3CF5Q

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cf5Q00
1R8PA 2RS2A 3UCUP 1QM9A 2DNMA 2OIHA 1OIAA 1U1QA 2KHCA 2XS5A 1WHXA 2D3OR 2JX2A 1N88A 2LXUA 1X5TA 2DB1A 2J0SD 3G6ES 2N3OA 1OWXA 3BO3A 3VAGA 3NMRA 2MKIA 4QQBA 3CCJS 1VQ6S 3UWTA 1WI6A 2MZ1A 1UAWA 2M2BA 2EK6A 4WCEQ 2CQCA 2DNRA 2O3DA 3P49B 3THTA 1M5PC 1QVGR 1U1MA 1VQMS 5CYJA 2E44A 4Z2XA 4IUFA 3N9UC 1F9FA 1HL6A 3NS6A 2XSFA 2L08A 4QPTA 4IOCQ 1WF1A 1NO8A 2MPUA 1U1KA 3IWNC 1FJ7A 2DGSA 2N7CA 1RKJA 3MI7X 1FXLA 5JVGQ 1DHMA 2Q79A 3Q2SC 4C7QA 2G0CA 4J5OA 2E5GA 1D9AA 2ZJQQ 1K73T 5GMKa 5JVHQ 3CUNA 1L3KA 2HGNA 3B4DA 4A8XA 1NJIT 1WHVA 4ERDA 3CD6S 2HVZA 1YITS 1JMTA 3G9CA 2FY1A 2CPIA 1H2VZ 5H1SV 1DBDA 2DH8A 1Q86T 2YH0A 2ADBA 5DDRC 2HGLA 3DXBA 2KVIA 4F26A 1JJHA 1VBZA 2K3KA 3H2UB 1G2EA 1X4DA 3ZZZA 2FC9A 3P6YC 2DNPA 2KXNB 1VC0A 4QU6A 2RQCA 3K0JA 3MOJB 3CMAS 1ZZFA 2KU7A 3CC7S 4WKRA 4IO9Q 1H2UX 2MQPA 2N3LA 1X4GA 3U1LA 2RVJA 3J7YU 1U2FA 1U6BA 5CXTA 2LMIA 2FC8A 5LXYA 3Q2TC 1Q81T 2MKJA 5MLCV 1A9NB 4CQ1A 2KM8B 1SJ3P 1WHYA 3TP2A 3D2WA 2I2YA 1X4AA 5HO4A 3G8SA 1X4EA 1WWHA 1U1PA 2AYEA 3U1MA 5IM0A 4OZ1A 4WFAQ 1X5SA 2K8GA 2MB0B 2MHNA 1U1LA 2L41A 1YJWS 1SJFA 5LXRA 3MD1A 1X0FA 1U1NA 2DIUA 3R1HA 2CQGA 3CCVS 1ZH5A 4UQTA 2CPYA 2KYXA 2MGZB 4Y00A 4V19X 2KI2A 2MJNA 2ADCA 2DGWA 4P6QA 1HD0A 5LJ5Y 1X5OA 2DNLA 2MQLA 2DNGA 2AYBA 3CCRS 5GAEU 4CIOA 4C0OC 5GAGU 3FEXB 4OZ0A 2LYVA 3RW6A 1KOHA 2KFYA 4YB1P 2CQHA 4PR6A 2DK2A 4QU7A 1M5OC 5GAHU 1SJ4P 1S79A 1IQTA 5GVQA 1VQ7S 2RQ4A 1Q82T 2CPDA 1FO1A 3TYTA 2DNZA 1FJCA 2X1BA 2B0GA 2LEBA 1RK8A 5DDPC 2V94A 1WEYA 3L3CA 1WG5A 2UP1A 2XB2D 2M52A 3MUVP 3CF5Q 1BY9A 3CCQS 2CQ0A 2OTLS 3I55S 3UD4P 5GADU 1K9MT 3J7ZT 1UW4A 2FHOB 1HA1A 3MDFA 2M70A 2CPJA 2SXLA 2CQ2A 5ITHA 2PEHA 4WF9Q 2DHSA 2VOOA 2G1DA 3MXHP 2FPHX 4LJMA 2RS8A 1URNA 2MSSA 2MKHA 2MY8A 2LECA 2F9DA 2DGTA 4F25A 2RT3A 1YWXA 5IQQA 1X4HA 2ZJRQ 2JVRA 1UP1A 4PKDB 5IFMA 3RW7A 5FJ4A 3CULA 2DGVA 2E5IA 3S6EA 2MXYA 2LA6A 2MY7A 2YH1A 5EN1A 2OTJS 2KG1A 2LXIA 3US5A 4TU7A 4FXWA 1M90T 1WELA 5DDQC 2E5JA 4WIIA 4C4WA 1CVJA 1YHQS 1YIJS 1U6FA 2MJUA 5LSOA 2M8HA 3CCUS 1O0PA 1VC5A 5CA5A 3HHNB 2DGUA 2HGMA 4IOAQ 2M8DB 1DZ5A 2X1GA 1VQKS 1X4CA 3CTRA 2VONA 1WI8A 2XNQA 1WF0A 1A7GE 2CQBA 4TU9A 3MUTP 3SMZA 1X4BA 2DHGA 3MD3A 3LQVA 4RU2A 1VQLS 3NS5A 3P5TL 2YTCA 1M5KC 3UCZP 2F3JA 1SJQA 1VQ5S 2M0GB 1JJ2R 2MMYA 2XNRA 1X5PA 3IRWP 1FT8A 2M4MA 2U1AA 3UCGA 2WBRA 3ZZYA 4CH0S 2RNEA 2MZRA 2M9KA 3VAJA 4YUDA 3JB9k 2DO0A 2AYMA 2KN4A 5LJ3Y 2MGZA 3VAFA 2JWNA 3BO4A 1M1KT 1VQ9S 3CCMS 2LKZA 3NNHA 4YOEA 1PO6A 1NU4A 1B7FA 1PGZA 2DH7A 2OSQA 2CQDA 1WEZA 1ZZNA 2CPXA 2CQ4A 2DGQA 2A3JA 1S72S 5DETA 2LCWA 4CH1A 3EX7B 1P1TA 3CXCR 1YJNS 4WFBQ 3SDEB 2N82B 2MYFA 3CC4S 2X1FA 2XS7A 3VAHA 4TLQA 2LA4A 3LPYA 4WFNQ 2MZJA 2G4BA 3CC2S 3BO2A 1SJRA 2LEAA 1K8AT 1HD1A 2KRRA 2CPEA 1DRZA 1VQPS 1VQ4S 1Q7YT 2M88A 3EGNA 1KC8T 2MKKA 2OJ3A 1VC6A 3ULHA 4PRFA 4ZKAA 2DHXA 1WG4A 4Y0FA 1H6KX 2EVZA 4BS2A 1VQ8S 2J0QD 2MQQA 1FHTA 2MQMA 2MZQA 2EK1A 5D78A 3CCES 1WG1A 2MSTA 3PIPQ 3VALA 2NLWA 5HL7Q 2RRBA 3PIOQ 2MKSA 2JVOA 2DNHA 5BJRA 2VODA 2KM8C 2KXHA 2YWKA 3BS9A 1YI2S 3BEGB 1WTBA 2BOPA 2GO9A 2J76E 1QVFR 3V4MA 2RRAA 4LMZA 2AD9A 2I38A 2CQ3A 3FEYB 2F9JA 2QEXS 3HI9A 1XN9A 2JRSA 2KRBA 1U1OA 4UY8T 1WF2A 3CPWR 4W90B 1R8HA 2LQ5A 2DGXA 3VAIA 2KH9A 1VBXA 2VOPA 2E5HA 3G8TA 3NNAA 4U67Q 2CJKA 4ED5A 2BZ2A 3S7RA 2J8AA 2XS2A 3VF0B 1M5VC 1WHWA 1W2BR 2DNQA 2MKCA 3G4SS 2X1AA 3H2VE 1FNXH 2GHPA 1FJEB 2L9WA 2DISA 1U1RA 2CPFA 2HYIB 2DNYA 3R1LA 3NNCA 2D9OA 1YJ9S 3S8SA 5DM7Q 2ZJPQ 3R27A 2MQNA 2DNNA 3CMES 3TO8A 1OO0B 3MURP 2U2FA 2PE8A 2DH9A 3VAKA 4FXVA 2RUGA 1SXLA 3MUMP 3B4MA 1N52B 1N8RT 1KQSR 3I56S 3DLLQ 2KG0A 3UD3P 1KOOA 1D8ZA 4EGLA 2CPZA 2DGOA 2HZCA 4M5DB 2MZTA 2CQ1A 1AUDA 4F02A 1N54B 2CQPA 2D9PA 2KT5A 1KD1T 1VQNS 2DO4A 2CQIA 3P3DA 3VAMA 3S01A 3SXLA 1JJ4A 3G71S 2MZSA 5LSLA 5DDOC 3G96A 1OPIA 3EGZA 1X4FA 5DM6Q 2DHAA 2DITA 2KXFA 3OW2R 2DNKA 5D77A 2DNOA 1H2TZ 5IM0B 4TU8A 2MQOA 4W92B 1YTYA 3UE2A 1UFWA 4LIRA 3CCSS 2DIVA 1P27B 2QFJA 2M7SA 2RU3A 2NZ4A 1WEXA 3CCLS 2YKAA 3THPA 2OSRA 2ERRA 2AYGA 3SDEA 1VBYA 2QA4S 1VQOS 2CPHA
chains in the Genus database with same CATH superfamily
4DSFA 4G6VB 5HSPA 4ZPWR 1C1BB 4FYYB 5HJYA 2N3OA 1S76D 3ENVA 4DR2F 3UN5A 3T5JA 2X3DA 1DLOA 1TTHB 2W01A 3MEDA 1NDPA 1VQMS 2BQRA 4EEYA 3AODA 2ZC3A 3CJKA 4B9TA 3MI7X 2Z2LA 1RHKB 3FGVA 1RWMB 4Q0BA 1S1TB 3MAAA 5FLXY 3VQSA 2HGNA 4DFJA 5J2MA 3CD6S 3EXYA 3OL9A 3A4TA 4DV7F 1YITS 4P71A 2VFRA 5H1SV 5EX3A 2GJ2A 2ATLA 1WOPA 1T9WA 5A6WA 4KJIA 5ETNA 1S6QB 3Q89A 3K0JA 3P5BP 3BDPA 2ILYA 2Y3YA 1Q16B 2KU7A 5A8WB 3U1NA 4B9LA 2D74B 2ZKUA 4B3MJ 4HTIA 2Z0GA 3BSCA 3M2UA 5B0GA 1REVB 1A9NB 3TP2A 3MM7B 1MSWD 4W4MA 4FYDA 1RWOB 1P1LA 4OJHA 3PM9A 2PEBA 4UOCA 5KG3A 4ZLJA 2L41A 2LFVA 2EEYA 4DL5A 3OTCA 2RD5C 2YNIA 5L9XA 5K8MA 3LWLA 5F9NA 1HQUA 2GMLA 4LFAF 3SCIE 4DL6A 2DNLA 4A8MP 1C1BA 4OJ3A 1RE1B 4CIOA 1U02A 4CM0A 5B0EA 3PYGA 1R43A 1EARA 2ZBRA 2VUGA 2RQ4A 3RB0A 1NSPA 1WDTA 3ICLA 5LL6d 2ZNZA 2Z30B 2R4FA 1WG5A 1KNZA 4NLOA 4WK1A 2GMJA 2RSQA 4RZRA 1MLAA 2NCKL 4YB7A 3K5NA 2EPIA 3Q83A 1U2CA 1NSAA 2PMHA 3GV8B 3GU0A 1KHWA 4QIFA 5ITHA 3R8YA 3D66A 4MK7A 4OX7A 2O66A 4U6PA 1KFSA 1UETA 4NLWA 3K2YA 3IRXB 2AGOA 1S6QA 2XI2A 1LWFB 1V5VA 4JI3F 1U6FA 1RAJA 5A8WA 2CIMA 2M8HA 3IC1A 1NM2A 2BV3A 3BPSP 2NUHA 3E8OA 1JLBB 1K0VA 1REVA 4PG5A 4C6AA 2HBQB 3MM7A 4KV8B 1FTRA 5LOQA 3AJ1A 1ZOTA 3QYYA 3NEKA 1I1GA 4ED7A 2ZH5A 5GMDA 3FSIA 5KOXA 1RA7A 1VRQC 2V8GA 1VQ5S 3L7PA 1CG2A 2AEFA 3PR4A 3PY8A 3JB9k 2AYMA 4PZVA 2GMHA 3CJQA 3R6GB 3TAQA 2J7UA 4P9SA 2FVRA 4X4NA 2QIFA 4A47A 1AA1B 4C11B 2MZJA 2UZAA 1B4SA 3I4HX 1YZ6A 5HMXA 2CJAA 3H5UA 1KONA 3V6DB 2VDIA 3KJFB 3GIJA 4ECQA 3QIDA 2F9JA 1XN9A 2KRBA 4KIAA 4WP9A 2LQ5A 1U25A 3IRXA 4LRCA 3VAIA 3PO4A 2VOPA 3BGLA 4M5NA 2OFGX 3Q23A 1S7HA 1HWJA 2VFSA 3S7RA 3NCQA 8RUCA 2VL1A 3QAUA 4LF1A 5DZ6A 2L9WA 3LW5C 1ZA1B 1JLBA 1WOSA 1OSCA 4OQJA 1UWBB 3N6MA 5DM7Q 2ZJPQ 4HT7A 3KNGA 5A6PA 2C2EA 3VAKA 4KV8A 3A8EA 4GVBB 2GIRA 2D3UA 2JC0A 3OUYB 2UU9F 4DV0J 3CCTA 5KOWA 2R7VA 1KD1T 5LSRA 2VKZG 2PIIA 5D6GA 2MZSA 1Q5YA 3EGZA 2BEFA 3R3TA 5DM6Q 4LRDA 4RNOA 4NLTA 4B3OB 4FXDA 3MMJA 3AD9C 2IRXA 1NKEA 5LM7E 2BUNA 2VJUA 3SV3A 5KG4A 5M2UA 4EI2A 4ZJOA 3MPDA 1CQNA 1R8PA 4TN2A 2XS5A 2BOAA 2QX0A 2CVEA 4IR9A 1TL1B 3IS9A 3NMRA 1XMOF 1N36F 1EP4B 4E98A 2A2CA 3HF5A 3TX0A 1JNZB 2EK6A 3V6DA 1U1MA 2J9EA 4PXDA 4N47A 4P2SA 3SFGA 1NHKL 2F5GA 2M3DA 5A76A 4GKJF 2E5GA 5LT5A 4HR2A 1H38A 4P2MA 2F63A 1UWBA 3G8QA 1OS5A 4FVCA 3ZZZA 4FDFA 4B08A 1XEZA 4DX5A 1XK8A 1S1VB 2B9EA 1UTAA 4GVBA 2H5EA 1RHMB 1EQMA 3TR5A 3KHLA 2XLKA 1WHYA 3D2WA 4OLOA 2JLFA 5BR8F 5IQ6A 1HNIA 4IRKA 3FVYA 2K1RB 1LNQA 4B3OA 4E0DA 2XZWA 4C8LA 1APSA 2NXJA 1HYSB 4OJGA 2IJNA 1HPZB 2CPYA 2YBVA 3D6TB 3L9ZA 2JZ5A 4FPIA 1I94F 4ECSA 1RAAB 2R7UA 1RHJB 1VLYA 3NOGA 1TL1A 3Q8VA 1FCAA 3KDOA 3C46A 2UXCJ 2CVIA 1WNEA 2CQHA 4DR6F 5KFFA 2XGQA 4WXOA 1FO1A 3TYTA 2ZHBA 2X1BA 4OI4A 4CO4A 4DR1J 2FJBB 1FD8A 2LQ9A 2B8PA 1PJ5A 1W25A 3WIVA 2G2YA 2F1FA 2SXLA 2OPQB 2UXDJ 4PQUB 2G1DA 2IBOA 2VV5A 1J5EJ 4ANCA 2QLFB 3GE9A 1WC6A 4KBIA 2ASYA 1YWXA 2V2QA 3PV8A 3FRYA 3OXLA 3CULA 3KLHB 2YH1A 5H9FK 1B0TA 2PC6A 4NI2B 5E3CA 4JI1F 4DEZA 3PHEA 3LAMA 1S1VA 3MM6B 4TY9A 4ELUA 4ES3A 5LSOA 1VLOA 1JKHB 1R0BG 4KRWA 4OYPA 3DDIA 3IM8A 2DGUA 2HGMA 3FKBA 1RI7A 1VQKS 1X4CA 1QSYA 1FWLA 5IWAF 2H51B 3DOMB 1T9TA 4LF5J 3RAQA 4AXIA 1U4BA 2K1RA 3MCOA 3PHTA 4R5PB 1NPPA 2RIJA 3C16A 3WBZA 1JJ2R 2C2KB 3LGMA 3HZEA 1HYSA 2YX1A 2ZNYA 3UCGA 3C2PA 3ZZYA 2RNEA 5D15A 5RUBA 1HPZA 1V3RA 1NB7A 2DPIA 3GR0A 2O5DA 2PMWA 5ETTA 1QAXA 4QWBA 2FVQA 3SCKE 2RF2A 3BN4A 5DG7A 3KUHA 5DGBA 5E33A 3VQTA 2DPJA 4PWUA 2HVHA 4RW6B 3FQKA 2BKPA 2V68A 5JUMA 4I0WA 2BJEA 4CNYA 4ZVFA 3GCWP 5IV4A 2DR5A 2V2KA 4Y6IA 3ISZA 1UW9A 5CHCB 1B0PA 5KFTA 2OPQA 3F0NA 1GMWD 3FSYA 4PQUA 1V3SA 4S0MA 2VODA 2IM1A 3FDSA 5AXLA 2JRSA 3IFEA 4URGA 4DSKA 3KLHA 1XTZA 3V4IB 4NI2A 2FJVA 4KC5A 3KJVA 4F0MA 3GJRB 2XS2A 3MM6A 2W7AA 2OD6A 2IA0A 2OPRB 4Q8FA 1JKHA 3CD5A 1TVRB 4TYAA 4C0BA 2W7OA 3NNCA 2CAJA 3F44A 2IM2A 4O23A 1OO0B 2DHHA 1VK8A 3KK3B 3DOMA 2DH9A 1CJVB 1KR4A 4M63A 3L95X 1WC1A 5D0GA 2BJ8A 1KOOA 1D8ZA 3TW0A 4MAKA 2FJEB 4J9RA 5E3PA 2W8KA 4FN5A 1JLAB 3RYLA 2Q6CA 4YDXA 1WOOA 4O4RA 2W2QP 1T9UA 4RX6A 3W9JA 3I0RB 4MTPA 2IVFB 2YKNB 3BBFA 3LP2B 4LF4F 3UVJB 3AJ2A 1DJ0A 3HMJG 1R6VA 3IG1B 1MMDA 2UXBJ 3MM5B 1HNXF 5L39A 1U1QA 1NZAA 5ETKA 2K3IA 4ZN3A 1HBMB 3QSIA 5KFBA 5GAHI 3VAGA 2MKIA 4QQBA 3B78A 1KLNA 3HD1A 4QYRA 2BKOA 1WI6A 4CM2A 4KR0B 1QVGR 1NB2A 1VQSA 4J7CA 4DN0A 3SCJE 2R7QA 1M1HA 3N79A 1EIYB 1Y00A 1TK5A 4IQXA 2XSFA 2CNNB 3FJ2A 2DXEA 3PX0A 4K4ZA 3AOBA 4USTA 4PPZA 3T19A 4ZLPA 2QGFB 4ZPCA 3PW4A 3V4IA 4RW8A 5GMKa 1YRUA 1Q8LA 4ERDA 1WSRA 3WC2A 1JLGA 1DFDA 3HSDA 1NJZA 1N0VC 4DQRA 4ER8A 4JI4F 1KRPA 4WKYA 1FE0A 2K3KA 3EJMA 4K4WA 3KK3A 1CJVA 2J6TA 3KK1B 3HVWA 1U8SA 4ZJQA 1XMQF 3HZGA 4R25A 4DV1J 1SQGA 4XTTA 3T6JA 5LMNF 1JLAA 4DCJB 5M2RA 1J27A 1ULRA 3DHWC 3J81Y 3I0RA 1FDNA 1WWHA 1U1PA 3G87A 2YKNA 5E2QA 2C3UA 4OZ1A 4WFAQ 3LP2A 4RJVA 2MB0B 1PC5A 1VJQA 2RQKA 2P9CA 4PWDA 4Y2IA 2OO4A 2CWXA 2W4CA 1V3ZA 2KYXA 3MM5A 1HD0A 3LALA 2ZE2B 3DRRB 1HBMA 3BV8A 2LYVA 4YB1P 2ZM6J 2W9CB 2DTJA 2QN6B 3POTB 1WC0A 2Y9HA 1TL3A 3GV7B 2A6OA 1MMNA 4X64J 3C66A 3PX4A 1TFYA 4MFBA 1VISA 2HFUA 3RAMA 4O44B 2OD4A 2XC9A 2QLXA 3OTOF 3DU6A 1HA1A 3A13A 2EG2A 2R8IA 1L3VA 5D0HA 3OT9A 5LMUF 1X9MA 3KHHA 2MY8A 1DTQB 2FHJA 4ED6A 1TQLA 5HMWA 2Y1RI 3M6XA 4IDKB 1Y5NB 1OYEA 2IVMA 4DUYJ 4KGXB 3KK1A 2MJUA 2QSFA 1RWXB 3CCUS 1VC5A 1TL7B 3QGIA 1LEOA 3DOKB 1IWGA 8AT1B 1S5ZA 3KOAA 4X66F 3UPFA 3AHPA 1U6ZA 3PEJA 1GQEA 1PYSB 3OVSA 3UCZP 4ZHRA 3BKTA 2VQEF 4AL7A 2WBRA 3GP9A 3RRGA 2V4JB 1FVQA 3W3SA 3NCPA 3GFZA 3AQOA 2V4QA 4DHVA 1EQ0A 3DRRA 5K9FA 2GHWA 2OSQA 4A8QA 4PAAA 2BANB 4NMXA 2W9CA 3ENAA 3KLVA 2ZBCA 2C3MA 1Q78A 1HD1A 5FLXU 4NCAA 3SQGB 1P9QC 1JX4A 2OJ3A 2R2RA 4ZKAA 1HMVB 2NREA 4O44A 2J0QD 4KTQA 4MKAA 2QE5A 2V50A 1AZSB 3V81B 2KZMA 4C98A 3GSIA 3TANA 4O3RA 3TJ8A 5F3ZA 1QVFR 4LMZA 2UV8A 4LF2A 3P4UB 2RAQA 1ZM3A 4DG1B 4N56A 1RDRA 3N5FA 4IDKA 2QJ3A 1H98A 5G4DA 1EJ7L 1UJ4A 2IPOB 1W2BR 1N5VA 1KLMB 3G4SS 1TL7A 4F67A 3R1LA 1HNZF 3DOKA 4M5MA 1XNRJ 5H9FJ 2MQNA 5KT6A 4NCBA 2HZCA 4ENOA 5CAAA 3TZXA 3V6HA 3R5CA 1SKSA 5CYMB 2XMUA 3BH6B 3ONQA 3E01B 1HW9A 2MQOA 2VHGA 1IBKJ 3PR5B 3H90A 2BANA 2P9GA 4QYZK 3QT7A 1EKRA 1XNQJ 2AIRB 4KHPF 4LSNA 5B0CA 2GAHC 3SQGA 4DR3J 2JX2A 1X5TA 1HMVA 1OWXA 5C42B 3GIRA 4C97A 3BGRA 1VQ6S 4JI6F 1XR7A 4QCLA 1AZSA 5D4PA 4AT1B 3V81A 1M5SA 3C3LA 4OV6A 3IR7B 4OZ2A 1YBUA 3IWNC 1FJ7A 1RKJA 4JI8J 3NP5A 4DG1A 5JXSA 3EMTA 4F8RA 1T3NA 4L6V3 1IBLJ 3HO1A 2XG8A 1V5IB 3M8ZA 1KLMA 1HNWJ 2ADBA 1S9EB 1SUQB 2E1MC 3LH2S 3SCLE 2HNDB 3DXBA 4UUXA 4I2QA 2F8EX 4AFFA 4FS2A 1VC0A 1QUVA 2XMAA 3KYLA 2RQCA 3NWRA 4A8SA 3CC7S 1HWIA 3V2UC 3EM1A 3K57A 5F8GA 1CQMA 1CC7A 1RACB 2JDJA 5LXYA 3JQKA 2J0WA 3IGVA 4DLEA 1X4EA 4DDFA 3TX8A 1URRA 3BR9A 1TKDA 2ZUGA 3CJTA 3W9IA 3BBCA 2FJXA 1HARA 4F4KA 3D3BJ 4DSLA 2BYCA 1Y7PA 2ADCA 2DGWA 2VBZA 2W8LA 1G6BA 4ZDNA 4DV0F 2Z56B 2CA9A 4ZVUB 5C42A 3RW6A 2VA3A 4OYOA 2WW4A 4K4UA 3ZZRA 4ECUA 4CRJA 4U8YA 9ATCB 2UUTA 3O6QA 2YNGB 3FNNA 1NNDA 1MG7A 5AE2A 2G2ZA 2ZOFA 3GFHA 4M5GA 4EBEA 4Q8EA 4PXBA 4ZVGA 2FHKA 4ZCMA 1LWCB 4LJMA 3NOCA 3TVKA 1WJ9A 1KQKA 3RBZA 1N5YB 4DFPA 2DGTA 4HACB 2B6AB 2HNDA 4JYAF 3QATA 3CJ2A 4C48A 2MY7A 1S6PB 3TI0A 4XDDA 5B09A 1ZAXA 4DU8A 4NLYA 4TNOA 2OPSB 1NDLA 3BGOP 1HBUB 4EYIB 4QWAA 2H3EB 4CO0A 3RJMB 4DXLA 2OI2A 4ZN1A 3Q8SB 2QA4G 2Z58B 4F4WA 2XNQA 2CJ9A 2D7SA 1RWUA 1X4BA 4NMLA 2YKMB 3LQVA 1IJFB 1JXLA 2NXCA 4A8KA 4A4JA 4TKTA 2R8KA 5D3GB 3QGHA 1IWAA 2R2SA 2CNKB 5KG2A 3TQEA 4DPUA 2KN4A 1RAEB 1U24A 3VAFA 1M1KT 3NNHA 5KFJA 3TUJC 2AEJA 5BXIA 3OXFA 2DGQA 2J9CA 2WSCC 3CJ3A 4CH1A 4J9MA 2BQ3A 3UDCA 5IZHA 4K4XA 2XS7A 4ED2A 1IKXB 3HVRA 4NZ6A 2YNGA 3KK2B 2V8PA 1Q7YT 1KC8T 2MKKA 5CABA 4P2FA 4RW7B 5EWEA 1M5HA 1IKYB 2MZQA 1I51B 4BDPA 5D78A 2HHWA 3PIOQ 3C19A 2BW2A 4FP9A 5KG7A 2C2DA 1N5YA 3DI6B 4DWIA 4DZDA 4HACA 5AJ3J 2B6AA 1U1OA 4W90B 3JTOA 3K8VA 4O3NA 3CJ4A 3NMAA 3I5CA 2CJKA 2VASA 1M1GA 1TK8A 2OPSA 1CPZA 1HBUA 3RRKA 5BYRA 5ETRA 4A8OA 3V5RA 3PXGa 4AQYJ 4ILRA 3KJNB 4NLPA 2U2FA 2GVZB 4FVMA 2KG0A 2YKMA 4PCQA 3M6VA 3WZ0A 5D3GA 4Y28C 3P3DA 1NHVA 1VRUB 2AWZA 1RT1A 1UVNA 4K59A 1HR0F 1OQ3A 4LIRA 2RHSB 3CSKA 2XQCA 1GMUA 2MQ8A 1Q8KA 4YDDB 1F2HA 2C2NA 2W4DA 2QA4S 1HBOB 2CPHA 2O01C 2DNMA 3BSNA 3KK2A 1N88A 3G6ES 4RW7A 1S99A 3JSBA 1IKYA 5E7OB 2MZ1A 4K4TA 4RLEA 1GMVA 1RHRB 1ZM9A 4LSLB 4PABA 4WBFA 2WSFC 3B54A 3DI6A 3AB2B 1BC6A 4IR1A 4J5OA 2XGPA 4OYBA 4DPXA 1L3KA 1MWQA 4HEA9 4CTAB 2X51A 1XWLA 3AA8A 4L3KA 3TJAA 4RW4B 2DBBA 4EFAC 3PVXA 1RU1A 4J91A 2VU5A 5EUHA 2QZ8A 5C5JA 4LFBJ 1VI7A 4PWWA 2QMXA 2VC0A 3CMAS 2GVZA 1FJGJ 3TEHB 1GXUA 3MR2A 3WX4A 2L3MA 3R5AA 3D1OA 4RUAA 3N6LA 3E51A 5CXTA 1IN0A 1ZBTA 2KFNA 4J9NA 3UDLA 6AT1B 4L72B 1VRUA 3KFWX 1T7PA 2WW8A 5F8JA 5KFHA 4CWBA 1W7WA 1X0FA 1WD6A 2HBRB 3CCVS 1PAUB 4DR2J 2HHPA 2JNJA 4X4RA 1DAXA 2J0XA 1FVSA 4NYOA 2E7VA 5ETQA 3FUYA 3CCRS 5GAEU 4QYZJ 2RKIA 1PBAA 4QU7A 1JJCB 4RNNA 1N34J 4KYZA 5DZ7A 4IFYB 1RK8A 2FGCA 3H59A 1SCJB 1TELA 4LSLA 3OFHA 2XB2D 4DV7J 1S6OA 3CF5Q 4OHVA 4LR9A 3J7ZT 2FHOB 2UXBF 3E2EA 3RR8A 3RB3A 4X4UA 1Y5LB 5E3QA 2CDQA 3ITHB 4WF9Q 3GWCA 1YJUA 3CT9A 1Y3JA 5CYQB 2RS8A 2VFUA 4EO6A 4YHHF 2MKHA 2LECA 2HRTA 3MEGB 2J9DA 5HATA 4TU7A 3ZTPA 1ZS6A 3GR1A 1WELA 3A12A 2E5JA 3OPKA 4LQ3A 3WQPA 3M2RA 4N7TA 3VHQA 3G6VA 3OTBA 3FCWA 2CQBA 4KPCA 3I9ZA 1A6LA 2RQMA 4CLSA 4LFAJ 1M5KC 5KG6A 2ROPA 2HKEA 2M4MA 3GQCA 4F4XA 1KTVA 2AU0A 2CFXA 1K1QA 1RABB 4YOEA 2RHQB 2XMWA 4J90A 2YNHA 3BKFA 4ZVHA 2LCWA 4QR2A 2E5LF 4CLWA 2F4FA 1BLUA 1CBKA 2ZBQA 3EZOA 3F73A 1NK5A 3TNVA 2XO6A 2G4BA 1S0NA 4CNZA 1VQ4S 1FKOB 1LXJA 2XYPB 2EVZA 1SC3B 3HXMA 1B64A 2X7IA 3L09A 1LW2B 3KUEA 5T41A 3RB4A 4K0KF 3QLHB 5L1JA 3ITHA 4IQMA 3Q0AA 1I3OB 5CYQA 2QL9B 4HHHA 3T9NA 3BEGB 1AUSL 4JI3J 2JOQA 1FRLA 3MEGA 3ET6B 3NY0A 2J8AA 1YGYA 5HK4A 1NHUA 3GFXA 1S0OA 3M1VB 3BN7A 3CDBA 1NSKL 3J81U 3SFUA 4OYXA 2HYIB 1JNRB 2DNYA 4KKOA 1T9VA 2QLBB 3Q8UA 2HWTA 1N52B 3DLLQ 2HFNA 4DV2F 1F3FA 2RUSA 4DFMA 2MHEA 2QA2A 3ZTSA 2DO4A 2CUYA 3VAMA 1J2VA 5AT1B 1YKWA 1CJUB 3ZZTA 3G96A 2JJ4D 3QGGA 1FA0A 3OW2R 2VBWA 3CDEA 4TU8A 1FKAF 2DY9A 2RU3A 3AFGA 2OGUA 3EZUA 2CYYA 4ZVOB 4H4KA 1OIAA 1REGX 4ILMA 1YG0A 2HEKA 2LXUA 2DB1A 1FKOA 2HAFA 2FVSA 1RT7B 5SUHA 4OX9F 4C0HA 3QLHA 4O4GB 1YRTA 3BKUA 1SVDA 2V6AA 2O3DA 2HRUA 3FBEA 1Y3KA 4NOHA 1YJ7A 3CCZA 3NS6A 2L08A 4CYUB 2DGSA 3DXSX 5AE1A 3ZO7A 1CSJA 2G0CA 5KG0A 3ET6A 2DXDA 4OYIA 4L76A 2F8MA 3ELHA 4TXSA 2HQCA 3IN5A 1KFDA 5C25A 1HHSA 1T8EA 3M1VA 2HGLA 2DEJA 2KVIA 2E1AA 4WTYA 2UU9J 4O3SA 2PGCA 4UTGA 1H74A 4QU6A 1N33F 3H5YA 4IO9Q 3SBMA 3T1AA 3LUYA 2E29A 2HK3A 3SSRA 2Q1LA 5DLFA 3Q2TC 3HKZD 1Q81T 2BJDA 1RADB 2HHXA 4OHXA 1F5AA 1Q8IA 4DZ6A 4P52A 2WVFA 4R8UB 2APOA 2P6TA 2ZH9A 1VRTB 1HFEL 2P8IA 1Q7LB 3W2VB 2GV1A 1T05B 3GCXP 4X4QA 3M6UA 1XMOJ 1N36J 2D69A 2H54B 1ZM4A 3QFHA 3H4BA 4P6QA 2VB6A 5C2GA 2MQLA 4DUZF 4GC7A 1MN7A 4X4PA 4C0OC 3FEXB 4GRSA 1JLCB 2E9ZA 1RT7A 4XDCA 3TVYA 1G4CA 2IRUA 3IBWA 4ECYA 1MNEA 3OJUA 1R27B 1GTEA 3DGVA 2CG4A 4CI0B 1BY9A 3CCQS 2CQ0A 4JV5J 2YKPA 4K7QA 3TVZA 3IBFB 1FWPA 2R9LA 1S4EA 3QO9A 4NXNF 3H42A 3N01A 4F2RA 3R5GA 3KLGB 1UP1A 5FJ4A 3CDAA 4RWWA 4J9KA 4X2BA 4JI5F 2HHHF 4R0EA 2R7WA 3M32B 2YQ3A 1SC1B 2A6MA 3QMQA 5BR8J 3N6NA 4F0HA 3HHNB 1D8YA 4LBIA 2IY5B 2FD2A 1S59A 1BD6A 1ZETA 5E3RA 4USMA 1N6QB 3NGUA 4NX9A 3W65A 2QG9B 4R8UA 3EICA 1VRTA 1I94J 2MMYA 3W2VA 3A3OB 1T05A 4DR5J 2MZRA 3VAJA 1YBAA 4DR6J 2DO0A 3TRGA 1C2PA 1UPMB 2LKZA 5KFZA 4P7TA 3QT8A 2CNLB 3QZ8A 1WDDA 4NA3A 1JLCA 4M1KA 2LDIA 3R6LB 3CC4S 2B43A 4I69A 2UUCF 3CC2S 1RISA 5AXNA 2DHXA 2R8HA 2EG1A 1QAYA 3PIPQ 4O0IA 2NUUG 3FFIB 4JI1J 5BJRA 2WK4A 1YI2S 4EWTA 1FK9B 3N28A 2BQUA 1F2GA 1Q95G 3AY0A 3BQ1A 3MMBB 3KLGA 1SIZA 4OHZA 1WF2A 3DU5A 2BM1A 1S9FA 3NNAA 5KFLA 3M32A 3DYAB 5IWAJ 3IO1A 1NUEA 2X1AA 1WSVA 4LR7A 1U47A 5L8RC 1XQIA 3AT1B 2UVRA 2RU9A 1N6QA 4OX6A 7AT1B 3DLBA 2QA1A 3ENQA 4KO0B 1C0UB 1KTQA 1FERA 3UDVA 4EBCA 2AJ2A 2XTJP 3DRSB 4EGLA 1BWEA 2Z2ZA 5DGAA 2I9SA 3A8JA 4I1TA 1VQNS 4P2XA 2FUG9 4WP3A 1BUXA 3U7JA 1JJ4A 1SV5B 3DLKA 4JI2F 3DLJA 1RU2A 2ZZNA 4DSJA 1YTYA 3OXGA 2GFFA 2Y0BB 4ES2A 4EO8A 2M7SA 2RDJA 4ZS6A 3NLCA 2AYGA 4UOFA 2OIHA 4EMDA 4X65F 4K4SA 2I0XA 1TMJA 5K14B 1MWZA 2ZZTA 5F8HA 4F4YA 1T11A 3CCJS 5IV3A 3D7SB 4WCEQ 3J7Z5 3THTA 2JEJA 2K7JA 3FFIA 5D8HB 2PI4A 4PPDA 2LP4A 3N9UC 4OJ1A 4LFCF 4CT8A 1FK9A 1HL6A 4QPTA 4IOCQ 2KDOA 3AD7C 2WONB 2N7CA 5IXUA 2Q79A 4IFVA 1VCTA 2ZJQQ 1K73T 2WBMA 1AYEA 3DYAA 2FHJD 3GIKA 3EPGA 1N32F 3DM2B 3HP6A 2WZ1A 4N41A 4DV6J 1FF2A 4I6YA 1U0SA 1UA0A 2DNPA 2B4VA 1C0UA 4KO0A 3W61A 4ZVPB 3MM8B 1NK8A 4GO7X 2H4WB 5HQLA 1X4GA 1QSSA 2WSEC 2OPPB 2F4VF 3NGRA 4LF4J 4IG0A 1XR5A 1RTDB 4MJKA 4NRTA 2XLJA 3MMAB 4MKVA 1SV5A 2VG5B 1WUUA 5K20B 3DNCA 5DRKA 2XYGB 5KG5A 1D9FA 4RBTA 3BB5A 1S1XB 4F04B 1IKWB 3KG4A 4UQTA 3CJSA 3M8QB 3W64A 4P73A 4B9MA 2QMUB 3ETMA 5K14A 5GAGU 3HHLB 1YK9A 2KFYA 2GZOA 2H5IB 3B8HA 4UF4A 4CH7A 2ZVIA 1R8AA 4HYKA 4ALZA 2P2CB 1CS4B 2WONA 4DL3A 2HURA 4JI4J 2HS3A 1AROP 2CPJA 1DLOB 3TJ9A 2CQ2A 1Y0HA 3MXHP 3NAHA 3UN2A 2H9ZA 2LLZA 2MSSA 4U95A 2NPFA 3DM2A 1XMQJ 2OH2A 3CB4A 3EVMA 4DLGA 2E5IA 2LA6A 2OTJS 2KG1A 5LMNJ 1YVFA 3HLUA 3D54A 4TVAB 1FDAA 5DDQC 5J2MB 3N5BA 3MM8A 2ZH8A 2C22A 2VQFF 1IR0A 4CLTA 1O0PA 3LANA 1AT1B 2KJVA 4IOAQ 4IH7A 1B3TA 4OYMA 3WC0A 1DZ5A 1Y9OA 2VONA 1RTDA 3H2LA 1MMLA 2VBYA 3E3XA 3MMAA 5HP1B 2K2PA 1RBOB 3D1QA 1RA6A 4KGMA 1LK7A 4JUZA 1VQLS 3M2UB 3VGUA 1RBAA 1S1XA 2XEXA 1UPPA 4WYWA 3W60A 1CC8A 3M8QA 1UEVA 1GTHA 3CCMS 5HVHA 1MU2A 1NU4A 4XIUA 2QT7A 2Y1IA 2LXFA 3HHLA 3EX7B 1NSQA 2YNIB 3OTOJ 3QRPA 4FBUA 4LVNP 3PRBA 4UUWA 4NWBA 1D1UA 1HQUB 5DQGA 2J5AA 1K8AT 1TP7A 5LMUJ 4Y2MA 1VQPS 3NWGA 3I4PA 4OI1A 3VV2B 1CS4A 2FIUA 4OZNA 4LVOP 5KFXA 4JV2A 1KVIA 3ZXWA 1WG1A 1R0AB 1HI1A 1WC5A 1F5BA 4RU9A 3OBIA 4B02A 1PILA 1IR1A 4QR0A 3FEYB 1N34F 4YB5A 3JSRA 5KT3A 4USKA 2FJAB 3R7NB 2KH9A 1VBXA 2WRMA 3G8TA 4U67Q 4J9VA 2EBGA 3VF0B 3DLEB 4X66J 4HI2A 2PDAA 1FNXH 4DV4F 2B51A 1DURA 2XZTB 2WTFA 4EYHB 3HVAA 1YDLA 2VQEJ 4Z7CA 1AB8A 4NE9C 1DQ8A 4ZK7M 5HP1A 2ZWPA 4FXVA 2RUGA 4V19J 2CJXB 4K5SA 2GC8A 2CPZA 3CIZA 2AV5A 2D9PA 3PYDA 3G82B 1VFJA 3EPIA 1GX6A 4USWA 1NJXA 5KFOA 3K59A 3ISND 3D6HB 1XIQA 4ED4A 4ECXA 3UE2A 1UFLA 1P27B 3PZPA 4H4MA 5F0WA 3J80Y 2LQJA 5AXMA 3HULA 5KAKA 4G1PA 2D3OR 1HWKA 2FZGB 2FVPA 2PI5A 4OZ3A 1UAWA 4DR4F 1R0AA 4KGVB 3I9V9 5FDLA 3FRZA 1RCOB 4A8WA 3MAHA 2GVDB 4DL4A 4WZMA 1LWXA 3Q2SC 2MKYA 4C7QA 2CZ9A 1HNZJ 2DCUB 4QJVA 2DRAA 3PFEA 2JC1A 3DLEA 1RLCL 2FJWA 1Q86T 4KE5A 2V5HG 3CVKA 4HDHA 2NS1B 2Q3PA 1VBZA 4X4OA 1W26A 4WKRA 5CZXA 1H2UX 4DQIA 3KMQA 2N3LA 1Q4RA 2RRNA 2CNOB 2F40A 2RVJA 2FLOA 3Q8QB 2FC8A 2XCAA 2MKJA 3NBPB 3G82A 4YFUA 4A8FA 4MT1A 4X62J 4KPYA 3TEGA 4KHPJ 1S97A 1X8DA 3NGTA 2AYEA 3ILIA 5U47A 2OEJA 2EW9A 2HRYA 4LRFA 5T7LB 1FX2A 3T1YF 1U1NA 3UR0A 2MLYA 1H7WA 4JI6J 2K06A 5G0RB 2F7VA 1G7CB 2G1HA 4Z7YA 3SEOA 3MFIA 2FZKB 5A2QY 3RZAA 4AUKA 1KHVA 2POKA 2UVWA 2V94A 3LP0A 3L3CA 4WU3A 3C14B 2QYCA 4PQAA 3IS9B 2GVDA 4PYDA 3OFFA 1TAQA 3HFKA 4ILLA 2B7CB 1RWNB 4J9LA 3PACA 2ZZMA 4YB6A 2VOOA 2HHTA 2N4DA 3C8YA 5KFPA 2BE7D 1TK0A 2JH3A 2F9DA 1TUWA 2Q43A 2FLNA 1S0VA 2DGVA 2MXYA 2LXIA 2V8DA 3GB0A 4HL9A 4U9RA 2V8VA 1NJWA 5CQGA 4C4WA 4TLRA 1YIJS 3DRXA 1NRKA 2JL9A 1O5JA 5CA5A 3FK4A 4M5DA 1QJHA 3NBPA 4KH1B 3CO0P 3SMZA 2BRKA 4NL5A 4U7UK 3RAXA 3K5MA 2QTWA 3IRWP 1LWEB 2GNKA 5T7LA 3IR5B 3GZ7A 1LK5A 1NLKL 1HNIB 5G0RA 3EGVA 4ZVSB 4C8OA 2AX0A 4OLPA 3SI8A 2ZFHA 4F3MA 4OIXA 3BYRA 4MK8A 2V8HA 3FZBA 4WFBQ 4PG4A 4ED1A 4BBYA 1SJRA 3D3CJ 3C14A 1VQYA 1LW0A 2I5JB 4BWMA 3B82A 1H6KX 5J1PA 1TV6B 1IJEB 1R31A 4JYAJ 3AOCA 3CDUA 2MSTA 1JQGA 4F50A 1HIYA 2DNHA 1RTZA 3M2VB 2DR7A 2XY7A 3BS9A 1WTBA 2I38A 2CQ3A 2V2ZA 4YY3F 3HI9A 2V9WA 3MMCA 3OLBA 3FBBA 2L9NA 1VR6A 2HBYB 7FDRA 3D0IE 1X9WA 4M94A 4JV5F 2FB0A 1U09A 1XR6A 4RW9A 4IH6A 1RHQB 3HCXA 2KT2A 3PJ9A 4CO3A 5L9NA 1KQSR 3B4MA 4JBCA 3RBEA 4ID5B 3MTJA 4HTJA 2WOMB 4F02A 1LWEA 2QRRA 2HNZB 1WC4A 2R7XA 3S01A 3U02A 3G71S 4GKKF 2WCXA 3RBDA 4YR0A 5IT9U 3C16B 3MFHA 4N8NA 2AX1A 4F0KA 4A48A 3ILLA 1NDKA 2HFSA 1TFWA 1QDUB 1DQ9A 2AJ1A 2XSJB 2CJQA 1SQEA 5KG1A 4QBUA 3K17A 2RF2B 4CLUA 2I5JA 1KS2A 4DR5F 3AB4B 4QOTA 1TV6A 4P74A 2JHEA 4OI6A 4TY8A 1FDDA 4FNIA 2E1PA 3BSAA 4E8UA 1PJ6A 2COLA 3M2VA 4Z2XA 1FESA 2QC3A 4J9PA 1DHMA 3A8IA 4K8RA 3SIPB 3R97A 3AOAA 4DF4A 2HVZA 3MPWA 1JMTA 3G9CA 2HVIA 1H2VZ 2CZ4A 1X60A 3MCMA 4QZVB 2HK2A 5IS2A 2IDLA 5I3PA 3KJVB 4XK8C 4G3IA 4ID5A 1KQGB 3KHGA 2WOMA 2QL5B 1HR0J 2HNZA 3Q22A 4DPOA 1FEEA 3ILOA 4FKYA 3Q8YA 2WAQD 3EXCX 3BQ0A 4L73A 2OELA 4U96A 4M5LA 3NS7B 1QY7A 4B3SF 5LXRA 4LR8A 1RT4A 3R1HA 2CQGA 3JTNA 2XSJA 2BX6A 5E0OA 1GEHA 1WKKA 1OYDA 3RUBL 1PCAA 2J9DE 1LFPA 2HVDA 2GCFA 2GJFA 3DFEA 1KOHA 2KVQE 5L1KA 1B70B 1X0PA 1S79A 2HBZB 1WEYA 3GYNA 1BE4A 4OHWA 1SI9A 2M52A 3OR2B 5GADI 3MUVP 2F8HA 2IMOA 3UD4P 5CD4H 3MDFA 3K5PA 3VZIA 1VHFA 2YWEA 1FFWB 4LF8F 1U45A 4AL5A 3AJDA 3H8YA 3I82A 4GMKA 4KT0C 5DG9A 3RW7A 3BM7A 4QW9A 3SV4A 4RW8B 1EZZB 5H9EK 2NXEA 1BQMB 4ZPAA 3OL6A 1E6VA 1JLGB 3KLFB 4RBVA 5DQIA 1HI0P 3CD7A 2M8DB 1SBRA 3W5XA 2PA8D 3W62A 3HD2A 4ZP6A 3MD3A 1ZPWX 3W63A 5D0EA 4DV6F 2F3JA 3RRHA 1F60B 2XNRA 1RAGB 1X5PA 1QAIA 4UW2A 3FQLA 3FC9A 3LGHA 5HJXA 4ICLB 3QSYB 2JFDA 2DH7A 4D3GA 1YRXA 2CQ4A 1JLEB 1LOUA 4PWDB 2ZD1A 2D1CA 1YJNS 1IBMF 2KB2A 4NLVA 1RWKB 4WE1B 4OI2A 5DJBA 5E5NA 2OAUA 3OR2A 3TUZC 4PG6A 4YHHJ 2H1YA 2WVCA 2GIFA 2EK1A 1H3DA 3NKYA 3TZYA 3CCES 1FNOA 2Q66A 1TL3B 4U8VA 4DPTA 3RTVA 1VYAA 2YWKA 3DDKA 4LF6F 4MFBB 1GK8A 1R6YA 2J76E 3V4MA 5F8NA 3NL0A 2NPIA 4I64A 3TAMA 1KVJA 2JEGA 4RBUA 4DV3J 3OVAA 1PC4A 1BQMA 2ACYA 1BQNA 1D09B 1NK6A 2W9BB 4LF9F 3KLFA 3MF5A 3MEKA 5EHHA 2IVYA 4J9OA 2D9OA 2JEFA 1EAYC 3I0SA 2AJFE 4MIAA 1L3TA 2VG6B 1S0MA 3MPVA 3QAEA 3I56S 1X7VA 3UD3P 1K44A 2UUBF 2VJVA 4WYLA 4OX8A 3TZWA 2CQIA 2VFTA 2E5LJ 3VVUA 4DL7A 3THVA 4ICLA 3V6KA 2DNOA 4ZHRB 4W92B 2JFKA 3KLIB 3R2DJ 4MYTA 3C15B 4PEOA 3TA1A 1JLEA 3CGIA 3HPOA 2UV8G 1VQOS 5I42B 4K0KJ 4WE1A 2HQGA 3OTDA 2F65A 5GAEI 3W8PA 1F5CA 1WHXA 3LGNA 1CJTB 2AJ4A 2G13A 2RB7A 3WX8A 4F4ZA 2KHDA 1E6YA 2M2BA 3R5JB 3IAS9 1N5QA 2DNRA 3T5KA 2KZZA 2V67A 1GXLA 1U2RA 3OR1A 3HM9A 1JXEA 4MYUA 4ZP7A 3K5LA 3G86A 1IQZA 3GJTB 4OMFG 2XBPA 2W9BA 2FY1A 1S7IA 1UJ5A 4DV2J 1N5TA 3ISNC 1YBTA 4HHJA 2K7KA 3CNQP 4LIWA 2IFXA 2VG6A 1BQXA 3AA9A 3HHDA 4XPEA 2R7RA 5A8KB 1SH3A 5SZTA 1T94A 2ZOMA 3J7YU 4RUBA 3A3PB 4ZPTR 3M9OB 4YP3A 4I7FB 2I2YA 3VGSA 1FTCA 4USVA 5I3QA 3JAMY 5I4MA 1VOMA 1GNKA 4CO2A 3KLIA 2K8GA 3DOLA 2CXEA 3C15A 3MD1A 2GQCA 2DIUA 3FZ2A 2YVSA 3P45B 4OX9J 5I42A 1N4LA 2WHOA 3BREA 5A0YA 1CJTA 1IBCB 1FD2A 1KDNA 4NCGB 3OSPA 2IHR1 1SPBP 4LSNB 1P9YA 1QTNB 5A8RB 4OZLA 3TUIC 3CWJA 3ZZ0A 4PXEA 2OTLS 3BGRB 2VA2A 2VPYB 2M70A 4OZ5A 1XC9A 1T9XA 1J5OB 2ASDA 2DHSA 4WWSA 4BC9A 2A2DA 9RUBA 1YJTA 4FYVB 4H54A 1N33J 1PKUA 3O3LA 5IQQA 2P5VA 1JWWA 3EDQB 1GAOA 3US5A 2KL8A 1NK4A 3DRPB 1CVJA 2EKNA 5A8KA 2LQ8A 3OL8A 2CJYB 1C1CA 3ILJA 2GX8A 4I2QB 2P6SA 3BDEA 5B0DA 3WIUA 4I7FA 3Q8RB 2J6SA 4ZOSA 3KLEB 2HPUA 2PFFB 1XERA 3VR1A 3M8WA 4G1IA 3DHXA 3J80U 2XMTA 1RYRA 4DUZJ 1X9SA 1FT8A 2RJZA 1FFGB 2B8QA 2C1EB 2CRLA 2R3VA 1ITPA 3GV5B 2W1BA 1PO6A 2R2UA 1S1WB 4GC6A 4WPAA 5THWA 2PSZA 2UVUA 3T5LA 1C0TB 1F0XA 1ZTTA 4OV1A 2GGPB 2UUAJ 4NCGA 2C2ZB 3LTOA 4ECWA 4X62F 1SH2A 4N77A 2N82B 3TQ1A 1NAQA 2FY8A 4WU2A 5IC4B 4TLQA 5KT4A 3LWMA 1BGXT 5A8RA 2KRRA 1DRZA 2RDIA 2LU2A 1VS3A 4NXNJ 1HQEB 4BS2A 1HKAA 3FBCA 3CJ0A 3M8PB 1S1TA 2UVVA 2VDHA 1H73A 1JLQB 1J5OA 2WB4A 3P8BB 3HK2A 1T02A 1Z1ZA 5J2PB 4JI5J 2VPWB 4X4SA 1UZHA 3GIIA 2HHHJ 5HQ8A 2AD9A 2ZDPA 3I5AA 1S48A 3GG0A 4ZIVA 4BC7A 1FKPB 3DRPA 3VGTA 2DNQA 4R0JA 5T14A 4B9UA 2HZVA 3OJSA 2HFOA 4WP8A 2BABA 2H65B 5H9EJ 3G6YA 1RKIA 2DRBA 1OJ4A 3KLEA 1N8RT 4NXMF 4YMEA 5KFMA 1V6HA 2PA3A 4LQ9A 2IDEA 4X84A 3AD8C 5F8MA 1SKWA 1N54B 3KTQA 4ANDA 1MW7A 5A2QU 3DGPB 5DDOC 3WHIA 2HLTA 4USUA 1IKVB 1O8BA 2VH7A 2DITA 2UUCJ 1UL3A 1OMSA 3ZC4A 4KQZA 1S1WA 2IYIA 1OQ6A 1UFWA 1C0TA 2H5JB 4B9SA 2GGPA 2YX7A 1WACA 2EWHA 5IC6B 4C8MA 5DO2A 3VTIA 3I31A 3CE8A 1QM9A 3PFOA 4PG7A 4DPYA 3DKDA 1HQEA 3UN3A 2W2NP 5KT7A 4LF7F 3UWTA 3M8PA 5C2CA 4RWXA 1JLQA 1IM4A 2O67A 4KGZB 5HVFA 2LU1A 2MLXA 2VPXB 2YX4A 5J2PA 3CW2C 4PUOB 1S77D 1FXLA 3ADAC 3CUNA 3C6UB 1NJIT 1FKPA 1T03B 2Z4PA 2ZVSA 4JI0F 4C3MA 1LWFA 2Y8YA 2XWXA 4Q2MA 1O6XA 2DYAA 2DH8A 4LBHA 4B9VA 2NSBA 5FD1A 4F26A 2FGOA 1BHNA 2NQPA 1CJKB 5F3TA 1CULB 1ZZFA 2RILA 2IM0A 4JI2J 5F0UA 1VIOA 1U6BA 4Q7AA 3QIPB 3U27A 3ZNJ1 2HQIA 1SJ3P 2HIQA 2BW7A 3M8RA 3DGPA 2Z8QA 1IKVA 2ZH7A 3U1MA 4X65J 3NXZA 3M05A 3KDNA 2BJ7A 3CIMA 2HAIA 2XYHB 2W7PA 4A8YA 2KI2A 4C11A 1RT1B 1D9DA 2YXLA 2AW0A 2GQQA 3HHLD 5L1LA 4I68A 4LFCJ 1B0VA 1FJCA 3R5DA 2YQ1A 1RAFB 1N56A 2UP1A 3LAKA 3OHAA 4Q5VA 4PUOA 4M5KA 5GADU 1N32J 2ZC4A 4HDGA 4C3KA 6FD1A 1SH0A 2BE9B 1TKZB 3C6UA 3TAPA 2ALYB 1T03A 2ABYA 3UNGC 2KT3A 4RPFA 2JVRA 3AAWB 3FCVA 4F3QA 3O44A 4K5RA 2F4VJ 2Y1JA 2KO1A 1CJKA 2N4CA 3K89A 1CULA 4HH0A 1YHQS 4JI7F 4DF8A 4Y2AA 4M5JA 1MWYA 4LBPA 3R7SB 3OUYA 1TUGB 3QIPA 3NAIA 3AH6A 1WI8A 3MM9B 3MUTP 4M8LA 5HN0A 2YPYA 3MWBA 3BGFA 2E9TA 2C3OA 2V69A 2FYXA 4M5IA 5LJ3Y 2BA9A 3BQ2A 5B0BA 4DR7F 1FXDA 4ED3A 2NSCA 1S49A 2YNFB 1PGZA 4URQU 4U7UD 3M4XA 1ZPVA 2CPXA 5KFRA 2QLJB 1EP4A 1VDHA 3OL7A 4WJBA 2XMVA 4UT4A 2AT1B 3MCSA 3JTPA 4RUHA 4WFNQ 3BGUA 5KFEA 4QWEA 3BO2A 4CZCA 5FIIA 1FE4A 2IMWP 1T9YA 5B0AA 1KSPA 5HQMA 2RKIB 1VQ8S 1TL5A 1RXOB 1TKZA 4YS2A 2KM8C 4X4TA 4NLRA 4Y2CA 2VQFJ 1R8HA 3W5ZA 2BZ2A 1Y4ZB 4RUCA 3CO9A 4C3LA 1U49A 1L3UA 2HS0A 3H2VE 4Y3CA 2DISA 1S4FA 1HHQA 4P7VA 1YJ9S 3PNIA 4CLFA 4IH5A 1RSCA 3MM9A 5HLFB 2R2TA 2BE2B 4M5HA 4DPWA 1UMJA 4H4KC 4K2JA 4J9QA 3M2RB 2MZTA 3MOZA 2CQ1A 2LEPA 2KT5A 4B3RJ 1NJYA 2DD8S 3ZNUA 1GT8A 4CLZA 2YNFA 1H2TZ 3PW0A 2DIVA 3UO0A 1RAHB 3F56A 4B17A 2YKAA 2B56A 2OSRA 2MTLA 1VBYA 3EGWB 3UCUP 4NEYA 5GAGI 3VWSA 2YNHB 1NXIA 3O5TB 3OQ2A 3PRVA 3BH7B 4QW8A 1S6UA 2EKYA 3Q24A 1K1SA 2R7TA 3UD5A 3KG0A 3R9LA 3QWPA 4F4AA 2E44A 4ATNA 4IUFA 3K8WA 4V1Ak 4UQGA 5JVGQ 4DV4J 3OTEA 2VKRA 5B7WA 2OKQA 3NRBA 3HFZB 4DX8H 1YX2A 3M30B 3T1HF 1NKBA 5KFUA 3QRRA 4I6WA 2YH0A 5CH7B 1UEUA 2C3PA 2GW8A 5HLFA 1JK9B 2O1PA 2HFVA 3GIMA 2BE2A 4ES1A 1UFKA 4R5PA 3CCWA 3U1LA 4KKOB 1FFSB 2B4PA 4DX6A 3IM9A 5HI7A 4DV3F 3HJVA 1VBKA 2KM8B 4F36A 1WC3A 4IOBA 1I6JA 2MHNA 1U1LA 3I87A 2HS4A 3ZZUA 4DR4J 1I5OB 2VBXA 1DTTB 4DL2A 4RW6A 2XMKA 1X5OA 2HWHA 4KHRA 1QTMA 3R5BA 4MKYA 5ETOA 4UOHA 5ETLA 2CG8A 1Y10A 3HT3A 4RL1A 3L7UA 1M5OC 5GVQA 1VQ7S 1Q82T 2CPDA 2DT9A 2CDRB 2B7BB 4N8OA 2VFVA 2N7YA 4L75A 3AQPA 3OFGA 3BZQA 4WZQA 3HJFA 3M30A 1K47A 1Q0NA 5L46A 4DU7A 1NZ8A 4QIEA 4TQRA 2OPRA 2I8EA 3DDNA 1TVRA 4O3QA 4PKDB 3T41A 3W1YC 2OMLA 4FXWA 3ZFVA 3UNYA 4BHQA 4WIIA 1M0SA 3HKWA 5C25B 2HSEB 1NDCA 1UWAA 3BF4A 4WIQA 3MHYA 5HMZA 1P8GA 5MAOA 4DJBA 2HQFA 3T1YJ 3J81j 4TU9A 1S1UB 1PIEA 4RU2A 1QE1B 2GS8A 3DLGB 1H72C 3IWLA 2HHUA 1AXQA 3UVJA 5L1IA 4IYQA 5KFDA 4F2SA 1RQ0A 2ZEJA 1EETB 1KEKA 4NLUA 3IG1A 1DTTA 1SJ1A 3CD0A 4ZVTB 4I67A 3CXCR 2B9XA 3DC2A 2X1FA 3GJSB 4PYAA 2WVDA 1NCLA 4UOGA 2LEAA 4ZJLA 4C8YA 1UVKA 1U0HB 3ULHA 5EX0A 1WG4A 4ECVA 2J7KA 5C24B 1FHTA 2MQMA 1SKUB 3ENWA 1RHUB 2R7OA 4ECRA 5M2PA 4U7CA 3HT0A 1JXVA 2BOPA 1R8CA 2AZ1A 4B3TJ 2QEXS 1BXNA 4NA1A 2OP5A 3MPYA 2B5JB 4ELVA 2Y1LB 1B99A 2Z57B 4DV5J 3QO9B 4C8NA 4OZJA 3I5BA 4X4VA 2AF6A 2MKCA 3IMQJ 2ZH4A 3D0HE 3LPEA 3AXMA 4DFKA 1FRKA 3JAMU 3OHBA 1IR2A 2DNNA 3MURP 4ZCIA 3NG8A 4Y34A 3ZTRA 5KFIA 1RUSA 1S1UA 3O1LA 4ED8A 2FVCA 1QE1A 3DLGA 1ZM2A 4JP8A 2AJQA 2PFDA 3M9NB 1KQFB 2HHSA 1EETA 5LSLA 5DQHA 1LQ9A 2QL7B 4B3MF 5K8OA 2ZE2A 2DNKA 5D77A 3RG6A 4BCAA 3D5MA 3TOQA 1WEXA 3THPA 4HI1A 2ROEA 2ZITA 2ERRA 3POTA 1HI8A 5F8LA 3RB6A 4Q44A 2KFZA 3TUPA 2DR8A 2KHCA 3VGVA 3QJJA 1U0HA 3J7AN 2J0SD 1Q8BA 1PBUA 2HG4A 2HLUA 3HSZA 5C24A 4YY3J 4Q2LA 5DLGA 1FI4A 4KY3A 3PEHA 4QIGA 2OFHX 3CEDA 1IUJA 4CO1A 2AHOB 1DTQA 3QZ7A 2UUAF 3A3NB 1NO8A 1ELOA 3T5HA 5KFCA 1KBRA 1R0CB 3QFWA 4EK2A 2B5JA 4YN3B 1D9AA 5JVHQ 2E9RX 5B0FA 3B4DA 4A8XA 2IA6A 1N5SA 4HH1A 3UFCX 4IRDA 1DQAA 1LKZA 4N76A 4I56A 5F9LA 3JQJA 1PAEX 3H2UB 1X4DA 2W24A 1NPRA 1RB0A 5JJBA 2EFQA 2IC3B 2IM3A 4ZPBA 4YR2A 1JIHA 4NZ0A 2ZOGA 4GKKJ 2IBKA 3V6JA 3ZTOA 4AD6A 1F9HA 4USHA 5EDWA 2GAGC 4ZP9A 3TZZA 4CQ1A 2V4JA 4RR5A 3G8SA 1JB0C 2MEWA 1Q5VA 4G1QB 4UZBA 1X5SA 2XY6A 1NKCA 3HHEA 2R8JA 2GHVC 3DLKB 2BR0A 1QAJA 2QSWA 2MJNA 3BPDA 2HQDA 4HT5A 4EZ9A 4OZ0A 1TUVA 1FRXA 4PR6A 1KP6A 2W9AA 1EB0A 3PW2A 1IQTA 4AXJA 1ZAWA 2LQBA 2Q6BA 3MR6A 2XCPA 2AKWB 2DRDA 2HW3A 3FBFA 2CWKA 2Z2MA 3DMJB 3AXKA 3EWGA 3NCRA 2E1RA 1SKRA 1R7IA 2C2RA 3KWMA 1YLXA 3UR3C 4EU0A 5JMNA 4DSIA 4I2PB 3KMSA 4RNFA 3D6FB 4IFVB 3CJ8A 3DLHA 3MZIA 3M6WA 1M90T 5E3AA 2IC3A 1XJWB 1VHIA 3UQSA 4QR1A 3KJQB 3I96A 2YWHA 4LRAA 2X1GA 2XI3A 3DN9A 3CTRA 4B3SJ 4L3NA 3HHLC 5CYMA 1A7GE 1WKLA 3E01A 4MMOA 2AMCB 3W5YA 2YTCA 1ZAVA 4G1QA 1SJQA 2GIQA 2M0GB 4IRCA 1YQHA 4IG0B 4LUBA 3EUNA 4DN9A 2U1AA 4FF4A 4CLKA 4CH0S 5HBMB 2M9KA 2DCLA 2OHDA 5ADZA 1S9GB 3HSJA 3NGDA 2CQDA 2BJ1A 1RT5B 2A3JA 1GH8A 2VICA 1S12A 5KFGA 3C6TB 1JLFB 3HHKA 3GJQB 4LF8J 1QSLA 2JEIA 3EGNA 2C2OB 5B08A 2MDAA 2EFGA 3D68A 2JSXA 4ZPVR 3EE3A 4Y0FA 1T95A 3DMJA 3PRDA 2RE1A 4AE5A 2NLWA 2RRBA 3UDEA 2JVOA 3R7BB 3N4WA 4I2PA 5HANA 3ZZPA 1S9EA 1SUQA 4UY8T 4D3HA 3EVOA 4JOUA 4J9UE 1NK9A 3F41A 3GYXB 4CDIA 4IO1A 1FRIA 3QPIA 5F41A 1N0UA 4TQSA 5DG8A 3M8SA 1UVLA 1WHWA 3M9MB 3D0GE 3TWZA 4WXWA 2HQ3A 3W7BA 2UUWA 3PW7A 1ZTWA 3CMES 4UZCA 1RWWB 2GQ2A 5KFKA 4QIWD 2DR9A 1RAOA 2HNYB 3QQCD 5HBMA 2Y0SD 2HVEA 3ZZOA 3SXLA 3HVTB 1ZA2B 1IBMJ 1EX8A 1TU0B 2V4RA 1S9GA 1T0TV 2FQQB 2E7WA 3OD2A 3PX6A 5ETSA 1RT5A 2BBEA 3W9HA 3D4JA 2NXUA 4C9DA 2IJFA 2EFNA 3C6TA 5KT2A 1JLFA 2FHMA 2RS2A 1F1BB 1MU2B 1OY6A 3SQOP 4LRBA 3R2CJ 5HAOA 1S57A 5EWFA 4LF6J 3H0PA 3BO3A 2NYIA 2QO3A 3T3FA 2NXNA 3QNWB 3JXOA 2L48A 4ZITA 4DS4A 1LWCA 2OMOA 5D0RA 1RJJA 2UXCF 4DSEA 1WF1A 4LF9J 1IVZA 1FX4A 1BWVA 4URSA 3CJRA 3O2IA 2ZWOA 1S6PA 3P96A 4DR1F 3BJYA 4MIWA 1WHVA 4DL0C 4ZP8A 3PJXA 2W2MP 3QJLA 1DBDA 2J8SA 5DDRC 1JJHA 2UUBJ 2UXDF 4FBTA 3KKFA 2FC9A 4MIBA 3KXDA 2KXNB 1J5EF 5KFWA 1Z2LA 2I1RA 3EYZA 2NYHA 1RTIB 1YJVA 1H0HB 2MQPA 3G2XA 4W98A 1BMQB 3PO5A 2AGQA 2HNYA 1CLFA 2LMIA 4ZLNA 1RWVB 1UVJA 2B4OA 3HVTA 1X4AA 5HO4A 4DUTA 4E2FB 5J1NA 3JYTB 3MECB 1FEHA 1PYOB 4DQSA 2H48B 3IP0A 4C8KA 1NMEB 4KGKA 3DRYA 2CZVC 3MPUB 4LF5F 2RMLA 2EFOA 2B4UA 1U48A 1IKXA 1U7LA 3H4DA 1NK0A 2DNGA 3M7VA 1PSDA 2D41A 4B3RF 3JS9A 4H4MB 5GAHU 1SJ4P 4P75A 1IXKA 4DBQA 2B0GA 2LEBA 1QLNA 4RO0A 1HWLA 1RP5A 4ZMMA 3J7A1 2AGPA 3KHRA 2PT0A 5ETMA 1K9MT 1UW4A 2J6UA 3BSOA 5FDLB 4FKXA 2PEHA 5J2QB 5K8NA 3A8KA 4Y65A 2FPHX 1P6TA 2VIHA 3MR5A 4FZVA 4ITSA 4ZLLA 4F25A 2IJRA 2ZJRQ 3EVWA 3OV7A 4HLBA 2WVEA 5EN1A 5KFQA 2BMBA 3H5XA 1G3OA 1PYTA 3OLAA 2D3O1 1RTIA 2DEIA 2G0IA 3B6BA 1TKTB 4KHMA 4OYZA 5D4OA 3IGNA 2E66A 4IG3B 5CD4A 2FZCB 4CCHA 4BLGA 3LOUA 4HKQA 3IA0A 1Q53A 4ED0A 3KUGA 1UZDA 3JYTA 3MECA 1L5UA 2VZ9A 3P5TL 4ZVEA 2AZ3A 1W2IA 3NGSA 3CDWA 4FNHA 5J1EB 3IBCB 1L3SA 2QMWA 3CMQA 2XZDB 1HW8A 1RBLA 4O3PA 4LT6A 1YZ7A 1RT3B 1IM6A 1HBOA 4ECZA 4ETXA 4DQQA 3TARA 2B9YA 1F6TA 1B7FA 8ATCB 3JSMB 1EKSA 1S72S 4PG8A 4XO0A 1TL4A 4EUVA 3IR6B 3SDEB 2MYFA 2QYGA 3VAHA 1ZYQA 1PJ7A 4NEZA 1LFWA 5J2NB 2ZH6A 2M88A 2EFVA 1HQ2A 1RAIB 1NPKA 2MQQA 1WORA 2A10A 3VALA 4YR3A 3PCOB 2MKSA 4QIVA 5J2QA 3LP0B 4QPXA 4CTAA 2HWIA 1ACMB 2ZDOA 3GILA 2A0FB 1R89A 1TAUA 4RNMA 2AEMA 4RW4A 2KJWA 3PYFA 2FJDB 1NK7A 2GO8A 6FDRA 2VC1A 1SL1A 4ED5A 3K7RA 2D3ZA 5EGYA 2VG7B 2KYZA 2HMIB 2CADA 3WDOA 1SQFA 1FJEB 1D3WA 1TKTA 1U1RA 3D1HA 4IG3A 3BYPA 2J7WA 3GFYA 3R27A 5KFYA 4J37A 3D28A 3TO8A 2ASJA 4OHYA 3GG1A 3MUMP 3D67A 3JSYA 3N0VA 3J7YI 2DGOA 4M5DB 3UW1A 4OI3A 3MEEB 5J1EA 1MROB 1AUDA 2ATCB 4DX7A 5AXKA 1C4AA 4DQPA 1OPIA 1RT3A 4J9SA 4CLPA 2IRYA 3G6XA 1HLWA 2BJ3A 4DV1F 4FS1A 3JSMA 5I3UB 2WVBA 4CP5A 3SDEA 5D4NA 3X1LB 4IFYA 3LO3A 5KFSA 5J2NA 1RTHB 2V34A 1VJWA 1GXTA 2C2MB 2XO7A 2X3GA 1WTFA 3PYEA 4FF3A 1VGYA 3M8YA 1M5PC 4ECTA 4NA2A 4DI6A 1GMWA 2XHCA 5CYJA 1FRJA 1LW0B 4KFBB 4CLLA 1F9FA 2XMMA 3H20A 2ZM6F 4Z37A 1DARA 3OFEA 5K5MA 4C8ZA 3MR3A 3OVBA 3LP1B 2YWGA 2W2OP 2H4YB 2C28A 4X64F 1ICEB 2PO4A 2VG7A 1UCNA 4NXMJ 2HMIA 2Z2YB 3RBXA 3I32A 1FRHA 4I6AA 3MMCB 2FLLA 4M95A 1G2EA 4FF2A 5AE3A 4DCOB 2LDYA 3P6YC 5BYSA 2DJWA 2XM3A 2ZH2A 3MOJB 4B3TF 1H7XA 4CT9A 4WTOB 4PXCA 1EHWA 1O51A 4RW9B 1Y11A 4KSEB 3MEEA 1MROA 1U2FA 2FLPA 2FTRA 5MLCV 3FMWA 3GPAA 1Q79A 4DUYF 4DV5F 1XBWA 2E7XA 2L9DA 4Q43A 3FEZA 1OY8A 1MN9A 3RR7A 2QV6A 5I3UA 2HFZA 2ZH3A 4LF7J 2ZUAA 1UA1A 4ZCLA 4YEAA 2MGZB 4V19X 2BXJA 1RLDA 1AFIA 3EZ5A 3PKYA 2JLEA 2AYBA 1RTHA 2AQ4A 3TA0A 2EC0A 4TYBA 4NLQA 4P10A 2DK2A 1TMMA 1LW2A 2XWYA 4K4VA 5F8IA 3PW5A 1SL2A 4HHUA 3S1TA 2LVWA 4KFBA 4JI0J 3GONA 3RU0A 2V9KA 3BR8A 4H4OB 3LP1A 4KAIA 3Q86A 3H7HB 1TKXB 4LSZB 4FF1A 4TY8B 1OPZA 2JLGA 1KKHA 4UY85 1HBNB 4QWCA 1RT2B 1TZ0A 1URNA 1NBEB 3MTKA 1N48A 2RT3A 3O8WA 1VMBA 3JQMA 1QUPA 4K2XA 3IXQA 7FD1A 3H98A 3Q8PB 1F9EB 4OYWA 1KN6A 1Y5IB 2G0JA 1UVMA 3QT5A 3GYGA 1VK3A 2XHWA 2HHQA 1RZMA 1KVKA 1WF0A 1CJUA 3EDRB 3H40A 5E41A 3A1YG 1UVIA 1XNRF 2YWFA 4ETZA 2EFPA 2W2PP 2A18A 3GSDA 3MAQA 1S10A 3IAM9 3VCDA 2MGZA 5KTQA 2C3YA 4MH8A 5DS7A 2CJBA 1B7YB 2G9OA 4EZ6A 4USIA 1HNVB 3W66A 1XMBA 1RT4B 1UJ6A 2DXFA 1P1TA 3PDNA 2VF3A 4GKJJ 4C2MA 4O4GA 3FCHA 3LPYA 4GO5X 5IT9Y 1AW0A 3SSQA 2ZHOA 1IBKF 3QGPA 1G1XA 4CYUA 2NZCA 2KKHA 1XNQF 1FRMA 4H4OA 3HFVA 1F3VA 1RGVA 1TKXA 3K58A 5HL7Q 1YJRA 1HBNA 1RT2A 1C4CA 4DR3F 2VD3A 2KXHA 4O0NA 2GO9A 4Q45A 4JI7J 2RRAA 4JV1A 3CPWR 2OEKA 4N5SA 2OUGA 3HDSA 1HHTP 5D4LA 2QLWA 4NYPA 4O3OA 5K8PA 1M5VC 2PMZD 4JI8F 2GHPA 2HZAA 2EBEA 3LF0A 2CPFA 2EI5A 3CJ5A 4KB7A 3ETOA 1LV5A 1IBLF 2E1CA 2BDPA 5L38A 1T3OA 2YQ0A 3H25A 2ZBIA 1GX5A 1E6VB 1SIWB 2VPZB 1HNWF 4DR7J 4GVLA 3SYZA 4G65A 3HX9A 4NYZA 5CCLA 4AYBD 2R8GA 1X31C 2XULA 3UI3A 1Q1KA 2ZKTA 5IM0B 4P72A 3QRQA 4WFYA 1HNVA 2NZ4A 5HVGA 3CCLS 4ZIWA 2MLZA 1FNMA 3L7OA 5HROB 1RYSA 2QFIA 4NPOA 2DKOB 1PG5B 5KFAA 3QBCA 3VZHA 3IWXA 3LA0A 3MGJA 2ZD1B 3PTWA 4KH0B 2CQCA 3P49B 4QWDA 2DR6A 5IOLA 4IKAA 2ASLA 4WFZA 3W2WB 2CKWA 2GA7A 3VVTA 1U1KA 2MPUA 1A0OB 3FMBA 1GFWB 2YY3A 2W4PA 4MK9A 3T9ZA 4I4BA 4XPCA 4ZVQB 3GTYX 5EWGA 1NEEA 2CPIA 2WB1D 2V2VA 2KTQA 1KWMA 3TAMB 4JB8B 4L74A 2YKQA 2ALZA 2NR0A 1FXRA 2XLIA 2ZHAA 4LREA 1NH8A 1BQNB 1YSJA 3QT6A 1SC4B 1AFJA 4EBDA 2OLWA 2BJ9A 3BBBA 1UKUA 3I0SB 1CEZA 4OFZA 4ELTA 2IYGA 3PG9A 4ZA1A 5CZVA 2ZBPA 3HSGA 4DCPB 5IM0A 1D0EA 1R8BA 1UEKA 1YJWS 1SJFA 4NZ7A 2YWWA 1ZH5A 2V63A 1Z2ZA 4Y00A 5HROA 5IT4A 5LJ5Y 2IIHA 2DVIA 5HMYA 1RT6B 2FDNA 3TA2A 4NASA 4ID8A 2DNZA 4NLXA 5DDPC 3T1HJ 3X3UA 1VIXA 4ZPDA 3W2WA 2ZH1A 3OSNA 3RGIA 2AP6A 3I55S 2DY1A 3MMBA 1E6YB 2M5YA 2W25A 2YPZA 4ANEA 4FPRA 4Y2KA 1DY3A 3D6MB 3PKMA 2BVZA 3GLJA 4JV0A 1RTJB 3OR1B 1X4HA 1QD1A 5IFMA 3S6EA 1SL0A 3QWUA 3D9BA 4BWJA 2HHVA 1FWKA 2HIYA 1OY9A 4NLDA 5IT0A 4DOZA 2ILZA 5ETPA 2BRLA 2PD1A 4FYWB 5AJ3F 1OSDA 3DRSA 2R7SA 4DMZA 2XY5A 4XAKA 4OYAA 2ROGA 4CLYA 4WFXA 5C7PA 3K5OA 1ROFA 5BYQA 2DHGA 1R3NA 2IAJB 4NLGA 4OL8A 3NS5A 3I6PA 1HNXJ 2RDDA 3ZTQA 4AQYF 4A46A 1FDBA 4YUDA 2JWNA 4USJC 3BO4A 1VQ9S 1TR0A 1RT6A 1WEZA 1ZZNA 3DOLB 3KG1A 1NH7A 3GMGA 1HWUA 2EXUA 5DETA 4AL6A 4F3OA 2ACMA 1Z4UA 2AJ0A 1V9OA 2LA4A 3MCNA 2P9EA 4ZCKA 5A0YB 2CPEA 1SC6A 3KNAA 1VC6A 4PRFA 4NLSA 2C42A 2B3TB 5KFNA 5KFVA 3T6BA 4HVZA 4OI0A 4MKBA 3DCAA 1U26A 3L4BC 2PN6A 3MEDB 4YQWA 1WKJA 2G2OA 1RWPB 1RTJA 3CJKB 5GMEA 3SZ2A 4Q0BB 3MAAB 2DGXA 2E5HA 1RCXB 5CCMA 2V0NA 4F7VA 3SSSA 2OPPA 4RKUC 2I6WA 2EC2A 1K0TA 3S8SA 3NGKA 2BKNA 2OEMA 3FSXA 4B9NA 2PE8A 3W8GA 5KT5A 1SXLA 2VG5A 4DS5A 2IAJA 4RNHA 1C1CB 2YKOA 5ETVA 4K50A 2GJIA 3H5SA 4FYXB 2R42A 2CQPA 4WK3A 4LFBF 3QJPA 1IKWA 1FJGF 4CO5A 3PJWA 1X4FA 2B9WA 2DHAA 2KXFA 1LXNA 1SB6A 4K4YA 4NRUA 3MR7A 3CCSS 2QFJA 2XMJA 2Y8WA 2A1BA 1U8WA 4ZVRB 2BACA 2RH3A 2BM0A
chains in the Genus database with same CATH topology
4Q44A 2KFZA 2DR8A 1SQEA 2O01C 2DNMA 4DSFA 5KG1A 3BSNA 2KHCA 4QBUA 3KK2A 4G6VB 2RF2B 4ZPWR 3QJJA 2I5JA 1N88A 1C1BB 1KS2A 3G6ES 2J0SD 1Q8BA 2N3OA 1S76D 4DR5F 2HG4A 2HLUA 3AB4B 4RW7A 4QOTA 1S99A 3ENVA 3JSBA 1TV6A 5C24A 1IKYA 4Q2LA 5E7OB 2MZ1A 4DR2F 5DLGA 2JHEA 4OI6A 4K4TA 3T5JA 4TY8A 4RLEA 1DLOA 1FDDA 3PEHA 4FNIA 4QIGA 3BSAA 2OFHX 4E8UA 1ZM9A 2COLA 3CEDA 3MEDA 1VQMS 4LSLB 1IUJA 3M2VA 4Z2XA 2BQRA 2WSFC 4CO1A 4EEYA 1DTQA 3QZ7A 1FESA 3DI6A 3AB2B 2UUAF 2ZC3A 1NO8A 3CJKA 4B9TA 1BC6A 1ELOA 3MI7X 3T5HA 2Z2LA 4J9PA 1DHMA 3FGVA 5KFCA 4IR1A 4Q0BA 1S1TB 4J5OA 2XGPA 2B5JA 5FLXY 3VQSA 1D9AA 5JVHQ 2E9RX 1L3KA 5B0FA 2HGNA 3B4DA 4HEA9 4A8XA 4CTAB 4DFJA 5J2MA 4DF4A 2IA6A 1N5SA 3CD6S 2HVZA 3EXYA 2X51A 3MPWA 1XWLA 4DV7F 3AA8A 1YITS 1JMTA 3G9CA 3OL9A 2VFRA 4HH1A 2HVIA 1H2VZ 3UFCX 4RW4B 5H1SV 4IRDA 1DQAA 2CZ4A 5EX3A 1LKZA 4N76A 2DBBA 4I56A 2GJ2A 4EFAC 5F9LA 4QZVB 3PVXA 2ATLA 5IS2A 3H2UB 5A6WA 1X4DA 2W24A 5I3PA 4KJIA 5EUHA 1S6QB 2QZ8A 5C5JA 5JJBA 3KJVB 1VI7A 2EFQA 4XK8C 2IC3B 2IM3A 2QMXA 3K0JA 2VC0A 4ZPBA 3BDPA 3CMAS 2ILYA 4YR2A 1Q16B 2KU7A 5A8WB 4G3IA 1JIHA 3U1NA 4B9LA 4ID5A 1GXUA 2D74B 2ZKUA 2ZOGA 4NZ0A 3WX4A 2L3MA 1KQGB 3MR2A 4HTIA 2IBKA 3R5AA 3D1OA 2Z0GA 4RUAA 3V6JA 3BSCA 3M2UA 4USHA 3N6LA 3E51A 3KHGA 5B0GA 2WOMA 5EDWA 5CXTA 1IN0A 1REVB 4ZP9A 2HNZA 1A9NB 4CQ1A 3Q22A 1ZBTA 4DPOA 2KFNA 3TP2A 1FEEA 2V4JA 3MM7B 4J9NA 3UDLA 3G8SA 1MSWD 1JB0C 4L72B 1VRUA 4FYDA 3KFWX 2WAQD 1T7PA 1P1LA 3EXCX 4OJHA 2WW8A 3BQ0A 3PM9A 5F8JA 5KFHA 4UOCA 4G1QB 1X5SA 2XY6A 1NKCA 5KG3A 2L41A 1QY7A 4B3SF 5LXRA 4DL5A 3HHEA 1X0FA 3OTCA 1RT4A 1WD6A 3R1HA 2CQGA 2RD5C 2YNIA 3CCVS 2R8JA 2GHVC 3JTNA 2XSJA 2HHPA 3DLKB 2BR0A 1QAJA 2QSWA 5L9XA 5K8MA 4X4RA 5E0OA 2MJNA 5F9NA 3LWLA 1DAXA 1HQUA 2GMLA 2J0XA 4LFAF 3SCIE 4DL6A 1FVSA 2DNLA 4A8MP 2J9DE 4NYOA 1LFPA 1C1BA 2GCFA 4OJ3A 3CCRS 5GAEU 4CIOA 4QYZJ 5B0EA 2RKIA 4HT5A 4EZ9A 4OZ0A 1R43A 1TUVA 3DFEA 1KOHA 1FRXA 4QU7A 4PR6A 5L1KA 2W9AA 4RNNA 1X0PA 2VUGA 3PW2A 1S79A 1IQTA 2RQ4A 4AXJA 1ZAWA 3RB0A 2LQBA 2Q6BA 4IFYB 3MR6A 3ICLA 1RK8A 5LL6d 2FGCA 2ZNZA 1WEYA 3H59A 2XCPA 3GYNA 2R4FA 1WG5A 4LSLA 4OHWA 1SI9A 3OFHA 1KNZA 2XB2D 2HW3A 2M52A 3OR2B 4NLOA 4WK1A 2GMJA 2RSQA 5GADI 4RZRA 1S6OA 3MUVP 3CF5Q 4OHVA 4YB7A 3K5NA 2EPIA 2F8HA 2IMOA 3UD4P 2Z2MA 5CD4H 3DMJB 3J7ZT 2FHOB 3NCRA 3MDFA 2E1RA 3K5PA 2UXBF 3VZIA 1VHFA 2PMHA 1SKRA 3RR8A 3RB3A 3E2EA 1R7IA 3GV8B 4X4UA 1Y5LB 2YWEA 2C2RA 4LF8F 3KWMA 2CDQA 5E3QA 1KHWA 3ITHB 4QIFA 5ITHA 3GWCA 1YJUA 3CT9A 1U45A 4WF9Q 4AL5A 3H8YA 3UR3C 4EU0A 1Y3JA 4DSIA 3I82A 5CYQB 2RS8A 2VFUA 4GMKA 4MK7A 4EO6A 4YHHF 4OX7A 2MKHA 4KT0C 2O66A 4I2PB 2LECA 4U6PA 3KMSA 1KFSA 5DG9A 1UETA 3RW7A 4RNFA 3BM7A 4QW9A 4IFVB 3DLHA 4NLWA 3MZIA 3K2YA 3SV4A 3MEGB 2J9DA 3IRXB 4RW8B 2AGOA 1S6QA 3M6WA 4TU7A 3GR1A 1M90T 1WELA 2XI2A 5E3AA 2IC3A 1BQMB 4ZPAA 2E5JA 3OL6A 1LWFB 1E6VA 1JLGB 3OPKA 4JI3F 1U6FA 4LQ3A 1RAJA 5A8WA 2CIMA 3KLFB 2M8HA 4RBVA 3IC1A 3UQSA 2BV3A 5DQIA 1HI0P 3CD7A 2NUHA 4QR1A 3E8OA 1JLBB 1K0VA 3I96A 2M8DB 3M2RA 2YWHA 2X1GA 1SBRA 2XI3A 3DN9A 1REVA 3G6VA 3CTRA 4PG5A 2PA8D 4L3NA 3HHLC 3OTBA 5CYMA 3MM7A 1A7GE 4KV8B 1FTRA 2CQBA 4ZP6A 3E01A 3AJ1A 3I9ZA 1ZOTA 3MD3A 3QYYA 4MMOA 1ZPWX 1I1GA 4ED7A 1A6LA 2ZH5A 2RQMA 3FSIA 2YTCA 5KOXA 4DV6F 1RA7A 1M5KC 1ZAVA 2F3JA 1SJQA 2V8GA 4G1QA 5KG6A 1VQ5S 2GIQA 2M0GB 3L7PA 3RRHA 1F60B 2XNRA 2ROPA 4IRCA 1YQHA 1X5PA 4IG0B 1QAIA 4LUBA 1CG2A 3EUNA 4UW2A 2M4MA 3FQLA 2U1AA 4DN9A 3GQCA 4F4XA 4FF4A 3PR4A 4CH0S 5HBMB 1KTVA 2M9KA 3PY8A 3JB9k 2AU0A 2CFXA 2AYMA 2GMHA 1K1QA 2DCLA 4ICLB 5ADZA 4YOEA 3TAQA 1S9GB 2JFDA 2XMWA 2J7UA 2DH7A 2YNHA 1YRXA 2CQDA 4D3GA 3NGDA 2CQ4A 2FVRA 1RT5B 4X4NA 2A3JA 4ZVHA 1GH8A 1JLEB 2LCWA 1LOUA 4QR2A 4PWDB 2ZD1A 2E5LF 1BLUA 2D1CA 2QIFA 1YJNS 3F73A 5KFGA 3C6TB 4A47A 1IBMF 1NK5A 3TNVA 2KB2A 1JLFB 3HHKA 4C11B 4NLVA 2G4BA 2MZJA 2UZAA 4WE1B 1S0NA 1QSLA 4OI2A 5DJBA 2JEIA 5E5NA 4CNZA 2OAUA 3OR2A 1VQ4S 3EGNA 3TUZC 5B08A 4PG6A 2MDAA 2EFGA 1FKOB 2JSXA 4ZPVR 4Y0FA 1T95A 1LXJA 3I4HX 2EVZA 3HXMA 1B64A 3DMJA 3L09A 5HMXA 1LW2B 2CJAA 2EK1A 1H3DA 3H5UA 5T41A 3NKYA 3PRDA 3CCES 1FNOA 2RE1A 3RB4A 2Q66A 4K0KF 3QLHB 1KONA 4AE5A 5L1JA 2NLWA 1TL3B 2RRBA 3V6DB 3ITHA 4IQMA 3Q0AA 2JVOA 3GIJA 3RTVA 2YWKA 3DDKA 5CYQA 4ECQA 4LF6F 4MFBB 3T9NA 3BEGB 3N4WA 1R6YA 2J76E 3V4MA 5F8NA 4I2PA 3NL0A 2JOQA 3ZZPA 2NPIA 3QIDA 2F9JA 1S9EA 1SUQA 1XN9A 2KRBA 4I64A 3TAMA 4D3HA 4UY8T 1KVJA 4KIAA 2JEGA 4JOUA 1FRLA 2LQ5A 1U25A 4RBUA 1NK9A 3MEGA 3F41A 3GYXB 4IO1A 1FRIA 3IRXA 3OVAA 3QPIA 3VAIA 3PO4A 5F41A 2VOPA 1N0UA 3BGLA 1PC4A 2OFGX 4TQSA 1S7HA 1BQMA 1HWJA 2ACYA 2VFSA 3S7RA 2J8AA 5DG8A 3M8SA 1BQNA 3NCQA 1YGYA 1UVLA 1WHWA 3M9MB 1NK6A 3D0GE 1NHUA 2W9BB 4LF9F 3KLFA 3GFXA 1S0OA 2VL1A 3BN7A 3M1VB 3QAUA 4WXWA 3CDBA 3MEKA