3BEGB

Crystal structure of sr protein kinase 1 complexed to its substrate asf/sf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
86
Chain Sequence
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGSYGRSRSRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A sliding docking interaction is essential for sequential and processive phosphorylation of an SR protein by SRPK1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/splicing
molecule keywords Serine/threonine-protein kinase SRPK1
total genus 14
structure length 86
sequence length 90
ec nomenclature
pdb deposition date 2007-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3begB01
3SDEA 5IFMA 3L3CA 3CMAS 2DB1A 2DGXA 4TU8A 5GVQA 2FY1A 3OW2R 2RRBA 4OZ0A 1M1KT 1K9MT 2QA4S 2DNGA 2MHNA 1U1OA 4LMZA 3VAMA 2ERRA 3HI9A 2DGVA 2MZJA 3NNHA 2DHSA 2J76E 2DNRA 3P3DA 1Q82T 2E5HA 2KI2A 1WEZA 2M2BA 2M52A 1A9NB 2KXHA 1VQ7S 1S72S 3CCSS 1UAWA 2MKJA 2XNQA 1VQPS 2CPZA 2KH9A 2CQIA 1X5TA 2X1FA 3PIOQ 3NNAA 2MY7A 5GAEU 3HHNB 2AYGA 2M8DB 1WTBA 2CPEA 1WF2A 2DNLA 2RQCA 1Q7YT 2F3JA 1U1PA 2U1AA 1OO0B 3CCMS 3H2UB 2QFJA 3TP2A 4YB1P 3N9UC 2QEXS 2ADCA 3V4MA 2K8GA 2MQOA 1KC8T 4U67Q 3S01A 3UCUP 2JRSA 3Q2SC 2MKIA 2MZQA 1X4AA 5BJRA 1YI2S 2O3DA 3MXHP 3FEXB 1U1RA 1UFWA 1B7FA 2XS7A 2LXIA 2MSTA 2MKCA 2E44A 1H2VZ 1H2TZ 2RQ4A 4C0OC 4QU7A 2MY8A 2PEHA 2MYFA 1X4FA 3UD4P 2DO0A 1XN9A 2JX2A 2KFYA 3FEYB 3VAGA 3G8SA 2PE8A 2EK1A 3CC4S 4BS2A 2KYXA 2GHPA 1ZH5A 3ZZZA 2D3OR 2MQQA 4OZ1A 3VF0B 2DGSA 2CQ0A 2KXNB 2V94A 2JWNA 1VC0A 2CQCA 2DNHA 3BS9A 4WFNQ 5DDPC 1SJFA 2M8HA 1YJNS 4WIIA 2AYMA 2HGMA 2KG1A 2A3JA 2MZTA 1N8RT 3CCVS 3R1HA 3BO3A 1VBXA 2VONA 1X5OA 5HL7Q 2WBRA 4YUDA 2D9OA 2MJNA 2CQDA 2MZ1A 1YJWS 1X5SA 2U2FA 4A8XA 3ULHA 2CQ2A 1CVJA 2FPHX 2KRRA 1QM9A 1KD1T 1FNXH 2DHGA 5HO4A 3CD6S 5IM0A 4Y0FA 3IRWP 2AYBA 2I2YA 1H2UX 2NLWA 5JVHQ 3DXBA 1R8HA 2XSFA 3CCUS 2DHAA 3THPA 3UD3P 1FJEB 3CULA 3MOJB 1JJ4A 2CPHA 2MGZB 2RS2A 1QVGR 1VQ5S 1U1KA 2G0CA 5CA5A 1HA1A 2MMYA 1UP1A 2N7CA 1U1LA 2XB2D 1HD0A 4PRFA 1WI8A 2DNOA 3PIPQ 1WF0A 2FC9A 1NJIT 2LYVA 4IO9Q 2AD9A 3I55S 2DNPA 4V19X 1N88A 2N3LA 2JVOA 5DM6Q 2FC8A 2LXUA 1HD1A 3VALA 3MUVP 2YWKA 5IQQA 5LSOA 2KM8C 1X4HA 4UQTA 2DNYA 1WG5A 3JB9k 4IUFA 4PKDB 1VBYA 1WG4A 3DLLQ 1U2FA 2LKZA 3THTA 3P49B 4QU6A 3CF5Q 4Y00A 2E5GA 2M9KA 5DDRC 3S8SA 3UCGA 2F9DA 2L9WA 4ZKAA 2DNNA 2ZJQQ 4Z2XA 4UY8T 1URNA 3U1MA 2YH1A 1PO6A 4FXVA 4IOCQ 1NO8A 1JJHA 2KXFA 2DITA 1FO1A 5LXRA 4WFBQ 1BY9A 1WEYA 1U1NA 1A7GE 3P6YC 1FT8A 3MUMP 3NS5A 4CH0S 1YTYA 5GMKa 3VAHA 1U6FA 2XS5A 1VQNS 1DZ5A 3R27A 2MQLA 2L08A 2YTCA 3G8TA 2HGNA 5LXYA 2DK2A 3S7RA 4WFAQ 2RT3A 4CIOA 2KU7A 3BO4A 2ADBA 1KQSR 1WWHA 4WCEQ 1SJ4P 5GAGU 2MXYA 1VQ6S 1WELA 4WKRA 2KHCA 2CQ1A 1L3KA 3CCES 3IWNC 1S79A 4F26A 2LA6A 2MQNA 3MD1A 1X0FA 2MZRA 3CC2S 3B4MA 1FHTA 1DBDA 2RRAA 1K73T 5ITHA 1DHMA 4PR6A 2VOOA 4FXWA 5MLCV 2XS2A 1VQ8S 2RUGA 3EX7B 1VQ9S 3U1LA 1VC5A 1FJCA 2G4BA 2DGUA 1VC6A 2OTJS 2M88A 4WF9Q 5LJ3Y 1VQLS 2KT5A 3MDFA 3G4SS 2K3KA 2CQGA 2CQ3A 3CC7S 2YH0A 1X5PA 3G71S 1RK8A 2M0GB 2RS8A 2UP1A 3G9CA 2DISA 4J5OA 1WG1A 1WF1A 2LA4A 2N82B 2DO4A 1ZZFA 3CCRS 1G2EA 4ERDA 2ZJPQ 1HL6A 1YIJS 2I38A 3MD3A 3TYTA 2ZJRQ 4LJMA 1KOHA 1N52B 4TLQA 4F25A 2F9JA 2RU3A 1O0PA 1F9FA 2GO9A 2E5JA 2KM8B 2CPXA 5DETA 3LPYA 1WHYA 2DHXA 2VOPA 1QVFR 2DH8A 2AYEA 5IM0B 5DDOC 3NS6A 2OSQA 3CMES 2LQ5A 2EK6A 1U6BA 4LIRA 3J7YU 2CPYA 3US5A 1VQ4S 1X4GA 2DGOA 5JVGQ 1YWXA 5LJ5Y 1OIAA 2DGWA 4P6QA 2BZ2A 1SJ3P 2M4MA 4QQBA 3I56S 1OWXA 1PGZA 2DIUA 2MGZA 2G1DA 3VAFA 2DH9A 3ZZYA 2LMIA 2MKHA 1Q86T 1DRZA 1FXLA 3CXCR 2DGTA 2MB0B 4TU9A 3S6EA 2CPFA 1YHQS 3LQVA 3G96A 3CCLS 2LECA 4QPTA 1VQKS 3VAKA 3NNCA 1JMTA 2N3OA 1X4DA 5D77A 3G6ES 1SJRA 2CQPA 1OPIA 2CPIA 2RNEA 1M5VC 2OJ3A 1VQMS 3SDEB 1VQOS 5LSLA 2DNZA 2LEBA 1WI6A 2J0SD 5GADU 4ED5A 2OSRA 2MSSA 1JJ2R 2DGQA 2J0QD 1UW4A 1P1TA 3CCQS 2CQHA 4RU2A 2HZCA 1YITS 2MJUA 2MPUA 3VAIA 2HYIB 4EGLA 3R1LA 1WEXA 1WHVA 3MURP 2MQMA 2MKKA 1D9AA 2Q79A 2B0GA 2OIHA 2CJKA 2D9PA 2FHOB 2DNKA 3VAJA 1M5PC 3RW7A 4M5DB 5GAHU 1M5KC 1WHWA 1X4EA 2M70A 2KG0A 2MZSA 2BOPA 3J7ZT 3EGZA 2X1AA 1D8ZA 2CPDA 2DNMA 1K8AT 1AUDA 2LCWA 2KRBA 3B4DA 3TO8A 4F02A 4YOEA 2NZ4A 2XNRA 1KOOA 2JVRA 2M7SA 2X1GA 3CPWR 1WHXA 3NMRA 3MI7X 1M90T 1U1MA 2KVIA 5EN1A 3UWTA 2J8AA 2CQBA 3BEGB 5H1SV 3H2VE 4CH1A 1FJ7A 5FJ4A 3MUTP 2DH7A 4W92B 3UE2A 1R8PA 3CTRA 3K0JA 4CQ1A 1YJ9S 2EVZA 2X1BA 2RVJA 5DM7Q 2L41A 5D78A 4C7QA 4W90B 3SXLA 3Q2TC 3RW6A 2HGLA 1IQTA 4TU7A 2DNQA 1W2BR 2LEAA 3EGNA 2YKAA 2E5IA 5CXTA 3SMZA 1SJQA 2HVZA 2MQPA 1X4CA 3CUNA 4C4WA 1H6KX 3UCZP 3CCJS 1P27B 5DDQC 1Q81T 1ZZNA 1U1QA 2KN4A 1N54B 2CPJA 3P5TL 5CYJA 1M5OC 2DIVA 4IOAQ 1NU4A 2CQ4A 2OTLS 3D2WA 2MKSA 1RKJA 2VODA 3BO2A 1VBZA 2SXLA 1X4BA 1SXLA
chains in the Genus database with same CATH superfamily
1S9EA 1FDBA 4MK7A 3UN5A 3NCQA 3LANA 3OR2B 3KK1A 3CMAS 1REGX 1X9SA 1IBKJ 2HHHJ 3KLIB 1RXOB 5FLXU 2XZTB 4F0MA 4Z7YA 3AHPA 3OW2R 1NK9A 2PMWA 3SCJE 1RT4A 2CJXB 1PSDA 1SB6A 4DZ6A 2QLXA 2I1RA 3FCHA 2XO6A 1BWVA 1RTJB 3PEJA 4FN5A 3KJNB 1PBAA 1YKWA 2FHJA 2VFVA 3HI9A 4OYAA 4RL1A 5IZHA 1S0MA 1KLNA 1RP5A 3IM9A 1NKEA 2HEKA 2J76E 1DLOA 3P3DA 3LP0A 3IAS9 1GMUA 5L46A 2AZ3A 4USWA 3BKUA 2HURA 3ADAC 1A9NB 4ED1A 2RU9A 3QFHA 3RU0A 3TEGA 1JJCB 3CCSS 2BE2A 4DPUA 1JLQB 4IFYA 2XG8A 2XNQA 4CH7A 5KFRA 3K5LA 4J9MA 5KFQA 4ZVRB 2FHJD 2BQUA 3GIJA 2IJNA 2YPZA 5E3QA 1SV5B 2XMVA 4LF6J 1KSPA 5GAEU 4PG6A 1VQSA 2B51A 3R5JB 5CYQB 3G6XA 5KT4A 1S76D 2ZBCA 2QTWA 2AYGA 2Z4PA 4IG0A 5KG2A 1J27A 4OYXA 1WTBA 3BYRA 4FYYB 5J2QB 5A6PA 5LSRA 1T9TA 4DV6J 1TQLA 3DMJB 3T3FA 1C4AA 2F3JA 3E8OA 1FVQA 4O23A 1VCTA 4P73A 4WYLA 2RF2A 1NK7A 2ZBIA 4DX8H 3P96A 3KXDA 3CCMS 2FTRA 1TV6A 4J9SA 2O5DA 5LOQA 4GKJJ 4RW6B 1YSJA 2K1RB 3M2RA 4DUYF 2D3O1 2V69A 2R8HA 3IMQJ 3MOZA 3KMQA 3DRPA 2ADCA 1SUQB 2CNNB 3ZNUA 3DDIA 2VIHA 2HNYA 3V2UC 1KNZA 3GJSB 1PKUA 3SCLE 1UTAA 2E1AA 2O3DA 3V6DB 4BHQA 3DFEA 3QO9B 3BPSP 4USKA 3HHKA 4CRJA 2AQ4A 2XS7A 2V4QA 2RHSB 3M4XA 4EEYA 1C0TA 2BRLA 1YX2A 2H9ZA 1AFIA 1RWOB 4K4WA 2UZAA 4DV0J 5HMZA 4J9UE 3D0HE 5F0WA 4ELTA 2PEHA 3JQKA 2MYFA 3QT5A 4RWXA 3Q8PB 4AXIA 2HQIA 4I0WA 3D3BJ 2Y8WA 5H9FJ 2AZ1A 4M5JA 4DUYJ 3K5PA 4O4GB 3FEYB 3WX4A 4UUWA 5J2PB 3LAKA 2GAGC 2B4VA 3LGNA 1AYEA 3TUJC 3UN3A 5LMUJ 2XHCA 3CC4S 4E0DA 3HKZD 3RRKA 3PR5B 1TAQA 3BH7B 1X9WA 3ZZZA 3LF0A 3W63A 2VPXB 4H4OA 4N76A 2I8EA 4JI0J 2ZC4A 1ICEB 1G3OA 1Q5YA 1OY8A 4OX7A 4C8LA 3MFIA 3U7JA 4JYAJ 1RWKB 4MKBA 4Q45A 1T9XA 3RAMA 4OI6A 2ZZMA 2DNHA 4M5NA 4N77A 3OFFA 3PEHA 4WFNQ 3F73A 4IH7A 2OO4A 3DLGA 3LP1A 2OPQB 1L3UA 3U1NA 3PR4A 2X51A 3TR5A 3OQ2A 1S1VA 2MZTA 4H4MB 3HK2A 1EB0A 2HBQB 1GTHA 2Y8YA 2AJQA 1BQMB 1VHFA 1ZS6A 3I32A 2WVBA 5IC4B 3Q24A 1VS3A 3GV5B 2UU9J 3MCMA 3Q8YA 1I3OB 3CE8A 4URSA 4UZBA 4I68A 5HBMA 2AEFA 3KJFB 4ZPCA 3QZ7A 3H5SA 4YHHF 3N28A 4DG1B 2FVQA 2XLIA 2XSJA 4QJVA 3LWLA 4ILLA 2E9ZA 3MEGA 2OPRA 5HO4A 1U0HB 7FDRA 1H2UX 1JNZB 4NPOA 3C14A 3HFVA 3PTWA 2HVEA 2QL9B 4K2XA 4YHHJ 1YVFA 3NRBA 3W9HA 1C0UA 1F5BA 4OX6A 5C24A 2UVWA 4FPRA 1FKOA 4FYXB 1R8HA 2GIRA 3UD3P 1JKHB 4OYOA 4F0HA 1FJEB 2B5JA 1GX6A 4NASA 1EIYB 2UU9F 3MEKA 3BGLA 1QVGR 1F5CA 1U1KA 3R5AA 5H9FK 1ZA1B 1NK5A 3BJYA 4ALZA 3PNIA 5KG1A 3DN9A 4Q8FA 3MM9B 3NXZA 1LXJA 3SEOA 4F04B 1WF0A 1HYSB 2HFUA 3QGIA 2LYVA 2NPIA 3W5ZA 2AD9A 2FJDB 3RYLA 1D9FA 2B7BB 2DNPA 3ZZRA 1FKPB 3W5XA 9ATCB 1HNWJ 4NZ6A 5CYMB 3DDNA 3GV8B 4TVAB 3R7NB 3W5YA 1KS2A 6FD1A 1XERA 2ABYA 2JVOA 5DM6Q 3HJVA 1HD1A 3DC2A 3Q8RB 2ZZTA 5A0YA 3BQ1A 2R8GA 1VRTA 3Q8SB 1ZAVA 4UQTA 1LFWA 2DNYA 3R8YA 3M32A 4Q2LA 3WX8A 2UVRA 4IFVA 3M6UA 2OPSA 4JV1A 1CEZA 2E7VA 4NI2B 3M30B 4LRAA 2ZVSA 5L9NA 2NREA 3ETOA 4B3MF 1PGZA 2H48B 2LKZA 3THTA 4O3OA 3JAMU 4M5GA 1TUGB 1N36F 2KB2A 3CF5Q 3M8QB 1Y5LB 3QSIA 1U24A 4NA2A 4I2QB 5CZXA 3Q8QB 4NLQA 1FESA 3OFGA 3S8SA 3POTB 3HM9A 3UNGC 3GB0A 2F9DA 4RBTA 2A6OA 1FRIA 2L9WA 1RE1B 2DNNA 4KO0A 3WC2A 1UVNA 2ZJQQ 2HQ3A 4WZQA 3QGPA 4KRWA 4NZ0A 4Z2XA 3TJ9A 1TMJA 3V4IA 2OH2A 3NMAA 4GKKF 3OLAA 5KFXA 2PMHA 4DCOB 1ZAXA 1UFKA 4KJIA 4CNYA 2ZWOA 3FCWA 4DDFA 2C1EB 2B43A 3DRXA 2VF3A 3H5XA 1FRKA 2IJFA 3IP0A 4CDIA 2NXUA 3TAMB 4K5SA 3HHEA 2DPIA 1WEYA 2YKNB 3QBCA 5GMDA 3R6LB 4TQRA 1U1NA 2IM0A 4DFJA 4HHHA 3DU5A 2NR0A 1FA0A 3T5LA 1AB8A 3NL0A 2YX4A 2RSQA 3M8PB 4OJ1A 3T41A 3C6UB 5M2PA 1YRTA 2YWFA 4HEA9 2KJVA 3QIPB 1DTTA 5GMKa 4X4VA 3BSNA 2LLZA 2D7SA 2JZ5A 2HNYB 4OLOA 3M8WA 4AQYJ 2MQLA 2ZM6F 3ZO7A 1LNQA 3IBFB 4HR2A 4JI5F 2HAFA 2HGNA 5EHHA 1RWWB 2QYGA 4CLUA 3UDLA 2C3YA 4OZJA 1IUJA 5BR8J 5E3RA 3HJFA 3KFWX 3TUIC 1WOSA 4CIOA 4B9SA 2JDJA 3UO0A 1WWHA 2RH3A 2V67A 2IM1A 1KLMA 3GIKA 2DXDA 3UVJB 3AOBA 2Z2YB 4RW8B 5C2CA 1EKSA 1WELA 2KHCA 1HQUB 4R25A 3CCES 4JI7J 3HFKA 2IAJB 4LR9A 3IWNC 1MG7A 4LF8J 3KLEA 1GXLA 1S79A 1UVKA 2WVCA 4F26A 4QWDA 3KK2B 1F6TA 3OFEA 3QIDA 2ZHBA 3PW7A 1AT1B 4CLPA 1IJFB 2A6MA 3CC2S 2HMIA 4B3TF 1RAIB 3PHEA 4O0IA 3OTOJ 3KG1A 4LF5F 1ZAWA 5A2QU 4X65J 1JIHA 1S6PA 2BYCA 2N4CA 2H5EA 1DBDA 2RKIA 2ZHOA 3HDSA 3LTOA 4P10A 1IBCB 4DCPB 4J9OA 4PR6A 1VLYA 1YG0A 2B9WA 5I42B 1U7LA 2B4PA 2ZH5A 2HK2A 3W2VA 1SKSA 1S7IA 3EE3A 3O44A 4RNNA 2XS2A 4UOFA 1YBAA 2JC1A 2ZE2A 4TXSA 5LMNF 1VQ8S 1RA7A 3U1LA 2C3PA 1FNOA 4DL3A 1ZA2B 2W2PP 1YZ7A 2DGUA 1RHQB 3UW1A 2IM3A 4R5PA 4DSKA 2OTJS 3TJ8A 2CNOB 2R2UA 5I3UB 2F40A 2PDAA 2YX1A 3FNNA 2KT5A 3M6VA 2QJ3A 3MM5A 5IC6B 2XMMA 3O8WA 4CTAA 2XO7A 4I64A 1RHUB 1KVKA 1LXNA 4RUCA 3HPOA 4A8MP 1X5PA 2ALYB 3HHLA 1RTZA 3H4BA 4DR3F 1NJWA 1RJJA 2AWZA 1U47A 2UP1A 3G9CA 2KYZA 4OI2A 1B7YB 1L3VA 4FYDA 3QYYA 5DO2A 2LA4A 3PYDA 3QMQA 2CDRB 2X7IA 3HSDA 2DO4A 3SSQA 3K5MA 4UT4A 4DV3F 4RLEA 4P2FA 3M2UA 2Q66A 3DRYA 2ROEA 1HL6A 4ETXA 2ZH6A 1S49A 2I38A 2QLFB 2XSJB 3UD5A 4AYBD 2PA3A 3OVBA 1PILA 2R7TA 1RT4B 4X62F 3DMJA 4HHJA 3I6PA 3MPWA 2FLPA 4TLQA 2RU3A 1RTJA 2F9JA 4FP9A 2MLZA 3CIMA 4CP5A 2KM8B 2HHPA 3ZTOA 2Y3YA 2GQCA 4O0NA 4FNIA 4OHZA 3KLIA 2Z2MA 4OZ2A 4RZRA 2K1RA 4OZ5A 3BSAA 1TL1B 1ZETA 4LBIA 4ES2A 4DV4F 2F4VF 4FNHA 5HP1A 3CWJA 3C15B 4NL5A 2BE2B 4GKJF 2RE1A 4MFBB 1U09A 1DTQA 4G1QB 4X84A 5C25B 3IXQA 2B9EA 2YX7A 4XDDA 1HQEA 1Q7LB 1X4GA 2J6SA 4KHMA 5JVGQ 2NUUG 1YWXA 3IR6B 1OIAA 2DGWA 4J9NA 2BZ2A 2QMWA 3GE9A 2M4MA 3PX0A 3PHTA 4EK2A 3R5DA 1GMVA 1OWXA 1KFDA 4DV7J 4ANEA 1LOUA 1E6VA 4CO4A 4ZK7M 1WDTA 5K8OA 3M9NB 1VYAA 1GX5A 1M1HA 2IDLA 2CJ9A 3M32B 5D4LA 1N5YA 4CO0A 3KLVA 5KFGA 2DGTA 3D6MB 2MB0B 1JLFB 3RR7A 2HPUA 3S6EA 4FBTA 2G0JA 5MAOA 1U26A 4X62J 2DPJA 1XNQJ 5KFNA 5J2QA 3AD9C 4USHA 2YNFA 4YFUA 1UJ5A 1I94F 1RTDA 5AXMA 2BUNA 3D6TB 3DRPB 2DVIA 2AJ1A 3D66A 3ILJA 4L6V3 3GG1A 3KDOA 3ILOA 1URRA 1X4DA 4WE1A 1J2VA 2IPOB 2G1HA 1YRUA 2CQPA 3L09A 4KC5A 3JYTA 1TKDA 3OSNA 1XMBA 2RNEA 4CCHA 5HANA 1KQSR 1AZSA 4HLBA 2ZH3A 3OXFA 5AE3A 1Z4UA 1FWLA 1FNMA 3SDEB 3CGIA 3IGVA 2BJ9A 1TKZB 3CEDA 3FBEA 3ZZ0A 5KT3A 2J0SD 5KFIA 2MQ8A 3A8IA 4JBCA 3DLGB 1VR6A 4CLYA 5KAKA 4B3OB 1JQGA 5B0FA 2MSSA 1X8DA 3CB4A 2DGQA 5D6GA 2WVDA 2GMJA 4ZIWA 2PEBA 1UW4A 2VFSA 4RU2A 1PYOB 4EYIB 3M8SA 1XIQA 4ED6A 3VAIA 3SV3A 4HACA 4NE9C 1Y0HA 1KKHA 3D67A 2OAUA 1WEXA 2VG6A 4M5KA 1KEKA 3T1YJ 1QAIA 2V2ZA 2CG4A 4HTJA 1XR5A 1D9AA 4WFXA 2Q79A 3OL9A 2RF2B 3I9V9 2HS0A 1CS4A 3BQ2A 5HN0A 2D9PA 2FHOB 2WONA 3VAJA 1KBRA 1M5PC 2W1BA 4K5RA 3RB3A 3GYNA 2PFDA 3QWPA 4OMFG 5D0RA 2HW3A 2KHDA 4M5DB 5GAHU 1M5KC 4U95A 2M70A 4DSJA 1RAFB 2MZSA 4F4AA 2BOPA 4DL5A 3EGZA 4I7FB 5F0UA 1D8ZA 3PJWA 2JLFA 1XTZA 4GKKJ 4DFKA 1S9GA 4GRSA 2IYGA 5SUHA 2BJ1A 3SQOP 2CKWA 2H4WB 1PG5B 4WP8A 1D0EA 2LQ9A 1AUDA 3IS9A 1OSDA 4Y2KA 1S1VB 2NZ4A 2GV1A 2VG5B 3X3UA 3SYZA 2XNRA 1S48A 3MMCB 2FUG9 4RUHA 1Q5VA 4U96A 2UUAJ 4NLGA 1V5VA 5F9LA 3ET6A 2ZITA 1BQNA 1CULA 4YN3B 1RKJA 4DR4J 3E3XA 2Z57B 2H4YB 2VUGA 3QNWB 3V6HA 1CLFA 1TL3B 5T7LA 2C22A 2UUAF 3IN5A 1S1WB 3G2XA 5EN1A 2GIQA 2NSCA 3EICA 4B3SF 3CCJS 3K5OA 1L3SA 2BEFA 3BEGB 3BBFA 3H2VE 5HROB 4CO5A 3MF5A 2UUCJ 4K4VA 5FJ4A 4G65A 1FJ7A 3LPEA 5DG9A 2DH7A 1HNWF 1ZOTA 3D3CJ 1TL1A 1VQYA 3UE2A 3TZXA 1V9OA 1DARA 1R6YA 3JSRA 5HP1B 3K0JA 3PKMA 1BMQB 4EI2A 1S1TB 2X1BA 4IH6A 2RVJA 5KFVA 4ZPWR 2HIYA 4DN9A 3VV2B 4X4NA 3BGRB 1UVLA 1KN6A 2XMAA 5D78A 3AB4B 4W90B 3RTVA 3CDAA 3Q86A 1Y7PA 4LR7A 3T9NA 4HDHA 4ZVFA 4TU7A 3WDOA 4O3PA 2DNQA 2E29A 3I5CA 4D3HA 3SFGA 2QX0A 1SI9A 2KL8A 4BC7A 3M9OB 3V81B 1W2BR 3IA0A 4EBDA 4NX9A 1CJUB 1D3WA 2HRYA 3QAUA 1XMOJ 2P5VA 4C11B 4B3MJ 4NMLA 1NSPA 1X4CA 1T8EA 1H6KX 2HSEB 3MMAB 2JEJA 3V6KA 2UUBF 1HWUA 1NSQA 2V5HG 1P27B 2BMBA 1M0SA 1U48A 1RAEB 4CLKA 1MSWD 2Z58B 2HHSA 4P2MA 4EZ6A 4LF6F 1UCNA 3P5TL 3NG8A 1TKXB 1HI1A 4NEZA 2DIVA 4WE1B 2FZGB 3ZNJ1 2IRYA 3FZBA 3T5HA 1LV5A 2KT2A 1VRUA 5KFTA 4GMKA 2JLEA 4DPWA 1FCAA 2ZHAA 2OTLS 2OPRB 4OV6A 4XDCA 5CYMA 1VDHA 4BWJA 2R9LA 1RADB 4YR2A 4IFVB 4N56A 1X4BA 1P1LA 3BO2A 1VBZA 2Y1RI 1RQ0A 1SXLA 4KO0B 3SDEA 4QOTA 5IFMA 3T1HF 1S6QA 4BWMA 3G8QA 4TU8A 3SIPB 2RRBA 1FI4A 3DXSX 4I6WA 2JLGA 1OSCA 1ZTWA 2VJVA 1VISA 2FGCA 3VVTA 2ERRA 2KTQA 5HAOA 1SUQA 3M7VA 1HNIB 3GQCA 1N5QA 4QIWD 4DR6J 1O8BA 1IKVB 1IM6A 1GMWA 1HKAA 4DBQA 3MR7A 5E5NA 2DNRA 2PN6A 3GLJA 1U45A 3EVOA 1PIEA 2HMIB 2KI2A 3GYXB 1WEZA 4WXOA 3QFWA 2XMUA 4F50A 4JOUA 4JI2J 2O1PA 4NLVA 3JSYA 1WC1A 2OI2A 2GVZB 1FWKA 2YBVA 1DLOB 3FC9A 1VQPS 1KTQA 1ZM4A 2CPZA 3KKFA 1NJXA 4RU9A 1TR0A 2CQIA 2RRNA 3ISZA 1SKWA 3DM2A 2X1FA 4M5DA 5DS7A 3PIOQ 4AT1B 1FRJA 2F8HA 4NEYA 3JSMA 4QYZJ 3V5RA 2QLBB 2AEJA 2JNJA 5DLGA 4OZ3A 2DTJA 3A12A 4TYAA 3N01A 4MAKA 4AE5A 2K7KA 4QWCA 4YQWA 4EYHB 2WVEA 2XTJP 2WW4A 2QN6B 3GPAA 5C2GA 3T5KA 1N4LA 1JLAA 2M8DB 1WF2A 3VQSA 2XY5A 4IR1A 2RQCA 2BA9A 1Q7YT 4X4PA 3K59A 1S59A 3B82A 3PRBA 2U1AA 3POTA 4ED8A 2XY7A 2V2QA 2B9XA 2RAQA 3HSGA 3R9LA 3OXLA 2Y9HA 3G82A 1UL3A 2CWXA 1QAJA 4K4UA 3EZ5A 1BLUA 1H3DA 3ITHB 3N9UC 3IR7B 5JUMA 2R8IA 4X64J 3PKYA 2WHOA 3DNCA 3DYAB 2QEXS 1YBUA 1G4CA 3NGDA 5HLFA 1QSSA 1LWFB 2BRKA 3ZTQA 1HBNB 4IR9A 4Q7AA 1KC8T 1FF2A 1P6TA 4F67A 3UQSA 3KLEB 2GGPA 2V8HA 4A8FA 2MKIA 1NCLA 2MZQA 1RT5A 2R8JA 2QA1A 2W4DA 4FXDA 1XQIA 1I6JA 1G7CB 2OEMA 1WKLA 3FEXB 2EFPA 4XPEA 2V8PA 5A8WA 2LXIA 3LA0A 3QPIA 3SSSA 2BANA 1WSVA 2EBGA 2YVSA 3CJ8A 4CLWA 3CDEA 2W2OP 3P8BB 4QR0A 4CO3A 5J2NB 4C9DA 3EXCX 3W2VB 3CJTA 1T11A 3TJAA 3IAM9 5ETRA 1IVZA 3DRSA 3Q83A 3TNVA 2DR8A 2D69A 3DU6A 4O3SA 4PPDA 1S5ZA 3PW4A 5IT0A 3AQPA 1RBOB 4LF7F 1I51B 1NJYA 5ETQA 2EK1A 2JC0A 4DV1F 3SV4A 3PW2A 1VFJA 1Z2ZA 3MM7B 1BGXT 1K44A 1F1BB 3GJTB 3MECB 3M6XA 5BYSA 3SCKE 2XQCA 3J7AN 3GU0A 3HLUA 5A6WA 1FTRA 4DR1F 1LWXA 2D3OR 4KHPJ 2YXLA 2DHHA 3WC0A 4LFBF 1MROB 2HHQA 3LALA 2OFGX 4P2SA 4MIBA 5DZ6A 2CQ0A 3UPFA 4CTAB 2KXNB 2V94A 3ZZUA 3DI6B 1VC0A 2CQCA 3OPKA 4K0KJ 2IBOA 3K89A 4DUZJ 3MM9A 4U7UK 1MWYA 4AL7A 2RIJA 3LP2A 2VFRA 4ECXA 3BS9A 3NGKA 5DDPC 3OJSA 5E3PA 1SJFA 3H4DA 4ED2A 3QAEA 4Q8EA 2M8HA 1YJNS 4HKQA 2CIMA 5DG7A 1O51A 1TFWA 1IJEB 1M5HA 5B0CA 3CCVS 1R43A 1SIWB 4OYWA 4RWWA 4R8UB 2NSBA 4QIGA 5THWA 4DG1A 4ZVTB 1VBXA 1H72C 1X5OA 2PD1A 3KLGB 2XYHB 4OHXA 1GAOA 3MCSA 3JTOA 4YUDA 2FVSA 1NDCA 2N4DA 3EXYA 2OPSB 5J1NA 1XNQF 4USVA 1IWAA 3ULHA 1HNIA 3BQ0A 4DR1J 1FKOB 4ID8A 5HSPA 1CVJA 2FZCB 2CADA 3NOCA 1QM9A 4LVNP 3H20A 1HW9A 4M5MA 4ZVHA 2DHGA 5AJ3F 4XAKA 5CCLA 1FNXH 4Y0FA 3IRWP 3CD6S 2YWEA 3H25A 2CZ9A 2XULA 3MPUB 4ZMMA 2FJWA 2IFXA 3MFHA 2C2RA 1VI7A 2AHOB 3BDPA 3M1VB 4J9RA 2VFTA 1NDLA 4ZIVA 1V3SA 2OMLA 1SL1A 3DXBA 2RB7A 3CCUS 3CULA 4HACB 1EARA 4O44B 4ANCA 4B9LA 4QYZK 1E6VB 2YNFB 1CBKA 1LWEB 2RS2A 3C14B 4JI3F 1YJUA 3KYLA 4F4YA 2VU5A 1HA1A 2MMYA 2WVFA 2ZVIA 2YY3A 2N7CA 1RHRB 1VIOA 1WI8A 2WW8A 1B3TA 3HZEA 1SCJB 4ZDNA 1F3FA 4IO9Q 2FLLA 3I55S 4DI6A 4J37A 4V19X 4PWDB 3HD2A 1FDNA 1K1SA 5IT9U 4P52A 1N34F 3NLCA 2APOA 3GFYA 1NXIA 1X60A 2QC3A 1NNDA 2QLWA 2YWKA 1EQMA 2BM1A 1UW9A 5LSOA 2KM8C 2VICA 1JLGB 3HVTA 4ZA1A 1Y00A 3H5UA 2VA3A 1FD8A 1WG5A 2KVQE 2ZUGA 3TUZC 1CSJA 1UVIA 5KFYA 1K0TA 1RACB 2NXEA 2W2NP 4I2PA 3HZGA 1QE1B 4NLWA 1WG4A 4UTGA 2MLXA 3V4IB 3DLLQ 1RAOA 2WSEC 4OHVA 3CJRA 1S4EA 1FRHA 5B0AA 1TK5A 2BJ8A 5A76A 5D3GB 3DM2B 4C6AA 4KTQA 1S0VA 3FVYA 8ATCB 1JLBB 4NLYA 1RT7A 1WD6A 3I0RB 5D0GA 2XGQA 5K9FA 3WZ0A 1RUSA 1EP4A 1HNXF 3U1MA 7FD1A 2YNIA 1PBUA 1KWMA 2BJDA 4IOCQ 1NO8A 1W2IA 4PG4A 4RW9B 3EZUA 1ROFA 4ECYA 4DF8A 2DXFA 2AGQA 5D4OA 4OX9F 3OSPA 1S9FA 5KFWA 1WNEA 1NBEB 1TVRB 2ROGA 2H1YA 5IV4A 4LRBA 1ZTTA 5KT2A 3TX0A 1TU0B 1XR7A 2J8SA 1HHQA 4HVZA 3KLFB 4DN0A 3MR3A 1S6UA 4CH0S 1T94A 2Y0BB 1APSA 1YTYA 3FMWA 3VAHA 3HCXA 4M5LA 2R8KA 1HW8A 2V4JA 3D6HB 4WWSA 3PW0A 2GGPB 1L5UA 1DZ5A 2XS5A 2RDIA 3O1LA 2WZ1A 2XM3A 2QMUB 4A8QA 2BBEA 2COLA 4DF4A 1FRXA 5LXYA 3CJKA 2DK2A 3DI6A 4ENOA 3RAQA 3S7RA 3CD5A 3BO4A 4TN2A 4A48A 2ADBA 2FVPA 1XNRF 2UXDF 3WIVA 4WCEQ 1NK4A 1SJ4P 5KG7A 4KFBA 4ZPTR 2MXYA 4LBHA 2OELA 2CQ1A 3TARA 2NXCA 3A3PB 1L3KA 4DSLA 3NP5A 4F0KA 2IC3B 1QTMA 3CD7A 5I42A 5GMEA 2MQNA 5AXKA 2LFVA 3KNAA 5HI7A 3AA8A 2MZRA 2WB1D 3IG1B 4KYZA 5M2RA 3UDEA 3ZTPA 5HJXA 2CZVC 4HH1A 4PWUA 3ZXWA 5BR8F 1JXEA 3D54A 4Q0BA 2ZC3A 2ZM6J 4M5HA 2R7SA 1FEHA 2VOOA 1CPZA 4FXWA 4LSZB 2DEJA 2YQ0A 5D0EA 4QR2A 3DOMB 4ZN3A 3PX4A 2FD2A 3BGRA 5EX3A 2QA4G 1XNRJ 2RUGA 3EX7B 2UXDJ 5HQMA 2W7PA 5SZTA 4DV4J 1EKRA 5L39A 4NLUA 4UZCA 4MIWA 4WPAA 3PRDA 5IS2A 1U25A 2F7VA 4DPOA 1VC6A 2M88A 2RDDA 1GT8A 2NXNA 4OQJA 2UXBF 1N33J 3KHRA 3G4SS 2K3KA 1KFSA 3RRGA 3IBWA 4NA1A 2CQ3A 2C2NA 3CC7S 1RB0A 3MGJA 4HI2A 1RK8A 2M0GB 3HVRA 1R89A 3MMAA 4J91A 5E7OB 2H65B 4A8KA 2DISA 4RW6A 4J5OA 3UDVA 3MZIA 3N5FA 2CJKA 5B7WA 2DY1A 3Q8UA 4C11A 3M2RB 1U4BA 1R8CA 3BB5A 3UN2A 4PWDA 2W7OA 2N82B 4F2RA 4QCLA 4X4UA 1ZZFA 1NPRA 3S1TA 1JLFA 1XEZA 1A6LA 2Y1JA 5CZVA 1TKXA 3JSBA 1FRLA 2XWYA 4DSEA 4G1IA 2B8QA 3UR0A 2KFNA 1HMVB 2ZDPA 2DCUB 1KOHA 2F8EX 4OJ3A 4F25A 1UJ6A 1YGYA 2GMLA 4I4BA 4K4TA 2GO9A 2W01A 2BW7A 4LF2A 2LP4A 3OD2A 3CCTA 2W2QP 4MJKA 5A8RA 2CPXA 5DETA 5HMXA 3LPYA 4NRTA 1WHYA 3JXOA 2VOPA 1QVFR 3D5MA 3OTBA 4ZJQA 1FKAF 1HQEB 1WKJA 3OHBA 4C8KA 5D3GA 3GIIA 5IM0B 5DDOC 2QMXA 2D41A 1LK7A 3NS6A 3WHIA 2R2RA 2OSQA 1RWVB 3I87A 5HVFA 3CCWA 2EG2A 3I0RA 2LQ5A 2MHEA 3OTDA 4B02A 5HMYA 3MPYA 4KHPF 3QSYB 3J7YU 4UF4A 4OLPA 1IKVA 3H42A 4C0BA 5HJYA 4RW7A 1U49A 2CPYA 3VWSA 1TUWA 2V68A 4Q2MA 3PO5A 1U2CA 1C1BB 2DGOA 2J0XA 2Y0SD 3CSKA 4DV1J 1FFWB 2E9TA 3DOLA 2VZ9A 4P6QA 4MH8A 1SJ3P 1F9EB 3I56S 2VB6A 3QRRA 4ZCIA 4B9MA 2WSFC 5H9EJ 4URGA 4N41A 2CRLA 1HNVB 2DIUA 3O3LA 2G1DA 3ZTRA 3HXMA 2LMIA 3T1YF 5KFOA 1C2PA 1DRZA 4Y34A 4M95A 4L76A 4AD6A 3GG0A 3EM1A 4H4KC 5L9XA 2CVEA 1S6QB 4CT9A 4LF9J 2CPFA 2ILYA 2GZOA 4H54A 4ID5B 3C3LA 2HQDA 3JYTB 4RX6A 3J81j 3G96A 2R2SA 3DCAA 4K8RA 3BBCA 5J2MB 3KHGA 1AZSB 3VCDA 3N0VA 3D28A 4MTPA 1HBOA 2YKMA 3R5GA 4L72B 5KG4A 3TWZA 1Q4RA 4LF9F 3C6TA 1HBUB 2VC0A 5KG6A 3M8YA 2HHUA 2B9YA 4CYUB 2ASDA 1G6BA 5D77A 4RW4A 4I67A 4JI8F 4HH0A 4CLLA 3PACA 3PG9A 1R8BA 4F3QA 3AT1B 2W9BB 2C3MA 1M5VC 4JUZA 2V50A 3J7A1 1F2GA 3IS9B 1X31C 5A8WB 2OJ3A 1R0AB 3DLEB 2G2ZA 4Y2IA 2XLJA 3A3NB 2VKZG 3N6MA 1VQOS 3E51A 2FZKB 3AAWB 3DDKA 5HMWA 2LEBA 5GADU 1R0BG 1WC6A 3CW2C 1MMLA 2P8IA 1JNRB 3HF5A 3IRXA 2AJ4A 5KFAA 4C8NA 5HLFB 1CULB 2LU1A 3BR9A 3CD0A 2UV8G 1IM4A 2Z56B 1MN9A 1LFPA 2H5IB 3HSZA 3KDNA 4S0MA 2J0QD 4ZPBA 1ACMB 4OJGA 1KVIA 2HZCA 1Y4ZB 2B7CB 4W4MA 2PFFB 2W4PA 5ADZA 3R1LA 4ILMA 1VRQC 2R7RA 2M5YA 2MKKA 3RB4A 1XMQJ 4UY85 3TZWA 4JV2A 3CJ2A 4K0KF 3FQLA 2Q43A 4KGVB 2C28A 1T3NA 2DNKA 2RQKA 3B78A 3H40A 2VQEJ 1S12A 4K4XA 1LK5A 2XMJA 2VC1A 2EFOA 1HI8A 4GVLA 2XHWA 2POKA 1RLCL 2GC8A 1R0CB 1WSRA 2QO3A 1I1GA 5EWGA 4D3GA 1Y3JA 2D3UA 5U47A 1IKYB 1NH7A 5FDLA 3ZC4A 1LW2A 4AUKA 4DLGA 3FBBA 4AL5A 2V8VA 2DNMA 5KFCA 3MM7A 3EUNA 1OQ3A 3EDQB 4B9UA 1VJQA 2LCWA 2KRBA 4F02A 4YB5A 5KFUA 3TQ1A 4DHVA 2J7KA 2M7SA 5EWEA 5AJ3J 2X1GA 3VGSA 1DJ0A 1WTFA 3G6VA 4KAIA 3ZZTA 3GILA 3TANA 1S10A 1WOPA 1WC5A 2Q6CA 3MI7X 3TW0A 4E8UA 3MMBA 4UQGA 1SV5A 1HNZF 4EU0A 4WJBA 4B3RF 4C8YA 4JI8J 4LF1A 5D0HA 3UWTA 1B0VA 4U9RA 1CJVB 2Q1LA 1BQNB 1IKXA 3GSDA 3M8RA 3Q22A 2EKYA 4J9QA 3AY0A 1SH3A 5L1IA 3R2CJ 1P9YA 2YPYA 1SH2A 4PEOA 3QT7A 1F2HA 4W92B 1Q8LA 1TP7A 3OFHA 2ZUAA 1R8PA 4JI2F 4CQ1A 2UVUA 4EO6A 3HHDA 2HHHF 3D0GE 3AA9A 4ECQA 2HHVA 2CJAA 2HIQA 1RCOB 2FDNA 3MEDA 3DKDA 3TRGA 4DR2J 2HGLA 1YJVA 4JI1F 4OIXA 2BQRA 2IBKA 4AQYF 5IWAF 1VJWA 3FMBA 4ZP8A 5IV3A 4KGXB 1MWZA 1ITPA 4HT7A 1RHMB 2PO4A 3J81Y 2CWKA 2AX1A 4B9TA 1FE0A 4QWBA 2E5IA 1L3TA 1RBLA 2AP6A 3O2IA 1DQ8A 3HVAA 3GTYX 4KSEB 5CXTA 3PY8A 2MQPA 1PJ6A 2BKOA 1PYTA 1S57A 1T9YA 2VFUA 4UW2A 4QW9A 2ASYA 3UCZP 4YMEA 2VBWA 3BKFA 4LFCF 2CXEA 2YWGA 1MW7A 2YNHA 4DEZA 1ZZNA 3W2WB 2DKOB 1NK8A 2KN4A 2E66A 2IRXA 2GQQA 2XBPA 3UDCA 4B17A 2G9OA 3QWUA 1SC4B 1HHTP 3BSOA 2CQ4A 5ETMA 3NS7B 1TKTB 3KTQA 2VG7A 3PW5A 2MKSA 3FCVA 2VODA 1D9DA 2EXUA 2SXLA 4F4XA 1RT7B 1QSLA 3DLEA 3VVUA 5AE1A 3L3CA 1OY6A 2ZKUA 3VGVA 4WP9A 5AXLA 4KV8A 2B56A 2QL7B 2XMWA 3ZFVA 2FY1A 3BDEA 3DRRA 4QR1A 2HS3A 2W24A 1M1KT 4FF4A 2DCLA 2P9EA 4DR7F 5F41A 3L7PA 3T1HJ 3KUHA 3N79A 4DL6A 3MWBA 1TK0A 2HHWA 1MWQA 2BM0A 2ZOGA 2VHGA 2R7XA 1VOMA 3DGPB 4ZVUB 5CH7B 5CCMA 1AW0A 2DGVA 2KJWA 4YP3A 3NNHA 4ED5A 2DHSA 5D8HB 1RSCA 5F8NA 4FPIA 1Q82T 2E5HA 2OPQA 3QJLA 2KXHA 2AIRB 2H3EB 2LVWA 3MM5B 2CZ4A 3GJQB 5IT4A 4KIAA 1S0OA 1Q0NA 1VHIA 4F3OA 2G0IA 4FYWB 4IQXA 4RW4B 2AGOA 5C24B 2DRBA 1TVRA 2B6AA 1JLAB 3HSJA 4GO5X 4WXWA 4TY9A 1X5TA 3FZ2A 4DR7J 3QLHB 3BBBA 2CNLB 5H9EK 2EC2A 2ZZNA 2BW2A 2LU2A 1E6YB 5F3TA 4I2PB 1GEHA 4DUTA 2DRAA 4MKAA 2V4JB 3KLHA 4DPTA 2CPEA 3PJXA 4CLFA 2R2TA 2EEYA 5KOXA 2DNLA 4Y3CA 1MMDA 1RYSA 4EO8A 1CJTA 1U1PA 1NDPA 1OO0B 1Q1KA 4X4TA 1VMBA 3MPVA 4I69A 4NYZA 3RJMB 3OVSA 2QFJA 4DV5F 3RBDA 4J9PA 4WKYA 1RGVA 3GR0A 3RAXA 5CAAA 2HLUA 2WCXA 3OXGA 1EJ7L 3KHLA 4WTOB 4B9VA 3CJKB 2QFIA 3FSXA 1Y9OA 2HNZB 2JHEA 2KKHA 2ZOFA 4DPYA 3NGUA 2K8GA 4RBUA 4C48A 5HBMB 1YBTA 1U2RA 5FLXY 4U67Q 3RB0A 3S01A 3UCUP 2JRSA 2CG8A 3BSCA 2WOMA 3Q2SC 3TAQA 1C1CA 5DJBA 4NXNF 1QDUB 3MXHP 2NS1B 4X2BA 2FJBB 4ECRA 3TVZA 1U1RA 1UFWA 1YK9A 2P9GA 1V3RA 2IC3A 4LRDA 4N8OA 2Y1IA 4DL7A 1B7FA 1S9EB 3KK1B 2MSTA 5K5MA 2HFVA 3LGHA 3AOCA 3E01B 3LW5C 4K4SA 1H2VZ 1H2TZ 2RQ4A 4UUXA 4C0OC 2JEFA 4C8ZA 4G1PA 4QU7A 1U0HA 1ZM2A 1Q8IA 3DOMA 3K2YA 3PFOA 4Q0BB 3I0SA 2NCKL 3GJRB 4MMOA 3NAIA 1PJ5A 1RU2A 2DO0A 4OYIA 4DQSA 2H54B 3NY0A 2I5JB 2DT9A 3MMJA 1FHTA 3P45B 5IOLA 2KFYA 2W9CB 3G8SA 1VGYA 2PE8A 4X4OA 3T5JA 1OY9A 3DLBA 1H73A 3FGVA 2KYXA 4CM2A 2GHPA 1GTEA 1IBKF 1FKPA 2IMWP 1WC0A 2R7QA 3C6UA 4WFZA 1ZH5A 3KK3A 4W98A 5ETLA 3GV7B 4ED7A 1HYSA 1KHVA 1YJTA 2AJFE 4AFFA 1AXQA 3RBEA 2VPZB 1U6ZA 3NBPB 3IG1A 4LRCA 2KFZA 4ECWA 1CJKA 2JOQA 2DYAA 3BM7A 3NWGA 4NWBA 3CDWA 3MCOA 2YNGB 4DOZA 1BD6A 1LKZA 4B3RJ 4QWAA 4DV6F 4USMA 4ID5A 3NCRA 3KLGA 1JLEA 3UVJA 4WIIA 4AXJA 1C4CA 2QG9B 1TFYA 3C66A 3FBCA 2FHKA 2BACA 3CIZA 3L4BC 3GZ7A 5KT7A 1NAQA 3OTEA 1HWJA 2AEMA 2ZNYA 4PCQA 3V6JA 2F4FA 1UWBA 1A0OB 1JXLA 2W9BA 2HQGA 4L3KA 5AT1B 3HVTB 4FZVA 4P71A 2WBRA 4WBFA 5D4NA 2D9OA 4C8MA 2CQDA 5A8KB 3EVWA 2MZ1A 3BPDA 1YJWS 3CNQP 4EZ9A 2WK4A 3M2VA 3QIPA 4LUBA 1KDNA 4XO0A 4P74A 5CD4A 2CQ2A 1RLDA 1F9HA 1SQGA 4HYKA 2V4RA 1KD1T 2GA7A 2HLTA 5EWFA 5IM0A 1AUSL 2RQMA 4NRUA 3TA2A 2I2YA 2LXFA 2NLWA 2C2ZB 3DOLB 3FSIA 2HFZA 5L8RC 5JVHQ 4PQAA 2OPPA 2VDHA 4CLSA 3THPA 4QZVB 1S1XA 3MCNA 1JJ4A 1HNVA 2CPHA 4DS5A 2AW0A 1VQ5S 2E1PA 4WU3A 2E5LF 4HI1A 4A46A 2G0CA 1N5TA 1S97A 4F4WA 4PRFA 1UP1A 2UXCJ 1BE4A 1RT3A 1HD0A 4CYUA 3SQGA 4IKAA 3PIPQ 1B4SA 1CQNA 1VBKA 4H4OB 1AFJA 3OL6A 1RHKB 1S7HA 2ZOMA 1W7WA 9RUBA 3OBIA 3X1LB 2AT1B 3UFCX 1BWEA 1KVJA 4MT1A 1O6XA 1W26A 2AF6A 3QGHA 3JQMA 4OYBA 4A47A 4A8YA 3R5CA 1CJTB 2ZBQA 4DX5A 5I3QA 2QA2A 5ETVA 2LXUA 1UZDA 3TUPA 4HT5A 4N8NA 2MEWA 4IQMA 2XCPA 3MUVP 4NYPA 4DZDA 1SKUB 5IQQA 4CLZA 5KTQA 2D3ZA 2E1MC 5HROA 1T7PA 4IRKA 4ZP9A 3L7OA 2OGUA 1RU1A 2P9CA 4LRFA 3KHHA 2HVDA 1EAYC 2PA8D 2VQEF 1HBUA 4ZLLA 3JB9k 4PKDB 4ED0A 1S6PB 3GIMA 4OYMA 3W9IA 4X66J 3EGVA 4USTA 3MR2A 2RD5C 1VBYA 4I1TA 3CVKA 1EP4B 2ZWPA 1U2FA 1GXUA 3AODA 4HTIA 4EFAC 4R5PB 3P49B 1GK8A 3PCOB 2LQJA 5KG0A 4JI5J 5DDRC 2M9KA 2AX0A 4U7CA 2BABA 2V34A 3GFXA 2ZE2B 2AMCB 2R4FA 2G2OA 4JV0A 1C0TB 4O4RA 1KQKA 3FKBA 3RBXA 2FLNA 1Y3KA 1RT1A 3QT8A 2HFNA 2FLOA 2I0XA 4BLGA 4PAAA 1HFEL 4Q5VA 3K57A 2YH1A 4Y65A 5GAGI 3MEGB 4NLRA 2BDPA 1UJ4A 5KFPA 2DITA 3B8HA 3DLHA 1DQ9A 1BY9A 5J2PA 4PQUA 2DR6A 2YNIB 4N5SA 1N6QB 1YRXA 4DX6A 3ONQA 1NKBA 2B5JB 3D4JA 3P6YC 3D7SB 1FT8A 4C3LA 1FX2A 3K5NA 1XBWA 5DZ7A 1YLXA 4M1KA 2NQPA 1LQ9A 3SBMA 4CLTA 1U6FA 3DHXA 1WC3A 1VQNS 1FD2A 4PXCA 3MAQA 1QUPA 4EBCA 4LSLA 1BQMA 3A8JA 2IVMA 2XMTA 4FVCA 4N47A 4DQRA 2FGOA 3H90A 1ULRA 2DRDA 2X3DA 4QYRA 2ZH7A 1XR6A 1RCXB 1LW2B 3D9BA 5CHCB 3OHAA 3ENQA 2IA6A 3QJJA 5IT9Y 3U27A 4ECVA 1MMNA 5GAGU 1BQXA 1SC1B 1MNEA 4WKRA 1RT6B 3MAAB 3M9MB 4DSFA 2UVVA 2WB4A 3AD7C 3H2LA 2A18A 3EVMA 2F8MA 1U8SA 1RWPB 4RUBA 5GAEI 2LA6A 1T95A 2EFGA 4PG5A 2GJFA 3MD1A 1X0FA 2C2KB 5ETKA 4DR6F 2EPIA 3IO1A 3HULA 4B3OA 2XMKA 1NZ8A 4NI2A 3MEDB 4ZP6A 1OQ6A 1GMWD 2DR9A 3BH6B 3T1AA 4MK8A 1K73T 2CJBA 3G6YA 5D4PA 5C7PA 2VBZA 1N0UA 2VA2A 4JI7F 1GXTA 2P6TA 4WTYA 2J7UA 3EZOA 1BHNA 1DURA 4ES3A 1DAXA 1ZPVA 1RTIB 2UXBJ 3NBPA 3DRRB 1PYSB 1T03A 2V8GA 3KG4A 3GR1A 3FK4A 4DJBA 1VQ9S 4XPCA 2L9NA 2J7WA 4NXNJ 1VC5A 5KFEA 1FJCA 3HKWA 1HPZB 3QGGA 1TKZA 2G4BA 1CC7A 3A13A 2MLYA 4DXLA 5GAHI 4WF9Q 5LJ3Y 2YQ1A 1VQLS 1JLEB 1T0TV 3MDFA 4XIUA 5JJBA 1OMSA 2VPYB 4M63A 3W2WA 3OVAA 4X4QA 5F8LA 2CQGA 5IWAJ 2A1BA 3W64A 2YH0A 4OZLA 1UFLA 2NYHA 2RS8A 2W4CA 2V8DA 4KGKA 4FS1A 2ZBPA 1IBLJ 4KH0B 1R8AA 2BE9B 2VKRA 4DS4A 1WG1A 2DR5A 3F41A 4I6YA 4WYWA 2X3GA 4FYVB 4ZCKA 2FQQB 3K7RA 4O3QA 1H98A 1CS4B 4MKYA 3CCRS 4DX7A 3TAMA 4C2MA 1G2EA 4ERDA 3IBCB 2Z8QA 1Q78A 2B4OA 3NWRA 2ZJPQ 3C2PA 4F3MA 3KLHB 1KLMB 2GQ2A 1YIJS 3MD3A 2VG6B 3JS9A 4LJMA 1RT5B 2HBYB 1HBOB 2YKMB 2EBEA 2C3OA 5F8GA 1F9FA 1YZ6A 2CAJA 3M30A 2E5JA 1NLKL 2IYIA 4BDPA 3GWCA 5EDWA 2JJ4D 2KDOA 2OPPB 4ED3A 4NXMF 2DHXA 5DQIA 4QIVA 1K0VA 2UUTA 2DH8A 2IMOA 4JYAF 3PJ9A 3I4HX 3EWGA 1EETA 1MU2A 1Y11A 2AYEA 2QGFB 3O6QA 3SSRA 3MR6A 4FF3A 1UPPA 4ZPDA 2UUBJ 5KT5A 4YDDB 3EGWB 3ZZOA 4ETZA 1U6BA 4LIRA 2GFFA 5DGBA 1T05A 2HKEA 2FVCA 4ZLNA 3TA0A 3A8EA 3EDRB 4TLRA 2RKIB 2OD6A 3D6FB 4LVOP 4CWBA 2XZWA 5ETPA 5T14A 3OL7A 5ETNA 2IRUA 5LJ5Y 5LMUF 1RAJA 2Z2LA 2KO1A 3DHWC 1IBMF 4LT6A 2LQBA 3KK2A 4JV5J 1D1UA 1OS5A 2G13A 1TELA 4L75A 4M5IA 2MGZA 3FQKA 3IWXA 4OZNA 2QL5B 2B6AB 3VAFA 4PUOA 3PYFA 2CDQA 1HQUA 1SC3B 1OYDA 1QAYA 2F4VJ 5F8MA 4O4GA 3U02A 3CXCR 2I5JA 4TU9A 4KR0B 1S9GB 1NM2A 2V6AA 1S1TA 3OR1B 4DV2F 4DFMA 3LQVA 4ECUA 2YQ3A 4CNZA 4PXBA 3Q89A 1NK6A 4J9VA 1H38A 1N5VA 5IXUA 4GVBA 3AXKA 2AJ2A 4ZHRA 3KWMA 4ICLB 4O3RA 1TK8A 3J80Y 2AV5A 2HNZA 4L3NA 1VQKS 3NNCA 1QAXA 1UWAA 2BXJA 3GONA 2N3OA 5L1LA 4HL9A 5KG5A 2BOAA 5K8MA 2FB0A 2QZ8A 1HR0F 3G6ES 3M2UB 2CPIA 3DOKA 3EMTA 4KT0C 4QBUA 1RWUA 4ZVPB 4ZLPA 6FDRA 1VRUB 4JI0F 4ZVGA 3W1YC 2N7YA 1AROP 1RABB 2GHWA 2A10A 5F8IA 4ELVA 1VQMS 3AD8C 1N33F 5LSLA 3ENAA 2ZDOA 4PQUB 3V81A 4IRCA 3LP1B 4DQPA 4NMXA 3HT3A 1V3ZA 1PAUB 5DLFA 4DR3J 2CYYA 4P72A 3OUYA 3B6BA 1ZM3A 1NDKA 2IDEA 1P1TA 5AE2A 2B4UA 2HS4A 3HX9A 3CCQS 2IY5B 1MN7A 2Z0GA 2BR0A 2MJUA 2MPUA 1EHWA 3MEEA 2HYIB 2B8PA 4G1QA 4YR0A 3AB2B 5K8PA 1RZMA 4JI3J 3DLKA 2LDYA 2BQ3A 1WHVA 3MURP 4KGMA 4OYPA 5F9NA 1HARA 2GX8A 1PAEX 1REVA 2B0GA 4DPXA 1NB7A 4OYZA 3OTCA 3KK3B 1IN0A 2ACYA 2V2KA 1IKYA 2AGPA 1F3VA 1S99A 4DU7A 3C16B 1SPBP 5HVGA 1PC5A 2C2OB 4DV5J 4USIA 1PC4A 2YKPA 5DQGA 2Q6BA 5KFBA 4Q44A 2JEGA 4PXEA 1WHWA 2R3VA 4QW8A 2VDIA 3JAMY 3FSYA 5JMNA 3TOQA 3J7Z5 1JX4A 3W8GA 3JSMB 1LW0B 3VZHA 1NHKL 2PI4A 1Z2LA 2X1AA 4UOGA 4C3MA 3G86A 2XEXA 4XTTA 2CPDA 1RWXB 2VV5A 5C25A 3FUYA 3FBFA 1RHJB 1K8AT 1N5YB 1CJKB 4YR3A 1QUVA 4ILRA 3TO8A 1O5JA 1KHWA 3CMQA 1ZBTA 3OV7A 1HWKA 1NHVA 2E7WA 2JVRA 2ATCB 4Y2CA 1XC9A 2CA9A 3LUYA 3NEKA 2ALZA 1RDRA 1WHXA 2HQCA 1UEUA 1VLOA 1Y5NB 3NGTA 5B09A 3QRQA 2KZZA 4RUAA 2ROPA 4YB7A 3L9ZA 1JLCB 1T3OA 3R7BB 2E7XA 4MYTA 5KG3A 1M90T 3FJ2A 2YNGA 2KVIA 1R3NA 4TYBA 2O66A 3CT9A 3I96A 3TVKA 2BE7D 2WTFA 3M2VB 3FEZA 3T6JA 2OEKA 3QJPA 1BC6A 2J8AA 4P75A 5H1SV 2ZBRA 1S0NA 1UVJA 4ZITA 3KJQB 1HNXJ 3W8PA 1SQEA 2VG7B 4WU2A 3PZPA 3VTIA 4DL4A 2HWTA 1IKWB 1SJ1A 3VGTA 4JB8B 1NMEB 1D8YA 2EFNA 1CJVA 2BANB 2O01C 1HIYA 1IR0A 1H7WA 2E1RA 2EVZA 3FRZA 4ZP7A 4BBYA 3PV8A 5E33A 5DM7Q 1TTHB 3OJUA 2L41A 3DYAA 3J7YI 3D1OA 5A8KA 4C7QA 4MYUA 4Y28C 3HFZB 1NRKA 1RT3B 3SXLA 3KLFA 3DRSB 3BGFA 2ZH9A 4LF8F 2I9SA 4ELUA 2HZVA 1UVMA 1IQTA 1TL4A 2A2DA 4OI1A 3VZIA 5F8JA 2XCAA 1SVDA 3W3SA 4PYDA 1Q53A 3EGNA 4PUOB 4P9SA 4DQQA 1UKUA 2A2CA 4LIWA 2HVZA 4ECTA 3GIRA 2EG1A 3CUNA 2OP5A 1NKCA 2HZAA 2FJVA 5KFLA 1N0VC 2MTLA 1UMJA 1UZHA 1IR2A 2HNDB 3HD1A 2NUHA 4MKVA 5KOWA 2JFKA 2DY9A 5M2UA 3LH2S 4DWIA 2F63A 2J0WA 2CJYB 3CJ0A 4X4RA 3CJ3A 2FJEB 4X64F 4PPZA 3UNYA 1LWFA 1LWCB 3HHLD 1WOOA 1E6YA 5CYJA 3GCWP 3ITHA 4IOAQ 1T05B 1NU4A 2QRRA 1KP6A 5E0OA 2HQFA 4CT8A 1FWPA 2XLKA 2L3MA 3R7SB 2VG5A 3TVYA 3MM6A 1J5EJ 3G87A 1VK8A 3Q8VA 4Y2MA 3W9JA 1S1WA 4DV3J 1FXDA 2QT7A 4P7VA 2DB1A 2DGXA 4RW8A 5GVQA 4P7TA 2ILZA 3THVA 5EX0A 2CUYA 3EYZA 2AU0A 4OZ0A 4K50A 3GFZA 1K9MT 2QA4S 2DNGA 2MHNA 1U1OA 4LMZA 4QPXA 3VAMA 3OL8A 2W7AA 2YKQA 1W25A 1V6HA 1SKRA 2BKPA 2WBMA 3K8VA 4DSIA 1JWWA 5EGYA 3QZ8A 4B3TJ 3BKTA 2MZJA 2ZH8A 3P4UB 4OV1A 1Y5IB 4IFYB 3F0NA 4ZJOA 4ES1A 3M6WA 4JI1J 4Y6IA 3DLJA 2GNKA 2M2BA 2M52A 1IXKA 3DGVA 4H4KA 3TAPA 1UA1A 1VQ7S 5K20B 1S72S 1REVB 1TL7B 1Q16B 2DEIA 1IR1A 2LEPA 3MAHA 4QIEA 5L1KA 4C8OA 2I6WA 3KNGA 1UAWA 2CVIA 5ETTA 2MKJA 1KR4A 1M5OC 2KH9A 1N6QA 4NLSA 5AXNA 5L38A 5KFDA 3I82A 2C2EA 3AOAA 2C2MB 3QQCD 2MY7A 3NNAA 1RAHB 4IYQA 1NUEA 2V63A 2XZDB 3I0SB 1B0PA 4QIFA 1U02A 3I5BA 4IDKB 3HHNB 4NLDA 4M8LA 5I3UA 1RTDB 2C2DA 1RTHA 3AH6A 4HDGA 4LSLB 2FVRA 2HBZB 4LF5J 1P8GA 3AJ2A 1QLNA 2IHR1 1SBRA 1FE4A 3I5AA 2XI3A 3W61A 1R31A 3H2UB 5B0BA 2PGCA 4N7TA 4NLOA 4Y2AA 2ASLA 2QSFA 1WJ9A 3TP2A 4IG0B 4JI6J 2BX6A 2XYPB 2Q3PA 3ELHA 1FX4A 2F5GA 4R8UA 7AT1B 4YB1P 3TZYA 2EC0A 1N32F 1IBMJ 3IC1A 1ZM9A 4KKOB 1S4FA 1RT6A 3IWLA 3MAAA 3PYGA 3RUBL 3WQPA 3W62A 4DR5J 2GHVC 3V4MA 3RG6A 1WKKA 2MQOA 3E01A 4WZMA 4F7VA 2VQFF 5BJRA 1X4AA 4OL8A 1YI2S 2JEIA 1LWEA 1B0TA 2V0NA 2XI2A 4IOBA 1RT2A 4NCGA 2XYGB 4ZLJA 2RDJA 4GC7A 3H0PA 3HMJG 2K2PA 1LW0A 1HQ2A 2MKCA 3CJQA 3AQOA 4YB6A 2ZH1A 1Q8KA 2PIIA 2E44A 1S6OA 2HAIA 2FJAB 2RMLA 3UR3C 2VASA 2W9CA 4FS2A 3CJSA 4GO7X 4F2SA 5B0EA 2MY8A 4K4YA 4C97A 3V6DA 1MLAA 1T03B 4IG3A 1FEEA 1T9WA 4RJVA 1X4FA 4RW9A 1N5SA 4RNOA 3UD4P 1UETA 3GFHA 1XN9A 1KTVA 4K7QA 3KJVA 2JX2A 4I6AA 2HBRB 1JXVA 1DY3A 3H7HB 4HHUA 2F65A 4R0JA 4BCAA 4OI3A 4O44A 4ZN1A 2VQFJ 3VAGA 3BGUA 2H5JB 1Q95G 3CJ5A 3BR8A 1JLGA 4JP8A 4USJC 4BS2A 2OD4A 5C42A 4DV0F 4OX8A 2GVDB 2K3IA 3GMGA 2HFSA 4DR5F 3BN7A 4A8OA 1HPZA 4JI4F 3JQJA 4RKUC 1TV6B 2CJQA 5LT5A 2ZH2A 2HFOA 5LL6d 2MQQA 4OZ1A 3VF0B 2DGSA 4FVMA 4KH1B 3BN4A 1FERA 1GFWB 4ZPVR 4RNFA 3CJ4A 5J1EA 4WFYA 3AFGA 4KHRA 4ZJLA 1FFGB 2JWNA 3M8ZA 1NB2A 3RGIA 4YY3F 1R0AA 1S1UA 4K2JA 1IQZA 2J9DE 2HK3A 4YDXA 3T6BA 3OR1A 3BYPA 3G82B 4OJHA 4PWWA 4WIQA 4B9NA 1V5IB 1H7XA 1LEOA 1NPKA 2C3UA 3A3OB 3A4TA 3FFIA 1SC6A 3IRXB 3N5BA 4KFBB 3VHQA 5E41A 2KZMA 2OMOA 3K8WA 2AYMA 2HGMA 4NLTA 2A3JA 4U8YA 2KG1A 2J6UA 1N8RT 2CFXA 3R1HA 4C98A 1ZYQA 4TY8A 4IRDA 1OYEA 3BO3A 2VONA 1HWLA 1NPPA 2W25A 3LGMA 5DRKA 3KOAA 4PABA 5HL7Q 3SI8A 2MJNA 2MDAA 2DR7A 3LO3A 4LQ3A 1X5SA 4ZPAA 1R6VA 2U2FA 4A8XA 2NPFA 4V1Ak 2J9EA 2GIFA 3N6NA 2FPHX 4KB7A 1FXRA 2KRRA 1QD1A 4TKTA 4ZOSA 4EMDA 5J2NA 5CABA 5KFMA 2AYBA 5KFJA 1WUUA 4F4KA 4M94A 3MM8A 4A8SA 3I9ZA 4ZVOB 1RI7A 2WRMA 3PRVA 5BYQA 3SQGB 1TAUA 1X9MA 2P2CB 1M1GA 5LM7E 2XSFA 5G0RB 4QWEA 2DHAA 2EI5A 1UA0A 3MOJB 4ZS6A 2VH7A 1NEEA 3F44A 2MGZB 4NLXA 3VR1A 5CA5A 3D1HA 1FK9B 4F4ZA 1HBNA 1U1LA 4LREA 4LF7J 2XB2D 2PT0A 2DNOA 1G1XA 3FDSA 1C0UB 3O5TB 4KQZA 4DL2A 2ZD1B 2FC9A 1S1XB 8AT1B 1NJIT 2V9WA 1BXNA 1JKHA 5KFZA 5A0YB 2VBYA 3PXGa 2IVYA 5ETSA 4GVBB 1HWIA 1N88A 4DU8A 4ZHRB 2N3LA 5T41A 2FC8A 3VALA 1FVSA 2VBXA 3MTKA 4KPYA 5F3ZA 3LP2B 3OR2A 1XWLA 2QSWA 2R7OA 3TA1A 1X4HA 1KRPA 2O67A 2F1FA 3JTNA 2B3TB 2M3DA 1NJZA 3R6GB 4LFCJ 3RB6A 4IUFA 2IM2A 3NOGA 4PYAA 3C8YA 4XK8C 1HBMA 1GNKA 2XWXA 3R3TA 1RT1B 1UPMB 5GADI 4J7CA 4QU6A 1QTNB 1YJRA 1HNZJ 2YWHA 4WP3A 2ATLA 2VL1A 2RJZA 2E1CA 2OEJA 3M05A 2E5GA 5ETOA 3D0IE 4Y00A 1KONA 2J9DA 3MECA 1J5OA 1U8WA 5KFFA 4KE5A 3UCGA 3SCIE 4ZKAA 3CO0P 3TEHB 4KPCA 2V9KA 1GH8A 4UY8T 1URNA 2YKNA 3K17A 2XC9A 2EKNA 2LDIA 3ENWA 4FXVA 4Z37A 2QIFA 1PO6A 3BREA 4FBUA 1JJHA 4IG3B 2KXFA 2QLJB 2QYCA 4L73A 4CI0B 1FO1A 2H51B 3AXMA 5LXRA 4WFBQ 5A8RB 4R0EA 2V2VA 2BJEA 4DR4F 4F8RA 3SFUA 1A7GE 1RTIA 2FY8A 4B08A 4U6PA 2R42A 5JXSA 1HMVA 3ZTSA 1WACA 3MUMP 3NAHA 3D68A 3NS5A 2KT3A 3M1VA 3H8YA 4YEAA 3JTPA 3Q0AA 4DLEA 5B08A 4EWTA 3R27A 1CJUA 1TL5A 3GSIA 4URQU 3W60A 2L08A 1UEKA 3NCPA 2JL9A 2YTCA 4NLPA 2AJ0A 3G8TA 1RA6A 1TKTA 1EZZB 1RT2B 1YQHA 4NCGB 1OPZA 3OUYB 2HRTA 1EX8A 2UV8A 5CYQA 3FRYA 1WC4A 1RWNB 2KU7A 2RT3A 3KG0A 1FRMA 1S1UB 1XJWB 4WFAQ 3C46A 5B0GA 1J5EF 3VGUA 4KV8B 1GQEA 1B99A 1ELOA 3BV8A 2GMHA 2ZEJA 3FFIB 3M8QA 1WORA 4RW7B 4X65F 4DV7F 2PI5A 1VQ6S 1NSAA 2FIUA 4K59A 1VK3A 3MR5A 3TQEA 1B70B 4DL0C 1RWMB 3CDBA 5DQHA 4NCBA 2Z30B 1CC8A 3DGPA 1SIZA 2PC6A 5KFHA 4LF4F 3LP0B 3B4MA 4NYOA 2K06A 3WIUA 5C42B 1CQMA 1SL2A 4U7UD 1F5AA 4LFAF 2RRAA 2PMZD 2FJXA 5ITHA 1DHMA 3TX8A 1X0PA 1PJ7A 1JLQA 5E3CA 4ITSA 4PG7A 4RR5A 5J1PA 3MPDA 5MLCV 4G3IA 1IWGA 1NSKL 1BUXA 3F56A 1MU2B 2GJIA 3GCXP 4GC6A 3QLHA 3AJDA 4I56A 1DTTB 2LQ8A 2XY6A 3D1QA 3CO9A 4CO2A 3IFEA 3QATA 4ATNA 5HQLA 4KGZB 5LMNJ 4J90A 4EBEA 2NZCA 4LSNA 3C19A 4NXMJ 5J2MA 1F60B 1Q79A 1N56A 1NH8A 2OLWA 2RHQB 1FK9A 1QSYA 4WK1A 5KFKA 2GVZA 3KMSA 1I94J 3G71S 4UOCA 1OJ4A 4TNOA 3N4WA 3PDNA 3B54A 4ZCLA 1RYRA 2ASJA 4EUVA 1X7VA 4NCAA 5E2QA 1WF1A 2J5AA 3PO4A 2IAJA 1Z1ZA 1JLBA 1T9VA 4ZVEA 1CG2A 5K8NA 4AL6A 1U0SA 3BZQA 5CD4H 2OKQA 3HHLC 4ZVQB 2HVHA 2GW8A 3TYTA 2ZJRQ 1B64A 1EQ0A 1C1CB 4LFAJ 4ZVSB 1N52B 5RUBA 4UOHA 4OFZA 1O0PA 5HVHA 4PXDA 5DGAA 5FDLB 5CQGA 1N48A 2NXJA 4LR8A 1K47A 1FFSB 1XMOF 2WAQD 4PZVA 1T9UA 2GO8A 1N32J 5HATA 4TQSA 3MHYA 4X4SA 3MM6B 3ENVA 3OT9A 1PCAA 3PFEA 4FKXA 4OI0A 2HVIA 1QJHA 4ZCMA 1M5SA 3CMES 2P6SA 2EK6A 4NA3A 1HLWA 2ZKTA 2VPWB 3IGNA 3A1YG 3OTOF 4Z7CA 3ILIA 5G4DA 3NGRA 5I3PA 4PG8A 1EETB 3US5A 2XGPA 5L1JA 4J9KA 1HR0J 1VQ4S 2OUGA 5K14A 3R2DJ 3HP6A 2DXEA 4RNMA 1SH0A 3ISNC 2E5LJ 1TL7A 3NGSA 4P2XA 4QQBA 2GCFA 3H59A 2OFHX 1FDDA 4MFBA 3R97A 2HRUA 4RPFA 1QY7A 4OHYA 4DV2J 5FD1A 5KT6A 3H5YA 2J6TA 3H98A 2DH9A 3ZZYA 2MKHA 2UUCF 1Q86T 1FXLA 3L95X 1NHUA 1WDDA 2GS8A 1K1QA 4NZ7A 3EPGA 1YHQS 3W66A 3DOKB 4RNHA 4JV5F 2DJWA 1JK9B 2ZFHA 1RTHB 3CCLS 3VQTA 1HI0P 2LECA 2QE5A 3GYGA 3MMBB 4QPTA 1JB0C 3VAKA 1JMTA 4ER8A 4BC9A 3TI0A 1MROA 2W8LA 1IBLF 1ZPWX 2JH3A 5KFSA 1SQFA 3P5BP 1SJRA 1VRTB 1OPIA 4FKYA 1AA1B 3T9ZA 4OX9J 4C0HA 4ICLA 1UWBB 3RBZA 3NKYA 3M8PA 4CZCA 2GJ2A 1NZAA 3L7UA 2MKYA 4JI4J 3C15A 2VD3A 2DNZA 3IM8A 4ECZA 1WI6A 1FTCA 1VIXA 1TUVA 1IKXB 3BGOP 4OI4A 4USUA 1KQFB 3SZ2A 2YKOA 2ZH4A 3DLKB 4KY3A 2OSRA 4KKOA 3ISND 4LQ9A 1JLCA 3K58A 2L48A 4MIAA 2HG4A 4WK3A 1JJ2R 3ETMA 1FJGJ 3ILLA 2NYIA 2IJRA 3IR5B 4O3NA 2JSXA 1SL0A 2BJ3A 1H74A 2CQHA 5HK4A 4TY8B 4C3KA 2W9AA 1YITS 3KUEA 4DFPA 4EGLA 4LBPA 4G6VB 2AKWB 4MK9A 3OLBA 4K4ZA 3AJ1A 3ICLA 2MQMA 5FIIA 4J9LA 1RBAA 4I2QA 2RILA 3RR8A 2BJ7A 2A0FB 1IKWA 3RZAA 1DFDA 1F0XA 2OIHA 1FDAA 2PSZA 1S77D 2Z2ZA 3MEEB 4I7FA 5F8HA 3RW7A 3PM9A 1DQAA 2W2MP 3LOUA 2GAHC 3Q23A 2HHTA 2HWHA 3I4PA 1Q8BA 2YWWA 1X4EA 2RUSA 2KG0A 3QT6A 1N34J 3EJMA 2YNHB 4DUZF 3J81U 3W65A 3J7ZT 2IA0A 3C16A 2WONB 3CCZA 4Q43A 1HHSA 1RAAB 5DG8A 1FJGF 2CNKB 2GVDA 1KQGB 1Y10A 5A2QY 2JFDA 5J1EB 3B4DA 4FF2A 2EFVA 3TZZA 4YOEA 1H0HB 1KOOA 3W7BA 3E2EA 1TL3A 5T7LB 5BXIA 1P9QC 2UUWA 3CDUA 3CPWR 2ZNZA 4FF1A 4LFBJ 2ZD1A 4ECSA 4DCJB 2UXCF 4ANDA 3NMRA 3RRHA 1U1MA 1C1BA 4OHWA 2G2YA 3GP9A 2ACMA 4IO1A 3HO1A 4NOHA 3N6LA 3HHLB 4FDFA 3KJVB 2CQBA 2J9CA 4DQIA 3T19A 3UI3A 6AT1B 4CH1A 2L9DA 3ET6B 1RISA 3HT0A 3QO9A 3MUTP 8RUCA 2FYXA 4LSNB 2W8KA 4A8WA 2BVZA 3PX6A 3KUGA 2EW9A 2QV6A 2IVFB 2C42A 3CTRA 1QE1A 5D15A 1HBMB 1YJ9S 1N36J 5HQ8A 3LAMA 2OHDA 1R27B 4DMZA 4CM0A 2DD8S 4LF4J 2EWHA 3HVWA 3I31A 4JI6F 4YY3J 4IH5A 1J5OB 2Y1LB 4RO0A 5K14B 3Q2TC 2BV3A 1TMMA 1NK0A 5E3AA 4A4JA 2FHMA 4ED4A 2DBBA 3RW6A 1TZ0A 2D1CA 4KBIA 3QRPA 3LWMA 1T02A 2R7WA 2LEAA 5G0RA 2VJUA 1XMQF 4YS2A 5EUHA 2YKAA 4X66F 1D09B 2K7JA 2BKNA 3SMZA 2WSCC 1SJQA 3MM8B 3J80U 3PVXA 1I5OB 2HHXA 2R7UA 2R7VA 3MMCA 4E98A 4L74A 2E9RX 4C4WA 5BYRA 3ZZPA 4B3SJ 1DTQB 3A8KA 3MTJA 4RBVA 5I4MA 4V19J 1YJ7A 2WOMB 5DDQC 1RKIA 3EPIA 3BF4A 5B0DA 2IIHA 4E2FB 1Q81T 2D74B 1U1QA 3C6TB 3WBZA 1N54B 2HWIA 1RAGB 1R7IA 2CPJA 2HNDA 4IDKA 4U8VA 1XK8A 1UEVA 1YDLA 4CO1A 4DR2F 3D2WA 2EFQA 3PYEA 5C5JA 4H4MA 3R5BA 1LWCA 4F36A 5IQ6A
chains in the Genus database with same CATH topology
1S9EA 1FDBA 4MK7A 3KK1A 3NCQA 3LANA 3OR2B 3CMAS 1TK5A 1X9SA 3KLIB 3OW2R 3AHPA 1NK9A 3SCJE 1RT4A 1PSDA 1SB6A 2QLXA 2I1RA 3FCHA 3PEJA 1RTJB 4FN5A 3H4DA 3TANA 2FHJA 2VFVA 3HI9A 1NJZA 1S0MA 1KLNA 5IZHA 1RP5A 1NKEA 2J76E 1DLOA 3P3DA 3LP0A 3IAS9 1A9NB 4ED1A 2RU9A 3RU0A 3CCSS 2BE2A 1JLQB 4IFYA 2XG8A 2XNQA 4CH7A 5KFRA 3K5LA 4J9MA 5KFQA 2FHJD 2BQUA 3GIJA 2IJNA 5E3QA 1SV5B 2XMVA 1KSPA 5GAEU 4PG6A 1VQSA 2B51A 5CYQB 3G6XA 1S76D 5KT4A 2ZBCA 2AYGA 2Z4PA 4IG0A 5KG2A 1WTBA 5J2QB 5A6PA 5LSRA 1TQLA 3DMJB 3T3FA 1C4AA 2F3JA 3E8OA 1FVQA 4O23A 1NK7A 4WYLA 2RF2A 2ZBIA 4DX8H 3P96A 3CCMS 2FTRA 1TV6A 4J9SA 2O5DA 4RW6B 1YSJA 2K1RB 3M2RA 4DUYF 2R8HA 3MOZA 3KMQA 3DRPA 2ADCA 1SUQB 2HNYA 3V2UC 1KNZA 3SCLE 2E1AA 2O3DA 3V6DB 4BHQA 3DFEA 3QO9B 3HHKA 2AQ4A 2XS7A 2V4QA 3M4XA 1C0TA 2BRLA 2H9ZA 1AFIA 4K4WA 2UZAA 5HMZA 5F0WA 3D0HE 4ELTA 2PEHA 2MYFA 4RWXA 3Q8PB 4AXIA 2HQIA 4I0WA 5H9FJ 3K5PA 4O4GB 3FEYB 3WX4A 4UUWA 5J2PB 3LAKA 3LGNA 2B4VA 4E0DA 3TUJC 3CC4S 3HKZD 3RRKA 3PR5B 1TAQA 1X9WA 3ZZZA 3LF0A 2VPXB 4H4OA 4N76A 2I8EA 2ZC4A 1G3OA 4C8LA 4OX7A 3MFIA 3U7JA 4MKBA 4Q45A 3RAMA 4OI6A 2ZZMA 2DNHA 4N77A 3OFFA 3PEHA 4WFNQ 3F73A 4IH7A 2OO4A 3DLGA 3LP1A 2OPQB 1L3UA 3U1NA 3PR4A 2X51A 3TR5A 3OQ2A 1S1VA 2MZTA 4H4MB 3HK2A 1GTHA 2AJQA 1BQMB 1VHFA 4Q8FA 3I32A 3Q24A 1VS3A 3GV5B 3CE8A 4URSA 4I68A 5HBMA 4ZPCA 3QZ7A 3H5SA 4YHHF 3N28A 4DG1B 2FVQA 2XLIA 2XSJA 4QJVA 3LWLA 4ILLA 2E9ZA 3MEGA 2OPRA 5HO4A 7FDRA 1H2UX 1JNZB 4NPOA 4K2XA 1YVFA 3NRBA 1C0UA 1F5BA 4OX6A 5C24A 4FPRA 1FKOA 3UD3P 1R8HA 2GIRA 1FJEB 1JKHB 2B5JA 1GX6A 2UU9F 3MEKA 3BGLA 1QVGR 1F5CA 1U1KA 3R5AA 1NK5A 3BJYA 4ALZA 3PNIA 5KG1A 3DN9A 3MM9B 1LXJA 3SEOA 1WF0A 1HYSB 3QGIA 2LYVA 2NPIA 2AD9A 2FJDB 3RYLA 1D9FA 2B7BB 2DNPA 3ZZRA 1FKPB 4NZ6A 5CYMB 3DDNA 3GV8B 1KS2A 6FD1A 1XERA 2ABYA 2JVOA 5DM6Q 1HD1A 3DC2A 3Q8RB 5A0YA 3BQ1A 2R8GA 1VRTA 3Q8SB 1ZAVA 4UQTA 1LFWA 2DNYA 3M32A 4Q2LA 2UVRA 4IFVA 3M6UA 2OPSA 4JV1A 1CEZA 3M30B 2ZVSA 5L9NA 2NREA 3ETOA 4B3MF 2LKZA 3THTA 4O3OA 1N36F 2KB2A 3CF5Q 3M8QB 1Y5LB 3Q8QB 1U24A 4NA2A 4I2QB 5CZXA 3HM9A 4NLQA 1FESA 3OFGA 3S8SA 3POTB 3UNGC 3GB0A 2F9DA 4RBTA 1FRIA 2L9WA 4KO0A 2DNNA 3WC2A 1UVNA 4WZQA 2ZJQQ 2HQ3A 3QGPA 4KRWA 4NZ0A 4Z2XA 3V4IA 2OH2A 4GKKF 3NMAA 3OLAA 5KFXA 2PMHA 1ZAXA 4KJIA 4CNYA 4DDFA 2B43A 3DRXA 3H5XA 1FRKA 2IJFA 2NXUA 3TAMB 4K5SA 3HHEA 2DPIA 1WEYA 2YKNB 4TQRA 1U1NA 2IM0A 4DFJA 3DU5A 2NR0A 1FA0A 3T5LA 3NL0A 2YX4A 2RSQA 3M8PB 4OJ1A 5M2PA 3C6UB 1YRTA 2YWFA 4HEA9 2KJVA 3QIPB 1DTTA 5GMKa 4X4VA 3BSNA 2LLZA 2D7SA 2JZ5A 2HNYB 4OLOA 2MQLA 2ZM6F 4JI5F 2HGNA 5EHHA 3UDLA 2C3YA 4OZJA 1IUJA 5E3RA 3HJFA 3KFWX 3TUIC 4CIOA 4B9SA 2JDJA 1WWHA 2RH3A 2IM1A 1KLMA 3GIKA 4RW8B 1WELA 2KHCA 1HQUB 4R25A 3CCES 3HFKA 2IAJB 3IWNC 3KLEA 1GXLA 1S79A 1UVKA 4F26A 4QWDA 3KK2B 3QIDA 3OFEA 3PW7A 2ZHBA 1IJFB 3CC2S 2HMIA 4B3TF 4O0IA 3PHEA 4LF5F 3KG1A 1ZAWA 1JIHA 1S6PA 2BYCA 2N4CA 2H5EA 1DBDA 2RKIA 2ZHOA 3HDSA 4J9OA 4PR6A 1VLYA 1YG0A 2B9WA 5I42B 1U7LA 2B4PA 2ZH5A 3W2VA 1SKSA 4RNNA 3O44A 2XS2A 1YBAA 2JC1A 2ZE2A 4TXSA 5LMNF 1VQ8S 1RA7A 3U1LA 2C3PA 1FNOA 4DL3A 2DGUA 2OTJS 3UW1A 2IM3A 4R5PA 4DSKA 2R2UA 5I3UB 2F40A 2PDAA 2YX1A 3FNNA 2KT5A 3M6VA 3MM5A 2XMMA 3O8WA 4CTAA 2XO7A 4I64A 4RUCA 1LXNA 3HPOA 4A8MP 1NJWA 1X5PA 3HHLA 3H4BA 4DR3F 2UP1A 1RJJA 2AWZA 1U47A 3G9CA 2KYZA 4OI2A 1L3VA 4FYDA 3QYYA 5DO2A 2LA4A 3K5MA 3QMQA 3SSQA 2DO4A 4DV3F 4RLEA 3M2UA 2Q66A 3DRYA 2ROEA 1HL6A 4ETXA 2ZH6A 2XSJB 1S49A 2I38A 4AYBD 2PA3A 3OVBA 1PILA 2R7TA 1RT4B 4X62F 3DMJA 4HHJA 3I6PA 3MPWA 2FLPA 4TLQA 2RU3A 1RTJA 2F9JA 4FP9A 3CIMA 2KM8B 2HHPA 2GQCA 4RZRA 4FNIA 4OHZA 3KLIA 2Z2MA 2K1RA 4OZ5A 3BSAA 1TL1B 1ZETA 4ES2A 4DV4F 2F4VF 4FNHA 5HP1A 3CWJA 4NL5A 2BE2B 4GKJF 2RE1A 4MFBB 1U09A 1DTQA 4G1QB 4X84A 5C25B 3IXQA 2YX7A 4XDDA 1HQEA 1Q7LB 1X4GA 2J6SA 4KHMA 5JVGQ 2NUUG 1YWXA 3IR6B 1OIAA 2DGWA 4J9NA 2BZ2A 2QMWA 3GE9A 2M4MA 3PX0A 3R5DA 1OWXA 1KFDA 1LOUA 1E6VA 4CO4A 4ZK7M 5K8OA 3M9NB 3M32B 1GX5A 5D4LA 2CJ9A 1N5YA 4CO0A 3KLVA 5KFGA 2DGTA 3RR7A 2MB0B 1JLFB 4FBTA 2HPUA 3S6EA 5MAOA 1U26A 2DPJA 5KFNA 5J2QA 4USHA 2YNFA 4YFUA 1UJ5A 1I94F 1RTDA 5AXMA 2BUNA 2DVIA 3DRPB 2AJ1A 4L6V3 3GG1A 1URRA 1X4DA 4WE1A 1J2VA 1YRUA 2CQPA 3L09A 4KC5A 3JYTA 1TKDA 3OSNA 1XMBA 2RNEA 4CCHA 4HLBA 2ZH3A 3OXFA 5AE3A 1Z4UA 1FNMA 3SDEB 3CGIA 3IGVA 1TKZB 3CEDA 3ZZ0A 5KT3A 2J0SD 5KFIA 4JBCA 3DLGB 5KAKA 4B3OB 5B0FA 2MSSA 1X8DA 3CB4A 2DGQA 5D6GA 2GMJA 1UW4A 2VFSA 4RU2A 3M8SA 4ED6A 3VAIA 3SV3A 1Y0HA 1QAIA 2OAUA 1WEXA 2VG6A 1KEKA 2CG4A 4HTJA 1XR5A 1D9AA 4WFXA 2Q79A 3OL9A 2RF2B 3I9V9 2HS0A 3BQ2A 5HN0A 2D9PA 2FHOB 2WONA 3VAJA 1M5PC 4K5RA 3RB3A 3GYNA 3QWPA 4OMFG 2HW3A 2KHDA 4M5DB 5GAHU 1M5KC 2M70A 4DSJA 2MZSA 2BOPA 4DL5A 3EGZA 4I7FB 5F0UA 1D8ZA 3PJWA 2JLFA 1XTZA 4DFKA 1S9GA 2IYGA 5SUHA 2CKWA 1D0EA 2LQ9A 1AUDA 3IS9A 1OSDA 4Y2KA 1S1VB 2NZ4A 2GV1A