1FTRA

Formylmethanofuran:tetrahydromethanopterin formyltransferase from methanopyrus kandleri
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
296
Chain Sequence
MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDCGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMYLMETHANOFURAN\:TETRAHYDROMETHANOPTERIN FORMYLTRANSFERAS
publication title Formylmethanofuran: tetrahydromethanopterin formyltransferase from Methanopyrus kandleri - new insights into salt-dependence and thermostability.
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Formyltransferase
total genus 85
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 1997-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
A PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ftrA02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ftrA01
1FTRA 1M5SA 1M5HA 2FHKA 2FHJD 2FHJA
chains in the Genus database with same CATH superfamily
5B0AA 4Q43A 1JXVA 1XMOF 1TELA 4U7UK 4OI6A 1VRTA 2QTWA 4I4BA 2XMMA 1JLAB 4TYBA 3D2WA 1YITS 4HT7A 1KBRA 1KD1T 1RTIB 1LWCB 3KJQB 3QAUA 4B9LA 4OL8A 5KFOA 4B3RF 2R3VA 1VQPS 2W9CB 3ET6A 2CQCA 1YLXA 1PAEX 1R7IA 4ED7A 5HP1B 2IRXA 3NBPB 5DM6Q 5HMYA 2RILA 3DGVA 4EZ9A 1T9YA 5HMXA 3MD1A 2DEJA 3D28A 4NEYA 4NRUA 4ICLA 2DR5A 2QX0A 5GAGI 5EGYA 4IR9A 1DRZA 5IT9Y 4YR2A 3BO3A 5A6PA 3MEDA 5IM0A 3KK1A 1SJRA 1DJ0A 1UVJA 4GC6A 5M2PA 3N79A 2V9WA 4DL6A 2HHXA 1N32J 2HGMA 2W4CA 1KLMB 2JLFA 4FBTA 4RBTA 4U8YA 1REVA 3EE3A 5D6GA 2FTRA 2GGPA 2F65A 1CJTA 1GFWB 2N3LA 4DV6F 2G4BA 2ZFHA 2QC3A 3CNQP 4KQZA 1P1LA 2HRUA 4USTA 1Y00A 2QEXS 2P9EA 1C0TA 1R43A 5KT5A 2YWFA 1W2BR 1LWXA 3N5BA 4B9NA 4OJ1A 1XNQJ 1NK7A 2R8HA 1RK8A 2XNQA 3K17A 1D9AA 3LWMA 4JI6J 4LR9A 2FJWA 2Y0SD 1S0NA 4U6PA 1MLAA 3BGOP 4URGA 3GR1A 4MKBA 1IBKJ 3PY8A 2QA4G 2YKMB 5HLFB 4DR7F 5IWAJ 3B6BA 1T3OA 5KFNA 2KKHA 4USUA 3PTWA 4LFBJ 1X4EA 2PA8D 3TQEA 1TP7A 4DXLA 3GV7B 1WC0A 1Z2LA 2XY5A 3WZ0A 5L38A 1S4FA 2VL1A 1SJQA 5BR8F 1NRKA 3DLKB 1VS3A 2OPPB 1ZM9A 2ZC4A 2I2YA 1GX5A 3J7YI 2POKA 3PO4A 2OFHX 2DNPA 2HFUA 3LWLA 2KH9A 3T5LA 1U1LA 3CD6S 3S8SA 3VAGA 2MJNA 2QRRA 2NZ4A 1HD1A 2LMIA 1M5OC 4D3HA 4DCJB 2HZAA 2MZRA 3HHLC 4HR2A 3H90A 4UOCA 5GMDA 2X1FA 2KFZA 2I8EA 4DHVA 1AW0A 1HPZA 2Q79A 4JI7J 1ZYQA 2LA6A 4NA1A 2O5DA 5DLGA 3VZHA 1QAYA 3H4DA 1AUDA 3CF5Q 4B9MA 3CW2C 1I94J 4EBDA 3QIDA 3MAAB 3TAMA 4DR2J 3CC4S 1GMWD 4X4SA 3DLEB 2EFNA 3NEKA 1HIYA 2V68A 3I82A 2V4QA 4ELTA 3CJTA 5L1JA 2P9GA 3EZOA 5DZ6A 4TKTA 4X4VA 3D66A 1S59A 2BJEA 3D6FB 3TARA 1S1TA 4X4RA 1N6QA 2BE2A 3KDNA 1XMQJ 4HDHA 4EWTA 3PYEA 1U2RA 2B5JB 2HG4A 2J0WA 4KY3A 4IUFA 4RW9B 2WBRA 1S99A 2XWXA 1OY9A 1UCNA 3M6XA 2HWTA 8ATCB 4ZKAA 2XMTA 3MPDA 2F9JA 3V81A 1Z2ZA 3MMCA 2HKEA 1S5ZA 1C1BB 3HZGA 3OSPA 2RUSA 4OMFG 1O0PA 2AGOA 3CTRA 3U1NA 1O8BA 4M1KA 4J9RA 3RAXA 5JXSA 2QLWA 2DGUA 3OHBA 3RG6A 4OHVA 3MGJA 3NNCA 2HVIA 4YQWA 3CO0P 3TZYA 4NLYA 2XB2D 3E51A 4JI2F 5DQGA 1TV6A 2K7JA 5ETMA 4CI0B 3KHHA 4JV5J 3NNHA 5F8IA 2AKWB 5KFWA 1D1UA 1X8DA 3GSDA 4IFYB 3CJQA 3HD2A 1TUWA 3K58A 1KVJA 5HVHA 3E3XA 4BWJA 4ZCLA 3RW7A 5DG9A 4KH0B 4HTIA 5KFTA 3EXYA 4PXDA 3UNGC 1N5QA 1LWFA 4B9SA 3KLGA 4NLSA 3G4SS 3SCIE 3P5BP 2GCFA 1YQHA 1PC5A 1RWNB 1YX2A 4IKAA 5C25A 3PW5A 3BH6B 2MHNA 1I3OB 1K8AT 3M7VA 2J8AA 4USMA 1S1VA 3BR8A 1WKLA 3IAM9 2HWHA 4OYPA 2RUGA 3DHXA 4DUYF 3FC9A 4KC5A 3GILA 2R8KA 3K0JA 3KNGA 3AJ1A 2DR8A 3MEEB 5D78A 4O0NA 2BBEA 1EKSA 3CXCR 5J2NA 4LIWA 4NXMJ 4EMDA 3BSOA 1Y0HA 2JEJA 1RT2B 3MD3A 5L1LA 3BQ2A 3B8HA 3FRZA 1FRHA 4HVZA 4ZP9A 4KHPJ 1S0MA 2BQUA 2VFTA 4NLWA 5KG3A 2FHOB 4YEAA 4BCAA 2GJ2A 4OZ1A 4K4ZA 1RAAB 2BX6A 3J81U 2J0QD 2DNRA 2DRBA 2ZHAA 2VFRA 1NKCA 2HFSA 2DR9A 2JDJA 2W9AA 4NXNF 1E6VB 4NZ6A 4ZCIA 1KS2A 1U02A 1TVRB 3ILIA 1PBUA 5KFYA 2ZEJA 2CPJA 1ZZFA 2Q1LA 4ES2A 2OPSA 3LTOA 1ICEB 2KRBA 3AOAA 3RR7A 2C2ZB 3OBIA 3PJXA 1VIXA 1UJ4A 4Z2XA 1I6JA 2KO1A 4WCEQ 1WF0A 2RDIA 2VV5A 1LK5A 2ZBCA 4M5GA 1HMVA 2FLNA 1TKTB 3FCWA 3T6BA 4F4ZA 1OYDA 3WX8A 5E7OB 1WC4A 1FE4A 3GYGA 1OQ3A 4LFAF 1VQYA 3KNAA 1F9EB 3K5PA 5AXNA 3J7AN 4RWXA 3RR8A 5ADZA 4AE5A 2AX1A 2MQOA 3RBXA 2ZKTA 2XI3A 1OY8A 4B02A 4ZJLA 2R8GA 3KLFB 3M32B 4UUWA 2G9OA 2CQBA 3PM9A 1WELA 2VQFJ 4JV2A 4WFXA 2XYHB 4EO6A 3BB5A 5GVQA 5LJ5Y 2SXLA 5CYQB 3IGNA 4L3NA 2GS8A 3PFEA 2GV1A 2BE9B 4O3NA 1Y7PA 2AEJA 2VBYA 1QAIA 2EPIA 1YJ7A 4F7VA 2QLBB 2J7KA 2M4MA 2DYAA 1U8SA 2KZZA 2BQ3A 5GAEU 1ZOTA 2F8EX 4P6QA 1Q8LA 2UXBJ 2GA7A 4DI6A 4PG8A 1UZHA 2BVZA 4R5PB 2OPQB 2B0GA 4FYWB 3OFEA 3MM8B 4LF5F 3OVBA 5IXUA 3A4TA 4ED4A 5DG7A 4LR7A 1FA0A 2KVIA 2E5JA 2YX4A 3QSIA 4GKJF 2CPIA 3EJMA 1LKZA 3TJAA 1RDRA 4HH0A 3Q8SB 3SXLA 3TW0A 3AD8C 1SH2A 5K9FA 3UN5A 2J0SD 2EG1A 2EFPA 4ED2A 2VIHA 1AYEA 4C3MA 1TL7A 2W9CA 3HVRA 1LW0B 4RBVA 2V4RA 1NDPA 3KK2B 1U8WA 3A3OB 2HHQA 3M6WA 4A8SA 4J9LA 1WC6A 3DMJB 2LVWA 1HNZJ 4P73A 4ZP8A 4B3SJ 2MQPA 4M5MA 1RA6A 4PPZA 3J81j 3OTBA 3DC2A 2JOQA 1AFJA 4W90B 3QIPB 4RU2A 3QJLA 5K5MA 2EW9A 2ZBPA 1RHMB 2RS2A 3H5UA 3LF0A 4RX6A 5L1KA 1NSPA 5B0CA 1CSJA 2HVHA 3Q2TC 5KTQA 3QT7A 5F8LA 3HSGA 4K4WA 3L7PA 2PEBA 2MY8A 2V2VA 4P2XA 5L46A 1WEXA 1TZ0A 1TUGB 5L39A 4C7QA 2PMHA 1YJWS 4QU6A 3H25A 4F3QA 3C14B 4P10A 3D6HB 4KH1B 2W4PA 1T05A 2V8PA 1N0UA 1FERA 2PT0A 4F0MA 4RW4A 1SV5A 3CMAS 4HTJA 2VHGA 4RBUA 1OY6A 3AH6A 4RL1A 1PSDA 2VC0A 1P9YA 4OQJA 1M5VC 3L7UA 4HHUA 4QW9A 1FX2A 4PQUB 4F2SA 3W5ZA 2OEJA 3T5HA 2IY5B 3N28A 4DSFA 4Y2CA 3T6JA 1IKWB 4HI2A 2NS1B 3TQ1A 2G2OA 4N8OA 1HFEL 4M63A 3J7A1 3NXZA 2FHMA 5DDQC 4DPUA 3DDKA 2YWGA 1VQNS 4OZJA 4KHRA 1EHWA 2OPPA 2RE1A 5AXMA 9ATCB 5EDWA 1X7VA 1JK9B 5AXKA 2CJKA 2CUYA 2HRTA 4FNIA 2GAGC 3DHWC 3H7HB 1OPIA 1WI6A 1FO1A 2KI2A 1OS5A 2HZCA 2R7XA 2C28A 2AZ1A 1ELOA 1S1XA 2BJ8A 4C11A 5B0BA 4X4QA 5HANA 1URRA 1B70B 2LYVA 2ZUAA 4ZITA 1CEZA 1FK9A 3K5LA 2QFIA 4UY8T 4K8RA 5J1NA 3JSYA 5F8NA 4LSNB 3ZTQA 1N33J 3SCJE 4UY85 2PDAA 2ZZNA 3R5GA 1VC5A 2I0XA 2B6AB 1WWHA 1RXOB 4ZN1A 5KFGA 4M5NA 4NLXA 4LR8A 4AL7A 1WOOA 5FLXU 3M05A 3V6JA 3GIRA 1RBLA 1YRTA 4LF7J 2JFKA 2IDLA 1E6YB 4IQXA 3GV8B 1IR1A 3OJSA 3PNIA 4KGKA 1I1GA 4MFBB 4CIOA 5ITHA 2BE7D 2V50A 4LQ9A 3ILOA 4FYVB 2LDYA 3CCMS 3UVJA 3V4MA 1X9SA 2QYGA 4DL3A 2DR6A 1RT4A 3MMJA 1IM4A 4B9VA 3TX0A 4P2SA 2KU7A 3TAPA 4DR6J 1C0UB 1SUQA 3P4UB 3BSAA 4DUTA 3T9ZA 3R5DA 2GQ2A 2KM8B 3D1QA 4WPAA 3QQCD 2BEFA 3HT3A 2B51A 5E33A 4OI3A 3ENWA 3JSRA 4J90A 1S9GB 3HHLD 5L9XA 4ZA1A 3GG0A 3T1AA 2MJUA 4JYAF 1PILA 5A76A 1FEHA 4F2RA 2C2OB 3T5JA 4TY8A 2LECA 3DRPB 2RRNA 2Y1IA 2FHKA 2JHEA 3AY0A 3LQVA 2OIHA 3DLBA 4C48A 3Q23A 3PXGa 3AHPA 1FRKA 2V2KA 4NWBA 3CDBA 3PG9A 2CWKA 2K1RB 3D1HA 4YHHJ 4WP3A 4B3TF 3D5MA 2CFXA 2JJ4D 1RT1A 1O5JA 4CTAB 1KFDA 2UP1A 3DLHA 1FESA 3MR2A 1U45A 2ZJRQ 1WC5A 3TANA 2NUUG 2RB7A 4NPOA 5B0FA 3J81Y 1X0FA 5D8HB 2FZKB 1C1CB 4Q2MA 2KXHA 3F0NA 1N5SA 4ZPVR 4M94A 5H9EJ 2X1AA 3FVYA 2OI2A 4BC7A 3P8BB 2YKAA 1SJ4P 5M2RA 3D68A 1TKXB 2CJXB 2GC8A 2Z2YB 2B4VA 2LCWA 2YKQA 3GCXP 1WHYA 3UDCA 1HR0F 1TU0B 2AJ2A 3ZZUA 5DM7Q 1L3KA 4PWUA 2ROGA 4DV4F 4CO4A 3Q0AA 1LOUA 1HW8A 1S1WB 3K7RA 1S79A 4LF6J 3R6GB 1ZA1B 5J2PB 4YR3A 1WG4A 3JYTA 2CPFA 4IR1A 4DLEA 2CVIA 4QWAA 1UETA 5KFCA 1B99A 4M5DB 5C42B 3I5BA 4RW7A 4ECQA 1VCTA 2JFDA 1RBOB 1CULB 3ICLA 2BW7A 4LF8F 5LSLA 4KSEB 1R8AA 2FIUA 3FCVA 1SL1A 4K50A 1S1UA 3D67A 1W2IA 3TNVA 3PJWA 2XO6A 1QVFR 4KGXB 2GHPA 1B3TA 1YRUA 3QWPA 4DCPB 1X31C 3I0SB 3IS9B 2CPZA 2OMLA 4C98A 2I38A 3ISZA 3DM2B 4ZIVA 4ECXA 3Q2SC 3M6UA 3T1YF 3UCUP 4DX6A 1FRJA 1DLOA 4AXJA 4AYBD 4LBHA 3ZZ0A 4A8QA 3RB6A 1JLGA 4OHZA 2K3IA 3I87A 3QYYA 4ZPAA 3BGLA 4ATNA 3OHAA 2HPUA 4XDCA 1FKPA 2WHOA 1IWGA 2WVFA 4F4KA 1H3DA 2G1HA 2JSXA 1TK8A 3DU6A 3CWJA 2C3MA 4LBPA 4ANDA 1FTRA 3EUNA 5GAEI 2M88A 4RNFA 2W2OP 4R25A 1UEUA 2MSSA 4X4PA 4CNYA 4ENOA 3BO4A 1FJCA 1Y3JA 1GNKA 4CLYA 1RAEB 4Q45A 3K57A 3SQOP 2RU9A 2DK2A 5JUMA 2JZ5A 3Q24A 2CXEA 4X62J 2DTJA 4OYXA 3I96A 2JEFA 1RYRA 2GVZB 5ETOA 4KGMA 3TVKA 3I0RB 5F8HA 3MF5A 2HURA 4ZVUB 4EEYA 5BYQA 2E1CA 3CCZA 3IRXB 2AW0A 3QJPA 2UZAA 2VC1A 4IRDA 5MAOA 2F9DA 2OPQA 1FJEB 1L3TA 2YTCA 2HHHJ 4JI0J 4GKKJ 2GIQA 1WHXA 3G82B 4XK8C 5KFSA 5J1EA 2HQFA 5LOQA 2DB1A 3NLCA 1CJKB 3MR5A 2VQEF 3LP1B 1FT8A 3W62A 3BN7A 1N48A 4DPYA 3HK2A 3ZFVA 4RNHA 4EK2A 4I7FA 3HPOA 3DOLA 1U7LA 2EKYA 4Z37A 2YKNA 2DNKA 2HQIA 1FXDA 2DXFA 1QSLA 4CLUA 4ZHRB 3OPKA 2ZE2B 4A8FA 1L3UA 5T14A 1R6YA 2ZNYA 1X9WA 3WIUA 4PQAA 3N01A 2HFZA 1WDTA 2E1RA 2QLXA 4ZVQB 3OUYA 2VPXB 4PG4A 4FS2A 1NB7A 2WK4A 2F5GA 1SC6A 1HWLA 3HHDA 3DMJA 1OWXA 1G6BA 4P71A 4P74A 2IM1A 3H5YA 4L76A 3AB4B 3UD3P 1G7CB 4O44B 2QZ8A 4A8YA 1OO0B 1KFSA 4I67A 4AD6A 3DU5A 5IS2A 3IWNC 3WHIA 5KG2A 2BJDA 4CLKA 3FSIA 1K73T 2HBZB 2XZTB 2ZM6F 2HSEB 2MKIA 3TZZA 1R8BA 3KYLA 4DCOB 2HVDA 4GC7A 4IOBA 2Q3PA 2ZDOA 1VK8A 3J7ZT 2MKCA 1VBZA 3T1HF 3ISNC 4DV1F 3KUGA 4YMEA 4CYUA 5J2MB 1HBMB 3J7Z5 4KFBB 4CLSA 2OEKA 3GCWP 3U1MA 4KO0A 1YI2S 1YJVA 3Q8PB 2AU0A 2K8GA 3VQSA 4TYAA 1SJ3P 1QY7A 3Q86A 5IFMA 1OQ6A 3N5FA 4YOEA 2OTLS 4RW8B 1T7PA 5K20B 1SCJB 1NZ8A 2HZVA 4LBIA 4OLPA 3PW4A 3OTOF 1VLOA 3GFYA 4CLZA 2DGSA 3VQTA 2YNGB 4OZNA 2ZNZA 2C42A 2L3MA 3DRRB 3M8PA 4A8MP 1MN9A 1JMTA 5C24A 3BSNA 2FZCB 2CPYA 3BQ0A 4DPOA 1RT7B 4KKOB 1SKRA 1VQ4S 5DJBA 4DWIA 5A0YB 2W24A 3EVWA 1VQ6S 1UVIA 4OX7A 2W4DA 2F7VA 1VJWA 3TEGA 1CJUB 3IMQJ 4NZ7A 3MMBA 3THTA 3EGWB 3DDIA 3K59A 4FVMA 1QE1B 3EMTA 5FLXY 1WTFA 2YPZA 4QYZK 1UVNA 1Q86T 5F8MA 2DNOA 3MM6A 2QO3A 1HNIA 2HGLA 3V6HA 1AT1B 3IP0A 3SSRA 3C15A 1T9UA 1BHNA 2J9DA 3TOQA 3BPDA 3FBEA 4Y2AA 3UR3C 2M3DA 2CPDA 4N76A 2RF2A 1MMDA 1U1MA 5KG4A 2ZC3A 1KNZA 1NU4A 1NSKL 3ZZTA 3HULA 1AA1B 3B4DA 1SPBP 1RTHA 4UQGA 1IKVB 5HVFA 2PGCA 2VH7A 4OLOA 4CM2A 2KT5A 2QT7A 3SI8A 4BHQA 3MI7X 4IRKA 3D0IE 2W9BB 3HZEA 4OZ2A 1SL2A 1RU2A 1YZ7A 2HHPA 4DV0J 1RZMA 2HFVA 3JSBA 2IVFB 4DQRA 4J9PA 3KUHA 4MK7A 3PYDA 2LXFA 1IVZA 4HL9A 3KOAA 3OW2R 1T9VA 3RB0A 4MKYA 4FXWA 1JLQA 3TAQA 2RRBA 2IYIA 2HS3A 4JI3J 2J9EA 2BM0A 4J9MA 4IH6A 1X4AA 3BGRB 1HLWA 4A46A 1K1SA 2I6WA 3GJQB 5CQGA 4OZ5A 4DFJA 1S9GA 4JV0A 4ECUA 1V3RA 4WK1A 4I64A 3O3LA 2UXCF 1RE1B 1SVDA 1ZPWX 3EGNA 5IV4A 4IG0B 3UFCX 1Q53A 2HLUA 3AB2B 3PO5A 3GTYX 2HQ3A 3R5JB 1XNRF 3BKUA 3VAJA 3SZ2A 4GMKA 1T03B 1U4BA 2YQ0A 4NA3A 2E9TA 2Z0GA 4NOHA 1I5OB 3FFIA 2FLOA 4NYZA 1SH0A 2ZH8A 1QJHA 4PAAA 4ED0A 4ALZA 1S49A 4CNZA 4LREA 1JXLA 4C8ZA 2AQ4A 1XWLA 2JLEA 3F56A 2CJYB 1KLNA 5D0EA 5KG7A 2V67A 3NP5A 2CQ0A 1EETB 3CCSS 2XBPA 3OJUA 1FJGJ 3S6EA 3SBMA 1C1CA 2DNGA 4KV8B 3EDRB 4ZPDA 1DQ9A 5LM7E 5KG6A 2RNEA 3FRYA 5KFAA 2HQDA 1PIEA 1B0TA 2CQDA 4UZBA 3MR7A 1ZTWA 2MZ1A 4PXBA 2C2EA 1HQUA 5HQ8A 4OYAA 4J9OA 3HX9A 3MR6A 4ZVEA 1RHRB 1IBLJ 3QRPA 2KYZA 2PMWA 2AGQA 1JKHB 2XS7A 1KONA 3MEGA 3O44A 5CYJA 4PG7A 5HATA 3R27A 1HNVB 4O0IA 2F1FA 2QJ3A 4OV6A 2BW2A 1WF2A 2ADBA 3M6VA 1UFLA 4WF9Q 3BKTA 3NL0A 2EC0A 3NAHA 3G8SA 1VR6A 2YPYA 2HNZA 2RH3A 2A0FB 4RZRA 1XMOJ 2C1EB 3D54A 1IKYB 3GU0A 1FNOA 3N9UC 5F0WA 4ZJQA 2ASYA 2B4OA 2OTJS 2OAUA 4H4OA 1RTDB 1T94A 3LAMA 2RQCA 4LFCF 2XMVA 3IGVA 1SKUB 4NLVA 3BO2A 1WOPA 4EO8A 2R2RA 3WQPA 4B3RJ 2LXIA 3CJKA 4LIRA 3M2VA 4WFNQ 4DR5J 3JAMU 4EYHB 3GPAA 3R6LB 2BJ9A 2ROEA 3T3FA 1R31A 1HBUB 1XR5A 2FD2A 2QG9B 1IWAA 5HJYA 3TR5A 3LH2S 4I0WA 2QGFB 1G3OA 1SQFA 4K5SA 4G1QA 3KLIB 4QCLA 4L75A 1UW4A 4DG1A 2GFFA 2GIRA 3TWZA 2MGZA 2M2BA 3TUIC 1HBOA 2MZJA 4WE1B 4C8MA 3KHRA 4DPXA 3CCQS 1YG0A 3NOCA 5A8KA 2J6UA 2OPRA 4DEZA 1FFWB 5E5NA 5KT2A 2QA1A 4UTGA 1HQ2A 2QV6A 3H0PA 2C22A 3A13A 3BS9A 5KG5A 2Q6BA 1XMQF 4ANEA 2XMUA 3NAIA 2UVRA 2H5EA 2KT2A 3BH7B 5FJ4A 3R97A 3M8RA 4QR2A 3KG1A 5E2QA 3CB4A 2RKIB 3Q83A 1XK8A 1RAGB 4DV6J 5LT5A 3W9IA 3LA0A 5FDLB 3RAQA 4X66J 1T9WA 2GVZA 3NMRA 4D3GA 1RHQB 5IT9U 1PC4A 1HWKA 2XMJA 4M95A 3NS5A 4F4YA 3LP2A 1VJQA 2V94A 5D4NA 3AA8A 3IRXA 2BYCA 1UVMA 2JVRA 3THVA 1RKJA 2HQCA 3UN2A 2DD8S 1GX6A 1ZAVA 1VRUB 3I5CA 1U49A 1BD6A 4JV5F 3G82A 5HO4A 2MTLA 2MLZA 1MU2A 1N5TA 4P9SA 3T41A 1VYAA 4O3QA 1JLEB 1LWEA 3DYAB 4NA2A 4DS5A 2E9RX 4ZLNA 3Q8UA 3POTA 5F41A 1QD1A 3AXMA 2YKOA 2HNDA 2J5AA 3MCSA 2AD9A 5BR8J 2ACMA 4IOAQ 3RYLA 2WONB 5A8WA 4R8UA 1DTTA 5KFBA 5F8GA 3FQKA 2I9SA 2MZQA 2IM0A 2MZSA 2NXCA 3GONA 1JIHA 2EKNA 3D6MB 2W7AA 3CCES 2HFNA 3R9LA 1PYSB 4DV5J 2DCLA 2OFGX 2KXNB 4NCGA 2AWZA 3LUYA 1GT8A 1HI0P 1TKZB 4Y65A 2PN6A 1J5EJ 3GE9A 5GMKa 4X4NA 4CQ1A 1XEZA 5A8RB 3HP6A 2DGTA 2V34A 5KT4A 1Q8KA 1WKKA 3W2VA 3DRSB 3FZ2A 2PO4A 5K14B 1WKJA 1RT3A 2VONA 1F5BA 3SQGB 1RB0A 3GYXB 4I6WA 2ABYA 3VR1A 4EYIB 4AXIA 1UPMB 1IXKA 5DQIA 4UF4A 3QRQA 3HXMA 4X65J 1F5AA 3PRVA 2E1MC 4AFFA 4C3KA 4LF2A 1AZSB 4IG3B 2R7SA 1P9QC 3LO3A 2JC1A 2LP4A 1F9HA 2V9KA 4UT4A 1HBMA 2UUTA 3VGUA 4FP9A 3M30B 4KFBA 2XC9A 2BJ1A 5HSPA 1RT6B 2VPYB 2LLZA 3HFZB 5KFFA 1W26A 1WUUA 2GVDA 2FVQA 2VG7B 1FDBA 4O3SA 4U8VA 3UDEA 3OLBA 3CIZA 1FRLA 2DRDA 3T9NA 4PWDA 2AEFA 1VMBA 5KT7A 1HQEB 3CJ3A 2YH0A 1F2GA 2Y0BB 2WOMB 5GAHU 2YNFA 4JI4F 2ATCB 4ZVPB 1FD8A 3TA2A 4ES3A 5B0EA 2E5IA 2UXDF 3RRGA 4ZP6A 3M8QB 3IR7B 1N36F 2VA2A 2B9EA 3IRWP 4N7TA 3ZTRA 2RVJA 1R89A 2PE8A 1UEVA 4MH8A 5ETVA 4JI2J 2KT3A 4DUZF 2ZVIA 3ZNJ1 1IJEB 2MDAA 2YWWA 3MUTP 1OSDA 3M2UB 4DPWA 1S6PB 2R42A 2DHGA 4C8LA 1PAUB 1Q7LB 1S76D 1Y5IB 4CZCA 1DBDA 2HBYB 4E98A 3VCDA 4ZK7M 1NK6A 1F0XA 5I3UA 1D0EA 3MECB 4XO0A 1QAXA 2R8IA 3IAS9 2F40A 1Q95G 4ANCA 3TYTA 4NCBA 4OJ3A 1MMLA 2YNHB 1Q4RA 1NEEA 3PX6A 1RSCA 1EARA 1CJVB 3W61A 2G13A 1TK5A 1RABB 5IQQA 2YNIB 3FSXA 3OXGA 5FD1A 1TL1A 4USWA 1Q8IA 4ETXA 1VQLS 1U1PA 4NLOA 5HMZA 3TVZA 4JI1F 1HBNA 2CADA 2UV8G 3CCWA 3C6TB 3W64A 2A18A 4TQRA 4Q2LA 1UWBB 1CG2A 5M2UA 2R7WA 2IC3B 4DUYJ 3FEZA 2GMLA 8AT1B 2DGQA 1FXLA 3H2UB 4ZJOA 2DGXA 4EU0A 5CYMA 3W2WB 3C6UA 5KFIA 4GVBA 3G6VA 1TMMA 4ZIWA 4CO2A 2FC8A 1IBMF 1FWLA 4KJIA 2V5HG 4WP8A 4YN3B 2BQRA 2IMWP 2IAJB 2NPFA 1U1OA 3I5AA 4WU2A 1LW2A 4OYOA 4FPIA 4FPRA 2DEIA 3W1YC 2Z2LA 2DPJA 4G3IA 3KMQA 2VG5A 4WK3A 3MCNA 1MWYA 2K06A 3ZO7A 5KOWA 4FYXB 4K7QA 4EI2A 1OYEA 4WFZA 1KQGB 5E3CA 4NXNJ 1JLCB 2KG1A 2HBQB 4P72A 2V2ZA 5THWA 3DGPA 1UP1A 4OHXA 2NPIA 1EAYC 2XO7A 2ZH2A 1V5VA 2HAFA 3W3SA 2O67A 3IG1A 2BDPA 1DURA 2VUGA 1HNZF 1R8PA 1VGYA 2Z58B 1JNZB 2PC6A 2J7WA 1U47A 1JLBB 2C3OA 1LXJA 1U1RA 2GQQA 4FF1A 1H7WA 2IBKA 5KFZA 2QL9B 4RNNA 2R9LA 3N6LA 1FWKA 2AJ0A 4ZCMA 2KB2A 3E01B 2FVRA 1H2UX 2D3O1 1K0VA 1YGYA 3NCPA 4QPXA 1FRXA 4UZCA 3M1VA 3TA0A 4LFAJ 1KOOA 4Y2KA 4CLPA 1VHFA 4NI2B 2FLLA 4F67A 4NL5A 3RGIA 3ULHA 1HL6A 3DRYA 3BGUA 4RW6A 2FY1A 2GJIA 1NM2A 1DHMA 4DR3F 2OHDA 1TAUA 2OSQA 3MMAA 4C0BA 2I5JA 1Q81T 1RWVB 3MM9A 3KLEA 1HNXF 4LRBA 2EC2A 5CA5A 2ROPA 1FX4A 2DGWA 2CQ4A 5J2QA 5MLCV 4UQTA 5ETSA 1TK0A 2QL5B 3PZPA 3W5XA 1HHSA 5DRKA 1N5YA 3MCMA 1WHWA 3C16A 3D0HE 2L9WA 4DSJA 1KHWA 2J6SA 1VQ5S 5DO2A 2JVOA 3LP0B 3ZZRA 1RADB 2ATLA 2MPUA 5KG1A 3JAMY 2DRAA 3RTVA 4FXDA 5B7WA 5KFKA 1YJ9S 4CH7A 2ZVSA 3I6PA 2IVYA 2W2QP 2CQIA 1HKAA 4QIVA 2P2CB 1TR0A 1QVGR 4HH1A 4LF5J 4MAKA 4KB7A 4BWMA 2G2YA 3HVTA 2QMUB 4NLRA 2GO9A 4P75A 2J8SA 2YQ1A 3C19A 1U1KA 1IKYA 2UU9J 3MAQA 3HSJA 1RTDA 2HK3A 2XSJA 2PMZD 3V4IB 3A3NB 3CD0A 2OD4A 5A2QU 1RAFB 2HRYA 3U27A 1QUVA 4J9VA 2J0XA 4FYYB 1MNEA 3GSIA 3KK3B 1FVQA 4N5SA 2BANA 4AQYF 3IO1A 4URSA 1DQ8A 3QFWA 1RTJB 5E3RA 2RQMA 4Q8FA 3CCUS 2NXUA 3AXKA 4NE9C 4OX8A 1Y4ZB 1R0AA 2NUHA 1UA1A 6AT1B 1N33F 2KDOA 3QBCA 1N34J 3TUZC 2GQCA 4ID5A 2XQCA 4M5HA 4E2FB 2I1RA 4IQMA 1AFIA 2DNLA 1J27A 3EWGA 3KG0A 5KT3A 4DR4F 3JTPA 3L4BC 3R5CA 3AT1B 2E7VA 5D4PA 1AB8A 3MEKA 3R1HA 1SIWB 1SJFA 3TA1A 5L9NA 2AT1B 5AJ3F 5KOXA 4MKVA 4CRJA 3RBEA 3M2RA 2YH1A 2C3UA 4X64F 4GO5X 4M5JA 1HYSB 4NMXA 3RB4A 4RR5A 2E29A 4QR0A 3UPFA 1MROB 4WXWA 1JLFB 5CZVA 1BQNA 2B7CB 4MT1A 4KPYA 2XMKA 4DV3F 1JJHA 1U2FA 2FVPA 2WRMA 5H9FK 5EWGA 5HL7Q 4PUOB 1EKRA 1RWUA 2EK1A 3NS6A 4WFBQ 4OYMA 3ITHA 2VDIA 1S77D 2FVSA 1CS4B 2RMLA 4N47A 5HROA 1T3NA 1S48A 3DOMB 2HNYB 3SEOA 1U0HA 2DNZA 3W8PA 1WC1A 2QN6B 5D4OA 2MKYA 3R5AA 3MPUB 5IC6B 4HKQA 1UFKA 1RBAA 4ECYA 2UVUA 2D69A 2DHXA 1HWUA 5D3GA 3EGZA 1Z1ZA 3CD7A 3UQSA 2WONA 2ALZA 1FEEA 1B0PA 5I3QA 3HJFA 1FWPA 1K47A 3DLGB 4YDDB 1X4GA 3SMZA 4O23A 5I42A 3TUJC 2WB1D 1ITPA 2YKPA 4G1PA 1RLDA 4ELVA 1UVLA 1JX4A 1BQMB 3G6YA 4YB7A 1QAJA 1S12A 4HEA9 5EHHA 2CPHA 1BLUA 4L3KA 2C3PA 3B78A 2LQ8A 5D4LA 2V4JA 2XLIA 2ZD1B 5A8RA 1FNXH 3KFWX 2XZDB 4USKA 3W9JA 1J5OA 3FEXB 3W65A 3SV3A 2R8JA 5CABA 3OL9A 3A8JA 1O51A 2BOAA 5ETTA 2HIYA 3ZNUA 5I4MA 2MQ8A 2BV3A 1L5UA 2KYXA 4LF6F 2FQQB 2B8QA 3PFOA 3OR2A 5JMNA 2V6AA 2IVMA 4DLGA 2A2CA 5E0OA 3G71S 3OFHA 1NPKA 3OR1A 5GAHI 2DVIA 3ETOA 4Q0BA 2GNKA 2VOPA 5HBMA 4H4MB 3G86A 3UDVA 1KDNA 2JH3A 3V6DA 1VRTB 1RWPB 2QYCA 1YHQS 1NK0A 2JNJA 1U26A 2QL7B 3MUMP 1RT5A 2HWIA 1NAQA 4IYQA 4DBQA 3SCKE 4C2MA 4WKYA 1FD2A 1XJWB 4L6V3 2KXFA 5D0HA 2HS0A 1B7YB 3SYZA 3ET6B 4F26A 3A8IA 2LKZA 5C7PA 3B4MA 3VGVA 3P3DA 1RU1A 4EUVA 4LT6A 5KFUA 2M7SA 2OLWA 1ZETA 2RT3A 4ICLB 4JYAJ 4C4WA 3I56S 1SQEA 2CJQA 1NHVA 5F9NA 2HMIA 3GP9A 3CC7S 3P49B 4WFAQ 2F4VJ 3RBDA 3M2UA 4YR0A 4W92B 2UUAF 2YWHA 5ETRA 2KFNA 3MEDB 5IM0B 8RUCA 3MM7A 3KK1B 1YKWA 4OHWA 2DNMA 3GIIA 1GMUA 1LXNA 2VZ9A 4B3TJ 4M5KA 1Q78A 1TL3A 3SDEA 2FJDB 2AYMA 2VPWB 1REVB 3AJDA 4QJVA 1ACMB 2YNIA 2IA0A 3KLHA 2B9YA 1CJTB 3UD5A 5T41A 5KFXA 3LGHA 3CDEA 2L41A 3PR5B 5DGAA 3A12A 2ASLA 2DO0A 1KKHA 2XYPB 3BDPA 3H8YA 2DIVA 4C8OA 1PYOB 2RDDA 2Z2MA 4CH0S 3QO9B 2AYBA 2N7CA 2O3DA 2Q66A 4I68A 2DXDA 1HR0J 3EVMA 3NGUA 4HHHA 1VHIA 3R7NB 3LGNA 4U67Q 4OX9J 2KRRA 1SKSA 4DV4J 2NREA 4J37A 1KVKA 2W01A 1GMWA 2NXNA 3KKFA 5AE1A 5KT6A 3K2YA 1H98A 2YY3A 5HK4A 2Z8QA 3H98A 4PKDB 1FRIA 2N3OA 2HLTA 1R8CA 1SQGA 4LF8J 4W4MA 1RWKB 5FIIA 2RRAA 4HACA 3TJ9A 1FVSA 1HI1A 2AYGA 5K8OA 1RJJA 1RA7A 2XEXA 3MFIA 3VAIA 4ID8A 1NJIT 2XS2A 4NCAA 1IKXB 4DX8H 3CCRS 1Q82T 1D8YA 4ED6A 2G0IA 4QW8A 4M5IA 2F4FA 4IDKA 2RIJA 4FKYA 3TEHB 4J9SA 1HPZB 1OJ4A 3LOUA 4ED8A 3SSSA 1IUJA 4IFVA 3J7YU 1V6HA 2QIFA 1IR0A 4P52A 3QAEA 2VODA 4G6VB 2GX8A 3TAMB 4MK9A 3E01A 2Y8YA 1NBEB 2IMOA 3HHLB 3ZZPA 4QYRA 4ILMA 3AA9A 3W7BA 4YDXA 3UCGA 3O8WA 3X3UA 4OFZA 5F3ZA 1HNWF 5ETPA 1ZAXA 2EK6A 4C8YA 2VBWA 3G8TA 4I2QB 1S1TB 1UFWA 3MOZA 2D1CA 1NK9A 4JI8J 3RUBL 4WZMA 2GMHA 3PYFA 1EP4A 1QTNB 3EZ5A 3R7SB 3VTIA 1VQMS 5HQMA 2MKJA 3MMCB 5AXLA 3NGSA 4J5OA 5A2QY 4LSLB 2M0GB 2ZH9A 2ZH4A 3LALA 2BOPA 2ZH6A 2C2RA 3KHLA 1TKDA 3CMQA 2OD6A 1FF2A 4UOGA 3DI6A 1RTZA 4Y2IA 2ACYA 3ZTOA 3BGFA 4KR0B 3VALA 1X4FA 1U0SA 2AF6A 2GMJA 3TJ8A 4QWCA 1JQGA 4TN2A 4Y28C 1XC9A 1SIZA 3CULA 5ETKA 4TLQA 4C97A 1D09B 1TV6B 4TVAB 4RKUC 4F36A 2Y1RI 2P9CA 4LF4F 1JLAA 3Q8RB 2JL9A 2VQEJ 3CCLS 3OL8A 1ZH5A 4OYZA 4JP8A 1OPZA 4WU3A 1RTIA 2FHJA 1LWCA 2G0CA 2FVCA 1R6VA 2U2FA 4ZDNA 3EPIA 1HA1A 1LWFB 4PG5A 3KLGB 3SCLE 5HP1A 1VRQC 3NBPA 1VBYA 4QPTA 3FUYA 4ZPCA 1Q8BA 5C25B 1N5VA 3BJYA 4UOFA 4ZVHA 4L73A 4F25A 4F02A 4ILRA 1I51B 4DQQA 3AOCA 2ASDA 3GJRB 3CDUA 1YBUA 2GIFA 1EIYB 3RBZA 1S1VB 2O1PA 4V19X 1VC0A 1NJZA 3OTCA 2JWNA 2XZWA 2VJUA 4WXOA 1FRMA 1UAWA 2D3ZA 1FXRA 1T95A 3JS9A 3V5RA 1RWXB 1KLMA 3NGDA 4DU7A 2M70A 5J2NB 1RI7A 1UJ5A 3HKWA 2O66A 1ROFA 1JJCB 2LU2A 2CYYA 1PKUA 3CEDA 3IBWA 4F0HA 1NKEA 4J9KA 1MROA 2E5HA 4OYBA 2NSBA 5F8JA 4NLUA 1K9MT 1AXQA 3T1HJ 1X4BA 2VKRA 3D3BJ 4DV1J 1SC1B 2VICA 3TZXA 4ZLPA 4IH5A 3P6YC 1NDLA 3THPA 4R0EA 2PIIA 2IJNA 1PYTA 1A0OB 5E41A 1C2PA 3UI3A 4PUOA 4KIAA 4WTOB 2YKMA 3P45B 2XCPA 2C2KB 1HD0A 1NB2A 5HLFA 4YB6A 3EZUA 1CS4A 1WEYA 3DLLQ 2OPSB 2IBOA 3DOMA 1CC7A 4LF9F 3OXFA 3OTOJ 2X1GA 1JB0C 4CM0A 4K4SA 4QIFA 4QOTA 4KRWA 3DLKA 1G2EA 2X3DA 1PJ6A 1FFSB 3QT5A 2AJ4A 2WB4A 2WTFA 1NPRA 2V8DA 2GO8A 2KZMA 2H65B 2M8HA 2CG8A 2IM2A 5E3PA 3M8WA 2DGVA 4S0MA 3ELHA 2UUCF 1RHJB 4MJKA 4Q7AA 2OMOA 2KJVA 4RNMA 5K8NA 4TNOA 4H54A 2IDEA 1T0TV 3FMWA 3HF5A 2IRUA 4Q5VA 1BE4A 1FJGF 3BREA 3VGTA 3ONQA 5B0GA 2ERRA 2H1YA 1FJ7A 3MAAA 3OVAA 2R7OA 3DLEA 1KOHA 2B9XA 2E44A 1V3ZA 2XM3A 3G6XA 1F3FA 1IQZA 5D77A 2UUBJ 2CQ2A 3CDAA 2QA2A 2B56A 5CCMA 2HHWA 4CCHA 1M5PC 1QTMA 4NRTA 1GK8A 1D3WA 2J6TA 3OVSA 3M8YA 3UD4P 4ER8A 2R2UA 1V9OA 2ZOGA 2JRSA 5E3AA 1CVJA 1JNRB 2B5JA 4H4MA 3ZXWA 4RW9A 3I31A 4RUCA 3IFEA 5EX0A 2CWXA 4PZVA 4MK8A 2FGCA 3FEYB 3ENVA 2BRKA 1C1BA 1GQEA 4LUBA 1DTQB 4NASA 4KGVB 1IM6A 3NMAA 4DR1J 2CIMA 4DFMA 1H7XA 3O5TB 1W7WA 3FKBA 3I4HX 1SH3A 5KFHA 4AL6A 1DY3A 4C6AA 4OV1A 4NLQA 3NWGA 4MKAA 1TL7B 4DR5F 2MKKA 3US5A 3TRGA 2RHQB 2ZOFA 4IOCQ 4OI4A 3EM1A 1DZ5A 5ETNA 1RHUB 5LMUJ 4UUXA 4FN5A 5JVGQ 2UXCJ 4IFYA 1YRXA 2J9DE 4J9NA 2CNNB 1XNRJ 4TU8A 2XHCA 4EGLA 1S6QB 3HFVA 3M4XA 1XBWA 4C8KA 2W2PP 1VOMA 2ADCA 2HVEA 4KGZB 3F41A 4QIGA 3QLHB 4LVOP 2WSCC 1X5OA 3PKYA 1M1GA 3R8YA 3UN3A 2CPEA 2MHEA 1NK8A 2LEBA 2MSTA 3K8WA 1RKIA 3PDNA 1XN9A 2F8MA 2CJAA 2BM1A 2V8HA 2ZITA 4X66F 5LL6d 3P96A 1T05B 2KVQE 5D15A 3QO9A 3MEEA 2OO4A 5AT1B 5CXTA 4HHJA 1P27B 2ZZTA 3HO1A 2XTJP 4RW4B 4CLFA 1SV5B 4ZS6A 2W25A 1S0VA 4BS2A 1VBKA 1RT2A 2AJFE 3GZ7A 3PV8A 4O3OA 3TVYA 3AQOA 3FCHA 1L3VA 3GIJA 3PIPQ 4NEZA 5GADU 3GB0A 3QJJA 3BQ1A 4L72B 2P6SA 4K0KJ 1H38A 3QPIA 1WC3A 2RAQA 1E6VA 1DQAA 4P2MA 4XIUA 1EZZB 4KBIA 4DSLA 1TVRA 1QUPA 5SUHA 1N8RT 2KHCA 4ZP7A 3W9HA 2XULA 5KFMA 2W7PA 2H5JB 4F3MA 4LFCJ 4DV5F 2H5IB 3JQMA 3OL6A 4XAKA 4CLWA 1IKXA 2A3JA 2NXJA 3GWCA 1S1XB 3D1OA 1J5EF 4C11B 3NGTA 3VHQA 1H74A 3OT9A 3H2LA 4DL2A 2LFVA 3ILJA 5DLFA 1VQSA 1FK9B 1TKTA 2MKHA 4MMOA 3HLUA 2F8HA 2C2NA 2HQGA 2RQ4A 4YP3A 3ENAA 1YBTA 5IQ6A 1RGVA 4KTQA 3G8QA 5F9LA 3H59A 4RUAA 3HHLA 2VPZB 4GVLA 4X65F 2BKPA 1WTBA 1ZS6A 4DV2F 3KLFA 3M32A 4TQSA 3FSYA 4OZ3A 3MFHA 4YB1P 3G2XA 2EBGA 4DX7A 3ZZYA 5IT4A 2E5GA 1MW7A 4I2QA 5CYQA 2NYHA 3GYNA 4K4XA 4MYUA 3CCTA 1WACA 4ZVRB 2A10A 1BC6A 1CQMA 2MXYA 3UVJB 2AIRB 3K5MA 2AJQA 4QU7A 3S01A 5IT0A 1PJ5A 3QGIA 1G4CA 3VV2B 1RT4B 1HHTP 3H4BA 1KVIA 2W8LA 1KWMA 3FDSA 2VOOA 4NYOA 3KG4A 3DNCA 3JSMB 1SUQB 4LSLA 1KQKA 2B4UA 4GO7X 3FBCA 3QMQA 4R5PA 2VF3A 3ZC4A 3MM8A 2E5LJ 3BKFA 3C8YA 1Q79A 5LMNF 5T7LB 3FBFA 7FD1A 4TY8B 5LXYA 1NJXA 3BYRA 1P8GA 1UMJA 5U47A 1V3SA 4K2JA 2GZOA 4U7CA 3B82A 3W60A 3MPWA 4UOHA 5BXIA 2D74B 3J80U 4P2FA 3CD5A 2LEAA 3VGSA 1N4LA 1LW0A 1RT1B 1PO6A 4K4VA 4FZVA 5CAAA 5IC4B 3KK2A 2CZVC 2VFVA 3PEJA 1S7IA 2HGNA 2AGPA 1NUEA 2MQQA 4B3OB 2YVSA 1FKAF 3KDOA 3CT9A 3QIPA 3AOBA 1S0OA 1NZAA 2H48B 2MYFA 2CNKB 2CQ3A 3TI0A 3MWBA 2WSEC 4QR1A 4C3LA 1T02A 2G1DA 3PVXA 1NK5A 3LANA 2FJAB 2V63A 3U1LA 4U7UD 4EBEA 1FDAA 1O6XA 1UL3A 3I32A 4X4UA 1SXLA 2K2PA 1B4SA 1XMBA 2FHJD 2MMYA 3GIKA 1FI4A 2EWHA 4ECTA 1XR6A 1Y5NB 3WBZA 4YY3F 2RHSB 4FXVA 2RDJA 4PG6A 1WNEA 1D8ZA 2QSWA 3JYTB 4ZVFA 1LEOA 5BJRA 4DS4A 3C14A 4RW7B 3PIOQ 2H9ZA 2ZBIA 3MAHA 3MR3A 1LV5A 2XWYA 2M9KA 4JI5F 2WVEA 3H5SA 1S1UB 1H72C 4L74A 4NLGA 2ZZMA 1EQMA 1RAOA 4PQUA 4RPFA 3CJ8A 3VVTA 1IKWA 3HVAA 3HDSA 5H9EK 4JI4J 5J1PA 4M5LA 1U1NA 2XGPA 1FKOB 4BBYA 2UXDJ 3HI9A 1N36J 4DV7J 2IA6A 1D9DA 2Z4PA 3DOKB 5HQLA 3MURP 4EZ6A 1DLOB 1GXUA 2DHSA 1JLGB 2QE5A 4DUZJ 2HW3A 2Z57B 2Q6CA 1EJ7L 3M8SA 1FKPB 2A6OA 3CSKA 5HI7A 3GG1A 4QWBA 3N4WA 3QSYB 3OL7A 4ES1A 3SSQA 1BGXT 3JB9k 3Q89A 4ZMMA 2AV5A 1UVKA 2MKSA 2D41A 4OI2A 2R7UA 1IBCB 2W1BA 3GFZA 2ZH1A 2OEMA 3CCJS 2NZCA 3ZTSA 1YIJS 3BV8A 4LSNA 4ED1A 4ZVOB 2PFFB 2EEYA 1KN6A 3C66A 2MLXA 4WTYA 3BBFA 4F3OA 2B6AA 3NGKA 4JI1J 5IOLA 3EDQB 2E7XA 2WVDA 3D9BA 4B3MF 2XHWA 1QDUB 4KT0C 1R0CB 2ZOMA 4CT9A 2KG0A 1E6YA 3QT6A 4RO0A 3W5YA 1TUVA 4MFBA 2KM8C 4K4YA 2YXLA 3JQKA 2HFOA 4DOZA 2RU3A 5KFDA 4MIBA 1A6LA 5J1EB 2VD3A 1BY9A 2ZH3A 5C2CA 1IBMJ 2H51B 3ILLA 4B9UA 5KFVA 2FUG9 4CLTA 4I6YA 2OH2A 1RWWB 2BJ7A 2A2DA 1BMQB 4I7FB 2X51A 1C0UA 3AD9C 3AD7C 2UU9F 3DOLB 2CA9A 2A6MA 1MN7A 1DTQA 3U7JA 2YKNB 3I9V9 4PXEA 2K7KA 5CD4A 3WIVA 2PI4A 4USIA 3CCVS 3CJ4A 2HVZA 4ECZA 1PBAA 1TAQA 2ASJA 1NLKL 4OYIA 1T9TA 3OUYB 2FLPA 1S6UA 2DHAA 1WSRA 3IR5B 1VC6A 4B9TA 3GJSB 3O1LA 3DRPA 2VA3A 1N34F 4NYPA 1IR2A 2HHSA 4DQPA 4MIWA 3FBBA 3L9ZA 4LRFA 3U02A 5H1SV 4RUHA 5KFLA 1VQOS 1S6QA 2ZH5A 2K1RA 1G1XA 1N32F 3ENQA 1MSWD 1SC4B 2Y1JA 4K5RA 3A8KA 4CTAA 3NNAA 4RLEA 3VZIA 3QLHA 4A8OA 4X84A 3BM7A 3DFEA 1YSJA 4WP9A 5KAKA 3I9ZA 4FNHA 1UW9A 3GQCA 2E7WA 2YWKA 5DG8A 2LQ5A 2PSZA 3TZWA 3MPVA 2Z30B 4DR3J 3RW6A 2RJZA 4K4TA 3KMSA 2J7UA 1Q16B 1XNQF 4RUBA 4CYUB 4WIQA 1X9MA 2L08A 3JQJA 5GADI 4JI6F 3R1LA 1HNXJ 1SJ1A 4J9UE 2WBMA 1TKXA 2QMXA 4AUKA 4KO0B 2DO4A 3RZAA 2EFQA 1IBKF 3A3PB 3EXCX 5IWAF 2PFDA 1U6ZA 4LFBF 5AE3A 2MQMA 4N56A 1EX8A 4USHA 2CZ9A 1S1WA 2DH7A 4DDFA 5F3TA 1KTQA 2M52A 1UJ6A 1F1BB 3NCQA 5J2PA 3CJ2A 3W8GA 3NY0A 2PEHA 3JTNA 4FBUA 1OSCA 2NYIA 4DF4A 4M5DA 5C42A 4ZLJA 4JV1A 4WYWA 1X4DA 2FPHX 2R7VA 1T8EA 4DQSA 4CWBA 3M8PB 1CULA 1Y5LB 4JBCA 5C24B 4OYWA 3KLVA 4ED3A 3HSDA 2E1AA 2Z2ZA 2R2SA 3LPYA 3PCOB 4C8NA 4CH1A 2DH8A 3G9CA 1RYSA 5CHCB 3MMBB 2CVEA 3FQLA 4YS2A 5JVHQ 1JJ4A 1P6TA 1VLYA 3BSCA 2UUWA 4PWWA 3PW7A 3I0SA 3IS9A 3MM6B 4KPCA 4JI7F 2B3TB 1HNIB 2R2TA 3DM2A 3R2CJ 4PRFA 1SB6A 2B9WA 3SFUA 5KFRA 1W25A 3C15B 2CQGA 2FJVA 2APOA 1VFJA 1OIAA 1N88A 1I94F 4DR2F 3C46A 1U25A 4AQYJ 4F0KA 5F0UA 2RF2B 3RAMA 4ETZA 4QBUA 3M9MB 1S6OA 3HVWA 4J91A 3QNWB 3A8EA 3D4JA 1GTEA 1PCAA 1VISA 3ZZZA 3BN4A 3C3LA 1RTHB 2AMCB 1IN0A 1SKWA 3HKZD 2CJ9A 1YZ6A 1X4CA 2PD1A 3PHTA 1R27B 2VU5A 2LDIA 2MQNA 4DR4J 3QZ8A 3GV5B 2GHVC 4F50A 3IM8A 4ZN3A 2P6TA 3BF4A 4TU9A 2N7YA 5AJ3J 2BZ2A 3MM5B 4F4XA 2KN4A 4V19J 3OFFA 3LAKA 4DSIA 1SC3B 4X64J 3KJVB 1M5SA 3NWRA 3JXOA 4XDDA 2BR0A 1WHVA 4CO5A 2FJBB 2VDHA 3IM9A 1TQLA 5KFQA 2CDRB 3J80Y 2EXUA 2JC0A 3I0RA 1N0VC 1JLQB 1HWJA 3I4PA 3JSMA 1VBXA 3WDOA 4DV3J 3R3TA 5GMEA 4CT8A 3HHEA 5IV3A 2ZHOA 4DSKA 2KL8A 4DR7J 3W66A 4PYDA 5DQHA 5DETA 1QSYA 3H42A 1HW9A 1F60B 4J7CA 1Q0NA 5C2GA 1CJKA 4ERDA 5T7LA 4LSZB 1XR7A 3LP1A 4ZVSB 3PX4A 2L9NA 1FDNA 5KFPA 2F4VF 3N6MA 4ZVGA 4RU9A 2JLGA 3T19A 2MZTA 5BYSA 1JWWA 2ZHBA 4LRCA 3FFIB 4HYKA 1NJYA 2AEMA 1TTHB 4ZHRA 3IBFB 2W8KA 2HIQA 2ZE2A 5A6WA 2VBXA 1IQTA 1MMNA 1S10A 4EFAC 4DN9A 1U6BA 2XY6A 2C2MB 3CO9A 2DNHA 1P1TA 5AE2A 3O6QA 3H40A 2RQKA 1N54B 3R5BA 5HMWA 2ZKUA 5B0DA 5L8RC 4A4JA 2HS4A 2IJFA 4CO3A 4B3OA 2VFUA 3KJFB 2ILYA 2BKNA 3CDWA 3QZ7A 4O44A 1Q5VA 4OZ0A 4A47A 1VQ8S 2DBBA 1WD6A 4H4KC 1WI8A 2AJ1A 4HDGA 4NXMF 3F44A 1HQUB 4DZ6A 3BDEA 3PW0A 1XIQA 2W2MP 4O4GB 2D9PA 2AHOB 4OX9F 4KHPF 1CQNA 3MEGB 3QRRA 2C2DA 1NPPA 4A8XA 2DT9A 3ZTPA 4QYZJ 1R3NA 4FF4A 1UEKA 4H4KA 1AUSL 5J2MA 2IYGA 3DXSX 4U95A 2IHR1 1RLCL 1ULRA 1RHKB 2HNZB 3LW5C 4HLBA 1S4EA 1GMVA 1RAHB 1D9FA 4CDIA 4FF3A 4NZ0A 3OTDA 2DCUB 3BZQA 5HAOA 1CLFA 4K4UA 4H4OB 4RW8A 4A48A 2CAJA 3PJ9A 1T11A 3QGPA 2DJWA 4AL5A 3PHEA 4C0HA 1ZM4A 2YNGA 5DDOC 4AT1B 3CJKB 3HMJG 3M2VB 2CQPA 1FKOA 2ZBQA 3DRRA 1S97A 5SZTA 1UZDA 2E9ZA 1RT7A 4E0DA 3OQ2A 1U2CA 4KKOA 3DOKA 3MHYA 2EFVA 5A0YA 2DIUA 4DMZA 4FYDA 6FD1A 1CJUA 3RRKA 5LXRA 1GH8A 4G1QB 1QE1A 3KHGA 1Q5YA 4DG1B 3EGVA 2G2ZA 2MGZB 2UUAJ 1HBOB 1PGZA 3FNNA 2VQFF 2X3GA 2A1BA 5A8KB 1LNQA 1YDLA 2OPRB 2PA3A 2CJBA 2R7QA 4LQ3A 4Q44A 4X2BA 4JI8F 4ILLA 1WEZA 5CH7B 3KUEA 4ECRA 1NSQA 3NKYA 2DXEA 1IKVA 4ZCKA 1CBKA 3TX8A 2DPIA 2XNRA 3DRXA 1WDDA 2VASA 2UXBF 3IC1A 1WORA 2W9BA 3LP2B 1MWZA 3UE2A 2CNLB 3QATA 1RISA 2Y8WA 1X4HA 3RJMB 4Y2MA 2DH9A 2FZGB 4PR6A 2N4DA 1N52B 3G87A 4Q8EA 3N0VA 7AT1B 2R4FA 4F4WA 3HHNB 3CJRA 4FVCA 1MU2B 4O3PA 4K2XA 2DNQA 2Y3YA 1LWEB 2N82B 3L7OA 2HEKA 1URNA 3POTB 4ITSA 3PRBA 3WC2A 1YJTA 4WJBA 2CQHA 2HNDB 1DAXA 3AQPA 2YBVA 4NLDA 2NLWA 5A8WB 3BGRA 2RSQA 4R8UB 2ILZA 1DTTB 2IRYA 4QWDA 2Y1LB 4URQU 2QLJB 2YX1A 3HM9A 2ZWOA 2BA9A 4IH7A 1H2TZ 1F2HA 5HVGA 4FS1A 2LQJA 5BYRA 4B3SF 4IG0A 4NCGB 2FY8A 3SV4A 2D7SA 2DY9A 4ECVA 3HFKA 1T03A 3DDNA 3CJ0A 1RUSA 2FDNA 1RP5A 4RNOA 1ZZNA 3HHKA 5DS7A 1Z4UA 3W2VB 3MPYA 2DGOA 3FGVA 4CLLA 2O01C 1YWXA 1RT3B 2CG4A 4DF8A 4B17A 3UCZP 1AROP 2WW4A 4DSEA 2HYIB 4I2PB 1BUXA 2OKQA 1VQ9S 2HHUA 7FDRA 4WFYA 1GAOA 1NK4A 3UW1A 4CO1A 1HNWJ 2CDQA 1WF1A 3B54A 1Y9OA 1EETA 4BLGA 2FJEB 1LFPA 4KV8A 3I55S 4G1IA 1NDCA 3LPEA 1YJNS 1WSVA 1Y11A 1UWAA 2D3UA 3PRDA 1EQ0A 2XI2A 1Q7YT 1EB0A 1WJ9A 4ECSA 1U1QA 2E1PA 5EWFA 1WOSA 2GVDB 2CKWA 3EICA 5DGBA 3TP2A 3ZZOA 1JKHA 3KJNB 4I69A 4PWDB 4MIAA 1NKBA 3SIPB 3BEGB 1HNVA 4TY9A 2NXEA 2YNFB 5IZHA 2XMWA 4USVA 3H20A 3M8ZA 4F8RA 3AFGA 1S7HA 3GIMA 2QMWA 1LQ9A 2VG6B 2J9CA 2XYGB 2JEIA 2H54B 4XTTA 5D0GA 4GKJJ 4LF4J 3VWSA 3S1TA 1S9EB 3AJ2A 4ZPWR 4TXSA 3RRHA 1BXNA 2IM3A 3N6NA 3CMES 4A8KA 2DHHA 4A8WA 5I3UB 4ELUA 4WBFA 4BC9A 2ZUGA 3Q8YA 3PYGA 3CPWR 3OTEA 1M1HA 4PPDA 1HBUA 2WW8A 3GMGA 4BDPA 3MXHP 3E8OA 2VB6A 4ZPBA 4O4RA 4KAIA 3IR6B 3CJ5A 1TL1B 4PABA 2DISA 2NCKL 4TU7A 2F3JA 1UKUA 3KLIA 4N77A 2X1BA 1HBNB 4GRSA 1WG5A 4R0JA 2UUBF 4DL5A 4F04B 1Y10A 4WE1A 4EBCA 4LF7F 3KTQA 2EFOA 5EX3A 1N56A 1U24A 2YX7A 1T9XA 2LU1A 1RCOB 3C2PA 2GW8A 4LRDA 1BWVA 2V8GA 3E2EA 3IWLA 5CYMB 3C6UB 4GVBB 2OELA 4WIIA 5B09A 4IRCA 3V6KA 2J76E 3VAFA 3MM5A 1YVFA 1KQFB 2RKIA 4MYTA 5KFJA 1ZBTA 1GXLA 4WZQA 2IJRA 3KJVA 4OJGA 4WKRA 3FJ2A 5FDLA 1XQIA 4DR6F 1LW2B 3HJVA 5G0RB 1C4CA 5I3PA 3KXDA 2BABA 2VG5B 4DR1F 1L3SA 5B08A 3X1LB 3KWMA 3F73A 3PKMA 5ETLA 2HK2A 4U96A 3PEHA 1K44A 2V8VA 2KFYA 1SI9A 3CC2S 1M0SA 3TUPA 3DGPB 1VRUA 4K59A 2DNYA 1LK7A 3CIMA 4FKXA 3BBBA 4ZOSA 2X7IA 5LMUF 3IG1B 4V1Ak 5G4DA 2D3OR 1B7FA 1ZAWA 1JLEA 3DYAA 3K8VA 4LF9J 1DARA 3HSZA 4PCQA 3VAMA 2OUGA 3DN9A 2VBZA 4YHHF 4C0OC 2CRLA 2XSFA 3PR4A 2AP6A 5K8MA 1RAJA 4RWWA 4OX6A 3M1VB 2NR0A 1UPPA 2NQPA 1LFWA 4B08A 2F63A 1F5CA 2UUCJ 1J2VA 3W63A 4RW6B 1TKZA 2KTQA 3SFGA 4DJBA 3VAHA 3MMAB 2I5JB 3VAKA 1BWEA 4ZPTR 2ZH7A 3MM9B 3AAWB 3KLEB 2H4YB 2AZ3A 1KHVA 5C5JA 3T5KA 2BKOA 3DRSA 1H6KX 1NO8A 3NGRA 1RWOB 5K14A 3NS7B 1TL4A 5J2QB 4M8LA 3SQGA 5KG0A 4OIXA 4XPEA 1VQ7S 1HWIA 5DDPC 1N5YB 4DFKA 3C16B 3EPGA 4O4GA 4P7TA 1R0BG 2DNNA 4KE5A 2XLJA 2NSCA 1AZSA 2JEGA 1KR4A 3MZIA 4IG3A 2R7RA 1JXEA 2ALYB 1UTAA 3NOGA 2OJ3A 2M5YA 4NMLA 3P5TL 3M9OB 3D3CJ 1X0PA 2B43A 3M30A 3L3CA 4K0KF 1RT6A 1F3VA 1F6TA 3Q22A 2ZJPQ 5EN1A 4QQBA 3FK4A 2Z56B 1YTYA 3HVTB 3CUNA 2UVWA 4Y34A 3HT0A 2VKZG 3BR9A 3NRBA 2VG7A 4TLRA 1ZM2A 1HQEA 2XSJB 2WOMA 2L48A 3MCOA 2EI5A 4IO1A 2BXJA 5DZ7A 3M8QA 2GJFA 4ZVTB 2EG2A 3L09A 1KC8T 5LSOA 2BANB 3L95X 4C9DA 1MWQA 4UW2A 4DN0A 2V0NA 4Y3CA 1R0AB 3IXQA 4NLPA 1NH8A 1S6PA 4ID5B 3AODA 5LSRA 5L1IA 2DY1A 2K3KA 2WCXA 2XG8A 3MECA 1A9NB 1FE0A 2B8PA 1QM9A 1YBAA 1NJWA 4LMZA 3TO8A 1VIOA 5CZXA 4J9QA 2Y9HA 2YNHA 3HCXA 3R2DJ 3QT8A 1VI7A 3DKDA 2GGPB 1CJVA 2DR7A 3UNYA 1HHQA 2HBRB 1GEHA 3HD1A 3QWUA 3M2RB 2LEPA 5GAGU 1Q1KA 2ZBRA 2GAHC 2FC9A 4X62F 6FDRA 2XCAA 4DFPA 3H5XA 1C0TB 3BYPA 4KYZA 1NSAA 3C6TA 1UWBA 1BQNB 4I1TA 3K5NA 2IC3A 3MDFA 4LJMA 1CC8A 4JB8B 1XERA 2HHHF 2OGUA 3W2WA 4JI0F 3A1YG 4GKKF 4I6AA 1K0TA 3ITHB 2E5LF 2VJVA 1H73A 3OLAA 5HROB 3BBCA 1H2VZ 1U6FA 2HAIA 2JX2A 1KP6A 1U0HB 4PEOA 1H0HB 1KTVA 1REGX 2IAJA 2ZWPA 1M5HA 4F4AA 1ZM3A 4YB5A 2MQLA 2E66A 1NMEB 4E8UA 5D0RA 3OFGA 4O3RA 5KFEA 1SL0A 1FFGB 2RS8A 1C4AA 3S7RA 4Z7YA 5D3GB 1GTHA 2CQ1A 1X5PA 4YFUA 1JLCA 2EFGA 2MEWA 4LVNP 2H4WB 4FF2A 5K8PA 1FCAA 5RUBA 1RWMB 2XS5A 2XMAA 5I42B 1UA0A 4QIWD 2MY7A 4WYLA 3V2UC 4JUZA 4LRAA 3ADAC 1R8HA 2P5VA 2HHTA 1JLBA 3CVKA 1Y3KA 1IJFB 1RACB 4OJHA 2EVZA 3MOJB 4HT5A 3OV7A 3T1YJ 2V4JB 2YWEA 1GXTA 1KRPA 1VDHA 1J5OB 1V5IB 2IFXA 2L9DA 2W7OA 2COLA 4Y6IA 1FTCA 2HHVA 2BUNA 3QGHA 2CZ4A 4NI2A 2WVBA 3GFHA 4I2PA 4Y00A 3EX7B 2M8DB 3NG8A 4DV2J 3OXLA 3OR2B 4NX9A 2QA4S 1SBRA 4P7VA 3LGMA 3IBCB 1N6QB 1U09A 3NCRA 2PI5A 2BE2B 3OR1B 1NCLA 3JTOA 4Q0BB 2UV8A 2RD5C 2BJ3A 5HBMB 2FYXA 1NNDA 3VVUA 2V69A 2N4CA 3WC0A 2WSFC 3OSNA 1KSPA 3V6DB 1CPZA 3V81B 3QFHA 3IA0A 2CNOB 2W2NP 1RT5B 3LP0A 3R7BB 3H2VE 1TL5A 4DQIA 4DL7A 3MTKA 2DITA 4IO9Q 2EBEA 2OSRA 4N41A 2G0JA 4DPTA 2C3YA 3GLJA 4DL4A 2QFJA 1S9FA 4DZDA 1YJUA 4DV7F 1NDKA 2AX0A 4ED5A 2VG6A 4X4OA 5LMNJ 2P8IA 1X5SA 3GR0A 2HMIB 1VK3A 2KHDA 3GJTB 3DCAA 2B7BB 1S9EA 4W98A 5HJXA 1QSSA 5JJBA 3MM7B 1RQ0A 3V4IA 1A7GE 1ZA2B 5E3QA 1S72S 2ZDPA 1TL3B 3SDEB 3KK3A 5CCLA 4X4TA 1RAIB 3ETMA 1RCXB 1RTJA 5H9FJ 4QWEA 1APSA 3WX4A 3ISND 1KQSR 3KLHB 1TFWA 1QLNA 2VFSA 1NH7A 3DLJA 3RB3A 2R7TA 3G96A 1X5TA 2FJXA 1JJ2R 4HI1A 1F9FA 2YQ3A 1B64A 4QZVB 4YUDA 1FNMA 2FB0A 5DDRC 5HN0A 1FDDA 9RUBA 1YK9A 3PACA 4U9RA 3DXBA 4DU8A 4DX5A 2QLFB 3EYZA 4ECWA 1XTZA 4JOUA 4DV0F 2ZM6J 4OI0A 1HYSA 2FGOA 2ZJQQ 4G65A 1NXIA 2XLKA 2WAQD 4XPCA 3FMBA 4Y0FA 4YY3J 3EVOA 3VF0B 1JLFA 5LJ3Y 1NHUA 2V2QA 3QGGA 2CPXA 5G0RA 3OD2A 4JI3F 1DFDA 2IIHA 1M90T 4N8NA 3IWXA 1HARA 4RJVA 3M9NB 1BQXA 4LF1A 2UVVA 1X60A 3Q8VA 4I56A 5EUHA 4HACB 3UO0A 1FHTA 4JI5J 4PYAA 1ZPVA 2WZ1A 1OMSA 4MTPA 2GHWA 2KJWA 2MB0B 2HNYA 1B0VA 2LA4A 1U48A 2B4PA 2XGQA 4IDKB 2DKOB 2LQ9A 1KEKA 4PXCA 2QSFA 3CJSA 1S57A 1M5KC 1HMVB 3CE8A 4IFVB 2BACA 4CP5A 3BPSP 3PW2A 1PJ7A 3IN5A 1YJRA 3MUVP 1K1QA 1VQKS 3K5OA 3DLGA 3K89A 4OHYA 3D7SB 1M1KT 3UDLA 1TMJA 3GFXA 4NLTA 1BQMA 4CO0A 5EWEA 2BMBA 3G6ES 2AYEA 4DL0C 2WVCA 1WG1A 2ZD1A 2D9OA 3D0GE 4KHMA 4Z7CA 1EP4B 1PG5B 3RU0A 3UWTA 4OI1A 2BRLA 4ZLLA 3MTJA 2U1AA 2Q43A 1IBLF 4USJC 4FDFA 4WWSA 5ETQA 3PX0A 1ZTTA 5CD4H 2XY7A 3Q8QB 3D6TB 2H3EB 4B3MJ 1TFYA 1MG7A 4QIEA 3DI6B 2LQBA 1HI8A 2MLYA 2LXUA 3O2IA 2OP5A 4OZLA 2IPOB 3UR0A 1NHKL 3FZBA 3CGIA
chains in the Genus database with same CATH topology
4TYAA 1SJ3P 5B0AA 4Q43A 1QY7A 3KKFA 3R3TA 5AE1A 5KT6A 4CT8A 3HHEA 1XMOF 3K2YA 1H98A 5IFMA 1OQ6A 3N5FA 4YOEA 4U7UK 2OTLS 4RW8B 4OI6A 2YY3A 2ZHOA 1VRTA 1T7PA 4DSKA 2Z8QA 4I4BA 4OLPA 3H98A 3PW4A 3OTOF 4PKDB 2XMMA 3GFYA 1JLAB 1FRIA 2N3OA 2DGSA 4TYBA 3VQTA 2HLTA 1R8CA 2YNGB 5DQHA 4OZNA 2ZNZA 3D2WA 5DETA 1YITS 1QSYA 1HW9A 1F60B 4HT7A 1KD1T 1RTIB 5T7LA 2C42A 4ERDA 1LWCB 1XR7A 2L3MA 3DRRB 3LP1A 3M8PA 5FIIA 4A8MP 2RRAA 3QAUA 1JMTA 5C24A 1FVSA 3BSNA 3PX4A 2L9NA 1HI1A 5KFOA 2CPYA 4B9LA 4B3RF 1FDNA 4OL8A 5KFPA 2AYGA 3BQ0A 2F4VF 4DPOA 1VQPS 3N6MA 1RT7B 5K8OA 2W9CB 1RJJA 2CQCA 1RA7A 4KKOB 4ZVGA 1SKRA 2XEXA 1VQ4S 3MFIA 4RU9A 5DJBA 4ID8A 3VAIA 2JLGA 1NJIT 5A0YB 2W24A 4DWIA 1VQ6S 1R7IA 4ED7A 2XS2A 4NCAA 1UVIA 4OX7A 3T19A 2MZTA 5HP1B 2IRXA 1IKXB 2W4DA 5BYSA 3NBPB 2F7VA 4DX8H 1JWWA 1VJWA 5DM6Q 3CCRS 5HMYA 2ZHBA 2RILA 1Q82T 4ED6A 1D8YA 3FFIB 4HYKA 4EZ9A 4QW8A 1NJYA 4NZ7A 5HMXA 3MMBA 3MD1A 3EGWB 3THTA 4ZHRA 2W8KA 4IDKA 2RIJA 3K59A 2HIQA 4FVMA 1QE1B 4J9SA 5FLXY 1HPZB 1WTFA 2ZE2A 3D28A 4NRUA 5A6WA 2VBXA 4ICLA 1UVNA 3LOUA 1IQTA 4ED8A 1MMNA 3SSSA 2DR5A 1Q86T 1S10A 5F8MA 4EFAC 1IUJA 4IFVA 4DN9A 2DNOA 1U6BA 3MM6A 3J7YU 1V6HA 2XY6A 2QO3A 5GAGI 2QIFA 3CO9A 1IR0A 5EGYA 4IR9A 1HNIA 2HGLA 2DNHA 1DRZA 1P1TA 3QAEA 2VODA 4G6VB 5AE2A 2GX8A 3TAMB 3O6QA 3V6HA 5IT9Y 3SSRA 4YR2A 3BO3A 3H40A 5A6PA 3MEDA 2RQKA 4MK9A 5IM0A 3E01A 1N54B 3R5BA 3KK1A 1SJRA 5HMWA 1DJ0A 2ZKUA 2J9DA 5B0DA 5L8RC 3TOQA 4A4JA 2HS4A 2IJFA 4CO3A 1UVJA 2VFUA 4GC6A 4B3OA 5M2PA 2IMOA 3HHLB 4Y2AA 3N79A 2M3DA 2CPDA 3UR3C 3ZZPA 2RF2A 1MMDA 2V9WA 2ILYA 1U1MA 5KG4A 2ZC3A 4QYRA 4DL6A 4ILMA 1KNZA 2HHXA 3AA9A 1NU4A 3W7BA 4YDXA 3CDWA 3QZ7A 3ZZTA 4O44A 2HGMA 3UCGA 3O8WA 2W4CA 3X3UA 1KLMB 2JLFA 4OFZA 3B4DA 5F3ZA 4FBTA 1HNWF 4RBTA 1RTHA 4UQGA 1IKVB 1REVA 1ZAXA 2EK6A 4OZ0A 4A47A 5D6GA 4C8YA 1VQ8S 2VBWA 2FTRA 2DBBA 1WD6A 2GGPA 2PGCA 4H4KC 3G8TA 2VH7A 1WI8A 2AJ1A 4OLOA 4I2QB 1S1TB 1UFWA 2KT5A 4HDGA 2N3LA 2QT7A 4NXMF 3F44A 3MOZA 2D1CA 4DV6F 1NK9A 2G4BA 1HQUB 2ZFHA 4BHQA 3SI8A 3MI7X 4IRKA 4KQZA 3BDEA 3D0IE 3PW0A 1P1LA 2HRUA 4WZMA 2GMHA 1Y00A 2W9BB 2QEXS 1EP4A 1C0TA 1R43A 2P9EA 5KT5A 4O4GB 2D9PA 4OX9F 2YWFA 1W2BR 3EZ5A 3HZEA 4KHPF 3N5BA 1CQNA 4OJ1A 3MEGB 3VTIA 1NK7A 2C2DA 1SL2A 4B9NA 2R8HA 1RK8A 2HHPA 1VQMS 4A8XA 2XNQA 2DT9A 2MKJA 3MMCB 1D9AA 3JSBA 3LWMA 2IVFB 4QYZJ 5AXLA 4DQRA 2FJWA 4J9PA 1R3NA 4J5OA 2Y0SD 4FF4A 5A2QY 1S0NA 4LSLB 2M0GB 4H4KA 4U6PA 2ZH9A 4MK7A 5J2MA 2ZH4A 3LALA 2IYGA 2BOPA 2ZH6A 2C2RA 2LXFA 4URGA 3KHLA 3DXSX 4HL9A 3GR1A 1TKDA 2IHR1 3KOAA 4MKBA 3OW2R 2OD6A 1FF2A 2QA4G 3PY8A 2YKMB 3RB0A 3DI6A 1ULRA 5HLFB 4Y2IA 4DR7F 2ACYA 2HNZB 3BGFA 3LW5C 4KR0B 1T3OA 3VALA 1X4FA 5KFNA 2KKHA 2AF6A 2GMJA 4HLBA 4MKYA 4FXWA 1D9FA 4QWCA 1X4EA 4FF3A 4NZ0A 1JLQA 2PA8D 1TP7A 4TN2A 4Y28C 1XC9A 3TAQA 2RRBA 2IYIA 2HS3A 3OTDA 2DCUB 3BZQA 1SIZA 2J9EA 2BM0A 3GV7B 3CULA 4J9MA 4IH6A 1CLFA 4TLQA 1Z2LA 4C97A 4K4UA 1X4AA 4H4OB 1TV6B 2XY5A 4RW8A 4A48A 3WZ0A 3BGRB 4RKUC 5L38A 1S4FA 2P9CA 2Y1RI 4A46A 1K1SA 2VL1A 1SJQA 4LF4F 5CQGA 5BR8F 4OZ5A 1NRKA 3DLKB 1JLAA 3Q8RB 4DFJA 2JL9A 3QGPA 2DJWA 1S9GA 4AL5A 1VS3A 2OPPB 4JV0A 1ZM9A 2ZC4A 3PHEA 1ZM4A 4C0HA 2YNGA 3CCLS 2I2YA 5DDOC 3OL8A 1ZH5A 4ECUA 1GX5A 1V3RA 3J7YI 2POKA 1OPZA 4WK1A 3CJKB 4I64A 3PO4A 3O3LA 3HMJG 2UXCF 4WU3A 1RTIA 3M2VB 1ZPWX 2CQPA 1FKOA 2FHJA 2OFHX 1LWCA 3EGNA 3DRRA 2G0CA 2DNPA 1S97A 4IG0B 3LWLA 2FVCA 3UFCX 2KH9A 3T5LA 1U1LA 3CD6S 1Q53A 2U2FA 3S8SA 2HLUA 5SZTA 3VAGA 3AB2B 3PO5A 4ZDNA 3EPIA 1HA1A 2HQ3A 2E9ZA 1LWFB 1XNRF 4PG5A 2MJNA 3VAJA 2QRRA 3SZ2A 1RT7A 4E0DA 3OQ2A 2NZ4A 4GMKA 4KKOA 3KLGB 1T03B 3DOKA 3MHYA 2EFVA 1U4BA 1HD1A 2LMIA 1M5OC 5A0YA 2DIUA 4NA3A 2Z0GA 4D3HA 2E9TA 3SCLE 5HP1A 3NBPA 4DMZA 1VBYA 4QPTA 4NOHA 4FYDA 6FD1A 2MZRA 3FFIA 2FLOA 3HHLC 4ZPCA 3RRKA 1Q8BA 4NYZA 5LXRA 5C25B 1N5VA 4UOCA 4G1QB 1GH8A 2X1FA 1SH0A 3BJYA 2ZH8A 1QJHA 2KFZA 4ED0A 2I8EA 1QE1A 3KHGA 4DHVA 1AW0A 1HPZA 4ZVHA 4DG1B 4ALZA 1S49A 2Q79A 4CNZA 1ZYQA 2LA6A 4NA1A 4F25A 4F02A 2MGZB 1JXLA 2O5DA 4ILRA 5DLGA 4DQQA 2ASDA 4C8ZA 2AQ4A 1HBOB 3CDUA 3VZHA 1PGZA 1QAYA 3FNNA 2VQFF 3H4DA 1AUDA 2X3GA 2A1BA 1XWLA 5A8KB 3CF5Q 4B9MA 2JLEA 1S1VB 2O1PA 2OPRB 4V19X 1VC0A 4EBDA 3QIDA 3F56A 3TAMA 2PA3A 2CJBA 3CC4S 2R7QA 4LQ3A 1NJZA 4X4SA 1KLNA 3OTCA 2JWNA 2XZWA 4Q44A 4X2BA 4WXOA 5KG7A 3DLEB 2EFNA 4JI8F 1FRMA 1UAWA 4ILLA 1WEZA 5CH7B 3NP5A 2D3ZA 3I82A 2CQ0A 1EETB 1FXRA 3CCSS 1T95A 2V4QA 4ELTA 2XBPA 4ECRA 3OJUA 3V5RA 3S6EA 1C1CA 2DNGA 1KLMA 4KV8B 3NKYA 3NGDA 5L1JA 2P9GA 4TKTA 2M70A 1IKVA 5J2NB 4ZPDA 1DQ9A 1RI7A 4ZCKA 1UJ5A 5KG6A 4X4VA 3TX8A 3HKWA 2O66A 2RNEA 1ROFA 3FRYA 5KFAA 2DPIA 2BJEA 2XNRA 2LU2A 2CYYA 3TARA 3DRXA 1S1TA 4X4RA 1B0TA 2CQDA 1N6QA 1ZTWA 2VASA 2MZ1A 2BE2A 3CEDA 4PXBA 2C2EA 3IBWA 1HQUA 1NKEA 4HDHA 5HQ8A 4EWTA 2UXBF 3IC1A 4J9OA 4J9KA 1MROA 1U2RA 2E5HA 3HX9A 2W9BA 2NSBA 2B5JB 3LP2B 4ZVEA 4NLUA 3MR6A 5F8JA 2HG4A 1K9MT 2J0WA 1AXQA 1MWZA 3UE2A 4IUFA 4RW9B 2KYZA 1X4BA 2VKRA 2AGQA 2WBRA 1JKHB 1S99A 1RISA 2XWXA 2XS7A 1KONA 3MEGA 3O44A 3M6XA 2HWTA 5CYJA 1X4HA 4PG7A 4ZKAA 2XMTA 3R27A 1HNVB 2F9JA 4O0IA 4Y2MA 2DH9A 3V81A 1Z2ZA 2F1FA 3MMCA 4ZLPA 4IH5A 3P6YC 4PR6A 2N4DA 1C1BB 1N52B 3THPA 3HZGA 4R0EA 2BW2A 1WF2A 2ADBA 4Q8EA 3N0VA 2PIIA 3M6VA 1UFLA 3OSPA 2IJNA 4WF9Q 2R4FA 4OMFG 1O0PA 4F4WA 3HHNB 5E41A 3NL0A 1C2PA 3UI3A 2EC0A 2AGOA 4PUOA 3NAHA 3CTRA 4FVCA 4KIAA 3U1NA 1O8BA 3G8SA 1MU2B 4M1KA 2YKMA 4O3PA 2XCPA 5HLFA 1HD0A 4J9RA 2HNZA 2RH3A 2DNQA 4K2XA 4YB6A 3RAXA 1LWEB 2N82B 5JXSA 4RZRA 2QLWA 3EZUA 3L7OA 2DGUA 3OHBA 4OHVA 1URNA 3MGJA 3NNCA 1WEYA 3POTB 3D54A 4ITSA 3PRBA 2HVIA 4YQWA 3DLLQ 3WC2A 1YJTA 2OPSB 2IBOA 1IKYB 4NLYA 4WJBA 1FNOA 2CQHA 2HNDB 3N9UC 3DOMA 1CC7A 5F0WA 1DAXA 2ASYA 3AQPA 2B4OA 4LF9F 2XB2D 3E51A 3OXFA 4JI2F 2OAUA 5DQGA 2OTJS 2X1GA 4NLDA 2NLWA 4H4OA 1JB0C 1TV6A 2K7JA 4CI0B 3KHHA 4K4SA 1RTDB 5A8WB 1T94A 3LAMA 2RQCA 4LFCF 3BGRA 2RSQA 2XMVA 2ILZA 3IGVA 4R8UB 4QIFA 4QOTA 1DTTB 2IRYA 4NLVA 4QWDA 3NNHA 5F8IA 3BO2A 4KRWA 4URQU 5KFWA 1D1UA 3DLKA 1G2EA 4EO8A 1X8DA 3GSDA 4IFYB 2YX1A 3HM9A 2R2RA 2BA9A 4IH7A 3K58A 1KVJA 1H2TZ 2LXIA 2AJ4A 3CJKA 4LIRA 4FS1A 2WB4A 2WTFA 2LQJA 3E3XA 2V8DA 3M2VA 2GO8A 4ZCLA 5BYRA 4BWJA 3RW7A 4WFNQ 5DG9A 2KZMA 4EYHB 4B3SF 2M8HA 2IM2A 4IG0A 4NCGB 4HTIA 2ROEA 3EXYA 5KFTA 3T3FA 5E3PA 1R31A 1HBUB 1XR5A 4PXDA 3UNGC 2DGVA 2FD2A 1N5QA 1LWFA 3SV4A 2D7SA 4B9SA 4ECVA 3KLGA 2UUCF 3HFKA 1T03A 4NLSA 3DDNA 3CJ0A 4MJKA 3G4SS 3TR5A 3SCIE 4Q7AA 2OMOA 2FDNA 3LH2S 1RP5A 4I0WA 2KJVA 1G3OA 4RNOA 4RNMA 1ZZNA 5K8NA 3HHKA 4K5SA 2GCFA 4TNOA 1YQHA 1PC5A 5DS7A 4IKAA 5C25A 1Z4UA 4G1QA 3KLIB 4H54A 3FMWA 3W2VB 3MPYA 4QCLA 2DGOA 3FGVA 3HF5A 2IRUA 1UW4A 2O01C 4DG1A 4Q5VA 1YWXA 2GFFA 3PW5A 2GIRA 1FJGF 1RT3B 2CG4A 3BREA 2MGZA 2M2BA 3TUIC 2MHNA 1HBOA 4DF8A 2MZJA 4WE1B 3ONQA 4C8MA 3KHRA 1K8AT 3CCQS 1YG0A 5B0GA 2J8AA 2ERRA 5A8KA 4B17A 3UCZP 1S1VA 1AROP 2J6UA 2OPRA 1FJ7A 3BR8A 3OVAA 3IAM9 4DSEA 2HWHA 4DEZA 2HYIB 4I2PB 5E5NA 2OKQA 5KT2A 1VQ9S 2HHUA 2R7OA 7FDRA 2QA1A 4WFYA 2QV6A 2RUGA 1GAOA 2C22A 1NK4A 3DHXA 4DUYF 3DLEA 1KOHA 4KC5A 2B9XA 3BS9A 5KG5A 2Q6BA 2E44A 1V3ZA 3GILA 1XMQF 2R8KA 3K0JA 3UW1A 2XMUA 4CO1A 3KNGA 2CDQA 1WF1A 1Y9OA 3NAIA 1EETA 3G6XA 2UVRA 2FJEB 2H5EA 2KT2A 1LFPA 3AJ1A 2DR8A 3MEEB 5D78A 1IQZA 5D77A 5FJ4A 2CQ2A 3CDAA 4KV8A 3M8RA 2QA2A 2B56A 2BBEA 4QR2A 3KG1A 5CCMA 5E2QA 3CXCR 2HHWA 3I55S 1M5PC 4CCHA 1QTMA 5J2NA 3CB4A 4NRTA 2RKIB 4G1IA 4LIWA 1D3WA 1YJNS 2J6TA 1XK8A 3OVSA 3BSOA 1Y0HA 5LT5A 2D3UA 5FDLB 2JEJA 3RAQA 3PRDA 3UD4P 2XI2A 1RT2B 3MD3A 5L1LA 2R2UA 1V9OA 2ZOGA 3BQ2A 1Q7YT 3NMRA 2JRSA 3B8HA 3FRZA 5E3AA 4D3GA 1CVJA 1FRHA 4HVZA 4ECSA 4ZP9A 1U1QA 5EWFA 1PC4A 2CKWA 1S0MA 2BQUA 1HWKA 1JNRB 2XMJA 4M95A 3NS5A 4F4YA 2VFTA 4NLWA 5KG3A 2B5JA 3LP2A 2FHOB 2V94A 4H4MA 4YEAA 5D4NA 4BCAA 3AA8A 4RW9A 3I31A 5DGBA 3TP2A 3ZZOA 4RUCA 2GJ2A 3IFEA 1JKHA 3IRXA 4I69A 4PWDB 5EX0A 4OZ1A 4K4ZA 4MIAA 2BYCA 4MK8A 2FGCA 1UVMA 3FEYB 2JVRA 3ENVA 1NKBA 3BEGB 2J0QD 1HNVA 2BRKA 4TY9A 2DNRA 3THVA 1RKJA 2DRBA 2ZHAA 2YNFB 2VFRA 1C1BA 1GQEA 2DD8S 5IZHA 1NKCA 2XMWA 4LUBA 1GX6A 3H20A 2DR9A 1ZAVA 1VRUB 3I5CA 1U49A 2JDJA 1BD6A 4JV5F 2W9AA 1DTQB 4NXNF 4F8RA 1E6VB 5HO4A 4NZ6A 4ZCIA 1KS2A 1MU2A 1TVRB 3NMAA 1N5TA 1S7HA 3GIMA 4O3QA 1JLEB 1LWEA 5KFYA 2CIMA 3DYAB 4DFMA 1H7XA 3O5TB 4NA2A 4DS5A 2QMWA 1LQ9A 2CPJA 3I4HX 1SH3A 2E9RX 2VG6B 5KFHA 1ZZFA 4AL6A 2Q1LA 3POTA 4OV1A 4NLQA 2J9CA 3NWGA 5F41A 4MKAA 4ES2A 2OPSA 4DR5F 2KRBA 2YKOA 2MKKA 2HNDA 3US5A 3TRGA 2J5AA 2JEIA 3MCSA 2AD9A 3RR7A 2ZOFA 3VWSA 3OBIA 3PJXA 3S1TA 4IOCQ 1S9EB 1VIXA 3RYLA 2WONB 4OI4A 5A8WA 4IOAQ 3AJ2A 1UJ4A 4ZPWR 4R8UA 4Z2XA 4TXSA 3RRHA 1I6JA 1DZ5A 1DTTA 2KO1A 5KFBA 4UUXA 1WF0A 4WCEQ