1FFGB

Chey-binding domain of chea in complex with chey at 2.1 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Further insights into the mechanism of function of the response regulator CheY from crystallographic studies of the CheY--CheA(124--257) complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1ffgB00
2LP4A 1A0OB 1FWPA 1FFSB 1EAYC 1FFGB 1FFWB
chains in the Genus database with same CATH superfamily
4GVBA 1S79A 2RIJA 3DMJB 2KVQE 1FWKA 4OX8A 5I42B 4EBEA 2FJVA 3I5CA 2M5YA 2QL5B 4YQWA 1GK8A 3FBCA 3T3FA 1XWLA 4LF2A 2GJIA 3NWRA 2E5HA 3MOZA 2APOA 3C6UB 5ETOA 2G2OA 4PG6A 3NL0A 4JI5J 1QM9A 3Q86A 3T1HJ 1NAQA 4TKTA 4LFBF 4G1QA 2WONA 3DDKA 4ZK7M 1F9HA 4L3KA 3ZZZA 4EEYA 3TEHB 2XBPA 2KZMA 1R8CA 1UA0A 1FX2A 2JC1A 4X62J 3P4UB 4RL1A 1QE1A 4Y2CA 3LH2S 3W60A 1VQ4S 3V6DB 1VQPS 4NLSA 1X5OA 4X65J 5K8OA 1N34F 4PZVA 2JRSA 4QPTA 5E33A 4A46A 3UO0A 1XR7A 3AD8C 2R9LA 3OW2R 3QRRA 2NQPA 4YY3J 4E98A 1C1CB 4CYUB 3PW5A 1D3WA 2Z2MA 4DSLA 5F9NA 3CD0A 4LVOP 5LXYA 1WOSA 2HVZA 5ADZA 4RUBA 1HBOA 3B4DA 4Q45A 4YOEA 2IJNA 3C3LA 1RTDB 1WUUA 3BKUA 4EK2A 3Q8QB 1XK8A 3CJKB 5BYSA 1C0TA 3MPVA 3F44A 2OAUA 3M2VB 5ETQA 5EWEA 4Q0BB 2FQQB 2X1FA 1OPZA 1Q0NA 1RWUA 2J6SA 4WYLA 4FS1A 3M32B 4LVNP 1OMSA 4GC6A 2LEBA 1WOOA 1MWYA 1RZMA 1ZAXA 4KYZA 2ZM6F 3FCHA 1AFJA 2DNPA 2DY9A 3LAMA 1F9EB 1B99A 2I38A 2ZH8A 2AV5A 3WQPA 4O3SA 3J7Z5 1F0XA 2DXEA 5J2MB 3FFIA 2OUGA 3BQ2A 2DVIA 2YWFA 1O51A 1TL4A 4CT8A 2QA1A 4KGKA 2RRNA 3DLGA 3VQTA 2KN4A 2CJAA 5HATA 4M5IA 4ZLPA 3QZ7A 2XZWA 1U48A 4K4ZA 1RUSA 1HWUA 1MG7A 1X4AA 2G2ZA 3BDEA 3IGNA 4U6PA 1U2CA 2LXIA 3R6GB 4P6QA 1HPZA 1NPKA 3DCAA 3CO0P 5JVGQ 4DV5J 3SI8A 2MKCA 3RRGA 4HDHA 2BKOA 4BDPA 2ZC4A 3MCNA 5B7WA 3M9NB 2WRMA 1JJHA 2H4WB 1U2FA 1VRTB 3LP0B 1S1VA 3R9LA 1BQXA 3TZYA 1PG5B 3J7YI 3KLEA 1SJQA 5J2QA 3PHTA 1NK4A 1R8PA 1S7IA 2AF6A 2PE8A 3R5DA 3V81A 5AXMA 4LBHA 1HNZF 1W2BR 2GVZB 2OPSA 2Y0BB 4H4MB 4LR7A 4O4GA 1PIEA 3TVKA 1X5TA 3LWLA 2B6AB 1IJEB 2CJYB 5T7LB 5GAGU 1XMOF 2QSWA 3MAQA 4JI0J 5DDPC 2ZH2A 3ENVA 4NYPA 1S6PA 1EQ0A 3QJPA 2DNQA 2XNRA 4U8YA 2IAJB 3HVTB 3LF0A 2YNHA 3V5RA 2CZ9A 2BJDA 2DNMA 3KLIB 2XWXA 3U1NA 5KFWA 1UZDA 1OYDA 2ZITA 1DARA 4ID5B 1VRQC 4DSFA 3QAEA 1R8HA 3J80Y 2BQRA 2VFUA 1Y00A 3LPEA 1IBMJ 4UOHA 1IM4A 1BQNB 5AE3A 4DQSA 3ULHA 1S9GA 5CZXA 1VC0A 3D4JA 2ZKUA 1NU4A 3LOUA 3KDOA 3OR2B 4YFUA 2PN6A 1HR0F 2DR9A 1LW0A 2CQDA 4X4RA 1PJ5A 4F0HA 5IWAF 1GX5A 2VV5A 1PILA 2R7WA 5KFYA 3HFZB 4TQRA 1IQZA 2KG0A 3PXGa 4QYZK 1KLMA 2H51B 1EQMA 2OHDA 3QNWB 1R0AB 1DQAA 2RE1A 4OJ3A 2OP5A 4UOCA 1RWOB 2OPPB 2H9ZA 5GAHI 3K8WA 1R0AA 2QL7B 1Q79A 2RSQA 2MB0B 2AWZA 3IG1B 4WK1A 4JUZA 2XMWA 3MM8B 2CVEA 1M1KT 3NS7B 1GXTA 2FLPA 4WE1B 2XNQA 2RQKA 3VR1A 1UJ6A 1BD6A 2YKMA 1QDUB 2J0XA 2VASA 3MPUB 3ZTSA 4CI0B 4USMA 1FJGF 4N8OA 2CQ3A 5IXUA 1JNZB 3RAQA 3OVSA 3EGWB 1YG0A 3PHEA 1RU1A 1NHVA 2ZDPA 5D8HB 4LF8F 1HFEL 2KM8B 3PW4A 1HNWJ 3J7YU 1LQ9A 4WPAA 1JJ4A 1U47A 2KT2A 4C98A 5IT4A 5DQGA 4F2RA 3EWGA 5KG2A 2V8GA 2QTWA 5DJBA 4O3NA 3HHKA 4WFYA 4YUDA 5T14A 3TUZC 1NCLA 2VG5A 3PFEA 1HWIA 3TQ1A 5J1EB 1NK9A 1NB2A 1JLEB 2DGTA 4I0WA 3Q23A 2QO3A 4C11B 1KSPA 5FDLB 5LSOA 3OUYA 2DGSA 4CLPA 3OR1B 3D67A 2UXBJ 3R5CA 2HBRB 3RAMA 3UVJA 2ZJRQ 1FTRA 1KP6A 2CJQA 3QSYB 3NY0A 3VAMA 2DGUA 3UDLA 5KFLA 1F5AA 5EHHA 4ID8A 4DL3A 4PG4A 1ZM3A 4DQQA 4ZP7A 1WKKA 2BACA 2GQCA 2RUSA 1SIZA 2V34A 1D9DA 2LCWA 2HRTA 3BR8A 3HHDA 3BGRB 3T19A 2F8HA 3WDOA 3HHLD 3ZXWA 1DRZA 2DB1A 3KHHA 2FUG9 1S6UA 1RDRA 4DFPA 1BC6A 1OS5A 2CADA 2C2RA 4NLUA 1CJTA 2P6SA 1NNDA 3MM9A 1U26A 2MKYA 1V5VA 3T6JA 3UDVA 1VK8A 1KC8T 1G1XA 4P2MA 5IT9U 4ZIWA 3OL9A 2KT5A 3AAWB 4X65F 4N41A 1RTHA 2E9RX 3RBEA 2UUAJ 1RA7A 1YRXA 1D8YA 4JV5J 2W9BA 2VPZB 4KR0B 4F67A 1SJRA 1FJ7A 3EXCX 3TW0A 4V19X 4OHYA 3TZZA 1YJ9S 1IN0A 5I3UA 2XO7A 3JXOA 3U27A 3ZZUA 1HQUB 1U25A 1VGYA 2YWHA 3ZC4A 1RT5A 3QLHB 4AXJA 2IFXA 1IKYB 2Q1LA 2HQFA 1FDBA 2OPQA 3M6WA 2WW4A 3MEEA 2GAGC 4FPIA 4PXCA 1OWXA 4JI7J 1JLAA 3OFEA 4BLGA 1SH0A 4CDIA 1JIHA 3MPYA 4WIQA 3FMWA 5HQMA 2WK4A 3WC2A 2CXEA 3R6LB 1VLOA 2W2NP 2V4QA 3QIPA 3LWMA 3L09A 4MH8A 4F3QA 3HJFA 3D1QA 4NI2B 3HSZA 2AJQA 4H4KA 2G2YA 4ILLA 2L3MA 3KJQB 3WHIA 2V68A 3AD7C 3DGPA 1VI7A 3IBCB 5BR8F 4J9OA 2FJAB 1S6PB 4FNHA 2RT3A 4UY8T 2RMLA 2Z30B 4TU9A 1OQ3A 3DGPB 2B8QA 4K7QA 4CLTA 4WJBA 4ICLA 5J2PB 3AA8A 2VKZG 1VQOS 1YJVA 2QN6B 5K14B 5HJXA 1WTBA 3A8JA 3FFIB 3DLHA 5IV3A 4OZJA 2HFZA 5D4OA 4IKAA 3IM9A 1EX8A 4PCQA 2D3ZA 2DEJA 3FSYA 3K5MA 3CULA 4PXDA 1V9OA 2DNGA 2IA0A 1B7FA 1NK8A 3EXYA 5M2RA 2W1BA 2ERRA 3TJ9A 2IBOA 2W7OA 1GEHA 1BUXA 1DLOA 1RBOB 4RWXA 4LBPA 2CFXA 3Q8VA 4W92B 1K1SA 3W2WA 3CCMS 3HT0A 2VJVA 4KSEB 4AQYJ 1X9WA 2DPIA 5CABA 2XHCA 2HMIA 3ILJA 4OJGA 2A6OA 4XDCA 2IMWP 4PXBA 5F41A 2UUCF 3AOBA 8RUCA 4IUFA 5LMUJ 4DR3J 2DIVA 1HBMB 3GU0A 3CIZA 3GIKA 2EK1A 4TY8B 1HA1A 4QYZJ 2W7PA 4DV2J 3KJNB 3NG8A 3HZGA 4I4BA 1GMVA 5A8RB 4DV0J 2X3DA 1F2GA 3M8QA 2RHQB 1ZTWA 2HQ3A 2HFUA 4O0IA 1G7CB 2DJWA 2E7WA 4RO0A 1WELA 4FYVB 1FEEA 2IYIA 4ITSA 3ZZYA 3GJQB 1FTCA 1VYAA 3FRZA 3P5TL 5DG9A 4U67Q 4L74A 2ZBIA 2GGPB 1PAEX 2JEFA 2EKNA 1KOOA 1NO8A 4YR0A 4C0HA 2MQQA 1BQNA 4QIGA 5KFAA 2ABYA 2PEBA 2CJ9A 3M1VA 2VQEF 3POTA 1NKEA 4OX6A 2Z57B 4CQ1A 3DHWC 1YVFA 1SV5B 4ECZA 1S99A 3C14B 4ZP9A 5HAOA 5KFRA 4RWWA 5EWFA 3M8RA 2E1CA 1VDHA 3W1YC 3LGMA 3KLHB 4LF4F 1KVKA 3FVYA 1XNRF 4IH7A 1U8WA 5LM7E 2ZHOA 3BO4A 1O5JA 1NBEB 1R31A 1FRHA 1KQKA 5D4LA 3KLVA 2H48B 3N5BA 3PEHA 4JI1J 2VA2A 3X1LB 4E8UA 1UPPA 4PPDA 5IS2A 3IP0A 5KTQA 4Y00A 1AYEA 3DGVA 3OPKA 3KG0A 4ZN1A 1KWMA 2B7CB 4QR0A 2WSFC 1T8EA 1RQ0A 1Z2LA 4KKOB 5DGAA 1B7YB 3BBFA 5K20B 1LNQA 3MEDA 1UVKA 1NEEA 4KGMA 5HANA 3BSNA 1YBAA 1ZZFA 1SPBP 2XGPA 1LXNA 4WWSA 4MKVA 3UDCA 4DPWA 1H2TZ 1N5SA 1YK9A 1JLQB 3BKTA 5C24A 3R27A 3CGIA 3NXZA 4RNNA 3KHRA 4A8QA 1N36J 1YKWA 1RA6A 1RE1B 2HVDA 3CSKA 3DOKA 2VG7B 4KC5A 1MMLA 5L39A 2OH2A 3N4WA 2ZH5A 3HO1A 4WZMA 5DO2A 1H0HB 2MQLA 2IRUA 2ACYA 2IVFB 2X1AA 4U8VA 3MFHA 1ZTTA 4B3RJ 3QGIA 2KKHA 4IH6A 4B08A 2CNNB 2RS8A 1VQ9S 1S6QB 1C1BA 3SCKE 1RT5B 4B9MA 3QGGA 1FCAA 4WZQA 1WJ9A 2W9CB 4DV5F 1RT4B 3F73A 4DCJB 1IBLJ 4ZVSB 2EBEA 2MXYA 1TAQA 2NPIA 2BM0A 2KB2A 3EJMA 4DPOA 2PO4A 1KEKA 4QWEA 3VAHA 1VRUB 2ZE2A 2E5LF 5GADI 1JKHB 1RGVA 2CQPA 4PQUA 2EG1A 1YRTA 4ED7A 3VZIA 2C2ZB 1TL7A 2F4FA 3F56A 4USKA 4ED0A 3UD3P 4B3OB 4OZ5A 4XIUA 4O4RA 3AOAA 1YZ7A 5DDRC 2RAQA 4FN5A 4RW4A 1UTAA 2E5LJ 2R2RA 3IWXA 1VIXA 3QYYA 4LSLA 1X9MA 3VGTA 4Q8FA 2DGQA 1QY7A 5KG0A 4RW4B 4B3SJ 4WTOB 4USJC 3M8WA 3HT3A 3IAM9 3TRGA 1T02A 2X1GA 4PRFA 2UVVA 2MTLA 3GFYA 3GONA 4DPUA 3G2XA 1H74A 4P10A 1F6TA 3N5FA 4ZVEA 1TL1A 3SDEB 3WZ0A 1QSLA 2CJBA 4N8NA 4OJ1A 3WX4A 1K47A 3Q2SC 4HDGA 3AA9A 2VPYB 4I2QA 4JV0A 5CH7B 4F3OA 3A4TA 3DNCA 1CULB 3H4DA 4MK9A 1M5SA 2MJUA 3ZTQA 1HQUA 1GQEA 3CWJA 3KMQA 2H4YB 1YGYA 3RB3A 2CJXB 3A3NB 5LOQA 2QA4S 1AUDA 4U7UD 1ZAWA 4ZCKA 2Q43A 3DLJA 1TFYA 3OXFA 1C4CA 2AIRB 2F8EX 4F4AA 2X7IA 1N34J 3MWBA 3UPFA 4XPCA 2NZ4A 1SUQA 1UW4A 4Q2LA 4QOTA 2BVZA 2DHGA 4IYQA 3WBZA 5A6PA 2JWNA 4C97A 2OTJS 4HL9A 3M8SA 2PI4A 1QJHA 2KFZA 4BHQA 4TY9A 3GYXB 1JLGB 1Q95G 4RW8B 5D0EA 4OYBA 2FHOB 1F3VA 5H9FJ 3UN3A 2DRBA 2WB1D 2FVQA 2M88A 4CH0S 3ETMA 3NNAA 5D6GA 3ILIA 2XGQA 1U2RA 1ITPA 1WD6A 1WHXA 2BE7D 4NCGB 1BGXT 2B4VA 3OHAA 3K59A 3CD6S 4ICLB 1NK0A 4ZP8A 2ROGA 3GSIA 3NWGA 1FKPB 5GAEU 2VIHA 1RHMB 4I7FB 1JJ2R 4CLZA 2QL9B 4C8YA 2V63A 1Y7PA 3NCQA 1ZZNA 5ITHA 3MUVP 3LGHA 4NX9A 3PJ9A 2MYFA 2XMUA 2FZGB 5DDQC 4F36A 3E01B 4U96A 3MXHP 4E0DA 5A8KB 3CT9A 4DOZA 2R7UA 1SV5A 1NSQA 2QLFB 3UCUP 4G1IA 5IC4B 2NXEA 3TAMA 2VB6A 2YKNA 2AD9A 2FLNA 4LF9F 2FIUA 4LRCA 3R7NB 3IMQJ 2C2NA 5LSLA 5A2QU 1B0TA 2MKJA 1OPIA 3M30A 1RWVB 1EETA 4UUWA 1RABB 2J0QD 3CC7S 3LTOA 3CCVS 1QUVA 3MZIA 4FXWA 3TVZA 1QE1B 3OV7A 4EBDA 2CQ1A 2OO4A 4IQMA 3PR4A 1XNRJ 3GWCA 1VBZA 2UP1A 1HNXJ 3BKFA 4DWIA 2HBQB 2BXJA 4QR1A 2J7WA 3R97A 4PQAA 4CT9A 4YEAA 4DXLA 4QIVA 3GB0A 4JV1A 1U09A 1UMJA 4FXVA 4OJHA 2QA2A 1SC6A 1RBLA 4V1Ak 2IRXA 3PYDA 4ANDA 1WEYA 3BSAA 2A18A 2ZBPA 1SJ1A 2YNIB 3M8QB 4LQ9A 4P9SA 5IC6B 2E1PA 5DQHA 5FLXY 4JV2A 3H98A 4KE5A 4X4NA 4FYDA 1CQNA 5HMYA 4DDFA 3GIRA 1JLBA 1PCAA 2HHQA 4BBYA 2GHPA 2DBBA 3K2YA 3DYAB 4OZ1A 1MNEA 3E51A 4ECUA 1RTDA 3W9HA 3DOMA 1SQGA 4OZ2A 1ZPVA 4KFBA 5F8HA 4RUAA 4NRUA 2L9WA 4KGVB 5B0AA 3KOAA 4IFVB 2YQ0A 4LR9A 4TU7A 2ZVIA 4PWUA 2RDIA 3QO9A 3R5BA 2Q3PA 4QW8A 3SCIE 3T9NA 3RTVA 4ED5A 1N5VA 4IFVA 2MQPA 3OFHA 2O3DA 3QFWA 4ANEA 3HMJG 2OEJA 4NLQA 5ETSA 4YY3F 4AL7A 2H5JB 3TJAA 2YQ3A 2K3IA 1NMEB 3DDNA 3VAGA 1J5EJ 1UWAA 4DR7F 2LXUA 3CCJS 2V8HA 2HS0A 4K2JA 2XI2A 2QMWA 4OYAA 5J2MA 3GLJA 5FJ4A 2G9OA 1VC6A 3CIMA 3ITHA 3JQKA 3QWPA 3FCVA 8AT1B 3MURP 1T03B 4B9TA 4YR2A 1M1HA 4LMZA 1VQ6S 3PFOA 1YZ6A 3A12A 3CC4S 4L75A 2MZTA 5LJ5Y 1N52B 2BJ1A 3P6YC 2RH3A 2UU9F 2HQCA 1CBKA 2HPUA 2OELA 3KUGA 3MCSA 3RRHA 3KHLA 4JI1F 4OZ0A 3QT5A 2K2PA 4LQ3A 1YJNS 4NLYA 4LF9J 4OZNA 3OHBA 5C24B 1KHWA 2NCKL 1O6XA 4USIA 4YDXA 1K73T 4R5PA 3UFCX 1MN9A 3I0RB 4CO3A 1HQ2A 3GG1A 1RU2A 4EGLA 3BN4A 4DUZF 2R7TA 4UUXA 3ZTRA 1A0OB 2B6AA 1B70B 1WHYA 4ELUA 2JH3A 2HNZA 4GC7A 4NA2A 4OL8A 2LEPA 3FRYA 4YHHF 4KRWA 1YLXA 3CJRA 3EX7B 1FK9A 4F8RA 1N6QA 1FRKA 2FVCA 1ROFA 4ATNA 1KNZA 1N88A 5EUHA 2QIFA 4YB6A 2G4BA 1X4CA 1X4FA 4GO5X 5BXIA 2N4DA 1MWZA 2MY7A 4TLQA 1IM6A 1WG1A 5BJRA 3AB2B 1DQ9A 4KQZA 1REVB 3ZZTA 4C8ZA 5ETNA 3JS9A 4DV3J 2HG4A 4PYDA 1CJVA 2J6UA 2HK2A 1VQYA 3LQVA 4DU8A 4DL2A 2KH9A 5E3QA 5KG1A 1HNVA 3THVA 1XNQJ 2FC8A 5LMUF 4DR3F 3BSCA 5CYMA 3SBMA 5B08A 1KFDA 4FF4A 4MK8A 3UN5A 2D7SA 4HVZA 5E3RA 5K8NA 4K5SA 4MT1A 4USWA 2HS3A 2FVPA 3I96A 2E1MC 4IFYA 4DFMA 2HWIA 1U6ZA 5LL6d 4DLGA 2HHXA 1JLFA 1NSAA 2JLEA 2DTJA 2IM2A 4WYWA 2DR6A 2P9CA 5KFUA 2HNYA 5HROB 1K1QA 1S97A 5ETTA 2JVRA 3RGIA 2FD2A 4HACB 4HHHA 5GAGI 2BE2B 3PG9A 3BGFA 5A8RA 5F8GA 3N6NA 1UVMA 3CCQS 1RJJA 2J8AA 3NBPB 4F4WA 1VOMA 5T7LA 2AYEA 3F41A 5A8KA 3BB5A 4EMDA 1FVQA 5HL7Q 2AX1A 3VZHA 3MR3A 2DGWA 4JI4J 4F2SA 1WHWA 1YJUA 1UA1A 3IRXB 1L3VA 2V9KA 3DOLB 4ZLJA 3OJSA 3T9ZA 2H3EB 3L3CA 2RJZA 2AQ4A 2DEIA 2A0FB 2QGFB 4FVMA 4EU0A 4X4OA 2Y1JA 5KFHA 3H5XA 1CS4A 4XAKA 1TQLA 2HBYB 2DH7A 3IRWP 3BJYA 1JLEA 4N56A 2F9DA 3ONQA 4N47A 3BGOP 4UQTA 4JI6F 3SQOP 3Q22A 1T05A 3BPDA 4MKYA 3PW2A 1SCJB 3OR2A 1U49A 1SL2A 3M6UA 1HWJA 1NM2A 1YJ7A 1NK5A 1OJ4A 1WSRA 2OSRA 4J9NA 2BV3A 2E5IA 1AB8A 2COLA 3IFEA 2VG6B 3ELHA 4DSEA 4C8OA 1LWXA 3EDRB 1C0UB 3G96A 4ZHRA 2MKSA 2DR5A 4WFXA 4F0KA 3HVRA 2OPPA 3G86A 1VQNS 3EGZA 2RQCA 4DV6F 4ER8A 3FCWA 4O3RA 5SZTA 3DN9A 3FBBA 3OTDA 5KOWA 4C8MA 4KO0A 3CJ5A 4QWBA 2PDAA 4IQXA 2LU1A 3V6KA 1KOHA 2DGOA 5DDOC 2AYMA 3HHEA 4ED2A 2MGZB 3QGPA 3CPWR 1LFPA 3OFGA 2KI2A 3KG1A 3TAMB 3TEGA 1C1CA 2N4CA 4CYUA 1RT6A 3TJ8A 2BOAA 2C2EA 4FYXB 1UETA 1NHUA 1TP7A 5B0EA 1OIAA 2DNOA 1U1KA 3S7RA 1HI0P 1U6BA 1YWXA 4A8YA 2GC8A 1FNXH 4KT0C 1VHIA 4K2XA 5FLXU 3CJ3A 3MEGA 3DM2B 2X3GA 3THPA 5KAKA 4EZ9A 4LIRA 3S01A 1S10A 3R7BB 4TU8A 2CQ0A 5KG3A 4CLYA 3PX0A 3T41A 1NSPA 3IA0A 2LEAA 2KTQA 3DXSX 2AW0A 3M6XA 2DNZA 4JI5F 2BQUA 3D3CJ 3Q8RB 1LWEB 2CNOB 1N5YB 2R7XA 3H5SA 5A2QY 2ZJQQ 1EZZB 1AXQA 2OMLA 4IRKA 1N5QA 1RT4A 3R7SB 1T95A 4MTPA 5KFCA 4IRCA 1JWWA 3HXMA 2MLXA 3HF5A 1T3NA 3PX6A 3GFXA 4NZ6A 1PYSB 4IOBA 4MYUA 4CZCA 1DTQB 2UXCJ 3RJMB 2HHWA 1UVNA 5H1SV 3OTCA 4PPZA 3CJKA 2W01A 5DGBA 1YQHA 4M63A 1RTIA 3DRRB 5EDWA 1CJKA 1RAAB 1ZM9A 3U1MA 5K8MA 3PZPA 2C2DA 1RTIB 4LT6A 1X5SA 4ZP6A 1VRTA 3KLEB 2HIQA 3CCRS 4DCPB 4B3SF 1JNRB 1UVLA 4O44A 3ISZA 2CQBA 3LP1A 5J2PA 1KFSA 2YPYA 3H2VE 2YX1A 2UV8G 1IUJA 2VHGA 4DV2F 1MW7A 4QZVB 3CJTA 3IO1A 2EFVA 3R5GA 3ZNJ1 1RYRA 1SXLA 4IG3A 1MSWD 4DUYJ 4AD6A 3TX0A 4DV7J 5EGYA 1D1UA 2UUCJ 2ZH7A 5C25A 4CH1A 4H54A 4ZVPB 5JXSA 4F25A 3HVTA 3H40A 3PIOQ 4F4ZA 2ZOGA 3RR7A 1W25A 1WI6A 1IBLF 3G8QA 4EUVA 1OY6A 2FHMA 1AW0A 1SC4B 2R42A 2ZC3A 1TL3A 5GADU 3E8OA 2XY7A 4J7CA 3ENQA 4C8LA 4DN9A 4TY8A 1J27A 3CJQA 3A8IA 3FJ2A 2ADBA 4B3TF 3OXLA 5E3PA 4RNMA 3LALA 4OYOA 2XCAA 2XY6A 4DN0A 3G6ES 1LWFB 1UVIA 1IKVA 1WKLA 5IWAJ 3MMCA 3BGLA 3H5UA 4KHMA 4UQGA 4CCHA 1S1VB 3Q89A 1RKIA 2PT0A 2VC0A 5A8WA 1RAFB 2W8KA 4DV3F 2DKOB 1YBTA 3IM8A 3T1AA 4DQIA 2B4OA 3UNYA 4CP5A 4TLRA 4WIIA 3MUMP 2E9TA 2LQJA 4K0KF 2AJ0A 2GHVC 3N6MA 1U1QA 3TR5A 1NUEA 1TKTA 3R1LA 3X3UA 2D69A 4ECXA 3IRXA 3ADAC 5AJ3J 3GG0A 5F0UA 1KTQA 1TTHB 3KMSA 2WW8A 3NGRA 2FJXA 3Q2TC 3G87A 2A2DA 1ZS6A 4A48A 4DR4J 2DCUB 2M9KA 3EGVA 1D9FA 3ISNC 2QZ8A 2HNDB 3RZAA 4K4VA 1OQ6A 1OO0B 2E1AA 1CS4B 2OEKA 2BEFA 5B0BA 2POKA 2C3UA 2BJEA 2XYPB 4I7FA 4K4XA 1Z1ZA 3I6PA 2IM0A 2XYHB 3K7RA 2DIUA 3D1HA 3MD1A 4CO1A 2BUNA 3W66A 4DF4A 4LSNA 4ZS6A 1SKWA 5I42A 4F0MA 5I3QA 2CNKB 3C2PA 4RKUC 1VCTA 1IXKA 4B9SA 3ET6B 4EZ6A 1MLAA 4OX9J 1RADB 1HD0A 1Y5IB 4IDKA 4O0NA 7AT1B 4YR3A 2NXCA 3PCOB 1LOUA 4CO0A 2C42A 1QD1A 1YI2S 2VODA 4JYAF 4DPTA 3EYZA 1FEHA 4JI3J 4ZVHA 2FB0A 2QSFA 5F8JA 1RYSA 1HBMA 3A1YG 4ZPTR 5KT2A 3QT8A 5IZHA 4WFAQ 1JMTA 1FESA 2BANA 4JV5F 4BS2A 1RACB 2CQHA 3OTOJ 1SB6A 4DR1F 3MM8A 3PEJA 5AT1B 3ILLA 4RBUA 2VF3A 1VISA 1DAXA 1PBAA 1WG5A 4I2PA 4PUOA 2XMJA 1H98A 3GV8B 5L9XA 1HL6A 4NZ0A 4OHXA 4NXNF 2B5JB 1X31C 1LW2B 2XB2D 2ZKTA 4ELVA 1NK7A 4OYZA 3KLGA 2J9DA 3Q8SB 2DY1A 5DZ6A 1LW2A 1M90T 4XK8C 1UL3A 3BSOA 1IR2A 1TELA 1FRJA 4ED6A 3MTJA 1PAUB 2LU2A 3TQEA 4FF2A 2XYGB 2HAFA 1REGX 3DOMB 4FKXA 2MZJA 2R2UA 4XDDA 3DHXA 2QLJB 2Z2ZA 3FEYB 2L9NA 1WDTA 3OT9A 1RWWB 2GS8A 3MECA 3TZXA 2WSEC 2A1BA 3KJVB 4DFKA 1Y10A 2EPIA 3PRBA 4A8FA 2AEMA 1VQ5S 2AU0A 3OL6A 1PC5A 1Y9OA 3MOJB 2YWWA 1VQKS 4NA1A 2XZTB 2I8EA 2UVRA 1ULRA 3I87A 4PQUB 3V6JA 1EP4A 1FNOA 3D0IE 2HWHA 4LREA 4QR2A 1K8AT 4OYIA 1KD1T 3C66A 3OXGA 3NOGA 1CEZA 4G1PA 3AB4B 5D15A 3HD2A 1NH7A 3EVWA 1P1LA 3MMAB 2KL8A 2V67A 3HJVA 5D4NA 1A7GE 1CC7A 1O0PA 2QRRA 2ASYA 5IOLA 4NRTA 1TKXA 1RT6B 2RU3A 1WEXA 3NKYA 3EPGA 1QAJA 4MAKA 1FD2A 1HPZB 3MM7B 4RU2A 1N54B 2OMOA 1DTTA 3R8YA 2XQCA 5HP1A 2NSBA 2J0WA 3H20A 1D0EA 2KRRA 3W9JA 2M8DB 1RAJA 3MM7A 4L3NA 1S5ZA 5HBMA 2N7YA 2NLWA 1CJTB 1WF0A 3MM9B 4NYOA 2Q6BA 3I32A 4U9RA 3W2VB 5L38A 3JAMY 1HI8A 1ACMB 2BRLA 2E7VA 1HW8A 2GQ2A 3L4BC 2UV8A 5D0HA 4PG7A 4Z37A 1M5PC 4ZVRB 2CPDA 3CO9A 1T94A 3DLKB 3C6TA 1MU2B 1UEUA 3DRPB 3LW5C 4XPEA 3KLIA 4DLEA 1DFDA 2LP4A 5E2QA 1LWEA 3C8YA 1E6VA 3OSNA 5AXNA 1VBYA 2AT1B 5HLFB 4DV4J 2RUGA 3HLUA 3RRKA 1I94J 3JAMU 2AGPA 1N8RT 2I9SA 4ES1A 1HR0J 1B64A 3HZEA 3N9UC 2OIHA 4P52A 4DPYA 4M5KA 5CA5A 1FFWB 5I3PA 4QWDA 5I4MA 1REVA 1VQLS 2DNLA 1TZ0A 4FVCA 4QWAA 1TK8A 3J81Y 3IXQA 2WOMB 1WI8A 2OSQA 4G65A 1ZA1B 4HLBA 4O23A 2XO6A 3PW7A 4ZJOA 3NOCA 2HAIA 2Z0GA 5A76A 2AEJA 3GIJA 2KYZA 3CCES 1B4SA 2Z2LA 1X0FA 1L3TA 1NDLA 3GCXP 4C48A 3LP1B 4RU9A 4C3LA 2HHSA 1RCXB 2NXNA 4O3PA 2AJ1A 3U1LA 2FTRA 3MM6A 2D41A 4ES3A 1S9EB 4ALZA 2Y1RI 4C8KA 2K8GA 5F8LA 3SCJE 1UW9A 2J9EA 3FQLA 3OTBA 2MHEA 2P6TA 4KHRA 3UD4P 4ED3A 2DISA 4HACA 3R5JB 4LIWA 4NXMF 3K5LA 2XS5A 5G4DA 2C2OB 2G0IA 3GMGA 4TYAA 2A10A 3OD2A 3OLAA 4PWDB 2NSCA 2BKPA 4IDKB 1RSCA 2ASJA 5D3GA 1R7IA 3CCZA 2B9EA 3MDFA 2KHDA 3MEKA 1U1NA 2IC3B 2UZAA 3W7BA 5KFFA 2RB7A 2BR0A 4PKDB 1NKBA 1F60B 1TL5A 3JTNA 3MMJA 4NLPA 4UOGA 2PFDA 4M5GA 1DHMA 1I1GA 1JLCA 3BR9A 4FKYA 1H7WA 1U1LA 1QAXA 4URSA 1V3SA 2J9CA 4UOFA 3JSYA 3LPYA 6AT1B 1PJ6A 4R0EA 2V2ZA 3LP2A 4OYWA 2C1EB 4A4JA 2V69A 4HTIA 4ZOSA 4OV6A 4ZIVA 2F8MA 2KFNA 3L7UA 1FDDA 5L8RC 2XI3A 1S1WB 1S77D 3JQMA 5MLCV 3MUTP 3P49B 4C4WA 3RB0A 2L08A 2XULA 2OFHX 3OLBA 4CO2A 2JLGA 4F02A 3RUBL 2ZOMA 1PYOB 1RP5A 1HIYA 5F8MA 4DS5A 4Y2MA 3MAAA 3K58A 3PVXA 3CJ8A 5CZVA 4UTGA 4LJMA 4DBQA 3CDEA 2LDIA 2DNYA 4WXOA 5BYRA 2HQIA 2J76E 2V0NA 4RNOA 5DLFA 4NMLA 1EETB 1Q4RA 3HI9A 4MMOA 3IAS9 4OLPA 4TVAB 2FJDB 5EX0A 4W90B 1F2HA 5HI7A 2CNLB 5E7OB 4OZ3A 2W9AA 3RB6A 5HMXA 2HGNA 3HKZD 3LAKA 1I5OB 4GRSA 4LF5J 3CNQP 1R6VA 5HO4A 4KTQA 3KLFB 3HVAA 1DY3A 1IBMF 4QPXA 5C42B 1UZHA 2HYIB 1GT8A 5I3UB 2QMUB 3H42A 2YNIA 2W9CA 1TKXB 3TA0A 2AYGA 2MQNA 4B3TJ 1GFWB 5C42A 1S1XB 4LF4J 1XIQA 3AH6A 4KPYA 4P75A 1R3NA 5HP1B 2HVHA 1Q7LB 3MEEB 3TA2A 2PMHA 2JX2A 4WP8A 1CJUA 2O5DA 4MYTA 1W26A 2Y3YA 2HURA 3CCLS 2DGXA 5H9EK 2ASLA 4J5OA 3W2VA 4Z2XA 3T5KA 3DDIA 2VBZA 3IBFB 4NEYA 3MAHA 4ETZA 5SUHA 2DD8S 2RD5C 3CXCR 3CDUA 2R2SA 4KFBB 5U47A 1T9YA 2PEHA 3M2RB 2YNFB 2JOQA 3KK3B 2VKRA 4DQRA 2NREA 1CC8A 3EZOA 3FSXA 4NLDA 1C0TB 2VD3A 3GSDA 3T5JA 2MQMA 1FK9B 1IKXB 2KDOA 2FVRA 1KONA 4KH1B 3HSDA 3VAIA 2MKIA 1NHKL 2EFOA 1H6KX 4DL4A 4OX7A 1NK6A 3E2EA 1KHVA 2VFVA 2RVJA 4K4YA 2DXDA 3MGJA 2BJ3A 4HTJA 3CMES 5DZ7A 3J7A1 4MFBB 3DRSA 3BO3A 2VFSA 1YTYA 4NMXA 4RW7B 4RNFA 4USVA 1XR5A 1T03A 1K0VA 1FFGB 1RHKB 5GAHU 5CAAA 4NE9C 2ZZNA 3IWNC 2NPFA 4QBUA 2NYHA 4M8LA 5KT7A 4GKJF 3QIDA 4L76A 5CYQA 1RWNB 3GCWP 6FDRA 2GMLA 4BWJA 3LP0A 2OPQB 2MKKA 4P72A 2D3OR 1RKJA 5LT5A 2GIRA 3FUYA 4P2SA 3NCPA 5A8WB 1IWGA 4W98A 5DG7A 1X60A 4G3IA 2W24A 2J0SD 3CB4A 4W4MA 2VZ9A 4FPRA 4FYWB 3MPDA 4DL7A 3ZZPA 1BWVA 1RT1A 1S4EA 2U2FA 5K5MA 4KGZB 3RBZA 3T1YJ 2QA4G 4H4MA 3TANA 5B0GA 4YB7A 1GNKA 1FD8A 1LWCB 2M70A 4DV1F 1AZSA 2MMYA 3AT1B 2RU9A 4B17A 3WIVA 2WVBA 3NRBA 3I55S 1RWMB 2VU5A 2YNHB 3W8GA 2HVEA 1WTFA 1KVJA 2CAJA 4UF4A 3JYTA 2HVIA 2LA4A 4M5JA 2F4VF 1NLKL 1V5IB 4OV1A 4ZITA 2D1CA 2KG1A 2IM1A 1RAHB 2F9JA 3CVKA 4KB7A 4A47A 3ETOA 3UDEA 2OTLS 2G1DA 1XMQJ 1S12A 4YMEA 4A8MP 3GIMA 4CIOA 4FBUA 2V6AA 3EUNA 2N82B 1UVJA 1UJ4A 4OX9F 4DV4F 3GR0A 3NGKA 3IR5B 3P8BB 2RDJA 3VF0B 3LANA 4DL0C 3CF5Q 1RHRB 1WDDA 2JZ5A 2ZBQA 2Q66A 3FQKA 3PIPQ 1KLMB 2CVIA 4FBTA 1JXEA 4YN3B 1WC0A 2MEWA 1LV5A 5GMKa 3BGUA 4CLWA 1RT2B 2MLZA 4F7VA 3GJSB 3P5BP 2BKNA 4YB5A 4RJVA 3D6TB 4NLVA 5HVHA 4J91A 3DLBA 1T3OA 4DX7A 4DSIA 1QLNA 4OI2A 2A6MA 1JLQA 2AP6A 1ZBTA 2M8HA 3CEDA 1QAIA 5ETKA 2R7RA 1KR4A 2V4JA 3E3XA 3PYEA 4B3MJ 4X4UA 4DV1J 4RW6B 5CD4H 1KTVA 3C16A 4DCOB 4J9RA 5D3GB 5CHCB 4ZLLA 2H65B 1NKCA 2V4JB 1VJWA 1XMBA 3K5OA 3KK1B 2R7OA 5GMDA 2V8VA 3D68A 3MCOA 5KG6A 5B09A 5L46A 4ENOA 1IQTA 2JJ4D 2YX4A 1QTNB 1RLCL 2CPEA 3DI6A 5M2UA 4ETXA 2ZHAA 1SQFA 2CQCA 3WC0A 4ECVA 1KRPA 2DYAA 2VA3A 4QIEA 3J7AN 3MR7A 5E41A 3F0NA 2BRKA 4Q7AA 4ZJQA 3VCDA 3H0PA 3V4IB 3H2LA 1GMUA 3KWMA 3LP2B 5IT9Y 5KG7A 3KLHA 1X4GA 2HIYA 4NLTA 2HS4A 3G4SS 2DT9A 4ILRA 4IO9Q 1S72S 3AY0A 2R2TA 4NASA 3EGNA 3GE9A 3OUYB 1X8DA 1FF2A 1S1TB 2JVOA 2UUTA 3NP5A 5LMNF 4J9KA 3TX8A 4DUYF 2IVMA 1VR6A 4I6WA 1XNQF 4DR4F 2J7KA 4J37A 3GPAA 1DBDA 3I56S 4AL6A 1HBUA 1O8BA 2JFKA 3B8HA 3MMAA 2WAQD 1DTQA 2YTCA 4IG0A 5HQ8A 1X0PA 1FKOB 4A8SA 3O6QA 2ZVSA 3UNGC 4RR5A 3DRRA 2RKIA 1IKXA 3HFVA 1RAOA 2O01C 2O67A 1JXVA 1FRMA 2UUBF 1GTHA 4R5PB 3BDPA 2Y8YA 2LQ5A 4NYZA 1DURA 4MJKA 2GZOA 1X4BA 4BWMA 3H5YA 4B9LA 1XQIA 1FX4A 1MROB 1RT7A 3OQ2A 2N3OA 1NH8A 3QZ8A 1Q86T 2ALZA 3IR6B 1TAUA 4DEZA 2FY8A 2M4MA 5KOXA 3K5NA 2B3TB 3C6TB 1H7XA 4S0MA 2K7JA 5DRKA 4F26A 4F4KA 4DUZJ 5GVQA 4HKQA 1TK5A 2MDAA 2RQ4A 1TL3B 1ELOA 3ITHB 3PDNA 1RAGB 2FPHX 3AJDA 1Q8BA 4RPFA 3Q8PB 2KXHA 1ZOTA 1G6BA 1RISA 3SSSA 3W5XA 4LRAA 4WXWA 4EYHB 1D8ZA 3TO8A 5F9LA 1SUQB 1KBRA 1JLAB 1M5HA 5DG8A 4Q5VA 3OVBA 3M8YA 2QX0A 2VL1A 4LF7F 2ZBRA 4GO7X 4KJIA 1DQ8A 2B43A 2N3LA 4GKKJ 3QLHA 2Y9HA 4EBCA 2Q6CA 1ZH5A 4M5DB 1IKVB 2HZAA 4I69A 3G82B 1LFWA 2FHJD 3QJLA 1RHQB 2IRYA 4X84A 4CTAA 1ZPWX 5KFDA 3NGSA 2UUAF 5IQ6A 1F1BB 4RNHA 1SKUB 2BABA 3LA0A 4RLEA 5KFTA 1CJKB 2PI5A 1LWCA 4ELTA 2A3JA 2VOPA 3RBDA 4CO4A 3GYNA 1JLFB 3H4BA 2XZDB 2VBYA 3I4PA 2IYGA 2V2QA 2YY3A 1B0VA 4NWBA 1VQ7S 1TKZB 4ES2A 1UWBA 2CPZA 3JSMB 3BBBA 4D3HA 1KQSR 4U7UK 2GJ2A 2EK6A 1XR6A 2FYXA 2HQGA 4ZDNA 4YDDB 2ZD1A 3JTOA 4GVBB 3T5LA 1BY9A 3CD5A 2ZJPQ 1W7WA 4K4TA 1ZYQA 2E5JA 2NYIA 3EZUA 4ZCIA 1SKSA 2B0GA 2HLTA 2NXJA 2OLWA 3D6MB 4KPCA 3UQSA 2M2BA 2WZ1A 2ZZTA 2BJ8A 4L73A 4RZRA 1WC1A 2W4PA 2BJ9A 3AQPA 3U7JA 1YJRA 5AE2A 2VPXB 2UUWA 5B0CA 4J9MA 3S8SA 4ZCMA 4X4TA 4I64A 3G6YA 4YP3A 2CZVC 3EVOA 3OL7A 4ECTA 3OVAA 4DS4A 1NPPA 2RS2A 1BXNA 2O66A 1HHSA 2HMIB 5F8NA 4DV7F 2LA6A 4OMFG 4URGA 2HZVA 2RQMA 1IBCB 2J8SA 3RW7A 5F3ZA 2ADCA 2RDDA 4MK7A 4L6V3 2HNYB 3RBXA 4K4UA 5KFPA 3PV8A 1HD1A 3BN7A 1SIWB 1Q8IA 2QLXA 2HRYA 3A3OB 3PRVA 4H4OB 4M5HA 2MZQA 2EG2A 3D3BJ 3O2IA 4OYXA 4DX5A 5IM0B 1K9MT 2X1BA 1DJ0A 3SFUA 5HVGA 3ISND 1VC5A 2EXUA 3M8PA 4NCGA 1RTJB 1BLUA 2XWYA 4UW2A 2CPJA 2FDNA 2ILZA 4NXMJ 2BDPA 4KO0B 1WF2A 3KK1A 5KFBA 2BBEA 2FGCA 2C3YA 4LFAF 3TARA 1N32J 2JEIA 3WIUA 1TU0B 1FRIA 2GGPA 5DLGA 1Y5LB 1H3DA 1FFSB 3QQCD 3VAFA 5KFJA 1Q82T 4WE1A 1PJ7A 3MECB 3KJVA 1EKSA 1NJIT 3I5AA 4LR8A 4PXEA 4WP3A 2FLLA 2XS2A 4QW9A 2QT7A 2YPZA 4KHPJ 3VGUA 1GXUA 4DX6A 3RU0A 1Z2ZA 4U7CA 3DMJA 2G13A 3PKMA 4WKYA 2PMWA 2PD1A 4OIXA 3M30B 1RLDA 2FZKB 3GTYX 2YVSA 1BHNA 3AOCA 1Y3KA 4LBIA 3RG6A 2GW8A 2OGUA 3SSQA 3Q0AA 1Y5NB 5JVHQ 2ATLA 4PG5A 2JEJA 2GQQA 4CRJA 4DMZA 3G8TA 1KQGB 1S49A 2ZDOA 3D6FB 2G0CA 3VALA 1ZAVA 3I5BA 5ETLA 4C7QA 1S0MA 2Y0SD 3D0GE 2JLFA 5GMEA 2MQOA 4DSKA 1KN6A 2RKIB 4ZVQB 3KLFA 2P5VA 3H90A 1KKHA 2ZH3A 3MD3A 5DETA 1NJWA 4YB1P 3KJFB 4YHHJ 1P9YA 5KG4A 3PYGA 4WFBQ 1U0SA 1M0SA 3DOKB 2GVZA 1F5CA 3NMRA 3QIPB 3W9IA 5BYQA 3MMBA 4JI0F 2B4PA 3UCZP 3MEGB 1XMOJ 2FJWA 4AXIA 4AL5A 1HBOB 1NXIA 2RF2B 2UXDF 4J9UE 4X4SA 3UD5A 2PFFB 3BGRA 3CD7A 3R3TA 2K1RA 3K89A 3TAQA 4BCAA 2DK2A 4USTA 1M1GA 1FA0A 7FD1A 5KFNA 2R8IA 1S6OA 4O44B 2XLKA 3PO4A 3NNCA 4LUBA 3IS9B 4I67A 1P1TA 1ZM2A 3B54A 3HULA 3AXMA 4M5NA 5HK4A 1Q8LA 4ZPAA 2EW9A 1F9FA 4MFBA 2CQIA 4K4WA 3H59A 5JMNA 1U1OA 2YXLA 2K06A 1S9GB 4QU7A 3A3PB 4IRDA 2WSCC 2WOMA 2F63A 3M9MB 3Q24A 1WC6A 2XS7A 2CUYA 1U45A 4IG0B 2V2KA 3BYPA 5DM7Q 2P8IA 2DNRA 4X64J 2XMTA 2V5HG 5AXLA 1HHQA 2E44A 2PA3A 1X5PA 3HX9A 4RW7A 4C3MA 4ED8A 1N33J 1TV6B 4P74A 7FDRA 4K50A 4O3QA 5IV4A 1Y11A 1FKPA 4IFYB 2F7VA 2P9EA 2V8PA 2WVFA 2HHUA 3HHNB 2IIHA 2DNKA 1H2UX 3MMCB 3OTEA 2VQFJ 2HK3A 2BW7A 2YH0A 2E7XA 4TN2A 5HROA 1N56A 3I0RA 4B3RF 2HZCA 3GV5B 3W61A 1Y0HA 3MI7X 1SL0A 3AD9C 3W5ZA 4I56A 3NS5A 4K59A 2GO9A 2CPXA 4PABA 3IWLA 4HT7A 3MCMA 4IG3B 1R0BG 2WHOA 2IAJA 1U0HA 5CCMA 4DR2J 1H38A 2DPJA 4JI2J 3UE2A 2Z58B 5ETRA 1F3FA 4TQSA 1N48A 5C25B 4CM2A 2AGOA 3EDQB 3TUIC 3KYLA 2MZSA 1S48A 2ROEA 3EMTA 4CLKA 2ZFHA 4TYBA 2CG8A 3AQOA 2ZWPA 3SSRA 4X64F 1U1PA 1M5VC 1T7PA 1SBRA 2AEFA 1FXLA 3QT7A 1QSYA 3KXDA 2F5GA 3C14A 2B56A 1C2PA 4OI4A 1HNXF 2I5JB 2GMHA 1QSSA 1J2VA 4MIAA 1S7HA 4C6AA 2M52A 1K44A 1FXDA 1JXLA 3OFFA 1YDLA 2I5JA 1C0UA 4JI8J 3EPIA 3BV8A 2HFSA 3C6UA 5K9FA 5HJYA 3K0JA 4X4VA 2HKEA 3AJ1A 3KUEA 2R7VA 2V8DA 2JC0A 4I6YA 3C46A 3S6EA 1SC3B 2WONB 2PA8D 3FBFA 3ENWA 1JK9B 1JLBB 4F4YA 1JB0C 1HMVA 1WG4A 2LQBA 2P9GA 4N77A 3QMQA 2UXDJ 1FDAA 4I68A 4WKRA 2CPYA 1UWBB 1HWLA 4ZVUB 1VQSA 3JSMA 2R8KA 1EHWA 2HFVA 3HCXA 4WFZA 2VPWB 3B82A 5L9NA 4FNIA 2MSSA 1NZ8A 1X4DA 3FDSA 2FJEB 3SV3A 5ETMA 1A9NB 4Q2MA 4PG8A 2CPFA 1T9TA 3CJ2A 4P7VA 4QIWD 2JHEA 2WTFA 4PYAA 1CSJA 5MAOA 4Y0FA 3ILOA 4OHZA 2QFJA 1FDNA 1B0PA 1T0TV 2KVIA 4X66F 1WC4A 2MQ8A 3MR5A 2EEYA 2YKMB 2HGLA 2F1FA 2KJWA 1Q16B 4R8UB 2H5IB 2DH8A 3SMZA 4K0KJ 2EFNA 3R2DJ 2W4DA 5KFSA 3HD1A 2CPIA 2XY5A 3FZ2A 1UAWA 2LVWA 2HHVA 2KXNB 3TP2A 1KVIA 1HI1A 2VG5B 4HI2A 2AYBA 4NPOA 1RWXB 1N5TA 3ICLA 5J1EA 1S1XA 2EVZA 2L9DA 5HVFA 3KTQA 4DR6F 4ZPVR 2R3VA 3M9OB 2IM3A 5LMNJ 2BANB 3BQ0A 1QTMA 5J1PA 4ZVTB 1KLNA 3BH6B 2YWKA 5B0DA 4N5SA 2KM8C 4A8XA 4IO1A 4N7TA 4KHPF 1SJ3P 4LF6J 4DL6A 2JFDA 1BQMA 1TVRB 4NLRA 1APSA 1OY8A 1S4FA 1WF1A 4OI3A 1VMBA 3MPWA 3KK2B 5T41A 1Q5VA 2ZH4A 1PKUA 4DR6J 2WBMA 2BE9B 3BF4A 4LFAJ 1N32F 2FGOA 1NPRA 4A8KA 4NCAA 1R27B 3ZZ0A 3G6VA 3C19A 3J80U 2A2CA 2FHKA 3M2RA 1RCOB 2DNNA 4OHWA 2XMVA 2HWTA 3MM5A 2BMBA 4O3OA 1HNWF 5KFZA 4OI0A 4LSLB 4BC7A 1FKOA 1IR1A 4OYPA 1HBNB 3VHQA 2V4RA 3DC2A 4IH5A 4NXNJ 1HYSB 1YRUA 5G0RB 2CIMA 2WB4A 2W2PP 1R8AA 2Z8QA 3NMAA 2OPRB 3VV2B 1V3ZA 1EAYC 5C7PA 2E1RA 2BQ3A 4Y3CA 1URRA 2OD6A 3DM2A 5M2PA 3EM1A 2DHHA 2GNKA 2OPRA 2WCXA 3UCGA 3OTOF 4CH7A 1IKWB 1YHQS 2AZ1A 2PSZA 3VVUA 1TK0A 2UVUA 2B9XA 1UCNA 5IT0A 4URQU 3IBWA 1CPZA 4DF8A 1VS3A 2E66A 4ECYA 4C8NA 2ALYB 3BM7A 4FP9A 3M2UB 3OSPA 2IBKA 1S76D 3O44A 1TR0A 1FWLA 2XTJP 1OSCA 1U24A 1UFKA 2Q79A 4L72B 5CYQB 5HMZA 4JI7F 3BH7B 3CCWA 3US5A 4FS2A 1PYTA 1Q78A 3J81U 9ATCB 2UU9J 2FHJA 4LF5F 2LQ9A 4CLSA 1LWFA 1VIOA 3L95X 3I82A 2DO4A 2NZCA 3PNIA 4RW8A 2DITA 3NNHA 1BWEA 1FERA 3CMAS 5LSRA 4IR1A 1IR0A 3O5TB 2GO8A 4O4GB 4C0OC 4Y2AA 3KK3A 2W9BB 4F50A 4DZDA 3R1HA 2X51A 2B7BB 1P6TA 1WSVA 2NS1B 2OFGX 1S1UA 2VICA 3AFGA 1TMJA 3ZTPA 2ZNYA 4RW9B 3TAPA 1J5EF 4DR7J 1MU2A 3DRPA 5J1NA 1WORA 1OSDA 3IN5A 1VHFA 3T5HA 2BOPA 2C28A 1LXJA 3E01A 4OFZA 4DR5F 2KFYA 3ZZOA 2HEKA 3TOQA 5RUBA 1TL1B 2C3PA 2DRAA 3O3LA 1LEOA 4KV8B 2CKWA 1RT3A 3GYGA 3W5YA 4F3MA 2Y1IA 2LQ8A 2GIQA 2YNGB 3BPSP 4PEOA 4P73A 3PJXA 4EWTA 1HNZJ 4C3KA 4GKKF 2BZ2A 1RWPB 2KT3A 1FRLA 2VBWA 2VBXA 3D1OA 3PRDA 5KFOA 2VQFF 1FT8A 1L5UA 2DR7A 1U02A 1HWKA 1W2IA 1BMQB 3GJRB 4R25A 4ZA1A 2FY1A 3HHLA 1TMMA 3H2UB 2C3MA 2HBZB 2IHR1 3FNNA 5F0WA 2KJVA 5DQIA 2YH1A 4ZVFA 3MTKA 2HHPA 2DH9A 1BE4A 1VBXA 3B78A 3K8VA 4B02A 1RAIB 2QEXS 2GFFA 1N33F 3CUNA 4B9NA 4HH0A 4F04B 4EFAC 3PR5B 2Y8WA 5E3CA 4JI6J 1FE4A 2AJFE 4KY3A 2D74B 2EC0A 3A8EA 5LJ3Y 1L3UA 3SQGB 3GQCA 2YQ1A 4KKOA 2ASDA 1K0TA 4RW6A 1SJ4P 2XEXA 1S0OA 2OI2A 2VH7A 4YS2A 3OR1A 3UR3C 4HT5A 3VTIA 4A8WA 3B6BA 2UUBJ 1FO1A 1RHJB 2ACMA 4I2PB 2ZM6J 2Z56B 2M0GB 5B0FA 1JJCB 4HI1A 1SI9A 3C16B 2F3JA 2J7UA 3MR6A 2R8JA 3DOLA 3DXBA 4C2MA 3G8SA 2VDIA 3J7ZT 1WC5A 2VG7A 4I1TA 3EICA 5D78A 3DLEA 1FJGJ 2W25A 1KQFB 2W4CA 3NLCA 5JJBA 2UXCF 4KAIA 1P9QC 2BX6A 2MLYA 4NLXA 4OLOA 4Y2KA 2ZZMA 5GAEI 1XC9A 4CLUA 3SCLE 2J9DE 1S6QA 2GX8A 1N5YA 1I3OB 1WOPA 5IFMA 1R0CB 1NB7A 1GX6A 4AT1B 4J9PA 4NLGA 5A0YB 1WWHA 1RTHB 4OI1A 2C2KB 3FEXB 5EX3A 1HMVB 1EP4B 2BJ7A 2CYYA 2VG6A 3FC9A 2LKZA 3LO3A 3VVTA 1SL1A 3KK2A 2H5EA 4KGXB 4M5LA 5L1JA 4DI6A 1RAEB 1U1MA 2HFNA 5KFEA 3UR0A 1R43A 3RR8A 1SKRA 1UFLA 4JBCA 4EI2A 1EKRA 2LFVA 2B9YA 3MR2A 3CW2C 2VOOA 2XMKA 3JTPA 4NZ7A 1U7LA 4J9SA 1N36F 3G71S 4DHVA 4HHUA 1R6YA 1V6HA 3V6HA 1CJUB 3P96A 2JSXA 2DO0A 2XSJB 2QC3A 2XSFA 3D6HB 4NI2A 3VGSA 2FZCB 3H25A 4OHVA 5KG5A 1FNMA 5CCLA 2RILA 1NZAA 1UPMB 2Z2YB 3L7PA 2JNJA 3TUJC 4XO0A 1UFWA 3BO2A 2EFQA 2C3OA 3CJ0A 4J9QA 2VFRA 3H7HB 4PWWA 4BC9A 3PO5A 3PM9A 1CULA 5A6WA 1M5KC 2M7SA 3GV7B 4NL5A 1B3TA 1C1BB 4JI8F 1S0VA 1FRXA 4FXDA 2ZH9A 3QO9B 4WK3A 3SYZA 2E5GA 4HH1A 3HP6A 5H9EJ 4DSJA 1C4AA 3KKFA 2RNEA 4FDFA 2QLWA 3M32A 4RBVA 1A6LA 1RB0A 1ZA2B 2LLZA 3BZQA 2DGVA 4IOAQ 2IJRA 2F4VJ 3UWTA 3W8PA 2HW3A 1XBWA 4ZCLA 4RUHA 4JI3F 1MWQA 2D9OA 3DLLQ 3W2WB 3IR7B 2DHSA 2R8HA 5KFIA 4C0BA 3W62A 1HHTP 4WF9Q 3KNGA 1TKZA 1H72C 2CQGA 2YBVA 1CG2A 2E29A 1QUPA 1WACA 2CWXA 1IJFB 1OY9A 3Q83A 4HYKA 2IY5B 5DM6Q 4AE5A 1HNIB 3T1YF 1WHVA 1AT1B 4KH0B 4UZBA 2HQDA 3V81B 3N79A 2J6TA 5KT4A 3RB4A 5KFMA 1M5OC 2B51A 2YWEA 3W3SA 3CCTA 5K14A 4F4XA 4LFCF 2BM1A 1WC3A 2MZ1A 1Q53A 2KU7A 5AXKA 3L7OA 4NLOA 2I2YA 2CA9A 2LYVA 5KT5A 2EFGA 3W65A 1FI4A 1GTEA 1RBAA 1TUWA 2I0XA 5H9FK 4EO8A 3FK4A 2EWHA 3QGHA 4X4QA 1VQ8S 3KUHA 4AQYF 5KFQA 4RBTA 2Z4PA 2JL9A 2AKWB 3D66A 1NSKL 4CO5A 1T9UA 3KHGA 4B3MF 4IOCQ 2NR0A 2ZWOA 4JOUA 1UKUA 2CJKA 3UW1A 3EZ5A 4OQJA 4NA3A 5IM0A 3C15B 5CD4A 1LKZA 4XTTA 3DU6A 4UT4A 3VWSA 3SQGA 5CYJA 4X62F 4HEA9 2CPHA 2QV6A 3C15A 1EJ7L 2KO1A 3UN2A 2L48A 4CTAB 3GR1A 1RTJA 3Q8YA 4CWBA 1XJWB 4ECSA 1R8BA 1V3RA 5FDLA 3D7SB 4V19J 4A8OA 2AGQA 1RT1B 5F8IA 3JB9k 1SJFA 4QCLA 1JLGA 4X66J 3KLGB 2HHHJ 2IA6A 4ED4A 1UP1A 1XN9A 1AZSB 3TUPA 1GMWD 2CG4A 2B9WA 3ENAA 3IG1A 2G1HA 3AHPA 3JSBA 4NEZA 4EO6A 5JUMA 1XMQF 3MM6B 2IJFA 2BYCA 3M8ZA 2KHCA 2R7SA 2CWKA 4JB8B 1FJCA 2YNGA 3GFZA 2WVEA 3POTB 4G6VB 2CZ4A 3NBPA 5D0RA 3KFWX 4Y65A 1FWPA 2YKNB 3P45B 1MN7A 5E5NA 2NUUG 3IC1A 3D2WA 1LK5A 2SXLA 3MFIA 1FXRA 3THTA 2HHHF 3QT6A 4G1QB 5KT3A 4RUCA 4J9VA 2YKOA 5IQQA 2XG8A 3HSJA 4QYRA 3OJUA 3PW0A 3TA1A 2B4UA 4M1KA 4ED1A 3AODA 2C2MB 3CDWA 3HPOA 5KFKA 1NJXA 4M94A 1EB0A 1GMWA 2QMXA 3P3DA 2IMOA 2XMMA 1U6FA 1HW9A 4CNYA 2F65A 2QE5A 3I4HX 1FHTA 1FKAF 3L9ZA 1T9WA 3HK2A 3SEOA 1SVDA 3G6XA 2C22A 1KDNA 4D3GA 1PGZA 4USUA 1U8SA 2XMAA 2ZH6A 2M3DA 3MEDB 1ZETA 2I1RA 2HFOA 2YX7A 4Y2IA 1BQMB 1TVRA 3BEGB 2B8PA 1S57A 4CNZA 3SXLA 3QBCA 4ZHRB 5HQLA 5HN0A 1TL7B 4DR2F 1IWAA 1S59A 4C11A 4JP8A 2ZOFA 1Z4UA 3DLEB 3TWZA 9RUBA 4DJBA 3W64A 3CCUS 4UZCA 1H2VZ 1P27B 2GIFA 3MF5A 3UVJB 1WEZA 5J2NA 3BS9A 4LFCJ 3HKWA 2ZHBA 2HNZB 4KIAA 2D3O1 3ZFVA 4P2XA 3GZ7A 2YKPA 2RRAA 3FBEA 5FIIA 1N6QB 5D0GA 1HQEA 4MIBA 2R7QA 3HM9A 3TYTA 4FF1A 1RXOB 2BA9A 1D9AA 2GAHC 2J5AA 4DQPA 2UXBF 3MM5B 4HHJA 1CQMA 2AZ3A 2PGCA 3DRSB 2YKQA 2PIIA 3A8KA 1HBNA 1TUGB 2EFPA 4TNOA 3VQSA 5AE1A 3VAJA 2W2MP 2XLIA 5EWGA 1SH2A 4ECQA 2MHNA 3EVMA 5BR8J 2OEMA 3I9V9 2JEGA 3M6VA 1VRUA 1ICEB 2ZE2B 3FGVA 4J90A 1SC1B 3CTRA 2VJUA 1H73A 3DKDA 2FVSA 1VQMS 4ZMMA 2VFTA 5FD1A 4B3OA 1YJTA 2QFIA 3PTWA 4AYBD 1DZ5A 2WVCA 4P7TA 4QIFA 2ILYA 5E0OA 3VGVA 3TZWA 3B4MA 4B9UA 4MKBA 3PY8A 2FLOA 1TV6A 4MKAA 2HHTA 2O1PA 3PX4A 2DR8A 3RW6A 2W2QP 4P71A 1HNIA 2IDLA 1GH8A 3M4XA 5F3TA 3HDSA 2DRDA 2OPSB 2MSTA 2ZUAA 3QFHA 3KDNA 4WU3A 3N01A 1URNA 1T11A 1IKYA 2QG9B 1NDKA 1AFIA 4QQBA 1AROP 5J2QB 1TUVA 1U0HB 3OL8A 1X4EA 1QVGR 5HBMB 1WKJA 3V4MA 3ZZRA 1J5OA 2JDJA 3GIIA 1EARA 2D3UA 4LF1A 4PWDA 2YKAA 4LRFA 2DCLA 5ETVA 2HSEB 2K1RB 3DFEA 3FEZA 4ZPWR 3IGVA 4ZLNA 3TVYA 4QWCA 2XC9A 4DPXA 2HNDA 4ID5A 4CLLA 3ZNUA 3JYTB 2DXFA 4Y6IA 3UI3A 1XEZA 2IVYA 3IS9A 3PACA 3K57A 1HARA 4OZLA 1IBKF 2GVDA 2VUGA 5J2NB 3V2UC 2D9PA 3KG4A 2P2CB 4LSNB 4MIWA 1IVZA 2GVDB 3HSGA 2EC2A 4P2FA 2W7AA 3ET6A 4DX8H 3K17A 4KV8A 3G82A 2XHWA 3QRPA 4WP9A 1PC4A 1CJVB 3S1TA 2KZZA 3HHLB 6FD1A 4FZVA 4N76A 4ECRA 3ZTOA 4M5MA 4UY85 1HNVB 4Y28C 2K7KA 2H54B 3D28A 3LGNA 3NCRA 4ZN3A 2RHSB 5L1KA 4DZ6A 2AJ4A 4PAAA 1S0NA 1DLOB 2CDQA 4GKJJ 2ATCB 4KBIA 3QPIA 4WFNQ 1ZM4A 2VQEJ 3A13A 1RT2A 3NGDA 1CVJA 3HHLC 2CRLA 4AUKA 4X2BA 1YX2A 4WBFA 2YWGA 8ATCB 3N28A 2QYGA 2QYCA 1S9EA 3D9BA 1MMDA 2GV1A 3LUYA 1UEVA 2U1AA 1YSJA 3NAIA 3RYLA 2BE2A 2W8LA 1RWKB 2QJ3A 4ZVGA 3SV4A 3PKYA 1NDCA 5D77A 4DL5A 2PC6A 4ZPCA 4LF8J 2HLUA 1PBUA 2MJNA 3DU5A 4JI4F 2AJ2A 4FYYB 2B5JA 5THWA 3DI6B 4DV0F 3SFGA 2AHOB 4ZJLA 2ZH1A 1AA1B 1G3OA 4LSZB 4LRBA 5CQGA 1N0VC 3M7VA 3T6BA 3V4IA 3O8WA 4NCBA 2XCPA 2IC3A 3M2VA 2V9WA 4ZVOB 4DUTA 1HKAA 3BQ1A 2IDEA 2WVDA 4Q0BA 2MY8A 2NXUA 3D5MA 5LXRA 3OBIA 2MPUA 2E9ZA 5A0YA 3D0HE 2XLJA 5D4PA 4K5RA 5ETPA 4HR2A 4LF6F 5EN1A 4I6AA 1PO6A 3Q8UA 3O1LA 2CQ2A 1R89A 1RI7A 3QRQA 2V94A 2ROPA 1Y3JA 3FKBA 4IR9A 3DRXA 1S1WA 3I0SB 1P8GA 1EIYB 1S1TA 2R8GA 1UJ5A 2RRBA 1VBKA 1Q5YA 1VLYA 2EI5A 4E2FB 5C2GA 4DFJA 1NJZA 2H1YA 3I0SA 2XM3A 2KRBA 2YNFA 3I9ZA 3NAHA 1X7VA 1LK7A 3R5AA 4OI6A 4OYMA 4X4PA 2MGZA 3V6DA 4K8RA 2Y1LB 5L1LA 5C5JA 5G0RA 4DR5J 1QVFR 3HVWA 1IBKJ 1I94F 1HQEB 1Q81T 1VJQA 1JQGA 2KXFA 1YIJS 1NJYA 3NEKA 2XSJA 4J9LA 4AFFA 4M95A 2I6WA 1NDPA 1Q1KA 2CQ4A 1HYSA 1Y4ZB 4R8UA 1DTTB 4QJVA 3J81j 1G2EA 1IKWA 4RX6A 1SH3A 4B9VA 4ERDA 3GP9A 2ZUGA 1YBUA 1CLFA 2LMIA 1GXLA 5CXTA 1F5BA 1S9FA 4GVLA 3SIPB 2HRUA 2RF2A 2N7CA 3EE3A 3CJSA 3G9CA 1E6VB 5KT6A 1E6YA 1SQEA 3DLKA 4JYAJ 2GJFA 3BREA 3MHYA 3HFKA 1FVSA 2OD4A 1MMNA 4DV6J 4LF7J 5AJ3F 3M2UA 1E6YB 1I6JA 4CLFA 2AX0A 3TI0A 2FC9A 3JQJA 2LDYA 4Q43A 3M05A 2DHAA 2ZEJA 1QAYA 1XERA 2FJBB 1Q8KA 4GMKA 3VAKA 4PR6A 4TXSA 2DHXA 1JKHA 1L3KA 5K8PA 2PMZD 2OJ3A 5L1IA 4CM0A 1S1UB 1VK3A 2DNHA 3GFHA 3ZO7A 3NGTA 3CE8A 1X4HA 3DLGB 4QU6A 4NOHA 1HBUB 1LW0B 1PSDA 4NLWA 2BW2A 5HSPA 1TKDA 4Q44A 2LECA 1RTZA 2V2VA 3K5PA 3MMBB 1TKTB 4C9DA 3N6LA 2GHWA 1YJWS 2F40A 3D54A 4H4KC 4RW9A 3WX8A 1AUSL 1TFWA 2VONA 3KNAA 1T9XA 1N4LA 4Z7CA 4JI2F 2ZNZA 1RT3B 4USHA 2EBGA 2ZD1B 1FE0A 4ZPBA 1Q7YT 4WU2A 2VC1A 3CDBA 3GJTB 3JSRA 3SDEA 1MROA 1RT7B 4DU7A 1G4CA 2CDRB 1JX4A 3AXKA 1U4BA 3R2CJ 4Z7YA 1N0UA 5KFXA 2NUHA 4I2QB 3FZBA 2L41A 3CCSS 4K4SA 3N0VA 4ANCA 2MKHA 1U1RA 3BBCA 1WNEA 5CYMB 4ILMA 2G0JA 4Q8EA 3CJ4A 2VDHA 4Y34A 3CC2S 2ZBCA 2UVWA 2LXFA 3TNVA 2HGMA 1GAOA 2R4FA 2IPOB 5HLFA 1T05B 5E3AA 1HLWA 2GCFA 1NRKA 3FMBA 3U02A 4DG1A 4DR1J 4ZKAA 2GA7A 3H8YA 3GILA 2GMJA 3PYFA 1XTZA 1RK8A 2EKYA 2WBRA 3NGUA 3QSIA 4H4OA 4M5DA 3W63A 4DG1B 3RAXA 1J5OB 2KYXA 3CMQA 1JLCB 4ECWA 4LRDA 2QLBB 2W2OP 4PUOB 5HMWA 3I31A 2K3KA 1X9SA 4FF3A 2V50A 4LFBJ 4WTYA 4WCEQ 3T1HF 1FJEB 3AJ2A 1UEKA 1VFJA 2AMCB 3NS6A 4U95A 3M8PB 3BYRA 1T9VA 1OYEA 2MZRA 2OKQA 3M1VB 4ZPDA 3FSIA 3SZ2A 3CDAA 3DYAA 1YITS 5DS7A 4R0JA 5KFGA 5KFVA 3PJWA 3QATA 3QJJA 5C2CA 1L3SA 1I51B 1RHUB 3MAAB 1D09B 3QWUA 3QAUA 1KS2A 3DRYA 4EYIB
chains in the Genus database with same CATH topology
2LP4A 1A0OB 1FWPA 1FFSB 1EAYC 1FFGB 1FFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP4 A;  1A0O B;  1FWP A;  1FFS B;  1EAY C;  1FFG B;  1FFW B; 
#chains in the Genus database with same CATH topology
 4GVB A;  1S79 A;  2RIJ A;  3DMJ B;  2KVQ E;  1FWK A;  4OX8 A;  5I42 B;  4EBE A;  2FJV A;  3I5C A;  2M5Y A;  2QL5 B;  4YQW A;  1GK8 A;  3FBC A;  3T3F A;  1XWL A;  4LF2 A;  2GJI A;  3NWR A;  2E5H A;  3MOZ A;  2APO A;  3C6U B;  5ETO A;  2G2O A;  4PG6 A;  3NL0 A;  4JI5 J;  1QM9 A;  3Q86 A;  3T1H J;  1NAQ A;  4TKT A;  4LFB F;  4G1Q A;  2WON A;  3DDK A;  4ZK7 M;  1F9H A;  4L3K A;  3ZZZ A;  4EEY A;  3TEH B;  2XBP A;  2KZM A;  1R8C A;  1UA0 A;  1FX2 A;  2JC1 A;  4X62 J;  3P4U B;  4RL1 A;  1QE1 A;  4Y2C A;  3LH2 S;  3W60 A;  1VQ4 S;  3V6D B;  1VQP S;  4NLS A;  1X5O A;  4X65 J;  5K8O A;  1N34 F;  4PZV A;  2JRS A;  4QPT A;  5E33 A;  4A46 A;  3UO0 A;  1XR7 A;  3AD8 C;  2R9L A;  3OW2 R;  3QRR A;  2NQP A;  4YY3 J;  4E98 A;  1C1C B;  4CYU B;  3PW5 A;  1D3W A;  2Z2M A;  4DSL A;  5F9N A;  3CD0 A;  4LVO P;  5LXY A;  1WOS A;  2HVZ A;  5ADZ A;  4RUB A;  1HBO A;  3B4D A;  4Q45 A;  4YOE A;  2IJN A;  3C3L A;  1RTD B;  1WUU A;  3BKU A;  4EK2 A;  3Q8Q B;  1XK8 A;  3CJK B;  5BYS A;  1C0T A;  3MPV A;  3F44 A;  2OAU A;  3M2V B;  5ETQ A;  5EWE A;  4Q0B B;  2FQQ B;  2X1F A;  1OPZ A;  1Q0N A;  1RWU A;  2J6S A;  4WYL A;  4FS1 A;  3M32 B;  4LVN P;  1OMS A;  4GC6 A;  2LEB A;  1WOO A;  1MWY A;  1RZM A;  1ZAX A;  4KYZ A;  2ZM6 F;  3FCH A;  1AFJ A;  2DNP A;  2DY9 A;  3LAM A;  1F9E B;  1B99 A;  2I38 A;  2ZH8 A;  2AV5 A;  3WQP A;  4O3S A;  3J7Z 5;  1F0X A;  2DXE A;  5J2M B;  3FFI A;  2OUG A;  3BQ2 A;  2DVI A;  2YWF A;  1O51 A;  1TL4 A;  4CT8 A;  2QA1 A;  4KGK A;  2RRN A;  3DLG A;  3VQT A;  2KN4 A;  2CJA A;  5HAT A;  4M5I A;  4ZLP A;  3QZ7 A;  2XZW A;  1U48 A;  4K4Z A;  1RUS A;  1HWU A;  1MG7 A;  1X4A A;  2G2Z A;  3BDE A;  3IGN A;  4U6P A;  1U2C A;  2LXI A;  3R6G B;  4P6Q A;  1HPZ A;  1NPK A;  3DCA A;  3CO0 P;  5JVG Q;  4DV5 J;  3SI8 A;  2MKC A;  3RRG A;  4HDH A;  2BKO A;  4BDP A;  2ZC4 A;  3MCN A;  5B7W A;  3M9N B;  2WRM A;  1JJH A;  2H4W B;  1U2F A;  1VRT B;  3LP0 B;  1S1V A;  3R9L A;  1BQX A;  3TZY A;  1PG5 B;  3J7Y I;  3KLE A;  1SJQ A;  5J2Q A;  3PHT A;  1NK4 A;  1R8P A;  1S7I A;  2AF6 A;  2PE8 A;  3R5D A;  3V81 A;  5AXM A;  4LBH A;  1HNZ F;  1W2B R;  2GVZ B;  2OPS A;  2Y0B B;  4H4M B;  4LR7 A;  4O4G A;  1PIE A;  3TVK A;  1X5T A;  3LWL A;  2B6A B;  1IJE B;  2CJY B;  5T7L B;  5GAG U;  1XMO F;  2QSW A;  3MAQ A;  4JI0 J;  5DDP C;  2ZH2 A;  3ENV A;  4NYP A;  1S6P A;  1EQ0 A;  3QJP A;  2DNQ A;  2XNR A;  4U8Y A;  2IAJ B;  3HVT B;  3LF0 A;  2YNH A;  3V5R A;  2CZ9 A;  2BJD A;  2DNM A;  3KLI B;  2XWX A;  3U1N A;  5KFW A;  1UZD A;  1OYD A;  2ZIT A;  1DAR A;  4ID5 B;  1VRQ C;  4DSF A;  3QAE A;  1R8H A;  3J80 Y;  2BQR A;  2VFU A;  1Y00 A;  3LPE A;  1IBM J;  4UOH A;  1IM4 A;  1BQN B;  5AE3 A;  4DQS A;  3ULH A;  1S9G A;  5CZX A;  1VC0 A;  3D4J A;  2ZKU A;  1NU4 A;  3LOU A;  3KDO A;  3OR2 B;  4YFU A;  2PN6 A;  1HR0 F;  2DR9 A;  1LW0 A;  2CQD A;  4X4R A;  1PJ5 A;  4F0H A;  5IWA F;  1GX5 A;  2VV5 A;  1PIL A;  2R7W A;  5KFY A;  3HFZ B;  4TQR A;  1IQZ A;  2KG0 A;  3PXG a;  4QYZ K;  1KLM A;  2H51 B;  1EQM A;  2OHD A;  3QNW B;  1R0A B;  1DQA A;  2RE1 A;  4OJ3 A;  2OP5 A;  4UOC A;  1RWO B;  2OPP B;  2H9Z A;  5GAH I;  3K8W A;  1R0A A;  2QL7 B;  1Q79 A;  2RSQ A;  2MB0 B;  2AWZ A;  3IG1 B;  4WK1 A;  4JUZ A;  2XMW A;  3MM8 B;  2CVE A;  1M1K T;  3NS7 B;  1GXT A;  2FLP A;  4WE1 B;  2XNQ A;  2RQK A;  3VR1 A;  1UJ6 A;  1BD6 A;  2YKM A;  1QDU B;  2J0X A;  2VAS A;  3MPU B;  3ZTS A;  4CI0 B;  4USM A;  1FJG F;  4N8O A;  2CQ3 A;  5IXU A;  1JNZ B;  3RAQ A;  3OVS A;  3EGW B;  1YG0 A;  3PHE A;  1RU1 A;  1NHV A;  2ZDP A;  5D8H B;  4LF8 F;  1HFE L;  2KM8 B;  3PW4 A;  1HNW J;  3J7Y U;  1LQ9 A;  4WPA A;  1JJ4 A;  1U47 A;  2KT2 A;  4C98 A;  5IT4 A;  5DQG A;  4F2R A;  3EWG A;  5KG2 A;  2V8G A;  2QTW A;  5DJB A;  4O3N A;  3HHK A;  4WFY A;  4YUD A;  5T14 A;  3TUZ C;  1NCL A;  2VG5 A;  3PFE A;  1HWI A;  3TQ1 A;  5J1E B;  1NK9 A;  1NB2 A;  1JLE B;  2DGT A;  4I0W A;  3Q23 A;  2QO3 A;  4C11 B;  1KSP A;  5FDL B;  5LSO A;  3OUY A;  2DGS A;  4CLP A;  3OR1 B;  3D67 A;  2UXB J;  3R5C A;  2HBR B;  3RAM A;  3UVJ A;  2ZJR Q;  1FTR A;  1KP6 A;  2CJQ A;  3QSY B;  3NY0 A;  3VAM A;  2DGU A;  3UDL A;  5KFL A;  1F5A A;  5EHH A;  4ID8 A;  4DL3 A;  4PG4 A;  1ZM3 A;  4DQQ A;  4ZP7 A;  1WKK A;  2BAC A;  2GQC A;  2RUS A;  1SIZ A;  2V34 A;  1D9D A;  2LCW A;  2HRT A;  3BR8 A;  3HHD A;  3BGR B;  3T19 A;  2F8H A;  3WDO A;  3HHL D;  3ZXW A;  1DRZ A;  2DB1 A;  3KHH A;  2FUG 9;  1S6U A;  1RDR A;  4DFP A;  1BC6 A;  1OS5 A;  2CAD A;  2C2R A;  4NLU A;  1CJT A;  2P6S A;  1NND A;  3MM9 A;  1U26 A;  2MKY A;  1V5V A;  3T6J A;  3UDV A;  1VK8 A;  1KC8 T;  1G1X A;  4P2M A;  5IT9 U;  4ZIW A;  3OL9 A;  2KT5 A;  3AAW B;  4X65 F;  4N41 A;  1RTH A;  2E9R X;  3RBE A;  2UUA J;  1RA7 A;  1YRX A;  1D8Y A;  4JV5 J;  2W9B A;  2VPZ B;  4KR0 B;  4F67 A;  1SJR A;  1FJ7 A;  3EXC X;  3TW0 A;  4V19 X;  4OHY A;  3TZZ A;  1YJ9 S;  1IN0 A;  5I3U A;  2XO7 A;  3JXO A;  3U27 A;  3ZZU A;  1HQU B;  1U25 A;  1VGY A;  2YWH A;  3ZC4 A;  1RT5 A;  3QLH B;  4AXJ A;  2IFX A;  1IKY B;  2Q1L A;  2HQF A;  1FDB A;  2OPQ A;  3M6W A;  2WW4 A;  3MEE A;  2GAG C;  4FPI A;  4PXC A;  1OWX A;  4JI7 J;  1JLA A;  3OFE A;  4BLG A;  1SH0 A;  4CDI A;  1JIH A;  3MPY A;  4WIQ A;  3FMW A;  5HQM A;  2WK4 A;  3WC2 A;  2CXE A;  3R6L B;  1VLO A;  2W2N P;  2V4Q A;  3QIP A;  3LWM A;  3L09 A;  4MH8 A;  4F3Q A;  3HJF A;  3D1Q A;  4NI2 B;  3HSZ A;  2AJQ A;  4H4K A;  2G2Y A;  4ILL A;  2L3M A;  3KJQ B;  3WHI A;  2V68 A;  3AD7 C;  3DGP A;  1VI7 A;  3IBC B;  5BR8 F;  4J9O A;  2FJA B;  1S6P B;  4FNH A;  2RT3 A;  4UY8 T;  2RML A;  2Z30 B;  4TU9 A;  1OQ3 A;  3DGP B;  2B8Q A;  4K7Q A;  4CLT A;  4WJB A;  4ICL A;  5J2P B;  3AA8 A;  2VKZ G;  1VQO S;  1YJV A;  2QN6 B;  5K14 B;  5HJX A;  1WTB A;  3A8J A;  3FFI B;  3DLH A;  5IV3 A;  4OZJ A;  2HFZ A;  5D4O A;  4IKA A;  3IM9 A;  1EX8 A;  4PCQ A;  2D3Z A;  2DEJ A;  3FSY A;  3K5M A;  3CUL A;  4PXD A;  1V9O A;  2DNG A;  2IA0 A;  1B7F A;  1NK8 A;  3EXY A;  5M2R A;  2W1B A;  2ERR A;  3TJ9 A;  2IBO A;  2W7O A;  1GEH A;  1BUX A;  1DLO A;  1RBO B;  4RWX A;  4LBP A;  2CFX A;  3Q8V A;  4W92 B;  1K1S A;  3W2W A;  3CCM S;  3HT0 A;  2VJV A;  4KSE B;  4AQY J;  1X9W A;  2DPI A;  5CAB A;  2XHC A;  2HMI A;  3ILJ A;  4OJG A;  2A6O A;  4XDC A;  2IMW P;  4PXB A;  5F41 A;  2UUC F;  3AOB A;  8RUC A;  4IUF A;  5LMU J;  4DR3 J;  2DIV A;  1HBM B;  3GU0 A;  3CIZ A;  3GIK A;  2EK1 A;  4TY8 B;  1HA1 A;  4QYZ J;  2W7P A;  4DV2 J;  3KJN B;  3NG8 A;  3HZG A;  4I4B A;  1GMV A;  5A8R B;  4DV0 J;  2X3D A;  1F2G A;  3M8Q A;  2RHQ B;  1ZTW A;  2HQ3 A;  2HFU A;  4O0I A;  1G7C B;  2DJW A;  2E7W A;  4RO0 A;  1WEL A;  4FYV B;  1FEE A;  2IYI A;  4ITS A;  3ZZY A;  3GJQ B;  1FTC A;  1VYA A;  3FRZ A;  3P5T L;  5DG9 A;  4U67 Q;  4L74 A;  2ZBI A;  2GGP B;  1PAE X;  2JEF A;  2EKN A;  1KOO A;  1NO8 A;  4YR0 A;  4C0H A;  2MQQ A;  1BQN A;  4QIG A;  5KFA A;  2ABY A;  2PEB A;  2CJ9 A;  3M1V A;  2VQE F;  3POT A;  1NKE A;  4OX6 A;  2Z57 B;  4CQ1 A;  3DHW C;  1YVF A;  1SV5 B;  4ECZ A;  1S99 A;  3C14 B;  4ZP9 A;  5HAO A;  5KFR A;  4RWW A;  5EWF A;  3M8R A;  2E1C A;  1VDH A;  3W1Y C;  3LGM A;  3KLH B;  4LF4 F;  1KVK A;  3FVY A;  1XNR F;  4IH7 A;  1U8W A;  5LM7 E;  2ZHO A;  3BO4 A;  1O5J A;  1NBE B;  1R31 A;  1FRH A;  1KQK A;  5D4L A;  3KLV A;  2H48 B;  3N5B A;  3PEH A;  4JI1 J;  2VA2 A;  3X1L B;  4E8U A;  1UPP A;  4PPD A;  5IS2 A;  3IP0 A;  5KTQ A;  4Y00 A;  1AYE A;  3DGV A;  3OPK A;  3KG0 A;  4ZN1 A;  1KWM A;  2B7C B;  4QR0 A;  2WSF C;  1T8E A;  1RQ0 A;  1Z2L A;  4KKO B;  5DGA A;  1B7Y B;  3BBF A;  5K20 B;  1LNQ A;  3MED A;  1UVK A;  1NEE A;  4KGM A;  5HAN A;  3BSN A;  1YBA A;  1ZZF A;  1SPB P;  2XGP A;  1LXN A;  4WWS A;  4MKV A;  3UDC A;  4DPW A;  1H2T Z;  1N5S A;  1YK9 A;  1JLQ B;  3BKT A;  5C24 A;  3R27 A;  3CGI A;  3NXZ A;  4RNN A;  3KHR A;  4A8Q A;  1N36 J;  1YKW A;  1RA6 A;  1RE1 B;  2HVD A;  3CSK A;  3DOK A;  2VG7 B;  4KC5 A;  1MML A;  5L39 A;  2OH2 A;  3N4W A;  2ZH5 A;  3HO1 A;  4WZM A;  5DO2 A;  1H0H B;  2MQL A;  2IRU A;  2ACY A;  2IVF B;  2X1A A;  4U8V A;  3MFH A;  1ZTT A;  4B3R J;  3QGI A;  2KKH A;  4IH6 A;  4B08 A;  2CNN B;  2RS8 A;  1VQ9 S;  1S6Q B;  1C1B A;  3SCK E;  1RT5 B;  4B9M A;  3QGG A;  1FCA A;  4WZQ A;  1WJ9 A;  2W9C B;  4DV5 F;  1RT4 B;  3F73 A;  4DCJ B;  1IBL J;  4ZVS B;  2EBE A;  2MXY A;  1TAQ A;  2NPI A;  2BM0 A;  2KB2 A;  3EJM A;  4DPO A;  2PO4 A;  1KEK A;  4QWE A;  3VAH A;  1VRU B;  2ZE2 A;  2E5L F;  5GAD I;  1JKH B;  1RGV A;  2CQP A;  4PQU A;  2EG1 A;  1YRT A;  4ED7 A;  3VZI A;  2C2Z B;  1TL7 A;  2F4F A;  3F56 A;  4USK A;  4ED0 A;  3UD3 P;  4B3O B;  4OZ5 A;  4XIU A;  4O4R A;  3AOA A;  1YZ7 A;  5DDR C;  2RAQ A;  4FN5 A;  4RW4 A;  1UTA A;  2E5L J;  2R2R A;  3IWX A;  1VIX A;  3QYY A;  4LSL A;  1X9M A;  3VGT A;  4Q8F A;  2DGQ A;  1QY7 A;  5KG0 A;  4RW4 B;  4B3S J;  4WTO B;  4USJ C;  3M8W A;  3HT3 A;  3IAM 9;  3TRG A;  1T02 A;  2X1G A;  4PRF A;  2UVV A;  2MTL A;  3GFY A;  3GON A;  4DPU A;  3G2X A;  1H74 A;  4P10 A;  1F6T A;  3N5F A;  4ZVE A;  1TL1 A;  3SDE B;  3WZ0 A;  1QSL A;  2CJB A;  4N8N A;  4OJ1 A;  3WX4 A;  1K47 A;  3Q2S C;  4HDG A;  3AA9 A;  2VPY B;  4I2Q A;  4JV0 A;  5CH7 B;  4F3O A;  3A4T A;  3DNC A;  1CUL B;  3H4D A;  4MK9 A;  1M5S A;  2MJU A;  3ZTQ A;  1HQU A;  1GQE A;  3CWJ A;  3KMQ A;  2H4Y B;  1YGY A;  3RB3 A;  2CJX B;  3A3N B;  5LOQ A;  2QA4 S;  1AUD A;  4U7U D;  1ZAW A;  4ZCK A;  2Q43 A;  3DLJ A;  1TFY A;  3OXF A;  1C4C A;  2AIR B;  2F8E X;  4F4A A;  2X7I A;  1N34 J;  3MWB A;  3UPF A;  4XPC A;  2NZ4 A;  1SUQ A;  1UW4 A;  4Q2L A;  4QOT A;  2BVZ A;  2DHG A;  4IYQ A;  3WBZ A;  5A6P A;  2JWN A;  4C97 A;  2OTJ S;  4HL9 A;  3M8S A;  2PI4 A;  1QJH A;  2KFZ A;  4BHQ A;  4TY9 A;  3GYX B;  1JLG B;  1Q95 G;  4RW8 B;  5D0E A;  4OYB A;  2FHO B;  1F3V A;  5H9F J;  3UN3 A;  2DRB A;  2WB1 D;  2FVQ A;  2M88 A;  4CH0 S;  3ETM A;  3NNA A;  5D6G A;  3ILI A;  2XGQ A;  1U2R A;  1ITP A;  1WD6 A;  1WHX A;  2BE7 D;  4NCG B;  1BGX T;  2B4V A;  3OHA A;  3K59 A;  3CD6 S;  4ICL B;  1NK0 A;  4ZP8 A;  2ROG A;  3GSI A;  3NWG A;  1FKP B;  5GAE U;  2VIH A;  1RHM B;  4I7F B;  1JJ2 R;  4CLZ A;  2QL9 B;  4C8Y A;  2V63 A;  1Y7P A;  3NCQ A;  1ZZN A;  5ITH A;  3MUV P;  3LGH A;  4NX9 A;  3PJ9 A;  2MYF A;  2XMU A;  2FZG B;  5DDQ C;  4F36 A;  3E01 B;  4U96 A;  3MXH P;  4E0D A;  5A8K B;  3CT9 A;  4DOZ A;  2R7U A;  1SV5 A;  1NSQ A;  2QLF B;  3UCU P;  4G1I A;  5IC4 B;  2NXE A;  3TAM A;  2VB6 A;  2YKN A;  2AD9 A;  2FLN A;  4LF9 F;  2FIU A;  4LRC A;  3R7N B;  3IMQ J;  2C2N A;  5LSL A;  5A2Q U;  1B0T A;  2MKJ A;  1OPI A;  3M30 A;  1RWV B;  1EET A;  4UUW A;  1RAB B;  2J0Q D;  3CC7 S;  3LTO A;  3CCV S;  1QUV A;  3MZI A;  4FXW A;  3TVZ A;  1QE1 B;  3OV7 A;  4EBD A;  2CQ1 A;  2OO4 A;  4IQM A;  3PR4 A;  1XNR J;  3GWC A;  1VBZ A;  2UP1 A;  1HNX J;  3BKF A;  4DWI A;  2HBQ B;  2BXJ A;  4QR1 A;  2J7W A;  3R97 A;  4PQA A;  4CT9 A;  4YEA A;  4DXL A;  4QIV A;  3GB0 A;  4JV1 A;  1U09 A;  1UMJ A;  4FXV A;  4OJH A;  2QA2 A;  1SC6 A;  1RBL A;  4V1A k;  2IRX A;  3PYD A;  4AND A;  1WEY A;  3BSA A;  2A18 A;  2ZBP A;  1SJ1 A;  2YNI B;  3M8Q B;  4LQ9 A;  4P9S A;  5IC6 B;  2E1P A;  5DQH A;  5FLX Y;  4JV2 A;  3H98 A;  4KE5 A;  4X4N A;  4FYD A;  1CQN A;  5HMY A;  4DDF A;  3GIR A;  1JLB A;  1PCA A;  2HHQ A;  4BBY A;  2GHP A;  2DBB A;  3K2Y A;  3DYA B;  4OZ1 A;  1MNE A;  3E51 A;  4ECU A;  1RTD A;  3W9H A;  3DOM A;  1SQG A;  4OZ2 A;  1ZPV A;  4KFB A;  5F8H A;  4RUA A;  4NRU A;  2L9W A;  4KGV B;  5B0A A;  3KOA A;  4IFV B;  2YQ0 A;  4LR9 A;  4TU7 A;  2ZVI A;  4PWU A;  2RDI A;  3QO9 A;  3R5B A;  2Q3P A;  4QW8 A;  3SCI E;  3T9N A;  3RTV A;  4ED5 A;  1N5V A;  4IFV A;  2MQP A;  3OFH A;  2O3D A;  3QFW A;  4ANE A;  3HMJ G;  2OEJ A;  4NLQ A;  5ETS A;  4YY3 F;  4AL7 A;  2H5J B;  3TJA A;  2YQ3 A;  2K3I A;  1NME B;  3DDN A;  3VAG A;  1J5E J;  1UWA A;  4DR7 F;  2LXU A;  3CCJ S;  2V8H A;  2HS0 A;  4K2J A;  2XI2 A;  2QMW A;  4OYA A;  5J2M A;  3GLJ A;  5FJ4 A;  2G9O A;  1VC6 A;  3CIM A;  3ITH A;  3JQK A;  3QWP A;  3FCV A;  8AT1 B;  3MUR P;  1T03 B;  4B9T A;  4YR2 A;  1M1H A;  4LMZ A;  1VQ6 S;  3PFO A;  1YZ6 A;  3A12 A;  3CC4 S;  4L75 A;  2MZT A;  5LJ5 Y;  1N52 B;  2BJ1 A;  3P6Y C;  2RH3 A;  2UU9 F;  2HQC A;  1CBK A;  2HPU A;  2OEL A;  3KUG A;  3MCS A;  3RRH A;  3KHL A;  4JI1 F;  4OZ0 A;  3QT5 A;  2K2P A;  4LQ3 A;  1YJN S;  4NLY A;  4LF9 J;  4OZN A;  3OHB A;  5C24 B;  1KHW A;  2NCK L;  1O6X A;  4USI A;  4YDX A;  1K73 T;  4R5P A;  3UFC X;  1MN9 A;  3I0R B;  4CO3 A;  1HQ2 A;  3GG1 A;  1RU2 A;  4EGL A;  3BN4 A;  4DUZ F;  2R7T A;  4UUX A;  3ZTR A;  1A0O B;  2B6A A;  1B70 B;  1WHY A;  4ELU A;  2JH3 A;  2HNZ A;  4GC7 A;  4NA2 A;  4OL8 A;  2LEP A;  3FRY A;  4YHH F;  4KRW A;  1YLX A;  3CJR A;  3EX7 B;  1FK9 A;  4F8R A;  1N6Q A;  1FRK A;  2FVC A;  1ROF A;  4ATN A;  1KNZ A;  1N88 A;  5EUH A;  2QIF A;  4YB6 A;  2G4B A;  1X4C A;  1X4F A;  4GO5 X;  5BXI A;  2N4D A;  1MWZ A;  2MY7 A;  4TLQ A;  1IM6 A;  1WG1 A;  5BJR A;  3AB2 B;  1DQ9 A;  4KQZ A;  1REV B;  3ZZT A;  4C8Z A;  5ETN A;  3JS9 A;  4DV3 J;  2HG4 A;  4PYD A;  1CJV A;  2J6U A;  2HK2 A;  1VQY A;  3LQV A;  4DU8 A;  4DL2 A;  2KH9 A;  5E3Q A;  5KG1 A;  1HNV A;  3THV A;  1XNQ J;  2FC8 A;  5LMU F;  4DR3 F;  3BSC A;  5CYM A;  3SBM A;  5B08 A;  1KFD A;  4FF4 A;  4MK8 A;  3UN5 A;  2D7S A;  4HVZ A;  5E3R A;  5K8N A;  4K5S A;  4MT1 A;  4USW A;  2HS3 A;  2FVP A;  3I96 A;  2E1M C;  4IFY A;  4DFM A;  2HWI A;  1U6Z A;  5LL6 d;  4DLG A;  2HHX A;  1JLF A;  1NSA A;  2JLE A;  2DTJ A;  2IM2 A;  4WYW A;  2DR6 A;  2P9C A;  5KFU A;  2HNY A;  5HRO B;  1K1Q A;  1S97 A;  5ETT A;  2JVR A;  3RGI A;  2FD2 A;  4HAC B;  4HHH A;  5GAG I;  2BE2 B;  3PG9 A;  3BGF A;  5A8R A;  5F8G A;  3N6N A;  1UVM A;  3CCQ S;  1RJJ A;  2J8A A;  3NBP B;  4F4W A;  1VOM A;  5T7L A;  2AYE A;  3F41 A;  5A8K A;  3BB5 A;  4EMD A;  1FVQ A;  5HL7 Q;  2AX1 A;  3VZH A;  3MR3 A;  2DGW A;  4JI4 J;  4F2S A;  1WHW A;  1YJU A;  1UA1 A;  3IRX B;  1L3V A;  2V9K A;  3DOL B;  4ZLJ A;  3OJS A;  3T9Z A;  2H3E B;  3L3C A;  2RJZ A;  2AQ4 A;  2DEI A;  2A0F B;  2QGF B;  4FVM A;  4EU0 A;  4X4O A;  2Y1J A;  5KFH A;  3H5X A;  1CS4 A;  4XAK A;  1TQL A;  2HBY B;  2DH7 A;  3IRW P;  3BJY A;  1JLE A;  4N56 A;  2F9D A;  3ONQ A;  4N47 A;  3BGO P;  4UQT A;  4JI6 F;  3SQO P;  3Q22 A;  1T05 A;  3BPD A;  4MKY A;  3PW2 A;  1SCJ B;  3OR2 A;  1U49 A;  1SL2 A;  3M6U A;  1HWJ A;  1NM2 A;  1YJ7 A;  1NK5 A;  1OJ4 A;  1WSR A;  2OSR A;  4J9N A;  2BV3 A;  2E5I A;  1AB8 A;  2COL A;  3IFE A;  2VG6 B;  3ELH A;  4DSE A;  4C8O A;  1LWX A;  3EDR B;  1C0U B;  3G96 A;  4ZHR A;  2MKS A;  2DR5 A;  4WFX A;  4F0K A;  3HVR A;  2OPP A;  3G86 A;  1VQN S;  3EGZ A;  2RQC A;  4DV6 F;  4ER8 A;  3FCW A;  4O3R A;  5SZT A;  3DN9 A;  3FBB A;  3OTD A;  5KOW A;  4C8M A;  4KO0 A;  3CJ5 A;  4QWB A;  2PDA A;  4IQX A;  2LU1 A;  3V6K A;  1KOH A;  2DGO A;  5DDO C;  2AYM A;  3HHE A;  4ED2 A;  2MGZ B;  3QGP A;  3CPW R;  1LFP A;  3OFG A;  2KI2 A;  3KG1 A;  3TAM B;  3TEG A;  1C1C A;  2N4C A;  4CYU A;  1RT6 A;  3TJ8 A;  2BOA A;  2C2E A;  4FYX B;  1UET A;  1NHU A;  1TP7 A;  5B0E A;  1OIA A;  2DNO A;  1U1K A;  3S7R A;  1HI0 P;  1U6B A;  1YWX A;  4A8Y A;  2GC8 A;  1FNX H;  4KT0 C;  1VHI A;  4K2X A;  5FLX U;  3CJ3 A;  3MEG A;  3DM2 B;  2X3G A;  3THP A;  5KAK A;  4EZ9 A;  4LIR A;  3S01 A;  1S10 A;  3R7B B;  4TU8 A;  2CQ0 A;  5KG3 A;  4CLY A;  3PX0 A;  3T41 A;  1NSP A;  3IA0 A;  2LEA A;  2KTQ A;  3DXS X;  2AW0 A;  3M6X A;  2DNZ A;  4JI5 F;  2BQU A;  3D3C J;  3Q8R B;  1LWE B;  2CNO B;  1N5Y B;  2R7X A;  3H5S A;  5A2Q Y;  2ZJQ Q;  1EZZ B;  1AXQ A;  2OML A;  4IRK A;  1N5Q A;  1RT4 A;  3R7S B;  1T95 A;  4MTP A;  5KFC A;  4IRC A;  1JWW A;  3HXM A;  2MLX A;  3HF5 A;  1T3N A;  3PX6 A;  3GFX A;  4NZ6 A;  1PYS B;  4IOB A;  4MYU A;  4CZC A;  1DTQ B;  2UXC J;  3RJM B;  2HHW A;  1UVN A;  5H1S V;  3OTC A;  4PPZ A;  3CJK A;  2W01 A;  5DGB A;  1YQH A;  4M63 A;  1RTI A;  3DRR B;  5EDW A;  1CJK A;  1RAA B;  1ZM9 A;  3U1M A;  5K8M A;  3PZP A;  2C2D A;  1RTI B;  4LT6 A;  1X5S A;  4ZP6 A;  1VRT A;  3KLE B;  2HIQ A;  3CCR S;  4DCP B;  4B3S F;  1JNR B;  1UVL A;  4O44 A;  3ISZ A;  2CQB A;  3LP1 A;  5J2P A;  1KFS A;  2YPY A;  3H2V E;  2YX1 A;  2UV8 G;  1IUJ A;  2VHG A;  4DV2 F;  1MW7 A;  4QZV B;  3CJT A;  3IO1 A;  2EFV A;  3R5G A;  3ZNJ 1;  1RYR A;  1SXL A;  4IG3 A;  1MSW D;  4DUY J;  4AD6 A;  3TX0 A;  4DV7 J;  5EGY A;  1D1U A;  2UUC J;  2ZH7 A;  5C25 A;  4CH1 A;  4H54 A;  4ZVP B;  5JXS A;  4F25 A;  3HVT A;  3H40 A;  3PIO Q;  4F4Z A;  2ZOG A;  3RR7 A;  1W25 A;  1WI6 A;  1IBL F;  3G8Q A;  4EUV A;  1OY6 A;  2FHM A;  1AW0 A;  1SC4 B;  2R42 A;  2ZC3 A;  1TL3 A;  5GAD U;  3E8O A;  2XY7 A;  4J7C A;  3ENQ A;  4C8L A;  4DN9 A;  4TY8 A;  1J27 A;  3CJQ A;  3A8I A;  3FJ2 A;  2ADB A;  4B3T F;  3OXL A;  5E3P A;  4RNM A;  3LAL A;  4OYO A;  2XCA A;  2XY6 A;  4DN0 A;  3G6E S;  1LWF B;  1UVI A;  1IKV A;  1WKL A;  5IWA J;  3MMC A;  3BGL A;  3H5U A;  4KHM A;  4UQG A;  4CCH A;  1S1V B;  3Q89 A;  1RKI A;  2PT0 A;  2VC0 A;  5A8W A;  1RAF B;  2W8K A;  4DV3 F;  2DKO B;  1YBT A;  3IM8 A;  3T1A A;  4DQI A;  2B4O A;  3UNY A;  4CP5 A;  4TLR A;  4WII A;  3MUM P;  2E9T A;  2LQJ A;  4K0K F;  2AJ0 A;  2GHV C;  3N6M A;  1U1Q A;  3TR5 A;  1NUE A;  1TKT A;  3R1L A;  3X3U A;  2D69 A;  4ECX A;  3IRX A;  3ADA C;  5AJ3 J;  3GG0 A;  5F0U A;  1KTQ A;  1TTH B;  3KMS A;  2WW8 A;  3NGR A;  2FJX A;  3Q2T C;  3G87 A;  2A2D A;  1ZS6 A;  4A48 A;  4DR4 J;  2DCU B;  2M9K A;  3EGV A;  1D9F A;  3ISN C;  2QZ8 A;  2HND B;  3RZA A;  4K4V A;  1OQ6 A;  1OO0 B;  2E1A A;  1CS4 B;  2OEK A;  2BEF A;  5B0B A;  2POK A;  2C3U A;  2BJE A;  2XYP B;  4I7F A;  4K4X A;  1Z1Z A;  3I6P A;  2IM0 A;  2XYH B;  3K7R A;  2DIU A;  3D1H A;  3MD1 A;  4CO1 A;  2BUN A;  3W66 A;  4DF4 A;  4LSN A;  4ZS6 A;  1SKW A;  5I42 A;  4F0M A;  5I3Q A;  2CNK B;  3C2P A;  4RKU C;  1VCT A;  1IXK A;  4B9S A;  3ET6 B;  4EZ6 A;  1MLA A;  4OX9 J;  1RAD B;  1HD0 A;  1Y5I B;  4IDK A;  4O0N A;  7AT1 B;  4YR3 A;  2NXC A;  3PCO B;  1LOU A;  4CO0 A;  2C42 A;  1QD1 A;  1YI2 S;  2VOD A;  4JYA F;  4DPT A;  3EYZ A;  1FEH A;  4JI3 J;  4ZVH A;  2FB0 A;  2QSF A;  5F8J A;  1RYS A;  1HBM A;  3A1Y G;  4ZPT R;  5KT2 A;  3QT8 A;  5IZH A;  4WFA Q;  1JMT A;  1FES A;  2BAN A;  4JV5 F;  4BS2 A;  1RAC B;  2CQH A;  3OTO J;  1SB6 A;  4DR1 F;  3MM8 A;  3PEJ A;  5AT1 B;  3ILL A;  4RBU A;  2VF3 A;  1VIS A;  1DAX A;  1PBA A;  1WG5 A;  4I2P A;  4PUO A;  2XMJ A;  1H98 A;  3GV8 B;  5L9X A;  1HL6 A;  4NZ0 A;  4OHX A;  4NXN F;  2B5J B;  1X31 C;  1LW2 B;  2XB2 D;  2ZKT A;  4ELV A;  1NK7 A;  4OYZ A;  3KLG A;  2J9D A;  3Q8S B;  2DY1 A;  5DZ6 A;  1LW2 A;  1M90 T;  4XK8 C;  1UL3 A;  3BSO A;  1IR2 A;  1TEL A;  1FRJ A;  4ED6 A;  3MTJ A;  1PAU B;  2LU2 A;  3TQE A;  4FF2 A;  2XYG B;  2HAF A;  1REG X;  3DOM B;  4FKX A;  2MZJ A;  2R2U A;  4XDD A;  3DHX A;  2QLJ B;  2Z2Z A;  3FEY B;  2L9N A;  1WDT A;  3OT9 A;  1RWW B;  2GS8 A;  3MEC A;  3TZX A;  2WSE C;  2A1B A;  3KJV B;  4DFK A;  1Y10 A;  2EPI A;  3PRB A;  4A8F A;  2AEM A;  1VQ5 S;  2AU0 A;  3OL6 A;  1PC5 A;  1Y9O A;  3MOJ B;  2YWW A;  1VQK S;  4NA1 A;  2XZT B;  2I8E A;  2UVR A;  1ULR A;  3I87 A;  4PQU B;  3V6J A;  1EP4 A;  1FNO A;  3D0I E;  2HWH A;  4LRE A;  4QR2 A;  1K8A T;  4OYI A;  1KD1 T;  3C66 A;  3OXG A;  3NOG A;  1CEZ A;  4G1P A;  3AB4 B;  5D15 A;  3HD2 A;  1NH7 A;  3EVW A;  1P1L A;  3MMA B;  2KL8 A;  2V67 A;  3HJV A;  5D4N A;  1A7G E;  1CC7 A;  1O0P A;  2QRR A;  2ASY A;  5IOL A;  4NRT A;  1TKX A;  1RT6 B;  2RU3 A;  1WEX A;  3NKY A;  3EPG A;  1QAJ A;  4MAK A;  1FD2 A;  1HPZ B;  3MM7 B;  4RU2 A;  1N54 B;  2OMO A;  1DTT A;  3R8Y A;  2XQC A;  5HP1 A;  2NSB A;  2J0W A;  3H20 A;  1D0E A;  2KRR A;  3W9J A;  2M8D B;  1RAJ A;  3MM7 A;  4L3N A;  1S5Z A;  5HBM A;  2N7Y A;  2NLW A;  1CJT B;  1WF0 A;  3MM9 B;  4NYO A;  2Q6B A;  3I32 A;  4U9R A;  3W2V B;  5L38 A;  3JAM Y;  1HI8 A;  1ACM B;  2BRL A;  2E7V A;  1HW8 A;  2GQ2 A;  3L4B C;  2UV8 A;  5D0H A;  4PG7 A;  4Z37 A;  1M5P C;  4ZVR B;  2CPD A;  3CO9 A;  1T94 A;  3DLK B;  3C6T A;  1MU2 B;  1UEU A;  3DRP B;  3LW5 C;  4XPE A;  3KLI A;  4DLE A;  1DFD A;  2LP4 A;  5E2Q A;  1LWE A;  3C8Y A;  1E6V A;  3OSN A;  5AXN A;  1VBY A;  2AT1 B;  5HLF B;  4DV4 J;  2RUG A;  3HLU A;  3RRK A;  1I94 J;  3JAM U;  2AGP A;  1N8R T;  2I9S A;  4ES1 A;  1HR0 J;  1B64 A;  3HZE A;  3N9U C;  2OIH A;  4P52 A;  4DPY A;  4M5K A;  5CA5 A;  1FFW B;  5I3P A;  4QWD A;  5I4M A;  1REV A;  1VQL S;  2DNL A;  1TZ0 A;  4FVC A;  4QWA A;  1TK8 A;  3J81 Y;  3IXQ A;  2WOM B;  1WI8 A;  2OSQ A;  4G65 A;  1ZA1 B;  4HLB A;  4O23 A;  2XO6 A;  3PW7 A;  4ZJO A;  3NOC A;  2HAI A;  2Z0G A;  5A76 A;  2AEJ A;  3GIJ A;  2KYZ A;  3CCE S;  1B4S A;  2Z2L A;  1X0F A;  1L3T A;  1NDL A;  3GCX P;  4C48 A;  3LP1 B;  4RU9 A;  4C3L A;  2HHS A;  1RCX B;  2NXN A;  4O3P A;  2AJ1 A;  3U1L A;  2FTR A;  3MM6 A;  2D41 A;  4ES3 A;  1S9E B;  4ALZ A;  2Y1R I;  4C8K A;  2K8G A;  5F8L A;  3SCJ E;  1UW9 A;  2J9E A;  3FQL A;  3OTB A;  2MHE A;  2P6T A;  4KHR A;  3UD4 P;  4ED3 A;  2DIS A;  4HAC A;  3R5J B;  4LIW A;  4NXM F;  3K5L A;  2XS5 A;  5G4D A;  2C2O B;  2G0I A;  3GMG A;  4TYA A;  2A10 A;  3OD2 A;  3OLA A;  4PWD B;  2NSC A;  2BKP A;  4IDK B;  1RSC A;  2ASJ A;  5D3G A;  1R7I A;  3CCZ A;  2B9E A;  3MDF A;  2KHD A;  3MEK A;  1U1N A;  2IC3 B;  2UZA A;  3W7B A;  5KFF A;  2RB7 A;  2BR0 A;  4PKD B;  1NKB A;  1F60 B;  1TL5 A;  3JTN A;  3MMJ A;  4NLP A;  4UOG A;  2PFD A;  4M5G A;  1DHM A;  1I1G A;  1JLC A;  3BR9 A;  4FKY A;  1H7W A;  1U1L A;  1QAX A;  4URS A;  1V3S A;  2J9C A;  4UOF A;  3JSY A;  3LPY A;  6AT1 B;  1PJ6 A;  4R0E A;  2V2Z A;  3LP2 A;  4OYW A;  2C1E B;  4A4J A;  2V69 A;  4HTI A;  4ZOS A;  4OV6 A;  4ZIV A;  2F8M A;  2KFN A;  3L7U A;  1FDD A;  5L8R C;  2XI3 A;  1S1W B;  1S77 D;  3JQM A;  5MLC V;  3MUT P;  3P49 B;  4C4W A;  3RB0 A;  2L08 A;  2XUL A;  2OFH X;  3OLB A;  4CO2 A;  2JLG A;  4F02 A;  3RUB L;  2ZOM A;  1PYO B;  1RP5 A;  1HIY A;  5F8M A;  4DS5 A;  4Y2M A;  3MAA A;  3K58 A;  3PVX A;  3CJ8 A;  5CZV A;  4UTG A;  4LJM A;  4DBQ A;  3CDE A;  2LDI A;  2DNY A;  4WXO A;  5BYR A;  2HQI A;  2J76 E;  2V0N A;  4RNO A;  5DLF A;  4NML A;  1EET B;  1Q4R A;  3HI9 A;  4MMO A;  3IAS 9;  4OLP A;  4TVA B;  2FJD B;  5EX0 A;  4W90 B;  1F2H A;  5HI7 A;  2CNL B;  5E7O B;  4OZ3 A;  2W9A A;  3RB6 A;  5HMX A;  2HGN A;  3HKZ D;  3LAK A;  1I5O B;  4GRS A;  4LF5 J;  3CNQ P;  1R6V A;  5HO4 A;  4KTQ A;  3KLF B;  3HVA A;  1DY3 A;  1IBM F;  4QPX A;  5C42 B;  1UZH A;  2HYI B;  1GT8 A;  5I3U B;  2QMU B;  3H42 A;  2YNI A;  2W9C A;  1TKX B;  3TA0 A;  2AYG A;  2MQN A;  4B3T J;  1GFW B;  5C42 A;  1S1X B;  4LF4 J;  1XIQ A;  3AH6 A;  4KPY A;  4P75 A;  1R3N A;  5HP1 B;  2HVH A;  1Q7L B;  3MEE B;  3TA2 A;  2PMH A;  2JX2 A;  4WP8 A;  1CJU A;  2O5D A;  4MYT A;  1W26 A;  2Y3Y A;  2HUR A;  3CCL S;  2DGX A;  5H9E K;  2ASL A;  4J5O A;  3W2V A;  4Z2X A;  3T5K A;  3DDI A;  2VBZ A;  3IBF B;  4NEY A;  3MAH A;  4ETZ A;  5SUH A;  2DD8 S;  2RD5 C;  3CXC R;  3CDU A;  2R2S A;  4KFB B;  5U47 A;  1T9Y A;  2PEH A;  3M2R B;  2YNF B;  2JOQ A;  3KK3 B;  2VKR A;  4DQR A;  2NRE A;  1CC8 A;  3EZO A;  3FSX A;  4NLD A;  1C0T B;  2VD3 A;  3GSD A;  3T5J A;  2MQM A;  1FK9 B;  1IKX B;  2KDO A;  2FVR A;  1KON A;  4KH1 B;  3HSD A;  3VAI A;  2MKI A;  1NHK L;  2EFO A;  1H6K X;  4DL4 A;  4OX7 A;  1NK6 A;  3E2E A;  1KHV A;  2VFV A;  2RVJ A;  4K4Y A;  2DXD A;  3MGJ A;  2BJ3 A;  4HTJ A;  3CME S;  5DZ7 A;  3J7A 1;  4MFB B;  3DRS A;  3BO3 A;  2VFS A;  1YTY A;  4NMX A;  4RW7 B;  4RNF A;  4USV A;  1XR5 A;  1T03 A;  1K0V A;  1FFG B;  1RHK B;  5GAH U;  5CAA A;  4NE9 C;  2ZZN A;  3IWN C;  2NPF A;  4QBU A;  2NYH A;  4M8L A;  5KT7 A;  4GKJ F;  3QID A;  4L76 A;  5CYQ A;  1RWN B;  3GCW P;  6FDR A;  2GML A;  4BWJ A;  3LP0 A;  2OPQ B;  2MKK A;  4P72 A;  2D3O R;  1RKJ A;  5LT5 A;  2GIR A;  3FUY A;  4P2S A;  3NCP A;  5A8W B;  1IWG A;  4W98 A;  5DG7 A;  1X60 A;  4G3I A;  2W24 A;  2J0S D;  3CB4 A;  4W4M A;  2VZ9 A;  4FPR A;  4FYW B;  3MPD A;  4DL7 A;  3ZZP A;  1BWV A;  1RT1 A;  1S4E A;  2U2F A;  5K5M A;  4KGZ B;  3RBZ A;  3T1Y J;  2QA4 G;  4H4M A;  3TAN A;  5B0G A;  4YB7 A;  1GNK A;  1FD8 A;  1LWC B;  2M70 A;  4DV1 F;  1AZS A;  2MMY A;  3AT1 B;  2RU9 A;  4B17 A;  3WIV A;  2WVB A;  3NRB A;  3I55 S;  1RWM B;  2VU5 A;  2YNH B;  3W8G A;  2HVE A;  1WTF A;  1KVJ A;  2CAJ A;  4UF4 A;  3JYT A;  2HVI A;  2LA4 A;  4M5J A;  2F4V F;  1NLK L;  1V5I B;  4OV1 A;  4ZIT A;  2D1C A;  2KG1 A;  2IM1 A;  1RAH B;  2F9J A;  3CVK A;  4KB7 A;  4A47 A;  3ETO A;  3UDE A;  2OTL S;  2G1D A;  1XMQ J;  1S12 A;  4YME A;  4A8M P;  3GIM A;  4CIO A;  4FBU A;  2V6A A;  3EUN A;  2N82 B;  1UVJ A;  1UJ4 A;  4OX9 F;  4DV4 F;  3GR0 A;  3NGK A;  3IR5 B;  3P8B B;  2RDJ A;  3VF0 B;  3LAN A;  4DL0 C;  3CF5 Q;  1RHR B;  1WDD A;  2JZ5 A;  2ZBQ A;  2Q66 A;  3FQK A;  3PIP Q;  1KLM B;  2CVI A;  4FBT A;  1JXE A;  4YN3 B;  1WC0 A;  2MEW A;  1LV5 A;  5GMK a;  3BGU A;  4CLW A;  1RT2 B;  2MLZ A;  4F7V A;  3GJS B;  3P5B P;  2BKN A;  4YB5 A;  4RJV A;  3D6T B;  4NLV A;  5HVH A;  4J91 A;  3DLB A;  1T3O A;  4DX7 A;  4DSI A;  1QLN A;  4OI2 A;  2A6M A;  1JLQ A;  2AP6 A;  1ZBT A;  2M8H A;  3CED A;  1QAI A;  5ETK A;  2R7R A;  1KR4 A;  2V4J A;  3E3X A;  3PYE A;  4B3M J;  4X4U A;  4DV1 J;  4RW6 B;  5CD4 H;  1KTV A;  3C16 A;  4DCO B;  4J9R A;  5D3G B;  5CHC B;  4ZLL A;  2H65 B;  1NKC A;  2V4J B;  1VJW A;  1XMB A;  3K5O A;  3KK1 B;  2R7O A;  5GMD A;  2V8V A;  3D68 A;  3MCO A;  5KG6 A;  5B09 A;  5L46 A;  4ENO A;  1IQT A;  2JJ4 D;  2YX4 A;  1QTN B;  1RLC L;  2CPE A;  3DI6 A;  5M2U A;  4ETX A;  2ZHA A;  1SQF A;  2CQC A;  3WC0 A;  4ECV A;  1KRP A;  2DYA A;  2VA3 A;  4QIE A;  3J7A N;  3MR7 A;  5E41 A;  3F0N A;  2BRK A;  4Q7A A;  4ZJQ A;  3VCD A;  3H0P A;  3V4I B;  3H2L A;  1GMU A;  3KWM A;  3LP2 B;  5IT9 Y;  5KG7 A;  3KLH A;  1X4G A;  2HIY A;  4NLT A;  2HS4 A;  3G4S S;  2DT9 A;  4ILR A;  4IO9 Q;  1S72 S;  3AY0 A;  2R2T A;  4NAS A;  3EGN A;  3GE9 A;  3OUY B;  1X8D A;  1FF2 A;  1S1T B;  2JVO A;  2UUT A;  3NP5 A;  5LMN F;  4J9K A;  3TX8 A;  4DUY F;  2IVM A;  1VR6 A;  4I6W A;  1XNQ F;  4DR4 F;  2J7K A;  4J37 A;  3GPA A;  1DBD A;  3I56 S;  4AL6 A;  1HBU A;  1O8B A;  2JFK A;  3B8H A;  3MMA A;  2WAQ D;  1DTQ A;  2YTC A;  4IG0 A;  5HQ8 A;  1X0P A;  1FKO B;  4A8S A;  3O6Q A;  2ZVS A;  3UNG C;  4RR5 A;  3DRR A;  2RKI A;  1IKX A;  3HFV A;  1RAO A;  2O01 C;  2O67 A;  1JXV A;  1FRM A;  2UUB F;  1GTH A;  4R5P B;  3BDP A;  2Y8Y A;  2LQ5 A;  4NYZ A;  1DUR A;  4MJK A;  2GZO A;  1X4B A;  4BWM A;  3H5Y A;  4B9L A;  1XQI A;  1FX4 A;  1MRO B;  1RT7 A;  3OQ2 A;  2N3O A;  1NH8 A;  3QZ8 A;  1Q86 T;  2ALZ A;  3IR6 B;  1TAU A;  4DEZ A;  2FY8 A;  2M4M A;  5KOX A;  3K5N A;  2B3T B;  3C6T B;  1H7X A;  4S0M A;  2K7J A;  5DRK A;  4F26 A;  4F4K A;  4DUZ J;  5GVQ A;  4HKQ A;  1TK5 A;  2MDA A;  2RQ4 A;  1TL3 B;  1ELO A;  3ITH B;  3PDN A;  1RAG B;  2FPH X;  3AJD A;  1Q8B A;  4RPF A;  3Q8P B;  2KXH A;  1ZOT A;  1G6B A;  1RIS A;  3SSS A;  3W5X A;  4LRA A;  4WXW A;  4EYH B;  1D8Z A;  3TO8 A;  5F9L A;  1SUQ B;  1KBR A;  1JLA B;  1M5H A;  5DG8 A;  4Q5V A;  3OVB A;  3M8Y A;  2QX0 A;  2VL1 A;  4LF7 F;  2ZBR A;  4GO7 X;  4KJI A;  1DQ8 A;  2B43 A;  2N3L A;  4GKK J;  3QLH A;  2Y9H A;  4EBC A;  2Q6C A;  1ZH5 A;  4M5D B;  1IKV B;  2HZA A;  4I69 A;  3G82 B;  1LFW A;  2FHJ D;  3QJL A;  1RHQ B;  2IRY A;  4X84 A;  4CTA A;  1ZPW X;  5KFD A;  3NGS A;  2UUA F;  5IQ6 A;  1F1B B;  4RNH A;  1SKU B;  2BAB A;  3LA0 A;  4RLE A;  5KFT A;  1CJK B;  2PI5 A;  1LWC A;  4ELT A;  2A3J A;  2VOP A;  3RBD A;  4CO4 A;  3GYN A;  1JLF B;  3H4B A;  2XZD B;  2VBY A;  3I4P A;  2IYG A;  2V2Q A;  2YY3 A;  1B0V A;  4NWB A;  1VQ7 S;  1TKZ B;  4ES2 A;  1UWB A;  2CPZ A;  3JSM B;  3BBB A;  4D3H A;  1KQS R;  4U7U K;  2GJ2 A;  2EK6 A;  1XR6 A;  2FYX A;  2HQG A;  4ZDN A;  4YDD B;  2ZD1 A;  3JTO A;  4GVB B;  3T5L A;  1BY9 A;  3CD5 A;  2ZJP Q;  1W7W A;  4K4T A;  1ZYQ A;  2E5J A;  2NYI A;  3EZU A;  4ZCI A;  1SKS A;  2B0G A;  2HLT A;  2NXJ A;  2OLW A;  3D6M B;  4KPC A;  3UQS A;  2M2B A;  2WZ1 A;  2ZZT A;  2BJ8 A;  4L73 A;  4RZR A;  1WC1 A;  2W4P A;  2BJ9 A;  3AQP A;  3U7J A;  1YJR A;  5AE2 A;  2VPX B;  2UUW A;  5B0C A;  4J9M A;  3S8S A;  4ZCM A;  4X4T A;  4I64 A;  3G6Y A;  4YP3 A;  2CZV C;  3EVO A;  3OL7 A;  4ECT A;  3OVA A;  4DS4 A;  1NPP A;  2RS2 A;  1BXN A;  2O66 A;  1HHS A;  2HMI B;  5F8N A;  4DV7 F;  2LA6 A;  4OMF G;  4URG A;  2HZV A;  2RQM A;  1IBC B;  2J8S A;  3RW7 A;  5F3Z A;  2ADC A;  2RDD A;  4MK7 A;  4L6V 3;  2HNY B;  3RBX A;  4K4U A;  5KFP A;  3PV8 A;  1HD1 A;  3BN7 A;  1SIW B;  1Q8I A;  2QLX A;  2HRY A;  3A3O B;  3PRV A;  4H4O B;  4M5H A;  2MZQ A;  2EG2 A;  3D3B J;  3O2I A;  4OYX A;  4DX5 A;  5IM0 B;  1K9M T;  2X1B A;  1DJ0 A;  3SFU A;  5HVG A;  3ISN D;  1VC5 A;  2EXU A;  3M8P A;  4NCG A;  1RTJ B;  1BLU A;  2XWY A;  4UW2 A;  2CPJ A;  2FDN A;  2ILZ A;  4NXM J;  2BDP A;  4KO0 B;  1WF2 A;  3KK1 A;  5KFB A;  2BBE A;  2FGC A;  2C3Y A;  4LFA F;  3TAR A;  1N32 J;  2JEI A;  3WIU A;  1TU0 B;  1FRI A;  2GGP A;  5DLG A;  1Y5L B;  1H3D A;  1FFS B;  3QQC D;  3VAF A;  5KFJ A;  1Q82 T;  4WE1 A;  1PJ7 A;  3MEC B;  3KJV A;  1EKS A;  1NJI T;  3I5A A;  4LR8 A;  4PXE A;  4WP3 A;  2FLL A;  2XS2 A;  4QW9 A;  2QT7 A;  2YPZ A;  4KHP J;  3VGU A;  1GXU A;  4DX6 A;  3RU0 A;  1Z2Z A;  4U7C A;  3DMJ A;  2G13 A;  3PKM A;  4WKY A;  2PMW A;  2PD1 A;  4OIX A;  3M30 B;  1RLD A;  2FZK B;  3GTY X;  2YVS A;  1BHN A;  3AOC A;  1Y3K A;  4LBI A;  3RG6 A;  2GW8 A;  2OGU A;  3SSQ A;  3Q0A A;  1Y5N B;  5JVH Q;  2ATL A;  4PG5 A;  2JEJ A;  2GQQ A;  4CRJ A;  4DMZ A;  3G8T A;  1KQG B;  1S49 A;  2ZDO A;  3D6F B;  2G0C A;  3VAL A;  1ZAV A;  3I5B A;  5ETL A;  4C7Q A;  1S0M A;  2Y0S D;  3D0G E;  2JLF A;  5GME A;  2MQO A;  4DSK A;  1KN6 A;  2RKI B;  4ZVQ B;  3KLF A;  2P5V A;  3H90 A;  1KKH A;  2ZH3 A;  3MD3 A;  5DET A;  1NJW A;  4YB1 P;  3KJF B;  4YHH J;  1P9Y A;  5KG4 A;  3PYG A;  4WFB Q;  1U0S A;  1M0S A;  3DOK B;  2GVZ A;  1F5C A;  3NMR A;  3QIP B;  3W9I A;  5BYQ A;  3MMB A;  4JI0 F;  2B4P A;  3UCZ P;  3MEG B;  1XMO J;  2FJW A;  4AXI A;  4AL5 A;  1HBO B;  1NXI A;  2RF2 B;  2UXD F;  4J9U E;  4X4S A;  3UD5 A;  2PFF B;  3BGR A;  3CD7 A;  3R3T A;  2K1R A;  3K89 A;  3TAQ A;  4BCA A;  2DK2 A;  4UST A;  1M1G A;  1FA0 A;  7FD1 A;  5KFN A;  2R8I A;  1S6O A;  4O44 B;  2XLK A;  3PO4 A;  3NNC A;  4LUB A;  3IS9 B;  4I67 A;  1P1T A;  1ZM2 A;  3B54 A;  3HUL A;  3AXM A;  4M5N A;  5HK4 A;  1Q8L A;  4ZPA A;  2EW9 A;  1F9F A;  4MFB A;  2CQI A;  4K4W A;  3H59 A;  5JMN A;  1U1O A;  2YXL A;  2K06 A;  1S9G B;  4QU7 A;  3A3P B;  4IRD A;  2WSC C;  2WOM A;  2F63 A;  3M9M B;  3Q24 A;  1WC6 A;  2XS7 A;  2CUY A;  1U45 A;  4IG0 B;  2V2K A;  3BYP A;  5DM7 Q;  2P8I A;  2DNR A;  4X64 J;  2XMT A;  2V5H G;  5AXL A;  1HHQ A;  2E44 A;  2PA3 A;  1X5P A;  3HX9 A;  4RW7 A;  4C3M A;  4ED8 A;  1N33 J;  1TV6 B;  4P74 A;  7FDR A;  4K50 A;  4O3Q A;  5IV4 A;  1Y11 A;  1FKP A;  4IFY B;  2F7V A;  2P9E A;  2V8P A;  2WVF A;  2HHU A;  3HHN B;  2IIH A;  2DNK A;  1H2U X;  3MMC B;  3OTE A;  2VQF J;  2HK3 A;  2BW7 A;  2YH0 A;  2E7X A;  4TN2 A;  5HRO A;  1N56 A;  3I0R A;  4B3R F;  2HZC A;  3GV5 B;  3W61 A;  1Y0H A;  3MI7 X;  1SL0 A;  3AD9 C;  3W5Z A;  4I56 A;  3NS5 A;  4K59 A;  2GO9 A;  2CPX A;  4PAB A;  3IWL A;  4HT7 A;  3MCM A;  4IG3 B;  1R0B G;  2WHO A;  2IAJ A;  1U0H A;  5CCM A;  4DR2 J;  1H38 A;  2DPJ A;  4JI2 J;  3UE2 A;  2Z58 B;  5ETR A;  1F3F A;  4TQS A;  1N48 A;  5C25 B;  4CM2 A;  2AGO A;  3EDQ B;  3TUI C;  3KYL A;  2MZS A;  1S48 A;  2ROE A;  3EMT A;  4CLK A;  2ZFH A;  4TYB A;  2CG8 A;  3AQO A;  2ZWP A;  3SSR A;  4X64 F;  1U1P A;  1M5V C;  1T7P A;  1SBR A;  2AEF A;  1FXL A;  3QT7 A;  1QSY A;  3KXD A;  2F5G A;  3C14 A;  2B56 A;  1C2P A;  4OI4 A;  1HNX F;  2I5J B;  2GMH A;  1QSS A;  1J2V A;  4MIA A;  1S7H A;  4C6A A;  2M52 A;  1K44 A;  1FXD A;  1JXL A;  3OFF A;  1YDL A;  2I5J A;  1C0U A;  4JI8 J;  3EPI A;  3BV8 A;  2HFS A;  3C6U A;  5K9F A;  5HJY A;  3K0J A;  4X4V A;  2HKE A;  3AJ1 A;  3KUE A;  2R7V A;  2V8D A;  2JC0 A;  4I6Y A;  3C46 A;  3S6E A;  1SC3 B;  2WON B;  2PA8 D;  3FBF A;  3ENW A;  1JK9 B;  1JLB B;  4F4Y A;  1JB0 C;  1HMV A;  1WG4 A;  2LQB A;  2P9G A;  4N77 A;  3QMQ A;  2UXD J;  1FDA A;  4I68 A;  4WKR A;  2CPY A;  1UWB B;  1HWL A;  4ZVU B;  1VQS A;  3JSM A;  2R8K A;  1EHW A;  2HFV A;  3HCX A;  4WFZ A;  2VPW B;  3B82 A;  5L9N A;  4FNI A;  2MSS A;  1NZ8 A;  1X4D A;  3FDS A;  2FJE B;  3SV3 A;  5ETM A;  1A9N B;  4Q2M A;  4PG8 A;  2CPF A;  1T9T A;  3CJ2 A;  4P7V A;  4QIW D;  2JHE A;  2WTF A;  4PYA A;  1CSJ A;  5MAO A;  4Y0F A;  3ILO A;  4OHZ A;  2QFJ A;  1FDN A;  1B0P A;  1T0T V;  2KVI A;  4X66 F;  1WC4 A;  2MQ8 A;  3MR5 A;  2EEY A;  2YKM B;  2HGL A;  2F1F A;  2KJW A;  1Q16 B;  4R8U B;  2H5I B;  2DH8 A;  3SMZ A;  4K0K J;  2EFN A;  3R2D J;  2W4D A;  5KFS A;  3HD1 A;  2CPI A;  2XY5 A;  3FZ2 A;  1UAW A;  2LVW A;  2HHV A;  2KXN B;  3TP2 A;  1KVI A;  1HI1 A;  2VG5 B;  4HI2 A;  2AYB A;  4NPO A;  1RWX B;  1N5T A;  3ICL A;  5J1E A;  1S1X A;  2EVZ A;  2L9D A;  5HVF A;  3KTQ A;  4DR6 F;  4ZPV R;  2R3V A;  3M9O B;  2IM3 A;  5LMN J;  2BAN B;  3BQ0 A;  1QTM A;  5J1P A;  4ZVT B;  1KLN A;  3BH6 B;  2YWK A;  5B0D A;  4N5S A;  2KM8 C;  4A8X A;  4IO1 A;  4N7T A;  4KHP F;  1SJ3 P;  4LF6 J;  4DL6 A;  2JFD A;  1BQM A;  1TVR B;  4NLR A;  1APS A;  1OY8 A;  1S4F A;  1WF1 A;  4OI3 A;  1VMB A;  3MPW A;  3KK2 B;  5T41 A;  1Q5V A;  2ZH4 A;  1PKU A;  4DR6 J;  2WBM A;  2BE9 B;  3BF4 A;  4LFA J;  1N32 F;  2FGO A;  1NPR A;  4A8K A;  4NCA A;  1R27 B;  3ZZ0 A;  3G6V A;  3C19 A;  3J80 U;  2A2C A;  2FHK A;  3M2R A;  1RCO B;  2DNN A;  4OHW A;  2XMV A;  2HWT A;  3MM5 A;  2BMB A;  4O3O A;  1HNW F;  5KFZ A;  4OI0 A;  4LSL B;  4BC7 A;  1FKO A;  1IR1 A;  4OYP A;  1HBN B;  3VHQ A;  2V4R A;  3DC2 A;  4IH5 A;  4NXN J;  1HYS B;  1YRU A;  5G0R B;  2CIM A;  2WB4 A;  2W2P P;  1R8A A;  2Z8Q A;  3NMA A;  2OPR B;  3VV2 B;  1V3Z A;  1EAY C;  5C7P A;  2E1R A;  2BQ3 A;  4Y3C A;  1URR A;  2OD6 A;  3DM2 A;  5M2P A;  3EM1 A;  2DHH A;  2GNK A;  2OPR A;  2WCX A;  3UCG A;  3OTO F;  4CH7 A;  1IKW B;  1YHQ S;  2AZ1 A;  2PSZ A;  3VVU A;  1TK0 A;  2UVU A;  2B9X A;  1UCN A;  5IT0 A;  4URQ U;  3IBW A;  1CPZ A;  4DF8 A;  1VS3 A;  2E66 A;  4ECY A;  4C8N A;  2ALY B;  3BM7 A;  4FP9 A;  3M2U B;  3OSP A;  2IBK A;  1S76 D;  3O44 A;  1TR0 A;  1FWL A;  2XTJ P;  1OSC A;  1U24 A;  1UFK A;  2Q79 A;  4L72 B;  5CYQ B;  5HMZ A;  4JI7 F;  3BH7 B;  3CCW A;  3US5 A;  4FS2 A;  1PYT A;  1Q78 A;  3J81 U;  9ATC B;  2UU9 J;  2FHJ A;  4LF5 F;  2LQ9 A;  4CLS A;  1LWF A;  1VIO A;  3L95 X;  3I82 A;  2DO4 A;  2NZC A;  3PNI A;  4RW8 A;  2DIT A;  3NNH A;  1BWE A;  1FER A;  3CMA S;  5LSR A;  4IR1 A;  1IR0 A;  3O5T B;  2GO8 A;  4O4G B;  4C0O C;  4Y2A A;  3KK3 A;  2W9B B;  4F50 A;  4DZD A;  3R1H A;  2X51 A;  2B7B B;  1P6T A;  1WSV A;  2NS1 B;  2OFG X;  1S1U A;  2VIC A;  3AFG A;  1TMJ A;  3ZTP A;  2ZNY A;  4RW9 B;  3TAP A;  1J5E F;  4DR7 J;  1MU2 A;  3DRP A;  5J1N A;  1WOR A;  1OSD A;  3IN5 A;  1VHF A;  3T5H A;  2BOP A;  2C28 A;  1LXJ A;  3E01 A;  4OFZ A;  4DR5 F;  2KFY A;  3ZZO A;  2HEK A;  3TOQ A;  5RUB A;  1TL1 B;  2C3P A;  2DRA A;  3O3L A;  1LEO A;  4KV8 B;  2CKW A;  1RT3 A;  3GYG A;  3W5Y A;  4F3M A;  2Y1I A;  2LQ8 A;  2GIQ A;  2YNG B;  3BPS P;  4PEO A;  4P73 A;  3PJX A;  4EWT A;  1HNZ J;  4C3K A;  4GKK F;  2BZ2 A;  1RWP B;  2KT3 A;  1FRL A;  2VBW A;  2VBX A;  3D1O A;  3PRD A;  5KFO A;  2VQF F;  1FT8 A;  1L5U A;  2DR7 A;  1U02 A;  1HWK A;  1W2I A;  1BMQ B;  3GJR B;  4R25 A;  4ZA1 A;  2FY1 A;  3HHL A;  1TMM A;  3H2U B;  2C3M A;  2HBZ B;  2IHR 1;  3FNN A;  5F0W A;  2KJV A;  5DQI A;  2YH1 A;  4ZVF A;  3MTK A;  2HHP A;  2DH9 A;  1BE4 A;  1VBX A;  3B78 A;  3K8V A;  4B02 A;  1RAI B;  2QEX S;  2GFF A;  1N33 F;  3CUN A;  4B9N A;  4HH0 A;  4F04 B;  4EFA C;  3PR5 B;  2Y8W A;  5E3C A;  4JI6 J;  1FE4 A;  2AJF E;  4KY3 A;  2D74 B;  2EC0 A;  3A8E A;  5LJ3 Y;  1L3U A;  3SQG B;  3GQC A;  2YQ1 A;  4KKO A;  2ASD A;  1K0T A;  4RW6 A;  1SJ4 P;  2XEX A;  1S0O A;  2OI2 A;  2VH7 A;  4YS2 A;  3OR1 A;  3UR3 C;  4HT5 A;  3VTI A;  4A8W A;  3B6B A;  2UUB J;  1FO1 A;  1RHJ B;  2ACM A;  4I2P B;  2ZM6 J;  2Z56 B;  2M0G B;  5B0F A;  1JJC B;  4HI1 A;  1SI9 A;  3C16 B;  2F3J A;  2J7U A;  3MR6 A;  2R8J A;  3DOL A;  3DXB A;  4C2M A;  3G8S A;  2VDI A;  3J7Z T;  1WC5 A;  2VG7 A;  4I1T A;  3EIC A;  5D78 A;  3DLE A;  1FJG J;  2W25 A;  1KQF B;  2W4C A;  3NLC A;  5JJB A;  2UXC F;  4KAI A;  1P9Q C;  2BX6 A;  2MLY A;  4NLX A;  4OLO A;  4Y2K A;  2ZZM A;  5GAE I;  1XC9 A;  4CLU A;  3SCL E;  2J9D E;  1S6Q A;  2GX8 A;  1N5Y A;  1I3O B;  1WOP A;  5IFM A;  1R0C B;  1NB7 A;  1GX6 A;  4AT1 B;  4J9P A;  4NLG A;  5A0Y B;  1WWH A;  1RTH B;  4OI1 A;  2C2K B;  3FEX B;  5EX3 A;  1HMV B;  1EP4 B;  2BJ7 A;  2CYY A;  2VG6 A;  3FC9 A;  2LKZ A;  3LO3 A;  3VVT A;  1SL1 A;  3KK2 A;  2H5E A;  4KGX B;  4M5L A;  5L1J A;  4DI6 A;  1RAE B;  1U1M A;  2HFN A;  5KFE A;  3UR0 A;  1R43 A;  3RR8 A;  1SKR A;  1UFL A;  4JBC A;  4EI2 A;  1EKR A;  2LFV A;  2B9Y A;  3MR2 A;  3CW2 C;  2VOO A;  2XMK A;  3JTP A;  4NZ7 A;  1U7L A;  4J9S A;  1N36 F;  3G71 S;  4DHV A;  4HHU A;  1R6Y A;  1V6H A;  3V6H A;  1CJU B;  3P96 A;  2JSX A;  2DO0 A;  2XSJ B;  2QC3 A;  2XSF A;  3D6H B;  4NI2 A;  3VGS A;  2FZC B;  3H25 A;  4OHV A;  5KG5 A;  1FNM A;  5CCL A;  2RIL A;  1NZA A;  1UPM B;  2Z2Y B;  3L7P A;  2JNJ A;  3TUJ C;  4XO0 A;  1UFW A;  3BO2 A;  2EFQ A;  2C3O A;  3CJ0 A;  4J9Q A;  2VFR A;  3H7H B;  4PWW A;  4BC9 A;  3PO5 A;  3PM9 A;  1CUL A;  5A6W A;  1M5K C;  2M7S A;  3GV7 B;  4NL5 A;  1B3T A;  1C1B B;  4JI8 F;  1S0V A;  1FRX A;  4FXD A;  2ZH9 A;  3QO9 B;  4WK3 A;  3SYZ A;  2E5G A;  4HH1 A;  3HP6 A;  5H9E J;  4DSJ A;  1C4A A;  3KKF A;  2RNE A;  4FDF A;  2QLW A;  3M32 A;  4RBV A;  1A6L A;  1RB0 A;  1ZA2 B;  2LLZ A;  3BZQ A;  2DGV A;  4IOA Q;  2IJR A;  2F4V J;  3UWT A;  3W8P A;  2HW3 A;  1XBW A;  4ZCL A;  4RUH A;  4JI3 F;  1MWQ A;  2D9O A;  3DLL Q;  3W2W B;  3IR7 B;  2DHS A;  2R8H A;  5KFI A;  4C0B A;  3W62 A;  1HHT P;  4WF9 Q;  3KNG A;  1TKZ A;  1H72 C;  2CQG A;  2YBV A;  1CG2 A;  2E29 A;  1QUP A;  1WAC A;  2CWX A;  1IJF B;  1OY9 A;  3Q83 A;  4HYK A;  2IY5 B;  5DM6 Q;  4AE5 A;  1HNI B;  3T1Y F;  1WHV A;  1AT1 B;  4KH0 B;  4UZB A;  2HQD A;  3V81 B;  3N79 A;  2J6T A;  5KT4 A;  3RB4 A;  5KFM A;  1M5O C;  2B51 A;  2YWE A;  3W3S A;  3CCT A;  5K14 A;  4F4X A;  4LFC F;  2BM1 A;  1WC3 A;  2MZ1 A;  1Q53 A;  2KU7 A;  5AXK A;  3L7O A;  4NLO A;  2I2Y A;  2CA9 A;  2LYV A;  5KT5 A;  2EFG A;  3W65 A;  1FI4 A;  1GTE A;  1RBA A;  1TUW A;  2I0X A;  5H9F K;  4EO8 A;  3FK4 A;  2EWH A;  3QGH A;  4X4Q A;  1VQ8 S;  3KUH A;  4AQY F;  5KFQ A;  4RBT A;  2Z4P A;  2JL9 A;  2AKW B;  3D66 A;  1NSK L;  4CO5 A;  1T9U A;  3KHG A;  4B3M F;  4IOC Q;  2NR0 A;  2ZWO A;  4JOU A;  1UKU A;  2CJK A;  3UW1 A;  3EZ5 A;  4OQJ A;  4NA3 A;  5IM0 A;  3C15 B;  5CD4 A;  1LKZ A;  4XTT A;  3DU6 A;  4UT4 A;  3VWS A;  3SQG A;  5CYJ A;  4X62 F;  4HEA 9;  2CPH A;  2QV6 A;  3C15 A;  1EJ7 L;  2KO1 A;  3UN2 A;  2L48 A;  4CTA B;  3GR1 A;  1RTJ A;  3Q8Y A;  4CWB A;  1XJW B;  4ECS A;  1R8B A;  1V3R A;  5FDL A;  3D7S B;  4V19 J;  4A8O A;  2AGQ A;  1RT1 B;  5F8I A;  3JB9 k;  1SJF A;  4QCL A;  1JLG A;  4X66 J;  3KLG B;  2HHH J;  2IA6 A;  4ED4 A;  1UP1 A;  1XN9 A;  1AZS B;  3TUP A;  1GMW D;  2CG4 A;  2B9W A;  3ENA A;  3IG1 A;  2G1H A;  3AHP A;  3JSB A;  4NEZ A;  4EO6 A;  5JUM A;  1XMQ F;  3MM6 B;  2IJF A;  2BYC A;  3M8Z A;  2KHC A;  2R7S A;  2CWK A;  4JB8 B;  1FJC A;  2YNG A;  3GFZ A;  2WVE A;  3POT B;  4G6V B;  2CZ4 A;  3NBP A;  5D0R A;  3KFW X;  4Y65 A;  1FWP A;  2YKN B;  3P45 B;  1MN7 A;  5E5N A;  2NUU G;  3IC1 A;  3D2W A;  1LK5 A;  2SXL A;  3MFI A;  1FXR A;  3THT A;  2HHH F;  3QT6 A;  4G1Q B;  5KT3 A;  4RUC A;  4J9V A;  2YKO A;  5IQQ A;  2XG8 A;  3HSJ A;  4QYR A;  3OJU A;  3PW0 A;  3TA1 A;  2B4U A;  4M1K A;  4ED1 A;  3AOD A;  2C2M B;  3CDW A;  3HPO A;  5KFK A;  1NJX A;  4M94 A;  1EB0 A;  1GMW A;  2QMX A;  3P3D A;  2IMO A;  2XMM A;  1U6F A;  1HW9 A;  4CNY A;  2F65 A;  2QE5 A;  3I4H X;  1FHT A;  1FKA F;  3L9Z A;  1T9W A;  3HK2 A;  3SEO A;  1SVD A;  3G6X A;  2C22 A;  1KDN A;  4D3G A;  1PGZ A;  4USU A;  1U8S A;  2XMA A;  2ZH6 A;  2M3D A;  3MED B;  1ZET A;  2I1R A;  2HFO A;  2YX7 A;  4Y2I A;  1BQM B;  1TVR A;  3BEG B;  2B8P A;  1S57 A;  4CNZ A;  3SXL A;  3QBC A;  4ZHR B;  5HQL A;  5HN0 A;  1TL7 B;  4DR2 F;  1IWA A;  1S59 A;  4C11 A;  4JP8 A;  2ZOF A;  1Z4U A;  3DLE B;  3TWZ A;  9RUB A;  4DJB A;  3W64 A;  3CCU S;  4UZC A;  1H2V Z;  1P27 B;  2GIF A;  3MF5 A;  3UVJ B;  1WEZ A;  5J2N A;  3BS9 A;  4LFC J;  3HKW A;  2ZHB A;  2HNZ B;  4KIA A;  2D3O 1;  3ZFV A;  4P2X A;  3GZ7 A;  2YKP A;  2RRA A;  3FBE A;  5FII A;  1N6Q B;  5D0G A;  1HQE A;  4MIB A;  2R7Q A;  3HM9 A;  3TYT A;  4FF1 A;  1RXO B;  2BA9 A;  1D9A A;  2GAH C;  2J5A A;  4DQP A;  2UXB F;  3MM5 B;  4HHJ A;  1CQM A;  2AZ3 A;  2PGC A;  3DRS B;  2YKQ A;  2PII A;  3A8K A;  1HBN A;  1TUG B;  2EFP A;  4TNO A;  3VQS A;  5AE1 A;  3VAJ A;  2W2M P;  2XLI A;  5EWG A;  1SH2 A;  4ECQ A;  2MHN A;  3EVM A;  5BR8 J;  2OEM A;  3I9V 9;  2JEG A;  3M6V A;  1VRU A;  1ICE B;  2ZE2 B;  3FGV A;  4J90 A;  1SC1 B;  3CTR A;  2VJU A;  1H73 A;  3DKD A;  2FVS A;  1VQM S;  4ZMM A;  2VFT A;  5FD1 A;  4B3O A;  1YJT A;  2QFI A;  3PTW A;  4AYB D;  1DZ5 A;  2WVC A;  4P7T A;  4QIF A;  2ILY A;  5E0O A;  3VGV A;  3TZW A;  3B4M A;  4B9U A;  4MKB A;  3PY8 A;  2FLO A;  1TV6 A;  4MKA A;  2HHT A;  2O1P A;  3PX4 A;  2DR8 A;  3RW6 A;  2W2Q P;  4P71 A;  1HNI A;  2IDL A;  1GH8 A;  3M4X A;  5F3T A;  3HDS A;  2DRD A;  2OPS B;  2MST A;  2ZUA A;  3QFH A;  3KDN A;  4WU3 A;  3N01 A;  1URN A;  1T11 A;  1IKY A;  2QG9 B;  1NDK A;  1AFI A;  4QQB A;  1ARO P;  5J2Q B;  1TUV A;  1U0H B;  3OL8 A;  1X4E A;  1QVG R;  5HBM B;  1WKJ A;  3V4M A;  3ZZR A;  1J5O A;  2JDJ A;  3GII A;  1EAR A;  2D3U A;  4LF1 A;  4PWD A;  2YKA A;  4LRF A;  2DCL A;  5ETV A;  2HSE B;  2K1R B;  3DFE A;  3FEZ A;  4ZPW R;  3IGV A;  4ZLN A;  3TVY A;  4QWC A;  2XC9 A;  4DPX A;  2HND A;  4ID5 A;  4CLL A;  3ZNU A;  3JYT B;  2DXF A;  4Y6I A;  3UI3 A;  1XEZ A;  2IVY A;  3IS9 A;  3PAC A;  3K57 A;  1HAR A;  4OZL A;  1IBK F;  2GVD A;  2VUG A;  5J2N B;  3V2U C;  2D9P A;  3KG4 A;  2P2C B;  4LSN B;  4MIW A;  1IVZ A;  2GVD B;  3HSG A;  2EC2 A;  4P2F A;  2W7A A;  3ET6 A;  4DX8 H;  3K17 A;  4KV8 A;  3G82 A;  2XHW A;  3QRP A;  4WP9 A;  1PC4 A;  1CJV B;  3S1T A;  2KZZ A;  3HHL B;  6FD1 A;  4FZV A;  4N76 A;  4ECR A;  3ZTO A;  4M5M A;  4UY8 5;  1HNV B;  4Y28 C;  2K7K A;  2H54 B;  3D28 A;  3LGN A;  3NCR A;  4ZN3 A;  2RHS B;  5L1K A;  4DZ6 A;  2AJ4 A;  4PAA A;  1S0N A;  1DLO B;  2CDQ A;  4GKJ J;  2ATC B;  4KBI A;  3QPI A;  4WFN Q;  1ZM4 A;  2VQE J;  3A13 A;  1RT2 A;  3NGD A;  1CVJ A;  3HHL C;  2CRL A;  4AUK A;  4X2B A;  1YX2 A;  4WBF A;  2YWG A;  8ATC B;  3N28 A;  2QYG A;  2QYC A;  1S9E A;  3D9B A;  1MMD A;  2GV1 A;  3LUY A;  1UEV A;  2U1A A;  1YSJ A;  3NAI A;  3RYL A;  2BE2 A;  2W8L A;  1RWK B;  2QJ3 A;  4ZVG A;  3SV4 A;  3PKY A;  1NDC A;  5D77 A;  4DL5 A;  2PC6 A;  4ZPC A;  4LF8 J;  2HLU A;  1PBU A;  2MJN A;  3DU5 A;  4JI4 F;  2AJ2 A;  4FYY B;  2B5J A;  5THW A;  3DI6 B;  4DV0 F;  3SFG A;  2AHO B;  4ZJL A;  2ZH1 A;  1AA1 B;  1G3O A;  4LSZ B;  4LRB A;  5CQG A;  1N0V C;  3M7V A;  3T6B A;  3V4I A;  3O8W A;  4NCB A;  2XCP A;  2IC3 A;  3M2V A;  2V9W A;  4ZVO B;  4DUT A;  1HKA A;  3BQ1 A;  2IDE A;  2WVD A;  4Q0B A;  2MY8 A;  2NXU A;  3D5M A;  5LXR A;  3OBI A;  2MPU A;  2E9Z A;  5A0Y A;  3D0H E;  2XLJ A;  5D4P A;  4K5R A;  5ETP A;  4HR2 A;  4LF6 F;  5EN1 A;  4I6A A;  1PO6 A;  3Q8U A;  3O1L A;  2CQ2 A;  1R89 A;  1RI7 A;  3QRQ A;  2V94 A;  2ROP A;  1Y3J A;  3FKB A;  4IR9 A;  3DRX A;  1S1W A;  3I0S B;  1P8G A;  1EIY B;  1S1T A;  2R8G A;  1UJ5 A;  2RRB A;  1VBK A;  1Q5Y A;  1VLY A;  2EI5 A;  4E2F B;  5C2G A;  4DFJ A;  1NJZ A;  2H1Y A;  3I0S A;  2XM3 A;  2KRB A;  2YNF A;  3I9Z A;  3NAH A;  1X7V A;  1LK7 A;  3R5A A;  4OI6 A;  4OYM A;  4X4P A;  2MGZ A;  3V6D A;  4K8R A;  2Y1L B;  5L1L A;  5C5J A;  5G0R A;  4DR5 J;  1QVF R;  3HVW A;  1IBK J;  1I94 F;  1HQE B;  1Q81 T;  1VJQ A;  1JQG A;  2KXF A;  1YIJ S;  1NJY A;  3NEK A;  2XSJ A;  4J9L A;  4AFF A;  4M95 A;  2I6W A;  1NDP A;  1Q1K A;  2CQ4 A;  1HYS A;  1Y4Z B;  4R8U A;  1DTT B;  4QJV A;  3J81 j;  1G2E A;  1IKW A;  4RX6 A;  1SH3 A;  4B9V A;  4ERD A;  3GP9 A;  2ZUG A;  1YBU A;  1CLF A;  2LMI A;  1GXL A;  5CXT A;  1F5B A;  1S9F A;  4GVL A;  3SIP B;  2HRU A;  2RF2 A;  2N7C A;  3EE3 A;  3CJS A;  3G9C A;  1E6V B;  5KT6 A;  1E6Y A;  1SQE A;  3DLK A;  4JYA J;  2GJF A;  3BRE A;  3MHY A;  3HFK A;  1FVS A;  2OD4 A;  1MMN A;  4DV6 J;  4LF7 J;  5AJ3 F;  3M2U A;  1E6Y B;  1I6J A;  4CLF A;  2AX0 A;  3TI0 A;  2FC9 A;  3JQJ A;  2LDY A;  4Q43 A;  3M05 A;  2DHA A;  2ZEJ A;  1QAY A;  1XER A;  2FJB B;  1Q8K A;  4GMK A;  3VAK A;  4PR6 A;  4TXS A;  2DHX A;  1JKH A;  1L3K A;  5K8P A;  2PMZ D;  2OJ3 A;  5L1I A;  4CM0 A;  1S1U B;  1VK3 A;  2DNH A;  3GFH A;  3ZO7 A;  3NGT A;  3CE8 A;  1X4H A;  3DLG B;  4QU6 A;  4NOH A;  1HBU B;  1LW0 B;  1PSD A;  4NLW A;  2BW2 A;  5HSP A;  1TKD A;  4Q44 A;  2LEC A;  1RTZ A;  2V2V A;  3K5P A;  3MMB B;  1TKT B;  4C9D A;  3N6L A;  2GHW A;  1YJW S;  2F40 A;  3D54 A;  4H4K C;  4RW9 A;  3WX8 A;  1AUS L;  1TFW A;  2VON A;  3KNA A;  1T9X A;  1N4L A;  4Z7C A;  4JI2 F;  2ZNZ A;  1RT3 B;  4USH A;  2EBG A;  2ZD1 B;  1FE0 A;  4ZPB A;  1Q7Y T;  4WU2 A;  2VC1 A;  3CDB A;  3GJT B;  3JSR A;  3SDE A;  1MRO A;  1RT7 B;  4DU7 A;  1G4C A;  2CDR B;  1JX4 A;  3AXK A;  1U4B A;  3R2C J;  4Z7Y A;  1N0U A;  5KFX A;  2NUH A;  4I2Q B;  3FZB A;  2L41 A;  3CCS S;  4K4S A;  3N0V A;  4ANC A;  2MKH A;  1U1R A;  3BBC A;  1WNE A;  5CYM B;  4ILM A;  2G0J A;  4Q8E A;  3CJ4 A;  2VDH A;  4Y34 A;  3CC2 S;  2ZBC A;  2UVW A;  2LXF A;  3TNV A;  2HGM A;  1GAO A;  2R4F A;  2IPO B;  5HLF A;  1T05 B;  5E3A A;  1HLW A;  2GCF A;  1NRK A;  3FMB A;  3U02 A;  4DG1 A;  4DR1 J;  4ZKA A;  2GA7 A;  3H8Y A;  3GIL A;  2GMJ A;  3PYF A;  1XTZ A;  1RK8 A;  2EKY A;  2WBR A;  3NGU A;  3QSI A;  4H4O A;  4M5D A;  3W63 A;  4DG1 B;  3RAX A;  1J5O B;  2KYX A;  3CMQ A;  1JLC B;  4ECW A;  4LRD A;  2QLB B;  2W2O P;  4PUO B;  5HMW A;  3I31 A;  2K3K A;  1X9S A;  4FF3 A;  2V50 A;  4LFB J;  4WTY A;  4WCE Q;  3T1H F;  1FJE B;  3AJ2 A;  1UEK A;  1VFJ A;  2AMC B;  3NS6 A;  4U95 A;  3M8P B;  3BYR A;  1T9V A;  1OYE A;  2MZR A;  2OKQ A;  3M1V B;  4ZPD A;  3FSI A;  3SZ2 A;  3CDA A;  3DYA A;  1YIT S;  5DS7 A;  4R0J A;  5KFG A;  5KFV A;  3PJW A;  3QAT A;  3QJJ A;  5C2C A;  1L3S A;  1I51 B;  1RHU B;  3MAA B;  1D09 B;  3QWU A;  3QAU A;  1KS2 A;  3DRY A;  4EYI B; 
#chains in the Genus database with same CATH homology
 2LP4 A;  1A0O B;  1FWP A;  1FFS B;  1EAY C;  1FFG B;  1FFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...