1FFGB

Chey-binding domain of chea in complex with chey at 2.1 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Further insights into the mechanism of function of the response regulator CheY from crystallographic studies of the CheY--CheA(124--257) complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1ffgB00
2LP4A 1FFWB 1EAYC 1FWPA 1A0OB 1FFGB 1FFSB
chains in the Genus database with same CATH superfamily
4NRUA 4YDDB 3LH2S 9RUBA 3GG0A 2CDQA 4AL6A 4X4QA 5F0WA 3VGTA 1N32F 1S9EB 2HPUA 1K9MT 1FRMA 1YBUA 4IFVA 2HZCA 2OPPB 3CCRS 3DYAA 2QX0A 2YVSA 2I0XA 4KBIA 2VKRA 2MKSA 1CVJA 4YR2A 3THVA 1OSDA 2KG1A 1YJNS 5EX3A 1UVIA 1JQGA 1Q0NA 3MMCB 4DPWA 1KQGB 3TZZA 4O4RA 1UVMA 3TWZA 3QWPA 2XMVA 5C7PA 1NJWA 1YHQS 2CUYA 3U1LA 1VFJA 4IQXA 1HNZJ 5GAEU 4QBUA 4O4GB 3IRWP 1AROP 1T02A 2WVFA 2KTQA 3W1YC 1J5EF 1W7WA 1U45A 4F25A 1KSPA 3DI6A 4K50A 2W4DA 3VALA 3FGVA 3LWMA 5C42A 4I69A 3K7RA 1VISA 4C3KA 4G65A 3JB9k 5DDQC 1DTTA 4TLQA 4JI2J 2KM8B 1QE1A 3LW5C 2HVIA 3IG1A 1X4CA 1C1BA 2RE1A 3V6JA 2F4VJ 1LWEB 1UPMB 1HFEL 4B17A 3DRRA 4OZLA 1JXVA 1KD1T 4XTTA 3T6JA 4JUZA 2E1CA 4L72B 4LBHA 3RB6A 3SCLE 3MEGA 8ATCB 4FYYB 3LP1B 1N52B 2BBEA 1IR0A 4FF2A 4ILMA 1L5UA 3GJQB 1TKXA 1KWMA 3CJ0A 2J8SA 2JWNA 3CDEA 3CGIA 5IOLA 2PFFB 2XCAA 4TXSA 4U7CA 4QWEA 3RAMA 4NYPA 4H4KA 1OY8A 2MDAA 2ILZA 2J6UA 2JEFA 3OVSA 5ADZA 2C2RA 4K4SA 1S9GA 5KFAA 1ZBTA 2WB4A 3NGTA 1FTRA 3NEKA 2KU7A 4DSFA 2EBGA 3R5BA 2WVCA 4A8KA 4ETZA 1HWKA 1NCLA 1IR1A 2DH7A 1J5OA 5B0AA 4TQRA 4NI2B 3HHLB 2DR7A 1AUSL 3R7BB 3J7AN 1RKJA 4FXWA 2MY8A 2E5HA 2F40A 3WC0A 3DGPA 4X84A 4PXBA 3QRPA 3EZOA 2J9DE 2J8AA 2IRUA 2RH3A 1UW9A 2EFGA 1YTYA 2KI2A 1BE4A 4B02A 2OP5A 5GADI 3AB2B 4EO8A 3ONQA 2CQBA 3M2VA 2CPIA 3HFKA 3NAHA 4MYUA 1MNEA 1S7HA 2M7SA 4JI6J 3RBZA 4OZ5A 3CJTA 1G2EA 3D68A 4ZVOB 2VPWB 3H4DA 4C8KA 3JSYA 4L73A 1GMWA 4J9SA 1V3SA 2ATLA 5B0GA 4OI6A 3E01A 2HFUA 2OD6A 3Q8QB 2CZVC 5LSOA 2WOMB 2M9KA 2MZTA 4B3MF 4RO0A 3IS9B 1TV6B 4V1Ak 2JH3A 3NWRA 1SL1A 2V68A 4LFBJ 3NGSA 1SJ3P 1FI4A 2OMLA 2ZDPA 2HQIA 3N01A 2OEKA 3J7A1 4RNOA 2EKYA 3T5LA 3T6BA 3FCHA 4B3TJ 4YHHJ 1PC5A 1HYSB 2DIUA 3T1HJ 1HKAA 2R7OA 1UMJA 2YKPA 1H73A 1SKRA 1SJ4P 1C1CB 3N6MA 4R8UA 2K7KA 1BQXA 3DLLQ 5A2QU 2DNYA 3D6HB 4CLUA 3WIVA 4KFBB 1S1XB 3RGIA 5IT9U 2F8EX 2GVZB 1S79A 1NSQA 3MOZA 1ACMB 1XJWB 3CCES 4IRKA 2AZ3A 3RU0A 1S5ZA 5HO4A 3VAKA 2FJBB 1NUEA 4LRFA 4IYQA 4DPXA 3HVTB 1FX2A 4YR0A 2ROPA 4P73A 2RUSA 1GTEA 4NCGA 3HSGA 4DR1J 3M32B 2R3VA 4P2SA 3GJTB 5CXTA 2V2QA 5I3QA 4F4KA 4CDIA 4QR1A 3NOCA 3VAGA 4LSLA 4RUAA 4F0MA 2Y9HA 1RAOA 4R5PA 3HCXA 2RDDA 4TY8A 2BJEA 4LF2A 2XC9A 4OI3A 4M94A 2V69A 4YN3B 3RJMB 5DGAA 4U9RA 3RRGA 1AXQA 5ETNA 4UOHA 1P1LA 1GMWD 3IO1A 4PQUB 3AAWB 3PDNA 3ELHA 4MKAA 3PNIA 2YNIA 1RTHA 4OHVA 2ZZNA 1X4GA 4OZ2A 1ZETA 3JQMA 2AF6A 3G8SA 4N76A 4L74A 3QATA 4LQ3A 4Q44A 4U96A 2ATCB 3LPEA 3TEGA 1RAEB 3HM9A 1OPIA 5CCMA 2R8IA 2ALYB 1UJ6A 4CRJA 4DR2F 3T5JA 3PM9A 2ZH7A 3O6QA 4HVZA 3CMAS 3EJMA 5IT0A 2C2OB 4Z37A 4UOFA 3G82B 4WIIA 1F60B 1YJVA 2OPRB 1JX4A 1I94F 3PJ9A 2D74B 2CQHA 2ZH6A 1R8HA 2PMHA 3SZ2A 5HVFA 3GTYX 3SIPB 2WCXA 4DL0C 2WBRA 4F0HA 2CQ4A 1RAJA 1YRXA 4HDHA 4F36A 1JJCB 2VA3A 1XC9A 2J0WA 3I87A 5F3ZA 1R6YA 3H40A 1SJ1A 3Q2TC 1FNMA 1TMJA 5D0RA 1IKVA 2IAJA 3IRXA 4M5DB 1CS4B 2C3PA 4A8SA 4LJMA 3CULA 5AE2A 2MJUA 5F8NA 5T41A 3VF0B 4ED1A 2OAUA 4GO5X 4X4NA 2BVZA 1HNIA 3CCZA 4BWMA 1E6VB 2ZH8A 1LNQA 5F3TA 3EVWA 3BR9A 4JV5F 3W64A 3K58A 1NHKL 4F04B 2KB2A 1YIJS 5ETTA 2APOA 1WI8A 1SC3B 2XS2A 2AGQA 4M5KA 1YWXA 2EVZA 2QA1A 2FLOA 1UJ4A 4BC7A 3R5AA 4FBUA 5KFYA 3R2DJ 3PHEA 2LA6A 2NUUG 4DR7J 2ZBPA 4CLTA 4C0OC 3R1HA 5LT5A 2G4BA 3BN7A 3BKFA 1RHMB 2X1AA 3L9ZA 2B4PA 3QT6A 3MMAB 3PTWA 1B7YB 2I38A 2E9ZA 3QRRA 1KDNA 4RWWA 2CJXB 3SDEB 2PEHA 2RDJA 3R6LB 4ZN1A 4QW9A 4PPDA 3DLEA 3T3FA 3BO2A 3ZZUA 3DLKA 4O0NA 2R8HA 1M5PC 3JTPA 2AKWB 4USJC 1TU0B 4YB6A 1WSVA 1VI7A 3DRPB 4LFCJ 1REVA 3KLEB 4YB5A 1RBLA 2IYIA 2DITA 1RU1A 2E7VA 4I0WA 1TKZB 2WVDA 1MMNA 2E44A 3I5CA 2ZBQA 4A47A 2PN6A 2E29A 3EZUA 2P2CB 1N54B 3GONA 1P27B 4NMXA 4LSNA 3IXQA 1RWVB 2GMJA 3C6TA 3S1TA 1I51B 1MU2B 2K3KA 3SMZA 2XMAA 3JAMU 4EBCA 1RWNB 1XBWA 3HMJG 4DV3F 1IBLF 3RBDA 1VQMS 2U1AA 2LDIA 3J81U 2LKZA 4WFAQ 2VONA 3FZ2A 5AXKA 4DF8A 5D0HA 3CDAA 3VCDA 4MK8A 4CT9A 1FFSB 3QZ8A 4YFUA 3TZYA 3BO4A 1BXNA 2W9CB 1U1LA 1N33F 3JSBA 2AYEA 1UTAA 2GJFA 4DV7F 5KG2A 1QAJA 1YBAA 2R42A 3PY8A 4C0BA 4Q45A 4JI0F 1KQSR 4HTJA 3MCSA 4J9RA 1RADB 2YNFB 4PG7A 2GA7A 2HNZA 1YJRA 4DZ6A 4M95A 2RRNA 5KG3A 2XY5A 1NH7A 3J7ZT 2AYMA 3WQPA 5CYMB 1PO6A 1FJGJ 2VBZA 4WYWA 1Y3JA 4ID8A 3R3TA 2C28A 5L8RC 3C14A 3I96A 1FFGB 2EKNA 3ULHA 4RW8B 4ED8A 3IWNC 1HNWJ 2QRRA 2Y0BB 2XWYA 1S4FA 4DV6F 4WJBA 1SL0A 2EFQA 4I2PB 4HHJA 4NLYA 2ALZA 2HNDA 2Q3PA 2P5VA 5HMYA 2G0CA 2GCFA 1BHNA 5IQ6A 3MM5A 3BSNA 3T41A 4YQWA 4ZHRB 5A8KB 2M52A 1PYSB 1RP5A 1QDUB 5DG8A 3H5UA 1IM4A 2OH2A 1QY7A 2AV5A 3GP9A 2WVEA 1U48A 3U02A 3KHLA 3W9HA 4YP3A 1R8BA 1NSPA 2CJKA 2YNHB 2LEBA 2E9TA 1S1UA 4B08A 2FPHX 5LSRA 3W8GA 3HP6A 4KGKA 3PW5A 3ENVA 2O5DA 4KO0A 1XNQF 2MLYA 4JBCA 5GAEI 2E1MC 4K7QA 4LSZB 4BS2A 1NZ8A 4OYMA 3LOUA 4GKKF 2IVMA 3SV4A 4YS2A 3OVAA 3K0JA 1FO1A 4MYTA 4ETXA 3AHPA 1VQOS 2Z57B 1UFKA 2R8GA 2DO0A 3V2UC 3MFIA 2HGMA 4OHYA 3DYAB 2A6MA 5K5MA 4I2QA 5KFGA 3RTVA 1KVJA 1U7LA 4B9SA 2MKIA 3M1VA 5DZ6A 2Q6BA 4LF4J 4O23A 2IVYA 2UUBF 3R6GB 3KDOA 4WZMA 1GQEA 3CCTA 3WIUA 2FHMA 2MYFA 5B0EA 2CPFA 1FJCA 1RTJB 3FQLA 1WTBA 4F2RA 4P2MA 3MM6B 1KOHA 4HH0A 2ZE2A 4K5RA 3QIPA 1UVLA 2JDJA 2E1PA 2F63A 2J7UA 4NPOA 3GV7B 4I7FA 1WG4A 4IDKB 2E5LJ 4LRBA 1FRJA 1LWCB 1SV5A 1R0CB 2DGWA 1Q7YT 1U24A 3DRRB 1RHUB 3FFIA 1SH3A 3BPDA 4B9MA 2ZJRQ 4ILRA 2UXDF 5KFXA 5EWEA 5K20B 1RAHB 4DV5J 4PUOA 3NGRA 2XNRA 4W98A 2HMIB 4QIWD 5FJ4A 1VQYA 4Q5VA 4YDXA 1LK7A 2DGUA 4LF6J 4ECSA 2OEMA 2C2NA 1HL6A 4NRTA 1TKXB 4URGA 2NLWA 4UQTA 4RNFA 2IA0A 5DQHA 3HT0A 4NLRA 1LWFA 3E3XA 2DGVA 1TELA 2GGPA 3VZHA 1S9GB 3MUMP 5HBMA 3D6FB 3BSAA 1TK0A 1F6TA 3V4MA 2N7CA 2DY9A 3HI9A 2CZ4A 1J5OB 3OL9A 2D3UA 3BV8A 2CQPA 2QLJB 1OMSA 4DR6J 4ENOA 5LMNF 2B51A 1DTQA 2HHTA 3DGPB 2KFNA 1R8PA 3DM2A 4Y0FA 4Y00A 2D9OA 4KGXB 3MM7A 2MQNA 2JOQA 4DPTA 3NOGA 5L38A 1JB0C 2AJQA 1OIAA 4DU8A 2W9BA 4NLOA 4X65J 4JB8B 4WE1A 2YX7A 3M2VB 1X5PA 1UW4A 2EG1A 4B3RF 4QJVA 3TYTA 2UUWA 3NXZA 3VGUA 3D3BJ 1X9MA 1S1VA 2IM2A 4NA3A 4LUBA 4J9LA 3U1MA 2XG8A 5BYQA 1Z2ZA 2M88A 5T7LA 3E01B 1YG0A 3FJ2A 2UXCF 4QIGA 2VKZG 4KE5A 4DV2J 1LKZA 2AP6A 4FNIA 4I4BA 4KHRA 4YOEA 2QA4G 5HLFB 4DWIA 5BJRA 3KK3B 2DEIA 2WW8A 2EEYA 1G3OA 4TN2A 4C8YA 1OPZA 1F0XA 2EC2A 4LR9A 1B7FA 3J7YU 4DV1J 1NK6A 4RW6A 1N4LA 1DQ9A 1FRKA 3O5TB 1TZ0A 1S4EA 2GC8A 4WWSA 5KFQA 4OX9J 3HK2A 3B82A 4DUZJ 3H8YA 5LM7E 2YQ0A 2E66A 4X62J 1HMVB 3BEGB 3BR8A 3HXMA 4J37A 1A0OB 3A12A 3DCAA 2BW2A 1CQMA 2EK1A 1WDDA 2RSQA 4UY85 1HA1A 2P9GA 1F9HA 1QSLA 3PX4A 3RYLA 5M2PA 2LXFA 5E3QA 3PRDA 2GHPA 1YSJA 1XMQJ 3NMAA 2HHVA 3RR7A 1IUJA 1WC0A 5J2PA 1U6BA 4LFAF 1K47A 4HI1A 1N6QA 4DFMA 5B0BA 3MWBA 3UVJA 1YDLA 3DMJA 3B54A 2JEJA 1EKRA 3N79A 1AYEA 3W63A 2LEAA 4UUWA 2NSCA 1V9OA 2QL5B 4WKYA 3JQKA 2NXEA 3CNQP 1VOMA 1FEHA 3RB4A 1IBMF 1VR6A 4FXDA 5DETA 1NKBA 2HURA 2IM1A 2F4FA 4R5PB 2W8LA 1NJZA 3CJ2A 3OFEA 1FK9B 2SXLA 4HL9A 4CLPA 4ZLJA 2VJVA 3Q2SC 3D54A 4GMKA 2HGLA 1VLYA 4Y2KA 2XMTA 3ZXWA 3GR1A 3FZBA 4OI4A 4ZVPB 2DJWA 1SCJB 2DK2A 5ETMA 2QSFA 2QLXA 1SBRA 3T19A 2YNIB 3AXKA 2VPYB 3PRVA 5E3RA 4J5OA 1SIWB 1MN7A 2YWKA 2V2KA 4K2JA 3US5A 2HHHJ 1TK5A 5KFLA 2FHKA 2BM1A 3KJVA 1QUVA 4P9SA 3LAMA 4ECWA 5B0FA 3MCMA 4DDFA 2HLUA 1UETA 1C0TA 4M5MA 3EXYA 2CFXA 1FEEA 2MXYA 1PBUA 1ZH5A 5LJ5Y 4DS5A 1HNZF 1RAGB 3Q8SB 4ZIWA 4M5GA 4RWXA 2AJ0A 1T9UA 2KRBA 4NEYA 3QO9B 4ER8A 2ZBCA 2DNMA 2DEJA 3TVKA 4MIBA 3LGNA 3KK1B 4KQZA 3TAMB 1DJ0A 3AB4B 4JI2F 3L4BC 3NCPA 1CC8A 5C25A 3NAIA 3L95X 1VC6A 3RR8A 4EZ9A 2CWXA 2V4JB 4KT0C 2F4VF 2HHPA 2AT1B 2QLBB 4DJBA 5DG7A 2IAJB 1N0UA 3NRBA 3IRXB 1CEZA 3JTNA 1KFSA 3W61A 1NPKA 5D3GB 2VBYA 3I56S 2HWHA 1HNIB 2XS5A 2A0FB 3D1HA 1OJ4A 1S1TB 4ED2A 1RT4A 3CCWA 2ZKTA 1UEUA 5KOWA 1FNOA 2GX8A 3FUYA 4WYLA 2E7XA 3C6UA 4RNMA 4ED4A 4O3QA 2OTLS 2DVIA 1HW8A 5IQQA 5AXNA 4I56A 2BACA 5EX0A 5M2RA 4KV8B 5D0EA 3OPKA 4G1QA 3TP2A 3VGVA 2W2MP 3ZZ0A 3RAXA 5EN1A 4NLGA 1EETB 2ILYA 6FD1A 3CE8A 1SXLA 1HIYA 1ZM4A 3KK2A 1XK8A 3CSKA 1OQ3A 2M0GB 3Q8RB 4TY9A 1CSJA 3IA0A 4DV4J 4ID5A 4WFXA 2RQKA 3U1NA 3D0HE 2LQ8A 3HJFA 4EYHB 3QFHA 3I0SA 3EM1A 5EWFA 2EBEA 2PDAA 1RKIA 3EGWB 3H59A 1MG7A 1ITPA 2XULA 4Y2IA 2J0XA 4J9VA 5HMXA 2JFKA 4IUFA 1X0PA 3M6WA 4JI6F 1FA0A 3I6PA 4EBEA 1FD2A 1HWJA 4FYWB 2WAQD 4KGVB 5J1EB 4A4JA 4F4ZA 1JLEB 1GXUA 3M7VA 3M9OB 1T11A 3H5YA 1D9FA 1LXJA 3K57A 3D5MA 2VDIA 3L7OA 3CJ5A 4CO1A 1EAYC 3UD3P 4LSNB 1XQIA 3OR2A 1K8AT 1FFWB 2L9WA 3C6TB 1A9NB 1RTIA 5KFCA 4LFBF 4G3IA 1SH0A 4QWBA 3M8QB 1NAQA 4OL8A 3L7UA 3KYLA 5JJBA 4OYWA 3BM7A 4B3TF 2CVIA 4YHHF 3LALA 1OS5A 3T1HF 2FGCA 5SZTA 1WI6A 2EFOA 4KY3A 1CBKA 4ECZA 3NGUA 1D9DA 2WK4A 4GKJJ 1CC7A 1S9FA 2W25A 2K2PA 1FKOA 2RKIA 1U4BA 2L41A 2AX0A 5KT3A 1NK9A 3GIKA 1SH2A 4HACB 1S6QB 5CZXA 1JLAB 2RIJA 2AHOB 3H90A 2ZM6J 5EHHA 5DQGA 1R0BG 2AX1A 1U1NA 4P75A 3M8PA 1XR6A 3K5LA 4IG0A 1AFJA 3IM9A 2VIHA 2XO6A 3Q83A 5HSPA 3B78A 4DR1F 2AGPA 3C14B 6AT1B 2ZJQQ 2QA4S 4IOBA 3DOMA 3VV2B 1UA1A 1QSYA 4JI7J 4XPEA 3OR1A 3M30B 2GZOA 3K5PA 4OX8A 5FLXY 1VQ6S 1KFDA 1QM9A 4KKOB 5KFPA 2HIQA 4WPAA 1Q8KA 4WXWA 2DHAA 4GO7X 1ROFA 3QPIA 4JV0A 4NA1A 1RA7A 4ZPWR 1S12A 1NM2A 4C8LA 4KHMA 3CMQA 3GFXA 2CAJA 1RWWB 3JYTA 2GQ2A 5AJ3J 3DU6A 1U09A 4ZCIA 2QV6A 2MJNA 4LIRA 2R2SA 2RU3A 1H3DA 2FJVA 2GJIA 3MM9A 3KUGA 4CCHA 1DBDA 1GH8A 3OTBA 1BQNA 4UT4A 1HI8A 2W7PA 1EP4A 2F8MA 4OJ3A 3QSYB 1FXDA 4O3OA 1X7VA 4QIVA 2R2RA 1K44A 2DISA 1S1UB 4FN5A 2A1BA 4MIAA 3HSJA 2HBZB 1D1UA 4F3QA 2H3EB 3VVUA 4RU2A 5A8WA 2W2QP 5KG0A 2MQLA 1WTFA 4CM2A 5GAHU 2Q6CA 5DO2A 3CCVS 1RBOB 1S6OA 3V6DA 2LECA 2RT3A 4DBQA 3MMBB 3G6XA 2MKJA 2LYVA 3ZTSA 2UP1A 1L3TA 4HH1A 1T05B 3BYRA 3MPDA 4ECTA 3BBFA 5DRKA 3L09A 4WFNQ 2NZCA 1U6ZA 3MD1A 3I4HX 1F3FA 2LU1A 2XLIA 1T03A 1RT2A 1DQ8A 1T9XA 1P1TA 3UR0A 4DSEA 2Y1IA 1B4SA 3JSRA 4CNZA 3AD7C 4KR0B 4OHWA 2BX6A 4YMEA 3SV3A 4F2SA 2ZZMA 2I5JB 4DLGA 2F3JA 2FLPA 5D0GA 2DCUB 2BA9A 3E2EA 2ZE2B 2DXFA 3QIPB 3HPOA 4D3GA 6FDRA 1SKWA 4C8MA 4I7FB 2DGOA 4ECQA 3TEHB 4MTPA 1P6TA 1SV5B 2Z2YB 3NGDA 4DR7F 1Q78A 3MCOA 2OELA 3FFIB 1EB0A 3IWLA 5K14A 2AJ4A 4FZVA 1U2FA 2JC0A 4LRAA 4NLXA 2W2OP 5D77A 3TJAA 1VJWA 5E5NA 1NK4A 4IQMA 4YEAA 3DLBA 4XO0A 1BD6A 5DLGA 1RE1B 2EFNA 2A6OA 2Q66A 4NLQA 5JUMA 3SI8A 2G1HA 2VD3A 3KLVA 5G0RA 1U0HB 2BV3A 2CVEA 3FVYA 2DNZA 1JLFA 5K8PA 2R7UA 1CPZA 4ZPTR 4LFCF 1UJ5A 4ECXA 1ZA1B 1YRUA 1PJ5A 1KR4A 4PWUA 1QAXA 2XCPA 4OLOA 5AT1B 1FKAF 1KP6A 3BSCA 4NZ6A 1S0NA 1UL3A 4Q0BA 1NDCA 3F56A 1HI1A 4USHA 2M8DB 1YITS 5J2NA 5KG5A 3LP2A 3D66A 3ET6A 1YX2A 1UA0A 3IP0A 4HHHA 1MWQA 1RBAA 1U1QA 1WORA 2ZH5A 3D6TB 2A2CA 2Z0GA 3V4IA 2QYGA 4FPIA 4ZN3A 3MM8A 1X4BA 2KXFA 5AE1A 2I6WA 2D69A 5A2QY 3Q89A 1VQ7S 3AQOA 3ZZRA 3J7YI 3H20A 3D9BA 1S7IA 4B3SJ 1NSKL 2K1RA 1TL3A 3RZAA 4WE1B 2OI2A 4WZQA 3U27A 4ES2A 3DGVA 4HT5A 2CQIA 4OZ0A 2MEWA 3DRSA 1RCXB 1O5JA 2DR8A 3CXCR 4PWDB 1FJ7A 2IFXA 3KDNA 1SJQA 4DS4A 3GQCA 4DPOA 3GU0A 4JV1A 4P72A 3UDCA 1HNVA 3GILA 4ZVFA 4YB1P 4W4MA 4OYXA 1Y5LB 3IWXA 2CDRB 1CULB 2YX1A 2WHOA 5KFRA 1XEZA 3BF4A 1AW0A 3M8SA 5F41A 3N28A 1GAOA 5KFZA 4RW6B 4RZRA 1A7GE 2BJ3A 1FJGF 2HHXA 5H1SV 2KT2A 2VB6A 3CJQA 1FNXH 4FDFA 4LVOP 3O3LA 4PR6A 1LW2A 3AY0A 3FSXA 8AT1B 4B3OA 2ZC3A 1VRUA 3OXLA 5CAAA 2MQMA 5HP1A 5A0YB 1GXLA 1HNWF 3L3CA 4DN0A 2VFSA 5L39A 2NXCA 5F8MA 1VMBA 1RAAB 2FZCB 1JLGA 4DV0J 1KHVA 3CCMS 5J2PB 3EGNA 3TJ8A 2HWIA 1N6QB 5AE3A 4ZP6A 3G9CA 4C9DA 1URRA 1DQAA 1N34J 2OKQA 4Z7YA 5JXSA 1Z1ZA 4XPCA 4P2XA 4K4YA 2K3IA 1AB8A 1R27B 3P5BP 3DOKA 1X5TA 1RWKB 3UN2A 1RWXB 4JP8A 3JTOA 1N8RT 1X9SA 2ZHAA 3BSOA 5LXYA 4ZIVA 2DHSA 4MH8A 4JOUA 4ED6A 1X9WA 2BJ1A 4EUVA 2X1GA 2ZFHA 3B4DA 3SQGA 3KOAA 3HVRA 1Q5YA 5G4DA 4URSA 4Q2LA 5HN0A 3UD5A 1W26A 2EW9A 4FBTA 5KFVA 2VC0A 3CIMA 5E3CA 1UCNA 1APSA 4HLBA 3UDEA 4AE5A 2B9EA 2OUGA 1IKYA 1GMVA 4JI1J 1R6VA 3VR1A 5C2GA 1RAIB 2YPZA 1S0OA 1UFWA 3B6BA 4R25A 1N88A 3H7HB 2CKWA 3KJVB 5HL7Q 2H5IB 2F9DA 1FTCA 1Q8LA 4CLLA 1SL2A 4LF4F 3V81A 2MB0B 1C0TB 3ZZZA 3POTA 2HNYA 2GHWA 1ZAVA 3KJNB 2N3LA 3QT5A 2VICA 1HARA 5CA5A 1A6LA 1UVKA 2ZNYA 3C15A 3CC4S 3NNHA 2CNLB 5DLFA 3SCKE 2V6AA 5D6GA 3A3PB 5HQMA 2E5LF 3AODA 1DLOB 3JSMB 2NXUA 2YKMA 2CPJA 2FVRA 2MKCA 4LR7A 4JYAJ 1RWPB 2WW4A 3GJRB 3P45B 4WU3A 2XGQA 3PYFA 2FDNA 4LF7J 2DNHA 2PMWA 1RT6A 1U1OA 4Y2AA 1SPBP 4PRFA 4L76A 4DV5F 2RILA 3ITHA 1B3TA 2L3MA 1QUPA 1Y11A 3X3UA 4LF6F 4TKTA 2CWKA 3MR6A 2W01A 1IJFB 4ED3A 1SQGA 1ZZNA 1WNEA 1VRTA 3QQCD 1RB0A 1RTDA 1Y00A 4KH1B 2J9EA 3ZZPA 2GO8A 4I6AA 3A8IA 4DQPA 2J9CA 2FY8A 2OHDA 4H4MB 4J91A 4M5LA 3CMES 2RHQB 2E1RA 2F9JA 1FJEB 2N7YA 2CNKB 3BB5A 1RT5B 1VHFA 3M6UA 2RQMA 2PGCA 3KLHA 2CPEA 2Z2LA 2XLJA 2ZUAA 3KNAA 1NKEA 2Z2ZA 1UWAA 5A8RA 4NXMJ 3J81Y 4KTQA 3KK2B 1KBRA 2AMCB 2XYGB 4DR6F 2MY7A 2VASA 1WD6A 5AXLA 3QLHB 3OXGA 4ID5B 4TNOA 4ZLPA 1YBTA 2VG5A 3I0SB 1YZ6A 4PG6A 1N5TA 2QE5A 4A8FA 3DLGA 2F65A 4Y2CA 2IC3B 3W5YA 2EXUA 3GIRA 3T9NA 2LA4A 1FE4A 4OZJA 3I5BA 4X65F 3QZ7A 3VVTA 1U8WA 2P6TA 3F73A 3AA8A 2GW8A 4LBIA 1MWYA 3VGSA 3AOBA 4DR5J 3PIPQ 3BN4A 3HD2A 5KFTA 1K0VA 2OPQA 4USIA 4ZCMA 1MROA 3CCUS 1M1HA 5F0UA 4OIXA 4HYKA 4DV2F 1TL1A 3TX0A 3PFOA 2YY3A 4PQAA 1F9EB 1WC5A 1SKSA 2FGOA 4DQQA 4F4XA 2CNOB 5DGBA 1IWAA 4AL5A 4PAAA 3OUYA 1T94A 1HPZA 2BW7A 4DV1F 1FVQA 4PCQA 1H74A 4CTAA 4PG8A 9ATCB 3I9V9 5H9FJ 3GZ7A 4OX9F 4DUZF 4Y3CA 1JLBA 4X62F 4CLSA 3KG4A 3UE2A 1KONA 2BE2B 3W2WA 1ZTTA 2DPJA 2RU9A 2AYBA 4JV2A 5FDLA 2HZVA 2YNGA 4HI2A 1FKOB 5H9FK 2XHWA 1XIQA 2H1YA 1XMQF 3S8SA 2C2EA 4F50A 2OPSA 3CPWR 3HFVA 2AZ1A 5FLXU 1VHIA 1WJ9A 3TA0A 4K4ZA 3FQKA 4C8OA 2HS3A 4PG5A 4UOCA 4N8OA 4ZJQA 1HD0A 4IG0B 3PACA 1F5CA 2BKPA 4NOHA 2DGXA 4C4WA 2HQDA 1RABB 5E3PA 5LJ3Y 3R7SB 1PAUB 1TQLA 1W2IA 4RUBA 1N36J 3HDSA 2IJFA 1V6HA 3BBCA 3OR1B 2EG2A 2V63A 2FJEB 5D4NA 4FVCA 1BQMB 4LVNP 5BYSA 1RZMA 3M9MB 5HVGA 2H51B 3H98A 4BBYA 4CWBA 3I5AA 1RT3B 1WHYA 3IGNA 2XSFA 4EU0A 5GAHI 2ADBA 1E6YA 1R7IA 2F7VA 2VDHA 4DX5A 2E5JA 3EGZA 1MW7A 4DFPA 2OPPA 2YQ1A 3GFHA 4BLGA 2HHHF 3EWGA 2VQEJ 3FEYB 3BGRA 4MKVA 3JQJA 4N41A 3MM9B 1TUVA 2FLNA 3MI7X 1VS3A 2G1DA 1BQNB 5KG7A 4CLWA 4K0KJ 7FDRA 1EP4B 2IDLA 3G71S 3TR5A 3NMRA 2QEXS 4ED5A 4ZMMA 4ERDA 4C11A 3NCRA 1IKXB 5IT4A 4WP9A 3BH7B 4O4GA 3LO3A 1DFDA 5E3AA 4RLEA 2NYIA 3OL8A 5KT7A 1LFPA 2KKHA 5C5JA 4TU7A 2HZAA 5IC4B 3ZNJ1 1VBXA 1QVGR 2V2VA 1KQKA 3I55S 2WSEC 4R0EA 5HMZA 2OFGX 2VL1A 2ASJA 1S72S 1NU4A 2JHEA 2DPIA 2ZKUA 3OTOJ 1MLAA 4EEYA 1T0TV 5KFFA 1TAUA 1S49A 1HBOB 2YWEA 2JX2A 2XZWA 3F44A 3THPA 1WUUA 1UFLA 2LXIA 4N8NA 3M2UA 1KVIA 3H2UB 3UO0A 3D28A 3J80U 1S0MA 1EKSA 2HFNA 3VAIA 1YJWS 2KO1A 2O67A 4LIWA 2NR0A 4R0JA 4RW4B 5KTQA 4QPTA 2DH9A 3LP0A 2XYHB 4DFKA 1TL4A 4H4KC 5KFOA 3FBFA 1KNZA 3GV8B 3Q22A 5D15A 3J7Z5 2HFOA 4M1KA 4RNNA 1WSRA 4OX6A 5KAKA 3CCLS 3CJRA 3WHIA 5E2QA 3T5KA 3DDNA 5D78A 4DV4F 2OEJA 2CJQA 2X3GA 4U95A 4XDCA 3AJ1A 3CVKA 5B09A 1ZPVA 2IJNA 2XLKA 1PJ7A 2QYCA 2Z58B 1KC8T 2UUAJ 5G0RB 2QC3A 1JLFB 4A8OA 3R7NB 3R9LA 3OD2A 4DXLA 2YTCA 4DL5A 2V67A 4Q0BB 3RB0A 5L46A 2XMUA 2IHR1 2CQ1A 2UU9J 5J2NB 3PYGA 2JRSA 2IJRA 2C2MB 5DS7A 3ET6B 2GAGC 2WTFA 1VQLS 3GIJA 1SKUB 3M4XA 2ZD1B 2BOPA 4ZVQB 3M6VA 2C1EB 3C16A 1U0SA 3FC9A 5E41A 3TARA 5D4PA 4Q8FA 4NASA 2ACMA 2K06A 2VF3A 3D1QA 3MM8B 3OFHA 5J2QB 2ZZTA 3ZTOA 2FZGB 2DYAA 3EE3A 2CPYA 2KL8A 3ISZA 3BREA 3M8YA 2K1RB 2WRMA 1EIYB 3EMTA 1P8GA 3TAPA 1HYSA 5HAOA 1HQUB 1PG5B 2ZC4A 2ZVIA 2I1RA 3PRBA 1N5QA 3MAAB 3DRSB 2XBPA 2GQCA 4GKJF 4LRCA 4QIEA 5KFIA 1JIHA 4TYAA 3SQOP 1HNVB 2FVCA 2XSJB 1S1XA 2R7RA 3SEOA 3EGVA 5HQLA 2QFIA 2GVZA 2ZM6F 1U2RA 3PKMA 5GMEA 3UDVA 3UDLA 4IH7A 4NLDA 1CJTA 4YB7A 5U47A 1H2VZ 3ILJA 4H54A 2VODA 4M8LA 4OYZA 2V8GA 4K5SA 2KT5A 4WBFA 3C3LA 3HVTA 5B08A 4PEOA 4ZVSB 2V8PA 5B0CA 1M5OC 5HMWA 4X4TA 2DR6A 2B5JA 1LW2B 3KHGA 3M32A 2DXDA 1V5IB 3W8PA 1XTZA 4B3OB 4YY3J 1JLQB 3G87A 3IAM9 4ANEA 1U6FA 4G1IA 4OYOA 4DL7A 3FSIA 4NLSA 2D9PA 4JI7F 3PW0A 3EVOA 3SCIE 1TKTB 2Z2MA 1FXLA 4NLTA 2OIHA 1PILA 5IV3A 5HROA 2IBOA 4DCOB 4WKRA 4K59A 2CYYA 4OJHA 4MAKA 4K4UA 2OFHX 3TW0A 4PQUA 1JLGB 5J2MA 5KFDA 1UWBB 4FF4A 4B9NA 2HFZA 1O6XA 2R7QA 3LAKA 2VOPA 4ZP9A 5A6WA 1O51A 5AJ3F 1NKCA 1WDTA 5ETOA 2MZ1A 4ZK7M 4DEZA 1GXTA 3FBCA 3GB0A 1BC6A 3H25A 4IFYA 5L1IA 3QT8A 3CJ8A 2DD8S 4Q8EA 1N56A 4F02A 4RW9A 4J90A 3BQ0A 3K8WA 2UUCJ 4P10A 1RA6A 2RJZA 4OYIA 3MECA 2CZ9A 2ZH4A 3NGKA 2HRYA 2FJWA 3AJ2A 3CO0P 3PW7A 2CG8A 5GVQA 4QWAA 1VQ4S 3G82A 2GAHC 1WEXA 1KRPA 2IDEA 2JLEA 1FESA 4ZVEA 3FNNA 1RLDA 2QLFB 2MLXA 2W8KA 2XMWA 4DZDA 5I4MA 2ZH3A 4AQYJ 3GR0A 3KMQA 1R8AA 3A3OB 1AZSA 2HWTA 2D3ZA 4PG4A 1IKYB 2FHJA 4F3OA 5JVGQ 2CQDA 4M5JA 3RB3A 4P52A 4KSEB 3D4JA 3MEEB 4J9QA 3M8WA 4M5DA 1CS4A 3OFFA 1CQNA 1XMOJ 3POTB 1LW0B 3B8HA 1HLWA 3FSYA 1UVJA 1E6VA 1EQ0A 1XR5A 2XYPB 4DHVA 3BGOP 1RSCA 3C15B 1T95A 4DN9A 5F8JA 2VOOA 4AUKA 3SYZA 3DRXA 3MF5A 3DN9A 3OQ2A 4USWA 3CJ4A 1QAIA 1YJUA 2HYIB 1BMQB 2MLZA 3OSNA 2VG7A 3GWCA 4I1TA 1NZAA 3N5FA 3WC2A 1GEHA 2IPOB 2KYXA 1T9VA 5DDRC 3IBCB 1YJ9S 2BEFA 3LTOA 3R5GA 4LF5J 1Q95G 1RT6B 1S1WA 3Q23A 1HHTP 3CJKA 1H6KX 3ITHB 3QGHA 1U1MA 1B0TA 2CPXA 1VGYA 1N0VC 2HQGA 3RW7A 5D4OA 2XY7A 2KJWA 1DRZA 4A46A 1H98A 1VRTB 4MFBB 2W1BA 5MLCV 2RRBA 3A8JA 3DRPA 2GVDA 4Y65A 3KLEA 2PC6A 1OY9A 4AD6A 1R31A 3QWUA 3ADAC 2B6AB 4F8RA 2UVWA 4RW7A 3KG1A 2X1BA 3FRZA 3QT7A 4JI5J 2I2YA 2H5JB 2R8KA 2DB1A 1KTQA 2BQRA 1RT7A 1Q79A 2RHSB 1SC1B 4CO0A 1ZM9A 4ZVTB 2VC1A 5BYRA 2NUHA 1M1KT 2RF2A 4Q43A 2J76E 1BUXA 3IR6B 2R9LA 3ZNUA 2VG5B 1FD8A 4C8ZA 1FXRA 3OLBA 3G6ES 4RUHA 3BZQA 3CC7S 4NLUA 1TUWA 2BKOA 2BR0A 2YKOA 1W25A 4B3SF 4F7VA 5KFUA 1S59A 1WACA 1NHUA 3MZIA 1NB7A 3C8YA 1BGXT 3BDPA 4B9VA 2OLWA 3K5NA 5KT5A 2QN6B 2C3UA 3Q8UA 2XI2A 2FUG9 4X4OA 5L1JA 2AGOA 2W9CA 1MROB 3DHXA 1W2BR 2HBYB 3ENAA 3FEZA 1TMMA 3TANA 2PEBA 1KTVA 1TL1B 1SIZA 4PYDA 2YWFA 1HBUB 4WTYA 2GIQA 3OUYB 5I3PA 2VBXA 4QCLA 4ZA1A 3ZTQA 4ZPVR 2Z8QA 2JNJA 4ZS6A 1KLMA 3SSQA 3D6MB 1JLBB 2HRUA 4ECVA 2MHNA 2XGPA 2EFPA 5FDLB 3TAQA 3CC2S 4OV1A 4I2PA 3ZTPA 1VC0A 2PSZA 3LQVA 4U8VA 3HSDA 4DUYJ 4DV0F 2FJAB 3PKYA 4IFVB 1P9QC 5IM0A 5KFJA 2AWZA 2LCWA 2V8HA 4MJKA 2HAIA 1OO0B 1T3OA 2HQ3A 2QTWA 5A8KA 3C46A 1N34F 2NZ4A 1UKUA 3CTRA 3TZWA 3HLUA 2MTLA 3VAHA 1FDBA 4BDPA 3DLHA 1NSAA 1S76D 3UW1A 3P5TL 3KLFA 3QNWB 2DHHA 2G2OA 2B7CB 1JLCA 1I3OB 1EJ7L 4O44A 2YNHA 2L08A 4TU9A 4PKDB 2PFDA 3DI6B 4X4VA 1GMUA 2AEJA 5C42B 1LEOA 2DCLA 3RBXA 3W3SA 3GPAA 1FRIA 1JNRB 3FDSA 1N5YA 2R7WA 1DTTB 4ZDNA 1X4DA 1QE1B 4O3SA 5KT6A 4TYBA 2FTRA 3OT9A 4AFFA 3DLJA 3WX4A 3IG1B 1C1BB 5RUBA 1E6YB 4USKA 2JC1A 4MIWA 3DRYA 2MQ8A 2GJ2A 1RHJB 4RPFA 4JI1F 1R8CA 3W9IA 2A18A 1PIEA 1Q7LB 2YKNA 4EZ6A 3FCVA 2B9WA 4N47A 3N4WA 3KLIA 3PV8A 3UWTA 4ECRA 3MEGB 3BGRB 1PSDA 1K1SA 3ZZTA 1IQTA 4FXVA 4DQRA 2VUGA 1PGZA 2ASYA 2HSEB 4RBVA 2V0NA 2RQ4A 5EDWA 2AJ1A 5T14A 3KUHA 1G6BA 1R3NA 2R7VA 1G1XA 3PYDA 3B4MA 1VJQA 4UQGA 3V6KA 4C11B 3L7PA 4QPXA 4X66J 5M2UA 1R43A 3H4BA 1RTJA 2ERRA 4IRCA 4P7TA 2KN4A 1Z2LA 1SQFA 1ZM3A 3UNGC 4XK8C 4RKUC 1TVRA 4K4WA 3MM6A 3W5ZA 2VQFJ 4HT7A 4QQBA 2B43A 5BR8J 3HHKA 1M1GA 3HSZA 4IDKA 2BDPA 2HGNA 3GCXP 1FRLA 2XZDB 3PX0A 2QO3A 3FBEA 1LWCA 4C6AA 1EX8A 5IC6B 4JYAF 1WF0A 3QYYA 2R7XA 2JLFA 3GYNA 2MSTA 3QJPA 4LF7F 3QGIA 1GFWB 2MGZA 4WP3A 3DOLA 2KHDA 4A8MP 4QIFA 3UI3A 3UCUP 2GS8A 1NPPA 4QYRA 3MFHA 1ZS6A 2HMIA 3MOJB 3M2UB 4RL1A 1NDLA 3UCZP 2IRXA 5D4LA 4JI3J 2QMWA 4RJVA 2B9YA 3EPIA 1P9YA 3RUBL 3CJSA 1VBKA 2QJ3A 4CM0A 4WK1A 3LP0B 4LR8A 1QJHA 3OHAA 2DIVA 3O8WA 4U7UD 1S48A 1GT8A 3P6YC 4NXMF 1X5OA 2ADCA 1LQ9A 3H2LA 4J9PA 1FX4A 2X3DA 2LU2A 3GFYA 2CJAA 2HS0A 3EDQB 4ZJOA 4U7UK 4D3HA 2VV5A 3OTDA 4OI0A 2GMLA 1KS2A 3EPGA 1MMLA 2B8PA 3I82A 4R8UB 2OMOA 2KXNB 5CYQA 1XNRJ 2YWHA 3ETMA 2PIIA 5ETPA 4ANDA 5ETLA 3CT9A 1N5SA 1R0AA 1SI9A 2HFVA 4DR5F 2QLWA 4Q7AA 2XZTB 4KIAA 4NX9A 3HKZD 1Q81T 2CPZA 1DAXA 4KC5A 4MK7A 2E5IA 1IBKJ 1N5VA 2NS1B 4ZITA 4B9UA 4AXIA 1Q4RA 3P3DA 3HD1A 3C16B 2YWWA 4USVA 4K4XA 5HLFA 4OHZA 3KK3A 2W4CA 4XAKA 4CH7A 4NCGB 1YLXA 2LQ5A 2JJ4D 3N6NA 2CXEA 4ICLA 1RAFB 2BJ8A 2QSWA 1RHKB 4QR2A 3TRGA 4LSLB 4EK2A 4USMA 3Q8PB 5ETKA 4RX6A 3PIOQ 1WEYA 4TY8B 4I6YA 1DURA 1DZ5A 1ICEB 2XMMA 1HMVA 4NLVA 1K73T 1FWPA 3CD6S 1ZPWX 2OTJS 4DG1A 3D3CJ 5JVHQ 1NPRA 1LFWA 3HZGA 3N9UC 4H4OA 1RYRA 2O1PA 1RTHB 4N77A 1U26A 4I6WA 4FS2A 4NWBA 1CJTB 2K8GA 3H5XA 3SSRA 2Q43A 2KHCA 1NNDA 5HATA 1NK7A 1FDNA 5I42A 5SUHA 1WF2A 1T9YA 1SJRA 2R4FA 1VK8A 1NJXA 3G6VA 1FKPA 1NEEA 1WF1A 2IM0A 5A76A 4QWCA 2ACYA 2DR5A 5DM7Q 2JEGA 2B5JB 3T1YJ 3J81j 3BGLA 4NLPA 2U2FA 2CQ2A 3IAS9 2DNQA 3Q8YA 1N36F 1VBYA 1TKDA 3ZFVA 3CJ3A 1SQEA 2DNKA 2W4PA 3IR7B 3PZPA 3NCQA 1VQ9S 1HBMA 1WEZA 1YI2S 1FK9A 1X0FA 5HROB 1RACB 3G8QA 1RWMB 2ABYA 1S6PA 1JMTA 3R8YA 3QJJA 2A10A 1VRQC 4OV6A 3AD8C 5ETVA 5J2MB 1Y7PA 2EWHA 4F4WA 3AXMA 4O3RA 1X5SA 2HFSA 2DNLA 2R2TA 1IKVB 1CJUA 1RK8A 2VFTA 2NPIA 1JKHA 4NZ0A 4CNYA 4ZPAA 2NPFA 2BANA 3KMSA 2VQEF 4HEA9 5IWAJ 4KPYA 1QD1A 5D8HB 4IFYB 4KB7A 1IN0A 2DH8A 2CQGA 4C48A 4RW9B 2OGUA 2HVHA 4K0KF 4LF1A 2UXBJ 2Q1LA 3MECB 2JFDA 2DTJA 2FHOB 2QL9B 3MUTP 2PE8A 3S6EA 4OMFG 2MZSA 2XM3A 2VJUA 2HVDA 1T8EA 2IYGA 4CO5A 5E7OB 2QMXA 3MEDA 4CYUA 2W7OA 3QO9A 2PT0A 1RLCL 2QA2A 3TUIC 1M0SA 3KJFB 1QAYA 1AZSB 1NH8A 7AT1B 1S10A 4DL3A 3KK1A 3A1YG 3TAMA 2P9CA 5ETRA 2G9OA 3OFGA 1JXEA 1MN9A 1V3ZA 4AT1B 3RG6A 3OSPA 3CDBA 4AL7A 4KHPJ 1LOUA 3SXLA 3QIDA 2CIMA 2AD9A 1WOOA 2V4JA 3QRQA 1BWVA 3OTOF 2IMOA 1JK9B 1MMDA 2NREA 3MTKA 2P6SA 3DLEB 3DLKB 1I5OB 3CEDA 2VPZB 4GVLA 4ZPCA 1HBNA 3OBIA 4L6V3 5D3GA 1REVB 4UUXA 5LMUJ 1QVFR 2FB0A 2XWXA 3HULA 3MPUB 3D7SB 1S1TA 3QAUA 1WKJA 1KQFB 5H9EJ 3HHDA 8RUCA 1JXLA 2DNGA 4DI6A 3CF5Q 4WTOB 1B64A 2VG7B 2FIUA 4KV8A 4USUA 1GX5A 2V34A 2DR9A 2LVWA 4TLRA 1EETA 1ZAXA 4QW8A 2M70A 4PPZA 4V19J 5H9EK 2WVBA 1JNZB 1S1WB 2QG9B 4NXNJ 3CJKB 4F4YA 1VDHA 3IGVA 3OVBA 2LQ9A 2B3TB 2WONA 2XTJP 4XIUA 2H4YB 2DRDA 2RRAA 2UUAF 2FVSA 3GCWP 2JVOA 1NK5A 4CLKA 1VQPS 1XERA 4OZ1A 3N0VA 1WHVA 3S7RA 1SUQA 2V9KA 2GVDB 4AXJA 5KFKA 1S97A 3LUYA 4DR3J 3W2VA 1RGVA 2RAQA 4NLWA 1GK8A 3GV5B 4RW7B 2UU9F 3THTA 5J1EA 1JLEA 2X7IA 1IKWA 3O1LA 1HW9A 1NMEB 2HNZB 2ZJPQ 3LANA 3MPVA 3HHNB 2VBWA 2K7JA 1RT7B 2HLTA 1NBEB 1IVZA 3GLJA 3MAHA 1ZOTA 4BCAA 1QTNB 4NEZA 4DQSA 2RF2B 4DX8H 4IRDA 1NJIT 3EDRB 2IIHA 3M8QA 3V5RA 3Q86A 4X64J 3FKBA 3UN3A 2J7WA 1IBCB 4WFBQ 3H0PA 2H54B 4CLYA 3TA2A 2KDOA 3VQSA 3EZ5A 4TU8A 3AA9A 4FNHA 2J6TA 1X4HA 1HQEA 2FD2A 4EO6A 2FY1A 3LA0A 5E0OA 3HT3A 2AJFE 2HNDB 2ASLA 2GIFA 1RWOB 1RTZA 3MR2A 2IY5B 3GYGA 4WP8A 2B4OA 2KRRA 1PCAA 2KJVA 3MM5B 5CQGA 2YKQA 4EMDA 3NNCA 4FPRA 3PFEA 4HACA 1S6QA 3LGMA 3BQ1A 2RNEA 1JLAA 2LQJA 4EBDA 3AT1B 3EVMA 1H7WA 1HHQA 1TAQA 2FC9A 1RISA 4I67A 2PO4A 1NDPA 5HJYA 1L3KA 5L1LA 2B4VA 4FVMA 3AH6A 4ZP7A 2MKHA 4FKXA 3W60A 4ZVRB 1KLMB 3ILIA 1WOSA 2VFRA 1OWXA 4U67Q 2ASDA 3FMWA 1KVKA 2NCKL 2WSFC 1UEVA 1YQHA 4DMZA 2POKA 1U47A 4HDGA 1L3SA 4YY3F 2ZH2A 1OYDA 1KOOA 4KO0B 1WELA 1T7PA 5LL6d 3QAEA 1FCAA 3NS7B 2B9XA 4IH5A 3M30A 3IFEA 4ALZA 2XMKA 3WDOA 4KKOA 3RRHA 1UP1A 2VG6A 1HQ2A 4CLFA 1TL7A 1Q5VA 5IM0B 2NQPA 2PMZD 4I2QB 3RW6A 2QIFA 1TR0A 5KT2A 4GC6A 2DNNA 3NS6A 1FRHA 3M1VB 1FE0A 2LMIA 4NMLA 4UTGA 3HZEA 4JI8J 5LOQA 5KG1A 1M5HA 2BOAA 5KFEA 4W92B 1GX6A 3WX8A 2FYXA 3OTEA 4ZCLA 1EQMA 5HQ8A 4QR0A 3KLFB 2N3OA 2UUCF 4CLZA 4OX7A 3R27A 3PCOB 2VU5A 1JLCB 5THWA 1IWGA 2HHQA 4ZJLA 3VAMA 2ROGA 4O44B 4WK3A 2M8HA 4FYXB 2MMYA 1M90T 5A6PA 4LF9J 3P49B 2HK3A 4EYIB 3KLGA 4E0DA 2MPUA 1N5YB 4ANCA 3FMBA 4ZP8A 3BKTA 4IOCQ 4AQYF 2B0GA 2KVQE 1AUDA 2IVFB 2ZNZA 3QJLA 2C2DA 2DKOB 1AA1B 1VQNS 3MMBA 2DGSA 3H5SA 3TQEA 2KG0A 2YKNB 5I3UA 3KLIB 3J80Y 1T05A 2FJDB 4PUOB 1PBAA 1RT1A 1TFWA 2AU0A 3MPWA 3ISNC 2LEPA 4OJ1A 3I4PA 2M4MA 2LQBA 5F8IA 1C4CA 2DHXA 4PXCA 1XMOF 2MZRA 4JI4J 3PHTA 1VIOA 1CJVA 2MKYA 3C2PA 4EFAC 1HR0J 2Z56B 4L75A 5B7WA 3HO1A 2JEIA 1LWFB 5FD1A 2I5JA 3WBZA 4K8RA 2BQ3A 2GGPB 2UVRA 1TTHB 5KFMA 2PI5A 2DT9A 5HBMB 4KAIA 2KH9A 1TVRB 2ZITA 4ELVA 3W66A 4GVBA 1FF2A 1S77D 1PYOB 3MR7A 2QT7A 5IXUA 3ISND 1PYTA 2LFVA 1HNXJ 4LF8J 3TZXA 3RAQA 2Y8YA 2FQQB 4ATNA 1KEKA 1DTQB 4J9KA 4L3NA 4A48A 3DM2B 4LF5F 2MGZB 1C4AA 3TUPA 3DOLB 3VAJA 3MM7B 1B0PA 2H65B 4ED0A 3UD4P 3HFZB 1Q82T 2ZWPA 2W9BB 2O3DA 1WC1A 4DL4A 4LT6A 2W2NP 2D1CA 4G6VB 2E5GA 1U0HA 2D41A 1S1VB 3N6LA 4RUCA 2F8HA 3M05A 2LDYA 4C2MA 2PA3A 3UPFA 5T7LB 1FVSA 1JJHA 5KT4A 4JI5F 1DY3A 2BYCA 2P8IA 3PR5B 5F8LA 5L9XA 1RDRA 2YX4A 2I8EA 1F3VA 5EUHA 1NHVA 4EI2A 4IO9Q 1VYAA 4MKBA 3A4TA 4DL2A 3CCJS 2HRTA 3C19A 1H38A 3GFZA 1RQ0A 2B4UA 4P2FA 2ZUGA 1F9FA 2HHUA 1U49A 1FDAA 4DR4J 4ELTA 3DKDA 3W7BA 2R7SA 2VFUA 4A8XA 5BXIA 3I0RA 5CYQB 2Z4PA 5EGYA 2UV8G 3HX9A 5CYJA 1OQ6A 4LQ9A 4HTIA 2R7TA 1R0AB 3FEXB 3R2CJ 4CI0B 2C3MA 4L3KA 5CD4H 4PWDA 1GTHA 2HS4A 2KFYA 3UVJB 3MHYA 3DMJB 5CH7B 3X1LB 4IOAQ 1CULA 1UPPA 2YKAA 1FDDA 1WG1A 3ZTRA 1XR7A 1SC4B 1YVFA 4DLEA 2H5EA 3UFCX 2OSQA 1L3VA 4ICLB 2CQ0A 3DXBA 4C3LA 5F8HA 3ZZOA 4EWTA 2E9RX 2IMWP 3G86A 2V94A 1KKHA 1RU2A 1EZZB 4ZVHA 2VPXB 3K8VA 1WC3A 3VTIA 4IR1A 4DG1B 3R5DA 3PR4A 5A0YA 1YK9A 1FRXA 3FBBA 2F1FA 2LXUA 4P74A 4H4OB 1NB2A 3HHEA 2HIYA 1N32J 4URQU 1V3RA 4DUYF 1F5BA 1TUGB 1KLNA 4F3MA 3F0NA 2V9WA 2GNKA 2PA8D 5IV4A 1D8YA 1M5VC 3T5HA 3BPSP 2HK2A 1V5VA 5KG4A 2N4CA 4FYVB 3IR5B 5I42B 2FVPA 3JS9A 2MZQA 5GAGU 4X2BA 4J9OA 1FKPB 4ZOSA 3FK4A 1F2GA 1M5KC 1H72C 4ZPBA 2JVRA 5K8OA 2BRKA 1HI0P 4DSJA 1U1RA 3IBWA 2N4DA 4CO2A 2IM3A 3N5BA 3DC2A 3NG8A 4X4RA 1J5EJ 5F8GA 1N48A 2WBMA 1AFIA 1HBMB 3MUVP 3MXHP 2BRLA 1S6PB 2WSCC 1DARA 4Z7CA 2RUGA 5C25B 1REGX 4J9MA 3V6HA 3AJDA 1Y0HA 3BGFA 3GE9A 4UZBA 1LWXA 3CDWA 3G2XA 1VBZA 3PVXA 5CCLA 1CJUB 4K2XA 1T9WA 3ZO7A 4X4SA 3NWGA 2FLLA 2UVUA 4I68A 1JKHB 2BANB 1WKKA 3IMQJ 4X4PA 4OJGA 3K5OA 2W2PP 3OJSA 4LMZA 3GMGA 1RXOB 2DGTA 2CJ9A 3PEJA 3KXDA 3TVYA 4P6QA 1NRKA 1RT4B 4OHXA 4OYAA 4DCJB 3PJWA 2NYHA 2XY6A 1OY6A 1KN6A 3C6UB 1Q16B 3BGUA 2RDIA 3BQ2A 3OW2R 4X66F 5HANA 4CP5A 5C24A 3OL6A 3K5MA 2ZDOA 3NP5A 1C0UA 5L1KA 2J5AA 4G1QB 3NBPA 2XB2D 1VQ5S 3MEDB 4FF1A 4N7TA 4CYUB 4E2FB 1ZM2A 3M6XA 2VQFF 5CABA 1WC4A 2XI3A 2QFJA 4QYZJ 1ZAWA 3BDEA 5BR8F 3CIZA 1PJ6A 1I6JA 2VA2A 1DLOA 1NK8A 2D7SA 3JSMA 1CJKA 1RWUA 1FWKA 2KT3A 2ZBRA 3M2RA 2BJDA 4F4AA 2Y1JA 4QYZK 5MAOA 1HBNB 2XNQA 2ZOFA 1VK3A 3NS5A 2LLZA 3LWLA 3EICA 3WZ0A 4K4VA 3R97A 1U8SA 1HWLA 4JI3F 3MTJA 3D1OA 2DGQA 4F26A 4KRWA 1LV5A 4Y2MA 4E98A 1X8DA 1J2VA 1IJEB 3D0GE 4ITSA 2C2ZB 4H4MA 3VHQA 3KHHA 2RD5C 2WZ1A 2J0SD 3PW2A 1O8BA 3U7JA 3KFWX 1Z4UA 5IFMA 3ZZYA 1RT5A 4B3MJ 2JSXA 3OR2B 3FRYA 2G2ZA 4IG3A 3Q24A 1KHWA 1RTIB 3CUNA 1NDKA 2Y1RI 4LRDA 1RI7A 2KYZA 1K1QA 2FC8A 4C98A 1WHXA 4PZVA 3IM8A 3QLHA 2Y0SD 5KFBA 4OZNA 5FIIA 2MHEA 3RBEA 1QSSA 3CDUA 5F9NA 4UZCA 2V4QA 2WONB 4FKYA 4ZVUB 2VFVA 1FHTA 4WXOA 4A8YA 2IC3A 2H9ZA 3W9JA 3QMQA 1VIXA 4WFYA 2ZHOA 5DM6Q 3CO9A 1SUQB 4V19X 1XNRF 3ETOA 3W2VB 2RKIB 3H2VE 3CW2C 4F67A 4OLPA 2J9DA 3CWJA 2GV1A 2YXLA 4QZVB 1IKWB 2BJ9A 2BABA 3M8PB 1K0TA 1EHWA 3C66A 1S99A 4IH6A 3PW4A 1WHWA 1IBKF 4O3PA 4DUTA 3NL0A 3JXOA 3KKFA 4OI2A 4DL6A 2CADA 2HG4A 2VHGA 1RYSA 2GO9A 4NE9C 2DRAA 1D09B 1XN9A 1NO8A 2C3YA 4IO1A 2D3O1 4M5HA 3SFUA 2HKEA 2OO4A 3ZC4A 3OLAA 3RRKA 4DOZA 4BC9A 3DOMB 3P4UB 4Y6IA 4CIOA 2R2UA 3TO8A 1B0VA 3LPYA 2M2BA 2A2DA 1HQEB 4U8YA 3HVWA 1Q8IA 1TP7A 2H48B 2VH7A 2DY1A 2BE2A 2BMBA 3EUNA 1F2HA 5L9NA 3BKUA 2J7KA 2HQCA 4IR9A 1GNKA 3FCWA 3BS9A 1RHQB 4NZ7A 3K59A 4BHQA 3P8BB 3PEHA 3M8ZA 2XMJA 2GQQA 3JYTB 1S9EA 2HHSA 2ZH1A 5IS2A 5ETSA 4ZLLA 4DSIA 1UZHA 1Q1KA 3MMCA 3KNGA 3KWMA 4DR2J 2EC0A 1D9AA 3GSDA 5LSLA 3T1YF 4WIQA 2EFVA 2M3DA 2EPIA 2JLGA 3TJ9A 2CRLA 2QL7B 1I94J 3T1AA 5A8WB 5K8MA 3UR3C 1X31C 3HF5A 3IC1A 2YQ3A 1B70B 3CB4A 3OHBA 2GFFA 3MGJA 2ZBIA 4UY8T 1BQMA 1WKLA 3KUEA 3V6DB 3OTCA 3P96A 4RBTA 2KVIA 5DG9A 2MQPA 2VG6B 3AOAA 5GMKa 2X1FA 1UVNA 4PABA 4AYBD 5B0DA 1TL7B 4WU2A 1RT3A 2L48A 1S57A 4OYBA 1OYEA 1LWEA 2FJXA 2Q79A 2L9NA 3AD9C 2X51A 3BH6B 4QWDA 4CZCA 2BM0A 1O0PA 4PXDA 1T03B 4M63A 1J27A 1RT2B 3E8OA 5IWAF 3GIIA 4TQSA 1OSCA 2DBBA 3LP1A 3OL7A 4NA2A 4NL5A 2HBRB 3HJVA 5F9LA 3SCJE 3AQPA 2UXBF 1Q8BA 4TVAB 4JV5J 3MEKA 3UCGA 1F1BB 4WFZA 2HQFA 1YKWA 2ZOGA 2ZVSA 3DNCA 1IKXA 3AOCA 1PKUA 3KLGB 4N5SA 3O44A 4C7QA 2D3OR 2HAFA 2XHCA 4MK9A 3VQTA 2KXHA 2C22A 4NI2A 2JL9A 3HHLA 1ZTWA 5K14B 1SB6A 3TQ1A 4DSKA 4KHPF 5I3UB 2IBKA 4FP9A 3CD0A 2ZH9A 2KM8C 3TI0A 1VQ8S 1F5AA 1RT1B 3ENQA 2CPDA 5K8NA 3NNAA 3CD5A 1H2TZ 2KZMA 1LK5A 1H2UX 1HBOA 4G1PA 2YH1A 3K89A 4DX7A 4DCPB 1Y5NB 2G0IA 4M5NA 3R1LA 4Y28C 2BKNA 1CJVB 4FYDA 1C2PA 1AT1B 2UZAA 1WWHA 2GHVC 5LMUF 4NCAA 1YRTA 4MT1A 1X4AA 3A13A 1YJTA 4C0HA 3MAQA 3QSIA 3EYZA 4A8QA 3LF0A 3W65A 4UW2A 3LP2B 2AEFA 4RW4A 4ELUA 4GVBB 1D8ZA 1VQSA 1SJFA 1LXNA 2Y1LB 1IR2A 5KFHA 4DFJA 1HWUA 2VZ9A 2V4RA 2UVVA 1FWLA 3HKWA 1U2CA 2WOMA 3F41A 2O01C 3R5CA 3IS9A 1TV6A 4OQJA 3V4IB 1TFYA 2YPYA 2W24A 1X60A 2HEKA 3OJUA 2Y8WA 4X4UA 1JJ4A 5GADU 4PXEA 1Y5IB 2COLA 4DV3J 3HHLC 4NXNF 1ELOA 2RQCA 2OJ3A 2EI5A 2YBVA 1IBLJ 3IBFB 3TVZA 1TL3B 4DX6A 1NJYA 1VQKS 2WB1D 3G4SS 4C8NA 2YH0A 5DZ7A 4FS1A 4CQ1A 2XEXA 1Y10A 2R8JA 2BZ2A 2I9SA 3QFWA 2F5GA 2DXEA 2RB7A 2V5HG 1BLUA 3VAFA 2RVJA 1C1CA 2AYGA 1BY9A 1IQZA 4KPCA 5ITHA 4DQIA 4DR3F 1N33J 1S0VA 3EX7B 4KFBA 3W62A 4DV7J 3G96A 1S6UA 4ILLA 2ZHBA 4MMOA 1U25A 2V8VA 4PWWA 4JI0J 3HHLD 3K2YA 3VZIA 1HHSA 2MQQA 4YUDA 1SVDA 3MR3A 4YR3A 2ZD1A 1Q86T 4LREA 2XQCA 1NXIA 4BWJA 2AIRB 3SSSA 5HVHA 3MR5A 3MPYA 1H0HB 4OFZA 3PYEA 4S0MA 4X64F 5J2QA 4I64A 1VRUB 3PJXA 2QZ8A 3UN5A 5C2CA 3CD7A 5HP1B 3MURP 3KTQA 1Y9OA 2BJ7A 4DV6J 5IT9Y 3HVAA 3I0RB 3NLCA 4KGZB 4CO3A 2BQUA 3CCQS 1YGYA 1VC5A 3A3NB 1HQUA 3K17A 2CNNB 4P71A 1NK0A 4GC7A 2P9EA 2Z30B 1T3NA 2CA9A 3MAAA 2FVQA 3A8KA 4NYZA 4OZ3A 2YWGA 1DHMA 2J6SA 3M9NB 4C3MA 1ZA2B 4OYPA 2XSJA 3AFGA 4CH0S 4USTA 1TL5A 1QLNA 4NYOA 4A8WA 3DDIA 2UUTA 3DOKB 4KJIA 3DXSX 4W90B 2HVEA 2LP4A 2OSRA 2CPHA 4HR2A 4Z2XA 4GRSA 3KG0A 2L9DA 1VLOA 2MSSA 2G13A 5GAGI 3SQGB 2AEMA 2DO4A 3E51A 4HKQA 2OPRA 1FERA 1JLQA 1XNQJ 1G7CB 4O0IA 1RHRB 1PC4A 1JWWA 2MKKA 4GKKJ 1TKTA 4DSLA 4PYAA 4WF9Q 4KH0B 5J1PA 2IRYA 2CQCA 1X4EA 3QGGA 5IZHA 3H42A 3PO5A 1XWLA 2OD4A 1ZYQA 1B99A 4KYZA 5KOXA 1UWBA 4U6PA 5K9FA 2G2YA 3ICLA 2ZOMA 2J0QD 4HHUA 4C97A 1G4CA 3TUJC 3V81B 3I31A 1L3UA 4JI8F 2UUBJ 1JJ2R 1SC6A 2BE9B 2RS2A 2QGFB 2M5YA 1YZ7A 2HNYB 3A8EA 2KFZA 3GSIA 4ES3A 2IA6A 2DRBA 4IKAA 1CLFA 2CG4A 5E33A 4NCBA 2ZEJA 2V50A 4QOTA 1UEKA 1YJ7A 2V8DA 4LF9F 1UZDA 3D0IE 2BUNA 3D2WA 2XO7A 4J7CA 2YKMB 2E1AA 5KFSA 2W9AA 1RUSA 2B8QA 2NXJA 7FD1A 2C2KB 1WC6A 4ED7A 1Y4ZB 2Y3YA 2HVZA 1RJJA 2C3OA 3KHRA 3SBMA 1EARA 1CG2A 4ZLNA 2CJBA 4ZKAA 2UXDJ 2EK6A 1IXKA 3OXFA 5KFWA 4DF4A 3MMAA 5KFNA 3OV7A 1D3WA 3IN5A 3MEEA 3SDEA 2RS8A 4J9UE 3LGHA 5AXMA 4ZVGA 2AJ2A 3QGPA 4JI4F 5DDPC 2E7WA 2HW3A 2PD1A 3Q8VA 1LW0A 4ES1A 1RTDB 2B7BB 1RCOB 2DNRA 1HR0F 5LXRA 2AQ4A 5C24B 4FF3A 1C0UB 1Y3KA 3NBPB 4Y34A 4QU6A 1TKZA 2BXJA 1VCTA 3W5XA 3BO3A 4WCEQ 2PI4A 4ECUA 4O3NA 5DJBA 2FHJD 3KLHB 1X4FA 1ZZFA 4ECYA 1IM6A 3BJYA 3TX8A 5DQIA 3TA1A 3QBCA 4CT8A 5A8RB 2ROEA 3MMJA 3EXCX 1HNXF 3NKYA 4LF8F 1M5SA 2NSBA 3GJSB 5EWGA 1CJKB 4ZCKA 5HI7A 4M5IA 1BWEA 5LMNJ 1NLKL 5CD4A 3CCSS 5CZVA 5CHCB 1MSWD 1MU2A 3SFGA 3PXGa 5JMNA 4XDDA 5DDOC 2W7AA 3M2RB 3DLGB 4UF4A 5HK4A 4RU9A 1PAEX 3VWSA 4DPYA 2GIRA 3O2IA 4RBUA 1MWZA 5HJXA 1HWIA 4DU7A 4QU7A 2AW0A 3PX6A 3MCNA 3DDKA 4B3RJ 2G0JA 2ZWOA 1URNA 1H7XA 2C42A 2DNPA 4P7VA 4MFBA 2FZKB 2OPQB 1XMBA 3KJQB 5J1NA 2KZZA 4N56A 4E8UA 3BBBA 1TK8A 4RR5A 3I9ZA 4B9TA 2UXCJ 2B6AA 2QMUB 1QTMA 3TNVA 2UV8A 2RMLA 3JAMY 1I1GA 1HD1A 2YNFA 4CO4A 4IG3B 4UOGA 1T9TA 3GG1A 1U1PA 2V2ZA 1HPZB 4CTAB 5CYMA 2CJYB 2MZJA 2GMHA 3G6YA 3BYPA 4K4TA 5ETQA 3MDFA 3GIMA 2MQOA 4J9NA 3M8RA 2B56A 4DR4F 2HHWA 4CH1A 4RW8A 1D0EA 3W2WB 4LBPA 2O66A 4DPUA 3NY0A 3DFEA 3UNYA 3PG9A 2YNGB 2HBQB 2XS7A 3TOQA 2JZ5A 3ENWA 3TUZC 3Q0AA 4EGLA 1WOPA 4LFAJ 3ILOA 2OPSB 2CQ3A 3D67A 3S01A 4ZHRA 5KG6A 1U02A 3I32A 3DHWC 1Q53A 1UAWA 3GYXB 3T9ZA 3UQSA 1HBUA 2DHGA 1WG5A 3PO4A 4RNHA 3G8TA 1IBMJ 4F0KA 2H4WB 5GMDA 4MKYA 2A3JA 2DNOA 1U1KA 2BE7D 4KGMA 4Q2MA 1ULRA 1FT8A 3ILLA 4B9LA 1R89A 2NXNA 3R5JB 3MD3A 2N82B 4ZPDA 4OI1A 3DU5A
chains in the Genus database with same CATH topology
2LP4A 1FFWB 1EAYC 1FWPA 1A0OB 1FFGB 1FFSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP4 A;  1FFW B;  1EAY C;  1FWP A;  1A0O B;  1FFG B;  1FFS B; 
#chains in the Genus database with same CATH topology
 4NRU A;  4YDD B;  3LH2 S;  9RUB A;  3GG0 A;  2CDQ A;  4AL6 A;  4X4Q A;  5F0W A;  3VGT A;  1N32 F;  1S9E B;  2HPU A;  1K9M T;  1FRM A;  1YBU A;  4IFV A;  2HZC A;  2OPP B;  3CCR S;  3DYA A;  2QX0 A;  2YVS A;  2I0X A;  4KBI A;  2VKR A;  2MKS A;  1CVJ A;  4YR2 A;  3THV A;  1OSD A;  2KG1 A;  1YJN S;  5EX3 A;  1UVI A;  1JQG A;  1Q0N A;  3MMC B;  4DPW A;  1KQG B;  3TZZ A;  4O4R A;  1UVM A;  3TWZ A;  3QWP A;  2XMV A;  5C7P A;  1NJW A;  1YHQ S;  2CUY A;  3U1L A;  1VFJ A;  4IQX A;  1HNZ J;  5GAE U;  4QBU A;  4O4G B;  3IRW P;  1ARO P;  1T02 A;  2WVF A;  2KTQ A;  3W1Y C;  1J5E F;  1W7W A;  1U45 A;  4F25 A;  1KSP A;  3DI6 A;  4K50 A;  2W4D A;  3VAL A;  3FGV A;  3LWM A;  5C42 A;  4I69 A;  3K7R A;  1VIS A;  4C3K A;  4G65 A;  3JB9 k;  5DDQ C;  1DTT A;  4TLQ A;  4JI2 J;  2KM8 B;  1QE1 A;  3LW5 C;  2HVI A;  3IG1 A;  1X4C A;  1C1B A;  2RE1 A;  3V6J A;  2F4V J;  1LWE B;  1UPM B;  1HFE L;  4B17 A;  3DRR A;  4OZL A;  1JXV A;  1KD1 T;  4XTT A;  3T6J A;  4JUZ A;  2E1C A;  4L72 B;  4LBH A;  3RB6 A;  3SCL E;  3MEG A;  8ATC B;  4FYY B;  3LP1 B;  1N52 B;  2BBE A;  1IR0 A;  4FF2 A;  4ILM A;  1L5U A;  3GJQ B;  1TKX A;  1KWM A;  3CJ0 A;  2J8S A;  2JWN A;  3CDE A;  3CGI A;  5IOL A;  2PFF B;  2XCA A;  4TXS A;  4U7C A;  4QWE A;  3RAM A;  4NYP A;  4H4K A;  1OY8 A;  2MDA A;  2ILZ A;  2J6U A;  2JEF A;  3OVS A;  5ADZ A;  2C2R A;  4K4S A;  1S9G A;  5KFA A;  1ZBT A;  2WB4 A;  3NGT A;  1FTR A;  3NEK A;  2KU7 A;  4DSF A;  2EBG A;  3R5B A;  2WVC A;  4A8K A;  4ETZ A;  1HWK A;  1NCL A;  1IR1 A;  2DH7 A;  1J5O A;  5B0A A;  4TQR A;  4NI2 B;  3HHL B;  2DR7 A;  1AUS L;  3R7B B;  3J7A N;  1RKJ A;  4FXW A;  2MY8 A;  2E5H A;  2F40 A;  3WC0 A;  3DGP A;  4X84 A;  4PXB A;  3QRP A;  3EZO A;  2J9D E;  2J8A A;  2IRU A;  2RH3 A;  1UW9 A;  2EFG A;  1YTY A;  2KI2 A;  1BE4 A;  4B02 A;  2OP5 A;  5GAD I;  3AB2 B;  4EO8 A;  3ONQ A;  2CQB A;  3M2V A;  2CPI A;  3HFK A;  3NAH A;  4MYU A;  1MNE A;  1S7H A;  2M7S A;  4JI6 J;  3RBZ A;  4OZ5 A;  3CJT A;  1G2E A;  3D68 A;  4ZVO B;  2VPW B;  3H4D A;  4C8K A;  3JSY A;  4L73 A;  1GMW A;  4J9S A;  1V3S A;  2ATL A;  5B0G A;  4OI6 A;  3E01 A;  2HFU A;  2OD6 A;  3Q8Q B;  2CZV C;  5LSO A;  2WOM B;  2M9K A;  2MZT A;  4B3M F;  4RO0 A;  3IS9 B;  1TV6 B;  4V1A k;  2JH3 A;  3NWR A;  1SL1 A;  2V68 A;  4LFB J;  3NGS A;  1SJ3 P;  1FI4 A;  2OML A;  2ZDP A;  2HQI A;  3N01 A;  2OEK A;  3J7A 1;  4RNO A;  2EKY A;  3T5L A;  3T6B A;  3FCH A;  4B3T J;  4YHH J;  1PC5 A;  1HYS B;  2DIU A;  3T1H J;  1HKA A;  2R7O A;  1UMJ A;  2YKP A;  1H73 A;  1SKR A;  1SJ4 P;  1C1C B;  3N6M A;  4R8U A;  2K7K A;  1BQX A;  3DLL Q;  5A2Q U;  2DNY A;  3D6H B;  4CLU A;  3WIV A;  4KFB B;  1S1X B;  3RGI A;  5IT9 U;  2F8E X;  2GVZ B;  1S79 A;  1NSQ A;  3MOZ A;  1ACM B;  1XJW B;  3CCE S;  4IRK A;  2AZ3 A;  3RU0 A;  1S5Z A;  5HO4 A;  3VAK A;  2FJB B;  1NUE A;  4LRF A;  4IYQ A;  4DPX A;  3HVT B;  1FX2 A;  4YR0 A;  2ROP A;  4P73 A;  2RUS A;  1GTE A;  4NCG A;  3HSG A;  4DR1 J;  3M32 B;  2R3V A;  4P2S A;  3GJT B;  5CXT A;  2V2Q A;  5I3Q A;  4F4K A;  4CDI A;  4QR1 A;  3NOC A;  3VAG A;  4LSL A;  4RUA A;  4F0M A;  2Y9H A;  1RAO A;  4R5P A;  3HCX A;  2RDD A;  4TY8 A;  2BJE A;  4LF2 A;  2XC9 A;  4OI3 A;  4M94 A;  2V69 A;  4YN3 B;  3RJM B;  5DGA A;  4U9R A;  3RRG A;  1AXQ A;  5ETN A;  4UOH A;  1P1L A;  1GMW D;  3IO1 A;  4PQU B;  3AAW B;  3PDN A;  3ELH A;  4MKA A;  3PNI A;  2YNI A;  1RTH A;  4OHV A;  2ZZN A;  1X4G A;  4OZ2 A;  1ZET A;  3JQM A;  2AF6 A;  3G8S A;  4N76 A;  4L74 A;  3QAT A;  4LQ3 A;  4Q44 A;  4U96 A;  2ATC B;  3LPE A;  3TEG A;  1RAE B;  3HM9 A;  1OPI A;  5CCM A;  2R8I A;  2ALY B;  1UJ6 A;  4CRJ A;  4DR2 F;  3T5J A;  3PM9 A;  2ZH7 A;  3O6Q A;  4HVZ A;  3CMA S;  3EJM A;  5IT0 A;  2C2O B;  4Z37 A;  4UOF A;  3G82 B;  4WII A;  1F60 B;  1YJV A;  2OPR B;  1JX4 A;  1I94 F;  3PJ9 A;  2D74 B;  2CQH A;  2ZH6 A;  1R8H A;  2PMH A;  3SZ2 A;  5HVF A;  3GTY X;  3SIP B;  2WCX A;  4DL0 C;  2WBR A;  4F0H A;  2CQ4 A;  1RAJ A;  1YRX A;  4HDH A;  4F36 A;  1JJC B;  2VA3 A;  1XC9 A;  2J0W A;  3I87 A;  5F3Z A;  1R6Y A;  3H40 A;  1SJ1 A;  3Q2T C;  1FNM A;  1TMJ A;  5D0R A;  1IKV A;  2IAJ A;  3IRX A;  4M5D B;  1CS4 B;  2C3P A;  4A8S A;  4LJM A;  3CUL A;  5AE2 A;  2MJU A;  5F8N A;  5T41 A;  3VF0 B;  4ED1 A;  2OAU A;  4GO5 X;  4X4N A;  2BVZ A;  1HNI A;  3CCZ A;  4BWM A;  1E6V B;  2ZH8 A;  1LNQ A;  5F3T A;  3EVW A;  3BR9 A;  4JV5 F;  3W64 A;  3K58 A;  1NHK L;  4F04 B;  2KB2 A;  1YIJ S;  5ETT A;  2APO A;  1WI8 A;  1SC3 B;  2XS2 A;  2AGQ A;  4M5K A;  1YWX A;  2EVZ A;  2QA1 A;  2FLO A;  1UJ4 A;  4BC7 A;  3R5A A;  4FBU A;  5KFY A;  3R2D J;  3PHE A;  2LA6 A;  2NUU G;  4DR7 J;  2ZBP A;  4CLT A;  4C0O C;  3R1H A;  5LT5 A;  2G4B A;  3BN7 A;  3BKF A;  1RHM B;  2X1A A;  3L9Z A;  2B4P A;  3QT6 A;  3MMA B;  3PTW A;  1B7Y B;  2I38 A;  2E9Z A;  3QRR A;  1KDN A;  4RWW A;  2CJX B;  3SDE B;  2PEH A;  2RDJ A;  3R6L B;  4ZN1 A;  4QW9 A;  4PPD A;  3DLE A;  3T3F A;  3BO2 A;  3ZZU A;  3DLK A;  4O0N A;  2R8H A;  1M5P C;  3JTP A;  2AKW B;  4USJ C;  1TU0 B;  4YB6 A;  1WSV A;  1VI7 A;  3DRP B;  4LFC J;  1REV A;  3KLE B;  4YB5 A;  1RBL A;  2IYI A;  2DIT A;  1RU1 A;  2E7V A;  4I0W A;  1TKZ B;  2WVD A;  1MMN A;  2E44 A;  3I5C A;  2ZBQ A;  4A47 A;  2PN6 A;  2E29 A;  3EZU A;  2P2C B;  1N54 B;  3GON A;  1P27 B;  4NMX A;  4LSN A;  3IXQ A;  1RWV B;  2GMJ A;  3C6T A;  3S1T A;  1I51 B;  1MU2 B;  2K3K A;  3SMZ A;  2XMA A;  3JAM U;  4EBC A;  1RWN B;  1XBW A;  3HMJ G;  4DV3 F;  1IBL F;  3RBD A;  1VQM S;  2U1A A;  2LDI A;  3J81 U;  2LKZ A;  4WFA Q;  2VON A;  3FZ2 A;  5AXK A;  4DF8 A;  5D0H A;  3CDA A;  3VCD A;  4MK8 A;  4CT9 A;  1FFS B;  3QZ8 A;  4YFU A;  3TZY A;  3BO4 A;  1BXN A;  2W9C B;  1U1L A;  1N33 F;  3JSB A;  2AYE A;  1UTA A;  2GJF A;  4DV7 F;  5KG2 A;  1QAJ A;  1YBA A;  2R42 A;  3PY8 A;  4C0B A;  4Q45 A;  4JI0 F;  1KQS R;  4HTJ A;  3MCS A;  4J9R A;  1RAD B;  2YNF B;  4PG7 A;  2GA7 A;  2HNZ A;  1YJR A;  4DZ6 A;  4M95 A;  2RRN A;  5KG3 A;  2XY5 A;  1NH7 A;  3J7Z T;  2AYM A;  3WQP A;  5CYM B;  1PO6 A;  1FJG J;  2VBZ A;  4WYW A;  1Y3J A;  4ID8 A;  3R3T A;  2C28 A;  5L8R C;  3C14 A;  3I96 A;  1FFG B;  2EKN A;  3ULH A;  4RW8 B;  4ED8 A;  3IWN C;  1HNW J;  2QRR A;  2Y0B B;  2XWY A;  1S4F A;  4DV6 F;  4WJB A;  1SL0 A;  2EFQ A;  4I2P B;  4HHJ A;  4NLY A;  2ALZ A;  2HND A;  2Q3P A;  2P5V A;  5HMY A;  2G0C A;  2GCF A;  1BHN A;  5IQ6 A;  3MM5 A;  3BSN A;  3T41 A;  4YQW A;  4ZHR B;  5A8K B;  2M52 A;  1PYS B;  1RP5 A;  1QDU B;  5DG8 A;  3H5U A;  1IM4 A;  2OH2 A;  1QY7 A;  2AV5 A;  3GP9 A;  2WVE A;  1U48 A;  3U02 A;  3KHL A;  3W9H A;  4YP3 A;  1R8B A;  1NSP A;  2CJK A;  2YNH B;  2LEB A;  2E9T A;  1S1U A;  4B08 A;  2FPH X;  5LSR A;  3W8G A;  3HP6 A;  4KGK A;  3PW5 A;  3ENV A;  2O5D A;  4KO0 A;  1XNQ F;  2MLY A;  4JBC A;  5GAE I;  2E1M C;  4K7Q A;  4LSZ B;  4BS2 A;  1NZ8 A;  4OYM A;  3LOU A;  4GKK F;  2IVM A;  3SV4 A;  4YS2 A;  3OVA A;  3K0J A;  1FO1 A;  4MYT A;  4ETX A;  3AHP A;  1VQO S;  2Z57 B;  1UFK A;  2R8G A;  2DO0 A;  3V2U C;  3MFI A;  2HGM A;  4OHY A;  3DYA B;  2A6M A;  5K5M A;  4I2Q A;  5KFG A;  3RTV A;  1KVJ A;  1U7L A;  4B9S A;  2MKI A;  3M1V A;  5DZ6 A;  2Q6B A;  4LF4 J;  4O23 A;  2IVY A;  2UUB F;  3R6G B;  3KDO A;  4WZM A;  1GQE A;  3CCT A;  3WIU A;  2FHM A;  2MYF A;  5B0E A;  2CPF A;  1FJC A;  1RTJ B;  3FQL A;  1WTB A;  4F2R A;  4P2M A;  3MM6 B;  1KOH A;  4HH0 A;  2ZE2 A;  4K5R A;  3QIP A;  1UVL A;  2JDJ A;  2E1P A;  2F63 A;  2J7U A;  4NPO A;  3GV7 B;  4I7F A;  1WG4 A;  4IDK B;  2E5L J;  4LRB A;  1FRJ A;  1LWC B;  1SV5 A;  1R0C B;  2DGW A;  1Q7Y T;  1U24 A;  3DRR B;  1RHU B;  3FFI A;  1SH3 A;  3BPD A;  4B9M A;  2ZJR Q;  4ILR A;  2UXD F;  5KFX A;  5EWE A;  5K20 B;  1RAH B;  4DV5 J;  4PUO A;  3NGR A;  2XNR A;  4W98 A;  2HMI B;  4QIW D;  5FJ4 A;  1VQY A;  4Q5V A;  4YDX A;  1LK7 A;  2DGU A;  4LF6 J;  4ECS A;  2OEM A;  2C2N A;  1HL6 A;  4NRT A;  1TKX B;  4URG A;  2NLW A;  4UQT A;  4RNF A;  2IA0 A;  5DQH A;  3HT0 A;  4NLR A;  1LWF A;  3E3X A;  2DGV A;  1TEL A;  2GGP A;  3VZH A;  1S9G B;  3MUM P;  5HBM A;  3D6F B;  3BSA A;  1TK0 A;  1F6T A;  3V4M A;  2N7C A;  2DY9 A;  3HI9 A;  2CZ4 A;  1J5O B;  3OL9 A;  2D3U A;  3BV8 A;  2CQP A;  2QLJ B;  1OMS A;  4DR6 J;  4ENO A;  5LMN F;  2B51 A;  1DTQ A;  2HHT A;  3DGP B;  2KFN A;  1R8P A;  3DM2 A;  4Y0F A;  4Y00 A;  2D9O A;  4KGX B;  3MM7 A;  2MQN A;  2JOQ A;  4DPT A;  3NOG A;  5L38 A;  1JB0 C;  2AJQ A;  1OIA A;  4DU8 A;  2W9B A;  4NLO A;  4X65 J;  4JB8 B;  4WE1 A;  2YX7 A;  3M2V B;  1X5P A;  1UW4 A;  2EG1 A;  4B3R F;  4QJV A;  3TYT A;  2UUW A;  3NXZ A;  3VGU A;  3D3B J;  1X9M A;  1S1V A;  2IM2 A;  4NA3 A;  4LUB A;  4J9L A;  3U1M A;  2XG8 A;  5BYQ A;  1Z2Z A;  2M88 A;  5T7L A;  3E01 B;  1YG0 A;  3FJ2 A;  2UXC F;  4QIG A;  2VKZ G;  4KE5 A;  4DV2 J;  1LKZ A;  2AP6 A;  4FNI A;  4I4B A;  4KHR A;  4YOE A;  2QA4 G;  5HLF B;  4DWI A;  5BJR A;  3KK3 B;  2DEI A;  2WW8 A;  2EEY A;  1G3O A;  4TN2 A;  4C8Y A;  1OPZ A;  1F0X A;  2EC2 A;  4LR9 A;  1B7F A;  3J7Y U;  4DV1 J;  1NK6 A;  4RW6 A;  1N4L A;  1DQ9 A;  1FRK A;  3O5T B;  1TZ0 A;  1S4E A;  2GC8 A;  4WWS A;  5KFQ A;  4OX9 J;  3HK2 A;  3B82 A;  4DUZ J;  3H8Y A;  5LM7 E;  2YQ0 A;  2E66 A;  4X62 J;  1HMV B;  3BEG B;  3BR8 A;  3HXM A;  4J37 A;  1A0O B;  3A12 A;  3DCA A;  2BW2 A;  1CQM A;  2EK1 A;  1WDD A;  2RSQ A;  4UY8 5;  1HA1 A;  2P9G A;  1F9H A;  1QSL A;  3PX4 A;  3RYL A;  5M2P A;  2LXF A;  5E3Q A;  3PRD A;  2GHP A;  1YSJ A;  1XMQ J;  3NMA A;  2HHV A;  3RR7 A;  1IUJ A;  1WC0 A;  5J2P A;  1U6B A;  4LFA F;  1K47 A;  4HI1 A;  1N6Q A;  4DFM A;  5B0B A;  3MWB A;  3UVJ A;  1YDL A;  3DMJ A;  3B54 A;  2JEJ A;  1EKR A;  3N79 A;  1AYE A;  3W63 A;  2LEA A;  4UUW A;  2NSC A;  1V9O A;  2QL5 B;  4WKY A;  3JQK A;  2NXE A;  3CNQ P;  1VOM A;  1FEH A;  3RB4 A;  1IBM F;  1VR6 A;  4FXD A;  5DET A;  1NKB A;  2HUR A;  2IM1 A;  2F4F A;  4R5P B;  2W8L A;  1NJZ A;  3CJ2 A;  3OFE A;  1FK9 B;  2SXL A;  4HL9 A;  4CLP A;  4ZLJ A;  2VJV A;  3Q2S C;  3D54 A;  4GMK A;  2HGL A;  1VLY A;  4Y2K A;  2XMT A;  3ZXW A;  3GR1 A;  3FZB A;  4OI4 A;  4ZVP B;  2DJW A;  1SCJ B;  2DK2 A;  5ETM A;  2QSF A;  2QLX A;  1SBR A;  3T19 A;  2YNI B;  3AXK A;  2VPY B;  3PRV A;  5E3R A;  4J5O A;  1SIW B;  1MN7 A;  2YWK A;  2V2K A;  4K2J A;  3US5 A;  2HHH J;  1TK5 A;  5KFL A;  2FHK A;  2BM1 A;  3KJV A;  1QUV A;  4P9S A;  3LAM A;  4ECW A;  5B0F A;  3MCM A;  4DDF A;  2HLU A;  1UET A;  1C0T A;  4M5M A;  3EXY A;  2CFX A;  1FEE A;  2MXY A;  1PBU A;  1ZH5 A;  5LJ5 Y;  4DS5 A;  1HNZ F;  1RAG B;  3Q8S B;  4ZIW A;  4M5G A;  4RWX A;  2AJ0 A;  1T9U A;  2KRB A;  4NEY A;  3QO9 B;  4ER8 A;  2ZBC A;  2DNM A;  2DEJ A;  3TVK A;  4MIB A;  3LGN A;  3KK1 B;  4KQZ A;  3TAM B;  1DJ0 A;  3AB4 B;  4JI2 F;  3L4B C;  3NCP A;  1CC8 A;  5C25 A;  3NAI A;  3L95 X;  1VC6 A;  3RR8 A;  4EZ9 A;  2CWX A;  2V4J B;  4KT0 C;  2F4V F;  2HHP A;  2AT1 B;  2QLB B;  4DJB A;  5DG7 A;  2IAJ B;  1N0U A;  3NRB A;  3IRX B;  1CEZ A;  3JTN A;  1KFS A;  3W61 A;  1NPK A;  5D3G B;  2VBY A;  3I56 S;  2HWH A;  1HNI B;  2XS5 A;  2A0F B;  3D1H A;  1OJ4 A;  1S1T B;  4ED2 A;  1RT4 A;  3CCW A;  2ZKT A;  1UEU A;  5KOW A;  1FNO A;  2GX8 A;  3FUY A;  4WYL A;  2E7X A;  3C6U A;  4RNM A;  4ED4 A;  4O3Q A;  2OTL S;  2DVI A;  1HW8 A;  5IQQ A;  5AXN A;  4I56 A;  2BAC A;  5EX0 A;  5M2R A;  4KV8 B;  5D0E A;  3OPK A;  4G1Q A;  3TP2 A;  3VGV A;  2W2M P;  3ZZ0 A;  3RAX A;  5EN1 A;  4NLG A;  1EET B;  2ILY A;  6FD1 A;  3CE8 A;  1SXL A;  1HIY A;  1ZM4 A;  3KK2 A;  1XK8 A;  3CSK A;  1OQ3 A;  2M0G B;  3Q8R B;  4TY9 A;  1CSJ A;  3IA0 A;  4DV4 J;  4ID5 A;  4WFX A;  2RQK A;  3U1N A;  3D0H E;  2LQ8 A;  3HJF A;  4EYH B;  3QFH A;  3I0S A;  3EM1 A;  5EWF A;  2EBE A;  2PDA A;  1RKI A;  3EGW B;  3H59 A;  1MG7 A;  1ITP A;  2XUL A;  4Y2I A;  2J0X A;  4J9V A;  5HMX A;  2JFK A;  4IUF A;  1X0P A;  3M6W A;  4JI6 F;  1FA0 A;  3I6P A;  4EBE A;  1FD2 A;  1HWJ A;  4FYW B;  2WAQ D;  4KGV B;  5J1E B;  4A4J A;  4F4Z A;  1JLE B;  1GXU A;  3M7V A;  3M9O B;  1T11 A;  3H5Y A;  1D9F A;  1LXJ A;  3K57 A;  3D5M A;  2VDI A;  3L7O A;  3CJ5 A;  4CO1 A;  1EAY C;  3UD3 P;  4LSN B;  1XQI A;  3OR2 A;  1K8A T;  1FFW B;  2L9W A;  3C6T B;  1A9N B;  1RTI A;  5KFC A;  4LFB F;  4G3I A;  1SH0 A;  4QWB A;  3M8Q B;  1NAQ A;  4OL8 A;  3L7U A;  3KYL A;  5JJB A;  4OYW A;  3BM7 A;  4B3T F;  2CVI A;  4YHH F;  3LAL A;  1OS5 A;  3T1H F;  2FGC A;  5SZT A;  1WI6 A;  2EFO A;  4KY3 A;  1CBK A;  4ECZ A;  3NGU A;  1D9D A;  2WK4 A;  4GKJ J;  1CC7 A;  1S9F A;  2W25 A;  2K2P A;  1FKO A;  2RKI A;  1U4B A;  2L41 A;  2AX0 A;  5KT3 A;  1NK9 A;  3GIK A;  1SH2 A;  4HAC B;  1S6Q B;  5CZX A;  1JLA B;  2RIJ A;  2AHO B;  3H90 A;  2ZM6 J;  5EHH A;  5DQG A;  1R0B G;  2AX1 A;  1U1N A;  4P75 A;  3M8P A;  1XR6 A;  3K5L A;  4IG0 A;  1AFJ A;  3IM9 A;  2VIH A;  2XO6 A;  3Q83 A;  5HSP A;  3B78 A;  4DR1 F;  2AGP A;  3C14 B;  6AT1 B;  2ZJQ Q;  2QA4 S;  4IOB A;  3DOM A;  3VV2 B;  1UA1 A;  1QSY A;  4JI7 J;  4XPE A;  3OR1 A;  3M30 B;  2GZO A;  3K5P A;  4OX8 A;  5FLX Y;  1VQ6 S;  1KFD A;  1QM9 A;  4KKO B;  5KFP A;  2HIQ A;  4WPA A;  1Q8K A;  4WXW A;  2DHA A;  4GO7 X;  1ROF A;  3QPI A;  4JV0 A;  4NA1 A;  1RA7 A;  4ZPW R;  1S12 A;  1NM2 A;  4C8L A;  4KHM A;  3CMQ A;  3GFX A;  2CAJ A;  1RWW B;  3JYT A;  2GQ2 A;  5AJ3 J;  3DU6 A;  1U09 A;  4ZCI A;  2QV6 A;  2MJN A;  4LIR A;  2R2S A;  2RU3 A;  1H3D A;  2FJV A;  2GJI A;  3MM9 A;  3KUG A;  4CCH A;  1DBD A;  1GH8 A;  3OTB A;  1BQN A;  4UT4 A;  1HI8 A;  2W7P A;  1EP4 A;  2F8M A;  4OJ3 A;  3QSY B;  1FXD A;  4O3O A;  1X7V A;  4QIV A;  2R2R A;  1K44 A;  2DIS A;  1S1U B;  4FN5 A;  2A1B A;  4MIA A;  3HSJ A;  2HBZ B;  1D1U A;  4F3Q A;  2H3E B;  3VVU A;  4RU2 A;  5A8W A;  2W2Q P;  5KG0 A;  2MQL A;  1WTF A;  4CM2 A;  5GAH U;  2Q6C A;  5DO2 A;  3CCV S;  1RBO B;  1S6O A;  3V6D A;  2LEC A;  2RT3 A;  4DBQ A;  3MMB B;  3G6X A;  2MKJ A;  2LYV A;  3ZTS A;  2UP1 A;  1L3T A;  4HH1 A;  1T05 B;  3BYR A;  3MPD A;  4ECT A;  3BBF A;  5DRK A;  3L09 A;  4WFN Q;  2NZC A;  1U6Z A;  3MD1 A;  3I4H X;  1F3F A;  2LU1 A;  2XLI A;  1T03 A;  1RT2 A;  1DQ8 A;  1T9X A;  1P1T A;  3UR0 A;  4DSE A;  2Y1I A;  1B4S A;  3JSR A;  4CNZ A;  3AD7 C;  4KR0 B;  4OHW A;  2BX6 A;  4YME A;  3SV3 A;  4F2S A;  2ZZM A;  2I5J B;  4DLG A;  2F3J A;  2FLP A;  5D0G A;  2DCU B;  2BA9 A;  3E2E A;  2ZE2 B;  2DXF A;  3QIP B;  3HPO A;  4D3G A;  6FDR A;  1SKW A;  4C8M A;  4I7F B;  2DGO A;  4ECQ A;  3TEH B;  4MTP A;  1P6T A;  1SV5 B;  2Z2Y B;  3NGD A;  4DR7 F;  1Q78 A;  3MCO A;  2OEL A;  3FFI B;  1EB0 A;  3IWL A;  5K14 A;  2AJ4 A;  4FZV A;  1U2F A;  2JC0 A;  4LRA A;  4NLX A;  2W2O P;  5D77 A;  3TJA A;  1VJW A;  5E5N A;  1NK4 A;  4IQM A;  4YEA A;  3DLB A;  4XO0 A;  1BD6 A;  5DLG A;  1RE1 B;  2EFN A;  2A6O A;  2Q66 A;  4NLQ A;  5JUM A;  3SI8 A;  2G1H A;  2VD3 A;  3KLV A;  5G0R A;  1U0H B;  2BV3 A;  2CVE A;  3FVY A;  2DNZ A;  1JLF A;  5K8P A;  2R7U A;  1CPZ A;  4ZPT R;  4LFC F;  1UJ5 A;  4ECX A;  1ZA1 B;  1YRU A;  1PJ5 A;  1KR4 A;  4PWU A;  1QAX A;  2XCP A;  4OLO A;  5AT1 B;  1FKA F;  1KP6 A;  3BSC A;  4NZ6 A;  1S0N A;  1UL3 A;  4Q0B A;  1NDC A;  3F56 A;  1HI1 A;  4USH A;  2M8D B;  1YIT S;  5J2N A;  5KG5 A;  3LP2 A;  3D66 A;  3ET6 A;  1YX2 A;  1UA0 A;  3IP0 A;  4HHH A;  1MWQ A;  1RBA A;  1U1Q A;  1WOR A;  2ZH5 A;  3D6T B;  2A2C A;  2Z0G A;  3V4I A;  2QYG A;  4FPI A;  4ZN3 A;  3MM8 A;  1X4B A;  2KXF A;  5AE1 A;  2I6W A;  2D69 A;  5A2Q Y;  3Q89 A;  1VQ7 S;  3AQO A;  3ZZR A;  3J7Y I;  3H20 A;  3D9B A;  1S7I A;  4B3S J;  1NSK L;  2K1R A;  1TL3 A;  3RZA A;  4WE1 B;  2OI2 A;  4WZQ A;  3U27 A;  4ES2 A;  3DGV A;  4HT5 A;  2CQI A;  4OZ0 A;  2MEW A;  3DRS A;  1RCX B;  1O5J A;  2DR8 A;  3CXC R;  4PWD B;  1FJ7 A;  2IFX A;  3KDN A;  1SJQ A;  4DS4 A;  3GQC A;  4DPO A;  3GU0 A;  4JV1 A;  4P72 A;  3UDC A;  1HNV A;  3GIL A;  4ZVF A;  4YB1 P;  4W4M A;  4OYX A;  1Y5L B;  3IWX A;  2CDR B;  1CUL B;  2YX1 A;  2WHO A;  5KFR A;  1XEZ A;  3BF4 A;  1AW0 A;  3M8S A;  5F41 A;  3N28 A;  1GAO A;  5KFZ A;  4RW6 B;  4RZR A;  1A7G E;  2BJ3 A;  1FJG F;  2HHX A;  5H1S V;  2KT2 A;  2VB6 A;  3CJQ A;  1FNX H;  4FDF A;  4LVO P;  3O3L A;  4PR6 A;  1LW2 A;  3AY0 A;  3FSX A;  8AT1 B;  4B3O A;  2ZC3 A;  1VRU A;  3OXL A;  5CAA A;  2MQM A;  5HP1 A;  5A0Y B;  1GXL A;  1HNW F;  3L3C A;  4DN0 A;  2VFS A;  5L39 A;  2NXC A;  5F8M A;  1VMB A;  1RAA B;  2FZC B;  1JLG A;  4DV0 J;  1KHV A;  3CCM S;  5J2P B;  3EGN A;  3TJ8 A;  2HWI A;  1N6Q B;  5AE3 A;  4ZP6 A;  3G9C A;  4C9D A;  1URR A;  1DQA A;  1N34 J;  2OKQ A;  4Z7Y A;  5JXS A;  1Z1Z A;  4XPC A;  4P2X A;  4K4Y A;  2K3I A;  1AB8 A;  1R27 B;  3P5B P;  3DOK A;  1X5T A;  1RWK B;  3UN2 A;  1RWX B;  4JP8 A;  3JTO A;  1N8R T;  1X9S A;  2ZHA A;  3BSO A;  5LXY A;  4ZIV A;  2DHS A;  4MH8 A;  4JOU A;  4ED6 A;  1X9W A;  2BJ1 A;  4EUV A;  2X1G A;  2ZFH A;  3B4D A;  3SQG A;  3KOA A;  3HVR A;  1Q5Y A;  5G4D A;  4URS A;  4Q2L A;  5HN0 A;  3UD5 A;  1W26 A;  2EW9 A;  4FBT A;  5KFV A;  2VC0 A;  3CIM A;  5E3C A;  1UCN A;  1APS A;  4HLB A;  3UDE A;  4AE5 A;  2B9E A;  2OUG A;  1IKY A;  1GMV A;  4JI1 J;  1R6V A;  3VR1 A;  5C2G A;  1RAI B;  2YPZ A;  1S0O A;  1UFW A;  3B6B A;  4R25 A;  1N88 A;  3H7H B;  2CKW A;  3KJV B;  5HL7 Q;  2H5I B;  2F9D A;  1FTC A;  1Q8L A;  4CLL A;  1SL2 A;  4LF4 F;  3V81 A;  2MB0 B;  1C0T B;  3ZZZ A;  3POT A;  2HNY A;  2GHW A;  1ZAV A;  3KJN B;  2N3L A;  3QT5 A;  2VIC A;  1HAR A;  5CA5 A;  1A6L A;  1UVK A;  2ZNY A;  3C15 A;  3CC4 S;  3NNH A;  2CNL B;  5DLF A;  3SCK E;  2V6A A;  5D6G A;  3A3P B;  5HQM A;  2E5L F;  3AOD A;  1DLO B;  3JSM B;  2NXU A;  2YKM A;  2CPJ A;  2FVR A;  2MKC A;  4LR7 A;  4JYA J;  1RWP B;  2WW4 A;  3GJR B;  3P45 B;  4WU3 A;  2XGQ A;  3PYF A;  2FDN A;  4LF7 J;  2DNH A;  2PMW A;  1RT6 A;  1U1O A;  4Y2A A;  1SPB P;  4PRF A;  4L76 A;  4DV5 F;  2RIL A;  3ITH A;  1B3T A;  2L3M A;  1QUP A;  1Y11 A;  3X3U A;  4LF6 F;  4TKT A;  2CWK A;  3MR6 A;  2W01 A;  1IJF B;  4ED3 A;  1SQG A;  1ZZN A;  1WNE A;  1VRT A;  3QQC D;  1RB0 A;  1RTD A;  1Y00 A;  4KH1 B;  2J9E A;  3ZZP A;  2GO8 A;  4I6A A;  3A8I A;  4DQP A;  2J9C A;  2FY8 A;  2OHD A;  4H4M B;  4J91 A;  4M5L A;  3CME S;  2RHQ B;  2E1R A;  2F9J A;  1FJE B;  2N7Y A;  2CNK B;  3BB5 A;  1RT5 B;  1VHF A;  3M6U A;  2RQM A;  2PGC A;  3KLH A;  2CPE A;  2Z2L A;  2XLJ A;  2ZUA A;  3KNA A;  1NKE A;  2Z2Z A;  1UWA A;  5A8R A;  4NXM J;  3J81 Y;  4KTQ A;  3KK2 B;  1KBR A;  2AMC B;  2XYG B;  4DR6 F;  2MY7 A;  2VAS A;  1WD6 A;  5AXL A;  3QLH B;  3OXG A;  4ID5 B;  4TNO A;  4ZLP A;  1YBT A;  2VG5 A;  3I0S B;  1YZ6 A;  4PG6 A;  1N5T A;  2QE5 A;  4A8F A;  3DLG A;  2F65 A;  4Y2C A;  2IC3 B;  3W5Y A;  2EXU A;  3GIR A;  3T9N A;  2LA4 A;  1FE4 A;  4OZJ A;  3I5B A;  4X65 F;  3QZ7 A;  3VVT A;  1U8W A;  2P6T A;  3F73 A;  3AA8 A;  2GW8 A;  4LBI A;  1MWY A;  3VGS A;  3AOB A;  4DR5 J;  3PIP Q;  3BN4 A;  3HD2 A;  5KFT A;  1K0V A;  2OPQ A;  4USI A;  4ZCM A;  1MRO A;  3CCU S;  1M1H A;  5F0U A;  4OIX A;  4HYK A;  4DV2 F;  1TL1 A;  3TX0 A;  3PFO A;  2YY3 A;  4PQA A;  1F9E B;  1WC5 A;  1SKS A;  2FGO A;  4DQQ A;  4F4X A;  2CNO B;  5DGB A;  1IWA A;  4AL5 A;  4PAA A;  3OUY A;  1T94 A;  1HPZ A;  2BW7 A;  4DV1 F;  1FVQ A;  4PCQ A;  1H74 A;  4CTA A;  4PG8 A;  9ATC B;  3I9V 9;  5H9F J;  3GZ7 A;  4OX9 F;  4DUZ F;  4Y3C A;  1JLB A;  4X62 F;  4CLS A;  3KG4 A;  3UE2 A;  1KON A;  2BE2 B;  3W2W A;  1ZTT A;  2DPJ A;  2RU9 A;  2AYB A;  4JV2 A;  5FDL A;  2HZV A;  2YNG A;  4HI2 A;  1FKO B;  5H9F K;  2XHW A;  1XIQ A;  2H1Y A;  1XMQ F;  3S8S A;  2C2E A;  4F50 A;  2OPS A;  3CPW R;  3HFV A;  2AZ1 A;  5FLX U;  1VHI A;  1WJ9 A;  3TA0 A;  4K4Z A;  3FQK A;  4C8O A;  2HS3 A;  4PG5 A;  4UOC A;  4N8O A;  4ZJQ A;  1HD0 A;  4IG0 B;  3PAC A;  1F5C A;  2BKP A;  4NOH A;  2DGX A;  4C4W A;  2HQD A;  1RAB B;  5E3P A;  5LJ3 Y;  3R7S B;  1PAU B;  1TQL A;  1W2I A;  4RUB A;  1N36 J;  3HDS A;  2IJF A;  1V6H A;  3BBC A;  3OR1 B;  2EG2 A;  2V63 A;  2FJE B;  5D4N A;  4FVC A;  1BQM B;  4LVN P;  5BYS A;  1RZM A;  3M9M B;  5HVG A;  2H51 B;  3H98 A;  4BBY A;  4CWB A;  3I5A A;  1RT3 B;  1WHY A;  3IGN A;  2XSF A;  4EU0 A;  5GAH I;  2ADB A;  1E6Y A;  1R7I A;  2F7V A;  2VDH A;  4DX5 A;  2E5J A;  3EGZ A;  1MW7 A;  4DFP A;  2OPP A;  2YQ1 A;  3GFH A;  4BLG A;  2HHH F;  3EWG A;  2VQE J;  3FEY B;  3BGR A;  4MKV A;  3JQJ A;  4N41 A;  3MM9 B;  1TUV A;  2FLN A;  3MI7 X;  1VS3 A;  2G1D A;  1BQN B;  5KG7 A;  4CLW A;  4K0K J;  7FDR A;  1EP4 B;  2IDL A;  3G71 S;  3TR5 A;  3NMR A;  2QEX S;  4ED5 A;  4ZMM A;  4ERD A;  4C11 A;  3NCR A;  1IKX B;  5IT4 A;  4WP9 A;  3BH7 B;  4O4G A;  3LO3 A;  1DFD A;  5E3A A;  4RLE A;  2NYI A;  3OL8 A;  5KT7 A;  1LFP A;  2KKH A;  5C5J A;  4TU7 A;  2HZA A;  5IC4 B;  3ZNJ 1;  1VBX A;  1QVG R;  2V2V A;  1KQK A;  3I55 S;  2WSE C;  4R0E A;  5HMZ A;  2OFG X;  2VL1 A;  2ASJ A;  1S72 S;  1NU4 A;  2JHE A;  2DPI A;  2ZKU A;  3OTO J;  1MLA A;  4EEY A;  1T0T V;  5KFF A;  1TAU A;  1S49 A;  1HBO B;  2YWE A;  2JX2 A;  2XZW A;  3F44 A;  3THP A;  1WUU A;  1UFL A;  2LXI A;  4N8N A;  3M2U A;  1KVI A;  3H2U B;  3UO0 A;  3D28 A;  3J80 U;  1S0M A;  1EKS A;  2HFN A;  3VAI A;  1YJW S;  2KO1 A;  2O67 A;  4LIW A;  2NR0 A;  4R0J A;  4RW4 B;  5KTQ A;  4QPT A;  2DH9 A;  3LP0 A;  2XYH B;  4DFK A;  1TL4 A;  4H4K C;  5KFO A;  3FBF A;  1KNZ A;  3GV8 B;  3Q22 A;  5D15 A;  3J7Z 5;  2HFO A;  4M1K A;  4RNN A;  1WSR A;  4OX6 A;  5KAK A;  3CCL S;  3CJR A;  3WHI A;  5E2Q A;  3T5K A;  3DDN A;  5D78 A;  4DV4 F;  2OEJ A;  2CJQ A;  2X3G A;  4U95 A;  4XDC A;  3AJ1 A;  3CVK A;  5B09 A;  1ZPV A;  2IJN A;  2XLK A;  1PJ7 A;  2QYC A;  2Z58 B;  1KC8 T;  2UUA J;  5G0R B;  2QC3 A;  1JLF B;  4A8O A;  3R7N B;  3R9L A;  3OD2 A;  4DXL A;  2YTC A;  4DL5 A;  2V67 A;  4Q0B B;  3RB0 A;  5L46 A;  2XMU A;  2IHR 1;  2CQ1 A;  2UU9 J;  5J2N B;  3PYG A;  2JRS A;  2IJR A;  2C2M B;  5DS7 A;  3ET6 B;  2GAG C;  2WTF A;  1VQL S;  3GIJ A;  1SKU B;  3M4X A;  2ZD1 B;  2BOP A;  4ZVQ B;  3M6V A;  2C1E B;  3C16 A;  1U0S A;  3FC9 A;  5E41 A;  3TAR A;  5D4P A;  4Q8F A;  4NAS A;  2ACM A;  2K06 A;  2VF3 A;  3D1Q A;  3MM8 B;  3OFH A;  5J2Q B;  2ZZT A;  3ZTO A;  2FZG B;  2DYA A;  3EE3 A;  2CPY A;  2KL8 A;  3ISZ A;  3BRE A;  3M8Y A;  2K1R B;  2WRM A;  1EIY B;  3EMT A;  1P8G A;  3TAP A;  1HYS A;  5HAO A;  1HQU B;  1PG5 B;  2ZC4 A;  2ZVI A;  2I1R A;  3PRB A;  1N5Q A;  3MAA B;  3DRS B;  2XBP A;  2GQC A;  4GKJ F;  4LRC A;  4QIE A;  5KFI A;  1JIH A;  4TYA A;  3SQO P;  1HNV B;  2FVC A;  2XSJ B;  1S1X A;  2R7R A;  3SEO A;  3EGV A;  5HQL A;  2QFI A;  2GVZ A;  2ZM6 F;  1U2R A;  3PKM A;  5GME A;  3UDV A;  3UDL A;  4IH7 A;  4NLD A;  1CJT A;  4YB7 A;  5U47 A;  1H2V Z;  3ILJ A;  4H54 A;  2VOD A;  4M8L A;  4OYZ A;  2V8G A;  4K5S A;  2KT5 A;  4WBF A;  3C3L A;  3HVT A;  5B08 A;  4PEO A;  4ZVS B;  2V8P A;  5B0C A;  1M5O C;  5HMW A;  4X4T A;  2DR6 A;  2B5J A;  1LW2 B;  3KHG A;  3M32 A;  2DXD A;  1V5I B;  3W8P A;  1XTZ A;  4B3O B;  4YY3 J;  1JLQ B;  3G87 A;  3IAM 9;  4ANE A;  1U6F A;  4G1I A;  4OYO A;  4DL7 A;  3FSI A;  4NLS A;  2D9P A;  4JI7 F;  3PW0 A;  3EVO A;  3SCI E;  1TKT B;  2Z2M A;  1FXL A;  4NLT A;  2OIH A;  1PIL A;  5IV3 A;  5HRO A;  2IBO A;  4DCO B;  4WKR A;  4K59 A;  2CYY A;  4OJH A;  4MAK A;  4K4U A;  2OFH X;  3TW0 A;  4PQU A;  1JLG B;  5J2M A;  5KFD A;  1UWB B;  4FF4 A;  4B9N A;  2HFZ A;  1O6X A;  2R7Q A;  3LAK A;  2VOP A;  4ZP9 A;  5A6W A;  1O51 A;  5AJ3 F;  1NKC A;  1WDT A;  5ETO A;  2MZ1 A;  4ZK7 M;  4DEZ A;  1GXT A;  3FBC A;  3GB0 A;  1BC6 A;  3H25 A;  4IFY A;  5L1I A;  3QT8 A;  3CJ8 A;  2DD8 S;  4Q8E A;  1N56 A;  4F02 A;  4RW9 A;  4J90 A;  3BQ0 A;  3K8W A;  2UUC J;  4P10 A;  1RA6 A;  2RJZ A;  4OYI A;  3MEC A;  2CZ9 A;  2ZH4 A;  3NGK A;  2HRY A;  2FJW A;  3AJ2 A;  3CO0 P;  3PW7 A;  2CG8 A;  5GVQ A;  4QWA A;  1VQ4 S;  3G82 A;  2GAH C;  1WEX A;  1KRP A;  2IDE A;  2JLE A;  1FES A;  4ZVE A;  3FNN A;  1RLD A;  2QLF B;  2MLX A;  2W8K A;  2XMW A;  4DZD A;  5I4M A;  2ZH3 A;  4AQY J;  3GR0 A;  3KMQ A;  1R8A A;  3A3O B;  1AZS A;  2HWT A;  2D3Z A;  4PG4 A;  1IKY B;  2FHJ A;  4F3O A;  5JVG Q;  2CQD A;  4M5J A;  3RB3 A;  4P52 A;  4KSE B;  3D4J A;  3MEE B;  4J9Q A;  3M8W A;  4M5D A;  1CS4 A;  3OFF A;  1CQN A;  1XMO J;  3POT B;  1LW0 B;  3B8H A;  1HLW A;  3FSY A;  1UVJ A;  1E6V A;  1EQ0 A;  1XR5 A;  2XYP B;  4DHV A;  3BGO P;  1RSC A;  3C15 B;  1T95 A;  4DN9 A;  5F8J A;  2VOO A;  4AUK A;  3SYZ A;  3DRX A;  3MF5 A;  3DN9 A;  3OQ2 A;  4USW A;  3CJ4 A;  1QAI A;  1YJU A;  2HYI B;  1BMQ B;  2MLZ A;  3OSN A;  2VG7 A;  3GWC A;  4I1T A;  1NZA A;  3N5F A;  3WC2 A;  1GEH A;  2IPO B;  2KYX A;  1T9V A;  5DDR C;  3IBC B;  1YJ9 S;  2BEF A;  3LTO A;  3R5G A;  4LF5 J;  1Q95 G;  1RT6 B;  1S1W A;  3Q23 A;  1HHT P;  3CJK A;  1H6K X;  3ITH B;  3QGH A;  1U1M A;  1B0T A;  2CPX A;  1VGY A;  1N0V C;  2HQG A;  3RW7 A;  5D4O A;  2XY7 A;  2KJW A;  1DRZ A;  4A46 A;  1H98 A;  1VRT B;  4MFB B;  2W1B A;  5MLC V;  2RRB A;  3A8J A;  3DRP A;  2GVD A;  4Y65 A;  3KLE A;  2PC6 A;  1OY9 A;  4AD6 A;  1R31 A;  3QWU A;  3ADA C;  2B6A B;  4F8R A;  2UVW A;  4RW7 A;  3KG1 A;  2X1B A;  3FRZ A;  3QT7 A;  4JI5 J;  2I2Y A;  2H5J B;  2R8K A;  2DB1 A;  1KTQ A;  2BQR A;  1RT7 A;  1Q79 A;  2RHS B;  1SC1 B;  4CO0 A;  1ZM9 A;  4ZVT B;  2VC1 A;  5BYR A;  2NUH A;  1M1K T;  2RF2 A;  4Q43 A;  2J76 E;  1BUX A;  3IR6 B;  2R9L A;  3ZNU A;  2VG5 B;  1FD8 A;  4C8Z A;  1FXR A;  3OLB A;  3G6E S;  4RUH A;  3BZQ A;  3CC7 S;  4NLU A;  1TUW A;  2BKO A;  2BR0 A;  2YKO A;  1W25 A;  4B3S F;  4F7V A;  5KFU A;  1S59 A;  1WAC A;  1NHU A;  3MZI A;  1NB7 A;  3C8Y A;  1BGX T;  3BDP A;  4B9V A;  2OLW A;  3K5N A;  5KT5 A;  2QN6 B;  2C3U A;  3Q8U A;  2XI2 A;  2FUG 9;  4X4O A;  5L1J A;  2AGO A;  2W9C A;  1MRO B;  3DHX A;  1W2B R;  2HBY B;  3ENA A;  3FEZ A;  1TMM A;  3TAN A;  2PEB A;  1KTV A;  1TL1 B;  1SIZ A;  4PYD A;  2YWF A;  1HBU B;  4WTY A;  2GIQ A;  3OUY B;  5I3P A;  2VBX A;  4QCL A;  4ZA1 A;  3ZTQ A;  4ZPV R;  2Z8Q A;  2JNJ A;  4ZS6 A;  1KLM A;  3SSQ A;  3D6M B;  1JLB B;  2HRU A;  4ECV A;  2MHN A;  2XGP A;  2EFP A;  5FDL B;  3TAQ A;  3CC2 S;  4OV1 A;  4I2P A;  3ZTP A;  1VC0 A;  2PSZ A;  3LQV A;  4U8V A;  3HSD A;  4DUY J;  4DV0 F;  2FJA B;  3PKY A;  4IFV B;  1P9Q C;  5IM0 A;  5KFJ A;  2AWZ A;  2LCW A;  2V8H A;  4MJK A;  2HAI A;  1OO0 B;  1T3O A;  2HQ3 A;  2QTW A;  5A8K A;  3C46 A;  1N34 F;  2NZ4 A;  1UKU A;  3CTR A;  3TZW A;  3HLU A;  2MTL A;  3VAH A;  1FDB A;  4BDP A;  3DLH A;  1NSA A;  1S76 D;  3UW1 A;  3P5T L;  3KLF A;  3QNW B;  2DHH A;  2G2O A;  2B7C B;  1JLC A;  1I3O B;  1EJ7 L;  4O44 A;  2YNH A;  2L08 A;  4TU9 A;  4PKD B;  2PFD A;  3DI6 B;  4X4V A;  1GMU A;  2AEJ A;  5C42 B;  1LEO A;  2DCL A;  3RBX A;  3W3S A;  3GPA A;  1FRI A;  1JNR B;  3FDS A;  1N5Y A;  2R7W A;  1DTT B;  4ZDN A;  1X4D A;  1QE1 B;  4O3S A;  5KT6 A;  4TYB A;  2FTR A;  3OT9 A;  4AFF A;  3DLJ A;  3WX4 A;  3IG1 B;  1C1B B;  5RUB A;  1E6Y B;  4USK A;  2JC1 A;  4MIW A;  3DRY A;  2MQ8 A;  2GJ2 A;  1RHJ B;  4RPF A;  4JI1 F;  1R8C A;  3W9I A;  2A18 A;  1PIE A;  1Q7L B;  2YKN A;  4EZ6 A;  3FCV A;  2B9W A;  4N47 A;  3N4W A;  3KLI A;  3PV8 A;  3UWT A;  4ECR A;  3MEG B;  3BGR B;  1PSD A;  1K1S A;  3ZZT A;  1IQT A;  4FXV A;  4DQR A;  2VUG A;  1PGZ A;  2ASY A;  2HSE B;  4RBV A;  2V0N A;  2RQ4 A;  5EDW A;  2AJ1 A;  5T14 A;  3KUH A;  1G6B A;  1R3N A;  2R7V A;  1G1X A;  3PYD A;  3B4M A;  1VJQ A;  4UQG A;  3V6K A;  4C11 B;  3L7P A;  4QPX A;  4X66 J;  5M2U A;  1R43 A;  3H4B A;  1RTJ A;  2ERR A;  4IRC A;  4P7T A;  2KN4 A;  1Z2L A;  1SQF A;  1ZM3 A;  3UNG C;  4XK8 C;  4RKU C;  1TVR A;  4K4W A;  3MM6 A;  3W5Z A;  2VQF J;  4HT7 A;  4QQB A;  2B43 A;  5BR8 J;  3HHK A;  1M1G A;  3HSZ A;  4IDK A;  2BDP A;  2HGN A;  3GCX P;  1FRL A;  2XZD B;  3PX0 A;  2QO3 A;  3FBE A;  1LWC A;  4C6A A;  1EX8 A;  5IC6 B;  4JYA F;  1WF0 A;  3QYY A;  2R7X A;  2JLF A;  3GYN A;  2MST A;  3QJP A;  4LF7 F;  3QGI A;  1GFW B;  2MGZ A;  4WP3 A;  3DOL A;  2KHD A;  4A8M P;  4QIF A;  3UI3 A;  3UCU P;  2GS8 A;  1NPP A;  4QYR A;  3MFH A;  1ZS6 A;  2HMI A;  3MOJ B;  3M2U B;  4RL1 A;  1NDL A;  3UCZ P;  2IRX A;  5D4L A;  4JI3 J;  2QMW A;  4RJV A;  2B9Y A;  3EPI A;  1P9Y A;  3RUB L;  3CJS A;  1VBK A;  2QJ3 A;  4CM0 A;  4WK1 A;  3LP0 B;  4LR8 A;  1QJH A;  3OHA A;  2DIV A;  3O8W A;  4U7U D;  1S48 A;  1GT8 A;  3P6Y C;  4NXM F;  1X5O A;  2ADC A;  1LQ9 A;  3H2L A;  4J9P A;  1FX4 A;  2X3D A;  2LU2 A;  3GFY A;  2CJA A;  2HS0 A;  3EDQ B;  4ZJO A;  4U7U K;  4D3H A;  2VV5 A;  3OTD A;  4OI0 A;  2GML A;  1KS2 A;  3EPG A;  1MML A;  2B8P A;  3I82 A;  4R8U B;  2OMO A;  2KXN B;  5CYQ A;  1XNR J;  2YWH A;  3ETM A;  2PII A;  5ETP A;  4AND A;  5ETL A;  3CT9 A;  1N5S A;  1R0A A;  1SI9 A;  2HFV A;  4DR5 F;  2QLW A;  4Q7A A;  2XZT B;  4KIA A;  4NX9 A;  3HKZ D;  1Q81 T;  2CPZ A;  1DAX A;  4KC5 A;  4MK7 A;  2E5I A;  1IBK J;  1N5V A;  2NS1 B;  4ZIT A;  4B9U A;  4AXI A;  1Q4R A;  3P3D A;  3HD1 A;  3C16 B;  2YWW A;  4USV A;  4K4X A;  5HLF A;  4OHZ A;  3KK3 A;  2W4C A;  4XAK A;  4CH7 A;  4NCG B;  1YLX A;  2LQ5 A;  2JJ4 D;  3N6N A;  2CXE A;  4ICL A;  1RAF B;  2BJ8 A;  2QSW A;  1RHK B;  4QR2 A;  3TRG A;  4LSL B;  4EK2 A;  4USM A;  3Q8P B;  5ETK A;  4RX6 A;  3PIO Q;  1WEY A;  4TY8 B;  4I6Y A;  1DUR A;  1DZ5 A;  1ICE B;  2XMM A;  1HMV A;  4NLV A;  1K73 T;  1FWP A;  3CD6 S;  1ZPW X;  2OTJ S;  4DG1 A;  3D3C J;  5JVH Q;  1NPR A;  1LFW A;  3HZG A;  3N9U C;  4H4O A;  1RYR A;  2O1P A;  1RTH B;  4N77 A;  1U26 A;  4I6W A;  4FS2 A;  4NWB A;  1CJT B;  2K8G A;  3H5X A;  3SSR A;  2Q43 A;  2KHC A;  1NND A;  5HAT A;  1NK7 A;  1FDN A;  5I42 A;  5SUH A;  1WF2 A;  1T9Y A;  1SJR A;  2R4F A;  1VK8 A;  1NJX A;  3G6V A;  1FKP A;  1NEE A;  1WF1 A;  2IM0 A;  5A76 A;  4QWC A;  2ACY A;  2DR5 A;  5DM7 Q;  2JEG A;  2B5J B;  3T1Y J;  3J81 j;  3BGL A;  4NLP A;  2U2F A;  2CQ2 A;  3IAS 9;  2DNQ A;  3Q8Y A;  1N36 F;  1VBY A;  1TKD A;  3ZFV A;  3CJ3 A;  1SQE A;  2DNK A;  2W4P A;  3IR7 B;  3PZP A;  3NCQ A;  1VQ9 S;  1HBM A;  1WEZ A;  1YI2 S;  1FK9 A;  1X0F A;  5HRO B;  1RAC B;  3G8Q A;  1RWM B;  2ABY A;  1S6P A;  1JMT A;  3R8Y A;  3QJJ A;  2A10 A;  1VRQ C;  4OV6 A;  3AD8 C;  5ETV A;  5J2M B;  1Y7P A;  2EWH A;  4F4W A;  3AXM A;  4O3R A;  1X5S A;  2HFS A;  2DNL A;  2R2T A;  1IKV B;  1CJU A;  1RK8 A;  2VFT A;  2NPI A;  1JKH A;  4NZ0 A;  4CNY A;  4ZPA A;  2NPF A;  2BAN A;  3KMS A;  2VQE F;  4HEA 9;  5IWA J;  4KPY A;  1QD1 A;  5D8H B;  4IFY B;  4KB7 A;  1IN0 A;  2DH8 A;  2CQG A;  4C48 A;  4RW9 B;  2OGU A;  2HVH A;  4K0K F;  4LF1 A;  2UXB J;  2Q1L A;  3MEC B;  2JFD A;  2DTJ A;  2FHO B;  2QL9 B;  3MUT P;  2PE8 A;  3S6E A;  4OMF G;  2MZS A;  2XM3 A;  2VJU A;  2HVD A;  1T8E A;  2IYG A;  4CO5 A;  5E7O B;  2QMX A;  3MED A;  4CYU A;  2W7O A;  3QO9 A;  2PT0 A;  1RLC L;  2QA2 A;  3TUI C;  1M0S A;  3KJF B;  1QAY A;  1AZS B;  1NH8 A;  7AT1 B;  1S10 A;  4DL3 A;  3KK1 A;  3A1Y G;  3TAM A;  2P9C A;  5ETR A;  2G9O A;  3OFG A;  1JXE A;  1MN9 A;  1V3Z A;  4AT1 B;  3RG6 A;  3OSP A;  3CDB A;  4AL7 A;  4KHP J;  1LOU A;  3SXL A;  3QID A;  2CIM A;  2AD9 A;  1WOO A;  2V4J A;  3QRQ A;  1BWV A;  3OTO F;  2IMO A;  1JK9 B;  1MMD A;  2NRE A;  3MTK A;  2P6S A;  3DLE B;  3DLK B;  1I5O B;  3CED A;  2VPZ B;  4GVL A;  4ZPC A;  1HBN A;  3OBI A;  4L6V 3;  5D3G A;  1REV B;  4UUX A;  5LMU J;  1QVF R;  2FB0 A;  2XWX A;  3HUL A;  3MPU B;  3D7S B;  1S1T A;  3QAU A;  1WKJ A;  1KQF B;  5H9E J;  3HHD A;  8RUC A;  1JXL A;  2DNG A;  4DI6 A;  3CF5 Q;  4WTO B;  1B64 A;  2VG7 B;  2FIU A;  4KV8 A;  4USU A;  1GX5 A;  2V34 A;  2DR9 A;  2LVW A;  4TLR A;  1EET A;  1ZAX A;  4QW8 A;  2M70 A;  4PPZ A;  4V19 J;  5H9E K;  2WVB A;  1JNZ B;  1S1W B;  2QG9 B;  4NXN J;  3CJK B;  4F4Y A;  1VDH A;  3IGV A;  3OVB A;  2LQ9 A;  2B3T B;  2WON A;  2XTJ P;  4XIU A;  2H4Y B;  2DRD A;  2RRA A;  2UUA F;  2FVS A;  3GCW P;  2JVO A;  1NK5 A;  4CLK A;  1VQP S;  1XER A;  4OZ1 A;  3N0V A;  1WHV A;  3S7R A;  1SUQ A;  2V9K A;  2GVD B;  4AXJ A;  5KFK A;  1S97 A;  3LUY A;  4DR3 J;  3W2V A;  1RGV A;  2RAQ A;  4NLW A;  1GK8 A;  3GV5 B;  4RW7 B;  2UU9 F;  3THT A;  5J1E A;  1JLE A;  2X7I A;  1IKW A;  3O1L A;  1HW9 A;  1NME B;  2HNZ B;  2ZJP Q;  3LAN A;  3MPV A;  3HHN B;  2VBW A;  2K7J A;  1RT7 B;  2HLT A;  1NBE B;  1IVZ A;  3GLJ A;  3MAH A;  1ZOT A;  4BCA A;  1QTN B;  4NEZ A;  4DQS A;  2RF2 B;  4DX8 H;  4IRD A;  1NJI T;  3EDR B;  2IIH A;  3M8Q A;  3V5R A;  3Q86 A;  4X64 J;  3FKB A;  3UN3 A;  2J7W A;  1IBC B;  4WFB Q;  3H0P A;  2H54 B;  4CLY A;  3TA2 A;  2KDO A;  3VQS A;  3EZ5 A;  4TU8 A;  3AA9 A;  4FNH A;  2J6T A;  1X4H A;  1HQE A;  2FD2 A;  4EO6 A;  2FY1 A;  3LA0 A;  5E0O A;  3HT3 A;  2AJF E;  2HND B;  2ASL A;  2GIF A;  1RWO B;  1RTZ A;  3MR2 A;  2IY5 B;  3GYG A;  4WP8 A;  2B4O A;  2KRR A;  1PCA A;  2KJV A;  3MM5 B;  5CQG A;  2YKQ A;  4EMD A;  3NNC A;  4FPR A;  3PFE A;  4HAC A;  1S6Q A;  3LGM A;  3BQ1 A;  2RNE A;  1JLA A;  2LQJ A;  4EBD A;  3AT1 B;  3EVM A;  1H7W A;  1HHQ A;  1TAQ A;  2FC9 A;  1RIS A;  4I67 A;  2PO4 A;  1NDP A;  5HJY A;  1L3K A;  5L1L A;  2B4V A;  4FVM A;  3AH6 A;  4ZP7 A;  2MKH A;  4FKX A;  3W60 A;  4ZVR B;  1KLM B;  3ILI A;  1WOS A;  2VFR A;  1OWX A;  4U67 Q;  2ASD A;  3FMW A;  1KVK A;  2NCK L;  2WSF C;  1UEV A;  1YQH A;  4DMZ A;  2POK A;  1U47 A;  4HDG A;  1L3S A;  4YY3 F;  2ZH2 A;  1OYD A;  1KOO A;  4KO0 B;  1WEL A;  1T7P A;  5LL6 d;  3QAE A;  1FCA A;  3NS7 B;  2B9X A;  4IH5 A;  3M30 A;  3IFE A;  4ALZ A;  2XMK A;  3WDO A;  4KKO A;  3RRH A;  1UP1 A;  2VG6 A;  1HQ2 A;  4CLF A;  1TL7 A;  1Q5V A;  5IM0 B;  2NQP A;  2PMZ D;  4I2Q B;  3RW6 A;  2QIF A;  1TR0 A;  5KT2 A;  4GC6 A;  2DNN A;  3NS6 A;  1FRH A;  3M1V B;  1FE0 A;  2LMI A;  4NML A;  4UTG A;  3HZE A;  4JI8 J;  5LOQ A;  5KG1 A;  1M5H A;  2BOA A;  5KFE A;  4W92 B;  1GX6 A;  3WX8 A;  2FYX A;  3OTE A;  4ZCL A;  1EQM A;  5HQ8 A;  4QR0 A;  3KLF B;  2N3O A;  2UUC F;  4CLZ A;  4OX7 A;  3R27 A;  3PCO B;  2VU5 A;  1JLC B;  5THW A;  1IWG A;  2HHQ A;  4ZJL A;  3VAM A;  2ROG A;  4O44 B;  4WK3 A;  2M8H A;  4FYX B;  2MMY A;  1M90 T;  5A6P A;  4LF9 J;  3P49 B;  2HK3 A;  4EYI B;  3KLG A;  4E0D A;  2MPU A;  1N5Y B;  4ANC A;  3FMB A;  4ZP8 A;  3BKT A;  4IOC Q;  4AQY F;  2B0G A;  2KVQ E;  1AUD A;  2IVF B;  2ZNZ A;  3QJL A;  2C2D A;  2DKO B;  1AA1 B;  1VQN S;  3MMB A;  2DGS A;  3H5S A;  3TQE A;  2KG0 A;  2YKN B;  5I3U A;  3KLI B;  3J80 Y;  1T05 A;  2FJD B;  4PUO B;  1PBA A;  1RT1 A;  1TFW A;  2AU0 A;  3MPW A;  3ISN C;  2LEP A;  4OJ1 A;  3I4P A;  2M4M A;  2LQB A;  5F8I A;  1C4C A;  2DHX A;  4PXC A;  1XMO F;  2MZR A;  4JI4 J;  3PHT A;  1VIO A;  1CJV A;  2MKY A;  3C2P A;  4EFA C;  1HR0 J;  2Z56 B;  4L75 A;  5B7W A;  3HO1 A;  2JEI A;  1LWF B;  5FD1 A;  2I5J A;  3WBZ A;  4K8R A;  2BQ3 A;  2GGP B;  2UVR A;  1TTH B;  5KFM A;  2PI5 A;  2DT9 A;  5HBM B;  4KAI A;  2KH9 A;  1TVR B;  2ZIT A;  4ELV A;  3W66 A;  4GVB A;  1FF2 A;  1S77 D;  1PYO B;  3MR7 A;  2QT7 A;  5IXU A;  3ISN D;  1PYT A;  2LFV A;  1HNX J;  4LF8 J;  3TZX A;  3RAQ A;  2Y8Y A;  2FQQ B;  4ATN A;  1KEK A;  1DTQ B;  4J9K A;  4L3N A;  4A48 A;  3DM2 B;  4LF5 F;  2MGZ B;  1C4A A;  3TUP A;  3DOL B;  3VAJ A;  3MM7 B;  1B0P A;  2H65 B;  4ED0 A;  3UD4 P;  3HFZ B;  1Q82 T;  2ZWP A;  2W9B B;  2O3D A;  1WC1 A;  4DL4 A;  4LT6 A;  2W2N P;  2D1C A;  4G6V B;  2E5G A;  1U0H A;  2D41 A;  1S1V B;  3N6L A;  4RUC A;  2F8H A;  3M05 A;  2LDY A;  4C2M A;  2PA3 A;  3UPF A;  5T7L B;  1FVS A;  1JJH A;  5KT4 A;  4JI5 F;  1DY3 A;  2BYC A;  2P8I A;  3PR5 B;  5F8L A;  5L9X A;  1RDR A;  2YX4 A;  2I8E A;  1F3V A;  5EUH A;  1NHV A;  4EI2 A;  4IO9 Q;  1VYA A;  4MKB A;  3A4T A;  4DL2 A;  3CCJ S;  2HRT A;  3C19 A;  1H38 A;  3GFZ A;  1RQ0 A;  2B4U A;  4P2F A;  2ZUG A;  1F9F A;  2HHU A;  1U49 A;  1FDA A;  4DR4 J;  4ELT A;  3DKD A;  3W7B A;  2R7S A;  2VFU A;  4A8X A;  5BXI A;  3I0R A;  5CYQ B;  2Z4P A;  5EGY A;  2UV8 G;  3HX9 A;  5CYJ A;  1OQ6 A;  4LQ9 A;  4HTI A;  2R7T A;  1R0A B;  3FEX B;  3R2C J;  4CI0 B;  2C3M A;  4L3K A;  5CD4 H;  4PWD A;  1GTH A;  2HS4 A;  2KFY A;  3UVJ B;  3MHY A;  3DMJ B;  5CH7 B;  3X1L B;  4IOA Q;  1CUL A;  1UPP A;  2YKA A;  1FDD A;  1WG1 A;  3ZTR A;  1XR7 A;  1SC4 B;  1YVF A;  4DLE A;  2H5E A;  3UFC X;  2OSQ A;  1L3V A;  4ICL B;  2CQ0 A;  3DXB A;  4C3L A;  5F8H A;  3ZZO A;  4EWT A;  2E9R X;  2IMW P;  3G86 A;  2V94 A;  1KKH A;  1RU2 A;  1EZZ B;  4ZVH A;  2VPX B;  3K8V A;  1WC3 A;  3VTI A;  4IR1 A;  4DG1 B;  3R5D A;  3PR4 A;  5A0Y A;  1YK9 A;  1FRX A;  3FBB A;  2F1F A;  2LXU A;  4P74 A;  4H4O B;  1NB2 A;  3HHE A;  2HIY A;  1N32 J;  4URQ U;  1V3R A;  4DUY F;  1F5B A;  1TUG B;  1KLN A;  4F3M A;  3F0N A;  2V9W A;  2GNK A;  2PA8 D;  5IV4 A;  1D8Y A;  1M5V C;  3T5H A;  3BPS P;  2HK2 A;  1V5V A;  5KG4 A;  2N4C A;  4FYV B;  3IR5 B;  5I42 B;  2FVP A;  3JS9 A;  2MZQ A;  5GAG U;  4X2B A;  4J9O A;  1FKP B;  4ZOS A;  3FK4 A;  1F2G A;  1M5K C;  1H72 C;  4ZPB A;  2JVR A;  5K8O A;  2BRK A;  1HI0 P;  4DSJ A;  1U1R A;  3IBW A;  2N4D A;  4CO2 A;  2IM3 A;  3N5B A;  3DC2 A;  3NG8 A;  4X4R A;  1J5E J;  5F8G A;  1N48 A;  2WBM A;  1AFI A;  1HBM B;  3MUV P;  3MXH P;  2BRL A;  1S6P B;  2WSC C;  1DAR A;  4Z7C A;  2RUG A;  5C25 B;  1REG X;  4J9M A;  3V6H A;  3AJD A;  1Y0H A;  3BGF A;  3GE9 A;  4UZB A;  1LWX A;  3CDW A;  3G2X A;  1VBZ A;  3PVX A;  5CCL A;  1CJU B;  4K2X A;  1T9W A;  3ZO7 A;  4X4S A;  3NWG A;  2FLL A;  2UVU A;  4I68 A;  1JKH B;  2BAN B;  1WKK A;  3IMQ J;  4X4P A;  4OJG A;  3K5O A;  2W2P P;  3OJS A;  4LMZ A;  3GMG A;  1RXO B;  2DGT A;  2CJ9 A;  3PEJ A;  3KXD A;  3TVY A;  4P6Q A;  1NRK A;  1RT4 B;  4OHX A;  4OYA A;  4DCJ B;  3PJW A;  2NYH A;  2XY6 A;  1OY6 A;  1KN6 A;  3C6U B;  1Q16 B;  3BGU A;  2RDI A;  3BQ2 A;  3OW2 R;  4X66 F;  5HAN A;  4CP5 A;  5C24 A;  3OL6 A;  3K5M A;  2ZDO A;  3NP5 A;  1C0U A;  5L1K A;  2J5A A;  4G1Q B;  3NBP A;  2XB2 D;  1VQ5 S;  3MED B;  4FF1 A;  4N7T A;  4CYU B;  4E2F B;  1ZM2 A;  3M6X A;  2VQF F;  5CAB A;  1WC4 A;  2XI3 A;  2QFJ A;  4QYZ J;  1ZAW A;  3BDE A;  5BR8 F;  3CIZ A;  1PJ6 A;  1I6J A;  2VA2 A;  1DLO A;  1NK8 A;  2D7S A;  3JSM A;  1CJK A;  1RWU A;  1FWK A;  2KT3 A;  2ZBR A;  3M2R A;  2BJD A;  4F4A A;  2Y1J A;  4QYZ K;  5MAO A;  1HBN B;  2XNQ A;  2ZOF A;  1VK3 A;  3NS5 A;  2LLZ A;  3LWL A;  3EIC A;  3WZ0 A;  4K4V A;  3R97 A;  1U8S A;  1HWL A;  4JI3 F;  3MTJ A;  3D1O A;  2DGQ A;  4F26 A;  4KRW A;  1LV5 A;  4Y2M A;  4E98 A;  1X8D A;  1J2V A;  1IJE B;  3D0G E;  4ITS A;  2C2Z B;  4H4M A;  3VHQ A;  3KHH A;  2RD5 C;  2WZ1 A;  2J0S D;  3PW2 A;  1O8B A;  3U7J A;  3KFW X;  1Z4U A;  5IFM A;  3ZZY A;  1RT5 A;  4B3M J;  2JSX A;  3OR2 B;  3FRY A;  2G2Z A;  4IG3 A;  3Q24 A;  1KHW A;  1RTI B;  3CUN A;  1NDK A;  2Y1R I;  4LRD A;  1RI7 A;  2KYZ A;  1K1Q A;  2FC8 A;  4C98 A;  1WHX A;  4PZV A;  3IM8 A;  3QLH A;  2Y0S D;  5KFB A;  4OZN A;  5FII A;  2MHE A;  3RBE A;  1QSS A;  3CDU A;  5F9N A;  4UZC A;  2V4Q A;  2WON B;  4FKY A;  4ZVU B;  2VFV A;  1FHT A;  4WXO A;  4A8Y A;  2IC3 A;  2H9Z A;  3W9J A;  3QMQ A;  1VIX A;  4WFY A;  2ZHO A;  5DM6 Q;  3CO9 A;  1SUQ B;  4V19 X;  1XNR F;  3ETO A;  3W2V B;  2RKI B;  3H2V E;  3CW2 C;  4F67 A;  4OLP A;  2J9D A;  3CWJ A;  2GV1 A;  2YXL A;  4QZV B;  1IKW B;  2BJ9 A;  2BAB A;  3M8P B;  1K0T A;  1EHW A;  3C66 A;  1S99 A;  4IH6 A;  3PW4 A;  1WHW A;  1IBK F;  4O3P A;  4DUT A;  3NL0 A;  3JXO A;  3KKF A;  4OI2 A;  4DL6 A;  2CAD A;  2HG4 A;  2VHG A;  1RYS A;  2GO9 A;  4NE9 C;  2DRA A;  1D09 B;  1XN9 A;  1NO8 A;  2C3Y A;  4IO1 A;  2D3O 1;  4M5H A;  3SFU A;  2HKE A;  2OO4 A;  3ZC4 A;  3OLA A;  3RRK A;  4DOZ A;  4BC9 A;  3DOM B;  3P4U B;  4Y6I A;  4CIO A;  2R2U A;  3TO8 A;  1B0V A;  3LPY A;  2M2B A;  2A2D A;  1HQE B;  4U8Y A;  3HVW A;  1Q8I A;  1TP7 A;  2H48 B;  2VH7 A;  2DY1 A;  2BE2 A;  2BMB A;  3EUN A;  1F2H A;  5L9N A;  3BKU A;  2J7K A;  2HQC A;  4IR9 A;  1GNK A;  3FCW A;  3BS9 A;  1RHQ B;  4NZ7 A;  3K59 A;  4BHQ A;  3P8B B;  3PEH A;  3M8Z A;  2XMJ A;  2GQQ A;  3JYT B;  1S9E A;  2HHS A;  2ZH1 A;  5IS2 A;  5ETS A;  4ZLL A;  4DSI A;  1UZH A;  1Q1K A;  3MMC A;  3KNG A;  3KWM A;  4DR2 J;  2EC0 A;  1D9A A;  3GSD A;  5LSL A;  3T1Y F;  4WIQ A;  2EFV A;  2M3D A;  2EPI A;  2JLG A;  3TJ9 A;  2CRL A;  2QL7 B;  1I94 J;  3T1A A;  5A8W B;  5K8M A;  3UR3 C;  1X31 C;  3HF5 A;  3IC1 A;  2YQ3 A;  1B70 B;  3CB4 A;  3OHB A;  2GFF A;  3MGJ A;  2ZBI A;  4UY8 T;  1BQM A;  1WKL A;  3KUE A;  3V6D B;  3OTC A;  3P96 A;  4RBT A;  2KVI A;  5DG9 A;  2MQP A;  2VG6 B;  3AOA A;  5GMK a;  2X1F A;  1UVN A;  4PAB A;  4AYB D;  5B0D A;  1TL7 B;  4WU2 A;  1RT3 A;  2L48 A;  1S57 A;  4OYB A;  1OYE A;  1LWE A;  2FJX A;  2Q79 A;  2L9N A;  3AD9 C;  2X51 A;  3BH6 B;  4QWD A;  4CZC A;  2BM0 A;  1O0P A;  4PXD A;  1T03 B;  4M63 A;  1J27 A;  1RT2 B;  3E8O A;  5IWA F;  3GII A;  4TQS A;  1OSC A;  2DBB A;  3LP1 A;  3OL7 A;  4NA2 A;  4NL5 A;  2HBR B;  3HJV A;  5F9L A;  3SCJ E;  3AQP A;  2UXB F;  1Q8B A;  4TVA B;  4JV5 J;  3MEK A;  3UCG A;  1F1B B;  4WFZ A;  2HQF A;  1YKW A;  2ZOG A;  2ZVS A;  3DNC A;  1IKX A;  3AOC A;  1PKU A;  3KLG B;  4N5S A;  3O44 A;  4C7Q A;  2D3O R;  2HAF A;  2XHC A;  4MK9 A;  3VQT A;  2KXH A;  2C22 A;  4NI2 A;  2JL9 A;  3HHL A;  1ZTW A;  5K14 B;  1SB6 A;  3TQ1 A;  4DSK A;  4KHP F;  5I3U B;  2IBK A;  4FP9 A;  3CD0 A;  2ZH9 A;  2KM8 C;  3TI0 A;  1VQ8 S;  1F5A A;  1RT1 B;  3ENQ A;  2CPD A;  5K8N A;  3NNA A;  3CD5 A;  1H2T Z;  2KZM A;  1LK5 A;  1H2U X;  1HBO A;  4G1P A;  2YH1 A;  3K89 A;  4DX7 A;  4DCP B;  1Y5N B;  2G0I A;  4M5N A;  3R1L A;  4Y28 C;  2BKN A;  1CJV B;  4FYD A;  1C2P A;  1AT1 B;  2UZA A;  1WWH A;  2GHV C;  5LMU F;  4NCA A;  1YRT A;  4MT1 A;  1X4A A;  3A13 A;  1YJT A;  4C0H A;  3MAQ A;  3QSI A;  3EYZ A;  4A8Q A;  3LF0 A;  3W65 A;  4UW2 A;  3LP2 B;  2AEF A;  4RW4 A;  4ELU A;  4GVB B;  1D8Z A;  1VQS A;  1SJF A;  1LXN A;  2Y1L B;  1IR2 A;  5KFH A;  4DFJ A;  1HWU A;  2VZ9 A;  2V4R A;  2UVV A;  1FWL A;  3HKW A;  1U2C A;  2WOM A;  3F41 A;  2O01 C;  3R5C A;  3IS9 A;  1TV6 A;  4OQJ A;  3V4I B;  1TFY A;  2YPY A;  2W24 A;  1X60 A;  2HEK A;  3OJU A;  2Y8W A;  4X4U A;  1JJ4 A;  5GAD U;  4PXE A;  1Y5I B;  2COL A;  4DV3 J;  3HHL C;  4NXN F;  1ELO A;  2RQC A;  2OJ3 A;  2EI5 A;  2YBV A;  1IBL J;  3IBF B;  3TVZ A;  1TL3 B;  4DX6 A;  1NJY A;  1VQK S;  2WB1 D;  3G4S S;  4C8N A;  2YH0 A;  5DZ7 A;  4FS1 A;  4CQ1 A;  2XEX A;  1Y10 A;  2R8J A;  2BZ2 A;  2I9S A;  3QFW A;  2F5G A;  2DXE A;  2RB7 A;  2V5H G;  1BLU A;  3VAF A;  2RVJ A;  1C1C A;  2AYG A;  1BY9 A;  1IQZ A;  4KPC A;  5ITH A;  4DQI A;  4DR3 F;  1N33 J;  1S0V A;  3EX7 B;  4KFB A;  3W62 A;  4DV7 J;  3G96 A;  1S6U A;  4ILL A;  2ZHB A;  4MMO A;  1U25 A;  2V8V A;  4PWW A;  4JI0 J;  3HHL D;  3K2Y A;  3VZI A;  1HHS A;  2MQQ A;  4YUD A;  1SVD A;  3MR3 A;  4YR3 A;  2ZD1 A;  1Q86 T;  4LRE A;  2XQC A;  1NXI A;  4BWJ A;  2AIR B;  3SSS A;  5HVH A;  3MR5 A;  3MPY A;  1H0H B;  4OFZ A;  3PYE A;  4S0M A;  4X64 F;  5J2Q A;  4I64 A;  1VRU B;  3PJX A;  2QZ8 A;  3UN5 A;  5C2C A;  3CD7 A;  5HP1 B;  3MUR P;  3KTQ A;  1Y9O A;  2BJ7 A;  4DV6 J;  5IT9 Y;  3HVA A;  3I0R B;  3NLC A;  4KGZ B;  4CO3 A;  2BQU A;  3CCQ S;  1YGY A;  1VC5 A;  3A3N B;  1HQU A;  3K17 A;  2CNN B;  4P71 A;  1NK0 A;  4GC7 A;  2P9E A;  2Z30 B;  1T3N A;  2CA9 A;  3MAA A;  2FVQ A;  3A8K A;  4NYZ A;  4OZ3 A;  2YWG A;  1DHM A;  2J6S A;  3M9N B;  4C3M A;  1ZA2 B;  4OYP A;  2XSJ A;  3AFG A;  4CH0 S;  4UST A;  1TL5 A;  1QLN A;  4NYO A;  4A8W A;  3DDI A;  2UUT A;  3DOK B;  4KJI A;  3DXS X;  4W90 B;  2HVE A;  2LP4 A;  2OSR A;  2CPH A;  4HR2 A;  4Z2X A;  4GRS A;  3KG0 A;  2L9D A;  1VLO A;  2MSS A;  2G13 A;  5GAG I;  3SQG B;  2AEM A;  2DO4 A;  3E51 A;  4HKQ A;  2OPR A;  1FER A;  1JLQ A;  1XNQ J;  1G7C B;  4O0I A;  1RHR B;  1PC4 A;  1JWW A;  2MKK A;  4GKK J;  1TKT A;  4DSL A;  4PYA A;  4WF9 Q;  4KH0 B;  5J1P A;  2IRY A;  2CQC A;  1X4E A;  3QGG A;  5IZH A;  3H42 A;  3PO5 A;  1XWL A;  2OD4 A;  1ZYQ A;  1B99 A;  4KYZ A;  5KOX A;  1UWB A;  4U6P A;  5K9F A;  2G2Y A;  3ICL A;  2ZOM A;  2J0Q D;  4HHU A;  4C97 A;  1G4C A;  3TUJ C;  3V81 B;  3I31 A;  1L3U A;  4JI8 F;  2UUB J;  1JJ2 R;  1SC6 A;  2BE9 B;  2RS2 A;  2QGF B;  2M5Y A;  1YZ7 A;  2HNY B;  3A8E A;  2KFZ A;  3GSI A;  4ES3 A;  2IA6 A;  2DRB A;  4IKA A;  1CLF A;  2CG4 A;  5E33 A;  4NCB A;  2ZEJ A;  2V50 A;  4QOT A;  1UEK A;  1YJ7 A;  2V8D A;  4LF9 F;  1UZD A;  3D0I E;  2BUN A;  3D2W A;  2XO7 A;  4J7C A;  2YKM B;  2E1A A;  5KFS A;  2W9A A;  1RUS A;  2B8Q A;  2NXJ A;  7FD1 A;  2C2K B;  1WC6 A;  4ED7 A;  1Y4Z B;  2Y3Y A;  2HVZ A;  1RJJ A;  2C3O A;  3KHR A;  3SBM A;  1EAR A;  1CG2 A;  4ZLN A;  2CJB A;  4ZKA A;  2UXD J;  2EK6 A;  1IXK A;  3OXF A;  5KFW A;  4DF4 A;  3MMA A;  5KFN A;  3OV7 A;  1D3W A;  3IN5 A;  3MEE A;  3SDE A;  2RS8 A;  4J9U E;  3LGH A;  5AXM A;  4ZVG A;  2AJ2 A;  3QGP A;  4JI4 F;  5DDP C;  2E7W A;  2HW3 A;  2PD1 A;  3Q8V A;  1LW0 A;  4ES1 A;  1RTD B;  2B7B B;  1RCO B;  2DNR A;  1HR0 F;  5LXR A;  2AQ4 A;  5C24 B;  4FF3 A;  1C0U B;  1Y3K A;  3NBP B;  4Y34 A;  4QU6 A;  1TKZ A;  2BXJ A;  1VCT A;  3W5X A;  3BO3 A;  4WCE Q;  2PI4 A;  4ECU A;  4O3N A;  5DJB A;  2FHJ D;  3KLH B;  1X4F A;  1ZZF A;  4ECY A;  1IM6 A;  3BJY A;  3TX8 A;  5DQI A;  3TA1 A;  3QBC A;  4CT8 A;  5A8R B;  2ROE A;  3MMJ A;  3EXC X;  1HNX F;  3NKY A;  4LF8 F;  1M5S A;  2NSB A;  3GJS B;  5EWG A;  1CJK B;  4ZCK A;  5HI7 A;  4M5I A;  1BWE A;  5LMN J;  1NLK L;  5CD4 A;  3CCS S;  5CZV A;  5CHC B;  1MSW D;  1MU2 A;  3SFG A;  3PXG a;  5JMN A;  4XDD A;  5DDO C;  2W7A A;  3M2R B;  3DLG B;  4UF4 A;  5HK4 A;  4RU9 A;  1PAE X;  3VWS A;  4DPY A;  2GIR A;  3O2I A;  4RBU A;  1MWZ A;  5HJX A;  1HWI A;  4DU7 A;  4QU7 A;  2AW0 A;  3PX6 A;  3MCN A;  3DDK A;  4B3R J;  2G0J A;  2ZWO A;  1URN A;  1H7X A;  2C42 A;  2DNP A;  4P7V A;  4MFB A;  2FZK B;  2OPQ B;  1XMB A;  3KJQ B;  5J1N A;  2KZZ A;  4N56 A;  4E8U A;  3BBB A;  1TK8 A;  4RR5 A;  3I9Z A;  4B9T A;  2UXC J;  2B6A A;  2QMU B;  1QTM A;  3TNV A;  2UV8 A;  2RML A;  3JAM Y;  1I1G A;  1HD1 A;  2YNF A;  4CO4 A;  4IG3 B;  4UOG A;  1T9T A;  3GG1 A;  1U1P A;  2V2Z A;  1HPZ B;  4CTA B;  5CYM A;  2CJY B;  2MZJ A;  2GMH A;  3G6Y A;  3BYP A;  4K4T A;  5ETQ A;  3MDF A;  3GIM A;  2MQO A;  4J9N A;  3M8R A;  2B56 A;  4DR4 F;  2HHW A;  4CH1 A;  4RW8 A;  1D0E A;  3W2W B;  4LBP A;  2O66 A;  4DPU A;  3NY0 A;  3DFE A;  3UNY A;  3PG9 A;  2YNG B;  2HBQ B;  2XS7 A;  3TOQ A;  2JZ5 A;  3ENW A;  3TUZ C;  3Q0A A;  4EGL A;  1WOP A;  4LFA J;  3ILO A;  2OPS B;  2CQ3 A;  3D67 A;  3S01 A;  4ZHR A;  5KG6 A;  1U02 A;  3I32 A;  3DHW C;  1Q53 A;  1UAW A;  3GYX B;  3T9Z A;  3UQS A;  1HBU A;  2DHG A;  1WG5 A;  3PO4 A;  4RNH A;  3G8T A;  1IBM J;  4F0K A;  2H4W B;  5GMD A;  4MKY A;  2A3J A;  2DNO A;  1U1K A;  2BE7 D;  4KGM A;  4Q2M A;  1ULR A;  1FT8 A;  3ILL A;  4B9L A;  1R89 A;  2NXN A;  3R5J B;  3MD3 A;  2N82 B;  4ZPD A;  4OI1 A;  3DU5 A; 
#chains in the Genus database with same CATH homology
 2LP4 A;  1FFW B;  1EAY C;  1FWP A;  1A0O B;  1FFG B;  1FFS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...