3CF5Q

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cf5Q00
3CCJS 2DO0A 2DGXA 2DH9A 4OZ0A 2KG1A 2RS8A 5CYJA 3V4MA 3BO3A 4WF9Q 1N52B 2MKJA 3CCLS 3VAJA 2KT5A 4U67Q 3VAMA 2BOPA 2SXLA 1FHTA 1VC6A 2RRAA 1X5OA 1NJIT 1VQNS 2N3OA 2JVRA 1RK8A 4UY8T 1U1RA 2AYMA 2HGMA 2YKAA 3MUMP 1ZH5A 1YWXA 2DNGA 1SJRA 2KU7A 5ITHA 1HL6A 1DZ5A 3DLLQ 3P49B 2RQ4A 3HI9A 3S8SA 2L41A 3TYTA 2ZJQQ 2MJUA 3SMZA 3VAHA 1WWHA 2J0QD 2XS7A 3RW7A 2JVOA 1AUDA 2MQOA 5LXYA 3US5A 3BO2A 2LKZA 1OIAA 2M2BA 2XNQA 3CF5Q 1NO8A 5DETA 2MKHA 5LJ5Y 4FXWA 2ZJPQ 2V94A 2DHAA 2MGZB 2KXHA 3CC7S 2DK2A 1FT8A 1P1TA 3FEYB 1UP1A 1L3KA 2CQCA 3NNHA 3CULA 2CPYA 2CPHA 3MI7X 2YWKA 2DB1A 4TU8A 2KXFA 1WHXA 2M4MA 2QEXS 3ULHA 2N7CA 3G9CA 2DGVA 2E5JA 2GHPA 1OWXA 1N54B 2DNLA 2QA4S 1YJWS 1VQ8S 3G71S 2DHSA 1U1NA 3G96A 1XN9A 1WI8A 2LA6A 4C7QA 2XNRA 2DNHA 3CCSS 1X4GA 3I55S 2RS2A 3IRWP 1F9FA 4YB1P 1RKJA 2LEBA 1YTYA 1X4EA 2CPIA 1VC0A 3SDEB 1YJNS 2DNOA 4A8XA 1YITS 2AYBA 1VQKS 2AYGA 2J0SD 3NNCA 1FXLA 4Y00A 2HGLA 2MZQA 2MZTA 2EVZA 2XB2D 1OPIA 2D9PA 4Z2XA 2RU3A 1SJ3P 3NMRA 1FO1A 2G1DA 5IM0B 4PKDB 1WHWA 1VQ6S 4ZKAA 1O0PA 2XSFA 2MHNA 2MKCA 2F9DA 1WEXA 5LSOA 3UD4P 1PO6A 2DNRA 1WF2A 1BY9A 2KN4A 1KQSR 2CQBA 5GADU 2LEAA 1N88A 4RU2A 2DNNA 4F26A 1FNXH 4TLQA 2D3OR 2CPDA 1SJ4P 2RUGA 1N8RT 2DGQA 3CCMS 2DGUA 5IFMA 1SJQA 1R8HA 4PRFA 3CC2S 1W2BR 2MQQA 4W92B 1QVFR 4Y0FA 1CVJA 1D9AA 1SXLA 1UW4A 2ADBA 3BO4A 1JJHA 2MMYA 3CD6S 4F02A 2JRSA 4QPTA 2CPXA 2CQ2A 3ZZYA 3S6EA 4QU6A 1JJ4A 2KG0A 1K9MT 2CQ4A 2ERRA 2LXIA 2RT3A 2F3JA 5HO4A 2X1AA 1UAWA 2GO9A 2KVIA 2VONA 2B0GA 3CCVS 2DGOA 3PIPQ 1G2EA 2DISA 2RQCA 5CA5A 1VQ7S 3B4MA 2DNPA 1JJ2R 2OTJS 1KOOA 4CQ1A 4LIRA 1H6KX 2LQ5A 3THTA 1VQ4S 1Q7YT 3NS6A 2KYXA 1HA1A 3I56S 2VODA 4J5OA 2X1FA 4QQBA 2M9KA 5IQQA 2MZSA 4CH0S 1DRZA 2YH1A 4ERDA 4WIIA 5GAEU 4IOAQ 2JWNA 5JVHQ 1JMTA 1QVGR 5GVQA 3G6ES 5JVGQ 2E44A 1U2FA 4QU7A 2PEHA 2MQNA 2N82B 3VALA 2LA4A 2KHCA 1U1QA 4LJMA 1VQOS 3JB9k 2M8DB 1A9NB 2CPZA 4IOCQ 1FJ7A 3CMES 4LMZA 1HD0A 1S72S 3D2WA 2MY8A 1DBDA 1X4FA 3S01A 2XS2A 2FC8A 2ZJRQ 2D9OA 5GAGU 1U6BA 5MLCV 2FHOB 5D77A 1U1PA 2PE8A 2OSQA 4YUDA 5CXTA 2BZ2A 2CQ3A 3B4DA 3S7RA 4IO9Q 2OTLS 2E5HA 3CCUS 4IUFA 3TP2A 2CQ1A 1YJ9S 2MKSA 4CIOA 1VBXA 1U6FA 2CQHA 4CH1A 3MD3A 2XS5A 3MURP 3CCRS 3CCQS 2DGWA 3DXBA 3MUVP 4V19X 5H1SV 4C4WA 2CQDA 1IQTA 3R1HA 4F25A 1P27B 3LPYA 2KXNB 5BJRA 1H2TZ 3EGZA 3VF0B 4C0OC 2KM8C 2MXYA 2DH8A 3SXLA 2AD9A 1DHMA 2RVJA 3J7ZT 1X5SA 2LMIA 2DIUA 1Q86T 2M88A 3J7YU 3IWNC 2MQMA 5DDPC 2LXUA 2G0CA 2K8GA 2X1GA 3PIOQ 2NLWA 2CQPA 2VOPA 2KI2A 1VC5A 1FJEB 1Q81T 4OZ1A 2MB0B 2CPJA 2DNMA 1K8AT 2MZJA 2OJ3A 1M1KT 2RNEA 5GMKa 1M5PC 3BS9A 3P6YC 5D78A 2YH0A 2DH7A 2A3JA 1M5VC 1U1MA 1A7GE 2MQLA 1U1OA 2DNQA 3UWTA 2HVZA 1KC8T 2QFJA 2MZRA 1X4DA 2LYVA 1VQ5S 1HD1A 2RRBA 1UFWA 2YTCA 4ED5A 2MKIA 1URNA 1ZZNA 1H2UX 1M5KC 5EN1A 2MYFA 2MSSA 3BEGB 3THPA 2CJKA 1ZZFA 1H2VZ 2CQGA 1OO0B 2KRBA 2MJNA 5DM6Q 3UCZP 2LCWA 3OW2R 3CMAS 2KM8B 1YIJS 3L3CA 1SJFA 2WBRA 2M8HA 1VQLS 2MY7A 3RW6A 1B7FA 3NS5A 1VQPS 2KRRA 3NNAA 3MD1A 2MQPA 2UP1A 2KFYA 2AYEA 3G4SS 1VBZA 2DHGA 2F9JA 2CQIA 1KOHA 3CTRA 1R8PA 2MGZA 2U1AA 3VAIA 3FEXB 3Q2SC 1X4AA 2JX2A 3VAFA 3UD3P 4M5DB 3MOJB 3EX7B 1YHQS 1VQMS 4W90B 4YOEA 3UCUP 1VBYA 2L08A 1VQ9S 3CCES 3K0JA 1X5TA 3P5TL 1WG4A 1WEYA 1D8ZA 5HL7Q 2HGNA 1Q82T 2DNKA 3CPWR 5DM7Q 1NU4A 1WHYA 4WKRA 5LXRA 3VAGA 2M0GB 1M90T 1WF1A 2EK1A 4P6QA 1WHVA 1WELA 4TU7A 3N9UC 1K73T 1WEZA 2LECA 5DDOC 3CC4S 2I2YA 4EGLA 4WFNQ 2G4BA 2MKKA 1X4HA 3Q2TC 2DITA 2M70A 3HHNB 4WCEQ 3SDEA 2L9WA 2EK6A 3R27A 3EGNA 3P3DA 1YI2S 3G8TA 2M7SA 2MZ1A 4WFBQ 1WG5A 3MXHP 3MDFA 3ZZZA 3R1LA 1KD1T 2CPFA 5IM0A 3UE2A 2DIVA 1WF0A 3U1MA 1FJCA 2U2FA 4TU9A 5LSLA 2J8AA 1U1KA 2J76E 3CUNA 1X5PA 3G8SA 2ADCA 2M52A 1WG1A 2VOOA 1WTBA 2MSTA 5FJ4A 5GAHU 3MUTP 2CQ0A 3LQVA 2DO4A 4WFAQ 1M5OC 3TO8A 1X0FA 2OSRA 3UCGA 2DNYA 4UQTA 2DGSA 1X4CA 2DNZA 2I38A 2KH9A 4PR6A 2FY1A 2E5GA 1QM9A 3H2VE 5LJ3Y 2FPHX 2HYIB 2FC9A 4BS2A 5DDQC 2X1BA 5DDRC 2Q79A 1WI6A 3H2UB 2HZCA 2O3DA 2DHXA 4FXVA 2N3LA 3CXCR 1X4BA 2OIHA 2CPEA 2MPUA 1U1LA 1S79A 2E5IA 3VAKA 2K3KA 1PGZA 3U1LA 2DGTA 2NZ4A
chains in the Genus database with same CATH superfamily
4DSKA 2QLBB 2HVHA 1FWPA 5HVHA 2KT5A 3PW5A 4J9NA 1VC6A 2RRAA 1M1GA 3NCQA 1NJIT 2ABYA 3KHHA 3AAWB 3FKBA 3HD2A 1FK9A 2AYMA 3HSZA 5A6PA 3QLHA 3RBZA 1HFEL 4DR3J 3OT9A 4IH7A 3I4PA 2AKWB 3V6DA 3SMZA 4U8VA 3M30B 4F4WA 2J6SA 2V8DA 4DHVA 3PKMA 3RW7A 4DV2J 5LXYA 1S4FA 5J2NA 2LKZA 3DM2B 4DL4A 1YJVA 3KLVA 2QLXA 5ETSA 4U8YA 4X4VA 1LFWA 3CGIA 3LP1B 2QL5B 4LF9F 1KVKA 5B09A 4A46A 1ELOA 2HFNA 1N54B 2QA4S 3HK2A 3G96A 1WKJA 2LU1A 1GXTA 2BYCA 4LSNA 2RDDA 5SUHA 1QAYA 1XMQJ 3SDEB 3JQMA 3KFWX 2AYBA 4JI5F 3IXQA 5DG8A 1IBLF 2HGLA 2D9PA 2DVIA 2D7SA 3H5SA 1ZA1B 2R8KA 1WF2A 2CQBA 2V4JB 4ECRA 3T1HJ 5KAKA 2AGPA 5K5MA 1RUSA 5C25A 1SJ4P 2E1CA 3K2YA 4ELUA 2D1CA 2QL9B 4FXDA 1JJHA 4S0MA 2V50A 3SFGA 2CPXA 2BACA 3K17A 2W8KA 3RB3A 1F3FA 4QR1A 4NLRA 1TFWA 1ZAWA 1H6KX 3QGIA 3NRBA 1HNZJ 4FYVB 2QJ3A 2ZM6J 2X1FA 1Y3KA 2HS0A 3V81A 1QUPA 4KGMA 1GTHA 4LF4J 1AFIA 2AX1A 3VZIA 2HHVA 1XNRF 2QLJB 5B0BA 3S01A 3IN5A 2ZJRQ 1WKKA 1DY3A 1F3VA 4DN9A 3QT5A 2PA3A 1H7XA 3GTYX 4J9OA 2UUCJ 2HBZB 2B51A 2F4VJ 3CCRS 2CG8A 1RQ0A 3L09A 2IC3B 4DR5J 3EXYA 4I67A 1K0VA 2EFQA 3MM6B 1YJ7A 2BOAA 4PQUB 2RSQA 4WWSA 3MM8B 2IM3A 2LXFA 3RBDA 4ZVFA 1U45A 2MQ8A 2MQLA 2J6UA 4LFBJ 2QFJA 3DKDA 4ED7A 2LYVA 3GJQB 4CLLA 1CEZA 3BEGB 4I6YA 3THPA 1R6YA 2DEIA 4F3OA 1Q78A 4ZLLA 3CE8A 5CQGA 1MN7A 4KPYA 1N32F 3OTEA 1VQLS 2MY7A 1B7FA 4I68A 2E9ZA 2C3UA 1TVRA 2OEJA 2UP1A 1YGYA 3PHTA 2KFYA 3ZTQA 4KPCA 2ZC4A 3G6XA 3A1YG 5BYRA 4GKJF 2H1YA 1LV5A 5EWGA 2C1EB 1SL2A 5DQHA 4GKKJ 2L08A 4L72B 3A3OB 1NZAA 2WK4A 2ZHBA 2R7VA 1Q82T 1WHYA 3N0VA 1HWUA 1S6UA 4OI0A 1BQNA 2QG9B 1SKRA 4MMOA 2QTWA 2QE5A 2L9WA 2ZOGA 2QL7B 3EGNA 3G8TA 3TI0A 2MZ1A 3D3CJ 2E5LJ 3PO4A 3IP0A 3TAPA 2XY6A 3MUTP 4DG1A 2C2MB 1N5YB 4KBIA 1S9GB 2DNYA 2VA2A 4NXNJ 4DR4J 4OX8A 2H5IB 5F0WA 1QM9A 4I7FA 2YX7A 4UUWA 2VC0A 4DN0A 1YG0A 4DOZA 3HT0A 4ILRA 3LAMA 1JLQA 3CCJS 3M2RB 5KFBA 2IPOB 2YWFA 3SCJE 2ASLA 3BV8A 4N77A 4DQSA 1SUQB 3EDRB 1LFPA 1WC0A 5D3GB 2QA1A 2HGMA 3MUMP 1JLGB 3MGJA 1CULA 5J1PA 1DZ5A 2VDIA 2RQ4A 4LVOP 5T7LB 3U27A 3A4TA 2EEYA 3IRXA 3GILA 4G6VB 3LWLA 4C48A 4FXWA 4ELVA 4B17A 5D0HA 4BCAA 1FT8A 3H2LA 1N5TA 4KHRA 1KNZA 4DQRA 4DV1J 4CLTA 3PR4A 4JBCA 3MFIA 1YJWS 3KHGA 4OJ3A 1CS4A 3GFHA 1X4GA 3H4BA 4RU9A 3M32B 2ZBPA 2E7XA 3G6VA 4QYZJ 3M6UA 4BWMA 2RU3A 2KDOA 4PZVA 3AOBA 3HPOA 5E7OB 4P7VA 1NKEA 1FE4A 5C24A 4X64F 4YDXA 5DRKA 2H5JB 5K8OA 3RRGA 1SKWA 2BRKA 2AIRB 2N4DA 3FFIA 1RZMA 3CC2S 1RA7A 5ETPA 3RBEA 4IQXA 4K4TA 1CLFA 3ONQA 2VG6B 1SIZA 1HWKA 4ZN3A 2CQ4A 5A2QU 4AQYJ 4ZIWA 3A8JA 1VJWA 1N5QA 2AF6A 4IDKB 1R31A 4USWA 3OSPA 1VQ4S 4DSLA 2MTLA 1HA1A 1WJ9A 1P1LA 4M5DA 2Y0SD 1JQGA 2HHUA 3B82A 4WIIA 1FRJA 4CTAB 1QVGR 2FDNA 5GVQA 2ZKTA 1IKVA 2N82B 4DR7F 3AA8A 1RP5A 5I4MA 3UNGC 2EFPA 3TAMB 4RO0A 4UW2A 1HWIA 4ECUA 3X1LB 2E5HA 4CO3A 1PAUB 2F63A 3WIUA 3O8WA 2DGWA 3CCQS 1SKUB 3TEGA 1EETB 2XHCA 4OQJA 2DY1A 1PBUA 3BBFA 1B4SA 4F3QA 4BC7A 1WKLA 3SZ2A 1S1UA 3TARA 1QY7A 3HHLD 2ZD1B 4OI1A 3DDIA 3OR1B 4EU0A 3JAMU 4DPXA 4YB6A 2YNFA 2CZ9A 1KVJA 5DDPC 1AROP 1S0OA 2FZKB 5LL6d 2DNMA 1S1XB 2OPRA 1BHNA 4WZQA 1P6TA 1ZTTA 5IS2A 1RAEB 1U1MA 4DR6F 1V3SA 4DU7A 2DPJA 1R27B 3ITHB 3WIVA 2GQ2A 3QAUA 2PFFB 2W4PA 1OPZA 1M5KC 1HPZB 2MSSA 4X65F 3N5FA 4JB8B 3GV5B 2MJNA 2R7SA 2I5JB 2ZUAA 4DL5A 2DPIA 1HNWF 1HWJA 2GVZA 2JHEA 3TOQA 4QIFA 3IO1A 1VQPS 1UETA 3C6UB 2RQKA 2MLZA 1Q0NA 3QRRA 4MK9A 1WC5A 4MKBA 3ZTPA 2RF2B 1S6PB 4OYPA 4JV1A 3E01B 4QWCA 5KFUA 2OEMA 2XZDB 3UCUP 1HI8A 4F0KA 1X5TA 5AE1A 3CPWR 3QATA 1SJ1A 2GV1A 4P6QA 1OYDA 1WHVA 1WELA 3JQJA 1NM2A 2G4BA 3UDCA 2AJFE 3KLIA 3WX4A 4AL5A 4PAAA 4RBUA 1WG5A 3QWPA 2CPFA 2R2RA 1Y5IB 2DIVA 4DEZA 1C1BA 5KFIA 3CVKA 1N5VA 3DFEA 3BM7A 4DSJA 1H38A 1K1QA 3JSMA 4RW8A 4CYUA 3C6TB 5L9XA 1YZ6A 1GNKA 1G1XA 4LIWA 3R7NB 4ZPWR 1CSJA 2HYIB 3GIIA 3AD9C 3H2UB 3CJ5A 4OI3A 2G0JA 4DV0J 3CXCR 3DGVA 2NPIA 2NZ4A 3F44A 3IBWA 3DMJB 1FCAA 1RAFB 2FVRA 3F41A 1RTHB 3R5BA 4A4JA 4WTOB 3C19A 5CAAA 1EJ7L 3OXFA 2DNGA 2YQ3A 4D3HA 3SSSA 1GQEA 3W66A 1AUDA 2OPPA 3MR3A 1IJEB 4O0IA 4JV0A 1RTDB 1IM4A 4JI2F 1SC1B 3J80Y 2NUHA 2Y8WA 3KLFB 1NJZA 5HBMB 2XO7A 3AXMA 1X0PA 5B0FA 3P45B 1Y7PA 3ULHA 5HK4A 2GHPA 1N36F 1IKYB 3NAIA 2GMJA 1WI8A 2E7WA 3CCSS 1KQKA 2CNOB 1U6ZA 1VI7A 4HTIA 4EI2A 4KC5A 1RAAB 3IBCB 1RHKB 3G82B 4R5PA 4B3OA 1RTIA 1I94F 2DNOA 1P9YA 5BR8J 1Q53A 2C3MA 4Z2XA 3K57A 4X4SA 4AUKA 3PJWA 4DQQA 4KGXB 2DNRA 1BY9A 4B3MF 2E7VA 2MLXA 2P9CA 2DNNA 3ICLA 4WTYA 2NYHA 1Z1ZA 5IFMA 1F5CA 1H73A 2ZEJA 4ZITA 1T9YA 2PA8D 2HFVA 4I0WA 2QX0A 2EFOA 1FA0A 4F02A 2YKMB 2ASDA 3SYZA 1QD1A 3IGNA 4OZLA 1U0SA 2V2ZA 3ENVA 1NXIA 3PIPQ 1RHMB 3Q8SB 2R8JA 4OX9J 3QIDA 4UTGA 2HBRB 3CT9A 2G0IA 4DFPA 1GMUA 3OFFA 3DI6B 4ERDA 3AB4B 1S48A 1Y4ZB 2HURA 3OR2A 1ULRA 2ZOMA 3KK2A 1HQUB 3D2WA 4PYAA 2FLNA 4KGKA 4A8WA 1RBAA 2M3DA 2VPYB 2HNZA 2VFVA 2V67A 1DAXA 1S99A 4MIAA 4YEAA 2OTLS 3SV3A 3V4IB 5J2QA 4HT7A 4HYKA 1T8EA 1O6XA 3QT6A 3MD3A 3L9ZA 4DUYJ 4X4NA 2HPUA 4C11A 3TUZC 1TP7A 3P5BP 2B4VA 4ZOSA 2VA3A 3W61A 3FMWA 1RT4A 1LWFA 3HM9A 5IZHA 1ZPWX 2LMIA 4E0DA 2J9CA 4ED6A 3HVWA 1LW2A 4LVNP 4IG0B 5KFNA 2MQMA 1QAIA 2BABA 3R97A 1WSRA 3FEZA 2UVUA 1HNXJ 1K8AT 4B9LA 2HMIA 2XC9A 3PDNA 4OMFG 1VGYA 2A3JA 2CVIA 4C9DA 2OH2A 3T3FA 5A8KB 4JYAF 1XMOF 5I42A 5B08A 3CJSA 1F5AA 1T7PA 2PN6A 4IRDA 5C42A 3MEDA 1ZZFA 4K4UA 4NASA 3AB2B 3W5XA 2W01A 2Y3YA 5IWAJ 1GEHA 3BN4A 3RW6A 4C3LA 1N6QB 1Y5NB 2HHHF 3KJVB 5HROB 2KB2A 5L9NA 5EDWA 3D6MB 2XMMA 2YBVA 2ZZTA 4ZIVA 1S0VA 4OZ2A 2I9SA 2P5VA 1YBTA 2KTQA 5KT2A 5IC4B 2PEBA 5E3CA 3CCES 4MAKA 3H98A 1WEYA 1D8ZA 3BGFA 1DTTB 5K8MA 3HHLA 3LP2A 4U96A 1UW9A 5LMNF 9RUBA 2V34A 1VHFA 2Z30B 5KFSA 5DDOC 1HBOB 3BKFA 3UD5A 2DITA 2CJXB 4KT0C 2DR7A 2Y8YA 4NOHA 5L1LA 1WC3A 4UOCA 3P3DA 3EJMA 3H20A 2GGPA 3D9BA 2VG7A 2J76E 2QLWA 2NR0A 2Q66A 1VIXA 1AFJA 2XMAA 4O23A 4ID8A 3CMQA 4RW7A 4UQTA 4Y6IA 4K8RA 4JV5F 4WYWA 4EK2A 4BS2A 3UVJA 2PDAA 1UVLA 2P8IA 1D3WA 1TV6B 1BQXA 3B54A 2DGTA 1NKCA 1NH7A 5KG2A 3DOKA 3VAJA 4C8ZA 3LWMA 2GJFA 4B3RJ 1JB0C 3EXCX 1RCXB 5DGBA 5J2MB 1N33J 1RTZA 4HKQA 2C2EA 3ZXWA 4RW9B 2O66A 2AJ2A 1WWHA 4B08A 2H51B 2OAUA 3D1OA 1HR0J 2ATLA 1WTFA 2MQOA 3FGVA 1TU0B 1LWEA 5CYMB 5A8WB 1RADB 4DCOB 3R5JB 3DRPA 3T5KA 3EGVA 2MEWA 1EQ0A 1JLBA 1TL7A 3BR9A 1KFSA 1HBUA 2DHSA 1D9DA 1TK5A 4QWDA 4OI6A 3BZQA 3WZ0A 5HMXA 1FTCA 2V8HA 3CW2C 3L7UA 1NLKL 2C3YA 4WBFA 4HLBA 4MKAA 1YLXA 2FVCA 4NI2B 4Y00A 1OPIA 4Q8EA 4YR2A 1HI0P 4KY3A 3TVYA 5IM0B 5EWEA 2MKCA 5LSOA 3T19A 2Q6BA 3NOGA 3MPUB 1YRUA 3MMAB 2OPSB 4KV8B 3BN7A 1ZAVA 3BQ0A 2V2KA 4J9VA 1FDDA 4RW6B 3ZZYA 1NDKA 2RH3A 1SC6A 2JFKA 4FNHA 2YKQA 2CNNB 1G3OA 1HW9A 5KG3A 3NGUA 3DNCA 1REVA 1E6VB 4HH0A 2BRLA 2J5AA 2BJEA 2MZSA 3R6GB 2BA9A 2FJBB 1J2VA 3CJ3A 3A8KA 2PEHA 4C0HA 1RWWB 3MEKA 4KE5A 4LF7F 3M05A 1S9EB 2OHDA 4EEYA 2IA6A 2D9OA 5GAGU 1BD6A 1IN0A 4UOHA 2VV5A 1J5OB 2C2ZB 2IJNA 4QIEA 1O5JA 3DXBA 4P72A 4B9UA 4RUAA 4N5SA 2XEXA 1PC5A 4LFCJ 1DTQB 1NK7A 4A8FA 1O8BA 2QRRA 2VFSA 1DLOA 3L7OA 2KXNB 3VF0B 1OJ4A 2FGOA 1DHMA 3J7ZT 4X62J 9ATCB 2XO6A 1Q86T 3BGRB 2POKA 4QW8A 2VKZG 3UDVA 3KK1A 5L46A 4Y3CA 4DPOA 3NAHA 3QYYA 2WW8A 3QSIA 3W9HA 2UU9J 2OPQB 5GAGI 3GB0A 3UN2A 2Y0BB 1H98A 1KC8T 5H9FJ 3P96A 5KFJA 1MROA 2GO8A 2KZZA 1TKZA 4JI6J 3H8YA 4ZJOA 3PY8A 1H2VZ 4B9TA 2J7KA 2K1RA 5KFDA 1UVIA 3BSAA 2M8HA 3GSIA 2HHTA 3T1YJ 1OQ3A 3JS9A 5F9NA 4N7TA 1RCOB 4NLDA 3PVXA 2ZDPA 2IVMA 4IFYA 1IBKF 1IJFB 1BWEA 5IT9Y 3D0HE 3PW4A 2EG1A 1B0PA 3MR7A 3LP0B 3HVTB 5DM7Q 5LXRA 2VBXA 4TU7A 3N9UC 4KHPJ 2WONB 4K4SA 3M8WA 1U09A 4P7TA 4DBQA 3R1LA 2UV8A 3FCHA 1TL1A 5A0YB 4A8YA 4NLTA 2KJWA 2OUGA 4ALZA 1R7IA 3LQVA 1IQZA 1IVZA 2AJ4A 3ILOA 5LJ3Y 3P8BB 3TUPA 4XO0A 1NZ8A 3M8PB 1CJVB 2X1BA 1MMDA 4Q7AA 1SV5B 1NSAA 1YK9A 3ZTOA 4WK1A 3BREA 2YWGA 4RPFA 3OHAA 2Z2LA 4P2FA 4ID5B 2W9BB 1X5OA 2CWXA 3RYLA 3UW1A 2D3UA 5D0EA 4UY8T 1Y5LB 3HHKA 4GVBA 4FNIA 1IBMF 3C15B 4HDHA 1U24A 2UUWA 4DS4A 4MJKA 4ZVRB 4V1Ak 2R2TA 2UZAA 1RT2A 3FSYA 1G4CA 1P9QC 4DJBA 2FHJA 2PO4A 1OIAA 2XNQA 1G7CB 2DHAA 1V9OA 3CC7S 4G3IA 1X9SA 4FDFA 1ZAXA 1L3SA 4P10A 2DB1A 5SZTA 4TY9A 4PG6A 4ZK7M 1RBLA 1FERA 5CABA 1HNIB 5F8MA 3M1VA 2B7CB 3C14B 1XN9A 2V8PA 4ITSA 2LA6A 2DNHA 1J5EF 3GYNA 1WOPA 1IKWB 3OVBA 3MCSA 5K14B 4A8XA 1B3TA 4R0JA 3OLAA 3NNCA 3KG0A 1RHQB 1LWCB 3O1LA 1NHUA 4NYOA 4OFZA 4K59A 4J7CA 4KO0A 5GADU 3KK3B 3Q24A 3QPIA 3PACA 2RE1A 3KJQB 1Q7LB 4TLQA 1T9XA 3MEGB 2WBMA 3HHDA 2NUUG 3EWGA 5AT1B 3DLKA 5AJ3J 2JNJA 3MM9B 1AA1B 3MECB 2RT3A 1HMVA 1SC3B 3OTOJ 1PJ7A 1M1HA 4J9LA 8RUCA 1G2EA 2DISA 5C5JA 1FK9B 2RMLA 4UQGA 1RLCL 3QLHB 2BDPA 4XDDA 1XNQJ 1HBNA 3I56S 1TL5A 4Y28C 3V6DB 5G0RA 2WVCA 1TUWA 4QWEA 5JVHQ 4L74A 4A47A 5CYQA 3PRVA 1R89A 5B7WA 3NGKA 4C6AA 5J2NB 1XMBA 3SV4A 5HMZA 3DRRA 4KTQA 3POTA 3SCKE 1Y00A 3LTOA 2ILZA 3QAEA 4YDDB 4FS2A 4J9QA 2GVDA 1D09B 2FHOB 5D77A 3H0PA 2CZ4A 2ZKUA 3BF4A 3KLHA 1VBXA 5EWFA 5F3TA 1S1VA 5KFWA 4CLFA 4C3MA 1F1BB 3MR5A 3ENWA 4LSNB 4P9SA 4NEZA 4DDFA 5K8PA 3H25A 4DV4F 3W7BA 2ZH7A 2KM8C 2XI3A 4Z7YA 3RAQA 2DIUA 3QT7A 1MN9A 1EIYB 3DHXA 4K5RA 2LXUA 2WHOA 2LP4A 2YNGA 2VOPA 3OSNA 2KI2A 1C0TA 3NGTA 1Q95G 1HNZF 2GA7A 4M8LA 3WHIA 4LBPA 1M5VC 4KSEB 1A7GE 5C25B 4F50A 1JLEA 5A76A 4LF4F 1VQ5S 1HD1A 1DJ0A 3PHEA 4XPEA 3KHRA 2G2OA 3RAMA 2XZWA 2UXDJ 1RI7A 3NWRA 2ZHOA 4M5NA 2ZFHA 3U02A 1YIJS 4HHJA 4JI4F 1LQ9A 1AZSA 1GH8A 3TX0A 3R9LA 3QZ8A 3NNAA 3DRXA 2VICA 4FPRA 2VQFF 3UDEA 3HSDA 1GMWA 4L73A 5DZ6A 5AXNA 4JI7J 2LQJA 1IKXA 3DHWC 3MOJB 3V81B 1VQMS 4YOEA 2D74B 3WX8A 1EARA 1WG4A 2HGNA 3CDWA 1WOOA 2PI5A 3CCWA 1NU4A 4CM2A 3HZGA 3CJ2A 2KHDA 4JP8A 4FYDA 3W2VA 4LF8F 4KKOA 1LK5A 3HHNB 4WCEQ 4NRTA 4KHMA 2R4FA 1TKXA 5CD4H 3AJ1A 4DL7A 4LF5F 5D0RA 1AUSL 3D68A 3SSRA 1KD1T 4HACA 3UE2A 4DZ6A 3GE9A 1FRLA 4OJGA 5IC6B 4CDIA 4FF4A 2B43A 2MDAA 1HQEA 1DQ9A 2DO4A 4ZVQB 3MMCA 5HQ8A 1JXVA 1N34J 1AYEA 3AH6A 4FXVA 1L3TA 2ZH1A 3EVOA 1L3VA 7FDRA 1XR7A 4OZ0A 2KG1A 4WU2A 1NK4A 2B9XA 2ROGA 5E2QA 2Q6CA 2ACMA 2CJAA 4Y2KA 4F67A 2G1HA 3R7BB 1FDBA 1W25A 2HWIA 1VR6A 1ZM3A 3T5JA 3DM2A 2KT3A 2C28A 5E3RA 1FE0A 4NLUA 4G1QA 4ZVUB 4FF3A 4R25A 1TVRB 5L1KA 2C3PA 2CJYB 3KYLA 5IXUA 5BXIA 3I0SA 1IM6A 2IJFA 4MIBA 1RT1A 2KXHA 3UDLA 2XG8A 3CIZA 2R2UA 1L3KA 2CQCA 3CULA 3DGPA 1ZOTA 1TMMA 4A8QA 2KXFA 3DOMA 4N8OA 4X66F 5DG9A 4CO1A 2E5JA 3MM7A 3HP6A 4FYYB 5J2PA 1NDCA 4Q45A 1KONA 3Q83A 2XNRA 1REGX 5J1EA 2DJWA 3N4WA 1BQNB 3KJFB 4WZMA 4C8LA 4YB1P 1RKJA 1NK6A 4PXCA 2AYGA 3D28A 4PWDA 2XB2D 3RRHA 2G1DA 2A2CA 5IT0A 4LF9J 5JUMA 2MKYA 1JK9B 1F9HA 3ZZPA 3HULA 2FJDB 1RT5A 4NCBA 4ES2A 2WVDA 2UXCF 2J0XA 1N5SA 4DG1B 1FNXH 1JLCA 3HFZB 1RWKB 2AMCB 4I7FB 2NQPA 4JI5J 4ED3A 3DRYA 2ADBA 1IBLJ 1R43A 4AL6A 2D3ZA 4USKA 1LXNA 4QU6A 3IS9B 1JLQB 4LFAF 1UJ5A 1FKAF 1VQSA 1W2IA 4J90A 1UVNA 2BM1A 3CDAA 1RLDA 3RG6A 2NREA 2FJEB 1FRKA 1QLNA 5LSRA 1CULB 3ISND 4AE5A 3MMBA 4FVMA 3CO0P 4CH0S 1TUGB 2BJ8A 3O2IA 2WVBA 4TY8A 4O4GA 4ENOA 4DV3F 4OYXA 2HWHA 2MQNA 3IRXB 3SSQA 2V8GA 1RGVA 1A9NB 2V6AA 1FJGF 2RU9A 4KR0B 3GCXP 1NJXA 1NBEB 5AXLA 1U7LA 4F0MA 2QSFA 2XTJP 4EFAC 2OSQA 1XEZA 2CDRB 3K5PA 3W1YC 5IT9U 3NS7B 3PYFA 4CO4A 3BPSP 1CS4B 3OVAA 2WCXA 3TVZA 4C98A 2X3GA 4PQUA 3MM8A 3AQOA 1C4CA 1XNRJ 2UUAJ 3H59A 1TL3A 2HEKA 4RUCA 1VK3A 4OL8A 2X1GA 1N4LA 3TA2A 2NLWA 4OI4A 3IWLA 1Q81T 5I3PA 1N48A 2VPWB 5C24B 4ATNA 1WOSA 3NG8A 2FB0A 1H74A 4J9KA 3UWTA 4Q0BA 3PW7A 2GQQA 1UWBA 3FFIB 2QMXA 3HVAA 3NOCA 4B9NA 4OZNA 3KUEA 3CSKA 3MM5A 4TNOA 2IA0A 3N01A 3NCPA 2KKHA 4XIUA 2MQPA 4DMZA 2AYEA 4DFMA 2DHGA 2CQIA 2YVSA 2EFGA 2U1AA 3FEXB 3U1NA 3LUYA 3GV8B 4WP3A 1F6TA 4ZVPB 1OY9A 4M5DB 1UFLA 3EX7B 2WRMA 4IRCA 3CWJA 2CUYA 2IMWP 4PG8A 2DNKA 3NEKA 1IKVB 5L1JA 1OSDA 4LRDA 4DL3A 2EPIA 2GCFA 1K73T 2XZTB 4M5MA 3FRYA 2QZ8A 2B56A 1X4HA 3Q2TC 2K7JA 4F0HA 5DQGA 4YY3F 1T3NA 1U2RA 1SI9A 2HRYA 2PSZA 2P2CB 2O01C 3AD8C 1EP4A 1MWYA 3G8SA 2V69A 1TAQA 5GAHU 5A8RA 3QIPA 1S1UB 2AJ0A 4J9PA 1S6OA 2KH9A 5B0DA 4ZVGA 1KN6A 2IVYA 2WB1D 3D3BJ 3GYGA 2YNFB 1HI1A 1S6QA 3ZC4A 2Y1IA 2N3LA 1X4BA 3KMQA 3F56A 2OPRB 4DPTA 4KIAA 2AP6A 1MU2A 3VR1A 2BOPA 4RKUC 2E1MC 2SXLA 2CVEA 4IG3A 4YB7A 1VQNS 4USVA 2XY7A 1RWMB 2YKAA 2BMBA 4FYXB 2GMLA 2XYHB 3P49B 4M5KA 4HI1A 4QYZK 3OFGA 5LM7E 2GVZB 3BDPA 2Y1RI 3M2VA 1UEVA 4M5HA 4XPCA 4NYZA 1M5HA 1S77D 1WD6A 1SL0A 1GAOA 1NO8A 2HG4A 5DETA 3QGGA 2OELA 1P1TA 4ZLJA 2MHEA 4PWUA 1NPRA 5GMDA 3NXZA 2YWKA 2Z57B 4NLQA 1KHWA 1S57A 5DLGA 4LRFA 1VQ8S 3ILJA 5THWA 2LDYA 4LUBA 3UR0A 3CDUA 4C2MA 5F8HA 3I4HX 3J7A1 4A8SA 5HLFA 2IHR1 3KLIB 1VC0A 1HWLA 3RGIA 3BKTA 1FXLA 2RUSA 2EVZA 4YP3A 5KFKA 2K06A 3OUYA 3DLBA 3KKFA 1AXQA 2B6AA 1C1BB 1YJRA 1WEXA 4Q43A 1NB2A 3VQSA 3JSMB 4RW8B 4CYUB 4CNZA 2BJDA 2GHVC 4QPXA 4RJVA 4RL1A 1Z4UA 2K7KA 1F9EB 2ZWPA 2QYCA 4YN3B 5KT3A 4IQMA 1KS2A 5U47A 3CD6S 1I3OB 4WIQA 1FVSA 3TZWA 2Z2MA 2DXDA 4QWAA 1KVIA 2ERRA 3MAQA 5HO4A 3WC2A 1FKOA 3H7HB 1T03A 3D6TB 3OPKA 4X64J 1VQ7S 2V0NA 4M94A 1S76D 3P4UB 1U48A 1EZZB 3JXOA 2AZ1A 4QQBA 2M9KA 5EGYA 1KKHA 1RA6A 1V3RA 3GWCA 3M6XA 2AWZA 2C2RA 1CJKA 4GC7A 4R8UA 2OPPB 1YZ7A 4LMZA 3TAQA 4ZS6A 2JC1A 5CXTA 3S7RA 4IO9Q 1WUUA 2H9ZA 4ZDNA 1N0VC 2YKNA 4CT9A 2J9EA 3GCWP 3HKWA 3PTWA 4X4QA 3AOAA 2CQDA 4MTPA 1P27B 3LGNA 3EGZA 3WC0A 5T41A 4R5PB 1S1XA 1RTIB 4EUVA 2RVJA 1C1CA 2PGCA 3O3LA 4NMLA 2F40A 2RNEA 4P73A 2FHMA 2HFUA 3QJJA 1NPPA 1KQGB 3D0GE 1Q5VA 2RRBA 4NLWA 2Q1LA 1KLNA 4FN5A 4GO5X 3KOAA 3W8PA 3CMAS 1SJFA 3L3CA 3W2WA 1E6YA 5H9EJ 3B6BA 4DR6J 3VWSA 1FD2A 1R8PA 2MGZA 3Q2SC 3I6PA 3ADAC 2BV3A 4FYWB 2YNIA 4X65J 1VBYA 3P5TL 1LOUA 3OR2B 2ROPA 3VAGA 1WF1A 1OS5A 2EG2A 2R7OA 4WFNQ 4EBEA 1HYSA 2HNZB 2YQ1A 1LK7A 4MFBA 5HJYA 1TZ0A 2LQ9A 5J2QB 1MNEA 1O51A 2FD2A 1EHWA 1SKSA 3TA1A 1QAXA 2BANA 2HQGA 3ELHA 3PJXA 4C11B 1RABB 3DU5A 3TWZA 4NXMF 2PMHA 5IWAF 4OLPA 3JTNA 1RT4B 1LWFB 3IMQJ 2FY1A 1LW2B 1WI6A 1BQMA 3RTVA 4NZ6A 2YY3A 4WFYA 2HMIB 2RHQB 3K8WA 3RBXA 4X4UA 3OFHA 5KFTA 2GJIA 4Y65A 2E9TA 1BXNA 4FBTA 3GV7B 3RAXA 4U67Q 2ZZNA 4CP5A 2CADA 2CRLA 1Q4RA 2CA9A 2V63A 5I42B 5DG7A 2IDLA 2N3OA 2WSFC 2JLFA 1VRTA 3MF5A 4K4ZA 4IH5A 1YWXA 3TX8A 3A12A 5C42B 2HBYB 3MEDB 2L41A 2YNHA 2JZ5A 4F7VA 4WKYA 2Y1LB 3BO2A 3PYEA 1JWWA 4OX7A 2FLOA 4EO6A 1R8AA 4DR1F 3OHBA 3NNHA 1PIEA 4UT4A 2NSBA 2AU0A 2RQMA 2FY8A 1U1NA 3HHLB 3LP2B 2JOQA 5ETKA 1F9FA 3E3XA 2L9NA 3W9IA 3D67A 4JI2J 2FLLA 1YITS 2J0SD 1P8GA 2DR9A 1SJ3P 3NMRA 5ETQA 3D6HB 1VLYA 2YPYA 2XLIA 2GGPB 4YHHJ 4ZKAA 4EZ9A 1N36J 2MHNA 1N33F 2VPXB 5AE2A 2VG7B 3UD4P 2YKOA 1WDDA 5F8JA 3FCVA 4RW7B 2HWTA 3CCMS 4PRFA 2H5EA 4W92B 1QVFR 1YVFA 1AW0A 3UVJB 4RW4A 4Y2CA 5KFXA 1UW4A 4NCGA 6FD1A 3KLEA 2R9LA 1ICEB 4Q2MA 4C3KA 2F3JA 4BHQA 5IT4A 3DOKB 4F36A 4B3MJ 1QAJA 1S1TA 2J9DE 2HKEA 2IM1A 3R5GA 4NEYA 1MWZA 1SB6A 3DDNA 3D1HA 2CKWA 4ZP8A 3L4BC 1VMBA 2H3EB 3HJFA 3CO9A 3Q23A 3AY0A 3OL8A 2YH1A 1UCNA 3F0NA 1SH3A 4DZDA 2OO4A 2E44A 5KFZA 4DQIA 1FJ7A 3O6QA 1LWEB 5KG6A 5FLXY 3PW2A 3V4IA 3FZBA 2A6MA 2XS2A 3IBFB 2NXEA 3DRPB 2B4UA 2PE8A 4YUDA 3R6LB 3CCUS 2AT1B 1KSPA 2J9DA 1JLBB 1T9VA 1HBUB 1HBMA 4ZVEA 4V19X 1NMEB 3MWBA 4U6PA 3EZ5A 4W4MA 2UVVA 2RKIA 3I0RA 1C4AA 3GFZA 3DN9A 2G13A 3ZNUA 2K8GA 4F4AA 5A8KA 3N5BA 1RAIB 4OZ1A 2YX1A 2FVPA 2MZJA 1X31C 4NWBA 1BUXA 2DR6A 3LF0A 4LT6A 4CM0A 1FNOA 3PJ9A 2ACYA 2ZH9A 2YTCA 2MKIA 1URNA 2BBEA 5EN1A 4CH7A 2I0XA 4OX6A 2WBRA 3M2UA 1NSPA 4N41A 2W2QP 2GIFA 4PG7A 4OYBA 4JYAJ 1XMOJ 1ZBTA 2DY9A 5F0UA 1REVB 2E9RX 1B99A 3RRKA 3IA0A 2OD4A 4LFCF 4FS1A 2XCPA 1VQ9S 1H72C 5HQLA 2QFIA 5T14A 2B9YA 3MAAA 1CG2A 4ZHRA 1XWLA 2EK1A 4NA2A 1F0XA 2Z58B 2HHHJ 4IR9A 2I2YA 3Q8YA 1SQFA 5HI7A 2EK6A 2D69A 3D4JA 4HTJA 2IM2A 2XMUA 1PAEX 3QO9A 4F4XA 4JI6F 1JKHA 2XBPA 1RT3A 4DV6J 4CWBA 3HSJA 2VOOA 2YWWA 1VK8A 5LMNJ 1VRUA 3EMTA 1DLOB 3LANA 3DLJA 3V6HA 2DNZA 2FPHX 4PG5A 2HZCA 1RTJA 2DHXA 2FZGB 3GQCA 1TK8A 3KK1B 2WVEA 2V9KA 4C0BA 4QR0A 3T5LA 5KOWA 1S79A 4LRBA 3VAKA 3PV8A 1FX2A 3V4MA 3CCLS 4HH1A 5C2CA 3VAMA 5HAOA 2RB7A 3N28A 3NGDA 1UZDA 2DCUB 1MROB 5I3QA 2HQDA 4CNYA 1TKZB 4JV5J 4MIWA 3Q8QB 4G65A 5D4LA 1C0UA 3R7SB 2RRNA 3NLCA 2K1RB 1PYOB 3S8SA 5KFCA 2ZJQQ 2BM0A 2MJUA 2A1BA 2VQEF 3MCOA 2AEFA 1Z2ZA 4K0KF 2XS7A 4ICLA 3CJ4A 4PXDA 4LQ3A 4NLYA 3US5A 1NUEA 2FVSA 1UA1A 3EDQB 2CNKB 5ETTA 2DK2A 3THVA 3FEYB 3D6FB 1FTRA 1JJCB 2M4MA 3EGWB 4NZ7A 2DGVA 2NXUA 3LOUA 1Y9OA 2ALYB 4WP9A 2IY5B 1SIWB 3G71S 3I96A 4LF6F 3I55S 1U47A 4I1TA 2KVQE 4XAKA 1TMJA 2ZBCA 3K8VA 2C2OB 1LKZA 1X4EA 4KJIA 1YJNS 4OZJA 3QMQA 1MMNA 5KG5A 3MMAA 2EC0A 2EWHA 1TL1B 1CJUA 2PIIA 3CJKA 4DS5A 2UXBF 2DGUA 1SJQA 1D9AA 1V6HA 2O67A 3W5ZA 3PM9A 2W2NP 4UUXA 1BMQB 2B9EA 2CQ2A 2XMJA 3S6EA 4DU8A 1KLMA 2KG0A 4JI1F 1M0SA 1IR1A 2QA4G 2W7PA 1CQMA 2B0GA 3SFUA 2JLEA 2OTJS 3KWMA 4GVBB 4H4KC 2JC0A 2HZVA 1JIHA 4PPZA 3R8YA 3QGHA 1G6BA 3VQTA 3V6KA 4ZVOB 4NPOA 4L3KA 3I32A 1MW7A 3HX9A 4GC6A 4ECYA 1LEOA 5F8IA 1S72S 4ED2A 2PC6A 1RU2A 1RWXB 4I2PA 4B9VA 2HAIA 2ZZMA 4WPAA 2AQ4A 4WJBA 1H0HB 1N56A 5H9FK 1YJ9S 3MTKA 3VHQA 2XS5A 3M1VB 4K5SA 2HS4A 5CHCB 3PXGa 3K59A 2HIQA 4EO8A 1TKTA 1XIQA 5KG1A 1KRPA 1S7HA 3R1HA 3N6NA 2V2VA 4LF7J 1GX6A 3ZTRA 3OL9A 4OHYA 5BJRA 5M2UA 4MH8A 2R2SA 3GPAA 4KH1B 2XWXA 5DS7A 2CZVC 2ZE2A 4EYHB 2CQPA 2EC2A 3FDSA 3QWUA 4WE1A 4DX5A 4KO0B 3MCNA 5D6GA 3P6YC 1CJTA 2FUG9 3Q8PB 4DPUA 2XGQA 2NYIA 1FF2A 2B4PA 1FFWB 2MZRA 1ZYQA 4WU3A 1LW0A 3CJ0A 3DLKB 1V5VA 2VJVA 3QNWB 2V5HG 2BXJA 5EHHA 5HSPA 1UA0A 1S1WA 1HMVB 1YQHA 1Q16B 1KTQA 3I87A 4ED8A 4DV7J 3KLGA 1IBCB 2VKRA 1X4AA 2A18A 2Z2YB 2COLA 1NDPA 2BKNA 1HBNB 1GXLA 3OLBA 1YHQS 1OY8A 2J0WA 5G0RB 5CYQB 4ZCMA 4OYWA 2BQUA 4R0EA 1UWAA 3W63A 4IFVA 3DRRB 3POTB 3EUNA 4P71A 3FVYA 1R0AA 4IRKA 3EICA 2HQIA 3VGVA 2GVDB 1T94A 2HRTA 2R7XA 2BJ3A 1YI2S 1FKPA 1RKIA 3KLHB 3W3SA 3OTCA 3SCIE 1FI4A 1S1VB 4LBHA 2OFGX 4TU9A 1FEHA 2OD6A 3OTBA 2GX8A 4Q44A 2HQCA 3GIRA 5IV4A 2MSTA 3OL7A 4Y2IA 3GJSB 2G9OA 3ENQA 1SQGA 4IR1A 1FWLA 2O3DA 2YNGB 3QRQA 4FVCA 4J9MA 2I8EA 1C0TB 3I82A 1TL4A 3OXGA 1U1LA 4JI7F 3PW0A 2DO0A 2RS8A 2C2NA 4BLGA 1NJYA 2HS3A 2B4OA 1JLEB 3G6YA 3DLEA 2WSEC 3PX6A 1SJRA 2KU7A 2UUTA 1HL6A 1FESA 4G1IA 2IRUA 2K3IA 5KFMA 1IUJA 3LO3A 1S97A 4RX6A 2JEGA 2RILA 3MCMA 4PEOA 2WB4A 3QRPA 5EX3A 1S12A 1AZSB 4C8OA 2ZH8A 1BGXT 1R8CA 1NAQA 2OP5A 5LJ5Y 4ER8A 2ZJPQ 2JEJA 4H4MA 3B8HA 1IR0A 1IKXB 2VDHA 1IBMJ 2V2QA 3JSYA 4TU8A 5A6WA 2VASA 1XR6A 4M63A 3UN3A 5KT5A 4TYAA 4QIVA 3QQCD 4M5GA 4Q8FA 1MWQA 3TZZA 4I56A 1RT6A 2CAJA 3GU0A 4OJHA 5F3ZA 2IRXA 2LEBA 3W2VB 4KKOB 2OLWA 4ECSA 2R8GA 1TKXB 1NHVA 3OXLA 3RB0A 4F4KA 4HACB 1RJJA 1SCJB 2ZH5A 1B0VA 4LR9A 3BSOA 2FJVA 1PO6A 4ILMA 6FDRA 2LEAA 1J5EJ 5E3AA 1HQEB 2F65A 4YB5A 2VC1A 1CC8A 3MMCB 4ZLPA 1N8RT 4HHHA 1R8HA 4PWWA 2KFZA 4Y0FA 2W9CB 2BQ3A 2FLPA 3HLUA 1Y0HA 4OHWA 3BO4A 1SBRA 1XQIA 3UN5A 4L75A 4NL5A 3RZAA 1MMLA 2E66A 4X4TA 2Y9HA 2EKYA 3ZZ0A 1UAWA 4KH0B 3ZO7A 4I69A 1JJ2R 3D66A 4KFBA 2Q43A 1KOOA 2WOMA 3HXMA 2DTJA 2KYXA 4LRAA 3T9ZA 2VODA 1NPKA 4RNMA 1HHTP 1RACB 3J7AN 1JMTA 4G1QB 2FQQB 3G6ES 1U2FA 3NBPA 1X8DA 3I0SB 1HD0A 2XMKA 5ETLA 4DSEA 2MY8A 4CLYA 1RT1B 4WYLA 3M9OB 4WXOA 1XC9A 2IAJA 2F7VA 3D0IE 2FC8A 1F60B 3DGPB 3PNIA 3DOMB 2ZUGA 3GSDA 3MM7B 4DF8A 2CQHA 3WBZA 4UZCA 5J2PB 1BE4A 5LOQA 4DUZJ 3M8SA 4K4WA 1DARA 4DR2F 4PUOA 2FGCA 5J1EB 5H1SV 3DXSX 2IFXA 3AODA 3GFYA 3ZZOA 2B5JA 3ISNC 1NSKL 3BB5A 2FHKA 4A8OA 4NLPA 4PWDB 4LF2A 5D0GA 4QYRA 3UQSA 2OFHX 3AXKA 2O1PA 8AT1B 4TXSA 4JI3F 3BH6B 2CPJA 3ETOA 1K1SA 1RT5B 4I6AA 5HP1A 4CRJA 4DLEA 5D78A 3PG9A 2FJAB 2DNQA 1JLCB 4DV4J 1U0HA 3GR1A 1UFWA 4N8NA 3BKUA 3MR2A 1H2UX 2VL1A 4Q5VA 4O44A 4ED0A 4C8YA 2CJKA 3HFVA 2P9GA 3TJAA 1S5ZA 4KGVB 4TQRA 3UCZP 2LCWA 2BVZA 1TK0A 2CJQA 4PPDA 4QIWD 4TLRA 2F9JA 4ZPVR 2XYPB 3CTRA 3AD7C 4JI0J 3MMBB 3A8EA 3SQGA 2QLFB 3AJ2A 4ZPCA 2UUAF 3K0JA 4TY8B 4O4GB 4DV5F 4AXJA 2W9AA 4JI4J 4OYAA 4WKRA 2M0GB 4CLUA 1TQLA 1BLUA 1ZETA 2VQFJ 2WTFA 3M8QA 3NWGA 1X7VA 1LWXA 4N56A 5JJBA 2VHGA 1M5SA 4ZP9A 4K4XA 3J7Z5 3R27A 1R8BA 4ZPDA 4QR2A 2M7SA 2EKNA 2W4CA 3FBBA 4CT8A 2DRAA 4CO5A 1RAOA 5FDLA 5LSLA 2ADCA 4K4VA 1RWVB 3BPDA 2HVEA 1TAUA 2AZ3A 3AHPA 1ZM4A 3LPEA 3PFOA 1X0FA 4O4RA 1X4CA 1TL3B 1PSDA 4LF8J 3M8YA 4JI8F 4PR6A 3H2VE 3I5CA 2YXLA 4KAIA 4B3TF 2HFSA 4LF5J 1QE1A 2OEKA 2LEPA 3KUGA 5JMNA 3TNVA 1RWNB 2P9EA 2E5IA 2XI2A 1VS3A 3LW5C 2DH9A 4DLGA 3HJVA 3RR8A 3BO3A 4WF9Q 2V68A 3MMJA 1LXJA 2EFNA 1FEEA 5ETRA 4Q0BB 1L5UA 1Q79A 1UWBB 4ANCA 2JVRA 4FF1A 2ALZA 2QN6B 5K20B 1NK8A 2WW4A 3MM5B 1PYTA 1S49A 4I2QA 3TYTA 2PMZD 1B70B 3VVTA 5CZXA 2JVOA 2NS1B 3JSRA 3QFWA 2HNYA 1S0NA 1FRXA 2ILYA 2CPHA 3MI7X 1HNVA 5HQMA 3PYGA 3S1TA 3TVKA 2N7CA 3G9CA 1NB7A 4NLOA 2YWHA 3BQ1A 1DURA 1F2HA 1GX5A 1URRA 4K2JA 3GONA 2C3OA 2APOA 3HO1A 4C97A 2FYXA 2HAFA 1RWOB 3CNQP 3W65A 3BSCA 2R3VA 5F8NA 3TRGA 1HW8A 4X66J 3OQ2A 1GFWB 4I64A 1NJWA 4ETXA 1VBKA 1EP4B 4K50A 4U9RA 3GMGA 3ET6A 3IG1A 5A8RB 2IBOA 4F26A 3QIPB 1XERA 1RYRA 4LSLA 3C66A 2CPDA 2D41A 2DGQA 3IS9A 1RWUA 2HVDA 4UY85 5C7PA 3T1AA 1CVJA 1GMVA 3HHEA 1S6QB 3VGTA 2ZBRA 7AT1B 3MPWA 4QPTA 1VCTA 2X1AA 4J9SA 1MU2B 2VFUA 2UXCJ 3CCVS 5HN0A 1VRQC 4IG3B 4M1KA 4MYTA 1VOMA 4B3SF 3JTOA 5D4PA 3DRSA 1Q7YT 1X9WA 4QW9A 4CCHA 4AT1B 2ZOFA 3M2VB 3M7VA 3PFEA 1APSA 4JOUA 4ANEA 3MEEA 5KG4A 3FUYA 1DQAA 4LFAJ 4B9SA 3SIPB 1JLAA 1R6VA 5KFRA 2H4YB 4H54A 2VU5A 2BZ2A 2UUBF 2WAQD 3TP2A 3KTQA 3DDKA 1T05A 4FP9A 3TQ1A 3J80U 2W2MP 3MURP 4DV3J 4J91A 2IJRA 1R3NA 2CJBA 5L39A 3FQLA 3TA0A 4ZMMA 1WC1A 1FJGJ 2IRYA 1HHQA 5HLFB 2HNDA 2KYZA 1I5OB 1NEEA 4ZJLA 4NA3A 3OJUA 1WORA 1SH0A 4EZ6A 2Z8QA 4F8RA 3OUYB 4DWIA 4CLWA 2B6AB 2MB0B 5M2PA 5G4DA 3VTIA 5HMWA 5GMKa 4LR7A 2L9DA 4USJC 1RXOB 4P2XA 1TELA 1TTHB 1RAJA 1RT7A 3UO0A 3NP5A 2PMWA 4DI6A 5I3UA 2HHWA 3IM9A 2XMVA 1RSCA 1FKOB 5LT5A 1T03B 2F5GA 5K9FA 1D9FA 2R42A 2VJUA 3Q22A 1T9UA 2GAGC 3HDSA 1UEKA 1Q8IA 3VAFA 4X4OA 4M5LA 1CJKB 4H4OA 5HL7Q 1UVMA 2R8IA 2XSJA 4R8UB 1Q8BA 3NCRA 3TW0A 4KYZA 1AT1B 3KXDA 3CCTA 1L3UA 3G87A 4NMXA 2MKKA 2J7UA 2HBQB 4ZPTR 5AE3A 1B64A 3TUIC 3VZHA 3EZOA 2EI5A 4ECVA 2YKNB 4NX9A 3ZZZA 3TUJC 1UVKA 1FD8A 2J8AA 3CUNA 4XK8C 3C3LA 3Q8VA 4X4RA 2G2ZA 3A8IA 2ZC3A 2A10A 3J81Y 4ES1A 1JNZB 2VF3A 1C1CB 1KQFB 4U7CA 2FC9A 4YY3J 2RJZA 4DR3F 5CZVA 5D15A 2GQCA 1EX8A 2VBYA 1FVQA 4GO7X 2DGXA 4DV2F 3T5HA 2ZHAA 3AT1B 2ASYA 2MKJA 3DLGA 2FIUA 3OFEA 2DR8A 2R7RA 4GRSA 2BE2A 1X60A 2FTRA 4L76A 1FXDA 3BJYA 2CJ9A 2ZNYA 5ITHA 3FSIA 3D54A 4XDCA 4OV6A 1NHKL 4IO1A 3VAHA 4RNHA 3W2WB 2BQRA 2E29A 1E6YB 1MG7A 4OYOA 2M2BA 3W60A 1ACMB 3CF5Q 4U7UD 1XMQF 2V94A 3T6BA 2MGZB 5GADI 3PKYA 4CLZA 2CPYA 1Y10A 4TQSA 1HIYA 2YNIB 1S10A 1TUVA 5E5NA 2YPZA 3OL6A 4DX6A 3GFXA 3T1HF 2VUGA 2ZITA 2RS2A 2KFNA 5KTQA 5LMUJ 1KHVA 2JEFA 2CIMA 1LNQA 2CWKA 1GK8A 1HYSB 2PFDA 4NA1A 2UVWA 2WZ1A 1VQKS 3LALA 3PYDA 3W5YA 3IAS9 3OJSA 3NY0A 4MFBB 2W2OP 2ZBIA 2B8QA 4ZP7A 2HFOA 2HHXA 5E33A 1WHWA 3CJTA 2XSFA 3GJTB 2BANB 2VZ9A 2AGQA 4RNFA 2KN4A 1VFJA 3DYAA 1N88A 3FMBA 4AD6A 4A48A 3FBEA 3GR0A 2ZM6F 1BQMB 4M5IA 2Y1JA 1K9MT 1ZA2B 2LXIA 1CPZA 3TEHB 2KVIA 3J81j 2F8EX 5CA5A 2BJ9A 1VRTB 4LIRA 3THTA 3W8GA 3QZ7A 3NS6A 3TJ9A 1VIOA 1JX4A 4UF4A 1KBRA 1PILA 5EUHA 2Z4PA 2UUCF 2YNHB 1DRZA 3ZFVA 5L1IA 2F4VF 4IOAQ 3PZPA 1VJQA 4PXBA 3VALA 4LJMA 2GS8A 3JB9k 2CXEA 1Q1KA 1UPPA 1ITPA 2F8MA 5HANA 4YHHF 1KDNA 4DR5F 2VG5A 2NZCA 2R7WA 1W7WA 2VBZA 4WXWA 1KP6A 1U1PA 3PX4A 1JLFA 2Z56B 2VH7A 1YJUA 2CQ1A 2MKSA 3I5AA 3C8YA 4I4BA 3ZTSA 3OVSA 3A13A 4IKAA 3HVRA 2FZCB 3C16A 2HSEB 4BDPA 4LFBF 3JYTA 3LPYA 1H2TZ 2IIHA 4C0OC 4URGA 2MXYA 3SXLA 2AJ1A 1HLWA 5H9EK 1K47A 2M88A 2WSCC 3DOLA 3TZXA 1S0MA 1NH8A 4OV1A 1VYAA 1M5PC 3KG1A 2W8LA 4NLSA 1AB8A 3FBCA 1U1OA 3DU6A 2HVZA 2BR0A 4NRUA 1X4DA 2A6OA 4RW4B 2C2KB 3ISZA 4NCGB 3KLEB 4GKKF 3K5LA 2JJ4D 3DCAA 3M30A 4PYDA 3MAHA 4OJ1A 1A6LA 2GNKA 3BH7B 2ZNZA 1RHRB 1S1TB 4TN2A 4LR8A 2ZVIA 2B3TB 4DFJA 4DSIA 5GMEA 4QJVA 2KL8A 1NK0A 2FJWA 4ELTA 2XQCA 3LP1A 4W90B 3JTPA 4TYBA 2E5LF 5AXMA 1IWGA 5BYQA 4IYQA 1D8YA 4QCLA 3CD5A 3AA9A 4O3NA 3R2DJ 4NXNF 4DR4F 4RUBA 2E1RA 3QGPA 3SEOA 2DD8S 4FKYA 3SDEA 4LF1A 3R5DA 2HIYA 4WFBQ 1U4BA 5HVGA 3U1MA 3FZ2A 1HBMB 1FDAA 1FX4A 2HZAA 3LGMA 2E1AA 4DL0C 1KFDA 3RB4A 2V4JA 3L95X 5KFAA 2RKIB 3I0RB 2CQ0A 1NSQA 3UCGA 5RUBA 2DGSA 5FD1A 3NMAA 2W7OA 1GTEA 1RWPB 4RWWA 2A2DA 2NXNA 2XMWA 1T3OA 3NGRA 2V9WA 1UTAA 5DDRC 4QBUA 2IVFB 3IR7B 4PQAA 2PI4A 3NGSA 3MR6A 3AQPA 1WSVA 4AL7A 5CYJA 4OZ5A 2DT9A 4ZP6A 2RIJA 1UFKA 2R7TA 3I31A 2AX0A 3N6MA 3MFHA 4NXMJ 2Q3PA 3QJLA 4AXIA 4BBYA 3FRZA 2XLKA 4DV1F 3IGVA 2UV8G 1QUVA 2XLJA 3Q8RB 3X3UA 2J0QD 2JL9A 1H3DA 3M2UB 5KFHA 4GMKA 3QBCA 5C2GA 2D3O1 4GVLA 3V5RA 4WK3A 4NCAA 2AJQA 3FC9A 2HRUA 2VIHA 1UPMB 1CQNA 4DV6F 2ZWOA 4CLKA 4PCQA 4Y2MA 1PCAA 4OYIA 3W9JA 3HCXA 2IM0A 2DNLA 2FHJD 3MAAB 1OMSA 4LSZB 2J6TA 4H4KA 4ZHRB 3CDBA 3EYZA 1YTYA 2IC3A 3RU0A 4DR1J 3Q0AA 4ES3A 4NE9C 2MZQA 2HQ3A 3MM6A 2CFXA 1TKDA 4PKDB 3QO9B 1QSSA 4E2FB 1VQ6S 4MKYA 1JKHB 3SI8A 1RT3B 3EPIA 1YRTA 4I6WA 4AQYF 4ZN1A 1B0TA 3AOCA 1VRUB 3G8QA 3IR5B 4OHVA 2XULA 2RUGA 5F8GA 2H48B 5E3PA 1SXLA 3L7PA 1RTJB 4ECXA 3FSXA 1UVJA 2RDJA 2NXCA 1RB0A 2MLYA 2XY5A 4HHUA 1OY6A 2XGPA 4ECZA 7FD1A 1C2PA 4X4PA 2QYGA 2QC3A 3GZ7A 4PG4A 1N0UA 3K7RA 3CIMA 1HHSA 4EWTA 1C0UB 4J5OA 2X3DA 5IQQA 5L38A 2OGUA 1JNRB 4ICLB 5E0OA 5JVGQ 4QU7A 1U1QA 2LA4A 4UOFA 1VQOS 4DL2A 3CMES 1QDUB 2OMOA 5KFFA 1FFSB 3M6WA 1KWMA 1N32J 5KFPA 1RDRA 1RAGB 3CEDA 3B4DA 1D0EA 4K2XA 1BWVA 4PXEA 1GT8A 3KJNB 1ZM9A 4GKJJ 3MUVP 4NLXA 1IQTA 4DXLA 1R0BG 4F25A 4MYUA 1N5YA 1S59A 1S9GA 4IOBA 1B7YB 2AD9A 3OD2A 2W7AA 5KFQA 2XHWA 1PC4A 4KGZB 3VGSA 1CJUB 4Z37A 1HQ2A 2OKQA 2OJ3A 3UI3A 3O44A 4RLEA 3E2EA 4ZCIA 3M2RA 2DH7A 3CJKB 1D1UA 4L6V3 1SUQA 3BYRA 3GIJA 3J81U 5D3GA 2IMOA 4ED5A 4WFXA 1T11A 1ZZNA 1JLGA 2MYFA 2CQGA 4L3NA 3BBCA 2KRBA 4AFFA 2LVWA 1KLMB 2QV6A 5T7LA 2KM8B 4ETZA 3MD1A 4DF4A 2BE7D 1WC6A 4ZCKA 3H5UA 2OI2A 3JSBA 3TZYA 4URSA 1UZHA 5GAHI 1EB0A 2ZH2A 3ENAA 2AEJA 4LQ9A 3UD3P 3CD0A 4JV2A 3HZEA 4CO2A 2KO1A 2EW9A 1NK5A 1GMWD 1M90T 1WEZA 3M32A 3PR5B 3CC4S 1PYSB 1U8WA 4I2PB 4A8KA 3PCOB 4LRCA 2QMWA 3U7JA 4DV0F 5F9LA 3BBBA 2R7UA 2HQFA 3MPVA 5B0EA 4KRWA 4O3OA 2YWEA 2DYAA 3EPGA 1X5PA 4OZ3A 1TKTB 3CB4A 3R2CJ 1WTBA 5FJ4A 5CCLA 2DXFA 4YR0A 5B0GA 1NRKA 3KG4A 5F8LA 1W26A 1VISA 2NPFA 4QIGA 2VFRA 2JEIA 2Q79A 3VVUA 2ZE2B 2CNLB 1WNEA 3NKYA 1R0CB 4DV7F 4WE1B 2VG6A 2J8SA 1Q8KA 3GIKA 1F2GA 2K3KA 3U1LA 1ROFA 4ZA1A 2RDIA 3C46A 4YFUA 1CJTB 4YMEA 1FHTA 4RBTA 5CH7B 1EKSA 3GJRB 1RK8A 1RHUB 4IDKA 4O3QA 1LW0B 1YX2A 4J9UE 1ZH5A 1T0TV 2NSCA 4P75A 2V8VA 4ZVTB 5KFOA 4UZBA 3H5XA 4CTAA 1S1WB 4USHA 2Z0GA 1VLOA 2H54B 5KFGA 3ZZRA 3K5MA 2BUNA 3EVMA 3ZZTA 3TAMA 2JLGA 3KLGB 4ZPBA 4QOTA 1PBAA 1UP1A 4URQU 4DQPA 5BR8F 3IAM9 2QEXS 3A3PB 1OWXA 1FRHA 2W2PP 2VQEJ 4FZVA 4AYBD 4K0KJ 1KTVA 1EETA 2DKOB 4IFVB 3IRWP 5KG7A 4FF2A 3GLJA 1R0AB 2ZD1A 3H90A 1YBAA 2CPIA 3EM1A 3OR1A 1IR2A 3OTDA 4DR7J 3N6LA 1FKPB 2MZTA 3KNGA 1FO1A 2YQ0A 2UVRA 3W62A 2EBEA 4DL6A 5KT6A 3TR5A 2HHPA 2CDQA 4B3OB 3O5TB 2I6WA 1YKWA 1NNDA 1KQSR 4DCJB 2DHHA 2GFFA 4LF6J 5DGAA 2AEMA 3MPDA 4OX9F 2R7QA 3ITHA 3HSGA 5ADZA 1HPZA 4OHXA 2BKOA 4WFZA 1Y11A 3IWXA 2I5JA 4P74A 5DQIA 1U49A 4DFKA 2J7WA 2KJVA 2C42A 2DGOA 3C6UA 2RQCA 3B4MA 2L48A 2X7IA 3DLEB 3F73A 2UXBJ 4DX8H 1FXRA 1Q8LA 2DEJA 2RF2A 1S6PA 4HI2A 5D8HB 3E01A 2KZMA 5GAEU 3QFHA 2W24A 4DUYF 4JI1J 2IDEA 3KDNA 4OI2A 2EBGA 1RYSA 1NDLA 4H4MB 3PX0A 3CJRA 1HNWJ 3E51A 1U02A 1FNMA 3KK2B 2H4WB 2CQ3A 5FIIA 4YR3A 4CI0B 1U6FA 3RJMB 4Q2LA 1HNXF 1T9WA 5HVFA 4C4WA 1RT6B 5DLFA 3C6TA 3LAKA 3UFCX 1XJWB 4TVAB 5GAEI 2HK2A 2JDJA 1QTNB 1VC5A 1FJEB 4RBVA 5KT4A 3FK4A 4ZJQA 3ZNJ1 1Z2LA 2QT7A 1DQ8A 4F3MA 3DMJA 1S9FA 5IV3A 5IOLA 1RTHA 2FVQA 1VHIA 4WP8A 1UMJA 4NLGA 1ZS6A 3R5AA 1OO0B 3AJDA 2KRRA 2QMUB 4DPYA 1RISA 1K0TA 3G4SS 1RTDA 3I5BA 4KFBB 2NCKL 1KOHA 4DUZF 2QO3A 2WOMB 4X2BA 1EQMA 3KLFA 2AW0A 5HBMA 2EXUA 1FFGB 4RNOA 3WQPA 3EZUA 1IKYA 2YX4A 2QSWA 5J1NA 3TANA 1U26A 3NBPB 4U7UK 2CG4A 2IAJB 1UJ6A 1FRIA 3G82A 2ZH6A 1UEUA 2WVFA 4K4YA 4C8NA 2BE9B 1I1GA 2BKPA 1DFDA 1FJCA 3FBFA 1K44A 3FJ2A 1U1KA 4PUOB 5B0CA 3PRBA 1RU1A 2F8HA 1SPBP 2B5JB 1TR0A 4YQWA 3KMSA 4B3RF 5M2RA 3TO8A 3A3NB 3SQOP 2I38A 3Q86A 3V6JA 3CJ8A 3GG1A 2YKMA 2OIHA 2CPEA 3D7SB 4B9MA 1PGZA 3EVWA 5HP1B 1HR0F 4JI0F 1I94J 4EBDA 5BYSA 4E8UA 4Z7CA 4MT1A 3BGUA 3PRDA 4HDGA 1U0HB 3KNAA 1T95A 1U1RA 5E3QA 4RNNA 4O44B 3BQ2A 4ED4A 4DX7A 3DI6A 3HI9A 1Q5YA 1SC4B 4NZ0A 3WDOA 4EBCA 1ZM2A 1YDLA 1HQUA 4J9RA 2LQ8A 2ROEA 2W4DA 5KT7A 3KDOA 2V4QA 3JQKA 3Q89A 4ZCLA 1XK8A 1A0OB 2I1RA 1U8SA 1EAYC 3SQGB 5EX0A 4Y2AA 1JXEA 2AGOA 1HARA 2HHQA 4ZVHA 3LGHA 3V2UC 4C7QA 2ZBQA 2QA2A 3VCDA 2HK3A 4DPWA 3M8QB 1TL7B 1PJ6A 4HR2A 3HFKA 4X84A 1S7IA 4FBUA 1OSCA 4IG0A 1FWKA 2EFVA 1O0PA 5FDLB 3SCLE 2F9DA 2W9CA 1NKBA 3H4DA 4RU2A 4E98A 1PJ5A 3DC2A 1W2BR 2MQQA 3SBMA 4ZLNA 4BC9A 4N76A 5E41A 1NCLA 1ZTWA 4DSFA 2XWYA 3GYXB 1QE1B 3CDEA 5ETVA 1JJ4A 2F1FA 1N6QA 4RWXA 4HT5A 4EMDA 2VONA 3HKZD 3KJVA 1CBKA 5HROA 3CCZA 3KUHA 2VPZB 2L3MA 3R3TA 4CQ1A 3W64A 3HF5A 2LQ5A 3H42A 1SQEA 2JH3A 3DLHA 2VFTA 5DO2A 4OHZA 2V4RA 3GIMA 4I2QB 5CCMA 4OYZA 2JWNA 1RAHB 4CO0A 2C22A 1DTTA 3BGOP 1YBUA 1T02A 2M8DB 4IOCQ 2AHOB 4CLSA 4RUHA 3QT8A 5K8NA 2VB6A 2BEFA 2GW8A 1X4FA 2HNYB 2HFZA 1HBOA 3I9V9 4X62F 5MLCV 3T41A 5KG0A 1HNVB 2GJ2A 2RD5C 5IQ6A 3R5CA 4IUFA 2GHWA 2K2PA 2XM3A 4MKVA 3UNYA 2DXEA 2UU9F 2GMHA 2HVIA 2VD3A 4V19J 3NL0A 3IR6B 2DH8A 3MOZA 2B8PA 1X5SA 3M4XA 2IYGA 3D1QA 3J7YU 3IWNC 2G0CA 3RR7A 3PIOQ 1WDTA 5D4NA 2PD1A 3IFEA 4D3GA 1TV6A 2ATCB 1UL3A 2RHSB 4DUTA 3M9NB 4DR2J 2YH0A 3ET6B 3IG1B 3T1YF 1YRXA 4LSLB 1HKAA 2ZH3A 3VGUA 1QSLA 5MAOA 4IH6A 2BW7A 5J2MA 4F4ZA 3BR8A 3IM8A 4ZVSB 4HEA9 2X51A 3UPFA 2P6SA 5DM6Q 4JI3J 2JSXA 4RW9A 3OW2R 4ECTA 3OV7A 5ETMA 3HMJG 3NS5A 4RZRA 1V3ZA 5CD4A 3LA0A 3E8OA 4KHPF 1SH2A 4USTA 1KR4A 3J7YI 1WACA 5CYMA 5A8WA 4EYIB 3VAIA 4ANDA 3K89A 1XBWA 3DRSB 5ETNA 2HW3A 1I51B 4KB7A 1EKRA 3LH2S 4ECQA 3MEEB 4FKXA 2GZOA 4ZPAA 1J27A 4IFYB 1BC6A 5B0AA 8ATCB 1JLAB 4EGLA 5JXSA 1S4EA 2M5YA 2M70A 3G86A 4U95A 4NI2A 1FDNA 3MXHP 1VQYA 1T05B 4F2SA 5IM0A 1OYEA 4DV5J 3BYPA 4OYMA 2GIQA 2DRBA 1QTMA 3ILIA 4WFAQ 3H40A 4FPIA 1M5OC 4USMA 2DCLA 2NXJA 2OSRA 2OPSA 2HNDB 4KV8A 3PO5A 2E5GA 2E1PA 3VV2B 3K58A 1UJ4A 4RW6A 5L8RC 4P2MA 5DZ7A 3EE3A 4P2SA 3T9NA 3ZZUA 4HVZA 1N52B 4QWBA 2BJ1A 1FRMA 2YKPA 2ASJA 5HJXA 3M9MB 1QSYA 4Y34A 3N79A 2BJ7A 3HHLC 2KT2A 1YJTA 3RB6A 3I9ZA 4JI8J 1E6VA 1RT7B 2W1BA 3Q8UA 3DLLQ 4B3TJ 3M8RA 4YS2A 5I3UB 2GAHC 1IWAA 1NK9A 4NLVA 3MHYA 3BSNA 2BW2A 2BX6A 2MKHA 5F41A 1S9EA 3PEHA 1GXUA 4USIA 1RHJB 1XR5A 1RT2B 1OQ6A 1J5OA 1WHXA 2XCAA 2LQBA 3T6JA 1X9MA 4H4OB 2F4FA 4J37A 3G2XA 2XSJB 4MK8A 4O3SA 3ETMA 3HT3A 4OLOA 1DTQA 4QZVB 2FJXA 3ILLA 3MZIA 1U25A 2DBBA 2P6TA 5AJ3F 3BGRA 3K5OA 1SL1A 1IXKA 1V5IB 3OBIA 2GC8A 3OTOF 2Z2ZA 4CLPA 2IBKA 2OPQA 2GIRA 4HL9A 5KFLA 5AXKA 2D3OR 4NYPA 1ZPVA 3BDEA 4ILLA 3TQEA 2R8HA 2C2DA 3GG0A 1XNQF 4MK7A 3KHLA 2N4CA 2PT0A 2MMYA 3HD1A 2DR5A 2JRSA 1WC4A 2HLTA 2W25A 2IYIA 2LFVA 3MTJA 2GO9A 4USUA 3DLGB 5D4OA 1UKUA 2DNPA 3M6VA 3PEJA 2BE2B 4LBIA 3H5YA 5KOXA 1KEKA 2CYYA 6AT1B 4N47A 5LMUF 1MSWD 2LLZA 4P52A 1PKUA 4W98A 4B02A 1JXLA 3QSYB 3LP0A 3HVTA 4TKTA 2KHCA 2LU2A 2CPZA 4XTTA 5DJBA 2WONA 1DBDA 1SVDA 4B3SJ 2N7YA 4C8MA 1U6BA 4O3RA 4G1PA 3C2PA 5KFEA 2ZDOA 4CIOA 4ECWA 4CH1A 4BWJA 3M8ZA 5A0YA 3B78A 4K7QA 2HHSA 2B9WA 4F4YA 4DCPB 1VDHA 2OMLA 1IBKJ 3RUBL 4F2RA 5KFYA 4KQZA 2XMTA 1TFYA 3M8PA 1CJVA 4ED1A 3UR3C 2UUBJ 1SV5A 2UXDF 1YSJA 3D5MA 1M1KT 2JFDA 3QJPA 2O5DA 3BGLA 4F04B 3BS9A 5A2QY 1MLAA 1RE1B 3DYAB 1F5BA 5HMYA 1RBOB 3FNNA 4ID5A 2W9BA 4OIXA 1H7WA 2VBWA 3C15A 1Y3JA 3CD7A 2A0FB 1PG5B 2DRDA 4M95A 1VBZA 2AV5A 2JX2A 4A8MP 4C8KA 2XYGB 1HNIA 3AFGA 3GP9A 4UOGA 3C14A 3K5NA 1U2CA 1QJHA 2LECA 1IKWA 3TJ8A 4O3PA 3IC1A 2VG5B 5KFVA 4RR5A 3FCWA 1N34F 2RAQA 5K14A 3JAMY 1JLFB 4LREA 2G2YA 2QIFA 5FLXU 1LWCA 4M5JA 3MDFA 1WF0A 3MPYA 2LDIA 1I6JA 2U2FA 1XTZA 4JUZA 2HLUA 2M52A 4PABA 3C16B 1WG1A 1CC7A 3KK3A 4CZCA 3JYTB 2H65B 5ETOA 3FQKA 1T9TA 5HATA 3MEGA 3CJQA 2QGFB 2B7BB 5DDQC 3DOLB 4O0NA 2ZVSA 2ZH4A 2MPUA 3MM9A 3MECA
chains in the Genus database with same CATH topology
4DSKA 3AQPA 4AL7A 3OHAA 5CYJA 2HVHA 4OZ5A 3V4MA 2Z2LA 3CCLS 2DT9A 4HH1A 4ZP6A 2KT5A 3VAMA 2RIJA 3PW5A 2R7TA 2RB7A 3N28A 3I31A 3NGDA 4J9NA 2AX0A 4ID5B 2W9BB 1VC6A 2RRAA 3N6MA 3NCQA 3MFHA 1X5OA 3RYLA 2DCUB 3UW1A 1NJIT 2D3UA 1MROB 2ABYA 5I3QA 3KHHA 3AAWB 4UY8T 1Y5LB 1FK9A 2Q3PA 3HHKA 2AYMA 4CNYA 1TKZB 4FNIA 1IBMF 3QJLA 4MIWA 4AXIA 3Q8QB 4BBYA 5A6PA 3FRZA 3QLHA 5D4LA 2XLKA 4HDHA 1C0UA 1HFEL 1U24A 4DV1F 2RRNA 3IGVA 3NLCA 2UV8G 4IH7A 2K1RB 2UUWA 3I4PA 1QUVA 3S8SA 5KFCA 2XLJA 2ZJQQ 4DS4A 3V6DA 4MJKA 2R2TA 2BM0A 2MJUA 3SMZA 3Q8RB 2A1BA 2VQEF 3M30B 2UZAA 3X3UA 4F4WA 1RT2A 2J6SA 2J0QD 1Z2ZA 2V8DA 4K0KF 4DHVA 3FSYA 2XS7A 4ICLA 3RW7A 2JL9A 3PKMA 1H3DA 1P9QC 3CJ4A 3M2UB 4PXDA 4DJBA 5KFHA 2FHJA 4GMKA 4LQ3A 5LXYA 1S4FA 5J2NA 2PO4A 4NLYA 3US5A 2LKZA 3DM2B 1OIAA 4DL4A 3V5RA 2XNQA 1G7CB 4WK3A 2FVSA 1UA1A 1YJVA 3KLVA 2QLXA 4NCAA 2AJQA 2DHAA 2HRUA 1V9OA 3CC7S 4G3IA 2DK2A 3THVA 3FEYB 4X4VA 1CQNA 4DV6F 1FTRA 1X9SA 1LFWA 1ZAXA 1L3SA 3CGIA 2DB1A 3LP1B 5SZTA 4PCQA 4Y2MA 4TY9A 2M4MA 4PG6A 3EGWB 4NZ7A 4ZK7M 1FERA 4LF9F 2IM0A 5B09A 2DGVA 4A46A 1HNIB 1ELOA 2HFNA 2NXUA 1N54B 3LOUA 1Y9OA 2DNLA 2QA4S 5F8MA 1SIWB 2FHJD 3G71S 3M1VA 3HK2A 3G96A 2B7CB 3I96A 1XN9A 2LU1A 2J6TA 4H4KA 4ITSA 2LA6A 4ZHRB 1GXTA 2BYCA 2DNHA 4LSNA 1J5EF 4LF6F 3I55S 1U47A 4I1TA 5SUHA 3CDBA 4XAKA 2ZBCA 3GYNA 1QAYA 1IKWB 3EYZA 3K8VA 3OVBA 1LKZA 3MCSA 1YTYA 2IC3A 1X4EA 3RU0A 4KJIA 3SDEB 3Q0AA 5K14B 1YJNS 3KFWX 4A8XA 4R0JA 2AYBA 4JI5F 3OLAA 4ES3A 3NNCA 3IXQA 5DG8A 1IBLF 2HGLA 2MZQA 4OZJA 3KG0A 2HQ3A 3MM6A 3QMQA 1MMNA 1LWCB 2D9PA 5KG5A 3O1LA 1NHUA 4NYOA 2CFXA 3MMAA 4OFZA 1TKDA 2DVIA 2EC0A 2EWHA 4PKDB 3QO9B 2D7SA 1QSSA 1VQ6S 1TL1B 3H5SA 4MKYA 1JKHB 2PIIA 4K59A 4KO0A 3SI8A 1RT3B 3EPIA 1YRTA 2R8KA 4I6WA 4AQYF 1WF2A 2CQBA 2V4JB 4ECRA 1B0TA 5GADU 3KK3B 5KAKA 2AGPA 3Q24A 3QPIA 1VRUB 2RE1A 3PACA 3G8QA 3IR5B 5K5MA 3CJKA 5C25A 4OHVA 1Q7LB 4TLQA 2XULA 1SJ4P 4DS5A 2E1CA 2RUGA 5F8GA 3MEGB 2UXBF 2DGUA 1SJQA 3K2YA 2WBMA 5E3PA 3HHDA 4ELUA 2NUUG 1D9AA 2D1CA 1V6HA 2O67A 3DLKA 1SXLA 3L7PA 1RTJB 4ECXA 3PM9A 4FXDA 1JJHA 3FSXA 4UUXA 3SFGA 2CPXA 2CQ2A 2BACA 2XMJA 1UVJA 3S6EA 1KLMA 3MM9B 2RDJA 2KG0A 4JI1F 1M0SA 3MECB 2W8KA 2RT3A 1HMVA 2QA4G 2XY5A 2W7PA 3RB3A 4J9LA 1CQMA 2B0GA 1G2EA 2DISA 2XGPA 4ECZA 7FD1A 3SFUA 5C5JA 1C2PA 2JLEA 2OTJS 4QR1A 4X4PA 4NLRA 1TFWA 3GZ7A 1ZAWA 1FK9B 3KWMA 2RMLA 4PG4A 1N0UA 1H6KX 3K7RA 3NRBA 3QGIA 2JC0A 4H4KC 4UQGA 3CIMA 1HHSA 1JIHA 4PPZA 3QLHB 4EWTA 2BDPA 4XDDA 1C0UB 1HBNA 3I56S 4J5OA 2X1FA 3QGHA 1G6BA 1Y3KA 1TL5A 2HS0A 5IQQA 5L38A 3V81A 4Y28C 3VQTA 3V6KA 3V6DB 5G0RA 1QUPA 4NPOA 4KGMA 4QWEA 5JVHQ 4A47A 1GTHA 1JNRB 3I32A 5CYQA 1MW7A 3HX9A 4ICLB 1R89A 5E0OA 5JVGQ 4QU7A 5B7WA 1U1QA 2LA4A 3NGKA 5J2NB 1VQOS 1AFIA 2AX1A 1XMBA 3VZIA 4GC6A 3SV4A 4ECYA 4DL2A 2HHVA 5HMZA 5F8IA 3CMES 3DRRA 4KTQA 3POTA 3SCKE 1Y00A 1S72S 1XNRF 4ED2A 2PC6A 2OMOA 2ILZA 5B0BA 3QAEA 3S01A 5KFFA 3IN5A 4YDDB 2ZJRQ 3M6WA 4FS2A 4I2PA 4J9QA 4B9VA 2HAIA 2ZZMA 2FHOB 5D77A 4DN9A 5KFPA 1RDRA 2CZ4A 2PA3A 2AQ4A 3CEDA 3B4DA 4WJBA 1D0EA 1H0HB 4K2XA 2ZKUA 4PXEA 3BF4A 1H7XA 3KLHA 1N56A 4J9OA 1YJ9S 1VBXA 3MTKA 1GT8A 5EWFA 5F3TA 1S1VA 2B51A 3M1VB 5KFWA 1ZM9A 2XS5A 3CCRS 4C3MA 4K5SA 2HS4A 3MUVP 3MR5A 5CHCB 3ENWA 3PXGa 4LSNB 1RQ0A 4DDFA 3K59A 4NLXA 2HIQA 4EO8A 1TKTA 5K8PA 3H25A 5KG1A 1IQTA 1KRPA 1S7HA 3R1HA 3N6NA 4DV4F 3L09A 4F25A 1GX6A 3W7BA 3OL9A 4MYUA 1N5YA 4OHYA 5BJRA 2ZH7A 1S9GA 2KM8C 2IC3B 2XI3A 3EXYA 4IOBA 4I67A 2AD9A 2W7AA 5M2UA 1K0VA 4MH8A 3RAQA 2EFQA 5KFQA 2DIUA 2R2SA 2XHWA 2XWXA 5DS7A 2CZVC 1PC4A 2ZE2A 3MM6B 3DHXA 4K5RA 2LXUA 4EYHB 2WHOA 4PQUB 2CQPA 2RSQA 3MM8B 2YNGA 3OSNA 2VOPA 2IM3A 2LXFA 3FDSA 2KI2A 1C0TA 3QWUA 4WE1A 3RBDA 4ZVFA 4Z37A 1HNZF 2GA7A 4M8LA 2OKQA 4KO0B 1U45A 2OJ3A 3UI3A 3O44A 4RLEA 3E2EA 4ZCIA 5D6GA 3M2RA 3P6YC 2DH7A 1M5VC 4KSEB 1A7GE 3CJKB 2FUG9 2MQLA 3Q8PB 5C25B 2XGQA 1D1UA 2NYIA 4F50A 1FF2A 2J6UA 4L6V3 2QFJA 1SUQA 1JLEA 2B4PA 3GIJA 5D3GA 2MZRA 4ED7A 1ZYQA 4LF4F 4WU3A 2LYVA 1LW0A 1VQ5S 1HD1A 2IMOA 4ED5A 1DJ0A 3CJ0A 4WFXA 1CEZA 3DLKB 1ZZNA 1JLGA 3PHEA 2MYFA 4XPEA 3BEGB 4I6YA 3THPA 3KHRA 1R6YA 2CQGA 4F3OA 2V5HG 2BXJA 4L3NA 1Q78A 2KRBA 5EHHA 4AFFA 3CE8A 3RAMA 2XZWA 5CQGA 1RI7A 2LVWA 1KLMB 2QV6A 2ZHOA 4KPYA 2ZFHA 5T7LA 3U02A 1UA0A 2KM8B 1YIJS 1N32F 1S1WA 3OTEA 4HHJA 1HMVB 4JI4F 1LQ9A 1VQLS 2MY7A 1YQHA 1B7FA 1GH8A 4ETZA 4I68A 2E9ZA 3QZ8A 3NNAA 2C3UA 1TVRA 3DRXA 3MD1A 4DF4A 1Q16B 4FPRA 1KTQA 2VQFF 2UP1A 1YGYA 2KFYA 3I87A 4ED8A 4ZCKA 2ZC4A 3KLGA 3G6XA 3A1YG 3H5UA 3JSBA 4URSA 5BYRA 4GKJF 2VKRA 5GAHI 1X4AA 2A18A 1LV5A 5AXNA 2ZH2A 2LQJA 2COLA 1IKXA 3DHWC 5EWGA 4LQ9A 1HBNB 1GXLA 3UD3P 3OLBA 3CD0A 3MOJB 1YHQS 1SL2A 3V81B 1VQMS 4YOEA 4JV2A 2J0WA 5DQHA 3HZEA 5G0RB 2D74B 2L08A 4L72B 4CO2A