4USHA

Nitrogen regulatory protein pii from chlamydomonas reinhardtii in unliganded state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
103
Chain Sequence
SIQCDLSAFPGVKFFRIEAIFRPWRLPFVIDTLSKYGIRGLTNTPVKGVNLVDKEKLDIVVSRAQVDAVVRLVAASAYTGEIGDGKIFVHPVAEVVRIRTAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Signaling protein
molecule keywords NITROGEN REGULATORY PROTEIN PII
total genus 24
structure length 103
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ushA00
3BZQA 4CO0A 4C3KA 1UFLA 2RD5C 2XULA 1V3RA 4RWWA 4R25A 4CO3A 2GNKA 4RWXA 2PIIA 1O51A 5L9NA 4CO2A 4ZK7M 2CZ4A 4USJC 1O5JA 4Y65A 1V3SA 1P1LA 4CNYA 4CO1A 3X3UA 1H3DA 2GX8A 4YB5A 3NCRA 3AA9A 2Z0GA 3L7PA 4D3GA 3N5BA 4USIA 5DRKA 4RX6A 2EG1A 4WK3A 2ZFHA 3AHPA 3TA1A 1V6HA 2J9CA 1UKUA 4NYOA 4USHA 5D4PA 2O67A 5D4LA 1UMJA 3NCQA 2J9DA 5D4OA 2XZWA 1XK8A 3HLUA 2E66A 2NUHA 3CE8A 4RLEA 1NH8A 2NUUG 2EG2A 3LF0A 2DCLA 4CO5A 4CNZA 3NCPA 4OZNA 4D3HA 3GSDA 4C3LA 1QY7A 1HWUA 3AH6A 3AA8A 3O8WA 4CO4A 2XG8A 1VHFA 4NYPA 2XBPA 2NS1B 2GW8A 1VFJA 2J9DE 3MHYA 1NAQA 1J2VA 1NH7A 4WK1A 4IYQA 2J9EA 1V9OA 2VD3A 1UL3A 2ZOMA 3TA0A 4E98A 4OZJA 5D4NA 2V5HG 2JJ4D 1KR4A 2O66A 1PILA 4Y6IA 4YB6A 1OSCA 4AFFA 3DFEA 1NZAA 3T9ZA 5DS7A 4YB7A 4OZLA 3TA2A 3OPKA 1Q1KA 3O5TB 3M05A 1GNKA 4C3MA
chains in the Genus database with same CATH superfamily
2LQBA 2QMXA 3NGDA 1RGVA 3IM8A 3J7ZT 2DXDA 3BEGB 3MAHA 4QOTA 2FVSA 2KG0A 1GTHA 4Y2AA 2ZH6A 1ZTTA 1TFYA 1JWWA 3TUZC 3J81j 1Y0HA 2M8HA 3T5HA 4URQU 1ZOTA 2R8KA 5A2QU 4FF2A 4E0DA 1N32J 3OFHA 2OGUA 5E3QA 1BGXT 1JLFB 3VVUA 4OX9J 1RTHB 2CDRB 1IXKA 2Y1RI 2HHTA 1BWVA 3UN2A 4I6WA 1HBNB 1QE1A 2IRUA 2KVIA 2YKNA 2CNLB 3DC2A 1U6ZA 4IG0B 2L9NA 2HMIB 3KUEA 3M6UA 4EO8A 4X65J 2E9ZA 4PRFA 1L3KA 2FDNA 2I2YA 1U6BA 2XS5A 3TUPA 1CJTA 4IRDA 5C42B 3LGMA 2YWKA 2XZDB 2KT3A 3LP0B 3OXGA 3TEGA 5H1SV 1LW0A 4DV0F 2VOOA 2ASYA 5D0RA 3K7RA 5CYJA 5D6GA 2HYIB 2RHSB 4ZPCA 3DU5A 4NLTA 5C25B 4ECUA 3WC0A 2C2EA 4FPRA 1PJ7A 2QFIA 3BBBA 3KKFA 3HD2A 4AL6A 3ZO7A 2I0XA 2J0QD 4D3GA 2UUTA 2Z30B 2ZKTA 3LH2S 1JXLA 4RNFA 3D0IE 3EZOA 2YNIA 4K0KF 2RAQA 4ZPBA 5MAOA 3OHAA 1HFEL 1VS3A 2FLLA 1VYAA 2YTCA 1UW9A 4JV5J 3VGUA 3DLEB 1HWJA 2IYIA 4QBUA 1KONA 4R8UB 2GGPB 5L39A 4ZKAA 3IG1B 4NLSA 5IWAJ 5DM7Q 1X7VA 3A8EA 3OV7A 3NOGA 2RU3A 4NLGA 3A12A 3L7OA 1WF1A 2ZUGA 2NXNA 4C0OC 5IWAF 2DD8S 2NSCA 4QIGA 5A8RA 3QLHB 1S1WB 5KFIA 2JFKA 5J2NB 4F7VA 5KFSA 4M5JA 1DURA 4F2RA 1UVMA 3VAJA 1LQ9A 1LK5A 3C14A 4F25A 3IRWP 4KHPJ 3LTOA 2MKJA 1K47A 1WHWA 3OL7A 3OVBA 3DDKA 1EETB 3MR5A 4Q8EA 3LQVA 5KFQA 1U26A 4OX8A 4PXDA 3QJPA 3R7NB 1G1XA 2H1YA 3NCPA 3DXBA 3H2UB 1JLBA 1DLOA 2CAJA 1RYRA 4X4VA 4ZN1A 4X65F 1DLOB 1SJQA 4E2FB 4YOEA 3HT0A 2DNYA 3UNYA 4J5OA 3GIIA 2DIVA 2E1PA 1RAJA 4GC7A 5I42A 3DMJB 3BPSP 4RW4A 3V4MA 1KBRA 1RCXB 3DU6A 1RHKB 2XO7A 3RW7A 3M8RA 2W9BA 3I32A 1NU4A 5LJ3Y 3RB0A 2C1EB 3CNQP 3M30B 4KFBA 4Y2CA 2RQKA 2ILZA 4FYYB 4WTOB 3UQSA 1JLEB 1HNIB 1BXNA 3DRPB 1FVQA 1T9WA 4IG3B 2CQ4A 3PRDA 4K0KJ 2ZKUA 3OR2A 2I5JB 1I6JA 2KFNA 4P73A 1Y5IB 5C7PA 1PSDA 2R7TA 3QRQA 4RUBA 3A3NB 3CJ0A 2H65B 1FK9A 3DRXA 3N5FA 4ZDNA 1UPMB 1F3FA 4M5IA 2QTWA 3HJVA 1U1NA 2ZZNA 3V6KA 1RZMA 3PJ9A 1VQNS 5M2RA 3FNNA 1FJGJ 2B8PA 2WVEA 3I0SA 1AUSL 1LWXA 5DG7A 3QIDA 2GVZB 1VQPS 1F3VA 4QWDA 3FBBA 2HURA 2QV6A 5A0YB 1UVJA 5C2GA 2FVRA 2PO4A 1C0UB 1CJUA 2R7QA 4UOCA 3BKUA 4CDIA 3RRKA 2XLJA 3KK2B 4IO1A 4NMLA 2XM3A 3ET6A 2AKWB 1VRTA 1H2VZ 1KNZA 2LEAA 4IH7A 3CULA 4OZLA 3KXDA 5JXSA 1IKVA 2PDAA 5DM6Q 2UVUA 2K7KA 4KH1B 2ZH4A 2VQEJ 4UY8T 1HKAA 1S4EA 2QO3A 4OYOA 2BZ2A 4CI0B 4A8WA 1VIXA 6FD1A 2MJUA 3HHDA 1N6QA 2UXDJ 2HQFA 4Z37A 2J7KA 3M2UA 2WTFA 3GV7B 2XMMA 1NJIT 4QU6A 3MAAB 4FYXB 4MTPA 1PBAA 2QMUB 2A6OA 3KMSA 3ZTPA 4QZVB 1EKSA 2MQQA 1NZ8A 3OXFA 3FMWA 4ZVHA 3VTIA 5KFCA 5KT7A 3IBWA 2RU9A 2V2ZA 2OPSB 2OHDA 1D09B 4C8KA 2M3DA 1URNA 4QU7A 4CO2A 1BQMA 3W3SA 2B6AB 1SKSA 3VGSA 1LW2A 4ERDA 3UD5A 2QLFB 4HT5A 2AJ0A 2CVEA 4OJGA 5K14B 3TVYA 2J76E 3QWPA 5LJ5Y 2GIRA 2VFRA 3D4JA 4TXSA 3D0HE 1JKHA 3TX8A 3ITHA 1TL1B 4JUZA 2F63A 1S9EB 4URSA 5G0RA 2QLXA 3GYGA 3RAXA 3Q2TC 4OI0A 4FS2A 2AYGA 2ZVSA 2AP6A 2DR7A 3TNVA 1N33F 3UD3P 2AJ2A 2CJBA 1JQGA 3BN4A 1RYSA 2OI2A 2ZFHA 1HNWJ 3CC4S 1RP5A 1KTQA 1UKUA 2XMKA 1HHSA 4HHHA 3TUIC 2KTQA 3SV3A 2CJ9A 1C1CB 3EGVA 2EFQA 3SSSA 4JV5F 3JAMY 4NASA 3Q0AA 1T11A 1GMWD 1UMJA 3Q8RB 3PW0A 2J9DA 1K8AT 3FCHA 2J8SA 2QX0A 1T05A 1Y3KA 3HLUA 4OHXA 4X64F 3HX9A 1U48A 1T8EA 2EKNA 4JI8J 2OUGA 2RMLA 4ZVQB 1WHXA 5JVGQ 1AXQA 3EGNA 2F9DA 2NXCA 2ZM6J 1JLQB 2VG6A 3LA0A 4UQTA 2DCLA 3CCWA 5KG4A 4PWUA 2DRBA 1IKXA 1GT8A 1S48A 2HFNA 3DM2B 2IM3A 5HQ8A 1N32F 2LXFA 1TKZA 2EVZA 3S01A 2RVJA 2H9ZA 3Q83A 5I3UB 2R7XA 5T41A 1XBWA 3BYRA 1EX8A 1NHVA 1IKWB 1JLAB 3CJ5A 3HHKA 2YQ0A 2Q66A 1KLMB 1RE1B 5CYMB 1HL6A 1NPRA 4EBCA 5H9EK 1PBUA 2Z58B 2OELA 3UI3A 5IV4A 2R2UA 1Q8LA 3MHYA 3MECA 5L38A 4YR2A 1FKPB 3AT1B 5FLXY 4DCJB 4M94A 4UOGA 2XSFA 1XJWB 5BXIA 2DT9A 1RHMB 4WK1A 3CJKA 2CPZA 2LA4A 1UEKA 2H54B 1NHUA 1UVLA 2OSQA 1V9OA 1FKOB 2RH3A 3K89A 2VBXA 1TK0A 1EP4A 3JTOA 3PYGA 4F4XA 4AT1B 1DQ9A 5IQ6A 3MMBB 4WFAQ 2HAFA 4K4YA 2Z57B 2XTJP 3MMBA 1FT8A 1UWAA 3D1HA 2PI5A 2W4PA 1J5OB 1R8CA 1ZM4A 2WVBA 3I87A 1TELA 2KB2A 3KJVA 2H5JB 1NJWA 3M32B 4ZHRA 1URRA 2MSSA 3VV2B 4DPXA 1FKPA 2YKPA 2LEPA 3BKFA 3U7JA 3TI0A 5HMYA 4B3SJ 2D7SA 3ETMA 4NCGA 3WBZA 2JLFA 2CG4A 2H4YB 2PGCA 2BUNA 3P5BP 4ZCMA 5ADZA 3DLKA 1WKLA 1TUVA 2CPJA 1SJRA 2CPXA 5KFFA 4BDPA 3D6FB 3I0RA 1T7PA 3DYAA 4ZP9A 1XR5A 2XCAA 2FTRA 3THTA 2G0CA 1Z4UA 1VQ5S 1N36F 4NXNJ 2WSFC 3IG1A 4ZCLA 4AXIA 4DFJA 1S0VA 1V3RA 4B3OA 1F2GA 2VB6A 4DL7A 4DR4J 4J90A 2CPIA 2EW9A 4QJVA 3GG0A 2YKOA 4JYAJ 2FLNA 2FJVA 2CPHA 3U27A 2VHGA 4YR0A 2HNYA 2D3UA 4JI1F 4E8UA 2BJ7A 3GJSB 1GH8A 3HI9A 3TUJC 1WORA 3M8SA 2CNKB 2NZCA 2DH7A 3RW6A 5C24A 3G4SS 4QIWD 3VAGA 5J1NA 4J9OA 1F9HA 4JI6F 3W65A 5DDOC 9RUBA 1W2IA 2W8LA 4DV7F 1Q7LB 3T19A 3QT6A 2VFVA 3KDOA 5ETKA 3CO9A 5KFJA 3MR3A 3T1YJ 4IG0A 4NXMF 4X64J 1NK0A 1VCTA 5HN0A 5HQMA 4LIRA 4F04B 2CQIA 2DY1A 3BDEA 3TA1A 3IS9B 1JJ2R 2R7VA 5KG5A 5FD1A 1Q8BA 3M4XA 4USHA 4N41A 3IC1A 1D1UA 2W9BB 4I6YA 4NRTA 4PG8A 2IA6A 2IC3B 2M88A 4WFXA 3W2VA 1UP1A 1S1VA 2HGNA 5D4LA 5CAAA 3GV5B 1FXLA 1YZ7A 3EICA 3JB9k 1O6XA 1UZHA 1LW2B 2QC3A 4FNHA 4PYAA 4YY3F 2LVWA 1QTNB 3VF0B 1RT7A 3OTBA 2AGQA 5CCLA 4JI6J 2XS2A 1N33J 5D3GA 3A4TA 1XMOJ 1WG5A 2UUWA 4LR9A 5DDPC 1XQIA 4UZBA 2ZDOA 1NUEA 3HM9A 4O4GB 1U1LA 3IR6B 1EHWA 3MECB 4RLEA 3T3FA 1ZYQA 3CDEA 1NH8A 2MKYA 4USVA 2XLIA 2W2NP 3IA0A 4KGZB 3KHLA 5J2NA 4RPFA 5K9FA 1FDAA 4O44B 1VISA 2QA4G 2DNLA 1HARA 3R5GA 1K0VA 1QY7A 4XIUA 3AA8A 4LF1A 3SCKE 1WUUA 3DM2A 2BR0A 3CEDA 2W7OA 2Z2LA 1IKXB 3W8GA 1S59A 1WKKA 2ZC4A 1TMJA 3W9HA 3HZGA 4LF7J 4WE1A 1U1RA 2FJDB 3W2WA 1A0OB 4L72B 4OZ1A 2I6WA 3IXQA 5E2QA 1VFJA 4LBHA 2YNFA 4C9DA 3A3PB 1F5CA 2I9SA 1BQNB 5HVGA 4K7QA 3H5YA 3PTWA 2N7YA 5D8HB 1HNZJ 1RABB 2OP5A 1S7IA 4A8QA 3BR9A 1X9MA 2ATLA 1NJZA 4H4KC 2B4OA 2HQCA 1RISA 3GFZA 3I5CA 3ZXWA 4J9UE 5C25A 4CIOA 1AFJA 2E5GA 4Q45A 1HNWF 4E98A 1Q5YA 2OPRA 1R7IA 4LRDA 2GQQA 1B70B 2D1CA 4OZJA 2RKIA 2JJ4D 4YS2A 5LXYA 3EX7B 1AT1B 2BOAA 2H4WB 5AJ3F 3P96A 5LOQA 1QE1B 2CQ2A 3DFEA 1M1KT 2UVRA 2WBRA 1HQEA 1EB0A 2WZ1A 5IFMA 1WDDA 4DSLA 4GKKF 2AGOA 4U8YA 2E5IA 3BKTA 4WU3A 2KHCA 2KU7A 4DU8A 1NB7A 4UOFA 2NR0A 4EYHB 1RAFB 2P6TA 3MCSA 2BW7A 2F9JA 2FHMA 4NRUA 5GMDA 1VBYA 3BH6B 1G4CA 4O3PA 4LRAA 2G0JA 4OHWA 4C3KA 2RD5C 3H4BA 5B0CA 2DVIA 2HNDB 1XMOF 3TJAA 1NEEA 1F5AA 1FKOA 1X4CA 2OMLA 2WB1D 4CRJA 4CLWA 3G8QA 2G1DA 5KFNA 5HVHA 2DGOA 4H54A 3CJSA 2Y0BB 4PXBA 3KG4A 3LAKA 2MLXA 4IQXA 1E6YB 3AOAA 3DDNA 5KG6A 3TW0A 1VC0A 2FQQB 4ZK7M 4B02A 1XIQA 2KZZA 3IMQJ 4K59A 5T7LB 1B4SA 4TLQA 4DR5F 1T02A 3DRYA 2BJ1A 2IMWP 1WEZA 4PWWA 4UOHA 1C1BB 3UPFA 4RUCA 2HRYA 4F0MA 2PI4A 2Z0GA 4WFNQ 3L7PA 4KHPF 2FZKB 4UT4A 4NL5A 3TZWA 3WC2A 2RRNA 3ET6B 1X60A 1MW7A 4P52A 5M2UA 3MUMP 1NJYA 2M7SA 3MMAB 2HLTA 5LMNF 2C42A 3HKWA 1RTZA 3IBFB 2CPDA 2BX6A 2ZWOA 1Q86T 2V69A 3GG1A 2HPUA 3G9CA 4GKKJ 1H2UX 2FC9A 1WKJA 2WAQD 2B5JB 4HACA 4O3NA 2W4DA 5KFEA 2IVMA 1I3OB 1IJFB 2IJNA 3PZPA 1N34F 1IQZA 4OI1A 4ELUA 4ZVEA 2XZTB 1SC1B 1Y00A 5JMNA 1I1GA 4DQRA 3MM7A 1IKYA 3NCQA 4ZP6A 4DDFA 3PKMA 2YNGA 1RAHB 2GV1A 4DSIA 4WBFA 2QFJA 1N5TA 3EWGA 5ETSA 2ASJA 4IUFA 2X1BA 4Y3CA 3A8JA 4F0KA 5BR8F 4FVMA 5AE3A 2MDAA 5JJBA 3R8YA 2BJEA 3HXMA 4DSJA 1YGYA 2HHXA 5ETQA 4F3OA 2D41A 4N5SA 3ZZTA 4FXWA 3GTYX 2BANB 2HFVA 2HQ3A 2ALZA 2XHWA 1FXDA 4CO5A 4DS4A 2QEXS 4IQMA 4UY85 1SUQB 5HLFB 1R89A 4EGLA 4PQAA 2K1RB 3CDWA 4KY3A 2QL5B 1TL1A 4WYLA 4DN9A 4ZLPA 2F4VF 2RE1A 1HWIA 1Q7YT 1GQEA 2FPHX 1SV5A 2C3MA 1JLQA 1OMSA 3D3CJ 4PXCA 3IP0A 2UXDF 3BGFA 4KAIA 5KG2A 3CCSS 2XG8A 1T3NA 4EEYA 1UW4A 2NS1B 1DHMA 2KM8B 3PACA 4FPIA 5DDRC 4KSEB 5ETPA 2Y0SD 1NSQA 4NOHA 4WE1B 2HVZA 1EAYC 1JJCB 2CADA 1FEEA 4B08A 1QDUB 2WVFA 3KLHB 1CS4A 1TL4A 1S6PB 3AJ1A 4A8XA 1P27B 2CNOB 1ZTWA 2P2CB 2COLA 2BQRA 3MM6B 2DR6A 1NDKA 3ENVA 4ID5A 5HMXA 3QRRA 1YVFA 3KUHA 2GIFA 4KBIA 3W8PA 1FERA 4RBTA 4URGA 2IM0A 3RR8A 1VQ8S 4NA3A 4XPCA 4HKQA 4MFBB 4I2QA 1WHVA 4EMDA 1E6VA 2V2QA 4NLXA 3OBIA 3CCZA 1PO6A 4X4NA 1F5BA 2P8IA 3FBFA 4M5KA 2FLPA 3B82A 4X62F 3OTOJ 5FLXU 1SQFA 4DV6J 4IH6A 2CJKA 3O3LA 2MY8A 1TR0A 3MEGB 3SIPB 3DOLA 1KOHA 2HEKA 2W25A 3JSBA 4OIXA 5D77A 1LFPA 2VG7B 1RB0A 4MYTA 4KV8B 3I96A 3D6HB 3CO0P 1YI2S 5K8MA 3NL0A 4OQJA 4Y00A 1CLFA 3POTA 3H5UA 3PEHA 1N56A 2KT5A 2CJXB 1M1HA 2EFNA 5A2QY 4Y0FA 2ACYA 4HH1A 3QQCD 4P7TA 4CT8A 3HPOA 3OSPA 4OI2A 1X5PA 2XMUA 2MLYA 4JI2J 3MCMA 3SBMA 3TZYA 3PJWA 2QLWA 3J80U 2XWXA 2XMJA 5CQGA 5KFVA 4OV1A 2VBYA 3I4HX 4HDGA 4USMA 4MYUA 1WF2A 2MQNA 2AJ1A 4Q2LA 2GMLA 5A6PA 2DNZA 2NXEA 4I7FA 4B17A 3FQLA 3ENQA 1IWAA 3RG6A 4A47A 4CO1A 4JYAF 3POTB 1H3DA 3EDRB 1C4AA 2GX8A 3OD2A 1YG0A 2VKZG 2CQGA 2GHPA 2PN6A 3DRSB 3L95X 3M2VA 4NEZA 3RB4A 3MPYA 3W63A 3GR0A 4PG6A 2RQ4A 2VL1A 2VICA 3OW2R 3W64A 4J9LA 3Q8VA 2L9DA 5BYRA 1VQ9S 1VK8A 3DI6A 3G6VA 5D4PA 1KRPA 4Q5VA 1U25A 1N52B 3W66A 2VASA 3MFIA 3L4BC 3I6PA 4IFYB 3DDIA 5EUHA 2JWNA 4Z2XA 5HMZA 3VAHA 1JLGB 4DSKA 4LFBJ 2ZBIA 5HL7Q 1M5OC 1N5SA 4TVAB 5IT4A 2CA9A 2BE2A 3A3OB 3J7YI 2XO6A 2QA1A 4DF8A 1L3UA 1RA7A 4IOBA 3HZEA 2JLEA 2WONA 2DKOB 1U2RA 2DPJA 2QA2A 2XMWA 2KT2A 3PFOA 4NEYA 1FO1A 3QYYA 5EDWA 4K4TA 4F3QA 3M30A 1VLOA 3MGJA 1VDHA 3O44A 5F3TA 5IM0B 3P45B 1RT1A 3DI6B 3GB0A 3I9V9 4RNOA 3JTNA 4ED1A 2YQ3A 3UFCX 4ANCA 5EGYA 1IWGA 3VVTA 4WCEQ 3N01A 4CNZA 5KFKA 1MSWD 4KE5A 2E7WA 4GO5X 1N0VC 4HLBA 2MEWA 2VDIA 2PD1A 4QIFA 2DNKA 3CSKA 3M8PA 3CT9A 2AHOB 1RT4B 4LSZB 4DUTA 2MMYA 4ZLNA 2DXFA 1S6QB 2HWHA 4RW8B 4I7FB 4YR3A 1CC7A 4JI0J 2NQPA 2CPFA 1LFWA 3N79A 1N5QA 1XERA 3R5AA 4PPZA 3PXGa 1EIYB 3FSIA 2QIFA 4KIAA 3QFHA 1L3TA 3C6UA 2WONB 2B4VA 2CXEA 2HLUA 2MSTA 4WIQA 4AL7A 4ZP8A 5C2CA 5F9LA 2DBBA 4K4XA 2WW4A 1SC3B 1OY6A 1RTDA 2LFVA 5HBMA 1LWEB 2N4DA 3LOUA 3S1TA 4DV3F 1JLFA 4KO0A 5L1JA 4KPCA 1Q4RA 2MJNA 2RF2A 3RR7A 2ZH1A 3M8QB 1UL3A 1OSDA 2LQJA 4NZ0A 1FX4A 5KAKA 4MKYA 2HHVA 2IDLA 4DX7A 1CJKB 3I5AA 2DTJA 2L9WA 2OAUA 3EPGA 1DQ8A 1HMVA 2ZOFA 5ETNA 1NHKL 4NI2B 4TQSA 3SCJE 2XMVA 3HD1A 2FHOB 1SKWA 3RYLA 2DJWA 2JL9A 3Q22A 1WEXA 4MIBA 1U1MA 1SKRA 4U7UD 5FDLB 5M2PA 3CD5A 2W1BA 5KTQA 3I0SB 2QLBB 4BS2A 3DGPA 3O6QA 1ITPA 2XHCA 2HWTA 2CQBA 5SZTA 1NCLA 4ICLB 4FF3A 2LKZA 4L74A 1H7WA 1NSKL 3DOMA 2BJ3A 4CM2A 3P4UB 2VV5A 3DYAB 4ES1A 1K1SA 4P2FA 1RU2A 3ZZUA 2AX1A 2HRTA 1R6YA 4C11B 4KH0B 2HMIA 4DU7A 3D3BJ 2KN4A 2QG9B 1FRJA 2YKNB 2XULA 1H6KX 2Z2ZA 4C8MA 3SQOP 8ATCB 2U1AA 3V6DA 4JB8B 3OL9A 4N77A 1U6FA 1NK6A 2AT1B 4FVCA 4AL5A 2UV8A 3MI7X 2WRMA 3O1LA 4O4GA 4R25A 4CLSA 4F2SA 2DHGA 2GIQA 1S49A 4ITSA 1KN6A 1Z1ZA 4ZS6A 3TRGA 3ZZ0A 3BSNA 3D0GE 5B0DA 3GV8B 3QZ7A 1D3WA 1TP7A 3MUTP 2V68A 3WHIA 2IM2A 3QAUA 2DY9A 1LWFB 5CD4H 2HZVA 2DGQA 2RS8A 1P1LA 2BRLA 4F4WA 2E9TA 1ELOA 1NK5A 4V19X 4WF9Q 3N6LA 3N6NA 1DTTB 4RBVA 5LT5A 3MEGA 4F8RA 2VIHA 2IMOA 4ZIVA 3VAIA 4LVNP 4W92B 4NLDA 3PV8A 2P6SA 5H9FK 2IBOA 3DCAA 5GADI 1TQLA 2G9OA 3CJ8A 3MM8B 4DZDA 3EZUA 2V2VA 4GMKA 4DSEA 1HR0J 1V6HA 3WDOA 1EKRA 4GKJF 2OD6A 2OPPA 2VJUA 2V9KA 1M5HA 3GONA 3LPYA 2F7VA 5DO2A 3ZTSA 5KT2A 1Q5VA 2XLKA 3IGVA 5B0EA 3PW2A 4FXVA 1ZZNA 2P5VA 3NS5A 3DLLQ 2VFTA 1U47A 4RL1A 2JEJA 1YBAA 2V8VA 3EMTA 1J27A 1VIOA 1TK5A 3GYNA 3C3LA 4R8UA 1RSCA 3DLEA 4ZPAA 2NZ4A 4ER8A 2CNNB 1YWXA 3HFZB 3M1VB 4WTYA 2GVDB 5A6WA 4DPWA 2HQDA 3MR7A 3QWUA 2J5AA 3H59A 3WZ0A 2GQCA 3ZTOA 2GC8A 1S0MA 1KQGB 2FZCB 3VGVA 1S6UA 5IT9U 4PZVA 3MUVP 3A13A 5E3CA 4AQYJ 3AD7C 3I82A 2AMCB 1V3ZA 3CCTA 3HHLA 4U6PA 4D3HA 2YKMA 1PJ6A 1YJTA 4ED0A 4DFMA 2ZM6F 5AXLA 3NRBA 2H48B 4ZLJA 4B9SA 2P9GA 3I0RB 4PG4A 2L41A 1R31A 4A8MP 1U1KA 2J6UA 3BSAA 3MCOA 2I5JA 4J9VA 4LFAF 2EC0A 3TANA 1T3OA 4KT0C 1KS2A 2BDPA 3CJQA 1HBNA 2EBGA 1NDPA 1Q8KA 4A8FA 3N4WA 3F0NA 2HHSA 3K17A 1LV5A 3IFEA 3G8TA 1RLDA 3CCJS 1PAEX 1RWOB 5K20B 3V4IA 4C2MA 1YLXA 4ILRA 1SIZA 5KFAA 2ZH5A 2OEMA 2YQ1A 3N9UC 5DG8A 2VPZB 4F02A 4JI5J 1B7FA 3GFYA 5ETTA 4NE9C 1SH0A 3OJUA 1VOMA 2EBEA 1GX5A 4PG5A 2LU1A 3BGOP 2X51A 2DR9A 1RAEB 1LWFA 1OIAA 2V4RA 4QW9A 5IOLA 2LA6A 3QJJA 3MMCA 3B6BA 1PC5A 5AJ3J 3HHNB 1U09A 2GMJA 3PR5B 4LF6F 2GAGC 1NK4A 1Y3JA 4ED4A 5CA5A 5J2PB 4GC6A 1TUWA 5I3PA 1C0TB 3GJRB 4UUXA 5ETVA 4J9MA 3I4PA 2KG1A 1BC6A 4CP5A 1X31C 3B4MA 2RDDA 3MAAA 2MKSA 3OR1B 1YHQS 1TV6A 2V0NA 4RR5A 3M2UB 4X4SA 3QLHA 2F65A 3O5TB 3LP2B 1UCNA 2G2OA 2GO8A 4M1KA 2KXHA 1XMQF 1W2BR 5D0EA 4DL3A 4LSNA 3SQGB 3TR5A 3MM9B 1HBMB 3GIMA 4K4ZA 3DKDA 2WCXA 4DX8H 2HKEA 2CQCA 1WJ9A 2GHWA 1GXLA 2GA7A 4MAKA 1ZA1B 1QAXA 1FDBA 2HIYA 2L3MA 4UZCA 4LFAJ 2J6TA 5KFUA 1AUDA 3GJQB 1P6TA 3QO9B 4LUBA 4A8KA 1DTQB 1BQNA 3HHLD 1SBRA 2AIRB 3QO9A 2HS0A 1FX2A 2GVDA 2YNFB 3GWCA 3QAEA 1O51A 4NYZA 5CH7B 3ZC4A 2AZ1A 2N3OA 2XGPA 1VI7A 2AU0A 4CH0S 3IAS9 2CZ4A 1T9YA 3MEEA 1I5OB 1VBZA 1B64A 1GTEA 2XCPA 1O5JA 3T1HF 1Q8IA 3EDQB 5E7OB 3L3CA 3R1HA 4IR1A 4U9RA 5KFMA 5EWFA 1R0AB 2AEMA 1TKTA 3LW5C 1OPZA 3HHLC 1OY9A 1TL5A 1S57A 4UW2A 2RS2A 2QN6B 4DR2J 4OYWA 3M8ZA 4ECXA 1JJ4A 4J9PA 5LXRA 2E9RX 4EBEA 1JXVA 3TARA 1RTHA 4CLKA 4DR1F 4K5SA 2MB0B 3KK3B 4EO6A 4JV2A 3UW1A 4LFBF 2CKWA 4FYDA 2C2NA 4N8NA 2FD2A 5EX0A 2KM8C 3BH7B 4DR3F 2IJRA 3Q8UA 3R1LA 3KLEA 2A18A 4WPAA 1REVA 1R27B 2NPIA 3QNWB 3FBCA 4DF4A 3BGRB 4RW4B 1MMLA 3G96A 2PFDA 3AD9C 1PG5B 1SC6A 2EKYA 2ZVIA 1TU0B 2RSQA 2BEFA 2KYZA 2XGQA 2B9XA 1SXLA 3TP2A 4OZ0A 5F8HA 3T1HJ 5B0BA 1NK8A 4IRKA 2A6MA 1HPZA 1DY3A 1HI8A 3D1OA 3I9ZA 1PC4A 2XMTA 3D28A 4YEAA 3QGPA 4USWA 3V6DB 5F8JA 1MWYA 2RHQB 4OV6A 2HWIA 3PKYA 4RUHA 3P5TL 4YHHJ 2MZRA 2OSRA 3MTJA 3CPWR 2VFSA 5T7LA 1MROA 2DHHA 5H9EJ 3M2RA 2MQMA 4EWTA 2KXFA 2LCWA 2CZVC 3QBCA 5HMWA 1GAOA 5IXUA 3H2LA 4RUAA 2Q79A 4FF1A 2PSZA 3IR7B 1SB6A 2HFSA 3KNAA 4ELVA 2DHAA 1ZAXA 2LECA 3LAMA 3CIMA 3J81U 4DV1F 2M5YA 2M9KA 1JNZB 2DPIA 3TAPA 1J5OA 2VONA 2WOMB 3AY0A 4JV1A 3M1VA 4M5LA 2ZJRQ 2ZITA 1H38A 2HBZB 1AA1B 3JXOA 2CQPA 4P71A 3ILOA 3RBZA 2BMBA 5ITHA 5HVFA 2DHSA 1KDNA 4C8LA 3OFGA 3DHWC 5HP1B 2G4BA 1RBOB 1M1GA 1REVB 1FRXA 1QM9A 1SCJB 2OO4A 1WOOA 4WU2A 4ZCIA 4XO0A 2BQ3A 1HR0F 1NK9A 4MIWA 2V5HG 3Q24A 3HK2A 4OI3A 1Y10A 2B4PA 2CQHA 4YB6A 3CF5Q 1YJWS 4AXJA 5F3ZA 1S1XB 1XNRF 3UN5A 1XC9A 3HFVA 1CQMA 1S1XA 3ZZPA 5A8KA 5IZHA 5DGBA 2O1PA 3DRPA 1N54B 1NRKA 2MKIA 1Q79A 3FJ2A 4WXOA 2B0GA 4DFKA 2D3O1 3BF4A 1HLWA 4ECVA 1LWCB 2CRLA 1DBDA 2FGOA 3L09A 3ENWA 1S9EA 4RW8A 3D7SB 3UCGA 4NLYA 3PO5A 3MEEB 1YX2A 5KFWA 1WI6A 2A10A 1NKEA 3T1YF 2VBZA 1QVGR 1AROP 2FB0A 3DLJA 3NGSA 1GFWB 4MK9A 3K5PA 2GCFA 1GMVA 4RW7B 4M5MA 1LXNA 2Q6CA 2IAJB 2D3ZA 2XYGB 2ATCB 2XY6A 3CCES 3CXCR 4KYZA 3DOKB 4QWBA 1R43A 2HHPA 3Q89A 2GS8A 2AV5A 4BWJA 1LK7A 5K8NA 2DNGA 2HVEA 4ED5A 4LFCJ 3THVA 3VR1A 3JAMU 1RT2B 2KRBA 2XEXA 3C6TA 3JYTB 3BJYA 1HHTP 8RUCA 4NLVA 1HA1A 4KHMA 4B3MJ 3BBFA 2NYHA 3FMBA 4NA2A 2W9CB 1RWVB 4GRSA 1XMBA 3NOCA 2W9CA 4ZP7A 3MTKA 3OR1A 1KQKA 5GAEU 2AYBA 2QZ8A 1Q95G 2ZNZA 3MWBA 2UZAA 4EUVA 4DV4J 2F3JA 3D9BA 1U2FA 2PEHA 4JI8F 2OIHA 1SQEA 1UWBB 2XS7A 3UR0A 1APSA 4J91A 4C8NA 2ZWPA 4C97A 4Q43A 1RUSA 2DNRA 2GO9A 4YQWA 3BV8A 3FKBA 4ENOA 2Y9HA 3P49B 2M0GB 2HQGA 3I5BA 4NYOA 2VQFJ 1HNXJ 2FVCA 1TL3B 3CJTA 2B9YA 1TKDA 1RLCL 2WB4A 4DHVA 4C98A 2GJIA 4P7VA 4HR2A 5L1IA 3H8YA 4NXMJ 4QR2A 4ZLLA 2OKQA 1ZPWX 4HYKA 3TO8A 3K58A 2FHJD 4WZMA 1TK8A 3KLEB 4C0HA 1SUQA 4PKDB 3WIUA 2W2QP 1R8HA 1EQMA 2BW2A 2XZWA 4C8OA 1WDTA 2XNRA 4MKAA 5L8RC 4OYMA 4JI0F 2OJ3A 5LMUF 4PUOB 3H0PA 5E3PA 2NUHA 4PUOA 2ADCA 1FESA 4PG7A 4ED8A 3HKZD 1YBTA 2DEJA 3H98A 3PNIA 3JSMB 2R2SA 2R8JA 4ETZA 1FWPA 1SJ1A 1FJEB 1IKVB 3C8YA 3M6VA 1CJVB 3QIPA 5B0GA 2BABA 2DYAA 2V4JB 2HNZB 4C3LA 4DR4F 1SVDA 1ZS6A 1RT6B 4Y2KA 5T14A 2C2DA 2YPYA 2B9EA 4MIAA 3UDCA 4G1QB 3PX0A 1YJ7A 2GAHC 3W61A 3ZZRA 5F8LA 3S6EA 2GW8A 4DN0A 3P6YC 1HBUA 3KWMA 1U1OA 1ZM3A 2B7CB 2G2YA 2V8HA 4NZ6A 4RW6B 3OL6A 1REGX 3EUNA 1DJ0A 3MAQA 4C6AA 4DUZJ 3MOZA 3OTCA 4FKXA 1T9UA 2V34A 4CLUA 1ZH5A 3D6TB 3KMQA 2MYFA 2RF2B 3NGUA 2A0FB 4OYIA 2XI2A 5HK4A 4ALZA 4U7UK 2MKKA 1HNXF 4QWAA 1FJ7A 1S1UA 2JDJA 2XSJB 4H4OB 1HW8A 2W9AA 2PFFB 4FZVA 1HD0A 3BGLA 3SDEA 4X62J 2A2CA 1JB0C 3OTOF 1T03B 4MJKA 3MR2A 5F8IA 3BREA 3MM6A 2O66A 3UVJA 1PILA 4Y6IA 2VG5A 1OSCA 2RJZA 3PRBA 3ZZYA 4DV4F 1TUGB 3MD1A 3N28A 1TFWA 4KB7A 2FJAB 1S0NA 7AT1B 1MN7A 3OLAA 3DRRB 2R7RA 1CPZA 1NBEB 1T0TV 3KK1B 3IRXB 1F6TA 1MLAA 1NSPA 2LDIA 3K5LA 5A0YA 2HNDA 1TVRB 2YNIB 4EZ9A 4A8OA 1XNQJ 2BQUA 4QPXA 1GNKA 1LKZA 2AJFE 4X84A 3F73A 4ED2A 1KQSR 2B6AA 4K4VA 4LF2A 1TMMA 4OHVA 2HZAA 4DQQA 1VRQC 4O3QA 3CC2S 4BHQA 1QAJA 2UXBJ 1VBKA 2HSEB 2DHXA 2P9CA 1EZZB 3V4IB 4MH8A 3HVRA 2F8MA 4ECTA 4ZPDA 2WW8A 3E3XA 3A8IA 4HL9A 1WOSA 3IS9A 1RADB 2Z2YB 5KFBA 4Z7YA 3RBDA 3EM1A 4FNIA 1F9FA 4ZJOA 3DXSX 5HO4A 4IRCA 4DQSA 1S1WA 3GU0A 3NGRA 1RHUB 3LP1B 5HANA 3TX0A 3THPA 2VPXB 3J80Y 2IY5B 2BM0A 1H74A 1FXRA 3R6LB 3BQ1A 3OT9A 3R7BB 3UO0A 2FJWA 3ILJA 1KFSA 4NZ7A 2VFUA 4OLPA 4Q7AA 4AYBD 2OH2A 3GMGA 1XEZA 1TZ0A 4ZJLA 2WVDA 1FVSA 1RWKB 2ADBA 4USUA 4WWSA 3CC7S 2KO1A 4HACB 2L08A 2FLOA 5L46A 2WSCC 4B9NA 1FJCA 4RX6A 2VQEF 2BOPA 3ENAA 1N8RT 1K73T 1RBAA 3K5MA 2X3GA 2OTLS 5IM0A 4DR6J 2FYXA 3D1QA 4QW8A 3AAWB 2AJQA 1Q81T 3NBPA 2JEIA 5D78A 2R7UA 2C2KB 2O67A 1SL1A 5J1PA 4W98A 4KO0B 3DLKB 4ZVSB 2BRKA 2ACMA 5IT0A 3TOQA 2R8HA 3IO1A 3OR2B 2XSJA 2CQ3A 4H4OA 5DLGA 4CYUB 5HROB 1X4HA 1NB2A 4F3MA 1RT2A 1UVNA 4A48A 1FNMA 1VC5A 3CJ3A 2Q43A 2E66A 3DLGA 4MKVA 4MT1A 3P3DA 5KFYA 2FVQA 2Y8YA 3M32A 4ZHRB 1DFDA 2MQOA 1Z2LA 2C2ZB 2D9PA 3T1AA 1WHYA 2Z2MA 5EN1A 1R0CB 2CQ1A 3OUYB 4B3TF 3IN5A 1RJJA 2NUUG 4CTAB 5HJYA 2N82B 3BR8A 1WSRA 2AEFA 3GIRA 4JI2F 4MMOA 4EI2A 1KVIA 1UZDA 2VF3A 2WK4A 1UA0A 1A7GE 1FRKA 1MWQA 4ZVUB 4DV5F 4QWCA 1CJVA 5BR8J 3GZ7A 3G6XA 3OVAA 4EFAC 4DV5J 3KTQA 1NM2A 2VH7A 3SI8A 3DLGB 3SEOA 1YJNS 2VG5B 3D5MA 2CDQA 2EFOA 2DIUA 2YPZA 3C19A 4JBCA 3CCVS 3V6HA 2UU9F 4UUWA 4PAAA 3GCXP 3V81A 5FJ4A 5E3RA 1FI4A 1ROFA 3OXLA 1NKCA 2EC2A 1UETA 5GMEA 3HP6A 1WG4A 1JNRB 2MQLA 2F8HA 3NBPB 3PW5A 2OPRB 3DOMB 4ZPTR 2R7WA 4ICLA 1TL7A 2I8EA 2DO0A 1T9TA 3NKYA 1TTHB 1H7XA 4OYBA 5KG1A 3UR3C 3J7Z5 3UCUP 1VR6A 1B0PA 4AFFA 5E0OA 4DQPA 4ECZA 1JLCA 1MWZA 1MU2A 4W4MA 4RJVA 5LMUJ 2M4MA 3MPVA 4NI2A 1J5EJ 3DRSA 4UTGA 1FE0A 4DR5J 4YB7A 1VLYA 4OHYA 1CULA 1KWMA 2O5DA 2HK3A 2YNHB 3TA2A 2MGZB 2ZH3A 1UWBA 3KLFA 1S9FA 1SJ3P 2JFDA 2YWWA 4C3MA 3MPDA 3S7RA 2AGPA 1FA0A 1LEOA 2GJ2A 3CMQA 4P75A 1FHTA 4LR7A 2B9WA 3PHTA 4TY9A 2C22A 1TAQA 3RGIA 4Q44A 2ZOGA 3LO3A 3CCMS 3KLIB 1UAWA 2ZEJA 5CABA 2R3VA 2YKAA 2F1FA 4OJ1A 1NO8A 4OI6A 4CLPA 2E5JA 3RBEA 5BYSA 3AOCA 3NG8A 2KH9A 2R42A 2C2MB 1TKXB 4X66F 3R6GB 2QJ3A 3T6JA 3A1YG 4RNMA 3DMJA 2BJ9A 3HVAA 1IUJA 1X4EA 2C3PA 3MDFA 4RW9B 4AD6A 2E44A 4CLLA 3PW7A 2AQ4A 1GX6A 2BE9B 1IJEB 2BACA 4LSLB 9ATCB 4YN3B 3RUBL 2XY7A 1FNXH 1X4GA 1TVRA 1S1VB 2Z8QA 1KQFB 3Q2SC 3X1LB 4DCPB 2IRYA 4A4JA 2OPSA 2XNQA 3TEHB 4U67Q 2NREA 1VGYA 3IWXA 1Y5LB 1EETA 2M2BA 3HSZA 4DX6A 1BD6A 4OFZA 4NLQA 3VZIA 5HP1A 4DWIA 4WK3A 3OQ2A 2BANA 3MURP 3CMAS 4DPYA 4H4MA 5U47A 2UUCF 3ZNUA 4DX5A 3VAFA 1HQEB 2J9CA 5IC4B 4FN5A 1KLMA 4L3NA 5CYMA 1RKJA 1IKWA 1JLAA 3RRHA 2JRSA 5A8RB 3FEYB 1R6VA 4LSLA 3KLGA 3ZFVA 4PCQA 3PY8A 2OPQB 2G13A 4CH1A 5AXMA 5E33A 3GSIA 3KLFB 5D4OA 5K8OA 1O8BA 2R7OA 2ZHAA 1XK8A 1YQHA 2BA9A 2CVIA 4G65A 5JVHQ 1XN9A 1AFIA 3FSYA 1A9NB 1T95A 3UDVA 1R3NA 4YFUA 4EZ6A 1VBXA 1XR6A 3R7SB 3CDUA 4BLGA 1YRUA 2GFFA 3LANA 1RDRA 4OZ3A 4CLTA 2XB2D 3FRZA 3FRYA 2LP4A 3LF0A 2VC1A 4P2SA 3KOAA 3SFGA 2ZC3A 2W7AA 3Q86A 4F50A 2K1RA 2MZJA 5CZVA 4M95A 1B7YB 2PEBA 4KHRA 4DPOA 5B0FA 1FDNA 3CJRA 5F8GA 4YP3A 3QPIA 1HWUA 4ATNA 3KLGB 1Q53A 1C1BA 4JI1J 2EEYA 3KDNA 4O44A 3E51A 3NAIA 5RUBA 2RUGA 4XPEA 1D9DA 2R8GA 2WSEC 2XBPA 1YRXA 5LSLA 4WKYA 2DISA 2HS3A 5DZ6A 4OYZA 1N36J 4DMZA 5F8MA 4LMZA 4I2PB 1HPZB 2O01C 3RTVA 5J2PA 1VQOS 3NMRA 5KG3A 3FC9A 5CD4A 3MM5A 2J9EA 1W26A 3H5SA 3M8PB 2VD3A 1X9WA 4RU9A 2H3EB 1YJ9S 1L3VA 4GKJJ 2LMIA 3B4DA 3ZZZA 5KFHA 5KFDA 3QT5A 3AQOA 4MK8A 1B99A 1WOPA 2F5GA 1IM6A 1BY9A 2ZHOA 3C15B 1SKUB 2V8GA 3GP9A 3HDSA 4CTAA 2C3YA 3L7UA 2DNMA 1RT5B 2BM1A 4OX6A 1D0EA 1D9FA 3MMJA 2VODA 3CD6S 1VJQA 2MQPA 4WP9A 3C16A 5GADU 1CQNA 3HO1A 4L75A 1HNZF 3OL8A 4WJBA 4AUKA 2AWZA 3D54A 3QGIA 3UDLA 5KFZA 4IO9Q 2ZBCA 5HROA 2ZZMA 4OJHA 1RHQB 3OPKA 3KHGA 1Q78A 2PE8A 1N6QB 2BKPA 4DOZA 3HMJG 1RWNB 1BWEA 1MMDA 1R0BG 2W2PP 1ICEB 4CO0A 3OLBA 5A8WB 2MGZA 4NLUA 1RXOB 3K57A 3HHLB 4P74A 4DV1J 2R8IA 1SQGA 2LXUA 1MG7A 2B56A 3AXMA 1B3TA 2J0SD 1JXEA 1QUVA 1YRTA 2XYHB 5EX3A 3UNGC 3MFHA 4KGKA 4TY8A 1OPIA 4U8VA 2J8AA 2WOMA 2X3DA 4BCAA 4TU9A 2ZDPA 2PIIA 4PYDA 5K5MA 5KFLA 3TVZA 4HTIA 4IR9A 2A3JA 2JSXA 3D66A 1NJXA 1RT6A 3W2WB 1GEHA 5DDQC 3RAMA 2V4JA 1T05B 2IRXA 4OYAA 1P9YA 2JC0A 4P6QA 1OYDA 3G87A 3LP0A 4LF5J 1IQTA 2W2MP 1GXTA 1U0HA 2EFPA 1FFGB 3KJFB 1YJRA 1MROB 1O0PA 3NCRA 4YB5A 3LP1A 3VZHA 4X4OA 4YB1P 3HT3A 2KI2A 1UTAA 5CYQA 3MPUB 1Y5NB 4ZVRB 2IJFA 1RTDB 3U1MA 5CYQB 4IG3A 2FGCA 3BDPA 1RQ0A 3AHPA 4DL2A 2YH0A 1VQ6S 3KHHA 1WC3A 2QRRA 2RKIB 4FS1A 1Y9OA 1K1QA 4ECQA 2VQFF 2KYXA 1YIJS 4F4KA 2IM1A 2RQCA 2E1CA 4CLYA 2B8QA 2YX7A 4L6V3 4DV6F 4OI4A 2ZHBA 1WNEA 4OLOA 1RWXB 4M5NA 2GJFA 4F4ZA 4TN2A 4X2BA 1ZETA 1YZ6A 4DXLA 1K0TA 2ZH2A 2PA8D 2B5JA 2E5HA 1N88A 6AT1B 5J1EA 2HHUA 4G6VB 3I56S 4K8RA 5F41A 4LF5F 1FFWB 2A2DA 4DPUA 4RW9A 2N7CA 3OTDA 3OUYA 3IRXA 2E1AA 1WD6A 2Y3YA 4U95A 3KK1A 3H90A 2ZH9A 2J0XA 7FDRA 4LF8J 2XQCA 2QYCA 2ASDA 3MM9A 3HVTA 1WTFA 4KRWA 4LFCF 1I51B 1YJUA 1PCAA 1KVKA 4C7QA 4TKTA 4L3KA 2JC1A 4DLGA 3NP5A 3N6MA 1YTYA 3EYZA 2HFUA 4P2XA 1WWHA 3FZBA 3IR5B 2RRBA 3FVYA 1JIHA 2IPOB 4NLPA 3GIJA 2ZJPQ 4ECYA 1C0TA 1MN9A 1P8GA 1HWKA 2MTLA 4OJ3A 4TNOA 3W1YC 4C48A 3QZ8A 1F60B 5ETMA 4OL8A 2KFYA 4P72A 5J2QA 2YNHA 3UD4P 1RTJB 3G6YA 3CWJA 3M7VA 2IAJA 5C24B 3J7AN 2J9DE 2VG6B 3J81Y 3OJSA 1C0UA 1CJUB 3BBCA 4G1IA 4WXWA 2V50A 1FRHA 1UJ4A 5B08A 3PO4A 4B3SF 4CCHA 3J7A1 1FDDA 1RHJB 2DCUB 2EI5A 5IC6B 1HNVB 5LSOA 1JJHA 4ZIWA 1KLNA 1EP4B 1KOOA 2DH8A 4XK8C 5G4DA 1CJKA 2LLZA 4FP9A 1FCAA 1G3OA 1SH2A 2ZOMA 4LF9F 3AQPA 4RKUC 3TAMB 5EHHA 3DLHA 2Y8WA 1FK9B 3F41A 5C42A 4Y28C 3W5YA 1X4BA 2Y1IA 4DJBA 4KJIA 1HI1A 1P1TA 1ZA2B 2NPFA 2WVCA 2FVPA 3TAQA 1RU1A 1C2PA 3LGNA 3GIKA 3G86A 3EXYA 3WX8A 3DLBA 4ILMA 4PXEA 3JSRA 4DR3J 2D9OA 4BC7A 3QMQA 4JI5F 1IN0A 2FUG9 3FK4A 4IKAA 4M5GA 4TLRA 4WIIA 2VDHA 3D6MB 3M05A 4RNHA 1S6OA 4LIWA 3ILLA 4X66J 2AF6A 3PHEA 4WFYA 2UU9J 2FY8A 2HGMA 3BN7A 2D3OR 4V19J 2B51A 1NMEB 4I6AA 3C66A 2H51B 2ZE2B 4KGMA 4BC9A 4J9SA 4FBTA 3G2XA 3NS7B 4O23A 4RZRA 1WF0A 1FKAF 1RAGB 1RTJA 2F4VJ 2GNKA 2IHR1 2W7PA 2JZ5A 2NCKL 1SL2A 3WQPA 5A76A 4HI2A 2IIHA 2PMZD 1XMQJ 1XWLA 1GMUA 4WZQA 3FBEA 2RRAA 1UVKA 2MPUA 2Q3PA 3KLIA 4HHUA 4N7TA 4R5PA 2ZD1B 3T5JA 4NPOA 4Y65A 4QIVA 2R9LA 1B0VA 1L3SA 2CWXA 4C11A 2HK2A 2QSWA 3LPEA 1S79A 1S1UB 3BO4A 2BKNA 1UVIA 2K06A 2M52A 1P9QC 3TVKA 4CQ1A 4DR7J 4H4MB 2AW0A 2PMHA 4C8YA 1VMBA 1WEYA 4OX7A 2W24A 1KEKA 1AYEA 1CULB 4HI1A 5DRKA 1SC4B 1IBCB 4PWDB 1FJGF 2QE5A 5G0RB 5LL6d 2J7UA 4RW6A 3ULHA 1XNQF 8AT1B 2E1MC 3LGHA 3PRVA 3C15A 4I67A 3FGVA 3KHRA 2OEJA 3LUYA 1YKWA 2DEIA 2YX4A 4DR1J 3EGWB 2FJXA 1WG1A 4IOCQ 3BSOA 4LF6J 1I94J 3US5A 5D0HA 3AFGA 3CCUS 2BJDA 4P2MA 3R3TA 2V63A 2D69A 4K4WA 1TKXA 4DUYJ 3FCWA 3OTEA 3DN9A 2KFZA 2HBRB 2EFVA 2XYPB 3V2UC 4DFPA 3CD0A 3KJQB 1M5VC 4K50A 2FIUA 4GVBA 1FRLA 4K2XA 2FZGB 2AZ3A 4LBIA 4LVOP 2JLGA 5DGAA 1FD2A 2HQIA 1PYTA 4F36A 1SJ4P 1YJVA 3H42A 3JSYA 3UWTA 3W5ZA 4KFBB 4WKRA 1HHQA 3EZ5A 1V5VA 2HZCA 1KFDA 1WACA 3R5JB 4NA1A 2BXJA 4OZNA 1S97A 4QR1A 2UUAF 4I64A 3PX6A 1UA1A 4BBYA 1U02A 4LR8A 1VRTB 2G0IA 1NPKA 1BLUA 3O8WA 2XC9A 1KC8T 3H25A 3ISNC 1I94F 4XDDA 5K14A 4ETXA 2HFOA 2JEFA 3PYDA 2VG7A 1DTQA 1S10A 1JX4A 2HNYB 2IYGA 3M9MB 1FWKA 4J9QA 2AX0A 3B8HA 2DRDA 3VAMA 1ZAVA 2VBWA 4M5DB 5KT5A 3FUYA 3QSYB 2UUAJ 4KTQA 5F0WA 3BQ0A 3R2DJ 2IA0A 1ZZFA 5J2QB 3HSGA 1W25A 3TZZA 4IYQA 3PYEA 5HQLA 3SQGA 2RNEA 3C14B 3ONQA 4OHZA 1WI8A 2LQ8A 2LDYA 3IM9A 1HYSA 5THWA 1U1PA 3MD3A 3K5NA 5GVQA 2VPWB 2NLWA 3UE2A 4YDDB 4X4TA 2ZD1A 3AXKA 1YSJA 3EXCX 3FFIA 5SUHA 1ZAWA 2V2KA 2YX1A 3C6TB 1JLGA 5GAEI 4YY3J 3R9LA 2XMAA 3CJ4A 3JYTA 1KVJA 4XDCA 2RDJA 3CDBA 1PYOB 5CZXA 4DR7F 1IBLJ 1S1TB 2EK1A 2DNHA 5AE1A 5GAHU 2MZ1A 1U49A 1FD8A 1S6QA 2YKQA 4M5DA 1NZAA 2R2TA 5I42B 3HCXA 3HF5A 4DV0J 1UJ5A 3H20A 1U0SA 4X4QA 2NXJA 3EVOA 1R8AA 5FDLA 1Q82T 4Z7CA 3O2IA 2UUBJ 3W62A 4ED6A 1QAYA 2GVZA 3SCLE 4WFBQ 4JI7J 3E8OA 4JV0A 4EYIB 5IV3A 3M6XA 3RB6A 4FF4A 2MLZA 1VQ7S 1S7HA 1TL7B 3PR4A 4J7CA 2E7XA 2BJ8A 4KC5A 4ES2A 2V9WA 3RRGA 1U8WA 3RJMB 4P9SA 1ZPVA 3M8YA 3BO2A 1HI0P 1KKHA 1NLKL 3KK3A 3AD8C 1BMQB 1N5VA 2RILA 1JMTA 3KNGA 5BJRA 3LWLA 3V81B 5KFGA 2FY1A 2BE2B 4DL6A 3FCVA 1Y7PA 1A6LA 3BYPA 3GLJA 1CC8A 3UCZP 5L9NA 4XAKA 4F0HA 4O0IA 1TKTB 5ETRA 3TJ8A 2YNGB 3BB5A 1F1BB 4L73A 3HJFA 5KT6A 1VRUB 4OYPA 1QSSA 4Y2IA 1QD1A 4B9VA 3CIZA 2ASLA 4QYZJ 4NXNF 4I56A 2A1BA 3OFEA 4KV8A 1OS5A 3GFHA 4CM0A 4QYZK 1EQ0A 3WIVA 1VHIA 1OJ4A 2DNPA 5KG0A 2LQ5A 4YUDA 1NDCA 3PVXA 3QGGA 2ILYA 3MMAA 2RUSA 4I1TA 1IBMF 3FDSA 1U8SA 1NK7A 2CG8A 1K44A 2ABYA 3RZAA 1S1TA 4M5HA 4TU7A 3KLVA 3BO3A 2I1RA 1E6VB 2W2OP 3DGVA 2OPQA 3ZTQA 2KVQE 3CW2C 4DUZF 2DR8A 3R5CA 3ADAC 2EPIA 1PYSB 2ROEA 1R8PA 2DK2A 3LP2A 5E5NA 1RWMB 1N4LA 1LWEA 1ZBTA 2B43A 1C1CA 2BKOA 2CPYA 4R5PB 2EFGA 2DRAA 4IDKB 4LF7F 5DQIA 3L9ZA 4IFYA 1RWWB 2W4CA 4J9KA 4HDHA 1BE4A 3T5KA 3UN3A 1D9AA 2RIJA 3NWGA 4CWBA 5GAGI 3PIOQ 3D67A 2GGPA 2EXUA 3TWZA 3IAM9 3ITHB 3G6ES 5HAOA 1MNEA 1V5IB 1JKHB 2DGWA 2DGSA 1RI7A 2XI3A 3NNAA 3GE9A 1X4FA 2QGFB 2IVFB 5CXTA 4R0EA 3QGHA 4BWMA 2VUGA 3IBCB 2UV8G 1F2HA 1FFSB 3QFWA 3PIPQ 4DL5A 4LF8F 3V5RA 4ZN3A 2HHWA 2IC3A 1HIYA 4Q2MA 2XY5A 4J37A 1ACMB 4B3RJ 3AB4B 3NXZA 5JUMA 4JI3J 3W7BA 1YK9A 3CD7A 2DO4A 2KDOA 3IGNA 3MEKA 4TYBA 3JQJA 1M0SA 2B4UA 3QT8A 4NLWA 1T03A 4IFVB 2C3OA 3SDEB 2YH1A 1H72C 1NH7A 1N5YB 3I55S 2JX2A 2AJ4A 4ID5B 4ECSA 3OHBA 4HEA9 1FRMA 1M5SA 3ZNJ1 4DL0C 2UUBF 2AD9A 5B7WA 2K2PA 3PX4A 1VQLS 1NPPA 1EJ7L 2LXIA 3R5DA 1H2TZ 4JI4F 3H5XA 3DGPB 5D4NA 3RU0A 1AZSA 5DQHA 1XNRJ 2F8EX 3NNHA 3PM9A 1HNVA 1T9XA 3KK2A 3TJ9A 1HBOB 4R0JA 1TL3A 2MXYA 1PIEA 1VC6A 1QSYA 4TY8B 1NDLA 3SCIE 4LRCA 5DS7A 1RKIA 2V8PA 4OZ2A 4I68A 2YWFA 3G71S 1H73A 4B3OB 2ZUAA 3E01B 5HI7A 2MHEA 2BV3A 2APOA 3QIPB 4X4PA 1N48A 1G6BA 1OQ3A 2UUCJ 3EVWA 1M90T 5KFOA 3HSJA 1LW0B 1XR7A 4KKOB 3CCQS 4ZVTB 1IVZA 1T9VA 3UVJB 5L1LA 2KJVA 4I2QB 2QL7B 2NYIA 3BZQA 3R97A 2MZTA 4NCGB 4Y2MA 3MPWA 5AE2A 4N76A 1X4DA 2GMHA 2JVOA 3SFUA 3GQCA 4ECRA 2MHNA 1WC1A 1IM4A 2K8GA 3HULA 1JLEA 1HNIA 5F9NA 4A8YA 4DG1A 3D68A 3HVTB 1FNOA 3C16B 3F44A 1S4FA 3QT7A 2E29A 4TYAA 4L76A 1OO0B 3GYXB 4GO7X 4O4RA 4ZPWR 5DG9A 3KLHA 2EK6A 2WHOA 1UFKA 3G82B 4JP8A 5EWEA 5D3GB 1RT4A 4QCLA 1SI9A 2B7BB 3W9JA 2HS4A 2ZE2A 1CG2A 2G2ZA 2MQ8A 5K8PA 5KOWA 1U45A 5CCMA 1V3SA 2K3IA 3NAHA 4G1QA 2R7SA 2D74B 1X0FA 4NCAA 1SV5B 4ZA1A 1H98A 2CFXA 1GMWA 2CJYB 4N56A 1R8BA 3MEDB 2E5LF 3R2CJ 3AA9A 5HJXA 1SIWB 5E41A 1RT1B 3CJKB 4F4AA 2N3LA 2NSBA 4DG1B 2VU5A 2YXLA 2HRUA 1X5OA 3HVWA 4DSFA 3T5LA 1KTVA 2YWEA 4ZITA 4CYUA 4QWEA 1QVFR 1H0HB 3FFIB 1N34J 2FJBB 2PC6A 4DCOB 1VQMS 1IBMJ 5I3UA 5KFXA 1J5EF 4GVLA 1IBLF 4LQ3A 4RO0A 3MR6A 2P9EA 3GCWP 3Q8SB 1HQ2A 4KKOA 1D8YA 4ZMMA 3CUNA 2V8DA 2YVSA 3MM7B 4A46A 3CJ2A 1U24A 1LNQA 3CCRS 2HVIA 1Y11A 1IR2A 2VPYB 3U02A 3H4DA 4DR2F 1L5UA 4Q8FA 1VQYA 2KJWA 3TQEA 2HW3A 4LRFA 2ROPA 3KUGA 5I3QA 1HBOA 3EE3A 1HWLA 4Q0BA 3N0VA 3SXLA 2HGLA 4FYVB 2EG2A 2ZH8A 1KHVA 3PW4A 2HNZA 1U1QA 1VQ4S 2C3UA 2WBMA 1LWCA 2NXUA 3ZTRA 3K5OA 5HLFA 1YBUA 5D15A 4NLOA 1QTMA 1CJTB 4OYXA 4PEOA 2ZZTA 3M2RB 1RCOB 2YY3A 4PR6A 1F9EB 1U7LA 4PPDA 3Q23A 4LF4F 2CJQA 2VKRA 4EU0A 2ZJQQ 1TV6B 1S76D 3FZ2A 2X1FA 5EWGA 2ROGA 1SJFA 4MKBA 2W01A 4TU8A 1U2CA 4O3SA 1FE4A 1NAQA 4FXDA 2CPEA 3OFFA 3RBXA 3DOKA 3EJMA 3G8SA 4B3TJ 5LM7E 2ERRA 1RAAB 2Y1LB 3CMES 2GZOA 2C2RA 4F26A 1RHRB 1G7CB 5H9FJ 3SMZA 2QYGA 1RT3B 1T94A 2GQ2A 3B54A 2EWHA 1S5ZA 5J1EB 1RT3A 3TQ1A 4X4UA 4DEZA 2CUYA 3Q8YA 5L1KA 3NMAA 1F0XA 4J9NA 5GMKa 2VA2A 3FSXA 2OLWA 3DRRA 4WYWA 3UDEA 1PKUA 1RTIA 1NXIA 4ZCKA 3GJTB 2OFGX 3K8WA 1OQ6A 2UXCJ 2BBEA 2KRRA 2YWHA 2E7VA 1X4AA 5A8KB 2AEJA 4C8ZA 4QR0A 5KT4A 2B3TB 3MZIA 4ANEA 3JTPA 2RQMA 4LRBA 2CZ9A 1WC6A 3M6WA 3TAMA 3JQKA 5HATA 4ZPVR 1SL0A 4ANDA 3A8KA 3NY0A 1S99A 5J2MB 2FC8A 5CHCB 5GAHI 3T6BA 1FEHA 4W90B 2V67A 2VC0A 1MMNA 4JOUA 4LQ9A 4YHHF 4LF4J 1G2EA 5MLCV 4HT7A 1HQUA 5DZ7A 3SSRA 3H40A 1YDLA 3Q8QB 3KYLA 4KGXB 4DPTA 5KT3A 2SXLA 2DNNA 4QPTA 1BQXA 2MKHA 3C46A 1LXJA 3R5BA 1Q16B 3QSIA 2HBYB 4USJC 5ETOA 1M5PC 3NNCA 2HAIA 2MY7A 4OX9F 3K59A 2JOQA 2MZSA 5KFTA 4CNYA 3M9OB 4UF4A 2H5EA 3EVMA 2KL8A 3CVKA 3HHEA 1B0TA 4FDFA 2H5IB 4NWBA 4QIEA 3WX4A 4DUYF 1S72S 2KZMA 2HHQA 3QATA 1AW0A 2UXBF 4CLZA 3M9NB 1X9SA 1VQKS 1KSPA 2V6AA 3MXHP 2M70A 1BUXA 1UEUA 4GVBB 1WC5A 4DLEA 1FTCA 4HVZA 3TYTA 2Q1LA 5F8NA 2EG1A 2J0WA 4O0NA 3TZXA 3C6UB 1WC0A 4P10A 1VJWA 1RTIB 2J7WA 3C2PA 3E2EA 1Z2ZA 4FKYA 2I38A 5LMNJ 2DB1A 2LU2A 4ZVFA 1WTBA 4N47A 1KHWA 1Q0NA 1NNDA 2DH9A 2K7JA 3CB4A 3MMCB 4DBQA 1RT7B 1UPPA 3GR1A 3D2WA 2AYEA 3S8SA 1DTTA 1NSAA 4LT6A 3KJNB 3PYFA 1CVJA 4ED3A 3FEZA 5L9XA 1RK8A 3PDNA 1JLBB 3HSDA 4I0WA 4ZVOB 4FYWB 3CGIA 3LWMA 4OZ5A 1QSLA 1S9GB 3BQ2A 1RACB 2HBQB 4DQIA 3CCLS 3KG0A 2O3DA 3T41A 4USTA 3BGRA 4U96A 1CSJA 1ZM9A 4U7CA 2RT3A 2ZH7A 2W8KA 3VAKA 2E5LJ 2XWYA 2OTJS 2E1RA 1PJ5A 1QUPA 2BVZA 2DNQA 3CE8A 4HTJA 5KFRA 5A8WA 1SPBP 4DV7J 4LSNB 2DGTA 5F0UA 2LYVA 3MOJB 4IDKA 2DGXA 5B0AA 3W9IA 2Z56B 1DQAA 1C4CA 3PG9A 5KFPA 3Q8PB 2UVWA 3V6JA 1WSVA 2C28A 5DETA 3NGTA 4WP3A 1XTZA 1UEVA 3AJDA 1NKBA 3AH6A 1IR0A 1TKZB 1S12A 1OWXA 4C0BA 4KQZA 4YMEA 1X5SA 1E6YA 2CQ0A 5KG7A 1K9MT 5GAGU 2OEKA 3VCDA 2QMWA 1VHFA 4NYPA 3KJVB 3RB3A 4Y34A 1HW9A 1D8ZA 1VQSA 2PT0A 5FIIA 2V4QA 4K4UA 4B9TA 1HBUB 3R27A 2X1AA 3CTRA 3MCNA 4DS5A 1J2VA 3GPAA 4RW7A 2RDIA 2YWGA 2FJEB 1IBKF 2UXCF 2OD4A 1HQUB 2FHJA 2Z4PA 4RU2A 2M8DB 1TAUA 1M5KC 4LJMA 1AZSB 4PQUB 3W2VB 4DR6F 1X5TA 2CQDA 1WELA 3IWLA 1HBMA 4M63A 4DL4A 1FWLA 4G1PA 4IH5A 1RWPB 4DV2J 1QJHA 5IQQA 4ES3A 4QYRA 3ICLA 5ETLA 1DRZA 4LF9J 2IVYA 1X8DA 3AB2B 3EPIA 1OY8A 1LOUA 2OMOA 4DZ6A 1S0OA 1JK9B 2ALYB 1X0PA 2DITA 3ILIA 4IOAQ 2OPPB 2QL9B 4AE5A 3CDAA 4ZJQA 3T9ZA 5IS2A 4JI4J 2QLJB 1U0HB 2FHKA 1IR1A 3FEXB 3W5XA 4TQRA 1N0UA 1R0AA 1GK8A 2YKMB 1RT5A 4DV3J 1RAIB 1DARA 3NWRA 2VA3A 1DAXA 4ID8A 2ZBQA 3OSNA 4PQUA 2HVHA 4O3OA 4K4SA 4H4KA 4Q0BB 4M8LA 2GHVC 1GXUA 2HVDA 1UFLA 4KR0B 3H2VE 4CH7A 4RWWA 1QLNA 5LSRA 3QJLA 4B3RF 4EBDA 2L48A 3K8VA 4FBUA 2IFXA 5C5JA 2R4FA 4NMXA 4G3IA 4CO3A 2JH3A 3MM5B 4RWXA 4PWDA 4AQYF 4CZCA 5J2MA 1KP6A 1SH3A 2LEBA 1FTRA 2KXNB 4HH0A 4CT9A 3K2YA 4N8OA 2HFZA 2U2FA 3NEKA 3PCOB 5DJBA 2HHHJ 3SZ2A 3LALA 4WP8A 1YITS 4KPYA 3ELHA 2IDEA 1RWUA 5I4MA 2VOPA 4A8SA 4ZOSA 1RA6A 3AOBA 4KGVB 2DGUA 2X1GA 2PMWA 3X3UA 2IBKA 1HYSB 2V94A 2MKCA 3K0JA 2VJVA 3VHQA 3SV4A 5D0GA 1UJ6A 3PJXA 4NLRA 3ZZOA 2J6SA 1S6PA 5AT1B 3N5BA 4EK2A 4USIA 3E01A 4PABA 3M8WA 3DNCA 3PFEA 4ZVPB 1EARA 2AYMA 3KG1A 3JS9A 3RAQA 5DLFA 1Y4ZB 3T9NA 2F40A 2X7IA 3B78A 3VQSA 4RNNA 2F4FA 2N4CA 3M2VB 2G1HA 4NX9A 3BGUA 1QAIA 3GFXA 2DXEA 1HD1A 1ULRA 2BYCA 1FRIA 1VRUA 4RBUA 2LQ9A 5HSPA 4C4WA 2QT7A 4I69A 3U1NA 4OMFG 3M8QA 4QQBA 3JSMA 4I2PA 4DV2F 4JI3F 2ZNYA 1S77D 3IWNC 2C2OB 2KHDA 2Y1JA 2DGVA 4IFVA 1N5YA 1CEZA 3U1LA 1ZM2A 3VQTA 4S0MA 4WFZA 4CLFA 1KD1T 1CBKA 1U4BA 2JEGA 2OFHX 3ISND 3GILA 5AXKA 3VGTA 1IBKJ 4V1Ak 3W60A 3QRPA 3MM8A 1BHNA 3NLCA 4MK7A 4B9LA 2ZBRA 2HIQA 2R2RA 3VALA 4J9RA 2POKA 4O3RA 2UVVA 1IKYB 5KOXA 2CYYA 2UP1A 4ECWA 3GSDA 3MEDA 1VK3A 3I31A 3BPDA 4CO4A 4DI6A 2YBVA 5E3AA 3ETOA 5BYQA 1WC4A 2KKHA 1BQMB 3DOLB 4F67A 4XTTA 3F56A 5DQGA 2JHEA 4K5RA 1HMVB 2CJAA 2ZBPA 3G82A 3P8BB 3SYZA 4ELTA 3FQKA 1DZ5A 2QSFA 1PAUB 3AJ2A 3MF5A 4HHJA 1FF2A 2MZQA 2K3KA 5IT9Y 4JI7F 1OYEA 2JNJA 1W7WA 1AB8A 4LREA 3NGKA 3KFWX 2CWKA 1RBLA 4MFBA 4USKA 4UQGA 4NCBA 4F4YA 4K2JA 3VWSA 3TA0A 5HBMB 3J7YU 3OVSA 2JVRA 1KR4A 7FD1A 4ZVGA 5B09A 2Q6BA 3JQMA 3H7HB 2PA3A 1CS4B 2HG4A 3DHXA 1UFWA 4I4BA 2CIMA 3BS9A 4ED7A 4B9UA 3HFKA 2BE7D 5AXNA 4B9MA 3AODA 3EGZA 2DR5A 2VZ9A 4B3MF 1S9GA 3BSCA 2DNOA 4LBPA 1JLCB 1MU2B 4X4RA 2QA4S 3PEJA 3SSQA 1PGZA 2HHHF 4ILLA 2RB7A 1Q1KA 3ISZA 6FDRA 1RAOA 3BM7A 4YDXA 3NS6A
chains in the Genus database with same CATH topology
2LQBA 2QMXA 3NGDA 1RGVA 3J7ZT 3BEGB 4QOTA 3MAHA 2FVSA 2KG0A 1GTHA 4Y2AA 2ZH6A 1ZTTA 1TFYA 1JWWA 3TUZC 1Y0HA 2M8HA 3T5HA 4URQU 1ZOTA 2R8KA 4FF2A 4E0DA 3OFHA 5E3QA 1BGXT 1JLFB 1RTHB 1IXKA 2Y1RI 2HHTA 4I6WA 1HBNB 1QE1A 2IRUA 2KVIA 3DC2A 2YKNA 4IG0B 1U6ZA 3MOJB 2L9NA 2HMIB 2E9ZA 3M6UA 4EO8A 4PRFA 1L3KA 2FDNA 2I2YA 1U6BA 2XS5A 4IRDA 5C42B 3LGMA 2YWKA 3LP0B 2KT3A 5H1SV 3OXGA 2VOOA 1LW0A 4DV0F 2ASYA 5CYJA 3K7RA 5D6GA 2HYIB 4ZPCA 3DU5A 4NLTA 5C25B 4ECUA 3WC0A 2C2EA 4FPRA 3KKFA 4AL6A 2I0XA 2J0QD 4D3GA 2UUTA 2ZKTA 3LH2S 4RNFA 3D0IE 4K0KF 2YNIA 3OHAA 4ZPBA 5MAOA 2FLLA 1HFEL 1VS3A 2YTCA 3DLEB 1HWJA 2IYIA 4QBUA 1KONA 4R8UB 2GGPB 5L39A 4ZKAA 3IG1B 4NLSA 5DM7Q 1X7VA 3A8EA 3OV7A 2RU3A 4NLGA 3L7OA 1WF1A 2ZUGA 4C0OC 5IWAF 2DD8S 2NSCA 4QIGA 5A8RA 3QLHB 1S1WB 5KFIA 2JFKA 5J2NB 5KFSA 1DURA 4F2RA 1UVMA 3VAJA 1LQ9A 1LK5A 4F25A 3IRWP 2MKJA 1WHWA 3OL7A 3OVBA 3DDKA 1EETB 3MR5A 4Q8EA 3LQVA 5KFQA 1U26A 4OX8A 4PXDA 3QJPA 1G1XA 3NCPA 3DXBA 3H2UB 1JLBA 1DLOA 1RYRA 4X4VA 4X65F 1DLOB 1SJQA 4YOEA 2DNYA 4J5OA 3GIIA 2DIVA 4GC7A 1RAJA 5I42A 2F4VF 3DMJB 3V4MA 4RW4A 3DU6A 2XO7A 3M8RA 3RW7A 2W9BA 3RB0A 3I32A 1NU4A 5LJ3Y 3M30B 4KFBA 4Y2CA 2RQKA 2ILZA 3UQSA 1JLEB 1HNIB 3DRPB 1FVQA 4IG3B 2CQ4A 3PRDA 2ZKUA 3OR2A 2I5JB 1I6JA 2KFNA 1Y5IB 1PSDA 2R7TA 1D0EA 3N5FA 3CJ0A 3DRXA 1FK9A 1XC9A 1U1NA 4ZDNA 2ZZNA 3V6KA 1VQNS 5M2RA 3FNNA 3I0SA 5DG7A 3QIDA 1VQPS 4QWDA 2QV6A 5A0YB 1UVJA 2FVRA 2PO4A 1C0UB 2XLJA 2R7QA 4UOCA 3KK2B 3RRKA 4IO1A 4NMLA 1VRTA 1H2VZ 1KNZA 2LEAA 4IH7A 3CULA 4OZLA 5JXSA 1IKVA 2PDAA 2UVUA 2K7KA 4UY8T 2ZH4A 1CPZA 2QO3A 4CI0B 2BZ2A 4A8WA 1VIXA 6FD1A 2MJUA 3HHDA 1N6QA 4Z37A 2J7KA 3M2UA 2WTFA 3GV7B 2XMMA 1NJIT 4QU6A 4MTPA 3KMSA 4QZVB 2MQQA 3OXFA 3FMWA 4ZVHA 3VTIA 5KFCA 5KT7A 3IBWA 2RU9A 4QU7A 2OPSB 4C8KA 1URNA 2M3DA 4CO2A 1BQMA 3W3SA 2B6AB 1SKSA 1LW2A 4ERDA 4OJGA 4HT5A 2AJ0A 2CVEA 5K14B 3TVYA 4ECVA 2J76E 3QWPA 5LJ5Y 2GIRA 2VFRA 4TXSA 3D0HE 1JKHA 3TX8A 3ITHA 1TL1B 4JUZA 4URSA 1S9EB 3Q2TC 5G0RA 2QLXA 3RAXA 4OI0A 4FS2A 2AYGA 2ZVSA 2AP6A 2DR7A 3TNVA 3UD3P 2CJBA 3BN4A 1RYSA 2ZFHA 1RP5A 1KTQA 1UKUA 2XMKA 1HHSA 3TUIC 2KTQA 3SV3A 2CJ9A 1C1CB 3SSSA 2EFQA 4JV5F 3JAMY 3Q0AA 1UMJA 3Q8RB 3PW0A 2J9DA 1K8AT 3FCHA 1T05A 1Y3KA 3HLUA 4OHXA 4X64F 3HX9A 1U48A 1T8EA 2RMLA 1WHXA 5JVGQ 1AXQA 3EGNA 2F9DA 1JLQB 2VG6A 4UQTA 2DCLA 3CCWA 5KG4A 4PWUA 2DRBA 1IKXA 1GT8A 1S48A 2HFNA 3DM2B 2IM3A 5HQ8A 1N32F 2LXFA 1TKZA 2EVZA 3S01A 2RVJA 2H9ZA 5I3UB 2R7XA 5T41A 1XBWA 3CJ5A 1NHVA 1IKWB 1JLAB 3HHKA 2Q66A 1KLMB 5CYMB 1HL6A 4EBCA 3UI3A 4DFPA 2R2UA 1Q8LA 3MHYA 3MECA 5L38A 4YR2A 1FKPB 5FLXY 4M94A 2XSFA 2DT9A 4WK1A 3CJKA 2CPZA 2LA4A 1NHUA 1UVLA 2OSQA 1V9OA 1FKOB 2RH3A 2VBXA 1TK0A 1EP4A 3JTOA 4F4XA 1DQ9A 5IQ6A 3MMBB 4WFAQ 4K4YA 3MMBA 1FT8A 3D1HA 2PI5A 2W4PA 1J5OB 1R8CA 1ZM4A 3I87A 2KB2A 3KJVA 1NJWA 3M32B 4ZHRA 1URRA 2MSSA 1FKPA 2YKPA 2LEPA 3U7JA 3TI0A 5HMYA 2D7SA 4NCGA 3WBZA 2JLFA 2CG4A 2PGCA 5ADZA 2BUNA 4ZCMA 3DLKA 1TUVA 2CPJA 1SJRA 2CPXA 5KFFA 4BDPA 3I0RA 1T7PA 3DYAA 4ZP9A 1XR5A 2XCAA 2FTRA 3THTA 2G0CA 1Z4UA 1VQ5S 1N36F 2WSFC 3IG1A 4ZCLA 4AXIA 4DFJA 1S0VA 1V3RA 4B3OA 1F2GA 2VB6A 4DL7A 4QJVA 2CPIA 2EW9A 3GG0A 2YKOA 2FLNA 2FJVA 2CPHA 3U27A 4YR0A 2HNYA 2D3UA 4JI1F 4E8UA 1GH8A 3HI9A 3TUJC 3M8SA 2DH7A 3RW6A 5C24A 3G4SS 4QIWD 3VAGA 5J1NA 4J9OA 4JI6F 5DDOC 1W2IA 2W8LA 4DV7F 1Q7LB 3T19A 2VFVA 3CO9A 5KFJA 3MR3A 4IG0A 4NXMF 1NK0A 5HN0A 4LIRA 2CQIA 3TA1A 3BDEA 3IS9B 5KG5A 5FD1A 1Q8BA 3M4XA 4USHA 4N41A 3IC1A 1D1UA 2W9BB 4I6YA 4NRTA 4PG8A 2IA6A 2IC3B 2M88A 4WFXA 3W2VA 1UP1A 1S1VA 2HGNA 5D4LA 3GV5B 1FXLA 3JB9k 1LW2B 4FNHA 4YY3F 2LVWA 3VF0B 1RT7A 3OTBA 2AGQA 5CCLA 2XS2A 5D3GA 1WG5A 2UUWA 5DDPC 2ZDOA 3HM9A 4O4GB 1U1LA 3IR6B 3MECB 1ZYQA 4RLEA 3T3FA 3CDEA 1NH8A 2XLIA 3IA0A 3KHLA 5J2NA 5K9FA 1FDAA 4O44B 2QA4G 2DNLA 1HARA 1K0VA 1QY7A 4XIUA 3AA8A 3SCKE 3DM2A 2BR0A 3CEDA 2W7OA 2Z2LA 1IKXB 2ZC4A 3HZGA 4WE1A 1U1RA 2FJDB 3W2WA 4L72B 4OZ1A 3IXQA 5E2QA 1VFJA 2YNFA 4C9DA 1F5CA 2I9SA 1BQNB 3H5YA 2N7YA 2OP5A 4A8QA 3BR9A 1X9MA 2ATLA 1NJZA 4H4KC 2B4OA 1RISA 3GFZA 3I5CA 5C25A 4CIOA 1AFJA 2E5GA 4Q45A 1HNWF 4E98A 2OPRA 1R7IA 2GQQA 2D1CA 4OZJA 2RKIA 2JJ4D 5LXYA 3EX7B 5AJ3F 3P96A 1QE1B 2CQ2A 3DFEA 1M1KT 2UVRA 2WBRA 1HQEA 5IFMA 4DSLA 4GKKF 2AGOA 2E5IA 4WU3A 2KHCA 2KU7A 1NB7A 2NR0A 4EYHB 2P6TA 3MCSA 2F9JA 2FHMA 4NRUA 1VBYA 4O3PA 4OHWA 4C3KA 2RD5C 3H4BA 5B0CA 2DVIA 2HNDB 1XMOF 1NEEA 1F5AA 1FKOA 1X4CA 2OMLA 2WB1D 3G8QA 2G1DA 5KFNA 2DGOA 4H54A 4PXBA 3KG4A 3LAKA 4IQXA 1E6YB 3DDNA 3TW0A 5KG6A 1VC0A 4ZK7M 4B02A 2KZZA 4K59A 5T7LB 4TLQA 4DR5F 1T02A 3DRYA 2IMWP 1WEZA 1C1BB 3UPFA 4RUCA 2HRYA 2PI4A 2Z0GA 4WFNQ 3L7PA 4KHPF 4NL5A 3WC2A 2RRNA 1MW7A 5M2UA 1NJYA 3MUMP 2M7SA 3MMAB 2HLTA 5LMNF 2C42A 3HKWA 2CPDA 1Q86T 3GG1A 3G9CA 2HPUA 1H2UX 2FC9A 2WAQD 4O3NA 2B5JB 2W4DA 5KFEA 2IVMA 2IJNA 1IJFB 3PZPA 1N34F 1IQZA 4OI1A 4ELUA 4ZVEA 2UUAF 1Y00A 1I1GA 4DQRA 3MM7A 1IKYA 3NCQA 4ZP6A 4DDFA 3PKMA 2YNGA 2GV1A 4DSIA 2QFJA 1N5TA 4IUFA 2ASJA 2X1BA 4Y3CA 5BR8F 4FVMA 5AE3A 2MDAA 5JJBA 3HXMA 2BJEA 2HHXA 4DSJA 1YGYA 4F3OA 2D41A 4N5SA 3ZZTA 4FXWA 2BANB 2HQ3A 2ALZA 2XHWA 1FXDA 4CO5A 4DS4A 2QEXS 4IQMA 4UY85 1SUQB 5HLFB 1R89A 4EGLA 4PQAA 2K1RB 3CDWA 4WYLA 1TL1A 4DN9A 4ZLPA 2RE1A 1HWIA 1Q7YT 1GQEA 2FPHX 1SV5A 2C3MA 1JLQA 3J7A1 4PXCA 2UXDF 3BGFA 4KAIA 5KG2A 3CCSS 2XG8A 1T3NA 4EEYA 1UW4A 2NS1B 1DHMA 2KM8B 3PACA 5DDRC 2UVVA 4KSEB 2Y0SD 1I94F 4NOHA 4WE1B 2HVZA 4B08A 3KLHB 1FEEA 1TL4A 1S6PB 3AJ1A 4A8XA 1P27B 2COLA 2BQRA 3MM6B 3ENVA 4ID5A 5HMXA 1YVFA 4KBIA 1FERA 4RBTA 4URGA 2IM0A 3RR8A 1VQ8S 4NA3A 4XPCA 4HKQA 4MFBB 4I2QA 1WHVA 1E6VA 4NLXA 3OBIA 3CCZA 1PO6A 4X4NA 1F5BA 2FLPA 3B82A 4X62F 4IH6A 2CJKA 3O3LA 2MY8A 1TR0A 3MEGB 3M9NB 3DOLA 1KOHA 2W25A 3JSBA 4OIXA 5D77A 1ZTWA 1LFPA 2VG7B 4MYTA 4KV8B 3I96A 1YI2S 5K8MA 3NL0A 4OQJA 4Y00A 1CLFA 3POTA 3H5UA 3PEHA 1N56A 2KT5A 2EFNA 5A2QY 4Y0FA 2ACYA 4HH1A 4P7TA 4CT8A 3HPOA 3OSPA 4OI2A 1X5PA 2XMUA 3PJWA 2QLWA 2XWXA 2XMJA 5CQGA 5KFVA 4OV1A 2VBYA 3I4HX 4HDGA 4MYUA 1WF2A 2MQNA 2AJ1A 4Q2LA 2GMLA 5A6PA 2DNZA 4I7FA 4B17A 3FQLA 3ENQA 4A47A 4CO1A 4JYAF 3POTB 1H3DA 1C4AA 2GX8A 4NCBA 1YG0A 2VKZG 2CQGA 2GHPA 2PN6A 3DRSB 3L95X 3M2VA 3RB4A 1JJ2R 3MPYA 2HHVA 3GR0A 4PG6A 2RQ4A 2VL1A 3OW2R 4J9LA 2L9DA 5BYRA 1VQ9S 1VK8A 3DI6A 3G6VA 5D4PA 1KRPA 4Q5VA 1U25A 1N52B 2VASA 3MFIA 3I6PA 4IFYB 5EUHA 2JWNA 4Z2XA 3VAHA 1JLGB 4DSKA 2ZBIA 5HL7Q 1M5OC 1N5SA 5IT4A 1M5PC 2BE2A 3J7YI 4DF8A 2QA1A 1L3UA 1RA7A 4IOBA 3HZEA 2JLEA 2WONA 2DPJA 1U2RA 2QA2A 2XMWA 2KT2A 3PFOA 5EDWA 1FO1A 3QYYA 4K4TA 2JEGA 4F3QA 3M30A 3MGJA 5F3TA 3O44A 5IM0B 1RT1A 3DI6B 3GB0A 3I9V9 4RNOA 3JTNA 4ED1A 2YQ3A 3UFCX 5EGYA 4B9VA 4WCEQ 3N01A 4CNZA 5KFKA 1MSWD 4KE5A 2E7WA 4GO5X 1N0VC 4HLBA 2PD1A 4QIFA 2DNKA 3CSKA 3M8PA 3CT9A 1RT4B 4YR3A 2MMYA 1N33F 2HWHA 1S6QB 4RW8B 4I7FB 1CC7A 2NQPA 2CPFA 1LFWA 3N79A 1N5QA 1XERA 3R5AA 4PPZA 3PXGa 3FSIA 2QIFA 4KIAA 1L3TA 3C6UA 2WONB 2B4VA 2HLUA 2MSTA 4AL7A 2X1FA 4ZP8A 4ED5A 5F9LA 2DBBA 4K4XA 1RTDA 5HBMA 1LWEB 2N4DA 3LOUA 3S1TA 4DV3F 1JLFA 4KO0A 5L1JA 1Q4RA 2MJNA 2RF2A 3RR7A 2ZH1A 3M8QB 1UL3A 1OSDA 2LQJA 4NZ0A 5KAKA 4MKYA 3I5AA 2DTJA 2L9WA 2OAUA 3EPGA 1DQ8A 1HMVA 2ZOFA 4TQSA 3SCJE 2XMVA 2FHOB 1SKWA 3RYLA 2DJWA 2JL9A 3Q22A 1WEXA 4MIBA 1U1MA 1SKRA 5FDLB 5M2PA 3CD5A 5KTQA 3I0SB 4BS2A 3DGPA 3O6QA 4FF3A 2HWTA 2CQBA 5SZTA 4ICLB 2LKZA 1H7WA 3DOMA 2VV5A 3DYAB 4ES1A 1K1SA 3ZZUA 2AX1A 1R6YA 4C11B 2HMIA 2KN4A 2YKNB 1FRJA 4C8MA 2XULA 1H6KX 4RNNA 3C2PA 2U1AA 3V6DA 3OL9A 4N77A 1U6FA 1NK6A 4FVCA 4AL5A 2UV8A 3MI7X 2WRMA 3O1LA 4O4GA 4R25A 4F2SA 1KN6A 2DHGA 2GIQA 1S49A 4ITSA 1Z1ZA 4ZS6A 3TRGA 3ZZ0A 3BSNA 3D0GE 5B0DA 3GV8B 3QZ7A 1D3WA 1TP7A 3MUTP 2IM2A 3QAUA 1LWFB 5CD4H 2DGQA 2RS8A 1P1LA 2BRLA 4F4WA 2E9TA 1ELOA 1NK5A 4V19X 4WF9Q 3N6LA 3N6NA 1DTTB 4RBVA 5LT5A 3MEGA 4F8RA 2IMOA 3VAIA 4LVNP 4W92B 4NLDA 3PV8A 2P6SA 2IBOA 3DCAA 5GADI 1TQLA 2G9OA 3MM8B 3EZUA 4GMKA 4DSEA 1V6HA 3WDOA 4GKJF 2OD6A 2OPPA 2V9KA 1M5HA 3LPYA 5KT2A 2F7VA 5DO2A 2XLKA