4LIWA

Ccmk1 carboxysome shell protein from synechocystis pcc6803, l11k point mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
92
Chain Sequence
IAVGMIETKGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVTAGIENIRRVNGGEVLSNHIIARPHENLEYVLPILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK homolog
publication title A challenging interpretation of a hexagonally layered protein structure.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Transport protein
total genus 25
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4liwA00
4P7TA 3CGIA 2G13A 3NGKA 4LIWA 4P7VA 4RBUA 4RBVA 5L38A 4OX8A 4QIGA 5DJBA 3CIMA 2A1BA 4AXIA 3I96A 3DN9A 4OX6A 4OLOA 3BN4A 3DNCA 4QIFA 3SSSA 3SSQA 4RBTA 2A18A 3I6PA 4QIEA 3MPWA 4DDFA 2A10A 3H8YA 3IA0A 4PPDA 3PACA 3NWGA 2EWHA 4P2SA 4QIVA 4AXJA 3N79A 3SSRA 3MPYA 3VCDA 4OLPA 4OX7A
chains in the Genus database with same CATH superfamily
4CLSA 5EWFA 1WTFA 1SC4B 3KXDA 2ACMA 2Z58B 1BQMB 2PD1A 5HQMA 3KNGA 1N5VA 4OHVA 1M1HA 1M90T 5DM6Q 1RT7A 1EETB 2B4VA 3HI9A 1BWEA 4DL6A 5H9EJ 2R8KA 1GK8A 4OI1A 5G4DA 2XLJA 3SFGA 2GIQA 5I3UA 1UAWA 2KTQA 1NJXA 1Y7PA 4O3SA 2HFZA 2FIUA 1Q5YA 2X7IA 3CD5A 2HRYA 2XMJA 5D8HB 2FY1A 4NXMF 1UETA 2I6WA 1IUJA 3CD0A 1JB0C 1TK5A 1SB6A 2W2PP 2YTCA 2KO1A 4RU9A 3SCLE 2M8HA 2Q6BA 6AT1B 3P5TL 4DR2F 1QTMA 1JK9B 2RKIB 2U2FA 4LMZA 2ZKTA 3ILIA 2Y1RI 2LXIA 3QZ8A 1D8YA 3MUMP 3W3SA 3PACA 5HROB 1ZM9A 3CCRS 5GADI 1NKBA 1EZZB 3KKFA 3IRWP 2ZUGA 3PYEA 4PQAA 3OTDA 4CH0S 3OVSA 3CB4A 2QL7B 2ERRA 1N33J 1N52B 3HXMA 1F3FA 4GC6A 5LMUJ 5K8MA 4DR6J 5BR8J 1MU2B 3VQTA 4ID5A 2IA0A 2VZ9A 2V2QA 2OKQA 3B8HA 4Q45A 2U1AA 5IT9U 1E6VA 5LMNJ 3VGVA 4N77A 2CPHA 1Q81T 1VK8A 1YQHA 5LL6d 2J9DE 3PRDA 2CQ0A 1Q4RA 2IY5B 2MY8A 2UUTA 1VMBA 3AA9A 4JYAJ 3OPKA 5D4NA 1IWAA 4L6V3 3EMTA 2OPQA 4OYPA 4RUHA 2APOA 2RUSA 1SL1A 4C7QA 4QR1A 1ZS6A 4QYZJ 2IJFA 1U0HA 3AAWB 2R7QA 5CCLA 1N36J 3R5DA 3A4TA 5J2NB 1R0CB 3ZTRA 1M5SA 3BGFA 2CQBA 2RMLA 2YPYA 4Q7AA 1Q86T 2W2NP 3R1LA 2AJ1A 1B70B 3HPOA 2A6MA 2UXBJ 1BUXA 2XCPA 2R8GA 4LFCF 2XYPB 5B0FA 2JLEA 4DSFA 1GEHA 1HR0F 4QU7A 3PZPA 5K8NA 4J9MA 4JI6J 3P4UB 2FJWA 2XB2D 1UEKA 2YKOA 7FDRA 3HCXA 2FPHX 1FEHA 4F36A 3DHWC 2HBRB 1VK3A 3CC7S 1NM2A 2AEMA 2Y1LB 1J5OA 3U7JA 4DSJA 2UUCF 3KG4A 2WSCC 2G2YA 1NZ8A 2ZH3A 4HH1A 1AUDA 3BPSP 3EDQB 3KDNA 3DMJA 2FLLA 4DR1F 5F9LA 3DDKA 3IGNA 2VG6B 1RT4B 1TL7B 2E9TA 4G65A 1RCXB 1C0TA 3CDWA 4AXIA 4F3MA 3DU6A 4JI2J 5GMDA 1X60A 3MUTP 3KLIA 1IR0A 1RTJB 4DV4J 4IR9A 1NRKA 4NXMJ 3R6LB 3OW2R 2AJ0A 3H5XA 4Y2CA 3PKYA 5D3GB 5IWAF 1KC8T 4JP8A 3DLLQ 2W2MP 2FLOA 4DV7F 5LT5A 2NXJA 4ZS6A 4H4KA 2NPIA 2B56A 1QVFR 1D8ZA 3TO8A 1QY7A 2VKZG 4PAAA 3M32A 3L7PA 3NOCA 3CIZA 1ZA2B 1U2RA 3D1OA 2D3O1 4FYYB 1L3SA 3TJ8A 1S9EA 3ITHA 2HBQB 3N28A 4QQBA 1OSCA 3UE2A 1S1TA 2OI2A 2FYXA 2AGPA 4DFMA 5HK4A 5ETSA 5GAHI 2JSXA 1TK8A 5AXMA 2CG8A 3GIRA 4WP3A 1QLNA 1IN0A 5E3PA 3T9ZA 1T9WA 3AJ1A 1D09B 3MCNA 1C0UB 4DUZF 4NLRA 5KOWA 2AU0A 3KJNB 1GMUA 3UVJA 2KKHA 5EX3A 5HMWA 2ZH9A 4P2SA 4OYAA 2WW4A 1ZA1B 4C2MA 1UVKA 1NK8A 2CQPA 2HVEA 4NLPA 2DGUA 1TK0A 2OSRA 4LFAJ 6FD1A 3D66A 4NZ7A 1Y10A 2E1AA 1N56A 4IUFA 4JI0F 4U7UK 1OO0B 3U27A 3WIVA 2GX8A 4ZCIA 1V3SA 3SI8A 4PWDA 1Q8IA 2H48B 3RB3A 1WHYA 4WXOA 1VIXA 1U47A 1H0HB 4I2QB 5J1EA 4GKKF 2BANB 4ES2A 2R7WA 4LFCJ 2VPXB 4K2XA 1Q8KA 2IAJB 1JKHA 3VAFA 2QFIA 2MZSA 4J9PA 3N79A 4Y34A 4PABA 2HBYB 2G2ZA 1YSJA 1S7IA 1FWLA 5C5JA 2GC8A 2GV1A 1SH3A 3H90A 4NXNF 2UUCJ 1A6LA 5LJ3Y 1G2EA 3OTOF 2HWHA 1FE4A 2F8EX 1TL3A 5K5MA 4DSLA 4QPTA 3NLCA 4EO6A 1JNZB 3OJUA 3D0HE 4F04B 4DR1J 4G3IA 1HARA 3D6HB 1U0SA 4DLGA 4WWSA 2BXJA 2WONB 2MHNA 1FWKA 3MGJA 5KFTA 3RYLA 1OIAA 4FYWB 5JMNA 3ET6A 1RU2A 4ED3A 2OPSB 1KNZA 2V2VA 4DV2J 2WVBA 3TP2A 2JLGA 2G0JA 3HULA 1NSPA 3LP1B 1MG7A 5IWAJ 1LW2A 4ZPAA 3MUVP 2UU9F 4ED4A 4RNFA 3MEGA 3P8BB 4IDKB 3Q2SC 5DM7Q 3DHXA 1NKCA 4F0HA 1RWPB 2L41A 2KT2A 5G0RB 1NMEB 4G6VB 2HYIB 2RAQA 3G2XA 5KFDA 3TRGA 5KFZA 3IWXA 3S01A 1KDNA 2DVIA 4NYOA 1RYSA 4LF7F 1C1BB 1X4AA 3HHLA 3KLEA 1VISA 3C15B 3OHBA 4F2SA 1P9QC 4DUYF 4LSNA 4TU8A 3EXCX 2LVWA 4DCJB 3H20A 2CJYB 3ZZRA 1QM9A 2KFZA 5HJXA 3TQ1A 4HTIA 4KHMA 5ETOA 4QIWD 4NLOA 3TQEA 4X64F 4QW9A 4EK2A 3DKDA 1SI9A 3MOJB 3VF0B 2CDRB 5E3QA 1SCJB 2KDOA 1HWJA 2RQKA 3KTQA 1IKXB 4Q8EA 1VQMS 2LECA 1N6QA 4N7TA 5HQ8A 4PQUA 3EM1A 2K3KA 3SDEB 5A8KA 3BKFA 1LEOA 3LP2A 3W5ZA 4CLLA 3MD1A 4GKKJ 2W25A 1CJVA 2LDYA 4D3HA 4HACB 1RT3A 1D9DA 4KHRA 1HI8A 3ILOA 2CQCA 3C16B 3NCPA 3Q2TC 4USMA 1LFWA 2LQJA 2ZDOA 3IO1A 1REVA 2GVZA 1N4LA 3RB6A 4QIVA 2DO4A 4F4XA 1RHQB 2NCKL 2XSJA 4YOEA 3IS9A 3OVBA 1V6HA 4FPIA 3TUIC 1YHQS 3G9CA 1SJRA 3HSDA 4NXNJ 3OTOJ 2EKNA 1NJYA 2RB7A 3IXQA 3U1LA 3WZ0A 3W1YC 5A6PA 2KHCA 3TZWA 4JUZA 2NXCA 3MXHP 1KOHA 2XC9A 1HPZA 3AD9C 4FKXA 4ZOSA 1UMJA 5J2PB 2OO4A 4OZ3A 4LQ3A 3J80U 2NS1B 1S49A 4WP8A 1R89A 4U9RA 2XO6A 2W01A 3OSPA 3TEGA 4IO9Q 3H42A 2C2ZB 4ZLLA 5KFUA 2UU9J 2XY7A 1K1QA 3KOAA 3M8PA 1NO8A 5I4MA 3FZBA 3JSRA 4YY3F 4RW7B 1CJKA 2HAFA 2DK2A 5D77A 2BE2B 1RAGB 3LWLA 3OXGA 2HHPA 2F4VJ 3HP6A 2H51B 5KFYA 3QATA 4EMDA 3MAAA 4RBUA 2LA4A 3GB0A 3NBPA 3EX7B 3CMES 4KGKA 4TQRA 1FK9A 3LTOA 5KFQA 4WFBQ 3FNNA 5F41A 2W7OA 3VCDA 3QFHA 2VICA 4DUYJ 8AT1B 2RF2B 2GHPA 4R25A 3OHAA 3PDNA 2N4CA 4M5LA 1RWWB 3TR5A 5ETVA 2GQCA 3N0VA 2ZBRA 1T9YA 2VFSA 5KFRA 2E7VA 2KU7A 3OR1B 2M5YA 4KJIA 3DM2A 1UA1A 2HHSA 2VUGA 1BLUA 2C2DA 4X4QA 3LALA 2KXFA 2HWIA 3QIPA 4R5PA 5ETRA 2UZAA 4C11B 2IJNA 3ZZUA 3C6UA 4ZP8A 3HHLD 3AFGA 1RK8A 2POKA 3NGSA 1RT5B 3MI7X 1AFIA 4BWMA 1U1MA 1T3OA 1KVIA 1ICEB 5L1KA 3W64A 3N6LA 2M8DB 2ZVIA 4A8YA 4M5MA 2IM0A 3DOKB 2Y1JA 2BYCA 3OFFA 1S72S 1K44A 3HT0A 3TZYA 3NRBA 1QTNB 2UV8G 4P7VA 2XY5A 2HK3A 1GXLA 3IBCB 1RABB 4A8MP 2E5LJ 2QLXA 1GX5A 2AZ1A 3FBCA 2W2QP 4DF4A 5IT0A 1ZTTA 5A76A 1WC5A 5CAAA 3GJSB 2NXUA 4NA1A 4C3MA 5CYMA 5A0YB 4NLTA 4DR5J 3BREA 3CJQA 3EZOA 4ILRA 2OUGA 1N34J 4WYWA 4B08A 2XI2A 2HS4A 1M5VC 4QW8A 3PTWA 1O0PA 4ANCA 1I94F 5GVQA 4LR8A 1RHJB 4ED1A 1S6OA 3NMAA 1I51B 4M1KA 2H5EA 4DR7F 2QSFA 3QWUA 4OX8A 1S1WA 1IQTA 4BCAA 2HVHA 5KT2A 2HNZB 3IM8A 4EEYA 3NNAA 4FF4A 4MFBA 1NJZA 3SQGA 2CQIA 3FRZA 2I38A 5C25A 2SXLA 5GAEU 4YY3J 2BJ3A 1SBRA 2VFVA 5B0BA 1FJEB 1Y5IB 4WK1A 3EVMA 2JEFA 3I32A 1UW9A 2DNMA 3R7SB 3BSAA 3Q24A 2L9WA 3EICA 4YQWA 3PX4A 3KK1B 4ZDNA 1RBLA 4C8OA 5K20B 2J7KA 4R8UB 4LSLA 1R3NA 4AQYJ 4RR5A 3FCWA 4DV6F 5B0CA 4PCQA 2FD2A 2V4JB 5K8OA 3W8GA 2KJWA 4GVBB 5IC4B 3WQPA 3BDPA 1MN7A 3HHLC 2DR7A 2XMAA 2LKZA 3W9IA 1KEKA 1RWXB 3UQSA 4AFFA 2B5JA 4P6QA 4ENOA 3T6BA 3LGMA 2XZTB 2XGQA 1G3OA 2KT5A 4OJ3A 3GJTB 1XQIA 2A2CA 1AW0A 4ICLA 2EK6A 3BDEA 4O44B 2RS2A 1KLNA 5CA5A 4NCGA 2J6UA 2YQ1A 3I0RA 1U49A 3W2VA 3BH7B 2QC3A 1KR4A 2RRAA 1AXQA 3MCSA 2FHOB 3MTJA 1FVSA 3L09A 1TQLA 2O3DA 1EP4A 1FRJA 3V6KA 4DI6A 1C1CA 3MFHA 3Q22A 3FQLA 4RW4B 3GYGA 3VAJA 1HNIB 2F4FA 4LQ9A 4O4GA 2BQRA 1RWUA 2DEJA 5CHCB 4DJBA 1R8CA 4V19X 3IAM9 1J2VA 2MKCA 2O01C 2KHDA 3IM9A 2YNIB 2HBZB 1H7WA 2MZTA 3MM8B 2R7OA 2MZJA 2AJ2A 2CDQA 5KG6A 1I94J 4ZP9A 3T5HA 3RUBL 5KFKA 4AT1B 2A18A 2VJVA 4DR7J 1PAUB 1SC6A 4JV0A 5IQQA 3EGNA 3LANA 2YWKA 1XBWA 4X84A 3Q8QB 3AODA 4CLTA 2CZ9A 5E5NA 1W2BR 3ENQA 2I5JB 2V94A 1NHVA 3PHEA 4ECZA 1UFWA 3G8TA 1PYTA 3SZ2A 4C3LA 5KOXA 5E0OA 4FXWA 1SKWA 3T5KA 1HQ2A 1KHVA 8RUCA 2C22A 1IKYB 1VI7A 5DG8A 3PFEA 2HW3A 3ZTPA 5GAGI 2I1RA 2XS2A 3LPEA 2X51A 1EARA 1TKXA 4KT0C 2OD6A 1RHRB 3H98A 2EKYA 2RQCA 1X4BA 2BOAA 2EFOA 1WF1A 5AJ3F 4DV6J 3DLGB 3PO4A 3HKZD 2V9KA 3BPDA 2N4DA 5FIIA 3VQSA 3ZTOA 2CWKA 1UWBA 5HVGA 2D3OR 4CYUA 3GYXB 3M2VA 1RTZA 4DSIA 2BV3A 1WJ9A 2HNYB 3NWRA 2DR8A 1FD8A 1S1TB 2XMTA 4X62F 2R42A 4YS2A 1QE1A 1OSDA 2K3IA 4I7FA 4WFNQ 4FS2A 2X1AA 3NS6A 3BGRA 1FXLA 4J9RA 1D9AA 2GO8A 3GTYX 4CT9A 2KG0A 2HIQA 2OEKA 2HVZA 1F5CA 5U47A 3L7UA 3R3TA 3OQ2A 5KAKA 3D9BA 1KKHA 3NNHA 4HH0A 2DHXA 1NDPA 2Y8WA 2XMMA 4QBUA 2HHTA 1QUPA 2AJFE 3SBMA 1JLAA 4IRCA 5A8RB 4KTQA 3UD3P 2ZHOA 1HNVB 5DG9A 1RISA 2XZDB 4K4WA 2GMLA 4EO8A 1VBXA 2GIFA 1TKZA 5T7LA 4DDFA 2RU9A 2VKRA 4ERDA 2RHQB 4Z37A 4J9LA 2XSFA 2DNQA 2FJBB 3G8QA 1GTHA 1PBAA 4ZJOA 1SL0A 4M5GA 4CLFA 3RBZA 4CH1A 3R27A 2E66A 1N5SA 2ZBQA 3GU0A 2EVZA 5KG3A 1MMNA 4IFVA 2FGOA 5B09A 3MPWA 4ER8A 1JLGA 1R0AA 1TELA 4DU8A 3UW1A 1VRUB 4LF8F 4R0JA 1WOOA 1TKTA 3S1TA 4K4ZA 1KVJA 1V3ZA 4RNHA 4DL7A 4ID8A 4PXCA 2VG7A 1KTQA 3IAS9 2WK4A 4CM0A 1VOMA 3R6GB 2CPXA 4WBFA 4F26A 1X9MA 3FEYB 2AYMA 3NCRA 4P71A 2AEFA 3SSSA 1XNRF 4EBCA 2R8JA 1RAJA 4RW9A 1R6YA 2CQ4A 3HT3A 4I4BA 4F2RA 1IR1A 2G0IA 1AA1B 2HHXA 3FMWA 5GADU 1OPIA 4WFYA 1E6YB 3MF5A 2G2OA 3PEJA 2UV8A 3MOZA 3C14A 2LA6A 3G6ES 3OT9A 3UCUP 2E5HA 4GO5X 2ZE2B 2HHVA 3GIJA 4KGVB 3G6VA 4LVOP 1S6UA 2IC3A 2BE9B 3DLEB 9ATCB 4WFXA 4CT8A 1RTHA 3UD5A 3BF4A 2HRTA 1URRA 1AB8A 3VAIA 4KFBA 2BR0A 4NLDA 4Z2XA 2R8IA 4JI3F 1XK8A 2FZCB 2RDIA 1JXLA 2FY8A 2YBVA 1RAIB 3IG1A 5F0UA 4HDHA 1PG5B 2YX7A 1CC8A 4FNIA 2B4OA 4DV1F 1S12A 1RWVB 1B0TA 1NUEA 1R27B 1XWLA 3CCUS 5CD4H 1NB2A 2BQUA 3NS5A 4F8RA 2XMVA 4BBYA 1UCNA 1S6QA 3G82A 4X62J 2IMOA 4NLWA 2HZVA 5HBMA 1VQ6S 1X8DA 1FNXH 1U1PA 2Q6CA 4K2JA 4DU7A 4GC7A 1QAYA 1T94A 2FVSA 1BQMA 2VPZB 4K4YA 3G87A 2MSTA 3GG1A 1FHTA 2UUAF 4TN2A 2M9KA 2KXNB 1YZ6A 1HQEB 3M7VA 1EETA 4RZRA 1NK6A 4M8LA 2XLKA 2HQGA 5C7PA 3KHHA 2CQ2A 2EXUA 2WHOA 2A10A 2ZZNA 3CDEA 1BMQB 1QSLA 4LRBA 2C3YA 2L08A 5J1NA 1TZ0A 4K8RA 3OFHA 3PV8A 4CO2A 4M5NA 1Q0NA 4U95A 4I64A 2C1EB 2BJDA 4C4WA 4EYHB 5KT6A 2RQ4A 2CPIA 2K2PA 2XULA 4ECWA 2VOPA 3J7Z5 3HKWA 3JAMY 2FHMA 2NR0A 1DY3A 3R5AA 2R7VA 2DNYA 2RKIA 4HT7A 3N5FA 1JJ2R 4MYTA 5HROA 5LSRA 4L3KA 4MYUA 2ALZA 1LNQA 4J37A 4ES3A 1RE1B 3WX8A 4KH0B 3M30B 1WI8A 1RT1B 4KE5A 3LW5C 2ROEA 4LF8J 5CXTA 4L73A 3DLKB 2MQOA 1C4CA 3M1VB 1XNQF 1NPKA 1L3KA 2RH3A 3A12A 1MU2A 3SSQA 4OZ1A 2DPIA 2DNKA 3ZFVA 1VQKS 1PBUA 1X4HA 1RAFB 2DJWA 3CVKA 3HZEA 5KTQA 1HW8A 1X4EA 2LEAA 2HS3A 4G1QB 1XNRJ 2CAJA 3MMCB 1XR5A 1HHTP 3ULHA 3DYAB 1UVLA 2JFDA 5IS2A 1ZBTA 4N56A 4PRFA 3UR0A 4C8YA 2H9ZA 4OL8A 2VF3A 4ZVEA 2ROPA 1KLMB 1FRLA 3G6XA 4I6YA 4B3RF 1CULB 4ED7A 3KWMA 3HMJG 4P75A 2I9SA 3T9NA 2FC9A 2LQ9A 1WORA 5LM7E 3K0JA 4I0WA 5J2NA 2JFKA 3I5AA 5DZ7A 3W5XA 1RB0A 4HLBA 1HQUA 2J0WA 1F1BB 2ZOGA 1W26A 3PW7A 2CQ3A 3HDSA 5HLFB 1F5BA 5IXUA 2OLWA 5BYRA 4CQ1A 5H1SV 3JQJA 2FVQA 3RBDA 2XMUA 3E01B 4DV1J 5JUMA 2EPIA 5C42B 2BMBA 2B6AB 4ZJQA 5E7OB 2JL9A 3T1AA 2JEGA 1U6BA 3QGPA 5F8JA 1Y11A 2WAQD 5FLXY 2DNZA 2FC8A 3CJRA 1B7YB 3V2UC 1HNXF 1FKAF 3TUZC 3EDRB 1YRUA 3W2WB 3MECB 3V5RA 4J9NA 2UUAJ 3P5BP 3L7OA 3A13A 3G8SA 4KB7A 1VQ4S 4DX8H 2M2BA 1U8WA 3R5GA 1I1GA 4O0NA 1BQNB 3A1YG 3NMRA 2H65B 1YBUA 1W7WA 2Y3YA 3AXKA 3CCTA 4FXDA 2VG6A 1RT4A 1TL7A 4DL0C 1K73T 1VGYA 3W5YA 1YTYA 3GJRB 5M2RA 5JVGQ 4CP5A 5J2MB 2YH0A 4XDDA 1RTJA 4Y2AA 2D9OA 2VD3A 2DNNA 3TNVA 3QZ7A 4WCEQ 3FGVA 5HAOA 5D3GA 4UOHA 5T14A 3M9OB 3J7YI 1QDUB 2IM1A 3NGUA 2P6TA 1NK5A 2HKEA 3M8RA 1XMQF 3ZO7A 4YR2A 1M5PC 3I82A 4ZKAA 4FYVB 4CWBA 5F8NA 3V6DB 2OJ3A 1HD1A 1BQXA 1FERA 2C2OB 1BY9A 4EGLA 4K4VA 2YNGB 1RSCA 4B3SF 4A8FA 1WHVA 3OL8A 5I42B 4CH7A 1C0UA 4CO4A 2J5AA 5L1LA 3QMQA 2H1YA 3KK2B 2VQFF 3OFEA 2NXNA 1P1LA 1PJ7A 5E3RA 5RUBA 2X3DA 5DDOC 1RA6A 5IT9Y 4DQQA 1YDLA 2P8IA 3W9HA 5HVHA 3PR5B 2C3MA 4TYAA 3BEGB 2RIJA 3MMBB 2OD4A 1VQ7S 1ZPVA 1IVZA 1FNOA 2ZH6A 2QMUB 4OYBA 1HBUB 4WFZA 1TL5A 2QZ8A 3RW6A 2HWTA 1O51A 2IDEA 4CZCA 4I2QA 4USKA 1BWVA 2C28A 4DWIA 1S1UB 4DL2A 1MW7A 2BANA 1MMLA 1U1QA 3FKBA 1ZZNA 1ZH5A 4K5SA 1LWXA 3ZZPA 4CI0B 5KG1A 3LAMA 2GQQA 2AGOA 2AT1B 2IAJA 3CJ4A 2LYVA 5ITHA 2BA9A 1YZ7A 2DGXA 3I96A 3R5JB 4DR3F 4DPOA 1OPZA 2J76E 3VV2B 2IVYA 4X4RA 2CPDA 1RWNB 4UF4A 4P73A 1FESA 4ECXA 1HNXJ 1GMWD 3NL0A 3WBZA 2D9PA 4TY9A 2HAIA 5H9EK 2AW0A 2HHQA 4OYXA 3H4BA 1S59A 4ZVSB 2NUUG 2OPPB 1IBCB 4FF3A 2QA4S 3PX6A 4EI2A 2WONA 5LXYA 5CH7B 1KONA 2BACA 3UD4P 3AXMA 1P1TA 3QLHB 2GMHA 3CT9A 5L9NA 2OPSA 1UVNA 3KLFB 2HMIB 4Q8FA 2IRYA 2PFDA 2HLUA 3M6UA 1RA7A 4DXLA 3LP1A 1FF2A 1JQGA 2RDDA 4IDKA 1TMMA 1RI7A 1X9WA 2B43A 3SXLA 3PG9A 1X5PA 1TV6B 1FFGB 5G0RA 2Q3PA 4Y0FA 1X4CA 5D6GA 4LBIA 3BBFA 1XMQJ 1RBAA 4P2XA 3U1MA 4OJHA 4DFKA 3KJFB 4QIFA 3PJXA 4XK8C 2B9YA 3KFWX 3SCIE 1C1BA 3NG8A 4E2FB 1NSQA 3CCMS 2YWHA 2BDPA 1VC5A 2IA6A 2FDNA 3AT1B 3HHNB 2FB0A 3R1HA 2BJ7A 4B3SJ 3GYNA 2ILZA 2X3GA 1N8RT 4KC5A 2ZBIA 5JXSA 2NZCA 5F8LA 2WVDA 3DRPB 2N7CA 2DH7A 2ILYA 3H5YA 2DISA 1T03B 2LU2A 2VQFJ 2ZH7A 2Y9HA 2UXDF 4RBTA 2MQ8A 1SPBP 2HQIA 1O5JA 2PA8D 1SC3B 3PYDA 4DQRA 4UOCA 1PKUA 3PY8A 2UVWA 1F6TA 5KFCA 3UN3A 1U48A 3UWTA 2CIMA 4QYZK 4PR6A 1IKXA 1SQEA 2HGNA 2MQLA 2JNJA 2MPUA 4A47A 2VG5B 4URQU 3LOUA 3TVYA 4QOTA 4OX7A 1SXLA 4ZPDA 2CJAA 2E29A 1YRTA 3W8PA 2Y0BB 4X4UA 3SDEA 3GE9A 1VC0A 1U2FA 1H73A 2C2NA 4HYKA 3TOQA 3TX0A 3OL9A 2MJNA 1U1RA 1XEZA 4P10A 3PJ9A 4I2PB 4HACA 1PCAA 1U1OA 3NAIA 1VC6A 1FKOB 3VTIA 3LQVA 4IYQA 4RNOA 3C16A 1I5OB 2FZKB 1FDNA 4ZPVR 1NB7A 1HYSB 1Q95G 4C8KA 2MKYA 4RU2A 2VQEF 2HZAA 4OZNA 1RT6B 4DR3J 3CXCR 1KFSA 1WDDA 3GCXP 1WEYA 3GFXA 2RSQA 2DGTA 1QSSA 5GMKa 2CPYA 3KLVA 4UT4A 1HWUA 5F8IA 1VQ8S 4OMFG 3M05A 2W8LA 5CZVA 3PX0A 4ZP7A 2IRUA 3JSMB 5ETKA 4ZVGA 4IR1A 3H40A 3I4PA 1GXTA 1Q82T 1VIOA 4O3OA 2M88A 4HTJA 3HFZB 1S99A 5J2PA 2CQ1A 4EBDA 4DR4F 2YH1A 1S1XB 3TUJC 1PC5A 2DT9A 3MCOA 2VHGA 1CQMA 4RLEA 2HPUA 4MJKA 2V8DA 2C2EA 2R7RA 3EGZA 1QE1B 2B7CB 4ZK7M 4IQMA 5H9FJ 2VFRA 3BZQA 2HQ3A 4NLSA 4QU6A 2WOMB 3PFOA 1JLEB 4XIUA 1CS4B 4LR7A 4L74A 3ILJA 3VAKA 2FVCA 2N7YA 4RW7A 3CUNA 3O2IA 2QLWA 1DAXA 1PAEX 2PMWA 2BE2A 3HSJA 1WC1A 5HVFA 3DFEA 2KZMA 2XWXA 4HHHA 4R0EA 2AQ4A 2VA3A 2VDIA 3KMQA 1CC7A 2JRSA 3TI0A 4A8QA 3J7AN 1MSWD 3VAHA 3TAQA 2RF2A 3RGIA 1J5EF 1HMVB 2YXLA 3LF0A 5F0WA 4RW8B 3D68A 3FBEA 4I69A 4BC7A 1HD0A 2I0XA 3R97A 1JLCB 1MROB 4UY85 1YGYA 2WVEA 3HFVA 2AF6A 3LGNA 1N88A 2DXEA 4UW2A 1DBDA 3DOLB 1JX4A 3Q8RB 3AQPA 3HZGA 3QRQA 1YK9A 2ZWOA 1LOUA 3IRXB 4C11A 3GFHA 1Y3JA 4Y2MA 1SKSA 1R6VA 1WC3A 4OZ2A 4DL4A 1FDAA 1DRZA 2D41A 4JBCA 5L38A 1RT5A 5DDRC 1Q16B 5KG4A 2J7UA 3N5BA 2ZNZA 4ECSA 1DTTB 2QJ3A 4KV8B 1DTQB 4USTA 4B9MA 1Z1ZA 3DOKA 1JLBB 3IBWA 2WB4A 4C8LA 2HK2A 3N01A 2VQEJ 5A8WB 4NLQA 4F4AA 2G1DA 2MQQA 1VRTB 2GFFA 2GGPB 3HHKA 3G96A 2WBRA 4YB6A 2NPFA 2O67A 4CLWA 1SV5B 3OTBA 3GQCA 4WE1B 2YPZA 4K0KF 3UO0A 5A0YA 3CE8A 3M9NB 3BGUA 3D6MB 2AZ3A 2XI3A 1YBAA 3MFIA 2UP1A 2KL8A 3UN5A 2AP6A 1SIZA 3LH2S 4DR4J 2HFNA 3VWSA 4OV1A 4QR0A 4LREA 4Q44A 2V2ZA 2NZ4A 4RPFA 3J80Y 4ED8A 2OSQA 2V6AA 1UZHA 1PILA 2Z2ZA 2XS5A 5D0EA 2HNZA 3BGLA 4YMEA 1HA1A 2RDJA 2K7KA 1WHWA 4IOBA 3D0IE 2QIFA 2HVIA 1WTBA 4BLGA 1UJ5A 2D3ZA 4URSA 3MCMA 1URNA 2NQPA 3LPYA 2Z8QA 4OLPA 5D4LA 1K0TA 2DRBA 2IRXA 2WTFA 1DQ8A 4DX6A 3QRPA 1S7HA 4ZLPA 5ETMA 2OEMA 1X4FA 4ZVUB 2DHSA 3KK1A 4NCBA 2KJVA 3R7NB 2E1RA 3LAKA 2QLFB 4LRFA 2F63A 4R8UA 4RX6A 3OLAA 1U8SA 4OZJA 5D0RA 3LA0A 3DLBA 2V4JA 4OIXA 2BQ3A 1FRIA 4GVBA 3ZZYA 1NJWA 1IBMJ 2BRLA 4HVZA 3BJYA 2FUG9 1WNEA 4O3QA 2H5IB 4LBHA 2IM2A 3ISND 3MPYA 4YUDA 2ZHBA 4OI4A 3QWPA 2PN6A 3UFCX 3MEDB 3I0SB 4O44A 1KFDA 3GR0A 1IJEB 5GAGU 2N3OA 2FJEB 1Q79A 1KHWA 2ZKUA 4A8XA 4MIAA 3DGPB 2YNHB 4HHUA 3JYTB 3POTB 2R8HA 4WFAQ 3MM9B 2F1FA 4FYXB 5HP1B 5B08A 3CNQP 1F3VA 2GO9A 1C2PA 4OHXA 2JH3A 1FFWB 3I55S 2A6OA 4USVA 2F65A 4B3MF 4RW4A 4ECRA 1RTIA 1KQGB 1AZSB 1HNIA 2KRBA 3FSYA 1I3OB 3Q23A 1M1GA 4B17A 4OHWA 4M5HA 2HFUA 2ASDA 1HQUB 1OQ3A 3QO9B 1H74A 2KFNA 2YNIA 3O3LA 4FVCA 3MM8A 3DRRB 4P9SA 3SIPB 3GILA 1KTVA 1HW9A 1LWCB 2HRUA 1G4CA 2C3PA 2DEIA 1FRKA 1S48A 4C8MA 1GTEA 2YX4A 2UUBJ 2HHWA 4O23A 2LU1A 3QT8A 1NNDA 2J0XA 2FJXA 3BKTA 2MMYA 1XMOF 1U25A 2KFYA 1VS3A 2RILA 1N0VC 2BKPA 2VJUA 2I5JA 4YN3B 4B3OB 4QWEA 2QYGA 4I6AA 3LO3A 2R7TA 3EWGA 2VU5A 2G4BA 1IKYA 3O5TB 3M8QB 1JMTA 4ZN1A 4MK9A 4KQZA 2RRNA 5IQ6A 4OZ5A 4PPDA 3CC4S 3G86A 1T9UA 4J7CA 5CYQB 5F8MA 3EPIA 3BYPA 4NE9C 3CJ8A 2IFXA 1NSAA 1RP5A 5L8RC 2EFVA 4KO0B 3ISNC 1GMVA 3SV4A 1VJWA 4DS5A 2MZRA 3DLGA 2P9EA 4USUA 4RL1A 3RB0A 4DR2J 1UVMA 3IWNC 4LJMA 1LK5A 2CNLB 1WC4A 5EWEA 4ZVPB 2DH8A 1K0VA 1F9EB 2PI4A 2WSFC 1R8BA 2HNYA 2CJXB 2V63A 2JEIA 4C9DA 3BSNA 1KS2A 4RNNA 2YWFA 1QAIA 1EIYB 2L3MA 3DCAA 3F0NA 2HURA 1X5OA 4IO1A 2HSEB 1VJQA 1VLYA 4UUWA 3MEEB 4QCLA 2MHEA 3M6VA 4TVAB 2RHSB 4CO1A 1WDTA 1K47A 2RE1A 2M0GB 5AE1A 4RBVA 2F9DA 1WKLA 4ED2A 3QYYA 4DOZA 2N3LA 1JIHA 2MZ1A 3CO9A 4B3TF 3QGGA 3AH6A 5AE2A 2DNRA 2FJAB 3KUEA 5ADZA 3T19A 3TUPA 1BE4A 2DR9A 5D0HA 5EN1A 1LWEA 1RTDB 1VQ5S 3BQ0A 5A8RA 1VQYA 2J6TA 4GO7X 1HNVA 1U1LA 5DO2A 1JXVA 4KY3A 1S9FA 2OFHX 4ZLJA 2EBEA 2V50A 4K7QA 5J1PA 5A6WA 1UZDA 3QT6A 4J90A 3BKUA 1NDCA 3KUGA 2ZH4A 4QWAA 2CPJA 3P6YC 2BABA 2XZWA 1HR0J 1GFWB 1VRUA 1RADB 4EZ9A 4LFBF 3MM6B 1QVGR 4ECQA 3MMJA 3ZTSA 1YJTA 4M5JA 1U45A 4HEA9 1XMOJ 3K5OA 2W4DA 1UFKA 4K4UA 2HG4A 5D15A 2E7WA 1M5OC 3CO0P 3GFYA 4WPAA 5L1IA 1A0OB 1RUSA 2MGZB 2DYAA 2FHJA 4CM2A 2L9DA 2BM0A 2DGOA 3PW0A 3Q8UA 2P6SA 4FKYA 4OZ0A 2BVZA 4CNYA 1ZAWA 1E6YA 1W25A 4F4WA 1TR0A 2CPEA 2ZC3A 2PO4A 3CCLS 1ZZFA 3MR7A 2A2DA 3EPGA 2M4MA 2ZE2A 4ZCMA 3M2RB 3Q8VA 2HFSA 5F3TA 1QAJA 4TLRA 3DLEA 2R3VA 1RU1A 2YKMB 4DV7J 1VBZA 3ZXWA 4OHZA 3DDNA 3ENWA 3K17A 2BJ9A 3KUHA 5KFOA 2CJ9A 4DV5F 3C2PA 2GMJA 3AJDA 4J9SA 4LF5F 1N5YB 3D1QA 2JDJA 1LWFB 1EQMA 1WWHA 2F7VA 2NYHA 4NWBA 4DZ6A 4X2BA 1ZETA 2CNOB 5THWA 1T9VA 4LIRA 4DMZA 5BYQA 1PGZA 2W9CB 4I6WA 5HANA 1HQEA 2RD5C 5BJRA 4DUZJ 2KYZA 3PIPQ 2BJ8A 2YKNB 1NHKL 2VBZA 4KPYA 3DXSX 3O8WA 2KRRA 5CYJA 4MMOA 2ZBPA 4NOHA 1CEZA 4X65F 4CRJA 3OR2B 3U02A 3CD6S 2H3EB 2R4FA 4TKTA 5DDPC 3HHEA 4B3TJ 4PWUA 3JQKA 2PSZA 5KT4A 2DNHA 4C97A 4YHHF 2R2UA 5AXLA 4JI0J 4F67A 2IIHA 1TTHB 2XGPA 3BN4A 5FDLB 3HLUA 2NSBA 4DPWA 4J9QA 3W66A 3HVTA 4ED5A 3VHQA 2Z56B 1R43A 1NJIT 4JV1A 3WC2A 1U1KA 2XTJP 4KHPF 3FCHA 2DRDA 3FK4A 4PG7A 3GV8B 3MWBA 3M30A 2HGLA 3VVUA 1RT1A 4CLYA 3BR8A 3A8EA 2BM1A 1M5HA 3DLKA 2XY6A 3AD7C 4RUAA 4LFBJ 3M1VA 2GS8A 3M6WA 1YVFA 1OY8A 2IM3A 2P2CB 1VR6A 4USIA 1PYOB 1KQKA 1DARA 3IN5A 2ASYA 2ZJPQ 3J7YU 1U2CA 1HWLA 4G1QA 2VDHA 3MMCA 2Q66A 1TAUA 3T6JA 1FD2A 3RU0A 2XMWA 3HSZA 3DYAA 1EHWA 1HNWF 2JLFA 3N6MA 2AYGA 3PYFA 5KFXA 2G1HA 3AB4B 1KLMA 2B9EA 2JHEA 3NGDA 2MQPA 1CULA 5M2PA 3HSGA 1VYAA 4ZVQB 3AY0A 3WIUA 1UJ4A 2DTJA 2Z2YB 2GHWA 4PPZA 3CCES 3PIOQ 4GMKA 3THPA 4OI6A 3CMQA 3FUYA 2CNNB 1F9HA 1PYSB 2DGQA 3M9MB 5HLFA 1UKUA 3I9V9 1Y4ZB 4N8OA 3HFKA 5C24B 4M5KA 3ZTQA 5LXRA 4OX9F 3E51A 1M1KT 1T05A 3E01A 1RJJA 2BJ1A 4DV5J 2RNEA 3RAMA 2H5JB 4LBPA 4LF7J 1UP1A 3QSIA 4B9SA 1RLCL 4OV6A 5C42A 2GW8A 2B6AA 5IFMA 1F2GA 3HK2A 1SJQA 1IKVB 4WU2A 4FNHA 1JLQB 4F0KA 4DSEA 1YJ7A 2OMOA 3U1NA 1V3RA 2YVSA 3W2WA 1GT8A 3MECA 1Z2ZA 5KFVA 3LP0A 1KQSR 2DBBA 3W61A 2GHVC 3R5BA 4H4KC 1BQNA 1S0VA 1N5QA 3Q8YA 3CJSA 3LGHA 1WEZA 4X65J 1Y5NB 3C46A 2C3OA 3BQ2A 4X64J 2FLNA 4B02A 1O6XA 3CPWR 3EVWA 1HHQA 3ENAA 1YJNS 2IPOB 1IM4A 3TA2A 4PUOB 2QG9B 5J2MA 2QV6A 2DGSA 4XAKA 4TQSA 4YHHJ 1N54B 1DFDA 4U7UD 1HBOB 4MIWA 3X1LB 4DPYA 4MKBA 4X66F 3VAMA 3FFIB 4AL7A 4DX5A 2W9BB 4J5OA 4I56A 2B3TB 2QE5A 2E1CA 5KFPA 3J81Y 3J81j 4KHPJ 1SH2A 3GV7B 1VHIA 2XO7A 3EGWB 2QLJB 3MAQA 3V6DA 5DDQC 2MLZA 2QFJA 4PYAA 2ZITA 3I56S 2VBXA 5K9FA 2EEYA 3M6XA 2YNGA 4UZCA 2LEBA 1VRQC 3OXLA 4WK3A 2QMXA 4Q2LA 5I42A 2LQBA 4FXVA 3S6EA 2CUYA 2K1RB 3TAMB 3NGKA 4MKAA 4ETZA 3KK3B 2VB6A 3KK2A 3US5A 1Z2LA 3I5BA 2DGWA 3CCJS 4RJVA 5E33A 1FRMA 1VHFA 4K50A 2LMIA 5KFLA 4CLUA 3GSDA 3SCKE 4UOGA 5ETNA 2BJEA 4I68A 3MMBA 5IOLA 2QTWA 2UXBF 1SQFA 3ILLA 2GCFA 2DD8S 1V9OA 4ZLNA 1XIQA 1TL1B 2KM8C 3B4DA 3T3FA 1L3TA 3J7ZT 2RS8A 1HBUA 4FN5A 1CPZA 1YITS 4OYMA 3ZZOA 2VPYB 4UQGA 2ZH8A 1S1UA 3KHLA 5ETTA 4LUBA 4DG1B 4QWBA 4OX9J 4L3NA 5DS7A 1XN9A 2QYCA 1R8PA 1RT2B 1IBKF 4M95A 3GIKA 1XC9A 3AD8C 2PE8A 2AMCB 2KH9A 3B78A 4WZQA 2O5DA 3DOMB 2CA9A 5D4PA 1IBLF 1X4DA 5IC6B 3OSNA 1YJ9S 4JI2F 4AL6A 4YFUA 2XYHB 4U6PA 3PRBA 4DV4F 1UTAA 2OPPA 2OAUA 5EX0A 4J9UE 5MLCV 3X3UA 2OPRB 2GZOA 3KJVB 2YKPA 1SJ3P 4I1TA 2JOQA 3Q0AA 3QLHA 1ZPWX 2QO3A 3KLFA 1F60B 2HMIA 1WSRA 5BXIA 3KDOA 1NLKL 4X66J 4FZVA 4IG3B 5L46A 4C0HA 3OLBA 1MN9A 1U02A 3L3CA 2XNQA 3AOBA 1OYEA 3QIDA 3UNYA 1NDKA 1TV6A 3B54A 3HD1A 2HLTA 4NL5A 2B51A 2O66A 4W4MA 4FPRA 2RRBA 4DCPB 3M8WA 4WP9A 4QWDA 4OI2A 3CD7A 4F02A 3ETMA 2ABYA 2BOPA 5KFWA 2F8HA 2MY7A 3DI6B 3UDLA 1CJTB 1DURA 2K8GA 1D1UA 1FWPA 5HJYA 2EC2A 1YG0A 2VH7A 5HQLA 1OYDA 3CIMA 3UDVA 4IH6A 3DDIA 3R2CJ 1RTIB 3DU5A 3MM5B 4P74A 3P45B 4HI1A 5HMYA 4U67Q 3DRPA 1KVKA 4LFAF 4N8NA 4C0BA 1T03A 1D9FA 2F40A 2WSEC 5L1JA 1ZOTA 1NKEA 1HBNB 4U8VA 3FMBA 2QL9B 1S1VB 3D67A 4I67A 2P5VA 1PJ5A 3OUYB 2MQNA 5E3AA 1HBMB 1SVDA 4CLPA 4Q0BA 4ZPWR 1F0XA 2DCUB 2GAGC 4ATNA 2MB0B 4ED0A 1FKPB 3WHIA 1P8GA 1S6PB 2VG5A 5KFNA 1G7CB 2D3UA 4DV3F 2ALYB 3BS9A 3BSOA 1S4EA 3KG1A 5KG2A 3RBXA 5F9NA 2Q1LA 3W63A 2XMKA 3WX4A 4Y3CA 3SQOP 4C48A 3BQ1A 5FD1A 4TY8B 2DR5A 1TP7A 1WI6A 3OD2A 5B0AA 2NREA 4I2PA 3FBBA 4MK7A 1FKOA 1HWKA 1X7VA 2E1PA 2NYIA 1IBKJ 1K9MT 2XS7A 1HYSA 1X5TA 3HVRA 4NLXA 2B8QA 1RT6A 2QLBB 1W2IA 4ZVFA 4F4KA 3QNWB 3RJMB 1F2HA 1YJVA 4KYZA 1IBLJ 2YNFB 2ZOMA 3L4BC 2BBEA 2GQ2A 4HR2A 1JLFB 3ONQA 1T02A 5BYSA 4DV2F 1L3VA 3JSYA 4RKUC 4IFYB 2E1MC 4IOAQ 3D2WA 3JSMA 2J6SA 4X4PA 3IP0A 4JI7F 6FDRA 2QEXS 1RKJA 3TANA 3CMAS 1REGX 3QJPA 4IG0B 3MTKA 1S1XA 1KRPA 5HN0A 2DNLA 5J2QA 3C8YA 3GPAA 5B0DA 3OL6A 1T0TV 4ZVOB 5HATA 1Z4UA 1Y00A 2WOMA 3KLHB 3DGVA 3E3XA 1AROP 1YLXA 4A8SA 1JLEA 3FCVA 9RUBA 4ZMMA 1CS4A 4EWTA 4P72A 1B0PA 1AUSL 1LW0B 3AQOA 2DY1A 3RR7A 2BRKA 2LXUA 5IV3A 4BS2A 1LQ9A 3FZ2A 1L5UA 4KKOB 3M2UB 4PG8A 2KI2A 2F5GA 4NRUA 2HQDA 3QAEA 1O8BA 1D3WA 1SH0A 2GNKA 2HZCA 1NK7A 3GZ7A 2DY9A 1LWEB 1Q8BA 2RVJA 4YDXA 1B99A 4UTGA 4FF2A 3PW4A 2MDAA 2DPJA 1ULRA 1WG4A 3PVXA 1CJUB 1A7GE 2MKKA 1HMVA 4ZP6A 2KN4A 1RLDA 4RW8A 2CWXA 1S0MA 3J7A1 4WF9Q 2BKNA 3FBFA 3D6FB 1JLCA 1MROA 4ILMA 4QR2A 4QPXA 1DQ9A 2RJZA 2PT0A 5IZHA 5KG0A 1QUVA 2JC1A 3DOLA 3IRXA 4ZVTB 1H72C 3NXZA 2BW2A 2HEKA 2EFQA 4DV3J 1LKZA 2BUNA 3FSXA 3P49B 4OFZA 1MWZA 1JWWA 3H4DA 5KFSA 3MM7A 2M52A 1RAHB 2XLIA 3M4XA 1WELA 1LV5A 4X4NA 1FTRA 1N48A 1DTTA 4KV8A 5L9XA 1DTQA 1LK7A 3TVZA 3THTA 2D74B 2YKAA 1HKAA 3GIIA 4LRDA 1JLBA 1H7XA 2KXHA 2LQ5A 1NK9A 1N32F 1IKWB 4PWWA 4BC9A 2VC0A 4BDPA 3L95X 4EFAC 4F4ZA 2YWWA 5A8WA 3AB2B 2XYGB 1VRTA 3A8JA 4C3KA 2GVDB 2WRMA 2GGPA 4W90B 3B82A 2Q79A 1SV5A 3DXBA 4F7VA 2CVIA 4TLQA 4WE1A 2J0SD 5DQIA 1DHMA 3K7RA 3FRYA 5E2QA 3BV8A 3AHPA 4OYWA 3CC2S 2XWYA 3WDOA 3VZIA 3V4IB 5AJ3J 1NXIA 2HFOA 3ETOA 3RG6A 4JI7J 1R8AA 4OI3A 4O3PA 4J9KA 4MTPA 4HI2A 4DPXA 2QL5B 4XTTA 2AYEA 4FVMA 4ZN3A 3DRSB 3O1LA 1NAQA 4W92B 3UCZP 2F4VF 3D1HA 2UXCF 1Y0HA 5SUHA 3HM9A 2DR6A 4OX6A 1LXNA 2RQMA 3UR3C 4LRAA 1V5IB 2P9GA 4M5DB 1RAOA 2HFVA 4ZIWA 2AEJA 4DL5A 4DCOB 4WZMA 4PG4A 2D69A 3KLGB 4W98A 2ASLA 3UDEA 5DZ6A 1M0SA 2CZVC 2PEHA 2W4PA 2ZJQQ 3RZAA 3HF5A 2DXDA 2HHHF 1FI4A 3Q89A 1I6JA 1WHXA 3S8SA 2ZH2A 1U6FA 3OL7A 5DQHA 1H2UX 2GIRA 4FYDA 1HWIA 2OP5A 4NI2B 4A8OA 5CZXA 2QX0A 1FA0A 1H2TZ 2E7XA 4DQPA 2PGCA 2Q43A 4OYOA 2MKIA 3HVTB 4F4YA 3RB4A 4CO5A 2W7AA 4H4OB 2VODA 4JI5F 1TUWA 4ZHRB 4M5IA 1SUQB 2XQCA 4LIWA 3ENVA 3BR9A 3W65A 3CWJA 1S4FA 3N6NA 4WTOB 3OXFA 2D7SA 3PNIA 1PO6A 1EB0A 3MEDA 3I0SA 4TU7A 5DGAA 3D28A 2ZJRQ 2COLA 2GJIA 2KB2A 1SIWB 3RR8A 1Y9OA 4PG5A 4A4JA 3DGPA 2YNHA 2AYBA 2OHDA 3JYTA 3ISZA 2E5LF 1APSA 4LR9A 2V4RA 3NEKA 2FHKA 4XDCA 3POTA 5KG7A 1WUUA 4KBIA 4YEAA 3MM9A 5HP1A 1T11A 3TJAA 1RWMB 2YX1A 3O6QA 4CTAB 1N32J 2M3DA 3DN9A 5A2QU 3RBEA 2R2SA 4DR5F 1TVRB 3PW5A 2CRLA 4RW6B 5I3PA 4MKYA 4L76A 1N34F 2V2KA 3TW0A 3T41A 1P27B 3IWLA 4GKJF 1VQOS 2C2RA 4LF1A 3IR7B 1AZSA 4E8UA 3GFZA 1C4AA 2VASA 2QA4G 3F41A 5GAHU 2RU3A 1KSPA 3UI3A 4Y2KA 4UY8T 3SYZA 3QO9A 2ZEJA 4DS4A 3P96A 3AJ2A 2DO0A 3I6PA 4B9TA 1CSJA 5FJ4A 3DRRA 2DIVA 3OBIA 4JI3J 3M8SA 3CTRA 1LWCA 1NH8A 4KGZB 2IVFB 5LSOA 1T05B 3JXOA 1Q7YT 5KFAA 3H7HB 1M5KC 5H9FK 2RT3A 4G1IA 2M70A 3V4MA 4NMXA 3K5MA 5ETQA 1JJCB 2UXCJ 2FJVA 4H4MB 3T1YF 2PEBA 3Q8SB 1WOSA 5F8GA 4DF8A 3VGSA 2EFNA 3LP0B 3CJKB 4B3OA 3K59A 1VBKA 4YDDB 3BBCA 4DBQA 4YR3A 4A46A 1IR2A 3AA8A 2ZD1B 4AQYF 4WKYA 4V1Ak 1KQFB 3M8QA 1U09A 3V6JA 2HHHJ 1GAOA 2DB1A 3MMAB 1ZAXA 2PC6A 1S9GB 3DRXA 4ZJLA 3VZHA 4CDIA 1R0BG 3I31A 5CYQA 3MR5A 3CDAA 5IM0B 7FD1A 2F9JA 4KO0A 2ATLA 3H5SA 1RHUB 2M7SA 4ELVA 1TKDA 4ELTA 4JI1F 3KYLA 1NU4A 4GVLA 4O3RA 4EBEA 1RXOB 2LDIA 2XHCA 4JI5J 3UCGA 2DKOB 2B8PA 1DLOA 3KHRA 5JVHQ 2V8GA 4TU9A 3D5MA 1NDLA 1RWKB 2PMHA 1XNQJ 4K5RA 4WIIA 1X9SA 3MEEA 1WF0A 1WC0A 5D0GA 4QJVA 2DH9A 4MT1A 1UW4A 4HL9A 1TU0B 3D3BJ 2WBMA 5CCMA 2QSWA 5KT3A 3QRRA 4NYPA 3GONA 4EYIB 3KG0A 1MLAA 3CDUA 1SJ1A 2KT3A 1RYRA 3RRGA 1S0OA 3OVAA 3MD3A 3C6TB 1FX4A 1RTDA 2FQQB 4B3RJ 1VQPS 4GKJJ 1JJ4A 3UPFA 1VDHA 1VQ9S 5K14B 2C2KB 2L9NA 4E98A 2AWZA 3VGTA 2HNDB 4ECUA 3QGIA 3PJWA 4MIBA 2R7SA 1HI1A 2W24A 4Y2IA 5B0EA 2PIIA 1RAEB 3T5JA 2ZH1A 4Z7CA 4IQXA 4DUTA 2V8PA 4NLUA 4JOUA 4IRDA 1VQNS 2MKSA 2WB1D 4Y65A 2PFFB 2MEWA 2K06A 3UDCA 2OGUA 1RT7B 4EU0A 1NCLA 3QQCD 3MM6A 1UL3A 1UPPA 2AD9A 1UWAA 2DIUA 3S7RA 3CCWA 3KMSA 1Y3KA 3TVKA 3TZZA 3T1YJ 4O4RA 5I3UB 4HT5A 3JB9k 2XCAA 2G0CA 4AD6A 2CZ4A 4U7CA 4D3GA 4CLZA 1YJRA 3HJVA 2QMWA 2MKHA 1OY9A 1HHSA 2BZ2A 4YB5A 4NASA 2MGZA 1HFEL 5HI7A 3W9JA 5KFEA 2DGVA 4F0MA 3EYZA 2VC1A 2V8HA 3PHTA 3R9LA 1F9FA 2X1GA 3R2DJ 3A3NB 2FJDB 2LEPA 4PZVA 3NWGA 4F50A 4K59A 2V68A 2XG8A 2C3UA 2J9DA 3TA1A 3D4JA 3M2RA 2DITA 2DHAA 1MNEA 2WCXA 2YKMA 1H3DA 4JI1J 4F3OA 2ZHAA 4Q5VA 3R5CA 3QPIA 5E3CA 4X4VA 2V67A 1RCOB 2XM3A 1OS5A 4UUXA 3QSYB 4A48A 4RUBA 3Q83A 4ID5B 3GLJA 3H2LA 2E9RX 1DQAA 1N5YA 1CQNA 3PEHA 1Q7LB 3M8ZA 2QA2A 5DGBA 1E6VB 1IXKA 4RNMA 2JZ5A 2CG4A 1LWFA 2W2OP 3W60A 1D0EA 4U8YA 2Z57B 1MMDA 2A3JA 1MWYA 2W9CA 1SJ4P 4UZBA 4NA3A 2W8KA 3PW2A 2YKNA 5AXNA 2OPQB 3BYRA 1FTCA 1U24A 3DNCA 1NZAA 2JVRA 2ATCB 4QIEA 1FFSB 2EG2A 1Y5LB 2X1FA 2AX1A 1DJ0A 3OR2A 1U0HB 3QT7A 3ZC4A 1PIEA 2V34A 4PEOA 4L75A 2AX0A 2OTJS 4Q0BB 3N9UC 1FT8A 2R7XA 2KVIA 3B6BA 1Q78A 4JI8F 5FDLA 4G1PA 1BXNA 5DLGA 4MK8A 1NEEA 4YB7A 2FGCA 4PYDA 2OIHA 3D54A 3H0PA 3IR6B 4ZPBA 1OWXA 2CYYA 2EFPA 2J8AA 1OMSA 2VONA 5HSPA 1KOOA 3B4MA 3DC2A 3N4WA 1RZMA 1G1XA 1RQ0A 4WKRA 1WG5A 1J5OB 3T1HF 1CLFA 1NSKL 4Z7YA 4AUKA 2VPWB 3CJ0A 4PG6A 3V81A 5ETPA 5JJBA 3DMJB 1TFWA 2IHR1 2F3JA 5SZTA 4UQTA 4FBTA 4PXDA 2CQHA 1C0TB 3FEZA 2G9OA 2UVVA 4FDFA 3KLIB 2FZGB 1FEEA 2VFTA 1X0FA 3MR6A 4C0OC 4AE5A 3GSIA 4LRCA 3BO2A 3IBFB 4ANEA 2KYXA 3KJQB 3T5LA 4DFJA 3MAHA 2IYGA 3LWMA 2NLWA 3M32B 3CF5Q 1T95A 5J2QB 3KHGA 1S9EB 2YWGA 3ITHB 3HJFA 5L39A 3CULA 1MWQA 3GCWP 4X4SA 4HKQA 1F5AA 2AJ4A 3D0GE 3I9ZA 2AHOB 3ELHA 2UUWA 1Q5VA 4DN9A 2HS0A 5AXKA 4HDGA 5C24A 1WOPA 4IKAA 4LF4F 2Z2MA 4NCAA 2ZBCA 1YJWS 1VFJA 2DHHA 5C2CA 1ELOA 1NPPA 3PO5A 4N5SA 4DQSA 3UVJB 1IKVA 2L48A 1JLQA 2GJFA 1YIJS 8ATCB 3VALA 1RHMB 2XNRA 3PCOB 1K8AT 4ED6A 3DLHA 4P52A 4NZ0A 2B4PA 2ZOFA 1FO1A 3MPVA 2OMLA 3IR5B 2UXDJ 1X31C 3ADAC 1L3UA 3RAQA 2EW9A 1IQZA 4PWDB 2EK1A 5EDWA 2Z0GA 1VQLS 4PUOA 2KZZA 2AGQA 1ZYQA 1BD6A 1HBOA 1H2VZ 3EVOA 3UNGC 2CQGA 2E5IA 2MZQA 5J1EB 4GRSA 3MR2A 3G71S 3FSIA 3FFIA 4JI8J 3FQKA 2CNKB 3BO4A 2W9BA 3TEHB 5D4OA 4QWCA 1U6ZA 1B0VA 4NYZA 3MM7B 2N82B 4USJC 4BWJA 2BE7D 1TMJA 1JKHB 1SL2A 1A9NB 2EG1A 2YY3A 4ZA1A 3JTOA 4V19J 4KH1B 1SJFA 2KM8B 3C19A 1P6TA 3T1HJ 3DLJA 2AKWB 1QD1A 1TL3B 5B0GA 1P9YA 1UPMB 1V5VA 2HQFA 2BX6A 2QRRA 3K8VA 1BGXT 2K1RA 3TAMA 3AOAA 3EE3A 3W62A 3KK3A 2MJUA 1AT1B 3VVTA 3ET6B 4KSEB 1HIYA 3KNAA 1G6BA 1XTZA 2MYFA 3TX8A 2CVEA 2E44A 3OTCA 1LW2B 3TAPA 3EZUA 2HGMA 3MEGB 1NHUA 4K4TA 2EFGA 4AXJA 3BB5A 2IBOA 2P9CA 1EJ7L 2Z4PA 3SFUA 1U7LA 5ETLA 5CQGA 3V6HA 1TL1A 1TL4A 2O1PA 4WU3A 2B9XA 3HHLB 1FNMA 1B7FA 3KLEB 4N76A 3PM9A 2BEFA 2CJQA 3BN7A 2VBYA 4F3QA 1KD1T 5I3QA 3CSKA 3Q8PB 4OQJA 4LF4J 3NY0A 4DG1A 5DLFA 4LSNB 1RT2A 1S5ZA 3M8YA 3CDBA 1R31A 1FVQA 4ZPCA 2DHGA 1BHNA 2W7PA 3MDFA 2LXFA 3TARA 3GMGA 2QN6B 3DOMA 3CJ3A 4NLVA 3LUYA 4Q2MA 5AE3A 4DSKA 2UVUA 1UVIA 3NOGA 1KWMA 2HIYA 3I87A 4EUVA 1TAQA 2ACYA 4ZCLA 2V0NA 3TWZA 1S77D 1J5EJ 3MEKA 3HX9A 1BC6A 2F8MA 2MSSA 2MLYA 1N6QB 1RDRA 3J81U 4ZVRB 3QJJA 3A8IA 2OPRA 4PQUB 3KJVA 4NPOA 1NK4A 2HVDA 5A8KB 3RW7A 4NEZA 4B9NA 1QJHA 5K8PA 3LP2B 1PSDA 2Y1IA 4QIGA 3PXGa 1ZAVA 1CJVB 4IG3A 4IOCQ 3FVYA 1RBOB 1RT3B 2K7JA 2ASJA 3VR1A 4UOFA 3BGOP 4DEZA 2QGFB 1REVB 2GVZB 4FF1A 4C6AA 1RKIA 3MR3A 5KFHA 2JVOA 1B4SA 1FXRA 5EWGA 3CJTA 2XSJB 3AOCA 3IS9B 2FVPA 3VAGA 3JQMA 1FXDA 4XPCA 1X0PA 2XEXA 1FDDA 1UA0A 4PKDB 3DI6A 5HMZA 1CJTA 2A1BA 3F56A 2HHUA 5KFJA 4JV5F 3CJ5A 4ES1A 1UEUA 1ITPA 1HPZB 1GMWA 3MM5A 1YRXA 3H5UA 1FJGF 3MURP 4K0KJ 4KGMA 2MLXA 1HBNA 1S57A 3BBBA 1S1VA 1SKUB 3E2EA 1SQGA 3OUYA 3ICLA 1IJFB 3DRYA 5GMEA 4NRTA 5DJBA 1HBMA 1Q8LA 3SMZA 3TA0A 3M8PB 1FKPA 1RWOB 4CLKA 1S6PA 4WIQA 1CJKB 3G6YA 4ITSA 4CO0A 3A3PB 2CADA 2ZDPA 3K8WA 3MPDA 2B9WA 3PRVA 3MAAB 2J9EA 3H25A 5LJ5Y 4TY8A 3NBPB 3A3OB 1FJ7A 4P7TA 2MQMA 3IGVA 2FVRA 1FK9B 2QA1A 4DPUA 2V8VA 5DETA 4N47A 4JI4F 2A0FB 5DRKA 3K5NA 4ZITA 2VV5A 3OJSA 1HNZF 1DZ5A 1OY6A 2ZZMA 2LCWA 3SSRA 1NH7A 4ELUA 1XR7A 2KG1A 4B9UA 4J9VA 3EZ5A 4NLGA 2IBKA 4O3NA 3RAXA 2YNFA 3HHDA 4XPEA 2LP4A 3H8YA 3DM2B 4OJGA 4E0DA 2CFXA 2E9ZA 1JLFA 2V4QA 1FX2A 1X5SA 2FTRA 3H2VE 3QIPB 2JWNA 2WVFA 4R5PB 3NCQA 4DL3A 5EGYA 4IFYA 4RWWA 1NPRA 3ZNUA 4CO3A 4FS1A 1U4BA 1YI2S 2CJKA 3C6UB 4URGA 3PKMA 3QT5A 3C3LA 2ZNYA 1DLOB 2C2MB 2DCLA 2J0QD 2J8SA 5AT1B 4IG0A 3C66A 2I8EA 4A8KA 3EXYA 3K57A 1KBRA 3K5PA 1PJ6A 1FDBA 3EUNA 4X4OA 1Q53A 1H6KX 4IH7A 4A8WA 3KLHA 2W9AA 1KN6A 2EBGA 1TUGB 1UFLA 4P2MA 4AYBD 3TZXA 4JB8B 4KAIA 3TYTA 1T7PA 1LW0A 4IH5A 2E5GA 3JTPA 4KKOA 3M2UA 2MXYA 3O44A 2WVCA 3G4SS 3HO1A 1XERA 3THVA 2Z30B 5CYMB 3NAHA 2B4UA 4JV5J 4ECVA 4B3MJ 1AYEA 4NEYA 1YKWA 4KR0B 2VBWA 4HHJA 1AFJA 3IFEA 1IM6A 2CXEA 3GV5B 1CJUA 2PA3A 3JS9A 1FJGJ 1WKKA 2CJBA 5LOQA 4QYRA 3L9ZA 4Q43A 4DHVA 3NGRA 2DNPA 3BSCA 5KFIA 2GJ2A 4AL5A 1S1WB 4CIOA 1ACMB 3F73A 1OQ6A 3F44A 4MFBB 4RO0A 4TYBA 5KFBA 1UJ6A 3SQGB 1ZM3A 3SCJE 1QAXA 5C25B 4Y6IA 4OLOA 2ZFHA 5HMXA 1CBKA 2HQCA 5KFFA 1WG1A 1NK0A 1GQEA 1ROFA 3GG0A 3PR4A 4C98A 3H59A 4ZPTR 2CPFA 5D78A 4ANDA 1K1SA 1CG2A 4IRKA 1HL6A 3D6TB 3SV3A 4JI4J 2OELA 1IKWA 2V9WA 4CCHA 3Q86A 1HNZJ 2CKWA 2PMZD 4OHYA 4KRWA 3QFWA 4LSLB 4LF6F 2W4CA 4OI0A 3IC1A 2DNOA 2OFGX 2IYIA 2LFVA 2GVDA 2PI5A 4ZVHA 2R2RA 3NNCA 1HLWA 2LQ8A 4MAKA 5IT4A 3ZZZA 1GNKA 2VIHA 1T9TA 1VBYA 1N0UA 4WJBA 4RUCA 1IWGA 1XMBA 4TNOA 3NS7B 3V4IA 3QGHA 7AT1B 2B5JB 5IV4A 1OJ4A 4ECTA 4N41A 1EAYC 3CCZA 4OYIA 3RRKA 3K5LA 1TUVA 4ICLB 3OTEA 4K4SA 2XBPA 4NCGB 4USWA 2EI5A 2ADCA 1ZTWA 3I0RB 2BW7A 3W2VB 2YQ0A 4F25A 4LVNP 2YWEA 2NUHA 3QJLA 2IJRA 3DRSA 2CQDA 4NZ6A 2RUGA 1NBEB 2ZVSA 3CW2C 1VCTA 1SKRA 3R8YA 4L72B 3HVWA 3MPUB 2W1BA 3C15A 5CABA 1GXUA 1S97A 4M5DA 1J27A 3GP9A 3GR1A 4KIAA 1EP4B 1GX6A 3CCSS 1FRHA 3BO3A 1C1CB 2JX2A 2OEJA 1U1NA 3KLGA 2ZM6F 4CNZA 1VLOA 1QSYA 2V69A 1T9XA 5GAEI 4O4GB 3JTNA 4NX9A 4NLYA 1B64A 3EJMA 4DN0A 2D1CA 2IDLA 1ZM4A 4LT6A 1RHKB 1S79A 1VQSA 1XR6A 4MH8A 3D3CJ 2AV5A 4LF9F 4NI2A 2R7UA 3PYGA 3EGVA 4M94A 4KPCA 3NP5A 4FBUA 4TXSA 2Z2LA 4H4OA 3CEDA 4K4XA 4J9OA 4ZHRA 3ZNJ1 3K58A 1SUQA 3GIMA 2E5JA 2EC0A 4WYLA 3WC0A 1LXJA 3OFGA 5EUHA 3BH6B 3FJ2A 5KT5A 2XHWA 3D7SB 4BHQA 2UVRA 2Y8YA 4H54A 3ZZTA 4DQIA 3IMQJ 4JV2A 4DX7A 3V81B 2ZUAA 1FJCA 3GWCA 1WKJA 3IA0A 2JJ4D 3VGUA 4DV0F 4QZVB 1XJWB 3CGIA 4ILLA 4OZLA 3TJ9A 2DXFA 2DRAA 3I4HX 1N5TA 5M2UA 4ECYA 1S0NA 2OTLS 1TKXB 4C8NA 3R7BB 4USHA 4CTAA 4MKVA 4O0IA 4KGXB 4EZ6A 5MAOA 2G13A 2AJQA 2GAHC 1YJUA 3BM7A 2B7BB 5T41A 1TVRA 2QT7A 3CCVS 4LF6J 4YR0A 1YBTA 4RW6A 1WD6A 4DPTA 1EKSA 1RACB 2VOOA 2YQ3A 1TFYA 1UWBB 5HL7Q 4CYUB 1WF2A 4PXEA 3M2VB 1FE0A 1SC1B 2CPZA 1H98A 2OH2A 2ZH5A 1PC4A 1JJHA 1X4GA 1GH8A 4DFPA 1ZM2A 5F3ZA 4B9LA 4ZCKA 1EKRA 4I7FB 4P2FA 5HO4A 3BGRB 4Y28C 2J9CA 2WZ1A 4RWXA 1R7IA 2X1BA 2FLPA 3MZIA 1R8HA 1FRXA 4LF5J 2ROGA 2Y0SD 4YP3A 3I5CA 2H4YB 4H4MA 4C8ZA 2FHJD 1UEVA 2YKQA 2MTLA 3E8OA 2ZC4A 3CJKA 2BKOA 1U26A 4DZDA 4WXWA 1JLAB 2ADBA 1RAAB 4OJ1A 2ZM6J 3JAMU 4ZIVA 2ZD1A 5E41A 4X4TA 1EQ0A 1TKZB 2MKJA 5T7LB 2WW8A 3MMAA 5DG7A 3W7BA 4ETXA 1S9GA 3OR1A 1IBMF 4B9VA 4LF9J 4WTYA 5IM0A 4IFVB 3K2YA 3JSBA 3ZZ0A 5CD4A 1JLGB 1FCAA 4PXBA 2R9LA 1R0AB 1KP6A 5KG5A 2ZZTA 1JXEA 2JC0A 1N33F 1TKTB 4DLEA 3A8KA 5LMUF 4DR6F 1YX2A 5BR8F 2GA7A 5EHHA 2VG7B 4NA2A 2I2YA 4M63A 1HI0P 3QAUA 2KVQE 3GJQB 2VL1A 4LSZB 3CCQS 3RRHA 4XO0A 1WSVA 4RW9B 5F8HA 5LMNF 4S0MA 3UN2A 2B0GA 3H2UB 3CJ2A 1LFPA 4DV0J 2NXEA 4LF2A 2R2TA 4JYAF 5DQGA 1UVJA 3OV7A 2H54B 4Y00A 2JEJA 3SEOA 1S10A 2LLZA 2H4WB 2PDAA 3C14B 3FEXB 1N36F 1H38A 2NSCA 4J91A 4NMLA 1HNWJ 1RGVA 2IVMA 3NGTA 2IC3B 2AIRB 3C6TA 5C2GA 1WACA 4U96A 2J7WA 1RTHB 3RTVA 2ZWPA 3K89A 4KFBB 5A2QY 3MHYA 2IMWP 2VFUA 2VA2A 1WC6A 1WEXA 5KFMA 3NKYA 1S76D 3P3DA 3FC9A 5K14A 4ALZA 1JNRB 3QBCA 1B3TA 3IG1B 2V5HG 2HNDA 4OYZA 1T3NA 3HD2A 4JI6F 2C42A 5KT7A 5FLXU 4FP9A 2DNGA 3FDSA 1Q1KA 1T8EA 1CVJA 1S6QB 3G82B 5KFGA 1YWXA 3HVAA 2EWHA 5HBMB 5LSLA 4YB1P 2UUBF 1EX8A 5B7WA
chains in the Genus database with same CATH topology
4OZ0A 5EWFA 4NLDA 1WTFA 2BVZA 4CNYA 1ZAWA 4Z2XA 1E6YA 2G0CA 2R8IA 4JI3F 1BQMB 1W25A 1XK8A 2CZ4A 2PD1A 2RDIA 4D3GA 4U7CA 4F4WA 1JXLA 1YJRA 3IG1A 1TR0A 3KNGA 5F0UA 1N5VA 2QMWA 4HDHA 2MKHA 2YX7A 1CC8A 2CPEA 4FNIA 2B4OA 4OHVA 1HHSA 4DV1F 2ZC3A 2PO4A 2BZ2A 1M90T 3CCLS 1B0TA 1ZZFA 5DM6Q 1RT7A 1R27B 1XWLA 4YB5A 1EETB 2A2DA 3CCUS 3EPGA 5CD4H 2M4MA 2MGZA 2B4VA 2BQUA 2ZE2A 4ZCMA 3M2RB 1HFEL 3NS5A 5HI7A 4F8RA 2XMVA 3HI9A 4BBYA 5KFEA 2DGVA 5F3TA 3EYZA 1QAJA 4TLRA 1BWEA 4DL6A 1S6QA 5H9EJ 2IMOA 3DLEA 2R8KA 2VC1A 2V8HA 4OI1A 5G4DA 2XLJA 4NLWA 2YKMB 3SFGA 5HBMA 1VQ6S 2GIQA 5I3UA 1F9FA 1UAWA 2X1GA 2KTQA 1X8DA 1VBZA 1NJXA 4OHZA 1Y7PA 3DDNA 1FNXH 3ENWA 1U1PA 2FJDB 4O3SA 2Q6CA 2HFZA 2LEPA 2FIUA 4GC7A 1QAYA 1T94A 2FVSA 1BQMA 3CD5A 2VPZB 3NWGA 4K59A 4K4YA 4F50A 5KFOA 2CJ9A 2MSTA 3GG1A 1FHTA 2HRYA 2UUAF 2XMJA 4TN2A 5D8HB 4DV5F 2M9KA 2KXNB 2FY1A 1HQEB 2XG8A 1UETA 2C3UA 4NXMF 1EETA 4RZRA 3C2PA 1IUJA 2J9DA 3CD0A 1NK6A 3TA1A 2GMJA 3M2RA 4J9SA 1JB0C 4M8LA 2XLKA 4LF5F 1TK5A 1N5YB 1SB6A 2DITA 2DHAA 2YTCA 3KHHA 2KO1A 4RU9A 3D1QA 1MNEA 2CQ2A 2WHOA 3SCLE 2M8HA 2WCXA 2A10A 2YKMA 2ZZNA 1H3DA 2Q6BA 2JDJA 4F3OA 2ZHAA 3CDEA 1LWFB 4Q5VA 1QSLA 3R5CA 3P5TL 3QPIA 1WWHA 2C3YA 5E3CA 2F7VA 2L08A 5J1NA 4NWBA 1TZ0A 4X4VA 4X2BA 1ZETA 3OFHA 5THWA 4DR2F 1QTMA 3PV8A 4LIRA 1JK9B 2RKIB 4DMZA 1OS5A 2U2FA 4UUXA 5BYQA 4CO2A 1PGZA 2W9CB 4LMZA 2ZKTA 4I6WA 4A48A 1HQEA 2RD5C 2Y1RI 5BJRA 2KYZA 2LXIA 4ID5B 3H2LA 3PIPQ 3QZ8A 1D8YA 4I64A 3MUMP 3W3SA 3PACA 5HROB 1ZM9A 2YKNB 3CCRS 2VBZA 2E9RX 4KPYA 1DQAA 5GADI 1NKBA 1N5YA 2BJDA 4C4WA 4EYHB 1CQNA 3DXSX 5KT6A 3O8WA 3PEHA 3KKFA 2KRRA 5CYJA 4MMOA 1Q7LB 4NOHA 2RQ4A 1CEZA 4X65F 3IRWP 2QA2A 5DGBA 2ZUGA 1E6VB 1IXKA 4RNMA 4PQAA 3OTDA 3OR2B 4CH0S 2JZ5A 2CPIA 2K2PA 2XULA 3U02A 3OVSA 3CB4A 4ECWA 2CG4A 2ERRA 1LWFA 2R4FA 4TKTA 5DDPC 2VOPA 3HHEA 3J7Z5 1N52B 3HKWA 1D0EA 3HXMA 3JAMY 2FHMA 2NR0A 4PWUA 1MMDA 3R5AA 4GC6A 5K8MA 2R7VA 2PSZA 2DNYA 5KT4A 2A3JA 1MWYA 2DNHA 2RKIA 4HT7A 4C97A 1MU2B 4YHHF 2W9CA 1SJ4P 3N5FA 1JJ2R 4MYTA 4NA3A 3VQTA 4ID5A 2IA0A 2VZ9A 2W8KA 2R2UA 3PW2A 2OKQA 5HROA 5LSRA 2YKNA 5AXLA 5AXNA 4MYUA 4F67A 2ALZA 2OPQB 3B8HA 4J37A 4ES3A 4Q45A 2XGPA 1FTCA 1U24A 3M30B 3BN4A 3DNCA 5FDLB 1NZAA 2U1AA 2JVRA 1WI8A 1RT1B 4QIEA 3HLUA 2NSBA 1E6VA 2EG2A 4KE5A 1Y5LB 2X1FA 2AX1A 3LW5C 4J9QA 1DJ0A 3OR2A 2ROEA 3ZC4A 3HVTA 5CXTA 3DLKB 4N77A 2CPHA 2MQOA 1C4CA 1Q81T 3M1VB 4ED5A 1XNQF 1VK8A 1YQHA 1L3KA 2RH3A 5LL6d 2J9DE 3PRDA 1R43A 1Q4RA 2CQ0A 2AX0A 1NJIT 2MY8A 4JV1A 3WC2A 1U1KA 2OTJS 2UUTA 1VMBA 4KHPF 1MU2A 4Q0BB 3AA9A 3FCHA 3SSQA 4OZ1A 2DPIA 3N9UC 1FT8A 2DNKA 3OPKA 5D4NA 2R7XA 2KVIA 3ZFVA 4L6V3 1VQKS 2OPQA 4PG7A 1X4HA 1Q78A 3GV8B 2DJWA 4RUHA 2APOA 3CVKA 3MWBA 3M30A 2HGLA 4JI8F 1SL1A 3HZEA 5FDLA 4G1PA 4C7QA 1RT1A 5KTQA 5DLGA 1HW8A 1X4EA 4QR1A 2LEAA 4MK8A 4QYZJ 2HS3A 2IJFA 4G1QB 1NEEA 3A8EA 3BR8A 4YB7A 2BM1A 2FGCA 3AAWB 3MMCB 2R7QA 5CCLA 1M5HA 1XR5A 3DLKA 2XY6A 2OIHA 3R5DA 4RUAA 3M1VA 3D54A 5J2NB 1HHTP 3M6WA 3ULHA 1YVFA 3IR6B 4ZPBA 3DYAB 1M5SA 2IM3A 1UVLA 1OWXA 2CYYA 2JFDA 2CQBA 2EFPA 1ZBTA 2J8AA 2RMLA 3BGFA 5IS2A 4N56A 4PRFA 3UR0A 2VONA 4C8YA 4USIA 2H9ZA 1KQKA 1DARA 4Q7AA 1Q86T 4OL8A 1KOOA 3IN5A 4ZVEA 3B4MA 3DC2A 2ROPA 1KLMB 1FRLA 3N4WA 3R1LA 2AJ1A 3G6XA 4I6YA 2ASYA 3HPOA 4B3RF 1G1XA 1RQ0A 4WKRA 1WG5A 1J5OB 4ED7A 2XCPA 3KWMA 3HMJG 2R8GA 3T1HF 2ZJPQ 3J7YU 4LFCF 2I9SA 3T9NA 5B0FA 2JLEA 4DSFA 1CLFA 1HWLA 1HR0F 4QU7A 2FC9A 4G1QA 2LQ9A 3MMCA 3PZPA 4AUKA 5K8NA 4J9MA 2Q66A 2VPWB 2FJWA 2XB2D 3K0JA 3CJ0A 1TAUA 3T6JA 4PG6A 1FD2A 4I0WA 5J2NA 2YKOA 3V81A 3RU0A 2JFKA 2XMWA 3I5AA 3DYAA 5JJBA 3DMJB 4HLBA 1TFWA 1HNWF 2IHR1 2JLFA 2F3JA 1HQUA 5SZTA 3N6MA 7FDRA 2AYGA 4UQTA 2J0WA 5KFXA 4FBTA 2FPHX 4PXDA 2ZOGA 1FEHA 2CQHA 3AB4B 1C0TB 2CQ3A 1KLMA 3DHWC 3FEZA 3HDSA 3PW7A 2JHEA 5HLFB 2G9OA 1VK3A 3NGDA 3CC7S 2MQPA 1F5BA 5IXUA 2OLWA 2UVVA 5BYRA 5M2PA 1J5OA 3U7JA 4CQ1A 4DSJA 2UUCF 3KG4A 5H1SV 2WSCC 3KLIB 2FVQA 3RBDA 3AY0A 1UJ4A 2DTJA 2XMUA 3E01B 2GHWA 4PPZA 3CCES 2ZH3A 1FEEA 4HH1A 2VFTA 1AUDA 5JUMA 3PIOQ 2EPIA 4GMKA 1X0FA 5C42B 3MR6A 2B6AB 3THPA 4C0OC 4OI6A 2JL9A 3DMJA 5E7OB 3T1AA 2JEGA 2FLLA 4DR1F 1U6BA 3QGPA 5F9LA 3DDKA 5F8JA 3IGNA 2VG6B 1RT4B 4AE5A 2E9TA 2WAQD 5FLXY 2DGQA 3BO2A 1C0TA 3M9MB 2DNZA 5HLFA 1UKUA 2FC8A 1Y4ZB 3I9V9 4N8OA 3V2UC 3CDWA 3HFKA 4AXIA 4F3MA 5C24B 5LXRA 1HNXF 1FKAF 3DU6A 2KYXA 3TUZC 3T5LA 4DFJA 4OX9F 3E51A 3MAHA 2IYGA 3MUTP 1YRUA 3KLIA 3W2WB 3LWMA 2NLWA 3MECB 3V5RA 1M1KT 1IR0A 4J9NA 1T05A 3L7OA 1RTJB 3E01A 1RJJA 3M32B 4IR9A 3G8SA 3CF5Q 2RNEA 1T95A 4KB7A 5J2QB 1VQ4S 3RAMA 1NRKA 4DX8H 2M2BA 3OW2R 1I1GA 1UP1A 2AJ0A 3H5XA 1BQNB 3KHGA 3A1YG 4Y2CA 4B9SA 3NMRA 3PKYA 5C42A 2GW8A 1S9EB 2B6AA 2YWGA 3ITHB 5D3GB 3HJFA 3CCTA 5L39A 5IWAF 5IFMA 1F2GA 4FXDA 3CULA 3HK2A 1KC8T 2VG6A 1RT4A 4X4SA 1F5AA 1SJQA 3DLLQ 2AJ4A 1IKVB 4WU2A 4HKQA 3D0GE 3I9ZA 4FNHA 1VGYA 1JLQB 4DL0C 2UUWA 1K73T 2FLOA 4DN9A 2HS0A 4DV7F 5LT5A 4DSEA 5AXKA 4HDGA 1YTYA 5M2RA 5C24A 4ZS6A 5JVGQ 2OMOA 4H4KA 3U1NA 4IKAA 2NPIA 4LF4F 1V3RA 5J2MB 2YVSA 2YH0A 2B56A 2Z2MA 4NCAA 2ZBCA 3W2WA 1QVFR 1GT8A 1D8ZA 3MECA 4XDDA 3TO8A 1Z2ZA 1QY7A 2VKZG 1RTJA 5KFVA 1YJWS 3M32A 1VFJA 3L7PA 3LP0A 2DBBA 4Y2AA 2D9OA 2VD3A 3CIZA 2GHVC 1KQSR 1U2RA 2DNNA 3D1OA 3R5BA 4H4KC 3TNVA 1BQNA 3QZ7A 1L3SA 1S0VA 1N5QA 4WCEQ 3FGVA 1ELOA 1S9EA 3ITHA 5D3GA 3N28A 3PO5A 4QQBA 5T14A 1WEZA 1OSCA 3UE2A 4N5SA 3M9OB 1S1TA 3J7YI 4DQSA 1Y5NB 3C46A 2C3OA 2IM1A 3BQ2A 1IKVA 2FLNA 4B02A 2L48A 1JLQA 3CPWR 2AGPA 4DFMA 1YJNS 1YIJS 5GAHI 2P6TA 1NK5A 3VALA 1IM4A 3TA2A 2JSXA 1TK8A 2XNRA 4PUOB 5J2MA 3M8RA 5AXMA 2QV6A 2DGSA 4XAKA 1K8AT 4TQSA 4ED6A 1IN0A 5E3PA 3DLHA 1QLNA 3T9ZA 1XMQF 3AJ1A 1N54B 4NZ0A 2B4PA 2ZOFA 1FO1A 4YR2A 1DFDA 1HBOB 4MIWA 3X1LB 4MKBA 1M5PC 3I82A 1C0UB 4ZKAA 4X66F 3MPVA 4DUZF 2OMLA 3VAMA 4NLRA 3IR5B 5F8NA 5KOWA 3V6DB 2OJ3A 3FFIB 1HD1A 1BQXA 2AU0A 1FERA 4AL7A 1BY9A 2W9BB 4EGLA 4J5OA 2KKHA 4I56A 1L3UA 3RAQA 2EW9A 4K4VA 2B3TB 5EX3A 5HMWA 2QE5A 2YNGB 1IQZA 2ZH9A 4PWDB 2EK1A 4B3SF 4P2SA 2E1CA 5KFPA 3J81Y 5EDWA 2Z0GA 1VQLS 4PUOA 4A8FA 2KZZA 4C2MA 1UVKA 1WHVA 2AGQA 1ZYQA 1NK8A 1SH2A 2CQPA 1BD6A 3GV7B 4NLPA 3OL8A 1HBOA 5I42B 1H2VZ 4CH7A 3UNGC 2XO7A 2DGUA 2CQGA 2OSRA 1TK0A 2E5IA 2MZQA 1C0UA 4CO4A 6FD1A 2J5AA 5J1EB 4NZ7A 3QMQA 3EGWB 5L1LA 3MR2A 3G71S 2E1AA 3MAQA 1N56A 3FSIA 3V6DA 4JI0F 3FFIA 1OO0B 4U7UK 4IUFA 3FQKA 3U27A 5DDQC 3BO4A 2GX8A 3KK2B 2VQFF 2QFJA 2W9BA 2ZITA 3OFEA 3I56S 5D4OA 4QWCA 1U6ZA 1P1LA 1B0VA 4ZCIA 2VBXA 5K9FA 1V3SA 3M6XA 3SI8A 4NYZA 3MM7B 5E3RA 4USJC 2N82B 2YNGA 4BWJA 1JKHB 4PWDA 1Q8IA 1SL2A 5DDOC 3RB3A 2LEBA 1A9NB 1RA6A 1WHYA 4WXOA 2EG1A 5IT9Y 3OXLA 4DQQA 2YY3A 4WK3A 1VIXA 4ZA1A 2QMXA 1U47A 1H0HB 4I2QB 4Q2LA 3JTOA 4V19J 1SJFA 3PR5B 2C3MA 5I42A 4TYAA 3BEGB 2RIJA 2LQBA 2OD4A 3MMBB 4FXVA 3S6EA 5J1EA 1VQ7S 2KM8B 2K1RB 4GKKF 3TAMB 2BANB 3NGKA 4MKAA 1ZPVA 4ES2A 4ETZA 1P6TA 3KK3B 2VB6A 3KK2A 3US5A 2R7WA 1Z2LA 1FNOA 3DLJA 2ZH6A 3I5BA 2VPXB 4K2XA 2DGWA 3CCJS 1TL3B 5B0GA 2IAJB 1JKHA 3VAFA 1HBUB 2MZSA 4J9PA 4WFZA 5E33A 1TL5A 2QZ8A 3N79A 3RW6A 1FRMA 2HWTA 4Y34A 1VHFA 4K50A 2LMIA 5KFLA 1O51A 4CZCA 1YSJA 3GSDA 4I2QA 3SCKE 2C28A 5C5JA 2GC8A 4DWIA 2QRRA 2GV1A 1S1UB 1SH3A 4DL2A 2BJEA 4I68A 3MMBA 3K8VA 1BGXT 2K1RA 1MW7A 3TAMA 2BANA 1MMLA 1U1QA 4NXNF 1ZZNA 3KK3A 2UXBF 1ZH5A 4K5SA 2MJUA 1A6LA 5LJ3Y 2GCFA 3OTOF 2DD8S 1G2EA 2HWHA 3ZZPA 1FE4A 4CI0B 5KG1A 2F8EX 1V9OA 3LAMA 4KSEB 1TL3A 1TL1B 5K5MA 3B4DA 2KM8C 3T3FA 2GQQA 3J7ZT 2AGOA 1L3TA 4DSLA 3KNAA 2IAJA 2RS8A 3CJ4A 4QPTA 2LYVA 1G6BA 3NLCA 1HBUA 4EO6A 4FN5A 5ITHA 2BA9A 1JNZB 1XTZA 3OJUA 2DGXA 2MYFA 3TX8A 3I96A 1CPZA 3D0HE 2CVEA 2E44A 1YITS 3OTCA 3ZZOA 1LW2B 4G3IA 3TAPA 1HARA 3EZUA 4DR3F 4DPOA 2VPYB 2HGMA 1OPZA 3MEGB 1NHUA 2J76E 4K4TA 2IVYA 4X4RA 4DLGA 4UQGA 2CPDA 2EFGA 2ZH8A 4AXJA 1S1UA 3KHLA 2BXJA 3BB5A 2WONB 2MHNA 2IBOA 1FESA 2P9CA 4ECXA 2Z4PA 3MGJA 5KFTA 3RYLA 4LUBA 1OIAA 3SFUA 3NL0A 1U7LA 3WBZA 4QWBA 4DG1B 2D9PA 4TY9A 4L3NA 2HAIA 5CQGA 1XN9A 2AW0A 5DS7A 2QYCA 2HHQA 1R8PA 1RT2B 3V6HA 4ED3A 2OPSB 1IBKF 1KNZA 3H4BA 1TL1A 1TL4A 4M95A 3GIKA 2O1PA 4WU3A 1XC9A 3TP2A 2JLGA 3JB9k 2NUUG 2OPPB 2PE8A 2B9XA 3HHLB 2KH9A 1FNMA 1B7FA 3LP1B 2QA4S 3KLEB 4FF3A 1LW2A 4ZPAA 3MUVP 2UU9F 3B78A 4N76A 4WZQA 3PM9A 4RNFA 3MEGA 2O5DA 4IDKB 3PX6A 2CJQA 3BN7A 2VBYA 3Q2SC 2WONA 5D4PA 4F3QA 3DHXA 5LXYA 5DM7Q 1KD1T 1IBLF 5I3QA 1X4DA 3CSKA 1NKCA 5CH7B 3Q8PB 3OSNA 2L41A 2KT2A 4OQJA 5G0RB 1KONA 2BACA 4G6VB 4DG1A 3UD4P 1YJ9S 2HYIB 4JI2F 1P1TA