3BEGB

Crystal structure of sr protein kinase 1 complexed to its substrate asf/sf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
86
Chain Sequence
b'NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGSYGRSRSRSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase SRPK1
publication title A sliding docking interaction is essential for sequential and processive phosphorylation of an SR protein by SRPK1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/splicing
total genus 14
structure length 86
sequence length 90
ec nomenclature
pdb deposition date 2007-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3begB01
3CC7S 3PIOQ 3G6ES 2MXYA 4UY8T 2MJUA 1WTBA 2E44A 3BO3A 3SDEA 2I38A 3G8SA 1X4BA 2JRSA 5ITHA 4P6QA 1U6FA 1VBXA 2F3JA 1U1QA 2M7SA 4C7QA 2X1AA 3G96A 2DIUA 1M5OC 2FC9A 2LKZA 3CULA 1ZZNA 3CC2S 1U2FA 1K73T 5LSLA 2HZCA 3NNAA 1RKJA 2LQ5A 2CPYA 3SXLA 1YWXA 2CQ1A 2J0QD 1WG4A 1P27B 2DB1A 1WELA 3RW6A 4CH0S 3VF0B 4QQBA 3PIPQ 2JVOA 3CPWR 2RRAA 5LSOA 1NJIT 4IUFA 3US5A 2DIVA 4F26A 2M88A 1R8HA 5LXRA 2DO0A 3UCUP 2HGLA 4TU8A 2MMYA 2MZQA 4IOCQ 1ZZFA 1QM9A 1WF0A 1VQ9S 2MQLA 2RVJA 5IFMA 2RU3A 2LA6A 1X5OA 2OTJS 2KN4A 5GMKa 4U67Q 2DGUA 2NZ4A 2RNEA 3BS9A 3FEXB 3MUVP 1X0FA 4EGLA 2MQQA 2D9PA 3HI9A 1FO1A 3ZZYA 2K3KA 2DITA 2X1FA 3R1LA 1VQ4S 1S72S 1WF2A 2EK6A 4WKRA 5CYJA 3LPYA 3EGNA 2RQ4A 4LIRA 1M5VC 4Y00A 1UW4A 3UCGA 1XN9A 3NS6A 2QA4S 3CXCR 2YWKA 2CQCA 2D9OA 2CPXA 1D9AA 1WI6A 2JWNA 2MKCA 2RRBA 1WG1A 2DNNA 5DDRC 3CUNA 1KC8T 1WWHA 1K8AT 3VAIA 1U6BA 4Y0FA 2U1AA 2X1BA 1VQ6S 3G8TA 3EGZA 2GO9A 2JVRA 3ZZZA 2OIHA 4OZ1A 2ADBA 3CMAS 5HO4A 4BS2A 4WFAQ 1YJWS 2CPZA 1K9MT 3H2VE 1NU4A 4WFBQ 3UE2A 1H6KX 1O0PA 4ZKAA 2VOOA 3LQVA 2DNLA 2CQGA 3VAMA 3U1MA 3TP2A 3Q2TC 2F9DA 1A9NB 2KHCA 1JJ2R 2CQBA 3VAKA 2FHOB 1VC5A 3MURP 1UAWA 2HGMA 3J7YU 2PE8A 3CCMS 1X4CA 2KT5A 1WI8A 1Q82T 3B4DA 2DNYA 5D78A 2DGTA 1P1TA 2MSTA 5GADU 3S01A 2AYEA 2VODA 3UCZP 1VQ7S 1U1PA 3CCJS 5DM6Q 4IOAQ 1X4AA 2CQ0A 2ADCA 4A8XA 1UFWA 2DNGA 3CCES 2MY7A 4QPTA 1X4GA 1VBZA 4WF9Q 2MSSA 2KU7A 2RUGA 2XNQA 2KM8B 2DGOA 5GVQA 1U1MA 1HL6A 2DHAA 2MZ1A 2KG0A 2AYGA 2HVZA 1U1OA 4FXWA 2DHXA 4LMZA 3VAGA 1VBYA 3CCRS 1DRZA 3BEGB 2KI2A 2MKHA 2DISA 3B4MA 1BY9A 1Q81T 2XSFA 2I2YA 1OWXA 4M5DB 2MKIA 1B7FA 5DETA 2HYIB 2DH8A 3D2WA 2LYVA 1RK8A 1DHMA 3SMZA 1YTYA 1IQTA 3OW2R 1FXLA 1YIJS 1X5TA 1ZH5A 3BO4A 2MGZB 2CPDA 3THPA 3DXBA 1VC6A 1U1KA 2DGXA 1VQ5S 4QU6A 3CCQS 1U1RA 1WHYA 2N7CA 1JJHA 2MQPA 2MQOA 4J5OA 3MI7X 4C0OC 1X5SA 1L3KA 3J7ZT 2EVZA 2MB0B 1FNXH 2DH9A 2MHNA 3K0JA 1KQSR 2EK1A 2CPFA 2CQ2A 3VAJA 2DGVA 5JVHQ 3MOJB 3BO2A 2L08A 2N3LA 1NO8A 2LMIA 2ZJQQ 1SJ4P 1H2VZ 2MZSA 2PEHA 3RW7A 5DDQC 2KFYA 1OPIA 1U1NA 1VQ8S 3CCUS 1D8ZA 1F9FA 4CH1A 5DDOC 2DNQA 2AYBA 2OTLS 2JX2A 3HHNB 1X4EA 1QVFR 4IO9Q 5EN1A 2KYXA 2LCWA 3IRWP 2M9KA 2KXFA 2ZJRQ 4C4WA 1KOHA 1HD1A 3MDFA 1N52B 3THTA 1QVGR 3VAHA 2CQ4A 2XNRA 3ULHA 2VOPA 2DGWA 3CD6S 4WIIA 5IM0B 3VALA 1X4FA 1M5KC 2DNPA 5H1SV 1PGZA 2MZJA 2MPUA 2MZTA 2MZRA 3NS5A 2QEXS 4PR6A 2ERRA 3R1HA 1WHWA 3G71S 2KRBA 5BJRA 2V94A 4PKDB 3NNCA 1N8RT 3MD3A 4V19X 1WHXA 3CC4S 1WG5A 1OIAA 4WCEQ 2OSQA 1VQMS 3CF5Q 2CQPA 5DM7Q 1N88A 5GAHU 1U1LA 2VONA 3DLLQ 5LXYA 2ZJPQ 3P49B 2DGSA 2DHSA 2FY1A 4YB1P 3NNHA 4FXVA 2U2FA 2UP1A 2J76E 2MQMA 4RU2A 3CCSS 1A7GE 1Q7YT 2DH7A 2QFJA 1KOOA 4F25A 1M5PC 1X4DA 5GAGU 1KD1T 2KXHA 1YJNS 2MYFA 1X4HA 5IQQA 4PRFA 2HGNA 2B0GA 2MQNA 1X5PA 2RS2A 2O3DA 3SDEB 1YI2S 2AD9A 3MD1A 1PO6A 2SXLA 3CCVS 1S79A 3P5TL 2KG1A 3TYTA 2KRRA 1M90T 2LECA 1JJ4A 2CQDA 1W2BR 2J8AA 3U1LA 2DK2A 3EX7B 3FEYB 2AYMA 2DGQA 1DZ5A 4ED5A 2F9JA 3N9UC 3P6YC 1H2UX 3S7RA 3CCLS 2MGZA 2A3JA 2CQIA 4WFNQ 2DNHA 4CIOA 1FJEB 2LEBA 1CVJA 1SJQA 2CPEA 2FPHX 3P3DA 5JVGQ 4TLQA 4YOEA 2Q79A 2KXNB 2BZ2A 4W90B 2MKSA 1YJ9S 3JB9k 2MY8A 2YH1A 2BOPA 5HL7Q 2M70A 2CPHA 5CA5A 3IWNC 3G4SS 2RQCA 3S6EA 2XS7A 3MUMP 3UD3P 2KVIA 2KH9A 1R8PA 1SJ3P 1URNA 3Q2SC 1YHQS 5CXTA 5LJ5Y 2MKJA 1WEXA 4YUDA 2N82B 2KM8C 3UWTA 2CPIA 4TU9A 2G0CA 1Q86T 1FJCA 4Z2XA 2DHGA 5LJ3Y 4F02A 2L9WA 2M0GB 3CMES 2DNMA 3TO8A 1DBDA 2E5IA 2D3OR 5MLCV 1JMTA 5GAEU 4TU7A 1VC0A 2L41A 3V4MA 2CJKA 1OO0B 1M1KT 1SJRA 1VQKS 1FJ7A 1HD0A 2DNKA 2YKAA 1SJFA 2M8HA 4UQTA 2LEAA 2E5GA 4LJMA 5IM0A 3MUTP 2OSRA 1YITS 4QU7A 3I55S 2DNRA 3G9CA 1SXLA 2FC8A 2OJ3A 4W92B 2LA4A 2K8GA 2YTCA 3MXHP 1VQPS 2N3OA 1FHTA 2DNZA 2DO4A 2G4BA 2LXIA 2MKKA 1VQNS 4OZ0A 2DNOA 5DDPC 3L3CA 3VAFA 2M4MA 3NMRA 1WF1A 3H2UB 3R27A 2NLWA 2M8DB 2M2BA 2G1DA 2X1GA 2MJNA 1N54B 3S8SA 2RS8A 4CQ1A 1UP1A 2M52A 2RT3A 1VQOS 2XS2A 3UD4P 1WHVA 2GHPA 2J0SD 1VQLS 1WEZA 2E5JA 3I56S 1AUDA 5D77A 5FJ4A 1WEYA 2XS5A 2CQ3A 1HA1A 2XB2D 2LXUA 2CQHA 2WBRA 1FT8A 1H2TZ 2CPJA 2YH0A 3CTRA 2E5HA 4ERDA 1G2EA
chains in the Genus database with same CATH superfamily
3FBCA 4Q7AA 3SFGA 1GXUA 3SCIE 1WTBA 1KWMA 3IR7B 5KFNA 3PHEA 2QC3A 1QY7A 1HMVA 2YNGA 5IC6B 1JLQA 3OR1B 3NNAA 1RKJA 5F8JA 4DFMA 4B3MF 2OPQA 4ZCLA 4Y2AA 3NXZA 3N4WA 5CABA 1RWVB 3SV3A 4AUKA 1KKHA 4DR2F 2MQLA 1RI7A 2RU3A 1MNEA 1DQAA 4M5IA 3G82B 5CYJA 2BE9B 3G6VA 3A3OB 4CLPA 4N8OA 3NS6A 2YWKA 5B09A 4IR1A 2C3YA 1S7HA 3QBCA 3SIPB 3M2RB 1F5BA 5KT6A 2GHWA 3GMGA 3ZZZA 4ZIWA 3DRYA 2OUGA 4DSIA 3CO9A 1S9EB 1YJWS 4URGA 4TY8B 2F9DA 1U02A 2FHOB 1YBUA 3KMQA 4JI2J 3K7RA 2DGTA 2V68A 1RT4A 3CW2C 2B8PA 2I5JA 2HHSA 2F5GA 1NDCA 1W25A 3EVMA 4M94A 3OPKA 4LF8F 2QL7B 4A8XA 2OMOA 2FVSA 3JYTA 1FXRA 2V9KA 3MFIA 5DZ6A 3QJJA 5B08A 4PG6A 4ECVA 2O66A 1U1OA 2PMZD 1IBKJ 1HNZF 3CCRS 4DV6F 1FCAA 1DRZA 2GGPA 4F50A 4LRBA 3V6HA 3KNGA 3ZTPA 4M5DB 4H4MB 1HI0P 1VLOA 2LYVA 4JI7F 5DLFA 1XERA 1YTYA 1LV5A 3MPUB 2IM1A 5B0CA 3HK2A 1A0OB 5IS2A 3GIKA 1HPZB 2ASYA 1S1VA 2BACA 3W62A 2Y1LB 1DTTB 1Y5IB 5JXSA 2RRNA 3VTIA 1EP4A 4QW9A 4LFCJ 4I56A 3EPGA 2VFUA 1QSLA 4NI2A 1HIYA 4DR1F 1YJRA 1T9VA 2J9DA 1KLMA 2DPJA 2W4DA 5A2QU 4WK1A 4QZVB 1ZM4A 4ZITA 1V5IB 2QTWA 3NWGA 3TR5A 2BKNA 4PUOB 1DLOB 2M3DA 3D1HA 1CJUA 1RJJA 4KRWA 1SKSA 1XJWB 3NS5A 1KHWA 4B3OA 3PW0A 1S1TB 3FQLA 4K0KJ 2MDAA 3HHKA 3IR5B 1YRUA 2OSQA 3MMAB 1U1LA 4CLFA 3MF5A 2GQCA 2FY1A 4HACA 1HBOB 2C22A 1ICEB 2J76E 2G2OA 2XLKA 1UA0A 2BVZA 5GAGU 5H9EJ 2NYHA 2BE7D 1Q0NA 1JXEA 5AJ3F 3PDNA 1PO6A 4LF4F 2HWTA 3M32B 3M6UA 3UD5A 3R5AA 1TL1B 2D1CA 4DQIA 3KUGA 4HT5A 4KBIA 4RW7B 4CO3A 2J0WA 3I87A 2FYXA 2MY8A 3MZIA 1RT6A 4AL5A 1TK5A 2HHUA 4O3PA 4R8UB 4A8KA 1KTQA 3FZ2A 4K8RA 5HJXA 5F0WA 1NMEB 1S1WA 2EG1A 1L3SA 5KFPA 3OSNA 2L41A 3BN4A 3FCWA 1NHVA 2XM3A 3SCKE 2OSRA 3PCOB 2JDJA 5D4LA 3CGIA 3GV5B 1QE1B 3IBWA 4EWTA 3IS9B 1IXKA 4LVNP 1QUPA 4DXLA 3EM1A 3DRRA 1B99A 5HK4A 3I6PA 3S8SA 2RS8A 4P72A 2GHPA 1AUDA 3FK4A 1KONA 3G2XA 4IFVB 2BE2A 3C6UA 4X4QA 2IBKA 1RWPB 2XMMA 1NAQA 2CNNB 4X4NA 3BN7A 4NCGB 2WVEA 1JLEB 4B08A 4DPUA 2ZH3A 1QTNB 1KVKA 3CC2S 2JEFA 2VBZA 3VF0B 3PIPQ 3D67A 3H20A 4PYDA 4TU8A 4CT8A 3HKZD 4IOCQ 1WF0A 4QYRA 3Q8YA 1VQ9S 4LBPA 1TL7B 4CLLA 4IDKA 4OX9J 4ZVGA 3RB0A 4UQGA 1U2RA 5IWAF 4QOTA 2FIUA 3UCGA 4KGXB 5F8HA 3VGTA 2D3UA 2NYIA 1NUEA 3D6MB 3PR4A 1R7IA 3RR7A 3DGPB 4FKYA 2KFZA 3I5BA 3R5BA 5C24A 1GK8A 2DTJA 2Q43A 2QT7A 3CDEA 2BW2A 3ICLA 1V3SA 3DHWC 4RUHA 2ZKUA 3M30A 3FCVA 4FS1A 3ZZRA 1T05B 1VISA 4DV0F 1CC8A 3OR2A 3TZXA 2IRXA 5EWEA 1HWJA 2CIMA 2RF2B 1WC4A 3V2UC 4NL5A 2VIHA 3AD8C 1G4CA 1X4GA 2UXCJ 2CADA 3Q89A 4IKAA 2KM8B 1JLGB 2KG0A 1JLCB 1VBYA 3R7SB 4M5KA 3MWBA 1CJTA 2GMLA 2I6WA 4HHUA 5FDLA 3E3XA 1ZOTA 1JLFA 2QZ8A 3KLHA 5B0DA 4KJIA 5E7OB 3HD2A 2MGZB 1BC6A 3DXBA 3TA1A 3V4IB 4B9VA 3L9ZA 1VQ5S 4OYPA 3M8QA 3HHLD 4U7UD 4LBIA 3BSOA 5CHCB 4NLVA 2R8HA 3JTPA 1GXLA 2XI3A 2CG8A 3M2UA 5J2QA 3BZQA 1N5SA 5KFVA 4MJKA 1OJ4A 1ZPWX 4FPRA 4TQRA 2MZSA 2HS0A 3HVAA 3W8PA 3W5ZA 2DR6A 3UVJA 2FTRA 4UT4A 2AJ2A 1Y5LB 1H0HB 3OLBA 3V6KA 1GXTA 2OO4A 2HEKA 3ZTOA 3M8ZA 1Y11A 1UEUA 4C9DA 4NOHA 1SJ1A 3VAHA 5DQGA 5EGYA 2BM0A 1U24A 2HAFA 2B4PA 4BBYA 2ZBIA 2LU1A 4K4TA 5KT7A 5BJRA 2V94A 5CYMA 1N8RT 4NPOA 4CYUA 4WCEQ 2C1EB 2P9CA 2X51A 1N88A 5GAHU 1KP6A 5LXYA 4K5RA 1RAGB 3NNHA 1IBMJ 2UP1A 2VQFJ 1C0TA 4KHMA 4LF5J 4P73A 4J9QA 3TUPA 3BR9A 3NBPB 2F1FA 1BQMA 1TKTB 3FUYA 3D5MA 5F8GA 4F3OA 3RYLA 3I0RA 2UUBJ 2DK2A 4MFBB 4YDXA 3MM9B 4K4YA 2UUAJ 2COLA 3O6QA 2GZOA 2F7VA 2OD4A 3BBCA 3MMBA 4NASA 3P3DA 4TLQA 4KGZB 5IQ6A 1XTZA 2VDIA 1RHUB 3DYAA 4JI8J 2Q1LA 1KQFB 3W2VA 1TVRB 4MK7A 1FI4A 2XS7A 3MUMP 2V50A 3NGRA 1F9EB 3D3CJ 4BC9A 4L74A 1VYAA 1NK7A 3KNAA 1IJFB 2CPIA 1O51A 1SC4B 4CM2A 4ECZA 2ASLA 5LJ3Y 4HYKA 2P5VA 5GAEU 4CLYA 5L8RC 5A0YB 2AX1A 3KWMA 4CM0A 2LEAA 4A8FA 2W9BA 1TU0B 5F8LA 5I3UA 2VICA 4WP9A 3MXHP 1R89A 2V8HA 3KMSA 2P6TA 1VMBA 2EPIA 1SVDA 1MROB 4JP8A 1WJ9A 1X9WA 2V6AA 4ZVFA 4NEYA 2ZUGA 3K5PA 1WOSA 3TA2A 1N54B 1Y9OA 4OZJA 4G3IA 1HNVA 1S1XB 3JSRA 1VQOS 4P2XA 4F0MA 1VQLS 5BYRA 3VR1A 2F63A 1RHQB 2WSEC 2K1RB 4A4JA 1ZM2A 2CPJA 1AFJA 4ERDA 2AZ3A 2HNYB 1YQHA 2I38A 2JRSA 4KO0B 4J9VA 4RNMA 4PABA 2H48B 3G96A 3T1HF 1VRTB 1M5OC 1NSKL 3IG1A 1JX4A 2YNIB 2OEMA 3D54A 4PWWA 1H98A 2CPYA 1F3VA 4ECUA 4FKXA 2EFVA 4CLSA 3DOKB 4OI3A 1OQ3A 5KFEA 4GKJF 2JC0A 3TEGA 3WC2A 1QJHA 4CT9A 2HQIA 3T5JA 2XMWA 3QSYB 1RT5A 3TA0A 1TUGB 4WKYA 5JMNA 4X84A 2DNNA 2QG9B 1JNZB 3KLGA 4OZLA 1K8AT 3VVUA 2U1AA 4ZIVA 4F4WA 3HXMA 4WP3A 1EIYB 4OZ1A 3T6JA 2IM0A 2WSFC 3PY8A 4BS2A 4OV1A 4NLOA 3AD7C 1QAXA 1PBAA 1YG0A 4B02A 3KTQA 1AA1B 2PI5A 2PE8A 1F5CA 5D78A 2AYEA 2HFOA 2LFVA 3HSGA 4KV8B 3BSAA 3D66A 4LIWA 3NOCA 4NLYA 3KLEB 4LMZA 3W9JA 4ED4A 2F8HA 2XY6A 1U7LA 4Y65A 3QQCD 1NHKL 5A8WB 1B0VA 3OR1A 2IJFA 2W8KA 3ONQA 2FLNA 4PQUB 4JV2A 2B4UA 4YS2A 2KJWA 5KG7A 3D0GE 2CJAA 1MW7A 2MQPA 4J5OA 4MYUA 4P7VA 5HN0A 3DMJB 4J9SA 2EVZA 4DQRA 2D7SA 1KQSR 5HJYA 2O67A 3NGUA 2K7KA 2DGVA 4RO0A 2LMIA 2ZH2A 1H2VZ 5D0RA 3G82A 3CDBA 4CP5A 1Z1ZA 5D8HB 4DPXA 4A8QA 3M2RA 1RHKB 4WYLA 3OTDA 3MM5A 2JLGA 3OFHA 3PRDA 2OMLA 2V5HG 2VOPA 1GQEA 4U8VA 5HATA 4LF9F 4PYAA 4USUA 1FJGF 3NCRA 3MEGB 1S9EA 2Z2ZA 1BLUA 2XC9A 4TY8A 1S4EA 2B51A 4RUBA 1WHXA 4ZPTR 1U26A 4LFBF 5DM7Q 3D68A 2FDNA 3HSJA 4C97A 1RCXB 2Z2LA 1A7GE 3SQGB 5B0EA 3OBIA 1NK9A 1UVKA 2L3MA 1SI9A 4X66F 4YDDB 1RAAB 2AD9A 1VHIA 3CCVS 2I1RA 3P5TL 4YEAA 4OL8A 1G6BA 1ZAWA 4ED6A 2C3UA 1CJVA 5E3QA 1KHVA 3GONA 1RTDB 1N5QA 3KOAA 4U6PA 1QAJA 3HD1A 4O0NA 2KVQE 3T41A 3MM7A 4NLXA 5J2MB 3AOCA 2BANA 1APSA 4MIWA 3TZZA 5M2PA 3CJ4A 1ELOA 5HL7Q 3EDQB 4LQ9A 3H5UA 5HBMA 4NXNF 2RQCA 4IR9A 3MM6B 3Q2SC 4OYMA 1WEXA 4B9SA 4TVAB 3CJ3A 3IO1A 4ZCMA 4UF4A 1J5EF 2D3OR 3J81U 1VC0A 3IR6B 3OLAA 1T9WA 4DDFA 1DLOA 2R4FA 2XY7A 3W2WB 4DL2A 2Y8WA 2BW7A 2O1PA 3NGTA 4N77A 3T19A 4NEZA 3QRQA 2ZWOA 1S1TA 1FNMA 3F73A 1FERA 2M4MA 3H90A 2Z2YB 3GV7B 2P9GA 3PX0A 3MMAA 2V34A 2V2KA 2CG4A 1WHVA 3PW7A 2J0SD 1HBOA 1DAXA 2YH0A 1UTAA 4RU9A 1MMDA 1G2EA 2MXYA 3TJ9A 4IO1A 3M32A 2CVIA 2MKYA 4TYAA 1TL1A 1X9SA 3TJAA 2C2NA 5SUHA 1X0PA 4EMDA 4RW7A 2DB1A 3F0NA 4CH0S 4QQBA 1IKYB 4DPWA 2RRAA 1NJIT 3PTWA 4L72B 1WD6A 2UXBJ 3FBEA 4ZVHA 4DV3J 3QSIA 3KJFB 3V6DB 2WVDA 1I3OB 3W9IA 2FB0A 3KK1B 4FZVA 3HCXA 4B9MA 2RNEA 1DFDA 3HI9A 1XNRF 4A8MP 4K59A 1S72S 4WKRA 1RAFB 1R3NA 4Y00A 2J6TA 4AFFA 2HZVA 5LMNJ 5CH7B 1DURA 2H4YB 2RRBA 3WZ0A 2UVRA 1QD1A 4XK8C 1NK6A 2R2SA 4K4SA 1KC8T 3VAIA 2JFKA 2HHQA 5KFQA 2W01A 4ZPBA 2HMIB 3C6TB 4GO7X 4NA2A 4B9UA 1LFPA 4F0KA 2OIHA 1QE1A 2PN6A 3CJKB 4B3SJ 3KFWX 4HH0A 5HO4A 2WTFA 3OQ2A 3EZUA 3UE2A 1RSCA 2R42A 5AE1A 5IT9Y 3Q2TC 3DU5A 3GFZA 1A9NB 1G3OA 4DUZJ 2QLJB 1WI8A 3MPWA 4OHVA 4HL9A 1VQ7S 1U1PA 1EX8A 1N36F 2MY7A 3Q8PB 2XZDB 1LOUA 5L9NA 4J9UE 2Y0BB 1N4LA 2AW0A 4AXJA 2DHXA 3KJVA 1JLEA 1UEKA 3CIZA 1MLAA 1BY9A 1T9YA 1TAQA 3OW2R 4Y2CA 2BQUA 3H0PA 2YKOA 1PYTA 1IKXB 5GAHI 1WHYA 4X2BA 2C2MB 1LW0B 4KQZA 5KFDA 5L38A 4DR7F 4FYXB 1TL7A 2CPFA 2IBOA 4PXDA 3POTB 1LW2B 3EZ5A 4RNNA 1F60B 4F04B 3HFVA 4M1KA 2E7XA 1U2CA 5KT2A 2BOAA 3BGRA 3NCPA 9ATCB 1EZZB 1T7PA 4USTA 3U27A 4ID5B 1IBLF 1N52B 2PFDA 3SFUA 5A8KA 3CD6S 2C3OA 5IM0B 4USVA 1CLFA 1PGZA 4BC7A 1R8AA 1RT7B 1RDRA 4ED8A 4UOGA 2J6UA 2ERRA 3R1HA 1WHWA 2LQBA 1N5YB 4USWA 3D7SB 1PAUB 3DLEB 2YX4A 2VFSA 1VQMS 2RU9A 1TFWA 4R5PB 4ZVEA 3FFIB 4YFUA 4DSEA 2Z2MA 1KVJA 4ZDNA 3CCSS 2QFJA 1S0VA 4F25A 1X4DA 5GAEI 4QR0A 2ZH5A 1EETB 2I0XA 1JLGA 3AODA 5L39A 1JLCA 3HMJG 1RXOB 3EZOA 4HHJA 5DRKA 3FZBA 4HHHA 3ENQA 2ZC3A 1W2BR 3DLBA 5G4DA 2ATCB 4UUXA 1NXIA 2MGZA 2CQIA 3DC2A 1F6TA 1T11A 3V4IA 4CIOA 2NCKL 5IV4A 4PEOA 2GIRA 5D0HA 2CJBA 1HQEB 2R8JA 4F4AA 2BOPA 3NS7B 3MCMA 3DLJA 3I31A 1R27B 5CXTA 2IVMA 4W4MA 2R7SA 2DHGA 3FBBA 3PJWA 3CVKA 4TN2A 1SJRA 3D6HB 2DNKA 2XWYA 2RUSA 3DRPB 1SC3B 4R0EA 2M8HA 8ATCB 3PKMA 3EJMA 2AEMA 2Z57B 2WZ1A 4QU7A 2DNRA 4QWAA 1FHTA 2DNZA 2ZVSA 1RUSA 7FD1A 2HURA 3TI0A 1J27A 3SYZA 4CQ1A 1C1BA 2YWEA 2M52A 2WRMA 1YJVA 3TAPA 1N32F 1RHRB 3CJ2A 1YZ6A 1Y00A 2GW8A 2D3O1 1XR5A 1FVQA 3PVXA 1CC7A 2E5HA 2OKQA 1TKTA 3PIOQ 4M63A 3G6ES 4KIAA 3MFHA 3FMWA 2HKEA 1UFLA 1M5SA 1X4BA 3QT7A 4NX9A 4PG7A 3CDAA 3KLVA 2HHVA 4HDHA 2K7JA 1UVLA 2WHOA 1SKWA 1D3WA 3K5LA 4RNFA 4ZJQA 4TXSA 3BKUA 1V9OA 1LWCB 2J0QD 2HNDB 4QYZK 2VQEF 1CSJA 4V19J 1ZYQA 3FC9A 1NZAA 3ZO7A 1TKXB 3PJXA 2MZQA 3O5TB 1R43A 1TVRA 1JB0C 3MAAB 4C2MA 4HI1A 4G1QB 1X0FA 4CLKA 1RA7A 2K3KA 2X1FA 1FNOA 2BKPA 2ZDPA 3FDSA 2XGQA 4I6WA 2UV8G 5ETSA 3MM8B 4LVOP 1NK4A 1HWLA 4KHPF 5A0YA 4X65F 1TMMA 3UDVA 3OD2A 2WB4A 2V63A 1HLWA 1RADB 3LTOA 1K1SA 2YVSA 4ELTA 1XMOF 5C5JA 3M9OB 2JH3A 4AQYF 4ZPAA 3VAMA 1REVB 4KKOB 5HQ8A 3VGVA 2CQBA 2QLBB 1X31C 3MURP 3OFGA 4WXOA 3BDEA 1S1XA 1Q78A 3FNNA 3EVWA 1KVIA 3IFEA 1FK9A 4LR7A 2K1RA 2ADCA 4UZBA 1O5JA 1WKKA 4YMEA 1IR0A 4LRAA 1SUQB 2HNYA 3TUJC 3W5XA 3JSYA 2H9ZA 1H74A 4LF1A 2AYGA 4EI2A 4IH6A 2GAHC 4NA1A 1VRTA 1DY3A 4I2QA 2YNIA 2O5DA 5J2PB 3LP2B 4YY3F 1LNQA 1IQTA 2YNGB 1YIJS 3N0VA 4LR9A 2ZNYA 3CO0P 2H4WB 4O4RA 2ZH1A 3DOKA 4P9SA 3C16A 1BGXT 3U1NA 3W66A 1KSPA 4LSNB 1WDDA 1FNXH 2R2UA 5KG0A 4I64A 4A8OA 2L08A 1NO8A 1QDUB 2PEHA 1U1NA 4P2SA 2ZHOA 1HNIB 2AEJA 4HH1A 2OTLS 1NDPA 1U0SA 1HQUA 2R8KA 1TFYA 4KH0B 3R2CJ 1YVFA 4ENOA 1B7YB 2GIQA 2DVIA 5F3ZA 3SEOA 3THTA 3OT9A 2ZH9A 3JQKA 2NXUA 4OMFG 3FQKA 1FFGB 2MZJA 3THVA 5HLFB 1L3TA 4QWBA 1RE1B 1TMJA 3PKYA 3NNCA 4C3MA 4IQMA 5LL6d 4RNHA 4FN5A 4WZQA 1HR0F 1Y7PA 2LQJA 4KV8A 1H73A 1RT4B 1L5UA 3ENAA 2I5JB 3T5KA 3K59A 3L4BC 2MQNA 2B0GA 4K4UA 3BGUA 3UN5A 3JYTB 2O3DA 3SDEB 3KLEA 2GNKA 3FVYA 3TYTA 3JTNA 3H4DA 5ETMA 3ISND 2ZH6A 5M2UA 3IBCB 3FEYB 3Q0AA 2HFVA 2GGPB 4PQUA 3H59A 2QE5A 1NSAA 2BABA 1FJEB 2D41A 2EXUA 3IP0A 4YOEA 1SH2A 2BZ2A 1U8SA 3CJRA 5CYQB 2YQ1A 1B70B 1U48A 3DMJA 2B4OA 1S1VB 4P7TA 1UKUA 2M70A 3AJDA 2ZE2A 1YJ7A 2J8SA 2QX0A 3AB2B 4Y2IA 2APOA 1KBRA 4DR3J 4YUDA 4X4RA 2ZUAA 2Z58B 2N82B 4LFCF 1SIZA 2G0CA 2F4VF 3FJ2A 2WB1D 3KG0A 4DFPA 5KFHA 1FJ7A 1N0UA 2OHDA 5E33A 4USJC 4X4TA 4J9PA 4DEZA 4H4KC 2DT9A 4QWEA 4CDIA 4DX6A 1RBOB 1RBLA 1XBWA 2F8EX 4DV7J 4EYHB 4K4VA 2YY3A 1T8EA 3H7HB 1RAOA 2FVPA 4K4WA 5DDPC 4OZ3A 2Q66A 2YX7A 1BD6A 5KG5A 4B3OB 1FRMA 3HHLB 2CJ9A 1DARA 4EZ6A 2XS2A 4L3KA 2OAUA 3UD4P 4IH7A 4WZMA 4AL6A 1FX2A 4JI3F 2LXUA 3EPIA 5D0EA 4QW8A 4HACB 5HVGA 3OTCA 4WXWA 1RTJB 1TKDA 1G7CB 1ZA2B 3BO3A 2XULA 4Y6IA 3GJRB 4B3MJ 1QAIA 2M7SA 3NP5A 2LQ8A 4X4OA 4DL7A 3CULA 1LWXA 3GYGA 1RTDA 4F4KA 4DZDA 4DR2J 3UFCX 2CWKA 3A8IA 3MR2A 1K44A 1YWXA 1BQNB 2RJZA 1P27B 2H5EA 5J2MA 4ED2A 3GJQB 3PRVA 3A8JA 4KY3A 3BQ2A 3BSCA 2CZVC 2RVJA 2KYZA 3MM6A 3OSPA 5ETKA 1B3TA 2V2QA 1FO1A 3QPIA 4OHZA 4ZLJA 3SSQA 3N6LA 1N56A 1H3DA 3CIMA 3BGOP 1NK0A 1D9AA 3ZTRA 4AXIA 1WG1A 1I5OB 2VPXB 5DDRC 3ET6B 1IN0A 1XK8A 3W2WA 4XPCA 3G8TA 2GO9A 3V81A 4IYQA 1RTZA 3KHRA 2CFXA 3K5NA 2XSJA 4WFAQ 1D9FA 1H6KX 2PDAA 3M9NB 3ZZPA 3UDEA 4LF8J 3TAQA 3MAHA 3HVWA 1RACB 4ZN3A 1CG2A 3DRRB 4WFYA 1XNQF 4KH1B 4P2MA 1GNKA 2MSTA 3G87A 3ZZ0A 4CNYA 2R2TA 1HNZJ 1FRXA 4DV6J 3W60A 4LRDA 1MU2B 2GAGC 2YNHB 4DUYF 4RR5A 5GMDA 4JI7J 1I6JA 2XNQA 2BE2B 3A1YG 2DGOA 3B82A 1HL6A 2NZCA 5CD4A 4FXWA 2VZ9A 2H5JB 3R5DA 1VFJA 3AT1B 2HBZB 2J7WA 2QSWA 2DH8A 2E29A 2EC0A 5DG8A 3DDNA 4FVMA 5F8NA 2XYPB 4A8SA 3SMZA 3PR5B 1S9FA 4X64F 4F4YA 2XZWA 4ECYA 2XI2A 3TQ1A 3DHXA 2DGXA 4DR1J 4FF1A 4RLEA 3AJ1A 4JI4J 3KK1A 2XCPA 1GMWA 3PV8A 4A8WA 3IAS9 2N3LA 2BDPA 1VQ8S 3TVYA 4CH1A 3OTOF 3KLFA 1J5OB 2B8QA 2R2RA 2KYXA 2KB2A 3QYYA 2M9KA 3MCNA 4EFAC 5B0FA 4EUVA 3H98A 1URRA 4ZPDA 3VALA 4DSFA 1U0HB 3CJKA 1HI1A 4PR6A 2DY1A 4CO5A 1JLAB 2N4DA 4B3TF 1SV5B 2DR9A 2HVHA 2BQ3A 2G2YA 2FJWA 1SIWB 2KJVA 3BH7B 3QMQA 2XMKA 5AJ3J 3BDPA 1IWAA 3R6GB 5KOXA 4LF4J 1CULB 4OFZA 3K8WA 1PILA 6FD1A 2W24A 1KD1T 5IQQA 1HW8A 4JUZA 3OFFA 4DPYA 4YR2A 3HM9A 3QFWA 2HQCA 1RT3B 4ETXA 3LGMA 3UI3A 4BWJA 1DZ5A 2JL9A 2W7OA 1S0MA 4AT1B 3P4UB 3AXMA 4B17A 1B64A 4NRTA 1IKXA 1CBKA 1NB2A 1LW0A 4ANEA 1HWKA 3M8QB 1KR4A 1N33F 4NWBA 1LW2A 4M8LA 3LPEA 1URNA 3N6MA 2VG7A 3Q24A 4F0HA 2ROGA 3M2UB 3HJFA 5EWGA 3H8YA 3SQOP 2FGOA 3QIDA 1KQKA 2A2DA 1AT1B 3QJLA 3GZ7A 1E6VB 4ZCIA 1R0BG 2BMBA 4ID5A 2YX1A 4O4GB 3UR3C 1S76D 4X4SA 3AA9A 5IM0A 3ZTQA 3E8OA 3GIJA 2V69A 1RT7A 3HT3A 2UU9F 5SZTA 3KDOA 1VQPS 2M5YA 3PFEA 3VV2B 2MKKA 1D09B 4IG3B 2MLYA 1N5YA 9RUBA 3BPDA 3DLEA 1T9XA 3X3UA 2X1GA 2EG2A 1T3OA 3CMQA 3FFIA 4M5JA 4QR2A 1S49A 3GG1A 1UWBB 4KB7A 1UVJA 4NRUA 3SI8A 4WIQA 1NEEA 2DHHA 1C0TB 4C8YA 2ACMA 3KHHA 4WFZA 3UW1A 2VQFF 2J9EA 4R25A 2ZDOA 1BQMB 4RW9B 1I1GA 2LKZA 3SBMA 4ILLA 2RB7A 4ZVUB 2HZCA 1OPZA 2GQ2A 1OY6A 3GCWP 3I5CA 2V8DA 4NYOA 2UUBF 5IWAJ 3MMBB 4FF4A 4RW8A 2DBBA 1S9GB 1EAYC 5K14B 3VQTA 2IY5B 2YKQA 2RHQB 3BS9A 3FEXB 3J80U 3R1LA 3CCZA 1WF2A 4CTAA 4J7CA 4ZK7M 3WX4A 4J9LA 4XDDA 1QTMA 2QLXA 3EYZA 1F1BB 2QA4S 4NLGA 4Z7YA 4C8OA 2CPXA 3K58A 1NZ8A 2CWXA 1WWHA 2Z56B 2GC8A 3PFOA 3QRPA 2AGQA 3Q8UA 4DN0A 3EGZA 4UW2A 4DV0J 5ETLA 1FESA 3CMAS 1UVIA 1N0VC 2OELA 4ZKAA 5I3UB 2GHVC 5I3QA 5AXKA 3VAKA 2AGPA 5HQLA 2B7CB 1NK8A 4LT6A 1P1TA 4ZHRB 4KFBB 3UCZP 1HNVB 2CKWA 4ZP9A 3NOGA 3WIUA 5ADZA 2PA3A 1RHJB 2ZBCA 3GLJA 3CB4A 3RRGA 3EMTA 2PO4A 4UUWA 4EK2A 2RD5C 4JI1F 3Q23A 4C8ZA 3BEGB 3JQJA 4F3QA 4ZA1A 4DU8A 1QAYA 2HQ3A 4RNOA 2HNDA 1HKAA 2IIHA 4PG5A 4QU6A 3TRGA 1U1RA 3QGPA 4OV6A 1TUWA 3MAAA 3V6JA 5J2NB 3VAJA 3OL7A 5ETOA 1YDLA 1ZS6A 1UFKA 2HFUA 2HQFA 4C11B 1FRJA 2FJVA 4NMLA 1VQYA 2NR0A 2RE1A 1JXVA 1HD1A 2XNRA 2HVDA 1TUVA 2YWWA 4PAAA 2DNPA 1NBEB 1RWKB 3ZZUA 4ZOSA 4JB8B 3QZ8A 1REVA 4PKDB 4KKOA 3AD9C 3PYEA 2NQPA 2NUUG 3GFYA 2Y9HA 3D9BA 2Q6CA 5KOWA 2IMWP 1RWXB 1M5PC 3PRBA 4DV4F 1YJNS 1SUQA 1X4HA 2JC1A 5KFOA 3QWUA 2RS2A 4GVLA 1DTQB 2RQMA 1VRQC 3T5HA 3GILA 2W25A 4RZRA 1F5AA 3SCJE 2E1PA 1YJUA 5D6GA 5J2PA 3LP2A 5KG4A 3ZC4A 4E2FB 1NDKA 2DGQA 2F9JA 4KR0B 4L75A 1FDBA 2J6SA 2VBYA 3OTEA 3D28A 1YJTA 2FPHX 1IUJA 1UW9A 4LSNA 1YZ7A 4LRFA 1PYSB 1H72C 1SJ3P 3MR7A 3NL0A 5LJ5Y 1KFSA 2Z0GA 1HNIA 3UN2A 2YXLA 3TO8A 1ROFA 1VJQA 4AD6A 1OO0B 4OHXA 3ETOA 1FEEA 4JV5F 3MM5B 1Q53A 5CCLA 2G9OA 1SBRA 2D74B 4O23A 5HLFA 2LA4A 4I69A 4FXDA 5JUMA 2EFQA 2IYGA 2HHXA 3EWGA 2RT3A 1Q7LB 1NDLA 5D77A 2VPYB 2PMHA 2A18A 3ETMA 3QIPA 5D4PA 1WSVA 2GVDA 3CTRA 3PW2A 4DV2F 5HMZA 3LGNA 3SDEA 2VH7A 3G8SA 3MPDA 4N8NA 5ITHA 1R8BA 2FZKB 4P6QA 3MR6A 4O44A 2DIUA 4HEA9 3MECA 2XZTB 1SKUB 1RZMA 2R7QA 2KTQA 3MGJA 2YPYA 3GSIA 4KT0C 1CJVB 4GKJJ 3VGSA 4KYZA 2HBQB 2YKNA 3RW6A 4DF8A 5CYQA 1Y0HA 1R8HA 3MM7B 2BANB 1HFEL 3AFGA 3C14B 4LRCA 2DCLA 1S6PB 1TAUA 2LP4A 2P8IA 4FF2A 3O2IA 5KG3A 1VQ4S 5HBMB 1M5VC 1HHQA 2IAJA 4DS4A 5KT4A 3TEHB 2ZD1B 1HBMB 1NJWA 1RLDA 1PBUA 2L48A 1Q4RA 2RDDA 1BHNA 4NLDA 4RJVA 2E5LF 1WC3A 1PC4A 2YQ3A 1ITPA 1ULRA 4WFBQ 3M8WA 3UN3A 3HT0A 3HZGA 5A8RB 1UWAA 2DNLA 2R7RA 3ILIA 3U1MA 4UOFA 2BXJA 2OFHX 5C2GA 3HHLA 4OLPA 4D3HA 3NGDA 1X4CA 1KN6A 5LT5A 1EKRA 1KQGB 4S0MA 2C2KB 2ILYA 4IOAQ 2CQ0A 4YR0A 1TKZB 2EI5A 3RB3A 2ZZNA 1RTJA 2JLFA 4QPTA 3VQSA 4LREA 2GJFA 2MZ1A 3D6TB 1WC0A 2MKHA 2UXDF 2DISA 4RUAA 2ILZA 1B7FA 1S0NA 4OI4A 3OUYB 3R7NB 1BQNA 4DL5A 1ZTWA 4NYZA 3K8VA 4C8LA 1Q79A 4M5LA 4ECQA 2XO6A 4DBQA 4NCBA 3M8PB 4FBUA 3HVRA 3CJTA 1XMQF 1YRTA 2CZ4A 1S0OA 2CUYA 1XR6A 4LF9J 1QVFR 4IO9Q 2V4JA 4KTQA 3L7UA 4M95A 2NS1B 2ZJRQ 3ET6A 3KHGA 3HLUA 4ILMA 5IZHA 4LFBJ 5LSRA 3NWRA 1YBTA 2KRBA 4MH8A 4ELVA 4EEYA 3KG1A 3CJ0A 1TR0A 4WTOB 5KFBA 5HVHA 1RABB 5KFSA 4X62F 1FWKA 2F40A 1YK9A 3CF5Q 2CQPA 3IM9A 4KHRA 4X66J 2DXDA 1E6YB 4YB1P 4FXVA 2CZ9A 8RUCA 1ZTTA 2MTLA 1MU2A 4GMKA 3F56A 2YNHA 4DPOA 2RAQA 1HNWJ 3J7Z5 4DX8H 2UUWA 5BR8F 2HRTA 3DN9A 3M6WA 3QATA 3SZ2A 3MEKA 3FSIA 3R97A 4Y2KA 1TK8A 3KJVB 2J8AA 1HBNA 4ED5A 5I42B 2AJ0A 3UPFA 3KG4A 1ZETA 1ZM9A 4NXNJ 4FBTA 3RR8A 4OI2A 2EFGA 1U47A 1YJ9S 3R3TA 3ILOA 1RU2A 4WWSA 4ZVQB 2R3VA 3IWLA 5D15A 2HIQA 3CJ8A 4DF4A 1J5EJ 2RH3A 2I8EA 4DX7A 3BQ0A 1BE4A 4YN3B 2HHPA 4OZNA 4JBCA 1J5OA 2VB6A 2QA4G 5KFGA 2M0GB 1DBDA 2E5IA 4A46A 2JSXA 3KJQB 1JJCB 1VQKS 1FVSA 4C0HA 2A6MA 3I96A 1S5ZA 4I7FB 3WBZA 3BGRB 4LJMA 3PYDA 1U0HA 2KFNA 1NJYA 4J90A 2AF6A 1PIEA 5A8KB 2FC8A 4JI6F 4O0IA 1JLAA 2HFZA 3PM9A 1SV5A 2HRUA 3DDIA 4KAIA 4E0DA 3NGKA 3M1VB 1WF1A 2CRLA 3LANA 2JNJA 1N5TA 4YHHF 4C3KA 3TQEA 2ZKTA 1VLYA 3TARA 3DXSX 4Z7CA 2VC0A 2E5JA 4NLQA 1CULA 4ECWA 2XS5A 3GU0A 2CQ3A 1HA1A 1S97A 1H2TZ 4A47A 2R7TA 4I4BA 2NSBA 3BKFA 3IXQA 4YB7A 4Q44A 3HP6A 1RT3A 1P6TA 1U6FA 2XMUA 1MSWD 5H9FK 1VRUA 1FFSB 1OMSA 1U2FA 3LAMA 3J7A1 4HI2A 4A8YA 1IKVB 2GIFA 4ZLPA 2NPFA 2QYCA 1XNRJ 5KFKA 2EFNA 2PEBA 5LSOA 2H51B 2PT0A 4F26A 3HHLC 2DO0A 4W98A 4DI6A 2MMYA 4CZCA 1ZZFA 2ALZA 1LWEB 2K2PA 1HYSB 1RT2B 3EGNA 4LIRA 3O8WA 2AV5A 2V8PA 1QSYA 1E6VA 4DCPB 4K2JA 4O4GA 4RPFA 2W2PP 2CVEA 3QGHA 3X1LB 3A13A 4QIEA 2B43A 2FQQB 2Y8YA 4OYOA 2WW8A 3IBFB 4IG3A 3FMBA 4OI6A 3D1QA 1JQGA 1N36J 2IVYA 2Y0SD 1Q95G 3J7YU 1GTHA 2Z8QA 4NMXA 2RIJA 1B0PA 1C1BB 5DM6Q 1LXJA 1UWBA 1X9MA 2QLFB 2WK4A 1UFWA 1NKBA 2FVQA 1IVZA 2KU7A 3HFZB 1QUVA 2RDIA 1TL5A 1U1MA 2DHAA 2EC2A 2AWZA 4HR2A 2UVWA 4RW9A 4XIUA 4Q43A 3DOMB 1Q81T 1OWXA 2HFSA 4NE9C 4WU3A 3NGSA 4PPZA 3B54A 1ZH5A 2MHEA 2JOQA 2NXCA 4MKVA 5GADI 3OHBA 4MKBA 4DR6F 2JLEA 1AZSA 2EBGA 2ZOMA 2DRAA 1S9GA 8AT1B 5K14A 2MHNA 1H38A 2FUG9 2EK1A 3FGVA 1B4SA 3MOJB 2VG6A 1IBLJ 5DDQC 3RW7A 1W26A 2PFFB 3JQMA 3BH6B 2DR5A 5KFXA 2AYBA 2JX2A 2C42A 2ACYA 4USIA 2NXNA 1RTHA 4K4XA 3DLKA 1GEHA 1WKLA 1RTIB 3TWZA 2I9SA 4DL6A 5CZVA 3CCTA 1LK7A 2FVCA 2BJ3A 2H65B 2FLLA 1BWEA 5BXIA 4MYTA 3JAMY 3L7PA 1VS3A 5J1NA 1FDAA 2A1BA 2ZJPQ 4ZHRA 3VWSA 3BBBA 4KFBA 3C8YA 4CNZA 2U2FA 4RU2A 1JKHB 1VJWA 1AXQA 4XPEA 1FK9B 2ROPA 1HNXF 1KRPA 3RRKA 4JOUA 2XBPA 1PJ7A 3H40A 1YI2S 4F36A 3MD1A 5J1PA 2QSFA 2LECA 4UOHA 1LKZA 2DEJA 4I2QB 2VD3A 3J81j 2XYGB 4O3NA 2QL5B 2E1MC 2VBWA 3MTKA 3W5YA 2CPEA 5FLXY 1UJ4A 5C2CA 3IMQJ 3CJQA 3OFEA 1IKWB 4KPYA 4DUTA 1EHWA 1S4FA 2BBEA 3C16B 2JEJA 2EBEA 5J2NA 3IWNC 4Q5VA 2KH9A 2FHMA 3C66A 1R8PA 1FRLA 1FDNA 3MAQA 2E7WA 1Y5NB 3UR0A 3UWTA 4C11A 5JJBA 2PI4A 4RW4A 4Z2XA 2IFXA 3CMES 2DNMA 3UDLA 4GKKF 2XLJA 4Q2MA 4F2SA 1HQUB 3FSXA 3NKYA 2R7VA 2PIIA 3HO1A 4OJ3A 3GSDA 5KFWA 5HMWA 1YITS 2BJ7A 2LDIA 2E9ZA 4ICLB 3G9CA 5A76A 2J0XA 1H7XA 1X7VA 1N32J 3ITHB 4BCAA 2LXIA 2XHCA 1VK3A 3NMRA 2VUGA 2M2BA 2ATLA 3PYFA 3MMJA 1PKUA 1GMWD 5ETQA 1UP1A 3KDNA 2XB2D 1NLKL 4OYBA 2HNZB 3CD5A 4IRCA 2W9CB 1S1UB 3AQPA 1DTQA 2VHGA 1RLCL 2ZH8A 2FJXA 1FKPB 5K9FA 4C7QA 2X1AA 2VQEJ 2YNFB 4DV1F 3ZNJ1 5LSLA 3TAMB 1D1UA 3IN5A 1ZBTA 3A8EA 3OXLA 3IRXB 2YPZA 4R0JA 2X7IA 3LOUA 4JI5F 3US5A 5HANA 1BMQB 2VFTA 1HWUA 3NMAA 4ZPVR 4XAKA 5IFMA 3MCOA 4KHPJ 2GVZB 3PEJA 2B6AA 2OTJS 4X65J 2D9PA 2ZE2B 3E51A 3HJVA 2DITA 3VHQA 3W9HA 1GT8A 1XMOJ 2D9OA 5ETRA 2AX0A 3CUNA 4AQYJ 4N7TA 4Y0FA 2OPPB 4GRSA 4USKA 4DR4F 2ZM6F 3I4PA 3MPVA 4DQSA 2K06A 2VBXA 2IDEA 4XO0A 3RAXA 4ZS6A 3SSSA 2CQGA 4CLTA 2CDQA 5B0AA 4ATNA 3LP0B 2LDYA 1Q82T 3PX4A 2XMAA 3IM8A 2E1AA 4L76A 2MEWA 3QNWB 2RDJA 3C2PA 1TL3B 3MEDA 4YY3J 1JLBB 4WTYA 2HVZA 5KFFA 2BQRA 1XWLA 3R8YA 2AP6A 4MKAA 5FD1A 2CNOB 1RK8A 3QWPA 3U7JA 4DV5F 3N28A 2HG4A 3Q8VA 1VC6A 2V2ZA 3HSDA 4U9RA 4KGVB 4NXMF 4OI0A 4K5SA 2DH9A 1RISA 3C14A 4RW6A 1S6PA 4ILRA 1OQ6A 1F2HA 3N79A 4DFKA 1C0UB 3LA0A 2DEIA 2R7WA 4NLTA 3NG8A 2ZD1A 1HBMA 4L3NA 3MMCB 4LF2A 4HLBA 2BJ8A 1L3UA 1TZ0A 3M8SA 3GPAA 3H5SA 5F8IA 4DFJA 5A2QY 2PSZA 1M5KC 5H1SV 5LOQA 1HR0J 3I9ZA 1FRIA 1GAOA 3V81B 5A8RA 1O8BA 3DI6A 4QIFA 2IM2A 3FKBA 1OYDA 2XSJB 4KGMA 4DHVA 4M5MA 1WG5A 4KSEB 4OJ1A 5KFYA 2C3MA 3HF5A 3HFKA 4FYYB 3GP9A 2OH2A 2NREA 2AMCB 1OSDA 1TKZA 1OS5A 3GYNA 3UNGC 1Q7YT 2BM1A 4TLRA 2E1RA 2GJ2A 4N5SA 2OD6A 3RGIA 4C6AA 4WU2A 2BJ9A 2CAJA 2HWHA 3EX7B 5ETTA 2B4VA 3N9UC 3CE8A 5L1KA 3CCWA 3OUYA 1H2UX 3S7RA 1W7WA 1LWFB 1VIOA 4WFNQ 3MOZA 1M1GA 3QGGA 3H25A 1Y3JA 4DQPA 3KUEA 5EWFA 1TQLA 2ZFHA 3T1YF 4WBFA 2F4VJ 2IDLA 1ZAVA 3M8PA 4RX6A 5CA5A 1NPKA 1S7IA 2A0FB 1JK9B 1D8YA 3S6EA 3DM2B 4OIXA 5KT3A 2P9EA 3LP1B 4ZVOB 1C1CB 1RGVA 2HVIA 3AQOA 1KDNA 4JI4F 4AL7A 4F02A 2RMLA 4F8RA 3IWXA 5MLCV 3KLFB 2BUNA 2YKAA 3R2DJ 3MUTP 2HWIA 3C19A 5T7LA 3Q8RB 4DWIA 5KG2A 1I94F 2EW9A 2YTCA 4N56A 4WYWA 1EQ0A 4PG4A 4JI3J 2DNOA 3VCDA 1PSDA 4C98A 3H2UB 2ALYB 2NLWA 1FEHA 3DFEA 1IQZA 2W4PA 1D9DA 3M05A 2W2QP 1CQMA 3I4HX 1E6YA 5FJ4A 3HDSA 4JYAJ 2PD1A 1YX2A 3OJSA 1S6UA 3CC7S 4ED0A 3R6LB 4DL0C 3DLGB 3WIVA 5IT4A 4ES1A 5F8MA 1VBXA 4F4ZA 4F3MA 1N34F 2LLZA 1VQSA 2FC9A 2WOMA 5I42A 3BM7A 1RU1A 1MMLA 3SXLA 2W7PA 1V3ZA 2CQ1A 2XMVA 3J7YI 4DMZA 3KHLA 3TANA 4DR5F 3CPWR 4RUCA 1F2GA 1IR1A 5CD4H 2HIYA 2R7OA 1RKIA 1KTVA 4B9TA 3BJYA 2FLOA 3AJ2A 3CDUA 2EK6A 3I32A 3LPYA 2RQ4A 4ETZA 2L9DA 2VG7B 1WI6A 2VKRA 3FBFA 4FVCA 1WDTA 3IA0A 4TKTA 4U7UK 4I7FA 1VQ6S 5IT9U 4YB6A 2KZZA 1Z4UA 1U25A 2DY9A 3TW0A 1TV6B 3GIRA 3NAIA 1XNQJ 1AUSL 4DCOB 1HBUB 2CPZA 3B6BA 3OTBA 5F9NA 3M1VA 4ZLNA 1AFIA 4DUYJ 1VC5A 2OP5A 3WC0A 1MMNA 1VR6A 5HSPA 2DNYA 1FKAF 5L46A 3RG6A 2POKA 2ZZMA 1I51B 1SL1A 4X4UA 4Y2MA 3AA8A 1XIQA 3CCES 1SQGA 1MN9A 1UL3A 4UOCA 4B3RF 1FD8A 3JSMB 3OJUA 2RUGA 1Q5YA 4X64J 5IOLA 2Y1JA 1R8CA 4CLWA 1T94A 5DQIA 2FGCA 3VAGA 2KI2A 1DQ9A 4LF7F 3B4MA 4JI0J 2N7YA 2HYIB 5K8MA 3LWMA 2V0NA 1FXLA 1IKVA 4C8NA 5H9FJ 2UZAA 3THPA 2RKIA 3AY0A 3PW4A 3M6XA 1FKOA 2MQOA 3BF4A 3EXYA 3OTOJ 2LU2A 3BPSP 1L3KA 3J7ZT 1ZAXA 3IAM9 4RW8B 1P9YA 1IM6A 1LWEA 4OHWA 3BO2A 1HYSA 5HQMA 1RT2A 3CCUS 3RRHA 4YR3A 3CSKA 3R9LA 4LF6F 5AXLA 1Z2LA 4CTAB 2BR0A 4QPXA 1EARA 4B3TJ 4ZJLA 3MDFA 3RB4A 1YSJA 1Z2ZA 2DGWA 3EICA 3KK2B 4WIIA 2ZWPA 3HHEA 1LFWA 1PYOB 2FHJA 2IJRA 3G71S 1NPRA 4QJVA 3RBZA 4NZ7A 2ZITA 3P5BP 2DR7A 2FLPA 1XR7A 3MD3A 4V19X 3C46A 2HK3A 2RHSB 4G1PA 1Q8KA 4CLUA 6FDRA 2XO7A 1S6QB 2ZH7A 2DH7A 4URSA 1SKRA 2F65A 5HP1B 3D0IE 5DG9A 4EBDA 4IQXA 4C0BA 2OGUA 3PACA 4YB5A 4IG0A 2XY5A 2KDOA 3HPOA 3EDRB 2SXLA 3N01A 3L7OA 5CZXA 3DOMA 3CJ5A 4O3SA 4J9KA 1IR2A 3R5JB 4H4KA 1N33J 2QMUB 4ZVTB 1CVJA 1SJQA 3W64A 1SL2A 4PXBA 2CDRB 2W9AA 1N6QB 4NLWA 2B56A 3DDKA 3JB9k 4L73A 4K7QA 4J9MA 1AW0A 3MPYA 2MLXA 1GMUA 1QLNA 3R5GA 4PCQA 2D3ZA 1UVMA 1FJCA 2UU9J 1TP7A 1RTIA 5LMUF 2CJKA 1V5VA 1HD0A 2WONB 4FYDA 4XTTA 4UQTA 3R5CA 5KFAA 4OJGA 1CPZA 1ZA1B 1GX6A 1ZM3A 3QT8A 3AH6A 3BR8A 2UUCF 4PPDA 4LFAF 3QAUA 3PZPA 2YWHA 4CLZA 2F4FA 1FX4A 3SV4A 2RILA 2FVRA 2CXEA 1JKHA 1WUUA 1S48A 2H54B 3I9V9 1DQ8A 4O3RA 2HFNA 3M2VB 3G86A 4C8MA 2HHHF 3KJNB 4WP8A 4OYWA 1UMJA 3OXFA 4F2RA 3B8HA 5F0UA 3ZXWA 2QO3A 3RAMA 1YLXA 3PX6A 3IC1A 5G0RB 4DSKA 2DXFA 1IKWA 2LXFA 4QWDA 3UCUP 4Q8EA 1T95A 5FIIA 1QM9A 3HULA 3QAEA 5AE2A 2KN4A 1SB6A 2NZ4A 3MUVP 4LUBA 3GWCA 5HMYA 2DXEA 4WE1B 2PA8D 4OX7A 2R8IA 4ANDA 2AJFE 4IH5A 4CO2A 1XN9A 3H4BA 4WFXA 4G65A 1SCJB 1FFWB 3Q22A 2UVUA 1P1LA 4LSLB 4ICLA 4C48A 3SSRA 3ITHA 5K8PA 2O01C 4C8KA 3VVTA 3GR0A 3TP2A 5KFLA 2VFVA 1U8WA 3FRZA 5D3GB 1UA1A 2KT5A 2K3IA 4N47A 5J1EB 3QRRA 1RAHB 3TX0A 5MAOA 4JI1J 2V8GA 5AXNA 3M8YA 2HNZA 2W9CA 1S1UA 1LEOA 3QIPB 3W7BA 4JV1A 4Y28C 2GVDB 4JI2F 1M0SA 1PAEX 1FKPA 5E3AA 3TVKA 4GO5X 2UV8A 2YNFA 3ISNC 4O44B 2ASDA 3OHAA 3TAMA 3MECB 1X5TA 4X4PA 2GO8A 5CCMA 2XHWA 1IBKF 2JFDA 2LQ9A 3IRXA 3BBFA 3T3FA 3G8QA 3CCQS 3IGNA 2IMOA 3RZAA 5K20B 2YKNB 3OV7A 1U49A 2ZOFA 2MB0B 3ILLA 3K0JA 2GVZA 4FPIA 2WVBA 3ISZA 2Z4PA 1F9FA 5DDOC 3TX8A 2QV6A 3AB4B 3M9MB 1RAEB 2LCWA 3IRWP 2IAJB 3DKDA 5E0OA 2OPPA 1QVGR 3EUNA 2ABYA 2J9DE 2DKOB 2A6OA 2DD8S 4ZVSB 2HQDA 2ZHAA 2DYAA 4EO6A 4KC5A 3KKFA 4NLUA 1P9QC 2JEIA 4NA3A 4DV4J 3LP0A 1A6LA 5F9LA 1EJ7L 4DSLA 2DGSA 4ZN1A 2VKZG 5ETPA 4K0KF 1NRKA 1KOOA 1MN7A 1TL3A 4RBVA 4URQU 3LF0A 4PRFA 3HZEA 1JLBA 5L9XA 1NSQA 2Y1RI 4XDCA 4F7VA 4ES2A 1CJKB 1RAJA 1YKWA 1Y10A 3CD7A 4UZCA 3I0SB 2AYMA 2VFRA 4QR1A 1IBCB 4U8YA 4OYIA 5F41A 2EKNA 2VJVA 4DU7A 5BYQA 2KHDA 2W2OP 2ZBQA 4RWXA 1XC9A 1VHFA 5GAGI 2KL8A 2AIRB 3W3SA 4LR8A 4O3OA 3GFHA 3UD3P 4NZ0A 2ZVIA 4NCAA 1YHQS 4JV5J 3DLHA 1C0UA 2VV5A 3EVOA 3MMCA 5E3CA 2HLTA 4Q8FA 1JMTA 1FF2A 4ELUA 3U02A 2GMJA 4Q0BB 2V4JB 1Q8IA 1SJFA 2HBYB 5B0BA 2GA7A 3J81Y 2B9YA 2OJ3A 2G4BA 3RJMB 1UZDA 2BKOA 2FHKA 3R7BB 4OZ0A 5THWA 3VAFA 2AU0A 2B9XA 2VL1A 1EKSA 1RT1B 4DV2J 1HHSA 1WACA 2RQKA 1OY9A 4Q2LA 1FXDA 2W7AA 3K2YA 4M5NA 3GYXB 1FT8A 2KKHA 4I68A 2E1CA 1CS4B 1N5VA 2E9TA 4QIGA 4M5DA 4H4MA 3DRSB 1HNWF 1HQ2A 1UPPA 1K73T 1WOOA 4ZPCA 1HPZA 3HX9A 1LWFA 1HBNB 1WG4A 3BSNA 1DTTA 1WOPA 2B9EA 5KFJA 5L1LA 4IUFA 1T0TV 2YKMB 4MIAA 2BX6A 2C28A 4J37A 2LA6A 1X5OA 3DM2A 5GMKa 2ZZTA 4EGLA 4OZ5A 2MQQA 3LP1A 3ZZYA 1C1CA 1KEKA 2WAQD 3BB5A 3A4TA 1BXNA 4FS2A 2E5LJ 2H3EB 3KYLA 3CXCR 4PUOA 2CQCA 4PZVA 2VPWB 4OX9F 4BWMA 3ILJA 2ZOGA 3A3PB 2Y1IA 4UY85 2GJIA 3BKTA 2ZBRA 1R0CB 4MAKA 2WCXA 1SQFA 3ADAC 2HLUA 1VOMA 2IVFB 4PWUA 5D4NA 1RYRA 3B4DA 5K8NA 3CCJS 1X4AA 4AYBD 4FYWB 2UXDJ 3DOLB 3BQ1A 4I0WA 4WF9Q 3DLGA 4CO0A 2JEGA 1PJ6A 3TUIC 2ZC4A 4CO1A 2QLWA 3NCQA 2XSFA 5DETA 4JV0A 2UXCF 3CDWA 2L9NA 1VRUB 4DZ6A 2QRRA 3AOAA 2Q3PA 3BO4A 2CPDA 1XMQJ 2QGFB 1U1KA 4OHYA 1R0AB 1RAIB 4OLOA 2BA9A 2N7CA 3KLIB 4PG8A 5C25B 4R8UA 3TVZA 3K57A 2CNLB 6AT1B 2HRYA 5DO2A 4ZVRB 2CJYB 5F3TA 2BJEA 3LUYA 1S59A 4ED3A 1X4EA 4E8UA 1UZHA 2IC3B 3LGHA 2FJEB 4ALZA 5DG7A 2FJBB 2IYIA 2IA0A 3IS9A 1TV6A 4X62J 1X4FA 3BV8A 2Q6BA 3O3LA 1HBUA 3CJSA 1K47A 2QEXS 4ZJOA 3ELHA 2YWFA 4PQAA 4BDPA 2XYHB 5BR8J 3DLLQ 5KFUA 3TUZC 2GFFA 5EX0A 3P49B 3T5LA 4OX8A 1F9HA 2DHSA 4IFVA 2Y3YA 5C42B 4P10A 2J7KA 1SC6A 5HROB 2YQ0A 4DPTA 2ZEJA 3WDOA 2KZMA 3TNVA 2XQCA 2HW3A 2EKYA 3JSMA 2HGNA 3LH2S 4NCGA 2H5IB 3QGIA 4OYAA 2WW4A 1XMBA 4Y34A 5KFMA 1IBMF 4LF5F 1FTRA 3OVSA 2CQDA 3D0HE 2VASA 3HVTB 4EZ9A 3QO9B 3P6YC 2DCUB 2AJ4A 4Y3CA 3RAQA 2BEFA 2DNHA 3DNCA 7FDRA 3QZ7A 2LEBA 2Q79A 5HVFA 4CO4A 3OVBA 1NKCA 2WVFA 2UUAF 2YH1A 1AZSB 4ECXA 2P6SA 3B78A 4DJBA 2KVIA 5C7PA 4I2PB 1KNZA 2NSCA 2VG6B 4NYPA 4JI8F 1PCAA 4OX6A 4IFYB 4TU7A 4JI6J 1C2PA 1L3VA 3PW5A 3V4MA 2HVEA 4USHA 2HAIA 1WSRA 4H54A 4C3LA 1RTHB 5L1IA 3DLKB 3DGPA 4DG1B 2E5GA 3D1OA 3KK2A 4YHHJ 3FEZA 2QMXA 1UEVA 4DL3A 3QLHB 1JWWA 1W2IA 4MK8A 2W2NP 2DO4A 4ZP7A 2OLWA 4P75A 3UQSA 3TZYA 1T05A 1YGYA 1KS2A 3R27A 3E01B 2M8DB 3PYGA 2RF2A 2EFOA 3TOQA 2W1BA 1LK5A 2LVWA 4TNOA 1S6QA 5DLGA 1WEYA 3F41A 1RWNB 2V4QA 1H7WA 3ZNUA 1HHTP 2WBRA 2VG5B 5HP1A 1GFWB 1WKJA 2RSQA 5LM7E 3W8GA 3PEHA 2MJUA 2CJQA 3JXOA 2OPSB 1FWLA 1U1QA 3NY0A 4MTPA 2OPRB 2AKWB 1S12A 3DCAA 5HI7A 1GMVA 3FRYA 1T3NA 1NPPA 3ENVA 2GCFA 3AHPA 4FP9A 1WELA 4WPAA 2R8GA 1N6QA 4YP3A 1K0TA 2M88A 3CT9A 2HGLA 5HAOA 4ZPWR 1HI8A 1QSSA 4QYZJ 2D69A 1M5HA 4USMA 3K89A 1UJ5A 1SL0A 3RU0A 4PWDB 2WSCC 2GQQA 1UW4A 2V67A 4J9NA 5EUHA 2XMTA 1FE4A 4AE5A 2A10A 1U45A 2WONA 4RW4B 4DS5A 2A2CA 1U6BA 1BUXA 2X1BA 4EYIB 2B5JB 2HK2A 3T1AA 2BYCA 3C15B 1K9MT 1O0PA 2HZAA 2J9CA 4MK9A 4P74A 1EB0A 3D3BJ 1JJ2R 1SH0A 5E5NA 1T9UA 2HGMA 4X4VA 4Z37A 3OL6A 5GADU 2VA3A 2IRUA 3NBPA 4K2XA 1FRHA 4I6YA 1KLNA 3KK3B 3AOBA 4OYXA 3M2VA 5GVQA 1AROP 2IA6A 2QA1A 2WBMA 1UCNA 4MFBA 3T9NA 3OL9A 4DR6J 3MM9A 1YBAA 3I82A 1T02A 2MKIA 3MEEB 3D2WA 2VJUA 3HSZA 1Q5VA 3V5RA 1PG5B 5DQHA 1G1XA 4DLGA 5G0RA 4DX5A 4GVBB 4GC7A 1VBKA 4C0OC 3MR3A 1AYEA 4FYVB 3LO3A 3F44A 5DGAA 1WC6A 4HT7A 4WE1A 1SC1B 2B6AB 5BYSA 3E2EA 2V4RA 2DNQA 3OXGA 2ROEA 3HHNB 2B7BB 2E9RX 2H1YA 3TJ8A 1D0EA 4QBUA 2N4CA 3H5YA 2KXFA 4C4WA 2IJNA 3M8RA 2QIFA 3W63A 3FSYA 4LSLA 3ENWA 1T03B 1FA0A 3JS9A 1MROA 2UVVA 3T6BA 3OVAA 3GIMA 4G6VB 2F8MA 4NLRA 2V8VA 2DRBA 5D3GA 3CNQP 1HNXJ 1OIAA 4H4OB 4ECRA 3DRXA 4TYBA 5J1EA 2VONA 5IT0A 2KT3A 2MQMA 2XTJP 3T1HJ 1NHUA 4KO0A 1NH7A 4CI0B 3MEDB 3QT6A 5KG6A 3G6YA 3VZIA 3S1TA 5DS7A 1HW9A 2KG1A 1UETA 1HMVB 2KRRA 1M90T 2G0JA 4HTIA 3U1LA 3EGWB 3EXCX 1JLQB 4L6V3 3W61A 5I3PA 3MHYA 3CCLS 1WNEA 1C4AA 5CAAA 2OPQB 3HHDA 1SPBP 1Y4ZB 4ED7A 2V2VA 3RBXA 5JVGQ 1FWPA 1O6XA 1Q8BA 2KXNB 5DJBA 2MKSA 1VI7A 2GX8A 2ZNZA 2CJXB 4V1Ak 1NNDA 2CPHA 4GKKJ 2B9WA 3JSBA 3QJPA 1TELA 3LALA 4RW6B 4IOBA 1TL4A 1Q8LA 4OYZA 3RUBL 3GE9A 2KM8C 4TU9A 5AT1B 1Q86T 3GQCA 2E7VA 2GS8A 4QIVA 1XQIA 4LQ3A 5E3PA 1R31A 3G6XA 3I55S 1FTCA 1B0TA 4W92B 2R9LA 2XMJA 3NLCA 2AJ1A 3VGUA 1X8DA 3DI6B 2C2DA 3UO0A 3MR5A 2G1DA 2OEJA 3ZZOA 5EX3A 3I56S 3C3LA 3H2LA 3M4XA 2QYGA 4DV1J 3LAKA 4FF3A 4PXEA 4MIBA 2XEXA 5E41A 2HQGA 3K5MA 5AE3A 1YRXA 3ZZTA 4J91A 4EBCA 1CJKA 5A8WA 4ECSA 2G1HA 2CYYA 4RBUA 1XEZA 4JI5J 1ZZNA 3I0SA 2HPUA 2YBVA 4TY9A 4ZMMA 2FHJD 4PXCA 1EQMA 4I6AA 7AT1B 3W65A 4ZLLA 2NPIA 3NRBA 3N6NA 1NM2A 2QN6B 5DZ7A 5CQGA 3CD0A 4KPCA 2IPOB 2BJ1A 1EP4B 4RBTA 3D4JA 1MWQA 2DGUA 3P8BB 4OQJA 4B9LA 1LXNA 4NI2B 1FD2A 4YQWA 1S77D 3NAHA 3WHIA 2ZM6J 4DR4J 1KLMB 3A3NB 2HHWA 2UXBF 4DV3F 2EWHA 2VF3A 2JWNA 1OSCA 1FJGJ 4Q0BA 1R6VA 1NB7A 3QT5A 1OY8A 1CJUB 3MEGA 2JVRA 1IWGA 4GC6A 3T9ZA 3TZWA 5LMNF 2ADBA 5T7LB 1U09A 4U96A 5B7WA 2VOOA 3LQVA 1RT1A 2FZCB 1RCOB 3O1LA 1UAWA 3CCMS 4ER8A 3J7AN 2HHTA 1NJZA 4B3SF 1RWOB 3S01A 3SQGA 4Q45A 2XGPA 5H9EK 2AT1B 1ZPVA 1SH3A 4DUZF 1CS4A 1NJXA 3H5XA 4CWBA 2MSSA 2ASJA 2G0IA 4DV5J 4RKUC 4JYAF 1RBAA 2FZGB 3DU6A 1S10A 5A6PA 3HKWA 3RTVA 3DRSA 3O44A 1DJ0A 1X60A 3GV8B 5IXUA 2I2YA 4NXMJ 1GTEA 3UDCA 1ACMB 3D6FB 3GFXA 2ZHBA 3A8KA 2J5AA 2BV3A 2WOMB 1VK8A 3SCLE 3NEKA 1C4CA 1JJHA 2C2RA 4P52A 5KFTA 1WC5A 1X5SA 2YKMA 2QJ3A 3Q83A 1RT6B 5DGBA 5JVHQ 3K17A 3W1YC 2ZJQQ 1SJ4P 1OPIA 1PJ5A 1F3FA 1VDHA 1S1WB 1M1HA 2G13A 5I4MA 1NSPA 1K0VA 1KOHA 3QFHA 3ULHA 1CQNA 2MZTA 2DJWA 3GG0A 4RWWA 5T14A 2LEPA 2R7XA 4U95A 2AEFA 3CC4S 1R6YA 4I1TA 4MKYA 1NK5A 3A12A 2ZBPA 4CRJA 3DOLA 1GH8A 2KXHA 1JIHA 2MYFA 3C6UB 1BWVA 4P2FA 2JZ5A 2NXJA 2IRYA 3AAWB 4FDFA 1RWWB 1JJ4A 5EHHA 3GJTB 1RWUA 4O3QA 1IJEB 3T1YJ 3UNYA 3BGFA 4NZ6A 1IKYA 3L95X 2DR8A 4JI0F 1R0AA 2PMWA 5M2RA 3DGVA 3BREA 1U4BA 2PC6A 3P45B 3KLIA 4A48A 2RKIB 3V6DA 2C2ZB 3GR1A 5C25A 4ID8A 2VA2A 2W4CA 4M5HA 1FKOB 3M7VA 3PXGa 4ZP8A 1RQ0A 5E3RA 5ETVA 5AXMA 2HS4A 3BYRA 2HS3A 4IDKB 1MWZA 4P71A 2BJDA 2HSEB 4OJHA 2YWGA 1TK0A 4MMOA 1F0XA 2EEYA 1I94J 2AGOA 2IC3A 2HMIA 3C6TA 5ETNA 2NXEA 2ZH4A 1SQEA 2C3PA 3LW5C 3LWLA 4ITSA 3BYPA 1SXLA 5C24B 4HKQA 2WVCA 1UPMB 1MG7A 5KTQA 5IV3A 3L3CA 3WQPA 3M30B 4K4ZA 4I67A 2MQ8A 4OI1A 3RBEA 5KFRA 3OR2B 1VIXA 2XCAA 4HVZA 4CCHA 5C42A 1N34J 3N5FA 5HROA 2CQHA 4B9NA 1RA6A 1S6OA 2W2MP 4E98A 4QIWD 1WC1A 4UY8T 3L09A 2E44A 2DPIA 2F3JA 4IG0B 4UTGA 5E2QA 4ED1A 1TTHB 4DR5J 3JTOA 2X3GA 1CJTB 4FNHA 2Z30B 3HVTA 5EDWA 1BQXA 3QO9A 4EU0A 3GB0A 5FDLB 1JLFB 2LQ5A 3KLHB 4BHQA 1LQ9A 3K5OA 3WX8A 1S99A 3PJ9A 4DR7J 1S57A 3P96A 2NUHA 1NCLA 5IC4B 2JVOA 4TQSA 3GJSB 1JXLA 2DIVA 3CWJA 5LXRA 4RL1A 1RWMB 2OI2A 3POTA 2FJDB 3RBDA 2JJ4D 5J2QB 4U67Q 4I2PA 4EBEA 4ZCKA 2PGCA 1JNRB 4HTJA 1P8GA 1VGYA 5T41A 2V9WA 3UVJB 4QWCA 4IFYA 2MKCA 3J80Y 4IRDA 2BRLA 3MCSA 4DG1A 2P2CB 3AXKA 1IM4A 3H42A 4F4XA 4WK3A 1AB8A 3CEDA 3QLHA 2GMHA 1NU4A 3H2VE 1NH8A 5CYMB 2KHCA 3E01A 4R5PA 1K1QA 4CYUB 4B3RJ 1NKEA 1WORA 2VODA 2VDHA 2YKPA 1EETA 2VG5A 4LF7J 2DNGA 1Y3KA 4DQQA 5K5MA 3KUHA 3BGLA 1VBZA 5D4OA 2KT2A 2GV1A 2OPSA 5KFCA 5U47A 2OPRA 3PNIA 1RB0A 2G2ZA 3I0RB 2C2EA 3I5AA 4N41A 4NLSA 2EFPA 1J2VA 1DHMA 2FD2A 3PG9A 2IM3A 3M6VA 2XWXA 1N48A 1HQEA 2E66A 2AJQA 1PC5A 1VCTA 2CA9A 1UJ6A 3MI7X 2CNKB 4LF6J 4ECTA 2J7UA 3DYAB 2C2OB 2OFGX 2FY8A 3W2VB 2CQ2A 4DCJB 2KFYA 4PWDA 2XLIA 1D8ZA 2AHOB 5L1JA 4ANCA 4F67A 3PHTA 4ZP6A 5EN1A 3DRPA 2AQ4A 1HWIA 1RP5A 2VPZB 1OYEA 2QMWA 2B5JA 2CQ4A 3JAMU 2W9BB 4OZ2A 3Q8QB 1FDDA 3C15A 2MPUA 5A6WA 2MZRA 3MTJA 4DOZA 4DL4A 4NLPA 2UUTA 3OL8A 4EO8A 1U6ZA 2QA2A 4FNIA 1HARA 1FRKA 3EE3A 3KK3A 2QL9B 3PO5A 2MLZA 2VC1A 1X5PA 2X3DA 5KG1A 1S79A 1Q16B 1T9TA 3Q86A 1GX5A 1KFDA 3IG1B 4DSJA 3MEEA 5FLXU 4HDGA 4IRKA 1REGX 1LWCA 2A3JA 3GIIA 5RUBA 3GCXP 1UVNA 1V3RA 1TKXA 5HMXA 4W90B 2VU5A 4GVBA 2B3TB 4J9RA 4WJBA 2IHR1 3N5BA 4G1QA 2JHEA 1WTFA 3G4SS 5LMUJ 1RHMB 3VZHA 4M5GA 3MM8A 2AZ1A 1Q1KA 5KAKA 2MKJA 4MT1A 5KFIA 2BRKA 4LBHA 1RT5B 2HBRB 2L9WA 2FJAB 3ZTSA 3Q8SB 3GTYX 1M1KT 4KE5A 3KLGB 2XG8A 5D0GA 1RYSA 4DLEA 4ZVPB 2QFIA 4DN9A 2UUCJ 4D3GA 4K50A 5KT5A 3EGVA 1MWYA 4DR3F 2W8LA 1FE0A 2OEKA 5GMEA 2DRDA 4CH7A 4LFAJ 1T03A 4BLGA 2K8GA 4ES3A 2N3OA 3IGVA 3FCHA 1V6HA 1VQNS 4QCLA 5KFZA 3PO4A 4G1IA 4LSZB 5K8OA 4H4OA 2MJNA 3KXDA 3ZFVA 2R7UA 1CEZA 2HHHJ 4J9OA 4N76A 1WEZA 4DV7F 4U7CA 2KO1A 3RB6A 5B0GA 4KGKA
chains in the Genus database with same CATH topology
1TKTA 3PIOQ 4M63A 3G6ES 4I4BA 4Q7AA 3SFGA 4KIAA 3MFHA 1N5VA 2NSBA 1GXUA 3FMWA 3SCIE 1WTBA 1UFLA 1M5SA 2E9TA 1X4BA 4QIGA 3IXQA 3IR7B 4YB7A 4Q44A 1RT3A 3HP6A 1P6TA 1U6FA 4NX9A 4PG7A 4M5DA 4H4MA 5KFNA 3CDAA 3PHEA 3KLVA 3DRSB 1QY7A 1HMVA 4HDHA 2HHVA 2XMUA 1HNWF 1MSWD 2K7JA 2YNGA 1VRUA 2WHOA 1SKWA 1UVLA 1D3WA 1U2FA 1K73T 3K5LA 4RNFA 3LAMA 1JLQA 3OR1B 3J7A1 1RKJA 3NNAA 4HI2A 4ZPCA 4A8YA 1HPZA 4TXSA 1IKVB 3HX9A 5F8JA 4ZLPA 1V9OA 1LWFA 1HBNB 4DFMA 4B3MF 1LWCB 2OPQA 4ZCLA 2J0QD 1WG4A 2NPFA 2HNDB 4Y2AA 3BSNA 1DTTA 2QYCA 5KFJA 2VQEF 1CSJA 5KFKA 5L1LA 4V19J 1ZYQA 2EFNA 3N4WA 1NZAA 5LSOA 4IUFA 2PT0A 4F26A 3HHLC 3SV3A 1TKXB 2DO0A 4AUKA 2YKMB 4MIAA 4DR2F 3PJXA 2MMYA 2MZQA 3O5TB 4CZCA 1R43A 1TVRA 2C28A 1ZZFA 1JB0C 2ALZA 2MQLA 4J37A 1RI7A 2LA6A 4C2MA 1X5OA 2RU3A 3DM2A 4HI1A 5GMKa 1MNEA 1LWEB 4G1QB 2K2PA 1X0FA 1HYSB 4EGLA 4OZ5A 1DQAA 2MQQA 3LP1A 3ZZYA 1RA7A 2K3KA 2X1FA 1C1CA 1KEKA 1FNOA 2WAQD 3BB5A 1RT2B 5CYJA 4FS2A 3EGNA 2ZDPA 3G6VA 3FDSA 2XGQA 4I6WA 4LIRA 2UV8G 3MM8B 3O8WA 3KYLA 2AV5A 3NS6A 4N8OA 3CXCR 2YWKA 4LVOP 5B09A 1NK4A 1HWLA 2CQCA 4IR1A 4PUOA 2C3YA 1L3VA 1QSYA 1S7HA 1E6VA 4KHPF 3M2RB 2VPWB 4OX9F 1F5BA 4BWMA 5A0YA 5KT6A 2ZOGA 4O4GA 4X65F 2GHWA 3GMGA 2WB4A 2CVEA 3QGHA 3ZZZA 2Y1IA 3X1LB 3DRYA 1K1SA 4QIEA 2B43A 2YVSA 4UY85 2GJIA 4DSIA 4ELTA 1XMOF 5C5JA 2WW8A 1S9EB 3CO9A 3M9OB 1YJWS 2JH3A 4URGA 4MAKA 4AQYF 4IG3A 4ZPAA 2WCXA 3VAMA 3FMBA 4OI6A 4TY8B 1REVB 3D1QA 2F9DA 2IVYA 2HLUA 2Y0SD 4KKOB 5HQ8A 1VOMA 2CQBA 2FHOB 2IVFB 3MURP 3OFGA 4WXOA 3BDEA 3J7YU 1GTHA 4PWUA 1S1XA 5D4NA 1Q78A 3KMQA 1RYRA 3FNNA 2Z8QA 3B4DA 3K7RA 2DGTA 1RT4A 2RIJA 2I5JA 1B0PA 5K8NA 2HHSA 1W25A 4M94A 3CCJS 1C1BB 5DM6Q 1LXJA 3IFEA 1FK9A 1X4AA 1KVIA 2K1RA 4AYBD 1UWBA 2ADCA 1X9MA 3OPKA 4LF8F 4A8XA 2WK4A 1UFWA 3DOLB 1O5JA 2OMOA 4YMEA 3JYTA 2FVSA 1FXRA 1IR0A 3BQ1A 4I0WA 1SUQB 2HNYA 3TUJC 4WF9Q 2V9KA 3JSYA 3DLGA 1NKBA 4CO0A 3MFIA 2JEGA 2FVQA 2KU7A 1QUVA 2H9ZA 2RDIA 1TL5A 1U1MA 3QJJA 2DHAA 4PG6A 5B08A 4ECVA 2O66A 2AYGA 3TUIC 2AWZA 1U1OA 2ZC4A 4IH6A 2PMZD 4CO1A 2QLWA 2UVWA 3NCQA 4NA1A 4RW9A 4XIUA 1HNZF 1VRTA 3CCRS 4DV6F 4Q43A 1FCAA 1DRZA 2E1CA 2GGPA 4F50A 4I2QA 2YNIA 3V6HA 2O5DA 2XSFA 3KNGA 1Q81T 1OWXA 4H4MB 4M5DB 1HI0P 5DETA 5J2PB 3LP2B 4WU3A 2LYVA 4JV0A 2UXCF 4JI7F 4YY3F 5DLFA 1XERA 1YTYA 3CDWA 2L9NA 1LV5A 1IQTA 2YNGB 1YIJS 1VRUB 4PPZA 1ZH5A 2MHEA 2QRRA 2IM1A 5B0CA 3N0VA 2Q3PA 2JOQA 3BO4A 3HK2A 2CPDA 2ZNYA 5IS2A 1U1KA 3GIKA 5GADI 4O4RA 3OHBA 2ZH1A 4MKBA 1HPZB 4OHYA 2ASYA 1R0AB 3DOKA 4DR6F 1S1VA 2BACA 4OLOA 2BA9A 2N7CA 2JLEA 3KLIB 2EBGA 2ZOMA 1BGXT 4PG8A 5C25B 2DRAA 1DTTB 3U1NA 4R8UA 1S9GA 1Y5IB 1KSPA 4LSNB 5JXSA 1FNXH 3TVZA 2RRNA 5K14A 3VTIA 1EP4A 2MHNA 1H38A 3K57A 4QW9A 2FUG9 2R2UA 5KG0A 2EK1A 4I56A 3EPGA 2VFUA 1QSLA 3FGVA 4I64A 3MOJB 2HRYA 5DO2A 4A8OA 2L08A 5F3TA 2BJEA 1NO8A 2VG6A 4DR1F 1YJRA 2J9DA 2PEHA 5DDQC 3LUYA 4P2SA 1KLMA 3RW7A 1U1NA 2ZHOA 4ED3A 2PFFB 1HNIB 2DR5A 4HH1A 5KFXA 2DPJA 2AYBA 2W4DA 2OTLS 2JX2A 4WK1A 4QZVB 1HQUA 1X4EA 2C42A 4E8UA 1ZM4A 2ACYA 2R8KA 4USIA 1TFYA 1RTHA 4K4XA 1YVFA 3DLKA 2IC3B 3NWGA 3TR5A 2GIQA 2DVIA 1RTIB 5F3ZA 3SEOA 2FJEB 4ALZA 2I9SA 4PUOB 4DL6A 5DG7A 1DLOB 2M3DA 2FJBB 2IYIA 3D1HA 5CZVA 3CCTA 2IA0A 1RJJA 3THTA 1LK7A 3IS9A 2ZH9A 1TV6A 4KRWA 1X4FA 1SKSA 2Q6BA 2FVCA 3O3LA 2NXUA 4OMFG 3FQKA 1HBUA 3THVA 2MZJA 2FLLA 5HLFB 1L3TA 1BWEA 3NS5A 2QEXS 1KHWA 4B3OA 4QWBA 3PW0A 4MYTA 1S1TB 3FQLA 3JAMY 3PKYA 3NNCA 2MDAA 3HHKA 3L7PA 3IR5B 4C3MA 1YRUA 2YWFA 4IQMA 5LL6d 4PQAA 4RNHA 4FN5A 4BDPA 1VS3A 2OSQA 4WZQA 5J1NA 3MMAB 1U1LA 3DLLQ 1FDAA 1HR0F 2A1BA 1Y7PA 2LQJA 5KFUA 2ZJPQ 3TUZC 4ZHRA 2GFFA 5EX0A 3VWSA 3P49B 3T5LA 4KFBA 4OX8A 3C8YA 3MF5A 2DHSA 2GQCA 4IFVA 4CNZA 2FY1A 5C42B 1HBOB 2U2FA 2C22A 2J76E 4KV8A 2XLKA 4RU2A 1JKHB 1SC6A 2J7KA 5HROB 1RT4B 1VJWA 1UA0A 1L5UA 2BVZA 2I5JB 3T5KA 1AXQA 3K59A 3WDOA 2KZMA 3TNVA 4XPEA 5GAGU 1FK9B 2ROPA 1HNXF 1KRPA 3RRKA 2HW3A 2EKYA 4JOUA 5H9EJ 3JSMA 2HGNA 2B0GA 2MQNA 3LH2S 4K4UA 3BGUA 4NCGA 2XBPA 3JYTB 2O3DA 3H40A 3SDEB 3QGIA 1JXEA 1YI2S 5AJ3F 3KLEA 3PDNA 1XMBA 2GNKA 3MD1A 4Y34A 1PO6A 4LF4F 2HWTA 3FVYA 3M32B 5KFMA 5J1PA 1IBMF 2QSFA 3M6UA 3TYTA 4LF5F 3JTNA 1FTRA 3H4DA 3OVSA 2CQDA 3ISND 2LECA 3R5AA 1LKZA 2ZH6A 1TL1B 3D0HE 5M2UA 2VASA 3FEYB 3Q0AA 3HVTB 2GGPB 2D1CA 4EZ9A 4PQUA 3QO9B 4I2QB 3P6YC 2DCUB 2VD3A 3H59A 2AJ4A 2QE5A 4DQIA 4Y3CA 4O3NA 3RAQA 2BABA 2DNHA 3DNCA 2E1MC 4HT5A 7FDRA 4KBIA 2VBWA 3MTKA 4RW7B 4CO3A 2D41A 3QZ7A 2LEBA 1FJEB 2CPEA 5FLXY 2J0WA 1UJ4A 3I87A 4YOEA 1SH2A 2Q79A 2BZ2A 1U8SA 5CYQB 3OFEA 4CO4A 1U48A 3DMJA 3OVBA 1IKWB 1NKCA 4KPYA 2B4OA 1S1VB 2MY8A 2UUAF 4P7TA 3MZIA 2YH1A 1RT6A 4AL5A 1S4FA 1UKUA 2BBEA 2M70A 1TK5A 2HHUA 4O3PA 2ZE2A 2JEJA 2EBEA 5J2NA 4ECXA 2P6SA 4R8UB 3IWNC 3B78A 4A8KA 4DJBA 1KTQA 3FZ2A 3AB2B 4Y2IA 4Q5VA 2APOA 2KVIA 2KH9A 2FHMA 3