4A8XA

Structure of the core asap complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
b'SMKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLAPWPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-BINDING PROTEIN WITH SERINE-RICH DOMAIN 1
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 18
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a8xA00
3BO3A 2YH1A 3NMRA 2D9OA 2Q79A 2HGMA 5IFMA 5D77A 2AD9A 3I55S 1X5SA 1X4GA 2DGTA 4ZKAA 2E44A 5DDPC 2E5JA 2V94A 1M1KT 2LEAA 3CCRS 1VQPS 2M52A 4Y0FA 4LMZA 1PGZA 2DHXA 1ZZNA 5ITHA 1IQTA 1DZ5A 2MKIA 3VF0B 2LEBA 2VONA 2M2BA 4Y00A 5LSLA 4WCEQ 1FHTA 3Q2SC 3CXCR 2MGZB 2GO9A 1HD1A 2QA4S 1P1TA 2KXFA 1JMTA 3UCZP 1U1QA 2DNQA 4F02A 2NLWA 3SDEA 1AUDA 2DNGA 2DB1A 3CCMS 1VQKS 4WF9Q 3CC7S 2XS5A 2PE8A 1HA1A 3R27A 3VAKA 2DIVA 2BZ2A 4OZ0A 1X4AA 1WG1A 3MI7X 3HHNB 1WI8A 1D9AA 1SJFA 2ZJQQ 2M8HA 2ADBA 1U6BA 2DNYA 3G96A 1HL6A 3SXLA 2JWNA 1YHQS 2AYBA 1KC8T 1VBZA 1VQ9S 3MDFA 1YTYA 2M0GB 2K8GA 2I38A 1WHYA 2RS8A 3DLLQ 1X5OA 5JVHQ 2KG0A 4WFBQ 1ZH5A 2DNKA 3UCGA 1BY9A 3ZZZA 2MQQA 1JJ4A 2LQ5A 1KQSR 3CULA 5DM7Q 3NS5A 1WEYA 2DNNA 1M90T 1OIAA 4F26A 1FJEB 2KFYA 1KOOA 4OZ1A 3S01A 4WFAQ 5GMKa 1FT8A 1U6FA 2B0GA 4QQBA 2M88A 1WHXA 2QEXS 2FHOB 2L41A 2RUGA 3VAJA 4EGLA 2FC9A 1R8PA 5GVQA 4IO9Q 2MKCA 1N88A 4J5OA 3U1LA 4Z2XA 2L9WA 2CPYA 2DNZA 1VQNS 2KN4A 4P6QA 2RQ4A 3CCVS 2HVZA 5HO4A 2RS2A 1K8AT 3L3CA 5CA5A 2G0CA 1JJ2R 1X4CA 2DHGA 4QU6A 2XB2D 1VC0A 2MQLA 2M7SA 2KVIA 2HGLA 2K3KA 2CPZA 5D78A 3VAMA 2ERRA 3CCUS 2MGZA 1U1OA 2CQ0A 3TO8A 2JVRA 2OSQA 5HL7Q 5BJRA 1WI6A 3ULHA 2MKHA 2DNPA 2KI2A 2GHPA 1FNXH 2FY1A 2KRBA 1UP1A 2I2YA 2DH7A 2DIUA 3EX7B 2KM8B 2XS7A 1WF2A 3MUMP 3US5A 1U1MA 1WHVA 2KT5A 1VC6A 1FJCA 2DGOA 1R8HA 2MZRA 2RRBA 2E5GA 1DRZA 3THTA 2LXUA 4FXWA 5DDQC 1SXLA 3TP2A 4YOEA 2WBRA 1KD1T 4V19X 1L3KA 4F25A 2DGQA 3D2WA 3P49B 3MURP 5IQQA 3OW2R 2CJKA 1HD0A 2CQ3A 2RNEA 3B4MA 3J7ZT 1VQ6S 2N82B 2RT3A 2J8AA 3FEYB 1X4BA 2CPJA 4C0OC 2CQBA 2MYFA 4RU2A 1KOHA 1WEXA 4PRFA 2L08A 5DM6Q 2E5HA 2MXYA 2MQMA 1WF1A 3VALA 4TU8A 2DGXA 4YB1P 1DHMA 2PEHA 2E5IA 2CPHA 2MY7A 1YITS 2CQ2A 1QVGR 2MKJA 3MUTP 3VAHA 3BS9A 1H2VZ 3UD3P 2EVZA 2MPUA 5FJ4A 3CUNA 3H2UB 2VODA 3MUVP 1X4EA 5LXRA 2KU7A 3VAIA 3J7YU 1U1RA 3UWTA 2D9PA 2DGVA 2MMYA 4CIOA 4M5DB 1X5TA 1SJ4P 3K0JA 2KH9A 3IWNC 2X1BA 4PKDB 4WKRA 1CVJA 3G9CA 1S72S 1F9FA 2DITA 2ADCA 5H1SV 1H2TZ 2CQDA 2MSSA 2CPXA 2DNOA 3CTRA 2CQ1A 2KXHA 1UAWA 2MB0B 1M5OC 2CPDA 2DH8A 2LA4A 5DDRC 4QPTA 2ZJRQ 3VAFA 3S7RA 2LA6A 2LMIA 3SDEB 2MZSA 2MZQA 2AYMA 2RRAA 1VQ5S 2U1AA 1OPIA 1UW4A 2XS2A 1Q86T 4IOCQ 2MHNA 2AYEA 5CXTA 3NS6A 2CPEA 3V4MA 3BEGB 2DHAA 2YTCA 2F9JA 5IM0B 3CCJS 1WG4A 1YWXA 1YJWS 3LPYA 2J76E 2X1FA 3CD6S 3CC2S 1H6KX 1JJHA 1S79A 3TYTA 1VQ8S 2KHCA 2CQIA 4IUFA 2CPFA 1YI2S 1RKJA 4YUDA 1U1NA 4IOAQ 1FO1A 2RQCA 1WWHA 2DHSA 5GAEU 2KM8C 2X1AA 3EGNA 2RVJA 1YJ9S 5DDOC 3CMES 2J0QD 3IRWP 4FXVA 1K9MT 2YH0A 1WG5A 3HI9A 4WFNQ 4W90B 3R1LA 3RW6A 3PIOQ 1M5KC 2DO4A 1SJ3P 2EK1A 2MJUA 5DETA 3RW7A 3N9UC 3SMZA 2HYIB 3NNAA 3CCES 5LXYA 2NZ4A 4BS2A 1M5VC 2DGUA 1G2EA 2X1GA 2G1DA 1A9NB 3G8SA 3ZZYA 1OWXA 2MQOA 1Q81T 2N7CA 1NO8A 4TU9A 1QVFR 4TLQA 2U2FA 3UD4P 2MJNA 2M8DB 4C7QA 4WIIA 2MQPA 2KG1A 4QU7A 2MKKA 4TU7A 4ED5A 2KXNB 1P27B 3LQVA 2RU3A 1X4HA 2MZJA 2VOPA 2OIHA 3Q2TC 2FPHX 2KRRA 5LSOA 2CQGA 2DNMA 3S8SA 2AYGA 2HZCA 4PR6A 1YIJS 5JVGQ 2OSRA 3MD1A 3P3DA 2OTLS 2CQPA 3VAGA 4UY8T 1NU4A 1VBYA 5CYJA 1N54B 2LXIA 5GADU 1VBXA 1X0FA 5LJ3Y 2G4BA 1DBDA 3CCLS 1X4DA 3P6YC 1FXLA 1SJQA 1FJ7A 1SJRA 1WELA 4W92B 4UQTA 1A7GE 2MZTA 2DK2A 2FC8A 2N3LA 4LJMA 3CMAS 1WF0A 1WHWA 1D8ZA 2J0SD 1N8RT 5IM0A 2JX2A 2DNLA 1M5PC 2D3OR 1YJNS 1U1LA 2XNRA 2M70A 2YWKA 4U67Q 1WTBA 1URNA 1QM9A 4LIRA 2A3JA 4C4WA 1U2FA 2MZ1A 4A8XA 1PO6A 3CPWR 1B7FA 2MY8A 2KYXA 3CCSS 3UCUP 2CQHA 2N3OA 1VQOS 1VC5A 3G71S 5GAHU 2CPIA 3CC4S 5MLCV 3MXHP 1OO0B 1UFWA 2JRSA 3CCQS 2OTJS 3BO4A 1NJIT 2MQNA 2BOPA 2F3JA 1RK8A 2OJ3A 5GAGU 3MOJB 4ERDA 3NNHA 3CF5Q 1VQ7S 1VQMS 3EGZA 2DNRA 2EK6A 2LKZA 3MD3A 1VQ4S 3PIPQ 3U1MA 2DNHA 2YKAA 3BO2A 3NNCA 3P5TL 2O3DA 3I56S 2LCWA 4CQ1A 3JB9k 1VQLS 3THPA 2CQ4A 2QFJA 2VOOA 1N52B 4CH1A 2LECA 2DH9A 3DXBA 2DO0A 2JVOA 3R1HA 2HGNA 3B4DA 1X5PA 2MKSA 3S6EA 2CQCA 1W2BR 3G4SS 1Q82T 1K73T 1ZZFA 3H2VE 1Q7YT 1WEZA 1XN9A 2F9DA 5LJ5Y 1H2UX 3G6ES 2DGWA 2M4MA 2DISA 2ZJPQ 2MSTA 1U1KA 1O0PA 2SXLA 3UE2A 2DGSA 2LYVA 4CH0S 2UP1A 3FEXB 2XSFA 5EN1A 2XNQA 3G8TA 1X4FA 1U1PA 2M9KA
chains in the Genus database with same CATH superfamily
3R7NB 2EFVA 5F3TA 2B6AA 1SKWA 4M5MA 3J80U 4AT1B 4I7FA 3PR4A 2Y0BB 4ID5A 2E7XA 4TY8B 4F3MA 1SH3A 1QAXA 1M1KT 4OIXA 3CW2C 1CBKA 1RB0A 4EO8A 4OHXA 2QGFB 4G1IA 4DX7A 1AT1B 4MK9A 3TAMA 1U1QA 1GX6A 3C16B 1C1BA 2BJ9A 5T41A 1CQNA 4P72A 1SL1A 3OR2A 4OZ0A 2CXEA 3BH6B 1UJ6A 1X4AA 5D3GA 5HJXA 3G96A 1C2PA 3KG0A 2E1CA 2UXDF 5MAOA 2Q6CA 4XIUA 1N34F 1WHYA 1UVJA 1T3NA 1VQSA 3FUYA 1HHSA 4DQSA 2DNKA 4XPCA 2EG1A 4CRJA 2B5JA 1M1HA 2AJQA 1A6LA 3SQGA 2P2CB 5KFAA 4OYOA 3AODA 4WFXA 4E2FB 5L1KA 2ZH4A 3WX8A 2DNZA 1HBNB 4CO2A 1P8GA 2R7TA 1UMJA 1NHKL 3SFGA 1TUGB 4JI0J 2N4DA 3JYTA 3DU6A 3KG4A 3GCXP 2VA3A 2JVRA 2WB1D 1TV6B 3LPEA 2VF3A 1NKCA 4OV6A 3RBEA 2KT5A 1R8HA 4KC5A 1NDPA 1HNWF 2HIYA 5E41A 1V9OA 2PI4A 1RTIB 1KEKA 1W2IA 2QMXA 3P49B 3LWLA 1TELA 5CYMB 2GO8A 2W4PA 4CNZA 2GHWA 2RNEA 3T19A 2VFRA 5K9FA 4EI2A 7FD1A 3BSOA 1HLWA 2ZD1A 2YQ1A 4PRFA 3UN5A 2MXYA 2JLEA 1RT3A 5I4MA 1WF1A 4RNFA 3M8YA 5IXUA 4N47A 3BS9A 4C6AA 4PYDA 2KU7A 4KO0B 4DG1B 4BBYA 3ZTSA 2DYAA 3TVZA 4OYPA 4ANDA 2HBQB 2YPZA 1YJUA 3NCRA 3D68A 5J2MB 3MPWA 1SC3B 1UAWA 4O3SA 3D6MB 3UDEA 2ZC4A 1EP4B 2R7VA 5I42B 1VQ5S 4FKYA 4AYBD 1OPIA 2RQMA 1GNKA 3LPYA 4PPZA 4ZCIA 4ZCLA 2UUAF 2PFDA 4DI6A 1H6KX 3MEGA 4DOZA 1HBUA 3HM9A 1JLQB 1WTFA 4IH5A 3FKBA 4K5SA 2A2CA 1P9YA 3CMES 3OTCA 2I5JB 3DYAB 2YH0A 2K3IA 4PWUA 1RAJA 4K2XA 4Q0BA 4OI3A 1RXOB 5KFPA 4K8RA 5G0RB 2HYIB 1LWFB 1RSCA 4CLWA 4IG3A 2YKNB 1PG5B 4QR0A 4QIEA 2XMAA 1HBMA 2GQ2A 3HJVA 2XMKA 3ZC4A 2PN6A 3MM9A 3TAPA 4RW8A 5BR8J 2OP5A 4EWTA 3J81j 3T1YF 2E29A 3A8EA 5KFWA 3D0IE 1DQAA 3P3DA 3B54A 3NGUA 5B0GA 4HTJA 5J1EB 5LMUJ 2Y0SD 3AD8C 5CH7B 4N7TA 1X0FA 4NYPA 4DCOB 4UQTA 4JI4F 4LJMA 3Q86A 1TFWA 4ENOA 1PIEA 4RUBA 1Y11A 2JX2A 1NUEA 1YG0A 1U1LA 3KJVB 2DPJA 3LTOA 1NXIA 4ER8A 2WVDA 2C2KB 4Z37A 2JJ4D 1AYEA 3CCQS 3T5HA 1HMVB 4HH0A 1TKZA 2UVRA 2CG8A 1H73A 4DCPB 2F3JA 3ET6B 1BQNB 1ZM4A 1RTDB 4DR7J 3IM8A 1VQ7S 5HVHA 1KTVA 2FGCA 1REVA 4YY3F 4B3TF 1TTHB 2V9KA 2POKA 2OKQA 3WHIA 3W9HA 2E1AA 3Q8VA 3NCPA 3BF4A 2MSTA 5F8HA 2QL9B 4GO7X 4X66J 3DDNA 3W2WA 4JI1F 1HWKA 1U1PA 5KTQA 3DMJB 3GB0A 4FYVB 5E0OA 5KT4A 2KO1A 2CJAA 1SL2A 1N33F 2AHOB 3N6MA 1VISA 4F4AA 2FGOA 4JI6J 5A8KB 1NPKA 4CTAB 1UWBA 4DMZA 2VHGA 5HMWA 3GJQB 2BE7D 1KVKA 5E33A 2OPSA 2FZGB 2B4OA 3IAM9 5F41A 2ZVIA 4QOTA 4Y2CA 2QE5A 2VC0A 1J5OA 3BGLA 3DLLQ 1FDBA 1XQIA 1X9SA 1I5OB 2C42A 1WKKA 4X4QA 3T6JA 2WW4A 1WORA 3W62A 5GMKa 3SEOA 5AE2A 4X4PA 3MFIA 5M2UA 2HQGA 3GONA 4DXLA 2QLXA 2ALYB 4W98A 2DHGA 1OS5A 1VC0A 4URQU 3M2VB 4QIGA 1U1OA 2CQ0A 4IFVB 2GW8A 1QE1B 5HBMA 1FJCA 3C6TA 2DGOA 1FEHA 2E5GA 4DR4J 1S77D 4OX9F 3I6PA 1OQ3A 3HO1A 4RZRA 4C8KA 2QO3A 5F8IA 3AQPA 1IKYA 4B3MJ 3TVKA 3R7SB 3MMCB 4MKYA 1Y9OA 3L9ZA 5CQGA 2WSCC 2BRKA 1X9MA 3H2UB 2GIFA 3EGWB 3NCQA 3I5CA 4M5DB 1DTQB 2HQIA 4X2BA 4F4ZA 1JNRB 2X1BA 2ZBCA 3MM8B 4ZLNA 3W63A 4ECQA 4I2PA 4RW6B 2QL5B 2CJYB 3I9ZA 1UL3A 4OX6A 2BBEA 3OVSA 1H2TZ 4YMEA 3KLHA 4URSA 3AXKA 3QNWB 3OL8A 4FF2A 3LOUA 1WKJA 3AJ2A 4B3OB 1T03B 4JB8B 3GYXB 4WXOA 5KFMA 2QV6A 4ED0A 3N6LA 2D69A 4AXJA 2IFXA 3NMAA 4TY8A 2R8KA 4HTIA 2HURA 2CPFA 3RB3A 3V6HA 2LQBA 2ZBIA 3KHLA 4QJVA 3ZZTA 1YJ9S 2BDPA 4P52A 1X8DA 3JTNA 1RKIA 1TL7A 2VFTA 3K8WA 3WIUA 4DUZF 3RW6A 4OX7A 1XIQA 2RKIA 3I0SB 1SPBP 1TU0B 4FYWB 2N7CA 3LP2B 2A10A 2G13A 2U2FA 3K5MA 2DCLA 1Y4ZB 1CS4B 2MJNA 2MQPA 5HAOA 3BGRA 3LANA 5KFHA 4KPCA 4DHVA 1TL5A 4DL2A 3A1YG 4P9SA 3FBCA 1XNQF 2DRDA 1JLAA 3HVRA 2VQEF 5LJ3Y 1FXLA 4UZCA 1ZOTA 3DXSX 3FCVA 3GU0A 3OLBA 1S9EB 1T9TA 3A3NB 1C0TA 1Q8LA 3DM2B 3IWXA 3ZTQA 1HW9A 2NSCA 3I87A 2HQDA 2XY5A 2QLJB 1Q7LB 5IZHA 4IQXA 4U7UK 5MLCV 2UXBJ 2YNIB 4NRTA 3BO4A 1TV6A 1NLKL 1S49A 3KWMA 4LF9J 2UZAA 3MD3A 3U1MA 2KDOA 3P5TL 1RT1A 2K1RA 1BD6A 4IDKB 1RAHB 2GGPB 3QJJA 5K8NA 2JVOA 4LFBJ 4NLOA 3IS9A 5CYMA 3G4SS 1XERA 1K73T 3RBDA 3LGHA 5LJ5Y 2DGWA 2R3VA 4R25A 1U1KA 2APOA 4AFFA 2SXLA 2IC3B 3SIPB 1I3OB 4CH0S 2HLUA 4NI2B 1ZETA 2UP1A 3G8TA 1S5ZA 2M9KA 5HMYA 2VQFF 1X4GA 3D5MA 2NYHA 5J2MA 4IOBA 4KH0B 1WSRA 4L74A 1IQTA 1JQGA 2OO4A 4KHPF 1JK9B 5J2NB 3EDQB 4X62F 4U9RA 2DNGA 1SIZA 2R8JA 2DIVA 5U47A 3POTB 1MMDA 1YK9A 4DN9A 2Y8YA 3SZ2A 3A3OB 4B08A 1JLQA 4NLPA 4L75A 1VBZA 1VQ9S 3MDFA 2K8GA 1H38A 3TR5A 4WIQA 2I5JA 2G2OA 3OTOJ 5I3UB 2XI3A 4LSLB 3BBCA 4MYUA 3PX4A 3OSPA 5JXSA 3TEGA 4A8KA 2M88A 1FA0A 2YKNA 3DRRA 4DL3A 3V6JA 3CJ2A 2FC9A 1FJGF 2YX1A 1B0VA 2WW8A 5LOQA 1UVNA 4QYRA 1VMBA 4EYHB 3OV7A 2LU2A 5F8NA 2RS2A 1KLNA 4ZMMA 4PQUA 5ETOA 1B64A 2XHWA 3F0NA 4QU6A 1D9FA 4J9OA 3I4HX 2FVSA 1SC4B 5KT3A 4M5HA 1QTNB 3CJ4A 5L1LA 1WI6A 1FXRA 2XMJA 5EDWA 4NX9A 2I2YA 2EC2A 4JI7F 2KYZA 3OTDA 1TKXA 1U1MA 3D54A 2MZRA 4LR8A 4XO0A 2LXUA 3KJVA 2XTJP 3QGGA 3KLGB 1MWYA 3QMQA 4ALZA 3MR3A 5KFSA 5HP1B 3OW2R 2Y8WA 2GA7A 3UD5A 3ICLA 3NBPA 1RHMB 5DM6Q 1FNOA 3ET6A 1BQNA 4DR2J 2IDLA 1SI9A 1YITS 6FD1A 2LEPA 1PC5A 3P8BB 3OFGA 3MUVP 2HNDA 2DGVA 2MMYA 4YS2A 2AT1B 1G3OA 3K0JA 4FNIA 4YHHF 2VFVA 3G9CA 2IJRA 5H1SV 2B51A 2COLA 3UVJB 1K0VA 3EICA 2ASLA 2YWGA 3W2VA 4DLEA 1IUJA 2YKQA 2YTCA 1KTQA 4ZK7M 4MIWA 1N4LA 4DV4F 4ZVFA 2XLIA 1BUXA 2XZDB 2UUCF 1F1BB 4C98A 4DFKA 3NWRA 3T41A 1HNWJ 1GXLA 4RW4B 3D6FB 3MAHA 4F0KA 2ZUAA 5HQMA 3GFZA 1R8BA 3ISZA 3DI6A 3T1HF 4BS2A 1VDHA 2G1DA 3DDIA 1QVFR 2IPOB 2EBGA 4TLQA 2FTRA 4CM2A 5D8HB 3I96A 3TW0A 4UQGA 2WTFA 4JYAF 2MZJA 1XK8A 4ZIWA 3S8SA 2VU5A 4NXMF 4ZVGA 4NLGA 3DOMB 5HATA 3NAHA 4UOCA 4JV2A 3KK1A 4RU9A 2WZ1A 1H98A 1HWIA 4DPWA 1N54B 1T9XA 5DG7A 4LRBA 1DBDA 1SJQA 1UTAA 1NH8A 2NPIA 2VKZG 4ED8A 2BE2A 1JB0C 3J7A1 1LW0A 4ZP9A 4U67Q 3MAAA 4LF7F 1GT8A 1RAOA 5C25B 1PYTA 5EHHA 2CQHA 3HHLB 1D0EA 3M2VA 2YKMA 3LP1A 2IBKA 2UUAJ 3CO0P 3LA0A 3OL7A 1FRXA 1BLUA 3P4UB 4LFAJ 1BE4A 1JLCA 3W64A 2LECA 1L3UA 1YJTA 2DO0A 1F2HA 4QCLA 1IWGA 3JSMA 2AJ4A 3EVOA 2IM0A 1JKHA 4DX8H 4IRDA 3OQ2A 3M8QB 3MM7A 2HHPA 1RZMA 3MMCA 4IH6A 4KBIA 1R3NA 2DGSA 4K4YA 4QW9A 4AD6A 3H40A 3T1YJ 4BC9A 2EKNA 2HGMA 4FPIA 4DFJA 1UEKA 1RWKB 1U4BA 4M5DA 2R42A 3RZAA 2E5JA 4RW6A 4F67A 5D4PA 3MPUB 1CJTB 4E0DA 1FHTA 3HKWA 1HD1A 2AZ1A 4WZQA 1RT7A 1HBOA 5D4NA 2V8VA 4GC6A 4M5LA 4WF9Q 2PE8A 1I94F 3R27A 3BKUA 1MROA 4I69A 5T7LA 4IYQA 2YY3A 3S1TA 2ADBA 4ZP7A 4I6YA 3QYYA 4RL1A 5HMZA 1QTMA 2GHVC 4LF5F 2JWNA 3NKYA 3DDKA 2I38A 3ENAA 1LW2A 2X3GA 5EUHA 3HF5A 2YNGB 2MQQA 3DGVA 4YY3J 1KQSR 5DQIA 2IVMA 4MMOA 4B3TJ 5F0WA 1HYSA 5FDLB 1H3DA 4CI0B 3D6TB 2D74B 2FHOB 3TAQA 4DV0F 3LP2A 2ZZNA 1CS4A 4L72B 5IC4B 3QIDA 1RABB 2RF2A 4JI1J 4LF8F 2G0CA 5E3AA 1WACA 1Y5LB 1LEOA 2XCAA 1I51B 1S76D 4K4XA 4X4RA 2M3DA 4O44A 3C3LA 2OSQA 2NR0A 1T9UA 2OEJA 4NA1A 1DLOB 2GHPA 3BB5A 5KFXA 2BABA 2DT9A 1U48A 1LFPA 3ZTOA 3DM2A 3WQPA 1D09B 4Q8FA 3I4PA 2RSQA 2ZH5A 5DDQC 5FIIA 2DGQA 3ZXWA 1YKWA 4KV8B 4WP9A 3CDUA 4WYWA 3K5OA 3CCZA 3OXGA 2E5HA 1FVSA 2MQMA 4TU8A 1N5YB 3VAHA 2E9TA 2W7AA 3AHPA 4O3NA 1YGYA 4USMA 2D9PA 1S1UA 3A3PB 4OJHA 5KFTA 4X4UA 3EMTA 5CD4H 2VZ9A 1T95A 4Z7CA 5ETVA 3QT8A 4MIBA 4Y28C 4OI4A 2GVDB 2C3PA 2V2KA 4A4JA 1K1QA 4FYDA 5I3PA 1HR0F 2LA6A 1UFLA 1VR6A 4NI2A 2AYEA 2HRUA 3MR6A 4KSEB 2V8HA 3M2RA 3V4IB 1LOUA 1PJ7A 4WZMA 2J76E 2RJZA 4P73A 2VPZB 3AB4B 1PJ5A 3PV8A 3HZEA 1AFIA 4PG8A 3NS7B 4OHYA 1S6QB 1FK9B 1SQFA 1U1NA 1V5IB 4BC7A 2KM8C 3BKTA 5LM7E 2EI5A 1K9MT 2EW9A 2R4FA 3CD7A 4OX9J 3T6BA 1SJ3P 5DETA 1L3SA 1NK0A 1V3ZA 2W9BA 1H7XA 4XK8C 5A2QY 4ED3A 1FDDA 4KKOA 3DLHA 5CABA 1RAFB 4TU9A 2O66A 2FVPA 2FYXA 1F9EB 1KR4A 2VBXA 4OV1A 1J2VA 1M0SA 2FPHX 3IG1A 2BKNA 2EEYA 2FLNA 3Q8RB 3PACA 4USJC 3AH6A 4NCGB 3QAUA 2P8IA 1IBCB 1MU2A 4PG5A 3CCLS 2ZUGA 1BMQB 3IC1A 1ZA2B 1U0HA 3QGPA 2NPFA 2CAJA 1FWKA 3VZHA 1LK7A 3ILJA 1KBRA 2DCUB 2J0SD 1MG7A 3MF5A 3A12A 2HHVA 1WTBA 4DZ6A 4X65F 3MOZA 5AXLA 1OSDA 3V81B 2JLFA 2CKWA 1FESA 4B3RF 5DO2A 2K06A 1CULB 4USVA 3RRHA 4MK7A 2LDYA 3DLEB 1JLBB 3L7PA 2HBYB 3FCHA 4A48A 1VQMS 3VV2B 3ZZOA 3NNCA 1OPZA 2O3DA 1O51A 4G65A 4WP8A 1VQLS 2KZMA 3PR5B 4CH1A 3NY0A 1UZDA 4ECTA 4DUZJ 2MKSA 4HL9A 5B0FA 3S6EA 3NGKA 1Q7YT 1WOPA 1LWEA 2PSZA 3DRPA 2FHJD 1EJ7L 3M8PA 5EWGA 3EYZA 2CWXA 4EUVA 1H74A 3KLFB 4TQSA 4KYZA 1RT4A 2DVIA 3EDRB 1XNQJ 1RHQB 5D77A 3I55S 2F8HA 2VB6A 1U2CA 4RW9A 2JHEA 2EBEA 2VQEJ 1HW8A 1WC5A 4BCAA 3UNGC 4OHVA 3R6GB 1R27B 2V8DA 2QSWA 4WCEQ 4Q8EA 3HHDA 3M6WA 4OJGA 2HHUA 2QYGA 1RADB 3UCZP 1JLEA 3LW5C 1AUDA 3SCKE 3H0PA 4ZP6A 5K14B 3ILLA 4RPFA 2W2NP 1YQHA 2R2UA 1D9AA 4I68A 4GKJF 1OYDA 2NZCA 2J6UA 3WC2A 4CO0A 1AFJA 4A47A 4KFBA 4M5NA 2HFVA 3KK3B 3CJQA 5HLFB 4LR7A 1YTYA 1ULRA 4N5SA 4HI2A 4DQRA 5JVHQ 2V8PA 1ELOA 4U8VA 2MTLA 1M90T 2JFKA 4N56A 1T9WA 2EFNA 2RUGA 3DHXA 3H20A 3TANA 1VRTB 4Z2XA 1VQNS 3CCVS 1K8AT 2QA4G 2J9CA 4FPRA 1HNZF 1RA6A 3L7OA 1HNIA 4NPOA 3BGFA 2M7SA 2KVIA 2CPZA 4L6V3 2MGZA 5DGAA 1DTTB 5BJRA 2WOMB 4G1QB 2CJBA 2DIUA 4PEOA 2A2DA 1VCTA 5A8RA 2X7IA 1VC6A 4M5JA 3QSYB 3IGVA 3LH2S 1ZBTA 3FSYA 1ZAXA 1S57A 4NCAA 4X62J 2Z4PA 1NZAA 3CDBA 3HHLA 5IQQA 1VOMA 3J7ZT 3CT9A 3BR9A 4FVMA 1X4BA 3MTKA 1RAAB 5ETPA 5DQGA 5D6GA 3PW4A 3UDVA 2VG5A 2NS1B 3DOKB 4OX8A 3O2IA 3QJLA 2ZNZA 3KK2B 3FQLA 3T5LA 3HPOA 3AOAA 4RNOA 3IWNC 1YZ7A 1SV5A 1CVJA 1NB7A 1S72S 4ECZA 4ETZA 2CQDA 3DRSB 2CADA 3M8QA 5D0EA 2XCPA 5CHCB 4F4XA 2Y1LB 3TEHB 1FJGJ 3R3TA 2RRAA 1Q5VA 5KAKA 2JC0A 2CNOB 2ILYA 1YJWS 1KWMA 1CJKB 2RAQA 4P71A 2UU9J 3ZNUA 2YX4A 4JI7J 2LP4A 5HJYA 4HACA 5F8GA 1SH2A 3QIPB 2CZ9A 3HI9A 3SFUA 2CJQA 3SCLE 4ZVOB 4OI2A 1S1XA 3H5UA 2EFGA 3OL6A 1NO8A 3ZTRA 1RWNB 4JI0F 3UD4P 2Z2LA 2ZH7A 2MKKA 4KPYA 3HP6A 3QT6A 4NLWA 5ETNA 1NJWA 1ITPA 2EKYA 3WBZA 5GAEI 2YNGA 3A8KA 2OSRA 3FSIA 3BGOP 5CYQA 2HQCA 2OFHX 2G0IA 4ZPBA 5FDLA 1VK8A 5ADZA 2Q1LA 4W92B 2QX0A 3PW0A 2MZTA 4A8FA 2I1RA 1WHWA 1B70B 5E7OB 3K59A 4F0HA 3IBCB 3Q8PB 3FJ2A 2XNRA 4ZHRB 4F3QA 2FVQA 1CC8A 1SBRA 4X4SA 4PXEA 3FRZA 4CH7A 1UCNA 2VG6A 3C6UB 2OELA 1S12A 4DV4J 4P7TA 4ELVA 2ROGA 4LBPA 2UUCJ 4YR2A 2XYGB 1MNEA 1UFKA 3EGZA 3BREA 4C9DA 3TJ8A 2Q3PA 2NUHA 4GO5X 1IXKA 2FZCB 3THVA 3DHWC 5KFDA 4R5PB 2XO7A 3QLHB 4KHMA 3AB2B 2M4MA 3FZBA 4YEAA 3M6XA 4JYAJ 4YFUA 1Q8IA 1N5YA 4P2XA 5KG3A 4FVCA 4QZVB 1E6YB 2V4JB 3QWUA 2XGQA 2ZDPA 3TA0A 3PX6A 1IKVB 1XNRF 1X31C 2BUNA 4CT8A 4ZKAA 5DDPC 4USUA 2V94A 1BHNA 2IAJB 5K8PA 1B7YB 2AF6A 4IG0A 3OHBA 4MKBA 3KUGA 1F3FA 3HZGA 2GQCA 4NA3A 2DB1A 4LF7J 4HT7A 3HDSA 2V9WA 5KFKA 2XS5A 1HA1A 2HVEA 2BZ2A 2WAQD 5C5JA 1ZAWA 3V4IA 3MR2A 3VVTA 3HHNB 1WI8A 3KNGA 3VWSA 4U7UD 1UZHA 3M32A 3SXLA 2V67A 1S6QA 4PZVA 1FI4A 3MEEA 4DV5F 4WFZA 2XULA 1ZH5A 2AIRB 2LQ5A 1S97A 4O3RA 3C14B 4ZPVR 5BYRA 3PYFA 1BQMB 4WE1A 1IQZA 1WC1A 2CJ9A 3VAJA 5KFIA 3HHKA 3E01B 4J5OA 2KZZA 3W60A 2HVZA 1CLFA 4GKKF 2DY1A 2R7WA 1XWLA 2K3KA 4EBCA 4JV5F 1UW9A 1Z2LA 1KLMA 4DSFA 1GX5A 2GIRA 2PGCA 2AKWB 1UVIA 2RDIA 4A8MP 2DNPA 8RUCA 2FHKA 4DSJA 2WHOA 3WDOA 5DLGA 2R7UA 1F6TA 1L3KA 1YRTA 2E66A 2E5LF 3M8WA 2PMHA 5E3PA 3U27A 3CNQP 1QJHA 3HK2A 3VALA 3VGTA 2H5EA 4M8LA 4LF5J 2MY7A 3IAS9 4FF1A 4JI6F 3H4BA 4F4WA 3B78A 4DPXA 4KGVB 2MPUA 1GFWB 2JEGA 1ROFA 3J7YU 4JI5J 5E5NA 1NNDA 4NLYA 2ZE2B 4USHA 4WYLA 5F8LA 4DV0J 3TVYA 3KLIB 5DDRC 3VAFA 3JQKA 2MZSA 1SC6A 5D15A 3CJ5A 1VHFA 4N8OA 4LF8J 2DHAA 3BSNA 3OVBA 1KHVA 2NSBA 4RR5A 1RA7A 2QN6B 2ZOFA 7FDRA 5DGBA 4K4VA 2ATLA 4LSNB 1GXUA 3DOLA 4PUOA 4FN5A 3RR7A 3G82B 3N9UC 1PBUA 3MCSA 3CCES 2ABYA 3OFEA 1LV5A 1RWUA 1U7LA 5L8RC 3OT9A 4C7QA 3KK3A 5HLFA 2KT3A 4ED5A 2FHMA 1VLOA 2RMLA 2VD3A 4DV1F 1D9DA 4I2QA 3HD1A 2AYGA 5C24B 3GV8B 2WONB 4LRAA 1NU4A 3H2LA 1NDKA 2AEMA 4RUCA 2E1MC 3CSKA 3SQOP 3ZNJ1 2W25A 4RNNA 4MTPA 3DLKB 3G8QA 1Y7PA 2QA2A 3M6UA 1JX4A 1VRUA 2P5VA 2EFPA 2W2OP 2ASJA 1HARA 1HR0J 2C2EA 1VQOS 3QFHA 5GAHU 3QAEA 5BXIA 1OO0B 3U7JA 1UFWA 4UOFA 4FBUA 1WKLA 4OZ5A 2WOMA 4NMXA 1GXTA 4O3OA 3R6LB 1MN7A 2B43A 1RT6A 4B9VA 1WC0A 1FKOA 2DH9A 2OEKA 5C42A 1TL1A 2NYIA 3KFWX 2CQCA 1RJJA 1VFJA 2W4DA 4D3GA 3DCAA 3PZPA 4LRDA 2BJEA 2DISA 2ZJPQ 2OHDA 3CDAA 2BJ8A 2QYCA 4B9SA 3M8ZA 3KNAA 3DOKA 4IFYA 3AAWB 2V2VA 3UN2A 2NUUG 2J9DE 3RGIA 1X4FA 4P10A 2E9ZA 3M7VA 1M1GA 1EETB 4ICLB 3W5XA 5KFQA 2FHJA 1NSPA 5DRKA 2XYHB 2FJVA 3GTYX 2LDIA 3MMBA 1RWXB 4Q44A 2AEJA 4DV2F 4X65J 4ES1A 1TAUA 3GSIA 2W9AA 4ITSA 1S1WB 1RWMB 2A6MA 1R31A 1TZ0A 4CLSA 1VGYA 3PYGA 2QT7A 1HQEB 1GMWD 6FDRA 2B9WA 2AYBA 3M30B 2WB4A 5A8WB 2KJVA 4FYXB 2GAGC 3UCGA 1HI8A 3FMWA 1JJ4A 3AT1B 4L73A 3NS5A 3E3XA 2CDRB 3M4XA 5J2PA 4DL6A 3FDSA 3OTEA 3AA8A 4X4NA 4TN2A 2QEXS 1Q5YA 2BKPA 3EM1A 1YZ6A 2XY7A 3NGRA 4DF4A 4WP3A 2J6SA 4DPUA 2D3O1 2L9WA 5DG8A 1F60B 3JTOA 3TUJC 2C2RA 1RISA 2PO4A 2IJNA 1H0HB 1JJ2R 2VASA 1XJWB 1L3VA 2QC3A 1NMEB 4Y2IA 1WSVA 4UW2A 1KSPA 4N8NA 1IN0A 2CDQA 3MCOA 1W26A 3UPFA 2KRBA 4LFBF 3E2EA 1C1CA 2OPQB 3D0GE 5ETLA 4EZ6A 4AQYF 4EYIB 2MQ8A 5EWEA 2B9EA 5F9NA 2FJDB 4E8UA 5HSPA 5GMDA 4L3NA 3MURP 3SSQA 2CJKA 3C6UA 2VPXB 4ZDNA 6AT1B 4I56A 2HS0A 4JUZA 2RT3A 2QIFA 1H7WA 3MECA 4GKJJ 1Z4UA 3V2UC 2RHSB 2YNFA 2PEHA 4ZVUB 3CJKA 2RHQB 3D6HB 3KLEB 2IM1A 2VV5A 3BQ1A 2NQPA 2IYIA 4S0MA 5HANA 2VODA 4LBIA 2R8HA 3VAIA 1U1RA 1U0SA 3O44A 4CIOA 1WD6A 4N41A 4PKDB 4WKRA 3K2YA 5B0AA 4DS5A 2IYGA 4B9UA 3I9V9 4KGZB 4NEZA 2LA4A 2RIJA 5KFLA 4K4TA 4IRKA 2PEBA 4J9SA 3SDEB 2R2SA 2IVFB 1RI7A 1Q86T 2X51A 2R7OA 1PAUB 3D3CJ 1HNZJ 4DR5F 3BEGB 1VK3A 3SBMA 4DPYA 1S10A 3H5XA 2O01C 1G4CA 4F7VA 2BYCA 1YI2S 4LQ9A 5HVGA 2WVFA 1HNXF 3UN3A 5GAEU 4FS1A 5LMNF 4XTTA 1MWZA 3IRWP 2YWWA 2GV1A 2CVEA 3RAQA 2ZM6F 5KG1A 2XZWA 1JXEA 3CE8A 5KT5A 2YQ3A 3J81Y 2DGUA 2DXDA 3UW1A 1OWXA 2MQOA 3C15B 3I5AA 5J2QA 4ZPDA 3F73A 4HR2A 2KG1A 4OYMA 4CP5A 4R8UB 1P27B 2MLYA 4UF4A 4B3SF 5F9LA 1YJVA 2IVYA 2VG7B 5IC6B 3EGVA 2JEIA 4DR1J 5CYJA 4IQMA 2HNYB 3QRRA 5GADU 4C11A 2F65A 1RDRA 1SJRA 1FD2A 3NGDA 4RW7A 2XYPB 1N5QA 3VGSA 2M70A 1MSWD 4YDDB 1N5VA 4K4SA 2RB7A 4DR2F 1NDLA 1JLFB 3ZO7A 2N3OA 4ZVHA 3HULA 2D3UA 5EGYA 2EWHA 3Q8QB 4QWBA 2BVZA 2ZBQA 1NJIT 3D1QA 3P45B 5GAGU 4DDFA 4H4OB 3RAXA 1V3RA 4RX6A 3L7UA 5HI7A 2PT0A 3MM5B 3PHTA 4PG4A 1W2BR 2HEKA 1TQLA 1TVRB 1Q82T 3CIMA 2C2DA 2DBBA 1WC3A 4O4GA 3HLUA 4UOHA 1NSAA 4JI2F 2HWHA 2BW2A 1AB8A 3FGVA 3GIKA 3GP9A 2F5GA 3CB4A 4F3OA 4LREA 2BRLA 5DG9A 1RT5B 2OPPA 2QLFB 2ZE2A 1S1VB 5DZ6A 4ECWA 3D4JA 1C0UA 5KFFA 3MMAA 3QQCD 4MT1A 4U6PA 1CEZA 3HCXA 3OD2A 1T05A 2BANA 1SIWB 1WG1A 1YBAA 1SJFA 5AT1B 4Q2MA 2ZOGA 1QLNA 2Z57B 3W1YC 1KNZA 2KJWA 3R2CJ 2GC8A 2R7XA 1S0VA 1N6QA 3IWLA 4MFBB 3MR5A 1E6VA 3PRDA 4J7CA 2XWYA 1WEYA 2DNNA 2ZH3A 1TUWA 3J7AN 4OZ2A 5ETQA 4WKYA 3GFXA 4Y65A 5L1JA 1M5HA 2XMUA 2V6AA 4LSZB 4IH7A 4C0BA 2CPYA 4ZLLA 2HNZB 2W7PA 4YQWA 2C1EB 4LF6F 2XB2D 1IKWA 3TO8A 4LFAF 1XNRJ 5HL7Q 3ILOA 1DQ8A 3C66A 3JAMU 2XZTB 1HPZB 3KHGA 3FQKA 3GIRA 3DLKA 4C3LA 1LKZA 1QAYA 2IM3A 4YOEA 4K50A 3X3UA 1UJ5A 3HSGA 2J9DA 1R8AA 4RBVA 3W66A 3GYNA 4PWDB 2DPIA 3GZ7A 4LF2A 2BKOA 4DV6F 5D4LA 1HKAA 1FF2A 2CQ2A 1OMSA 3MUTP 4NLDA 4DV5J 3TJ9A 7AT1B 4X4OA 1NHVA 1BWEA 1X5TA 5JMNA 3B82A 3BBFA 1KDNA 1F9FA 2ADCA 3OSNA 3FFIB 3MEDA 2H3EB 3BN7A 3PCOB 4O4RA 4DU7A 4DV3J 2YNHB 2QFIA 4KTQA 1T0TV 2KT2A 4CO3A 3R9LA 1FKPB 1X9WA 4YP3A 2F9JA 4GKKJ 3VGUA 3CCJS 2CVIA 1RAGB 3HVTB 2LQ9A 2GVZA 4JV5J 3PDNA 2HHXA 2XSJB 3ETMA 3MM6B 1N32F 3HT3A 3OR1A 1HWUA 1U26A 4DFMA 1FRIA 3KOAA 3MMJA 3J80Y 1RYSA 1M5KC 4YB5A 4CO4A 4CYUB 2UVVA 1QUVA 2C2NA 2E5LJ 2X1GA 1TK5A 5CAAA 1HQEA 3CMQA 3BPDA 2HS4A 2M8DB 1NBEB 3LQVA 2OIHA 4PR6A 2DY9A 3GFYA 4PXBA 2E7VA 4QR1A 1SKUB 2DR8A 3CIZA 3VAGA 4GVBA 4UUXA 2HHSA 2B6AB 3CDEA 1FJ7A 2W01A 4U7CA 3DLGA 4I7FB 1AZSA 2W8LA 4ID5B 2BQRA 4KIAA 2VBYA 5D0HA 5IM0A 4FP9A 2AW0A 1M5PC 2Z56B 1NRKA 4MKVA 1PJ6A 1G1XA 1V6HA 1B7FA 4J9KA 1ZS6A 1BQXA 2W2PP 3TAMB 3GJSB 4Y2AA 5K20B 1C1BB 3EVWA 3UI3A 1FNMA 4D3HA 3HXMA 3W7BA 3K5LA 2BJ3A 1TK8A 3VHQA 3OR2B 3DRYA 2HSEB 3C46A 5IOLA 5D3GB 3BR8A 2HFZA 2LVWA 3OFFA 4ZPAA 2QFJA 1RHRB 3PYEA 2MDAA 1GMVA 1JLGB 1I1GA 4JI3F 1WEZA 1YSJA 2FJWA 1H2UX 1ZM3A 1ZPWX 1SC1B 2B5JB 3PXGa 4I67A 1JXVA 3SQGB 4QWCA 3KLEA 1IJFB 4WK3A 3K8VA 4DV1J 1F2GA 1KHWA 2KFNA 1XR7A 2AD9A 1CJVA 4Q5VA 2P9EA 4PYAA 4F50A 2HVDA 3CCRS 4C8MA 3V6DA 2DHXA 5KG0A 1IKXA 2MKIA 2M2BA 3PJ9A 1RTZA 3IGNA 1DURA 2H65B 3ITHB 1YRUA 4PQAA 3SDEA 2VA2A 5A6PA 4ZVEA 1LWCA 2JC1A 3E8OA 3LAMA 4UZBA 2OI2A 2HK2A 4EBDA 2C3UA 2EPIA 1TL3A 2M8HA 1U6BA 2BMBA 4OYAA 3LP0A 2GQQA 4K4UA 5HVFA 4CLPA 2LQJA 1X5OA 3FNNA 2ZD1B 3DRXA 3ZZZA 5KT6A 1RT3B 3CULA 4ILLA 4ANEA 3EXCX 1AW0A 2FJXA 2XMMA 3OXLA 2PDAA 2G2ZA 2XHCA 1Q78A 1U6FA 4GRSA 4EZ9A 3C19A 1R0AA 1S4FA 3I82A 1GMWA 4TQRA 2GMLA 4LRFA 2VJVA 4ILMA 1RCOB 5HROB 1B0PA 1KN6A 5KOWA 3HT0A 2D3ZA 2MQLA 4RBTA 1EX8A 4FNHA 1U8SA 1RU1A 3WIVA 1HQUB 3TX8A 2V69A 2HFUA 4ECUA 3C16A 1RGVA 3KXDA 4NLUA 4BDPA 4BLGA 4OZLA 3BKFA 3MEGB 1U47A 1HBUB 1T9YA 3F56A 3TUIC 3K7RA 4XAKA 2WBRA 3ZZPA 4HDHA 3RYLA 4DV2J 1S6PB 1X0PA 3D1HA 3ENVA 1Y0HA 5B08A 2DXEA 1W7WA 2IRXA 3OJSA 4Q0BB 2RDDA 5GMEA 4CM0A 1CG2A 2FJEB 3OHAA 3PFOA 4IG3B 3FK4A 2C3MA 2EVZA 1WOOA 1HBMB 2BM1A 3MM9B 4CZCA 2KH9A 1N36F 3RBZA 5J1NA 4NYZA 1HBNA 1P6TA 2XMWA 2YWEA 1M5OC 2CPDA 5EX0A 5G4DA 1Q4RA 3NP5A 4QPTA 4OFZA 3JXOA 2VIHA 2MHNA 5CXTA 4MKAA 2XC9A 4O3QA 2KHCA 1R89A 3OL9A 4YUDA 4HH1A 2F4VF 1RTIA 4NE9C 1PC4A 2VICA 2AGOA 3EGNA 4NLXA 3HFKA 5ETKA 4AQYJ 1TKZB 3Q8UA 2C22A 4PG7A 1IBMF 1NK8A 2BR0A 4F4YA 4OZJA 5FD1A 4PABA 3PTWA 1NJZA 5AE1A 2OLWA 1GEHA 1REVB 3RB6A 1G2EA 3G8SA 2OEMA 3JSYA 2HVHA 1ZA1B 2PD1A 4KO0A 4DG1A 3KLVA 4X4TA 2JSXA 3QT5A 3R5AA 4B9TA 1EP4A 2WBMA 3KUEA 3RR8A 5I42A 2HS3A 2P6TA 1X4DA 4J9QA 4WBFA 2FC8A 4ELUA 4GMKA 1N8RT 4ZJQA 5IT0A 1YJNS 2V50A 4LIRA 3NRBA 1UWBB 3PJXA 4MH8A 1JJCB 1D1UA 4P7VA 1VC5A 2K2PA 4DR5J 1KKHA 2B9XA 2ZHBA 4ZPTR 1AA1B 3FBBA 3DYAA 4ERDA 3CF5Q 2A1BA 5KG2A 1FD8A 1VLYA 2VL1A 4TYAA 2DNRA 1HNXJ 1QSLA 5G0RA 2UXCF 4EK2A 2OPSB 2UVUA 2ATCB 3G2XA 3I56S 4N77A 1LWFA 5LMNJ 1Q1KA 1Z2ZA 3GCWP 1NSKL 2HGNA 2EXUA 4ZN1A 2DR9A 4Y2KA 2ZM6J 3H2VE 4HDGA 2HWIA 3TNVA 2VPWB 5F8JA 2V4QA 5IV3A 2FB0A 2KB2A 2CNNB 3QJPA 3IO1A 1PKUA 3HHLD 5J1EA 3PRVA 5IWAF 1T3OA 2DTJA 3FEXB 4LF4F 4URGA 3E51A 3NMRA 2H5IB 4B3SJ 2RU9A 2D9OA 2UU9F 2ZHAA 2KTQA 1F3VA 4PPDA 2PC6A 2DGTA 3R8YA 3H5YA 4C48A 3CJSA 3D7SB 4LMZA 1YJ7A 2WSFC 1IBKJ 1DZ5A 2LEBA 2UUWA 2VUGA 2QA4S 2KXFA 4J9RA 3RJMB 4LRCA 2YNHA 1HMVA 1NDCA 3SSSA 4CLFA 5HBMB 3C6TB 1RTDA 3GG0A 1FFGB 3AOBA 1KP6A 4RJVA 1U25A 3HSDA 1DFDA 4NASA 1FE0A 1S0MA 4QW8A 3ZZ0A 3IR7B 4FYYB 2HBRB 4MYTA 1IKYB 3P96A 2NCKL 1OSCA 2Q6BA 2DR6A 2QSFA 1T7PA 3W9IA 1KOOA 1KVJA 2JOQA 4A8WA 3HD2A 4BWMA 4JV1A 3DMJA 3H8YA 4OYZA 2C2OB 2ZVSA 2GMJA 1AUSL 3U1LA 4NZ7A 4I2PB 4U96A 2JDJA 4JI2J 4LFCJ 5A8KA 3KLHB 3R5JB 4CTAA 3KDNA 4CLLA 4OZNA 4UOGA 3K58A 4AUKA 1PBAA 4YDXA 2MKHA 2NREA 3PY8A 2XS7A 3MUMP 2HHQA 5IT4A 3EZOA 2RRBA 3IA0A 4RNMA 2DR5A 2I6WA 2DR7A 1TMJA 1NK9A 4ZVQB 1MMLA 1PILA 2N82B 3LGMA 1TL7B 2J8AA 3FEYB 4DBQA 4ZLPA 3FSXA 3NEKA 1BC6A 2RKIB 4DSIA 4YB1P 2UUTA 3MTJA 1B99A 3BDPA 2E5IA 2P9CA 3GPAA 1I6JA 5HQLA 5IQ6A 1GMUA 4QWAA 1Q8KA 4XDCA 2IRUA 1R6YA 1UPMB 3BGRB 3M6VA 1JLGA 2DITA 4QWDA 4ZS6A 4ZP8A 5L46A 3UO0A 4X64F 4DR6F 1JLAB 5KFJA 3T3FA 1TMMA 3CJ3A 5A6WA 1KFSA 5K8MA 2LMIA 2AYMA 1MWQA 1RBLA 2EC0A 2HHHF 3AXMA 2B7BB 4IFVA 1EAYC 1C0TB 4USKA 2Y3YA 1QE1A 1YWXA 4LF6J 3CVKA 3MPVA 3CD6S 2UUBF 2B3TB 2O67A 4EEYA 3IFEA 3D9BA 2CQIA 3ETOA 5F0UA 3A8JA 4KR0B 3PW7A 3PO4A 2R7RA 5LL6d 3ITHA 4WJBA 3CO9A 1WG5A 3GV7B 3FCWA 4ZITA 3SMZA 2YWFA 1RT1B 2K1RB 3W61A 1T94A 3PX0A 1EQ0A 2NXEA 2AX0A 2V8GA 2IRYA 5EX3A 3IS9B 4DV6J 1DTQA 4JI8J 4Y2MA 1S9GB 3O8WA 3MM8A 4USTA 1TK0A 2NXNA 3Q24A 1Q79A 1OY6A 1RU2A 3MD1A 2Z30B 5D0RA 2CQPA 1LWXA 2CZVC 1U24A 1Y3JA 8AT1B 4EFAC 5JJBA 5KFZA 4B3OA 1T03A 1Y00A 2N3LA 2DNLA 5HROA 1N5TA 3TUPA 2ACYA 5IT9U 2GFFA 2A3JA 4XDDA 3TA1A 2J7UA 1JIHA 1PO6A 4ECRA 4H4MB 3MCMA 2JRSA 1O8BA 1HQUA 4P2FA 5CZVA 2J6TA 4DL4A 3AD7C 4JI5F 2HFOA 1HFEL 1XC9A 1N32J 3ADAC 2DNHA 3I0SA 2CYYA 4UTGA 2HQ3A 3DXBA 5KFEA 4GC7A 3T5KA 5KOXA 2HG4A 1S6PA 1YX2A 4JP8A 3MAQA 1WOSA 4C8LA 3CJTA 4K2JA 4DSLA 3L4BC 1O0PA 1RT2B 3OBIA 3DRRB 1GK8A 2XNQA 4ZLJA 3BBBA 2BOAA 4HHJA 4PAAA 1S9EA 5HN0A 3GIMA 3H59A 3RRKA 3WC0A 2FQQB 4QIWD 4PQUB 3V6KA 2LEAA 3R5BA 2HRYA 2W2MP 4B9LA 1P1TA 3SYZA 1QDUB 4ZCMA 5E3RA 2EFQA 2GMHA 1WDTA 4G6VB 3TQEA 2YNIA 1CPZA 1NKEA 5KFUA 1IM6A 1TKXB 3LUYA 4F4KA 3O5TB 2DD8S 2M5YA 4DL5A 1G6BA 4E98A 4IDKA 2GGPA 1YHQS 2AV5A 4W4MA 2M0GB 1HWJA 1N5SA 3NBPB 2KG0A 4CWBA 1BY9A 3RRGA 1S0NA 4DSKA 2CWKA 2IC3A 4WFAQ 2B0GA 4QQBA 4JI3J 2R8GA 4ZPWR 3IBWA 1CJUB 2HNDB 4RNHA 4EGLA 2AEFA 4ZVRB 4CLKA 1R8PA 5GVQA 1HI1A 4NZ6A 3PO5A 4O23A 5HO4A 2F40A 4G1PA 3W8PA 4L76A 4EMDA 4DR3F 5J2NA 2FIUA 3W2VB 2C2MB 1XMQJ 4ECVA 4KE5A 2DH7A 2FLOA 3US5A 3GQCA 2H4YB 3POTA 5KFGA 4DPTA 3HVAA 1DRZA 5HMXA 4CNYA 1NZ8A 3TP2A 2ZFHA 3OPKA 4A46A 5KFCA 1MN9A 2I9SA 5KG7A 2CQ3A 3B4MA 2ROPA 4J9VA 1YBTA 4OQJA 1FRHA 3WZ0A 3FEZA 1T02A 2XBPA 3T9NA 1FRJA 2ZITA 3DI6B 5I3UA 4LSLA 4JOUA 2BM0A 3UD3P 3MR7A 3NG8A 3OTBA 3UWTA 1SJ4P 5HQ8A 4C8NA 1FX2A 4ECYA 5E3QA 2V63A 5LSRA 4RO0A 4FDFA 3UR3C 1R7IA 2AJ0A 1S48A 3KK1B 2VKRA 2HFSA 4K4ZA 2ZJRQ 1RAIB 3MEKA 4IO1A 4GVLA 5C2GA 3SCJE 3C8YA 3ZFVA 2U1AA 2XS2A 1RWWB 5THWA 4F2SA 3NS6A 2BE2B 1LW0B 1WG4A 4B9MA 3FMBA 3MAAB 3M9OB 3ELHA 4OI6A 2RQKA 3ZTPA 2JNJA 2J8SA 3TRGA 3UQSA 4IUFA 1OY8A 3BV8A 3KLGA 4ZIVA 4IOAQ 3H4DA 1NEEA 1RAEB 2X1AA 5HP1A 2YKMB 3LP1B 3CEDA 3HMJG 1GAOA 1NPRA 4OL8A 1B0TA 1NK4A 2DXFA 4B02A 3LO3A 1XMOJ 5CCMA 1JLCB 2YBVA 3L95X 1SJ1A 4ZVSB 1APSA 2AQ4A 3JSMB 4WIIA 1O6XA 4I6AA 4TU7A 2O5DA 1JKHB 2VOPA 3MM7B 5H9FK 4IR1A 1U02A 3D0HE 2JH3A 2ZBPA 4K4WA 4UY8T 2QLWA 1VBYA 4KGKA 5IT9Y 3UVJA 1N36J 3RB4A 3FRYA 4DL7A 3TZYA 3AA9A 4C3KA 1PYOB 2YVSA 5EWFA 1UA0A 3ENWA 4KB7A 4TVAB 1LXNA 1URNA 4YR0A 2OAUA 3TJAA 2VC1A 1KRPA 4A8XA 3FBEA 4USIA 3UCUP 2FD2A 3G71S 1PYSB 1RT7B 1HBOB 3GFHA 3BSAA 1FDAA 2HHWA 4RW4A 3ILIA 1MROB 3NNHA 2OGUA 1UVMA 1UKUA 2F4VJ 2AMCB 5T7LB 3R5DA 4ES3A 4CQ1A 2CQ4A 2VOOA 3KJFB 1VIXA 2YWHA 1IBMJ 1X5PA 1LW2B 4A8YA 4A8OA 2OD6A 1R0BG 1N0VC 3DOMA 1KONA 4M5IA 1HYSB 4PCQA 2YH1A 2LXFA 4DWIA 5IFMA 4NYOA 2RF2B 2NXUA 1LXJA 3HFZB 2E44A 3PKMA 2A0FB 4WU2A 4Y0FA 5C25A 3VF0B 3Q2SC 4O44B 3W5YA 2A6OA 3NOGA 2DNQA 1NB2A 2VFSA 1SUQB 3AJ1A 4LT6A 4RWWA 4OI1A 5I3QA 3H90A 3HHLC 2IMOA 3UDCA 1FRLA 2HVIA 2P6SA 4K0KF 9ATCB 2IDEA 2HQFA 2ZWOA 4OMFG 4CCHA 4NLQA 2BJ1A 4DQQA 2CZ4A 4ILRA 2R8IA 4DR1F 3BN4A 2PFFB 5DS7A 4CLUA 3QGIA 2E1PA 3KKFA 2UXCJ 4USWA 1RLDA 3N4WA 2KFYA 3KTQA 1HI0P 1REGX 2L41A 2HMIB 1S1UB 1KS2A 2F63A 4WPAA 3DKDA 3G6VA 1FERA 1U09A 1U45A 1NM2A 5B0BA 2RQ4A 1S9GA 5IWAJ 4DUYF 1X4CA 2JFDA 4LF4J 4CO5A 1CJTA 1QAJA 3D28A 3VAMA 2Y9HA 3ONQA 4NRUA 3ULHA 2Z8QA 1FTCA 1V3SA 1FNXH 3A8IA 3M2RB 1XTZA 2KM8B 1WF2A 1IWAA 2V34A 1ZTWA 2XY6A 3MFHA 3THTA 3LALA 2L9DA 2CFXA 2RD5C 1KD1T 3W3SA 4V19X 3I0RB 3QZ8A 4B9NA 3M05A 1VIOA 2DEIA 4H4MA 2B56A 2ZKUA 1KFDA 1VBKA 4RU2A 3D66A 1P9QC 1JXLA 3TUZC 1DHMA 2W9BB 4MJKA 4KKOB 2IA6A 2N7YA 4ED1A 3TX0A 5FJ4A 4CDIA 4OYIA 4ZVTB 2FZKB 3IG1B 1MMNA 4AL7A 1XR5A 2CQ1A 2J0WA 3W8GA 3VTIA 2ALZA 1RT2A 1MU2B 4U95A 3UFCX 4IOCQ 1U0HB 2HIQA 1DLOA 1S9FA 1VQYA 3K89A 2XMTA 4CLZA 3Q23A 2V4RA 3KHRA 5HK4A 3KMSA 1RKJA 4OYBA 1SCJB 3OLAA 2RQCA 1RHUB 5KFRA 2RVJA 2J0QD 4KV8A 1FX4A 1YLXA 3M9MB 1UA1A 2HLTA 2MJUA 1IR2A 1RYRA 4WU3A 2PMWA 3M2UB 1A9NB 3K5PA 4PXCA 2BQ3A 4NEYA 2KXNB 3NOCA 5KFOA 2DRBA 1LWEB 1C4AA 2KRRA 3DRPB 3IXQA 1L3TA 3M8PB 1TKTB 4NA2A 4AXIA 2GVDA 4KT0C 2OTLS 2MLZA 2UXDJ 1N34J 1DJ0A 2LXIA 2Z2ZA 2ZH2A 1VBXA 3M8SA 4RLEA 1RT4B 4OLOA 2JEJA 1CJUA 1U6ZA 2N4CA 4N76A 1S99A 4RW9B 4DR6J 1SH0A 4X64J 4EBEA 3IN5A 3QBCA 3R2DJ 1QM9A 4M63A 3IP0A 3CD5A 4YB6A 2VPYB 1U2FA 2MZ1A 1VRQC 2V68A 2HHHJ 2ZOMA 1FK9A 2F8MA 4YR3A 3SCIE 3KYLA 3CC4S 1YRXA 3MXHP 1JLEB 2Q43A 4ZJLA 4UT4A 2UUBJ 4FKXA 3VZIA 4BHQA 2HK3A 4AE5A 2QTWA 2EK6A 1VQ4S 5AXMA 4RWXA 2WK4A 5RUBA 4IKAA 4NWBA 4KFBB 1N52B 4KRWA 3B4DA 2Q66A 3GIIA 1Y5NB 2VFUA 3HHEA 4DV3F 3T9ZA 2FLPA 2ILZA 1FEEA 1XEZA 4Y34A 3RTVA 4NCGA 3CJ8A 3UR0A 3IRXB 1UWAA 1UPPA 1RQ0A 4IRCA 1HNIB 1J27A 1VQPS 1OJ4A 4ED7A 5A2QU 3WX4A 1PGZA 4I1TA 5ITHA 3V81A 3QWPA 4Y00A 1U8WA 2MGZB 3Q8SB 1EARA 2UV8G 1CULA 4A8SA 4WWSA 2W24A 3CCMS 5IS2A 3DLEA 5A8RB 1JLBA 3D1OA 2HKEA 3MI7X 1J5EF 4HVZA 2DNYA 4ES2A 5ETSA 3GV5B 2RS8A 2FLLA 4EO6A 5AE3A 5KT2A 1RWOB 1TL4A 4WFBQ 3UNYA 3LAKA 1EKRA 2VG5B 5DM7Q 3MZIA 4HLBA 1FJEB 3CDWA 3KLFA 5D4OA 4IO9Q 1EHWA 1SV5B 1ZYQA 2R7QA 2D7SA 3CCTA 3K17A 4LVOP 2HGLA 5D78A 4DS4A 4J9NA 3RBXA 2CNLB 4Y6IA 5E3CA 3LWMA 5CZXA 1SVDA 1U2RA 2FJAB 2KI2A 4QWEA 1HWLA 3EX7B 4WFYA 1ZM9A 2AWZA 5BYSA 3QO9B 5K14A 4ED6A 4FS2A 5SZTA 3AD9C 4JI4J 1RUSA 4RBUA 4YN3B 4NLSA 4HACB 1ZTTA 2H9ZA 4F04B 2QL7B 1DARA 2CRLA 2L48A 5B0DA 5AJ3F 1S1XB 2VBZA 1KQKA 4FXDA 1H2VZ 2C3YA 1YJRA 4DJBA 2LQ8A 3QRQA 1VRTA 1MW7A 3N5FA 3F44A 3AFGA 4YB7A 5L1IA 1UETA 2CUYA 1NHUA 5CYQB 1NK7A 2CPXA 3CTRA 5H9EJ 1VI7A 1S7HA 2MZQA 1DTTA 1CSJA 2GIQA 4C8OA 1K0TA 4G1QA 4QBUA 3V4MA 1SQGA 3BGUA 4TYBA 2R2RA 4DR3J 2ZNYA 3TYTA 3MGJA 1DQ9A 1FRKA 1VJWA 2B4UA 9RUBA 2VG6B 4ZPCA 4HYKA 4OYXA 2VBWA 2YX7A 1NCLA 1N33J 3VQSA 2OD4A 4WFNQ 4QPXA 3T5JA 1SUQA 2W8KA 3PIOQ 1T8EA 3TWZA 5C2CA 3DC2A 1HHTP 4DUTA 3NNAA 4ETXA 2E1RA 3QPIA 1EZZB 2CIMA 3KK2A 2HZAA 1Q81T 2B4PA 2B8QA 4FF3A 4KJIA 4QU7A 3CGIA 4KGMA 2Y1IA 2BEFA 3U02A 4ED2A 2H54B 3V5RA 5T14A 3DRSA 4QYZJ 4KH1B 3A4TA 3P6YC 2HRTA 3U1NA 1NJYA 2HMIA 3HSZA 4H54A 1S6UA 2C2ZB 3PVXA 4KGXB 3GE9A 4MIAA 2IBOA 2MEWA 1CJKA 4ZJOA 3EVMA 1PCAA 1UJ4A 2BV3A 4IG0B 4R0JA 3HVWA 2F1FA 4DLGA 4UY85 5M2RA 3QIPA 1D3WA 2Z2MA 3MOJB 2G1HA 3Q83A 1FFSB 2AJFE 3PIPQ 3J7YI 3BO2A 1P1LA 3H42A 5AXNA 4F36A 3M32B 1A0OB 4K5RA 5L9NA 3B6BA 5L39A 3M1VB 3EZ5A 2AZ3A 2L9NA 3MEEB 3EE3A 3I0RA 4P2SA 2ZZTA 4DV7F 4M95A 4P75A 4OYWA 2F9DA 5D0GA 2H48B 1IBLF 3O3LA 3QT7A 1S6OA 4I64A 4WE1B 3BYPA 4J90A 3GJRB 4O0IA 5J1PA 4DF8A 3BO3A 3B8HA 1QY7A 4J9LA 2JLGA 3DU5A 1IR1A 4FBTA 1X5SA 1HNVB 4A8QA 3ISND 3OUYB 2Z0GA 4ECXA 4ZHRA 1ZZNA 4ZCKA 1N56A 1KLMB 1Z1ZA 4C3MA 5LSLA 3ZZUA 3GR1A 3PKYA 3FBFA 1JMTA 1NSQA 2ASDA 4DFPA 4F02A 2NLWA 4CT9A 2QZ8A 3RUBL 3LGNA 2QMWA 4C8ZA 5KG5A 4CO1A 1HL6A 5ETRA 3TZZA 4NXNF 1R8CA 4R5PA 3N01A 1NK6A 4OI0A 4LVNP 1JWWA 3QLHA 1LFWA 1TUVA 2J9EA 3J7Z5 3CWJA 4J9MA 1QUPA 3PJWA 4F26A 3FC9A 1XMBA 3G87A 2ZH9A 3S01A 5LT5A 1KVIA 1WHXA 2WCXA 3M2UA 2V2QA 1E6YA 4NLRA 2V4JA 2IY5B 1S59A 2BX6A 3GR0A 1IKVA 1XR6A 2KN4A 4P6QA 5GAHI 3K5NA 3L3CA 5CA5A 2FJBB 1TKTA 1FCAA 2ZH1A 2IAJA 2ERRA 2K7KA 3SV3A 3DLJA 2FY1A 1GTEA 1OQ6A 2FVCA 3BH7B 4ELTA 3N0VA 3DN9A 1S1TB 1IR0A 4F25A 3D2WA 2F8EX 3DOLB 1RACB 4PUOB 3GILA 1HD0A 1BXNA 1VQ6S 4BWJA 2CPJA 1RTJB 4C0OC 4K0KJ 2GJIA 2XM3A 3C14A 2VDIA 4F2RA 1JNZB 1ZM2A 2CPHA 1BQMA 2MKJA 3MCNA 1IBKF 1FXDA 2HAIA 5LXRA 4ZOSA 4HEA9 1U49A 3HJFA 4B17A 4I2QB 4OLPA 3E01A 1EIYB 1SKRA 4Q45A 2QMUB 3PRBA 3PW2A 2KXHA 2DH8A 3KUHA 5AXKA 3NGTA 2DEJA 3S7RA 1K1SA 1V5VA 3NWGA 4DEZA 5KG4A 3I5BA 2CPEA 4C0HA 4DUYJ 3FZ2A 4U8YA 3IRXA 1UVLA 2FVRA 1NH7A 1VRUB 3VCDA 3CD0A 2YKPA 5ETMA 5DLFA 4QIVA 1RWVB 2RH3A 1FO1A 2VQFJ 1WWHA 4V19J 4NL5A 5DDOC 4ZVPB 4DU8A 2DHHA 3FVYA 1LQ9A 1WUUA 4W90B 3TARA 3KG1A 3N6NA 3R1LA 1RT6B 4WK1A 1FKOB 4G3IA 3RW7A 4KHPJ 2NZ4A 5F3ZA 3QGHA 4LFCF 1IVZA 3KJNB 5C42B 4LIWA 1TL1B 3MWBA 2MHEA 1H72C 2VJUA 5A0YB 2RU3A 2BXJA 3DGPB 1DY3A 3NLCA 2CQGA 2L3MA 2HZCA 1YIJS 5JVGQ 1WDDA 2DJWA 3H25A 3IMQJ 3TA2A 2W4CA 5B7WA 4IFYB 3PW5A 2FUG9 3KLIA 1IJEB 3EZUA 2LFVA 2YXLA 2J7KA 2G4BA 5L38A 5KFYA 1WELA 3TZWA 3IR6B 2H5JB 1VJQA 3TZXA 1X7VA 2D3OR 2AU0A 3GMGA 1NJXA 2R9LA 3D67A 1ACMB 2W9CB 1UEVA 4AL5A 2QG9B 2QA1A 3OXFA 3MMBB 2CPIA 4XPEA 4LSNA 5M2PA 3QSIA 3VR1A 4J37A 4RKUC 5SUHA 4DPOA 2OMLA 2D1CA 1RK8A 3X1LB 2O1PA 4Q2LA 1RCXB 3QFWA 2LKZA 3G82A 4M5KA 5CD4A 3GG1A 3GIJA 3QO9A 5BYQA 1NK5A 1FKAF 2HWTA 2W2QP 1Y5IB 2XO6A 2PI5A 1SB6A 4C97A 4KQZA 1ZZFA 3BYRA 1XN9A 1HQ2A 5DJBA 2P9GA 1O5JA 1EQMA 4ZN3A 5C24A 5J2PB 2WONA 3R5CA 3UE2A 3EJMA 2LYVA 5C7PA 3GWCA 2H51B 2Q79A 4NLVA 2OH2A 3EUNA 3N79A 3CJRA 4IR9A 2RDJA 2A18A 3BDEA 4HI1A 1OYEA 2EFOA 3BSCA 3BZQA 1W25A 2M52A 4OJ3A 2VONA 4I0WA 4QR2A 3RAMA 1FTRA 3ZZRA 5FLXU 2XI2A 4YHHJ 1C1CB 3AJDA 2ZKTA 3PM9A 4JI8F 1PSDA 3TOQA 4J9UE 2ZJQQ 1ICEB 1WC4A 3A13A 1RP5A 3BPSP 4DZDA 4P74A 3VGVA 1QAIA 4UUWA 1HIYA 3MECB 2IMWP 3GJTB 5GADI 2YNFB 2BQUA 1HHQA 3CJKB 2H1YA 1G7CB 1OIAA 1RHJB 3EXYA 2OMOA 1NKBA 3K57A 4OZ1A 1FT8A 2OPRB 2PMZD 3BQ2A 4O3PA 4AL6A 2MKCA 1EETA 2IJFA 3JTPA 1N88A 2KKHA 4ICLA 3T1HJ 4Y3CA 5B0EA 8ATCB 5H9FJ 4HT5A 2JEFA 2GZOA 1RTHB 2AGQA 3IM9A 2AX1A 5GAGI 2V0NA 2ACMA 2ZH8A 5KT7A 2WRMA 2ZWPA 1F9HA 2HW3A 4NXMJ 1UP1A 3M8RA 3R5GA 1S1WA 4DCJB 3JQJA 2OFGX 4K7QA 4Z7YA 1SXLA 1VYAA 3JS9A 2JL9A 2V2ZA 2G9OA 2UV8A 2H4WB 3N5BA 3M30A 3I31A 5A8WA 3Q8YA 1RBOB 2C3OA 4M94A 1NAQA 3VQTA 2MYFA 1J5EJ 1KOHA 2L08A 3BJYA 5L9XA 3JSBA 5BR8F 1CC7A 3RU0A 3D3BJ 4ANCA 5J2QB 1Q53A 2ZHOA 4O0NA 2LLZA 2B9YA 2B4VA 3M1VA 2HFNA 2B7CB 5LMUF 1N48A 2ZH6A 3LF0A 2BE9B 3PFEA 1N0UA 1FE4A 1PAEX 2YKOA 1FDNA 2R2TA 2DNOA 4DQPA 2MB0B 1B3TA 2ZEJA 4C11B 1Q16B 1RBAA 2FDNA 2PA3A 4RW7B 3W5ZA 1FRMA 2GAHC 2OPQA 4ID8A 1HNVA 2WSEC 2ZDOA 3SI8A 2E7WA 3OUYA 1BGXT 4DR7F 2PA8D 3DLBA 2WVBA 2DHSA 1Y3KA 1UVKA 5B09A 3R97A 3G86A 3SV4A 2DO4A 2EK1A 1F5BA 4HHHA 2YPYA 3KDOA 4TNOA 3JSRA 4LBHA 4X66F 2HHTA 2CG4A 1I94J 1ZAVA 4R0EA 5AJ3J 4MAKA 1XMQF 1X4HA 2G2YA 3Q2TC 5LSOA 4O4GB 2BA9A 4OJ1A 4LUBA 3JYTB 5DQHA 1TAQA 2Z2YB 3JQMA 1MLAA 3KJQB 2DK2A 3VVUA 4K59A 1RLCL 3GLJA 1D8ZA 2OPPB 4DSEA 2YWKA 2C28A 4C4WA 1C0UB 3CPWR 4KY3A 2KHDA 2MY8A 2KYXA 2IIHA 3MMAB 1S0OA 2HBZB 2XQCA 2Z58B 5JUMA 2OTJS 4J91A 2MQNA 3N28A 4H4KA 1T05B 2BANB 4FF4A 1SL0A 1YDLA 2IA0A 1KQGB 4C8YA 5DZ7A 4MK8A 4QIFA 2ZC3A 2CJXB 2LCWA 2R7SA 1S1TA 3THPA 4KAIA 3C15A 4H4KC 3NGSA 1YBUA 1N6QB 1ZPVA 2GJ2A 1OY9A 4R8UA 3MHYA 3JAMY 1VHIA 1E6VB 3G6ES 1KQFB 1RTJA 1SKSA 1TKDA 5KFBA 2XLJA 2MKYA 3PEHA 1LK5A 3EPGA 4RUAA 2VG7A 3BM7A 1EKSA 5KFNA 5B0CA 2XSFA 5EN1A 2HNYA 3DFEA 2ASYA 4M5GA 1YVFA 5FLXY 3RB0A 2AJ2A 5KG6A 1FWPA 4LR9A 3Q0AA 4FZVA 4I4BA 1D8YA 3J81U 2XG8A 2V5HG 1DAXA 3TQ1A 2UVWA 4TXSA 1IKWB 2NXJA 4KHRA 1JLFA 3CXCR 4DR4F 1WC6A 2XLKA 2GO9A 4CLTA 1XMOF 3W65A 1X60A 4TLRA 2DKOB 2CA9A 1VQKS 4J9PA 3CC7S 4WXWA 3VAKA 4CLYA 3KMQA 2VH7A 3G6YA 4B3MF 2NXCA 4HKQA 4H4OA 2ZBRA 4LQ3A 3KHHA 1VS3A 3BQ0A 4WTYA 3PG9A 1GTHA 3HSJA 2AP6A 1KC8T 2J7WA 4RW8B 3QZ7A 2K7JA 1R0CB 2XGPA 2CNKB 3MM5A 3O6QA 1TVRA 3ISNC 1R43A 3OVAA 3CJ0A 4X4VA 4Q7AA 4TY9A 1K44A 1T11A 2J0XA 3MPDA 2ROEA 4M1KA 2RE1A 3H98A 1WJ9A 4NLTA 3SSRA 2ZZMA 4DV7J 3EPIA 4DX5A 4EU0A 1T9VA 1RE1B 1IBLJ 2WVCA 1BWVA 2XEXA 3AQOA 3PHEA 4C2MA 5A0YA 1R6VA 2F7VA 3DGPA 1RT5A 4ATNA 2KL8A 1S1VA 3MEDB 4JV0A 4LF1A 5E2QA 2RRNA 3CCUS 4OZ3A 4P2MA 5K8OA 1RWPB 3NAIA 5K5MA 1UEUA 3W9JA 1TFYA 1M5SA 1WNEA 1WHVA 2GVZB 2Y1JA 4F8RA 1F5CA 2X3DA 3F41A 3Q22A 1EB0A 4FXWA 3NXZA 1LNQA 4WTOB 2W9CA 3OR1B 1QSYA 4PG6A 2I8EA 3QRPA 4F0MA 3GYGA 3QATA 3AY0A 1FWLA 2CQBA 4MFBA 2RILA 1WEXA 3IR5B 1NPPA 4PXDA 3OFHA 2DGXA 3W2WB 4B3RJ 4NXNJ 1QD1A 1QVGR 1URRA 2JZ5A 3UDLA 2VDHA 2IM2A 2W7OA 1C4CA 3CUNA 1X4EA 4L3KA 2B8PA 1AXQA 1K47A 2BJ7A 2HPUA 4ECSA 2WVEA 2D41A 2HNZA 2MSSA 4I6WA 2QLBB 3DNCA 1GQEA 1F5AA 2QRRA 1L5UA 4HHUA 4GVBB 1QSSA 4ED4A 3OJUA 2QJ3A 1GH8A 5KFVA 2XWXA 3DLGB 1UW4A 4Q43A 3C2PA 1S4EA 1AZSB 3GSDA 1FVQA 1HPZA 5IM0B 2UXBF 2X1FA 3EWGA 1Q8BA 3CC2S 4DX6A 1JJHA 3M9NB 1S79A 1Y10A 1VQ8S 5IV4A 2RUSA 2W1BA 4LF9F 4DN0A 3CCWA 1J5OB 1RHKB 2BW7A 2XMVA 3PNIA 4FXVA 4OHZA 3NL0A 2I0XA 4PWDA 5H9EK 4NZ0A 5LXYA 2YQ0A 2KVQE 1M5VC 3ZZYA 4OHWA 4DQIA 4DL0C 3I32A 3P5BP 5F8MA 3O1LA 2GNKA 3RG6A 1AROP 2DNMA 3T1AA 2BACA 2AJ1A 2Y1RI 3FFIA 2IHR1 4NMLA 4X84A 2J5AA 1CQMA 2OPRA 2E9RX 2MLXA 1FFWB 1A7GE 5A76A 3CMAS 1WF0A 2GJFA 2FY8A 1FKPA 1CJVB 3L09A 3Q89A 5CCLA 2AGPA 3HVTA 3V6DB 3AOCA 3ENQA 1IM4A 1TP7A 1IKXB 1B4SA 4RUHA 3CCSS 2XSJA 3MPYA 3R7BB 3MM6A 3HKZD 1RTHA 4JBCA 1F0XA 3TI0A 2DRAA 2PIIA 3H5SA 1LWCB 2HAFA 4NOHA 2BOPA 2KFZA 5ETTA 2OJ3A 3PYDA 4QYZK 4PWWA 3PEJA 2YKAA 1TL3B 2GCFA 1S7IA 4ZA1A 4CYUA 3LP0B 3JB9k 2F4FA 3OTOF 3G6XA 3HFVA 1Q95G 1XBWA 1Q0NA 3R1HA 3H7HB 2OUGA 2HZVA 1TR0A 2BJDA 3HX9A 2EG2A 3IBFB 4V1Ak 4TKTA 1SQEA 2GS8A 4NCBA 2GX8A 2LU1A 1R0AB 2G0JA
chains in the Genus database with same CATH topology
1RT4A 2EFVA 5F3TA 1F2GA 2B6AA 1KHWA 1SKWA 2DVIA 3UR0A 3IRXB 2KFNA 4I7FA 5D77A 3PR4A 1XR7A 3I55S 2AD9A 4ID5A 2F8HA 1RQ0A 2E7XA 2VB6A 4RW9A 4Q5VA 4IRCA 2P9EA 4TY8B 4F3MA 2JHEA 4F50A 1SH3A 1QAXA 1HNIB 1M1KT 2EBEA 1VQPS 3CCRS 4C8MA 4ED7A 1HW8A 3WX4A 3V6DA 4BCAA 1PGZA 2DHXA 4OIXA 5KG0A 3UNGC 4I1TA 5ITHA 4OHVA 1IKXA 2MKIA 3V81A 1R27B 3QWPA 2M2BA 2V8DA 2QSWA 4Y00A 4EO8A 4WCEQ 4OHXA 4Q8EA 2MGZB 3HHDA 3M6WA 3IGNA 1DURA 4OJGA 3Q8SB 2HHUA 2UV8G 4G1IA 3ITHB 3UCZP 4MK9A 3TAMA 1U1QA 2IA6A 1YRUA 1GX6A 4A8SA 1JLEA 4PQAA 2W24A 3SDEA 3LW5C 2VA2A 1AUDA 5A6PA 1C1BA 3CCMS 5IS2A 4ZVEA 1LWCA 3DLEA 2JC1A 3E8OA 3LAMA 3SCKE 5A8RB 1JLBA 5T41A 1CQNA 1SL1A 3D1OA 3OR2A 4OZ0A 4ZP6A 4EBDA 5K14B 1UJ6A 1X4AA 5D3GA 3MI7X 2C3UA 1YQHA 2R2UA 2EPIA 1D9AA 4I68A 1J5EF 4HVZA 1TL3A 2M8HA 4GKJF 1U6BA 2DNYA 3LP0A 3G96A 1C2PA 3KG0A 2J6UA 2GQQA 3WC2A 2E1CA 4CO0A 1AFJA 4A47A 2UXDF 4KFBA 4ES2A 4K4UA 3KK3B 5MAOA 2Q6CA 3GV5B 4XIUA 5HLFB 1N34F 1YTYA 1ULRA 4N5SA 2LQJA 2RS8A 1WHYA 4HI2A 4DQRA 1X5OA 2FLLA 1UVJA 3FNNA 5JVHQ 4EO6A 5AE3A 5KT2A 1VQSA 1T3NA 1TL4A 1HHSA 2ZD1B 4DQSA 4WFBQ 3DRXA 2DNKA 4XPCA 3ZZZA 1ELOA 5KT6A 3LAKA 1RT3B 3CULA 2VG5B 5DM7Q 3MZIA 4ILLA 2EG1A 3EXCX 2B5JA 4HLBA 1M90T 1AW0A 1FJEB 2FJXA 2JFKA 2XMMA 3OXLA 4N56A 2PDAA 2AJQA 3CDWA 1A6LA 3SQGA 1Q78A 1U6FA 5KFAA 4EZ9A 2EFNA 3KLFA 1R0AA 4WFXA 1S4FA 2RUGA 3I82A 5D4OA 4TQRA 3DHXA 3H20A 3TANA 5L1KA 2GMLA 4IO9Q 1VRTB 1SV5B 1ZYQA 2R7QA 4ILMA 2D7SA 3CCTA 4Z2XA 2ZH4A 5HROB 1B0PA 1KN6A 2DNZA 1VQNS 3CCVS 5KOWA 1HBNB 1K8AT 2QA4G 2J9CA 4FPRA 1HNZF 1RA6A 3L7OA 1HNIA 4NPOA 4CO2A 1P8GA 2R7TA 1UMJA 2D3ZA 3SFGA 3BGFA 2MQLA 2M7SA 4LVOP 2KVIA 2HGLA 4RBTA 2CPZA 4L6V3 4FNHA 5D78A 2N4DA 3JYTA 4DS4A 4J9NA 1U8SA 3DU6A 3KG4A 2MGZA 2VA3A 1HQUB 3TX8A 5DGAA 1DTTB 2JVRA 2WB1D 4Y6IA 5E3CA 5BJRA 3LWMA 5CZXA 1TV6B 2WOMB 4G1QB 4ECUA 1U2RA 2FJAB 2KI2A 1RGVA 2CJBA 4QWEA 1NKCA 2DIUA 4NLUA 1HWLA 3EX7B 4WFYA 4BDPA 2A2DA 3RBEA 5A8RA 2KT5A 1VC6A 1ZM9A 4OZLA 1U47A 3MEGB 1HBUB 1R8HA 2AWZA 4KC5A 5BYSA 1HNWF 5E41A 3QO9B 3IGVA 3LH2S 1V9OA 5K14A 4ED6A 1ZBTA 3F56A 3FSYA 3TUIC 3K7RA 1ZAXA 4XAKA 2PI4A 1RTIB 2WBRA 4FS2A 4NCAA 3ZZPA 5SZTA 4HDHA 3RYLA 1KEKA 1W2IA 2QMXA 3P49B 3LWLA 2Z4PA 1NZAA 3CDBA 1S6PB 4RBUA 5CYMB 3HHLA 1X0PA 4NLSA 5IQQA 1VOMA 3D1HA 2GO8A 2W4PA 4CNZA 3ENVA 2GHWA 2RNEA 3T19A 1Y0HA 2VFRA 5K9FA 5B08A 3J7ZT 1ZTTA 3CT9A 2H9ZA 3BR9A 7FD1A 2IRXA 3BSOA 3OJSA 4FVMA 1X4BA 3MTKA 4Q0BB 2ZD1A 1DARA 2CRLA 2L48A 4PRFA 5DQGA 2MXYA 5D6GA 2JLEA 1RT3A 5I4MA 1WF1A 3PW4A 4RNFA 5B0DA 2VG5A 5AJ3F 1CG2A 2NS1B 2FJEB 3OHAA 3DOKB 4OX8A 5IXUA 1S1XB 2VBZA 3O2IA 3PFOA 1KQKA 3QJLA 4FXDA 2ZNZA 4IG3B 3KK2B 2C3MA 4N47A 3BS9A 1H2VZ 2EVZA 3FQLA 3T5LA 2C3YA 1HBMB 3HPOA 1YJRA 2KU7A 2BM1A 4KO0B 4RNOA 4DJBA 3MM9B 4BBYA 4DG1B 4CZCA 1VRTA 1MW7A 2KH9A 3IWNC 3N5FA 1N36F 1SV5A 3TVZA 1CVJA 1NB7A 3F44A 1YJUA 3NCRA 4NYZA 5J1NA 4YB7A 5J2MB 1S72S 5L1IA 4ECZA 1UETA 4ETZA 1HBNA 3MPWA 1NHUA 2CQDA 3DRSB 5CYQB 1NK7A 2CPXA 3CTRA 1P6TA 2XMWA 3M8QA 5CHCB 2XCPA 4F4XA 1UAWA 2YWEA 1M5OC 4O3SA 2CPDA 5EX0A 5G4DA 5H9EJ 2VODA 2ZC4A 1EP4B 1Q4RA 3NP5A 4QPTA 1VI7A 4OFZA 2R7VA 1S7HA 5I42B 3R3TA 1VQ5S 2MZQA 2RRAA 4AYBD 1OPIA 1DTTA 1CSJA 2MHNA 2RQMA 2GIQA 4C8OA 1K0TA 5CXTA 4G1QA 1GNKA 4QBUA 5KAKA 3V4MA 2JC0A 2ILYA 1YJWS 3LPYA 4MKAA 3BGUA 4PPZA 4TYBA 4ZCIA 2R2RA 4ZCLA 2UUAF 1H6KX 2ZNYA 3MEGA 1HBUA 4DOZA 2XC9A 4O3QA 3MGJA 3TYTA 3HM9A 1JLQB 1WTFA 1DQ9A 2KHCA 1R89A 1FRKA 3OL9A 1VJWA 4IH5A 4YUDA 4HH1A 2F4VF 2B4UA 2VG6B 1RTIA 1PC4A 2YX4A 4K5SA 4ZPCA 2A2CA 2AGOA 3EGNA 4HYKA 4NLXA 3HFKA 5F8GA 3CMES 2VBWA 3OTCA 1TKZB 2YX7A 2C22A 1SH2A 2I5JB 3DYAB 3QIPB 2YH0A 2K3IA 4PG7A 3VQSA 2BR0A 4F4YA 4OZJA 4PWUA 1RAJA 4K2XA 5FD1A 1NK8A 3HI9A 4Q0BA 2OD4A 4WFNQ 4QPXA 3T5JA 1SUQA 4OI3A 2W8KA 3PIOQ 1T8EA 3SFUA 2CJQA 3SCLE 5KFPA 1NJZA 3DC2A 5G0RB 5AE1A 1HHTP 2HYIB 3NNAA 2OLWA 1REVB 4ETXA 2E1RA 4OI2A 3RB6A 1LWFB 3QPIA 1S1XA 1G2EA 4IG3A 2YKNB 3H5UA 3G8SA 2CIMA 2EFGA 3KK2A 1Q81T 3OL6A 1NO8A 2B4PA 3JSYA 4QR0A 2HVHA 4FF3A 4JI0F 3UD4P 4QIEA 4KJIA 2Z2LA 1HBMA 2GQ2A 2ZH7A 2XMKA 4QU7A 2PD1A 3ZC4A 2MKKA 3CGIA 3HP6A 4KO0A 4KPYA 2PN6A 4NLWA 3MM9A 4DG1A 3KLVA 4KGMA 3TAPA 4RW8A 2OP5A 4EWTA 2Y1IA 1NJWA 3T1YF 2E29A 2EKYA 3WBZA 3A8EA 5GAEI 3U02A 5KFWA 4ED2A 2YNGA 4X4TA 3FSIA 2OSRA 3V5RA 3D0IE 1DQAA 2JSXA 5T14A 3P3DA 3DRSA 5CYQA 3R5AA 5B0GA 4HTJA 5J1EB 4B9TA 4QYZJ 1EP4A 2Y0SD 5CH7B 2OFHX 2WBMA 4ZPBA 3RR8A 5FDLA 5I42A 1X0FA 2HS3A 2P6TA 1VK8A 1X4DA 4NYPA 3P6YC 5ADZA 2Q1LA 4J9QA 4W92B 4UQTA 4JI4F 3U1NA 3PW0A 2MZTA 1NJYA 2HMIA 2FC8A 4LJMA 4A8FA 4ELUA 1TFWA 2I1RA 4H54A 1WHWA 4GMKA 1S6UA 5E7OB 3K59A 1N8RT 3PVXA 2JX2A 3GE9A 5IT0A 1YJNS 1YG0A 3Q8PB 1U1LA 3FJ2A 2XNRA 3KJVB 4MIAA 2DPJA 2IBOA 4LIRA 3NRBA 4ZHRB 4F3QA 1UWBB 2FVQA 3PJXA 4MH8A 1CC8A 1SBRA 4X4SA 4PXEA 3FRZA 1D1UA 4CH7A 1UJ4A 4P7VA 1VC5A