3PYGA 3QQCD 4I6WA 2ZE2B 1UWAA 2PSZA 4W4MA 3TZWA 1NPRA 4AQYF 3DRRA 3KUGA 1ZM3A 3NKYA 3R8YA 1RTZA 1F9HA 4LSLA 2RHSB 3HHLA 4WXOA 2AYBA 1XMQF 4M5DB 1FKOB 2DK2A 2JOQA 5U47A 3ZTOA 2CNOB 4FNIA 5T41A 2FHKA 3M8PB 1YDLA 3GPAA 5H9FK 3CCMS 1R89A 1WKJA 3W2WB 4OV1A 1BD6A 3PG9A 2ASJA 1HQUA 2HGLA 3EVWA 4RX6A 4NXNJ 3B4MA 4I7FB 1KD1T 3MCOA 1SUQA 4JI4J 1IR0A 2RT3A 5IC6B 4XIUA 1Q95G 4A8OA 2GGPB 3OUYA 2IPOB 1D3WA 5M2RA 1NDLA 4ID8A 1GQEA 2B8PA 3VGTA 6FD1A 2JHEA 5E33A 4ED7A 4Q43A 3GILA 2I5JA 3D6FB 4ZVOB 4CCHA 3H8YA 3O5TB 4ZPDA 3V81A 4NRUA 3BGRA 4TU9A 4MYUA 4C3MA 1Q53A 4BCAA 4WK3A 2W7PA 3CNQP 4B9VA 4MKAA 5DG8A 2A10A 3VAGA 2UUCJ 3SFUA 3K57A 3B78A 1WC5A 1NKEA 1SL0A 3MPYA 3LP1A 4V19J 4L76A 1HD0A 3N6NA 2DVIA 4Q5VA 4E2FB 2GQ2A 2YQ0A 2E1PA 2BOAA 5DZ6A 2EFQA 5D78A 4JI3F 2HS0A 3PW7A 3JSBA 3WQPA 1FJCA 1XERA 2XM3A 4QPTA 1UAWA 1ZAXA 4ED1A 1T9YA 3Q0AA 2KFNA 2DGWA 1QSLA 4A8MP 3J7YU 2XC9A 1AZSB 4IYQA 3MPWA 3PM9A 4J9VA 4UTGA 1FNMA 2MQ8A 4M94A 4BLGA 2WSFC 1HWJA 1FRKA 4ZS6A 1TL4A 2NR0A 1RB0A 2RDJA 2WBRA 2MHEA 1HMVB 2OMLA 4AL7A 1GFWB 3A1YG 2CA9A 1SPBP 3SIPB 5E2QA 3DXSX 3BQ1A 4ECTA 2BYCA 3BZQA 3OJUA 3JYTB 3MM7A 4TLRA 4S0MA 4LF7J 2XGQA 5GADU 3DMJB 1VRTA 3NOGA 3QJJA 4YOEA 2KT5A 5CYQB 1TKTA 3ZTRA 4BS2A 5A8KA 2CUYA 4I2PA 2L08A 4RW9A 1G2EA 3GV5B 1SKUB 2EEYA 2O01C 4MIWA 5DDOC 2MZQA 2UXCF 2AJ4A 1RI7A 3J80Y 4EYIB 2LXUA 3QO9A 2DNNA 1Z2LA 4A46A 1VMBA 3R27A 2YXLA 2MKKA 2FHJD 2AIRB 1JLCB 3KG4A 5C2CA 2W01A 4ERDA 3EXCX 2XGPA 2AHOB 1UCNA 5EUHA 1IM4A 3W9IA 3FEXB 4PCQA 3GG1A 2EC2A 4TY9A 1KQFB 1U1KA 3DOLB 3M8QB 4IFVA 4G6VB 4B9NA 3D66A 4E0DA 1SJ4P 1GEHA 3GIRA 2GIRA 1RT7A 4ZP6A 2M7SA 5E41A 1VYAA 3M9NB 4A8YA 2NPFA 1NPKA 3CC2S 4Q0BA 2VG5A 2GQQA 3T5JA 2XY7A 4ZKAA 4X4QA 3LP0A 4A8QA 1LWFA 5LJ5Y 5EX0A 4YR0A 2Y8YA 2ZHAA 3F41A 4XK8C 4ETXA 3MXHP 2ZH6A 2HMIB 3MAAA 2BJ1A 5KFRA 2YNHB 5DDQC 2VDHA 1UWBB 3MTKA 4K50A 5HBMB 3HHLC 2B8QA 3PIOQ 5AXKA 3HX9A 4WF9Q 3JB9k 2FGOA 3N5FA 5JVHQ 3IR6B 2VDIA 2GW8A 4AT1B 4U96A 4ECXA 5ETQA 1VQKS 2E1RA 1NK6A 3LOUA 3PW0A 3M30B 1K9MT 3DOMA 1UVJA 4DHVA 3K59A 1SB6A 4J9LA 3H90A 2VOPA 1S4FA 1JKHB 2CKWA 1FE4A 2R42A 1S48A 1VIOA 4KAIA 3CJ3A 2VPXB 1C1BB 1P1LA 4P2XA 3RB6A 2V8GA 4ZN3A 3WIVA 2E66A 1CJUB 3MMCA 3KOAA 2FJDB 4RW6A 3ZZPA 4IQMA 5E3AA 5CH7B 1HBNB 3L9ZA 2XS5A 1DARA 3K5OA 4Y6IA 4PG6A 2G4BA 5CXTA 5F3TA 2G0IA 2DYAA 2D9PA 2YWHA 4YB5A 3CC4S 4JI8J 3OL8A 1G4CA 3OTEA 1PJ7A 1YITS 4TXSA 4ITSA 5IWAJ 1IQZA 3I6PA 3KJQB 4WIQA 1HPZA 5DO2A 3CMQA 2OUGA 4CLTA 4O44A 2EKNA 4B9LA 3UN5A 3IAM9 4IFYA 1MG7A 1S12A 2F8MA 3E51A 4ALZA 2FVRA 1UL3A 3ADAC 1IBKF 2KZMA 2LA4A 4C98A 2V4RA 3MM6B 1A7GE 1RT4A 2FGCA 1X0PA 5B0EA 1HFEL 1H2VZ 3DN9A 4HDHA 5HP1B 4KO0A 4L73A 1PYOB 1U7LA 1S99A 2R7VA 4HI2A 1WSRA 2YNIA 4DDFA 4C8OA 2F3JA 5GMEA 2PE8A 3EJMA 2DR5A 1RK8A 5EWFA 4WXWA 1YJRA 4TLQA 1VLYA 2GV1A 1TAUA 5F41A 1OY8A 4CH7A 4ZCKA 1RWXB 1IXKA 2X3DA 2DPJA 3ILJA 1RTDB 2JNJA 4GO5X 2QL7B 3CPWR 4F3MA 1QSYA 4RBTA 2D74B 5AJ3F 4B3SF 3FKBA 4IOCQ 3MURP 3W2VA 3TJ8A 1BE4A 3HULA 4DSFA 1HQ2A 2IVFB 3OTOF 5DETA 4IG0A 2QTWA 4FF3A 2MXYA 4O3RA 5I3PA 3IR7B 3TW0A 3CD7A 3Q8YA 2AYGA 3A8EA 3NS7B 2FVPA 3KKFA 2WW8A 1HWUA 4DMZA 3E2EA 2RRNA 2KU7A 4X65F 5ETVA 4K2JA 1PYTA 2Z4PA 2HFUA 2J0WA 3DGPA 3RBEA 2JSXA 3AQPA 4J9NA 2BRKA 4A47A 4ECRA 4NXNF 4AE5A 2J7KA 1NDKA 1F6TA 2J8SA 2QLWA 4IO1A 3KK3B 4JI4F 4R25A 1LWXA 5HJYA 5A8RA 3DLGA 1CJVA 1WHXA 2IA0A 3PX6A 4RUAA 5HLFB 1XMOJ 5HQLA 3GWCA 2OLWA 2IVMA 1QAIA 4RW4B 2HNZB 5KOWA 3IWXA 4DR4J 4O4GB 2KG1A 3KWMA 3K89A 4G1QA 5J1EB 3D54A 1Q82T 3G6VA 4P7TA 3Q8PB 4F2RA 5B0GA 1MW7A 4LUBA 1NNDA 4ZPBA 4QWCA 2Q43A 3IWNC 1RTHA 2MDAA 2UXDF 3RAMA 5A0YA 2WVEA 4FYDA 1IN0A 1IBMJ 2XLKA 4PQUA 2MSSA 2QL5B 3MPUB 1KFSA 2EC0A 3IG1A 1KVKA 4MFBB 1PGZA 3M7VA 2W4CA 3A13A 2QC3A 3BSOA 3T9ZA 2PDAA 3Q8UA 4AD6A 2IBKA 4I4BA 5F0UA 4EK2A 2B7BB 5DDRC 2LECA 1KR4A 4RU9A 2XMAA 2HVDA 3DDIA 2FY1A 4CDIA 7FDRA 2HFOA 3BV8A 5I3UA 1NPPA 1HIYA 3L95X 2H3EB 4M5KA 2EFOA 3OR2B 5DLGA 2V6AA 3EICA 2Y3YA 1GTEA 1YKWA 4EZ9A 1UJ4A 3MWBA 1FDNA 4USHA 4CH1A 5D4PA 4PUOA 3C14A 4K4WA 1Y3JA 1YJTA 5ADZA 1CC7A 4LF7F 2RS8A 3MEEB 3CMES 1VQ6S 1TL1A 5L1JA 3QT7A 3M6WA 3CC7S 3M4XA 1S1WA 4FZVA 1T05A 3OVSA 3OXFA 4DX7A 4ES3A 1IKXA 4I2QB 2GMJA 4O0IA 4JI1F 3ZXWA 3ET6A 1EARA 3LWMA 3K5LA 1ZOTA 1WI8A 4RLEA 3VAKA 4QWDA 3RRKA 2RF2A 1X4AA 4DQQA 3BPDA 1AYEA 3VGUA 4JI2J 2HVZA 2HSEB 2DBBA 3PKMA 2MEWA 2ERRA 3B8HA 5KT4A 3P49B 2H51B 2KYXA 4LF6J 1HBOA 1WTFA 4NMXA 4UY8T 2VFSA 1IKVA 1F5CA 4PQAA 4CH0S 2EK6A 4OYXA 3M9MB 1R31A 2U1AA 3GP9A 2L3MA 2PMZD 3EM1A 1B7FA 3NNCA 1T7PA 3HO1A 1N5YB 3MUTP 1EKRA 3BF4A 3GV7B 3MM9A 2POKA 4FVCA 1HWLA 4OYMA 1W25A 3FDSA 1RA7A 1E6VB 2AQ4A 4F04B 4OI2A 4B3MJ 1NDPA 5G4DA 1Q8LA 5KFBA 3NNAA 3OSPA 1FRJA 1FKOA 3QLHB 3OBIA 2MZTA 4LR7A 1M5OC 3ENVA 1NHVA 3M8PA 2KI2A 3UCGA 4IQXA 2HWTA 1LWCB 2DXEA 4DN9A 3LP2B 4ZVPB 3VGVA 4U67Q 1RAFB 1RT6A 4LRDA 4U95A 3TAMB 2C22A 1R6VA 3NGDA 2I9SA 5LSOA 2QSFA 1N0UA 4H4KA 2VF3A 2GGPA 5I42B 2ZKUA 1L3TA 2KXFA 4OX7A 3M6UA 4KC5A 4QW8A 4JI8F 2B9XA 4WKYA 4DUTA 3QZ7A 4QQBA 4ES2A 5IWAF 3CD6S 1WF0A 2LEPA 2MHNA 4RNFA 1ACMB 4ZLLA 4KFBA 2MKSA 2ATLA 3E3XA 3SV3A 1XK8A 1RCXB 3VQTA 1NJIT 3Q8VA 2LKZA 2J9EA 3I0RB 4ETZA 4PZVA 2KHDA 3HHNB 1L3UA 3RRGA 1NKCA 1P9YA 2EI5A 1XC9A 4WP9A 1IR2A 2H5IB 1UEVA 4LF4J 3SQOP 5KT6A 3HF5A 5D0HA 4QR0A 2EFGA 4H54A 2C2KB 4LFBJ 1YJUA 3AJ1A 2ASYA 1Y10A 3ENWA 1U09A 2CJBA 2IFXA 1QAJA 2AGQA 2B4OA 4BC7A 2Z57B 3M05A 1SH0A 3QWPA 4KY3A 2CQ0A 1NJYA 2B0GA 3TX0A 2QX0A 1NH7A 3RB3A 2GZOA 2OPRB 3PX4A 1W7WA 3SYZA 2JEIA 4C9DA 4DL7A 2UVVA 3JAMU 1Y5NB 3I31A 1RHQB 4URQU 3FQLA 1FFGB 3B54A 5G0RB 1RBAA 1DTQB 2ZJPQ 1XWLA 1UA0A 3BEGB 4KRWA 3QT5A 1RTIA 1OY6A 3Q2TC 4DV2J 4WIIA 4A8FA 2C2MB 3NBPB 4NE9C 1SJ3P 2YH1A 3QPIA 2XMTA 4HLBA 1OYEA 3DMJA 1OQ3A 4Y2IA 1V5VA 5CYQA 1V9OA 1KFDA 2ROEA 1XJWB 3Q8RB 2BVZA 2OH2A 2L9NA 2HW3A 1YBAA 3M2RB 4OZLA 3LUYA 4O0NA 4YB1P 5AXLA 1FHTA 1KC8T 1N36J 3PO4A 4ED4A 4LF9J 2IA6A 1RAGB 4Z37A 3BO3A 5KG1A 3M8QA 3IN5A 4JUZA 5H9FJ 2VJUA 1EHWA 1F0XA 3SSQA 2YTCA 2FHJA 3GR1A 4PEOA 2DNLA 3OXGA 3R1LA 2BQ3A 4K59A 2AV5A 2AD9A 1T9TA 2BXJA 1XMOF 1UFWA 1JMTA 3O2IA 3AJ2A 4LQ3A 5LXRA 1CC8A 5GAEI 3H5UA 5ETRA 1NDCA 4DR4F 1UW4A 1PAEX 2ILYA 1HARA 2YNHA 3HT3A 4N8NA 1UWBA 1VK8A 4EO8A 3E01B 1H38A 2B3TB 4LIWA 3SDEA 5LSRA 4PG7A 3IC1A 2ZZMA 3H25A 2MQMA 2KXHA 2QMUB 3T9NA 3U27A 3PYEA 4Y2CA 2QG9B 3SCJE 1GMVA 1HNXJ 1WC6A 3M30A 1RLDA 4K5SA 2FJXA 5AXNA 1IBMF 4C8LA 4OIXA 3FSIA 2LVWA 4N5SA 4G65A 4MT1A 4H4KC 3TUIC 3DCAA 1WNEA 2V0NA 3OHBA 1N0VC 3O8WA 2J6TA 5ETNA 3MR3A 5EDWA 3OVAA 5L9XA 2MGZB 2G1DA 4N47A 3GFZA 2W9BB 4DQIA 1NZ8A 1FFWB 1MNEA 2YBVA 3M32A 3OFFA 3RG6A 3LTOA 1M5KC 2XULA 2O1PA 1MWQA 1OPIA 3AD8C 4XAKA 1KTQA 2R7WA 2CPFA 3SZ2A 1Q5YA 4MKYA 3I87A 3IWLA 4ECQA 1WEZA 3DU5A 2NXJA 2I8EA 2XZDB 5DRKA 4J9OA 1WOPA 2W2PP 3I9ZA 4DN0A 1VS3A 1SH3A 2DO0A 3G82A 2OSRA 4USTA 4F0KA 3V4MA 1U1PA 1TQLA 2HIQA 2H5JB 2JWNA 5D3GB 2DR9A 1WI6A 2EFNA 3EUNA 1PYSB 2KFZA 1M5HA 4JV0A 2FB0A 4PYDA 1NJZA 4ILMA 1G1XA 3CCES 3OLBA 2JLGA 2RAQA 4LF8J 4V19X 5HROA 1SKWA 2K3IA 5EWGA 3NY0A 2XMMA 2X1AA 1U0HB 2HBRB 4ZDNA 4JI2F 5KFZA 2I1RA 2KN4A 4DV3J 1F2HA 5KG2A 1G7CB 2VC0A 4A4JA 3K58A 1M5PC 4DV7J 4GMKA 5I4MA 2V8PA 3MEGB 2CYYA 3CD5A 2DR7A 2U2FA 2YY3A 3CIZA 5BYQA 4LF6F 2KM8B 3F73A 1H98A 1UJ5A 3MI7X 5D0RA 2YWEA 2IIHA 4P74A 1YIJS 3BGUA 4DJBA 3FFIA 5CZXA 1VCTA 4DL0C 4QIFA 3N0VA 4OHWA 3AD9C 2A2CA 2OPQB 1RT2B 4Y00A 1CVJA 3H2VE 1DQ9A 5DLFA 1MWZA 4HACA 1VBXA 2HAIA 1HR0J 1VFJA 1WC4A 4NCGB 4OZ0A 1RAHB 4P71A 1SC1B 3HSGA 1NKBA 1DLOA 3ISZA 3GMGA 4ZVGA 2OFHX 1KDNA 3OFHA 4DFKA 4DQPA 3MAQA 1KRPA 3TUJC 4MIBA 1SQFA 4EBCA 3BBCA 4GKKJ 3RRHA 1NHUA 2EFPA 4EYHB 2CAJA 4OYZA 1L3KA 1X4GA 2DPIA 2EG2A 1K47A 1N88A 1P6TA 1FE0A 1G3OA 3WHIA 2XCPA 4LF1A 2AGOA 2AU0A 3DNCA 4NI2B 2QO3A 2K1RB 4ES1A 2VA3A 2CJKA 2AJ0A 4C3KA 4DSJA 1HW9A 3OLAA 2IDEA 3ENAA 1VC0A 4RWXA 4CO4A 1HHTP 1BQNA 4X4PA 4X62J 2MQQA 1S0NA 1TUVA 1JXVA 2ZWPA 4O4GA 3GQCA 1GXUA 3W61A 5J1EA 1SL1A 3CXCR 2HEKA 4USMA 4YDXA 4FBUA 2QLXA 1Y00A 3FZBA 3MCSA 2E5IA 4K0KJ 3Q24A 1J2VA 4CLSA 4Q8EA 3W9HA 2JLEA 2C42A 4R5PA 2X3GA 1FA0A 2WVCA 3AH6A 1O6XA 4YS2A 3IS9A 3US5A 3RR7A 2FVSA 1EETB 4WTOB 2OEKA 2M8DB 4X84A 1Z2ZA 3R5DA 2APOA 1CSJA 4MFBA 4CLZA 3KLGB 1TKDA 4LFBF 1JLQA 3SSRA 3UCZP 2GX8A 1ICEB 1I5OB 3OPKA 1KS2A 1JXLA 4QCLA 1ZAWA 3AB4B 5F0WA 2B6AB 2EKYA 1EQMA 2RDIA 4MK9A 2MY7A 2KYZA 3TZYA 1FJEB 3QAEA 1T9XA 3DLEB 3G8TA 4QIGA 1K0VA 2ZC4A 2F63A 3OR2A 4ELVA 1S49A 1CLFA 2XCAA 2B51A 2E1MC 3LAKA 4DR3J 2D69A 1GMUA 3J81Y 5L39A 3QT6A 1T95A 3N6LA 4HR2A 3CW2C 3U1LA 4ZMMA 4DV2F 4KGXB 3ZFVA 3W5YA 3UN2A 4ECSA 3ILLA 4KV8B 1N34J 1IUJA 2CFXA 4NZ6A 4JI5F 2VD3A 2CG8A 2J7WA 1AB8A 4DPUA 1D8YA 2DRDA 1UZHA 5KFGA 2B5JA 3HFZB 2BR0A 1SJ1A 2ZOGA 5F8GA 3KUEA 1LFWA 3R7SB 2FLNA 1S1UA 5IZHA 1N36F 4P75A 3EVMA 4BBYA 4LF9F 2W2MP 1NSQA 2NUHA 4I6AA 1U1LA 1RHRB 2P6SA 3CCZA 5CYMB 3HVAA 2I0XA 4ED6A
chains in the Genus database with same CATH topology
2ZKTA 1HWJA 4ZP8A 4PKDB 1Q81T 1K0TA 2LQ5A 2ZOMA 4CO0A 1FRKA 2CPIA 5KFMA 4ZS6A 4K4UA 3M2VA 1TL4A 2NR0A 3VF0B 4DV0F 2QRRA 4F4ZA 1NAQA 1YTYA 1KHVA 2RDJA 4DWIA 2WBRA 1GTHA 4LF5F 2MHEA 1HMVB 2OMLA 2QIFA 4X2BA 4AL7A 2EG1A 2RIJA 1HNVA 3I5AA 5B09A 1LFPA 3A1YG 5KG3A 2HHWA 1R43A 1RWUA 2BZ2A 5E2QA 5D3GA 3DXSX 3BQ1A 4YB6A 1ZM4A 4ECTA 5CHCB 3DRSB 3TARA 1T03B 2BYCA 3BZQA 2Q1LA 3OJUA 4NYPA 4ICLB 3JYTB 3MM7A 4TLRA 1U24A 2LXIA 1T94A 4TQSA 4UOCA 1X5SA 2XGQA 5GADU 3DMJB 1VRTA 1QY7A 5EWEA 3QJJA 3M2UA 1SJQA 4WE1A 1IKWB 4YOEA 2KT5A 5CYQB 1TKTA 4FPRA 2EBGA 3H5YA 3TAQA 1MMDA 2W7OA 3VAHA 4BS2A 5A8KA 4BDPA 1JXEA 1GXLA 1TP7A 4I2PA 2L08A 4RW9A 1G2EA 3GV5B 1JB0C 2O01C 4MIWA 5DDOC 4ZHRA 2MZQA 2UXCF 2AJ4A 2UUBF 1DAXA 1DTTB 1TL3A 4P7VA 1SKSA 3HLUA 3CDEA 1RI7A 3T1AA 3DLGB 3J80Y 1ELOA 1LXNA 1FT8A 3VWSA 4EYIB 2KZZA 4HDGA 1IKYB 3TNVA 5KFXA 2LXUA 3QO9A 1XMBA 2DNNA 1Z2LA 3EZ5A 5EHHA 4A46A 3KLIB 1VMBA 3R27A 3C8YA 4NLQA 1FRHA 4TN2A 4RNNA 2RNEA 2MKKA 2G13A 2FHJD 1WHWA 4NWBA 3ZZYA 1JLCB 2B4PA 3KG4A 4ERDA 3EXCX 1FD8A 2XGPA 2V4QA 2AYMA 1B0PA 3D1HA 2VKRA 2RJZA 4XDDA 2K3KA 3QGHA 1CG2A 1WWHA 5EUHA 2CPHA 2FDNA 1IM4A 1HNXF 5E3RA 3VALA 2GC8A 3FEXB 3M1VA 4ZVEA 4B02A 4DL4A 1HI0P 4PCQA 2E5HA 4KHRA 3VAFA 4IDKA 3GG1A 3THTA 2WBMA 4KHMA 1E6VA 4TY9A 1KQFB 1U1KA 3LALA 1IJEB 3DOLB 3M8QB 4IFVA 2HHSA 2OPPB 1KVJA 3KNGA 5D4LA 1FCAA 4G6VB 3KFWX 4B9NA 1RKIA 4E0DA 2FUG9 5GVQA 3U02A 1SJ4P 2GIRA 4HKQA 1T02A 2M2BA 1RT7A 3KHGA 4ZP6A 2M7SA 2JEJA 1YI2S 1RTHB 5E41A 1V3RA 3M9NB 1RJJA 3IO1A 3GYNA 4A8YA 3QLHA 4ECYA 4QIWD 4DOZA 2NPFA 3CC2S 4DFJA 2Q66A 1U6BA 4Q0BA 2VG5A 1O0PA 2GQQA 2R2TA 3T5JA 3NRBA 3PHEA 4HT5A 1D9AA 2XY7A 2KKHA 4KKOB 4GC7A 3UR3C 2KVIA 4QR1A 1XR6A 4ZKAA 4X4QA 3BREA 1UETA 3LGMA 4OHYA 3LP0A 4USJC 4URGA 1LWCA 2CPZA 2WAQD 2A18A 4ELUA 2UV8A 4IH7A 4A8QA 1VQ4S 1QVFR 4O3PA 1KQKA 2LU2A 4I0WA 2IRXA 2W8LA 3DDNA 1LWFA 2DNRA 5LJ5Y 5EX0A 4YR0A 1GT8A 3F41A 2ZHAA 2FD2A 4FS1A 3IG1B 4XK8C 5KG0A 5SUHA 3TAMA 4ETXA 5LT5A 2ZH6A 3MXHP 2HMIB 1ZAVA 2BV3A 1BY9A 5KFRA 2YNHB 5DDQC 1OIAA 2CQBA 1UWBB 2MJNA 4FS2A 2OTJS 4ZA1A 4QWAA 3I9V9 3MTKA 2OPQA 4LQ9A 5HBMB 3HHLC 1UP1A 4K50A 2MMYA 2F9DA 1RT2A 5DQGA 5KFOA 3DOKB 3PIOQ 5AXKA 3HX9A 4WF9Q 3UD4P 3JB9k 3PX0A 4ED5A 1JLFB 2FGOA 3CVKA 2LEBA 5F8NA 3N5FA 4NCGA 4EZ6A 2DNHA 2VASA 5JVHQ 4F4XA 3OR1B 1YJ9S 4OFZA 1TAQA 3DYAB 3IR6B 4N56A 3KMSA 2ZH4A 2ZD1A 5KFHA 3LANA 1GXTA 2GW8A 1EP4B 4PWDB 2GQCA 4ECXA 3J7A1 4F25A 1TK0A 1DURA 2J7UA 1VQKS 4MMOA 4CTAA 1AUDA 4KHPF 1Q79A 1V3ZA 5ITHA 2W7AA 1FRIA 2E1RA 2NXUA 3LOUA 5KFIA 5IXUA 3EGWB 5FDLB 1NK6A 2J6UA 4XPEA 3PW0A 3M30B 5I3UB 1TVRA 1FJ7A 5E7OB 1S7HA 4YEAA 2WRMA 1S6PA 2HLUA 1M5VC 2XI2A 2Z2MA 4NLXA 2ROGA 5D6GA 3Q2SC 5GAGI 2DD8S 4IKAA 2SXLA 3QIDA 3OXLA 1S77D 1RTJB 2WOMB 4TU8A 2E5JA 2XSJA 4EBDA 1K9MT 5KG6A 3DOMA 1M90T 1UVJA 3LF0A 1FO1A 5MAOA 4DHVA 4B08A 3KHRA 3K59A 5KT2A 3B82A 1J5OB 1SB6A 2DO4A 4J9LA 2VOPA 1S4FA 2K1RA 2N7CA 2R8GA 1UVIA 5C5JA 4OL8A 1JKHB 2CKWA 1FE4A 3S01A 1HWIA 5F8LA 1RT5B 3J7Z5 1S48A 1VIOA 3IAS9 4C11B 4KAIA 1C4CA 3CJ3A 3ONQA 4RW8A 4F02A 1KOHA 2VPXB 1C1BB 1P1LA 5A6PA 3D0HE 4Q7AA 3RB6A 2PN6A 2V8GA 1Q16B 2OD6A 2CVIA 4BC9A 2E66A 1X8DA 3BN4A 4ZOSA 3CUNA 1S9GB 3G8QA 3MMCA 1N48A 3KOAA 1DJ0A 2FJDB 3LPYA 2VZ9A 1SIZA 4RW6A 1SC6A 1N8RT 1TL1B 3ZZPA 2IJNA 4X66F 4IQMA 1H6KX 5F8IA 5E3AA 1R27B 3QIPA 5CH7B 5IT9Y 4A48A 1HBMA 3OL7A 4DG1A 5HQ8A 1HBNB 1H2TZ 2ZE2A 3UE2A 3FEZA 5A8WA 5LL6d 3PKYA 2K2PA 2XS5A 1S1WB 3D1QA 1DARA 3T19A 4JV2A 4IO9Q 3L09A 3K5OA 3ISND 2VBYA 4Y6IA 1T05B 1K73T 4MIAA 1NU4A 2QYCA 4Y3CA 1ZTTA 3HMJG 3R1HA 4PG6A 1WG4A 3FVYA 2MZSA 2G4BA 1IKXB 5EGYA 3N79A 4FXVA 4JV1A 5CXTA 4MYTA 5F3TA 3U7JA 4M5DA 2VH7A 2QA4S 1X5OA 2D9PA 4N77A 3RU0A 2YWHA 2RH3A 4YB5A 3CC4S 1VGYA 3OFEA 5F8MA 4B3OB 1U6FA 3RTVA 1UVKA 3OL8A 5LMNF 4DV3F 4K4TA 2CRLA 3M6XA 2R2UA 4WU3A 1I6JA 3OTEA 1YITS 1N6QA 4TXSA 4ITSA 2D3ZA 4KGKA 3CCJS 1IQZA 2XG8A 4ZCLA 2M70A 3T1YF 5KFKA 4WFBQ 2KJVA 1LW2A 2LXFA 3OSNA 2R2SA 3W2WA 4DV7F 2PFFB 3I6PA 2PI4A 4MK8A 2YKQA 4HTJA 1JWWA 1U1NA 4OX8A 3MUMP 1MROB 1EETA 4MH8A 2FPHX 1S79A 3IRXB 4O23A 5K9FA 2RF2B 1HPZA 3NCQA 5G0RA 5KFDA 3THVA 4YB7A 4B3MF 5DO2A 3MR6A 4I7FA 1DTQA 2P9EA 3KK2A 2P5VA 2VFUA 3NMAA 2VG6B 4O44A 3KLGA 4B9LA 4B9SA 1RP5A 3IAM9 4Q2LA 2VODA 4IFYA 2A2DA 1SV5A 3KLVA 2CQ1A 4C8NA 4ZK7M 1HNZF 2F8MA 3BGLA 2IRYA 3E51A 4BWJA 4ALZA 1S0MA 2FVRA 1UL3A 4F2SA 2RUGA 3MM5B 3HKZD 3HP6A 3NBPA 1BWEA 1X4EA 5KG7A 3T5HA 3TA0A 1SKRA 2HWHA 3GZ7A 1IBKF 2KZMA 4WKRA 2LA4A 2JJ4D 4C98A 4K4XA 1KQGB 2V4RA 3D28A 4B9MA 3MM6B 2XNQA 1A7GE 3VR1A 2IC3A 2YKMA 3GSDA 3HHDA 1S1TB 2HWIA 2XO7A 4URSA 1WEYA 2B6AA 4DSEA 2ZHOA 1RT4A 2EPIA 1TV6B 2FGCA 1X0PA 4PRFA 5B0EA 2FJBB 3D0IE 4JI0F 5KT5A 4ED8A 1HBOB 1HFEL 4AXJA 4ECVA 1H2VZ 3HVTA 3NL0A 3H98A