4LIWA

Ccmk1 carboxysome shell protein from synechocystis pcc6803, l11k point mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
92
Chain Sequence
IAVGMIETKGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVTAGIENIRRVNGGEVLSNHIIARPHENLEYVLPILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A challenging interpretation of a hexagonally layered protein structure.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Transport protein
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK homolog
total genus 25
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4liwA00
4RBTA 4RBVA 4QIVA 4P7VA 4P7TA 4QIGA 3MPWA 4OX7A 4P2SA 4AXJA 3NWGA 2G13A 3CGIA 2EWHA 4AXIA 4OLOA 4OX8A 3H8YA 4DDFA 3DNCA 3I6PA 3SSSA 2A1BA 3DN9A 4QIEA 3SSRA 3BN4A 3CIMA 4OLPA 4OX6A 2A18A 3NGKA 3PACA 3VCDA 5L38A 3MPYA 3I96A 3SSQA 4LIWA 2A10A 4RBUA 4QIFA 5DJBA 3IA0A 3N79A 4PPDA
chains in the Genus database with same CATH superfamily
1VQYA 3FEYB 2MGZA 3CCES 4FS2A 2B5JA 2WVBA 2XWYA 4IFYA 5IT0A 1HWLA 1T9UA 2AWZA 1KONA 2VBYA 3CIZA 3T19A 2V4JB 5CABA 5I4MA 4ID8A 1URRA 2PDAA 3ZC4A 1JLQA 2QSWA 2XY6A 3C6TA 2HFUA 2VODA 2VFTA 1IR2A 2H9ZA 4ES2A 4ZMMA 2AKWB 2BJ3A 3HCXA 3A8JA 4DR1J 4C8YA 1YG0A 3DU5A 3TARA 3MM7A 3HVTA 3GILA 2RKIA 4NCGB 3VZHA 2ATLA 3MPVA 1VFJA 3UQSA 4YUDA 4ZJOA 3O8WA 2FPHX 2YH0A 3OD2A 3WC2A 2HQFA 4CWBA 3OR1A 3WHIA 4K7QA 1Q8IA 1EETB 2XMAA 2PI5A 4PPDA 1TV6A 1H38A 1HFEL 1X5TA 2XLKA 3NGTA 2H1YA 2CXEA 3WZ0A 1OO0B 5IQ6A 2MTLA 5DRKA 5J1NA 2QG9B 3PY8A 4MIWA 4WXOA 5KG1A 3N6NA 8AT1B 4U7UK 4DR6J 1DQ8A 2DNQA 1HNIB 5LJ3Y 4N47A 1OY9A 1RQ0A 3BN7A 3L7OA 3POTA 2F8MA 5IM0B 1SKWA 3PW7A 1KR4A 4I7FA 6FDRA 1WHYA 2E66A 4EZ6A 1AW0A 4N5SA 1FERA 3FVYA 3BEGB 1Y9OA 1S6QB 2QV6A 3EDQB 4KKOB 4RW7B 2ZBIA 1EARA 1ROFA 3AQOA 3MEGB 3L95X 4DR7J 1G4CA 4NZ0A 2VBZA 4MAKA 1ZM3A 3ET6A 1Q79A 2F65A 1R8CA 4QYRA 1TAQA 2B56A 1X9MA 4O4GB 2IDEA 2IM1A 1H74A 1IKVA 2KI2A 2O01C 2NR0A 1WDTA 4UY85 1R8PA 5KFZA 1FESA 5EWFA 5KT7A 1HNWF 2P5VA 5CZVA 4A8MP 1FD8A 3JTNA 4ECZA 3Q23A 4PCQA 1RADB 1VIOA 2CNNB 2K3IA 4FPRA 4Q2LA 4RW4B 2GNKA 2V50A 5C5JA 1TQLA 3QJJA 2LYVA 4A48A 2QE5A 2FVPA 4FBTA 2L9DA 5K8PA 1TL1A 4DU8A 3CDBA 2D3ZA 1H98A 2AJ0A 1SQGA 1TP7A 2DNOA 1UZHA 3D2WA 4O3RA 1NZAA 1KHWA 1WI6A 3GFYA 2RF2A 2BUNA 1HLWA 2WVEA 4KH0B 3JYTA 2FJEB 4LF4J 4ILRA 4PXEA 4Q43A 1CVJA 2V4RA 1G7CB 3G86A 2H51B 1WC6A 4CT9A 2AU0A 3GYGA 2B4UA 2BQ3A 3W2WA 1R0AA 2BEFA 4KR0B 3TI0A 3I56S 4DR7F 2ZH5A 1B0VA 3K2YA 3G9CA 1U4BA 3CD7A 1RWKB 2ZH8A 2V2VA 1WORA 2DGOA 3ZTOA 1SJRA 1E6VB 3EVMA 2DHHA 4HT7A 1SH0A 1U8SA 1X4CA 2R2UA 3C16B 4DR3J 3HHLA 2CPXA 1YJUA 2WVCA 5D0HA 4DV3F 6AT1B 2IRXA 4ZPVR 5GAHU 4X4PA 1SKSA 1IN0A 4ZITA 5KG2A 4DPOA 2CWKA 1WDDA 4DWIA 1HBNB 1C1CA 1SVDA 2Z8QA 3H5UA 2CPFA 4OI0A 4DPYA 2RDDA 1HARA 1S1XB 1SH2A 2C2RA 1A0OB 3H7HB 1S0MA 4DV6J 3PR4A 2UVRA 1EX8A 4ECQA 2BYCA 1YDLA 2ZJPQ 3KUEA 2GVZB 2WVFA 2ZFHA 4RNFA 2BMBA 5KT4A 5HLFB 3MEDB 2J6UA 3QRRA 3DGPB 1LWFB 1O0PA 2OEKA 3PO4A 4EBEA 1L5UA 4IRCA 2W9BA 1HWJA 1VRUB 2DO0A 2H4YB 2U1AA 4J7CA 7AT1B 3Q83A 1NBEB 2LXUA 8RUCA 1UEUA 1SL1A 4EUVA 4ERDA 2DR6A 3A8IA 3OJUA 3KG4A 2DRBA 1RBLA 2EVZA 3PCOB 1X9SA 1KSPA 3FC9A 2R4FA 1M5PC 1GXTA 2A3JA 2WZ1A 2GAHC 4CTAA 1RLDA 2KH9A 2W01A 1WOPA 2BE7D 2OPPB 2ZOFA 5RUBA 2YWEA 1BLUA 3K0JA 2FC9A 4BC9A 4NYZA 3JS9A 2MZJA 4IG3A 4JI3J 1Y11A 4UZCA 1TZ0A 1HQEA 4R8UB 2CYYA 3FCWA 2MKYA 4ZLPA 2M88A 1FJCA 3NMAA 2RRNA 2XHWA 3T1HJ 2Z56B 7FD1A 2XMJA 1NO8A 2LP4A 3AXMA 3PRVA 4K4TA 3K8WA 3CJ4A 4ECWA 5JJBA 2RAQA 1R8AA 4ED0A 2VUGA 1XR5A 3HDSA 3H5SA 2KM8B 4TN2A 3CJQA 1F2HA 3M8QB 1NK0A 1HNWJ 3GQCA 4GKJJ 1IVZA 4OX8A 4ECUA 4WIIA 3MF5A 5G4DA 1N52B 4J5OA 1PJ5A 4P72A 3WBZA 1Z1ZA 1YLXA 3EZUA 3RG6A 3V81A 2W1BA 2LQBA 4UQGA 1TKDA 4ATNA 1PBUA 1FRJA 2QL9B 4C7QA 1J27A 1HBOA 1PYOB 3T1YJ 2CPYA 4IG0A 4Y2MA 3GMGA 5DGAA 2R7XA 2IYIA 3HX9A 5DS7A 2V4QA 4OIXA 4F2RA 2YX4A 4H4OB 1RTJB 3KFWX 4P6QA 2Y1JA 5J2MA 4ED7A 3P45B 4USWA 1H72C 3UVJA 3T1HF 3DOKB 1FTCA 2F1FA 3ILLA 1AXQA 1H0HB 3FCVA 4OHZA 1VQOS 2X51A 3MGJA 1U1KA 1NLKL 2W25A 4WP3A 1C4CA 2QL7B 2Y8YA 5J1PA 1U25A 3NBPA 2BDPA 2DRDA 4F0HA 3NKYA 1K1SA 2M4MA 2ZVSA 2J76E 4I2PA 2E5LJ 2R42A 5ETVA 3THVA 2ZWOA 1XMOF 2C2NA 2CNKB 2VG7A 3ZFVA 1I5OB 5IWAF 5U47A 1C0TB 4DPXA 1VQ7S 5ETOA 1S1WB 2UU9F 1NKEA 3DRRB 4OZLA 5LSOA 1NB2A 4KYZA 4TY8B 3SSQA 1UCNA 3VAKA 5KFMA 2DRAA 3QT6A 1T9YA 3G8QA 4K59A 3MUVP 1RZMA 1Y00A 4NMLA 2HMIB 3JSMA 3PIOQ 3PKYA 4RBTA 5C42B 1LV5A 3HJVA 3U1NA 5L8RC 4KFBA 1OPIA 3HD2A 1U1LA 3NWGA 3UN3A 3TAQA 4P52A 1R6VA 4IRDA 4DPUA 4QWAA 5F0UA 4JB8B 2FLNA 3KLGB 2F8HA 3WX4A 3J80Y 3TX0A 3CCRS 1JLCA 3KWMA 1RTIB 2B9EA 2HG4A 1T05A 1S6PA 3I4HX 5HO4A 2KT2A 1CPZA 2C3YA 3CDWA 4USMA 3HXMA 3MWBA 4A4JA 1FF2A 4CLYA 1Z4UA 2UXCF 2LDYA 4NMXA 3CCUS 1CC7A 4EI2A 1RAJA 2IM0A 3LP0A 3TUJC 2QFJA 4ECTA 3UW1A 1L3TA 2NPIA 2FY1A 4LBPA 3C46A 3NNCA 2XSFA 3K5LA 1MN9A 5DQGA 4XAKA 5GVQA 1D9DA 2W2MP 1D9AA 3FSXA 2VU5A 3BR9A 2W8KA 4ED3A 4DV7J 3WIUA 3SQOP 4UTGA 4JI8F 5LMNF 4HR2A 1U1NA 2HAIA 2POKA 3N5FA 4OJHA 1GTHA 4U95A 5CYQA 3I6PA 2LU1A 3VALA 4PKDB 3RBEA 3L4BC 2DIVA 3QIDA 3Q8QB 3K17A 3M1VB 4ZP8A 4ZDNA 1W2IA 3F44A 2MKSA 4PG7A 4JI0F 3W5YA 4AUKA 4M5JA 4ZPBA 1VC6A 4C48A 1QAIA 3IS9A 5D3GB 2FYXA 2ASYA 5E5NA 4DSKA 3C3LA 2IM3A 2DTJA 4NLVA 3CF5Q 2DR8A 4CH0S 4Q8EA 4FF3A 3H4BA 4WU2A 1TFWA 3HHDA 1V6HA 3QZ7A 1YJRA 3CCMS 4DR1F 4KGMA 5A0YB 4QYZJ 2GHPA 3RRKA 2F7VA 5L1JA 1BHNA 3IR6B 4IFVB 4DHVA 4Z2XA 5CYJA 2R9LA 1KDNA 3J7YI 4B3MJ 1ZA2B 5LOQA 1JLBB 2MLXA 4FP9A 2MEWA 3R1LA 4AFFA 2MKKA 2HHQA 4DF8A 3KKFA 1LK7A 1SC4B 3PHEA 3ZZ0A 3BO4A 4ZVUB 1XK8A 2R7WA 1S1UA 1TL5A 1VISA 2LVWA 3BPSP 1N5VA 2C2MB 5GAHI 1EAYC 4OHVA 3BYRA 2HURA 2W24A 1SPBP 1ZBTA 4ZN1A 3IXQA 3TJ9A 3U02A 2MSTA 4ECXA 2QLBB 3D1OA 1TU0B 2CZ4A 5KFDA 4OX6A 5F8MA 2P6TA 4WFXA 2GQQA 2XC9A 2W7OA 3SQGB 4JI0J 4WKRA 4URSA 4AQYJ 1XR7A 3SEOA 3DOKA 3K5PA 1HNZJ 3OUYA 2GZOA 2JH3A 2AGPA 2K1RA 4GC6A 1N6QB 1IBKJ 1NSQA 2PE8A 1IQZA 4R0EA 3BREA 2GQ2A 1JLQB 4F0MA 1QSSA 4GO5X 3LQVA 2GO9A 3LPYA 4K4VA 4AXIA 3EJMA 2DO4A 3NGUA 2WOMA 3AJ2A 3I5CA 3SMZA 4IYQA 3UD4P 3RB4A 5KG4A 4OYIA 2ZD1A 2FJBB 4LSNA 2N7CA 1EJ7L 3OW2R 4JV2A 3KK1A 4F4XA 1R8HA 2IYGA 3UDEA 1VBXA 3CJTA 3JB9k 4KTQA 3KK2B 3CO0P 4DN0A 4CIOA 2HSEB 2MY7A 4WIQA 3SIPB 3JSBA 5BJRA 1N54B 5F9LA 3KHGA 2R7RA 1ZETA 5E3AA 2MQMA 2XCPA 1CLFA 1LW0B 2XMUA 3PXGa 3B6BA 4KPYA 3X1LB 1GMUA 3OTCA 2CG4A 2V67A 3CCWA 4RLEA 2BA9A 2OIHA 4ZPCA 1TUVA 3VR1A 4F4ZA 1MNEA 4C11B 2PIIA 3EM1A 2YWFA 4QIVA 4KY3A 1SQFA 2UZAA 3GYXB 4ILLA 5IM0A 3FBEA 1XERA 2XG8A 3GSIA 4I7FB 4OZJA 4A47A 2FLLA 1BWVA 2CNOB 3RW7A 3QJPA 3FMBA 2E5LF 5B0BA 4DFKA 4DI6A 4NLGA 1NPKA 3S6EA 3DLHA 1C4AA 1TKZB 2HEKA 3EVWA 3O2IA 1UFWA 5E3QA 3Q89A 4IO1A 1YZ7A 2QLXA 5EHHA 1UW9A 4RJVA 1KBRA 2E5HA 2FHKA 1IJFB 2JZ5A 3MAAA 2IMWP 1N36J 2QTWA 1SBRA 2X7IA 3HLUA 4O4GA 3HFKA 4B17A 3C2PA 3QJLA 4B3SF 2GJIA 1XN9A 5J2PB 3NGKA 1HBUB 1ICEB 3QPIA 4M5GA 3OXGA 2AV5A 3A3OB 4C8NA 4EMDA 3FSIA 4DSIA 4WF9Q 4OI6A 2OTJS 5AXKA 3EX7B 4IO9Q 2W2QP 3CNQP 1S1TB 2CZ9A 4TYBA 3TAMA 4FXDA 2CFXA 1CJVA 4NRUA 4CLKA 1HNVA 1FRLA 1OYDA 2Y1RI 2YKNA 3JTPA 3M1VA 3N4WA 1ACMB 2WSCC 1MWQA 3CGIA 2VFVA 1B3TA 1T7PA 1FDNA 2RILA 2KXNB 3HPOA 3SCLE 3NRBA 1B0TA 5A8KB 3M8SA 1M5KC 5IS2A 4MTPA 5D4PA 1Q0NA 5KFIA 2B43A 2MZRA 2MZTA 4HHUA 4KO0B 4LF6J 1M0SA 4FNIA 3U1MA 3X3UA 2GHWA 1YQHA 4FYDA 3MECA 3DDKA 4C8KA 3JQJA 2L41A 5KFLA 2XI3A 2DITA 1FNMA 3QMQA 4I0WA 5GADI 2J0SD 2DGWA 1GH8A 3PX4A 3OBIA 4LIRA 3A3PB 3HHLB 1WSRA 1F0XA 4LMZA 5DO2A 3HM9A 3Q8RB 2JEGA 3CT9A 4B9SA 4A8QA 4K4UA 2MKJA 3M32A 2G13A 4PPZA 1B64A 1RHKB 3D68A 1S1VB 3CE8A 3TYTA 1GMWD 2IJFA 3IC1A 3PTWA 2HHXA 3I0SA 1WELA 1S1XA 3M2VB 4LF7F 5DGBA 3NGSA 1UJ6A 2FJAB 1U0HB 4HYKA 2VC1A 3BQ1A 4LVOP 1VHIA 2OMLA 1RT5B 3MEKA 5E33A 2Y1LB 5A8WA 5HLFA 1SKRA 1IM6A 1TL4A 3OFHA 5HVHA 3FKBA 1NZ8A 1YRTA 2IAJB 5CHCB 1FKPA 3VAMA 3IRXA 2KZMA 2BABA 3EVOA 1UKUA 3QSYB 2OGUA 2EFOA 2DJWA 4NA3A 4Y65A 4QWBA 3VHQA 3VAFA 3PW4A 1NB7A 1NM2A 3MM8B 2V63A 5A8RA 2DR9A 2CG8A 1MWYA 2RDIA 1Q1KA 4BHQA 3TZXA 3L3CA 1FFWB 3MHYA 2VDIA 1R0CB 4LSNB 3DOLA 3HVWA 2X1FA 4ZVOB 1GEHA 2HS4A 3G8SA 1NSAA 4PUOB 2DGSA 3L7PA 4PQUA 3OFEA 4HDHA 2C3PA 5MAOA 4DCJB 1NJZA 1K8AT 2KTQA 3Q2SC 3DDNA 2JLGA 4UY8T 4UZBA 3OFGA 5EX3A 1D9FA 3OSNA 1EETA 1KC8T 4DL6A 1P8GA 2OD4A 4B9TA 3H2VE 2JJ4D 2B9XA 2AX1A 2K8GA 2PMHA 3AJDA 4Q7AA 2DR5A 4W98A 4EFAC 2J6SA 4LF7J 2VOOA 4H4MA 1N88A 2GMLA 2HZCA 2B6AA 3PNIA 2ROPA 5ETTA 3H98A 3R9LA 3T9NA 2HBQB 1I3OB 3LWLA 1D8YA 2C28A 2O66A 2U2FA 3D1HA 1TK8A 4B3SJ 4LF9J 2L9WA 4O0NA 4OHYA 4PG5A 1F60B 3TVZA 4XPEA 2L3MA 4PZVA 2MPUA 2JEJA 2UXBJ 2HHHF 2DNMA 2FVSA 1NPRA 4FZVA 1EP4B 3US5A 4R0JA 2ALZA 3TZZA 4E8UA 1DAXA 3W5XA 1X4HA 1RT3A 1CJKA 1YHQS 1VRQC 4ZVGA 5G0RB 3O3LA 1KEKA 4CLWA 2AEMA 2YVSA 4M5KA 2Q1LA 5HANA 1FJGF 2KFZA 4YS2A 3LPEA 4G1QB 4NLRA 4TYAA 4M94A 1RHQB 2DNHA 2EBGA 2HNDB 3WX8A 5F8GA 3T3FA 4S0MA 2HFZA 8ATCB 3MR2A 5KFSA 4F67A 4H54A 4ITSA 1NKCA 5JMNA 5ETRA 4O3SA 4Y2CA 1KLNA 4WK1A 1NSKL 3Q8UA 2GMJA 3RU0A 5L1KA 3VGTA 2IIHA 5H9FJ 5HROB 2IA6A 4NCAA 4OL8A 3NGRA 1DLOB 2XEXA 1IWAA 1UVJA 4RZRA 1X4EA 3LGNA 2FZKB 4ZIWA 3NBPB 2RJZA 1V3ZA 4DL3A 4ID5A 5KFQA 4YB1P 5E0OA 1T94A 2ZZNA 3TQEA 2FJXA 2CPZA 1FD2A 1SJ1A 2VQFF 4DS4A 3DRYA 3ZZRA 4NXMF 4QR0A 4ZKAA 1N36F 3DRXA 1JLGA 5EDWA 1ZTWA 1R0AB 1WC5A 3DC2A 1VJWA 2L48A 1DZ5A 2OPQB 1FCAA 3LGMA 1D0EA 3OL9A 3Q22A 5K14B 2CJBA 5AE3A 3TW0A 3PACA 4K4SA 4FXWA 4B3RJ 3TANA 2HS3A 1GAOA 1GNKA 1N32F 2M5YA 2VQEJ 1T11A 1HYSB 4H4KA 1RHRB 2G2OA 2XMWA 2EFVA 1F3FA 1VQLS 3FDSA 3R5CA 2DXFA 4ZVPB 1RTIA 2XS2A 4Q8FA 1X31C 1KFDA 2IDLA 1JMTA 1QSLA 1YWXA 2XO7A 2JHEA 1S79A 3DLEA 3DRSA 3W8GA 2GA7A 3RBXA 3NAHA 1RTDA 2HW3A 3SSSA 4W92B 5HN0A 4EZ9A 3MCOA 3AFGA 4B3OA 2IJRA 3RB6A 2BKNA 4DZ6A 4M5IA 4OX9J 3CDEA 2Y3YA 5DETA 4HVZA 3CCVS 2MDAA 2O5DA 2PGCA 5A8RB 4R5PB 2UP1A 4NLUA 3VTIA 2BJEA 1HIYA 1VLOA 4ZPTR 1FX4A 2RD5C 4DR4J 2FZGB 1U8WA 2VG5B 1Y0HA 2B3TB 3BSCA 3DOLB 3GTYX 3T6BA 2BR0A 3HJFA 3FFIA 4DR2J 3AD7C 3NGDA 3V4IB 4EO6A 4QR2A 2EKNA 2HKEA 2OLWA 4KB7A 4OHXA 3TO8A 2HAFA 2MYFA 2E5JA 4LF8F 2GV1A 4AE5A 1IR0A 1LFWA 3BO3A 1N34F 2EC0A 1APSA 1N0UA 4OFZA 2KFYA 2XMKA 2E1CA 2NXJA 4WE1A 3OXLA 4ZVEA 3RR8A 4LSLA 3W7BA 5GAGI 5D4OA 1KNZA 2UV8G 4OI3A 5DDQC 5BR8J 2RVJA 1QUVA 3W8PA 1RT7B 1XC9A 4DSLA 5KFUA 1WSVA 2DH9A 5HMZA 1NK5A 2HNYA 5ETNA 3D9BA 2ZHBA 2OELA 2VD3A 3MPYA 1ZM9A 1WC0A 5KFYA 2K2PA 4ALZA 4WP8A 5KOXA 2F4VF 4RNHA 4JI7J 2GGPB 3I0RB 4AL5A 4DR4F 3PX6A 2E1AA 2QGFB 3DOMB 2Q79A 5IT4A 3J81U 1RKJA 2AZ3A 2O3DA 1Q81T 2V8VA 3GFHA 1B4SA 4CP5A 2W2OP 2AMCB 2DK2A 4KIAA 4MH8A 1JKHB 4YP3A 4LF5F 4CLLA 2B51A 3DRPA 3E01B 3D5MA 2ZNZA 3PJXA 4QIEA 3VGUA 3GIRA 2W7PA 5HBMA 4DU7A 5HROA 2LQ9A 3B54A 2IA0A 4HACB 1WTBA 1SIWB 2LKZA 1FTRA 4NWBA 4RW6B 3J7Z5 2VB6A 4A8SA 1KD1T 1NU4A 4BS2A 4DFMA 2K7JA 4HT5A 4DL0C 2PFFB 4QPXA 2DH8A 4L72B 1KVIA 3T9ZA 1URNA 4CRJA 4QU7A 3OR2A 4I2QB 3PYEA 1MMDA 4C8LA 3QLHB 1JLGB 4OX7A 4ZVQB 4OV6A 1XEZA 2DT9A 3L09A 1OY8A 1O51A 4G65A 3D6MB 4DOZA 1C0UA 2AJFE 3C15A 4USIA 2C2DA 1V9OA 1F6TA 3KLIB 3CIMA 4PWUA 4O3QA 2MZ1A 1S7HA 2B7CB 2P2CB 2BACA 4QYZK 3NS5A 5C42A 3IO1A 5BYSA 5AXLA 3MMJA 1QE1B 2H4WB 2CQCA 1KVJA 3J7YU 5B08A 4Y34A 2DEJA 1RWUA 3NNHA 4QCLA 2WVDA 3NWRA 1YRUA 2D41A 2JOQA 3I4PA 3DLGA 5HMXA 1CS4A 2DVIA 4JV1A 3C14B 1T9XA 1J5EF 1KLMA 4FYXB 4UF4A 4QBUA 3EZ5A 3EGZA 1RACB 1H2VZ 1P1TA 1B0PA 2QLJB 2YPZA 2HNZA 5B0GA 4Y0FA 2ZM6F 4IOCQ 4B3MF 2NXNA 4DDFA 1YJ7A 2HVEA 3MR7A 4Y00A 1FDBA 2DPJA 4USTA 5J2PA 1Y10A 5LL6d 3BN4A 1XMOJ 2OPSA 4YFUA 1U26A 2CDQA 4OJ3A 3ET6B 2M2BA 2LDIA 3GU0A 4NLYA 4F50A 1K0VA 1PAEX 1C1BB 2RQ4A 3P3DA 2LECA 1F2GA 3E3XA 5B0EA 4J9RA 2HVZA 2BJ7A 2EEYA 1N5QA 1HWIA 2NS1B 3D3CJ 2KN4A 4KSEB 2IY5B 5DDOC 2ERRA 3DCAA 3VAIA 3T5KA 1GTEA 3JYTB 2KFNA 2HRUA 1MMLA 1DBDA 1PCAA 2R3VA 3CJRA 3LP2A 4TVAB 1VJQA 1HNZF 3NNAA 2LU2A 1NDCA 2XY5A 2YQ1A 3NY0A 3GFZA 1F3VA 3P5BP 1RT7A 3GV7B 4OI4A 3AA8A 3HT0A 4EU0A 1S5ZA 2EFPA 4PQUB 3EXCX 4YR3A 3Q8SB 4YB7A 4MFBB 5LT5A 4OYBA 2YKMA 2H48B 3Q8YA 3M05A 3UD3P 4I4BA 1VIXA 2YNFA 1KKHA 2WW4A 4PXBA 5LSLA 3SDEB 3HKWA 1SXLA 2QMWA 2XSJB 3ILJA 4RNMA 3MFHA 1HL6A 1QD1A 3CO9A 3IRWP 1KRPA 5D78A 3UFCX 2N3OA 2X1BA 3SV4A 3TJ8A 5J1EA 2CPDA 2I8EA 4WTYA 4ZLNA 3HHNB 4B9UA 4DV7F 4P7TA 1O5JA 2IVMA 5D77A 4K0KJ 4C0BA 1TKTB 4DV5J 4KQZA 1RA6A 1S9GA 1OSCA 1RWXB 1SI9A 1AYEA 1OQ3A 1RJJA 1U2RA 1UPPA 2XYPB 3DI6B 3N28A 3OTEA 2F4FA 3R7BB 4HL9A 2CAJA 2BJ1A 4NLDA 5F3ZA 4X66F 4X65F 5AJ3J 3BQ2A 2WONB 1JXLA 3K5OA 3M8PA 5C24B 1BQMB 1UJ5A 4U7CA 4PWDB 1RCXB 2EPIA 4ZIVA 4P2MA 4K8RA 5EUHA 3KJVB 2W9BB 3PW0A 1I1GA 3FZBA 4DLEA 3R7NB 2V94A 4CO0A 2ZH4A 3BSOA 1ZAWA 2PD1A 2I38A 1MROA 2OH2A 1RAAB 4KGXB 5D4NA 2E1RA 3FRZA 3B8HA 2D74B 3QO9B 1FK9A 2RMLA 4IR9A 4AQYF 1K73T 1J5OA 2OPPA 3SFUA 5J2QA 1RGVA 1MWZA 4UOGA 4RR5A 3R5BA 1NMEB 3I55S 2ZDPA 1YJNS 2N4CA 1PGZA 3KLFB 3H5YA 1GMWA 5L39A 1LWCA 1YBTA 2BW7A 1Q8LA 2G0JA 4MIAA 4JBCA 4O0IA 3DKDA 1VQKS 2KKHA 2PA3A 3QT5A 3D0GE 4IG3B 1EB0A 4H4MB 2KU7A 1IKYA 1RXOB 2ZVIA 4KV8A 4O4RA 5DZ7A 3TRGA 5GAGU 4DUYJ 1HBMA 1VQ6S 1DTQA 3CCSS 3GIJA 1FWKA 3RRHA 4LQ9A 2ASLA 1LQ9A 4X65J 1NH7A 5AJ3F 4DL7A 5KT3A 3H20A 1ZS6A 2J9EA 3IG1A 5KFXA 4B02A 3KHRA 2EG2A 1EIYB 3NXZA 3GR0A 1IUJA 4ZLLA 5I3UB 2BKOA 1U2CA 2CPIA 4B9MA 2MLZA 1W25A 2WRMA 3CCQS 4USKA 3I32A 1VGYA 3CMQA 5KFHA 3D6HB 1RISA 2AD9A 4U8VA 3MOZA 2QYGA 5DQHA 3RTVA 2OKQA 3MPWA 2F4VJ 4FXVA 2ALYB 2VJVA 4LFCJ 4TKTA 1H3DA 4WZMA 1W7WA 1HBOB 1MG7A 1MLAA 3R27A 1YJVA 2MXYA 3MFIA 4JI6J 2HNDA 1H7XA 4LF4F 3D66A 4LF1A 3CJ3A 2ASJA 2VZ9A 3I82A 4NA2A 2HYIB 1HI0P 1IKXB 5J2MB 1OQ6A 2AZ1A 4X4TA 2X1AA 2XQCA 2W9AA 3K5NA 2XMVA 4WFZA 1OWXA 1RK8A 4UOCA 3AXKA 3BKTA 4CO2A 5I42A 2RHQB 4FF4A 4LT6A 3KDOA 4USUA 3HZEA 2BW2A 2B5JB 4IFYB 3LAKA 4QIFA 4WWSA 4JV5F 2AJQA 3UI3A 2UUWA 1PC5A 1T95A 3MM6A 1WG5A 1IM4A 1WJ9A 1FKOA 2AW0A 2YNGB 3ENVA 4IDKB 3C6TB 5E41A 1F9FA 4DR2F 2RRAA 1HMVA 5IC6B 3PV8A 2OPRB 1UVIA 4BLGA 1S1WA 2V9KA 3D1QA 4LFAJ 3KLVA 3GJQB 2MQOA 2G2ZA 2VG7B 5LJ5Y 3SDEA 1D09B 4WTOB 1N8RT 1IBMF 1X8DA 1YZ6A 2KDOA 2CADA 4LRFA 3S01A 2QIFA 3QFHA 4XO0A 2HBRB 2YY3A 1VQNS 4C0HA 2M70A 2ZOGA 1VBZA 5L9NA 3KLEA 3Q2TC 4E2FB 4DV1F 1P9YA 3IBWA 1SL0A 2N4DA 2D9PA 1FRHA 3LOUA 1WF1A 2GO8A 4KFBB 1O8BA 3UR3C 3DMJA 1FJ7A 2R8KA 3OTOF 1YTYA 4ZA1A 1VRTA 7FDRA 1REVB 1TL7B 3EPIA 1TFYA 1RAEB 2BANA 5AE2A 2KHCA 4TU8A 3POTB 2C3UA 5IC4B 1IWGA 5L1IA 3R2DJ 1SB6A 3GONA 3JTOA 2UVUA 3EDRB 1RAFB 3D54A 1N34J 4L76A 2FTRA 5IQQA 3KDNA 1U6ZA 2ZC4A 1WTFA 3MI7X 3MMCA 3R5GA 1DTTB 4F4YA 4LFAF 2YKQA 4LRBA 3CVKA 2CQDA 2KL8A 4IRKA 3J80U 2LA4A 3KOAA 3RW6A 2LLZA 4DL5A 1Z2LA 4OLPA 2ROGA 3A8EA 2HFNA 1HQUB 3M7VA 4C8OA 1G3OA 3MTKA 2RUSA 3D6FB 4AD6A 1MU2A 1RU1A 4OYZA 2JWNA 1IBLF 1L3UA 1X5OA 3I9V9 2FVCA 2DCLA 5IFMA 1T02A 3P8BB 3ZZZA 3GB0A 4ZHRA 2V2QA 2FB0A 4N41A 1AFJA 4M5HA 3TA1A 2ACYA 4WE1B 5DDRC 4C9DA 2JLEA 2Z2LA 2WW8A 3BV8A 3AAWB 2C42A 5D0EA 2G9OA 2X1GA 2MB0B 4RKUC 2ZM6J 1SC1B 2BBEA 3B78A 3LA0A 2ASDA 4UT4A 2C22A 4Y2AA 4N56A 1YBUA 2V2KA 3HVAA 4I64A 5A2QY 1S9FA 1XNRF 3MEEA 5SUHA 1X4DA 3GCXP 3GLJA 3PYFA 3IN5A 2XZDB 3H0PA 5EWGA 2LXFA 4P74A 2DNZA 3RB0A 4UOFA 1NHKL 2DH7A 1I94F 1IQTA 1TK0A 4PR6A 1G2EA 1HA1A 2CA9A 4FYWB 3PIPQ 1SV5A 3M6UA 3VGVA 2YQ0A 5KFKA 2ZBPA 1WOSA 5I3QA 4G1QA 3OXFA 4I6YA 3DRPB 2LEAA 3E01A 3BS9A 3GJTB 3M6WA 3OTBA 1XQIA 2C2KB 4O44A 2QL5B 3HVTB 2NREA 5F8LA 1N5YA 1QDUB 1RWPB 3QBCA 1N0VC 5CCLA 4PXDA 3PRDA 2K06A 4F4WA 5LXYA 3HZGA 5LM7E 2EG1A 3ENQA 1K9MT 3MDFA 3PEHA 2DGVA 2LXIA 2Z30B 1N33F 1ZM4A 4RNOA 1ZOTA 1VQMS 1DQ9A 3GJRB 3KYLA 1RTHA 3DYAA 4LREA 2DCUB 2J8AA 1PIEA 1BQNA 2E5GA 2QLFB 3NOGA 1F5AA 4ID5B 1HI8A 4DL2A 3K8VA 1Q4RA 1VRUA 4DV4F 3EPGA 1IJEB 2XNQA 1RT6A 3EGVA 3IBFB 3TNVA 3UDCA 5D6GA 2UUTA 1N48A 2AJ1A 3RRGA 1RYSA 2BKPA 1C2PA 2WHOA 3BR8A 1Q8KA 1GT8A 3ZO7A 4DV0J 2RB7A 4KPCA 3PHTA 3GIIA 2XHCA 5BXIA 4I1TA 3BBCA 4J9OA 4DQQA 1QUPA 2G0IA 2QX0A 3BGLA 5SZTA 1J5EJ 1NAQA 1R0BG 2J5AA 2K7KA 3AY0A 3PFOA 4WBFA 2VG6B 1G6BA 3TZYA 3CTRA 4GVBA 3KMSA 1TL3A 4HHHA 1YKWA 3OQ2A 2EFGA 2QJ3A 4QZVB 3CCJS 5D8HB 4JI1F 3F73A 2BM0A 2AP6A 2V8HA 5DLGA 5KT2A 4XTTA 4RUHA 3UPFA 3TR5A 1U09A 1GK8A 3HHKA 1U45A 4IR1A 2ZZMA 4KGKA 2CQ0A 1N4LA 3W65A 4FNHA 3EYZA 4IUFA 4USHA 1WWHA 2MZSA 2ZBQA 5LMNJ 1KTVA 3I87A 4CH1A 3MPUB 4JI8J 4A46A 3W60A 2KZZA 1IBCB 2OFGX 1SUQA 2VH7A 4YR2A 3HP6A 1IBMJ 4B3TF 3UCUP 4J9UE 3MMBB 5E3CA 1WEZA 1AT1B 3R7SB 4WJBA 4GKKF 2X3GA 1L3SA 2ZUAA 1U1OA 1U1QA 2DR7A 3MXHP 1U7LA 1NPPA 3MCMA 1FT8A 3HK2A 1OPZA 1UPMB 3CD0A 1BGXT 2KB2A 3DDIA 1CJVB 3JSYA 4DR6F 1X0PA 3A4TA 2V9WA 1E6YA 4NLQA 2QFIA 3KK3A 5KAKA 1I6JA 3K57A 2D3O1 3BGRA 3QT7A 1IKWB 4RW4A 5F3TA 5LSRA 1EZZB 1LWEB 5DG9A 1PYSB 2Y1IA 3M8YA 2BQRA 1NJIT 2DNRA 2FUG9 2H5IB 3OJSA 1SKUB 3AQPA 2V34A 2WCXA 3ILIA 4J9VA 2RF2B 4U9RA 3R8YA 4D3GA 3UCZP 1OJ4A 1W2BR 1YBAA 2KVIA 4QIGA 2XO6A 2DEIA 4IOBA 2IJNA 1S57A 3ILOA 4CLPA 1S77D 4NLOA 1TR0A 2NXUA 2FVRA 1NCLA 1U1PA 5DZ6A 4P73A 4PEOA 1H73A 1FKAF 2R8GA 2M0GB 2HHVA 4KAIA 3J81Y 4UQTA 1NDKA 1SJ4P 1WG4A 4W90B 3T5HA 3FQKA 3R5JB 1HR0F 1GXLA 3AOAA 4J9MA 1ZYQA 5IOLA 3OV7A 2HMIA 2GMHA 4L6V3 1VC5A 4IQXA 3R6GB 2R8HA 1R3NA 1FEHA 2AT1B 2NSCA 4LIWA 3DXSX 1FEEA 5L1LA 1QLNA 5D0RA 1T9VA 1YGYA 4U6PA 4X62F 2LQ5A 4EBDA 1HD1A 2HBZB 3IA0A 2YKOA 3N0VA 5KG3A 3IWLA 2PI4A 5GMEA 3G6VA 4ECYA 1BQXA 3KLGA 2BJDA 2CUYA 2LEPA 1UAWA 1YI2S 1HNXJ 2ILYA 2OJ3A 2WONA 4F7VA 1JLCB 3RR7A 3THTA 4KBIA 4QIWD 4W4MA 3KJQB 1A7GE 5HAOA 1QTMA 2BRKA 2FHJD 3IR7B 1FKPB 3MCSA 1WHXA 5KFNA 5CD4H 3DNCA 4JI1J 4LFCF 4OZ0A 2CQHA 2L9NA 2R7TA 3AB4B 2C2EA 3T1AA 3FZ2A 3QGPA 2ZH6A 4DR3F 1NNDA 1I94J 1VK8A 3FNNA 1Q95G 3QO9A 1FK9B 4CO3A 5C2GA 3V6KA 3TAPA 4A8OA 3CJ0A 3CSKA 2A18A 4USJC 4B08A 1S7IA 4TXSA 5B0AA 4LQ3A 5FDLB 3EGNA 2BE2B 2XLJA 3N6LA 4IH7A 4BWJA 3NP5A 1RHMB 2ZWPA 3BKUA 3HSZA 3CC2S 4MK9A 1S99A 1K47A 1WC1A 2VC0A 1QAYA 1WEYA 2YNIA 3KLIA 4L73A 1VQPS 4DQRA 1S0VA 4RBVA 3TUIC 4O23A 4CQ1A 4CM2A 4A8YA 2VPZB 2N7YA 2XMTA 2J9CA 1XTZA 4IG0B 2YNHA 4PRFA 1HQEB 1HNXF 3FBBA 1CQMA 1N33J 5J2NA 1QE1A 4PG6A 1UVMA 4F26A 1IR1A 2E44A 2UXBF 3WQPA 1UWBB 4N8NA 4FKXA 4F0KA 3CWJA 1K0TA 1FFGB 3DHXA 1NHVA 2Z58B 1UZDA 3TUZC 1HHTP 1B70B 3SCKE 4M5LA 2KT5A 3QQCD 3UO0A 4A8WA 2GVDB 2HNZB 1BMQB 2V4JA 4DV0F 1OMSA 2DIUA 3OL6A 2DB1A 2OAUA 2XZTB 2AHOB 3I5AA 2IMOA 1PJ6A 3FJ2A 1RABB 3T5JA 4FVMA 1T9TA 3QIPA 4F3MA 1X5SA 2HHWA 5JVHQ 2OPSB 1NK8A 2DXEA 2CPEA 2OSRA 4TU7A 3MOJB 4P2SA 3CUNA 4AXJA 4QWEA 4DBQA 2ROEA 4URGA 5H9EJ 4TY8A 4NEZA 4DFPA 1VS3A 4FPIA 2A1BA 5GMKa 2DGXA 2CJYB 2FGCA 3K7RA 2XCAA 4DV5F 3CD5A 3P5TL 4NX9A 1WOOA 3OT9A 1XIQA 2YWWA 2NLWA 3HHEA 4RW6A 4Y2KA 5KFTA 3ZXWA 3IAM9 5BYQA 2I9SA 1M5HA 1MW7A 3PR5B 3PX0A 5DM7Q 1TKXA 1MN7A 3U7JA 1WKKA 4CLSA 1OS5A 2JVOA 4RU9A 4ZVTB 3PM9A 1UETA 2J0WA 4ES1A 1M1HA 2BE9B 3E51A 1T05B 2RS8A 2V6AA 3NCQA 1ZPWX 2H3EB 3CB4A 3G71S 4DCOB 2QEXS 2VDHA 2JFDA 4A8FA 2CJQA 2YWKA 4RPFA 5KFGA 2YTCA 1AFIA 4CI0B 2Q3PA 4L74A 3PG9A 4PYDA 1GX6A 2RKIB 3H8YA 4NCGA 5KFCA 1FJGJ 3MPDA 4NI2A 4R25A 3GSDA 5HI7A 3CMES 2Y0SD 1YITS 3FQLA 1DY3A 4XK8C 2HQCA 1NXIA 2HIQA 3TVYA 2CZVC 2LMIA 4K4WA 1RB0A 3MR5A 2HZVA 5JXSA 2CPHA 4RX6A 3RB3A 2W4CA 2N3LA 2OEJA 5C7PA 2XM3A 4IH6A 4OZ1A 1FWLA 2WBRA 4JI3F 5CYQB 1L3VA 4TLQA 3S7RA 2D69A 2QSFA 1QTNB 2KVQE 4B3OB 2J0XA 4HH1A 1VR6A 2F40A 3VV2B 3MAQA 4PWDA 4JI4F 1Q86T 2SXLA 1TKZA 4I68A 4N7TA 2EBEA 2I5JB 1RAHB 3LP1B 3BZQA 3Q86A 4LRDA 4A8XA 4ER8A 1R6YA 2J7KA 2VA3A 2RNEA 3O1LA 4NXNJ 4ZP6A 3BB5A 4LJMA 2DHXA 3KHLA 3BPDA 2DPIA 4DV2J 1PC4A 1JWWA 3H59A 2I2YA 4KHPJ 3OFFA 1P6TA 1PKUA 4M5DB 2J6TA 3NL0A 1U6FA 1KOHA 2FD2A 2NYHA 1NKBA 4NZ7A 4DSEA 1E6VA 4EYIB 4DR5F 3VCDA 3DM2B 3ZTQA 2BJ9A 1LWCB 3EZOA 3M2RB 5IZHA 4X4RA 1VK3A 3LH2S 1FX2A 1FFSB 1Y3KA 2ATCB 4N76A 2HVHA 3GIKA 1GQEA 2I1RA 4DV4J 4NL5A 4WYLA 5KFOA 2EK1A 4C2MA 1HBNA 1S72S 4LBIA 1CBKA 2XGPA 5A8KA 1BUXA 3GIMA 5CXTA 3P49B 4LSLB 2HRTA 4Y2IA 2MKIA 2MKHA 4X4VA 1LW2B 5HK4A 4OYWA 1UFKA 4ANDA 2FJWA 2IC3A 2JRSA 5H9FK 2GVZA 3CCTA 3UWTA 4JYAF 4K50A 3U27A 4IKAA 2EXUA 4F02A 2WK4A 4NZ6A 1KN6A 3W62A 4IFVA 5KG0A 2P9GA 2BXJA 4NA1A 2GGPA 4OJGA 3ZZYA 3ZZOA 4EO8A 3OSPA 1S0OA 2B4PA 3DHWC 3AD8C 2MSSA 5HP1A 1S12A 5KFEA 5K8NA 2FHJA 4BDPA 5L38A 1Y5IB 5GAEI 3JAMY 1DURA 2HWTA 2MY8A 3DOMA 4WFYA 5IWAJ 3MR3A 1U48A 2UU9J 5HSPA 3MR6A 3TP2A 1X7VA 3LW5C 3TJAA 4KH1B 1B7YB 2M8HA 2YKAA 4HH0A 2IPOB 2MHEA 2XZWA 3UN2A 4ETXA 3KK2A 1G1XA 3M8ZA 2RQMA 3M2UA 3LANA 4LBHA 1T0TV 2AIRB 2W2PP 2E1PA 3BDPA 5I42B 2R7VA 5K5MA 2HQIA 1AUDA 6FD1A 4NCBA 2V8PA 2RDJA 3RZAA 1LWFA 2YWHA 2WB4A 4YHHJ 4DV3J 3TQ1A 2Q6BA 2CNLB 2G1DA 4OHWA 3EMTA 2HHUA 2ZC3A 3IWNC 1U6BA 2YPYA 4I69A 1LEOA 4WYWA 2HVIA 2DNLA 1M5SA 1ZA1B 4J9QA 1OY6A 4RW7A 3PVXA 4ANEA 3VAJA 1N56A 3KK1B 4RWXA 3RAXA 2V68A 1NH8A 3AOCA 3D67A 3MAAB 1NK7A 3UR0A 2B9YA 3LWMA 2BJ8A 4DX5A 2QT7A 4OZ5A 4PWWA 3SBMA 3ENWA 1IKVB 3PFEA 1S6OA 2A6MA 1LW0A 1ZPVA 2HFOA 4CT8A 2Z2MA 4HTJA 1ELOA 3L9ZA 3ZZTA 3NEKA 5ETQA 1NK9A 3OVSA 1QM9A 1TMJA 2UV8A 1PAUB 2F9DA 3DLGB 4OYMA 3R5DA 3S1TA 2OHDA 2Y0BB 4ZVSB 4HHJA 4C11A 3EUNA 4ELTA 1TL1B 1LFPA 3W2VA 4Q0BA 2ZBCA 4DX7A 3M8QA 3N01A 2VIHA 1Y3JA 3N9UC 3GV5B 4DR5J 3AJ1A 4LUBA 3M9NB 4JV0A 1WC3A 4CCHA 4DLGA 2E9RX 3C19A 4I2PB 4HEA9 2DD8S 1DTTA 5T7LA 1RDRA 1WF2A 2DY9A 2QLWA 4NOHA 4URQU 3MCNA 3BSAA 2G2YA 3DLJA 4Y6IA 2IM2A 4DCPB 1CULB 5KFPA 4X64J 5FD1A 1HQUA 1MSWD 4CLUA 4V19X 3TX8A 1FNOA 1T8EA 4CNZA 1UA0A 4F8RA 4LF6F 3R5AA 3GZ7A 5F41A 4PABA 2CQ1A 4X4UA 5KFRA 4RNNA 2XI2A 3ISND 1B7FA 2WAQD 1AB8A 2R7OA 4BBYA 1FNXH 4JYAJ 1RTJA 5AXMA 1S1TA 4QU6A 2WBMA 1KOOA 1VYAA 3HMJG 1Q82T 4G1IA 1SC3B 3M8RA 3A8KA 2W4PA 4O3NA 4DEZA 3BQ0A 4DFJA 1GXUA 2R7SA 4K4ZA 1M1GA 3I96A 3OTOJ 2IVYA 3M4XA 3BO2A 4RL1A 4DV6F 2EC2A 5CZXA 2WSEC 4ZVHA 4DQPA 2CJAA 4ZP9A 3Q24A 3EWGA 1JJCB 1RT5A 2GJFA 2YKMB 4NXNF 2XBPA 4NLWA 3UNYA 2YWGA 3G2XA 2R2RA 3V6DA 1SCJB 2OP5A 2XSJA 5A2QU 3DRRA 1NDLA 1RT2B 3KG1A 2YNFB 4F25A 1XMQJ 1GX5A 1K1QA 2KRBA 5K14A 1CJUA 1JLFA 5HP1B 1RUSA 5KG7A 3KMQA 3C6UB 1RE1B 1NSPA 3IR5B 3JSMB 2J0QD 1CEZA 2A6OA 3IP0A 2HWHA 3PJWA 3J7AN 4EBCA 4YHHF 4OJ1A 2CQGA 1X0FA 5KFFA 2OFHX 2NQPA 2VFUA 1RAIB 1ZH5A 5M2RA 1X5PA 2NXCA 3CPWR 1U47A 5FIIA 1S76D 1RP5A 3SCJE 4DMZA 1VQSA 1LXJA 1RI7A 3IS9B 4PAAA 5B0DA 4RW8B 2J9DA 3LUYA 1NJYA 2B6AB 3V2UC 1BQNB 1S10A 3H2LA 4ZN3A 1SQEA 3VZIA 4FS1A 1V5IB 2IAJA 4LRCA 1T03B 2DNNA 1MROB 2G1HA 2KYZA 3FCHA 4WK3A 2IHR1 4JI2J 4R5PA 2E29A 5BYRA 2HPUA 3TZWA 1D3WA 3NCRA 2HZAA 4OZ2A 3TVKA 3MMAB 1P1LA 4AL7A 1UEVA 3R3TA 4WZQA 3A3NB 3FFIB 2HGNA 2GW8A 2ZH1A 3Q0AA 1UW4A 3WC0A 1TVRA 2AJ2A 2P9CA 4L75A 5G0RA 5HVFA 4Z7CA 4ZJLA 5H1SV 3KLFA 2UUCJ 4M95A 3OVBA 4Z7YA 5L46A 4X4OA 2ZJRQ 4C8MA 3N5BA 5AT1B 4HKQA 2HHSA 3UCGA 4GVBB 4M5MA 2BZ2A 4ZLJA 1FE0A 1XR6A 4MKVA 3BJYA 4KV8B 1Q16B 2COLA 2R7UA 2CJ9A 4DUZF 1KS2A 3VAHA 2WB1D 1FXDA 1QAXA 3SQGA 3HULA 3VGSA 5KT5A 3UNGC 2DYAA 4B9VA 1UVNA 4TU9A 1T3NA 4ED6A 3W5ZA 1U02A 3GG0A 5I3UA 4YB5A 2UUAJ 1RT4A 1VI7A 1DLOA 4AL6A 1VLYA 2DGTA 1RLCL 4X4NA 2BRLA 3K58A 1FXLA 3H42A 3VVTA 3QAEA 1EP4A 3GWCA 4P9SA 1U1RA 1N32J 3DXBA 4Z37A 2IRUA 3B4DA 3HHLD 2V0NA 3QIPB 4YN3B 4GRSA 3P4UB 2BOPA 4I67A 4NLSA 4F3QA 1AA1B 1CJKB 4N77A 2QMXA 3PYDA 3ZTSA 3G4SS 1LNQA 1S1UB 2PO4A 5H9EK 4JI7F 2AYGA 2CVIA 3W63A 2UVVA 2ZHOA 3CC4S 1C0TA 1FO1A 2IFXA 1S6UA 3ISZA 4ED5A 2LFVA 4OYAA 4MJKA 4E98A 2VF3A 2MJNA 3MM7B 3A13A 3AH6A 2KXFA 1IBKF 1UTAA 2MHNA 2VPXB 2GS8A 2YX7A 1BD6A 1RWWB 4IQMA 4CLTA 5F8HA 3JSRA 2RQCA 2XYGB 4P10A 1EKSA 1DJ0A 1FVQA 2E9TA 5D4LA 2K1RB 1N6QA 3OTDA 3CD6S 3K59A 1EHWA 1RKIA 1FKOB 4IDKA 4ZPAA 4EGLA 4YEAA 5KFWA 2VQEF 2FJVA 1EKRA 1VMBA 3BYPA 2ZZTA 3CEDA 5GAEU 2AEFA 5DQIA 3CCLS 2LEBA 1TTHB 4YMEA 5ADZA 2FIUA 5B0FA 3QFWA 4TLRA 4J9LA 1HMVB 2BM1A 2D7SA 3W66A 4X64F 4FYYB 1YIJS 2BQUA 2QA1A 3ZNJ1 4NYPA 1VCTA 2MKCA 4X84A 1AROP 2HLTA 2ZH3A 4NI2B 2ZKUA 3PDNA 3LP0B 1CJUB 1DHMA 1JLFB 1JNZB 4LVNP 4X66J 4EWTA 4ED8A 2LQ8A 2E5IA 4ED2A 4JI4J 4NASA 4C98A 2KRRA 4RO0A 4MT1A 4RUBA 4DX8H 4ZOSA 5BR8F 2FVQA 4Q5VA 3LALA 2E7WA 2EK6A 2ZE2A 3FEXB 4U8YA 4G1PA 1M5OC 3BM7A 2JFKA 3F41A 3TAMB 1QAJA 3ISNC 4JI5J 2BANB 3NG8A 4NE9C 1FXRA 4DQIA 4WXWA 3IBCB 4JOUA 1WF0A 2MQLA 3DGVA 1WHVA 3M6XA 5HMYA 4F2SA 4RUCA 1HQ2A 4I56A 2KM8C 3D4JA 4LF9F 1ULRA 5HQLA 4X4SA 4WP9A 2R2TA 1YVFA 1F5CA 3CJ8A 2MMYA 2ZH2A 4RBUA 4V1Ak 5D3GA 2NZ4A 2APOA 3KJFB 1DQAA 3VWSA 3H2UB 3OLBA 2HQDA 1H7WA 4X4QA 1OSDA 3T1YF 1R7IA 4B3RF 5CD4A 4X62J 1XMQF 5A0YA 1JLAA 1R31A 1X4GA 3LF0A 4CM0A 5JVGQ 2MZQA 2C2ZB 4E0DA 1MU2B 1UL3A 4MKAA 2P9EA 4DG1A 3HHLC 1X9WA 1RWOB 2WSFC 2E1MC 1P27B 4QW9A 1WEXA 1QVGR 1FRKA 1PJ7A 3SYZA 1VQ8S 2QA2A 3KNAA 2VBWA 4FN5A 1ZM2A 2GCFA 1RU2A 2AF6A 2PC6A 1LXNA 3KUHA 3IM8A 1BWEA 1C1CB 2Q43A 4QPTA 4D3HA 1RWMB 5FLXY 1HPZA 3V4IA 2VA2A 2UXDJ 2C3OA 1LW2A 3HSDA 5HQ8A 2OEMA 1UWBA 3N79A 4KO0A 3PRBA 3GE9A 2JX2A 2O67A 1FRIA 4WPAA 3RJMB 3BBBA 1WD6A 3WDOA 1RYRA 1RT4B 1LWXA 3BF4A 5ETKA 2B4OA 1CSJA 4OYXA 3OUYB 1JNRB 3W9IA 4OLOA 1UA1A 2GVDA 2QYCA 2OI2A 3S8SA 1RT1B 2DHGA 3LTOA 4J37A 1HHQA 3PW2A 2JEFA 3M6VA 2OTLS 2AJ4A 2BOAA 3DGPA 3ETOA 1FRMA 2CIMA 2PSZA 4LRAA 4KT0C 1RHJB 4Y28C 5A6WA 5HQMA 4NXMJ 4C8ZA 1PG5B 3B82A 2ZHAA 3QT8A 1FI4A 2CQ4A 2ADCA 3M32B 4LR7A 4GVLA 2HQGA 1JXVA 1KQFB 4HI1A 1X60A 3C15B 2FHOB 2HWIA 4WU3A 3TOQA 5ETMA 1TKTA 4PG4A 1SJFA 3D28A 2QRRA 4U96A 4DSFA 1SH3A 4CLZA 3M30B 2B8QA 2E7XA 3F56A 3PKMA 1VBYA 4WCEQ 2UUAF 2W9CB 4MKYA 3ITHB 5M2UA 3PZPA 4R8UA 4V19J 4MYTA 2RU3A 3LAMA 4TQRA 2QA4S 3NMRA 3SXLA 4YOEA 1HWKA 2F9JA 4K2JA 2CQBA 3HVRA 2BX6A 2C2OB 3NOCA 5K8MA 5MLCV 3OR2B 4I2QA 2PMWA 1RT6B 2NCKL 2RU9A 4DV2F 1Y7PA 2VKZG 3FBFA 4HTIA 4GC7A 1RT3B 1TMMA 3QGIA 2B7BB 4OI2A 4ECRA 1AZSA 2CQIA 2QO3A 1PSDA 1WKJA 2ACMA 1C0UB 1KP6A 3JQKA 3R6LB 4TQSA 4QWCA 3LGHA 4DQSA 1KTQA 4EYHB 1ZAVA 5T14A 1GMVA 2ZBRA 1TUGB 1FDAA 3CCZA 4MYUA 3V81B 4M63A 3D0HE 2XLIA 1FDDA 2JSXA 3AOBA 3KHHA 1M5VC 1CG2A 2GFFA 1S4EA 5FLXU 4BWMA 2OO4A 1IKYB 2ZE2B 1XBWA 3KNGA 5THWA 4CO5A 2YX1A 1Y5LB 5C25A 5AE1A 1HW9A 3VAGA 4DUZJ 3UVJB 3IG1B 4USVA 1WACA 1UEKA 3KTQA 4FF1A 5HMWA 4OQJA 3LP2B 3W1YC 2JC1A 3E2EA 4QR1A 5E3RA 4PQAA 4LR9A 5ETPA 4DUTA 2GHVC 3MAHA 1BE4A 2EI5A 2EKYA 2UXCJ 1CULA 2MJUA 1SUQB 4CNYA 5CQGA 2OSQA 2PA8D 3MECB 2Z2YB 4K5RA 2XNRA 4J9NA 4YDXA 5B09A 1XMBA 3TWZA 5KTQA 2IBOA 3VVUA 1MMNA 2LCWA 5F0WA 3ULHA 4DG1B 4ZJQA 3TEHB 1KVKA 3ZZUA 5D15A 4PG8A 1VC0A 3MM5B 2HHHJ 2VL1A 2EFNA 1IKWA 3DM2A 1PYTA 4O3PA 2CWXA 3H40A 2E7VA 1U1MA 3H90A 4ED4A 1E6YB 2L08A 3PJ9A 1Q78A 3IMQJ 1KFSA 1XNQF 2AEJA 2W4DA 2XY7A 1TV6B 2VJUA 4CDIA 3W3SA 4FKYA 1OIAA 2PMZD 1LWEA 1D8ZA 3K89A 1HPZB 2ABYA 2NZCA 5E7OB 3ZTPA 1SC6A 3CDUA 4OYPA 3SI8A 2KHDA 2HQ3A 4OV1A 1PO6A 1U0HA 2DNYA 4UUWA 3V4MA 4C97A 2PFDA 3I9ZA 1QY7A 1H2TZ 2IC3B 3RBDA 2UVWA 1R27B 1JLEA 2CRLA 2DXDA 3O5TB 3CJKA 5A8WB 3M8PB 5KFBA 4ZPWR 3V6DB 3HSGA 2UUCF 1BQMA 4MFBA 2VBXA 5K9FA 4Q44A 3TUPA 4KJIA 3BGFA 4WFAQ 3IWXA 2Y9HA 3K5MA 5F8IA 3MEGA 1YRXA 3MM8A 1BC6A 4ZVRB 1WKLA 2RH3A 2VV5A 5E2QA 2VG5A 5EWEA 4DF4A 3RAQA 4OZNA 2AX0A 3KLEB 4MK7A 3QZ8A 4TY9A 3CW2C 3QWUA 5D0GA 4K4YA 2VQFJ 1KWMA 4O3OA 3BGUA 3DMJB 2YKPA 4DS5A 4B9NA 1XNQJ 1Q53A 2GAGC 3R1HA 1X4FA 4LR8A 2A2DA 3QNWB 3OLAA 5K20B 1XWLA 4RW9A 1VQ4S 1H6KX 4RW8A 3T5LA 3ITHA 3KLHB 3I5BA 3R2CJ 4KGZB 1Q5VA 1YSJA 2QMUB 3BH6B 2FHMA 5CCMA 1W26A 1IXKA 1ITPA 2YXLA 1QVFR 2G0CA 1S49A 4ICLA 4P7VA 3KJVA 2JEIA 3GV8B 2W7AA 4QQBA 3QGGA 3BKFA 3M9OB 4DSJA 4FBUA 3ELHA 3ETMA 4LF8J 3FMWA 4GO7X 4LFBJ 4GMKA 1WNEA 1Q8BA 4G6VB 4ED1A 3O44A 2BVZA 5I3PA 2A2CA 2IRYA 1F9HA 3AHPA 2J8SA 1FVSA 2HBYB 3MD3A 2YH1A 1ZZNA 3FEZA 1J5OB 4C3MA 2C3MA 4RU2A 2UUBJ 2VKRA 3G87A 3JQMA 3LO3A 4KE5A 5HATA 2P8IA 2Z4PA 2YNIB 4XIUA 2ZH7A 4MMOA 3UD5A 1JJHA 3HT3A 4CZCA 2FLPA 3J7ZT 3MUMP 1BXNA 2R7QA 2YBVA 1SL2A 4YB6A 3AD9C 5KFAA 2XB2D 1HBMB 5CAAA 1DTQB 1H2UX 4YY3J 5C25B 2RUGA 2MQQA 3OHAA 3HSJA 2V5HG 1RSCA 2B9WA 2I0XA 3VF0B 2ZEJA 4WKYA 2FGOA 3HKZD 2ZJQQ 3IAS9 1JJ2R 3GR1A 4NRTA 4ZCMA 4OYOA 1GFWB 2M7SA 3DLKA 3GG1A 2MGZB 3EICA 3DLLQ 5DM6Q 4QW8A 2YNGA 3BDEA 3M8WA 3V5RA 2NXEA 5T7LB 2MQPA 2KJWA 3MUTP 5IT9U 3EGWB 2ZD1B 2MQNA 3NCPA 3SZ2A 2OPRA 3TA2A 9RUBA 3CMAS 3QRQA 3G6XA 3KUGA 2HS0A 4OMFG 4ELUA 1RWNB 2Q6CA 1FHTA 3QAUA 2V8GA 2OPQA 1A6LA 4O44B 3FUYA 3D0IE 3NS7B 4HLBA 4QOTA 1K44A 1VBKA 3MM5A 5EX0A 5L9XA 4IOAQ 3W9HA 4F3OA 5ITHA 1SJ3P 1IKXA 1RCOB 2HVDA 3C8YA 4KHRA 5B7WA 1CJTB 5KG5A 2GIFA 3QRPA 1V5VA 2HK2A 2JVRA 3FSYA 4J91A 4NYOA 3PO5A 3BSNA 2G4BA 1RTHB 2HRYA 1LOUA 3DYAB 1WG1A 1TKXB 3DN9A 3OHBA 3OL8A 2V8DA 1REVA 1TL7A 3JAMU 2ZITA 1D1UA 3DLBA 4DV1J 1N5TA 1VHFA 2B4VA 3C14A 3MM6B 4L3NA 3DLEB 3MD1A 1JLEB 1HNIA 3GP9A 4NLPA 4KC5A 1RBAA 2HFSA 4Q2MA 4ZP7A 3CJKB 2I6WA 4JI5F 3R97A 5F9NA 2GIQA 4Q45A 2LA6A 4ETZA 1RT2A 4K4XA 3OL7A 3BBFA 1TUWA 2DBBA 1S6QA 2F63A 4KKOA 3MMCB 1OYEA 3CJ5A 3EXYA 3OVAA 3IM9A 4U7UD 3C6UA 2H5JB 2QC3A 5HJYA 3MURP 2VG6A 4J9SA 1VQ9S 2XYHB 3TEGA 2VOPA 4C3LA 2HHPA 2DGUA 4ELVA 2EW9A 1QJHA 1BY9A 3NS6A 4ZPDA 3TA0A 1NRKA 4CLFA 2XTJP 3MZIA 5CYMA 2R2SA 1YK9A 5LMUJ 1HNVB 2YKNB 2ZDOA 1S9EB 4KRWA 4J9PA 3ZTRA 2HGLA 4CYUB 1YJ9S 4CO4A 1VRTB 1NK4A 3QYYA 4OZ3A 3T41A 1S97A 4JUZA 1I51B 2F5GA 3KLHA 3SCIE 5A6PA 2UUBF 1V3SA 2DISA 1KHVA 1REGX 1WHWA 1UWAA 3ADAC 4HI2A 3Q8PB 1T03A 3FBCA 1FRXA 3AA9A 1X4AA 4ICLB 1FA0A 5DLFA 1A9NB 1JLAB 4C0OC 2D9OA 5EN1A 4K0KF 3P96A 1HI1A 2F3JA 3G8TA 2HNYB 5A76A 1SJQA 4G3IA 4C4WA 4GKJF 3MMAA 4I6AA 1JB0C 2DKOB 3GPAA 4NLXA 3V6HA 1U24A 1UVKA 4A8KA 1VOMA 1XJWB 3WIVA 2PEHA 1TELA 2Z0GA 4M8LA 3CULA 1JJ4A 5JUMA 1QSYA 2KYXA 3ZNUA 2A0FB 3GCWP 2HHTA 4J90A 1FWPA 2RQKA 3G6YA 2DNPA 2M9KA 2VPYB 5IV4A 1S59A 3A12A 4CH7A 4UUXA 3F0NA 1YX2A 1RA7A 4MIBA 2H5EA 4ZCLA 1Z2ZA 3M2RA 4ZHRB 2ILZA 3C16A 1R8BA 1JKHA 1NEEA 2HLUA 2OMOA 1Q5YA 2X3DA 3DFEA 3FK4A 3M2VA 1S9GB 1CQNA 4N8OA 1F5BA 1RWVB 4QJVA 4C6AA 1DRZA 1S1VA 2Y8WA 4FVCA 3I31A 4ANCA 1Y5NB 3UN5A 1ZTTA 3HF5A 1RAGB 2PN6A 1F1BB 3UE2A 2ZNYA 4J9KA 1SIZA 3HFZB 1S6PB 2KT3A 3PW5A 4EEYA 4LFBF 4ZCIA 1RT1A 3DLKB 3MM9B 2XWXA 4JI2F 3H4DA 3MEDA 4DN9A 3IRXB 5ETLA 3RAMA 3DU6A 1CC8A 1HWUA 3CJ2A 1U49A 4KHPF 3ONQA 3NLCA 3QLHA 5IT9Y 1YJTA 1NUEA 1HR0J 1SV5B 2EFQA 1KQKA 5E3PA 3L7UA 2XULA 5CH7B 5J1EB 2CKWA 1RHUB 1NJWA 4ES3A 3HFVA 4ENOA 4DL4A 9ATCB 3QWPA 4M5NA 3HO1A 4PUOA 4CTAB 1F9EB 4BC7A 1N5YB 3DI6A 4YY3F 1NJXA 4P75A 3SFGA 1ZZFA 3RBZA 5K8OA 2W9CA 1CJTA 2AYMA 1X4BA 2LQJA 3M2UB 5DJBA 2ADBA 5F8NA 1TL3B 2FJDB 2FZCB 2BV3A 4H4KC 4M1KA 5HJXA 2V2ZA 4PYAA 5C24A 4AYBD 1EQ0A 4ECSA 4HDGA 1T3OA 4DPWA 2AGOA 1FE4A 1FJEB 4GKKJ 1HKAA 3G82A 4XDCA 2Z57B 4X2BA 4P2XA 5T41A 2CQ3A 2QA4G 1Q7LB 2CDRB 1VQ5S 4KHMA 5HL7Q 1HHSA 1TK5A 1CS4B 2N82B 2V69A 4AT1B 2JNJA 5IV3A 1KLMB 5M2PA 1M1KT 5IXUA 4QWDA 3CXCR 4XPCA 1RTDB 2XS7A 3MTJA 4I6WA 1JLBA 4P2FA 4RWWA 5J2QB 4IH5A 5DDPC 1S48A 4KGVB 2ZOMA 4BCAA 3D3BJ 2ZH9A 1DARA 3BH7B 3MMBA 2IBKA 2JDJA 1UP1A 3SV3A 3RYLA 2VASA 1UVLA 4F4KA 4OI1A 2A10A 1PILA 3BGOP 2J9DE 3CJSA 2E9ZA 5KFVA 1LK5A 3HD1A 1C1BA 1JIHA 3N6MA 2ZUGA 4DPTA 1S0NA 2VFRA 4LSZB 1RTZA 5CYMB 1NHUA 4WFNQ 3RUBL 3Q8VA 3U1LA 1S9EA 2UXDF 3IGNA 4CYUA 3H25A 1JQGA 1EQMA 1JXEA 2QN6B 2RIJA 1NDPA 2CJXB 3ICLA 4H4OA 1B99A 2B0GA 2FDNA 1Y4ZB 4XDDA 2H65B 2KG0A 2AGQA 3W61A 2DGQA 2D3OR 3W2VB 2FY8A 4Q0BB 2DNKA 5ETSA 2RT3A 1O6XA 2RE1A 1KQSR 4JI6F 2FQQB 3FRYA 2M52A 2W2NP 3IFEA 3J7A1 2AYEA 3ZZPA 3O6QA 4OX9F 2DY1A 2WOMB 2HK3A 3AB2B 4P71A 5KT6A 4K2XA 3V6JA 4DXLA 1HD0A 2GX8A 2GIRA 4LF2A 3RGIA 4MKBA 5AXNA 2OD6A 3QGHA 1TAUA 3J81j 4F4AA 4FDFA 1AUSL 2VONA 2CJKA 2VFSA 2R8IA 1PBAA 3GJSB 3KXDA 5CA5A 3OR1B 2XS5A 2H54B 4NEYA 5KG6A 3KK3B 1HYSA 2K3KA 3E8OA 3BGRB 1NK6A 2CVEA 1UFLA 3IGVA 2RRBA 4ECVA 4NLTA 3FGVA 4ZK7M 2R8JA 2MQ8A 2RS2A 3PEJA 2YQ3A 1VDHA 4K5SA 2HFVA 1UMJA 1HW8A 2DNGA 4JP8A 4C3KA 4MK8A 5C2CA 1IBLJ 3VQTA 5EGYA 3G6ES 3A1YG 5KFJA 1YJWS 2AYBA 3KG0A 3DRSB 2D1CA 4L3KA 3QATA 2PEBA 3MM9A 4FF2A 2VICA 2O1PA 2J7WA 3G96A 3H5XA 2GJ2A 1M90T 1RAOA 2Q66A 4ILMA 2CQ2A 2B8PA 4RUAA 4JV5J 3JXOA 3THPA 1HBUA 2M8DB 5GADU 5FDLA 2F8EX 3C66A 2XGQA 4F36A 4EK2A 3P6YC 2ZKTA 5LXRA 2GC8A 2HGMA 2XMMA 2HIYA 3D6TB 5GMDA 4TNOA 4DZDA 4YDDB 4NPOA 3SSRA 5DG7A 2NPFA 4LF5J 3T6JA 2MLYA 3M30A 2OUGA 3UDVA 4F04B 1S4FA 2PT0A 4RW9B 4WFBQ 1WI8A 3KJNB 3M9MB 2JLFA 1L3KA 4UOHA 4DUYF 5LMUF 4CO1A 3CC7S 2D3UA 4ZS6A 2QZ8A 2W8LA 1U2FA 2J7UA 2YNHB 2JL9A 3OPKA 3UDLA 3ENAA 2NUUG 4DJBA 1P9QC 1ZAXA 2KXHA 4U67Q 3NAIA 2I5JA 3LP1A 1WUUA 3G82B 2P6SA 4ZCKA 3MEEB 4Y3CA 2IVFB 2KG1A 5FJ4A 2RSQA 2Z2ZA 1V3RA 3CDAA 3D7SB 1U0SA 1WC4A 4DX6A 2WTFA 2NYIA 3QSIA 4ZVFA 2JC0A 2DHSA 2CQPA 2EWHA 3VQSA 1T9WA 3W2WB 1TVRB 1AZSB 3GFXA 4YR0A 4M5DA 2KO1A 2BE2A 5KOWA 5DG8A 4B3TJ 1JK9B 3EE3A 3PYGA 5F8JA 4B9LA 3W9JA 4FYVB 5B0CA 3I0RA 1UJ4A 1JX4A 1Q7YT 1R89A 2M3DA 3W64A 3HI9A 1R43A 2RHSB 4YQWA 2NUHA 1KQGB 2KJVA 2AQ4A 1DFDA 1XNRJ 2C1EB 1J2VA 2CPJA 3AODA 5HVGA 4PXCA 2FC8A 3AT1B 3I0SB 4UW2A 2FLOA 5J2NB 5HBMB 2NSBA 1RBOB 2GQCA 2VPWB 1LKZA 4HACA 1N5SA 3GYNA 3B4MA 2DHAA 2VHGA
chains in the Genus database with same CATH topology
1VQYA 3FEYB 2MGZA 3CCES 4FS2A 2B5JA 2XWYA 4IFYA 5IT0A 1HWLA 2AWZA 3T19A 1KONA 2VBYA 3CIZA 3RTVA 2V4JB 5I4MA 1VBYA 4ID8A 1URRA 2PDAA 3ZC4A 1JLQA 2QSWA 2XY6A 3C6TA 2VFTA 2H9ZA 4ES2A 4ZMMA 4C8YA 1YG0A 3DU5A 3TARA 3MM7A 3HVTA 3GILA 2RKIA 4NCGB 3VZHA 2ATLA 3MPVA 1VFJA 3UQSA 4YUDA 3WC2A 3O8WA 2FPHX 2YH0A 3OR1A 1Q8IA 1EETB 2PI5A 4PPDA 1TV6A 1H38A 1HFEL 1X5TA 2XLKA 3WZ0A 1OO0B 5IQ6A 5DRKA 5J1NA 3PY8A 4MIWA 4WXOA 5KG1A 3N6NA 4U7UK 1DQ8A 2DNQA 1HNIB 5LJ3Y 4N47A 3BN7A 1RQ0A 1SKWA 3L7OA 3POTA 2F8MA 5IM0B 3PW7A 1KR4A 4I7FA 6FDRA 1WHYA 2E66A 4EZ6A 1AW0A 4N5SA 1FERA 3FVYA 3BEGB 1Y9OA 1S6QB 2QV6A 4KKOB 4RW7B 2ZBIA 1ROFA 3AQOA 3MEGB 3L95X 4NZ0A 2VBZA 4MAKA 1ZM3A 1Q79A 4QYRA 1R8CA 1TAQA 2B56A 1X9MA 4O4GB 2O01C 2IM1A 2KI2A 1IKVA 2NR0A 4UY85 1R8PA 5KFZA 1FESA 5EWFA 5KT7A 1HNWF 2P5VA 5CZVA 4A8MP 1FD8A 3JTNA 4ECZA 3Q23A 4PCQA 1VIOA 4FPRA 2K3IA 4Q2LA 4RW4B 5C5JA 2GNKA 3QJJA 1TQLA 2LYVA 4A48A 2QE5A 2FVPA 4FBTA 2L9DA 5K8PA 1TL1A 3CDBA 2D3ZA 1H98A 2AJ0A 1TP7A 3D2WA 2DNOA 4O3RA 1NZAA 1KHWA 1WI6A 3GFYA 2RF2A 2BUNA 3JYTA 2FJEB 4ILRA 4PXEA 4Q43A 1CVJA 2V4RA 1G7CB 3G86A 4CT9A 2AU0A 2BQ3A 2B4UA 3W2WA 1R0AA 4KR0B 3TI0A 3I56S 4DR7F 2ZH5A 1B0VA 3K2YA 3G9CA 1U4BA 3CD7A 2ZH8A 2DGOA 1SJRA 1E6VB 4HT7A 1SH0A 1U8SA 1X4CA 2R2UA 3HHLA 2CPXA 1YJUA 4DV3F 2IRXA 4ZPVR 5GAHU 4X4PA 1IN0A 5KG2A 4DPOA 4DWIA 1HBNB 1C1CA 2Z8QA 3H5UA 2CPFA 4OI0A 1HARA 1S1XB 1SH2A 2C2RA 1S0MA 3PR4A 2UVRA 4ECQA 2BYCA 2ZJPQ 2ZFHA 4RNFA 5KT4A 5HLFB 2J6UA 3MEDB 1O0PA 1LWFB 3PO4A 4EBEA 1L5UA 4IRCA 2W9BA 1HWJA 1VRUB 2DO0A 2U1AA 2LXUA 1UEUA 1SL1A 4EUVA 4ERDA 3OJUA 3KG4A 2DRBA 2EVZA 1X9SA 1KSPA 1M5PC 2R4FA 1GXTA 2A3JA 4CTAA 2KH9A 2OPPB 2ZOFA 2YWEA 1BLUA 3K0JA 2FC9A 4BC9A 4NYZA 2MZJA 4IG3A 1TZ0A 1HQEA 4R8UB 2CYYA 4ZLPA 2M88A 1FJCA 3NMAA 2RRNA 2XHWA 7FD1A 2XMJA 1NO8A 4K4TA 4ECWA 3K8WA 3CJ4A 5JJBA 4ED0A 1R8AA 2VUGA 1XR5A 3HDSA 3H5SA 2KM8B 4TN2A 3M8QB 1NK0A 3GQCA 4OX8A 4ECUA 4WIIA 3MF5A 5G4DA 1N52B 4J5OA 3WBZA 1Z1ZA 3EZUA 3V81A 2LQBA 4UQGA 1TKDA 4ATNA 1FRJA 4C7QA 1HBOA 2R7XA 5DGAA 2CPYA 4IG0A 4Y2MA 3GMGA 2IYIA 3HX9A 5DS7A 4OIXA 2YX4A 4H4OB 1RTJB 3KFWX 4P6QA 5J2MA 4ED7A 3T1HF 3DOKB 1FTCA 2F1FA 1VQOS 1AXQA 1H0HB 4OHZA 2X51A 3MGJA 1U1KA 2W25A 1C4CA 5J1PA 1U25A 3NBPA 3NKYA 1K1SA 2M4MA 2ZVSA 2J76E 4I2PA 3THVA 1XMOF 2VG7A 3ZFVA 5IWAF 1VQ7S 5U47A 1C0TB 2UU9F 1S1WB 1NKEA 3DRRB 4OZLA 5LSOA 3SSQA 4TY8B 3VAKA 5KFMA 2DRAA 4K59A 3G8QA 3MUVP 1Y00A 4NMLA 2HMIB 3JSMA 3PIOQ 3PKYA 4RBTA 5C42B 1LV5A 3U1NA 5L8RC 4KFBA 1OPIA 1U1LA 3NWGA 3TAQA 4IRDA 4QWAA 5F0UA 2FLNA 3KLGB 2F8HA 3WX4A 3J80Y 3CCRS 1JLCA 3KWMA 1RTIB 2HG4A 1T05A 1S6PA 3I4HX 5HO4A 2KT2A 1CPZA 2C3YA 3CDWA 3HXMA 3MWBA 4A4JA 1FF2A 1Z4UA 2UXCF 2LDYA 3CCUS 1CC7A 1RAJA 2IM0A 3LP0A 3TUJC 2QFJA 4ECTA 3UW1A 1L3TA 2NPIA 2FY1A 3C46A 2XSFA 3K5LA 5DQGA 4XAKA 5GVQA 1D9DA 1D9AA 3FSXA 3BR9A 2W8KA 4ED3A 1U1NA 2HHTA 4JI8F 5LMNF 2HAIA 2POKA 3N5FA 4OJHA 1GTHA 3VALA 5CYQA 3I6PA 2LU1A 3RBEA 4PKDB 2DIVA 3QIDA 3Q8QB 3M1VB 4ZP8A 4ZDNA 1W2IA 3F44A 2MKSA 4PG7A 4JI0F 4AUKA 4ZPBA 1VC6A 1QAIA 3IS9A 5D3GB 5E5NA 2ASYA 4DSKA 3C3LA 2IM3A 2DTJA 4NLVA 3CF5Q 4CH0S 4Q8EA 4FF3A 3H4BA 4WU2A 1TFWA 3HHDA 1V6HA 3QZ7A 1YJRA 3CCMS 4DR1F 4KGMA 5A0YB 4QYZJ 2GHPA 3RRKA 2F7VA 5L1JA 3IR6B 4Z2XA 4IFVB 4DHVA 5CYJA 2R9LA 3J7YI 1JLBB 4FP9A 3R1LA 4AFFA 2MKKA 2HHQA 4DF8A 3KKFA 1LK7A 3PHEA 3ZZ0A 3BO4A 1XK8A 2R7WA 1S1UA 1TL5A 2LVWA 1N5VA 5GAHI 4OHVA 2W24A 1ZBTA 3IXQA 3U02A 2MSTA 4ECXA 3D1OA 5KFDA 2CZ4A 4OX6A 5F8MA 2P6TA 4WFXA 2GQQA 2XC9A 2W7OA 3SQGB 4WKRA 4URSA 1XR7A 3SEOA 3DOKA 3K5PA 3OUYA 2JH3A 2AGPA 2K1RA 4GC6A 1N6QB 2PE8A 1IQZA 4R0EA 3BREA 2GQ2A 1JLQB 1QSSA 4GO5X 3LQVA 2GO9A 3LPYA 4K4VA 4AXIA 2DO4A 3UD4P 2WOMA 3AJ2A 3I5CA 3SMZA 4IYQA 3RB4A 5KG4A 2ZD1A 2FJBB 4LSNA 2N7CA 3OW2R 4JV2A 3KK1A 4F4XA 1R8HA 2IYGA 1VBXA 4KTQA 3JB9k 3KK2B 4DN0A 4CIOA 2ALZA 2MY7A 3JSBA 5BJRA 1N54B 5F9LA 3KHGA 2R7RA 1ZETA 5E3AA 2MQMA 2XCPA 1CLFA 1LW0B 2XMUA 3PXGa 4KPYA 3X1LB 4RLEA 3OTCA 2CG4A 3CCWA 2BA9A 2OIHA 4ZPCA 1TUVA 3VR1A 4F4ZA 1MNEA 4C11B 2PIIA 4QIVA 2YWFA 2UZAA 3GYXB 4ILLA 5IM0A 1XERA 2XG8A 4I7FB 4OZJA 2FLLA 4A47A 3QJPA 3RW7A 3FMBA 2E5LF 5B0BA 4DFKA 4NLGA 3S6EA 3DLHA 1C4AA 1TKZB 5E3QA 5KG6A 3O2IA 1UFWA 5EHHA 4IO1A 2QLXA 2JZ5A 2E5HA 2FHKA 1IJFB 2IMWP 1SBRA 4O4GA 3HLUA 3C2PA 3HFKA 4B17A 3QJLA 4B3SF 2GJIA 1XN9A 5J2PB 3NGKA 1HBUB 3QPIA 3FSIA 3OXGA 2AV5A 4C8NA 4WF9Q 4DSIA 4OI6A 2OTJS 5AXKA 3EX7B 1S1TB 4TYBA 3TAMA 4FXDA 2CFXA 4NRUA 2YKNA 1HNVA 1FRLA 2Y1RI 3JTPA 3N4WA 3M1VA 3CGIA 2WSCC 2VFVA 1T7PA 1FDNA 2RILA 2KXNB 3HPOA 3SCLE 3NRBA 1B0TA 5A8KB 3M8SA 1M5KC 5IS2A 4MTPA 5D4PA 5KFIA 2B43A 2MZRA 2MZTA 4KO0B 1M0SA 4FNIA 3U1MA 3X3UA 2GHWA 1YQHA 3MECA 3DDKA 4C8KA 2L41A 5KFLA 2XI3A 2DITA 1FNMA 3QMQA 4I0WA 5GADI 2J0SD 2DGWA 3PX4A 3OBIA 4LIRA 3HHLB 1F0XA 4LMZA 5DO2A 3HM9A 3Q8RB 2JEGA 3CT9A 4B9SA 4A8QA 4K4UA 2MKJA 3M32A 2G13A 4PPZA 1B64A 1S1VB 3CE8A 3TYTA 2IJFA 3IC1A 2HHXA 3I0SA 1WELA 1S1XA 3M2VB 4LF7F 5DGBA 4HYKA 1UJ6A 2FJAB 2VC1A 3BQ1A 4LVOP 2OMLA 1RT5B 3MEKA 5E33A 5A8WA 1SKRA 5HLFA 1TL4A 3OFHA 1YRTA 2IAJB 5CHCB 1FKPA 3VAMA 3IRXA 2KZMA 2BABA 1UKUA 4Y65A 2EFOA 2DJWA 4NA3A 4QWBA 3VAFA 3PW4A 1NB7A 2DR9A 3MM8B 5A8RA 1MWYA 2RDIA 1Q1KA 4BHQA 3L3CA 3MHYA 4LSNB 3DOLA 3HVWA 2X1FA 2HS4A 3G8SA 4PUOB 2DGSA 3L7PA 4PQUA 3OFEA 4HDHA 2C3PA 5MAOA 1NJZA 2KTQA 1K8AT 3Q2SC 3DDNA 2JLGA 4UY8T 3OFGA 5EX3A 1D9FA 3OSNA 1EETA 1KC8T 4DL6A 1P8GA 2OD4A 4B9TA 3H2VE 2JJ4D 2B9XA 2AX1A 2K8GA 2PMHA 4Q7AA 2DR5A 2J6SA 2VOOA 4EFAC 4H4MA 1N88A 2GMLA 2HZCA 2B6AA 3PNIA 2ROPA 3H98A 3T9NA 3LWLA 1D8YA 2C28A 2O66A 2U2FA 3D1HA 1TK8A 2L9WA 4OHYA 4PG5A 1F60B 3TVZA 4XPEA 2L3MA 2JEJA 2MPUA 2HHHF 2DNMA 2FVSA 4FZVA 3US5A 1EP4B 4R0JA 4E8UA 1DAXA 1X4HA 1RT3A 1YHQS 4ZVGA 5G0RB 3O3LA 1KEKA 2YVSA 2Q1LA 1FJGF 2KFZA 4G1QB 4NLRA 4TYAA 4M94A 2DNHA 2EBGA 2HNDB 5F8GA 3T3FA 2HFZA 3MR2A 1NKCA 5KFSA 4F67A 4H54A 4ITSA 4O3SA 4Y2CA 1KLNA 4WK1A 2GMJA 3RU0A 5L1KA 5HROB 2IA6A 5H9FJ 4NCAA 4OL8A 1DLOB 2XEXA 1UVJA 4RZRA 1X4EA 3LGNA 3NBPB 2RJZA 1V3ZA 4DL3A 4ID5A 5KFQA 4YB1P 5E0OA 1T94A 2ZZNA 2FJXA 2CPZA 1FD2A 1SJ1A 2VQFF 4DS4A 3DRYA 3ZZRA 4NXMF 4QR0A 4ZKAA 1N36F 3DRXA 1JLGA 5EDWA 1ZTWA 1R0AB 3DC2A 1VJWA 2L48A 1DZ5A 2OPQB 1FCAA 3LGMA 1D0EA 3OL9A 3Q22A 5K14B 2CJBA 5AE3A 3TW0A 3PACA 4K4SA 4FXWA 3TANA 2HS3A 1GAOA 1GNKA 1N32F 2M5YA 1HYSB 4H4KA 2XMWA 2EFVA 1VQLS 3FDSA 3R5CA 1RTIA 2XS2A 4Q8FA 1KFDA 1QSLA 1JMTA 1YWXA 2XO7A 2JHEA 1S79A 3DLEA 3DRSA 1RTDA 2GA7A 2HW3A 3NAHA 3SSSA 5HN0A 4EZ9A 4B3OA 3RB6A 3CDEA 5DETA 4HVZA 3CCVS 2MDAA 2O5DA 2PGCA 5A8RB 4R5PB 2UP1A 4NLUA 3VTIA 2BJEA 4ZPTR 2RD5C 2VG5B 3HJFA 1Y0HA 2B3TB 3BSCA 3DOLB 3T6BA 2BR0A 3FFIA 3NGDA 4B9VA 4EO6A 4QR2A 2OLWA 4KB7A 3TO8A 4OHXA 4LF8F 2MYFA 2E5JA 2GV1A 4AE5A 1IR0A 1LFWA 3BO3A 1N34F 2EC0A 1APSA 1N0UA 4OFZA 2KFYA 2XMKA 2E1CA 4WE1A 3OXLA 4ZVEA 3RR8A 4LSLA 3W7BA 5GAGI 5D4OA 2UV8G 4OI3A 5DDQC 4DSLA 2RVJA 1QUVA 1RT7B 1XC9A 5KFUA 2DH9A 5HMZA 1NK5A 2HNYA 2ZHBA 2VD3A 3MPYA 1ZM9A 5KFYA 2K2PA 4ALZA 5KOXA 2F4VF 4RNHA 2GGPB 3I0RB 4AL5A 4DR4F 3PX6A 2E1AA 2Q79A 5IT4A 1RKJA 2O3DA 1Q81T 2V8VA 3GFHA 2DK2A 4KIAA 4MH8A 1JKHB 4YP3A 4LF5F 2B51A 3DRPA 3E01B 3D5MA 2ZNZA 3PJXA 4QIEA 2W7PA 5HBMA 5HROA 2LQ9A 1WTBA 2IA0A 1SIWB 2LKZA 1FTRA 4NWBA 4RW6B 3J7Z5 2VB6A 4A8SA 1KD1T 1NU4A 4DFMA 2K7JA 4HT5A 4DL0C 2PFFB 4QPXA 2DH8A 4L72B 1KVIA 3T9ZA 1URNA 4QU7A 3OR2A 4I2QB 1MMDA 4C8LA 3QLHB 1JLGB 4OX7A 1XEZA 2DT9A 3L09A 1O51A 4DOZA 1C0UA 2AJFE 4USIA 2C2DA 1V9OA 3KLIB 3CIMA 4PWUA 4O3QA 2MZ1A 1S7HA 2B7CB 2BACA 3NS5A 5C42A 3IO1A 5BYSA 5AXLA 3MMJA 1QE1B 2CQCA 3J7YU 5B08A 4Y34A 1RWUA 3NNHA 4QCLA 1YRUA 2D41A 2JOQA 3I4PA 3DLGA 5HMXA 2DVIA 4JV1A 1J5EF 3EGZA 1KLMA 4QBUA 3EZ5A 1H2VZ 1P1TA 1B0PA 2HNZA 5B0GA 4Y0FA 2ZM6F 4IOCQ 4B3MF 4DDFA 4Y00A 1FDBA 2DPJA 5J2PA 5LL6d 3BN4A 2OPSA 4YFUA 1U26A 2CDQA 4OJ3A 2M2BA 2LDIA 4F50A 4NLYA 1K0VA 1C1BB 2RQ4A 3P3DA 2LECA 1F2GA 3E3XA 5B0EA 4J9RA 2HVZA 1N5QA 1HWIA 2NS1B 2KN4A 4KSEB 5DDOC 3DCAA 3VAIA 3T5KA 1GTEA 3JYTB 2KFNA 2HRUA 1MMLA 1DBDA 3LP2A 3NNAA 1HNZF 2LU2A 2XY5A 3GV7B 3GFZA 1RT7A 4OI4A 3AA8A 4EU0A 2EFPA 3EXCX 4YR3A 3Q8SB 4YB7A 4MFBB 5LT5A 2YKMA 3M05A 3UD3P 4I4BA 1VIXA 2YNFA 4PXBA 5LSLA 3SDEB 3HKWA 1SXLA 2QMWA 2XSJB 4RNMA 3MFHA 1HL6A 3CO9A 3IRWP 1KRPA 5D78A 3UFCX 2N3OA 2X1BA 3SV4A 5J1EA 2CPDA 2I8EA 4WTYA 3HHNB 4B9UA 4DV7F 4P7TA 1O5JA 2IVMA 5D77A 4C0BA 1TKTB 4KQZA 1RA6A 1S9GA 1OSCA 1SI9A 1U2RA 1OQ3A 1RJJA 3DI6B 3N28A 3OTEA 4HL9A 1GH8A 5F3ZA 4NLDA 2R8JA 4X66F 3BQ2A 1JXLA 4X65F 2WONB