4USHA

Nitrogen regulatory protein pii from chlamydomonas reinhardtii in unliganded state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
103
Chain Sequence
SIQCDLSAFPGVKFFRIEAIFRPWRLPFVIDTLSKYGIRGLTNTPVKGVNLVDKEKLDIVVSRAQVDAVVRLVAASAYTGEIGDGKIFVHPVAEVVRIRTAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Signaling protein
molecule keywords NITROGEN REGULATORY PROTEIN PII
total genus 24
structure length 103
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ushA00
2XG8A 4WK3A 4YB6A 4NYPA 4RX6A 1PILA 2O66A 4E98A 3GSDA 4CO4A 4Y6IA 3T9ZA 3OPKA 3MHYA 4R25A 2J9CA 4CO2A 2EG1A 2NS1B 3O5TB 4WK1A 2J9EA 3NCQA 2E66A 2J9DA 5D4NA 1HWUA 3AA9A 4CNZA 1GNKA 3AH6A 4USIA 2ZFHA 5D4OA 4ZK7M 2GW8A 1V3RA 1O5JA 1J2VA 2NUUG 2ZOMA 4OZNA 4C3KA 5D4PA 3HLUA 1H3DA 1V3SA 4YB5A 3NCRA 3TA0A 1NH7A 3TA2A 1VFJA 3DFEA 1O51A 2Z0GA 4USHA 4C3LA 1UFLA 3BZQA 4IYQA 1UKUA 1QY7A 4OZJA 3O8WA 2PIIA 4OZLA 3TA1A 1XK8A 2GX8A 3CE8A 3X3UA 2XULA 1UL3A 2GNKA 4USJC 1Q1KA 3AHPA 1P1LA 3N5BA 4D3GA 5L9NA 4Y65A 3M05A 2XZWA 4RLEA 1OSCA 4CO5A 4AFFA 5DRKA 3NCPA 2V5HG 4CO1A 2EG2A 1VHFA 2O67A 4RWXA 2JJ4D 3LF0A 4RWWA 5D4LA 1UMJA 1NH8A 4CNYA 4NYOA 4CO0A 1NZAA 1NAQA 3AA8A 3L7PA 4YB7A 1V6HA 2RD5C 2VD3A 1KR4A 1V9OA 2CZ4A 2J9DE 2XBPA 2DCLA 4CO3A 5DS7A 4C3MA 2NUHA 4D3HA
chains in the Genus database with same CATH superfamily
2GIRA 3V2UC 3TAPA 2U2FA 1SV5B 2VA3A 1S49A 4PRFA 3WX4A 5KFFA 1RAJA 1WC5A 1C0TB 3C14B 1YSJA 3MM8B 4H4OB 3IRXB 4ZJLA 3W8PA 3QZ8A 1JLQA 4OZ0A 3UDCA 1UEKA 2JH3A 3JSMB 2ZM6F 3V4IA 3TVYA 2KM8B 2ZH6A 2OGUA 2HNZB 2XMJA 4Y6IA 1MLAA 4CO4A 4OI1A 2VODA 2B8PA 2H3EB 3OR2B 2QIFA 3EDRB 2CVEA 5IV3A 3BQ1A 1RWOB 1CVJA 4LF7F 4ILMA 4I67A 5KT6A 2OSQA 4BC7A 1N34F 4R0JA 3QJLA 2KT5A 1VLOA 3PKMA 2KHCA 3MEEA 1UJ4A 1JLGB 2VFSA 1UP1A 1N52B 2CQ0A 1URRA 2CQ2A 3EPGA 1GMWA 1HBMA 4USIA 2J7KA 3C3LA 2GW8A 4GVBA 4ENOA 1SJ3P 5FLXU 3UVJA 3PEHA 1J2VA 4F3OA 1GH8A 3H2UB 3JYTA 2AGQA 1XC9A 4IQXA 1RXOB 4FBTA 4HYKA 3UI3A 1UZHA 5E41A 3PR5B 4ZP6A 4QWAA 1ULRA 3RRGA 4YB5A 5HP1A 2RIJA 3E01B 4IO1A 1IKWA 1FA0A 5KT4A 1K47A 3DLKA 1ZZFA 3ENWA 3EZOA 4LF2A 2WVBA 1BWVA 3HHDA 4ZVTB 3NXZA 3UN2A 5C7PA 3OUYB 2FHJA 3G6ES 3F56A 1UW9A 3DXBA 3NS7B 4B3OB 4DQSA 4NLSA 2D9OA 4MIWA 4KE5A 1S0OA 4IDKB 2H4YB 4WZMA 6FD1A 1RABB 3IAS9 5ETKA 3O8WA 3EM1A 4TY8A 4P10A 2GCFA 1FNMA 2A3JA 1S12A 2MJUA 5DETA 3K57A 1ITPA 2XHWA 4OZLA 1NM2A 5D77A 2OFHX 1IR1A 3B54A 2MLYA 2DKOB 4EBCA 4QR0A 4DI6A 1HHSA 1VIOA 1U0SA 4ECSA 3NBPA 2V0NA 1UPMB 3Q0AA 1TK0A 3RUBL 2Q6CA 2GNKA 1S9EB 3HVTB 3UD4P 1P1LA 2COLA 3KXDA 2MZQA 3N5BA 4U7UK 4YEAA 3VR1A 4C6AA 2XHCA 5J1EA 2B56A 3M7VA 1NJIT 2PFDA 1JX4A 1RLDA 5A0YA 2M0GB 2E5JA 2BUNA 3TWZA 1O8BA 5A8KA 3CTRA 3FBEA 4NWBA 4DV3J 3TANA 1R0AA 2F1FA 3R5AA 5F0WA 2OMOA 4ZVOB 3LOUA 3GV5B 1U1PA 1PCAA 3G8SA 2UXBJ 1MROB 4MK7A 3OTEA 1F3VA 2WONA 4F0MA 3I82A 4I7FA 5ETQA 5AXNA 5KFOA 5J2QB 1NSPA 2ZUGA 3FQKA 4RWWA 4IOAQ 3BGLA 1DFDA 2AJ1A 1RAIB 2VH7A 1YJ7A 3HHEA 1I94F 1WEYA 2ZHBA 2GIQA 4IOBA 2DHXA 5KFDA 3OFEA 3EGZA 1VRTA 3W7BA 2OFGX 3JYTB 4DR2J 1XMQF 1BGXT 3KJQB 2NXEA 3D4JA 1X5OA 2DEJA 3KDOA 4ANEA 5HQ8A 2EI5A 2PEBA 3C16B 4FF3A 4TU7A 2VD3A 5HVGA 5K8NA 1NK6A 1N36J 4RUCA 3R97A 4WE1B 5HO4A 3EZ5A 2MLXA 4G1QB 3JTNA 2CZ4A 4K59A 4OHWA 1S99A 3RAMA 1RT3B 3T1YJ 4LJMA 3QYYA 2HVDA 2NR0A 4ED4A 4PAAA 2EC0A 1JLAB 4JI3F 5CYMB 4B3SJ 4FYYB 4BBYA 5L1LA 2P9CA 1HLWA 2IM0A 4Y2CA 3VGTA 3MGJA 2DRDA 1FCAA 2NCKL 2IDEA 4QCLA 3MI7X 4K4SA 1TKZA 1U09A 2XS7A 1ZOTA 1IN0A 4QJVA 5IT9Y 1WHVA 4ZN1A 3PFEA 2HNZA 2GIFA 3MTKA 4LT6A 4HDGA 5CYMA 1VQ4S 4E98A 2UXDJ 3LGNA 3PW4A 2B5JA 3CDUA 1S4EA 1YGYA 2DEIA 3NGRA 4M5NA 4OI0A 1HNZF 3BGFA 2ZUAA 3NGDA 5LM7E 3LQVA 4NI2A 3BEGB 1XJWB 1YJVA 2R8KA 4A8SA 2OJ3A 4A8MP 4B3TJ 4J9MA 1NPPA 2ZC3A 4DV4J 3HHKA 5KT7A 4WFBQ 2NYIA 3DMJB 1ZS6A 1W2BR 4ED5A 4U8YA 5E3AA 4MK8A 4EFAC 4NLYA 1N0UA 4U95A 1RHMB 3L7OA 2VJVA 2V4QA 3I6PA 2DK2A 4I0WA 4P52A 3OTOF 1DRZA 3OVAA 3CCRS 3BM7A 5IC4B 2MLZA 1BXNA 3R5GA 4X65F 2UVUA 1T9XA 4B9UA 4RBUA 4OYXA 2NPIA 2VG7A 5FIIA 2Z56B 3SIPB 5E7OB 4WF9Q 3ZTOA 4PWWA 3OW2R 1D9FA 2AGPA 2R7XA 3I4HX 1IKWB 2Y3YA 4QYZK 3CNQP 2CQGA 5KT2A 1HYSA 2R7WA 2FIUA 1QVGR 1YJNS 1REGX 3NNAA 1RGVA 4OYWA 4DBQA 1BY9A 3O44A 1R3NA 1WF1A 2HG4A 4XPEA 4ID8A 2FJVA 5F8JA 3BZQA 4WP3A 4B9SA 2VDIA 4MK9A 1YJ9S 1LNQA 1UKUA 1PBUA 2BZ2A 5GAHI 2JZ5A 3V81A 2MEWA 5H9EJ 1RWXB 2AGOA 2V4JA 4DL2A 1S1UB 1X9MA 1LEOA 3MMJA 1RBAA 3A4TA 1RWNB 3CCSS 4LFCJ 2LFVA 2D3OR 1HBMB 4IR9A 3VAMA 4KV8A 2YQ3A 2AX1A 2R2RA 4KPYA 1JIHA 4UZBA 4U6PA 5CD4H 1VQPS 3FEYB 5LMNF 3MZIA 3VAFA 1UETA 1SJQA 1VOMA 5HSPA 4OYZA 4NLRA 5HVHA 4RU2A 4WYWA 5LT5A 1RKIA 4L73A 2Y1RI 4PQUB 1N5QA 2CPFA 4BLGA 3BN7A 2GHPA 2QLBB 3KNAA 4K0KJ 2CJYB 5D0EA 3AODA 5F0UA 4F4AA 4DX8H 2VQFJ 4QWEA 1WNEA 2KB2A 3FC9A 2HNDB 4DV6J 1IWGA 4GRSA 4MIAA 2A18A 3SI8A 2CNKB 1QTNB 2DGWA 2RRNA 3LPYA 4AUKA 4DL7A 3LO3A 3SSRA 2O67A 3D67A 3VCDA 4CZCA 2JDJA 3VGSA 1XNRF 1A9NB 2PA8D 5D4LA 5A2QU 2FC8A 1Q4RA 1QDUB 4I6WA 2FLNA 1NH8A 3TRGA 3JS9A 1CC7A 1NDCA 3M2RB 4NLUA 2LA4A 2I8EA 2LQ8A 2GAHC 4NYOA 3KLFB 5KG7A 4ZVGA 4GO7X 3E8OA 2C28A 5C42B 3PO5A 1S6QA 4ELTA 1Q78A 2GVDB 5I3UA 4ZMMA 1F5CA 1ZA2B 2F4VJ 2UU9J 3NGUA 3IWLA 3G86A 1HYSB 1FRIA 3MOZA 2J9DE 4ANCA 1HPZB 2YNFB 1JK9B 2HNDA 1E6VB 2DO0A 2C2KB 4OJGA 1P27B 3WC0A 4B08A 1IQTA 3EPIA 1YRTA 2KHDA 3BBCA 4ZDNA 5IM0B 5DM7Q 3Q8YA 5I4MA 1SVDA 2RDDA 4FYVB 1APSA 1ZAVA 4BCAA 1OYEA 1S7IA 2P6SA 4ZP8A 3CXCR 5IZHA 2UV8G 1SI9A 1SV5A 4J37A 5E3QA 3PIOQ 1HWKA 2MZTA 5G0RA 2ASYA 4WFAQ 3P4UB 1XNQJ 1FRHA 3BSCA 3CO0P 3MAAA 1VQNS 2EWHA 1LV5A 3D66A 1H2UX 3JSRA 1AUSL 1VS3A 1WHXA 3PDNA 3Q8RB 3FK4A 1L3TA 2DY9A 2HSEB 4KYZA 4YUDA 4KAIA 2DD8S 2L9NA 1RTJA 5CA5A 3FEXB 2YH0A 2D69A 3KKFA 4PEOA 5EHHA 2XGPA 2OPRB 4KJIA 1RA7A 3R27A 2BACA 3J7YI 3LAKA 4E2FB 1GNKA 3AH6A 2HGLA 1XQIA 3LGHA 2R7QA 1S1XA 2W4DA 1HNIB 4L72B 2BW2A 3AJDA 5GVQA 1X4DA 1J27A 4FN5A 2OD4A 2CQCA 2RKIA 4Y2AA 5AE3A 5GMKa 5J2NA 1SUQB 3C15A 2BEFA 3GYGA 2DCUB 1BUXA 2FHKA 4RW4B 3I0SA 2QMUB 3FDSA 5EGYA 4MKYA 3M8WA 3PJXA 4OZ1A 1M1HA 4PYAA 3K59A 4AQYJ 3T1AA 2PD1A 3OXFA 2W2PP 3AJ1A 2HRUA 3K8WA 3MM6B 1HNXF 1QAYA 2BANA 4TVAB 4C98A 1VYAA 4J9QA 2XLIA 1NK8A 3DDNA 2DPIA 3C2PA 5D8HB 2B9YA 4O3PA 1EETB 3IO1A 1WTBA 2IBOA 2NPFA 3RAXA 4IH6A 1UVIA 2GQCA 1MU2B 5U47A 2AW0A 4NI2B 3ISNC 2HZVA 3TZZA 2E5LF 4ITSA 3R6LB 4X4VA 3V6KA 3P5TL 2F40A 2YBVA 2IDLA 2F7VA 2V4RA 5CH7B 1N4LA 4OZJA 3HM9A 2NREA 4JI5F 1GTHA 2HQFA 3CCVS 1UJ5A 4DWIA 3TOQA 2VOPA 3QIDA 2HQIA 1IJFB 1Q95G 4MJKA 5KFHA 1Q82T 2CVIA 3W5XA 3HFKA 4DX6A 3A1YG 3CW2C 1YLXA 4F4YA 1G1XA 4OYMA 4USJC 3TP2A 4A8OA 1U4BA 4LR8A 4PABA 4JI7J 2G13A 5DGAA 3UFCX 2M3DA 1YZ6A 5CYJA 4JYAJ 4IG3A 3VV2B 4GKJJ 2HAIA 1TMMA 2VG6A 2ZEJA 4NA2A 1GXTA 1RAAB 3NY0A 4M5DB 4NLWA 3KHRA 2J0QD 4CLZA 4NLOA 4AXIA 1HBOA 2ZC4A 5KFWA 2OEKA 1N5SA 2RQKA 3M32A 2XY6A 3OL8A 1UWAA 4WBFA 2JRSA 3R5CA 2ZZMA 4ZVRB 3N9UC 1ZH5A 2J6SA 4HL9A 5J2PA 2Y8WA 1VBXA 1VRQC 2DH8A 2G1DA 3DM2A 3DLJA 3GPAA 3QNWB 4UOFA 5CCLA 3NRBA 4PWDB 4RZRA 4ELVA 1BQXA 2BJ3A 3LA0A 4J9VA 2ZHOA 3LPEA 1WC1A 3AA8A 1KEKA 3JTPA 5KFSA 4J90A 1Q86T 4RPFA 1CJUA 3BDEA 4PQUA 4WXWA 2DHGA 2DGTA 1CULA 2MKKA 7FDRA 5DDPC 1GAOA 1CJUB 3PR4A 3R7BB 3W66A 2Z2ZA 2OIHA 4DSJA 4DLGA 4KFBB 2DXFA 5A2QY 4L74A 2DCLA 4HT5A 5DGBA 5D0HA 3FJ2A 5A0YB 2OLWA 4P75A 3K5OA 3C6TB 1FKAF 4I6YA 5J1EB 4R5PA 3KLEB 1F2GA 4HVZA 3O3LA 4UZCA 1KVJA 4DV5J 2Y0SD 3VAKA 1T3OA 2E7XA 4OHYA 3GB0A 2Z8QA 3VVTA 2JEIA 1HQUA 1FD2A 2O5DA 2KT3A 2O66A 2PMWA 3EMTA 3FSYA 3QGHA 2Q3PA 3ZZYA 4BHQA 3KUEA 2ZOFA 5T14A 1AZSA 3Q89A 2B4OA 2EXUA 2ZJRQ 4HKQA 4QYZJ 1X5TA 4OX9F 2GS8A 4YOEA 3OSPA 1KVIA 1KHWA 3CCLS 2QRRA 2Y9HA 2BJEA 2R8GA 2CPHA 4NRTA 2DNHA 1KDNA 2SXLA 3PACA 4ETZA 3OXLA 3Q23A 4HHHA 5H9EK 3V6DA 2RB7A 1XNQF 3T6JA 4PWUA 2GGPB 3FMWA 1GTEA 2G2ZA 2CPEA 4CTAA 2WTFA 2V8PA 2FY1A 2VBWA 3SQGA 4DU7A 1RWKB 4LSZB 1OS5A 2IYGA 2IJRA 1VIXA 2W2NP 3BYRA 3CJ0A 5EN1A 1XERA 1O6XA 2CAJA 2YKMA 1JJCB 3DLEA 4B02A 2M70A 3FCVA 4DFMA 4X4PA 4OZNA 5D4PA 4CLPA 4UOHA 1Y5LB 1LXNA 2YWKA 3QGIA 1SL2A 3H90A 3DLBA 4C0HA 2YKQA 5LSOA 2BANB 1U7LA 2FJBB 3A3PB 1Q7LB 1BD6A 3HVRA 1WI8A 2QJ3A 4FZVA 4LQ9A 1AB8A 4IH7A 1X0PA 2E9TA 1SB6A 4UQGA 2HNYB 3AB4B 4Z2XA 1D0EA 3D0IE 4HHJA 5C24B 1BHNA 3GG0A 2R2TA 2J0XA 2QL9B 2OO4A 1IKVB 2EW9A 3PW5A 3GSIA 1SKWA 1FHTA 3OR1B 4ZVSB 1HWJA 1KNZA 2QFIA 1AA1B 1DTQB 3BGUA 3JSYA 4EYIB 2DGSA 2HWHA 4DV0J 2IMOA 2LQJA 2ZBQA 3FRZA 4WU3A 5K14B 1QVFR 1UVMA 4DV7F 2D3ZA 1JLCB 3Q83A 3DU6A 1N54B 2PGCA 4O23A 2DXEA 2XC9A 2YKOA 3ILJA 1LWFB 2LXUA 4ED0A 4USVA 2XEXA 1QLNA 1HBUA 1JLFA 1NBEB 3N6NA 3KK3A 3ULHA 4YR2A 1EQMA 1U1NA 2X1BA 3UN3A 5JMNA 4L3KA 3TYTA 1M5PC 3QT8A 1SL0A 4AFFA 3MAAB 3EXCX 3QFWA 2HHXA 2KU7A 2G0JA 2I5JB 4UTGA 1VHFA 4LF5F 4CYUA 2ZH8A 4HDHA 1T7PA 3I0SB 5KFKA 5IT9U 4ES3A 2BJDA 3C15B 3W64A 3H5YA 1RU1A 3RTVA 4GKKF 1TL1B 3T5KA 2FJXA 4CNYA 3KJVA 1Y3KA 3D3CJ 3M6VA 1NJWA 1C1CB 2IJFA 1S1XB 4AD6A 3WQPA 2YNFA 3JAMU 4JI5J 2DRAA 1FRLA 2GJFA 2K8GA 3L7PA 1SJFA 1YBAA 4DQRA 1N56A 5I42B 3T9NA 4QWCA 2XMUA 1KOOA 2Z2LA 1KP6A 3D1QA 1RSCA 1V6HA 3MECA 2CNLB 4KGKA 4U7CA 4K4ZA 4ZJQA 1S4FA 3KMQA 1CG2A 1HNVA 2DIUA 1TMJA 5BYSA 1YHQS 1HWLA 1S6QB 4PQAA 5JVGQ 2HHQA 1X4AA 2NXJA 2EVZA 2LEPA 5CYQB 3U1MA 1SC1B 2XQCA 3Q24A 2NSCA 4C3MA 4F3MA 1HBOB 1L3SA 2IHR1 1N48A 2V9WA 4FYXB 3HD1A 3M1VB 3WIUA 2IBKA 5ETMA 5DZ7A 1V5IB 1VBKA 5KTQA 3CIZA 4DUYF 1IWAA 5ITHA 3TAQA 3FSIA 5E0OA 1RTHB 2B9WA 3ZZTA 4JI6F 2BKPA 5FLXY 4NASA 3UQSA 1CJVA 4ECUA 3THTA 3DLLQ 2BRKA 3IWXA 5EX0A 2UVRA 4ILLA 4JI1F 4Y00A 4GC6A 3A8EA 1WJ9A 3W62A 4ECZA 1R89A 3GTYX 2A10A 1BQNB 2WCXA 1NK7A 5JXSA 1MNEA 5F8NA 3BKTA 1RB0A 2J9EA 4LF4F 1IKYA 3BN4A 3BR8A 3GFHA 1WOOA 1GT8A 2C2ZB 2HZCA 2KXFA 2YX7A 3BR9A 3C14A 4H4OA 4TQSA 4W98A 2VPXB 2WZ1A 1VQ9S 1TUGB 2KVQE 2OEJA 2IRYA 2YWGA 4KHMA 2HIQA 2MHEA 3TVZA 5DQHA 2BOPA 2OTLS 2MDAA 4DCPB 3BSOA 2MGZA 2V67A 1YBTA 3D0GE 4B3SF 3B8HA 4MKAA 3PO4A 2VFVA 3BF4A 4G1IA 1GEHA 3V81B 1RTZA 1T05B 1H0HB 1TFWA 5KFEA 2XO6A 3SV4A 1RT4B 1U26A 4QR2A 2QYCA 2B4VA 4GMKA 4CLUA 2HQCA 3QJJA 4DR4F 4DR6F 2HFZA 4C9DA 2DPJA 3TEHB 1H3DA 1G2EA 3H42A 4ALZA 1N8RT 1SUQA 2ZH5A 1FRKA 2IRUA 2HHVA 3NGKA 3TAMB 1UAWA 2MQNA 2MQ8A 5AE2A 1O51A 3A3OB 3H5SA 4ZIWA 1NHVA 1Y7PA 1X8DA 2HQDA 2QN6B 3JQMA 4ZVPB 4NEZA 3MURP 2XO7A 4ECRA 1NHUA 3MMCB 4M5JA 3MDFA 4IYQA 4OX9J 1U6FA 1Y0HA 3FBCA 1F3FA 3NS5A 2B43A 2M7SA 1RAHB 1RT6A 4KKOA 4KO0A 1MWYA 1NEEA 4ANDA 3BO2A 4B9LA 3DN9A 3M2VA 5KFTA 3CF5Q 1HW8A 1RT2B 3EE3A 2QA2A 1SH3A 1TKTB 1F6TA 1W26A 1Z1ZA 2ZWPA 4OLOA 2V4JB 2XULA 3PHEA 4OX8A 4P74A 3PXGa 1EB0A 2HGMA 4X65J 3KK3B 3TJ9A 1VCTA 1UVKA 1KFDA 2ZZNA 2Z2YB 2KVIA 3ZC4A 4EEYA 2XSJA 3FFIA 4OI6A 4AQYF 1VQLS 1V3ZA 2EFNA 4F25A 4ECQA 3HHLB 1RISA 1JMTA 2C1EB 2MMYA 5F8LA 4QIGA 4DV7J 2V6AA 2XTJP 3KK1B 4RW7A 4OI2A 1G4CA 4ID5A 3BPDA 4YB1P 4JI4J 4X4NA 3T1HF 3C66A 1MWZA 2AQ4A 1DY3A 2Z58B 1ZTWA 1RYRA 2BQ3A 1LQ9A 4WP8A 1CC8A 3LF0A 1VQ6S 2OPQA 2F3JA 1R0BG 2ZBCA 1LWXA 3FCHA 1VQ8S 2HMIB 8AT1B 1FE4A 5B0EA 3U02A 3TJ8A 2VJUA 3OFGA 2CJQA 3HVWA 2ZM6J 3DRRB 1RWWB 2MKHA 3H20A 3I9V9 1OMSA 5A76A 1RT3A 1HKAA 2MZRA 2CQ3A 5HMYA 3SCLE 1KQGB 3CCMS 1RT5A 1OQ3A 3EGVA 4DR3J 3PW0A 1LK7A 1SIWB 5CABA 3VAGA 2E44A 1DHMA 2B9XA 3CEDA 1LWEB 2VDHA 2RILA 2JFDA 2YKMB 5ETPA 2JLGA 1U1QA 1KD1T 2OP5A 1Y00A 5CQGA 4EGLA 3LAMA 4LF8J 3LTOA 1LW0A 1F60B 4KY3A 3G2XA 4Q7AA 4O4RA 4USTA 2I9SA 3D1OA 2XWXA 3C6UA 3TI0A 4L6V3 2FQQB 4CTAB 3D7SB 5KG6A 1IBKJ 3CJ8A 4MKBA 2MSTA 1U1MA 3HK2A 1DARA 2CPIA 5J2MB 1YITS 2JL9A 3UD5A 1M5VC 3T5JA 3TUPA 1NSKL 1KBRA 5KFXA 4NXMF 2ILZA 4J9UE 5T7LA 4JV5J 1HW9A 4L76A 2EFGA 4USMA 4TU8A 1CS4B 1WI6A 5KG2A 1SC3B 3J80U 2C3OA 4DPUA 1CSJA 2BJ8A 4RUHA 2UXBF 2OD6A 1AYEA 4R25A 2J9CA 1ZYQA 5EWGA 4P73A 5L46A 1WC4A 1JJ2R 4DR7F 3THVA 3WBZA 4X4QA 3M30A 1J5EF 2IY5B 3MR6A 2P5VA 2H1YA 3CJTA 1S1VB 1S6OA 1HWUA 2R4FA 3DRYA 3LALA 4ZCKA 5CD4A 4PG5A 1CQNA 2RF2A 2VF3A 2V8DA 4QBUA 3UR0A 3CCQS 3TJAA 3KTQA 4PKDB 2IC3B 2A2DA 5L1JA 2H51B 3ZNUA 5L38A 4FXDA 2N7CA 1WWHA 4RNHA 2HHHJ 3JQJA 1NPRA 2VFRA 2V94A 1WG1A 4HEA9 2MZ1A 2DB1A 1K1SA 4M94A 1RE1B 4TYBA 5L9XA 2G0CA 4I7FB 5J2QA 3UO0A 1WUUA 3OUYA 1V5VA 5SZTA 1MROA 2YWWA 3AJ2A 2JX2A 3D6HB 2DR5A 3DOLB 3TUZC 3GQCA 3SYZA 2HLTA 4I68A 2MJNA 3PCOB 3TA2A 4DV3F 2V34A 4KHPF 1RQ0A 2Z0GA 5F41A 3KHHA 4C3LA 3Q22A 1K44A 4YR3A 1NU4A 3MEGB 1P8GA 1WHWA 2HEKA 3PYEA 3RR7A 2C3UA 1B0PA 1RJJA 1S9GA 2IA0A 1X5SA 2MKYA 3MEDA 2RF2B 4IFVB 3NBPB 4J91A 1NRKA 5BXIA 3TQ1A 4GVBB 4DPTA 2F4FA 2FVPA 2PI5A 3DI6B 4DSEA 2XM3A 2CPYA 1IM6A 2LU1A 3P8BB 4O3OA 2L9WA 1ACMB 2HQGA 1FNXH 4K5SA 1WC0A 3GZ7A 4F0HA 3VF0B 3B78A 3SFUA 3L95X 1Q1KA 1IXKA 2ATCB 2BE2B 1SC6A 2ALYB 2L41A 4MYUA 4KR0B 2CJXB 2VPWB 3PX6A 2BDPA 1KTQA 2Z2MA 4NLDA 4C8OA 4QU6A 3IRWP 2C2DA 4KBIA 2RE1A 3DLKB 1SC4B 5GAEI 2AJ0A 3W5YA 4C8NA 4ED1A 3PYDA 4LSLA 5DLFA 3CMES 3IRXA 2UP1A 3RYLA 5F9NA 1VQ7S 1TK8A 1FJEB 4QWBA 2GJ2A 2QMWA 1YJRA 5LMUJ 4PYDA 1FKPA 5AXMA 1NZ8A 4DL3A 1R8BA 1H98A 1FFSB 3OQ2A 1UWBA 2WOMB 3UPFA 1GQEA 3M9NB 2VC1A 1EHWA 2C2MB 3H0PA 1RT5B 2BE9B 1EETA 1NSQA 4DX5A 1IKXA 2M88A 2FLLA 3IBFB 2HFSA 2BE7D 2W24A 1Q5VA 3C19A 3ITHB 4U7UD 1S72S 4NCGA 1HR0J 3OTOJ 4M5HA 2XYPB 4Z7YA 1FRJA 2MZSA 4RW4A 2FZCB 1X4BA 1I3OB 3MPYA 2HK3A 3D3BJ 3NWRA 2MXYA 4XIUA 2VB6A 1V9OA 2HMIA 3OR2A 4OMFG 1S7HA 4OZ2A 4AL5A 4ZVQB 4ED7A 1QUPA 1UTAA 3RZAA 4LF6F 3DRPB 3MMBA 4RW6A 3RRKA 2IRXA 4DDFA 3ONQA 2XG8A 3DNCA 3PRDA 1C0TA 4DX7A 2N4CA 1U49A 3RGIA 3W9JA 1QTMA 4U96A 4DPWA 5GAHU 3HP6A 1VQSA 4RX6A 4B17A 3AFGA 2K3KA 3DGVA 4KGXB 1BLUA 1UVLA 5BR8F 4AE5A 2YWFA 5GAGU 3AY0A 2ZOGA 2W9CA 1X7VA 2BW7A 5GADI 2B3TB 1JXLA 3HULA 2QC3A 4LRDA 1T02A 2IVMA 3M2VB 1TKTA 3RBEA 1H38A 4V19X 2DGXA 2DHHA 1AT1B 2QL5B 3QMQA 4RW9A 1X5PA 1C4AA 5FDLB 5KG1A 4TY8B 4A46A 2BBEA 4LUBA 3KYLA 1T9WA 3IAM9 3LP2B 3FGVA 2PMZD 2G0IA 1T95A 3QPIA 2YKNB 4JB8B 2VFTA 3AA9A 2H65B 3OSNA 3RR8A 4ZHRB 1RHUB 4LFCF 1C2PA 2HVIA 3KJFB 2QT7A 1R43A 2ASJA 4P2XA 1G7CB 4H54A 3TAMA 1LWCA 1CQMA 1OWXA 3IS9A 4FVCA 3QSIA 4Y34A 4K4VA 1HI8A 4AXJA 4LRCA 4K2XA 3CJQA 4J9OA 2WB4A 4JUZA 2IIHA 3M8RA 1ZPWX 2LECA 2XB2D 3GLJA 4WKRA 4JI8J 2MKSA 4X84A 4WKYA 5F8HA 3MEKA 2VV5A 3MUTP 1X60A 3LANA 2EK1A 4OI3A 2IA6A 3CJSA 1VR6A 1VFJA 2ZH9A 3HT3A 4J9KA 5HROA 1WF2A 3CJ5A 1FDNA 3M2RA 2R7UA 5IOLA 2LXFA 3HZEA 2K7JA 1HMVB 2Y1IA 4U9RA 3BBBA 2HPUA 3KLIA 3LH2S 1Q0NA 2RAQA 2YWHA 2W8KA 4DR7J 1RP5A 1IKYB 4R8UA 4Q0BB 2APOA 4JOUA 1Q7YT 2B7BB 3P96A 9RUBA 3KHGA 3CULA 3GP9A 2HZAA 2QTWA 3RBXA 1HHQA 1RACB 3L7UA 3W63A 3I0RB 4OYIA 1YRXA 2PDAA 2YY3A 3ELHA 2RSQA 3VWSA 2FB0A 4FS2A 4BDPA 1CJVB 2QLJB 4NCAA 1C0UA 1SJ1A 5BYQA 2RRAA 3I31A 4WFNQ 2DVIA 2ZNYA 1RTHA 1VISA 1X4CA 2C42A 4P72A 3UW1A 3V5RA 3UD3P 2NXCA 1VC5A 2A6MA 1FEEA 2VKZG 4CLLA 1L3VA 1QE1A 1PJ6A 5HMXA 1UVJA 3G8TA 4RWXA 2YVSA 5M2RA 2JJ4D 3ZZ0A 4QIEA 5CYQA 2M52A 2DRBA 1AW0A 1S1WA 1GFWB 2DNLA 4G6VB 3FNNA 2BABA 4NX9A 5L39A 3CVKA 4KIAA 3HHLD 2DR6A 2GQ2A 1X4FA 1HBNA 3P5BP 3ZZZA 5EDWA 3GV7B 2HHUA 4IRDA 2XMVA 1F9EB 4KH0B 3H5UA 1FESA 1VC6A 1D8YA 4EZ6A 3IGVA 3PM9A 1JLEA 2PT0A 3MM5A 5C25A 4F2RA 2KFYA 2FJAB 2PEHA 3UWTA 2W1BA 2R2SA 2RVJA 1URNA 3NL0A 2RD5C 1C1CA 1PYTA 1B7YB 4ZOSA 3KJVB 4C8YA 4CQ1A 1R27B 1YG0A 3H7HB 1VC0A 3E3XA 1REVA 1JJ4A 3T19A 2CDQA 2DNKA 4DPXA 1F5BA 5KG5A 1U45A 3U1NA 3IM8A 2LVWA 4KPCA 3MFHA 1RCOB 3QJPA 2EBEA 3GJRB 2EFPA 4DF4A 2ZE2B 3OV7A 1TL3B 2C3MA 4DG1B 3SEOA 3MD1A 3QWPA 2FZKB 4ED8A 4GKKJ 2GMJA 5AT1B 2XMKA 1A6LA 1VI7A 4E8UA 4WCEQ 1JLFB 4TQRA 1FVQA 3KG0A 1N34J 4HI1A 4USWA 5E33A 2HVZA 2D1CA 2A1BA 3AAWB 3BH6B 3KOAA 4ECXA 2MB0B 2YKPA 3PYFA 1MMLA 1RHKB 5E5NA 3HKZD 3GYXB 2LMIA 3FSXA 3THPA 2ZNZA 3DYAA 5K14A 4W4MA 2ZD1B 1QUVA 2DNGA 5C2GA 4OYOA 5BYRA 3B4DA 4KH1B 4PG7A 5KOWA 2VHGA 1HNWJ 2KN4A 4V1Ak 4LIRA 4NEYA 4DZ6A 4IOCQ 2JHEA 1N0VC 4HACB 2M4MA 3R7SB 3L3CA 2DGVA 3EUNA 2DR7A 3MR7A 2GQQA 3VAHA 2MSSA 1C1BB 5D3GB 3BGRA 3LWMA 1W2IA 2LDIA 3CJ3A 1RT1A 1S79A 5LMNJ 1IBKF 2WB1D 1BMQB 1LW2A 1T9UA 3A3NB 1S0MA 1KSPA 3OD2A 4NA3A 3G82A 2RUGA 4JI0F 4M63A 1F9HA 3E51A 4FPIA 4YP3A 3DLEB 4WJBA 4TYAA 1FWLA 4JI1J 3EJMA 2DNRA 3CPWR 1UEVA 4USKA 4ERDA 2NLWA 4UUXA 3G82B 4DV6F 1B4SA 5AJ3J 3K58A 2JVRA 3R6GB 2LLZA 1TU0B 2V68A 4I1TA 3SCIE 5J1PA 4BC9A 2KJWA 3MCSA 2AEJA 4LREA 2ZH4A 5H9FK 3S6EA 2O1PA 2GVZB 3H25A 1RDRA 5EWFA 1NJZA 3MM9B 4QIWD 1T03A 2G1HA 3M9MB 4EUVA 2QGFB 1MSWD 4LRBA 1YJWS 4KT0C 3N4WA 2KYZA 4TLQA 4WZQA 5A8KB 4I56A 3IN5A 2EEYA 3RBDA 4ZVFA 1JLBB 5LOQA 4FKXA 8ATCB 4RKUC 4CH0S 2RRBA 3AHPA 2I6WA 4A8XA 1D9AA 3DLGB 1S1TB 1XR7A 2CQHA 4X62F 1IBLJ 2UU9F 1S9EA 1GXLA 1H2VZ 1HQUB 3NMAA 4ZIVA 4ZJOA 2R2UA 1VK3A 3KLGA 4PR6A 3ZNJ1 4JI2J 4HT7A 2HWIA 3DCAA 4DG1A 4PPZA 3VGVA 2OPPB 1M5HA 2VBYA 3POTA 4EMDA 3D1HA 1EP4B 4R5PB 3KLEA 3G6VA 1AROP 2BXJA 2Y1LB 3M6XA 2YX4A 4WXOA 1T8EA 5GADU 3PW7A 2WVFA 2V2ZA 3M8QB 2ATLA 2BV3A 1FDBA 2VG5A 2B0GA 1K9MT 2AJQA 3KJNB 3KLVA 2D74B 3H2VE 2W01A 3KWMA 3AB2B 4NPOA 2A6OA 3H40A 1VQOS 4UY85 4GO5X 1KQSR 4M5LA 1NZAA 3TNVA 5M2PA 2ZJPQ 4DLEA 5GMDA 4BWJA 3MM5B 5HP1B 1RWUA 4QPTA 1FFWB 1PYSB 4S0MA 2AJ2A 4DV4F 3I87A 4PWDA 3N6MA 2HHWA 1FJ7A 2DNOA 4L75A 1RHJB 5KFNA 3NAHA 2HVHA 2R9LA 1HI0P 3MMAA 1OQ6A 4ZPTR 3K5MA 4HH1A 5DG7A 2RNEA 4UY8T 2Q6BA 4CIOA 2AJFE 1CPZA 4IKAA 4F67A 2HFOA 5HQLA 3OVBA 4CO3A 1HD0A 3M32B 4FYWB 2J8AA 3HJFA 2BVZA 3IG1B 1RKJA 5CZXA 2GA7A 1R6YA 2BA9A 1N33J 2WRMA 2ALZA 1WC3A 3PG9A 2P9EA 2CG4A 1RAEB 3W3SA 5LMUF 1X9SA 2HIYA 2PSZA 3EXYA 2KG1A 2Y0BB 2VG6B 1U2RA 2IM3A 1OPIA 1G6BA 1TV6A 3BGRB 4G1PA 3M9OB 3N5FA 1R8HA 4IFYB 4DV2F 1X9WA 2V2KA 2E1CA 2KFZA 2DHSA 3CCUS 1Y5IB 1TAQA 2RH3A 2BR0A 5B7WA 2YTCA 2C3PA 4PG6A 3I0RA 4J9PA 1WEXA 3PVXA 1FK9B 3JSMA 3HJVA 1FTRA 4ZLNA 4DFJA 2ERRA 2Q79A 1RYSA 3MXHP 2J9DA 2QLWA 2J7WA 2ZH1A 2E5LJ 1R8AA 5EX3A 5E2QA 4GVLA 4F4KA 4ZP7A 3W9HA 2BX6A 1PAEX 1FT8A 1WKKA 1WDTA 4O0NA 5F8IA 1Y5NB 4ECVA 1VMBA 1QSSA 1MMNA 4F26A 4B3OA 5ETVA 1DQ9A 1OY6A 1JNZB 2GJIA 2HBZB 5F9LA 5D4OA 1QAXA 2B51A 3QGPA 3WC2A 4P2MA 3M6WA 1V3RA 4LFAJ 4DL0C 4J5OA 2J5AA 4DFPA 2VOOA 4RL1A 1S57A 3IFEA 1TL3A 3SDEA 4F02A 3AD8C 2DNNA 1NKEA 4RO0A 3PX0A 4HI2A 2CPXA 4C3KA 2KL8A 2XNRA 1KLMB 4JYAF 2JWNA 5E3PA 1WSVA 2MHNA 2YPYA 2W2MP 2YX1A 1DLOA 1RK8A 3CD0A 2W4PA 5KT5A 2RKIB 5J2NB 3UDLA 2QFJA 2CJ9A 1KTVA 2FYXA 3M6UA 1HFEL 2IAJA 2VPYB 2DNZA 3MCOA 4ETXA 1Z2ZA 4C0BA 2RMLA 4USHA 4K4TA 3PW2A 3HFVA 2KZZA 3R9LA 4MTPA 4KC5A 4FF1A 3ZO7A 4N77A 4FF4A 3P3DA 4FP9A 1HD1A 4Q0BA 2Z30B 3ISND 2AX0A 2OPRA 4EO6A 4FYDA 3W2VB 2BMBA 1FDAA 3QLHB 1L3UA 3GR1A 1HNWF 1TAUA 2RQ4A 1UCNA 1U25A 1K1QA 2B4PA 2XYHB 4W92B 1PC5A 1H73A 4CLTA 4A48A 1XK8A 4LR9A 3AQPA 2D7SA 3DKDA 3W2WA 3GWCA 1JKHB 2DNPA 2VZ9A 3DOKB 4AYBD 1BQMA 2IYIA 2R8IA 3ILIA 3CJ4A 1ZM4A 1N6QB 1TL7A 5D6GA 1ZAXA 1XNRJ 3EZUA 4IG0A 5KFIA 3M05A 5KFYA 2BOAA 4WFYA 2PC6A 4N8OA 2IVFB 4P2SA 3G9CA 3DOMB 1EZZB 1VGYA 3QIPB 4GC7A 4WPAA 5IM0A 3HSDA 2H9ZA 5KAKA 4DV5F 3SFGA 3HVAA 1FJGF 1VRUA 5HBMB 2RHQB 3ETOA 1N5VA 2YNGA 1FWPA 3IGNA 4PG8A 3QT6A 3L4BC 5IWAF 1DLOB 4DUYJ 2RHSB 3AD7C 2DGQA 4WP9A 3WHIA 4H4MA 2R3VA 1FXDA 2HWTA 3KG1A 1MN7A 5IC6B 2W9AA 3NS6A 2XYGB 5K8MA 3RB6A 4XDDA 3F41A 3I55S 4NCGB 4G65A 1FXLA 4NLQA 5HVFA 3SDEB 3W1YC 3QATA 4YB7A 1F5AA 2WVCA 2BJ7A 2PFFB 2YQ1A 3MUVP 3EVMA 5B0DA 4B9TA 1FKOA 1HL6A 3VAIA 3GV8B 2ROEA 3PRBA 4OZ3A 3MAQA 3BS9A 3CC7S 3EX7B 1KHVA 3QRQA 1FDDA 2AYGA 2GHWA 2P8IA 4ZPDA 4NLTA 1T9YA 4KSEB 2I38A 2NUHA 3GR0A 2BQRA 2CNOB 4ZPCA 1FK9A 2AKWB 3ZZPA 4ER8A 1NDKA 1AFJA 3OBIA 4ICLB 5THWA 3KK2B 4LF5J 2OPSA 1T11A 3M8PA 3SZ2A 2V8VA 4YS2A 1W25A 2E1MC 2ZVSA 2ZH7A 1R7IA 2CQPA 4DJBA 3OPKA 5IQQA 1U24A 4CLYA 3T6BA 1DZ5A 5GAEU 1XMOF 3CCTA 4YFUA 3KLIB 3NMRA 1U0HB 1TL7B 4NE9C 1QD1A 3IWNC 1FX2A 2ZDOA 2J0SD 3BSNA 3NCQA 2ZH2A 4DV2J 2CXEA 4K4UA 3DI6A 4RNMA 5KFCA 2N7YA 1RHRB 3SSQA 4X4SA 2XI3A 1B64A 5AXLA 2VU5A 2YKAA 3JSBA 1T94A 3KUHA 3M2UA 1P1TA 1HNVB 3ISZA 4H4KA 5K5MA 4LRFA 4OYBA 2FC9A 2HFNA 4JI7F 4FS1A 2CQDA 4O4GB 1I51B 3G8QA 5JJBA 2VA2A 3MTJA 3J7YU 2YNGB 2E5GA 2NUUG 4K8RA 1JXVA 2WSFC 1TR0A 4L3NA 1GMVA 2VBZA 3OT9A 4KQZA 3DOMA 3QIPA 2LQ9A 4NL5A 3I5CA 3SSSA 3U7JA 4K4XA 3K17A 4C8MA 3S7RA 2FHMA 3SBMA 1S97A 1TKXA 1N36F 1NK9A 4M95A 2LQ5A 1DJ0A 2ROGA 2IPOB 3DMJA 2CQ1A 4BWMA 2HW3A 1U1LA 2HFVA 1AXQA 2IM1A 1E6YA 1B0TA 2EFOA 3A8KA 3IR6B 4ZLPA 3MFIA 4ATNA 2ACMA 3PX4A 2YPZA 1ELOA 1H7XA 5LL6d 1SH2A 4LFBJ 3DDIA 4ZPWR 1SKSA 4FXVA 3NG8A 1EKSA 2NXUA 3CDAA 4OIXA 4KGMA 1TVRA 3MF5A 1S0NA 1RLCL 1R31A 3CMQA 4URSA 3K89A 4Q8FA 2J0WA 2F8EX 3KFWX 1FI4A 4NRUA 2EFQA 1OY9A 2AYEA 5KFZA 4RU9A 5F8MA 4MFBB 2B6AA 2MKIA 3U1LA 1S6PA 4RW8A 3PJWA 3G6XA 2XZWA 4C48A 5FJ4A 1NB2A 3C8YA 2CPJA 3S01A 2X7IA 3CGIA 2CQ4A 3PFOA 4P6QA 4PXEA 1EJ7L 4C2MA 4RUAA 4B9MA 2LU2A 3A13A 1Z4UA 3D6MB 3C6UB 3CD6S 4M5IA 5IFMA 4UOGA 2HFUA 2HAFA 1SPBP 4DUZJ 3H5XA 4WE1A 6AT1B 3PIPQ 1VBZA 4G1QA 4LIWA 4YQWA 4NXMJ 2X1FA 1KOHA 1R8CA 4OV6A 1EAYC 2WBRA 1UA0A 1GX5A 3C16A 4V19J 1E6YB 3OJUA 2W2QP 1VRTB 1NMEB 4MH8A 3CCES 2C2RA 4X64F 3A8JA 2XGQA 1RT1B 4LF4J 1FWKA 2QZ8A 3DRRA 1FF2A 1Y9OA 1C1BA 2GAGC 4OJ1A 3TZYA 4KTQA 4XAKA 3NNHA 1IUJA 4WFZA 3D9BA 1XMBA 4NLPA 5HN0A 4J9RA 2VKRA 1CJKA 2L9DA 2XBPA 1ZPVA 4K4WA 2V2VA 3TUIC 2CIMA 1XMQJ 4JI2F 3VZHA 2MQOA 3PZPA 1TUWA 4FNIA 2B6AB 4N8NA 4EWTA 4NYZA 1BE4A 5D0GA 1YX2A 2QMXA 6FDRA 1RT7B 1XBWA 2YQ0A 2G2OA 1DBDA 2K7KA 3BBFA 3A12A 4QIFA 3CJ2A 3GFZA 5ETTA 5RUBA 4DF8A 4YY3F 1M5OC 1F1BB 2CADA 2F9DA 4YB6A 1PYOB 4DR4J 5KFVA 1PILA 1NDPA 1B7FA 1RWMB 3IMQJ 1NK4A 3VGUA 4DQQA 1QSYA 4DV1F 2XI2A 3GSDA 1S76D 5I3QA 4EBDA 1NSAA 4NMXA 4ECTA 1I6JA 4F4ZA 1S1VA 2HHTA 4IFVA 3CCJS 4FVMA 1NUEA 2ZKTA 4TU9A 2E7WA 4M8LA 2JC1A 2NS1B 4WK1A 3RBZA 4YMEA 1HQ2A 2XZTB 2FHOB 3B82A 4DU8A 4Q44A 4BS2A 4NA1A 5HQMA 2M5YA 3RW7A 3OL7A 4DV0F 4IDKA 4X66F 4F7VA 2VIHA 4DSIA 4HTIA 3R8YA 4LBIA 2IMWP 2OUGA 2CZ9A 5ETLA 5IV4A 5IT0A 1YQHA 3MMCA 1BWEA 2ZFHA 5HI7A 4W90B 1NNDA 2DTJA 3PKYA 1RAFB 1T03B 1WORA 3E01A 3GCWP 1CJKB 4ICLA 2W8LA 2CDRB 1HIYA 1JWWA 5A6PA 2F8MA 3C46A 1SQGA 2ZOMA 1TZ0A 2G9OA 2Q66A 4DSKA 2F9JA 3MAHA 1HBNB 2V8HA 2OPPA 3POTB 4P71A 2DYAA 3ZZUA 3J80Y 2ZJQQ 3HO1A 1V3SA 2GZOA 3M2UB 3UVJB 4XTTA 2CYYA 1RUSA 3K0JA 4IQMA 1JJHA 1T05A 2HK2A 3CDEA 4R0EA 4B9NA 1LWEA 2LEAA 2KJVA 3BSAA 4AT1B 4DXLA 5DLGA 3EDQB 3NGSA 1CLFA 3Q8UA 4YDDB 4I2QA 2AZ1A 2GMLA 2NYHA 3CC2S 1XMOJ 4OHZA 2D3O1 4FBUA 4DOZA 2GFFA 2JVOA 1WG4A 4B3MF 4ZLLA 2C2OB 5KOXA 1HNZJ 1JLGA 3PJ9A 2GO8A 3MUMP 1KVKA 4FXWA 1KQFB 3FQLA 4NLVA 3MEEB 3DRSA 3H98A 2PI4A 2AMCB 1TL5A 1ROFA 2E5HA 3TA1A 2GX8A 4EK2A 4I69A 2UUAF 3EYZA 5D78A 2U1AA 2LP4A 2OPSB 3ENQA 3MM9A 3CD5A 2WVDA 5KG3A 5L8RC 1WDDA 4ID5B 4A8WA 2PN6A 5DG9A 1HR0F 1N32J 4OYPA 4PXDA 5KFGA 2JEJA 5AE1A 1S0VA 3R2CJ 3UN5A 4F4WA 3HHLA 5T41A 4R8UB 2ZHAA 3S1TA 1PAUB 3NNCA 5H9FJ 1WHYA 4CO5A 2KDOA 5D0RA 4Y2IA 5DRKA 3CWJA 4CO1A 1N6QA 3M8ZA 2EG2A 3UNGC 4X4OA 1K0TA 1FFGB 5DQIA 2LA6A 4LF1A 5JVHQ 5LSRA 1FRXA 4WU2A 1RBLA 5LSLA 5HJXA 3DOKA 1W7WA 3NOCA 3W2WB 4QW9A 1FEHA 4IRCA 4AL6A 5K20B 2KH9A 3FEZA 4F50A 4DS4A 1RWVB 4ZPVR 5D3GA 1IBCB 2CG8A 3GJQB 2P9GA 3QLHA 2EK6A 3P6YC 3CC4S 1KFSA 4I6AA 3DGPA 4RNNA 1KS2A 2LQBA 1WOSA 4ZITA 2ZBRA 5DM6Q 2WAQD 3DDKA 3W65A 2DGUA 5A8WA 4QWDA 4DL5A 2E1RA 3MOJB 4LFBF 3G71S 4X4UA 3CSKA 2DH7A 4ZCMA 1SQFA 1HNIA 2FVQA 3BKUA 3KK1A 4NCBA 3DGPB 1FXRA 4LBPA 3FVYA 2AJ4A 4X64J 4F2SA 4XPCA 1KLMA 2MY7A 2F65A 1RTJB 3GIMA 5AXKA 5ETRA 3QAEA 3PEJA 1HARA 3H59A 1VHIA 2I5JA 3JTOA 3OFFA 4F04B 2UUBF 3ET6A 1FJGJ 4NXNJ 2VASA 2WBMA 1VQ5S 1PJ5A 2D9PA 3DHWC 1FTCA 2X3GA 2KI2A 1M5SA 1JKHA 2L08A 4HLBA 3RU0A 3ET6B 5KG0A 3W60A 3S8SA 4A8YA 5B0AA 2XSFA 4OX7A 4CCHA 3D28A 3SQOP 2UZAA 3KUGA 1U1RA 3R3TA 3VHQA 1RT6B 2V2QA 1WG5A 4KKOB 4KO0B 2VBXA 4LRAA 4RBVA 4RUBA 3OTBA 4YN3B 3SCKE 3ZFVA 2QA4G 1U47A 3W2VA 4KHPJ 1U8SA 2EG1A 3D0HE 2ZBPA 3UNYA 5EWEA 3MMBB 4O3RA 2E66A 1NJYA 2J6TA 1PKUA 1RADB 3I5AA 3MPVA 4ZA1A 1WC6A 2N4DA 5C25B 2IAJB 3KK2A 3T1YF 2HVEA 1A7GE 1E6VA 5G4DA 4JV1A 2KKHA 2CQBA 2JC0A 4CNZA 2WK4A 1OO0B 5DDOC 1RBOB 2HS4A 2AWZA 1H74A 2AIRB 4CI0B 2MY8A 2XY5A 1M1GA 2AF6A 2EKYA 2FGOA 3D54A 4N47A 4DCOB 2M8DB 3M1VA 4XK8C 4C11A 2AYBA 3HLUA 2NZCA 4A8KA 4PUOA 4FNHA 2CZVC 1KWMA 5IXUA 3IR5B 2MKJA 2XZDB 3FZ2A 2HBRB 4JBCA 2IM2A 4IUFA 1NH7A 3FZBA 2AD9A 4ZVUB 4C7QA 4ZLJA 2CRLA 3AOBA 4H4MB 4NZ6A 4OFZA 5EUHA 1HA1A 1S9FA 2FTRA 2RU9A 2BM1A 3IXQA 3IS9B 4ILRA 3VQTA 3QO9A 5LXRA 4A8QA 1XEZA 3NOGA 2G4BA 1SCJB 4H4KC 2XS5A 1F0XA 4P2FA 4TN2A 4O0IA 4DR3F 1SQEA 2CJBA 2NXNA 3DRSB 1TL1A 2CA9A 3NP5A 4LFAF 3CE8A 2VQEF 1MW7A 5B0FA 4K50A 4PZVA 4WIIA 4N76A 4DHVA 5IT4A 2RS2A 4O3QA 3T1HJ 2FZGB 5L9NA 1JB0C 4Q2MA 3MR3A 2EKNA 2GO9A 4MKVA 4MYTA 5SUHA 2FVRA 3H4DA 4DUTA 5HROB 3UCUP 2ASDA 1TQLA 2HGNA 2XMTA 2UXCF 1S1UA 1OSCA 3PHTA 3OL9A 4Q43A 3Q8SB 1U6BA 2V5HG 1HNXJ 1S1TA 3R1HA 5A8RA 5B0GA 1XIQA 3ILLA 2XS2A 2FLOA 2H4WB 2AYMA 1JLBA 2P6TA 2QSFA 3EGWB 2AHOB 1XN9A 2H54B 3K8VA 4KB7A 4YDXA 4EYHB 4GKJF 1X4GA 1LWCB 5L1IA 2MQMA 3GU0A 3UR3C 2DIVA 3ENVA 1U1KA 1IVZA 4LF8F 2UVVA 1J5EJ 2QV6A 3F0NA 3HT0A 3KNGA 1EX8A 2FDNA 3BREA 2JLEA 1UPPA 3UDVA 3UE2A 3X1LB 5ETNA 3ZXWA 1EQ0A 1U02A 3LP2A 2BJ9A 3UCZP 1D8ZA 2HHSA 5ETSA 3K5NA 4Q2LA 1EP4A 4DSLA 3DM2B 1KR4A 4N5SA 3DRXA 3GIKA 5HLFA 2QLXA 3NKYA 2O01C 5F3TA 5J2PB 2VQFF 4CLFA 1PO6A 1IKXB 4LQ3A 1RAGB 5K8PA 2LCWA 3PRVA 4ED2A 1WD6A 3CUNA 1PBAA 4A4JA 3TX8A 4N41A 2E1PA 3N28A 4ES2A 1HBUB 1M0SA 4ZPBA 4ZVHA 3TARA 1IBLF 4D3HA 4PCQA 1SXLA 4C4WA 2PO4A 1UZDA 3QGGA 1Q8KA 1GXUA 4OHXA 1SH0A 5IWAJ 1NK5A 1RT7A 4NYPA 2B5JB 1TK5A 3DLHA 4KGVB 4DMZA 1DTQA 2RUSA 4O44A 3FBFA 3MM7B 4N7TA 1Q8IA 5KT3A 3Q8QB 4TY9A 2R8HA 4ZS6A 4QQBA 3HKWA 4I64A 1S6PB 3D6TB 4RW8B 1HI1A 4OQJA 4U8VA 2F5GA 4MFBA 3CCZA 5HL7Q 1FNOA 3ZTQA 3OVSA 2HNYA 4NZ0A 2J7UA 4NLGA 2KZMA 1U2FA 1FVSA 3I96A 3TZWA 3LP0A 4DCJB 3NEKA 1ZAWA 2C22A 1NB7A 1Q79A 4I2QB 3CT9A 4Y3CA 1QSLA 5K9FA 1HQEB 1U48A 1UFWA 1YTYA 3QFHA 3VZIA 4ZCLA 3R5DA 2RQCA 2VPZB 5E3RA 4FPRA 5HLFB 3MEGA 2AU0A 3MMAB 2MQLA 3IR7B 4OZ5A 2K1RB 2ZVIA 2M9KA 4EU0A 5KFMA 1TKXB 3W9IA 4C97A 5FD1A 2AP6A 1XR6A 3GJTB 4PXBA 4USUA 5LJ3Y 1NK0A 1H2TZ 3CJRA 4I4BA 1T0TV 5LJ5Y 4DQIA 1MWQA 2YXLA 3HHLC 4YHHF 4EI2A 1GMWD 2XLKA 2OPQB 1ZA1B 1DTTB 2EPIA 4F0KA 3KHLA 4HTJA 2WHOA 3ZTRA 1M90T 4DQPA 3D6FB 3F44A 5B08A 2WONB 1TL4A 2LXIA 2RDJA 2VUGA 2RJZA 3G87A 3EVWA 5KFLA 4MMOA 1UFLA 1Y4ZB 3WX8A 3JAMY 3GG1A 4CLWA 4RW7B 2ZITA 5HMWA 4YR0A 3DYAB 3Q86A 3I5BA 4FDFA 4Y2MA 4DPYA 2MQPA 4CH1A 3F73A 4J9LA 1P6TA 1OY8A 2X3DA 3OFHA 1IBMF 3BB5A 5A8RB 4DFKA 1L5UA 3MCNA 1VBYA 3AOAA 1P9QC 1QM9A 1AFIA 1VLYA 2I0XA 2R7RA 1MMDA 4PG4A 1T3NA 1S1WB 3KLGB 2DHAA 4IR1A 3EICA 4P7VA 5HANA 1QAJA 1WKJA 1UL3A 3G4SS 1PGZA 1ZBTA 4RR5A 4UT4A 2KXHA 4J9SA 4C8KA 2F63A 1DQ8A 3QT7A 3CJKB 1N5YA 2DR8A 1QJHA 4LF9F 5BJRA 1H6KX 2KFNA 3ETMA 2MKCA 1K8AT 4HHUA 2WVEA 5GAGI 1NPKA 5GMEA 4X2BA 3BO4A 3FBBA 4DN0A 4Q8EA 1U2CA 1TELA 2ABYA 2FJEB 3A8IA 3H8YA 2CNNB 4QYRA 5T7LB 4ZN3A 1FD8A 4NOHA 4DEZA 1N33F 2HLUA 1YWXA 1RTIB 1HPZA 2MYFA 4C8LA 1YDLA 2E5IA 2CWXA 3HXMA 2OSRA 3VAJA 2KRBA 2JNJA 4CT8A 5IS2A 2O3DA 3BH7B 1RCXB 1RI7A 2DGOA 2AZ3A 3I56S 2QA4S 2UUAJ 3W8GA 1HMVA 4M5MA 2DITA 3GFYA 2N3OA 2LEBA 1R0CB 3RB0A 4C11B 2A2CA 3P49B 3LGMA 2PMHA 2HKEA 3V4MA 1ZETA 1PG5B 1OIAA 2KYXA 3AXKA 2QA1A 2QYGA 2UV8A 3IC1A 4G3IA 2W9BB 2HHPA 3LP1A 2W7PA 1NDLA 1N88A 1RU2A 2BRLA 3GIRA 4JI8F 4HACA 1B3TA 3ICLA 1LXJA 2VICA 4JI0J 2JOQA 1TP7A 3CCWA 1VJQA 3DHXA 1DAXA 3KDNA 2NZ4A 3KMSA 2BKNA 3Q2TC 2E1AA 3MHYA 1FO1A 3MM8A 1X4EA 4CDIA 2CKWA 1DURA 2X51A 2XSJB 3FFIB 4DR1J 3J7Z5 2VONA 1WSRA 2M2BA 3HX9A 3GE9A 4FKYA 3T41A 3M8YA 2M8HA 2HYIB 2F4VF 1TTHB 2YNHA 2W4CA 1S59A 1YZ7A 3AXMA 4TLRA 2R7VA 1NKBA 3GILA 4ZKAA 3BQ0A 2WSCC 5C5JA 3BYPA 3HI9A 2EBGA 1VDHA 3GCXP 3P45B 2ZH3A 4A8FA 1VJWA 3AD9C 4OX6A 4IH5A 4WTOB 4ZK7M 1CJTA 1ICEB 4DN9A 3CMAS 5L1KA 2E9ZA 5F3ZA 4X4TA 3V6JA 3RW6A 3J81Y 2UUBJ 1ZM9A 2MQQA 4YY3J 2UUTA 5H1SV 3DRPA 4RW6B 4DL4A 3US5A 3TR5A 2RS8A 3OTCA 4CP5A 2W7AA 4IRKA 3B6BA 1FE0A 3V6HA 5A8WB 5KFBA 2XY7A 4K5RA 4DZDA 2OTJS 3LW5C 2J6UA 2QE5A 4ZHRA 2QO3A 4Z37A 2IFXA 1IJEB 3NCRA 3Q8VA 4UUWA 2YWEA 3QT5A 3SV3A 1FX4A 1JXEA 1SIZA 4NXNF 3DFEA 3O1LA 5CZVA 3JQKA 1WKLA 1RT4A 2PE8A 2ASLA 5CXTA 5I3UB 3LUYA 2NSBA 3PY8A 8RUCA 4F8RA 2EFVA 5M2UA 1QY7A 4ZP9A 1C4CA 3MCMA 4N56A 1SL1A 1M1KT 1GX6A 1Y10A 4I2PA 2K06A 4CT9A 1S6UA 2DH9A 2WSEC 4A47A 4RNFA 1RT2A 3QSYB 1OYDA 2CQIA 2IJNA 1NKCA 2VFUA 2WOMA 3HZGA 5KG4A 2YNHB 3J81U 3OJSA 4ECYA 1YI2S 1RA6A 1X0FA 2DJWA 3VTIA 2LKZA 3BKFA 1I5OB 4OI4A 3W61A 2KTQA 2OELA 1N5TA 1O0PA 2Q43A 3QQCD 3N6LA 3D5MA 3J7A1 1C0UB 1KONA 2AT1B 3CDBA 4LSLB 1B99A 5MLCV 4Y65A 3T5LA 2ROPA 5D15A 4Y0FA 3M8PB 3JXOA 2W7OA 4TXSA 4B3RJ 2Y1JA 3VQSA 3HSGA 3J7ZT 1NJXA 1Q5YA 2W9BA 3MD3A 3PYGA 4JV0A 1UFKA 1TV6B 3LP1B 3QWUA 4Y2KA 1JLAA 3I32A 2FUG9 4ED6A 4NLXA 4YHHJ 3R5JB 1IM4A 4RJVA 2GVDA 3VVUA 3OL6A 4B3MJ 4UF4A 1UMJA 1PJ7A 4MIBA 2DBBA 4O3NA 2X1AA 3IG1A 3HMJG 2D41A 1Q81T 3GJSB 5J1NA 3J7AN 2FVCA 1EARA 1GK8A 2R7OA 1UWBB 3OTDA 4OJHA 3MEDB 1R6VA 4LVNP 2JLFA 4M5KA 1NAQA 2XMMA 1YJTA 3FRYA 3RG6A 5DG8A 4LF7J 2WW8A 5DDRC 3EWGA 4QPXA 4WWSA 5HJYA 2E29A 1VQMS 2HURA 4ZPAA 3R1LA 4TKTA 3SQGB 2OH2A 1T9VA 1RTIA 4Y28C 1BQNA 1NHKL 3N0VA 5K8OA 4K4YA 2HRYA 1JQGA 4ECWA 2JEGA 4B3TF 1K0VA 1OSDA 3T3FA 2YNIB 3M8SA 2RQMA 4UOCA 3R2DJ 3T5HA 1H7WA 2PA3A 4RBTA 3OHAA 2VG7B 5HK4A 1NLKL 4IFYA 3ENAA 3M4XA 2VG5B 1IR2A 5HATA 2CPZA 2YKNA 3ADAC 4LSNB 3D2WA 1TFYA 4WK3A 3BV8A 1RWPB 4IG0B 1IR0A 4JI4F 1N5YB 1SKUB 3DC2A 3IM9A 3WDOA 2HBQB 1SJRA 2VC0A 3GYNA 4UW2A 5AJ3F 2IC3A 5CHCB 4DR5F 3CJKA 1ZTTA 4F4XA 3T9ZA 1BQMB 2OAUA 2XNQA 3AOCA 3CB4A 4MT1A 3BQ2A 3HVTA 4WIQA 5KFPA 2UVWA 1UW4A 1YK9A 2OI2A 5E3CA 1PC4A 1S9GB 1KQKA 4F36A 1KC8T 2JEFA 1WF0A 1ZZNA 3K2YA 4J9NA 2DY1A 2OHDA 5I42A 1SKRA 3BJYA 5ADZA 1S77D 2WW4A 1CS4A 1PIEA 2D3UA 2DNYA 3DOLA 4DV1J 2LYVA 3E2EA 1CEZA 2IVYA 2HRTA 3NAIA 2VL1A 1OJ4A 1TKZB 5HAOA 5DDQC 2X1GA 1X31C 3RJMB 3ZZOA 5J2MA 4OLPA 1DTTA 2CPDA 3L9ZA 1H72C 1O5JA 4HR2A 5C24A 4QW8A 4C8ZA 2DT9A 3FUYA 1Q8BA 2W25A 4ZCIA 1A0OB 3K5PA 4F3QA 4KHRA 2XCPA 5DO2A 1G3OA 1Q16B 3IP0A 4OYAA 2EC2A 2K1RA 4TNOA 4LMZA 1CBKA 2FGCA 3PNIA 2E9RX 5CAAA 2B8QA 1LOUA 2BQUA 3HSJA 2ZKUA 2AEMA 3M30B 1LWFA 2J8SA 4C0OC 2MTLA 1HQEA 3W5ZA 3DLGA 2LDYA 4ZVEA 1FKPB 4U67Q 3HD2A 1AUDA 5DZ6A 3GIJA 2DNQA 3R5BA 1KRPA 3RAQA 1XTZA 2XMWA 2KRRA 3LP0B 4DUZF 4DR1F 2C2EA 2PIIA 2P2CB 2MPUA 4FF2A 4KRWA 3I9ZA 4X62J 4M5GA 3HCXA 1U8WA 3OLAA 3SMZA 2DO4A 3HPOA 1I94J 4E0DA 2OEMA 1UEUA 3GFXA 3LWLA 4CH7A 1FJCA 5B0BA 2H48B 2GGPA 1BC6A 3FCWA 2FJDB 5I3PA 1D3WA 1OPZA 2L3MA 3MM7A 3L09A 7AT1B 1UVNA 3IA0A 1LKZA 5A6WA 1EKRA 1ZM3A 2FPHX 2OKQA 3CO9A 4O44B 2QG9B 4D3GA 4Q45A 2GMHA 2BE2A 1SJ4P 1UJ6A 4XO0A 1WELA 1YJUA 2ADCA 1JLQB 1ZM2A 1R0AB 1TVRB 4RLEA 1VQKS 2ZWOA 3N01A 4PXCA 2K2PA 1AZSB 1I1GA 2POKA 3NCPA 4K7QA 4AL7A 5MAOA 3O6QA 2GHVC 4J7CA 5KFRA 3HF5A 3MPDA 4CLKA 1MU2A 5B0CA 3DU5A 4CRJA 2H5IB 3J81j 4M1KA 2V9KA 4Q5VA 3QAUA 1IQZA 1IBMJ 2V63A 2RDIA 5F8GA 1YRUA 2XCAA 4QOTA 4P7TA 3TUJC 2CFXA 3K5LA 3DXSX 1K73T 1MG7A 3OXGA 1NXIA 4CO0A 2VQEJ 4EBEA 3D68A 1REVB 3ZTSA 2FJWA 3B4MA 3CIMA 1YKWA 5DQGA 3Q8PB 2FVSA 2A0FB 3QZ7A 3HHNB 4Z7CA 3PTWA 1LFPA 2L48A 2QX0A 1S5ZA 2FY8A 2ZD1A 1P9YA 3M8QA 4X4RA 1X4HA 3WZ0A 2C3YA 4RNOA 4O4GA 2C2NA 2B4UA 2XWYA 4CM2A 4QIVA 1XWLA 5DS7A 3UCGA 1T9TA 4KGZB 1D1UA 3FMBA 5JUMA 2G2YA 3ZTPA 4WTYA 5HMZA 2F8HA 4B3RF 5DJBA 4CLSA 2DISA 3QBCA 2ZDPA 2E7VA 4K2JA 4NMLA 4WYLA 2KG0A 4DSFA 2MGZB 2ILYA 3RB3A 2R7TA 3MPWA 2BM0A 2BKOA 3HSZA 3VALA 2RT3A 3SXLA 3C6TA 3ZZRA 1U0HA 2CWKA 4JP8A 4QR1A 2RU3A 5G0RB 1S10A 1D9DA 4JV2A 2JFKA 2HS0A 4KFBA 2OMLA 4XDCA 1HWIA 5KFAA 3NLCA 4CO2A 1KLNA 3RRHA 1KN6A 3O5TB 4LSNA 1YIJS 2JSXA 4WFXA 3GIIA 1J5OB 2UUWA 2UXCJ 1QAIA 1R8PA 1RHQB 1CULB 3U27A 1RTDA 3AQOA 3CDWA 2DXDA 3QO9B 1NCLA 2H5JB 4QZVB 5D4NA 2GVZA 5BR8J 2NQPA 1LK5A 2KT2A 2YNIA 7FD1A 3JB9k 1TUVA 3MR5A 2BYCA 1RAOA 3V4IB 3GMGA 2XLJA 1UA1A 1S48A 2V69A 2HS3A 4O3SA 1LW0B 3N79A 1MN9A 3SCJE 2ZZTA 4IO9Q 2FD2A 3TW0A 1FKOB 1Y3JA 5C42A 4ES1A 3KLHA 3G6YA 2AEFA 4HH0A 4JI6J 4LF6J 1D09B 3MPUB 4ELUA 2N3LA 4UQTA 4PUOB 1U6ZA 4JV5F 1N32F 2QLFB 1GMUA 3QRRA 4K0KF 1QE1B 3I4PA 2KXNB 3BDPA 4EO8A 1LW2B 1DQAA 2R42A 2V8GA 3TVKA 2I1RA 3IBCB 4M5DA 3MM6A 3TA0A 4IG3B 5KFQA 4DR5J 2ACYA 3KG4A 3MR2A 1VQYA 1KKHA 2J76E 2XMAA 1VRUB 1B70B 5HBMA 1Q53A 3BPSP 3BO3A 2HQ3A 2CJAA 2BJ1A 4ED3A 5KFJA 1WTFA 3HFZB 3TZXA 1FERA 3CD7A 4OJ3A 2DNMA 2KO1A 4P9SA 1RZMA 1SBRA 3EGNA 3K7RA 1RTDB 2FLPA 3GONA 2N82B 3PV8A 1J5OA 2HHHF 2R8JA 3X3UA 1HHTP 2H5EA 2CJKA 2UUCF 3V6DB 2W2OP 2YH1A 1WOPA 2Q1LA 4NZ7A 4LR7A 1YVFA 2UUCJ 4RW9B 4DR6J 1L3KA 5IQ6A 2Z57B 3NWGA 4KV8B 3AT1B 4PPDA 4JI3J 4QU7A 2W9CB 4I2PB 1Y11A 1Z2LA 1TKDA 2ZE2A 1NO8A 1PSDA 2B9EA 1Q8LA 2FHJD 4CWBA 4OHVA 4B9VA 1B0VA 1M5KC 2HBYB 4URQU 9ATCB 1LFWA 3FKBA 5ETOA 2GC8A 2R7SA 2Z4PA 3RB4A 1U1OA 3QRPA 3MWBA 4CM0A 3MECB 1YBUA 2B7CB 3IBWA 4DR2F 1JLCA 2UXDF 3H4BA 3OHBA 3O2IA 3TQEA 2MZJA 4DPOA 2K3IA 3BGOP 1FRMA 4URGA 3TX0A 1EIYB 3H2LA 5C2CA 1VK8A 3OR1A 4OV1A 5KFUA 5CCMA 1JLEB 5LXYA 1IKVA 1F9FA 2GV1A 4EZ9A 3Q2SC 2Y8YA 4OL8A 2ADBA 4CYUB 5FDLA 3EVOA 1CJTB 1JNRB 4MAKA 3ITHA 4LF9J 2QL7B 2DR9A 5B09A 4DS5A 2AV5A 1F2HA 2QSWA 3UDEA 3WIVA 4X66J 3TEGA 4LBHA 1XR5A 2ZBIA 1WEZA 3KLFA 1WACA 3TO8A 3OLBA 3G96A 4DL6A 4LVOP 3ILOA 2CUYA 2V50A 2KM8C 3KLHB 2QEXS 3HDSA 3NGTA 3R7NB 2I2YA
chains in the Genus database with same CATH topology
2GIRA 3V2UC 3TAPA 2U2FA 1SV5B 2VA3A 1S49A 3WX4A 5KFFA 1RAJA 3MM8B 1C0TB 4H4OB 1YSJA 3IRXB 3QZ8A 1JLQA 4OZ0A 3UDCA 3JSMB 2JH3A 2ZM6F 3V4IA 1Q86T 3TVYA 2KM8B 2ZH6A 2XMJA 2HNZB 4CO4A 4Y6IA 2AYBA 2VODA 4OI1A 3OR2B 2QIFA 2CVEA 3BQ1A 1CVJA 4LF7F 4ILMA 4I67A 5KT6A 2OSQA 4BC7A 1N34F 4R0JA 3QJLA 2KT5A 3PKMA 2KHCA 3MEEA 1UJ4A 1JLGB 2VFSA 1UP1A 1N52B 2CQ0A 1URRA 2CQ2A 3EPGA 1HBMA 4USIA 2J7KA 3C3LA 2GW8A 1SJ3P 3PEHA 1J2VA 4F3OA 1GH8A 3H2UB 3JYTA 2AGQA 1XC9A 4IQXA 4FBTA 4HYKA 3UI3A 5E41A 3PR5B 4ZP6A 4QWAA 1ULRA 3RRGA 4YB5A 5HP1A 2RIJA 3E01B 4IO1A 1IKWA 1FA0A 5KT4A 3DLKA 1ZZFA 3ENWA 3V6DB 1S10A 3OUYB 3G6ES 3HHDA 2FHJA 3F56A 3DXBA 4B3OB 4DQSA 4NLSA 2D9OA 4MIWA 4KE5A 1S0OA 4IDKB 4WZMA 6FD1A 3IAS9 3O8WA 4TY8A 2GCFA 1FNMA 2A3JA 5DETA 2MJUA 3K57A 2XHWA 4OZLA 5D77A 2OFHX 4EBCA 4QR0A 1HHSA 1VIOA 1TK0A 4ECSA 3NBPA 2V0NA 3Q0AA 2Q6CA 2GNKA 1S9EB 3HVTB 3UD4P 1P1LA 2COLA 2MZQA 3N5BA 4U7UK 4YEAA 3VR1A 5J1EA 2B56A 1NJIT 1JX4A 5A0YA 2M0GB 2E5JA 2BUNA 1O8BA 5A8KA 3CTRA 4NWBA 1R0AA 3TANA 2F1FA 3R5AA 5F0WA 2OMOA 3GV5B 3LOUA 1U1PA 3G8SA 1MROB 4MK7A 3OTEA 5AXNA 2WONA 5KFOA 3I82A 4I7FA 5J2QB 2ZUGA 3FQKA 4RWWA 4IOAQ 3BGLA 1DFDA 2AJ1A 2VH7A 1I94F 3HHEA 1WEYA 2ZHBA 2GIQA 4IOBA 2DHXA 5KFDA 3OFEA 3EGZA 1VRTA 3W7BA 2OFGX 3JYTB 1XMQF 1BGXT 1D1UA 1X5OA 5HQ8A 2EI5A 4FF3A 4TU7A 2VD3A 5K8NA 1NK6A 4RUCA 4WE1B 5HO4A 3EZ5A 4G1QB 3JTNA 2CZ4A 4K59A 4OHWA 1S99A 3RAMA 1RT3B 4LJMA 3QYYA 2NR0A 2EC0A 1JLAB 4JI3F 5CYMB 4BBYA 5L1LA 2P9CA 2IM0A 4Y2CA 3MGJA 1FCAA 3MI7X 4K4SA 1TKZA 1U09A 2XS7A 1ZOTA 1IN0A 4QJVA 5IT9Y 1WHVA 3PFEA 2HNZA 4LT6A 3MTKA 5CYMA 4HDGA 1VQ4S 4E98A 3LGNA 3PW4A 2B5JA 3CDUA 1YGYA 4OI0A 1HNZF 3BGFA 3NGDA 3LQVA 3BEGB 2R8KA 1YJVA 4A8SA 2OJ3A 4A8MP 4J9MA 2ZC3A 3HHKA 5KT7A 4WFBQ 2NYIA 3DMJB 1W2BR 4ED5A 5E3AA 4EFAC 4MK8A 4NLYA 1N0UA 3L7OA 2V4QA 3I6PA 2DK2A 4I0WA 1DRZA 3OTOF 3OVAA 3CCRS 3BM7A 4X65F 2UVUA 4B9UA 4RBUA 2NPIA 2VG7A 5FIIA 5E7OB 4WF9Q 3OW2R 1D9FA 2AGPA 2R7XA 3I4HX 1IKWB 2CQGA 5KT2A 1HYSA 2R7WA 2FIUA 1QVGR 1YJNS 3NNAA 1RGVA 4DBQA 1BY9A 3O44A 1R3NA 1WF1A 2HG4A 4XPEA 4ID8A 2FJVA 5F8JA 3BZQA 4B9SA 4MK9A 1YJ9S 1UKUA 3V81A 2BZ2A 5H9EJ 5GAHI 2JZ5A 2AGOA 2V4JA 4DL2A 1S1UB 1X9MA 3MMJA 3CCSS 4IR9A 2D3OR 1HBMB 3VAMA 4KV8A 2YQ3A 2AX1A 2R2RA 4KPYA 1JIHA 1VQPS 4U6PA 5CD4H 3FEYB 5LMNF 3MZIA 3VAFA 1UETA 1SJQA 1VOMA 4NLRA 4RU2A 4WYWA 5LT5A 1RKIA 2Y1RI 4PQUB 1N5QA 2CPFA 3BN7A 2GHPA 3KNAA 5F0UA 4DX8H 4QWEA 1WNEA 2KB2A 2HNDB 4MIAA 2A18A 2DGWA 2RRNA 3LPYA 4AUKA 4DL7A 3LO3A 3SSRA 2O67A 3VCDA 4CZCA 2JDJA 1XNRF 2PA8D 5D4LA 2FC8A 1Q4RA 4I6WA 2FLNA 1NH8A 3TRGA 1CC7A 3M2RB 4NLUA 2LA4A 2I8EA 4NYOA 3KLFB 5KG7A 4ZVGA 4GO7X 3E8OA 2C28A 5C42B 3PO5A 1S6QA 4ELTA 1Q78A 5I3UA 4ZMMA 1F5CA 3IWLA 3G86A 1HYSB 1FRIA 3MOZA 2J9DE 1HPZB 2YNFB 1JK9B 2HNDA 1E6VB 2DO0A 3WC0A 4OJGA 1P27B 1IQTA 4B08A 3EPIA 1YRTA 2KHDA 4ZDNA 5IM0B 5DM7Q 5I4MA 1APSA 1ZAVA 4BCAA 4ZP8A 2P6SA 3CXCR 5IZHA 2UV8G 1SI9A 1SV5A 4J37A 5E3QA 3PIOQ 1HWKA 2MZTA 5G0RA 2ASYA 4WFAQ 1FRHA 3BSCA 1VQNS 2EWHA 1LV5A 1H2UX 3JSRA 1WHXA 1VS3A 3PDNA 3Q8RB 1L3TA 4YUDA 4KAIA 2DD8S 2L9NA 1RTJA 5CA5A 3FEXB 2YH0A 4KJIA 3KKFA 5EHHA 2XGPA 2OPRB 1RA7A 3R27A 2BACA 3J7YI 3LAKA 1GNKA 3AH6A 2HGLA 2R7QA 1S1XA 2W4DA 1HNIB 4L72B 2BW2A 5GVQA 1X4DA 4FN5A 2OD4A 2CQCA 2RKIA 4Y2AA 5AE3A 5GMKa 5J2NA 1SUQB 2DCUB 2FHKA 4RW4B 3I0SA 4MKYA 3FDSA 5EGYA 3PJXA 4OZ1A 3K59A 3T1AA 2PD1A 3OXFA 3AJ1A 3K8WA 2HRUA 3MM6B 1HNXF 1QAYA 2BANA 4C98A 4J9QA 1NK8A 2DPIA 2XLIA 5D8HB 3DDNA 3C2PA 2B9YA 4O3PA 1EETB 3IO1A 1WTBA 2IBOA 2NPFA 3RAXA 4IH6A 1UVIA 2GQCA 1MU2B 5U47A 2AW0A 3ISNC 2E5LF 4ITSA 4X4VA 3V6KA 3P5TL 2F40A 2V4RA 2NREA 2F7VA 1K0VA 5CH7B 1N4LA 4OZJA 3HM9A 4JI5F 1GTHA 3CCVS 1UJ5A 4DWIA 3TOQA 2VOPA 3QIDA 2HQIA 1IJFB 4MJKA 5KFHA 1Q82T 2CVIA 3HFKA 3A1YG 4F4YA 1G1XA 3TP2A 4USJC 4A8OA 1U4BA 2G13A 5DGAA 3UFCX 2M3DA 5CYJA 4IG3A 2HAIA 2VG6A 4NA2A 1GXTA 4M5DB 2J0QD 4NLWA 3KHRA 4NLOA 4AXIA 1HBOA 2ZC4A 5KFWA 1N5SA 2RQKA 3M32A 2XY6A 3OL8A 2JRSA 3R5CA 2ZZMA 3N9UC 1ZH5A 2J6SA 4HL9A 5J2PA 1VBXA 2DH8A 2G1DA 3DM2A 3DLJA 5CCLA 3NRBA 4PWDB 4RZRA 4ELVA 1BQXA 1KEKA 2ZHOA 3PO4A 3AA8A 3JTPA 5KFSA 3BDEA 4PQUA 4WXWA 2DHGA 2DGTA 2MKKA 7FDRA 5DDPC 1GAOA 3PR4A 2OIHA 4DSJA 4DLGA 4KFBB 5A2QY 5DGBA 2DCLA 4HT5A 3FJ2A 5A0YB 2OLWA 3K5OA 3C6TB 4I6YA 5J1EB 4R5PA 3KLEB 1F2GA 4HVZA 3O3LA 1KVJA 2Y0SD 3VAKA 1T3OA 2E7XA 4OHYA 3GB0A 2Z8QA 2JEIA 1HQUA 1FD2A 2O5DA 2KT3A 2O66A 3FSYA 3QGHA 3ZZYA 2Q3PA 4BHQA 2ZOFA 5T14A 2ZJRQ 4HKQA 2B4OA 4QYZJ 1X5TA 4OX9F 4YOEA 3OSPA 1KVIA 1KHWA 3CCLS 2QRRA 2BJEA 2R8GA 2CPHA 4NRTA 2DNHA 2SXLA 3PACA 4ETZA 1XNQF 3OXLA 3Q23A 3V6DA 2RB7A 3T6JA 4PWUA 2GGPB 3FMWA 1GTEA 2CPEA 4CTAA 2WTFA 2FY1A 2VBWA 3SQGA 1OS5A 2IYGA 1VIXA 3CJ0A 5EN1A 1XERA 2YKMA 3DLEA 4B02A 2M70A 4DFMA 4X4PA 4OZNA 5D4PA 1Y5LB 1LXNA 2YWKA 3QGIA 1SL2A 3DLBA 4C0HA 2YKQA 5LSOA 2BANB 1U7LA 2FJBB 1Q7LB 1BD6A 3HVRA 1WI8A 4FZVA 4LQ9A 4IH7A 1X0PA 2E9TA 1SB6A 4UQGA 2HNYB 3AB4B 4Z2XA 1D0EA 3D0IE 4HHJA 5C24B 3GG0A 2R2TA 2J0XA 2OO4A 1IKVB 2EW9A 3PW5A 1SKWA 1FHTA 3OR1B 1HWJA 1KNZA 3BGUA 1DTQB 3JSYA 4EYIB 2DGSA 2HWHA 2IMOA 2LQJA 3FRZA 1UVMA 4WU3A 5K14B 1QVFR 4DV7F 2D3ZA 1JLCB 3DU6A 1N54B 2PGCA 4O23A 2XC9A 2YKOA 1LWFB 2LXUA 4ED0A 2XEXA 1QLNA 1HBUA 1JLFA 3N6NA 3KK3A 3ULHA 4YR2A 1U1NA 2X1BA 3TYTA 1M5PC 1SL0A 4AFFA 3EXCX 2HHXA 2KU7A 2I5JB 1VHFA 4LF5F 2ZH8A 4HDHA 1T7PA 3I0SB 5KFKA 4ES3A 2BJDA 3H5YA 3RTVA 4GKKF 1TL1B 3T5KA 2FJXA 4CNYA 3KJVA 1Y3KA 3M6VA 1NJWA 1C1CB 2IJFA 1S1XB 2YNFA 2DRAA 1FRLA 2K8GA 3L7PA 1SJFA 1YBAA 4DQRA 1N56A 5I42B 3T9NA 4QWCA 2XMUA 1KOOA 2Z2LA 3D1QA 3MECA 1V6HA 4K4ZA 4U7CA 4KGKA 1S4FA 3KMQA 1CG2A 1HNVA 2DIUA 1YHQS 5BYSA 1HWLA 1S6QB 4PQAA 5JVGQ 2HHQA 1X4AA 2EVZA 2LEPA 5CYQB 3U1MA 2V9WA 3Q24A 2NSCA 4C3MA 4F3MA 1HBOB 1L3SA 2IHR1 1N48A 3M1VB 2IBKA 5KTQA 3CIZA 4DUYF 5ITHA 3TAQA 3FSIA 5E0OA 1RTHB 2B9WA 3ZZTA 4JI6F 5FLXY 3UQSA 4ECUA 3THTA 3DLLQ 2BRKA 3IWXA 5EX0A 2UVRA 4ILLA 4JI1F 4Y00A 3A8EA 4ECZA 1R89A 2A10A 1BQNB 2WCXA 1NK7A 5JXSA 1MNEA 5F8NA 4LF4F 2J9EA 1IKYA 3BN4A 3BR8A 3GFHA 1FKAF 1GT8A 2KXFA 2HZCA 2YX7A 3BR9A 4H4OA 4TQSA 3M9MB 4PRFA 4C4WA 2VPXB 2IRYA 2YWGA 4KHMA 2HIQA 2MHEA 3TVZA 5DQHA 2BOPA 2OTLS 2MDAA 3BSOA 4B3SF 2MGZA 3D0GE 3B8HA 4MKAA 2VFVA 3BF4A 4G1IA 1T05B 3V81B 1H0HB 1TFWA 5KFEA 3SV4A 1RT4B 1U26A 4QR2A 2QYCA 2B4VA 4GMKA 4DR4F 4C9DA 3QJJA 4DR6F 2HFZA 2DPJA 1H3DA 1G2EA 4ALZA 1N8RT 1SUQA 2ZH5A 1FRKA 2IRUA 2HHVA 3NGKA 3TAMB 1UAWA 2MQNA 5AE2A 1O51A 1A9NB 3H5SA 3MURP 1NHVA 1Y7PA 1X8DA 2XO7A 3P6YC 4ECRA 1NHUA 3MMCB 3MDFA 4IYQA 1U6FA 1Y0HA 3NS5A 2B43A 2M7SA 1RT6A 4KKOA 4KO0A 1MWYA 1NEEA 3BO2A 4B9LA 3DN9A 3M2VA 5KFTA 3CF5Q 1HW8A 1RT2B 3PW0A 2QA2A 1SH3A 1TKTB 4OLOA 3KHLA 1Z1ZA 3PXGa 4IUFA 2V4JB 2XULA 3PHEA 4OX8A 2HGMA 3KK3B 1UVKA 1KFDA 2ZZNA 2KVIA 3ZC4A 4EEYA 2XSJA 3FFIA 4OI6A 4AQYF 1VQLS 1V3ZA 2EFNA 4F25A 4ECQA 3HHLB 1RISA 1JMTA 5F8LA 2MMYA 4QIGA 3KK1B 4X4NA 4RW7A 4OI2A 4ID5A 4YB1P 3T1HF 3C66A 1MWZA 2AQ4A 1VQ6S 1ZTWA 1RYRA 2BQ3A 1LQ9A 1CC8A 3LF0A 2OPQA 2F3JA 1VQ8S 2ZBCA 3FCHA 2HMIB 1FE4A 5B0EA 3U02A 3OFGA 2CJQA 3HVWA 3DRRB 2MKHA 3I9V9 3H20A 1RT3A 2MZRA 2CQ3A 5HMYA 3SCLE 1KQGB 3CCMS 1RT5A 1OQ3A 1LK7A 1SIWB 3VAGA 2E44A 1DHMA 2B9XA 3CEDA 1LWEB 2JLGA 2RILA 2JFDA 2YKMB 4DV1F 1U1QA 1KD1T 2OP5A 1Y00A 5CQGA 4EGLA 3LAMA 1LW0A 1F60B 4Q7AA 4O4RA 2I9SA 3D1OA 2XWXA 3C6UA 3TI0A 4L6V3 4CTAB 5KG6A 1U1MA 4MKBA 2MSTA 3HK2A 1DARA 2CPIA 5J2MB 1YITS 2JL9A 1M5VC 3T5JA 5KFXA 4NXMF 2ILZA 5T7LA 1HW9A 4TU8A 2EFGA 1WI6A 5KG2A 2C3OA 1CSJA 4RUHA 2UXBF 2OD6A 4R25A 2J9CA 1ZYQA 5EWGA 1JJ2R 4DR7F 3THVA 3WBZA 4X4QA 3M30A 1J5EF 3MR6A 2P5VA 3LALA 1S1VB 1S6OA 1HWUA 2R4FA 3DRYA 4ZCKA 4AL7A 4PG5A 1CQNA 2RF2A 3KTQA 2V8DA 4QBUA 3UR0A 3CCQS 4PKDB 2IC3B 2A2DA 5L1JA 5L38A 4FXDA 2N7CA 1WWHA 4RNHA 2VFRA 2V94A 1WG1A 4HEA9 2MZ1A 2DB1A 1K1SA 4M94A 4TYBA 5L9XA 2G0CA 4I7FB 5J2QA 3OUYA 5SZTA 1MROA 3AJ2A 2JX2A 2DR5A 3DOLB 3TUZC 3GQCA 3SYZA 2HLTA 4I68A 2MJNA 3TA2A 4DV3F 4KHPF 1RQ0A 2Z0GA 5F41A 3KHHA 4C3LA 3Q22A 4YR3A 1NU4A