4DR2F

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dr2F00
1IBKF 4X65F 1CQMA 1J5EF 2VQFF 5LMNF 4DR2F 4LF7F 4B3MF 1XMOF 2UXDF 4JI0F 4B3SF 2UUAF 1G7CB 1XNRF 2F4VF 3R3TA 1I94F 4DV6F 1XNQF 4DV7F 4DV3F 1F60B 1IJFB 3T1HF 1CQNA 4JYAF 4YHHF 1N34F 4DR5F 1IBLF 2RJZA 3OTOF 4K0KF 2J5AA 4JI7F 4X66F 1VMBA 4NXNF 1FKAF 4GKJF 4LF9F 4B3RF 1HNZF 1B64A 2B7BB 4DV4F 1IJEB 5IWAF 4DV1F 1N33F 1XMQF 2YY3A 1FJGF 4DV5F 4LF8F 4AQYF 1HNXF 1HNWF 1IBMF 4JV5F 4JI2F 4JI4F 2HHHF 2UU9F 4X62F 1LOUA 4DV0F 2KJWA 4JI5F 4JI1F 4LF5F 2VQEF 4DR4F 2ZM6F 2UXBF 4LF4F 4DUZF 2UXCF 4LFCF 5BR8F 2UUBF 1HR0F 2KJVA 1QJHA 2BXJA 4GKKF 4JI6F 4DR1F 2B7CB 5LMUF 4KHPF 4LF6F 1GH8A 2BVZA 4LFAF 4DUYF 4JI3F 1N36F 4DR7F 4OX9F 4DR3F 4B3TF 2UUCF 1N32F 4YY3F 3T1YF 4DR6F 4JI8F 4DV2F 3ZZPA 4NXMF 1RISA 5AJ3F 2E5LF 1G1XA 4LFBF 4X64F
chains in the Genus database with same CATH superfamily
2X3GA 3D9BA 2W9BA 1CQMA 1RT4A 1QUPA 1RTJA 1ZM2A 2SXLA 4LSNA 1PG5B 3NCQA 3GJRB 4PWUA 1RJJA 5A8WB 4L73A 2B4OA 3MM9B 3BQ1A 2N3OA 4WE1A 4B3MF 4G65A 1VBZA 2J8AA 2D69A 3E8OA 3MWBA 3M30B 1V5VA 3N6NA 4WFAQ 1GXLA 5DQGA 4PYAA 3M6VA 1U1KA 4M95A 1UZDA 2B9XA 3C15B 1DTQB 2GVZB 1FX2A 3D6TB 5HMXA 1JKHA 3O2IA 5CZVA 1IWGA 1RHJB 2FIUA 4IH7A 4DV6F 1MG7A 2B9WA 4WE1B 1F60B 2F4FA 2F7VA 1H73A 2CJXB 4IRKA 2YQ1A 5HMWA 5KFLA 3KLEB 2UXDJ 4ZVOB 1U1NA 1PJ6A 2ZD1B 3MPUB 3NBPA 4MFBB 4WK1A 4NLXA 3OTOF 3TX0A 4HL9A 2A2CA 4OZNA 2HVEA 5T7LB 2X3DA 1EX8A 1H74A 1CPZA 2XMAA 4O44A 2K3IA 2N3LA 3OSNA 1VQ7S 1JLFB 3HHEA 4ZVEA 3CCMS 4V19J 3GIRA 2HK3A 2K7KA 4AQYJ 2I8EA 3G8QA 3SFGA 3U1LA 2LEPA 4FKXA 5F8IA 1ZM3A 2AGQA 3CNQP 1U6ZA 4DCPB 3W62A 1WF0A 4L6V3 4PABA 4RX6A 3ZNJ1 3H40A 2RILA 1NSAA 3DU6A 3V6KA 2Z2YB 2QYGA 4DSFA 2CNOB 1TAQA 4LRDA 1YX2A 4KH1B 3OV7A 1GFWB 2X1FA 2IPOB 3PKMA 2QMUB 2Y0BB 2KU7A 2RT3A 4O0IA 3BF4A 3RW6A 2P9CA 1H7WA 3EYZA 2ADBA 3CCZA 2DNYA 2MZTA 2XLIA 2EBEA 2ZKUA 4K8RA 2Z8QA 1VC0A 2HNDB 4NWBA 1ZPWX 4WP3A 3UNGC 3KLFB 4EEYA 3R27A 2FJWA 2RNEA 1NK4A 4TVAB 2Q43A 4RL1A 3Q2TC 4USUA 4RU2A 3PX6A 1K0TA 3LPYA 1IM6A 3NXZA 5A2QY 1LFPA 2GO8A 3CC2S 1Q81T 3BPDA 4M63A 2BE7D 2DB1A 2ZE2A 4FBTA 5ETNA 5KFCA 2B4PA 2HFUA 1DTQA 2GVZA 4DPWA 2YPYA 2ROGA 4BWJA 1NNDA 2DCLA 5D77A 3BSOA 1Q79A 1UEKA 2I9SA 3MMAB 1SUQA 3J81U 4LF6F 1K47A 2GHVC 4N8NA 1CJUA 4J9NA 2OJ3A 3RRGA 1Y10A 2CQ2A 3HLUA 2IMOA 2KHCA 4LSNB 2FJBB 1RWXB 3MMBA 1PGZA 1V6HA 5J1EA 2CPHA 1SKSA 4N76A 1Y7PA 2QLXA 4ED1A 1QTMA 3V4IA 1TKTA 3F41A 1WSRA 1PBUA 5ETOA 3RBXA 4KJIA 2A6MA 1AYEA 4QZVB 5KT5A 1P9YA 5E3PA 5DRKA 3R5JB 3ZTRA 1LKZA 2M8HA 1P1TA 3H42A 4WIIA 4TU7A 3TQ1A 2G1HA 2NSBA 2W4DA 4KSEB 3JB9k 1SBRA 7FD1A 5F8LA 5J2MA 1FRLA 3T6JA 3FKBA 1HMVA 1HBUA 1YTYA 1XWLA 4UW2A 3Q24A 2QLWA 3OFHA 1K9MT 3O1LA 4ZKAA 3KLEA 2RS8A 1YVFA 1CLFA 1XMOF 1QSLA 2GGPA 2XMTA 1WEYA 4ZPDA 3CJ3A 1QAIA 1KSPA 4HACA 5GMDA 4X2BA 2YQ0A 2GC8A 2FC9A 2DHAA 4WYWA 5CQGA 2ZE2B 4OHYA 2NZ4A 4Q0BA 1RTDA 2MGZB 4B3SF 1AROP 2B3TB 2HBQB 1G7CB 2YVSA 3CJSA 1Q78A 1RT1B 3DHWC 3EGVA 1GXUA 2IRUA 1JJHA 3NAHA 4J7CA 4CNYA 3I9V9 4OI0A 1GTHA 1QVFR 2DJWA 3NNHA 3PM9A 4G1QA 1BWVA 1PC5A 5LSRA 5DDRC 3GV5B 1I94F 4YOEA 4WTYA 3W8PA 3M8RA 2XYPB 3ZZTA 3KXDA 2ZOMA 3M2RA 5ETKA 2ZDOA 3TUZC 4YHHF 4A8QA 2J7KA 4QIVA 3T3FA 2AJQA 3ENQA 4O4RA 4ED4A 3OVSA 1T9YA 1VQ6S 3OL8A 4QOTA 4YP3A 2MLXA 3BZQA 2VQFJ 2DXDA 4YN3B 4KTQA 3QSIA 5AXKA 3I5AA 1URRA 1MLAA 4F67A 3DOMB 1D09B 5KFGA 4C11A 4CLTA 3GQCA 3BH6B 5JVHQ 3D54A 3QYYA 2DCUB 2WONA 1YKWA 1R7IA 4WXOA 4DS4A 2V2QA 2DIUA 3TA1A 2ZHAA 3CMES 3HHLA 4NPOA 4LSLB 3UE2A 2BEFA 2KT3A 4NRTA 2BKNA 2YKQA 5EUHA 4N41A 5DDQC 4DZ6A 1ZM9A 1IJEB 1WI6A 1Y5IB 5ITHA 1F3VA 1BXNA 1LNQA 3L9ZA 4U7CA 5GAEU 2IJNA 3D6HB 5FD1A 1NZAA 2D74B 5E2QA 5A8RA 1KQFB 3C66A 5C2CA 2QJ3A 4X4PA 2Y3YA 3I0RB 3KJVA 4DUZJ 2GFFA 5F8NA 3QZ8A 2ERRA 3FQLA 3H20A 4ZCMA 2HHXA 1YJRA 2N4CA 4NA1A 4JI5J 1WC4A 2H5EA 4X62J 1M5PC 1U1PA 4KGMA 1Q5VA 3D1OA 4OZLA 3OTDA 2HHHF 3HVTA 3K8WA 2BJ1A 5EN1A 2CJ9A 3CJ8A 3GU0A 4UOFA 5KG1A 2FHJD 3PYDA 4W90B 2OTJS 4B9TA 3CDWA 4OHWA 1KNZA 3MCMA 3FMWA 5LM7E 4KV8B 1FX4A 1HKAA 1NH7A 3CT9A 3JSYA 2YNIB 4PPZA 1D1UA 2MPUA 3CW2C 4DV2J 4EK2A 1X7VA 1U1OA 4EMDA 4U8VA 4N47A 4PWDB 3LOUA 2W25A 2RU3A 1YRUA 3JTNA 4DL6A 4CLPA 4M94A 3NCRA 1NH8A 4KY3A 4LRFA 4I67A 4MK7A 1FESA 3QGPA 4RJVA 2BYCA 1LK5A 1HHTP 3W9IA 1S6QB 2CFXA 2K8GA 1VRQC 2ZBCA 3IP0A 4P73A 4USWA 2AX0A 5DGBA 1ZTWA 2DXFA 2IDEA 1OMSA 1SQGA 3IC1A 1OY6A 1SQFA 4TYBA 1SJFA 1S9GB 3AODA 3UDCA 2ATLA 3GFYA 1XN9A 1HARA 2C3UA 1GNKA 1OYEA 1IKYB 2LQ8A 3FNNA 3RYLA 4D3GA 2WVCA 2ZVSA 1X9SA 2G4BA 1NPRA 4DUYF 1YJWS 1RWWB 2YKMB 1EKSA 2CUYA 1HNIB 5HVGA 4BHQA 1HD0A 2CJQA 4Q43A 3TANA 1HHSA 3EICA 2UVRA 1SL1A 2E7WA 4M8LA 3ILLA 3GLJA 1FDAA 2JLGA 2BE9B 2ZWOA 3MXHP 2VBYA 2RF2A 3TZWA 5F8HA 2E9ZA 1O51A 2MKCA 1RZMA 2DEJA 2ATCB 2GA7A 3T5KA 1D8ZA 5KG2A 3KKFA 5HQ8A 4I6WA 4P72A 3AXMA 1R0AA 3EXCX 4ZJOA 4ER8A 1B0PA 1RA7A 4NXNJ 3GIKA 2Q66A 2HQFA 1FRJA 4C0HA 3SXLA 1IXKA 3OR2B 3GFHA 3MHYA 2VQFF 3V81A 2E7VA 2HWTA 4PR6A 3Q8PB 2ZJQQ 4W92B 1FXLA 3MEEA 2RRAA 4LF7F 1OQ6A 3PTWA 4PUOB 1T02A 3PW4A 4WYLA 1LQ9A 1W2IA 4ZCLA 5LT5A 5FDLB 5J2PB 2XZTB 2LLZA 4DV3J 4WP9A 4J5OA 5A76A 2QE5A 4HDHA 1FJCA 2ROPA 3OTBA 4J9LA 3CJ4A 4URQU 1RKJA 4UOHA 1DJ0A 1VQ9S 2V8VA 4HT5A 2D3OR 2RE1A 2H65B 2OPRB 1FDDA 1AFJA 2XQCA 1HWUA 1OWXA 4B3TJ 4B3SJ 1NJIT 2CPFA 2P8IA 3G6XA 1SL0A 4DX6A 5KFZA 2W2NP 3QIDA 4CLLA 1CS4B 3WBZA 3QJJA 3UCGA 4X66F 3RGIA 3DMJB 5KG5A 2MQQA 1NDPA 4DX5A 2J7WA 4F36A 1JLEA 1VS3A 4BCAA 3V5RA 1FRKA 4DV5J 1D9DA 4RW6A 5IT0A 1FI4A 2XMWA 4NLOA 3J81j 4CRJA 3W2VA 1XNQJ 1Y9OA 3JQMA 4DV4F 1R31A 4UZCA 3D4JA 2IMWP 2ZH8A 4F8RA 3K59A 2MHNA 4PYDA 1YZ7A 4YB7A 1K73T 4RNFA 2VDIA 4G1QB 1XNRJ 3N6MA 2W7PA 1LK7A 2HURA 2AZ3A 3DXSX 3GONA 5AXLA 3SIPB 5AT1B 3TVZA 4DPUA 1UJ6A 3OR1B 8AT1B 1X4HA 2IA6A 4ED3A 1BD6A 3GR1A 3CD6S 3PJXA 2GW8A 2XI2A 1UW4A 3UR0A 1ZA1B 2AEFA 3KYLA 2UU9J 1P27B 1MMLA 5FJ4A 3RJMB 2HYIB 2WRMA 3ISZA 2V8GA 1WOPA 1KD1T 4JI5F 2LP4A 4HI2A 1RQ0A 4RUBA 3DLBA 2OFHX 3D0HE 4QR0A 4KPYA 5JXSA 3W2WA 1JKHB 2DNOA 2Y8YA 1ZOTA 3QLHA 2FDNA 2YQ3A 5HJXA 5LXRA 1UVKA 1NHUA 3D66A 4S0MA 4ZVSB 2XHCA 4ETZA 2PMWA 4K59A 3I0RA 4A48A 4A46A 2KO1A 3T41A 5J1NA 1IKVB 2BJ9A 4KGKA 4B08A 1SH2A 3LTOA 1NPPA 3C14B 3K89A 3MMCA 1S79A 4LRBA 4Z37A 2HHPA 3VR1A 1Y4ZB 4NLRA 5KFBA 4UQGA 4CIOA 4DR4J 4DR7J 3M6XA 3VGSA 1S9GA 1ZM4A 6AT1B 1S1TA 2EXUA 2WONB 4LIWA 1UEUA 1KHVA 4PG4A 4K4UA 1WC6A 2J0SD 2VFRA 3RG6A 3KJVB 3RR7A 4GMKA 2RSQA 2B5JB 4MTPA 4ZVGA 3VWSA 4TN2A 1RADB 4R0JA 5I3QA 1E6YA 2IM0A 4ELVA 1T9VA 2AX1A 4H4KA 5KG4A 4U9RA 2AZ1A 4X4VA 3FQKA 1T9UA 1NSPA 7FDRA 1P1LA 4ZK7M 5EWFA 3SCKE 3G6VA 1XIQA 5HO4A 1S4EA 2IYIA 3PHTA 2IVFB 5DZ6A 2QRRA 2W1BA 2AW0A 4H4KC 1ZH5A 1BC6A 1UJ4A 1C4CA 2VFSA 1N5TA 2BANB 3U7JA 4IO9Q 2YNFA 4LQ3A 2UXBJ 4DN0A 1SI9A 2QYCA 3VAKA 4NLUA 5FLXU 1J27A 3QFWA 3H90A 2MZRA 3HD1A 3M7VA 2M8DB 1C4AA 1QVGR 3UPFA 3NS5A 4DQRA 4CLKA 3LPEA 1QSYA 2FD2A 4KC5A 2ZVIA 1K44A 1SC1B 2LA6A 3LP0A 2CPIA 2QL9B 3PRVA 3Q8QB 3HI9A 4QW9A 1CC7A 1IKVA 5GMKa 1WC1A 3RAQA 5KFOA 3GTYX 3I87A 2BM0A 3GV8B 5DZ7A 1WG1A 2MB0B 3IWLA 2FLLA 3SDEA 1S49A 2DR5A 2VPZB 3K5PA 4PG8A 2NQPA 5KT6A 2JLEA 2MZJA 3M1VB 3CC4S 4FYDA 2QSFA 2KHDA 3NRBA 4NMLA 1U0SA 3T1YJ 4ZVUB 4P74A 4C9DA 2C3PA 4DWIA 3MFHA 4OYPA 3T1AA 5CZXA 1B0TA 4DUTA 4JYAF 4OJ1A 2YKOA 3M4XA 3CEDA 2UV8A 2JZ5A 4GO5X 3EZOA 2A1BA 3C6TB 3THVA 3BN4A 1FT8A 2RRBA 3QO9A 2BQUA 5J1EB 3TUJC 3U02A 1DARA 5FIIA 4JI4J 1RKIA 4C4WA 2XCPA 2V69A 2KYZA 1QE1B 1TL5A 4HLBA 5BXIA 2FY1A 1C0TB 3TUIC 1RU1A 4WKYA 1VQPS 1VQNS 4PAAA 2CAJA 3NMAA 4RUCA 5K9FA 3G6ES 1A6LA 3BGUA 2PI4A 1NU4A 3SQOP 3TA2A 1F5CA 1R8PA 4KO0A 1TKZA 3W2VB 5K8NA 3IBWA 3RUBL 5IT4A 1B70B 1FTCA 2HNYA 2J76E 3QATA 2AMCB 5C42B 3MM8B 4WTOB 1FRHA 4HACB 1HBNA 1DBDA 4CLZA 3BKFA 3MUTP 2DR9A 2FHJA 5L9NA 2G2ZA 3DMJA 4Y65A 1U47A 2KL8A 2X1AA 1P8GA 3BYPA 4FYWB 4WFZA 2XCAA 2R9LA 1WKLA 4I2PA 3CSKA 4K4SA 1RAIB 3ZXWA 1DURA 3AD9C 4DPOA 1X4DA 2Z0GA 4ICLB 2RUGA 5I3UB 2LEBA 2E9TA 3ETOA 5H9EJ 1CULB 3N5BA 4JI2J 5CYMA 3AHPA 2VQEF 3QGIA 1HIYA 3J80U 1HYSA 1GEHA 4OHVA 4DFJA 1DQ8A 1U2CA 2B6AB 5MAOA 1HR0J 4PWWA 6FD1A 2O66A 2HVZA 2W7AA 3Q0AA 1TV6B 4JUZA 3G87A 5KFMA 4FZVA 1OYDA 4RKUC 3WIVA 2EVZA 2JRSA 3CJ5A 2E66A 3MM7A 4WZMA 3Q8VA 4I2QB 4ZP6A 5CYJA 3HULA 4NL5A 1JLEB 3SSRA 2VG6B 4HTJA 3UDVA 4R8UB 4DQQA 1NK7A 2KJVA 3O44A 4K7QA 4P2XA 4ZVHA 3GMGA 3EXYA 2KT5A 3IAM9 3PACA 1S7HA 3IMQJ 3R6GB 1LWFB 2R7XA 4C97A 4WFNQ 2HHHJ 2XS2A 1GH8A 4TY9A 2RAQA 3R5DA 4USTA 4EO6A 3PR5B 4UOCA 1VIXA 1UWBA 3DRSB 4I7FB 3R9LA 4O3NA 3OTOJ 2B9EA 4K4VA 2DRAA 4Q45A 4DR7F 1ULRA 3DLKB 1RE1B 3HHKA 3VHQA 4B3TF 2VFVA 2DTJA 2UUBJ 2C2KB 1Q8BA 2WK4A 2OEMA 2QZ8A 4OJHA 3A8IA 2XTJP 4ZITA 4YY3F 3G96A 5J2PA 2JH3A 3IR7B 1TL1B 3JQJA 4C0OC 3NEKA 1GTEA 2YWGA 1UTAA 1X4AA 1XERA 1DTTB 3KLFA 2H3EB 5LL6d 3MM5A 2V4QA 4QR1A 2B0GA 1B7YB 4DL2A 1RT1A 1Z2LA 3EVOA 3CDBA 3FCVA 3NY0A 4QIEA 4BLGA 2FUG9 1N5YA 3CO0P 3KDNA 2L3MA 4OZ0A 4QQBA 3TJAA 4EGLA 3DM2A 4MFBA 5E3CA 4DSKA 4LF7J 3K2YA 1EJ7L 5DGAA 5HP1B 1NKEA 2KKHA 2V0NA 1YJTA 2XMUA 1VISA 1X5PA 3HF5A 3ZTOA 5A2QU 3KK1A 3VAHA 3DDKA 4DR1J 2XS5A 3A3NB 3Q8UA 2V4RA 4CQ1A 3RB4A 1F9HA 1FWPA 2K2PA 3K5NA 3QRPA 2DGXA 3H2UB 2K3KA 2I6WA 1RT7A 2OLWA 1T9TA 3DGPA 3POTB 3KNAA 3CUNA 3EMTA 3B78A 3P3DA 3NGTA 4DCJB 3HFVA 2CQDA 2CQ0A 2DYAA 2NPIA 3MM5B 3BBBA 3G82B 3EUNA 4Y3CA 3UD4P 2JDJA 4C8OA 3G82A 4B3OA 2CADA 2R7QA 2FZCB 1F1BB 2WB4A 4NYOA 1CQNA 1P9QC 2J0QD 5A8WA 3A8KA 4DQPA 1TKTB 3BM7A 1U6BA 1WJ9A 2XLKA 3OVAA 3QFHA 4Q8EA 1AB8A 3IGVA 4OJGA 5L39A 2H1YA 2MLZA 3LAMA 2JFDA 4N56A 2KN4A 5C25A 3LUYA 1UFLA 3IA0A 2W7OA 3UVJB 1VMBA 2ZH6A 1WELA 2I38A 1KTVA 4DL4A 3MEDB 1ZA2B 1D9AA 1FCAA 3M8ZA 3D5MA 4Q44A 3WZ0A 1N6QB 1FKAF 4JV5J 1SKWA 2V4JA 3MMAA 4O4GA 2AGPA 4OMFG 1KTQA 4K4WA 1HWLA 3OHAA 2GHPA 2MMYA 4J9KA 2YKAA 1W2BR 3DNCA 1NK8A 4USKA 2WAQD 3IRXB 1S1XA 4C7QA 4DF4A 4IUFA 2F4VJ 5KFUA 2UUAJ 2QLBB 2K1RA 2ALZA 1O8BA 3AXKA 3MPDA 2W9CB 1HI0P 3FMBA 1SV5A 3KK1B 4AQYF 5HI7A 4WP8A 3MCSA 1EQMA 1WWHA 3FGVA 4RWXA 5E3AA 1TAUA 1FNMA 2JSXA 1L3UA 1T94A 1NSQA 4KIAA 1BQMB 3UWTA 2Y0SD 2JX2A 1UVLA 2BANA 4JP8A 2YX1A 3TWZA 4UOGA 2VBWA 3L3CA 5CYQA 2PMHA 2EI5A 3IBFB 3LP1A 4OI3A 3NP5A 4BC7A 2FC8A 5HL7Q 2VG5B 2FHMA 2IRYA 1IM4A 1VQSA 2LXUA 2RH3A 3DDIA 3KJQB 5KFFA 2GX8A 5AXNA 4B17A 5IC4B 1OY9A 2IBKA 2QA1A 1Y3KA 4CTAB 1VQMS 1U1MA 1B64A 1HBNB 3IAS9 4DU7A 1EARA 4P7VA 4PG7A 4QIFA 2YWKA 5BR8F 1D3WA 4AUKA 1R0CB 1Q53A 4QWBA 5IFMA 3MEDA 5C24A 1PC4A 2FVPA 2Z2ZA 4OJ3A 1JXLA 1FERA 1Z4UA 2UUWA 4FF4A 5I3PA 3D1HA 4KO0B 2I5JB 1WHYA 3MM6A 4N77A 1U1RA 2IJRA 2BQ3A 1S1UB 2QSWA 3CCWA 4HR2A 3AQOA 1RAFB 1S6PA 4J9SA 2DR7A 2B9YA 5M2RA 3HPOA 3D0GE 4LRAA 1E6VA 4RO0A 5I3UA 3CGIA 2W8KA 4BS2A 3E01B 3DI6B 2C2DA 4JI3F 3J7ZT 2EC2A 1KLNA 4OZ3A 3QNWB 3NGKA 4O3OA 1WUUA 3UDEA 1BQXA 1NM2A 2VL1A 3PCOB 4MYTA 2IVYA 2OUGA 2QA4G 4LT6A 1Y00A 2E1RA 4B9MA 2Z2LA 4NI2A 2VJVA 1TFWA 2YX4A 1RYSA 3EGNA 3TW0A 3EPIA 1YJNS 2CNLB 1S6UA 1Y5LB 1RT7B 4OI4A 3S01A 5LSOA 2FHKA 3LWMA 3G71S 2XMVA 4USHA 3W9HA 2GIRA 3EGZA 1W25A 1H2UX 2I2YA 4DX8H 4U7UD 1YG0A 3SI8A 2DY1A 3C15A 2L08A 2FVSA 2AV5A 1IR2A 1CJUB 1TKZB 4CM0A 2VQEJ 2J6TA 1PKUA 1U02A 3WC0A 3FJ2A 3OL6A 5DDOC 3RB3A 4KBIA 1TK5A 4PQAA 4O0NA 1WHWA 2FJDB 3JTOA 3M05A 3U1MA 4C0BA 3DI6A 1S0NA 2CQCA 3ZZOA 3H8YA 3KK2B 3I5CA 2QMXA 3DLHA 2F8MA 2PE8A 1R8CA 2UXDF 2OSRA 1NO8A 4OQJA 4P52A 1M5KC 4EWTA 4LJMA 3KUGA 2VOOA 2KVQE 1ZAVA 1TL1A 2QA2A 5B0CA 1JXEA 4HTIA 5CABA 4P2MA 4CLUA 2ZEJA 1EP4B 4FNHA 4ES1A 2NSCA 1TVRB 4ELUA 3PDNA 3HHLD 3KFWX 4L72B 4ZDNA 4TU8A 3KLVA 4IOCQ 4LREA 2VUGA 3R3TA 2HWIA 4WFYA 2OFGX 3HT0A 3IO1A 2MQPA 4DV7F 3E01A 2FVRA 1RT3B 3PR4A 4YR2A 2VONA 5A0YA 2BKPA 2FTRA 2D9PA 2ZOGA 4KGVB 3TEGA 4ECTA 3IS9B 3NLCA 4USMA 1ZPVA 3V2UC 5C2GA 2OP5A 4CO0A 3G8TA 2QFJA 2VA2A 1E6YB 3C6TA 3SBMA 3GV7B 2MLYA 3GJSB 3M6UA 3FC9A 4ZIVA 2ZHBA 3P6YC 2XNRA 5F3TA 1F9EB 1PJ5A 2VG7B 1RXOB 5EWEA 3IGNA 2ZH7A 3ELHA 1Z1ZA 2PFFB 5DG7A 3Q23A 2CJKA 3RBZA 3HSJA 2VKRA 1IN0A 2AWZA 3KG0A 4CI0B 1WNEA 4HVZA 3I82A 1IKWA 3NS6A 4DV7J 2LDIA 4KQZA 4LVNP 1XK8A 1CJTB 4NRUA 5KFSA 3THPA 2NR0A 2N82B 4P75A 4PCQA 1HQEB 2L9WA 1S1XB 2MJUA 2A0FB 2EBGA 4WBFA 4JI0J 4UQTA 3Q2SC 1DAXA 5IQ6A 4XIUA 3I55S 1FHTA 4CLSA 2C3YA 1ZS6A 3H7HB 2CIMA 4RZRA 4O3SA 2IBOA 3AJ2A 4MJKA 1SJ4P 3QJPA 4UT4A 4Q0BB 2CQIA 5GADU 4IKAA 5SZTA 3KMSA 1CVJA 4UF4A 2UUCF 4Z2XA 1R0BG 1SC4B 2D9OA 2FY8A 3DOLA 2MSSA 2MY7A 4LF5F 1JLBA 1JQGA 2RHQB 2OD4A 3DOKB 1X4GA 2VBXA 4IDKA 2C1EB 5B0BA 4WFXA 4XPCA 4LF4F 4JYAJ 2HNYB 4NX9A 2HQCA 2HLTA 2DIVA 1XMQJ 2UVVA 5F8MA 5LJ3Y 3HO1A 1IBCB 4J9VA 1RT2B 3HX9A 3D2WA 3ULHA 2ZUAA 1WDDA 3HVWA 5E7OB 2E1MC 3LH2S 3A3OB 3DLGB 3R7SB 8RUCA 4EZ6A 1C0TA 1S5ZA 2W2OP 3FEXB 1HR0F 2ILZA 2FLPA 1REVB 3UDLA 2DKOB 2MKYA 3CJ0A 4WU3A 2F5GA 1VQYA 4TY8B 3I4HX 3GB0A 2ZZNA 4RW6B 3W2WB 5HVFA 4TY8A 4YR3A 5C5JA 5B09A 4NCBA 4OHZA 1JLBB 2I1RA 3BJYA 2BJ8A 2GJIA 2DR6A 3FVYA 1YQHA 4RNHA 2WOMB 2DNGA 4ENOA 4ZP9A 2CWXA 3KUEA 3NS7B 4DFMA 5LSLA 2B56A 4R5PB 4XO0A 3LGMA 2FGCA 3P8BB 5CD4H 3POTA 3RBDA 1KR4A 1CJKA 2ASYA 4DR6J 4A47A 3PW7A 1NB7A 1APSA 2IM1A 4KR0B 2DNPA 4RW9A 1RAHB 2RQ4A 5DLFA 3CIZA 3OHBA 1G1XA 4IFVB 1BHNA 3G9CA 1CG2A 2KVIA 3QGGA 1JJ4A 3M8QB 2GVDA 1IBKF 2VHGA 1RWOB 3H2VE 1AZSA 1HA1A 1X8DA 4FXDA 2X1GA 4Q7AA 4ZPBA 1YIJS 1KLMA 1WEZA 2XSJB 3CCQS 2BJDA 3MECA 3OT9A 3V6DA 1U48A 4F0MA 3RW7A 3R5BA 5F9NA 1UVJA 4YB1P 4LF8J 3I5BA 4DLEA 2HS0A 4HDGA 4AD6A 3JAMU 5L1LA 2O5DA 2UUAF 3K7RA 2YKPA 5ETQA 1ZETA 1Y11A 2HS3A 1MROA 4B02A 3BYRA 3K8VA 4IH5A 4P6QA 4ZP8A 4ILLA 4ILMA 1XNQF 4IFYA 4OYWA 3FZBA 3CJKB 3VGUA 3T1HF 2CPXA 2BV3A 2EEYA 4EZ9A 2ASLA 2OPSB 2ABYA 3BN7A 1N36J 3NL0A 4OYIA 5DDPC 4KHRA 3TO8A 4MIWA 3BBCA 3ITHB 3OFEA 4C8NA 3GWCA 1N8RT 4DSLA 2PD1A 1J5EJ 4MT1A 1NK6A 2DXEA 3MEEB 3BB5A 4ZPTR 3UR3C 1YJ9S 2RHSB 1VYAA 2XGQA 4HH0A 3T19A 1L3SA 2MQ8A 3B6BA 4HEA9 5CAAA 3A12A 2YBVA 3VQTA 3ISNC 3OSPA 3OL9A 2DITA 1HLWA 2W2PP 2F65A 2XNQA 1JLQB 2ZOFA 3KDOA 4YB6A 5G0RB 4B9SA 2YH0A 3UCZP 2BE2A 5HROB 1JLAA 4QIGA 3LP2B 1JNRB 2J9CA 1F2HA 1TL3B 2OHDA 3ZZRA 5F3ZA 3W1YC 1HYSB 2IAJA 2X1BA 3IWXA 5A6WA 1SQEA 5DM6Q 3RRHA 5HSPA 3L4BC 2ZBRA 6FDRA 4OZJA 4OV1A 1MU2B 2AU0A 1V5IB 4M5DA 5ETRA 3F44A 2HRYA 5L38A 3UNYA 1JLQA 3PRDA 1ZYQA 4XTTA 4F4XA 2GV1A 1BUXA 1XR7A 1ZZNA 2VD3A 5L8RC 3TAPA 3AFGA 3JYTB 2R7UA 2HRUA 2G9OA 1SJ1A 1IR0A 2PEBA 3LAKA 4X84A 1XTZA 1RTJB 3ZZUA 2KH9A 2RQCA 1L3VA 4LBHA 1B3TA 3W61A 2IC3A 1SKRA 1RB0A 2IJFA 3LP2A 4BDPA 2Q6CA 3PKYA 2NYHA 4M5NA 1PYTA 3SCIE 4DPYA 1U26A 3CDUA 4RNNA 2HW3A 1QDUB 5IWAJ 1KS2A 1KWMA 1KQSR 1HNIA 3B82A 1N5VA 3TQEA 3A8JA 3R1LA 1S59A 2FZGB 2GMHA 3UN2A 4DDFA 4NLGA 4NLVA 1L3KA 3LGNA 2QN6B 1QE1A 4NLTA 3MPYA 1OJ4A 1WORA 2RDIA 4G3IA 2FGOA 5DQHA 2WSCC 3CVKA 2RKIB 3MAHA 3M9MB 2XY6A 3S8SA 1J5OA 5KFAA 4KHPJ 4FF2A 2XC9A 2AJ2A 4GVLA 3EE3A 4RPFA 2P2CB 1XC9A 1PO6A 2KZZA 4NLWA 1EETA 1N34J 2VOPA 2R7OA 2H9ZA 4QR2A 4NOHA 2CPDA 3SMZA 1FKOA 3HK2A 5KOXA 1N32F 2ZZTA 1VQ5S 2ZBQA 1N54B 4EBCA 4F2RA 4V1Ak 4TU9A 3K0JA 3SDEB 3H5YA 3N5FA 2YKNB 1DHMA 2DO4A 3ZZPA 4MKVA 2ZH3A 1T03B 3C2PA 5CYQB 4U95A 4Y2CA 2LQJA 3KG4A 3M2VB 3VCDA 1BQMA 1NHKL 2DHSA 2QEXS 2RU9A 4LSLA 4AL7A 1GMWA 1JNZB 3KLGA 5KG7A 3M8QA 4U67Q 1TMMA 1YSJA 5L1KA 2WOMA 2OPSA 1J5OB 1K1QA 4ZLNA 1RGVA 1VIOA 2V6AA 3GFXA 2W9CA 4ITSA 4Y34A 4UY85 3DOMA 3H2LA 4C11B 2C28A 2GIQA 2Y1LB 4CP5A 2EK6A 2H4YB 4EI2A 3MURP 2ACMA 2W8LA 2HEKA 5HLFB 2RF2B 1YRXA 3T5JA 1RT5A 1UWAA 1CJKB 4O3QA 4JI0F 1HWJA 3W60A 2MTLA 4ED6A 1U49A 1B0VA 2HFVA 2V94A 4MH8A 2D3UA 1FWKA 3GYXB 1NAQA 3EX7B 1VK8A 2VPYB 4NCAA 1UVNA 1REVA 4UZBA 2HHSA 4MK9A 1HHQA 4ZVPB 1KEKA 2KFYA 3NNCA 1IR1A 1C0UA 4FPRA 4CO4A 5DM7Q 4AFFA 4L3NA 3DFEA 4Y2KA 2XGPA 2AYBA 2J6UA 3MDFA 2WB1D 5GMEA 2NXEA 1N4LA 3EDRB 2OMLA 1X31C 1H98A 2XULA 3C6UB 3M8PB 4WJBA 4DS5A 1FD2A 2BA9A 2OGUA 4K0KF 5J2NA 4KGXB 3GJTB 2R8GA 3ZTPA 1NKBA 1XJWB 5H9FJ 4KAIA 3TZXA 4QCLA 3MMCB 4RBUA 1CC8A 4OX8A 2F40A 4C8ZA 1DRZA 5ETPA 1FJEB 5CD4A 3N6LA 3BPSP 1T9WA 1ZAWA 4AYBD 4FP9A 1HBUB 2CG8A 4JI8J 1JB0C 2QFIA 3AH6A 3ET6A 1VOMA 4NASA 2ASDA 2R42A 4FS2A 1UPPA 3E3XA 3SSQA 2J9DE 3KOAA 1H7XA 1FFWB 2IAJB 3AA9A 1JIHA 1RT6B 4KYZA 5EHHA 1H3DA 3AQPA 2E1AA 2GGPB 1YBUA 3JSMA 2C2EA 2NXUA 3N4WA 2DRBA 1RTHA 3IM9A 1U4BA 3TJ8A 1XBWA 5GAEI 4OX6A 5HMZA 2QX0A 1KONA 2CXEA 4I56A 4CDIA 1WC5A 2ZHOA 5B7WA 2D3O1 3MR7A 4JI4F 2HGNA 2J7UA 1HMVB 4P2SA 2LFVA 4ZCKA 4B9LA 1S9EA 2O1PA 4Y6IA 3R5GA 3UN3A 2AHOB 5BYRA 3A8EA 1S6PB 4CO3A 2R7RA 3ISND 2VB6A 2MQMA 5JUMA 2ZZMA 2U2FA 3J7YU 1R6VA 4ZPAA 5IM0A 1RDRA 4B9VA 3DYAB 1S72S 5DG9A 4QU6A 1Y3JA 2G0CA 4M1KA 3HCXA 4PXEA 4DI6A 3W5XA 3TARA 2W01A 3OD2A 3DOLB 1M1KT 5EDWA 3PW5A 2QL7B 2OPQA 3BO4A 1TK8A 2BXJA 3ZTSA 3TVYA 4XDCA 3W5YA 3H4DA 1W7WA 3AD7C 1AUSL 2G13A 2KT2A 3KG1A 3BR8A 3FBCA 1WG5A 3AJDA 3EM1A 4USIA 2AJ0A 3RRKA 2OEJA 2CPJA 2CYYA 3NOGA 2ZJRQ 2AJ1A 5A0YB 4FPIA 3NNAA 3MUMP 4IOAQ 2OPRA 3M2UA 4G1PA 3L7OA 1Q95G 2R7VA 2HHWA 4E98A 4OX9F 3W9JA 4CCHA 4ID8A 1FJ7A 3NMRA 4WXWA 3I9ZA 2Z58B 1KQGB 4GVBB 3DDNA 4L75A 5B0GA 3THTA 3MAQA 1HFEL 1U1QA 2HFSA 3T9NA 1SV5B 3IBCB 1UAWA 2MGZA 5EGYA 1WF2A 2YWFA 3QAEA 4URGA 2ZUGA 2GQQA 2DHHA 3BREA 2DNNA 1K1SA 4FS1A 3KLHA 2YNHA 3GPAA 3I0SB 1VFJA 1XR5A 5E41A 4WF9Q 4X64F 2GQCA 2LMIA 2DY9A 4OLOA 4DV0J 4U6PA 4CWBA 4URSA 3Q22A 2DNMA 1UA0A 1C1CB 1NEEA 2P9GA 4UTGA 1U0HB 4AL5A 1FA0A 2OSQA 3CE8A 3EZUA 4X4RA 1E6VB 1RWPB 3EVMA 4H4OB 3M9NB 4X64J 1S48A 4CLWA 1HNWJ 3HT3A 1MN9A 1I5OB 2M7SA 1PILA 2V2VA 1M1GA 2ZD1A 3TAQA 1YHQS 1KHWA 1Q86T 2E9RX 2IYGA 2RVJA 3EDQB 1EP4A 1VLOA 4DPXA 1HPZB 3CD5A 2ROEA 1VRUB 1B99A 4USVA 3MR6A 5LOQA 4HT7A 1M90T 5IOLA 3FEYB 3WX4A 3PX0A 3ETMA 4A8XA 3OJUA 3L7UA 1FDBA 1UL3A 1XR6A 1NJWA 1N56A 4KPCA 3HMJG 1RWNB 2XSFA 2OIHA 1WG4A 4UY8T 1A7GE 1FNOA 2APOA 3J7Z5 1LWEB 4ZJQA 5ETLA 2XLJA 3NBPB 1EQ0A 1AA1B 3BKUA 4X66J 3W7BA 3OW2R 2OPPA 1IVZA 2RQKA 2UVUA 3ZO7A 1R6YA 2VC0A 3IG1A 1QTNB 3EPGA 3VAMA 3A13A 4JOUA 2JC0A 3QT6A 3FBFA 3OXLA 1VI7A 3TJ9A 3K17A 3BSCA 5KT2A 3LGHA 5HVHA 3SYZA 4JB8B 1KRPA 1N0VC 5G0RA 2EKNA 1Q0NA 2NXJA 4LRCA 3CCJS 2B4VA 3DU5A 3W65A 2V68A 2YPZA 3L95X 1N33F 3NOCA 3TEHB 1XMQF 2CVEA 4M5KA 2V2ZA 3H4BA 1YRTA 2KYXA 1QAXA 4FN5A 3KK3B 4LF8F 1IBMF 4JV5F 3FEZA 2QTWA 2IFXA 4V19X 3ITHA 1YWXA 3TZZA 2Q1LA 5K14A 4DBQA 2LXIA 3TP2A 1TZ0A 4HHJA 5LMUJ 3WDOA 1Q8LA 3QT8A 2H5JB 4C6AA 2OH2A 3AOCA 2NPFA 3PFOA 1OO0B 3BQ2A 4DUZF 3W64A 3KLGB 3T1HJ 1N5SA 3PYEA 4GRSA 2ALYB 3CC7S 3CCSS 2V9KA 2BMBA 2GNKA 2C3OA 2KXHA 3FK4A 3H98A 3R7NB 1U25A 4F4AA 5AE1A 2FPHX 2VF3A 4RU9A 4EYIB 4ECUA 1YITS 2FJXA 2UVWA 2B5JA 4QPTA 2QV6A 1SKUB 2VKZG 2UUBF 1U8WA 1TFYA 1X4EA 1HPZA 1RK8A 2QT7A 3HD2A 4Y2AA 4DR3J 3HSDA 4JV0A 1QAJA 2HBZB 3RR8A 3EVWA 4L3KA 1RUSA 1S1TB 1JXVA 3RB0A 5K20B 5KG3A 5LMUF 4ATNA 3OJSA 4IFVA 3AY0A 2QLJB 3PFEA 2IA0A 5EX3A 2ZC3A 1C1CA 2LDYA 4PKDB 3BH7B 3D6FB 3AOAA 2RDDA 1LEOA 1T7PA 1T95A 3QT7A 2NYIA 4YDDB 3KNGA 5D4NA 3SCJE 2E7XA 5LXYA 3VQSA 4R5PA 3D0IE 3BSNA 2Y1IA 3VZIA 2DVIA 4CYUA 3ZZYA 2CDQA 1DTTA 2J8SA 2WVEA 3BEGB 1VRTB 1U1LA 1N6QA 2PIIA 3DLEA 4NXMF 1RISA 1HBMB 3MPVA 2V67A 2GJ2A 4PXCA 1I51B 4X4UA 3SCLE 3MR5A 1JJ2R 1S1WA 2XY5A 3VAGA 1FFGB 1OY8A 3GR0A 1NRKA 4CM2A 2WVBA 1JLCA 3FDSA 3GILA 2W2MP 3A4TA 4TQRA 2MYFA 1QY7A 1WI8A 1LWXA 2M4MA 1UCNA 3CJRA 3ILJA 3VV2B 1N5QA 2E5GA 5AE3A 2ZBPA 2HAFA 1HQ2A 5F9LA 2XEXA 3NGUA 5IZHA 1SC6A 3AA8A 3C19A 1HNXJ 3DLGA 2EFPA 4YMEA 3UFCX 1WHXA 2HWHA 1LW2A 2CQHA 3L09A 4C48A 4XAKA 4ID5B 1IKXA 3HSZA 5F8GA 4RLEA 3E2EA 1WC3A 3CCLS 4G1IA 1DY3A 3CD7A 1YBTA 3FBEA 1GAOA 2E5JA 2NCKL 2W4CA 5BJRA 3D3BJ 5DS7A 3J80Y 2CPYA 2D3ZA 4OIXA 2CDRB 4OI6A 4C3LA 3NG8A 1DQ9A 1EKRA 2F9JA 4ES3A 1FE0A 3EJMA 3HKWA 5HJYA 4ERDA 2QLFB 1BY9A 3QGHA 1H0HB 2DNLA 2RJZA 4BC9A 3PYFA 5DG8A 2HHTA 4KKOB 2CJAA 2OELA 5LMNJ 2B51A 2XM3A 1YGYA 5E5NA 4CLFA 2JEGA 1WDTA 3MTJA 5RUBA 2XSJA 1KVKA 1QD1A 3BO2A 3PEHA 4R8UA 4ZPVR 1X60A 2AJFE 3FUYA 2V8PA 1NB2A 1TK0A 3BDPA 2KB2A 1JLGA 2VPWB 3CDAA 1RWVB 1FVQA 1C2PA 2OMOA 3WIUA 4ANDA 4ZLLA 9RUBA 3OLBA 2VJUA 4QW8A 1T0TV 4EUVA 2OTLS 4F4WA 1V3SA 3CB4A 3R2DJ 3IM8A 2GMLA 3UD3P 2H51B 5DETA 1S9FA 1QUVA 4IRCA 4DV1F 3H25A 1RAGB 1EB0A 2C2RA 1VJWA 4X4QA 4CT8A 4LR9A 2BBEA 3T5HA 3V81B 3PW0A 2DNZA 1ELOA 3GG1A 5D78A 1SB6A 4ID5A 4FXWA 4I2PB 5ETTA 4PRFA 2FB0A 3BGFA 5ETMA 1HW9A 1RABB 5M2UA 2BABA 1KBRA 3MGJA 3TRGA 2Q79A 1DLOA 1H38A 3MEKA 2R8JA 3IXQA 1WTFA 4ZJLA 2BJ3A 3P5BP 1KC8T 4GO7X 1WHVA 1IBMJ 1T3NA 3MTKA 3MAAA 4BBYA 3FFIA 2GVDB 2FYXA 3H59A 3SZ2A 2JC1A 1BMQB 2WCXA 1TV6A 3M8PA 5ETVA 5IQQA 2E29A 1I94J 1U2FA 2CNKB 4LUBA 5KFWA 1TELA 2IRXA 4PEOA 3SSSA 2V9WA 3U1NA 4DL5A 2HIYA 3BDEA 1S9EB 4O3RA 5HQLA 4IR1A 5T41A 2Z4PA 3PJ9A 2KXFA 2VFTA 1X5OA 1ZZFA 4O44B 4DXLA 4F0HA 5F41A 3JYTA 3DGPB 3VF0B 5EX0A 5FLXY 4IDKB 3FSIA 2HFZA 2VODA 4I68A 4P10A 3ILOA 5KFJA 1VJQA 5D0EA 4AL6A 2R8KA 2EFVA 5MLCV 3NKYA 4AT1B 4OHXA 2MKJA 4IOBA 4E8UA 4QWAA 5ETSA 4LQ9A 4A8SA 2XY7A 1H2TZ 3NWRA 2XB2D 4GC6A 4DV6J 3HP6A 1FEHA 1HQUB 4ETXA 4YR0A 2I0XA 4DG1A 4ZMMA 2A3JA 3SV3A 3AJ1A 3N01A 1JMTA 4L76A 1FRXA 3ZC4A 4YDXA 4KFBA 2GAHC 2G0IA 1MSWD 2C2OB 1TUGB 2G1DA 4P71A 4NMXA 4EBEA 3T9ZA 1TL7B 1YK9A 1Q8IA 3PG9A 1VBKA 3JTPA 1RAEB 2OKQA 1SXLA 4OI2A 4ANEA 2KM8C 1AUDA 5H1SV 2LXFA 4RW4A 2CWKA 2BQRA 1UZHA 4ZHRB 1M5VC 2BJEA 5LMNF 3AD8C 4DFPA 2PDAA 2YTCA 1MNEA 4R0EA 3S7RA 5IS2A 4E2FB 3CWJA 1GX6A 1UP1A 2N7YA 2RUSA 2J6SA 2ILYA 3FCHA 4PPDA 4IG0A 1IQZA 3CJ2A 1MROB 3GCXP 2LYVA 2COLA 2DGOA 2X7IA 3D67A 2PEHA 3M1VA 4EFAC 3CCES 4PQUA 1NBEB 3SEOA 2F4VF 2RB7A 3H5XA 2CZ9A 4N8OA 3I31A 5I42A 2VG5A 3FRZA 1XMBA 1FNXH 2D1CA 3P4UB 4CT9A 2MZSA 3TOQA 5HMYA 1RCOB 5L1JA 2FLOA 2VA3A 5D4OA 2ZM6J 1VBXA 4MK8A 5FDLA 1T11A 3WQPA 3ZTQA 5BYSA 4NLDA 4J9QA 3HHDA 4PUOA 1GMUA 1G4CA 2VG7A 4ICLA 2IHR1 3R5AA 1PYOB 2ACYA 4GKKJ 5H9FK 4J9OA 2ZH9A 3H5SA 2UUTA 3AB2B 1NK0A 3W66A 3GCWP 2XBPA 4DMZA 5KFPA 1B7FA 1M5HA 4ZVQB 2HVIA 1BLUA 1YLXA 3CXCR 2HMIB 2CRLA 4O4GB 3RU0A 1VCTA 3PV8A 3GP9A 2L9NA 5IC6B 2DH9A 1EETB 1UVIA 2V63A 3V6JA 1VC6A 2W24A 2AYEA 2YY3A 4JBCA 1R8BA 4USJC 1LWCB 2E1CA 2QL5B 4B9UA 5E3RA 4DV5F 1UETA 2MEWA 2OPPB 4KE5A 1BE4A 2KTQA 2RRNA 3C16A 4K4XA 4UUWA 2BOPA 2JEJA 5J2NB 1RHKB 3L7PA 2AP6A 4E0DA 4DN9A 3I56S 4J90A 1RWKB 1TL7A 1LOUA 3ZZZA 5KOWA 2CQBA 2KJWA 4L74A 4DR5J 3RB6A 3JS9A 2ZM6F 1L3TA 2QG9B 4ED8A 1KKHA 3QJLA 3QIPA 3FSXA 3R6LB 4ZS6A 1MW7A 1FFSB 4PXBA 3DRYA 5BR8J 1F5AA 1FE4A 3S6EA 5GADI 4DPTA 2IC3B 1LW0A 3NAIA 2MQNA 1GXTA 5HK4A 1Q5YA 1RI7A 1VK3A 2CKWA 1NK5A 4LFCJ 1VQ8S 1PYSB 1VQLS 4B3RJ 3FZ2A 2GJFA 3CD0A 1F2GA 2AT1B 2LA4A 4ED5A 2XYHB 3HZGA 2GAGC 1XEZA 2PSZA 2DISA 4DX7A 2H5IB 3QBCA 4FYVB 4NLYA 3MR2A 4DSEA 1FDNA 4EO8A 1WEXA 3TI0A 2ZNYA 3CMQA 4QBUA 4J37A 2CQ4A 4F4YA 2YNHB 5K8OA 2HNDA 3NCPA 4FVMA 2AD9A 1IBKJ 2NREA 4CLYA 4K0KJ 2AYGA 1S4FA 2HZCA 1RHMB 1FRIA 4C8YA 1S76D 2FJAB 2J9DA 2PMZD 1S0OA 4M5HA 1N52B 2L9DA 3GIMA 2OPQB 2MKHA 4C8LA 2XHWA 3TUPA 1FKOB 3HHLC 2F8HA 4RW8B 5C24B 2VICA 4J9MA 4M5LA 4DV2F 4NYZA 3PRBA 1RACB 1R89A 4ILRA 3PJWA 2ZJPQ 1X9MA 1NJYA 1HW8A 2YNGA 1O0PA 2ZITA 4A8WA 3CULA 3D7SB 5IM0B 2WW4A 1T05A 4P7TA 4I1TA 3K5MA 4QJVA 2D7SA 5DO2A 2BACA 2BRLA 3V4MA 4F25A 4X65F 1DFDA 3ENVA 3QZ7A 4FYXB 1FK9A 5LJ5Y 3MECB 5M2PA 3V6DB 3R2CJ 3E51A 3DKDA 4ECSA 1RT3A 1FTRA 2WSEC 3CDEA 3LALA 3QSYB 3HJFA 5C25B 2WSFC 4OFZA 3TAMA 3BBFA 2ZH2A 1S0MA 2BKOA 2HNZA 4YEAA 4DL7A 1JX4A 2DGSA 4NLPA 1S12A 2EFOA 1TVRA 2KRRA 4KGZB 4ECWA 2O01C 1IKXB 1SIZA 2CG4A 2O67A 3GJQB 4KH0B 1SJ3P 3VGTA 3H5UA 2VU5A 3CTRA 2PO4A 2OEKA 4TXSA 2NXNA 4BWMA 1H72C 2AJ4A 4H54A 3W8GA 4A8KA 3KMQA 3W5ZA 4DCOB 3W3SA 1IKYA 4NZ7A 1RP5A 3OR2A 4LF1A 3K5LA 2RDJA 1TUWA 1N34F 2Y1JA 4LF5J 1TU0B 2E5HA 3RZAA 5KFQA 2HGLA 1U7LA 5KT3A 4OZ5A 3U27A 3I32A 3C16B 5L9XA 2O3DA 2YXLA 3GFZA 4M5DB 2PGCA 3MEGA 3MM9A 2AKWB 4NXNF 4YS2A 1HL6A 1SJRA 2MQLA 1HBMA 1AXQA 5EWGA 3OLAA 2GMJA 3IWNC 4LR8A 1I6JA 4PG6A 3NGSA 1D8YA 2R7WA 2BUNA 4LF9F 2RQMA 1NDKA 1N48A 3KHLA 2BE2B 5HROA 4DSIA 5DJBA 2HZVA 4WIQA 2A2DA 1RA6A 2V5HG 1NK9A 3TYTA 5DLGA 1WSVA 4GC7A 1C0UB 1N88A 3VAIA 3CCRS 1SCJB 4NZ0A 2PA8D 4DLGA 2DO0A 2JVOA 1UMJA 3F56A 3DXBA 3K58A 2JEIA 1RWUA 2R7TA 2VFUA 2XWXA 2B8QA 2C22A 1HBOB 1RT5B 1ITPA 3BKTA 1TTHB 4U8YA 4FYYB 3DRPB 3G6YA 1VC5A 4LIRA 1X4FA 4DQSA 1GMVA 2B43A 2EW9A 3DRXA 1DLOB 1RAJA 4JI1F 2OD6A 1NDLA 4C98A 5B0DA 1SUQB 1C1BA 2NUHA 5I42B 3HM9A 3GIIA 2UXCF 1CS4A 4X4NA 1UKUA 3KLIB 1N5YB 1RT2A 2QO3A 2Z2MA 2HHUA 4ED7A 1M0SA 2YNIA 4RBVA 3UCUP 4MIBA 3SQGA 1GK8A 4IG3A 2VG6A 1JWWA 5HLFA 4DV4J 1R8HA 2MZQA 2X51A 3IRWP 1QSSA 5GVQA 5D0HA 3AAWB 2WHOA 2J9EA 3MD1A 3DGVA 3DLJA 2PN6A 4OYXA 4NLQA 4RW7A 1FO1A 4JI6F 5K8MA 3HVRA 1S77D 2XS7A 2GQ2A 3D3CJ 4KHPF 4IQMA 4IR9A 1UFKA 1CULA 5GAHU 3P96A 4F26A 1QLNA 2R2RA 1S10A 1HQEA 5HBMA 4WU2A 1EHWA 1S7IA 2ZBIA 2Z57B 1TR0A 4KKOA 4NZ6A 2V8DA 3OUYA 1F9FA 4WCEQ 2KG1A 5E3QA 3PY8A 3IS9A 3HZEA 1EZZB 2E44A 1SL2A 4NCGB 3AT1B 3I96A 3OFGA 1OQ3A 4MKBA 4JI8F 4OYZA 2R8HA 4DJBA 4FBUA 3FCWA 4NEYA 3QAUA 5HN0A 4ZHRA 2IY5B 1IWAA 2VDHA 4TLQA 5F0UA 2CQPA 3UW1A 3W63A 3VAFA 4OZ1A 2BJ7A 4NYPA 2F9DA 3R8YA 5D4LA 4DL0C 3CMAS 4IYQA 3DHXA 4DR2F 3OL7A 3KK2A 1ACMB 2NUUG 2XO7A 1L5UA 2UZAA 2HQGA 2EC0A 4B3OB 4KT0C 2DBBA 5KG0A 5T7LA 1RU2A 2M3DA 4R25A 4A8YA 2HSEB 2Q6BA 1PCAA 1VRUA 1FVSA 1OPIA 4DQIA 1LXNA 1HWIA 1RTHB 2HRTA 3HFZB 1VBYA 2VBZA 5CA5A 1RHQB 2WVFA 4F4KA 1XNRF 4F4ZA 1FEEA 3F73A 3UQSA 1Q4RA 3ZNUA 3MOJB 2DPIA 3MAAB 2OO4A 2BX6A 1HNZJ 3TR5A 4K4TA 1JLAB 1UEVA 1U8SA 1RHUB 4HHUA 4OZ2A 1F6TA 1VR6A 4TNOA 5IT9U 3PZPA 4M5IA 5HP1A 4DR5F 4NEZA 3MCNA 2BRKA 4Y00A 4F04B 3OUYB 2POKA 4JI7F 3R7BB 1KOOA 1U6FA 2MZ1A 5L1IA 3VAJA 2EFNA 3LP0B 2C3MA 3RAMA 2YWEA 1M1HA 4J9PA 1TUVA 2ZH4A 4FF3A 4LF2A 4LMZA 3MF5A 5G4DA 8ATCB 1O6XA 1WACA 4Q5VA 1HNZF 2B7BB 1KOHA 3QMQA 4ECRA 2F3JA 2HHQA 1KVIA 2R4FA 5B0FA 4O3PA 4JI3J 4PG5A 3M6WA 3MMBB 2B8PA 3D28A 1DZ5A 2FJVA 1RBAA 4ECZA 1HNWF 2XO6A 2AEMA 2CA9A 2XMKA 5A6PA 1UW9A 1PAEX 1CEZA 4FF1A 3PHEA 5GAHI 4IG0B 2EPIA 4Z7YA 4DR2J 1Y5NB 3KWMA 2DHGA 4M5MA 4OI1A 3I6PA 2DH8A 2HGMA 1U24A 2XMJA 1IBLJ 4F0KA 1JJCB 2IM2A 1D9FA 1P6TA 3G4SS 2DR8A 3HDSA 3PW2A 3LQVA 1X0FA 4CTAA 3MFIA 4OYAA 2DGTA 4LFCF 1NPKA 1UFWA 1HNVA 2HFOA 3M2RB 3EGWB 3KUHA 5IV4A 2BR0A 2WW8A 3T6BA 4ED2A 3WC2A 1M5OC 1NSKL 1EAYC 2K06A 2DGWA 4ZIWA 2BZ2A 2P6TA 1OPZA 1S99A 2YKNA 2YX7A 3I4PA 2E1PA 3MD3A 5KFXA 4EU0A 3HKZD 1TP7A 3MR3A 2PC6A 4DFKA 1TMJA 1HQUA 1Q7YT 5CXTA 3OFFA 1GX5A 4WKRA 2NS1B 1RBOB 2M9KA 3BSAA 4RW7B 3LO3A 1PJ7A 4DR1F 1Q1KA 1FKPA 1S57A 2BVZA 2N4DA 2VC1A 3OXGA 4Y2MA 1NMEB 3QRQA 4F02A 1XQIA 2K1RB 1QAYA 5KFVA 3WX8A 1KFDA 3HJVA 4I69A 1REGX 1X5SA 1LWEA 1LW0B 3IRXA 4P2FA 3SQGB 1HBOA 2ZDPA 1R3NA 1U09A 2M88A 3C6UA 3VTIA 5A8KB 4X4SA 4ZVFA 4Y28C 4OL8A 3C14A 1RAOA 3T1YF 1ZAXA 1MMNA 5KFEA 1VGYA 2H54B 2BW2A 2V4JB 4QWDA 3IR5B 3TNVA 3BR9A 4Q2MA 3VVTA 2UUCJ 3CPWR 1GMWD 2UXCJ 2E5LF 4QPXA 4OX9J 7AT1B 3OQ2A 1VQKS 4RR5A 1T9XA 4DUYJ 1RLDA 1S97A 5A8KA 3RTVA 3NWGA 2W9BB 1KVJA 2M5YA 3H0PA 2BW7A 5L46A 1RBLA 3TAMB 4FKYA 2V34A 2ZH1A 3CCVS 1YBAA 1ROFA 2CQ3A 4AXJA 4IRDA 4H4OA 3D1QA 2AQ4A 2JNJA 3B54A 1RT6A 3Q89A 4QIWD 2LQ5A 3JSMB 2ZH5A 3CF5Q 1KP6A 2QGFB 1KQKA 1FF2A 4RUHA 2M70A 2ASJA 4DOZA 4CYUB 1FJGJ 4U7UK 1X4BA 2J0XA 4NCGA 1YJ7A 4ALZA 2HPUA 2JLFA 3MPWA 5GAGI 3PIPQ 4EYHB 1T05B 4MAKA 4C8KA 1J2VA 3KLHB 2YNGB 1A9NB 2ADCA 1FRMA 3R1HA 4Y0FA 1NJXA 4MIAA 1N32J 2QA4S 2AF6A 4DF8A 2LVWA 1CJTA 3WHIA 1OSCA 3C46A 1IJFB 4QYRA 4K5RA 1NUEA 3EWGA 1N0UA 4DZDA 3ILIA 4WZQA 1R8AA 4HI1A 4B3MJ 2HQDA 2KI2A 3OXFA 3PYGA 4Y2IA 2CQGA 1NJZA 4XDDA 5U47A 4F50A 1RHRB 1TKXB 4ZN1A 3O5TB 3GIJA 1R27B 2EK1A 1X9WA 1FD8A 2Q3PA 4ZLPA 1WD6A 1MMDA 1T03A 1R43A 3KHRA 2UV8G 2HVHA 1U2RA 2DNHA 1HD1A 2GHWA 3Q83A 1R0AB 4HH1A 1O5JA 4B3RF 2W9AA 2JOQA 5J1PA 3LW5C 2WBRA 3LWLA 1NDCA 1S6OA 4NA3A 2C2NA 4K5SA 3KLIA 4K4YA 1W26A 3F0NA 3JXOA 4JV2A 2PT0A 3DLKA 1ZBTA 2Z30B 3Q8SB 2FLNA 2L48A 1AW0A 2CZ4A 2EFGA 1TKDA 3DYAA 4YQWA 1VQ4S 1NZ8A 1FJGF 1FK9B 2EG1A 1HNXF 3A1YG 1BWEA 3TA0A 2QIFA 4NLSA 5K14B 1NKCA 4H4MB 2XI3A 5D0RA 1YDLA 2R8IA 5CYMB 2BM1A 2GCFA 1RLCL 3DRRB 4U96A 2AGOA 2UU9F 2V2KA 2ZC4A 4LBPA 3LANA 2LQBA 4ES2A 4CZCA 3QPIA 4ZVTB 1PSDA 4DEZA 2UXBF 4LFBJ 2PFDA 1JLCB 2WVDA 3N28A 2D41A 2KFZA 3KJFB 4ELTA 2G0JA 4NXMJ 5KTQA 1PIEA 2RD5C 1SC3B 4YFUA 1CBKA 3BGLA 2JJ4D 4FDFA 2W2QP 3MCOA 1MU2A 4J9RA 4ECQA 2XMMA 1D0EA 2BOAA 3MM8A 1VRTA 4YB5A 3NGRA 5E33A 2BDPA 4CO2A 3KHHA 3JQKA 3G2XA 3IG1B 2E5IA 3FSYA 4ANCA 4W4MA 2JL9A 4LF4J 2DH7A 4OYMA 3OBIA 2ZKTA 4M5JA 4A8OA 4MKYA 5F8JA 1WF1A 3ZZ0A 1MWYA 2YKMA 9ATCB 2A18A 5J2MB 1TQLA 1WOOA 2RIJA 4LFAF 3CCUS 2JFKA 1H2VZ 3HFKA 4D3HA 5B0AA 1RT4B 2C2ZB 3UO0A 1UJ5A 3QO9B 3CO9A 4G6VB 2LQ9A 4F3QA 2DD8S 3P45B 3N9UC 4NI2B 3PVXA 4CH0S 1S6QA 2HIQA 5HATA 2MKKA 4ZPWR 4PZVA 2HNZB 3UN5A 3GG0A 2JVRA 4GKJJ 3M32A 4X4TA 4B9NA 4J91A 5HANA 2RMLA 2ZNZA 3GYNA 4MMOA 4RUAA 3HHLB 1CJVA 1LWFA 4ZA1A 1S1VB 2CJBA 2F63A 3PEJA 4C2MA 3TZYA 3RAXA 3IR6B 1RCXB 3LP1B 3OTEA 2HAIA 5HBMB 2CJYB 3I0SA 4ZN3A 2GO9A 2EKYA 1VQOS 3C3LA 4HHHA 4LSZB 1HI1A 2DK2A 2FHOB 1LWCA 1WKKA 4K2XA 1T8EA 1KLMB 2Y1RI 1GQEA 2CNNB 2ZFHA 2AYMA 2DPJA 4C3KA 3M8WA 4K2JA 1PBAA 4KRWA 3MM7B 2HQ3A 2WZ1A 5E0OA 3PX4A 2M52A 1SPBP 3GE9A 1OS5A 2HLUA 1YI2S 1N33J 2YNFB 4MYUA 3M2VA 4ZP7A 1BQNA 4YY3J 4RBTA 1Q82T 2HVDA 1S0VA 3GSIA 1BQNB 1JK9B 2EG2A 2OI2A 3MMJA 4I4BA 3ICLA 4FVCA 4I6AA 3QWPA 4OYBA 2R7SA 4TQSA 4OLPA 5BYQA 1NHVA 1K0VA 1AZSB 4P9SA 5D3GA 5IT9Y 3AB4B 1IBLF 3O8WA 5I4MA 1T3OA 5K5MA 1HI8A 1YJVA 2DEIA 3GZ7A 2MJNA 1LV5A 3CCTA 5CCMA 4IQXA 3DN9A 4FNIA 2XZDB 5IXUA 4F3OA 1DQAA 2IDLA 5KT7A 2HHVA 5B08A 4JV1A 4IFYB 4ECXA 4N7TA 4TLRA 1TL4A 1VDHA 3Q8RB 2DRDA 2RKIA 3DRPA 3A3PB 1GT8A 1Q8KA 2F1FA 3X3UA 5IV3A 2N7CA 2E5LJ 5K8PA 5KFHA 3S1TA 5KFDA 3ET6B 5KFKA 3ENAA 3M32B 3BQ0A 2FQQB 2FZKB 3ENWA 3MOZA 3VGVA 3TVKA 1C1BB 5AE2A 4QYZK 4Q2LA 5GAGU 2MKIA 1VHIA 4HKQA 1PAUB 4QWCA 1KDNA 2H4WB 4KHMA 2YWWA 1LFWA 3TX8A 4QYZJ 2HZAA 4JI2F 2L41A 4CH1A 2A10A 4JI1J 2R2SA 2R2UA 2MKSA 1G3OA 1UPMB 2AIRB 2MDAA 4LF6J 1S1WB 2KDOA 4IH6A 4X62F 2RS2A 1Y0HA 3JAMY 4DV0F 5KFIA 3ADAC 2YH1A 1SH3A 3B4MA 1FKPB 1FXRA 3IN5A 2HG4A 4DR4F 2AEJA 3DM2B 4RWWA 5AJ3J 4TKTA 5H9EK 4DL3A 1SVDA 3BGRB 3R97A 5D3GB 2HMIA 2KG0A 2DGVA 3BGRA 3GYGA 2V50A 2J0WA 3QLHB 3M30A 4LVOP 3VZHA 4DSJA 4A8FA 3GSDA 2DGUA 4J9UE 5B0EA 2XZWA 4ED0A 1LXJA 1EIYB 2G2OA 3PO5A 3MEGB 3SFUA 1F3FA 3HVTB 3VVUA 1BGXT 4F3MA 1QJHA 4K50A 2EFQA 2KZMA 1UVMA 3V4IB 1IQTA 1SIWB 1ICEB 4I6YA 1JLGB 4W98A 3BS9A 4YUDA 4EBDA 2DT9A 1M5SA 2WTFA 1NXIA 2C42A 2OAUA 4I7FA 3SV4A 5HAOA 3PNIA 4AE5A 4DHVA 5HQMA 5KFNA 5A8RB 2Z56B 4YHHJ 4DU8A 3HXMA 3QRRA 4X4OA 1KN6A 3AOBA 2I5JA 3MM6B 2HS4A 1HNVB 3B4DA 3KTQA 4TYAA 3OTCA 3PIOQ 5C7PA 2B4UA 3ZFVA 1RTZA 2KRBA 2KM8B 4DR6F 5ADZA 3LF0A 2VH7A 3NGDA 1Q7LB 1URNA 2NLWA 3UI3A 5JVGQ 2IVMA 5KT4A 3IFEA 4FXVA 1UWBB 3DRSA 2KXNB 4LFBF 1RTIA 4WWSA 2F8EX 4OYOA 3K57A 1RAAB 1UA1A 1KFSA 4RW4B 1X5TA 1MWQA 1CJVB 2XG8A 2FVCA 1J5EF 4ECYA 3KK3A 4QU7A 4O23A 4OV6A 2HBRB 3QWUA 2IIHA 4AXIA 4WK3A 4Z7CA 2XWYA 4F7VA 1X0PA 4I2QA 2VV5A 4NA2A 4RW8A 5J2QB 2M0GB 3MUVP 1K8AT 3DLLQ 4CH7A 2M2BA 1G2EA 5D4PA 3HSGA 2WBMA 3OPKA 4IO1A 3O3LA 3R5CA 2HBYB 1SJQA 1Q16B 2VASA 3M8SA 1RTDB 1RSCA 1WKJA 2LCWA 4ECVA 2VIHA 3JSBA 4RW9B 5C42A 4ZVRB 2MQOA 4DV3F 3EZ5A 3PO4A 3Q86A 4NE9C 1RWMB 2DNQA 2PI5A 2HKEA 4MKAA 3B8HA 2W4PA 5CHCB 3JSRA 3QIPB 2QMWA 3Q8YA 4ZLJA 1S1VA 4QWEA 1AFIA 2K7JA 2J5AA 1FXDA 3J7A1 5AXMA 2CPEA 3O6QA 3OR1A 1JLFA 1F0XA 1VLYA 4C8MA 5D6GA 4WFBQ 2GS8A 3UVJA 2UP1A 2CPZA 4HYKA 1MN7A 5D0GA 2A6OA 4F2SA 2DGQA 5KFYA 3OVBA 1QM9A 1IUJA 2CVIA 2XYGB 4N5SA 4GKJF 3CJTA 3J7AN 2HQIA 4OX7A 5JMNA 3X1LB 4DV1J 2NXCA 3FRYA 1B4SA 1A0OB 3V6HA 2YWHA 3CIMA 3CJQA 5IWAF 3FFIB 1RYRA 5F0WA 3DC2A 1NLKL 3ONQA 3UD5A 3M8YA 4RNOA 5KFRA 3G86A 4LF9J 2MSTA 3K5OA 4PWDA 1VHFA 3M9OB 2KFNA 1U0HA 1V3RA 3DRRA 2DHXA 1F5BA 4ZOSA 1XMOJ 4LFAJ 2PA3A 2R3VA 1I1GA 2ZWPA 1AT1B 3DOKA 1Z2ZA 4A4JA 2DNRA 3BGOP 2GZOA 4X65J 1U45A 1OSDA 3VALA 4JI6J 1FWLA 3DLEB 3N79A 5JJBA 3QT5A 3BV8A 4ZCIA 1TL3A 5D8HB 4XK8C 2CQ1A 2NZCA 3US5A 1SH0A 2IM3A 3QQCD 3D6MB 2FVQA 4PXDA 4GVBA 1I3OB 2JHEA 4KV8A 3HVAA 2LKZA 2FJEB 4WPAA 5J2QA 5CH7B 4Q8FA 2VZ9A 3M2UB 3N0VA 3G8SA 1H6KX 1YJUA 2P9EA 2VPXB 5CCLA 1MWZA 3T5LA 3MI7X 1TKXA 2JEFA 2EWHA 2V8HA 1V9OA 5SUHA 5KG6A 1IKWB 5DQIA 4GKKF 4M5GA 4I64A 4H4MA 2U1AA 2Y8WA 1V3ZA 2DNKA 1S1UA 2B7CB 3MZIA 4LR7A 4CO1A 5D15A 2LECA 1RTIB 1G6BA 2G2YA 2C2MB 2MY8A 2HFNA 2LU1A 5THWA 1HWKA 3BO3A 4JI7J 3CJKA 3P5TL 4CO5A 1NCLA 4CNZA 1ZTTA 3C8YA 3RBEA 1N36F 1X4CA 3KJNB 3D68A 2JWNA 4I0WA 4RNMA 4XPEA 3FBBA 4IG3B 2P5VA 4DR3F 4A8MP 4LBIA 1CSJA 4KB7A 1WC0A 3LA0A 4UUXA 4ZPCA 3PXGa 2Y9HA 2GIFA 4PQUB 5KAKA 4K4ZA 1LW2B 1WTBA 4KFBB 5KFTA 2R2TA 2LEAA 2P6SA 2CZVC 2HK2A 5T14A 3J7YI 3J81Y 3P49B 3KHGA 2MXYA 4C3MA 4DG1B 2LU2A 5AJ3F 1OIAA 3HHNB 1YZ6A 1WOSA 2H48B 3DCAA 2QC3A 2MHEA 2B6AA
chains in the Genus database with same CATH topology
2X3GA 2W9BA 1CQMA 1RT4A 1QUPA 1RTJA 1ZM2A 2SXLA 4LSNA 4PWUA 3NCQA 5A8WB 1RJJA 2B4OA 3MM9B 3BQ1A 2N3OA 4WE1A 4B3MF 1VBZA 2J8AA 3E8OA 3MWBA 3M30B 3N6NA 4WFAQ 1GXLA 5DQGA 1U1KA 3M6VA 4M95A 2B9XA 1DTQB 5HMXA 1JKHA 3O2IA 5CZVA 2FIUA 4IH7A 4DV6F 2B9WA 4WE1B 1F60B 2F7VA 4IRKA 5HMWA 5KFLA 3KLEB 1U1NA 3NBPA 2ZD1B 4MFBB 4WK1A 4NLXA 3OTOF 4HL9A 2A2CA 4OZNA 5T7LB 1CPZA 4O44A 2K3IA 2N3LA 3OSNA 1VQ7S 1JLFB 3HHEA 4ZVEA 3CCMS 4V19J 2K7KA 2I8EA 3G8QA 3SFGA 3U1LA 2LEPA 5F8IA 2AGQA 1ZM3A 1U6ZA 1WF0A 4L6V3 4RX6A 3H40A 2RILA 3DU6A 3V6KA 1TAQA 3OV7A 2X1FA 3PKMA 2KU7A 2RT3A 4O0IA 3BF4A 3RW6A 2P9CA 1H7WA 3EYZA 2ADBA 3CCZA 2DNYA 2MZTA 2XLIA 2EBEA 2ZKUA 2Z8QA 1VC0A 2HNDB 4NWBA 1ZPWX 3UNGC 3KLFB 4EEYA 3R27A 2FJWA 2RNEA 1NK4A 2Q43A 3Q2TC 4RU2A 3PX6A 3LPYA 5A2QY 1LFPA 2GO8A 3CC2S 1Q81T 4M63A 2DB1A 2ZE2A 4FBTA 5KFCA 2B4PA 1DTQA 2ROGA 4BWJA 1NNDA 2DCLA 5D77A 3BSOA 1Q79A 2I9SA 3MMAB 1SUQA 4LF6F 2GHVC 4N8NA 4J9NA 2OJ3A 3RRGA 2CQ2A 3HLUA 2IMOA 2KHCA 4LSNB 2FJBB 3MMBA 1PGZA 1V6HA 5J1EA 2CPHA 1SKSA 4N76A 1Y7PA 2QLXA 4ED1A 1QTMA 3V4IA 1TKTA 3F41A 4KJIA 4QZVB 5KT5A 5E3PA 5DRKA 1LKZA 2M8HA 1P1TA 4WIIA 4TU7A 3TQ1A 2NSBA 2W4DA 4KSEB 3JB9k 1SBRA 7FD1A 5F8LA 5J2MA 1FRLA 3T6JA 1HMVA 1HBUA 1YTYA 1XWLA 4UW2A 3Q24A 2QLWA 3OFHA 1K9MT 3O1LA 4ZKAA 3KLEA 2RS8A 1YVFA 1QSLA 2GGPA 2XMTA 1WEYA 4ZPDA 3CJ3A 1QAIA 1KSPA 4X2BA 1K0TA 2GC8A 2FC9A 2DHAA 4WYWA 5CQGA 2ZE2B 4OHYA 2NZ4A 4Q0BA 1RTDA 2MGZB 4B3SF 1AROP 2B3TB 1G7CB 2YVSA 1Q78A 1RT1B 3DHWC 3NAHA 1GXUA 2IRUA 1JJHA 4CNYA 1QVFR 3I9V9 4OI0A 1GTHA 2DJWA 3NNHA 3PM9A 4G1QA 3GV5B 1PC5A 5LSRA 5DDRC 1I94F 4YOEA 4WTYA 3M8RA 3ZZTA 2ZOMA 3M2RA 3TUZC 2ZDOA 4YHHF 3T3FA 4A8QA 2J7KA 4QIVA 2AJQA 3ENQA 4O4RA 3OVSA 1VQ6S 3OL8A 4QOTA 4YP3A 3BZQA 4KTQA 5AXKA 3I5AA 1URRA 4F67A 4C11A 3GQCA 5KFGA 5JVHQ 3D54A 3QYYA 2DCUB 2WONA 1R7IA 4WXOA 4DS4A 3TA1A 2DIUA 2ZHAA 3CMES 3HHLA 4NPOA 4LSLB 3UE2A 2KT3A 4NRTA 2YKQA 5EUHA 4N41A 5DDQC 1ZM9A 1IJEB 1WI6A 1Y5IB 5ITHA 4U7CA 5GAEU 2IJNA 5A8RA 5FD1A 1NZAA 2D74B 5E2QA 1KQFB 3C66A 4X4PA 3I0RB 3KJVA 2GFFA 5F8NA 3QZ8A 2ERRA 3FQLA 3H20A 4ZCMA 2HHXA 1YJRA 2N4CA 4NA1A 2H5EA 1M5PC 1U1PA 4KGMA 3D1OA 4OZLA 3OTDA 2HHHF 3HVTA 3K8WA 5EN1A 2CJ9A 5KG1A 2FHJD 4W90B 2OTJS 4B9TA 3CDWA 4OHWA 1KNZA 3FMWA 4KV8B 3JSYA 1NH7A 3CT9A 2YNIB 4PPZA 1D1UA 2MPUA 1X7VA 1U1OA 4N47A 4PWDB 3LOUA 2W25A 2RU3A 1YRUA 3JTNA 4DL6A 4M94A 3NCRA 1NH8A 4I67A 4MK7A 1FESA 3QGPA 2BYCA 1LK5A 1HHTP 1S6QB 2ZBCA 2CFXA 2K8GA 5DGBA 2AX0A 1ZTWA 1JWWA 1QAJA 3IC1A 4TYBA 1SJFA 1S9GB 3UDCA 2ATLA 3GFYA 1XN9A 1HARA 2C3UA 1GNKA 1IKYB 3FNNA 3RYLA 4D3GA 2ZVSA 1X9SA 2G4BA 4DUYF 1YJWS 2YKMB 1HNIB 4BHQA 1HD0A 2CJQA 4Q43A 3TANA 1HHSA 2UVRA 1SL1A 2E7WA 4M8LA 1FDAA 2JLGA 3MXHP 2VBYA 2RF2A 5F8HA 2E9ZA 1O51A 2MKCA 3T5KA 2GA7A 1D8ZA 5KG2A 3KKFA 5HQ8A 4I6WA 1R0AA 3EXCX 2Q66A 1B0PA 1RA7A 3GIKA 1FRJA 4C0HA 3SXLA 1IXKA 3OR2B 3GFHA 3MHYA 2VQFF 3V81A 2HWTA 3Q8PB 4PR6A 4W92B 2ZJQQ 1FXLA 3MEEA 2RRAA 4LF7F 1OQ6A 4PUOB 1T02A 3PW4A 4WYLA 1LQ9A 1W2IA 4ZCLA 5LT5A 5FDLB 5J2PB 2LLZA 4J5OA 2QE5A 4HDHA 1FJCA 2ROPA 3OTBA 4J9LA 3CJ4A 4URQU 1RKJA 1VQ9S 1DJ0A 2V8VA 4HT5A 2D3OR 2RE1A 2OPRB 1FDDA 1AFJA 1HWUA 1OWXA 1NJIT 2CPFA 3G6XA 1SL0A 5KFZA 3QIDA 3WBZA 3QJJA 3UCGA 4X66F 3DMJB 5KG5A 2MQQA 2J7WA 1JLEA 1VS3A 4BCAA 3V5RA 1FRKA 1D9DA 4RW6A 5IT0A 2XMWA 4NLOA 3W2VA 1Y9OA 4DV4F 2IMWP 1R31A 2ZH8A 4F8RA 3K59A 2MHNA 4YB7A 1K73T 4RNFA 4G1QB 3N6MA 2W7PA 1LK7A 3DXSX 5AXLA 3TVZA 1UJ6A 3OR1B 1X4HA 2IA6A 4ED3A 1BD6A 3GR1A 3CD6S 3PJXA 2GW8A 2XI2A 1UW4A 3UR0A 3KYLA 1P27B 1MMLA 5FJ4A 2HYIB 2WRMA 3ISZA 2V8GA 1KD1T 4JI5F 4HI2A 1RQ0A 3DLBA 2OFHX 3D0HE 4QR0A 4KPYA 5JXSA 3W2WA 1JKHB 2DNOA 1ZOTA 3QLHA 2FDNA 2YQ3A 5LXRA 1UVKA 1NHUA 4ETZA 4A48A 4K59A 3I0RA 4A46A 2KO1A 5J1NA 1IKVB 4KGKA 4B08A 1SH2A 4Z37A 4ED6A 3MMCA 1S79A 2HHPA 3VR1A 1Y4ZB 4NLRA 5KFBA 4UQGA 4CIOA 3M6XA 1S9GA 1ZM4A 1S1TA 2WONB 4LIWA 1UEUA 1KHVA 4PG4A 4K4UA 2J0SD 2VFRA 3RR7A 3KJVB 4GMKA 2RSQA 2B5JB 4MTPA 4ZVGA 3VWSA 4TN2A 5I3QA 4R0JA 3MFHA 1E6YA 2IM0A 4ELVA 2AX1A 4H4KA 5KG4A 4U9RA 4X4VA 3FQKA 7FDRA 5EWFA 1P1LA 4ZK7M 3SCKE 5HO4A 2IYIA 2IVFB 2QRRA 4H4KC 2AW0A 1BC6A 1ZH5A 1UJ4A 1C4CA 2VFSA 1N5TA 2BANB 3U7JA 4IO9Q 2YNFA 4LQ3A 4DN0A 1SI9A 2QYCA 3VAKA 4NLUA 2M8DB 2MZRA 1C4AA 1QVGR 3UPFA 3NS5A 4DQRA 1QSYA 2FD2A 4KC5A 2LA6A 3LP0A 2CPIA 3Q8QB 1NK0A 3HI9A 4QW9A 1CC7A 1IKVA 5GMKa 3RAQA 2MB0B 5KFOA 3I87A 2BM0A 3GV8B 1WG1A 3IWLA 3SDEA 1S49A 2DR5A 2VPZB 3K5PA 4PG8A 2NQPA 5KT6A 2JLEA 2MZJA 3M1VB 3CC4S 4FYDA 2QSFA 2KHDA 3NRBA 4NMLA 4C9DA 2C3PA 4DWIA 3T1AA 5CZXA 1B0TA 4JYAF 4OJ1A 2YKOA 3M4XA 3CEDA 2UV8A 2JZ5A 4GO5X 2A1BA 3C6TB 3THVA 3BN4A 1FT8A 2RRBA 3QO9A 2BQUA 5J1EB 3TUJC 3U02A 1DARA 5FIIA 4C4WA 1RKIA 2XCPA 2KYZA 1QE1B 1TL5A 4HLBA 2FY1A 1C0TB 3TUIC 4WKYA 1VQPS 1VQNS 3NMAA 4RUCA 5K9FA 3G6ES 1A6LA 3BGUA 2PI4A 1NU4A 3TA2A 1F5CA 1R8PA 4KO0A 1TKZA 3W2VB 5K8NA 3IBWA 5IT4A 1FTCA 2HNYA 2J76E 5C42B 3MM8B 1FRHA 1HBNA 1DBDA 3MUTP 2DR9A 2FHJA 5L9NA 3DMJA 4Y65A 1U47A 2X1AA 1P8GA 4K4SA 4WFZA 2XCAA 2R9LA 4I2PA 3CSKA 4DPOA 1DURA 1X4DA 2Z0GA 4ICLB 2RUGA 5I3UB 2LEBA 2E9TA 3ETOA 5H9EJ 3N5BA 5CYMA 3AHPA 2VQEF 3QGIA 1HYSA 4OHVA 4DFJA 1DQ8A 2B6AB 5MAOA 6FD1A 2O66A 2HVZA 2W7AA 3Q0AA 1TV6B 4JUZA 5KFMA 4FZVA 4RKUC 2EVZA 2JRSA 3CJ5A 2E66A 3MM7A 4WZMA 4I2QB 5CYJA 4ZP6A 4NL5A 1NK7A 1JLEB 3SSRA 2VG6B 4HTJA 4R8UB 4DQQA 2KJVA 3O44A 4ZVHA 3GMGA 3EXYA 2KT5A 3IAM9 3PACA 1S7HA 1LWFB 2R7XA 4C97A 4WFNQ 2XS2A 1GH8A 4TY9A 3R5DA 4EO6A 3PR5B 4UOCA 1VIXA 1UWBA 3DRSB 4I7FB 4O3NA 4K4VA 2DRAA 4Q45A 4DR7F 1ULRA 3DLKB 3HHKA 4B3TF 2VFVA 2DTJA 1Q8BA 2WK4A 2QZ8A 4OJHA 4YY3F 1H38A 3G96A 5J2PA 2JH3A 3IR7B 1TL1B 4C0OC 2YWGA 1GTEA 1X4AA 1XERA 1DTTB 3KLFA 5LL6d 3MM5A 2V4QA 4QR1A 2B0GA 4DL2A 1RT1A 1Z2LA 4QIEA 3CDBA 2FUG9 1N5YA 4EGLA 4QQBA 2L3MA 4OZ0A 3DM2A 4MFBA 5E3CA 4DSKA 3K2YA 5DGAA 5HP1B 1NKEA 2KKHA 2V0NA 1YJTA 2XMUA 3HF5A 1X5PA 3KK1A 3VAHA 2XS5A 3DDKA 2V4RA 4CQ1A 3RB4A 2K2PA 3K5NA 2DGXA 3H2UB 2K3KA 1RT7A 2OLWA 3POTB 3DGPA 3KNAA 3CUNA 3P3DA 3B78A 2CQDA 2CQ0A 2NPIA 3MM5B 3EUNA 4Y3CA 3UD4P 2JDJA 4C8OA 4B3OA 2R7QA 2J0QD 4NYOA 2WB4A 1CQNA 1P9QC 5A8WA 4DQPA 1TKTB 3BM7A 2XLKA 3OVAA 4Q8EA 3IGVA 4OJGA 5L39A 3LAMA 2JFDA 4N56A 2KN4A 5C25A 3LUYA 1UFLA 3IA0A 2W7OA 1VMBA 2ZH6A 1WELA 2I38A 1KTVA 4DL4A 3MEDB 1D9AA 1FCAA 3D5MA 4Q44A 3WZ0A 1N6QB 1FKAF 1SKWA 2V4JA 3MMAA 4O4GA 2AGPA 4OMFG 1KTQA 4K4WA 1HWLA 3OHAA 2GHPA 2MMYA 4J9KA 2YKAA 1W2BR 3DNCA 1NK8A 4C7QA 2WAQD 3IRXB 1S1XA 4DF4A 4IUFA 5KFUA 2K1RA 2ALZA 1O8BA 2W9CB 1HI0P 3FMBA 1SV5A 3KK1B 4AQYF 5HI7A 3MCSA 1WWHA 3FGVA 4RWXA 5E3AA 1FNMA 2JSXA 1L3UA 1T94A 4KIAA 1BQMB 3UWTA 2Y0SD 2JX2A 1UVLA 2BANA 2YX1A 3L3CA 2VBWA 5CYQA 2PMHA 2EI5A 4BC7A 3LP1A 4OI3A 3NP5A 5HL7Q 2FC8A 2VG5B 2FHMA 2IRYA 1IM4A 1VQSA 2LXUA 2RH3A 5KFFA 4DQIA 2GX8A 5AXNA 4B17A 2IBKA 2QA1A 1Y3KA 4CTAB 1VQMS 1U1MA 1HBNB 3IAS9 4QIFA 4P7VA 4PG7A 2YWKA 5BR8F 1D3WA 4AUKA 1Q53A 4QWBA 5IFMA 3MEDA 5C24A 1PC4A 2FVPA 4OJ3A 1JXLA 1FERA 1Z4UA 2UUWA 4FF4A 5I3PA 3D1HA 4KO0B 2I5JB 1WHYA 3MM6A 4N77A 1U1RA 2BQ3A 1S1UB 2QSWA 3CCWA 3AQOA 1S6PA 4J9SA 2DR7A 2B9YA 5M2RA 3HPOA 3D0GE 1E6VA 5I3UA 3CGIA 2W8KA 4BS2A 3E01B 3DI6B 2C2DA 4JI3F 3J7ZT 1KLNA 3NGKA 4O3OA 1BQXA 4MYTA 2VL1A 2QA4G 4B9MA 2IVYA 4LT6A 1Y00A 2E1RA 2Z2LA 1TFWA 2YX4A 1RYSA 3EGNA 3TW0A 1YJNS 2FLLA 4OI4A 1S6UA 1Y5LB 1RT7B 3S01A 5LSOA 2FHKA 3LWMA 3G71S 2XMVA 4USHA 2GIRA 3EGZA 1W25A 1H2UX 2I2YA 4DX8H 1YG0A 3SI8A 2L08A 2FVSA 2AV5A 2J6TA 1TKZB 3WC0A 3OL6A 3FJ2A 5DDOC 3RB3A 4KBIA 1TK5A 4PQAA 1WHWA 2FJDB 3JTOA 3M05A 3U1MA 4C0BA 3DI6A 1S0NA 2CQCA 3ZZOA 3H8YA 3KK2B 3I5CA 2QMXA 3DLHA 2F8MA 2PE8A 1R8CA 2UXDF 2OSRA 1NO8A 4OQJA 1M5KC 4EWTA 4LJMA 2VOOA 1ZAVA 1TL1A 2QA2A 5B0CA 1JXEA 4HTIA 1EP4B 4FNHA 4ES1A 2NSCA 1TVRB 4ELUA 3PDNA 3HHLD 3KFWX 4L72B 4ZDNA 4TU8A 3KLVA 4IOCQ 2VUGA 3R3TA 2HWIA 4WFYA 2OFGX 3IO1A 2MQPA 4DV7F 3E01A 2FVRA 1RT3B 3PR4A 4YR2A 2VONA 5A0YA 2FTRA 2ZOGA 2D9PA 4ECTA 3IS9B 3NLCA 1ZPVA 3V2UC 3G8TA 2OP5A 4CO0A 2QFJA 2VA2A 1E6YB 3C6TA 3GV7B 3P6YC 3M6UA 2ZHBA 2XNRA 5F3TA 2VG7B 5EWEA 3IGNA 2ZH7A 2PFFB