3S7RA

Crystal structure of a heterogeneous nuclear ribonucleoprotein a/b (hnrpab) from homo sapiens at 2.15 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
NEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein A/B
publication title Crystal structure of a Heterogeneous nuclear ribonucleoprotein A/B (HNRPAB) from Homo sapiens at 2.15 A resolution
rcsb
source organism Homo sapiens
total genus 17
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s7rA00
4EGLA 2DH7A 2DGVA 4Y00A 2AYGA 2RVJA 2D9OA 1N52B 2LYVA 2FY1A 2ERRA 2YH0A 3VAFA 3P49B 2RU3A 3CCES 2K8GA 3NNAA 1WHYA 1YJ9S 3G4SS 2KVIA 2LEBA 1QVGR 3NNHA 3CCJS 2CQDA 5LXRA 1OWXA 1U1LA 2DIVA 1H6KX 1WEZA 4ZKAA 2MSTA 2RNEA 2OSQA 4WIIA 2KM8C 4YOEA 4WFNQ 1IQTA 1VQNS 5GVQA 2G4BA 2LCWA 3P6YC 2DNGA 4Z2XA 3US5A 1M5VC 2YKAA 2YTCA 2V94A 2DITA 2N3LA 1X4AA 3P5TL 3NS6A 2YH1A 1RKJA 2N3OA 2CPHA 1YTYA 5IM0B 1ZZNA 3MI7X 2MYFA 2M70A 1K8AT 2MKIA 3TYTA 1K9MT 2L41A 3MUVP 1Q86T 2KN4A 2MY7A 2CQ0A 2KM8B 3CC7S 1VQ5S 2DNZA 2JVRA 2DHGA 2DO0A 2MKCA 3DXBA 1VBZA 1U1RA 1HL6A 4C7QA 3PIPQ 5LSOA 2DHSA 5DDPC 2RS2A 2M7SA 3MOJB 2CQ2A 2LEAA 2OSRA 3Q2TC 4IOCQ 1U1NA 1WI6A 1VQ7S 1S72S 1X4CA 1M5PC 5BJRA 2MQOA 2MJNA 3R1LA 2M2BA 2MQMA 1SJFA 1SJ3P 3CCVS 1D8ZA 1Q81T 1FNXH 1FXLA 2OIHA 2LA6A 2LA4A 5HO4A 4J5OA 1U6BA 2CPJA 1UAWA 2EK6A 3B4DA 3NS5A 1FJCA 2K3KA 3FEXB 2M0GB 5GAGU 5GMKa 1M5KC 1P1TA 3VALA 4WF9Q 5EN1A 2CPYA 2X1AA 2LXIA 1G2EA 2J76E 3CMAS 1X5SA 5GAHU 2DIUA 5D77A 2CQGA 3EGZA 1HD1A 1X4FA 3TP2A 5CYJA 3MD1A 2MQLA 2RQ4A 3BO3A 3CD6S 2CQIA 3I56S 3HHNB 2XS5A 3Q2SC 3S7RA 1N88A 5GAEU 2NZ4A 2KXFA 1WWHA 5JVHQ 1R8HA 1QM9A 2MZTA 5LSLA 1PGZA 3R1HA 4TLQA 5IQQA 3I55S 2DGXA 3SMZA 1VQOS 2DGUA 1SJRA 3CCUS 1WF0A 4WCEQ 5CXTA 2OJ3A 3CF5Q 3G96A 3J7YU 2AYBA 2LECA 2MZRA 2F9JA 2X1GA 2X1FA 2BZ2A 1M1KT 2QFJA 5H1SV 5DM6Q 2HGMA 3UE2A 1AUDA 3CCLS 2MKJA 1WHVA 3SDEA 3V4MA 1H2UX 2N82B 3L3CA 4PR6A 3THTA 2J8AA 3VAKA 3VF0B 2KXNB 2DK2A 3VAMA 1WEYA 4YB1P 1NJIT 3B4MA 1L3KA 3MD3A 1JJHA 4LIRA 1UP1A 4QU6A 4UY8T 2DGWA 2KG1A 1KC8T 1VQ9S 2CPIA 4TU9A 1SJQA 2M52A 2MPUA 3HI9A 2JX2A 4A8XA 2PEHA 4OZ0A 1N8RT 1VBYA 2DNNA 2DNRA 2U1AA 3UCZP 3U1LA 2M8HA 1DRZA 2Q79A 5DM7Q 2ADBA 2MY8A 2DH8A 1SJ4P 5MLCV 2ZJPQ 4F26A 2SXLA 1FJEB 2VOPA 2XSFA 1M5OC 3K0JA 1X5PA 2HVZA 2MZJA 2L08A 3CC2S 2E5HA 5IFMA 2XS2A 2J0QD 2MKHA 3VAGA 2RRAA 1WF2A 3RW6A 1YWXA 2HGLA 2X1BA 5DDQC 4FXVA 1PO6A 2E5IA 1YJWS 3G8SA 3BEGB 1A7GE 2M88A 3S01A 2U2FA 5LJ3Y 4BS2A 3S6EA 4CIOA 4TU7A 1URNA 5FJ4A 4U67Q 2XS7A 1OIAA 3CUNA 1X5TA 2MGZA 3G71S 2CPFA 5IM0A 2M9KA 1NU4A 2CPEA 3BO2A 2XNRA 1XN9A 4CH0S 3CCQS 2HYIB 2D9PA 1HA1A 1HD0A 2OTJS 2JWNA 1JMTA 2CQHA 2NLWA 2KYXA 3R27A 4WFBQ 2DO4A 2DNQA 1U1QA 2CQPA 3G9CA 4RU2A 1WG5A 2RRBA 1H2TZ 1U2FA 2CPXA 3BO4A 2D3OR 1W2BR 2DB1A 1WELA 3MUMP 2G1DA 3CMES 5DDRC 2DH9A 4P6QA 1VQMS 4F02A 1ZH5A 3H2UB 1B7FA 1UFWA 2MSSA 2L9WA 2KFYA 1KD1T 1X4BA 1S79A 1A9NB 3N9UC 2MKKA 3CTRA 1WI8A 2FPHX 3CCSS 1KQSR 2VOOA 2LQ5A 2I38A 2JVOA 1WTBA 3S8SA 2DGQA 1YI2S 2RQCA 2KH9A 4WFAQ 1X4DA 2VONA 4PRFA 3CC4S 4IO9Q 1U1KA 2XB2D 1OO0B 1WHXA 2PE8A 4V19X 3IWNC 3UCUP 2DNYA 2RS8A 3UD3P 2KU7A 2ZJRQ 1WG4A 2CQBA 4M5DB 1DHMA 2GHPA 5DDOC 3G6ES 2CJKA 3G8TA 1D9AA 2KT5A 1U1PA 3JB9k 3H2VE 3UWTA 2E44A 2OTLS 4IUFA 4C4WA 1X4GA 5HL7Q 3BS9A 3RW7A 3SDEB 1Q7YT 4Y0FA 3CCMS 2MZSA 1F9FA 2MB0B 3CCRS 1CVJA 3NMRA 1H2VZ 3ZZYA 2G0CA 1YITS 2CQCA 1VQKS 4CQ1A 4LJMA 3UD4P 1K73T 2LMIA 1VBXA 1UW4A 3FEYB 2AD9A 2GO9A 2MMYA 2DGTA 1YHQS 2QEXS 4W90B 1N54B 4YUDA 1KOOA 3PIOQ 3OW2R 3DLLQ 3IRWP 1YJNS 3LPYA 3J7ZT 2MZ1A 3VAIA 1VQLS 2CQ1A 2CPDA 4QQBA 1VC0A 1WEXA 1DZ5A 2ZJQQ 3SXLA 1O0PA 2MQNA 3THPA 2MZQA 2N7CA 1VQPS 1R8PA 2F3JA 2EK1A 1Q82T 2AYMA 4TU8A 5GADU 2O3DA 2WBRA 1VQ4S 1U1MA 4W92B 1FJ7A 2KXHA 5CA5A 1WG1A 4F25A 5ITHA 3U1MA 2I2YA 4PKDB 3UCGA 2DNKA 3LQVA 2CQ3A 2E5JA 4ERDA 2MGZB 1FT8A 2DGSA 2ADCA 2F9DA 1YIJS 1WHWA 5D78A 2QA4S 2RT3A 2B0GA 4ED5A 2KRBA 4CH1A 2DHAA 2DGOA 3MXHP 1U1OA 2FC9A 5LXYA 1VC5A 2XNQA 1BY9A 3EX7B 1JJ4A 2VODA 4QU7A 2DISA 4C0OC 2LKZA 3CULA 2E5GA 3MDFA 4LMZA 3ZZZA 1VC6A 2M4MA 4FXWA 2BOPA 1KOHA 5JVGQ 2A3JA 2J0SD 2EVZA 1P27B 3MURP 1JJ2R 3VAJA 2CPZA 3P3DA 3MUTP 3D2WA 2YWKA 3CPWR 4IOAQ 3NNCA 2FHOB 2JRSA 1M90T 1DBDA 1OPIA 4UQTA 2DNLA 2KHCA 2DHXA 2RUGA 3ULHA 1X4EA 2MQPA 3CXCR 1FHTA 3EGNA 1FO1A 2DNPA 2FC8A 3VAHA 5DETA 2MXYA 2DNHA 1X4HA 2MKSA 1NO8A 4WKRA 2KRRA 5LJ5Y 2MQQA 1X5OA 2HGNA 2MJUA 1ZZFA 2DNOA 2MHNA 2M8DB 2CQ4A 2AYEA 1RK8A 2UP1A 1VQ6S 1U6FA 4OZ1A 1WF1A 2KG0A 2DNMA 1QVFR 2HZCA 1X0FA 1VQ8S 3TO8A 1SXLA 2LXUA 2KI2A 4QPTA
chains in the Genus database with same CATH superfamily
4KH0B 2DH7A 3HFKA 4AT1B 2FY1A 4EBDA 1K1QA 4B3TF 3VAFA 2ZH1A 1QY7A 3N5FA 2HBYB 2OPRB 1RP5A 1L3TA 2ZDOA 4CRJA 4JI2J 4PAAA 2RNEA 4WIIA 3DKDA 4ZLPA 5J2PA 4OYPA 2HNZA 3I0RA 4CT8A 3L7PA 2IRUA 3UNGC 1HNXF 3HKWA 1R89A 3D6FB 1XNQF 5ETPA 1F60B 3BSAA 3N28A 2PN6A 2MKIA 1K9MT 4DV4F 4NCGA 1NAQA 3CB4A 2ZDPA 2M7SA 4DR5F 2AEMA 2LEAA 3BGFA 3OFEA 3BYPA 1VHIA 2VZ9A 1JLGA 5BJRA 2MQOA 4UOHA 3UN3A 1M1GA 1MMLA 2ZBQA 4NYPA 1NB2A 2P2CB 3IGVA 4NA2A 4J5OA 1UAWA 4KBIA 4BHQA 4K4ZA 4ZHRB 1HBOB 1AFIA 2DXEA 3GIMA 1X5SA 4C11B 3KHGA 2CQGA 2HNDA 4ZCIA 4GRSA 3TAMB 8AT1B 2H3EB 4JI8J 2HW3A 1JLBA 3ICLA 3HLUA 3QQCD 5E2QA 5GAEU 3DGPB 2XHCA 1TK8A 3O8WA 3SYZA 1VQOS 1HLWA 4ZITA 3QATA 2V34A 2EBGA 3QJJA 1S9GA 2F5GA 2QFJA 1I1GA 3NY0A 2I0XA 4QIWD 3Q89A 2BKNA 4EEYA 3PO5A 1VQSA 3JYTA 2FHJA 1WEYA 1RT7B 1PBAA 2ASYA 2L3MA 2MPUA 3R9LA 1P6TA 3HI9A 2DNNA 2GGPA 1VLOA 1JKHA 2O66A 4DX6A 2I6WA 1AZSB 1RYSA 1YVFA 2EWHA 4ZVOB 2ZH6A 1X5PA 4DLGA 3CC2S 3FFIB 1FEHA 2VC1A 3TW0A 4K4WA 3OR1B 1X7VA 4HT7A 1HI1A 3KLHB 2BVZA 1HNVB 1LOUA 1IQZA 1NPPA 2CKWA 4CH0S 3GR1A 1RT1A 1ZAXA 4EYHB 1HD0A 2NSBA 2KYXA 1NBEB 2VQFF 4F4AA 1EETB 3FZBA 1O8BA 3H98A 5J1EB 4RW9A 4EU0A 3MAQA 2ZH7A 2AZ1A 4USKA 3N6MA 2VOOA 2IJRA 2YQ0A 4XAKA 2DGQA 2KH9A 3RBXA 3PYEA 3CC4S 3AXMA 1IBCB 3UCUP 2P9CA 3VWSA 3LOUA 2PMWA 1T05A 3NBPA 4IYQA 4RX6A 3SCKE 2XMVA 4A8QA 2C42A 2QLJB 2C2EA 2OTLS 3QWPA 3RR8A 1R0BG 4F4KA 1X4GA 5KFVA 1Q16B 4U6PA 3GLJA 1C4AA 5GAGI 5KFBA 1T9TA 3OL7A 1YITS 2N4CA 3DLKA 1FKOB 3HKZD 2GO9A 2CIMA 1QDUB 3EXYA 3Q24A 2ALYB 3RAXA 1KOOA 3DLLQ 2GC8A 2VUGA 4G1IA 3NCPA 1NH7A 3W2WB 4Y65A 3THPA 2N7CA 4I69A 2B9WA 4ICLA 5LSRA 4FKYA 1JLFB 1NDCA 1T11A 4YDDB 3T9ZA 3AD7C 3UCGA 1MWQA 3AY0A 3GZ7A 2HHXA 4UUWA 1FT8A 4FYWB 3LP0B 2CVEA 3CEDA 2RQKA 3IC1A 1YIJS 4CI0B 4X66F 2EC0A 2ZZMA 2D3O1 3LGMA 2FC9A 6FD1A 3GSDA 1JJ4A 2DRDA 3FBEA 4C0OC 3CULA 1KBRA 2UZAA 4ZN1A 3KG1A 5B0AA 2AGOA 1PYTA 4UOFA 2RMLA 3GR0A 3MURP 4TVAB 1TMMA 1TK0A 4CDIA 2QFIA 2RUGA 1FHTA 3KUEA 4C48A 2DNHA 5LJ5Y 3UD5A 4UTGA 2HGNA 3A8KA 1ZZFA 4ZVTB 2XBPA 4N77A 2O1PA 3MEKA 1RK8A 4E0DA 4JB8B 2QLWA 3T5HA 1VIOA 1VQ8S 1HIYA 3MAAA 5HSPA 1SBRA 3HO1A 4OX9J 3M1VA 2FVQA 2E7WA 3T1AA 3ZZPA 1SC6A 1CG2A 1YJ9S 2RU9A 2K2PA 2V5HG 3FMWA 2VKZG 3UQSA 1U1LA 2C3YA 2QSFA 2MSTA 2AJQA 1N32F 2BACA 2EPIA 2B4PA 2E5LJ 3CDEA 2ZFHA 4O0NA 2GV1A 4ECXA 3VVTA 3TUZC 1M5VC 3KNAA 3BM7A 3C16B 2NR0A 1RCOB 3DOKA 4CM0A 3FDSA 1RA7A 3MI7X 3TYTA 2L41A 2DRAA 3NGDA 2DO0A 1UVIA 4MAKA 1VBZA 3D5MA 4GVBB 2D1CA 2R7WA 2FIUA 1WI6A 1TU0B 2OP5A 5I4MA 3KK3B 4CTAB 2OIHA 4ZK7M 3GV5B 3TARA 3X3UA 4Z37A 1U48A 2BANA 4ZJQA 2HVDA 4WXWA 3QLHA 2BM1A 1T9UA 5IS2A 2GJ2A 3EGZA 2XMTA 2Z58B 3MD1A 2VQEF 2OFGX 4L3KA 3HHNB 3GU0A 1KONA 3Q2SC 3S7RA 1DLOB 2XMUA 2BJ7A 1TFWA 3D28A 3X1LB 4NMLA 1IJEB 3LALA 2HZAA 4M5DA 4FBTA 2B9YA 2FZKB 3UO0A 3MMJA 3KJVB 3GE9A 4DN9A 4K4TA 1UJ6A 3OUYA 1LWFB 3I9V9 4KKOB 3CE8A 2HGMA 3OTBA 4CWBA 2EFOA 4NLDA 4OV1A 2YNGB 1NJIT 3H7HB 3BH7B 1IR2A 1U2RA 4EK2A 2YNFA 1KC8T 4Y6IA 2CNNB 1R8CA 3TA0A 2G9OA 4EZ9A 2HLUA 1SL1A 2NPFA 4J9QA 3LAMA 2UXCF 2GQQA 1R7IA 2O67A 3KMQA 2ZJPQ 4OLOA 4ITSA 2LU2A 4OYOA 1M5OC 3K0JA 4J9RA 2L08A 4KV8A 5EX0A 1TKDA 5D0HA 5D0RA 1RABB 2BKOA 1K47A 4YR2A 4FXVA 2VBZA 5HP1B 3P96A 3M32A 1OYDA 1YRTA 3C15A 1ZM3A 2DKOB 4IH6A 2E1RA 3ZNUA 1TAQA 2E7VA 5AT1B 2D9PA 5D8HB 1Y3JA 3MUMP 5KFRA 1FRKA 3FK4A 3C3LA 2DPJA 2BW2A 1ELOA 4DL4A 2L9WA 2Q43A 2BV3A 1S79A 4YFUA 3EZUA 1KR4A 4JI6J 1MMDA 4RU9A 1X4DA 1Q1KA 1MW7A 2XYGB 4C97A 2KTQA 4RW4B 2CYYA 4LRCA 1TK5A 3TVKA 1Y0HA 5L1IA 3W5YA 3D66A 1HWJA 1AW0A 2KT5A 2E9TA 4MK8A 5HL7Q 2EG2A 5A8KA 1CVJA 1B70B 2ZBCA 1FK9B 3ZC4A 1TKZB 3M2VB 4JUZA 3HSZA 1N5YB 5IC4B 3IRWP 1I3OB 4JI3F 2DHHA 5L8RC 1IKYB 2V2VA 3FBBA 1SIZA 1RTIA 3TZWA 4OI2A 4EBEA 4YN3B 4DWIA 3GIRA 3KG0A 3M8QA 3N01A 1G7CB 3DOMB 1QSLA 5HQMA 1S1UA 4QYZK 4Z7CA 3A12A 3KYLA 3AA8A 1RT5B 3MR2A 2OFHX 5KOWA 4ZVUB 4DV2F 3T1YJ 1NJXA 2QMWA 1RT6B 1U4BA 2HRUA 4LMZA 2RAQA 2HFZA 2RHQB 2B5JB 4BDPA 3JSYA 3DNCA 2W7OA 4NPOA 1M90T 1UEKA 2XTJP 4PCQA 1BWVA 4NI2A 2ASLA 3OTOJ 4JI0J 2R7TA 1NO8A 4KC5A 3ISNC 5KAKA 3UNYA 5J2MB 4WFYA 1NHUA 1X0FA 2PMHA 1FNOA 2N4DA 4A8FA 3DLEB 1C0TB 1TV6B 5EX3A 2AKWB 3D9BA 3RB3A 2LP4A 4LF8F 1R0AB 2RF2A 4QW9A 2BRLA 2FJDB 4NRTA 5LMNF 2F8MA 1T03B 2P6TA 1NSKL 4TQSA 3IR5B 2UUAF 3JTOA 2B4OA 3QAEA 2YKAA 1YBAA 1U0SA 4CLFA 1XNRF 3BGUA 5E7OB 2NQPA 2YH1A 2AGQA 1U49A 4GO7X 2NSCA 3W5XA 1IBKJ 4ED3A 1GT8A 3P5BP 2R8IA 3BH6B 2MKCA 1LW0A 3MOJB 2CQ2A 2E1CA 2HPUA 3QSYB 1J2VA 1S72S 7FDRA 2PT0A 4PG6A 1LWEA 1YJUA 4RJVA 2K1RA 4KJIA 3KLEA 1SJ3P 1JQGA 5K8PA 5DRKA 3MMCA 1N56A 1N34F 1IKWB 3M6XA 2LXIA 2P6SA 5GAHU 3MMBA 2XCAA 2VA2A 3DYAA 4X84A 3R2CJ 3MECB 2OEJA 1UCNA 3UN5A 2EFVA 5IV4A 3G2XA 4ECRA 3DMJB 4AQYF 1GMVA 5AJ3J 1FEEA 4L76A 2VL1A 1ZA1B 3V2UC 5CH7B 1K0TA 2BZ2A 3ZZ0A 2MLXA 3V4MA 3K17A 2N82B 4FPIA 4DV3J 4O4GA 4U7UK 1U7LA 2ZE2A 4LFCF 1BQNA 3M6VA 2DR7A 3QT5A 5ETSA 5KG1A 1NRKA 2VICA 1RBOB 1FNMA 3FVYA 2ZHBA 3HULA 2F4VJ 5D3GB 3QIDA 4YHHJ 2MKHA 4O3PA 1YWXA 2HS3A 2X1BA 4WK3A 5HANA 4AD6A 5FJ4A 5K20B 2OKQA 1D1UA 4EMDA 4I68A 3PR4A 4XO0A 4QWCA 1HNZJ 4LF2A 3M8PB 1UVNA 2JC1A 3MFIA 3IR6B 3O6QA 3AJ2A 3QYYA 3CW2C 4WFBQ 2UXBF 4ZJOA 5B0FA 2JHEA 4RPFA 1TKTA 5F8JA 1G1XA 3BGOP 3GG0A 4HACA 3D7SB 3A4TA 1S7HA 2CNKB 4O3SA 3EGWB 3H2UB 2FYXA 1B7FA 4ED7A 2IVFB 2KFYA 3LUYA 5IC6B 3MM5B 3TVZA 1A9NB 1KTQA 2VHGA 4RW7B 4L75A 3FEZA 3MM8B 4LF5J 3HHLD 4CLSA 2XHWA 2OLWA 3SI8A 4TYAA 4X62J 4AE5A 1IM4A 4ZPAA 5F0UA 1J5EJ 3M30B 1OSCA 4UOGA 1O51A 4CT9A 4ID8A 3BPSP 2BR0A 4J9UE 2KJWA 3TA1A 3CCMS 5LMUJ 3DRSA 4DR6F 1NNDA 4LJMA 3MPVA 2APOA 4PG8A 3UVJA 4CLYA 1N54B 4B9TA 3QIPA 4F04B 1YJNS 1WD6A 5KFQA 4NRUA 3IWLA 2MZQA 2PMZD 1Q82T 1UKUA 1FWLA 4IFYB 1FFGB 4PQUA 3L7UA 4KHPF 4OX6A 3SQGA 3N4WA 3O5TB 2MGZB 2DGSA 2LDIA 4KSEB 1U47A 3K57A 2XO6A 4KT0C 2OGUA 4CO5A 5L1JA 2GHVC 1ZYQA 1U26A 2D7SA 1FDDA 4NLTA 1MROB 4DR2J 1NM2A 3DCAA 4QU7A 2UXDJ 2P9EA 4JI4J 1VC6A 5HVHA 2GVZA 4YEAA 5JVGQ 3EJMA 1KVKA 2WB4A 2K7JA 3CPWR 1JLCB 2JRSA 4LF1A 2Y1IA 3QT7A 4FDFA 4USMA 1OPIA 2XULA 4OYZA 3EPGA 4DN0A 4PYAA 1RLCL 2FY8A 2A18A 2HAFA 2OPPA 1RTDA 2XYHB 5HROB 5D0EA 1WF1A 2DTJA 3QBCA 4LSNB 1RT4B 2UUBJ 4M5KA 3VGSA 3ILOA 3ENAA 1T95A 3BF4A 2DEJA 3TVYA 3TOQA 5C5JA 1RI7A 4F3MA 2I5JA 1KWMA 1Y4ZB 1VFJA 4JI2F 2KVIA 1QVGR 2FLPA 4BC9A 2CQDA 3JTPA 3F41A 1OWXA 2VPXB 1AROP 4URSA 4HHHA 3RBDA 3MEGA 2DEIA 2HFUA 4P71A 4YDXA 4NE9C 3CWJA 3TX8A 1V3RA 2RE1A 5D4PA 5D4LA 1HQUB 4CO3A 3K5PA 2MYFA 4F4ZA 1XEZA 3T5KA 2MY7A 3IA0A 3EM1A 4DV0J 1DTQA 3T3FA 4C7QA 2GAGC 3L09A 4DL3A 3HHLA 4IOCQ 4OLPA 1FKPA 4DUYJ 1EHWA 4LVOP 3QT8A 4B9MA 4WKYA 1FNXH 4WE1A 2W7AA 4QJVA 4L3NA 2Z4PA 5BXIA 2EK6A 4DR1J 4JI8F 4RW6B 3BDPA 4QOTA 4Q7AA 5A0YB 3QZ7A 2YPYA 3GYXB 3EUNA 2MQLA 2ZNYA 3CJ8A 3QMQA 1FTRA 2CQIA 1NKCA 4YS2A 3GIJA 5LSLA 1JLAA 1HBNB 2WCXA 3GYGA 5CHCB 3I55S 4O3QA 1AB8A 4P2XA 3H90A 4B9LA 3G96A 4MKBA 3LGHA 1U6ZA 2J9CA 5F8MA 1OY8A 1IKXA 3K8WA 3HJVA 2KXNB 3W2VB 4X4UA 4UY85 4MJKA 2RB7A 4TYBA 2KG1A 3KDOA 4AYBD 3BYRA 4ZVGA 1LWXA 4P74A 1N8RT 4ZCKA 3UCZP 3R5BA 5ETKA 3IFEA 4X4TA 1T3NA 1SJ4P 3OTEA 5MLCV 3W62A 1RAFB 3V6JA 5IT0A 4FBUA 3PX4A 2OPSB 2PO4A 1WF2A 4RBUA 4LRBA 1UW9A 3TRGA 4BS2A 3W1YC 1P8GA 1X5TA 2R7XA 1NMEB 3G71S 2ZBRA 4CM2A 4FP9A 4DFJA 3GFXA 4PYDA 4ES1A 2Y8YA 1JMTA 7FD1A 2JSXA 2DO4A 3OJUA 1HBUB 2HWHA 2KB2A 1FXDA 4DS4A 4KFBB 2UU9F 5C25A 4OI6A 1RCXB 4F02A 3AXKA 3TUIC 4DBQA 2KFNA 2B4VA 4ZVEA 1RWKB 2J7UA 1KD1T 2VG6B 2XC9A 3O2IA 2XM3A 3ZZUA 2I38A 4K7QA 4P10A 4WZMA 3D0HE 1QAJA 4ZPBA 3A13A 2VONA 4I7FB 4USUA 2XB2D 1WHXA 1FDNA 1WG4A 2OPQB 4QWAA 4OJ3A 4ED6A 1KHVA 5IWAF 4Y2KA 3JAMY 4J9PA 4W4MA 3D6HB 2ROEA 4B9NA 1REGX 4X65J 5SUHA 2QZ8A 3DOLB 1YHQS 3PIOQ 4K0KF 4LQ3A 1TL7B 3PCOB 1W7WA 4HYKA 1TKXA 1CQNA 4QQBA 4OZJA 4I6AA 2GIFA 3EWGA 1Y3KA 4MFBA 1CJVA 1MLAA 1U1MA 1FJ7A 3HD2A 2CQ3A 2YX7A 3JQJA 1VRUB 2B6AB 1DJ0A 1WHWA 3DRXA 4M5HA 2L48A 4ILLA 3NCQA 2DGOA 3VQSA 3LF0A 3PYFA 2VV5A 3R3TA 3QWUA 1PKUA 4FXWA 4Q43A 1Q8BA 2EVZA 1P27B 1LW2B 4OHVA 3OHBA 2YNHB 3C46A 2NPIA 3NMAA 3OFHA 1HHSA 4H4KA 5B08A 3ITHA 2WVCA 4IQMA 5A8WB 1X4EA 3DRPB 2HWIA 1TL1B 4ECQA 4S0MA 3DDKA 2HHPA 4YQWA 1X5OA 1GMUA 2ZEJA 3WIVA 2V2KA 1S0OA 2Z8QA 2EW9A 2UP1A 3QNWB 1YK9A 3NXZA 4OX9F 1HI8A 2A6OA 3PM9A 1YSJA 3BGRA 2CG8A 2LYVA 2C3PA 5IT4A 1S1VA 4DR3J 3TUPA 2VC0A 1YBUA 4R5PA 2AJ4A 1NZAA 5F9NA 3IBCB 2ZWOA 1JKHB 4KYZA 2X51A 2UUCF 2YPZA 2XMWA 4K2JA 5DGAA 1G6BA 1RAHB 2AEFA 5KFHA 4C8LA 1PIEA 2HBRB 2W7PA 4DPXA 1TUWA 1LWCB 1MWYA 1QUPA 3IMQJ 3T6JA 3G86A 3ISND 5C42A 3SV4A 1OSDA 1WSRA 3T1HJ 1CULA 1YTYA 4CYUB 2JLEA 1TZ0A 1RT1B 4DCOB 4LFBJ 4L72B 4HH1A 4RR5A 4MKAA 2FLNA 3DI6A 4ZDNA 1KN6A 2D3UA 2MKYA 5D4NA 2OSRA 4Y34A 2WVDA 1KQKA 1X4CA 1NCLA 4B3SJ 1JK9B 4Z7YA 1S5ZA 1Q81T 1RDRA 1U0HA 4DQQA 4PXCA 3B4DA 5GAGU 2B8QA 1N5TA 3WBZA 1SUQB 4J9MA 3MAHA 1NHVA 2WK4A 5KFNA 4F2SA 3I56S 3HVTB 3LO3A 1D9FA 4TQRA 2J6UA 2IY5B 1JLEB 4MK9A 3RB6A 2YQ1A 3KKFA 1ZAWA 2OMLA 3K8VA 2V4JA 4DUZF 1KNZA 4DCPB 3GJQB 3MPWA 1OYEA 4KPCA 4A8WA 2VIHA 3SFUA 4IH7A 4DQPA 4KB7A 1XBWA 4PPZA 3IN5A 2WSFC 2WONA 3WC0A 2ZITA 4KTQA 4B3OA 5KFUA 3U1NA 3G6XA 2XZWA 1SH3A 5AE2A 2RRAA 4OHZA 4OYIA 4Q2LA 5DDQC 1BMQB 1F3VA 2WRMA 1CC8A 1HNIA 3C19A 1HPZA 2E66A 4FVMA 1S57A 2VDHA 2Y1LB 2HYIB 4NA1A 2JNJA 4HR2A 2DNQA 5K8MA 3PW7A 1F5AA 1GQEA 4LRDA 3LWMA 1EQ0A 2IA0A 2HLTA 3HSDA 4GKKJ 4FF2A 1TL3B 4KGXB 3M2UA 5T7LA 1ULRA 4DL7A 1DTTA 1KQSR 3BJYA 4OYWA 2IC3A 2JVOA 5BYRA 4V1Ak 4DPUA 5HLFB 1CS4B 4OJ1A 2PE8A 3DLJA 4ZPVR 2ZVSA 3I5AA 2C28A 5C7PA 1SV5A 3M1VB 2XY5A 4KO0B 2B9EA 4P72A 4C4WA 4Y0FA 2OD6A 1LXNA 4DL2A 1M5SA 1UW4A 3K5NA 4K5RA 3V81A 2G2YA 2R8GA 2FDNA 2OUGA 4OJHA 2VG5A 4RNMA 2ZZNA 4A46A 4RLEA 2CPDA 3FGVA 3ZTQA 5ETVA 3MM7A 3OD2A 5B0EA 2J6SA 5K14B 2GHWA 3FQLA 5AE3A 2I2YA 3AA9A 3MWBA 5B0DA 4RBVA 3V4IA 4RUBA 3GILA 1NK8A 1S9EA 3CSKA 1S59A 2QA4S 3T1YF 4WU3A 4DSIA 4LSLA 2KJVA 2KRBA 3HK2A 4WZQA 5KFWA 1UZDA 2W2MP 2R8KA 2ZH8A 2NXJA 6AT1B 3ZZZA 4FNHA 2I1RA 2FZGB 1T9XA 3MUTP 4JI0F 4MKYA 3R8YA 1TFYA 4WP9A 1RU1A 1NEEA 3H8YA 2ZM6J 1SH0A 4Y3CA 3GYNA 2QLFB 4ZVQB 3I0SB 1KHWA 3BSNA 2MJUA 3W9IA 1LV5A 3QO9B 1VQ6S 2QLXA 2W1BA 1KKHA 4DG1A 1WSVA 4IFVB 4Y2MA 4PUOB 2AJFE 3F44A 1SXLA 2A6MA 3FZ2A 2W25A 4ID5B 2IM2A 3IP0A 4QIFA 1TQLA 2LEBA 3NNHA 1MG7A 4QR2A 4I2PA 2W9CA 5GVQA 1HR0J 4DXLA 1RAGB 5MAOA 4TN2A 3P6YC 3V5RA 1FD8A 3BB5A 2PSZA 1IBKF 2D69A 4O4RA 3AD9C 3CJSA 2GZOA 5RUBA 5F8NA 3C15B 4JV5F 3V6DA 1ZZNA 3KLIA 3CD7A 1AA1B 1MNEA 2B7CB 3IXQA 4LRAA 3W7BA 4JP8A 4NLQA 2J7WA 3POTB 4C6AA 3FSXA 2XYPB 1VQ7S 2XQCA 3I4HX 2M2BA 4MYUA 2Z56B 4JBCA 4ENOA 5KFCA 2H5JB 4DF4A 1NDPA 2NUUG 3I9ZA 4H54A 3NS5A 1JLQA 5GMKa 4PZVA 1TP7A 3K59A 1G2EA 3BR8A 1BQMA 4U8YA 3FUYA 2AHOB 3NL0A 3KG4A 1J5OA 2HVIA 3Q8YA 2R7OA 3IWXA 2NZ4A 1U8WA 2H65B 4TLRA 4F2RA 1UPPA 4DQRA 5A8KB 1REVA 3J7YU 2AYBA 3CJ0A 2X1FA 5KT7A 1WC6A 3G87A 4FZVA 4DV3F 1RT2B 4YR3A 3SDEA 2O01C 4OJGA 2UUTA 3PHTA 3VAKA 3VF0B 1UEUA 3VAMA 5K5MA 4HVZA 1L3UA 5GAHI 1CJUB 1SQEA 3GFHA 1JXLA 3D0IE 2Q79A 5HJXA 4YHHF 3KK1A 2IMOA 4M5NA 1AXQA 3PY8A 4H4MB 4F26A 4TY8B 4EI2A 3M8WA 1ZTWA 2NCKL 2HSEB 1NK4A 3OR2A 2MZJA 1WTFA 2V2QA 2J0XA 2W2PP 2C2OB 1HNZF 1BWEA 2E5IA 1HWKA 3ILJA 5LJ3Y 3TZYA 4IG3B 2CUYA 3K5OA 3KDNA 2RQMA 1NHKL 1UVJA 1ZPWX 2WOMB 4V19J 3DM2B 1C0UB 2W4CA 2XZDB 1GXLA 3IS9A 4Q0BA 1Q0NA 2C2ZB 4P9SA 3BQ0A 1YX2A 3CIMA 3OLBA 4DLEA 2XY7A 2ZKTA 3R7BB 3BO4A 2DB1A 4KGMA 2V8DA 3S1TA 4KRWA 4KGKA 2KT2A 3PFEA 4U8VA 3BQ2A 1BHNA 1TMJA 4TNOA 1N0UA 4X62F 1YI2S 1J5EF 3RYLA 4UOCA 3DRYA 2J9DE 1BXNA 3QRRA 4F3QA 1DHMA 2UV8A 4CZCA 4C3LA 2GMLA 4J9SA 3W64A 1Q7LB 3SSSA 3N6NA 3UR0A 4FVCA 4O44A 3W65A 5BYSA 1XMOJ 4ZP8A 1F9FA 4KR0B 5CCMA 3W5ZA 3MEDA 1V5VA 3WHIA 2E9ZA 1H73A 1KTVA 1FJGJ 4CQ1A 3UD4P 2QA4G 2JOQA 5IOLA 4OHWA 4KHMA 4QIVA 4A8SA 2OPRA 1MU2A 4I67A 4QCLA 2V8VA 4F3OA 3M8ZA 2AQ4A 2M3DA 2HHSA 1WKLA 1VQPS 2H1YA 4JI7J 5IZHA 3SSRA 2ZH9A 2LVWA 4MH8A 2DCUB 2VG7A 1NSAA 2XWXA 1LW0B 3AAWB 1UJ5A 3HMJG 3FRYA 4DR2F 2AV5A 2UXDF 4TY9A 3H5SA 4C8NA 4JI4F 3KLEB 2KT3A 3I82A 1N33F 1W2IA 2I8EA 3GQCA 5HVFA 2M4MA 2BOPA 1H72C 1KFSA 4RWXA 2J0SD 3BKTA 3TEGA 2R9LA 4LREA 3OPKA 4MT1A 4ED1A 5B0BA 3O1LA 5JJBA 4ZHRA 1HBOA 4NXNF 4GVLA 4XIUA 1X9SA 4C11A 5DETA 2QE5A 1OJ4A 3TAMA 2MQQA 2BYCA 3PJ9A 4FYYB 3TQ1A 4IOBA 5IQ6A 2RKIB 2IVYA 2ASJA 4QW8A 2EI5A 3DGPA 2M8DB 2IDLA 2UUBF 5EWFA 1U6FA 2VPWB 1U02A 3H4BA 2AYGA 1S99A 2HHHJ 1S1TA 4O4GB 2BABA 2QTWA 3RB0A 1BQNB 2XGPA 1WJ9A 3MPDA 1SKRA 3NNAA 5L38A 2QMXA 4NZ6A 1HQEB 2ATLA 3FCWA 2W9BB 3W9HA 3DLGB 2G4BA 1RBAA 1AZSA 2JFDA 4AXIA 2ZHOA 1VBKA 1QE1A 3RBEA 5F3TA 2XWYA 2D41A 3OR1A 1Z4UA 2CQ0A 2RD5C 1HNVA 4NEYA 4DUYF 5DG8A 3CJ5A 4PABA 2K3IA 1SKWA 1HNWJ 3Q2TC 3NP5A 3T6BA 2HRYA 3MCSA 4Q8FA 3HF5A 2HBQB 1FXLA 2XEXA 1WOSA 3OSPA 1EETA 5JUMA 5J1EA 2CPYA 1VK3A 2OEMA 1YJRA 4EO8A 3LA0A 2RQ4A 3VGTA 2F1FA 2FVPA 4DV1J 4IRDA 1XERA 1AYEA 3BBCA 4MTPA 4FF1A 5E0OA 2IBKA 3Q8SB 1QAYA 3DRSB 1B0PA 1CSJA 1Q8LA 3GJTB 1V3ZA 4XK8C 3SBMA 2G2OA 4G6VB 4M94A 2WB1D 1V3SA 2MKJA 2VPYB 4GO5X 4RW8B 2DRBA 1JXEA 1IVZA 4MIWA 1JJHA 3NGUA 2CXEA 1FKOA 4UY8T 2CPIA 4I6YA 3IM9A 3TA2A 4LT6A 3U1LA 3NRBA 2M8HA 1IJFB 1WDDA 3DRRB 3AH6A 5K8NA 1UMJA 3W2WA 4X4SA 2UV8G 4ECSA 3FQKA 2UUWA 2FHJD 4Q44A 1ROFA 5DQHA 1XNQJ 1D9DA 4XTTA 1URNA 1Y5LB 1OIAA 1Z2ZA 3LP0A 5IM0A 4DV4J 4WTOB 2GVZB 2OTJS 2NLWA 4DR5J 2CQPA 3G9CA 3LANA 1UVLA 5I3PA 3M8YA 4L6V3 3KJNB 3OHAA 4CP5A 1C1BB 3OTCA 2G2ZA 1XJWB 5KFJA 2XGQA 3ISZA 3LP1B 2ZZTA 3VV2B 4ZVPB 4WFAQ 4F67A 4DV7F 3EVOA 4RO0A 1M1HA 2FVSA 2FLOA 2D3ZA 1SPBP 1U1PA 1RKIA 4IG0B 3UI3A 1Q7YT 2GA7A 2PGCA 4X65F 1D3WA 2V6AA 4NLXA 3THVA 1XR6A 1ZM9A 4IO1A 3OXGA 4HL9A 3TWZA 2H5IB 5KFKA 1FE4A 5KFXA 1AFJA 2BJEA 3QGHA 4PG5A 1T3OA 5A8RB 3I5CA 4RNHA 2CQ1A 3PJWA 1RWUA 1VS3A 5H9FJ 2MQNA 4TKTA 1TELA 2WBRA 1DFDA 1R43A 4DUTA 3C16A 4F25A 1DTQB 3C6UB 3LW5C 5J1NA 2HFSA 2ADCA 2F9DA 3HHLB 4DZ6A 3MM6B 3C66A 3MCNA 3AB2B 1FKPB 2A2CA 3K5MA 4G1PA 5LXYA 4WE1B 1VC5A 2BKPA 3UW1A 4WYLA 2IM1A 2Z0GA 5KOXA 3DU6A 2VQFJ 2ZH3A 1KOHA 2HWTA 3PKYA 3KK3A 2X3GA 3FC9A 4NLWA 4P75A 4IOAQ 4WK1A 1LFPA 4DPYA 1S76D 3IRXB 3KLGB 1JLAB 3R2DJ 1FDBA 3B6BA 3CJ4A 1DLOA 2MHNA 2JLFA 1DQ9A 3QGPA 1XR5A 2YWFA 1IKXB 4ECZA 4N8OA 3TO8A 4NZ7A 2FJWA 4QPXA 5FLXU 3KJVA 1YGYA 4KKOA 3MR3A 4DEZA 2WSEC 4P73A 3P49B 3FSYA 1BUXA 1SQGA 8ATCB 1WHYA 3NAHA 1N36J 2W2QP 2YNGA 2CRLA 1XK8A 1X31C 4C0HA 4DV5J 2BUNA 4YMEA 4XPCA 3T1HF 3EXCX 3EE3A 1RYRA 3US5A 1RHMB 3ET6B 4LFBF 4DU7A 1SCJB 3BKFA 5KG6A 1QAXA 5AXKA 5HP1A 1H7XA 1S6QB 1FXRA 1OMSA 4CO4A 1Q95G 4B3SF 1T02A 1WC3A 2XLKA 3HPOA 2Q6BA 1QJHA 1XIQA 1UFKA 1UVKA 2F63A 3TJAA 3PTWA 2AJ1A 4J9LA 4J91A 2AIRB 1SC3B 3DDIA 4YB7A 1GEHA 1U6BA 2CPJA 2LLZA 3W63A 3PX0A 4R0JA 2RH3A 1E6YA 5D77A 2MDAA 1KVIA 1HD1A 3TP2A 4ILRA 4OZNA 2Z57B 3KJFB 2YWWA 4CNZA 4UW2A 1R8HA 2IYGA 1Y5IB 2BOAA 4LFAJ 1NLKL 5HMXA 2AF6A 4YY3J 4TLQA 4RW4A 4DR4J 3MMAB 2DGXA 3I32A 2P5VA 4PQAA 1F1BB 1FA0A 4PWUA 2X1GA 1SIWB 2K06A 2DR6A 5DM6Q 4JI1F 1TL4A 5AXNA 1FK9A 3GG1A 2ZD1B 2QJ3A 3ZZOA 1TKZA 3M2VA 3SSQA 3W8PA 4QU6A 1TKXB 1JNZB 4KGZB 1SJQA 1RHKB 1N5YA 3LPEA 5KFIA 1IBMF 1N32J 2JZ5A 5ETOA 2GMHA 4YB5A 3WIUA 1VYAA 3B54A 5IFMA 3CJKB 1L3VA 1UZHA 1RAJA 1A7GE 4IDKB 4ZIVA 4FF4A 1NK0A 4MKVA 3UDEA 3F73A 3QSIA 5C2GA 2FLLA 1ACMB 1TUGB 1S1XB 3D1OA 4LR7A 1UWAA 2RRBA 2CPXA 1RT6A 2J0WA 2G1DA 3BREA 3KLFB 2B5JA 2LU1A 5GMDA 2FGOA 2BJDA 2NXCA 1GK8A 3RTVA 4N8NA 3GB0A 3JSMB 1QTNB 3GMGA 2XCPA 2W24A 4FYVB 4KH1B 4ILMA 5L1KA 1FX4A 5E41A 2YX1A 2EG1A 4IO9Q 5D15A 2GAHC 3H40A 1FRHA 1FKAF 5E3QA 2IYIA 5FLXY 3G6ES 5FIIA 5J2MA 4BLGA 3FBCA 4O3RA 5DLFA 1CQMA 5DQIA 2MZSA 4OYBA 1U8SA 3JSRA 3LWLA 3DLEA 1C0TA 3EDQB 5CYQB 2PA3A 5U47A 3OW2R 1ZS6A 3IG1B 2EFPA 4ZA1A 1F2GA 1R0CB 1O0PA 1T03A 3IO1A 2UXCJ 3A3PB 1VQ4S 1XMQF 3PW2A 1VMBA 1U2CA 4B3MJ 4RUHA 1DARA 2FGCA 4HDGA 4BWJA 1U24A 2OI2A 1RGVA 1BY9A 1R8BA 1WC0A 1RZMA 5KFLA 2GVDB 3MDFA 1PC5A 3UDLA 3OJSA 1D09B 3GPAA 4KY3A 1WNEA 1WC1A 2A3JA 2FVRA 4B17A 4X4PA 2BX6A 2ZM6F 4GMKA 2VKRA 1FDAA 3CIZA 3GIIA 4OYAA 1IKWA 1AUSL 3OT9A 1FTCA 3ETMA 3EGNA 2FC8A 3V6HA 1ZAVA 3MECA 4ELVA 1CPZA 2R8JA 3J81U 3DMJA 2KG0A 1QVFR 1U25A 5HN0A 2AW0A 3IAS9 2V4JB 2DGVA 2WW4A 5I42B 3NS7B 4DPOA 3VZHA 4C8ZA 1P9YA 1RTJB 3IBWA 2K8GA 2OD4A 2YKOA 4UT4A 2EFNA 3CCJS 5HMYA 3BSCA 2IDEA 2DIVA 2HQGA 1WEZA 5F3ZA 4URGA 4IR9A 2JLGA 1FCAA 1M5HA 1VQNS 1H0HB 2XMMA 3DLHA 2LCWA 3D0GE 1V9OA 4GKJF 2Y0SD 5KFYA 1EB0A 2ZH5A 5D3GA 2BBEA 1OS5A 4RNOA 4ZVHA 1RKJA 2N3OA 3A3OB 3MUVP 2R7RA 5ETNA 2GIRA 2JVRA 2MTLA 1KLMB 4WU2A 2DY1A 1U1RA 1KS2A 2FTRA 4USTA 4PPDA 2QRRA 3M8PA 1S4FA 3Q8VA 5KFAA 2MQMA 4OHXA 5C2CA 3MR7A 5DGBA 2V8GA 1Q8KA 3FEXB 3BZQA 1M5KC 4H4OB 4WF9Q 3OSNA 4CLUA 5H9EK 4RL1A 3K5LA 4CO1A 1X9MA 3SV3A 4RW7A 3NWRA 3MM8A 2FD2A 3CD6S 1EIYB 2W9AA 3D54A 1N88A 3HM9A 4QZVB 2KXFA 4J37A 1PGZA 1IN0A 2OH2A 3AHPA 4WCEQ 3BBFA 2OJ3A 3M6WA 3M30A 3G6YA 3BPDA 4FF3A 2IAJB 3SEOA 3NGTA 9ATCB 3MD3A 2JH3A 2HQ3A 3WX8A 1CJKB 1VQ9S 4TXSA 3RZAA 2JX2A 4EO6A 4F0MA 4OZ0A 3MM7B 2PFFB 4JV2A 4LF9J 5LMNJ 2ADBA 2SXLA 1L5UA 2XSFA 2UUAJ 5C24A 3V4IB 4IRCA 1BQXA 2WVBA 3TAPA 3J7YI 4DHVA 4IFYA 4LSLB 2O5DA 4C8YA 4HI1A 3S01A 3G8QA 3S6EA 3RAMA 3UDVA 4JYAF 2YKMB 4NZ0A 3P45B 2MGZA 2WW8A 2DR5A 2QL7B 4KGVB 2V2ZA 1HA1A 3M2RB 2RJZA 4Y2AA 1HBMB 1MROA 1H2TZ 3TR5A 1PAUB 1K1SA 2ALZA 1RT3B 1FI4A 1K44A 3C14B 1UFWA 2MSSA 3U7JA 2WHOA 1N34J 1JLCA 3T41A 1PJ7A 1RWMB 4OMFG 4OV6A 3J81Y 3KLVA 3IWNC 2RSQA 2X7IA 2RS8A 1N5VA 2QN6B 4LR9A 5ETQA 5KFGA 1EZZB 3AOAA 4I6WA 1XMOF 3P8BB 3J80U 5HROA 3Q8QB 3GFYA 3G8TA 3KK2A 1VIXA 1RWNB 4PWDA 1NKBA 1VR6A 1X8DA 2YKNB 1VBXA 1FERA 2MMYA 3M7VA 1G4CA 2VBXA 1S0VA 3J7Z5 4LFCJ 5K9FA 4JI7F 2MZ1A 3K89A 2HEKA 4LQ9A 2BJ1A 2ILYA 3MR6A 2F3JA 3V6DB 5KT3A 1NSQA 2KYZA 2KXHA 2JJ4D 3QFHA 4I56A 2YXLA 4B02A 1HQUA 1GMWA 5L46A 3PYGA 1S1WB 2VASA 2C2KB 1E6VA 2RT3A 2E1AA 2AU0A 3A8JA 4CH1A 1S6UA 2BMBA 2LKZA 2G13A 2FB0A 4M5MA 3TAQA 2HVEA 1HW8A 4F50A 4I2QB 4QBUA 1HYSA 2UXBJ 1IKVB 1BQMB 5D6GA 1CLFA 3CD5A 3BBBA 1RA6A 4RW6A 1J5OB 2HNYA 3HD1A 5A0YA 2HMIB 4WFXA 3AJDA 3RUBL 4RUCA 1C1CB 3H25A 1REVB 4DR7F 1T0TV 3TI0A 2V9KA 2IFXA 5SZTA 5KG0A 3MGJA 1FF2A 2WTFA 1HBNA 4K4UA 2FHMA 4CLPA 4P7TA 2BM0A 1HQ2A 1T9VA 2EFQA 2V67A 2RU3A 2H48B 3P4UB 3JSBA 2W8LA 3W2VA 3FJ2A 2BXJA 4P2SA 4F7VA 1T9YA 2IIHA 1Y10A 4M5JA 1JX4A 2FZCB 1S9FA 5E33A 1C4CA 3ZNJ1 5KFZA 1EP4B 1FRXA 2WVEA 3CCWA 2BA9A 2C2NA 2CPHA 2OPSA 2AWZA 3OL9A 4Q0BB 3SCJE 1FESA 5ADZA 3EGVA 2RS2A 4WFZA 3W66A 3BSOA 2MLYA 4C98A 5G0RB 1FRIA 2DPIA 4ETXA 2HHUA 2MJNA 2A10A 5J2QA 3Q23A 1B4SA 1HBUA 2BE7D 1ZETA 4A8OA 4FKXA 2JDJA 4DPWA 1UWBB 5GADI 4NYOA 1ITPA 1S4EA 1FJCA 1KP6A 4CO0A 5FDLA 2R7UA 4OYMA 3G82A 2ZOFA 4P2FA 5F41A 4DV1F 3HVRA 1LFWA 4DFPA 1JB0C 1YJTA 3AQPA 3MM9B 2JEGA 1RAOA 2KVQE 1X9WA 3J80Y 4I7FA 4ELTA 4UF4A 1IR1A 3A8EA 4QYZJ 2QLBB 2HHQA 1WF0A 2OPQA 3MEDB 4ZN3A 2VPZB 1X60A 4K50A 3OFFA 1F6TA 1YZ6A 1H98A 1R8AA 1RUSA 5AE1A 4MK7A 2BE2B 2OEKA 2KO1A 3I6PA 2WBMA 4QWDA 4YB1P 1L3KA 1MU2B 2DJWA 2M5YA 4TU9A 2CFXA 3GFZA 5L9NA 3DOLA 3M4XA 1SC4B 4HT5A 3KUGA 1NK5A 1SKUB 1TL7A 1RAAB 4YB6A 4K4SA 4X64J 4FXDA 5CD4A 1FJEB 2PDAA 2VG7B 1APSA 4C9DA 1N5QA 5KT5A 1MN7A 3O44A 4OX7A 3RW6A 3NGKA 2E1PA 2Z2MA 1YJWS 2B4UA 2DR9A 5J2NB 1YJ7A 1VRUA 2B6AA 1NU4A 3LP2B 4JV1A 3CCQS 5HBMB 4LUBA 2CZ4A 4NLUA 2UVUA 2BDPA 2YNIA 2ZC4A 1ZH5A 1LW2A 1PBUA 2YNHA 1X4BA 2EBEA 2MKKA 1WI8A 2FPHX 3VGUA 3CCSS 4CLKA 1HMVB 5A8WA 3DRPA 1TL1A 2AGPA 4WTYA 1IM6A 2OO4A 3GSIA 2HAIA 2GHPA 1TAUA 5DDOC 3O3LA 2FQQB 4X2BA 1S1TB 3TUJC 1N5SA 3U02A 2BJ3A 4ANDA 2B51A 1D9AA 3ELHA 3MEEB 4IUFA 3PX6A 2MB0B 2UVVA 4Q2MA 3ZZYA 5FD1A 4QIEA 2PD1A 4ZCMA 1TVRB 3CJQA 2IBOA 3PHEA 2Z30B 1K73T 1FE0A 3M9MB 3BQ1A 2AD9A 2DGTA 3DU5A 3JAMU 4W90B 3MCOA 4YUDA 3FNNA 4JOUA 3HHLC 1QE1B 2ZOGA 1B3TA 1LWCA 4M95A 2JEIA 2NXEA 2E5JA 1UA0A 3L9ZA 4NASA 4CYUA 2B0GA 4R8UB 2DHAA 4RNNA 2Y0BB 2EKYA 2JL9A 1FRLA 3R7SB 1RLDA 3BGLA 1HW9A 4K5SA 2CJXB 2UU9J 3PG9A 5IT9U 5LM7E 1XTZA 2Y8WA 1NZ8A 2C3UA 1NK6A 1SUQA 4K2XA 4CLLA 3ZTOA 3HVTA 4B9SA 2IHR1 4KQZA 4LBPA 4OZ1A 2XSJA 2HZCA 5F8GA 3D3BJ 1S6OA 4QPTA 2FVCA 1VHFA 1KQFB 3KHLA 5IWAJ 4MYTA 1JLEA 2Y1JA 1N36F 4EBCA 3QPIA 2COLA 3VR1A 4DV5F 3TZXA 1F9HA 2R2UA 2F8EX 4N76A 4B3RJ 2KKHA 4J9VA 1TUVA 3IM8A 4K0KJ 1LNQA 3NWGA 3HFVA 4ES2A 4X4RA 2OAUA 2QX0A 4BCAA 3P5TL 4Y28C 2QYCA 4Q5VA 5IM0B 1WOOA 2BRKA 2KM8B 3CC7S 1VQ5S 3J7AN 2DHGA 5ETTA 3WQPA 3DXBA 2A1BA 4YP3A 1HL6A 5LSOA 3IBFB 4Y2IA 4KHRA 3CT9A 4DL5A 3PKMA 7AT1B 4OFZA 1IWGA 3CGIA 5HO4A 2R7VA 4HTIA 3QT6A 2ROPA 2HVHA 2BEFA 4F0HA 1TL3A 2VFRA 2MHEA 3NGSA 4M1KA 3I96A 4J9KA 4LFAF 4YY3F 4C8KA 4DR4F 1DQAA 4UUXA 1NJYA 5HLFA 1CS4A 4LIWA 1WWHA 3EVWA 2ILZA 1VRTB 2CAJA 3BKUA 2AP6A 3CCUS 2RDIA 3H20A 1YQHA 4KO0A 5KFDA 1AUDA 3FRZA 4ZOSA 3PVXA 1HWUA 3L3CA 4OZ3A 1O6XA 1RB0A 3RG6A 2XLJA 3FCVA 1IUJA 2UUCJ 2DNRA 4UZCA 4FS2A 2P8IA 5J2PB 3A3NB 1T7PA 2HNZB 3I0RB 4HLBA 3VCDA 4ZLJA 4BWMA 2XI2A 4M5GA 1N6QA 1VQYA 2NXNA 2HVZA 2D74B 5K14A 4X4NA 3R5DA 3I87A 4AUKA 1XQIA 2HGLA 1EQMA 4QWBA 3PW4A 5ETRA 4NCGB 2U2FA 2F7VA 2CWKA 4CIOA 4TU7A 4H4KC 4AL6A 4PXEA 1H74A 3BO2A 1JLGB 2NYHA 4C3MA 2V4QA 4RU2A 5I3QA 1U2FA 3D3CJ 5IT9Y 1FFWB 5EUHA 5KTQA 3LTOA 2EEYA 1SI9A 3W60A 5A6PA 1MWZA 2HNDB 5L9XA 4ANEA 4DOZA 3BV8A 3CTRA 3KFWX 1WUUA 4DCJB 1Y00A 1JLBB 5LL6d 3EZ5A 2ZUGA 2LXFA 1V6HA 3I0SA 1OO0B 1RXOB 5D0GA 1RWXB 3UD3P 4G1QA 2ZJRQ 1I6JA 1PAEX 3L7OA 1S9GB 2V69A 3QO9A 1KVJA 1JJCB 4IFVA 4M5IA 4PUOA 1GTHA 1GFWB 4NLRA 1VLYA 4A8KA 3JYTB 2HQCA 2AEJA 1CC7A 3OXFA 2CQCA 4ECWA 4ID5A 1NK7A 1KEKA 3QRQA 3N5BA 1CJTA 2GGPB 4USVA 2ROGA 4DUZJ 2E5LF 1VC0A 2VFTA 2GMJA 1FRJA 2J9EA 2W2OP 2EK1A 1T8EA 4TU8A 5KG2A 3VGVA 3D6MB 3L95X 4B3MF 5CYMA 2QL9B 1WG1A 4A8MP 1RHUB 2DNKA 4URQU 3HT0A 4GC6A 1VOMA 4JI5J 1Y11A 2ZBIA 3SCLE 1YKWA 3MXHP 3POTA 4ER8A 4NEZA 4NYZA 4RW9B 4KIAA 1E6YB 2QSWA 2H9ZA 4B9VA 1F5BA 2FHOB 3CNQP 3AOBA 2XZTB 2GS8A 4LVNP 3RB4A 3MZIA 1LEOA 2MQPA 3R6GB 4DI6A 3T5JA 1IXKA 1JXVA 1T05B 3BN4A 2BJ9A 3NBPB 3HJFA 3N0VA 3C6TA 4NWBA 3MPYA 3TQEA 4USWA 4ED4A 2C2DA 3D4JA 4WYWA 1EX8A 2Q1LA 3ONQA 3DLKB 4DFKA 4PXDA 1RT2A 2HFNA 1UVMA 4G3IA 4FS1A 1SB6A 2H51B 2XMKA 3B82A 3ILIA 4HH0A 3D1HA 1FVQA 3OL6A 2CZVC 1KSPA 1RADB 4ZKAA 4DSEA 1HHTP 1S6PA 1CJUA 4ZIWA 4ICLB 5A76A 3HCXA 4H4MA 2DITA 2V0NA 4TY8A 1GAOA 6FDRA 2DCLA 2N3LA 2IJNA 1X4AA 3GIKA 1F3FA 3E01A 5B0GA 3NS6A 2VFSA 1BC6A 1Z1ZA 1T94A 2HIYA 1P1LA 3PRDA 1Q86T 1I51B 3EDRB 3M05A 1N48A 2B56A 5KT4A 2RIJA 4IG3A 4WP3A 2VD3A 4EUVA 2DHSA 5F8LA 2VDIA 2WOMA 1PG5B 3DM2A 2Q6CA 1C0UA 2LDYA 2Z2ZA 1LK5A 2GFFA 2LA6A 2LA4A 2QA1A 3R7NB 4A47A 1QAIA 3SIPB 4M5LA 4JI6F 1X4FA 1NPRA 2CJQA 3PRBA 3H59A 1I94J 4O23A 1QD1A 1EARA 4XDCA 3OVAA 4ZCLA 1UL3A 4DQIA 5IQQA 3J7A1 2ZBPA 2DGUA 3CF5Q 2MZRA 2YY3A 4ZPDA 3MAAB 4F0KA 5H1SV 1RU2A 1RWPB 1VJWA 3CJRA 2A2DA 2DK2A 2NREA 4LF9F 4RBTA 1OQ6A 4NLVA 1FWKA 2QG9B 1WC5A 4ZPTR 2HK3A 1FVSA 2U1AA 1NB7A 2GQ2A 5F9LA 1HARA 3NOCA 2DH8A 4LBIA 3R6LB 3DOKB 2OMOA 4IH5A 3VAGA 1SKSA 2RUSA 3DFEA 2ZWPA 4JV5J 2ASDA 1VRQC 2CNOB 5ETLA 3M6UA 2ZH2A 2HFOA 2CPEA 1RHJB 2PC6A 4WJBA 4ZLLA 1U1QA 2D3OR 4CNYA 2BANB 1PCAA 1UJ4A 4DDFA 2NS1B 2BQRA 3QLHB 1RAEB 3RRGA 3OXLA 4KPYA 3QZ8A 2CJ9A 1RWOB 4C3KA 2KDOA 2QYGA 3PDNA 4KE5A 3OTOF 2ACYA 1RHQB 1RTHA 3AB4B 1HFEL 1QSSA 2ZNZA 3MPUB 1Z2LA 3H5XA 3CDUA 2XLIA 3VQTA 4M5DB 2RKIA 4DF8A 3OUYB 4ZVFA 2R3VA 1QLNA 2N7YA 2QO3A 4LF4J 3RW7A 1UA1A 3CCRS 2G0CA 2L9DA 1WORA 4OYXA 1VQKS 1D0EA 2YNFB 4NXMJ 3QGGA 1PILA 4DL6A 4B08A 1HQEA 4PG7A 3HHEA 3J7ZT 3GV7B 2W9BA 4DMZA 3D6TB 4D3HA 3EICA 2HIQA 3DLGA 3R97A 3B8HA 4KV8B 2O3DA 3JTNA 4G65A 1XMBA 2CADA 3PR5B 3M32B 4ZS6A 5M2PA 3FKBA 3GONA 1N0VC 1PJ5A 3HVWA 3M8RA 5D78A 4I0WA 2OHDA 5BR8J 5HQLA 4ED5A 2QA2A 3M9OB 1HHQA 3J81j 2QMUB 3NCRA 2J8SA 1B0VA 1CBKA 3DLBA 1RHRB 2G0IA 3MF5A 5E3CA 3ZZRA 1ZPVA 2LEPA 3TJ8A 5I3UA 1NSPA 4DX8H 1S97A 3D2WA 4WWSA 3K7RA 2BQ3A 2KL8A 3HHDA 3M9NB 2DHXA 4DSJA 3VAHA 4ZP7A 1BGXT 4NLSA 1X4HA 2KRRA 2XMJA 2DBBA 1UPMB 1VISA 4ZP6A 1LQ9A 1N4LA 2R4FA 5AJ3F 4W98A 2V8HA 2B7BB 2LXUA 2J6TA 1URRA 1EKRA 4Y00A 2D9OA 4KAIA 3CJTA 1RE1B 3CCTA 1IBLJ 1PYSB 3RRHA 4RW8A 1NDLA 4OHYA 9RUBA 3MTJA 1DQ8A 3ZTPA 5C24B 4YOEA 4WFNQ 2F4VF 1RTIB 4FNIA 2DNGA 3DRRA 4J90A 3H0PA 2IM3A 1HKAA 2W4DA 5B0CA 2V94A 4LSZB 1MSWD 3M8QB 1VK8A 1R6VA 4HHUA 1S1UB 2ACMA 1RAIB 1XC9A 4ED8A 4X4VA 2MLZA 4WPAA 2ZC3A 3FMBA 2Q66A 4ZP9A 1YRUA 3R1LA 4IQXA 2C3MA 1SJFA 1N33J 1GXTA 1ZTTA 1LK7A 3UPFA 2K3KA 2M0GB 3NOGA 3R5GA 2IJFA 2GJIA 4LF5F 4NI2B 1C1BA 4F36A 5CYJA 3ADAC 3NG8A 4O0IA 4NXNJ 4WIQA 3BO3A 3LP1A 4PXBA 1BLUA 4J9OA 4YR0A 2XS5A 4RUAA 2VF3A 1WDTA 4NA3A 5DS7A 2G0JA 3KK2B 5JVHQ 4NLOA 2QC3A 5CZXA 1ZM2A 4PWDB 4LF7J 2MQ8A 4XDDA 2F9JA 5LMUF 3GJRB 4IG0A 3KNGA 1BE4A 3QRPA 2J8AA 2RF2B 4MIBA 2F4FA 3B4MA 5KG7A 2AX1A 4X64F 3ZXWA 3DC2A 5DJBA 5A8RA 1JWWA 2F65A 3B78A 4N5SA 1VJQA 2EXUA 2GNKA 4ZVSB 3WC2A 2XS2A 2J0QD 4BC7A 1E6VB 3PW0A 2DVIA 2CG4A 2H5EA 2IPOB 2RDJA 3C6UA 2VU5A 3MM6A 3FSIA 1YBTA 5KFSA 5L1LA 1RACB 1LWEB 2Y1RI 1HYSB 2K1RB 2VJUA 3GCWP 2Y9HA 1W2BR 1WELA 1W25A 5DDRC 3FCHA 3MMCB 2HNYB 4CCHA 3CJ2A 2AJ2A 4LF6J 4ZPCA 2VFUA 2GX8A 3MMBB 3RBZA 3DYAB 3N9UC 4F4XA 3I31A 2XO7A 3IRXA 1OY9A 2AJ0A 3KLGA 3PFOA 3G6VA 2X3DA 5BYQA 5EHHA 2DNYA 2VBWA 4N7TA 3BR9A 2H4YB 3JB9k 4ES3A 2E44A 4OQJA 5KFFA 4GC7A 2CJAA 2UVRA 1UETA 1JIHA 1Q8IA 2WSCC 1MN9A 5DZ7A 3KHHA 2PA8D 2ZE2B 3E51A 4J7CA 2HK2A 2GW8A 2QEXS 1TL5A 4K8RA 1XR7A 1KQGB 2ZVIA 1RT7A 5GAEI 3LPYA 1F5CA 1NJWA 1WEXA 1RSCA 4DQSA 3SXLA 2E7XA 2CVIA 3E8OA 5KFMA 3N6LA 2AYMA 1YG0A 2KHDA 5GADU 5G4DA 4AL7A 3PV8A 3BDEA 3ET6A 2G1HA 2FHKA 4RKUC 5ITHA 2J9DA 3LQVA 4DV6J 4DV0F 3FFIA 4QIGA 4X4OA 3A8IA 2YWGA 2DR8A 5J2QB 1S6QA 2LQJA 2VFVA 4ECVA 2B8PA 1RISA 3KLHA 1G3OA 2Z2YB 2PEBA 3E3XA 5KG3A 1TKTB 5FDLB 5CABA 4HACB 3V6KA 3G82B 4DR1F 5AXMA 3SCIE 1Q53A 3VAJA 3P3DA 1RBLA 2HQIA 2YWKA 3NNCA 4OI3A 2R2TA 4NX9A 2KHCA 1OPZA 4Y2CA 1EAYC 1FO1A 3AT1B 3Q8UA 3RRKA 4DFMA 5A2QU 4B9UA 4NCAA 2CA9A 2AYEA 4DV7J 4L74A 2Y3YA 1B99A 3MMAA 2KI2A 2HURA 2V9WA 2BQUA 3K58A 3CVKA 1QSYA 5T14A 3AODA 2YH0A 4B3RF 3CCES 3UVJB 4CLZA 4Q8EA 1GXUA 3JS9A 2ZD1A 1VDHA 3QIPB 5E3RA 5JXSA 4B3TJ 3E2EA 3R5CA 3K2YA 3TZZA 4EZ6A 2KM8C 1IQTA 3OQ2A 3PNIA 2C2MB 2XG8A 1WKJA 4PQUB 1WOPA 3T19A 4RWWA 3W8GA 3SQGB 4NMXA 4UQGA 3CJKA 3TNVA 2NZCA 5DG9A 2M70A 1K8AT 1JLFA 1Y5NB 1HNXJ 1Y9OA 2W4PA 4IRKA 4IDKA 4IR1A 4R0EA 3CDAA 3N79A 3DXSX 2YNIB 1S1XA 1ZBTA 2GJFA 1O5JA 3DN9A 1D8ZA 4ZJLA 4CLTA 3C2PA 2W8KA 3KLFA 1P1TA 1IR0A 3VALA 5EN1A 3CMAS 5KT2A 4USIA 4DU8A 3JSMA 1HI0P 3HX9A 2DD8S 2UVWA 2OPPB 1RTDB 4MMOA 4K59A 1RQ0A 3OLAA 3R1HA 3Q83A 3HFZB 1SJRA 5CXTA 1DY3A 2LECA 2PFDA 3H5YA 4X4QA 2WZ1A 4UZBA 2GQCA 4C8OA 3L4BC 2HKEA 4PWWA 3UE2A 2I5JB 2YQ3A 2IRYA 3GV8B 3THTA 4NL5A 1H3DA 3M8SA 2HHTA 4OI1A 2WVFA 4LIRA 1YLXA 3R5AA 5CYQA 2V63A 3MEGB 2V4RA 2PEHA 1VBYA 3C8YA 3IG1A 3PEHA 1DRZA 5DM7Q 4FPRA 3OFGA 2VOPA 1ZA2B 1GTEA 4IKAA 1S0MA 4FYXB 1VGYA 3JXOA 3VHQA 1SH2A 3G8SA 5F8IA 4O3NA 3ZFVA 2E29A 4DSFA 3EPIA 4NOHA 1NDKA 5EDWA 2DXDA 1H38A 1KFDA 1QUVA 2JWNA 4DSLA 3PW5A 2GVDA 4GVBA 3U27A 2VH7A 3CO9A 3TX0A 4DX7A 4CTAA 5HJYA 2R8HA 4LR8A 3S8SA 5A2QY 4N41A 4PRFA 2XSJB 3TEHB 2ZOMA 4ZPWR 2KU7A 2CQBA 2CJKA 3PYDA 1EJ7L 1KRPA 4EFAC 2AT1B 5DLGA 2JFKA 3H2VE 3RU0A 4OI4A 4DR3F 5DQGA 3PJXA 1KDNA 8RUCA 1H2VZ 2GO8A 5I42A 4K4XA 4JI1J 1LWFA 3FEYB 1RTJA 4ETZA 4ELUA 5EGYA 5JMNA 2LQ8A 3HSJA 4USJC 5CD4H 1TTHB 4FN5A 4U7CA 2CZ9A 1R6YA 2EFGA 3QFWA 3PEJA 2JEJA 1DZ5A 3H42A 3DDNA 4AXJA 1F9EB 1H7WA 1IBMJ 4ANCA 4WBFA 1HWIA 4DZDA 4JI5F 3Q22A 2PI5A 3NGRA 4P52A 4PKDB 1LKZA 3R5JB 5B09A 5T41A 1GH8A 3EYZA 3DGVA 3T9NA 1UFLA 3UR3C 2L9NA 3PRVA 1AT1B 3CJ3A 2BJ8A 3AJ1A 1KLMA 3KJQB 4C0BA 3NAIA 2XNQA 4WP8A 2VODA 2KFZA 3JQKA 1SVDA 2DISA 4X66J 5C25B 2E5GA 4HDHA 3RJMB 1GNKA 4ECTA 3CD0A 2B43A 3IAM9 5E3AA 3LH2S 3A1YG 1NXIA 2CPZA 2H4WB 1DBDA 1SJ1A 3OV7A 2DXFA 3KTQA 4H4OA 3CXCR 3ZTSA 2MXYA 1UTAA 5LT5A 4QYRA 1W26A 4QR1A 4WKRA 5KFOA 4E2FB 1A6LA 3CDWA 4HEA9 2HQDA 2QIFA 4K4VA 1R3NA 4N56A 4F4WA 4OX8A 2RVJA 3D1QA 2IAJA 2ERRA 3GTYX 2HRTA 4P7VA 2C1EB 2ABYA 2HHWA 5CQGA 2F40A 3W3SA 3G4SS 3GJSB 1S7IA 2CJYB 2C22A 2GIQA 1CJKA 4NLGA 4XPEA 1H6KX 3H2LA 2E1MC 1N6QB 2OSQA 4MFBB 4A4JA 1DURA 2H54B 3WDOA 2ZH4A 1CJVB 1S48A 4Z2XA 1NPKA 4WXOA 5F0WA 1BD6A 3I4PA 4AFFA 1IKYA 1XMQJ 1Q5YA 2LFVA 1T9WA 5HI7A 1WKKA 2DNZA 3W9JA 4U95A 3ZO7A 2QV6A 1SC1B 2ATCB 2YKMA 1SQFA 3DOMA 3MFHA 5KFEA 3NEKA 1U1NA 3M2RA 1F2HA 3ETOA 1HBMA 3CCVS 1RT5A 3PZPA 4GKKF 4DS5A 4DSKA 1C2PA 4A8YA 5HATA 4DPTA 1RWVB 2EC2A 1RT3A 3ITHB 5AXLA 5EWGA 1WC4A 2PIIA 3C14A 2DIUA 1PC4A 4P2MA 1I94F 3LGNA 1R27B 2IMWP 4G1QB 4ECYA 2RDDA 2F8HA 1QM9A 2VQEJ 5HVGA 3SMZA 2YKQA 1OQ3A 3BGRB 3Q86A 5KFPA 1X0PA 2XI3A 3QJLA 2AZ3A 1S1VB 1Q78A 2FJEB 4R5PB 3CCLS 1CJTB 1WHVA 4A48A 3MOZA 2ZKUA 3QJPA 4RNFA 3TJ9A 2YKNA 1TV6A 2ZHAA 2DGWA 3AOCA 3HP6A 4A8XA 3HDSA 1R0AA 2OELA 2CJBA 4LRFA 4U9RA 5CYMB 3DHXA 1MMNA 2I9SA 5HMWA 5C42B 2V68A 2E5HA 1CULB 5THWA 4GKJJ 4ZLNA 1PO6A 3BEGB 2M88A 1B7YB 1OY6A 4DJBA 3UDCA 3DI6B 5HMZA 4U67Q 1TR0A 1EKSA 3CUNA 1S1WA 1RWWB 2CPFA 2M9KA 4PEOA 2XNRA 1XN9A 3Q8PB 2R42A 2CQHA 2CNLB 3R27A 1U0HB 1WG5A 5KT6A 3CMES 2DH9A 1VQMS 5IV3A 4I2QA 2W2NP 5M2UA 4HHJA 1IKVA 4E98A 4EWTA 1J27A 2WAQD 2LQ5A 1WTBA 3Q0AA 3C6TB 3HHKA 2RQCA 2HBZB 4MIAA 2HMIA 2V50A 5CCLA 1C1CA 1JNRB 4LF4F 2NUHA 1S49A 3GP9A 2KZMA 3UWTA 4PG4A 5HK4A 3BS9A 3CO0P 1A0OB 3NMRA 4NXMF 1YRXA 1PJ6A 4F4YA 1RTZA 1S6PB 1RJJA 5LOQA 1VI7A 2C2RA 1NH8A 2YWEA 4NLPA 1HR0F 3RAQA 2FJAB 4OZLA 2WONB 3VAIA 2ZJQQ 4B3OB 3OL8A 1ZM4A 3E01B 1R8PA 4JI3J 1EP4A 3SZ2A 4W92B 5BR8F 5CA5A 3U1MA 3TANA 4OIXA 1HNIB 2DYAA 3RGIA 3MHYA 1HPZB 4C8MA 1Q4RA 2J5AA 4JYAJ 1FRMA 5D4OA 3EX7B 5G0RA 3H5UA 2B3TB 1NJZA 2W01A 2IA6A 1XWLA 4DV2J 4JV0A 1JJ2R 1GMWD 1R31A 3M2UB 1PYOB 1UWBA 5T7LB 4Q45A 4OZ2A 3HT3A 2RRNA 1DTTB 3JQMA 1KLNA 5DG7A 2IC3B 3ULHA 5CZVA 1GX6A 2DNPA 4D3GA 1ICEB 4K4YA 2R2SA 3MM5A 2MKSA 3CCZA 5A6WA 1S77D 3IR7B 4L73A 3MM9A 1ZOTA 1GX5A 1SV5B 2HFVA 5K8OA 2BE9B 2DNMA 5E3PA 3F56A 4EGLA 1IBLF 4U7UD 1N52B 5B7WA 1SL0A 4O3OA 4HKQA 2BE2A 4AL5A 3V81B 3EMTA 1YZ7A 4FYDA 2HS4A 3H4DA 2A0FB 1Q79A 3W61A 2IRXA 2VG5B 5LXRA 4LF8J 4OZ5A 4QWEA 5HAOA 1B0TA 2YKPA 4U96A 1YDLA 3HZEA 3QGIA 4RZRA 2YTCA 3MR5A 1VCTA 5EWEA 2PI4A 2B9XA 3ENQA 1S9EB 5M2RA 3D68A 4BBYA 1WACA 1NUEA 2KN4A 4CH7A 2IM0A 1XNRJ 3AD8C 5J2NA 1S10A 2YVSA 4DX5A 3PIPQ 1NKEA 4CLWA 5DDPC 3LP2A 1I5OB 1M5PC 5HBMA 4M8LA 1Q5VA 2Z2LA 1QTMA 1D8YA 1RTHB 3CDBA 2AMCB 2X1AA 2J76E 5KFTA 2QGFB 3HZGA 3UN2A 3ILLA 5H9FK 2HS0A 1HMVA 2QL5B 3NKYA 1CEZA 4LF7F 1Y7PA 2MZTA 3MCMA 4DG1B 4DR7J 2FJXA 3VZIA 4USHA 2VBYA 3QAUA 4QR0A 2VJVA 3RR7A 1U45A 1NK9A 1M1KT 4AQYJ 2QT7A 3KHRA 3KUHA 3MEEA 1FJGF 2BW7A 2HHVA 1H2UX 4LSNA 1HWLA 4PR6A 1RT4A 1TVRA 1UP1A 4ED0A 2FJVA 4I64A 2RHSB 2M52A 4E8UA 1L3SA 4I2PB 2W9CB 4NCBA 3EVMA 5HQ8A 4OL8A 2MY8A 1U09A 2XMAA 4I4BA 5KG5A 2HZVA 1YJVA 2AX0A 5IXUA 2FUG9 2CWXA 1SL2A 3KLIB 5DZ6A 2P9GA 4CO2A 3D67A 3I5BA 3BN7A 3CMQA 2XS7A 3HVAA 2MEWA 5DO2A 2YWHA 3HXMA 3ZZTA 1UEVA 4ED2A 3PO4A 3DHWC 4R8UA 2GCFA 5I3UB 1FX2A 4LF6F 2CDRB 3GCXP 3PXGa 3PACA 2EKNA 2J7KA 1JLQB 5F8HA 4P6QA 4ZMMA 4DL0C 4R25A 3KOAA 3ZTRA 3SQOP 2HG4A 2RILA 3LAKA 4EYIB 1FD2A 2FJBB 2IVMA 2POKA 4HTJA 3T5LA 2K7KA 3KWMA 1U1KA 4V19X 3ENWA 2JEFA 3VVUA 2R2RA 3ENVA 2NYIA 4J9NA 1S12A 3F0NA 2HHHF 4LBHA 2HQFA 3EZOA 2DT9A 3IGNA 3NLCA 3SDEB 2R7SA 3OBIA 3OVBA 2V8PA 2LMIA 1K0VA 2LQBA 4HI2A 2KZZA 5ETMA 4DR6J 5H9EJ 3VTIA 3KK1B 4I1TA 1VQLS 3SFGA 2Q3PA 3OTDA 4ECUA 4M63A 2YBVA 1FWPA 1F0XA 3OR2B 4ZVRB 2VB6A 3HSGA 1V5IB 5GMEA 4ATNA 4DV6F 1IWAA 2ZUAA 4OI0A 2E9RX 2NXUA 2DY9A 3KMSA 4NLYA 4ERDA 5CAAA 3OVSA 2C3OA 1HNWF 3IS9B 4F8RA 4KHPJ 3KXDA 1U1OA 2VA3A 1FFSB 1PSDA 1LXJA 1P9QC 2LQ9A 3AFGA 3FBFA 1B64A 3UFCX 5KG4A 4KFBA 5E5NA 3GWCA 2JC0A 4UQTA 2DNLA 2R7QA 1DAXA 2XY6A 2CDQA 5J1PA 4N47A 1S0NA 2VG6A 2YX4A 3WX4A 3Q8RB 3WZ0A 2DNOA 3AQOA 4C2MA 2CQ4A 5L39A 3MTKA 1M0SA 1VRTA 4ALZA 4O44B
chains in the Genus database with same CATH topology
3PM9A 2J6TA 1URRA 1YSJA 2DH7A 2V4JB 2DGVA 3BGRA 4Y00A 3HFKA 5I42B 2D9OA 2LYVA 2C3PA 4KAIA 5IT4A 2FY1A 1S1VA 4EBDA 1K1QA 4DPOA 3VZHA 4B3TF 3VAFA 4C8ZA 2VC0A 2ZH1A 4R5PA 1RTJB 1QY7A 3CCTA 3IBWA 3N5FA 2K8GA 2AJ4A 2OD4A 1NZAA 5F9NA 2YKOA 3RRHA 2OPRB 4RW8A 4OHYA 1JKHB 2X51A 2EFNA 2UUCF 1RP5A 2XMWA 3CCJS 1L3TA 2ZDOA 5HMYA 3BSCA 5DGAA 1G6BA 2DIVA 1WEZA 3MTJA 1DQ8A 5F3ZA 4URGA 5KFHA 4IR9A 2JLGA 2RNEA 5C24B 4C8LA 1FCAA 4WIIA 4YOEA 4WFNQ 1M5HA 1VQNS 1H0HB 4ZLPA 2XMMA 2W7PA 5J2PA 3DLHA 2F4VF 1RTIB 2HNZA 2LCWA 3I0RA 2DNGA 4FNIA 3DRRA 3D0GE 1LWCB 4CT8A 1V9OA 1MWYA 2IM3A 3L7PA 2W4DA 5B0CA 1QUPA 2V94A 4GKJF 2Y0SD 2IRUA 5KFYA 3T6JA 3UNGC 1HNXF 3HKWA 3G86A 3ISND 5C42A 3SV4A 1R89A 2ZH5A 1OSDA 1MSWD 1XNQF 5D3GA 3M8QB 1F60B 1VK8A 2BBEA 1OS5A 4RNOA 4ZVHA 1RKJA 2N3OA 1YTYA 3BSAA 2JLEA 3N28A 1S1UB 1TZ0A 2PN6A 2MKIA 1K9MT 3MUVP 1RT1B 4L72B 2R7RA 4DV4F 4ED8A 1XC9A 4HH1A 4NCGA 1NAQA 3CB4A 2GIRA 2JVRA 1KLMB 4MKAA 2FLNA 4WU2A 3DI6A 1U1RA 4ZDNA 4X4VA 1KN6A 1KS2A 2D3UA 2ZDPA 5D4NA 2FTRA 2M7SA 2ZC3A 4DR5F 4PPDA 2QRRA 2LEAA 2OSRA 4Y34A 3M8PA 1KQKA 3BGFA 1S4FA 3FMBA 2Q66A 3OFEA 2VZ9A 1X4CA 1JLGA 5BJRA 2MQOA 5KFAA 4ZP9A 1YRUA 1JK9B 2MQMA 3R1LA 4IQXA 2C3MA 4OHXA 1MMLA 1SJFA 1Q81T 1GXTA 4NYPA 1RDRA 5DGBA 3IGVA 4DQQA 1ZTTA 4NA2A 2V8GA 1LK7A 4J5OA 4PXCA 3UPFA 1UAWA 3B4DA 4KBIA 4BHQA 2K3KA 3FEXB 2M0GB 5GAGU 4K4ZA 3BZQA 2IJFA 4ZHRB 1HBOB 4H4OB 1N5TA 2GJIA 4LF5F 3WBZA 1M5KC 4WF9Q 1AFIA 3OSNA 3GIMA 1X5SA 1SUQB 4C11B 3KHGA 1C1BA 2CQGA 2HNDA 4J9MA 3MAHA 4ZCIA 5CYJA 3K5LA 3NG8A 4CO1A 1NHVA 4O0IA 1X9MA 3SV3A 4RW7A 2WK4A 3TAMB 3MM8A 5KFNA 2FD2A 3BO3A 3CD6S 1JLBA 3ICLA 3HLUA 3LP1A 4PXBA 3I56S 1BLUA 4F2SA 2W9AA 4J9OA 4YR0A 3HVTB 2XS5A 4RUAA 5E2QA 3D54A 1N88A 5GAEU 3HM9A 4NA3A 5DS7A 3LO3A 2KXFA 4QZVB 3KK2B 5JVHQ 1D9FA 4NLOA 4J37A 1TK8A 3O8WA 1PGZA 1IN0A 5CZXA 3SYZA 2OH2A 1ZM2A 1VQOS 4TQRA 2J6UA 3AHPA 4PWDB 4WCEQ 2OJ3A 4XDDA 2EBGA 3M6WA 3QJJA 1JLEB 3M30A 3G6YA 1S9GA 4MK9A 2F9JA 3RB6A 5LMUF 4FF3A 2IAJB 2QFJA 1I1GA 3KKFA 1ZAWA 2OMLA 2I0XA 4QIWD 4IG0A 3K8VA 3KNGA 4EEYA 3SEOA 3PO5A 1VQSA 2J8AA 3JYTA 2RF2B 2V4JA 4MIBA 2FHJA 1WEYA 1RT7B 3B4MA 5KG7A 3MD3A 2JH3A 2HQ3A 2ASYA 2AX1A 4DUZF 1VQ9S 4TXSA 2L3MA 3RZAA 2MPUA 1P6TA 3HI9A 1KNZA 2JX2A 4X64F 4EO6A 3MPWA 4OZ0A 4A8WA 2DNNA 3MM7B 2GGPA 3SFUA 4IH7A 4DQPA 1JKHA 4KB7A 2PFFB 4JV2A 1XBWA 2O66A 4PPZA 3DC2A 5DJBA 2ADBA 1RYSA 1YVFA 5A8RA 2EWHA 3IN5A 2WSFC 1JWWA 2WONA 3WC0A 3B78A 2SXLA 2ZITA 4N5SA 4KTQA 1L5UA 2XSFA 4B3OA 5KFUA 3U1NA 2GNKA 5C24A 2ZH6A 3V4IB 1X5PA 4DLGA 4IRCA 3CC2S 3FFIB 3G6XA 2XZWA 1FEHA 1BQXA 1SH3A 2VC1A 3WC2A 2XS2A 2J0QD 3TW0A 4BC7A 1E6VB 3J7YI 3PW0A 4DHVA 4K4WA 5AE2A 3TAPA 2RRAA 2DVIA 4OHZA 3OR1B 2CG4A 4Q2LA 1X7VA 4IFYA 4HT7A 4LSLB 5DDQC 1HI1A 2O5DA 2H5EA 4C8YA 4HI1A 3S01A 2RDJA 3G8QA 3S6EA 3KLHB 2BVZA 2WRMA 1HNVB 1LOUA 3RAMA 1CC8A 1HNIA 1IQZA 3C6UA 4JYAF 2YKMB 4NZ0A 2MGZA 2WW8A 1HPZA 2E66A 3MM6A 2DR5A 3FSIA 2CKWA 4FVMA 4CH0S 3GR1A 1RT1A 1ZAXA 5KFSA 5L1LA 2HYIB 4EYHB 4NA1A 1LWEB 1HA1A 1HD0A 2Y1RI 1HYSB 2NSBA 3M2RB 2RJZA 2KYXA 2K1RB 4Y2AA 1HBMB 2DNQA 2VQFF 5K8MA 1MROA 1H2TZ 3TR5A 1W2BR 1WELA 1K1SA 2ALZA 3PW7A 1W25A 1EETB 1F5AA 3FCHA 5DDRC 3MMCB 3FZBA 1O8BA 1GQEA 1RT3B 3H98A 5J1EB 2HNYB 4RW9A 4EU0A 3MAQA 4CCHA 3CJ2A 3LWMA 2IA0A 2HLTA 4ZPCA 1UFWA 2MSSA 2VFUA 2GX8A 3MMBB 3U7JA 2ZH7A 4FF2A 1TL3B 3M2UA 2WHOA 5T7LA 3DYAB 3N9UC 4F4XA 1ULRA 3N6MA 1JLCA 4DL7A 1DTTA 3I31A 1KQSR 3BJYA 2VOOA 2IC3A 2JVOA 4XAKA 5BYRA 2XO7A 2DGQA 3IRXA 2KH9A 2AJ0A 5HLFB 4OMFG 3KLGA 4OJ1A 3PFOA 3G6VA 3CC4S 3J81Y 5BYQA 2PE8A 3KLVA 3IWNC 3DLJA 2RSQA 3UCUP 5EHHA 2P9CA 4ZPVR 2DNYA 2RS8A 2ZVSA 2VBWA 3LOUA 1N5VA 3I5AA 3VWSA 2C28A 1T05A 5KFGA 4I6WA 3NBPA 4IYQA 1XMOF 1SV5A 3BR9A 4RX6A 5HROA 3SCKE 3M1VB 3GFYA 3Q8QB 3KK2A 2XMVA 3G8TA 4A8QA 2C42A 2XY5A 3JB9k 2C2EA 4KO0B 4ES3A 2E44A 2OTLS 3QWPA 4C4WA 3RR8A 4F4KA 1X4GA 4OQJA 5KFVA 1Q16B 5KFFA 4U6PA 4Y0FA 1VIXA 4GC7A 5GAGI 1C4AA 2OD6A 4PWDA 2CJAA 5KFBA 1LXNA 1NKBA 2UVRA 1UETA 4DL2A 1JIHA 1Q8IA 2WSCC 1X8DA 3OL7A 1YITS 2N4CA 3DLKA 1FKOB 3KHHA 2YKNB 2PA8D 1M5SA 2ZE2B 3E51A 3HKZD 1VBXA 1UW4A 3K5NA 4K5RA 3V81A 2GO9A 1FERA 2CIMA 2MMYA 2R8GA 3EXYA 2FDNA 3Q24A 2GW8A 2QEXS 1TL5A 2VBXA 4OJHA 3RAXA 1KOOA 1S0VA 3J7Z5 1XR7A 1KQGB 3DLLQ 1RT7A 2VG5A 2GC8A 5K9FA 5GAEI 3LPYA 1F5CA 2VUGA 4G1IA 4RNMA 4A46A 2MZ1A 1NJWA 4JI7F 2ZZNA 4RLEA 2CPDA 3NCPA 1WEXA 3FGVA 1NH7A 3W2WB 4DQSA 3SXLA 2E7XA 2CVIA 4LQ9A 3E8OA 5KFMA 4Y65A 2ILYA 3THPA 2N7CA 3MR6A 4I69A 3MM7A 2F3JA 5B0EA 3V6DB 3N6LA 2AYMA 2B9WA 4ICLA 2J6SA 1YG0A 2KHDA 5K14B 5LSRA 5GADU 2GHWA 5G4DA 4AL7A 3FQLA 5KT3A 1JLFB 3PV8A 5AE3A 3BDEA 2KYZA 2KXHA 2JJ4D 4YDDB 2FHKA 4RKUC 5ITHA 3T9ZA 2I2YA 4I56A 3UCGA 3AA9A 1HQUA 3AY0A 3MWBA 4B02A 2J9DA