3S7RA

Crystal structure of a heterogeneous nuclear ribonucleoprotein a/b (hnrpab) from homo sapiens at 2.15 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
NEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Heterogeneous nuclear ribonucleoprotein A/B (HNRPAB) from Homo sapiens at 2.15 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein A/B
total genus 17
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s7rA00
2KM8C 1OPIA 2OJ3A 3NNAA 2EVZA 1X4CA 5GMKa 1NU4A 1F9FA 4WFBQ 2RRAA 1R8HA 3R27A 3CCES 1KQSR 4IOAQ 3N9UC 3SMZA 2FC9A 2DHXA 5JVGQ 1VQMS 1U2FA 2M9KA 1DRZA 1QVFR 2AYMA 2MZSA 2MYFA 1WHXA 1DBDA 1WG5A 2GO9A 2E5JA 2VOPA 1X0FA 4QU7A 2X1GA 1L3KA 2E5GA 1Q86T 1WI6A 1SJRA 3TYTA 4FXWA 1Q82T 5CXTA 4F02A 5DDQC 1M5OC 3CMAS 3MUMP 1JMTA 5HO4A 1KOHA 3OW2R 1FO1A 2LCWA 3VF0B 2K8GA 1VQOS 1CVJA 2DB1A 2M88A 1PO6A 5GAEU 3P6YC 2DO4A 1UW4A 5GAGU 3B4DA 3FEYB 3EGZA 1FJEB 2J76E 2YH1A 2N3OA 2LA4A 1SXLA 2DH7A 2YH0A 3UE2A 4WFNQ 2FY1A 5HL7Q 4OZ1A 2MKSA 3RW7A 2MY7A 2DGOA 4EGLA 3CTRA 3UWTA 3EX7B 1VQ8S 1QVGR 4PR6A 2E44A 4CH0S 1HA1A 2JX2A 2RRBA 2E5HA 4CIOA 4QQBA 2CQDA 4Y0FA 4CQ1A 3UD3P 1FXLA 2G0CA 3UCUP 2MZTA 2KVIA 2MKHA 2DGUA 2X1FA 1S72S 1WTBA 1YWXA 2DGWA 3G71S 3G8SA 3CULA 3G6ES 2NLWA 3EGNA 2CPIA 4WIIA 1RKJA 3VAKA 1U1PA 1WEYA 1PGZA 1M90T 1WG1A 2CQIA 1U6FA 3LQVA 1K9MT 2XNRA 2KRRA 1WF2A 2CPDA 5LJ3Y 3FEXB 4WCEQ 2F9JA 2CPHA 1SJ3P 2J0QD 3SDEB 2D9OA 2KM8B 2MQPA 4A8XA 5DDPC 2DGVA 3PIOQ 1JJHA 2RVJA 4Y00A 3JB9k 3U1LA 1KOOA 2LEAA 1K8AT 3MXHP 2M52A 1M5PC 1YJWS 2HGLA 2CQGA 1K73T 1H2TZ 2ADBA 3CCLS 2D9PA 1A9NB 3VAGA 2G4BA 2RS2A 3S01A 1WF1A 2DK2A 2CQHA 1YIJS 2DGQA 2XB2D 1BY9A 5D78A 2MB0B 3CD6S 2U2FA 2VODA 5LJ5Y 1JJ4A 3MURP 1U1LA 1WF0A 2AYEA 1M5VC 4C0OC 2JRSA 3J7YU 2MPUA 2QFJA 2I2YA 2CQ0A 4F26A 1SJ4P 2CJKA 1WHVA 2DO0A 4ED5A 2N3LA 4YB1P 3G4SS 1FJCA 1WHWA 2LXUA 3DLLQ 4U67Q 1KD1T 3DXBA 3CCMS 4ERDA 3BO3A 1OWXA 4TU9A 2MKKA 1HD0A 4LJMA 2N7CA 3S6EA 1WEXA 2DIUA 3THTA 5LSLA 5CYJA 2G1DA 1YJNS 2DNYA 4W92B 3NNCA 5CA5A 1VQ4S 3ZZYA 2RQ4A 2MSSA 1P27B 1U1KA 2DNQA 1X4BA 1H2UX 2CQ2A 4IUFA 2DHSA 2K3KA 2RU3A 2CQCA 4QPTA 3BO2A 2M0GB 1OIAA 4F25A 1W2BR 2FC8A 2BZ2A 2X1BA 2YKAA 1U1NA 2L08A 1VQ9S 2U1AA 1NO8A 2RNEA 2MY8A 4LIRA 3VAIA 1H2VZ 2XNQA 5FJ4A 3P3DA 3U1MA 2MQQA 3S8SA 5JVHQ 2RS8A 3UCGA 3CXCR 3IWNC 1X5SA 1URNA 1U1QA 2DNGA 2CPFA 1NJIT 2KXHA 3IRWP 2MQNA 2MKIA 3CPWR 3CC7S 2XSFA 1IQTA 5MLCV 2OSQA 2MMYA 2DH9A 2O3DA 5DM7Q 3I55S 1ZZFA 1VC5A 2LKZA 2MZQA 3MOJB 5DETA 1B7FA 3SXLA 5H1SV 2KT5A 1ZH5A 2DIVA 3CC2S 1YHQS 2MJNA 2CPYA 2KG1A 5LXRA 2E5IA 2DITA 4OZ0A 4PKDB 3J7ZT 2DNPA 3K0JA 1VC6A 3L3CA 1WWHA 1N8RT 2DGSA 2LXIA 1YITS 3R1HA 4LMZA 2CQ3A 1O0PA 2JVRA 4ZKAA 4WF9Q 2B0GA 1X4GA 2LQ5A 2ZJRQ 1N52B 2NZ4A 2JWNA 1WELA 2DNHA 4WFAQ 5DDOC 4QU6A 4W90B 2FHOB 3S7RA 1VBYA 1X4HA 2MZJA 3CC4S 3TP2A 3CCJS 2DGTA 2LMIA 2PE8A 3MUVP 2KI2A 2SXLA 3CCSS 3VAMA 2MKJA 2RQCA 3P49B 1HD1A 2HZCA 1X4EA 3VAHA 2FPHX 1VQ6S 2A3JA 2KHCA 1YTYA 3CCQS 3G8TA 1UAWA 5DDRC 2J8AA 3CCVS 3VAJA 1FNXH 4WKRA 2MJUA 2Q79A 3CUNA 2OTJS 2L41A 3MUTP 2AYGA 3TO8A 2HVZA 3VAFA 2M70A 1JJ2R 1U1OA 3H2VE 1VQKS 2LA6A 2GHPA 4PRFA 5EN1A 4TU8A 4M5DB 3V4MA 2HGNA 2ZJPQ 3Q2TC 2ADCA 4YOEA 5BJRA 2KXNB 3SDEA 2CQ4A 2MSTA 3CCUS 1G2EA 1UP1A 2DNOA 4C7QA 2HYIB 3RW6A 2MZ1A 1VQLS 2X1AA 3CF5Q 3H2UB 3UD4P 3BEGB 1KC8T 2M2BA 2CQBA 2KFYA 1D9AA 1Q81T 2MXYA 2MQLA 2DISA 2MQMA 2MQOA 1DHMA 2DHGA 1VC0A 2XS2A 2QA4S 2J0SD 2AYBA 1U1RA 2N82B 3R1LA 3THPA 2MGZA 1WI8A 2HGMA 1SJQA 2MZRA 2KG0A 1X5OA 2LYVA 1SJFA 3BS9A 4J5OA 3ZZZA 2DNNA 3NNHA 4BS2A 1U6BA 5IM0A 1VQ7S 1VQ5S 3NMRA 2EK6A 2F9DA 1M5KC 3ULHA 2DNZA 2KXFA 1WHYA 1Q7YT 1N54B 5IFMA 1YJ9S 3HI9A 2M7SA 2CQ1A 2JVOA 5D77A 4IOCQ 1HL6A 2D3OR 1AUDA 4RU2A 2KU7A 2YTCA 3MI7X 1DZ5A 4TU7A 1ZZNA 2WBRA 3MD3A 3P5TL 5ITHA 2L9WA 2KH9A 1N88A 2F3JA 2V94A 4TLQA 2ERRA 2KRBA 2M8HA 2DNMA 2DNRA 1YI2S 2VONA 2DHAA 1WG4A 2AD9A 1XN9A 2PEHA 1X5PA 1VBZA 1QM9A 3LPYA 1H6KX 2XS7A 2LECA 2MKCA 2MGZB 1M1KT 1X4AA 2LEBA 2MHNA 1S79A 2DH8A 2KYXA 4IO9Q 1X4DA 1X5TA 2EK1A 1X4FA 5LSOA 1U1MA 3NS5A 2KN4A 4FXVA 1R8PA 2OSRA 3G9CA 4V19X 3US5A 1A7GE 2DNKA 2QEXS 2BOPA 5IM0B 3NS6A 3BO4A 2CPEA 2DNLA 3UCZP 2ZJQQ 1WEZA 1RK8A 1FT8A 1FHTA 1VBXA 2M8DB 1P1TA 1VQNS 5GAHU 2OIHA 1OO0B 2CPXA 3PIPQ 3CMES 2CPJA 4P6QA 1UFWA 3B4MA 2RT3A 2VOOA 2XS5A 4UY8T 4CH1A 4C4WA 3MD1A 2CPZA 2UP1A 2I38A 1VQPS 3VALA 5GVQA 2DGXA 4UQTA 2YWKA 3CCRS 2RUGA 1D8ZA 2M4MA 4Z2XA 3D2WA 5GADU 2CQPA 3MDFA 5LXYA 3HHNB 1FJ7A 4YUDA 5DM6Q 3I56S 2OTLS 5IQQA 3G96A 3Q2SC
chains in the Genus database with same CATH superfamily
2KM8C 2B5JA 1OPIA 2NYHA 1BQMB 3DLEA 4NLQA 4IFYB 4ZVOB 2HMIB 2C3MA 2E1AA 3BSCA 1DTTB 2O1PA 1B0TA 2LQ8A 2V68A 2GQ2A 5GMKa 4X64J 3TRGA 1I5OB 2MLXA 1LW0A 2QMXA 3OFFA 2E9TA 1CJTA 2NSCA 1F9FA 3OVAA 3QJPA 4NRTA 1ZS6A 4U7UK 3SCIE 4ZVTB 2F4FA 5B7WA 4IG0B 5F8NA 2OAUA 2RH3A 3M2RA 3NOCA 3OFGA 1RDRA 4K2JA 4DU7A 2PDAA 3CCES 5J2MA 2HHHJ 4IOAQ 1RT5A 2DHXA 5A8WB 2IMWP 3H5SA 1HFEL 4WK1A 2XEXA 4CLUA 2C2OB 4OZJA 4U6PA 2BW7A 1RT1B 2ZC3A 3D68A 2E29A 4RL1A 1TKXA 3EWGA 4LF5F 1DBDA 2BE7D 3PW4A 1VIOA 1O8BA 2HURA 3VVUA 2ZZMA 3UN5A 5E3CA 1X0FA 2X1GA 4Y2AA 4ZVEA 4U95A 5HQ8A 1S7IA 4LSNA 3SV4A 3RB6A 3DDKA 1UVNA 2B7CB 5KFBA 3NGKA 3D1HA 2CIMA 1S6QA 1HBOB 3IA0A 1HYSB 3TZZA 4JI5F 1Q82T 4PG5A 4F02A 3JXOA 3CMAS 5KG7A 2H5IB 1FD8A 3OR2A 2QL7B 3BN7A 3HT0A 2DPJA 4NL5A 2GFFA 4OV1A 1HWJA 1VQOS 2LCWA 3VF0B 3DRPA 3FRZA 4DV3J 2GJIA 3OXLA 3EICA 1HR0J 3I5BA 1HNWJ 4KGVB 3H8YA 3OD2A 3RBXA 1UW4A 2LLZA 3ELHA 2XY5A 4EUVA 3B4DA 2Q66A 3GFZA 1GXLA 2IIHA 1HNIA 2AMCB 5L9XA 3CJ0A 3UI3A 2F40A 4OZ1A 4ZIWA 1S6UA 3I9ZA 2M3DA 2ILYA 4OZ2A 3V81B 1S1XB 1VLYA 1PBAA 2AKWB 4USMA 4UZBA 3EX7B 3G8QA 2ZH7A 4K0KJ 2VFVA 2PI4A 2JX2A 4A47A 3IAS9 7FD1A 3FEZA 4J9QA 1XERA 4GC7A 1Y11A 2KKHA 2F5GA 4QIEA 5KFAA 2UUCJ 1V3SA 4OHXA 5AE3A 2W9CB 1N34F 3NCRA 4DQIA 2W9BA 3D28A 5B0AA 3F56A 2F8EX 3BF4A 3HHDA 2KVIA 3M32A 1NB7A 4KV8A 5DRKA 2VC0A 1S72S 1ICEB 4RW7B 1LWCB 1YJTA 1GNKA 2YKMA 4NMLA 1FE4A 4D3GA 3G8SA 1XNQJ 4Y2CA 3OTEA 3MM8A 2CPIA 3CJTA 5T7LB 1RKJA 2J0WA 4Y28C 1WC5A 3ONQA 2WONB 4ZCKA 1WEYA 4IG3B 5E0OA 1NH7A 5BXIA 3LGNA 1VK3A 1M90T 2AWZA 3PACA 4DX6A 1T9VA 3M8YA 2HFVA 2RJZA 4EO8A 1RCXB 5J2QB 2XHCA 1YK9A 4KRWA 1CC8A 1IKWB 1TL7A 4HHHA 3QT7A 3IN5A 4U8VA 5LJ3Y 3FEXB 1TTHB 4HT7A 1JLFA 1SJ3P 2J0QD 4NCBA 3EXYA 1RTIB 2OKQA 3LW5C 3OTCA 1W26A 4DV1J 2AJQA 3HD2A 2RQKA 4Q7AA 2KM8B 1FWKA 5H9FJ 2MQPA 2H4YB 4JB8B 5DDPC 4ZVRB 1JJHA 1UWAA 2QFIA 4YHHJ 4YB6A 1CJKB 1RBAA 1WDTA 3BB5A 1P8GA 4YQWA 1KOOA 3AQPA 1WDDA 3DOLB 3NP5A 3JB9k 3MXHP 3FMWA 5HJYA 2J5AA 2M52A 2QLFB 1CJUB 2HS3A 2ZZNA 1TFYA 3DYAA 1NDCA 3F0NA 4YS2A 1YJWS 4K4TA 3AJ1A 2E7WA 3C14A 1DQ8A 1R0CB 2CVEA 3QMQA 2ADBA 1NSPA 4PWWA 3VAGA 4KO0B 1HNXJ 2CYYA 2IVMA 4B9VA 2HBZB 2XO7A 3W2VB 1WF1A 3A8EA 3OQ2A 1RXOB 1QSSA 1IWAA 4O3NA 4DL0C 4UQGA 1ULRA 2DGQA 2JFDA 3D1QA 5IWAF 5I42A 3D6TB 2ATLA 2GHWA 3D66A 4ES2A 1RADB 2FHKA 4EK2A 2VODA 1JJ4A 2OFGX 2QIFA 4ZCIA 2Z2YB 4G1QB 1RT4B 5D0RA 2HQIA 1M5VC 2V0NA 2GQQA 1RE1B 4B3TF 1RT7A 2MPUA 4RWXA 2CQ0A 3VGSA 4ZVQB 3BQ0A 5KFGA 2GCFA 1IKYA 1ZBTA 1CJVB 4F4ZA 4LRFA 2W01A 3PO5A 2DXDA 3RRHA 2R8KA 4M5NA 2BKPA 3GJQB 4X4QA 3BGFA 2KTQA 4IRDA 4DF8A 1YSJA 4KHPJ 2RD5C 1K0VA 3CDAA 5KG2A 3N0VA 2D41A 3QGGA 1BQNB 2XGPA 1RWXB 3DXBA 4ED6A 1KD1T 1U6ZA 2Z30B 3CCMS 3TUZC 1XR5A 1HD0A 4AD6A 4LJMA 5GAEI 3JAMU 2P6TA 5DLFA 5KFXA 4K4UA 3P45B 1IBMF 3D0GE 3IGNA 4Y6IA 5LSLA 4USHA 2R3VA 5J2QA 2G1DA 1YJNS 1G6BA 2FVCA 4FPIA 1R8CA 1Q7LB 1NZ8A 1Q16B 1G3OA 1UZDA 4JI1F 4B02A 1P27B 4A4JA 1T7PA 2F65A 3ENQA 3M1VA 4W98A 1Q4RA 1MNEA 4Z7CA 3CIZA 2VG7A 4AUKA 4OYBA 2CQ2A 1M0SA 4OYIA 5CHCB 4C2MA 3SZ2A 2KJVA 2DHSA 2ZUAA 4ITSA 3TJ9A 4IH6A 2RU3A 1ELOA 3PRBA 2JDJA 2JFKA 3GIRA 4JI4J 2GO8A 4RW8A 2FY8A 3RTVA 4U8YA 5H9FK 2MEWA 4YDXA 3SCJE 1VQ9S 3HULA 1KN6A 4WYWA 1S10A 4KJIA 2L48A 3CW2C 3PJXA 3T9ZA 4B3OB 1TU0B 1QSLA 2RUSA 3MM7B 2V50A 3NWGA 4H4MA 5IOLA 2DRDA 2VUGA 2PD1A 3P3DA 1PC4A 5FDLA 1HNVA 3U1MA 5HMWA 2MQQA 4PXEA 1L3TA 2F4VJ 2KL8A 1YZ6A 5CYQA 3CXCR 5JVHQ 4DV2F 2BE2B 4WP8A 1NJXA 1U24A 3KG1A 4IDKB 2XMVA 2KXHA 3GTYX 5KFRA 5IS2A 3KJVB 3LA0A 4C0BA 1XBWA 1CEZA 1CG2A 1RHUB 1AT1B 4OX8A 3DRRB 2VDIA 3HKWA 1IKXB 4L74A 1RYSA 2XSFA 1IQTA 4G1QA 2AP6A 2OSQA 2YPYA 3KMSA 4DCJB 4GKKF 2YX4A 1S6PA 3FQLA 2O3DA 3MPVA 2PO4A 4F04B 4F3OA 1QE1A 3C14B 4KGZB 1BWVA 3DRPB 2CZ9A 2DD8S 1IKVA 2BANB 1H98A 2BJ1A 2MZQA 3NCPA 5CD4H 4N56A 2O01C 2FJAB 2CJQA 4S0MA 5H1SV 4CM0A 3CJ3A 4NA3A 3HT3A 1H7XA 2DIVA 3DLKA 1TUGB 3DU6A 1N5SA 3OV7A 4GKJF 4ATNA 2IRXA 4DR1F 3FBBA 1EETB 4MYTA 4PKDB 3J7ZT 3QRRA 3FJ2A 2DNPA 2F1FA 1DURA 2AT1B 5EHHA 1D3WA 2DGSA 1N8RT 2DEIA 2XYGB 4XIUA 3UDVA 1YITS 4H4OB 2KHDA 2G2YA 4LMZA 4YY3J 2AHOB 4HHUA 4UY85 3EVWA 3KUGA 1MU2A 1HNZJ 4DV6F 3CB4A 1YBTA 2G0IA 3GJTB 1X4GA 5LMUF 4ECSA 1IM4A 3M1VB 2JWNA 4MMOA 1SC3B 1XNRF 4OIXA 2ZBIA 1T02A 3GSIA 3AOAA 4WFAQ 1RISA 2ZH4A 5F0UA 2C2DA 3MEDA 2GHVC 2HK2A 2BQ3A 3HLUA 4OHYA 3VV2B 4EI2A 3BR8A 4NXMJ 2WZ1A 2WB1D 4CLKA 1U45A 4ZHRB 2ZM6J 2KT3A 2IM3A 4ZP6A 3KNAA 3CIMA 3OSNA 3T1YJ 1RAIB 1OY8A 3M8ZA 2IBOA 2EG2A 2DGTA 4Q8FA 3UR3C 5B0CA 2SXLA 4JI7J 5HP1B 2PSZA 4TN2A 3EMTA 1HBMA 3T1YF 1U2RA 1S1VB 1Q5YA 4LBIA 4RW4A 3A1YG 4CTAA 3J80Y 3VAMA 2B9WA 1T9TA 4Q8EA 5KG1A 1YRXA 2YVSA 2HZCA 4OFZA 3ZNUA 3RZAA 3KHLA 5GMDA 2BE2A 2E66A 3V6DB 1N4LA 2FPHX 2FIUA 1F5AA 3BM7A 1VQ6S 1IBCB 1RAHB 5ETSA 1I94F 4JI6J 4FKYA 2KHCA 2VJUA 1YTYA 4WP9A 2J8AA 3CCWA 3R5JB 4IR9A 3IWLA 4TKTA 4ES1A 4RW9B 1KLMB 3PYEA 2RU9A 4X4TA 2UVWA 3JSBA 3BN4A 2V67A 4EMDA 1S1TA 4CZCA 5F8JA 4K4XA 3KLVA 4CLPA 3VAFA 2M70A 3MCMA 1HMVA 1MN9A 4F7VA 1IM6A 3H2VE 4FS2A 1AZSB 1TL3B 1X8DA 1UEKA 2GHPA 2OLWA 4BWMA 3W2VA 4PQUB 1LWEA 2BACA 4M5DB 5EN1A 3CCRS 1KP6A 3AODA 1YZ7A 4DFJA 3MZIA 2X3GA 3SDEA 3FKBA 3PM9A 5HSPA 3FFIA 3EZOA 2KXNB 3OVSA 2FUG9 2XWXA 1R27B 5J1NA 4C7QA 1LFPA 3IM8A 1RWNB 4BHQA 3EE3A 1JXVA 1S0NA 3SSSA 4DUYF 3H2UB 3C19A 3Q8VA 4DQSA 1KKHA 3TAQA 4FBTA 2W2QP 2YNGB 4KH1B 4C8MA 3GMGA 3BPDA 1PYTA 4OI4A 2O67A 4O3OA 4AYBD 1ZA1B 2IA6A 2YQ1A 3RAMA 4DL7A 2GIQA 4UTGA 5KFYA 1RBOB 5DLGA 1HNXF 4M8LA 1LK7A 4PYAA 5THWA 4LF4J 1FTRA 2MQLA 2DISA 4M5LA 3EDRB 5HJXA 4M5KA 1DHMA 4KV8B 1FI4A 1DTTA 2RDDA 3GR0A 2DHGA 3PCOB 3UW1A 4A48A 4A8WA 1HPZA 2APOA 4DZ6A 4Y3CA 5DQGA 4A8OA 2Y1RI 4EBEA 3MOZA 2AYBA 4WZMA 1EZZB 5B0FA 2WSCC 3FBCA 3HJFA 2R4FA 3GYNA 2V8PA 2FGCA 3T41A 3THPA 2MGZA 4G3IA 3N79A 3OXFA 5FD1A 4X65F 1JLEA 1SJQA 3OSPA 1X5OA 3QLHA 2VA2A 2C2ZB 1UEVA 2LVWA 1AW0A 4GO5X 4KIAA 1YRUA 3QO9A 4WXOA 3BS9A 2BJEA 2WCXA 3PRDA 4DL6A 4OYPA 1T03A 5C25A 3DLEB 3PR4A 4Y65A 1FERA 2DNNA 4BS2A 3N28A 1U6BA 4CRJA 1VQ5S 2CUYA 3R5DA 1OS5A 2ABYA 1DTQB 3KHGA 1M5KC 1PJ6A 2YWEA 2CG8A 1HARA 3GPAA 4P74A 2CNLB 3E51A 2DRBA 1EHWA 3MR7A 3GCXP 1WHYA 2ZDOA 3JS9A 4FVMA 1Q7YT 2J6UA 3D6MB 3TUPA 1BHNA 2RSQA 3HI9A 4IOCQ 2K7JA 4C8KA 4JI2F 4BC9A 3HX9A 1YG0A 5A0YB 1FESA 2XYPB 1S1TB 4URGA 3LP1A 3MI7X 3JYTB 4DR7F 4ID8A 1ZZNA 1VHFA 5FDLB 3R5AA 2Q6BA 3VCDA 3KLEA 3GU0A 1CS4A 3P5TL 4JOUA 1FCAA 1TK8A 5LMUJ 3JTNA 3QSYB 1N33F 1RB0A 2PA8D 3QJLA 3N01A 1FKPA 4K7QA 1H72C 1LW2A 4TY8B 3EYZA 3Q0AA 2BEFA 2E1MC 2YKNB 2DNMA 1NK5A 2NR0A 3ILIA 1RJJA 1VLOA 3GZ7A 1RZMA 5E3QA 5I42B 1TAQA 1WG4A 2AIRB 3DDNA 4LF4F 4LF1A 4C9DA 2X51A 4PABA 1QLNA 3LPYA 3M2VA 3DFEA 2XMJA 8ATCB 5KFWA 3EZ5A 1KHWA 4OI3A 1QUPA 2XS7A 2B4VA 1R43A 1TKTA 5U47A 1TV6B 4DUYJ 1SJ1A 2UV8G 5AJ3F 1SH0A 1VCTA 1VQYA 3M32B 2HAIA 3K5MA 2DCLA 2Q43A 2KYXA 2FJEB 1C4CA 3KJQB 2FHJA 2DEJA 1RWMB 3AB2B 4ZJLA 1SKUB 5BR8F 2FVPA 2IBKA 5DG7A 1Y5LB 3E8OA 1HW8A 4YN3B 3MM6A 4TQSA 3C66A 3JSRA 1NPRA 3MPUB 4OX9F 4LT6A 4DX7A 1S1XA 4U7CA 3GB0A 3D0HE 4DX5A 4NYOA 5E3RA 4X62F 1U1MA 2Y9HA 1S1UA 4RKUC 1JKHB 2JZ5A 3LP0A 2KN4A 3NS5A 1DLOA 3G2XA 3M8SA 4AL5A 4ICLA 4O0NA 4LFBJ 1NHKL 3G9CA 2AX1A 3G86A 4ALZA 4DG1B 4LF5J 3BGRA 1A7GE 2DNKA 2H54B 2GA7A 3B54A 2OPSA 1WD6A 3M2UA 1JNZB 3V5RA 3EDQB 5IT4A 3JSMA 2GAHC 1U4BA 1TL4A 1FFWB 3KLFA 1NNDA 2BOPA 3NS6A 3DLGA 2IAJA 2F8MA 4KB7A 1SIWB 2HAFA 3UCZP 2ALYB 4EWTA 3HXMA 4FF4A 1OYDA 4PWDB 2XLIA 4B9TA 1CJUA 1RTDB 3T5KA 2CJBA 2AQ4A 1LXJA 1R0AB 2C3OA 2V4JB 2IDEA 2ZH3A 3A8IA 4L76A 1AB8A 5IT9Y 4WTYA 2D74B 2LP4A 4DPTA 3HK2A 1PAEX 2VOOA 2XS5A 4UY8T 3AXMA 3W1YC 3W3SA 3MEKA 3PEHA 4RNMA 1TR0A 2AF6A 2OPRA 2Z8QA 1M1GA 4FYXB 4P9SA 4NYZA 3BR9A 1VR6A 4WJBA 2I38A 4ZDNA 4DV7F 1VQPS 1X60A 2MDAA 2OMOA 2NXJA 2EFQA 1G4CA 2L9NA 4XPCA 4BCAA 2FLPA 3DOLA 5C2CA 4NLVA 2CQPA 1B7YB 3MDFA 4GRSA 3HHNB 3N6LA 3FSYA 1FJ7A 1X0PA 3NAIA 4YUDA 5DM6Q 5HMYA 4DFPA 3R8YA 3G96A 3H90A 5D4LA 4DV6J 2VG5B 1YRTA 3L95X 4ECUA 5KFCA 4HI1A 2WVBA 4MK7A 4JYAJ 2K3IA 4Y34A 4ZMMA 5FJ4A 3QZ8A 4KKOA 1HMVB 1TUVA 4NRUA 2EVZA 2OELA 3OUYA 3KLHB 1TL1A 3NWRA 2ZH9A 1FRMA 1R3NA 2UZAA 4JI2J 2B3TB 3NKYA 1M5HA 4EU0A 1VFJA 1ZTWA 4QWEA 4QR2A 2W8LA 4WYLA 5DJBA 2ACMA 2XMMA 3LANA 3SCKE 1R8HA 2C2EA 2VFSA 3ENWA 4UOGA 4C3LA 2RF2B 1LWFA 3BYRA 2FVRA 3VTIA 2ZUGA 4QIFA 3RRGA 3N9UC 5B08A 2FC9A 4YP3A 5JVGQ 2MKYA 1VQMS 2CKWA 4C97A 3GV5B 4RW6A 3SFGA 1EKRA 1U2FA 1N6QB 5A2QU 5A8KA 4EZ6A 4B9UA 4K8RA 2AYMA 2MZSA 2MYFA 2ZD1B 4C8NA 1JQGA 4WU2A 3HHEA 2E5JA 1TV6A 2CVIA 3ADAC 3IWXA 4QU7A 2VOPA 1L3KA 4Y2KA 1TK5A 3R7SB 5F3ZA 4CNYA 5KFTA 2ZOFA 5K5MA 1V3ZA 3ILLA 1GT8A 2YKQA 2HKEA 3I4HX 4F0HA 3X3UA 1T3NA 4KH0B 3AOCA 3MCSA 2UUAJ 1PCAA 1M5OC 1TVRB 1L3UA 5KFOA 2HNDA 2DTJA 5KFFA 3HSZA 2R7TA 1VRTB 1F9HA 5HLFA 2DB1A 3A3PB 2W7AA 3ZZOA 1PO6A 3ISZA 3KYLA 3P6YC 1RT5B 1N5YA 1WOOA 2WVCA 5KFSA 5B0GA 1TKZB 1H38A 2DKOB 4LRAA 2PI5A 3EZUA 1HI8A 4CT8A 4XAKA 4DG1A 5C25B 4O44B 3KLIA 1SXLA 1ZM9A 3GG0A 2JHEA 1J2VA 4U9RA 5HQMA 2N3OA 2UUBJ 1Y3KA 3RW7A 3IMQJ 3TA1A 4J9LA 1FE0A 3CMQA 3IXQA 3S1TA 4EGLA 2ZOGA 1UJ6A 4NLUA 2ROEA 1S6QB 2E44A 4CH0S 1HA1A 5KFMA 3W2WB 2JLFA 4CIOA 2IPOB 2I5JB 3DGPA 1HBUA 2RDIA 4QJVA 4CLTA 2VU5A 2CQDA 4YB7A 1PG5B 3DOKA 3G87A 3TX8A 2B4PA 2BABA 4CQ1A 3UD3P 5F41A 2W4PA 1N32J 2GIRA 2MKHA 3I4PA 2DGUA 4CCHA 4FXDA 2J9DA 2FD2A 2V6AA 3QZ7A 4ANEA 1D09B 1S9EB 4KGXB 4MAKA 4Q45A 3CULA 3EGNA 1AA1B 1RSCA 3CSKA 2IC3A 3O3LA 2C2RA 4C8OA 4L3NA 4WXWA 4LR7A 3BQ1A 3NRBA 2XC9A 4NWBA 3Q22A 2YPZA 4FS1A 3KDNA 4DCPB 1PGZA 3MEEB 2V4QA 4EYHB 2CQIA 4J37A 3WIUA 4ED4A 1FNOA 3LQVA 3I96A 2W1BA 5BYSA 2BDPA 1LEOA 2RHSB 4IFVA 3OFEA 1KHVA 2WHOA 4M1KA 2QLBB 5CCLA 3FZ2A 4LF9J 2CPHA 2QRRA 3OR2B 5A8KB 3BDPA 2D9OA 4I6WA 4ECXA 2YKOA 4IH5A 3I0RB 2FZKB 2GQCA 3BGUA 1UA1A 1YDLA 4B3MJ 1CPZA 1WKKA 2YWWA 2DGVA 1X9WA 4FF1A 1Z4UA 2RVJA 2E1CA 2AW0A 4DV3F 3IGVA 5KFIA 1LFWA 1EP4A 1DARA 2DHHA 1NUEA 3U1LA 1IBLF 1KS2A 4RW7A 3EVOA 5GMEA 5KG6A 7FDRA 1K8AT 3PY8A 5ETVA 3OJSA 3WBZA 1M5PC 3N6MA 1FFSB 5L1LA 1RUSA 4KT0C 5A6PA 4R5PA 4JI0F 2CQGA 2Z2ZA 4P75A 2AX0A 3QGPA 3J7YI 2HSEB 4MK8A 1S1UB 1NPKA 1MROB 3RGIA 2VPZB 4YFUA 1FJGF 1MSWD 3DNCA 4C3KA 4TLRA 3UD5A 3TAMA 4PG7A 4FF3A 2CQHA 4NZ7A 3PW2A 1YIJS 4LFBF 2XB2D 3M8RA 3RJMB 2VICA 1U8SA 4QR0A 2MB0B 3DU5A 4HYKA 4KHMA 2YWGA 3I31A 3I87A 3J7AN 1VJQA 4NPOA 4A46A 3MF5A 5CZVA 3ISND 4DV4F 4ED3A 4O4RA 2DPIA 2EFNA 1U1LA 4OX9J 4OHVA 1WF0A 2BVZA 3RR8A 2VIHA 4DQPA 3MM9A 1QY7A 5HANA 4C0OC 1S9GB 1RHKB 2V9KA 5IZHA 3EPGA 2QFJA 2IVYA 1UVLA 2HHSA 3BH6B 3J81Y 4F26A 2V2QA 4ETZA 4GKJJ 2H1YA 3ZZTA 3VGUA 2G2ZA 4XPEA 2CJKA 1KVJA 4DF4A 4I7FA 1FKOA 5IC6B 3FBFA 2LXFA 3PX0A 2GMJA 3RUBL 1T9WA 4RW4B 2WOMB 5KFHA 4OJHA 5FLXY 1DAXA 3G4SS 2W25A 1RI7A 1FJCA 1WHWA 1BMQB 1T9UA 2VG6B 3TOQA 5JJBA 4LRBA 4P7VA 4RZRA 2NZCA 4U67Q 4J9PA 4LSNB 3BO3A 1OWXA 1FFGB 2B6AA 2GX8A 4ZPAA 4DPOA 2XSJA 4NLPA 4DN9A 4C11A 4E8UA 4C8YA 4C8ZA 4F67A 1MW7A 4KFBB 2X3DA 2DIUA 3GIKA 3OLAA 5M2RA 3B78A 3NNCA 3W66A 2CA9A 5I3UA 1T9XA 3A13A 1HBUB 4LR8A 2IFXA 2K7KA 3NGTA 4OL8A 1KQGB 2OPPA 3W7BA 4KC5A 4J9MA 1KVIA 3KJNB 4WU3A 1APSA 2BXJA 1SVDA 2FYXA 1F2GA 2IJNA 4DX8H 1GX5A 2A2DA 5F9LA 3BO2A 3NL0A 2M0GB 3MR3A 3L4BC 3H2LA 4AQYJ 1UL3A 1O5JA 1S0MA 2BQRA 1HNIB 2FC8A 2BZ2A 1UWBA 2VKRA 2C3YA 4X4PA 4DL4A 4WE1A 3E3XA 1NO8A 2RNEA 3CCTA 3P8BB 3D4JA 4LIRA 4JI8J 5JXSA 2F8HA 4JI7F 1JLEB 2J8SA 3ILJA 4ZOSA 2UXCJ 3O6QA 3HSGA 1F60B 3MM5B 5C2GA 4NA2A 3S8SA 4DR4F 2V8VA 4KSEB 3I0RA 4OZLA 1IR0A 2ZM6F 3IWNC 4LF6J 5HVGA 1RACB 2YX1A 4C8LA 3WC2A 2RHQB 4NMXA 4NXMF 1URNA 2CPFA 3MFHA 3IRWP 1PYSB 1PIEA 4ZA1A 1RAOA 2KZMA 3CPWR 2XZDB 3T1HF 2GVZB 3W9IA 3FBEA 4GC6A 2K06A 2OD4A 4OX6A 4X4UA 3CJSA 3H5YA 4UZCA 4DR2J 1BQNA 5F3TA 3PW0A 2WONA 2MMYA 2DH9A 5EX3A 4PUOA 2FJVA 5HLFB 5LMNF 1P6TA 3KHHA 4KHPF 3N5BA 4NI2B 4DQQA 3BYPA 5A0YA 3OTOJ 1SUQB 3NGRA 4LSLA 3JYTA 4YDDB 2V8DA 3LAKA 1VYAA 3QLHB 3NY0A 3CO0P 3SXLA 5L1KA 5DGAA 1AUSL 2XMWA 3CC2S 1YHQS 1N36J 2ATCB 4O3SA 1HNVB 3CJKA 3R7NB 1FRXA 4LUBA 2QLXA 3C6TA 4OZ0A 2EBEA 1N5VA 4AT1B 1VBKA 4USTA 1AXQA 3HFVA 2DXFA 3T6BA 1W25A 3MMBB 3WC0A 3KJVA 4KE5A 4DMZA 2R7QA 2AU0A 4U96A 4C11B 4IRCA 3C15B 5KOWA 3SEOA 5EWGA 5IC4B 5I3PA 5IWAJ 1WACA 4E0DA 2EFOA 3IBWA 3TA0A 3T1AA 3ENVA 4EEYA 4WF9Q 2ZJRQ 4DPWA 2KT2A 2D69A 1YX2A 4O3QA 3MR2A 4GKKJ 1GMWA 2NZ4A 1OY9A 4B3OA 3SSQA 1HIYA 1YJ7A 1WOSA 2J9CA 3CWJA 5L38A 1UZHA 1PC5A 1HBNB 2HS0A 1TL1B 1XIQA 4RX6A 4TXSA 3C6UB 1IBKJ 3DLHA 1S48A 1DQAA 3VR1A 4MIAA 1BGXT 2QL5B 1S99A 3GJSB 4PWUA 1VBYA 2B6AB 2PFDA 3D67A 2OFHX 4QYZK 4G6VB 2PE8A 2BR0A 3B8HA 5F8GA 4DR7J 3O1LA 5LM7E 3M2VB 3HZEA 2MKJA 4USWA 3Q83A 1MU2B 4RNNA 4V1Ak 4ZLNA 1CJVA 3MGJA 1QAXA 2QSFA 1B0VA 3Q24A 1I1GA 1ZAWA 4IKAA 4KKOB 5K8OA 3UN3A 4IFYA 4DI6A 3KKFA 3DLBA 4ZVHA 3KLFB 2XMUA 3FGVA 4ILRA 3CCVS 2HNYB 1ZPWX 2GVZA 2IJRA 5KT4A 3VAJA 1SH3A 4NZ0A 4FVCA 3UDLA 4WKRA 2RB7A 5KFUA 3LH2S 2E1PA 3CUNA 2VKZG 2OTJS 4OJ1A 2HNDB 5K14B 1UTAA 5C24B 1NEEA 3J80U 3G6YA 1XNQF 4BDPA 5HQLA 1WC1A 1IBMJ 4L3KA 2QMUB 1RT3B 1ZAVA 4WKYA 3MMAA 2HQDA 1EIYB 4X84A 1XMOF 3MPYA 1ACMB 4WP3A 2RIJA 3GLJA 3V4MA 4HL9A 5L9NA 2B5JB 1HQUA 2ZJPQ 1C1BA 4FF2A 3Q2TC 5CAAA 2GIFA 2OPSB 2XZWA 3CCUS 4YOEA 2MTLA 3W5XA 3JSMB 2DNOA 1VISA 4RPFA 4RUCA 1TK0A 4LVNP 3RW6A 3E2EA 2VBXA 1VQLS 2KZZA 2X1AA 4QPXA 4A8SA 2KO1A 3DRSB 2B43A 2LDIA 4ED8A 2WRMA 3M9MB 1TVRA 1HYSA 3MPDA 4F3MA 4DR6F 4P52A 1UFKA 2BM0A 2KDOA 2QV6A 3I0SB 3M6WA 2ALZA 3CDEA 2BOAA 4MJKA 4ZPBA 5E3PA 4JV1A 4J9OA 1Q81T 1FJGJ 4GVBA 2HBYB 3GSDA 2BJ8A 3ICLA 2HS4A 2RILA 2MQOA 5D15A 1JLGB 4LFAF 3QT6A 2AJ1A 4PYDA 2G1HA 2HLUA 2GJFA 2QJ3A 3OUYB 1KR4A 4RO0A 2FVQA 1HBNA 3OR1B 1EQMA 5E3AA 1BD6A 2XWYA 5M2PA 2VB6A 2N82B 4I2PA 1C0UA 4JI5J 3DC2A 1XR6A 3MEEA 2FLOA 2RF2A 3QFWA 3HM9A 3FQKA 2CJ9A 3H4DA 2HGMA 2MZRA 2KG0A 2V4RA 1HWUA 1B3TA 4A8FA 1SQFA 3OPKA 3BBBA 3K58A 5DGBA 3CJQA 3G6XA 1SJFA 2V63A 4U7UD 2R7VA 3H7HB 3I5CA 1OQ6A 1P9QC 1IKVB 3DOKB 5DG8A 3DHXA 1GEHA 1WJ9A 3NNHA 4HT5A 2ZFHA 1VQ7S 1B4SA 5KFVA 1P9YA 5LT5A 3MECA 2DY1A 5D3GB 4JI6F 2PIIA 1I94J 4M5DA 1V6HA 3OT9A 2R7SA 4ZP7A 3OXGA 3KLGB 1MMNA 5IFMA 3MM8B 5T7LA 3PKYA 2R8HA 3KK1A 3TANA 2DVIA 4HVZA 4IOBA 1MWYA 1U25A 4NYPA 1KQKA 1HL6A 2XI3A 1U02A 3ZXWA 1REGX 1K1QA 4NLTA 4ZPWR 4RU2A 4LF7J 2YTCA 4H4OA 1J5EJ 3A4TA 4TU7A 4F4YA 1DZ5A 4LF6F 1N32F 3MD3A 4UT4A 1RHMB 3C3LA 2JEIA 3GIMA 4H54A 2JLGA 3UPFA 2L9WA 1N5YB 1N88A 4F36A 4J7CA 1LNQA 1IXKA 3KG4A 1I6JA 1V9OA 4ZIVA 2KRBA 4P2XA 5D4PA 3TEHB 1NK6A 1FEEA 4LFAJ 4Q0BB 1YI2S 2VONA 2J6TA 4I67A 1VRQC 2XGQA 1N0VC 4Y2MA 3M8WA 3FK4A 3QPIA 4DU8A 1X5PA 2OO4A 3AXKA 1KQFB 2AD9A 4NLDA 1S7HA 1H6KX 1SL2A 1X7VA 2BBEA 3MAQA 5D4OA 2HPUA 2MKCA 3HHLB 1HNZF 2MGZB 1UW9A 1T95A 1BE4A 4KPCA 1X4AA 1RAGB 3M7VA 4PCQA 2BJ7A 2MHNA 4H4KA 2IRYA 2LEBA 4CNZA 1CQNA 3ISNC 4I7FB 2GMHA 5DQHA 2YBVA 4RBVA 1R31A 3MR5A 2ZDPA 4IO9Q 4RBTA 2CJXB 1T11A 3QO9B 3UN2A 1X4DA 3V6DA 2OEKA 2KJWA 4N5SA 2XG8A 1UETA 3ITHB 3GFHA 3MMCA 1VQSA 4OMFG 3IAM9 4IRKA 1IJEB 3ZC4A 4RUHA 3F44A 5GADI 1DTQA 1HNWF 3KOAA 4HTIA 3ET6A 3MEGA 2FZGB 1HR0F 2I0XA 5KFNA 3IP0A 1J27A 5CD4A 3R97A 2ZHBA 1S1WA 2HVEA 1HWKA 2MLYA 2OSRA 3DCAA 3E01B 4N41A 1WKJA 5EDWA 4DS5A 2FQQB 4KPYA 4OI0A 4CLWA 1QAYA 3C8YA 5HK4A 3RBZA 1VRUA 1IBLJ 4ETXA 1CS4B 3BO4A 4NOHA 1AZSA 1TL3A 2PN6A 2VG6A 1MG7A 2ZJQQ 4WZQA 5GAHI 5KFLA 5AE1A 1O6XA 1FT8A 4FNHA 4K5SA 2ASDA 4PPZA 4QU6A 1I51B 2DYAA 1T05A 5A8RA 3OFHA 1DY3A 9ATCB 2CPJA 1CBKA 4OYWA 4P6QA 2AEMA 3CMES 3B4MA 5C42A 3TZXA 4JYAF 1MROA 4QWAA 1R7IA 1YBAA 4O23A 1D0EA 4CH1A 2HQ3A 2PMZD 2E5LJ 3TI0A 3VZIA 1KONA 4NLYA 3MD1A 2CPZA 5A76A 1YJVA 2PMHA 2DGXA 4IH7A 4X4SA 1ITPA 3FCWA 3D6HB 3TA2A 3HMJG 2F63A 4Q0BA 3HKZD 2M4MA 4C48A 4Z2XA 4RUAA 1KFSA 3JQJA 5A8WA 4QOTA 4DV7J 3KLGA 3GQCA 1OY6A 2ASLA 4MFBA 1Q8BA 2OTLS 4R0JA 3J81U 2XO6A 1CJTB 1U0HA 1FD2A 2B4OA 4RLEA 3F73A 2CWKA 3RBEA 2W8KA 2OJ3A 1VS3A 3NNAA 3FUYA 1RT3A 2AGOA 2IY5B 2E9RX 1D9FA 2FJDB 1X4CA 2CZVC 2E7XA 3RG6A 4CWBA 4LF7F 2C2KB 1RT1A 2RE1A 1C1BB 1WSRA 1NU4A 5DO2A 5C7PA 1N34J 5CYQB 1JX4A 4WFBQ 1S57A 2V8HA 2C42A 2ZKUA 1IUJA 3NGDA 1OMSA 2RRAA 1UVIA 2Z56B 3R27A 4OYXA 1JXLA 2JEFA 3R6GB 1K0TA 3TJ8A 2P6SA 3GG1A 3SMZA 4J9SA 3KDOA 4LRCA 2ZBRA 1NKBA 2M9KA 2LFVA 4GMKA 1MMLA 4I2QA 3BQ2A 1DRZA 1QVFR 4YEAA 4QBUA 3QFHA 1EB0A 3AJ2A 1S1WB 2POKA 3BBCA 1S6PB 1JXEA 2QA1A 2RQMA 5CYMA 4OJGA 5A2QY 2RDJA 1SL0A 4IR1A 2Q6CA 4JV0A 3TUIC 3T1HJ 1Q86T 1WI6A 3KK3A 3C46A 2GZOA 3KG0A 4OI2A 2IDLA 5G0RB 5F8HA 2RAQA 4CI0B 3TYTA 1B70B 4FXWA 2W2NP 2E7VA 2G2OA 1JMTA 1FRIA 2GMLA 4UOCA 1KOHA 2EC2A 4ZCLA 5GAGI 2JLEA 4DR4J 1FO1A 3FFIB 2K8GA 4FYWB 2JH3A 5J1EA 2Z0GA 3NGSA 1YJRA 2HHPA 3K2YA 2JC1A 2QN6B 5ETNA 2PGCA 1RLCL 3AA8A 3NLCA 3ZTOA 5GAGU 5C42B 5M2UA 2ZKTA 4X4VA 3BBFA 2FB0A 2QTWA 2BKOA 4ZVFA 4CP5A 1FJEB 4LFCF 3EGZA 2ZD1A 1XMQJ 3LALA 3LP2A 3N6NA 2NXCA 2DH7A 2VHGA 1YBUA 2BANA 2IYGA 4WFNQ 4XDCA 2FY1A 5HL7Q 2WAQD 1H74A 1NBEB 2MKSA 4ECVA 1D8YA 3VGVA 2B9EA 1N5TA 2MY7A 2DGOA 2W4DA 2G0JA 3CTRA 3PVXA 3UWTA 2BJ3A 3PFEA 4ANDA 1SC1B 3QWUA 3B6BA 2UXCF 4NASA 2EI5A 3A8KA 4QQBA 3R9LA 5IXUA 4RU9A 1N33J 2WK4A 4F3QA 1KSPA 5LSRA 5A8RB 2EKYA 3HHLD 1CQMA 4HH0A 1XMOJ 1FXLA 2G0CA 2I6WA 2MZTA 3UCUP 3RBDA 2R8GA 3W62A 9RUBA 4RW6B 2X1FA 4ZS6A 4DR3F 2OPQB 1YWXA 3L7UA 2H51B 2DGWA 2FTRA 3NCQA 1NMEB 2W7OA 2RKIB 1TP7A 2NLWA 4DSLA 1HQEA 1GTEA 1Q8KA 1RHQB 2CADA 3DKDA 3GR1A 3VAKA 1EARA 1DFDA 3R2CJ 1E6VA 1Y4ZB 3T5LA 3W5ZA 1FDAA 2ASJA 1WG1A 2XM3A 2YQ3A 2FJXA 3TR5A 3UVJA 2BV3A 1SV5B 3SQGA 3QQCD 4OYAA 2VL1A 3LPEA 4DLGA 4MT1A 1NSAA 2HEKA 2ZC4A 1WF2A 4HHJA 2VBZA 5AXLA 1HHTP 2F9JA 1KTVA 3EJMA 4B3SF 5HVFA 2HIQA 4UF4A 3CCZA 2CXEA 5MAOA 1F1BB 3BGOP 2ZBPA 3GONA 3M2RB 4YR2A 4R25A 5J2MB 4DJBA 3PIOQ 1B0PA 1ZTTA 2C22A 3Q8SB 2QT7A 1V5IB 3VWSA 3KK3B 3TNVA 1F6TA 3M6VA 3KHRA 2AZ1A 2A10A 4ECTA 3QNWB 1RWKB 3NGUA 2LEAA 4AXIA 4ZPDA 1GK8A 1R0BG 5IV3A 1FX4A 1BXNA 1GFWB 1F3FA 1RTIA 2DXEA 4PXDA 2Z4PA 5CZXA 1FDNA 5FIIA 2HGLA 2UUAF 3UO0A 2BX6A 3NG8A 1H2TZ 3GFYA 1J5OB 2L3MA 2EFGA 3MMBA 3PHEA 3KWMA 3V6HA 1IBKF 5KFEA 4OYZA 4TQRA 2D9PA 3OTDA 4QR1A 2EEYA 3HSJA 4K4YA 3LOUA 4DV5J 2BA9A 2V34A 4BWJA 3C16A 4MKBA 4E2FB 2UU9F 3W2WA 1FNMA 2WVFA 3IRXB 2RS2A 3CD5A 4NCGA 3E01A 4B3RF 1S4EA 2R7OA 2XCPA 4PG8A 2DK2A 2FDNA 2ASYA 4HI2A 1KVKA 5K20B 1FWLA 4R8UA 1BY9A 2VQEJ 1C1CB 1NH8A 2HLTA 1ZM4A 3EM1A 5D78A 3OHBA 4NX9A 3W8GA 2D7SA 3SV3A 1HI1A 3V6KA 2JNJA 1X9MA 1B99A 1S0OA 3QT8A 4BLGA 2UXBF 1ZOTA 2CJAA 2ZWOA 3FCHA 4F2RA 2EBGA 4RNFA 2JRSA 1N56A 1UMJA 1C0TA 3J7YU 2W24A 2I2YA 3PO4A 4V19X 1S49A 3QT5A 3KTQA 3BPSP 3M30A 1SJ4P 4J9RA 1GXTA 4R5PB 3DN9A 1FK9A 2GVDA 1GMWD 1SIZA 4MIWA 3W61A 3D7SB 1MLAA 3MAAB 1RYRA 2QLJB 1RAJA 1WHVA 1IWGA 1NCLA 2DR7A 2DCUB 1SKWA 4D3HA 5KG4A 1JKHA 3LP0B 1T8EA 4NLOA 2LXUA 4UOFA 2CFXA 4USJC 4DUZJ 6AT1B 4TVAB 2YX7A 5D6GA 1WC0A 4DR2F 3MPWA 2ZBQA 1U2CA 4DLEA 1K44A 2ZH8A 3M2UB 4TU9A 1H7WA 2MKKA 2EW9A 2IM1A 2P2CB 3S6EA 1NRKA 4I68A 1OYEA 1RABB 1ZM2A 3O5TB 3R3TA 2ZOMA 4J9VA 3THTA 2XY7A 5CYJA 4W92B 2DNYA 3ZNJ1 4CYUA 2R2SA 4K2XA 3QGIA 1ZA2B 2A18A 4IO1A 5EUHA 3ZTQA 5CA5A 3ZZYA 3KK1B 1VQ4S 2GC8A 2MSSA 4FDFA 4IG3A 5CCMA 1U1KA 4JBCA 2IYIA 3I0SA 5KAKA 3HHLA 4N77A 3CJRA 4OQJA 3DMJB 3RYLA 3V2UC 2OHDA 5FLXU 4IUFA 3LP1B 3PG9A 4QYZJ 2CQCA 4QPTA 1E6YA 1FVQA 1U09A 2WOMA 8AT1B 3IM9A 4QWDA 1RWUA 1W2BR 2UUBF 1DQ9A 2Z2MA 1S76D 2YKAA 2L9DA 4W4MA 2YNIB 1U1NA 4EYIB 2L08A 3K89A 2U1AA 3M05A 4KTQA 4PZVA 4AQYF 3X1LB 2ZE2A 3AA9A 4NCAA 2XBPA 3M8PB 4G1IA 4XTTA 4N47A 6FDRA 1H2VZ 1JIHA 2RQCA 4RBUA 3PV8A 1VIXA 2XMTA 2FVSA 5KT7A 4URSA 1RU1A 2HFUA 2NS1B 3I82A 3K5OA 3UCGA 1SC4B 1JLBB 3POTB 1MN7A 1C4AA 1X5SA 3PYFA 2AJ2A 4MYUA 4DR5J 5HROA 3F41A 3DM2B 3TJAA 5D4NA 2VQFJ 4A8YA 1U1QA 1PSDA 1TL5A 1QJHA 2Z2LA 1FKOB 4OZNA 2HG4A 5IQ6A 4J9KA 2MQNA 1RKIA 4M94A 2UXBJ 3BZQA 1H3DA 2I1RA 4X62J 2KB2A 3D1OA 2Y1LB 3HHKA 2IA0A 4TNOA 3CC7S 3PRVA 4QIWD 5MLCV 3T3FA 2UVUA 4ID5B 1FDBA 1R6YA 3GV7B 1J5OA 1NAQA 1R8BA 1RHRB 1SH2A 5DS7A 4IDKA 5DM7Q 2DR9A 3ZZ0A 4ZCMA 4M63A 5KT3A 2LKZA 3AOBA 4LBPA 3J7A1 1T05B 2HBRB 4GO7X 2E9ZA 3MOJB 1V3RA 3T5JA 3MEGB 4X4NA 2R2RA 5L1JA 2AGPA 1A6LA 4V19J 1ZH5A 3AH6A 2XMKA 3GIJA 3IRXA 1REVB 3D3BJ 2HHTA 4IYQA 2OPPB 2E5IA 2DITA 1RBLA 3M8QB 4URQU 2QZ8A 4CO1A 4KGKA 4QIVA 1Y00A 1HWLA 5HATA 1VC6A 3CD7A 4FPRA 1WWHA 5AT1B 1WSVA 1Z1ZA 2LXIA 4YB5A 4AL7A 1U7LA 2ZH5A 3G6VA 1JB0C 2WW8A 4ZJQA 3MCOA 3MEDB 2LQ9A 5I4MA 2VQFF 1F2HA 1O0PA 3BKUA 3HVTA 3SI8A 2JVRA 1RLDA 4ZKAA 3KUHA 5CQGA 2IHR1 4DV2J 2LQ5A 4EFAC 1U48A 4DSJA 4FBUA 1N52B 5DZ6A 1H73A 4IG0A 5ETPA 1RCOB 4P2MA 2DNHA 4Q2LA 3WX4A 4DXLA 2OMLA 1KWMA 4F0MA 1SUQA 3JTOA 4NLWA 4PQAA 3AAWB 2RKIA 4UW2A 4ZVPB 3VHQA 5DDOC 3OHAA 1BC6A 5HMZA 2BKNA 1IKWA 2PEBA 3PW5A 2V2ZA 1NHVA 2G13A 4HLBA 2VPYB 1TKXB 4UUWA 3S7RA 4ED2A 1QTMA 4ECWA 3H59A 2OPRB 5DZ7A 3PW7A 1Q0NA 2MZJA 1FRKA 3NBPA 2HHQA 2J9DE 1TELA 4ZLJA 3BH7B 5D0GA 3U1NA 4CM2A 3MUVP 4I6AA 4LF8F 2PFFB 2EWHA 3KJFB 4CO3A 4QIGA 5J1PA 3Q8YA 2W9AA 2OI2A 3PHTA 4JI8F 1EX8A 4ECQA 1LW0B 1WKLA 1NDLA 1XMBA 4ECZA 2HNZA 2DR8A 2HVIA 1B64A 3P49B 1HD1A 1X4EA 3VAHA 1VMBA 2CNKB 1JLBA 3DI6A 5HROB 4DDFA 1VK8A 1KLMA 4NI2A 2BE9B 3WIVA 2XCAA 3UDEA 5F8MA 2XHWA 5J2PB 5HP1A 4X2BA 3MM7A 3IS9B 4DL5A 4X65J 3G8TA 1GH8A 2C1EB 1TKZA 1S4FA 3WHIA 5DDRC 2P9GA 3KLEB 1YVFA 2UVRA 2UXDF 4FN5A 1RWPB 2MJUA 4CT9A 1WORA 2YNHB 4K4VA 2L41A 1Z2ZA 4UUXA 5ETRA 3K5PA 5B0BA 1Y9OA 2OH2A 4WFZA 5KFDA 4ZLLA 3ET6B 4J9UE 2HVZA 3H25A 1HBOA 4N7TA 1U1OA 3HVRA 1JJ2R 1VQKS 2J6SA 2LA6A 2BQUA 4NCGB 4PRFA 1G1XA 4RW9A 3JQMA 4TU8A 3AJDA 3DGPB 4BBYA 1Q8LA 2VG5A 2BM1A 4USVA 2J7WA 3CDBA 3BSOA 5BJRA 4DR1J 1T9YA 1G2EA 2MSTA 2VFUA 3W5YA 1RTJB 4DSFA 2HK3A 2Q3PA 3KLHA 5IT9U 4JV5J 3FMBA 4JUZA 2HHWA 3LTOA 3UD4P 3C6UA 2DT9A 5SZTA 1EP4B 2J9EA 4ZVUB 4PPDA 3M9NB 1KC8T 2K1RB 2M2BA 5L39A 3FCVA 3TX0A 4X4OA 5SUHA 2KFYA 3JTPA 1D9AA 2Z57B 3SCLE 3HP6A 3DRYA 3AT1B 1BWEA 4ILMA 1W7WA 4DV4J 4HACB 1AFJA 3B82A 3P4UB 1ZYQA 1EJ7L 1ZAXA 2R9LA 3A3OB 3R7BB 2HRUA 3UDCA 2XS2A 4ZPVR 4ED7A 2FGOA 2QA4S 4M95A 1XQIA 5E5NA 1RQ0A 1U1RA 2KYZA 4ZVSB 1HQUB 2F4VF 5F9NA 3R1LA 1E6VB 1XJWB 2A1BA 3TZWA 3BSNA 1TMMA 3HO1A 4CLLA 2H65B 2NXEA 2VBYA 3HVTB 3W9HA 2LYVA 3I32A 5G4DA 1Y5NB 4CLFA 2ZVSA 4ZHRA 4JI0J 4J5OA 3ZZZA 3QWPA 4DOZA 4XK8C 2QLWA 4PG4A 5D8HB 4HTJA 3IFEA 5IM0A 2EK6A 4QCLA 3JAMY 1RP5A 2F9DA 2V8GA 4RNHA 3U7JA 2VA3A 4I1TA 5ETKA 2RRNA 2KXFA 3T5HA 1AFIA 3PYGA 5F8IA 2YQ0A 4DPUA 2JL9A 4WIQA 2OP5A 1YJ9S 1UVJA 3UNGC 4Q5VA 2CAJA 2M7SA 2JVOA 5D77A 2D3OR 2AEJA 5JUMA 2YKNA 4J91A 2KU7A 1CJKA 1SB6A 1SCJB 3K17A 3NXZA 1Y3JA 2WBRA 5KFJA 2R8JA 2HZAA 4MH8A 1Y10A 4ELUA 1XNRJ 5ITHA 3JSYA 3MM9B 1SQEA 2KH9A 1O51A 1ZM3A 2F3JA 2FZCB 2UUCF 2CZ4A 4TLQA 2P8IA 4A8QA 3CDUA 4R0EA 5I3UB 2YXLA 4TY9A 2M8HA 3HHLC 2DNRA 4ZP9A 3W64A 4YY3F 4R8UB 1NK8A 4C3MA 4HDGA 2V9WA 4JP8A 2MQ8A 5L1IA 4LBHA 4ZP8A 3LF0A 2CNOB 2CRLA 1UVKA 2BRKA 2WVEA 4P10A 1Z2LA 3FC9A 1LW2B 1IN0A 1KBRA 2Y8WA 4FNIA 1VJWA 4LQ9A 3RB3A 1FKAF 1SKRA 4B9MA 2XMAA 4BC7A 1AUDA 3VQTA 1WOPA 3AD9C 4L72B 3MAAA 4GVLA 2BMBA 2GGPB 2XQCA 4G65A 2FLLA 1LQ9A 3CD0A 2DH8A 2G9OA 4I4BA 3A12A 2BJDA 2EK1A 5B09A 3G82A 4FYYB 4USUA 2BJ9A 1OSDA 2BUNA 1Q79A 4DV5F 5E41A 2LDYA 3CJ5A 3MECB 5D3GA 4USIA 4ZVGA 5LOQA 4ZLPA 1L3SA 3LUYA 3EPIA 1NB2A 1RA6A 4DFMA 1RWWB 4OZ5A 1R8PA 3M30B 4OV6A 3AFGA 3US5A 3ETMA 2GVDB 4F0KA 2CWXA 3GFXA 4LRDA 1JLAB 1QUVA 1PJ5A 4KGMA 3TWZA 4OI1A 2QEXS 5IM0B 2FHMA 3DMJA 4X66J 6FD1A 4L73A 4O0IA 1AYEA 3PKMA 3BDEA 2KFZA 2DNLA 2HIYA 1X9SA 3L09A 4CDIA 4DV1F 4B17A 1T03B 1RK8A 3PJ9A 3R5CA 4M5MA 3HJVA 3DXSX 3TVYA 1VBXA 2A6MA 1VQNS 2QC3A 2OIHA 4QYRA 1OO0B 3OL9A 4QW8A 1FXDA 3PIPQ 3K57A 4DEZA 4ED0A 2XSJB 2FJWA 2RT3A 3R6LB 4RUBA 3TVKA 2IM0A 3O44A 3C16B 1S9GA 5K8PA 1U49A 1NZAA 1FWPA 2C3UA 1UJ4A 4PXCA 4C4WA 3OTOF 1JWWA 3EGVA 5LL6d 4NLXA 2UP1A 3HD1A 5J2PA 4ZJOA 3OJUA 2DY9A 4NZ6A 3J7Z5 5GVQA 4UQTA 2YWKA 1F3VA 1JLGA 1C1CA 5HAOA 3T6JA 4F2SA 3I6PA 1YLXA 1D8ZA 3D2WA 4F4KA 2EC0A 4CTAB 5LXYA 1OQ3A 3DGVA 4KO0A 1RT6A 4MKAA 3I56S 3NEKA 1CSJA 3Q2SC 1C0TB 4I2PB 2I8EA 4B9SA 3V4IA 2HFNA 2NXUA 4B9LA 4K0KF 4WE1B 2UVVA 1S5ZA 1NK9A 1UCNA 1XTZA 4M5HA 3ZFVA 2YNFB 2B9XA 3DLJA 2HBQB 1PKUA 3A3NB 4F50A 3V81A 3PFOA 4Q43A 4LF2A 4IFVB 2HZVA 3QYYA 3PDNA 1GX6A 4DL3A 1WC3A 3K5LA 4DQRA 2XYHB 1GAOA 1I3OB 4LSZB 2AJFE 3D3CJ 4NLSA 3NMAA 3IBFB 4EBCA 2QGFB 2HRYA 4PG6A 2J0XA 3GYGA 2UUWA 4PEOA 5E2QA 1UWBB 3H20A 1HPZB 1WHXA 4YR0A 2N7YA 4Z37A 1WG5A 2GO9A 1KNZA 2NYIA 2XY6A 1RAFB 2E5GA 4K50A 1RAAB 4LR9A 3L7PA 4YHHF 4YMEA 1TQLA 3ILOA 4AXJA 1SJRA 3HVAA 4LIWA 1MWQA 3BJYA 1RGVA 2YNGA 3ZTPA 3THVA 4IQXA 3MMAB 5CXTA 2GV1A 1HQ2A 3N5FA 4ER8A 1S97A 5DDQC 4DL2A 1JLCA 3EGWB 3MUMP 1JLFB 2H5JB 2EPIA 2IRUA 3TAMB 4MK9A 5HO4A 3QGHA 4KHRA 4O44A 5KT5A 5KT2A 3OW2R 2ADCA 1UEUA 1CVJA 2QYCA 3DLGB 2H5EA 2M88A 5GAEU 4O4GB 2O66A 3M8PA 3HPOA 1CLFA 5E33A 2DO4A 2HNYA 3AB4B 2C2NA 2JC0A 5KOXA 3FEYB 2J76E 2YH1A 1HI0P 2XLKA 2LA4A 2V69A 5BR8J 2VH7A 3WX8A 3DI6B 4JI4F 2V4JA 2YH0A 3UE2A 8RUCA 5KT6A 4C0HA 4LSLB 1T94A 1D9DA 4P2SA 3QRQA 5BYRA 3FSIA 2B51A 4F8RA 2HRTA 3GJRB 1HBMB 4DWIA 1NPPA 4JV5F 2LU2A 3GCWP 3UFCX 3VZHA 3OLBA 5EGYA 1PYOB 4H4MB 4NE9C 4PR6A 4B08A 3NAHA 5G0RA 5AJ3J 1QVGR 2RRBA 3OVBA 2E5HA 2J7KA 4JI1J 1RAEB 3C6TB 1UPMB 3NBPB 1NJZA 4L6V3 3IR7B 3R5GA 3ZZUA 4Y0FA 3MFIA 1N0UA 4I6YA 4L75A 2Y1JA 3PJWA 1WTFA 3D0IE 3UR0A 4WWSA 1J5EF 3HF5A 2XZTB 4LREA 4OLOA 4CLZA 1WTBA 2HNZB 4QWCA 3G71S 4K4WA 4QZVB 3G6ES 5EWEA 4WIIA 3IBCB 4NXNF 2IMOA 2E5LF 5H9EK 1HKAA 1SI9A 3IC1A 2NXNA 3MMJA 3FVYA 1XK8A 4A8MP 4I64A 1U1PA 1ZPVA 4B3TJ 1VGYA 1KQSR 3QIPB 1GTHA 2ZBCA 1U6FA 3KK2A 3TARA 1FXRA 2P9EA 2R7UA 3H40A 2A6OA 1Q5VA 1F5BA 1NHUA 1RU2A 3CJ8A 3KUEA 4M5GA 4OHWA 4ZPTR 1K9MT 2KRRA 3OR1A 4DZDA 2XNRA 2CPDA 4WCEQ 1FKPB 4TY8A 2FJBB 2PC6A 3SDEB 4DV0J 5E7OB 1JLQA 4I56A 1NJYA 4LFCJ 1TZ0A 1XC9A 1LWFB 3IR5B 1EETA 2HVHA 4A8XA 5ETMA 2W7PA 1XWLA 2LQBA 3GP9A 1NKCA 3N4WA 1F5CA 1PAUB 4Y00A 3AY0A 4C6AA 2BRLA 2MHEA 1F0XA 1S59A 4ZK7M 1QDUB 2OPQA 4JI3F 5JMNA 2CG4A 3RRKA 2ZH6A 1ROFA 3SSRA 7AT1B 1IKYB 3RAXA 1RTJA 4J90A 3SYZA 1ZETA 1K73T 3PX6A 4NLRA 5HBMB 2ZZTA 2EFPA 1KTQA 1BQMA 3VGTA 2R2UA 2WSFC 2R7WA 5KFZA 3CCLS 2JEJA 3DOMA 3EXCX 4ZN3A 3TAPA 1A9NB 1FVSA 1U26A 1GXUA 1PJ7A 1YKWA 2G4BA 3H42A 3Q89A 1K47A 2K1RA 2OEJA 2YWFA 3S01A 5C5JA 2B8QA 2HHHF 3K8VA 1FRLA 3Q8QB 3CD6S 2M5YA 1UA0A 2HWIA 5AXKA 2U2FA 1PILA 2NSBA 1EKSA 1CULA 4CLYA 3HDSA 5K8MA 5LJ5Y 3ZO7A 3MURP 3LO3A 5HVHA 4FKXA 2AYEA 1A0OB 3JQKA 5KTQA 1KFDA 3UNYA 5CABA 2NREA 2A2CA 2VC1A 4DCOB 2ROPA 3I9V9 2QA2A 1M1HA 1VHIA 5EWFA 2R2TA 4OYOA 3PYDA 1SV5A 3SQGB 4PXBA 2D3ZA 1XR7A 2DO0A 2ZH2A 4ED5A 2N3LA 4YB1P 1EQ0A 3ENAA 4PWDA 1RTHA 1SC6A 4EO6A 2MLZA 3BSAA 2HW3A 3DLLQ 1QSYA 4ERDA 3SIPB 2COLA 3DDIA 4NEYA 2BW2A 3IS9A 1VRUB 3MTKA 4OYMA 2N7CA 3K59A 1AROP 1WEXA 5J2NB 4OX7A 1UKUA 2OEMA 1S0VA 3EUNA 3CT9A 4YR3A 5AXNA 2XTJP 3V4IB 5ETOA 2RQ4A 1SBRA 1HHQA 2DNQA 1NJWA 4DN0A 1Y5IB 1X4BA 3WDOA 1NDKA 3M9OB 3MAHA 1H2UX 4O3PA 2OUGA 1H0HB 3MTJA 2DR6A 4XO0A 3MM6B 1XEZA 1UJ5A 4OLPA 3TVZA 2K3KA 3SFUA 1NXIA 4Q44A 4O3RA 4CO2A 1OIAA 2AJ0A 1VOMA 2XULA 3NS7B 2H3EB 3IG1B 4P72A 5T41A 4F25A 3PX4A 3H5XA 1QE1B 1U8WA 2X1BA 5F8LA 3PEJA 4ICLB 4A8KA 2B4UA 2HFZA 4M5IA 4B9NA 3MWBA 2H48B 2QG9B 4F4WA 1VI7A 3V6JA 3AHPA 1G7CB 2MY8A 3EVMA 4Y2IA 3D9BA 3M6XA 3VAIA 4ZPCA 1IJFB 2NPFA 1FDDA 3GE9A 4P2FA 1Q1KA 3CVKA 2XNQA 3DLKB 4X4RA 2KFNA 1R6VA 2RS8A 4K59A 4P7TA 1WUUA 2ROGA 3QJJA 5KG0A 2ILZA 5L46A 2DNGA 1NJIT 2NPIA 5K14A 5C24A 4DPYA 2GGPA 2H4WB 4X66F 2MKIA 3PR5B 1GQEA 1D1UA 2BYCA 3M4XA 1HLWA 1L3VA 2ACYA 3HFKA 1Q78A 4MTPA 5KG5A 4QW9A 3BGRB 1OPZA 2UUTA 3CJKB 4WK3A 3I55S 4RNOA 5HBMA 1R8AA 1ZZFA 1N36F 1VC5A 2KVQE 2HWTA 1QAJA 1TAUA 1WC6A 3ZTRA 3HVWA 1GMVA 1F9EB 1QTNB 3UVJB 3GIIA 3ETOA 1BQXA 2GS8A 5DETA 1TFWA 1B7FA 1W2IA 2KT5A 1Y7PA 1EAYC 1UFLA 2AV5A 2IM2A 3H0PA 4J9NA 4P73A 4LQ3A 4Q2MA 3MCNA 2W2PP 2MJNA 2CPYA 2KG1A 2EXUA 1RTZA 5LXRA 2A0FB 4ED1A 1JJCB 1HWIA 1NKEA 1JLAA 2IVFB 3K0JA 2PA3A 3O2IA 3L3CA 3RB0A 1TL7B 3R1HA 1E6YB 2Y0SD 2N4DA 1KEKA 1Q95G 2CQ3A 4DSKA 3D6FB 5ETLA 2R8IA 3CO9A 2ZHOA 2VQEF 3HCXA 2B0GA 3I5AA 1RWVB 4DBQA 2Y0BB 3OL7A 2UU9J 4I69A 1WELA 1C0UB 2R42A 1LK5A 2WSEC 2EFVA 3TUJC 4K4SA 3KXDA 4FYDA 2JOQA 1X31C 1SL1A 4W90B 1N5QA 4DSEA 2LQJA 4EZ9A 4LVOP 4TYBA 5H9EJ 1NSKL 1Q53A 2FHOB 3OBIA 5AXMA 3LWLA 1N6QA 3AD8C 4KY3A 3IG1A 5KG3A 1X4HA 3CC4S 4NEZA 1KDNA 2QL9B 3BKFA 3M8QA 3QIPA 5AE2A 1MWZA 3TP2A 3KK2B 1KRPA 3CCJS 1IR2A 2LMIA 2X7IA 3QSIA 2CDQA 4OJ3A 2KI2A 3CCSS 3UQSA 2CDRB 4HDHA 4PQUA 2B56A 1RT6B 3K5NA 2YKPA 2IC3B 1LWCA 2H9ZA 2YKMB 1HHSA 4RJVA 1OJ4A 2F7VA 1YJUA 5D0HA 5F0WA 3BGLA 3FDSA 1FK9B 2NUHA 4C98A 1LWXA 1T0TV 2V2KA 2XI2A 5B0DA 5HI7A 2FLNA 4USKA 2A3JA 2WW4A 2Y3YA 1R89A 4MIBA 1KLNA 2VPXB 3BV8A 3CCQS 1UAWA 4LF8J 4HH1A 1RWOB 3BKTA 3BREA 4DPXA 1FNXH 2VFRA 2C3PA 2HFSA 2Q79A 3GYXB 2PT0A 4KQZA 3MUTP 2HQGA 2ZITA 2LEPA 4CO5A 2W2OP 4P71A 3U02A 2AYGA 1S12A 3TO8A 4ZN1A 5HMXA 2IJFA 4MKVA 3PZPA 1TUWA 4ECRA 5L8RC 2IAJB 2OGUA 4N8OA 3L9ZA 2ZHAA 2R7RA 4DUTA 3OL6A 4PUOB 2UXDJ 2HGNA 5D0EA 1IR1A 1U0HB 5CH7B 2J7UA 3QATA 2CQ4A 2OD6A 4WBFA 1QAIA 1UP1A 2DJWA 2EG1A 1NSQA 4HKQA 3GWCA 2E1RA 5CYMB 3RU0A 2HYIB 1R0AA 2JEGA 4ELVA 2MZ1A 3K8WA 2ZWPA 2AEFA 4UOHA 3CF5Q 3OL8A 1N48A 3W60A 1S77D 4WFXA 1U47A 3BEGB 3OTBA 1YQHA 3KLIB 4WFYA 4M5JA 2GAGC 5K8NA 4G1PA 5KFPA 1XMQF 2CQBA 3Q23A 5RUBA 2B9YA 3QAUA 2QE5A 2VG7B 2YY3A 2ZE2B 3ITHA 1NLKL 3DHWC 3MMCB 3W65A 2LU1A 3CJ4A 2MXYA 1LV5A 2Y8YA 3TQ1A 2MQMA 1CC7A 3DRSA 2C28A 2AJ4A 3C15A 5J1EB 1P1LA 1V5VA 2V5HG 2YNFA 4I2QB 1TMJA 4KFBA 4RW8B 3IO1A 3W9JA 5KFQA 1BUXA 2VDHA 1VC0A 4NLGA 3KMQA 4ILLA 3DYAB 3TZYA 2J0SD 2Y1IA 1S6OA 1RT7B 1RHJB 4E98A 4ES3A 3LGHA 1NDPA 4JI3J 1FTCA 2VBWA 3QRPA 1MMDA 2P9CA 1TKTB 1RT2A 4ZITA 1YGYA 1RA7A 1WI8A 4XDDA 5K9FA 1DJ0A 1FF2A 3HSDA 3IR6B 4AL6A 5A6WA 1S9EA 1BLUA 2AZ3A 2NUUG 4FYVB 1M5SA 3TEGA 4B3MF 2DRAA 4K5RA 2Z58B 2GJ2A 4CO4A 4DV0F 1UPPA 1Y0HA 2YNHA 4DR5F 4CLSA 5DG9A 3MR6A 3CEDA 2QA4G 4JV2A 1OSCA 2JJ4D 3P5BP 1FX2A 3Q86A 3RR7A 2QMWA 3NMRA 1IKXA 3WZ0A 3MHYA 1RT4A 3LAMA 4FZVA 3ULHA 5IV4A 3C2PA 2DNZA 4DSIA 1WNEA 2FHJD 4OZ3A 1N54B 2K2PA 1HQEB 2CNNB 4F4XA 1NM2A 4MKYA 5B0EA 4NXNJ 1JLCB 4DHVA 4B3SJ 2CQ1A 2ZNZA 3H5UA 1NK0A 3D5MA 5ETTA 2ZVIA 3TW0A 4AE5A 3PNIA 4KAIA 2HQCA 2C2MB 2HMIA 2WVDA 2ZH1A 2VJVA 1TKDA 3CDWA 5T14A 3SBMA 3SQOP 2WTFA 3CNQP 4WTOB 2V94A 1JLQB 3FSXA 2QYGA 3R5BA 4HR2A 2VD3A 1WC4A 4ENOA 5KFKA 2ERRA 2YWHA 3O8WA 4AFFA 2WBMA 4OI6A 1FA0A 1VRTA 2VZ9A 2NQPA 2P5VA 4HACA 4DR3J 1IVZA 4KYZA 2DHAA 3T19A 3QAEA 1Q8IA 1DLOB 1URRA 3MM5A 1LKZA 1XN9A 2PEHA 4NA1A 1JNRB 1QM9A 2D1CA 4ANCA 1VBZA 3A8JA 1S1VA 4ELTA 5DQIA 3DRXA 4DR6J 3H98A 2HQFA 2LECA 2CJYB 5BYQA 3U27A 4DUZF 1C2PA 2VFTA 2ZEJA 4I0WA 3R2DJ 4K4ZA 1LXNA 2HWHA 2WB4A 1M1KT 2HHVA 3PTWA 4O4GA 1S79A 2HHUA 1NK4A 3RAQA 3KNGA 4CYUB 2R7XA 3PXGa 3D54A 5LMNJ 3ZTSA 3M6UA 3GV8B 2UV8A 3FZBA 1RTDA 3K7RA 2VV5A 1X5TA 2I5JA 1X4FA 3POTA 1SQGA 1L5UA 3VQSA 4GVBB 3NOGA 2D3UA 4N8NA 3AQOA 3FRYA 1CULB 5LSOA 4ECYA 4DS4A 1RT2B 4WPAA 1FRJA 1SPBP 4F4AA 3CJ2A 1HW9A 4H4KC 4KBIA 3P96A 4FXVA 2YNIA 1FEHA 3W63A 4Z7YA 2EKNA 3AD7C 3H4BA 4B3RJ 3ZZRA 2QSWA 3LGMA 2DR5A 3FNNA 1K1SA 3KFWX 1IQZA 1S9FA 5IT0A 1VDHA 1SKSA 3DRRA 2HVDA 4TYAA 3RB4A 3VVTA 1T3OA 2CPEA 2PMWA 2HHXA 2NCKL 1RTHB 3Q8UA 4OHZA 3Q8PB 4PAAA 1JK9B 1WEZA 1REVA 2AGQA 3T9NA 2HFOA 2N4CA 3DM2A 1VQ8S 2V2VA 1FHTA 1GMUA 2M8DB 2JSXA 4HEA9 4LF9F 1P1TA 2B7BB 3LP2B 5GAHU 2O5DA 4KR0B 2CPXA 4IQMA 2W9BB 4DFKA 2ZNYA 2W4CA 5J2NA 2QX0A 5I3QA 1UFWA 3J81j 2QO3A 2VPWB 1UVMA 3DOMB 3QIDA 1LWEB 4ID5A 2GW8A 2VF3A 2W2MP 5EX0A 1LOUA 4QWBA 2D3O1 3WQPA 4MFBB 3QBCA 3Q8RB 1NK7A 4CH7A 2RMLA 3W8PA 2B8PA 4RR5A 4N76A 3VALA 3CE8A 4X64F 1QD1A 2DBBA 1PBUA 3TQEA 3L7OA 5ADZA 2RUGA 4RWWA 2XLJA 3ZZPA 4CO0A 3GILA 3LWMA 1U0SA 2GNKA 4FP9A 5HN0A 3HFZB 4EBDA 3HZGA 5ETQA 5GADU 2VASA 1FRHA 2I9SA 2Q1LA 5IQQA 2W9CA 3G82B 3CGIA
chains in the Genus database with same CATH topology
2KM8C 2B5JA 1OPIA 1BQMB 3DLEA 4NLQA 4IFYB 2HMIB 2C3MA 2E1AA 3BSCA 1DTTB 2O1PA 1B0TA 2GQ2A 5GMKa 3TRGA 1LW0A 2QMXA 3OFFA 2E9TA 2NSCA 1F9FA 3OVAA 4NRTA 4U7UK 3SCIE 5B7WA 4IG0B 5F8NA 2OAUA 2RH3A 3M2RA 3CCES 3OFGA 1RDRA 1KQSR 4IOAQ 2PDAA 5J2MA 1RT5A 2DHXA 2IMWP 3H5SA 1HFEL 4WK1A 2XEXA 4OZJA 4U6PA 1RT1B 2ZC3A 2E29A 1TKXA 4LF5F 1DBDA 1VIOA 1O8BA 5E3CA 1X0FA 2X1GA 4Y2AA 4ZVEA 5HQ8A 4LSNA 3RB6A 1UVNA 3DDKA 2B7CB 5KFBA 3NGKA 3D1HA 2CIMA 1S6QA 1HBOB 3IA0A 1HYSB 4JI5F 1Q82T 4PG5A 4F02A 3CMAS 5KG7A 1FD8A 3OR2A 3BN7A 2DPJA 4NL5A 2GFFA 4OV1A 1HWJA 1VQOS 2LCWA 3VF0B 3DRPA 3FRZA 2GJIA 3OXLA 3I5BA 3H8YA 1UW4A 2LLZA 2XY5A 4EUVA 3B4DA 2Q66A 3GFZA 1GXLA 1HNIA 3UI3A 5L9XA 3CJ0A 2F40A 4OZ1A 1S6UA 3I9ZA 2M3DA 2ILYA 3V81B 1S1XB 1VLYA 3EX7B 2ZH7A 3G8QA 2VFVA 2PI4A 2JX2A 4A47A 3IAS9 7FD1A 3FEZA 4J9QA 1XERA 4GC7A 2KKHA 4QIEA 3H5XA 5KFAA 1V3SA 4OHXA 5AE3A 2W9CB 1N34F 3NCRA 4DQIA 2W9BA 3D28A 5B0AA 3F56A 2F8EX 3BF4A 3HHDA 2KVIA 3M32A 1NB7A 4KV8A 5DRKA 2VC0A 1S72S 4RW7B 1LWCB 1YJTA 1GNKA 2YKMA 4NMLA 1FE4A 4D3GA 3G8SA 4Y2CA 3OTEA 3MM8A 2CPIA 5T7LB 1RKJA 2J0WA 4Y28C 3ONQA 2WONB 4ZCKA 1WEYA 4IG3B 5E0OA 1NH7A 3LGNA 1VK3A 1M90T 2AWZA 3PACA 2RJZA 4EO8A 5J2QB 4KRWA 1CC8A 1IKWB 3IN5A 5LJ3Y 3FEXB 4HT7A 1JLFA 1SJ3P 2J0QD 4NCBA 3EXYA 1RTIB 2OKQA 3LW5C 3OTCA 2AJQA 2RQKA 4Q7AA 2KM8B 5H9FJ 2MQPA 5DDPC 1JJHA 4YB6A 3BB5A 3PW4A 4YQWA 1P8GA 3JB9k 1KOOA 3AQPA 3DOLB 3NP5A 3MXHP 3FMWA 2J5AA 2M52A 2HS3A 2ZZNA 1TFYA 3DYAA 1YJWS 4K4TA 3AJ1A 2E7WA 1DQ8A 2CVEA 3QMQA 2ADBA 3VAGA 4KO0B 2CYYA 2IVMA 4B9VA 2XO7A 3W2VB 1WF1A 3A8EA 3OQ2A 1QSSA 4O3NA 4DL0C 4UQGA 1ULRA 2DGQA 2JFDA 3D1QA 5IWAF 5I42A 2ATLA 2GHWA 4ES2A 2FHKA 2VODA 1JJ4A 2OFGX 2QIFA 4ZCIA 4G1QB 1RT4B 1M5VC 2HQIA 2V0NA 2GQQA 4B3TF 1RT7A 2MPUA 4RWXA 2CQ0A 3BQ0A 5KFGA 2GCFA 1IKYA 1ZBTA 4F4ZA 3PO5A 3RRHA 2R8KA 4X4QA 3BGFA 2KTQA 4IRDA 4DF8A 1YSJA 2RD5C 1K0VA 3CDAA 5KG2A 3N0VA 2D41A 3QGGA 1BQNB 2XGPA 4ED6A 3DXBA 1KD1T 3J7A1 1U6ZA 3CCMS 3TUZC 1XR5A 1HD0A 5GAEI 4LJMA 2P6TA 5DLFA 5KFXA 4K4UA 1IBMF 3D0GE 3IGNA 4Y6IA 5LSLA 4USHA 5J2QA 2G1DA 1YJNS 1G6BA 2FVCA 1R8CA 1Q7LB 1Q16B 1G3OA 4JI1F 4B02A 1P27B 4A4JA 1T7PA 3ENQA 3M1VA 1Q4RA 1MNEA 3CIZA 2VG7A 4AUKA 2CQ2A 1M0SA 5CHCB 4C2MA 3SZ2A 2KJVA 2DHSA 4ITSA 2RU3A 4IH6A 1ELOA 3PRBA 2JDJA 2JFKA 2GO8A 4RW8A 3RTVA 4YDXA 3SCJE 1VQ9S 1KN6A 4WYWA 1S10A 4KJIA 2L48A 3PJXA 3T9ZA 4B3OB 1QSLA 3MM7B 3NWGA 4H4MA 3U02A 5FJ4A 2VUGA 5FDLA 2PD1A 3P3DA 1PC4A 3U1MA 1HNVA 5HMWA 2MQQA 1L3TA 4PXEA 5JVHQ 5CYQA 3CXCR 4DV2F 2BE2B 1NJXA 1U24A 3KG1A 4IDKB 2XMVA 2KXHA 5KFRA 5IS2A 3KJVB 4C0BA 1CEZA 1XBWA 1CG2A 4OX8A 3DRRB 3HKWA 1IKXB 1RYSA 2XSFA 1IQTA 4G1QA 2AP6A 2OSQA 3KMSA 4GKKF 2YX4A 1S6PA 3FQLA 2O3DA 3MPVA 2PO4A 4F3OA 1QE1A 3DRPB 2DD8S 1IKVA 2BANB 1H98A 3NCPA 2MZQA 5CD4H 4N56A 2O01C 2FJAB 2CJQA 5H1SV 3CJ3A 4NA3A 3HT3A 1H7XA 2DIVA 3DLKA 3DU6A 1N5SA 3OV7A 4GKJF 4ATNA 2IRXA 4DR1F 1EETB 4MYTA 4PKDB 3J7ZT 3FJ2A 2DNPA 2F1FA 1DURA 5EHHA 1D3WA 2DGSA 1N8RT 4XIUA 1YITS 4H4OB 2KHDA 4LMZA 4UY85 1MU2A 4DV6F 3CB4A 1X4GA 5LMUF 4ECSA 1IM4A 3M1VB 2JWNA 4MMOA 1XNRF 4OIXA 2ZBIA 1T02A 4WFAQ 2C2DA 1RISA 2ZH4A 5F0UA 3MEDA 2GHVC 2BQ3A 3HLUA 4OHYA 3BR8A 2WB1D 1U45A 4ZHRB 2KT3A 2IM3A 4ZP6A 3KNAA 3CIMA 3OSNA 2IBOA 2EG2A 2DGTA 4Q8FA 3UR3C 5B0CA 2SXLA 5HP1B 2PSZA 4TN2A 1HBMA 3T1YF 1U2RA 1S1VB 4RW4A 3A1YG 4CTAA 3J80Y 3VAMA 2B9WA 4Q8EA 5KG1A 1YRXA 2YVSA 2HZCA 4OFZA 3V6DB 3RZAA 3KHLA 1N4LA 2BE2A 2E66A 2FPHX 2FIUA 1F5AA 3BM7A 1VQ6S 1I94F 2KHCA 1YTYA 2J8AA 3CCWA 4IR9A 3IWLA 4TKTA 4ES1A 4RW9B 1KLMB 2RU9A 4X4TA 2UVWA 3JSBA 3BN4A 5F8JA 1S1TA 4CZCA 4K4XA 3KLVA 3VAFA 2M70A 4FS2A 1HMVA 3H2VE 1TL3B 1X8DA 2GHPA 2OLWA 4BWMA 3W2VA 4PQUB 5EN1A 1LWEA 2BACA 4M5DB 4DFJA 3MZIA 2X3GA 3SDEA 2KXNB 3PM9A 3OVSA 3FFIA 2FUG9 2XWXA 1R27B 5J1NA 4C7QA 1LFPA 4BHQA 1S0NA 3SSSA 4DUYF 3H2UB 3TAQA 4DQSA 4FBTA 4C8MA 2YNGB 3GMGA 4OI4A 2O67A 4O3OA 4AYBD 2IA6A 3RAMA 4DL7A 2GIQA 5KFYA 5DLGA 1HNXF 4M8LA 1LK7A 5THWA 1FTRA 2MQLA 2DISA 1DHMA 4KV8B 4A48A 1DTTA 3GR0A 3UW1A 2DHGA 4A8WA 4ED3A 1KRPA 1HPZA 2APOA 5DQGA 4Y3CA 4EBEA 4A8OA 2Y1RI 3MOZA 2AYBA 4WZMA 5B0FA 2WSCC 3HJFA 2R4FA 3GYNA 2FGCA 3THPA 4G3IA 2MGZA 3N79A 3OXFA 5FD1A 4X65F 1JLEA 1SJQA 3OSPA 1X5OA 3QLHA 2VA2A 2LVWA 1UEVA 1AW0A 4GO5X 4KIAA 1YRUA 3QO9A 4WXOA 3BS9A 2BJEA 2WCXA 3PRDA 4DL6A 1T03A 5C25A 3DLEB 3PR4A 4Y65A 1FERA 2DNNA 4BS2A 3N28A 1U6BA 1VQ5S 3R5DA 1OS5A 2ABYA 1DTQB 3KHGA 1M5KC 2YWEA 4X4NA 1HARA 3E51A 2DRBA 2J6UA 4FVMA 1WHYA 2ZDOA 1Q7YT 2RSQA 3HI9A 4IOCQ 2K7JA 4C8KA 4JI2F 4BC9A 3HX9A 1YG0A 5A0YB 1FESA 3JYTB 1S1TB 4URGA 3LP1A 3MI7X 4DR7F 4ID8A 1ZZNA 1VHFA 5FDLB 3R5AA 2Q6BA 3VCDA 3KLEA 3P5TL 4JOUA 1TK8A 1FCAA 3JTNA 1N33F 2PA8D 3QJLA 3N01A 1FKPA 4TY8B 1LW2A 3Q0AA 3EYZA 2NR0A