1FFGB

Chey-binding domain of chea in complex with chey at 2.1 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Further insights into the mechanism of function of the response regulator CheY from crystallographic studies of the CheY--CheA(124--257) complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1ffgB00
1EAYC 1A0OB 1FFSB 1FFGB 1FWPA 1FFWB 2LP4A
chains in the Genus database with same CATH superfamily
3LOUA 2XI2A 6AT1B 2BX6A 2RH3A 1ZBTA 3L4BC 3C16B 3L95X 5L1IA 3T9ZA 4KRWA 1IKWB 4U8VA 1XMQJ 4IDKA 2HGNA 2L48A 5J2MB 2Z2MA 1QD1A 5HLFB 4D3GA 1R3NA 1T05B 4XIUA 2W7PA 3TZXA 3HVAA 1QTMA 4QW9A 4ER8A 2FVSA 1P9YA 5CH7B 4A8KA 3IBCB 2X3DA 2AJ0A 1CEZA 4RW4A 2IBKA 1VLOA 4C8YA 1PKUA 4ECRA 3UN5A 4F4WA 1VBZA 2VFUA 4RW9B 3MMJA 4C0BA 1RT2B 1T7PA 1SJRA 1N52B 2E5LF 3IN5A 3UDEA 2R7XA 2DT9A 4GVBA 3BQ1A 2DO0A 4AL6A 1F1BB 3TQ1A 4DV6J 4WTOB 4GVLA 1RTIB 2C3MA 1CJTA 2BYCA 4ZP7A 2Q6CA 2QSFA 4ZVHA 1AFIA 2R8IA 5KAKA 2O3DA 5K8OA 5DQGA 3MEEA 1HBMB 1GAOA 3TA2A 1A6LA 3QRQA 3UFCX 1QJHA 2ZC3A 3B82A 3ZZTA 2M88A 3K7RA 3W62A 4DFKA 3T5JA 3QGIA 4F0HA 1RGVA 2CAJA 2IMWP 4QU7A 2ZH5A 3KDNA 5D15A 1H74A 1TK0A 3QJPA 1IQZA 1C0UA 4IQMA 4DPXA 4DSKA 4KGKA 3RBZA 2LLZA 2BBEA 2CVEA 2GO8A 3TUZC 4ED7A 1SCJB 2QN6B 1E6VB 1WD6A 1F2GA 2CPZA 1KDNA 3PJ9A 2GS8A 2VA3A 4LF5F 4ZMMA 2KJVA 3P49B 1KFDA 3HO1A 3QLHA 1WC6A 3OBIA 1HYSA 3MTKA 2UZAA 1OQ6A 4RUBA 3ONQA 4JI3J 2DR6A 4YB1P 4NE9C 4N5SA 1TL3A 2J7UA 1S1VA 5LMNJ 4K4TA 4JI1J 1VR6A 5HMYA 3SCJE 3SBMA 3K8WA 5M2UA 1T03A 4KSEB 1HWKA 3DOKB 3G2XA 2ZBPA 2DPJA 3Q8RB 3KUEA 2KH9A 4WXWA 3DU5A 3C14A 3LP2A 2OELA 1FDNA 1RTJA 1FJCA 2RIJA 2RQ4A 3NCQA 3NOGA 2PFFB 4QYZK 4NLGA 2QZ8A 2PA3A 5KFOA 1FJGJ 1M1GA 2VJUA 3MEDA 3UD4P 3T6BA 1QY7A 3BJYA 4RW6A 3NCPA 3D4JA 4C8ZA 2VJVA 3QRRA 1GMWA 4M5LA 1LXJA 2RAQA 3B4MA 1HD1A 4TY9A 2IDEA 4HDGA 2XCPA 2DGXA 3QWUA 3TO8A 4FZVA 2DIUA 5AJ3F 2R7SA 1S0NA 5I3UA 1HHSA 3MECB 3UDVA 1JLGA 2F9DA 2V6AA 4B3SJ 5LOQA 3F44A 2CPXA 2QA4S 4ZPDA 2YKMB 4ZPAA 1LWEB 3H5XA 4C9DA 1U2CA 3FJ2A 1XR5A 5LMUJ 1R6VA 2EFGA 1I3OB 4TVAB 3MM7A 4URSA 3VGTA 4NMLA 4C0OC 3R5BA 5L39A 4DF8A 2VFRA 5IS2A 1R8HA 1WHXA 4ICLB 3FBCA 1RAAB 2ATCB 5KT5A 2KRBA 2MTLA 1LQ9A 1Q0NA 2W24A 3QQCD 1VC5A 4B9VA 3D1QA 4OHXA 4ZVQB 4Y2KA 3MPDA 3TJ9A 4PEOA 1SC1B 1DQAA 1RE1B 2NSCA 4ZPWR 1RT1A 4EYIB 3PKMA 4DU8A 3LGHA 1XNRF 3DLBA 2ALZA 2P9GA 4OYZA 4X4QA 3IM9A 5KFDA 3CCUS 4MAKA 2MKHA 1H2VZ 2CJXB 3BSNA 1WC4A 3M2RA 2CNKB 2JX2A 4ED3A 1ZM3A 4NCAA 4Z7YA 2P6TA 2AEJA 1HIYA 3ENQA 3M8RA 1T95A 3CCES 3MMCA 2ASLA 4ZVFA 1S0VA 1VBKA 3U1LA 1QLNA 1HLWA 1CC7A 4BWJA 3UO0A 2X1BA 4L74A 4YDDB 4H4KA 3T1AA 1DQ9A 4USJC 3KLEB 4RBTA 1NPRA 2MZQA 2VBZA 1NLKL 5DETA 5H9FJ 4J9NA 3GPAA 1N36J 3KDOA 2PI5A 4UQTA 2ROPA 5E0OA 4IG0B 2VD3A 3T1HF 1T94A 1FWPA 1OY8A 3N6NA 2CQBA 4DBQA 2DGWA 4TN2A 4HACB 1AFJA 4OYAA 1S1XB 1IBCB 2MZJA 1PSDA 3SSSA 2ACMA 4QZVB 3R27A 3OJUA 3OTDA 3BGRB 1KVJA 3ITHB 1EETB 2MYFA 4CP5A 4ZIWA 2V8HA 1MMLA 1F9EB 1PYTA 3CF5Q 5AXNA 3CJQA 3ENVA 3DHWC 4LFAF 1CBKA 3IS9B 4IG3B 1KC8T 2QIFA 2DGSA 3HFVA 3US5A 3PW5A 4P7VA 1VQOS 3J80U 3CD6S 3MM5B 2FQQB 4JI7F 1IR1A 2QSWA 2J0XA 2VQEF 1O0PA 2XULA 4EBCA 4ZCMA 2UUBF 3EMTA 1RWNB 4A8FA 2G1HA 5KFBA 3BQ0A 3WHIA 4UW2A 5F9NA 1DTQB 2O66A 1YBAA 3FFIA 2CPFA 3OL8A 4DR6F 3QRPA 1DTTA 4W4MA 3CDAA 3F0NA 4M5DA 2HIYA 3CCWA 2KFNA 2DJWA 2A2DA 5IOLA 3OR2B 5BYSA 2X1GA 3PHTA 3OL6A 3EGNA 1X0PA 4ATNA 4FXDA 5HMZA 3OVSA 3A8EA 4I68A 1W2IA 3CJKB 2ZH4A 2EC0A 1XERA 5KFHA 4QW8A 4DV5F 3CB4A 2NZ4A 2D3O1 2DRAA 4UOFA 3BPSP 4P9SA 5DO2A 4LF4J 3K5MA 1H7WA 2MMYA 2VG5A 2WB1D 4RL1A 1M1HA 4LBHA 2HFSA 3KWMA 3TX8A 3OFGA 4QIEA 1VQ4S 2X1FA 1HI1A 4USUA 4EUVA 1D0EA 1JLFA 3D9BA 5DG7A 1SL2A 1HI8A 5F3ZA 1BY9A 2RF2A 3M8YA 3DRSB 3RGIA 3Q24A 1MG7A 5E3PA 4DV2F 2HVEA 3S8SA 3NGTA 2ZBRA 3ZTRA 3CMAS 3TRGA 3UPFA 1HBUA 2JC0A 4OI4A 1NRKA 3NP5A 5HMXA 1RHUB 3UNYA 1UVMA 3HD2A 3K89A 2LVWA 3NMRA 1XMBA 1VGYA 3J7YU 3EPGA 3NGKA 2HS4A 1CULA 4BBYA 1UWAA 1VK3A 2HW3A 2XLJA 5EX0A 2K3KA 4L6V3 1GNKA 1UFLA 2D9OA 4UY85 1FKPA 1XBWA 5LJ3Y 5LSOA 2ZH7A 2FJWA 3RRGA 3NGDA 2LQJA 1HR0J 1T9UA 3EVWA 5G4DA 3CJRA 2B4UA 4UQGA 1T9VA 4W98A 2V34A 2V5HG 1LW2B 4NLRA 2EXUA 5KFUA 1JLCA 1UW4A 4ILMA 4QR1A 4RNOA 2RILA 4QR2A 3EZUA 2XO6A 1XN9A 2L9WA 3BF4A 3JQJA 2V69A 1EKRA 3L9ZA 3CD7A 1HA1A 3SSQA 4WFXA 2JLEA 4TLQA 4ELTA 2VL1A 1RT7A 4CTAB 4F3MA 2RDJA 4CLPA 1KP6A 1NO8A 3MM6B 4PXDA 4JI0F 2MGZA 3KG1A 1VC6A 3DKDA 1H6KX 5KG6A 4PWDB 3HP6A 2CVIA 2GHWA 4DR5F 3H20A 2JHEA 2FDNA 2RKIB 3PW0A 4H4MB 3ZZZA 2MY8A 5HP1B 2B3TB 4I7FB 4F7VA 4CLZA 3BBFA 1UWBA 4P71A 3TUIC 1YJNS 2VQFF 3MAAA 2B7BB 3V81A 1RT5B 1NKEA 5AXKA 3I87A 5A6PA 1U0SA 4OI6A 4HHUA 3FZ2A 3M2UB 1Y5IB 1WEXA 1FX4A 3HHDA 1JLEB 3GSIA 1VYAA 2F8HA 2H54B 2OEMA 3W1YC 4WPAA 3GG1A 2LQ8A 2X3GA 2WAQD 4MT1A 4DSLA 2M0GB 2DNMA 5B0GA 1RWMB 4G6VB 4A8WA 4FF4A 3CUNA 1VCTA 3R1LA 5B0DA 2XS5A 1YRXA 1UEVA 2QO3A 2DR9A 3SDEA 1WSVA 4PPDA 2HHWA 1S9FA 4ANCA 2B4OA 3FNNA 2DNQA 1JXEA 2XZDB 1BQNB 1OSCA 4DSJA 2ZBCA 1N33F 4TU9A 1Q5YA 1YG0A 4WIIA 5HI7A 1Q82T 1UAWA 3GONA 4Y2IA 3CDBA 1F6TA 3BR9A 2H5IB 1F9FA 2KXFA 3J80Y 5CD4H 3DLGA 1NHVA 3R2CJ 2AJFE 2ILYA 3IRXB 3ZTPA 3BPDA 1CJVA 4MKBA 2HNYA 3IG1B 4ES3A 3NS5A 3BKTA 1JWWA 2GC8A 1JLBB 4I69A 4OX9F 2MZRA 4ED5A 4KJIA 3ZZRA 4LF6J 3NGSA 4F04B 2ZE2A 3AXMA 2MSSA 5BR8J 2QGFB 4O3SA 4DV3F 2DY1A 2KM8B 5AXLA 2N3LA 2V4JB 5D77A 2AYBA 5J1NA 1X5OA 2M2BA 3I55S 4NOHA 2DITA 4PQUA 3LP1B 3D28A 3FUYA 4DL0C 1SIZA 4DSIA 4LF5J 5D4LA 3M8ZA 4P74A 2R7VA 1SV5B 2XY5A 3EGZA 4FVCA 1RHQB 4Y3CA 3AHPA 2UXCF 5B7WA 5E2QA 2LDYA 1R6YA 1BE4A 1S1WA 2GQCA 1T3NA 3KNAA 2YWWA 2DO4A 1DLOB 3FBEA 2WONA 4USWA 3OHAA 3R7SB 4OX7A 3CJTA 4EI2A 4LBIA 1RHRB 1TV6B 3GFYA 3OV7A 1DJ0A 1P1LA 4YR2A 2HLUA 2PD1A 3DRYA 4AT1B 4LFCJ 2I9SA 3V6DA 4I6YA 5GADI 4ZPVR 2BE9B 4MFBB 4QYZJ 3K0JA 2VBWA 7FDRA 2VODA 2YKPA 4A4JA 1V5VA 3TZZA 5CA5A 1T11A 3LPEA 3FVYA 3CC4S 1N5YB 1SB6A 2VKZG 2CJYB 3UDLA 5B0BA 1ULRA 2GVDA 4Z2XA 5HJYA 4X65F 3RJMB 3IWNC 4RKUC 4I67A 2JEFA 1VOMA 3JQMA 4USVA 4PXCA 5IV4A 3M32A 3IRWP 3K8VA 4KV8A 3N5BA 1YTYA 5MAOA 2RVJA 3SQOP 3BH7B 4CLLA 3H4BA 3RB0A 1X9MA 2GQQA 3OQ2A 1HBNB 5KFZA 4B3OA 2KRRA 2K1RB 1C1CB 3GWCA 1PAUB 3D68A 4QIFA 1QSLA 3ULHA 3P3DA 3ADAC 2FB0A 4KO0B 2OSQA 3MPYA 1X9WA 2FJVA 3EVMA 3JSMA 5IWAF 4EBEA 3TX0A 2XMJA 3UQSA 4I2QB 1H73A 2VASA 1TKXA 2P8IA 4IH6A 3G9CA 1EQ0A 4OI2A 2B9YA 2J0QD 4J7CA 4QWDA 1XNRJ 2V8GA 2MZ1A 1ZTWA 3JQKA 3NL0A 2XQCA 2OPQA 4XTTA 2BANB 2B4VA 2D7SA 4DR2F 2J6UA 5HSPA 2IYGA 2PEBA 4KKOB 4CM2A 1TTHB 2RSQA 3CD5A 1YKWA 3N9UC 3EICA 1L3KA 2G0IA 3I0SB 4DV1F 4YOEA 2WRMA 1P1TA 4RBVA 4CO5A 1NM2A 4KT0C 2WSFC 4RZRA 1U1MA 4RW7B 2GVZA 3VR1A 2IJNA 3GFXA 2E9ZA 4KGXB 4A8SA 5KFQA 4TYAA 1G6BA 1YDLA 3EDQB 3W9HA 4AFFA 4Y2CA 2MQOA 2AZ1A 1VQSA 1AUSL 5KT6A 4YHHF 2EPIA 3ZO7A 1VC0A 2NXNA 3OW2R 4H4OB 3CJ2A 3ZZOA 2A3JA 2OD6A 2XZTB 1VQ7S 2Y1LB 2DNPA 2CPHA 2OTJS 2OFHX 3KK2B 1F3VA 2FD2A 2RQKA 3UD3P 4O44A 4LSNB 2CFXA 3J81U 5H9EJ 3TAMA 2J9DE 1P27B 1U49A 2QG9B 3DXSX 3Q8PB 2C2MB 2MKSA 3GCXP 1GEHA 3DMJB 5K8NA 4ID5A 3MD1A 2L9NA 2D9PA 1Z1ZA 3OFFA 4HI1A 4ED4A 5A8WA 2RRAA 1WOOA 1JLQB 2AV5A 3RUBL 3W60A 1T02A 2QYCA 4CIOA 3MMAA 2GIQA 2ALYB 1B3TA 3DU6A 3CT9A 3ZXWA 2ZZMA 5F41A 4LFAJ 1RAIB 2VH7A 1TQLA 2R7OA 4IR9A 1B7YB 3IWXA 3MWBA 4C2MA 1U0HA 5A8RB 1KN6A 4JI7J 2BJ8A 2M4MA 3OL7A 4B08A 1X8DA 3G71S 2VQEJ 1UFWA 3KHLA 2DRDA 2X7IA 4G65A 1W26A 2GHVC 4KTQA 2BACA 5C25A 1HNVA 5EGYA 4V19X 4UOHA 1R89A 2AX1A 1VJQA 3L7UA 4F26A 2J9CA 3MZIA 3AOCA 2V2KA 3M1VB 4N77A 4X64F 3U7JA 1RUSA 3I31A 5CYMA 1R8PA 4LRBA 4UUWA 3M7VA 1DRZA 4FNHA 4P72A 3G8TA 3SFGA 2XG8A 1FEHA 3D67A 3KUHA 2C2DA 4F3QA 2G1DA 4NI2A 1D9FA 5H1SV 3CCQS 3Q2SC 4X4UA 3W5XA 3M2VA 4DV5J 4J9OA 3TJAA 4TY8A 1YVFA 3I0RB 2CYYA 3MMBA 1VLYA 5KG5A 2B51A 2NXUA 2IHR1 2CPDA 1TVRB 1IKVB 2KVIA 3QT7A 4EO6A 1SJ4P 1S4FA 5HAOA 3I6PA 5DDQC 4HHJA 4PXBA 1E6YB 3NG8A 1AW0A 3SIPB 3MXHP 2V2VA 4DV2J 1SKWA 3C46A 4CLUA 4OX6A 1NB7A 2WOMA 3HHKA 5BJRA 1CLFA 2EC2A 2CZ4A 1WC0A 2LA6A 3KK1A 1Q8IA 1OJ4A 4M5KA 2UUCJ 5BYQA 4BCAA 4WZQA 1MROB 3TJ8A 1SC3B 2QMXA 2HQFA 3JYTB 2KG1A 4B9SA 2BJ3A 4DL7A 3CCVS 3POTB 1N34F 2V2ZA 4FXWA 2IM3A 1G1XA 5HVFA 2AHOB 3MUMP 4K4XA 4Q2MA 3DCAA 4J9KA 1JIHA 3NMAA 4KGVB 1NAQA 4LVOP 1FNXH 2YNIB 1Y5NB 1NK9A 5DG8A 4DQSA 3ENAA 3RTVA 4GO5X 1ZOTA 4IDKB 3VALA 1FKAF 4GMKA 2ZH2A 2GV1A 1YRTA 1NSAA 5GADU 1CJKA 3CNQP 4AUKA 2HQCA 4HI2A 5D0HA 2XZWA 3Q8QB 2J76E 4WF9Q 2BOAA 3FMBA 4CNYA 5ITHA 1ZETA 5LL6d 2AEMA 4RW4B 3UCZP 1X4AA 4X4PA 4F0MA 4JI0J 2V94A 3GMGA 3AD7C 4DR5J 2BDPA 1MWZA 3R8YA 4FYDA 3OFHA 5FDLA 4X4RA 3GV8B 1YJTA 4K2JA 1RTHA 1VQ9S 2VQFJ 4MIBA 4JI6F 1I94F 4GKKJ 2XNRA 1JNZB 4M8LA 2NR0A 1L3UA 4JI4F 2OPSA 1CJTB 2F63A 3H5UA 2FY1A 2HHTA 1Y00A 2WW4A 2AF6A 3S6EA 2KYZA 1TL4A 1WKJA 2Y0SD 2OMLA 3O2IA 2EW9A 4C8OA 1U2FA 2PMZD 1Q16B 2CXEA 2FZGB 2CJ9A 5LT5A 4C7QA 3IR7B 3RR8A 5ETVA 1C0UB 5LJ5Y 3WZ0A 3ZFVA 4DLEA 5EX3A 2AX0A 1WJ9A 2C3OA 5J1EA 4ZVPB 2MZTA 1XQIA 2DGQA 1RBAA 4I56A 4M94A 3PRBA 2G0JA 4M5GA 4UUXA 2YQ1A 3QLHB 3OL9A 1QE1A 2WB4A 2CNNB 1HYSB 2OPRA 2UVUA 1N33J 1UMJA 2CPJA 1H72C 4NA1A 2HHSA 7FD1A 1TL3B 4YS2A 1S1VB 1FERA 2ILZA 4BDPA 1KOOA 1GQEA 3CXCR 3G6ES 2FJBB 1T03B 3WIVA 1M5SA 3CPWR 2H5JB 3FSXA 2NLWA 1NDCA 1FHTA 1X4BA 4IRDA 2W9AA 1QUPA 3C14B 3A8IA 1GK8A 3LP2B 2U1AA 2MLYA 1RTJB 1IBMF 4OX9J 4NRTA 4QWAA 2VPZB 4OYMA 2V8PA 2CQGA 4O23A 4USTA 3CMES 4J9QA 3HKWA 1NDLA 5D3GA 1VQPS 4NYZA 4DV3J 3P45B 2FJEB 1FRIA 3JTNA 1FO1A 4J9SA 3KG4A 2DNZA 3R5JB 4Y34A 2VBYA 2B5JA 2OHDA 1XR7A 3MFHA 4L76A 2J8SA 3FSYA 4TQRA 3AOBA 3LAKA 3H5YA 1ZA1B 3DDKA 2DNGA 1XK8A 2V9WA 3R7NB 4OLOA 2BRKA 1V9OA 4DUZF 4A46A 2K7JA 2KFYA 1G7CB 4OZNA 4DCJB 3AOAA 2QE5A 1WG5A 1LK7A 1A7GE 3HVRA 1GX5A 3IR6B 1VK8A 4KPYA 2QYGA 2CNLB 1OYDA 3N0VA 3M05A 5DM7Q 4B3TJ 3D1HA 5B08A 4C8KA 5I3UB 1H0HB 4GKJJ 4IO9Q 1NJXA 4XPCA 1JLGB 2UUTA 3LP0A 3BKUA 2YVSA 4NLPA 5GMDA 4OJHA 3ENWA 2QL9B 2YNHA 2XYGB 4K0KF 3TUJC 1UVIA 1S1TB 3MM7B 3HM9A 3CCJS 2HZAA 5CHCB 4IR1A 2NYHA 4DR7J 3FRYA 3RYLA 3PYFA 2HS0A 3I5BA 4DV4F 1FK9A 2VOPA 1G3OA 3SCKE 3HT0A 5IFMA 1XMQF 1H7XA 1S9EA 2R4FA 4X65J 4ILLA 2YX4A 4F4YA 4I1TA 3TR5A 1KVIA 3DOLA 3TVYA 2P6SA 1RT1B 4OZ3A 4PYDA 1AZSA 4K7QA 3PHEA 3L7PA 2DH9A 4RW8B 3QPIA 3JTOA 2AP6A 3B4DA 2GA7A 1QM9A 1FDAA 1DZ5A 1KNZA 2XMTA 5AXMA 2ZJPQ 1N32J 3HCXA 3B54A 2J8AA 3BH6B 4PUOA 2Y3YA 2H48B 4PABA 4OZ5A 2DH8A 3M2RB 1KTVA 2FHMA 5B0AA 3MCNA 1EIYB 2H4WB 2ZHAA 4NLWA 3DLEA 2UV8A 3TWZA 5C24A 5FLXU 4D3HA 1Y7PA 1C0TA 1PJ6A 4RU9A 2VA2A 5MLCV 4O3PA 2ROGA 1BQMA 1UP1A 4I6AA 1FA0A 2ZVIA 3VAHA 2NPFA 4Y2MA 3BO3A 3T5LA 1NSKL 2D3OR 2XNQA 3MUVP 5B0FA 2BABA 5AE3A 5IV3A 4RU2A 1UA1A 3MM8A 4O3RA 4DMZA 5F8MA 1X4HA 4WZMA 3BM7A 2RDIA 4X4SA 5CCLA 3D5MA 2FLOA 4DV1J 2ZEJA 1WOPA 2W9BA 4FYYB 4BS2A 4WU2A 3EUNA 3PRVA 3DLLQ 4DX7A 1TKZA 4URQU 3KUGA 5KG7A 4OQJA 1S49A 4J37A 1FJEB 4EU0A 4EYHB 1NMEB 2MKIA 3E2EA 4DCOB 4LREA 2DR7A 3ZC4A 2HBRB 1TFYA 2DGOA 4O0IA 1X5SA 3NNAA 1NBEB 5C42A 3PM9A 2XMAA 4ECUA 2NQPA 1HQEA 4LRDA 2RB7A 2J9DA 3M6VA 2KT5A 2I5JA 5GAGI 2IBOA 2QC3A 3K5PA 1KSPA 2HQ3A 1KQGB 5F8IA 4WFNQ 1FJGF 3AFGA 2RNEA 4NEYA 1HNXF 2E5IA 4KE5A 1FRKA 2YH0A 1WHVA 1DY3A 4NX9A 5EWFA 4DXLA 4ETZA 1TK8A 2AGQA 3FFIB 4LRCA 1EQMA 2DHXA 4F36A 1DTTB 3MCMA 4M5DB 1OWXA 4EZ9A 1U1NA 3HULA 3KJVB 4ED6A 1MW7A 2WBMA 2B4PA 5I42A 4KPCA 3H98A 4CLKA 3H2VE 2CIMA 3A13A 2ZOMA 1FD2A 3HSGA 4OYXA 1F5BA 2YH1A 1YGYA 4YB6A 3LTOA 1FXLA 2KB2A 4DFMA 3KLGA 3MR5A 5CD4A 4KAIA 1X4GA 2HNDA 2B9EA 3AY0A 1TKDA 4YY3F 2XGPA 4B3SF 4RBUA 2VG5B 4IOBA 1XTZA 3QT8A 1GX6A 2OEJA 3D7SB 3THTA 5CYQA 1NHKL 5E3QA 5LMUF 5K14A 3I5AA 4ZCIA 3QAUA 2KKHA 1U2RA 4OYOA 1RAHB 2CQPA 3CJ5A 1Q86T 1RTZA 1O8BA 1YZ7A 1SQGA 4ILRA 2HRTA 4XK8C 5KFEA 5KFRA 3P4UB 1HBUB 5ETMA 1HL6A 3HVTA 2GMJA 1IKWA 1ZTTA 3W2VB 1SC4B 3KK3B 2D3UA 4HTJA 2GJ2A 1RKJA 5J2MA 1TUWA 3PNIA 4WIQA 4CDIA 1CULB 1T05A 4G3IA 1HHTP 2MZSA 3EJMA 3EGVA 1K0TA 4RX6A 1FKPB 1EAYC 1MNEA 3RRKA 3CJSA 2IY5B 2QRRA 2DR8A 1WNEA 2PGCA 3IAM9 4DSFA 1JXLA 2XMVA 1VRTA 2P5VA 5THWA 4X4NA 2J7WA 3MD3A 5U47A 2B7CB 1JLCB 2VUGA 3G82A 4HDHA 2BQRA 1RA7A 1RHJB 1PBUA 1A0OB 3ILJA 1FRJA 4C11A 2HGMA 2VU5A 1K1QA 1S4EA 4ZJQA 4MIAA 1VQLS 1JQGA 5K8MA 1RT7B 1CQMA 3I5CA 5H9FK 4LF7J 3V4MA 2LEBA 1GXLA 1S1UA 3QIDA 3CCZA 4NL5A 1X5TA 1XR6A 1D9AA 1N36F 5CZVA 2V67A 4DR1F 3TANA 4JI5J 4KB7A 4UY8T 2WVDA 5LXYA 2DCLA 4DHVA 1UWBB 5EN1A 3MAAB 1NK6A 3V6KA 5FLXY 2HHXA 3M30A 3GILA 4DL6A 2L08A 1LW0A 1E6VA 2WSCC 3L7OA 1LXNA 2PC6A 4DS4A 2YKNB 4DX6A 2V9KA 2KXHA 2ZOFA 3HDSA 4MTPA 4WTYA 2NCKL 5KFYA 4CLYA 4DV0F 4PG5A 3PEJA 4QIVA 1VRQC 2OI2A 4XDDA 2Y0BB 1IM4A 3GU0A 3MM9A 2N4CA 2JJ4D 2GNKA 4X62J 2YWEA 1S0MA 3BEGB 3GG0A 3DOKA 2Z58B 3BQ2A 4OJ3A 1FJ7A 5DQHA 1XC9A 3FQKA 4NEZA 2FZCB 4MYUA 2HFUA 3JTPA 3LUYA 2CQ0A 1BWVA 3SDEB 3ILLA 3H25A 1QDUB 3PVXA 4I2PA 4JI6J 3K59A 1AA1B 2O5DA 2QTWA 1QSSA 4JI4J 3ZTSA 4UZCA 2W8LA 3VVUA 2HHVA 4WKRA 2HFOA 2IMOA 4QJVA 1Q79A 3FBFA 3PX4A 5C2GA 3DLGB 2ZWPA 4H54A 3FKBA 1CJVB 4PR6A 2X1AA 1D1UA 1V3ZA 2C2EA 3GR1A 4Q8EA 4MYTA 1TL1B 1Q7LB 3CJ8A 5E5NA 3TAQA 2ZHOA 5ETOA 1HPZA 2LP4A 1J5OA 1J5EJ 1UETA 1Q95G 3OVAA 1GH8A 1XNQJ 3MECA 3Q83A 4J91A 5D0EA 5IZHA 4ZOSA 3R6LB 3V6HA 2KO1A 2Z57B 4KHPF 4K50A 4M5JA 3U1NA 2XGQA 4DWIA 2XCAA 1GMUA 4LF4F 2CQ2A 2OSRA 4FVMA 1ZA2B 2BJEA 4YQWA 3GZ7A 3PW7A 3RZAA 1RT4A 1CS4A 5G0RA 4OZ1A 1S1WB 2KZMA 2R2UA 1RWVB 4DN0A 4NMXA 5HQ8A 4ZS6A 2XSFA 2K3IA 2WONB 3EE3A 1U1PA 3OFEA 3T5HA 3P6YC 1XWLA 2HG4A 2W4PA 2JVRA 4B9LA 1N5TA 2VF3A 2K7KA 4ZLNA 2DHAA 1OIAA 4PPZA 3E01B 3SYZA 3V6DB 2WHOA 4OMFG 1NH7A 2BQ3A 3CW2C 1S59A 1F60B 3ILOA 5ETNA 4ZCKA 5HO4A 1RHKB 2LQBA 4USIA 3KLHA 4YMEA 1R31A 1KLMA 3Q8VA 2DGUA 2YPYA 3D0GE 3VTIA 4F2SA 2G2YA 5GAGU 2YQ3A 2I38A 5DLGA 2GVDB 1HQ2A 3UVJA 1FFSB 4R8UA 4IRCA 2I6WA 3A8JA 3KLIA 4Q45A 4LFBJ 3N79A 1HWIA 3HI9A 2J5AA 5I3PA 4I0WA 3M32B 3AAWB 1B70B 4KV8B 3TA0A 3KLEA 2ZJQQ 4LMZA 3HVWA 2R2TA 2J0SD 2BM1A 3H40A 2Q3PA 1T9YA 2V4QA 4B3OB 4Q0BA 3HHLC 3KFWX 1RWXB 2HFNA 3H4DA 1U02A 1M5VC 3HHLA 2OUGA 2XBPA 4A8OA 3LWLA 1C2PA 5E33A 2KL8A 4DV4J 1TMJA 5BYRA 2QV6A 3CDEA 3QWPA 5KOWA 2HBQB 2XM3A 4NLDA 4PG7A 2HFVA 4K4ZA 4BLGA 3VGVA 3HJVA 4C97A 5EHHA 4WFBQ 2PEHA 1YJWS 1TELA 1FKOB 3TNVA 3D2WA 4ZVSB 4WK1A 4IG3A 1YJ7A 2OPQB 3HT3A 2N7YA 2VPYB 1F2HA 1FCAA 4ZVRB 2QLFB 2RRNA 3O8WA 3QIPB 1I5OB 3LGNA 1QVGR 2IVYA 4QR0A 4A8YA 1P9QC 4CYUA 2YX7A 4S0MA 5CAAA 4MH8A 2HRYA 3IC1A 2IVFB 1QUVA 4AE5A 2GVZB 4C3LA 4WYLA 2QX0A 1ZM2A 2HKEA 2IRYA 4QU6A 2HMIA 2BW7A 5L1KA 3SQGA 4P2FA 2J6SA 1H3DA 5KT4A 2FVQA 3M6UA 3E3XA 2P9EA 3NEKA 4QPXA 2HWHA 3D6TB 3OR2A 2UXBF 1VI7A 3IA0A 2ERRA 5JMNA 4F4KA 1MN9A 4LF6F 4OYIA 2B8PA 3BO2A 4O44B 1N0VC 3CJKA 2E5HA 1IUJA 3IGVA 5BR8F 3KMSA 3TAMB 4B3MJ 3GJQB 2JLFA 2EVZA 3I4PA 1DFDA 5GMKa 4KIAA 4ZCLA 2ZFHA 4ID5B 4KFBA 4O4GA 1LWFA 3EWGA 5A8WB 4CO4A 4DQRA 1UPPA 1WHWA 3GYNA 4DSEA 4DPUA 2AGPA 2LQ5A 4PAAA 3T1YJ 3KJFB 5DDRC 4ZDNA 3SXLA 1F0XA 3G6XA 4YR3A 4USMA 3IGNA 1B4SA 2ZUAA 3MTJA 3QGHA 1U0HB 3M8QB 4R25A 3ZZ0A 4U67Q 1TKTA 2RRBA 3U27A 2A6OA 1ELOA 3I96A 4IQXA 3GQCA 4QWEA 5C25B 1HNVB 4EZ6A 4LFCF 3EZ5A 4JV1A 3R1HA 3QBCA 1HNXJ 1CG2A 3VZHA 4JV5F 1FD8A 5D6GA 3UN2A 1KONA 3K5LA 3N6MA 5CYMB 1FXDA 1RAGB 4OHYA 2EFNA 4ETXA 4FS1A 1QAYA 5K9FA 2EG1A 2E5GA 4RWWA 4ZP8A 1N6QB 1NU4A 4OYPA 3AD8C 2W2PP 2WVBA 2IDLA 2E9RX 4CLTA 2FVRA 4ELVA 4NI2B 1JB0C 3NBPA 2LCWA 1HQUB 4Q44A 2FVCA 2EWHA 3C6TA 3M2VB 2VPWB 1SPBP 4TY8B 1K44A 4YY3J 3MMBB 4L75A 3DOMB 3MM6A 2W2QP 4HTIA 2BVZA 3DGVA 5DS7A 1U25A 1U1KA 3PYDA 4PG8A 3LQVA 4WU3A 5DDPC 3BGOP 4B9NA 2GCFA 2YPZA 1BUXA 4USHA 3HFZB 3PEHA 2SXLA 2B0GA 5A0YB 2UXDF 7AT1B 1TFWA 1UEUA 1BC6A 1RT3A 2AYMA 1Z2LA 1PIEA 1LFPA 5KOXA 2WOMB 3SZ2A 4XAKA 2GZOA 2BRLA 4OLPA 4DFPA 3KK1B 3DFEA 1YSJA 4DL2A 1JJ2R 4ANEA 1B7FA 3EM1A 4K4YA 1JLEA 2HWIA 1S79A 1OS5A 5JXSA 2OO4A 3P5TL 4A8XA 2IA6A 3RAMA 3IAS9 5KG4A 3W9JA 1WI6A 3LANA 4J5OA 3PCOB 1R43A 4YP3A 4JOUA 3PJWA 4C3MA 1C4CA 2H65B 2W8KA 2RMLA 2MKYA 5DZ6A 1CJKB 1M0SA 1YBUA 2C28A 1HBOA 4R0EA 4PKDB 5DRKA 1CJUA 4IFYB 4H4KC 4DG1B 2GHPA 1X4DA 2B6AA 3RRHA 2NZCA 2HGLA 2WVCA 2OFGX 1NSQA 3C15A 1FNMA 4B02A 4NLVA 3P8BB 4CQ1A 3NRBA 4DR1J 2OP5A 5J2QB 5FDLB 1TK5A 3VCDA 4ED2A 3MF5A 4YR0A 1RTHB 2HRUA 1QAXA 5H9EK 4P6QA 4OL8A 4K4UA 3MAHA 1FDDA 2XY7A 2V4JA 2V0NA 1U09A 3D54A 1H38A 2N3OA 2OPSB 2R7RA 3CC7S 1HHQA 2M9KA 1QSYA 1NHUA 2LMIA 3LAMA 1SV5A 4KHRA 1S6PB 4K59A 2APOA 4DV0J 3PYGA 3UW1A 2F3JA 5KG3A 4XO0A 4ZPTR 4C0HA 2IRUA 1IKXB 4F67A 4JV0A 1K8AT 2AQ4A 4DPYA 3DI6A 2IM2A 4RWXA 5J2NA 1DLOA 1LOUA 1NDKA 2JZ5A 4RUCA 2AT1B 3EXYA 2DNNA 4LR9A 5J1EB 2UVRA 4DZ6A 3BZQA 4R5PB 3ISNC 3RBEA 3MCSA 3U1MA 3M9OB 2G2OA 2UUWA 3RU0A 4X66F 3FSIA 3GIRA 3TARA 2YKQA 3PW2A 3CDWA 1QE1B 1S9GA 2YNGA 1YK9A 3MEGA 2OPRB 2RT3A 5EUHA 4N47A 3FEZA 2FVPA 3QT6A 3FZBA 1U48A 1S7HA 1VQYA 1R0AA 3FCHA 4MIWA 3GR0A 2HAIA 1K47A 2A2CA 4UOGA 3GYXB 1WWHA 2F40A 3R7BB 3MOJB 2C42A 4J9UE 1RT6B 2W7OA 1REGX 3BR8A 4K2XA 1T9TA 5D3GB 1S97A 1OY9A 3J7Z5 3PFOA 3PY8A 1NJWA 2MKJA 2WK4A 3R9LA 2EG2A 2AD9A 1JJHA 2CDRB 3R5CA 4KHPJ 3OVBA 3OUYA 3J81j 1ICEB 4GC6A 3HHLD 2R8HA 4DF4A 1U1QA 3PXGa 2HHPA 1VRUA 1IWAA 3SEOA 3I32A 1OSDA 4O3OA 2K1RA 3W5YA 4F8RA 4NXMF 3C8YA 1NXIA 2C2KB 4DFJA 1I51B 1JJ4A 2RS2A 1MLAA 1CQNA 1LV5A 3MPUB 1NK7A 4PZVA 2DGVA 1WF1A 1KS2A 3PIPQ 1BD6A 3OTEA 1RLDA 3LP0B 4FDFA 5GAEI 1IVZA 4ZLLA 1Y10A 1EX8A 2UUCF 1AUDA 1UKUA 3PV8A 1ZAWA 1RZMA 1KFSA 3QO9A 3K2YA 3I4HX 5A2QU 3CMQA 1S12A 4HH1A 3MDFA 1Q78A 1SUQA 2BANA 3PZPA 1OYEA 1FWKA 1FK9B 4QYRA 3HX9A 1PAEX 1ZZFA 1WC3A 1MMNA 1LK5A 1S9EB 5KFKA 3CWJA 2H3EB 2CQ3A 1LWCA 4M63A 1WACA 2CQ1A 2RHSB 1AZSB 3BN4A 2MJNA 1KHVA 4C8MA 4YEAA 1RWPB 2QA2A 3CO0P 3ICLA 4JI8F 3AJDA 3D6MB 4NCGA 4PUOB 2CRLA 2HYIB 1WKLA 2YQ0A 4DPTA 5D4PA 4E0DA 1F5CA 4LSZB 1RYSA 2L3MA 3KK2A 1WG1A 4USKA 4LF8F 3DLEB 2G0CA 1ZM9A 4GKKF 5C24B 3V4IB 3G87A 2ZZTA 2IFXA 1C0TB 1U6ZA 1T9XA 4P7TA 2FLLA 3M8PB 4G1QA 1X31C 4Y00A 1R8CA 1WF0A 4C98A 5C2CA 3FCVA 4BC7A 1MMDA 1NJIT 3KYLA 1MWYA 1JLQA 2VPXB 1WDDA 3CCLS 2E7VA 1BHNA 4C4WA 1MWQA 4DR4J 1RCXB 2UU9J 1HWJA 2UVWA 1YBTA 2Y1IA 3MM8B 1Q4RA 4RUHA 3PX6A 1YJVA 1GTEA 2NYIA 1KD1T 4B17A 5DGBA 1SKRA 4RNFA 2ZDPA 3FQLA 1RWKB 3NGRA 3PDNA 1RBOB 2ZOGA 3N4WA 2NPIA 2W9BB 2XB2D 2Y8YA 1PO6A 2HPUA 5FIIA 1YQHA 2Z4PA 1BLUA 4CWBA 1TKZB 2FC8A 4PG4A 3M8WA 2HZCA 1XIQA 3MR2A 1GMWD 3THPA 4YFUA 2MLZA 3S7RA 2GJFA 2MPUA 3DYAA 3AD9C 3Q8SB 2F8MA 2D3ZA 1URRA 2EEYA 2UXBJ 2DNYA 3KTQA 2CWKA 5C42B 4IUFA 4XPEA 1FRMA 4KR0B 2I5JB 4OHVA 8RUCA 2XO7A 3KXDA 4WE1A 4JUZA 3TW0A 2CKWA 2QA1A 2BQUA 3W2WA 2POKA 5JVHQ 4M5IA 1R8AA 2FUG9 5SUHA 3OTOF 4J9RA 3FRZA 1HW8A 1RHMB 2G4BA 2VONA 2AIRB 4CH7A 1TVRA 4TU7A 1UVNA 2YWKA 4CO2A 3ZZYA 2XMUA 1SI9A 4FBTA 3KJQB 3VAJA 1HNZF 2CWXA 1VS3A 5I42B 1FRXA 2V8VA 2AJ2A 2EBGA 2ZC4A 1WUUA 4U8YA 2JEGA 2V4RA 1U26A 3FMWA 1NK4A 2LFVA 1DBDA 4CM0A 5GAHI 1AXQA 4B3TF 1WEYA 4CH1A 4GKJF 2B56A 3S01A 5K8PA 3KLGB 6FD1A 2HNDB 4OFZA 1SH3A 3MFIA 4C48A 4EO8A 2J0WA 2BKOA 3HD1A 4PRFA 5T7LA 5K14B 3WC0A 5D4NA 2ZD1A 4JV5J 4MK7A 3MPVA 1S48A 3NAIA 3RB6A 3E8OA 4DR7F 2DHGA 2ZZNA 1KBRA 2RUGA 2MB0B 1X7VA 5IQ6A 3QFHA 5LXRA 3DN9A 1NK5A 2DK2A 2VFTA 3HVTB 2YNIA 4TLRA 4ZHRA 4B9UA 2A6MA 2Q1LA 3LW5C 1NZ8A 3PACA 3V6JA 2GQ2A 2FY8A 4YN3B 3T3FA 3IR5B 4ZVEA 5A2QY 2EK1A 2IYIA 5DGAA 1C1BA 5ETQA 3WDOA 3DGPB 3MOZA 1VQ8S 1O6XA 1GXUA 1N32F 2GGPB 1K1SA 3FEYB 3A3OB 1VRTB 3RW7A 2H1YA 2ASJA 5DZ7A 4NA3A 1SJFA 1OMSA 2PSZA 3DLJA 3G82B 4FPRA 2UXDJ 3MHYA 2QLWA 2P2CB 3C3LA 2AEFA 4C11B 4QIWD 3CDUA 1SC6A 2N7CA 3Q23A 2PE8A 4CZCA 2QMUB 2O01C 2JWNA 2FHJA 3OTCA 4FF1A 1IR2A 2RQCA 3IWLA 3EPIA 1TP7A 1EARA 3VGUA 1S1UB 3BGUA 2YKOA 1X5PA 3TI0A 4AQYF 1IXKA 1C4AA 4DZDA 3HXMA 3CSKA 6FDRA 2VC1A 1GT8A 3OR1A 4K4SA 2LXIA 3ISND 2CQ4A 4WK3A 1SL0A 5I4MA 4KY3A 4MK9A 2FGOA 2W9CA 5GAEU 3M30B 4F02A 2V8DA 3D6FB 3K57A 1LW0B 3FK4A 3I82A 3WQPA 4DV7J 1U6BA 1VHFA 2M8HA 3KLVA 1ZM4A 4PWWA 2ZJRQ 5D8HB 3T41A 3K58A 3C6UA 2DHHA 4JV2A 4LQ9A 1Z4UA 3VGSA 1YJ9S 4B3RF 3J7YI 3GIJA 1RWUA 3UCGA 1T8EA 3MM9B 3NS7B 2W2OP 4O0NA 4DJBA 1N5SA 5KT7A 1B0VA 3DXBA 3JSBA 4Q7AA 1WOSA 1VQKS 3A8KA 3G6YA 2JDJA 3IFEA 1T9WA 5M2RA 2OIHA 2BJDA 4OJGA 4HL9A 2LU2A 2DNOA 3ZZUA 2OGUA 2ZH9A 3K5NA 3LGMA 1V5IB 3ET6A 4HR2A 4M95A 4I2PB 1HWUA 5ETPA 2DEJA 2MQMA 1U1OA 4FPIA 2A0FB 4WXOA 3DRRA 4NASA 2D74B 2FGCA 4U6PA 1EKSA 3PW4A 1G2EA 2BW2A 1FWLA 1RYRA 1JX4A 1PBAA 1CPZA 5AT1B 1U24A 3TZYA 4WKYA 3QGGA 1RI7A 3A12A 1ZAVA 1R0CB 3NNHA 4IO1A 3OXGA 1O5JA 1HPZB 1REVA 1J5OB 4PXEA 2HIQA 4DN9A 4ZP9A 4OV1A 1HMVA 2FHKA 5E3RA 4Q8FA 2FJAB 4X66J 3TZWA 1YI2S 3ZTOA 1FX2A 2F7VA 1S1TA 3M6XA 1SBRA 1RT4B 4LF1A 1CS4B 5G0RB 1IBLJ 1EJ7L 4HH0A 4P73A 3UE2A 2NS1B 4U95A 1UFKA 2HVIA 3Q8UA 4DS5A 1L3SA 3HK2A 2E66A 5HQMA 5IC6B 3CEDA 2HK2A 4Y6IA 1N54B 3GIMA 1BQXA 3DC2A 2FIUA 5A76A 3H59A 2XSJA 2FPHX 3QJLA 1GTHA 3TAPA 2EFVA 2IVMA 1RTDA 3FC9A 1UA0A 1ZPWX 4RNHA 3R3TA 5KG2A 5GMEA 3AQOA 4ZVTB 4J9VA 2RE1A 5KT2A 2MKCA 4RW8A 2OAUA 4DR3F 3Q8YA 4FXVA 3KLHB 4WFYA 2HS3A 1KLMB 1EHWA 3A1YG 1KOHA 3HSZA 4RJVA 5HBMA 1NKBA 1L3TA 1N0UA 5HK4A 1JMTA 3MR7A 4V1Ak 2QLXA 4NXMJ 4F50A 2DXEA 5IT4A 3UVJB 3UN3A 3QT5A 4R8UB 5DG9A 1KHWA 3G4SS 1X4EA 2HLTA 4ZN3A 2XEXA 3KLIB 1PG5B 1X4CA 4AL7A 2YNFA 2K8GA 3PYEA 3EDRB 5IM0B 2IM0A 1D9DA 1IBKJ 2WZ1A 4NRUA 5F8NA 2G2ZA 3RR7A 4WYWA 2BUNA 5J2PA 3W5ZA 4ZIVA 3BDEA 4LF7F 4ELUA 2OD4A 1Y3KA 2KT3A 5AE2A 2C3PA 3PR4A 1VIOA 4GO7X 5L46A 4MKYA 5IQQA 4FBUA 4Q0BB 3UDCA 1S6QA 2DRBA 3HHLB 3MEKA 1N48A 4OZLA 4LIWA 3QSIA 1HNIA 4JI5F 4M5HA 5GAHU 1RAFB 4NXNJ 2V2QA 1AYEA 5M2PA 3C66A 3OHBA 3DM2A 4P2SA 2ZH1A 3RAQA 2CJBA 1VQNS 4ED0A 4DQQA 3NCRA 2LEAA 3QAEA 2RHQB 2A18A 1TAQA 3H42A 8ATCB 2E29A 1PYOB 3QYYA 3BO4A 1O51A 3AB2B 2DTJA 1RAOA 4E2FB 4JI8J 3WIUA 1N4LA 3UCUP 3JSRA 3H90A 4X62F 2R7TA 4K4VA 1RU1A 2Z2ZA 4FS2A 2R2SA 3CE8A 3CCMS 3SV3A 1Q8KA 4QBUA 4GC7A 4R0JA 4UZBA 4CYUB 3H8YA 4LF8J 3TVKA 1UZDA 2D69A 4GVBB 3OPKA 2LXFA 4KGMA 2HMIB 3T5KA 1X9SA 3N5FA 2CPYA 3SQGB 5D4OA 1RK8A 8AT1B 2C3YA 2W01A 4YB5A 2YWFA 4UOCA 3MEEB 2HBYB 5KTQA 3KJVA 4DX8H 3TYTA 4KC5A 3KOAA 4JYAJ 2WCXA 4ECSA 1OY6A 4OHWA 4DI6A 3W64A 1Q8LA 4FP9A 1Y0HA 4YB7A 1OPZA 4A8MP 4ED1A 1J5EF 1MN7A 3J81Y 3MGJA 3WX4A 1XNQF 3TA1A 3NKYA 1S7IA 2UUAJ 3TVZA 1TAUA 1U1LA 3W8PA 2CQCA 4KFBB 4O4GB 1LWFB 4N76A 1X60A 2LQ9A 3LO3A 3GTYX 4LR7A 5ETSA 3TQEA 1XMOF 1NSPA 1WORA 4DUYJ 2W1BA 4WP8A 1KEKA 3O6QA 3AODA 3W65A 3CC2S 4J9MA 4KYZA 2E1CA 3G8QA 4P2XA 1UPMB 2IRXA 1RABB 4N8OA 3SCLE 3F73A 3BB5A 3CULA 1Y3JA 3W2VA 4MK8A 5F0WA 1TKTB 5F9LA 3W66A 3KK3A 2YWHA 1FI4A 2DVIA 4CLWA 1HFEL 2HNZA 4NLTA 2VG7A 3LH2S 1UVLA 2YTCA 3MEDB 5HN0A 1XEZA 3OTOJ 1UJ6A 4F2RA 3OXLA 2BM0A 1RKIA 1Z2ZA 1OO0B 2H5EA 4RW6B 3UWTA 1JK9B 3AH6A 1HNWJ 2JC1A 4Y2AA 3MUTP 4ECWA 4DL3A 1WI8A 2BE2A 2FZKB 1HNZJ 3OT9A 1IWGA 2W2NP 2ZVSA 1Y9OA 2QA4G 2HQIA 3UNGC 2FHJD 4ZP6A 3C19A 1IJFB 2C2RA 4M5NA 3T9NA 3THVA 3NBPB 2HWTA 4LFBF 2HVZA 1DAXA 4LSLA 3C6TB 2VKRA 1DQ8A 1NKCA 2XS2A 2X51A 3W63A 2Q43A 3TOQA 4ZK7M 4NPOA 2AYGA 3MAQA 2B43A 2B9XA 4URGA 3FEXB 4U7UD 1X0FA 4UF4A 3T19A 1D8YA 5HJXA 1RWOB 2VZ9A 2CQDA 1FVQA 4F4AA 4DU7A 4JP8A 1M90T 2VDHA 1RT3B 2VG6A 2W4CA 2FJDB 1SH2A 1KKHA 1RP5A 3D6HB 3ZNUA 5GVQA 4HEA9 1F9HA 1NDPA 1NNDA 1RB0A 2YKNA 4Q5VA 2CG4A 1ZYQA 2PMWA 4YDXA 2C3UA 2OLWA 5DM6Q 3BBCA 3JXOA 2CDQA 2FTRA 2E1AA 5HROA 3MR6A 4QWBA 4J90A 2KXNB 3PJXA 1OQ3A 4M5MA 2AU0A 3J7A1 4OV6A 2J7KA 4Y0FA 3JSYA 1MU2A 5IXUA 3N01A 2RU3A 3I56S 4CRJA 5C7PA 3O3LA 2E5LJ 1SIWB 3MMCB 1L5UA 2PFDA 5FJ4A 2GMLA 1HBOB 4ED8A 1UTAA 1D8ZA 3VV2B 1VFJA 3FGVA 1CJUB 3CCRS 4EGLA 3OJSA 2B6AB 1APSA 5CCMA 5EWEA 4IFVA 1ZPVA 2B8QA 2ZITA 5HATA 1B99A 1JLAA 1WKKA 2E1PA 1RCOB 4U7CA 4MKAA 2PMHA 2W2MP 4AQYJ 1NJZA 3C15B 2H4YB 1JNRB 1TL1A 1TL7A 2OJ3A 5D0GA 2Q66A 4F25A 4OX8A 1Q8BA 1M5PC 2CA9A 4CT9A 4N41A 4B3MF 2MQPA 3GJTB 3ZZPA 1WF2A 3I9ZA 2UV8G 1NH8A 5IC4B 2JVOA 2OH2A 1R7IA 3VZIA 1LKZA 2OPPA 2PA8D 5ETLA 4B3RJ 3BSCA 2E5JA 5A8KA 4FF2A 2V68A 3F56A 1NJYA 3R2DJ 2AZ3A 3VF0B 3T1YF 2DISA 3T6JA 4AXJA 1HARA 1AROP 2QFIA 2COLA 3DI6B 3PX0A 5J2NB 4KHMA 1TUGB 4C3KA 5F3TA 3DRPA 5B09A 2HHQA 1NB2A 1VMBA 4NLXA 4EEYA 2IC3A 1R0BG 1RADB 4DPWA 5RUBA 4ZVOB 2R8JA 2G9OA 3E01A 1S9GB 2YNGB 3MEGB 2BE7D 3UR3C 2MJUA 2DYAA 2E9TA 1SJ3P 2ZM6F 4ZN1A 4Z7CA 2CUYA 3MR3A 2CG8A 4ZJLA 2IAJA 4I6WA 2JNJA 1R0AB 2NXEA 4EWTA 1RBLA 4J9LA 1KQFB 1EB0A 5BXIA 2R2RA 4PG6A 3I9V9 4NWBA 2R7QA 2YWGA 5EWGA 1JKHA 4O4RA 1Y5LB 1VJWA 2HVHA 2ABYA 1H2TZ 4Q2LA 1TU0B 1Y11A 1S6OA 1WC5A 5AJ3J 4OZJA 1IKYA 4Q43A 3JAMU 2XC9A 2LA4A 3D0HE 1SL1A 2GIRA 2MXYA 2DB1A 3ZTQA 1EP4A 3V2UC 1YWXA 3GJSB 3DLKA 3OUYB 1W7WA 4JB8B 4ECTA 1FTCA 2DD8S 2VC0A 1D09B 3IO1A 1NPKA 3P96A 4DX5A 1VBXA 3CTRA 1UJ5A 4HLBA 3HZGA 1VRUB 3KLFA 5J1PA 3W61A 2ADCA 1JLFB 1KR4A 5CQGA 2AW0A 2XYHB 4OIXA 3UD5A 2EFPA 2RF2B 4P2MA 4RLEA 4EMDA 1FNOA 2E7WA 3U02A 1VDHA 4X2BA 1CSJA 1NPPA 3CCSS 4ECYA 3H5SA 4ANDA 3C16A 1T3OA 3EZOA 1B64A 3R5DA 3KJNB 1U4BA 2C2OB 4I4BA 4RNNA 3KKFA 3QO9B 3TP2A 1UW9A 5HLFA 1ROFA 1M5HA 3J7ZT 1FKOA 2GIFA 1M5OC 3H7HB 2DXFA 4DR3J 1SUQB 5ETRA 2MKKA 4CLFA 1K0VA 4ZVUB 2EKNA 1IQTA 3OSNA 3NNCA 3QIPA 1I6JA 3Q89A 3DDIA 1FRLA 1VISA 4LJMA 3AJ2A 5L1JA 4RW9A 5CXTA 2EK6A 5KFCA 4IKAA 3WX8A 3LPYA 4WBFA 1RT2A 4LF2A 3GFZA 3W8GA 1LWCB 5A6WA 2CJKA 2AWZA 3RAXA 2RU9A 4FKXA 2XHWA 2DEIA 3IMQJ 2KI2A 4WWSA 3SCIE 1RTIA 1KLNA 3OD2A 3RB4A 3AA9A 2XI3A 2RQMA 5ETKA 3SMZA 4CCHA 4ZJOA 2QT7A 4NCGB 1S57A 4EFAC 1HBMA 4K8RA 1V3SA 2QLBB 2MGZB 1YZ6A 1NK0A 1TMMA 1ZZNA 3M6WA 4RUAA 1U7LA 1KQKA 3T1HJ 1SKUB 4NZ7A 3BREA 4NZ6A 2I2YA 2MHEA 3V81B 5D0RA 1U6FA 2MEWA 4LIRA 4G1QB 5KFIA 1UCNA 3CO9A 2VICA 4JI2F 1CVJA 1RDRA 2PT0A 4ECQA 3HSJA 2AJ4A 5L1LA 3BYRA 1YJUA 5T41A 4C6AA 2CJAA 2IJFA 4LRAA 1RJJA 4W90B 2Y1JA 1K73T 2R8KA 2KN4A 2MQNA 1ZH5A 3M8QA 2UP1A 5E3CA 3X3UA 1S77D 3DNCA 2HURA 4DQIA 3V5RA 2VHGA 2UUBJ 2BJ1A 2EFQA 2DY9A 3NXZA 4WP9A 2HHHF 1GMVA 3HSDA 1VQ6S 3QFWA 4NA2A 4F4XA 2CNOB 3CD0A 3PFEA 1L3VA 2E1RA 4DR6J 3LF0A 2F9JA 2FYXA 4U9RA 3DYAB 3O1LA 3OXFA 1NCLA 2HNYB 3H2UB 1GXTA 3EX7B 4KH1B 1N6QA 3HFKA 4LVNP 1KTQA 5EDWA 2M7SA 2GX8A 3IXQA 1W2BR 4WE1B 2DBBA 3W2WB 2PIIA 1SH0A 2ZE2B 1HQUA 2LU1A 2VFSA 4PYAA 5F8JA 4CH0S 2WVFA 4P75A 1S10A 4IH5A 2ASYA 1SJQA 3DOMA 4PQUB 3RW6A 2FLPA 2YKMA 1LWEA 4DEZA 1XMOJ 3EVOA 3IBFB 3HZEA 4WFAQ 5A0YA 1Y4ZB 3D66A 3CJ0A 3NGUA 4FNIA 4CT8A 2A1BA 4ICLA 5KFVA 1F5AA 4LT6A 2R8GA 4NYPA 2YX1A 3J7AN 3JAMY 1Q81T 1FE0A 2QEXS 2BZ2A 2BA9A 2ROEA 3ELHA 2IJRA 1FEEA 5HQLA 3M9NB 2FJXA 3KHRA 1TUVA 2H51B 3DLHA 1KRPA 2IA0A 4NLUA 2EFOA 4KQZA 4OJ1A 1R27B 5CYJA 5T7LB 2L9DA 2ZNZA 2ZD1B 1S72S 4DL4A 3QMQA 2DKOB 3DRXA 2DHSA 1EZZB 5DDOC 2M52A 1U45A 4EK2A 2M5YA 1YHQS 3ISZA 1BGXT 2JFKA 1UEKA 4LR8A 4ZHRB 5KG0A 3G96A 2CJQA 2YXLA 2DXDA 3O5TB 2UVVA 2XHCA 2R7WA 4A8QA 4IFYA 4DG1A 3VAKA 3QNWB 3WBZA 5JVGQ 2HEKA 2HVDA 3BS9A 4B9TA 1C1BB 1AT1B 3GIIA 4ITSA 2LECA 2GMHA 2AKWB 3NS6A 2BEFA 3D0IE 4PWUA 2QL5B 1W25A 2Y9HA 2C1EB 1M1KT 9ATCB 5J2QA 4Y65A 2FLNA 3IBWA 4IG0A 3GFHA 1M5KC 2ZHBA 3CJ4A 1WC1A 4HACA 2AGOA 4FN5A 1S1XA 4QWCA 3E51A 2WBRA 3M8SA 3JSMB 2DR5A 1RXOB 2QMWA 2YBVA 5D78A 2PI4A 3BGRA 5K20B 1TKXB 2PN6A 2XYPB 1QVFR 3ITHA 2HQGA 1IM6A 1EETA 1S6PA 4ALZA 1WDTA 2XS7A 2VV5A 2IM1A 1N5VA 3CIZA 1IKXA 1SJ1A 3VHQA 1S0OA 3OR1B 4U96A 3IS9A 3TEGA 2ADBA 3RBDA 4DR4F 3OSPA 2K2PA 2UU9F 4ZLPA 2RUSA 3MM5A 2W9CB 1BMQB 4OI0A 4R5PA 2F4VF 4BC9A 3B6BA 3RBXA 1FDBA 5K5MA 2L41A 4WJBA 3GYGA 3C6UB 4UT4A 3JS9A 4WCEQ 4C8NA 2HQDA 1UVKA 3F41A 3FCWA 5KFAA 2WSEC 2ZH3A 1DTQA 3AB4B 4NZ0A 2F65A 2MQQA 4LUBA 4ES2A 3O44A 3VQTA 1HW9A 5AE1A 3LWMA 5CZXA 2BR0A 3GJRB 2CZVC 5KFSA 2YY3A 3GB0A 1RT6A 2MSTA 1ZS6A 2PDAA 4ZLJA 4X4VA 2VDIA 1VIXA 3ET6B 2KTQA 1HWLA 2W4DA 1H2UX 3DRRB 3TEHB 4N56A 3KHHA 3UR0A 2AYEA 3ETOA 3UI3A 1YJRA 3P5BP 2DNRA 2QJ3A 2ZKUA 4ZPBA 4LF9F 2GAGC 5KFNA 1WG4A 2CPIA 2RDDA 2DPIA 2UXCJ 5F8GA 3KNGA 5ADZA 2BMBA 3MMAB 4FYXB 2M3DA 4JBCA 2ZWOA 3KG0A 3FBBA 1J2VA 2J9EA 3DRSA 3G8SA 1SQEA 3MURP 3DDNA 4PCQA 2IIHA 3Q86A 1REVB 1WTBA 3RB3A 4DLGA 3AQPA 1SVDA 2KHCA 3NOCA 1YLXA 1HMVB 3PTWA 4ECXA 3GLJA 4X4OA 1IJEB 2R7UA 2N82B 2I0XA 1RACB 5HL7Q 4IYQA 4DCPB 2OKQA 3LA0A 4ZVGA 4HHHA 3BGFA 3L3CA 2XTJP 4HT7A 4TQSA 4BWMA 2ZM6J 3KMQA 4OI3A 2WW8A 1D3WA 4MKVA 1PC5A 3VVTA 1PJ5A 2Q6BA 2C2NA 2IPOB 4I64A 2BJ9A 1VQ5S 3AT1B 4L3NA 1LW2A 2Z56B 4DUTA 1T0TV 1X4FA 2XSJB 4DOZA 4OZ0A 3D1OA 3BSOA 1RTDB 4NLQA 1J27A 4NCBA 2KHDA 1VHIA 3CCTA 1S76D 1IN0A 3LALA 4CTAA 1KQSR 3QGPA 3VAIA 2ZNYA 1FRHA 5HBMB 3W3SA 4F0KA 4N8NA 4PWDA 1RQ0A 3GP9A 3QJJA 3EXCX 2RKIA 5CABA 4H4MA 4QCLA 3B78A 4KGZB 5HP1A 4I7FA 1N5QA 2CQIA 2VOOA 2KG0A 4K4WA 4HVZA 2RS8A 2HBZB 5KT3A 4AYBD 2YNFB 4LBPA 3V4IA 1RT5A 1U47A 5KFJA 4RNMA 4X84A 2H9ZA 5IWAJ 4DV6F 3M8PA 4FYWB 4F3OA 3BKFA 4ECZA 2F4FA 4LQ3A 5J2PB 1RU2A 3FDSA 3M2UA 2ZKTA 2DNKA 3VWSA 1NK8A 3AA8A 4O3QA 4HYKA 3W9IA 3ETMA 4A47A 3JB9k 4X4TA 3MPWA 3CGIA 4QPTA 5SZTA 4IOAQ 1S6QB 1HNIB 2R42A 2EBEA 2M8DB 2NXCA 2Z30B 5C5JA 4DR2J 5JUMA 3VQSA 1S6UA 3DM2B 4TKTA 5F0UA 2GFFA 3BN7A 3L09A 4DV7F 2VFVA 3BGLA 4U7UK 2ASDA 5KFPA 5IT0A 2Y8WA 1SXLA 4G1PA 2XMMA 4FKYA 3QATA 1TZ0A 5L38A 1BQNA 1XJWB 3HPOA 2JH3A 2ZBIA 4JI3F 2DCUB 1DHMA 4F4ZA 1YIJS 5LMNF 4JI1F 3WC2A 3GCWP 2RD5C 2M70A 2ATLA 3IRXA 3KHGA 1FT8A 4YHHJ 3QZ8A 2R3VA 3IG1A 4CO1A 4TXSA 2Z8QA 4BHQA 3IP0A 2JEIA 1JLBA 1KVKA 2NXJA 1FESA 4TNOA 1LEOA 2BV3A 2MLXA 4QOTA 3B8HA 2OEKA 4XDCA 3NWGA 3GV7B 4V19J 3HHNB 1Q7YT 2KM8C 1P8GA 5KFWA 3W7BA 2KVQE 1FFGB 1YX2A 2AJQA 4AL5A 2P9CA 3LP1A 3CVKA 4JI2J 1FTRA 5KFLA 2C2ZB 3NLCA 3R5AA 2LYVA 2KU7A 1IR0A 4CO3A 5B0EA 2EI5A 3OTBA 3BSAA 4Y28C 5L8RC 2O1PA 5FD1A 3GV5B 2XMWA 2VB6A 2EKYA 2KDOA 1RAEB 1QAJA 4G1IA 2BKPA 4NLYA 1V3RA 2XMKA 3R5GA 4DL5A 1TV6A 2E1MC 1RSCA 2KYXA 4L3KA 1SKSA 2Z2YB 4UTGA 1AB8A 2YKAA 3NWRA 2JLGA 3AJ1A 3HKZD 1DURA 4W92B 2D41A 3Q0AA 2HHHJ 2OTLS 4MFBA 4J9PA 5I3QA 4ID8A 5KFXA 1IBLF 1PC4A 4X64J 4GRSA 2HHUA 4OZ2A 2GW8A 3IM8A 3ILIA 3C2PA 1GFWB 1LFWA 3HJFA 5KFFA 4FYVB 1N5YA 1FFWB 2DIVA 4WP3A 2VIHA 1PILA 3Q22A 5E41A 2WVEA 2KT2A 3VAGA 2AJ1A 2XLIA 3PR5B 2BKNA 2HNZB 2VG7B 2JSXA 2G13A 2CQHA 2FC9A 4DPOA 1UVJA 1F3FA 3EGWB 2B5JB 4HKQA 3DGPA 3BBBA 3PO4A 3H0PA 2GGPA 3ZNJ1 3R6GB 2LXUA 2K06A 4ECVA 5E7OB 1YITS 2NUHA 2DH7A 2NREA 4E98A 1HBNA 2DNHA 2BE2B 5KFMA 1PYSB 5IT9U 1C1CA 3S1TA 3SI8A 5F8HA 1WEZA 4OYBA 2WTFA 4KO0A 5E3AA 1YRUA 1SQFA 2E7XA 5JJBA 1RAJA 2DNLA 4C8LA 1IBKF 1VBYA 4KH0B 3PIOQ 4LSLB 1NEEA 1JXVA 2A10A 1JJCB 2QL7B 4I2QA 3RG6A 1PCAA 1TR0A 4B9MA 4ES1A 4K5RA 2MHNA 2YNHB 1KWMA 1NUEA 1I1GA 2LKZA 4RO0A 5B0CA 4M1KA 2F1FA 4ZKAA 1U8WA 2V63A 2MDAA 5KFTA 1N34J 9RUBA 2C22A 4P52A 4ZPCA 4RR5A 4NXNF 4N7TA 3SV4A 2F8EX 2XY6A 2VG6B 3DHXA 4KKOA 1BWEA 4NLSA 1LNQA 1ACMB 3PG9A 4CI0B 1U8SA 2CPEA 5ETTA 3G86A 1B0PA 2V50A 1N88A 2F5GA 3I0SA 4ERDA 2AMCB 2NSBA 4TYBA 2KZZA 2BXJA 3A4TA 3QZ7A 1Q53A 4IOCQ 2XWYA 2JL9A 2QLJB 2Q79A 5L9XA 5HVHA 2JEJA 3DOLB 2Y1RI 1WSRA 4RW7A 3HMJG 3A3PB 1S5ZA 2GO9A 3GIKA 5HROB 3HF5A 1N8RT 2J6TA 2CZ9A 4E8UA 3MCOA 2JFDA 1ITPA 1FE4A 1MU2B 4H4OA 1QTNB 1PJ7A 1A9NB 4L73A 2MY7A 3OLAA 3PKYA 1HI0P 2I8EA 2FHOB 3MI7X 2D1CA 5HANA 3HHEA 4LSNA 1I94J 1WHYA 1FXRA 3EYZA 1FVSA 3K17A 1S99A 2R9LA 1WELA 2W25A 1HKAA 5HMWA 2HK3A 5F8LA 3BDPA 2E44A 3DMJA 2XLKA 1BQMB 2ACYA 4IFVB 4OYWA 3SSRA 2MQLA 1JLAB 2ZDOA 5LSRA 3VAMA 3R97A 3M9MB 4AXIA 1RISA 4JYAF 2DGTA 3H2LA 1TL7B 4QQBA 2LEPA 4NLOA 1NZAA 1ZAXA 2NUUG 4CO0A 5DQIA 1HD0A 5KG1A 1N56A 1UZHA 2OMOA 5KFGA 3PO5A 5A8RA 1RA6A 3QSYB 2Z2LA 2F4VJ 2HAFA 4EBDA 2ZBQA 3A3NB 2UUAF 4QIGA 1UJ4A 3D3BJ 1P6TA 3D3CJ 1OPIA 1UL3A 1R8BA 3CJ3A 4OHZA 4LRFA 1MSWD 4DUYF 1B0TA 2OPPB 4DQPA 2O67A 1Q5VA 5A8KB 1BXNA 3BV8A 2I1RA 2JOQA 1TL5A 5LM7E 2JRSA 3M1VA 4Z37A 2ZH8A 2VBXA 4HT5A 1VQMS 3BYPA 4MJKA 2ZUGA 4YUDA 1K9MT 4A48A 3DRPB 3GE9A 2KJWA 4ZA1A 4PQAA 4ZITA 2IC3B 1HQEB 2B9WA 3Q2TC 1IBMJ 2HZVA 1Q1KA 2RJZA 2KFZA 1QAIA 2XWXA 4P10A 4AD6A 1CC8A 1RLCL 3HLUA 1U1RA 3I0RA 4MMOA 4WFZA 4K5SA 5DJBA 3X1LB 2IAJB 1HNWF 1HR0F 4LF9J 5T14A 3GSDA 4ENOA 5L9NA 4TU8A 3NY0A 1V6HA 1IKVA 2HFZA 4NYOA 2BJ7A 3N6LA 1LWXA 4DUZJ 1H98A 3OLBA 2LDIA 3VAFA 2CADA 3M4XA 3K5OA 2MQ8A 1E6YA 3TUPA 3N28A 1JKHB 4KBIA 2ZH6A 2GJIA 1URNA 2N4DA 1IKYB 5IM0A 3G6VA 2PO4A 4L72B 1RWWB 2U2FA 2Z0GA 1PGZA 3CIMA 5DLFA 4IH7A 1EP4B 3PRDA 4O3NA 5HVGA 3DLKB 2QFJA 1MROA 1WTFA 4K0KJ 5LSLA 1G4CA 4IRKA 3JYTA 3SFUA 3NAHA 4OI1A 5CYQB 3KLFB 2BOPA 5IT9Y 3AXKA 4FF3A 3POTA 2W7AA 2GAHC 1FF2A 4CLSA 2HSEB 4DDFA 4RPFA 4CNZA 1DARA
chains in the Genus database with same CATH topology
1EAYC 1A0OB 1FFSB 1FFGB 1FWPA 1FFWB 2LP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAY C;  1A0O B;  1FFS B;  1FFG B;  1FWP A;  1FFW B;  2LP4 A; 
#chains in the Genus database with same CATH topology
 3LOU A;  2XI2 A;  6AT1 B;  2BX6 A;  2RH3 A;  1ZBT A;  3L4B C;  3C16 B;  3L95 X;  5L1I A;  3T9Z A;  4KRW A;  1IKW B;  4U8V A;  1XMQ J;  4IDK A;  2HGN A;  2L48 A;  5J2M B;  2Z2M A;  1QD1 A;  5HLF B;  4D3G A;  1R3N A;  1T05 B;  4XIU A;  2W7P A;  3TZX A;  3HVA A;  1QTM A;  4QW9 A;  4ER8 A;  2FVS A;  1P9Y A;  5CH7 B;  4A8K A;  3IBC B;  2X3D A;  2AJ0 A;  1CEZ A;  4RW4 A;  2IBK A;  1VLO A;  4C8Y A;  1PKU A;  4ECR A;  3UN5 A;  4F4W A;  1VBZ A;  2VFU A;  4RW9 B;  3MMJ A;  4C0B A;  1RT2 B;  1T7P A;  1SJR A;  1N52 B;  2E5L F;  3IN5 A;  3UDE A;  2R7X A;  2DT9 A;  4GVB A;  3BQ1 A;  2DO0 A;  4AL6 A;  1F1B B;  3TQ1 A;  4DV6 J;  4WTO B;  4GVL A;  1RTI B;  2C3M A;  1CJT A;  2BYC A;  4ZP7 A;  2Q6C A;  2QSF A;  4ZVH A;  1AFI A;  2R8I A;  5KAK A;  2O3D A;  5K8O A;  5DQG A;  3MEE A;  1HBM B;  1GAO A;  3TA2 A;  1A6L A;  3QRQ A;  3UFC X;  1QJH A;  2ZC3 A;  3B82 A;  3ZZT A;  2M88 A;  3K7R A;  3W62 A;  4DFK A;  3T5J A;  3QGI A;  4F0H A;  1RGV A;  2CAJ A;  2IMW P;  4QU7 A;  2ZH5 A;  3KDN A;  5D15 A;  1H74 A;  1TK0 A;  3QJP A;  1IQZ A;  1C0U A;  4IQM A;  4DPX A;  4DSK A;  4KGK A;  3RBZ A;  2LLZ A;  2BBE A;  2CVE A;  2GO8 A;  3TUZ C;  4ED7 A;  1SCJ B;  2QN6 B;  1E6V B;  1WD6 A;  1F2G A;  2CPZ A;  1KDN A;  3PJ9 A;  2GS8 A;  2VA3 A;  4LF5 F;  4ZMM A;  2KJV A;  3P49 B;  1KFD A;  3HO1 A;  3QLH A;  1WC6 A;  3OBI A;  1HYS A;  3MTK A;  2UZA A;  1OQ6 A;  4RUB A;  3ONQ A;  4JI3 J;  2DR6 A;  4YB1 P;  4NE9 C;  4N5S A;  1TL3 A;  2J7U A;  1S1V A;  5LMN J;  4K4T A;  4JI1 J;  1VR6 A;  5HMY A;  3SCJ E;  3SBM A;  3K8W A;  5M2U A;  1T03 A;  4KSE B;  1HWK A;  3DOK B;  3G2X A;  2ZBP A;  2DPJ A;  3Q8R B;  3KUE A;  2KH9 A;  4WXW A;  3DU5 A;  3C14 A;  3LP2 A;  2OEL A;  1FDN A;  1RTJ A;  1FJC A;  2RIJ A;  2RQ4 A;  3NCQ A;  3NOG A;  2PFF B;  4QYZ K;  4NLG A;  2QZ8 A;  2PA3 A;  5KFO A;  1FJG J;  1M1G A;  2VJU A;  3MED A;  3UD4 P;  3T6B A;  1QY7 A;  3BJY A;  4RW6 A;  3NCP A;  3D4J A;  4C8Z A;  2VJV A;  3QRR A;  1GMW A;  4M5L A;  1LXJ A;  2RAQ A;  3B4M A;  1HD1 A;  4TY9 A;  2IDE A;  4HDG A;  2XCP A;  2DGX A;  3QWU A;  3TO8 A;  4FZV A;  2DIU A;  5AJ3 F;  2R7S A;  1S0N A;  5I3U A;  1HHS A;  3MEC B;  3UDV A;  1JLG A;  2F9D A;  2V6A A;  4B3S J;  5LOQ A;  3F44 A;  2CPX A;  2QA4 S;  4ZPD A;  2YKM B;  4ZPA A;  1LWE B;  3H5X A;  4C9D A;  1U2C A;  3FJ2 A;  1XR5 A;  5LMU J;  1R6V A;  2EFG A;  1I3O B;  4TVA B;  3MM7 A;  4URS A;  3VGT A;  4NML A;  4C0O C;  3R5B A;  5L39 A;  4DF8 A;  2VFR A;  5IS2 A;  1R8H A;  1WHX A;  4ICL B;  3FBC A;  1RAA B;  2ATC B;  5KT5 A;  2KRB A;  2MTL A;  1LQ9 A;  1Q0N A;  2W24 A;  3QQC D;  1VC5 A;  4B9V A;  3D1Q A;  4OHX A;  4ZVQ B;  4Y2K A;  3MPD A;  3TJ9 A;  4PEO A;  1SC1 B;  1DQA A;  1RE1 B;  2NSC A;  4ZPW R;  1RT1 A;  4EYI B;  3PKM A;  4DU8 A;  3LGH A;  1XNR F;  3DLB A;  2ALZ A;  2P9G A;  4OYZ A;  4X4Q A;  3IM9 A;  5KFD A;  3CCU S;  4MAK A;  2MKH A;  1H2V Z;  2CJX B;  3BSN A;  1WC4 A;  3M2R A;  2CNK B;  2JX2 A;  4ED3 A;  1ZM3 A;  4NCA A;  4Z7Y A;  2P6T A;  2AEJ A;  1HIY A;  3ENQ A;  3M8R A;  1T95 A;  3CCE S;  3MMC A;  2ASL A;  4ZVF A;  1S0V A;  1VBK A;  3U1L A;  1QLN A;  1HLW A;  1CC7 A;  4BWJ A;  3UO0 A;  2X1B A;  4L74 A;  4YDD B;  4H4K A;  3T1A A;  1DQ9 A;  4USJ C;  3KLE B;  4RBT A;  1NPR A;  2MZQ A;  2VBZ A;  1NLK L;  5DET A;  5H9F J;  4J9N A;  3GPA A;  1N36 J;  3KDO A;  2PI5 A;  4UQT A;  2ROP A;  5E0O A;  4IG0 B;  2VD3 A;  3T1H F;  1T94 A;  1FWP A;  1OY8 A;  3N6N A;  2CQB A;  4DBQ A;  2DGW A;  4TN2 A;  4HAC B;  1AFJ A;  4OYA A;  1S1X B;  1IBC B;  2MZJ A;  1PSD A;  3SSS A;  2ACM A;  4QZV B;  3R27 A;  3OJU A;  3OTD A;  3BGR B;  1KVJ A;  3ITH B;  1EET B;  2MYF A;  4CP5 A;  4ZIW A;  2V8H A;  1MML A;  1F9E B;  1PYT A;  3CF5 Q;  5AXN A;  3CJQ A;  3ENV A;  3DHW C;  4LFA F;  1CBK A;  3IS9 B;  4IG3 B;  1KC8 T;  2QIF A;  2DGS A;  3HFV A;  3US5 A;  3PW5 A;  4P7V A;  1VQO S;  3J80 U;  3CD6 S;  3MM5 B;  2FQQ B;  4JI7 F;  1IR1 A;  2QSW A;  2J0X A;  2VQE F;  1O0P A;  2XUL A;  4EBC A;  4ZCM A;  2UUB F;  3EMT A;  1RWN B;  4A8F A;  2G1H A;  5KFB A;  3BQ0 A;  3WHI A;  4UW2 A;  5F9N A;  1DTQ B;  2O66 A;  1YBA A;  3FFI A;  2CPF A;  3OL8 A;  4DR6 F;  3QRP A;  1DTT A;  4W4M A;  3CDA A;  3F0N A;  4M5D A;  2HIY A;  3CCW A;  2KFN A;  2DJW A;  2A2D A;  5IOL A;  3OR2 B;  5BYS A;  2X1G A;  3PHT A;  3OL6 A;  3EGN A;  1X0P A;  4ATN A;  4FXD A;  5HMZ A;  3OVS A;  3A8E A;  4I68 A;  1W2I A;  3CJK B;  2ZH4 A;  2EC0 A;  1XER A;  5KFH A;  4QW8 A;  4DV5 F;  3CB4 A;  2NZ4 A;  2D3O 1;  2DRA A;  4UOF A;  3BPS P;  4P9S A;  5DO2 A;  4LF4 J;  3K5M A;  1H7W A;  2MMY A;  2VG5 A;  2WB1 D;  4RL1 A;  1M1H A;  4LBH A;  2HFS A;  3KWM A;  3TX8 A;  3OFG A;  4QIE A;  1VQ4 S;  2X1F A;  1HI1 A;  4USU A;  4EUV A;  1D0E A;  1JLF A;  3D9B A;  5DG7 A;  1SL2 A;  1HI8 A;  5F3Z A;  1BY9 A;  2RF2 A;  3M8Y A;  3DRS B;  3RGI A;  3Q24 A;  1MG7 A;  5E3P A;  4DV2 F;  2HVE A;  3S8S A;  3NGT A;  2ZBR A;  3ZTR A;  3CMA S;  3TRG A;  3UPF A;  1HBU A;  2JC0 A;  4OI4 A;  1NRK A;  3NP5 A;  5HMX A;  1RHU B;  3UNY A;  1UVM A;  3HD2 A;  3K89 A;  2LVW A;  3NMR A;  1XMB A;  1VGY A;  3J7Y U;  3EPG A;  3NGK A;  2HS4 A;  1CUL A;  4BBY A;  1UWA A;  1VK3 A;  2HW3 A;  2XLJ A;  5EX0 A;  2K3K A;  4L6V 3;  1GNK A;  1UFL A;  2D9O A;  4UY8 5;  1FKP A;  1XBW A;  5LJ3 Y;  5LSO A;  2ZH7 A;  2FJW A;  3RRG A;  3NGD A;  2LQJ A;  1HR0 J;  1T9U A;  3EVW A;  5G4D A;  3CJR A;  2B4U A;  4UQG A;  1T9V A;  4W98 A;  2V34 A;  2V5H G;  1LW2 B;  4NLR A;  2EXU A;  5KFU A;  1JLC A;  1UW4 A;  4ILM A;  4QR1 A;  4RNO A;  2RIL A;  4QR2 A;  3EZU A;  2XO6 A;  1XN9 A;  2L9W A;  3BF4 A;  3JQJ A;  2V69 A;  1EKR A;  3L9Z A;  3CD7 A;  1HA1 A;  3SSQ A;  4WFX A;  2JLE A;  4TLQ A;  4ELT A;  2VL1 A;  1RT7 A;  4CTA B;  4F3M A;  2RDJ A;  4CLP A;  1KP6 A;  1NO8 A;  3MM6 B;  4PXD A;  4JI0 F;  2MGZ A;  3KG1 A;  1VC6 A;  3DKD A;  1H6K X;  5KG6 A;  4PWD B;  3HP6 A;  2CVI A;  2GHW A;  4DR5 F;  3H20 A;  2JHE A;  2FDN A;  2RKI B;  3PW0 A;  4H4M B;  3ZZZ A;  2MY8 A;  5HP1 B;  2B3T B;  4I7F B;  4F7V A;  4CLZ A;  3BBF A;  1UWB A;  4P71 A;  3TUI C;  1YJN S;  2VQF F;  3MAA A;  2B7B B;  3V81 A;  1RT5 B;  1NKE A;  5AXK A;  3I87 A;  5A6P A;  1U0S A;  4OI6 A;  4HHU A;  3FZ2 A;  3M2U B;  1Y5I B;  1WEX A;  1FX4 A;  3HHD A;  1JLE B;  3GSI A;  1VYA A;  2F8H A;  2H54 B;  2OEM A;  3W1Y C;  4WPA A;  3GG1 A;  2LQ8 A;  2X3G A;  2WAQ D;  4MT1 A;  4DSL A;  2M0G B;  2DNM A;  5B0G A;  1RWM B;  4G6V B;  4A8W A;  4FF4 A;  3CUN A;  1VCT A;  3R1L A;  5B0D A;  2XS5 A;  1YRX A;  1UEV A;  2QO3 A;  2DR9 A;  3SDE A;  1WSV A;  4PPD A;  2HHW A;  1S9F A;  4ANC A;  2B4O A;  3FNN A;  2DNQ A;  1JXE A;  2XZD B;  1BQN B;  1OSC A;  4DSJ A;  2ZBC A;  1N33 F;  4TU9 A;  1Q5Y A;  1YG0 A;  4WII A;  5HI7 A;  1Q82 T;  1UAW A;  3GON A;  4Y2I A;  3CDB A;  1F6T A;  3BR9 A;  2H5I B;  1F9F A;  2KXF A;  3J80 Y;  5CD4 H;  3DLG A;  1NHV A;  3R2C J;  2AJF E;  2ILY A;  3IRX B;  3ZTP A;  3BPD A;  1CJV A;  4MKB A;  2HNY A;  3IG1 B;  4ES3 A;  3NS5 A;  3BKT A;  1JWW A;  2GC8 A;  1JLB B;  4I69 A;  4OX9 F;  2MZR A;  4ED5 A;  4KJI A;  3ZZR A;  4LF6 J;  3NGS A;  4F04 B;  2ZE2 A;  3AXM A;  2MSS A;  5BR8 J;  2QGF B;  4O3S A;  4DV3 F;  2DY1 A;  2KM8 B;  5AXL A;  2N3L A;  2V4J B;  5D77 A;  2AYB A;  5J1N A;  1X5O A;  2M2B A;  3I55 S;  4NOH A;  2DIT A;  4PQU A;  3LP1 B;  3D28 A;  3FUY A;  4DL0 C;  1SIZ A;  4DSI A;  4LF5 J;  5D4L A;  3M8Z A;  4P74 A;  2R7V A;  1SV5 B;  2XY5 A;  3EGZ A;  4FVC A;  1RHQ B;  4Y3C A;  3AHP A;  2UXC F;  5B7W A;  5E2Q A;  2LDY A;  1R6Y A;  1BE4 A;  1S1W A;  2GQC A;  1T3N A;  3KNA A;  2YWW A;  2DO4 A;  1DLO B;  3FBE A;  2WON A;  4USW A;  3OHA A;  3R7S B;  4OX7 A;  3CJT A;  4EI2 A;  4LBI A;  1RHR B;  1TV6 B;  3GFY A;  3OV7 A;  1DJ0 A;  1P1L A;  4YR2 A;  2HLU A;  2PD1 A;  3DRY A;  4AT1 B;  4LFC J;  2I9S A;  3V6D A;  4I6Y A;  5GAD I;  4ZPV R;  2BE9 B;  4MFB B;  4QYZ J;  3K0J A;  2VBW A;  7FDR A;  2VOD A;  2YKP A;  4A4J A;  1V5V A;  3TZZ A;  5CA5 A;  1T11 A;  3LPE A;  3FVY A;  3CC4 S;  1N5Y B;  1SB6 A;  2VKZ G;  2CJY B;  3UDL A;  5B0B A;  1ULR A;  2GVD A;  4Z2X A;  5HJY A;  4X65 F;  3RJM B;  3IWN C;  4RKU C;  4I67 A;  2JEF A;  1VOM A;  3JQM A;  4USV A;  4PXC A;  5IV4 A;  3M32 A;  3IRW P;  3K8V A;  4KV8 A;  3N5B A;  1YTY A;  5MAO A;  2RVJ A;  3SQO P;  3BH7 B;  4CLL A;  3H4B A;  3RB0 A;  1X9M A;  2GQQ A;  3OQ2 A;  1HBN B;  5KFZ A;  4B3O A;  2KRR A;  2K1R B;  1C1C B;  3GWC A;  1PAU B;  3D68 A;  4QIF A;  1QSL A;  3ULH A;  3P3D A;  3ADA C;  2FB0 A;  4KO0 B;  2OSQ A;  3MPY A;  1X9W A;  2FJV A;  3EVM A;  3JSM A;  5IWA F;  4EBE A;  3TX0 A;  2XMJ A;  3UQS A;  4I2Q B;  1H73 A;  2VAS A;  1TKX A;  2P8I A;  4IH6 A;  3G9C A;  1EQ0 A;  4OI2 A;  2B9Y A;  2J0Q D;  4J7C A;  4QWD A;  1XNR J;  2V8G A;  2MZ1 A;  1ZTW A;  3JQK A;  3NL0 A;  2XQC A;  2OPQ A;  4XTT A;  2BAN B;  2B4V A;  2D7S A;  4DR2 F;  2J6U A;  5HSP A;  2IYG A;  2PEB A;  4KKO B;  4CM2 A;  1TTH B;  2RSQ A;  3CD5 A;  1YKW A;  3N9U C;  3EIC A;  1L3K A;  2G0I A;  3I0S B;  4DV1 F;  4YOE A;  2WRM A;  1P1T A;  4RBV A;  4CO5 A;  1NM2 A;  4KT0 C;  2WSF C;  4RZR A;  1U1M A;  4RW7 B;  2GVZ A;  3VR1 A;  2IJN A;  3GFX A;  2E9Z A;  4KGX B;  4A8S A;  5KFQ A;  4TYA A;  1G6B A;  1YDL A;  3EDQ B;  3W9H A;  4AFF A;  4Y2C A;  2MQO A;  2AZ1 A;  1VQS A;  1AUS L;  5KT6 A;  4YHH F;  2EPI A;  3ZO7 A;  1VC0 A;  2NXN A;  3OW2 R;  4H4O B;  3CJ2 A;  3ZZO A;  2A3J A;  2OD6 A;  2XZT B;  1VQ7 S;  2Y1L B;  2DNP A;  2CPH A;  2OTJ S;  2OFH X;  3KK2 B;  1F3V A;  2FD2 A;  2RQK A;  3UD3 P;  4O44 A;  4LSN B;  2CFX A;  3J81 U;  5H9E J;  3TAM A;  2J9D E;  1P27 B;  1U49 A;  2QG9 B;  3DXS X;  3Q8P B;  2C2M B;  2MKS A;  3GCX P;  1GEH A;  3DMJ B;  5K8N A;  4ID5 A;  3MD1 A;  2L9N A;  2D9P A;  1Z1Z A;  3OFF A;  4HI1 A;  4ED4 A;  5A8W A;  2RRA A;  1WOO A;  1JLQ B;  2AV5 A;  3RUB L;  3W60 A;  1T02 A;  2QYC A;  4CIO A;  3MMA A;  2GIQ A;  2ALY B;  1B3T A;  3DU6 A;  3CT9 A;  3ZXW A;  2ZZM A;  5F41 A;  4LFA J;  1RAI B;  2VH7 A;  1TQL A;  2R7O A;  4IR9 A;  1B7Y B;  3IWX A;  3MWB A;  4C2M A;  1U0H A;  5A8R B;  1KN6 A;  4JI7 J;  2BJ8 A;  2M4M A;  3OL7 A;  4B08 A;  1X8D A;  3G71 S;  2VQE J;  1UFW A;  3KHL A;  2DRD A;  2X7I A;  4G65 A;  1W26 A;  2GHV C;  4KTQ A;  2BAC A;  5C25 A;  1HNV A;  5EGY A;  4V19 X;  4UOH A;  1R89 A;  2AX1 A;  1VJQ A;  3L7U A;  4F26 A;  2J9C A;  3MZI A;  3AOC A;  2V2K A;  3M1V B;  4N77 A;  4X64 F;  3U7J A;  1RUS A;  3I31 A;  5CYM A;  1R8P A;  4LRB A;  4UUW A;  3M7V A;  1DRZ A;  4FNH A;  4P72 A;  3G8T A;  3SFG A;  2XG8 A;  1FEH A;  3D67 A;  3KUH A;  2C2D A;  4F3Q A;  2G1D A;  4NI2 A;  1D9F A;  5H1S V;  3CCQ S;  3Q2S C;  4X4U A;  3W5X A;  3M2V A;  4DV5 J;  4J9O A;  3TJA A;  4TY8 A;  1YVF A;  3I0R B;  2CYY A;  3MMB A;  1VLY A;  5KG5 A;  2B51 A;  2NXU A;  2IHR 1;  2CPD A;  1TVR B;  1IKV B;  2KVI A;  3QT7 A;  4EO6 A;  1SJ4 P;  1S4F A;  5HAO A;  3I6P A;  5DDQ C;  4HHJ A;  4PXB A;  1E6Y B;  3NG8 A;  1AW0 A;  3SIP B;  3MXH P;  2V2V A;  4DV2 J;  1SKW A;  3C46 A;  4CLU A;  4OX6 A;  1NB7 A;  2WOM A;  3HHK A;  5BJR A;  1CLF A;  2EC2 A;  2CZ4 A;  1WC0 A;  2LA6 A;  3KK1 A;  1Q8I A;  1OJ4 A;  4M5K A;  2UUC J;  5BYQ A;  4BCA A;  4WZQ A;  1MRO B;  3TJ8 A;  1SC3 B;  2QMX A;  2HQF A;  3JYT B;  2KG1 A;  4B9S A;  2BJ3 A;  4DL7 A;  3CCV S;  3POT B;  1N34 F;  2V2Z A;  4FXW A;  2IM3 A;  1G1X A;  5HVF A;  2AHO B;  3MUM P;  4K4X A;  4Q2M A;  3DCA A;  4J9K A;  1JIH A;  3NMA A;  4KGV B;  1NAQ A;  4LVO P;  1FNX H;  2YNI B;  1Y5N B;  1NK9 A;  5DG8 A;  4DQS A;  3ENA A;  3RTV A;  4GO5 X;  1ZOT A;  4IDK B;  3VAL A;  1FKA F;  4GMK A;  2ZH2 A;  2GV1 A;  1YRT A;  1NSA A;  5GAD U;  1CJK A;  3CNQ P;  4AUK A;  2HQC A;  4HI2 A;  5D0H A;  2XZW A;  3Q8Q B;  2J76 E;  4WF9 Q;  2BOA A;  3FMB A;  4CNY A;  5ITH A;  1ZET A;  5LL6 d;  2AEM A;  4RW4 B;  3UCZ P;  1X4A A;  4X4P A;  4F0M A;  4JI0 J;  2V94 A;  3GMG A;  3AD7 C;  4DR5 J;  2BDP A;  1MWZ A;  3R8Y A;  4FYD A;  3OFH A;  5FDL A;  4X4R A;  3GV8 B;  1YJT A;  4K2J A;  1RTH A;  1VQ9 S;  2VQF J;  4MIB A;  4JI6 F;  1I94 F;  4GKK J;  2XNR A;  1JNZ B;  4M8L A;  2NR0 A;  1L3U A;  4JI4 F;  2OPS A;  1CJT B;  2F63 A;  3H5U A;  2FY1 A;  2HHT A;  1Y00 A;  2WW4 A;  2AF6 A;  3S6E A;  2KYZ A;  1TL4 A;  1WKJ A;  2Y0S D;  2OML A;  3O2I A;  2EW9 A;  4C8O A;  1U2F A;  2PMZ D;  1Q16 B;  2CXE A;  2FZG B;  2CJ9 A;  5LT5 A;  4C7Q A;  3IR7 B;  3RR8 A;  5ETV A;  1C0U B;  5LJ5 Y;  3WZ0 A;  3ZFV A;  4DLE A;  5EX3 A;  2AX0 A;  1WJ9 A;  2C3O A;  5J1E A;  4ZVP B;  2MZT A;  1XQI A;  2DGQ A;  1RBA A;  4I56 A;  4M94 A;  3PRB A;  2G0J A;  4M5G A;  4UUX A;  2YQ1 A;  3QLH B;  3OL9 A;  1QE1 A;  2WB4 A;  2CNN B;  1HYS B;  2OPR A;  2UVU A;  1N33 J;  1UMJ A;  2CPJ A;  1H72 C;  4NA1 A;  2HHS A;  7FD1 A;  1TL3 B;  4YS2 A;  1S1V B;  1FER A;  2ILZ A;  4BDP A;  1KOO A;  1GQE A;  3CXC R;  3G6E S;  2FJB B;  1T03 B;  3WIV A;  1M5S A;  3CPW R;  2H5J B;  3FSX A;  2NLW A;  1NDC A;  1FHT A;  1X4B A;  4IRD A;  2W9A A;  1QUP A;  3C14 B;  3A8I A;  1GK8 A;  3LP2 B;  2U1A A;  2MLY A;  1RTJ B;  1IBM F;  4OX9 J;  4NRT A;  4QWA A;  2VPZ B;  4OYM A;  2V8P A;  2CQG A;  4O23 A;  4UST A;  3CME S;  4J9Q A;  3HKW A;  1NDL A;  5D3G A;  1VQP S;  4NYZ A;  4DV3 J;  3P45 B;  2FJE B;  1FRI A;  3JTN A;  1FO1 A;  4J9S A;  3KG4 A;  2DNZ A;  3R5J B;  4Y34 A;  2VBY A;  2B5J A;  2OHD A;  1XR7 A;  3MFH A;  4L76 A;  2J8S A;  3FSY A;  4TQR A;  3AOB A;  3LAK A;  3H5Y A;  1ZA1 B;  3DDK A;  2DNG A;  1XK8 A;  2V9W A;  3R7N B;  4OLO A;  2BRK A;  1V9O A;  4DUZ F;  4A46 A;  2K7J A;  2KFY A;  1G7C B;  4OZN A;  4DCJ B;  3AOA A;  2QE5 A;  1WG5 A;  1LK7 A;  1A7G E;  3HVR A;  1GX5 A;  3IR6 B;  1VK8 A;  4KPY A;  2QYG A;  2CNL B;  1OYD A;  3N0V A;  3M05 A;  5DM7 Q;  4B3T J;  3D1H A;  5B08 A;  4C8K A;  5I3U B;  1H0H B;  4GKJ J;  4IO9 Q;  1NJX A;  4XPC A;  1JLG B;  2UUT A;  3LP0 A;  3BKU A;  2YVS A;  4NLP A;  5GMD A;  4OJH A;  3ENW A;  2QL9 B;  2YNH A;  2XYG B;  4K0K F;  3TUJ C;  1UVI A;  1S1T B;  3MM7 B;  3HM9 A;  3CCJ S;  2HZA A;  5CHC B;  4IR1 A;  2NYH A;  4DR7 J;  3FRY A;  3RYL A;  3PYF A;  2HS0 A;  3I5B A;  4DV4 F;  1FK9 A;  2VOP A;  1G3O A;  3SCK E;  3HT0 A;  5IFM A;  1XMQ F;  1H7X A;  1S9E A;  2R4F A;  4X65 J;  4ILL A;  2YX4 A;  4F4Y A;  4I1T A;  3TR5 A;  1KVI A;  3DOL A;  3TVY A;  2P6S A;  1RT1 B;  4OZ3 A;  4PYD A;  1AZS A;  4K7Q A;  3PHE A;  3L7P A;  2DH9 A;  4RW8 B;  3QPI A;  3JTO A;  2AP6 A;  3B4D A;  2GA7 A;  1QM9 A;  1FDA A;  1DZ5 A;  1KNZ A;  2XMT A;  5AXM A;  2ZJP Q;  1N32 J;  3HCX A;  3B54 A;  2J8A A;  3BH6 B;  4PUO A;  2Y3Y A;  2H48 B;  4PAB A;  4OZ5 A;  2DH8 A;  3M2R B;  1KTV A;  2FHM A;  5B0A A;  3MCN A;  1EIY B;  2H4W B;  2ZHA A;  4NLW A;  3DLE A;  2UV8 A;  3TWZ A;  5C24 A;  5FLX U;  4D3H A;  1Y7P A;  1C0T A;  1PJ6 A;  4RU9 A;  2VA2 A;  5MLC V;  4O3P A;  2ROG A;  1BQM A;  1UP1 A;  4I6A A;  1FA0 A;  2ZVI A;  3VAH A;  2NPF A;  4Y2M A;  3BO3 A;  3T5L A;  1NSK L;  2D3O R;  2XNQ A;  3MUV P;  5B0F A;  2BAB A;  5AE3 A;  5IV3 A;  4RU2 A;  1UA1 A;  3MM8 A;  4O3R A;  4DMZ A;  5F8M A;  1X4H A;  4WZM A;  3BM7 A;  2RDI A;  4X4S A;  5CCL A;  3D5M A;  2FLO A;  4DV1 J;  2ZEJ A;  1WOP A;  2W9B A;  4FYY B;  4BS2 A;  4WU2 A;  3EUN A;  3PRV A;  3DLL Q;  4DX7 A;  1TKZ A;  4URQ U;  3KUG A;  5KG7 A;  4OQJ A;  1S49 A;  4J37 A;  1FJE B;  4EU0 A;  4EYH B;  1NME B;  2MKI A;  3E2E A;  4DCO B;  4LRE A;  2DR7 A;  3ZC4 A;  2HBR B;  1TFY A;  2DGO A;  4O0I A;  1X5S A;  3NNA A;  1NBE B;  5C42 A;  3PM9 A;  2XMA A;  4ECU A;  2NQP A;  1HQE A;  4LRD A;  2RB7 A;  2J9D A;  3M6V A;  2KT5 A;  2I5J A;  5GAG I;  2IBO A;  2QC3 A;  3K5P A;  1KSP A;  2HQ3 A;  1KQG B;  5F8I A;  4WFN Q;  1FJG F;  3AFG A;  2RNE A;  4NEY A;  1HNX F;  2E5I A;  4KE5 A;  1FRK A;  2YH0 A;  1WHV A;  1DY3 A;  4NX9 A;  5EWF A;  4DXL A;  4ETZ A;  1TK8 A;  2AGQ A;  3FFI B;  4LRC A;  1EQM A;  2DHX A;  4F36 A;  1DTT B;  3MCM A;  4M5D B;  1OWX A;  4EZ9 A;  1U1N A;  3HUL A;  3KJV B;  4ED6 A;  1MW7 A;  2WBM A;  2B4P A;  5I42 A;  4KPC A;  3H98 A;  4CLK A;  3H2V E;  2CIM A;  3A13 A;  2ZOM A;  1FD2 A;  3HSG A;  4OYX A;  1F5B A;  2YH1 A;  1YGY A;  4YB6 A;  3LTO A;  1FXL A;  2KB2 A;  4DFM A;  3KLG A;  3MR5 A;  5CD4 A;  4KAI A;  1X4G A;  2HND A;  2B9E A;  3AY0 A;  1TKD A;  4YY3 F;  2XGP A;  4B3S F;  4RBU A;  2VG5 B;  4IOB A;  1XTZ A;  3QT8 A;  1GX6 A;  2OEJ A;  3D7S B;  3THT A;  5CYQ A;  1NHK L;  5E3Q A;  5LMU F;  5K14 A;  3I5A A;  4ZCI A;  3QAU A;  2KKH A;  1U2R A;  4OYO A;  1RAH B;  2CQP A;  3CJ5 A;  1Q86 T;  1RTZ A;  1O8B A;  1YZ7 A;  1SQG A;  4ILR A;  2HRT A;  4XK8 C;  5KFE A;  5KFR A;  3P4U B;  1HBU B;  5ETM A;  1HL6 A;  3HVT A;  2GMJ A;  1IKW A;  1ZTT A;  3W2V B;  1SC4 B;  3KK3 B;  2D3U A;  4HTJ A;  2GJ2 A;  1RKJ A;  5J2M A;  1TUW A;  3PNI A;  4WIQ A;  4CDI A;  1CUL B;  1T05 A;  4G3I A;  1HHT P;  2MZS A;  3EJM A;  3EGV A;  1K0T A;  4RX6 A;  1FKP B;  1EAY C;  1MNE A;  3RRK A;  3CJS A;  2IY5 B;  2QRR A;  2DR8 A;  1WNE A;  2PGC A;  3IAM 9;  4DSF A;  1JXL A;  2XMV A;  1VRT A;  2P5V A;  5THW A;  4X4N A;  2J7W A;  3MD3 A;  5U47 A;  2B7C B;  1JLC B;  2VUG A;  3G82 A;  4HDH A;  2BQR A;  1RA7 A;  1RHJ B;  1PBU A;  1A0O B;  3ILJ A;  1FRJ A;  4C11 A;  2HGM A;  2VU5 A;  1K1Q A;  1S4E A;  4ZJQ A;  4MIA A;  1VQL S;  1JQG A;  5K8M A;  1RT7 B;  1CQM A;  3I5C A;  5H9F K;  4LF7 J;  3V4M A;  2LEB A;  1GXL A;  1S1U A;  3QID A;  3CCZ A;  4NL5 A;  1X5T A;  1XR6 A;  1D9A A;  1N36 F;  5CZV A;  2V67 A;  4DR1 F;  3TAN A;  4JI5 J;  4KB7 A;  4UY8 T;  2WVD A;  5LXY A;  2DCL A;  4DHV A;  1UWB B;  5EN1 A;  3MAA B;  1NK6 A;  3V6K A;  5FLX Y;  2HHX A;  3M30 A;  3GIL A;  4DL6 A;  2L08 A;  1LW0 A;  1E6V A;  2WSC C;  3L7O A;  1LXN A;  2PC6 A;  4DS4 A;  2YKN B;  4DX6 A;  2V9K A;  2KXH A;  2ZOF A;  3HDS A;  4MTP A;  4WTY A;  2NCK L;  5KFY A;  4CLY A;  4DV0 F;  4PG5 A;  3PEJ A;  4QIV A;  1VRQ C;  2OI2 A;  4XDD A;  2Y0B B;  1IM4 A;  3GU0 A;  3MM9 A;  2N4C A;  2JJ4 D;  2GNK A;  4X62 J;  2YWE A;  1S0M A;  3BEG B;  3GG0 A;  3DOK A;  2Z58 B;  3BQ2 A;  4OJ3 A;  1FJ7 A;  5DQH A;  1XC9 A;  3FQK A;  4NEZ A;  2FZC B;  4MYU A;  2HFU A;  3JTP A;  3LUY A;  2CQ0 A;  1BWV A;  3SDE B;  3ILL A;  3H25 A;  1QDU B;  3PVX A;  4I2P A;  4JI6 J;  3K59 A;  1AA1 B;  2O5D A;  2QTW A;  1QSS A;  4JI4 J;  3ZTS A;  4UZC A;  2W8L A;  3VVU A;  2HHV A;  4WKR A;  2HFO A;  2IMO A;  4QJV A;  1Q79 A;  3FBF A;  3PX4 A;  5C2G A;  3DLG B;  2ZWP A;  4H54 A;  3FKB A;  1CJV B;  4PR6 A;  2X1A A;  1D1U A;  1V3Z A;  2C2E A;  3GR1 A;  4Q8E A;  4MYT A;  1TL1 B;  1Q7L B;  3CJ8 A;  5E5N A;  3TAQ A;  2ZHO A;  5ETO A;  1HPZ A;  2LP4 A;  1J5O A;  1J5E J;  1UET A;  1Q95 G;  3OVA A;  1GH8 A;  1XNQ J;  3MEC A;  3Q83 A;  4J91 A;  5D0E A;  5IZH A;  4ZOS A;  3R6L B;  3V6H A;  2KO1 A;  2Z57 B;  4KHP F;  4K50 A;  4M5J A;  3U1N A;  2XGQ A;  4DWI A;  2XCA A;  1GMU A;  4LF4 F;  2CQ2 A;  2OSR A;  4FVM A;  1ZA2 B;  2BJE A;  4YQW A;  3GZ7 A;  3PW7 A;  3RZA A;  1RT4 A;  1CS4 A;  5G0R A;  4OZ1 A;  1S1W B;  2KZM A;  2R2U A;  1RWV B;  4DN0 A;  4NMX A;  5HQ8 A;  4ZS6 A;  2XSF A;  2K3I A;  2WON B;  3EE3 A;  1U1P A;  3OFE A;  3T5H A;  3P6Y C;  1XWL A;  2HG4 A;  2W4P A;  2JVR A;  4B9L A;  1N5T A;  2VF3 A;  2K7K A;  4ZLN A;  2DHA A;  1OIA A;  4PPZ A;  3E01 B;  3SYZ A;  3V6D B;  2WHO A;  4OMF G;  1NH7 A;  2BQ3 A;  3CW2 C;  1S59 A;  1F60 B;  3ILO A;  5ETN A;  4ZCK A;  5HO4 A;  1RHK B;  2LQB A;  4USI A;  3KLH A;  4YME A;  1R31 A;  1KLM A;  3Q8V A;  2DGU A;  2YPY A;  3D0G E;  3VTI A;  4F2S A;  2G2Y A;  5GAG U;  2YQ3 A;  2I38 A;  5DLG A;  2GVD B;  1HQ2 A;  3UVJ A;  1FFS B;  4R8U A;  4IRC A;  2I6W A;  3A8J A;  3KLI A;  4Q45 A;  4LFB J;  3N79 A;  1HWI A;  3HI9 A;  2J5A A;  5I3P A;  4I0W A;  3M32 B;  3AAW B;  1B70 B;  4KV8 B;  3TA0 A;  3KLE A;  2ZJQ Q;  4LMZ A;  3HVW A;  2R2T A;  2J0S D;  2BM1 A;  3H40 A;  2Q3P A;  1T9Y A;  2V4Q A;  4B3O B;  4Q0B A;  3HHL C;  3KFW X;  1RWX B;  2HFN A;  3H4D A;  1U02 A;  1M5V C;  3HHL A;  2OUG A;  2XBP A;  4A8O A;  3LWL A;  1C2P A;  5E33 A;  2KL8 A;  4DV4 J;  1TMJ A;  5BYR A;  2QV6 A;  3CDE A;  3QWP A;  5KOW A;  2HBQ B;  2XM3 A;  4NLD A;  4PG7 A;  2HFV A;  4K4Z A;  4BLG A;  3VGV A;  3HJV A;  4C97 A;  5EHH A;  4WFB Q;  2PEH A;  1YJW S;  1TEL A;  1FKO B;  3TNV A;  3D2W A;  4ZVS B;  4WK1 A;  4IG3 A;  1YJ7 A;  2OPQ B;  3HT3 A;  2N7Y A;  2VPY B;  1F2H A;  1FCA A;  4ZVR B;  2QLF B;  2RRN A;  3O8W A;  3QIP B;  1I5O B;  3LGN A;  1QVG R;  2IVY A;  4QR0 A;  4A8Y A;  1P9Q C;  4CYU A;  2YX7 A;  4S0M A;  5CAA A;  4MH8 A;  2HRY A;  3IC1 A;  2IVF B;  1QUV A;  4AE5 A;  2GVZ B;  4C3L A;  4WYL A;  2QX0 A;  1ZM2 A;  2HKE A;  2IRY A;  4QU6 A;  2HMI A;  2BW7 A;  5L1K A;  3SQG A;  4P2F A;  2J6S A;  1H3D A;  5KT4 A;  2FVQ A;  3M6U A;  3E3X A;  2P9E A;  3NEK A;  4QPX A;  2HWH A;  3D6T B;  3OR2 A;  2UXB F;  1VI7 A;  3IA0 A;  2ERR A;  5JMN A;  4F4K A;  1MN9 A;  4LF6 F;  4OYI A;  2B8P A;  3BO2 A;  4O44 B;  1N0V C;  3CJK A;  2E5H A;  1IUJ A;  3IGV A;  5BR8 F;  3KMS A;  3TAM B;  4B3M J;  3GJQ B;  2JLF A;  2EVZ A;  3I4P A;  1DFD A;  5GMK a;  4KIA A;  4ZCL A;  2ZFH A;  4ID5 B;  4KFB A;  4O4G A;  1LWF A;  3EWG A;  5A8W B;  4CO4 A;  4DQR A;  1UPP A;  1WHW A;  3GYN A;  4DSE A;  4DPU A;  2AGP A;  2LQ5 A;  4PAA A;  3T1Y J;  3KJF B;  5DDR C;  4ZDN A;  3SXL A;  1F0X A;  3G6X A;  4YR3 A;  4USM A;  3IGN A;  1B4S A;  2ZUA A;  3MTJ A;  3QGH A;  1U0H B;  3M8Q B;  4R25 A;  3ZZ0 A;  4U67 Q;  1TKT A;  2RRB A;  3U27 A;  2A6O A;  1ELO A;  3I96 A;  4IQX A;  3GQC A;  4QWE A;  5C25 B;  1HNV B;  4EZ6 A;  4LFC F;  3EZ5 A;  4JV1 A;  3R1H A;  3QBC A;  1HNX J;  1CG2 A;  3VZH A;  4JV5 F;  1FD8 A;  5D6G A;  3UN2 A;  1KON A;  3K5L A;  3N6M A;  5CYM B;  1FXD A;  1RAG B;  4OHY A;  2EFN A;  4ETX A;  4FS1 A;  1QAY A;  5K9F A;  2EG1 A;  2E5G A;  4RWW A;  4ZP8 A;  1N6Q B;  1NU4 A;  4OYP A;  3AD8 C;  2W2P P;  2WVB A;  2IDL A;  2E9R X;  4CLT A;  2FVR A;  4ELV A;  4NI2 B;  1JB0 C;  3NBP A;  2LCW A;  1HQU B;  4Q44 A;  2FVC A;  2EWH A;  3C6T A;  3M2V B;  2VPW B;  1SPB P;  4TY8 B;  1K44 A;  4YY3 J;  3MMB B;  4L75 A;  3DOM B;  3MM6 A;  2W2Q P;  4HTI A;  2BVZ A;  3DGV A;  5DS7 A;  1U25 A;  1U1K A;  3PYD A;  4PG8 A;  3LQV A;  4WU3 A;  5DDP C;  3BGO P;  4B9N A;  2GCF A;  2YPZ A;  1BUX A;  4USH A;  3HFZ B;  3PEH A;  2SXL A;  2B0G A;  5A0Y B;  2UXD F;  7AT1 B;  1TFW A;  1UEU A;  1BC6 A;  1RT3 A;  2AYM A;  1Z2L A;  1PIE A;  1LFP A;  5KOX A;  2WOM B;  3SZ2 A;  4XAK A;  2GZO A;  2BRL A;  4OLP A;  4DFP A;  3KK1 B;  3DFE A;  1YSJ A;  4DL2 A;  1JJ2 R;  4ANE A;  1B7F A;  3EM1 A;  4K4Y A;  1JLE A;  2HWI A;  1S79 A;  1OS5 A;  5JXS A;  2OO4 A;  3P5T L;  4A8X A;  2IA6 A;  3RAM A;  3IAS 9;  5KG4 A;  3W9J A;  1WI6 A;  3LAN A;  4J5O A;  3PCO B;  1R43 A;  4YP3 A;  4JOU A;  3PJW A;  4C3M A;  1C4C A;  2H65 B;  2W8K A;  2RML A;  2MKY A;  5DZ6 A;  1CJK B;  1M0S A;  1YBU A;  2C28 A;  1HBO A;  4R0E A;  4PKD B;  5DRK A;  1CJU A;  4IFY B;  4H4K C;  4DG1 B;  2GHP A;  1X4D A;  2B6A A;  3RRH A;  2NZC A;  2HGL A;  2WVC A;  2OFG X;  1NSQ A;  3C15 A;  1FNM A;  4B02 A;  4NLV A;  3P8B B;  4CQ1 A;  3NRB A;  4DR1 J;  2OP5 A;  5J2Q B;  5FDL B;  1TK5 A;  3VCD A;  4ED2 A;  3MF5 A;  4YR0 A;  1RTH B;  2HRU A;  1QAX A;  5H9E K;  4P6Q A;  4OL8 A;  4K4U A;  3MAH A;  1FDD A;  2XY7 A;  2V4J A;  2V0N A;  1U09 A;  3D54 A;  1H38 A;  2N3O A;  2OPS B;  2R7R A;  3CC7 S;  1HHQ A;  2M9K A;  1QSY A;  1NHU A;  2LMI A;  3LAM A;  1SV5 A;  4KHR A;  1S6P B;  4K59 A;  2APO A;  4DV0 J;  3PYG A;  3UW1 A;  2F3J A;  5KG3 A;  4XO0 A;  4ZPT R;  4C0H A;  2IRU A;  1IKX B;  4F67 A;  4JV0 A;  1K8A T;  2AQ4 A;  4DPY A;  3DI6 A;  2IM2 A;  4RWX A;  5J2N A;  1DLO A;  1LOU A;  1NDK A;  2JZ5 A;  4RUC A;  2AT1 B;  3EXY A;  2DNN A;  4LR9 A;  5J1E B;  2UVR A;  4DZ6 A;  3BZQ A;  4R5P B;  3ISN C;  3RBE A;  3MCS A;  3U1M A;  3M9O B;  2G2O A;  2UUW A;  3RU0 A;  4X66 F;  3FSI A;  3GIR A;  3TAR A;  2YKQ A;  3PW2 A;  3CDW A;  1QE1 B;  1S9G A;  2YNG A;  1YK9 A;  3MEG A;  2OPR B;  2RT3 A;  5EUH A;  4N47 A;  3FEZ A;  2FVP A;  3QT6 A;  3FZB A;  1U48 A;  1S7H A;  1VQY A;  1R0A A;  3FCH A;  4MIW A;  3GR0 A;  2HAI A;  1K47 A;  2A2C A;  4UOG A;  3GYX B;  1WWH A;  2F40 A;  3R7B B;  3MOJ B;  2C42 A;  4J9U E;  1RT6 B;  2W7O A;  1REG X;  3BR8 A;  4K2X A;  1T9T A;  5D3G B;  1S97 A;  1OY9 A;  3J7Z 5;  3PFO A;  3PY8 A;  1NJW A;  2MKJ A;  2WK4 A;  3R9L A;  2EG2 A;  2AD9 A;  1JJH A;  2CDR B;  3R5C A;  4KHP J;  3OVB A;  3OUY A;  3J81 j;  1ICE B;  4GC6 A;  3HHL D;  2R8H A;  4DF4 A;  1U1Q A;  3PXG a;  2HHP A;  1VRU A;  1IWA A;  3SEO A;  3I32 A;  1OSD A;  4O3O A;  2K1R A;  3W5Y A;  4F8R A;  4NXM F;  3C8Y A;  1NXI A;  2C2K B;  4DFJ A;  1I51 B;  1JJ4 A;  2RS2 A;  1MLA A;  1CQN A;  1LV5 A;  3MPU B;  1NK7 A;  4PZV A;  2DGV A;  1WF1 A;  1KS2 A;  3PIP Q;  1BD6 A;  3OTE A;  1RLD A;  3LP0 B;  4FDF A;  5GAE I;  1IVZ A;  4ZLL A;  1Y10 A;  1EX8 A;  2UUC F;  1AUD A;  1UKU A;  3PV8 A;  1ZAW A;  1RZM A;  1KFS A;  3QO9 A;  3K2Y A;  3I4H X;  5A2Q U;  3CMQ A;  1S12 A;  4HH1 A;  3MDF A;  1Q78 A;  1SUQ A;  2BAN A;  3PZP A;  1OYE A;  1FWK A;  1FK9 B;  4QYR A;  3HX9 A;  1PAE X;  1ZZF A;  1WC3 A;  1MMN A;  1LK5 A;  1S9E B;  5KFK A;  3CWJ A;  2H3E B;  2CQ3 A;  1LWC A;  4M63 A;  1WAC A;  2CQ1 A;  2RHS B;  1AZS B;  3BN4 A;  2MJN A;  1KHV A;  4C8M A;  4YEA A;  1RWP B;  2QA2 A;  3CO0 P;  3ICL A;  4JI8 F;  3AJD A;  3D6M B;  4NCG A;  4PUO B;  2CRL A;  2HYI B;  1WKL A;  2YQ0 A;  4DPT A;  5D4P A;  4E0D A;  1F5C A;  4LSZ B;  1RYS A;  2L3M A;  3KK2 A;  1WG1 A;  4USK A;  4LF8 F;  3DLE B;  2G0C A;  1ZM9 A;  4GKK F;  5C24 B;  3V4I B;  3G87 A;  2ZZT A;  2IFX A;  1C0T B;  1U6Z A;  1T9X A;  4P7T A;  2FLL A;  3M8P B;  4G1Q A;  1X31 C;  4Y00 A;  1R8C A;  1WF0 A;  4C98 A;  5C2C A;  3FCV A;  4BC7 A;  1MMD A;  1NJI T;  3KYL A;  1MWY A;  1JLQ A;  2VPX B;  1WDD A;  3CCL S;  2E7V A;  1BHN A;  4C4W A;  1MWQ A;  4DR4 J;  1RCX B;  2UU9 J;  1HWJ A;  2UVW A;  1YBT A;  2Y1I A;  3MM8 B;  1Q4R A;  4RUH A;  3PX6 A;  1YJV A;  1GTE A;  2NYI A;  1KD1 T;  4B17 A;  5DGB A;  1SKR A;  4RNF A;  2ZDP A;  3FQL A;  1RWK B;  3NGR A;  3PDN A;  1RBO B;  2ZOG A;  3N4W A;  2NPI A;  2W9B B;  2XB2 D;  2Y8Y A;  1PO6 A;  2HPU A;  5FII A;  1YQH A;  2Z4P A;  1BLU A;  4CWB A;  1TKZ B;  2FC8 A;  4PG4 A;  3M8W A;  2HZC A;  1XIQ A;  3MR2 A;  1GMW D;  3THP A;  4YFU A;  2MLZ A;  3S7R A;  2GJF A;  2MPU A;  3DYA A;  3AD9 C;  3Q8S B;  2F8M A;  2D3Z A;  1URR A;  2EEY A;  2UXB J;  2DNY A;  3KTQ A;  2CWK A;  5C42 B;  4IUF A;  4XPE A;  1FRM A;  4KR0 B;  2I5J B;  4OHV A;  8RUC A;  2XO7 A;  3KXD A;  4WE1 A;  4JUZ A;  3TW0 A;  2CKW A;  2QA1 A;  2BQU A;  3W2W A;  2POK A;  5JVH Q;  4M5I A;  1R8A A;  2FUG 9;  5SUH A;  3OTO F;  4J9R A;  3FRZ A;  1HW8 A;  1RHM B;  2G4B A;  2VON A;  2AIR B;  4CH7 A;  1TVR A;  4TU7 A;  1UVN A;  2YWK A;  4CO2 A;  3ZZY A;  2XMU A;  1SI9 A;  4FBT A;  3KJQ B;  3VAJ A;  1HNZ F;  2CWX A;  1VS3 A;  5I42 B;  1FRX A;  2V8V A;  2AJ2 A;  2EBG A;  2ZC4 A;  1WUU A;  4U8Y A;  2JEG A;  2V4R A;  1U26 A;  3FMW A;  1NK4 A;  2LFV A;  1DBD A;  4CM0 A;  5GAH I;  1AXQ A;  4B3T F;  1WEY A;  4CH1 A;  4GKJ F;  2B56 A;  3S01 A;  5K8P A;  3KLG B;  6FD1 A;  2HND B;  4OFZ A;  1SH3 A;  3MFI A;  4C48 A;  4EO8 A;  2J0W A;  2BKO A;  3HD1 A;  4PRF A;  5T7L A;  5K14 B;  3WC0 A;  5D4N A;  2ZD1 A;  4JV5 J;  4MK7 A;  3MPV A;  1S48 A;  3NAI A;  3RB6 A;  3E8O A;  4DR7 F;  2DHG A;  2ZZN A;  1KBR A;  2RUG A;  2MB0 B;  1X7V A;  5IQ6 A;  3QFH A;  5LXR A;  3DN9 A;  1NK5 A;  2DK2 A;  2VFT A;  3HVT B;  2YNI A;  4TLR A;  4ZHR A;  4B9U A;  2A6M A;  2Q1L A;  3LW5 C;  1NZ8 A;  3PAC A;  3V6J A;  2GQ2 A;  2FY8 A;  4YN3 B;  3T3F A;  3IR5 B;  4ZVE A;  5A2Q Y;  2EK1 A;  2IYI A;  5DGA A;  1C1B A;  5ETQ A;  3WDO A;  3DGP B;  3MOZ A;  1VQ8 S;  1O6X A;  1GXU A;  1N32 F;  2GGP B;  1K1S A;  3FEY B;  3A3O B;  1VRT B;  3RW7 A;  2H1Y A;  2ASJ A;  5DZ7 A;  4NA3 A;  1SJF A;  1OMS A;  2PSZ A;  3DLJ A;  3G82 B;  4FPR A;  2UXD J;  3MHY A;  2QLW A;  2P2C B;  3C3L A;  2AEF A;  4C11 B;  4QIW D;  3CDU A;  1SC6 A;  2N7C A;  3Q23 A;  2PE8 A;  4CZC A;  2QMU B;  2O01 C;  2JWN A;  2FHJ A;  3OTC A;  4FF1 A;  1IR2 A;  2RQC A;  3IWL A;  3EPI A;  1TP7 A;  1EAR A;  3VGU A;  1S1U B;  3BGU A;  2YKO A;  1X5P A;  3TI0 A;  4AQY F;  1IXK A;  1C4A A;  4DZD A;  3HXM A;  3CSK A;  6FDR A;  2VC1 A;  1GT8 A;  3OR1 A;  4K4S A;  2LXI A;  3ISN D;  2CQ4 A;  4WK3 A;  1SL0 A;  5I4M A;  4KY3 A;  4MK9 A;  2FGO A;  2W9C A;  5GAE U;  3M30 B;  4F02 A;  2V8D A;  3D6F B;  3K57 A;  1LW0 B;  3FK4 A;  3I82 A;  3WQP A;  4DV7 J;  1U6B A;  1VHF A;  2M8H A;  3KLV A;  1ZM4 A;  4PWW A;  2ZJR Q;  5D8H B;  3T41 A;  3K58 A;  3C6U A;  2DHH A;  4JV2 A;  4LQ9 A;  1Z4U A;  3VGS A;  1YJ9 S;  4B3R F;  3J7Y I;  3GIJ A;  1RWU A;  3UCG A;  1T8E A;  3MM9 B;  3NS7 B;  2W2O P;  4O0N A;  4DJB A;  1N5S A;  5KT7 A;  1B0V A;  3DXB A;  3JSB A;  4Q7A A;  1WOS A;  1VQK S;  3A8K A;  3G6Y A;  2JDJ A;  3IFE A;  1T9W A;  5M2R A;  2OIH A;  2BJD A;  4OJG A;  4HL9 A;  2LU2 A;  2DNO A;  3ZZU A;  2OGU A;  2ZH9 A;  3K5N A;  3LGM A;  1V5I B;  3ET6 A;  4HR2 A;  4M95 A;  4I2P B;  1HWU A;  5ETP A;  2DEJ A;  2MQM A;  1U1O A;  4FPI A;  2A0F B;  4WXO A;  3DRR A;  4NAS A;  2D74 B;  2FGC A;  4U6P A;  1EKS A;  3PW4 A;  1G2E A;  2BW2 A;  1FWL A;  1RYR A;  1JX4 A;  1PBA A;  1CPZ A;  5AT1 B;  1U24 A;  3TZY A;  4WKY A;  3QGG A;  1RI7 A;  3A12 A;  1ZAV A;  1R0C B;  3NNH A;  4IO1 A;  3OXG A;  1O5J A;  1HPZ B;  1REV A;  1J5O B;  4PXE A;  2HIQ A;  4DN9 A;  4ZP9 A;  4OV1 A;  1HMV A;  2FHK A;  5E3R A;  4Q8F A;  2FJA B;  4X66 J;  3TZW A;  1YI2 S;  3ZTO A;  1FX2 A;  2F7V A;  1S1T A;  3M6X A;  1SBR A;  1RT4 B;  4LF1 A;  1CS4 B;  5G0R B;  1IBL J;  1EJ7 L;  4HH0 A;  4P73 A;  3UE2 A;  2NS1 B;  4U95 A;  1UFK A;  2HVI A;  3Q8U A;  4DS5 A;  1L3S A;  3HK2 A;  2E66 A;  5HQM A;  5IC6 B;  3CED A;  2HK2 A;  4Y6I A;  1N54 B;  3GIM A;  1BQX A;  3DC2 A;  2FIU A;  5A76 A;  3H59 A;  2XSJ A;  2FPH X;  3QJL A;  1GTH A;  3TAP A;  2EFV A;  2IVM A;  1RTD A;  3FC9 A;  1UA0 A;  1ZPW X;  4RNH A;  3R3T A;  5KG2 A;  5GME A;  3AQO A;  4ZVT B;  4J9V A;  2RE1 A;  5KT2 A;  2MKC A;  4RW8 A;  2OAU A;  4DR3 F;  3Q8Y A;  4FXV A;  3KLH B;  4WFY A;  2HS3 A;  1KLM B;  1EHW A;  3A1Y G;  1KOH A;  3HSZ A;  4RJV A;  5HBM A;  1NKB A;  1L3T A;  1N0U A;  5HK4 A;  1JMT A;  3MR7 A;  4V1A k;  2QLX A;  4NXM J;  4F50 A;  2DXE A;  5IT4 A;  3UVJ B;  3UN3 A;  3QT5 A;  4R8U B;  5DG9 A;  1KHW A;  3G4S S;  1X4E A;  2HLT A;  4ZN3 A;  2XEX A;  3KLI B;  1PG5 B;  1X4C A;  4AL7 A;  2YNF A;  2K8G A;  3PYE A;  3EDR B;  5IM0 B;  2IM0 A;  1D9D A;  1IBK J;  2WZ1 A;  4NRU A;  5F8N A;  2G2Z A;  3RR7 A;  4WYW A;  2BUN A;  5J2P A;  3W5Z A;  4ZIV A;  3BDE A;  4LF7 F;  4ELU A;  2OD4 A;  1Y3K A;  2KT3 A;  5AE2 A;  2C3P A;  3PR4 A;  1VIO A;  4GO7 X;  5L46 A;  4MKY A;  5IQQ A;  4FBU A;  4Q0B B;  3UDC A;  1S6Q A;  2DRB A;  3HHL B;  3MEK A;  1N48 A;  4OZL A;  4LIW A;  3QSI A;  1HNI A;  4JI5 F;  4M5H A;  5GAH U;  1RAF B;  4NXN J;  2V2Q A;  1AYE A;  5M2P A;  3C66 A;  3OHB A;  3DM2 A;  4P2S A;  2ZH1 A;  3RAQ A;  2CJB A;  1VQN S;  4ED0 A;  4DQQ A;  3NCR A;  2LEA A;  3QAE A;  2RHQ B;  2A18 A;  1TAQ A;  3H42 A;  8ATC B;  2E29 A;  1PYO B;  3QYY A;  3BO4 A;  1O51 A;  3AB2 B;  2DTJ A;  1RAO A;  4E2F B;  4JI8 J;  3WIU A;  1N4L A;  3UCU P;  3JSR A;  3H90 A;  4X62 F;  2R7T A;  4K4V A;  1RU1 A;  2Z2Z A;  4FS2 A;  2R2S A;  3CE8 A;  3CCM S;  3SV3 A;  1Q8K A;  4QBU A;  4GC7 A;  4R0J A;  4UZB A;  4CYU B;  3H8Y A;  4LF8 J;  3TVK A;  1UZD A;  2D69 A;  4GVB B;  3OPK A;  2LXF A;  4KGM A;  2HMI B;  3T5K A;  1X9S A;  3N5F A;  2CPY A;  3SQG B;  5D4O A;  1RK8 A;  8AT1 B;  2C3Y A;  2W01 A;  4YB5 A;  2YWF A;  4UOC A;  3MEE B;  2HBY B;  5KTQ A;  3KJV A;  4DX8 H;  3TYT A;  4KC5 A;  3KOA A;  4JYA J;  2WCX A;  4ECS A;  1OY6 A;  4OHW A;  4DI6 A;  3W64 A;  1Q8L A;  4FP9 A;  1Y0H A;  4YB7 A;  1OPZ A;  4A8M P;  4ED1 A;  1J5E F;  1MN7 A;  3J81 Y;  3MGJ A;  3WX4 A;  1XNQ F;  3TA1 A;  3NKY A;  1S7I A;  2UUA J;  3TVZ A;  1TAU A;  1U1L A;  3W8P A;  2CQC A;  4KFB B;  4O4G B;  1LWF B;  4N76 A;  1X60 A;  2LQ9 A;  3LO3 A;  3GTY X;  4LR7 A;  5ETS A;  3TQE A;  1XMO F;  1NSP A;  1WOR A;  4DUY J;  2W1B A;  4WP8 A;  1KEK A;  3O6Q A;  3AOD A;  3W65 A;  3CC2 S;  4J9M A;  4KYZ A;  2E1C A;  3G8Q A;  4P2X A;  1UPM B;  2IRX A;  1RAB B;  4N8O A;  3SCL E;  3F73 A;  3BB5 A;  3CUL A;  1Y3J A;  3W2V A;  4MK8 A;  5F0W A;  1TKT B;  5F9L A;  3W66 A;  3KK3 A;  2YWH A;  1FI4 A;  2DVI A;  4CLW A;  1HFE L;  2HNZ A;  4NLT A;  2VG7 A;  3LH2 S;  1UVL A;  2YTC A;  3MED B;  5HN0 A;  1XEZ A;  3OTO J;  1UJ6 A;  4F2R A;  3OXL A;  2BM0 A;  1RKI A;  1Z2Z A;  1OO0 B;  2H5E A;  4RW6 B;  3UWT A;  1JK9 B;  3AH6 A;  1HNW J;  2JC1 A;  4Y2A A;  3MUT P;  4ECW A;  4DL3 A;  1WI8 A;  2BE2 A;  2FZK B;  1HNZ J;  3OT9 A;  1IWG A;  2W2N P;  2ZVS A;  1Y9O A;  2QA4 G;  2HQI A;  3UNG C;  2FHJ D;  4ZP6 A;  3C19 A;  1IJF B;  2C2R A;  4M5N A;  3T9N A;  3THV A;  3NBP B;  2HWT A;  4LFB F;  2HVZ A;  1DAX A;  4LSL A;  3C6T B;  2VKR A;  1DQ8 A;  1NKC A;  2XS2 A;  2X51 A;  3W63 A;  2Q43 A;  3TOQ A;  4ZK7 M;  4NPO A;  2AYG A;  3MAQ A;  2B43 A;  2B9X A;  4URG A;  3FEX B;  4U7U D;  1X0F A;  4UF4 A;  3T19 A;  1D8Y A;  5HJX A;  1RWO B;  2VZ9 A;  2CQD A;  1FVQ A;  4F4A A;  4DU7 A;  4JP8 A;  1M90 T;  2VDH A;  1RT3 B;  2VG6 A;  2W4C A;  2FJD B;  1SH2 A;  1KKH A;  1RP5 A;  3D6H B;  3ZNU A;  5GVQ A;  4HEA 9;  1F9H A;  1NDP A;  1NND A;  1RB0 A;  2YKN A;  4Q5V A;  2CG4 A;  1ZYQ A;  2PMW A;  4YDX A;  2C3U A;  2OLW A;  5DM6 Q;  3BBC A;  3JXO A;  2CDQ A;  2FTR A;  2E1A A;  5HRO A;  3MR6 A;  4QWB A;  4J90 A;  2KXN B;  3PJX A;  1OQ3 A;  4M5M A;  2AU0 A;  3J7A 1;  4OV6 A;  2J7K A;  4Y0F A;  3JSY A;  1MU2 A;  5IXU A;  3N01 A;  2RU3 A;  3I56 S;  4CRJ A;  5C7P A;  3O3L A;  2E5L J;  1SIW B;  3MMC B;  1L5U A;  2PFD A;  5FJ4 A;  2GML A;  1HBO B;  4ED8 A;  1UTA A;  1D8Z A;  3VV2 B;  1VFJ A;  3FGV A;  1CJU B;  3CCR S;  4EGL A;  3OJS A;  2B6A B;  1APS A;  5CCM A;  5EWE A;  4IFV A;  1ZPV A;  2B8Q A;  2ZIT A;  5HAT A;  1B99 A;  1JLA A;  1WKK A;  2E1P A;  1RCO B;  4U7C A;  4MKA A;  2PMH A;  2W2M P;  4AQY J;  1NJZ A;  3C15 B;  2H4Y B;  1JNR B;  1TL1 A;  1TL7 A;  2OJ3 A;  5D0G A;  2Q66 A;  4F25 A;  4OX8 A;  1Q8B A;  1M5P C;  2CA9 A;  4CT9 A;  4N41 A;  4B3M F;  2MQP A;  3GJT B;  3ZZP A;  1WF2 A;  3I9Z A;  2UV8 G;  1NH8 A;  5IC4 B;  2JVO A;  2OH2 A;  1R7I A;  3VZI A;  1LKZ A;  2OPP A;  2PA8 D;  5ETL A;  4B3R J;  3BSC A;  2E5J A;  5A8K A;  4FF2 A;  2V68 A;  3F56 A;  1NJY A;  3R2D J;  2AZ3 A;  3VF0 B;  3T1Y F;  2DIS A;  3T6J A;  4AXJ A;  1HAR A;  1ARO P;  2QFI A;  2COL A;  3DI6 B;  3PX0 A;  5J2N B;  4KHM A;  1TUG B;  4C3K A;  5F3T A;  3DRP A;  5B09 A;  2HHQ A;  1NB2 A;  1VMB A;  4NLX A;  4EEY A;  2IC3 A;  1R0B G;  1RAD B;  4DPW A;  5RUB A;  4ZVO B;  2R8J A;  2G9O A;  3E01 A;  1S9G B;  2YNG B;  3MEG B;  2BE7 D;  3UR3 C;  2MJU A;  2DYA A;  2E9T A;  1SJ3 P;  2ZM6 F;  4ZN1 A;  4Z7C A;  2CUY A;  3MR3 A;  2CG8 A;  4ZJL A;  2IAJ A;  4I6W A;  2JNJ A;  1R0A B;  2NXE A;  4EWT A;  1RBL A;  4J9L A;  1KQF B;  1EB0 A;  5BXI A;  2R2R A;  4PG6 A;  3I9V 9;  4NWB A;  2R7Q A;  2YWG A;  5EWG A;  1JKH A;  4O4R A;  1Y5L B;  1VJW A;  2HVH A;  2ABY A;  1H2T Z;  4Q2L A;  1TU0 B;  1Y11 A;  1S6O A;  1WC5 A;  5AJ3 J;  4OZJ A;  1IKY A;  4Q43 A;  3JAM U;  2XC9 A;  2LA4 A;  3D0H E;  1SL1 A;  2GIR A;  2MXY A;  2DB1 A;  3ZTQ A;  1EP4 A;  3V2U C;  1YWX A;  3GJS B;  3DLK A;  3OUY B;  1W7W A;  4JB8 B;  4ECT A;  1FTC A;  2DD8 S;  2VC0 A;  1D09 B;  3IO1 A;  1NPK A;  3P96 A;  4DX5 A;  1VBX A;  3CTR A;  1UJ5 A;  4HLB A;  3HZG A;  1VRU B;  3KLF A;  5J1P A;  3W61 A;  2ADC A;  1JLF B;  1KR4 A;  5CQG A;  2AW0 A;  2XYH B;  4OIX A;  3UD5 A;  2EFP A;  2RF2 B;  4P2M A;  4RLE A;  4EMD A;  1FNO A;  2E7W A;  3U02 A;  1VDH A;  4X2B A;  1CSJ A;  1NPP A;  3CCS S;  4ECY A;  3H5S A;  4AND A;  3C16 A;  1T3O A;  3EZO A;  1B64 A;  3R5D A;  3KJN B;  1U4B A;  2C2O B;  4I4B A;  4RNN A;  3KKF A;  3QO9 B;  3TP2 A;  1UW9 A;  5HLF A;  1ROF A;  1M5H A;  3J7Z T;  1FKO A;  2GIF A;  1M5O C;  3H7H B;  2DXF A;  4DR3 J;  1SUQ B;  5ETR A;  2MKK A;  4CLF A;  1K0V A;  4ZVU B;  2EKN A;  1IQT A;  3OSN A;  3NNC A;  3QIP A;  1I6J A;  3Q89 A;  3DDI A;  1FRL A;  1VIS A;  4LJM A;  3AJ2 A;  5L1J A;  4RW9 A;  5CXT A;  2EK6 A;  5KFC A;  4IKA A;  3WX8 A;  3LPY A;  4WBF A;  1RT2 A;  4LF2 A;  3GFZ A;  3W8G A;  1LWC B;  5A6W A;  2CJK A;  2AWZ A;  3RAX A;  2RU9 A;  4FKX A;  2XHW A;  2DEI A;  3IMQ J;  2KI2 A;  4WWS A;  3SCI E;  1RTI A;  1KLN A;  3OD2 A;  3RB4 A;  3AA9 A;  2XI3 A;  2RQM A;  5ETK A;  3SMZ A;  4CCH A;  4ZJO A;  2QT7 A;  4NCG B;  1S57 A;  4EFA C;  1HBM A;  4K8R A;  1V3S A;  2QLB B;  2MGZ B;  1YZ6 A;  1NK0 A;  1TMM A;  1ZZN A;  3M6W A;  4RUA A;  1U7L A;  1KQK A;  3T1H J;  1SKU B;  4NZ7 A;  3BRE A;  4NZ6 A;  2I2Y A;  2MHE A;  3V81 B;  5D0R A;  1U6F A;  2MEW A;  4LIR A;  4G1Q B;  5KFI A;  1UCN A;  3CO9 A;  2VIC A;  4JI2 F;  1CVJ A;  1RDR A;  2PT0 A;  4ECQ A;  3HSJ A;  2AJ4 A;  5L1L A;  3BYR A;  1YJU A;  5T41 A;  4C6A A;  2CJA A;  2IJF A;  4LRA A;  1RJJ A;  4W90 B;  2Y1J A;  1K73 T;  2R8K A;  2KN4 A;  2MQN A;  1ZH5 A;  3M8Q A;  2UP1 A;  5E3C A;  3X3U A;  1S77 D;  3DNC A;  2HUR A;  4DQI A;  3V5R A;  2VHG A;  2UUB J;  2BJ1 A;  2EFQ A;  2DY9 A;  3NXZ A;  4WP9 A;  2HHH F;  1GMV A;  3HSD A;  1VQ6 S;  3QFW A;  4NA2 A;  4F4X A;  2CNO B;  3CD0 A;  3PFE A;  1L3V A;  2E1R A;  4DR6 J;  3LF0 A;  2F9J A;  2FYX A;  4U9R A;  3DYA B;  3O1L A;  3OXF A;  1NCL A;  2HNY B;  3H2U B;  1GXT A;  3EX7 B;  4KH1 B;  1N6Q A;  3HFK A;  4LVN P;  1KTQ A;  5EDW A;  2M7S A;  2GX8 A;  3IXQ A;  1W2B R;  4WE1 B;  2DBB A;  3W2W B;  2PII A;  1SH0 A;  2ZE2 B;  1HQU A;  2LU1 A;  2VFS A;  4PYA A;  5F8J A;  4CH0 S;  2WVF A;  4P75 A;  1S10 A;  4IH5 A;  2ASY A;  1SJQ A;  3DOM A;  4PQU B;  3RW6 A;  2FLP A;  2YKM A;  1LWE A;  4DEZ A;  1XMO J;  3EVO A;  3IBF B;  3HZE A;  4WFA Q;  5A0Y A;  1Y4Z B;  3D66 A;  3CJ0 A;  3NGU A;  4FNI A;  4CT8 A;  2A1B A;  4ICL A;  5KFV A;  1F5A A;  4LT6 A;  2R8G A;  4NYP A;  2YX1 A;  3J7A N;  3JAM Y;  1Q81 T;  1FE0 A;  2QEX S;  2BZ2 A;  2BA9 A;  2ROE A;  3ELH A;  2IJR A;  1FEE A;  5HQL A;  3M9N B;  2FJX A;  3KHR A;  1TUV A;  2H51 B;  3DLH A;  1KRP A;  2IA0 A;  4NLU A;  2EFO A;  4KQZ A;  4OJ1 A;  1R27 B;  5CYJ A;  5T7L B;  2L9D A;  2ZNZ A;  2ZD1 B;  1S72 S;  4DL4 A;  3QMQ A;  2DKO B;  3DRX A;  2DHS A;  1EZZ B;  5DDO C;  2M52 A;  1U45 A;  4EK2 A;  2M5Y A;  1YHQ S;  3ISZ A;  1BGX T;  2JFK A;  1UEK A;  4LR8 A;  4ZHR B;  5KG0 A;  3G96 A;  2CJQ A;  2YXL A;  2DXD A;  3O5T B;  2UVV A;  2XHC A;  2R7W A;  4A8Q A;  4IFY A;  4DG1 A;  3VAK A;  3QNW B;  3WBZ A;  5JVG Q;  2HEK A;  2HVD A;  3BS9 A;  4B9T A;  1C1B B;  1AT1 B;  3GII A;  4ITS A;  2LEC A;  2GMH A;  2AKW B;  3NS6 A;  2BEF A;  3D0I E;  4PWU A;  2QL5 B;  1W25 A;  2Y9H A;  2C1E B;  1M1K T;  9ATC B;  5J2Q A;  4Y65 A;  2FLN A;  3IBW A;  4IG0 A;  3GFH A;  1M5K C;  2ZHB A;  3CJ4 A;  1WC1 A;  4HAC A;  2AGO A;  4FN5 A;  1S1X A;  4QWC A;  3E51 A;  2WBR A;  3M8S A;  3JSM B;  2DR5 A;  1RXO B;  2QMW A;  2YBV A;  5D78 A;  2PI4 A;  3BGR A;  5K20 B;  1TKX B;  2PN6 A;  2XYP B;  1QVF R;  3ITH A;  2HQG A;  1IM6 A;  1EET A;  1S6P A;  4ALZ A;  1WDT A;  2XS7 A;  2VV5 A;  2IM1 A;  1N5V A;  3CIZ A;  1IKX A;  1SJ1 A;  3VHQ A;  1S0O A;  3OR1 B;  4U96 A;  3IS9 A;  3TEG A;  2ADB A;  3RBD A;  4DR4 F;  3OSP A;  2K2P A;  2UU9 F;  4ZLP A;  2RUS A;  3MM5 A;  2W9C B;  1BMQ B;  4OI0 A;  4R5P A;  2F4V F;  4BC9 A;  3B6B A;  3RBX A;  1FDB A;  5K5M A;  2L41 A;  4WJB A;  3GYG A;  3C6U B;  4UT4 A;  3JS9 A;  4WCE Q;  4C8N A;  2HQD A;  1UVK A;  3F41 A;  3FCW A;  5KFA A;  2WSE C;  2ZH3 A;  1DTQ A;  3AB4 B;  4NZ0 A;  2F65 A;  2MQQ A;  4LUB A;  4ES2 A;  3O44 A;  3VQT A;  1HW9 A;  5AE1 A;  3LWM A;  5CZX A;  2BR0 A;  3GJR B;  2CZV C;  5KFS A;  2YY3 A;  3GB0 A;  1RT6 A;  2MST A;  1ZS6 A;  2PDA A;  4ZLJ A;  4X4V A;  2VDI A;  1VIX A;  3ET6 B;  2KTQ A;  1HWL A;  2W4D A;  1H2U X;  3DRR B;  3TEH B;  4N56 A;  3KHH A;  3UR0 A;  2AYE A;  3ETO A;  3UI3 A;  1YJR A;  3P5B P;  2DNR A;  2QJ3 A;  2ZKU A;  4ZPB A;  4LF9 F;  2GAG C;  5KFN A;  1WG4 A;  2CPI A;  2RDD A;  2DPI A;  2UXC J;  5F8G A;  3KNG A;  5ADZ A;  2BMB A;  3MMA B;  4FYX B;  2M3D A;  4JBC A;  2ZWO A;  3KG0 A;  3FBB A;  1J2V A;  2J9E A;  3DRS A;  3G8S A;  1SQE A;  3MUR P;  3DDN A;  4PCQ A;  2IIH A;  3Q86 A;  1REV B;  1WTB A;  3RB3 A;  4DLG A;  3AQP A;  1SVD A;  2KHC A;  3NOC A;  1YLX A;  1HMV B;  3PTW A;  4ECX A;  3GLJ A;  4X4O A;  1IJE B;  2R7U A;  2N82 B;  2I0X A;  1RAC B;  5HL7 Q;  4IYQ A;  4DCP B;  2OKQ A;  3LA0 A;  4ZVG A;  4HHH A;  3BGF A;  3L3C A;  2XTJ P;  4HT7 A;  4TQS A;  4BWM A;  2ZM6 J;  3KMQ A;  4OI3 A;  2WW8 A;  1D3W A;  4MKV A;  1PC5 A;  3VVT A;  1PJ5 A;  2Q6B A;  2C2N A;  2IPO B;  4I64 A;  2BJ9 A;  1VQ5 S;  3AT1 B;  4L3N A;  1LW2 A;  2Z56 B;  4DUT A;  1T0T V;  1X4F A;  2XSJ B;  4DOZ A;  4OZ0 A;  3D1O A;  3BSO A;  1RTD B;  4NLQ A;  1J27 A;  4NCB A;  2KHD A;  1VHI A;  3CCT A;  1S76 D;  1IN0 A;  3LAL A;  4CTA A;  1KQS R;  3QGP A;  3VAI A;  2ZNY A;  1FRH A;  5HBM B;  3W3S A;  4F0K A;  4N8N A;  4PWD A;  1RQ0 A;  3GP9 A;  3QJJ A;  3EXC X;  2RKI A;  5CAB A;  4H4M A;  4QCL A;  3B78 A;  4KGZ B;  5HP1 A;  4I7F A;  1N5Q A;  2CQI A;  2VOO A;  2KG0 A;  4K4W A;  4HVZ A;  2RS8 A;  2HBZ B;  5KT3 A;  4AYB D;  2YNF B;  4LBP A;  3V4I A;  1RT5 A;  1U47 A;  5KFJ A;  4RNM A;  4X84 A;  2H9Z A;  5IWA J;  4DV6 F;  3M8P A;  4FYW B;  4F3O A;  3BKF A;  4ECZ A;  2F4F A;  4LQ3 A;  5J2P B;  1RU2 A;  3FDS A;  3M2U A;  2ZKT A;  2DNK A;  3VWS A;  1NK8 A;  3AA8 A;  4O3Q A;  4HYK A;  3W9I A;  3ETM A;  4A47 A;  3JB9 k;  4X4T A;  3MPW A;  3CGI A;  4QPT A;  5SZT A;  4IOA Q;  1S6Q B;  1HNI B;  2R42 A;  2EBE A;  2M8D B;  2NXC A;  2Z30 B;  5C5J A;  4DR2 J;  5JUM A;  3VQS A;  1S6U A;  3DM2 B;  4TKT A;  5F0U A;  2GFF A;  3BN7 A;  3L09 A;  4DV7 F;  2VFV A;  3BGL A;  4U7U K;  2ASD A;  5KFP A;  5IT0 A;  2Y8W A;  1SXL A;  4G1P A;  2XMM A;  4FKY A;  3QAT A;  1TZ0 A;  5L38 A;  1BQN A;  1XJW B;  3HPO A;  2JH3 A;  2ZBI A;  4JI3 F;  2DCU B;  1DHM A;  4F4Z A;  1YIJ S;  5LMN F;  4JI1 F;  3WC2 A;  3GCW P;  2RD5 C;  2M70 A;  2ATL A;  3IRX A;  3KHG A;  1FT8 A;  4YHH J;  3QZ8 A;  2R3V A;  3IG1 A;  4CO1 A;  4TXS A;  2Z8Q A;  4BHQ A;  3IP0 A;  2JEI A;  1JLB A;  1KVK A;  2NXJ A;  1FES A;  4TNO A;  1LEO A;  2BV3 A;  2MLX A;  4QOT A;  3B8H A;  2OEK A;  4XDC A;  3NWG A;  3GV7 B;  4V19 J;  3HHN B;  1Q7Y T;  2KM8 C;  1P8G A;  5KFW A;  3W7B A;  2KVQ E;  1FFG B;  1YX2 A;  2AJQ A;  4AL5 A;  2P9C A;  3LP1 A;  3CVK A;  4JI2 J;  1FTR A;  5KFL A;  2C2Z B;  3NLC A;  3R5A A;  2LYV A;  2KU7 A;  1IR0 A;  4CO3 A;  5B0E A;  2EI5 A;  3OTB A;  3BSA A;  4Y28 C;  5L8R C;  2O1P A;  5FD1 A;  3GV5 B;  2XMW A;  2VB6 A;  2EKY A;  2KDO A;  1RAE B;  1QAJ A;  4G1I A;  2BKP A;  4NLY A;  1V3R A;  2XMK A;  3R5G A;  4DL5 A;  1TV6 A;  2E1M C;  1RSC A;  2KYX A;  4L3K A;  1SKS A;  2Z2Y B;  4UTG A;  1AB8 A;  2YKA A;  3NWR A;  2JLG A;  3AJ1 A;  3HKZ D;  1DUR A;  4W92 B;  2D41 A;  3Q0A A;  2HHH J;  2OTL S;  4MFB A;  4J9P A;  5I3Q A;  4ID8 A;  5KFX A;  1IBL F;  1PC4 A;  4X64 J;  4GRS A;  2HHU A;  4OZ2 A;  2GW8 A;  3IM8 A;  3ILI A;  3C2P A;  1GFW B;  1LFW A;  3HJF A;  5KFF A;  4FYV B;  1N5Y A;  1FFW B;  2DIV A;  4WP3 A;  2VIH A;  1PIL A;  3Q22 A;  5E41 A;  2WVE A;  2KT2 A;  3VAG A;  2AJ1 A;  2XLI A;  3PR5 B;  2BKN A;  2HNZ B;  2VG7 B;  2JSX A;  2G13 A;  2CQH A;  2FC9 A;  4DPO A;  1UVJ A;  1F3F A;  3EGW B;  2B5J B;  4HKQ A;  3DGP A;  3BBB A;  3PO4 A;  3H0P A;  2GGP A;  3ZNJ 1;  3R6G B;  2LXU A;  2K06 A;  4ECV A;  5E7O B;  1YIT S;  2NUH A;  2DH7 A;  2NRE A;  4E98 A;  1HBN A;  2DNH A;  2BE2 B;  5KFM A;  1PYS B;  5IT9 U;  1C1C A;  3S1T A;  3SI8 A;  5F8H A;  1WEZ A;  4OYB A;  2WTF A;  4KO0 A;  5E3A A;  1YRU A;  1SQF A;  2E7X A;  5JJB A;  1RAJ A;  2DNL A;  4C8L A;  1IBK F;  1VBY A;  4KH0 B;  3PIO Q;  4LSL B;  1NEE A;  1JXV A;  2A10 A;  1JJC B;  2QL7 B;  4I2Q A;  3RG6 A;  1PCA A;  1TR0 A;  4B9M A;  4ES1 A;  4K5R A;  2MHN A;  2YNH B;  1KWM A;  1NUE A;  1I1G A;  2LKZ A;  4RO0 A;  5B0C A;  4M1K A;  2F1F A;  4ZKA A;  1U8W A;  2V63 A;  2MDA A;  5KFT A;  1N34 J;  9RUB A;  2C22 A;  4P52 A;  4ZPC A;  4RR5 A;  4NXN F;  4N7T A;  3SV4 A;  2F8E X;  2XY6 A;  2VG6 B;  3DHX A;  4KKO A;  1BWE A;  4NLS A;  1LNQ A;  1ACM B;  3PG9 A;  4CI0 B;  1U8S A;  2CPE A;  5ETT A;  3G86 A;  1B0P A;  2V50 A;  1N88 A;  2F5G A;  3I0S A;  4ERD A;  2AMC B;  2NSB A;  4TYB A;  2KZZ A;  2BXJ A;  3A4T A;  3QZ7 A;  1Q53 A;  4IOC Q;  2XWY A;  2JL9 A;  2QLJ B;  2Q79 A;  5L9X A;  5HVH A;  2JEJ A;  3DOL B;  2Y1R I;  1WSR A;  4RW7 A;  3HMJ G;  3A3P B;  1S5Z A;  2GO9 A;  3GIK A;  5HRO B;  3HF5 A;  1N8R T;  2J6T A;  2CZ9 A;  4E8U A;  3MCO A;  2JFD A;  1ITP A;  1FE4 A;  1MU2 B;  4H4O A;  1QTN B;  1PJ7 A;  1A9N B;  4L73 A;  2MY7 A;  3OLA A;  3PKY A;  1HI0 P;  2I8E A;  2FHO B;  3MI7 X;  2D1C A;  5HAN A;  3HHE A;  4LSN A;  1I94 J;  1WHY A;  1FXR A;  3EYZ A;  1FVS A;  3K17 A;  1S99 A;  2R9L A;  1WEL A;  2W25 A;  1HKA A;  5HMW A;  2HK3 A;  5F8L A;  3BDP A;  2E44 A;  3DMJ A;  2XLK A;  1BQM B;  2ACY A;  4IFV B;  4OYW A;  3SSR A;  2MQL A;  1JLA B;  2ZDO A;  5LSR A;  3VAM A;  3R97 A;  3M9M B;  4AXI A;  1RIS A;  4JYA F;  2DGT A;  3H2L A;  1TL7 B;  4QQB A;  2LEP A;  4NLO A;  1NZA A;  1ZAX A;  2NUU G;  4CO0 A;  5DQI A;  1HD0 A;  5KG1 A;  1N56 A;  1UZH A;  2OMO A;  5KFG A;  3PO5 A;  5A8R A;  1RA6 A;  3QSY B;  2Z2L A;  2F4V J;  2HAF A;  4EBD A;  2ZBQ A;  3A3N B;  2UUA F;  4QIG A;  1UJ4 A;  3D3B J;  1P6T A;  3D3C J;  1OPI A;  1UL3 A;  1R8B A;  3CJ3 A;  4OHZ A;  4LRF A;  1MSW D;  4DUY F;  1B0T A;  2OPP B;  4DQP A;  2O67 A;  1Q5V A;  5A8K B;  1BXN A;  3BV8 A;  2I1R A;  2JOQ A;  1TL5 A;  5LM7 E;  2JRS A;  3M1V A;  4Z37 A;  2ZH8 A;  2VBX A;  4HT5 A;  1VQM S;  3BYP A;  4MJK A;  2ZUG A;  4YUD A;  1K9M T;  4A48 A;  3DRP B;  3GE9 A;  2KJW A;  4ZA1 A;  4PQA A;  4ZIT A;  2IC3 B;  1HQE B;  2B9W A;  3Q2T C;  1IBM J;  2HZV A;  1Q1K A;  2RJZ A;  2KFZ A;  1QAI A;  2XWX A;  4P10 A;  4AD6 A;  1CC8 A;  1RLC L;  3HLU A;  1U1R A;  3I0R A;  4MMO A;  4WFZ A;  4K5S A;  5DJB A;  3X1L B;  2IAJ B;  1HNW F;  1HR0 F;  4LF9 J;  5T14 A;  3GSD A;  4ENO A;  5L9N A;  4TU8 A;  3NY0 A;  1V6H A;  1IKV A;  2HFZ A;  4NYO A;  2BJ7 A;  3N6L A;  1LWX A;  4DUZ J;  1H98 A;  3OLB A;  2LDI A;  3VAF A;  2CAD A;  3M4X A;  3K5O A;  2MQ8 A;  1E6Y A;  3TUP A;  3N28 A;  1JKH B;  4KBI A;  2ZH6 A;  2GJI A;  1URN A;  2N4D A;  1IKY B;  5IM0 A;  3G6V A;  2PO4 A;  4L72 B;  1RWW B;  2U2F A;  2Z0G A;  1PGZ A;  3CIM A;  5DLF A;  4IH7 A;  1EP4 B;  3PRD A;  4O3N A;  5HVG A;  3DLK B;  2QFJ A;  1MRO A;  1WTF A;  4K0K J;  5LSL A;  1G4C A;  4IRK A;  3JYT A;  3SFU A;  3NAH A;  4OI1 A;  5CYQ B;  3KLF B;  2BOP A;  5IT9 Y;  3AXK A;  4FF3 A;  3POT A;  2W7A A;  2GAH C;  1FF2 A;  4CLS A;  2HSE B;  4DDF A;  4RPF A;  4CNZ A;  1DAR A; 
#chains in the Genus database with same CATH homology
 1EAY C;  1A0O B;  1FFS B;  1FFG B;  1FWP A;  1FFW B;  2LP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...