1FFGB

Chey-binding domain of chea in complex with chey at 2.1 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
b'PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Further insights into the mechanism of function of the response regulator CheY from crystallographic studies of the CheY--CheA(124--257) complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1ffgB00
1FFWB 1EAYC 2LP4A 1FFSB 1A0OB 1FWPA 1FFGB
chains in the Genus database with same CATH superfamily
1NZ8A 2OPRA 2LP4A 2P2CB 4CYUB 3G82B 2XYPB 4QW8A 3CD0A 1J5OA 3W7BA 3DGPB 3W2VB 3CO9A 4UZBA 4P2XA 1FA0A 2X51A 1RDRA 5H9EK 1TR0A 2WVCA 9ATCB 2HNYB 4NXMF 3VAKA 3MM7B 2H5IB 4LR8A 3MPUB 4DSKA 2HWIA 2MHEA 4PQAA 2ZJPQ 3CMAS 1RABB 4JB8B 3AHPA 3IBWA 3CC4S 1IM4A 5F9NA 1M5HA 2XS7A 3QFWA 4J7CA 3G6ES 3Q8RB 1X7VA 3K5LA 4ALZA 1OYEA 4OQJA 3J7Z5 1XEZA 3DGVA 4I2QA 5K8MA 2XWYA 1ZA1B 1EETA 4DV1J 1AFIA 2UZAA 4K5RA 1N0UA 1U2CA 4OYZA 2AF6A 3TYTA 5D0HA 2ZKTA 3R5JB 2I8EA 2VFTA 1YK9A 5CQGA 1LWCA 2KVQE 1RT1B 4FPRA 4QR2A 4IRKA 4FBTA 5T14A 1HKAA 4LSNB 1NDLA 4B3RJ 3NNAA 2FTRA 2EFPA 2BJ7A 1AUDA 3R6GB 1Q16B 2KT2A 4FBUA 1QSLA 4WE1B 5CD4A 3UO0A 1DLOA 1S49A 2AIRB 4PUOA 4XAKA 2Y1IA 3D1OA 4O4GB 3NS6A 2RQMA 2UUBF 3CF5Q 2DXEA 4J9VA 2D1CA 4V19J 5ITHA 3B54A 3EZUA 5KFDA 2YTCA 3P4UB 1EAYC 4EO8A 1C0TA 2LVWA 2X1GA 3MEEA 4F4KA 3NP5A 3HSZA 1RHQB 4P7VA 3T6BA 2XYGB 2DNHA 4CLSA 1U6BA 4CLWA 3Q8PB 2PFDA 1ZPWX 1WNEA 4GKKF 4RNMA 3CJ3A 1VK3A 3FK4A 2WTFA 5HP1B 2VOPA 3VAHA 2Z2YB 3QSYB 1VI7A 3OVAA 5H9FJ 8ATCB 1A0OB 3BBBA 3MEGB 2HW3A 1REVA 2C2DA 3RAMA 1LWFB 1U48A 4USVA 1F3FA 2ASJA 4I67A 5LT5A 1VIXA 4MIBA 4AXIA 3IR7B 4USKA 1TV6B 4K2JA 1TL7A 4F36A 3BGRB 5K9FA 2G9OA 2AJQA 1O6XA 2RILA 3P8BB 4RZRA 3MD3A 1VK8A 3EYZA 3M32B 3W1YC 3G96A 1S4EA 1G3OA 2C2OB 3R5CA 4N8NA 2FQQB 1HYSB 3K89A 2DR5A 1NPPA 1TFYA 2LU2A 5FDLA 4JI1J 4GRSA 2HGLA 4MFBA 4KGVB 4G6VB 2FHKA 3DN9A 3T9ZA 1I6JA 3OJSA 4RX6A 2WOMA 2E29A 4ZVGA 4YEAA 4DUTA 2M70A 1SC6A 2MQPA 4DBQA 1CC8A 4WTOB 1ZZFA 1CJUA 2DNNA 5KFYA 1X5OA 2P6SA 2GIQA 3UW1A 1FNXH 1NDKA 2YWEA 4DZ6A 4JV5J 5KT2A 2IC3B 2F4VF 2GJ2A 2MLYA 3UNYA 1VQNS 3EM1A 5EWFA 2XGQA 4U7UD 2OPSA 2KO1A 2CNOB 3CDUA 2DH7A 2OAUA 3VGVA 1FFWB 2RUGA 5HQMA 4ENOA 1H2VZ 2C2RA 1SB6A 2ZDPA 3PKYA 1KQKA 4OJGA 3KK2B 4OJ3A 4A8FA 3OTBA 2BW7A 2IRXA 2VPYB 3T3FA 3G6YA 2EKNA 4ZP7A 5GADI 2IA0A 2OTLS 4C3LA 2WHOA 3DYAB 1D8YA 4CYUA 1HQEB 5F8IA 1S1XB 2C3UA 3ITHB 4MK9A 3R7BB 1YWXA 2R7XA 2HNYA 4IOAQ 1JLFA 3MM7A 4X4PA 3MD1A 4ED5A 3DLEB 5HVGA 4MYUA 1Q8LA 3DOMB 1TUGB 5F0UA 3POTB 3V81A 4DV4F 1KEKA 4WPAA 3T1YF 3EVWA 1FJCA 2R2RA 1B0PA 2D9PA 2H1YA 3TJ8A 1RAHB 4YR3A 1HIYA 4AL6A 1Y00A 4MYTA 4DZDA 1H6KX 4TVAB 2GQQA 2KXFA 1BMQB 2MQOA 3CGIA 1GTHA 4M1KA 1JXVA 2UUCJ 3UCGA 2JEJA 2JVRA 3CD5A 3OD2A 1RT1A 2AWZA 3ILJA 4F26A 1SL2A 1NLKL 4LSNA 1N0VC 4RNOA 4X64J 5B0CA 1CG2A 3BREA 3BV8A 3M8RA 4F4YA 2VQEF 4EGLA 5E7OB 2CDRB 3R9LA 2CJAA 3HLUA 4DL3A 1VQMS 3D66A 1HBMB 2B7CB 3ZO7A 1JXLA 1K47A 4URSA 1M0SA 4M5IA 3D7SB 3BPDA 5HK4A 2C2NA 2KZZA 4EYIB 1MWYA 4KFBB 1X4GA 4IR9A 2QLBB 2AW0A 2QMXA 1FK9A 2WW4A 2MZSA 2J9EA 3RB0A 1EP4B 2MTLA 1S6QA 2IVMA 1M5VC 3ISNC 1NSAA 4UF4A 2OFHX 3HZGA 3VAIA 2KHCA 4NYZA 3QIDA 4CI0B 4WJBA 2DNYA 3TVYA 3QMQA 3OSNA 4LF5F 5D15A 4C0HA 2BQUA 5CYMB 1WSRA 1I3OB 5HP1A 3Q0AA 4F3MA 2ZH9A 4NWBA 2UXCJ 2VBZA 4QIVA 1Q5YA 4ZA1A 1RKIA 1FDAA 3TEGA 2V8DA 2GS8A 2YVSA 4AXJA 1LWFA 7FDRA 4K2XA 4L3NA 5HROB 1U1PA 1K73T 1ITPA 1GXUA 1TUWA 4O44B 4Y2CA 2HZCA 3BGRA 4ZHRB 4OZLA 4ATNA 3L7UA 1YRUA 3PKMA 1OY8A 1F6TA 3CCJS 2NUUG 3M32A 4Y28C 2N3LA 1FO1A 4LSZB 2UP1A 3J7A1 2EG2A 5BYRA 2NQPA 3LA0A 5C7PA 1Y10A 4IG3B 3M8SA 4QZVB 2W4DA 3AOAA 2HVHA 4CM0A 1HYSA 2LEBA 2PE8A 4RNFA 3WDOA 3S7RA 5D0RA 1XN9A 5E3CA 4KYZA 3D6TB 1YJUA 1RT5B 4RW6B 2PI5A 3GSIA 2MJNA 3NKYA 1N56A 3OR2B 3G9CA 5JVGQ 1RWUA 3N6NA 2NUHA 2ZBPA 4I68A 2ZH3A 2DPJA 3TARA 3I0RB 4CZCA 5AE1A 4DSJA 2CZ4A 4ECYA 2IC3A 2VD3A 2ALYB 1XK8A 1KS2A 2DISA 1S9EA 4KHPJ 2Y8WA 2NSCA 3EGWB 4DX8H 3R2CJ 1CJVB 1CQMA 2UUAJ 4WFZA 1KBRA 1PG5B 5LSOA 3KK2A 3SSRA 2YQ3A 4DEZA 1MSWD 1F5BA 2AZ1A 3FEXB 3QRQA 4K4WA 1Q8IA 3MEDA 1HBUA 2Z2ZA 2B4OA 1HQEA 3C46A 2QEXS 1T03A 1S1XA 1T9XA 2MKIA 3ITHA 1WHYA 3GJQB 2UVVA 2R4FA 1P6TA 2QZ8A 4DL0C 4B17A 1VHIA 2CPXA 2HQIA 4Q7AA 3PO4A 2NZCA 1F2HA 5GAHI 1KD1T 1RBOB 1CPZA 4DI6A 2QLFB 3POTA 4N8OA 4Y6IA 1WC4A 2MSTA 3BBCA 2DCUB 2G13A 5DDRC 2V68A 4IH7A 1B7YB 1SV5B 2DGSA 3M9MB 1NO8A 2BR0A 2ZITA 5KFXA 3LANA 1RT4B 3AD7C 4YR2A 2RD5C 2J6SA 1S0NA 1BHNA 2MMYA 1WG1A 1W2IA 3ZTQA 5B0DA 2F1FA 4NXNJ 4DQSA 3UN3A 1AXQA 3KLGB 3B6BA 2MGZB 2EC0A 3QO9B 3JTNA 1XERA 3J7YI 1SQFA 2E44A 1CJTB 2HIQA 1U2RA 1GNKA 3DI6B 4ZN3A 3CIZA 4U8YA 2YQ1A 2U1AA 2IYIA 4DSIA 2AEJA 3W5YA 9RUBA 4DV6F 2JJ4D 3ONQA 4ECVA 1QUVA 4OI3A 1IKWA 2H3EB 2CKWA 1TFWA 2KYZA 3R8YA 4Y65A 4O3PA 3W3SA 2NLWA 4GO5X 3LALA 4KT0C 3MMAB 5ADZA 2DRDA 2QTWA 4DV3F 1EP4A 3ZZYA 3D54A 3Q8VA 1XMOF 3OTDA 4CDIA 5J1PA 3LOUA 4CO0A 2OMOA 1JLBB 1APSA 4DR3F 1H72C 3SCKE 3ULHA 1T05A 4PAAA 3NNCA 2AJ1A 4F04B 3RRHA 3UDEA 4H4OB 1H74A 5CYMA 4EZ6A 2YNIA 4TU9A 3KK3B 2V5HG 2Q66A 2LQ5A 3IMQJ 3HVAA 4E2FB 3THTA 5DJBA 3TUZC 4FKXA 2GAHC 4LF4F 5IC4B 3TRGA 5CCLA 2JFDA 4LFCF 3I87A 4DPUA 1X60A 1SJRA 3NGSA 4YFUA 2X1BA 3CMES 2CJXB 4LF8J 1ZM2A 4O44A 2OELA 4N77A 1P9YA 4ZHRA 4I7FA 1IBKF 3KMSA 2ACYA 3QRRA 3QJJA 1TL4A 3NRBA 4PXCA 4LQ9A 1SJQA 2YNHB 4RU9A 4RW9B 4J90A 1FXLA 1VFJA 3IAM9 1JB0C 1Q7LB 1UA0A 2WBMA 4IO1A 3VAMA 4NLYA 3M2VB 2ZEJA 2D74B 1RAEB 3A3NB 2WAQD 3Q83A 3BQ1A 3PW7A 5C25B 3MDFA 2X1FA 2DGQA 1RT5A 1Q8KA 3QFHA 3DLJA 4LF9J 1CULA 4ID5B 4CLLA 1U49A 3CJ4A 3OR2A 3KJFB 5M2RA 1TVRB 4U6PA 2D3ZA 2PEHA 3TQ1A 4ED3A 1VJQA 2QLJB 4HT5A 2EFQA 3I0RA 2I38A 4C3KA 2BYCA 3W5ZA 4MK8A 2P9GA 3GE9A 2NXJA 4A8MP 1RYRA 2VHGA 2CYYA 4OZ5A 3K5MA 1HHQA 2QGFB 4OJHA 1AFJA 3O1LA 1CJVA 2J7WA 1WEXA 3W63A 4KIAA 4NOHA 2JDJA 2I2YA 4DFPA 3H42A 3B8HA 4L75A 1AZSB 5GMDA 3DXBA 2YWGA 1O51A 3EWGA 1SQGA 4IUFA 1C2PA 3KHGA 2XLIA 3D5MA 1FDBA 2ZBRA 2F5GA 3MPWA 1OPIA 1U25A 2V0NA 4HHJA 5M2UA 3J7AN 1ULRA 3JAMY 4KV8B 3LTOA 3D9BA 3I5AA 3T1YJ 3WC2A 2WSEC 4WYWA 2AYGA 2W2PP 2CZ9A 3CCWA 2W2NP 5B0AA 5D4LA 4LF2A 2DGXA 4X4VA 2DRAA 1NKCA 4C8NA 1H0HB 3CDEA 3CCSS 3E01B 4WKYA 3HPOA 1S12A 2OD4A 1LW0B 1M90T 5LSRA 4HYKA 3MMCB 5DM7Q 1SV5A 4QYZJ 3MM8B 3HHLC 2HNZB 4EU0A 3ZZRA 1RT4A 4WFXA 2F4FA 1RU1A 3UVJB 3SQOP 1OS5A 3OPKA 2ZJRQ 1X5SA 2ZC4A 3KLGA 3EXYA 3NAHA 5KFNA 3VGTA 5DDQC 4PWUA 2BKNA 1CJTA 3BGUA 4RW7B 2DNOA 3DI6A 1RTJB 3PW0A 5A76A 2FJVA 4H4KC 3AD8C 2HURA 1N8RT 1FXDA 4XPEA 2I0XA 4CH7A 3VGUA 2XCAA 5HJXA 1WKLA 2RU9A 1KOHA 2FJXA 1ZS6A 4LF7F 3PW4A 2GAGC 3GILA 3AQOA 3F56A 4FS1A 1RU2A 3OFHA 2CNLB 1XTZA 3C19A 1KLNA 3JSBA 3KLHB 5DRKA 4KQZA 2BJEA 1SJ1A 5KT3A 2J76E 4MJKA 5L39A 2JRSA 2B3TB 4WBFA 5A2QU 3DCAA 4LF5J 4C11B 1L3TA 3K8WA 4DV7J 2MLZA 1JKHB 1JLBA 1RK8A 1KN6A 4DL4A 1LWEA 4ZVRB 2LQBA 2Z2MA 4KJIA 1IR2A 1X9SA 5E0OA 2G2YA 4KHRA 2V6AA 2HAFA 2UVRA 1TELA 2HFZA 2XMVA 1KONA 1Q5VA 3GG1A 1PBAA 1B3TA 3SQGA 5KFZA 3TEHB 3KNAA 1OO0B 1PC4A 1N54B 3HZEA 5KFOA 1UPMB 1VHFA 3ENQA 2NZ4A 2IY5B 4FF1A 2L41A 3U1LA 1RHKB 4ZPBA 1F9HA 3EUNA 2AGPA 5L9XA 1VMBA 1F9EB 1RADB 4CO5A 2WK4A 3CCZA 3BSAA 4RW9A 1WC6A 4RNNA 5FLXU 4ZDNA 4MIWA 5GAEU 3V4IB 3HFKA 3PW5A 3TUJC 3R1LA 2KJWA 2OLWA 4DR5F 3HJFA 3VAGA 1LK7A 1K1QA 2HMIB 1EZZB 4DLGA 1S1UA 4F3OA 5KT6A 2L48A 4ID5A 5AJ3F 1TVRA 2YQ0A 4I0WA 4U67Q 3S1TA 2MPUA 2K7KA 3I55S 3BGOP 3OSPA 1WC3A 1U6FA 3D0IE 2K1RB 4KGXB 4RBTA 1UWBB 3UD5A 2RKIA 2EEYA 4I2PB 4NPOA 1R6YA 5E3RA 3ET6B 5B0BA 4ZP6A 2GHPA 4NCGB 3SSQA 3IBFB 2R2SA 3H40A 4IH6A 3W5XA 4TU7A 3R5DA 4PPZA 1HPZA 3QT8A 1AZSA 2V8VA 5KFVA 3OTCA 5CYQB 4ZLLA 2X1AA 1SQEA 5IT9U 1E6VB 2BDPA 3BGLA 1IQZA 4KV8A 4BC9A 3RJMB 2XO7A 3LUYA 2DGTA 1DTTA 2IM2A 2OSQA 3HP6A 1URNA 2ZDOA 3PRVA 2XNQA 4HHHA 1AUSL 1DBDA 3G6VA 3FCWA 3E01A 2BANA 2EWHA 3K58A 2POKA 2HVZA 2FVQA 3TUPA 1LW0A 3TI0A 1WOOA 3MM8A 2YWKA 4UOGA 4LBPA 1U47A 3O6QA 2E5LF 3HFVA 4NLDA 5DDPC 4CO2A 2G2OA 2F8MA 3O5TB 4IG0B 3DXSX 2M8HA 1JLQA 4M5HA 3OTOF 3FCHA 2HS3A 1NK4A 2RF2B 3TNVA 5D4NA 5IQQA 4LVNP 4X4UA 3W8PA 4DV6J 6AT1B 1X4EA 2FVCA 2KI2A 1TKZB 4RW7A 4F4ZA 3THVA 1RTJA 1RE1B 2H48B 4A46A 4M5DB 1X5TA 3HI9A 2VA3A 1HMVB 3LGMA 3KJQB 2GHWA 1GX5A 2MZRA 3VCDA 1UFLA 2HBYB 4TLRA 2D3O1 1OPZA 2YPYA 2J0XA 1XMOJ 4YB5A 4QWCA 5J1EB 1D9FA 1QAXA 3X3UA 1WWHA 4JI3F 4ERDA 4DR3J 3CB4A 1WEYA 4B3TF 3I82A 4C11A 3GIRA 1EQMA 2AU0A 1JMTA 5G4DA 2GC8A 1JKHA 1U45A 4OZ1A 3DRPB 3RB6A 3OR1B 1JJCB 4KY3A 3BO3A 1TP7A 1RLDA 4QOTA 5EUHA 3UI3A 3VR1A 4DFKA 4LF4J 3OXGA 1HBNB 2DGWA 2V9KA 1R8CA 3B4DA 3CSKA 4ZS6A 1MROB 3SSSA 4QU7A 1S97A 4TKTA 3AB2B 4HHUA 2QRRA 2GFFA 1KFDA 3C6UB 3K57A 2AEMA 3MWBA 5F9LA 3PZPA 3I31A 1IBKJ 1FJEB 5DGAA 1OQ6A 2XQCA 4DUYJ 2QV6A 4JUZA 5C5JA 4P2SA 4DG1A 4CRJA 2KRRA 4L73A 3NNHA 4ES2A 1Q78A 4DV0F 3MM5A 5LM7E 2KL8A 3M30B 5IC6B 3PRBA 3I56S 4QW9A 5LMUF 2P8IA 4ZVUB 2Z58B 2V2KA 4ZLPA 3NWGA 2V34A 1IJEB 3LP0A 3LAMA 2ZZNA 4W4MA 1TQLA 4E8UA 2I1RA 3ENAA 5HI7A 2J6TA 4Y00A 4RKUC 1MMLA 4HDGA 4PCQA 1Q86T 1TMJA 3P3DA 5IOLA 3C6TA 2F8HA 3A8KA 2YKAA 1JLEA 2CQBA 4HLBA 3PRDA 5B0EA 1PYSB 2XMMA 5J1NA 5KFUA 1NU4A 2BJ3A 1UWBA 2XULA 1RWPB 3DLBA 3JTOA 2L9DA 5D0EA 4I2PA 2E7WA 3VVUA 2GO9A 3RGIA 5E3AA 5ETVA 2HK3A 5F8MA 4R0JA 4NASA 2B4VA 3ZZUA 4K4TA 4LBIA 1GMUA 2E5IA 2HWHA 2F3JA 3U02A 1N36F 2XTJP 4NCGA 2AYBA 4M5KA 4CLYA 1F5CA 3DRXA 1HHSA 5IWAF 3EZ5A 1RT3B 1YVFA 1PCAA 2MY7A 5CYQA 1LQ9A 2LEPA 2M7SA 1HNIB 1JIHA 2O1PA 1XR5A 1KQGB 3A1YG 3KWMA 5JVHQ 5D6GA 2J9DE 1U8WA 1FKOB 2RSQA 4Y2AA 1KQFB 2KT5A 3QT5A 2ZD1B 3MR6A 4HR2A 1NHKL 3A3PB 4DL7A 1YI2S 4OYAA 2QA4G 4A8WA 1HQUB 2ZE2B 1EIYB 3CD6S 3NS7B 5J2QA 3H4BA 3J80U 4ZPTR 4AUKA 4OL8A 1RI7A 2B43A 2W2QP 1A7GE 2WB1D 2Q6CA 5ETQA 5CAAA 5I3UB 3FCVA 4IFVA 1HNVB 4IG0A 3EPGA 3SFUA 4ANDA 1HR0J 3RTVA 1BGXT 3W65A 4O4RA 3TW0A 1M1HA 1RWMB 2M0GB 1KTVA 1X4HA 1YSJA 1KC8T 1YJVA 4NYPA 2RF2A 3JSRA 4J9RA 2HHUA 1IKXB 2XMTA 2R7VA 1C0UB 1TKZA 5CZXA 3EGNA 2LLZA 2CJQA 3HSDA 1WF1A 1ZPVA 1HBOA 2HK2A 2NPFA 1WDTA 4G3IA 4Y34A 1BD6A 5DGBA 4PQUB 2HZVA 1AA1B 4PWDB 4Q8EA 1EHWA 4QCLA 5DG9A 2W7AA 1MW7A 2OMLA 4Q2MA 2GVZB 1SL0A 4DF8A 2RRBA 4B3SF 1VISA 3KNGA 5DQHA 2FHJD 1VBYA 5D0GA 5KFTA 1URRA 5ETTA 2F9JA 2QJ3A 1TTHB 2E1RA 1RTDA 3DRPA 3OR1A 1JLCB 2A2CA 3FSIA 2GQCA 3MXHP 2OKQA 3A4TA 1UA1A 1KDNA 3D6FB 2JC0A 1ZM4A 2F8EX 4ED7A 1YJTA 4NE9C 3PTWA 1BLUA 1T9UA 5F41A 3BO4A 4ES3A 3Q24A 2KU7A 3PHEA 3MF5A 2KG1A 4BC7A 1WUUA 4AYBD 2OJ3A 2WCXA 1RTHB 1XR6A 1AT1B 4X66F 4P2FA 2ZH1A 3GIKA 5DETA 2BOAA 3QGIA 1RT7B 5A8KB 1V3RA 4DV1F 3LP2B 4XDDA 1M1KT 5K8PA 3OVBA 1P1TA 3FZ2A 3CJKB 1WOSA 2QX0A 4H54A 2HGMA 2QFIA 4DR5J 1PSDA 1QUPA 4URQU 1NBEB 1IKVB 3E3XA 4B3RF 4WTYA 2FZKB 5DS7A 5A0YB 3C16A 3CPWR 3HMJG 1WEZA 2HFUA 3QAUA 1T02A 4OZ0A 5CZVA 3ZZTA 3LP1B 3KLVA 4L6V3 1WF0A 2A18A 2E5JA 1N5YB 1PAUB 3BN4A 2VA2A 2E1MC 2ADCA 2E5GA 1VYAA 4M5LA 1LNQA 1SKSA 2Z8QA 1UMJA 3LH2S 2CUYA 5DDOC 1H2TZ 2ZFHA 3ZTRA 3OV7A 4M8LA 4OLPA 3ZZPA 1DARA 2HQGA 5E33A 1YZ6A 3E2EA 2BEFA 2B5JA 1A6LA 4OHZA 3BSOA 3FSXA 1TK5A 1SKUB 1L3KA 2HHWA 2HYIB 4B9NA 1RT3A 4MH8A 2BBEA 2KFZA 3I9V9 1RTIB 4LFBJ 4G1PA 3CJ8A 4R25A 1R0CB 4RWWA 5L8RC 3IWLA 3K59A 4EBEA 3S01A 3MPVA 5DO2A 1HI8A 5CH7B 3P96A 3GR1A 5IQ6A 3M8QB 1V6HA 1JJ2R 1M1GA 2LDIA 3UD4P 3KLIB 5HATA 3HHLB 3RB3A 1RTZA 4ED1A 1FKOA 1YJNS 1W26A 2YKMA 4DLEA 1Y5LB 2FGCA 1HQUA 2ZE2A 3MECB 2FZGB 1XBWA 3TJ9A 2GMLA 4HACB 2BM1A 5FIIA 2RS2A 2E5LJ 1XC9A 3RW6A 1IR1A 2M4MA 3NGKA 1RWXB 1ZYQA 3N5BA 3Q8SB 5HQLA 3OFGA 2ZJQQ 2BW2A 4EYHB 1IJFB 2V2QA 2IDLA 1HNVA 1JWWA 4TY8B 4NMLA 1VCTA 1BUXA 3BKFA 4K50A 1IUJA 1EARA 5CYJA 4FNHA 3GIJA 2IBKA 1E6YA 2JOQA 1VRTB 2IAJA 2KVIA 2XZDB 4FYXB 4A8YA 4FP9A 2Q6BA 1QM9A 1IKXA 3Q23A 2OI2A 2HSEB 1C0UA 2DD8S 5EGYA 2XMKA 2BRKA 1L5UA 3E8OA 1JXEA 2D41A 1NXIA 2NYHA 2CPHA 5L1JA 4L72B 5KAKA 4F4WA 2AYMA 4EUVA 2FHJA 4PQUA 1FFSB 4PWDA 5JUMA 3PJXA 2AEFA 3DFEA 2NS1B 2VG5B 2RQ4A 4B3TJ 4D3HA 1MWZA 3PFOA 3W2WB 2PMWA 1UJ6A 4NA1A 1I94J 3MM6A 3BYRA 2DR8A 1S9GB 2J9DA 5B0GA 3HSGA 4DQRA 5BR8F 2ALZA 1QD1A 2XBPA 4DV5J 1JLCA 3ENVA 3KUHA 2CQ0A 3PEJA 4DWIA 2CPEA 2XEXA 4J9OA 1RGVA 2AGQA 3IXQA 2ZHAA 1VC5A 2D9OA 2X7IA 5BJRA 4ZLJA 1IN0A 1BQMB 5AXLA 3NCRA 3KXDA 4BWMA 4I2QB 4BWJA 4DHVA 4HTIA 2MHNA 1EETB 3N6LA 4P2MA 2Q3PA 3HHEA 3OVSA 3NGTA 3MGJA 1UPPA 1HD1A 4ED2A 1RTHA 2RRAA 3DRRA 2DYAA 1RT7A 4DV0J 1BWVA 5A8KA 4GMKA 3MFHA 3BQ2A 1YX2A 3JTPA 3LP2A 1GXLA 2N82B 1HFEL 5LMUJ 1TAUA 1WF2A 2UV8G 4XDCA 5T7LA 5ETSA 1XR7A 3OL6A 1K9MT 5ETLA 4NLOA 3PG9A 4ZN1A 1NMEB 5HL7Q 3RG6A 1DLOB 1VC0A 1UWAA 5A0YA 2W8KA 5JMNA 3KHHA 2GX8A 4DU7A 3LP1A 3S6EA 4IO9Q 3X1LB 3IN5A 1S7IA 2DNLA 1N5YA 1QTNB 1YJWS 4J9PA 2ZKUA 4F2SA 1GQEA 2VBXA 2LDYA 5AXKA 4CLKA 3IFEA 3KMQA 2HQ3A 4WK1A 3EGVA 2Y8YA 1LV5A 2B0GA 3NAIA 3O2IA 3BN7A 4JI7F 3JYTA 3BR9A 1M5SA 5A6WA 2COLA 3THPA 2PSZA 1R8HA 5C24B 5IWAJ 3DLKA 2FGOA 2M3DA 2R8KA 3K8VA 5F0WA 2C3OA 2L3MA 3TOQA 1RHJB 4F8RA 2NYIA 3M9NB 2CQHA 4X4NA 2MLXA 3J81U 4I6YA 1J27A 4DPWA 2MKKA 1VQ7S 2HLUA 3IM8A 2FY8A 3M8QA 4FDFA 2EFOA 4DPOA 2Y0BB 3CIMA 4ED0A 1SUQA 3M8WA 3HHLA 4IOBA 2HFOA 2ILYA 1TKDA 1YRXA 3DM2A 1D8ZA 4EK2A 4OX9F 1DTQB 1YGYA 3MECA 2ZOMA 1N52B 1X4FA 4HACA 2Q79A 2KJVA 3VAJA 3QWUA 3Q8UA 5IM0B 4PYAA 2W4CA 2Q1LA 1WKJA 1NJYA 2XS2A 1TZ0A 4N41A 4H4KA 2H4WB 4DR2J 5DQGA 1XNRF 2YX7A 2ZOGA 3US5A 3G8SA 1NJZA 3H59A 4YDXA 2HQCA 3UD3P 4QR0A 1UFWA 1PIEA 3FGVA 2VJUA 3CVKA 4RWXA 1VRTA 4DUZJ 1NPKA 3L7PA 3LGHA 4RW8B 4C6AA 2B9XA 1S6PB 3UNGC 1VRQC 2JL9A 4DQQA 4EZ9A 3ZZZA 2DNGA 1PJ5A 4YHHJ 2BKOA 4UY8T 2H54B 2VH7A 3MAAB 2W01A 3GFYA 2BJDA 1ZOTA 1H2UX 2UUAF 3IWNC 3QGPA 4B3SJ 3GFXA 1H38A 3BDEA 3DOLB 2VG5A 3BR8A 2NXEA 4J9MA 5KFWA 3T5KA 4PXEA 4OZ3A 5HQ8A 3W2WA 2C1EB 3VF0B 5I42B 3FNNA 1IVZA 3JB9k 1UVMA 2GHVC 1S9GA 3W9HA 1JLFB 3BBFA 3RR7A 2O67A 1VBXA 2VUGA 3MAQA 1MU2A 1Z2LA 1OSDA 1VQOS 5DLGA 3FMWA 3HK2A 1JJ4A 2AYEA 3A13A 3LWMA 4OI0A 3V81B 4YB1P 3NOGA 5BXIA 2XY7A 2R7SA 2QA4S 3CT9A 3FBEA 4ED6A 3UN5A 2E5HA 3T1HJ 3NGUA 4XIUA 5H9FK 4U7CA 3H5YA 2R8HA 1BQMA 1RISA 3RBDA 1NH7A 4ECTA 4X66J 1NAQA 2ATCB 2IMOA 3SFGA 4O0IA 1X9MA 1FT8A 4ED4A 4F4AA 4DS4A 4LREA 5ETRA 1IBCB 1KSPA 3QAEA 1C1BA 3FC9A 4NXNF 1ZA2B 1SKRA 3LQVA 4YR0A 1HNXF 4JI8F 4FYVB 4N76A 2LXUA 2B56A 2YKOA 2UUTA 2AZ3A 2HHTA 5L46A 1N88A 4CM2A 2YWWA 1HHTP 1HWUA 3DU5A 3CCMS 2APOA 4BHQA 4OI4A 1B4SA 2UXDF 4NLPA 4NRTA 1HWLA 2QFJA 1YBTA 2DXDA 5MLCV 3NMAA 3UDLA 3UWTA 4KRWA 3JS9A 5KFHA 2IYGA 1DQAA 1RXOB 4WFAQ 1FK9B 2EK6A 1CS4B 3QGHA 3OT9A 1SCJB 1S6QB 4I1TA 3AAWB 3GSDA 3VTIA 4R0EA 3HD1A 1LFWA 2EC2A 4ECRA 2CNKB 2KZMA 1Q95G 4PRFA 1QAYA 4LIWA 3D67A 2O66A 3PW2A 3TX8A 4ITSA 1VRUB 4YB7A 5C24A 2CPZA 1SH0A 3H2UB 4K8RA 4X4TA 2HHXA 2UUWA 5KFAA 1IR0A 1NSPA 3DNCA 1H7XA 3FBCA 2BOPA 1ZAWA 1AROP 1FJ7A 1ZM3A 2O01C 1XNQF 1OQ3A 1F1BB 3R2DJ 4Q43A 4WZMA 2YX4A 4RU2A 1R89A 3WHIA 2Y1JA 4MTPA 1YRTA 5HVHA 2YNFB 3KHLA 3HHDA 1F5AA 4LF8F 2CQDA 1GEHA 4MIAA 3LPYA 3R3TA 2WVEA 3DHXA 3JSYA 2RJZA 1RA6A 1UZHA 3CDWA 2UXBF 4LR9A 2WVFA 1DTQA 4PXBA 4NX9A 4K59A 2DH9A 4IFYA 3T19A 4ZVHA 3PJWA 2AKWB 3MOZA 2ZM6J 2O3DA 1X5PA 1UJ4A 3CDAA 2DJWA 4QIGA 4JI5F 2OSRA 5IM0A 3TAQA 2DNZA 3C2PA 1NK0A 3V2UC 4A8XA 1FHTA 4IDKA 2RE1A 3L7OA 1PBUA 1GFWB 2VICA 4LF6J 4HEA9 4LF9F 1N6QA 2B9EA 3TO8A 2ZOFA 1U7LA 2CJYB 4Y2KA 4TN2A 1R31A 2HZAA 5D78A 1YKWA 3G87A 2DT9A 2VFVA 4RW8A 1S9EB 5HLFB 1S6PA 1X4DA 3CD7A 3FMBA 2QLWA 1NSKL 3BM7A 2IM3A 3D1HA 5KFGA 1KLMB 3Q8QB 1K0TA 2DIUA 2X3GA 3MAAA 4NYOA 3NCPA 1KVJA 1F0XA 2MEWA 2AX0A 2IVFB 1YTYA 3GV8B 3DOLA 3I6PA 3MEDB 1YLXA 5BR8J 3K2YA 1HBUB 1WHXA 2RDJA 5I42A 4QIWD 1T03B 3PJ9A 1X4BA 4RPFA 1L3SA 1IQTA 2DO4A 1A9NB 5RUBA 4Q0BA 3SCJE 3UCUP 4ETZA 4WWSA 1U1KA 1MLAA 5B7WA 2YX1A 1S1TB 3NY0A 5KFFA 4KGZB 2I5JA 2HVIA 3OFFA 4DN0A 3BEGB 3Q22A 3GONA 2GVDA 1BQXA 5BYSA 2XI3A 1WTFA 2D69A 3QYYA 3H4DA 3BKTA 4LQ3A 3NS5A 2G2ZA 4UZCA 4P10A 5LJ3Y 3VV2B 3L95X 2V8PA 1RACB 2BJ1A 4NCBA 2ASDA 1Q4RA 2QSWA 4XPCA 3V6KA 2MQQA 2V2VA 4OFZA 4RL1A 1D9DA 4QWBA 5E2QA 2W8LA 2MJUA 3TZXA 1ZTWA 3KYLA 2K7JA 1CQNA 1SIWB 2DR6A 1JNRB 3PV8A 1FTRA 3QJLA 2FJAB 1HNWF 2LEAA 4WFYA 2ZNZA 1QAIA 2LMIA 5SZTA 1IKWB 2C42A 3ILIA 1EQ0A 4A4JA 2CQGA 3BKUA 2AT1B 2LKZA 4GKJJ 4DV2J 2YH0A 2Z57B 2OGUA 4USWA 4YP3A 2CJBA 2XMWA 5HBMA 4DSFA 2JLEA 2DITA 1UZDA 2V4JA 4WU2A 1CS4A 4JI7J 4UY85 4DCPB 4RUAA 3CW2C 3WZ0A 4Q5VA 3CC7S 1UVIA 4C8LA 1RA7A 1LXJA 3S8SA 5HN0A 4OX7A 3CCRS 4RR5A 3NGDA 1T05B 1VRUA 1L3UA 4DV7F 3Q2TC 4F50A 3I5BA 2YNIB 3GIMA 4X2BA 4HKQA 2V8GA 4X4SA 4C3MA 1U6ZA 1RB0A 1W7WA 2XHCA 1U0SA 3W9IA 3PO5A 4PWWA 4USTA 1DAXA 2JH3A 1HI1A 4G1IA 4R8UB 4WF9Q 4DX5A 3SEOA 2V69A 1RCOB 3Q86A 2KDOA 4ECUA 1CLFA 2KFNA 3WX4A 3M6XA 4O3SA 3R5GA 1WHWA 2CQCA 2B51A 4DS5A 2YNFA 1WC0A 2P9CA 4I7FB 2AD9A 3T41A 2FVPA 3PDNA 4OX9J 4J37A 4OX8A 2DHAA 2DHSA 2MSSA 2EI5A 2ZHOA 4USHA 1FDNA 2WSFC 2DHGA 6FDRA 3LGNA 3D0GE 5GADU 2GGPA 4DSEA 2JC1A 2NPIA 4DPXA 2CVIA 4I6WA 1U09A 3BZQA 1DJ0A 2EKYA 3VWSA 1RAGB 2L08A 4YQWA 4W90B 2VJVA 3MTJA 2VIHA 1XNRJ 4C8KA 3ICLA 4OHXA 1CULB 5HMYA 4M5MA 1WORA 1VQ5S 3MFIA 4IR1A 4KH1B 3H5SA 2ROEA 4HDHA 2VC1A 1TAQA 2XGPA 3DDNA 3VQTA 1LW2B 3T6JA 5EX0A 3N6MA 4H4MB 1X4AA 4TYBA 2Y0SD 3I96A 2XHWA 5HLFA 4FZVA 2IHR1 4DU8A 2R7TA 1KLMA 3Q2SC 1NHUA 2ZH8A 3TA1A 2C22A 1WI8A 3RRKA 1G6BA 1HWJA 3PVXA 2W4PA 3AB4B 2BRLA 4G65A 3P5TL 5EWEA 2AGOA 3UDVA 4CO3A 4LIRA 1S6OA 4A8SA 1U0HB 1IBMJ 2CNNB 3ILOA 1OIAA 3CCQS 3JQKA 5ETKA 1FESA 4DDFA 4ELUA 1S1TA 3GMGA 3ELHA 4OV1A 2FHOB 4PR6A 1YZ7A 1TUVA 3NOCA 1R0AB 4CLZA 4ZK7M 5IT4A 4KHMA 3MUTP 4O3OA 2HKEA 5EDWA 2KH9A 1VQSA 4WFNQ 1V5IB 5K20B 3F41A 2VBWA 4N56A 4JI6J 1O0PA 1VGYA 2HNDB 1S1VB 2E1PA 3NBPB 1PKUA 1FEEA 2HQDA 3AXKA 5LOQA 1HNXJ 4JI8J 3RR8A 3GPAA 3OW2R 2PA3A 3FBBA 3HD2A 2A0FB 4MKYA 4OV6A 3W8GA 2NR0A 1RHMB 4ZITA 4EBDA 3UR0A 2PC6A 3PX0A 2UV8A 5KOWA 2DH8A 3AJ2A 2UXDJ 3QRPA 3KLEA 4B9VA 3IAS9 1UVJA 1LOUA 3EGZA 4OYOA 4B08A 3G71S 3GJRB 3BH6B 1X0PA 1Q8BA 4FXWA 1TMMA 2B8PA 2XZWA 3IC1A 2FVRA 4J9UE 2Y1LB 1SXLA 1F2GA 4LUBA 4DQPA 2ADBA 4B3MF 2OHDA 5IFMA 1Q53A 5LXRA 3B82A 2MB0B 1R8PA 4ID8A 4ZKAA 1C4CA 3ENWA 3RB4A 3TWZA 4WK3A 4OYMA 1QSYA 1EB0A 3D4JA 4KE5A 3BYPA 3GYXB 1Z4UA 2CPJA 1WHVA 3WC0A 1C4AA 1R0BG 5E41A 3WQPA 5C42A 2IVYA 2KXHA 1LWEB 3KDNA 2VFRA 3DRYA 5LMNJ 1KHVA 4A48A 2D7SA 2J0QD 1S10A 1WC1A 2ASYA 4NA3A 2P5VA 2UVWA 1XNQJ 4RO0A 3L4BC 4P72A 5U47A 1Q0NA 2MKHA 4R8UA 4ZP8A 2FUG9 2HHQA 1DY3A 2GMHA 3V6HA 3SQGB 1U1QA 1WSVA 4ZIWA 1TL3B 1RT6B 5KG4A 4J91A 3B4MA 5BYQA 1RAFB 2DO0A 4UOHA 2JVOA 3CJTA 4IYQA 1SC1B 4OLOA 2V50A 2VODA 1B0TA 3AA8A 2C2EA 2QIFA 2C28A 2BV3A 2UXBJ 4ZP9A 2GMJA 3UE2A 4DUYF 3K5NA 3EDQB 1IM6A 2XY5A 4JI0J 1O5JA 2MYFA 2HLTA 1FRIA 3FDSA 1HNZF 4A47A 3OQ2A 4KO0A 3VAFA 4JI5J 3D3BJ 2DK2A 2HBZB 4UTGA 5L9NA 2W7OA 2PMHA 2W2OP 1B70B 5HMWA 3P6YC 1S1UB 3D3CJ 3M6WA 3TZYA 4QYZK 2QN6B 1N5SA 3QT6A 1S77D 4NL5A 4KC5A 1VQYA 2ZNYA 5GAHU 1GK8A 4J9SA 2MQNA 2LCWA 4OI6A 4Y2IA 2GIRA 4ZCMA 5I3QA 1U1MA 2OH2A 2LU1A 1LW2A 5IZHA 1VJWA 3BS9A 4H4MA 2RKIB 4ZCIA 3H0PA 1VQKS 2N7CA 1FJGF 3PIPQ 4B02A 4RNHA 4TQSA 5KFMA 3PY8A 2DB1A 2EVZA 4PG4A 2B4PA 4EMDA 3R7SB 4ANEA 2Y1RI 2AQ4A 2G1HA 3PR4A 1QJHA 5ETNA 4NZ6A 2KHDA 2HQFA 1MN9A 1KTQA 2FZCB 3FRYA 4P73A 1XMQF 1GT8A 3PIOQ 1HPZB 1NB7A 2M2BA 5EWGA 1CSJA 1H98A 3M6VA 4QWAA 2BMBA 2GJFA 4IRCA 3ZTSA 3J81j 3J7YU 3GIIA 3GCWP 1FWPA 2V4RA 2ZBQA 2VG6B 4X62F 4NI2B 1U0HA 3BQ0A 2LA4A 5J2PB 3RBZA 5HMZA 2VFUA 1FNOA 1AB8A 1KNZA 2FJBB 1DTTB 4A8QA 2YKQA 5GAGI 4IH5A 3DHWC 2PMZD 2JHEA 4WKRA 2OEKA 4X84A 1U1NA 3M2UB 1CEZA 1R0AA 2BANB 3KDOA 1TL1A 1U02A 4DPYA 4F2RA 3DDKA 2MZJA 4C7QA 1N32J 3OHBA 3V6DB 3AJDA 2J7KA 3CDBA 2C3YA 3L9ZA 2A6MA 2HNDA 1S1VA 3QZ7A 4EI2A 2DVIA 1JLQB 1ZZNA 4OI1A 2Z4PA 5D77A 5EHHA 3NBPA 1IWAA 2BE2A 4TQRA 4CT8A 5D3GA 1HR0F 4OYXA 1C1CB 1HNWJ 5L1IA 3I0SA 4WIIA 4Y0FA 3NEKA 4P74A 1VR6A 1DQ8A 1O8BA 4NLWA 5HANA 2PA8D 2OTJS 2RU3A 5H9EJ 5K14B 1GXTA 2XS5A 3SIPB 1SL1A 4FVCA 4DOZA 1K44A 5KFSA 1SJFA 2IPOB 4DR4J 1ZH5A 4WCEQ 1HLWA 3CO0P 4QPXA 4M5NA 4Y3CA 4Z7CA 4KR0B 1R43A 3LW5C 3I4PA 2GV1A 4LT6A 3W66A 1B7FA 1HQ2A 2EFVA 1NK7A 3F73A 2DCLA 1V3ZA 3LO3A 3VVTA 4CH0S 4ILLA 1Y7PA 3FEZA 2DGOA 2E1AA 3AXMA 3FEYB 4A8OA 4DX6A 5LL6d 2M88A 4DCOB 1EKRA 3FSYA 3AY0A 2DIVA 2VB6A 3H90A 1Y3KA 4YOEA 3TX0A 2WRMA 1WTBA 1YQHA 3D6MB 3ZTPA 3GQCA 2JX2A 1BQNB 1SC4B 1NEEA 1TL3A 1U1LA 1VC6A 3H7HB 1R6VA 2ERRA 2YH1A 1RT6A 2RB7A 5E3PA 2F40A 4I56A 4DR1F 3HKZD 1RSCA 4D3GA 1RWWB 3EJMA 4IQMA 4DG1B 3EMTA 2IA6A 2CQ3A 3IA0A 2FHMA 3QATA 2OIHA 4LRCA 1VLYA 4L3KA 1RWKB 4UT4A 2ZH4A 3HHNB 1SH2A 3R27A 4CLUA 3MM5B 3MPDA 5K8OA 4OZNA 4NA2A 5DZ6A 3RAQA 3KKFA 4C8YA 3R97A 2RMLA 3GFHA 2FYXA 3M1VA 4OMFG 1VQ4S 3P45B 4AL7A 4EBCA 2CVEA 3LP0B 4G1QA 4J9QA 5AT1B 3T9NA 3UR3C 4Q45A 1G4CA 4MMOA 2HHPA 4NZ0A 4TXSA 3C6TB 3QQCD 4I69A 5GAGU 1JLEB 1RT2B 1P8GA 1OJ4A 3AD9C 5AXNA 2RS8A 3UPFA 5A2QY 1CBKA 3Q8YA 4LRBA 2CJKA 3L3CA 2VKRA 3IP0A 3BPSP 4ZPVR 1RUSA 2BA9A 4B9UA 4KPYA 3OL8A 2ACMA 4K0KF 3HFZB 3CTRA 3KUEA 3T1AA 3G82A 1NJIT 2ZH6A 1RWVB 4JYAF 3DGPA 3W2VA 1I1GA 2WW8A 4UUWA 4NLXA 4ED8A 4O3QA 3KJVB 5CXTA 2JFKA 2VG6A 3VGSA 2XMUA 3R1HA 2UU9F 3GU0A 4NI2A 1WOPA 4LMZA 4LFBF 4UOFA 5J2PA 4UQGA 1RKJA 1LWXA 3TANA 2Z2LA 1SJ3P 4O0NA 1VQPS 1MN7A 1YIJS 4DL2A 3BSCA 1FX2A 3PACA 1Q1KA 4JV0A 2YKNB 5FLXY 2EBGA 4HI2A 3UQSA 4KGMA 1XIQA 4KBIA 5J2QB 3M2UA 3PYFA 1NKEA 2EFNA 3CXCR 2RNEA 2MKCA 2BABA 1HA1A 3RAXA 2ZUGA 2ILZA 3T5HA 2W9CB 3CULA 1BY9A 1T11A 2FD2A 1R8AA 1AYEA 3I9ZA 2A10A 2HAIA 4OIXA 3KTQA 4OYPA 3V6DA 2RHQB 3N9UC 4AD6A 3KLFB 4IFVB 4TNOA 4CWBA 4AT1B 2KTQA 3OXFA 4K4ZA 5F3TA 3OL7A 2PIIA 2IJRA 4NLVA 1BWEA 3GCXP 4CLPA 1NNDA 4ZJQA 4HH0A 2C3PA 2DNMA 4WE1A 1C1CA 3OFEA 2CQIA 1UFKA 2GJIA 5CCMA 1DRZA 1NCLA 1FFGB 1PJ7A 4O4GA 1S79A 4NCAA 1HBOB 4P7TA 6FD1A 3A8IA 2CZVC 2QLXA 1QE1B 3HJVA 3NCQA 3RYLA 2X3DA 4B3MJ 1RAAB 5K14A 5KG1A 1FE4A 3DU6A 1NJXA 2K06A 4NLSA 2MQMA 3I5CA 2OPPB 4UUXA 2H5JB 4W92B 1S9FA 4UW2A 2G0CA 2PI4A 3BDPA 1B0VA 5IT9Y 2CG8A 2GIFA 1KR4A 5I4MA 1J5EJ 3SMZA 1I94F 2ZC3A 3MEGA 2IBOA 1RTDB 2K8GA 5KG5A 2RH3A 2GZOA 3AOBA 4DV5F 5IV3A 4DFJA 2VPZB 3NWRA 2QA1A 4IOCQ 2J6UA 3HHKA 1TV6A 4Z37A 4CH1A 2XI2A 5KFIA 2HPUA 2VDIA 1X4CA 4QYRA 1BQNA 2XYHB 3OTEA 3TVZA 3NGRA 4PXDA 5KOXA 4OI2A 3FRZA 1N33F 2DHXA 3PNIA 5A8RB 2LFVA 4QJVA 4KPCA 3PX4A 4JI4J 3ZZ0A 1QTMA 2VASA 2NXNA 1HNZJ 4PG6A 3K5OA 2HHHJ 1I51B 3K17A 2F7VA 4WXOA 3I4HX 3H2VE 1X9WA 3QT7A 1FF2A 4DX7A 2VDHA 2PEBA 1KKHA 3G8QA 2EXUA 5HVFA 5D4OA 4GVLA 2H51B 3MUVP 1GTEA 1NB2A 1VLOA 1V5VA 4NMXA 4WYLA 1RBAA 3HXMA 3CEDA 3C16B 3T5LA 1UVLA 4PYDA 1NSQA 4L76A 2MKYA 1N5TA 1QVFR 1TK8A 1FTCA 1RT2A 2WSCC 3AA9A 3H8YA 1RAIB 2KXNB 2XSJB 1FJGJ 1M5PC 1JQGA 2FC8A 1FRLA 3TUIC 2IM0A 2R42A 2E7XA 4NEYA 1IBLF 3PYGA 1SJ4P 3GV5B 3HULA 5H1SV 1BC6A 3CC2S 4HTJA 3DYAA 4ZVQB 1XMQJ 1CC7A 2K3IA 2QYGA 2B5JB 4F25A 4NXMJ 2EG1A 3PEHA 2MDAA 2E7VA 1YJRA 3SV3A 1NK8A 3K7RA 4FYWB 3DKDA 4YY3F 2G0IA 4LRDA 3HSJA 2R8JA 2ABYA 2VQFF 3QNWB 4X62J 4J9KA 4Q44A 2G0JA 3N01A 2CA9A 1YG0A 3DLEA 3KJVA 4JI2F 3DOMA 1J2VA 3DLLQ 4YMEA 2P6TA 1VDHA 2ZWPA 3MR2A 2DR7A 2OEMA 3K5PA 2N4CA 4ZOSA 3QSIA 1H3DA 4HL9A 4DJBA 2V2ZA 2GA7A 5KFQA 1F3VA 5KG7A 3T5JA 2YKMB 2YKNA 1BE4A 2KM8C 4FF3A 3EX7B 1NK5A 1UP1A 4F7VA 3GV7B 1HARA 4KH0B 1LFPA 2EW9A 5HMXA 3ILLA 5ETMA 2W9CA 3HF5A 4JV1A 1UTAA 4IRDA 4B9SA 3KLFA 1FERA 4LR7A 4M5GA 2NREA 1XWLA 3FVYA 7AT1B 1OY9A 4DR2F 1E6YB 1NM2A 4IKAA 4B9MA 4S0MA 2IAJB 4J9LA 2UUBJ 3M8PB 4PKDB 1HBMA 2BQRA 3HKWA 3MCMA 3D6HB 4K7QA 3U7JA 4M63A 3ZFVA 5T41A 2XB2D 1S72S 1U1OA 4DUZF 1Y11A 4KFBA 3R5AA 2FB0A 1QE1A 4USJC 1MG7A 1S0OA 1UL3A 1RLCL 4YHHF 3IS9B 1UKUA 1UJ5A 2BE7D 2ATLA 3OL9A 3W62A 4EFAC 4GKKJ 4L74A 1ZBTA 1KFSA 2R7WA 2QYCA 8RUCA 2OPPA 3CWJA 1G1XA 3N5FA 3MM6B 2R7UA 5AE2A 2VPWB 4CO4A 3GLJA 1X8DA 2QMWA 3MCSA 4GVBB 3CCUS 1N5VA 2IMWP 3AJ1A 3MCOA 4C9DA 1NK6A 1RQ0A 2CQ2A 3KG4A 3MPYA 2B7BB 1N5QA 4MAKA 1Y9OA 2W25A 2KKHA 3D68A 4AE5A 3IWXA 2VOOA 4ECZA 4CTAB 3PXGa 5HROA 4ZVOB 3A8EA 2Z56B 1Q7YT 2L9WA 3J80Y 2MKJA 3SBMA 5KFBA 1JNZB 1CVJA 3JAMU 4DR1J 2PN6A 4DXLA 5D8HB 1ICEB 1FKAF 1KVIA 2DPIA 4PEOA 5FD1A 3PCOB 3T1HF 5A8RA 2G1DA 2E9TA 1T3NA 2HFVA 5DG7A 5KT4A 4IG3A 3DRRB 1K1SA 2XSFA 1SBRA 1LEOA 4NLUA 4GC6A 1RAJA 2I9SA 4USUA 1K8AT 4DMZA 2H9ZA 2V67A 2OO4A 4RW6A 3RBEA 5T7LB 1HWIA 1G2EA 2W9BB 2M8DB 3M2RB 4FYYB 3RUBL 2VV5A 4KAIA 2QO3A 3KOAA 5KT7A 2RQCA 1ROFA 5B09A 2F4VJ 2CJ9A 3BSNA 3EE3A 4K4VA 1FEHA 1FRHA 3MOJB 2CPIA 2E1CA 2ZVSA 3DDIA 4YS2A 1MMDA 4NEZA 1WKKA 1UETA 4BCAA 5KTQA 2A3JA 2VFSA 2B6AB 3SCLE 2XSJA 2JEFA 2WBRA 2MKSA 4K0KJ 2FLNA 3GWCA 1S57A 1S5ZA 1DQ9A 1T95A 2AJFE 2R2UA 1KP6A 3JYTB 3A12A 1H7WA 5F8LA 3UDCA 3CUNA 3PYEA 4QQBA 5GAEI 3KK1B 2BM0A 2EBEA 4BBYA 4JYAJ 3KG1A 3LPEA 3DLKB 1SVDA 2CAJA 3AH6A 4DQIA 3ISZA 1SC3B 3K0JA 4Q8FA 2UU9J 2M9KA 1TL5A 3W61A 4DV4J 2PGCA 3QWPA 3DLGB 2AJ2A 1R7IA 1HI0P 3GJSB 4JP8A 1K0VA 1VBKA 3VZHA 2EPIA 3PFEA 1SUQB 2PT0A 1GX6A 4LSLB 1X31C 4RLEA 4RUCA 5KFCA 1FWKA 2XCPA 3DM2B 3BF4A 5EX3A 3UCZP 2YPZA 3UN2A 2V4QA 4P6QA 3VZIA 4QPTA 5CA5A 3G6XA 2OPQB 3TVKA 2CG4A 4DFMA 3D28A 5HJYA 4I6AA 2MGZA 1TK0A 3QO9A 2N3OA 2J0SD 2PO4A 1T7PA 2VQEJ 1Z2ZA 4CNZA 3AQPA 4USIA 3KUGA 1NH8A 3TJAA 2ZM6F 5AE3A 4PABA 3MI7X 4K4UA 4ILMA 3A8JA 1T9TA 4DR7F 4ZPWR 1OSCA 4ZVPB 2FJWA 3TA0A 2IJNA 4LF6F 3M8PA 3SI8A 2IFXA 1VQLS 2WONB 4ER8A 4OZJA 4OZ2A 4B9LA 3MHYA 4C8ZA 3MMAA 2JLGA 2YNGB 4K4XA 3CNQP 1T9WA 2ZZTA 5LJ5Y 2B8QA 4MT1A 1KQSR 2HEKA 2HBRB 2AHOB 3WIVA 5J2NB 3IS9A 2R7OA 5KFKA 3E51A 2J8AA 2R7RA 2Z0GA 3H20A 2IIHA 4C0BA 2RDDA 4NLRA 7FD1A 1D3WA 1S0MA 4H4OA 3KK3A 2F63A 1T9YA 5SUHA 1U4BA 2MZTA 8AT1B 5LSLA 4B9TA 4GVBA 1Q82T 4FXDA 5KT5A 2CRLA 1MU2B 3BB5A 4QWEA 1FRXA 3SXLA 4OX6A 3AODA 4PPDA 4PZVA 4WXWA 3C14B 2BQ3A 4CTAA 3KFWX 3NMRA 4YUDA 2G4BA 4AFFA 1UCNA 1RYSA 3IO1A 1N33J 4YB6A 4EWTA 2R9LA 4M5JA 2KT3A 1D1UA 2DHHA 2XO6A 3M4XA 4TLQA 2GO8A 4C0OC 2YNHA 4EEYA 2Z30B 1RHUB 3DLHA 3FBFA 3M2VA 4LFAF 1V3SA 1NZAA 1WD6A 4F3QA 1DZ5A 1SI9A 1C1BB 1OY6A 3C66A 1WJ9A 5C25A 1QAJA 2W9BA 3M2RA 3MZIA 4Q2LA 3G8TA 4LRFA 2XWXA 2ASLA 4C2MA 1NDPA 4N47A 1JK9B 2W2MP 3W60A 4UQTA 3QLHB 3DRSB 1PAEX 3ADAC 3JQMA 3EZOA 4DR6F 4GKJF 4DV2F 1UEUA 2B6AA 1IBLJ 5F8NA 2W9AA 1HL6A 3V6JA 3LF0A 1ELOA 1FKPB 4KTQA 4V1Ak 3U27A 1HWKA 5HSPA 3KG0A 5M2PA 2RRNA 5KFLA 3GZ7A 3DOKB 3KK1A 2R3VA 4YY3J 2ROPA 5IXUA 2LECA 3CMQA 3D0HE 4FXVA 2VQFJ 2RVJA 2B9YA 2XM3A 1V9OA 2V63A 4ECWA 1YITS 4JI2J 3OHAA 4A8KA 4JV2A 4FVMA 2K3KA 4P75A 3HCXA 2VC0A 1RWNB 1RJJA 4F0HA 5KG6A 3DC2A 4ZCKA 3V5RA 4FYDA 3DLGA 2KN4A 2WVBA 1YDLA 3NXZA 2W1BA 4QIFA 2RUSA 1DFDA 1NJWA 4X4RA 2ZWOA 4FF4A 3C8YA 2HBQB 3JXOA 4LSLA 2PFFB 4XTTA 5DQIA 3MMCA 2CPFA 4HT7A 4ZVSB 2HNZA 3Q89A 1IWGA 3UVJA 2U2FA 1S99A 2Q43A 1RCXB 2OPQA 2P9EA 2NSBA 4IFYB 1NUEA 2ZZMA 4CLTA 1NK9A 1RAOA 5L1LA 3RZAA 1VQ6S 3HVWA 1PC5A 3ZC4A 1UW9A 1NDCA 3IRXB 2OD6A 3P5BP 1F9FA 3P49B 2FLOA 5JXSA 3WBZA 1RHRB 4I64A 4ILRA 4IDKB 1XJWB 2HRUA 4P9SA 2HFNA 4NLTA 4TU8A 5L38A 3TZZA 1N6QB 2ZH2A 1SH3A 3FFIB 4MKBA 1FVQA 2QSFA 3N0VA 4KB7A 2JSXA 2WONA 3DMJB 5C2CA 1RBLA 5KFJA 4I4BA 4DV3J 1QSSA 4ZVEA 3KLHA 1FD8A 2YNGA 2BZ2A 4QIEA 2HWTA 4HH1A 4U9RA 4WZQA 4NZ7A 3ISND 4X4QA 2QL5B 3JSMB 3MUMP 3VQSA 4ICLB 2VPXB 3PHTA 1JLAB 2Y3YA 3AFGA 4DN9A 4CIOA 2UVUA 4PG5A 5KG3A 1T0TV 4K5SA 5J2NA 1PYOB 3HM9A 5IV4A 4DL5A 4OHYA 3J81Y 2FLLA 3HT0A 1S76D 2B4UA 3C3LA 1Y5IB 1VS3A 4LJMA 3B78A 2QL9B 2AJ0A 2FJEB 4Q0BB 1QVGR 2FJDB 3OJUA 4ECSA 1S1WB 3LAKA 1DURA 2XC9A 1IXKA 4LFCJ 1ZM9A 4KSEB 2QC3A 2FLPA 1IBMF 5L1KA 2F65A 2LQJA 2I5JB 1YHQS 3C14A 4X65F 1UAWA 2GVDB 3CCLS 3FQKA 1UEVA 2MZ1A 3MMBB 5IS2A 4V19X 3N28A 3PX6A 2GW8A 2C2MB 3FUYA 3RRGA 4MKVA 1FD2A 3MURP 4PG8A 2QMUB 4P52A 3V4IA 1FX4A 4JI6F 1P1LA 2LQ8A 2A6OA 3QPIA 4BS2A 1ZAVA 2ZBIA 2CDQA 4ZVTB 2WZ1A 2HMIA 2R7QA 2QL7B 3VHQA 1FNMA 3F0NA 4OYBA 5CD4H 2NXUA 1F60B 2MQ8A 2A2DA 2ZVIA 1VQ9S 3TA2A 1JLGB 3C15B 2IRYA 3R7NB 2K1RA 4BDPA 2E9ZA 2CWXA 3QLHA 3MR7A 3DRSA 2CADA 1MNEA 5HBMB 2HHVA 2NXCA 1TKXB 2V4JB 3ET6A 3HX9A 4K4YA 4OYWA 2HFSA 3O44A 5MAOA 3BO2A 3G4SS 4CQ1A 2FIUA 4RUBA 1FKPA 1Y4ZB 1R27B 3AT1B 4TYAA 5K5MA 1LKZA 3QJPA 3GFZA 3DOKA 5CHCB 4HI1A 3RU0A 1TKTB 4ZPDA 4YN3B 4ZPAA 1VBZA 2JEGA 3IGVA 1FI4A 1UW4A 5LMNF 2V94A 1E6VA 3EVMA 4ZMMA 1FRKA 2CQ1A 3KJNB 3HO1A 3IR6B 2WB4A 2JLFA 5GMKa 1Z1ZA 2AX1A 2KM8B 1ZAXA 2MQLA 2AJ4A 5G0RB 2IRUA 4CT9A 1SKWA 2DGUA 2N4DA 2DY9A 2J8SA 3M7VA 3UFCX 4CP5A 2MZQA 1KOOA 1FRJA 2BACA 2VG7B 4WP9A 1REGX 4AQYF 3U1MA 1RZMA 2GGPB 4MKAA 3D1QA 1XQIA 2VONA 3MCNA 2H5EA 4TY9A 4ZPCA 3QGGA 2BUNA 2ROGA 3ETOA 2DRBA 2BJ9A 3RBXA 4JI0F 2DNRA 2QG9B 3PR5B 3I32A 1T94A 1N34F 3CCES 2OFGX 1NRKA 2BX6A 1S7HA 1Y5NB 3IRXA 1Y0HA 1U1RA 4DR7J 3QIPB 1VIOA 2RQKA 2IM1A 2R8GA 3OBIA 3TZWA 4LF7J 3MMJA 4M5DA 4WIQA 2XMAA 4FS2A 2BJ8A 3FFIA 5E3QA 2VKZG 3TAMB 4OHWA 3JQJA 1HMVA 2E66A 5F8GA 1SIZA 3DMJA 2QE5A 1FCAA 4U7UK 4E0DA 3WX8A 2BE9B 1OWXA 4R5PB 1WDDA 1KVKA 3V4MA 1UVKA 2HVDA 4M94A 3ZZOA 2L9NA 2O5DA 5B0FA 5J1EA 4F0KA 5B08A 2HRYA 3JSMA 4DPTA 1T8EA 4ICLA 2CIMA 2D3UA 3IRWP 1JLAA 4BLGA 2RT3A 5D4PA 4WP3A 5K8NA 4WU3A 3EPIA 3EXCX 4ZLNA 2W7PA 2XY6A 1PILA 4URGA 1WACA 2LA6A 3HVTB 2FC9A 2GQ2A 4QR1A 1HBNA 3QZ8A 5DLFA 1S1WA 3CJQA 4ANCA 1M5KC 1MROA 3OLBA 4KGKA 3KHRA 2YWFA 3C6UA 4F4XA 4YDDB 3OLAA 2DNPA 1WG4A 3MTKA 3U1NA 2D3OR 2BXJA 2ZBCA 4QWDA 2J5AA 5GVQA 3FJ2A 4GC7A 3IGNA 2CWKA 5DG8A 4XK8C 3MMBA 1PGZA 1ZTTA 4USMA 4J5OA 4O23A 2VL1A 2DXFA 1SPBP 3SYZA 3ETMA 4NLGA 4LFAJ 1H73A 2LXFA 4X4OA 2ZH5A 3IBCB 1VQ8S 2HIYA 1N32F 3M30A 5LXYA 3H5UA 2PDAA 2OUGA 5KFEA 1FVSA 4ELVA 4F02A 4C8OA 3MM9B 1XMBA 2H65B 5C2GA 3OUYB 5AJ3J 2IDEA 1G7CB 3GP9A 1PJ6A 4DL6A 1FE0A 2RHSB 2W24A 1I5OB 3KLEB 4P71A 4CNYA 3G2XA 3W9JA 2V8HA 3SDEB 3MR3A 2ZHBA 4RW4B 1CJKB 2MXYA 1JLGA 3C15A 4RBUA 4DR6J 4B3OB 2V9WA 1MMNA 3TQEA 2XMJA 4Z2XA 2JZ5A 5J2MB 4DR4F 1TKXA 2LYVA 1YJ7A 4ELTA 4F67A 2FY1A 4F0MA 2BKPA 3CCVS 4LBHA 2N7YA 3LWLA 1PO6A 4FF2A 5C42B 1RP5A 3GJTB 3FZBA 3ZTOA 2FPHX 2OEJA 3N4WA 4W98A 1TKTA 1BXNA 4KKOB 1WI6A 3M9OB 3R6LB 1HNIA 3NL0A 4UOCA 1B64A 4ZJLA 1KHWA 2EFGA 4C98A 2R8IA 4IQXA 3J7ZT 1DHMA 2DGVA 2HS0A 2GCFA 3WIUA 3FQLA 5A8WB 2AP6A 2HG4A 4C4WA 3CJRA 3GTYX 5GMEA 2ZD1A 3BGFA 3AOCA 1EX8A 4CLFA 2RDIA 4K4SA 2C3MA 5G0RA 2ZUAA 2YKPA 4DF4A 2IJFA 2XNRA 2DBBA 3M6UA 3HHLD 1UEKA 3HDSA 2CQPA 2H4YB 2YWHA 3NLCA 1B99A 3SZ2A 2VG7A 4ECXA 4JI1F 3GYGA 3IM9A 2BVZA 1AW0A 3OTOJ 4FPIA 3MAHA 2RIJA 4N5SA 5I3UA 4KO0B 2KB2A 2ZH7A 1IKYB 2AV5A 1GH8A 3GR0A 2YBVA 2DTJA 5IT0A 5A6PA 3QIPA 1HW8A 4LVOP 3TR5A 4JV5F 3IG1B 1S0VA 1GMWD 1FWLA 4C8MA 3R5BA 3N79A 1W25A 1JJHA 3EICA 2JEIA 3IR5B 3TAMA 4ETXA 5KFPA 1R8BA 4C97A 1R3NA 4R5PA 1W2BR 4JI3J 5E5NA 2YY3A 2J9CA 2GVZA 2OPRB 2VBYA 3HT3A 1J5OB 3TAPA 1S4FA 4JOUA 2PD1A 4CCHA 3L09A 3H2LA 4O3NA 2LXIA 1N48A 1TU0B 2GNKA 1U8SA 1D0EA 1S6UA 1Q81T 1MWQA 2CXEA 5EN1A 1D09B 4OYIA 3HVTA 2KFYA 2DKOB 3FKBA 5HO4A 3GG0A 5THWA 4OHVA 1KRPA 4X65J 1S59A 1Y3JA 1QLNA 4U95A 1Q79A 3QBCA 2DEIA 2RAQA 3A3OB 2F9DA 4J9NA 3GYNA 1LXNA 1YBUA 1U24A 2HGNA 1WELA 1ACMB 3O8WA 4FN5A 1KWMA 1TL1B 4ZVFA 2MY8A 3H98A 4RBVA 4CO1A 4LRAA 1LWCB 1L3VA 1FRMA 5JJBA 2CPDA 2HS4A 2QA2A 4RUHA 3NG8A 4ZIVA 3CJKA 2XLJA 2UUCF 1EJ7L 1T9VA 1RWOB 1VOMA 3CJSA 2BE2B 1GAOA 1T3OA 1LK5A 4JBCA 2DNKA 3CJ5A 5D3GB 3EVOA 3GB0A 4M95A 1U26A 1IKVA 3MR5A 3I0SB 4X64F 2DY1A 3MM9A 4PUOB 3OUYA 1HW9A 2WVDA 4QBUA 1D9AA 1YBAA 1X0FA 5F8HA 1NKBA 1NHVA 2EK1A 2JNJA 3ZNJ1 5F3ZA 3SDEA 2KYXA 4RW4A 3CE8A 2SXLA 2XLKA 2CQ4A 4N7TA 1CJKA 4Y2MA 2CFXA 1YJ9S 4B3OA 4FKYA 2R2TA 4MK7A 4AL5A 1C0TB 3MEEB 4EO6A 3OXLA 4DCJB 2HRTA 2B9WA 1WC5A 5J2MA 1N36J 5HAOA 3H5XA 1HD0A 4Z7YA 2JWNA 2E9RX 4C48A 3CCTA 4HVZA 1WG5A 2CPYA 1REVB 2VF3A 5F8JA 1J5EF 2KRBA 5KG0A 4FNIA 1JX4A 2AMCB 2XZTB 1RTIA 2J0WA 3M8YA 2UXCF 4KKOA 1PYTA 1OYDA 1TL7B 3TP2A 1GMVA 1NPRA 2M5YA 2DEJA 2K2PA 3PM9A 2YXLA 3W64A 3G86A 4QU6A 1QDUB 5KG2A 3KLIA 2KG0A 3VALA 2OP5A 5A8WA 2HVEA 3CJ0A 4NRUA 1U2FA 2C2ZB 3D2WA 4LF1A 1QY7A 4PG7A 3F44A 5KFRA 5AXMA 3SCIE 2Y9HA 2QT7A 4ECQA 5FDLB 3EDRB 1FDDA 2M52A 4AQYJ 2J7UA 4MFBB 1FXRA 2NCKL 1EKSA 2C2KB 3M05A 4JI4F 1UVNA 1P27B 2LQ9A 2WOMB 4U96A 3HVRA 4U8VA 2A1BA 5DM6Q 1N34J 2HHHF 5DZ7A 2DNQA 1N4LA 3M8ZA 3ZXWA 1CJUB 2VZ9A 3M1VB 4DSLA 4TY8A 2I6WA 1GMWA 3ZNUA 1IKYA 4E98A 5FJ4A 4G1QB 4GO7X 3SV4A 3CJ2A 3MEKA 3H25A 5ETPA 3O3LA 4WP8A 2OPSB 4ES1A 4XO0A 3RW7A 2FDNA 3IG1A 5ETOA 4RJVA 1P9QC 2DR9A 1M5OC 5CABA 4WFBQ 1OMSA 4NLQA 3BJYA 2VU5A 3BH7B 4KHPF 5I3PA 1S48A 3PYDA 2FVSA 4O3RA 4OJ1A 4ZJOA 1ZETA 2HHSA 2XG8A 4ZCLA
chains in the Genus database with same CATH topology
1FFWB 1EAYC 2LP4A 1FFSB 1A0OB 1FWPA 1FFGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFW B;  1EAY C;  2LP4 A;  1FFS B;  1A0O B;  1FWP A;  1FFG B; 
#chains in the Genus database with same CATH topology
 1NZ8 A;  2OPR A;  2LP4 A;  2P2C B;  4CYU B;  3G82 B;  2XYP B;  4QW8 A;  3CD0 A;  1J5O A;  3W7B A;  3DGP B;  3W2V B;  3CO9 A;  4UZB A;  4P2X A;  1FA0 A;  2X51 A;  1RDR A;  5H9E K;  1TR0 A;  2WVC A;  9ATC B;  2HNY B;  4NXM F;  3VAK A;  3MM7 B;  2H5I B;  4LR8 A;  3MPU B;  4DSK A;  2HWI A;  2MHE A;  4PQA A;  2ZJP Q;  3CMA S;  1RAB B;  4JB8 B;  3AHP A;  3IBW A;  3CC4 S;  1IM4 A;  5F9N A;  1M5H A;  2XS7 A;  3QFW A;  4J7C A;  3G6E S;  3Q8R B;  1X7V A;  3K5L A;  4ALZ A;  1OYE A;  4OQJ A;  3J7Z 5;  1XEZ A;  3DGV A;  4I2Q A;  5K8M A;  2XWY A;  1ZA1 B;  1EET A;  4DV1 J;  1AFI A;  2UZA A;  4K5R A;  1N0U A;  1U2C A;  4OYZ A;  2AF6 A;  3TYT A;  5D0H A;  2ZKT A;  3R5J B;  2I8E A;  2VFT A;  1YK9 A;  5CQG A;  1LWC A;  2KVQ E;  1RT1 B;  4FPR A;  4QR2 A;  4IRK A;  4FBT A;  5T14 A;  1HKA A;  4LSN B;  1NDL A;  4B3R J;  3NNA A;  2FTR A;  2EFP A;  2BJ7 A;  1AUD A;  3R6G B;  1Q16 B;  2KT2 A;  4FBU A;  1QSL A;  4WE1 B;  5CD4 A;  3UO0 A;  1DLO A;  1S49 A;  2AIR B;  4PUO A;  4XAK A;  2Y1I A;  3D1O A;  4O4G B;  3NS6 A;  2RQM A;  2UUB F;  3CF5 Q;  2DXE A;  4J9V A;  2D1C A;  4V19 J;  5ITH A;  3B54 A;  3EZU A;  5KFD A;  2YTC A;  3P4U B;  1EAY C;  4EO8 A;  1C0T A;  2LVW A;  2X1G A;  3MEE A;  4F4K A;  3NP5 A;  3HSZ A;  1RHQ B;  4P7V A;  3T6B A;  2XYG B;  2DNH A;  4CLS A;  1U6B A;  4CLW A;  3Q8P B;  2PFD A;  1ZPW X;  1WNE A;  4GKK F;  4RNM A;  3CJ3 A;  1VK3 A;  3FK4 A;  2WTF A;  5HP1 B;  2VOP A;  3VAH A;  2Z2Y B;  3QSY B;  1VI7 A;  3OVA A;  5H9F J;  8ATC B;  1A0O B;  3BBB A;  3MEG B;  2HW3 A;  1REV A;  2C2D A;  3RAM A;  1LWF B;  1U48 A;  4USV A;  1F3F A;  2ASJ A;  4I67 A;  5LT5 A;  1VIX A;  4MIB A;  4AXI A;  3IR7 B;  4USK A;  1TV6 B;  4K2J A;  1TL7 A;  4F36 A;  3BGR B;  5K9F A;  2G9O A;  2AJQ A;  1O6X A;  2RIL A;  3P8B B;  4RZR A;  3MD3 A;  1VK8 A;  3EYZ A;  3M32 B;  3W1Y C;  3G96 A;  1S4E A;  1G3O A;  2C2O B;  3R5C A;  4N8N A;  2FQQ B;  1HYS B;  3K89 A;  2DR5 A;  1NPP A;  1TFY A;  2LU2 A;  5FDL A;  4JI1 J;  4GRS A;  2HGL A;  4MFB A;  4KGV B;  4G6V B;  2FHK A;  3DN9 A;  3T9Z A;  1I6J A;  3OJS A;  4RX6 A;  2WOM A;  2E29 A;  4ZVG A;  4YEA A;  4DUT A;  2M70 A;  1SC6 A;  2MQP A;  4DBQ A;  1CC8 A;  4WTO B;  1ZZF A;  1CJU A;  2DNN A;  5KFY A;  1X5O A;  2P6S A;  2GIQ A;  3UW1 A;  1FNX H;  1NDK A;  2YWE A;  4DZ6 A;  4JV5 J;  5KT2 A;  2IC3 B;  2F4V F;  2GJ2 A;  2MLY A;  3UNY A;  1VQN S;  3EM1 A;  5EWF A;  2XGQ A;  4U7U D;  2OPS A;  2KO1 A;  2CNO B;  3CDU A;  2DH7 A;  2OAU A;  3VGV A;  1FFW B;  2RUG A;  5HQM A;  4ENO A;  1H2V Z;  2C2R A;  1SB6 A;  2ZDP A;  3PKY A;  1KQK A;  4OJG A;  3KK2 B;  4OJ3 A;  4A8F A;  3OTB A;  2BW7 A;  2IRX A;  2VPY B;  3T3F A;  3G6Y A;  2EKN A;  4ZP7 A;  5GAD I;  2IA0 A;  2OTL S;  4C3L A;  2WHO A;  3DYA B;  1D8Y A;  4CYU A;  1HQE B;  5F8I A;  1S1X B;  2C3U A;  3ITH B;  4MK9 A;  3R7B B;  1YWX A;  2R7X A;  2HNY A;  4IOA Q;  1JLF A;  3MM7 A;  4X4P A;  3MD1 A;  4ED5 A;  3DLE B;  5HVG A;  4MYU A;  1Q8L A;  3DOM B;  1TUG B;  5F0U A;  3POT B;  3V81 A;  4DV4 F;  1KEK A;  4WPA A;  3T1Y F;  3EVW A;  1FJC A;  2R2R A;  1B0P A;  2D9P A;  2H1Y A;  3TJ8 A;  1RAH B;  4YR3 A;  1HIY A;  4AL6 A;  1Y00 A;  4MYT A;  4DZD A;  1H6K X;  4TVA B;  2GQQ A;  2KXF A;  1BMQ B;  2MQO A;  3CGI A;  1GTH A;  4M1K A;  1JXV A;  2UUC J;  3UCG A;  2JEJ A;  2JVR A;  3CD5 A;  3OD2 A;  1RT1 A;  2AWZ A;  3ILJ A;  4F26 A;  1SL2 A;  1NLK L;  4LSN A;  1N0V C;  4RNO A;  4X64 J;  5B0C A;  1CG2 A;  3BRE A;  3BV8 A;  3M8R A;  4F4Y A;  2VQE F;  4EGL A;  5E7O B;  2CDR B;  3R9L A;  2CJA A;  3HLU A;  4DL3 A;  1VQM S;  3D66 A;  1HBM B;  2B7C B;  3ZO7 A;  1JXL A;  1K47 A;  4URS A;  1M0S A;  4M5I A;  3D7S B;  3BPD A;  5HK4 A;  2C2N A;  2KZZ A;  4EYI B;  1MWY A;  4KFB B;  1X4G A;  4IR9 A;  2QLB B;  2AW0 A;  2QMX A;  1FK9 A;  2WW4 A;  2MZS A;  2J9E A;  3RB0 A;  1EP4 B;  2MTL A;  1S6Q A;  2IVM A;  1M5V C;  3ISN C;  1NSA A;  4UF4 A;  2OFH X;  3HZG A;  3VAI A;  2KHC A;  4NYZ A;  3QID A;  4CI0 B;  4WJB A;  2DNY A;  3TVY A;  3QMQ A;  3OSN A;  4LF5 F;  5D15 A;  4C0H A;  2BQU A;  5CYM B;  1WSR A;  1I3O B;  5HP1 A;  3Q0A A;  4F3M A;  2ZH9 A;  4NWB A;  2UXC J;  2VBZ A;  4QIV A;  1Q5Y A;  4ZA1 A;  1RKI A;  1FDA A;  3TEG A;  2V8D A;  2GS8 A;  2YVS A;  4AXJ A;  1LWF A;  7FDR A;  4K2X A;  4L3N A;  5HRO B;  1U1P A;  1K73 T;  1ITP A;  1GXU A;  1TUW A;  4O44 B;  4Y2C A;  2HZC A;  3BGR A;  4ZHR B;  4OZL A;  4ATN A;  3L7U A;  1YRU A;  3PKM A;  1OY8 A;  1F6T A;  3CCJ S;  2NUU G;  3M32 A;  4Y28 C;  2N3L A;  1FO1 A;  4LSZ B;  2UP1 A;  3J7A 1;  2EG2 A;  5BYR A;  2NQP A;  3LA0 A;  5C7P A;  1Y10 A;  4IG3 B;  3M8S A;  4QZV B;  2W4D A;  3AOA A;  2HVH A;  4CM0 A;  1HYS A;  2LEB A;  2PE8 A;  4RNF A;  3WDO A;  3S7R A;  5D0R A;  1XN9 A;  5E3C A;  4KYZ A;  3D6T B;  1YJU A;  1RT5 B;  4RW6 B;  2PI5 A;  3GSI A;  2MJN A;  3NKY A;  1N56 A;  3OR2 B;  3G9C A;  5JVG Q;  1RWU A;  3N6N A;  2NUH A;  2ZBP A;  4I68 A;  2ZH3 A;  2DPJ A;  3TAR A;  3I0R B;  4CZC A;  5AE1 A;  4DSJ A;  2CZ4 A;  4ECY A;  2IC3 A;  2VD3 A;  2ALY B;  1XK8 A;  1KS2 A;  2DIS A;  1S9E A;  4KHP J;  2Y8W A;  2NSC A;  3EGW B;  4DX8 H;  3R2C J;  1CJV B;  1CQM A;  2UUA J;  4WFZ A;  1KBR A;  1PG5 B;  5LSO A;  3KK2 A;  3SSR A;  2YQ3 A;  4DEZ A;  1MSW D;  1F5B A;  2AZ1 A;  3FEX B;  3QRQ A;  4K4W A;  1Q8I A;  3MED A;  1HBU A;  2Z2Z A;  2B4O A;  1HQE A;  3C46 A;  2QEX S;  1T03 A;  1S1X A;  1T9X A;  2MKI A;  3ITH A;  1WHY A;  3GJQ B;  2UVV A;  2R4F A;  1P6T A;  2QZ8 A;  4DL0 C;  4B17 A;  1VHI A;  2CPX A;  2HQI A;  4Q7A A;  3PO4 A;  2NZC A;  1F2H A;  5GAH I;  1KD1 T;  1RBO B;  1CPZ A;  4DI6 A;  2QLF B;  3POT A;  4N8O A;  4Y6I A;  1WC4 A;  2MST A;  3BBC A;  2DCU B;  2G13 A;  5DDR C;  2V68 A;  4IH7 A;  1B7Y B;  1SV5 B;  2DGS A;  3M9M B;  1NO8 A;  2BR0 A;  2ZIT A;  5KFX A;  3LAN A;  1RT4 B;  3AD7 C;  4YR2 A;  2RD5 C;  2J6S A;  1S0N A;  1BHN A;  2MMY A;  1WG1 A;  1W2I A;  3ZTQ A;  5B0D A;  2F1F A;  4NXN J;  4DQS A;  3UN3 A;  1AXQ A;  3KLG B;  3B6B A;  2MGZ B;  2EC0 A;  3QO9 B;  3JTN A;  1XER A;  3J7Y I;  1SQF A;  2E44 A;  1CJT B;  2HIQ A;  1U2R A;  1GNK A;  3DI6 B;  4ZN3 A;  3CIZ A;  4U8Y A;  2YQ1 A;  2U1A A;  2IYI A;  4DSI A;  2AEJ A;  3W5Y A;  9RUB A;  4DV6 F;  2JJ4 D;  3ONQ A;  4ECV A;  1QUV A;  4OI3 A;  1IKW A;  2H3E B;  2CKW A;  1TFW A;  2KYZ A;  3R8Y A;  4Y65 A;  4O3P A;  3W3S A;  2NLW A;  4GO5 X;  3LAL A;  4KT0 C;  3MMA B;  5ADZ A;  2DRD A;  2QTW A;  4DV3 F;  1EP4 A;  3ZZY A;  3D54 A;  3Q8V A;  1XMO F;  3OTD A;  4CDI A;  5J1P A;  3LOU A;  4CO0 A;  2OMO A;  1JLB B;  1APS A;  4DR3 F;  1H72 C;  3SCK E;  3ULH A;  1T05 A;  4PAA A;  3NNC A;  2AJ1 A;  4F04 B;  3RRH A;  3UDE A;  4H4O B;  1H74 A;  5CYM A;  4EZ6 A;  2YNI A;  4TU9 A;  3KK3 B;  2V5H G;  2Q66 A;  2LQ5 A;  3IMQ J;  3HVA A;  4E2F B;  3THT A;  5DJB A;  3TUZ C;  4FKX A;  2GAH C;  4LF4 F;  5IC4 B;  3TRG A;  5CCL A;  2JFD A;  4LFC F;  3I87 A;  4DPU A;  1X60 A;  1SJR A;  3NGS A;  4YFU A;  2X1B A;  3CME S;  2CJX B;  4LF8 J;  1ZM2 A;  4O44 A;  2OEL A;  4N77 A;  1P9Y A;  4ZHR A;  4I7F A;  1IBK F;  3KMS A;  2ACY A;  3QRR A;  3QJJ A;  1TL4 A;  3NRB A;  4PXC A;  4LQ9 A;  1SJQ A;  2YNH B;  4RU9 A;  4RW9 B;  4J90 A;  1FXL A;  1VFJ A;  3IAM 9;  1JB0 C;  1Q7L B;  1UA0 A;  2WBM A;  4IO1 A;  3VAM A;  4NLY A;  3M2V B;  2ZEJ A;  2D74 B;  1RAE B;  3A3N B;  2WAQ D;  3Q83 A;  3BQ1 A;  3PW7 A;  5C25 B;  3MDF A;  2X1F A;  2DGQ A;  1RT5 A;  1Q8K A;  3QFH A;  3DLJ A;  4LF9 J;  1CUL A;  4ID5 B;  4CLL A;  1U49 A;  3CJ4 A;  3OR2 A;  3KJF B;  5M2R A;  1TVR B;  4U6P A;  2D3Z A;  2PEH A;  3TQ1 A;  4ED3 A;  1VJQ A;  2QLJ B;  4HT5 A;  2EFQ A;  3I0R A;  2I38 A;  4C3K A;  2BYC A;  3W5Z A;  4MK8 A;  2P9G A;  3GE9 A;  2NXJ A;  4A8M P;  1RYR A;  2VHG A;  2CYY A;  4OZ5 A;  3K5M A;  1HHQ A;  2QGF B;  4OJH A;  1AFJ A;  3O1L A;  1CJV A;  2J7W A;  1WEX A;  3W63 A;  4KIA A;  4NOH A;  2JDJ A;  2I2Y A;  4DFP A;  3H42 A;  3B8H A;  4L75 A;  1AZS B;  5GMD A;  3DXB A;  2YWG A;  1O51 A;  3EWG A;  1SQG A;  4IUF A;  1C2P A;  3KHG A;  2XLI A;  3D5M A;  1FDB A;  2ZBR A;  2F5G A;  3MPW A;  1OPI A;  1U25 A;  2V0N A;  4HHJ A;  5M2U A;  3J7A N;  1ULR A;  3JAM Y;  4KV8 B;  3LTO A;  3D9B A;  3I5A A;  3T1Y J;  3WC2 A;  2WSE C;  4WYW A;  2AYG A;  2W2P P;  2CZ9 A;  3CCW A;  2W2N P;  5B0A A;  5D4L A;  4LF2 A;  2DGX A;  4X4V A;  2DRA A;  1NKC A;  4C8N A;  1H0H B;  3CDE A;  3CCS S;  3E01 B;  4WKY A;  3HPO A;  1S12 A;  2OD4 A;  1LW0 B;  1M90 T;  5LSR A;  4HYK A;  3MMC B;  5DM7 Q;  1SV5 A;  4QYZ J;  3MM8 B;  3HHL C;  2HNZ B;  4EU0 A;  3ZZR A;  1RT4 A;  4WFX A;  2F4F A;  1RU1 A;  3UVJ B;  3SQO P;  1OS5 A;  3OPK A;  2ZJR Q;  1X5S A;  2ZC4 A;  3KLG A;  3EXY A;  3NAH A;  5KFN A;  3VGT A;  5DDQ C;  4PWU A;  2BKN A;  1CJT A;  3BGU A;  4RW7 B;  2DNO A;  3DI6 A;  1RTJ B;  3PW0 A;  5A76 A;  2FJV A;  4H4K C;  3AD8 C;  2HUR A;  1N8R T;  1FXD A;  4XPE A;  2I0X A;  4CH7 A;  3VGU A;  2XCA A;  5HJX A;  1WKL A;  2RU9 A;  1KOH A;  2FJX A;  1ZS6 A;  4LF7 F;  3PW4 A;  2GAG C;  3GIL A;  3AQO A;  3F56 A;  4FS1 A;  1RU2 A;  3OFH A;  2CNL B;  1XTZ A;  3C19 A;  1KLN A;  3JSB A;  3KLH B;  5DRK A;  4KQZ A;  2BJE A;  1SJ1 A;  5KT3 A;  2J76 E;  4MJK A;  5L39 A;  2JRS A;  2B3T B;  4WBF A;  5A2Q U;  3DCA A;  4LF5 J;  4C11 B;  1L3T A;  3K8W A;  4DV7 J;  2MLZ A;  1JKH B;  1JLB A;  1RK8 A;  1KN6 A;  4DL4 A;  1LWE A;  4ZVR B;  2LQB A;  2Z2M A;  4KJI A;  1IR2 A;  1X9S A;  5E0O A;  2G2Y A;  4KHR A;  2V6A A;  2HAF A;  2UVR A;  1TEL A;  2HFZ A;  2XMV A;  1KON A;  1Q5V A;  3GG1 A;  1PBA A;  1B3T A;  3SQG A;  5KFZ A;  3TEH B;  3KNA A;  1OO0 B;  1PC4 A;  1N54 B;  3HZE A;  5KFO A;  1UPM B;  1VHF A;  3ENQ A;  2NZ4 A;  2IY5 B;  4FF1 A;  2L41 A;  3U1L A;  1RHK B;  4ZPB A;  1F9H A;  3EUN A;  2AGP A;  5L9X A;  1VMB A;  1F9E B;  1RAD B;  4CO5 A;  2WK4 A;  3CCZ A;  3BSA A;  4RW9 A;  1WC6 A;  4RNN A;  5FLX U;  4ZDN A;  4MIW A;  5GAE U;  3V4I B;  3HFK A;  3PW5 A;  3TUJ C;  3R1L A;  2KJW A;  2OLW A;  4DR5 F;  3HJF A;  3VAG A;  1LK7 A;  1K1Q A;  2HMI B;  1EZZ B;  4DLG A;  1S1U A;  4F3O A;  5KT6 A;  2L48 A;  4ID5 A;  5AJ3 F;  1TVR A;  2YQ0 A;  4I0W A;  4U67 Q;  3S1T A;  2MPU A;  2K7K A;  3I55 S;  3BGO P;  3OSP A;  1WC3 A;  1U6F A;  3D0I E;  2K1R B;  4KGX B;  4RBT A;  1UWB B;  3UD5 A;  2RKI A;  2EEY A;  4I2P B;  4NPO A;  1R6Y A;  5E3R A;  3ET6 B;  5B0B A;  4ZP6 A;  2GHP A;  4NCG B;  3SSQ A;  3IBF B;  2R2S A;  3H40 A;  4IH6 A;  3W5X A;  4TU7 A;  3R5D A;  4PPZ A;  1HPZ A;  3QT8 A;  1AZS A;  2V8V A;  5KFV A;  3OTC A;  5CYQ B;  4ZLL A;  2X1A A;  1SQE A;  5IT9 U;  1E6V B;  2BDP A;  3BGL A;  1IQZ A;  4KV8 A;  4BC9 A;  3RJM B;  2XO7 A;  3LUY A;  2DGT A;  1DTT A;  2IM2 A;  2OSQ A;  3HP6 A;  1URN A;  2ZDO A;  3PRV A;  2XNQ A;  4HHH A;  1AUS L;  1DBD A;  3G6V A;  3FCW A;  3E01 A;  2BAN A;  2EWH A;  3K58 A;  2POK A;  2HVZ A;  2FVQ A;  3TUP A;  1LW0 A;  3TI0 A;  1WOO A;  3MM8 A;  2YWK A;  4UOG A;  4LBP A;  1U47 A;  3O6Q A;  2E5L F;  3HFV A;  4NLD A;  5DDP C;  4CO2 A;  2G2O A;  2F8M A;  3O5T B;  4IG0 B;  3DXS X;  2M8H A;  1JLQ A;  4M5H A;  3OTO F;  3FCH A;  2HS3 A;  1NK4 A;  2RF2 B;  3TNV A;  5D4N A;  5IQQ A;  4LVN P;  4X4U A;  3W8P A;  4DV6 J;  6AT1 B;  1X4E A;  2FVC A;  2KI2 A;  1TKZ B;  4RW7 A;  4F4Z A;  3THV A;  1RTJ A;  1RE1 B;  2H48 B;  4A46 A;  4M5D B;  1X5T A;  3HI9 A;  2VA3 A;  1HMV B;  3LGM A;  3KJQ B;  2GHW A;  1GX5 A;  2MZR A;  3VCD A;  1UFL A;  2HBY B;  4TLR A;  2D3O 1;  1OPZ A;  2YPY A;  2J0X A;  1XMO J;  4YB5 A;  4QWC A;  5J1E B;  1D9F A;  1QAX A;  3X3U A;  1WWH A;  4JI3 F;  4ERD A;  4DR3 J;  3CB4 A;  1WEY A;  4B3T F;  3I82 A;  4C11 A;  3GIR A;  1EQM A;  2AU0 A;  1JMT A;  5G4D A;  2GC8 A;  1JKH A;  1U45 A;  4OZ1 A;  3DRP B;  3RB6 A;  3OR1 B;  1JJC B;  4KY3 A;  3BO3 A;  1TP7 A;  1RLD A;  4QOT A;  5EUH A;  3UI3 A;  3VR1 A;  4DFK A;  4LF4 J;  3OXG A;  1HBN B;  2DGW A;  2V9K A;  1R8C A;  3B4D A;  3CSK A;  4ZS6 A;  1MRO B;  3SSS A;  4QU7 A;  1S97 A;  4TKT A;  3AB2 B;  4HHU A;  2QRR A;  2GFF A;  1KFD A;  3C6U B;  3K57 A;  2AEM A;  3MWB A;  5F9L A;  3PZP A;  3I31 A;  1IBK J;  1FJE B;  5DGA A;  1OQ6 A;  2XQC A;  4DUY J;  2QV6 A;  4JUZ A;  5C5J A;  4P2S A;  4DG1 A;  4CRJ A;  2KRR A;  4L73 A;  3NNH A;  4ES2 A;  1Q78 A;  4DV0 F;  3MM5 A;  5LM7 E;  2KL8 A;  3M30 B;  5IC6 B;  3PRB A;  3I56 S;  4QW9 A;  5LMU F;  2P8I A;  4ZVU B;  2Z58 B;  2V2K A;  4ZLP A;  3NWG A;  2V34 A;  1IJE B;  3LP0 A;  3LAM A;  2ZZN A;  4W4M A;  1TQL A;  4E8U A;  2I1R A;  3ENA A;  5HI7 A;  2J6T A;  4Y00 A;  4RKU C;  1MML A;  4HDG A;  4PCQ A;  1Q86 T;  1TMJ A;  3P3D A;  5IOL A;  3C6T A;  2F8H A;  3A8K A;  2YKA A;  1JLE A;  2CQB A;  4HLB A;  3PRD A;  5B0E A;  1PYS B;  2XMM A;  5J1N A;  5KFU A;  1NU4 A;  2BJ3 A;  1UWB A;  2XUL A;  1RWP B;  3DLB A;  3JTO A;  2L9D A;  5D0E A;  4I2P A;  2E7W A;  3VVU A;  2GO9 A;  3RGI A;  5E3A A;  5ETV A;  2HK3 A;  5F8M A;  4R0J A;  4NAS A;  2B4V A;  3ZZU A;  4K4T A;  4LBI A;  1GMU A;  2E5I A;  2HWH A;  2F3J A;  3U02 A;  1N36 F;  2XTJ P;  4NCG A;  2AYB A;  4M5K A;  4CLY A;  1F5C A;  3DRX A;  1HHS A;  5IWA F;  3EZ5 A;  1RT3 B;  1YVF A;  1PCA A;  2MY7 A;  5CYQ A;  1LQ9 A;  2LEP A;  2M7S A;  1HNI B;  1JIH A;  2O1P A;  1XR5 A;  1KQG B;  3A1Y G;  3KWM A;  5JVH Q;  5D6G A;  2J9D E;  1U8W A;  1FKO B;  2RSQ A;  4Y2A A;  1KQF B;  2KT5 A;  3QT5 A;  2ZD1 B;  3MR6 A;  4HR2 A;  1NHK L;  3A3P B;  4DL7 A;  1YI2 S;  4OYA A;  2QA4 G;  4A8W A;  1HQU B;  2ZE2 B;  1EIY B;  3CD6 S;  3NS7 B;  5J2Q A;  3H4B A;  3J80 U;  4ZPT R;  4AUK A;  4OL8 A;  1RI7 A;  2B43 A;  2W2Q P;  1A7G E;  2WB1 D;  2Q6C A;  5ETQ A;  5CAA A;  5I3U B;  3FCV A;  4IFV A;  1HNV B;  4IG0 A;  3EPG A;  3SFU A;  4AND A;  1HR0 J;  3RTV A;  1BGX T;  3W65 A;  4O4R A;  3TW0 A;  1M1H A;  1RWM B;  2M0G B;  1KTV A;  1X4H A;  1YSJ A;  1KC8 T;  1YJV A;  4NYP A;  2RF2 A;  3JSR A;  4J9R A;  2HHU A;  1IKX B;  2XMT A;  2R7V A;  1C0U B;  1TKZ A;  5CZX A;  3EGN A;  2LLZ A;  2CJQ A;  3HSD A;  1WF1 A;  1ZPV A;  1HBO A;  2HK2 A;  2NPF A;  1WDT A;  4G3I A;  4Y34 A;  1BD6 A;  5DGB A;  4PQU B;  2HZV A;  1AA1 B;  4PWD B;  4Q8E A;  1EHW A;  4QCL A;  5DG9 A;  2W7A A;  1MW7 A;  2OML A;  4Q2M A;  2GVZ B;  1SL0 A;  4DF8 A;  2RRB A;  4B3S F;  1VIS A;  3KNG A;  5DQH A;  2FHJ D;  1VBY A;  5D0G A;  5KFT A;  1URR A;  5ETT A;  2F9J A;  2QJ3 A;  1TTH B;  2E1R A;  1RTD A;  3DRP A;  3OR1 A;  1JLC B;  2A2C A;  3FSI A;  2GQC A;  3MXH P;  2OKQ A;  3A4T A;  1UA1 A;  1KDN A;  3D6F B;  2JC0 A;  1ZM4 A;  2F8E X;  4ED7 A;  1YJT A;  4NE9 C;  3PTW A;  1BLU A;  1T9U A;  5F41 A;  3BO4 A;  4ES3 A;  3Q24 A;  2KU7 A;  3PHE A;  3MF5 A;  2KG1 A;  4BC7 A;  1WUU A;  4AYB D;  2OJ3 A;  2WCX A;  1RTH B;  1XR6 A;  1AT1 B;  4X66 F;  4P2F A;  2ZH1 A;  3GIK A;  5DET A;  2BOA A;  3QGI A;  1RT7 B;  5A8K B;  1V3R A;  4DV1 F;  3LP2 B;  4XDD A;  1M1K T;  5K8P A;  3OVB A;  1P1T A;  3FZ2 A;  3CJK B;  1WOS A;  2QX0 A;  4H54 A;  2HGM A;  2QFI A;  4DR5 J;  1PSD A;  1QUP A;  4URQ U;  1NBE B;  1IKV B;  3E3X A;  4B3R F;  4WTY A;  2FZK B;  5DS7 A;  5A0Y B;  3C16 A;  3CPW R;  3HMJ G;  1WEZ A;  2HFU A;  3QAU A;  1T02 A;  4OZ0 A;  5CZV A;  3ZZT A;  3LP1 B;  3KLV A;  4L6V 3;  1WF0 A;  2A18 A;  2E5J A;  1N5Y B;  1PAU B;  3BN4 A;  2VA2 A;  2E1M C;  2ADC A;  2E5G A;  1VYA A;  4M5L A;  1LNQ A;  1SKS A;  2Z8Q A;  1UMJ A;  3LH2 S;  2CUY A;  5DDO C;  1H2T Z;  2ZFH A;  3ZTR A;  3OV7 A;  4M8L A;  4OLP A;  3ZZP A;  1DAR A;  2HQG A;  5E33 A;  1YZ6 A;  3E2E A;  2BEF A;  2B5J A;  1A6L A;  4OHZ A;  3BSO A;  3FSX A;  1TK5 A;  1SKU B;  1L3K A;  2HHW A;  2HYI B;  4B9N A;  1RT3 A;  4MH8 A;  2BBE A;  2KFZ A;  3I9V 9;  1RTI B;  4LFB J;  4G1P A;  3CJ8 A;  4R25 A;  1R0C B;  4RWW A;  5L8R C;  3IWL A;  3K59 A;  4EBE A;  3S01 A;  3MPV A;  5DO2 A;  1HI8 A;  5CH7 B;  3P96 A;  3GR1 A;  5IQ6 A;  3M8Q B;  1V6H A;  1JJ2 R;  1M1G A;  2LDI A;  3UD4 P;  3KLI B;  5HAT A;  3HHL B;  3RB3 A;  1RTZ A;  4ED1 A;  1FKO A;  1YJN S;  1W26 A;  2YKM A;  4DLE A;  1Y5L B;  2FGC A;  1HQU A;  2ZE2 A;  3MEC B;  2FZG B;  1XBW A;  3TJ9 A;  2GML A;  4HAC B;  2BM1 A;  5FII A;  2RS2 A;  2E5L J;  1XC9 A;  3RW6 A;  1IR1 A;  2M4M A;  3NGK A;  1RWX B;  1ZYQ A;  3N5B A;  3Q8S B;  5HQL A;  3OFG A;  2ZJQ Q;  2BW2 A;  4EYH B;  1IJF B;  2V2Q A;  2IDL A;  1HNV A;  1JWW A;  4TY8 B;  4NML A;  1VCT A;  1BUX A;  3BKF A;  4K50 A;  1IUJ A;  1EAR A;  5CYJ A;  4FNH A;  3GIJ A;  2IBK A;  1E6Y A;  2JOQ A;  1VRT B;  2IAJ A;  2KVI A;  2XZD B;  4FYX B;  4A8Y A;  4FP9 A;  2Q6B A;  1QM9 A;  1IKX A;  3Q23 A;  2OI2 A;  2HSE B;  1C0U A;  2DD8 S;  5EGY A;  2XMK A;  2BRK A;  1L5U A;  3E8O A;  1JXE A;  2D41 A;  1NXI A;  2NYH A;  2CPH A;  5L1J A;  4L72 B;  5KAK A;  4F4W A;  2AYM A;  4EUV A;  2FHJ A;  4PQU A;  1FFS B;  4PWD A;  5JUM A;  3PJX A;  2AEF A;  3DFE A;  2NS1 B;  2VG5 B;  2RQ4 A;  4B3T J;  4D3H A;  1MWZ A;  3PFO A;  3W2W B;  2PMW A;  1UJ6 A;  4NA1 A;  1I94 J;  3MM6 A;  3BYR A;  2DR8 A;  1S9G B;  2J9D A;  5B0G A;  3HSG A;  4DQR A;  5BR8 F;  2ALZ A;  1QD1 A;  2XBP A;  4DV5 J;  1JLC A;  3ENV A;  3KUH A;  2CQ0 A;  3PEJ A;  4DWI A;  2CPE A;  2XEX A;  4J9O A;  1RGV A;  2AGQ A;  3IXQ A;  2ZHA A;  1VC5 A;  2D9O A;  2X7I A;  5BJR A;  4ZLJ A;  1IN0 A;  1BQM B;  5AXL A;  3NCR A;  3KXD A;  4BWM A;  4I2Q B;  4BWJ A;  4DHV A;  4HTI A;  2MHN A;  1EET B;  3N6L A;  4P2M A;  2Q3P A;  3HHE A;  3OVS A;  3NGT A;  3MGJ A;  1UPP A;  1HD1 A;  4ED2 A;  1RTH A;  2RRA A;  3DRR A;  2DYA A;  1RT7 A;  4DV0 J;  1BWV A;  5A8K A;  4GMK A;  3MFH A;  3BQ2 A;  1YX2 A;  3JTP A;  3LP2 A;  1GXL A;  2N82 B;  1HFE L;  5LMU J;  1TAU A;  1WF2 A;  2UV8 G;  4XDC A;  5T7L A;  5ETS A;  1XR7 A;  3OL6 A;  1K9M T;  5ETL A;  4NLO A;  3PG9 A;  4ZN1 A;  1NME B;  5HL7 Q;  3RG6 A;  1DLO B;  1VC0 A;  1UWA A;  5A0Y A;  2W8K A;  5JMN A;  3KHH A;  2GX8 A;  4DU7 A;  3LP1 A;  3S6E A;  4IO9 Q;  3X1L B;  3IN5 A;  1S7I A;  2DNL A;  1N5Y A;  1QTN B;  1YJW S;  4J9P A;  2ZKU A;  4F2S A;  1GQE A;  2VBX A;  2LDY A;  5AXK A;  4CLK A;  3IFE A;  3KMQ A;  2HQ3 A;  4WK1 A;  3EGV A;  2Y8Y A;  1LV5 A;  2B0G A;  3NAI A;  3O2I A;  3BN7 A;  4JI7 F;  3JYT A;  3BR9 A;  1M5S A;  5A6W A;  2COL A;  3THP A;  2PSZ A;  1R8H A;  5C24 B;  5IWA J;  3DLK A;  2FGO A;  2M3D A;  2R8K A;  3K8V A;  5F0W A;  2C3O A;  2L3M A;  3TOQ A;  1RHJ B;  4F8R A;  2NYI A;  3M9N B;  2CQH A;  4X4N A;  2MLX A;  3J81 U;  4I6Y A;  1J27 A;  4DPW A;  2MKK A;  1VQ7 S;  2HLU A;  3IM8 A;  2FY8 A;  3M8Q A;  4FDF A;  2EFO A;  4DPO A;  2Y0B B;  3CIM A;  4ED0 A;  1SUQ A;  3M8W A;  3HHL A;  4IOB A;  2HFO A;  2ILY A;  1TKD A;  1YRX A;  3DM2 A;  1D8Z A;  4EK2 A;  4OX9 F;  1DTQ B;  1YGY A;  3MEC A;  2ZOM A;  1N52 B;  1X4F A;  4HAC A;  2Q79 A;  2KJV A;  3VAJ A;  3QWU A;  3Q8U A;  5IM0 B;  4PYA A;  2W4C A;  2Q1L A;  1WKJ A;  1NJY A;  2XS2 A;  1TZ0 A;  4N41 A;  4H4K A;  2H4W B;  4DR2 J;  5DQG A;  1XNR F;  2YX7 A;  2ZOG A;  3US5 A;  3G8S A;  1NJZ A;  3H59 A;  4YDX A;  2HQC A;  3UD3 P;  4QR0 A;  1UFW A;  1PIE A;  3FGV A;  2VJU A;  3CVK A;  4RWX A;  1VRT A;  4DUZ J;  1NPK A;  3L7P A;  3LGH A;  4RW8 B;  4C6A A;  2B9X A;  1S6P B;  3UNG C;  1VRQ C;  2JL9 A;  4DQQ A;  4EZ9 A;  3ZZZ A;  2DNG A;  1PJ5 A;  4YHH J;  2BKO A;  4UY8 T;  2H54 B;  2VH7 A;  3MAA B;  2W01 A;  3GFY A;  2BJD A;  1ZOT A;  1H2U X;  2UUA F;  3IWN C;  3QGP A;  4B3S J;  3GFX A;  1H38 A;  3BDE A;  3DOL B;  2VG5 A;  3BR8 A;  2NXE A;  4J9M A;  5KFW A;  3T5K A;  4PXE A;  4OZ3 A;  5HQ8 A;  3W2W A;  2C1E B;  3VF0 B;  5I42 B;  3FNN A;  1IVZ A;  3JB9 k;  1UVM A;  2GHV C;  1S9G A;  3W9H A;  1JLF B;  3BBF A;  3RR7 A;  2O67 A;  1VBX A;  2VUG A;  3MAQ A;  1MU2 A;  1Z2L A;  1OSD A;  1VQO S;  5DLG A;  3FMW A;  3HK2 A;  1JJ4 A;  2AYE A;  3A13 A;  3LWM A;  4OI0 A;  3V81 B;  4YB1 P;  3NOG A;  5BXI A;  2XY7 A;  2R7S A;  2QA4 S;  3CT9 A;  3FBE A;  4ED6 A;  3UN5 A;  2E5H A;  3T1H J;  3NGU A;  4XIU A;  5H9F K;  4U7C A;  3H5Y A;  2R8H A;  1BQM A;  1RIS A;  3RBD A;  1NH7 A;  4ECT A;  4X66 J;  1NAQ A;  2ATC B;  2IMO A;  3SFG A;  4O0I A;  1X9M A;  1FT8 A;  4ED4 A;  4F4A A;  4DS4 A;  4LRE A;  5ETR A;  1IBC B;  1KSP A;  3QAE A;  1C1B A;  3FC9 A;  4NXN F;  1ZA2 B;  1SKR A;  3LQV A;  4YR0 A;  1HNX F;  4JI8 F;  4FYV B;  4N76 A;  2LXU A;  2B56 A;  2YKO A;  2UUT A;  2AZ3 A;  2HHT A;  5L46 A;  1N88 A;  4CM2 A;  2YWW A;  1HHT P;  1HWU A;  3DU5 A;  3CCM S;  2APO A;  4BHQ A;  4OI4 A;  1B4S A;  2UXD F;  4NLP A;  4NRT A;  1HWL A;  2QFJ A;  1YBT A;  2DXD A;  5MLC V;  3NMA A;  3UDL A;  3UWT A;  4KRW A;  3JS9 A;  5KFH A;  2IYG A;  1DQA A;  1RXO B;  4WFA Q;  1FK9 B;  2EK6 A;  1CS4 B;  3QGH A;  3OT9 A;  1SCJ B;  1S6Q B;  4I1T A;  3AAW B;  3GSD A;  3VTI A;  4R0E A;  3HD1 A;  1LFW A;  2EC2 A;  4ECR A;  2CNK B;  2KZM A;  1Q95 G;  4PRF A;  1QAY A;  4LIW A;  3D67 A;  2O66 A;  3PW2 A;  3TX8 A;  4ITS A;  1VRU B;  4YB7 A;  5C24 A;  2CPZ A;  1SH0 A;  3H2U B;  4K8R A;  4X4T A;  2HHX A;  2UUW A;  5KFA A;  1IR0 A;  1NSP A;  3DNC A;  1H7X A;  3FBC A;  2BOP A;  1ZAW A;  1ARO P;  1FJ7 A;  1ZM3 A;  2O01 C;  1XNQ F;  1OQ3 A;  1F1B B;  3R2D J;  4Q43 A;  4WZM A;  2YX4 A;  4RU2 A;  1R89 A;  3WHI A;  2Y1J A;  4MTP A;  1YRT A;  5HVH A;  2YNF B;  3KHL A;  3HHD A;  1F5A A;  4LF8 F;  2CQD A;  1GEH A;  4MIA A;  3LPY A;  3R3T A;  2WVE A;  3DHX A;  3JSY A;  2RJZ A;  1RA6 A;  1UZH A;  3CDW A;  2UXB F;  4LR9 A;  2WVF A;  1DTQ A;  4PXB A;  4NX9 A;  4K59 A;  2DH9 A;  4IFY A;  3T19 A;  4ZVH A;  3PJW A;  2AKW B;  3MOZ A;  2ZM6 J;  2O3D A;  1X5P A;  1UJ4 A;  3CDA A;  2DJW A;  4QIG A;  4JI5 F;  2OSR A;  5IM0 A;  3TAQ A;  2DNZ A;  3C2P A;  1NK0 A;  3V2U C;  4A8X A;  1FHT A;  4IDK A;  2RE1 A;  3L7O A;  1PBU A;  1GFW B;  2VIC A;  4LF6 J;  4HEA 9;  4LF9 F;  1N6Q A;  2B9E A;  3TO8 A;  2ZOF A;  1U7L A;  2CJY B;  4Y2K A;  4TN2 A;  1R31 A;  2HZA A;  5D78 A;  1YKW A;  3G87 A;  2DT9 A;  2VFV A;  4RW8 A;  1S9E B;  5HLF B;  1S6P A;  1X4D A;  3CD7 A;  3FMB A;  2QLW A;  1NSK L;  3BM7 A;  2IM3 A;  3D1H A;  5KFG A;  1KLM B;  3Q8Q B;  1K0T A;  2DIU A;  2X3G A;  3MAA A;  4NYO A;  3NCP A;  1KVJ A;  1F0X A;  2MEW A;  2AX0 A;  2IVF B;  1YTY A;  3GV8 B;  3DOL A;  3I6P A;  3MED B;  1YLX A;  5BR8 J;  3K2Y A;  1HBU B;  1WHX A;  2RDJ A;  5I42 A;  4QIW D;  1T03 B;  3PJ9 A;  1X4B A;  4RPF A;  1L3S A;  1IQT A;  2DO4 A;  1A9N B;  5RUB A;  4Q0B A;  3SCJ E;  3UCU P;  4ETZ A;  4WWS A;  1U1K A;  1MLA A;  5B7W A;  2YX1 A;  1S1T B;  3NY0 A;  5KFF A;  4KGZ B;  2I5J A;  2HVI A;  3OFF A;  4DN0 A;  3BEG B;  3Q22 A;  3GON A;  2GVD A;  1BQX A;  5BYS A;  2XI3 A;  1WTF A;  2D69 A;  3QYY A;  3H4D A;  3BKT A;  4LQ3 A;  3NS5 A;  2G2Z A;  4UZC A;  4P10 A;  5LJ3 Y;  3VV2 B;  3L95 X;  2V8P A;  1RAC B;  2BJ1 A;  4NCB A;  2ASD A;  1Q4R A;  2QSW A;  4XPC A;  3V6K A;  2MQQ A;  2V2V A;  4OFZ A;  4RL1 A;  1D9D A;  4QWB A;  5E2Q A;  2W8L A;  2MJU A;  3TZX A;  1ZTW A;  3KYL A;  2K7J A;  1CQN A;  1SIW B;  2DR6 A;  1JNR B;  3PV8 A;  1FTR A;  3QJL A;  2FJA B;  1HNW F;  2LEA A;  4WFY A;  2ZNZ A;  1QAI A;  2LMI A;  5SZT A;  1IKW B;  2C42 A;  3ILI A;  1EQ0 A;  4A4J A;  2CQG A;  3BKU A;  2AT1 B;  2LKZ A;  4GKJ J;  4DV2 J;  2YH0 A;  2Z57 B;  2OGU A;  4USW A;  4YP3 A;  2CJB A;  2XMW A;  5HBM A;  4DSF A;  2JLE A;  2DIT A;  1UZD A;  2V4J A;  4WU2 A;  1CS4 A;  4JI7 J;  4UY8 5;  4DCP B;  4RUA A;  3CW2 C;  3WZ0 A;  4Q5V A;  3CC7 S;  1UVI A;  4C8L A;  1RA7 A;  1LXJ A;  3S8S A;  5HN0 A;  4OX7 A;  3CCR S;  4RR5 A;  3NGD A;  1T05 B;  1VRU A;  1L3U A;  4DV7 F;  3Q2T C;  4F50 A;  3I5B A;  2YNI B;  3GIM A;  4X2B A;  4HKQ A;  2V8G A;  4X4S A;  4C3M A;  1U6Z A;  1RB0 A;  1W7W A;  2XHC A;  1U0S A;  3W9I A;  3PO5 A;  4PWW A;  4UST A;  1DAX A;  2JH3 A;  1HI1 A;  4G1I A;  4R8U B;  4WF9 Q;  4DX5 A;  3SEO A;  2V69 A;  1RCO B;  3Q86 A;  2KDO A;  4ECU A;  1CLF A;  2KFN A;  3WX4 A;  3M6X A;  4O3S A;  3R5G A;  1WHW A;  2CQC A;  2B51 A;  4DS5 A;  2YNF A;  1WC0 A;  2P9C A;  4I7F B;  2AD9 A;  3T41 A;  2FVP A;  3PDN A;  4OX9 J;  4J37 A;  4OX8 A;  2DHA A;  2DHS A;  2MSS A;  2EI5 A;  2ZHO A;  4USH A;  1FDN A;  2WSF C;  2DHG A;  6FDR A;  3LGN A;  3D0G E;  5GAD U;  2GGP A;  4DSE A;  2JC1 A;  2NPI A;  4DPX A;  2CVI A;  4I6W A;  1U09 A;  3BZQ A;  1DJ0 A;  2EKY A;  3VWS A;  1RAG B;  2L08 A;  4YQW A;  4W90 B;  2VJV A;  3MTJ A;  2VIH A;  1XNR J;  4C8K A;  3ICL A;  4OHX A;  1CUL B;  5HMY A;  4M5M A;  1WOR A;  1VQ5 S;  3MFI A;  4IR1 A;  4KH1 B;  3H5S A;  2ROE A;  4HDH A;  2VC1 A;  1TAQ A;  2XGP A;  3DDN A;  3VQT A;  1LW2 B;  3T6J A;  5EX0 A;  3N6M A;  4H4M B;  1X4A A;  4TYB A;  2Y0S D;  3I96 A;  2XHW A;  5HLF A;  4FZV A;  2IHR 1;  4DU8 A;  2R7T A;  1KLM A;  3Q2S C;  1NHU A;  2ZH8 A;  3TA1 A;  2C22 A;  1WI8 A;  3RRK A;  1G6B A;  1HWJ A;  3PVX A;  2W4P A;  3AB4 B;  2BRL A;  4G65 A;  3P5T L;  5EWE A;  2AGO A;  3UDV A;  4CO3 A;  4LIR A;  1S6O A;  4A8S A;  1U0H B;  1IBM J;  2CNN B;  3ILO A;  1OIA A;  3CCQ S;  3JQK A;  5ETK A;  1FES A;  4DDF A;  4ELU A;  1S1T A;  3GMG A;  3ELH A;  4OV1 A;  2FHO B;  4PR6 A;  1YZ7 A;  1TUV A;  3NOC A;  1R0A B;  4CLZ A;  4ZK7 M;  5IT4 A;  4KHM A;  3MUT P;  4O3O A;  2HKE A;  5EDW A;  2KH9 A;  1VQS A;  4WFN Q;  1V5I B;  5K20 B;  3F41 A;  2VBW A;  4N56 A;  4JI6 J;  1O0P A;  1VGY A;  2HND B;  1S1V B;  2E1P A;  3NBP B;  1PKU A;  1FEE A;  2HQD A;  3AXK A;  5LOQ A;  1HNX J;  4JI8 J;  3RR8 A;  3GPA A;  3OW2 R;  2PA3 A;  3FBB A;  3HD2 A;  2A0F B;  4MKY A;  4OV6 A;  3W8G A;  2NR0 A;  1RHM B;  4ZIT A;  4EBD A;  3UR0 A;  2PC6 A;  3PX0 A;  2UV8 A;  5KOW A;  2DH8 A;  3AJ2 A;  2UXD J;  3QRP A;  3KLE A;  4B9V A;  3IAS 9;  1UVJ A;  1LOU A;  3EGZ A;  4OYO A;  4B08 A;  3G71 S;  3GJR B;  3BH6 B;  1X0P A;  1Q8B A;  4FXW A;  1TMM A;  2B8P A;  2XZW A;  3IC1 A;  2FVR A;  4J9U E;  2Y1L B;  1SXL A;  1F2G A;  4LUB A;  4DQP A;  2ADB A;  4B3M F;  2OHD A;  5IFM A;  1Q53 A;  5LXR A;  3B82 A;  2MB0 B;  1R8P A;  4ID8 A;  4ZKA A;  1C4C A;  3ENW A;  3RB4 A;  3TWZ A;  4WK3 A;  4OYM A;  1QSY A;  1EB0 A;  3D4J A;  4KE5 A;  3BYP A;  3GYX B;  1Z4U A;  2CPJ A;  1WHV A;  3WC0 A;  1C4A A;  1R0B G;  5E41 A;  3WQP A;  5C42 A;  2IVY A;  2KXH A;  1LWE B;  3KDN A;  2VFR A;  3DRY A;  5LMN J;  1KHV A;  4A48 A;  2D7S A;  2J0Q D;  1S10 A;  1WC1 A;  2ASY A;  4NA3 A;  2P5V A;  2UVW A;  1XNQ J;  4RO0 A;  3L4B C;  4P72 A;  5U47 A;  1Q0N A;  2MKH A;  4R8U A;  4ZP8 A;  2FUG 9;  2HHQ A;  1DY3 A;  2GMH A;  3V6H A;  3SQG B;  1U1Q A;  1WSV A;  4ZIW A;  1TL3 B;  1RT6 B;  5KG4 A;  4J91 A;  3B4M A;  5BYQ A;  1RAF B;  2DO0 A;  4UOH A;  2JVO A;  3CJT A;  4IYQ A;  1SC1 B;  4OLO A;  2V50 A;  2VOD A;  1B0T A;  3AA8 A;  2C2E A;  2QIF A;  2C28 A;  2BV3 A;  2UXB J;  4ZP9 A;  2GMJ A;  3UE2 A;  4DUY F;  3K5N A;  3EDQ B;  1IM6 A;  2XY5 A;  4JI0 J;  1O5J A;  2MYF A;  2HLT A;  1FRI A;  3FDS A;  1HNZ F;  4A47 A;  3OQ2 A;  4KO0 A;  3VAF A;  4JI5 J;  3D3B J;  2DK2 A;  2HBZ B;  4UTG A;  5L9N A;  2W7O A;  2PMH A;  2W2O P;  1B70 B;  5HMW A;  3P6Y C;  1S1U B;  3D3C J;  3M6W A;  3TZY A;  4QYZ K;  2QN6 B;  1N5S A;  3QT6 A;  1S77 D;  4NL5 A;  4KC5 A;  1VQY A;  2ZNY A;  5GAH U;  1GK8 A;  4J9S A;  2MQN A;  2LCW A;  4OI6 A;  4Y2I A;  2GIR A;  4ZCM A;  5I3Q A;  1U1M A;  2OH2 A;  2LU1 A;  1LW2 A;  5IZH A;  1VJW A;  3BS9 A;  4H4M A;  2RKI B;  4ZCI A;  3H0P A;  1VQK S;  2N7C A;  1FJG F;  3PIP Q;  4B02 A;  4RNH A;  4TQS A;  5KFM A;  3PY8 A;  2DB1 A;  2EVZ A;  4PG4 A;  2B4P A;  4EMD A;  3R7S B;  4ANE A;  2Y1R I;  2AQ4 A;  2G1H A;  3PR4 A;  1QJH A;  5ETN A;  4NZ6 A;  2KHD A;  2HQF A;  1MN9 A;  1KTQ A;  2FZC B;  3FRY A;  4P73 A;  1XMQ F;  1GT8 A;  3PIO Q;  1HPZ B;  1NB7 A;  2M2B A;  5EWG A;  1CSJ A;  1H98 A;  3M6V A;  4QWA A;  2BMB A;  2GJF A;  4IRC A;  3ZTS A;  3J81 j;  3J7Y U;  3GII A;  3GCW P;  1FWP A;  2V4R A;  2ZBQ A;  2VG6 B;  4X62 F;  4NI2 B;  1U0H A;  3BQ0 A;  2LA4 A;  5J2P B;  3RBZ A;  5HMZ A;  2VFU A;  1FNO A;  1AB8 A;  1KNZ A;  2FJB B;  1DTT B;  4A8Q A;  2YKQ A;  5GAG I;  4IH5 A;  3DHW C;  2PMZ D;  2JHE A;  4WKR A;  2OEK A;  4X84 A;  1U1N A;  3M2U B;  1CEZ A;  1R0A A;  2BAN B;  3KDO A;  1TL1 A;  1U02 A;  4DPY A;  4F2R A;  3DDK A;  2MZJ A;  4C7Q A;  1N32 J;  3OHB A;  3V6D B;  3AJD A;  2J7K A;  3CDB A;  2C3Y A;  3L9Z A;  2A6M A;  2HND A;  1S1V A;  3QZ7 A;  4EI2 A;  2DVI A;  1JLQ B;  1ZZN A;  4OI1 A;  2Z4P A;  5D77 A;  5EHH A;  3NBP A;  1IWA A;  2BE2 A;  4TQR A;  4CT8 A;  5D3G A;  1HR0 F;  4OYX A;  1C1C B;  1HNW J;  5L1I A;  3I0S A;  4WII A;  4Y0F A;  3NEK A;  4P74 A;  1VR6 A;  1DQ8 A;  1O8B A;  4NLW A;  5HAN A;  2PA8 D;  2OTJ S;  2RU3 A;  5H9E J;  5K14 B;  1GXT A;  2XS5 A;  3SIP B;  1SL1 A;  4FVC A;  4DOZ A;  1K44 A;  5KFS A;  1SJF A;  2IPO B;  4DR4 J;  1ZH5 A;  4WCE Q;  1HLW A;  3CO0 P;  4QPX A;  4M5N A;  4Y3C A;  4Z7C A;  4KR0 B;  1R43 A;  3LW5 C;  3I4P A;  2GV1 A;  4LT6 A;  3W66 A;  1B7F A;  1HQ2 A;  2EFV A;  1NK7 A;  3F73 A;  2DCL A;  1V3Z A;  3LO3 A;  3VVT A;  4CH0 S;  4ILL A;  1Y7P A;  3FEZ A;  2DGO A;  2E1A A;  3AXM A;  3FEY B;  4A8O A;  4DX6 A;  5LL6 d;  2M88 A;  4DCO B;  1EKR A;  3FSY A;  3AY0 A;  2DIV A;  2VB6 A;  3H90 A;  1Y3K A;  4YOE A;  3TX0 A;  2WRM A;  1WTB A;  1YQH A;  3D6M B;  3ZTP A;  3GQC A;  2JX2 A;  1BQN B;  1SC4 B;  1NEE A;  1TL3 A;  1U1L A;  1VC6 A;  3H7H B;  1R6V A;  2ERR A;  2YH1 A;  1RT6 A;  2RB7 A;  5E3P A;  2F40 A;  4I56 A;  4DR1 F;  3HKZ D;  1RSC A;  4D3G A;  1RWW B;  3EJM A;  4IQM A;  4DG1 B;  3EMT A;  2IA6 A;  2CQ3 A;  3IA0 A;  2FHM A;  3QAT A;  2OIH A;  4LRC A;  1VLY A;  4L3K A;  1RWK B;  4UT4 A;  2ZH4 A;  3HHN B;  1SH2 A;  3R27 A;  4CLU A;  3MM5 B;  3MPD A;  5K8O A;  4OZN A;  4NA2 A;  5DZ6 A;  3RAQ A;  3KKF A;  4C8Y A;  3R97 A;  2RML A;  3GFH A;  2FYX A;  3M1V A;  4OMF G;  1VQ4 S;  3P45 B;  4AL7 A;  4EBC A;  2CVE A;  3LP0 B;  4G1Q A;  4J9Q A;  5AT1 B;  3T9N A;  3UR3 C;  4Q45 A;  1G4C A;  4MMO A;  2HHP A;  4NZ0 A;  4TXS A;  3C6T B;  3QQC D;  4I69 A;  5GAG U;  1JLE B;  1RT2 B;  1P8G A;  1OJ4 A;  3AD9 C;  5AXN A;  2RS8 A;  3UPF A;  5A2Q Y;  1CBK A;  3Q8Y A;  4LRB A;  2CJK A;  3L3C A;  2VKR A;  3IP0 A;  3BPS P;  4ZPV R;  1RUS A;  2BA9 A;  4B9U A;  4KPY A;  3OL8 A;  2ACM A;  4K0K F;  3HFZ B;  3CTR A;  3KUE A;  3T1A A;  3G82 A;  1NJI T;  2ZH6 A;  1RWV B;  4JYA F;  3DGP A;  3W2V A;  1I1G A;  2WW8 A;  4UUW A;  4NLX A;  4ED8 A;  4O3Q A;  3KJV B;  5CXT A;  2JFK A;  2VG6 A;  3VGS A;  2XMU A;  3R1H A;  2UU9 F;  3GU0 A;  4NI2 A;  1WOP A;  4LMZ A;  4LFB F;  4UOF A;  5J2P A;  4UQG A;  1RKJ A;  1LWX A;  3TAN A;  2Z2L A;  1SJ3 P;  4O0N A;  1VQP S;  1MN7 A;  1YIJ S;  4DL2 A;  3BSC A;  1FX2 A;  3PAC A;  1Q1K A;  4JV0 A;  2YKN B;  5FLX Y;  2EBG A;  4HI2 A;  3UQS A;  4KGM A;  1XIQ A;  4KBI A;  5J2Q B;  3M2U A;  3PYF A;  1NKE A;  2EFN A;  3CXC R;  2RNE A;  2MKC A;  2BAB A;  1HA1 A;  3RAX A;  2ZUG A;  2ILZ A;  3T5H A;  2W9C B;  3CUL A;  1BY9 A;  1T11 A;  2FD2 A;  1R8A A;  1AYE A;  3I9Z A;  2A10 A;  2HAI A;  4OIX A;  3KTQ A;  4OYP A;  3V6D A;  2RHQ B;  3N9U C;  4AD6 A;  3KLF B;  4IFV B;  4TNO A;  4CWB A;  4AT1 B;  2KTQ A;  3OXF A;  4K4Z A;  5F3T A;  3OL7 A;  2PII A;  2IJR A;  4NLV A;  1BWE A;  3GCX P;  4CLP A;  1NND A;  4ZJQ A;  4HH0 A;  2C3P A;  2DNM A;  4WE1 A;  1C1C A;  3OFE A;  2CQI A;  1UFK A;  2GJI A;  5CCM A;  1DRZ A;  1NCL A;  1FFG B;  1PJ7 A;  4O4G A;  1S79 A;  4NCA A;  1HBO B;  4P7T A;  6FD1 A;  3A8I A;  2CZV C;  2QLX A;  1QE1 B;  3HJV A;  3NCQ A;  3RYL A;  2X3D A;  4B3M J;  1RAA B;  5K14 A;  5KG1 A;  1FE4 A;  3DU6 A;  1NJX A;  2K06 A;  4NLS A;  2MQM A;  3I5C A;  2OPP B;  4UUX A;  2H5J B;  4W92 B;  1S9F A;  4UW2 A;  2G0C A;  2PI4 A;  3BDP A;  1B0V A;  5IT9 Y;  2CG8 A;  2GIF A;  1KR4 A;  5I4M A;  1J5E J;  3SMZ A;  1I94 F;  2ZC3 A;  3MEG A;  2IBO A;  1RTD B;  2K8G A;  5KG5 A;  2RH3 A;  2GZO A;  3AOB A;  4DV5 F;  5IV3 A;  4DFJ A;  2VPZ B;  3NWR A;  2QA1 A;  4IOC Q;  2J6U A;  3HHK A;  1TV6 A;  4Z37 A;  4CH1 A;  2XI2 A;  5KFI A;  2HPU A;  2VDI A;  1X4C A;  4QYR A;  1BQN A;  2XYH B;  3OTE A;  3TVZ A;  3NGR A;  4PXD A;  5KOX A;  4OI2 A;  3FRZ A;  1N33 F;  2DHX A;  3PNI A;  5A8R B;  2LFV A;  4QJV A;  4KPC A;  3PX4 A;  4JI4 J;  3ZZ0 A;  1QTM A;  2VAS A;  2NXN A;  1HNZ J;  4PG6 A;  3K5O A;  2HHH J;  1I51 B;  3K17 A;  2F7V A;  4WXO A;  3I4H X;  3H2V E;  1X9W A;  3QT7 A;  1FF2 A;  4DX7 A;  2VDH A;  2PEB A;  1KKH A;  3G8Q A;  2EXU A;  5HVF A;  5D4O A;  4GVL A;  2H51 B;  3MUV P;  1GTE A;  1NB2 A;  1VLO A;  1V5V A;  4NMX A;  4WYL A;  1RBA A;  3HXM A;  3CED A;  3C16 B;  3T5L A;  1UVL A;  4PYD A;  1NSQ A;  4L76 A;  2MKY A;  1N5T A;  1QVF R;  1TK8 A;  1FTC A;  1RT2 A;  2WSC C;  3AA9 A;  3H8Y A;  1RAI B;  2KXN B;  2XSJ B;  1FJG J;  1M5P C;  1JQG A;  2FC8 A;  1FRL A;  3TUI C;  2IM0 A;  2R42 A;  2E7X A;  4NEY A;  1IBL F;  3PYG A;  1SJ4 P;  3GV5 B;  3HUL A;  5H1S V;  1BC6 A;  3CC2 S;  4HTJ A;  3DYA A;  4ZVQ B;  1XMQ J;  1CC7 A;  2K3I A;  2QYG A;  2B5J B;  4F25 A;  4NXM J;  2EG1 A;  3PEH A;  2MDA A;  2E7V A;  1YJR A;  3SV3 A;  1NK8 A;  3K7R A;  4FYW B;  3DKD A;  4YY3 F;  2G0I A;  4LRD A;  3HSJ A;  2R8J A;  2ABY A;  2VQF F;  3QNW B;  4X62 J;  4J9K A;  4Q44 A;  2G0J A;  3N01 A;  2CA9 A;  1YG0 A;  3DLE A;  3KJV A;  4JI2 F;  3DOM A;  1J2V A;  3DLL Q;  4YME A;  2P6T A;  1VDH A;  2ZWP A;  3MR2 A;  2DR7 A;  2OEM A;  3K5P A;  2N4C A;  4ZOS A;  3QSI A;  1H3D A;  4HL9 A;  4DJB A;  2V2Z A;  2GA7 A;  5KFQ A;  1F3V A;  5KG7 A;  3T5J A;  2YKM B;  2YKN A;  1BE4 A;  2KM8 C;  4FF3 A;  3EX7 B;  1NK5 A;  1UP1 A;  4F7V A;  3GV7 B;  1HAR A;  4KH0 B;  1LFP A;  2EW9 A;  5HMX A;  3ILL A;  5ETM A;  2W9C A;  3HF5 A;  4JV1 A;  1UTA A;  4IRD A;  4B9S A;  3KLF A;  1FER A;  4LR7 A;  4M5G A;  2NRE A;  1XWL A;  3FVY A;  7AT1 B;  1OY9 A;  4DR2 F;  1E6Y B;  1NM2 A;  4IKA A;  4B9M A;  4S0M A;  2IAJ B;  4J9L A;  2UUB J;  3M8P B;  4PKD B;  1HBM A;  2BQR A;  3HKW A;  3MCM A;  3D6H B;  4K7Q A;  3U7J A;  4M63 A;  3ZFV A;  5T41 A;  2XB2 D;  1S72 S;  1U1O A;  4DUZ F;  1Y11 A;  4KFB A;  3R5A A;  2FB0 A;  1QE1 A;  4USJ C;  1MG7 A;  1S0O A;  1UL3 A;  1RLC L;  4YHH F;  3IS9 B;  1UKU A;  1UJ5 A;  2BE7 D;  2ATL A;  3OL9 A;  3W62 A;  4EFA C;  4GKK J;  4L74 A;  1ZBT A;  1KFS A;  2R7W A;  2QYC A;  8RUC A;  2OPP A;  3CWJ A;  1G1X A;  3N5F A;  3MM6 B;  2R7U A;  5AE2 A;  2VPW B;  4CO4 A;  3GLJ A;  1X8D A;  2QMW A;  3MCS A;  4GVB B;  3CCU S;  1N5V A;  2IMW P;  3AJ1 A;  3MCO A;  4C9D A;  1NK6 A;  1RQ0 A;  2CQ2 A;  3KG4 A;  3MPY A;  2B7B B;  1N5Q A;  4MAK A;  1Y9O A;  2W25 A;  2KKH A;  3D68 A;  4AE5 A;  3IWX A;  2VOO A;  4ECZ A;  4CTA B;  3PXG a;  5HRO A;  4ZVO B;  3A8E A;  2Z56 B;  1Q7Y T;  2L9W A;  3J80 Y;  2MKJ A;  3SBM A;  5KFB A;  1JNZ B;  1CVJ A;  3JAM U;  4DR1 J;  2PN6 A;  4DXL A;  5D8H B;  1ICE B;  1FKA F;  1KVI A;  2DPI A;  4PEO A;  5FD1 A;  3PCO B;  3T1H F;  5A8R A;  2G1D A;  2E9T A;  1T3N A;  2HFV A;  5DG7 A;  5KT4 A;  4IG3 A;  3DRR B;  1K1S A;  2XSF A;  1SBR A;  1LEO A;  4NLU A;  4GC6 A;  1RAJ A;  2I9S A;  4USU A;  1K8A T;  4DMZ A;  2H9Z A;  2V67 A;  2OO4 A;  4RW6 A;  3RBE A;  5T7L B;  1HWI A;  1G2E A;  2W9B B;  2M8D B;  3M2R B;  4FYY B;  3RUB L;  2VV5 A;  4KAI A;  2QO3 A;  3KOA A;  5KT7 A;  2RQC A;  1ROF A;  5B09 A;  2F4V J;  2CJ9 A;  3BSN A;  3EE3 A;  4K4V A;  1FEH A;  1FRH A;  3MOJ B;  2CPI A;  2E1C A;  2ZVS A;  3DDI A;  4YS2 A;  1MMD A;  4NEZ A;  1WKK A;  1UET A;  4BCA A;  5KTQ A;  2A3J A;  2VFS A;  2B6A B;  3SCL E;  2XSJ A;  2JEF A;  2WBR A;  2MKS A;  4K0K J;  2FLN A;  3GWC A;  1S57 A;  1S5Z A;  1DQ9 A;  1T95 A;  2AJF E;  2R2U A;  1KP6 A;  3JYT B;  3A12 A;  1H7W A;  5F8L A;  3UDC A;  3CUN A;  3PYE A;  4QQB A;  5GAE I;  3KK1 B;  2BM0 A;  2EBE A;  4BBY A;  4JYA J;  3KG1 A;  3LPE A;  3DLK B;  1SVD A;  2CAJ A;  3AH6 A;  4DQI A;  3ISZ A;  1SC3 B;  3K0J A;  4Q8F A;  2UU9 J;  2M9K A;  1TL5 A;  3W61 A;  4DV4 J;  2PGC A;  3QWP A;  3DLG B;  2AJ2 A;  1R7I A;  1HI0 P;  3GJS B;  4JP8 A;  1K0V A;  1VBK A;  3VZH A;  2EPI A;  3PFE A;  1SUQ B;  2PT0 A;  1GX6 A;  4LSL B;  1X31 C;  4RLE A;  4RUC A;  5KFC A;  1FWK A;  2XCP A;  3DM2 B;  3BF4 A;  5EX3 A;  3UCZ P;  2YPZ A;  3UN2 A;  2V4Q A;  4P6Q A;  3VZI A;  4QPT A;  5CA5 A;  3G6X A;  2OPQ B;  3TVK A;  2CG4 A;  4DFM A;  3D28 A;  5HJY A;  4I6A A;  2MGZ A;  1TK0 A;  3QO9 A;  2N3O A;  2J0S D;  2PO4 A;  1T7P A;  2VQE J;  1Z2Z A;  4CNZ A;  3AQP A;  4USI A;  3KUG A;  1NH8 A;  3TJA A;  2ZM6 F;  5AE3 A;  4PAB A;  3MI7 X;  4K4U A;  4ILM A;  3A8J A;  1T9T A;  4DR7 F;  4ZPW R;  1OSC A;  4ZVP B;  2FJW A;  3TA0 A;  2IJN A;  4LF6 F;  3M8P A;  3SI8 A;  2IFX A;  1VQL S;  2WON B;  4ER8 A;  4OZJ A;  4OZ2 A;  4B9L A;  3MHY A;  4C8Z A;  3MMA A;  2JLG A;  2YNG B;  4K4X A;  3CNQ P;  1T9W A;  2ZZT A;  5LJ5 Y;  2B8Q A;  4MT1 A;  1KQS R;  2HEK A;  2HBR B;  2AHO B;  3WIV A;  5J2N B;  3IS9 A;  2R7O A;  5KFK A;  3E51 A;  2J8A A;  2R7R A;  2Z0G A;  3H20 A;  2IIH A;  4C0B A;  2RDD A;  4NLR A;  7FD1 A;  1D3W A;  1S0M A;  4H4O A;  3KK3 A;  2F63 A;  1T9Y A;  5SUH A;  1U4B A;  2MZT A;  8AT1 B;  5LSL A;  4B9T A;  4GVB A;  1Q82 T;  4FXD A;  5KT5 A;  2CRL A;  1MU2 B;  3BB5 A;  4QWE A;  1FRX A;  3SXL A;  4OX6 A;  3AOD A;  4PPD A;  4PZV A;  4WXW A;  3C14 B;  2BQ3 A;  4CTA A;  3KFW X;  3NMR A;  4YUD A;  2G4B A;  4AFF A;  1UCN A;  1RYS A;  3IO1 A;  1N33 J;  4YB6 A;  4EWT A;  2R9L A;  4M5J A;  2KT3 A;  1D1U A;  2DHH A;  2XO6 A;  3M4X A;  4TLQ A;  2GO8 A;  4C0O C;  2YNH A;  4EEY A;  2Z30 B;  1RHU B;  3DLH A;  3FBF A;  3M2V A;  4LFA F;  1V3S A;  1NZA A;  1WD6 A;  4F3Q A;  1DZ5 A;  1SI9 A;  1C1B B;  1OY6 A;  3C66 A;  1WJ9 A;  5C25 A;  1QAJ A;  2W9B A;  3M2R A;  3MZI A;  4Q2L A;  3G8T A;  4LRF A;  2XWX A;  2ASL A;  4C2M A;  1NDP A;  4N47 A;  1JK9 B;  2W2M P;  3W60 A;  4UQT A;  3QLH B;  3DRS B;  1PAE X;  3ADA C;  3JQM A;  3EZO A;  4DR6 F;  4GKJ F;  4DV2 F;  1UEU A;  2B6A A;  1IBL J;  5F8N A;  2W9A A;  1HL6 A;  3V6J A;  3LF0 A;  1ELO A;  1FKP B;  4KTQ A;  4V1A k;  3U27 A;  1HWK A;  5HSP A;  3KG0 A;  5M2P A;  2RRN A;  5KFL A;  3GZ7 A;  3DOK B;  3KK1 A;  2R3V A;  4YY3 J;  2ROP A;  5IXU A;  2LEC A;  3CMQ A;  3D0H E;  4FXV A;  2VQF J;  2RVJ A;  2B9Y A;  2XM3 A;  1V9O A;  2V63 A;  4ECW A;  1YIT S;  4JI2 J;  3OHA A;  4A8K A;  4JV2 A;  4FVM A;  2K3K A;  4P75 A;  3HCX A;  2VC0 A;  1RWN B;  1RJJ A;  4F0H A;  5KG6 A;  3DC2 A;  4ZCK A;  3V5R A;  4FYD A;  3DLG A;  2KN4 A;  2WVB A;  1YDL A;  3NXZ A;  2W1B A;  4QIF A;  2RUS A;  1DFD A;  1NJW A;  4X4R A;  2ZWO A;  4FF4 A;  3C8Y A;  2HBQ B;  3JXO A;  4LSL A;  2PFF B;  4XTT A;  5DQI A;  3MMC A;  2CPF A;  4HT7 A;  4ZVS B;  2HNZ A;  3Q89 A;  1IWG A;  3UVJ A;  2U2F A;  1S99 A;  2Q43 A;  1RCX B;  2OPQ A;  2P9E A;  2NSB A;  4IFY B;  1NUE A;  2ZZM A;  4CLT A;  1NK9 A;  1RAO A;  5L1L A;  3RZA A;  1VQ6 S;  3HVW A;  1PC5 A;  3ZC4 A;  1UW9 A;  1NDC A;  3IRX B;  2OD6 A;  3P5B P;  1F9F A;  3P49 B;  2FLO A;  5JXS A;  3WBZ A;  1RHR B;  4I64 A;  4ILR A;  4IDK B;  1XJW B;  2HRU A;  4P9S A;  2HFN A;  4NLT A;  4TU8 A;  5L38 A;  3TZZ A;  1N6Q B;  2ZH2 A;  1SH3 A;  3FFI B;  4MKB A;  1FVQ A;  2QSF A;  3N0V A;  4KB7 A;  2JSX A;  2WON A;  3DMJ B;  5C2C A;  1RBL A;  5KFJ A;  4I4B A;  4DV3 J;  1QSS A;  4ZVE A;  3KLH A;  1FD8 A;  2YNG A;  2BZ2 A;  4QIE A;  2HWT A;  4HH1 A;  4U9R A;  4WZQ A;  4NZ7 A;  3ISN D;  4X4Q A;  2QL5 B;  3JSM B;  3MUM P;  3VQS A;  4ICL B;  2VPX B;  3PHT A;  1JLA B;  2Y3Y A;  3AFG A;  4DN9 A;  4CIO A;  2UVU A;  4PG5 A;  5KG3 A;  1T0T V;  4K5S A;  5J2N A;  1PYO B;  3HM9 A;  5IV4 A;  4DL5 A;  4OHY A;  3J81 Y;  2FLL A;  3HT0 A;  1S76 D;  2B4U A;  3C3L A;  1Y5I B;  1VS3 A;  4LJM A;  3B78 A;  2QL9 B;  2AJ0 A;  2FJE B;  4Q0B B;  1QVG R;  2FJD B;  3OJU A;  4ECS A;  1S1W B;  3LAK A;  1DUR A;  2XC9 A;  1IXK A;  4LFC J;  1ZM9 A;  4KSE B;  2QC3 A;  2FLP A;  1IBM F;  5L1K A;  2F65 A;  2LQJ A;  2I5J B;  1YHQ S;  3C14 A;  4X65 F;  1UAW A;  2GVD B;  3CCL S;  3FQK A;  1UEV A;  2MZ1 A;  3MMB B;  5IS2 A;  4V19 X;  3N28 A;  3PX6 A;  2GW8 A;  2C2M B;  3FUY A;  3RRG A;  4MKV A;  1FD2 A;  3MUR P;  4PG8 A;  2QMU B;  4P52 A;  3V4I A;  1FX4 A;  4JI6 F;  1P1L A;  2LQ8 A;  2A6O A;  3QPI A;  4BS2 A;  1ZAV A;  2ZBI A;  2CDQ A;  4ZVT B;  2WZ1 A;  2HMI A;  2R7Q A;  2QL7 B;  3VHQ A;  1FNM A;  3F0N A;  4OYB A;  5CD4 H;  2NXU A;  1F60 B;  2MQ8 A;  2A2D A;  2ZVI A;  1VQ9 S;  3TA2 A;  1JLG B;  3C15 B;  2IRY A;  3R7N B;  2K1R A;  4BDP A;  2E9Z A;  2CWX A;  3QLH A;  3MR7 A;  3DRS A;  2CAD A;  1MNE A;  5HBM B;  2HHV A;  2NXC A;  1TKX B;  2V4J B;  3ET6 A;  3HX9 A;  4K4Y A;  4OYW A;  2HFS A;  3O44 A;  5MAO A;  3BO2 A;  3G4S S;  4CQ1 A;  2FIU A;  4RUB A;  1FKP A;  1Y4Z B;  1R27 B;  3AT1 B;  4TYA A;  5K5M A;  1LKZ A;  3QJP A;  3GFZ A;  3DOK A;  5CHC B;  4HI1 A;  3RU0 A;  1TKT B;  4ZPD A;  4YN3 B;  4ZPA A;  1VBZ A;  2JEG A;  3IGV A;  1FI4 A;  1UW4 A;  5LMN F;  2V94 A;  1E6V A;  3EVM A;  4ZMM A;  1FRK A;  2CQ1 A;  3KJN B;  3HO1 A;  3IR6 B;  2WB4 A;  2JLF A;  5GMK a;  1Z1Z A;  2AX1 A;  2KM8 B;  1ZAX A;  2MQL A;  2AJ4 A;  5G0R B;  2IRU A;  4CT9 A;  1SKW A;  2DGU A;  2N4D A;  2DY9 A;  2J8S A;  3M7V A;  3UFC X;  4CP5 A;  2MZQ A;  1KOO A;  1FRJ A;  2BAC A;  2VG7 B;  4WP9 A;  1REG X;  4AQY F;  3U1M A;  1RZM A;  2GGP B;  4MKA A;  3D1Q A;  1XQI A;  2VON A;  3MCN A;  2H5E A;  4TY9 A;  4ZPC A;  3QGG A;  2BUN A;  2ROG A;  3ETO A;  2DRB A;  2BJ9 A;  3RBX A;  4JI0 F;  2DNR A;  2QG9 B;  3PR5 B;  3I32 A;  1T94 A;  1N34 F;  3CCE S;  2OFG X;  1NRK A;  2BX6 A;  1S7H A;  1Y5N B;  3IRX A;  1Y0H A;  1U1R A;  4DR7 J;  3QIP B;  1VIO A;  2RQK A;  2IM1 A;  2R8G A;  3OBI A;  3TZW A;  4LF7 J;  3MMJ A;  4M5D A;  4WIQ A;  2XMA A;  4FS2 A;  2BJ8 A;  3FFI A;  5E3Q A;  2VKZ G;  3TAM B;  4OHW A;  3JQJ A;  1HMV A;  2E66 A;  5F8G A;  1SIZ A;  3DMJ A;  2QE5 A;  1FCA A;  4U7U K;  4E0D A;  3WX8 A;  2BE9 B;  1OWX A;  4R5P B;  1WDD A;  1KVK A;  3V4M A;  1UVK A;  2HVD A;  4M94 A;  3ZZO A;  2L9N A;  2O5D A;  5B0F A;  5J1E A;  4F0K A;  5B08 A;  2HRY A;  3JSM A;  4DPT A;  1T8E A;  4ICL A;  2CIM A;  2D3U A;  3IRW P;  1JLA A;  4BLG A;  2RT3 A;  5D4P A;  4WP3 A;  5K8N A;  4WU3 A;  3EPI A;  3EXC X;  4ZLN A;  2W7P A;  2XY6 A;  1PIL A;  4URG A;  1WAC A;  2LA6 A;  3HVT B;  2FC9 A;  2GQ2 A;  4QR1 A;  1HBN A;  3QZ8 A;  5DLF A;  1S1W A;  3CJQ A;  4ANC A;  1M5K C;  1MRO A;  3OLB A;  4KGK A;  3KHR A;  2YWF A;  3C6U A;  4F4X A;  4YDD B;  3OLA A;  2DNP A;  1WG4 A;  3MTK A;  3U1N A;  2D3O R;  2BXJ A;  2ZBC A;  4QWD A;  2J5A A;  5GVQ A;  3FJ2 A;  4GC7 A;  3IGN A;  2CWK A;  5DG8 A;  4XK8 C;  3MMB A;  1PGZ A;  1ZTT A;  4USM A;  4J5O A;  4O23 A;  2VL1 A;  2DXF A;  1SPB P;  3SYZ A;  3ETM A;  4NLG A;  4LFA J;  1H73 A;  2LXF A;  4X4O A;  2ZH5 A;  3IBC B;  1VQ8 S;  2HIY A;  1N32 F;  3M30 A;  5LXY A;  3H5U A;  2PDA A;  2OUG A;  5KFE A;  1FVS A;  4ELV A;  4F02 A;  4C8O A;  3MM9 B;  1XMB A;  2H65 B;  5C2G A;  3OUY B;  5AJ3 J;  2IDE A;  1G7C B;  3GP9 A;  1PJ6 A;  4DL6 A;  1FE0 A;  2RHS B;  2W24 A;  1I5O B;  3KLE B;  4P71 A;  4CNY A;  3G2X A;  3W9J A;  2V8H A;  3SDE B;  3MR3 A;  2ZHB A;  4RW4 B;  1CJK B;  2MXY A;  1JLG A;  3C15 A;  4RBU A;  4DR6 J;  4B3O B;  2V9W A;  1MMN A;  3TQE A;  2XMJ A;  4Z2X A;  2JZ5 A;  5J2M B;  4DR4 F;  1TKX A;  2LYV A;  1YJ7 A;  4ELT A;  4F67 A;  2FY1 A;  4F0M A;  2BKP A;  3CCV S;  4LBH A;  2N7Y A;  3LWL A;  1PO6 A;  4FF2 A;  5C42 B;  1RP5 A;  3GJT B;  3FZB A;  3ZTO A;  2FPH X;  2OEJ A;  3N4W A;  4W98 A;  1TKT A;  1BXN A;  4KKO B;  1WI6 A;  3M9O B;  3R6L B;  1HNI A;  3NL0 A;  4UOC A;  1B64 A;  4ZJL A;  1KHW A;  2EFG A;  4C98 A;  2R8I A;  4IQX A;  3J7Z T;  1DHM A;  2DGV A;  2HS0 A;  2GCF A;  3WIU A;  3FQL A;  5A8W B;  2AP6 A;  2HG4 A;  4C4W A;  3CJR A;  3GTY X;  5GME A;  2ZD1 A;  3BGF A;  3AOC A;  1EX8 A;  4CLF A;  2RDI A;  4K4S A;  2C3M A;  5G0R A;  2ZUA A;  2YKP A;  4DF4 A;  2IJF A;  2XNR A;  2DBB A;  3M6U A;  3HHL D;  1UEK A;  3HDS A;  2CQP A;  2H4Y B;  2YWH A;  3NLC A;  1B99 A;  3SZ2 A;  2VG7 A;  4ECX A;  4JI1 F;  3GYG A;  3IM9 A;  2BVZ A;  1AW0 A;  3OTO J;  4FPI A;  3MAH A;  2RIJ A;  4N5S A;  5I3U A;  4KO0 B;  2KB2 A;  2ZH7 A;  1IKY B;  2AV5 A;  1GH8 A;  3GR0 A;  2YBV A;  2DTJ A;  5IT0 A;  5A6P A;  3QIP A;  1HW8 A;  4LVO P;  3TR5 A;  4JV5 F;  3IG1 B;  1S0V A;  1GMW D;  1FWL A;  4C8M A;  3R5B A;  3N79 A;  1W25 A;  1JJH A;  3EIC A;  2JEI A;  3IR5 B;  3TAM A;  4ETX A;  5KFP A;  1R8B A;  4C97 A;  1R3N A;  4R5P A;  1W2B R;  4JI3 J;  5E5N A;  2YY3 A;  2J9C A;  2GVZ A;  2OPR B;  2VBY A;  3HT3 A;  1J5O B;  3TAP A;  1S4F A;  4JOU A;  2PD1 A;  4CCH A;  3L09 A;  3H2L A;  4O3N A;  2LXI A;  1N48 A;  1TU0 B;  2GNK A;  1U8S A;  1D0E A;  1S6U A;  1Q81 T;  1MWQ A;  2CXE A;  5EN1 A;  1D09 B;  4OYI A;  3HVT A;  2KFY A;  2DKO B;  3FKB A;  5HO4 A;  3GG0 A;  5THW A;  4OHV A;  1KRP A;  4X65 J;  1S59 A;  1Y3J A;  1QLN A;  4U95 A;  1Q79 A;  3QBC A;  2DEI A;  2RAQ A;  3A3O B;  2F9D A;  4J9N A;  3GYN A;  1LXN A;  1YBU A;  1U24 A;  2HGN A;  1WEL A;  1ACM B;  3O8W A;  4FN5 A;  1KWM A;  1TL1 B;  4ZVF A;  2MY8 A;  3H98 A;  4RBV A;  4CO1 A;  4LRA A;  1LWC B;  1L3V A;  1FRM A;  5JJB A;  2CPD A;  2HS4 A;  2QA2 A;  4RUH A;  3NG8 A;  4ZIV A;  3CJK A;  2XLJ A;  2UUC F;  1EJ7 L;  1T9V A;  1RWO B;  1VOM A;  3CJS A;  2BE2 B;  1GAO A;  1T3O A;  1LK5 A;  4JBC A;  2DNK A;  3CJ5 A;  5D3G B;  3EVO A;  3GB0 A;  4M95 A;  1U26 A;  1IKV A;  3MR5 A;  3I0S B;  4X64 F;  2DY1 A;  3MM9 A;  4PUO B;  3OUY A;  1HW9 A;  2WVD A;  4QBU A;  1D9A A;  1YBA A;  1X0F A;  5F8H A;  1NKB A;  1NHV A;  2EK1 A;  2JNJ A;  3ZNJ 1;  5F3Z A;  3SDE A;  2KYX A;  4RW4 A;  3CE8 A;  2SXL A;  2XLK A;  2CQ4 A;  4N7T A;  1CJK A;  4Y2M A;  2CFX A;  1YJ9 S;  4B3O A;  4FKY A;  2R2T A;  4MK7 A;  4AL5 A;  1C0T B;  3MEE B;  4EO6 A;  3OXL A;  4DCJ B;  2HRT A;  2B9W A;  1WC5 A;  5J2M A;  1N36 J;  5HAO A;  3H5X A;  1HD0 A;  4Z7Y A;  2JWN A;  2E9R X;  4C48 A;  3CCT A;  4HVZ A;  1WG5 A;  2CPY A;  1REV B;  2VF3 A;  5F8J A;  1J5E F;  2KRB A;  5KG0 A;  4FNI A;  1JX4 A;  2AMC B;  2XZT B;  1RTI A;  2J0W A;  3M8Y A;  2UXC F;  4KKO A;  1PYT A;  1OYD A;  1TL7 B;  3TP2 A;  1GMV A;  1NPR A;  2M5Y A;  2DEJ A;  2K2P A;  3PM9 A;  2YXL A;  3W64 A;  3G86 A;  4QU6 A;  1QDU B;  5KG2 A;  3KLI A;  2KG0 A;  3VAL A;  2OP5 A;  5A8W A;  2HVE A;  3CJ0 A;  4NRU A;  1U2F A;  2C2Z B;  3D2W A;  4LF1 A;  1QY7 A;  4PG7 A;  3F44 A;  5KFR A;  5AXM A;  3SCI E;  2Y9H A;  2QT7 A;  4ECQ A;  5FDL B;  3EDR B;  1FDD A;  2M52 A;  4AQY J;  2J7U A;  4MFB B;  1FXR A;  2NCK L;  1EKS A;  2C2K B;  3M05 A;  4JI4 F;  1UVN A;  1P27 B;  2LQ9 A;  2WOM B;  4U96 A;  3HVR A;  4U8V A;  2A1B A;  5DM6 Q;  1N34 J;  2HHH F;  5DZ7 A;  2DNQ A;  1N4L A;  3M8Z A;  3ZXW A;  1CJU B;  2VZ9 A;  3M1V B;  4DSL A;  4TY8 A;  2I6W A;  1GMW A;  3ZNU A;  1IKY A;  4E98 A;  5FJ4 A;  4G1Q B;  4GO7 X;  3SV4 A;  3CJ2 A;  3MEK A;  3H25 A;  5ETP A;  3O3L A;  4WP8 A;  2OPS B;  4ES1 A;  4XO0 A;  3RW7 A;  2FDN A;  3IG1 A;  5ETO A;  4RJV A;  1P9Q C;  2DR9 A;  1M5O C;  5CAB A;  4WFB Q;  1OMS A;  4NLQ A;  3BJY A;  2VU5 A;  3BH7 B;  4KHP F;  5I3P A;  1S48 A;  3PYD A;  2FVS A;  4O3R A;  4OJ1 A;  4ZJO A;  1ZET A;  2HHS A;  2XG8 A;  4ZCL A; 
#chains in the Genus database with same CATH homology
 1FFW B;  1EAY C;  2LP4 A;  1FFS B;  1A0O B;  1FWP A;  1FFG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...