4LIWA

Ccmk1 carboxysome shell protein from synechocystis pcc6803, l11k point mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
92
Chain Sequence
IAVGMIETKGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVTAGIENIRRVNGGEVLSNHIIARPHENLEYVLPILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK homolog
publication title A challenging interpretation of a hexagonally layered protein structure.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Transport protein
total genus 25
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4liwA00
3MPWA 4P7TA 4OX6A 3MPYA 4RBVA 3SSQA 3NGKA 3PACA 4OX7A 4AXJA 3BN4A 3NWGA 2A1BA 3I96A 4OLOA 3VCDA 4QIVA 5L38A 3CGIA 2A18A 4P7VA 2G13A 3H8YA 3N79A 3DNCA 4OLPA 3SSSA 3CIMA 3SSRA 2EWHA 3I6PA 5DJBA 4QIEA 4RBUA 4OX8A 4DDFA 4PPDA 2A10A 4LIWA 4RBTA 4QIGA 4QIFA 3IA0A 4P2SA 3DN9A 4AXIA
chains in the Genus database with same CATH superfamily
2XG8A 3ET6A 2LMIA 4C8LA 3NAIA 2BA9A 2YXLA 3L3CA 2B7BB 1VLYA 4ZK7M 3FVYA 5IOLA 2HVEA 2G0JA 2ZHBA 2AJ4A 2WB1D 3PW5A 5C42A 4CO0A 1TFYA 3KDNA 2E5JA 4KGKA 2JJ4D 1F6TA 7FDRA 5LT5A 5L39A 3GFYA 1A9NB 4Q5VA 1CVJA 1RGVA 1TVRB 1VQ7S 5DQIA 2ZE2B 4KIAA 3OT9A 4KO0B 3KJQB 2DGOA 4LRBA 4CO1A 5CH7B 3C15B 3THTA 4OX6A 2UUAF 4G1IA 1Q79A 4LVOP 1H73A 1Q8LA 4RW7A 3K8VA 1URRA 1BD6A 1YBAA 1SC6A 5IQQA 1YITS 3TOQA 4PEOA 2QIFA 3KHGA 3G6YA 2BUNA 2OP5A 1XR7A 2YKQA 5D77A 2PIIA 4M63A 5KOXA 3ZNUA 4C3MA 3KK1B 2QT7A 1W2BR 4Y2MA 1HBOA 3R5GA 3OTEA 2FLLA 3BGUA 5IV3A 2XMTA 2B4UA 1C0UB 4IOCQ 3PIOQ 5KFXA 1RAAB 2XS5A 4Y0FA 1MMDA 1VRUA 5J2MA 1JLEB 3BDEA 1B0VA 4QPXA 3EDRB 2AJFE 3O1LA 4RBUA 2ZZTA 2WAQD 3MEEB 1YLXA 3A8KA 4I1TA 3UN3A 4FPRA 4ED7A 1LWFA 2Q3PA 4OLOA 2MQLA 2BZ2A 2C2OB 1S7IA 1VQOS 4Q8FA 5A8WB 4ITSA 3IBWA 1VRTA 4YFUA 1KLNA 3QRPA 4I6YA 1RADB 4O3SA 1G3OA 5D0RA 4RW9A 4GMKA 3KLIA 1U1LA 1HWJA 4DU8A 1APSA 2KFZA 2VB6A 3LP2B 4QJVA 5KFFA 3LW5C 3CUNA 4LF5J 2XZTB 1T03B 3R3TA 2WVDA 5ETMA 4CYUA 2LQBA 2R8GA 3EVMA 3GP9A 4Z7CA 1NSPA 4AQYF 1B0PA 1U2CA 3CULA 1LWEB 1BE4A 4WFXA 2DNPA 1FXLA 1GNKA 2BJ1A 1N5YA 1G6BA 3TWZA 5DETA 2G2YA 2VIHA 3B82A 2LA6A 2CWXA 3QNWB 1QAIA 1JWWA 5E7OB 3HSZA 1NH8A 1H74A 2DNRA 3M8PB 5D6GA 2I6WA 1OO0B 3T19A 1VYAA 2Z58B 5EN1A 1LQ9A 2HHTA 5LSLA 2FGCA 1QSLA 1TQLA 4QWAA 4CLFA 3BGOP 3U1MA 3H4BA 4OJ3A 1X4DA 4V19J 4Q7AA 4H4MB 1NDKA 5DM7Q 4UW2A 3BF4A 2WCXA 2V4JB 3AY0A 2ZH5A 3F73A 2UVWA 3SDEA 4ZP9A 4P2FA 2YX7A 4NRTA 4Y65A 4QU7A 1RACB 1SC4B 5LOQA 1TELA 1VQNS 1EX8A 5KG3A 1GMVA 1IWAA 2D3ZA 3Q8SB 2XSFA 4CWBA 1E6VB 1L3SA 4LIWA 2E9ZA 4W90B 4FNHA 4ANEA 1N36F 3FRZA 4B3TF 3MMAB 1H2VZ 3G6ES 1FKPB 3QZ8A 1X7VA 2BQUA 5K20B 1T11A 1YWXA 3TUJC 3BQ0A 1F3VA 4LF2A 3OL7A 3K57A 4LR7A 3B78A 4DV2J 4ZIVA 2XSJB 1UJ4A 3IN5A 5C2GA 2AJQA 1AA1B 4LF8J 4EO8A 4W92B 1FJGJ 4H4KA 3S8SA 3HJFA 1J5OA 5KG6A 3CC4S 4OMFG 2BEFA 3NCQA 2CQ0A 2F4FA 2RF2A 3ILIA 5IM0A 1OY8A 4IRDA 1R27B 2WZ1A 4USTA 3PR5B 3BO4A 3OSPA 1N32F 4JI0J 2EFGA 3WHIA 4EMDA 2XWXA 2DEIA 2UXBJ 1TKZB 5A0YB 5I3PA 2YVSA 2UXCJ 3K5MA 4ZVOB 4OHZA 4J9PA 2B51A 3RW6A 3R1HA 2W9AA 3KLGA 3Q2SC 1NHUA 4OZ1A 4WK3A 1RTIA 2XGQA 1YJ7A 5J2QB 1P1TA 2CPIA 3CPWR 4ZN3A 2ZWOA 4XK8C 3KK2A 3TO8A 1DQAA 4U7CA 2YNIA 5DG8A 2AX1A 3QGIA 2H54B 4HR2A 3M1VB 2MMYA 4PG4A 4B17A 5CCMA 1IKXA 2A2CA 4A8MP 3NY0A 4EZ6A 3A8JA 4U8VA 1T3NA 2H5JB 1H6KX 5E2QA 3G71S 1I6JA 1S4EA 2W01A 1ZS6A 2KXFA 1FRXA 3W2WA 1VHFA 3QIDA 4RR5A 3DMJA 1ZM4A 5FLXU 2B9EA 3MMCB 4USMA 4DR5F 2OAUA 2YQ3A 2EFVA 2NR0A 3HCXA 1XMOJ 2HWIA 2QO3A 2WW8A 4G1QB 3GLJA 2Z8QA 1CSJA 2DIVA 2IM3A 3RRGA 3ETMA 5DQHA 1B0TA 2ZH2A 4OZNA 3MFHA 4PUOB 3UFCX 4LSZB 1S6PA 3L7OA 3KG1A 4KFBB 3VVUA 2CQBA 1C1CA 1VLOA 5F3TA 1YRUA 3GQCA 2HIYA 3DDIA 3TZWA 1KFDA 2FLPA 4CO5A 3ENVA 1W7WA 2KKHA 1NM2A 4A8QA 5AXNA 4DCJB 3W2VB 5ETOA 4DR3F 3E2EA 4NLOA 3MEDB 4K2JA 1P9QC 3IS9B 1EIYB 1DTTB 3C8YA 2Y0SD 2BJ9A 2M8HA 1X4AA 2LYVA 3V6JA 2ZZNA 4JI3F 2D3OR 1X4FA 2FY8A 3D1OA 1NDPA 2QYGA 4ID5A 2HMIB 2F9JA 4X4RA 5B0CA 1IXKA 4Q0BB 3I9ZA 2YKMA 2DJWA 2DRBA 1EP4A 4AL7A 2ATCB 3M6UA 1R3NA 2ZWPA 4ZLNA 4YR3A 2WSEC 4DDFA 1IBMJ 4ZVRB 3DLKB 3DRPA 1KR4A 2AMCB 1T7PA 3W60A 1UVNA 1VQLS 3QJLA 2ASJA 1KVKA 3KLHB 4O3OA 1BQXA 4F3OA 2OMOA 2J8SA 2XMKA 3I82A 4KHRA 2BR0A 4I6WA 3OTDA 4NYOA 5AE3A 2OJ3A 1NCLA 2KM8B 4GC7A 2VFUA 3C19A 2JFKA 5KG1A 2YQ0A 3RB6A 4I0WA 2IYGA 1M1HA 1LK5A 5CCLA 3NGRA 3MD1A 1N54B 3PX4A 2FVPA 1GX6A 2YKOA 2GGPA 1IN0A 1EKRA 2IRXA 4JI7J 3EGVA 4MT1A 4U7UD 1N0UA 4JV5F 4RUHA 1QSSA 5BYQA 1UEUA 2OEJA 4ICLA 4NI2A 4WWSA 3Q8YA 1JNRB 2B9YA 2Y1JA 3FCWA 5ITHA 2HHXA 4WF9Q 3DOMB 2HVZA 1GMWD 3CCQS 1RQ0A 2DR5A 4LUBA 4ILRA 4U8YA 2KT3A 1SB6A 3HHLC 1U8SA 3LF0A 2HSEB 4O3QA 1S76D 3DDNA 2LEPA 4LBIA 3KLVA 4RW8B 1LW0B 2HBRB 4FVCA 1UZDA 3IG1A 4KKOB 5C2CA 3PR4A 4ED1A 5HVGA 2ZHAA 2CPFA 3HHDA 2JWNA 4ZP7A 3SBMA 4WKYA 1F1BB 4QU6A 4EYHB 3MAAB 4DBQA 4OLPA 1HYSA 2HHWA 1X8DA 5LMUF 4PPDA 2MKJA 4TU9A 2GO9A 4RO0A 3IAS9 3IWXA 2MKKA 2J8AA 4DR7F 2IM1A 3C15A 3MECA 3PXGa 1SL1A 5CYMB 5F41A 3N6MA 4ZVEA 3NBPA 3ULHA 3UCUP 3GE9A 3BYPA 4HH1A 2DGVA 4XO0A 3CGIA 4Q45A 1I94F 3GG1A 4ZLLA 3MGJA 4ELTA 3ILOA 2VBWA 1SH2A 3QO9A 1HWKA 4ZP6A 2HRTA 4JI1J 1BHNA 3M9NB 5JMNA 3CF5Q 5F8IA 2FHKA 4ZCLA 1RBLA 1X5TA 3JSBA 1Y7PA 4JI2J 3FBFA 1N52B 4ERDA 2QLFB 2PA8D 2AZ1A 3EZUA 3NEKA 3MM9B 2ATLA 2FVCA 4RJVA 1IBMF 4J9NA 4OV6A 2VF3A 5KFIA 4BS2A 3RBZA 2JEFA 4MK7A 5FD1A 4EZ9A 4ED8A 2OELA 2E5IA 3EICA 4Q2MA 3AJDA 4EU0A 3JQJA 4CNZA 3PO4A 2NZCA 1ZAXA 2OFHX 2X1BA 1U1QA 5HATA 1N88A 4WFBQ 3KJVB 2ZH6A 2CJQA 4DR2F 3B6BA 2FLNA 1EQ0A 2ZBRA 3VGSA 1N34J 2OI2A 5A8WA 2WONA 4P71A 1AFJA 2HS0A 1G7CB 4OFZA 5H1SV 3BKUA 1N5VA 5IFMA 2EG1A 4GVBB 5E33A 4B9LA 5DZ6A 5GAGI 3BGFA 1YJVA 2CJYB 4QPTA 2DCLA 4OX7A 5FDLB 4OHXA 3CXCR 2H51B 1GXTA 1HBUA 4QZVB 1EKSA 4N47A 2EFQA 3QGPA 3NAHA 1FE4A 1Y5LB 4NCGA 1T03A 4WP3A 1IKYA 2PDAA 1XNQJ 4USHA 1M5PC 4YB1P 4ZPBA 1FKOB 1PSDA 1FRKA 4DUTA 1UJ6A 5HMXA 2HFNA 3ELHA 1KWMA 4HTJA 1RXOB 2VG7B 3D6HB 2BE7D 4Y28C 4TVAB 3MM8B 4U6PA 2CDRB 2KXHA 1YIJS 1HQUA 1IR2A 5U47A 1PYSB 2C22A 3NG8A 4NLDA 3R7BB 1AXQA 2CNOB 3M8PA 2O66A 4DPTA 2KG1A 2GQ2A 3OV7A 2BJ8A 2FGOA 1KNZA 4Q2LA 3SXLA 3H5XA 4ETZA 4LMZA 3NXZA 4UY8T 1L3TA 3D68A 2FJAB 1RHUB 1S6OA 4QR2A 1P8GA 3RRKA 2E5GA 2BQ3A 4C8YA 4X4TA 2ASYA 4FZVA 2V4JA 2O1PA 1VBYA 1PC5A 1YDLA 3QAUA 3CD5A 3FFIB 3D7SB 2HK2A 2GHVC 4XAKA 4P74A 3DOKB 4P73A 1YQHA 2DT9A 4NLQA 3W65A 5J2NB 4DSEA 3IGNA 4AXJA 1Q53A 3N6LA 2CIMA 2GVDA 3B8HA 3DFEA 2VQFJ 2DGQA 1QAYA 4JI1F 2L3MA 3CIMA 1S79A 2U2FA 1IWGA 3MUMP 3AD8C 3OJUA 4DQRA 1VMBA 2VC1A 1XMQJ 1P27B 1WDTA 4DOZA 2DO0A 1R31A 2AF6A 3RBXA 4WP8A 2AGPA 2VFVA 2BANA 2XSJA 3LP1B 3AXMA 5E3QA 3TJ9A 2KYZA 2QGFB 2B4VA 2QLXA 4K4WA 2EBGA 2VBXA 4ZHRB 1HMVA 1TL3B 2DNHA 1NK5A 4DL6A 1T05A 2EXUA 2RDJA 1RTDB 4JI8J 4I68A 1TL1A 3RGIA 3IRXB 1GQEA 2MJUA 3MDFA 2AX0A 1QE1B 1M5SA 2OO4A 3OR1A 5KFLA 1FHTA 1YSJA 1TKZA 4QIWD 5AXMA 3DLBA 1SC3B 4JYAF 2EPIA 4NXNF 2XMVA 1WHWA 4O23A 2DGWA 1FFGB 2ZBIA 4F2RA 1WOPA 4YB7A 2MSSA 4O0NA 1FDDA 2K1RB 4O3NA 2K2PA 2FTRA 2XM3A 1X9SA 3AA8A 5J2QA 3V6KA 2G0CA 4HYKA 1OQ6A 4TXSA 1RTJB 2DXDA 5MAOA 4ECSA 4O4GB 3T9ZA 3CCSS 2Z2LA 1RT2A 2WK4A 5KG4A 4ECZA 2X51A 4PQUB 3C14B 2G13A 2V34A 1TUGB 3CDUA 1QJHA 5D3GB 3DGPB 1M90T 2VC0A 2CQGA 4F4XA 2VONA 2NUHA 3UQSA 4PKDB 2PD1A 3HKZD 3CCWA 4DL4A 1M0SA 3F44A 3J80Y 2DNNA 2XS7A 1RAGB 1RYRA 4DPWA 6FD1A 2AT1B 1RISA 2BJEA 1AUDA 2P6SA 2BRKA 3HD2A 5KFGA 2IJNA 4V19X 2ACYA 3KLFA 4FKYA 2D9PA 4F67A 2OHDA 2CZVC 4CH1A 2H4YB 4QWEA 3GZ7A 3MMCA 4M5LA 1U4BA 1FE0A 4J5OA 2RNEA 3JXOA 1HARA 1FEEA 1XBWA 1JLAB 3C6UB 1IJEB 3SQGA 1SXLA 4I56A 1LWCB 1KD1T 5HBMB 2XMMA 4NMLA 4N77A 3NKYA 3VAKA 2EFPA 2XULA 3E3XA 3M2RB 3K5LA 2HQCA 2EK1A 3G9CA 3O44A 2VKRA 2I5JA 4J9SA 2VQFF 3ZC4A 1WI6A 2BE2A 4ANCA 2D74B 5EHHA 3SCKE 4WPAA 3HVTA 1Q16B 2DHXA 1HD0A 3JSMA 3W9HA 4HDGA 3MEDA 4QYRA 1DTTA 4DV3J 4I2QB 2W9CB 3IO1A 3OTOJ 4WFNQ 1NEEA 2K7KA 4Q0BA 1S72S 2IBKA 2OEMA 2RU3A 1KQFB 1FDAA 3LGNA 3MPUB 4X4PA 4JI8F 3QLHB 3KLEB 4B9TA 4X64J 3ETOA 1X0PA 3GFHA 2HFUA 1M5OC 3WDOA 4CP5A 3VAGA 3DI6B 4DUZF 1M5VC 1Y5NB 3UNGC 1LK7A 3D1HA 4MFBA 3CJSA 1HR0J 2HNZB 3M4XA 4FF1A 5DQGA 2AGOA 2YWKA 2H9ZA 2RSQA 2VPWB 2F5GA 2F3JA 4FVMA 3PACA 3TJ8A 4K4SA 3LGMA 5K8NA 2ZKTA 3HVWA 1FTCA 3MOJB 1K44A 1D8YA 2ZEJA 2EWHA 2NPIA 2ZHOA 2DGSA 3TA0A 2UU9F 1HWUA 3ENQA 1VFJA 2OTLS 4TLQA 4Z7YA 2NXCA 1B99A 3A4TA 1REVB 1AZSA 3DGVA 1GEHA 2VA2A 2ZDPA 1HW9A 3QGGA 2W8LA 3DOMA 4ZPDA 2GZOA 3HHEA 1R6YA 4DCPB 3SV4A 1J5EJ 3TEHB 3IM8A 3IA0A 4NYZA 2CPXA 4CCHA 2BYCA 2J76E 1QDUB 4KKOA 2MXYA 1S77D 4IDKB 1VI7A 2DH9A 4AUKA 2IA0A 4A46A 1T9TA 4LF9J 5KFUA 3MAAA 3OR2B 1IBKJ 5F9NA 2C2KB 3M2VB 3EJMA 1WG5A 3PW7A 2A18A 2D69A 1KTQA 5HSPA 1RWWB 3DN9A 1U47A 1WORA 1JLGB 2BABA 5E5NA 5L46A 3HFVA 1SJRA 3CWJA 4URGA 4HI1A 4CH7A 1N5SA 2HGMA 1GXUA 2MQ8A 1ZETA 4MIAA 1FD2A 5CYQB 4OHVA 5CA5A 1PYOB 4ZN1A 1VK8A 3SYZA 4C8OA 2JH3A 1R8HA 3PRVA 4OHWA 1UPPA 3MXHP 4LF1A 4FF2A 4LF6F 3KYLA 5GADU 1WKJA 2LQ5A 4IG3B 4DQQA 2A2DA 4JI5F 3Q22A 3MM9A 3PW2A 1OPZA 2RRNA 3PRBA 4BWMA 2CG8A 8ATCB 3V81B 4WU2A 1YX2A 1V9OA 4B3MF 5B08A 1VQ8S 4DFKA 4DZDA 2AYMA 3MCSA 3T1HF 3SCLE 3W61A 4M5NA 2QA2A 5KFPA 2N7YA 1Z1ZA 3BO3A 1KEKA 2EBEA 2ZBPA 5EWEA 1UKUA 1VQPS 3T5JA 2XI2A 1RYSA 3RR8A 2KYXA 4RU9A 5ETVA 2YNHB 5B0DA 3H25A 1SKSA 4ETXA 3U27A 2LDIA 4CZCA 1SJQA 4LSLB 2AYBA 1HHQA 2I2YA 3IM9A 3UWTA 2SXLA 4UUWA 3BV8A 3ZTQA 2ZC4A 5C25B 3KHHA 4ED4A 2UUCJ 2VQEJ 3CO0P 2E9TA 1GH8A 4MYUA 4NZ7A 3H20A 5GVQA 1UFWA 3HHLA 1J5EF 3W9JA 1S5ZA 2VG7A 3AA9A 3MM8A 2DD8S 5A8KA 4KHMA 3SEOA 3W8PA 2KI2A 3TJAA 4DS5A 4HTIA 3MFIA 2FUG9 2AJ1A 3K0JA 2GFFA 3ZZ0A 1Q0NA 2Y8WA 5H9FJ 4DV5J 1WC6A 1WEYA 1JLBB 1JX4A 4X4SA 4O3RA 4WTYA 2GHWA 1XIQA 1X5PA 3I6PA 1XQIA 3M32B 1NJWA 2Q1LA 3CDEA 2PO4A 4FF4A 2QG9B 2QA4G 2OKQA 3R7NB 1HQEA 5AXLA 5IZHA 1UVMA 2D9OA 3FFIA 1RT7B 4R5PB 4ZPCA 3T9NA 3DOKA 5J1NA 2WBMA 1VHIA 1FDBA 4F3MA 1HWIA 4KT0C 2V68A 4C2MA 4DQIA 4NXMJ 3ILJA 2NSBA 2KL8A 4J9VA 1NK4A 1CJKB 5KT4A 4PQAA 2J7KA 3F41A 1R8AA 3C3LA 1PAUB 4KC5A 3I4PA 4AL5A 1S0NA 3P45B 1NKCA 2CQ1A 1HW8A 2RAQA 1MWQA 1C1BB 2Z2ZA 2RE1A 4QIFA 4QBUA 2CQDA 1AB8A 3OL8A 5JVHQ 3H4DA 4YB5A 3JYTB 3N5BA 2OMLA 5D4OA 4B9NA 1OPIA 3AOCA 1T02A 4AFFA 2GCFA 3M8QA 4M5HA 2FJEB 3RW7A 4DV1J 1H0HB 3FMWA 2LXUA 3BKFA 3BN4A 5A2QY 4LR8A 2QLWA 1RTDA 2IDLA 4R0EA 3L09A 3N79A 1G1XA 1F3FA 1WEXA 1S99A 1FNXH 2JSXA 1RHKB 2F7VA 2J6TA 2B43A 4CM2A 1UW4A 1YJRA 5T14A 2DR6A 4HT7A 2XO6A 4WXWA 4LF4J 1DQ8A 1NHKL 2HHVA 3QJJA 2MGZB 1GAOA 3BH6B 4J7CA 2VA3A 3ENAA 2W2MP 3Q89A 3PKYA 4U67Q 5A76A 3RR7A 2X3GA 5B09A 4U7UK 3ET6B 3MEGA 1GK8A 4O4GA 4TNOA 3EM1A 3C14A 2HNDA 4HHHA 3S01A 4DV7J 5D3GA 2VFRA 3DGPA 4N41A 3D0HE 1CS4A 2GS8A 3PDNA 3MUVP 1U1NA 3QT7A 4C4WA 2DNQA 4CM0A 1FA0A 3G8TA 2QEXS 1AFIA 2EEYA 1KOHA 4W98A 1RWOB 5EWGA 1Z4UA 3LGHA 2GVZA 3KG4A 3NS5A 4CO4A 4A8SA 4L3KA 4ED5A 2RMLA 3KFWX 5C24A 2CRLA 4M5DA 3D2WA 1MU2A 3C2PA 1FNMA 3CJ8A 1JLAA 2JC0A 1HD1A 3C6UA 3JB9k 3UVJA 1RAHB 3FCHA 1HBNB 4DV4J 1SV5B 2ABYA 1LWCA 5HBMA 2I0XA 2K3KA 4CH0S 1GFWB 2YX1A 3SMZA 2AD9A 4KV8B 1MMNA 3TYTA 4C7QA 3CCES 3CMQA 1RU1A 3BZQA 1L5UA 3TI0A 1T8EA 1XJWB 3OJSA 1HBOB 4UOCA 3IAM9 4LIRA 1B7YB 3R7SB 3TQ1A 4CLYA 2HFVA 4ECRA 1NNDA 2LKZA 2R2UA 1KHWA 2CJBA 4I2QA 4N7TA 2MYFA 3QIPB 1YRTA 2FJWA 5BR8J 3EVOA 3QSYB 5J2MB 4W4MA 2DNOA 4WFAQ 3QZ7A 3P49B 1RLDA 2CVEA 2AYEA 3AB2B 4LSNB 3QWPA 2HZCA 4Y2IA 1TFWA 1XEZA 1LWFB 3M6VA 2YX4A 4ZVSB 1LW2B 3PRDA 3MPWA 4QYZJ 2J9EA 3BQ1A 1VRTB 3NWRA 2ZKUA 1WSRA 1OYDA 4EBDA 3I5AA 4EGLA 1T9XA 4RW9B 1KHVA 1YVFA 4JI6F 1KS2A 2W2PP 3W7BA 2ZBCA 4FYWB 2LLZA 4ECVA 1NLKL 4WIIA 1XNRJ 1RTZA 2POKA 1Q1KA 1U25A 2F8EX 2L48A 3N0VA 2IYIA 4RU2A 4LRDA 1M5HA 5L38A 4X4VA 2CA9A 4CYUB 4OZ2A 3VHQA 5C5JA 5DDPC 1R0CB 2IHR1 1IVZA 4IO1A 1HHSA 3NGDA 1D9FA 2W9BB 4FNIA 5GAEI 1WUUA 2P6TA 2YTCA 3IR5B 4DWIA 1RLCL 5AT1B 1TMMA 2ILZA 1N5YB 1VJQA 3G96A 1B7FA 3G8SA 3ITHB 1RT3A 4KY3A 1SKUB 4PG6A 5DS7A 1U49A 2ZVSA 1UVIA 2FD2A 2N7CA 4PYDA 5IS2A 4M94A 2BDPA 2ROPA 2RQKA 1YG0A 9RUBA 2BW7A 2I1RA 1T3OA 5LL6d 2DTJA 3ENWA 5DG7A 4OV1A 4V1Ak 1KP6A 3BB5A 3UPFA 3R1LA 1XK8A 3QWUA 1RAEB 4QR0A 1S1TB 3R6GB 3SDEB 1UAWA 3ZZPA 5FJ4A 2MQQA 4C8NA 1DZ5A 2MKIA 1JLFA 2KXNB 2NYIA 3B54A 3DOLA 2XYGB 4RWWA 4OI1A 4RUBA 3VVTA 1R6VA 2QZ8A 4M5MA 3I32A 2DHGA 2XHCA 3KJFB 3BBFA 4KBIA 1WF1A 4N56A 5GAGU 2KDOA 3TZXA 1PO6A 3UCGA 3MTKA 4CO2A 4KAIA 3I0RB 5CYQA 1RTHB 4A8XA 4K4ZA 1Q81T 4ZS6A 2IAJA 3IR7B 5F8GA 4HVZA 2V9KA 1WNEA 3GV8B 2RIJA 3PJXA 3IXQA 3U02A 1J5OB 4K0KF 4JV0A 1S1VA 2A6MA 3TNVA 1BY9A 2RF2B 3G2XA 5IM0B 4WKRA 4F4WA 5BYSA 2CQPA 2J6UA 2W4PA 1O51A 4FYDA 4F0HA 5DRKA 1HNWJ 2M3DA 1S1XA 1HNZJ 3Q0AA 1Q95G 2V8PA 2QC3A 4MKBA 1DURA 4OYIA 3DLJA 3KLGB 2E9RX 1RAOA 3LTOA 3JTOA 1RTIB 5HJYA 2F4VJ 2XLJA 4JI4J 2CDQA 5D15A 3L95X 3TAQA 1FJ7A 4J9QA 3J7Z5 2V50A 2MJNA 3HFKA 3R6LB 1T9YA 3S6EA 1PJ5A 3JAMY 4HHJA 1R43A 2CNKB 4DX7A 4FP9A 2KT5A 3VAJA 1TKDA 4M1KA 2NZ4A 3LA0A 4R25A 2AZ3A 5KFVA 2L9WA 4LSLA 5HMWA 4F4KA 1IKXB 2C2RA 5LMNJ 2VDHA 4OI6A 2NXNA 3AHPA 3RJMB 3CC7S 4LF7J 2N3LA 3RZAA 5ETTA 3I56S 4ZVFA 2KTQA 2BJDA 5C25A 5DDRC 3FBBA 4N76A 3K5PA 1SCJB 4G65A 2HFOA 3IP0A 2ZM6J 2BQRA 2MHEA 1OQ3A 3CTRA 2R3VA 1PIEA 4IOAQ 2OIHA 4X4NA 3EPGA 1PCAA 1DLOA 2ZD1A 5KFOA 4OYWA 2GMLA 3M8WA 3CCVS 3I87A 3EUNA 1BMQB 3OTCA 2H3EB 3CJ5A 2HLTA 1S4FA 4P72A 4PYAA 1VQYA 4OJ1A 5D4LA 4LRCA 5L1JA 1PGZA 2XY6A 5A6PA 3GR1A 2WSFC 1JLBA 1TL4A 1PKUA 1UW9A 3K58A 1S6PB 1N6QB 3J7YU 4ED0A 3ZZTA 2CQIA 1EB0A 4KSEB 3EGZA 3D66A 4LJMA 1HNVB 2QN6B 3BPDA 4YP3A 1NJIT 4F36A 4DR4F 1UJ5A 2C3YA 4FDFA 2YH1A 2VJVA 1RJJA 4DV6J 3CNQP 2Z2MA 4IFYB 2RUSA 3QBCA 1N4LA 3D54A 1A7GE 4GKKJ 1CJKA 4BC7A 4JBCA 2YKMB 3RRHA 2C28A 2Q6BA 4C0BA 5EGYA 3MM7A 2F65A 1WG1A 1LFWA 4DMZA 4AXIA 4RUAA 2B56A 3T3FA 2V4RA 4RNMA 1KFSA 3PHEA 3DRPB 5I3UA 2HWTA 1TK0A 5KFHA 4C3LA 4OYAA 3E01A 4RL1A 2M5YA 5KT2A 3B4DA 3PNIA 1JLCA 2F8HA 2M70A 1X4HA 1R89A 3WX8A 1NO8A 4B9UA 4DQSA 2R7RA 2DISA 5KT3A 3C6TA 4QIGA 2V67A 1S9GA 4LT6A 2F4VF 4FXWA 1GT8A 1YJWS 3CD7A 2ROEA 3RYLA 2PN6A 2RUGA 2ZH8A 3VAFA 2IIHA 3UE2A 3TX8A 1YGYA 1N5QA 2K8GA 2GGPB 5L9NA 3GJQB 4I67A 3M8YA 3ZNJ1 1F9FA 3CCTA 4J90A 2DR7A 1SH3A 2MQOA 1IBCB 2HIQA 2HGNA 2A1BA 2VG6A 4Q8EA 4QOTA 4A8OA 3CD6S 2MGZA 3JSRA 4C11A 4UOGA 4USUA 4ZCIA 4IH6A 4O0IA 4NI2B 4DV0F 2CKWA 4EEYA 3KTQA 2LDYA 3CJTA 4DUYF 2XMJA 4E2FB 4DN9A 2YWGA 4FBUA 5M2PA 3T5KA 5F8JA 2RS8A 2RD5C 5DZ7A 3RAMA 2QL7B 4PXDA 2UXDJ 1F5BA 3GCWP 3IG1B 3W1YC 4N8OA 2HNYB 3TX0A 3THVA 2VICA 3UDEA 1MWYA 1HNXJ 3I55S 3O2IA 2QYCA 1SKRA 2J9DA 4FXVA 3MCMA 1MN7A 1HYSB 2R7QA 3E8OA 2ZH4A 2AIRB 2MDAA 4ZVQB 4X2BA 3FGVA 4B3SJ 2DKOB 3OPKA 3RAXA 3T6JA 7AT1B 3TUPA 2BM1A 3J7AN 2FJBB 2H5IB 2LFVA 3MECB 2UP1A 1RT6A 5IXUA 4A48A 4YHHJ 2G2ZA 4ZP8A 4FPIA 2KVIA 4FBTA 3NBPB 3WC2A 3H7HB 3HI9A 4FF3A 4WZQA 2QX0A 1HBNA 4ZJOA 1SV5A 3ZZRA 3CJ0A 4WU3A 1UMJA 2EC2A 3QO9B 3J80U 3U7JA 5CD4A 4YUDA 4ZDNA 3WIVA 1YBUA 3M8RA 4KV8A 4CO3A 3LAMA 4DL3A 3V6HA 1S0MA 5T7LB 4BBYA 2LQ8A 2MLYA 1TU0B 3D4JA 2VFTA 1NPKA 2CQ3A 3I0SB 3VGVA 4OZLA 2C3UA 2GV1A 4UUXA 2QTWA 1NXIA 2IFXA 2HQFA 1IBLJ 2V8GA 3R5AA 1MROB 2YNGA 2IMWP 3QIPA 4PWDA 2BOPA 4X65J 3MMBA 5D4NA 2OSQA 1XR6A 3DKDA 4LFBJ 3T5LA 5SUHA 1NSAA 5GMDA 4BDPA 7FD1A 2R2TA 4K4XA 1FWLA 4LSNA 2ZJQQ 2DNYA 4LFCF 1WF0A 3GYGA 3H40A 4YMEA 1LW2A 3MD3A 4QR1A 2BJ3A 2WONB 3V2UC 4DL2A 2GO8A 4H4OA 4F26A 1K73T 2K3IA 4G6VB 3QRRA 2WRMA 2V6AA 3PW4A 2RILA 2B8QA 1Y3KA 5D8HB 3GIKA 5IQ6A 2LXFA 1VQ5S 1HBUB 2YWEA 2ZJPQ 4D3HA 3CJKA 4NCBA 4C0HA 4NCGB 2CWKA 2YQ1A 1IKYB 1N0VC 1D3WA 2EW9A 4KH1B 3FEZA 1WOOA 3T41A 2XBPA 1T0TV 5GADI 2UUBJ 2HZAA 2W9BA 2F8MA 3A8EA 1SIZA 4CRJA 3OD2A 3HP6A 2IVFB 2GJIA 3IWLA 2EC0A 1HQUB 4C48A 1V5VA 4DX5A 5E3PA 1VCTA 3SCJE 3ITHA 1TMJA 3J7A1 1HWLA 3HHKA 4QYZK 3THPA 3KNGA 3L7UA 4UQTA 3VAHA 3MR3A 1K0VA 5KFNA 1D0EA 2C3OA 4Z2XA 3OXFA 4F04B 1U24A 5KT6A 3HSGA 3QGHA 3C16A 1XN9A 3UDLA 2KU7A 5K8MA 4L74A 4YDXA 3MR7A 1CC7A 5L1IA 1S1TA 2UV8A 3MAHA 1VR6A 2G0IA 3H0PA 2LU2A 4LQ3A 4TU8A 9ATCB 2APOA 2YNFB 3FRYA 4P7VA 3QPIA 5DLGA 2GVDB 4ZVPB 2DH7A 2ZFHA 1FWPA 1SKWA 2X1GA 4PPZA 3WQPA 1YJ9S 1FTRA 3CE8A 1OSCA 3TW0A 4E98A 3KHRA 4HLBA 2PI5A 1K1QA 2L9DA 1NK6A 4LFAJ 5CABA 2IC3A 1OY9A 4PRFA 3OUYA 4M8LA 2B9XA 5DLFA 3GJRB 3IWNC 3I0RA 2P9CA 3ZTRA 3TRGA 4ZLPA 4B02A 2BANB 1RTHA 4DJBA 1EARA 4J9OA 2RDIA 1Q7LB 1OY6A 4U95A 1HMVB 4PZVA 3BSCA 1LEOA 3CJQA 4LFBF 4J91A 2CQCA 2DHHA 1T05B 4DR6J 3MPYA 3OFEA 2Z0GA 1FEHA 3KUHA 4YR2A 3DM2A 3WX4A 5I4MA 2J9CA 1NK8A 2JX2A 3FEXB 1TL1B 2UVUA 2RRBA 2ASDA 3N28A 2Q43A 1HPZA 5J2PA 3OR1B 5CHCB 1YJTA 2QLBB 2MZJA 2HHSA 4KGMA 2LA4A 3RTVA 2W24A 3BN7A 2IM0A 5B0EA 3UD4P 3R2CJ 1NKEA 1HI0P 2VV5A 1Q8BA 1NKBA 2BX6A 4TN2A 1EETA 1QLNA 2RHSB 1VC6A 5IWAJ 1GTHA 1IJFB 2DHAA 4UOHA 4U9RA 4LF5F 4WTOB 1Q5VA 3GU0A 3H2LA 3MEKA 1RT2B 1HHTP 1KC8T 5L1LA 1NAQA 2OPSA 3HX9A 2CQ4A 5K9FA 3TA2A 3RB0A 4KYZA 2MQNA 3O6QA 4H4KC 5M2RA 4B9SA 4DSLA 2JHEA 3CDBA 3W62A 2QMWA 1YJUA 1XERA 2IM2A 3D3CJ 3KHLA 3R2DJ 2V94A 1RBOB 1S9EA 3EGWB 3G87A 2MQPA 4ER8A 5J1PA 3P4UB 3W5ZA 1RWKB 1H98A 5D0EA 3CD0A 4CTAA 1ITPA 2DNMA 5IV4A 3M2UA 3KLFB 4MJKA 2DO4A 4CLPA 1PBUA 1FJCA 3W63A 3P96A 2VASA 3J81Y 4PWUA 2VPZB 2WW4A 4RNHA 3OFGA 2Y8YA 2HAIA 3ZZZA 2QV6A 1U09A 3SQGB 5A8RA 3L7PA 3SFGA 2IJFA 5HJXA 5F3ZA 2FQQB 1RHJB 4DR1J 2DITA 2KRRA 2HZVA 1N6QA 3N9UC 2A6OA 4KB7A 5KFYA 2I5JB 5E3CA 4X66J 2QFIA 2BE2B 1HNVA 3QFWA 1G2EA 3KJNB 5RUBA 2AHOB 3MHYA 3VR1A 3HVTB 3B4MA 4EBCA 2N3OA 2WBRA 1JXVA 4DG1B 3JSMB 2BKNA 2RS2A 4EYIB 1WTFA 2Z2YB 2B8PA 2R7SA 1S59A 4DV2F 4ZPVR 1P9YA 5K8PA 4IFYA 1C0TA 4EK2A 4LF8F 3AT1B 3AODA 2Q79A 5E3AA 4YY3J 1FJGF 3DU5A 2GJ2A 4CQ1A 3A3OB 1WI8A 2AV5A 2CFXA 5HLFB 3JQMA 4EWTA 5IC6B 4B08A 1WDDA 3IMQJ 4XIUA 4JI0F 1WOSA 1MLAA 2MPUA 2FJVA 1IQZA 1SQGA 2CQ2A 2UXBF 3GG0A 2C2MB 2NREA 4MFBB 4QWDA 5KG5A 2UXCF 5CQGA 3H2VE 1ZM9A 1KN6A 4KHPJ 4PG8A 4AD6A 3BBBA 1FRHA 2V9WA 3VAMA 1VS3A 2M52A 1TK8A 3VGTA 4HEA9 5F8MA 3AFGA 3IBFB 3OHAA 1PC4A 4UT4A 2L41A 4KE5A 2OFGX 4DN0A 1BLUA 2KFYA 3NGKA 4IG0B 1H7XA 5KFBA 4R8UA 2QL9B 3DLGB 2V0NA 4NCAA 3OVAA 4UZCA 1WG4A 2OGUA 3AQOA 3Q2TC 2HHHJ 2D1CA 2Y3YA 4XPEA 1AZSB 3UO0A 2CPHA 3R5DA 5IC4B 3TAPA 2M9KA 2GMJA 3VQSA 3OBIA 2G2OA 4TQSA 4KQZA 2F1FA 4F02A 2VUGA 5A2QU 2M2BA 2VOPA 3HSJA 3RBDA 3Q83A 4DPUA 1ZTTA 2DY9A 5K14B 1V5IB 4CI0B 4H54A 3BGRB 1TUVA 4I6AA 2HNYA 2QFJA 1XMOF 3MR5A 4OYZA 3Q86A 3LALA 3GIRA 1FF2A 4IOBA 1JKHA 3VALA 2VBYA 2EFOA 4QIVA 2H1YA 1IKWA 3HKWA 3K89A 4C0OC 4Q43A 1SVDA 3PZPA 4DCOB 2V63A 4F0KA 1N33J 1Z2ZA 2W2NP 2JNJA 5M2UA 1ZTWA 1CJTA 4LVNP 4MH8A 1UWBA 2G1DA 3NOCA 4OZ3A 2KZMA 5IT9Y 2MKHA 3CDAA 4P2SA 4K2XA 1CJUB 5AJ3J 1UWAA 2BBEA 5IT4A 5G0RA 3RUBL 3RAQA 3T6BA 2J0WA 3ZO7A 5KOWA 2IA6A 3GPAA 1URNA 2JEGA 1Y10A 2R8JA 1X5SA 3R5CA 2BKPA 4A8FA 2E1PA 4RNFA 3PYFA 5T7LA 4UTGA 3EVWA 4HHUA 2P9EA 4ILLA 3K17A 5GAEU 1CULB 2AKWB 3I0SA 4RBTA 1HKAA 3LP0A 2AU0A 1HFEL 3NGUA 4PAAA 1GTEA 4IQMA 2PI4A 4M5JA 2XYPB 3NCPA 3R5JB 3MOZA 4TY8B 4B3OA 5HP1A 2ERRA 1MROA 3C46A 4UY85 5BXIA 2UUAJ 4ED2A 2D7SA 2GX8A 1HI1A 2XS2A 4NRUA 5T41A 3PTWA 2FZGB 3NS6A 4RWXA 4WE1B 2DNGA 3NGSA 4KGZB 3V6DA 1VQ9S 3FDSA 1WWHA 1C4CA 4NOHA 2ZNYA 1EQMA 1UEVA 3BSAA 4OYOA 4EFAC 1K8AT 1QAXA 4NLYA 2YPYA 2AEFA 1NHVA 4DPYA 2P9GA 4FXDA 5HROA 4JI7F 3N6NA 2H4WB 1HNIA 3FSYA 3FK4A 3CB4A 1WC1A 2B7CB 4O44A 2KB2A 5B0GA 1U1PA 1UVJA 3U1NA 4OX9J 3SSSA 3FC9A 3D0GE 1S1WA 2V69A 1RHRB 1W25A 1C4AA 5A6WA 1VK3A 4XTTA 1S97A 4I2PB 4DU7A 3HHLB 5KT7A 2CPJA 2QE5A 3PIPQ 2YWHA 4OX8A 4TYBA 3US5A 2ADBA 2XI3A 5A8KB 3MAQA 3Q8UA 2ZH7A 1U26A 5CAAA 3FNNA 2B5JA 3G4SS 2OPRA 2JLEA 4NE9C 4MIBA 1YZ7A 3GJSB 4NLRA 2D3UA 1TAQA 2R2RA 1GMUA 3CCLS 3QQCD 3QT8A 3C66A 3W9IA 2XB2D 5THWA 3TP2A 2P2CB 2IJRA 2RVJA 3VTIA 2MZ1A 2AGQA 2W4DA 1ULRA 4K5SA 1FT8A 2CNLB 3MR2A 1HQEB 2NLWA 1EZZB 1RAJA 3P6YC 3TVYA 1VOMA 4AQYJ 5AJ3F 3DRRA 1F2GA 4NA3A 4OJHA 3VAIA 3OXLA 4NA1A 3GV5B 3M9OB 2BV3A 3HFZB 1U6BA 2YNFA 3NRBA 4F8RA 3M7VA 1VBZA 3TVKA 4WP9A 4JV1A 4F4AA 4ZCKA 4F4YA 4WXOA 3ISZA 4F0MA 4LBHA 2R4FA 1TKTA 2V2KA 3BPSP 4IRCA 2ILYA 3ILLA 1NDLA 4JI2F 4C8KA 4CLLA 4USVA 2DNKA 3LWLA 3SV3A 3LAKA 5KFTA 3BH7B 3VWSA 1IR1A 1WJ9A 2N82B 2RU9A 2E7WA 4DSIA 2XNRA 1NK9A 3M9MB 1PJ6A 4CLKA 3M8QB 2UV8G 1JXEA 2IVYA 1IM6A 2UZAA 3L9ZA 3CCRS 2V2VA 4HACA 4IFVA 4L3NA 1NJXA 2QLJB 1WKKA 1G4CA 4ZA1A 4CLTA 1H38A 3J7YI 5DG9A 3SZ2A 4WYWA 1N34F 1GMWA 2HWHA 1I5OB 1N36J 2Z56B 3IC1A 4B3TJ 3GSDA 3CJ4A 2HLUA 2MZRA 2ZOFA 3GB0A 2LP4A 4PABA 2A0FB 3NOGA 2FHJD 1NMEB 4M5KA 2XCPA 2C3PA 1UA1A 4JV2A 2KG0A 2XQCA 4PG5A 4USKA 4OX9F 3MEGB 1CEZA 2QMXA 5HANA 1JLQA 2PMHA 4MAKA 4AE5A 1SC1B 2DYAA 5E0OA 1ZAVA 2NCKL 1XNQF 2HNDB 1ICEB 5KG7A 3SQOP 4NEZA 2WVCA 1RWUA 3G82A 1JJCB 4L76A 3CO9A 4ZPWR 2C42A 1CS4B 3VZHA 1YTYA 4NX9A 4DSJA 2W1BA 1N32J 3PFEA 3TUIC 2WB4A 1PILA 3KUEA 5DDQC 2J7WA 2ZH9A 5LSOA 5AE2A 2GVZB 3UCZP 1UP1A 2LEBA 4RW4A 1PAEX 3HULA 3HF5A 1Y3JA 5KFJA 1NB7A 5C24B 1R8CA 2BJ7A 4TU7A 4M5DB 4JUZA 4YR0A 1MU2B 2LECA 1X9WA 1V3ZA 1UPMB 4NLPA 3JAMU 2VG5A 4ZMMA 4QW8A 2YWWA 4ZVUB 3Q8VA 3UVJB 1RKIA 4HH0A 1AYEA 2B3TB 1XR5A 1RAFB 3D3BJ 3FZ2A 3GTYX 3Q8RB 3LQVA 1WC4A 1RI7A 4RPFA 3AH6A 4HKQA 4IRKA 1FK9B 2Z30B 2EKYA 1B3TA 1NRKA 4Y34A 1FVQA 1JMTA 2CNNB 2VPYB 3DRYA 3TZZA 2O67A 4C6AA 2KN4A 1JQGA 2J5AA 4DG1A 1UZHA 1XMQF 3UD3P 2BXJA 1N5TA 3ADAC 3TANA 2OPPA 1FRLA 4DR5J 1Y00A 3UDVA 2MZSA 2GIQA 3FBEA 1MSWD 1ZZFA 1LOUA 1ZM3A 2DGTA 2FPHX 2XMUA 2OLWA 4LBPA 4WFZA 2DHSA 3GIMA 5LXYA 4A8KA 1OYEA 5D78A 5L8RC 3FQLA 2HS4A 1LWXA 4U96A 1FKAF 1UTAA 1FI4A 1V3RA 5HLFA 1N48A 5HMZA 3A8IA 4DEZA 4K5RA 5AE1A 5ETNA 3OFHA 2GA7A 4NMXA 2WOMA 1VQKS 2AW0A 2E66A 1L3VA 1IQTA 5MLCV 3H5YA 2Z4PA 4KPYA 2HQIA 1WACA 5HQLA 3OLAA 1LKZA 2W2OP 3M6WA 4DR3J 1H2UX 1RT4A 2OTJS 2G9OA 2LU1A 2CPDA 3ISNC 5ETKA 3SFUA 4JI3J 3DRSA 3AAWB 4ES2A 3PCOB 4BLGA 4IG0A 3CSKA 3DLGA 3DU6A 1XC9A 3W5YA 4KGXB 4CLWA 2CPEA 2CPYA 2XTJP 4FS2A 1RT3B 2UUTA 1VQ4S 3I5BA 5KAKA 4R0JA 4RZRA 3K7RA 5KTQA 1VISA 4IH5A 1S0OA 3DHXA 1SBRA 4Y6IA 3F0NA 2HW3A 2W25A 2ZITA 4E8UA 1BWVA 4OYMA 2N4CA 5K14A 3ZTSA 2KM8C 4DLGA 1CC8A 1UEKA 3MR6A 1YRXA 3AOBA 1QD1A 3TARA 1X0FA 3BGRA 3IBCB 3R8YA 3GIIA 1WD6A 3PJ9A 1JIHA 2I9SA 3DCAA 2I38A 3DDKA 5GMKa 2FIUA 1RHMB 2FB0A 3H59A 1D1UA 1U1OA 3SCIE 2XCAA 2LQ9A 3MI7X 3Q24A 2AP6A 2FLOA 4TYAA 4A8YA 2OSRA 1JLFB 2ZH3A 3PVXA 1NZAA 3JTNA 4JV5J 3DOLB 2XO7A 5F8NA 5EDWA 4LQ9A 5KFCA 2VD3A 3G8QA 4C8MA 3HMJG 4MTPA 1S6QA 2CXEA 4DZ6A 5CZVA 1CJUA 5F8LA 1U1RA 4NLWA 2G1HA 4ZPTR 4DXLA 2DPIA 2EVZA 3A3NB 1WSVA 3M30A 4DV3F 2IAJB 2X3DA 3O8WA 3OTOF 3UN2A 3HT3A 3OVBA 3CCJS 1ACMB 1CQNA 2Q66A 2BE9B 2FHJA 2IRUA 2VH7A 3DHWC 3OSNA 3BDPA 1S1VB 3O3LA 2C2NA 1RHQB 5LMUJ 1CULA 1RAIB 4PG7A 3GYXB 1FCAA 3RBEA 4PCQA 1A0OB 2OPQB 1S1XB 4TY8A 4DR7J 4DF8A 2PMZD 4X64F 4DHVA 2W7AA 4CT9A 3FKBA 3VGUA 1TV6A 2DB1A 4K4TA 2NXUA 3NCRA 5L1KA 1HR0F 3BGLA 2R9LA 1NJYA 2W7PA 2GQCA 3TQEA 4DPXA 3BJYA 3CJ2A 5KFEA 4WE1A 4MMOA 3KK3B 1I94J 3BBCA 3T5HA 2L9NA 2E7XA 1SPBP 4RW6A 3SSRA 4NASA 3JS9A 3OQ2A 1IKVB 2BM0A 2KZZA 2FDNA 3TEGA 4ZITA 5F8HA 2D41A 3UR3C 4DFJA 3OTBA 4PR6A 1WTBA 5B0FA 1D8ZA 2HVHA 4JOUA 3W64A 2DIUA 4NLTA 1TTHB 1X4EA 2HG4A 2LVWA 4I2PA 1UFKA 2R7VA 4P6QA 3D6TB 1DLOB 3H5UA 2ZD1B 4DR2J 2JRSA 3MCOA 4FYYB 3R97A 4OI0A 5ETLA 5HVHA 1K9MT 3WC0A 1U0SA 3FSXA 4OQJA 2QSWA 3POTB 1TL5A 2CZ4A 2CJXB 1S57A 4LF9F 3JSYA 1VIOA 2FHMA 4BCAA 4ECQA 1WHYA 2CJAA 1AT1B 1ZM2A 1IBKF 1FD8A 5BJRA 1J2VA 4ZLJA 2DH8A 2BRLA 2A10A 3UN5A 5F0UA 3MM6A 2E1MC 2JZ5A 2DR9A 1U0HA 1O8BA 4MIWA 1JJ4A 3M8SA 1I3OB 4YB6A 5HI7A 4ECXA 2GQQA 4DX6A 5HMYA 4TQRA 2RQ4A 2LXIA 2KJVA 2HS3A 2XMWA 1Q82T 2ASLA 4EUVA 3DLLQ 4OHYA 2QA1A 1RA7A 2R42A 2EKNA 3PJWA 2DRDA 3MM7B 1E6YB 3I9V9 3GILA 5HL7Q 3CMAS 2JFDA 5I3UB 4YOEA 1WF2A 3FEYB 1Y0HA 3AXKA 3E01B 1TVRA 3SI8A 3IR6B 2ZE2A 4KO0A 3UNYA 1JLCB 3ZZOA 2DGXA 3D5MA 5EX3A 5KFSA 2DNZA 3D9BA 4NLUA 2MTLA 1S12A 3C6TB 1S9GB 1D9AA 2IDEA 1TZ0A 1FX4A 2XY5A 2YPZA 1I1GA 2Y1LB 5F0WA 3OL6A 2R7UA 1K47A 3BM7A 1F2HA 5K8OA 1FESA 3KK1A 3P5BP 1RP5A 2VG6B 4Y2AA 4C11B 3GV7B 2CYYA 3MM5B 4F3QA 1NSKL 1C0UA 1NJZA 5KFQA 4M5IA 2KO1A 2UUCF 5ETPA 2VQEF 1JLEA 4USJC 3KWMA 1MMLA 3DLEB 3H90A 1KVIA 1H3DA 1NSQA 1EJ7L 3QT6A 3F56A 3MEEA 2MKYA 2B9WA 4DL7A 3G86A 2GW8A 3LWMA 3M05A 4NPOA 1WC5A 2MLZA 2P5VA 3ISND 1Q8KA 4XPCA 1PBAA 1WHXA 4DFPA 4JYAJ 4DV5F 4NXNJ 3ZTPA 1U6ZA 1AW0A 2CPZA 1ZPWX 4IO9Q 3KMQA 3HDSA 2M7SA 2OEKA 4B3RJ 4DI6A 4GO7X 1U45A 4ES1A 4ZJQA 3EDQB 1RK8A 3CMES 1RT5B 3LP2A 1RT6B 3EE3A 1NB2A 3CVKA 1VIXA 2VPXB 4DL5A 2ALYB 5DDOC 4GKJJ 2YKAA 4MKVA 2PFDA 2KH9A 1SJ4P 4ZVHA 5KFWA 1LWEA 5KT5A 5LXRA 1VC5A 4NXMF 1KTVA 1LV5A 2RB7A 1FK9A 1SL0A 4O4RA 3UI3A 1RSCA 4ZCMA 3P5TL 4BWJA 4P10A 3J81U 5B0AA 5CD4H 4MK9A 2HBZB 2YNGB 2E1CA 3HD1A 4PWDB 3CJRA 3IRWP 3MMBB 1TKXB 2BVZA 1KBRA 2XWYA 4H4MA 2PFFB 4QW9A 1Z2LA 4K4YA 4ED3A 1U2RA 1I51B 2HFSA 2R7OA 3V4MA 3FQKA 4C98A 2C2DA 4DV1F 3RU0A 1TL7B 1HQ2A 3QRQA 2ZNZA 3QMQA 3L4BC 2YH0A 1S7HA 2RH3A 1CG2A 2JDJA 3I4HX 1X9MA 1KKHA 1AUSL 3WZ0A 2HQGA 2PC6A 3DXSX 4H4OB 1YKWA 1R0AB 1KDNA 5GAHU 5B7WA 4MK8A 1E6VA 1NZ8A 3AJ1A 1OMSA 4FS1A 4A4JA 4OL8A 3MMAA 2CAJA 2PA3A 2V8DA 1FKPA 1QUPA 4LF4F 3NMAA 3TZYA 1RU2A 1D09B 1FWKA 3ICLA 3H2UB 1LXJA 3CJKB 1RABB 4FYVB 5JJBA 2ZH1A 2M0GB 3D6MB 4QCLA 3A13A 1ZOTA 3BO2A 3T1AA 4DV7F 4CNYA 2MY7A 1DY3A 4QQBA 2K7JA 4P2MA 3CJ3A 3SIPB 2MQMA 3GSIA 5EX0A 2FHOB 4A47A 4ALZA 4DUZJ 3ZZYA 5A0YA 1W26A 3W8GA 1MW7A 4S0MA 3G6XA 1FFWB 1HBMB 2PMWA 2FJXA 3C16B 2C2ZB 1U6FA 4HL9A 4B3RF 3MUTP 3NL0A 3A3PB 4I7FB 1WC3A 2FC8A 1ZA2B 1JK9B 5BYRA 5HN0A 5KFZA 4GO5X 4GKJF 2U1AA 3W3SA 4DV4F 1RWVB 4RNNA 2EK6A 3M1VA 2UU9J 1O6XA 5I42B 1X4BA 4HT5A 2DPJA 3O5TB 4C97A 1CJVB 3K5OA 3GYNA 2IC3B 2ALZA 1F60B 3OUYB 2CG4A 4DF4A 2HK3A 2OD4A 1QSYA 1N56A 3UW1A 1S6UA 2VDIA 4GRSA 3W66A 1WEZA 5HQ8A 2A3JA 2PSZA 1J27A 5BR8F 2N4DA 3PM9A 1N8RT 1H2TZ 1HA1A 4G1QA 1CPZA 4CT8A 4FN5A 3DM2B 1OS5A 4Z37A 4ZVGA 3HVRA 3R9LA 2IY5B 3EYZA 1EHWA 3CCUS 1HPZB 4PUOA 1U7LA 5J2PB 3BSOA 5IT9U 2F63A 2OPQA 2WTFA 3OW2R 4KFBA 1RKJA 3HHLD 4O3PA 5DJBA 6AT1B 1UL3A 3AJ2A 4KGVB 3MZIA 3EZOA 2HFZA 3BR9A 3FJ2A 2RHQB 5FIIA 1VGYA 3VF0B 2QL5B 4USIA 1XNRF 1EETB 4M95A 2WVFA 1YBTA 3HPOA 3TAMB 3HXMA 1MG7A 4NLXA 3T1YJ 2MSTA 3W2VA 3KNAA 4F25A 3KK3A 2KJWA 1HLWA 3IS9A 4LR9A 3KOAA 2OPSB 1ZYQA 1R7IA 1F9EB 1Q4RA 1RCXB 5KFRA 2AEMA 2HMIA 1IKVA 4G3IA 2GC8A 2E1RA 1AROP 1T9WA 4LF6J 1GX5A 1MN9A 3FBCA 1A6LA 1DFDA 2R8IA 2C2EA 1ZZNA 2WVEA 3FSIA 1S9EB 5DM6Q 4JI5J 4KTQA 2RKIB 3DLKA 4KR0B 3DXBA 2COLA 2DCUB 4FKXA 1TAUA 4CLZA 2DR8A 4CTAB 3EXYA 5JUMA 4B3MJ 3KLHA 3M2UB 1DQ9A 2GIRA 1LXNA 1VDHA 3T1HJ 2E5HA 5ETSA 1CQMA 1HI8A 3PYDA 4JB8B 3HVAA 3EX7B 1CBKA 4P9SA 2V5HG 2Z57B 1ZA1B 1VBXA 2QSFA 2JEJA 5A8RB 3POTA 5KFKA 1RA6A 3DNCA 5EWFA 1KVJA 2FC9A 4DQPA 3MTJA 1KQKA 2B6AB 3MF5A 2R8KA 4KJIA 5GMEA 1IM4A 3KUGA 4P2XA 2O01C 3MWBA 3VCDA 2ZUAA 8AT1B 3BKTA 3QSIA 1QAJA 2IPOB 3PX6A 2GAHC 4F50A 1IUJA 2BKOA 4URQU 2FVQA 1RWXB 1FRJA 1LFPA 2QMUB 3BSNA 3EWGA 4J9KA 3U1LA 4D3GA 1NDCA 3IFEA 2YKNB 2F40A 2NXJA 4C9DA 3VZIA 2RJZA 4M5GA 5KG2A 4CLUA 3HZEA 2QJ3A 4ECWA 3GFXA 2V4QA 2XLIA 2J0QD 2ZVIA 1KRPA 1B70B 1C0TB 4RW8A 1LW0A 3P3DA 4DS4A 1Q5YA 5SZTA 3KDOA 2R7TA 1M5KC 5H9EJ 1T94A 2DK2A 1E6YA 1BQMB 3OFFA 1ZBTA 5CYJA 1K0TA 3I96A 1NPRA 4DPOA 2GNKA 2E44A 4N8NA 2AJ0A 1PG5B 1HNWF 2UVRA 4WZMA 1HNZF 4WBFA 2HAFA 2GIFA 1P1LA 3PV8A 2XLKA 2VFSA 3K8WA 2P8IA 3JQKA 2E29A 5CYMA 2PT0A 4ZVTB 2VHGA 2ACMA 4DSFA 3PW0A 4JI4F 3OXGA 1NK0A 1VRQC 3T1YF 4RBVA 4C8ZA 4ANDA 3AQPA 1JNZB 4UQGA 4J9LA 2NSCA 3CCZA 3HO1A 3M6XA 3HT0A 2RQMA 1VQSA 2HQDA 1RWPB 3S1TA 3G6VA 4R8UB 3V5RA 1FDNA 4AYBD 2EI5A 3LH2S 3CDWA 3Q8QB 3PFOA 1S1UB 2MKSA 2MY8A 4K4VA 3KXDA 2JVOA 3MM5A 5LMNF 3RG6A 3MPVA 1BC6A 1ROFA 1V3SA 4NEYA 2J0XA 2PEBA 4LF7F 1NK7A 2M8DB 3HHNB 1YZ6A 3LANA 4IQXA 1Y9OA 2ZM6F 2DEJA 3HSDA 2OD6A 1RUSA 1HL6A 3OHBA 3CIZA 3DLEA 3HM9A 3KJVA 1FERA 1K1SA 6FDRA 3QAEA 1SJ3P 1PJ7A 3QATA 4OJGA 2VOOA 1MNEA 2DY1A 1JKHB 5FLXY 4OIXA 1BUXA 1SI9A 3DLHA 3PX0A 1L3KA 5E3RA 4CDIA 1IKWB 1SIWB 1X60A 3JTPA 2HBQB 3I31A 4OYBA 4GVBA 1W2IA 1CJTB 3QYYA 3EPIA 3MURP 2MLXA 2KHDA 1UWBB 3R27A 2FVSA 5FDLA 2CUYA 1M1GA 1RT5A 4Y00A 2H5EA 1NPPA 1VC0A 3N01A 1BXNA 1R0BG 5G0RB 4TY9A 1EAYC 1LNQA 2V2ZA 2BACA 1FKOA 3ONQA 1DTQB 2O5DA 4DV6F 4X62J 3AD7C 4ECTA 3GFZA 2G4BA 3D28A 3DRXA 2HHPA 4GKKF 3PYEA 1F5AA 3V4IB 5HVFA 2KFNA 4BHQA 3LP0B 1YI2S 3EXCX 2J0SD 1MWZA 1KQGB 1O0PA 1BWEA 2FVRA 1L3UA 4B3OB 1TUWA 2E5LJ 5JXSA 4EI2A 3LUYA 3N5FA 5HP1B 2MZTA 1KQSR 3UDCA 1TKXA 2XMAA 4HI2A 3OLBA 3PHTA 3P8BB 5G4DA 1QVGR 2MHNA 4NYPA 3TR5A 1XTZA 3BYRA 3BR8A 1TL7A 3NLCA 3V6DB 3NMRA 3UD5A 5J2NA 3HLUA 1QM9A 4IR9A 4AL6A 1U1KA 1R0AA 2YWFA 1BQNB 1RT1B 4OZJA 2ZDOA 2PE8A 3PYGA 5J1EB 3Q23A 4WCEQ 5HROB 4OI2A 5F9LA 2CVIA 1VQMS 5DGBA 3CCMS 1TK5A 1HNIB 3E51A 4WYLA 2D3O1 1F5CA 2E1AA 4O44B 5DO2A 3GMGA 4QWBA 2FZCB 1U2FA 2XGPA 1S1WB 4YEAA 3QJPA 2AQ4A 5CXTA 3LP1A 4WIQA 1SUQB 3MMJA 1D9DA 4NLVA 4ZHRA 4DSKA 1TL3A 1S9FA 1VBKA 2AJ2A 2W8KA 1KLMB 3LO3A 2UXDF 1UCNA 4RNOA 1DAXA 2B5JB 1RE1B 2OPRB 1HNXF 2IVMA 3IRXA 1QE1A 3DYAB 3WIUA 3W5XA 3CC2S 2V8HA 3OVSA 2NPFA 3FCVA 2IMOA 4KPCA 4NA2A 2RRAA 4URSA 4X4OA 4X4UA 4P52A 2R2SA 4JI6J 5KG0A 2X1AA 1VJWA 1HBMA 4B3SF 5KFDA 4F4ZA 2GAGC 4X4QA 2K1RA 3CEDA 3NNAA 4MKYA 2R7WA 4GVLA 4K50A 4OZ0A 1YK9A 4I7FA 4NLSA 4KH0B 4USWA 1RTJA 4YHHF 5C7PA 2R7XA 2MKCA 3DRRB 4PQUA 1Q7YT 3EZ5A 1OWXA 1BGXT 2M88A 3KG0A 1Y5IB 5I42A 1XWLA 1GXLA 5C42B 4X62F 3GONA 2Y1RI 3I5CA 3FZBA 1SJ1A 1X5OA 1TKTB 4ILMA 1CJVA 2YY3A 1C2PA 3HZGA 4QIEA 5HO4A 4RX6A 1WC0A 1U02A 2VU5A 2Y9HA 2QA4S 2JC1A 1DBDA 2KRBA 1FXDA 1IBLF 1JJ2R 2E5LF 4KRWA 4ZKAA 2HQ3A 4X65F 3BS9A 1REGX 2UUWA 4E0DA 3NNHA 2J6SA 1S48A 4HACB 4IFVB 4G1PA 4RW7B 4J9UE 4K7QA 1ELOA 2R8HA 4Y3CA 2YBVA 3EGNA 2XC9A 2BOAA 2B0GA 3AD9C 5E41A 2MB0B 3M2RA 4AT1B 3ZXWA 4IR1A 2CJKA 1TP7A 2RQCA 4IYQA 1UVKA 2CADA 4LREA 2HYIB 2ZOGA 2IBOA 3HK2A 2LCWA 4DX8H 2C1EB 3PG9A 2XZWA 3EMTA 1QY7A 1QTMA 3TAMA 1OJ4A 3NWGA 4B9MA 3D0IE 3NNCA 2LEAA 4L75A 1JLQB 5ETRA 2W9CA 5LJ3Y 4I64A 2OUGA 2JOQA 1KOOA 1VRUB 1O5JA 5D4PA 4L6V3 4K4UA 2ZBQA 4ZPAA 3G82B 3KMSA 4K0KJ 2XYHB 2UUBF 4WJBA 2W4CA 4UZBA 2JEIA 4DL0C 1P6TA 1S10A 3VV2B 4UOFA 2HKEA 2DBBA 4EO6A 3ZTOA 2HEKA 2RKIA 3QLHA 1Q86T 1WHVA 2GHPA 2V2QA 4MYTA 3KLEA 3K59A 5IT0A 1FJEB 2J7UA 2M4MA 3D6FB 4NWBA 4RW4B 3K5NA 1QUVA 1JB0C 1FX2A 2H65B 3GR0A 3DI6A 2DGUA 3KLIB 3GJTB 2NYHA 3NGTA 3A12A 2HNZA 3A1YG 2O3DA 1T9UA 2Y0BB 2K06A 2VG5B 4CIOA 1DJ0A 4YQWA 3BREA 2CJ9A 4FYXB 4DFMA 1NUEA 2MZQA 2B6AA 4ECUA 3BQ2A 4F7VA 3GWCA 1NBEB 2NS1B 4B9VA 2XY7A 3HJVA 4I4BA 1REVA 3TA1A 3R5BA 2MEWA 4MKAA 1UETA 3CW2C 3H5SA 3N4WA 2ZZMA 1OSDA 1FO1A 3MCNA 3GCXP 1FVSA 4RUCA 1T9VA 4LFAF 4XDCA 5AXKA 2YKNA 3S7RA 3DC2A 2X1FA 2OPPB 1FRMA 2H48B 3X1LB 2EG2A 4TKTA 3AB4B 3FUYA 4ELVA 5HAOA 4PWWA 4Y2KA 3MPDA 4PXCA 1RDRA 2NXEA 4IDKA 1H7WA 4J9MA 4ID8A 1YJNS 4F2SA 4GC6A 4DR6F 2YKPA 4QWCA 1BQMA 4ZIWA 3OR2A 1RB0A 3FMBA 3PY8A 3M2VA 1ZAWA 4C3KA 1SH0A 2RT3A 2VKZG 2WOMB 2JL9A 1U48A 1TR0A 1JLGA 1ZPVA 4L73A 4DR4J 1RT4B 3PO5A 4OI4A 2OH2A 3UR0A 1B4SA 2VODA 2HVIA 5IWAF 2W2QP 2XEXA 2RDDA 4TLRA 5HK4A 3QT5A 3NP5A 3DRSB 4ECYA 1X4CA 5I3QA 2WVBA 1UFLA 2IRYA 2Q6CA 3PKMA 3H8YA 2JLFA 4CLSA 1U8WA 1NH7A 1KONA 8RUCA 1S1UA 1XMBA 2L08A 5LJ5Y 4L72B 1RBAA 5H9EK 4IG3A 2AEJA 3VQTA 2HRUA 2PEHA 2VBZA 3KKFA 4J37A 2XZDB 2B4PA 2KVQE 3V81A 5DGAA 3M8ZA 2C3MA 3J81j 2CZ9A 5CZXA 2GMHA 2NQPA 2ZJRQ 4PXBA 5B0BA 1FRIA 4ZOSA 3LPEA 2ZOMA 4OYPA 1Q8IA 4ENOA 3AOAA 4I69A 1F9HA 2E7VA 2AWZA 3TUZC 3KK2B 2CQHA 2LQJA 4NL5A 2ZC3A 5EUHA 1PYTA 2F9DA 5GAHI 5L9XA 4K59A 4Y2CA 4HDHA 2YNIB 3D1QA 4ES3A 2YNHA 4WFYA 1HIYA 2VZ9A 2HVDA 4NZ0A 4ELUA 4DR1F 2FJDB 1X31C 1DHMA 4P75A 5LSRA 4DV0J 4JP8A 4X66F 1QTNB 2ADCA 2PGCA 1RWNB 4DUYJ 4IH7A 1S6QB 3Q8PB 4XDDA 5D0GA 2HRYA 3K2YA 2BW2A 2DRAA 4A8WA 4K8RA 1SQFA 1S0VA 3X3UA 3W2WB 2KT2A 3M30B 1QVFR 3DMJB 1VQ6S 4Q44A 1DRZA 3LOUA 2WHOA 3BEGB 1DTQA 1OIAA 3H42A 5ETQA 1UVLA 5HQMA 3OL9A 1F0XA 2FZKB 1Y11A 4YDDB 4ATNA 4YY3F 3V4IA 1V6HA 2W7OA 2J9DE 1SL2A 1U1MA 2XNQA 2AYGA 4P7TA 2JVRA 3LPYA 5ADZA 1RCOB 3SSQA 4IUFA 4IKAA 3M32A 1C1CB 2KHCA 1YHQS 4BC9A 2HURA 3RB4A 1X4GA 2DXFA 1TV6B 4PXEA 4ED6A 2FY1A 3IGVA 4KHPF 2EFNA 1KSPA 2VL1A 2UVVA 1CLFA 2GJFA 2QRRA 3D67A 2VJUA 3RB3A 1RT7A 1R8BA 3J7ZT 1JXLA 2B4OA 4R5PA 1FNOA 4RW6B 4YS2A 3GIJA 4RKUC 5JVGQ 1NU4A 5LM7E 1DARA 4ID5B 4UF4A 4WK1A 1WELA 1BQNA 4NZ6A 2HHUA 1RT1A 4OZ5A 1B64A 5J1EA 4DLEA 1EP4B 2HGLA 2HBYB 4LRFA 1IR0A 5KFAA 2HHHF 2Y1IA 1RZMA 1C1BA 1JJHA 3QFHA 5H9FK 2DNLA 1WKLA 2V8VA 4N5SA 3H98A 3CT9A 3JYTA 2FYXA 4NLGA 2ZUGA 1SUQA 4X84A 4OYXA 1Y4ZB 2NUUG 2HPUA 3WBZA 5K5MA 3TVZA 1RWMB 2I8EA 1KLMA 4OI3A 2ROGA 4LRAA 1SQEA 4LFCJ 4YN3B 1ZH5A 4EBEA 2JLGA 2DXEA 1Q78A 2X7IA 5D0HA 2DVIA 1FFSB 3PEHA 2WSCC 4RLEA 3DYAA 3ZFVA 3PEJA 1UA0A 2BMBA 2XHWA 1SJFA 2HHQA 3ZZUA 3MM6B 1N33F 3NS7B 1R8PA 4J9RA 4ZJLA 4ICLB 1S49A 1FXRA 1U0HB 1T95A 1M1KT 5KFMA 1H72C
chains in the Genus database with same CATH topology
3MXHP 2JDJA 3I4HX 1X9MA 2XG8A 2VASA 3WZ0A 2PC6A 4FF2A 3DXSX 4LF6F 2LMIA 4H4OB 3KYLA 4C8LA 3NAIA 5GADU 1R0AB 5GAHU 3J81Y 5B7WA 2BA9A 4PWUA 2LQ5A 3L3CA 4MK8A 4IG3B 2B7BB 2VPZB 1E6VA 4RNHA 1VLYA 3OFGA 3AJ1A 4ZK7M 4DQQA 2A2DA 4JI5F 3Q22A 3MM9A 3FVYA 3PW2A 4FS1A 2HAIA 1OPZA 2RRNA 4A4JA 4OL8A 3MMAA 2ZHBA 3ZZZA 2QV6A 2PA3A 3PRBA 4BWMA 2V8DA 1FKPA 4F4WA 1QUPA 1U09A 3SQGB 4LF4F 5A8RA 3V81B 3NMAA 2AJ4A 3L7PA 2WB1D 3SFGA 3ICLA 2IJFA 4WU2A 5C42A 4CO0A 3PW5A 3H2UB 1LXJA 1V9OA 5F3ZA 4B3MF 1TFYA 3CJKB 2E5JA 5B08A 1VQ8S 4KGKA 5JJBA 2ZH1A 4DFKA 2JJ4D 2DITA 2KRRA 7FDRA 5LT5A 1N6QA 2AYMA 3N9UC 2M0GB 3MCSA 3T1HF 3SCLE 4KB7A 5KFYA 2QA2A 5KFPA 2I5JB 2N7YA 5L39A 3GFYA 5E3CA 1Z1ZA 4QCLA 3BO3A 1A9NB 1KEKA 2BE2B 2EBEA 1HNVA 4Q5VA 1ZOTA 1CVJA 1RGVA 1G2EA 1TVRB 1VQ7S 3BO2A 3T1AA 5DQIA 2ZE2B 1UKUA 4KIAA 5EWEA 4DV7F 1VQPS 3MHYA 4CNYA 3VR1A 4KO0B 2MY7A 2DGOA 3T5JA 2XI2A 3HVTB 1RYSA 4CO1A 3B4MA 3RR8A 4QQBA 2KYXA 2N3OA 2WBRA 4RU9A 4EBCA 2YNHB 5CH7B 5B0DA 4DG1B 3THTA 4OX6A 3JSMB 3H25A 2RS2A 1SKSA 2UUAF 2K7JA 4G1IA 4ETXA 3CJ3A 4EYIB 1Q79A 1WTFA 3U27A 4LVOP 2R7SA 2LDIA 2MQMA 4CZCA 1Q8LA 1SJQA 4DV2F 4LSLB 4RW7A 2AYBA 5EX0A 2FHOB 4A47A 4ZPVR 4ALZA 3ZZYA 3K8VA 5A0YA 1URRA 5K8PA 2I2YA 4IFYA 1C0TA 1BD6A 1YBAA 1SC6A 4LF8F 1MW7A 5IQQA 3UWTA 1YITS 2Q79A 5E3AA 3G6XA 2SXLA 4UUWA 3TOQA 2QIFA 2ZC4A 3KHGA 1HBMB 5C25B 2FJXA 1FJGF 3G6YA 2BUNA 2OP5A 1XR7A 3DU5A 3KHHA 2GJ2A 2YKQA 5D77A 2PIIA 4M63A 5KOXA 1U6FA 4HL9A 4CQ1A 4B3RF 1WI8A 2AV5A 2CFXA 3MUTP 3NL0A 4C3MA 2E9TA 4I7FB 5HLFB 1GH8A 3KK1B 4EWTA 4MYUA 2FC8A 4B08A 4NZ7A 1JK9B 2QT7A 3H20A 5GVQA 1UFWA 3HHLA 1W2BR 5BYRA 1J5EF 5HN0A 4XIUA 4Y2MA 4JI0F 2VG7A 3AA9A 2MPUA 2FJVA 1IQZA 2CQ2A 5KFZA 2UXBF 1HBOA 3MM8A 2DD8S 3GG0A 4GO5X 4GKJF 2NREA 3OTEA 5A8KA 2U1AA 4MFBB 4QWDA 5KG5A 2UXCF 3W3SA 2FLLA 3BGUA 5CQGA 4DV4F 4KHMA 4RNNA 3SEOA 2EK6A 2XMTA 2B4UA 2KI2A 3H2VE 1ZM9A 3M1VA 1KN6A 4PG8A 2V9WA 1FRHA 4DS5A 3VAMA 1C0UB 4HTIA 5I42B 1VS3A 1X4BA 4HT5A 4IOCQ 2DPJA 3PIOQ 5KFXA 3MFIA 2FUG9 2AJ1A 3K0JA 2M52A 2XS5A 3O5TB 2GFFA 3ZZ0A 5H9FJ 4C97A 4Y0FA 1WEYA 1JLBB 1MMDA 1TK8A 1VRUA 5J2MA 1JLEB 3BDEA 1JX4A 4X4SA 1B0VA 4WTYA 4QPXA 4O3RA 2GHWA 4HEA9 5F8MA 2AJFE 1X5PA 3OHAA 3I6PA 3O1LA 4RBUA 3K5OA 1PC4A 2L41A 3M32B 3GYNA 1NJWA 2WAQD 3MEEB 2IC3B 2Q1LA 4KE5A 2OFGX 2ALZA 4DN0A 1BLUA 1F60B 3OUYB 2KFYA 4I1TA 2CG4A 3CDEA 3NGKA 2PO4A 4IG0B 1H7XA 4FPRA 4ED7A 5KFBA 1LWFA 2Q3PA 4R8UA 4DF4A 2OD4A 4FF4A 3DLGB 4OLOA 1QSYA 1N56A 2V0NA 4NCAA 2MQLA 2BZ2A 1WG4A 3UW1A 3OVAA 1VQOS 1S6UA 2QA4G 2OKQA 4Q8FA 5A8WB 3AQOA 4ITSA 1WEZA 3Q2TC 1HQEA 5AXLA 5HQ8A 2A3JA 3IBWA 5IZHA 2PSZA 1UVMA 1VRTA 4YFUA 1KLNA 2D1CA 4I6YA 2D9OA 4XPEA 4O3SA 1G3OA 5BR8F 3FFIA 2N4DA 3PM9A 1N8RT 1H2TZ 2CPHA 1HA1A 3R5DA 1RT7B 4RW9A 4R5PB 4G1QA 4ZPCA 3T9NA 4GMKA 4CT8A 3TAPA 1CPZA 2M9KA 2GMJA 3KLIA 1U1LA 1HWJA 3VQSA 3DOKA 5J1NA 2WBMA 3OBIA 1FDBA 4F3MA 1APSA 1HWIA 4FN5A 4KT0C 2KFZA 3DM2B 1OS5A 4Z37A 4C2MA 4TQSA 4DQIA 4KQZA 4ZVGA 2VB6A 2NSBA 3LP2B 3HVRA 2F1FA 1NK4A 5KT4A 4QJVA 4PQAA 5KFFA 4F02A 2VUGA 3LW5C 2J7KA 3EYZA 3CUNA 3CCUS 2M2BA 2VOPA 3F41A 1R8AA 3C3LA 1HPZB 1T03B 4PUOA 1U7LA 5J2PB 3RBDA 3BSOA 1ZTTA 3R3TA 5K14B 4KC5A 2OPQA 3I4PA 2WTFA 3OW2R 2LQBA 2R8GA 4KFBA 1RKJA 4AL5A 1S0NA 4CI0B 1NKCA 2CQ1A 3HHLD 4H54A 3BGRB 1HW8A 4O3PA 5DJBA 1TUVA 4I6AA 1C1BB 1UL3A 2HNYA 4AQYF 1B0PA 3AJ2A 2QFJA 2RE1A 3MZIA 1XMOF 4QIFA 3MR5A 4QBUA 3LALA 2CQDA 3CULA 3OL8A 1FF2A 1LWEB 4IOBA 5JVHQ 1JKHA 3H4DA 3VALA 4WFXA 2HFZA 3BR9A 3FJ2A 2DNPA 2VBYA 1FXLA 5FIIA 1GNKA 1VGYA 3VF0B 4USIA 2EFOA 4YB5A 1N5YA 3JYTB 1G6BA 1EETB 3N5BA 4QIVA 5DETA 4M95A 2OMLA 3HXMA 1XNRF 3HPOA 3TAMB 5D4OA 3B82A 4B9NA 2LA6A 1OPIA 4NLXA 1IKWA 2MSTA 3HKWA 3W2VA 3KNAA 1QAIA 1JWWA 5E7OB 4C0OC 4F25A 3KK3A 1NH8A 1T02A 4Q43A 2DNRA 3M8PB 2KJWA 4AFFA 5D6GA 3PZPA 2GCFA 3IS9A 3M8QA 1Z2ZA 1OO0B 2FJEB 3KOAA 3T19A 3RW7A 1H0HB 3FMWA 5M2UA 2LXUA 1ZTWA 2OPSB 3BN4A 1R7IA 4LVNP 4MH8A 1ZYQA 5EN1A 1UWBA 5A2QY 1Q4RA 2G1DA 1LQ9A 5KFRA 2HHTA 5LSLA 2HMIA 1IKVA 2QLWA 1RTDA 4G3IA 2FGCA 2GC8A 4R0EA 2E1RA 3L09A 1QSLA 2KZMA 3N79A 1TQLA 1G1XA 5IT9Y 2MKHA 4QWAA 1S99A 1AROP 1WEXA 1FNXH 2JSXA 3U1MA 1GX5A 2F7VA 2J6TA 2B43A 3CDAA 4P2SA 3H4BA 4K2XA 1A6LA 1UW4A 1DFDA 2R8IA 4OJ3A 2C2EA 1ZZNA 1X4DA 3FSIA 1S9EB 4V19J 4Q7AA 5DM6Q 1YJRA 5T14A 2BBEA 4HT7A 4KTQA 4H4MB 5IT4A 5G0RA 5DM7Q 4UW2A 3BF4A 2WCXA 2RKIB 3DLKA 3RAQA 4KR0B 3T6BA 2J0WA 2V4JB 3DXBA 3AY0A 4WXWA 2COLA 2ZH5A 2DCUB 3F73A 1TAUA 2UVWA 1DQ8A 5KOWA 2DR8A 4CTAB 2IA6A 1URNA 2HHVA 2JEGA 3QJJA 2MGZB 1GAOA 3EXYA 3SDEA 5JUMA 4ZP9A 2R8JA 3KLHA 2YX7A 1X5SA 4NRTA 3M2UB 3R5CA 4Y65A 1DQ9A 2VA3A 2GIRA 1LXNA 4QU7A 4A8FA 3PKYA 4RNFA 4U67Q 3RR7A 2X3GA 5T7LA 5B09A 1VQNS 4U7UK 5KG3A 2E5HA 3MEGA 4O4GA 4TNOA 2P9EA 2D3ZA 1CQMA 3Q8SB 4ILLA 1HI8A 2XSFA 5GAEU 1E6VB 3I0SA 4LIWA 4RBTA 1L3SA 3HVAA 3LP0A 2E9ZA 2AU0A 4W90B 1HFEL 2HNDA 4FNHA 3EX7B 1N36F 1GTEA 4IQMA 3FRZA 2V5HG 3S01A 2PI4A 4B3TF 3MMAB 1H2VZ 3NCPA 3G6ES 3MOZA 4TY8B 4B3OA 1VBXA 1FKPB 2QSFA 2VFRA 3QZ8A 2JEJA 1X7VA 5D3GA 3DGPA 2BQUA 4N41A 5A8RB 1YWXA 3POTA 3TUJC 5KFKA 5HP1A 1RA6A 3BQ0A 2ERRA 1MROA 3DNCA 5EWFA 3D0HE 3C46A 1KVJA 4UY85 3PDNA 2FC9A 3MUVP 4ED2A 1U1NA 2D7SA 2GX8A 1HI1A 4DQPA 4C4WA 2DNQA 3OL7A 3MTJA 3K57A 2XS2A 4NRUA 3B78A 1KQKA 1FA0A 2B6AB 3MF5A 3G8TA 2DR5A 2QEXS 2R8KA 4KJIA 1AFIA 2XSJB 1UJ4A 1IM4A 1KOHA 5T41A 2O01C 3MWBA 5EWGA 3IN5A 1Z4UA 3VCDA 2AJQA 3KG4A 3NS5A 3NS6A 4RWXA 4WE1B 1QAJA 2DNGA 4EO8A 4CO4A 4W92B 3PX6A 4F50A 1IUJA 4A8SA 3V6DA 4ED5A 4H4KA 3S8SA 2RMLA 4URQU 2FVQA 1VQ9S 3HJFA 1FRJA 3FDSA 1LFPA 1WWHA 3BSNA 1C4CA 3KFWX 5C24A 4J9KA 3U1LA 4D3GA 4NOHA 1J5OA 2ZNYA 1UEVA 2CRLA 4M5DA 5KG6A 3BSAA 3D2WA 3IFEA 1MU2A 4EFAC 1K8AT 2YKNB 1QAXA 2F40A 3CC4S 4OMFG 3C2PA 3NCQA 2CQ0A 4C9DA 2RF2A 4NLYA 3VZIA 1FNMA 2RJZA 5IM0A 1NHVA 4IRDA 5KG2A 1R27B 3HZEA 3PR5B 3OSPA 3BO4A 1N32F 4ECWA 2P9GA 1JLAA 2JC0A 3GFXA 4FXDA 2V4QA 2EFGA 5HROA 4JI7F 1HD1A 2XLIA 2J0QD 2XWXA 3C6UA 3JB9k 1KRPA 1TKZB 3N6NA 5A0YB 5I3PA 3FCHA 1HNIA 1C0TB 2YVSA 3FSYA 1HBNB 4RW8A 1LW0A 3K5MA 3P3DA 3CB4A 1SV5B 4OHZA 4DS4A 4J9PA 2ABYA 2B7CB 2B51A 1LWCA 5SZTA 5HBMA 4O44A 2KB2A 5B0GA 1U1PA 1M5KC 1UVJA 2R7TA 2I0XA 3U1NA 3SSSA 3RW6A 2K3KA 4CH0S 3D0GE 1S1WA 3R1HA 5H9EJ 2W9AA 1T94A 2DK2A 3Q2SC 3KLGA 1E6YA 2YX1A 1BQMB 1W25A 1C4AA 1NHUA 4OZ1A 5A6WA 4WK3A 3OFFA 3SMZA 2AD9A 1ZBTA 1RTIA 4KV8B 2XGQA 1MMNA 1VK3A 5J2QB 1S97A 5CYJA 1P1TA 2CPIA 1K0TA 3CPWR 4I2PB 3TYTA 3I96A 4XK8C 3KK2A 4DPOA 4C7QA 3HHLB 3CCES 2GNKA 5KT7A 2E44A 3BZQA 2CPJA 4N8NA 2AJ0A 1L5UA 3TI0A 2QE5A 3PIPQ 3TO8A 1DQAA 1T8EA 2YWHA 4OX8A 4TYBA 3OJSA 1HNWF 3US5A 4U7CA 2YNIA 5DG8A 1HBOB 2AX1A 4UOCA 2ADBA 2XI3A 2UVRA 4WZMA 3IAM9 3QGIA 5A8KB 1HNZF 4LIRA 3MAQA 2ZH7A 1P1LA 1U26A 3FNNA 3PV8A 2B5JA 3M1VB 3G4SS 2VFSA 2XLKA 2OPRA 3TQ1A 2JLEA 4ECRA 1NNDA 2LKZA 4MIBA 1KHWA 3K8WA 2R2UA 2CJBA 4NLRA 2E29A 4I2QA 2MYFA 3QIPB 5CYMA 2MMYA 1YRTA 2D3UA 2FJWA 1TAQA 2PT0A 4PG4A 4B17A 5CCMA 1IKXA 2A2CA 5J2MB 2R2RA 4A8MP 4DSFA 3PW0A 2DNOA 4WFAQ 4JI4F 3OXGA 1NK0A 3QZ7A 3CCLS 3T1YF 4EZ6A 3C66A 3P49B 2XB2D 4RBVA 2CVEA 5THWA 4C8ZA 2AYEA 3TP2A 3AQPA 1T3NA 1JNZB 2RVJA 3AB2B 4UQGA 4J9LA 2NSCA 4LSNB 1H6KX 3CCZA 3QWPA 2HZCA 5E2QA 3VTIA 3G71S 1I6JA 3M6XA 3HO1A 4Y2IA 1TFWA 2MZ1A 2AGQA 2RQMA 1VQSA 1XEZA 2W4DA 1ULRA 3S1TA 3G6VA 1LWFB 4K5SA 4R8UB 1FT8A 3M6VA 2KXFA 3V5RA 1FDNA 4AYBD 2EI5A 2YX4A 3LH2S 1FRXA 3CDWA 3W2WA 1LW2B 3Q8QB 3PRDA 1VHFA 3MR2A 3MPWA 3QIDA 3PFOA 1HQEB 4QYZJ 2NLWA 1RAJA 2J9EA 3DMJA 3BQ1A 3P6YC 1ZM4A 3TVYA 3MMCB 1VRTB 4DR5F 2ZKUA 1S1UB 2OAUA 2YQ3A 1VOMA 2EFVA 2MKSA 2NR0A 2MY8A 4K4VA 5AJ3F 4EBDA 3DRRA 3I5AA 2JVOA 4EGLA 2HWIA 1F2GA 2QO3A 4NA3A 3MM5A 4RW9B 5LMNF 2WW8A 4OJHA 3VAIA 4G1QB 3OXLA 1KHVA 3MPVA 1ROFA 2Z8QA 1V3SA 1YVFA 4NA1A 4JI6F 3M9OB 2J0XA 3GV5B 1CSJA 2BV3A 2DIVA 1KS2A 1U6BA 3W7BA 4LF7F 2IM3A 2ZBCA 2YNFA 3NRBA 2LLZA 4ECVA 3RRGA 4F8RA 5DQHA 4WIIA 1VBZA 3TVKA 2POKA 1Q1KA 4JV1A 1NK7A 1U25A 2M8DB 3HHNB 2F8EX 2L48A 3N0VA 1B0TA 2IYIA 4ZCKA 2ZH2A 4RU2A 4OZNA 3LANA 4F4YA 1Y9OA 3MFHA 4IQXA 1M5HA 4WXOA 3ISZA 2ZM6F 5L38A 4PUOB 2R4FA 3UFCX 2OD6A 4X4VA 1HL6A 1S6PA 3L7OA 1TKTA 3OHBA 3CIZA 3KG1A 2V2KA 4KFBB 4IRCA 2ILYA 3DLEA 5C5JA 4JI2F 3HM9A 3KJVA 5DDPC 1FERA 2CQBA 1C1CA 4C8KA 1K1SA 6FDRA 5F3TA 2IHR1 1YRUA 3QAEA 3GQCA 1SJ3P 2DNKA 3LWLA 3SV3A 4IO1A 4OJGA 1KFDA 2FLPA 2VOOA 1HHSA 4CO5A 3NGDA 1MNEA 3LAKA 1D9FA 5KFTA 1JKHB 5FLXY 3VWSA 4FNIA 2W9BB 4OIXA 5GAEI 2P6TA 2YTCA 3IR5B 3ENVA 4DWIA 2N82B 2RU9A 2ILZA 2KKHA 2E7WA