3BEGB

Crystal structure of sr protein kinase 1 complexed to its substrate asf/sf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
86
Chain Sequence
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGSYGRSRSRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase SRPK1
publication title A sliding docking interaction is essential for sequential and processive phosphorylation of an SR protein by SRPK1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/splicing
total genus 14
structure length 86
sequence length 90
ec nomenclature
pdb deposition date 2007-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3begB01
2MPUA 1X5OA 4TU8A 2MQMA 2G4BA 2XB2D 2DIVA 1X4AA 2CPZA 2MKJA 5ITHA 2OTLS 2CPEA 2MKCA 1U1KA 2AD9A 1YI2S 1KOHA 3SDEA 2CQPA 3G8TA 1A9NB 3MI7X 2XNRA 2MY8A 2NZ4A 3TP2A 2LEAA 1H2UX 3MUVP 1SXLA 2MSSA 2I38A 2KG1A 1SJ3P 2MKKA 4C7QA 2KRBA 4QPTA 2XS2A 1ZZFA 2KT5A 1X4BA 2KH9A 2EK6A 1YJWS 4U67Q 1U1MA 5BJRA 3CCVS 1FO1A 2MSTA 5GAGU 2D3OR 2BOPA 2FC8A 2MGZB 3VAMA 2YTCA 3U1MA 2OJ3A 1QVFR 5GVQA 1SJ4P 1L3KA 1X4CA 2G0CA 1H2VZ 1OPIA 1WF1A 2L41A 2DNYA 2DB1A 2YH1A 2MQLA 4FXVA 1M1KT 2MKIA 1YJNS 1H2TZ 1N52B 5CXTA 2KI2A 3CPWR 2M7SA 1Q86T 1UAWA 3N9UC 1FXLA 1WF0A 1PGZA 1U1RA 2CPHA 2JWNA 2DGXA 2AYBA 1VBZA 5IQQA 2KU7A 1M5KC 3VAIA 3IRWP 1XN9A 2JVOA 4LMZA 5GMKa 5JVHQ 3NMRA 3CTRA 2DGTA 2HGNA 5DDRC 3CCQS 4PR6A 1X4EA 5IM0B 2KM8B 2MZRA 1WEYA 4WIIA 2KXNB 2MYFA 1R8HA 3CUNA 2KXFA 1VQPS 2CQBA 3G8SA 4F25A 2AYMA 3LQVA 3P6YC 4IOCQ 1X0FA 2WBRA 1WG5A 3VAGA 1S72S 1HD0A 3R1HA 2G1DA 2I2YA 2N3OA 1DBDA 5HO4A 2HZCA 1SJFA 5DM6Q 3ZZZA 5IFMA 1HD1A 5DDPC 3HI9A 1X5PA 3UCZP 2JVRA 1NJIT 2CPDA 1WG1A 2DH9A 3G4SS 3ULHA 1VC6A 2RT3A 3VAKA 1X4GA 3MUTP 2DNLA 5HL7Q 1WTBA 1M5VC 4ED5A 5DDQC 3Q2TC 1VQ5S 3VF0B 2X1BA 4WFBQ 1OO0B 1BY9A 2F3JA 1U6BA 3THPA 1D9AA 1VC0A 1AUDA 2MJUA 4ERDA 1WELA 1YWXA 1HA1A 2DGSA 2Q79A 5JVGQ 3MD3A 2FPHX 2D9OA 2QFJA 2KXHA 4A8XA 1YITS 5LJ5Y 3RW6A 1VBYA 1YHQS 2HYIB 1X4HA 1NO8A 3CC7S 1O0PA 2MZJA 2LA6A 2LXUA 2DNRA 1WEZA 3S8SA 2DIUA 2YWKA 2RVJA 3IWNC 2CQ2A 2K3KA 3HHNB 2KN4A 1K9MT 2LQ5A 2UP1A 2ERRA 5GAEU 3SDEB 2DNNA 1YIJS 2VONA 2DNOA 3BO2A 2QEXS 3OW2R 2MHNA 2DNKA 1Q82T 1U1QA 1M90T 4FXWA 2RRAA 4YOEA 1P27B 3UD4P 3BEGB 2EVZA 3LPYA 1F9FA 2DNHA 2MQOA 2XSFA 2MQQA 1DRZA 1FJ7A 2RQCA 5DDOC 1N54B 3CCRS 2OIHA 4CQ1A 3EGZA 1UP1A 1WI8A 2ADCA 3NNHA 2DHAA 3MURP 2FY1A 1WHYA 1VBXA 3CCES 1OIAA 3CCSS 2DGWA 3D2WA 5LSOA 3MUMP 1X5SA 1FJEB 5D78A 2E44A 2X1AA 1ZZNA 2RUGA 4QU6A 4Y00A 3S7RA 1R8PA 1JJ4A 1DHMA 4BS2A 3I55S 3TO8A 1VQ4S 1OWXA 1K73T 1JJ2R 1QM9A 2FHOB 2MKHA 2DHGA 3EGNA 2CQGA 4V19X 2DH7A 4PKDB 2XS5A 4YB1P 1G2EA 5GADU 5D77A 2HVZA 3THTA 3UCUP 2SXLA 1X4DA 1YTYA 2K8GA 1WHXA 2CQ3A 1WI6A 2OSQA 3MD1A 2CQ0A 2LECA 2NLWA 3CCUS 2DNMA 3B4MA 5GAHU 1WF2A 3CF5Q 1KOOA 2CQDA 2MB0B 1PO6A 3P49B 3DXBA 3BS9A 3DLLQ 3J7ZT 2DO4A 2MZTA 2ZJQQ 1U1LA 4WF9Q 2M8HA 1QVGR 1KQSR 1D8ZA 2KFYA 1H6KX 3S6EA 4P6QA 2DGVA 3NS6A 2LXIA 2N7CA 3CMAS 1JMTA 1FNXH 1VQKS 3SXLA 3CC4S 3G9CA 2J8AA 2AYEA 2M88A 4PRFA 4W90B 2VOOA 4YUDA 2LA4A 2X1GA 1KD1T 2CQIA 2B0GA 2E5GA 2LCWA 1SJQA 1N8RT 3US5A 2XNQA 3R27A 4QQBA 2VOPA 3V4MA 2MMYA 2MZQA 3G96A 2M9KA 3CC2S 1Q7YT 4TU9A 1U1PA 4CH0S 2M2BA 2E5HA 2N3LA 3CXCR 1N88A 2EK1A 2LYVA 2OTJS 2DO0A 4LIRA 5LSLA 2CJKA 2RS8A 2DK2A 1UFWA 4OZ0A 2LEBA 4CH1A 4WKRA 2D9PA 1Q81T 4IOAQ 2DHXA 2LMIA 4TU7A 3FEXB 4Y0FA 1SJRA 2L08A 4OZ1A 2FC9A 2HGLA 5LXYA 4C0OC 3PIPQ 2J76E 1VQOS 2CQ1A 2HGMA 2KHCA 4M5DB 2BZ2A 3UE2A 4QU7A 1P1TA 1WHWA 2KM8C 2RQ4A 2MQPA 1WWHA 1KC8T 2PE8A 3UCGA 2KYXA 5DM7Q 3U1LA 4Z2XA 3K0JA 1X5TA 3VALA 1DZ5A 3CULA 3G71S 2YH0A 2CQ4A 5EN1A 1VQ8S 3RW7A 1CVJA 1U2FA 2CPYA 3MXHP 5CYJA 1VC5A 1VQ9S 4ZKAA 5MLCV 2MKSA 2OSRA 4LJMA 3CCMS 2N82B 4F26A 1X4FA 1RKJA 3SMZA 2PEHA 3P3DA 3UD3P 1NU4A 5CA5A 2ADBA 4J5OA 4WFAQ 2CPIA 1VQNS 2JRSA 4IO9Q 2GO9A 2KG0A 1A7GE 2MGZA 3FEYB 1WG4A 5LJ3Y 3VAHA 3JB9k 1HL6A 1S79A 2O3DA 3TYTA 2DNQA 1WHVA 2RS2A 1FT8A 1U1NA 5LXRA 3PIOQ 2KVIA 1B7FA 2DGOA 1URNA 3CCJS 2DNGA 2DITA 2M0GB 3Q2SC 2L9WA 3L3CA 2XS7A 1FHTA 1W2BR 1JJHA 3NNAA 1YJ9S 2DNZA 2F9DA 3H2VE 3EX7B 2KRRA 2DGUA 2F9JA 2E5JA 4CIOA 1K8AT 2U2FA 1FJCA 1VQLS 2U1AA 5IM0A 4EGLA 4W92B 2DH8A 2RNEA 4C4WA 2AYGA 3CCLS 1ZH5A 1M5OC 3VAFA 2M4MA 2GHPA 2CQCA 1U1OA 2V94A 4TLQA 2M8DB 1VQ6S 3UWTA 1U6FA 3J7YU 2CQHA 2MZSA 2J0QD 2J0SD 2MJNA 1RK8A 1VQ7S 3CD6S 4F02A 2A3JA 2X1FA 3ZZYA 2LKZA 2YKAA 3H2UB 2QA4S 2MQNA 4WFNQ 2E5IA 2DHSA 4RU2A 5H1SV 4UQTA 3NS5A 1VQMS 3B4DA 2RU3A 2M52A 2RRBA 3S01A 5DETA 3NNCA 2VODA 3MOJB 3MDFA 4UY8T 2CPFA 3BO4A 2MZ1A 2DGQA 1WEXA 5FJ4A 2ZJPQ 3CMES 2M70A 2DNPA 2DISA 1UW4A 4IUFA 3I56S 3BO3A 2MY7A 3G6ES 4WCEQ 1IQTA 1M5PC 2MXYA 3VAJA 2ZJRQ 2CPXA 2JX2A 3P5TL 2CPJA 3R1LA
chains in the Genus database with same CATH superfamily
5E3QA 1VLYA 4Q44A 2W9BB 3KTQA 5ETQA 1WOPA 3CJ0A 2GQCA 3DLKA 2CUYA 1RDRA 4ED4A 2MY8A 2P2CB 1P9QC 1T11A 2KB2A 3BGRB 3LGNA 3DDKA 2ROPA 2KH9A 4MTPA 3NGRA 3KLIA 1R0AA 2VG7A 4RW6B 2RSQA 1YJNS 2RDJA 1FA0A 3IBWA 1FTRA 4NLVA 1VK8A 4YS2A 4B9NA 3DRPA 4F0KA 4K4SA 1JLCB 3IRWP 4GMKA 4HI2A 5DDRC 1U2RA 3TJ8A 3KNAA 3CD0A 4DMZA 4Q8FA 2L9NA 3QNWB 4LRAA 1RAJA 1S72S 5KG5A 4LIWA 1DBDA 4OLPA 2J7UA 3OFEA 1RQ0A 4FYXB 2APOA 1TELA 1PAEX 2R7TA 3K5LA 4O3QA 4FBTA 4LFBF 4K50A 2ALYB 2EFNA 5CYQA 2GVZA 1ITPA 4DCPB 5DDQC 2YKPA 2AEMA 2WAQD 2BACA 4YY3F 2MJUA 2XHWA 4DDFA 2D9OA 2QFJA 3QPIA 1X4HA 2F4VF 5A6WA 5HMXA 4LRDA 4KO0A 4RWWA 3HHNB 1XK8A 3I9ZA 5D4NA 4U6PA 4O3SA 2KKHA 4DV0F 3MM6B 2DY1A 3TQ1A 3JQMA 3UD4P 3BEGB 2EVZA 2LQJA 2J9CA 4X4UA 1FJ7A 1N56A 1WSVA 3J81Y 4K4YA 3NL0A 3CCSS 4PCQA 3DHXA 2CNNB 4U95A 2B9WA 3ZZ0A 2F40A 1CJVB 2QSFA 3CB4A 2I1RA 5HMYA 2XHCA 2NR0A 4ZVUB 1ZA2B 3EGNA 1VRQC 1WOSA 5KFHA 2QC3A 1H74A 1G2EA 5GADU 3O5TB 3GMGA 1LWFA 1YTYA 1EKRA 4FVCA 1SKUB 1RUSA 3B4MA 2Q66A 1FK9A 1NSQA 3P49B 3GYXB 5J1EB 1RAHB 1UMJA 1FERA 5GAEI 2OEKA 4NCAA 3FRYA 4PYAA 3ZTPA 1TVRA 3SSRA 3RBEA 2G0JA 2LDIA 4Q7AA 1H7WA 4X64J 4ES2A 3A8IA 3D1OA 3QT7A 2M2BA 3MEEA 1SV5B 3DCAA 3CIZA 4BDPA 3OHAA 3PNIA 4WKRA 4XO0A 2VPXB 1SJRA 3D5MA 5K14B 2CQ1A 4WE1A 1AYEA 4GRSA 2BKPA 5HLFA 2WSCC 2UU9J 4YR3A 2BQUA 1HQUA 5DM7Q 4LSLA 3NP5A 3KJQB 1REVA 3A3OB 5EWEA 4CLLA 4OHYA 3C14B 2MHEA 1X4FA 4KV8B 2AMCB 3JQJA 4QR2A 2CJQA 2QMUB 1KQKA 2JRSA 1RT2A 3K5OA 3LP1A 2GO9A 1DURA 4A8SA 4DN9A 2DHHA 3L4BC 1ZPWX 2IIHA 3A4TA 3T19A 1NKCA 1R6YA 1RWOB 2M0GB 2VBZA 3Q2SC 4C3MA 5SZTA 1UEKA 4RW4B 5KFUA 4NA1A 2IDEA 4DQSA 1A0OB 4KKOA 4FDFA 3EGWB 3VAFA 1Q0NA 5HROA 1J5OA 5EX0A 4DV1J 2HWTA 1VQ6S 4IFYA 3EDQB 2F5GA 4Y2KA 1FF2A 1VMBA 1WC4A 3CD7A 4CO3A 1FRHA 2BJ8A 1VQMS 4RW9A 4FYWB 1S10A 1NZAA 1FE0A 2W4DA 4MKAA 3LP2A 2MZ1A 1CJKB 2ZOGA 1HYSB 4J9KA 3PHTA 2W7OA 4AE5A 2YWFA 1GX5A 2Y0SD 3BO3A 1I94J 5FLXU 4WCEQ 3D7SB 4CLZA 4ETXA 2HHPA 2PI5A 4D3HA 2R8IA 3PW2A 1JLFA 4K4UA 1C1BB 4ZDNA 1KOHA 4OYZA 2R2SA 3M9OB 1BXNA 4M5GA 4LR9A 3PFEA 2I38A 2JH3A 2YNGB 3KUHA 4L3NA 2UVUA 2ZM6J 2D3OR 3IBCB 1EX8A 3M8PA 2GA7A 4B9VA 3T3FA 1UPMB 4XTTA 2BW7A 1H2VZ 3PG9A 1YJUA 3L7OA 2ZWOA 1DFDA 5IV3A 1F9EB 3ZZPA 3IGVA 3VQTA 2K7JA 3IR7B 1UJ5A 3OFHA 1HBNA 4PR6A 1RT3B 2ZH2A 3FCWA 3BGOP 1S0OA 1UWBB 4Q2MA 1B0VA 1CS4B 4PWUA 3SI8A 3ZNJ1 3G8SA 3K57A 2JEFA 4OJ1A 2PGCA 1NNDA 2IJNA 3TRGA 3D1QA 1HD1A 1NH7A 2Z0GA 2CPDA 3VGTA 2D3UA 4ZVEA 2C3OA 2XWYA 4A8WA 5KT2A 4I2PB 2AJ4A 1PC5A 8AT1B 1IM6A 3V6DB 2VJUA 5J2MB 2J9DE 4WJBA 2WHOA 3DM2A 4B08A 1YITS 1SCJB 4I2QB 1LKZA 5LJ5Y 3KOAA 2ZH1A 2XLJA 1HNWJ 4OYBA 2ZZMA 1LFWA 1FDAA 1XNRF 2R7UA 3QRQA 2HHHF 2QSWA 2DNKA 1I5OB 4C6AA 1XNQF 1I6JA 2YNFA 2XSFA 1DRZA 2F63A 4CQ1A 2B4OA 2KVQE 3EM1A 2P6TA 2HNYB 3D2WA 1S59A 4ID5A 1WKJA 4ANDA 4DN0A 1ZA1B 3H25A 3JYTA 2GHWA 3QRPA 2CG8A 2VIHA 1RWVB 4TY9A 4NRTA 2OH2A 4MK9A 4OX8A 1TL7B 5KFAA 1WI6A 1CC8A 5F8GA 4K4XA 2HS3A 4OQJA 4AXIA 1QDUB 2MZTA 3S6EA 2OP5A 2LXIA 2N7CA 2M88A 3R3TA 3B78A 2XNQA 3R27A 4WK3A 5LMNJ 3ONQA 5G0RB 4C97A 2CZ9A 2RHQB 1RU2A 1M1GA 1Q8LA 3UN2A 2AF6A 3HD2A 1S6PB 1RGVA 3T5JA 1KHWA 4JV1A 1RBAA 1S1WB 1F3VA 4OYXA 5KFBA 4RW7B 3HT0A 4QIEA 1CQMA 3T41A 1RA7A 2QMXA 1WC5A 2B6AA 3M05A 1VC5A 4ZKAA 3DGVA 3MEKA 4N5SA 1HBOB 2RHSB 5IC6B 3W8PA 2CJAA 3OV7A 2GIFA 1VQNS 4DZ6A 4OHXA 4NE9C 3OFGA 1X9SA 4OJHA 3LOUA 4LF1A 3UD5A 1DQAA 2KVIA 3MM5A 5B0AA 3BKFA 3V6HA 5E5NA 2UVWA 2R7VA 1XMQF 3ENWA 2AZ1A 1FRLA 4DZDA 5KG1A 3J81U 2WVCA 3MTKA 2BQRA 2GJFA 5D4LA 2G2ZA 3FZBA 1ZH5A 1X0PA 4Y2MA 1M5OC 3BQ2A 1PBUA 2BJ1A 1QD1A 4QJVA 2HMIA 1S48A 2J0QD 1VQ7S 2HSEB 3ZZYA 2GVDA 2WB4A 1T03B 2XMTA 4ICLA 1IBLJ 5KFNA 5BYQA 3N01A 2BXJA 2XGPA 4MIBA 1UVLA 1IBKF 3IMQJ 3TAQA 3RBDA 4PEOA 2M70A 3KNGA 4X62J 1HMVB 1UW4A 3BDEA 3F44A 3OLAA 3PDNA 2EG2A 3P5TL 5BYSA 1VFJA 1NB7A 4ANEA 4G65A 1UCNA 1RSCA 4ITSA 3WQPA 3E3XA 3EVOA 3CMQA 4MIAA 4URSA 1YJWS 1R8BA 3DI6A 1J2VA 3HPOA 3Q89A 1GNKA 6FD1A 1RAOA 1WOOA 1S97A 3W2VB 1HQEA 5CD4A 5H9FK 2Z2ZA 4A47A 4HT7A 5CXTA 4IG3A 3A8JA 5KG0A 4I64A 3ILLA 4DBQA 2JVOA 2KZZA 2P9GA 1BHNA 2FB0A 3G2XA 3L7PA 3BZQA 4C11A 5H9EK 4Q0BA 2A2CA 3DGPA 1WEYA 4WIIA 4PUOA 3PR4A 2WVEA 3GIMA 2DBBA 3LQVA 4CLYA 3GV7B 3ENAA 2JHEA 1FKAF 2I2YA 3QIPA 4JI0F 1MU2B 3TWZA 2EG1A 4U7UK 3ILIA 2JVRA 4PQUA 3G6VA 1IN0A 3ULHA 1RJJA 4B9UA 4WZMA 3M2RA 2C1EB 4FPRA 3R97A 3I0SB 1OSCA 4K2XA 4WFBQ 3AOAA 5HJXA 1VC0A 4ED0A 1YWXA 2IJRA 3DOLA 3V81B 3ZZTA 5E41A 1J5EF 1NSAA 1T0TV 1V3ZA 1NMEB 3FZ2A 1WEZA 2KN4A 3AB4B 1S1TB 4RUCA 1DTQB 1RISA 2B8QA 5K5MA 4K8RA 2F8MA 2AV5A 5B0EA 1Z2ZA 1Q95G 2ROGA 1CJUB 5A8RB 4RR5A 3R6LB 3OTOJ 3CJ4A 3AAWB 4ED8A 3HVAA 3J7YI 4ZHRA 2MQQA 3AXKA 3QBCA 2OIHA 2ADCA 4DJBA 2DHAA 2J7KA 2FY1A 3OD2A 2VC1A 2W2MP 4JB8B 4M5IA 2BJ7A 1JKHB 5DS7A 3PVXA 5E2QA 5AXKA 2G2YA 1DHMA 1JJ2R 4DR3J 1T9UA 4QIGA 1IKWA 2PC6A 4JI2J 1IKVB 3BGLA 2HHUA 3WX4A 1HNZF 4URQU 5K8OA 4Y2AA 2DNMA 4D3GA 3DLLQ 2YXLA 1RTIB 2B43A 3TJ9A 2GGPB 4P74A 1RKIA 3D6TB 5CQGA 5HVHA 3US5A 4TY8B 2X3DA 3W61A 2MZQA 2M9KA 5D8HB 3VGVA 3CXCR 4XIUA 2V68A 1K0TA 3C6UA 5JUMA 3KLGA 1Y9OA 2LEBA 3R5CA 3MMCA 4TU7A 3D67A 4USVA 4NCGA 2AGQA 2R8HA 1S76D 1BUXA 4USMA 4C0OC 4CLUA 3I87A 3KJVB 3HMJG 2RB7A 4ILLA 4J91A 1HI1A 3U1LA 1X5TA 3GFYA 1DZ5A 3D54A 1YLXA 3H7HB 3HSZA 4F26A 5LSRA 3UD3P 3AB2B 2DVIA 2OPSB 3GB0A 5KT4A 3NXZA 4CI0B 2UZAA 5M2RA 5LXRA 3FDSA 2A6OA 2DGOA 3PKMA 5C24A 3IP0A 2OAUA 3CDAA 1L3TA 3HFVA 3NNAA 2C3PA 2VHGA 2KRRA 2DGUA 1K8AT 5J2NA 3TUPA 4JBCA 4OX7A 1LW2B 3TA1A 2KZMA 4QWCA 4NZ7A 1D09B 3OTBA 3ETMA 3BYRA 1SBRA 3NAIA 4PQAA 3UDVA 3H2UB 5I42A 2HQFA 3AODA 4U7CA 3K58A 4Q45A 4JI5F 2D7SA 3TAMB 1G4CA 3QWUA 2RQKA 1FDBA 2VODA 3MOJB 2CADA 4LFBJ 4XAKA 4ZCKA 3MHYA 1PSDA 1VS3A 1P9YA 2I5JB 3X1LB 4DR6F 2R2TA 3HD1A 3KKFA 4YY3J 1QJHA 2CG4A 4TU8A 2MQMA 3OUYA 1KBRA 3TQEA 3PRDA 1WNEA 4H4MA 3A12A 1N36F 3M7VA 2F4VJ 1KSPA 1YI2S 1X7VA 4ECSA 3PO4A 1VLOA 2BEFA 4ZIWA 5B0DA 4R8UA 3C66A 1H2UX 2AIRB 4DV0J 4DL0C 5BJRA 2BOPA 3HSGA 1KDNA 4DF4A 1WF1A 4YB5A 1RHQB 1M1KT 5KG6A 3M8RA 3HP6A 2QLBB 2OHDA 2JZ5A 3CPWR 5CD4H 2KO1A 4LBPA 2YY3A 3NCQA 4TLRA 2OPQA 3AA9A 4PG4A 2WSEC 3FSIA 1EP4A 1PBAA 4NEZA 3TZZA 2KTQA 1LWCB 1IWAA 1SL0A 1X0FA 1FRJA 3VAGA 4DSKA 2NQPA 1ZS6A 3SYZA 3I32A 3QT8A 2HFZA 1KQGB 4WYLA 3OPKA 3ITHA 2CAJA 3ZZZA 2EBGA 4GO5X 4DLEA 1EQ0A 2YNIB 5LT5A 2UV8G 5MAOA 4JP8A 3A1YG 1BY9A 4JI6F 2AKWB 4X4RA 2FJXA 2ACYA 2KXHA 3RW6A 1O0PA 3PCOB 1JWWA 3GTYX 3OLBA 1HWIA 3JTNA 1T9WA 3MR7A 2O5DA 2HAIA 3IR5B 2MHNA 1PILA 1KN6A 2NXCA 2F65A 1BE4A 3MURP 1GXUA 3Q8QB 3DRRB 2VZ9A 1VBXA 3IRXA 3MCOA 1AZSA 2WVFA 2DPJA 4F2SA 1GQEA 1HNIB 4O3RA 2ZC4A 3OSNA 1VDHA 4W98A 2XS5A 4YB1P 4L74A 5FD1A 1WHXA 2YWEA 1MLAA 2I8EA 2O1PA 1AW0A 4MFBB 2E5LF 1NZ8A 4ZN3A 2QRRA 4ED2A 2F8EX 2W8LA 2HHQA 2WOMA 3NS6A 1ZM2A 1JMTA 3BSCA 2CDRB 1O6XA 2Y8WA 1N33F 1VR6A 4U7UD 1FDDA 1VCTA 3W7BA 2GX8A 1FI4A 4LSNA 3BSOA 4KFBB 3DLJA 2EK1A 2LYVA 3M4XA 1H3DA 2DRBA 1B7YB 5KFIA 3UR3C 5D0RA 2HNZA 1SPBP 4BC7A 3MM9B 1VISA 4P7VA 3UE2A 1RLCL 2QL9B 3GILA 2NXNA 3UCGA 1KFDA 2UUWA 3LALA 4LR7A 4L6V3 4WP3A 2ZH3A 8RUCA 3AH6A 5K8NA 1RYRA 3MR5A 2HFNA 2W4PA 4ZVFA 3SFUA 5JXSA 3HT3A 3RB6A 4UTGA 4BHQA 1MSWD 3K8WA 1YDLA 1RKJA 1R0AB 4CRJA 3SMZA 2J5AA 2RAQA 3P3DA 3D9BA 3NMAA 1TKDA 2XULA 4NOHA 4H4OA 4CTAA 2XSJA 3SQOP 4ED1A 5L1JA 3MCNA 3H4DA 3GFZA 2VB6A 3ZTRA 2HVIA 3QSYB 3A8EA 4EYHB 5EGYA 1TK0A 3DMJA 3DNCA 2XS7A 4OMFG 2GFFA 4KQZA 1QSYA 1HHQA 2C28A 4I1TA 4IRKA 4CIOA 2WCXA 4KE5A 2QLXA 3N4WA 2HHXA 2IYIA 4NLXA 3E01A 1U1OA 3Q0AA 2CQHA 2EXUA 4DCOB 3TX8A 2X1FA 2CKWA 4IDKB 3C46A 2GVZB 2RKIB 3TEHB 5F9LA 3D1HA 2B9XA 4LF4F 4WKYA 2FJAB 2V34A 4C8MA 3EGVA 1WEXA 4ZCMA 1TUVA 4ZLNA 5EWGA 3KK3A 4UF4A 3O1LA 2HAFA 1IQTA 4PYDA 1C0TB 4KYZA 3MAAB 3C15A 3BR8A 3W66A 3UO0A 1RHKB 4AL7A 4KSEB 2VPWB 3CDBA 3KG1A 3KG0A 1JQGA 1XNRJ 1FX2A 1UJ4A 2HHHJ 1SXLA 3KHHA 3LA0A 4WWSA 1XNQJ 2IVYA 3L95X 5A8KB 1FO1A 1FWKA 1TU0B 4C8OA 2MGZB 4LFAF 3EXYA 1OPIA 2YH1A 5LMUF 1N5YB 1RBOB 2DGXA 3PX0A 3WX8A 1VBZA 5IQQA 4CNZA 3DDIA 1S9EB 1FK9B 1LOUA 1Q5VA 3MPYA 1A6LA 1T9XA 3PYGA 3M6XA 1SJ1A 1S5ZA 1TVRB 2VFRA 1T05A 3PX6A 1PCAA 3NY0A 4F7VA 1YJTA 2CZ4A 3MWBA 3SV3A 1NH8A 3DOKA 2XQCA 3FFIA 3UCZP 3GJSB 1NJIT 2IVMA 1E6YB 2HQCA 3HVTA 3BKUA 1LWEA 4CO4A 3GYGA 1M5VC 4I6YA 2R2UA 1RT5B 3HCXA 2IAJB 2VUGA 1E6VB 3MMBA 1IUJA 2HQDA 1U6BA 2CVEA 2E1AA 4Y2IA 2ASYA 1FXRA 2F7VA 1SL1A 1ACMB 4WTOB 3HDSA 2YWKA 2HNDA 3IC1A 2ZH4A 2L3MA 4CZCA 2XGQA 1MMDA 2VONA 3OW2R 5AE3A 5I3UB 4YDDB 1TL3A 1HWKA 4RW8A 2WRMA 3TVYA 1GX6A 1RT2B 1YRUA 4X66F 3LUYA 3LPYA 3LP1B 1LQ9A 1OY8A 5E3PA 1U09A 4DPWA 2FVCA 1Y5NB 3OVSA 3KLHB 1OIAA 2D1CA 1U8WA 3P8BB 3F56A 1VBKA 1N0VC 2XYGB 5T7LA 3RBXA 4HTIA 1PAUB 4ENOA 4NEYA 1IKYA 2W9CA 5KFMA 2HVZA 2FHKA 3T6BA 4KKOB 2ZWPA 1K0VA 2LECA 4LREA 3DLGB 2QA1A 4CO5A 1XMQJ 4G1PA 4YMEA 1QVGR 4IFYB 2E1MC 2Z57B 1RT1A 2K1RA 1HWLA 4ELUA 1PYSB 2R7QA 4E8UA 2BW2A 4NX9A 3ET6B 3SQGB 3HVWA 2AYEA 3O2IA 1Q1KA 4JI3F 4TVAB 4DF8A 2VOPA 2HFUA 2HK2A 3KLVA 4X4NA 3M2UB 2EFOA 3M32A 1XR5A 2DK2A 4OZ0A 2Q43A 4P2SA 3PZPA 2DHXA 1IR1A 3FEXB 2R3VA 1CG2A 1IBKJ 5LXYA 2CZVC 1JLFB 4ILMA 4R5PB 3CDUA 1B70B 4M5DB 2HHVA 3BBFA 4N77A 4RWXA 4CCHA 2N7YA 1VI7A 4DQRA 2JLFA 4Z2XA 4NLGA 2YH0A 3OR1A 2KL8A 1GMWD 1LXJA 2R9LA 2A1BA 3A13A 1KLMB 3CCMS 1NK8A 2YKMB 3R6GB 3KMQA 3JSYA 3GP9A 3PYDA 3MPWA 2DPIA 2CPIA 3KK2A 1CJTB 4F4XA 1EKSA 2CWXA 3EJMA 4RX6A 1N6QA 4AQYF 3ADAC 2JSXA 3LTOA 2DRDA 1EJ7L 1RTJA 5D6GA 4LF5F 2HRYA 5HBMA 1C4CA 1HBNB 1P8GA 4KHPF 4Y34A 2DNGA 2DITA 2AEJA 3QGHA 4ER8A 4ZVSB 5L39A 3AHPA 4K0KF 3N5BA 3H2VE 2E5JA 3VQSA 5DJBA 2ZVSA 5IM0A 3FUYA 2AYGA 4FKXA 1XMBA 2M4MA 4OIXA 1NB2A 4HACA 4FF1A 2E9TA 4CLFA 1S0VA 3JSMA 3J7YU 2A3JA 1TKXA 4N76A 3MAQA 1N5VA 1WUUA 3NRBA 4JI0J 5F8NA 1EETB 4WFNQ 3Q23A 4G6VB 3AQOA 4QOTA 3D3CJ 3NGDA 1KEKA 2KYZA 2HEKA 3J7A1 3IS9B 3QGGA 2FZCB 3OXGA 1RWKB 3HHEA 1RWMB 3CMES 4DL5A 4WK1A 3W5ZA 3DRXA 2HK3A 4QW9A 2MY7A 1QUPA 4Z7CA 1T95A 1WKKA 1NDLA 2Y3YA 2G4BA 2OFGX 3C8YA 4PXCA 4R25A 4LT6A 3W5YA 1J5EJ 3U1NA 4YR2A 5CZXA 1U1KA 4NMXA 4LF8F 4K59A 4V19J 2FYXA 1Y5LB 3KUEA 4OZNA 1YGYA 2PDAA 1FVSA 2KG1A 3CNQP 4ZLLA 2OD6A 2XS2A 1TQLA 4LR8A 1RWWB 3Q8SB 5KT7A 2PSZA 4ID5B 3HKWA 1U25A 2FJBB 2JC0A 2ZUAA 2NREA 2XCPA 3FSYA 3DU5A 1H2TZ 4C0BA 3H0PA 2JFKA 3H59A 1S49A 3PHEA 4N8OA 4C2MA 1UEVA 1P1LA 5CAAA 1M5KC 1H38A 4DXLA 2GIRA 3GZ7A 3BDPA 4DI6A 1HNZJ 4HHJA 2CQBA 1IBCB 3JQKA 4NPOA 1NJWA 1FFSB 2G1DA 5KFFA 1VGYA 2HZCA 1OYEA 4RZRA 1T9VA 1S6OA 2HFOA 2H5EA 3H42A 1WC1A 2ZE2A 2I6WA 1TK5A 4ED5A 2OI2A 3QZ8A 4H4KC 3CJTA 1S57A 4QR1A 3DYAB 2XWXA 2CJXB 2Q79A 1QE1B 1XWLA 4A8XA 3OFFA 4M5HA 4IR1A 4NLDA 2CFXA 2LXUA 3Q83A 1FD8A 4X65F 1TMJA 4USWA 1VHFA 3SDEB 4IRCA 2B8PA 3FNNA 2QEXS 5KFSA 2HVEA 5J1PA 1ZTTA 1HI0P 1Y4ZB 4QIWD 4O0IA 4YQWA 3KHRA 3EE3A 2LFVA 4E2FB 2DTJA 5DLGA 3TUIC 2EC2A 4WP8A 2E44A 1JX4A 2GMHA 1NDCA 2VA2A 3S7RA 1RWXB 3I55S 2C3UA 4HDHA 1HWJA 2D3O1 1HWUA 3K5PA 1SL2A 1XERA 3UNYA 5DGAA 1C0UB 3EPIA 2E1CA 5EHHA 4E0DA 3CJSA 1CPZA 4GKJF 2G13A 1QAYA 1KS2A 2PA8D 1FRXA 3J7ZT 4KJIA 5H9FJ 1TR0A 1SQFA 2LXFA 1JLGA 1NK7A 3N79A 3AJDA 3JTOA 2E5GA 4QQBA 1OMSA 1UPPA 5H9EJ 1UA1A 3OL9A 4WFXA 1HNVA 5LSLA 4JI5J 1T3NA 2PO4A 1K1QA 3WHIA 3MPUB 2D41A 2VFVA 1U0HA 4OZ1A 4HTJA 1Q8IA 4DR6J 1RTHB 2DXDA 5DG8A 2AU0A 1KP6A 4NCBA 2W9BA 1RWPB 3GFXA 2VD3A 3VALA 2DR6A 3MECB 1N36J 1CBKA 1RHMB 3HFZB 3I5BA 2GAHC 3QT5A 4QWEA 3BGRA 1CEZA 2H48B 2EWHA 5CABA 1FX4A 4FF2A 2ZKTA 1X9WA 3CDEA 3IN5A 2J9EA 4ZMMA 3EDRB 4RW6A 4NXMF 1WHVA 2MLXA 2IM2A 5L1KA 1U8SA 3EZUA 1S1XB 4YHHF 2JC1A 1LW0A 5CCLA 4Q0BB 2KJWA 3DGPB 1T94A 2B7BB 1JLCA 3OSPA 2OKQA 4OL8A 1TAUA 1IXKA 3G87A 1VRUB 2AJFE 1V5IB 3UI3A 2PI4A 2BA9A 1NXIA 5LM7E 2BJ9A 3HF5A 3QYYA 1MWYA 1SIZA 3L7UA 2ZFHA 2VG5B 2XBPA 2YKAA 2QA4S 4MYTA 4Z7YA 3M2RB 3HHKA 2M52A 2HZAA 4F50A 3ZZOA 5KT6A 2Y1IA 1AROP 2UUBF 2ZHBA 4ID8A 4F4ZA 4JI6J 1F2HA 4DV3J 3MCMA 4P2FA 2Z30B 3NLCA 2MKJA 1HI8A 2Y8YA 5U47A 2AD9A 1N32F 2PN6A 4U8YA 5M2PA 2QYCA 5HVFA 2GJ2A 1ZOTA 3MM6A 3V6KA 4LF9F 1X4BA 3CCVS 5EWFA 5AT1B 1QVFR 1L3KA 2V9KA 5T14A 3CD5A 4ZP9A 2Q6BA 3DHWC 4HH0A 2WVDA 3FBEA 4ZP8A 3TX0A 3O44A 4DV2F 3HZGA 5E3CA 1WDTA 1ZTWA 2YNHB 2ZZNA 5E0OA 2V2KA 3CWJA 3QGPA 2AYMA 4MYUA 5J1EA 2BOAA 4DX7A 4IOCQ 2E5LJ 2GJIA 3HI9A 4IG0B 5C5JA 2C3YA 5CYMB 3DKDA 1N33J 1URRA 3F41A 3PKYA 1RI7A 1SUQA 4NCGB 5HL7Q 3GIIA 1BQNA 1RWUA 3MEGB 3S1TA 1SV5A 3PXGa 1FWPA 5C25A 1YRXA 4JV0A 3SZ2A 3HVRA 3BM7A 3DRSB 5KFZA 3QGIA 2QZ8A 3G8QA 4FYDA 2OGUA 1YHQS 3RZAA 1RT6A 3U7JA 2B9YA 4EBDA 3N28A 2QLWA 2PIIA 4HH1A 1Z4UA 2BUNA 1RABB 1FEEA 4L72B 3M8QA 2ROEA 4P52A 2DR9A 3RRGA 1F9FA 5DDOC 4KV8A 3VTIA 3P4UB 3QJLA 2RF2B 4HR2A 5L46A 1WKLA 3ZZUA 4ZJLA 2UXDF 2ZVIA 2ZHOA 4Q5VA 3VR1A 2J6SA 2MDAA 3NBPB 1K73T 3DU6A 4ZPVR 1VQSA 3M8WA 1AXQA 3CJ3A 1UVNA 1U49A 4GC7A 4F0MA 1LK5A 2WW8A 2LU1A 1OPZA 2OFHX 2J6TA 2BQ3A 4RW4A 5DO2A 3FQKA 1PKUA 2V50A 5BXIA 1KFSA 1FE4A 1W2IA 3ENVA 2Y1LB 2J8AA 5F8MA 5M2UA 2VOOA 5I42B 4X4VA 3SCLE 4NLUA 1SJQA 4ZPDA 1AB8A 3T5HA 2CA9A 2BE7D 3PACA 2E5HA 2OTJS 4P72A 3GFHA 2RS8A 3J7AN 1NK6A 4LF4J 4DL2A 1CJKA 4C98A 4Y65A 2L08A 5C2CA 5B09A 2ZH7A 9RUBA 2BYCA 3HM9A 4C8NA 3BF4A 1C1BA 1SVDA 4ZVRB 2MQ8A 1FKPB 4M94A 4LFCF 4ZLPA 3G71S 2WZ1A 2QT7A 3MFIA 3SCKE 4B9TA 1L3SA 3JAMY 3CJKB 4ED6A 4DL4A 1RAEB 2HIYA 1NU4A 4WXOA 2BKOA 2LQ8A 5KOXA 4DFKA 3MMAB 1RHUB 2FVQA 4CYUB 2FVSA 2O3DA 3F0NA 4ECTA 4LFAJ 2CIMA 3H5SA 3LF0A 3D68A 1NDPA 4TYBA 2AEFA 5LMUJ 4K2JA 1URNA 1NJZA 3TA0A 2XZWA 3W9HA 3L3CA 4I6WA 1IBMJ 2JFDA 1NPKA 3IA0A 3UDEA 2IY5B 5HQMA 2YWWA 1RT3A 1K47A 1RT4A 3OR2A 1C2PA 1UWBA 2RILA 1CS4A 2CJ9A 3KDOA 1EIYB 3ITHB 3M9MB 2W24A 1TL1B 5KT3A 1HKAA 3M6VA 3V5RA 3CD6S 5BYRA 1FWLA 3SCIE 1YBUA 4DX8H 2JEGA 2JL9A 1VQYA 2V4RA 3PYEA 4ES3A 1FXDA 3ELHA 1S0MA 2HHSA 1YJRA 3HFKA 3BO4A 3HSDA 4TN2A 3OXLA 4I2PA 3FBBA 3OQ2A 4KGKA 2DNPA 2K06A 3V6DA 3V4IB 5J2MA 4X4TA 3THVA 3GCXP 1U0SA 4DFPA 2ZBQA 3OVBA 1JLBB 2V2QA 2V6AA 1Y3KA 2V4QA 2LLZA 3G8TA 2VL1A 2YQ3A 5B0CA 1RE1B 2R8GA 3Q8PB 4CT9A 4EZ9A 3J81j 3IWXA 4KRWA 2RRNA 1W25A 2EK6A 1U1MA 3IRXB 2VPYB 4J37A 1OY9A 4X66J 4L75A 4ED7A 2YTCA 3MM8B 3R5AA 2HNYA 2L41A 3TUZC 5I3QA 5KFVA 1UAWA 1KRPA 1FXLA 3POTB 1NHVA 3OTCA 3DLBA 2KU7A 3VAIA 3GIJA 2DRAA 1S6QB 1GMWA 3CCQS 5HI7A 2AT1B 2KXNB 1SC6A 5A2QY 4JYAF 3MAHA 3KLFB 1RHRB 3AFGA 3SSSA 4B17A 3A3NB 3GV8B 4OHVA 4K4WA 4DSIA 1WG1A 3OT9A 3P45B 4FP9A 3ISNC 4JI3J 5G0RA 2HNZB 4P2MA 3VAKA 4WPAA 3E51A 3GJRB 2FDNA 3MMJA 2A10A 2YKOA 1VHIA 5DG7A 1MMLA 1TAQA 1OO0B 2RIJA 2O01C 3MPVA 2EKYA 2DGSA 2VU5A 1GAOA 1S4EA 3JXOA 3C6TB 1VBYA 3QO9A 1AUSL 1RADB 2IVFB 2W2NP 1S1WA 5IS2A 4RW7A 5KG3A 4N8NA 1RT7B 4ECVA 3OTEA 1O5JA 5I4MA 1D0EA 1HBOA 2RQCA 1N54B 4MK8A 4CTAB 1UP1A 4NMLA 3PV8A 3RU0A 4M5MA 3CCES 1Y10A 2DGWA 5G4DA 4ELVA 3DMJB 4QU6A 4Y00A 3X3UA 4RUAA 4AQYJ 3GE9A 4USTA 4LF5J 3L09A 2XO7A 3RRHA 4KHPJ 3QFHA 2BE2B 1RBLA 1SC3B 4JI1J 3TEGA 4K0KJ 2Z2LA 4TXSA 4ANCA 3QJPA 1QLNA 1NLKL 2FJWA 2KFYA 4URGA 1FFGB 1HPZB 7FD1A 5L1IA 1T7PA 3BSAA 1YRTA 2X1GA 4L3KA 2AGOA 3HKZD 2BABA 4OYIA 1R6VA 1T9YA 3Q8YA 1ZM4A 1Y0HA 1Q7YT 1GXTA 5ETRA 1D1UA 5FIIA 1T03A 2UXCF 2CJKA 3GCWP 1G7CB 2OMLA 2QL5B 2V8GA 4NLYA 2HGLA 2LQ9A 2KHCA 2ZD1A 1WWHA 3JSRA 3NGKA 1PYOB 3PR5B 1BD6A 2XI2A 3KHLA 2VBXA 4ECQA 2HWHA 4ALZA 4DPOA 4LF8J 1XIQA 1TV6A 2BM1A 1LNQA 3VWSA 3N5FA 4YDXA 5J2QB 4WBFA 2VKRA 4DR4F 3ETOA 3RAQA 4J5OA 3D66A 1PC4A 5K20B 1HHSA 1PG5B 1VYAA 3W2VA 2FD2A 3TVZA 4HLBA 1TFWA 3T5LA 1TTHB 3UQSA 4EO8A 1FHTA 5F0WA 4NA3A 4LBIA 3LANA 2RNEA 5B08A 1U48A 4KGMA 1R7IA 4ZITA 3H5UA 2QN6B 2H51B 4USKA 1MU2A 1LWEB 2RMLA 3TAPA 4B3TF 3W9IA 1Y11A 3AY0A 3C16B 5B0GA 3EUNA 4YEAA 1D9FA 1SQGA 1L5UA 2GZOA 2L9DA 4IUFA 3RAMA 1EB0A 1GMUA 2CRLA 4RNHA 2ZJRQ 1Q4RA 3FMBA 3HSJA 3R5DA 3V81A 2MPUA 4B3SF 3BBBA 4QYZK 1FRIA 2W7AA 3IG1B 2Y1RI 1KWMA 5KAKA 2ZBCA 4X65J 1S1TA 3CCTA 3MI7X 4EBCA 4TYAA 3I6PA 5KG2A 1DLOA 4X4PA 1CJUA 2KRBA 4QPTA 1ZZFA 3H40A 4MT1A 2IPOB 2FC8A 2PFDA 3M1VB 5EDWA 2OJ3A 3BPSP 1X4CA 2KDOA 3SBMA 1NDKA 3FK4A 5T7LB 1WC6A 4RUHA 4FXVA 4DWIA 2F8HA 2XY6A 3N6LA 2M7SA 3PFOA 4FYYB 2ZITA 5T41A 5K9FA 5HATA 1Q8KA 1B99A 2KHDA 5JVHQ 9ATCB 1RTDA 3JAMU 4BWMA 1IKVA 3Q8VA 4DV7F 2NPIA 3D0HE 2DR7A 1R8HA 2HBZB 5D0HA 3M8ZA 4AFFA 4GKJJ 4HEA9 2OLWA 1ZYQA 1RTIA 2BJDA 2VDHA 5F0UA 2GGPA 3GSIA 4KPCA 2HHWA 3TANA 4TY8A 4DR1F 4KHRA 3BREA 2DNLA 1U45A 3ZC4A 2AJ1A 5IC4B 4ECWA 1VQ5S 2UUTA 3ZTOA 1D9DA 2H1YA 4MAKA 4EYIB 4KAIA 2IRUA 1WSRA 4X4OA 4DV4F 3GONA 3DFEA 4CO2A 3H2LA 2NYHA 4MK7A 3KJVA 4HDGA 2GV1A 3B8HA 4NLTA 3OR1B 2J0WA 2XG8A 1JB0C 1BQMB 2DNNA 3NGSA 4RL1A 4B3OB 1S0NA 2YKNA 3G86A 4PG5A 5HANA 3CJQA 2F4FA 2RE1A 4F36A 1CQNA 1YJVA 2OPPA 3FCVA 4HHUA 4YOEA 3HXMA 4AT1B 2KT3A 2E29A 3EVWA 1BMQB 3CCRS 2V69A 5IWAF 3OL7A 4DV5F 4ZPAA 1BWVA 1FJEB 2HQGA 1OWXA 3H4BA 2FUG9 2FHOB 2MKHA 5LL6d 4NXMJ 1MROB 4V19X 4ZVOB 2RUSA 1JNZB 2W01A 4ZLJA 3THTA 3SFGA 4YHHJ 2SXLA 4P10A 3MD1A 3CJ8A 2MLZA 3M6WA 4HACB 2RQMA 2FVPA 1NUEA 1KQFB 1DTTB 2BM0A 5KFYA 1PO6A 3DXBA 3I96A 4KGZB 1LW2A 4A46A 3G9CA 3TA2A 4PXDA 3GR1A 4J9QA 4FXDA 4JOUA 2LCWA 2B3TB 2BE9B 3IXQA 4M5NA 3V4MA 4DR2F 2NZCA 4K5RA 3G96A 1U1PA 4CH0S 3L9ZA 3TAMA 2DO0A 4LIRA 2XMUA 2R7WA 2B7CB 2ZC3A 4DX5A 5A2QU 1FD2A 2WSFC 3PJWA 1JLAB 2YVSA 2I5JA 2K2PA 2PMZD 5L1LA 2UUBJ 2NSBA 2RJZA 2NXJA 1IVZA 2CWKA 2CQ4A 2N4CA 3RW7A 1N32J 1GFWB 1U6ZA 4USUA 1YX2A 1NK0A 5F9NA 2YBVA 1T9TA 2CJBA 2IBKA 1KLNA 1MG7A 2BJEA 4LF9J 2ATCB 2QFIA 5LJ3Y 4CM0A 3D4JA 1F3FA 1HL6A 4J9LA 1S9GB 3LWMA 1MW7A 2E7XA 4ATNA 7FDRA 1QAJA 1IKXA 1U47A 2V4JB 1VK3A 5HVGA 3PW5A 4DSJA 4NXNF 2I0XA 1OJ4A 2AWZA 4MH8A 3AT1B 4DV2J 2U1AA 2OPRB 4OX9F 5HMZA 3K5NA 3R2DJ 1HQ2A 1LWCA 1X8DA 3H90A 2CQCA 1R0BG 4RPFA 3QAEA 1VRTB 4GO7X 4YB6A 4PWDB 2YX1A 3UDLA 2C2MB 4OZLA 5FDLA 5THWA 4ECZA 5KFXA 5D4PA 2ZJPQ 3DLEB 3BN7A 3O3LA 3GG0A 5KTQA 3FRZA 3I56S 3CDWA 2J7WA 3R5GA 2BVZA 2YX4A 1IJEB 5SUHA 3I82A 4F0HA 1UTAA 4M5KA 2CQPA 2JDJA 3HJFA 2HQ3A 2LEAA 5I3PA 1S6UA 2J8SA 2YPZA 2HVDA 3QMQA 2MSTA 5GAGU 2IM3A 1P6TA 3M2VA 3DRRA 4XDCA 2GMLA 2MQLA 4J7CA 4K5SA 1S1UB 3HO1A 2VQEF 2UXDJ 1T8EA 3V2UC 4PPDA 1HNIA 2AGPA 2JLEA 1O51A 1XN9A 5GMKa 4OJ3A 4LQ9A 5AXMA 4UOCA 4Z37A 5ETVA 2MZRA 4JUZA 4RLEA 1R31A 1HLWA 2LP4A 1VQPS 4OZ2A 2HKEA 3G82B 4O23A 3GJTB 1WG5A 3TZWA 5HO4A 1TKTB 2FJVA 1Z1ZA 1X5PA 1JK9B 4QWAA 2XM3A 3OHBA 2OELA 4KFBA 4A8MP 2AHOB 2BKNA 3MUTP 4O44B 3LP0B 1U0HB 3VF0B 5KFJA 2F3JA 4LF7F 3FGVA 4IO1A 1D9AA 3OJUA 4EMDA 1HA1A 3MM9A 4RBTA 4AD6A 4B9LA 2RVJA 1IQZA 5AE2A 2ZDOA 4EWTA 1YIJS 3RTVA 2B5JB 4N56A 4DPUA 4LFCJ 3UVJA 4OX6A 4QIFA 2VQFF 4F04B 2FLPA 3W62A 3ZZRA 3U02A 1LW0B 1JJ4A 3TO8A 3ZFVA 1GEHA 3TZYA 1F2GA 2DH7A 3RB3A 2K8GA 1W7WA 2XLIA 4IFVB 4KH0B 2IA6A 2CQDA 4FN5A 3BS9A 2IFXA 1GTHA 2ZEJA 1FKOB 3GSDA 2DGVA 3SXLA 4GVLA 2CNLB 4WFZA 4P2XA 4JI7F 2HRUA 2XCAA 4IDKA 4DX6A 6AT1B 2RKIA 1N88A 2GMJA 3IBFB 3PTWA 4DLGA 4QW8A 3R5JB 3LPEA 5IQ6A 4DG1B 3V6JA 3KHGA 1Q81T 4IOAQ 3VGSA 4Q8EA 2NYIA 3GU0A 1SC1B 3MR6A 4Y0FA 4BWJA 1X60A 2RH3A 5KT5A 3KK1B 3BKTA 4QU7A 1C0TA 1P1TA 3MAAA 4PAAA 4XDDA 1Q53A 4PG6A 2PE8A 1BGXT 4H54A 1RWNB 3HHLB 3QLHB 4I4BA 2NPFA 1RAIB 2EC0A 1CULA 4LRBA 4DQPA 4HT5A 4I67A 2N82B 1S99A 1RB0A 5B0FA 5A8KA 1PJ7A 2B4PA 4P71A 3TVKA 2MGZA 4GVBB 3JB9k 3QQCD 3ICLA 3RRKA 4WIQA 1N5YA 3T1AA 1HIYA 2RS2A 5D4OA 1HW8A 3FCHA 4DU8A 3CSKA 4G3IA 5IZHA 3P96A 4DR5F 1YJ9S 1S9EA 1ZM3A 1QAIA 1NSPA 1ZM9A 2U2FA 1VQLS 4IYQA 3QJJA 3MM7A 4I7FB 1Y3JA 4OI3A 3CO9A 2C2OB 2Y1JA 1TKZA 3Q8UA 2BX6A 2Z2MA 2V94A 4JYAJ 3M30B 5A0YB 5D15A 1K1SA 5CH7B 1SUQB 1BQNB 1E6YA 4NASA 3S01A 3PJ9A 1XR7A 5C25B 3EZ5A 2AJQA 3FBFA 2R2RA 5IOLA 2JOQA 1RT5A 2IAJA 4G1QB 1E6VA 2ATLA 3SCJE 1OY6A 1O8BA 1QUVA 2R42A 5CHCB 1RT6B 4UY85 4DV3F 2K3IA 3M6UA 1X5OA 1J27A 5AJ3F 1X4AA 2CPZA 3DOMB 5GAHI 3M8QB 1HBMA 1YKWA 1WD6A 4NI2A 5I3UA 1RAFB 2XMKA 1SJ3P 2B4VA 3NS7B 4KT0C 2KT5A 3LAMA 4IOBA 1V6HA 3KLEB 2QO3A 1NAQA 2JNJA 2B51A 5HQLA 3U1MA 1JLEB 4HKQA 3IGNA 3KLHA 4ZN1A 1GMVA 4I6AA 2HVHA 3C3LA 2UUAF 3GQCA 3NCPA 5GMEA 2PMWA 1WTFA 3M8YA 1KHVA 4PWWA 3EXCX 2DCLA 2OEMA 3DLGA 4ZPWR 1HBUB 5D3GB 4CLSA 2WBRA 4FKYA 1WC0A 2BANA 3ET6A 3SQGA 3R7SB 2A0FB 2PD1A 4BBYA 2QMWA 4FYVB 1Q5YA 4C8LA 3G6YA 3BGFA 3K8VA 4IKAA 1WACA 4YR0A 1NK5A 2XMWA 3D0IE 4RNOA 3M2UA 1R43A 4NA2A 3CE8A 2UXCJ 4WU3A 5C42A 1RCOB 3K59A 1UKUA 4ERDA 1K44A 4IH7A 4R5PA 4M5DA 2MZJA 1TP7A 3UFCX 2ZBIA 4XPEA 1I51B 2DNRA 2ZDPA 2PA3A 2CQ2A 3DLKB 3GG1A 2UP1A 3ILOA 1F60B 1AFJA 2RDDA 2C2EA 2XTJP 2CYYA 3EVMA 4PABA 4OZJA 2QIFA 3WC2A 1KLMA 2WB1D 5KFCA 2ASDA 2YKMA 3T9ZA 2MTLA 3T1HF 3NNHA 3MTJA 1UL3A 3KLIB 2EI5A 2VG7B 1WHYA 2XLKA 1CJTA 2WONA 1HARA 4DR4J 2JEIA 3OXFA 2NUUG 4OI2A 2OMOA 4C8ZA 2BDPA 1B0TA 1QM9A 4EBEA 2C42A 3DRPB 1NKBA 3CO0P 5BR8F 1KONA 3FKBA 1S1VA 2HPUA 4FPIA 1RT4B 3UCUP 3N6MA 3OR2B 3K2YA 1DQ8A 3PW7A 1JJCB 2QJ3A 4EK2A 1R8AA 3A3PB 2AQ4A 1KOOA 2E7WA 4CLWA 5C2GA 4NLRA 2ZZTA 4WF9Q 3ZTQA 1H6KX 2VKZG 4DV6F 3LH2S 2KFNA 4OYMA 2RD5C 2LA4A 5HMWA 4WTYA 3RR7A 4P73A 2V2VA 2VFTA 4F8RA 2J0XA 1EETA 4ECUA 1VIOA 2FGOA 3CC2S 1W26A 5CYQB 1F1BB 1KR4A 4B3TJ 3IS9A 2EFGA 2XY7A 5F8IA 4F3OA 4C9DA 3MCSA 4KO0B 2D74B 3NGUA 5IT0A 4B3SJ 3K0JA 4ZJOA 5EN1A 2OO4A 3VZHA 1KVJA 1VQ9S 2NSCA 4KGXB 1ICEB 1LEOA 3IFEA 2OEJA 1JIHA 1ZETA 1NBEB 5CA5A 2ADBA 3CCZA 2DY9A 2X51A 4M95A 3FEYB 4Q2LA 4ZCIA 4OYPA 2C22A 2FGCA 4O0NA 2HBYB 2A6MA 1WJ9A 4AL5A 3TZXA 4DL3A 1U1NA 3NGTA 2H54B 1G1XA 2B9EA 1IBMF 1LWFB 2IM0A 4C8KA 4DOZA 1UEUA 4GKKF 3FEZA 2XMJA 4W92B 1ZPVA 3LWLA 3QATA 4DV7J 1DQ9A 4OI0A 1QSSA 2UV8A 1IR0A 1PJ5A 1RU1A 1FDNA 4A8FA 1XBWA 3M9NB 2J0SD 4F02A 4DSFA 4B3RF 5F3ZA 2DYAA 1UFLA 3MEEB 4C48A 4ILRA 4DR1J 3MDFA 4UY8T 4DUYF 2D3ZA 3UW1A 3QO9B 4NLQA 4K4ZA 4WE1B 1WC3A 3DYAA 3B54A 3VAJA 2FLNA 1VJWA 2CPXA 5HLFB 1QE1A 3GPAA 1IM4A 4OI4A 4PXBA 5KFKA 1HQUB 4DV4J 1B4SA 3GIRA 4LSLB 3SDEA 4DUZF 2V0NA 1A9NB 4EFAC 1REVB 4J9VA 3TP2A 3HLUA 1OYDA 3TJAA 2IMOA 1TMMA 2HG4A 2R7SA 2COLA 4MJKA 1R0CB 4MKVA 5GVQA 2G0CA 4UUWA 3O6QA 5IWAJ 2DB1A 2EPIA 4DV5J 2P9CA 1Q86T 2CPHA 5ADZA 2AYBA 3R2CJ 2EW9A 4RO0A 1FJGF 2EFVA 1JLQA 1C0UA 1FTCA 5ETSA 3CCWA 2EKNA 3AJ1A 3GLJA 5HROB 1J5OB 3NOGA 4ZK7M 3QWPA 2BBEA 4N7TA 4U9RA 2FLLA 4ZP6A 2H5JB 2YPYA 5K8PA 2DR8A 3AD7C 2UUCF 2V2ZA 5IFMA 3NEKA 3J7Z5 4NYPA 4RW9B 4P9SA 5HN0A 1U26A 1X4GA 3LP2B 4DR2J 1GH8A 2R7XA 4J9SA 3FC9A 4W4MA 1HR0F 2X1BA 2AX0A 3THPA 2H4YB 2ZD1B 3BH6B 2O66A 1N4LA 4OHWA 5IT9Y 4DR7F 3CC7S 4QPXA 3R5BA 4ZVHA 3S8SA 3IWNC 1LFPA 1RTHA 2NXEA 1HNXF 3TARA 2A18A 1NEEA 1TV6B 3W65A 5A8WA 3BO2A 4CP5A 3MECA 1M90T 2P8IA 1YK9A 2HS4A 5E7OB 3OL8A 4JI4F 3M8PB 3PEHA 4QYZJ 4YFUA 4KY3A 1IWGA 1X5SA 5D78A 1ZZNA 3OVAA 1C1CA 2FY8A 3KYLA 1X31C 2RDIA 4BCAA 2GAGC 4FNHA 2V5HG 3IR6B 3OJSA 1S1XA 2ZUGA 3K89A 3PYFA 2ZOFA 5KFLA 5EUHA 2UXBF 4NLWA 1OQ3A 1XMOF 1N34F 2CQ0A 4OV1A 4JI1F 2X3GA 3LO3A 4NXNJ 5KFDA 4OZ5A 1C4AA 3MEDA 3T9NA 1XJWB 3W5XA 5KOWA 2FHMA 4A8YA 3D3BJ 2HFSA 1D8ZA 1VRUA 3AD9C 5F8JA 4OX9J 4FVMA 4TKTA 2H3EB 4IQXA 2CVIA 1S9FA 2UVVA 3BQ1A 2VG5A 3DN9A 3E8OA 5LOQA 4LUBA 3FJ2A 2VJVA 4YP3A 1DY3A 4JI8F 3PM9A 3AQPA 3VZIA 2BV3A 3DM2B 3H98A 2DCUB 3I0RA 2YQ0A 3W2WA 4OYAA 2FHJD 1ZAVA 2VBWA 3GWCA 2KYXA 5L9NA 3Q22A 1DLOB 1FNMA 3IAS9 3CULA 2HLUA 3DXSX 3RR8A 3IM8A 3MXHP 5DZ7A 4TQSA 2YNFB 4ZIVA 1X9MA 4CO0A 2VASA 2LQBA 2FQQB 3FQLA 4AXJA 4R0EA 3C2PA 4O4RA 2DNQA 2HQIA 4TQRA 3JYTB 2CXEA 1MN9A 2FVRA 1RTDB 5HK4A 2E1PA 3CCJS 2BR0A 1CSJA 4F67A 2VQEJ 1JJHA 2Z4PA 2DNZA 2F9DA 2G9OA 3AOBA 1SIWB 2YNHA 1UVIA 4WU2A 2B4UA 2QL7B 2R4FA 3CCLS 3MFHA 4Y6IA 1FRMA 1Y00A 4NYZA 3UWTA 2MJNA 2LKZA 4KBIA 1U4BA 4FZVA 5H1SV 4CLPA 4IG0A 5CZVA 5CYMA 2QGFB 3MOZA 2V8PA 2RU3A 1SB6A 3UN3A 2XZTB 3GV5B 3NNCA 2DGQA 1RZMA 3MEGA 4I56A 4I0WA 2E7VA 2DISA 4FS1A 5IT4A 4NZ0A 4IRDA 4LF7J 2LU2A 4FS2A 2AJ0A 3DRSA 2VA3A 4J9PA 1S12A 2YKNB 2AX1A 3QZ7A 4O4GA 1OS5A 2OTLS 3UDCA 3VHQA 2OPPB 5F41A 1N48A 2B6AB 5AXLA 3R8YA 1L3VA 2NZ4A 1TZ0A 2ZKUA 3WBZA 4LVNP 1XEZA 1UZDA 4UT4A 2XYPB 3W8GA 5ETTA 4E98A 1GK8A 2C2NA 3DDNA 2VQFJ 1SJ4P 2RF2A 3SIPB 1GXLA 4DQQA 2MLYA 1SH0A 1MN7A 4RBUA 2KI2A 5HP1A 3ISZA 3MM5B 4ZVPB 3NBPA 5RUBA 4HHHA 4FF3A 4B3MF 2EFQA 1RLDA 4K4VA 2IC3A 3CTRA 2HGNA 3KG4A 3H20A 4X4SA 3RGIA 2G1HA 2KM8B 4O3PA 3QT6A 5D0GA 3K7RA 4F25A 4XPCA 1H73A 1HD0A 3R1HA 2HMIB 4J9RA 4L76A 2DKOB 4CDIA 2GVDB 5DM6Q 2Q3PA 3ENQA 2XMAA 1UVKA 3NAHA 2GCFA 1LWXA 2DH9A 2P6SA 5J2PA 4OYOA 4JI7J 1VC6A 1RXOB 4ICLB 5C7PA 3PRVA 3WIVA 4DS4A 2GQQA 4DL6A 4RNFA 4USIA 1WELA 4FNIA 4KR0B 3W9JA 2B56A 2VG6A 3Q8RB 2HYIB 3EYZA 3GJQB 4A8KA 4I68A 4MKYA 4OFZA 2LQ5A 5KFRA 5GAEU 4QR0A 4J9MA 1N5QA 3N6NA 4QIVA 1FKPA 4F4KA 1Q82T 4RJVA 4JV5F 1Q79A 2RRAA 2DD8S 4IH5A 1R3NA 3DI6B 2IJFA 3JTPA 1NSKL 1R89A 3RBZA 4DHVA 3CJKA 1WI8A 1TUWA 1MMNA 2ZH5A 2R7OA 1HQEB 3MMAA 5LSOA 1IKXB 2E9ZA 3M8SA 3PRBA 4IG3B 4CYUA 4FBUA 1R8PA 1KKHA 1VQ4S 1OSDA 2VFUA 3G6XA 2HZVA 4PKDB 4KGVB 5KFTA 4K4TA 2XYHB 4HL9A 4C11B 2M5YA 2KJVA 2OSQA 4KTQA 4F4YA 4ZOSA 3R7BB 3CCUS 4PUOB 5GAHU 4C3KA 4DR5J 2UVRA 2DO4A 3MF5A 2ZJQQ 2VICA 4M5LA 2Z56B 3BH7B 2AW0A 3QIPB 3CMAS 2WW4A 4PRFA 4W90B 4YUDA 1TL1A 4DPTA 2Q1LA 2L48A 4A4JA 3IWLA 2WK4A 2B0GA 1N8RT 4PQUB 5FDLB 2KT2A 4NLOA 2CNKB 1KTQA 5DLFA 4NLPA 4TU9A 3D6HB 1G3OA 1F5AA 4ETZA 2D9PA 2KFZA 2BRLA 4F4WA 3DOLB 2J76E 3V4IA 2HGMA 2VDIA 2JEJA 1U24A 3PJXA 4CWBA 1KC8T 4OYWA 1JLBA 2G0IA 5AJ3J 1AA1B 4ES1A 4OLOA 2POKA 2V63A 4B02A 2W2OP 4LBHA 2ZH8A 5MLCV 4ZHRB 1F5BA 3ZXWA 4LJMA 3M2VB 4YB7A 1REGX 4P7TA 5IT9U 2QLFB 4EEYA 4WFAQ 1U7LA 1M0SA 8ATCB 2YQ1A 1A7GE 2KG0A 3VAHA 2NCKL 3MM8A 1PIEA 5HSPA 3RYLA 3NCRA 1ULRA 2IRYA 5JMNA 1FNOA 3POTA 1CJVA 1IKWB 4TNOA 5DQIA 2UUAJ 4IR9A 1QSLA 3WIUA 1W2BR 2W1BA 1S6QA 5IXUA 3R9LA 1G6BA 4PXEA 1XR6A 4EGLA 2W8KA 3KMSA 3BQ0A 2ASJA 4LF6F 7AT1B 4QWBA 1YZ7A 3GR0A 3H5XA 2FZGB 1ELOA 3KLFA 3EZOA 3BGUA 2CNOB 2M3DA 3BBCA 3T1YF 2VBYA 4UOGA 4RU2A 1CLFA 3HHLD 3NS5A 3B4DA 4BC9A 3C6UB 5KFPA 3KLGB 1V3RA 1Q8BA 3SEOA 1SC4B 3MMCB 2OUGA 3FVYA 5D0EA 5DZ6A 1QY7A 4HVZA 1M5SA 5DRKA 2BRKA 5J1NA 3TOQA 1P27B 2CPJA 4I69A 3R1LA 2FIUA 4NZ6A 3C6TA 3D0GE 5K14A 2C2RA 3D6MB 4CLTA 3MR2A 5ITHA 1YBAA 4ZP7A 5HQ8A 2MEWA 4X84A 3UVJB 3JSBA 1Q16B 2XNRA 2A2DA 2MSSA 1RT7A 3O8WA 2HURA 5A76A 4U67Q 5ETPA 3C14A 3EPGA 4WYWA 4AUKA 5L38A 3T1HJ 4ZPCA 1S4FA 1YVFA 3OTDA 5HAOA 3BSNA 2VF3A 2O67A 3N9UC 1WF0A 1PGZA 1SH3A 5C24B 3QFWA 3VGUA 2JWNA 2V8DA 2Q6CA 2XI3A 1XQIA 2GC8A 3U27A 5BR8J 4K7QA 3KJNB 5J2NB 2BE2A 2FJDB 3MZIA 3HHLC 2ILZA 3UNGC 1B64A 1N5TA 2ZNYA 1HPZA 4OZ3A 4DV6J 1NJXA 4DL7A 3RAXA 3G4SS 2BMBA 2RT3A 4OI6A 5GAGI 3PEJA 1I3OB 1EAYC 1JNRB 5KG4A 3FBCA 5ETOA 2R7RA 1UETA 2IA0A 1AUDA 2VH7A 3IM9A 2IM1A 1HYSA 4EUVA 3OUYB 3NG8A 3H5YA 1NO8A 2LA6A 4H4MB 1MNEA 1YBTA 2ERRA 4MIWA 1CULB 1B3TA 2DNOA 1MWZA 2C3MA 4IH6A 4R8UB 1RCXB 1ZAXA 2VV5A 4FXWA 4M8LA 4C0HA 1RHJB 2LDYA 2GHVC 4C3LA 2NS1B 2DNHA 3PY8A 4QCLA 5J2QA 2YNGA 4MMOA 3UR0A 3BN4A 2XZDB 4NL5A 5CCMA 4DFJA 2YX7A 4KH1B 5F3TA 2YWHA 4U96A 2HBQB 1YJ7A 5D77A 2OPQB 4C8YA 3W1YC 2HWIA 3MM7B 1EP4B 1TL4A 1NK9A 4S0MA 1TKZB 2IDLA 1U1LA 4GKKJ 4KHMA 4P6QA 2C2ZB 3GYNA 3CC4S 4ELTA 2DXEA 1QTMA 2QLJB 1UA0A 1VJQA 4OI1A 1V9OA 2Z8QA 3CJ5A 4DU7A 2N3LA 4YN3B 4B3RJ 2QTWA 3C16A 4X4QA 6FDRA 1VOMA 3IO1A 3SV4A 3W3SA 4ZS6A 4O3OA 5A6PA 4DUYJ 1NJYA 1QTNB 1VQOS 3NKYA 1HBMB 3ISND 3AOCA 2RQ4A 1N5SA 3LGMA 5DQGA 4I2QA 4NI2B 3IG1A 1KNZA 3FMWA 1CVJA 2GQ2A 3I9V9 1U2FA 2CPYA 5CYJA 4DUZJ 4WFYA 3E2EA 2H65B 3EICA 4IO9Q 1AZSB 1YG0A 3M1VA 3T6JA 5DGBA 2C2DA 1S79A 1YSJA 3BR9A 2GS8A 1T02A 2XMMA 2CDQA 4EI2A 3PIOQ 1D8YA 4M63A 4DCJB 5E33A 1WORA 3QIDA 1TFYA 2G2OA 1D3WA 2CJYB 3K17A 5KFWA 3I4HX 3NWRA 4DSEA 1FJGJ 2F9JA 1JXEA 3TR5A 1TL7A 2WBMA 2DH8A 4C4WA 1UW9A 2BANB 1Y7PA 2WOMB 2N4DA 2V9WA 1AT1B 1EHWA 3F73A 4Y2CA 1FFWB 4X64F 2Z58B 4PZVA 2MZSA 1RK8A 3BYPA 2VPZB 1N0UA 4LSNB 3DRYA 4CM2A 2DHSA 5JJBA 2UUCJ 5F8LA 3CJRA 5C42B 1ZBTA 3HULA 2ILYA 4KPYA 3BPDA 1SKSA 2EEYA 2FZKB 2ZOMA 2PMHA 3NWGA 3WZ0A 1OQ6A 2UU9F 1F5CA 1S6PA 2W25A 1RA6A 1HR0J 5L8RC 2YKQA 2Y9HA 3RJMB 3PW0A 5GADI 1RAAB 4WZQA 1S7IA 2DIVA 1U02A 1GT8A 4DR7J 2CPEA 2J6UA 4JV2A 1XC9A 3P5BP 1BQMA 4B3OA 1HNXJ 4USJC 3TNVA 1MWQA 5ETKA 1NM2A 2XO6A 2HRTA 2J9DA 4PG7A 1EZZB 2GO8A 3IAM9 1CC7A 2WONB 4ECXA 5KFEA 4ZVQB 1M1HA 3AJ2A 3VAMA 4N41A 4LF2A 2H5IB 4JI4J 2ZBRA 4H4OB 2XSJB 1TK8A 3RB0A 2DNYA 5DG9A 1N52B 3ZO7A 1S1VB 4OJGA 2FHJA 4CLKA 2W2PP 1RTZA 1FEHA 1MROA 1JXVA 4H4KA 3NMRA 1F9HA 1RYSA 4GC6A 5E3AA 1LK7A 1UFKA 3HZEA 2UXBJ 4DV1F 4EO6A 2KXFA 1XMOJ 1N34J 1U2CA 4L73A 1DTTA 3D6FB 3BJYA 4P75A 2Y0BB 4CNYA 3E01B 2QX0A 1T3OA 3OBIA 2N3OA 5B0BA 1NRKA 1SQEA 3Q86A 3EMTA 2QA2A 1PYTA 4QZVB 4G1IA 2AZ3A 2H9ZA 1EARA 4F3MA 2E9RX 2R8JA 1UVJA 2QA4G 1I94F 4Q43A 3KK3B 3VVTA 4JI8J 5KFOA 1JLAA 3MD3A 2FPHX 3LAKA 3EWGA 2IRXA 1ROFA 3C15B 1HMVA 4MKBA 2HBRB 2DIUA 4UOFA 2PEBA 1K9MT 4RUBA 1FCAA 1Z2LA 1IJFB 1VIXA 5ETNA 2XC9A 3GIKA 2ZM6F 4F4AA 1U1QA 2ACMA 1UZHA 3TUJC 1SH2A 4ECYA 3LW5C 2MQOA 3H8YA 3J80Y 2JLGA 3Q24A 2W9AA 1AFIA 3VCDA 2HIQA 3MUMP 2X1AA 2RUGA 1S9GA 5AE1A 3CT9A 3ZTSA 1F0XA 4ED3A 2DHGA 1NHKL 2IHR1 3MR3A 3KFWX 3PW4A 2V4JA 4LVOP 1FESA 2LEPA 1L3UA 1SI9A 4ZVTB 1WF2A 2MB0B 2OPRA 4DPYA 1T05B 1KQSR 2FJEB 3KUGA 1VQKS 3C19A 4HI1A 3DOKB 4RKUC 2CQIA 4UQGA 3FFIB 3UPFA 2NUHA 1VRTA 2NXUA 4X2BA 3HVTB 2C2KB 4NRUA 4PWDA 1M5HA 3QAUA 2PT0A 3MMBB 2LVWA 1UFWA 2EFPA 4KB7A 3DLEA 5EX3A 1DJ0A 2FC9A 3I0SA 1HNWF 3VVUA 1WHWA 4DPXA 2MQPA 4AL6A 2HNDB 5ETLA 4DS5A 4LSZB 5GMDA 4HYKA 1TL3B 4RW8B 1DTQA 1NK4A 2W2QP 2WVBA 3VV2B 3AD8C 2ABYA 4ZJQA 1NCLA 1KVKA 5A8RA 2YWGA 1RAGB 4ZPBA 1WG4A 3WDOA 4Y3CA 4N47A 4J9NA 1H98A 2I9SA 1FT8A 5L9XA 1IKYB 1R8CA 1S1UA 1JKHA 3RB4A 2W9CB 1NPRA 1JLQB 2X7IA 2V8HA 2L9WA 3DC2A 2QE5A 1H7XA 5DQHA 3JS9A 4LRCA 4B3MJ 2AP6A 1B0PA 3EX7B 1FJCA 2DXFA 4KC5A 4DFMA 4NWBA 4A8QA 1RT1B 2K1RB 3G82A 3NOCA 1BC6A 5LMNF 1HW9A 4TLQA 2M8DB 1U6FA 1TKTA 2XEXA 4R0JA 4QYRA 3KXDA 2E5IA 2ZBPA 1H0HB 2V67A 3BV8A 2VFSA 2RRBA 4DUTA 3M32B 5B7WA 2CPFA 4F2RA 4CT8A 4O44A 1SKWA 2ZNZA 2RU9A 3LP0A 3B6BA 4J9OA 4CO1A 1M5PC 2MXYA 2JX2A 3MPDA 3W63A 2XB2D 1WDDA 3RG6A 5A8WB 4B9SA 2MKCA 5F8HA 3TW0A 1HHTP 1Q78A 1V5VA 2B5JA 1NPPA 2ALZA 2DJWA 3MUVP 2MKKA 4C7QA 1V3SA 1NKEA 4PG8A 2E1RA 4FF4A 4LRFA 4JV5J 4OV6A 3KK2B 3AXMA 5IV4A 1N6QB 1C1CB 1UWAA 5AXNA 2HS0A 2GNKA 2OPSA 4J90A 1SKRA 2MKIA 3CVKA 1RTJB 1U1RA 5HBMB 4ZPTR 3N0VA 4V1Ak 1IR2A 3ZNUA 3BB5A 4LMZA 1KTVA 4WP9A 2BJ3A 4A48A 2DGTA 1XTZA 3MEDB 1LXNA 3T5KA 1X4EA 5IM0B 1HFEL 4UZBA 2MYFA 3CUNA 1KVIA 3HK2A 4IFVA 3CEDA 4QBUA 3P6YC 3D28A 1ZAWA 4EZ6A 1FKOA 2V8VA 3JSMB 2VC0A 3PO5A 1SJFA 1S77D 1TKXB 5ETMA 5DDPC 4AYBD 1H72C 3KWMA 3OL6A 1FVQA 1IBLF 1NHUA 3CIMA 5KG7A 2HFVA 2AJ2A 1YZ6A 4F3QA 1LV5A 2GW8A 4X62F 1WTBA 4UOHA 3K5MA 3Q2TC 2R8KA 1DARA 4DG1A 4LQ3A 3HHDA 3I0RB 3W2WB 5JVGQ 3DLHA 4A8OA 1TL5A 4NLSA 3KK1A 4KIAA 2DT9A 2K3KA 1QAXA 3HHLA 3QLHA 4WXWA 1Q7LB 4EU0A 3EGZA 3A8KA 4O3NA 3CGIA 1GTEA 1RACB 4UW2A 2ZH6A 2H4WB 3LGHA 4GVBA 3HX9A 1F6TA 3CW2C 2OD4A 4BS2A 4UZCA 2HLTA 4IQMA 2F1FA 2P9EA 3HJVA 2IMWP 2CQGA 1JXLA 1PJ6A 3I5CA 4ZCLA 1X4DA 2CQ3A 4USHA 2NLWA 4BLGA 3I31A 3CF5Q 3R7NB 2IBOA 1I1GA 2M8HA 4I7FA 4M5JA 3TI0A 2D69A 4XK8C 1FNXH 2Z2YB 2DR5A 5FLXY 1KD1T 4LF6J 3M30A 5A0YA 1RP5A 5KFGA 3UN5A 5K8MA 2ZE2B 2MMYA 4CH7A 3T1YJ 1BQXA 1TUGB 2HW3A 3W60A 2YNIA 4NYOA 3SSQA 3WC0A 2QV6A 5HJYA 4CH1A 4ZVGA 5KFQA 2LMIA 2WTFA 2FTRA 4G1QA 2W7PA 3FSXA 3ILJA 2IYGA 2K7KA 3PIPQ 2BZ2A 4O4GB 2MKYA 4ECRA 1YQHA 4UUXA 4M1KA 2KM8C 1FRKA 1UVMA 2ZHAA 3DOMA 3I4PA 2E66A 3OTOF 4OHZA 4QWDA 2XMVA 1VQ8S 4RU9A 2GIQA 2ZH9A 2QYGA 3KDNA 5E3RA 2MKSA 3MGJA 2OSRA 4DSLA 3QRRA 3RUBL 2PEHA 3AA8A 3QSIA 3KLEA 2HHTA 1DAXA 5HP1B 1JLEA 2W4CA 4J9UE 3TYTA 4DR3F 3I5AA 2DEJA 3B82A 2IC3B 1EQMA 4JI2F 1R27B 1B7FA 2PFFB 2EBEA 4RBVA 3J80U 1BWEA 4PPZA 1Y5IB 4U8VA 4Y28C 4B9MA 1HBUA 5D3GA 1JLGB 1APSA 2GHPA 2ASLA 4MFBA 2QG9B 4DQIA 3KJFB 3PX4A 3W64A 1S7HA 5J2PB 2DEIA 3CJ2A 2MQNA 4UQTA 1HNVB 4ZA1A 5DETA 2P5VA 1BLUA 5FJ4A 1UJ6A 4RNMA 2VG6B 2FLOA 2XY5A 2JJ4D 3G6ES 4RNNA 4DEZA
chains in the Genus database with same CATH topology
2MPUA 4B3SF 5E3QA 1VLYA 2YKNB 4Q44A 1FRIA 2AX1A 3BR8A 2W7AA 3IG1B 3QZ7A 2W9BB 3KTQA 4O4GA 1OS5A 2Y1RI 4KSEB 4AL7A 3UDCA 2OTLS 5KAKA 3CJ0A 2OPPB 5F41A 2GQCA 1N48A 2VPWB 3DLKA 2ZBCA 1S1TA 2B6AB 3CDBA 3CCTA 5AXLA 3MI7X 4EBCA 3KG1A 1RDRA 1L3VA 3KG0A 2MY8A 4TYAA 2NZ4A 1P9QC 1TZ0A 3I6PA 2KB2A 5KG2A 1DLOA 1UJ4A 2ZKUA 4X4PA 1SXLA 3WBZA 3BGRB 3LGNA 3KHHA 4LVNP 2KRBA 4QPTA 3DDKA 1ZZFA 2ROPA 2KH9A 1XEZA 4MTPA 2IVYA 3H40A 3L95X 5A8KB 1FO1A 4E98A 2FC8A 4C8OA 2MGZB 4LFAF 3M1VB 5EDWA 3DDNA 2OJ3A 3KLIA 1SJ4P 1X4CA 2KDOA 1R0AA 2RF2A 3EXYA 2VG7A 1OPIA 5T7LB 1GXLA 4RW6B 4DQQA 4RUHA 2YH1A 2RSQA 4FXVA 5LMUF 1N5YB 1YJNS 2RDJA 1FA0A 1SH0A 4DWIA 3IBWA 4RBUA 2F8HA 1FTRA 2XY6A 4NLVA 3N6LA 2KI2A 5HP1A 2M7SA 3PFOA 3ISZA 3MM5B 2ZITA 5T41A 3NBPA 1VK8A 5K9FA 2DGXA 3PX0A 4B9NA 4FF3A 1VBZA 4B3MF 3DRPA 2KHDA 5IQQA 2EFQA 1JLCB 4CNZA 4K4SA 3IRWP 4K4VA 5JVHQ 4GMKA 2IC3A 4HI2A 1RTDA 3CTRA 4BWMA 2HGNA 3KG4A 1S9EB 3H20A 1FK9B 5DDRC 1IKVA 1LOUA 4X4SA 1U2RA 4DV7F 2KM8B 2NPIA 3D0HE 4O3PA 2DR7A 3MPYA 1R8HA 3KNAA 3CD0A 1A6LA 3K7RA 4DMZA 4AFFA 4F25A 3M6XA 1SJ1A 1TVRB 2VFRA 4HEA9 1T05A 4XPCA 4Q8FA 2L9NA 2OLWA 3PX6A 1RAJA 1S72S 1HD0A 1RTIA 3R1HA 1ZYQA 2HMIB 5KG5A 4LIWA 4J9RA 1DBDA 1YJTA 2BJDA 4OLPA 2CZ4A 2J7UA 3MWBA 3OFEA 5DM6Q 2Q3PA 3SV3A 1RQ0A 1NH8A 5F0UA 2APOA 3DOKA 2GGPA 2R7TA 3ENQA 3FFIA 3K5LA 1UVKA 3UCZP 2HHWA 3NAHA 3TANA 1NJIT 4TY8A 2GCFA 2IVMA 2DH9A 2P6SA 4O3QA 4DR1F 5J2PA 1E6YB 4KHRA 3HVTA 4FBTA 4LFBF 4K50A 1VC6A 1LWEA 3BREA 4ICLB 4CO4A 2DNLA 2EFNA 5CYQA 1M5VC 1U45A 3ZC4A 4I6YA 2R2UA 1RT5B 2AJ1A 5DDQC 2IAJB 2VUGA 2YKPA 4ECWA 1VQ5S 1E6VB 2UUTA 2WAQD 3MMBA 1D9DA 2BACA 4DS4A 2GQQA 1IUJA 4MAKA 4EYIB 4DL6A 1U6BA 4KAIA 2IRUA 2CVEA 4USIA 4RNFA 4YY3F 2E1AA 2MJUA 4Y2IA 1WELA 2XHWA 4FNIA 4KR0B 2ASYA 1FXRA 4DDFA 2F7VA 2D9OA 2QFJA 3QPIA 2B56A 2VG6A 4X4OA 4DV4F 1SL1A 3DFEA 3Q8RB 2HYIB 1X4HA 4CO2A 3H2LA 3EYZA 4A8KA 4I68A 5A6WA 2F4VF 5HMXA 4MK7A 4KO0A 4RWWA 3HDSA 4HDGA 3KJVA 2GV1A 4MKYA 2YWKA 3B8HA 4NLTA 3OR1B 4OFZA 3HHNB 2J0WA 1XK8A 3I9ZA 5D4NA 2XG8A 2HNDA 2LQ5A 4U6PA 3IC1A 1JB0C 5KFRA 2ZH4A 1BQMB 5GAEU 2L3MA 2DNNA 4QR0A 4CZCA 2XGQA 4J9MA 1N5QA 4B3OB 1S0NA 1MMDA 2YKNA 3G86A 2VONA 3N6NA 4O3SA 2KKHA 4QIVA 1FKPA 4PG5A 3OW2R 4DV0F 5AE3A 5I3UB 4F4KA 2RE1A 1Q82T 1CQNA 1YJVA 3MM6B 4YDDB 2OPPA 4JV5F 1TL3A 1HWKA 4RW8A 1Q79A 2RRAA 4YOEA 3TQ1A 2WRMA 3HXMA 2DD8S 3TVYA 4IH5A 1GX6A 3UD4P 3BEGB 1RT2B 1YRUA 2EVZA 2KT3A 1R3NA 2E29A 3LP1B 3LPYA 3LUYA 1LQ9A 4X66F 2LQJA 3DI6B 2J9CA 2IJFA 5E3PA 3JTPA 4X4UA 1FJ7A 1R89A 1U09A 3CCRS 1N56A 4DHVA 3CJKA 1WI8A 5IWAF 2FVCA 3OL7A 1Y5NB 3OVSA 3J81Y 4K4YA 3KLHB 4DV5F 4ZPAA 1MMNA 2ZH5A 3NL0A 2R7OA 1OIAA 3CCSS 1HQEB 4PCQA 3DHXA 3MMAA 2B9WA 3ZZ0A 5LSOA 1IKXB 2D1CA 2F40A 3M8SA 2E9ZA 3PRBA 1FJEB 4IG3B 4FBUA 3F56A 1R8PA 2QSFA 3CB4A 2I1RA 1VQ4S 1OWXA 1N0VC 1OSDA 3H4BA 5T7LA 5HMYA 4HTIA 2NR0A 2FUG9 2FHOB 2MKHA 5LL6d 1IKYA 1MROB 2VFUA 3EGNA 3G6XA 4V19X 1JNZB 5KFHA 4PKDB 2W9CA 1G2EA 5KFMA 5GADU 2HVZA 3SFGA 3THTA 3O5TB 5KFTA 3GMGA 4K4TA 2SXLA 4HL9A 4C11B 2M5YA 2FHKA 1LWFA 1YTYA 3T6BA 4FVCA 2KJVA 2OSQA 4KTQA 4KKOB 4F4YA 4ZOSA 3MD1A 1K0VA 2LECA 3DLGB 2QA1A 3M6WA 3CCUS 4PUOB 2RQMA 3B4MA 5GAHU 4C3KA 2FVPA 2Q66A 4CO5A 1KQFB 1FK9A 1DTTB 2BM0A 5KFYA 1PO6A 2UVRA 3GYXB 3DXBA 3I96A 5J1EB 3P49B 2DO4A 4G1PA 3MF5A 4YMEA 2ZJQQ 1QVGR 1UMJA 4IFYB 2E1MC 1RT1A 2K1RA 1HWLA 1FERA 5GAEI 4ELUA 2R7QA 1LW2A 4E8UA 2AW0A 2BW2A 3QIPB 3CMAS 4A46A 4NX9A 3SQGB 3G9CA 4NCAA 3TA2A 3HVWA 4PXDA 2AYEA 4PRFA 3GR1A 4W90B 3FRYA 3O2IA 1TL1A 4YUDA 4J9QA 4FXDA 2Q1LA 1TVRA 2L48A 4A4JA 3SSRA 3RBEA 3IWLA 2WK4A 2B0GA 4JOUA 1Q1KA 2B3TB 2LCWA 1N8RT 4JI3F 4PQUB 4DF8A 2LDIA 4Q7AA 5FDLB 1H7WA 3IXQA 2VOPA 2KT2A 4NLOA 3V4MA 4DR2F 1KTQA 4ES2A 4K5RA 3G96A 3D1OA 5DLFA 4NLPA 4TU9A 1U1PA 4CH0S 2M2BA 3KLVA 4X4NA 3TAMA 3MEEA 2DO0A 1SV5B 4LIRA 2XMUA 3M2UB 2R7WA 1G3OA 2B7CB 1F5AA 2EFOA 3DCAA 3CIZA 3M32A 1XR5A 4BDPA 2DK2A 2ZC3A 4OZ0A 4ETZA 3OHAA 2Q43A 1FD2A 3PNIA 2WSFC 4P2SA 2D9PA 3PZPA 2KFZA 4WKRA 2BRLA 2DHXA 4F4WA 3PJWA 4XO0A 3FEXB 3DOLB 1CG2A 1JLAB 1SJRA 2VPXB 2YVSA 3D5MA 2I5JA 2CZVC 5LXYA 1JLFB 4ILMA 2J76E 5K14B 3V4IA 2CQ1A 3CDUA 4WE1A 2HGMA 4R5PB 2JEJA 2K2PA 4M5DB 2PMZD 1U24A 2HHVA 5HLFA 5L1LA 2WSCC 4N77A 4YR3A 2NSBA 4RWXA 2BQUA 2RJZA 3PJXA 4CCHA 1KC8T 2N7YA 1VI7A 4DQRA 1JLBA 1HQUA 5DM7Q 2JLFA 4Z2XA 4LSLA 4NLGA 2YH0A 2CQ4A 3NP5A 2N4CA 3OR1A 4ES1A 4OLOA 2POKA 3RW7A 1LXJA 4B02A 2R9LA 2A1BA 1REVA 1KLMB 2ZH8A 5EWEA 1U6ZA 5MLCV 4ZHRB 1F5BA 1NK0A 4OHYA 5F9NA 4LJMA 3CCMS 1NK8A 2YKMB 3M2VB 2MHEA 1X4FA 2CJBA 4KV8B 3JSYA 3KMQA 4YB7A 4QR2A 2IBKA 2CJQA 4P7TA 1KQKA 1KLNA 3MPWA 2BJEA 4EEYA 4WFAQ 2DPIA 1U7LA 2CPIA 2JRSA 3KK2A 1RT2A 3K5OA 4F4XA 3LP1A 2GO9A 1M0SA 2KG0A 1A7GE 1DURA 4A8SA 4DN9A 5LJ3Y 3MM8A 4RX6A 3VAHA 1N6QA 1ZPWX 1HL6A 4AQYF 3RYLA 4J9LA 1S9GB 2JSXA 3LWMA