3BEGB

Crystal structure of sr protein kinase 1 complexed to its substrate asf/sf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
86
Chain Sequence
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGSYGRSRSRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A sliding docking interaction is essential for sequential and processive phosphorylation of an SR protein by SRPK1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/splicing
molecule keywords Serine/threonine-protein kinase SRPK1
total genus 14
structure length 86
sequence length 90
ec nomenclature
pdb deposition date 2007-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3begB01
5DDRC 2ERRA 2AD9A 2X1AA 2RU3A 5HO4A 2DK2A 2YKAA 3THTA 2DNPA 1DHMA 1X5SA 4PR6A 3EGNA 3CUNA 1HD1A 1SJFA 2DGVA 3NMRA 2E44A 2DISA 2MQQA 5DM7Q 1VC5A 4LMZA 4CQ1A 3VF0B 3IWNC 1U1QA 4Z2XA 4FXVA 4FXWA 2HGNA 1NU4A 2KU7A 4ED5A 4QU7A 1H6KX 3J7ZT 3EX7B 1S72S 1PGZA 3CC7S 2N3OA 2MGZB 2DGUA 1KOHA 3D2WA 2QFJA 5JVGQ 2CQ0A 2M8HA 3NNAA 2CPZA 1QVGR 2RRBA 1FHTA 2KM8C 2E5IA 2YWKA 3CMAS 3UCZP 1DRZA 5CXTA 2CQ1A 2DH8A 2KXNB 4QQBA 4C7QA 4QPTA 1B7FA 1S79A 4YOEA 2KG0A 3LQVA 2N82B 1VQ7S 5GADU 4OZ1A 2LKZA 3CTRA 3S6EA 2KVIA 3CC2S 4WFAQ 1VQ4S 4IOAQ 2E5JA 1U1OA 4TLQA 3NS5A 4YB1P 2CQIA 3BS9A 2LMIA 2MQPA 3MUTP 4WCEQ 3JB9k 2HGLA 4UY8T 3L3CA 2KRBA 2EVZA 2M52A 1U2FA 2RT3A 1D9AA 4QU6A 1X4EA 4WKRA 2O3DA 3MD1A 1X5OA 2F9DA 2GHPA 3G6ES 3S7RA 5DDPC 3VAMA 2DO4A 3PIPQ 2X1BA 3UD4P 4C4WA 2QA4S 3S01A 3CC4S 1YIJS 3CULA 2D3OR 1ZH5A 3P6YC 2MKCA 3J7YU 4LIRA 5DM6Q 1WHXA 1X0FA 2OSRA 1U1PA 2MQLA 2XS5A 2MZJA 2DNMA 2LXUA 2MKHA 3UCUP 2CQ2A 1NO8A 4CH1A 2CPYA 2L08A 2KHCA 5GVQA 3G71S 1Q7YT 4IOCQ 2JX2A 2ZJRQ 3I55S 1YHQS 3VAGA 3NNHA 1VQ8S 2X1GA 3R27A 2CQ4A 2LA6A 2KFYA 2I38A 2CQBA 4M5DB 4WIIA 1QM9A 1HD0A 1WTBA 2DB1A 4PRFA 2MKJA 1Q81T 1YI2S 3G9CA 2CPJA 3SDEB 2DGQA 3S8SA 1VC0A 2MQOA 1VC6A 3MD3A 2MKSA 2DH7A 2DNNA 1K8AT 1URNA 2G1DA 2V94A 3G8TA 4C0OC 4WFNQ 1WELA 2MQNA 4Y0FA 1M5OC 1UFWA 2XB2D 2DNHA 2M2BA 4F25A 1R8HA 2LYVA 2ADCA 2FHOB 2CQHA 2AYBA 3R1HA 2K3KA 2RS8A 1N52B 3VAFA 1N8RT 4CIOA 4EGLA 2OSQA 2RQCA 1VQ6S 2VOPA 3RW7A 1HA1A 5HL7Q 3B4DA 3G4SS 2DHSA 5DDOC 4PKDB 2MJUA 3Q2SC 2MKKA 1X4BA 1M1KT 1A9NB 2M70A 2MZTA 1WF0A 3P5TL 2CPFA 3RW6A 1OIAA 2J0SD 2KI2A 3MI7X 1U6BA 4LJMA 5LSOA 2J76E 2M7SA 1NJIT 4WFBQ 2LECA 5MLCV 2RRAA 2PEHA 3NS6A 1X4FA 5IFMA 2M88A 1X4GA 2DIUA 1YTYA 4ZKAA 1U1NA 3MDFA 2YH1A 2NLWA 2KG1A 1WWHA 2FC8A 2RUGA 5IM0A 4W92B 2AYGA 2XNQA 2J0QD 2MYFA 3UD3P 3OW2R 1FJ7A 1WI6A 2ADBA 2F3JA 1U1MA 3DLLQ 2CQCA 1K9MT 2YH0A 2OJ3A 1YWXA 1VQMS 3MOJB 2BOPA 2CQ3A 1R8PA 1K73T 2DGWA 1Q82T 2FPHX 5GMKa 1ZZNA 2QEXS 3U1LA 2B0GA 1SJQA 2MHNA 3CCVS 2MSTA 3CXCR 3IRWP 1H2VZ 2DITA 1SXLA 1O0PA 2CQGA 2MY8A 3R1LA 3LPYA 2LQ5A 2MPUA 3THPA 1W2BR 1UW4A 2DGTA 3BEGB 3CCJS 4TU8A 3VAJA 2HVZA 5IQQA 2MZQA 5LXYA 2KYXA 1N88A 2K8GA 2XSFA 3H2VE 2WBRA 2FY1A 4J5OA 3UCGA 2DIVA 2DHXA 4P6QA 3EGZA 1WG4A 1KD1T 3MURP 4IUFA 1UP1A 3US5A 2HYIB 2DGXA 3CCQS 1H2TZ 1VBZA 3VALA 3BO2A 1WEXA 1WI8A 2JVRA 1X4HA 1ZZFA 2GO9A 5GAEU 1JJ4A 3CCES 3UE2A 1YJNS 2N3LA 4RU2A 1IQTA 1X5TA 2L9WA 1JMTA 2JRSA 3P3DA 2KXHA 1YJ9S 1FJEB 2I2YA 2CPHA 2NZ4A 1AUDA 2M0GB 2KRRA 2MKIA 2MXYA 1SJ4P 4V19X 5DETA 3MUMP 2D9OA 4ERDA 2DNZA 2MZRA 3PIOQ 2DNRA 1BY9A 2VOOA 2F9JA 2M9KA 2RS2A 1F9FA 2BZ2A 1A7GE 3SDEA 4W90B 3DXBA 2U2FA 2DHGA 2J8AA 3SXLA 1WG5A 2DGOA 3CCUS 4TU9A 5D78A 3VAKA 3MXHP 2DNKA 3H2UB 3CD6S 4F26A 1WEZA 2XS2A 2L41A 3K0JA 2MB0B 1FO1A 2XNRA 1OPIA 1X5PA 5H1SV 2DNGA 3G96A 1VQOS 2LXIA 1U1RA 2N7CA 2MQMA 2MY7A 2KH9A 2Q79A 4F02A 3MUVP 3CMES 1L3KA 1VBXA 1U1LA 5IM0B 1WEYA 5FJ4A 2CQPA 1VQKS 3N9UC 5GAGU 5LXRA 1M90T 3ZZYA 1SJRA 3ZZZA 2OIHA 4OZ0A 2OTJS 2E5GA 1OWXA 1SJ3P 2MZSA 3FEYB 5JVHQ 1DZ5A 1VQ9S 2X1FA 2G4BA 1VQLS 2KN4A 1X4CA 2UP1A 3BO3A 2KT5A 2RVJA 2ZJQQ 2MMYA 2DNQA 5BJRA 3VAIA 2RQ4A 5LJ5Y 1RKJA 1VBYA 1FT8A 1YJWS 4BS2A 1HL6A 1DBDA 2CPDA 2LA4A 2LCWA 2EK1A 3P49B 2FC9A 1WF1A 1WHYA 1YITS 2DH9A 1X4DA 2KXFA 2EK6A 1VQ5S 1P27B 2G0CA 3FEXB 2E5HA 2OTLS 3BO4A 2VODA 4WF9Q 2JVOA 1KOOA 2DNOA 1M5PC 2VONA 3G8SA 1X4AA 5LJ3Y 2DGSA 3UWTA 4YUDA 3B4MA 1OO0B 3U1MA 1CVJA 3CF5Q 3TP2A 1FXLA 1PO6A 5EN1A 2MJNA 2SXLA 3TYTA 1WG1A 5DDQC 1WHWA 2D9PA 2M4MA 4UQTA 5GAHU 1UAWA 3SMZA 4Y00A 2LEAA 2LEBA 1FJCA 2CJKA 2PE8A 3V4MA 3CCRS 1U1KA 1H2UX 2MGZA 2CPIA 4A8XA 3CPWR 5CYJA 4TU7A 1KC8T 1D8ZA 1JJHA 1WHVA 2U1AA 2CPEA 2M8DB 5ITHA 1G2EA 1VQNS 3CCMS 3I56S 1KQSR 1M5VC 2HGMA 3ULHA 2DNYA 2MZ1A 4CH0S 1WF2A 1N54B 5D77A 1RK8A 1U6FA 4U67Q 2ZJPQ 2AYEA 1Q86T 3VAHA 2DO0A 2HZCA 1XN9A 2DNLA 1M5KC 1QVFR 3CCLS 1VQPS 2AYMA 1P1TA 2XS7A 2YTCA 2A3JA 2KM8B 3CCSS 2MSSA 3HHNB 5CA5A 2DHAA 3NNCA 2RNEA 3HI9A 2CPXA 2JWNA 1FNXH 4IO9Q 3Q2TC 3TO8A 1JJ2R 2CQDA 5LSLA
chains in the Genus database with same CATH superfamily
2F8EX 3BREA 2ERRA 2X1AA 4DL3A 3FSIA 2DK2A 3MMAB 3THTA 1RI7A 1IUJA 1S5ZA 5E41A 5I3UA 1UWBA 1WOPA 1X5SA 2WSCC 2DGVA 4WK1A 3AD9C 4O3OA 5DM7Q 3KG4A 2HS3A 3G86A 3SV4A 2FVCA 1EAYC 1FDNA 3NGTA 3Q22A 4LREA 3IWNC 1YJUA 3PY8A 5J1NA 1U1QA 3O44A 3UNGC 4DR5J 3DOMA 4F04B 5CYMA 4L72B 1XC9A 2HGNA 1RUSA 1N36F 1XJWB 4X4RA 4N56A 1FKPB 4QU7A 1H6KX 1IN0A 2E1AA 2QYCA 1JLCA 2N3OA 1J5OA 4LF5J 4DS4A 4P74A 4ZOSA 5F8LA 4ED8A 1TUGB 4NYZA 1S9GB 2QLJB 4G1IA 4FYDA 5JVGQ 1EIYB 1FRHA 2RJZA 1AYEA 3GG0A 2V4RA 4C6AA 4Y3CA 3HULA 4KC5A 1FXDA 2CPZA 3M2UA 2WOMA 2YWGA 1NH8A 1NHKL 1RAAB 2E5IA 5FIIA 2KM8C 2LU2A 2AEMA 3H4BA 3CMAS 4V1Ak 2DH8A 4MIWA 4JBCA 1GMWD 1S7HA 3NEKA 4DQPA 4YOEA 1W2IA 3PJWA 2PFFB 5GMDA 2YKNB 4PG4A 4YEAA 4ZVEA 3MR3A 4OV1A 2E7WA 5DG9A 1UVNA 5AE1A 4CLTA 4DR6F 2LKZA 3AH6A 4BWMA 2Z30B 3C6TB 5F41A 1U7LA 2XG8A 3GCWP 4RW7A 1N32F 3MMCA 1CJTB 3KDNA 5C24A 4IOAQ 1XNRJ 1JLFA 4WKYA 5F8NA 1FJGJ 1RXOB 4YB1P 2BVZA 4B9SA 1FA0A 5KG7A 3BS9A 5CYMB 3DLJA 4M5DA 4J37A 4NCBA 1NDCA 3E01B 4CYUA 4AD6A 2IRYA 3M6XA 3CMQA 2OEKA 2RT3A 2M52A 4QOTA 4RNOA 2BR0A 2ZZNA 1YVFA 4M63A 3TEHB 2HKEA 2GJIA 4HHUA 4RZRA 2RDDA 3V81A 4CI0B 5KT3A 4ID8A 3EE3A 4NLTA 1S4EA 4DJBA 3D4JA 5I3UB 3A8EA 4KSEB 4ZP6A 5C2GA 3MR5A 3HSZA 3RB0A 4JI5J 1S6UA 3OHBA 7AT1B 2HQFA 1PYSB 3CDWA 4DV0J 3T5LA 1RA7A 4LRDA 2AT1B 2B4UA 1XR5A 1U2CA 3TA1A 4DR1J 3OL8A 3KLFB 4U6PA 4KJIA 1IKVB 5F3TA 4PQAA 3I82A 1TKZB 3CJRA 4LR7A 1FKAF 1SI9A 1OS5A 4TQSA 4OZ5A 2KT2A 3CC4S 1HKAA 3NG8A 5KT2A 3BGUA 4OL8A 3D66A 1NK6A 2EWHA 1B99A 2MKCA 2HRTA 2HSEB 1TU0B 3MEKA 3OFGA 2VKRA 1YBUA 1R6YA 4K4XA 4FS2A 4AL6A 5J2NA 3TANA 3QZ8A 3FVYA 2KT3A 2VPXB 2ZH8A 1B4SA 1U1PA 3M6VA 3CSKA 3SSRA 4KHPF 2AJ2A 2O01C 1H73A 3CDEA 4M5GA 3RTVA 2MZJA 1N0UA 1XR7A 3IR7B 4FVCA 2HW3A 2CVIA 2DNMA 2MKHA 1LXNA 4WZQA 3UCUP 1S1UB 5KT4A 2CQ2A 3IA0A 5KFPA 3T1HJ 4NLGA 2QC3A 3EDRB 1ZM9A 1EZZB 1DQAA 2EPIA 2C3YA 3GIKA 1F5CA 2FJWA 3I6PA 1X0PA 2OP5A 2L48A 3MZIA 4YY3J 1KLMA 4LF2A 4M5HA 4CH7A 1IKXB 2QL9B 1TL1B 3M9MB 1NJZA 4X4SA 4CM2A 4UF4A 1N34J 3KMSA 2QIFA 3N0VA 3VAGA 3JSBA 4DR2J 2KFYA 2HRUA 2I38A 2K1RA 1MROA 1QM9A 2YX7A 3AJ1A 3HVWA 4ZMMA 3LWLA 4PRFA 5IT0A 1Q81T 2ZC3A 4LBHA 4DUZF 2CPJA 2IVMA 2VF3A 2XBPA 3SFUA 3S8SA 2R8KA 3DLGA 2PA8D 5T7LA 2NXJA 3G6YA 2X51A 3MEDB 4C0BA 2UVUA 1VC6A 3MD3A 2MKSA 5BR8J 5AT1B 1TVRA 4ES2A 5D0HA 4PQUA 1AB8A 5D4OA 2WCXA 1HHSA 2OPRA 5BYRA 4ECWA 1K8AT 1URNA 2G1DA 3G8TA 3KHLA 4WFNQ 1N0VC 4J9VA 1WC6A 3FBFA 2CZVC 1HWIA 1M5OC 3BGOP 1JLQB 4KGZB 4QR2A 3FMBA 3IGVA 5D3GA 2M2BA 4ELTA 2HS4A 4F25A 1N48A 3BJYA 2BANB 4CO3A 4FZVA 1N5YA 1KVKA 2AYBA 5L1JA 3J7AN 1FK9A 4ZN3A 3M32A 3PV8A 5E7OB 1DAXA 1OMSA 2RS8A 2RUSA 3QFWA 1LW2B 4DL0C 3QT7A 3NMAA 3V6DB 3EVOA 5HATA 4TNOA 3X3UA 2VOPA 2CNLB 2J7WA 1RT7A 3PVXA 5HL7Q 1RWWB 2HAFA 1TMMA 4DN0A 3BM7A 4XPEA 2QTWA 5LOQA 4ZCIA 2BMBA 4PZVA 2XCAA 4URSA 1BC6A 3D7SB 1HI8A 3MM7A 3R5GA 3HO1A 1U8SA 2QG9B 3WIVA 5BR8F 1DTQA 2QSFA 4N8NA 1UFLA 2CPFA 4M94A 1WC0A 2E5LJ 3RW6A 4PYAA 3CJ4A 4B08A 2HMIB 4ED7A 3FUYA 2J0SD 3KLFA 4B17A 3QGPA 2UUCF 3DRPA 3HPOA 3M05A 3UN2A 1SUQB 2VG5A 4NCGB 4ZVTB 5FLXY 4Q45A 3J7YI 5T41A 4WFBQ 1N33J 5KFHA 4DPUA 4DV7F 1U47A 2D74B 3KLEA 3PX6A 2QL7B 1Y9OA 4KFBA 5C7PA 2XLJA 3NS6A 4CO0A 2M88A 2DTJA 3HD2A 2I0XA 1X4GA 2XULA 5MAOA 2F8HA 1MG7A 1XWLA 3ZZOA 3DOKB 4WP9A 3M32B 4ZLPA 4DQIA 1BXNA 2RAQA 1LEOA 1ZA2B 2NLWA 2RIJA 4DFKA 1N34F 1CC7A 5HVHA 3CJ3A 3HF5A 2H48B 2RUGA 4QPXA 1WUUA 2R7TA 4I2QA 3GV7B 1Q8BA 3QGGA 2AYGA 3V6DA 3UD3P 4ZCMA 4LF6F 1S6QB 2KL8A 2Z8QA 2HNDB 1WI6A 1ZM4A 1SVDA 2F3JA 3FFIA 3N6MA 4OI6A 2DCUB 4KKOA 1U1MA 4F0KA 2BANA 3BDEA 2HHUA 1BWVA 3DLLQ 3IS9B 2WHOA 3C15A 4DUYJ 1RBAA 4ID5A 3OR2A 2YH0A 4MYUA 1YWXA 1MMDA 1JB0C 1UA1A 3NXZA 3OFHA 3HKZD 1WDTA 3U1NA 4QZVB 4KV8B 1TAQA 4RNNA 4MK7A 3T5KA 4Q0BA 1I51B 5GMKa 1TL3A 2L3MA 2YY3A 4P72A 3IC1A 4P7TA 5KAKA 2AKWB 2IVYA 1Z2LA 4GMKA 4F4XA 4PUOA 1SJQA 4DV0F 1X9WA 4DSIA 4DZDA 4ZCKA 3M7VA 4NPOA 1UVLA 1P9QC 3F73A 4YS2A 1LFPA 1S9EA 2P2CB 2J5AA 2EW9A 2V8HA 4OYPA 4CLKA 3FDSA 3R1LA 5IOLA 1T3NA 2LQ5A 3ZNJ1 1GXLA 1W2BR 4U7CA 3BQ0A 3CCJS 4IKAA 1IR0A 1ICEB 2FHJD 4J90A 1G1XA 3FCWA 4CT9A 2C3PA 3F0NA 1IBCB 5ETKA 4YQWA 3RB4A 4KB7A 1KHVA 3KHGA 1HNIB 4WXWA 1GT8A 2H5IB 3LA0A 3OXLA 3PYGA 3Q8RB 1CS4A 3QZ7A 4J5OA 5LMUF 1RB0A 2V5HG 4NRUA 2IJRA 3BKTA 3MM5B 4C9DA 3AOCA 3A3PB 3BSOA 3KK3B 2WVCA 4JV1A 1SQFA 3KUGA 4OX9F 4ELUA 1FRMA 4OJGA 1FRKA 3MMAA 3FNNA 5KFLA 2QV6A 3TW0A 3W63A 3MAAB 2HYIB 1RJJA 2EG1A 1B0VA 1UJ4A 5K8NA 3CCQS 1H2TZ 4NXNJ 2WSEC 3BV8A 5KFQA 2IBOA 1WEXA 5HROB 4OHYA 3HVTA 2Q6BA 3AA9A 2Y8YA 3M2VA 1TELA 4G1PA 1RABB 2OO4A 3BSAA 3QIPA 1WKJA 2HHPA 3I5BA 4IH6A 3MR2A 4ED5A 1U0HA 2E1PA 1RAJA 3DFEA 3LTOA 4MKVA 4USJC 5EGYA 1YJRA 5J1PA 3K5NA 2LEPA 3POTA 4HVZA 5KT5A 2RDIA 5E3PA 4WFXA 4X4NA 1WTFA 1PJ5A 3QO9A 1Z1ZA 3HK2A 4USVA 4M8LA 4K5RA 4AQYF 2NXNA 3DI6B 4DV2F 3P3DA 1U48A 3TAQA 2YNHB 5B0CA 1YJ9S 2V2KA 2CPHA 2JDJA 1HNZF 5F8IA 5F8MA 2Z2LA 1C0UA 2M0GB 4USMA 2KRRA 3PM9A 2MXYA 2XYPB 3V81B 4NI2B 3HZEA 1VS3A 5D6GA 4FYXB 2W9CA 3C15B 5F3ZA 2J9DA 3AD8C 1CS4B 2D9OA 3KKFA 4ZHRA 4DR5F 1RWKB 2W2PP 5B7WA 3AA8A 3OTBA 3J80U 3CDUA 3CJSA 2VOOA 3W8GA 3B82A 2WVEA 2M9KA 1AFIA 3OVSA 1JLFB 5KFWA 3QRRA 4USTA 1T11A 2OD6A 2HBZB 3EVMA 1A7GE 4W90B 2E1CA 2ZD1A 4IO1A 1S9EB 1XIQA 2U2FA 1B0PA 3GJTB 4WPAA 3J80Y 1YJ7A 2XO6A 4RJVA 1CJVA 5L9XA 4PG5A 5D78A 2VICA 4Y2IA 3RBEA 2YKNA 1FFGB 3H2UB 3MXHP 2UXDF 1S6PB 2J0WA 1TV6B 4NLPA 1WEZA 4AQYJ 1G4CA 3CD6S 3Q24A 4PUOB 1U2RA 1TL3B 4OI1A 1ZTTA 2RF2B 1IKWA 3MHYA 1IVZA 2LXIA 1U1RA 1BLUA 3DRYA 2VFRA 1Q53A 2C42A 4WYLA 5G4DA 4DFJA 1KP6A 1S9GA 1TL4A 3DGVA 3MF5A 3O5TB 4L74A 4M5NA 4A8OA 2ZZTA 3IG1A 3H7HB 3MM9B 4Y65A 2RMLA 3MUVP 2ZOGA 2ABYA 2Y9HA 3JYTB 3ITHB 4DL6A 3M1VA 1L3KA 2VA2A 1S12A 5A0YA 2Z0GA 1VBXA 2GZOA 2IM2A 2RD5C 1U1LA 1DTQB 3A8KA 5FJ4A 4LUBA 5AXNA 2CUYA 1VQKS 5H9FK 5GAGU 1K0VA 2PGCA 4OYBA 5LXRA 4IFYA 2HFOA 1EQMA 1MN9A 3AAWB 1RYRA 1L3VA 4OX9J 3C6UB 3OBIA 4ZP9A 3RRKA 3FRZA 3AOBA 1CBKA 1TUVA 1OWXA 4FP9A 4RUBA 4LSLB 5RUBA 1VQ9S 1RWNB 2YNFB 3DCAA 1YLXA 3FEYB 3IN5A 1VQLS 1JLEB 4ZS6A 4E8UA 4IR9A 4GVBB 2GQ2A 2H9ZA 4YDDB 2FQQB 3R5DA 3NL0A 2B4PA 1SC6A 3CCZA 4C11B 2UP1A 4HR2A 3BO3A 4ECVA 1FVSA 3GTYX 3H5SA 3KG0A 2RVJA 1KRPA 2V8DA 3EZOA 3IAS9 2V69A 1CSJA 3N4WA 1RU1A 5JXSA 4F3MA 3VAIA 1NDKA 4XO0A 4QYZK 4YB6A 1RKJA 1J2VA 5HQMA 1L3UA 1SC1B 2ZUAA 2JEJA 5THWA 1YJWS 3CNQP 1R8CA 4ZVSB 4CRJA 2GAHC 1IM4A 1XK8A 3RZAA 4RNMA 3N6NA 2CPDA 4PWWA 1HI1A 2XMAA 2FB0A 3BN4A 2FJVA 2EK1A 3MCSA 3R6LB 3PXGa 2FC9A 1WHYA 5J2PA 2I1RA 1X4DA 1YITS 4JI1F 3ONQA 3A8IA 2BKNA 1RT3B 1JWWA 3A4TA 4AFFA 2J7KA 1HHTP 1FESA 1U0SA 2BOAA 2DXEA 2E5HA 3JAMU 3DOLA 4WF9Q 5D15A 2VODA 4B9VA 1DQ8A 2VIHA 1KOOA 1M5PC 2CJXB 2BKOA 1KTVA 2GVZA 3AY0A 2DGSA 3UWTA 1IXKA 3R5JB 1XMBA 2BE2B 2M3DA 4OYIA 4XAKA 2WTFA 3MECA 3KK3A 1IBLJ 2Z2MA 3JSMB 2UUBF 1HPZA 1OSDA 4NWBA 3U1MA 2B7CB 2ZEJA 3I0SB 4H4KA 4X4QA 1FWLA 2YVSA 1RHKB 1APSA 1HPZB 2H5JB 3BN7A 2OFGX 1TQLA 3OTDA 1WG1A 4USKA 1SH2A 3ZO7A 1JLGB 1WHWA 2RQKA 2VPZB 4ITSA 3OQ2A 4UQGA 4DF8A 3V4IA 3SMZA 2LEBA 1Q78A 2P5VA 2QZ8A 2V8VA 3M8QB 3BQ2A 2UXCF 2CJAA 2HLUA 5KFDA 3CCRS 2YQ3A 1U1KA 4J9PA 2C1EB 2NYHA 1U8WA 1RBLA 4F4WA 4NXMF 4W4MA 4FF2A 4KPCA 1FKOA 4FYVB 1REVB 1QE1A 1NKBA 2OPSB 3LANA 9RUBA 2OI2A 4B3MJ 1F5AA 1RAOA 3CD0A 1JJHA 4DCJB 2J7UA 3GQCA 2M8DB 4OIXA 5ITHA 1NKCA 2UUCJ 8ATCB 3T1YF 4A8MP 4X64F 2D3O1 2HGMA 3ENAA 4YR2A 4UY85 5C25A 4IG0A 4YHHJ 1K0TA 2V4JB 2KTQA 1WF2A 1N54B 2QLFB 2E5LF 2HBQB 2ZM6F 4PWDA 3H59A 4RL1A 3UVJB 4E98A 2ZJPQ 4JB8B 4OZJA 1C0TB 1YBAA 1OY6A 1Y10A 1TK5A 1FRIA 4C11A 4IOBA 5IZHA 2B9WA 2FHMA 2A1BA 2GVZB 1RWXB 3D3BJ 1ROFA 2GAGC 3L95X 4DR7J 1UCNA 2Q43A 1S76D 3OSPA 2ROPA 2AYMA 2JEGA 2BJ9A 3UD5A 4LFBJ 2W2NP 1VRTB 2WRMA 3GMGA 4OQJA 3BSCA 3TVYA 5CCMA 4K50A 2A3JA 3DOKA 3RUBL 4CLPA 1BMQB 2N4DA 1UVJA 3JXOA 1VJWA 4ECQA 8RUCA 2N7YA 4C3KA 3HHNB 4F2SA 3NNCA 1SCJB 2C2DA 1CQMA 4ILLA 1PJ6A 3M1VB 5D0RA 1UWAA 2EBEA 4AXIA 3I4PA 4BWJA 5KFGA 4PCQA 3SCJE 3KJQB 4UUXA 1SUQA 3WQPA 4DCOB 5DDRC 2AD9A 2RU3A 5HO4A 2JFKA 2V63A 2YKAA 3DHXA 2QSWA 4ZLNA 2HFZA 4USUA 2DNPA 1CJKA 1A9NB 3EGNA 3CUNA 3HXMA 2HMIA 2F65A 3P45B 3ISZA 2HURA 2Y3YA 3K8VA 5KFTA 1EX8A 2GW8A 2R8IA 2CRLA 3N01A 1EB0A 2JH3A 2EFPA 1VC5A 2FJAB 4JI7J 2BW2A 5D4LA 4WP8A 4UOCA 3VF0B 4ES1A 2G0IA 3FBEA 5IWAF 2HWHA 2ILZA 1MMLA 4F8RA 4WU2A 2C2OB 4ZCLA 3JSYA 3M6WA 3WX4A 1VISA 1VRUA 2KU7A 1RT7B 5E33A 4FPRA 3I87A 4KH1B 1YGYA 2FHJA 5KFXA 2IDLA 3DM2A 3H2LA 4TKTA 1T9WA 3RG6A 2YWHA 2VQEJ 2G2YA 3Q23A 2HK2A 3FJ2A 3QIDA 5ETSA 3K8WA 5ETRA 3W2WA 2DXFA 4X62J 3OJSA 2K06A 4TY8A 3DLBA 3D2WA 2VD3A 4B3OA 2QFJA 1FNMA 3MPYA 2XLKA 1FD8A 2HFNA 2CQ0A 5CZVA 3D28A 2BXJA 4NI2A 4CWBA 3ZTQA 2RRBA 1QVGR 1HLWA 2C2MB 2YWKA 1QY7A 3UCZP 3FMWA 2QRRA 2VPYB 2W2OP 4ZLJA 3RAQA 2LQ8A 1SIZA 2K7JA 5CXTA 1U4BA 1CULA 6FDRA 3P5BP 1D8YA 1B7FA 3M8PB 2KG0A 4RW6A 1AT1B 1TV6A 3OFFA 1HNWJ 3DLKA 1ZAXA 5L8RC 2BRKA 1F9EB 2B56A 2KVIA 4EU0A 3CC2S 4F36A 1QUVA 5ETMA 3EDQB 1VQ4S 4DL2A 3O3LA 3CJ0A 3QRPA 1YX2A 4YB7A 1V5IB 4TLQA 3NS5A 3MEGA 2CQIA 3CCTA 1MROB 2G9OA 3UR3C 1DLOB 2MQPA 2IYGA 3H8YA 1O51A 4JI6J 4JV5F 2VHGA 2B9XA 4UY8T 3HHDA 4IYQA 5K8PA 2KRBA 2DVIA 1F2HA 2EVZA 4DV1F 1L3TA 4B3SJ 1D9AA 3LALA 1S1XA 1S4FA 2PMHA 2O5DA 2GS8A 4DV4F 1ZTWA 1MWYA 4KRWA 3QGHA 1HARA 1X8DA 2KO1A 2O3DA 4AE5A 2LDYA 1X5OA 3R7NB 2GNKA 2BACA 4EI2A 3IM8A 2E1RA 4DI6A 5A2QU 3G6ES 3QRQA 3HHEA 2KYZA 3CJTA 2OGUA 2ZBQA 5GAHI 2DO4A 3PIPQ 2YXLA 2X1BA 1RTHA 2V9KA 3GE9A 3QO9B 5E2QA 3UD4P 1XMQJ 2AEJA 5E3AA 2HZVA 1N32J 3LWMA 5HAOA 3S01A 4JUZA 4X66J 2FVRA 3CULA 3QLHB 1Q79A 3HHKA 3CO9A 4LIRA 2XWXA 2AIRB 3ET6A 2LP4A 3J7YU 4RBVA 4OJ1A 3PJXA 3OVAA 1WHXA 3RGIA 3KNAA 1JLBB 2OSRA 2AP6A 1IBKF 4QIEA 3VZIA 4ED3A 2VG7A 3TX0A 2XS5A 4QIFA 2J9DE 2ZBIA 3KYLA 4B9LA 4P2SA 1S77D 2LXUA 4HT7A 4OHVA 4K0KJ 1ZPVA 5K8MA 3HSJA 5AXKA 2XCPA 4LF5F 2EFQA 2ZH2A 3FSYA 1Y4ZB 2KHCA 3R5CA 1LK7A 3PTWA 5A8KA 2ZHOA 5F0UA 3MM5A 2GFFA 3IAM9 4RWWA 2C3MA 2QYGA 1LWXA 1R89A 4M5LA 1VQ8S 2X1GA 2AF6A 1HWJA 1N5VA 1Y0HA 2BRLA 3R27A 2LA6A 2H3EB 5AXLA 1VK3A 2CFXA 2CQBA 4M5DB 3PW0A 4JI3F 2MTLA 1HD0A 4LFBF 1P1LA 2DB1A 3AOAA 2LQJA 5ETTA 5I3PA 2R7SA 5CH7B 2C2NA 3J7Z5 1HMVB 2C22A 3SDEB 3WX8A 2AU0A 1VC0A 4E0DA 1YZ6A 1GQEA 1C4CA 3C6TA 4OI4A 3M9OB 1FERA 1HQEA 1R0BG 5KTQA 1RHJB 2HQ3A 4KY3A 3H25A 5A76A 4D3HA 2UU9J 4GKJF 4EUVA 3I5CA 2HFVA 5SUHA 4RW6B 1QAJA 3JQJA 2V8PA 2KJWA 2OPQA 3SCIE 1TKTB 2Z2ZA 3TAMB 3TJ8A 4AT1B 4Y0FA 1UFWA 1YK9A 1V5VA 2DNHA 2D3UA 5KFBA 3VGSA 3Q8YA 2FHOB 4Z7YA 3T5HA 2V9WA 2FLNA 4ANDA 4MKYA 3IS9A 3R1HA 1J5EF 1FRLA 1CG2A 4EO8A 4ETZA 1SKWA 2WVBA 3FKBA 4ZPCA 3KK1A 1NUEA 4ZJLA 3HVAA 3VAFA 2R2RA 1U24A 1N8RT 1LWCA 3CJ2A 2DRAA 1Y3KA 1QTNB 2OSQA 1DTTA 3M2RB 4EGLA 4ECSA 3RW7A 2C2EA 1SKSA 4FF1A 5H9EJ 1S1TA 2DHSA 3MM7B 5KFMA 3AB2B 3DYAB 4I1TA 5F0WA 4QCLA 1KHWA 5BYSA 5G0RB 2CIMA 3Q2SC 4WXOA 4QIGA 4WJBA 1EJ7L 1X4BA 2FZCB 2M70A 2MZTA 1RU2A 3SCKE 3TOQA 2YNGB 3DLEB 2WK4A 1CJUB 1H7WA 1HNVB 3GSIA 3GIJA 1ZOTA 2B43A 4GKKJ 3EUNA 1UEVA 2HHQA 1LW2A 4KFBB 3JSRA 3MI7X 1KFDA 3HD1A 3GILA 4NX9A 1RAFB 4BHQA 1SIWB 1C0TA 2HPUA 2J76E 4KQZA 5ETQA 3D6TB 5LSOA 1NJIT 4P71A 2EFVA 4CLUA 1S1VB 3HDSA 2LECA 2OH2A 3PRDA 4F4KA 5E0OA 2RRAA 4OFZA 1U45A 2PEHA 3TX8A 2AX0A 3IR6B 3R9LA 5JUMA 2E9TA 2EKYA 4OLOA 4F67A 4ZKAA 1N6QB 1KSPA 2JNJA 3AT1B 1RAIB 3MDFA 2JLGA 4PPDA 1WC3A 2DD8S 2HQGA 2AJ0A 3QT6A 4Y2MA 1I6JA 2RILA 5KFAA 2KG1A 4F3QA 2I8EA 3E8OA 5IM0A 2RKIA 5K14A 1GTHA 4WU3A 1SH3A 4EEYA 2W4PA 2XMVA 2UV8G 2NREA 2XNQA 4MK9A 4ECUA 3TVZA 2J0QD 4A8WA 1XMOF 1E6VA 4FBUA 1XR6A 4JI8F 4NYPA 4OHZA 3OW2R 1FD2A 4ECRA 3NS7B 4YP3A 3EPIA 4I2PA 2BM0A 3U02A 1HNWF 2MHEA 2R4FA 5IWAJ 4LQ3A 5DZ7A 4K4ZA 3L7PA 4MT1A 3W3SA 1K9MT 3W1YC 3CJQA 1HBOB 2QA1A 4DBQA 1KDNA 1U6ZA 1FI4A 4OMFG 3QJLA 2K2PA 3I0RB 4ZVPB 3ZZTA 2D3ZA 3PKMA 3RB6A 2BE2A 2C3UA 1LWFA 5LSRA 4DQQA 3BGLA 3CJKB 5GADI 2DY1A 3W9HA 5DJBA 4DX6A 2GJ2A 4ZJQA 2MHNA 1E6VB 3H40A 1ZM2A 4PQUB 3CXCR 5KOXA 1H2VZ 2COLA 3PFOA 4DFPA 2DITA 3FZBA 4A8YA 1NB7A 2PI5A 1O0PA 3H5XA 4K4UA 2CQGA 2FVSA 1G3OA 3LPYA 1Q16B 3EZUA 4PPZA 1K47A 5C2CA 2CWKA 2QO3A 4TVAB 2B9YA 1RHQB 3PHEA 3CDAA 3S1TA 5J2PB 4FS1A 1Q7LB 2ZC4A 5D4NA 5D8HB 2M5YA 1RHRB 2KDOA 2MZQA 5IQQA 5A8WB 1DFDA 3ETMA 2HNZB 4IRKA 2YNIA 4LFAJ 1N6QA 2EC0A 1EETB 1N88A 3OXGA 3BPDA 3GV8B 3JQMA 4EBDA 1HQUA 4NLRA 2DHXA 1KLMB 2QT7A 3GZ7A 4P6QA 2WB4A 4ES3A 4Q43A 4FYWB 1J27A 2C2RA 3DRXA 2IFXA 3I96A 4ICLB 1NHUA 2VDIA 3MECB 1HW9A 2UUAF 2P9GA 2ALYB 1WACA 2Q1LA 3J81Y 2B5JA 3US5A 4MKAA 1S48A 3VGUA 1QJHA 1X7VA 2IRUA 4ZK7M 3C66A 3TZYA 3Q89A 2X3DA 1RT4B 4RUCA 4MYTA 3BO2A 1DJ0A 1YJVA 5DZ6A 1WI8A 1Y5IB 3AXMA 5KFSA 3W60A 3C6UA 4ZVQB 1I3OB 4TLRA 3UE2A 1Q5YA 1V3ZA 3E01A 4CYUB 1E6YA 5B0FA 4DX8H 3OVBA 2OD4A 3PEJA 3GIRA 4OYZA 2N3LA 3V5RA 1JK9B 5EWGA 1F5BA 5C24B 1JXVA 3G2XA 4RU9A 4LF7F 2GIQA 2W1BA 5B0BA 3V6JA 1TFYA 3W9IA 3MFIA 1IQTA 5HJXA 1OJ4A 1JMTA 1RAHB 3F44A 3TZZA 2UXCJ 4CLLA 2KXHA 2LQ9A 4CDIA 1FJEB 2I2YA 2NZ4A 3T9NA 4Z7CA 1IWGA 2MKIA 3EWGA 3M2UB 2IYIA 3EXYA 1VMBA 4BBYA 2FHKA 4FKYA 2QGFB 2HHHF 2G13A 3B54A 4I7FB 4OYWA 5KFNA 3MUMP 1F3VA 2FIUA 2YNFA 2DNZA 2DHHA 1JXEA 2IA6A 4NMLA 2MZRA 1IBLF 1RCXB 3VQTA 4MKBA 4KO0A 1UMJA 2P9EA 5F8GA 2DRBA 4R8UA 1TKXA 3GV5B 2OHDA 2R3VA 3GJQB 3RBZA 1YRTA 3TA0A 2RS2A 4GVLA 4LF8F 1GFWB 2V6AA 1F9FA 3KNGA 1R8BA 4ZP7A 4ZPWR 3KJNB 3DXBA 3QQCD 2AJ1A 2OFHX 1MWZA 2DHGA 4H4KC 2VC0A 5BXIA 5HI7A 5BYQA 3QGIA 5LT5A 4RLEA 5KFYA 2ZBCA 1ZBTA 2OKQA 2P6SA 3LP0A 2MLYA 4PXEA 1LW0B 4DLEA 2L41A 2B4VA 5CYQB 2XQCA 3K0JA 3PHTA 1FF2A 2HFUA 2H4YB 2OPPB 4DV4J 1OPIA 1X5PA 2GHVC 3QSYB 4ZDNA 2PMZD 5H1SV 5KFRA 5HK4A 2H54B 2MLZA 5J2QB 3PW4A 4F3OA 4C48A 3WC2A 4Q8FA 5IQ6A 4KHMA 1LV5A 2E29A 3HT0A 2H5EA 4A4JA 5EHHA 4RR5A 4WE1B 1ZAWA 1RT1B 3SIPB 4OV6A 2J6TA 3CMES 4H4OB 3LUYA 3KK2A 1JLCB 3M8YA 4FYYB 2XTJP 3D0HE 3ZZRA 1J5OB 4UZBA 1HMVA 1KQGB 3TR5A 3E51A 4F4YA 3ILIA 4HYKA 1O6XA 4IDKA 4FN5A 2OTJS 4P73A 3DGPA 4RW4A 2OEMA 2FUG9 5IC6B 3VV2B 4TYAA 4HACA 2MZSA 4PG6A 4QIVA 2OMLA 1RTHB 3CJ5A 2CKWA 2R7WA 2X1FA 4AL7A 4OHXA 1X4CA 3TJ9A 3G87A 1Q8LA 3GFYA 3KUHA 3MAAA 2BKPA 3MCMA 3MPWA 1QUPA 4L3KA 4N7TA 3VVTA 5IT9U 4J9KA 3QT8A 4ED0A 1CLFA 2ZH9A 3ICLA 2MMYA 1KQKA 2DNQA 4NEYA 3FEZA 2LLZA 3I4HX 3KLHB 5ETLA 2OEJA 3A8JA 3BQ1A 4ZA1A 4JOUA 1F6TA 3PYFA 2FLPA 1NK8A 2J9CA 2AX1A 1SQEA 2IAJA 2CYYA 1DBDA 1V9OA 2L9DA 2F1FA 2ZDPA 2LA4A 1HBUB 2FJDB 2ZVIA 2LCWA 2V67A 3G8QA 3IO1A 3V6HA 4MAKA 1Z2ZA 2DKOB 3JTNA 3EICA 4GKJJ 4U7UK 2Y1JA 2YPYA 3M2VB 4A8KA 1VQ5S 4F0HA 5E3RA 1TP7A 2OTLS 3BO4A 1FFSB 2NZCA 3PJ9A 4U8VA 3KJVB 4F2RA 2DNOA 4C3LA 1H3DA 2VONA 3DKDA 2RRNA 5LJ3Y 3UQSA 4C2MA 2LVWA 1ZS6A 2HBYB 1U49A 2DEIA 4USHA 2F63A 3HX9A 1TR0A 4GO5X 4YUDA 1FCAA 3UI3A 3B4MA 1CVJA 1B7YB 3CF5Q 1L5UA 3PDNA 1TKDA 3FZ2A 1FXLA 4K4YA 4EYIB 5EN1A 3OR2B 2RDJA 3H98A 2DCLA 2MJNA 5GAEI 5CYQA 3EYZA 1R6VA 2VBWA 1S97A 4EWTA 4UQTA 3AJ2A 1UPMB 3CT9A 3WBZA 1U26A 4Y00A 3QAUA 2W4CA 1JQGA 4I69A 4NA2A 1KQFB 3R5AA 5KFJA 2DYAA 3OUYA 4LF9F 4K0KF 3GB0A 3R2CJ 2MGZA 3FBBA 3IBCB 5LMNJ 2W4DA 1URRA 2IPOB 3DDIA 4DPYA 2CJ9A 3MEGB 1C1CA 1AA1B 3E3XA 5M2PA 3PR5B 3CPWR 1X9SA 1TKXB 1S1WB 2BM1A 5FDLB 4NASA 7FD1A 1DQ9A 1R0CB 3IR5B 4G65A 3HVRA 3BGRB 2FJXA 1K44A 1D8ZA 1W25A 2BJDA 3L09A 1SPBP 2D41A 2BJ7A 2U1AA 1OYDA 2YKMB 3PRBA 1W7WA 4LVNP 4MIAA 2GHWA 5HN0A 2IC3B 1G2EA 5D0GA 4L3NA 3I56S 2JLEA 2BJEA 3HSDA 3ULHA 3NRBA 2ILYA 2B8PA 4XPCA 3AB4B 1Q4RA 3D0GE 1U6FA 5D0EA 4U67Q 4DV3F 4ER8A 5IT9Y 2AYEA 2KFNA 2GCFA 3UNYA 2Q3PA 4DUTA 1IR2A 3DRPB 3VAHA 2DO0A 3H42A 2J0XA 3TI0A 2AWZA 4KKOB 5EWEA 2H1YA 3HZGA 2DR9A 2DNLA 1TZ0A 4DUZJ 1QVFR 3FQKA 3UN5A 5K20B 2NXCA 4I2QB 5KFOA 1BQNB 2CDRB 1VRUB 1P1TA 1FDAA 2JC1A 4Y2KA 5J1EB 2ZUGA 4DV1J 2WW4A 3KG1A 2JEIA 5T14A 1FE0A 4O3PA 4FF3A 2EC2A 2MSSA 2BJ1A 4OHWA 2GMHA 4I6WA 4F7VA 2ALZA 2B7BB 3GFHA 4DX5A 2DHAA 4JI4F 1RWOB 3Q2TC 2JWNA 4IH5A 1TUWA 4CP5A 2KZMA 2GQQA 1JJ2R 2WB1D 4WK3A 5LSLA 3C2PA 3IMQJ 3W62A 3VGTA 2QFIA 4CNZA 1PIEA 3C14A 3NGSA 4DU7A 5IV3A 2E1MC 1SBRA 2VKZG 4ICLA 2VG5B 4NCGA 4ZVUB 5AE3A 2ATLA 4OJHA 2BE7D 1Y7PA 2WAQD 2IIHA 1T9UA 1DHMA 1KN6A 5HP1A 1EQ0A 1SJ1A 1UETA 5CHCB 2FGCA 4S0MA 4R5PB 1HNXF 4PXBA 1RBOB 3R2DJ 4CT8A 3C46A 3NMRA 2DISA 3BZQA 3LP1B 4QIWD 5B0AA 2MQQA 2OPRB 2Y1IA 5A8RB 1V3RA 3UO0A 3Q86A 4UTGA 5CD4A 4PXCA 4F50A 3B8HA 4QR1A 4O0IA 3LP2B 4X62F 3F41A 3BGRA 2UVRA 1T95A 4FXWA 4RW9A 4HEA9 4LF6J 3TUZC 3OL7A 1HQ2A 3T6JA 3J7ZT 2LQBA 4JI2F 1IKYA 2A2DA 3WHIA 4X65F 1S72S 1GK8A 5I42A 4YDXA 1PGZA 2FVPA 3C3LA 2MGZB 1IR1A 3OLAA 3M9NB 2EBGA 2R7RA 2ZFHA 4CNYA 4USWA 1LKZA 1FFWB 1XQIA 1FX4A 3IRXA 3VR1A 3KFWX 3BYPA 3FCVA 2W7OA 5B0DA 4DF4A 2AGPA 3J81U 1HBOA 2GMLA 1T9TA 3ENVA 3K5OA 5AE2A 2PFDA 1BQMB 1FRJA 1DRZA 3NNAA 1FHTA 2HAIA 2QL5B 2A0FB 2KXNB 4QQBA 2XMJA 1M1GA 3DHWC 4C7QA 1R7IA 4QPTA 1S79A 3GIMA 4I2PB 4DV7J 1HYSB 3M8ZA 1VOMA 2CADA 1VQ7S 3UW1A 2FDNA 3NLCA 1NZAA 3S6EA 4C98A 2K7KA 1S6OA 2UZAA 1FE4A 1SC3B 3C16A 1Y00A 3W66A 1RWUA 2E5JA 3K17A 4J9UE 4EK2A 4O44B 4OX6A 1RT3A 3D9BA 3IP0A 3T5JA 3A3OB 1S59A 4I56A 5J2NB 2GA7A 1VHIA 4DR6J 2LMIA 2WONB 4QWEA 4WCEQ 2BJ3A 4A48A 3MUTP 1A6LA 1SC4B 2AZ3A 2HGLA 3MMBB 3L3CA 5A8RA 5L1IA 4PWUA 2IBKA 2I9SA 1NCLA 2P9CA 2H65B 1NKEA 1HBNB 1X4EA 1XTZA 5JMNA 1U02A 3HJVA 3K5PA 4G1QB 4OZ3A 4JI0J 4WKRA 3D5MA 1WORA 2EXUA 3PW5A 4DR7F 3MD1A 3W5XA 2FY8A 2YBVA 2HNYA 2UXDJ 3BH7B 4WFZA 4QW8A 3SSQA 3PCOB 1U25A 4KYZA 1QDUB 3P8BB 4M5KA 4DSLA 3BGFA 3OR1A 1EARA 3E2EA 4RPFA 1ZYQA 3OL6A 4Y34A 1P9YA 5DO2A 2R8JA 2XMUA 4ZITA 3OLBA 4YHHF 3NGDA 3KLHA 1RISA 1YIJS 3B78A 2D3OR 4XDCA 1W26A 3P6YC 4ZVHA 3PZPA 1YZ7A 4ZPDA 4NLXA 1NB2A 3OD2A 2XLIA 5A0YB 3RR8A 1NNDA 4RW7B 2W01A 2MQLA 2YX1A 4R5PA 4CTAA 3KLGB 1Z4UA 1TL7B 4WIQA 1JJCB 2G2ZA 1RKIA 4A8QA 5HP1B 1RLCL 2GIRA 4FF4A 1NO8A 3R97A 1Y5LB 2DR6A 3FCHA 3TQEA 5L1LA 3SI8A 3LOUA 2F4VJ 2L08A 2DT9A 3C14B 5DG8A 2DJWA 3D3CJ 4NYOA 4RWXA 5HMWA 4HI1A 2HBRB 1IKWB 1HIYA 1JNRB 1VIOA 2JX2A 4GVBA 1UA0A 1JLEA 4DU8A 3KHHA 4WBFA 2ZJRQ 2VJUA 1SB6A 2YNGA 3DLEA 4D3GA 5LL6d 3FRYA 2IMOA 4U95A 2OAUA 4KAIA 5FD1A 1NSKL 1RWVB 4KGMA 3TRGA 1WTBA 2YX4A 2MKJA 2CJBA 3DYAA 1IBKJ 4EZ6A 4QBUA 2CG8A 2AEFA 1YI2S 3BKFA 4A47A 3MM6A 3G6XA 2MQOA 3RAMA 4QWDA 3IWXA 1HW8A 3MMCB 1TAUA 2PEBA 1C4AA 1N33F 4PAAA 2DH7A 4KO0B 2DNNA 2ZH3A 3MM9A 2R2SA 1JKHB 2DEJA 4I68A 3JS9A 2R7VA 4C0OC 1IJEB 1WELA 2MQNA 3ETOA 3GFZA 3ZC4A 5DQIA 3MAQA 3PO4A 2CNOB 3AJDA 3HP6A 5B0EA 3M30B 1UWBB 3TNVA 3BYRA 2LYVA 2QMWA 3FSXA 3NAHA 2ADCA 1TKTA 4HDGA 3VVUA 1JLAA 4XDDA 3K59A 1RTDB 2R9LA 5K9FA 3O1LA 1N52B 4HHHA 5HMZA 2CG4A 4JI5F 2KVQE 4OZ2A 4KPYA 5HANA 1VQYA 5HLFB 1MMNA 2B3TB 4OI0A 4LFCF 2ZD1B 3IBFB 4DDFA 3B4DA 1QSLA 4DSKA 1C1CB 3ET6B 1FKPA 3HFVA 4ZLLA 5DDOC 4RW8B 2GQCA 1KBRA 1SKUB 2R7OA 3CEDA 2D7SA 2FJBB 3HHLB 2DY9A 4ED2A 2MEWA 3KOAA 3K5LA 2FVQA 6AT1B 1M1KT 4TY9A 2VG6B 4K5SA 4WP3A 4NLSA 1WF0A 1YJTA 2JZ5A 3CJ8A 1WKLA 3CIMA 3P5TL 1OSCA 3ZTPA 3HLUA 1F60B 3QJJA 1WSVA 2BW7A 3DU6A 2XC9A 3LF0A 2V50A 3WDOA 2HIQA 3QATA 4HDHA 3MR7A 3N5BA 4TXSA 2FD2A 3T19A 2G1HA 1OQ3A 1C0UB 1NDLA 1RQ0A 2ZOFA 4LJMA 4Q44A 1RT2B 2M7SA 3GR1A 2B9EA 1S0OA 2OUGA 2HNYB 4KGXB 3PNIA 2GJFA 4ZPTR 3CO0P 2C2ZB 4O3SA 1AZSB 1UTAA 2HHHJ 1HBMA 1RT6A 2ZNYA 3HT3A 3KJVA 1UVIA 2DIUA 2DR5A 1JLBA 1HBNA 2VG6A 3DDNA 3D54A 3O2IA 1MNEA 2I5JA 4IDKB 1M1HA 4OI2A 3I32A 2YH1A 4ZN1A 1DLOA 4OZNA 4ZPVR 1FTCA 4C3MA 1F0XA 2WBMA 4MFBA 1PILA 4NLVA 2FC8A 3HVTB 1IBMF 4RKUC 1PYOB 1ZM3A 2NXEA 4O4RA 5H9FJ 4B3SF 3TUPA 3CIZA 3R8YA 2ZE2B 1WDDA 2RSQA 3H4DA 2FTRA 3N28A 4BLGA 1R27B 4EYHB 2IM1A 4DEZA 3ENWA 1T02A 3RJMB 2W24A 2ADBA 4NCAA 1FJ7A 2RQMA 3M8PA 3OFEA 4LSNA 3FK4A 5E5NA 1JXLA 3ZXWA 3NGUA 1F1BB 5DGBA 4CO4A 4CLWA 3K7RA 1NLKL 2XZTB 4KV8A 2VPWB 2CQCA 5J2QA 3KDOA 2JFDA 4QYRA 1YJNS 2O67A 2OJ3A 5KG5A 4RUHA 4R25A 1PSDA 2XO7A 1VQMS 2VUGA 3MOJB 2CQ3A 1BQMA 2QJ3A 1OQ6A 1R8PA 5KFIA 5A2QY 2CDQA 1K73T 1BHNA 1NRKA 1LW0A 2G2OA 3DRSA 3LW5C 4Q7AA 4RX6A 3LP0B 4ZVRB 1ZZNA 2QEXS 2ZH6A 1B64A 2OLWA 3DGPB 2POKA 4RW4B 1EP4B 3GU0A 4HH1A 1S6QA 4ANCA 3DNCA 2IRXA 1SV5A 2KHDA 2O66A 2RH3A 2J9EA 2D69A 1ACMB 4URGA 3IRWP 4DV2J 4HTJA 1PBAA 4KHRA 2EKNA 1NJWA 2MY8A 1IKYB 1F2GA 1EKSA 2NUHA 3KLVA 2MPUA 3W2VA 2HIYA 1PC4A 1V6HA 2Y1LB 1UW4A 2DGTA 3QPIA 3PR4A 4TU8A 4J9QA 2QMUB 4H4OA 4LFAF 3SCLE 1RT1A 2HVZA 2V2VA 1MLAA 1NBEB 5LXYA 3CE8A 1T7PA 4DV6F 4M5MA 1Q8IA 2XSFA 2K8GA 1PG5B 3H2VE 4I7FA 2WBRA 4NE9C 3EZ5A 2FY1A 1O8BA 1BUXA 2IHR1 2J8SA 3UCGA 3UDCA 2W8KA 2DIVA 3KLEB 3CWJA 3M8RA 5DS7A 4NXNF 1S9FA 3DC2A 2VL1A 4ID5B 4N5SA 1NEEA 1X60A 1WG4A 4HL9A 4MH8A 2VBXA 4IUFA 1WD6A 1KWMA 1UVKA 2K3IA 3FFIB 1VJQA 1JNZB 2LDIA 2E66A 2DGXA 3GYNA 5KG0A 4DL4A 5B08A 2KZZA 4IFVB 2AJQA 4LRAA 3K5MA 1VBZA 1KTQA 3VALA 1R0AB 2AJ4A 2VB6A 3DM2B 2IY5B 3QSIA 5E3CA 1AUSL 1NH7A 2JVRA 1XBWA 6FD1A 1UJ6A 1JJ4A 1WC1A 3CCES 4R8UB 2Z57B 5C42B 4HHJA 3L7UA 4Y28C 2PI4A 2LFVA 3D68A 3W2VB 4IG3A 5F8HA 2EFNA 3EGVA 1RTJA 1B0TA 4DSEA 4X4OA 5EUHA 1XMOJ 3ILJA 2R42A 3V2UC 4YY3F 5KFKA 4RU2A 2ZKUA 4U96A 4HTIA 4X65J 4JI2J 1YKWA 1Q1KA 4C8LA 1NSAA 1SV5B 2MLXA 2UUWA 2L9WA 4ZIWA 5J2MB 3PW2A 1WC4A 2ROEA 3NBPA 4L73A 2FZKB 4LR8A 4IQXA 3DRSB 2D1CA 4ZJOA 3SBMA 4ANEA 1XERA 4DOZA 1AUDA 3GFXA 4G6VB 4NLWA 2QA2A 3MAHA 4C0HA 3I31A 2ASLA 3D6HB 1A0OB 1CPZA 1T9VA 4ECTA 2EEYA 3OT9A 4V19X 5DETA 2IJFA 1EETA 3MTKA 5HMXA 3AHPA 4YMEA 1MW7A 4ERDA 2C28A 2YWWA 2W7PA 2CNKB 4J9SA 3D6MB 2DNRA 2XZWA 3GJRB 2ZWPA 3U27A 2XYGB 1RYSA 2F9JA 4ZPAA 3L9ZA 4YN3B 3QAEA 4V19J 3AODA 1S1WA 2YQ1A 2W9AA 3W5YA 1HNXJ 4B9NA 3SDEA 4DR1F 4B9UA 1BWEA 1ZPWX 4NRTA 3SXLA 1WG5A 2DGOA 2WW8A 3EXCX 2Z2YB 3TZWA 3VZHA 4DG1B 4DSFA 3VAKA 4DPWA 2DNKA 3THVA 3PX4A 2ASJA 1B3TA 1LWFB 1X31C 2PC6A 2IDEA 1FK9B 3JAMY 4MIBA 1QSSA 2MB0B 2FJEB 3A12A 4HI2A 2XNRA 2FLOA 2A10A 2RHSB 3UVJA 3QWPA 2DNGA 3NCPA 4LIWA 1VQOS 3DMJB 2HWTA 1JLQA 2XM3A 2MQMA 5CCLA 1RA6A 2MY7A 1RTIB 2Q79A 4DHVA 4F02A 3NGRA 2PIIA 1PYTA 4DMZA 2V34A 5ADZA 2A2CA 3G82B 4OX8A 4FDFA 3QJPA 1FJGF 3AD7C 4DV3J 4CM0A 1XNRF 2XMMA 1FKOB 2BQUA 1K1SA 5L39A 5IM0B 1WEYA 3DLGB 3PW7A 3TWZA 3IFEA 4NLQA 1N4LA 5AXMA 1VK8A 1VR6A 1SJRA 4QWCA 4GC6A 2OIHA 1UVMA 1OPZA 4RW8A 4Z37A 4Y6IA 2UU9F 3OPKA 3LAMA 1GXTA 1DZ5A 3V4IB 1F3FA 2Z56B 4CLFA 2G4BA 2H51B 2KN4A 3W65A 1HFEL 4LBIA 2E9RX 3O8WA 5LMNF 3R6GB 4LF4F 2F4FA 5HQ8A 1AFJA 2KT5A 2XGQA 2CAJA 3VQSA 1FNOA 4JI3J 1NPKA 1JLAB 2ZJQQ 3QBCA 5LM7E 1NPPA 3EPGA 5J2MA 1FRXA 2VJVA 2EFGA 2W9BA 4L76A 1TMJA 4KGVB 3QWUA 2VBZA 1FT8A 4ALZA 1EHWA 1CJUA 3FBCA 4FVMA 4KGKA 5H9EK 4P52A 4BS2A 3GYGA 4MK8A 3CDBA 3LAKA 4M5IA 5KOWA 2JJ4D 4LF9J 2VH7A 4HACB 2NSBA 2F40A 5HVFA 2GGPA 1WNEA 5JJBA 3P49B 4EFAC 3TZXA 3ZTRA 5KG2A 2G0CA 3EVWA 3FEXB 3I5AA 4J9OA 2HZAA 3M2RA 4LRBA 5U47A 3D1OA 1D09B 3CB4A 2BBEA 2JVOA 4FPIA 3ITHA 4DPOA 2V4QA 2PD1A 1X4AA 3AXKA 3KK2B 3HFKA 4UT4A 4NA1A 4DR2F 2FYXA 1H38A 3MCNA 1S0MA 3SQGB 2GVDB 1OO0B 4IR1A 1T94A 4AL5A 3KLIA 5KFUA 2WOMB 3R7BB 4XTTA 4N76A 1XMQF 5IS2A 1PAUB 4K2JA 4QJVA 5KFEA 4YFUA 2NXUA 2GVDA 2SXLA 1HHQA 3Q8SB 3TYTA 1PC5A 5DDQC 2IC3A 3QNWB 2GV1A 3QFHA 3IGNA 4ECXA 1JKHA 5L38A 2ZBPA 5DG7A 2LEAA 1CJVB 3H0PA 4B3OB 4U8YA 3T1HF 4IRDA 4X4UA 2PE8A 3V4MA 3KXDA 4P10A 5FDLA 5GMEA 4ZPBA 4IFYB 3SQOP 1NMEB 5I3QA 9ATCB 4TN2A 1S1TB 3MM6B 5CYJA 1N5SA 2C2KB 3GPAA 4Q2MA 2X7IA 2HVHA 2JLFA 3T9ZA 1VCTA 5L46A 4DCPB 1WHVA 4ZVOB 4CO2A 3KK1B 3CCMS 3IG1B 5ETPA 1HI0P 4DN9A 2DNYA 1GEHA 2MZ1A 2EG2A 1KONA 1QAXA 3ILOA 4CH0S 1NSPA 2VV5A 5KFVA 4LT6A 3OJUA 1XNQF 1RK8A 3PKYA 4NLUA 3R7SB 1RE1B 2JOQA 2HHTA 2APOA 1H74A 4DL5A 1CJKB 1UL3A 3KLIB 1G6BA 5I4MA 5FLXU 1RLDA 1UPPA 1Q86T 2ZNZA 3UN3A 3CW2C 2JSXA 5M2UA 2VU5A 3N6LA 1ZAVA 2BYCA 4FNIA 2HZCA 5HQLA 2EI5A 4LR9A 4ILMA 2HQIA 4G1QA 3HMJG 4CTAB 1DARA 2B8QA 3KJFB 1VYAA 3ZNUA 3K57A 1M5KC 3M4XA 3BR8A 3HSGA 3POTB 3CCLS 2W7AA 3MR6A 4NZ0A 3KTQA 4Q2LA 8AT1B 3MMBA 1D9DA 1LWEB 4C8KA 1NAQA 1M5SA 2YTCA 1SQGA 2BUNA 3LGMA 4PG8A 3T1AA 1H7XA 2GGPB 4O44A 3OXFA 2W2QP 4A46A 1QTMA 5C5JA 1HBMB 1RT6B 1C1BB 2VQEF 2RNEA 1V3SA 1M5HA 3BSNA 4PXDA 3OTOF 1P8GA 2BABA 2W9BB 4ELVA 2E7VA 1RT2A 1K1QA 2VA3A 4P2XA 4P9SA 2ZH5A 2XSJA 4DS5A 4LVOP 4G3IA 2YNHA 4JI7F 1Q95G 3NCQA 4P7VA 1HD1A 4PR6A 4U9RA 5HBMA 1SJFA 1NK9A 4XIUA 4PYDA 3HM9A 1G7CB 2VG7B 1FWKA 5IT4A 4LF8J 2E44A 3IRXB 4CLZA 5F9NA 1H72C 3BKUA 5C25B 4B3RJ 4LMZA 4CQ1A 4K4WA 1S0VA 3HHLA 3P96A 4DG1A 4Z2XA 3QIPB 5AJ3J 1KFSA 4FXVA 4O0NA 3AQPA 4KT0C 2RB7A 1NU4A 1H98A 1HWLA 3C8YA 5CABA 1FX2A 3IM9A 3SYZA 1RSCA 4USIA 3EX7B 2ASDA 4B3TF 4OJ3A 2PA3A 3L7OA 3GP9A 2VFVA 1T05A 3CC7S 1MN7A 4IQMA 2F4VF 2DGUA 1S10A 2P8IA 1KOHA 1RWMB 4C8YA 2AGOA 1T0TV 2NCKL 4JYAF 2YWFA 1NDPA 3BBFA 1BQXA 5IC4B 3EMTA 3M30A 2M8HA 3Q8VA 4CLYA 3I0RA 2XEXA 4LF7J 4CO5A 1WOSA 2L9NA 1I5OB 2OPPA 2X3GA 3TARA 4NLDA 2CQ1A 3I0SA 1MU2A 4B9TA 4F4ZA 1T9XA 1U09A 1UZDA 2V68A 3LQVA 4MMOA 2N82B 1YSJA 1DY3A 3W61A 4OZ1A 2AW0A 4F4AA 5GADU 3SFGA 3ADAC 1T03A 1FXRA 3CTRA 3T3FA 2CA9A 3W8PA 1KR4A 2ZH4A 1GMVA 2PN6A 4WFAQ 4DR3F 4DR4J 4X4TA 2WVFA 1U1OA 3DOLB 4WZMA 2UXBF 2R2UA 4H4MB 3JB9k 4OLPA 1NSQA 2AQ4A 1BD6A 2LXFA 3DDKA 2IM3A 3ILLA 5KG6A 2DBBA 1BQNA 1TK8A 4B3MF 3OL9A 5F8JA 2CVEA 1U2FA 2YPZA 5KG4A 4QWBA 1VLOA 1CULB 4JI0F 1CQNA 1R0AA 4QU6A 4IFVA 1I94J 1UKUA 2HRYA 4Q0BB 3WC0A 4H54A 3UDLA 2ZITA 1HYSA 2F9DA 3QMQA 2XHCA 2GHPA 1B70B 2PDAA 4LF1A 3S7RA 2ROGA 4P2FA 2H4WB 4DZ6A 3KLGA 1ZETA 4NL5A 3W2WB 2BQ3A 4I64A 3ZZ0A 5DDPC 4NMXA 4K4SA 3VAMA 2AGQA 3F56A 4B3TJ 3GR0A 2PT0A 2XHWA 3GCXP 3HJFA 4C4WA 4OYAA 2QA4S 5AJ3F 1FDDA 2HVDA 1E6YB 1LK5A 2R7QA 2WVDA 2NQPA 2G0JA 4AXJA 1ZH5A 1VRTA 4B3RF 4EBEA 1I1GA 2IMWP 4GO7X 1RTZA 1RT4A 5DM6Q 4LBPA 2GC8A 1R43A 4URQU 5KFFA 1X0FA 3HKWA 3OR1B 4YR3A 4TQRA 3T41A 2UV8A 2A6OA 4I6AA 2QA4G 3GIIA 4KR0B 2VBYA 4CH1A 1MWQA 3O6QA 1YG0A 4DV5J 2CPYA 3SZ2A 3ENQA 5GVQA 3BH6B 3ZFVA 3G71S 3BBCA 1HQUB 4IOCQ 3ELHA 1Q7YT 1CC8A 2V4JA 1UW9A 3TA2A 4ZVGA 3WZ0A 1NZ8A 4IG0B 2XZDB 1VDHA 3Q8QB 3I55S 2HNZA 5KT7A 3ZZPA 3X1LB 4NLYA 5A8WA 1YHQS 3NNHA 4RO0A 4DWIA 1S6PA 2OPSA 2YKMA 2CQ4A 5HMYA 4BDPA 2C3OA 4WIIA 1PBUA 2ZE2A 5T7LB 4H4MA 1HQEB 2QN6B 2NR0A 1Q5VA 3G9CA 1RCOB 5KT6A 4A8SA 2DGQA 2VFUA 2V0NA 3N79A 4K8RA 2XI2A 5E3QA 2A6MA 3EGWB 3DRRB 2RHQB 3FC9A 3OUYB 3RYLA 4W98A 1RGVA 2DPIA 4I6YA 2V94A 1GTEA 4XK8C 1RHMB 2FLLA 2OMOA 1N5YB 1T9YA 4DQRA 1IQZA 4GKKF 3AFGA 2BDPA 1VLYA 3T6BA 4EMDA 2W9CB 4OYOA 4JI4J 1O5JA 1KNZA 1D0EA 2XB2D 3MOZA 1R8HA 2P6TA 1LQ9A 3BF4A 3LPEA 4ED6A 2NYIA 2EFOA 2F7VA 2CQHA 5CQGA 4QW9A 3LH2S 4O4GB 2K3KA 4K4VA 2KFZA 1YRXA 3RBXA 3FQLA 4MJKA 3CGIA 3PYDA 3TUJC 3RU0A 2AJFE 3JQKA 4B9MA 4CIOA 3MMJA 3Q8UA 2HHWA 4BC7A 1VIXA 2RQCA 1VQ6S 1C1BA 1RAGB 1HA1A 1RWPB 5A6PA 4RW9B 5ETVA 4X4VA 3G4SS 2Y0BB 4KH0B 1RADB 3PEHA 1C2PA 1Y3JA 4PKDB 1AROP 3VWSA 1S57A 1NK5A 3BPSP 2BJ8A 2NS1B 4MFBB 1U0HB 2JEFA 1UZHA 2MJUA 1LWEA 2YKOA 2XMTA 3DXSX 1IJFB 3M8QA 2MKKA 1SL1A 3PRVA 1GH8A 3EM1A 2BV3A 2I5JB 3PYEA 4J9MA 2BE9B 1HR0J 5HROA 1ITPA 3OTCA 1WJ9A 1RP5A 2IAJB 3K58A 4ECZA 4ED1A 1NJYA 2HHSA 4DFMA 4TYBA 1OIAA 2VASA 2KI2A 4ED4A 1XEZA 4DPTA 1U6BA 1R31A 2FZGB 5DLFA 3RAXA 1PJ7A 4OYXA 2GMJA 4R0EA 1LOUA 4X2BA 1BGXT 2VDHA 3MPDA 4X84A 2I6WA 3PX0A 1WSRA 3DLHA 5MLCV 5DGAA 2PMWA 5KFZA 1X4FA 1YDLA 5IFMA 2CZ9A 4ILRA 3OV7A 2ZBRA 1NK4A 3N5FA 4UOHA 1YTYA 3W5ZA 3A3NB 3NOCA 1HNIA 1U1NA 3NWRA 4X4PA 4DXLA 1HNZJ 2VQFF 4PEOA 5J1EA 5DRKA 2N4CA 3MPVA 1JX4A 4J9LA 3RRGA 2UVVA 1WWHA 3W64A 1TK0A 3CD5A 4KBIA 5M2RA 2ACMA 3D6FB 2CJYB 4JV2A 4QR0A 4W92B 1CJTA 1GNKA 2ACYA 2KJVA 3NWGA 3D67A 2MYFA 5HLFA 1IKVA 3IWLA 3RB3A 3FGVA 4DL7A 4WE1A 1VHFA 3BR9A 3D0IE 1FTRA 4I4BA 4O3RA 4ZP8A 1GX5A 1N5TA 2ATCB 4ETXA 1RTDA 3KWMA 3TQ1A 1HWKA 3GWCA 2BOPA 1RACB 2OPQB 2HK3A 1GMWA 3H5UA 2XMWA 3Q0AA 2UVWA 7FDRA 2DGWA 1Q82T 2XGPA 2FPHX 5SZTA 4NOHA 4O3QA 2B6AA 5DLGA 4LSLA 2V2ZA 1OY9A 1Y5NB 2ZOMA 3CVKA 2B0GA 3U1LA 3ZTSA 4ZVFA 4ZIVA 1TL7A 4J7CA 4X66F 3CCVS 2Y8WA 2MSTA 5D4PA 2WSFC 2V2QA 2HNDA 2KB2A 2AMCB 1SXLA 1UJ5A 2NPFA 5A6WA 2XY6A 3GONA 5ETNA 3SEOA 2UUTA 4GC7A 3J7A1 4DX7A 5LMUJ 2GX8A 2HFSA 3THPA 3BEGB 2JHEA 3PACA 3VAJA 2IJNA 2W2MP 3JYTA 3KHRA 5EX0A 2Y0SD 3ISND 4PABA 4JV5J 2KYXA 3NCRA 2B6AB 3D1HA 4JI6F 4WTOB 5K5MA 5HSPA 5K8OA 2Z58B 3W9JA 5IXUA 2LU1A 3TVKA 1KS2A 2B5JB 4HT5A 3EGZA 3L4BC 1Q8KA 4K7QA 5KG3A 4AYBD 2ZZMA 5DQHA 2ZHBA 3SQGA 4ENOA 1KD1T 3MURP 1VQSA 4FNHA 1UP1A 3TUIC 1Q0NA 3Q83A 4CO1A 3NGKA 3NOGA 5CD4H 1SH0A 4C8OA 1RHUB 3GSDA 4JV0A 2R8HA 1N5QA 2XWYA 2QE5A 3J81j 4DPXA 1P6TA 3G6VA 4A8FA 1ELOA 3OTEA 2Q66A 1TTHB 2YNIB 1GX6A 1X4HA 1ZZFA 2VFSA 2GO9A 3I9ZA 1BE4A 3IXQA 4OX7A 3LGHA 3W7BA 5GAEU 4DUYF 3QLHA 2WONA 1VI7A 3DOMB 1T3OA 3MCOA 2QMXA 3VCDA 3MFHA 1PKUA 5KFCA 1FEEA 2ZKTA 4WWSA 4GRSA 4ZHRB 3C16B 3CD7A 2VZ9A 3H20A 1LXJA 4RNFA 1X5TA 2HWIA 4ECYA 4UZCA 2JRSA 2IVFB 2MKYA 2QLBB 1VGYA 3NP5A 1VFJA 3MTJA 3DMJA 3DI6A 2HEKA 3GYXB 3I9V9 2ZVSA 4UOGA 3BDPA 3PG9A 3SV3A 2E9ZA 1SJ4P 1DURA 1S1XB 1YRUA 4HH0A 1CEZA 5DQGA 2R7UA 3PO5A 4K2XA 1UEKA 3M8SA 4K4TA 1D1UA 2XI3A 2W25A 4RUAA 3DRRA 4LRCA 3PIOQ 1RZMA 2DXDA 3RBDA 3P4UB 1X9MA 1BY9A 3MEEA 1REVA 2R2TA 2F5GA 4UW2A 3CCWA 2BZ2A 2R7XA 2HQCA 4N8OA 2J8AA 2AV5A 2PO4A 4EO6A 4QWAA 3WIUA 3CCUS 4TU9A 1NM2A 3G82A 1UFKA 2J6UA 4WTYA 4C8ZA 1KKHA 2XYHB 3V6KA 2HQDA 1LFWA 4F26A 4EBCA 4Y2CA 1NXIA 4O4GA 3CJKA 2VQFJ 2XS2A 1RDRA 1FO1A 1RTIA 3Q8PB 4F0MA 2XMKA 1I94F 2MQ8A 1IKXA 3LO3A 3G96A 1S1VA 4MTPA 5L9NA 4J9RA 2N7CA 4DV6J 4FBTA 4TY8B 2RE1A 2KH9A 2KKHA 3B6BA 1TL5A 3TJAA 3JSMA 2BQRA 4N47A 1QLNA 2XS7A 3QYYA 2NUUG 3NBPB 3LGNA 1FDBA 1FEHA 4O23A 3MGJA 1MSWD 4KIAA 2BA9A 2BEFA 1KLNA 1R3NA 4DR3J 1RTJB 2AZ1A 2CQPA 3A13A 4IG3B 2RKIB 3N9UC 3HFZB 4UOFA 2W8LA 1HR0F 2HHXA 1HWUA 5EDWA 1M90T 3ZZYA 4X64J 4M95A 3LP2A 1GMUA 4OZLA 4YB5A 3ZZZA 1SL2A 4OZ0A 4KTQA 4L6V3 2E5GA 3UR0A 3OHAA 4I67A 2QX0A 4NA3A 3UFCX 5JVHQ 1SJ3P 1PAEX 3NKYA 1F9HA 2ZM6J 1DTTB 3GG1A 1AXQA 1SL0A 3UDVA 3LP1A 1LWCB 1JIHA 1TKZA 4NEZA 2HS0A 1NHVA 3DU5A 4LQ9A 2CNNB 2E7XA 4PG7A 4LF4J 1RT5B 4E2FB 3T1YJ 2MDAA 3H5YA 2XY7A 4O3NA 2DR8A 4JYAJ 5F9LA 2HVEA 1QD1A 3TEGA 2QLWA 2ZWOA 5BJRA 2CWXA 1RT5A 5EWFA 2RQ4A 5LJ5Y 4DSJA 2AHOB 2YQ0A 2YKQA 1VBYA 4FXDA 3TAMA 1IBMJ 2ASYA 2RU9A 1HL6A 1WKKA 1LNQA 1HNVA 1UEUA 3MWBA 4B02A 2OELA 2WZ1A 3TAPA 1NK0A 1VRQC 3UPFA 2DPJA 4OI3A 4HKQA 4KE5A 4C8NA 1WF1A 2DH9A 5G0RA 2KXFA 5C42A 4BC9A 2A18A 4DQSA 2EK6A 1P27B 2PSZA 3K2YA 4L75A 3C19A 4KHPJ 1T8EA 3H90A 4RNHA 5IV4A 3BBBA 2DR7A 3PFEA 5CAAA 2UUBJ 3G8SA 1T03B 1GXUA 1YBTA 2V8GA 4M1KA 4J9NA 1KEKA 4JI1J 1VBKA 2VC1A 1QSYA 1H0HB 2UUAJ 2IA0A 4HLBA 4CLSA 2FGOA 1N56A 4JI8J 4JP8A 5KG1A 2YWEA 1S7IA 3M6UA 3OTOJ 1QAIA 4PWDB 1FWPA 5GAGI 4U7UD 3TP2A 4OYMA 4RBUA 1OY8A 5A8KB 5B09A 5D3GB 1YQHA 1PO6A 3RR7A 2CJQA 4Q8EA 1GAOA 2B51A 4IH7A 4LSZB 4M5JA 4DLGA 5CZXA 2RF2A 2HLTA 2D9PA 2M4MA 3VGVA 4N41A 5GAHU 1UAWA 4ATNA 1TVRB 1D3WA 3EJMA 5I42B 4DV5F 3KMQA 3R3TA 3ZTOA 4P2MA 2CJKA 4QYZJ 1QE1B 1FJCA 4K59A 1T05B 1H2UX 3OSNA 2HG4A 4EZ9A 2QLXA 1WC5A 4N77A 2CPIA 3VHQA 4A8XA 5HVGA 4LFCJ 2B4OA 2IM0A 4I0WA 2ZH7A 4TU7A 1KC8T 3MEEB 1NJXA 2Y1RI 2CXEA 3ZZUA 2O1PA 1REGX 2GO8A 2ZHAA 3MPUB 1FVQA 2GIFA 2CPEA 4RBTA 1EP4A 3SSSA 4C97A 1VQNS 4WYWA 1JLGA 1KQSR 1M5VC 2YKPA 4Q5VA 1XNQJ 2NPIA 1MU2B 1AZSA 4FKXA 2J6SA 4C8MA 1NPRA 3VTIA 5D77A 3D1QA 2XY5A 1EKRA 4NLOA 1SKRA 2XSJB 3HCXA 1M0SA 4AUKA 2F8MA 1S1UA 1IM6A 1L3SA 3JTPA 3RRHA 2VFTA 4P75A 3K89A 4WFYA 3QT5A 4LSNB 3U7JA 3R5BA 1ULRA 2JC0A 2ZDOA 2HVIA 1KVJA 1XN9A 1OYEA 1QAYA 2Z4PA 4Y2AA 4R0JA 1KVIA 3MEDA 2JL9A 3GJSB 5K14B 2R8GA 3JTOA 3UDEA 4LRFA 1D9FA 1VQPS 3DN9A 4NZ7A 4CCHA 3HHLD 3BB5A 3GLJA 3MM8A 3NAIA 1RAEB 3NY0A 4YR0A 4IRCA 3IBWA 1S0NA 3A1YG 2NSCA 3HHLC 3ISNC 1ZA1B 2Q6CA 4UUWA 4BCAA 2K1RB 1J5EJ 1AW0A 2ZH1A 2CZ4A 4NZ6A 2KM8B 1S99A 3AQOA 4J91A 3CCSS 5B0GA 1HBUA 5L1KA 1S49A 1PCAA 1R8AA 3MM8B 5HJYA 5CA5A 4NXMJ 2UXBJ 1Y11A 2BX6A 3HI9A 2CPXA 1TL1A 3KUEA 4IO9Q 1FNXH 1TFWA 3M8WA 5EX3A 3TO8A 2HHVA 2DRDA 4CZCA 3DLKB 5ETOA 1N36J 2CQDA 1NK7A 4DR4F 5HBMB 1WOOA 1IWAA
chains in the Genus database with same CATH topology
2F8EX 3BREA 2ERRA 2X1AA 4DL3A 3FSIA 2DK2A 3MMAB 3THTA 1RI7A 1IUJA 5E41A 5I3UA 1UWBA 1X5SA 2WSCC 2DGVA 4WK1A 4O3OA 5DM7Q 3KG4A 2HS3A 3G86A 3SV4A 2FVCA 3Q22A 1FDNA 3IWNC 1YJUA 3PY8A 5J1NA 1U1QA 3O44A 3UNGC 3DOMA 5CYMA 4L72B 1XC9A 2HGNA 1N36F 4X4RA 4N56A 4QU7A 1FKPB 1H6KX 1IN0A 2E1AA 2QYCA 1JLCA 2N3OA 1J5OA 4DS4A 4ZOSA 5F8LA 4ED8A 4NYZA 1S9GB 4G1IA 4FYDA 5JVGQ 1FRHA 2RJZA 3GG0A 2V4RA 4Y3CA 4KC5A 1FXDA 2CPZA 3M2UA 2YWGA 2WOMA 1NH8A 5FIIA 2E5IA 2KM8C 3H4BA 3CMAS 2LU2A 2DH8A 4MIWA 4JBCA 1S7HA 4DQPA 4YOEA 1W2IA 3PJWA 3MR3A 2YKNB 4PG4A 4YEAA 4ZVEA 1UVNA 4OV1A 2E7WA 5DG9A 4DR6F 5AE1A 2LKZA 3AH6A 4BWMA 3C6TB 5F41A 1U7LA 2XG8A 4RW7A 1N32F 3MMCA 5C24A 4IOAQ 5F8NA 1JLFA 4WKYA 4YB1P 2BVZA 4B9SA 1FA0A 5KG7A 3BS9A 5CYMB 3DLJA 4M5DA 4J37A 4NCBA 3E01B 2IRYA 3M6XA 2RT3A 2M52A 4QOTA 4RNOA 2BR0A 1YVFA 4M63A 2GJIA 4RZRA 3V81A 4CI0B 5KT3A 4ID8A 4NLTA 4DJBA 5I3UB 3A8EA 4KSEB 4ZP6A 3MR5A 3RB0A 1S6UA 3OHBA 3CDWA 3T5LA 1RA7A 2B4UA 1XR5A 3TA1A 4KJIA 3OL8A 3KLFB 4U6PA 1IKVB 5F3TA 4PQAA 3I82A 1TKZB 1FKAF 1SI9A 1OS5A 4TQSA 4OZ5A 2KT2A 3CC4S 3NG8A 5KT2A 3BGUA 4OL8A 1NK6A 2EWHA 3MEKA 2MKCA 3OFGA 5J2NA 4K4XA 3TANA 2VKRA 4FS2A 1R6YA 4AL6A 3QZ8A 3FVYA 2KT3A 2VPXB 2ZH8A 1U1PA 3M6VA 3CSKA 3SSRA 4KHPF 2O01C 3CDEA 3RTVA 2MZJA 1N0UA 1XR7A 3IR7B 4FVCA 4WZQA 2CVIA 2DNMA 2MKHA 1LXNA 3UCUP 1S1UB 5KT4A 2CQ2A 3IA0A 5KFPA 4NLGA 1ZM9A 1DQAA 2EPIA 2C3YA 3GIKA 1F5CA 2FJWA 3I6PA 1X0PA 2OP5A 2L48A 3MZIA 1KLMA 4CH7A 1IKXB 1TL1B 3M9MB 1NJZA 4X4SA 3KMSA 2QIFA 3N0VA 3VAGA 3JSBA 2KFYA 2HRUA 2I38A 2K1RA 1MROA 1QM9A 2YX7A 3AJ1A 3HVWA 4ZMMA 3LWLA 4PRFA 5IT0A 1Q81T 2ZC3A 4DUZF 2CPJA 2IVMA 2XBPA 3SFUA 3S8SA 2R8KA 3DLGA 2PA8D 5T7LA 3G6YA 2X51A 3MEDB 4C0BA 2UVUA 1VC6A 3MD3A 2MKSA 1TVRA 4ES2A 4PQUA 5D4OA 2WCXA 1HHSA 2OPRA 5BYRA 4ECWA 1K8AT 1URNA 2G1DA 3G8TA 3KHLA 4WFNQ 1N0VC 2CZVC 1HWIA 1M5OC 5D3GA 1JLQB 4QR2A 3FMBA 3IGVA 2M2BA 4ELTA 2HS4A 4F25A 1N48A 3BJYA 2BANB 4CO3A 4FZVA 1N5YA 2AYBA 5L1JA 1FK9A 3PV8A 5E7OB 1DAXA 2RS8A 4DL0C 3NMAA 1LW2B 3V6DB 4TNOA 3X3UA 2VOPA 2J7WA 1RT7A 3PVXA 5HL7Q 4DN0A 3BM7A 4XPEA 4ZCIA 2XCAA 4URSA 1BC6A 1HI8A 3MM7A 3HO1A 1U8SA 5BR8F 1DTQA 2QSFA 4N8NA 1UFLA 2CPFA 4M94A 3RW6A 3CJ4A 4B08A 2HMIB 4ED7A 2J0SD 3KLFA 4B17A 3QGPA 2UUCF 3DRPA 3HPOA 3M05A 5FLXY 1SUQB 2VG5A 4NCGB 4Q45A 3J7YI 1HYSB 5T41A 4WFBQ 5KFHA 1U47A 4DV7F 2D74B 3KLEA 4KFBA 1Y9OA 2XLJA 3NS6A 4CO0A 2M88A 2DTJA 2I0XA 1X4GA 2XULA 5MAOA 2F8HA 1XWLA 3ZZOA 3DOKB 3M32B 4ZLPA 4DQIA 2NLWA 4DFKA 2RIJA 1N34F 1CC7A 3CJ3A 3HF5A 2RUGA 4QPXA 2R7TA 4I2QA 3GV7B 1Q8BA 3QGGA 2AYGA 3V6DA 3UD3P 4ZCMA 4LF6F 1S6QB 2Z8QA 2HNDB 1WI6A 1ZM4A 3FFIA 2F3JA 3N6MA 4OI6A 2DCUB 4KKOA 1U1MA 2BANA 3BDEA 2HHUA 3DLLQ 3IS9B 2WHOA 4ID5A 3OR2A 2YH0A 4MYUA 1YWXA 1MMDA 1JB0C 1UA1A 3OFHA 3HKZD 3U1NA 4QZVB 4KV8B 1TAQA 4RNNA 4MK7A 3T5KA 4Q0BA 5GMKa 1TL3A 2L3MA 2YY3A 3IC1A 4P7TA 5KAKA 2IVYA 4GMKA 1Z2LA 4F4XA 4PUOA 1SJQA 4DV0F 1X9WA 4DSIA 4ZCKA 4NPOA 1UVLA 1P9QC 3F73A 1LFPA 1S9EA 2J5AA 2EW9A 2V8HA 3R1LA 3FDSA 1T3NA 2LQ5A 1GXLA 1W2BR 4U7CA 3BQ0A 3CCJS 4IKAA 1IR0A 2FHJD 1G1XA 4CT9A 2C3PA 4YQWA 3RB4A 4KB7A 1KHVA 3KHGA 1HNIB 4WXWA 1GT8A 3OXLA 3Q8RB 3QZ7A 2C2RA 1NK4A 5LMUF 4J5OA 2V5HG 4NRUA 3MM5B 4C9DA 3BSOA 3KK3B 4JV1A 4OX9F 4ELUA 1FRMA 4OJGA 1FRKA 3MMAA 3FNNA 5KFLA 2QV6A 3TW0A 2HYIB 1RJJA 2EG1A 1B0VA 1UJ4A 5K8NA 3CCQS 1H2TZ 2WSEC 5KFQA 2IBOA 1WEXA 5HROB 4OHYA 3HVTA 2Q6BA 3AA9A 3M2VA 4G1PA 3BSAA 2OO4A 4IH6A 3QIPA 2HHPA 3I5BA 3MR2A 5EGYA 3DFEA 1RAJA 4USJC 3K5NA 5J1PA 1YJNS 1YJRA 2LEPA 3POTA 4HVZA 5KT5A 2RDIA 5E3PA 4WFXA 4X4NA 1WTFA 3QO9A 1Z1ZA 3HK2A 4M8LA 4K5RA 4AQYF 3DI6B 4DV2F 3P3DA 3TAQA 2YNHB 5B0CA 1YJ9S 2V2KA 2CPHA 2JDJA 1HNZF 5F8IA 5F8MA 2Z2LA 1C0UA 2M0GB 2KRRA 3PM9A 2MXYA 3V81B 3HZEA 1VS3A 5D6GA 2W9CA 5F3ZA 2J9DA 3KKFA 2D9OA 4ZHRA 4DR5F 5B7WA 3AA8A 3OTBA 3CDUA 2VOOA 3B82A 2M9KA 1AFIA 3OVSA 1JLFB 5KFWA 2OD6A 1A7GE 4W90B 2E1CA 2ZD1A 4IO1A 2U2FA 1S9EB 1B0PA 3J80Y 5L9XA 4PG5A 5D78A 3MXHP 4Y2IA 3RBEA 2YKNA 4K4SA 3H2UB 2UXDF 1S6PB 2J0WA 1TV6B 4NLPA 1WEZA 3CD6S 3Q24A 4PUOB 1U2RA 1TL3B 4OI1A 1ZTTA 2RF2B 1IKWA 3MHYA 2LXIA 1U1RA 1BLUA 3DRYA 2VFRA 1Q53A 2C42A 4WYLA 5G4DA 4DFJA 1S9GA 1TL4A 3O5TB 3MF5A 4A8OA 3IG1A 3MM9B 4Y65A 2RMLA 3MUVP 2ZOGA 2ABYA 3JYTB 3ITHB 4DL6A 3M1VA 1L3KA 2VA2A 5A0YA 2Z0GA 1VBXA 2IM2A 2RD5C 1U1LA 1DTQB 5FJ4A 4LUBA 5AXNA 1VQKS 5GAGU 2PGCA 5LXRA 4IFYA 2HFOA 3AAWB 1RYRA 1L3VA 3C6UB 3OBIA 4ZP9A 3RRKA 3FRZA 1TUVA 4FP9A 1OWXA 4LSLB 1VQ9S 2YNFB 3DCAA 3FEYB 3IN5A 1VQLS 1JLEB 4ZS6A 4E8UA 4IR9A 2GQ2A 2H9ZA 4YDDB 3NL0A 3R5DA 2B4PA 1SC6A 3CCZA 4C11B 2UP1A 3BO3A 4ECVA 1FVSA 3H5SA 3KG0A 2RVJA 1KRPA 2V8DA 3IAS9 1CSJA 3N4WA 5JXSA 4F3MA 3VAIA 4XO0A 4YB6A 1RKJA 1J2VA 1L3UA 2JEJA 5THWA 1YJWS 1R8CA 1IM4A 1XK8A 3RZAA 4RNMA 3N6NA 2CPDA 1HI1A 2FB0A 3BN4A 2FJVA 2EK1A 3MCSA 3PXGa 2FC9A 1WHYA