1FTRA

Formylmethanofuran:tetrahydromethanopterin formyltransferase from methanopyrus kandleri
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
296
Chain Sequence
b'MEINGVEIEDTFAEAFEAKMARVLITAASHKWAMIAVKEATGFGTSVIMCPAEAGIDCGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRVGYKLSFFGDGYQEEDELDGRKVWKIPVVEGEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSKQYDFLPASTNDAYCPTVEDNELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMYLMETHANOFURAN\:TETRAHYDROMETHANOPTERIN FORMYLTRANSFERAS
publication title Formylmethanofuran: tetrahydromethanopterin formyltransferase from Methanopyrus kandleri - new insights into salt-dependence and thermostability.
pubmed doi rcsb
source organism Methanopyrus kandleri
molecule tags Formyltransferase
total genus 85
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 1997-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
A PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ftrA02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ftrA01
1FTRA 1M5HA 1M5SA 2FHJD 2FHJA 2FHKA
chains in the Genus database with same CATH superfamily
5DO2A 3BGLA 3P49B 4BLGA 3RB0A 2XNQA 2YNFB 3UCUP 4P73A 1VQYA 4RW6B 4ID5A 2D3O1 1EB0A 4KH1B 3GFYA 3PHTA 1IBLF 1IJFB 2BV3A 1NJXA 4QR1A 2C2KB 2CPDA 1PGZA 5DQHA 1PJ6A 3A1YG 4LRAA 4NI2A 4YEAA 2DITA 2FHKA 2HQCA 4Y2AA 1NK4A 1KLMA 1FJ7A 1KTQA 1L5UA 3Q8YA 2JEGA 1VQ9S 3OL9A 1M0SA 5DLGA 1W2IA 2XLKA 2B7BB 4O3OA 1PBUA 3I4HX 2H51B 1SJ1A 1S0OA 2LEAA 4A46A 3QRPA 1CS4B 3CW2C 2ZM6F 1U1LA 4UOFA 4QIWD 2JLGA 1R0AB 3MOJB 1RTHA 1FERA 2R2TA 2JOQA 4RW8B 4CLWA 2GS8A 3A8EA 2K1RA 4X4OA 1VQLS 3HCXA 1JLEA 3E01B 2ZZMA 3KUEA 4QPXA 4LSNA 1CJTA 1KKHA 3TA2A 2XMVA 5SZTA 4KFBA 1JLBA 3UW1A 2DPJA 1VQ6S 5AJ3F 1A9NB 3HSJA 3Q89A 2FC9A 3DLBA 1OSCA 4DFPA 1YKWA 4S0MA 3MUMP 3ILOA 3GU0A 4DR1J 5AXLA 3K17A 2ZM6J 1HNIA 4FXDA 3IO1A 1BGXT 4NRUA 2KFYA 1UWAA 3QJPA 2KTQA 4DZ6A 4C11B 2G0CA 1RTDB 1PJ5A 1X4GA 1PILA 1HQUB 3VAHA 4YB7A 5KFIA 3JTOA 4Z7YA 4W90B 1FWLA 4DV4F 4OI2A 2CNKB 2NXUA 4LF1A 4U67Q 2MKHA 3TQEA 4CLUA 3BKUA 4QWAA 3JTNA 1C1CB 1RHMB 5I42B 4F7VA 3C66A 4Y2IA 1LFWA 3VWSA 3PRBA 2CQBA 4DPYA 3J81j 1IR1A 2Y8WA 1VRUA 3WX4A 1N8RT 2HBQB 4F26A 2GQ2A 3GTYX 3TA0A 4Q2LA 3TI0A 1SUQA 2G4BA 1RWKB 3BN4A 4DX7A 2OPQB 4LT6A 1TL1B 5IC4B 1UVIA 2B0GA 4PPZA 3GCWP 3QAUA 2RDJA 4DQQA 2YKMB 2J7KA 2BJ1A 4F4WA 4C8KA 4J9PA 3D0IE 4YR2A 3BN7A 3M8SA 3SEOA 1WKKA 4Q5VA 4CO2A 4FXWA 1DQ8A 1WC4A 4ECZA 4C3MA 3WHIA 3I6PA 4HHUA 1ACMB 1NHUA 1PC4A 4PPDA 2K7KA 3V6JA 5LL6d 3M30B 4EFAC 4N56A 2PE8A 4KE5A 4DLGA 2YWHA 1ZA1B 4B9UA 3BGRB 4ZITA 4IRCA 4JI8F 1IKYA 2FLPA 3F56A 1S6QB 5ETKA 4MMOA 2ZD1B 2RUSA 2DXEA 2B5JA 1VYAA 3W8GA 2KRRA 3KG1A 3A3NB 5IT0A 1S6PB 2ERRA 2E5HA 1U1KA 1KVIA 2OMOA 2B9EA 2WB1D 1Q16B 4QW8A 1LWEB 1UZHA 1JJ4A 2LA6A 2JHEA 2X1GA 4K4ZA 2ATLA 4YR3A 4MKAA 4UQGA 2DYAA 3KK3A 4NEYA 3MOZA 2ZHOA 2GJIA 4QYZJ 3PYEA 2OO4A 1YG0A 4M5JA 1IBKF 1KQSR 2XTJP 3CDUA 4NX9A 3FSYA 2VQEF 4JI8J 1C2PA 3G86A 1EP4A 2EFGA 1MNEA 2QFIA 2XWXA 3EZUA 1XNQJ 2K06A 4ZIVA 1Y5LB 3FQLA 3A8IA 2CJKA 4IYQA 2W1BA 2LXIA 3N5FA 1FD8A 3N9UC 1R27B 1PCAA 4OZNA 2RH3A 2DNQA 4CQ1A 4F3QA 4OZ2A 5B0EA 1P27B 5G0RB 4AXJA 1B0TA 1DARA 4FF3A 1LV5A 4CYUB 3OTDA 2BMBA 3C15B 3HULA 3MCSA 1N54B 3T1YF 4ETZA 5AE1A 1OS5A 1RTIA 5DGBA 4FNIA 1FF2A 1CULA 3DI6B 5KFSA 2VBWA 3NCQA 1R8AA 1X4HA 1NHKL 2VQEJ 1V5VA 1GT8A 4F36A 1D9DA 4NLWA 1S9GB 2Q3PA 4GVBB 4IG0B 1R89A 2IPOB 3BV8A 1Z2ZA 1JLCA 4TY8A 1X4EA 1HNVA 4NPOA 4LR9A 1JLQA 4ZP8A 1KC8T 3I0RB 1VFJA 1WI6A 3MCNA 4NE9C 3NAIA 3OR1A 2AHOB 2V8PA 2AYGA 2LQ9A 3RJMB 3FVYA 1FX4A 5IC6B 3T1YJ 1QVFR 3DYAB 4K2JA 4K50A 4O4RA 1VS3A 3KK1A 3WC0A 4L73A 4OX6A 2AGQA 2MZJA 4UOCA 3OL7A 4OZ1A 2HMIA 3VALA 2F4FA 2BOPA 1S1TA 2HZVA 4DSKA 3KG0A 4ZDNA 1K1SA 4F4KA 4JI0F 1FVQA 2OPPA 2V8VA 5M2UA 2YKQA 4M95A 3BH6B 2BOAA 3HVTA 3QRRA 3NRBA 4A47A 3QQCD 3HX9A 4IQMA 3V4IA 4USTA 2R7WA 2BJ8A 4CH1A 2MJNA 3HPOA 1ZZNA 1FJGF 1A6LA 1MWQA 1RHUB 4ELTA 5F8IA 2D7SA 2GX8A 2YNFA 2XMMA 2I5JB 2E5JA 2OSRA 2LP4A 3R9LA 1V3SA 2LKZA 2PDAA 5KT7A 4MFBB 5A8RB 1UFLA 1WG1A 1GTEA 2IVFB 2FHJA 3DKDA 2MZ1A 2AU0A 4N7TA 3C14A 3QO9B 2BQRA 3FNNA 2QZ8A 2Z56B 2Z2LA 4I7FB 4I2QB 2R8IA 4YB6A 1Y10A 4LSZB 4A8YA 4M63A 2YX4A 2I1RA 2ZWPA 4ZVPB 3UVJB 5CD4A 4QYZK 1VQSA 2ZH6A 1CS4A 4LF9J 4CZCA 3PEHA 3BF4A 4P2MA 3ZNUA 1HWJA 3LP0B 4DCPB 5BXIA 1X5OA 2RUGA 4C97A 4CO1A 3THTA 1GXLA 2IJRA 4EYIB 3E01A 4FYDA 3L7OA 3MR3A 3C6UA 4RW7B 2LU1A 3HD1A 5KFYA 3MMBB 5LMUJ 2YVSA 2MPUA 1RXOB 4HTJA 1NDKA 2QO3A 2BQUA 1U25A 2EBEA 1UEUA 5FJ4A 1SL2A 2RDDA 3WX8A 3K5NA 5GMDA 2Z2ZA 5CYJA 3DLEA 4TN2A 3MWBA 4W98A 1TR0A 4LF5J 2HRYA 2IJFA 1HNWF 4IG3A 2BX6A 3A8KA 4TLRA 1URNA 1T9WA 2J9DE 3OBIA 2V68A 2I9SA 4DR5J 2O66A 1S7IA 2DGXA 1LWXA 3O44A 4MYTA 1BD6A 5KG0A 2GVDB 3VZIA 1IN0A 3OT9A 3SI8A 4KSEB 2HZCA 4ED8A 4DV2F 3PW2A 5E5NA 2VONA 3OR2A 2MKCA 1Q53A 1SH0A 2K3IA 4DR3F 3VQSA 1VQ5S 2V8GA 4I0WA 2WONB 1S0NA 1TL4A 3OSNA 2HFZA 1RTJA 2JEJA 1Y00A 3TO8A 4ES1A 1SL0A 2B4VA 2CQ2A 1TTHB 2DGTA 4YB5A 3FCVA 4RU9A 1VQ7S 1N33J 3EXYA 2F7VA 3TUPA 3J80U 4ZVEA 2J0SD 1JKHB 3W3SA 2GJ2A 1WC0A 2DEIA 2PO4A 4OYPA 3U02A 4J9NA 4HH0A 4AD6A 3GSDA 1IJEB 5E3RA 2AZ1A 1U8WA 2RSQA 1FKOA 3HZEA 2XCAA 2E9ZA 2OH2A 1T03A 2XZDB 1CVJA 2AF6A 4KQZA 2B4OA 2NUHA 2QYGA 2Z2MA 2H5IB 1AFIA 4DUYF 5ETTA 3GPAA 3H5XA 3DHXA 1HNZF 2CNOB 5IT9Y 2HAIA 5LMNF 4LF7J 5KFFA 1EETA 2EEYA 2W8KA 1JNZB 1NO8A 4GMKA 1TK8A 4OI1A 1GX5A 4B08A 4NLYA 3QZ8A 3M30A 4OYXA 2ASYA 5DRKA 4LSLB 3OUYA 2XLJA 3J7A1 2IBOA 2L9NA 1J5EF 5L9XA 1XN9A 2B4PA 1YZ7A 2ZH8A 1T05A 4FF1A 4XAKA 1AB8A 1O6XA 4G1QA 4J9KA 4ZA1A 1RADB 2IA6A 4MAKA 1HWLA 2B6AB 3KFWX 2C2OB 3M4XA 3E8OA 2RRBA 3IR5B 3ZZPA 4DPUA 3TAMA 3ISZA 2XY7A 4NLPA 4Q44A 3ILJA 1SIWB 3AA8A 1RP5A 4WP3A 3M8QB 3KJVB 4LF4F 1RZMA 2HVHA 2HYIB 1BXNA 2W2NP 3MUVP 4NCGB 3NP5A 4JUZA 1J5EJ 3DLKA 4ZS6A 1IVZA 4QIFA 5KG3A 1QUVA 2C2EA 2DXDA 2VBZA 1S79A 4OX9F 4ED4A 4GC7A 2L08A 3NOCA 2VOOA 3CCUS 2D3OR 2IMOA 2YWWA 4ED2A 3FUYA 2W4PA 1R0BG 4DL5A 4DX8H 2XSJB 4FPIA 3FBBA 2Q6BA 3ZZTA 5HQLA 2RQ4A 4DWIA 3W9HA 3ETOA 5G0RA 3HKZD 3LWLA 1WOPA 2XM3A 4LF4J 2HRUA 4Y3CA 2CAJA 3FGVA 2XLIA 3TANA 4WFBQ 2K7JA 5CABA 3DI6A 1GEHA 2AQ4A 4FYXB 3IMQJ 1SL1A 2RRNA 2M88A 1BQXA 4JYAF 4ZPBA 2Q66A 1MSWD 3OHBA 3FK4A 3VV2B 2QE5A 1Y3JA 4CO4A 2OPRA 2XMAA 5LJ3Y 4G1PA 4WKRA 3KK2B 5J2QB 3HI9A 4OL8A 3B4DA 4RW9A 3T1AA 3CPWR 5ETMA 3H42A 4ZVHA 4ZOSA 4PG6A 1GMVA 5A0YA 2MSTA 4ED5A 1VRQC 1RWPB 1LW2B 5EUHA 1OQ3A 2DNLA 2LYVA 2WSFC 3G4SS 1FDAA 3CCQS 3B8HA 4X65F 2UVVA 2KVQE 2W8LA 2G1DA 1APSA 2E5LF 5B08A 3Q24A 5E3CA 1H2TZ 3W2VB 1N34J 3J7YI 3CC2S 3DLGB 4G3IA 4FBUA 4MIBA 2HW3A 2UU9F 4ZLLA 4IOCQ 4CO5A 2KU7A 5F3ZA 3MR2A 1Q95G 2XULA 1AW0A 4X4TA 2JEIA 4ECUA 5B0GA 2D9OA 1NZAA 5DS7A 1RCXB 2JFDA 4C8MA 3LAMA 1RKJA 1SJFA 1RT1A 1XWLA 4HHJA 4DUZF 1M5OC 2IC3B 1UPMB 2GCFA 3IN5A 5IM0A 2P9CA 4PXCA 3M32B 2R8JA 4I67A 2HHQA 3M8WA 3UD4P 1OY9A 3EUNA 3ZTOA 1F3VA 4HEA9 1MLAA 4OZLA 1WSRA 1WDDA 2EC2A 3B6BA 2E1RA 2A3JA 2AYBA 3N6MA 4NYZA 2RB7A 1SJ3P 3HVRA 3F0NA 4ZPAA 4QW9A 4X66F 4ANCA 3DLLQ 1QE1B 3GJTB 5HJYA 1Q5YA 5B09A 1G2EA 3EVMA 1NM2A 1R6YA 5CQGA 4PABA 2CQ4A 3M8YA 5BYQA 4URGA 1X9SA 2JWNA 3US5A 1JMTA 1IBCB 1CJKB 2CZ9A 3PRVA 1GAOA 2X7IA 2WCXA 4LQ9A 4JI4F 3GV8B 3TOQA 2AP6A 2MKJA 3FJ2A 3T9NA 3ADAC 2LA4A 3LPEA 5KFMA 2JX2A 3D6MB 2QLJB 4WE1A 4B9MA 1FK9A 5HJXA 4C98A 1UAWA 1FXDA 4KV8A 4RL1A 1YJ9S 4HDGA 2L41A 5DDRC 1HMVB 2MJUA 4OLPA 1FRJA 4KHPF 3NNCA 3PX6A 4RNFA 3QIPB 4Y34A 2HZAA 4DL7A 1SCJB 3M8PA 3IR6B 3BGOP 1HBNB 2R8GA 3IRWP 1WEYA 4JI4J 1R0CB 3RGIA 2YH1A 4PUOB 1L3SA 1CLFA 3KLIB 1R8CA 4HI1A 2F8MA 2AWZA 1U0HB 1S4FA 1KS2A 2GVDA 4LQ3A 2RKIA 2E7WA 4L76A 2VH7A 3AOAA 2YY3A 1MROB 3V6DB 2Y0SD 2BR0A 4F02A 5LOQA 5EX3A 5B0DA 5A8WA 4DV5F 4RBUA 3R3TA 5HMZA 2R7SA 2WONA 4TQRA 4DPXA 2E29A 7FDRA 4QIGA 2FIUA 1NSQA 2V94A 3LUYA 4MK7A 3JTPA 2DD8S 2IIHA 1OQ6A 1ZPWX 1WKLA 1F2HA 1R8BA 2V0NA 1YJ7A 2XWYA 4LUBA 2KH9A 4IKAA 3FSIA 1ZYQA 3G2XA 2DNHA 4DL3A 3CCRS 3BDEA 2HFVA 5FD1A 3PO4A 3C3LA 1IQTA 3G9CA 2E9TA 2J0QD 1SC4B 4BWJA 1IKXA 3R2DJ 1Q8LA 3I82A 3HD2A 3OD2A 2QG9B 3D2WA 2FZCB 3C16A 3CDAA 1PYSB 3IRXB 2NUUG 5AXMA 2RIJA 3I9ZA 1RLDA 3DRXA 2IAJB 1TKXB 1U09A 3RB4A 2BJDA 4FF2A 1N32J 3TX0A 1XMQF 2MLXA 4ID8A 4P6QA 2FJWA 1FXRA 5DETA 3DOKA 1ZOTA 3POTA 4LSLA 3HHKA 4RPFA 5JVHQ 1SKRA 2DGUA 4MT1A 5LXYA 5DZ7A 4ZVOB 4UY85 3CCLS 1VQOS 1S7HA 2DH7A 5K20B 2UUBF 4K4WA 2EWHA 3TZYA 3LWMA 3Q86A 1RT3B 3T1HF 2UVUA 2B6AA 2H54B 2F63A 5C24B 1X5PA 1F5CA 2FVRA 3FQKA 2OMLA 3MAAA 4WK1A 1KLNA 2CPXA 1TKTB 2EVZA 3CCSS 1SQGA 2QFJA 4ZVTB 3VVTA 4N5SA 3PR4A 4A8MP 1S10A 4UT4A 1VR6A 1XMQJ 3ILIA 4FPRA 4Y6IA 3KJVA 4A8SA 9ATCB 2QC3A 1KVKA 2M9KA 4LF8F 5EWFA 1RGVA 3MPYA 3M2VB 3K7RA 2WVFA 4P52A 4YUDA 5ETVA 4TQSA 2YKOA 4JV1A 2APOA 4GKKJ 3GCXP 2QL9B 4KIAA 4LFBF 4NEZA 2KT2A 2ZH5A 2OIHA 5I4MA 2HG4A 1F5AA 2DY1A 3EGNA 4XDCA 3LTOA 1PSDA 4O3QA 2VDIA 1Q79A 4OYZA 3T3FA 3WIVA 1AZSA 2V4JB 4PRFA 1RAJA 1NDPA 2KHDA 4DV0F 2BE7D 2KZMA 4PWDA 1S48A 4LFAF 1ZETA 3IWXA 4IR9A 4LVOP 2FLOA 2OD6A 3PZPA 2HK2A 2CZ4A 1NJYA 3IGNA 3N79A 2J76E 1Y5NB 2J8AA 1OY6A 5HAOA 2ZH3A 4O0NA 5J2QA 2BYCA 2KG0A 4QWEA 2FD2A 3UFCX 1WD6A 3MMCB 3J7ZT 4G1IA 3AODA 3CJQA 3D1QA 1C1BA 1FJEB 4J9VA 5K8OA 2B43A 3BBCA 3TARA 4RO0A 1N0UA 1YITS 2V67A 4KAIA 3W5YA 3FBEA 1PG5B 3CCTA 3DOMB 4HL9A 3L7UA 4DV0J 1YJWS 2DHHA 3W2VA 3V81B 2UVWA 2WW8A 1M5SA 4QR2A 1DJ0A 4LFAJ 3RAXA 1SVDA 3AY0A 5KFGA 1BY9A 4J90A 3SZ2A 3OXGA 2G13A 4HVZA 3EGZA 2C42A 1U1PA 1K0TA 2YTCA 1GFWB 1AFJA 4P72A 3OTBA 1UEVA 4V19X 1V5IB 2W4CA 2FJEB 2DBBA 2BW7A 1NNDA 4OJ1A 3MUTP 2QRRA 2NYIA 3PEJA 3VAJA 3UDVA 1D9AA 4LIWA 2CQDA 2DNPA 2Z0GA 5J1EA 1UVMA 1LEOA 3CWJA 3TUJC 4P75A 4EMDA 2XGPA 3D66A 2Y0BB 2LEPA 5HL7Q 3JS9A 2HNDB 5CH7B 1TAQA 3CXCR 1T95A 4CTAA 2OELA 4OZ3A 1H74A 4UTGA 1NDCA 2H3EB 1FRLA 4WKYA 2YKNB 1M1GA 4ER8A 3Q83A 2JC0A 5KFAA 4Q0BB 5KOWA 2EK1A 3E3XA 4IFYB 1RQ0A 1RAFB 1VK8A 3DNCA 4PWWA 2Y8YA 2WK4A 3UN2A 4P7TA 2WTFA 3NLCA 1JXVA 3IR7B 1MU2B 1XMBA 3EWGA 3G82A 4PQUB 2KFZA 1Q8IA 1I5OB 2WHOA 4UW2A 1HBMB 2WBMA 2LXFA 2GJFA 1WTBA 5KFTA 4ECYA 4WIIA 1C0UB 5J2NB 3NY0A 4OHWA 4NLUA 5DQGA 2DCUB 3I0SB 2QSFA 2HIQA 2VFUA 3NKYA 3H40A 4J7CA 4Q43A 3U1LA 1OSDA 4O4GA 3VQTA 1XIQA 4CH0S 2UXDF 3U27A 1TKZA 1REVA 1TL3A 1TVRA 2VPXB 4ZLNA 3HJFA 2PEBA 2RT3A 5L8RC 2RMLA 3RAQA 3D3BJ 2AGPA 1TFYA 3UNYA 1F5BA 3QIPA 4EBDA 5KT3A 4O3NA 3KLHA 2MKIA 2DIVA 1HBNA 2C1EB 4ZVRB 3MGJA 4PUOA 1PO6A 2CXEA 3E51A 3KLIA 5F8HA 2ROPA 3MMJA 4EBCA 5DG9A 1S99A 1DTTB 4K4SA 1KNZA 1HARA 1UPPA 4WP9A 3SCKE 4TVAB 4M94A 2P6SA 3OLAA 4DSLA 5B0CA 2C2NA 3ENWA 3HDSA 1YWXA 2V34A 1MN7A 2B9WA 1V3ZA 1HL6A 2BE2B 4J9SA 3LO3A 2YKAA 1DTQB 3AAWB 4R8UA 1S12A 1H2VZ 4P9SA 1YGYA 1U6BA 4ZPVR 2CG8A 2KO1A 4EI2A 1VIXA 3VGTA 4U8VA 4V1Ak 2JH3A 3SDEA 4DR7F 1W2BR 5DQIA 1N6QB 1BE4A 3RU0A 4NA1A 1U7LA 3QBCA 5J2PB 5IT9U 2ZDPA 3ILLA 5ADZA 3GIJA 2VG6A 2FVPA 1FDNA 5DDOC 3M7VA 9RUBA 3BB5A 4ED1A 1TV6B 2W01A 3FDSA 4H4MB 1WEXA 1P8GA 3O1LA 2NCKL 4NLSA 5G4DA 3KDNA 5GAHI 1U2CA 3RYLA 3IRXA 2E7VA 1RT5A 2CDQA 4M5GA 2HK3A 1IKWA 1FHTA 2KDOA 2DKOB 4RUBA 4B3MJ 1SQEA 1RWVB 1FFSB 4IFVB 3MM8B 3NNAA 2C2ZB 2MZTA 5E2QA 2ZDOA 2W7PA 4LFCJ 5CCLA 3A8JA 1F60B 2FDNA 3ZZOA 2NREA 3CGIA 4J91A 3KG4A 2EI5A 2RE1A 5FIIA 4H4OA 4A48A 1FXLA 2WSEC 2DNNA 4O3SA 4QCLA 2AJ0A 5CZVA 2PD1A 3LAKA 1RSCA 1H7XA 2CQGA 4I1TA 2VPZB 4N41A 3P4UB 2E1MC 5HP1A 1RT3A 3TZWA 3D1HA 4KO0A 5C24A 4ECQA 2X3DA 2V4QA 2BANA 4RU2A 5LXRA 4LF2A 1RLCL 1ZM4A 2CJAA 1UZDA 1FTCA 1NPRA 5D3GA 2DK2A 3MM6B 3ET6B 2MB0B 4P2FA 4CLTA 1HI0P 4LRFA 2OLWA 1BQNA 4LRDA 3C8YA 5C42A 5K8NA 2KHCA 4MK8A 4DPWA 4RZRA 1U1OA 1L3UA 1S1VB 1MMLA 3S8SA 3ZZYA 3PRDA 3FRYA 2YX7A 1HWIA 3O6QA 4YDDB 5I3PA 2B4UA 2RS8A 3H0PA 4NI2B 5THWA 1KLMB 1TZ0A 3MEEA 4AFFA 3I55S 2BKOA 2LLZA 5EX0A 3OVBA 3ISND 2RHSB 2R7QA 4WF9Q 3D5MA 2GFFA 2HHPA 1SBRA 2AJ1A 4WFZA 3MAQA 1RTHB 4C8NA 2BM0A 1KWMA 2K1RB 4RNOA 4B3TJ 2Q1LA 3NS7B 5M2RA 1JLEB 4LSNB 4G65A 3HSGA 1O51A 2MMYA 1CJTB 3FRZA 1S77D 4KFBB 2R42A 2LCWA 2GHWA 1JLBB 3SXLA 1YDLA 3HO1A 3DRYA 1WC1A 2DRDA 3FZBA 2XYPB 1YRXA 5FLXY 3AD8C 3QGGA 4R5PA 3MEGB 2B3TB 1U8SA 3SQGB 4OZ0A 2V2ZA 4KPYA 5HMYA 5IQQA 3CDWA 2AGOA 1SC3B 4TKTA 3MR7A 4E8UA 4WFXA 1HNIB 2GMLA 4TYBA 3K5LA 3OTOF 4Z7CA 2IBKA 3H4DA 1R31A 1J27A 1WC3A 3NS6A 3H98A 2ZJPQ 2JJ4D 1RBOB 2Z57B 4YDXA 3K0JA 2JC1A 5K14B 4DLEA 3VAKA 2HQFA 4HTIA 3W66A 4WP8A 1WHYA 2VHGA 1SH3A 2CUYA 4GC6A 4HT7A 4BS2A 2XO7A 2GHPA 4NXMJ 4J9OA 1IR0A 4JI1F 4ALZA 4FYYB 5D4PA 1EARA 1C4CA 4X4PA 1OWXA 3VTIA 1KQGB 4K0KJ 3EJMA 4KR0B 2IM1A 1VQNS 2CJBA 5D4NA 3BBBA 4XPCA 3CULA 2YBVA 4KJIA 2L9DA 3UWTA 1WNEA 2ZH2A 5KG6A 1NPPA 1SUQB 5D4OA 1RUSA 4DV1J 3OTOJ 2XCPA 2FJBB 1K47A 4EYHB 3DLJA 2BM1A 4DS5A 2E1PA 2MKYA 2CKWA 2DH8A 1U26A 5E7OB 4WCEQ 3DM2A 2QTWA 1NK7A 2DNYA 3FMWA 2CWXA 5KG1A 3Q8PB 3P5BP 4UOHA 1UMJA 5CYMA 1HNXF 2UXCF 2QA2A 4JI1J 3MEDA 2ACYA 3DN9A 4C8ZA 4B3OB 4HH1A 3VVUA 1WF0A 1N5SA 1Y4ZB 4LIRA 1JJHA 4U7UK 4RKUC 3EVWA 1S97A 3ZZ0A 2BA9A 1I94J 1ITPA 5JVGQ 4NZ0A 4KC5A 3KJFB 4C8OA 2W9AA 2IRUA 3C6TA 2PMZD 3PJ9A 3M2UA 1NSAA 3PW4A 1C0UA 1YJNS 2IHR1 1FWPA 2CPIA 1U6ZA 3I0SA 1N36F 3VAIA 3R5JB 1IKYB 2A18A 3JYTB 1WSVA 1JJCB 5KG2A 3VR1A 3U1MA 4C3KA 3T5JA 4ECWA 1RKIA 4YB1P 2B5JB 3WDOA 1FKPA 1N4LA 4MKYA 2ZUGA 5KFOA 1HNXJ 4D3HA 2UXCJ 1TAUA 1YBTA 2A10A 4OIXA 2LDIA 2ZVSA 3G8TA 2VG5A 3CJ8A 1MN9A 4F0KA 1FFWB 3CSKA 2XYHB 2L3MA 2LDYA 3VAGA 4K4TA 5EWGA 3PNIA 3PFEA 2ZKUA 2ZBIA 3KK3B 3P96A 2Z58B 3NAHA 4WIQA 2MDAA 3FBCA 4OJGA 1LNQA 3IWNC 1DQ9A 3D54A 2QGFB 1N36J 4UF4A 1V9OA 3UE2A 3ZC4A 2EKYA 1S6UA 2E5GA 3ZXWA 4O44A 1EP4B 4JI6F 1WKJA 2ZBRA 4IH7A 3T5KA 1TQLA 1X4DA 3L9ZA 3UCZP 3W2WB 4KGMA 2MZQA 2PI5A 1B0VA 2BE2A 5HVGA 2A2CA 4C9DA 4NYPA 3EXCX 3MPVA 4QU6A 3Q2TC 3CJSA 3D1OA 3RAMA 5A76A 3CJ2A 5BYSA 1RTIB 1CULB 2R8HA 2CADA 3OJUA 1TL5A 1WF2A 2I0XA 2DO4A 1N6QA 5D0EA 5F3TA 2WRMA 5DZ6A 2N3LA 3PG9A 2Y1JA 4TY8B 1HNVB 3M6VA 4JI2J 2VUGA 2HHTA 2WAQD 1JLQB 1U1NA 1VISA 2Q43A 1SB6A 5JUMA 4UQTA 2H1YA 2DISA 3OR1B 4USUA 2N4DA 1U2FA 3GILA 2KT3A 2DB1A 4DR2J 2P6TA 4B9LA 2I38A 2DNZA 1ZA2B 4CLSA 5EHHA 2WW4A 1SH2A 2HRTA 1NKEA 4YFUA 3KK1B 3R97A 4USKA 4B9TA 2NXJA 3SIPB 4W92B 1RYSA 3HZGA 4XPEA 4KKOA 2HFOA 2V4RA 1JLFA 2HMIB 1Q1KA 3PFOA 4M5DA 1YTYA 2W25A 2F4VF 1S9FA 3RBZA 4EZ9A 3P8BB 2UXBF 3IGVA 2J8SA 3THPA 1IXKA 3KLVA 1LK7A 3HVTB 4DG1A 4NLOA 2HQDA 2K8GA 4ECTA 3V4IB 3T41A 2J0XA 2JL9A 4PYDA 1QM9A 1BLUA 3MM6A 4RNMA 3CMAS 3G71S 2ZC3A 5CXTA 2JZ5A 2XMTA 3BREA 3JAMY 1S1VA 1HD1A 4WU2A 4ZVUB 1VLYA 1Z2LA 1QTMA 3O3LA 4DPTA 2OPSB 4B02A 1J5OB 5CZXA 5HANA 2F4VJ 5DGAA 2QN6B 4OX7A 3DFEA 3LOUA 3C14B 1JWWA 5KFQA 1WHXA 2V9KA 3PXGa 4LF6F 3BO3A 2VJUA 2W2OP 3QLHB 2HHHF 1DAXA 2HS4A 2HAFA 4NLGA 1B4SA 1NJZA 3W5ZA 5IT4A 2RILA 3LANA 3I56S 2B7CB 2PFFB 4KT0C 4DV7F 2L9WA 1LWCA 2BE9B 2FB0A 2H48B 2QIFA 2VQFF 3NCRA 2YPZA 3QT8A 3EM1A 2QMUB 2G9OA 1FESA 1I3OB 1HFEL 1CJUA 1K0VA 4IUFA 3C6UB 3LQVA 4OLOA 1IBLJ 1S1XA 2F3JA 1XMOF 1KQFB 4CM2A 2M0GB 1YHQS 4UUWA 5AXKA 4LF6J 5F0WA 3MEGA 4KHRA 1RHRB 3HHLD 2JFKA 5JJBA 3V2UC 3SQGA 3DLEB 3D6FB 1QD1A 3Q8UA 2JSXA 2N7YA 3I5CA 3RR7A 5F8LA 2XGQA 4RNNA 4Z2XA 4IG3B 4IH6A 3KKFA 4CIOA 2DR9A 5D0GA 4X62F 1YJTA 4C2MA 4DV7J 2A1BA 3EICA 2KXFA 4NMLA 4CWBA 3TW0A 3AT1B 2CFXA 2EG2A 2VZ9A 4P74A 4FYWB 5M2PA 3OTEA 1U48A 4OQJA 5K14A 1IWGA 1EQMA 4N76A 3GQCA 3OR2B 1VLOA 3F73A 2H9ZA 1XMOJ 1KD1T 1NK5A 1N48A 5LSRA 2W9BB 2FJXA 5AE2A 1RTJB 5AJ3J 1UVLA 2MLYA 3EGWB 4Y2CA 2HSEB 1GX6A 5GAGU 3QSIA 3TAQA 2DGQA 3PYDA 3S1TA 1WUUA 2PIIA 2D3UA 3GLJA 2J5AA 1HW9A 4PYAA 3KNGA 4C0OC 1RAGB 2YWKA 1SJRA 2AD9A 3P5TL 3RBXA 1ZZFA 4IRKA 4LMZA 1HPZB 3L7PA 4KBIA 4ILMA 5D8HB 4ZVQB 1NHVA 3KNAA 5E3AA 3ZTQA 2UUAF 1X31C 4DV4J 2AEJA 1FKOB 3OLBA 2LU2A 2A6MA 1T03B 1IR2A 1RAOA 2IDEA 4OHXA 1PAUB 1IKVB 4URQU 3PJWA 4B3OA 1HBOB 2DPIA 2MQMA 2UUCF 3W63A 2PEHA 4ZP6A 1EETB 4DSIA 5JMNA 3H4BA 1FRKA 1H3DA 2BQ3A 3C19A 2W7OA 3HFVA 1LXNA 1OO0B 3HVAA 3OUYB 4FF4A 1HHQA 5EDWA 3I5BA 4LRBA 1T05B 4WK3A 5HLFB 3JYTA 1C0TA 1U6FA 2AX0A 2UUAJ 2YWGA 3G6XA 1TP7A 4EEYA 5KFKA 1GK8A 4G1QB 1SQFA 3TEGA 4EZ6A 1UVJA 4WTYA 1RTZA 1GTHA 1KHWA 3GV5B 2XI2A 4ED0A 3LGMA 5J1NA 3TAMB 2WVDA 3UQSA 3L09A 1UJ5A 1ZAVA 3Q8QB 2UUCJ 3RRGA 2X51A 3HT3A 4ILRA 4B3RF 3QJLA 2VV5A 4U9RA 5IV4A 2QA4G 5D6GA 3TR5A 4C0BA 4DDFA 3DLKB 4RUHA 3H5YA 3D0GE 2FTRA 1JX4A 2R7OA 1QY7A 1WHWA 1TL7B 4U95A 3EYZA 3HSDA 4UOGA 5IOLA 2M52A 1VQKS 2IYGA 3FEYB 1VBXA 1DFDA 3W2WA 5GADU 3TZXA 4NA3A 2X1AA 4I6YA 4F4AA 3D67A 3ETMA 5CAAA 2HHXA 3OFHA 1Y7PA 1F3FA 2GO9A 2V5HG 1QAIA 2CJXB 3DRRA 2XQCA 3J7AN 3FZ2A 1UP1A 4B3RJ 1WACA 2NYHA 5I3UB 1Q5VA 1Q8BA 1IBKJ 4NLVA 3GB0A 2A2DA 4BC9A 3GFXA 5E33A 1JJ2R 2V9WA 2LFVA 1JLAA 3NBPA 3EDRB 1NK0A 5KT4A 3MF5A 1A0OB 2XS2A 3ZZRA 3W62A 2OPRB 1HR0F 2VASA 4DV3F 3MM7A 2GAHC 3SSQA 4R0EA 4DF8A 4DCJB 4RW9B 2BJ9A 1AA1B 3JXOA 4L72B 1NAQA 2HHUA 4WZQA 1R6VA 1X4BA 5A0YB 2BUNA 3OPKA 1KP6A 2XMWA 4JV5F 3MEKA 3M9NB 1KFSA 4DR4F 4FKXA 2C3PA 3KDOA 4NA2A 2ILYA 3D7SB 1H6KX 5KG7A 2AZ3A 3Q8RB 1RAIB 2W24A 1XEZA 4X4RA 4RJVA 4A4JA 3QGPA 2AYEA 3ENQA 3CD5A 5ETPA 3SMZA 1Y3KA 3MM5A 3SQOP 1VQ4S 2GV1A 1ZAWA 2FQQB 2H4WB 3QIDA 4PG4A 1N56A 1RWOB 1NKCA 1VDHA 2HPUA 2HGNA 2V8HA 3R1LA 2R8KA 3SYZA 4DV3J 5GMEA 1ICEB 3M1VA 1NJWA 4ITSA 1XK8A 2IVYA 2FJDB 4DX5A 1OY8A 1RT1B 3FBFA 1U45A 4AQYF 3MPUB 2ZH1A 4ECRA 2CQCA 2NXEA 5KT5A 1S59A 1F9HA 5IM0B 4JV5J 2K2PA 5E3PA 5K8PA 5LT5A 3OXFA 1NK8A 2J6SA 4PEOA 5C7PA 3NGSA 5CYQB 3KLGB 2MQOA 1T02A 4RLEA 2CJQA 5D4LA 1T3OA 4JI7F 3OV7A 3PO5A 1RHJB 3T6BA 3SCJE 4QOTA 1JXLA 3IAM9 3KLFA 2I8EA 2VG7B 3MCMA 1HQ2A 4K4VA 1A7GE 1RT7A 3BQ2A 3G6ES 4BHQA 1X0FA 2OPSA 1J5OA 5H1SV 1U2RA 2RU9A 3BPSP 4JI0J 4I4BA 4C6AA 2ZJRQ 1N52B 2VFVA 1H2UX 3CJ4A 3TUIC 4NLQA 2RVJA 3QLHA 3R2CJ 1UVKA 3MDFA 5H9FK 4CP5A 1H98A 5FDLA 2BRKA 3DC2A 3PV8A 1G1XA 1KR4A 3RUBL 5FLXU 3IXQA 3UNGC 1UW9A 1FJGJ 2YNHA 4KB7A 3DDIA 4DN9A 1SC1B 4M1KA 4WE1B 2CA9A 2D3ZA 5L38A 1HQEA 2LQJA 1FK9B 4WU3A 2F8EX 2LXUA 2DR8A 4KV8B 1N5TA 2VF3A 1UKUA 5A6PA 4YP3A 3DLHA 2JNJA 4PR6A 1S1WA 3TQ1A 4CLYA 3AOCA 3ICLA 3DDKA 4NLTA 3JSBA 3HXMA 3RBDA 4ZHRA 3HHEA 3M8PB 4IH5A 4DCOB 4A8OA 1CG2A 4W4MA 4YY3F 2IM3A 3NWRA 1NZ8A 1QSYA 1GMUA 2Q6CA 5HVHA 5GAGI 1H72C 1S4EA 2OEJA 4M5LA 2OGUA 2FJVA 2M3DA 1KVJA 1FO1A 2RKIB 1W26A 4EWTA 1KONA 1Q81T 1M5VC 3FMBA 4K4YA 2GAGC 2FUG9 2WVBA 3DOLB 2BJ3A 5A8WB 4EBEA 3MMAA 4OYIA 1HA1A 2KI2A 1EZZB 1T9VA 2W9BA 4N47A 2P9EA 5T7LA 2LMIA 2C2MB 4OHVA 2J0WA 1MW7A 3BR9A 3ULHA 3H25A 3NGUA 3THVA 5C2GA 2HLUA 4WTOB 5HMXA 4KYZA 1HNWJ 1Q78A 2AEFA 3QT6A 5KFNA 1HPZA 3HFKA 3DXBA 1HW8A 3N28A 4JP8A 1VMBA 3Q23A 2DNMA 4I6AA 2R7RA 2GGPA 2H5EA 3UDCA 5ETOA 1IWAA 1IKXB 1NK6A 4DV2J 4MJKA 1Y0HA 2OEKA 2YNGB 2G0IA 4PG7A 4C0HA 3C16B 3DCAA 4DR3J 2AJFE 5RUBA 5BR8F 2QLBB 4LBIA 1NLKL 1IKVA 3MURP 2UUTA 1EKRA 1UETA 3X1LB 1HBOA 2CIMA 2CJ9A 4ZJLA 2XS7A 2XY5A 2ZH4A 1X8DA 1U47A 4ZVFA 5IQ6A 2H5JB 2DGSA 3DOKB 1VK3A 2E66A 3POTB 3OFGA 4RR5A 2J6TA 2CVIA 4KH0B 3MFHA 3UR0A 1Q86T 3EPIA 4NCBA 5GMKa 2OJ3A 2DXFA 3ENVA 1T9TA 1WG4A 3OJSA 5HLFA 2EFNA 1FDBA 2VL1A 4R25A 1FNOA 5KG4A 1XERA 4EO8A 1VCTA 4DQRA 4BDPA 5ETLA 4Y2KA 4TLQA 5BR8J 4XK8C 3LP1A 1JLGA 3MAAB 2P9GA 2M8DB 4DBQA 2G2ZA 1NCLA 3K57A 4DUYJ 4F50A 2WOMB 1HNZJ 3ITHA 5GADI 5LMNJ 1RWXB 2B9YA 2KJWA 3UCGA 3GV7B 1NKBA 2GQQA 3KWMA 4HR2A 3A3OB 2AJ4A 1ZM3A 2M7SA 4WXOA 3SV4A 4DU7A 3FKBA 3H2VE 4DL4A 2O01C 1LW0A 4DQSA 2AJ2A 2MGZA 2BRLA 2ZOFA 3AFGA 5HBMB 4PQAA 2E9RX 5KFPA 2ZVIA 1TL7A 1S1UA 1QAYA 4ZN3A 3CF5Q 2ZNZA 3DGPA 3DXSX 3KXDA 2FY8A 2DJWA 5HK4A 4H4KA 3CJKA 4U7CA 4FP9A 1YJUA 1AZSB 2VICA 1RACB 3GIRA 1F1BB 4J9RA 4WYLA 2HVIA 3DDNA 2OP5A 4OJ3A 3I32A 4IRDA 2U2FA 3Q0AA 1HLWA 3HM9A 5I3UA 4PWDB 1X5TA 2GO8A 1SKSA 4HYKA 1GNKA 1PYOB 1UVNA 4WWSA 2HWTA 1OYDA 3VGVA 4CI0B 3EZ5A 3IS9A 2FGOA 1WWHA 4KGZB 3EMTA 4OX9J 4DV6F 1ULRA 3HKWA 4RX6A 2Q79A 3H20A 5KFDA 2NQPA 3MZIA 2K3KA 1O8BA 4HI2A 1C1BB 4L3KA 2BBEA 1CQNA 4MIAA 1TK0A 3M8ZA 3R5GA 3L95X 2BDPA 3NWGA 4YN3B 3TX8A 4DSFA 3K58A 3EGVA 2BVZA 1Y11A 2ZZNA 2NXNA 1IQZA 2V6AA 3TEHB 3AJDA 1W7WA 4HLBA 1WG5A 3MPDA 3PX4A 2LEBA 1ZTWA 1P9QC 2IFXA 3B4MA 2XMUA 3K2YA 3PACA 1YQHA 4JYAJ 2IYIA 2C3UA 1M90T 2MQPA 4DV6J 4FXVA 2CPYA 2Y9HA 1D3WA 1VHFA 3BPDA 2ZITA 3Q22A 2IM2A 4DR1F 3CD0A 2QLFB 4DL6A 2DTJA 1ZPVA 4ES2A 4Y00A 1ELOA 2EFVA 3JAMU 2ZOGA 2CQPA 2AX1A 2JLFA 4ERDA 4X65J 5J2MA 2I2YA 1YJVA 3V6HA 5HVFA 4K4UA 1DBDA 5J1EB 2N3OA 2E5LJ 4YHHF 2VFRA 1KRPA 5CYQA 4QWCA 3KLGA 1FT8A 3CT9A 2VPWB 2Z2YB 2UP1A 1GXTA 2UU9J 4AL7A 1S9EA 4CTAB 2C2DA 2ZE2A 2VG7A 2QV6A 3K59A 3KHHA 5J1PA 3EX7B 3KUHA 3OFEA 1U02A 1FRHA 3QJJA 2CQHA 1T8EA 3GIIA 5F8NA 3LP2A 4A8WA 2VA2A 2YNIB 1HYSB 2MTLA 4ICLB 1RA7A 6AT1B 4DUZJ 2CQ3A 1Q82T 3BH7B 2R4FA 2KYXA 2PN6A 4TYAA 2PGCA 1SV5A 1GMWD 3G82B 2BJ7A 2VODA 4USWA 2VOPA 2DIUA 1JQGA 1BWVA 4L3NA 3DMJB 2NLWA 2GVZB 1P9YA 1Q4RA 2DHXA 4YHHJ 4DSEA 3IG1A 2FLLA 1R43A 1OYEA 1DLOA 4NZ6A 4K59A 4O4GB 1HBUB 1RWWB 4WFAQ 4UZCA 1YX2A 3CVKA 1TKZB 5HN0A 5ETRA 1KSPA 1REVB 1TL3B 2FVQA 4MTPA 4X66J 1TVRB 3BSNA 5A2QY 4ZCLA 3GONA 1U1RA 3CMQA 1WC5A 2ZZTA 4NRTA 3LPYA 4C8YA 4I68A 3TZZA 1WDTA 2RU3A 2XSFA 1W25A 2RF2B 4FVMA 2XZWA 3KLHB 2XBPA 3RB6A 4NWBA 1BQMA 3OHAA 3GIMA 2XY6A 2XHCA 3HLUA 1U0SA 2HURA 4ZCIA 5KAKA 2HHVA 2HNZB 3EDQB 2MZSA 2F5GA 2GIFA 3UO0A 4I64A 4D3GA 2J9DA 3BEGB 4KGVB 2ZJQQ 3QFHA 3IA0A 3KLEA 1D8ZA 1MMNA 2G1HA 4UZBA 2HNYB 4YMEA 3VAFA 3DOLA 5BYRA 1FNXH 1N88A 3CMES 2EC0A 4KHPJ 1YBUA 4R8UB 1N5VA 2UV8G 1PYTA 3TJ8A 2GNKA 4DL2A 3IBCB 5F41A 1UEKA 1N5YA 2FVSA 3W60A 4X2BA 4E2FB 2GMJA 2ZNYA 4MKBA 2V50A 3SDEB 1XNQF 3CTRA 2L48A 2P8IA 2C3OA 1RYRA 1U1QA 2WVEA 2FHMA 4TNOA 5HROA 1Z1ZA 4I56A 1KDNA 2VG6B 3LW5C 4DX6A 1M1KT 2J7UA 2Y3YA 3BS9A 4PCQA 3BJYA 2Y1RI 2HVEA 2YNGA 2CPFA 3TYTA 1VJWA 4DV5J 2KG1A 1RT5B 3NS5A 5K8MA 3CJTA 3M9OB 1IKWB 1P1TA 1V3RA 1CEZA 2DRBA 3I5AA 2R2UA 3FFIB 4B9NA 2W9CB 4NOHA 3MAHA 3ZTSA 2BKPA 3VGUA 5HI7A 5BJRA 1QAXA 2MQQA 3CD7A 2PI4A 1RISA 3JSMA 5SUHA 1E6VA 2HKEA 4UUXA 3O8WA 1Q8KA 2IDLA 3MCOA 2X1FA 1VI7A 1S76D 3EE3A 4H4OB 2RRAA 1RAEB 4FN5A 3OL6A 5KTQA 1REGX 4O23A 1EIYB 4ES3A 4ECSA 4PXBA 3FCWA 1FWKA 2JEFA 4JV0A 1VGYA 5HP1B 1CJVA 4KO0B 3AB4B 2A6OA 4IOBA 4TXSA 4M5MA 2ZFHA 2BANB 1HWUA 1NXIA 2HGMA 2WOMA 4R0JA 5D3GB 2MKSA 3ONQA 4CNYA 1BQNB 4OMFG 5C42B 1WEZA 1Z4UA 1WHVA 2HFUA 3IM9A 1QJHA 1YBAA 3AXKA 2UUBJ 5HBMA 3VCDA 5L9NA 4RWXA 3AD7C 1UW4A 3M2RB 4CH7A 2HWIA 3HMJG 2KKHA 3T1HJ 1LKZA 1RCOB 5KT6A 3MEEB 4X64F 4F4YA 1MG7A 4IDKA 4Y65A 1WC6A 3IFEA 3QPIA 2R7XA 1MWYA 3KUGA 1WJ9A 3TNVA 1O5JA 1VC5A 4TU9A 2D41A 4HACA 3QGIA 3PM9A 4QQBA 3UPFA 2SXLA 3MTJA 5KFEA 4LF8J 3N6LA 4K2XA 1NH8A 3BGFA 3M6WA 1RU1A 5IWAF 3MECB 3I31A 2ACMA 2C3MA 4FKYA 4OV6A 3J7YU 2R7UA 2AIRB 3GG0A 4LFBJ 4USJC 4ETXA 2WVCA 5D0HA 3GJSB 3SBMA 5LM7E 2ASLA 3JB9k 4LF9F 3H5SA 2V8DA 1OIAA 4R5PB 1VRTB 5U47A 2CPEA 4X64J 4UY8T 3ISNC 3D3CJ 3G6YA 4RW6A 5KFVA 3BSOA 2E1AA 4B9SA 4ZJOA 3NCPA 3T9ZA 2M5YA 2PT0A 2IRXA 5LMUF 2MEWA 4J9QA 4FVCA 4ZKAA 1NH7A 2UV8A 2OAUA 4NMXA 3GFHA 5IWAJ 3GP9A 2R3VA 4FS2A 4F4ZA 2CVEA 5IV3A 4M5IA 3V4MA 1RT2B 3GIKA 1OMSA 2HEKA 3H90A 4LF5F 3NXZA 5T41A 3PDNA 1RB0A 5KFBA 4U7UD 4ZPCA 2MLZA 1FEEA 1YIJS 4DR5F 1P1LA 1R0AA 2D9PA 3TWZA 2DR5A 3IBWA 1B7FA 4RW8A 5F0UA 5B7WA 1M1HA 4OYWA 1N5QA 1PAEX 3PTWA 2QJ3A 2QMWA 4DMZA 2ZBCA 2O3DA 4P2SA 3SV3A 3Q8SB 3CE8A 1C4AA 4TU7A 1PC5A 3X3UA 1Q7LB 3M6UA 3AQPA 1TKDA 2J9EA 4F0HA 3DM2B 4DN0A 1QSLA 1WI8A 1RWUA 2CYYA 2ILZA 4LVNP 4USHA 1N33F 4ZP7A 3BKFA 4X4SA 5CYMB 2MXYA 3UDEA 3MEDB 4DF4A 2B8PA 4X84A 5DDPC 4NLRA 2YNIA 1HYSA 1HHTP 4ICLA 1UCNA 4C11A 4MKVA 2BABA 1YK9A 4X4VA 1RTDA 3HHDA 3MPWA 2NSBA 3CJ0A 1HQUA 2ASJA 2R2RA 2E5IA 1ZAXA 2QYCA 3C6TB 3DMJA 4O3PA 2GVZA 3M2UB 3LH2S 4WFNQ 1BUXA 4OYAA 4J9MA 4CNZA 2B56A 4RW4B 3QGHA 5L46A 3CDBA 3N6NA 1KEKA 1HBUA 1C1CA 5I42A 2AKWB 2PMHA 1CPZA 2V69A 3CO9A 2C3YA 1TUGB 1NPKA 1RDRA 2MYFA 1FKPB 1XJWB 1TELA 4LF7F 4DFJA 1XNRF 1CSJA 1B0PA 4QIEA 1PIEA 2VG5B 4EUVA 4PXDA 1RE1B 2WBRA 2OPQA 4EGLA 1TL1A 2RF2A 2J7WA 1YI2S 1Y9OA 1EX8A 1KOOA 2CNLB 1GMWA 3A12A 4N77A 2YPYA 1JNRB 2XMKA 2PA8D 1X0PA 2F9DA 4K7QA 2RDIA 2O67A 2YKMA 2NPFA 3ZTRA 3HVWA 3FEXB 1RBAA 2HNZA 4AL6A 3R7SB 2KL8A 2RAQA 4O44B 2UXDJ 4J9LA 4X4NA 1QLNA 3ZZZA 1LWFB 1EHWA 1XNRJ 2HNYA 4GRSA 3MD3A 2RD5C 4XO0A 4P7VA 5E0OA 4C3LA 1V6HA 1TFWA 1K1QA 4XTTA 1EQ0A 4RUAA 4PWUA 2OFGX 3BGRA 5D77A 3J81Y 2CDRB 3RZAA 4J5OA 2BZ2A 3A13A 5A8KB 2LVWA 1S6QA 2W2QP 1EKSA 2BW2A 2ZD1A 2PMWA 2VFSA 4JBCA 4USIA 4LREA 1VQMS 3LGNA 4CCHA 3GWCA 3R8YA 3JSYA 1S6PA 4TY9A 4X4QA 4NLDA 2EFOA 2CQIA 5EGYA 3B54A 4PAAA 1LWEA 4KPCA 1M5KC 4PKDB 1LFPA 3PX0A 2OTLS 1SJQA 4NASA 1NB2A 4A8QA 3G8QA 4XIUA 2EG1A 3NMAA 1B70B 1FRIA 1FE0A 2ZHAA 3OXLA 3L3CA 1D9FA 3WC2A 2F8HA 4C4WA 2LQ5A 2DNRA 3G8SA 3PKYA 4QWDA 2DH9A 4OI6A 3FFIA 3P45B 1ZM2A 3L4BC 4CM0A 2W9CA 2CPHA 4IOAQ 1DRZA 3PY8A 1F6TA 4DR7J 1RHKB 1KHVA 3QWPA 2J9CA 4TU8A 4Y0FA 2RHQB 2VJVA 2KYZA 3K5OA 1PKUA 4KKOB 4DS4A 1XBWA 3QWUA 5DM7Q 1JLFB 2ZHBA 1J2VA 1BWEA 4M5DB 3CCVS 2KXHA 3D68A 3K8WA 3SFUA 2AJQA 4I6WA 3OTCA 4CYUA 1K44A 3ENAA 2O1PA 3C15A 1BHNA 1N34F 2NPIA 4F2RA 4GO5X 1WOOA 1KFDA 2FPHX 3I96A 4DG1B 3GSIA 4U6PA 3N01A 4H54A 2E7XA 1S9GA 1D8YA 2AT1B 2N7CA 2VPYB 3NGRA 4GVBA 4IG0A 3SFGA 2M4MA 2H65B 3CC7S 1B64A 3KHGA 3NL0A 4X4UA 2AEMA 4ZVGA 5EN1A 2XB2D 1JXEA 3RR8A 3N5BA 2DNKA 2JDJA 3I0RA 3W64A 3PKMA 4DFKA 1K8AT 2OHDA 1RABB 3T5LA 2GZOA 2Z30B 5DDQC 2N4CA 3P6YC 5KFWA 5AT1B 1SIZA 3R5AA 3BGUA 4F3OA 3M2RA 1AXQA 1Y5IB 1RT4B 4DOZA 1R3NA 1X7VA 3DYAA 4P71A 1K73T 1VBKA 3FC9A 4ANDA 2HVDA 2FZGB 2AV5A 2BKNA 2J6UA 4DFMA 4Q2MA 2LECA 1NDLA 1I51B 2VB6A 1AYEA 4QWBA 2KXNB 3HSZA 2V2VA 4KRWA 1TUWA 1LWCB 1B3TA 4DQPA 4BWMA 3IBFB 2R7VA 1NK9A 6FD1A 2CQ1A 3JQKA 1R8PA 1CJUB 1YLXA 3MECA 3CD6S 2KZZA 2W2PP 2KB2A 1S1XB 4F8RA 3CEDA 2FHOB 4BC7A 3S6EA 3O2IA 3VHQA 1G7CB 1VRTA 2BXJA 2VC1A 1GXUA 1VQPS 4ELVA 3GYNA 1SXLA 3TA1A 3Q8VA 2I5JA 3DRSB 1T0TV 2IJNA 2XNRA 1RHQB 4CO3A 2HBRB 5LJ5Y 3UDLA 4QJVA 4MFBA 5A8RA 3Q2SC 4ZPWR 1OPZA 5CD4H 3BO2A 3QO9A 5HMWA 4RUCA 2UZAA 4L74A 3ZZUA 3DU6A 5HO4A 4I7FA 4I2QA 3QZ7A 4OI4A 3MI7X 2ROEA 3UVJA 4YOEA 1RT2A 4FDFA 3DU5A 3HHLC 1VOMA 4QPTA 2OSQA 2MZRA 3V5RA 2O5DA 4J37A 3LP0A 2VBXA 4QR0A 3H8YA 2BJEA 1HKAA 2NSCA 2FYXA 1F0XA 3AA9A 1NJIT 5H9EJ 5DM6Q 4FNHA 4K8RA 3PYGA 4A8FA 2KVIA 3CCMS 4RW7A 2DO0A 4OI3A 1RAAB 2MY7A 2QLWA 3MMBA 2OI2A 1U49A 3CIZA 2OTJS 1CBKA 3D6TB 3ZNJ1 2BEFA 4MIWA 4KTQA 4OJHA 3M9MB 3JSRA 2ZKTA 3R7BB 3H2UB 3PR5B 2OEMA 3QMQA 3MHYA 4LBHA 1WOSA 2DT9A 4YS2A 4OYOA 3BDPA 3V6KA 1K9MT 3NMRA 3S7RA 3WIUA 4U96A 3T6JA 5GAEU 2GA7A 1AUDA 3K5PA 1L3KA 1T9UA 4JOUA 4OZ5A 4YR0A 4AL5A 2KJVA 2QL7B 3F44A 4DSJA 3JQJA 5A2QU 1H38A 4DR6F 4F04B 3K8VA 3R6GB 3QYYA 4RW4A 4DI6A 2MQLA 3W9IA 1SI9A 3AOBA 2G2YA 3GYXB 1AT1B 2ATCB 4OV1A 1C0TB 1EAYC 4Z37A 4AUKA 2MHNA 2QEXS 4ENOA 2YWFA 2Z4PA 1YVFA 2AW0A 1N32F 3N4WA 4MK9A 4DL0C 5AXNA 1G3OA 5HQMA 1JKHA 1ZH5A 1UA1A 3TAPA 3AD9C 1RI7A 1SPBP 2HS0A 1YSJA 2EBGA 2DVIA 3GZ7A 3IWLA 2QMXA 5JXSA 2POKA 2VIHA 1JB0C 2ZC4A 3M6XA 5DLFA 4DR6J 4F0MA 2W2MP 4LR7A 2W7AA 3JQMA 3LGHA 3SCIE 3ZFVA 4B3SF 3P3DA 5GVQA 2ABYA 4ZPDA 1QDUB 2QL5B 5KFUA 2DGVA 2F40A 1CC8A 2V63A 3CJ5A 1QTNB 1VBYA 4H4KC 5D78A 2UVRA 1LWFA 3AHPA 5D0RA 3RB3A 2QA1A 3VAMA 1PBAA 2PA3A 5B0AA 1KBRA 3FCHA 4A8KA 2DEJA 2JVOA 1QSSA 3G87A 2GIQA 5L1LA 2FZKB 3EZOA 3VGSA 2EPIA 4M8LA 3DRRB 2HQ3A 3J7Z5 3D0HE 5GAHU 1Q7YT 4PXEA 5A8KA 4GKKF 4AYBD 2GC8A 4F4XA 2YWEA 3QAEA 3BZQA 4B3SJ 2ALZA 1F9FA 4E98A 2VC0A 5EWEA 3W1YC 1JLAB 3CB4A 3NBPB 2ASDA 4JI6J 1RA6A 1FD2A 2CPZA 1ZTTA 2IRYA 1D1UA 3GJRB 1FFGB 3H59A 3D28A 3MM7B 4JI5F 1PJ7A 2XI3A 2LQBA 2PFDA 3M8QA 4JB8B 3MM9B 1DY3A 3PIPQ 2Y1LB 4M5NA 1NB7A 5E3QA 4ECXA 2QT7A 2C22A 4NCGA 4EK2A 4BBYA 1U4BA 3UR3C 5H9EK 3BYRA 1WELA 2DHGA 3E2EA 5IXUA 2ZEJA 3AQOA 2CRLA 3MM5B 1RAHB 1B7YB 2HFNA 1YRUA 1O0PA 2XSJA 1RWMB 3B78A 3WZ0A 2XS5A 4C7QA 2HBYB 4F3MA 2AMCB 1E6YB 1UFWA 1DQAA 3NG8A 2CQ0A 3OQ2A 2ZUAA 2W4DA 1X4CA 4JI5J 3HF5A 4ZK7M 3M1VB 1FA0A 3R7NB 4OI0A 3NGKA 3PIOQ 2VA3A 2VFTA 4OYBA 4NXNF 4IO9Q 4OZJA 5B0BA 2RJZA 4QYRA 3LALA 3RTVA 1RT6B 2MSSA 3EPGA 4MYUA 1HI1A 1L3VA 7AT1B 2HLTA 3GR0A 2DY9A 2FC8A 2KFNA 1FNMA 4DUTA 1SC6A 3KK2A 2Z8QA 2RQMA 4F2SA 1SKWA 1LQ9A 2M2BA 1QUPA 4CLKA 3KLFB 4U8YA 1NRKA 4CRJA 5C5JA 1LW2A 4OYMA 1RT7B 1X4FA 3NNHA 2D74B 1KOHA 2G2OA 3NGTA 2DHSA 3BBFA 4O0IA 4F67A 4NXNJ 1HHSA 1TUVA 1RT4A 3HHNB 2UXBJ 1HD0A 2XHWA 4N8NA 2OD4A 3PW5A 3CCJS 2FY1A 3GMGA 3DLGA 2M70A 3VZHA 3IP0A 3UN5A 2YKPA 4ZN1A 3IM8A 4CDIA 2EXUA 5FDLB 2OKQA 1UWBB 1AROP 4CLFA 4LJMA 2HHWA 2IA0A 3TRGA 1VQ8S 2DCLA 4P10A 1ZBTA 2YNHB 5IZHA 1JK9B 3BQ1A 3EVOA 1RWNB 2V2KA 5DG7A 1RK8A 3TUZC 2G0JA 3OL8A 4F25A 1H73A 1HQEB 5F9NA 2VKZG 1HWKA 2IC3A 4I2PB 2E1CA 3TVKA 3AJ2A 3M32A 3CJRA 2IY5B 3KHRA 4AT1B 3K89A 2NXCA 4AXIA 1S1WB 3WQPA 3R27A 1S6OA 2HIYA 4ZHRB 1FVSA 2YQ3A 4AE5A 5KFLA 5C2CA 2HHHJ 5A6WA 2KRBA 2PSZA 1S57A 3UD5A 3MXHP 2HVZA 3DRSA 1FI4A 5E41A 1M5HA 4ZCMA 2VKRA 1QE1A 3FEZA 3PVXA 3A4TA 3A3PB 2VQFJ 3QATA 1CJKA 3MFIA 2QX0A 4V19J 4C8LA 3VF0B 3OFFA 1GH8A 5C25B 3OSPA 3IC1A 2F65A 3MMAB 2IVMA 4RWWA 1R7IA 5F8JA 4WBFA 1F9EB 4ZPTR 2UUWA 1NBEB 1TK5A 4HT5A 5T7LB 4K4XA 2QSWA 3GR1A 3HHLB 5K5MA 4NZ7A 1LXJA 1FTRA 3PCOB 4WJBA 4NYOA 4X62J 5GAEI 3G6VA 1T9YA 3MTKA 3KHLA 1HMVA 2QLXA 4LR8A 2YX1A 2GGPB 5D15A 4OX8A 3RBEA 3CCZA 2CJYB 5KT2A 2V2QA 1JIHA 3I4PA 3UN3A 2ZH9A 2JVRA 1VJQA 1R8HA 2P2CB 3KJNB 2I6WA 2HWHA 2GMHA 2F9JA 3CIMA 1T9XA 1OPIA 2XG8A 4L6V3 4KHMA 1FEHA 2BACA 1U0HA 3ZTPA 2HGLA 5K9FA 4ZMMA 3PJXA 5KFCA 4FS1A 3GFZA 2GQCA 1VC0A 3F41A 1MROA 3V6DA 3U7JA 1T7PA 4ZJQA 3CCWA 2KM8C 4J9UE 2HQGA 4DXLA 4B3MF 2DRAA 2EW9A 8ATCB 1CC7A 1NU4A 1URRA 1YRTA 2EKNA 5I3QA 2ZOMA 3HK2A 2MQ8A 4WYWA 3CUNA 4Q8EA 4LFCF 2DR7A 3BR8A 1UFKA 2D69A 3LP1B 1JLGB 4WPAA 1XQIA 4ED3A 3DGVA 1NUEA 2DHAA 1L3TA 3ITHB 5H9FJ 1VC6A 3C2PA 2KN4A 1KN6A 2Y1IA 3W61A 3QNWB 2ALYB 4PG8A 1FE4A 3KJQB 1UTAA 4WFYA 4QBUA 3QSYB 3MD1A 1X9MA 2R9LA 3PW7A 4GVLA 1LW0B 2MGZB 1XR7A 3AJ1A 3J81U 2IAJA 1TKXA 1HIYA 2X3GA 2XC9A 7FD1A 1S1UB 4RBVA 3KMSA 2EFQA 4URSA 4MH8A 2DGWA 3DGPB 3MR6A 2IM0A 2FVCA 4OHZA 3S01A 4C48A 2MQNA 4I69A 4CLLA 3QRQA 3CJKB 1SJ4P 2A0FB 4OFZA 1T3NA 4ZIWA 4ILLA 4P2XA 3M05A 5MAOA 3DHWC 5KOXA 2ZBQA 3W7BA 1FDDA 2CG4A 4CT8A 4ZLJA 3DRPB 5MLCV 3CCES 1DZ5A 3IS9B 2MKKA 2AYMA 1TKTA 2GHVC 1DHMA 2YQ0A 1ROFA 1G4CA 3D6HB 3LF0A 2OUGA 4Q45A 4Q8FA 3CO0P 1VHIA 1WF1A 4EO6A 3MM9A 3W8PA 1S0MA 4ANEA 2M8HA 4QIVA 2XMJA 5L1JA 2PC6A 4DHVA 4USMA 5DG8A 2XYGB 5CCMA 3M2VA 4B3TF 2NZ4A 3BM7A 3LA0A 4CLZA 3MR5A 4ID5B 2EK6A 1YJRA 3K5MA 1H0HB 1YZ6A 2ZBPA 4PZVA 3G96A 4ED6A 1WTFA 3U1NA 1UA0A 1VBZA 5KG5A 1CQMA 3RRHA 5DJBA 3M8RA 1XR5A 1BMQB 1E6YA 1RBLA 5F9LA 5AE3A 2JRSA 2V4JA 1HR0J 1S72S 2FLNA 1ZS6A 4DJBA 5ITHA 2HS3A 3T19A 3BO4A 4KGXB 3HP6A 2MY8A 4RBTA 3IAS9 1RT6A 4O3RA 8AT1B 4EU0A 4DR4J 3C46A 1MWZA 1D0EA 5J2MB 3N0VA 2N82B 3PYFA 2R7TA 4FBTA 1X60A 4NXMF 4JI3F 1IBMF 1KQKA 4K5SA 3MMCA 1X9WA 1S9EB 1Q0NA 2ZE2B 4IR1A 3BQ0A 2JLEA 4DZDA 4K0KF 3R5BA 3R6LB 3H5UA 1GQEA 3GE9A 3NOGA 3LP2B 3ZO7A 1XC9A 4KY3A 3DOMA 1U24A 4L75A 5IFMA 1X4AA 3RRKA 4GKJF 4DV1F 4AQYJ 3I87A 3V81A 2NR0A 4OHYA 1SV5B 2B51A 2RS2A 2CZVC 1FRXA 1AUSL 1UWBA 3IG1B 4NCAA 4CO0A 1QVGR 1IM4A 2RQCA 4JI3J 1DLOB 4CT9A 4JI7J 5L1IA 1IBMJ 4RNHA 5HQ8A 5HSPA 2R2SA 3OW2R 3HT0A 5KFJA 4ELUA 5L39A 2WSCC 3NGDA 1VRUB 2HBZB 2E44A 1I94F 4I2PA 1WORA 2DGOA 1IUJA 5HATA 2B9XA 4WZMA 3PHEA 1RU2A 4GKJJ 1KTVA 3KYLA 2VU5A 4FYVB 1UL3A 3D4JA 3I9V9 2HNDA 2HFSA 1XR6A 4Y2MA 5KFXA 4QU7A 2C28A 2XEXA 1S0VA 1BQMB 1VIOA 4BCAA 4DEZA 4E0DA 5KFHA 2YKNA 3J80Y 2VBYA 4Q0BA 2GW8A 1NSKL 3OVSA 3CC4S 3FSXA 4IFYA 2KT5A 1FX2A 2X1BA 1RJJA 2EFPA 4YQWA 3KLEB 1MU2A 1S5ZA 4PQUA 4HDHA 3H2LA 5C25A 1HBMA 4B17A 4IO1A 2RNEA 5J2NA 1T11A 2YXLA 2VD3A 1TMMA 1B99A 3NEKA 4ECVA 4LRCA 1N5YB 3HHLA 1FJCA 5ETSA 4A8XA 3GJQB 4YY3J 4CLPA 5T14A 3TJAA 5KFZA 1I6JA 1NEEA 2WB4A 1DURA 1LK5A 1QAJA 4DU8A 3KMQA 3HJVA 2MHEA 2IMWP 5F8GA 5HROB 4ZLPA 1HI8A 4KGKA 2P5VA 2DNGA 2COLA 4IQXA 2HHSA 2CNNB 2YH0A 3WBZA 4QZVB 3BYPA 4USVA 1XTZA 2FGCA 1TMJA 3TVZA 2CWKA 3QFWA 2ZH7A 1UJ4A 2ZWOA 4K5RA 3UI3A 2ROGA 4HKQA 1X5SA 5IS2A 4GO7X 3SSRA 4ZCKA 4FZVA 1DTTA 4M5HA 2B8QA 2XO6A 3O5TB 1BC6A 3BSCA 4NL5A 3OVAA 1G6BA 3QT7A 3R1HA 4JI2F 2NZCA 4NLXA 3TJ9A 2XZTB 2C2RA 3JSMB 1E6VB 2GIRA 3GYGA 2YQ1A 3SSSA 1LOUA 1DTQA 4Q7AA 2CPJA 3QT5A 4WXWA 2HQIA 4HHHA 4ZP9A 4M5KA 4DR2F 5LSLA 1N0VC 3AXMA 1CJVB 2KM8B 2DNOA 3H7HB 3AB2B 5B0FA 5F8MA 5ETNA 3BSAA 4G6VB 1P6TA 6FDRA 1UJ6A 3KOAA 3RW6A 5J2PA 3BKTA 3CJ3A 4JV2A 1I1GA 1H7WA 1JLCB 1T94A 4LBPA 2FJAB 4DQIA 1U1MA 1TV6A 3R5CA 3R5DA 1M5PC 4H4MA 4B9VA 3PW0A 2VDHA 3KTQA 3RG6A 2U1AA 1MMDA 2WZ1A 2OFHX 4ED7A 4Y28C 3UD3P 3CNQP 4IFVA 3MM8A 3D9BA 3RW7A 2F1FA 2QA4S 2NS1B 3W5XA 2H4YB 1OJ4A 1EJ7L 4IDKB 3AH6A 4ZVSB 1IM6A 3B82A 1NMEB 1S49A 1D09B 4HACB 5CA5A 2LQ8A 5CHCB 5L1KA 2DR6A 5KFRA 1ZM9A 1FCAA 2FHJD 1S1TB 1TU0B 1F2GA 3ELHA 4XDDA 3HFZB 2OPPB 2D1CA 3DRPA 4DPOA 4PG5A 1SKUB 3T5HA 3TP2A 1NSPA 3TVYA 2ADBA 4ATNA 3CDEA 5ETQA 3GG1A 2RQKA 3W65A 1FKAF 8RUCA 4N8OA 5LSOA 3ET6A 3W9JA 2ADCA 1FRMA 3SCLE
chains in the Genus database with same CATH topology
5DO2A 3BGLA 3SYZA 2FLOA 3P49B 1RT4B 2OD6A 3M1VA 3RB0A 1NJWA 2XNQA 4DOZA 1R3NA 1X7VA 3PZPA 2YNFB 4ITSA 3DYAA 1XK8A 2CZ4A 3UCUP 2IVYA 2FJDB 1NJYA 3IGNA 1VQYA 3N79A 4RW6B 4ID5A 1K73T 2J76E 1Y5NB 2J8AA 1RT1B 3GFYA 1U45A 4AQYF 2ZH3A 2ZH1A 4ECRA 2AV5A 5J2QA 2CQCA 2BYCA 2KG0A 4QWEA 2FD2A 2J6UA 1IBLF 1IJFB 4DFMA 3UFCX 1WD6A 3MMCB 3J7ZT 2BV3A 4G1IA 4Q2MA 4QR1A 5KT5A 2LECA 1NJXA 5IM0B 2CPDA 3D1QA 1PGZA 1C1BA 2VB6A 5DQHA 1FJEB 2K2PA 5E3PA 5K8OA 2B43A 3A1YG 4QWBA 5K8PA 5LT5A 2KXNB 3OXFA 4YEAA 3TARA 2DITA 1NK8A 2FHKA 2J6SA 1N0UA 4KRWA 1LWCB 4Y2AA 1NK4A 5CYQB 3KLGB 1KLMA 2MQOA 1FJ7A 1KTQA 1YITS 1L5UA 4KAIA 4DQPA 4BWMA 1T02A 4RLEA 1VQ9S 2JEGA 3OL9A 2R7VA 1M0SA 2CJQA 5D4LA 1W2IA 6FD1A 5DLGA 1NK9A 2CQ1A 2XLKA 2B7BB 3CCTA 1T3OA 4JI7F 4O3OA 4HL9A 3I4HX 3OV7A 1YJWS 1SJ1A 1R8PA 3PO5A 3MECA 3T6BA 3W2VA 3SCJE 4QOTA 1JXLA 3IAM9 1S0OA 2LEAA 4A46A 3V81B 2UVWA 3CD6S 2KZZA 3KLFA 2KB2A 2I8EA 1S1XB 2VG7B 2ZM6F 2WW8A 4F8RA 1M5SA 4QR2A 1DJ0A 4K4VA 3RAXA 1U1LA 1A7GE 4QIWD 1RT7A 2JLGA 3AY0A 5KFGA 3CEDA 1BY9A 3BQ2A 1R0AB 3G6ES 4BHQA 3MOJB 1X0FA 3SZ2A 2FHOB 1RTHA 4BC7A 3S6EA 1FERA 3O2IA 2R2TA 2OPSA 3OXGA 1J5OA 2JOQA 4RW8B 1G7CB 2G13A 3A8EA 4HVZA 2K1RA 1U2RA 5H1SV 1VRTA 4X4OA 2RU9A 1VQLS 3EGZA 2C42A 1U1PA 2BXJA 1K0TA 1JLEA 2VC1A 4I4BA 1GXUA 2YTCA 3E01B 1VQPS 4ELVA 3GYNA 2ZZMA 2ZJRQ 4QPXA 1SXLA 1N52B 4LSNA 3TA1A 2VFVA 1H2UX 1AFJA 3CJ4A 3TUIC 4NLQA 2I5JA 3DRSB 2RVJA 3TA2A 2XMVA 3OTBA 3QLHA 5SZTA 1UEVA 4V19X 4KFBA 2IJNA 1UVKA 2XNRA 1JLBA 3MDFA 3UW1A 4CO3A 2W4CA 2DPJA 5LJ5Y 3UDLA 2FJEB 2DBBA 4MFBA 4QJVA 1VQ6S 1H98A 1NNDA 4OJ1A 5A8RA 5AJ3F 1A9NB 5FDLA 3Q2SC 4ZPWR 2BRKA 3DC2A 2FC9A 3MUTP 3PV8A 1OPZA 1G1XA 1KR4A 3IXQA 3DLBA 2QRRA 1OSCA 2NYIA 3PEJA 3UNGC 3VAJA 5CD4H 3BO2A 1D9AA 4LIWA 3QO9A 5HMWA 4DFPA 4RUCA 2UZAA 3ZZUA 2CQDA 2DNPA 2Z0GA 5J1EA 3DU6A 1UVMA 2YNHA 5HO4A 3CWJA 4I7FA 4I2QA 4KB7A 3MUMP 3TUJC 3QZ7A 4OI4A 4DN9A 2XGPA 3MI7X 4M1KA 5AXLA 4WE1B 2ROEA 1HNIA 4FXDA 2D3ZA 2LEPA 3IO1A 4YOEA 1RT2A 1BGXT 5HL7Q 5L38A 1HQEA 3DU5A 2HNDB 5CH7B 1TAQA 3HHLC 4NRUA 1VOMA 2KFYA 2LQJA 3QJPA 2KTQA 3CXCR 1T95A 4C11B 2G0CA 1FK9B 4WU3A 2F8EX 2LXUA 4QPTA 4CTAA 1RTDB 2DR8A 4KV8B 1X4GA 2OSQA 1N5TA 1UKUA 1FRLA 1PILA 4WKYA 2MZRA 1HQUB 2YKNB 3V5RA 5A6PA 3VAHA 2O5DA 4YB7A 4YP3A 5KFIA 3DLHA 4J37A 3JTOA 3LP0A 4PR6A 2VBXA 1S1WA 2JC0A 4QR0A 4W90B 3H8YA 2BJEA 3TQ1A 2NSCA 5KFAA 1NJIT 1F0XA 3AA9A 4DV4F 4OI2A 3ICLA 4Q0BB 3DDKA 4NLTA 3JSBA 5DM6Q 5KOWA 3HXMA 3RBDA 2EK1A 4ZHRA 5H9EJ 3E3XA 3HHEA 4IFYB 1RQ0A 4FNHA 2NXUA 3M8PB 4IH5A 1VK8A 3DNCA 4U67Q 2MKHA 4A8FA 2WK4A 4P7TA 2WTFA 2KVIA 4A8OA 3CCMS 1CG2A 4RW7A 4QWAA 3JTNA 1C1CB 2DO0A 4OI3A 5I42B 4YY3F 3C66A 3NLCA 4Y2IA 2MY7A 2IM3A 2QLWA 3IR7B 3MMBA 1MU2B 1XMBA 1LFWA 1QSYA 3VWSA 4PQUB 2KFZA 3PRBA 2CQBA 2Q6CA 1Q8IA 2WHOA 5GAGI 4UW2A 1U49A 1HBMB 2WBMA 3CIZA 2LXFA 1WTBA 5KFTA 1VRUA 3WX4A 4ECYA 2OTJS 4WIIA 1N8RT 1C0UB 5J2NB 4MIWA 2FJVA 4OHWA 2M3DA 1KVJA 4KTQA 4NLUA 4OJHA 5DQGA 2DCUB 3M9MB 3JSRA 4F26A 1FO1A 2RKIB 3I0SB 2QSFA 2GQ2A 2HIQA 2ZKTA 4EWTA 1KONA 3TA0A 2VFUA 3NKYA 3H40A 4Q2LA 3TI0A 4Q43A 1SUQA 1Q81T 3U1LA 3H2UB 1OSDA 4O4GA 3PR5B 3VQTA 1M5VC 2G4BA 3QMQA 4CH0S 3MHYA 2UXDF 3BN4A 2DT9A 3FMBA 4K4YA 2FUG9 3DOLB 2OPQB 3BDPA 4LT6A 3V6KA 1TL1B 1K9MT 3NMRA 5A8WB 3U27A 3S7RA 4EBEA 3MMAA 1TKZA 1HA1A 2KI2A 1REVA 1TL3A 3T6JA 5GAEU 2GA7A 2W9BA 1AUDA 1UVIA 3K5PA 1L3KA 4JOUA 1TVRA 2VPXB 2B0GA 4N47A 4PPZA 4OZ5A 3QAUA 2RDJA 4YR0A 3HJFA 4AL5A 2KJVA 2P9EA 3F44A 5T7LA 2LMIA 2RT3A 4DQQA 4OHVA 2YKMB 5L8RC 4DSJA 2J0WA 2RMLA 3RAQA 1MW7A 2J7KA 1H38A 3BR9A 4DR6F 2AGPA 1TFYA 3ULHA 4F4WA 3H25A 1F5BA 4C8KA 4J9PA 3THVA 3K8VA 3QIPA 2HLUA 3D0IE 4YR2A 4EBDA 5KT3A 5HMXA 3BN7A 3M8SA 4RW4A 3QYYA 1Q78A 2MQLA 4O3NA 3SEOA 3KLHA 4Q5VA 2MKIA 2DIVA 1SI9A 4CO2A 1HBNA 5KFNA 3GYXB 4FXWA 1DQ8A 4ECZA 4OV1A 1C0TB 4C3MA 4Z37A 1HPZA 3MGJA 4PUOA 1PO6A 3HFKA 3DXBA 3I6PA 1HW8A 3N28A 2MHNA 4AUKA 1VMBA 3Q23A 2QEXS 2DNMA 4I6AA 3E51A 3KLIA 2R7RA 5F8HA 2YWFA 2Z4PA 1YVFA 1NHUA 2AW0A 1N32F 1PC4A 2GGPA 2H5EA 3UDCA 2ROPA 2K7KA 4PPDA 5LL6d 3V6JA 3M30B 3MMJA 4EFAC 3N4WA 4MK9A 4N56A 4DL0C 5AXNA 1IKXB 2PE8A 1G3OA 4EBCA 1NK6A 5DG9A 4KE5A 4DLGA 4MJKA 1Y0HA 1S99A 2YNGB 1DTTB 2YWHA 4K4SA 4B9UA 3BGRB 4PG7A 4C0HA 1KNZA 1HARA 1JKHA 1ZH5A 3DCAA 4IRCA 1UA1A 3TAPA 3SCKE 4M94A 1RI7A 2AJFE 4JI8F 2P6SA 3OLAA 2HS0A 1IKYA 5BR8F 4DSLA 2FLPA 3F56A 1S6QB 1YSJA 5B0CA 2EBGA 4MMOA 2DVIA 3ENWA 3HDSA 3GZ7A 1YWXA 3IWLA 1IKVA 2QMXA 5JXSA 3MURP 2POKA 2ZD1B 2B9WA 1JB0C 2B5JA 1V3ZA 2UUTA 2ZC4A 1HL6A 2BE2B 2KRRA 3M6XA 4J9SA 5DLFA 1UETA 3LO3A 1HBOA 1DTQB 2YKAA 3AAWB 3X1LB 2CIMA 3KG1A 2CJ9A 4R8UA 5IT0A 2W7AA 1S6PB 2ERRA 2E5HA 1U1KA 3SCIE 1KVIA 1H2VZ 3ZFVA 2XS7A 2OMOA 2WB1D 4B3SF 2XY5A 3P3DA 5GVQA 1Q16B 1YGYA 1U6BA 2ZH4A 2ABYA 4ZPVR 4QW8A 2KO1A 4ZPDA 1LWEB 1JJ4A 1X8DA 2LA6A 1U47A 4ZVFA 5IQ6A 1VIXA 2DGSA 2JHEA 3DOKB 5KFUA 2X1GA 4K4ZA 1VK3A 2DGVA 2ATLA 2E66A 2JH3A 3POTB 2F40A 1CC8A 4YR3A 3OFGA 4MKAA 3CJ5A 2J6TA 4UQGA 5D78A 2CVIA 4H4KC 3KK3A 1VBYA 3MFHA 2UVRA 3SDEA 3UR0A 1Q86T 1LWFA 3MOZA 3EPIA 4NCBA 4DR7F 5GMKa 2OJ3A 1W2BR 2ZHOA 5DQIA 3AHPA 2GJIA 1N6QB 3ENVA 3RB3A 3RU0A 4QYZJ 1WG4A 2OO4A 1YG0A 2QA1A 3OJSA 5HLFA 4NA1A 1U7LA 2EFNA 3VAMA 1FDBA 2PA3A 2VL1A 5B0AA 1IBKF 5J2PB 4R25A 1KQSR 2ZDPA 3CDUA 5ADZA 3GIJA 3FCHA 4A8KA 1FNOA 2VG6A 2JVOA 5KG4A 1XERA 2FVPA 1QSSA 4EO8A 4DQRA 4NX9A 3FSYA 4BDPA 2GIQA 2VQEF 5L1LA 1FDNA 1C2PA 3G86A 4TLQA 4Y2KA 5DDOC 2EPIA 1EP4A 3BB5A 4ED1A 4M8LA 1TV6B 3DRRB 2HQ3A 2EFGA 3FDSA 4XK8C 3J7Z5 3D0HE 1WEXA 4H4MB 1MNEA 1P8GA 3LP1A 1JLGA 3O1LA 2P9GA 2XWXA 5GAHU 4NLSA 5G4DA 3EZUA 5GAHI 1Q7YT 2M8DB 4PXEA 4DBQA 3RYLA 3IRXA 1RT5A 2CDQA 5A8KA 4GKKF 4AYBD 2GC8A 1IKWA 3K57A 4F50A 2WOMB 1FHTA 2KDOA 1Y5LB 4F4XA 3ITHA 3FQLA 2YWEA 5GADI 1SQEA 2CJKA 4IYQA 3QAEA 2B9YA 3BZQA 2LXIA 2KJWA 3N5FA 3UCGA 1FD8A 3GV7B 3N9UC 1R27B 4IFVB 4OZNA 2GQQA 3KWMA 3MM8B 1NKBA 2RH3A 3NNAA 2DNQA 2ALZA 1F9FA 4E98A 2VC0A 5EWEA 2AJ4A 2MZTA 4CQ1A 5E2QA 1JLAB 1ZM3A 2ZDOA 3CB4A 4F3QA 2M7SA 4WXOA 2W7PA 3SV4A 3H2VE 5B0EA 4DL4A 1P27B 3NBPB 5CCLA 2O01C 5G0RB 2ASDA 4AXJA 1RA6A 1B0TA 1DARA 4FF3A 1F60B 1LW0A 1FD2A 2CPZA 1ZTTA 1LV5A 2IRYA 1D1UA 2FDNA 3ZZOA 4DQSA 3OTDA 3H59A 3MCSA 2MGZA 2BRLA 1N54B 3D28A 3MM7B 3T1YF 4JI5F 4ETZA 2ZOFA 2NREA 3CGIA 5AE1A 5HBMB 4PQAA 1OS5A 1RTIA 5DGBA 2XI3A 2LQBA 4FNIA 5KFPA 1FF2A 2E9RX 3KG4A 2EI5A 3M8QA 3MM9B 2RE1A 1S1UA 3DI6B 5FIIA 5KFSA 1QAYA 2VBWA 3NCQA 4H4OA 3PIPQ 1NB7A 4A48A 3CF5Q 1FXLA 1R8AA 1X4HA 2WSEC 2DNNA 4O3SA 2ZNZA 3DGPA 3DXSX 1GT8A 4QCLA 1D9DA 5E3QA 2AJ0A 4NLWA 5CZVA 2PD1A 1S9GB 3LAKA 4ECXA 2DJWA 2QT7A 2Q3PA 2C22A 4NCGA 4IG0B 1H7XA 2CQGA 4I1TA 4BBYA 1R89A 2VPZB 1U4BA 4N41A 3UR3C 4H4KA 2E1MC 1Z2ZA 1JLCA 3CJKA 5HP1A 4U7CA 1WELA 4TY8A 4FP9A 1RT3A 1X4EA 1YJUA 3D1HA 4KO0A 1HNVA 4NPOA 1JLQA 5C24A 4ECQA 2V4QA 4J9RA 2DHGA 3E2EA 4ZP8A 2BANA 1KC8T 5IXUA 4RU2A 5LXRA 3I0RB 4WYLA 1VFJA 2HVIA 3AQOA 1WI6A 2CRLA 3DDNA 2OP5A 3MM5B 4OJ3A 3I32A 4IRDA 2U2FA 3Q0AA 2HFNA 3NAIA 1ZM4A 3OR1A 3HM9A 5I3UA 2CJAA 1YRUA 4PWDB 1O0PA 1FTCA 1X5TA 5D3GA 2GO8A 1SKSA 2XSJA 2DK2A 3B78A 3WZ0A 4HYKA 3MM6B 1GNKA 4C7QA 2MB0B 4F3MA 1UVNA 2XS5A 1E6YB 1UFWA 2HWTA 1DQAA 1HI0P 3NG8A 2CQ0A 3OQ2A 2AYGA 2LQ9A 4CI0B 3FVYA 2OLWA 1BQNA 3EZ5A 2W4DA 1X4CA 3IS9A 3HF5A 2FGOA 1QVFR 3C8YA 1WWHA 4ZK7M 3M1VB 5C42A 1FA0A 5K8NA 2KHCA 3DYAB 4MK8A 4K50A 4O4RA 4DV6F 1VS3A 4RZRA 1U1OA 1L3UA 3KK1A 4OI0A 1S1VB 1MMLA 1ULRA 3NGKA 3S8SA 3HKWA 3PIOQ 2VFTA 2VA3A 3ZZYA 3PRDA 3WC0A 4NXNF 4IO9Q 4OZJA 5B0BA 3FRYA 4RX6A 2RJZA 4QYRA 2Q79A 3H20A 5KFDA 4OX6A 2AGQA 3LALA 3RTVA 2YX7A 2NQPA 1RT6B 2MZJA 2MSSA 3EPGA 4UOCA 1HWIA 3OL7A 3O6QA 4MYUA 1HI1A 3MZIA 4YDDB 2K3KA 1L3VA 4OZ1A 1O8BA 4HI2A 1C1BB 2B4UA 5I3PA 2BBEA 2RS8A 2HLTA 1CQNA 4MIAA 2HMIA 3VALA 3GR0A 1TK0A 2FC8A 3L95X 2BDPA 3NWGA 2KFNA 2BOPA 1S1TA 5THWA 4DSKA 1KLMB 1TZ0A 3KG0A 4ZDNA 3MEEA 1K1SA 3TX8A 4DSFA 4F4KA 4JI0F 3K58A 1FNMA 4AFFA 3I55S 2BVZA 1FVQA 1SC6A 3KK2A 2OPPA 2Z8QA 2ZZNA 2V8VA 2RQMA 5M2UA 4F2SA 1IQZA 2YKQA 1SKWA 4M95A 2LLZA 3HVTA 5EX0A 1LQ9A 2M2BA 3NRBA 1QUPA 4HLBA 3KLFB 1NRKA 1WG5A 3PX4A 4A47A 3ISND 2LEBA 1ZTWA 1P9QC 2IFXA 3OVBA 5C5JA 2R7QA 4WF9Q 3HX9A 1LW2A 3B4MA 2GFFA 2XMUA 3D5MA 4IQMA 2HHPA 3K2YA 3V4IA 1RT7B 1X4FA 3NNHA 2D74B 1KOHA 1SBRA 2AJ1A 4WFZA 3PACA 2R7WA 4CH1A 3MAQA 1RTHB 1YQHA 2IYIA 2MJNA 4C8NA 2BM0A 3HPOA 2C3UA 1M90T 1ZZNA 2MQPA 2DHSA 4O0IA 2K1RB 4RNOA 1FJGF 4FXVA 1A6LA 2CPYA 4F67A 2Q1LA 5M2RA 1JLEB 1HHSA 1TUVA 5F8IA 4ELTA 1RT4A 3HHNB 1HD0A 2D7SA 2XHWA 1D3WA 2GX8A 2OD4A 4N8NA 1VHFA 3PW5A 4LSNB 2YNFA 2ZITA 3Q22A 2IM2A 4DR1F 3CCJS 2FY1A 3GMGA 3DLGA 1O51A 2MMYA 2XMMA 2I5JB 3FRZA 1S77D 2E5JA 2OSRA 3CD0A 2M70A 3VZHA 4DL6A