4A8XA

Structure of the core asap complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
SMKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLAPWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords RNA-BINDING PROTEIN WITH SERINE-RICH DOMAIN 1
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a8xA00
1WI6A 2Q79A 1WF0A 2CQ1A 2YTCA 2CQPA 2N7CA 2MZQA 2DISA 1UAWA 3UCZP 1P1TA 4PRFA 1WTBA 3G96A 4OZ1A 1FJCA 1VQ5S 3BEGB 2M4MA 1VQ4S 3VAJA 2JRSA 1OO0B 1YTYA 1M90T 2CPIA 2M7SA 1X4CA 2BZ2A 2MKJA 2DGQA 4Y00A 3B4MA 2J8AA 4IOCQ 1K8AT 1WG5A 1VQ8S 2DGSA 4PR6A 2F9DA 2D9PA 3DXBA 2F9JA 3U1MA 3CCRS 3NMRA 1O0PA 5DDRC 3I55S 2V94A 1X4AA 4CH0S 1FT8A 2XSFA 2LCWA 2KXFA 3MOJB 2CQIA 2YKAA 1FJEB 1X4HA 1X4DA 2FC8A 3PIOQ 2MKSA 3LQVA 5ITHA 2DHXA 3CF5Q 2LXUA 2KH9A 1YJWS 2DIVA 2DK2A 1WF2A 2G0CA 3P49B 2HVZA 2CQ0A 5IM0B 3CCUS 3NNCA 2AYEA 2KXHA 2LYVA 2D9OA 2XNRA 3G8TA 1R8PA 1URNA 3N9UC 4PKDB 2DB1A 1VQPS 2CQ3A 4BS2A 1SJ3P 1HD0A 2AYGA 1K73T 1PGZA 5LSLA 3THPA 2RU3A 2F3JA 3MUTP 3OW2R 2UP1A 4FXWA 1U1LA 4LMZA 2MZRA 1U1MA 2MQMA 1OWXA 1KQSR 3ZZZA 1WF1A 2DNRA 1SJRA 1AUDA 5D78A 2HZCA 2VONA 1WEYA 1F9FA 2DGUA 2NLWA 5DDOC 3S8SA 2B0GA 2DH8A 1FXLA 3CCQS 2QEXS 1QVFR 3CD6S 4C0OC 1NO8A 2LXIA 1VQNS 4C4WA 3Q2TC 2CPEA 5JVHQ 5GMKa 1XN9A 2FHOB 1U1NA 2M2BA 2MHNA 2DNKA 2DNOA 2M88A 1FJ7A 1X4FA 3VAHA 4IOAQ 2DH7A 2RQ4A 2MQLA 2DGOA 3L3CA 2CPXA 4EGLA 3CTRA 2M8DB 3UCGA 2MZ1A 3CCVS 2N3OA 1WG4A 2O3DA 3H2VE 1H6KX 2CPHA 1N8RT 1YIJS 1SJ4P 2DO4A 4YUDA 4C7QA 2MKHA 2ADBA 1L3KA 1WHYA 2DNLA 4WFAQ 1Q82T 2PEHA 2K8GA 1QM9A 1WHXA 2RNEA 1HD1A 2MKIA 2RVJA 3ULHA 3K0JA 1X4EA 2X1BA 2MQPA 1KD1T 4Y0FA 2DNHA 4Z2XA 3P6YC 2A3JA 2M70A 1U6FA 1DHMA 3NS6A 5JVGQ 1M5KC 1R8HA 3VAIA 2DIUA 1VQ9S 2E5GA 3CPWR 1M5PC 2ZJQQ 1X5OA 1VBYA 4P6QA 2QFJA 2X1GA 2XNQA 2OTJS 2BOPA 2MY8A 3MUMP 2MXYA 1WG1A 3CCMS 5GAGU 2CQCA 1VQMS 3VAMA 2KM8B 3VAKA 2MKKA 2DITA 5HO4A 1U1RA 2VODA 2OSQA 2YWKA 2KG0A 2MY7A 2CJKA 1G2EA 1SJFA 2HYIB 2JX2A 3MDFA 2M9KA 1VQKS 2DNZA 1UFWA 2AYBA 5EN1A 1M5OC 2MPUA 2KI2A 1WHVA 1M5VC 2AYMA 4CIOA 2G1DA 2CQGA 2KRBA 2DH9A 1JJHA 3TYTA 1H2TZ 3EX7B 1Q7YT 2K3KA 5DETA 5DDQC 2MGZA 2HGLA 1FO1A 1P27B 3CC7S 5D77A 4CQ1A 3NNAA 3V4MA 3CMES 1X4GA 1DZ5A 3J7ZT 5DM6Q 4YB1P 3G4SS 2MZTA 2DGWA 1U6BA 1OIAA 2XS2A 4TU7A 1K9MT 1W2BR 4UQTA 1U1PA 4IO9Q 2EK1A 3FEXB 4RU2A 2LEAA 2RUGA 3SDEB 2CPZA 3S7RA 2DHGA 4QU7A 1IQTA 3CCLS 4U67Q 3BO2A 1KC8T 3J7YU 2MMYA 2KRRA 3CUNA 2DO0A 2DGVA 2KT5A 3PIPQ 2MQQA 3R1LA 3P3DA 2M0GB 3UWTA 1ZZNA 1JJ2R 2RS8A 2MB0B 2QA4S 2LA4A 4TU8A 1QVGR 3EGZA 1H2UX 4F26A 1WELA 2KYXA 3RW6A 2LQ5A 2RQCA 2E5HA 2DNGA 2OSRA 5LJ3Y 2XS7A 2KG1A 4OZ0A 4FXVA 4QU6A 3H2UB 5H1SV 4F02A 4W90B 1CVJA 2E44A 3FEYB 1FNXH 4UY8T 2JWNA 2I38A 3TP2A 2VOOA 2ERRA 2KHCA 3SXLA 1Q81T 2NZ4A 2LEBA 5GAHU 3BO3A 1ZZFA 4WFBQ 4TU9A 2JVOA 3UCUP 2OTLS 5LSOA 2KVIA 3R1HA 1RK8A 5CXTA 1HL6A 5GADU 2JVRA 5IQQA 5GVQA 1A7GE 1VBXA 5DDPC 2MJUA 3G8SA 2DNQA 1VQOS 2GHPA 1M1KT 1DRZA 3MI7X 1X5PA 4YOEA 2RRBA 2MJNA 1SJQA 2KU7A 1B7FA 2DGXA 3THTA 2RS2A 2E5IA 3UE2A 3TO8A 3LPYA 2DNPA 5FJ4A 3UD3P 3VAGA 3US5A 1KOOA 2D3OR 2N82B 3RW7A 2LMIA 2J76E 2KFYA 1OPIA 1U1OA 1SXLA 3HI9A 5GAEU 4QQBA 3VF0B 1PO6A 3VALA 2MSTA 3G9CA 1X4BA 2XB2D 3S6EA 2SXLA 2EVZA 1WWHA 1N54B 2KN4A 4CH1A 2MGZB 2AD9A 2U1AA 2CPJA 3BS9A 1FHTA 3EGNA 2RRAA 1X5SA 2DGTA 3G6ES 1UW4A 2CPDA 4WF9Q 2J0SD 3R27A 1VC5A 3I56S 1VQ6S 2U2FA 3DLLQ 2E5JA 5MLCV 3NNHA 1UP1A 5CA5A 1N52B 5LXYA 3MD1A 5IFMA 1S72S 3D2WA 3CCES 2CQHA 5LXRA 3CCJS 2LECA 3SMZA 2CQ4A 5BJRA 2CPYA 2FC9A 2EK6A 3CMAS 2GO9A 5CYJA 1JJ4A 1DBDA 1YHQS 1YJ9S 5HL7Q 2FY1A 1HA1A 2KM8C 5DM7Q 1WEXA 2X1AA 4F25A 2OJ3A 2MQNA 3IRWP 1YI2S 2LA6A 2L08A 3G71S 2DNMA 3JB9k 1YWXA 1VQ7S 3VAFA 2ZJRQ 4QPTA 1H2VZ 2MQOA 1RKJA 3B4DA 4LJMA 3CC4S 3CC2S 4WKRA 5IM0A 2XS5A 1KOHA 1A9NB 1NJIT 1JMTA 3MD3A 1YITS 2FPHX 4ERDA 1VC6A 3NS5A 4WFNQ 1U2FA 1ZH5A 3U1LA 2OIHA 4W92B 1VQLS 1U1KA 3CXCR 2L41A 2HGNA 1D9AA 5LJ5Y 1VC0A 2ADCA 1VBZA 3MUVP 2G4BA 2CQDA 2X1FA 1NU4A 2DHAA 2J0QD 3HHNB 2KXNB 1WI8A 3BO4A 2M52A 3IWNC 1N88A 2HGMA 2MZSA 3Q2SC 2N3LA 2MYFA 2M8HA 2DNYA 4IUFA 4A8XA 3MURP 1U1QA 4LIRA 2MSSA 3ZZYA 2YH0A 4TLQA 1BY9A 2MZJA 2VOPA 1WHWA 1Q86T 2DNNA 3S01A 3SDEA 1WEZA 2L9WA 2MKCA 4WIIA 2RT3A 2LKZA 2CQBA 2CPFA 1X5TA 2ZJPQ 4M5DB 3UD4P 4WCEQ 2DHSA 3CULA 3CCSS 4ED5A 2CQ2A 1X0FA 3P5TL 2I2YA 4V19X 2WBRA 4ZKAA 3MXHP 1D8ZA 1S79A 4J5OA 2PE8A 2YH1A 1YJNS
chains in the Genus database with same CATH superfamily
2Y3YA 1EP4B 3DRPA 1P1TA 2EG2A 3H5SA 5EWEA 1OSDA 2PA3A 5E3CA 3AFGA 4KT0C 5CHCB 1Y00A 4H4OB 4H4MA 1UKUA 2V34A 2OPSB 2X3GA 2V2QA 4Q0BA 5DDRC 1CULB 4KPCA 5J2NA 1Q8BA 1JLEB 1HQ2A 2AX1A 3M1VA 4NCAA 3PIOQ 2QL9B 3BBCA 1RXOB 1HWUA 4DG1B 2EI5A 1ZA2B 4KHRA 1JLGB 3QYYA 1M5HA 2GW8A 2ASJA 4KC5A 4PKDB 3MPUB 4KH1B 4BS2A 3DM2A 3KG1A 5KFLA 4NYOA 2LU1A 5AT1B 3CCWA 1NH7A 1U1LA 2K3IA 5EGYA 1UA0A 4YDXA 2MQMA 1SH2A 1KQSR 3D0HE 2QGFB 2ALYB 2ZOMA 4R0EA 1KQKA 3M9OB 1JLAB 2BJ8A 2V63A 3D54A 3AOAA 2L9NA 3OD2A 4NLRA 4X65F 2DNOA 4PAAA 2BE9B 2DH7A 4WZMA 1RYRA 1N5TA 5ETNA 3W64A 3TVKA 2O1PA 4ECSA 4YHHF 1TUWA 3ENWA 2MZ1A 4B9SA 4ELUA 4NL5A 1TELA 1SCJB 4CP5A 4FYWB 1ELOA 1HPZA 2HBZB 2MKHA 3ILOA 4K8RA 3NAIA 4CYUA 2XI3A 1QM9A 2I5JA 2VDIA 4QWDA 5A0YB 2A6OA 5HK4A 4ZVQB 4B9NA 2DIUA 1FDBA 1X5OA 1ITPA 4ED2A 4NCGB 3KLFB 3UFCX 2W8LA 5GAGU 3MMAA 4HLBA 2BJ3A 5CYQA 2KM8B 3NCPA 4DPWA 2CNNB 4JBCA 3R8YA 3M2UA 2AYBA 2KI2A 1C1BA 4LRAA 4ZVOB 1AZSB 1F9HA 2XULA 2ZHBA 2IVFB 3ZFVA 2HWTA 3EUNA 5KT4A 1HNWJ 1F2HA 3GONA 4KGKA 2F8EX 4I2QA 2V67A 1H38A 1LV5A 1G3OA 4NLDA 3BDEA 1DLOB 4QWBA 2DXEA 2OEKA 3TA2A 4DWIA 1H2UX 2LQ5A 3UDEA 5KFIA 1N5YA 1RWMB 2BW7A 2VBZA 2NZ4A 2FZKB 4NI2B 2OD4A 4FXDA 3R1HA 1YRTA 2GGPB 3L95X 1U0HA 2UUBF 4RW8A 4DZDA 2XZDB 4OX6A 1JXVA 2CAJA 3IGNA 1QUVA 3AQOA 1IBLJ 3VAGA 1KOOA 3HXMA 4DUYF 2BX6A 3HKWA 4PEOA 3CJ2A 1PO6A 2UUCJ 3CJTA 3DGPB 4OV6A 4OX8A 4CH1A 5D4LA 4E8UA 4LF6F 2PFDA 2B9EA 4QYZK 1S1VB 4H54A 2U2FA 3DLLQ 5KFCA 3CGIA 3A13A 4DUTA 3D28A 1RTIB 4K5SA 4ES2A 1S7HA 3KTQA 3NCQA 4C8ZA 1F3VA 4USMA 4PYDA 1BD6A 2YWHA 1N5SA 3MMBB 1NM2A 1YI2S 1HBOA 1N34J 1GMUA 2WZ1A 2HMIA 2XY7A 1C4CA 5HJXA 1KEKA 4NLWA 1YITS 2RILA 2XLKA 3BPSP 1IKYB 3PEJA 1CC8A 4C8MA 5C7PA 5T7LB 2M52A 4XPEA 1JLBA 4RBUA 1BUXA 5KFVA 2VOPA 3J80Y 3KK1A 4C3MA 3MF5A 1SKUB 3KLIA 3MAAB 4K2XA 2FIUA 3ZZUA 1HNZJ 4ZKAA 1NUEA 3HHLB 4F67A 1U8WA 4DQIA 5HROA 2JEJA 1GMVA 5F3ZA 4OZ1A 2B3TB 1L5UA 3VAJA 4TKTA 4AFFA 2KO1A 3V4IB 1Z1ZA 3A8KA 2K7JA 3PW2A 5CD4H 3B4MA 2EW9A 4RW9A 1BE4A 3PHTA 1U8SA 2V0NA 2VG6A 3I5AA 4ZMMA 3CCRS 4F4KA 3ZZPA 2YY3A 2YKAA 2IRUA 4V19J 3CF5Q 2WVFA 1RT4A 5GMEA 5KG0A 2DIVA 4AL5A 4WZQA 4KV8B 4DR3F 3BM7A 4J90A 3NNCA 4S0MA 3N9UC 5IWAJ 3PYFA 1C2PA 1IXKA 1VRUA 3MUTP 2HRYA 2UP1A 4DR6F 3BZQA 3D0GE 3MTJA 2P9EA 3HF5A 1KTQA 4NMLA 2X51A 3SV4A 2P5VA 2CJQA 4HVZA 4KKOA 3CB4A 2PO4A 2IJRA 1CQMA 1FK9B 1OY6A 1EKSA 4CLUA 3CNQP 2LXIA 4C4WA 2UVRA 2FHOB 1NNDA 2UUAF 3KLGB 2BUNA 5A8WA 1VRQC 4WFYA 4CO2A 3RB6A 4AXIA 2FVSA 1FRHA 4R5PA 4HR2A 4JI4J 1LOUA 3D3CJ 1H6KX 2CPHA 1SJ4P 3QJLA 2R7UA 1T3NA 4IG3A 4ETXA 2NR0A 1UEUA 3TUZC 2UUWA 1JXEA 2RDDA 4IDKB 1R7IA 4NYPA 2ZKUA 4O4GA 4A4JA 1HNXJ 2CFXA 3TA1A 1KVIA 1TKTA 3JYTA 1V9OA 1RWPB 1PJ7A 2HNYA 2BEFA 3H2LA 5IXUA 2PDAA 3H42A 1F9EB 2Q6BA 5DGAA 2J6SA 3R5AA 2MY7A 2HQCA 1RCXB 1UFWA 2XY5A 4E98A 1FKOB 2J0XA 3R7SB 1V3SA 3SI8A 3KJQB 3KHLA 2BABA 2C3MA 3GE9A 2W2NP 3HDSA 1RLDA 5DRKA 4A8MP 5KFXA 1S12A 2DGWA 5IOLA 2Y8YA 1OIAA 1XEZA 2QYCA 1B3TA 3L7PA 4NRTA 2HFSA 2RUGA 3DRSA 4U67Q 1NSKL 3DLEB 4DV0F 4PXBA 2FGCA 2R2UA 4NE9C 3BGLA 2FVRA 4CLPA 1MU2B 5L9NA 2DR5A 5HQLA 1L3SA 4X65J 3PKYA 1S9FA 4IKAA 3BH6B 4OX9J 5KG1A 4U7UK 1FTRA 3HULA 2KVIA 3DDIA 2JVRA 1U26A 3HHKA 4R0JA 1Y5IB 2LLZA 2RS2A 2ZH3A 3UE2A 2DNPA 2ROPA 2IMWP 3D1QA 2KYZA 2VKRA 2H1YA 2WVDA 2QL7B 3QFHA 5KG2A 1T05A 3FSYA 2ZZMA 4QQBA 3KJNB 2EVZA 1WWHA 8RUCA 2PA8D 2U1AA 5CD4A 2QA4G 2B4VA 2Z30B 3QLHA 3KLEA 3F0NA 4ZP7A 4ZCKA 1S72S 2QSWA 1NK0A 4O0NA 4QCLA 1IKVB 1HQUA 4L72B 3JSRA 1KRPA 3DOLA 1IBKJ 2O66A 5KFEA 2FC9A 3TVYA 1FEEA 2V9KA 4XTTA 3HZEA 3O2IA 3AQPA 1PKUA 3UVJB 2GIQA 5LMUF 3M7VA 3B4DA 2ZITA 2YPZA 4X64J 1NKBA 2FPHX 1U2FA 2VG5A 2E5LF 1TZ0A 1VC0A 2RRNA 2OI2A 3PDNA 2N4DA 3FBCA 1F2GA 5C24B 3WC2A 2N3LA 1EZZB 1Z2ZA 3M9NB 2X3DA 3ZO7A 1TV6A 1Y5LB 5C25A 4LBHA 4CO0A 5HANA 1D0EA 3DRRB 1OS5A 1Y4ZB 4K5RA 3F73A 4OHZA 2R8IA 3C19A 2JFKA 1UJ4A 1UZHA 2PI5A 4I6WA 1P8GA 1XTZA 4B08A 1VRTB 4DV6J 4C8NA 2CPIA 1RAFB 4JI0J 4Y00A 4KBIA 1RT1B 2D9PA 1BHNA 1WKKA 3Q22A 1T3OA 4LFCJ 1EETB 2XSJB 2HHWA 2C2ZB 1YRXA 2ALZA 4LF6J 1XNQF 2QO3A 2CA9A 1JXLA 5ITHA 1FRLA 1DFDA 2DEJA 2CZ4A 4B3SF 2LYVA 3G8TA 5ETTA 2BE2A 5M2UA 4U7CA 4A47A 2AJQA 2CQ3A 4WBFA 2E1RA 2HURA 4RX6A 1BWEA 4B3OB 2BJDA 5L39A 2GJIA 4JI6J 1CS4A 2DNRA 3FMBA 3RRKA 2OELA 3CDWA 3TEGA 2NXJA 3WHIA 3UDCA 1NO8A 3VTIA 2YWGA 1LWFA 3GR1A 1B0TA 2RQ4A 1QSYA 2D3O1 3M2RA 4EZ9A 3E2EA 4ED8A 3PX4A 2EBGA 2YNFB 4XAKA 2Z8QA 2FJDB 1Y11A 5L1KA 3FFIA 5L46A 2ACYA 1LWEA 3ILJA 4DLEA 1E6YA 2YX7A 3CDEA 1HWKA 4CLSA 2J6TA 4N47A 2HWHA 2M5YA 5J2PB 1ZS6A 1CC7A 3NGKA 2MLZA 1M5KC 5FIIA 2IYIA 1YX2A 4CO3A 5LT5A 5C42B 1VBYA 4ECZA 3HO1A 1H3DA 4RW6B 2VV5A 3R7BB 2KG0A 1T02A 5D15A 4A48A 5EN1A 3BBBA 3KJFB 2DR8A 1W7WA 3JAMY 2V69A 2CQGA 1ACMB 5J2QB 1JJHA 4PG4A 3P45B 4USTA 4DR3J 1EHWA 3J80U 2RF2A 3W5XA 3R5GA 4DFKA 2W8KA 1DJ0A 2UVVA 1NDKA 3MR7A 4FBUA 3RB0A 1S1WA 5KG6A 4EWTA 4KHPJ 2HHSA 2HHHJ 2FYXA 3EYZA 3IS9B 3UWTA 2M0GB 1S48A 3GQCA 1UVNA 4G1QA 2N7YA 2E5HA 3LP2B 4FXVA 1FXDA 5H1SV 1NK5A 4NXNJ 1FNXH 4C8OA 3JTPA 1WOOA 4K4SA 2KL8A 3ENVA 4LFAF 1RQ0A 1T0TV 1RK8A 3VZIA 2OGUA 5B0DA 3GJSB 4DSEA 1KTVA 3BYPA 1DTTA 1RB0A 4YOEA 2Y9HA 1X5PA 1TUVA 1SJQA 4CTAB 5L1JA 3UNYA 1V5VA 3E51A 2D3OR 4AQYF 2J76E 1NPKA 2B4PA 4HYKA 3IA0A 4OYPA 3NOCA 4IH5A 3D9BA 1OYDA 3KWMA 3LWMA 2RRAA 3MM7A 4DFJA 1UW4A 3ILLA 4DBQA 3AH6A 3R27A 3I56S 2VHGA 1VC5A 1LKZA 2VJUA 1FVQA 5CA5A 4H4OA 3J7AN 4FN5A 2CJ9A 1CJKA 3SIPB 2OPSA 3FBFA 3CCJS 4B3RJ 3NGRA 2FJEB 5BJRA 1N4LA 4HI1A 2EK6A 1CULA 4UOHA 1T7PA 1YJ9S 1JLEA 1GMWA 4DR4J 3UDLA 4HI2A 4CNYA 3R6LB 1RTJA 4ZK7M 3ZC4A 2M3DA 2HHUA 1WSVA 4FS1A 4P9SA 5A8RB 4Q7AA 3CC2S 2XS5A 1PC5A 1KOHA 1HNIB 4IYQA 3RB3A 2J9DE 3PW0A 3AJ2A 1UWBB 1NJYA 4JYAJ 1FFWB 2AT1B 1V3RA 5B09A 1N5QA 2DHAA 4NXMF 2KXNB 5C5JA 3MM6B 3Q2SC 4BLGA 4KE5A 4ER8A 3CDUA 2JLFA 1KP6A 1JLAA 3QPIA 4DOZA 4CCHA 2CPFA 3PHEA 3D4JA 3TJ8A 1HLWA 2DHSA 1DTQA 4RNNA 1BWVA 1SL0A 3RU0A 3QT5A 3W9IA 5E3PA 1S79A 1GMWD 4ED0A 5H9FJ 1QJHA 1UZDA 1IUJA 5F9LA 4NWBA 1Y7PA 2DR6A 1TK5A 1N0VC 1JIHA 2ZBPA 3MM5B 3VGUA 1CJTA 1DARA 1U2RA 2Q43A 1RTDB 4DX5A 3I82A 1K1QA 4CH0S 5HMWA 5A0YA 4G65A 3T41A 4WTOB 1KHVA 3UW1A 1VISA 2W25A 3OUYB 2LQ9A 3TOQA 3P49B 4NCGA 3KLFA 2VPZB 4WP8A 2AYEA 3G87A 1R8PA 3PYGA 1VQPS 1S4EA 1F0XA 3FBEA 1SJ3P 1K73T 3PG9A 2FVQA 2R7QA 4ATNA 4F4ZA 3R97A 4K2JA 2ZM6J 4ZCLA 4XIUA 4USHA 4RR5A 3HSZA 3FZBA 2B0GA 1H7WA 5B0BA 3LH2S 5DQIA 5B0FA 2KJWA 4AD6A 4O44B 2D3ZA 3IFEA 1KONA 1NSQA 2C22A 3DMJB 1N32J 4EUVA 2E1CA 1RAEB 1DLOA 2ZH8A 4LF2A 2IA6A 2HBYB 7FD1A 4I7FB 4JI8J 1KFSA 2H5EA 3PX6A 5DZ6A 3OFGA 3AAWB 3DOKB 4QIFA 2PEHA 1SH3A 3BYRA 3PXGa 4RWWA 3AHPA 1XMBA 5KFJA 9RUBA 1RT5B 4NI2A 3VAIA 3VZHA 2GIRA 3NEKA 2YNHA 2I6WA 2UXBF 3IBWA 2GGPA 2QLFB 5DS7A 1FVSA 1TAUA 4EK2A 2VF3A 5A76A 2VBYA 4O3NA 2E9RX 2JX2A 3MDFA 1XNQJ 2LQJA 5AJ3F 4ID5B 1PBUA 3DGPA 4OHXA 4Q2LA 5ETLA 1P27B 3UO0A 1GEHA 4CQ1A 3KK2A 1IWGA 3IP0A 4C3LA 2UU9J 2D74B 3MTKA 2GVZA 3W2VB 1SV5A 1K9MT 1W2BR 4EFAC 1RTIA 5HLFA 5HQMA 2V9WA 4F8RA 2Y1RI 4C8LA 1KC8T 1MN9A 4J9SA 2N4CA 3PO5A 4QOTA 1JJ2R 2KFNA 2ZVSA 1QVGR 4ZCIA 1EARA 3EGZA 5KOWA 2FJXA 3CD7A 1T11A 4HHUA 3MFIA 1WOSA 4DSKA 5D3GA 4NLUA 4KB7A 1VOMA 5DO2A 5HJYA 4XDCA 2OTLS 5T7LA 1F6TA 1KVKA 3TR5A 3QT7A 3TZYA 1MG7A 2O67A 1S1TB 3G8SA 2MJUA 2L3MA 4C3KA 1S97A 3MI7X 4CLYA 3W2WA 2HNZB 2GJFA 3TAPA 5D6GA 3US5A 2GV1A 4I2PB 4LRCA 5ETMA 5CCMA 3NBPB 4M5JA 1HBMB 2IBKA 1X5SA 2DGTA 3MGJA 3LGMA 4OI3A 2YNGA 1XNRF 1F5CA 1LEOA 3CCES 3JXOA 4M5MA 2C3YA 4PUOB 2HS4A 3T1HJ 1HA1A 3C6TA 1XR6A 1WEXA 4MH8A 3GG1A 4DV5F 1UVKA 2DNMA 3VAFA 2ZJRQ 3EWGA 2CIMA 1VCTA 4DUZJ 2JLGA 3EPIA 5IT4A 2OD6A 5A6PA 4ZN3A 3FVYA 5LOQA 5LJ5Y 4IO1A 2F8HA 2R2RA 4BWMA 3VVUA 2RIJA 2D3UA 5EUHA 1HYSA 1TP7A 3JQJA 3IWLA 4PWDB 1R8AA 1ZM4A 2DNYA 1VJWA 1HKAA 4GMKA 1I5OB 3ZZYA 2YH0A 2R8HA 1RT3A 2BYCA 2IJNA 2K7KA 2W7AA 3JSYA 1FK9A 3SEOA 3R9LA 2JC0A 4MTPA 1QAIA 3T1YF 4ED5A 4QIEA 3JAMU 5KFDA 2CQ1A 2CQPA 1H7XA 1RJJA 4UOGA 3IXQA 1B0PA 1VQ4S 4N76A 3O6QA 2ASLA 3BGRB 2VA2A 3BR8A 4JI3J 1NCLA 1IKXB 3BKUA 1AFIA 4QIWD 4ZPTR 3LP1A 3SZ2A 2WVBA 5J2MB 4AYBD 3B6BA 4ES1A 2F9DA 2BANB 1GQEA 4GKJF 1YRUA 3T6BA 2VASA 3EXYA 1KLNA 3D6FB 1XWLA 4EZ6A 4P75A 1NMEB 2FHJA 4DQRA 3W65A 5EX0A 3JS9A 1URNA 1O51A 4OLOA 2CJYB 3V2UC 4NEZA 2C2MB 2VFUA 1JNRB 5F8GA 2RU3A 2R7RA 3CCZA 4RW4A 3OVSA 4ED4A 3GYXB 1DURA 1IR2A 4M1KA 1IBCB 4WP9A 2HNDB 3FEZA 2VONA 1NB2A 4CO4A 2DH8A 2B4OA 3D6MB 2GS8A 4Z7YA 2GO8A 4M5HA 4K4XA 2NQPA 2M2BA 1VIOA 2DNKA 1HR0J 2OLWA 1AW0A 3Q89A 3M6WA 3A3NB 3KFWX 4AXJA 2GMLA 2FB0A 3Q24A 4ZJQA 3H4BA 3CD5A 3DLEA 2ZFHA 2FHJD 2H5JB 1VBKA 2IDLA 1MU2A 4CLFA 4LF4J 1IQZA 1MROB 2V2ZA 2HRTA 3CSKA 1FA0A 1FTCA 4Z2XA 3GFZA 3M2VB 2EKNA 2ZJQQ 2B6AA 2QFJA 3IC1A 1RI7A 4BHQA 1YBUA 1SQFA 3NP5A 2MXYA 5ETSA 3BGUA 3TQEA 4P7VA 4KGMA 2R7VA 4LVNP 2DNZA 1TL1B 2QE5A 3NOGA 5GAHI 4FYVB 2UZAA 5DDQC 5I3QA 3CC7S 1KWMA 1Y0HA 1GK8A 3D1HA 4Z37A 4CO1A 5SZTA 1U4BA 4IQXA 4HDHA 4QWEA 3G4SS 3H59A 2MZTA 3GFHA 1U6BA 2HEKA 2F40A 3EE3A 3DYAB 4I1TA 2LEAA 3JTOA 2CPZA 2B8PA 1KDNA 3MPYA 4LF1A 4RUAA 3J7YU 4C9DA 3EDQB 1G7CB 1NLKL 2DO0A 3VWSA 1ZZNA 3GLJA 5E7OB 3OL9A 4URSA 4FZVA 2G0IA 2FLLA 3IAS9 4K7QA 1CVJA 2UVWA 3FEYB 5G4DA 1M0SA 1MWYA 1S0NA 1GTEA 2G13A 1S6PB 1VLOA 1A7GE 3AJDA 5KT6A 4OYWA 3HVAA 4JI7F 2YWEA 2A2CA 3LPYA 3HVTA 3HSGA 3DRRA 2H65B 4MKAA 3KLVA 1NHKL 2KN4A 4UZCA 4DL3A 4FPIA 4LBPA 4L3KA 3RB4A 2XLJA 4FYXB 2E5JA 3AD8C 1KLMB 2BDPA 4KHMA 3G6YA 3BSNA 1H73A 5K8PA 2BVZA 2K1RA 5J1PA 3SMZA 1CG2A 2W7PA 1ULRA 2XSJA 2Y0SD 5CYJA 2AQ4A 3GIJA 4USUA 2KM8C 1DQ9A 4F25A 1IN0A 2NXNA 4RNMA 3JB9k 4FNHA 1IVZA 4ELVA 4WKRA 3KK3B 3G82B 1WC6A 1MMLA 1Y3JA 2QV6A 1VFJA 4ED7A 5JMNA 1VQLS 3CXCR 1ZTTA 3W66A 2G4BA 3GSIA 2VJVA 5F0UA 3KXDA 3P5BP 3HHNB 2CUYA 5IT9Y 1RT2B 4B3OA 3I0RB 2C2OB 4A8XA 1U1QA 4TLQA 1I51B 1KN6A 1UJ6A 4YY3F 1R0AB 2ZJPQ 1C1CB 2QN6B 3BDPA 1NAQA 1O8BA 1X0FA 1RAJA 2D9OA 2AEMA 2Q79A 4F50A 2FZGB 5GMDA 1ROFA 2V8HA 4PWUA 2AX0A 3QGPA 3D68A 3GG0A 5BXIA 3SCKE 2OPQA 1UPPA 1J5EJ 3U1MA 2EKYA 4RWXA 4IR1A 4QIGA 1IWAA 1FD8A 3RRGA 5J2PA 3D6HB 2R3VA 2JEFA 1FRMA 3LQVA 4DL7A 5G0RB 4GKKJ 4Y3CA 3V6DA 4M5LA 3O8WA 3N6MA 3QSIA 5FD1A 4RW6A 4USKA 2DRAA 4YR2A 4NA1A 5GADI 2XZWA 3DHXA 2WOMB 3LUYA 3NXZA 2IDEA 2PMZD 4C11B 1XMQF 4O3PA 2GQ2A 3KDOA 4ES3A 1AUDA 1CEZA 2XC9A 5IC6B 2Z58B 5ADZA 3D5MA 3P4UB 4OZ3A 4RNOA 4TLRA 2DT9A 2BM0A 1DQAA 1UA1A 3QATA 1UTAA 3GILA 3CCVS 2N3OA 5A2QY 4X62F 4NZ6A 5AE1A 3QRRA 1WC5A 4C7QA 5AE2A 2ADBA 4DJBA 1L3KA 2OEJA 5KFNA 3WQPA 3V81A 4OI1A 1NDPA 2IRYA 3PX0A 4TNOA 3TJAA 4JI5J 3I9ZA 3NS6A 5JVGQ 1R8HA 4ETZA 1M5PC 3OTEA 5E5NA 3HHLC 3ZZTA 1LQ9A 3VAKA 4CTAA 4GKJJ 1XMOJ 3HFKA 3MM9B 3Q8YA 4PQUA 2LXFA 2EFNA 3N4WA 3M05A 5KT2A 4P72A 1ZPVA 4N8OA 3MAQA 3A3OB 4JI2J 4GO7X 5HMYA 3LPEA 4LSNB 4M95A 3KYLA 4P7TA 5IV4A 1Y9OA 4M5GA 3I4PA 1BQMB 4P74A 2RAQA 3CVKA 3J7ZT 5DM6Q 3M8RA 1FXRA 2YBVA 3OVAA 1DQ8A 1U45A 4WIQA 5L8RC 1S1UB 1FX4A 1RTHB 2VBWA 2DGVA 2MKYA 5KFUA 2G1HA 3W63A 2B4UA 1FDNA 3ZTRA 1N48A 3FRYA 5LJ3Y 5A8RA 3SBMA 4U8YA 4DR5F 1HQEB 3TRGA 1YJTA 3FGVA 2JL9A 5J1EB 2UXCJ 4C48A 2JVOA 1NPRA 5CH7B 5IQQA 4V1Ak 4CLKA 5KFPA 1R0CB 3OXFA 3NS7B 3THTA 3I0SB 3FK4A 3TO8A 1SB6A 2F7VA 3RBXA 2Q6CA 3EMTA 5M2RA 2N82B 2ZOFA 4YP3A 1N33F 2QLBB 2QMWA 4USIA 3GTYX 5CZVA 2XB2D 4DQPA 2AJ2A 3GJTB 4LSLA 1VQ6S 4IRCA 2W2MP 2CNOB 1N52B 1RHQB 1YGYA 3W8GA 1S57A 2HHVA 1J5OB 3MM5A 2BJEA 3CJ3A 1HNVB 4DR7F 2ZDOA 2W4PA 2ZUAA 3GFXA 1J2VA 1H72C 2DR7A 2J6UA 1RHKB 4O23A 4DV2F 3GIIA 2ZZTA 3BH7B 5J1NA 4L73A 2IAJA 3MWBA 3GJRB 3JQKA 2C1EB 1M1HA 3I32A 3PFEA 1SI9A 2AIRB 1NU4A 4OMFG 1S7IA 4MFBB 4F2RA 4LF9F 4MKYA 2Y1LB 4JV5J 1U24A 3I31A 2H4YB 1I94J 4DR1J 4OI0A 5M2PA 3C6UB 2MKCA 2VG7B 1S4FA 4Q44A 1UMJA 1HBUB 3UD4P 1JQGA 4ZPBA 3P5TL 4DV3F 4V19X 3MHYA 2D41A 4J5OA 2Z2ZA 1H74A 2XMWA 1X8DA 3KUGA 4J9KA 1MMNA 2XEXA 3G96A 4OJGA 2V8VA 2C3PA 2A1BA 3BEGB 1VQSA 1OO0B 1RHRB 4RO0A 2DRDA 2PFFB 1VJQA 3UD5A 1EAYC 3CJ8A 2AZ1A 1RWKB 2Y1IA 4LF7J 4HACB 2F4VF 4WK3A 1CJVB 3DN9A 4KFBB 2RJZA 2GAHC 2OPRB 4FS2A 3LW5C 5FLXY 3UNGC 5LMNF 4OJHA 1IR0A 2RB7A 1S6UA 2VQEF 2VPXB 3DLJA 2QIFA 4C2MA 3VQTA 1VMBA 4BCAA 2IC3B 3CW2C 2DB1A 4OFZA 3AB2B 3LP0B 4OYXA 1WKLA 3C2PA 4LF5J 3Q0AA 1TKZA 2J7KA 4FXWA 3HCXA 4ID5A 2OUGA 2LDIA 1LWCB 1F9FA 2NLWA 3BGOP 1QVFR 3OL6A 3FZ2A 3UI3A 3M4XA 1RAAB 1FJ7A 4F4YA 2CWKA 4DPXA 1SIZA 2XGQA 2M8DB 4ICLA 3H2VE 1N8RT 1FWKA 4NLTA 1TR0A 1SJ1A 3SV3A 4PXDA 1RAOA 4I6YA 2X1BA 2MQPA 4J9LA 2PN6A 3SSSA 2YWWA 1YJRA 1JWWA 1PAUB 1VHIA 3Q8VA 4F7VA 3L09A 1O6XA 5HP1B 2VH7A 1RT7B 3AOCA 4RNFA 2V2VA 2AJ4A 1K44A 1RA7A 1S1TA 2A2DA 4GRSA 3WZ0A 3KLHB 4FYDA 1FESA 4K4VA 3TX8A 2OSQA 2YWKA 1RSCA 1T9UA 5IT9U 1WHVA 5KFQA 1M5VC 3AJ1A 4CIOA 3KJVB 2DH9A 3TZZA 1RT6B 2WB4A 1Q7YT 3NBPA 2NREA 1HBNB 3AXMA 1HBMA 3NNAA 4O3SA 3CE8A 2W2QP 3TEHB 5HBMB 4YEAA 3OL8A 1C0TA 2VC0A 5B0CA 3NWGA 3EICA 4ZS6A 2XMUA 1IQTA 1XMQJ 1IJFB 3W9HA 3I4HX 4DV1J 2MQQA 5KT7A 4I67A 4F26A 3BBFA 3OBIA 2QMUB 3M8QB 1IM4A 1RAHB 1CPZA 2H4WB 3AB4B 5B08A 1JLFA 3R3TA 2OAUA 1HHSA 4DN0A 2VOOA 1GX6A 1REVB 3H90A 4IH7A 2WVEA 2VL1A 2GHVC 4Q0BB 5HSPA 4N56A 2XO6A 4CWBA 4PWDA 4L6V3 3UN5A 5J2NB 2HAFA 3BSCA 3QMQA 4EBCA 3M1VB 4UF4A 4WTYA 5K20B 4B3TJ 3GJQB 3A4TA 3SSRA 4A8KA 3K59A 1YBTA 4NRUA 3K5PA 2HRUA 2R2SA 5F8LA 4TYAA 4XDDA 3HM9A 3DM2B 3FSXA 3DGVA 2CPDA 2J0SD 1KNZA 1NSPA 3BGRA 1RACB 3GV5B 1IKXA 4KPYA 5J2MA 5I3UA 2LECA 4FNIA 2CQ4A 3ET6A 4DX8H 2VQFF 2OHDA 4E2FB 4P73A 1DBDA 2FY1A 4X84A 1BC6A 2CYYA 2IVMA 4IFYA 2ZEJA 4DV4J 3MECB 2WSCC 3BQ1A 3QT6A 3THVA 4ZPDA 2VPYB 4ECQA 5E3AA 3RTVA 2OIHA 2ZHOA 1D9AA 1HPZB 3OTOF 1VBZA 2XWXA 4CYUB 1NRKA 1XR7A 4Y2MA 1N88A 3PY8A 2QSFA 2XTJP 1WHWA 1SL1A 3SDEA 3IGVA 4WIIA 1FNMA 3GIKA 2OKQA 3MMCB 3CCSS 3MMAB 4JI1J 4DV7F 2B56A 1HWIA 3IBCB 1Q16B 1F60B 2ZKTA 2RQMA 1UW9A 4X66F 2WSFC 1Q95G 2VFSA 2W01A 2BZ2A 5BR8F 1PC4A 2E1AA 2HQIA 4ED6A 1S6QA 1K8AT 1TL4A 2R7WA 2AZ3A 4RW7B 4I2QB 1K0TA 4OYMA 2DHXA 3QGIA 5T41A 1QE1B 2IMOA 3NGUA 4CI0B 1FJGJ 2DPIA 3LA0A 2AEJA 4Y65A 2GCFA 2Z4PA 1R89A 2G2ZA 2B5JB 4PZVA 2HSEB 1LK7A 1TL1A 5HMZA 1AROP 2MZRA 3D67A 2MTLA 3MEGB 2FJAB 3DOMB 2R9LA 2HFZA 1FWLA 1SVDA 3RBDA 5GAEI 1WC1A 2PIIA 1U0HB 4RW8B 1LFPA 3MOZA 1NZAA 4DPTA 5FDLB 1U1NA 4L76A 2BJ9A 3QGHA 1X4FA 2XLIA 2UUTA 3L3CA 1SKSA 1Q8KA 4LF9J 3W3SA 4USWA 4I56A 2A0FB 1S49A 4CZCA 2O3DA 3T9ZA 1GTHA 2B9WA 1YIJS 4LT6A 2DNLA 2XY6A 2RVJA 3NGDA 3DHWC 3HP6A 4N41A 3HT0A 3Q8SB 2NXCA 4HHHA 2BE7D 3QIPB 4A8WA 2DD8S 4USVA 4X4RA 2D7SA 4WWSA 4C8KA 3W5YA 4CM2A 3MEDA 4NMXA 4CM0A 1Q5VA 1HMVA 2CQCA 4KIAA 3OR2A 4Y2CA 3VAMA 3CDBA 5HO4A 2VIHA 1JKHB 2VZ9A 2UXDF 3QT8A 2CRLA 2NZCA 3FQLA 4NYZA 5HAOA 4LFBF 1H2TZ 2K3KA 1FO1A 4OZLA 5JXSA 4J9NA 4I0WA 1RAGB 5HVHA 1S9EB 3O1LA 1N6QB 2V4JB 3DLHA 4HEA9 4TU7A 1JLBB 4IO9Q 2V4QA 2XCAA 4ZN1A 2AW0A 3JSBA 2DHGA 5H9EJ 1BGXT 2KRRA 3CUNA 3HKZD 1UPMB 2HK2A 3MR2A 4DI6A 1QAJA 3M6UA 2D69A 1FRXA 2EC0A 1PBAA 2DNGA 3R5CA 3H2UB 3KK3A 4DX7A 2E44A 2AGPA 1APSA 1X9WA 4UY8T 1UVLA 3PCOB 5K14A 1Q81T 1OYEA 3CJKB 3BO3A 2E7XA 1ZZFA 3UCUP 3U27A 4RW9B 1TTHB 3J7Z5 1HL6A 2VG6B 1RT2A 3I0RA 2W9CB 5F8JA 5EWFA 4OIXA 2CVIA 2RRBA 4X4PA 3IBFB 4LF8J 1RT4B 1RBLA 2AJ0A 2LEPA 3RW7A 4DSIA 2ZH7A 2ZHAA 3KNGA 3RRHA 1YJUA 1KQGB 1FKAF 2GQQA 3KHGA 4E0DA 3BS9A 2V2KA 1VRUB 2KT3A 3B78A 3VGVA 3WIVA 1IBMF 3BJYA 1Y5NB 4WF9Q 3E3XA 1BQNB 4HT7A 2MQ8A 3QJJA 1UVMA 1MN7A 5AXKA 3ETMA 1S77D 4B9UA 4K0KJ 4OHWA 4ILRA 5IZHA 2YNIA 5KFYA 3ENQA 1ICEB 2LA6A 5A8WB 1YWXA 5G0RA 2ZBCA 2QL5B 2F65A 3R2DJ 3H98A 1TMMA 4R5PB 1BMQB 4OYZA 5I42A 1D3WA 5CYMB 3H5YA 4OZJA 4ERDA 4ZOSA 1D1UA 1ZH5A 4LVOP 5MAOA 4RZRA 5B7WA 3OSNA 1R0BG 3EM1A 4Y34A 4H4KC 2WOMA 2H3EB 4U95A 2DPJA 1HWJA 4ZDNA 1C0UA 4ANDA 4PG8A 2DNNA 1TKTB 2F5GA 3DLKA 4KO0B 3JYTB 5K8OA 5L38A 4EO6A 2FD2A 4Q8FA 1TUGB 3ICLA 4GC7A 4IQMA 2NCKL 1T9TA 3K2YA 4X4VA 2VKZG 3N0VA 5E3QA 4ZP9A 1GXUA 3M8YA 2B7BB 5KFSA 3R5BA 2Z2MA 1YQHA 4ECTA 4ZVSB 1VGYA 4PR6A 1S59A 4J9PA 2LFVA 1SUQB 3HX9A 2F9JA 2Y8WA 4YS2A 2LCWA 5DGBA 3GR0A 2XZTB 2CNLB 1WC3A 4ZA1A 5EHHA 1H98A 1X4DA 1HIYA 1HI8A 3OFHA 3R5JB 3DRXA 2ZC4A 1UVJA 3C14A 2BKOA 1VI7A 4UW2A 1RABB 1P9QC 3MM9A 2PMWA 3VHQA 3IR7B 2FJWA 3M8SA 3IRXA 4B9VA 3C15A 1WJ9A 4C97A 3HMJG 4D3GA 3ZZZA 2HLTA 2CKWA 4LSNA 4BC7A 5KFMA 5D78A 2HZCA 4CH7A 5DDOC 1FXLA 1BQMA 1LW2B 4OX7A 3CD6S 4WXWA 1IJEB 3I9V9 3OXLA 2WHOA 4L3NA 3N6NA 5L1LA 3VAHA 1ZAXA 4F3QA 1D09B 3QSYB 1WTFA 2CPXA 2BRLA 2XYGB 2GZOA 1G6BA 1PYTA 2XBPA 3CJRA 3OR1B 1WG4A 1T05B 1G4CA 3GCXP 4L74A 4YHHJ 1FRJA 1WC4A 3HZGA 1HQEA 1X4EA 1XR5A 3QLHB 2BXJA 3HJVA 2BKPA 5J1EA 1B7YB 4EYHB 2I8EA 4L75A 4YDDB 2QRRA 1HQUB 1S0MA 1R31A 3DOLB 2RSQA 2I0XA 1LWXA 3QZ7A 2KJVA 3BKFA 4WYLA 2V4RA 3I0SA 3L9ZA 1MW7A 4NZ0A 2MHEA 2GA7A 3ZNUA 4DL5A 1CSJA 1N5VA 1HNWF 4Z7CA 2KRBA 2IIHA 3TYTA 3CCTA 3IM9A 5DETA 3UQSA 4M63A 4PG7A 3DNCA 4DU8A 3G8QA 5HN0A 2PSZA 2RD5C 2XCPA 2F8MA 4RLEA 1SKRA 1E6VA 3TUJC 1U09A 4IH6A 1TV6B 8AT1B 1WUUA 3TARA 1J5OA 4ZJLA 1HNVA 5DLFA 4G1IA 2ZD1B 2E29A 5HQ8A 2AV5A 4ED1A 3R1LA 2EPIA 3H5XA 2LA4A 5K9FA 3M6VA 1RBOB 1KR4A 4DCPB 5HMXA 2J8SA 2ZNYA 4UT4A 2XS7A 4OZ0A 3FC9A 5HI7A 2B51A 2AKWB 3SXLA 1EJ7L 3EGVA 3IM8A 1IR1A 1Y3KA 2H5IB 1IBLF 4MFBA 4LQ3A 3SQGB 1GXLA 1VK3A 2G2OA 3PW5A 2QLJB 2C2EA 1TL3B 1TL7B 3JQMA 3O3LA 2UUBJ 3FBBA 1TQLA 3UD3P 2UUCF 1TKDA 2VG7A 4MKBA 4UOFA 2KFYA 1HBUA 3NGSA 1SXLA 1ZAVA 2WONA 2W2PP 2MSTA 3M32B 4DUYJ 1SBRA 5LSRA 3FCHA 4ENOA 3EGNA 3GCWP 4WU2A 4DXLA 5B0GA 5IQ6A 4MYUA 1CS4B 4GO5X 4RUHA 2IM1A 3PJ9A 1AUSL 3AA9A 3QRQA 1U47A 3K5LA 2GO9A 2HHXA 1JJ4A 1CJVA 2OPRA 1N34F 2X1AA 4LR9A 2BJ7A 3BSOA 2KZMA 2R7OA 1KS2A 3VGTA 5LM7E 5IT0A 3FMWA 4QYZJ 2IC3A 4UQGA 3Q86A 5B0EA 4W92B 3K5MA 4OYOA 3LP0A 1KBRA 4MK8A 2HQDA 3CD0A 3IWNC 3OHAA 2BJ1A 1LWCA 2GVDA 1Q86T 3ZTSA 2HFUA 1HNZF 3EDRB 3HSJA 5BYQA 1Q1KA 4RBVA 2FVCA 2B8QA 2GMHA 1V3ZA 4AUKA 3SYZA 2CNKB 1UAWA 3DXSX 1Q4RA 3OTDA 4LBIA 1B4SA 1VQ5S 2BBEA 4ZP6A 5D4NA 2JRSA 4DZ6A 3PR5B 1HHQA 2XI2A 1ZM3A 5ETPA 2E9ZA 3KNAA 1VQ8S 2RF2B 2ZZNA 5F8NA 2B9YA 5KFWA 3H5UA 1IKWB 3MPWA 2VBXA 1T03A 3MOJB 1LFWA 2CQIA 3QRPA 1IBMJ 5KG5A 1S1WB 3RBZA 1RT7A 1QAYA 4X4OA 5IWAF 3TAQA 3BSAA 3PNIA 3ELHA 4WE1B 3A8JA 5F41A 1RA6A 1BLUA 3TAMA 2GHWA 4G1QB 2JHEA 5DG7A 2PD1A 2AYGA 4X4SA 1RAIB 3TI0A 4ZVRB 1FE4A 3KJVA 1OWXA 2HS0A 4NEYA 1HFEL 3T19A 4DR6J 3E8OA 4OZNA 6FD1A 4J37A 4TYBA 3BGFA 2JEIA 5DQGA 5DG8A 3PEHA 1XN9A 1DTTB 5A8KB 4CLTA 3H0PA 1NBEB 4JI4F 3BN7A 3U02A 3DLGB 1JLCA 3QZ8A 3CTRA 3LAMA 4DF4A 1RHUB 4YFUA 2UUAJ 3GV7B 2EFPA 2KB2A 4OJ1A 4DL2A 1XK8A 3TNVA 4P2SA 3TW0A 3T5KA 1FKPB 2G9OA 1RISA 3GSDA 4PG5A 4WFAQ 5A6WA 3M8QA 2K8GA 3MM7B 1HNXF 2MKIA 2MLYA 1TMJA 4F0HA 4MK9A 5F0WA 1EKRA 2ZH2A 2APOA 2G0JA 2RUSA 1REVA 1CJKB 3T1AA 4X2BA 2KVQE 4MIWA 3J7YI 4FVMA 5CQGA 4USJC 1KVJA 2P6TA 3HFZB 3PYEA 1U1RA 3NWRA 1RTJB 2CJKA 1EP4A 1MNEA 1VQKS 1M5OC 2G1DA 4ELTA 3EX7B 3ISND 2DEIA 2ZE2B 4CT9A 3KG4A 1X4GA 1DZ5A 3PV8A 2YX1A 3P96A 2DCLA 4O3OA 3K8VA 1FERA 1YJ7A 2EK1A 4OYAA 5KFHA 3NRBA 4DG1A 3TQ1A 1JLGA 1FD2A 3PFOA 3TANA 1DTQB 3JTNA 3RW6A 4DV0J 4ZPAA 3ETOA 3MECA 3O44A 2IM2A 2COLA 4YN3B 4F4AA 4OX9F 3SSQA 4F02A 4QZVB 4ANCA 1NDLA 4P2XA 2JWNA 2KHCA 3OL7A 2QTWA 1ZPWX 1CJTB 5GADU 1FF2A 3R7NB 4CLWA 3HD2A 1LK5A 3R2CJ 1GX5A 2W2OP 4ZVUB 3ZTQA 1M1KT 1DRZA 3BR9A 3TVZA 1S0VA 4N5SA 5KFFA 4HKQA 1U1OA 3MMCA 5IV3A 1RHMB 3EPGA 3VALA 4EBDA 4ECXA 1ZAWA 2YKNB 2MGZB 4C8YA 1FHTA 2ZH1A 1UVIA 3DKDA 1QSSA 2DY1A 4UY85 2E1MC 3PW7A 1Q79A 1IBKF 1RWXB 4CNZA 3POTB 3ZZ0A 5LXRA 2F1FA 1RLCL 1VS3A 3NY0A 4PQAA 3CMAS 4FF3A 2FHKA 1LNQA 1YHQS 5HL7Q 1PJ5A 4RW7A 4IG0B 4Y28C 4X64F 3IRWP 2ROGA 4QW9A 3M8PB 2V8PA 4O4RA 2HHPA 4I68A 4QPTA 1H2VZ 1QE1A 1B64A 4U96A 1UETA 2CZVC 1A9NB 5LMUJ 1AZSA 1WD6A 2A18A 2BR0A 4LUBA 4ANEA 4ECUA 2J0QD 1NJWA 4LIWA 1MWZA 2B5JA 2E5LJ 1WI8A 3BO4A 4RPFA 4ZVHA 4NZ7A 3MEGA 1B99A 3BB5A 3DOMA 2IM3A 4K59A 2FHMA 1WEZA 3LANA 3TZWA 2YNHB 1I6JA 2PT0A 4NLVA 3AT1B 2YQ3A 4A8FA 5FDLA 4J91A 2I2YA 3MXHP 4DF8A 1Q7LB 3AD9C 2N7CA 2YTCA 1NDCA 1D9DA 2R7SA 1JK9B 2Q3PA 4DV6F 4PRFA 4JI0F 4CO5A 2UV8A 1PG5B 4ECWA 2IM0A 3A3PB 1B70B 5C2CA 3C16B 3GIMA 1VIXA 4LFCF 3MEKA 2HZVA 2P9CA 2W1BA 2DGSA 3KK2B 1O0PA 2HG4A 3AOBA 2GVZB 4QW8A 1SV5B 3PJXA 1FJEB 2AHOB 3QIPA 4G3IA 4DL0C 2MKSA 5HLFB 3LTOA 2ZWOA 4U9RA 2KH9A 4J9VA 4CLZA 1S9GB 4FKYA 1PILA 5IM0B 1FFGB 3TA0A 1SQGA 4Y2IA 4JI6F 1TL5A 1Z2LA 4TXSA 4ILMA 1JKHA 4B3SJ 3THPA 1LW0B 1S1VA 1OSCA 4ZLNA 1Q8LA 1T9VA 3ZXWA 2NSCA 3MPVA 3BQ0A 2VA3A 5D3GB 3OHBA 2XWYA 3MEEB 1OQ3A 5LL6d 1S9EA 5F8MA 5D0RA 1N6QA 2V4JA 3EZ5A 1L3UA 2MHNA 1YDLA 3W2WB 3MMBA 2GIFA 4IOAQ 3KHHA 1VQYA 2DGOA 4F0MA 4OL8A 3WDOA 2C2DA 3I5CA 4B9MA 1IKYA 1NKCA 4DL6A 2ZBRA 4A46A 1HD1A 1F5BA 2YNGB 4AL7A 2XYHB 2QMXA 3QFWA 2EC2A 2M70A 5F3TA 2EFQA 2AF6A 4I69A 3CJKA 2RKIB 5KG4A 2E5GA 4XPCA 4P6QA 3MAAA 1BXNA 2W9CA 2BOPA 1WG1A 1PIEA 1FFSB 3C6TB 2QJ3A 3HHLA 3M30B 2CJXB 4QJVA 3PRDA 2VC1A 2M9KA 2MPUA 3E01B 2C2KB 3V4IA 2CVEA 3CO9A 4OYIA 3OVBA 2FVPA 2B9XA 3CJ4A 4P71A 3NLCA 1HYSB 3AY0A 3Q8RB 2WTFA 1VLYA 1BQNA 2FLOA 4KHPF 2HHHF 4DN9A 4R25A 4BBYA 3S7RA 1RT3B 4MKVA 1XERA 4LSZB 3W60A 4KV8A 4WKYA 4NOHA 1WDTA 3CO0P 1JLQB 3G86A 4B3MF 2NSBA 2RS8A 1ZM2A 4TU8A 4ECVA 1K47A 4NXNF 1SKWA 3HHLD 2J0WA 2LVWA 2IPOB 3U1NA 4W90B 5CYMA 5K8NA 3GZ7A 3RAMA 1QUPA 2E7WA 3L7OA 2RDIA 4BC9A 3LP1B 5LSOA 2AGOA 5EWGA 4Q8EA 4DL4A 4P2MA 2YPYA 2CZ9A 5GVQA 3H8YA 2DYAA 1EIYB 4LFAJ 2GHPA 2VICA 4DQSA 1B7FA 3KLGA 2Q66A 3GPAA 5FJ4A 4KO0A 3K17A 2FGOA 4O0IA 3HVWA 3HI9A 3C3LA 2IYGA 1EX8A 2JJ4D 2SXLA 4EMDA 3UN3A 1U25A 4AQYJ 4ZLLA 1X60A 3OJSA 2V5HG 4RW4B 4IDKA 4B3RF 5LXYA 4OV1A 3D2WA 3QWPA 5I4MA 1L3VA 4LQ9A 4DR4F 1ZBTA 2MDAA 4ZJOA 1SUQA 1M5SA 5ETQA 5D8HB 4I4BA 3U7JA 4ZIWA 1R6VA 3W61A 1T9XA 1Q8IA 2ZC3A 4I6AA 5D0GA 3W8PA 2MQOA 3IR6B 1RKJA 3CC4S 1FRIA 2VD3A 3BV8A 4N77A 4JYAF 1FKOA 4F4WA 3KMSA 5K5MA 3SCLE 2L41A 1MMDA 5H9FK 4BDPA 4M8LA 2QG9B 4TVAB 2AJ1A 2CQDA 2X1FA 2D1CA 4HDGA 1PCAA 1ZOTA 2LQBA 2G2YA 3GYGA 4IUFA 2Z0GA 4X4UA 3HPOA 2MSSA 3D7SB 2V8DA 4NXMJ 4Q43A 4U7UD 2JSXA 3S01A 2L9WA 3WC0A 1LW2A 2B6AB 3SCJE 5AXNA 4M5DB 4WCEQ 2DCUB 4QIVA 3SQOP 3HSDA 3ISNC 4NLQA 3OPKA 5D0HA 4DFPA 4ILLA 1SL2A 3T6JA 1WI6A 4LR8A 1HW9A 4NPOA 3UCZP 2IA0A 2R8GA 4DFMA 3OR1A 4B17A 1UJ5A 2MKJA 4K50A 2J8AA 4C0HA 3LOUA 1YBAA 2ZH9A 4FDFA 4RU9A 2VFVA 2ZUGA 1X4AA 4A8OA 2JOQA 2E9TA 2FC8A 2NYHA 2P8IA 3MCNA 1YJWS 2HVZA 2XMJA 2BACA 4WU3A 4ZPVR 4QYRA 3A8IA 2KXHA 5IC4B 2AMCB 1HD0A 4PWWA 5DZ7A 2ZM6F 2Z56B 2JLEA 4TQRA 1H0HB 2AWZA 3N01A 4M5KA 2KHDA 1YJVA 2FJVA 4B9TA 1C4AA 1IKVA 4KSEB 2Q1LA 2ILZA 5HVGA 2YKQA 4UUXA 4YQWA 2EXUA 1SC6A 1N32F 3UVJA 2RHSB 3K8WA 3HVTB 1SC3B 4JI8F 2J9DA 2ZD1A 1FX2A 2HIQA 7AT1B 2WBMA 3LGNA 3RJMB 3B54A 2DO4A 5E3RA 1S76D 3MPDA 3I87A 2AP6A 1WHXA 2RNEA 2NPFA 3K0JA 5C24A 4Y0FA 2DNHA 2ZH5A 1R8CA 2K1RB 2L48A 2KT2A 4N7TA 1UFKA 3F41A 3SQGA 1AB8A 2GMJA 3CCMS 1TL3A 2UXBJ 1TL7A 3BQ2A 1X9MA 3FCVA 1G2EA 2HYIB 4KGZB 4DEZA 3DC2A 4EI2A 2OEMA 4K4WA 3J7A1 1VRTA 1AXQA 4AL6A 3M32A 2FZCB 1D9FA 1ZETA 2UU9F 2HGLA 3PZPA 1RT1A 5AJ3J 2BKNA 4I64A 4FVCA 2RU9A 1EETA 2JDJA 2W24A 4J9UE 3K58A 2AEFA 2IVYA 2J7UA 1ZTWA 3DDNA 2ZOGA 3EZOA 4QU7A 4O3RA 4Q45A 1OQ6A 2XMMA 3KOAA 2GFFA 4AE5A 3PIPQ 3CMQA 1Q0NA 2KYXA 2KKHA 5AE3A 4NA3A 4WJBA 5AXLA 2LU2A 2EWHA 4W98A 4ZVPB 5KG3A 1RWNB 4JP8A 2PMHA 2I38A 2CDQA 1NPPA 2B43A 4WFBQ 2JC1A 2EEYA 3D66A 3EZUA 2OPQB 2WK4A 4IR9A 1QY7A 2KZZA 5DDPC 1DAXA 1S6OA 3NL0A 3PRBA 3V6DB 2YNFA 5GAEU 1R27B 4OYBA 1TFWA 1FI4A 3V5RA 4WFZA 1YKWA 3O5TB 1JJCB 1KFDA 5MLCV 3HHEA 5IFMA 1PAEX 3EXCX 3V6JA 3DLBA 2Y0BB 2BV3A 1XNRJ 4DMZA 1HWLA 3T1HF 1WNEA 2HVEA 4IFVB 5C42A 3QQCD 4U8VA 2WCXA 1S1XB 3GFYA 1R8BA 1IKWA 1ZYQA 4DUZF 5DM7Q 5KT5A 3SFGA 5I3PA 3UPFA 2W4CA 3NMAA 2PGCA 4DV5J 4WE1A 3MD3A 3NS5A 4ALZA 2BQRA 5J2QA 4M94A 2ZVIA 1I1GA 2I9SA 2NUHA 4FP9A 2ADCA 3ZZRA 4GVBB 4ZHRB 4QBUA 5GAGI 1AA1B 3V81B 4B3MJ 3TUIC 1W25A 5CABA 3NKYA 2LP4A 4EU0A 2LKZA 2J5AA 1X5TA 2R42A 2CADA 5A8KA 1TKXB 3IS9A 3M8WA 3ZZOA 2YH1A 1SC1B 3DLGA 3ZNJ1 1W2IA 4PQUB 4IRKA 4JI3F 3LP2A 3T1YJ 3H40A 2QA1A 3GWCA 1NK7A 3T3FA 5DLGA 1RCOB 2I1RA 4G6VB 1NH8A 4NASA 1NB7A 3RYLA 1FKPA 2DGQA 2HVIA 4F3MA 4IOCQ 4LRDA 2YKMB 1RWVB 5E2QA 3N28A 3GYNA 2HZAA 3GV8B 4QWCA 2WAQD 3FKBA 2V6AA 1U49A 2OPPB 2AJFE 4ED3A 4Y2AA 2YVSA 1WF2A 2G0CA 5KFAA 4OI6A 3CCUS 1FNOA 2W9BB 1G1XA 2HVHA 2HW3A 5LSLA 1WSRA 2EFGA 1N36F 2V68A 2C2NA 2Y1JA 1HI0P 1CJUB 2ATLA 2ZH4A 2ZE2A 2HK3A 1HR0F 5JVHQ 2GAGC 2YWFA 4LRFA 1UL3A 1NK6A 2OFGX 2ZBIA 4P52A 2VB6A 2R7XA 4FF1A 4MMOA 3H25A 1XC9A 4OI4A 4Q5VA 4EGLA 4HTIA 1UFLA 2P6SA 2R8JA 4YMEA 1HNIA 4LF4F 4Q2MA 4M5IA 4ECRA 1UWBA 2HQFA 4LSLB 4HHJA 4DQQA 1Q82T 3WX4A 3QNWB 4KTQA 3MM6A 1KD1T 1U6FA 3IN5A 2KFZA 3DI6B 4J9RA 4RJVA 2GJ2A 1REGX 2HFVA 4Y6IA 1WOPA 3WBZA 3IR5B 4KAIA 2JEGA 2HFOA 2CXEA 5D4PA 1WORA 1VQMS 1OY8A 3PYDA 4YR3A 1RYSA 2HVDA 3IMQJ 1HARA 3T5HA 1TVRB 1S0OA 2XYPB 4PXEA 2IAJB 3KHRA 3FQKA 2IBOA 2YKNA 4RUBA 2MGZA 4EBEA 4C0BA 1SIWB 4KQZA 3N79A 2VU5A 4OHYA 1RTDA 2OMOA 3J81Y 3IO1A 3POTA 4TY8B 3OLAA 3OUYA 2NS1B 1RTZA 3BPDA 3MAHA 3BREA 4W4MA 4ZVEA 2E7VA 4NLYA 1F1BB 3P3DA 4DR2F 4IG0A 2QA4S 2IY5B 3W5ZA 3M8PA 3AD7C 4MJKA 2KG1A 1RU2A 4QU6A 5HVFA 1NK8A 3KDNA 3MMJA 4NLGA 2ERRA 4IOBA 1YVFA 2AU0A 2BMBA 2LQ8A 3OLBA 5CXTA 4JV2A 3IG1B 2XM3A 3N5BA 4O44A 4J9MA 2DGXA 2W9AA 3LALA 1RU1A 1XBWA 3D1OA 2LMIA 2FLPA 3DMJA 3ISZA 4F2SA 1OPIA 5CZXA 2CJAA 4JI7J 4MT1A 3VF0B 1O5JA 4I7FA 3HFVA 2AD9A 3DOKA 2RE1A 4DHVA 1TKZB 2C42A 2P9GA 2NUUG 2DTJA 1FWPA 1UP1A 3C16A 4OZ5A 4XK8C 3K89A 2EFOA 2FQQB 3MM8B 4B9LA 1RT5A 4YB5A 1KQFB 4TQSA 3QO9B 1AT1B 2CPYA 3H7HB 4P10A 2OJ3A 2MQNA 1MLAA 2PEBA 4URQU 2WRMA 4RUCA 1S9GA 4ICLB 5IM0A 5KFBA 1FCAA 2EBEA 4KY3A 1NJIT 1P9YA 5KFZA 3U1LA 1PYSB 2HGNA 3MUVP 4ZPCA 1XJWB 4H4KA 1LW0A 5ETKA 5THWA 2HGMA 3JSMB 2M8HA 3D0IE 5IS2A 2POKA 3W2VA 1J27A 2WSEC 3G6VA 2WW4A 3MEEA 2CQBA 1CBKA 4ZCMA 1YZ7A 4JV1A 3PTWA 4P2FA 4YY3J 4PCQA 1U7LA 2PE8A 2PC6A 3AXKA 3IAM9 2Z2LA 3BKTA 2MZQA 1YK9A 4DPUA 2VFTA 4R8UB 2HFNA 5CCLA 4HT5A 1YTYA 1FE0A 1J5EF 1X4CA 2A10A 2BM1A 2GNKA 3DXBA 4QR1A 1UEVA 2FDNA 3NGTA 3G2XA 3NMRA 1U6ZA 4GKKF 3M8ZA 1C0TB 2HNZA 1KHWA 2HLUA 1X4HA 3ITHB 2RKIA 1K0VA 3WX8A 2DK2A 1ZA1B 3MZIA 4I2PA 3MFHA 2WVCA 3A8EA 5KFTA 2XNRA 2HHTA 3M30A 3LGHA 4ZLJA 2CG4A 3GIRA 1DY3A 3QAUA 1JLFB 5KG7A 3E01A 4JV0A 3LWLA 5F9NA 4UOCA 1SJRA 3SCIE 3KG0A 1GAOA 1Q78A 5KFOA 4F4XA 3MCOA 3QJPA 3MR3A 4PUOA 4C0OC 4NLXA 1SPBP 2CPEA 3H20A 2NYIA 4TN2A 2M88A 2Z2YB 1P6TA 1Z4UA 2ZDPA 3EVWA 2RQKA 1MSWD 1YSJA 3DRPB 2JH3A 3TWZA 3HJFA 1JLQA 4H4MB 3PRVA 4YUDA 4NCBA 4RL1A 1WHYA 3IWXA 4X62J 4F0KA 4X4TA 1D8YA 4JI5F 1V6HA 1RDRA 2HAIA 6FDRA 4BWJA 3PJWA 2A3JA 2O5DA 4OQJA 2J7WA 2VUGA 3N5FA 5I3UB 1U2CA 1GXTA 3ET6B 1XMOF 2QT7A 3CJQA 4U6PA 2MKKA 2UV8G 2DITA 3EVOA 1FEHA 4IFYB 4JI2F 1QTNB 3QIDA 3VGSA 1SC4B 2P2CB 2ROEA 1QLNA 2K06A 4QWAA 2E66A 3RBEA 2XQCA 3PKMA 4YB7A 3J81j 3PW4A 3CIMA 3FUYA 2HPUA 1WDDA 4JUZA 2BANA 2YKOA 1U48A 2KDOA 5A2QU 3TUPA 3FEXB 3SDEB 3ENAA 4ZITA 3D3BJ 1N36J 3G6XA 3BO2A 3FDSA 3KUEA 5L9XA 3VV2B 3V6HA 4GC6A 4QR2A 4DX6A 1PSDA 2UXCF 2OSRA 2I5JB 4NLPA 3CJ5A 1S10A 2HNDA 2DR9A 3DDKA 4DR5J 1S6QB 3UDVA 2DHHA 5RUBA 1N0UA 4WPAA 1SH0A 3VR1A 1RUSA 1VQOS 1XQIA 2MJNA 2KU7A 5CYQB 4K4TA 4PPZA 1QSLA 2C28A 2GQCA 3I96A 2NXUA 2W7OA 3FNNA 4HH0A 4M5DA 3M2UB 4ZVGA 1C1BB 1NXIA 1N54B 2FY8A 4KGVB 3LAKA 2CPJA 1N33J 1X31C 1MROA 3Q8QB 3QBCA 1X9SA 3MD1A 1RZMA 2CQHA 1X0PA 4A8YA 3M2VA 1SQEA 2W4DA 3OXGA 2EG1A 3FJ2A 3GB0A 3OSPA 4ITSA 3ADAC 4HL9A 1GNKA 3EVMA 3OTCA 4K4ZA 4DR7J 2LDYA 4FKXA 3TJ9A 3G71S 3AA8A 3C46A 1N5YB 4ECYA 2C3UA 4LJMA 1T94A 5T14A 4EEYA 4DV2J 1VC6A 5DJBA 4ZLPA 1U1KA 5EDWA 4JV5F 3WIUA 1AYEA 3FSIA 2H9ZA 4OI2A 1I94F 4DR1F 3T9NA 4DR2J 3X3UA 1AFJA 1RWWB 1RE1B 1RHJB 2H48B 2MZJA 3DYAA 3F44A 4KH0B 2HHQA 3MEDB 3CULA 1HMVB 4X4NA 3OR2B 4PXCA 1D8ZA 4OZ2A 1WF0A 4JOUA 1HW8A 1CQNA 4YB6A 2RDJA 1WTBA 4DV3J 5DQHA 1FJCA 1KKHA 2M4MA 2VDHA 3J81U 4LF7F 3PACA 4DSLA 1NK9A 1WG5A 1CLFA 1S6PA 2BA9A 5JUMA 2VFRA 3ILIA 2V94A 3I55S 3HK2A 1FT8A 2XSFA 1I3OB 4LR7A 2F4VJ 2LXUA 4J9QA 1HBOB 3L4BC 2HMIB 2E1PA 2CQ0A 2ACMA 5LMNJ 4LF5F 1VR6A 3MCSA 9ATCB 2VQEJ 4G1PA 1OPZA 1IM6A 1WC0A 2NXEA 3QWUA 2JNJA 1A0OB 2GX8A 2HWIA 1KLMA 1WF1A 4ZPWR 5K14B 4CLLA 3FRZA 2KTQA 1WEYA 5ETVA 3KK1B 2DGUA 3S8SA 3BN4A 3KLIB 1VQNS 1NZ8A 5GMKa 2QC3A 3KKFA 1YLXA 4M5NA 2AGQA 5HROB 2YQ1A 2ZBQA 2CG8A 2ATCB 4RKUC 5B0AA 3UCGA 3G82A 4LRBA 2VPWB 4O3QA 2QYGA 4MK7A 3R6GB 3OJUA 3A12A 2H51B 5JJBA 5FLXU 2QFIA 3ONQA 3I5BA 1U02A 2ASYA 4KGXB 2HBRB 2F4FA 1TFYA 1EQ0A 1FRKA 2QZ8A 4UZBA 5E0OA 3KMQA 2B7CB 5KAKA 2YXLA 1VQ9S 1VYAA 3CPWR 2FJBB 2OP5A 1R0AA 2RHQB 2HS3A 2XNQA 1C1CA 2L9DA 5BYSA 2RH3A 3UR0A 5KFKA 3Q8PB 2BOAA 2BQUA 2FLNA 2YNIB 4NX9A 1FDAA 1SJFA 5C2GA 1M1GA 3C8YA 3K7RA 5I42B 3SFUA 3TX0A 1RGVA 1YG0A 3I6PA 4KKOB 1R43A 4EYIB 2HKEA 3VQSA 4F36A 4PPDA 5SUHA 4YB1P 3RUBL 1C0UB 2XS2A 1F3FA 2QLWA 4HH1A 1U1PA 1NJXA 4RU2A 3S1TA 4DV1F 4A8QA 3DLKB 1KSPA 3FCWA 4IFVA 1S1XA 3CCLS 2DJWA 5KTQA 2ZWPA 5D4OA 2MMYA 4CT8A 2MB0B 1OMSA 1WELA 2FTRA 4IG3B 2DXDA 2RQCA 1X7VA 2HQ3A 3DU5A 1OY9A 1LXJA 2R8KA 4KRWA 4C11A 5BYRA 3TP2A 4O4GB 1RKIA 4J7CA 8ATCB 3UR3C 3HHDA 4TU9A 4GVBA 4ZHRA 5EX3A 1Q53A 1UCNA 1JNZB 3RR7A 4MIAA 4B3TF 2HNYB 5DG9A 3ZTPA 1HHTP 1VBXA 3RAQA 2E5IA 3PR4A 4X4QA 5ETRA 2ASDA 3C14B 3AODA 4UUWA 3M6XA 1TKXA 1X4BA 5CAAA 3RZAA 3QAEA 3OV7A 3G6ES 3IRXB 1S5ZA 3C15B 3KUHA 4NA2A 4AT1B 4D3HA 4DSJA 3HLUA 2HBQB 3HT3A 4OHVA 3DRSB 2CJBA 2YKMA 1GT8A 3QGGA 2H54B 1S99A 3PVXA 1A6LA 2QA2A 4DV4F 5KFRA 3MCMA 2J9CA 2OPPA 2VQFJ 3W62A 2MEWA 3OFEA 3BF4A 1T8EA 1VQ7S 1GH8A 1TK0A 3F56A 2ZNZA 2IJFA 1HI1A 1JMTA 4ZP8A 3NAHA 2W9BA 4OLPA 3HD1A 3Q23A 3RR8A 3CT9A 1WKJA 3GU0A 2MZSA 3OTOJ 2MYFA 4CDIA 4KYZA 3MURP 2RMLA 3LF0A 2K2PA 3CDAA 1CJUA 2R2TA 4RBTA 1S1UA 4MYTA 3D6TB 4JI1F 2RT3A 2X7IA 2ZH6A 3CJ0A 1RTHA 3N6LA 2ABYA 4HTJA 1Q5YA 2CQ2A 4FPRA 1WACA 2WBRA 4J9OA 1K1SA 1YJNS 4TY9A 2BW2A 2XG8A 2DISA 1VHFA 4RNHA 4DV7J 3KLEB 2IFXA 4UTGA 1M90T 2M7SA 2XHWA 3CEDA 4X66J 3GP9A 3T5JA 4FYYB 4F04B 5E33A 5AXMA 5BR8J 1NKEA 3V6KA 2KXFA 1E6VB 1NK4A 3DI6A 4WP3A 1FJGF 2OMLA 4DPYA 4WFXA 4C98A 2XMAA 2DY9A 1RBAA 1T9WA 2PI4A 2JFDA 2OO4A 3W7BA 3B82A 2UVUA 2VG5B 3H4DA 2C2RA 2ILYA 4PYAA 1LXNA 1PGZA 1TAQA 2F3JA 3OW2R 4DLGA 3EJMA 1TVRA 4NLOA 4DS5A 2V8GA 4LMZA 2XO7A 2XHCA 4K4YA 1F5AA 1U1MA 1PYOB 4FF2A 1L3TA 5C25B 4ZIVA 2R7TA 2BQ3A 4F3OA 3UN2A 4PABA 3CCQS 2QEXS 3ZTOA 3Q2TC 5L1IA 1PJ6A 4TY8A 2MQLA 3DRYA 3B8HA 4QPXA 3VVTA 1T95A 4Y2KA 3L7UA 2XMTA 1B0VA 2WONB 3EGWB 4NLSA 2F63A 3CIZA 4GVLA 4WXOA 1RP5A 3Q8UA 1EQMA 3ULHA 1MWQA 4CRJA 1XIQA 3P6YC 2CDRB 1RADB 3TZXA 1DHMA 4YR0A 4DS4A 3P8BB 4A8SA 3C6UA 3VCDA 4KJIA 1N56A 1W26A 2X1GA 3K5OA 2GC8A 2IHR1 2OTJS 3IG1A 2MY8A 3MUMP 2BE2B 2VODA 2YKPA 5H9EK 4LREA 4DCOB 5K8MA 3M9MB 4IRDA 2AYMA 2JZ5A 2UXDJ 4ZVTB 3W1YC 3NCRA 4URGA 3OFFA 5D77A 4LFBJ 3V4MA 3CMES 3K57A 4HACA 2IRXA 1TK8A 2EFVA 2OFHX 4B02A 1Y10A 1OJ4A 3RAXA 3NG8A 1LWFB 4KFBA 2XMKA 4K4UA 4WK1A 2HQGA 2OH2A 4UQTA 2GVDB 3MM8A 5F8HA 3OT9A 1QDUB 2BRKA 1JB0C 1V5IB 3M2RB 1UWAA 3QO9A 3W9JA 4WYWA 4XO0A 5KFGA 1T9YA 5U47A 2KT5A 2XGPA 1TU0B 1QTMA 3OTBA 1NHUA 2V50A 3FFIB 2NPIA 3DU6A 1LWEB 3OQ2A 2WW8A 3RG6A 1E6YB 1P1LA 4FBTA 3MR5A 3MR6A 4PG6A 3PO4A 7FDRA 2R4FA 3DCAA 4MIBA 1QD1A 2LEBA 5GAHU 1ZM9A 5ETOA 2WB1D 2J9EA 2DBBA 4LF8F 1QAXA 3JSMA 1T03B 2DNQA 1NJZA 3CJSA 2QLXA 2CWXA 2FUG9 3RGIA 3Q83A 4C6AA 1BQXA 3R5DA 2HIYA 5HATA 2O01C 3G9CA 3S6EA 3TAMB 1JX4A 4QR0A 4MAKA 1RWUA 4DSFA 2Z57B 6AT1B 4R8UA 3A1YG 5F8IA 5E41A 3NNHA 3K5NA 1R6YA 4N8NA 4K0KF 3DFEA 2XMVA 5HP1A 4ID8A 2DVIA 2YX4A 5KOXA 2MLXA 4JB8B 1FDDA 1NEEA 3HVRA 3KLHA 3ITHA 2L08A 1JLCB 4DPOA 3C66A 5D0EA 2C3OA 4DCJB 3CWJA 4WFNQ 1RT6A 1VK8A 1R3NA 4OJ3A 5KT3A 1HBNA 1VDHA 4DDFA 1URRA 2DKOB 3T5LA 4FF4A 4KR0B 3PM9A 5HBMA 1NHVA 2DXFA 4LIRA 1UEKA 1BY9A 4DU7A 2DRBA 3X1LB 1GFWB 2QX0A 1NSAA 1EB0A 1RWOB 3GMGA 1YZ6A 4EO8A 4ZVFA 2YQ0A 2A6MA 3LO3A 1U0SA
chains in the Genus database with same CATH topology
5KFDA 2CQ1A 3DLGA 2CQPA 3K2YA 1W2IA 4PQUB 1H7XA 2VKZG 4X4VA 1EP4B 3DRPA 4IRKA 3N0VA 1P1TA 2EG2A 3LP2A 2QA1A 3GWCA 3H5SA 4ZP9A 5E3QA 5EWEA 3H40A 1RJJA 1NK7A 1OSDA 5DLGA 3T3FA 3IXQA 2PA3A 5E3CA 1GXUA 2I1RA 1B0PA 4KT0C 5CHCB 1Y00A 1VQ4S 4N76A 2B7BB 4G6VB 1NH8A 4H4OB 4H4MA 3O6QA 2ASLA 1NB7A 3BGRB 3RYLA 2VA2A 3BR8A 1UKUA 5KFSA 1FKPA 3R5BA 2Z2MA 1YQHA 1IKXB 2DGQA 4ECTA 2HVIA 4QIWD 1AFIA 2OPSB 4ZPTR 3LP1A 4F3MA 3SZ2A 4IOCQ 2X3GA 1VGYA 5J2MB 4AYBD 4PR6A 2YKMB 4ES1A 2F9DA 5E2QA 4J9PA 1SUQB 3HX9A 2F9JA 4Q0BA 2BANB 1GQEA 3N28A 4GKJF 3GYNA 1YRUA 3T6BA 4QWCA 2WAQD 5DDRC 3GV8B 2VASA 2LCWA 3EXYA 5DGBA 3GR0A 1Q8BA 5J2NA 1U49A 1JLEB 2OPPB 2AX1A 2AJFE 3M1VA 4ED3A 4ZA1A 5EHHA 1H98A 1X4DA 4NCAA 3PIOQ 4Y2AA 1KLNA 2YVSA 1HI8A 1HWUA 1XWLA 3OFHA 4DG1B 3DRXA 1WF2A 2EI5A 2G0CA 4KHRA 1JLGB 4EZ6A 3QYYA 1M5HA 2ZC4A 5KFAA 2FHJA 4DQRA 4OI6A 3CCUS 2GW8A 1UVJA 2ASJA 4KC5A 5EX0A 1FNOA 1URNA 2W9BB 4PKDB 1G1XA 1VI7A 1O51A 4UW2A 4OLOA 1P9QC 3MM9A 4BS2A 3DM2A 3KG1A 5KFLA 3V2UC 2HVHA 4NYOA 2HW3A 2VFUA 1JNRB 2LU1A 5LSLA 3CCWA 3IR7B 5F8GA 2RU3A 1NH7A 2FJWA 3M8SA 3IRXA 4B9VA 2R7RA 4C97A 2EFGA 2K3IA 1U1LA 5EGYA 3CCZA 4RW4A 3OVSA 1UA0A 4YDXA 2MQMA 1SH2A 3GYXB 1DURA 3HMJG 4D3GA 4M1KA 1KQSR 3ZZZA 1N36F 2HLTA 3D0HE 2CKWA 4LSNA 2HNDB 2Y1JA 2ZOMA 3FEZA 4BC7A 5KFMA 1HI0P 5D78A 2HZCA 4R0EA 2VONA 4CH7A 4CO4A 2ATLA 1KQKA 3M9OB 2ZH4A 5DDOC 2ZE2A 1JLAB 2DH8A 3D54A 1FXLA 1BQMA 1LW2B 4OX7A 1HR0F 2B4OA 2GO8A 3CD6S 2L9NA 4WXWA 1IJEB 5JVHQ 3I9V9 4NLRA 4K4XA 2YWFA 4X65F 2NQPA 2M2BA 1NK6A 1UL3A 1VIOA 3OXLA 2DNKA 2WHOA 2DNOA 2OFGX 2OLWA 1AW0A 4L3NA 2ZBIA 3N6NA 5L1LA 2VB6A 3VAHA 2R7XA 1ZAXA 2DH7A 4F3QA 4FF1A 4WZMA 1RYRA 1N5TA 4MMOA 3M6WA 3H25A 3KFWX 4OI4A 1XC9A 1WTFA 4AXJA 2CPXA 3TVKA 2GMLA 4EGLA 4Q5VA 2FB0A 2BRLA 1UFLA 4HTIA 2O1PA 2P6SA 1G6BA 4ECSA 2R8JA 4YHHF 3Q24A 2XBPA 3ENWA 2MZ1A 4B9SA 3OR1B 1WG4A 4YMEA 1HNIA 3H4BA 3CD5A 1T05B 3DLEA 4ELUA 4LF4F 2ZFHA 4NL5A 4Q2MA 2FHJD 1ELOA 1FRJA 1HPZA 1UWBA 4ECRA 1MU2A 2MKHA 4LSLB 3NAIA 4HHJA 2XI3A 4DQQA 1Q82T 1MROB 1IQZA 1QM9A 3WX4A 4KTQA 3MM6A 3CSKA 3HZGA 1HQEA 1X4EA 2I5JA 1XR5A 3QLHB 1FA0A 1KD1T 2BXJA 1FTCA 4Z2XA 4QWDA 5A0YB 5J1EA 1U6FA 3IN5A 4EYHB 3GFZA 2KFZA 3DI6B 4J9RA 2I8EA 4B9NA 4YDDB 2DIUA 2GJ2A 3M2VB 2QRRA 1HQUB 1S0MA 1R31A 1FDBA 2ZJQQ 2B6AA 1X5OA 3DOLB 4Y6IA 2RSQA 2QFJA 3IC1A 3WBZA 2I0XA 3IR5B 4NCGB 1RI7A 3QZ7A 4KAIA 3KLFB 2KJVA 4BHQA 2JEGA 2HFOA 3NP5A 3UFCX 2MXYA 3BGUA 2W8LA 5D4PA 5GAGU 3MMAA 1VQMS 4HLBA 4P7VA 4WYLA 5CYQA 2KM8B 2V4RA 3I0SA 1MW7A 4NZ0A 3NCPA 4KGMA 2R7VA 2MHEA 4YR3A 4LVNP 1RYSA 4JBCA 2GA7A 1HARA 3T5HA 2DNZA 4DL5A 1TL1B 3M2UA 2AYBA 1TVRB 1S0OA 2KI2A 1CSJA 1C1BA 2QE5A 1N5VA 1HNWF 5GAHI 2KRBA 4PXEA 2IAJB 3KHRA 3TYTA 3CCTA 3FQKA 2IBOA 2XULA 2UZAA 2YKNA 4M63A 4PG7A 2IVFB 3UQSA 3ZFVA 5DDQC 5DETA 5I3QA 3DNCA 4EBEA 2HWTA 4C0BA 1SIWB 3EUNA 3CC7S 5KT4A 1Y0HA 3G8QA 4KQZA 3D1HA 4Z37A 4CO1A 5SZTA 3N79A 5HN0A 1U4BA 4OHYA 1RTDA 4IQXA 4KGKA 2PSZA 4HDHA 4QWEA 2RD5C 2XCPA 2OMOA 3G4SS 3J81Y 2F8MA 3H59A 4RLEA 2MZTA 3GFHA 2F8EX 1U6BA 4I2QA 1SKRA 3IO1A 1E6VA 3TUJC 1H38A 1U09A 3POTA 4TY8B 4IH6A 2F40A 3DYAB 1TV6B 4I1TA 2LEAA 3JTOA 3OLAA 3TARA 1LV5A 3OUYA 1J5OA 1G3OA 2NS1B 2CPZA 4NLDA 1HNVA 5DLFA 4G1IA 3MAHA 3BDEA 2ZD1B 2E29A 3MPYA 5HQ8A 4RUAA 1DLOB 3J7YU 4QWBA 3BREA 4C9DA 4ZVEA 1G7CB 4NLYA 2AV5A 3TA2A 4ED1A 2DO0A 3R1LA 2EPIA 3VWSA 3P3DA 1ZZNA 4DR2F 5E7OB 3H5XA 3OL9A 4IG0A 4URSA 4FZVA 2LA4A 5K9FA 2QA4S 4DWIA 1H2UX 2LQ5A 3M6VA 3M8PA 1KR4A 5HMXA 5KFIA 2FLLA 1N5YA 4MJKA 2ZNYA 3IAS9 2XS7A 2KG1A 4OZ0A 4QU6A 1CVJA 2UVWA 1NK8A 3FEYB 5HI7A 2B51A 3MMJA 5G4DA 4NLGA 2ERRA 4IOBA 1YVFA 2VBZA 3SXLA 1M0SA 1MWYA 2NZ4A 1Y3KA 1S0NA 2AU0A 1GTEA 2OD4A 2G13A 4FXDA 3R1HA 3OLBA 1YRTA 5CXTA 1S6PB 4JV2A 2GGPB 3L95X 1IBLF 2UUBF 3IG1B 4RW8A 1A7GE 4MFBA 4LQ3A 3SQGB 1GXLA 1VK3A 4OX6A 3PW5A 3N5BA 4O44A 4J9MA 3IGNA 1QUVA 1TL3B 5KT6A 2C2EA 2DGXA 2W9AA 3LALA 3AQOA 3HVAA 1XBWA 3O3LA 4JI7F 2YWEA 2A2CA 3LPYA 1TQLA 3UD3P 2UUCF 3VAGA 3HVTA 1TKDA 3D1OA 2VG7A 1KOOA 3HXMA 4MKBA 4DUYF 3HKWA 2LMIA 2FLPA 3DMJA 3ISZA 4F2SA 2KFYA 1HBUA 1OPIA 1SXLA 5CZXA 2CJAA 3CJ2A 1ZAVA 2WONA 3DRRA 3VF0B 4MKAA 1PO6A 2MSTA 1O5JA 3KLVA 3M32B 4I7FA 1SBRA 4OX8A 2KN4A 4CH1A 5D4LA 4E8UA 5LSRA 4DL3A 2AD9A 3DOKA 2RE1A 4LF6F 3FCHA 3EGNA 1S1VB 4DHVA 3RB4A 1TKZB 4H54A 2C42A 2XLJA 4WU2A 2U2FA 3DLLQ 2E5JA 2P9GA 5B0GA 5KFCA 2NUUG 2DTJA 5IQ6A 1UP1A 1KLMB 2BDPA 4KHMA 4MYUA 4OZ5A 4XK8C 3CGIA 4GO5X 4RUHA 3G6YA 2EFOA 2IM1A 3BSNA 3D28A 3MM8B 5K8PA 4B9LA 1RTIB 1RT5A 2BVZA 2K1RA 4K5SA 3AA9A 4YB5A 5J1PA 4ES2A 1S7HA 3KTQA 3NCQA 4C8ZA 3SMZA 1KQFB 1CG2A 2W7PA 4TQSA 3QO9B 2CPYA 1ULRA 1U47A 3K5LA 2GO9A 2XSJA 2Y0SD 5CYJA 1BD6A 2HHXA 2AQ4A 1JJ4A 2YWHA 1N5SA 3GIJA 2OPRA 1N34F 2KM8C 1DQ9A 2X1AA 3MMBB 4F25A 2OJ3A 2MQNA 1IN0A 1YI2S 4URQU 4RNMA 3JB9k 3BSOA 4FNHA 1HBOA