1VK8A

Crystal structure of a putative thiamine biosynthesis/salvage protein (tm0486) from thermotoga maritima at 1.80 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
PKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TM0486 from the hyperthermophilic anaerobe Thermotoga maritima is a thiamin-binding protein involved in response of the cell to oxidative conditions.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Biosynthetic protein
molecule keywords hypothetical protein TM0486
total genus 25
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vk8A00
1LXJA 1S7HA 2EKYA 1YQHA 1VK8A 1LXNA 1S99A 1SBRA 2EPIA 2IBOA
chains in the Genus database with same CATH superfamily
5KG2A 1P9QC 4NLUA 2KM8B 1EJ7L 2M52A 1ZZFA 3CE8A 3DRYA 3I5CA 4I2PB 4OI2A 3UDCA 4DCJB 3VAGA 3VAKA 1IBMJ 4WP8A 2XGPA 5D4OA 2VFVA 3UN5A 3DOLA 1E6VB 2MQMA 4N8NA 3ZTOA 1NH8A 3QWPA 1LWCB 4NYPA 3T1AA 3V6JA 4IR1A 1ZOTA 3BR9A 2JOQA 1WG4A 1U1KA 2MKIA 3KK1A 3JSMB 4F2RA 2LU2A 1AFIA 2FJVA 1SUQA 3B82A 2HMIA 4CO1A 3WIUA 1UJ4A 4CH1A 2R7WA 1M0SA 3L09A 1OJ4A 1REGX 3JAMY 1IR2A 4QWBA 3CDAA 2CG4A 3SCJE 1PCAA 1VCTA 3GPAA 3IGNA 2DB1A 1R8CA 2DNMA 4J9PA 4A8QA 2ACYA 5F3ZA 1RAJA 4FF3A 2IC3A 2WW4A 2CZ9A 5KFFA 1TK5A 4LSLA 4HI2A 1S5ZA 2VUGA 3GYNA 4OZ2A 1LW2A 3QMQA 1EHWA 4RNHA 5HLFB 3HKZD 2VPZB 4AL7A 2I6WA 2Z57B 3HPOA 4C8MA 4IG3B 1L3VA 2B9YA 2J7WA 3MCSA 4PPZA 4NCBA 2FZKB 2HVZA 2V2ZA 4DV6J 1HWJA 2LYVA 4RWWA 5JVHQ 4DV1J 2QZ8A 4YY3F 4QZVB 1Q8KA 4I6YA 3UR0A 5CYMB 3RRGA 2XTJP 4I7FA 4L3NA 3MAHA 4NRTA 4M8LA 3OXGA 3T6BA 5IQ6A 2C2NA 5E33A 3PR4A 4RO0A 3ADAC 3MAAB 4F4YA 1N32J 4DMZA 2FVCA 1H0HB 3VTIA 4CH0S 2QA4S 1H6KX 2CZVC 4F36A 5HL7Q 4X4SA 1NK5A 5T41A 1S72S 4ZLNA 4BS2A 2RQ4A 2VBXA 1H2UX 1RJJA 2YH1A 4DS4A 1UWBA 1RA7A 3V5RA 1SC4B 3FBBA 2RD5C 1QDUB 3T5HA 1HLWA 3KLIB 2JH3A 2XB2D 3OV7A 3CJ2A 4LT6A 5HO4A 5DO2A 1UZDA 2A2CA 2KB2A 2QSWA 3J80U 4DF4A 1RCXB 3QJPA 4DCPB 3W9JA 5A0YA 5KFEA 4YHHF 4GVBB 1NMEB 2B9EA 5AT1B 2OPQB 3RR7A 4PXBA 1VRTA 4QBUA 5D4LA 4MKVA 5HBMB 3RBDA 1VBXA 4OV1A 1Y3KA 1PAUB 2CQCA 3D54A 2M4MA 9ATCB 4L75A 5CZVA 5DG7A 1HMVA 4F3QA 3KDOA 2XLIA 1KBRA 4CYUA 1OO0B 3EVWA 5L9XA 4ECTA 1TMMA 1KOHA 1ZYQA 4LIWA 3AQPA 3IRXB 2B6AB 3Q83A 2F7VA 4IFYB 1F1BB 2DTJA 3BH7B 2H4WB 4DL0C 3IWLA 1QSSA 2C3OA 5I3PA 1SJ4P 1LKZA 5BR8F 2XHCA 2ZJQQ 2BJ3A 4F4WA 5EWEA 2WONA 4RX6A 2CRLA 2RMLA 1F60B 3BGLA 3T1YJ 4OZ1A 1UVNA 1MWYA 3M2RA 4IQMA 1FO1A 1R0CB 2PFFB 1RLCL 1Y5LB 1TKXB 3DLEB 4UUWA 4F67A 5ADZA 2BW7A 2H3EB 7FD1A 1TL7B 1FT8A 3GYXB 2R2SA 3EVMA 3W2VB 4RR5A 4JYAJ 1WG1A 5KFIA 4LF9J 2XCAA 1FERA 4EYHB 3ET6A 2NYIA 2QT7A 1X9WA 1C1BA 3QIDA 4P2MA 2VHGA 2H5IB 2RRBA 2KHCA 2HQIA 2VG6A 1UVMA 2RRNA 3TP2A 1UCNA 3CCLS 2CQBA 4B3SF 1JNZB 1NNDA 2AHOB 1HWKA 1TVRB 3KUHA 1N88A 2JC0A 2MYFA 5D4PA 5L46A 2AGOA 3THVA 1SJFA 2GCFA 2VFTA 2UXBF 1DAXA 4ZPAA 1N4LA 2OPRB 4RW9B 3RW6A 1U09A 4U9RA 1SL1A 4F02A 1T9UA 1NK4A 5GAGU 4DR4F 1RT2B 3OXLA 3I0SB 5CYMA 3X3UA 2FLOA 2E5HA 3OR2A 2AIRB 5GAGI 1AW0A 3US5A 3KJVB 3D6MB 1VQ7S 4FKXA 1YJNS 4DU8A 2DD8S 3SDEB 2FZCB 1VJQA 2W7PA 2P6SA 3DRPB 5K8PA 3BN7A 5HJYA 1U6ZA 4M63A 5B0GA 1S12A 2DO4A 4ZOSA 4ECYA 2KG0A 3O44A 1RYSA 1Q1KA 1KRPA 1MU2A 3CD5A 1U02A 3FRZA 2JWNA 1XMQJ 1JJ4A 1KDNA 2DGUA 2IRYA 1VRUB 5E41A 3UFCX 1B7YB 1UFWA 3DRRA 2W4DA 3NOCA 1FJ7A 4R25A 1TKTB 2OMLA 2V9WA 1S0OA 4OL8A 3TVYA 3IR5B 3MECB 1VMBA 3FEXB 2BQUA 2YKOA 4TXSA 1N33F 2CQDA 1N33J 5EN1A 5M2PA 4DHVA 1QJHA 3V4IA 5DQIA 1RLDA 1UKUA 5HQLA 1V5IB 3NGDA 2VG7B 3DI6B 2HYIB 2RU3A 1EQMA 1H7WA 2CDQA 2XQCA 2CQ0A 4K4SA 2XS2A 5U47A 1CJUB 1WC1A 3RW7A 4F25A 2HHTA 1S1WB 2Z58B 4F0KA 3FMBA 2L9WA 3CMQA 4CT8A 4DR7J 2HNYB 3ENVA 3LGNA 4DSIA 1LQ9A 1X8DA 3DGVA 1WNEA 3VQSA 2YKPA 4HACA 3NWRA 3IP0A 3GJSB 4G6VB 2H4YB 3VGSA 4Q8FA 2AYMA 2VZ9A 1WEYA 1Z1ZA 3QGGA 4O4GB 8RUCA 5LJ3Y 4TY8A 2JJ4D 2KKHA 5ETTA 3MXHP 2R3VA 1NDLA 2XNRA 5KT3A 1WUUA 3R2CJ 4KPCA 2LXUA 3W2VA 1S76D 1F2HA 2GHPA 4ZPCA 1W7WA 2QG9B 4CO3A 2LCWA 2VC0A 4IKAA 1NLKL 2FC8A 3VGTA 3D67A 3I5BA 2EWHA 3CO0P 3PVXA 5I3UA 2ZC3A 2NXEA 1N34J 4KO0B 3DDIA 4QYZK 2C22A 1ZTWA 2XULA 2KJWA 3DNCA 3HVAA 2G9OA 3P8BB 5IT0A 4QCLA 3PX0A 1FX2A 3FC9A 4PPDA 1VIXA 1CJVB 4K4UA 2K1RB 2HLTA 4QPTA 5CCMA 2IYIA 5DZ7A 2CPIA 2FGCA 4LQ3A 3IM9A 1VJWA 1YI2S 2Z8QA 4CI0B 2R7QA 4N7TA 4KHPF 1YBAA 1HNZF 4PWDB 1FJEB 4N76A 3UCZP 2E66A 3W66A 5HI7A 4HVZA 4ES1A 3UCUP 4DWIA 3CCMS 4K50A 4Q5VA 4DUZJ 3BDEA 1JIHA 4CYUB 1NAQA 2CPDA 4A47A 3R6LB 4ALZA 2JRSA 2RT3A 5ETRA 2IMWP 2XI2A 4HTIA 4X64F 2HMIB 4B3MJ 2UUWA 3VF0B 1WD6A 4DV4F 3ZZ0A 4DL2A 1WTBA 1I94F 2JEFA 1D3WA 1CG2A 1YJTA 2GAGC 2ZVIA 2UUBF 1HNWJ 2I0XA 4J9NA 3K59A 1AXQA 1L5UA 1HWIA 1WHWA 4USMA 5RUBA 4Y2KA 2EK6A 2F63A 2GJ2A 3PKYA 1R27B 1MROB 1FFSB 1CSJA 1N5VA 2CQIA 2MHEA 2ZWPA 3CO9A 3PG9A 4ID5A 2W7OA 1X9SA 2QEXS 4Y65A 5DQGA 4DFKA 2OD6A 1RBOB 5HJXA 2HWIA 5HQ8A 1S6PA 1Q5YA 4USVA 5G0RB 2E9RX 1FA0A 1SVDA 2L9DA 2QMXA 3Q8VA 2EG2A 4K4XA 4DN0A 3UD3P 3AD9C 1F5AA 3LAKA 4Q2LA 3RG6A 4WFNQ 4U7UD 3QT5A 4EBCA 1Y7PA 2RH3A 2Z2YB 2ZKTA 4X4VA 2DHXA 1JLBB 4F7VA 1QSYA 4B3TJ 1TUWA 4Q45A 4XIUA 4CO4A 4JI5F 3T19A 1QUPA 2KYZA 1FTCA 2CJKA 3QFWA 3B8HA 3TAMB 4B02A 1XC9A 1IBKF 1ROFA 3QATA 1M5PC 1BE4A 1RT4A 4TLQA 5EHHA 1IKYB 2P9CA 2EFPA 2IRXA 3MDFA 4NXNJ 2ZE2A 3J81Y 1HBNB 4B9LA 4R8UB 2EBEA 1AZSB 2V5HG 2GQQA 5HSPA 5KOWA 2I38A 2XY7A 1TK0A 2FDNA 1S1XA 5CYQB 2YXLA 3AODA 2DISA 5C24A 1HNVA 5HBMA 1D9AA 1SH3A 4A46A 5AE1A 2DH9A 4ILMA 2E7VA 1AYEA 1OSDA 4NA3A 3HT3A 3PNIA 2ZH9A 4ELVA 3A3PB 3C6TA 1VC5A 5A2QY 4IQXA 2AZ3A 2IJNA 2V63A 3TEHB 2D74B 1KD1T 1VRTB 2XSJA 1HWLA 1B0PA 4LRFA 1O0PA 1YJ7A 4KFBB 3SDEA 4ECVA 1T9WA 3GP9A 2A2DA 3DLGB 2BANB 3AQOA 3M2UA 4GRSA 4C3LA 2APOA 3JYTA 2A0FB 4R0JA 1JXVA 2E1MC 1WJ9A 2HRUA 3G9CA 4EBEA 3AXMA 1IVZA 1HPZA 3I56S 2E1CA 2NREA 2FJWA 1VDHA 2DEIA 4OFZA 1W25A 2Y8WA 4JI3J 3KKFA 2HZCA 2CNKB 5DJBA 2AJQA 2VB6A 4KV8A 4EWTA 4X66F 4FP9A 3PRBA 3W1YC 1PIEA 2B5JA 4N8OA 4KT0C 1FWPA 3IA0A 5KTQA 3CMAS 4O3SA 3GIIA 1BLUA 4KHMA 3M8RA 3K8WA 1RKIA 4WTYA 1VS3A 2BUNA 4ZVPB 4R5PB 4ED0A 4UY85 5KFWA 4M5GA 3OL6A 3LGMA 4C0HA 5FLXY 2L3MA 3H20A 3CCWA 1H72C 4RNMA 2XMAA 2Z2LA 1P8GA 5D77A 3VWSA 3HHDA 2IA6A 2DK2A 3O6QA 2GQCA 2HVIA 3PJXA 3IAS9 5A8KB 4B3RF 1NHUA 3D1OA 3DOMB 4B3RJ 1B7FA 2LDYA 2VBYA 1RGVA 3KNGA 2AEMA 4YB5A 2B0GA 1S7IA 2B9WA 2EFVA 3PYEA 4C97A 1BWVA 3ULHA 3J81j 4HTJA 4USJC 3BQ0A 3UDVA 1BHNA 1HNIB 2J76E 1FCAA 1P6TA 2M88A 3GFHA 3M8WA 1NJZA 2MKYA 2YX1A 3N4WA 4P72A 2ZFHA 3G8SA 5CQGA 5A76A 3H59A 2OH2A 4JI4F 3PHTA 4DV0J 1P9YA 2YPYA 2HVHA 3UNGC 1XQIA 5T7LB 2B3TB 3OTEA 5LXRA 4ZLJA 3TARA 5IOLA 3K57A 3TANA 1IWAA 1LWFB 1CVJA 2YX4A 3Q89A 2ZH2A 5LMNJ 1Y0HA 1SC1B 3FGVA 1XNQF 3SI8A 2HPUA 2FC9A 2M8HA 4M5MA 2V4QA 2NXCA 3KOAA 2BJ7A 1HQUB 4ED4A 2CPXA 2MKSA 2RKIB 4WWSA 5E5NA 1JWWA 4YQWA 3C66A 1L3KA 2GAHC 2H5EA 1FTRA 2G13A 1SCJB 2PA3A 2D3OR 3QRPA 2NSBA 2GVZB 2BABA 2OUGA 2WAQD 3CUNA 2R2RA 2V8DA 5F8IA 2IAJB 3AOCA 3TZYA 2H51B 2ZC4A 1K73T 3OVBA 1LFWA 2ZH6A 1RWUA 1BY9A 5GMKa 3IO1A 2XS5A 4G1PA 3DCAA 2OEKA 2RE1A 1CJUA 2AD9A 3HSZA 2XHWA 3BQ1A 1N0VC 1FESA 1MMLA 3M8QB 3NLCA 5KFCA 3RTVA 1UJ5A 4P2XA 3DHWC 4ID5B 1AA1B 2IM2A 2VG7A 3DI6A 1ZM9A 3KJQB 1VOMA 4C11A 1NSAA 2MSTA 4WFBQ 1AUSL 2MHNA 4LF4F 3MUTP 1AUDA 2JEIA 4ANCA 1F9FA 3FSYA 2HFUA 1Q4RA 1Y10A 1B70B 5K8MA 2R7UA 4CLUA 3MM5A 4Q2MA 5IT4A 1FI4A 3I82A 4HDHA 3MUMP 4K4TA 2OPPA 1J5EJ 2HNDA 1HQEA 5H9FJ 3CGIA 3AD7C 2QA1A 5FDLA 3TVZA 1UW4A 2MQQA 3RBZA 3BSAA 5J1EA 1OY8A 3DFEA 4Y34A 2UVVA 4DQRA 2CPZA 2FHOB 4DS5A 3PIPQ 3ZZYA 3CCRS 4ZVQB 4K4YA 1QAJA 4Z7CA 2LQ5A 4MKYA 1S1TA 3GV5B 2VJVA 5KG6A 3D6HB 4JI6J 1ZETA 2AZ1A 2FQQB 4FN5A 3TZZA 3P4UB 1RSCA 2KXNB 2GIFA 1TU0B 2KXHA 3TAMA 1SI9A 3KFWX 4U7UK 3D0IE 4PUOB 3SSSA 1EB0A 1ELOA 3PW0A 1WSRA 2P9GA 4NMLA 2HRYA 4LRBA 4LVOP 4DL3A 1DQ8A 4DOZA 2FB0A 2FUG9 3G4SS 1Y4ZB 1SL0A 1VQ9S 3GIRA 3R7NB 3E01B 4KTQA 2ADCA 1FNOA 1RT7B 5DDOC 1MLAA 2FPHX 4DL5A 2D41A 3H42A 4DG1A 4FZVA 2KO1A 5KFPA 3MGJA 1WDDA 2MEWA 2K7KA 4HHUA 2BACA 4DL6A 2VDIA 3QQCD 1GMUA 4PG6A 1YBTA 2E7WA 4NRUA 4WKYA 5T7LA 4UY8T 1XEZA 1XNRF 3GQCA 4DR2F 5LJ5Y 1XNRJ 3SV3A 3HXMA 2B43A 4RL1A 3W8GA 4FS2A 1M5SA 2DHGA 1OIAA 1D0EA 1WEXA 2UUCF 3VAJA 1YVFA 1NPKA 3DLGA 4NLXA 4OYPA 1RAFB 2A1BA 2AJ1A 2XZTB 4USUA 2Y1IA 3QJLA 4DR2J 2Y1JA 3TVKA 3HVWA 4K2XA 1E6YA 1MN7A 1CEZA 2ZM6J 2IJRA 5HP1A 1VISA 3OL8A 5GAEI 4V19X 2ASLA 2HHQA 1PC4A 4DV7F 3NGTA 4MTPA 1GT8A 1JJHA 2MKKA 4A8YA 2JLEA 2KJVA 1LXNA 4QIVA 4WIQA 1PYSB 2DNOA 1FRJA 4IFVA 2XEXA 4DV5J 2J6UA 1NZAA 4KHRA 4HH0A 2HS4A 2QA4G 3QGPA 3CC2S 2IVFB 3O5TB 4IOAQ 2M3DA 5IT9U 3F41A 3OUYA 3R5CA 4IFYA 3R5DA 4OYOA 5GVQA 2CJXB 1Q8BA 4I0WA 1L3TA 4KGXB 3HKWA 2UP1A 1RAAB 2QTWA 1FXDA 2MXYA 3FCHA 3M8SA 2RUGA 2MZ1A 4KGKA 2P6TA 3T5KA 4OHYA 4EK2A 2ROEA 5BJRA 2MB0B 2CPYA 4ECWA 5KFDA 3BBCA 4LSLB 4F04B 1RWPB 3DM2A 4TU7A 1IR1A 1JKHA 2Y0SD 3DOKB 4J7CA 4CLZA 5J2QA 2ALZA 1SKWA 2ZD1B 1HI1A 4JYAF 1P1LA 4UQTA 2AMCB 4DPTA 2QE5A 1Z2ZA 5E0OA 1YITS 2I1RA 4K5RA 1S1VB 4OI1A 2X7IA 3GE9A 1PGZA 1C1BB 1HL6A 1UVJA 1NHKL 2WB4A 2EKNA 1FDDA 1ZH5A 2XSJB 4FVMA 3Q22A 1T9XA 2G2OA 1X0PA 3FMWA 2LQ9A 1WELA 3LH2S 4PYAA 2BW2A 3C16A 3EZOA 5E7OB 2VQFF 2ZBQA 2E1RA 2J9CA 2OI2A 5GMDA 4NI2A 4OJ3A 4U95A 4ZJQA 4A8KA 4AXJA 1IBMF 4IRDA 4I56A 4A4JA 2J0QD 2JEJA 4I6WA 4BCAA 1HHTP 3H2UB 1C0UB 3BGUA 3VCDA 2E44A 2X51A 1NRKA 3Q0AA 4KFBA 5CD4A 3CCUS 2OTLS 2HQDA 4OYWA 4KRWA 2CJBA 3I0RB 4K7QA 1S6UA 3R97A 4ECUA 1WF1A 3IC1A 1REVB 2GMHA 4UF4A 4DBQA 5HMXA 4DQSA 1RTDB 2F4VJ 1KN6A 3OXFA 1RWOB 1RP5A 1QAYA 4F0MA 1B99A 1RTIA 2KFZA 3ZO7A 4FXDA 4U96A 3ENQA 3CD7A 3I9ZA 4H4MA 1U6BA 2EEYA 2G0IA 2JVRA 3M8ZA 2YNIB 3R2DJ 1HYSA 2N3OA 1RDRA 1RAGB 1O5JA 1Y00A 4P10A 2ZUAA 3M1VB 4JV2A 3ILLA 1OPIA 3SCLE 4CO0A 3LANA 1U1OA 4CLFA 5CABA 1EIYB 1L3SA 1HMVB 3W3SA 2NUHA 2V34A 4C11B 1I94J 2GS8A 3R7SB 4PXEA 4ZIVA 2RQKA 5L38A 1TQLA 2VKRA 4IOBA 1FDAA 2WB1D 3IBCB 4LFAJ 1RHMB 1S9EB 3I96A 1TKZB 4H4KC 1ZPVA 1Z2LA 1RK8A 4RW8A 1FWKA 4IR9A 1RZMA 4H54A 3WZ0A 3PR5B 3IWXA 3KK2A 1VFJA 1LWEA 4ZVRB 2XO6A 1Q16B 2VV5A 4G1QA 5DS7A 5L1IA 3HSDA 2EW9A 2OPSB 4OV6A 3I5AA 2BKNA 2GMJA 5I42B 3ET6B 4DXLA 1VBZA 2OFGX 1PBAA 1TKXA 2GJFA 3CD0A 2QYCA 2OD4A 1FVSA 5ETKA 1U4BA 4HACB 1NM2A 1QD1A 3BGOP 4QJVA 1IBKJ 1M1GA 4HH1A 1VLOA 3H2LA 2VA2A 1QE1B 1HR0F 1U26A 2OO4A 3D7SB 2VBZA 4E98A 2JHEA 3EGVA 4JOUA 4JV5F 1RT7A 3RBEA 1TK8A 2ZOMA 4JV5J 4QWCA 2ZD1A 3JQMA 2HK3A 2WZ1A 4XO0A 4DL7A 2BVZA 4RUCA 3OT9A 4NLOA 1TKDA 2GQ2A 2IM3A 1D09B 2MZJA 5KFBA 2U1AA 4ZPBA 1C4AA 2RKIA 3O1LA 4C9DA 3H5XA 3NMAA 3AOBA 1SJRA 2WOMA 2AGPA 5F0WA 3DU6A 1KLNA 4CRJA 4J9VA 4XPEA 2R4FA 3LGHA 1WWHA 2ZH7A 2HHUA 1YSJA 4CWBA 1NHVA 4MIBA 4YR3A 2POKA 1S0VA 5KT7A 3U1NA 1HW8A 1CC8A 3TUJC 1LXJA 1T11A 4ATNA 1Q7LB 3HHKA 2CQ2A 5KFUA 1RWMB 4UZBA 2XZWA 1R6YA 1V3RA 1YRTA 3J7Z5 2KTQA 4D3GA 2DGXA 5DDPC 1TFWA 2HFZA 4FYDA 2B8QA 1YKWA 4QPXA 1E6YB 3KHHA 1S4FA 2HEKA 1VI7A 2AF6A 2XG8A 2DBBA 1XMOJ 1XMOF 3DKDA 1KLMA 3OJSA 2LA6A 4DPXA 3HI9A 4C8OA 3S8SA 1K47A 2HS3A 1Q78A 2X1GA 3HHLB 3HFKA 1RI7A 1S1UB 1QUVA 1XERA 4JUZA 1X9MA 4H4OA 1FRXA 5J1NA 1TVRA 2Y1LB 3NAIA 2WRMA 3NG8A 3RGIA 4M5LA 1NB7A 2I8EA 2G0CA 2E5IA 3B78A 3Q23A 4U8YA 2WK4A 1SPBP 3L7PA 2ZOFA 1GK8A 1XJWB 3EXCX 1S1WA 2BA9A 1C0TB 2F3JA 3BGRB 2UXBJ 2QLJB 5DDRC 1MNEA 3EE3A 3DOKA 2BE2B 3GSIA 5K5MA 4EO6A 5C25A 1N56A 2A18A 3W63A 4PUOA 2C2RA 2HAFA 1DURA 3AFGA 5KFKA 2KL8A 1PSDA 4HT7A 2IPOB 2J9EA 4OYAA 3GIJA 4UOHA 5DLGA 2DXDA 3H0PA 2OIHA 4UZCA 4ECZA 1B3TA 2M9KA 1MU2B 1GXUA 3D1HA 1SKRA 3DDKA 1VYAA 4RWXA 3M8PA 2ZH8A 3G82A 3V4MA 3V81B 4NXNF 5KFXA 1SJ3P 2QJ3A 5D15A 1M1KT 2BKPA 1KQSR 1T95A 1FRHA 4OYBA 3MR3A 4USTA 3GG1A 1HHQA 5C24B 4J9SA 4LVNP 1JNRB 2KHDA 3OTBA 3W5YA 1CJVA 5CXTA 2VONA 2O3DA 2PO4A 1S4EA 1XIQA 1YWXA 1JQGA 1WTFA 4ZVSB 3IR6B 1NH7A 2IJFA 4PQUB 3HJVA 1ZBTA 2XCPA 3HSJA 3OTDA 4DX5A 1OYEA 1U2FA 4Y3CA 3W5ZA 3MM9B 1AFJA 4K4WA 2XMTA 1W2BR 1RKJA 5J2NA 3QIPA 3J7ZT 3DHXA 2XMUA 3K5LA 5T14A 4P7VA 2KU7A 2E5GA 3HJFA 4WU2A 1I5OB 3E3XA 4G3IA 1WHVA 3MR5A 3GTYX 2WSFC 2ZH1A 4DR3F 3HO1A 2WSEC 3I87A 4WF9Q 4LBIA 4ES2A 2EFNA 4B3OB 2W9AA 2MJNA 3TX8A 1KR4A 2HHVA 1FK9B 5KG0A 3NBPB 1FJCA 2LA4A 4ZP6A 3FCVA 2BJ9A 3FJ2A 2CJYB 3QJJA 4F8RA 3IG1B 1XR5A 3W64A 2JEGA 4DUYJ 1A6LA 2G0JA 4J5OA 2VODA 1VQLS 2IVYA 2CJAA 5F41A 1MROA 4JB8B 3MEEB 1TFYA 3ITHA 3G6ES 4E8UA 1JLEB 5L9NA 4PAAA 2R7SA 3EZUA 4FXWA 5I4MA 3CTRA 1RAHB 4EO8A 1TAQA 5EDWA 1S9GA 3JS9A 2K3KA 4WFZA 4PG4A 5K8NA 5JVGQ 5DGAA 3A1YG 3CWJA 2EG1A 2M5YA 2IDLA 2PI4A 1N5TA 2CAJA 2V8HA 3GB0A 1GFWB 3SV4A 1RT4B 2BJEA 2LLZA 3CMES 2PC6A 4RJVA 9RUBA 2C2EA 2HHHF 3QAUA 2VQFJ 3CJKA 3CDUA 1Y11A 2HIQA 3C16B 4YUDA 5MAOA 1X5PA 3NP5A 5LL6d 1CBKA 2WVCA 2VU5A 3QT8A 4CQ1A 5IV4A 2B4PA 4MIWA 5F8MA 3UNYA 2XLKA 4IRKA 4LFCJ 3WX4A 2FJAB 1CC7A 1C2PA 2CQGA 2DITA 2IFXA 2YVSA 4W98A 2ASJA 2DHHA 1ITPA 5D4NA 3RB6A 4EUVA 4DPWA 3VHQA 2BJ1A 2RB7A 3D6TB 1PO6A 2MQNA 1AT1B 1U47A 1IBCB 3PCOB 1MMDA 2HG4A 3L4BC 3C15A 5E3RA 2PI5A 2BANA 2DY1A 2JLFA 3GSDA 4HDGA 3QZ8A 2XC9A 2V9KA 2HWHA 4K5SA 5HAOA 5BYQA 4ZMMA 4DLGA 4EZ9A 3DRXA 4BLGA 4I2PA 2LP4A 3R5BA 1TR0A 3T1YF 3MD3A 3LWLA 5KFSA 2ZNYA 5KG3A 4ZCIA 4DV7J 3FQKA 5IV3A 2RS2A 1F0XA 2KXFA 1KLMB 4KPYA 1N5SA 3GJQB 4TNOA 4WIIA 3BO4A 1RAOA 3UN2A 4YP3A 1HQ2A 4LF4J 3J7AN 1FNXH 5LT5A 1RT3A 2Y8YA 4RW4A 1FXRA 2XZDB 4WZMA 5JMNA 1SV5A 3G96A 1EETB 1GQEA 2Z0GA 2QLFB 3MMBB 1URRA 3A8EA 3BZQA 3W2WA 2ALYB 2YNGB 3MPUB 2DR5A 3EVOA 3GJTB 4KKOA 1S59A 3H2VE 3JB9k 2B9XA 2RQCA 4K59A 1N6QB 4B3SJ 4MFBA 2CXEA 3MR6A 2M2BA 2OLWA 3QZ7A 4KE5A 3NKYA 4ZVTB 3I4PA 1JLFB 3VVTA 3HMJG 5EWFA 2HNDB 3G8QA 3TA0A 1UFKA 2F9JA 4NZ0A 2FHKA 3VZHA 8AT1B 2M8DB 4NXMF 2CPJA 1UVKA 4QWEA 1QE1A 3MHYA 1KOOA 3QLHA 4I2QB 4ZPVR 3ETMA 5ETQA 4R8UA 4FPIA 4LF8J 1SIZA 3MWBA 3UDEA 1NB2A 1D8ZA 1S48A 4ZJLA 4WU3A 3TZWA 2GIQA 3DRSA 1VBYA 4DV6F 4WCEQ 4CM2A 3VGVA 4USIA 4ANEA 5SZTA 2IBOA 4OHWA 2VIHA 4LF2A 4P6QA 4F0HA 4TKTA 4JI0J 4JV0A 2YWHA 1KONA 2JFDA 1BUXA 2WTFA 3JYTB 3U27A 5B7WA 1TP7A 2XWXA 5C2CA 2V4JA 4F2SA 1M1HA 4HL9A 3W62A 2FHMA 2H9ZA 2ZZTA 4KC5A 2XWYA 4QWAA 2F8EX 2J0SD 2P2CB 4IH5A 2CDRB 3OFHA 2ZHBA 1DTTA 4Q8EA 3HSGA 4L6V3 3R27A 2W25A 3M2UB 3K7RA 3DXSX 4UOGA 5CA5A 3Q8QB 4KJIA 3E01A 1N8RT 4ZA1A 1VBKA 3M6UA 2V50A 1H3DA 3VQTA 2PD1A 1HKAA 4B3MF 4A8FA 2C2OB 2G2YA 2MZQA 4K8RA 4NCAA 5F8GA 3O8WA 3QIPB 4ZJOA 4EU0A 6FDRA 3SIPB 4URSA 2RS8A 2DNNA 1EARA 1SC3B 3LPYA 2GO9A 2RJZA 2OEMA 4KGMA 2JLGA 2KN4A 3EXYA 2UZAA 1OYDA 2Y1RI 1HHSA 3P5TL 1U0HA 5DZ6A 3MMCA 4ZVEA 4DV3J 1EQ0A 4GC7A 4CDIA 1FXLA 1ZAVA 3L7OA 3ZC4A 1HNXJ 5ETLA 1HNXF 1R3NA 2MLYA 4ILRA 3BGFA 1CJKA 3G8TA 3D6FB 3E51A 2W2MP 2NZCA 8ATCB 1RABB 2AT1B 4FKYA 4LREA 3ENWA 2CQHA 3IG1A 3ZTQA 2FJEB 2AEJA 1WC4A 2K3IA 3PJWA 4PG5A 2BKOA 1WF0A 2J8AA 3BGRA 2ZHAA 4LR8A 1MW7A 4TYBA 4WFYA 4LUBA 5B09A 3OD2A 3N5FA 2HZAA 4FVCA 5B0BA 1LW2B 5C25B 2OSRA 2HAIA 3G71S 1YJWS 2P5VA 1K44A 1UVLA 3DOMA 2MMYA 4X2BA 2DGSA 1FEEA 2BRLA 3IR7B 3TNVA 1C0TA 5F9NA 4QQBA 2BOPA 1KVJA 3CPWR 1YG0A 2KT2A 2IDEA 3LUYA 2DY9A 4WYLA 1S77D 3TX0A 5LSLA 1K9MT 1SQGA 2XM3A 2E5LJ 1FX4A 5ETVA 3KLHA 3KYLA 2R9LA 1MMNA 2H54B 4ZPTR 4LF9F 1HQUA 5KAKA 2JDJA 3MR2A 3T1HF 3JSBA 1XNQJ 3K0JA 1ACMB 4X62J 1MN9A 4OI4A 2VG6B 1R0BG 4NA2A 3OTOJ 5I3QA 2VJUA 1R8AA 4BBYA 3CJKB 3QLHB 4I2QA 2LECA 1TTHB 1LWCA 4DR5J 2OTJS 2WBMA 1UWBB 1J2VA 2FYXA 2L9NA 2W2NP 2DPJA 2ZZNA 1WOSA 4CIOA 2OPRA 4A8WA 4OX9J 4AT1B 4NYZA 2PMZD 1CQNA 4MYTA 3HHNB 1DLOB 4KAIA 3TA1A 2ZITA 1IKVA 4IDKB 1OQ3A 2R7TA 3VGUA 1R31A 3FDSA 2FVSA 2EFQA 3LTOA 4IG0B 1VQOS 1YZ6A 5F8NA 2F5GA 4NX9A 4CLKA 1Q81T 1XMQF 2IA0A 3KG4A 3DYAB 3JAMU 1GTHA 3DMJB 3KTQA 2PDAA 3D1QA 3QT7A 3H40A 4NLRA 4B3OA 2RRAA 2J6TA 3GZ7A 3PYFA 3OJUA 1UA1A 2LDIA 1A0OB 1ZPWX 2WCXA 4IOCQ 1RISA 2BR0A 1RT3B 1B0VA 4QIWD 4CLLA 3NY0A 3EX7B 3MEEA 4KY3A 3PX4A 3SCKE 3BQ2A 3ETOA 3ZZRA 2F8HA 1V9OA 4KKOB 3SQGB 4Y0FA 4ETZA 4Q44A 3BREA 5EWGA 3UE2A 3ZZUA 4J37A 2E9ZA 3Q8YA 2HBRB 3WBZA 1WF2A 3AB4B 5IM0A 1EETA 2UV8G 4LIRA 3MM7B 4Y2AA 4KR0B 2DHSA 4OYZA 4PWUA 3V2UC 3MEGA 5BYRA 4YDXA 1HARA 5A8RB 4MT1A 4ZP8A 2GNKA 4C0OC 3CC4S 4RZRA 1TKZA 1RT5B 2HNYA 3ENAA 3FBCA 3OSNA 1T94A 3AXKA 3FBFA 3AT1B 1K0VA 4A8XA 3Q8PB 3GFYA 4LR7A 2UU9J 4P52A 2GJIA 1RWVB 3SSQA 4WXOA 1H74A 3T5LA 2DNGA 2ZEJA 2R8GA 3KNAA 2BQRA 1SKUB 2Z30B 3BKUA 3UPFA 2FY1A 1M5KC 4IH6A 4USHA 3ICLA 2MY7A 4JP8A 3UVJA 1NPRA 1T9YA 2OAUA 5HVFA 3EYZA 1XK8A 1RT1B 3M7VA 2E1AA 5KFTA 2GVDB 4ECXA 1J5OA 4IO9Q 2NS1B 3MEDB 3Q24A 1RXOB 1QTMA 1NKBA 3IXQA 4GKJJ 2AJ0A 1S6QA 3H4DA 5IC4B 1X4DA 5H9EJ 1H38A 1WC6A 2Y9HA 4DCOB 2DH8A 1AROP 3M32A 3CJ3A 1SXLA 2PFDA 3EDQB 4QWDA 3KLGA 3H25A 3LPEA 4X62F 4L74A 3CIZA 3W61A 3O3LA 1CPZA 4OYMA 3LQVA 4TQRA 5LM7E 3I0RA 5AE3A 4NOHA 3OL7A 3DRPA 4OIXA 1U2CA 2CQPA 2MQLA 2FLLA 2WOMB 2E1PA 3QGHA 4S0MA 1KQFB 4XPCA 4WKRA 1YTYA 1NK9A 4J90A 2R7OA 3VVUA 3T6JA 5HMYA 1VRUA 1S0MA 2D3ZA 4ZP7A 2YKQA 2XYPB 2BYCA 2YNFA 2VKZG 1S57A 4USKA 5HROA 1KQKA 3UN3A 5DG8A 2IBKA 2YNGA 4I6AA 2UUBJ 5F0UA 2BE9B 1U0HB 1S49A 1WHYA 3ZNJ1 3OHBA 2HKEA 2YKMA 1T03A 4MH8A 1FKPA 3M9NB 5HMZA 3CC7S 2GO8A 2MQOA 1F5BA 1WC3A 4USWA 2E9TA 1JLAA 3BKFA 4XTTA 2QN6B 3NAHA 5DGBA 2VG5B 2A6OA 2DRBA 3HF5A 1HNWF 2W4PA 2XMJA 4FYWB 3H98A 1VK3A 5G4DA 4DUYF 2DR8A 2ATCB 4LBHA 2EK1A 3T9ZA 4ID8A 3FFIB 1I3OB 1OWXA 4M5DA 2UUTA 2VOPA 5E3QA 2ATLA 1R89A 3KMQA 3MPVA 2C2ZB 3DDNA 4O44B 3TOQA 4QR0A 3UWTA 4DV1F 4JI1J 3P6YC 1IM6A 1VQPS 3J7YU 4ZLLA 2AV5A 2H48B 1V3ZA 4KIAA 2KVIA 3LP0B 3NCPA 3PEJA 1KNZA 2FGOA 1P1TA 3TJ9A 1G4CA 2HGLA 2NLWA 2VICA 3TAPA 4QIGA 4YFUA 3NS6A 1K0TA 3C14B 3EGNA 3ZZTA 4YY3J 2QX0A 2AU0A 1ZS6A 1BQNB 2FTRA 4P71A 4OX7A 5CH7B 4CLTA 4XK8C 3KHGA 5E3PA 1WHXA 4JI8F 4X65J 4X4PA 4J9OA 3PY8A 4X4OA 2DGQA 4YEAA 4GC6A 4MK9A 1NEEA 2Q79A 2SXLA 3PXGa 1IKYA 1G6BA 3KXDA 3WC0A 1NJXA 1NK6A 2XNQA 5KFJA 3NCQA 4QOTA 4OI3A 2JZ5A 2QMUB 2YNIA 2A3JA 3UW1A 4C2MA 1KC8T 4IG0A 1YX2A 2LEPA 5CYQA 4YMEA 1F9HA 2R2UA 1Q86T 3GG0A 7AT1B 2R7RA 2F1FA 3GJRB 4I64A 5LMNF 2R2TA 1DLOA 1RT6A 1SIWB 4YR2A 3I55S 2BDPA 4FBTA 4O3PA 2MQPA 4Q0BB 2J0XA 2HFNA 2IIHA 4G65A 3BB5A 2W9CB 1OY9A 3GONA 2XY5A 5JUMA 1SKSA 2V8PA 3FSXA 3CJTA 3LW5C 3BPDA 2DH7A 3M30B 1UP1A 2I5JA 4FPRA 4LR9A 2WW8A 2YNHB 5C2GA 1UW9A 4WYWA 2DGVA 3M2VB 2M0GB 4XDCA 1T9TA 4DX8H 3RB4A 4FF1A 3J7A1 1FJGF 5ETMA 2AKWB 4JI7F 2QRRA 1U0SA 1BQXA 2JX2A 5E3AA 3SQGA 1X5SA 3V6HA 1ZZNA 1NKEA 1HPZB 3FZ2A 4O0IA 3OVSA 3Q2SC 4NE9C 3AJ1A 4NCGB 3JXOA 2DKOB 1U7LA 2CJ9A 2QV6A 1IKXA 4P9SA 1RHKB 3KHRA 4X4TA 3MFHA 1HBMB 2FZGB 4X4QA 3EWGA 3HZEA 2YY3A 2IVMA 4RUBA 1R7IA 4ZVHA 3HHLA 2YWKA 1JJ2R 2CFXA 2ZKUA 3R5JB 1NJYA 3WC2A 3BO3A 4L76A 1YRUA 1LEOA 1T7PA 1JXLA 4PABA 3PW4A 2WVDA 2KFYA 3LWMA 1MWQA 4Z7YA 3HD1A 5B0CA 3PV8A 3W8PA 3MR7A 3UQSA 1HR0J 4B9SA 4A48A 4LRCA 2YWGA 2ZE2B 3HVTB 5DDQC 3DLHA 3K8VA 4P74A 1N5YA 1N52B 1QSLA 4LF8F 5CD4H 3P49B 1WI8A 3IBFB 1ZM3A 1N32F 2WVFA 3BEGB 5D0EA 2B56A 2CVIA 2IMOA 5A8WB 5LMUF 3AJ2A 1HNVB 4DQIA 3TA2A 2EKYA 3OPKA 4RNOA 1HI8A 1U1MA 5C42A 1RE1B 4IDKA 4E2FB 2NR0A 1AZSA 2RAQA 1RHRB 3LP0A 5EX3A 1Q53A 1VQ6S 1XTZA 1KFDA 1REVA 2XMMA 3QBCA 4KB7A 1BWEA 2FJDB 1RYRA 1F5CA 1BC6A 2GX8A 1NDCA 1FKAF 1X5OA 1UZHA 2CJQA 3N79A 2CIMA 2C42A 2HNZB 2MZTA 2VPWB 3FQLA 3MEKA 4I4BA 2W8LA 3D4JA 4ER8A 1I6JA 1BD6A 3JSYA 3KLIA 4B17A 4IUFA 2MTLA 5LXYA 2HIYA 4KHPJ 4OJ1A 2ABYA 2QO3A 3PRDA 4RBTA 1E6VA 3IAM9 1T05A 1SQFA 2RF2B 4OMFG 4UOCA 2IM0A 3GIMA 1NBEB 2NXJA 3A3OB 2KM8C 1RTZA 4GVLA 4DV2J 4DZDA 3FEZA 4CT9A 5CCLA 2ILZA 1B0TA 1S9EA 1U25A 5KFRA 3Q8RB 1YK9A 1FFWB 2RNEA 5HROB 1J27A 1WI6A 1TELA 2EXUA 1FWLA 2DRDA 3NCRA 1JLCB 2NCKL 3POTB 2VA3A 1KSPA 1FVQA 1X4CA 2CADA 1O6XA 4J9RA 2I5JB 3MTJA 1R0AB 4DZ6A 3IRXA 1DQ9A 2JNJA 3R5AA 4LJMA 4OLOA 3V6DA 2B51A 1EKRA 2UXCF 2AP6A 5CYJA 2HVDA 1FNMA 2NYHA 5DG9A 4LSNA 2HQGA 5J2MA 1TL3B 2QIFA 3VAFA 4URGA 1IJEB 1XBWA 1X4GA 2AJFE 2BE7D 3NBPA 1GXLA 1WSVA 3W2WB 4DLEA 4TYAA 1F3FA 1HNIA 1RWNB 1LOUA 2F40A 4O3OA 1RT1A 3GCXP 5AXLA 1U1NA 2D7SA 3CF5Q 4DPOA 1J5OB 2DGTA 5HATA 1LW0B 4AQYF 3EGZA 3D0GE 3R9LA 1JLQA 4B9MA 3CXCR 3IMQJ 1YDLA 4MK8A 1Y5IB 1NK7A 2XMKA 3BR8A 2G1DA 4ECQA 1X4AA 3DOLB 2C3MA 4NYOA 3A3NB 1VQYA 1ZM2A 2MDAA 1S6OA 1IKWB 2DT9A 3C6UB 5K14B 2HHPA 4CNYA 3CJRA 5KG1A 4DFMA 4BC9A 1N36F 4PQUA 1WKJA 4CLYA 4DUTA 1N5QA 1Q5VA 4PR6A 3MM9A 1SUQB 4LMZA 3CJSA 2Y3YA 3ISND 4C0BA 5KFAA 5KFOA 2OELA 1PBUA 3K17A 2HFSA 2QSFA 3H5SA 2W9BA 2ZH4A 5A0YB 3PX6A 2BRKA 1PYOB 4DUZF 1NDPA 3H8YA 4BHQA 5FLXU 5IXUA 2CQ3A 2WVBA 3H5UA 1XMBA 4J9MA 1U8WA 4GO5X 2AYGA 2DNRA 2F4VF 1GMWA 2R7VA 1KFSA 1GX5A 2DGWA 2VBWA 1EP4A 1RUSA 3L95X 4MMOA 2YNFB 2RHQB 1N54B 1XWLA 2FY8A 3MM6B 1IBLJ 3SYZA 2KDOA 2OP5A 3S01A 3DLKA 4AFFA 3I9V9 4DSJA 1JJCB 4EFAC 3KG1A 4WTOB 2YKNA 5FIIA 3GILA 4IRCA 4M1KA 1FF2A 2IC3B 2PN6A 5LSOA 3SBMA 1EX8A 3EDRB 1HQEB 1I51B 1TUGB 1OSCA 2PMWA 2XSFA 3MM8B 4ZVUB 4ZHRB 5A8KA 3HCXA 2ZDOA 3O2IA 5HP1B 1H2TZ 1WOOA 4C98A 2C2MB 4TU9A 1KTVA 4DX6A 2CYYA 3TUIC 2QYGA 3BS9A 2IHR1 3E8OA 1WACA 1IKXB 3IWNC 4DR7F 4B9UA 2AX1A 3ITHB 1JLCA 2C28A 2UU9F 1RHUB 1UEVA 5FDLB 2R7XA 3KLEB 1HBUB 1WKLA 3CDBA 3QO9B 3K89A 4WP3A 3BN4A 3G2XA 3ZZZA 3SZ2A 1APSA 1R0AA 1YRXA 3IBWA 2NSCA 4X65F 1UETA 3HVRA 3GWCA 2CQ4A 3DU5A 2HBQB 3KG0A 3RB0A 4C8ZA 5J2PB 2ZVSA 2NUUG 2D9OA 4DDFA 2KG1A 1ZM4A 3NXZA 3M9MB 3PJ9A 1RA6A 2W2OP 2AQ4A 1KHVA 3TRGA 1Q8LA 1R8BA 2R42A 2BJ8A 4RU9A 3T3FA 1HYSB 4C4WA 1JKHB 2QFIA 3VAIA 2Q3PA 4LF5F 2GFFA 2PT0A 3L9ZA 4HHHA 2CPFA 1M90T 1U45A 3PHEA 5DM7Q 1D8YA 2YWFA 4NLYA 4JI2J 1VGYA 3RRKA 4N47A 3PDNA 4U7CA 3HHEA 4PQAA 4Q0BA 4NLQA 2B8PA 4JI0F 1FDBA 1OY6A 1LV5A 1BMQB 3AB2B 3CNQP 4C48A 2W9CA 1SJQA 3K58A 3RR8A 1UMJA 1QAXA 1RHJB 2W2PP 3JTOA 3M05A 4NLSA 1JB0C 2AYEA 1VC0A 4CZCA 3UO0A 4DFPA 4CLPA 1U1QA 1NK0A 2VASA 5K14A 3DRRB 1R8PA 2NPIA 3CEDA 2HSEB 4YB6A 1LNQA 3OW2R 1TL1A 4RW6A 2WBRA 4F4KA 4OJGA 1Q95G 3CVKA 4X64J 4QW9A 1U48A 2V94A 2B6AA 2ASYA 2V69A 4AD6A 3ZZOA 2LFVA 2CQ1A 1HFEL 1H73A 3QGIA 4C3MA 1RTDA 4FNIA 3MMCB 1NU4A 4RNFA 2VPYB 3OBIA 2VDHA 3TQ1A 1S0NA 4MFBB 5L1JA 4PKDB 4ENOA 3B4MA 3ZTSA 5AJ3F 3OUYB 3PYDA 3MF5A 2BX6A 4IO1A 3ZZPA 5HQMA 4PG7A 3QRRA 2B4VA 2F4FA 3MM6A 1RB0A 3H4BA 2JL9A 2XYHB 3RZAA 1IR0A 1HBMA 2LMIA 3FCWA 3T9NA 1YJRA 4O4RA 3VR1A 5AE2A 3NS7B 2DR9A 3UR3C 1IUJA 3BBFA 1U1LA 3QSIA 2HQFA 1UPPA 1WKKA 1VIOA 4TY8B 4Y6IA 5DM6Q 4ECRA 1HWUA 5IQQA 3D3BJ 1F2GA 2B7CB 4LSZB 3KHLA 5LMUJ 2AJ2A 1YZ7A 4F26A 5BXIA 2HLUA 3GR1A 3K5NA 4TY9A 1OQ6A 2CNOB 3QT6A 5D78A 2W24A 3NNAA 1S6PB 4C7QA 4O4GA 5IM0B 3QRQA 4HT5A 2VFRA 4RW8B 4A8OA 2C3UA 4JI5J 3C2PA 3E2EA 3MAQA 3GFZA 3KDNA 1TMJA 3MPYA 4RW9A 5KT2A 4ECSA 4V19J 2F65A 1YGYA 3DRSB 1FDNA 2HURA 2CG8A 1O8BA 4KGVB 4OYXA 4DI6A 4DV0F 4JI4J 1RT5A 2DIVA 1S1VA 1U1PA 5HVHA 4DU7A 3C3LA 5KFQA 1ZAXA 3PW5A 1OS5A 3ISNC 2AWZA 4FYYB 1GMWD 4EI2A 4NZ6A 1VRQC 3ZTRA 1X31C 1HBNA 3OFGA 3W65A 1ULRA 3FVYA 5JJBA 4TN2A 4GO7X 3BH6B 4ICLA 1K1QA 3DLJA 1LK5A 2OMOA 3MURP 2Q1LA 1T8EA 1D9FA 1N36J 1DBDA 3HULA 3MECA 2DR6A 1HBOA 2KT3A 3NWGA 3GCWP 3TO8A 2RU9A 1C0UA 5F3TA 3G6XA 1S79A 1T3OA 2CVEA 4B9NA 3RYLA 5B0FA 5KFGA 1QAIA 3KJNB 3KWMA 2D9PA 2BZ2A 2CWXA 2EFGA 1CJTB 3SFGA 4X66J 5H1SV 4ZPWR 4WBFA 2RDJA 3OTCA 3Q8UA 4DSFA 3THPA 4F3OA 3P96A 4KBIA 3NRBA 2F9DA 3PIOQ 1WC0A 1IKVB 2FHJD 1DTQB 1EP4B 3DMJA 1F3VA 4X84A 2G4BA 4LFBF 1RBLA 3EM1A 2RIJA 3CCTA 1G7CB 4ES3A 5F8LA 2I2YA 2PA8D 4QR1A 1PAEX 3I31A 4DR3J 1SB6A 3HHLD 3BSOA 4N41A 2L41A 1A9NB 3EJMA 2CWKA 1OMSA 1VHFA 2VH7A 1KWMA 1UFLA 1GEHA 5AJ3J 3TI0A 1IM4A 2O67A 4FS1A 3DM2B 2XBPA 1XN9A 3T5JA 3KK2B 4C6AA 4DV5F 1ICEB 2B5JB 2MSSA 3M6VA 2AYBA 2OPSA 3MOJB 2DXEA 2MKCA 2YTCA 3MFIA 5G0RA 4KYZA 2JSXA 1NKCA 1H98A 1TL5A 1J5EF 2DCLA 5M2UA 3TZXA 3FKBA 2RSQA 2ZOGA 1BGXT 4QR2A 1X60A 3KLEA 1S1UA 1Y9OA 3PTWA 3KUEA 1S9FA 1LW0A 1NJIT 2O5DA 4RBUA 4ZVGA 1M5OC 3RBXA 4C8YA 2K8GA 5DETA 3KK3B 4EEYA 4GKKF 1JLQB 3OSPA 2J6SA 4QYZJ 3BSCA 3AAWB 3V6KA 2V4JB 1RCOB 1S1XB 3K5PA 4QU7A 2MLXA 2HK2A 3Q8SB 2RVJA 1NZ8A 2QC3A 1RWXB 2D1CA 3MMJA 1A7GE 1MG7A 1RQ0A 3MI7X 3R6GB 1CULB 1KHWA 4OZ3A 2A10A 3ZXWA 3C19A 3M6XA 1R43A 1IJFB 2QA2A 1GNKA 4K2JA 4YR0A 4R0EA 1BQMA 1T9VA 1WC5A 3QWUA 4GKKJ 2BE2A 5HK4A 4YDDB 1Q82T 2NXUA 1KQGB 4JV1A 3TR5A 4NLGA 3GV8B 3V81A 1PC5A 2C2KB 3DYAA 4MJKA 2MKJA 2PMHA 4GMKA 4RPFA 2VQEJ 4EBDA 3S6EA 3C6TB 3PEHA 7FDRA 2ADBA 3AHPA 3ILJA 4ZLPA 4U6PA 3HM9A 1JX4A 3LA0A 4W92B 3UVJB 2QLBB 1KP6A 3MPWA 1TL1B 2N7CA 3SSRA 1SH2A 3L3CA 3IN5A 3VALA 1UTAA 4Z37A 3AA9A 3UD4P 1RADB 2DYAA 3MCMA 2H5JB 3MEDA 1FD2A 2KRBA 4Z2XA 2GA7A 1S6QB 2ZH3A 5SUHA 5KT4A 4J9QA 4ED6A 3FSIA 1RTJA 3BF4A 3MMAA 5IC6B 5KFMA 4OHXA 2ZM6F 3SFUA 1RBAA 4F4AA 2YWWA 1F9EB 1GMVA 1SJ1A 4ED7A 3DLBA 1X0FA 4FF2A 2HFVA 4MKBA 2AEFA 4YB1P 2DRAA 2V4RA 5D0RA 4F4XA 4U8VA 5E2QA 2B4OA 2QMWA 3JSMA 2E5JA 5BYSA 3KLFB 3F73A 4KSEB 2OJ3A 2C1EB 4DR6F 4NL5A 3TUPA 4NLPA 4H4OB 3RB3A 3B4DA 2R8IA 4DX7A 5H9FK 4EZ6A 3M2VA 1KVKA 4DQPA 3R3TA 4PYDA 5ETOA 4ZCLA 2OHDA 3KJFB 1U2RA 2D3O1 3AY0A 2ZH5A 2FJXA 3MEGB 4ELTA 4MIAA 4O23A 3D9BA 3PO5A 2YKAA 4PZVA 4UT4A 2ACMA 4NPOA 3UCGA 3ONQA 2GHVC 1RU2A 2OPPB 4RBVA 3M8YA 4ZCKA 2W8KA 5GMEA 4TU8A 4IYQA 2J5AA 2UV8A 4DFJA 2GGPB 4KH1B 5K9FA 5KFYA 4FBUA 1UEUA 3MD1A 2OSQA 4PXDA 1YBUA 3W9IA 3QPIA 4OQJA 2QL5B 3N6NA 4NZ7A 3BDPA 2PIIA 3M6WA 4OI0A 2HGMA 2DNHA 3OFEA 3SMZA 4DN9A 2KZZA 2DIUA 1KEKA 2GVDA 1Y3JA 2HVEA 2COLA 3D0HE 1IWGA 4C8NA 2B4UA 1U6FA 2LXIA 1N5YB 2Y0BB 2MZRA 3KK3A 2LQBA 3NNCA 2X3DA 5B0DA 4URQU 2UVWA 1WDTA 2XMWA 4BDPA 3D66A 3GR0A 2GVZA 3SCIE 1M5HA 3M4XA 1FRLA 1FRKA 3I0SA 4B08A 4DV4J 1NJWA 3Q2TC 1GX6A 2ZNZA 3FK4A 4XAKA 5KFHA 2VQEF 2CUYA 4MYUA 2XY6A 3CCZA 4NASA 1B64A 3BJYA 2C3PA 2DNKA 1RAEB 3W9HA 1S10A 4UQGA 1VC6A 1QLNA 5FD1A 3EPGA 1T03B 4BC7A 5D6GA 4B9TA 2BOAA 3BO2A 1RWWB 1X4BA 3A8JA 1IBLF 2NXNA 3R1LA 4DV2F 2DO0A 1DARA 3G6VA 3H5YA 2J8SA 4DV3F 1RHQB 1DHMA 1N0UA 2VD3A 4M5HA 2RUSA 1S7HA 3HLUA 4FXVA 4X4UA 3N01A 4LF1A 5J2NB 3NMRA 4IG3A 3WIVA 2RHSB 3UI3A 4LFBJ 3RAXA 1HD1A 2VG5A 4RUHA 5AXNA 5BR8J 5A6WA 4LFAF 1TV6B 1YJUA 3TQEA 4P7TA 3K5MA 1VQSA 4RNNA 1QVFR 2ZZMA 3RAMA 3HZGA 4AL5A 1DY3A 4AE5A 3DLEA 3MAAA 3OR1A 3MCNA 5ETSA 4IFVB 5KT5A 1WORA 2KT5A 2EVZA 5KFNA 3H7HB 1HA1A 2GIRA 5IS2A 4B3TF 4CH7A 5J1EB 1R8HA 1SV5B 3BKTA 2UVRA 4WFAQ 3GU0A 3BYPA 4Y2CA 3Q86A 1X7VA 1LFPA 4L3KA 4A8SA 1JLEA 2NPFA 3K5OA 4V1Ak 1MSWD 2HHHJ 3OLBA 1T3NA 1N6QA 1OPZA 4DR1F 3HVTA 3NGRA 4WXWA 3T41A 4ZCMA 5F8HA 1DQAA 2L48A 4RUAA 2XLJA 4ICLB 3C8YA 2ZHOA 4YS2A 4GVBA 2BXJA 2YH0A 5JXSA 2R8HA 2D3UA 3M32B 4DG1B 1HBOB 3DGPA 2J9DE 2DPIA 1NPPA 3JTPA 1EKSA 3B6BA 4NA1A 4DPUA 2ROGA 4DJBA 1CULA 3R5GA 5MLCV 2MGZB 4DR1J 2VFSA 3CJ0A 3I4HX 4OYIA 4YHHJ 2EC2A 4F3MA 4HKQA 4ZN1A 3HFZB 4ZN3A 3KK1B 2N3LA 3FEYB 3D2WA 4JI1F 2M7SA 4OX9F 1Q79A 1T02A 2LEBA 1RT2A 3BV8A 4P75A 2OFHX 1DTTB 3C15B 4I69A 3AH6A 4OX8A 3J81U 2UVUA 2C2DA 2IY5B 1QY7A 4OJHA 2XGQA 1IQZA 2GV1A 5B0EA 3PO4A 3WX8A 2DNLA 5J1PA 3PRVA 2Q43A 3OHAA 4O3RA 4JI3F 1G1XA 3M2RB 1YLXA 3GIKA 5ETPA 4NLWA 1U8SA 1V6HA 3BSNA 1CS4A 4LF6J 5KFZA 1Y5NB 2RILA 4LF6F 3U02A 2YBVA 1FEHA 3H90A 4U67Q 2WONB 2Z2ZA 3AA8A 3AJDA 4RKUC 2OGUA 4CO5A 1BXNA 1RTIB 4ZKAA 4CTAA 1NXIA 4Q7AA 1G2EA 5THWA 3GLJA 3MM5B 2UUAF 2HHXA 5F8JA 1RWKB 1UJ6A 2D69A 2AX0A 1UPMB 3G87A 4NWBA 4WK1A 3KUGA 4C3KA 4ZK7M 2YX7A 4WZQA 1ZA1B 4FYVB 1F6TA 5EGYA 3F56A 3RU0A 4O44A 3VV2B 4RW4B 1S9GB 1IXKA 2IYGA 5KG5A 3MUVP 3V4IB 2LVWA 1FD8A 2VPXB 4NMXA 3JQJA 4K4VA 4EMDA 4N77A 4QIEA 5C5JA 4AYBD 5E3CA 4M94A 3PYGA 1UA0A 4C8LA 1UEKA 5M2RA 5KOXA 1W26A 2W4CA 2N4CA 4LSNB 3S1TA 1FE0A 2YWEA 5B0AA 3CCQS 1YIJS 3C14A 4E0DA 3R7BB 4ZIWA 1U24A 2BV3A 4A8MP 1PKUA 1Q7YT 2QLWA 3IS9B 1QM9A 3EUNA 3PW7A 1C1CA 2DGOA 1FRIA 3KJVA 2PE8A 2ASDA 1SH0A 2CKWA 2Z2MA 2J9DA 1WEZA 4WP9A 1JLBA 4W4MA 3ZTPA 4WE1A 4LF7J 3X1LB 4ED5A 5I42A 5C7PA 1B4SA 3N0VA 1JMTA 2BJDA 2V67A 2H1YA 1UL3A 3RAQA 1TUVA 2K7JA 2LEAA 5B08A 1U1RA 4ED2A 1DJ0A 3BPSP 3CIMA 1T05B 2MJUA 3LOUA 2XO7A 4FF4A 1RT6B 2HNZA 2QGFB 4RW7A 2P9EA 3OQ2A 4F4ZA 4K0KF 3PFOA 3MMAB 4LF5J 2PEHA 4AUKA 2V2QA 4DSLA 5DLFA 3TUZC 2KI2A 2FVPA 2FIUA 2W01A 3CJQA 1S99A 4J9UE 2XYGB 2ZWOA 3J7YI 3OTOF 2CPHA 1SBRA 2FHJA 3U1MA 1H2VZ 3ILOA 4LRDA 1FRMA 2DHAA 5IWAJ 5EX0A 4K0KJ 1YJ9S 5CHCB 3LF0A 1YJVA 5F9LA 4DPYA 3M1VA 4YN3B 2KH9A 4RU2A 1SQEA 4ZVOB 3CCES 2HQCA 4M5IA 4ED1A 1U49A 1MWZA 1P27B 3HX9A 4H4MB 1IQTA 1H7XA 1HD0A 1S97A 5LSRA 4AL6A 1SC6A 2QLXA 3POTA 3CCSS 2J7UA 2C3YA 2V0NA 2PSZA 1RACB 4I68A 3NL0A 4WJBA 1RTHB 4DSEA 3CCJS 3NS5A 2QL7B 3PM9A 5ITHA 1JLFA 1D1UA 2FLPA 5K20B 1CS4B 3OR1B 4FDFA 3V6DB 1N48A 1M5VC 1UWAA 1YHQS 2W2QP 1NSKL 2HS0A 2XS7A 3FRYA 2HBYB 1KTQA 1Q8IA 2DNYA 2KVQE 3UDLA 3LP2B 4ZP9A 3W5XA 2DNQA 2X3GA 2KYXA 3MPDA 3MM7A 3NEKA 2DXFA 3GYGA 3PACA 1FE4A 5FJ4A 2JC1A 4NLVA 1LWEB 4JI6F 4TLRA 2ZUGA 2DEJA 3N28A 3HT0A 2K1RA 4ILLA 3P3DA 1WG5A 5LOQA 2WSCC 1NCLA 3KLHB 4OZ5A 3TAQA 2FVQA 1N34F 3OR2B 1IKWA 3L7UA 3OFFA 3KLVA 3PKMA 4JI8J 2CZ4A 2DJWA 2V68A 1NDKA 4O0NA 4Y28C 4Y2IA 3EGWB 3PFEA 4TQSA 3CULA 1VQMS 3CCVS 2AGQA 3EMTA 3N5BA 2ERRA 5KT6A 2VF3A 4O3NA 2B7BB 3IRWP 2W9BB 5L8RC 4CCHA 3OL9A 2BEFA 2I9SA 2J7KA 3C6UA 3CB4A 3CJ5A 2LQJA 1FKOB 2GMLA 2IRUA 3IS9A 4KH0B 3U1LA 4EGLA 4HEA9 5J2PA 4P2SA 4TVAB 1VR6A 1UVIA 2MLZA 4LRAA 3FZBA 5CAAA 5H9EK 1ZTTA 4ZITA 3ELHA 4LFCF 2MGZA 4ETXA 1VQKS 2ZBPA 4LQ9A 1G3OA 4ED3A 2X1FA 1GTEA 4I1TA 1GH8A 3NGSA 2VFUA 2HHWA 3A12A 4P2FA 3C46A 1V3SA 2YKNB 3G82B 4CM0A 4ZPDA 2ZBIA 3SQOP 3GV7B 4QYRA 1CJKB 3DLLQ 1T0TV 2HWTA 2O66A 4CNZA 3ILIA 2MY8A 4ZHRA 5IFMA 3KLGB 1VLYA 1IN0A 2X1BA 4M95A 5KFLA 1TV6A 2AJ4A 3HK2A 2K2PA 3LO3A 3B54A 2V2VA 3QNWB 1PYTA 1CJTA 3CDWA 3JTNA 1EAYC 1NUEA 4CLWA 2UXCJ 3CW2C 3MM8A 2ZJPQ 4HHJA 4DR6J 2MPUA 3DXBA 3G86A 4G1QB 1JLGB 1R6VA 4UW2A 2QFJA 2GHWA 2YQ3A 3A8KA 1NSQA 4RLEA 5EUHA 4ZS6A 5L1LA 1VQ5S 4UOFA 3BM7A 4QW8A 2NZ4A 4WPAA 3VZIA 3K2YA 1QTNB 2O1PA 4PCQA 1D9DA 3CT9A 3D5MA 4HYKA 4NLDA 2J0WA 2XI3A 1HW9A 3F44A 3P45B 3HP6A 2DCUB 3FFIA 2W1BA 4M5DB 3S7RA 1JLAB 3G6YA 2BBEA 4ED8A 4W90B 5KFVA 5A6PA 4DR4J 3QYYA 4OZLA 3THTA 1JK9B 2L08A 2HZVA 2DVIA 2LQ8A 1CLFA 1PJ6A 2RDDA 2ROPA 4JBCA 4FNHA 4NEYA 1VQ4S 1X4HA 2RDIA 4JI7J 2UXDF 4QU6A 4I67A 1C1CB 2U2FA 5D0GA 2KFNA 3LP1A 3GFXA 2BMBA 3DGPB 4DF8A 4J9LA 1ZA2B 4NEZA 3QAEA 3TJ8A 5GAEU 4ZVFA 4H4KA 4DR5F 3PW2A 4K4ZA 4XDDA 1SL2A 2JVOA 4P73A 3HDSA 2E7XA 3WHIA 3ZFVA 5DRKA 1PILA 3IGVA 4RW6B 2LKZA 5CZXA 5KG7A 3HFVA 2UUCJ 3CJ8A 3FBEA 5HN0A 4OZNA 1LK7A 2HFOA 2A6MA 1GXTA 2VL1A 2Z4PA 2HHSA 4DSKA 2KZMA 3DLKB 4PWDA 4WFXA 5A2QU 3BYRA 3TW0A 2E29A 3HHLC 2KRRA 2UUAJ 4CTAB 4PG8A 2AW0A 6AT1B 4ERDA 5L1KA 4R5PA 2MKHA 2FD2A 2PEBA 3CDEA 4KQZA 5IWAF 3RRHA 3GMGA 4X4NA 4OZ0A 3WDOA 1ZAWA 4M5KA 3N6LA 1FKPB 2YNHA 2DNZA 1NSPA 4DL4A 4HI1A 2QL9B 3CSKA 4L73A 2LU1A 4YB7A 3D3CJ 4MAKA 3DN9A 3AOAA 4DQQA 2V8GA 3RUBL 1HBUA 3QO9A 2XMVA 2N7YA 2YKMB 3NGKA 5A8RA 3M8QA 3ZNUA 2VC1A 4N5SA 1L3UA 3LP2A 1DTQA 3I6PA 1VHIA 2GW8A 5IZHA 3LALA 4Y00A 1URNA 4HR2A 1TL7A 3KLFA 1FJGJ 3R1HA 1NO8A 6FD1A 5HLFA 2YQ0A 2BM0A 2K06A 1RU1A 2HBZB 3FUYA 2CNLB 4OZJA 2MQ8A 4WE1B 1FHTA 4OI6A 3EICA 4PXCA 3P5BP 3T1HJ 4CP5A 5ETNA 5D3GB 3MMBA 5L39A 2UXDJ 2FLNA 1DZ5A 2ZBRA 5D3GA 1TAUA 2HQ3A 5D0HA 3M8PB 4D3HA 1X4FA 2HRTA 4PWWA 4JI2F 3R8YA 3SEOA 4AQYJ 3UD5A 2DR7A 2FVRA 4BWJA 1BQNA 2O01C 2Z56B 4FYXB 3MTKA 5J2QB 2HGNA 2Q66A 1LWFA 4AXIA 5GADI 1PJ5A 4Y2MA 1S1TB 5A8WA 3NNHA 1TL4A 1HNZJ 2EC0A 4L72B 2WHOA 3N6MA 3JQKA 2E5LF 1KVIA 5C42B 3PZPA 1YQHA 1C4CA 4LBPA 1VQNS 1W2IA 3OVAA 3MOZA 4RW7B 4J9KA 4UTGA 4G1IA 3CJ4A 1FKOA 2VOOA 2P8IA 4IH7A 3VAMA 2M70A 3D68A 1VK8A 2EFOA 2N4DA 4J91A 2YPZA 3KMSA 2V8VA 3WQPA 1NK8A 2HW3A 2IAJA 4OLPA 4GKJF 4PRFA 4KV8B 4NI2B 1K8AT 3J80Y 3D28A 1CQMA 2W7AA 3IFEA 3N9UC 2EI5A 3OLAA 4PEOA 5KG4A 3A8IA 3AD8C 2WVEA 3M30A 2ILYA 2LXFA 4OX6A 1EZZB 2CPEA 4M5NA 4F50A 1KKHA 3A4TA 1FK9A 3ISZA 3EZ5A 1WOPA 1KS2A 2F8MA 2G1HA 2V6AA 3MCOA 1RTJB 4DEZA 4UUXA 1RAIB 2GZOA 4MK7A 2JFKA 4B9VA 2ZDPA 1PG5B 3TWZA 2DNPA 1UAWA 4NCGA 2Q6CA 1RTHA 3TJAA 1O51A 2CNNB 2RF2A 1Q0NA 4Q43A 2IM1A 3BBBA 1XR7A 1TKTA 5HVGA 5D8HB 4ELUA 3M9OB 3W60A 4CO2A 1JLGA 4M5JA 5GAHI 4HLBA 2G2ZA 3W7BA 2CA9A 4X4RA 1X5TA 4I7FB 4O3QA 5K8OA 2N82B 5GADU 1DRZA 3MZIA 2R8KA 3HD2A 1Z4UA 5IT9Y 2H65B 5GAHU 5AXKA 4EYIB 4KGZB 1X4EA 2R8JA 4YOEA 1DFDA 2GC8A 4WK3A 3LAMA 1HIYA 1AB8A 1FFGB 2OKQA 1TL3A 3F0NA 3NOGA 2V2KA 4NLTA 4MKAA 1K1SA 3FNNA 3SXLA 4C8KA 2NQPA 1BQMB 2MZSA 2ZJRQ 4QIFA 2Q6BA 2RQMA 5AXMA 3U7JA 4OHZA 1PJ7A 3IM8A 2BQ3A 4N56A 2BM1A 2PGCA 2GGPA 3QFHA 5HMWA 3VAHA 5HANA 1QVGR 4NXMJ 3QSYB 2ZBCA 5J2MB 4ITSA 5DQHA 4ANDA 3RJMB 3TYTA 2YQ1A 4CLSA 3EPIA 4LF7F 3CD6S 2FJBB 4KO0A 1VQ8S 4OHVA 1TZ0A 3A13A 1XR6A 3NGUA 4BWMA 2OPQA 1JXEA 3LP1B 2X1AA 1GAOA 1V5VA 3JSRA 3TEGA 3I32A 2OEJA 1HI0P 4ZDNA 3DC2A 1LWXA 2EBGA 5I3UB 2EPIA 1I1GA
chains in the Genus database with same CATH topology
5KG2A 1P9QC 4NLUA 2KM8B 2M52A 1ZZFA 3CE8A 3DRYA 3I5CA 4I2PB 4OI2A 3UDCA 3VAGA 3VAKA 2XGPA 5D4OA 2VFVA 3DOLA 1E6VB 2MQMA 4N8NA 4IR1A 1NH8A 3QWPA 1LWCB 4NYPA 3T1AA 3V6JA 1ZOTA 3BR9A 2JOQA 1WG4A 1U1KA 2MKIA 3KK1A 3JSMB 4F2RA 2LU2A 1AFIA 2FJVA 1SUQA 3B82A 2HMIA 4CO1A 1UJ4A 4CH1A 2R7WA 1M0SA 3L09A 3JAMY 4QWBA 3CDAA 2CG4A 3SCJE 3IGNA 2DB1A 1R8CA 2DNMA 4J9PA 4A8QA 2ACYA 5F3ZA 1RAJA 4FF3A 2IC3A 1TK5A 5KFFA 4LSLA 4HI2A 2VUGA 3GYNA 1LW2A 3QMQA 4RNHA 5HLFB 3HKZD 2VPZB 4AL7A 3HPOA 4C8MA 4IG3B 1L3VA 2B9YA 2J7WA 3MCSA 4PPZA 4NCBA 2HVZA 1HWJA 2LYVA 4RWWA 5JVHQ 2QZ8A 4YY3F 4QZVB 4I6YA 3UR0A 5CYMB 3RRGA 4I7FA 4L3NA 3MAHA 4NRTA 4M8LA 3OXGA 3T6BA 5IQ6A 5E33A 3PR4A 4F4YA 4DMZA 2FVCA 1H0HB 3VTIA 4CH0S 2QA4S 1H6KX 2CZVC 4X4SA 5HL7Q 1NK5A 5T41A 1S72S 4BS2A 2RQ4A 2VBXA 1H2UX 1RJJA 2YH1A 1UWBA 1RA7A 3V5RA 2RD5C 3T5HA 3KLIB 2JH3A 2XB2D 3OV7A 3CJ2A 4LT6A 5HO4A 5DO2A 4DF4A 2A2CA 2KB2A 2QSWA 3QJPA 5A0YA 5KFEA 4YHHF 3RR7A 2OPQB 4PXBA 1VRTA 4QBUA 5D4LA 3RBDA 5HBMB 1VBXA 4OV1A 1Y3KA 2CQCA 3D54A 2M4MA 5CZVA 5DG7A 1HMVA 4F3QA 2XLIA 1OO0B 5L9XA 4ECTA 1KOHA 1ZYQA 4LIWA 3AQPA 3IRXB 2B6AB 4IFYB 2F7VA 2DTJA 4DL0C 3IWLA 1QSSA 2C3OA 5I3PA 1SJ4P 1LKZA 5BR8F 2ZJQQ 4F4WA 5EWEA 2WONA 4RX6A 2CRLA 2RMLA 1F60B 3BGLA 4OZ1A 1UVNA 1MWYA 3M2RA 4IQMA 1FO1A 2PFFB 1Y5LB 1TKXB 3DLEB 4UUWA 4F67A 5ADZA 7FD1A 1FT8A 3GYXB 2R2SA 3W2VB 1WG1A 5KFIA 2XCAA 1FERA 4EYHB 2NYIA 2QT7A 1X9WA 1C1BA 3QIDA 2RRBA 2KHCA 2HQIA 2VG6A 1UVMA 2RRNA 3TP2A 4B3SF 3CCLS 2CQBA 1JNZB 1NNDA 3K5NA 1HWKA 1TVRB 5D4PA 1N88A 2JC0A 2MYFA 2AGOA 1QVGR 1SJFA 3THVA 2UXBF 2GCFA 2VFTA 1HYSA 1DAXA 4ZPAA 1N4LA 2OPRB 4RW9B 3RW6A 1U09A 4U9RA 1SL1A 4F02A 1NK4A 5GAGU 4DR4F 1RT2B 3OXLA 3I0SB 5CYMA 3X3UA 2FLOA 2E5HA 3OR2A 5GAGI 1AW0A 3US5A 3KJVB 1VQ7S 1YJNS 2DD8S 3SDEB 2W7PA 2P6SA 3DRPB 5K8PA 3BN7A 1U6ZA 4M63A 5B0GA 1RYSA 2DO4A 4ZOSA 4ECYA 2KG0A 3O44A 1KRPA 1Q1KA 1MU2A 3CD5A 3FRZA 2JWNA 1JJ4A 2DGUA 2IRYA 1VRUB 5E41A 3UFCX 1UFWA 3DRRA 2W4DA 1FJ7A 4R25A 1TKTB 2OMLA 2V9WA 1S0OA 4OL8A 3TVYA 3IR5B 3MECB 1VMBA 3FEXB 2BQUA 2YKOA 4TXSA 1N33F 2CQDA 5EN1A 5M2PA 4DHVA 1QJHA 3V4IA 5DQIA 1UKUA 3NGDA 2VG7B 3DI6B 2HYIB 2RU3A 1H7WA 2CDQA 4K4SA 2CQ0A 2XS2A 5U47A 4F25A 3RW7A 2HHTA 1S1WB 3FMBA 2L9WA 4CT8A 2HNYB 3ENVA 3LGNA 4DSIA 1LQ9A 1X8DA 1WNEA 3VQSA 2YKPA 4G6VB 4Q8FA 2AYMA 2VZ9A 1WEYA 1Z1ZA 3QGGA 4O4GB 5LJ3Y 3MXHP 4TY8A 2JJ4D 2KKHA 4B3OA 2XNRA 5KT3A 3W2VA 2LXUA 1S76D 2GHPA 4ZPCA 4CO3A 2LCWA 2VC0A 4IKAA 2FC8A 3PVXA 3I5BA 2EWHA 5I3UA 2ZC3A 4KO0B 2C22A 1ZTWA 2XULA 2KJWA 3DNCA 3HVAA 2G9OA 5IT0A 4QCLA 3PX0A 4PPDA 4K4UA 1VIXA 2K1RB 2HLTA 4QPTA 5CCMA 2IYIA 2CPIA 2FGCA 4LQ3A 1VJWA 1YI2S 2Z8QA 4CI0B 2R7QA 4KHPF 1YBAA 1HNZF 4PWDB 1FJEB 4N76A 3UCZP 2E66A 5HI7A 4HVZA 4ES1A 3UCUP 4DWIA 3CCMS 4K50A 4Q5VA 3BDEA 1JIHA 1NAQA 2CPDA 4A47A 4ALZA 2IMWP 2JRSA 2RT3A 2XI2A 4HTIA 4X64F 2HMIB 2UUWA 3VF0B 1WD6A 4DV4F 3ZZ0A 4DL2A 1WTBA 1I94F 2JEFA 1D3WA 1CG2A 1YJTA 2UUBF 2I0XA 4J9NA 3K59A 1AXQA 1L5UA 1HWIA 1WHWA 4Y2KA 2EK6A 3PKYA 2GJ2A 1R27B 1MROB 2CQIA 1CSJA 1N5VA 2MHEA 3CO9A 4ID5A 2W7OA 1X9SA 2J6UA 2QEXS 4Y65A 5DQGA 4DFKA 2OD6A 2HWIA 5HQ8A 1S6PA 5G0RB 2E9RX 1FA0A 2L9DA 2QMXA 4K4XA 3UD3P 2EG2A 4DN0A 3LAKA 1F5AA 4Q2LA 4WFNQ 4EBCA 1Y7PA 2RH3A 2ZKTA 4X4VA 2DHXA 1JLBB 1QSYA 4Q45A 4XIUA 4CO4A 4JI5F 3T19A 1QUPA 2KYZA 1FTCA 2CJKA 3B8HA 3TAMB 4B02A 1XC9A 1IBKF 1ROFA 1M5PC 1RT4A 4TLQA 5EHHA 1IKYB 2P9CA 2EFPA 2IRXA 3MDFA 2ZE2A 3J81Y 1HBNB 4B9LA 4R8UB 2EBEA 2V5HG 2GQQA 5KOWA 2XY7A 2I38A 1TK0A 2FDNA 1S1XA 5CYQB 2DISA 5C24A 1HNVA 5HBMA 1D9AA 1SH3A 4A46A 5AE1A 2DH9A 4ILMA 1OSDA 4NA3A 3HT3A 3PNIA 2ZH9A 4ELVA 3C6TA 1VC5A 5A2QY 4IQXA 2IJNA 2D74B 1KD1T 1VRTB 2XSJA 1HWLA 1B0PA 1O0PA 4KFBB 3SDEA 4ECVA 2A2DA 3DLGB 2BANB 3AQOA 3M2UA 4C3LA 2APOA 3JYTA 4R0JA 2E1MC 2HRUA 3G9CA 4EBEA 1HPZA 3I56S 2E1CA 2NREA 2FJWA 4OFZA 1W25A 3KKFA 2HZCA 5DJBA 2AJQA 2VB6A 4KV8A 4EWTA 4X66F 4FP9A 3PRBA 2B5JA 4N8OA 4KT0C 5KTQA 3IA0A 3CMAS 4O3SA 3GIIA 1BLUA 4KHMA 3M8RA 3K8WA 1RKIA 4WTYA 1VS3A 2BUNA 4R5PB 4UY85 4ED0A 5KFWA 3OL6A 3LGMA 4C0HA 5FLXY 2L3MA 3H20A 3CCWA 4RNMA 2Z2LA 1P8GA 5D77A 3VWSA 3HHDA 2IA6A 2DK2A 3O6QA 2GQCA 3PJXA 3IAS9 5A8KB 4B3RF 1NHUA 3D1OA 1B7FA 2LDYA 2VBYA 1RGVA 3KNGA 4YB5A 2B0GA 2B9WA 2EFVA 4C97A 4HTJA 4USJC 3BQ0A 3GFHA 1HNIB 2J76E 1FCAA 1P6TA 2M88A 1NJZA 2YX1A 3N4WA 2ZFHA 3G8SA 5CQGA 2OH2A 3H59A 4JI4F 2HVHA 3UNGC 5T7LB 2B3TB 3OTEA 5LXRA 3TARA 3K57A 3TANA 1LWFB 1CVJA 2YX4A 2ZH2A 1XNQF 1Y0HA 3FGVA 3SI8A 2HPUA 2FC9A 2M8HA 2V4QA 3KOAA 1HQUB 2CPXA 2MKSA 2RKIB 5E5NA 1JWWA 4YQWA 3C66A 1L3KA 2PA3A 2H5EA 1FTRA 2G13A 2D3OR 2NSBA 3CUNA 2BABA 2WAQD 2R2RA 2V8DA 5F8IA 2IAJB 2ZC4A 1K73T 3OVBA 1LFWA 2ZH6A 1RWUA 1BY9A 5GMKa 3IO1A 2XS5A 4G1PA 3DCAA 2RE1A 2AD9A 2XHWA 3BQ1A 1N0VC 1FESA 1MMLA 3M8QB 3NLCA 5KFCA 3RTVA 1UJ5A 3DHWC 4ID5B 2IM2A 2VG7A 3DI6A 1ZM9A 4C11A 1VOMA 4WFBQ 2MSTA 2MHNA 4LF4F 3MUTP 1AUDA 2JEIA 1F9FA 3FSYA 1Q4RA 5K8MA 2R7UA 3MM5A 4Q2MA 5IT4A 3I82A 4HDHA 3MUMP 4K4TA 2OPPA 2HNDA 1HQEA 5H9FJ 3CGIA 2QA1A 5FDLA 3TVZA 1UW4A 2MQQA 3BSAA 5J1EA 2UVVA 3DFEA 4Y34A 4DQRA 2CPZA 2FHOB 4DS5A 3PIPQ 3ZZYA 3CCRS 1QAJA 4K4YA 2LQ5A 4MKYA 1S1TA 3GV5B 5KG6A 1ZETA 4FN5A 2KXNB 2KXHA 3TAMA 1SI9A 3KFWX 4U7UK 3D0IE 4PUOB 3SSSA 3PW0A 1ELOA 2P9GA 4NMLA 2HRYA 4LVOP 4DL3A 1DQ8A 4DOZA 2FB0A 2FUG9 3G4SS 1Y4ZB 1SL0A 1VQ9S 4KTQA 3E01B 2ADCA 1FNOA 1RT7B 5DDOC 2FPHX 4DL5A 2D41A 4DG1A 4FZVA 2KO1A 5KFPA 3MGJA 4DL6A 2K7KA 2BACA 4PG6A 2E7WA 4NRUA 4WKYA 5T7LA 4UY8T 1XEZA 1XNRF 3GQCA 4DR2F 5LJ5Y 3SV3A 3HXMA 2B43A 4FS2A 1M5SA 2DHGA 1OIAA 1D0EA 1WEXA 2UUCF 3VAJA 1YVFA 3DLGA 4NLXA 2A1BA 2AJ1A 2Y1IA 3QJLA 2Y1JA 3TVKA 3HVWA 4K2XA 1E6YA 1CEZA 5HP1A 3OL8A 5GAEI 4V19X 2ASLA 2HHQA 1PC4A 4DV7F 4MTPA 1GT8A 1JJHA 2MKKA 4A8YA 2JLEA 2KJVA 1LXNA 4QIVA 2DNOA 1FRJA 4IFVA 2XEXA 1NZAA 4KHRA 4HH0A 2HS4A 2QA4G 3QGPA 3CC2S 2IVFB 3O5TB 4IOAQ 2M3DA 3F41A 3OUYA 3R5CA 4IFYA 3R5DA 1L3TA 5GVQA 1Q8BA 4I0WA 3HKWA 2UP1A 2MXYA 1FXDA 5D3GB 3FCHA 3M8SA 2RUGA 2MZ1A 4KGKA 2P6TA 3T5KA 4OHYA 2ROEA 5BJRA 2MB0B 2CPYA 4ECWA 5KFDA 4LSLB 4DS4A 3DM2A 4TU7A 5J2QA 1JKHA 2Y0SD 3DOKB 2ALZA 1SKWA 2ZD1B 1HI1A 4JYAF 1P1LA 4UQTA 2QE5A 1Z2ZA 5E0OA 1YITS 2I1RA 4K5RA 1S1VB 4OI1A 3GE9A 1PGZA 1C1BB 1HL6A 1UVJA 2WB4A 1ZH5A 1FDDA 2XSJB 4FVMA 3Q22A 3FMWA 1X0PA 2LQ9A 1WELA 3LH2S 2BW2A 5E7OB 2VQFF 2E1RA 2J9CA 4OJ3A 4IRDA 4A8KA 4AXJA 1IBMF 4I56A 4A4JA 2J0QD 2JEJA 4I6WA 4BCAA 1HHTP 3H2UB 1C0UB 3BGUA 3VCDA 2E44A 2X51A 1NRKA 3Q0AA 4KFBA 3CCUS 2OTLS 4KRWA 2CJBA 3I0RB 1S6UA 4ECUA 1WF1A 3IC1A 1REVB 2GMHA 5HMXA 4DBQA 4DQSA 1RTDB 1KN6A 3OXFA 1RP5A 1QAYA 1RTIA 2KFZA 4FXDA 1U6BA 3ENQA 3CD7A 3I9ZA 4H4MA 2JVRA 2YNIB 2N3OA 1RDRA 1Y00A 1O5JA 4JV2A 3M1VB 3SCLE 1OPIA 1U1OA 4CO0A 3LANA 1L3SA 1HMVB 3W3SA 2NUHA 4C11B 5L38A 4PXEA 4DV2F 2RQKA 1TQLA 2VKRA 4IOBA 1FDAA 2WB1D 1S9EB 3I96A 1TKZB 4H4KC 1ZPVA 1Z2LA 1RK8A 4RW8A 4IR9A 4H54A 3WZ0A 3PR5B 3IWXA 3KK2A 1VFJA 1LWEA 1Q16B 2VV5A 4G1QA 5DS7A 5L1IA 2EW9A 2OPSB 3I5AA 2GMJA 5I42B 1VBZA 2OFGX 1TKXA 3CD0A 2QYCA 2OD4A 1FVSA 1U4BA 4QJVA 4HH1A 2VA2A 3H2LA 1QE1B 1HR0F 1U26A 2OO4A 2VBZA 4E98A 2JHEA 4JOUA 4JV5F 1RT7A 3RBEA 1TK8A 2ZOMA 4QWCA 2ZD1A 4XO0A 4DL7A 2BVZA 4RUCA 4NLOA 1TKDA 2GQ2A 2IM3A 2MZJA 5KFBA 2U1AA 4ZPBA 1C4AA 2RKIA 3O1LA 4C9DA 3H5XA 3NMAA 1SJRA 2WOMA 2AGPA 5F0WA 3DU6A 1KLNA 4XPEA 2R4FA 2ZH7A 1WWHA 2HHUA 1YSJA 1NHVA 4MIBA 4YR3A 2POKA 1S0VA 5KT7A 3U1NA 1HW8A 1CC8A 3TUJC 1LXJA 4ATNA 1Q7LB 3HHKA 2CQ2A 5KFUA 2XZWA 1R6YA 1V3RA 1YRTA 3J7Z5 2KTQA 4D3GA 2DGXA 5DDPC 1TFWA 2HFZA 4FYDA 4QPXA 1E6YB 3KHHA 1S4FA 1VI7A 2AF6A 2XG8A 2DBBA 1XMOF 3OJSA 1KLMA 2LA6A 3HI9A 4C8OA 3S8SA 2HS3A 1Q78A 2X1GA 3HHLB 3HFKA 1RI7A 1S1UB 1QUVA 1XERA 4JUZA 1X9MA 4H4OA 1FRXA 5J1NA 1TVRA 3NAIA 2WRMA 3NG8A 1NB7A 2I8EA 2G0CA 2E5IA 3B78A 3Q23A 2WK4A 3L7PA 2ZOFA 3EXCX 1S1WA 2BA9A 1C0TB 2F3JA 3BGRB 5DDRC 1MNEA 3DOKA 2BE2B 4EO6A 5K5MA 5C25A 1N56A 2A18A 4PUOA 2C2RA 1DURA 5KFKA 1PSDA 4HT7A 2J9EA 3GIJA 5DLGA 2OIHA 2M9KA 1MU2B 1GXUA 3D1HA 1SKRA 3DDKA 4RWXA 3M8PA 2ZH8A 3V4MA 3V81B 4NXNF 5KFXA 1SJ3P 1M1KT 1KQSR 1T95A 1FRHA 3MR3A 3GG1A 5C24B 4J9SA 4LVNP 1JNRB 2KHDA 3OTBA 5CXTA 2VONA 2O3DA 2PO4A 1YWXA 1WTFA 3IR6B 1NH7A 2IJFA 4PQUB 1ZBTA 2XCPA 3OTDA 1U2FA 4Y3CA 3MM9B 1AFJA 4K4WA 2XMTA 1W2BR 1RKJA 5J2NA 3QIPA 3J7ZT 3DHXA 2XMUA 3K5LA 5T14A 4P7VA 2KU7A 2E5GA 3HJFA 4WU2A 4G3IA 3E3XA 1WHVA 4DR3F 2ZH1A 2WSFC 3HO1A 4WF9Q 2WSEC 3I87A 4ES2A 2EFNA 4B3OB 2W9AA 2MJNA 3TX8A 1KR4A 2HHVA 1FK9B 5KG0A 3NBPB 1FJCA 2LA4A 4ZP6A 3FJ2A 3QJJA 4F8RA 3IG1B 1XR5A 2JEGA 1A6LA 4J5OA 2VODA 1VQLS 2IVYA 2CJAA 5F41A 1MROA 3MEEB 1TFYA 3ITHA 3G6ES 4E8UA 1JLEB 5L9NA 2R7SA 3EZUA 4FXWA 5I4MA 3CTRA 4EO8A 1TAQA 5EDWA 1S9GA 5JVGQ 2K3KA 4WFZA 4PG4A 5K8NA 5DGAA 3A1YG <