4A8XA

Structure of the core asap complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
SMKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLAPWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-BINDING PROTEIN WITH SERINE-RICH DOMAIN 1
total genus 18
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a8xA00
3CMAS 2MQLA 2M2BA 4CH1A 2MJNA 2GHPA 2MY7A 3NS6A 2DGSA 2AYBA 2DNOA 5LXYA 4UQTA 2OSRA 3CCES 2MY8A 3P5TL 2E5IA 1WELA 3P49B 1JMTA 1CVJA 2CQ3A 2D9PA 2MQQA 1DBDA 4WIIA 1Q81T 1U1RA 1M90T 1U6FA 1YWXA 3Q2TC 1Q82T 3CCJS 1VBZA 1A9NB 1QVGR 3J7ZT 2LCWA 3IWNC 1X4EA 4F25A 3MD1A 1P1TA 5GMKa 1YTYA 2DNGA 1VQ6S 1VQLS 2MPUA 3UCUP 2KXHA 2M88A 1WG5A 2KG1A 2YWKA 2KM8C 4F26A 1KC8T 3MDFA 1NU4A 1YJ9S 3CXCR 3SDEA 1Q7YT 3UE2A 1UAWA 1WHYA 2RUGA 1U1KA 3DXBA 2EK6A 2U1AA 3S8SA 4C4WA 5LJ3Y 2X1FA 2MZQA 2M8HA 1WHWA 1SXLA 1DHMA 1WHVA 3LQVA 3N9UC 3NNAA 3CUNA 1U1NA 4LIRA 5GAEU 2XS7A 3MURP 2DNZA 5LSOA 1BY9A 2RRAA 2JRSA 1DRZA 2J8AA 4EGLA 2KT5A 3FEYB 4TU8A 1KOHA 1YHQS 2XNQA 3UCZP 4OZ0A 1VQOS 3CTRA 1UW4A 5HL7Q 2FC8A 1X5SA 1FT8A 3HI9A 2CQ1A 3G6ES 2CPIA 1VQ7S 4WKRA 5EN1A 1WF0A 4YOEA 3R1HA 3U1LA 4M5DB 3MOJB 5JVHQ 4OZ1A 2OSQA 2XSFA 1HL6A 1X5TA 2FPHX 2DGOA 3V4MA 2DGQA 2DISA 2DNPA 3CPWR 1U1OA 1WHXA 3UD4P 5GADU 3IRWP 2CPYA 3NNCA 1D8ZA 2G0CA 1FXLA 5DDQC 2YH0A 5DDRC 3S01A 1UP1A 3G8TA 2NZ4A 2DNRA 2N7CA 2DNYA 1FJ7A 3VAMA 2HGMA 2FHOB 5CA5A 2JVOA 2MQMA 1JJHA 2RS2A 2MYFA 5GAHU 1VC5A 2MZTA 3UWTA 2J0QD 1N54B 2VOOA 3FEXB 1WI8A 1OWXA 3ZZYA 2M4MA 1ZZNA 1R8HA 2DB1A 4U67Q 2MXYA 1VBXA 1K8AT 2N82B 2DGUA 1VQKS 2XS5A 2KYXA 2MKKA 2AYEA 4W90B 3S6EA 2JVRA 1X5PA 2CQCA 3CCUS 3G9CA 2HYIB 2DNHA 2MZJA 2RS8A 1SJRA 2LEBA 1WF1A 1SJ3P 2RQ4A 4YB1P 3BO2A 4QQBA 3OW2R 4Y00A 2LXIA 1VBYA 2GO9A 1H2TZ 4CH0S 2CPFA 3UD3P 2VOPA 3I55S 1H2UX 3PIOQ 3CULA 3R1LA 2KHCA 2MZSA 3G8SA 3VAKA 2DH8A 4ERDA 2CPHA 3H2VE 5H1SV 1QM9A 1A7GE 2M52A 2E5GA 2OIHA 4WF9Q 2L08A 4IUFA 2LXUA 2KG0A 5IQQA 1YJNS 4ED5A 3CCMS 1FJEB 3ZZZA 4C0OC 1Q86T 3J7YU 3VAIA 1URNA 2RT3A 2QEXS 3SDEB 4QPTA 1WF2A 3VAFA 1HD1A 1PGZA 3EGNA 1M5PC 4QU6A 4P6QA 3G4SS 2M8DB 1VC0A 3BO4A 2OTLS 2X1AA 2F9DA 2MKHA 2AYMA 2QFJA 3VAJA 2DO0A 4C7QA 1FJCA 3VF0B 1DZ5A 2KRRA 1X4FA 1H2VZ 4A8XA 4LMZA 2RVJA 2DIUA 2J0SD 4PR6A 2HGNA 3TP2A 3PIPQ 2MKJA 2MB0B 2K8GA 1K9MT 2RNEA 2CQ4A 1VQ4S 2BOPA 1VQ5S 2CQIA 2CQBA 2CPJA 2CPEA 1PO6A 4IOAQ 2CPXA 3MI7X 5DETA 2DNKA 1H6KX 5DDOC 2XNRA 2CPZA 3U1MA 2LA6A 1NJIT 1U1LA 2DGVA 4RU2A 1SJQA 2KFYA 5DM7Q 1WG4A 2U2FA 3Q2SC 2MJUA 2QA4S 1M1KT 2FC9A 1YI2S 2MQNA 3CCLS 1YJWS 5DM6Q 5D78A 5LSLA 5CYJA 2DNMA 4ZKAA 2DH9A 1X4GA 3RW7A 2M0GB 3CC4S 4PRFA 1WG1A 1U1PA 1FO1A 2DHXA 2MQOA 1X4DA 4TU7A 3L3CA 1N88A 2JX2A 2OJ3A 2L41A 3MD3A 5MLCV 3NNHA 2KVIA 1U1QA 2DNQA 1VQMS 4WCEQ 2G1DA 2N3OA 2MSSA 1L3KA 2M7SA 4UY8T 4BS2A 3BS9A 1U6BA 4TU9A 2M9KA 2KM8B 1S79A 4W92B 5GVQA 3TYTA 1WEYA 2DO4A 3RW6A 1X4HA 4J5OA 3JB9k 2K3KA 3R27A 4F02A 4LJMA 2MQPA 3VALA 3HHNB 3SXLA 3S7RA 4V19X 1WEXA 2FY1A 2CQ0A 1KD1T 2DH7A 2LMIA 3MUVP 2BZ2A 3NS5A 1P27B 3MUTP 4TLQA 2DHAA 3EGZA 4IOCQ 3MXHP 2DNLA 2LKZA 2DGWA 2KRBA 3BEGB 4FXVA 2KXNB 1WWHA 3G71S 2ADBA 3THPA 1K73T 1KQSR 4CQ1A 2DK2A 2DGTA 1X4BA 2WBRA 3H2UB 3CCSS 2LYVA 1NO8A 3DLLQ 2CQHA 2EVZA 2AD9A 2MGZA 5FJ4A 2HZCA 2MKCA 2CPDA 2OTJS 4Y0FA 1X4AA 2I2YA 2RQCA 1JJ4A 2YTCA 2O3DA 1OPIA 2EK1A 2ZJRQ 5LJ5Y 3NMRA 3LPYA 3ULHA 5JVGQ 1RKJA 2DIVA 1ZH5A 1YITS 4IO9Q 5IM0B 5ITHA 1D9AA 1UFWA 2V94A 2ERRA 2MZRA 3P3DA 4FXWA 2N3LA 3VAHA 2F9JA 2L9WA 4YUDA 2LEAA 3I56S 2CQ2A 1VQPS 1M5VC 2JWNA 4WFAQ 1VQNS 1FNXH 2KN4A 1G2EA 5DDPC 1WEZA 1X5OA 2I38A 2VONA 1O0PA 2PEHA 1WI6A 2SXLA 2AYGA 2ZJPQ 1VC6A 2E44A 5D77A 3BO3A 1R8PA 2DNNA 1ZZFA 1X0FA 2A3JA 3MUMP 1W2BR 1SJ4P 2DHSA 2XB2D 2G4BA 2DGXA 1YIJS 1F9FA 5GAGU 1U2FA 3D2WA 2ZJQQ 2ADCA 2X1BA 2DITA 1VQ9S 1S72S 1B7FA 2UP1A 3B4DA 2Q79A 1OIAA 4WFBQ 3CMES 3K0JA 2RRBA 4CIOA 3CC2S 1FHTA 3CCVS 2MGZB 2HGLA 2YH1A 5LXRA 1X4CA 1RK8A 1OO0B 2B0GA 2MMYA 3CCRS 2LECA 2CQDA 2X1GA 1N8RT 3P6YC 1M5KC 4PKDB 3CC7S 2DHGA 4Z2XA 2CQGA 2HVZA 2D9OA 2J76E 3US5A 1VQ8S 3SMZA 2LQ5A 1SJFA 1KOOA 1HA1A 2KU7A 3THTA 2F3JA 2PE8A 3CD6S 2KI2A 2MKSA 5IM0A 3CF5Q 3TO8A 1XN9A 1HD0A 5IFMA 3CCQS 5CXTA 2MKIA 2E5HA 2NLWA 2CJKA 1U1MA 4QU7A 1IQTA 1N52B 5BJRA 1M5OC 2MSTA 4WFNQ 2E5JA 2LA4A 2MZ1A 3UCGA 2KXFA 2D3OR 2XS2A 2KH9A 2YKAA 2MHNA 3VAGA 3B4MA 2CQPA 5HO4A 2RU3A 2M70A 1AUDA 1QVFR 1JJ2R 3G96A 2VODA 3EX7B 1WTBA
chains in the Genus database with same CATH superfamily
5IS2A 3RYLA 3CMAS 1IBMF 4I7FB 2MQLA 2UXCJ 1U09A 2VPZB 2JSXA 3HSGA 1KLMA 2JEJA 3R5JB 4B08A 2DGSA 2OEJA 3ZZTA 4L3NA 3BGRA 3MEEA 1FKPB 2FHJD 2R4FA 3IR5B 1YSJA 4FXDA 3Q22A 1H7XA 2WSFC 2Y1RI 1H3DA 2IIHA 4ZVUB 1RWXB 2VHGA 4LR8A 1S1XA 3OFFA 4DR1F 3TEGA 2RH3A 4IR9A 1HBMB 2NXJA 3D0GE 3TOQA 1T9VA 4DUZJ 4ZPDA 2NCKL 1Q81T 4JI5J 1YWXA 5K5MA 3SSQA 3PX6A 4RNOA 3CJ3A 4QYRA 4P52A 3M6VA 3VGTA 3CCJS 4NXNF 2CZ9A 1KTQA 3ZZ0A 1IR0A 3J7ZT 3MTJA 3IM9A 4DCPB 2BJDA 2AJ2A 3BR9A 3AXKA 1PCAA 1WDDA 1ZBTA 3IM8A 4AL7A 3MD1A 1P1TA 1TL5A 4M94A 3OFHA 2HS3A 3OR1A 4CYUA 3BH6B 2F4VJ 2DNGA 4UT4A 2R2RA 2XSJB 4ZVRB 1VQ6S 1L3VA 2MPUA 3WHIA 2BA9A 2F40A 2KXHA 2I8EA 3HCXA 1NHVA 1QTNB 2ROGA 2YNIA 4LBIA 4CO1A 5C2CA 3ISZA 2Z2LA 3GG0A 4U8YA 1V6HA 2JFDA 4DV6J 4B9MA 3MDFA 1JLCB 1LWEA 1T9TA 1WOOA 3P5BP 3OL8A 3FSIA 3K5LA 4L76A 4HI2A 4YY3F 4X4QA 1FWPA 3SDEA 1NZ8A 4GC6A 1UVMA 1Q7YT 4KHMA 2HIQA 5G4DA 2V5HG 3M8WA 2RUGA 4NLQA 4H4OA 4OZNA 5KG2A 3LTOA 2OPRA 2ZE2A 4E98A 4M5MA 2DRBA 3PO4A 5H9FK 4DQRA 1BQXA 4DPTA 2RF2B 3R7BB 1S9EA 2ASYA 1S49A 5LJ3Y 4RNMA 2ZH4A 1AW0A 2DCLA 4JYAJ 1SXLA 5AXKA 1WHVA 2IAJA 2NXEA 3LQVA 4NEZA 3W3SA 1GT8A 5DQIA 1IKWB 2VF3A 3D7SB 4LSLB 3CUNA 3BF4A 2PD1A 3FQLA 3DLBA 2K06A 3GWCA 1S59A 5KFRA 4DBQA 2NUUG 1T03B 2M5YA 5K8NA 5K14A 5IC4B 2A0FB 3PYFA 1J5OB 2KYZA 4YY3J 1SQFA 3DHWC 1F5CA 2GVDB 4WP8A 4DPXA 2J8AA 3DN9A 3BB5A 3FEYB 2O5DA 4RW6A 4J9PA 5CD4A 5KG7A 1U8SA 4MFBA 3MPWA 1VQOS 4DV4F 1JLEA 2LQ8A 2MQ8A 4UOCA 4N8OA 3CTRA 3NBPA 2IBKA 4F4XA 3ENAA 4JI3F 4X4NA 2FC8A 1X5SA 4PEOA 4OV6A 1TKDA 3HVWA 4DX6A 3M7VA 2E7WA 3HI9A 3M1VA 5KFIA 4J9QA 2E7VA 3G6ES 2CPIA 1RXOB 3AJ2A 4DR7J 4ED4A 5HK4A 3D6HB 3R9LA 1ZA2B 4WKRA 5EN1A 2OPRB 2ZE2B 1BE4A 3EUNA 5JVHQ 3MR2A 2DHHA 1CQMA 2XSFA 1S76D 3T19A 4KB7A 4LRCA 4LFAF 5T7LB 2DGOA 4C9DA 1S0VA 5B0AA 1T8EA 2DISA 1XERA 4N56A 5E3CA 3GG1A 3DGPA 1LW0A 1IM4A 4M8LA 3MPDA 5GADU 3IRWP 3GJRB 4RNHA 2WVBA 4OHVA 5DDQC 2CJBA 2XZWA 2V63A 4IFVB 4ELUA 2HFZA 4DFJA 5LOQA 2YBVA 2R7VA 3NBPB 4P2FA 1CSJA 4WBFA 4A8FA 4NA2A 1NK6A 2DNRA 3GFXA 3VAMA 4MT1A 2RQMA 2WSCC 1S57A 4K0KF 2W4CA 4M5HA 2HS4A 5I3UB 1UWBA 1LXNA 5GAHU 2ZH5A 1VC5A 1FK9A 2HSEB 2V50A 2YWFA 1N54B 2DXDA 3PX0A 2VOOA 4O3RA 3DOLB 3M8YA 3ZZYA 5JJBA 3W61A 4UQGA 4RW8B 3AAWB 4U67Q 1TKTA 4EZ9A 1X9SA 4RWXA 8RUCA 1QAIA 2JLFA 3GMGA 4HVZA 3SCKE 5K8MA 2FVRA 2K7KA 3C14A 4WE1B 5CD4H 1G7CB 2VG6B 1OSCA 4PXEA 5KFFA 1RT6B 1UVLA 4IFVA 3Q8QB 2WHOA 4ES1A 4LFCF 1VRUB 1KLMB 3I9ZA 1S7IA 1RT7B 1VHFA 2JVRA 3EZUA 3ILJA 2HBQB 4DV2J 4DSIA 2DCUB 3RAQA 1CS4B 1HARA 1X0PA 2HNDB 2HYIB 3KUHA 4WTYA 3LA0A 2GJFA 4WJBA 1K47A 1ZTTA 4GKKJ 4U7CA 2MZJA 2HNZA 3LALA 3NLCA 1ZAXA 4ES3A 1GAOA 2RS8A 1SJRA 1JNZB 2LEBA 1SJ3P 2HVEA 2YNFA 3QATA 3RUBL 1RTJB 3F41A 1WD6A 4QQBA 1XMQJ 1WJ9A 1UVIA 3H5SA 1WACA 3PRDA 4UF4A 4N5SA 1T3NA 4ICLA 3BQ1A 2XMVA 1CULB 1HPZB 1T3OA 3KDNA 1WKLA 2KFNA 1M5HA 3FCWA 2AMCB 4QJVA 5EX0A 2XMTA 4DQQA 2GO9A 3BN4A 5DG9A 1Q8IA 2CPFA 1FD2A 3UD3P 4O3NA 4HYKA 2VOPA 3D6TB 4ID8A 4Y28C 2NUHA 3PIOQ 4TQSA 2MZSA 4X2BA 3GJSB 2DH8A 3BDEA 5GMDA 4ERDA 3HD2A 3CNQP 5D3GA 2HRUA 2LQ9A 2VQFF 1N5QA 2YKOA 4Y34A 4USIA 2EKYA 2J9EA 1VYAA 2LXUA 2KG0A 3FSXA 3MF5A 3MR7A 2RDIA 4RR5A 1G1XA 4C0OC 4HHUA 3GONA 1T05B 2ZZNA 3ZXWA 1YJUA 3HPOA 1FE4A 1SH0A 4DN0A 5EGYA 3M8ZA 1U47A 4J9MA 1MWZA 3VAIA 3I4PA 1N36F 1RHUB 2QEXS 3TQ1A 5GAEI 4B3OB 1GMWA 2PC6A 2NSCA 1JQGA 3MCNA 1Z1ZA 3M30B 3W60A 1F2GA 3D3CJ 1RGVA 3QIDA 4FPIA 4P6QA 4WYLA 3G4SS 1S9EB 2GGPB 2GMHA 2OTLS 2X1AA 2E1AA 1IKVB 1RT2B 2IRXA 3GZ7A 2QFJA 1XNRJ 5F8IA 2HBZB 4OZJA 3PR4A 3HHLD 4PG5A 4JB8B 2L9DA 2HEKA 2QA4G 2HHTA 4ECQA 4WP3A 1E6VB 3GIJA 3TRGA 1UZDA 3C6TA 3H5UA 4UW2A 1FKAF 4TYAA 2W24A 3ZTQA 4ECUA 1V3ZA 3X3UA 4LMZA 1WOSA 1N36J 4WYWA 2HGNA 2H5EA 4RW9A 3IBCB 4PWUA 3CDAA 4O44A 3V6JA 2K8GA 3BSCA 2HNDA 1UJ6A 2RNEA 4OZ3A 4DV1J 3RTVA 3MPVA 3UW1A 4M5GA 2ZDPA 3W5YA 2FZGB 1MLAA 3MMBB 4NLGA 1Q7LB 2CVEA 1KP6A 2CQIA 3LF0A 3OR2B 1C1CB 4ID5B 4CO5A 2CQBA 3OTOF 5HQMA 4F8RA 1MW7A 1JKHA 2CPEA 3HSJA 4M5JA 4A8KA 1LWFB 1HYSB 1MN9A 2BANB 1KNZA 3RB6A 3QJJA 3VGUA 1OQ3A 4HTIA 4NX9A 4ZP8A 1JLFA 3MM7A 4A47A 5DDOC 4RZRA 3PYGA 4JI3J 3T1HJ 5T14A 2BKNA 2E29A 1S9GA 2ACMA 3MMCA 4USWA 4NZ0A 2VDHA 2YWGA 2LA6A 3HVTB 5ETLA 2DKOB 4ZVTB 1MNEA 1S6OA 2C2KB 5E3AA 5A2QU 1SJQA 3B82A 1WG4A 1TMJA 1P6TA 1RP5A 1X7VA 5DRKA 3EZOA 2CNLB 2D41A 2FD2A 2VU5A 4P2MA 3BH7B 3B78A 3G6VA 3FZBA 3TR5A 4ZJQA 3KLIA 2J0WA 4MFBB 4RW9B 5DM6Q 3UN5A 5LSLA 2J7WA 4P9SA 1N32J 3MMAA 7FDRA 4ZITA 1RU2A 3GR1A 4ZCLA 3CC4S 4PRFA 1GMWD 1RA7A 1BQMA 1ZS6A 1FCAA 2D1CA 2X3GA 4X4SA 3OL9A 4DR6F 1X4DA 5CYMA 2MLYA 4PABA 1VLOA 3M8QB 2JX2A 3EVOA 4Q7AA 2R7SA 1NH7A 4CH7A 3H2LA 4OZLA 3OUYB 2OJ3A 1PBUA 3R5BA 1FWLA 1HQEB 4RBTA 2L41A 4G1QA 3GE9A 1IKWA 2CJXB 3R7SB 3UO0A 3HHLA 2MLZA 1SQGA 3G82A 3NS7B 5EHHA 4WCEQ 1NK5A 2ZM6J 4JI5F 3OJSA 2XO7A 2VPXB 3GIMA 3GR0A 4J9KA 1UZHA 2BQRA 5F8JA 3EXYA 1KBRA 1MN7A 2YVSA 4DR1J 4LQ3A 2CIMA 2IVFB 2M9KA 2HFVA 3J80U 1GFWB 1IVZA 4F0KA 1C1BA 4QZVB 3W8PA 3TYTA 4W92B 1WEYA 4FYDA 1R0BG 4HH0A 5HATA 5D4PA 1UCNA 1NM2A 1X4HA 1A6LA 3RW6A 3I6PA 3FJ2A 4P2XA 5CYMB 3JB9k 2IMOA 3VQSA 2B9EA 2K3KA 4F02A 4ITSA 5HBMB 5KT2A 2J6SA 4O3PA 3RB0A 4DV2F 4ID5A 1KSPA 4NYOA 3OXGA 4QBUA 2UVRA 2VPYB 3HHNB 3SXLA 4I69A 2BW2A 1XK8A 3IRXB 4KGXB 2DD8S 2CQ0A 3OHBA 2W2OP 2CVIA 2VC1A 4KFBB 2HRTA 3TJ9A 4DV3F 3R7NB 1KD1T 2UU9J 2DH7A 2LMIA 4C48A 3QWPA 5AXNA 4DV1F 3NS5A 3MZIA 5DG7A 1NK9A 1RWMB 1UL3A 2H51B 5LM7E 5IWAJ 4RUAA 4B9UA 4QW8A 1DTQB 2ROPA 2XHWA 4IH6A 4DI6A 2NS1B 1IKYA 3MXHP 2GA7A 4CM0A 2GJIA 3W5ZA 2J9CA 2C2DA 2DGWA 4H4KC 5J2QB 3QIPB 5HMWA 4FXVA 1S6PB 2FDNA 2YQ3A 1TL1A 3G71S 3THPA 5HP1A 2VC0A 4ECYA 4N7TA 3W8GA 4R0JA 4KPCA 4R5PA 2HAIA 1R8CA 2DR9A 2DGTA 2VFVA 4ZVFA 2RIJA 2ATCB 2VG7A 4JI6J 1SKSA 3C19A 3DLLQ 4B3SJ 2XZDB 3N6LA 3UN3A 5ETPA 4OYAA 2MGZA 5FJ4A 1B7YB 2EFNA 2HZCA 3M8QA 1TL3A 1R8AA 2CG4A 2CPDA 2WZ1A 5F8GA 1DARA 1HHQA 1GEHA 2WVFA 4HHHA 2DRDA 3WIVA 2J9DA 2RQCA 9RUBA 1JJ4A 2AEFA 1WTFA 2R7TA 2DT9A 4NEYA 1TTHB 2BVZA 2ZDOA 4S0MA 3W66A 5M2UA 1HNXF 2RKIB 2AJQA 3O8WA 5AE1A 3ULHA 1MROA 4LF8J 1LWCA 1YITS 4IO9Q 4NCAA 5IM0B 1DTTA 3H5YA 4DLEA 1SC4B 1TZ0A 4NLDA 1WC4A 3OBIA 3P3DA 4NXNJ 4OYWA 4U8VA 5EDWA 2L9WA 3DOMA 4I2PB 3I56S 3HK2A 4WKYA 5J2PA 4KJIA 2NQPA 4NCBA 3QMQA 3MAAB 4ICLB 4F7VA 5A76A 5SZTA 1UMJA 2V2VA 3DRYA 3IXQA 2V2KA 4FPRA 4B3TF 1VQNS 1TL7B 5DDPC 1FVQA 2NXNA 1LWFA 2VONA 2QIFA 4QYZJ 3Q8SB 5ETMA 5THWA 3L7PA 3HDSA 2AX0A 2B9WA 2RDDA 4NOHA 5D77A 1IKYB 5BYSA 3GV7B 4EI2A 4OL8A 2PFDA 2E1CA 1FTRA 2DNNA 4WFZA 2XEXA 2QN6B 3JS9A 5K20B 2HQ3A 3MUMP 1S4EA 1VRUA 2W2QP 2B4PA 1NK7A 3KNAA 4KE5A 3Q8UA 4KC5A 1U45A 4RU9A 2ADCA 2UV8G 1ZAVA 5C24B 1KFDA 2PT0A 1VQ9S 4QCLA 2V69A 5ETOA 4ECXA 4JI0J 1U02A 3OV7A 2BEFA 2Q79A 2VG5B 2XLIA 1W7WA 5B09A 2Z57B 3JXOA 1TAQA 3CC2S 4AQYF 3SV3A 3MAHA 1QY7A 1RTIB 3CT9A 3QGIA 4FP9A 1OY8A 5E0OA 1I3OB 1RB0A 2HGLA 2EEYA 5LXRA 3RB3A 1SL0A 1RK8A 1A0OB 3DRPB 2NZCA 4FYXB 4ZPWR 2MMYA 4DG1B 2R8HA 2LU2A 5CCLA 1RHQB 1NSPA 7FD1A 1VI7A 4J37A 3EVWA 4ATNA 2LECA 2CQDA 3Q24A 2JZ5A 1HBMA 4FVMA 3PW7A 1MU2A 2F5GA 2P9CA 4PKDB 2NYIA 4CLUA 3VR1A 3M9NB 1S99A 2D3UA 5CABA 3DLKA 2VA3A 3CC7S 4F4ZA 3BGOP 2BACA 2HVZA 2XULA 3ZTOA 1VLYA 2C2MB 4GVBA 1IBKJ 4URSA 3NXZA 3AT1B 1Y9OA 1DTTB 5BYQA 3PKYA 1M0SA 3RGIA 4BBYA 2ZD1A 5GAHI 4GC7A 2Z4PA 2OLWA 1SH2A 4HHJA 2C22A 4O44B 4ZLLA 2RRNA 3TA2A 2JEGA 1JLBA 2PE8A 4QR2A 4I2QB 4CO4A 1HNIB 2ZH3A 3KTQA 1GXLA 5IM0A 2W25A 3TJAA 4J9RA 3NGDA 3TZZA 4KHPJ 1HD0A 2IVMA 4WPAA 2YNIB 3H40A 1FJGJ 4TN2A 2FY8A 2NLWA 1RE1B 2XLJA 3V4IA 3AA9A 3O3LA 4QWEA 4KKOB 1IQTA 3IBWA 5BJRA 4WFNQ 3AJ1A 3A3NB 3HT3A 3UCGA 3H4BA 1T9UA 2QL7B 1NKBA 2KXFA 1CJKA 5M2PA 4U6PA 3KLEA 2XS2A 2ZH8A 2G0IA 1Q4RA 1RBAA 4ETZA 1BC6A 2HFSA 2QRRA 1TAUA 1S1VB 2A2DA 5HO4A 2M70A 3GSDA 4CLWA 4C8OA 1RTZA 1S6PA 2VODA 2HVHA 1FJGF 3EX7B 2ACYA 2DYAA 1JLBB 5CYQA 3UR0A 1YLXA 4C8MA 3PCOB 1JXEA 1JLCA 3FDSA 4X84A 4CH1A 1XNQF 2MJNA 1CC8A 2MY7A 3MECA 3NS6A 2BXJA 2J9DE 2J7UA 4TLRA 5D15A 5KG5A 2ALZA 1HKAA 3TVYA 3OFEA 5A6PA 5AE2A 3MCMA 5LXYA 2MY8A 1D09B 2FHJA 2WSEC 5IV3A 1Q95G 3GB0A 4H54A 1JMTA 5BR8F 1UFLA 4DLGA 2C2RA 3HX9A 1J2VA 2IVYA 2E5LJ 2B6AA 2VBZA 1PILA 4QWDA 1RAFB 3KK2B 1CJKB 3N01A 1NXIA 1VISA 2VQEF 5E3RA 3U27A 4ZCMA 1VIXA 3X1LB 4KH0B 3KJVB 1Q82T 3GTYX 1VBZA 5DGAA 5F9NA 1HPZA 1VGYA 1QVGR 1TKZA 4AL6A 2GIQA 4DR5J 3MPYA 4ZP7A 5A8RB 2ZOMA 1VIOA 2Y8WA 3A4TA 2GVDA 1JNRB 1NK8A 5G0RA 3C6UA 5GMKa 3OSPA 1YTYA 1U2RA 3E8OA 1XTZA 4I56A 1C4CA 1PSDA 3HM9A 1VQLS 2NZ4A 2OPQB 3UCUP 3NEKA 3PW4A 2HHPA 2M88A 2KVQE 3MEEB 4X4RA 2HBRB 5KFEA 1SL1A 3DLEA 2KG1A 4DQPA 1NDLA 2L3MA 1RQ0A 3GJTB 1KC8T 4ELTA 1RYSA 1QUVA 3HULA 4AL5A 5FLXU 1RWVB 1NU4A 4JBCA 5F0WA 4K4WA 1ACMB 4I1TA 4EBDA 2B56A 4EU0A 1UAWA 3BN7A 3OVSA 1ZPVA 2V8PA 2VG7B 2JDJA 3QGGA 4LF8F 2FJEB 2YX7A 4K4XA 4QIEA 4P71A 2Q3PA 3KUGA 3K58A 3FUYA 2Y1JA 2ZH2A 2MZQA 1X9WA 3OHAA 3NMAA 2HS0A 2DXFA 5KT5A 1DHMA 1SV5A 2DR7A 3OUYA 4K4VA 1SIWB 5DLFA 1JIHA 3HD1A 4XIUA 3BM7A 3NNAA 4H4MA 4MMOA 1SVDA 2HNYB 3M8PA 4NL5A 3C6TB 4DV0J 3Q8PB 4E8UA 5T41A 3FBFA 3WC0A 1YJVA 1DTQA 1GQEA 4C98A 2VKZG 1DLOA 5LSOA 2YWWA 2RRAA 1NZAA 4WE1A 4OI0A 3FSYA 4G65A 2IDEA 1S1TA 3TUIC 2XCPA 3KK3A 2B4VA 1HQUB 3C6UB 3LW5C 4MIWA 3FEZA 5ETSA 1LWCB 2KT5A 3MOZA 1KOHA 2W2MP 1F0XA 2CUYA 3P4UB 4ZLNA 3HSDA 4RL1A 1RWWB 1S0MA 1S7HA 1T94A 3DLHA 3RRHA 1IJEB 2V2QA 2ZM6F 3UCZP 3W63A 4KY3A 3V81B 1HMVB 4OHZA 1D3WA 2B51A 5IT4A 2F63A 1OS5A 5DLGA 2HLUA 4DZ6A 2ZBRA 3AB2B 2WVEA 3NGUA 2CQ1A 1F3VA 1VRTB 3FFIA 3OT9A 3VZHA 3D9BA 3G8QA 2A2CA 4OZ2A 1S0NA 3B6BA 1RHJB 2LDIA 1XC9A 1WF0A 4CT9A 1U6ZA 2XG8A 3U1LA 4M5DB 3QGPA 4CP5A 4G1IA 5ETRA 4EK2A 1IKXB 3TAMB 4EBCA 1SKWA 1KHVA 1EKRA 1X5TA 2FPHX 3M2RB 8AT1B 5F8LA 2ZHAA 1IBLJ 3V4MA 3CJ2A 1RT7A 4LFBJ 5KFWA 3LANA 3CPWR 1U1OA 3J7YI 1WHXA 1ZM4A 3Q8YA 3IWXA 1U2CA 5KFCA 1HWLA 1GTHA 2V67A 2JNJA 3UD4P 5A8KB 2VG6A 2G0CA 4X65F 2K7JA 3L4BC 5HQLA 1FXLA 2UU9F 1YVFA 2KL8A 3KWMA 1Q79A 3KLFA 4NLVA 2FTRA 3MEKA 5DDRC 2JFKA 5FD1A 1T95A 1YKWA 3G8TA 4DQIA 1NPPA 2LQJA 1ZM9A 3PVXA 4EZ6A 2KFZA 2FHOB 3RRKA 3ZO7A 5CA5A 3B8HA 2AEMA 2FB0A 2VFTA 2WW8A 3RAMA 1CJUA 1JJHA 1LEOA 3SFGA 1F9HA 3AODA 4P75A 4DR5F 2XMKA 4ES2A 3T1HF 2J0QD 4F3OA 3VHQA 3V4IB 3MEDB 4W98A 1Q1KA 1AT1B 2WB4A 1WI8A 1OWXA 2B9XA 3FEXB 2M4MA 2H9ZA 2R7OA 2MXYA 1VBXA 2CWKA 4YHHJ 5HN0A 4CTAB 1JX4A 3KJFB 3KJNB 1K8AT 1J5OA 1VQKS 2BJ7A 1RAAB 3C3LA 4P72A 5EWFA 2XS5A 3TAMA 3I4HX 1KFSA 4C3KA 1RAHB 3MEGA 1Q16B 3DHXA 2AYEA 3HVAA 3H59A 2R8GA 2V8VA 1X5PA 2KT3A 4FF1A 3W9JA 3CIMA 3M9OB 3BQ2A 4QWBA 2OFHX 4LFAJ 4LF6F 3G9CA 5L38A 3H5XA 3D0HE 3SQGB 1N33F 3DLGB 1WKJA 2OPSA 3N0VA 4IRCA 2H65B 3JTNA 5KFYA 3DOLA 4DSKA 2RU9A 3QZ8A 4N76A 1V5IB 2WONA 3PRBA 1O51A 1S1WB 1QAXA 2GIRA 2QJ3A 2WCXA 3HP6A 2HWHA 3DRPA 3QLHB 2B5JB 3HT0A 4OYMA 1G4CA 1EKSA 3PHEA 4XDDA 1Q78A 4ZVEA 4B3RJ 2XGQA 2QGFB 1S12A 3PTWA 2ASJA 4CH0S 2MTLA 2A6MA 5G0RB 4JI2J 4URQU 3SEOA 3QSYB 3KK1A 3FNNA 3I55S 1W25A 1RWUA 2KHCA 1NJWA 4NA3A 3G8SA 2NPIA 2F8EX 2CYYA 2CPHA 2XY6A 1XMOF 5H1SV 4M95A 4MIAA 2FVCA 4PYDA 1R6VA 2OIHA 2IRUA 2YKMA 4RNFA 5I4MA 2L08A 1XQIA 3BPDA 1UEVA 3LGHA 1BUXA 4PUOA 4GKJJ 3DI6B 2IC3A 2CJYB 2EXUA 1D0EA 1FXRA 5KAKA 3GYNA 4XAKA 1ZM3A 2FUG9 1RT5A 1SJ1A 4LF1A 1CS4A 4C97A 1M5SA 2BQ3A 3IS9B 3GPAA 1R8BA 5A0YB 4JV2A 1VRQC 1VJWA 2W2NP 4HDHA 1M1HA 2AU0A 5IV4A 4LF2A 4MTPA 1XMBA 4C8NA 3SCJE 1NCLA 5HJXA 1XR7A 2RILA 4HEA9 1PYSB 3PJ9A 4KSEB 4WU2A 3SCIE 3SDEB 4X62F 3EGNA 4DG1A 3MM5A 3C14B 4DSJA 1M5PC 4QU6A 3QFHA 2M8DB 1G3OA 3PHTA 2AGOA 3EGVA 1S5ZA 2V0NA 1VC0A 1U7LA 2P2CB 1HBUB 2F9DA 2MKHA 1Y00A 3BPSP 3MHYA 3NKYA 1VK3A 4OYBA 2GMJA 1S1VA 2QE5A 1OY6A 5CZXA 1PAEX 5H9EK 3I5AA 3VF0B 3TZYA 1NB7A 2KRRA 4A8XA 4ETXA 3ET6B 4QYZK 1TMMA 4O3SA 2RVJA 2DIUA 2OMOA 3E3XA 4KGVB 2J0SD 1NJXA 2CZVC 1PYTA 1KR4A 1T02A 1IWAA 5DZ6A 4TVAB 1UW9A 3KLHB 2AGQA 1RHKB 3C16B 3FK4A 3M32A 1IWGA 2FYXA 5F8HA 4WXOA 5E3QA 4NASA 2RDJA 3PM9A 2P5VA 2P9GA 4CNZA 1YBUA 1C1BB 2CNNB 5IOLA 1XEZA 1RSCA 2CPJA 3AHPA 2P9EA 1B99A 1EB0A 2GGPA 3BSAA 3IG1B 4AXJA 3QJPA 1KS2A 3QRPA 3VWSA 1X60A 1H7WA 2EFQA 3AXMA 3QAUA 1RT1B 2ZVSA 4YB7A 3CDEA 4ZIVA 3EZ5A 2Z2ZA 3E2EA 4IQMA 3V2UC 3RBEA 3DYAA 2UUBF 2POKA 5L9NA 1Q5VA 1YK9A 3M9MB 4PUOB 4USHA 1U0HB 2RJZA 3I5CA 4FYVB 1NPRA 3FBEA 3KHRA 1RDRA 4RU2A 2P6TA 5HMXA 2U2FA 2EW9A 1S6QA 2JOQA 3KDOA 4V1Ak 1TL1B 2V4JA 2V4QA 1TV6A 4WFYA 1N0VC 2YY3A 1M1KT 3OD2A 4EYIB 2KDOA 3TZWA 2HURA 1NKCA 3HMJG 2AJ0A 2ZHBA 1WC3A 3RR7A 2F4VF 4LFBF 4ZHRA 3A8KA 4I6AA 1HWUA 1X4GA 3RW7A 5DQGA 2WOMA 5LMUJ 5EUHA 3HHEA 4DL7A 1FO1A 2CKWA 2AIRB 2DHXA 1U1PA 2Q43A 1KRPA 3H90A 4KFBA 2FLPA 1N88A 1EP4B 1I51B 2VQFJ 4OYIA 2XTJP 4Z7CA 2XI3A 4RBVA 1X9MA 4YR2A 1L3TA 2HHHJ 4MK8A 5IQ6A 5MLCV 4M5NA 3NNHA 1U1QA 5K8PA 2C2OB 2JHEA 2G1DA 3NY0A 4Q43A 1MU2B 1HW8A 2HHUA 2MSSA 4YDXA 3LP0B 4FS2A 1RACB 2GQ2A 1WKKA 3TANA 3M4XA 4O4RA 2B7BB 3UN2A 4OI2A 4BS2A 2CWXA 3OSNA 1RCOB 3QT5A 2F7VA 3ZTPA 4UZBA 4ENOA 1YZ7A 3S1TA 1C1CA 4LF9F 1HNVB 2J0XA 3QWUA 2W8LA 4ZVHA 3C16A 3W2VA 1Y11A 5DG8A 1WC5A 2QSWA 2MDAA 3A3OB 3LP1A 4M63A 2D7SA 4QIVA 2BE9B 1QE1A 2HPUA 2WVCA 4LJMA 4NLPA 4NLWA 4PPZA 4EO6A 3HF5A 1REGX 3R97A 1BWEA 2XM3A 3GYGA 5AJ3F 1CULA 3HFZB 3CD5A 8ATCB 5GAGI 4JI8J 2W7OA 4DV4J 1C4AA 4NLOA 5LL6d 3FRYA 1I94J 4FNIA 2GHWA 2RD5C 3GCWP 5FIIA 3MUVP 2BZ2A 4KPYA 4PQAA 1P27B 4TLQA 2R2SA 3UI3A 2ZBPA 4IG3A 3EGZA 3MMCB 3PDNA 3MFIA 2RSQA 3O6QA 2C2ZB 4ZPVR 1L5UA 3RR8A 4IOCQ 3SFUA 2ZOFA 1TQLA 2EC2A 4DUYF 4X4UA 1EHWA 3QT7A 3BEGB 5KTQA 2KXNB 1C0TA 2YX1A 2F4FA 4CLYA 1K73T 2IC3B 2O01C 3UNGC 1BQNA 1KONA 4CQ1A 3WC2A 2F8MA 2HQCA 2PFFB 2DK2A 1RT5B 3OQ2A 1SC1B 1J27A 1RT4A 1X4BA 2YNFB 3HHDA 4C0BA 2A1BA 4OMFG 2BX6A 2BDPA 3PG9A 1VQYA 2LYVA 3PNIA 3NWGA 4FYWB 4ALZA 2H4YB 4CLKA 3IA0A 5DJBA 2CFXA 5ADZA 1ITPA 1Q8KA 2EFGA 5F8NA 2MKCA 1Y5IB 3CJ8A 2OTJS 1XNQJ 2C3UA 4Y0FA 3VVUA 2FJVA 3KG4A 2GJ2A 4YFUA 4DHVA 1OPIA 1H74A 1MG7A 3HXMA 2XSJA 3RBZA 2VZ9A 5LJ5Y 4OLOA 2OPQA 2ZBQA 4XDCA 3NMRA 6AT1B 4A8OA 2DIVA 3FCVA 4HLBA 4M1KA 4HT7A 3EMTA 4ZCKA 4BLGA 1GMUA 3ELHA 3SQGA 1UFWA 1LNQA 2HIYA 4J9VA 4DF4A 2DRAA 4EMDA 3JQKA 2BABA 1FXDA 1SKUB 4EFAC 4FXWA 2N3LA 3VAHA 2H48B 1YRUA 2LEAA 4G3IA 2OMLA 2BJEA 2LP4A 1HHTP 3BGFA 3ITHB 5B0CA 3PZPA 1EETB 1W26A 1NSAA 3FKBA 1VQPS 1RT4B 1K0TA 3I31A 3MM6B 4MJKA 5LMNF 3TUPA 1FNXH 1G2EA 4RW4B 1OYEA 1YGYA 2I38A 4BC9A 4P73A 2AYGA 1FNOA 3L95X 3K89A 2VBWA 3FRZA 3MGJA 2ZJPQ 2Y1IA 2E44A 2UUWA 3TX8A 2R7XA 3FC9A 1MROB 4FBTA 3P8BB 4ZPAA 3KYLA 2XMUA 5E7OB 3W7BA 4ED3A 1X0FA 1W2BR 3DOKA 2DHSA 1VMBA 3EDQB 3AD7C 2GNKA 4LF5F 2W2PP 2R3VA 2EFOA 4O23A 4YN3B 1N5YB 1B3TA 1AFIA 1DY3A 3L7UA 1P9YA 4C3LA 5KFVA 2HK2A 3D68A 1VOMA 2FVPA 2Z8QA 1X8DA 3G6XA 3CCWA 3W2WA 4J9NA 5ETTA 3K0JA 3I0RB 2HG4A 2RRBA 4DPUA 4MKYA 5HVFA 4JI4J 1UWBB 2V8GA 2PMWA 5L1IA 1R27B 4Q8FA 3DMJB 4L3KA 1RTJA 1ZETA 2E9RX 4LF6J 3M6WA 2MEWA 2WONB 4NMXA 3GIKA 4ZP6A 1JLEB 3POTB 1YQHA 4J9LA 4DOZA 3M30A 5A6WA 3CCRS 1RA6A 4KKOA 2B3TB 3A8EA 4M5IA 2ZNYA 2I5JA 4XPEA 2A6OA 1KQFB 4I6YA 2DHGA 5HVGA 5J1PA 1QTMA 4A8SA 3CO0P 2VJVA 2CQGA 1TELA 4OX7A 2I9SA 2ZFHA 3DOKB 4WP9A 3SIPB 1IN0A 4A4JA 4PG4A 4B3RF 2HRYA 4M5DA 2J76E 2W1BA 3US5A 3W9HA 4X64F 4O3OA 2CZ4A 4JP8A 1RT3A 1TP7A 2LQ5A 3M2RA 4K2JA 1SJFA 1H72C 2K3IA 4WWSA 4KT0C 1AA1B 4Y65A 3BKTA 5IC6B 3QPIA 4DSEA 2DEIA 2KU7A 3DRRB 3THTA 1PC4A 1TUGB 5KFBA 2F8HA 5J2NA 1GH8A 3TVKA 1OSDA 3T5LA 2MKSA 3I0SB 3K2YA 4NMLA 1RTHA 2Y1LB 3NGTA 5KFGA 1XN9A 4WFXA 1NK0A 3CCQS 4HTJA 3PY8A 2CXEA 3MEDA 4KO0B 1XWLA 4DX7A 1LWEB 4UTGA 1M5OC 4OHYA 1Y5LB 2I0XA 4JI0F 2E1RA 3HZGA 4PWDA 1H38A 4NLUA 4YS2A 3IR7B 4JV0A 3VZIA 1ICEB 3ZZPA 1HNZJ 4PYAA 1DJ0A 1FDNA 4DEZA 1GNKA 4J90A 2DPJA 2HNYA 1H98A 2KKHA 2MHNA 3OTBA 1XMQF 1LFWA 1Q0NA 4CYUB 4FKYA 1RT3B 2BJ8A 4U95A 4X62J 2HW3A 2IMWP 1SV5B 4NZ7A 1JJ2R 2V34A 3TARA 1NBEB 3CCTA 2FGOA 4NCGB 2ZC3A 4K5SA 4EUVA 4K8RA 3KJQB 1IM6A 3JSRA 1KDNA 2M2BA 2ADBA 2CDRB 5BYRA 3DCAA 1T11A 4PPDA 4ED1A 3T1AA 3HHKA 3I32A 4P74A 2PIIA 4DR2F 3KG0A 3CJRA 2H5JB 2H4WB 4F0MA 2VB6A 4UQTA 2OSRA 4ZVOB 3CB4A 3P5TL 5EX3A 1WELA 4L74A 1ZM2A 3FFIB 1B4SA 2LLZA 3R5DA 1NSQA 4OYPA 4R5PB 2D9PA 2QSFA 3U02A 5AT1B 2FLNA 1CVJA 2GQQA 1JLAA 3A13A 4CLZA 4IQXA 1T0TV 2UUAF 1U26A 1P9QC 1K1SA 2E1PA 3NRBA 3Q2TC 2JLEA 2RB7A 1N48A 5A8WA 3OTEA 4Q45A 3GILA 4IRKA 4Y2MA 4OIXA 3NGKA 4UOFA 2RQKA 1F5AA 2V2ZA 2LCWA 3A8IA 1X4EA 2IJNA 2V6AA 1FFSB 4USTA 2Z2MA 3LPEA 3DRRA 3TZXA 3CVKA 3RRGA 2RKIA 1R31A 1WC0A 3ZFVA 5D8HB 4A8YA 4UY85 2YPZA 4RBUA 2KO1A 1REVA 1S77D 4DR7F 2H5IB 2V4JB 4QWAA 1WG5A 2BJ3A 3PXGa 1YRXA 1O5JA 2YWKA 2KM8C 1NLKL 3LUYA 4ZPCA 4F26A 4R8UB 2GIFA 2ZHOA 3K5MA 3RJMB 1S9FA 4RW7B 3THVA 4G6VB 1EETA 4I2QA 4WIQA 4DUTA 4ZK7M 3CXCR 4B9SA 1NDKA 1YJ7A 3LP1B 1HBNA 2ILZA 1WTBA 3MR5A 1PBAA 1FKPA 4G1PA 4LRBA 2YWHA 1CJTB 1U1KA 4F67A 2UVUA 2EK6A 1ZA1B 3PJWA 2C28A 3HJFA 2BANA 3R6LB 4C4WA 5EWGA 1S10A 1RBLA 1RHMB 3M1VB 1ZPWX 1N6QB 1WHWA 2FIUA 4E0DA 2X1FA 3IBFB 2B4OA 3TW0A 2VIHA 2DY9A 1B64A 2EBEA 3N9UC 3HLUA 5JXSA 2N4CA 2W01A 1N4LA 2X51A 2VBYA 3OL7A 1U1NA 4LIRA 3Q23A 2XS7A 3MURP 3NOGA 4FZVA 2ZBIA 4DN9A 1BY9A 4RO0A 2CDQA 3BYRA 2JRSA 1DRZA 2YXLA 1BHNA 3HFKA 4OI4A 3MR6A 3K5OA 4TU8A 4BWMA 2AZ1A 4BC7A 2XNQA 3D4JA 3ET6A 1NB2A 1R89A 3IC1A 1F9EB 2OO4A 2WK4A 4OZ0A 3CD0A 2GO8A 4K7QA 4Y2AA 3MAQA 1UW4A 2C3PA 3ZTRA 3J80Y 3BJYA 2ZBCA 3AQPA 3CJ4A 3IP0A 4U7UK 5B0EA 1Q53A 3T1YF 2BM0A 2WB1D 3ZZUA 3MPUB 5CQGA 3K8VA 2ZWPA 5A8WB 2Q6CA 2VFSA 1VQ7S 1APSA 1S1UB 3DLKB 3FMWA 4GO5X 4UUWA 2ZH6A 5D0HA 2BKPA 4DQSA 1RI7A 4YOEA 4ECWA 2PDAA 3PRVA 4OZ1A 1E6YA 3LOUA 4C2MA 1QJHA 1WSVA 5HLFB 3F44A 3HVTA 4RKUC 5I42B 5KFJA 1OPZA 2NXCA 4DJBA 3ONQA 4LF7J 3JQMA 4H4KA 5A8RA 2XYPB 5J1NA 4NXMJ 2CPYA 3NNCA 1D8ZA 4C6AA 2HQIA 1FEHA 2YKNA 4DL6A 4K50A 4YMEA 3AOAA 1FVSA 1SC6A 3DRSB 2AT1B 4Y2IA 1YX2A 2ZH1A 2UUAJ 4C0HA 3N6MA 1UP1A 4KO0A 3TVZA 7AT1B 2N7CA 5C25B 3DLEB 4O4GA 4F0HA 3NG8A 3QNWB 2JVOA 4MH8A 3PW5A 2WOMB 1NMEB 2XMWA 3AJDA 4K4TA 1RTHB 4DV5F 4FBUA 2UUBJ 2WVDA 2MYFA 4QIWD 3AH6A 3KXDA 5DZ7A 2W9CB 2NREA 3UWTA 5HBMA 2WTFA 3CCZA 4Q8EA 2FJAB 3UPFA 3ILLA 3C8YA 3MM9B 4Q2MA 4H4MB 5A2QY 1R8HA 2DB1A 1ZZNA 2Q1LA 1HHSA 4KTQA 4NXMF 3C46A 3J7A1 3ILOA 1UJ4A 2HKEA 3OJUA 4WZMA 2OPPB 1GK8A 4B17A 5JMNA 2N82B 2AV5A 2DGUA 2GAGC 3GLJA 1VK8A 4KGZB 3Q89A 4HACB 4ZVSB 2PN6A 3I96A 2YNGA 3I5BA 2B43A 3SQOP 3S6EA 1NEEA 2HQFA 4YEAA 4QR1A 3V6DA 1SH3A 3AD8C 1AZSB 4OX9J 1MMNA 1YZ6A 2DNHA 5F41A 4CT8A 2YKNB 5IT0A 4DF8A 2LU1A 1VR6A 4KGMA 3MECB 3NGRA 3MM8B 3JYTB 2HHXA 1WF1A 5ETVA 2RQ4A 5KG6A 2B9YA 1XNRF 4IFYA 4PCQA 3BO2A 1FDBA 1XBWA 3ZC4A 1Y10A 4OHWA 2DY1A 1UJ5A 3IS9A 3N5FA 1D8YA 1HFEL 1FEEA 1VBYA 3KUEA 5J1EB 4DV6F 3GV5B 3ENVA 5E5NA 2ZZMA 1VBKA 4B3MF 4PWDB 5L1JA 1TL3B 1S0OA 1RZMA 3D0IE 2ZC4A 2CNOB 2X7IA 4CNYA 1UWAA 3KLEB 2VICA 4DR2J 2B4UA 3I9V9 5ETNA 1FKOA 4X4PA 4DS5A 4IRDA 3CULA 4Y6IA 2DJWA 4LF9J 1SPBP 1YRTA 2QC3A 3IRXA 2BUNA 4RJVA 3H2VE 1Z2ZA 3LO3A 3D3BJ 1QM9A 1A7GE 2M52A 1GXUA 4F04B 4MYUA 4WF9Q 4CM2A 4EO8A 2GW8A 4JYAF 1SIZA 2ZUGA 3DYAB 1TU0B 3KHLA 1SKRA 1HNWJ 1E6VA 1ZTWA 1NJYA 5U47A 5HP1B 1YJNS 1S97A 4EBEA 1N5VA 2VDIA 3JSYA 3ZZZA 3UD5A 2Z30B 1Q86T 1VFJA 4UUXA 4JI8F 4B3MJ 2QLFB 4OHXA 2IA6A 3VV2B 4LF5J 1P1LA 2B7CB 3JQJA 2M3DA 4JUZA 5KFMA 4XK8C 2OUGA 4WK1A 2OH2A 1URNA 3VAFA 1F5BA 1WF2A 2FHKA 1EP4A 3CDUA 4QPTA 3TNVA 4ZLJA 1O8BA 5KOXA 1MMDA 3KHHA 3PYEA 1PGZA 2KZZA 4I4BA 4JOUA 4JV5F 1HLWA 4CLTA 4E2FB 4KHPF 2AYMA 3A3PB 1I1GA 2QTWA 4JI7J 4K4SA 4A48A 1EARA 1CJVB 4ANDA 4USUA 1J5EJ 2DO0A 4C7QA 3CJKA 3W1YC 2QYGA 2ZVIA 2Y8YA 1FJCA 1TL4A 4RW6B 1H2VZ 3I87A 4R25A 4CI0B 2C2NA 5HMZA 4HI1A 2AP6A 3MM8A 4KH1B 3JYTA 1QSLA 4JI6F 4TNOA 3TP2A 3BQ0A 1N5TA 1REVB 3PIPQ 1K9MT 3K17A 4PG7A 1QAJA 4F4AA 5J2MA 4K5RA 2C3MA 3JTPA 5K8OA 5E2QA 2AQ4A 1IR1A 2GMLA 3MAAA 2QL9B 1RJJA 2UVWA 4MKAA 4ZVPB 1VQ5S 2BOPA 3KK2A 4YB6A 5A0YA 1J5EF 1CEZA 3CIZA 4KV8B 4ECRA 3WX8A 2OHDA 2HAFA 1HBUA 1FDAA 2WBMA 3BGUA 2XY5A 2CPXA 3KLGB 4OYZA 1RAEB 3ZNJ1 2W8KA 2XY7A 4IOAQ 3ITHA 4QR0A 1H6KX 2CJQA 3KKFA 4AFFA 1LW0B 3OLAA 1UKUA 1Y7PA 3H8YA 5A8KA 2XLKA 1E6YB 2DPIA 1NDPA 1HQEA 2XNRA 4LBPA 2E7XA 3AA8A 3LGNA 5T7LA 3U1MA 2FQQB 1LXJA 1IBCB 3NCQA 5KT6A 1U1LA 3G82B 2KJWA 2KFYA 2FLLA 1NUEA 2HK3A 5D3GB 4P7TA 4I68A 4U9RA 3Q2SC 4O4GB 2E1MC 3T5HA 1CPZA 3M32B 4IH7A 4U96A 4B9VA 2ZH9A 4LF4F 2QA4S 1FTCA 2FC9A 3PACA 1PAUB 1YDLA 1IR2A 4PQUB 3D6MB 3DLJA 3MMJA 3DMJA 1NPKA 1V3SA 2QO3A 5C25A 4B02A 5CYJA 1IBLF 2DH9A 1WOPA 4L75A 1WG1A 1S1XB 3I0RA 2VKRA 1FNMA 2FJBB 2QYCA 5KT3A 4TU7A 2PSZA 1JLAB 5D4NA 1SCJB 2D3ZA 2IFXA 2QT7A 1CJVA 3FGVA 4MKBA 4NYPA 5L46A 2JLGA 3NCPA 2DVIA 3RBXA 3CW2C 3EVMA 1FRKA 4Q5VA 1HYSA 2LQBA 2LDYA 2NYHA 3QYYA 4ZPBA 4GVBB 9ATCB 2KVIA 5HLFA 5D4LA 2DNQA 4ZJOA 1TR0A 1VQMS 1L3SA 1HI0P 4WU3A 1FRJA 2GVZB 2VL1A 2DTJA 2ZOGA 5ETQA 3JAMY 2M7SA 1HIYA 1S9GB 3EXCX 3BGLA 3TAPA 5KFKA 4UY8T 3EWGA 2W7AA 4X4VA 2J8SA 2O66A 5J2MB 4F2RA 2IBOA 2IDLA 3SSSA 1U6BA 2F1FA 4C11B 3MMBA 1RYRA 4DR4J 4HR2A 4QPXA 4PXDA 2KM8B 3JTOA 2J5AA 3QIPA 3SYZA 1D9FA 5C42A 4CLPA 3ISND 2HHSA 4J5OA 3IGNA 2Z56B 2ASDA 1B0TA 2Y9HA 1NNDA 2R42A 1FFGB 4ILRA 2PA3A 2ZUAA 3R27A 3V6KA 1FJ7A 4Z7YA 2BBEA 1O6XA 4X64J 4HT5A 3ADAC 4FDFA 4F36A 1IBKF 2Z2YB 4ZIWA 2FJWA 4ILMA 2VV5A 3MCOA 3QLHA 2GS8A 4V19X 2APOA 3D54A 4I0WA 4C8YA 4YDDB 1U25A 2QL5B 1VJQA 1RTDA 2H3EB 4IDKA 3JSBA 2VASA 1KLNA 4DR6J 3UVJA 4RUBA 5KFLA 2HQDA 2VFUA 3UQSA 1YJRA 4LT6A 2KTQA 1KVKA 2IM0A 1P8GA 2DR8A 1EQ0A 1Y3JA 2DNLA 2OD6A 3H98A 3J81j 1T9WA 1B70B 4RUHA 1LV5A 1RWNB 1XIQA 1WWHA 2FZKB 4URGA 5E41A 4F4WA 5H9EJ 1QSYA 1K0VA 1V3RA 4OYOA 4LIWA 1KQSR 1GXTA 2GHVC 5KT7A 1KVJA 4OI3A 2K1RB 4C11A 3ICLA 4DL0C 1T05A 1CG2A 1LK7A 2H54B 2QA1A 2YQ0A 2K2PA 2WBRA 5KG4A 4LRAA 3H2UB 1JB0C 3CCSS 2E9ZA 1NO8A 2ZZTA 3ETOA 3DOMB 3AD9C 3FZ2A 4I2PA 2EVZA 2C3OA 4Y2CA 1S1UA 5EWEA 2HMIB 4IR1A 2W4DA 3CD7A 3DU5A 1IUJA 2NPFA 4AUKA 4WTOB 3W9IA 4GKJF 2IJRA 3MM6A 4X66F 3R2CJ 3QT6A 3KHGA 2HWTA 4LBHA 4FYYB 4PZVA 4IG3B 5D0GA 1JLQB 4F3MA 5F0UA 3LWLA 2DR6A 2XMJA 4DV7F 4F3QA 2O3DA 4B9NA 2JEIA 2EK1A 1RWKB 3FCHA 4K4UA 3RG6A 1URRA 3NAIA 1DAXA 1WDTA 2NR0A 2YQ1A 5LMUF 1I94F 1CLFA 2XC9A 1D9AA 1UPPA 3N79A 2FVSA 2OEKA 3OTOJ 2ERRA 2V4RA 3CWJA 1LQ9A 4K59A 1HBOB 2MZRA 4MIBA 3O44A 4OJ3A 5E3PA 3AB4B 3TQEA 3R5AA 3ZZRA 3BSNA 1RBOB 1JKHB 1F2HA 4O0NA 3GFHA 4ED6A 2DEJA 3RU0A 4DZDA 2R8JA 4YUDA 5HJYA 3NWRA 3KMSA 3EPIA 3NP5A 2CQ2A 3ILIA 4WXWA 4OX6A 4ZA1A 2W9AA 2JWNA 4LVNP 4QOTA 3WBZA 4WFAQ 2ATLA 2RMLA 4C8LA 3FBCA 3LWMA 2KN4A 3M2VA 3MM5B 1FERA 1LW2B 1WEZA 1SI9A 2MLXA 3NGSA 1CJTA 2AW0A 1O0PA 2XZTB 2FJDB 3QGHA 2PEHA 3R5CA 5KFUA 1WI6A 4DX8H 1R0CB 5BXIA 4F4YA 3UR3C 1XR6A 4ZOSA 2Z58B 4DDFA 4K4YA 3UDCA 1R8PA 3D1OA 3R5GA 1U8WA 1RAOA 1SUQA 2YNHA 3BBCA 3T9NA 3WDOA 3RBDA 1FE0A 1ZZFA 3GQCA 4MAKA 2N7YA 2RHQB 2DGXA 4C8ZA 2UUCJ 3T6JA 2AKWB 4OJHA 1F9FA 3LAMA 2ZJQQ 3I0SA 4ECVA 3N4WA 4DX5A 1S4FA 2DITA 3IFEA 4DPYA 5KFHA 1QSSA 2OD4A 1S72S 3W62A 1HWJA 2CJAA 4WFBQ 1OIAA 3CMES 4NA1A 2NXUA 4CLLA 2BV3A 3KK3B 1CJUB 1VCTA 4HH1A 5B0GA 3CCVS 2F65A 2BE2A 3M6UA 2B6AB 4JI1J 4J91A 1FK9B 4IH5A 1LOUA 3SBMA 1OYDA 3U1NA 4NLYA 2B8QA 4ZN1A 1HI1A 1LW2A 4DL4A 3BR8A 1OO0B 4I67A 4XPCA 1OQ6A 2JH3A 4BCAA 4LF4J 2EG2A 5KFAA 1HR0J 5M2RA 1FRLA 3VGSA 2HMIA 3MR3A 3BKFA 3BZQA 1M5KC 1F1BB 2BKOA 3M2VB 3TUJC 4ANCA 3CDWA 4Z2XA 3PR5B 1YBAA 4NI2B 3LH2S 4IG0A 2D9OA 2EWHA 3IO1A 2AF6A 3E01A 4PXBA 1DFDA 2A18A 1IKXA 2R8KA 2CNKB 1FA0A 4Z37A 1UA1A 1TFWA 1VQ8S 2HHWA 4USKA 1MSWD 4ZJLA 1RLDA 4N77A 4CRJA 1EX8A 1KOOA 2QMWA 2WW4A 2OKQA 1NHKL 1RUSA 3C15B 4NCGA 2GZOA 4ILLA 1C0UA 4KR0B 4NE9C 2KI2A 2QMUB 3PKMA 2FLOA 4L73A 3TO8A 5IFMA 3QQCD 1PC5A 2DXEA 3V5RA 1M1GA 5KFZA 1HR0F 2HHVA 1RKIA 3W2WB 1RAIB 4IKAA 4JV1A 4LFCJ 1QLNA 2AEJA 1FWKA 3DM2B 4FVCA 3SSRA 2FVQA 2XHCA 3GJQB 2G1HA 2LA4A 5C7PA 1ZYQA 2MZ1A 1QE1B 5KG1A 3DNCA 2EI5A 2V8HA 3GFZA 5IWAF 2XBPA 2D3OR 4JI4F 2EBGA 4DCOB 1BXNA 1FKOB 2YKAA 3VAGA 1VDHA 3B4MA 2CQPA 1HWIA 3FVYA 3K5PA 4B3SF 4ZMMA 3OLBA 1KHWA 1AUDA 1QVFR 4FF4A 2GVZA 2Y0BB 3GIRA 3G96A 3BBFA 2IRYA 4OX8A 4FF3A 4LSLA 3FMBA 5D4OA 1RWPB 5ETKA 3OL6A 4DU8A 1N34F 4ZVQB 2VUGA 5KT4A 5IT9U 5KFNA 2GHPA 2R9LA 3H4DA 2VA2A 3M8SA 3T6BA 1BMQB 2C1EB 1HNXJ 2AYBA 4MK9A 4YR0A 4FF2A 1AYEA 2DNOA 3PEHA 3G87A 4H4OB 3CCES 2E5IA 2ILYA 4ZS6A 1ROFA 3K57A 3P49B 4YQWA 1KKHA 2CQ3A 3AOBA 2CRLA 3UFCX 3SV4A 5HI7A 2MQQA 2I5JB 3RAXA 3OR2A 1UFKA 1DBDA 4LSNA 2BJ1A 3OTCA 2ROEA 4WIIA 1NHUA 1YJTA 1U1RA 2QMXA 1U6FA 1M90T 1VQSA 3N5BA 4CO3A 1VRTA 2MHEA 2O1PA 1A9NB 1GMVA 2ZNZA 3Q8VA 1RADB 5HVHA 1KN6A 4A8MP 3IWNC 1N33J 1FRHA 4F25A 2JC0A 3QJLA 1UA0A 2YX4A 4PXCA 4Q0BA 1GTEA 4NLRA 4NLXA 4OYXA 4D3GA 4ED7A 1C0UB 2E9TA 1U48A 3BBBA 3OTDA 1G6BA 3SI8A 1ZAWA 1OY9A 4Y3CA 1Q8LA 2NSBA 2PMHA 5L39A 2GAHC 4FN5A 3NL0A 3QT8A 1R0AA 3J7Z5 2W7PA 2XWYA 4I7FA 1HNVA 1CC7A 2IHR1 2CJ9A 2YKQA 4ZPTR 3OVBA 4QW9A 4DL3A 1Z4UA 1YJ9S 2K1RA 3R6GB 5RUBA 4V19J 4B3OA 2PO4A 2COLA 4TY8A 3UE2A 2JJ4D 1F60B 1WHYA 1AXQA 3ETMA 4UZCA 2EKNA 3DXBA 4LUBA 4DXLA 2U1AA 1AROP 3AY0A 3H20A 3S8SA 3W5XA 1HNZF 1IQZA 1AUSL 2M8HA 2HHQA 3IMQJ 2XCAA 5HSPA 2VPWB 4GVLA 1QD1A 3I82A 4ER8A 4CLSA 4RW8A 1R7IA 4IDKB 2R7WA 2OI2A 1FRIA 5GAEU 4I64A 3H25A 1YG0A 2DNZA 2R7QA 2XWXA 3PEJA 2VQEJ 1Y5NB 4ZN3A 2JEFA 2HZAA 5IXUA 2UXBF 2FZCB 5FDLA 1FF2A 4AXIA 1LWXA 2UV8A 4DPWA 4NLTA 3U7JA 1T7PA 2BM1A 1YHQS 3A8JA 3WIUA 3IAS9 3QO9A 2CAJA 1UPMB 5KFTA 4LSNB 4CDIA 3KLFB 5HL7Q 5KG3A 4AD6A 1FFWB 5C42B 4RNNA 3QSIA 1FT8A 1V9OA 2GV1A 2GC8A 2HFOA 2ALYB 3TX0A 2Y3YA 3T5KA 4DFMA 3BV8A 3KLGA 1NH8A 1JLFB 3MM7B 5F9LA 3Q0AA 2V9WA 1RISA 4NRUA 3DDKA 2IM2A 3QBCA 3R1HA 4O0IA 5CH7B 3MOJB 3HJVA 3M2UB 1NK4A 2OSQA 4HDGA 2ZEJA 6FDRA 4EEYA 1HL6A 2BQUA 1N32F 4USVA 2V68A 2QFIA 4GO7X 2DGQA 2DNPA 1V5VA 4IG0B 1OJ4A 1HNWF 1ELOA 1Z2LA 3PX4A 3MTKA 1WC1A 2EFPA 1KTVA 4R8UA 1SBRA 1RT6A 4RPFA 3MEGB 2G2OA 4Y2KA 3DRXA 4A8WA 4LVOP 1MWQA 3IAM9 3KOAA 2FGCA 4J7CA 2YH0A 3C66A 4OQJA 3S01A 1KQGB 2E66A 3ISNC 4L72B 2DNYA 3NCRA 4FKXA 1S6QB 2HGMA 4NWBA 4AE5A 4DMZA 5C5JA 2MQMA 3EGWB 5KFQA 2GQCA 5FLXY 2R2UA 1NKEA 2RS2A 2DBBA 1K44A 2BE2B 2LXFA 1K1QA 1EZZB 1HMVA 2AJ4A 1PG5B 1U24A 1UETA 2MZTA 2QLBB 2XO6A 2OAUA 1H73A 3LGMA 3QFWA 3PYDA 2O67A 4P2SA 3ZTSA 2XMAA 1JXVA 3CJ5A 3GFYA 2PMZD 3HVRA 1N0UA 3M8PB 3IR6B 2R2TA 1TK8A 3K7RA 4FNHA 2N4DA 2L9NA 4BWJA 3TA1A 5KFDA 3T1YJ 3PFEA 4MYTA 4C8KA 1F3FA 3EYZA 2FJXA 3QRQA 4B9LA 3OVAA 2KYXA 2WAQD 3LP0A 3KLVA 2MKKA 1I5OB 1S48A 2GCFA 3D66A 3ENQA 5AJ3J 3E51A 4W90B 3HHLB 5JUMA 2ZKTA 1Y4ZB 3K8WA 4KQZA 5BR8J 2CQCA 4TKTA 3CCUS 2E5LF 5L1LA 1TFYA 4B3TJ 2HQGA 3T41A 1KEKA 1BQNB 1L3UA 2AZ3A 2W9BA 4EWTA 5AXLA 1RTIA 3OFGA 4D3HA 2YPYA 5LSRA 4ZDNA 3SCLE 2HZVA 3H42A 5KOWA 4YB1P 3K5NA 3UNYA 3KLHA 4U7UD 4UOHA 1JXLA 3POTA 5CAAA 4CO2A 3CGIA 3HKZD 3CE8A 3OW2R 4Y00A 2XI2A 2LXIA 2IPOB 4ELVA 2OPPA 5B08A 6FD1A 1TKXB 1H2TZ 1BD6A 1WC6A 4LSZB 3W65A 5MAOA 3J81Y 3GCXP 1R3NA 3TI0A 4Q0BB 3W64A 1H2UX 3KJVA 2D74B 3Q86A 4OI6A 3R1LA 3BKUA 2G0JA 3VAKA 2BOAA 3OXLA 3PV8A 3MCSA 5KFSA 4QWCA 4XTTA 1SUQB 2E5GA 2OFGX 1UEUA 4P10A 3CJKB 4CO0A 1S6UA 4JV5J 4IUFA 2QLXA 2I1RA 3JSMA 5IQQA 4BHQA 2YNGB 3D1HA 4ED5A 1OMSA 5AE3A 3CCMS 1FJEB 2V9KA 1ZOTA 3DRSA 4JI7F 5SUHA 1Y0HA 2XMMA 1IJFB 1FI4A 3J7YU 3O5TB 2BYCA 1R6YA 2UUCF 2UZAA 2RF2A 3IG1A 4LR7A 4TY9A 3BSOA 2AX1A 5DS7A 4HKQA 5HROB 2RT3A 2AWZA 1HBNB 2W4PA 1HD1A 3CJTA 4MKVA 4IO1A 2QG9B 4OFZA 3J7AN 4DV0F 1TL7A 2QZ8A 3KK1B 3P45B 4N41A 4G1QB 2QX0A 2QLJB 2PEBA 4KV8A 3BO4A 2QLWA 1ULRA 4DR4F 1IBMJ 4K4ZA 1NSKL 1LKZA 2B8PA 1SB6A 4PAAA 1DURA 4CTAA 3J81U 1CQNA 3VAJA 5FDLB 3M8RA 2BRLA 1DZ5A 1GX5A 4EGLA 2G13A 1Q5YA 1X4FA 3NAHA 3OR1B 1JLQA 3O2IA 4DV5J 5B0BA 4CZCA 1PIEA 3BYPA 5I3PA 4DV3J 2ZITA 3V6HA 4DR3F 2IYIA 1FDDA 2L48A 1FX2A 3QAEA 2OGUA 4PR6A 3F73A 2MKJA 3KNGA 2MB0B 1RABB 5CCMA 1U0SA 4DU7A 5C2GA 4J9SA 2UVVA 4F2SA 5HAOA 1U49A 4CCHA 2G2YA 3CMQA 1PJ5A 2BMBA 4ZVGA 3TAQA 2BW7A 2CQ4A 1B0PA 2OPSB 3HZEA 4USJC 2GX8A 4USMA 5J1EA 1VQ4S 2HVIA 1AB8A 1TKXA 1XR5A 4GRSA 4RWWA 1PJ6A 3DGVA 4TY8B 1TUWA 4TYBA 2ZKUA 4ECZA 2UXBJ 4PG8A 1KVIA 1N5SA 1KQKA 2IYGA 1FX4A 5B7WA 1PO6A 3GP9A 3MI7X 5DETA 2C3YA 3WQPA 1IXKA 4R0EA 1RCXB 2AHOB 3IN5A 2DNKA 3CSKA 4ED0A 4DL2A 1N6QA 1D1UA 4ED2A 2IAJB 4W4MA 4KIAA 4LRDA 4ECSA 4IYQA 5B0DA 5KFPA 4FS1A 2AGPA 1PJ7A 2CPZA 3CJQA 4XO0A 1FRXA 5LMNJ 1NJIT 1XJWB 5DQHA 2DGVA 1HW9A 3N6NA 4YHHF 5DM7Q 2YWEA 1AFJA 2FHMA 2J6UA 1TK5A 2RAQA 4LREA 2MJUA 4PWWA 2BR0A 1R43A 3PO5A 3R2DJ 2PI4A 3O1LA 5LT5A 3QO9B 2MQNA 1X31C 3CCLS 1YI2S 2PI5A 3UDLA 1YJWS 1NRKA 5D78A 3EPGA 3IGVA 5L8RC 5C24A 2DNMA 5GADI 3MM9A 4DV7J 2D69A 3DDIA 4ZKAA 4NLSA 4QIFA 2PGCA 4I6WA 2M0GB 2Q6BA 5I3QA 1SL2A 1VS3A 3R3TA 2MQOA 3TJ8A 3VQTA 3L3CA 1IKVA 1RT2A 3B54A 3BREA 5KG0A 4GKKF 2Z0GA 3HFVA 4N47A 2Q66A 4X65J 3G86A 3T9ZA 3TA0A 4X4TA 3MD3A 4AT1B 3E01B 4OZ5A 3D5MA 1U4BA 1T9YA 2HFNA 5I42A 3DKDA 2N3OA 2J6TA 2VH7A 1JJCB 3HKWA 3KFWX 5HANA 1L3KA 5L1KA 2ABYA 2KHDA 2KJVA 2BRKA 5CYQB 3VTIA 2HNZB 3L09A 1U0HA 3Q8RB 1SC3B 3WX4A 4KRWA 3BS9A 3HHLC 3UDVA 1PKUA 3D1QA 4KAIA 4TU9A 4NRTA 3BGRB 1XMOJ 3MMAB 4ZP9A 1S79A 1R0AB 3T3FA 5GVQA 2DO4A 4NZ6A 2UUTA 3VGVA 4ZLPA 2EFVA 3KLIB 4JI2F 3CJSA 2J7KA 2H1YA 1RWOB 3HSZA 4OV1A 1JWWA 1Y3KA 1EQMA 4EYHB 4GMKA 3OXFA 2MQPA 2IA0A 3VALA 2EG1A 3VVTA 4F4KA 1UTAA 3S7RA 4DWIA 2CG8A 3QRRA 2IM1A 1WEXA 3PFOA 1TKTB 4J9OA 2FY1A 2CA9A 3R8YA 3CEDA 3UDEA 1H0HB 4IOBA 3DDNA 3AOCA 1I6JA 2I6WA 1UVNA 2HFUA 2BE7D 3DGPB 5F8MA 3MUTP 2DHAA 4NPOA 3RB4A 1JK9B 1TUVA 4KGKA 4A8QA 2YKPA 4DSFA 5CZVA 4K0KJ 2AJ1A 3G2XA 2HLTA 4M5KA 4X4OA 4PQUA 2G9OA 1JLGA 2RE1A 2LKZA 2KRBA 3EJMA 3KMQA 3V6DB 3F0NA 3NOCA 4OI1A 3CO9A 1DQ8A 2EPIA 3A12A 3FBBA 3Q83A 2XQCA 4DCJB 3JSMB 2ZH7A 3DLGA 4KHRA 3L7OA 4QIGA 4YP3A 2W9BB 5DO2A 4M5LA 1HI8A 2MKYA 1HBOA 3FQKA 5F3ZA 1PYOB 2XGPA 2VD3A 3D67A 3GIIA 4CLFA 3LAKA 4NYZA 3GV8B 3KG1A 3AFGA 1MWYA 2CQHA 2R8IA 5J2PB 3M05A 4PG6A 3M6XA 5HQ8A 2AD9A 4DFKA 1TK0A 4O3QA 4B9TA 1X4AA 4K2XA 1Q8BA 5AXMA 5B0FA 3TEHB 2VJUA 2OP5A 2YTCA 4HACA 1GX6A 2KZMA 1T03A 2UXDJ 2DR5A 2OEMA 4ANEA 2ZJRQ 1DLOB 2IY5B 2IJFA 4LRFA 4ED8A 3LPYA 2YKMB 5K9FA 2YNHB 1RAGB 1HQUA 5JVGQ 4TXSA 3H0PA 1RKJA 4OLPA 4CWBA 1ZH5A 2V8DA 4LR9A 5ITHA 3GYXB 3N28A 5KFOA 2JL9A 2V94A 5D0EA 4MK7A 1N5YA 2C42A 1EJ7L 1RAJA 2VFRA 4J9UE 4Q2LA 4A46A 4DS4A 1HWKA 3C15A 4IFYB 5D6GA 2F9JA 3DU6A 2RHSB 5DGBA 5IT9Y 3PW0A 2HVDA 4L6V3 3W2VB 2B5JA 3MWBA 2XYHB 1C2PA 2R7UA 1M5VC 1CBKA 2UXDF 3F56A 4DR3J 1TVRB 1BGXT 3SZ2A 2ASLA 4OX9F 1N34J 2UXCF 3EDRB 4TQRA 1VHIA 1X5OA 4NI2A 4ECTA 1UVKA 2LFVA 3D6FB 3UVJB 3K59A 1FESA 2SXLA 4JI1F 1W2IA 3G6YA 1RT1A 1UVJA 1VC6A 1NDCA 3BO3A 5E33A 5HMYA 1JLGB 1QUPA 1YBTA 1EIYB 4Q44A 4OJGA 5J2QA 1RHRB 5D0RA 2HBYB 2R7RA 2Y0SD 2A3JA 4YR3A 4DUZF 1SJ4P 2XB2D 2QV6A 1N56A 2G4BA 3MFHA 4RLEA 4OJ1A 4RUCA 1YIJS 5GAGU 3D2WA 1U2FA 1UEKA 2HHHF 2X1BA 2JC1A 1T9XA 1WSRA 5K14B 3V81A 4P7VA 1B7FA 1TV6B 3B4DA 2GFFA 2UP1A 3OPKA 4YB5A 2C2EA 2BJ9A 4CIOA 1SQEA 4LF7F 1F6TA 3QZ7A 3P96A 1FHTA 2P6SA 2RUSA 2KT2A 3TWZA 4DPOA 1B0VA 1HNIA 4WK3A 5HROA 3EICA 3ZZOA 3HO1A 5GMEA 2MGZB 1RLCL 4ZHRB 3T5JA 2YH1A 4RW4A 2WRMA 1S1WA 3A1YG 3VCDA 1X4CA 3ENWA 2G2ZA 4C3MA 2B0GA 1RTDB 1FD8A 1LFPA 3DM2A 4DSLA 3M2UA 3DXSX 2IM3A 2ZWOA 2X1GA 4AYBD 1N8RT 3P6YC 1MMLA 3EM1A 2X3DA 1TVRA 3DC2A 1EAYC 1NAQA 1WORA 2A10A 3GSIA 5KFXA 4UOGA 1D9DA 4F50A 3LP2B 3IWLA 1KWMA 4AQYJ 4LQ9A 2PA8D 2AJFE 5IZHA 3SMZA 4ZCIA 3D28A 3EE3A 5L9XA 1HA1A 1QAYA 2VG5A 3AQOA 2CADA 5CHCB 3DI6A 3JAMU 2HWIA 2F3JA 3CD6S 5H9FJ 3CF5Q 5I3UA 5CXTA 2XYGB 2E5HA 4X66J 2MKIA 4DFPA 2I2YA 3GU0A 3WZ0A 3CDBA 1U1MA 3PW2A 2CJKA 2EC0A 1N52B 4RX6A 4DUYJ 2KB2A 4BDPA 4QU7A 1LK5A 3H7HB 4RW7A 2MSTA 2OELA 1BQMB 2E5JA 2LEPA 4KBIA 4N8NA 3C2PA 1WNEA 2D3O1 2QA2A 1BWVA 2W9CA 4WZQA 1TKZB 5F3TA 2KH9A 1WUUA 3L9ZA 3DFEA 4HL9A 3ZNUA 4DL5A 1FRMA 1QDUB 1DQ9A 2ZD1B 3PJXA 2RU3A 2LVWA 3RZAA 3BDPA 1BLUA 1DQAA 1RU1A 1S1TB 2P8IA 1C0TB 1HQ2A 2VBXA 3LP2A 3CJ0A 1NJZA 1AZSA 3TUZC 4KYZA 5J2NB
chains in the Genus database with same CATH topology
5IS2A 3RYLA 3CMAS 1IBMF 4I7FB 2MQLA 1U09A 2VPZB 2JSXA 1KLMA 2JEJA 4B08A 2DGSA 3ZZTA 4L3NA 3BGRA 3MEEA 1FKPB 2FHJD 2R4FA 3IR5B 1YSJA 4FXDA 3Q22A 1H7XA 2WSFC 2Y1RI 1H3DA 3PW0A 4Q8FA 4IR9A 1S1XA 3OFFA 4DR1F 2RH3A 1HBMB 3D0GE 3TOQA 4ZPDA 1Q81T 1YWXA 5K5MA 3SSQA 3PX6A 4RNOA 3CJ3A 4QYRA 3CCJS 3M6VA 4NXNF 1KTQA 3ZZ0A 1IR0A 3J7ZT 3MTJA 2BJDA 3BR9A 1ZBTA 4AL7A 3MD1A 1P1TA 1TL5A 4M94A 3OFHA 2HS3A 3OR1A 2DNGA 2R2RA 2XSJB 1VQ6S 1L3VA 2MPUA 2BA9A 2F40A 2KXHA 2I8EA 4CO1A 1NHVA 2ROGA 2YNIA 2VA3A 3ISZA 2Z2LA 3GG0A 1V6HA 2JFDA 4B9MA 3MDFA 1JLCB 1LWEA 3OL8A 3FSIA 3K5LA 4HI2A 4YY3F 4X4QA 3SDEA 1UVMA 1Q7YT 4KHMA 2HIQA 5G4DA 2V5HG 4NLQA 2RUGA 4OZNA 4H4OA 5KG2A 2OPRA 2ZE2A 4E98A 3PO4A 2DRBA 1BQXA 2RF2B 5LJ3Y 1S9EA 2ASYA 1S49A 4RNMA 2ZH4A 1AW0A 2DCLA 1SXLA 5AXKA 1WHVA 2IAJA 3LQVA 3W3SA 1GT8A 5DQIA 1IKWB 4LSLB 3CUNA 3BF4A 2PD1A 3FQLA 3DLBA 3GWCA 5KFRA 4DBQA 2NUUG 1T03B 2M5YA 5K8NA 5K14A 1J5OB 2KYZA 3DHWC 1F5CA 2J8AA 3DN9A 3BB5A 3FEYB 2O5DA 4RW6A 4J9PA 5KG7A 1U8SA 4MFBA 3MPWA 1VQOS 4DV4F 1JLEA 2IBKA 4UOCA 4N8OA 3CTRA 3NBPA 4JI3F 4F4XA 4X4NA 2FC8A 1X5SA 1TKDA 3HVWA 2E7WA 3HI9A 3M1VA 5KFIA 4J9QA 3G6ES 2CPIA 3AJ2A 4WKRA 5EN1A 2OPRB 2ZE2B 3EUNA 5JVHQ 3MR2A 1CQMA 2XSFA 1S76D 3T19A 4KB7A 4LFAF 5T7LB 2DGOA 4C9DA 1S0VA 5B0AA 1T8EA 2DISA 1XERA 4N56A 5E3CA 3GG1A 3DGPA 1LW0A 1IM4A 4M8LA 5GADU 3IRWP 4RNHA 4OHVA 5DDQC 2CJBA 2XZWA 4IFVB 4ELUA 2HFZA 4DFJA 2R7VA 3NBPB 1CSJA 4NA2A 1NK6A 2DNRA 3GFXA 3VAMA 2RQMA 2WSCC 4K0KF 2W4CA 2HS4A 5I3UB 1UWBA 1LXNA 5GAHU 2ZH5A 1VC5A 1FK9A 2YWFA 1N54B 3PX0A 2VOOA 4O3RA 3DOLB 3ZZYA 5JJBA 4UQGA 4RW8B 3AAWB 4U67Q 1TKTA 4EZ9A 1X9SA 4RWXA 1QAIA 2JLFA 3GMGA 4HVZA 3SCKE 5K8MA 2FVRA 2K7KA 4WE1B 5CD4H 1G7CB 2VG6B 1OSCA 4PXEA 5KFFA 1RT6B 1UVLA 4IFVA 3Q8QB 2WHOA 4ES1A 4LFCF 1VRUB 1KLMB 3I9ZA 1RT7B 1VHFA 2JVRA 3EZUA 4DSIA 2DCUB 3RAQA 1HARA 1X0PA 2HNDB 2HYIB 4WTYA 4WJBA 1ZTTA 4U7CA 2MZJA 2HNZA 3LALA 3NLCA 1ZAXA 4ES3A 1GAOA 2RS8A 1SJRA 1JNZB 2LEBA 1SJ3P 2YNFA 1RTJB 3F41A 1WD6A 4QQBA 1UVIA 3H5SA 1WACA 3PRDA 4N5SA 1T3NA 4ICLA 3BQ1A 2XMVA 1HPZB 1T3OA 2KFNA 1M5HA 4QJVA 2XMTA 4DQQA 2GO9A 3BN4A 5DG9A 1Q8IA 2CPFA 1FD2A 3UD3P 4O3NA 4HYKA 2VOPA 4ID8A 4Y28C 2NUHA 3PIOQ 4TQSA 2MZSA 4X2BA 2DH8A 3BDEA 4ERDA 5D3GA 2HRUA 2LQ9A 2VQFF 1N5QA 2YKOA 4Y34A 4USIA 2EKYA 2J9EA 2LXUA 2KG0A 3FSXA 3MF5A 2RDIA 1G1XA 4C0OC 1T05B 2ZZNA 3HPOA 1YJUA 1FE4A 1SH0A 4DN0A 5EGYA 1U47A 4J9MA 1MWZA 3VAIA 3I4PA 1N36F 2QEXS 3TQ1A 5GAEI 4B3OB 2PC6A 2NSCA 1Z1ZA 3M30B 1F2GA 3QIDA 1RGVA 4WYLA 4P6QA 3G4SS 1S9EB 2GGPB 2GMHA 2OTLS 2X1AA 2E1AA 1IKVB 1RT2B 2IRXA 3GZ7A 2QFJA 5F8IA 4OZJA 3PR4A 3HHLD 4PG5A 2QA4G 2L9DA 2HHTA 4ECQA 1E6VB 3GIJA 3TRGA 3C6TA 3H5UA 1FKAF 4UW2A 4TYAA 2W24A 4ECUA 1V3ZA 3X3UA 4LMZA 4WYWA 2HGNA 2H5EA 4RW9A 4PWUA 3CDAA 4O44A 3V6JA 2K8GA 3BSCA 2HNDA 1UJ6A 2RNEA 3RTVA 3MPVA 3UW1A 2ZDPA 3MMBB 4NLGA 1Q7LB 2CVEA 2CQIA 3LF0A 3OR2B 4ID5B 1C1CB 4CO5A 4F8RA 2CQBA 3OTOF 1MW7A 1JKHA 2CPEA 4A8KA 1LWFB 1HYSB 2BANB 1KNZA 3RB6A 3QJJA 1OQ3A 4HTIA 4NX9A 4ZP8A 1JLFA 3MM7A 4A47A 5DDOC 4RZRA 5T14A 2E29A 1S9GA 3MMCA 4NZ0A 2YWGA 3HVTB 2LA6A 1MNEA 1S6OA 5E3AA 1SJQA 3B82A 1WG4A 1P6TA 1RP5A 1X7VA 5DRKA 2D41A 2FD2A 3B78A 3G6VA 3FZBA 3TR5A 3KLIA 2J0WA 4MFBB 4RW9B 5DM6Q 5LSLA 2J7WA 3MMAA 7FDRA 3GR1A 4ZCLA 3CC4S 4PRFA 1RA7A 2X3GA 1BQMA 2D1CA 1FCAA 4X4SA 3OL9A 4DR6F 1X4DA 5CYMA 3M8QB 4Q7AA 2JX2A 2R7SA 1NH7A 4CH7A 3H2LA 4OZLA 3OUYB 2OJ3A 3R5BA 1HQEB 4RBTA 2L41A 4G1QA 3GE9A 1IKWA 3HHLA 5EHHA 4WCEQ 1NK5A 4JI5F 3OJSA 2XO7A 2VPXB 3GIMA 3GR0A 4J9KA 2BQRA 5F8JA 3EXYA 2YVSA 4LQ3A 2CIMA 2IVFB 2M9KA 1C1BA 4QZVB 4W92B 3TYTA 4FYDA 1WEYA 4HH0A 3RW6A 5D4PA 1X4HA 1A6LA 3I6PA 3FJ2A 3JB9k 5CYMB 2IMOA 3VQSA 2K3KA 4F02A 4ITSA 5HBMB 5KT2A 2J6SA 4O3PA 3RB0A 4DV2F 4ID5A 1KSPA 4NYOA 3OXGA 4QBUA 2UVRA 2VPYB 3HHNB 3SXLA 4I69A 2BW2A 1XK8A 3IRXB 2DD8S 2CQ0A 3OHBA 4DV3F 2CVIA 2VC1A 4KFBB 1KD1T 2DH7A 2LMIA 3QWPA 5AXNA 4DV1F 3NS5A 3MZIA 5DG7A 1NK9A 1UL3A 4B9UA 4RUAA 4QW8A 1DTQB 2ROPA 2XHWA 4IH6A 2NS1B 1IKYA 3MXHP 2GA7A 2GJIA 2J9CA 2C2DA 2DGWA 4H4KC 5J2QB 3QIPB 5HMWA 4FXVA 1S6PB 2FDNA 2YQ3A 1TL1A 3G71S 3THPA 5HP1A 2VC0A 4ECYA 4R0JA 4R5PA 2HAIA 1R8CA 2DR9A 2DGTA 2VFVA 4ZVFA 2RIJA 2VG7A 1SKSA 3DLLQ 3N6LA 2MGZA 5FJ4A 2EFNA 2HZCA 3M8QA 1TL3A 1R8AA 2CG4A 2CPDA 5F8GA 1DARA 2RQCA 2J9DA 1JJ4A 1WTFA 2R7TA 2DT9A 2BVZA 2ZDOA 5M2UA 1HNXF 2RKIB 2AJQA 3O8WA 5AE1A 3ULHA 1MROA 1LWCA 1YITS 4IO9Q 4NCAA 5IM0B 1DTTA 3H5YA 4DLEA 1TZ0A 4NLDA 3OBIA 3P3DA 5EDWA 2L9WA 3DOMA 4I2PB 3I56S 3HK2A 4WKYA 5J2PA 4KJIA 2NQPA 4NCBA 3QMQA 4ICLB 5SZTA 1UMJA 3DRYA 3IXQA 2V2KA 4FPRA 4B3TF 1VQNS 5DDPC 1FVQA 1LWFA 2VONA 2QIFA 4QYZJ 3Q8SB 3L7PA 3HDSA 2AX0A 2B9WA 4NOHA 5D77A 3GV7B 1IKYB 5BYSA 4OL8A 2E1CA 1FTRA 2DNNA 4WFZA 2XEXA 2HQ3A 3MUMP 1VRUA 2B4PA 1NK7A 3KNAA 4KE5A 4KC5A 1U45A 4RU9A 2ADCA 2UV8G 1ZAVA