4LIWA

Ccmk1 carboxysome shell protein from synechocystis pcc6803, l11k point mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
92
Chain Sequence
IAVGMIETKGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVTAGIENIRRVNGGEVLSNHIIARPHENLEYVLPILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK homolog
publication title A challenging interpretation of a hexagonally layered protein structure.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
total genus 25
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4liwA00
4AXIA 2A10A 3I6PA 3DNCA 3SSRA 5DJBA 4QIGA 2A1BA 4P7TA 4DDFA 4LIWA 3NWGA 3CGIA 2A18A 3MPYA 4QIEA 4RBUA 4OX6A 4QIFA 4RBVA 4OX8A 5L38A 3H8YA 3BN4A 3DN9A 3CIMA 3I96A 4OX7A 4RBTA 2EWHA 3VCDA 4OLPA 4QIVA 3N79A 3SSQA 4AXJA 3SSSA 3NGKA 3PACA 4PPDA 3IA0A 4P7VA 4OLOA 4P2SA 3MPWA 2G13A
chains in the Genus database with same CATH superfamily
2F4FA 4MYUA 2ZOMA 1YIJS 3A3OB 3O2IA 1RWPB 1VC0A 1LXNA 4HHJA 2IA0A 3CCTA 3QZ8A 2EVZA 2YH1A 1F2HA 2VF3A 4F8RA 4ZITA 2HQGA 4WE1B 1M1HA 2ZBQA 3AT1B 5IQ6A 2HQDA 3ZO7A 5B0CA 2PSZA 2ZH2A 2NZCA 3M8QA 3TWZA 1VQ4S 1APSA 3TW0A 1J5OB 1OY8A 4PRFA 2ZOFA 3CCWA 4I0WA 2VU5A 4NLDA 3W5ZA 1DY3A 3HULA 1YJUA 3I0SA 3HSGA 2R2TA 4AL5A 3BQ1A 5HBMA 3SQGB 3FDSA 4RUHA 1SQGA 1RWMB 1Y5IB 1HW8A 2YXLA 2VL1A 4LIRA 1JLQA 3C6TB 3CCJS 5HK4A 2Y1RI 4RW9B 4CYUA 4D3GA 2ZH8A 4IRCA 2DNHA 2FVCA 1MMNA 3R7SB 3H25A 1IKXB 3KJFB 1FXRA 2DO4A 4OL8A 3SDEB 3CC4S 3UNGC 5E3CA 4DX7A 3MMAA 2EWHA 3JSMA 4X4NA 1E6VB 2W9BB 1X9WA 2ZH6A 4AFFA 3ETOA 3NMRA 2YKMB 4AL6A 1YQHA 1JXLA 3CEDA 1WHXA 3DOKB 3NY0A 4QU6A 3EE3A 2V69A 3D1OA 2XS7A 1BXNA 2V8GA 2HHHF 2NXEA 1NCLA 1W26A 2YX1A 1CJKA 1ZA2B 3WC0A 1WC4A 4DUYF 2OPPA 3UCUP 2CPJA 3DLGB 2UUCF 4CLFA 4U95A 1UEKA 4OZ3A 4O4RA 1ZM3A 5D0GA 3W9IA 4OX8A 4PQUA 2MSSA 2QMUB 1AXQA 3IR5B 5LMUF 2KL8A 1C0TA 1TL1B 2CZ4A 1RTDA 3T5LA 4X84A 3ZTOA 3J7YU 2J6UA 3J80Y 5B09A 4ZS6A 2JRSA 4ZN1A 1H0HB 1B0PA 1MWZA 3HVAA 3MD3A 3OBIA 2VOOA 3ISZA 2C3MA 3CD6S 1FRMA 1U26A 1FI4A 4DX6A 1HNXJ 2KU7A 2CPDA 4OX9F 1TV6A 3TOQA 3BQ0A 4DV2F 4DV7F 4DL6A 1HBOA 1MWQA 4X4SA 1F2GA 1K1QA 4N8NA 1RWXB 3JSBA 1SH0A 3H8YA 3PYDA 2VB6A 5J1EA 1OWXA 5GAHI 3RBXA 2ZWPA 2OEMA 3PRDA 2KT5A 2X7IA 2RDDA 2ZD1B 4L3KA 2AGQA 4DV3F 2R7SA 2B6AB 2ILZA 2MZJA 4QBUA 2EW9A 1EKSA 2UUWA 3QPIA 1SH2A 3M2RB 1FD2A 1T7PA 3POTB 2WZ1A 4OYWA 4DV0F 2CIMA 4W90B 1LQ9A 1FX2A 3VVUA 1RT1A 5LSOA 2N3LA 4WP9A 2W4PA 2J0XA 2R7VA 2GAHC 1S59A 2DR5A 3GV7B 1I94F 1N4LA 1FK9A 4O23A 1YRXA 1R0AA 2R9LA 4C8OA 3IXQA 3TZWA 2RQMA 2BE7D 2BANA 4PG4A 3R9LA 5KG4A 5HQMA 1GH8A 2XZTB 2NCKL 1LW0B 3CUNA 4DQIA 1U1QA 3RBDA 4ZPTR 4WU2A 3G82B 2Q43A 3SIPB 3QIPB 1W2IA 5KFCA 3PXGa 1SL2A 2OPQA 1HW9A 4ZVFA 4F4XA 1V3ZA 3UD4P 2CJ9A 4URGA 2PI5A 1LXJA 3QATA 4UQTA 2J5AA 1ZTWA 1RTHA 4KGVB 2LVWA 3QLHB 3I6PA 2MMYA 2B9YA 5I42B 4FZVA 4FN5A 5KG5A 1K73T 4O3SA 3DLEB 4FF4A 4ZVGA 2B4PA 5LSRA 2VQFF 3IAS9 3RB4A 1N34J 2FLLA 3GFXA 3RAMA 3IS9B 1ZZFA 5AE2A 3R5BA 1GMUA 3MPUB 2F7VA 3LWLA 3RRGA 5M2PA 5IT9Y 4IFYB 5F0WA 4OJHA 2BM1A 2HW3A 2RVJA 2H4WB 4OI0A 2GVDB 4P73A 2KVQE 2ZUAA 2GIQA 2RNEA 4BWMA 4ZHRB 4HI1A 1C1CA 2FVRA 4I69A 1URRA 3PG9A 2C3YA 2XI3A 1IKYB 1LK5A 2FVSA 4HACB 5A8RB 1N56A 3P8BB 3OTDA 2PE8A 1FEEA 1JLCB 1S6UA 1SIZA 1QSSA 3QRPA 1VIOA 1Q95G 3MWBA 1UPPA 5FJ4A 4CZCA 4DOZA 1NKEA 1NJXA 4R25A 1RHUB 2IFXA 5AXKA 3MM5A 4RW4B 3BGUA 1QD1A 3K5LA 3G9CA 5DDPC 4ELTA 4CO2A 3M05A 4RW8A 3A13A 4C11A 5IM0B 3OVSA 5FIIA 3NBPB 2XGPA 5D0HA 1B0VA 5K8PA 3OTBA 4IR1A 4TLQA 1N5YA 1V5IB 4K4YA 4NA3A 3PNIA 1S6PA 1H73A 3H98A 5HLFB 2V94A 4UOGA 1NEEA 4IUFA 4OZJA 2R7RA 4RLEA 5FLXU 4YR0A 2VC0A 4OQJA 2GMHA 5A76A 4JI1J 3KXDA 3Q8UA 4K50A 3HCXA 4PWDA 4N76A 2QTWA 2W2OP 3UR0A 4P2MA 4A8WA 4KFBA 2ZH9A 3KHRA 2B4VA 2Y3YA 5EGYA 5J2QB 1PCAA 4USMA 1RTZA 4P10A 1SC4B 4DR7F 5KT4A 2GGPB 4U7UD 5HVGA 1T03B 3D3CJ 4RR5A 1S7IA 1CEZA 2ALYB 1WF1A 5A8WB 1QAXA 3G8QA 2RE1A 2OP5A 2VA3A 1N32F 1S1UB 6FD1A 2RUSA 2ZJRQ 1XNQJ 1HWUA 5C42B 2KRBA 5DG7A 3MHYA 4F50A 2EKNA 1XC9A 3TARA 1S6QA 3AY0A 2XSFA 5K14B 2I8EA 1B99A 2V9WA 4I4BA 4J9UE 2AQ4A 4TKTA 1TKTB 1T0TV 3K5MA 3EM1A 2HRTA 2N7CA 3MR6A 1DAXA 2K3IA 1S76D 2Y0BB 2XHCA 4C6AA 2WSCC 1GAOA 3BBCA 3ISND 2KJWA 4ZJLA 3N6MA 4CM2A 2DRAA 3KLEB 3FEZA 3T1HF 5HJXA 1SPBP 4DU8A 2V2QA 4M95A 3PIOQ 1UW4A 4A8KA 5DM7Q 4LSNA 4CNYA 2AYBA 2H65B 2ASDA 4TNOA 5HROA 4JI5J 4OLOA 2JWNA 3EXCX 1WNEA 3LP2A 4IH6A 4YDDB 4LFAF 4QOTA 4L74A 2QSFA 3QRQA 5F8IA 3C2PA 1NK8A 2DKOB 3R2CJ 3D0IE 5G4DA 2IJFA 2JEGA 4RUAA 4NLQA 2EFNA 2V4JB 4FKXA 1TELA 4YMEA 4OYPA 2YPYA 1REVB 4X66F 2Q3PA 3KLHB 1NHVA 3Q89A 5KT7A 1FTCA 3AJDA 4A8FA 4A8YA 3K8WA 3KK1A 1NK7A 2OH2A 4KRWA 3C19A 3ENQA 2HZAA 3IBFB 1FJGF 4LSLA 1SIWB 5KAKA 4A8XA 2ZE2B 2D3OR 1U8WA 4LF6J 1LWFA 1WJ9A 2MLYA 1M5HA 3PHEA 2R8JA 1IBKF 1TKXB 4CDIA 1T3OA 1C4CA 4X65F 5B0BA 3F56A 3HSZA 5ETPA 1EKRA 3J81Y 4HH1A 2V9KA 3FZBA 1PGZA 1NUEA 4PABA 2DHHA 4P7TA 4B9MA 1M5PC 3THPA 1PYTA 2BE9B 3QRRA 2VKZG 1WUUA 1RT2A 1ZOTA 4NMXA 4ECRA 3DGPB 5CCLA 4WFXA 5KG1A 5AT1B 3HF5A 1SXLA 2KM8C 2ZC3A 3DRYA 1RACB 1DBDA 3GP9A 4K4TA 1E6YB 2JX2A 1X4AA 4OI4A 3GU0A 3NNHA 3DOLA 1X4BA 1VBKA 1SB6A 4XDCA 5I3QA 4B3MJ 2FHJA 1RXOB 4C3LA 3RAXA 4J9VA 2IY5B 1HNZJ 3HHLA 2UUCJ 1D3WA 2HFUA 2HRUA 3LF0A 3JTNA 1TL3B 3EPIA 2XNRA 1S1VB 3ZTQA 1RI7A 4ZA1A 2CJAA 1DQAA 3PV8A 4LF7J 1Y4ZB 2OEKA 3UVJA 4F0KA 1A0OB 3SXLA 3W3SA 3RZAA 1M1KT 3SSRA 4HKQA 3OV7A 3KJVA 3BGRA 1SC1B 3RJMB 4F4KA 4J9LA 4Q44A 1GXTA 4P2SA 2HGNA 5GAEU 1R43A 2D74B 3CJ8A 3UDLA 2XHWA 1HWLA 4DR2J 1Q82T 2PGCA 1SBRA 4OX9J 1QSYA 3KOAA 4DR6F 2RH3A 3TZXA 2HZCA 1T9WA 1X60A 4USKA 1HPZB 5LMNJ 3KHHA 1JLEB 1UP1A 2PI4A 3MR7A 1GX6A 3IGNA 2FY8A 3PO5A 1OS5A 3M2VA 4UOHA 3PM9A 4X2BA 1X9SA 4I7FB 4Q45A 6AT1B 3QFWA 3R7NB 3G87A 5A2QY 3H59A 1G1XA 3CCQS 4HEA9 5D0RA 1KONA 3OR1B 1VMBA 4DV3J 1OJ4A 4P7VA 1IR1A 4KSEB 3OLBA 1UZHA 1SJRA 4WKYA 3BSCA 1YWXA 4DV6J 2KH9A 4Z7YA 1WTBA 4C97A 1K1SA 3IR6B 2HVIA 1JLAB 2EC2A 4NLXA 3LGNA 5CH7B 4DV0J 4O3NA 3GQCA 5B0GA 3BSOA 1HNIA 2VPYB 3UNYA 4NCGA 2B7BB 3H90A 4ZKAA 2W1BA 2CQGA 4ED4A 5KFFA 3RW6A 3UCGA 3ULHA 1GEHA 1N0VC 4IDKB 2ZH4A 2AW0A 3DFEA 1I94J 3DI6B 4TU8A 3HHLC 2L3MA 3VAIA 2DNNA 3W7BA 5GADU 3KHLA 5H9FK 2CPEA 3IR7B 4B3RF 3WC2A 1EP4B 4WZMA 2QYGA 3NGTA 3WX4A 3CD0A 4DR5F 1MMLA 4DLGA 5HP1A 3ICLA 3CT9A 2Z2ZA 4ICLA 4RX6A 4PXCA 3DRSB 2FZGB 3PYGA 4MAKA 4MK8A 2XNQA 1KVKA 4UOFA 3KLFA 3MECA 4M5HA 5IXUA 1S9GA 2BX6A 3QT6A 5K20B 4N5SA 3GV8B 2E1PA 5DLFA 4RW6B 3MAHA 1MROA 5AE3A 2AV5A 1MG7A 1VHIA 2BXJA 5HQLA 3MPDA 3NP5A 5IZHA 3S6EA 2M8HA 1RLDA 3IM9A 3A3NB 2GIRA 3NCRA 2VQFJ 3PW4A 2VG7B 1HQUA 3KK3B 5D77A 4LF4J 1LFPA 2NZ4A 3FMBA 3JYTB 1RT3A 4NA1A 3HZEA 3PX0A 4P72A 2DR8A 3GLJA 1MW7A 1VQYA 3GONA 1TAQA 3GFYA 3V2UC 2EXUA 2RF2B 2ERRA 1UVNA 4ECWA 4RBVA 1KVIA 1KS2A 4CLTA 3KUHA 1H2UX 2KN4A 2C2DA 3VCDA 1FRXA 2L9DA 1NK0A 3SSSA 4UQGA 1NKBA 1TUVA 3L4BC 1S97A 4QR1A 4CH0S 1VBXA 1VJQA 2HHPA 2CQIA 3GCWP 2MQPA 1HWKA 2BOAA 2F8MA 1YLXA 1S4EA 2CG8A 3T1AA 5AXMA 1HBUA 2FUG9 2R8KA 4WPAA 3PRVA 2W2PP 2JLGA 1TR0A 2FD2A 2MZ1A 3GV5B 4WP3A 2QO3A 2H5JB 4X62J 4HR2A 3DRPA 1EQMA 2FC9A 5F3ZA 5BJRA 2YKNA 1R7IA 4AXIA 2OIHA 3CXCR 2XZWA 2KFZA 3MEDA 4KO0B 5HQ8A 2POKA 2RJZA 3HPOA 2GW8A 2BA9A 5KFNA 4TXSA 2CPXA 5KFLA 1IM4A 3MF5A 2QE5A 4EFAC 4DFMA 2F9JA 3FRYA 1SKSA 4E2FB 2ADCA 3QZ7A 2AP6A 1T3NA 3NXZA 3D54A 2KTQA 3Q23A 4LF5F 4FBTA 4QW8A 3DM2A 3QAEA 3OXGA 1U1PA 3EICA 4DF4A 4DSLA 3I0SB 2CWKA 3AHPA 5H9EJ 1ZAVA 2XC9A 3PO4A 5JJBA 1YRUA 3VVTA 1VK8A 4LBHA 1D8YA 3W2WB 4KH0B 4DR7J 1ZZNA 1UFLA 4Y2MA 4HHUA 4FYYB 4NI2A 4DZDA 4CYUB 5I3UB 4DBQA 3PR5B 2KFYA 3RB6A 4ZVPB 4YS2A 1FRJA 3D1QA 4OLPA 3DHWC 1N32J 2QMXA 4PG5A 4M1KA 1R31A 4LRFA 2XI2A 1TUGB 3KLVA 3MAAA 2MLZA 3HK2A 2NREA 3JSMB 2YX7A 1UCNA 1REGX 3UN2A 4G1QB 3V6KA 5KOWA 2F63A 2EKYA 3M32A 2BACA 2LFVA 2PT0A 4OHYA 5E41A 2CQ1A 1CJKB 4OI1A 3CSKA 2OPPB 3T1HJ 2HIQA 4WFAQ 2LU2A 4DL7A 4MKVA 2DXFA 2KDOA 1HQ2A 1XMBA 3M8PA 1SKWA 2DNYA 2VBYA 2GQ2A 3IO1A 1Q0NA 2LQ8A 4PQUB 2LYVA 3GIIA 1CJVB 5G0RA 1JLBA 5GAHU 3DXSX 1WTFA 3GJQB 1HHTP 5IS2A 1TZ0A 3W64A 4ILMA 3VAJA 3LPEA 2HQ3A 3VZHA 3O5TB 3C6TA 4NXNF 1RTDB 2XS2A 4Q5VA 1PJ6A 4RW9A 3QYYA 1V9OA 3VV2B 4DG1A 4FXWA 2CQ3A 2MY7A 3CC2S 1FJGJ 3Q86A 1K44A 3W60A 3L7UA 1NSKL 1IKXA 2HIYA 1C2PA 1KOHA 2IMOA 3PRBA 1ICEB 4NYZA 5GMDA 1TUWA 1TV6B 2AHOB 2EFPA 1CJTA 3TVKA 3VR1A 1GMWD 1HARA 1D8ZA 5F3TA 2AD9A 2W9BA 1ZETA 4G3IA 4X4VA 3OXFA 2LEAA 2R7XA 4QPTA 2YKMA 2EEYA 3EVMA 5J1EB 3TZZA 2MKCA 5HO4A 4LF1A 1QLNA 2M88A 4R0JA 2QFJA 2NXUA 1F5CA 3NGKA 4EGLA 4O3RA 2VFSA 4LVOP 3AODA 1IVZA 2AX1A 4H4KA 2XO6A 2E44A 2B4UA 2JL9A 5ETMA 3DLGA 3N0VA 2CG4A 5KFYA 2WVBA 3OJUA 3MPYA 1XNRF 1R8HA 1NLKL 1KHVA 3G4SS 4CWBA 2QL9B 4PXEA 4DQSA 2V2VA 2Y8WA 1BUXA 3OQ2A 1HQEB 3I82A 3K58A 5GAGU 3L09A 1AUDA 2MQMA 3H0PA 1I51B 2XEXA 2HNYB 3CJ3A 4FYDA 1OPZA 1LV5A 3ZZPA 2XLJA 2BRKA 1TFYA 4Y2AA 1Q16B 1ITPA 3IM8A 1FK9B 3QWPA 4I2PA 2B9XA 2MPUA 2J9EA 3RTVA 1EHWA 3T1YJ 5D4LA 3EZUA 3FBFA 1NNDA 3LWMA 1RAGB 1HNWF 2ZNYA 1SUQA 1IWAA 2RB7A 4I67A 2VFVA 1H2VZ 3NGUA 3OT9A 3J7ZT 4LIWA 3QT7A 4OX6A 4I6AA 2XZDB 4KHMA 5CYJA 4QPXA 3AH6A 3E3XA 3CD7A 1IXKA 4DSIA 2K7JA 3PW0A 3VALA 2JNJA 1IR0A 2DY1A 2OPQB 2W7OA 4PZVA 2N4DA 2ZD1A 1VQKS 1T9XA 2JSXA 2ZBPA 4J9OA 1VQMS 4LMZA 3R8YA 3J7YI 1RTHB 3J81j 2B6AA 3HLUA 5HMWA 4DR6J 3QGIA 5B0DA 5LT5A 3QGGA 1J2VA 2M3DA 3OHBA 1P6TA 2MKJA 4DL3A 1FA0A 2EFOA 3FKBA 3M2RA 1FRIA 2HGMA 5HJYA 3POTA 4PEOA 5DDQC 3FFIA 3FK4A 3MTJA 2UUAJ 1VLOA 1YJVA 4QWDA 1RTJA 2V67A 1H38A 4UZCA 3TJ8A 1JXEA 1NH7A 3MR3A 1IN0A 2FGCA 1KSPA 1UVJA 4DFJA 2UUBF 4JB8B 3BJYA 2PFDA 5LJ5Y 2EFGA 1FE0A 3VQTA 4H4KC 1TP7A 1HBMB 3F0NA 2D3ZA 3DDKA 1VI7A 3W5YA 2OHDA 3QSYB 3NMAA 2DH8A 3SV4A 4LF8J 1Q5YA 2M2BA 1NK6A 1C1CB 4XPEA 2H4YB 1EX8A 3AXMA 1T8EA 1NZAA 2EG2A 3QO9A 3T9ZA 1LW0A 5K5MA 5IWAF 4USIA 1N36J 4XTTA 1QTMA 4XO0A 2KKHA 2FVPA 5EX3A 2F4VF 3DYAA 3GG1A 1T02A 3QIPA 2Z8QA 5KT2A 4ZVQB 3MM5B 1ZPVA 4OYIA 1N5QA 2LMIA 3LALA 1P27B 2MTLA 4RW8B 1OY9A 4QU7A 4K8RA 3CWJA 3IMQJ 2OI2A 3E01A 4ZVOB 2QLXA 4NOHA 4M5LA 2GMJA 5M2UA 3QLHA 2XQCA 2DXEA 1LWCB 2BJEA 4CLYA 2L48A 1S6PB 4GVLA 1XMQJ 5I42A 1WDDA 3DLEA 3MXHP 2I0XA 1M5KC 5FDLB 4JP8A 4ZIVA 3ZC4A 4OMFG 2RSQA 4EYIB 2R7TA 3MOJB 5IV3A 3IS9A 3AB4B 2IAJB 4M8LA 1AYEA 2BYCA 1KP6A 2DNLA 2WVCA 1FDBA 2HNZB 4PWDB 3H2VE 3CIZA 1Y00A 2JEIA 1WG5A 4DR1F 1ZS6A 4KFBB 4IFYA 1RHJB 1ZM2A 4P6QA 2FJEB 2OKQA 2HBRB 4O0IA 2QIFA 3KJNB 3N5BA 3HFKA 4OZ2A 2IIHA 4HACA 1IBLF 2IYGA 5L39A 1JLCA 2ZHAA 4F7VA 1OQ6A 3CJRA 3EGWB 4O4GA 4DV5J 3C3LA 1ZH5A 2ALZA 4USUA 2WTFA 2FHMA 3M7VA 1Q8LA 4U6PA 1LFWA 1NSAA 2V68A 4PQAA 4JI2F 3PEJA 4RW4A 2K3KA 3BF4A 3IWXA 5D8HB 2VA2A 4IOBA 1RKJA 1H98A 2K1RB 1VQ9S 3UW1A 1VOMA 5IM0A 4O44B 5ETLA 2JDJA 3GE9A 5MAOA 4HHHA 3OFGA 1PSDA 1UVKA 3H20A 2W24A 2MQQA 5U47A 3KTQA 3I32A 2RS2A 4GO5X 4L76A 1VIXA 2HBQB 3CMES 2FB0A 4RWXA 1B7YB 5KG3A 2WBMA 4FBUA 1D9FA 4I2QA 4OYZA 1D1UA 2W2MP 1KWMA 3IN5A 3C14A 3THTA 1FJCA 5HROB 3HHEA 3WZ0A 2CPHA 4ILLA 3LP2B 3I5BA 2HEKA 1K8AT 1BY9A 2HFSA 4DXLA 2O01C 4JV0A 3NNAA 3C16A 5J2QA 2ASYA 1TQLA 5C24A 1NB2A 2GGPA 1B7FA 2CQPA 1T03A 2XY5A 4CO5A 3P6YC 1RU2A 2V2KA 1J27A 1C4AA 2YWKA 2OPRA 5LXYA 3KHGA 1RA7A 4Y2IA 5L9NA 1H7WA 2QLJB 2QX0A 3NGDA 3QGHA 1RT4B 5K9FA 4LSLB 2IBOA 1C0UB 4TN2A 1J5EJ 4CLKA 5C42A 3IRXA 2GQQA 1DHMA 1WOPA 1FNOA 3W2VB 5H1SV 1LWFB 5K14A 1H72C 3D6TB 3RGIA 2H5EA 2G1HA 1GTEA 1TKTA 4HH0A 3EX7B 2VPXB 2MHEA 2HZVA 4D3HA 4EBDA 2ZBIA 2VJUA 3VGSA 4ID8A 2CQBA 1HNVB 4MKBA 5L1JA 3KLEA 4NYPA 4KE5A 2DGUA 5JVGQ 4J7CA 3FQLA 2UV8A 4MIAA 2DGOA 4ED1A 2EBGA 2BE2A 1RT2B 2HMIB 2O1PA 4WZQA 2MKSA 4FYVB 1FE4A 1F1BB 4JI0F 2AGOA 4ZP8A 4P74A 2UUTA 4KPYA 3GYXB 4P2XA 2RRBA 3C15B 1XMOJ 3OUYB 4ANCA 2CDQA 4JYAJ 2XB2D 3B6BA 4ZP7A 4QWBA 2Z2LA 3HP6A 2V4JA 3CCRS 1FFWB 4BCAA 1FESA 5RUBA 1FXLA 1S9FA 3S1TA 1VK3A 1GNKA 4JUZA 4YB7A 1YGYA 4NE9C 3CIMA 3CJ5A 3HHLB 1L3SA 2CNKB 3CCVS 3UN5A 2OPSB 3V6DB 1DLOA 2QA1A 2VD3A 4ECYA 4OJGA 1FRKA 2WSEC 2F65A 2ZE2A 1SL0A 1U8SA 2DR9A 3MAQA 2E1CA 1OY6A 4XAKA 1VQ6S 1S57A 1RT5A 1RAOA 4QWCA 3PIPQ 3DKDA 4NXNJ 4C8YA 2G0IA 5B0FA 1FWKA 3ILLA 1YTYA 2JJ4D 1NJZA 1KLMB 1DFDA 3CJKB 2OTJS 1B3TA 4LT6A 2A3JA 3MFIA 4JI4J 5MLCV 2RAQA 4ES1A 4ZJOA 2CVIA 2B9WA 3GIRA 2WRMA 4ES3A 3A1YG 1UA1A 5CABA 2EPIA 4DMZA 1BHNA 1N0UA 3T5KA 3M2VB 2U2FA 4NWBA 4JBCA 2EC0A 1E6YA 1VQ7S 2FC8A 5LJ3Y 4KR0B 4KT0C 2UVWA 2ROEA 1R8BA 3EZ5A 3MMCA 1N6QB 1N88A 5CHCB 1TKZA 1NDLA 3L9ZA 3DLKA 2E9RX 4OIXA 2MKYA 3HZGA 5ADZA 5J2MA 2DISA 1X8DA 1TMMA 3PEHA 3R6LB 1TL3A 1WSRA 5T41A 1XNRJ 1S1VA 2J6TA 4EYHB 2J9DE 2VFTA 2COLA 4FF3A 5F8MA 4RU2A 4PXDA 5F8HA 1M0SA 2DHAA 4QWEA 5IT9U 4NCGB 1R8AA 3TJ9A 3PJWA 4DQQA 3IP0A 2ZUGA 2HVEA 3D67A 1TK8A 3DU6A 2WB4A 4DPXA 1RHQB 1TK0A 2G2OA 3F73A 3HI9A 2XCAA 3G6YA 5B08A 3RG6A 4JI3J 5F8NA 3E2EA 4AT1B 3Q83A 2XYPB 3HKWA 4UF4A 4ZVRB 2W7AA 1HNWJ 2ZZNA 2F9DA 4B3OB 1YBAA 5CXTA 3FZ2A 3IAM9 2UXDF 3GZ7A 5HVHA 1JB0C 1JJCB 2EBEA 3U1MA 1SJ3P 1HPZA 1JLEA 4Q0BA 4O3OA 3BO2A 4ATNA 3EXYA 3B8HA 4TU7A 2QMWA 4TLRA 2KT3A 2I5JA 3KLFB 3MECB 1X5TA 2XGQA 2VICA 2ZJPQ 3MURP 3A4TA 5CA5A 1FVQA 2CWXA 5KFPA 2ZVIA 3O6QA 1NDKA 1UWBA 1ZYQA 1MROB 1RAFB 3TAQA 3L95X 4LFBF 3DGVA 4C0OC 2ZZMA 1U47A 4YR2A 5F0UA 3BQ2A 4WXOA 5BXIA 1LW2B 1JLAA 2DGQA 3KLGA 4CO4A 2NPIA 1WHWA 4J91A 5B0EA 3SCJE 2VG6B 4N8OA 5FLXY 4LRBA 2R3VA 3OR2B 1O51A 2PMWA 1RT3B 2Q1LA 2JLEA 3HJFA 3BDPA 3RBZA 3OJSA 4GO7X 1RWUA 1ELOA 4DS5A 1O0PA 2UUBJ 3DOMA 3FBBA 4AE5A 3A8KA 1Q86T 3CDWA 5E3PA 3SQOP 5EWGA 4KQZA 1AT1B 2WCXA 4Q2MA 2XSJB 4ED6A 4B08A 3ZZZA 3MCMA 1VRUB 3SMZA 3CJ4A 4ES2A 5J1NA 2MZTA 1IBMF 1UFKA 2MQNA 4RUCA 3N6NA 4C9DA 2C22A 3OFHA 3LAMA 2ROGA 4YB6A 2KZMA 3CC7S 3NS6A 1NRKA 4ZK7M 4C8ZA 1HBUB 1AA1B 2F4VJ 4DQPA 5E3QA 3PVXA 4V19X 4Y28C 3WX8A 4K4UA 4MKAA 3ENWA 4KKOB 3BGLA 2CA9A 2OD6A 2W8LA 2YKNB 4N41A 4RW6A 5DZ6A 5GMEA 3VQSA 2BUNA 1QSLA 4USTA 5AJ3F 1OSCA 2DRDA 2VZ9A 1FKAF 5HMZA 1YVFA 1L3TA 3M9OB 2B9EA 1NM2A 5KOXA 5C25A 3OL6A 4YOEA 2W9CA 3RW7A 2N3OA 1H6KX 3BEGB 1QE1B 4NLRA 2LEBA 2ZNZA 3ITHA 5KFKA 3H5UA 4X4PA 3JXOA 3PTWA 2HFVA 3PX4A 4LREA 4Y2CA 1UAWA 4NLOA 3TX0A 3JYTA 1WELA 4RNHA 2AWZA 3DM2B 3JQMA 3G96A 2FGOA 3D1HA 4FYWB 1R0CB 2NQPA 2CZ9A 4ER8A 2DO0A 4I64A 2RF2A 4YP3A 3O1LA 4YB5A 2R8IA 2AMCB 4YHHF 2YNGB 4OJ1A 2EG1A 3B4DA 1R0BG 4Y34A 4CQ1A 2CPYA 1IBLJ 5ETKA 5LOQA 4MT1A 3UDCA 4WFBQ 1RADB 2XMVA 3AD8C 3CCES 2XLKA 2Z0GA 3ZTPA 1B64A 3EGZA 2JOQA 2L08A 2QYCA 3MAAB 1RHKB 4CTAA 1U0SA 1YJRA 2GS8A 1YITS 5A6PA 2GZOA 2XMKA 2FJXA 1Y5NB 4QYZK 1VBYA 1FWLA 4DUZF 1RUSA 3HKZD 3V4IB 2LU1A 2AJFE 3AA8A 1QAYA 4KO0A 3M32B 4CI0B 1JIHA 1VISA 3DMJA 3G6XA 3CNQP 2D1CA 4HT7A 2V5HG 2A2CA 4MTPA 1NSPA 3G6VA 2UP1A 2EK6A 4WFYA 4WKRA 3OTEA 3M8PB 2FZKB 2CJYB 2HSEB 1DARA 2CQCA 7FD1A 1WKKA 1YKWA 1RLCL 3M6VA 4CO0A 4H54A 2QV6A 2YKOA 5G0RB 2IHR1 4ZVHA 1JLBB 2OTLS 4QZVB 3KG4A 4ECQA 3ET6B 4IG3B 3W2WA 2Y8YA 3P3DA 1M5VC 3AAWB 2FJVA 1G3OA 2QZ8A 4DG1B 5I3UA 3M2UA 3I9V9 2BVZA 1JKHA 4NEZA 1X4DA 4ZOSA 4QJVA 3M30A 1ZAXA 4DFPA 3EVWA 1MN9A 3NOGA 4KH1B 2H1YA 1JNRB 2YY3A 4O0NA 1VGYA 1UTAA 2ZKUA 1CJTB 3KUEA 1XR6A 1C1BB 4IR9A 3ENAA 2AYEA 1U1OA 2B5JB 1YX2A 3TQ1A 1QJHA 3R7BB 4G1QA 4TVAB 3IBCB 4WYLA 4S0MA 3K5PA 3OVAA 2XG8A 1OIAA 1RSCA 1FKPB 5ETNA 3DXBA 2DT9A 2B56A 4OZLA 4PR6A 1KFDA 3D6FB 3SFGA 3AD7C 4X64F 4YY3F 1FDAA 3C8YA 3DU5A 5DO2A 3WIVA 3VHQA 5BR8F 1S6OA 1VQ5S 2CVEA 4DUTA 4DPYA 3US5A 1KFSA 2GCFA 2J7UA 3CJTA 2AIRB 3DLLQ 5DQIA 1EAYC 4ED3A 2GHVC 2E7WA 1EJ7L 4DX5A 1CJVA 3LO3A 4L73A 1TK5A 1RCXB 4DV4F 4YFUA 3Q2TC 3H42A 2J6SA 3W66A 3FEYB 4URQU 4ALZA 3TI0A 4V19J 3FCHA 1IKVB 2CJKA 3T5JA 3IWLA 4I2PB 2YQ1A 3N6LA 2NR0A 2Y1IA 4LJMA 2C1EB 3K7RA 2XMWA 2E66A 3SBMA 4FPRA 5D4OA 1SUQB 3KNAA 4NYOA 2MDAA 2V8DA 3FQKA 4WF9Q 4RKUC 2CQ4A 4ERDA 4K4XA 2MJUA 3I87A 2OFGX 2HHUA 3MM7B 2HURA 2GHWA 4F26A 4Y3CA 4OI2A 3B82A 3MCNA 2UV8G 1AFIA 4C0HA 2M70A 3PJXA 4XPCA 3OTOJ 3QT8A 5F41A 4WYWA 1S48A 3TR5A 3ELHA 2HPUA 4ZVSB 2FJBB 2W4CA 3KG0A 1WC0A 5KFHA 2HK3A 3FRZA 1KC8T 2DTJA 3TUIC 5L46A 2AT1B 3QMQA 5ETRA 3FFIB 4R5PA 4URSA 3GTYX 2GAGC 2LXFA 3SCKE 2WONB 3NS5A 1RTJB 2XY6A 3HVRA 1SQEA 3E8OA 2A1BA 2MZQA 1HQEA 4ZP6A 2GHPA 2Y9HA 4I6YA 2P8IA 2UXCJ 2HNYA 4TYAA 2Q79A 2DR6A 3CMAS 3IBWA 1NAQA 4W92B 2ZDPA 1KRPA 3IC1A 3Q8SB 4IKAA 2KXNB 1FERA 4F4WA 2E5LJ 3IGVA 3CTRA 2MZRA 2OFHX 4OYOA 4RBUA 2YKQA 2OD4A 3HT3A 5EWEA 5JXSA 3SEOA 3I5CA 2J0SD 2VDIA 5IC6B 3QO9B 2HAFA 4USJC 4QYZJ 3NKYA 4UTGA 1T9UA 1PC5A 3DYAB 3GYGA 4GKJJ 1NPPA 4ZCLA 3BH6B 1FT8A 1BD6A 3H40A 2IM3A 2IVYA 5KFZA 2YNIB 4CLSA 1Q7YT 3H5XA 5GAGI 4F25A 2FLPA 1RBOB 3E01B 3NAHA 1S1TB 3AA9A 2EFQA 2FJDB 4X4RA 3NGSA 4C8LA 1PJ5A 1KNZA 3CDAA 3K5NA 5AXLA 2ZH7A 1T9TA 1RB0A 4ED0A 4NLTA 3MGJA 3TUPA 3NGRA 5KG7A 2Z30B 4I1TA 5D15A 2ZH3A 5L8RC 4ELUA 2OUGA 2RU9A 3TAMB 4QW9A 3QNWB 4PUOB 3Q22A 3DHXA 4J9MA 4IOAQ 4BWJA 1H3DA 2HWTA 4WK3A 2WOMA 2VC1A 2WW4A 4AL7A 1HBMA 1RDRA 2I38A 1FX4A 1Y11A 3LP0A 1X31C 1EETA 3LUYA 5J1PA 4K0KF 1RA6A 4B9NA 4ZLPA 2D7SA 3LP1A 2G4BA 4J9KA 2IA6A 3RR8A 4NLPA 4NA2A 5KT3A 4PG7A 1X0PA 4O4GB 2K7KA 1CVJA 4ITSA 4ECZA 1MSWD 2BJ3A 2XMAA 3D6HB 1P1TA 1VCTA 3W9HA 4MMOA 4ZN3A 3G71S 1VQ8S 1CQNA 4AQYF 4M63A 1JX4A 1JJ2R 2HFOA 4J37A 2PA3A 3J7A1 1P9QC 1KQGB 2V4RA 1HLWA 3D6MB 2KG1A 2RD5C 2DYAA 4WTYA 1LWCA 4O3QA 2XMUA 4U9RA 5T14A 1HNXF 2ACMA 1HA1A 2HRYA 2JVRA 1UVLA 2RHQB 5FDLA 2XO7A 5DETA 3E51A 3ZZYA 5HAOA 4A8QA 1U4BA 3K2YA 2BQUA 4ED5A 4I2QB 1U2RA 3H2LA 2IAJA 3C14B 3HFZB 2KI2A 5KFXA 1VRTA 1YDLA 4OYXA 2CJQA 2HNZA 3QT5A 4K5SA 3NWRA 3IA0A 5J2NA 4G1IA 3DLHA 4FVMA 3CCLS 4NZ6A 2FVQA 3C16B 4R8UA 5C24B 2UVRA 1ROFA 4LR8A 3R1HA 4USHA 1WACA 2OPRB 9ATCB 3MZIA 2W2QP 2BW2A 4DPTA 3CD5A 5IFMA 3IRXB 4IRDA 1X4GA 4WTOB 5E7OB 2J0WA 4ZIWA 2BMBA 4B9SA 2C2OB 2K1RA 4ZLLA 4O44A 2XMTA 1JXVA 2PN6A 4O3PA 3TQEA 3HHNB 4ECTA 2VFUA 1Q8BA 3NG8A 1YZ6A 1S79A 3VTIA 2CPFA 3NLCA 3T9NA 2RRAA 1WC1A 4JV5F 3TYTA 2ZEJA 2BE2B 2JZ5A 3FJ2A 2KZZA 2UXBF 2VDHA 8RUCA 1TTHB 2BQRA 1CG2A 2HBZB 4EBCA 4DR4F 1NU4A 3K0JA 4IFVA 4HTJA 4LFCF 1LWEA 5D3GA 4DPOA 3W5XA 3EGNA 4UY8T 2AYMA 1JMTA 4CO3A 2VPZB 2CJBA 4DL4A 4G6VB 2Z4PA 4ED7A 1OO0B 2ZITA 4ANEA 4DSFA 2QA4G 5L1KA 1Y10A 2Z58B 2B4OA 1HYSB 4F3MA 1AFJA 4DFKA 8ATCB 1DLOB 2LQBA 1RT4A 2GX8A 1BWVA 1C0UA 4NZ7A 4OV6A 1Q8KA 1HL6A 2NYHA 2AJ4A 4K2XA 1S0NA 5K8MA 3CULA 3W2VA 3BPDA 3KDOA 1RT5B 2DEJA 5C2GA 1N5VA 4IOCQ 4ECSA 2O67A 3G8TA 2LKZA 5M2RA 3ZNJ1 2CQ0A 1NSQA 3R5JB 2HS0A 2PA8D 2XLIA 4PWWA 5ETSA 4F0HA 2KYXA 1UMJA 2DY9A 4RNOA 4CP5A 2VASA 4FXVA 3U7JA 1HNVA 3WBZA 1OQ3A 3T6JA 4ECXA 4TY9A 2L9WA 4EUVA 4C98A 2WVDA 5HN0A 2HMIA 2ZWOA 1TL4A 4B3SF 1TVRA 2XBPA 4QIWD 1I3OB 4F0MA 1PG5B 1I6JA 1D9AA 3C15A 1EB0A 1RJJA 1YSJA 2ATLA 3OUYA 3GIJA 3K8VA 3H4BA 4PKDB 2X1BA 4Y0FA 2HHHJ 2DNOA 3MMCB 4YY3J 4FF2A 1TFWA 2MHNA 2A18A 4DUYJ 2HQCA 1IQTA 1TKZB 5DS7A 3BN4A 5LSLA 3DLKB 4ETZA 2X1AA 2BRLA 3JSYA 4W98A 5J2MB 2OPSA 3TA1A 3V6DA 5LM7E 4HDGA 3CCUS 4QIEA 4JI1F 2C2ZB 2ATCB 2GA7A 3QJLA 1TL7A 4CM0A 2W01A 4DV1F 5LMUJ 2YQ0A 2BOPA 5DQGA 2XWXA 5EHHA 3R5DA 2GO9A 1BQMA 4WFNQ 3Q8QB 2VBWA 1NK4A 2VH7A 3C6UA 3JTPA 1KLMA 3CJKA 1NMEB 3F41A 4GRSA 1CQMA 3UFCX 4OHVA 2M8DB 2HQIA 1W2BR 2HHXA 2C2EA 1VYAA 3BSNA 4PYDA 1NPKA 2YBVA 2Y0SD 1CS4A 1KBRA 2RKIB 4OJ3A 3MUVP 2WVEA 4LF2A 1YJ7A 2YWFA 4DV2J 4DV7J 4YN3B 3PY8A 1SL1A 3TUZC 3JSRA 1RYSA 3GFZA 2CQ2A 3O3LA 4TU9A 4Q0BB 1N5SA 4M5DB 4IYQA 4KC5A 3D9BA 4KY3A 3HMJG 3ILOA 2WK4A 4HYKA 2JFDA 2I5JB 2AZ1A 1F6TA 2GVZB 3PACA 2DGVA 1RTIA 2OELA 4I68A 3MD1A 2NS1B 1LNQA 1F0XA 1RKIA 2IBKA 4NCAA 4C4WA 1UWBB 1SJ1A 1N6QA 2ZHOA 1S49A 3EDQB 4FNIA 1FD8A 4KV8B 1YG0A 2WW8A 2JFKA 2DNKA 3LPYA 2Z2MA 3GJSB 2OGUA 3MEGB 2CNLB 2V2ZA 4QCLA 3RRHA 2MQOA 2ASLA 2BBEA 1L3KA 1RK8A 3FVYA 1U48A 2DITA 5E3AA 3KLGB 1FVSA 2K8GA 3LQVA 4JI5F 2C28A 1DQ8A 5ITHA 1WC5A 2JC1A 4NCBA 2MKIA 4I6WA 3RUBL 3JAMU 1P9YA 3DOMB 4NLVA 1KOOA 1BE4A 2VPWB 3QSIA 3FSIA 1EQ0A 1NK9A 2M7SA 3GILA 3I4PA 5CYQB 4DF8A 2C2RA 2DCUB 4B17A 3ZTRA 2AGPA 3I5AA 4OZ1A 4ILRA 1NDPA 4WXWA 3GPAA 2VHGA 1WC6A 4M5MA 3R1LA 2J8AA 2BEFA 2E9ZA 4B3OA 1CC7A 2HG4A 2P6TA 5IOLA 4BBYA 2R4FA 1X9MA 1AROP 2J9CA 4K4SA 1NBEB 2VKRA 5KFAA 4LF6F 4W4MA 4IO9Q 4KB7A 4H4OA 3J7AN 3I31A 1RAJA 2CNOB 1OMSA 4X4TA 4C0BA 2MKKA 2RDIA 1UZDA 3Q8VA 3FSXA 5T7LB 3D3BJ 5CQGA 1HD1A 4U96A 2QLBB 3I9ZA 2DIUA 3QFHA 1S10A 3PJ9A 2HLTA 3RB3A 3L3CA 1P1LA 3OW2R 1YZ7A 2HYIB 5C25B 3UI3A 1IKWA 1LW2A 3Q0AA 1Q7LB 2W9CB 4C2MA 3ITHB 2VG6A 2BJ9A 2OAUA 3OR2A 3FSYA 1IR2A 1X7VA 3OFFA 1FKOA 3HJVA 1R8PA 4C3KA 1RWVB 3BZQA 4OX7A 2OLWA 2B43A 4KGXB 3T19A 2YWWA 1B0TA 4FNHA 3ADAC 3NAIA 2WB1D 5A0YA 4ZPBA 4B3MF 1WOOA 1GXLA 2GV1A 2VV5A 2XSJA 1F9EB 4DQRA 4X4QA 1VRUA 1HNZF 2AEJA 3PKYA 4K0KJ 3BV8A 5E33A 5AXNA 4RO0A 2WAQD 3OSPA 2I9SA 2N82B 2XWYA 3LTOA 4LF7F 2AJ0A 2KO1A 2M52A 2C3OA 4CTAB 4H4MB 3BDEA 4M5NA 2A6OA 5GVQA 4AQYJ 4CLUA 1QVGR 3G2XA 4TQSA 4KKOA 2QL7B 3BBFA 5DG8A 3Q24A 4KHPF 1RAHB 2P5VA 3CCZA 2A10A 3BN7A 1UVIA 2CXEA 1UL3A 3TANA 2CKWA 4BLGA 2DHXA 1Y5LB 3VWSA 3DMJB 4DR2F 2JLFA 2XTJP 1NJWA 4JI8F 4GKKF 4NLYA 1BC6A 2G13A 4IG0A 3KG1A 4OZ5A 3AJ1A 1QE1A 5LMNF 5BYRA 1SC3B 3HD2A 5JMNA 3NL0A 2RUGA 3MM6B 1HMVB 1LWXA 2V8HA 1M1GA 1NO8A 1U09A 3OTCA 3IG1A 4HLBA 1S12A 4YB1P 5HI7A 2W7PA 7AT1B 2DNGA 1MNEA 1YRTA 6FDRA 2YNGA 3CDBA 1PO6A 2GJFA 1KD1T 3UCZP 4ID5B 2N4CA 1WF0A 4DV6F 1CLFA 3M2UB 2AYGA 3I0RB 1JKHB 3TJAA 3M8ZA 1GFWB 2VG5A 3M30B 2YWGA 2C2MB 3ZZOA 8AT1B 5CZVA 3DNCA 3MFHA 2E9TA 2H3EB 3AQOA 3UQSA 3HX9A 4A46A 3P45B 3G86A 5DDOC 3FNNA 2DCLA 5CAAA 2G1DA 2Z57B 3OXLA 5AE1A 2GIFA 2OEJA 3V81B 1A7GE 3V4IA 2GQCA 1Z4UA 3S7RA 1R8CA 5IT0A 3FEXB 3KLIA 4HDHA 3VAFA 1WD6A 3R6GB 4ZVUB 3W65A 3W63A 2P9CA 2FPHX 3TRGA 1X5SA 1NH8A 2HK2A 3VAKA 2R2SA 3CDUA 1X4CA 4JV5J 2XCPA 2XMMA 1QY7A 1WEZA 4OYMA 1NZ8A 2YKPA 4DX8H 1SI9A 1NJIT 5ETTA 2UXBJ 2RU3A 5JVHQ 1R6VA 4U8VA 4DN0A 4DR4J 1QVFR 4LBIA 4LFAJ 2BKOA 4DL2A 4Y6IA 4LFCJ 5LL6d 3DLBA 3R97A 3KJQB 1VQOS 1T05A 3DDIA 3FBCA 5KT6A 3GR1A 1M5SA 3M1VB 2O5DA 3ET6A 3S01A 4IG3A 2R7QA 4ZMMA 4X66J 4LR7A 2ABYA 5HVFA 3BGOP 3D28A 3CCSS 3IWNC 1DURA 1IBCB 3KYLA 3KNGA 5H9FJ 4F04B 3K59A 1XEZA 2D9OA 1IJFB 2WSFC 5F8LA 4Z7CA 4ZP9A 2DIVA 3BBBA 1SCJB 2Z56B 4LF4F 4A48A 1SVDA 5L1IA 1SQFA 2MSTA 5IQQA 3PHTA 1G6BA 4EWTA 3F44A 1HWIA 4OFZA 4F2RA 1C1BA 2FY1A 2B5JA 4NZ0A 1IBKJ 2NPFA 5HMYA 2X1FA 1M90T 3CO0P 5D0EA 2PEBA 1ULRA 4X65J 3WIUA 1N33F 5DG9A 4MYTA 3DLJA 3MMBA 3Q8RB 2IC3A 1JLGA 1NDCA 1FKPA 2KRRA 4AUKA 4LQ3A 4EEYA 3UWTA 2DPJA 5SZTA 3W61A 2LDYA 1T11A 4E8UA 3OLAA 2LXIA 1KHWA 2BW7A 1NPRA 1AZSB 5C7PA 1WORA 1ZTTA 3EMTA 2GJIA 5CYMA 1KTQA 2E5HA 1JQGA 2CRLA 1SJFA 4B9UA 4RW7A 4B3SJ 3VZIA 4K5RA 1WI8A 2QJ3A 4R5PB 3T6BA 4UZBA 1I1GA 4Y00A 4X62F 2CZVC 3V6HA 4ENOA 3HHKA 4B3TF 3GJTB 4CT8A 3QWUA 1LK7A 2F8HA 4Q8EA 4A8SA 4L3NA 4HL9A 2HNDA 3KK2A 1RWNB 2IRYA 3CGIA 3TA2A 1FXDA 3L7PA 4C8MA 4JI7F 2DH9A 2P6SA 3K57A 3I96A 3PYEA 1IKVA 2AZ3A 4B02A 2YH0A 2Y1LB 4EBEA 4RNNA 4WIIA 4FVCA 4ZPCA 1DTTA 1EARA 4NX9A 4PCQA 3HD1A 2BM0A 4P75A 3CVKA 5A6WA 2O66A 1XIQA 3V5RA 1Y3JA 1HBNA 1ZAWA 1X5OA 4DV1J 2A6MA 1F5BA 1F5AA 3M4XA 3QIDA 2LQ9A 2J8SA 4P52A 3EDRB 2MY8A 1NHKL 3MM7A 3TEHB 3A3PB 4LUBA 2V63A 3G6ES 2VJVA 1WF2A 1OYEA 3B4MA 2AX0A 1S1WA 4P2FA 3GG0A 4Q7AA 3THVA 1U6BA 2ZZTA 2G0JA 5EUHA 2DGSA 1HI8A 4DDFA 3D66A 2R2RA 2ILYA 2PIIA 2MEWA 3G8SA 2MXYA 4QR2A 3KKFA 4WFZA 3UDEA 2WONA 1WOSA 3MM9B 1U1LA 2N7YA 3HO1A 5CD4A 2HVZA 4R0EA 3PKMA 2ZH1A 1U0HB 4DI6A 4KHRA 2YNHA 2RS8A 3RR7A 2FQQB 3B78A 2WOMB 3N79A 3P49B 1S99A 5CZXA 1U1NA 4YUDA 1GTHA 4FDFA 3MPVA 2PEHA 3LP0B 1S9EB 3PFOA 2MLXA 1EETB 5KG6A 2PO4A 1RAAB 3LP1B 4M94A 2BZ2A 2IVFB 4QIGA 3AD9C 3ONQA 4MK7A 2C42A 4DCJB 3GWCA 2QRRA 4IH5A 3MTKA 1VR6A 3MEKA 1GQEA 3FUYA 2AF6A 3HDSA 4ZPWR 3H4DA 3CDEA 2DNMA 3VAMA 2GC8A 2YNIA 4Z37A 4LF9F 1DRZA 1S1TA 1Z2ZA 2CQDA 1LKZA 3RB0A 4B3RJ 1F9FA 4J9NA 4NPOA 2QGFB 4DL5A 4DR5J 3LGHA 4TYBA 4CH1A 3FGVA 2CQHA 2F3JA 1KQFB 1O8BA 3TAMA 4IQMA 4PUOA 1QM9A 3ETMA 1VRTB 3ZXWA 4J9RA 1X0FA 2C3PA 2HVHA 2E7VA 4DU7A 5J2NB 3MM8A 1Y9OA 3K89A 2CNNB 5EDWA 4LSZB 4M5JA 3UR3C 1RWKB 4R8UB 3LOUA 5F8JA 4NMLA 2HHVA 1U2FA 2CFXA 4ZDNA 1U25A 1FRLA 5B7WA 1QAJA 1PIEA 5I3PA 3J7Z5 1MU2A 4C3MA 2E5IA 5K8NA 1B4SA 3DDNA 5IT4A 4ECVA 2LECA 3BYRA 3M8WA 4J9SA 2H48B 1WHYA 2YKAA 2J7KA 1F9HA 4KJIA 4ANDA 2VFRA 4Q43A 1SJ4P 1RT6B 1XBWA 3QBCA 2RILA 5KFOA 3A8IA 1URNA 4MFBB 3BM7A 2WVFA 2CPZA 3BREA 2AEMA 2QA4S 4Y65A 3T1YF 2MGZB 4LQ9A 4WWSA 2IDLA 4C8NA 7FDRA 5KFSA 1Z2LA 2D69A 1UW9A 2HBYB 2LA6A 5H9EK 1UVMA 4JV1A 5C2CA 4L72B 1XWLA 1GK8A 4KHPJ 2YNFA 1HKAA 3EWGA 4IFVB 1LWEB 5D3GB 1VQPS 1RQ0A 3SFUA 3I56S 1UEVA 9RUBA 2DB1A 4UUXA 1HI0P 3UO0A 1FDDA 2RQ4A 2Q6CA 2IM1A 3KMSA 4JI8J 4GKKJ 1OYDA 2PD1A 4GC6A 3MEEA 3SCLE 3PZPA 2V0NA 4A8OA 4GVBA 3OHAA 1AUSL 1NB7A 4QQBA 2UUAF 1S72S 4LF5J 1R3NA 1VS3A 4P9SA 1GXUA 4Q2LA 1P8GA 2LEPA 3FBEA 1VDHA 4OI6A 3I55S 2IMWP 1T95A 4OYAA 4DEZA 1T94A 1VQSA 4U7UK 2F8EX 4EMDA 3V4MA 5E0OA 2F1FA 1MLAA 3TEGA 3J80U 2OSRA 5EN1A 2BDPA 4DPUA 1GMVA 1Q5VA 3DRRA 2OJ3A 1S4FA 2HQFA 1PYOB 4LF8F 1G4CA 2D9PA 4PWUA 3CO9A 1DJ0A 2H5IB 3A8EA 4J9PA 2KB2A 2IVMA 1U1MA 2PMHA 3CJ2A 2W8KA 1EIYB 1N36F 3V6JA 3NS7B 1CULB 1F3FA 4AXJA 1TVRB 2E1AA 5E3RA 2HFZA 3M9NB 3UE2A 3M6XA 2CJXB 1N52B 3D0GE 4CT9A 4CLWA 2ZHBA 5KFMA 4ZPDA 4X4OA 3AOCA 1DTQA 5A8KB 4F36A 2HWHA 4GMKA 1CSJA 5KFVA 4BS2A 4TQRA 1Q53A 1UFWA 3EZOA 4F4AA 2QT7A 2U1AA 4FPIA 2W4DA 2G2YA 2QSWA 1F60B 5J2PB 1XMQF 3A12A 3P5TL 1WDTA 1U6ZA 4PG6A 3OD2A 2NLWA 1VHFA 2BJ1A 1HYSA 3TAPA 2DGXA 2APOA 2QLWA 2KJVA 4A47A 1MMDA 1UJ4A 4ZLNA 2IRUA 4UW2A 1WKJA 3TVYA 5L9XA 3EVOA 1Q8IA 3BO4A 5ETOA 3GJRB 4KIAA 1HWJA 5FD1A 1Q4RA 1U6FA 1TL7B 1XJWB 2VUGA 3EJMA 2FYXA 1HFEL 3UD3P 4F02A 3ILJA 2EFVA 4J9QA 4EI2A 1BQMB 2FLOA 5SUHA 2M5YA 4TY8A 2DXDA 3C6UB 2R7UA 1X4HA 2L41A 4DSEA 4OYBA 3BPSP 2C2NA 5D4PA 3RYLA 2ZFHA 1VFJA 2RRNA 1KTVA 2UU9F 1CS4B 2IJRA 2RQKA 2X3GA 4DV5F 3IRWP 3GSIA 3TNVA 1EZZB 3DC2A 3ZZRA 1S0MA 1RT7A 3KWMA 4DS4A 1N33J 3Q2SC 3UN3A 2J9DA 4M5GA 3CW2C 2VONA 4V1Ak 1RTIB 1YK9A 3PX6A 3PCOB 1CJUA 1ZA1B 3JQJA 2RT3A 1SV5B 5KFDA 2HGLA 1S1XB 5IC4B 3OL9A 4BC7A 4EK2A 2CUYA 4F2SA 1RABB 1KQSR 2OO4A 3TUJC 5DZ7A 2I1RA 3GR0A 1D0EA 3K5OA 2VQEF 2XULA 3X3UA 1K47A 4RU9A 4JV2A 3DRXA 2DHGA 2H54B 5LXRA 4EZ6A 5BYQA 4YQWA 1S77D 3MCSA 5HMXA 4B3TJ 1TAUA 5E2QA 3NNCA 1X4EA 4FF1A 2NXCA 1ZPWX 3W62A 3T5HA 1K0TA 5D6GA 2YTCA 3B54A 3OPKA 4JI7J 1ZM9A 3HVTA 4FS2A 1SC6A 4N47A 4XK8C 3AB2B 2C3UA 5DRKA 2GFFA 2R7WA 1FHTA 4BC9A 1JWWA 2PFFB 3M8QB 3O44A 2B3TB 3GCXP 4NRTA 3SYZA 2VIHA 1HI1A 4LR9A 2RKIA 4CO1A 1J5EF 3CMQA 4AD6A 1PC4A 1NK5A 1L3UA 4DHVA 4K4VA 5HBMB 2I2YA 2JH3A 1VBZA 3QJJA 1FFGB 4H4OB 1JLFA 5KG2A 3N5FA 4M5DA 1Y0HA 2SXLA 5KFWA 4DSKA 4MKYA 1JLQB 4IQXA 2NUUG 2DK2A 2GVZA 5F9NA 3SZ2A 3VGVA 1BQNA 2VBZA 3RU0A 1PBAA 1RAIB 1H74A 1RHRB 2J76E 3BS9A 3TVZA 4KV8A 2JEFA 4EO6A 2BJDA 3MEGA 1UETA 4NLGA 2QN6B 4RNMA 3GIMA 3CJSA 4B9LA 3MR2A 3MMAB 2KXHA 1IKWB 1QUPA 4QWAA 1PAEX 1KVJA 4ZCIA 1T9YA 1PAUB 2LCWA 3PDNA 2AJQA 5D4NA 3TP2A 1KQKA 1FKOB 3BKTA 2BR0A 2R7OA 1XMOF 2GMLA 3ZZ0A 2L9NA 2FJWA 1S7HA 1MWYA 4CLZA 3AOBA 4JYAF 3WHIA 4WE1A 3H5YA 4A4JA 3HVWA 1DQ9A 1XK8A 3OL8A 3NRBA 5A0YB 1RGVA 1IQZA 5CYQA 3TX8A 4BDPA 1A6LA 4OHWA 4RPFA 2QL5B 3AXKA 4ZPVR 1J5OA 2HHSA 5EWFA 1VC6A 2WHOA 5IWAJ 1QUVA 3AFGA 5HATA 2P2CB 4NLWA 4KGZB 3SQGA 1WWHA 4ETXA 1PKUA 5JUMA 1N8RT 4CIOA 4QR0A 1C0TB 1NJYA 4LF9J 3EGVA 1JK9B 3P4UB 5T7LA 4RBTA 2MZSA 4IH7A 4USWA 4JI4F 4U8YA 2A0FB 5F9LA 1WC3A 2RMLA 4G65A 4KTQA 3U1LA 1Q79A 2JC0A 3SDEA 1K0VA 2ZKTA 4CNZA 4IG0B 1HBOB 1E6VA 3R2DJ 2J7WA 2W9AA 2KG0A 4N77A 3NWGA 4QIFA 2QG9B 2D41A 1RYRA 5E5NA 1ZM4A 2UVVA 2YWHA 4ELVA 1LEOA 1N48A 1G2EA 3DOKA 4DR1J 3IG1B 3OVBA 2X1GA 5DJBA 4WP8A 2ADBA 3CCMS 2BJ8A 2FIUA 2ASJA 3ZZTA 4X4UA 2FHJD 1XN9A 2BKNA 3HHLD 2HKEA 3NOCA 2VBXA 3OSNA 3D68A 2F40A 2K2PA 1XQIA 2W25A 4ZVTB 2KFNA 2RDJA 2VG5B 1Y7PA 3SSQA 2PMZD 1S5ZA 3D5MA 1RT1B 4B9TA 1V5VA 4ZPAA 1FO1A 3U27A 3AJ2A 4H4MA 4JI2J 4E0DA 3LH2S 1JJ4A 2ZM6F 1TL1A 3J81U 4RL1A 4F67A 4ZLJA 1FNXH 2BJ7A 1RWWB 3D7SB 2MJNA 1LOUA 2R2UA 3AOAA 4F3QA 3HSDA 3KLIB 4JI3F 2VODA 1R0AB 1HR0F 1XERA 1U7LA 2CADA 3RRKA 2Y1JA 2BANB 5KFGA 5CCMA 3X1LB 3S8SA 5KTQA 4NRUA 3GYNA 4LRDA 1Y3KA 1UPMB 4CH7A 2Q6BA 2V8PA 1KN6A 3VF0B 1KEKA 3A8JA 4HI2A 3MM6A 2V34A 3JS9A 1HMVA 2FTRA 5HSPA 1RE1B 1SJQA 1Z1ZA 1PBUA 1T05B 3UPFA 3BKUA 5KFQA 1U1RA 3LAKA 3HHDA 3PW5A 2E1RA 4ID5A 1RCOB 2VOPA 3MOZA 3FCWA 1RP5A 2EK1A 3I0RA 4EO8A 4QIVA 2HVDA 1BLUA 2IYIA 3R27A 1AB8A 1AW0A 2K06A 4ZVEA 1UJ5A 2IM2A 4WBFA 2DD8S 4I56A 2LA4A 5DQHA 5HL7Q 3NEKA 4NLSA 3V81A 4UT4A 2G9OA 5DGAA 3MMBB 4CLPA 1KKHA 2IC3B 1JLGB 3C46A 2BQ3A 1OPIA 1YI2S 3JTOA 5DM6Q 2HHWA 1YJNS 3PYFA 5C5JA 3PFEA 2RQCA 3QAUA 3HM9A 4K4WA 2KHDA 1XTZA 3O8WA 5CYMB 1G7CB 1RBAA 2CAJA 3MCOA 4UOCA 3UD5A 4DLEA 1RBLA 3BR9A 4RW7B 1W7WA 3G82A 4JI0J 2ZBRA 5K8OA 3R3TA 4DR3F 4KGKA 1WI6A 5A2QU 2EI5A 4C11B 4Q8FA 1H7XA 1T9VA 3ISNC 3KK2B 2HNDB 2E1MC 3M1VA 2DHSA 3JB9k 1N5YB 2OSQA 3CF5Q 4NLUA 4JI6F 3U02A 4DN9A 1V6HA 1WEYA 5KFEA 3CE8A 4A8MP 1S0OA 3HXMA 1HHSA 4KPCA 1DTTB 3TZYA 3PW7A 2AJ1A 4NXMF 4DL0C 1HBNB 1RAEB 1U49A 3HT0A 3D4JA 4NASA 3VGUA 5GMKa 1R27B 3KMQA 3MPWA 3VAHA 2DJWA 2CDRB 3SV3A 4DCOB 1Q1KA 2MQ8A 3JAMY 2DVIA 2GVDA 1QDUB 4ZHRA 1S1WB 4DSJA 1IKYA 5A8RA 4FYXB 4EZ9A 4RNFA 2UU9J 4KGMA 1AZSA 4PG8A 2BKPA 1KR4A 2KXFA 4HTIA 3D0HE 3T3FA 4RJVA 4OI3A 3MUTP 1UWAA 4OHXA 1S6QB 1FDNA 2CYYA 3ZZUA 2KM8B 2G2ZA 2X51A 5DGBA 2RHSB 4ZCKA 2ZOGA 2ZVSA 2DRBA 3NBPA 3FC9A 1JJHA 2J0QD 3BB5A 4LRCA 5I4MA 4IRKA 2XYHB 4FKYA 5F8GA 2YNHB 4DPWA 1A9NB 1PILA 2LDIA 2XY7A 2D3O1 2W2NP 1U1KA 2NXNA 2P9GA 5HLFA 2X3DA 2VQEJ 2KT2A 3HFVA 4FS1A 5THWA 3R5GA 1MN7A 2E5JA 1U24A 2UZAA 5KFUA 2V50A 3EUNA 3QGPA 4LSNB 1UA0A 1GT8A 4DWIA 3BSAA 5KFJA 4GC7A 5KFRA 3EYZA 4MK9A 2ACYA 1XR5A 4RUBA 4FP9A 2FJAB 4OHZA 3QQCD 2XS5A 3SCIE 3GB0A 2V8VA 1WHVA 4LVNP 3RBEA 3KK1B 5A8WA 4WK1A 3ENVA 1VLYA 4YR3A 2DNZA 3MMJA 2UXDJ 1S1UA 5D78A 4K4ZA 1FNMA 3OFEA 2Z2YB 2PC6A 3AQPA 1L3VA 5L38A 3CJ0A 2DNQA 1D09B 2OMOA 2QLFB 2I6WA 3N4WA 2LQJA 1CPZA 2E5GA 4B9VA 3MM9A 3ZTSA 1U0HA 3LA0A 5BYSA 3MM8B 2M4MA 3GIKA 3FMWA 3R5CA 3PR4A 1L5UA 4G1PA 4LFBJ 2HAIA 1S9EA 5KG0A 4C8KA 1GX5A 3HSJA 2XMJA 2G0CA 1N5TA 3FCVA 1MU2B 3LANA 2B7CB 3BO3A 2MYFA 2KYZA 1WKLA 1HIYA 1QAIA 4EU0A 3MI7X 3RAQA 3DOLB 3KUGA 1RWOB 3P5BP 2HFNA 4F4ZA 1REVA 1CBKA 3KLHA 4FXDA 5DLGA 3DN9A 3N01A 5KT5A 3BH7B 2QEXS 2NXJA 2BABA 3GFHA 2DNPA 1HD0A 1IBMJ 2XYGB 3CJQA 5EX0A 1TKDA 1YJWS 2B8PA 2IPOB 3IFEA 2HLUA 5DDRC 1RZMA 3WDOA 2M9KA 1X4FA 3UVJB 3MUMP 2JVOA 1N54B 2NSCA 1O6XA 2DEIA 3BYPA 1TKXA 3OL7A 3I4HX 3KJVB 3BGRB 3BKFA 2YPZA 4YEAA 4L75A 4ECUA 2YNFB 3LGMA 5CD4H 3U1NA 1KLNA 2R42A 4K7QA 5AJ3J 2QA2A 4BHQA 1R6YA 3OTOF 3NCQA 2XM3A 4MJKA 1S0VA 3UDVA 5IV4A 2P9EA 4NEYA 2DR7A 1WG1A 3M6UA 4ZCMA 1FEHA 3MEEB 3DGPA 3TO8A 1YBUA 3LW5C 4M5KA 1Q81T 2QFIA 4GVBB 1FTRA 5ETVA 2V6AA 3H7HB 4KYZA 4NL5A 3VAGA 2YWEA 1NKCA 3M8RA 1IWGA 1OSDA 1RU1A 5HANA 2V4QA 1RISA 1QTNB 3L7OA 1RT6A 1WSVA 2UXCF 3TA0A 2DBBA 2B0GA 4YHHJ 2ZJQQ 3DCAA 2ZBCA 1BQXA 3MR5A 4MFBA 4HVZA 4LRAA 3R5AA 1V3SA 4XDDA 4KBIA 2ROPA 1U02A 4UUWA 3DRRB 2E5LF 4CRJA 4DCPB 2FHKA 2MGZA 1FRHA 1SH3A 2IDEA 4ED2A 1IM6A 2PDAA 4CLLA 1BGXT 1VC5A 1HNIB 1NHUA 2MB0B 3WQPA 1VQNS 2NYIA 2OMLA 5KFBA 2HS3A 4C48A 2IRXA 3BGFA 1BWEA 4GKJF 2ZM6J 1X5PA 3PW2A 2KHCA 3M8SA 4DUZJ 1FJ7A 2Q66A 3SI8A 2FDNA 1TU0B 1YJTA 1ZBTA 4E98A 1DTQB 1HR0J 2HHTA 4HT5A 3N9UC 2B51A 1RHMB 2MQLA 3N28A 3GSDA 1W25A 1WEXA 2JEJA 4C7QA 2NSBA 4K2JA 3QJPA 5HP1B 5KFIA 4ICLB 2E29A 1YBTA 2ZC4A 4JOUA 2BV3A 2QC3A 1N34F 3ILIA 2WBRA 3CB4A 3P96A 1KDNA 4Z2XA 1SKUB 1I5OB 1BMQB 3GMGA 2LQ5A 2R8GA 2YX4A 1XR7A 4I7FA 2DNRA 1S9GB 2UVUA 2IJNA 4MIBA 5L1LA 1UKUA 1FCAA 4M5IA 3W1YC 3OR1A 2LXUA 1FF2A 2DH7A 4TY8B 4YDXA 1VRQC 5GAEI 4J5OA 2H9ZA 1YJ9S 1JNZB 1B70B 4DJBA 4QYRA 1HQUB 1IUJA 3W8PA 1F3VA 5KFTA 2GNKA 4F4YA 2IM0A 2B8QA 2CPIA 2YQ3A 2HWIA 4RWWA 4XIUA 1UEUA 1O5JA 1GMWA 1D9DA 4KAIA 1Q78A 2R8HA 1CULA 1WG4A 1RT7B 4IDKA 2AEFA 2FZCB 4OZ0A 4WU3A 1M5OC 3DI6A 1U2CA 4AYBD 4ZJQA 1DZ5A 2FLNA 5A8KA 1CJUB 3Q8PB 1U45A 1UJ6A 2H51B 4X64J 4P71A 4WIQA 1EP4A 4MH8A 5BR8J 1V3RA 2F5GA 5J2PA 4J90A 2DGWA 4CCHA 3H2UB 2NUHA 2JHEA 2FHOB 3DRSA 2DGTA 3M6WA 4OZNA 4F3OA 2LLZA 2AKWB 2MKHA 4WCEQ 2O3DA 4K59A 2HHQA 2ZDOA 3M8YA 2HS4A 3D2WA 4PYAA 4PPZA 4DR3J 5B0AA 3MDFA 5ETQA 2ZH5A 3DRPB 4PPDA 3ZFVA 3ZNUA 3W9JA 3MEDB 3BR8A 2LP4A 4DV4J 4ED8A 1TL5A 1CC8A 4LBPA 1NXIA 3C66A 1IJEB 4DZ6A 4JI6J 1PYSB 1FFSB 3HVTB 1K9MT 4PAAA 4PXBA 5GADI 1FJEB 2E7XA 2VG7A 1ACMB 3T41A 3KK3A 4IO1A 2D3UA 4OV1A 2M0GB 3K17A 2RIJA 2GO8A 3M9MB 4WJBA 4L6V3 2AJ2A 4NXMJ 2KVIA 1H2TZ 4USVA 1R89A 1VJWA 1XNQF 1TMJA 1YHQS 3H5SA 4U7CA 4Y2KA 1FWPA 2A2DA 4MIWA 1VQLS 1HHQA 1JLFB 4UY85 3JQKA 3KDNA 3KFWX 3CPWR 3VGTA 1SKRA 2DPIA 1PJ7A 4N7TA 3Q8YA 4N56A 4NI2B 3NCPA 1BQNB 2GJ2A 2C2KB 1SV5A 1S1XA 2YVSA 4RZRA 3EPGA 3W8GA 4U67Q 2AU0A
chains in the Genus database with same CATH topology
2KB2A 3LP1A 2G4BA 2CG4A 5KFYA 4J9KA 2IVMA 1U1MA 4MYUA 2IA6A 3RR8A 4NLPA 2ZOMA 4NA2A 5KT3A 4PG7A 2PMHA 3OJUA 3CJ2A 2W8KA 1X0PA 3MPYA 1YIJS 1XNRF 1N36F 4O4GB 1R8HA 3V6JA 2K7KA 1KHVA 1CVJA 3O2IA 4ITSA 4ECZA 1MSWD 1VC0A 3G4SS 1LXNA 4HHJA 4PXEA 4DQSA 2IA0A 3CCTA 4AXJA 1TVRB 3QZ8A 2E1AA 5E3RA 2EVZA 2HFZA 3M9NB 3UE2A 3M6XA 3OQ2A 1N52B 3D0GE 4CT9A 1HQEB 1P1TA 3I82A 4MMOA 3K58A 5GAGU 2YH1A 2ZHBA 3L09A 1AUDA 3G71S 2MQMA 5KFMA 1VQ8S 1CQNA 4AQYF 2XEXA 2HNYB 3CJ3A 4ZPDA 4X4OA 4FYDA 4F8RA 4M63A 1OPZA 1LV5A 3ZZPA 1DTQA 1JX4A 2HFOA 1JJ2R 4J37A 5A8KB 4WE1B 2XLJA 2BRKA 1TFYA 2HWHA 2PA3A 4GMKA 4Y2AA 1CSJA 1Q16B 5IQ6A 5KFVA 4BS2A 3J7A1 1FK9B 3QWPA 1P9QC 4TQRA 1KQGB 1Q53A 4I2PA 1UFWA 2B9XA 2V4RA 2MPUA 2J9EA 2QT7A 5B0CA 2U1AA 2PSZA 2ZH2A 2W4DA 2QSWA 3RTVA 1F60B 2KG1A 2RD5C 3M8QA 5D4LA 1VQ4S 4WTYA 5J2PB 1LWCA 3EZUA 4O3QA 1XMQF 2XMUA 4U9RA 5T14A 3P5TL 1U6ZA 4PG6A 1APSA 1HNXF 1NNDA 3LWMA 2NLWA 3TW0A 1HA1A 2HRYA 1J5OB 1HNWF 2ZOFA 3CCWA 4PRFA 2JVRA 2ZNYA 4I0WA 1VHFA 1UVLA 1SUQA 1HYSA 3TAPA 4NLDA 5FDLA 2XO7A 2DGXA 2RB7A 4I67A 2APOA 5DETA 3E51A 3ZZYA 2VFVA 1H2VZ 2QLWA 2KJVA 4A8QA 4A47A 1MMDA 1UJ4A 3J7ZT 2IRUA 4LIWA 4UW2A 3K2YA 1U4BA 1YJUA 2BQUA 3TVYA 5L9XA 4ED5A 4I2QB 3I0SA 1U2RA 2R2TA 4OX6A 4AL5A 3H2LA 2IAJA 4I6AA 3BQ1A 1Q8IA 4KHMA 3BO4A 5HBMA 5CYJA 4KIAA 1HWJA 5FD1A 1Q4RA 1U6FA 2VUGA 4QPXA 2KI2A 3SQGB 1VRTA 5KFXA 3FDSA 1HFEL 4RUHA 3AH6A 2CJQA 2HNZA 1Y5IB 3E3XA 3UD3P 3CD7A 1HW8A 4F02A 1IXKA 4K5SA 4ZLPA 4DSIA 3IA0A 5J2NA 2K7JA 3PW0A 3VALA 2VL1A 4G1IA 4LIRA 1JLQA 3DLHA 3C6TB 2EFVA 1IR0A 4FVMA 3CCJS 2Y1RI 4J9QA 4RW9B 2OPQB 3CCLS 1BQMB 2FLOA 4NZ6A 5SUHA 2M5YA 4TY8A 4D3GA 2W7OA 2ZH8A 2FVQA 4IRCA 2N4DA 4R8UA 2ZD1A 3C6UB 1VQKS 2DNHA 2JSXA 2R7UA 1X4HA 5C24B 4J9OA 1VQMS 2L41A 2FVCA 4DSEA 4LMZA 3J7YI 5D4PA 1RTHB 1MMNA 3RYLA 2UVRA 2B6AA 3HLUA 2ZFHA 1ROFA 1VFJA 3H25A 1IKXB 5HMWA 3R1HA 3QGIA 4USHA 5B0DA 1WACA 5LT5A 3QGGA 2RRNA 1FXRA 2OPRB 2DO4A 1J2VA 2M3DA 4OL8A 1KTVA 3OHBA 2UU9F 1P6TA 3MZIA 2MKJA 4DL3A 3SDEB 1FA0A 2EFOA 3M2RA 2RQKA 1FRIA 2X3GA 2HGMA 2BW2A 3CC4S 4DV5F 3UNGC 5E3CA 3IRWP 3POTA 5DDQC 3TNVA 3FFIA 3MMAA 2EWHA 3JSMA 3MTJA 4X4NA 1YJVA 1E6VB 4QWDA 3CD5A 5IFMA 1RTJA 3DC2A 3IRXB 3ZZRA 4IRDA 2W9BB 1X9WA 1H38A 2ZH6A 1X4GA 4AFFA 3ETOA 3NMRA 1S0MA 1RT7A 3KWMA 4DS4A 2YKMB 4AL6A 1JXEA 1NH7A 5E7OB 1YQHA 1IN0A 3MR3A 3Q2SC 2J0WA 2J9DA 1JXLA 3CEDA 2FGCA 1KSPA 4B9SA 1WHXA 1UVJA 2VONA 4DFJA 2UUBF 3BJYA 3DOKB 5LJ5Y 1RTIB 2K1RA 2EFGA 4QU6A 3PX6A 3D1OA 2XS7A 1FE0A 4O44A 3VQTA 4H4KC 1TP7A 2V8GA 2HHHF 1HBMB 2D3ZA 3DDKA 2RT3A 1VI7A 1SV5B 5KFDA 2HGLA 2XMTA 1S1XB 2YX1A 3WC0A 2PN6A 4DUYF 3OL9A 4BC7A 4O3PA 3NMAA 3HHNB 2DH8A 2VFUA 3SV4A 4ECTA 2OPPA 4F2SA 1Q8BA 3NG8A 3UCUP 2M2BA 1KQSR 1NK6A 2OO4A 1S79A 1C1CB 3VTIA 4XPEA 3TUJC 2CPFA 2CPJA 3DLGB 2I1RA 3GR0A 2UUCF 3NLCA 3T9NA 2RRAA 1D0EA 3K5OA 2VQEF 2XULA 1T8EA 1NZAA 3X3UA 4JV5F 3TYTA 2EG2A 4RU9A 3QO9A 3T9ZA 1LW0A 5K5MA 4JV2A 3DRXA 2DHGA 4O4RA 5IWAF 2BE2B 4USIA 1ZM3A 2JZ5A 3FJ2A 1QTMA 4XO0A 4OX8A 5LXRA 4EZ6A 4PQUA 2KZZA 2KKHA 2MSSA 2FVPA 5BYQA 5EX3A 1AXQA 2F4VF 4YQWA 1S77D 3DYAA 3GG1A 3MCSA 5HMXA 3IR5B 2UXBF 2BQRA 1CG2A 1TAUA 1T02A 3QIPA 5E2QA 4EBCA 2Z8QA 4DR4F 5LMUF 5KT2A 3MM5B 3NNCA 1ZPVA 1NU4A 1X4EA 4FF1A 1N5QA 2LMIA 3K0JA 4IFVA 4HTJA 4LFCF 3LALA 1ZPWX 3T5HA 1LWEA 1P27B 4DPOA 5D3GA 1K0TA 1C0TA 1TL1B 5D6GA 4RW8B 3EGNA 4UY8T 2YTCA 2CZ4A 1RTDA 2AYMA 1JMTA 3T5LA 3OPKA 4CO3A 4QU7A 4X84A 2VPZB 3CWJA 2CJBA 3J7YU 1ZM9A 2J6UA 3J80Y 3E01A 3HVTA 5B09A 4DL4A 4ZS6A 4FS2A 2JRSA 4G6VB 2Z4PA 4ED7A 2QLXA 4NOHA 1SC6A 2GMJA 4N47A 1H0HB 1OO0B 1B0PA 1MWZA 2ZITA 3AB2B 2C3UA 3HVAA 4XK8C 5DRKA 3MD3A 3OBIA 5M2UA 2GFFA 2VOOA 2R7WA 1FHTA 3QLHA 4BC9A 4DSFA 2QA4G 3ISZA 1JWWA 2PFFB 3M8QB 2C3MA 3CD6S 1LWCB 2BJEA 3O44A 1FRMA 1U26A 2L48A 1S6PB 2B3TB 5L1KA 5I42A 4NRTA 3DLEA 3MXHP 3SYZA 2I0XA 1HI1A 2KU7A 2CPDA 1M5KC 2B4OA 4OX9F 4F3MA 1HYSB 1AFJA 2RKIA 1TV6A 5FDLB 3TOQA 4DFKA 1NK0A 1DLOB 3BQ0A 2LQBA 3ZC4A 1RT4A 2GX8A 4OMFG 4CO1A 1C0UA 4DV2F 2RSQA 4NZ7A 4DV7F 4EYIB 4DL6A 1J5EF 1HBOA 2R7TA 1HL6A 1PC4A 2AJ4A 1NK5A 3MOJB 3IS9A 3AB4B 2IAJB 4K2XA 4M8LA 1L3UA 4X4SA 4DHVA 4K4VA 1F2GA 5HBMB 1S0NA 2I2YA 2JH3A 1VBZA 2BYCA 5K8MA 1K1QA 3CULA 4N8NA 3W2VA 3QJJA 3JSBA 4H4OB 2DNLA 1JLFA 1FDBA 1SH0A 3H8YA 2HNZB 5KG2A 3N5FA 4PWDB 3H2VE 4M5DA 1Y0HA 2SXLA 3CIZA 1Y00A 5KFWA 2VB6A 1RT5B 2JEIA 5J1EA 4DSKA 4MKYA 1WG5A 4DR1F 1N5VA 1OWXA 5GAHI 1JLQB 4IOCQ 2NUUG 2DK2A 4ECSA 4IQXA 4KFBB 4IFYA 2O67A 5F9NA 3PRDA 3G8TA 2LKZA 5M2RA 2KT5A 3SZ2A 2CQ0A 1ZM2A 1BQNA 2VBZA 3RU0A 4P6QA 2ZD1B 2HS0A 2PA8D 2XLIA 2AGQA 2J76E 4DV3F 2FJEB 2KYXA 1UMJA 4RNOA 2R7SA 2OKQA 2B6AB 4O0IA 2ILZA 2MZJA 3BS9A 3TVZA 2QIFA 4KV8A 2JEFA 4EO6A 4QBUA 3N5BA 3HFKA 2VASA 4FXVA 2EW9A 3U7JA 2BJDA 1HNVA 3WBZA 3MEGA 1IBLF 2UUWA 1UETA 2IYGA 1OQ3A 3QPIA 5L39A 3T6JA 1SH2A 1JLCA 4ECXA 3M2RB 4NLGA 2ZHAA 1FD2A 4RNMA 4TY9A 1OQ6A 2L9WA 3GIMA 4EUVA 1T7PA 3POTB 4C98A 4B9LA 3MR2A 3EGWB 4O4GA 3MMAB 5HN0A 2KXHA 1IKWB 1QUPA 4QWAA 2HMIA 3C3LA 1ZH5A 2ALZA 4DV0F 2CIMA 4W90B 1LQ9A 1KVJA 4ZCIA 1TL4A 4B3SF 2LCWA 2WTFA 2FHMA 1TVRA 3PDNA 5D4NA 2AJQA 2XBPA 4QIWD 1RT1A 1KQKA 1Q8LA 3TP2A 5LSOA 4U6PA 1LFWA 2N3LA 1FKOB 4PQAA 2BR0A 4JI2F 3PEJA 2R7OA 1XMOF 1I6JA 2GMLA 2W4PA 4RW4A 2K3KA 3ZZ0A 2L9NA 1D9AA 3BF4A 2FJWA 1S7HA 3IWXA 5D8HB 2J0XA 2R7VA 1RJJA 1MWYA 1YSJA 2ATLA 2DR5A 2VA2A 3OUYA 4IOBA 1RKJA 1H98A 3GIJA 4JYAF 3K8VA 3GV7B 3H4BA 2K1RB 4PKDB 1VQ9S 3UW1A 1VOMA 5IM0A 4WE1A 3H5YA 4O44B 2X1BA 4A4JA 2JDJA 3HVWA 1DQ9A 1I94F 3GE9A 1N4LA 1FK9A 1XK8A 5MAOA 4Y0FA 3OL8A 2DNOA 3NRBA 4O23A 3MMCB 5A0YB 1RGVA 1IQZA 5CYQA 4FF2A 3OFGA 1TFWA 2MHNA 1YRXA 2A18A 3TX8A 1PSDA 1IQTA 1R0AA 1TKZB 2R9LA 5DS7A 4BDPA 1UVKA 3H20A 4C8OA 3IXQA 2W24A 2MQQA 1A6LA 5U47A 2RQMA 3BN4A 4OHWA 3KTQA 3I32A 3DLKB 5LSLA 2RS2A 4GO5X 4ETZA 2BANA 4PG4A 4ZPVR 2X1AA 5KG4A 1J5OA 1VIXA 5EWFA 2HHSA 2BRLA 1VC6A 3JSYA 1GH8A 5J2MB 3CMES 2OPSA 3TA1A 1LW0B 2FB0A 3V6DA 4RWXA 2WHOA 3CUNA 4DQIA 1U1QA 4HDGA 5KG3A 2WBMA 3CCUS 4FBUA 1QUVA 3RBDA 4QIEA 4JI1F 1D9FA 4ZPTR 4I2QA 1D1UA 2GA7A 4NLWA 3IN5A 3QJLA 3THTA 1FJCA 5HROB 4WU2A 2Q43A 3HHEA 3SQGA 1WWHA 3QIPB 3WZ0A 4ETXA 2CPHA 4ILLA 3LP2B 5JUMA 4DV1F 1N8RT 3I5BA 4CIOA 2BOPA 1W2IA 5KFCA 4QR0A 1C0TB 5DQGA 3PXGa 1K8AT 1SL2A 2XWXA 5EHHA 1NJYA 2OPQA 1HW9A 2GO9A 1BY9A 1V3ZA 3R5DA 4ZVFA 4F4XA 3UD4P 1BQMA 2CJ9A 2O01C 4WFNQ 4JV0A 3Q8QB 4URGA 2PI5A 3NNAA 2VBWA 1JK9B 1NK4A 1LXJA 5T7LA 4RBTA 5J2QA 2VH7A 3C6UA 2MZSA 4IH7A 2ASYA 3JTPA 1KLMA 1TQLA 5C24A 3CJKA 4UQTA 2GGPA 2J5AA 4JI4F 1B7FA 1ZTWA 1RTHA 2CQPA 3F41A 1T03A 2LVWA 3QLHB 4CO5A 5F9LA 2XY5A 3I6PA 2RMLA 2MMYA 1CQMA 3UFCX 4KTQA 4OHVA 2B9YA 2M8DB 3P6YC 2HQIA 1W2BR 3U1LA 2V2KA 3BSNA 2C2EA 1C4AA 2YWKA 2OPRA 1Q79A 5LXYA 5I42B 3KHGA 4FZVA 4FN5A 5KG5A 1RA7A 1K73T 4O3SA 3DLEB 2JC0A 4Y2IA 4FF4A 4ZVGA 3SDEA 5L9NA 2Y0SD 2B4PA 2RKIB 5LSRA 4OJ3A 2VQFF 1K0VA 1H7WA 3MUVP 3IAS9 3QGHA 3NGDA 1RT4B 2ZKTA 4CNZA 3RB4A 2FLLA 4IG0B 3GFXA 5K9FA 4LSLB 2IBOA 1C0UB 1HBOB 4TN2A 1E6VA 3RAMA 2YWFA 5C42A 3IS9B 3PY8A 3IRXA 1SL1A 2J7WA 3TUZC 2GQQA 3JSRA 2KG0A 4N77A 2W9AA 1ZZFA 1DHMA 3NWGA 5AE2A 3GFZA 2CQ2A 3O3LA 1RYSA 4TU9A 3W2VB 1FNOA 4Q0BB 5H1SV 4QIFA 2D41A 1RYRA 1LWFB 1N5SA 3R5BA 5E5NA 4M5DB 1ZM4A 2UVVA 2YWHA 4IYQA 4KC5A 4ELVA 5K14A 3HMJG 2F7VA 2WK4A 4HYKA 3LWLA 2JFDA 2I5JB 3RRGA 2H5EA 3PACA 1N48A 5M2PA 1G2EA 2DGVA 3DOKA 4IFYB 1GTEA 5IT9Y 1TKTA 1RTIA 3IG1B 4HH0A 5F0WA 3OVBA 2X1GA 3DXBA 4I68A 3MD1A 5DJBA 2NS1B 2BM1A 4OJHA 3EX7B 2VPXB 1F0XA 1RKIA 2ADBA 3CCMS 2MHEA 2HW3A 2IBKA 2FIUA 2RVJA 4OI0A 4NCAA 4C4WA 4D3HA 1UWBB 1SJ1A 1N6QA 2ASJA 2ZHOA 3ZZTA 4X4UA 1S49A 4FNIA 2FHJD 1XN9A 4EBDA 2GIQA 2RNEA 2ZBIA 1FD8A 4KV8B 1YG0A 4BWMA 4ZHRB 4HI1A 1C1CA 2JFKA 2WW8A 2FVRA 2DNKA 4I69A 1URRA 4ID8A 2CQBA 2C3YA 2XI3A 3LPYA 1IKYB 1LK5A 2Z2MA 5A8RB 2FVSA 1HNVB 3HHLD 4MKBA 3MEGB 3OTDA 1N56A 2PE8A 1FEEA 2VBXA 5L1JA 4QCLA 1JLCB 3OSNA 3KLEA 2F40A 4KE5A 4NYPA 2K2PA 2DGUA 3RRHA 1S6UA 5JVGQ 2MQOA 2W25A 3FQLA 1SIZA 2ASLA 2UV8A 1QSSA 2BBEA 1L3KA 4MIAA 2DGOA 4ED1A 2EBGA 1RK8A 2BE2A 3FVYA 1RT2B 1VIOA 1U48A 2HMIB 2DITA 5E3AA 3KLGB 1FVSA 3MWBA 2KFNA 2K8GA 2RDJA 2VG5B 5FJ4A 2O1PA 4CZCA 4WZQA 4DOZA 3LQVA 1Y7PA 1NKEA 2MKSA 4JI5F 3SSQA 2C28A 2PMZD 1FE4A 1NJXA 3D5MA 1RT1B 4JI0F 4J9PA 4ZP8A 2AGOA 4B9TA 4R25A 4ZPAA 1DQ8A 1FO1A 2IFXA 2UUTA 5AXKA 4KPYA 5ITHA 3U27A 3AJ2A 2JC1A 4H4MA 4NCBA 2MKIA 3MM5A 4RW4B 3BGUA 3GYXB 2RRBA 3K5LA 4E0DA 3G9CA 4I6WA 5DDPC 4ELTA 3LH2S 1JJ4A 3OUYB 4CO2A 2ZM6F 1TL1A