4DR2F

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dr2F00
1HNZF 4K0KF 4JI8F 2UXCF 2F4VF 4DR3F 4DUYF 4DR1F 4YY3F 2UUCF 4DV3F 1FKAF 4LF7F 4LF5F 4B3RF 2HHHF 4DV1F 4LF4F 2BVZA 2UUAF 1XMQF 4X66F 1VMBA 1B64A 2UXBF 4DV5F 4AQYF 4LF8F 1IJEB 2YY3A 5BR8F 4DR6F 1FJGF 4JYAF 4B3MF 1XNRF 2VQEF 2BXJA 2UU9F 4DV4F 4NXMF 1HNXF 4DR2F 4DV2F 5IWAF 1F60B 1HR0F 1IBMF 1J5EF 5LMUF 1IJFB 2UXDF 4DR7F 1GH8A 4NXNF 4JV5F 1N33F 2RJZA 3R3TA 4GKKF 4DUZF 2VQFF 4OX9F 4JI5F 1XMOF 1N32F 4JI3F 4KHPF 1G1XA 3OTOF 4DR4F 3T1HF 3T1YF 4X65F 1RISA 4DV0F 4DV6F 1N36F 4B3SF 2ZM6F 1XNQF 4B3TF 2B7BB 1LOUA 1CQNA 4LF9F 4YHHF 4JI4F 1G7CB 4JI6F 4JI1F 1N34F 1IBLF 4GKJF 3ZZPA 2UUBF 4LF6F 4LFBF 1HNWF 1I94F 1QJHA 4X64F 2B7CB 1CQMA 5AJ3F 2E5LF 4LFCF 2KJVA 4DR5F 4DV7F 4JI2F 5LMNF 2J5AA 2KJWA 4JI7F 1IBKF 4X62F 4JI0F 4LFAF
chains in the Genus database with same CATH superfamily
2KXFA 1XNQJ 1FE0A 1Z4UA 3HMJG 3AD7C 3CDEA 2CQPA 1W2BR 5L1JA 4ES3A 2EI5A 3KJQB 2WONA 1CJVA 2CNKB 1QAIA 1BQNB 2QT7A 4MKVA 2FVCA 3IC1A 3MF5A 2UUAJ 1FA0A 2ZNZA 4R25A 1ZZNA 2GQCA 2KXNB 3C16A 5GAHU 5EUHA 3P4UB 5IM0B 2FVRA 5F3ZA 4L72B 2PD1A 5T14A 4OLOA 2NUUG 3TA2A 4ZN1A 1AFJA 5KT6A 4Q8EA 2ASDA 4K5RA 3UNYA 1Q86T 1U1OA 3MM5A 1RTJB 4C8NA 7FDRA 2CPEA 3AQPA 3DLJA 1RWVB 4USIA 5GADI 3G9CA 1NB7A 4YDXA 3QGGA 4K4SA 3M2VA 1KONA 1FDNA 1JNRB 4RLEA 4CLUA 1FO1A 1X4DA 4OIXA 1S6QB 2RDDA 2B4VA 1F2HA 3LP1A 2IAJA 2EFPA 3CNQP 4WF9Q 3C2PA 4IRCA 2MMYA 4RNMA 3ZZ0A 5GADU 3ZC4A 3F73A 2FY8A 3HI9A 2VV5A 1RHKB 1UWAA 1CULA 3CCRS 2GGPA 2MSTA 4PUOB 4L3NA 3N9UC 3R5JB 3I31A 1KKHA 5SUHA 3ENVA 2XSFA 1BMQB 5FLXU 2NSCA 2I5JB 2RE1A 5CCLA 3R2CJ 2AEFA 2VDIA 4U7CA 3OUYA 2IA0A 3HF5A 1KLNA 4ZPVR 2B3TB 1KDNA 4LBPA 4B17A 1X9WA 3ZNUA 4F50A 1IQTA 1RBOB 2OPPA 3UDEA 1CSJA 2W7PA 1N5YB 3R5BA 4HR2A 4C7QA 2H4WB 2XS7A 4QIFA 2YKOA 1FKAF 4USMA 2W2MP 4EWTA 1KOHA 4DR5J 1RGVA 3KLEB 4IR1A 2OD6A 3L9ZA 1RT6A 1RA6A 5LSRA 4JYAF 2CDRB 2BEFA 2CA9A 2W2OP 5KFDA 1ZM2A 5FD1A 3CD5A 3U1LA 1JKHA 2MYFA 2W4CA 1FRLA 1H6KX 3I5BA 5HK4A 4FPIA 2G0CA 1S76D 4E2FB 4CH1A 3C46A 3JSMA 4RZRA 2HQGA 3D1QA 3QO9B 2P8IA 2AU0A 3KDNA 1IKXB 4PWUA 1MLAA 2HKEA 1CLFA 3T3FA 4OZ5A 1REVA 2OPRB 4I7FA 2E5LF 3OTDA 4K59A 3EWGA 4N8OA 2AGPA 3VAKA 1L3TA 1UWBA 3ZZYA 4RW9A 4QR2A 4GO7X 3QRRA 3FEZA 2C2KB 2NZCA 4Z37A 5AJ3J 2B8PA 1JLEA 5BYQA 4Y34A 3RB0A 1FK9A 4YB7A 2MSSA 4TQSA 1KNZA 2YY3A 4DHVA 2GO8A 3GFHA 3TAMA 1N5QA 2J9EA 3CJRA 4DG1A 2WVDA 3GR1A 3G96A 2ZBRA 4AYBD 1U47A 3MDFA 1DURA 4ZHRA 4NLYA 3BGFA 2OIHA 3TUIC 2J7UA 3M32B 3TZYA 2XZDB 1UFLA 2NS1B 4OX6A 3CCMS 1SJRA 3Q8SB 5C42A 2KM8B 3C14A 5IWAJ 1EB0A 2JLFA 1WC1A 3SDEA 4E98A 3AHPA 2GHVC 4TU7A 3E3XA 1FRJA 2CVIA 1JLQA 2BKNA 4FBUA 4F0HA 1ZM4A 2HBQB 2OEJA 4ITSA 5J2QA 3SSRA 2XMAA 4B3SJ 4ZLPA 3G4SS 1UJ4A 2LDYA 1SC4B 2AYMA 2JSXA 1YJWS 5EX0A 2CQ3A 3LOUA 4QQBA 4TYAA 4N77A 2DGUA 1SJ1A 1R7IA 1S48A 4NLTA 2CKWA 2Z56B 2NPFA 2GFFA 5KFMA 2U2FA 3MURP 2MQLA 2H9ZA 1SL1A 4FNHA 1V9OA 4IH6A 2E9ZA 1CEZA 2XMTA 3AD8C 1VQLS 3O5TB 4XPEA 5KFLA 3O8WA 1HNIB 3BYRA 6FD1A 2W7AA 1TV6A 3T1YF 2GHPA 3H0PA 3ZO7A 4QWDA 3TA1A 4FZVA 1IKVB 1X0PA 1QD1A 4AL7A 2G4BA 3OD2A 1UEVA 2YQ1A 3IWXA 4Q45A 2JJ4D 1JLAA 4ECWA 4X4RA 1RKJA 3TYTA 2UUBF 2AIRB 4DX7A 2KZZA 2K8GA 2AF6A 1TKTB 2W25A 4KHPJ 5HQLA 1K0TA 3E01A 2LFVA 2G9OA 3M8PB 1VQ8S 5E0OA 5DZ6A 2V34A 4JI7F 1N36J 1N88A 1FKOB 2W2NP 4DQQA 2JOQA 3K0JA 5KTQA 1UVMA 1RBAA 2WB4A 3N5BA 2DRBA 3EGZA 5EX3A 1AYEA 4A8FA 1Z2LA 1I51B 3HSZA 1LWEA 1FTCA 4J9PA 4X66F 1ZM3A 3N5FA 4PWWA 1ROFA 2ZKUA 3CGIA 1VRTB 2FJDB 4DPUA 1PBUA 4GC6A 5DRKA 5D3GA 2RU3A 4O4RA 5DS7A 5HJXA 1WF1A 3G8TA 2EFGA 1WHWA 2AD9A 1OSDA 5BXIA 3HO1A 4HHUA 2K7KA 4PXDA 5K8PA 1Y5LB 4LUBA 1KTVA 4CDIA 3CIZA 5G0RB 1H0HB 4NA3A 3WIVA 1T3OA 1IBLF 2VU5A 4P2FA 2B4OA 3KHLA 1DLOB 5K20B 2FLPA 2W24A 2Y3YA 1B0VA 1TL1B 2VKRA 1H72C 1LK5A 4NI2A 1V5IB 1TZ0A 4ECZA 3T5HA 4K4VA 1LWCB 4BC9A 3G6ES 3HSGA 3K89A 2HBZB 4Y65A 1WTFA 3LWLA 3RYLA 4J9SA 2CQCA 3CJ2A 1AZSB 1B64A 3GYGA 2RKIA 4K0KJ 2VFUA 3A3NB 4JI8J 1QTMA 5ETRA 1SC1B 3MEKA 1UVNA 1ULRA 4CO1A 1GH8A 1YBTA 5HMYA 3PYEA 4DL5A 3EDRB 4Z7CA 5D6GA 5CH7B 4LSZB 3CCLS 4RJVA 3O2IA 1F9HA 3KYLA 2DXFA 1SUQB 3KLIB 5KOXA 2BW7A 1T11A 1Q95G 1CVJA 2ZH5A 4MIWA 2HYIB 2AJFE 2GV1A 4EU0A 3B4MA 3NCRA 3GV7B 2GQQA 2HMIB 4RW6A 4MKYA 2KH9A 1N8RT 2LQ8A 3ELHA 3TWZA 4NCGB 1RAEB 4DLEA 1YRTA 2GC8A 2E1AA 2BV3A 2HHHF 4TQRA 5KFYA 4F25A 1EETB 4PABA 5F8NA 3DRPA 4KGKA 1WKLA 4HVZA 1CC8A 4FVMA 3DOKA 3MGJA 4DL6A 4XK8C 1CJVB 1MWZA 1B70B 3M2UB 2V94A 2V5HG 2XTJP 4GKKF 2G2ZA 1HD0A 4CO0A 8RUCA 2FJVA 5A0YB 2R8KA 4KKOB 5ETQA 1F5BA 5J2PA 5FIIA 1UL3A 2PDAA 3C16B 4USUA 5JMNA 1I94F 4K4UA 4CIOA 1S0NA 1GT8A 1KEKA 2E5IA 4BWMA 4OI2A 2AGOA 1L5UA 4B9UA 1FEHA 3C15A 1NDCA 5DDQC 1MMLA 3MUMP 2VA3A 1TL3B 4F36A 1LWFA 2DD8S 3BKUA 3KNAA 4YQWA 3PW4A 2IFXA 4LF5F 4ZIVA 4DV1F 3NNHA 2JWNA 2YX4A 1PJ7A 2M9KA 2DNPA 1IKWA 1XMQF 4CWBA 2CZ4A 4C8ZA 4LIRA 3FRYA 3CJSA 4ED8A 2ZJQQ 3SEOA 4WFYA 1V6HA 2CNNB 2H65B 5KFKA 4Y28C 1NSKL 1I3OB 5J2MA 2DR7A 2J0QD 1KBRA 2WSCC 2OPQA 3RAQA 3PHEA 4YN3B 3AOAA 2IVYA 4IG3A 2W2PP 2E5JA 1HR0J 3HHLB 2AHOB 2L3MA 1CULB 1UTAA 2VFSA 3CWJA 3L95X 2GGPB 1K44A 2E1CA 2MXYA 2ZUGA 3Q83A 4U7UD 1WDDA 1WG1A 2UZAA 1Z2ZA 4I6YA 1WUUA 2RU9A 1PC4A 4LF9J 4ZPDA 1HBMA 1VRQC 3PW7A 4OZ3A 1UW9A 2W4PA 5LJ5Y 2OPPB 3UDCA 2BVZA 4N7TA 2IIHA 4OJ1A 5ETTA 1KQKA 1SI9A 2QLWA 2QMXA 1HPZA 2LXUA 2HHSA 4DUYJ 4ER8A 1KFSA 2FJEB 3JSBA 2ZH9A 1T3NA 2X7IA 4RW7A 2J9CA 1RU1A 4YFUA 3HDSA 5LMNJ 2KHDA 1IKYA 2N4CA 2RIJA 1PKUA 4PEOA 1VR6A 3NCPA 3CC4S 1NPKA 4F7VA 2J8SA 3M8RA 1M5SA 4YR0A 1G6BA 4WBFA 1DTQA 3M9NB 1RCOB 3VAGA 2ZOMA 4OYPA 4FXWA 2LXIA 3JSMB 4KSEB 2APOA 2FHOB 3NGDA 3W5XA 4E8UA 2LA4A 4RPFA 2Y1RI 5LOQA 3FQLA 1GAOA 3KK1A 2DO4A 3MPYA 1REVB 1FNXH 2I6WA 1SH2A 4W90B 2BE9B 3DFEA 2FLOA 3EUNA 1Q53A 1UWBB 1Y7PA 3D0HE 3LA0A 4RW9B 3VTIA 5F8HA 2PN6A 1V3ZA 2R8JA 1X4BA 1RWNB 3KUGA 1KRPA 3M7VA 4ERDA 3GV8B 1VJWA 2MY8A 1SIZA 2DRDA 3FVYA 2IVMA 4TY8A 1TVRB 5AXKA 5IS2A 1QAXA 2DGOA 4JBCA 4OYWA 1Q0NA 4DPXA 3JS9A 4ELTA 3ITHA 2B43A 3CCZA 4QR0A 1YITS 4XPCA 1C4CA 5KG3A 3PFEA 2Q6CA 4DG1B 3NRBA 1XQIA 3S01A 4TLQA 4LRBA 4ETZA 2HGLA 2XNQA 3EGWB 1RBLA 1FWPA 1TFYA 3LH2S 3CCJS 3N79A 5DM6Q 5JUMA 2JEGA 3NG8A 3KJFB 3CDBA 5C42B 2OELA 3C14B 4CYUA 3TZXA 3W64A 4I0WA 3SDEB 2DGVA 1LW0B 1F1BB 4Z7YA 4WFZA 2DIUA 4R0JA 4NASA 3KJVA 1EKRA 3CJTA 2W9BB 3AODA 2BBEA 3NL0A 1KOOA 4LF4F 1WSRA 2D3OR 4F4KA 1UEUA 4MFBA 1C1BB 2QE5A 2G0JA 1S1VA 2R2SA 4O3RA 5E7OB 1NJXA 1C1CB 1UVJA 3V2UC 2GAHC 2RAQA 2KB2A 3CPWR 3HHEA 7AT1B 2KN4A 2DT9A 2HURA 1RTHA 4JV0A 5EN1A 4QIEA 3KLGA 1HBOB 5D0GA 2L9WA 4TY9A 3HXMA 2MJNA 3SSQA 3AXMA 1EKSA 3DLEB 1BUXA 4Q2LA 3UR3C 1G7CB 2ZZTA 3QBCA 4U6PA 4PCQA 3OVAA 1WC3A 4DCPB 4F4XA 1UPPA 3M6VA 1QAJA 1JLAB 2CJBA 4UQGA 2RS8A 2V9WA 1W25A 5HSPA 3TZZA 3BGUA 2J9DA 2ABYA 1P1TA 2PMZD 2RS2A 4DSKA 2V67A 3FBCA 4K8RA 6FDRA 2V8PA 1SL2A 3MR2A 4C0BA 3QZ7A 3MUTP 2M52A 1AXQA 1X0FA 4C98A 2RJZA 1WHYA 3TRGA 3BM7A 5DG7A 5E3QA 1XIQA 1UAWA 1RT1B 5CYMB 1BXNA 3WC0A 1VRUA 4L73A 5GAEI 4M5MA 3CW2C 1Q8IA 3IAM9 4NXNJ 4LQ3A 1NDPA 5J1PA 4NLOA 1SC6A 3IR6B 3EICA 1FX4A 1QSLA 1RWKB 4B08A 2PMHA 2HQCA 2J7KA 1KS2A 4USWA 2E9TA 1N4LA 2QA1A 3KDOA 1X4CA 5GAEU 2KT3A 3OL9A 4CTAA 4BS2A 1HNWJ 3RBZA 3R7SB 2HK2A 4NI2B 2G1DA 4PAAA 2MZJA 3H59A 4M5IA 4TU8A 5HBMB 2ACMA 1RXOB 3FZBA 4PXEA 5LSOA 4Y2AA 3JTOA 1U1MA 1NKBA 5I3PA 4NRUA 2MEWA 3RBDA 1HI8A 1T9YA 4DCJB 2RMLA 2OMLA 1T02A 3QT5A 3HVAA 1VQ9S 1AFIA 4RR5A 2CG4A 4CP5A 3B54A 1KP6A 3IS9B 4LRDA 3G82B 4AE5A 4Y0FA 4ECYA 1N52B 3PR4A 2DITA 5EWGA 4ZITA 1XNQF 2RT3A 1J5EJ 1FKPA 3PW5A 3IR7B 2BZ2A 2M0GB 3NS5A 2XLKA 4F4YA 1R8BA 2ILYA 1FJGJ 1N5SA 3MM6B 3F44A 4R8UA 3OL7A 4ZP9A 1BWVA 2B56A 2DGXA 1J2VA 4QPXA 2OI2A 2GAGC 1NSPA 2JVOA 2OKQA 2VPZB 5IT0A 2MLXA 3D54A 1KD1T 1X4HA 2UUAF 3H8YA 3MAAA 5T7LA 3LGMA 1T8EA 3C8YA 1QVGR 2R3VA 2NYHA 2ERRA 4DR3J 3H4DA 4RX6A 4N56A 5HO4A 2JZ5A 4JV1A 1VDHA 1RWXB 2DNHA 2RHSB 2C3UA 3UO0A 4NZ7A 2R4FA 1FTRA 3DRXA 3HKWA 3V4MA 1U6ZA 4EBDA 1MROB 5A8RA 1YJVA 2BJEA 4KGMA 3GFZA 4MMOA 4EEYA 2EBEA 4CLZA 4EUVA 4NYZA 4IDKA 1YJNS 4KYZA 2KL8A 5CD4H 2DJWA 4NZ6A 3MTKA 1HWIA 5KFUA 2OTJS 2FUG9 4TU9A 5J2PB 3V6DA 2C2RA 1RHRB 3DXBA 5AE3A 3W9JA 2YX1A 1TKXA 2BOPA 2K2PA 4J9KA 4B9SA 3BJYA 1WEYA 3DOMA 1VQOS 4K7QA 5DGAA 1NK5A 3C15B 1FE4A 3NGRA 1HQ2A 3CJ8A 3KLHA 3G6YA 3I6PA 3NLCA 8ATCB 2X1GA 4USVA 4LMZA 4ZCIA 2QJ3A 3MPWA 5CAAA 3GPAA 4KO0A 4G6VB 3I55S 3QLHA 2QMUB 2PC6A 1IKWB 3GV5B 1F0XA 1FNOA 2Y8YA 1M1HA 3P6YC 2AV5A 4RUCA 1RYRA 3LP2B 3G8SA 2CQIA 4OJ3A 4Y3CA 3KUEA 3LALA 4X4NA 4U8VA 1N32F 3J7YU 3ZZUA 4G1IA 4WU3A 4KC5A 1RT7B 1C2PA 1FD8A 5A8KB 3TEGA 2CAJA 2OPQB 2YPYA 2NSBA 4YUDA 1H3DA 1TK0A 4WYWA 4JI3J 4DR4J 4GMKA 4DR5F 2DO0A 4J37A 2P9EA 3FCWA 2P9GA 2PI4A 4EGLA 1RSCA 3DLHA 2DNRA 4FYWB 3JXOA 4WP9A 1VOMA 4QW8A 2ZE2A 5D4OA 3B78A 3DMJB 3PKYA 4X84A 4LF8F 1YIJS 2LYVA 1ZETA 2DNKA 2UVVA 5EHHA 2P9CA 2D1CA 1HPZB 2CWKA 2HK3A 1Q7YT 2YWWA 2ZH8A 1NH8A 1BQXA 5L1LA 3CDWA 2OSRA 5DQIA 1RLCL 4X4TA 3DOLA 2J7WA 1HBUA 5LSLA 2KM8C 1CQNA 1F5AA 3K5OA 2DHSA 5A6WA 5K5MA 2A0FB 3L7OA 5GAGI 2DPIA 2ZH6A 5AJ3F 2DNNA 2WTFA 4DV6J 1S57A 1ZM9A 1DJ0A 5ETSA 2DR8A 3S6EA 4EZ9A 1M5KC 1NBEB 4LFAF 1TL4A 3D7SB 3D6TB 2ALYB 2BJ1A 4HT7A 4Q7AA 3T5LA 2RUGA 4TNOA 4IYQA 4X64J 2DNLA 4ZMMA 1TTHB 4QU6A 1NUEA 3DI6A 2QC3A 3LANA 1RWMB 1F3FA 1RADB 1SXLA 2NR0A 3C19A 4M5GA 2BE7D 2GS8A 3JQJA 2F7VA 2QLXA 2MQOA 5IWAF 4AT1B 3A8KA 3HT0A 1WEXA 3VGVA 1KC8T 3R6GB 3L09A 3TQEA 1VS3A 2BYCA 3D9BA 5E5NA 4TY8B 5C25A 1RTZA 4DR6J 5F0WA 1CG2A 1C0TA 4C11A 2V63A 4B3SF 4W92B 2Z8QA 1TK5A 2WW8A 3EJMA 1W2IA 3WDOA 2YXLA 4DV5J 5KFTA 4DPTA 4OX9J 2B8QA 2XY5A 4V19J 1UJ6A 2B7CB 5KFVA 3ET6A 3NNCA 3MPDA 2CFXA 2QV6A 3KJNB 2AYBA 5LXYA 2KU7A 2MTLA 4CYUB 5E3AA 4ID5B 1FEEA 1FWKA 3FCHA 3QIDA 2A18A 3KJVB 2K7JA 3NGUA 4ILLA 4U96A 4TYBA 5B7WA 3HP6A 4CLFA 4F3OA 4O3NA 2EC0A 1N0UA 1SV5A 3FSYA 4I2PB 1IN0A 3PX6A 4MFBB 2DH9A 3C6TB 3MI7X 4J90A 3WQPA 4A48A 1Y3KA 4KHPF 2E44A 4KT0C 3NS6A 3T9ZA 1N36F 2LQ9A 1O0PA 4PQAA 1PGZA 2IVFB 2R8HA 1NHUA 3MPUB 1OJ4A 3OXFA 1VBXA 3BBCA 4LFBF 1YDLA 3K2YA 3CB4A 3N6MA 4DPYA 3PEHA 1A9NB 2DHAA 1K73T 3ZNJ1 2HVDA 3K5LA 1VQ5S 2MDAA 2L9DA 3OR1B 1K1QA 4HKQA 4DUZJ 3OFFA 4KPYA 2HQDA 1XK8A 4FP9A 2AJ4A 4DSFA 4D3HA 1OIAA 3BH6B 4ECXA 2R7UA 2LKZA 1TKDA 2QG9B 1HI1A 2W8LA 1RDRA 3W9IA 4FVCA 3BPDA 2EPIA 5IXUA 3A13A 1TUVA 3VAIA 3F41A 3JQMA 4DV2F 4J9LA 4OYIA 3SFGA 2GVDB 2B9EA 1MN9A 3R3TA 1D1UA 5L1IA 4UY8T 1CS4B 1E6YA 1VQKS 3BO4A 5F8LA 3D3BJ 3T5JA 1PAEX 4PWDA 1PJ5A 4MIBA 1SQGA 3THPA 2BM1A 3TOQA 1OSCA 3NOCA 1N6QB 2F63A 1VRUB 1Y4ZB 1VJQA 3MEDB 2ACYA 5DZ7A 1KLMB 4JI5J 3UN5A 3AJ2A 1BQNA 2COLA 2D41A 1AUSL 1XJWB 1TKZA 2CQGA 2R2RA 1HFEL 5M2UA 4NZ0A 5L8RC 3QWPA 1X4FA 3R5CA 4K0KF 4DQPA 4JI8F 2NCKL 2C3PA 3AOBA 4CNYA 3J81Y 5DDPC 4JI6J 2Y1JA 2C1EB 2FGCA 5DJBA 1ZAWA 4QZVB 2YH0A 4DMZA 2BJDA 1U1RA 5K8MA 5IM0A 2XI2A 3DGPB 5CYQB 3D6HB 4DQRA 1HNZJ 1IJEB 4UUXA 2O5DA 4HACA 3GWCA 2ZVSA 2KYXA 1NKEA 5EGYA 1RTJA 4I2QA 1T95A 1XC9A 2B6AB 2HHUA 3BYPA 2WB1D 4ZVUB 1K9MT 3BN7A 4N41A 4DSEA 1GNKA 3W2VA 3RAMA 1KVJA 2W1BA 1S6QA 3KG1A 1FKPB 2XULA 3KXDA 3DLBA 3MFIA 5CABA 3PJXA 4DF4A 3EZ5A 2ZH3A 3TZWA 1OO0B 3IWNC 3T41A 3D66A 2GIRA 4ECVA 3BKTA 2AT1B 5A2QU 2FVPA 3IGVA 1VQNS 4ZVRB 4PUOA 3GFYA 2ZHAA 3QGPA 4NX9A 2ZBPA 2CPZA 4RU2A 4ZKAA 2RQCA 4F8RA 4I68A 2UXCJ 2I5JA 2P6SA 4C97A 1BC6A 1X5TA 5T7LB 4ENOA 2GNKA 1K1SA 1V5VA 2XMWA 2IRUA 5D4NA 1FESA 2PEHA 4BCAA 2MKHA 2DKOB 1LFWA 1TAQA 2E5GA 4OZLA 2HNZB 4QWBA 1X4AA 5THWA 1F2GA 3M30A 2VFRA 3MD3A 2R7XA 1S97A 4NCBA 2VQFJ 1VK3A 5HLFA 4C8YA 2GX8A 1WOOA 4X65J 4P6QA 4FF2A 4WK3A 3KHGA 3NCQA 3V6DB 2M2BA 2ZVIA 4WP8A 1C0UB 2GJ2A 2VBYA 3OPKA 3BV8A 3RB3A 1JLFA 3J7ZT 2FZKB 3DLKB 4IFVB 3QO9A 4OV1A 3W62A 2NXCA 2F4VJ 4NRTA 2ZDOA 3CULA 1TFWA 2VQEF 3I9ZA 4M5HA 1VQYA 5HN0A 4LF1A 1JLCA 4ZVSB 2I8EA 1HR0F 1SQEA 1DHMA 4KIAA 1QY7A 4OMFG 1Q79A 2J8AA 3D67A 4KGXB 4OI3A 2UP1A 3FC9A 1HI0P 2GMJA 2XEXA 2ZHOA 3ENAA 4NYOA 5KFXA 2QX0A 4IQMA 4LF9F 2WVFA 5FDLA 1AROP 4KHMA 1QJHA 4WFAQ 5HMXA 4LFCF 1NJWA 4G3IA 1GFWB 3EE3A 1WF2A 4ZJQA 4F02A 4B3TJ 2FY1A 5F9LA 1MMNA 4DUYF 1TQLA 1SJFA 1NNDA 4CLLA 4ED3A 1RTIB 4WFXA 4LR7A 4K4TA 3PXGa 2DNGA 2AW0A 4IOAQ 1U2CA 1T9XA 1L3KA 3HHKA 4UF4A 2FC8A 4HT5A 1KQGB 1SKWA 2X1FA 3RB6A 2V9KA 3A3OB 4YR3A 1NZ8A 3CJQA 3E8OA 2UXDF 1N33F 1J5OB 5C5JA 4A4JA 3VAHA 5LT5A 1C4AA 3AJ1A 4DV4J 3MCOA 4X4PA 1OY9A 2VBZA 1HWKA 1VQ7S 5JVGQ 2VF3A 4WJBA 4YEAA 3DOLB 2D9OA 4QIGA 1RAFB 1HBUB 4KAIA 2E7WA 1ZAVA 4URGA 2C2MB 2BW2A 3HD2A 3SCIE 2VIHA 1X7VA 2CJQA 3UD3P 5D8HB 3RRGA 3AY0A 5E2QA 1PBAA 4PKDB 1MSWD 1FERA 1HNIA 2YKQA 5D77A 3BPSP 3HLUA 1IKVA 3CJ3A 2DHGA 2HS3A 3ILJA 3SIPB 3H2VE 2C2ZB 2KRRA 2HVEA 1G4CA 1FVSA 4ZVTB 2N82B 5I42A 4HDGA 1B4SA 4OI6A 4Y2CA 3RW7A 4MK8A 4CO4A 1N56A 1T7PA 2JLGA 3BO2A 3I56S 4F4ZA 4DR2J 1K0VA 3HM9A 2XMKA 1UMJA 1KHWA 5LL6d 2XY6A 5F8MA 1XTZA 4G65A 4C11B 3BQ0A 4WIQA 5B0FA 2QFIA 1VRTA 3HFZB 2WAQD 3DNCA 4OJHA 4ED6A 1XR5A 3DHXA 1RZMA 2DGQA 3TJAA 4HHHA 4WKYA 5AXNA 4YB1P 2KTQA 1S77D 2OHDA 4RUBA 2DNZA 4RO0A 3WBZA 3GIJA 3IMQJ 5DM7Q 3HVTB 5KFWA 1DY3A 5CZVA 5G0RA 2ASJA 3D28A 4M5JA 1XR6A 2FYXA 2BXJA 2BQ3A 4ZVPB 1R0AB 4URQU 3CD7A 4PYDA 1U0HB 2ROEA 1WELA 1DLOA 4P2XA 2HZCA 1EQ0A 2RQKA 1TL1A 1CJUB 4EFAC 4QJVA 2R9LA 3HT3A 4DEZA 3TX8A 2L48A 2H51B 3J80Y 5ITHA 3R2DJ 1WHXA 3KTQA 1QM9A 1XN9A 1AZSA 3BDPA 3TEHB 2R8IA 3TUZC 1Q5YA 4A8SA 2CQHA 4ES1A 4JYAJ 3H90A 1AW0A 4YP3A 2ASLA 1UEKA 1R8AA 2OD4A 4CLKA 2IMOA 1UPMB 4F2RA 2ZFHA 2CZ9A 2F8HA 1YJRA 4PG6A 2WZ1A 2ADCA 1R8CA 3JTPA 2PFFB 2AZ3A 4UOFA 3DDKA 1PG5B 2HPUA 1L3SA 5DGBA 5HMWA 4K2XA 1NHKL 1SUQA 3KLIA 3KLVA 3CC7S 2RDJA 3LP0B 4O0NA 1HNXF 1VQSA 1HMVB 3A3PB 4NXNF 2HMIA 3P49B 3ILLA 5DQHA 3FBEA 1FXLA 1MU2A 2B9YA 1RT5B 3FGVA 2HFOA 1S72S 1UZHA 4KY3A 1QDUB 4PZVA 4PG8A 1RA7A 1EETA 4ZVHA 3V5RA 4PWDB 5AXMA 1HNWF 4X4OA 1U8SA 4O3OA 2FGOA 4OI4A 4ECQA 5GAHI 3K5NA 4B9TA 4CI0B 4FS2A 3FMWA 3QRPA 3A1YG 3LAMA 3QRQA 3DRSA 4K4YA 3M2UA 1FRKA 1TKZB 2PT0A 3FJ2A 3IBFB 3VGUA 3NP5A 2JC0A 2IC3B 3OTBA 1U1PA 3TI0A 1BLUA 4X2BA 5KFBA 5A0YA 1RHUB 3Q2TC 3DU5A 4KKOA 1WKKA 3GP9A 1IXKA 1CJTB 1KFDA 5DO2A 1DARA 2OTLS 1NXIA 4DR1J 4YY3J 3UN2A 1VI7A 3VF0B 1J5EF 4HACB 4Q2MA 5D0HA 2L9NA 3PJWA 4UOHA 1NPPA 4AFFA 4B9MA 4FF1A 1VYAA 3QGIA 3CDUA 3FBBA 1TL3A 4C9DA 2MQNA 2R7RA 3QNWB 1NHVA 3OJSA 4I2QB 2DPJA 3QJJA 4ECRA 2O01C 2C3MA 3QAEA 1S9GB 1FHTA 2YNHB 3AOCA 2O67A 1I1GA 5B0CA 2H5JB 3W2VB 1FXRA 1V3RA 3R5AA 4JB8B 2LECA 1RE1B 2HHWA 2IYGA 3N01A 3PRDA 2YKAA 3W7BA 2BKOA 4DR3F 4C2MA 3CMAS 4S0MA 1AUDA 1NEEA 4JI1J 1OPZA 2IMWP 3T6JA 2X51A 1B0TA 1ICEB 3Q86A 4Q43A 4A8YA 4DL7A 2CIMA 2W9CB 1TUWA 3CO9A 1R27B 3IRXA 3IBWA 2HVHA 3HHLA 2F1FA 3RGIA 4KH1B 1HBNB 3ZTOA 2XLIA 3W61A 2BJ8A 1LW2A 1W7WA 4U95A 1YZ7A 1SL0A 2NZ4A 2IM1A 4UZCA 1CBKA 4DS4A 3QMQA 2RHQB 3GIKA 2H5EA 2IHR1 1DQAA 2VOOA 3U02A 1M5OC 1EQMA 3NAIA 1XNRJ 2LDIA 2XO6A 1VHIA 1WF0A 3SQGB 1VQ6S 5FLXY 1X31C 3CJ0A 3ZXWA 1HLWA 1Q8BA 4ILRA 2RUSA 1FT8A 4OX8A 5KFEA 2G2OA 2WCXA 3T1HJ 1QUVA 3M30B 2HGMA 1OY8A 1S7HA 3HFVA 4DV7F 2E1RA 4FXDA 3PO4A 5HLFB 3BSCA 4X4SA 1NAQA 4EBEA 2PA3A 2XGQA 2QL5B 3G8QA 1IR2A 4H54A 2OEKA 3E2EA 2XSJB 2GJFA 2W7OA 1VMBA 3UCUP 2CWXA 2HNYB 4PXCA 1JLFB 4HH1A 1EZZB 2J0WA 1IBLJ 3VAMA 1RACB 2VDHA 3ZZOA 1U48A 3K5PA 3DRRB 2QEXS 3BR9A 3KOAA 5A8WB 4J9RA 1JLCB 3IM8A 4JI3F 1HYSB 3CSKA 4ICLB 4DR4F 4LSNB 1D9FA 4LSLA 4LR9A 1YBUA 1U0SA 5B0GA 2ILZA 2QL9B 4IH7A 2HBRB 4O44B 1P8GA 3CTRA 5KT5A 1IQZA 2D3ZA 4Y2MA 4H4MB 2NXUA 1YVFA 4P73A 1SJ3P 2VB6A 2C22A 2JHEA 1Y0HA 5FDLB 2I0XA 1DQ9A 2DNYA 1TVRA 3NNAA 4JI4J 1JLBB 1DTTA 2CPHA 4QWEA 2CNOB 3BH7B 4HLBA 2MLZA 4OHXA 3CUNA 3RG6A 1D0EA 4WE1B 3UDLA 4C8OA 2IBOA 2V2VA 3W5YA 3OLAA 3WIUA 2GIQA 1Q4RA 2FHKA 3W8GA 1S1XB 2YNFA 4WTOB 1KWMA 2KT2A 3PRBA 2HQFA 1FRMA 3ZZTA 4P2MA 2YH1A 1WC0A 1HHQA 1LW0A 2AX0A 3GE9A 4P7TA 3LPEA 4DU8A 3UVJB 3JB9k 2W9BA 1U6BA 4DV6F 2CZVC 3ETOA 4HEA9 3I0SB 3OL8A 4P7VA 2Y0SD 2AP6A 2UV8A 2EG2A 3X1LB 1WORA 1Q5VA 5CA5A 5DETA 1T94A 1RAJA 4J91A 2N4DA 2CJ9A 3OVSA 5IV3A 3C6UB 4X64F 1C1BA 1ZTTA 1WACA 2CJXB 2WVCA 2MZSA 3TJ8A 3BKFA 2F4FA 2OSQA 1C1CA 2MPUA 5KFQA 4EZ6A 3MCMA 3CT9A 4PR6A 3HFKA 3M6WA 3TW0A 1R6YA 3DM2B 1O51A 2A6OA 3EDQB 1HBOA 3TAQA 4BHQA 3DXSX 2YKNB 3JTNA 4CRJA 2BABA 5L39A 4IR9A 2BDPA 3H25A 4IFYB 2LP4A 3QT6A 3DLEA 2MQ8A 4DR6F 2E7VA 2CVEA 2RB7A 1I94J 3L7UA 3B6BA 2MHEA 2VD3A 2LQJA 1HNVB 2YWGA 4OX9F 4KGVB 1PSDA 3TX0A 2AWZA 1RWOB 5IC6B 5I42B 5K8OA 5H1SV 3QT8A 3UD4P 3LAKA 4LF5J 1WTBA 3QPIA 2C2EA 3I87A 2FQQB 4DV1J 1QTNB 3DRYA 3O1LA 1VQPS 4DI6A 1JNZB 4MK9A 2D9PA 3SZ2A 2J9DE 2RRBA 2DCLA 2VG5B 2LXFA 2YNIA 4ZVGA 4DZ6A 4ECUA 2HZVA 4IKAA 2HG4A 3MEGA 1UW4A 3DLLQ 4EYHB 1RT1A 5CYMA 4ED5A 2HNDB 5CHCB 3QSYB 1YK9A 2VG6A 2UUWA 3T19A 3D1OA 1M0SA 3QYYA 5H9EK 2MB0B 3CMQA 5DG9A 2VPWB 3FDSA 4J5OA 4QW9A 2DISA 3PM9A 1YRXA 3ILOA 3PYDA 2HFSA 4QYZK 1HL6A 4CH0S 4L75A 1S9FA 5IT9U 4ANCA 1ZYQA 4FS1A 4I4BA 2CPFA 3A12A 2IA6A 2VHGA 2B5JA 2MQMA 2YPZA 4C0HA 1U1QA 2DEIA 5HBMA 4ANDA 1YX2A 1TMJA 2BQRA 2GHWA 4ETXA 4NLSA 3F0NA 2P6TA 4DL0C 4EBCA 1U1NA 1Y5IB 3IS9A 3PFOA 1JMTA 3G82A 2M8DB 1IBKJ 4HHJA 2EFVA 2MZRA 1QE1A 3IRWP 3I5AA 4DSJA 4XO0A 2PEBA 3GMGA 1B7YB 3B8HA 4ZOSA 1NK9A 1UKUA 4ZDNA 3MM6A 4EO8A 2IDEA 1RWPB 4JOUA 4JI5F 2XNRA 1FXDA 3CCES 2D7SA 2LEBA 1M1GA 4NL5A 3MR3A 2HAFA 4CLPA 1BY9A 4O3QA 3TQ1A 3HZEA 4NYPA 2IDLA 1VBKA 3PVXA 1MU2B 4DXLA 1PJ6A 3X3UA 4JI6F 5DDRC 4Q8FA 3T6BA 5J1EB 2Z2ZA 1UFKA 1HIYA 2AZ1A 5F41A 2YKMB 1RUSA 3ZZZA 4CO3A 5H9EJ 1HNZF 2W9AA 1S6PB 3VHQA 2J6UA 3EPGA 4F3QA 1GMWD 3H5XA 4OHWA 4M95A 1S79A 3QGHA 4K4WA 2BR0A 1RU2A 2RF2A 5SZTA 1MROA 4QYZJ 3DRSB 5JVHQ 5DLGA 4O4GB 4H4KA 4JI0J 4RNNA 3MOJB 2YQ3A 1S4EA 2XC9A 2QTWA 2XM3A 5A76A 4ED2A 3OW2R 4NXMF 1DRZA 3HJFA 4UUWA 3PKMA 1PYTA 5KFSA 2HVIA 4ZK7M 3DDIA 2ALZA 2C2DA 4FYYB 1FFGB 4FDFA 2UU9J 3LGHA 5KFGA 4F3MA 1QSSA 2OLWA 3ZFVA 1Y00A 4H4OA 4ECSA 2MJUA 2WOMB 1NK6A 4WZMA 3SMZA 2IM0A 3CF5Q 3UQSA 3D5MA 5AE2A 2PO4A 2PE8A 1S1TB 2IYIA 2UXCF 3LP2A 2QA4G 3EVMA 1D09B 3T5KA 1D8ZA 4P52A 3AFGA 1JJ2R 4OYOA 2R2UA 3CCSS 4PG5A 5CXTA 4KFBA 1SVDA 1FFSB 1SJQA 2WBRA 5KFHA 1RT7A 1CC7A 2HW3A 1FRIA 5A8KA 1SKSA 2DR6A 3AXKA 2HFNA 4AXIA 2J76E 3IRXB 3NWRA 3N6LA 4I64A 2QA2A 1WC6A 1LW2B 4EYIB 4L6V3 1T03B 4DWIA 4ZPCA 2VQFF 1S1UB 2ZNYA 2D3O1 3HVRA 1P6TA 5F0UA 4X65F 4ED4A 2AEJA 1SKUB 3BZQA 3U7JA 1Y11A 2ZC4A 2CQ0A 2F8EX 1I6JA 4DPOA 1PIEA 2F40A 3DMJA 2ZH1A 3G6XA 1Y10A 1RYSA 2ROGA 2F4VF 5ETMA 4ZP8A 2ROPA 3W63A 3C66A 4C48A 5C2CA 4B9NA 4OV6A 4LVOP 3W2WB 3IR5B 4MH8A 3O3LA 2KZMA 2FLLA 2XYGB 2YWEA 3EX7B 8AT1B 2HWIA 3PEJA 3HD1A 3UR0A 3PYGA 2H3EB 4EO6A 5FJ4A 3H42A 3NBPB 4MYTA 2FB0A 3WZ0A 3PIOQ 1YSJA 3HPOA 3VVTA 3M9MB 3JAMY 5M2PA 3MD1A 3MMAA 3V6JA 2ZZNA 1VIXA 3PR5B 3LTOA 3MEEB 3UE2A 2V2KA 2IM3A 1LNQA 1RISA 4B3MJ 2F3JA 3FNNA 2QSWA 4F4WA 3IG1B 4USTA 4HTJA 3AT1B 4B3TF 2Z2YB 2VBXA 4DCOB 1S10A 2YQ0A 4LSLB 2Y9HA 3ZZPA 3BQ1A 2G2YA 3GB0A 4A47A 1KVIA 1JQGA 3W66A 4FKYA 3FEYB 1LV5A 3PZPA 1OMSA 4RU9A 1NPRA 2XG8A 3MM8A 3K58A 4A8QA 2DGTA 4Z2XA 3CCUS 5HP1A 1ZOTA 1DTTB 1RCXB 4ZP7A 1U49A 3UCGA 4RW4B 4AD6A 4YB6A 3MM7A 3IO1A 1H2TZ 2V4QA 1NK0A 4YOEA 4UY85 3Q8YA 2IJFA 3C3LA 3UN3A 1U09A 4DV4F 4LF7J 4OX7A 4FF4A 2C28A 1UA0A 3CEDA 2J0XA 4J9VA 1U02A 3THVA 2NPIA 2YNFB 2VJVA 2QN6B 5U47A 2MGZB 5EWFA 5BR8J 3QIPB 2KVQE 4ID5A 3GG0A 3S1TA 1Q1KA 1RT3B 1ZZFA 4MYUA 4IH5A 4ZLJA 2K3IA 2UVUA 1GMUA 1T9TA 1LOUA 1LXNA 3GCWP 3Q8VA 4B02A 4DUTA 2L41A 2M5YA 4R5PB 4BDPA 2XMMA 3AQOA 4I2PA 2VZ9A 3W65A 1J27A 1RAGB 3KFWX 3HVWA 1PILA 4ZCLA 2HHQA 2BUNA 3MM9B 3ADAC 1YZ6A 2Y0BB 4UTGA 3D6MB 4MKBA 3IA0A 1Q7LB 3C6TA 2V69A 4K4XA 1HQEA 1VISA 5K8NA 3NEKA 4RWWA 4QBUA 1U25A 3UD5A 1MWYA 2LMIA 3R7NB 4DU7A 1BQMA 5F9NA 2OFHX 2OJ3A 3LQVA 1V3SA 2N7YA 4RWXA 4DR2F 5ADZA 2QSFA 5K9FA 4G1QA 2F8MA 5D4PA 3B82A 2YKPA 3G87A 3OR1A 3JYTA 1LK7A 1HWLA 4O3SA 1E6VB 2VPYB 1B3TA 4IRKA 2KG1A 4QIVA 5LMUJ 2DB1A 4NA2A 2JNJA 4ZLNA 1RI7A 1YHQS 3GSIA 1OQ6A 1UZDA 1XWLA 1OPIA 3PO5A 3JQKA 4P75A 4JI2F 2J5AA 2YX7A 2AYGA 3KLFA 4PG7A 5C2GA 1IBCB 5ETNA 4CCHA 4OYBA 2GVDA 2YNIB 1RTDB 4LF6J 3VAJA 1N32J 1S6UA 1CS4A 4LT6A 1GXTA 3Q22A 3MEGB 2BX6A 3M6UA 5H9FK 4WFBQ 1N6QA 2VA2A 3MEDA 3L4BC 4QPTA 4DQIA 2ZH2A 2A3JA 4J9OA 1F3VA 4B3RJ 1KLMA 4F26A 1IBMF 2POKA 2VG6B 3KWMA 2FVQA 2C3YA 2Z58B 3BGRB 1F6TA 1EX8A 2BMBA 5ETKA 3WX4A 3AA8A 4I6AA 3CXCR 1RT4B 4PPDA 3BSOA 2R2TA 7FD1A 2UVWA 3GJTB 1NZAA 2OMOA 4C8MA 3TUJC 5F8GA 2ATLA 2MZTA 4N76A 4LF8J 3K5MA 3DGPA 5CYQA 1SPBP 2RQMA 1FNMA 1JJCB 2B5JB 3J7Z5 3CJ4A 2FJWA 5I3UB 4O23A 3Q8UA 3BQ2A 2XB2D 3VQSA 3VV2B 3Q23A 2XLJA 2ZZMA 4DV3F 1PYOB 3POTB 3MTJA 5IZHA 2Q1LA 2XS5A 1VBYA 5RUBA 3BSAA 2A2CA 2UV8G 2B6AA 2DHXA 1O8BA 3DN9A 5KFZA 1TL7B 4MAKA 4KPCA 4NLQA 2QO3A 2ZEJA 4LBHA 3I0RA 3Q89A 2UUCJ 1GMWA 5HJYA 2V4JB 2KDOA 2PMWA 2GW8A 2XWYA 4DFMA 1QE1B 5KFIA 1JJHA 4DX6A 4LFAJ 1TELA 4M5DB 3BSNA 2XS2A 4TN2A 1UA1A 2ASYA 5ETVA 1HQUB 4BC7A 1G3OA 2CQBA 1FJCA 5K14B 1NDKA 4LIWA 2KG0A 1CJKB 2JEJA 4DR7J 2WW4A 2U1AA 2N3LA 5H9FJ 2HSEB 1RWUA 4OLPA 2YWHA 4OQJA 3I5CA 2KKHA 1HWJA 4OYXA 3EGNA 1P27B 2AMCB 2M4MA 3PX4A 3DLGB 4WTYA 5D78A 4YDDB 5LXRA 3GJSB 4F0MA 4DR1F 3HSDA 2I9SA 4YY3F 1N34J 2LLZA 1A0OB 3OJUA 1ACMB 2K1RA 3M6XA 2CXEA 2ZWOA 4IRDA 2B4PA 4CLTA 3ZTSA 3GYXB 2FD2A 1YGYA 4WFNQ 1RHMB 2HNZA 2XZTB 2RF2B 2XMJA 5E3CA 3MMJA 4WYLA 3GONA 4A46A 4URSA 3KK2B 1JXEA 2HS0A 2FHJD 2VFTA 2PGCA 5IQQA 2B0GA 4G1PA 2JLEA 3VALA 4WZQA 3D4JA 3U27A 1GEHA 1KSPA 2SXLA 5EWEA 1ZA2B 3EXYA 2VPXB 1C0UA 1GQEA 3CJKB 3KHRA 2NYIA 2H1YA 4JV5J 4JI1F 3DLKA 4IFVA 5C24A 1XEZA 2DK2A 2FLNA 2P2CB 1JB0C 4DS5A 1CQMA 3J7YI 2R7QA 4H4OB 4CT9A 2HLUA 4LJMA 4B9LA 4KJIA 2JL9A 1S12A 1QUPA 1KR4A 2V4RA 3IBCB 1VQMS 1IM4A 3U1MA 5EDWA 3UDVA 4OZNA 3NOGA 2FZGB 3MR7A 2HEKA 2Q43A 2W01A 4OZJA 3G71S 1TAUA 5T41A 2ZD1A 3D0IE 4X62J 1RAHB 2MKKA 2A1BA 3PJ9A 4WWSA 3GTYX 4KFBB 3CC2S 3ISZA 1XNRF 2MQQA 4LFBJ 1NKCA 2J6SA 5KFJA 3RUBL 1H98A 4LREA 1MN7A 3US5A 3P8BB 1Q81T 4NLGA 4KV8B 9RUBA 1NSQA 3T1HF 4N47A 1O5JA 1NJYA 2DVIA 1RT2B 1ZBTA 1WEZA 5IT4A 1RTIA 3W1YC 2HHTA 2RILA 2UUTA 1EP4A 2DXDA 3KG0A 2ZJRQ 2EK6A 2GA7A 2LCWA 3BBBA 4OYMA 9ATCB 3HX9A 2FJAB 4IO9Q 4V19X 1NB2A 2GCFA 4GVBB 1D8YA 2YWKA 1YQHA 4XIUA 1DQ8A 2VODA 3MAHA 4F0KA 4DV2J 1OYDA 4YMEA 4YHHJ 2F65A 3V6HA 2C2OB 5D0RA 4GKJJ 1J5OA 3FEXB 4X4UA 3K17A 2YNGB 3ONQA 1U2RA 3SCLE 3UI3A 1HWUA 4U9RA 1I5OB 3QJPA 2BM0A 2BRKA 3GSDA 5DLFA 3GG1A 3GFXA 5KG5A 1VC0A 4QIWD 4HI2A 3FFIA 4NA1A 2JFKA 2NQPA 2CPYA 1Q16B 1MNEA 4FNIA 4DL2A 1YJ9S 1QVFR 3P3DA 5IFMA 3PRVA 1QSYA 2EVZA 2RH3A 3D3CJ 1UVLA 1SIWB 3ZZRA 3M8WA 3OHAA 4C3KA 4FXVA 3MMAB 1M5VC 2Y1LB 4IG0B 3B4DA 2CUYA 4JI4F 2KFYA 2X1AA 3M2RB 1JLGB 4PYAA 1NMEB 4USHA 1H38A 3RW6A 5B08A 1X5SA 2P5VA 2DNMA 3P45B 4TLRA 3P5BP 4XDCA 3EZUA 1HKAA 2BOAA 2CQDA 5BYSA 3MAQA 2KFNA 3KG4A 2CQ4A 3MM8B 1NK4A 5HAOA 4OZ2A 3MMBB 5L9XA 1FF2A 2OPSA 5B0BA 3ZTPA 5KT2A 4N5SA 1S59A 1K8AT 1KTQA 2L08A 5HP1B 1K47A 4FBTA 5HQMA 3U1NA 4ED1A 3KMSA 1RWWB 1QAYA 1RK8A 2V8HA 3MM7B 2VONA 1R3NA 3VCDA 1G2EA 2IRXA 3NGKA 4CLYA 1X5PA 1MG7A 3W60A 3KK3A 4LRAA 3K57A 3BR8A 2GJIA 2WONB 1R8PA 3PW2A 1EAYC 3GIIA 1UJ5A 4AUKA 3PTWA 3MUVP 2CPDA 3HVTA 4UT4A 1MW7A 2KI2A 3V6KA 2DRAA 1BE4A 1YKWA 3PY8A 2BACA 1R0AA 3BO3A 1U0HA 5CCMA 3H40A 1MWQA 1W26A 4A8WA 1D3WA 4USJC 1RLDA 2E5HA 3QZ8A 1CJUA 2W2QP 2ZOGA 1S9EA 3CD6S 1HQEB 3MECA 5L46A 3LUYA 1JK9B 1WI6A 2I1RA 1WG5A 4W4MA 3NAHA 1F9FA 3MM5B 1REGX 2VJUA 3RJMB 2VOPA 3WHIA 1MMDA 2AJ0A 1BQMB 2ADBA 4ALZA 2ZC3A 2FJXA 5KFNA 4RL1A 5HQ8A 4WIIA 1SH3A 3I96A 1TUGB 1B99A 4P10A 2X3DA 3M2VB 5HATA 3TP2A 3DC2A 4IOCQ 2IM2A 4G1QB 2A6MA 4ZA1A 2FIUA 4XDDA 2HAIA 2R7VA 3LW5C 2HIYA 2XWXA 3FCVA 3LP1B 3JYTB 2IAJB 1DZ5A 1IUJA 1VQ4S 5KT4A 2DCUB 2VICA 3W5ZA 5D0EA 4O0IA 4C0OC 4QOTA 3LWMA 1P9YA 2EK1A 3OTOJ 2CJKA 2VQEJ 3DU6A 3TNVA 2HRUA 3LP0A 3UCZP 1HMVA 4RNFA 4CNZA 3OTEA 4YB5A 3CIMA 3KLFB 3M8QA 4UOCA 3EM1A 3MCSA 4ZLLA 2EBGA 1VLOA 3VZIA 1OYEA 4CM2A 3NGTA 3OUYB 3DGVA 1RT5A 2OUGA 3IGNA 2Z0GA 4OHYA 2DR9A 2QRRA 3R1HA 4HDHA 4DL4A 3RAXA 4HL9A 1TP7A 4LFCJ 1RAAB 1GX6A 3OFHA 1Y9OA 2RDIA 2BJ9A 4B3OA 3MR6A 2F9JA 2CPXA 1RT6B 1U26A 2IC3A 3JAMU 3CVKA 1F5CA 1NJIT 3L7PA 3UPFA 2A2DA 2V68A 1VC5A 1WC5A 4BWJA 3ZTQA 2R7SA 1CJTA 2JRSA 1JKHB 2QZ8A 3OQ2A 4DV0J 2WVEA 2XI3A 1IBKF 1U1LA 1S0MA 4D3GA 2UXDJ 3RR8A 4Y2IA 1N33J 5GMEA 3MCNA 2Z57B 2BQUA 4DX5A 4QR1A 2E7XA 3SI8A 2RD5C 2DH7A 4I7FB 3FQKA 2K06A 3MZIA 3PCOB 1VCTA 2Z30B 3TAPA 4ES2A 3FMBA 4XAKA 1S9GA 2YNHA 3LO3A 2HFZA 2VFVA 4ECTA 3I0RB 4DFKA 4AQYJ 2HHXA 5KT7A 1TU0B 1JLEB 4X4QA 1FK9B 4CO5A 3UW1A 1IR0A 2FHJA 3TAMB 3H5YA 4ZVQB 4RUHA 2YVSA 2W9CA 1WD6A 5ETPA 2KFZA 1ZAXA 5JXSA 4KR0B 4ZHRB 1HBNA 2NXEA 4X4VA 2G0IA 2PFDA 5IV4A 4JI0F 3SBMA 1ZS6A 1IWGA 3CE8A 2I2YA 4C3LA 3N28A 4ZN3A 1CPZA 4OZ0A 1RP5A 5A2QY 3H5UA 4ZIWA 4LQ9A 2AQ4A 1S0VA 3OSPA 5CQGA 5HANA 1JLQB 3SQGA 2DIVA 2K1RB 4P72A 4QCLA 5J2QB 1APSA 2UU9F 1N48A 4M8LA 2LQBA 3Q24A 4I6WA 3Q8RB 2KVIA 5KG0A 2FJBB 3HHLC 2R7WA 1WWHA 3PW0A 1PO6A 2UXBJ 3MFHA 5F3TA 3L3CA 1YJUA 3MOZA 3N0VA 1EARA 1WSVA 2MKYA 5DDOC 5BJRA 3TARA 3V4IA 2ZBIA 3EPIA 3Q2SC 2XSJA 2EFOA 4K2JA 5GMDA 4ZCMA 2LEAA 2WSFC 4KE5A 2HNYA 4C4WA 2EG1A 1RB0A 2EFNA 4U8YA 5C24B 1Z1ZA 5KFPA 2ZM6J 1UVKA 2A10A 2JFDA 4IQXA 1TV6B 4A8KA 2IRYA 3DRRA 4M63A 3QSIA 5A8WA 2RRAA 3A4TA 2LEPA 3V81A 1HYSA 4ICLA 4LSNA 3IN5A 3T9NA 4TXSA 2VG7A 3W8PA 4ZPAA 4MJKA 3E01B 3FRZA 3MWBA 4O44A 2YWFA 2ZITA 2GO9A 4H4MA 2HGNA 3UWTA 2ZD1B 2V8GA 4NLWA 2IJNA 5B0EA 2JVRA 3P96A 1H2VZ 4DFJA 4MIAA 5G4DA 2Q66A 4DJBA 3MHYA 4L3KA 1LWEB 2DY9A 2KYZA 2MZ1A 3GZ7A 1JLBA 5B0DA 2I38A 2GVZA 5GMKa 3SYZA 2HLTA 3QAUA 4DOZA 2NLWA 1OQ3A 1OWXA 3M9OB 3GCXP 2EWHA 2JEIA 3SV3A 4WE1A 5D3GB 3CCTA 4CT8A 4XTTA 4UOGA 1XMOJ 4EI2A 1EP4B 2O3DA 3IM9A 5MLCV 3OHBA 3M05A 2W4DA 1HNXJ 1R8HA 5LMNF 1S1XA 2KJWA 3FK4A 4C8LA 5AE1A 1T9UA 3HCXA 2EXUA 3OXGA 2IY5B 4OHZA 3UVJA 4DLGA 2EKNA 4CH7A 1HW9A 4AL6A 3I0SA 2DY1A 4BLGA 2ZBQA 3OSNA 3PACA 1B0PA 1SCJB 3UFCX 5J2NA 4B3MF 3ISNC 1NDLA 3EXCX 3C6UA 4P74A 4A8OA 2V2QA 3MMCA 2QYCA 2CPJA 3FFIB 1F9EB 3D2WA 2OEMA 2LQ5A 3A8EA 2ZOFA 3OFGA 4A8MP 1G1XA 4WCEQ 2HQ3A 1VFJA 1U2FA 5IC4B 2XCPA 3DM2A 2RKIB 2IJRA 1LQ9A 3H2LA 4OYAA 3S8SA 3EGVA 2YKNA 1BGXT 3OV7A 2E1PA 5KG1A 3NXZA 3G86A 4IFYA 2B9WA 4E0DA 3LF0A 1NCLA 3BS9A 2QMWA 3SFUA 4P9SA 2Q79A 4QYRA 1EHWA 4CQ1A 1WI8A 1WNEA 3R6LB 5E41A 1HNVA 4LF7F 2X1BA 4PXBA 2DHHA 3EVWA 4RBTA 1Y3JA 2ZWPA 2QLBB 3M8SA 4RW8A 2WRMA 3BF4A 5BR8F 3UNGC 3IWLA 4JV2A 4DFPA 4M1KA 4RW6B 2OPSB 3K8WA 5L1KA 5HROA 1H2UX 2VG5A 3FUYA 1EIYB 1FD2A 4WXOA 2M7SA 5A6PA 1XR7A 4GVLA 3DRPB 4OI1A 4BBYA 1N0VC 2BRLA 3KK3B 2OFGX 2FPHX 3OFEA 3NKYA 3DOKB 5B0AA 2HNDA 2NXJA 1T9VA 3O6QA 2RSQA 2VH7A 2JDJA 1KHVA 3DYAA 5HMZA 1SQFA 1UETA 4ANEA 3CJ5A 3GJRB 2OAUA 4P2SA 2EFQA 2XBPA 4CO2A 3SV4A 3HHDA 2ZHBA 1VGYA 3VAFA 1HW8A 1T0TV 2R7OA 1NK8A 2GQ2A 2AJ2A 3I9V9 3GR0A 2BA9A 1BHNA 1S9EB 3SSSA 1GMVA 2FHMA 3QFHA 1HA1A 1TMMA 3CCQS 1PAUB 3MECB 5KFCA 3D6FB 5LMUF 4Q0BA 1IJFB 1LWFB 4DV7J 2ZJPQ 2O66A 1S1WA 4I67A 3SXLA 2MZQA 2FVSA 4DN9A 2QIFA 5L9NA 2ZDPA 2VUGA 5CYJA 2VC0A 5B09A 4NE9C 5E33A 4M5KA 3R9LA 1B7FA 3WC2A 1WG4A 4I56A 4LF6F 3BGLA 3M4XA 1GTEA 2EEYA 2Y8WA 3A8JA 4NLUA 2DGSA 1X4EA 5LJ3Y 1LWXA 5J2MB 3I82A 1S4FA 3AB4B 1L3VA 4IG3B 3HKZD 1EJ7L 1ZH5A 4ZP6A 4ZVOB 4B9VA 1UFWA 4B3RF 2D3UA 4NLVA 3TVZA 4RUAA 2E5LJ 1IWAA 4NOHA 2QLJB 2CADA 3PYFA 1R43A 3M8QB 2IPOB 2CQ1A 4I1TA 2DTJA 3H98A 4CLSA 3R5DA 1YWXA 5J1EA 4C6AA 2ZKTA 4RKUC 5AXLA 3VVUA 3SCJE 3CCWA 2M88A 1HBMB 1D9AA 2YKMA 3PDNA 3AJDA 1JX4A 1N5VA 1HHTP 1S6PA 4DF8A 2AEMA 2PA8D 2Z2MA 1M5PC 2HBYB 1JXVA 4R0EA 2FTRA 3KKFA 1HHSA 1XERA 1BWEA 2FDNA 4NPOA 3IAS9 1XMBA 4B3OB 4O4GA 2Y1IA 4RW7B 1X5OA 1IKYB 2MQPA 3LPYA 3N6NA 4LF2A 3OL6A 1H7WA 2XHWA 3VGSA 3CDAA 1PCAA 2GMHA 3AA9A 3S7RA 3ENWA 3TJ9A 2XYPB 2UUCF 5D4LA 1AB8A 1NH7A 1VBZA 2C42A 1DTQB 1H7XA 4HTIA 1T05A 4PQUA 3ETMA 2VASA 1S99A 3K8VA 4NEYA 3ENQA 2V50A 2HWTA 2R8GA 1QLNA 1FJGF 2J0SD 4NCAA 2WOMA 2FZCB 1TK8A 1S6OA 2HIQA 4ED7A 1FI4A 3KK1B 4H4KC 3FSXA 3DDNA 4DR7F 4M94A 5GAGU 1UCNA 5GVQA 3NGSA 2JEFA 3OR2A 2JX2A 2XY7A 1S1TA 1T9WA 1WJ9A 3K59A 4DX8H 4O3PA 4DPWA 3NWGA 3SCKE 2CJYB 2B7BB 3OBIA 4FYVB 2R7TA 2LU2A 1N34F 1A6LA 2KXHA 3THTA 4Q44A 2XMVA 4FKXA 1FDAA 5KFRA 2Q6BA 5KFOA 2CYYA 2Z4PA 3K7RA 4MT1A 2YBVA 2KRBA 3ITHB 2EC2A 3T1YJ 3QT7A 2CDQA 2JC1A 2BE2A 2LVWA 3DCAA 5KT3A 3TVKA 3QQCD 4ATNA 5KFFA 1T03A 2UUBJ 2X3GA 3BB5A 4ELUA 1S1UA 4GC7A 1FX2A 3QWUA 4TKTA 3F56A 1RQ0A 4JI7J 4RNHA 2ZUAA 3NS7B 3TANA 3GJQB 4RBUA 4ZPWR 5F8JA 4QU7A 1JJ4A 2XMUA 3BBFA 3RU0A 1FJ7A 1M90T 4X66J 4JV5F 2WVBA 1GK8A 2CRLA 1RAOA 2HVZA 2VL1A 5F8IA 3MPVA 2C2NA 4KQZA 3CD0A 2O1PA 2QFJA 2DXEA 3A8IA 2HFVA 1NSAA 3W2WA 4DQSA 1OY6A 4DL3A 1S1VB 4DZDA 2BANA 3CO0P 2CQ2A 3Q0AA 1JIHA 3V4IB 2GZOA 1NM2A 1PYSB 1YG0A 4FPRA 4HH0A 3IFEA 3NBPA 1RTHB 4X62F 1SB6A 3KLGB 1X60A 5DG8A 5HI7A 1UVIA 4UZBA 3NMRA 3M1VA 1NO8A 3MEEA 4N8NA 1LXJA 2H48B 3TUPA 1H74A 3IG1A 1RHQB 3OLBA 3I4PA 3V81B 2MKIA 1NRKA 2BKPA 5HL7Q 1FVQA 2V0NA 2VG7B 2CNLB 1YJ7A 2B9XA 1HARA 2E1MC 3JSRA 1PC5A 3JSYA 5I3QA 4LRFA 2D69A 3I32A 5C7PA 3IXQA 1Q8KA 1URNA 4AXJA 5HVGA 4ZJOA 3FBFA 2OP5A 4F04B 4YHHF 3VQTA 2XO7A 4GO5X 4LR8A 3W9HA 2GIFA 2GVZB 4GKJF 2AJ1A 4GRSA 4RW4A 3DKDA 1R6VA 3HSJA 4CM0A 2H5IB 3VZHA 3KHHA 1LKZA 4LVNP 1FFWB 5AT1B 4ID8A 2HZAA 3H2UB 3BEGB 5KG7A 1U6FA 1BD6A 3QJLA 3J81U 1O6XA 2HRYA 3AD9C 2MGZA 4HI1A 3QIPA 2IBKA 1R31A 2HWHA 1RT3A 3P5TL 1M5HA 2AJQA 5ETLA 4IUFA 1YI2S 1KQFB 1URRA 3KUHA 4Y00A 2H54B 3OXLA 4R5PA 2HHHJ 1FRHA 6AT1B 2GMLA 2RRNA 2MKSA 5J2NB 4CTAB 2V6AA 1S7IA 3D1HA 2J6TA 1P9QC 2QL7B 4ZPBA 3MM9A 4C8KA 4M5NA 3MMCB 2RVJA 1YRUA 1UP1A 2HHPA 3H5SA 2KO1A 5J1NA 2D74B 4GKKJ 1U8WA 4EK2A 1YBAA 1SH0A 2PSZA 3OTCA 3KMQA 5E3RA 4NXMJ 5KOWA 3VWSA 4PPZA 3MXHP 2DNQA 3R8YA 2RQ4A 5I4MA 3RRKA 2DH8A 1XBWA 4KHRA 3NMAA 3W3SA 1YLXA 2AX1A 3GIRA 2JH3A 1WC4A 1RKIA 2CJAA 3CCVS 4YS2A 1ELOA 3SQOP 2XYHB 2AYEA 4F2SA 4K5SA 2ZH4A 1AA1B 1VHFA 2N3OA 1E6VA 3GILA 1SBRA 4DV5F 2NUHA 5IQ6A 3PV8A 1ITPA 4Y2KA 4R8UB 2M8HA 4USKA 2RNEA 2ATCB 1ZPWX 4RW8B 3PIPQ 2HHVA 3R27A 1XMQJ 4NMXA 4ELVA 4J9NA 1X8DA 5HROB 3MAAB 1RTDA 5CZXA 2G1HA 4ZS6A 2XCAA 1N5TA 3GLJA 5KG2A 3MR5A 4W98A 1NU4A 2OH2A 2OGUA 2EKYA 4NWBA 5ETOA 2MHNA 5M2RA 2DEJA 1VC6A 2E9RX 3M8ZA 1N5YA 3HK2A 3VGTA 2W8KA 4KTQA 3RRHA 1FWLA 5A8RB 4ZPTR 3H4BA 3DYAB 4UQTA 3KLEA 4IDKB 1DFDA 4RNOA 3BGRA 1VLYA 3TO8A 3J7AN 1Y5NB 3EMTA 4CLWA 3T1AA 1RT4A 3HHLD 2V2ZA 2XZWA 4A8XA 4JUZA 2DBBA 4Q5VA 4OZ1A 4WP3A 4JP8A 3H20A 4DSLA 1TKXB 1IM6A 4KBIA 4KRWA 1FJEB 2AKWB 3FKBA 4UW2A 3RB4A 1WOSA 4WXWA 3DOMB 3HULA 1KN6A 4DUZF 3QATA 2Z2LA 4ILMA 1TR0A 1IKXA 5I3UA 3OTOF 5IT9Y 3KLHB 1HD1A 3AH6A 4Q0BB 2E29A 2HFUA 4OFZA 1U1KA 1IVZA 1S1WB 1U7LA 3POTA 4AL5A 2DR5A 4KO0B 2OPRA 1ZTWA 3PNIA 5D15A 3EYZA 4P71A 3QLHB 3J7A1 3M8YA 1RJJA 4WKRA 1GXUA 4OI0A 1TL7A 4NMLA 1GTHA 2CG8A 4DBQA 2V4JA 4HYKA 3EZOA 1D9DA 3O44A 4K4ZA 3BGOP 3QFWA 5HVHA 3ICLA 4OHVA 3HHNB 5KAKA 3ULHA 4M5DA 4MKAA 1FRXA 3GYNA 4U7UK 1HQUA 2NXNA 3AB2B 1L3UA 2MKCA 3PG9A 5K14A 2MY7A 4DDFA 2PI5A 1CJKA 2PIIA 1A7GE 2QLFB 4I69A 4OL8A 1TL5A 4FF3A 3Q8QB 1VK8A 3KNGA 3RBXA 1F60B 3M32A 4IO1A 2N7CA 3TA0A 4ZCKA 2VKZG 5BYRA 4FN5A 4Y6IA 4ED0A 2C3OA 2LU1A 1JWWA 1SJ4P 3G2XA 1VIOA 1FCAA 5HVFA 3DLGA 4DV0F 3PHTA 2ZE2B 1KQSR 4OYZA 4J9MA 3EVOA 5LM7E 1GX5A 3N4WA 4ZJLA 3E51A 3GU0A 2DNOA 1H73A 1R0CB 4LRCA 5KG4A 3RBEA 3H7HB 3KK2A 4FYDA 2QGFB 3ZTRA 2Q3PA 3RZAA 1N54B 2BJ7A 3ISND 4DSIA 1S49A 2ZBCA 4C3MA 2HS4A 5L38A 3J81j 3Q8PB 3BDEA 2QYGA 4AQYF 3CJKA 1T05B 2H4YB 4PQUB 3D68A 1ZPVA 4LF4J 3PX0A 5JJBA 2LA6A 2WK4A 3I4HX 1LFPA 1WKJA 3NY0A 3R1LA 1S5ZA 4NEZA 2G13A 1Q8LA 1S0OA 4EMDA 3DI6B 4QWAA 1U24A 1X9SA 1TKTA 3OR2B 4PRFA 3LGNA 3M8PA 5CD4A 3ILIA 3R7BB 3GQCA 1U4BA 3CMES 1FKOA 4L76A 4FYXB 2DGWA 1R89A 2CPIA 1RAIB 4K50A 1M1KT 1DBDA 5C25B 4F4AA 2KT5A 1X4GA 1C0TB 3G6VA 3DHWC 2WHOA 4MTPA 2BE2B 1YTYA 3IP0A 3HZGA 1WOPA 4KV8A 5E3PA 2WBMA 4NLRA 1GXLA 1RT2A 4KB7A 3HJVA 2XHCA 2UXBF 2AGQA 3AAWB 4LBIA 3TVYA 3ET6B 4J9UE 2B4UA 1NLKL 2KHCA 3TR5A 4TVAB 4GVBA 3OVBA 1SKRA 2VBWA 1RABB 4JI2J 3FZ2A 1Q82T 2B51A 2DYAA 5KFAA 1AT1B 3RR7A 1WDTA 2ZH7A 3J80U 2ZM6F 1SV5B 2YNGA 3D0GE 2HQIA 2XGPA 4PG4A 4YR2A 4CZCA 1JXLA 2KJVA 4L74A 4NLPA 2UVRA 1LWCA 1IBMJ 2BANB 4KGZB 1SC3B 4IOBA 1DAXA 4QWCA 1NJZA 1LEOA 4MK7A 5MAOA 2E66A 4DN0A 3OT9A 2QA4S 5IOLA 1RHJB 1X9MA 1U45A 3FSIA 4J9QA 4OJGA 4ZVEA 5DQGA 3M1VB 2HRTA 4IG0A 4U67Q 2NREA 3R97A 2F5GA 1IR1A 3M2RA 1JLGA 1YJTA 2WSEC 2V8VA 2OO4A 3BREA 2XQCA 2BJ3A 1XMOF 3BN4A 1FDBA 2F9DA 2MKJA 2V8DA 2M70A 4DV3J 4V1Ak 2MLYA 4M5LA 1KVKA 4WU2A 3R5GA 2M3DA 1ZA1B 1Q78A 2K3KA 4NLXA 4J7CA 1FDDA 5KG6A 3GIMA 1P1LA 3MMBA 4KH0B 3RTVA 3WX8A 4ZVFA 1R0BG 4F67A 1OS5A 4NCGA 2VC1A 2FC9A 2EW9A 2R42A 1WHVA 4NLDA 2YTCA 1NK7A 4WPAA 4RBVA 4WK1A 3VR1A 1E6YB
chains in the Genus database with same CATH topology
2KXFA 4ECUA 1FE0A 1Z4UA 4IKAA 3CE8A 2P9GA 2PI4A 2HG4A 3HMJG 3MEGA 3CDEA 1UW4A 3N28A 2CQPA 4C3LA 4EGLA 2I2YA 1CPZA 3DLLQ 3DLHA 1W2BR 4OZ0A 4EYHB 1RP5A 2DNRA 5A2QY 5L1JA 3H5UA 4ES3A 1RT1A 2EI5A 5CYMA 1VOMA 4LQ9A 2AQ4A 1S0VA 4QW8A 3OSPA 5CQGA 2ZE2A 4ED5A 2HNDB 5D4OA 1JLQB 3B78A 2WONA 3DMJB 4X84A 3SQGA 3PKYA 4LF8F 1YIJS 5CHCB 2VG6A 2DIVA 2UUWA 3T19A 2K1RB 1QAIA 3D1OA 1BQNB 1M0SA 2LYVA 4QCLA 1ZETA 3QYYA 5J2QB 2DNKA 2QT7A 2UVVA 1APSA 2UU9F 5EHHA 1N48A 2MB0B 4M8LA 2LQBA 2P9CA 3Q24A 2D1CA 2FVCA 5DG9A 1HPZB 3IC1A 4I6WA 3Q8RB 2KVIA 5KG0A 2VPWB 3MF5A 3FDSA 2FJBB 3HHLC 2R7WA 4J5OA 1WWHA 1Q7YT 4QW9A 3PW0A 2ZH8A 1NH8A 1PO6A 2DISA 3PM9A 1BQXA 1FA0A 2ZNZA 3CDWA 5L1LA 4R25A 1YRXA 2OSRA 3MFHA 1HL6A 1ZZNA 2GQCA 4CH0S 5F3TA 3L3CA 2KXNB 1S9FA 1YJUA 5DQIA 5GAHU 5EUHA 3MOZA 3N0VA 5IM0B 4X4TA 1ZYQA 3DOLA 2FVRA 4FS1A 2J7WA 4I4BA 5DDOC 2CPFA 1HBUA 5BJRA 5LSLA 2KM8C 2IA6A 5F3ZA 3TARA 3V4IA 1CQNA 1F5AA 2ZBIA 3K5OA 2DHSA 5A6WA 4L72B 2B5JA 3EPIA 5K5MA 2MQMA 3Q2SC 2PD1A 2XSJA 5T14A 2EFOA 3L7OA 4C0HA 5GAGI 2DPIA 1U1QA 2ZH6A 5HBMA 4OLOA 4ZCMA 2NUUG 3TA2A 2LEAA 2WSFC 1AFJA 4KE5A 2HNYA 5KT6A 4Q8EA 2ASDA 5AJ3F 2BQRA 2DNNA 2WTFA 2GHWA 4K5RA 1ZM9A 2EG1A 4C4WA 1DJ0A 2DR8A 4ETXA 1Q86T 2EFNA 3S6EA 4EZ9A 1M5KC 5C24B 1Z1ZA 5KFPA 1U1OA 3MM5A 4LFAF 1RTJB 1TL4A 4C8NA 7FDRA 1UVKA 2A10A 2JFDA 4IQXA 2CPEA 3AQPA 4NLSA 1TV6B 3DLJA 4A8KA 4USIA 2IRYA 2P6TA 5GADI 3DRRA 4M63A 4HT7A 4DL0C 4EBCA 3G9CA 4Q7AA 3T5LA 2RUGA 1U1NA 1NB7A 4YDXA 1Y5IB 5A8WA 4TNOA 2RRAA 3QGGA 4IYQA 2LEPA 2DNLA 3V81A 1HYSA 3IS9A 4ZMMA 4K4SA 3M2VA 3PFOA 1JMTA 4ICLA 4QU6A 4LSNA 1KONA 3DI6A 3IN5A 2M8DB 1FDNA 3T9NA 1JNRB 4RLEA 4TXSA 2VG7A 1FO1A 3LANA 4ZPAA 4HHJA 4MJKA 2EFVA 1X4DA 1SXLA 4OIXA 1S6QB 2NR0A 2B4VA 3E01B 3LP1A 3FRZA 2IAJA 3MWBA 2EFPA 4O44A 2MZRA 1QE1A 2YWFA 4WF9Q 3IRWP 3I5AA 4DSJA 2ZITA 2GO9A 4H4MA 2HGNA 4XO0A 3UWTA 2ZD1B 3C2PA 3GMGA 2F7VA 2QLXA 2MQOA 4IRCA 2V8GA 5IWAF 3B8HA 4ZOSA 2MMYA 4NLWA 1WEXA 2IJNA 1NK9A 5B0EA 4RNMA 3ZZ0A 5GADU 1KC8T 2JVRA 3P96A 1H2VZ 3ZC4A 3F73A 4DFJA 3HI9A 3L09A 1UKUA 2VV5A 1VS3A 4MIAA 4ZDNA 5G4DA 3MM6A 4EO8A 2BYCA 5E5NA 2Q66A 4JOUA 4TY8B 4JI5F 5C25A 2XNRA 1FXDA 4DJBA 3CCRS 3MHYA 2D7SA 1LWEB 2GGPA 3CCES 2MSTA 2KYZA 5F0WA 2MZ1A 3GZ7A 4PUOB 1JLBA 5B0DA 2LEBA 1CG2A 2I38A 4L3NA 1C0TA 4NL5A 3N9UC 5GMKa 3I31A 4C11A 3MR3A 3SYZA 2HLTA 3QAUA 5SUHA 1BY9A 4DOZA 3ENVA 4O3QA 4B3SF 2NLWA 4W92B 3TQ1A 3HZEA 1OQ3A 2XSFA 1OWXA 4NYPA 3M9OB 2Z8QA 2NSCA 2I5JB 2RE1A 2WW8A 5CCLA 3PVXA 1MU2B 1TK5A 1W2IA 2EWHA 2JEIA 3X3UA 3SV3A 4WE1A 4U7CA 4JI6F 5DDRC 3OUYA 4Q8FA 3WDOA 5D3GB 2IA0A 3HF5A 3T6BA 1KLNA 5J1EB 3CCTA 5KFTA 4CT8A 4ZPVR 2XY5A 4V19J 1UJ6A 2B3TB 2B7CB 5KFVA 1EP4B 2O3DA 4B17A 5MLCV 3OHBA 1X9WA 2CFXA 3M05A 5F41A 3NNCA 2QV6A 2W4DA 2YKMB 2AYBA 5LXYA 2KU7A 1R8HA 3ZZZA 5LMNF 4F50A 1S1XA 2KJWA 2OPPA 1IQTA 4CO3A 5H9EJ 1HNZF 5E3AA 2W9AA 4C8LA 5AE1A 1CSJA 1S6PB 4ID5B 1FEEA 2J6UA 3EPGA 2W7PA 1N5YB 4F3QA 3R5BA 3FCHA 3H5XA 3QIDA 3OXGA 4C7QA 4OHWA 4M95A 1S79A 2XS7A 2A18A 3QGHA 4QIFA 4K4WA 2BR0A 2YKOA 1FKAF 3KJVB 2RF2A 2K7JA 5SZTA 4ILLA 4OHZA 1MROA 4DLGA 4QYZJ 3DRSB 4EWTA 5JVHQ 5DLGA 4CH7A 4TYBA 5B7WA 1KOHA 3HP6A 1HW9A 4AL6A 4O4GB 4H4KA 1RGVA 3I0SA 3KLEB 4IR1A 2OD6A 3OSNA 3PACA 1RT6A 4F3OA 4O3NA 1B0PA 4RNNA 1N0UA 2EC0A 3MOJB 1RA6A 1SV5A 3FSYA 4I2PB 2YQ3A 5LSRA 2XC9A 3UFCX 4JYAF 5J2NA 4B3MF 3ISNC 4ED2A 1IN0A 3OW2R 4NXMF 3PX6A 3EXCX 4MFBB 1DRZA 5KFDA 1ZM2A 5FD1A 3C6UA 3HJFA 4UUWA 3CD5A 3U1LA 1JKHA 2DH9A 4A8OA 3PKMA 3MMCA 2MYFA 2QYCA 2CPJA 3FFIB 3C6TB 5KFSA 3D2WA 2W4CA 1FRLA 1H6KX 2LQ5A 3MI7X 3I5BA 2HVIA 3A8EA 4A48A 1Y3KA 2G0CA 2ZOFA 3OFGA 4A8MP 4KHPF 1G1XA 4WCEQ 4ZK7M 1S76D 2ALZA 4CH1A 2E44A 4KT0C 3C46A 2HQ3A 2C2DA 3JSMA 3NS6A 1VFJA 1U2FA 5KFGA 4RZRA 2XCPA 3T9ZA 3D1QA 1N36F 3DM2A 2RKIB 3QO9B 2AU0A 1IKXB 4F3MA 1QSSA 2OLWA 2LQ9A 3ZFVA 1O0PA 1Y00A 1LQ9A 4PQAA 4H4OA 1PGZA 4PWUA 2IVFB 3H2LA 4ECSA 2MJUA 2R8HA 2WOMB 3S8SA 1NK6A 1NHUA 2YKNA 1CLFA 1BGXT 3OXFA 4WZMA 3T3FA 1VBXA 3OV7A 4LFBF 4OZ5A 5KG1A 3SMZA 2IM0A 3G86A 4IFYA 1REVA 3K2YA 2B9WA 3CB4A 4E0DA 3N6MA 2OPRB 3LF0A 3PEHA 1A9NB 3CF5Q 4I7FA 2E5LF 3UQSA 2DHAA 3OTDA 3D5MA 1K73T 3BS9A 4K59A 2PO4A 4N8OA 5AE2A 3VAKA 2AGPA 1L3TA 2QMWA 3SFUA 1UWBA 3ZZYA 3K5LA 1VQ5S 2MDAA 2L9DA 3OR1B 4RW9A 2PE8A 1S1TB 2Q79A 4QR2A 1K1QA 4QYRA 2IYIA 4GO7X 3FEZA 2UXCF 4HKQA 3LP2A 4CQ1A 2QA4G 1WI8A 1WNEA 3T5KA 1D8ZA 3OFFA 4KPYA 5E41A 1JJ2R 1HNVA 4LF7F 2X1BA 1XK8A 2R2UA 3CCSS 4Z37A 4PG5A 4PXBA 5CXTA 4KFBA 4RBTA 4FP9A 2AJ4A 4DSFA 1Y3JA 1JLEA 4D3HA 1OIAA 5BYQA 4ECXA 4Y34A 3RB0A 1FK9A 2R7UA 4YB7A 2LKZA 1TKDA 1HI1A 3M8SA 1SJQA 2MSSA 2W8LA 2WBRA 2WRMA 4RW8A 1RDRA 1RT7A 5KFHA 4TQSA 3BF4A 2YY3A 1CC7A 2EPIA 2GO8A 4FVCA 3UNGC 4DHVA 5IXUA 5BR8F 2HW3A 1FRIA 3GFHA 1TUVA 5A8KA 3VAIA 3TAMA 3IWLA 1SKSA 1N5QA 4JV2A 3F41A 4DFPA 4M1KA 4RW6B 2HFNA 2J9EA 4DG1A 4AXIA 2J76E 2OPSB 4DV2F 3IRXB 3GR1A 3K8WA 3G96A 3SFGA 4J9LA 4AYBD 1U47A 3N6LA 3MDFA 5L1KA 4I64A 5HROA 1DURA 2QA2A 4ZHRA 1H2UX 4NLYA 1LW2B 2VG5A 4EYIB 3BGFA 4L6V3 3R3TA 1T03B 2OIHA 4DWIA 1D1UA 5L1IA 4UY8T 4ZPCA 2VQFF 3TUIC 2J7UA 1S1UB 1E6YA 1FD2A 3M32B 1VQKS 2ZNYA 4WXOA 3BO4A 3HVRA 1P6TA 5F8LA 2M7SA 5F0UA 5A6PA 3T5JA 4X65F 4PWDA 1XR7A 1UFLA 2NS1B 4MIBA 4OX6A 3CCMS 3DRPB 4OI1A 4BBYA 1N0VC 1SJRA 3THPA 2BM1A 3BZQA 3TOQA 3Q8SB 3U7JA 5C42A 1OSCA 2KM8B 2BRLA 2ZC4A 3KK3B 1N6QB 2JLFA 2CQ0A 3SDEA 4E98A 1VRUB 2OFGX 1Y4ZB 2FPHX 3MEDB 3OFEA 3NKYA 3AHPA 2GHVC 3DOKB 2F8EX 5B0AA 2ACYA 1I6JA 4DPOA 4TU7A 2HNDA 3E3XA 1FRJA 1KLMB 2F40A 2CVIA 3O6QA 1JLQA 2RSQA 3DMJA 4FBUA 2VH7A 2ZH1A 2JDJA 1ZM4A 3AJ2A 1KHVA 1BQNA 3DYAA 2COLA 2D41A 3G6XA 2CQGA 1TKZA 2R2RA 5HMZA 4ITSA 1HFEL 5J2QA 5M2UA 4NZ0A 5L8RC 3QWPA 3SSRA 1X4FA 1UETA 4ZLPA 1RYSA 3R5CA 4K0KF 3G4SS 4DQPA 4JI8F 1UJ4A 2ROGA 3CJ5A 2F4VF 2C3PA 2LDYA 2AYMA 2OAUA 4P2SA 4CNYA 4ZP8A 3J81Y 5DDPC 2EFQA 2JSXA 1YJWS 2ROPA 2Y1JA 2XBPA 3C66A 4CO2A 2FGCA 5DJBA 5EX0A 4B9NA 1ZAWA 4LVOP 2CQ3A 3SV4A 3W2WB 3LOUA 4QZVB 4QQBA 3IR5B 4MH8A 2YH0A 3O3LA 4TYAA 3HHDA 2KZMA 4N77A 2ZHBA 2DGUA 4DMZA 1SJ1A 1VGYA 2FLLA 2BJDA 3VAFA 1R7IA 1U1RA 1HW8A 2YWEA 2R7OA 5K8MA 3EX7B 2HWIA 1S48A 1NK8A 4NLTA 3PEJA 2GQ2A 5IM0A 2CKWA 2XI2A 5CYQB 3UR0A 4DQRA 3I9V9 2NPFA 2GFFA 3GR0A 1IJEB 4UUXA 4EO6A 2BA9A 2O5DA 1S9EB 5KFMA 3SSSA 5FJ4A 2U2FA 2FHMA 3MURP 2MQLA 3NBPB 4MYTA 1HA1A 2H9ZA 2FB0A 3CCQS 3GWCA 3WZ0A 3PIOQ 1SL1A 4FNHA 1V9OA 1YSJA 3MECB 4IH6A 3HPOA 3JAMY 5KFCA 3M9MB 2E9ZA 1CEZA 5M2PA 2XMTA 1VQLS 5LMUF 4Q0BA 1IJFB 1LWFB 2ZVSA 3O5TB 3MD1A 4XPEA 2ZJPQ 3MMAA 2O66A 5KFLA 3V6JA 2KYXA 2ZZNA 1S1WA 1NKEA 1VIXA 3PR5B 4I67A 3SXLA 3MEEB 3O8WA 1HNIB 2MZQA 6FD1A 5EGYA 2FVSA 1RTJA 4DN9A 3UE2A 2QIFA 5L9NA 4I2QA 1T95A 1XC9A 2W7AA 2B6AB 2ZDPA 2V2KA 1TV6A 2IM3A 3T1YF 1RISA 2GHPA 2VUGA 2F3JA 3FNNA 2HHUA 2QSWA 5CYJA 4QWDA 4F4WA 3IG1B 3TA1A 2VC0A 5B09A 4FZVA 1IKVB 1X0PA 2WB1D 4HTJA 5E33A 1K9MT 1B7FA 4B3TF 3BN7A 4AL7A 3WC2A 4N41A 2G4BA 4DSEA 1GNKA 1WG4A 3W2VA 1UEVA 2VBXA 3IWXA 4Q45A 1S10A 3RAMA 2JJ4D 4LSLB 1JLAA 4ECWA 4I56A 1KVJA 4X4RA 3ZZPA 1RKJA 3TYTA 2UUBF 4LF6F 3BGLA 3BQ1A 3M4XA 2K8GA 2KZZA 2AF6A 1TKTB 2W25A 3GB0A 4A47A 1S6QA 1KVIA 1K0TA 3E01A 1GTEA 3KG1A 1FKPB 2G9OA 3M8PB 1VQ8S 3FEYB 4NLUA 2DGSA 2XULA 5E0OA 1LV5A 1X4EA 3PZPA 5LJ3Y 3DLBA 3MFIA 4JI7F 1N88A 1FKOB 3PJXA 2XG8A 4RU9A 4DF4A 3EZ5A 5J2MB 2ZH3A 3I82A 4DQQA 1S4FA 2JOQA 3AB4B 1L3VA 3MM8A 3K0JA 5KTQA 3K58A 1OO0B 1UVMA 3IWNC 2DGTA 2WB4A 3N5BA 3HKZD 4IG3B 4A8QA 1ZH5A 4ZP6A 4Z2XA 2DRBA 3EGZA 4B9VA 1UFWA 2GIRA 3CCUS 4ECVA 5EX3A 4B3RF 2D3UA 4NLVA 2FVPA 4A8FA 1Z2LA 5HP1A 3TVZA 3IGVA 4RUAA 1ZOTA 1VQNS 1LWEA 1FTCA 4J9PA 1DTTB 4PUOA 3GFYA 1ZM3A 4NOHA 4X66F 4ZP7A 2ZHAA 3N5FA 3QGPA 1U49A 3UCGA 1ROFA 1R43A 3M8QB 4RW4B 4YB6A 2ZKUA 2CQ1A 3CGIA 1VRTB 4NX9A 3MM7A 2CPZA 2FJDB 3IO1A 4I1TA 4ZKAA 1H2TZ 2RQCA 4RU2A 4I68A 4F8RA 2V4QA 1NK0A 4YOEA 4UY85 2I5JA 3C3LA 2IJFA 2P6SA 4C97A 2DTJA 3H98A 1BC6A 1U09A 4GC6A 4DV4F 1X5TA 5T7LB 3R5DA 5DRKA 5D3GA 4OX7A 2RU3A 1YWXA 5J1EA 4FF4A 4O4RA 2ZKTA 5DS7A 4RKUC 5AXLA 1WF1A 2C28A 2GNKA 1UA0A 3CEDA 3SCJE 2J0XA 3CCWA