1SI9A

Boiling stable protein isolated from populus tremula
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
TRTPKLVKHTLLTRFKDEITREQIDNYINDYTNLLDLIPSMKSFNWGTDLGMESAELNRGYTHAFESTFESKSGLQEYLDSAALAAFAEGFLPTLSQRLVIDYFLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords stable protein 1
publication title The Structural Basis of the Thermostability of SP1, a Novel Plant (Populus tremula) Boiling Stable Protein.
pubmed doi rcsb
molecule tags Plant protein
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1si9A00
1K0VA 1KQKA 1APSA 1JWWA 2OAUA 1CC8A 1JK9B 1ULRA 1QUPA 2QLXA 3FGVA 1YRXA 4Y2KA 2BBEA 5B0DA 1N5VA 3BB5A 2IYIA 1FE0A 1AW0A 2FB0A 1Y0HA 2HLUA 3HFKA 2PGCA 1URRA 1TZ0A 2BJEA 2JDJA 4HI2A 1CC7A 1RJJA 3IWXA 1TL4A 1Q53A 2W4CA 1OQ6A 3FMBA 3DCAA 3KG0A 2OFHX 2IFXA 3BDEA 4A46A 4FNIA 5B09A 4HH0A 2VH7A 4OIXA 1AFIA 4HH1A 2AW0A 2HIQA 2OD6A 2QYCA 2XMJA 2XMMA 1Q8LA 3MZIA 3HX9A 4A4JA 4NL5A 2KKHA 1P8GA 2HQIA 3TNVA 1YJUA 2ROPA 2FIUA 2ZDOA 5B0BA 1N5SA 5A6PA 1KVJA 2RU9A 4Q2MA 2XMVA 1R6YA 1GXTA 5B08A 1SQEA 1AFJA 3IWLA 1X7VA 3VTIA 4OJ1A 1FEEA 2GFFA 3HHLC 3E8OA 2RSQA 3HHLB 4Y2IA 2XMWA 3BM7A 5B0CA 2LQ9A 4Q2LA 2AP6A 2XMUA 3HHLA 3LGNA 4QOTA 3TOQA 2N7YA 3LO3A 5IXUA 4YDXA 2QIFA 3WDOA 3KNGA 3UDCA 1FE4A 1TL5A 5B0FA 2ACYA 4A47A 4FNHA 3BN7A 1U7LA 3HHLD 2HLTA 4DN9A 1YG0A 3KG1A 1X8DA 2OMOA 4OJGA 1TUVA 5KAKA 5B0GA 2ZDPA 4EFAC 2HFOA 3BGUA 2K7JA 2BUNA 2OKQA 3CJKB 2XMKA 2AJ1A 3T9NA 3GZ7A 2BYCA 3BR8A 2W4PA 4HL9A 4OJHA 2GGPA 3CJKA 2CRLA 2RILA 2XMTA 1FESA 2GO8A 2GV1A 3HF5A 2KYZA 2LXFA 3QMQA 4DPOA 2N4DA 1OSDA 1OQ3A 2FTRA 3MCSA 1SB6A 4Y2MA 2RMLA 3K7RA 1S6OA 2LDIA 1GXUA 3QGPA 2G9OA 4A48A 4F67A 2LQBA 5A6WA 2GA7A 1IUJA 1XBWA 2AJ0A 2N4CA 5B0AA 2OD4A 3DXSX 5B0EA 1YJVA 5T7LA 2K7KA 1Q8BA 2KT2A 1S6UA 2ROGA 3FRYA 1LQ9A 1Q4RA 4NPOA 1MWZA 1SI9A 1Y3KA 4OJ3A 2ROEA 1V3ZA 2GGPB 4ZA1A 2VV5A 1FVSA 1VQSA 1X0PA 2IYGA 2OP5A 5F0UA 2FHMA 4U9RA 3F44A 3BF4A 2K1RB 2PD1A 3LGMA 2ASYA 1W2IA 4YEAA 1TR0A 2K1RA 2L3MA 1CPZA 2Q3PA 4ZOSA 1FVQA 1MWYA 3I9ZA 5F0WA 2QLWA 1N5TA 2EW9A 1KVIA 1P6TA 4HI1A 1VQYA 5K9FA 1YJRA 1FD8A 1N5QA 1OPZA 5T7LB 1YJTA 2BJDA 2KT3A 2GCFA 2HFNA 3TRGA 3KKFA 1Y9OA 2W4DA 4DL0C 1Y3JA 1WD6A 2OFGX 3HDSA 2K2PA
chains in the Genus database with same CATH superfamily
1FJGJ 2Z2ZA 4LF8F 2GZOA 3DRSB 3MR5A 3NGSA 1RI7A 5KG2A 4BDPA 2B4UA 2RQKA 3CO0P 2E1MC 4DX5A 4J9RA 2HVDA 1GEHA 2BANA 3CVKA 3DRPA 2AW0A 3LTOA 3OT9A 1FERA 1HNXJ 2OEKA 1U1NA 4F4ZA 2HNDA 2R4FA 3P96A 4KGMA 3KJVB 4K59A 5AE2A 1TK0A 2UV8G 2FY8A 4LVNP 4AE5A 2LFVA 4NXNF 1RA7A 2JFKA 3ILJA 2B4OA 3D54A 4P10A 2UUCF 1RBAA 2Y1RI 3ILLA 4NZ6A 3R5JB 1WEXA 5C2CA 1N48A 3MUMP 1VQOS 3MEDB 3DHWC 3VQSA 2HGNA 3EVOA 1U1QA 1Q8BA 2L9WA 4OI2A 2FLLA 4ED8A 2R7TA 3T6JA 4ZLPA 3CJ8A 4HVZA 4ICLA 4RPFA 3R9LA 4LT6A 2KT3A 4OYZA 3LQVA 2JZ5A 3UO0A 2V69A 4IH7A 4MIWA 2N3LA 3M9MB 2IYIA 2I1RA 4LF1A 4IUFA 3NLCA 5IQ6A 2GIRA 3U1NA 2KRBA 3IMQJ 2QG9B 2E66A 1IBMF 3CXCR 1FHTA 5BXIA 2LYVA 2XY7A 4UQGA 1P8GA 4C3LA 1DARA 4K5SA 2BDPA 4QR1A 1BQNA 5KTQA 3M32B 2PA3A 4F26A 3KHLA 2ZH1A 2B5JA 3CIMA 1SJ3P 1OY8A 2HQGA 4UUWA 4TNOA 3VAJA 2GGPA 3QAEA 3DXBA 2HGMA 4H54A 4OZ5A 3SV3A 4ES3A 2ZKTA 3MCSA 2BKPA 1HWKA 4A8MP 3IGVA 2DNLA 2BOPA 1PJ7A 4ID8A 2XBPA 4LSLA 5JMNA 2ZH2A 2EFVA 1TKDA 1OYDA 3TO8A 4CO2A 4DR1J 2HRTA 1S4FA 3MPUB 3OFFA 4LF5F 3LP2A 3Q83A 3TAQA 1TKZB 5HI7A 4C3KA 1NPPA 3DYAB 3LAMA 4WYLA 5ETMA 4PXDA 3GJQB 4DI6A 3V6DB 3IRWP 4LFAJ 3MXHP 1QE1B 1VC5A 5IC6B 4OIXA 1IBKF 4Y6IA 1LW2B 5M2PA 1RTZA 3I96A 2CQ1A 2EK1A 1HWLA 5M2RA 5IT0A 3AD9C 2VDHA 1KBRA 2WBRA 2V8VA 1YDLA 2VPXB 2QE5A 2VA2A 5CXTA 2ACYA 1NDCA 3D4JA 3KG1A 2XMKA 1B0PA 2XMTA 3EUNA 4NLTA 3T5LA 1S72S 4IFVB 1PBUA 3PV8A 1IKVA 1VGYA 4DN0A 1Q81T 2CQDA 4YEAA 2AIRB 1M1KT 3KHRA 2OI2A 4KGKA 1UPMB 4RW9B 1UETA 2ZZMA 3QZ8A 1TL3B 1LWCB 2IVYA 5KFMA 3OHBA 2VG7A 4X4RA 3FCWA 1SL1A 4J9SA 3CB4A 5HBMB 1TZ0A 2CQHA 1S0OA 3EICA 4O0NA 1GX6A 1BQMB 4EU0A 3RU0A 2LQ5A 1LNQA 1JB0C 3M7VA 3RW7A 3DLBA 5L8RC 2YKNB 2CQ3A 2C42A 2C2ZB 2M8HA 2MLYA 1ZA2B 3TAPA 1S1UB 5J1NA 2Z2YB 2E5LJ 1U2CA 2I5JB 3J80Y 1RHRB 2W24A 5H9EK 4DL4A 1L3TA 2YH1A 1GXUA 4A48A 4ECUA 2JWNA 2DNPA 4LF5J 3JTOA 1LK7A 3V5RA 4NPOA 3KMSA 4LR9A 2AGPA 2WVBA 3GFZA 4LRCA 5FLXY 1YJRA 1KWMA 3W1YC 5CABA 1GMVA 3P45B 3BB5A 1IBKJ 3BS9A 1URRA 4A8OA 4B08A 2ZUAA 1JLQA 3SSSA 4A46A 4RW4B 2VC0A 1S99A 2ASJA 3OTOF 1UW4A 1XMBA 4DQIA 2VC1A 5B08A 3MAQA 2AKWB 4MYTA 4QW8A 1XR6A 2U1AA 3BYPA 5HVGA 5E5NA 3AODA 1TV6A 3BN7A 1NKCA 2Q79A 2DEJA 1U1PA 3FCVA 4CLFA 5I42B 1FKPA 4OV1A 3UFCX 5KG7A 3VR1A 4JI3J 3PW0A 3RB3A 1U2FA 3V2UC 4ERDA 3AJ1A 2DITA 3NWGA 2B6AB 2DNMA 4NLGA 3Q8YA 2UVWA 1H2VZ 1KLMB 4WTYA 2QRRA 3TA0A 4QBUA 3CC4S 2MKCA 5ETLA 5KFVA 3IFEA 3ZC4A 2X1GA 5T7LB 4B3MF 2HHXA 3NBPB 3V4MA 2EXUA 4WZQA 2BBEA 2G1DA 1S6QA 4CO3A 3N9UC 2B8QA 3PACA 3HFKA 3M8ZA 4WIIA 4RUHA 2MPUA 5GAHU 3PM9A 3IG1B 1QAYA 5D0EA 2Z57B 2FD2A 3JTPA 3W2WA 4C98A 3TEGA 4DX6A 4WU2A 1NH7A 4ECVA 5IM0B 2W9AA 1TFYA 3DLKA 4Y2IA 2H9ZA 5FDLB 3G4SS 4H4OB 2DEIA 5A8KA 4ZLJA 1NHUA 1NLKL 5J2NA 3PFEA 3W65A 3DGVA 4ZPTR 2V50A 4KO0A 4JV5F 2CRLA 2WAQD 2PSZA 3AFGA 2C2DA 5B0AA 2CQCA 2QLBB 4JI8F 1RYRA 2MY8A 3VAGA 5HLFA 4ZCLA 3M1VA 1W2IA 1TR0A 1PSDA 3G82B 4UOGA 1HIYA 3MM7B 2JLGA 2CKWA 3PDNA 5H9FK 2VBZA 3C14A 4BC7A 3PCOB 1QSSA 4WPAA 1CBKA 1WTFA 4YHHF 4F0HA 3POTB 4DZDA 4J37A 3TR5A 1RCOB 4NLSA 3KLEA 1FDBA 2OPRA 3MEGA 4DV3F 4IOBA 4M63A 3QRRA 4O3SA 1ZAXA 4G1IA 2J7KA 1S1WA 2FJDB 2WONA 4LRBA 1SKWA 3WIUA 2ILYA 2IBKA 4JBCA 1M0SA 2CVIA 4GVBB 3C6UA 3EM1A 4FYDA 2GO8A 5DLGA 1UAWA 2HHVA 4IQMA 1ZPWX 4ILMA 4GC7A 2FTRA 1V5IB 4R5PB 3G6VA 3BGRA 3BKFA 2FLNA 4J9PA 3G96A 1SQFA 4M5MA 3QRQA 2OMLA 2G13A 1LOUA 4F0KA 2FY1A 3MF5A 5DM7Q 3GSDA 5E2QA 4CNYA 3RTVA 5E7OB 2PE8A 3I4PA 1T0TV 2WSFC 3ULHA 2RAQA 4L73A 4MTPA 5E3CA 3MMBA 3IP0A 5A8RB 2XMAA 3JS9A 5C5JA 2I2YA 4X4VA 1ZZFA 4QIWD 2FB0A 5DO2A 1IWGA 1G2EA 1S7IA 4AL5A 4DSIA 3MPVA 4YMEA 1C4CA 3KJFB 5KFDA 1S48A 1UKUA 4DQPA 5KG6A 4EO8A 2FC9A 2PMZD 3HK2A 1SKUB 4NEZA 1AUDA 2UUAJ 1Q82T 2QIFA 4JI0J 2NXUA 1LV5A 3K0JA 4LR7A 2VFVA 4WXWA 4Z7YA 3HO1A 4DQRA 2W4PA 1U1RA 2W9CA 5FIIA 1NB2A 4J91A 1S0NA 2ABYA 2C3YA 3G6XA 3ET6B 1P27B 4ECYA 1JXEA 2UU9F 2A3JA 2HVHA 4Q8FA 1RLDA 4EI2A 5KFWA 4IG0A 1SCJB 1GH8A 3R8YA 4XDDA 4YOEA 2APOA 2CPZA 2V67A 2H48B 4LF6J 2V0NA 1RAHB 3TUPA 3WHIA 3KK3B 2M8DB 2CWKA 2D3UA 2DB1A 3MEKA 4CWBA 3BPDA 2WW4A 4B9MA 3NGKA 3Q89A 2GHVC 4HLBA 1VMBA 3UQSA 4DV3J 1HNWF 4M5IA 4N56A 2C1EB 4PQAA 1GFWB 1LWEA 1S9GB 4WBFA 2GMJA 2JJ4D 2W2MP 2KYXA 2B0GA 4DL7A 4JYAF 1FWKA 3OSPA 2EG2A 4KIAA 3P6YC 4U95A 1S5ZA 1R0CB 1R31A 4NA1A 3FQKA 1B7YB 2H3EB 2HS0A 4L6V3 1Q8IA 1UA1A 1FO1A 1SKRA 2DGOA 1LK5A 3V6JA 1YVFA 3T9NA 1NCLA 5L1JA 4FDFA 1U02A 2G9OA 3SFGA 1JIHA 1S77D 2HHPA 2J8SA 1X4FA 5MLCV 3R5BA 2UXCF 3A3PB 3LA0A 3KLFA 2ZHOA 2MLXA 5L9XA 4OI1A 8AT1B 1VLOA 3SQGB 4ZITA 1IKWB 3M8QA 5E33A 5ETOA 2ILZA 4YQWA 3GP9A 5E0OA 4ED0A 3FGVA 4F25A 1FE0A 1J27A 2DCLA 1JLFB 3IWXA 4RU9A 1NBEB 1OQ6A 4FZVA 5L1IA 1T9UA 4I7FA 4I56A 4QIVA 1RT6A 2ZZNA 3V6HA 4ITSA 1OS5A 3T6BA 2EFOA 5J2PA 2Q6BA 3G8SA 4LFCF 5I3QA 3TARA 5EX3A 3NMAA 2GAHC 3FBFA 3HCXA 5LMUJ 4DN9A 3Q8SB 1X4DA 2OSQA 1T05B 4WFAQ 2YWGA 2DH8A 3G86A 3NL0A 2H51B 4QWCA 3B4MA 1F9FA 2ADBA 2IRXA 3K5NA 5KFIA 2HURA 2CYYA 9ATCB 3EDRB 4LJMA 3OL9A 3FRZA 1XMOF 3IA0A 3W2VB 3BSOA 1REVA 5F0WA 1IBLJ 5BYRA 4TQRA 3QSIA 5ETVA 2IBOA 3DRYA 3GJTB 2OPQB 1U09A 3AXMA 2HNZA 2LP4A 3IGNA 4DSJA 2OEJA 4WFNQ 3A3NB 4PG4A 1J2VA 3HLUA 4X64F 1NDLA 2GQ2A 4JYAJ 1KTQA 1E6VB 2AF6A 2RDIA 5DDOC 4RBTA 5GAGI 4DCOB 3GV5B 2WVFA 4DV1J 3GIIA 2AYEA 1FRKA 4Y00A 1SV5A 3LANA 1XERA 4DS4A 3AOBA 3FC9A 2KG1A 1Q79A 1ZAWA 2UUWA 2WZ1A 4J90A 5C25B 3BGUA 3T1YJ 1Q0NA 3AXKA 1R8BA 2HNYB 1WDTA 4ZP7A 4ETXA 1KVKA 1NJYA 3U1MA 2RH3A 2XYHB 2C22A 3ITHA 3CCZA 4K4SA 3CDWA 4USTA 2OGUA 3OHAA 2VKZG 1MROB 1NSQA 4URQU 2FPHX 2DR5A 3IS9A 2R7RA 3KLGB 3M30A 2GCFA 4DR7J 3P5TL 3W66A 4N8NA 2CNOB 1VBYA 3OUYB 2QJ3A 4LFCJ 2IJNA 2EWHA 4NA2A 3J81Y 3EZOA 4W98A 5AE1A 3K5MA 2DY9A 2KFNA 3C16B 4N5SA 4PRFA 4AT1B 1CJTA 4G65A 2P8IA 2W9BA 3ZXWA 3DLGB 3WQPA 4AD6A 1HHSA 3KK2A 1H2UX 1UZDA 4F4XA 2KXFA 3MUTP 3MPDA 4KH0B 3UVJA 3QZ7A 1HW9A 1N6QB 3J7AN 1N56A 4CH7A 5AXKA 7FD1A 3M8WA 4RUBA 4LQ9A 2PDAA 5FD1A 4GRSA 3CIZA 1JLBB 1IWAA 1T9TA 3AJDA 2YXLA 2J0QD 1VQYA 4M5HA 2OSRA 1P9YA 5HN0A 5HMYA 5DG8A 1ULRA 3MTKA 4Z37A 4CLPA 1RWKB 2E1RA 3CJ4A 2UVUA 2KU7A 4CLTA 3NMRA 4YR0A 2ZM6F 5KFFA 4OX9J 1V9OA 1DLOA 4Q0BB 3B6BA 1GXTA 3FQLA 3DLHA 3HVTB 3W61A 2YNFB 1QSLA 1Q8KA 4ED6A 4UTGA 1M90T 4PUOA 4TLRA 1VK8A 3RB0A 1M5VC 4DL5A 2HQFA 3VAMA 5H9EJ 5DZ7A 1VRTA 1IBCB 4J9VA 1N36F 4D3GA 1NJZA 4KFBA 2CPXA 2MQPA 2MZQA 3BGFA 2B9YA 2Z8QA 1H72C 2MKSA 3EGVA 4PYAA 2VPYB 4DQQA 1S1TB 1R8PA 1TL7B 2DNYA 3MCMA 2HRUA 2Z30B 1JWWA 2AD9A 2Y8YA 3HP6A 2XYPB 4KH1B 5KOXA 5KG0A 2F5GA 3NOCA 2NYIA 1R89A 3R1HA 2U2FA 5A0YA 5KFEA 2MKHA 4BBYA 1Q53A 4OHYA 4NMLA 2HBQB 2WSEC 4DV2F 1OO0B 4G6VB 4OYXA 4ZPBA 4IO9Q 2E5IA 3V81A 4DCJB 2AX0A 2HSEB 4DR5F 1IM6A 2OELA 4PPZA 1NK6A 3IWLA 2QL7B 4L72B 3TA2A 4B3TJ 5G4DA 2WVDA 3UDCA 4UF4A 3S8SA 3BBBA 1JJCB 1RTDA 2BJ8A 1ZH5A 2CPDA 5KAKA 3S6EA 1XQIA 5KG3A 2K7JA 2OKQA 2XLIA 3HF5A 4RBUA 4PYDA 2Z0GA 2DNOA 3MMAB 5DQGA 2GHPA 2E5JA 1V5VA 1JXVA 4DV0J 5FJ4A 1WUUA 3FRYA 2E7VA 1SC4B 3DRSA 3H7HB 4NX9A 2F1FA 2GQCA 1IQTA 4P74A 1CVJA 2Z58B 3CCJS 1FD8A 2EG1A 2QYGA 1Q7YT 2ZH8A 1T94A 1UP1A 4JI4F 3N79A 2MZSA 3UD3P 1BLUA 3HM9A 1N34J 3GPAA 3Q8UA 3EZ5A 4I2PA 3MWBA 2FZCB 2QA4G 4AQYJ 1M5PC 1GAOA 5ETQA 1EP4A 2JEGA 2BOAA 2XMVA 1BQNB 4LSZB 2DR8A 2XMUA 4L76A 2B5JB 3NRBA 1HPZA 2V8GA 1WG1A 2DK2A 1GMWA 1J5EF 3FCHA 3FZBA 3T9ZA 4USJC 1SB6A 1HYSA 4JB8B 3PEJA 4LSLB 2C3OA 2BXJA 1UMJA 4UZBA 6FDRA 1YITS 3LP2B 2ZC4A 2ZBRA 3IC1A 3O6QA 4USUA 1YRTA 1HI0P 4MKYA 2RT3A 2MGZA 2W4DA 1HI8A 3OQ2A 1YRXA 1RLCL 3NGTA 1AA1B 5H9FJ 4EYIB 1JLAA 1CC7A 2Z56B 4NLXA 5ETSA 1ZA1B 3KTQA 3M32A 2E29A 5BYQA 4DU8A 5THWA 3ZTPA 4B9NA 1W26A 2E44A 2IVFB 2KTQA 2FGCA 1QLNA 4TN2A 3OV7A 3HHLC 4YY3J 3KNGA 3G2XA 4EUVA 4ZVTB 4DLEA 4GKJF 3H5YA 2AJ1A 3BBCA 3TVYA 3THVA 4DDFA 4EYHB 4R8UA 4RL1A 3K57A 1RADB 1T9WA 2D7SA 1WC3A 1IKVB 4J7CA 2KH9A 3KLHA 1TKZA 2ZOGA 1UCNA 2DO4A 2VICA 4RZRA 1MSWD 2VBWA 2XS5A 4BLGA 3BKUA 2HFZA 1SUQA 4LSNA 2ZUGA 5HJYA 2FHKA 1QE1A 3BO2A 3LPEA 3VVUA 2VODA 3D1QA 3ZZTA 3FVYA 3PW7A 3GCWP 4AUKA 1U0HA 3NCQA 1WORA 1YWXA 5I3PA 3R2DJ 1UVIA 1RT5A 4ELVA 3M2UB 1H2TZ 1ZM2A 4LF9J 3W9JA 5E3PA 4FNIA 3QJLA 2KN4A 2JEFA 2ZZTA 5CCLA 4IQXA 2RU9A 3MM9B 4JI5F 4NASA 1HD1A 2NREA 3T1HJ 4USVA 4IFVA 2HHUA 3Q8VA 2NLWA 4WP9A 5HL7Q 3D5MA 1TVRA 3NS7B 2DJWA 2W25A 3HHDA 2Q1LA 2ZE2A 2F4VJ 1YZ6A 3G9CA 2RQCA 4MH8A 3WX8A 3PHTA 1G3OA 1CLFA 3OD2A 3UN5A 4PR6A 3L7UA 1TL3A 1LWCA 2J6SA 2BQUA 3VAHA 2YX1A 4DF8A 1XR7A 1U1MA 1W25A 1RT2B 4R0JA 2BRLA 2EW9A 3IBFB 5D0HA 4A8WA 3GYNA 3H98A 3DFEA 3RAMA 4NLQA 4NWBA 1WC4A 1FDNA 2KL8A 3TJAA 3QSYB 5DQIA 3NG8A 2BJ1A 1EKRA 4P71A 4O4GA 3OL7A 5D15A 3DCAA 2BM0A 4C0HA 4K0KJ 3RBEA 3MURP 2EFNA 1N5YA 1S1UA 2KM8B 3OVAA 4OX6A 2I5JA 3HZGA 2W2NP 4GKJJ 1GQEA 5HROA 3EGWB 5DJBA 4ZP8A 3ZZZA 4DR2J 3GIKA 4QR2A 3RR8A 1QTMA 1FKPB 1Q5YA 2CWXA 4YS2A 1P1LA 3NEKA 1KKHA 1R7IA 1ZETA 5L39A 2ERRA 2RRAA 3T5KA 2IY5B 3OTCA 4JI1J 3M6VA 4PXBA 3PZPA 3Q2TC 2C2EA 4Y34A 1N5QA 1U1LA 5DGAA 2POKA 1ICEB 4E98A 4RW4A 2RU3A 1S6QB 4OZ0A 1WC6A 3SMZA 3CT9A 3P49B 3PIOQ 1RJJA 1CG2A 3AA8A 3W2WB 1SH3A 3CD0A 1HBOA 4PABA 1N54B 2ADCA 2XO6A 2VOOA 2LXUA 3DRXA 2EFGA 2HAIA 3DLKB 4CT9A 1X4GA 2HWIA 2C3MA 2J0WA 3HKWA 5A2QY 5A8KB 3BJYA 3KJQB 3TW0A 3BBFA 4NMXA 1NZAA 2PFFB 5D0RA 4ZPDA 2B6AA 4RW8B 1UWAA 4Y28C 4UY85 1K0TA 1KLMA 2ZD1A 2V4QA 3LP1A 1JLGA 1VQ4S 5IOLA 3M8SA 4DFPA 5T7LA 5IZHA 3OL8A 3IBWA 1HKAA 1OYEA 2F40A 2JFDA 1PC4A 3TWZA 5HLFB 3KJNB 4IFYA 3M1VB 2ZBQA 2PD1A 3WC0A 2L9DA 1HQUA 2WHOA 4OZ3A 4DOZA 5GAHI 1HNZF 2K2PA 1KQKA 2AJFE 4YB1P 3C14B 2DBBA 3PJXA 1FNOA 4FS1A 5IM0A 1O51A 3OFGA 2BRKA 2HMIB 3GV7B 2A2DA 2E9RX 3FMBA 4DL3A 2LQJA 2YPZA 3HVAA 1C0TA 1S1WB 2WONB 1A7GE 1X7VA 2E7XA 3V4IB 3TOQA 3LO3A 2VHGA 4O44B 1Y11A 4NZ0A 4FPIA 2CNLB 1RTJA 3ISNC 4M5LA 4HEA9 4ZVFA 1F9HA 4OQJA 3PX6A 2R8HA 3THPA 3BGRB 1GMUA 2CG4A 3A8IA 2GNKA 3J80U 4DV4F 2AJ2A 5HMZA 3QIDA 3QFWA 4ZPWR 2ALZA 4F02A 4AYBD 3M2RA 4OL8A 2ROEA 3UWTA 5L9NA 3CCRS 2HZAA 1PBAA 1XR5A 4OYBA 1RHQB 3MMBB 4WE1A 3JQKA 4XPCA 1EQMA 1S59A 4O3NA 1HR0J 2JVRA 3M6UA 5FLXU 2KJWA 2XC9A 3BR9A 3GWCA 2CQ4A 3GYXB 4ZDNA 3K89A 1JLCA 2HFUA 3QNWB 5JXSA 5JVGQ 1OSCA 2LMIA 3R5DA 2CFXA 5HVHA 1Q7LB 3NOGA 2QYCA 1NK0A 2XMMA 1TKXA 3V6KA 2E9TA 2RDJA 3ILOA 1RT4A 4ZVOB 4PAAA 4NRUA 4R5PA 4IRDA 5F8JA 1K73T 1LW0A 2ZH4A 3K5LA 1QVGR 1HNVA 4H4MA 4OLPA 2ZNZA 1A9NB 4EBDA 4KY3A 3KWMA 4J9NA 2A6MA 3NGRA 1IXKA 3QQCD 4CQ1A 1SL0A 2UXBJ 2G1HA 5GMEA 5LMNJ 4QPXA 2DYAA 2LQ8A 1VQ8S 5ADZA 4K8RA 2MJUA 4CNZA 4IG0B 2VQFJ 1F0XA 3CCUS 1YTYA 4DUTA 2VBXA 1U6ZA 1Q4RA 1MWZA 3BKTA 1V3ZA 3CC7S 2BACA 3GG1A 1GTEA 2EKYA 1S57A 1QAXA 4Q5VA 2FZGB 3CCVS 2GIFA 4HI1A 1N32F 1FRHA 1RYSA 2PMHA 1WNEA 1R8HA 3DU5A 6FD1A 5K20B 1W2BR 5H1SV 3Q24A 2CQIA 2MZ1A 2DRBA 1CQNA 1X5PA 2RUSA 3O2IA 3KOAA 3M8PA 1S12A 4CDIA 2DXDA 1LWEB 1V3SA 4G3IA 1B4SA 3R1LA 2ZDOA 1I5OB 2HQ3A 4RO0A 4FF1A 4O3RA 2QEXS 1VHIA 1L3UA 1O5JA 1TMJA 4QCLA 4NXMF 2R2UA 5LXRA 2RRBA 1D9FA 1OMSA 3MUVP 4PEOA 4ZP9A 2HGLA 2A18A 3QMQA 4DPOA 5HVFA 3NY0A 5D4OA 1S0MA 5D8HB 1AB8A 1NZ8A 1VQ5S 3F41A 4RX6A 3D7SB 1I94F 3HSJA 4P7VA 2BEFA 1NM2A 2KT2A 1MMLA 2AQ4A 1WKLA 2MQOA 3ZTQA 5ETRA 4KPCA 4IR1A 3SEOA 4RNFA 1UFKA 1PGZA 3IN5A 4RU2A 4CT8A 2BX6A 1CEZA 1FRLA 2QLWA 3M8QB 3FMWA 2HBZB 3UN3A 1P6TA 4LFBF 2IJFA 2H65B 1XMQF 1NRKA 5EGYA 2XO7A 1C4AA 4OZJA 1JKHA 1S9GA 3AQOA 3OJSA 2BE7D 2J6UA 2VJVA 3MFHA 1RTHB 1RT6B 2MHNA 3PTWA 3F0NA 2GO9A 5HAOA 4DR3J 3TP2A 3JYTA 5J2PB 5CQGA 5DETA 3VV2B 3CD7A 2QTWA 3RUBL 4LBPA 4K4XA 1NK9A 2DNHA 1A0OB 4CLYA 2IA0A 2OO4A 2IJRA 2WB4A 5SUHA 2GMHA 1BHNA 2D3OR 5J1PA 1SXLA 5HMXA 3VALA 2RMLA 4X4TA 2EFQA 3SQGA 2JRSA 3FFIA 1HBUA 3J7YU 3TA1A 5BR8F 4RW7B 1XNQF 1HWJA 2KHCA 4DV6J 1Z2LA 1REVB 2X3DA 4X4NA 1BQXA 3NXZA 4DU7A 3MOZA 1NKEA 4ZCIA 1T9VA 3JQMA 2DVIA 2HFSA 3T3FA 1U26A 4FF2A 3TI0A 2M2BA 4XO0A 3JTNA 3KUEA 2B56A 3D9BA 4K2XA 3OW2R 2JDJA 4X62J 4S0MA 5KFPA 4JI7J 5MAOA 2DT9A 4B9SA 3DI6A 2KZMA 4QYRA 5A6PA 2DIUA 2GJIA 1Z4UA 1RUSA 2SXLA 3ELHA 4H4KA 1CS4B 1M5HA 3QT7A 4YP3A 1X9MA 4XDCA 1YG0A 4QIEA 1VFJA 2CPFA 4DHVA 2ZHAA 2HFOA 1DAXA 3A13A 4IH6A 2MQ8A 4WFBQ 3ZTSA 3LH2S 3W2VA 2HQCA 4DZ6A 2OTJS 3ITHB 3A12A 1SKSA 2EC2A 2D3O1 2CPYA 3CE8A 1YJ9S 4U7UD 1WTBA 1J5OA 4NEYA 2OPQA 4KHMA 2EK6A 4K2JA 3IAM9 1RWMB 1FD2A 4CH0S 3LGMA 2GVDA 3IS9B 3OVBA 2HHHF 1FVQA 2WOMA 3M30B 3SQOP 1FDDA 3I5CA 1FXRA 1GNKA 5EX0A 2E1AA 3AJ2A 4V19J 2BJ3A 3N28A 4URGA 4ZVHA 3AOCA 2X1FA 4B3OA 1FRIA 1BC6A 3WC2A 2IM0A 1PJ6A 4LRDA 2FJWA 5F8HA 1N5SA 4Q2MA 4DJBA 1FKAF 3WZ0A 2W7OA 2XI3A 5IXUA 2NCKL 1DBDA 3CJ2A 3KYLA 5F3TA 1U7LA 2RKIA 4C3MA 1IKYB 1RU1A 4C8LA 3KK2B 2A0FB 2BUNA 1VI7A 3DRRB 5DG9A 4BCAA 5BR8J 4NLRA 4OI0A 3UVJB 1U2RA 2CJKA 3PYGA 5CAAA 2B9EA 4TU8A 1RB0A 3KLGA 2FHJA 5F8LA 4I6WA 1NSPA 3A8KA 2DHXA 4CYUA 1FJGF 5DQHA 2V4JB 2VL1A 2AGOA 4JI6J 1LXNA 4M1KA 2BJDA 4Y65A 5HMWA 2QT7A 3D6HB 1AT1B 3KFWX 1LWFA 2Q43A 3B8HA 1KFSA 3R7BB 3W64A 4DSEA 2XCAA 5KFNA 2O67A 2ASLA 4FYXB 4O3QA 3F56A 3D1OA 1U49A 1S10A 4IDKB 1Q8LA 3MZIA 2J0SD 3BO3A 5LXYA 2HQIA 3TNVA 4F7VA 1RT1A 4DS5A 2LQ9A 3K17A 4PUOB 3CPWR 2FUG9 5F9LA 3RB6A 2HVZA 3GG0A 3H2VE 1N6QA 4DEZA 5KFSA 3OTDA 2QLFB 1IKXB 4UZCA 2MZTA 2YH0A 1W7WA 3C6TB 4OHXA 2H4YB 3G87A 2N4CA 4LIRA 4L75A 2HHHJ 2RRNA 4OI4A 2VFRA 4KFBB 3A1YG 3R7NB 3GR0A 4ZVRB 2AV5A 3CCLS 2J7UA 3AAWB 2CDRB 2LEBA 1VJQA 2L9NA 4HDHA 3TUJC 2NSCA 2AEFA 4J9OA 3C19A 3ISZA 1C1BA 3ZZRA 3P5BP 2HZCA 2JC1A 3HSGA 1YHQS 3N6MA 1WC5A 3TQEA 1CJVA 5DZ6A 2HW3A 5K8MA 3VAIA 3V81B 3IAS9 2NYHA 1PG5B 1DTQA 3C15A 2G0JA 2HK3A 5IT4A 1RTDB 1FX2A 1OY9A 3W5YA 2QX0A 2EC0A 1RWOB 2CPIA 3CJKA 3U1LA 3JAMY 2R2RA 1WHVA 2BKNA 2NUHA 1WSVA 3MMCB 2LDYA 1S1TA 1TL7A 2WTFA 1S6UA 2ROGA 2CPHA 4DR1F 1RAIB 4UOCA 1KHWA 1KR4A 2Z4PA 1VQSA 5F0UA 3VAKA 2W2QP 2VD3A 4EWTA 4ES2A 3QGIA 5CZXA 1APSA 1OJ4A 1QAJA 4LFAF 3NS5A 1DJ0A 1TP7A 5J1EA 2WB1D 2R7OA 1R0AA 4OX7A 2MDAA 1VIXA 4QPTA 4I2PB 3AA9A 4U8VA 3UR3C 1TMMA 4DMZA 2J76E 1EP4B 4NZ7A 1G7CB 3J81U 3MTJA 3UPFA 4CO5A 3I5AA 3MMAA 1HPZB 1FE4A 4F3QA 3MR7A 3T19A 3UE2A 2EI5A 3CF5Q 1EARA 2NR0A 2XULA 3O8WA 1RSCA 1HYSB 1U1KA 2J7WA 2CZ9A 3MCOA 3N5BA 1D09B 2D3ZA 3PG9A 1TELA 1HQEA 5A8WA 4RLEA 4ZA1A 1DZ5A 3LW5C 4WFYA 5HATA 3H40A 5M2UA 3OLAA 4KHPF 1B70B 2CAJA 2XHWA 2MGZB 4TKTA 2BV3A 2E1PA 3DDKA 3IRXA 3QWUA 4LVOP 2QFJA 1Y0HA 1JLAB 4F0MA 2BJEA 1JJHA 4HYKA 2B3TB 4DX7A 1H7XA 3ZZUA 4OYWA 1NSKL 5LOQA 4UW2A 2XZDB 2V63A 5K8PA 2Q66A 3KXDA 1PKUA 2LXIA 2I38A 1ZPVA 1VC0A 4KKOA 3HHLA 2E5LF 4Z7CA 1FT8A 1D8YA 4F8RA 1KHVA 1CSJA 1Y5LB 1L3VA 2HQDA 1N0VC 3MM6A 4R8UB 1RKIA 4X66J 2WBMA 3MM8A 3G8TA 1XBWA 4B3SJ 2PA8D 1TTHB 3KLHB 2XCPA 1SC1B 3NWRA 2YKPA 1SUQB 3FDSA 4LSNB 2YWWA 4X65J 5HP1A 2M88A 3DOKB 1U0HB 2VKRA 4RWWA 1RT5B 3CMES 2CADA 2PEHA 2B4VA 4KBIA 4F4WA 4ZCKA 3KDNA 3OBIA 1H74A 4L3NA 2RD5C 1AXQA 2NXNA 3ZNUA 3H90A 4ELUA 1Z2ZA 3W60A 4OYAA 2PMWA 4I1TA 2RS2A 1TVRB 4CM2A 2KVQE 2ZE2B 4ECXA 4JI3F 5F8IA 4HKQA 3TZWA 2QL5B 3TUIC 2D74B 4CLUA 1X9SA 5K14A 2CJ9A 3QT6A 3NNCA 2J8AA 2BA9A 1MWQA 4UOHA 5I4MA 7FDRA 4KHPJ 2X51A 3GU0A 5D4LA 1FK9A 3EXCX 3Q86A 3UR0A 1KLNA 3GSIA 3PYDA 2QV6A 2RE1A 3M2UA 3MAAB 2Y3YA 3W5ZA 2W7AA 1YIJS 2VZ9A 3ZZYA 3M2VA 4O4GB 3MM9A 2ZHBA 1DFDA 4OV6A 2YKMA 1Y00A 5IWAJ 2HK2A 4YB6A 1FX4A 1X5SA 1HI1A 5SZTA 2R7XA 1JXLA 1N5YB 4ZPVR 1SJ4P 3DHXA 4OYMA 2XGPA 3W9HA 1GXLA 4MK7A 4DR6J 2XG8A 2E9ZA 1AFJA 2W7PA 5HROB 3K8VA 1F9EB 3JSMB 3KHHA 3MM5A 3TZZA 1M5KC 1H0HB 4E2FB 2PFDA 3BSNA 3KUGA 1RAEB 3VGVA 3PW2A 1QM9A 1ZOTA 2DGSA 1LEOA 4A8QA 4B17A 3H5XA 3DDIA 2YVSA 4KRWA 4L3KA 1T3OA 4QYZK 1RT7B 2VOPA 1RT2A 3SDEB 4C8KA 4ZIWA 2WCXA 3CDBA 2ATCB 1N33F 2LVWA 2WW8A 4NCBA 2O5DA 3K2YA 3UDVA 3PO4A 2YKOA 4F4YA 2FLOA 4DSFA 2AGQA 2ZKUA 3I9ZA 2QLXA 2NZ4A 4C2MA 5EUHA 1Q78A 4FBUA 5KFJA 4RNMA 1HARA 3QAUA 4B3RJ 1RP5A 4OHWA 1V6HA 1G1XA 4ZP6A 3S7RA 4WTOB 2DGUA 4UQTA 1HBOB 2BKOA 3QGGA 2NUUG 3CMAS 1QJHA 4QU6A 4FS2A 3MD3A 2R2SA 5AE3A 4FF4A 2BMBA 2QMXA 5D4PA 4DV7J 1AZSB 3MFIA 2J9DE 1HBMA 1ZAVA 1FKOA 2XB2D 3H4BA 3G8QA 4MK9A 2FZKB 4R0EA 2QC3A 4O4RA 5F8MA 2XEXA 3X1LB 5CHCB 2ZD1B 4NCAA 3LP1B 1JLGB 2IM3A 2GA7A 3OR2A 4OYPA 3K8WA 2L41A 2ZVSA 3AB4B 4IFYB 3AD8C 2AMCB 4I6YA 4U7UK 3SV4A 1HQUB 3TANA 5D6GA 2XYGB 3GONA 4LF2A 1XIQA 4KQZA 1NB7A 1KVIA 1FXDA 2R7SA 2HFVA 3QT8A 4KGVB 3T1AA 4MK8A 1UWBA 4DR4J 1VR6A 4QWEA 1SJ1A 1URNA 1C0TB 2COLA 4FN5A 4CLZA 2Y0SD 4C9DA 3VCDA 4WF9Q 4FBTA 1F2GA 2UUAF 3RRGA 4RW8A 3DKDA 4JI0F 1FFSB 1VK3A 1UEVA 1YGYA 2JHEA 3B4DA 2MXYA 1RTJB 2AHOB 5CYQA 3RGIA 4XK8C 2E5HA 4K4TA 4LF7J 4I2QA 1N33J 3BYRA 4P6QA 3TVZA 4MKBA 2V5HG 4I68A 2XGQA 2Y1IA 3D66A 3H8YA 1VCTA 4IYQA 1NSAA 2FJXA 4NCGA 1XNRF 3E3XA 1WEYA 1K1SA 4KB7A 1N8RT 2K7KA 2HEKA 4O23A 4LF6F 3M2RB 3MHYA 1WF0A 3TJ9A 1HNIA 5CD4A 3SIPB 1U48A 4WE1B 3GIRA 2HMIA 2V8HA 2KFYA 2VG5B 2HVIA 3AOAA 5KG1A 2P9GA 2IA6A 1Q95G 1Y3JA 2HAFA 1CC8A 1ZZNA 2BJ7A 1PYSB 2F8MA 2QO3A 3DDNA 1RACB 1JLCB 4LUBA 5E41A 1R6VA 5GAEU 2J0XA 2K8GA 3V4IA 1WACA 1S9EA 2YNIA 1D0EA 4O44A 2VH7A 3W8GA 1TKXB 1RBLA 5D0GA 3MGJA 4BC9A 4DV5F 1KVJA 2RIJA 1RT4B 3U27A 4JV1A 4C8MA 1K9MT 1FF2A 3TJ8A 1K1QA 1QSYA 1LW0B 2OEMA 1HNVB 4H4MB 1TL5A 4BHQA 2OMOA 1TUVA 1R8AA 1IQZA 2J9DA 1F6TA 1WOSA 1L3KA 3U7JA 4F3OA 1U6BA 1NH8A 1EZZB 3DLLQ 1RZMA 3NAHA 3ENQA 4ANDA 4QW9A 2HG4A 1KP6A 3H5UA 1JJ4A 2XLKA 3PHEA 2D69A 1U24A 4FYWB 5KG5A 3MR6A 3N6NA 4A8SA 3NNAA 1U8WA 1RHJB 3LGHA 3L7OA 5I3UA 1WG5A 2GVZA 3KLIA 4URSA 3M8PB 4ZS6A 5GMKa 3LALA 2BE2A 2M7SA 3NGUA 3M05A 1UL3A 4GKKJ 3SSQA 4ZJLA 4HH1A 2CG8A 2VIHA 2IMWP 3IR5B 4NLOA 1KQGB 2BVZA 3QJJA 2G4BA 4CLSA 5F9NA 1BXNA 2XWYA 5LMUF 1SJRA 3TVKA 4QOTA 2DY1A 1Y5NB 2O01C 1VQLS 5A2QU 2YQ3A 4EFAC 4NLDA 1XNRJ 3CSKA 5IC4B 3CD6S 3W8PA 4DL2A 3TEHB 3K7RA 2W8KA 4DUYJ 2KXNB 3MD1A 4CO0A 2KG0A 1S76D 1IM4A 9RUBA 5IT9U 2GAGC 1EIYB 1IBLF 3R2CJ 2K1RA 5ETKA 4K4ZA 4HACB 2NZCA 2BABA 3HFZB 3FSYA 2ZVIA 4CM0A 3IR7B 1JKHB 4RW6B 3H25A 2G0CA 4DXLA 3PW4A 1YRUA 4XIUA 4OLOA 3PX0A 4RWXA 4DV5J 5EDWA 4DCPB 2HPUA 4DV1F 2G0IA 4HH0A 3JYTB 3IWNC 1H38A 2XMJA 3HULA 5DDPC 1U1OA 5CA5A 4FYYB 4PCQA 4TVAB 1A6LA 1UZHA 4ER8A 2FHOB 1EQ0A 1X4AA 3T1YF 1SJFA 5KFAA 2DR7A 3FJ2A 3UW1A 2R3VA 3Q0AA 1GMWD 4DUZJ 4QWDA 3H2LA 3FFIB 1HBUB 2UUBJ 3SI8A 2C3UA 3ZNJ1 2DNQA 1SBRA 2AJ0A 4ZVUB 1FTRA 4HHJA 3PR5B 1MNEA 3QRPA 3I6PA 4DF4A 5L1KA 4KV8A 5KT6A 5KFCA 2F65A 3SCKE 1OIAA 2X1AA 4DR7F 1NUEA 4R25A 1RTHA 3AQPA 2D1CA 4CTAA 1YJTA 1AROP 2UV8A 4ED4A 2F3JA 1F5BA 1I51B 3Q23A 2V2ZA 1RAGB 2D9PA 2NPFA 2VPWB 2FYXA 1F3VA 1PO6A 1WC0A 4CI0B 4HHHA 3SXLA 4DPWA 3DI6B 4USHA 3K58A 3MEEB 4M5DB 2YTCA 1NDPA 2PEBA 4EO6A 4F4AA 1FRJA 3E2EA 3LPYA 4PG5A 1FEEA 4RBVA 2IC3A 1B7FA 1PILA 1M1HA 4ED2A 1F5CA 4CLLA 4LBHA 1IN0A 4RW7A 3EGNA 3RYLA 3J7YI 4ECSA 5U47A 1WOPA 1PYTA 2BYCA 1M5OC 1L3SA 5BYSA 1UVMA 4G1QA 4DQSA 3GJSB 4MKAA 1J5OB 3UI3A 2NXCA 4K4UA 2YWKA 1NPKA 1R27B 2GVDB 3CJ5A 2WOMB 3CD5A 3GQCA 2E7WA 2MKJA 3VVTA 1WKKA 2LKZA 3S1TA 3TRGA 1RCXB 4ETZA 4ID5A 5AXLA 4LQ3A 1X9WA 4EBEA 2FC8A 3EE3A 2M3DA 3UNGC 2ZJPQ 4B02A 3RAXA 4B3OB 2JL9A 2QL9B 3KG0A 1CS4A 4OX9F 3Q8QB 5C24B 4C8ZA 2IAJA 1FJEB 2JLFA 3E01A 3I4HX 1XWLA 2LU1A 1NHKL 3UNYA 2O3DA 2AP6A 3LGNA 5KFOA 2RKIB 5AJ3J 2YBVA 5LM7E 2YQ1A 1YQHA 1YJWS 2QMUB 2GV1A 4I64A 3SFUA 5GMDA 2ZBCA 5HK4A 2MQMA 5KFKA 5HO4A 2F9DA 4HTJA 1TK8A 5CD4H 3H5SA 1VRUA 4GO7X 3MI7X 4FVCA 4CO1A 4OJ3A 3DMJA 4RNNA 4LRFA 2J6TA 2B8PA 4CYUB 1LFWA 2DH7A 3AY0A 4QWAA 2Q3PA 2AX1A 2JSXA 3BN4A 3KK1A 4FXWA 1VRQC 1LWFB 4ZVGA 3N0VA 2LEAA 1Y5IB 1VOMA 2VF3A 2W2PP 5D4NA 1VDHA 3ZZ0A 3ICLA 2OHDA 2CJAA 4EBCA 4OZ1A 4QR0A 4Q45A 2XSFA 4NL5A 1IKYA 1RT1B 3DRRA 2YWHA 4B3TF 3T5JA 5A76A 3N6LA 5CYJA 2LEPA 2N7YA 1T8EA 1YSJA 2D41A 3PYEA 1DQAA 2R7VA 3DOLB 4GMKA 4ECQA 2RILA 1WKJA 4F4KA 4LBIA 4DV0F 3I32A 3KNAA 3CCMS 1O0PA 4N8OA 2V4JA 2H54B 1TAQA 4CIOA 3I0SA 4PWUA 4EMDA 3R5GA 1FA0A 1ZS6A 2R7UA 4LF4J 2BJ9A 3Q22A 4V19X 2M70A 4N77A 1IR0A 1N34F 2OAUA 2YNGB 1QUPA 4IDKA 4OHVA 1C1BB 1TKTA 1NHVA 1UJ6A 2FQQB 3GJRB 1BUXA 3OVSA 1ROFA 4LF8J 1REGX 4Q7AA 5KFHA 1M5SA 1T9XA 1CJVB 4AQYF 2QA1A 3W9IA 4DPXA 1V3RA 3VGUA 1IKXA 2FIUA 5T14A 4XPEA 4QQBA 1DTQB 3C15B 4WCEQ 1FFWB 3C6TA 3VF0B 5B0CA 2XS2A 4V1Ak 4JI2F 4FF3A 3CJKB 1RQ0A 2XZWA 4WK1A 4E8UA 5JVHQ 2VJUA 1UEUA 4NXNJ 2UUCJ 3GR1A 2J5AA 4QYZJ 3H42A 3BGOP 2GIQA 1WHXA 3VZHA 1S49A 2I0XA 1WF2A 1S79A 3H4DA 2FLPA 4TYBA 2JX2A 4B9VA 2R7QA 1CJKB 2CQGA 2KZZA 1C1CB 1X4BA 3US5A 1OPZA 2OJ3A 5E3AA 1D3WA 1FJCA 4CLWA 2G2ZA 1S7HA 2VG6B 1HL6A 5J1EB 1AW0A 5KFRA 3HSZA 1SL2A 4DLGA 1R0AB 3UD5A 2NQPA 2V8DA 2AJQA 4J9UE 2OFHX 1VBXA 4ILLA 3MR3A 4ZIVA 2XSJA 3M8YA 1IBMJ 3PY8A 1S1VB 4MIBA 1SH0A 2YNHA 3HHEA 4YY3F 2BW7A 4NYZA 1RHKB 4ZVQB 1SIWB 3CJRA 3Q8PB 1XN9A 4C4WA 3MMCA 3NAIA 3QLHA 3I82A 2RS8A 3QFHA 3FK4A 3J7ZT 3M9OB 2UVRA 1LKZA 1OSDA 4KGXB 4Y2MA 2E1CA 4U7CA 2V8PA 1TUGB 5D77A 1DTTB 1WG4A 4FVMA 4OI3A 2PI5A 3LWMA 1RE1B 5K8NA 1HQEB 5A8WB 2CJXB 5LSOA 1EKSA 4WJBA 3NCRA 3W62A 2B9XA 1S0VA 4X4UA 1CPZA 1WF1A 1RAFB 5CH7B 5K9FA 4NYPA 1Y9OA 2OFGX 8ATCB 3IRXB 3LWLA 4MFBB 1PCAA 1VQMS 4LF9F 4PZVA 2LECA 3PKMA 1KFDA 4F36A 3SZ2A 4F3MA 1TAUA 2GJFA 1KONA 4ZVEA 2HWHA 3OTBA 4OX8A 1RT3B 1X60A 4Q43A 2HIQA 3CDEA 3A8EA 3HX9A 4C97A 2W1BA 3RB4A 3DLEB 3GCXP 5IV4A 3T1HF 4JI2J 4YFUA 2G2OA 3D3CJ 2M4MA 1SC3B 2D9OA 3E8OA 3HHLB 4KKOB 1NK5A 3BM7A 4YDXA 3WDOA 1SVDA 2HKEA 4FNHA 2RB7A 2HLTA 1HBNA 4JV2A 2F4VF 1WHWA 1AYEA 2DNNA 2LCWA 3MM6B 3EZUA 3H0PA 4B9TA 1FESA 4PXEA 3MM8B 2FGOA 4YR2A 1NK7A 1D1UA 1VQ7S 4PWDB 3M4XA 4RR5A 2MQLA 3KLVA 4FKYA 4P75A 1YBAA 3UD4P 3JB9k 5CCMA 2GHWA 1Y4ZB 2L3MA 4ATNA 4ZOSA 3PXGa 3TZXA 1KEKA 5HP1B 4IG3A 1DQ9A 2DGTA 3C3LA 3I31A 3LP0A 2J9EA 5ITHA 5L46A 4USKA 4RUCA 2XNRA 1HMVA 2XY6A 4K0KF 1S9FA 3NP5A 2XZTB 2F8HA 1JLEA 1RWNB 4U8YA 1NDKA 2IIHA 1G6BA 2F8EX 3OXLA 1H6KX 2WK4A 4DR2F 3DOMB 2DD8S 1MG7A 2BR0A 1F2HA 3TX0A 4OZLA 3UCUP 3CDUA 3PX4A 2YX7A 1N52B 4DSLA 3CJQA 5K14B 5F41A 3P4UB 1Q1KA 1X0FA 3JAMU 2PO4A 1WELA 4JI1F 5D3GB 1FK9B 2Z2LA 5KT2A 5EWGA 3VAFA 2ZBPA 2BQ3A 1MMDA 2QA2A 3DOKA 2OUGA 3EWGA 2BM1A 3G6ES 3W3SA 4ED5A 1R43A 2PC6A 3CCWA 3BREA 1MU2A 4CP5A 3E51A 3DM2B 1UVKA 1KRPA 3M2VB 4A8XA 5LJ3Y 2YKMB 5KT7A 2MQNA 4F2SA 3EDQB 2PI4A 3ZZOA 4NOHA 2A1BA 5B09A 2LA6A 4YB5A 4NLPA 2FVPA 3BV8A 4OZ2A 3ZO7A 2AYGA 2B7CB 4KAIA 3OTOJ 4OJ1A 4RNHA 3MM5B 5F3ZA 4ECTA 3UCGA 4Q2LA 4U96A 2IDEA 3RRKA 2WRMA 5KT3A 4DFKA 1BD6A 2VQEF 4RKUC 1VC6A 2EPIA 2KI2A 3U02A 1X31C 1T03A 2DHSA 1WJ9A 2N4DA 1HQ2A 1KD1T 2QA4S 1PAUB 1S6PA 2LDIA 3QGPA 3TX8A 2UXDF 3A8JA 3MAAA 2OD4A 1PJ5A 4HDGA 4HR2A 1VLYA 2EFPA 2V6AA 3HJFA 2ATLA 1VS3A 4N47A 2IMOA 3D0HE 3PFOA 4NA3A 5IFMA 2HVEA 3ENWA 5F8GA 4DG1B 3CJSA 1NJIT 1HA1A 3W63A 1RHMB 2P6TA 1NJWA 3NKYA 4B3MJ 4WKRA 3EYZA 2OPSA 1WDDA 1DURA 3JSMA 3PVXA 4IRKA 1GT8A 3OLBA 1OWXA 4WIQA 2H5EA 2I6WA 3BH6B 1HBMB 3QYYA 1FKOB 1UVJA 1RT7A 4OFZA 3SDEA 3OPKA 4I4BA 1RTIA 1JNRB 5L1LA 1YJ7A 1Y10A 1I1GA 1X8DA 4DPTA 3QATA 2DRAA 1ELOA 1RA6A 3T5HA 4CCHA 3B78A 3D1HA 2V9KA 1N0UA 4M95A 2ZITA 3OR2B 4JV5J 4DSKA 5EHHA 5AT1B 4TXSA 2L08A 4C8YA 3H2UB 4JI8J 1YI2S 1HR0F 3SCIE 3I56S 2VFSA 1VQ6S 3L4BC 3OL6A 4DL0C 2VASA 4ZPAA 2FDNA 4NLWA 3F73A 3CC2S 3N4WA 2CNKB 1UWBB 2VDIA 3HHKA 2CQBA 3VGSA 2L48A 2JEIA 2MHEA 3GFHA 4X4QA 1AZSA 1C0UA 1T9YA 5GADU 3I0RA 4YHHJ 4ZHRA 2AJ4A 4MIAA 4LR8A 5DDRC 3I55S 5LT5A 2VQEJ 5ETTA 4WP3A 3FSXA 4KYZA 3UN2A 5CYQB 3CTRA 3MCNA 2UXBF 1EETA 2ZDPA 2UXDJ 5LMNF 2DPIA 4NRTA 4I2QB 1N88A 4HL9A 5DDQC 3GIMA 2VQFF 3NS6A 3ZZPA 4NCGB 4OMFG 4A8YA 4QJVA 1FXLA 3P3DA 1LQ9A 4PKDB 2C2KB 1HNIB 2FHJD 2IRUA 1X4CA 5G0RB 2IYGA 3B54A 4K7QA 5JUMA 4F2RA 2OPPB 3CCQS 4NI2A 4ILRA 3BGLA 2B7BB 1FEHA 2DISA 1NMEB 3LF0A 2YY3A 4ZVPB 2JVOA 1S9EB 3BQ2A 4C0OC 2YNIB 2QSFA 1VYAA 3FUYA 3HZEA 3QPIA 3OXGA 2ROPA 4OYOA 2UVVA 5KFBA 3R3TA 2CJYB 3TUZC 3GILA 2DR9A 1R8CA 3GIJA 1YX2A 1D8ZA 2EVZA 1UFLA 1XJWB 1HLWA 3L9ZA 3FNNA 2VUGA 3QIPA 4NLUA 3MMJA 2BZ2A 4YB7A 1GX5A 2HS3A 2RUGA 5KFZA 5DGBA 2VG5A 4YDDB 4AFFA 4B9LA 3MECA 4PG6A 4TY8A 5HSPA 2UU9J 1KOOA 4ENOA 4YUDA 4BWMA 1O6XA 2HZVA 4IH5A 3B82A 4WZMA 3ZTOA 1WHYA 5I3UB 2GVZB 3D6MB 3HDSA 5GAEI 2O66A 4M5KA 4ED7A 3KLIB 1RISA 5LL6d 1JQGA 2BE2B 1TL4A 2RJZA 4DR3F 5DRKA 1HNWJ 4HHUA 4K50A 2XI2A 3CJ3A 2C2OB 4ZN1A 3BSCA 2OD6A 2ACMA 2DXEA 3EVWA 1EB0A 4U67Q 1T11A 2AYMA 2DR6A 2YWEA 2VPZB 2ZC3A 2J9CA 1B64A 3RBDA 4I0WA 2RF2B 1GTHA 3CCTA 1VBKA 4CO4A 3J81j 2GC8A 4YR3A 1FWPA 4H4KC 4FKXA 2P9CA 3CWJA 3R7SB 3ETMA 4DV6F 4PWWA 2F63A 2KJVA 3BH7B 3OR1B 5EWFA 1FVSA 1X5OA 1S1XB 3PRBA 2K1RB 2UXCJ 2N82B 2W2OP 4TU7A 4P2MA 2MJNA 3D3BJ 1UVLA 1RWWB 2R2TA 4RUAA 1R0BG 4X62F 3HMJG 3BQ1A 4JI7F 2HWTA 1QUVA 4WFXA 2V2QA 2C2NA 2AEJA 2P6SA 2HBYB 3QO9B 2WVEA 2XLJA 3I9V9 2A10A 1JJ2R 3WX4A 5J2QB 3DGPB 1BMQB 1X5TA 3W7BA 1TFWA 3D0IE 1KOHA 2P9EA 2Y0BB 1QY7A 4ZN3A 4FP9A 4ALZA 1F5AA 3S01A 3EMTA 3FBCA 1MN7A 2CQPA 2A6OA 2OIHA 4C6AA 3MDFA 1R3NA 5C42A 3EXYA 2GW8A 4HACA 4RW6A 4K4WA 4KV8B 2UZAA 2Q6CA 1RGVA 3CO9A 4HTIA 4EZ9A 1M1GA 4ECRA 3SCJE 3R27A 4CTAB 1XMOJ 1VJWA 4PQUA 4C11A 1YJNS 3TQ1A 4AXJA 1KTVA 2M52A 2Z2MA 4P2FA 3L7PA 2DNZA 1TQLA 4X64J 3Q2SC 1CULA 4A4JA 1YJUA 2QGFB 2B43A 1FFGB 2IC3B 5DLFA 1ITPA 2CQ2A 3HHLD 3MR2A 1QDUB 2M9KA 3FEXB 1NO8A 3C46A 2H5IB 3HT3A 3FSIA 4G1QB 1PIEA 1LFPA 2YKQA 1NEEA 3SYZA 2LQBA 2P5VA 2YX4A 1E6YB 3CULA 1IJFB 1BGXT 2F9JA 3M6WA 1UEKA 5GVQA 4C8OA 1Y3KA 4N7TA 1FCAA 2B9WA 4JI6F 4JOUA 3TAMB 1UFWA 4W4MA 3CDAA 2CNNB 2FVRA 3LUYA 2NXEA 4HT5A 4YN3B 2ZFHA 3HVWA 3KMQA 4ID5B 3MEEA 4J9MA 4M5DA 4QIGA 1JX4A 4WU3A 2UUTA 5CYMA 3IR6B 2CXEA 2JNJA 3VHQA 3RAQA 4HI2A 1VQ9S 1SQGA 2EBEA 1TU0B 1KSPA 1BWEA 2DGXA 2IAJB 1QD1A 3E01B 2XM3A 1RKJA 2MKKA 4ZK7M 1UPPA 3HT0A 3O44A 2E5GA 1SQEA 1YBUA 2DRDA 1TUWA 2XMWA 1TL1A 2BANB 4NYOA 1CJUA 3DRPB 4M8LA 2QZ8A 2FJVA 3AH6A 2V2KA 2Y8WA 1FTCA 4M5JA 1YLXA 2HNDB 2CQ0A 3EJMA 3NNHA 5IS2A 4KHRA 3C2PA 1VRUB 1Q16B 4UUXA 1U47A 3G71S 3DMJB 1HFEL 2CPJA 3BDPA 5J2MA 2R8IA 4CLKA 2AEMA 3PYFA 2H4WB 3KK1B 1IJEB 2HHSA 4C7QA 2GJ2A 5C24A 2DGVA 2PIIA 4O0IA 2ALYB 3CJTA 4ICLB 5F8NA 3OXFA 3ZFVA 3Q8RB 3EGZA 4MKVA 2ZNYA 3DLJA 4J9LA 4D3HA 3RG6A 2AZ3A 1H73A 1I3OB 3FEZA 1EX8A 1FNMA 3GYGA 2ZM6J 4A8FA 4ZJQA 4GO5X 2RQ4A 1GK8A 5KFTA 3A3OB 1KQSR 3KJVA 1YZ7A 3QWPA 5EWEA 3BO4A 2DIVA 1YKWA 2IDLA 2KYZA 3D6TB 1NAQA 4DPUA 4P2SA 3MEDA 1YJVA 3I0SB 2R7WA 4ZCMA 1C2PA 4MMOA 1SI9A 2IVMA 3WIVA 2OTLS 2GGPB 4OHZA 1NPRA 5HQLA 2PN6A 1N36J 3BF4A 4B9UA 2AZ1A 1PYOB 2MSSA 2EKNA 3HD1A 1S4EA 1MW7A 1UTAA 3D68A 2HFNA 1U8SA 3SBMA 1TKTB 4QZVB 1ZTTA 2JLEA 4E0DA 3VWSA 5HQ8A 1UVNA 2WSCC 1D9AA 3DOLA 1YK9A 4USIA 2CA9A 3UDEA 4UOFA 3LAKA 2QLJB 4ES1A 4DV2J 5JJBA 5KT4A 3PJWA 3JXOA 1HD0A 4DR5J 4KSEB 7AT1B 2MTLA 3D28A 1PC5A 2KO1A 1WSRA 2DHHA 2XNQA 3HHNB 2H1YA 4O3PA 4DPYA 1OQ3A 3KHGA 4EK2A 4F67A 4J5OA 3CEDA 3FEYB 1RAJA 3N01A 2YNGA 1FWLA 1X0PA 3PEHA 4WFZA 3RBZA 3K59A 1IVZA 3OFHA 4P52A 4BS2A 1EAYC 4KR0B 4GVLA 4Y2KA 3DYAA 5B0DA 1RAOA 2ZEJA 4IR9A 2HLUA 3EVMA 3V6DA 4JI4J 5KFUA 1LWXA 4QIFA 2XSJB 2DPJA 2ZOFA 1QTNB 3IO1A 5K5MA 2YNHB 1LW2A 3RW6A 2VG7B 4EZ6A 4KGZB 3TZYA 3BQ0A 3VTIA 2KT5A 1FJ7A 3QLHB 1UW9A 4X66F 2N7CA 3PO5A 3DC2A 4B3SF 3ISND 4ECWA 4F50A 1CJKA 1J5EJ 4KE5A 1XK8A 1C1CA 4NLVA 4JUZA 3GFYA 1S97A 3HSDA 4ELTA 3JSYA 1K44A 2V2VA 3KUHA 2VG6A 3O5TB 2VFTA 4X65F 1NKBA 1RHUB 1OPIA 2VU5A 2X1BA 2XY5A 3PIPQ 2I8EA 2RNEA 4EGLA 2B51A 2LXFA 1IR2A 4RW9A 3M6XA 1S1VA 1HWUA 5C7PA 2ZWPA 4X4PA 1SC6A 2BW2A 5HBMA 2W4CA 4U6PA 4JV0A 3AHPA 2QN6B 4I6AA 2LA4A 1NXIA 4ZMMA 5D78A 2MZRA 2O1PA 2DNKA 1BQMA 4J9QA 2DNRA 2CJBA 1U25A 3OSNA 2RHSB 3CJ0A 3VQTA 2W01A 1JLQB 2YKNA 3TYTA 4IO1A 1EJ7L 1KS2A 1HBNB 1DTTA 3HFVA 4Q8EA 1DHMA 2V9WA 3THTA 3CUNA 1Q5VA 3PJ9A 2R8KA 2MKYA 3BR8A 4RNOA 2HHWA 1O8BA 2BE9B 4MT1A 3QGHA 1BWVA 1TV6B 4ZJOA 4LMZA 4AXIA 4MFBA 2DO0A 2FHMA 4NLYA 3FBEA 2NPIA 5BJRA 4IG3B 5ETNA 3KG4A 1IR1A 2FJAB 4P73A 3LP0B 1RT3A 1K0VA 2VFUA 1KC8T 3CMQA 1HHQA 5IWAF 4FYVB 1HMVB 1RWVB 3DLEA 4Q44A 1P1TA 5LJ5Y 1HW8A 1VQKS 1JLEB 3SSRA 2I9SA 2XTJP 3GLJA 4DR6F 3BDEA 3D6FB 4W90B 3D2WA 1FRMA 3LOUA 2JEJA 1KQFB 5KG4A 5CZVA 2KM8C 1Q86T 4GC6A 4P72A 4JI5J 4PWDA 2RHQB 2EEYA 2HBRB 4OJGA 3PRVA 4TU9A 1T95A 4AL6A 3BEGB 3GE9A 5KFQA 3NGDA 5I42A 1DY3A 2GS8A 3GB0A 2CIMA 5J2NB 2MSTA 4M5NA 5B0EA 2HS4A 3AT1B 4TY9A 4IRCA 1B0VA 4KO0B 1F60B 1I6JA 1BE4A 3ENVA 2KVIA 4G1PA 2ASYA 1MU2B 5IT9Y 5B7WA 2RVJA 2C2RA 4B3RF 1CQMA 5LSLA 3NBPA 1ZM3A 5KFXA 1RWPB 2MY7A 3R5AA 5HQMA 2DXFA 4Y3CA 5C2GA 1D9DA 3DOMA 1U6FA 2P2CB 3IG1A 4OI6A 1QVFR 4ZPCA 3QJPA 4KJIA 4DV7F 5IV3A 1T7PA 1K8AT 2NSBA 1XEZA 2RSQA 2XWXA 5FDLA 4ZLLA 4H4OA 4PPDA 3KLEB 2OPRB 3MEGB 5D3GA 2IM2A 4ZKAA 1T03B 2M0GB 2DHGA 2V94A 4LIWA 1S6PB 1WOOA 1WWHA 4N41A 2WVCA 1OY6A 1X4EA 4NE9C 3KDOA 4MAKA 2V4RA 5A6WA 3N5FA 4LRAA 2R8GA 4CH1A 3OFEA 3DM2A 2V68A 4KT0C 2BQRA 2HRYA 3C6UB 2V34A 5L38A 3GTYX 2OP5A 3F44A 2XHCA 4ANCA 4OYIA 2DHAA 4K5RA 3PRDA 3G82A 4ANEA 4ZLNA 3K5PA 4RJVA 3MM7A 1MN9A 4DR4F 2IRYA 4K4YA 3GFXA 5KT5A 1F3FA 2KXHA 2OPSB 2FJEB 3HJVA 1ZYQA 2R9LA 4QWBA 5KFGA 1XTZA 3POTA 3G6YA 4X4OA 5K8OA 1AFIA 1VQPS 1DRZA 1KDNA 2F4FA 1SJQA 1H98A 2HHQA 2W8LA 1BY9A 2UP1A 3OTEA 3M8RA 1RTIB 4IOAQ 4LF7F 1ZM9A 3D0GE 4DX8H 4GVBA 4CZCA 5KFLA 2C3PA 2AU0A 1SIZA 4DG1A 4DBQA 2CZVC 5HANA 2XQCA 2W9CB 2EBGA 3X3UA 4J9KA 3L95X 1HHTP 1SH2A 2YKAA 5A8RA 4USWA 4KTQA 3MPYA 2B4PA 1HNZJ 3I87A 2CDQA 1C0UB 2OLWA 4XTTA 2DTJA 3I0RB 1MMNA 4ZHRB 1PAEX 3EPGA 2ZH6A 2NS1B 1ZM4A 5DG7A 2FVQA 1T02A 2VBYA 2MKIA 3HKZD 2X3GA 4A47A 1F1BB 5KOWA 1EETB 1B0TA 1H3DA 3EPIA 1RK8A 1QAIA 2HYIB 1DQ8A 4DFJA 3ET6A 3DN9A 2QSWA 4PG8A 3DXSX 4TQSA 3IM8A 2X7IA 3DU6A 4DWIA 1XC9A 4ED3A 1FI4A 1G4CA 1HWIA 2MLZA 4DV4J 3L09A 3D67A 3KK3A 4NI2B 2K3KA 2ZJQQ 4Y2AA 3HPOA 3KLFB 4MYUA 5GADI 1P9QC 3NCPA 4LREA 4GKKF 2OH2A 2QMWA 2PGCA 4WP8A 2CZ4A 3H59A 2ZH3A 3O1LA 4X4SA 1UJ5A 4K4VA 2PT0A 2AYBA 2F7VA 3HXMA 4C8NA 2KB2A 3VZIA 4Z2XA 2Y1LB 2MB0B 2ZH5A 4I7FB 3PW5A 3MOJB 1RDRA 4UY8T 5RUBA 1YBTA 4OJHA 4DUYF 5G0RA 3QIPB 2N3OA 1UJ4A 2OPPA 2IHR1 3CCSS 3MECB 1IUJA 4TY8B 4KC5A 2FJBB 2C28A 2JH3A 1NNDA 2AT1B 4AL7A 2VV5A 4U9RA 5KFYA 2GMLA 2IPOB 4P7TA 4CRJA 1U0SA 6AT1B 2ZOMA 4BWJA 2Y9HA 1IKWA 3ENAA 4O3OA 2KFZA 1N4LA 5LSRA 1RBOB 3RJMB 2DGQA 1N32J 4KPYA 3C66A 2HIYA 4EEYA 1FDAA 1JLFA 4P9SA 1AUSL 3IM9A 2HNZB 3FKBA 5B0BA 3FBBA 3UCZP 2ZJRQ 1R6YA 2JOQA 2NXJA 4USMA 3EX7B 2CVEA 5GAGU 1ACMB 3O3LA 4OZNA 4DUZF 4C48A 5B0GA 1Z1ZA 8RUCA 4DFMA 2UUBF 1T05A 1SV5B 4NXMJ 5E3RA 2DCUB 3R97A 2DKOB 3T41A 1X4HA 4ZVSB 1Y7PA 3CGIA 2KDOA 1RWXB 3K5OA 1NK8A 1I94J 2H5JB 4PXCA 1MLAA 2QFIA 1FRXA 3AB2B 4WXOA 4TLQA 1FNXH 2LLZA 1MWYA 1RXOB 3OJUA 3BSAA 4M94A 1KN6A 3SCLE 1VBZA 2MEWA 2ZH9A 2YQ0A 4JP8A 1WD6A 4Y2CA 4FXVA 4I67A 1N5VA 4LFBJ 4X84A 1XMQJ 3BZQA 4X2BA 2VONA 1SPBP 2KHDA 2HHTA 4DL6A 2ASDA 2XS7A 4N76A 1RWUA 1E6VA 1UA0A 3PKYA 3RBXA 4XAKA 3I5BA 3HD2A 4WK3A 1U45A 2RF2A 2LU2A 2C2MB 1WI8A 2GX8A 4ECZA 3GMGA 4HT7A 2RDDA 5DS7A 5B0FA 3CCES 1L5UA 2IM1A 3OR1A 5C25A 4I69A 1S1XA 2HNYA 1CJTB 5C42B 1NU4A 4L74A 2YPYA 2W9BB 1K47A 3UDLA 4QU7A 1ZBTA 2RQMA 2YWFA 2Y1JA 1RAAB 2CUYA 4IKAA 3M9NB 1XNQJ 4F04B 4WYWA 3CNQP 3W5XA 1MROA 3HI9A 4ED1A 1N5TA 3RRHA 4PQUB 4C11B 2DGWA 3KKFA 3BPSP 3DNCA 2FVCA 2G2YA 4MJKA 3WBZA 3QO9A 1JK9B 3L3CA 1VQNS 3JSRA 3QT5A 2MMYA 2CPEA 2K06A 1NJXA 3ONQA 1NK4A 3IXQA 5AXNA 4P2XA 5J2QA 4A8KA 3DGPA 3J7A1 3OUYA 2IFXA 1CULB 1RABB 5EN1A 2KKHA 3RR7A 3JSBA 3A4TA 2A2CA 2K3IA 5T41A 1WEZA 1JMTA 2GFFA 5AJ3F 3HVRA 3VGTA 3P8BB 1VIOA 2VB6A 3C16A 4C0BA 5DM6Q 2GQQA 1HNXF 4UT4A 1H7WA 1EHWA 1VISA 3ZTRA 3DLGA 2KRRA 1DLOB 1T3NA 5HJXA 1ZTWA 1S6OA 1U4BA 2VA3A 2DH9A 2MZJA 2ZH7A 4WKYA 3RZAA 4TYAA 2MYFA 3MAHA 4FPRA 3QBCA 3H20A 2DNGA 1JLBA 1VHFA 1VRTB 2ZBIA 1B99A 3JQJA 3C8YA 5CYMB 2R8JA 1B3TA 5E3QA 2MQQA 3ADAC 1WC1A 4PG7A 3PR4A 4FXDA 5AXMA 5A0YB 3FZ2A 4Q0BA 1WI6A 3ETOA 1TL1B 3ILIA 3HVTA 1CJUB 1E6YA 1JNZB 2YNFA 5IQQA 3AD7C 2R42A 3GV8B 3GZ7A 3R6GB 3CW2C 3MPWA 4Y0FA 3PNIA 3TAMA 4W92B 2AWZA 4IOCQ 3J7Z5 2M5YA 2JC0A 4LF4F 3R5CA 5J2MB 4M5GA 1KNZA 4WWSA 3R6LB 2ZWOA 5ETPA 3IBCB 1TK5A 1RU2A 2FVSA 1LXJA 2CJQA
chains in the Genus database with same CATH topology
2VODA 2R7SA 4LF8F 4X62F 3DRSB 3HMJG 3BQ1A 3MR5A 3D1QA 3ZZTA 3T1AA 3FVYA 3PW7A 4JI7F 2HWTA 1RI7A 5KG2A 4MK8A 1QUVA 4WFXA 2B4UA 4AUKA 3NCQA 4BDPA 1YWXA 1UWBA 5I3PA 1UVIA 1RT5A 2RQKA 4ELVA 3M2UB 4QWEA 1H2TZ 2E1MC 4J9RA 1SJ1A 1ZM2A 1URNA 2BANA 2P6SA 3CVKA 3DRPA 5E3PA 4FNIA 3QJLA 1C0TB 2COLA 4FN5A 2AW0A 3QO9B 2KN4A 2JEFA 2Y0SD 4C9DA 1FERA 3VCDA 4WF9Q 4FBTA 5CCLA 1F2GA 4IQXA 2UUAF 1U1NA 4F4ZA 2RU9A 3I9V9 2A10A 3MM9B 2XLJA 1JJ2R 3RRGA 2HNDA 4RW8A 2R4FA 4JI0F 4JI5F 3WX4A 1HD1A 5J2QB 1VK3A 3P96A 1UEVA 1X5TA 2NREA 4KGMA 3KJVB 3W7BA 1YGYA 1TFWA 2JHEA 3D0IE 4IFVA 1KOHA 2P9EA 4K59A 5AE2A 3B4DA 1TK0A 2HHUA 2UV8G 2MXYA 1RTJB 1QY7A 4LVNP 2NLWA 4FP9A 4AE5A 5HL7Q 4NXNF 4ALZA 1RA7A 5CYQA 3D5MA 2JFKA 1F5AA 1TVRA 2B4OA 4XK8C 3D54A 2E5HA 3S01A 4K4TA 2UUCF 2DJWA 2W25A 2Y1RI 3HHDA 4I2QA 2Q1LA 4P6QA 3TVZA 2ZE2A 4NZ6A 4MKBA 2V5HG 2CQPA 4I68A 2XGQA 2Y1IA 1WEXA 2OIHA 3H8YA 1N48A 3MUMP 3G9CA 1VQOS 2RQCA 3MEDB 4IYQA 3MDFA 1R3NA 4MH8A 5C42A 2FJXA 4NCGA 3EXYA 3DHWC 1XNRF 2GW8A 3E3XA 2HGNA 3VQSA 1WEYA 1G3OA 1K1SA 4KB7A 1N8RT 1U1QA 2K7KA 1Q8BA 4O23A 2L9WA 4LF6F 1CLFA 3M2RB 4OI2A 4RW6A 4K4WA 4KV8B 4PR6A 2UZAA 3MHYA 2Q6CA 1TL3A 1LWCA 1WF0A 1RGVA 2BQUA 2J6SA 2FLLA 3VAHA 3CO9A 1HNIA 2YX1A 4DF8A 1XR7A 4ED8A 1U1MA 4HTIA 3T6JA 1W25A 4ZLPA 2R7TA 4EZ9A 4HVZA 4ECRA 4ICLA 3SCJE 1U48A 4WE1B 1RT2B 3R27A 2HMIA 2V8HA 4R0JA 4CTAB 2BRLA 2EW9A 2KFYA 2VG5B 4LT6A 4A8WA 2HVIA 5KG1A 1VJWA 3GYNA 4PQUA 2KT3A 2P9GA 4C11A 2IA6A 3H98A 1Y3JA 3DFEA 3RAMA 3LQVA 4NLQA 4NWBA 3TQ1A 1YJNS 2JZ5A 4AXJA 1CC8A 1KTVA 2M52A 4IH7A 4MIWA 1FDNA 1ZZNA 2N3LA 3M9MB 2IYIA 2I1RA 5DQIA 3NG8A 2F8MA 2QO3A 2Z2MA 3DDNA 4IUFA 3NLCA 1JLCB 4LUBA 5IQ6A 4O4GA 3OL7A 2GIRA 3U1NA 5E41A 2KRBA 2E66A 3L7PA 5GAEU 2J0XA 2K8GA 1IBMF 3DCAA 3V4IA 1WACA 1S9EA 3CXCR 2DNZA 2YNIA 1D0EA 2BM0A 4O44A 4C0HA 2VH7A 1FHTA 1TQLA 1TKXB 3RBEA 2LYVA 2XY7A 3Q2SC 3MURP 2EFNA 1N5YA 1S1UA 3MGJA 4A4JA 4UQGA 1P8GA 1YJUA 2KM8B 4BC9A 4C3LA 1DARA 3OVAA 4DV5F 1KVJA 4OX6A 2RIJA 2I5JA 1RT4B 3HZGA 4K5SA 2B43A 3U27A 4JV1A 2BDPA 4C8MA 1K9MT 4QR1A 2IC3B 1GQEA 1FF2A 1BQNA 1K1QA 5HROA 3EGWB 1QSYA 5DLFA 5KTQA 1LW0B 3M32B 2CQ2A 5DJBA 4ZP8A 1HNVB 4H4MB 1TL5A 2PA3A 3ZZZA 4F26A 3KHLA 2ZH1A 2B5JA 3HHLD 3CIMA 4BHQA 1SJ3P 3GIKA 2OMOA 4QR2A 1TUVA 3RR8A 3MR2A 1R8AA 4UUWA 1IQZA 1QTMA 2M9KA 3FEXB 1NO8A 1FKPB 2J9DA 3C46A 4TNOA 3VAJA 1L3KA 2GGPA 3U7JA 3QAEA 3DXBA 2HGMA 4F3OA 1P1LA 4H54A 4OZ5A 1U6BA 1NH8A 3SV3A 3DLLQ 4ES3A 2ZKTA 3MCSA 3HT3A 3NAHA 3FSIA 3ENQA 4G1QB 4QW9A 1HWKA 1LFPA 2HG4A 2YKQA 1NEEA 3SYZA 3H5UA 1JJ4A 2XLKA 2LQBA 2P5VA 2YX4A 1E6YB 3CULA 4A8MP 3PHEA 1IJFB 1BGXT 3IGVA 2F9JA 1U24A 2DNLA 2BOPA 5KG5A 1R7IA 3M6WA 4ID8A 1ZETA 5L39A 2XBPA 2ERRA 2RRAA 3T5KA 5GVQA 4C8OA 3OTCA 4LSLA 1Y3KA 2ZH2A 3MR6A 3M6VA 2EFVA 1FCAA 2B9WA 1TKDA 3N6NA 3TO8A 4CO2A 4A8SA 4JI6F 4JOUA 3TAMB 1UFWA 3NNAA 4PXBA 1S4FA 3OFFA 3CDAA 4LF5F 3PZPA 3LP2A 2FVRA 3Q2TC 3LUYA 2C2EA 3TAQA 4HT5A 1N5QA 3L7OA 4Y34A 2ZFHA 1U1LA 5I3UA 3HVWA 5DGAA 2POKA 1TKZB 5HI7A 4ID5B 3MEEA 4C3KA 4E98A 4J9MA 4RW4A 3KMQA 3DYAB 4M5DA 1WG5A 4QIGA 2RU3A 1JX4A 3LAMA 4WYLA 1S6QB 4PXDA 4WU3A 4OZ0A 2UUTA 3SMZA 3CT9A 3P49B 3KLIA 4URSA 5CYMA 3IR6B 3V6DB 3M8PB 4ZS6A 3RAQA 4HI2A 3PIOQ 3IRWP 1RJJA 5GMKa 1VQ9S 3LALA 2BE2A 1CG2A 2M7SA 3MXHP 3AA8A 3M05A 1UL3A 2EBEA 3W2WB 1SH3A 3SSQA 1QE1B 1VC5A 3CD0A 1KSPA 1HBOA 4OIXA 1BWEA 1IBKF 1N54B 4HH1A 2DGXA 1LW2B 4Y6IA 5M2PA 3I96A 2IAJB 2ADCA 2IMWP 2CQ1A 2EK1A 3E01B 3IR5B 1HWLA 1KQGB 4NLOA 2BVZA 5M2RA 5IT0A 2MKKA 4ZK7M 2G4BA 2VOOA 3QJJA 2LXUA 2WBRA 3DRXA 3O44A 2V8VA 2EFGA 2E5GA 2HAIA 3DLKB 1SQEA 4CT9A 1X4GA 2HWIA 5F9NA 2VPXB 5LMUF 2C3MA 2XWYA 2J0WA 2QE5A 3HKWA 5A2QY 2XMWA 1SJRA 1TL1A 3TVKA 5A8KB 3BJYA 5CXTA 2BANB 4NYOA 4QOTA 2VA2A 3DRPB 3TW0A 1Y5NB 2ACYA 4M8LA 2O01C 2QZ8A 1VQLS 3KG1A 2YQ3A 2FJVA 3AH6A 1NZAA 2PFFB 4EFAC 2V2KA 4NLDA 2XMKA 4ZPDA 1B0PA 1FTCA 3CSKA 2B6AA 2HNDB 2XMTA 4RW8B 3CD6S 2CQ0A 3EUNA 4Y28C 4DL2A 4UY85 1K0TA 1KLMA 2ZD1A 4NLTA 3NNHA 2V4QA 3K7RA 2W8KA 3LP1A 5IS2A 1JLGA 3T5LA 2KXNB 1S72S 4IFVB 4KHRA 3MD1A 4CO0A 2KG0A 1VQ4S 3C2PA 1S76D 1VRUB 1IM4A 3M8SA 4DFPA 5T7LA 1Q16B 5IZHA 3OL8A 3PV8A 1IKVA 4UUXA 1U47A 3IBWA 1VGYA 3G71S 4DN0A 1Q81T 3DMJB 1HFEL 2CPJA 3BDPA 2F40A 2JFDA 5J2MA 1PC4A 5HLFB 2CQDA 1IBLF 4IFYA 3M1VB 2R8IA 2PD1A 3WC0A 2L9DA 4YEAA 2K1RA 1HQUA 3KK1B 1M1KT 3KHRA 1IJEB 2WHOA 4K4ZA 2BABA 2HHSA 4KGKA 4DOZA 3FSYA 4C7QA 2GJ2A 5GAHI 1HNZF 2K2PA 4RW9B 3IR7B 1KQKA 1JKHB 4RW6B 1UETA 2AJFE 2DGVA 5C24A 4YB1P 3H25A 3QZ8A 2PIIA 1TL3B 1LWCB 2IVYA 4O0IA 2DBBA 5KFMA 2ZZMA 3OHBA 2G0CA 2VG7A 3PJXA 4X4RA 3PW4A 1YRUA 1FNOA 4FS1A 1SL1A 5IM0A 4J9SA 3CB4A 5HBMB 4XIUA 1O51A 3OFGA 1TZ0A 2BRKA 4OLOA 4ICLB 2CQHA 3PX0A 5F8NA 4RWXA 2HMIB 3GV7B 2A2DA 3OXFA 5EDWA 1S0OA 2E9RX 3ZFVA 3FMBA 3Q8RB 2HPUA 3EGZA 4DV1F 4DL3A 4HH0A 2LQJA 2ZNYA 3DLJA 3JYTB 3IWNC 1H38A 4J9LA 2XMJA 3HVAA 4D3HA 1C0TA 1GX6A 5DDPC 1BQMB 1U1OA 4EU0A 3RU0A 2LQ5A 3FEZA 5CA5A 1S1WB 4PCQA 2WONB 1JB0C 3RW7A 1A6LA 1A7GE 1FNMA 4A8FA 1X7VA 2FHOB 3DLBA 5L8RC 4GO5X 2RQ4A 2E7XA 1X4AA 2YKNB 5KFTA 3V4IB 3TOQA 1KQSR 2CQ3A 2C42A 3LO3A 3KJVA 4O44B 3T1YF 3QWPA 2M8HA 1SJFA 5EWEA 3BO4A 2DIVA 4NZ0A 5KFAA 3TAPA 2DR7A 3ISNC 1RTJA 1S1UB 5J1NA 4HEA9 3FJ2A 4ZVFA 4OQJA 3PX6A 3UW1A 2R8HA 2I5JB 3Q0AA 3J80Y 2KYZA 3THPA 4QWDA 2W24A 3BGRB 3H2LA 2CG4A 1NAQA 4DL4A 3FFIB 1L3TA 1HBUB 2YH1A 1GXUA 4P2SA 3SI8A 2C3UA 4A48A 4ECUA 2GNKA 2DNQA 1SBRA 2JWNA 2AJ0A 3MEDA 2DNPA 1YJVA 1FTRA 4HHJA 4DV4F 3JTOA 3I0SB 5HMZA 3PR5B 1MNEA 2R7WA 3QIDA 4ZPWR 2ALZA 1LK7A 3V5RA 4ZCMA 4F02A 4NPOA 1C2PA 4AYBD 4MMOA 1SI9A 2IVMA 3I6PA 2ROEA 3M2RA 2OTLS 4OL8A 3KMSA 4DF4A 2GGPB 3UWTA 5L1KA 2AGPA 4KV8A 4OHZA 5L9NA 2PN6A 5KT6A 5KFCA 3CCRS 3SCKE 3BF4A 4B9UA 1XR5A 1OIAA 2X1AA 4DR7F 2MSSA 4R25A 3GFZA 3MMBB 4WE1A 1MW7A 1RTHA 5FLXY 3AQPA 2D1CA 4XPCA 1YJRA 4CTAA 1YJTA 4O3NA 2HFNA 1AROP 2UV8A 1U8SA 2F3JA 1F5BA 2JVRA 1TKTB 3M6UA 3Q23A 4QZVB 3BB5A 2KJWA 1ZTTA 2XC9A 2D9PA 3BR9A 3GWCA 2CQ4A 3BS9A 2NPFA 2VPWB 1URRA 2JLEA 3GYXB 4ZDNA 3VWSA 4E0DA 4A8OA 5HQ8A 1UVNA 4B08A 1JLCA 1PO6A 4CI0B 5JXSA 5JVGQ 1OSCA 1JLQA 3SXLA 2LMIA 3DI6B 2WSCC 3R5DA 3SSSA 4USHA 4A46A 1D9AA 3K58A 2CFXA 3MEEB 1Q7LB 4RW4B 4M5DB 2VC0A 1S99A 2QYCA 1NK0A 2XMMA 2YTCA 1TKXA 3DOLA 2ASJA 3OTOF 4USIA 3V6KA 4EO6A 1UW4A 1XMBA 2E9TA 3LAKA 4ES1A 5JJBA 4DQIA 1FRJA 2VC1A 5KT4A 5B08A 3MAQA 3E2EA 2RDJA 1RT4A 3LPYA 4NRUA 4MYTA 4PG5A 1FEEA 4QW8A 3PJWA 1XR6A 2U1AA 4RBVA 2IC3A 4R5PA 1B7FA 1PILA 4IRDA 5F8JA 1HD0A 1K73T 4ED2A 1F5CA 4KSEB 5E5NA 1LW0A 1TV6A 2ZH4A 3K5LA 1QVGR 3BN7A 1HNVA 3D28A 4H4MA 1NKCA 4OLPA 2ZNZA 1PC5A 2KO1A 4EBDA 1A9NB 1IN0A 4RW7A 3EGNA 3RYLA 3KWMA 2XNQA 2Q79A 3J7YI 4J9NA 5U47A 4ECSA 1U1PA 3HHNB 2BYCA 4O3PA 1M5OC 5I42B 1IXKA 1FKPA 4CQ1A 1SL0A 1L3SA 4OV1A 3UFCX 1OQ3A 5BYSA 5KG7A 3KHGA 4QPXA 1UVMA 4G1QA 3VR1A 1VQ8S 4F67A 5ADZA 4DQSA 2MJUA 4CNZA 4IG0B 4MKAA 4J5OA 3PW0A 1J5OB 3CEDA 1F0XA 3CCUS 1YTYA 3RB3A 3FEYB 1U2FA 2VBXA 3V2UC 1U6ZA 1RAJA 4ERDA 3AJ1A 2DITA 1Q4RA 3NWGA 3UI3A 3N01A 1MWZA 2YNGA 1V3ZA 2B6AB 3CC7S 2DNMA 4K4UA 4NLGA 1X0PA 3PEHA 2BACA 2YWKA 4WFZA 3CJ5A 1H2VZ 1R27B 2UVWA 1KLMB