1VK8A

Crystal structure of a putative thiamine biosynthesis/salvage protein (tm0486) from thermotoga maritima at 1.80 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
PKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords hypothetical protein TM0486
publication title TM0486 from the hyperthermophilic anaerobe Thermotoga maritima is a thiamin-binding protein involved in response of the cell to oxidative conditions.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 25
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vk8A00
1LXNA 1S7HA 2EKYA 2EPIA 1SBRA 2IBOA 1S99A 1VK8A 1YQHA 1LXJA
chains in the Genus database with same CATH superfamily
4FYXB 2Y0BB 3DGVA 4OYBA 4LVOP 4PRFA 2DHHA 4J91A 4KC5A 5HL7Q 4FF2A 3PX0A 4G1QA 1JLQA 1FO1A 2VC1A 3P6YC 1HNVA 4NXNF 3V6JA 1XN9A 4XIUA 2BQUA 4K7QA 4ZPWR 5IM0A 4RNHA 1EB0A 1M1HA 3MFHA 1WKJA 5HVFA 3I5BA 3E2EA 3VVTA 2B4VA 5HAOA 3N6NA 1VQNS 1RT3A 4QWDA 2C2OB 3HKWA 1BQXA 3C6TA 1S76D 3VQSA 2NREA 5EDWA 2W7PA 1SUQB 1ZM2A 2B3TB 1WOPA 2DPJA 1NAQA 3MPYA 1N5QA 3D6MB 4M5LA 3GSDA 5A6PA 1KFSA 5E2QA 3THTA 5SZTA 3CCVS 3SSRA 3KLEA 2BA9A 2LP4A 1YIJS 1JJHA 3CJ2A 4DN9A 3DRRB 3KMQA 1XNRJ 4ELUA 2YKAA 3L95X 4RBUA 3OQ2A 2WSEC 2F4VJ 4R0JA 2X1FA 2RD5C 4A8KA 1EAYC 3FBBA 4EYIB 4H4OA 5B0CA 3K7RA 3MECA 1PSDA 4DJBA 2RVJA 5D0HA 4KH0B 2R7QA 1NB7A 3KJVA 3UDEA 3J80U 3RW7A 2HHQA 4NEZA 2E1MC 2G1DA 2E29A 1RT2B 4NWBA 1FDAA 3HVTA 5AXKA 1L3VA 1S0VA 4O3PA 4PQUA 3RB3A 2E44A 2IJNA 2HZVA 2EK1A 4Y3CA 2Y1LB 1HBMA 1ZOTA 1HR0F 2DR7A 1EHWA 1HNZF 5I3PA 2HYIB 4S0MA 4F3QA 4CH1A 2XGPA 1MU2B 4EZ6A 1ZTWA 3Q2SC 1BLUA 5E3CA 4P71A 3I87A 2F8HA 4YB1P 1L3TA 4NZ7A 3KLHB 3JTPA 3D0IE 2D7SA 3OUYA 1SH0A 1TK5A 5K14B 1EP4A 4KV8B 2HNYB 5J2NA 2G13A 3H8YA 4BWJA 3I0RB 2LVWA 3P4UB 3M2VB 4DS4A 3CTRA 4K4SA 3ILJA 1IBMF 3QO9B 3WHIA 1FERA 3MCMA 1LWFB 1FWPA 3SQOP 1FCAA 3H5XA 1FFGB 1KSPA 4UY85 2AWZA 2RNEA 1I94J 5HP1B 4DUZF 3UD4P 1WC3A 2BUNA 3CVKA 3W64A 1SKRA 2IM1A 1TL1B 2FLPA 3I31A 1UTAA 4KHPF 4MK7A 3BEGB 5KFYA 4DR2F 1H0HB 4OI4A 3EGZA 4O4RA 2B9EA 2BACA 2RUGA 1BC6A 1IBKF 1S9EA 4Y65A 2FLOA 3KXDA 1SJ3P 4QCLA 4QWEA 1BHNA 2B6AA 2RUSA 3OT9A 1S1XB 4ED7A 2RDIA 4DG1A 4P2FA 3EVMA 1TZ0A 2ADCA 4NMLA 2C2ZB 3HHLD 4YDXA 4USTA 2R7SA 2UXCF 1N54B 3CIZA 1V6HA 1QVGR 3LANA 3GIRA 1JLCA 3DLLQ 3TI0A 3Q8PB 2F7VA 4DPWA 1RT6B 4JI7F 4KE5A 1M5SA 1ZM4A 2YQ1A 4B9MA 1KONA 4RR5A 3RJMB 3DMJA 3D0GE 3W3SA 4QWCA 1N34F 1OQ6A 2MKYA 3MCSA 3R6GB 5I3UB 1M0SA 2HRUA 3W61A 2H4WB 3CJKB 3TUPA 2KN4A 2BZ2A 2NSBA 2ZDPA 3CJSA 1RWOB 2KH9A 5LMUJ 2VBYA 3NNCA 2OGUA 3UDCA 2ZH6A 2OI2A 2BOPA 3JXOA 2PI4A 2OEJA 3TOQA 2D3ZA 1QAYA 4UOFA 4QR1A 2RKIB 3CD5A 2GO8A 1SVDA 5D77A 1VBYA 3D0HE 2ASYA 3ITHB 4P75A 2IHR1 4QWAA 1X4FA 1TK0A 4P9SA 3GR0A 4N8OA 5HLFB 1PO6A 4DR3F 3CC4S 4DHVA 4LR7A 3BO3A 4USMA 3FSIA 4C8MA 2MLYA 1L3SA 3EVOA 5CCLA 2YX4A 3MAAB 4HT7A 3NOGA 1NU4A 2B7BB 4OZ0A 4WXOA 4DL7A 1X9MA 4WJBA 1R8AA 3PXGa 1OQ3A 3U1NA 2WVCA 3BGRB 3BKFA 2FY8A 1JWWA 2FZCB 4ITSA 3NXZA 1MWYA 1R27B 3I56S 4CM0A 1GMUA 4TVAB 3TJ9A 2KFZA 2NQPA 1TKXA 3J80Y 4HH1A 4LF9J 2PMZD 2NXCA 1ULRA 4YHHJ 3FEXB 2VG6B 2M70A 4XPCA 3W8GA 4V19X 3Q24A 4C2MA 1IKYA 2E5GA 4RW4B 1WSVA 4IH7A 5ETRA 1FDNA 4ILLA 1MMNA 4J9NA 2GMLA 1O5JA 4ID5A 4UF4A 1YJUA 2VDHA 4TQSA 4LSLA 4USVA 4K0KF 4Q0BB 5ETMA 3JTOA 1FNOA 2QA2A 2LYVA 1N52B 4DX5A 2A0FB 4K4ZA 4TU8A 3L7UA 1ZS6A 1NDKA 4ED2A 3WZ0A 3IRXA 5A8WA 1JIHA 3CIMA 4JBCA 4JI1F 4X66J 4ZVHA 4ECUA 1R6VA 2EFGA 1ZPWX 4IR9A 2VONA 3LW5C 1SJ4P 1RKJA 1P1LA 3UVJA 3EICA 1YBAA 3TUJC 4G1QB 1JLQB 1S97A 1NJWA 1HNVB 1HWIA 2BVZA 3H42A 5CAAA 1CEZA 2B7CB 4CNYA 1RGVA 5F9LA 4OYIA 5B0BA 3ZZRA 4NLRA 1HNXF 3J7AN 1PGZA 5IM0B 1XQIA 5I3QA 1A0OB 4AE5A 2XMKA 3QATA 3TA0A 2J0SD 4DXLA 4LF4F 3ZZOA 3FUYA 1RT3B 3Q83A 1RWKB 3K0JA 3BQ1A 3C6TB 4XO0A 3KLVA 4LFBJ 2FYXA 3AJ1A 1YWXA 1T03A 1D9DA 3GZ7A 3OR1A 3GFYA 3CCES 3MCNA 3RBEA 3IBCB 2IY5B 4B3SF 2MZJA 4ZVSB 2V9KA 2ABYA 1TKZA 2CQBA 2EC0A 4B9LA 3W1YC 4YMEA 4ED5A 4J5OA 2XMUA 4PG7A 1T0TV 3GFXA 5KG1A 2YKQA 4TYAA 1YJ9S 2F5GA 1U0SA 1BE4A 2CQ4A 4TXSA 3O1LA 4J9SA 3LPEA 2Q6BA 3HSGA 1RHQB 2ZZNA 3EDQB 2C3UA 3W8PA 1AT1B 2CVEA 4DL5A 2MEWA 4H4OB 3MECB 4QOTA 4ZP9A 4LT6A 4YOEA 3KJVB 3PG9A 1NPRA 3EX7B 3LH2S 5LXRA 4WBFA 3F44A 1AZSA 2VA3A 1FDBA 1PYTA 3TVKA 5F9NA 3EMTA 4YR0A 3HVTB 4PQUB 3J7YI 1UWAA 1FKOA 4K5SA 5FJ4A 4FXWA 4JI8J 5F3TA 2F1FA 1L5UA 3W5ZA 1GT8A 4FKXA 3T1YF 4DV5F 1N0VC 2IAJA 3LO3A 2LMIA 3SQGA 4MAKA 2AJ2A 1HBMB 3I6PA 1ZAVA 1TR0A 2R3VA 1T02A 5F8LA 4DR7F 2R7VA 3BGFA 2PA3A 1QE1A 1JLFA 4JI3F 2ZC4A 2F8MA 2MGZA 4F0MA 3GE9A 3ZTPA 3RZAA 4FNHA 2BKOA 3CB4A 3NMRA 4ZDNA 3WC0A 1GK8A 2W4DA 2JZ5A 3FBFA 4NLVA 2A3JA 1SC3B 3OUYB 4OI0A 4FF3A 2HZCA 1EP4B 5GMEA 3TUIC 1VLOA 3FMBA 4TLQA 1G4CA 2Z2LA 5J2NB 4UQTA 5GADI 2IM0A 3R6LB 3CDWA 2ZVSA 1EKRA 4EGLA 1RAGB 1RAFB 1HI0P 1S59A 5HVGA 5AXNA 2W7OA 2UUWA 2HFZA 4P2MA 2F3JA 4RUHA 1I51B 1NZ8A 4OLOA 4B08A 2F40A 4H4MA 4U9RA 2BW2A 5EHHA 4Q44A 2W4CA 5KFBA 3VAJA 2Z0GA 4YUDA 4WE1A 3PEHA 1C0UA 1UJ6A 3JAMU 4D3GA 2DXDA 3Q8SB 2YPZA 4ETXA 4X2BA 2MQNA 4L6V3 3VQTA 3PY8A 1KTVA 3B8HA 4OI6A 3D54A 2HHWA 2XY7A 5IT0A 2PE8A 3PRDA 3W66A 3BKTA 2GIRA 4ELTA 2CYYA 1N5VA 3QT8A 1S57A 5E3PA 2OTJS 3TWZA 2IA6A 1Z2LA 2D1CA 4C0OC 1S9EB 2WCXA 3MUMP 4QR2A 1Q8BA 3J7Z5 1PCAA 4Z7YA 1SL1A 2C3OA 1P9QC 2B6AB 1NSAA 2MQPA 4DG1B 5GMDA 1DARA 1MN7A 4B3RF 3KK3A 2VKZG 4GKJJ 1TU0B 1JLCB 2YXLA 3M2UB 4G1IA 2ZD1A 4WP8A 1CJKA 2AJ0A 1YTYA 1G1XA 3OXLA 4ZCIA 3DMJB 4AL6A 5AJ3F 3NGRA 3O3LA 3R1LA 4ZIWA 3HHKA 1S48A 1K44A 2CPIA 4A8SA 3S7RA 1B7YB 2DGQA 2LDIA 2LU1A 4AUKA 5EWEA 3MR7A 2C2NA 3CGIA 5GAGI 3IAS9 3K58A 4RLEA 3FC9A 1UVKA 4NLTA 1WOOA 1FTRA 5DQHA 2CQPA 1Z2ZA 3GJQB 5CZVA 1RE1B 3TA2A 2OPQA 5BXIA 5A2QU 2WTFA 3NGDA 1VYAA 3Q22A 3MF5A 2MKIA 3ET6A 1WHXA 3NOCA 2OTLS 4NLUA 1FFWB 1BY9A 1R8PA 5B7WA 3N5FA 3H59A 3QWPA 1R31A 3ENVA 4WK1A 3QQCD 4KHRA 2DXEA 1T9TA 2C2KB 3C46A 4C8OA 4HHUA 3WDOA 2P2CB 3R8YA 4ZVRB 5DM7Q 3CEDA 2HWHA 2E9ZA 1CULA 3BBBA 4U6PA 3RB4A 4JV2A 3G6VA 1EIYB 3PO5A 4ZJQA 1KOOA 5HMWA 2YWWA 1DQ8A 4B3TF 1X9WA 9RUBA 2VC0A 3HCXA 4RNOA 2K2PA 1CJTA 4WP9A 1ZPVA 3QFHA 3J81j 4ILMA 3MFIA 2R2RA 3NRBA 5DDPC 1TKXB 4LR9A 1Q53A 2J8SA 3C15A 1WELA 4RPFA 2UUAF 4K2JA 2GHVC 1S10A 1U2RA 5HVHA 1AYEA 5KG7A 1IKYB 4CH7A 4DPYA 2GS8A 4GO5X 3ZZYA 2DNKA 2HK3A 3HDSA 1HWLA 3RBDA 1RLCL 3NCQA 1XWLA 4ID5B 1HLWA 1HNWF 5I42A 5CQGA 3SYZA 4LSLB 3WX4A 2MZTA 4IRDA 1NK0A 3JTNA 2J5AA 4CO3A 1UAWA 2BV3A 2IPOB 3CC2S 4DLGA 3V4IA 3NNAA 1XR6A 3DLGA 3IRXB 5A8WB 1D0EA 4ZP7A 5D0GA 1WACA 2BW7A 3VR1A 4M1KA 4RW6A 1HR0J 1U1KA 2ZM6F 3ZXWA 2DKOB 5SUHA 2K1RA 1HNZJ 3HHDA 3UVJB 4XDDA 5KFMA 1QY7A 4C8ZA 3A4TA 4EU0A 4C3KA 2ZDOA 1RTJA 8RUCA 1GMVA 3SEOA 2B51A 1X60A 4DQRA 1GXLA 1VRUA 4B02A 3QZ7A 4WFAQ 2HNZA 2I5JA 5D8HB 4ER8A 3JAMY 3BB5A 3JYTB 2ILYA 2OEKA 2GO9A 2W4PA 1IBMJ 2OPSA 3SFGA 2HGLA 2XMWA 1YGYA 1T03B 1JLBA 2IJRA 3OR1B 3UN2A 1R8CA 4DQQA 2Z2ZA 3QJPA 3E01A 3FFIA 3M9MB 3G86A 2ZNZA 2LQBA 3W7BA 2HQGA 4ZVOB 2ROPA 2NUUG 3SV4A 1O6XA 1DTTA 2WAQD 4A48A 1LV5A 4DUZJ 5IZHA 3EUNA 4ANCA 4YFUA 1WWHA 1TKZB 1LOUA 4DCOB 2QYGA 4KHPJ 5KFOA 3IAM9 2XTJP 3FEYB 4DR2J 4X4OA 2JHEA 2XG8A 2I38A 4C9DA 2L9NA 3O44A 5KFEA 3KG0A 2V6AA 4Y2MA 1IBKJ 3M8YA 3KWMA 4X65F 4KGKA 4CH0S 4OZ2A 4N76A 1WJ9A 3MEGA 4KQZA 2XS7A 3PV8A 2CJAA 2GX8A 2CFXA 5KFTA 3PYDA 2A2DA 1AZSB 2KTQA 1CSJA 2IVMA 1RWPB 4D3HA 1FKOB 2UXCJ 3W9JA 1NZAA 3T3FA 3PYGA 5KFWA 4NCAA 4FF1A 1SXLA 3WBZA 1VBZA 1BQMA 3SQGB 3QT7A 3RYLA 1WC4A 2DRAA 3MR6A 3R1HA 4DLEA 4JI7J 4WKYA 4CO0A 1IR1A 5LM7E 4FYDA 1QE1B 3IN5A 2GHPA 2U1AA 3BREA 2CAJA 3JSYA 2MGZB 1RYRA 1N34J 4USJC 3P3DA 5RUBA 2JVRA 3GU0A 2W8LA 4CQ1A 5A2QY 3L09A 1WD6A 5IQ6A 2CNKB 5JMNA 2BM1A 4EK2A 2C3YA 1O8BA 2W24A 1VQ9S 1JLAA 4RU9A 2UVWA 5FD1A 4RKUC 2V2ZA 4H4MB 4IDKA 2CPZA 3EGWB 4WE1B 4A8MP 1C0UB 3J7A1 2LQ9A 2Z2YB 5F41A 1JNRB 3BH7B 4Y0FA 2E7XA 4DR3J 3RAMA 3W9IA 4ZVUB 1Y3KA 1NK8A 2ZOFA 2YNIA 2KI2A 3TJAA 4DSEA 3JQJA 4RO0A 1FRMA 2XNQA 1UZHA 4Y2KA 5M2PA 5DM6Q 3T5KA 1FI4A 1FRXA 2DR9A 2V4QA 2HRYA 3LGMA 3GIIA 2VPWB 3SBMA 4A46A 3EGNA 4IQMA 1M5HA 2JOQA 3ZNJ1 4U95A 3KK3B 4DV1F 2A2CA 3KHRA 2QL7B 3VV2B 3HJVA 1WF1A 1VQ6S 2ERRA 4DV7F 3QSYB 4FVCA 3FCVA 3PYEA 4FVMA 4PG8A 1Y0HA 3MUVP 3PEJA 3R2DJ 2UXDF 1CJKB 2KG1A 3VAHA 1M1KT 4WZMA 4DCPB 5LXYA 3QRRA 3K5NA 2DHGA 3Q8UA 5IV3A 4QIGA 1VIXA 4K0KJ 3J7YU 5H9EK 3P96A 2O1PA 4CLPA 4JI2F 2P6TA 4K4VA 2H48B 2W9CA 1AB8A 2IFXA 2GMHA 4L72B 2EK6A 4JI1J 4NRTA 1DAXA 4JI0F 3QT5A 3RW6A 1YQHA 4ZS6A 5L46A 3ZZPA 2MQLA 4QQBA 1TAQA 3EM1A 2ZH2A 2B9XA 4P72A 3R5GA 3EXCX 2JFKA 4WKRA 1YJTA 1WEZA 3NAHA 5DETA 2OPQB 3HFZB 4CP5A 2RQKA 4KY3A 4DX6A 3R5AA 1HNXJ 3ET6B 2IRUA 3S01A 4RUCA 4HACA 3OTBA 3W5YA 4O3NA 2FGOA 2G9OA 2ZHOA 2HFSA 2DR5A 4NOHA 3PRBA 1RJJA 1IM6A 1YBUA 1KBRA 4P6QA 3G6XA 4LF4J 3TVZA 4PPDA 2W9BA 2XC9A 3K89A 7FDRA 1ZZFA 4WIIA 1E6VA 2V8VA 2MDAA 3GB0A 1GX6A 1UFKA 3Q8VA 3I9ZA 2N7YA 2FJAB 3QAUA 1NH7A 1S6OA 2XYGB 3PTWA 5BR8F 3VGUA 3MEDA 1M90T 3KUGA 4NX9A 2CDRB 1CJTB 2Q79A 2OEMA 2DO4A 2GJFA 2L41A 3PZPA 1OMSA 2MKJA 1JNZB 2GQCA 4OZNA 2M0GB 2PN6A 1NK9A 1KVIA 2LQ5A 1U1OA 3LGNA 3C15B 4ED0A 1KLNA 2DGUA 3H5SA 1NSQA 4RWWA 1P27B 1R0AB 2ADBA 4OLPA 1RTIA 4QYZK 2UVVA 5CH7B 1KKHA 3G9CA 2XLKA 3VZIA 3P5TL 3LGHA 1RWNB 5KFGA 5I42B 4ZCLA 1QAXA 2ZHBA 3SI8A 4QR0A 5GVQA 1X4BA 1CBKA 2IDLA 3FEZA 4M94A 2KVIA 5EX0A 2VASA 1ZM3A 4F25A 2ZKTA 3V4IB 1WKLA 1S1TA 1EKSA 3DLGB 2GA7A 3OBIA 5KFCA 1WHWA 2FVCA 4OJ1A 2CKWA 4I68A 4DV5J 3T1YJ 4ZJOA 3UI3A 3PFOA 2C1EB 4RW6B 1U2FA 2J6TA 4FS1A 1QJHA 2ZNYA 2Z56B 1HHQA 2R8HA 2K1RB 1F3VA 3L9ZA 2JEFA 4DR7J 3M8RA 4JB8B 2M7SA 4HTIA 2P9GA 4JI3J 5L1IA 1YJRA 1RTJB 1H74A 3ILIA 3GYXB 1BD6A 2EG1A 5L38A 1U48A 2V4JA 5MLCV 3GV7B 4F3MA 2Y1JA 1RA7A 3ZZZA 2YX1A 1VRUB 4MIBA 4IO9Q 4WCEQ 1TK8A 1U0HA 2HNZB 2I5JB 3WX8A 5KFKA 5FLXY 1Z4UA 1WKKA 2OPSB 1YJNS 4DX8H 1QSLA 4P2SA 2ATCB 1K0VA 1JLBB 3HFKA 4F7VA 1YJ7A 1RWMB 1PJ5A 4HEA9 3E01B 3FFIB 2IBKA 4ENOA 1HI1A 2BQ3A 2JWNA 1GH8A 1IUJA 1DTTB 4HTJA 1SJRA 4IFVA 2KXHA 3NG8A 1LWXA 2J9DE 3WIUA 3UW1A 2LA6A 4ZITA 2QLJB 4WP3A 2HZAA 2C2MB 4NLGA 1HHSA 4ETZA 3PO4A 2V50A 2I1RA 4ZHRA 2E1RA 3TAQA 3M8ZA 3U1MA 4OZ3A 3GJRB 4LR8A 3MEGB 3N01A 3OLAA 4QIVA 2A10A 5HJYA 5E5NA 2UU9F 2XY6A 3MZIA 2XZWA 5B0FA 4B3RJ 4ES2A 3K5PA 2V9WA 3BGOP 5KT4A 2V68A 1JX4A 1X31C 2V34A 2ZH7A 4BHQA 4L3NA 2OMOA 4HKQA 3LTOA 2XCAA 4J9KA 1BQMB 2H5EA 2FLLA 3TQ1A 4AT1B 4C3MA 2HFOA 5H1SV 2JSXA 1HQEA 1R7IA 4LF5F 2HS0A 1YHQS 3AJDA 2H65B 2OHDA 1OS5A 3PFEA 3DOLA 4B9VA 1OWXA 1YBTA 2QMWA 3MUTP 4PWDA 4M5IA 3D3BJ 2UUCF 4I2PA 2MSTA 3UCGA 5LMNF 5JVHQ 3BSNA 2J0QD 2UVRA 3FMWA 2YH0A 1M5OC 2VU5A 1SH2A 1L3KA 1X8DA 2IRYA 3AQOA 3I4HX 3O2IA 1N36F 3HXMA 2HVEA 3WC2A 4HH0A 2AZ1A 4C98A 1Q8IA 4MKBA 4AFFA 2A18A 1JLAB 4PWWA 3OHBA 2QC3A 2CPDA 8ATCB 4OZ1A 2BYCA 3AJ2A 4LRCA 1C4CA 3G4SS 2IMWP 2UUBF 3PVXA 4IDKB 2V63A 3AXMA 3IP0A 1KOHA 1TFYA 3KHGA 2RS2A 2KYXA 3HULA 3I4PA 2KJWA 1SJ1A 1KQSR 2YNFA 2R8IA 3CF5Q 3RR8A 4LBIA 4OHXA 2IM3A 1FXDA 2XGQA 2ASDA 1VQYA 2YNIB 5DG7A 1FRKA 1URRA 5LSLA 1RBAA 1UEVA 5C2CA 3CD0A 2CQ1A 2Y1IA 3DRRA 4PZVA 3U27A 3OVSA 1LWCA 4OHVA 1OO0B 4KGVB 4B3TJ 4V1Ak 1APSA 4ZKAA 4U7CA 3DKDA 4PR6A 2WW8A 2R4FA 4DV2F 3Q8QB 2NR0A 3M8SA 4J9UE 3QSIA 3MMCA 2CJ9A 1TELA 4ZVEA 3FZBA 5LT5A 3GPAA 2V4RA 1EQMA 4DL0C 1KVJA 4ECXA 1P8GA 3M9NB 1VS3A 2C2DA 5CYQA 3OJSA 3ZTRA 2M8DB 5G0RA 4DR5F 2WOMA 2QA4S 3KLIA 1HNWJ 5MAOA 1X0PA 2Z4PA 3S6EA 1Y5NB 1RA6A 3UR3C 1QD1A 5ETTA 2YWKA 2AT1B 1ELOA 2XSFA 2W9CB 1FF2A 4DFKA 2HFUA 4ED8A 2MB0B 2ZWPA 2DR6A 3D6TB 5E3AA 2CPJA 5HO4A 2ZM6J 1B4SA 3UPFA 2V2QA 4JV1A 2CDQA 4RU2A 4P7VA 4RW8A 5LOQA 3QGGA 1RHKB 3BO2A 1KHWA 1XR7A 3FSXA 3I0SA 2XO7A 2DGXA 3EDRB 3M2VA 3M2RA 4DV4F 4WZQA 2B9WA 4I6WA 3V2UC 1FRJA 2FC8A 4HACB 4CCHA 4DR4F 1X5OA 2VIHA 4RW7A 4FYVB 5LJ3Y 1WF0A 4ZPTR 5D15A 1TKDA 4M5JA 2W9BB 3CCMS 4U7UK 3G96A 5DDQC 4TKTA 1ZETA 2JL9A 4A8WA 4P7TA 2AYEA 1AFJA 4XTTA 4KGZB 4IG0A 4UOCA 4OZLA 4Y2CA 1VIOA 4J9PA 3K5LA 1LW2A 2R8KA 2E1PA 2F9JA 1S0MA 2E9TA 2VD3A 3MD3A 1FWKA 4OYOA 2HFNA 3D4JA 2PO4A 2KB2A 2CZ4A 2AYMA 1P6TA 4WFZA 3NCPA 3QYYA 4O4GA 1FRLA 2CNLB 1VCTA 3QZ8A 1RBLA 3AD7C 4DV6F 3LAKA 3KHHA 1BQNA 1YG0A 4X4PA 1YLXA 4OHYA 2DNQA 3AB4B 1RTIB 2MKKA 3D1OA 4RUAA 1A7GE 4X65J 3MAHA 2FUG9 2LXFA 3H2VE 4OV6A 4F36A 4PG4A 3PCOB 4QW8A 1V9OA 2FJVA 2WSFC 4IFYA 3BKUA 1RZMA 3HSDA 1NK4A 3NMAA 1S1TB 3OTOF 1U1RA 5KTQA 1MNEA 4LRFA 3OJUA 4KB7A 1FFSB 1FE4A 2G0JA 3NEKA 4DR6F 3FNNA 3H0PA 4LF7F 5HMXA 3CJKA 2HHUA 1S1UA 2R8GA 1NXIA 1Q1KA 2HHXA 1M5VC 4HI2A 2X1GA 4ZP8A 2CWKA 2V4JB 3G8TA 5KT3A 2FHOB 1YI2S 1EETA 3FK4A 4OZ5A 1U47A 4L74A 2HVZA 4KTQA 1SQFA 2CADA 5LL6d 3DU6A 3CNQP 2XYHB 1VQMS 2XBPA 1NLKL 1U0HB 4DX7A 2C3PA 5BYQA 2FGCA 3O8WA 2FJXA 3ISNC 1S72S 3HHEA 3NBPA 1WTBA 1TKTA 4ICLA 1ZA1B 4WFBQ 3BPSP 1NJZA 3DOKA 3MMAA 4E8UA 1UPPA 5DLGA 4JI4F 3AH6A 1KQGB 1WSRA 3EPGA 3M1VA 5HATA 2M2BA 2DY1A 4LFCF 3EZOA 5J1NA 4IFVB 4M5DA 5IXUA 5K8MA 4DSFA 3PJXA 3A8JA 2ZH3A 3D67A 3FKBA 1LEOA 2HW3A 4M95A 4MKYA 1F9HA 3R5CA 3KJQB 2UZAA 5CYMA 4ZHRB 3P45B 1U6BA 4WFNQ 1IN0A 5AE3A 1JMTA 4HT5A 4O3QA 4PG5A 2XB2D 2JLEA 1T05A 5KFFA 4LQ9A 4U67Q 4DU8A 1W25A 5KG0A 3KMSA 1PKUA 4U7UD 2ALYB 1P9YA 2ZKUA 3BV8A 1NJYA 1F5CA 5L1JA 4DV1J 2YNGA 1K1SA 3OR2A 4M8LA 2GIFA 2M4MA 1KC8T 2VG5A 1Q86T 1HA1A 4DV7J 4RNFA 3J81U 1QTNB 4HI1A 4J9VA 4LIRA 3SMZA 3Q2TC 2HBRB 3CDBA 1HPZA 1UEKA 4DWIA 3IO1A 3QNWB 1HQEB 2UXDJ 3TR5A 3T6BA 2HVDA 4A4JA 2FDNA 2HBZB 2BM0A 4WYWA 1WUUA 2DCLA 2YWFA 3M6XA 3NS5A 3DOLB 3GMGA 4PWDB 1UEUA 4NA3A 2AGOA 4JI2J 4LF8F 4I2PB 2J7UA 2JH3A 2FHJD 2A1BA 1K0TA 1NHVA 4JI0J 1S12A 3AODA 5CA5A 2XLIA 1QLNA 1ZYQA 1X4HA 2HVIA 3W2WA 2KFNA 1KTQA 2HFVA 2NCKL 4BLGA 3QAEA 2W01A 2LDYA 1RWUA 1Q95G 2DNNA 2YPYA 3R3TA 5HANA 1N5YA 3M8PA 5AXMA 4DR1F 4EO6A 4QYZJ 1T9WA 2LCWA 3G6ES 2CQCA 3MD1A 2VH7A 4N41A 4ZMMA 1G2EA 4A8FA 3GJSB 3TANA 3PHTA 2Y8WA 2AP6A 2YNFB 3MTKA 3HI9A 2RU3A 1I5OB 1WC0A 2QV6A 4EI2A 3QJJA 2C28A 3IS9A 2O67A 1R89A 4XAKA 3DCAA 4ES3A 2DRBA 1S99A 3H25A 4NL5A 1F5BA 5HMZA 1MMDA 2RSQA 5KFVA 1GMWD 2E5LJ 1RAAB 1X4GA 2VDIA 5BR8J 1TMJA 1K8AT 1LWCB 2CZ9A 4MKVA 4NMXA 1VRQC 2H5JB 3OVBA 4PPZA 1XNQF 2OKQA 1VC5A 3ZTOA 1VFJA 3MMCB 4O3OA 3MM5A 2QT7A 4L3KA 2B8QA 1VQ7S 2FVQA 4C11A 1GXUA 2R7RA 1B7FA 2JC0A 3NAIA 4KGXB 3TP2A 1VMBA 5B0DA 1FJGF 1NSKL 2WZ1A 3UCZP 3CJ5A 4IUFA 5CYQB 2YKMA 4DN0A 1OYEA 2AKWB 4ZJLA 3UN5A 2HG4A 4P52A 3LOUA 1U24A 5G0RB 3BH6B 2EBEA 2WOMB 4ED3A 3CO9A 3KLIB 1VK3A 4CLTA 4KBIA 3DRSA 2I0XA 4RW9B 1BWVA 4X84A 2V69A 1VC0A 3ISND 3KK1A 2QO3A 3R5JB 1FKAF 2ZOGA 1QUVA 2HMIA 2H1YA 3ENQA 2JNJA 2GQ2A 2VZ9A 4E2FB 2UXBF 3HSJA 2NXUA 3BN7A 2V8HA 1F3FA 3DDKA 3PR5B 4RW8B 3SV3A 2LXUA 2X1BA 3PX6A 1G7CB 4B3MF 2H3EB 3MPUB 3I0SB 1B3TA 3M2RB 1UA0A 2V8DA 1F6TA 2B8PA 5GAHU 1VJQA 2QTWA 1N48A 4RW7B 1Q8LA 2EW9A 2IM2A 3BGUA 4J9LA 1RHUB 1OYDA 4ZPVR 4F02A 2A6OA 3T41A 1RLDA 3F56A 3MGJA 2KT3A 2HQDA 2R7WA 1RHRB 4IG0B 3IR6B 1I94F 1JLEA 1FD8A 1LW2B 3SCJE 3ILLA 3IGNA 3US5A 1KR4A 2M8HA 1NKCA 1HBUA 1WHVA 2QRRA 4YEAA 4K4YA 1YJVA 4A8YA 1Y9OA 5C42A 5HBMA 1MWZA 2V0NA 5IV4A 4LREA 4ZVPB 2PT0A 1YZ7A 2QA4G 4AQYF 4O4GB 1I6JA 4DOZA 4FDFA 2FPHX 2BJ7A 1BQNB 4DPOA 3KJFB 3FQLA 3CMQA 4FKYA 2VB6A 4OI1A 2MY8A 4OX8A 5JVGQ 2BOAA 2R2SA 3K8VA 1RT4A 3ISZA 3PW0A 2UU9J 3M2UA 4IFYB 1C4AA 6FD1A 1U8WA 2Z30B 2VBZA 4OX9F 3TA1A 1K47A 3BBFA 1J5OA 1T9YA 4GVLA 3B4DA 2PFFB 1SIWB 2CQIA 2YKPA 5D4LA 3GV5B 3AD8C 4NYZA 1UVLA 4RX6A 4LF5J 2ZBPA 3ENWA 4DV0F 2BANA 1S1UB 5L8RC 2MKCA 4DMZA 1M5KC 1U45A 2O66A 2DTJA 1NHUA 1U8SA 3DLJA 2UUCJ 2XY5A 3GP9A 3NS7B 5LMUF 1EETB 3QRPA 5LMNJ 3IR7B 3PIPQ 2LEPA 2FVRA 4X4SA 1EQ0A 4KT0C 1TP7A 4WF9Q 5HQLA 3JSMA 2NXEA 2XNRA 1WC5A 3GV8B 2YNHA 3RRGA 3EGVA 3OL8A 4ILRA 3NBPB 3OTDA 4ELVA 4RBVA 3C16A 1KFDA 1TKTB 4ICLB 3QIDA 1FVSA 2ZUGA 3DOKB 2QJ3A 3MMAB 5KFJA 2Y0SD 3OV7A 3H2UB 4Y2AA 2UUBJ 2DHAA 3CCUS 2XHWA 3M1VB 4ZCKA 3QGIA 3DI6A 4M5DB 3G8SA 3DNCA 4JUZA 4JYAF 2EVZA 4R8UA 2ZZMA 4LUBA 5L1LA 4K4WA 3MR3A 4F0KA 2KU7A 2CPHA 4FPIA 1N5TA 2YKOA 5E41A 3H98A 5CYMB 1UFWA 1DRZA 5F0WA 4HDHA 3LQVA 1HD1A 1ZA2B 4NCBA 3CCJS 1TUGB 2E7WA 2DH9A 4OHWA 5IT9U 1IJEB 4Q8FA 2ZBQA 3LP2A 2RU9A 2WONA 4G65A 2AJFE 1T05B 3DU5A 1R0CB 1S1WA 3GJTB 4UY8T 3LP0A 1FWLA 4QW9A 4ECTA 2GV1A 5IOLA 3GFZA 3UR0A 4QYRA 1SC4B 4MKAA 5D78A 3D5MA 1IM4A 2YNGB 3OR2B 3G6YA 3H4BA 1DFDA 2B4OA 3ZTSA 4YP3A 1H98A 2VG5B 1Q0NA 3DLBA 1HPZB 2PIIA 3OL6A 4DR5J 1VI7A 3SFUA 4UZBA 2Q3PA 2E7VA 2VICA 4LQ3A 2IYGA 4BS2A 2NYHA 4GRSA 3EE3A 2XZDB 3VHQA 2VJUA 4B9NA 1HWKA 2OAUA 1S6PA 2BJ1A 4DI6A 3MM8A 1QSSA 1UMJA 1DLOA 3NGUA 4R25A 3CCLS 2QYCA 3NWGA 3AB2B 5ETQA 5KFUA 3K2YA 3VAFA 1N4LA 3CSKA 2L9WA 5KT5A 4YS2A 4LIWA 3W2WB 4DSIA 1H2VZ 2C42A 2VUGA 4KH1B 4GVBA 2FHKA 3G2XA 1RISA 1N5YB 3I5CA 1NH8A 3M8PB 2LLZA 1DJ0A 3JYTA 4U8VA 4DV4J 1Y5IB 2BRLA 4ECQA 4FPRA 1RU1A 1F9EB 4K4XA 4CM2A 4OV1A 1X5PA 4Q45A 1WEXA 2DPIA 3F41A 1KEKA 4DF4A 1YDLA 3HM9A 4LFBF 4CLKA 4QWBA 4FS2A 1SC6A 3TZYA 2X1AA 3WQPA 4PCQA 3V81A 4OMFG 3IS9B 3G71S 1RWVB 2AX0A 1Q82T 1DBDA 3DRXA 2M3DA 2X3GA 4UZCA 5CD4H 1G6BA 1VDHA 2KXFA 3I82A 4I4BA 1KRPA 1PBUA 3JB9k 2X3DA 5CXTA 4PYDA 4EUVA 5KG6A 4N7TA 2MJUA 4NYOA 4WU2A 1NNDA 3CUNA 3FSYA 1QUPA 2R2TA 1REVA 4K8RA 2H51B 3MM5B 1R6YA 2KRRA 3K5OA 1TQLA 3TJ8A 4C11B 2RILA 1QAJA 4MYUA 3PM9A 1U25A 2PSZA 4BBYA 3H2LA 4CO1A 3AOBA 4DV6J 5IQQA 4TYBA 5KFXA 3O5TB 5AXLA 1YRXA 2WVDA 4FBUA 2YKMB 1NMEB 3M30B 4ZPBA 2KJVA 3THPA 1DURA 1NO8A 4PXDA 2DNGA 2GJIA 3CW2C 2MY7A 5EWFA 1ZM9A 4ECRA 3N6LA 4TY8A 2G4BA 2CUYA 3DRSB 3H5YA 1WOSA 2G1HA 3ULHA 3L7PA 3UE2A 3OTOJ 1RU2A 1J2VA 1TFWA 2R8JA 3KK1B 2HMIB 3OW2R 3KNGA 2DGOA 1U2CA 1XIQA 3RBXA 1LXJA 4DR6J 2LKZA 3CE8A 4LF7J 2Y3YA 3H40A 5KAKA 2HHTA 2QLWA 2DNZA 3MURP 3HHLA 3AD9C 1SI9A 1NK7A 8AT1B 2GAGC 3H7HB 5DGBA 2K06A 3OTEA 2NXNA 1F0XA 1KLMA 2BJ8A 3DN9A 5HROA 4QBUA 1C2PA 3KNAA 3S8SA 2FVPA 1Q79A 2HQIA 4TY9A 2ZZTA 4X64F 4Y28C 2OLWA 4C97A 1XBWA 1AROP 3RAXA 4HR2A 2XCPA 3K5MA 4YY3F 1UZDA 3OVAA 3NP5A 2ZITA 2DGWA 2W2NP 4R0EA 4LFAF 1JLEB 3LWMA 2XMMA 4GKKJ 4JI4J 2QL5B 2FVSA 5D4PA 4I2QA 1QDUB 1HBUB 4AXJA 3GCWP 5E33A 3FVYA 2B4PA 3CJTA 3ZTQA 3JSBA 4LFCJ 2HLTA 5C42B 2XYPB 5HBMB 1WC1A 5IT9Y 3TQEA 2Q1LA 1K9MT 2BKPA 4BWMA 2DGSA 4KHMA 2ZBCA 2VPXB 2IRXA 1F1BB 5JUMA 5LSOA 2UV8G 3QBCA 2AMCB 4C8LA 3PRVA 1HD0A 1U1LA 9ATCB 2FLNA 2ROGA 5J1PA 2AEJA 1TUVA 3OD2A 3TW0A 4DBQA 1RT4B 3QPIA 2DNOA 2N3LA 2CRLA 2R7UA 1X4EA 2V67A 5KT7A 2W1BA 4J7CA 2B9YA 3M05A 2HQCA 2COLA 1JLGA 1FHTA 2DD8S 3IMQJ 3OSNA 2M9KA 3T1AA 3E51A 5A8RA 4X62F 3A8IA 3OFGA 3OPKA 1LFWA 4PAAA 4YB7A 5ETSA 1AXQA 4LMZA 5B0GA 1PYOB 1J5OB 1D09B 5AE1A 2VA2A 4W90B 1WG1A 1UVMA 1VOMA 2GFFA 4ECSA 2NLWA 2OH2A 2WW4A 1ZAWA 4JV5F 4X4NA 1ITPA 3OHAA 4C0BA 3JSRA 1S9GA 1Q5VA 1QVFR 4FYWB 1F60B 4XPEA 2BANB 3V6DA 3EWGA 5C5JA 3IFEA 4A8QA 2ACMA 4ECYA 3IRWP 2DK2A 3QJLA 4LF8J 3G82A 5H9FK 2AD9A 3OL9A 2UV8A 5IC6B 5D0RA 1SL0A 1E6YB 1KWMA 3CDUA 2D9OA 4OYXA 2MQOA 4NXNJ 4NA1A 4L75A 3NWRA 3JSMB 1N32F 4FN5A 4I56A 1IKWA 3E3XA 2J6SA 1OSDA 2YNHB 4WFXA 4N56A 1WI8A 3CPWR 3Q23A 1FX4A 3C16B 2CIMA 5HI7A 2KFYA 4FF4A 2WVFA 4LRAA 4DR1J 4DV3F 3PNIA 2EFPA 3MXHP 1S4FA 2HHVA 1XMOF 4OJ3A 2HGNA 1BMQB 4NLQA 5HJXA 2AIRB 2BJEA 3DI6B 2EWHA 2B56A 4R8UB 1HHTP 1RYSA 3ZC4A 3BO4A 1S7HA 2D41A 4R5PA 4H54A 4NLWA 2GGPA 1D9AA 3IWXA 1FJCA 1RAOA 1HWUA 2CVIA 1SL2A 2VQFF 1KD1T 2RH3A 4JP8A 4QU6A 1CJVA 1RWXB 2J0WA 3TZWA 4F26A 1LNQA 3TX8A 1TMMA 3A13A 3N28A 3LP2B 4O3SA 4ZVFA 2WONB 2MYFA 4HDGA 1XNQJ 1L3UA 5DLFA 1RAEB 1S1WB 3LP0B 1R0AA 4WPAA 1OY9A 1VISA 2PEBA 1X4AA 4CWBA 4F4ZA 1S4EA 1RCOB 3TNVA 2FB0A 3T19A 2M5YA 3AA9A 1PYSB 1FJGJ 2DB1A 5KFZA 1HKAA 3G87A 3FJ2A 3LF0A 2OIHA 1I1GA 2DH7A 3R7SB 4KGMA 1Q7LB 1XTZA 2RDDA 4DQSA 2HQ3A 1YJWS 1FNXH 1WTFA 2B4UA 1RT5A 4NLOA 4F0HA 4O23A 1F2GA 3J7ZT 3GTYX 3AOCA 4EO8A 3CCTA 5J1EA 2DNRA 5T14A 2XSJA 3CDAA 1S6PB 3MM8B 1DLOB 4DUTA 3NS6A 1KS2A 5C7PA 4H4KA 1R0BG 2Z58B 5DO2A 4WYLA 2DNMA 2C2RA 5K9FA 4DQPA 2UXBJ 4OX6A 2DNPA 2ZC3A 2FD2A 2KM8C 4DQIA 3BYPA 4GVBB 2VL1A 1VQ5S 1RTHA 1FXLA 1IWGA 4B3MJ 2GHWA 3HX9A 1Q81T 2CJYB 3C3LA 1GXTA 2F9DA 3GIJA 3MM7A 1HW8A 2MZSA 4FP9A 4PXEA 5ETLA 2J7KA 3SXLA 5E0OA 1YZ6A 3V81B 1CQNA 1IVZA 4QU7A 4EBDA 2ALZA 1LWEA 2CPYA 4YQWA 2EXUA 4W4MA 2K7JA 2KZMA 3M8WA 2R7TA 1YVFA 3M6VA 2XO6A 4JI5F 2ZVIA 3VTIA 2EBGA 1CG2A 4ECVA 3BQ2A 4I0WA 2HWTA 3HZGA 1JXEA 4B9SA 2B43A 1TUWA 2V8GA 2OSRA 1XR5A 3IM9A 1IBCB 1REVB 4Q7AA 2OD4A 4NLXA 3MWBA 2D3OR 3ILOA 4AQYJ 2RQ4A 3W2VA 2CPFA 2O5DA 2NUHA 1DZ5A 2D74B 3POTA 2K8GA 3VAMA 2PDAA 3D6FB 3ENAA 2H4YB 3GIKA 5ETKA 4I69A 3B4MA 3TZZA 2HAIA 4NASA 1PBAA 1U7LA 3QRQA 3GILA 4LRDA 1VLYA 3L7OA 2YQ3A 3KG1A 2CQDA 4OX7A 4TY8B 4A8OA 5BYRA 4UUXA 3OFHA 3KYLA 4OX9J 4WTYA 2JLGA 4LJMA 2Q66A 4KPCA 2FJEB 5J2QA 3CCZA 3BR8A 4LF2A 4F4KA 2ASLA 2VHGA 1FE0A 1FT8A 1DQ9A 2BQRA 4H4KC 1RKIA 2QE5A 1HMVA 2DHXA 4DV0J 2AV5A 4KRWA 3T9NA 3HHLB 4DPUA 3S1TA 2YWEA 1RCXB 1RXOB 1RHMB 3KOAA 2YBVA 4TLRA 2VOOA 4N47A 4IH5A 1NUEA 1KLMB 2WK4A 5HROB 2X51A 3EYZA 2CQGA 4WFYA 2NSCA 3UD3P 1KNZA 3BN4A 1AUDA 2DT9A 2IDEA 3M32A 3GR1A 2DGVA 3UO0A 3R2CJ 4LBPA 2A6MA 4USHA 1JJ2R 1NDLA 3HSZA 2DGTA 4RWXA 3X3UA 1VHIA 5C24A 3IBWA 2H54B 3DLEA 1LQ9A 2JLFA 2FZKB 2GVDA 1UKUA 2ASJA 4I2QB 3N6MA 3NGKA 2JEGA 3BF4A 3PACA 1RAJA 2WBRA 1AUSL 5DGAA 1SC1B 4KO0A 2C3MA 2EG2A 3HVAA 1T9UA 1CVJA 4CLZA 2DNHA 5E3QA 1RWWB 4JYAJ 3CJ4A 3ZFVA 1U02A 3HK2A 4KJIA 3CO0P 1IQZA 3CDEA 1SPBP 4CIOA 1H73A 3ETOA 4P74A 1HWJA 1BUXA 2GZOA 4N77A 1VHFA 4M63A 3BR9A 4B9UA 2QG9B 1JQGA 1UW4A 1VQ4S 4NI2A 1FNMA 1Q16B 1WHYA 3OXFA 2EKYA 1HL6A 3T5LA 1NSPA 1FEEA 3U1LA 5CCMA 5IWAF 3SSQA 1H2UX 3A12A 3HFVA 2M52A 1BXNA 2LA4A 4EEYA 2AGQA 1JLGB 3HVRA 1M5PC 1QTMA 4JOUA 5A8RB 3W65A 1VJWA 2J76E 3KG4A 3TZXA 2VFVA 3KFWX 3W5XA 3PDNA 2CA9A 4Z7CA 3MM6A 1UJ5A 1R43A 3ONQA 4F3OA 5D4OA 2RIJA 1HFEL 2XLJA 4J9RA 3EXYA 2FZGB 3QT6A 3ZNUA 2Q6CA 1S9GB 2VBWA 2HPUA 1FDDA 3W63A 3V6DB 1ICEB 5KFQA 3CJRA 4LF1A 5B09A 3IG1A 4O0IA 2Y8YA 2BE2A 3DXSX 1IR2A 4NLDA 2DEIA 3VWSA 1X0FA 1FXRA 1SQGA 3DLHA 3G82B 3GCXP 4KKOA 2JX2A 3VF0B 2HSEB 3KUEA 2WSCC 2ACYA 1R8HA 4PUOA 5KFSA 1LFPA 1H6KX 1RK8A 3KK2A 2RHQB 4O44A 2QGFB 4RJVA 3DHXA 1C0TA 2KM8B 3KUHA 3Q0AA 1TL4A 2KVQE 2E1CA 3U02A 2JEIA 1IKWB 1K1QA 2HIYA 2ZWOA 3DDNA 2LU2A 1W7WA 3TAPA 5J2PA 5GADU 4I6YA 2APOA 3EZUA 5L39A 2ZH1A 3ZO7A 2BKNA 4QIEA 4RUBA 4W92B 1N5SA 3KDNA 2FIUA 2WVBA 4IRCA 2QSFA 2BR0A 1GNKA 2MTLA 3A8EA 4NA2A 2QL9B 3ZZUA 2EEYA 3K59A 2OMLA 4C7QA 2CJQA 4OI3A 2YVSA 2QEXS 4B3SJ 4R5PB 4IOCQ 1MG7A 2GGPB 4JV0A 1V3ZA 2YTCA 1EARA 2IMOA 4ECZA 1WI6A 1CJVB 4WU3A 2P8IA 4DSKA 1RTZA 3KLEB 1NK6A 1HI8A 3UQSA 1RI7A 2IIHA 4OL8A 3I55S 2K7KA 4DZ6A 4ZCMA 4ATNA 4ECWA 4ES1A 2UUTA 2VFTA 3EPIA 3AFGA 3B54A 1RAIB 1ZAXA 1SJFA 3LA0A 4OIXA 5ETNA 4LBHA 1KHVA 3VAKA 4MK8A 3R7NB 5ITHA 3AT1B 4WIQA 4LF6F 3BSOA 4Y6IA 1WG4A 4DFJA 2FC9A 2P9EA 4ZLJA 4AL7A 4KIAA 2DISA 3RB6A 1WNEA 2G2YA 2VQEF 1YRUA 2BEFA 1RT5B 3UN3A 3TX0A 3T5JA 5EWGA 1S0OA 5DDRC 5BYSA 3DRPA 1IQTA 3T9ZA 1RSCA 1YRTA 4UQGA 3N0VA 1Y5LB 4B3OA 2JFDA 5J1EB 2HHHF 2XSJB 1ZZNA 4YR2A 2YY3A 2ZBIA 4X4QA 5F8MA 2EFQA 1IR0A 4USKA 4ANDA 2Z2MA 3B6BA 1R8BA 5IC4B 1S1VA 2HBQB 1SJQA 2XWYA 4PXCA 1NJIT 1YX2A 3LWLA 3ETMA 5DRKA 1VC6A 2WB4A 1G3OA 4J9OA 3EJMA 2MKSA 3X1LB 3BDPA 1RTHB 2IC3A 3PJWA 3UD5A 5GAGU 1UCNA 2ZH5A 3IWNC 2KO1A 1VQSA 3ADAC 2D3O1 1OPZA 4ERDA 2J0XA 1HQUA 4DEZA 2BJ9A 2HURA 3MM7B 5DZ7A 2QSWA 1MSWD 4DL3A 2N4DA 4X64J 2WB1D 3C66A 4BC7A 3KLFA 1HW9A 1LWEB 2ILZA 3FCHA 1RTDA 4YY3J 1N0UA 2BRKA 4MK9A 4HVZA 3TO8A 1U4BA 2PFDA 4LFAJ 2XS5A 2MQQA 2CQHA 1XJWB 4ZVTB 1WG5A 5K8PA 2AW0A 4MIAA 1V5IB 2RDJA 3DLKA 3CT9A 5C2GA 4L73A 4CZCA 2XMAA 2DNLA 3ZZ0A 2DNYA 3MEEA 2L08A 3W2VB 2MZQA 1CS4A 5H9FJ 4F2SA 2CWXA 4KYZA 4OYPA 5FDLA 3POTB 3AAWB 3GQCA 2BMBA 3CC7S 2GQQA 3GG1A 3M4XA 5D4NA 1RT7A 4I6AA 5E3RA 5F3ZA 1MLAA 2W25A 5L1KA 1J5EF 2OPRA 5IT4A 4ID8A 3M8QA 1JB0C 2AEFA 3AA8A 2DR8A 3EZ5A 1Y10A 4E0DA 2L48A 4XK8C 1WDTA 4FNIA 2J6UA 1AA1B 3RRKA 2I6WA 3IBFB 2MXYA 4X62J 2ZEJA 3QIPA 3N79A 3C14A 3C19A 5I4MA 5J2QB 2Y1RI 3FDSA 1WF2A 5AJ3J 5KFNA 3CD7A 3CMES 4JV5J 1QM9A 3Q8RB 1SV5A 2CPEA 3HKZD 4ZP6A 1ROFA 1HMVB 3BYRA 2MZ1A 3L3CA 3R97A 2POKA 5EGYA 4OJHA 4F2RA 1TTHB 2IJFA 3HJFA 2G2ZA 3NNHA 3MAQA 1NBEB 3CD6S 2CJXB 2RQMA 1V3RA 2PEHA 4DSJA 4IR1A 2ZJRQ 4Y2IA 3BM7A 4G3IA 2RQCA 3M32B 1FD2A 4EMDA 2YH1A 1HBOA 3PW5A 4CDIA 2FJWA 1JKHA 4W98A 4LSNA 1N32J 1LK5A 3A3NB 3C6UA 2OSQA 2OPPA 4K2XA 3HT0A 5C24B 2C2EA 1FKPA 3DLEB 2QZ8A 2HRTA 1CJUA 1J27A 2GVDB 2GMJA 4GO7X 2J9EA 1NM2A 4G6VB 2YX7A 4USWA 4DV3J 3W62A 1URNA 3N5BA 2DEJA 3QGHA 2HK2A 2ZE2A 1XMOJ 4KO0B 1S7IA 1H38A 3T1HF 4ED1A 2GCFA 2RS8A 1SCJB 2U2FA 4HLBA 1XK8A 2GIQA 2RAQA 1B0VA 1RHJB 3BDEA 4LVNP 2AJ1A 1FEHA 4CT8A 3P8BB 4NZ0A 2JDJA 1XMBA 3NY0A 5HN0A 2CNNB 2VPYB 2NYIA 2VQFJ 1KQFB 1I3OB 1SBRA 2XEXA 1V5VA 4CLYA 3V6HA 4NI2B 2AU0A 2H5IB 1VK8A 2E9RX 4NLPA 3TYTA 4RNMA 2E5IA 5CD4A 2UUAJ 3I9V9 2NZ4A 3MOJB 4CNZA 2GC8A 4Q2LA 4LSZB 5DJBA 4HHJA 2XULA 4HYKA 4CO2A 3KDOA 4Q2MA 2KG0A 1UVJA 1KP6A 4YB5A 4V19J 1N6QA 4Y00A 1UVNA 3D3CJ 1Q5YA 3MM6B 4J90A 2W7AA 4TNOA 1N33F 4RW9A 1T11A 4NXMF 2BX6A 2ZJPQ 3MMJA 3LP1A 5M2UA 1NDCA 1S49A 1W26A 3IG1B 2BE2B 1B64A 4MYTA 4RZRA 3PW7A 2NPIA 4PEOA 4KKOB 2BJDA 3GFHA 1GQEA 5KFDA 2ZBRA 4OQJA 2F63A 3LUYA 1CC8A 2AZ3A 2VPZB 4PUOB 1DY3A 3KK2B 4O44B 2KHCA 1RP5A 1C0TB 4MJKA 2QFIA 1TL3A 3BPDA 1U1QA 3R5BA 4XDCA 3D68A 1XMQF 5J2PB 3DM2A 4NYPA 2CQ2A 2R2UA 3LAMA 5CZXA 3MHYA 1H2TZ 3HD2A 3SDEA 2V2KA 4OYZA 2F4FA 1WEYA 3TRGA 2C22A 1U26A 4RL1A 2HKEA 2QA1A 3DXBA 3SZ2A 3L4BC 3RBZA 3HLUA 2HAFA 4Q5VA 1X7VA 4DPTA 1N8RT 3V6KA 4PQAA 2VBXA 2J8AA 3DC2A 1H3DA 2B5JA 2BJ3A 3PKYA 3DRYA 1ACMB 3HPOA 4NEYA 5KOXA 5CABA 4CLWA 2CZVC 3P49B 1UL3A 4JI5J 3PW4A 3TARA 5KT6A 2CG8A 3N9UC 2YQ0A 2HNDA 1C1CA 2MSSA 4DU7A 3KLGA 3JQMA 5D6GA 3D66A 3BSCA 2RHSB 3CJ8A 5DDOC 4P2XA 5KFRA 1GFWB 5C25A 1FVQA 1DTQA 4NLSA 2KDOA 2RF2A 2LQ8A 1Q78A 1S5ZA 2EFVA 4C4WA 4CLFA 3BS9A 4ZLPA 4GMKA 2QMUB 2N4CA 2KT5A 3V4MA 3SCLE 2IVYA 3QFWA 4JI6F 4G1PA 3A3OB 1SKSA 5LJ5Y 5J2MA 1NCLA 4N8NA 3PR4A 2ATLA 5T7LA 1YKWA 1Y4ZB 5A6WA 3IR5B 3HF5A 3DRPB 4NLYA 3BZQA 1T3OA 1Y11A 2GVZA 4QIFA 2I9SA 2G0CA 5L9NA 4B3OB 4N5SA 2IAJB 1WORA 2FHMA 2ZOMA 2RB7A 2KRBA 1CC7A 4ZPCA 1MMLA 4CO5A 4ZVGA 2ZHAA 1S1VB 5A8KA 2WRMA 3CCQS 2D69A 2CJKA 4IOBA 3MPVA 1JLFB 1VQKS 2MPUA 1UP1A 1SH3A 1WC6A 4OJGA 3T5HA 5ETPA 2HBYB 3RB0A 3D28A 2IA0A 4CO4A 2Z57B 4GC7A 2CG4A 3PJ9A 2CQ0A 2IC3B 5IS2A 4WXWA 3ELHA 1T94A 1U49A 1X9SA 2BDPA 2FQQB 5F8GA 4Z2XA 1HQUB 1RACB 2CXEA 4K4UA 1IJFB 3UDLA 3GONA 2V94A 1ZTTA 3RRHA 1SKUB 1MW7A 3AXKA 1NB2A 3SIPB 2AJ4A 3KLFB 1RTDB 4KAIA 4WK3A 1REGX 3NLCA 3D1QA 3PHEA 3O6QA 4C8NA 3VZHA 1TL7A 2PC6A 1IKVA 1D9FA 2KL8A 5FLXU 5H9EJ 3I96A 1VRTA 1U1MA 4DUYF 1A9NB 2JRSA 1PIEA 3PKMA 2JC1A 1UETA 1VBXA 1IBLF 4DDFA 2EFOA 5EX3A 4NRUA 3DLKB 2VOPA 5CHCB 1HYSA 2XQCA 2O01C 3GLJA 4M5GA 3Q86A 3MEEB 3KTQA 4BDPA 1CS4B 2VG7A 4DCJB 5FDLB 1VQOS 5D3GA 5B0EA 1GTHA 4YR3A 3W60A 4ANEA 4URQU 1ZBTA 1RBOB 3IXQA 4WTOB 1RT7B 1IXKA 2EKNA 5DQIA 2OPRB 5A76A 3K8WA 5IWAJ 3M8QB 3B78A 3IM8A 1SB6A 4O3RA 2FJDB 3MMBA 3DOMA 2XMJA 3QIPB 4C6AA 1EJ7L 6AT1B 4ED6A 2ZD1B 3C14B 2IVFB 1VBKA 3VALA 2KT2A 3GYNA 1RT1A 4QZVB 2XI3A 4CTAA 5GAEI 4TN2A 2YKNA 1SV5B 2NPFA 3RR7A 2JJ4D 3TUZC 4A47A 2DY9A 2PA8D 4TQRA 2V2VA 3CJ3A 3QLHA 2N82B 3A1YG 2QLFB 2QN6B 4C0HA 4Q8EA 5K20B 2HVHA 4DL6A 4OYMA 2MJNA 4ED4A 1JXLA 1ZH5A 3U7JA 1H7XA 1Z1ZA 2E66A 4U96A 4BCAA 4Z37A 5IFMA 2EPIA 2EI5A 1HBOB 4IH6A 4NZ6A 2GAHC 1JKHB 2AGPA 4F67A 4LSNB 1NKEA 3EVWA 2R7XA 3C6UB 2OPPB 4M5NA 4DFPA 1RQ0A 2XM3A 4UW2A 1CPZA 1PJ6A 1T3NA 2HWIA 1FKPB 2W2PP 3SCKE 5BJRA 4EFAC 4OHZA 1CJUB 5K5MA 3MPWA 3F73A 2MKHA 1TV6A 4USIA 2V8PA 1SIZA 4AXIA 3SSSA 1YSJA 2ZE2B 4EZ9A 1N88A 4I64A 1TL5A 2DIUA 3R7BB 2HHSA 3MOZA 2E1AA 2VJVA 2E5LF 3OL7A 4CI0B 4C8YA 1CULB 2CJBA 3FGVA 4E98A 4IG3A 3JS9A 5JXSA 2VFUA 3CCSS 2MLXA 1XNRF 4I7FA 2CPXA 2F4VF 1GAOA 2VKRA 5KFIA 3OLBA 5G4DA 2P6SA 3GWCA 2Z8QA 4CLSA 3MDFA 2RE1A 5KFPA 3M30A 4J37A 1TAUA 3KJNB 2RRBA 5CYJA 1KDNA 3D7SB 2ZFHA 4LF6J 3HMJG 1EZZB 3D9BA 3HP6A 1N6QB 5HSPA 4EBEA 1P1TA 1UW9A 2OUGA 2JEJA 1CLFA 1S79A 1D1UA 3TVYA 2MQMA 2KXNB 1GEHA 3SCIE 1O0PA 2VQEJ 2IYIA 2QLXA 1PC4A 3TAMA 4ZLNA 4DL4A 2RRAA 3LP1B 2QFJA 1W2IA 2IBOA 1U6FA 3CXCR 5KT2A 3PX4A 2O3DA 4MMOA 4F4XA 4MFBA 3DGPA 2HHHJ 3QWUA 3K57A 3VVUA 3BGLA 3M9OB 2MMYA 1BWEA 1OSCA 5K8OA 3RGIA 3OFFA 1LXNA 1HBNA 4MT1A 4KFBA 1Y7PA 3BQ0A 2CQ3A 1TL3B 4DS5A 3F0NA 2L9DA 1FX2A 2WHOA 3MR5A 3VAIA 1JK9B 4NCGA 2J7WA 3DM2B 3OXGA 2K3IA 3NGTA 2BE7D 3P5BP 2ZH9A 2AYBA 5KFLA 3SDEB 1MWQA 4UOGA 5AE2A 4X4VA 5DG8A 1U6ZA 3LALA 3HZEA 3FQKA 3MEKA 3NCRA 1Y3JA 2DVIA 1VQPS 4LRBA 5A0YA 3VGSA 4QPXA 4OI2A 1U1NA 2NS1B 4AYBD 1HARA 1LW0A 2B5JB 1N56A 3H4DA 4EYHB 2OD6A 1FK9A 1T8EA 4KR0B 2HNDB 1C1CB 1VQ8S 3DHWC 4P10A 2DHSA 4BC9A 3KLGB 1NRKA 4M5HA 4YDDB 2FJBB 3ZZTA 3AHPA 6FDRA 5DG9A 2FTRA 1IKXA 1NEEA 1OPIA 3BBCA 1X4CA 5C25B 1DTQB 1T9XA 2RF2B 2VF3A 1RB0A 2XZTB 2OELA 2XHCA 4URGA 4F4AA 3C2PA 3DYAA 1X5SA 4NE9C 1GTEA 3I5AA 2VV5A 3UDVA 4UTGA 5B08A 1QSYA 3VAGA 3J81Y 1H72C 1HQ2A 5KFHA 4K5RA 2D3UA 2R42A 2VODA 4PYAA 1FESA 3AOAA 1UWBA 1S6QA 4QJVA 3OTCA 4M5MA 2UP1A 5J2MB 2W2MP 1C1BA 1IWAA 1J5EJ 5T7LB 4CRJA 4ZN3A 3RAQA 1Q7YT 3CJQA 3KHLA 3I32A 1SKWA 2PGCA 5K8NA 2MZRA 2GVZB 2DCUB 4URSA 4IOAQ 2E5JA 3MM9A 5F8IA 2DYAA 3IWLA 5ETVA 1HNIA 4CYUA 2KHDA 1TVRA 4Y34A 1NKBA 2Q43A 1UPMB 2RRNA 4OFZA 2AQ4A 5A8KB 1LK7A 3R5DA 1MROA 2HQFA 2GW8A 4TU7A 2HS4A 3MCOA 2G2OA 1T95A 3CJ0A 1E6YA 4UOHA 4X4RA 3UFCX 5AT1B 4OZJA 5HQMA 2RJZA 1Q8KA 3PW2A 1K73T 3D1HA 5GAHI 2HLUA 3VGTA 3HT3A 4CLLA 1N36J 1FA0A 4ZIVA 1NHKL 2DJWA 4A8XA 3ICLA 2R7OA 2ROEA 4B9TA 2LQJA 4DPXA 2QIFA 5F8JA 2XMVA 1KN6A 5DZ6A 3FCWA 4F04B 1S77D 1V3SA 1JXVA 1OIAA 1TL7B 2J9DA 1IKVB 2X7IA 4ZPAA 2DXFA 4IQXA 4DF8A 2BBEA 2RMLA 2FHJA 1VRTB 1SUQA 3C8YA 3D2WA 2HIQA 2JVOA 4IRKA 2R9LA 4QIWD 3CULA 1A6LA 1OY6A 5KG4A 4QPTA 3T1HJ 5M2RA 1VQLS 2MHNA 1B70B 4X4TA 3DFEA 1HYSB 3GIMA 2DO0A 1PC5A 2W9AA 2VG7B 4IYQA 5D3GB 2PD1A 4DV2J 4LF9F 2BE9B 2PMWA 4K50A 4YHHF 1SQEA 1HIYA 2ZUAA 4DZDA 1JJ4A 1EX8A 2E5HA 4OYWA 4C3LA 2NXJA 1UJ4A 3OFEA 3IC1A 3Q8YA 4MTPA 3W9HA 2AEMA 5ETOA 2MQ8A 2L3MA 2XWXA 2DITA 4M5KA 1WDDA 2GNKA 3MMBB 2HS3A 3DOMB 4J9MA 3FRYA 1GMWA 4C48A 7FD1A 2QX0A 1RT2A 2RT3A 3R9LA 5KG2A 1QAIA 4PABA 2HEKA 2LFVA 1RT1B 4U8YA 1N33J 4CTAB 3UNYA 2YKNB 1RADB 2HHPA 4PKDB 4X66F 1X5TA 3MPDA 5F8HA 1PJ7A 3GSIA 4NXMJ 3WIVA 1MN9A 2FY1A 3QLHB 1NPKA 3H90A 3UCUP 1Q4RA 4ALZA 1XERA 4I67A 5JJBA 1MU2A 1FJEB 5ADZA 3M6WA 1F2HA 2AF6A 3QGPA 1XEZA 5KOWA 2AX1A 5EUHA 3UWTA 3KLHA 2OFGX 1NPPA 4PXBA 1AW0A 7AT1B 5K14A 4KV8A 4DL2A 1YK9A 2HNYA 1X4DA 3I0RA 4DR4J 3UNGC 4AD6A 2HGMA 2QMXA 1XMQJ 2BABA 4IO1A 3QO9A 4KPYA 1W2BR 1LWFA 3HHNB 4PG6A 1B0PA 1B0TA 5KFAA 1TV6B 4ZVQB 2DBBA 5GMKa 1Y00A 3THVA 1LKZA 3TEGA 2WBMA 5U47A 4HL9A 3GG0A 1S6UA 1FTCA 1D8ZA 2NZCA 2D9PA 2W8KA 2PMHA 5HP1A 1E6VB 2ZH4A 1AFIA 3M6UA 4X4UA 4IG3B 4B17A 1TL1A 3MEDB 2UVUA 3FRZA 2DH8A 1D8YA 1YITS 4I7FB 5EN1A 5HMYA 4ZK7M 3RG6A 2LEBA 5F0UA 5FIIA 4L76A 3VGVA 2DRDA 1FJ7A 1DQAA 2VFRA 4AL5A 3CCRS 1U09A 2ZJQQ 2LECA 3E8OA 1S1XA 1PILA 2B0GA 2XS2A 1PAUB 5T41A 4ZN1A 3JQKA 1VGYA 2J9CA 4JI8F 3FBCA 4JI6J 4K59A 1RUSA 4FZVA 2YWHA 1B99A 3GYGA 3V5RA 4CT9A 1F9FA 3K17A 5KG3A 3OSPA 3TAMB 1RT6A 1UA1A 2SXLA 4RNNA 1R3NA 4I1TA 4FXVA 3D6HB 1UVIA 4MFBB 1KQKA 4F4WA 3DGPB 3CMAS 3G8QA 4ZPDA 5I3UA 4J9QA 5GAEU 4C8KA 2WVEA 1H7WA 1FRIA 1RABB 1HBNB 5HQ8A 4KFBB 3MI7X 3CWJA 2ZH8A 5B0AA 5L9XA 2LXIA 2KKHA 2VFSA 5HK4A 4MH8A 4WWSA 2W2OP 3A8KA 4ZA1A 4DSLA 4NCGB 3RTVA 5LSRA 3H20A 2OO4A 4OYAA 4PWUA 2EFNA 1BGXT 1XC9A 1F5AA 3BSAA 4FXDA 3HD1A 4F8RA 1KVKA 2KYZA 2F8EX 4MIWA 4IKAA 4ZLLA 2RKIA 3A3PB 2AJQA 1PAEX 2N7CA 3M7VA 1GX5A 3ITHA 2BXJA 2I8EA 2V5HG 2MHEA 2GJ2A 5A0YB 3R27A 1FRHA 4CLUA 3PIOQ 1NJXA 2I2YA 3RUBL 4YN3B 3IGVA 4F50A 2QLBB 1UFLA 3KKFA 2AYGA 5HLFA 2XMTA 4F4YA 1O51A 4GC6A 1LW0B 4P73A 4GKKF 1OJ4A 2OFHX 3VCDA 1S9FA 4Q43A 1FK9B 1M1GA 3T6JA 2AHOB 2MLZA 2PI5A 3IA0A 3TEHB 3LPYA 3MAAA 2W2QP 3QMQA 3FBEA 2XI2A 3RU0A 5D0EA 2OJ3A 4DUYJ 3CCWA 1T7PA 4FBTA 1IKXB 5THWA 1D3WA 3BGRA 1IBLJ 1PG5B 5DQGA 3N4WA 5F8NA 2Y9HA 4UT4A 3HO1A 3MR2A 3BJYA 2EC2A 3DDIA 4RBTA 4TU9A 1JJCB 3DYAB 2H9ZA 2CNOB 3HVWA 2KZZA 1VR6A 2P5VA 4NPOA 3AQPA 2OP5A 3AY0A 2F65A 5KG5A 4K4TA 3MTJA 4HHHA 4GKJF 1UWBB 2VG6A 3NGSA 3NL0A 1S6QB 3NKYA 5E7OB 4DFMA 4UUWA 3FZ2A 1C1BB 4RW4A 3H5UA 2YWGA 4YB6A 4KSEB 4EWTA 3PYFA 1DHMA 3MM9B 2G0IA 5DS7A 1HNIB 4FYYB 1U1PA 4CYUB 4Q0BA 1OY8A 1TVRB 3B82A 1RDRA 2DIVA 2P9CA 4O0NA 1NK5A 2K3KA 1RAHB 3Q89A 1CQMA 2M88A 1NDPA 2N3OA 1S0NA 4ZOSA 4EBCA 1MROB 3HHLC 2LEAA 4USUA 1T9VA
chains in the Genus database with same CATH topology
4FVCA 3H98A 5CYMB 5C24B 2C2EA 1FKPA 1UFWA 3DLEB 1DRZA 4FVMA 5F0WA 2QZ8A 4HDHA 4LVOP 4PG8A 1Y0HA 3LQVA 3MUVP 1HD1A 4PRFA 3PEJA 4NCBA 3CCJS 2UXDF 2GMJA 2E7WA 2DH9A 4OHWA 4GO7X 2J9EA 4KC5A 4G6VB 1IJEB 2YX7A 2KG1A 5HL7Q 3VAHA 4Q8FA 1M1KT 4FF2A 4WZMA 3PX0A 4G1QA 3LP2A 5LXYA 1JLQA 1FO1A 1URNA 3K5NA 2VC1A 3P6YC 2DHGA 2RU9A 2WONA 1HNVA 2AJFE 1T05B 3N5BA 4QIGA 3DU5A 3QGHA 4NXNF 1VIXA 3V6JA 2ZE2A 1XN9A 1S1WA 4KO0B 3J7YU 4UY8T 3LP0A 4QW9A 4ECTA 3P96A 1H38A 2O1PA 3T1HF 2GV1A 4ED1A 2GCFA 2RS8A 3GFZA 4JI2F 3UR0A 4XIUA 4QYRA 2BQUA 2U2FA 4HLBA 1XK8A 2P6TA 4K4VA 4ZPWR 5IM0A 4RNHA 2GIQA 4MKAA 5D78A 3MFHA 1B0VA 2W9CA 3D5MA 3I5BA 1IM4A 2IFXA 2GMHA 4LVNP 2YNGB 3BDEA 2AJ1A 3OR2B 1FEHA 4L72B 4CT8A 3G6YA 2EK6A 4NRTA 1DAXA 2JDJA 4NZ0A 1XMBA 4JI0F 3E2EA 2B4VA 3H4BA 5HN0A 1DFDA 2B4OA 3N6NA 1VQNS 3RW6A 1YQHA 1H98A 4YP3A 4ZS6A 2VPYB 2VG5B 2NYIA 3DLBA 1RT3A 3ZZPA 2MQLA 1KQFB 4QWDA 4QQBA 1TAQA 3HKWA 2ZH2A 1BQXA 3C6TA 1S76D 1HPZB 2B9XA 1SBRA 2PIIA 3VQSA 2XEXA 3OL6A 3V6HA 2NREA 3EXCX 2AU0A 1VI7A 3SFUA 2JFKA 4WKRA 1YJTA 5EDWA 2W7PA 1VK8A 1SUQB 2Q3PA 1WEZA 4LQ3A 2E9RX 1ZM2A 4NLPA 3TYTA 2B3TB 4RNMA 2E5IA 2IYGA 4BS2A 3I9V9 3NAHA 2DPJA 1NAQA 5DETA 2OPQB 3MPYA 2NZ4A 1N5QA 3MOJB 4CNZA 2GC8A 2RQKA 3GSDA 5A6PA 4B9NA 1HWKA 4Q2LA 2OAUA 3R5AA 5DJBA 1KFSA 5E2QA 3THTA 1S6PA 2IRUA 5SZTA 3S01A 4HHJA 2XULA 3CCVS 4RUCA 3OTBA 4HYKA 3SSRA 4O3NA 2FGOA 2G9OA 3MM8A 4CO2A 3KLEA 2ZHOA 2BA9A 1QSSA 1UMJA 2DR5A 4NOHA 4Q2MA 2KG0A 3PRBA 1UVJA 1YIJS 1JJHA 3CJ2A 1RJJA 1DLOA 4DN9A 3DRRB 4YB5A 3CCLS 4R25A 2QYCA 3NWGA 4V19J 3AB2B 1N6QA 3KMQA 5KFUA 4P6QA 4Y00A 3G6XA 1UVNA 3K2YA 3VAFA 4ELUA 1N4LA 3TVZA 3CSKA 4PPDA 2YKAA 2L9WA 3MM6B 2W9BA 5KT5A 2XC9A 4LIWA 3W2WB 2W7AA 7FDRA 4DSIA 4TNOA 1N33F 1ZZFA 3L95X 1H2VZ 4WIIA 1E6VA 4RBUA 3OQ2A 1L3UA 2WSEC 4R0JA 2V8VA 2C42A 2X1FA 4RW9A 2VUGA 2MDAA 3GB0A 4NXMF 2RD5C 1GX6A 2ZJPQ 4A8KA 3I9ZA 2N7YA 2FJAB 3MMJA 2FHKA 3LP1A 5M2UA 3QAUA 1NH7A 1S49A 1S6OA 5BR8F 1RISA 4EYIB 1N5YB 3IG1B 3I5CA 1NH8A 4H4OA 3M8PB 3K7RA 2LLZA 5B0CA 3MECA 2BE2B 1DJ0A 1B64A 1PSDA 4DJBA 3MEDA 1M90T 2RVJA 1NB7A 2R7QA 4MYTA 3JYTA 4NX9A 4RZRA 3KJVA 3PW7A 3RW7A 2NPIA 2HHQA 1Y5IB 4KKOB 2BJDA 2Q79A 2BRLA 3GFHA 4ECQA 4FPRA 2DO4A 1GQEA 5KFDA 2L41A 3PZPA 4K4XA 2E1MC 4OQJA 2G1DA 4OV1A 1X5PA 1RT2B 1WEXA 2E29A 3LUYA 3F41A 1KEKA 4Q45A 2MKJA 2DPIA 1JNZB 1CC8A 2VPZB 2GQCA 4NWBA 3HM9A 4DF4A 1FDAA 3HVTA 4PUOB 4OZNA 4LFBF 5AXKA 4QWBA 1L3VA 1S0VA 4O3PA 4PQUA 4FS2A 1SC6A 2M0GB 2PN6A 3KK2B 4O44B 4PCQA 2KHCA 2X1AA 1RP5A 3V81A 1NK9A 3RB3A 1C0TB 1KVIA 2LQ5A 2E44A 4MJKA 4OMFG 1U1OA 3IS9B 3LGNA 3G71S 2IJNA 1TL3A 4ED0A 1U1QA 3R5BA 2EK1A 2AX0A 4XDCA 1KLNA 4Y3CA 2DGUA 3H5SA 1Q82T 1HBMA 1DBDA 3DRXA 4RWWA 1ZOTA 1P27B 1HR0F 1R0AB 2ADBA 2M3DA 2X3GA 4OLPA 5CD4H 1G6BA 1XMQF 1RTIA 2KXFA 5J2PB 3DM2A 3I82A 4I4BA 1KRPA 4NYPA 2UVVA 2CQ2A 2R2UA 3JB9k 2DR7A 5CH7B 1HNZF 5I3PA 2HYIB 3G9CA 5CXTA 2XLKA 3LAMA 5CZXA 3MHYA 4EUVA 3VZIA 1H2TZ 3P5TL 5KG6A 3SDEA 4F3QA 5KFGA 2V2KA 5I42B 4ZCLA 4CH1A 2XGPA 1QAXA 2MJUA 2ZHBA 4NYOA 1MU2B 3SI8A 4EZ6A 1WEYA 3Q2SC 4QR0A 3TRGA 4WU2A 1NNDA 5GVQA 1BLUA 1U26A 2C22A 3CUNA 1X4BA 2QA1A 3FSYA 1QUPA 3DXBA 5E3CA 2R2TA 3SZ2A 3FEZA 1REVA 3MM5B 4M94A 1R6YA 2KRRA 2KVIA 3K5OA 3HLUA 1TQLA 3I87A 2F8HA 5EX0A 4Q5VA 1X7VA 4C11B 2VASA 1ZM3A 2RILA 4F25A 4YB1P 2ZKTA 1QAJA 1N8RT 4MYUA 3V4IB 3PM9A 1L3TA 4NZ7A 3KLHB 3JTPA 1S1TA 1U25A 3D0IE 3V6KA 3DLGB 4PQAA 2PSZA 2D7SA 2GA7A 4BBYA 3OBIA 5KFCA 3OUYA 2VBXA 1WHWA 2J8AA 3H2LA 3DC2A 1H3DA 1SH0A 4CO1A 5IQQA 4TYBA 2B5JA 2FVCA 2CKWA 4OJ1A 1EP4A 5K14B 4I68A 5KFXA 3O5TB 3UI3A 5AXLA 3PFOA 4KV8B 1U48A 1YRXA 4FBUA 2HNYB 5J2NA 2G13A 2YKMB 3H8YA 4BWJA 3PKYA 3DRYA 3I0RB 2LVWA 4RW6B 3M2VB 3HPOA 1U2FA 4DS4A 2J6TA 3M30B 3CTRA 4ZPBA 2KJVA 4FS1A 1QJHA 2ZNYA 5KOXA 4K4SA 3THPA 1IBMF 1DURA 2R8HA 3QO9B 1NO8A 2K1RB 4PXDA 1FERA 2CZVC 1UL3A 3P49B 3PW4A 2JEFA 3TARA 5KT6A 3N9UC 1LWFB 2HNDA 2DNGA 1C1CA 2MSSA 2GJIA 3KLGA 3M8RA 5D6GA 2M7SA 2MY7A 1FCAA 5EWFA 4HTIA 2P9GA 1ZM9A 5L1IA 3BSCA 4ECRA 1YJRA 3H5XA 1KSPA 3N6LA 1RTJB 4TY8A 5DDOC 4UY85 2G4BA 5KFRA 2AWZA 3GYXB 5C25A 1BD6A 2EG1A 2RNEA 1FVQA 1DTQA 4NLSA 2V4JA 5L38A 2KDOA 5MLCV 3GV7B 3DRSB 2RF2A 4F3MA 5HP1B 2Y1JA 3H5YA 1Q78A 1RA7A 3ULHA 4DUZF 3L7PA 3UE2A 3UD4P 2EFVA 3ZZZA 2YX1A 1VRUB 4MIBA 4C4WA 2BUNA 3CVKA 3BS9A 1SKRA 4IO9Q 1J2VA 4GMKA 4ZLPA 1TFWA 2R8JA 4WCEQ 2IM1A 2N4CA 3KK1B 2KT5A 1TK8A 3V4MA 1TL1B 2HNZB 2FLPA 3SCLE 2IVYA 3I31A 4KHPF 2HMIB 4MK7A 2I5JB 3BEGB 5KFKA 3OW2R 3KNGA 4JI6F 2DGOA 5FLXY 1Z4UA 4G1PA 5KFYA 4DR2F 1SKSA 1H0HB 1LXJA 2LKZA 3CE8A 4OI4A 2OPSB 3EGZA 5LJ5Y 1YJNS 4O4RA 5J2MA 2BACA 2RUGA 4DX8H 1QSLA 4N8NA 4P2SA 3H40A 1BC6A 5KAKA 3PR4A 1K0VA 2HHTA 2QLWA 2ATLA 1JLBB 3HFKA 5T7LA 2DNZA 1IBKF 1S9EA 1Y4ZB 5A6WA 4Y65A 3MURP 3HHLA 3IR5B 3HF5A 4HEA9 1SI9A 1NK7A 2FLOA 3E01B 3DRPB 4NLYA 3FFIB 2IBKA 3BZQA 1T3OA 1HI1A 1SJ3P 4QIFA 4QCLA 2I9SA 2G0CA 5L9NA 5DGBA 2BQ3A 4B3OB 2JWNA 4QWEA 3OTEA 1GH8A 1IUJA 1F0XA 4N5SA 1KLMA 2IAJB 3DN9A 1DTTB 5HROA 2B6AA 2FHMA 4QBUA 2ZOMA 2RB7A 2KRBA 1S1XB 4HTJA 4ED7A 1C2PA 2RDIA 4DG1A 3KNAA 1SJRA 1TZ0A 4IFVA 1CC7A 2KXHA 3NG8A 2J9DE 4ZPCA 1MMLA 3S8SA 2FVPA 1Q79A 4CO5A 4NMLA 4ZVGA 3UW1A 2ADCA 2LA6A 2HQIA 2ZHAA 1S1VB 4TY9A 4X64F 3HHLD 4YDXA 4Y28C 5A8KA 2OLWA 2WRMA 3CCQS 2R7SA 2UXCF 4C97A 1N54B 1XBWA 2CJKA 4IOBA 1AROP 3MPVA 4NLGA 3RAXA 1HHSA 1JLFB 3CIZA 1VQKS 2XCPA 2MPUA 1UP1A 3K5MA 1SH3A 1V6HA 1QVGR 4YY3F 4ETZA 3LANA 4OJGA 1JLCA 3T5HA 3DLLQ 3OVAA 3NP5A 3TI0A 2ZITA 3PO4A 3Q8PB 3RB0A 3D28A 2I1RA 2IA0A 4CO4A 2DGWA 4ZHRA 2E1RA 2F7VA 4R0EA 4LFAF 4GC7A 3TAQA 1JLEB 2CG4A 3U1MA 2CQ0A 1RT6B 3LWMA 2XMMA 2IC3B 5IS2A 4JI7F 4KE5A 1TK5A 4WXWA 1M5SA 1T94A 1ZM4A 1U49A 1X9SA 2FVSA 5D4PA 4I2QA 4B9MA 1KONA 1HBUB 4AXJA 2BDPA 5F8GA 5E33A 4Z2XA 1HQUB 3FVYA 3DMJA 3MEGB 2B4PA 3N01A 3OLAA 3D0GE 2A10A 4QIVA 3W3SA 4K4UA 5E5NA 2UU9F 3JSBA 1IJFB 3UDLA 4QWCA 2HLTA 5C42B 1N34F 1OQ6A 5HBMB 2XY6A 3MCSA 3MZIA 5IT9Y 2XZWA 2V94A 1ZTTA 5B0FA 2Q1LA 5I3UB 1M0SA 3RRHA 4ES2A 1K9MT 1MW7A 2HRUA 4BWMA 3K5PA 3CJKB 2V9WA 2KN4A 5KT4A 1JX4A 2DGSA 2AJ4A 2BZ2A 4KHMA 3KLFB 2NSBA 2ZH7A 2ZBCA 2VPXB 2IRXA 2ZDPA 4L3NA 4BHQA 2OMOA 4HKQA 5JUMA 1RTDB 5LSOA 2UV8G 2XCAA 4KAIA 4J9KA 1BQMB 4WK3A 3NLCA 2H5EA 3D1QA 3PHEA 4C8LA 2KH9A 1HD0A 2VBYA 1U1LA 2FLLA 3NNCA 3O6QA 4C8NA 3UDCA 3VZHA 3TQ1A 2PC6A 2ZH6A 2FLNA 1IKVA 2ROGA 4C3MA 1D9FA 2BOPA 2HFOA 5J1PA 5H1SV 1TUVA 2JSXA 1HQEA 5H9EJ 2PI4A 1R7IA 4LF5F 3TW0A 3I96A 4DBQA 1VRTA 3TOQA 1U1MA 2D3ZA 2HS0A 1RT4B 1QAYA 3QPIA 2DNOA 4DUYF 1YHQS 1A9NB 2N3LA 1OS5A 2CRLA 2R7UA 4QR1A 2JRSA 3PFEA 2RKIB 1X4EA 3CD5A 3DOLA 2GO8A 4B9VA 1OWXA 5KT7A 2QMWA 3MUTP 5D77A 3PKMA 4PWDA 1VBYA 2JC1A 1UETA 3D0HE 2B9YA 1VBXA 3M05A 1IBLF 4DDFA 2UUCF 2ASYA 3ITHB 2EFOA 5EX3A 4NRUA 3DLKB 4I2PA 2COLA 1JLGA 2VOPA 2DD8S 2MSTA 2IHR1 5CHCB 3UCGA 2M9KA 3OSNA 3T1AA 1HYSA 2O01C 3E51A 4QWAA 5A8RA 4X62F 1X4FA 3MEEB 1TK0A 3GR0A 4N8OA 5LMNF 3KTQA 3OFGA 5JVHQ 5HLFB 1PO6A 4BDPA 4DR3F 3OPKA 1LFWA 4YB7A 3CC4S 1AXQA 4LMZA 3BSNA 2VG7A 5B0GA 2J0QD 2UVRA 4DHVA 5FDLB 1VQOS 5D3GA 3FMWA 1J5OB 2YH0A 5B0EA 5AE1A 1M5OC 2VA2A 4W90B 3BO3A 1WG1A 1UVMA 1VOMA 1SH2A 2GFFA 1L3KA 1GTHA 1X8DA 4YR3A 2IRYA 4ECSA 2NLWA 3AQOA 2OH2A 1ZAWA 3I4HX 4JV5F 3O2IA 4URQU 1ZBTA 4X4NA 3IXQA 3OHAA 1N36F 4C0BA 3JSRA 3FSIA 4C8MA 1S9GA 3HXMA 1L3SA 3WC2A 4HH0A 1QVFR 5CCLA 2YX4A 1RT7B 1F60B 1IXKA 4C98A 1Q8IA 4MKBA 4AFFA 4XPEA 2BANB 5DQIA 2A18A 1JLAB 4HT7A 2OPRB 3V6DA 3K8WA 1NU4A 3OHBA 2B7BB 3M8QB 2CPDA 4OZ0A 5C5JA 3B78A 4WXOA 4DL7A 1SB6A 4OZ1A 2BYCA 3AJ2A 1X9MA 3IFEA 4A8QA 4WJBA 1C4CA 4O3RA 1R8AA 2FJDB 3G4SS 3PXGa 2IMWP 1OQ3A 3PVXA 4IDKB 2UUBF 4ECYA 3U1NA 3IRWP 2DK2A 3BGRB 3MMBA 3QJLA 1KOHA 1TFYA 1JWWA 3KHGA 3DOMA 2XMJA 2RS2A 2KYXA 4ITSA 3I4PA 2AD9A 1MWYA 1R27B 2KJWA 3I56S 1SJ1A 3OL9A 1KQSR 2UV8A 2YNFA 3QIPB 2R8IA 3CF5Q 3RR8A 1SL0A 4ED6A 2ZD1B 1E6YB 4OHXA 2KFZA 3CDUA 2D9OA 2IM3A 1FXDA 2NQPA 1TKXA 3J80Y 2IVFB 2MQOA 2XGQA 4HH1A 4NA1A 2ASDA 1VQYA 3JSMB 2YNIB 1N32F 2PMZD 5DG7A 3VALA 1ULRA 1FRKA 3FEXB 2KT2A 3GYNA 1RT1A 1URRA 2VG6B 2XI3A 4FN5A 4I56A 4QZVB 1IKWA 4TN2A 2YKNA 3E3XA 4CTAA 5GAEI 5LSLA 1OSDA 2J6SA 2YNHB 4WFXA 1SV5B 2NPFA 2M70A 1UEVA 4XPCA 3RR7A 4N56A 2JJ4D 3Q24A 4C2MA 4V19X 3TUZC 1IKYA 4A47A 3CD0A 1WI8A 2PA8D 4TQRA 3CPWR 3Q23A 2E5GA 4RW4B 2CQ1A 3CJ3A 2Y1IA 4IH7A 2CIMA 3DRRA 5HI7A 3QLHA 3U27A 1FDNA 2N82B 2KFYA 3A1YG 3OVSA 1LWCA 4ILLA 1MMNA 4FF4A 4OHVA 4DV3F 1OO0B 3PNIA 2GMLA 4J9NA 2EFPA 1O5JA 4C0HA 4ID5A 4Q8EA 1APSA 4ZKAA 3MXHP 4U7CA 2HVHA 4DL6A 1S4FA 4PR6A 2HHVA 1YJUA 2MJNA 2WW8A 1JXLA 2R4FA 4TQSA 4DV2F 3Q8QB 4LSLA 2NR0A 1ZH5A 1XMOF 3M8SA 4K0KF 3U7JA 1H7XA 2HGNA 1Z1ZA 2E66A 4NLQA 4OJ3A 3JTOA 4Q0BB 3MMCA 2CJ9A 1FNOA 2QA2A 4ZVEA 4BCAA