1FTRA

Formylmethanofuran:tetrahydromethanopterin formyltransferase from methanopyrus kandleri
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
296
Chain Sequence
MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDCGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formylmethanofuran: tetrahydromethanopterin formyltransferase from Methanopyrus kandleri - new insights into salt-dependence and thermostability.
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Formyltransferase
molecule keywords FORMYLMETHANOFURAN\:TETRAHYDROMETHANOPTERIN FORMYLTRANSFERAS
total genus 85
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 1997-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
A PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ftrA02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ftrA01
1M5SA 2FHKA 1FTRA 1M5HA 2FHJA 2FHJD
chains in the Genus database with same CATH superfamily
2YKMB 2AJ1A 3HFZB 1RTDB 1S0NA 2OFHX 3VQSA 2GGPA 2HKEA 1FKOA 3SDEA 1K9MT 5CH7B 1YTYA 1XR6A 1WHWA 4DHVA 3GMGA 1HNWJ 2J9CA 4MK9A 3SI8A 2IA0A 3PHTA 3EWGA 4TY9A 3DLEB 5F8NA 2GAGC 2P8IA 4CI0B 5EHHA 2VHGA 1U1PA 2AMCB 1VI7A 2ZWOA 4B17A 1HNZJ 3JYTB 4CO4A 4JI7F 4DG1B 3M2VA 1PCAA 2NYHA 1B70B 2AV5A 2LQ8A 4MK8A 4RO0A 3W9JA 4O0IA 1KONA 1CQNA 3U02A 1X4FA 3NNAA 2WOMB 1NEEA 2NUHA 3OQ2A 2EG1A 4P7VA 3JSRA 3KJFB 3MWBA 2KKHA 1DBDA 1IN0A 4G1PA 5ETOA 1NK9A 3B78A 1WHVA 3CD0A 4RW7B 1RYRA 3IG1A 1OY6A 1IJEB 1R27B 5IOLA 2BQ3A 4OZ3A 3OL7A 2PA8D 2I6WA 3T9NA 1ZS6A 2SXLA 4A8YA 4NCBA 4DCJB 1HYSB 2LDYA 2B7BB 2BABA 2XMUA 4Q44A 4NOHA 2B4PA 2XULA 3QFHA 3MR2A 4JV5J 1QAYA 2CQCA 2EKNA 4DV2F 1LFPA 2XMVA 1KP6A 4Y2AA 1S6PB 3M7VA 2VQEJ 2QN6B 3MMCB 4YY3J 2F4FA 1NKCA 5E33A 1HHTP 2DR8A 3H2LA 5D4OA 2DR5A 3A3NB 4B9TA 1JLFB 2ZKUA 2OPRB 4LF4J 3TA0A 5IT4A 4USIA 1S9FA 5DRKA 3K8WA 1WOSA 1X4AA 2A2DA 5KFAA 2JWNA 1BQXA 2Z2ZA 3PJXA 3E2EA 1R8BA 1HLWA 3TEGA 5CXTA 3DKDA 5IS2A 3CD6S 2GMJA 4L75A 2K7KA 1T9XA 3G4SS 4C7QA 1L3TA 3RW7A 3TI0A 1FEHA 2J8SA 5A8RA 1BQMB 1HL6A 4L3KA 1DTQA 3QLHB 2R7QA 5D0GA 3J7ZT 1R0BG 2MZTA 3CEDA 1VQOS 2MKCA 3E01B 4CO0A 2MZ1A 1KFSA 2VFVA 2ZE2A 2LQJA 2VG6A 3NRBA 3C6UB 4HR2A 1CULB 1M1GA 1TVRA 3D6FB 3MAHA 4KC5A 5E0OA 3QT7A 4N7TA 4UUXA 3LP0B 1KSPA 1HIYA 3SCJE 2BW2A 3KG1A 2HVHA 3RG6A 2XMKA 1XBWA 3VAJA 3BO4A 4R8UA 1JLAA 3UNGC 2QMWA 2R8HA 1XMOJ 2HNDB 1LNQA 4DEZA 4EZ6A 3OHBA 1EAYC 2HVDA 5CZXA 3DRRB 4ENOA 3HHLB 3Q8QB 2XY7A 2WTFA 1EQMA 2B9WA 3OXLA 4MT1A 2IM0A 3GV8B 1D9DA 4NEYA 5IQQA 4DX6A 5HJYA 1KQGB 5L9NA 3JQKA 2GO8A 3QWUA 4NEZA 2PI5A 2V8HA 2YNHB 2EPIA 4DFPA 2Q66A 3QGPA 2FPHX 3CDBA 3ETMA 2DCUB 3QO9B 4RLEA 1D1UA 4OHZA 5DDPC 1RTIB 4WPAA 1M5OC 1OPZA 2IRYA 3IA0A 4ILMA 1KDNA 1OSDA 1VRQC 4MYTA 2W25A 5A76A 3IG1B 4A47A 3TVZA 5JVGQ 3EDQB 5ETSA 4JI0J 4L3NA 1XNRJ 3IS9A 3OXFA 4PG6A 4C3LA 2DHXA 2C42A 2HFVA 1PC4A 1LW0B 2Y9HA 3WX4A 1JWWA 1SUQA 3W5ZA 4ES2A 5KT2A 4PG5A 5LMUJ 4UOFA 4M5HA 1K1SA 2KJWA 3CIZA 5BYQA 2JVOA 2OPSB 4LBIA 3SSRA 1L3KA 4NXMF 3TVYA 5EGYA 1QE1A 2RKIB 3WBZA 4EK2A 2CQBA 5LSLA 1CPZA 2BJEA 2B7CB 2VC1A 1DTTA 4XO0A 2DGUA 3DXSX 2M3DA 3EVMA 2UXBJ 3KDOA 2DRDA 2J0WA 4P10A 3R3TA 4B3OA 3KJNB 1ULRA 2B56A 2PSZA 4HI2A 4A8WA 2OPQB 1RB0A 2XQCA 3TANA 4IH7A 2HQCA 3H0PA 4LR7A 1NSAA 2QLJB 2J0XA 1BWVA 3J80Y 1T03A 2DY1A 5D4LA 4DX7A 1X31C 1KVKA 2G2ZA 3BSCA 4DQSA 1MNEA 3P3DA 4AYBD 4K4SA 3D0HE 3PEHA 2DNQA 2LDIA 3LO3A 4FS2A 4OX9J 1KNZA 2JX2A 2FGOA 3E51A 4X4PA 3M6WA 2RSQA 3NS6A 1CULA 3Q8PB 4WZMA 4QCLA 3A8KA 3EPIA 2KI2A 2O66A 2XWYA 1RHUB 4KYZA 5B0GA 5KFMA 4DQRA 4DSKA 4QOTA 4ZPWR 5CCLA 1YBTA 3RRKA 3MM7A 3SFUA 3O2IA 2M0GB 2PN6A 2RUSA 3LGHA 3RB4A 3A13A 4OLPA 3QSYB 2R42A 1ACMB 3MM6A 2BUNA 4PCQA 3SCLE 1S99A 4FBTA 4U7UD 4WP8A 4H4KC 1Q78A 2GVZA 5DG8A 3MZIA 1REVB 2AGOA 2BE2B 4NI2A 2ZBRA 2CVIA 2EFNA 3R5AA 5D3GA 2Q6BA 1MMDA 5CYMB 4MKAA 5J2MB 4ES3A 3M8ZA 1JKHA 4I2QA 2FJWA 1F6TA 3KJVB 4K4TA 1F2HA 1AZSB 3CJKA 3CF5Q 2R7WA 4ILRA 1HWLA 2LYVA 3TZYA 4B9SA 3M6VA 1S59A 4CO1A 5DZ6A 1M0SA 3PM9A 1Q1KA 4IFYA 5E3AA 2W2QP 2F4VF 5F8IA 3JAMU 1FA0A 3V6DA 2KZMA 3PO4A 4C8MA 2U2FA 3KXDA 4MMOA 4HDGA 2ZNYA 4N56A 3JSMA 4TKTA 2AYMA 2OAUA 1K44A 1XERA 1D3WA 2FZCB 1RAFB 1RXOB 2OPSA 2RQMA 4LRCA 4FNIA 1TK8A 2GC8A 2MGZB 4M5KA 3K5LA 1ZYQA 2E1AA 1SUQB 1UMJA 1TUVA 1Y3JA 2AYEA 3A8IA 3AA9A 3DLKA 5LSOA 1N32J 4J9NA 1TFYA 4YB7A 3PFEA 2E1RA 3KLGA 8AT1B 2FLOA 4URQU 3CB4A 3M30A 3QBCA 1IM4A 4RW8B 2ALZA 4W90B 1UZDA 2DGOA 1NHKL 2KYZA 2IVYA 2WVEA 1T9TA 2XB2D 3G86A 1QDUB 2Q6CA 3N6LA 1FXDA 1U0HA 3PRDA 4LSZB 4XK8C 1FDNA 4DN0A 1YRTA 2VBWA 2GMHA 3TUJC 5AE1A 5JVHQ 3LA0A 4JI4F 1HBOB 4ZCKA 1GEHA 1XTZA 3R5BA 4A46A 3AOBA 3G6ES 2HIQA 3M6UA 2OPQA 4ANCA 4J5OA 4NLRA 2QE5A 1T8EA 2EFPA 2HAFA 3MAQA 4KPCA 4KGXB 3EX7B 3J7YI 4DV7J 2FLPA 5J2QB 2DO4A 2JEIA 3WDOA 2FYXA 3HD2A 4FZVA 4H4MA 4K5RA 4ECQA 4CLZA 4JI2J 3S01A 4DI6A 1BXNA 5ETQA 3RR8A 1D9FA 1IR2A 2E44A 4M5NA 5IT0A 2FY1A 4QU6A 3IFEA 5KG2A 4I0WA 4WE1B 3HM9A 1RT7A 1YJ7A 1NHUA 2BJDA 2UV8G 2QTWA 2IJNA 4BCAA 3QRPA 2ZE2B 1RWWB 5I42B 2GW8A 2MLZA 2QMXA 3C15B 2BOAA 3Q8RB 2R7RA 1IKYB 2IVMA 4F26A 5L1LA 3G82A 1ROFA 3W5XA 3GP9A 2QYGA 4OZ1A 4CT9A 4ZPVR 5KFFA 2XMMA 2YX4A 3CJ2A 1JKHB 3IGVA 4I2QB 4X4QA 1VQMS 2A1BA 2DXDA 3S1TA 2DR7A 3DRSA 4QR2A 1C0UA 3O3LA 1O51A 1EHWA 4X66J 4DR2J 4Y28C 4GC7A 1Z2LA 2ZOFA 4C0HA 3EGNA 3X3UA 4CYUB 8RUCA 1QTMA 1FNMA 1VGYA 4OZ5A 2EFVA 1XN9A 2ADBA 3DMJB 4I6YA 2PFDA 4EU0A 3I5AA 1TMMA 4FYYB 4A8XA 1VC5A 3V81B 1GX5A 4DR2F 2V63A 3TQ1A 3IWNC 3R2DJ 3VF0B 2VIHA 2VOOA 1F2GA 1JLEA 4X84A 4OZLA 4TYBA 4ZKAA 5F3ZA 3TVKA 2P9EA 5K8OA 2XHCA 1UTAA 3LOUA 4LSLB 5EDWA 2MJUA 4DSIA 2IAJB 5DQIA 1WC5A 4ZPDA 5E3CA 2JEGA 1HNZF 4R5PA 5KG3A 1XWLA 3OSPA 1UFLA 4I6AA 4JBCA 1MN7A 4O0NA 2W9BA 2E5HA 4ZVRB 5HROB 2QSWA 1N8RT 2E7WA 2V0NA 4Q7AA 3EGWB 1N32F 2K7JA 5KFLA 1RCXB 4OYIA 4URGA 1F1BB 2J9DE 3W5YA 5GAHU 1FRKA 2VQFF 2B8PA 2DJWA 2HK3A 3M8PA 4ITSA 2RRBA 5GMKa 2WB1D 1OMSA 2HQDA 1PG5B 4FF1A 2ZUAA 5F8GA 4DPOA 4AQYF 2AWZA 3PKMA 2YQ3A 4USHA 3HK2A 1QUPA 1GT8A 2CQIA 2X1GA 4CLLA 4U96A 3ZTQA 5D6GA 3CO9A 1HBNA 4XTTA 1FRIA 4H4MB 3PDNA 2FJEB 3MPVA 5BYRA 2K1RA 4NCGA 1UA0A 3ZZYA 2KYXA 1IR1A 1WWHA 2HQ3A 2YNGA 4YY3F 3CCMS 5HMXA 2A3JA 4ATNA 1NB7A 2E5JA 1VC6A 1G1XA 3L9ZA 5A0YA 2GQ2A 2CUYA 1RABB 1S1TB 3A8EA 3AQOA 4ZHRB 3BSAA 2CPZA 5D0EA 1TV6A 3OFHA 2LLZA 1ZH5A 2AGQA 3UW1A 1LXNA 2NXUA 4CZCA 4O44A 5DGAA 2ZM6F 4NZ7A 2HGLA 4RU9A 3ZZ0A 5DG9A 2DNYA 2DPIA 5ETRA 1WC1A 1PYTA 2IM1A 4A4JA 1CVJA 3T5KA 2NSBA 4N77A 5GAEU 3MFIA 2MMYA 3I0RA 4ECYA 4CCHA 1U6FA 5C5JA 2J76E 1F3VA 2P5VA 2X1BA 5HVFA 6FDRA 1CLFA 4J7CA 1QAJA 4BWJA 1HMVA 3Q86A 2HFUA 3UN2A 4ZVUB 2Q43A 5CQGA 4Q2LA 2FVCA 4HACB 2AU0A 4UY8T 4IFVA 4Y2IA 1RSCA 2EC2A 3WC0A 2CZVC 3AJ1A 5I4MA 5F8HA 3FSIA 5K5MA 4ECRA 3BKUA 4DR5F 5EWFA 3FFIB 1NJYA 1XNQJ 2WVCA 1QY7A 2YY3A 5B08A 5MAOA 2LEPA 1EARA 1QJHA 1Y5IB 2B6AB 2WRMA 4FXWA 4FXVA 4NE9C 4USVA 4ZVGA 3TR5A 1HR0F 2VONA 3DNCA 4PWWA 5IT9U 1EKSA 4G65A 4PUOA 2ZEJA 4HI1A 5HK4A 3D1HA 2BYCA 1NRKA 2UP1A 7FD1A 3KKFA 1DY3A 4WBFA 1K8AT 2KHCA 1OYEA 3GIJA 1AROP 1UJ4A 3AODA 3IBWA 3LP0A 3TJ9A 4DV5J 2QL9B 4Y6IA 2OH2A 4JV1A 1KEKA 2Z2MA 1HW8A 2OP5A 5A6PA 1R7IA 5JJBA 3V6HA 5LXRA 3D6HB 5D0HA 3DC2A 1TKTB 3W8PA 2L41A 4DR3F 1PC5A 3CVKA 1HWIA 1HBUA 1HPZB 1N0VC 3ISND 3IR5B 1T05A 1E6YB 4DL7A 2Y1IA 2UU9F 3IGNA 1ZZNA 4Q8EA 4JI5F 1RDRA 3TX8A 1Q53A 2EVZA 1GMWA 1CC8A 4OX7A 5FLXU 3FKBA 4Y0FA 1EP4A 3CCWA 4KV8B 4Z7CA 2K8GA 1S1TA 2CPFA 1HKAA 1U09A 2XMTA 3IBCB 3AB2B 4ZN1A 1S6QA 3C8YA 5K8NA 4BDPA 2KU7A 5IFMA 4Y34A 1AXQA 2WBMA 4O3RA 1N56A 1Z2ZA 3FMBA 3W62A 4DUTA 5M2UA 3MOJB 4HVZA 1SQGA 5KT4A 3C66A 1MN9A 4I69A 2ZFHA 1WF2A 3GJTB 4YEAA 2GMLA 1NK5A 1FWKA 2CIMA 4X62J 2X7IA 4IG0A 3HHEA 3N5FA 2B4OA 3LWLA 1IKXA 2WVDA 3HVTB 4DV1F 1TR0A 2VDIA 3BQ0A 1ZM4A 1Y10A 5KFCA 2IHR1 1LEOA 1X8DA 2EFQA 3AY0A 3LTOA 5L8RC 2CQPA 2R8IA 4I1TA 1R8CA 3QATA 1SL1A 4X4TA 1FO1A 2VBYA 1N36F 1IKVB 2PMHA 3BR9A 1RAEB 1IBCB 5AXKA 3C16A 4YB6A 3OTOJ 2GJIA 5FJ4A 1LW0A 2H4WB 3VGTA 1TL7B 3BR8A 3MEGB 1H7XA 1NSPA 2H5EA 4XDCA 3UN3A 4FVCA 2RU3A 3H4BA 4AQYJ 1LK7A 4EBCA 2HVEA 1SJ3P 4DFMA 4OI6A 3ONQA 1T9UA 1NSQA 2FC9A 2GIFA 2N4DA 4DCPB 1W2BR 4RW9B 2B4VA 2W2PP 3DMJA 2CQHA 2HNYA 3HDSA 3E8OA 5F3TA 3NNHA 2UXCJ 4AL6A 1Q7LB 3ETOA 5D15A 2XYPB 3HD1A 1FDBA 1TKZA 1YJVA 4H4OA 5A8WB 2C2DA 1NJWA 1V3ZA 1L3VA 1DLOA 1SL0A 4FKYA 3ENVA 1VQ8S 3QYYA 1XMOF 3FRYA 4DPTA 3FCVA 3HFKA 3MR6A 1WKKA 4IUFA 1NSKL 1EP4B 4KV8A 2R8JA 1FE0A 3FC9A 3MOZA 4A48A 1U47A 4G3IA 4J9RA 3CDEA 1EZZB 1O0PA 1RWOB 2ZUGA 1TL4A 4QW8A 2MZSA 1JLAB 1GXLA 2IDEA 1QLNA 2D3ZA 4P73A 3OVBA 2GO9A 4LT6A 1SH3A 4C6AA 2RQ4A 2WW4A 3H7HB 2V6AA 2W4CA 2GHWA 3AHPA 2QLFB 4CO3A 4TLQA 2KN4A 4C0BA 3NGDA 4I2PA 5KFOA 3HSDA 3J81U 3OSNA 4OI4A 3Q89A 2OD4A 1MMNA 1UZHA 5D0RA 2ZJRQ 2A6OA 3LF0A 1LK5A 5D78A 2V34A 4U9RA 4U7UK 3HVAA 2J6SA 1F3FA 2RMLA 2KHDA 1H3DA 2L9DA 3QRRA 4K0KF 4O3SA 3KLHB 2FHKA 1CEZA 1UW9A 2HW3A 2HS4A 3MDFA 3QGGA 2IMOA 2XNRA 1WG5A 4OJ1A 4CH7A 3MUTP 3H59A 1RAAB 2IC3B 2QA1A 1HHSA 2RKIA 1U1NA 4OYMA 4HKQA 1O8BA 2F3JA 4FP9A 3CC4S 4Q8FA 2DK2A 1FF2A 1FRLA 4ID5B 2C2MB 1CQMA 3SFGA 4AXIA 4WFAQ 1YI2S 4CM2A 2HHXA 1JLCB 3I0RB 3ZFVA 5KOWA 1KHVA 3KMSA 3KK2A 1X4CA 5E3RA 1Q7YT 5KFUA 3MMCA 4ECTA 2W8LA 3PW0A 3M8QB 1TKZB 4HACA 2BJ9A 4USWA 4O44B 5HANA 3DRPB 3DHWC 5AXLA 3BGRA 4BC9A 2APOA 4J9OA 1N36J 3HVRA 4RU2A 4EFAC 1CJKA 1NHVA 4B9LA 1LW2B 3QFWA 4P6QA 1VQ9S 4DUYJ 4CIOA 2HFSA 4ZPCA 2ZH8A 4J9PA 3N28A 1Q8LA 5L9XA 3DRPA 3RAQA 4LFBJ 1O6XA 2BVZA 1YZ7A 4KR0B 2CJYB 2CPDA 2NXNA 3PIOQ 4QPXA 2AJQA 2X3GA 1RAGB 3PKYA 5KTQA 4ELUA 2RUGA 4X4RA 4J90A 4MIBA 1VQ4S 2L08A 3BPSP 3GIKA 1S0OA 3DHXA 4RR5A 1X4BA 4IRCA 1P8GA 2ZH1A 4USKA 1B4SA 2GFFA 3C6TB 3QIPA 1HQUA 2G1HA 2HZAA 1H2TZ 2BKOA 4ZJOA 4RNFA 4R5PB 1FKOB 2QYCA 2YQ0A 3FK4A 5LM7E 1RT2A 4WXOA 2VOPA 2DEJA 3I31A 2GVZB 4RWXA 4ECVA 5BXIA 1L3SA 2G4BA 3R5GA 2RDJA 5ETKA 3TWZA 1RWNB 1RA6A 1S1UB 3VV2B 1HNIA 4QWCA 2Z2LA 2RVJA 1E6YA 2NZCA 3HULA 2GNKA 2ACMA 5FIIA 3ZNJ1 4F50A 3NMAA 4ANDA 4L76A 4U67Q 2MXYA 3S7RA 2QA4G 4DF4A 1KRPA 3OL9A 2W4DA 4KB7A 4EGLA 3PW5A 4KHPF 2MHEA 2FJAB 2BE9B 2XMJA 3TARA 3TUIC 1B7FA 2IPOB 2VD3A 3N0VA 5HQ8A 4DUYF 2OTLS 2VB6A 3BZQA 3LQVA 4E98A 4KT0C 2KFZA 4V19J 3OW2R 1G3OA 1QSSA 3CWJA 3QT5A 2VDHA 5E5NA 5EUHA 3Q8SB 2V9WA 1JK9B 2BKNA 2KXHA 4RZRA 3CJ5A 1OWXA 3TAMA 2DR6A 3G8SA 1IBMJ 2E9TA 5GADI 4C8ZA 4UUWA 2IA6A 1KR4A 1N4LA 1G7CB 3EE3A 1SL2A 1NB2A 4DPUA 1N54B 2RILA 3TOQA 4UQTA 2W9AA 2JOQA 1X4EA 3R7BB 2MLXA 4OMFG 2WZ1A 3NS7B 2DPJA 3JSBA 4DUZF 4DQPA 2U1AA 3J7AN 4CH1A 1HYSA 3R8YA 4U8YA 2WCXA 5KOXA 4UY85 3K59A 4DV3F 3NWRA 4GO5X 1S0MA 1FJCA 1R89A 1U7LA 2PC6A 3MMAA 1CJTB 1VS3A 4Z7YA 2V8GA 1KN6A 1E6VA 3W2WA 3KTQA 1FRMA 3AA8A 3MCNA 1N5QA 2VFTA 3PV8A 3S8SA 3RBZA 4ZP9A 3OUYA 3MUVP 2VUGA 1SI9A 4PABA 1JX4A 3MTJA 4GRSA 1ZA2B 3IBFB 4WYLA 5HP1A 7AT1B 5KFQA 4IFVB 1IKVA 5KFDA 2AJ0A 2C2NA 3I5CA 1FEEA 4WYWA 3DM2B 1TL7A 3ENWA 1KC8T 1FWPA 5KG5A 1RKJA 4HDHA 2CQ3A 2Y1JA 1FKPB 3LGNA 1Y9OA 1U6ZA 2FHJD 2Z57B 2BXJA 3LPYA 3WHIA 1NH7A 2PMWA 5GMDA 4AUKA 3UR0A 2KO1A 2OI2A 3H20A 2CVEA 2L48A 2EG2A 3LP1A 2CDRB 4YP3A 3UDVA 3HT0A 4GVLA 3QJLA 4I4BA 2HWTA 8ATCB 4A8QA 2KZZA 3HSGA 3EICA 2MSSA 2YBVA 3AH6A 2QJ3A 5DGBA 5JXSA 3BREA 4E8UA 1VBXA 2J0QD 3KLFB 2C3OA 4JI1F 4YOEA 4ZVTB 4K4VA 4BS2A 5L1JA 1YVFA 3LAMA 2GGPB 3CDUA 4WKYA 2BJ3A 2NYIA 1SIZA 2V8DA 2Z56B 3FBFA 3MECB 5BR8F 4OHYA 2I1RA 3HVWA 2MZRA 3MD3A 2YNGB 3NAHA 4ZVQB 2KT2A 3Q8VA 1Q5VA 1U4BA 1Z1ZA 3FQKA 3WZ0A 4ZVSB 1KOHA 5A8KA 2Y1LB 3TAMB 1FESA 1I1GA 1GNKA 2CA9A 2HHPA 5C42A 2OSQA 1CJUA 3GSIA 1YJRA 2BM1A 4N8OA 3MPUB 4DX5A 2D41A 1NKBA 1WKJA 5D77A 3U27A 3TJ8A 2P6TA 1GQEA 1D8ZA 3OFFA 5F9LA 2JEJA 3MMJA 5LSRA 5B0FA 3DXBA 1NXIA 1TZ0A 2NUUG 3NOGA 3R9LA 1ZM2A 1BLUA 4DQQA 3CJKB 4WU3A 2C22A 2CKWA 5F41A 3K58A 4B3RJ 4DJBA 4PRFA 5KFIA 3X1LB 4OI2A 1U0SA 3V81A 1KQSR 1SC1B 1K0TA 4I6WA 4RNOA 4M95A 3PCOB 4DZDA 6FD1A 5KFYA 4W92B 4LF6F 2HZVA 3J7Z5 1ZOTA 5IC6B 1CJTA 2DNPA 3IR7B 2C28A 1YDLA 1YRUA 3L95X 3M2RB 1U48A 1GXUA 3F0NA 2UUTA 4MJKA 1RT1A 5K8PA 4LF9F 4G1QA 5HAOA 5I3UA 2QRRA 2DNMA 3R1LA 1VRUB 3DYAB 4CTAB 2C2EA 2BOPA 5HJXA 3BS9A 4R0JA 2OMOA 2GX8A 1UP1A 1RZMA 2ASDA 2XGPA 2J9DA 1FX2A 2ADCA 1TKXB 2HBRB 4IRDA 3T6JA 1VQ6S 1Q8KA 4ZJLA 1P6TA 4NA2A 5AXMA 3ZC4A 4RW7A 4LFCJ 1OPIA 1D0EA 1RAJA 4OI3A 2B9XA 3C15A 3KUGA 3KK1A 3PRVA 2R2RA 1LV5A 4CP5A 4PKDB 1N6QA 1CSJA 4NMXA 3I4PA 5KFWA 4PAAA 3M2VB 3TNVA 2ZZTA 2AJ2A 1UJ5A 2EC0A 4JI6J 1RWKB 3BV8A 4TU7A 1S0VA 2PEBA 4LRAA 2KVIA 4B3MF 4CNYA 2KFNA 2XWXA 3Q22A 2FGCA 2F65A 2FHOB 2V4JA 2RF2A 2LQBA 3HP6A 3N6NA 3DRYA 3HHKA 4LF1A 2RRAA 4IQXA 4ED8A 3CIMA 3RW6A 3M6XA 4MKVA 4EUVA 2B0GA 1HD1A 3BSOA 1WC3A 2N3LA 3AD8C 3NGKA 3V4IB 4C8LA 2JC1A 2HK2A 3KUHA 4PWDB 2KH9A 4K4WA 5F0WA 1RJJA 5T41A 1VYAA 3RAMA 4ZJQA 4JI3F 4LRBA 2D7SA 5J2PB 1FJGF 4DXLA 1MU2A 2NQPA 1UWBA 1VQNS 4LREA 2HLUA 5HQMA 1KTQA 2RB7A 3HT3A 3IS9B 5HBMB 5G4DA 4OZ0A 1AFJA 1FJ7A 3D4JA 3ILIA 5A8RB 4MFBA 3BM7A 2C2KB 4LQ3A 3W65A 3GJSB 1RACB 2FDNA 4RW8A 4EBEA 1BQNB 2XZWA 4RUBA 3GV7B 3PZPA 3C6UA 3JQJA 4OZJA 3OVSA 3UR3C 1FD2A 3CCZA 1CG2A 3HZGA 3VZHA 2ZOMA 1NKEA 1PJ6A 1X0FA 2MGZA 3QGIA 2XMWA 2CPYA 4MAKA 5A2QY 4BWMA 1EJ7L 4OX9F 4DV7F 3IN5A 4DR5J 3RBEA 2RNEA 5DM7Q 3WQPA 3H5XA 2UU9J 4OJHA 3DI6A 3KHHA 2EKYA 3ULHA 4FF4A 3PFOA 1ZPWX 3CPWR 4DSFA 4FF2A 3J80U 1URRA 2IAJA 4YFUA 2XS2A 4GVBB 3AXKA 3VGUA 2XM3A 2NSCA 2F9JA 1IVZA 4FVMA 3AFGA 5HLFA 2A10A 2JLFA 3CDWA 2CNOB 3E01A 4HEA9 4DR7J 4ZDNA 1S79A 2BA9A 3BB5A 4GVBA 3OVAA 3HXMA 4F8RA 2B5JB 3F41A 4ZLLA 2EEYA 3RGIA 3RJMB 3EZOA 5C25A 3CJ3A 5HSPA 4UW2A 4F3MA 1EIYB 1UEVA 2JSXA 2CG8A 2QLWA 2WOMA 3CCRS 3CJRA 3OPKA 3EUNA 1VDHA 2G2YA 4KFBA 2MQLA 4OHVA 2MKKA 4K59A 4ILLA 2ZHAA 4IOAQ 4DG1A 3AAWB 2VQEF 4KH0B 4YR2A 4DL3A 4WCEQ 2UVVA 2VODA 2LXIA 2QT7A 2UXDF 4H4KA 1W2IA 2XS7A 2XSJA 3SEOA 4CLYA 2PFFB 4ES1A 1SJQA 2VA3A 2DNNA 4HH0A 4DN9A 3I0SA 4QWAA 2CAJA 2GVDA 1J5EJ 5I42A 3QO9A 1QSYA 1S6PA 2K06A 4IH5A 3RBXA 2QLXA 4FPRA 4NASA 1OQ3A 3R5CA 1R8PA 3CDAA 5C42B 2YKNA 3MECA 5KT3A 4X64F 2R2UA 4GO7X 4X4UA 4WFYA 2XCAA 3KLEA 3FRZA 5H9FJ 1B3TA 2GJ2A 3QMQA 5LMNJ 1UW4A 4IH6A 3E3XA 2XC9A 1OYDA 3BO3A 1U1OA 2Y0BB 3L09A 1FHTA 3CCUS 4LFAF 1ZPVA 3FVYA 2OJ3A 1S9GA 2OGUA 3R2CJ 1OJ4A 2E5IA 3KUEA 2F4VJ 3M05A 2QC3A 2HWIA 3J7A1 2GS8A 3GG0A 3FMWA 3D2WA 3RU0A 2CPXA 4WIIA 1N5YA 1GH8A 3GSDA 4TQRA 2E9RX 2H3EB 3D3CJ 2X3DA 4TY8B 3PW4A 1U2FA 4F2RA 4HL9A 4C0OC 1RTJA 3JS9A 3L7PA 4NLYA 3H4DA 4E0DA 4KPYA 3HO1A 3NKYA 5B0AA 1MSWD 1RWMB 3I4HX 2UUCJ 3KLIB 3JTOA 3KJQB 4JI2F 4DV2J 4O4RA 3QJJA 4FYDA 2W4PA 2YH0A 4ECZA 4KGZB 5KFPA 1VK8A 3EZ5A 2B9YA 4C97A 2I38A 2RIJA 3G8TA 1S1VB 2RD5C 1UPMB 4R0EA 5KT7A 2ZDPA 3DLEA 2CJBA 5HL7Q 2EBGA 2HIYA 2MZJA 2AT1B 4NZ6A 4UZCA 1NK6A 4LMZA 4LFCF 3K17A 4V19X 4XAKA 5AJ3F 2ZH4A 2RHSB 2AZ3A 2V67A 3K5OA 5J1EB 3TZZA 3Q24A 2DNZA 2BM0A 2DGVA 3MR7A 2PI4A 2AX0A 2LXUA 3DU6A 3NWGA 2C2ZB 4UQGA 1MG7A 3CGIA 2WW8A 3DU5A 3HZEA 1C0TB 3VCDA 1RQ0A 1PAUB 1KLMB 1M5KC 4I67A 5T7LA 1HQEB 3IRXA 4NPOA 1AFIA 2FZGB 1VFJA 1ZM9A 4QIWD 1MROA 1SH2A 2RS2A 1FJEB 5T14A 2OFGX 2KL8A 4IR1A 4IQMA 4QYRA 2YQ1A 1HA1A 2Z2YB 4JV2A 2IBOA 3N9UC 4GMKA 1TP7A 2BANA 1QVFR 2FVSA 1RAHB 2DTJA 4ZPBA 2BV3A 2CQ4A 2IIHA 4F7VA 1S57A 1LWEA 1WEXA 2D3UA 4KO0A 4ZA1A 2CPJA 2BZ2A 4JUZA 3TO8A 2ZBIA 3VHQA 2ASLA 1RGVA 4CQ1A 1PILA 3SCKE 5KFHA 3NLCA 3MPWA 3RUBL 3QZ8A 3KG4A 5KG4A 4LF7J 2H1YA 3GILA 3MEEA 3U1NA 4MFBB 4DFKA 2M4MA 5AJ3J 3CJTA 4P71A 1VC0A 4FN5A 3POTB 2OPPB 5HMYA 3GIMA 5HMWA 2R2TA 1UFKA 3NGSA 4LF8F 4Q5VA 1X5SA 1N34F 3D9BA 2NZ4A 2DH7A 4LR8A 2W7PA 1JLFA 3GJRB 1S1WB 2CXEA 2DYAA 1Y3KA 2OPPA 3W3SA 3W64A 1NBEB 2BX6A 2CQ2A 2BJ8A 2D9OA 5DDQC 2E7VA 1JLBA 1RHQB 1SC3B 2QGFB 4DR1F 4L72B 1IUJA 4J9MA 9ATCB 2YKOA 2JRSA 3DLGB 5EX3A 4QIVA 2ZH7A 4QU7A 1NDCA 1U0HB 1G4CA 3J81j 1X5PA 2O5DA 2PDAA 2OEKA 2VJVA 2OIHA 1YKWA 1N33J 2HGMA 2HRYA 1HNVA 2WSEC 3WIVA 4ED0A 2MB0B 4OZNA 1YJNS 3CD5A 2KG0A 2DISA 3KLIA 3MXHP 3M8SA 2ZH3A 4K4ZA 1SQFA 2EK6A 4O4GB 3H5YA 5IC4B 2V8VA 1ZAXA 5I3UB 2J5AA 3AD9C 3R5JB 2VICA 1JJ2R 2AJ4A 3GFZA 4RW6A 2GA7A 5KFEA 2W8KA 2ASYA 2CQGA 2DCLA 2QX0A 3DOMA 3MMBA 5J2MA 4B3MJ 1RTIA 3BKFA 2Y8YA 3RRGA 3TW0A 3ZZRA 4DR4J 3W9HA 3VAMA 5LJ3Y 1PKUA 2WONB 2XSFA 4UF4A 1UEKA 1Q82T 3BGUA 3GIRA 2MKHA 4NYZA 1WORA 3I6PA 3TQEA 1I94J 3H2VE 4LSNB 3DRSB 4M8LA 1UVLA 1WSRA 2XLJA 1OSCA 3Q23A 3THTA 4DR6J 4YHHF 3ISZA 3W2WB 4X64J 2L9NA 1H2UX 5J2NA 9RUBA 1FJGJ 2CFXA 2F40A 4ZITA 2YKNB 4KBIA 3CCQS 1DAXA 2E1MC 1TAUA 1FNOA 1NM2A 4C98A 1QVGR 4NLGA 2P2CB 1FT8A 2MQNA 3T1AA 4DQIA 4UOHA 2D3O1 4WIQA 1RT4B 4DV6J 1IBKJ 1IBLJ 4Q0BA 5HI7A 3M32A 2AX1A 2UXDJ 1KVIA 4GC6A 5KFGA 1U2RA 2FTRA 3FBCA 4WK1A 4F4WA 3DDKA 3UDCA 3MUMP 2ABYA 4IDKB 4DSEA 2W9BB 2H5JB 1CJVB 1C1CB 4O3QA 4CLFA 4XIUA 5J2PA 1TK0A 4WZQA 3M32B 4W98A 5M2PA 3VAFA 2GHVC 2HBZB 3Q2TC 2GCFA 1H72C 1X9MA 3H42A 3W9IA 5IM0B 3M9NB 5HQLA 4ER8A 4RBUA 1M90T 4NLDA 3ZTSA 3TUZC 3AOCA 4HH1A 3R7NB 2VG7B 2YWKA 2XCPA 1TU0B 3BN4A 3FCHA 5HATA 3QT6A 2AHOB 2QSFA 4KY3A 4LRFA 4X65F 4L73A 2MKIA 3GR1A 1RAIB 5H9EK 4F4KA 4X4NA 3KK3B 2HQIA 3PTWA 4B9UA 1P9YA 2LQ9A 2FHJA 4DWIA 2HRUA 2B9EA 3F44A 5K14B 3B54A 1I6JA 2K3IA 1W25A 3DOLB 2R9LA 2A18A 1FE4A 4J9KA 4C9DA 1GXTA 1HBOA 2JFDA 1WTFA 1SV5A 1RTJB 3MCOA 3R27A 3CNQP 4LRDA 2DRAA 2DR9A 1IR0A 2XSJB 2QV6A 3G82B 2DT9A 4LR9A 3JYTA 1HQUB 2UUAF 1H6KX 4JB8B 2EFGA 1D9AA 1W7WA 1U8SA 1WOPA 1XR5A 4P74A 3HKZD 1V5VA 2N7YA 3I96A 4A8MP 2FIUA 2V9KA 4MKBA 2AEJA 1HD0A 4USJC 1VLOA 1PYOB 4Y00A 4F2SA 4NRUA 1PYSB 4RUAA 4PQUB 5H9FK 4IOCQ 3MEDA 3PIPQ 4F25A 2EBEA 1WD6A 1RI7A 2OMLA 5CYMA 2WB4A 1HQ2A 1UL3A 2GQCA 1N5VA 4QIEA 3TRGA 3V6KA 1EQ0A 1U25A 2KDOA 1A6LA 1SJ1A 2VC0A 2KXNB 2UXBF 5GMEA 1AYEA 3W63A 2YXLA 4M1KA 2BW7A 3FBBA 4TU9A 3NXZA 3IP0A 4ED1A 5IM0A 1JLEB 5C7PA 4CO5A 2R7OA 3CT9A 1F5BA 1PGZA 2ALYB 2Q79A 2H9ZA 2HURA 2YPZA 2YX1A 3AXMA 2DGQA 3L7UA 1BE4A 2CDQA 1N5SA 2DVIA 5MLCV 2RAQA 2F9DA 4WTOB 2CG4A 2VH7A 1NK4A 1RT3B 4NA1A 3VTIA 1RKIA 4ECSA 1X5TA 4TU8A 1S72S 4Q0BB 1VIOA 3M8PB 3PYDA 4NLTA 1K73T 1YBUA 1ZTWA 1WEZA 1RLCL 3LW5C 3BDEA 2O01C 4DOZA 3RTVA 1D8YA 3MM7B 1H98A 1T9WA 2MY8A 1YRXA 2BACA 2VPZB 1HNWF 4LF5F 4AXJA 3BSNA 3PHEA 5B0BA 1CS4A 2HRTA 2DRBA 1MLAA 1N0UA 5B0CA 2Y8WA 4TVAB 2KVQE 2LP4A 5DDRC 3PX0A 3KMQA 2MY7A 3IMQJ 3VVTA 5DDOC 4K0KJ 2ZNZA 4K4YA 4KGMA 3BGOP 1RT7B 3RAXA 2ILZA 3KYLA 4CTAA 4PWUA 3MPDA 2UUBJ 3V5RA 2FJVA 3GU0A 3LPEA 1ZA1B 2AIRB 1UA1A 2CNKB 2VBXA 2R2SA 3KJVA 3KOAA 1LWFA 3HPOA 1UVKA 1S4FA 1A7GE 1VK3A 5L1IA 3JSYA 3QRQA 2HMIA 1FRJA 5B09A 1M5VC 2CWXA 2RE1A 2CADA 3W66A 4OI0A 5CYQA 3AT1B 2JEFA 5LXYA 5C24B 1HI8A 3LALA 4KGVB 4EYHB 1U24A 4ED6A 3L4BC 3L3CA 4QZVB 2G1DA 3MEGA 4I64A 1VR6A 2DB1A 2MKYA 4YS2A 2IBKA 2LVWA 2V8PA 3HHDA 3PR5B 4OJGA 2CJXB 2OLWA 2YKQA 4F3QA 4QYZJ 4IFYB 2ROEA 5DM6Q 2M5YA 3FEYB 5AXNA 2QZ8A 2RQKA 4YQWA 3R97A 4B3RF 3CTRA 4IO9Q 2ZC4A 2HS0A 2KXFA 4CLUA 4IO1A 2DO0A 3BPDA 2H65B 1JLCA 2OEJA 2NPFA 3IM9A 3PACA 1TMJA 5HP1B 4JI8F 3HF5A 5F9NA 3KK2B 4CWBA 3M9MB 1Q0NA 1V9OA 2DH8A 4JI8J 4DFJA 1NDPA 4OL8A 4G1QB 2W01A 3PO5A 2HLTA 2HVZA 4NLUA 4P75A 4KJIA 1AB8A 1UWAA 1VJWA 3M2RA 5IZHA 2XHWA 1J27A 3OLAA 1X0PA 5C2GA 5L39A 1TKTA 1Y7PA 1F5AA 2P6SA 3VZIA 4BLGA 4TQSA 5DLGA 4A8OA 1DJ0A 1C1BA 1FTCA 1WSVA 3NGUA 2BE7D 3NG8A 5KG0A 4DL5A 4L6V3 2UUAJ 1WDTA 4MKYA 1WG1A 2W7AA 5EWEA 1OO0B 3D1QA 1HW9A 4USMA 3CJSA 1X9WA 1DFDA 3K8VA 2HEKA 4RJVA 3OL8A 4HLBA 3CSKA 2MQ8A 1BQMA 3ENQA 1NAQA 2KG1A 3CC7S 3A3PB 1MROB 1RE1B 2BMBA 3DGPB 1S1UA 1VIXA 3GCXP 4EEYA 3W1YC 3ISNC 2GQQA 1GX6A 2HS3A 4M5DB 2UVUA 1JJCB 1BD6A 2IJRA 1QSLA 4B08A 3EJMA 1Q86T 1HNXF 2FVPA 4DV3J 4F36A 1MW7A 1B0TA 3KLFA 1U26A 1C0TA 1HBMB 3SQGB 3N5BA 1AZSA 1S12A 3ZZPA 3KHRA 1I94F 4K2XA 2RHQB 2FUG9 3QSIA 2DNKA 2DHSA 2HNZB 2ZKTA 3C14A 2MDAA 4MH8A 1S9EB 1B0PA 4NA3A 5IWAJ 2YKPA 1TELA 4I7FA 1IQZA 2BJ7A 4CYUA 2Y0SD 5KFVA 1WC0A 4YR3A 1Q8BA 2YKAA 3FEZA 3FUYA 2MYFA 2PIIA 4DV6F 1NUEA 1IBLF 3MM9B 4XPEA 1K0VA 4DPXA 3R1HA 3G8QA 3K5NA 1MWQA 4TY8A 3UCUP 1RTHA 3Q8YA 3K0JA 1C4CA 1F0XA 2ZDOA 4F04B 4AL7A 2WHOA 2NCKL 4ELTA 3HFVA 4QR0A 3T41A 1SC4B 1SKSA 3PG9A 3PRBA 4LJMA 4C48A 2DNOA 4D3HA 3BGFA 1QM9A 3K89A 2BEFA 2YKMA 2HGNA 1RTDA 1RBOB 3M8RA 1E6VB 1ICEB 1ZBTA 2LA4A 1RT1B 1WUUA 3ELHA 3ZXWA 4J37A 2MPUA 1NH8A 4WP3A 4X4VA 3BBBA 1NMEB 3UFCX 2ZVIA 2WAQD 1QE1B 3M9OB 1IBMF 1SKRA 3EDRB 3M8WA 4WF9Q 5HN0A 2VPXB 2F8MA 1RCOB 2UV8A 2W2NP 1S4EA 3QWPA 1WKLA 3UQSA 1XJWB 1X4GA 3A1YG 5B0DA 4WWSA 1S97A 1IWGA 3HHNB 2DXEA 3MM5B 1P9QC 3ITHA 3QZ7A 1M1KT 2QFIA 3NAIA 4RWWA 3QAEA 4DL4A 1T02A 3DLLQ 3D3BJ 2DD8S 4B3TF 2LKZA 1B99A 1F9HA 1RWPB 4RUHA 1ZTTA 1U1RA 3OFEA 1FFGB 4AE5A 4A8FA 1X9SA 1TL3A 3G6YA 3LP1B 1SQEA 1T9VA 2IMWP 1BUXA 5M2RA 2YNIB 4WXWA 1HBUB 1HPZA 2AF6A 2NS1B 2POKA 2VFSA 1Y00A 2HSEB 3ILOA 4OQJA 1R6VA 2A6MA 4RL1A 4YDDB 5AE2A 3SZ2A 3D7SB 3VWSA 2W2MP 5CZVA 2GVDB 3VQTA 2HHUA 1VLYA 2ZH2A 1KQFB 2VA2A 3CC2S 5DG7A 3VVUA 2DIUA 1RHRB 1MWYA 3UN5A 2CQ1A 3ADAC 1YG0A 3W60A 4TXSA 4OX8A 3J81Y 3PVXA 1OY9A 2JFKA 3RYLA 4DV0F 1HI0P 2ZHOA 3V2UC 2HBYB 5L46A 3TYTA 2B4UA 3C46A 3KHLA 2GHPA 5E7OB 3VAGA 4KFBB 2GAHC 5IT9Y 4CLTA 4FF3A 3BGLA 1ITPA 3AB4B 5HO4A 5CYJA 5CD4A 1D09B 1I51B 3DOKB 4HT5A 1JLQA 1YWXA 3WIUA 2FVRA 2HQGA 4X65J 1S48A 3PW7A 4JYAF 4U95A 2QL7B 3KLVA 5DJBA 3Q2SC 3TJAA 1JB0C 3UCGA 1OS5A 5CAAA 2J6TA 4KAIA 2G9OA 3IXQA 2COLA 4P2MA 2ZBPA 4TLRA 4D3GA 5ADZA 5GAHI 1URNA 3R7SB 2V4QA 1SC6A 3PX6A 4RW4B 1HMVB 3HLUA 1RADB 1FKPA 4ZP7A 3GFXA 5KFXA 1TQLA 2VG6B 3MI7X 3V4MA 2KB2A 2ZJQQ 1FD8A 5CA5A 1R0CB 3PYEA 3KDNA 2ATLA 4C4WA 4FXDA 2H48B 1U8WA 4QIGA 3OD2A 1OY8A 3DLHA 5FLXY 3B6BA 3SXLA 2YNFA 3JAMY 3C3LA 5KFZA 2VASA 2M52A 3FSXA 5J2QA 2IYGA 2XEXA 1UVNA 1TL3B 2M88A 5F8JA 3EYZA 3BQ1A 2L3MA 3KFWX 5C2CA 3CMAS 3TAPA 1ZZFA 2J7WA 2V2VA 2FD2A 1C1BB 1YITS 2CNNB 1PBAA 4M5IA 5HVGA 4IR9A 2ZITA 4J9UE 5KT6A 1DQAA 2EXUA 2QMUB 3IWLA 2VZ9A 4UOCA 4FNHA 3UVJA 3K5MA 3GJQB 2P9GA 5A8KB 1A0OB 3P8BB 4RBVA 2I2YA 2CRLA 4LSNA 4NLOA 3R6LB 4JI4J 3H5UA 4NCGB 3NOCA 2HHTA 2ZH6A 1EX8A 3VAHA 4QWEA 1FTRA 3KNGA 3OFGA 2DHAA 1T94A 2E1PA 4PXEA 5ITHA 1Q79A 4ZVEA 2BQUA 1WF1A 5B0EA 3ILLA 1B64A 1IQTA 4ETZA 1C4AA 2HWHA 2M8HA 4I2PB 4KH1B 4YB5A 2E5LF 2QA4S 5LL6d 1T3NA 3EM1A 3MR3A 3FJ2A 4K4XA 4Q43A 3HKWA 4ECXA 2R7UA 2DGXA 1RU1A 2AP6A 2QA2A 2CZ9A 3GYGA 2ATCB 3V6JA 1XC9A 3SSQA 5K8MA 4DS4A 4ERDA 2FB0A 2IYIA 5J1PA 3G6VA 2M2BA 3SYZA 1HQEA 3AOAA 4O23A 5IQ6A 4PXDA 1UVMA 3MMAB 2DNLA 3BGRB 4NZ0A 1RAOA 1FX4A 1HBMA 1ELOA 1S1XB 1T3OA 2OELA 2M8DB 1C0UB 1FVSA 3DOKA 2N7CA 5IV3A 2H51B 1S9EA 1YHQS 1P27B 4PZVA 3GV5B 4C8NA 4F4AA 5GAEI 1APSA 3SQOP 1DURA 4IG3B 2XZTB 2AYGA 2WSCC 2CQ0A 3U1MA 1N34J 2HFNA 5EN1A 3K2YA 1S10A 2DGSA 2NXJA 3LGMA 2MSTA 4AT1B 4C3MA 2HYIB 3SBMA 4KHPJ 2G13A 3D66A 2V50A 3THVA 1BQNA 3MAAB 3ENAA 5JMNA 3GFYA 4C11B 2WSFC 2AKWB 2BRLA 3MPYA 4ZK7M 3TAQA 1VQPS 1L3UA 4B3SF 1VQKS 1T9YA 1UAWA 1F9FA 2IJFA 2BDPA 4E2FB 3I9V9 3NY0A 2R4FA 1N33F 1F9EB 1NPPA 1NU4A 4CNZA 4ETXA 3DGPA 4ZIVA 3AJ2A 3MGJA 3CCJS 3ITHB 4XPCA 1FDDA 4RW6B 2HHWA 2C3YA 2NXEA 5D4PA 2VQFJ 2F1FA 5JUMA 1R31A 2VF3A 4X66F 3P4UB 3NCRA 4XDDA 4GKJF 1REGX 2LU1A 2LQ5A 2N4CA 4ED7A 1G6BA 2Z58B 1N48A 4DR3J 1BMQB 1H7WA 2D69A 1WI6A 3UVJB 5GAGI 1NK7A 1HR0J 1P1LA 1WHYA 4ZHRA 1XNQF 2AEMA 2DEIA 2MZQA 4HHJA 4J9LA 4CH0S 3MM5A 3UD4P 1U1MA 5ETVA 1BY9A 2ZBQA 4ZP8A 4GKKF 3SV3A 1UJ6A 3R6GB 1U02A 3IO1A 1QTNB 3A8JA 3W61A 1NLKL 5D4NA 2VKZG 2XMAA 4DV5F 1YJ9S 1XQIA 3I32A 1S1XA 2GIRA 2UUWA 4RNNA 3NL0A 3HCXA 2FJXA 1IKWA 4WU2A 1DZ5A 1S7IA 5ETMA 2XLIA 2ROPA 3RB6A 1RTHB 4N41A 4J9QA 1VQSA 1FRXA 1PSDA 2VG5B 4X4SA 1LW2A 3B4MA 3EVOA 3ET6B 1J5OA 2XY5A 2MTLA 2UZAA 2DNGA 2XYHB 4R25A 3V6DB 1KQKA 4DR1J 3M1VB 1BHNA 1F5CA 2FY8A 1PBUA 3CJQA 4P2XA 2KT3A 3H90A 3VGVA 3PEJA 3BH7B 3D54A 3M8QA 3N6MA 5G0RB 3MAAA 5KFTA 2PO4A 1V6HA 4NXNJ 1GAOA 4ED4A 3M1VA 3GCWP 3MHYA 1VQ5S 4C8OA 4PUOB 5FDLB 1NPKA 2MQPA 4C2MA 2ERRA 2V2KA 4FPIA 2EW9A 1TK5A 4WKRA 1CJKB 2MQMA 3GYNA 1V5IB 5J2NB 5KFJA 5HLFB 2XZDB 1KS2A 2XNQA 1LOUA 4OYPA 2BR0A 4DU7A 2R7SA 3M2UA 4AL5A 4NXNF 4DR6F 3LP2B 3CULA 3AD7C 3ZZZA 1S9GB 1VRTA 2KFYA 1YGYA 2HVIA 1SKUB 4H4OB 1R8HA 1Q5YA 5KT5A 2O1PA 1FDAA 1LWFB 5DQHA 3M2UB 2QO3A 1S1WA 3CCLS 1HBNB 1HHQA 2GIQA 2JL9A 3D0IE 1DQ8A 2RT3A 4A8KA 1BWEA 3I9ZA 3FZ2A 4Y2MA 1VBYA 7FDRA 3NCPA 2H5IB 1Q4RA 3EGZA 1IJFB 3GZ7A 1KHWA 3QQCD 4B9VA 4HYKA 5DETA 2YWWA 3DRXA 1AUDA 2CWKA 5KG7A 1TL1B 3I0SB 3OTCA 4WFZA 2ZVSA 2JLGA 1AT1B 1KWMA 1UKUA 3BJYA 3PYFA 4OV1A 3CXCR 4X2BA 1Q8IA 2VPYB 4JI7J 1FERA 1SJFA 1UETA 2D9PA 2QFJA 3T5LA 4QYZK 2C1EB 3OBIA 2CJQA 3H2UB 4DL6A 4PWDA 3ZTPA 3O1LA 3WC2A 3D6MB 4CDIA 4UTGA 4BHQA 4M5JA 2B51A 1U45A 3PYGA 5KFNA 1F60B 2IY5B 2WONA 3IRWP 3LANA 1GK8A 3D5MA 3HJFA 5IXUA 5I3PA 4CRJA 3IC1A 2W9CA 1VQ7S 2LFVA 3CJ0A 1NJXA 1WEYA 3DGVA 1UCNA 3T1HF 1N52B 4ZCIA 4DV1J 1EB0A 1TKDA 2IDLA 3W2VB 5DS7A 3DLKB 1N5TA 4X62F 2R8GA 3C16B 1G2EA 1FVQA 5DLFA 2YWFA 1X60A 2H4YB 2KJVA 4V1Ak 4RNMA 3HHLD 3KG0A 3MEDB 4LBHA 3T1HJ 1B7YB 4Q2MA 4RNHA 4F67A 4EO6A 2LU2A 1XK8A 5EWGA 3FEXB 3KLGB 4S0MA 3OTBA 3ICLA 1RLDA 2MJNA 5EX0A 4YN3B 3PJ9A 1J5EF 2K1RB 3CD7A 3I87A 4DL0C 1IBKF 2UUCF 3O6QA 1T95A 5RUBA 3OUYB 4P2FA 2PMZD 1SB6A 3FGVA 2HNDA 2XY6A 3W7BA 3GTYX 5K14A 2L9WA 3TZXA 5A2QU 4PG4A 2PE8A 4OFZA 1WI8A 3HHLA 4LVNP 2CYYA 4P52A 1TUGB 1SV5B 3D67A 2VG7A 1U1QA 1VRUA 2IRXA 3DYAA 4OYZA 3SDEB 2F8HA 1WDDA 2XYGB 3OTEA 4YHHJ 4ED2A 4MYUA 3D68A 2B5JA 4NLQA 4Y2KA 4Y2CA 4ANEA 1ZM3A 4PQAA 4ZPAA 2JJ4D 4JI0F 4MTPA 3US5A 3CO0P 3TEHB 1WHXA 1ZAVA 2QIFA 3PJWA 5GADU 1WG4A 4A8SA 2UVWA 1IKYA 4RPFA 1SJRA 4NLXA 4OYWA 2LEAA 2M70A 4DR4F 4I56A 1HFEL 4LIRA 1N88A 1TL5A 2IC3A 1T7PA 3MF5A 4NLWA 1SBRA 4FYWB 2RU9A 2YNIA 1JXLA 3KK1B 3UCZP 1RA7A 3KNAA 4TNOA 2EK1A 1VQLS 1L5UA 2OEMA 3D6TB 3BF4A 3PNIA 4NLVA 2Y3YA 3T6BA 3WX8A 4RBTA 3CW2C 3EVWA 2AEFA 3HX9A 1FFWB 5IV4A 2VU5A 2XLKA 2QEXS 2OUGA 4NL5A 5L38A 2B6AA 3D0GE 2B8QA 5A6WA 2Z0GA 3QIDA 5E41A 5F8LA 2K2PA 1H73A 2BANB 4PG7A 2EFOA 2JDJA 3H25A 2IVFB 4C8KA 5CCMA 4WTYA 1M5HA 1WF0A 4NRTA 1CC7A 1M1HA 3BBFA 5F0UA 2XTJP 4JV0A 4DLEA 4DUZJ 4F02A 1JIHA 1V3RA 3UDEA 5LMNF 1UWBB 4U7CA 2VV5A 4LF6J 3OTDA 3K5PA 4BC7A 4EYIB 2D1CA 1S5ZA 2O3DA 2DHHA 2PD1A 2FJBB 2Z8QA 3QAUA 3BDPA 4JI3J 3NMRA 1BC6A 2C3UA 4LF2A 5E3QA 2DHGA 4C3KA 3OV7A 1RK8A 1SVDA 6AT1B 4KKOB 2MHNA 3DCAA 4G6VB 2MQOA 4L74A 2ZH5A 3I82A 2A2CA 3QGHA 3PX4A 1JXVA 5GAGU 1GMVA 2JH3A 3JTNA 2XG8A 2HAIA 3DOMB 3MMBB 4KKOA 1VQYA 4IKAA 4NLSA 1JMTA 5CHCB 5KFSA 3CCVS 1NZAA 5ETLA 4OJ3A 3UD3P 3L7OA 3H40A 1KBRA 1RT5A 1VOMA 4OYOA 2H54B 3IAS9 4GKJJ 2CJAA 1XNRF 4DPWA 2YWHA 2BQRA 1SPBP 2E66A 1YLXA 2Y1RI 1ZETA 1S76D 4O3OA 2DIVA 2CQDA 3DRRA 3K7RA 1RWVB 3RB3A 2FLLA 1SXLA 3KK3A 4ED5A 2PEHA 5D3GB 3P5BP 3DOLA 3GG1A 2O67A 3ILJA 3OR1A 3DN9A 2VBZA 5C24A 4JI6F 3QT8A 4R8UB 3F73A 5LMUF 2FQQB 4I68A 5A0YB 1QAIA 5KAKA 2YNHA 3O44A 1U2CA 3RB0A 2HFOA 3HJVA 1AA1B 2G0IA 3GYXB 1S6QB 1CBKA 3MM6B 3OJSA 4K8RA 1JXEA 3OR1B 3BH6B 1KOOA 4ID5A 4LF4F 2FJDB 3NP5A 3P49B 2ZD1B 5ETTA 3JQMA 1X7VA 2D3OR 2KM8C 2JLEA 1FNXH 2V69A 2I0XA 2Z30B 3QPIA 2ZOGA 2DBBA 3CCTA 2RDIA 2VFRA 4USUA 4CLKA 2R8KA 4KTQA 4N76A 3FZBA 3MM9A 4K4UA 2BJ1A 3H8YA 2WVFA 2W1BA 2VKRA 3AQPA 4QWBA 1VBZA 1AUSL 1GMWD 2LA6A 4OZ2A 1Q16B 1YX2A 4DBQA 1S6UA 3MEEB 1RHJB 1LFWA 4K7QA 3T3FA 1SCJB 4FYVB 1R0AA 3GLJA 3SIPB 2F7VA 5L1KA 2HNZA 2OO4A 3C14B 2CPEA 3G6XA 1RP5A 5HROA 4NXMJ 3BBCA 2ZJPQ 1WJ9A 1YJUA 1X4HA 4ALZA 3UPFA 2E7XA 4YR0A 4NCAA 1WTBA 3GPAA 2F8EX 1S7HA 4LUBA 5SUHA 3I55S 4NX9A 3UNYA 4LF5J 4QWDA 2HNYB 4QBUA 2I5JA 1Y5NB 2W24A 1WELA 1DTTB 4F0MA 2NPIA 3VAKA 2LXFA 3PW2A 4IG3A 1FK9A 1HWUA 4ZOSA 3AJDA 5HMZA 1T03B 4LF9J 4LFAJ 1RISA 3MR5A 3NBPB 3OR2A 2PT0A 4QR1A 1YJWS 2ZZMA 5U47A 3MM8B 2R7XA 4O4GA 2YPYA 2OD6A 4JV5F 5BYSA 4YDXA 3G2XA 4ZIWA 2J7KA 4KIAA 4KRWA 1TVRB 2IM2A 2J9EA 2WVBA 4B02A 3KWMA 2XGQA 2ZBCA 3ZNUA 2XO7A 4FBUA 2ZZNA 5IWAF 3C6TA 3QIPB 4J9VA 3Q0AA 4DLGA 5FD1A 4ECUA 3HI9A 3TUPA 3BKTA 4B3SJ 4KHMA 4PQUA 4ED3A 5THWA 2ROGA 1S1VA 3NS5A 4KGKA 1RWXB 1EKRA 4M63A 3OLBA 3O5TB 5LT5A 4NYPA 1I3OB 4WK3A 4HHHA 1JLGA 3THPA 2MKSA 1U1KA 4GKKJ 2KRBA 1FWLA 2HHVA 1RBAA 1HNVB 2EWHA 4MIWA 1HWJA 4JI1J 1PJ7A 1XMBA 2IRUA 1JNRB 3BEGB 1FCAA 3CMQA 4YMEA 3HMJG 3B4DA 2YTCA 2RS8A 2HMIB 2R7VA 4IG0B 2JNJA 1RBLA 2V68A 2NR0A 1NNDA 1R6YA 3UI3A 2V4JB 3HSJA 2B3TB 2AZ1A 4HHUA 2WBRA 4P2SA 4DSLA 2UXCF 2BE2A 4NI2B 2N3OA 2YVSA 3W2VA 1FXRA 4K2JA 3CUNA 1KKHA 3RBDA 2V5HG 2NREA 1NZ8A 3F56A 4JOUA 2MQQA 4PYAA 4FDFA 3V4IA 1X5OA 2DY9A 3HHLC 4BBYA 1GTEA 3UD5A 3ZZUA 3KLEB 1H74A 5K20B 3A12A 3BYPA 3G96A 5KG1A 4FYXB 4B3OB 1PJ5A 4P72A 2XO6A 2D74B 4NLPA 3CJ8A 2RQCA 1RT4A 2E29A 4PPDA 3H5SA 2CNLB 3ZTRA 1UPPA 4YB1P 4X4OA 2E9ZA 2DGWA 3HSZA 4RKUC 1U49A 2GJFA 3FQLA 3JXOA 1X4DA 3GR0A 1TTHB 2VFUA 1H0HB 2A0FB 1RT3A 3NGTA 4ZVHA 1C1CA 1CJVA 4HTJA 3RZAA 4ZMMA 4DV4J 4EWTA 4LSLA 1WNEA 3UE2A 1R8AA 3DDIA 2HHHJ 4G1IA 3Q83A 4N8NA 4RUCA 2EI5A 3VALA 4EBDA 3T1YF 2HHQA 2PGCA 4DL2A 2AW0A 2ASJA 1PAEX 2DITA 4C11A 1TKXA 4P7TA 3ZZOA 2YWEA 4CLWA 2I5JB 1TFWA 4J9SA 1VRTB 2HHHF 2VL1A 1HNXJ 4RW4A 4F0HA 1MWZA 2XI2A 3MCSA 1YK9A 4DCOB 4TYAA 1NDKA 4ECWA 4M94A 1RT2B 4H54A 5E3PA 4RW9A 2I8EA 3B8HA 2W2OP 2HPUA 3NBPA 3OR2B 3I5BA 1WACA 3P5TL 1WOOA 4HTIA 5ETPA 2HZCA 4TN2A 3IM8A 1V3SA 4M5MA 2Q3PA 1IM6A 1HNIB 4CLSA 3B82A 4ICLB 4B3TJ 3TA2A 5H9EJ 3DLBA 1VHIA 3IAM9 3VAIA 1REVA 4NMLA 2CJKA 2KM8B 2V4RA 1OQ6A 1VCTA 2PA3A 4Y3CA 1PO6A 4NYOA 1XMQF 1RWUA 3S6EA 5DQGA 1JJ4A 1KLNA 2DH9A 3MEKA 4ELVA 2FHMA 3ET6A 2LMIA 1T0TV 2RH3A 2V2ZA 3Q8UA 2IM3A 5BJRA 2Q1LA 1J5OB 4ZLJA 1SKWA 2KTQA 4U6PA 1IKXB 2R3VA 2DGTA 2V2QA 2CPHA 1XEZA 3HVTA 4DMZA 2ZM6J 3FSYA 4J91A 4Y65A 2C2RA 4OYAA 1LWCB 4U8VA 1UVJA 1TV6B 4OX6A 4ZLNA 1S6OA 4KHRA 2BRKA 4DU8A 4Z37A 3OT9A 3LH2S 4ZVOB 2OHDA 2AYBA 2J0SD 5LJ5Y 1NJZA 1OIAA 4Z2XA 2YH1A 1DHMA 3TA1A 2MEWA 2QL5B 3IWXA 1MU2B 2CZ4A 3LAKA 3FCWA 3CJ4A 3P96A 3VGSA 4M5GA 5CABA 2HBQB 3OHAA 3A4TA 4DX8H 3SMZA 1JJHA 2RF2B 4K50A 1KVJA 3LUYA 1S77D 1GFWB 1VMBA 2C3MA 2WK4A 4KSEB 4ZPTR 5ETNA 4CO2A 4NWBA 1GMUA 4OHXA 1NK0A 2AGPA 2NLWA 3FBEA 5A8WA 2JC0A 2R7TA 1YZ6A 3UWTA 2BKPA 3GIIA 1IXKA 3FDSA 3NEKA 2KT5A 1RYSA 3EXYA 2E5GA 1FRHA 1QD1A 3N01A 3SSSA 4WFXA 2YNFB 4LVOP 3T5JA 4N47A 3UO0A 3MTKA 1TAQA 1IWAA 3N79A 4EO8A 2M7SA 5FDLA 2J6UA 1H2VZ 2P9CA 3EMTA 1W26A 2CPIA 1XIQA 3POTA 4PXBA 3JSMB 2OKQA 3OXGA 2ZC3A 3CCSS 2LEBA 2JZ5A 4F4ZA 1HI1A 1TL1A 3NGRA 2XI3A 4MIAA 2KRRA 1SH0A 3H98A 3ZO7A 3T1YJ 1Q81T 3C2PA 1Y0HA 4ID8A 5KFKA 1T05B 1RT6A 4OYBA 2LCWA 3CMES 4Q45A 3KHGA 1QUVA 3EGVA 2M9KA 3P45B 3TX0A 2E5LJ 2B43A 3BYRA 2ZHBA 3MM8A 4ZCLA 2J7UA 3G87A 2MLYA 1SJ4P 3IR6B 2W7OA 1KD1T 4LF7F 2X51A 3MD1A 1NK8A 1FK9B 1NDLA 1T11A 1YIJS 4UOGA 4ZN3A 5C25B 5SZTA 2GV1A 4O3NA 5J1EA 4ZVFA 2ILYA 1P1TA 5I3QA 4DF8A 2AQ4A 4AFFA 1RHKB 4I7FB 2XS5A 2DNRA 2JVRA 2OSRA 4QPTA 2DXFA 2I9SA 3BO2A 3IRXB 3J7YU 2W9CB 2Z4PA 2G0CA 2X1AA 3SV4A 1LKZA 3NCQA 1LXJA 1LWXA 3M4XA 4WP9A 1NPRA 4M5DA 4HT7A 3SQGA 3T9ZA 5KG6A 4ZLPA 1EETA 3GE9A 2N82B 4LIWA 3OTOF 1U1LA 1Z4UA 1C2PA 1Y11A 2FC8A 4ZS6A 4WE1A 2MKJA 4JYAJ 3D1OA 1R43A 4PEOA 3TP2A 4K5SA 4OV6A 4ZCMA 3GQCA 3ZTOA 4EI2A 2QG9B 5KFRA 1CJUB 2YX7A 1RTZA 3EPGA 3VR1A 1Y4ZB 4CLPA 4PR6A 4JP8A 5DO2A 2F63A 2ZD1A 3D28A 4KE5A 3LWMA 4DV0J 3QJPA 3GWCA 5F8MA 1A9NB 1AW0A 3FNNA 1KFDA 1WC4A 1DQ9A 2V94A 3R5DA 4PXCA 1FKAF 1WC6A 4C8YA 2X1FA 3LP2A 5HBMA 1B0VA 1UVIA 1XR7A 3PR4A 2ACYA 2VG5A 3O8WA 2C2OB 1R3NA 5BR8J 3U7JA 1RHMB 1VISA 4PG8A 1MMLA 1NJIT 3FFIA 3GFHA 3OJUA 4OI1A 3CE8A 4QQBA 1JLBB 4UT4A 3QNWB 2ZWPA 1DARA 1VHFA 3T5HA 2AD9A 1FXLA 2K3KA 3C19A 1Y5LB 5E2QA 5G0RA 3M30B 2QLBB 2AJFE 3BN7A 4N5SA 3BQ2A 2HG4A 4DZ6A 1N6QB 4QW9A 4IOBA 4LBPA 5DZ7A 2XBPA 3G9CA 2OTJS 3A3OB 1DRZA 2HQFA 1H38A 1JLGB 1O5JA 1RT6B 1FFSB 2IFXA 3PXGa 4P9SA 1KTVA 2UUBF 4JI5J 4O3PA 1RT5B 1YSJA 4OHWA 1VJQA 4FKXA 4ICLA 3M8YA 5J1NA 3DM2A 1K1QA 2ZH9A 4DS5A 1LQ9A 4PPZA 3K57A 4UZBA 2CJ9A 2VJUA 1M5SA 1BGXT 4FS1A 1SIWB 4ZVPB 3EZUA 5T7LB 4W4MA 1JLQB 4OYXA 4DPYA 1FI4A 1M5PC 2HHSA 4QJVA 1RUSA 2RDDA 3N4WA 1IKWB 4MK7A 4QIFA 4CM0A 5HVHA 1EETB 1S49A 4IYQA 1U6BA 4DSJA 2J8AA 4WFBQ 5CYQB 4M5LA 1RU2A 3OL6A 3KLHA 1YBAA 1TUWA 5GVQA 2FVQA 3RR7A 1Q95G 1NCLA 1R0AB 4KQZA 4B9MA 1KLMA 1HWKA 1ZAWA 4PYDA 4ZP6A 4F0KA 4KO0B 3SCIE 3DLJA 5AE3A 4IRKA 5CD4H 4WJBA 2RJZA 2VPWB 2YWGA 3GONA 2E1CA 3JB9k 3PY8A 3I56S 5D8HB 2JHEA 4F4XA 3DDNA 1J2VA 3TZWA 1XMQJ 3DFEA 3JTPA 2UVRA 5LOQA 2G0JA 4YUDA 5AT1B 3DI6B 3MCMA 1I5OB 1LWCA 4URSA 2RRNA 4USTA 4WFNQ 4DR7F 1UEUA 5H1SV 4F3OA 3U1LA 1JNZB 3ZZTA 3P6YC 3G71S 4IDKA 4F4YA 2BBEA 3RRHA 1CS4B 1LWEB 4LQ9A 3UDLA 2NXCA 2F5GA 4DV4F 2LECA 4LFBF 1JQGA 1DTQB 3QLHA 3T19A 1GTHA 4OIXA 3MFHA 4LF8J 1NO8A 2FZKB 2C3PA 3DLGA 4CT8A 4DDFA 3W8GA 1YQHA 5B7WA 3NNCA 1QAXA 1YJTA 2FLNA 1DLOB 2GZOA 4EZ9A 3GB0A 1HARA 2OPRA 1K47A 2DNHA 4AD6A 4EMDA 3CCES 1N5YB 2DKOB 4B9NA 5K9FA 1UFWA 2G2OA 1PIEA 4OLOA 4RX6A 2HFZA 5KFBA 3MURP 3EXCX 1VBKA
chains in the Genus database with same CATH topology
2YKMB 2AJ1A 1RTDB 1S0NA 2OFHX 3VQSA 2GGPA 1FKOA 3SDEA 1K9MT 5CH7B 1YTYA 1XR6A 1WHWA 4DHVA 3GMGA 2J9CA 4MK9A 3SI8A 2IA0A 4TY9A 5F8NA 3DLEB 4CI0B 1U1PA 1VI7A 4B17A 3JYTB 4CO4A 4JI7F 4DG1B 3M2VA 4MK8A 4O0IA 2AV5A 1KONA 1CQNA 3U02A 1X4FA 3NNAA 2WOMB 1NEEA 2NUHA 3OQ2A 2EG1A 4P7VA 3JSRA 1NK9A 3MWBA 2KKHA 1DBDA 1IN0A 4G1PA 2V9WA 3B78A 1WHVA 3CD0A 4RW7B 1RYRA 3IG1A 1IJEB 1R27B 2BQ3A 3OL7A 2PA8D 3T9NA 2SXLA 4A8YA 4NCBA 1HYSB 2LDYA 2B7BB 2BABA 2XMUA 4Q44A 4NOHA 2B4PA 2XULA 3MR2A 1QAYA 2CQCA 4DV2F 1LFPA 2XMVA 4F02A 4Y2AA 1S6PB 3MMCB 1NKCA 5E33A 1HHTP 2DR8A 3H2LA 5D4OA 2DR5A 1JLFB 2ZKUA 2OPRB 3TA0A 5IT4A 4USIA 1S9FA 5DRKA 3K8WA 1X4AA 2A2DA 5KFAA 2JWNA 1BQXA 3PJXA 3E2EA 1R8BA 5CXTA 5IS2A 3CD6S 2GMJA 2K7KA 3G4SS 4C7QA 1L3TA 3RW7A 3TI0A 1FEHA 5A8RA 1BQMB 1HL6A 1DTQA 3QLHB 2R7QA 3J7ZT 2MZTA 3CEDA 1VQOS 2MKCA 3E01B 4CO0A 2MZ1A 1KFSA 2VFVA 2ZE2A 2LQJA 2VG6A 3NRBA 3C6UB 3VZHA 3MAHA 1TVRA 5E0OA 4KC5A 4UUXA 3LP0B 1KSPA 3SCJE 2BW2A 3KG1A 2XMKA 1XBWA 3VAJA 3BO4A 4R8UA 1JLAA 3UNGC 2QMWA 2R8HA 2HNDB 4DEZA 4EZ6A 3OHBA 5CZXA 3DRRB 3Q8QB 3HHLB 2XY7A 2WTFA 2B9WA 3OXLA 2IM0A 3GV8B 1D9DA 5IQQA 1KQGB 5L9NA 3QWUA 2GO8A 2PI5A 2V8HA 2YNHB 2EPIA 4DFPA 2Q66A 3QGPA 2FPHX 3CDBA 3QO9B 2DCUB 4RLEA 1D1UA 4OHZA 5DDPC 1RTIB 1M5OC 1OPZA 2IRYA 3IA0A 4ILMA 1OSDA 4MYTA 2W25A 3IG1B 4A47A 3TVZA 5JVGQ 3P6YC 4L3NA 3IS9A 3OXFA 4PG6A 4C3LA 2DHXA 2C42A 1PC4A 1LW0B 3WX4A 1JWWA 1SUQA 5KT2A 4ES2A 4PG5A 1K1SA 2KJWA 3CIZA 5BYQA 2JVOA 2OPSB 3SSRA 4NXMF 1L3KA 3TVYA 5EGYA 1QE1A 2RKIB 3WBZA 1CPZA 2CQBA 5LSLA 2BJEA 2B7CB 2VC1A 1DTTA 4XO0A 2DGUA 3DXSX 2M3DA 2J0WA 3R3TA 1ULRA 2B56A 2PSZA 4HI2A 4A8WA 2OPQB 3TANA 4IH7A 2J0XA 3J80Y 1T03A 5D4LA 3BSCA 4DQSA 1MNEA 3P3DA 4AYBD 4K4SA 3D0HE 3PEHA 2DNQA 2LDIA 3LO3A 4FS2A 1KNZA 2JX2A 2FGOA 3E51A 4X4PA 3M6WA 2RSQA 3NS6A 3Q8PB 4WZMA 4QCLA 3EPIA 2KI2A 2O66A 2XWYA 5KFMA 5B0GA 4DSKA 4DQRA 4QOTA 4ZPWR 5CCLA 3RRKA 3MM7A 3SFUA 3O2IA 2M0GB 2PN6A 3RB4A 4OLPA 3MM6A 2BUNA 4PCQA 3SCLE 1S99A 4FBTA 4H4KC 1Q78A 5DG8A 3MZIA 1REVB 2AGOA 2BE2B 3R5AA 2CVIA 2EFNA 5D3GA 2Q6BA 1MMDA 5CYMB 4MKAA 5J2MB 4ES3A 1JKHA 4I2QA 2FJWA 3KJVB 4K4TA 3CJKA 3CF5Q 2R7WA 4ILRA 1HWLA 2LYVA 4B9SA 3M6VA 4CO1A 1M0SA 3PM9A 1Q1KA 4IFYA 5E3AA 2F4VF 5F8IA 3V6DA 1FA0A 2KZMA 3PO4A 2U2FA 4MMOA 4HDGA 2ZNYA 4N56A 3JSMA 4TKTA 2AYMA 2OAUA 1XERA 2OPSA 1D3WA 2RQMA 4ZA1A 4C8MA 1TK8A 2XLKA 4B3OA 4FNIA 2GC8A 2MGZB 3K5LA 1ZYQA 2E1AA 1SUQB 1UMJA 1TUVA 1Y3JA 2AYEA 3DLKA 3AA9A 5LSOA 1TFYA 4J9NA 4YB7A 3PFEA 2E1RA 3KLGA 2FLOA 4URQU 3CB4A 3M30A 1IM4A 4RW8B 2ALZA 4W90B 2KYZA 2DGOA 2XB2D 2IVYA 3G86A 4XK8C 2Q6CA 3N6LA 1FXDA 3PRDA 4DN0A 4U7CA 5AE1A 1FDNA 5JVHQ 2VBWA 1YRTA 2GMHA 3TUJC 4JI4F 1HBOB 4ZCKA 1XTZA 3R5BA 4A46A 3G6ES 2HIQA 3M6UA 2OPQA 4J5OA 4NLRA 2QE5A 1T8EA 2EFPA 3MAQA 3EX7B 3J7YI 2FLPA 5J2QB 2DO4A 2JEIA 3WDOA 4H4MA 4FZVA 4K5RA 4ECQA 3S01A 3RR8A 1D9FA 5IT0A 2E44A 2FY1A 4QU6A 3IFEA 5KG2A 4I0WA 4WE1B 3HM9A 1RT7A 1NHUA 2BJDA 2UV8G 2IJNA 4BCAA 2ZE2B 5I42B 2GW8A 2QMXA 3Q8RB 2R7RA 1IKYB 2IVMA 4F26A 5L1LA 1ROFA 4CT9A 4OZ1A 2ZH4A 4ZPVR 5KFFA 2XMMA 2YX4A 3CJ2A 1JKHB 3IGVA 4I2QB 4X4QA 1VQMS 2A1BA 3S1TA 2DR7A 3DRSA 4QR2A 1C0UA 3O3LA 1O51A 4GC7A 4Y28C 1Z2LA 2ZOFA 4C0HA 3EGNA 3X3UA 1QTMA 1FNMA 1VGYA 4OZ5A 2EFVA 1XN9A 2ADBA 3DMJB 4I6YA 4EU0A 3I5AA 4A8XA 1VC5A 3V81B 1GX5A 4DR2F 3TQ1A 3IWNC 1F2GA 3VF0B 1JLEA 4X84A 4OZLA 4TYBA 4ZKAA 5F3ZA 3TVKA 2P9EA 5K8OA 3LOUA 4LSLB 5EDWA 2MJUA 4DSIA 2IAJB 5DQIA 4ZPDA 2JEGA 5E3CA 1HNZF 4R5PA 5KG3A 1XWLA 3OSPA 1UFLA 4I6AA 4JBCA 2W9BA 2E5HA 5HROB 2QSWA 1N8RT 2E7WA 2V0NA 4Q7AA 3EGWB 1N32F 2K7JA 5KFLA 4URGA 2J9DE 5GAHU 1FRKA 2VQFF 3M8PA 2DJWA 4ITSA 5GMKa 2RRBA 2WB1D 4FF1A 5F8GA 4DPOA 4AQYF 2AWZA 3PKMA 2YQ3A 4USHA 3HK2A 1QUPA 1GT8A 2CQIA 2X1GA 4DR4F 5D6GA 3CO9A 1HBNA 1FRIA 4H4MB 3PDNA 2FJEB 3MPVA 5BYRA 2K1RA 4NCGA 1UA0A 3ZZYA 2KYXA 1WWHA 2HQ3A 2YNGA 4YY3F 3CCMS 5HMXA 2A3JA 4ATNA 1NB7A 2E5JA 1VC6A 1G1XA 5A0YA 2GQ2A 1S1TB 3A8EA 3AQOA 4ZHRB 3BSAA 2CPZA 1TV6A 3OFHA 2LLZA 1ZH5A 2AGQA 3UW1A 1LXNA 2NXUA 4CZCA 4O44A 5DGAA 2ZM6F 4NZ7A 2HGLA 4RU9A 3ZZ0A 5DG9A 2DNYA 2IM1A 4A4JA 1CVJA 3T5KA 2NSBA 4N77A 5GAEU 3MFIA 2MMYA 3I0RA 4ECYA 4CCHA 1U6FA 5C5JA 2J76E 2P5VA 2X1BA 6FDRA 1CLFA 1QAJA 4BWJA 1HMVA 2Q43A 5CQGA 4Q2LA 2FVCA 2AU0A 4UY8T 4IFVA 4Y2IA 3WC0A 2CZVC 3AJ1A 5I4MA 5F8HA 3FSIA 5K5MA 4ECRA 4DR5F 5EWFA 3FFIB 1NJYA 5B08A 1QY7A 2YY3A 5MAOA 2LEPA 2B6AB 1QJHA 1Y5IB 2WRMA 4FXWA 4FXVA 4ZVGA 3TR5A 1HR0F 2VONA 3DNCA 4PUOA 4HI1A 3D1HA 2BYCA 1NRKA 2UP1A 7FD1A 3KKFA 1K8AT 2KHCA 3GIJA 1AROP 1UJ4A 3IBWA 3LP0A 4Y6IA 2OH2A 4JV1A 1KEKA 2Z2MA 1HW8A 2OP5A 5A6PA 1R7IA 5JJBA 3V6HA 5LXRA 3DC2A 1TKTB 2L41A 4DR3F 1PC5A 3CVKA 1HWIA 1HBUA 1HPZB 1N0VC 3ISND 3IR5B 1T05A 1E6YB 4DL7A 2Y1IA 2UU9F 3IGNA 1ZZNA 4Q8EA 4JI5F 1RDRA 3TX8A 1Q53A 2EVZA 1CC8A 4OX7A 4Y0FA 1EP4A 3CCWA 4KV8B 2K8GA 1S1TA 2CPFA 1U09A 2XMTA 3AB2B 4BDPA 1S6QA 3C8YA 5K8NA 2KU7A 5IFMA 4Y34A 1AXQA 2WBMA 4O3RA 1N56A 1Z2ZA 3FMBA 3MOJB 4HVZA 5KT4A 3C66A 4I69A 2ZFHA 1WF2A 4YEAA 1NK5A 2GMLA 2CIMA 4IG0A 3HHEA 3N5FA 2B4OA 3LWLA 1IKXA 3HVTB 4DV1F 1TR0A 3BQ0A 1ZM4A 5KFCA 2IHR1 1X8DA 2EFQA 3AY0A 5L8RC 2CQPA 2R8IA 4I1TA 1R8CA 1SL1A 4X4TA 1FO1A 2VBYA 1N36F 1IKVB 2PMHA 3BR9A 5AXKA 5FJ4A 4YB6A 2GJIA 1LW0A 3BR8A 3MEGB 1H7XA 4XDCA 2H5EA 2RU3A 3H4BA 4FVCA 4EBCA 1SJ3P 3KNAA 1LK7A 4DFMA 4OI6A 3ONQA 2FC9A 2N4DA 1W2BR 4RW9B 2B4VA 3DMJA 2CQHA 2HNYA 3HDSA 3E8OA 5F3TA 3NNHA 4AL6A 1Q7LB 3ETOA 5A8WB 1FDBA 1TKZA 1YJVA 4H4OA 2C2DA 1NJWA 1L3VA 1V3ZA 1DLOA 1SL0A 3ENVA 1VQ8S 3QYYA 1XMOF 3FRYA 3HFKA 3MR6A 4IUFA 1EP4B 4KV8A 2R8JA 1FE0A 3MOZA 4A48A 4G3IA 4J9RA 3CDEA 1O0PA 2ZUGA 1TL4A 4QW8A 2MZSA 1JLAB 1GXLA 1QLNA 2D3ZA 3OVBA 2GO9A 4LT6A 1SH3A 2RQ4A 2W4CA 2GHWA 3AHPA 4CO3A 4TLQA 2KN4A 4C0BA 3NGDA 4I2PA 5KFOA 3OSNA 4OI4A 2OD4A 1MMNA 2ZJRQ 2J6SA 3LF0A 1LK5A 5D78A 4U7UK 4U9RA 3HVAA 2RMLA 4K0KF 2KHDA 1H3DA 2L9DA 4O3SA 3KLHB 2FHKA 1CEZA 2HW3A 2HS4A 3MDFA 3QGGA 2IMOA 2XNRA 1WG5A 4OJ1A 4CH7A 3MUTP 3H59A 2IC3B 2QA1A 1HHSA 2RKIA 1U1NA 4HKQA 1O8BA 2F3JA 4FP9A 3CC4S 4Q8FA 2DK2A 1FF2A 1FRLA 4ID5B 4WFAQ 1CQMA 3SFGA 4AXIA 1YI2S 1AFIA 2HHXA 1JLCB 3I0RB 3ZFVA 5KOWA 1KHVA 3KMSA 3KK2A 1X4CA 5E3RA 1Q7YT 5KFUA 3MMCA 4ECTA 2W8LA 3PW0A 3M8QB 1TKZB 4O44B 3DRPB 3DHWC 5AXLA 3BGRA 4BC9A 2APOA 4J9OA 4RU2A 3HVRA 4EFAC 4B9LA 1NHVA 1LW2B 4P6QA 1VQ9S 4CIOA 4ZPCA 2ZH8A 4J9PA 3N28A 1Q8LA 5L9XA 3DRPA 3RAQA 2BVZA 4KR0B 2CPDA 3PIOQ 4QPXA 2AJQA 2X3GA 4ELUA 3PKYA 5KTQA 2RUGA 4X4RA 4MIBA 1VQ4S 2L08A 1S0OA 3GIKA 3DHXA 4IRCA 1X4BA 1P8GA 2ZH1A 2GFFA 3C6TB 3QIPA 4RNFA 1HQUA 2ZH2A 1H2TZ 4R5PB 1FKOB 2QYCA 2VOPA 1RT2A 4WXOA 3I31A 4RWXA 4ECVA 1L3SA 2G4BA 2RDJA 1RA6A 1S1UB 1HNIA 4QWCA 2Z2LA 2RVJA 1E6YA 2GNKA 5FIIA 4F50A 3NMAA 4U67Q 2MXYA 2QA4G 3S7RA 4DF4A 1KRPA 3OL9A 2W4DA 4KB7A 4EGLA 3PW5A 4KHPF 2MHEA 2FJAB 2XMJA 3TARA 3TUIC 1B7FA 2OTLS 2VD3A 3N0VA 5HQ8A 4DUYF 4WKRA 2VB6A 3BZQA 3LQVA 4E98A 4KT0C 2KFZA 4V19J 3OW2R 1G3OA 1QSSA 3CWJA 5E5NA 3Q8SB 5EUHA 1JK9B 2KXHA 4RZRA 3CJ5A 1OWXA 3TAMA 3G8SA 2E9TA 5GADI 4C8ZA 4UUWA 2IA6A 1KR4A 1N4LA 1G7CB 1SL2A 1N54B 2RILA 3TOQA 4UQTA 2W9AA 2JOQA 1X4EA 4OMFG 4DQPA 2DPJA 3JSBA 4DUZF 2U1AA 4CH1A 1HYSA 2WCXA 5KOXA 4UY85 3K59A 4DV3F 4GO5X 1S0MA 1FJCA 1R89A 1U7LA 2PC6A 3MMAA 1VS3A 1KN6A 2V8GA 1E6VA 3W2WA 3KTQA 1FRMA 3AA8A 1N5QA 2VFTA 3PV8A 3S8SA 3OUYA 4ZP9A 3MUVP 2VUGA 1SI9A 1JX4A 3MTJA 5HP1A 4WYLA 5KFQA 4IFVB 1IKVA 5KFDA 2AJ0A 3I5CA 1FEEA 4WYWA 3DM2B 3ENWA 1KC8T 5KG5A 1RKJA 4HDHA 2CQ3A 2Y1JA 1FKPB 3LGNA 1Y9OA 1U6ZA 2FHJD 3LPYA 2BXJA 4AUKA 4YMEA 1NH7A 3UR0A 2DPIA 2KO1A 3H20A 2CVEA 2L48A 2EG2A 3LP1A 4YP3A 3QJLA 2KZZA 4I4BA 2HWTA 4A8QA 2MSSA 3AH6A 5DGBA 5JXSA 3BREA 4E8UA 1VBXA 2J0QD 3KLFB 2C3OA 4JI1F 4YOEA 4K4VA 4BS2A 5L1JA 1YVFA 3LAMA 2GGPB 3CDUA 4WKYA 2NYIA 2V8DA 1SIZA 3MECB 5BR8F 4OHYA 2I1RA 3HVWA 2MZRA 3MD3A 2YNGB 3NAHA 2KT2A 1U4BA 1Z1ZA 3FQKA 3WZ0A 5A8KA 1KOHA 3TAMB 1FESA 1GNKA 1I1GA 2HHPA 5C42A 2OSQA 4N8OA 1YJRA 2BM1A 2D41A 1NKBA 3U27A 5D77A 2P6TA 1GQEA 1D8ZA 3OFFA 5F9LA 2JEJA 3MMJA 5LSRA 5B0FA 3DXBA 1TZ0A 2NUUG 1ZM2A 1BLUA 4DQQA 3CJKB 4WU3A 2C22A 2CKWA 5F41A 3K58A 4PRFA 4DJBA 5KFIA 3X1LB 4OI2A 3V81A 1K0TA 4I6WA 4RNOA 4M95A 6FD1A 5KFYA 4W92B 4LF6F 3J7Z5 1ZOTA 2DNPA 3IR7B 2C28A 1YRUA 3M2RB 3L95X 1U48A 1GXUA 2UUTA 4MJKA 1RT1A 5K8PA 4LF9F 4G1QA 5I3UA 2QRRA 2DNMA 3R1LA 1VRUB 3DYAB 4CTAB 2C2EA 2BOPA 3BS9A 4R0JA 2OMOA 2GX8A 1UP1A 2ASDA 2XGPA 2J9DA 2ADCA 1TKXB 4IRDA 3T6JA 1VQ6S 1P6TA 4NA2A 5AXMA 3ZC4A 4RW7A 1OPIA 1D0EA 1RAJA 4OI3A 2B9XA 3KK1A 1LV5A 2R2RA 1N6QA 4PKDB 1CSJA 3I4PA 5KFWA 3M2VB 3TNVA 1UJ5A 2EC0A 4TU7A 1S0VA 2KVIA 4B3MF 4CNYA 2KFNA 2XWXA 3Q22A 2FGCA 2FHOB 2V4JA 2RF2A 2LQBA 3HP6A 3N6NA 3DRYA