1SI9A

Boiling stable protein isolated from populus tremula
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
TRTPKLVKHTLLTRFKDEITREQIDNYINDYTNLLDLIPSMKSFNWGTDLGMESAELNRGYTHAFESTFESKSGLQEYLDSAALAAFAEGFLPTLSQRLVIDYFLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of the Thermostability of SP1, a Novel Plant (Populus tremula) Boiling Stable Protein.
pubmed doi rcsb
molecule tags Plant protein
molecule keywords stable protein 1
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1si9A00
2BBEA 2ROGA 3IWLA 3UDCA 1AFJA 2XMVA 1KVIA 1OQ6A 1APSA 2GV1A 2GCFA 5B0GA 3VTIA 2QIFA 2L3MA 3TRGA 1X8DA 4OJ3A 1IUJA 2K7KA 1R6YA 3BN7A 2FTRA 2BJDA 2ASYA 2LDIA 2XMUA 4NPOA 5K9FA 1S6OA 1SB6A 1YJTA 1X7VA 2ROEA 2ZDPA 1QUPA 1Q53A 5KAKA 4HH0A 2QYCA 4Y2IA 1FD8A 3K7RA 2CRLA 1FE4A 5B0BA 1GXUA 3QGPA 1OPZA 1AW0A 2OD4A 2GA7A 2OAUA 4OJGA 2W4CA 5A6PA 2W4DA 2K1RB 1KQKA 5B08A 3HX9A 2KYZA 1VQSA 4YEAA 2AP6A 5T7LB 1YJRA 3FMBA 2HLTA 3KNGA 3MCSA 3QMQA 2OD6A 4A48A 1Y0HA 1AFIA 4U9RA 4YDXA 5F0UA 3KKFA 1SQEA 2QLXA 3FGVA 2RILA 5B0FA 2HLUA 1S6UA 1YJUA 4OIXA 2KT3A 2HQIA 5T7LA 1Q8LA 4FNIA 1YJVA 4DL0C 1TL5A 2HFNA 2IYGA 3BF4A 3HF5A 4ZA1A 1CC7A 2N7YA 2IFXA 2PGCA 2LXFA 1Y3JA 2OFHX 3HHLC 5B0DA 2AW0A 2BYCA 3HDSA 5B0AA 1WD6A 3TOQA 2ACYA 1YRXA 3GZ7A 5A6WA 1K0VA 2XMKA 1KVJA 2K2PA 2BUNA 1OQ3A 1FEEA 2Q3PA 1MWYA 2OP5A 1VQYA 2GFFA 2ZDOA 3F44A 1N5SA 1SI9A 2W4PA 1XBWA 2FHMA 1FVQA 2KKHA 2K1RA 1CC8A 1FESA 1FVSA 3BR8A 4HI1A 4A46A 1ULRA 1JWWA 3TNVA 5B0EA 2XMMA 2IYIA 2VV5A 3I9ZA 2OMOA 1W2IA 4HI2A 2AJ1A 2BJEA 4OJHA 4DN9A 3HHLD 2G9OA 2XMJA 4Y2MA 1TZ0A 3LO3A 2KT2A 3BDEA 2LQBA 1JK9B 1P6TA 1Q4RA 1TL4A 2RSQA 2VH7A 1Y9OA 2XMTA 3BB5A 3DCAA 3E8OA 4HL9A 2GO8A 2LQ9A 5B0CA 2XMWA 4FNHA 2FIUA 1Y3KA 2N4DA 4DPOA 2GGPA 1Q8BA 1RJJA 4Q2MA 4QOTA 4Q2LA 4Y2KA 1YG0A 3LGMA 3CJKA 2GGPB 3IWXA 2K7JA 1MWZA 1OSDA 2HIQA 3BM7A 1N5QA 3MZIA 2OKQA 1V3ZA 2RU9A 1X0PA 3HHLA 3KG0A 3HHLB 1N5VA 4A4JA 2AJ0A 1URRA 3KG1A 4NL5A 1P8GA 1GXTA 1CPZA 4HH1A 4A47A 3WDOA 1TUVA 4ZOSA 3BGUA 2FB0A 3T9NA 2EW9A 2QLWA 3DXSX 5B09A 2RMLA 4OJ1A 1U7LA 3LGNA 5F0WA 4EFAC 2HFOA 2ROPA 3FRYA 3CJKB 2N4CA 1LQ9A 2JDJA 2PD1A 5IXUA 2OFGX 3HFKA 1N5TA 1TR0A 4F67A 1FE0A
chains in the Genus database with same CATH superfamily
4OZ2A 1U1NA 3IWLA 1MU2B 4KKOA 1N88A 2ZD1B 3ENWA 2YNFA 2FC9A 2QG9B 1X8DA 3VGSA 3ITHB 2OPPB 2E5GA 4KPCA 1X0FA 4DQRA 1HIYA 1NJIT 2Y8WA 2HFZA 1RHUB 1QAXA 4WYLA 2OHDA 1LOUA 2QL5B 3D1HA 1CS4B 3QGHA 2HAIA 3QPIA 1HHTP 2XS5A 4I2QB 1UEVA 4RNHA 1VQPS 4NE9C 3D0IE 1U1MA 1TV6B 2FJWA 2X3DA 4LR9A 5C24A 3SZ2A 3HFVA 3QWUA 1UZDA 5DGBA 1G6BA 4Y2IA 3RRKA 1X5TA 4ECTA 3LGHA 1U26A 5B0BA 2XTJP 1XEZA 4Z2XA 5I42A 4AQYJ 1U48A 1OYEA 2V2VA 4W98A 3BQ1A 4JI6J 3I5AA 3DNCA 3E51A 3CCLS 3HX9A 2UVRA 4ERDA 3AD8C 3PFOA 1VISA 4LRDA 2HNDA 2V5HG 5DLGA 1RACB 1ZA1B 3QMQA 1RA6A 3KKFA 4CZCA 3VV2B 1SL2A 3M7VA 4R5PB 5KFNA 3F0NA 2HLUA 4OLPA 4JI1F 5C5JA 3QGGA 4DS5A 1GX6A 4GC6A 1A0OB 3WX8A 3P8BB 5T7LA 5L1JA 3T5JA 4ANDA 1YJNS 1RT6B 1UA1A 1A7GE 4DL0C 2XHWA 3LQVA 3DLKA 2UU9J 3VHQA 5KFSA 1HBOA 2B5JB 2CUYA 1NLKL 2JWNA 3EM1A 3HCXA 1PIEA 1GX5A 5DG7A 1QTMA 2B6AA 2XM3A 3I55S 4L73A 4PZVA 1IM6A 4DQIA 3D28A 3UQSA 4FYWB 1ROFA 3K57A 2KDOA 3NEKA 4LBHA 1C4AA 4LVOP 4RR5A 2YNFB 5A0YA 3VAIA 4DV1J 2Y0BB 1EX8A 1ZPWX 2EBGA 1XMOF 4K0KJ 4NLSA 3TJ8A 4B08A 4Q5VA 2DR5A 2QV6A 2R8JA 5D78A 3T19A 5D0GA 1GFWB 2RNEA 1F60B 1WI6A 4CH7A 4ZPDA 1XBWA 2FHMA 3V81A 1X9WA 4Q8FA 1CG2A 2DYAA 3KOAA 1RT7A 1V9OA 2YQ0A 1CJUB 3OBIA 4U8VA 2DGTA 5CH7B 4ZN3A 4X4QA 3UCUP 2JSXA 1KQSR 9RUBA 1VBYA 5B0EA 3H25A 1NK6A 2FJVA 2IYIA 2NXCA 1YKWA 3OR1A 4EEYA 1XR7A 1YLXA 4HT7A 4CH1A 3H5SA 4Y00A 1H3DA 2DHGA 2RDIA 2VC1A 3AODA 5F8JA 3SFGA 4X65F 2DNGA 3CMES 1RWNB 1HI8A 1HNXJ 4KH1B 2XYGB 4CI0B 1S1TB 2GGPA 4CRJA 5C25B 1X9SA 4J9SA 1Q81T 3NKYA 3C6TB 1S6QA 4C98A 4WFXA 2BE9B 2IAJA 3BGRA 4JUZA 3PVXA 2LECA 4J9QA 1S6QB 3G6XA 1UVJA 5KFBA 2M70A 1W7WA 4A47A 2R2SA 1AROP 1R8HA 3DRSB 3DMJA 4MK7A 1HNZJ 1S1TA 2V34A 1LNQA 1HR0J 3SFUA 3FCVA 1CJVB 3JS9A 3PYGA 2PMZD 3SQGB 3Q8SB 3BH7B 1FK9B 4L3NA 1QAJA 4KHPJ 1SC3B 1CBKA 1X4HA 2BABA 3AB2B 1RAIB 3HZGA 4H4OB 1C1CB 4DUTA 3RBDA 2LEPA 3FQLA 4ZLLA 1MN7A 3W2WA 2FLNA 1RCXB 5A2QU 2FHJA 4Q43A 3HK2A 3GFXA 3OXGA 2Y1LB 2ZE2A 1VJWA 4L76A 3TA1A 4QPXA 1T3OA 2R8GA 4PAAA 1KR4A 1Z2ZA 2WCXA 4CLPA 3V81B 2E9RX 3KNAA 4ZPTR 2J7WA 7FDRA 4OMFG 3NS5A 5FDLB 5BYRA 3SDEA 3W60A 4NLVA 4LF8J 3NRBA 4BBYA 2B4OA 3TX8A 1PBAA 2JLFA 4PQAA 3OQ2A 2X7IA 5GAHI 1IBKF 2ZDPA 5A8KA 2EFOA 1FX4A 1QUPA 4HT5A 3H4DA 3ILJA 3DDIA 4HH0A 1KOHA 4Q45A 1FD8A 1Q7LB 3O2IA 1HNIB 3HHDA 4N8NA 5E3RA 4F0MA 2Z2YB 2SXLA 4Y34A 3W5ZA 3T3FA 2OD4A 2IPOB 2WRMA 2CQGA 1QAIA 3IBWA 3V6HA 3C66A 2WVEA 4KGZB 1G3OA 4B9SA 1VQSA 3NL0A 1WC1A 4O0NA 3DC2A 5T7LB 4X66J 3ZNJ1 4JI7F 3GILA 3B6BA 1NB7A 3L4BC 2BANB 1JLEA 1L3UA 1FRXA 5E3QA 5C2CA 2J6UA 3D4JA 5J2MB 5L9XA 3TEHB 5AE1A 2HSEB 1IJFB 3MEEA 3PHTA 2FJEB 2HHWA 3DOLB 2EFGA 2B4VA 2ZVIA 5HQ8A 4GKJF 4LSNB 2MKCA 3IN5A 4P2XA 4WP8A 4PPDA 4F0HA 4OV6A 3UPFA 2E1PA 5JMNA 1LKZA 1PO6A 3QRPA 1VR6A 2B7BB 2GVDA 1K73T 2F8MA 4DPWA 3D6FB 1B70B 4CIOA 3ETOA 5DQIA 2L48A 4YR2A 3HHLC 3KLFB 1XMQJ 1R89A 1KBRA 5D0EA 5AE2A 2DNRA 2WOMA 2KG1A 3CO9A 2VFVA 1UEUA 5J2QA 2B51A 1CSJA 1XNQJ 2J0XA 5ETOA 2K2PA 1RI7A 4H4MA 3UFCX 3D6TB 2KN4A 2LCWA 2Q3PA 3JTPA 4NWBA 5EWGA 2FHKA 3PJXA 1VRTA 4F4KA 3DI6B 4BHQA 5HP1B 5LSLA 2NCKL 3V6JA 3EVMA 4J9LA 5DLFA 1FESA 3H5XA 2EKYA 1U2CA 3UW1A 4F36A 2QA2A 2F1FA 3G8QA 4QWCA 2M5YA 5LMUF 1MU2A 1RLCL 5K8NA 2FZKB 4CH0S 5KFIA 3WBZA 2ALZA 1JWWA 2QGFB 2VV5A 5HLFB 1QTNB 2MHEA 2PT0A 3VAFA 3EZ5A 2HNZB 2F3JA 1BY9A 3QIPB 1UJ4A 4FP9A 2HWTA 4MIAA 4R25A 3JSBA 4A8SA 2FJBB 3BGOP 3RBZA 5B0CA 5IV4A 2AX1A 2R42A 2EI5A 3OTDA 4LF9J 1N33F 2V63A 1UVKA 5IQ6A 1UJ6A 4PXBA 2H51B 2GMHA 4DPOA 2ZJQQ 3CJ0A 2HFUA 1LWEB 4FPRA 2ASJA 3VGTA 2V2KA 1HI0P 3GFYA 4B9MA 3M30A 8ATCB 1EETA 1TL1A 3VR1A 3J81j 3KG0A 4PRFA 2N7CA 5DQGA 1VC0A 3CMAS 4W90B 1HNZF 2GHVC 2QLBB 3I0RB 4F3QA 4C8KA 2G4BA 1FXLA 1S9GA 3JXOA 2FJDB 1LWCA 4F2RA 2ASLA 1QUVA 2HMIB 2EPIA 3WDOA 4B3RJ 2OPRB 2HQ3A 1KRPA 3M8SA 1N52B 2EVZA 5EN1A 4FVMA 4UTGA 4P52A 2M3DA 1FNOA 2ZOMA 4YMEA 3AXKA 4EUVA 1LQ9A 3UD4P 3QT6A 3JYTB 3D67A 4NLRA 3HFKA 4G1QA 2V8VA 1N5TA 1N4LA 3ZTRA 4DF4A 3BGFA 3DRRB 3D6HB 4DOZA 4FF1A 3CULA 2V68A 4XDCA 2E1AA 3SCJE 3IRWP 2KFNA 5IT0A 2AGQA 3R5DA 5J2QB 2H5IB 2CA9A 3UWTA 5EWFA 5LJ5Y 5HJXA 1YTYA 2VBWA 2FVCA 5CZVA 4IG0A 3LPYA 1XTZA 2HVZA 4K5RA 1LW0A 1UWBB 1WTFA 2FZGB 4K2JA 1GEHA 1Z2LA 4WF9Q 3CC4S 1BWEA 3GR1A 5IZHA 1U6FA 1YJTA 3M2VA 4R0EA 3UN2A 1T94A 4JOUA 4Q0BA 3V2UC 1DQ9A 3PRVA 2O1PA 2ZBCA 4LFCF 2HRUA 2DR9A 4Y2AA 1U0HB 3D54A 4ALZA 4DPXA 1OPZA 1RWMB 2HQCA 4LQ9A 2A6MA 4KYZA 1JXEA 1TUWA 4B9LA 3R2DJ 2W4CA 3AOCA 2WOMB 2P8IA 1J2VA 1OMSA 1YBUA 5F8MA 1UKUA 1Q8IA 2KYZA 1O6XA 2V0NA 5IM0A 2AGPA 2AMCB 3R7BB 4WFAQ 4OYXA 2CPEA 5EX3A 2HHVA 2MQMA 3UN5A 3ENQA 4CO5A 2IBKA 4ANCA 4U9RA 1JQGA 1YITS 2XB2D 4LRAA 4D3HA 4KHRA 4CLFA 4K4SA 5F3TA 1T03A 5ETKA 5HATA 1S99A 2OI2A 3IAM9 4DU8A 3OPKA 3HSJA 1NDCA 2MJUA 1X5SA 5LXRA 1DQ8A 3M6UA 3MM6B 1BHNA 1M5HA 1SC6A 2GO9A 2HGMA 3H90A 3N5FA 5J2MA 2DRBA 2NR0A 3MFHA 3TUZC 3R8YA 3MEGB 4ZLNA 1LXJA 1RAFB 3HVWA 5FLXY 5EDWA 1NK0A 1N0UA 3ISND 1LEOA 5I3UB 1WHVA 3K8WA 2BQ3A 3GIRA 3N79A 5DS7A 1C1BA 1UA0A 3NCQA 4BCAA 3TAPA 3AY0A 1KVJA 1DAXA 2MSTA 3PEHA 3I87A 3EZOA 4USMA 3SCIE 1SKWA 2E7WA 1HNIA 4N8OA 4JI2J 2LA6A 3NWGA 2HHQA 3BPSP 2BE2A 2MKJA 1IR2A 4WKYA 3AQPA 3QJLA 2W4PA 1RAOA 2CFXA 4KE5A 4PCQA 5D4LA 2I2YA 4QCLA 3NXZA 3NBPB 4DCPB 4A46A 1HWJA 3L7PA 4RW4B 4F4ZA 4USIA 3N6NA 5EX0A 3AHPA 3THVA 1NZ8A 3O5TB 4AL7A 3DMJB 4I64A 2BJEA 5GAEU 1U1QA 1D8YA 2G9OA 3ILOA 2H65B 5ETSA 4B3TJ 3BB5A 4NCGB 3V4IA 1KWMA 1VC5A 1PC4A 1UJ5A 3N6MA 4H4OA 1RT5B 4MAKA 1Q8BA 2DHAA 4TY9A 3TA2A 3H4BA 1C2PA 3GSIA 2CQ1A 3MOJB 4RBUA 1DJ0A 3QJPA 1P9QC 4IUFA 4L3KA 1HBUA 5HBMA 3HHLA 3KK2A 4C7QA 3ISZA 4Q7AA 4EYIB 1VHIA 1MLAA 3KG1A 2Q6BA 1NK5A 1PYOB 2E5LJ 2XZWA 3RAXA 1ZETA 1DTQA 4NEZA 2FPHX 2GVZA 4M5LA 2A0FB 2LP4A 2LXIA 4DR7J 2DISA 1RHKB 2VG6B 4O44A 3CJKB 1LWCB 2D9PA 2GS8A 3HVTA 2JDJA 2VODA 4LVNP 2CWKA 4DFPA 4U6PA 1BQMB 3RTVA 4QIFA 2BBEA 3VZIA 3PW0A 3FKBA 1R0AB 3UNGC 4WTYA 3M8QB 1RWUA 3NS7B 4ELUA 1H2VZ 4GVBB 2D41A 4H4KC 4UOFA 3IFEA 1N6QA 2DPJA 3IG1A 2EKNA 2P2CB 3KYLA 5J1NA 3VALA 1UVLA 2CJQA 1RQ0A 4ED5A 3Q86A 4I67A 4M5MA 4B3MF 2HG4A 4UZCA 5L46A 1TKTA 5HVFA 1G1XA 4ENOA 1Q78A 3WC0A 4L72B 5EGYA 2ROEA 2VHGA 3UDVA 3DRPA 4NA1A 4C97A 5KAKA 3FUYA 1RT2B 2HVDA 2V2ZA 3BREA 1OY6A 2FUG9 3J81U 1FE4A 1FRIA 3QGPA 4M5JA 4WU3A 2KFZA 4OJGA 2HWHA 5AXMA 2GQCA 2EFNA 2W2OP 4ER8A 2QL9B 2O3DA 4ECRA 2K1RB 4IRDA 4NRTA 4ES2A 5HVHA 1RTJA 4QIWD 5A2QY 1H73A 2YNGA 2HNDB 5GMDA 3W8GA 3QAEA 3M32B 4X66F 3VCDA 1RK8A 2QMWA 4U96A 1SIZA 5A8WB 2NXUA 2Z2ZA 2YKPA 3VQTA 4NLUA 1ZH5A 2POKA 3I5BA 4NASA 3R27A 1T9WA 4FNIA 2FHJD 4NLXA 1NAQA 3N4WA 4QBUA 5CZXA 2DTJA 3RUBL 4CNYA 1KEKA 2HFNA 4PABA 2DEJA 4V1Ak 5KFOA 3EYZA 3HT0A 4DR5F 2E1MC 4LUBA 4ZVUB 4NZ7A 1R0BG 4RX6A 5HQMA 2ASDA 4DS4A 1S6PA 3A12A 3PNIA 2M4MA 4KY3A 1MG7A 4A8OA 1T9YA 1RTJB 2L9WA 3IG1B 2AW0A 1N5YA 2GIFA 3MAHA 3MTKA 3U1MA 3R6GB 4PXDA 3DLLQ 3AJ2A 2ZD1A 4DQSA 1JLEB 2YKQA 4DF8A 2XMKA 3FJ2A 2ZZMA 1EKSA 4LF6J 4IOAQ 3SXLA 1D9FA 4IDKA 2KVQE 1QE1B 2VOOA 2MJNA 3IBCB 4TVAB 2XYHB 1HQUA 5A76A 2DPIA 4DL5A 4DR2J 5DQHA 3TO8A 2CQ0A 2YBVA 4HKQA 1ZS6A 3EGVA 4TU9A 2LKZA 1MWQA 1TKTB 3O3LA 1CS4A 3TNVA 3DLEA 5ADZA 4U7CA 4ED8A 2UXCJ 2OMOA 2VBYA 1W2IA 3IBFB 1F5AA 4B3TF 3MPDA 1F9EB 1U2RA 3K89A 2XMJA 1W25A 4DFMA 2KT2A 4RUAA 2FD2A 3IGNA 4DX5A 3I31A 4EZ6A 3KK2B 3D6MB 3L9ZA 1TKXB 3DYAA 2BJ8A 1VK8A 4MMOA 5BR8F 1IBMJ 3ELHA 1S57A 3VGVA 2VJVA 2BJ1A 4ZMMA 3ENAA 5IT9Y 3ZFVA 1RT5A 3ZZUA 4C8ZA 2WONB 4IO1A 2PEBA 4IH6A 2HBYB 3LH2S 2Z4PA 1S9EB 1IKYA 1C1CA 4CWBA 1QAYA 2BX6A 1RKJA 1EIYB 1FRMA 3G96A 3E01A 4LF5J 2GJIA 3CCWA 3JQMA 4HVZA 2WVBA 3V6DB 2LFVA 4IR9A 3ZZTA 3SQGA 4OV1A 3PX4A 3K2YA 1S76D 3C15B 1RDRA 1B7YB 1P1TA 3A3PB 4O23A 1S72S 1JX4A 2BVZA 2Y1JA 1TP7A 2KO1A 2UV8A 1XNQF 3NGTA 1WSRA 5ITHA 1RBLA 3NGRA 1FE0A 3DHXA 2DY9A 4RPFA 1Y00A 3DKDA 3QT5A 4X4VA 2E7XA 1TMMA 3UD5A 2L3MA 2R7WA 4DWIA 1FWKA 2I5JB 3HT3A 2MLXA 3DOMA 2VKRA 5ETMA 3HMJG 3HFZB 1KKHA 2AJQA 5M2PA 2V8GA 3MEKA 2JLEA 3AXMA 3EZUA 4B17A 2RQMA 3LA0A 5LJ3Y 1SKSA 4J9RA 4NXMF 4OX6A 2V4QA 3AJ1A 4WPAA 2Y1IA 3LAMA 4QQBA 1R8AA 3K7RA 1TK0A 2CJAA 3O6QA 3J7YU 4P2FA 2KYXA 2GA7A 4USHA 2FY1A 4CT8A 1T03B 1JLBB 2XSFA 1K8AT 3N28A 1ITPA 3D1QA 1C1BB 3DN9A 5KFRA 3NNAA 1TUGB 4DLEA 5ETNA 1U4BA 2P9CA 4P6QA 3KK3B 4CM2A 1RSCA 2NZCA 4WU2A 3MI7X 4E2FB 5JUMA 3PTWA 4YB5A 1Q82T 5L9NA 3MEGA 3CDEA 3Q8PB 4K2XA 4QWDA 2Q1LA 1KS2A 4DR6J 5B0FA 2CPJA 1RE1B 2ZBPA 1OYDA 3DRYA 3M1VA 4L74A 3RG6A 1WOOA 4RW7A 3ZTQA 2HVIA 3OL6A 4RNNA 2JLGA 5GMEA 3T9ZA 4EBEA 2AEFA 2HVEA 4RLEA 4CM0A 2F65A 2GJ2A 3Q83A 1CLFA 1HKAA 4X65J 3BF4A 4FXDA 3H2LA 4O3PA 5E7OB 3AB4B 3B54A 2M0GB 5F8GA 4OYMA 1Y11A 2C3YA 3CIZA 2ILZA 1REGX 3UNYA 3P45B 4XAKA 4JYAF 3F56A 2JEIA 2DNYA 2VFSA 1WNEA 3ICLA 3J80Y 4LIRA 2C2DA 1AYEA 2C3PA 2W25A 2BM1A 2IDLA 3DGVA 3W9HA 3IMQJ 5KFUA 2L41A 2K1RA 3CWJA 2D9OA 3GPAA 3Q8QB 3KLVA 4RW9A 4UF4A 3ZZZA 2DR6A 1IBLJ 3KDNA 2PC6A 4MKYA 1RKIA 3I9ZA 1QSSA 1N32F 1WOPA 4HI2A 2AJ1A 2CQBA 3M8YA 3VVTA 5F8IA 1K9MT 3P49B 1P27B 1KHVA 5EWEA 4K4YA 3PX6A 5H9EK 1HNXF 3K8VA 2CJ9A 5F8LA 3ZXWA 2MQQA 1PGZA 2LQJA 3DRRA 4WFZA 1UCNA 3UO0A 1KLNA 3DLHA 4X4NA 5J2PA 1MROA 3GFZA 4CO4A 2BJ3A 2FC8A 2HQDA 3E01B 4QOTA 4WFYA 4X64J 4JI8J 3W1YC 1R3NA 2HHXA 2W9BB 2RAQA 4RL1A 4MKVA 4NYPA 2VF3A 3BBFA 1V3ZA 2P9EA 1X4BA 3W65A 5CAAA 5C42A 3CO0P 5T14A 3Q2TC 1CEZA 1DURA 1ZAVA 4TXSA 2KB2A 1TKDA 2OEMA 3I82A 4WIQA 3G82A 1LWFA 5CQGA 1HR0F 1Q8KA 4OYZA 1SC1B 3MM5B 4ZOSA 5HLFA 2R7UA 1GK8A 1YZ7A 4ZK7M 4U95A 2IMOA 2B56A 4X84A 3OD2A 2C2ZB 3GG1A 2RU3A 2ADBA 1U47A 2E1RA 3Q89A 4DI6A 5CA5A 2HFOA 3LP2A 3U7JA 4DL3A 1WUUA 1NDPA 3IO1A 1HQ2A 2J0WA 2QC3A 4GO5X 4WIIA 4OX8A 1WKLA 1OSCA 1MROB 1JLAB 4FKXA 4M5DB 1TVRB 3DLEB 3QWPA 5D77A 2MXYA 1LK5A 2QYGA 3EPIA 4KFBA 3LWMA 1M5PC 1VDHA 4O0IA 3L09A 1AA1B 1KSPA 5CCMA 3OUYA 4JYAJ 4ATNA 3JAMY 3A8EA 2IDEA 2K7KA 5M2UA 1Q79A 1RU2A 4NLTA 5KFHA 4AYBD 2M7SA 2Z8QA 4NXNF 4LRFA 3UVJB 2Y9HA 1QY7A 2LDIA 2A2DA 3TYTA 3V4IB 2XMUA 1RLDA 1VQOS 2M8DB 5DM7Q 1M5OC 4ED4A 1NKEA 3MDFA 1RT3A 3KWMA 5AE3A 2XULA 4G1PA 4L75A 2KM8B 5HP1A 3CPWR 1J5OA 2CRLA 1S1VB 1PBUA 1ZM9A 1SC4B 3I4HX 3HHEA 3MEEB 4KGMA 5D8HB 1I3OB 1S12A 1WDDA 2ZWPA 4ZJLA 3IC1A 1HARA 2WHOA 3BZQA 2D1CA 3OTEA 2BANA 2EC2A 3DLBA 1C0TA 1ACMB 1SJRA 2CVIA 2CQIA 2YTCA 4ID5A 1SV5B 1IM4A 4YUDA 5HO4A 2XNQA 4PWWA 4WE1A 4ZVRB 3J80U 5D15A 4DV1F 2UUCJ 1RTDA 5F0UA 5A8WA 5DGAA 2D3O1 1U1RA 1UWAA 2GVDB 3FGVA 3D3CJ 3CXCR 1BUXA 1UPMB 2Z0GA 1YI2S 4DU7A 3NY0A 4HLBA 3MWBA 3OR2A 1WTBA 2XSJA 1PYTA 5HANA 2GC8A 4RWWA 3WZ0A 2OGUA 1JXLA 2UVVA 1X9MA 1S1XB 3CDBA 3FSIA 3PW2A 4F26A 1NEEA 2ATCB 2DIUA 2WW4A 1H72C 2VB6A 3H40A 4C0BA 8AT1B 3DM2B 3BYRA 1U25A 1YQHA 1GTHA 2OFHX 1RWOB 2IA0A 1FT8A 1U1KA 2IM2A 2VFUA 1HYSA 4DV4F 1HD0A 3RW7A 2HHTA 4C11A 1WD6A 2ACYA 1S79A 2HGLA 3G6YA 3JTNA 3C14B 1FEEA 2V4JB 3MD3A 3CCMS 2OH2A 4OHYA 2NXNA 3FFIA 3MM9B 3OLAA 1YZ6A 1VQYA 4P2MA 3PO4A 1WG1A 3W5YA 2D69A 4CLSA 4WZMA 2QZ8A 2YWFA 3EGWB 1OPIA 3LP1B 1QVFR 5LXYA 3M05A 2R8IA 3GTYX 3E3XA 4O3QA 3GG0A 4OYIA 1JIHA 4QWAA 4DR1F 1LFPA 3S01A 1PC5A 1NNDA 4IR1A 1F0XA 2A1BA 3GJRB 4X4SA 1VBXA 3DRSA 1VFJA 1RBOB 2LQ8A 3QT8A 2E5JA 4X62F 4ZVFA 3K5NA 2CKWA 1FO1A 3CD7A 1KNZA 5KG0A 1NJYA 3POTA 4MT1A 3H59A 1GMWA 2HYIB 4USWA 4LF7F 1SVDA 2GVZB 1FNXH 3W61A 2HHUA 1WKKA 1RTHB 4NMXA 4ZJQA 2AQ4A 1D1UA 2VZ9A 3FSXA 4ZITA 3MXHP 3OVAA 3BGLA 2GGPB 5C25A 3EDQB 4C4WA 4ZN1A 2RUGA 3BM7A 3C15A 3HHLB 4NI2A 3CDAA 3HSDA 4A4JA 4UQGA 4ECZA 1KD1T 3T5KA 2CWXA 2G13A 4JI3F 1TFWA 3OJUA 5I3QA 4EU0A 1VOMA 4OX9F 1VRUB 5AXLA 3GV7B 4JV5J 3CW2C 3U1LA 4FS2A 5K14A 4PKDB 1S97A 3DXSX 4NCGA 1T02A 4OJ1A 3GCXP 4ZVPB 3LGNA 2ZH9A 2WW8A 4LBPA 3P4UB 3PRBA 1KTVA 2EK6A 2MKHA 1S9GB 2VQFF 2N3OA 4YB1P 4OX7A 1SCJB 3MMAB 4Q44A 4DCOB 1TKXA 1VK3A 3M6XA 5E3PA 3MGJA 3PRDA 3R5GA 5KT6A 3MUTP 3C16B 4A8YA 5D0HA 2ZHBA 1RCOB 4ECQA 1OQ6A 1JJHA 4YY3F 4ED3A 1M5VC 3JSMA 3R5CA 4M5IA 2BXJA 2VUGA 1BWVA 3MMCB 2QFIA 1J5EJ 1P1LA 2MKIA 4DR4J 1WEZA 2NYIA 1JXVA 1X4FA 5KFWA 2FJXA 4FPIA 2ASYA 4KV8A 2MKSA 1CJUA 4OL8A 4CLLA 3S7RA 2CZ9A 5KOWA 3PKMA 2HNZA 2OUGA 4Y6IA 2C2OB 1RT6A 5K8OA 1NSAA 2CNOB 2QYCA 5HMYA 2KG0A 3ZZ0A 3RBEA 3OVBA 3MPWA 1AW0A 4CNZA 2DH7A 3CMQA 3DM2A 4NLDA 3LANA 4ZVOB 4G3IA 1XNRJ 5A6PA 1FDAA 2DNKA 3BO2A 2BOPA 5IT9U 1D3WA 5KFLA 1S1XA 4ZLPA 2RQCA 3MR3A 1U49A 2WZ1A 5AJ3J 2AP6A 2XSJB 4MK8A 5CD4H 3FMBA 4KB7A 3KNGA 5D4OA 1BGXT 4WYWA 2OD6A 3CCJS 4H4MB 1FTCA 3QT7A 3L7OA 4PQUB 4YDXA 4I1TA 4NMLA 1SQEA 2XEXA 2CQ2A 4NYZA 2E1CA 2OPSB 1MMLA 3AH6A 2XWXA 4HTIA 4M5HA 5CYMB 2EG1A 4LF2A 1GAOA 5J1EA 3CCQS 1FA0A 1SV5A 3FEYB 2DXFA 3TARA 2XLKA 2Z56B 4GKKJ 2H9ZA 4B3MJ 3M8ZA 3CJRA 4C8YA 3RRGA 4ZVGA 3GYGA 1PCAA 1SBRA 4JB8B 1REVA 2A10A 2XY5A 5T41A 1KHWA 2DGSA 4CLYA 1S1VA 4ZP9A 2BMBA 3MAQA 3Q0AA 4DV4J 4KRWA 3BKUA 2YXLA 3TW0A 2H48B 1UEKA 1Y5NB 3QATA 5KFJA 4JV1A 2C2KB 2PN6A 1S0NA 1B4SA 2H3EB 1NJWA 3M2VB 4QR1A 2FLPA 1X4DA 3BBBA 4K8RA 3RJMB 3CCRS 1N0VC 4YDDB 2CQHA 4J7CA 1LW0B 4NX9A 1YSJA 1EKRA 1CQMA 2ZDOA 3MPVA 4C8MA 2QEXS 1F5CA 3W2VA 1XC9A 2YKNA 3DLGA 1NPRA 2RDDA 5KFZA 4F3OA 3ET6A 1F5BA 3SSQA 1H2TZ 4B3SF 1FVSA 1MW7A 3BR8A 4WXOA 4XK8C 2X1AA 4DR1J 1T05A 5KG4A 2W2QP 1ZAXA 4NZ6A 4OYPA 1T7PA 2XMMA 3R1HA 4KHPF 5LMUJ 3EGZA 1JNZB 3MOZA 3CB4A 5E2QA 3KLGA 3CJSA 3CJ3A 4QIEA 1TL3B 3FK4A 4PG6A 3TZZA 1N32J 3OHAA 1JJ4A 4LF4J 3DCAA 4BWJA 5KTQA 3T41A 3NAIA 2LQ9A 2NSCA 3C16A 5L38A 2I1RA 4QJVA 5J2NA 3MUMP 4UOHA 3NCPA 1Y3KA 4K4WA 2V2QA 1V3RA 2ERRA 4M95A 1N33J 4OZ1A 2RQ4A 5DG9A 4QZVB 5BYSA 3K58A 3RGIA 2C2NA 4GMKA 2IRXA 4OZJA 1L5UA 4OYBA 1FFSB 1MWZA 3T1HJ 3D5MA 2QT7A 2OKQA 4IG3A 3FVYA 3NMAA 4NCAA 5DDQC 4CLZA 3M9NB 3FCHA 1EETB 1TL1B 2RQKA 1RTIB 1RADB 1URRA 3NWRA 1P8GA 2MEWA 3C6UB 5LL6d 4ZHRA 1UETA 2P6TA 4UW2A 3MPYA 4EBDA 1KOOA 2VFRA 5SUHA 2RS2A 2AWZA 1CJVA 2J6SA 4NI2B 4PEOA 3T6JA 2R7OA 3GJSB 3DGPA 4QW8A 1RT4B 1T95A 5KFDA 3KLEB 4TQRA 3M8PA 2VL1A 2UU9F 1HNWJ 2C3MA 4DEZA 1KQGB 3LPEA 2Y1RI 5IXUA 1K44A 1S4EA 1F9HA 1WC0A 2CPHA 2HS0A 1S0MA 1U6ZA 2VDHA 1N36F 5F8NA 2ZWOA 3X3UA 2KXNB 2FJAB 4J9OA 2NQPA 2CQDA 3KXDA 1ZM4A 3MM7A 2EXUA 1R8BA 5KT4A 2PI5A 1FXDA 3C6TA 4IQMA 4DR4F 3PHEA 4C6AA 4KBIA 5K5MA 1IKVA 3NP5A 4DFKA 3M4XA 3P5BP 2CYYA 4OYAA 1HWIA 1NPPA 2B4UA 1EZZB 2DO0A 4P2SA 4UQTA 4UOCA 4ZCMA 3W9IA 2ZH8A 1FKAF 4KPYA 4V19X 4B3OA 1KTQA 5HI7A 3PJWA 1S5ZA 1SB6A 2AV5A 2I38A 4OHZA 1W26A 1I5OB 4DN0A 2KL8A 2YNHA 3I4PA 1AZSA 3B4DA 1IWGA 1N56A 1SKUB 2F7VA 1AT1B 1RABB 4ZJOA 3IM8A 4ZPAA 4B9TA 1D09B 2L9DA 2OPSA 1QSYA 3RRHA 4CT9A 4TNOA 4DZDA 3P5TL 4F04B 3FNNA 2W8KA 1YJ7A 2V50A 2KFYA 1HWKA 1S77D 2E9TA 2HFSA 3PYFA 2MZTA 4CP5A 8RUCA 2HNYB 2UXDJ 7AT1B 2C2MB 1ZTTA 2DKOB 2MB0B 2OLWA 3IS9A 2U1AA 3I96A 5I3PA 5KG6A 1B7FA 2HBQB 3K17A 2KT3A 4HR2A 3VAMA 3SI8A 4J9PA 1X4AA 3LTOA 4EWTA 4LF8F 4IOBA 3THTA 1YHQS 1HBOB 4X4PA 2BRLA 3U02A 1JLBA 1RTDB 1ZOTA 2MKKA 1VCTA 5K8MA 5DRKA 2OTLS 2LLZA 3RB6A 3UDLA 3PZPA 2CPDA 4M94A 3QYYA 4HDGA 2YWEA 2MY8A 3I9V9 4FXVA 2R7RA 1FDBA 2H54B 3HD2A 5A8KB 3G8TA 4X4RA 1HMVA 1ZM2A 3TOQA 1K0VA 1Q5VA 3FBBA 3G86A 2IY5B 2YH1A 2HNYA 1U09A 3TUJC 4JI4J 4LSLA 1TTHB 1WEYA 1GH8A 1Q0NA 1NK4A 1GTEA 2ATLA 2I5JA 1J5OB 4NA3A 5DETA 4JI2F 3C8YA 1T9TA 5D3GB 2YH0A 2DEIA 2J9DE 5KT5A 2MGZB 4K5SA 2XNRA 2X1FA 4D3GA 1CC8A 2OELA 5THWA 2UXCF 4P75A 1HLWA 2KRRA 2LA4A 3CT9A 2EC0A 4N47A 4CLUA 4IRKA 1DBDA 1JLCA 2MYFA 3CD0A 5HSPA 2EK1A 5G0RB 1O8BA 5C24B 3LO3A 1LW2B 1RAAB 2GW8A 1HQEB 5M2RA 3TVZA 4FDFA 4ILLA 1RAHB 3FDSA 4P9SA 1RT4A 2XZDB 4ZVHA 2HWIA 2VFTA 2YQ1A 4M5DA 4ECVA 1XIQA 1NK8A 1AXQA 3IRXA 2XC9A 4Q2LA 4DBQA 4ID8A 5K8PA 1RP5A 3M9OB 3WIVA 3PY8A 2NREA 1M1HA 3NS6A 1S49A 3JTOA 1Q95G 4TQSA 3HXMA 4WKRA 1S9FA 3SSSA 3TQ1A 4ZPVR 3DHWC 2LXUA 4DV6J 1TAQA 4IFYA 4HHUA 2HFVA 2ZH4A 3V4MA 1SL0A 3HI9A 3UE2A 2R7SA 2KJWA 2XO7A 4MKAA 4JBCA 2QLWA 4XDDA 1UL3A 4ZPCA 2LDYA 3TANA 1N48A 4K4XA 1Q1KA 2EBEA 5AXNA 1XR5A 5CYQB 1A9NB 1HD1A 3G8SA 1NPKA 3BJYA 3RR8A 3OTOJ 3SMZA 1TMJA 3CJ4A 2KU7A 4AQYF 1VBZA 1KN6A 4DUYJ 4NXMJ 4DG1B 2ROGA 4LF9F 2IM1A 4CTAA 4RNFA 2J76E 2GV1A 4WFBQ 2WBRA 2WSEC 3WIUA 1HQUB 2B9WA 3FZ2A 2AX0A 1VBKA 4BWMA 1SH2A 1YGYA 2BKPA 2DNHA 5GAGI 3M2RA 3AJDA 2BEFA 1JLGA 2PA8D 5E5NA 1ZAWA 1KQFB 2JOQA 3NLCA 3N01A 4ELTA 2J8SA 4OX9J 3H2VE 5ETTA 3DI6A 3BKTA 4ZIVA 2NS1B 2Q79A 1S6PB 5F9NA 3HSZA 4UY85 2VASA 2E7VA 5CCLA 3OXFA 1IBCB 1REVB 3QAUA 4LRCA 1F6TA 2K06A 2W4DA 4MJKA 3T1YF 4OI4A 1T05B 4PG8A 1S1UA 3AD7C 3AT1B 4DUZJ 3HHNB 1RZMA 4C0OC 4KGKA 4A8FA 2KZZA 1X4CA 1YJRA 1AFIA 2CNKB 3DU6A 1JLFA 3I5CA 1S1UB 2JC1A 4J9VA 3ZNUA 2ZC3A 2R9LA 4DV7J 3JQJA 2VU5A 2VJUA 2DR7A 2R7TA 2HHPA 2M2BA 4CLWA 1S48A 3MR7A 3AAWB 3H5UA 3JSRA 2BJ7A 2HQIA 4ILRA 5HMWA 1FXRA 3B82A 4RW7B 2RE1A 4USJC 3HM9A 1TL5A 4N7TA 1JLQB 3GSDA 4F4XA 2AGOA 3BO4A 2F63A 3DXBA 5IV3A 3KUGA 2IMWP 4WK3A 1H7WA 2RRAA 2IIHA 2AZ1A 3VAKA 4A8QA 2GNKA 4P74A 1H0HB 4DR5J 4LFAF 1M1GA 3G2XA 1U1LA 1I51B 1RT1B 5B0AA 4PWDB 3MURP 6FDRA 2HZVA 4PQUA 2DT9A 1URNA 4LBIA 4RJVA 1A6LA 2EG2A 2FLOA 2CPZA 3ENVA 1FX2A 5DDRC 2BDPA 2OP5A 2GFFA 1XK8A 4RW8B 3VZHA 3ITHA 3CDWA 1R6VA 5EHHA 1X5OA 4PYDA 4CLKA 2B43A 2OJ3A 2G2OA 3H8YA 2CPIA 1TKZB 1X31C 2X1GA 2QX0A 5JXSA 3UCGA 1NHVA 4ECSA 4DLGA 3KDOA 3MM5A 4P10A 4M1KA 1H98A 4PUOB 1FJGF 1WF0A 1G4CA 2D3ZA 2LQBA 4O3NA 1FWLA 1Y9OA 3EE3A 3SYZA 4X2BA 4KV8B 1D0EA 3W8PA 5KT3A 3HKZD 3J7A1 5C42B 4WFNQ 4B9UA 2OEKA 5K14B 3A3NB 4ZVQB 1AUSL 3WX4A 5DDPC 5L1LA 3TP2A 3O44A 1HWLA 4Y2CA 3IRXB 5KFYA 1BQNB 2HAFA 3CJ2A 3PJ9A 4FN5A 3K59A 5CHCB 3GIKA 2MQ8A 2UUCF 1BC6A 1N5VA 3U27A 2ZH3A 3T1HF 3PR5B 3PIPQ 3MMAA 4WXWA 4GO7X 1WC4A 2BRKA 3DRXA 3RBXA 1AB8A 4OQJA 4J9UE 2CVEA 4FYXB 1D8ZA 2RB7A 4KGXB 3T1AA 5CD4A 4TU8A 2FY8A 5FLXU 1CJKA 5D6GA 2LQ5A 1MMNA 2Z57B 3VAGA 1PILA 4Z37A 1R8CA 3GWCA 1HNWF 4YOEA 3RW6A 1DLOA 3MR6A 1EQMA 2XS7A 2FVSA 5IS2A 2VKZG 2C1EB 3MPUB 2V6AA 4PG5A 1KVIA 1IQZA 2GCFA 5B0GA 2HVHA 4O4GA 1L3SA 2DHHA 3OL8A 5CABA 3AQOA 3R5JB 3FFIB 3MM9A 7FD1A 2CZVC 3BN7A 2J6TA 4GRSA 4R0JA 1EQ0A 3GR0A 3HD1A 3NGUA 4NPOA 1OS5A 2AEMA 1RT7B 1S6OA 4C11B 3OSNA 3R5BA 1L3TA 3RR7A 4M5NA 4DV3F 4H4KA 4LF1A 4N41A 4A8WA 2MZRA 2F4FA 3US5A 4USUA 1WJ9A 2G0IA 4OZ0A 1GXUA 2DGUA 4IDKB 3ILIA 1HA1A 3CUNA 2MQOA 2OAUA 5KG3A 4L6V3 3KLHA 3SV4A 1WG5A 4DR3J 4XPEA 3LP1A 4ED7A 1UAWA 3Q8VA 1PJ6A 3PW7A 4YEAA 3KTQA 3BBCA 1FERA 3MF5A 1XMQF 5H9EJ 1NJXA 1S4FA 1R8PA 3G6ES 3GV8B 3EDRB 1QLNA 1HBMA 2OSRA 5SZTA 2JEJA 5HJYA 2JZ5A 1KC8T 2RILA 1NU4A 3OFFA 4IOCQ 1S6UA 3BQ2A 1HYSB 3FC9A 4OIXA 3HHKA 4QU6A 4KSEB 2B9XA 3HULA 2VG5A 3ZZYA 1E6VA 2V8PA 1Y5LB 4I0WA 5C7PA 3H5YA 1YJVA 2KM8C 4IH5A 1QD1A 2BKOA 3GIMA 2HRTA 3Q24A 3QSYB 1IBLF 3GYNA 2FVPA 3PCOB 4PYAA 3DU5A 2ZM6J 3QIDA 2XGQA 3OFGA 4B3OB 2MDAA 4DXLA 3D0HE 3KJVA 2C2RA 1JMTA 2HQGA 4IFVB 3TEGA 3AA8A 2GIRA 1F3FA 4C8NA 2J9EA 5KG2A 1DQAA 3ETMA 5ETVA 4YHHF 2XCPA 2KI2A 2WTFA 1NH8A 1B3TA 5IOLA 1OQ3A 2QA4G 2DGOA 3ZZRA 5JVGQ 5J1PA 1FWPA 2O67A 4MFBB 4YY3J 4OI0A 5KG1A 3M2UA 4FF2A 1Z1ZA 2BKNA 2AHOB 4J5OA 4WP9A 2HPUA 4WK1A 2QLFB 2QE5A 2O01C 4OYWA 1QDUB 3R3TA 5F3ZA 2FGCA 3Q23A 4K4VA 1WKJA 2UUTA 2YWHA 4CO0A 5DZ6A 4X62J 2W7PA 2RS8A 1KFSA 3E2EA 2OPPA 3HHLD 6FD1A 1FJEB 5F41A 4GVBA 1TAUA 3K5OA 1T9XA 5CYQA 3I56S 3LP2B 2Z30B 2G0JA 4JI5J 1S9EA 3K5MA 4OI1A 3T5LA 4HDHA 4OYOA 5IT4A 4M5KA 2IVMA 1XNRF 1U0SA 2PE8A 4LFBF 4ZP7A 2G2YA 1YWXA 2XG8A 1ZTWA 2QTWA 1E6YA 1JKHB 1D9AA 3JSYA 4NRUA 4O44B 3CJKA 4DSEA 4Y2KA 4CTAB 4KFBB 2ADCA 2EFVA 3MEDB 4KJIA 3OFEA 2E9ZA 2BR0A 2KXFA 2PO4A 3M30B 3TJ9A 5KFQA 4BDPA 4F8RA 1NBEB 3MCMA 4RWXA 1CPZA 2JL9A 1HI1A 4NLWA 5LSRA 3KLGB 1IN0A 4B3SJ 2ZEJA 1PG5B 3PYEA 2Z2LA 3BGUA 3D68A 1BMQB 1SJQA 4TLQA 1HBUB 5F8HA 4U7UD 1U7LA 1KP6A 5F0WA 2AD9A 2CADA 1BXNA 1HQEA 1SJFA 3G82B 1L3VA 2DHSA 3EVWA 2N4CA 4NZ0A 4CYUB 2HBZB 2NUUG 2D74B 1BQXA 2DB1A 1B0VA 2QRRA 4ZCKA 4J9KA 2ZNYA 5KT7A 4DV5F 4MIWA 3O1LA 4RW9B 1CJTA 3MMBA 4DX6A 5BR8J 2QIFA 5ETRA 4TYAA 1IBMF 2CJBA 2A18A 4WBFA 5D3GA 1HHSA 1R6YA 1C0UB 1H6KX 3MAAA 4C0HA 4CO1A 3RB0A 2UZAA 4QU7A 2B7CB 2ZBQA 5KFXA 3ZO7A 3EMTA 1X7VA 1CULB 1NM2A 4ICLB 2AYEA 5GAEI 1WHYA 4FKYA 3UCZP 4LF5F 4O3RA 1E6VB 1ZPVA 2DK2A 2CPFA 1SQFA 2MMYA 4RBVA 3R9LA 1JLCB 1LFWA 3PM9A 4J91A 2HURA 2XLIA 1YDLA 2E29A 4ES1A 3D0GE 1T9UA 4F7VA 3PW5A 4M5GA 2ZUGA 2J7KA 2ILYA 3GB0A 4IFVA 4JI5F 2YX1A 3EICA 2DXDA 4LF6F 4ECWA 3KJVB 4LSNA 2P5VA 2QA1A 3W5XA 4KIAA 1G2EA 2HLTA 2CAJA 3GU0A 2XLJA 1FRHA 2KVIA 1HBNB 3T5HA 2WB4A 2CG4A 2CXEA 2LEAA 2QLXA 5DDOC 2VPYB 2AF6A 3S8SA 4UY8T 3CD6S 2U2FA 1NXIA 3J7ZT 1YJUA 2K3IA 3KLHB 3MM6A 3OSPA 4QR0A 3MUVP 2BW2A 1VQ9S 2X51A 1SL1A 2HS4A 1L3KA 2MY7A 1XN9A 2F9JA 2G0CA 4I69A 4ETXA 4QYRA 3HO1A 3P6YC 1W2BR 3FCWA 1BE4A 3HF5A 3OTCA 3OTOF 4URQU 2XZTB 4CCHA 2NYHA 3VVUA 5H1SV 1V5VA 1Z4UA 1TU0B 3AD9C 4OI6A 1LXNA 1WELA 4CQ1A 3HDSA 3CCSS 1YVFA 3I0SA 4YR3A 2V9WA 2AKWB 2IVYA 4CLTA 4LF7J 1YRXA 1IR1A 4G65A 1NCLA 5A6WA 2DGQA 4FYDA 4LRBA 1DZ5A 1R0AA 4KT0C 4PG4A 1IKXB 3GP9A 3SDEB 1MWYA 4DV5J 3CC7S 2HHHF 4W92B 2BV3A 3CJTA 3N6LA 1VMBA 4UUXA 4RU2A 3A8JA 1SPBP 3THPA 5GAHU 2RHSB 3W62A 2VG6A 4UOGA 2V67A 3FQKA 4HYKA 2DNOA 4ECUA 5A8RB 4KO0B 2VPWB 3IXQA 5KFKA 3HVRA 2BZ2A 3OL9A 4OZ3A 5KFMA 3MTJA 2AZ3A 2GIQA 3BDEA 2BW7A 4LIWA 1P6TA 1NB2A 4NCBA 2VH7A 4QR2A 1FRJA 4DDFA 2VICA 5HL7Q 1N36J 5B7WA 3QQCD 1O0PA 2RDJA 3GIJA 2NPIA 4YB6A 4ZHRB 3V6DA 1C4CA 1FKPA 2L9NA 2Y0SD 3NGKA 5H9FJ 1RYRA 4F4AA 2X1BA 4WTOB 4BLGA 3OL7A 3MM7B 5ETPA 3CGIA 4RBTA 1VQ6S 2AYBA 1SH3A 1WORA 3D7SB 2C28A 2AJ0A 2DITA 2IC3A 3IR6B 2W2PP 4N5SA 1GXTA 3NMRA 3CF5Q 2YKAA 2R8KA 2GAGC 1EAYC 2VDIA 1NSKL 2UUAJ 3M8PB 3M8WA 3KHHA 3T9NA 1UVIA 5HMZA 4RZRA 2ZC4A 4AE5A 3Q8RB 2QFJA 2MKYA 1VIXA 4UZBA 2C3UA 3GJTB 4NLOA 5JVHQ 1EHWA 3G71S 1PSDA 2XWYA 2BE2B 3BYPA 1RTIA 4DQPA 5GVQA 2CDRB 2V4JA 4G1IA 4X4TA 1AUDA 2KHDA 4YP3A 4KTQA 2AYGA 3VTIA 4KHMA 1EJ7L 2YNIB 3QIPA 3KUEA 2YKNB 3DLGB 5LMNJ 1RBAA 3C46A 1IUJA 2ZKUA 2UUWA 4NLPA 2JH3A 4CO3A 4DJBA 2YQ3A 4C2MA 2H4YB 3DYAB 1VC6A 3MR5A 2N3LA 1J5EF 2GQQA 2DCLA 1VQMS 1IKWA 5KFTA 3KK1B 2QA4S 1YIJS 1FKOB 2DY1A 4AT1B 1B0PA 1Q53A 1TL3A 4DV6F 1N5YB 4RW8A 3IAS9 3UI3A 1IJEB 1VRTB 2VQEJ 3KHRA 2B6AB 2JFDA 5LM7E 1UVNA 2ZFHA 3UN3A 4A8XA 2C42A 2QMXA 4I56A 3D2WA 2E5IA 4OHWA 3TAMB 2XHCA 1ZZFA 3DLKB 2IJFA 1VRQC 2R2TA 2DNQA 2CG8A 1FI4A 3GE9A 5KG5A 2BM0A 3BSAA 1M1KT 4LSZB 5I4MA 2V9KA 4P7VA 1OIAA 1YK9A 2KTQA 5IWAF 2LU2A 2HRYA 1PYSB 2YY3A 3HP6A 2VBXA 2ZZTA 2YWKA 1U45A 1M5KC 2QSFA 3PG9A 2B9EA 3TA0A 3GIIA 2IM3A 4EYHB 2FGOA 4DR2F 4FBTA 1CVJA 2I9SA 2JHEA 2ZOFA 4OZLA 4JV0A 3NNCA 4FZVA 2IRYA 2YX7A 4I2PB 1TFYA 2OSQA 1S59A 4HACA 2UUBJ 2QJ3A 1JLFB 3TX0A 5I42B 2IFXA 2J8AA 1UWBA 2ZM6F 1Y3JA 3W63A 1FJ7A 4RKUC 4IG0B 5CYMA 5AJ3F 2BYCA 4JI8F 1U8WA 3TAMA 4U8YA 4DPUA 3GZ7A 1SQGA 1HBMB 3JB9k 2PSZA 2GQ2A 4P7TA 3BKFA 2IVFB 1TVRA 4EI2A 5U47A 4U67Q 1VLYA 2YNGB 3KHGA 1RHQB 2ALYB 2MZSA 1N5SA 3G9CA 5AT1B 3KHLA 1RHRB 3KK1A 4LF4F 4B3RF 4Q8EA 4M8LA 1RHMB 3BR9A 2MQLA 4DX8H 1JLGB 3CSKA 2LVWA 3FEXB 2RVJA 2B0GA 3MD1A 2CQ4A 3W64A 4ETZA 1U2FA 2UVWA 3GQCA 4FYYB 4OI2A 2ZUAA 1TZ0A 4LT6A 3EJMA 3PV8A 1JK9B 5DO2A 2C3OA 2QLJB 5KFPA 1VGYA 5LOQA 1WACA 3X1LB 2GX8A 1SIWB 2MPUA 4DG1A 1V3SA 2DNLA 3SEOA 2DBBA 2FIUA 3D1OA 3U1NA 1F9FA 4ZP6A 1XMOJ 3OLBA 1NHUA 1VRUA 2CIMA 1R0CB 2OTJS 3C19A 3QZ8A 2DNZA 3LGMA 4RU9A 4FF4A 1HFEL 1FKPB 1LK7A 5MLCV 2CJYB 5E0OA 2VA2A 2AYMA 1FF2A 1KONA 1X0PA 2V94A 3V5RA 1KDNA 4F3MA 2H4WB 3D66A 4NLYA 4DL7A 4ILMA 3D3BJ 1VIOA 4O4RA 1NH7A 2KJVA 4K4UA 3SQOP 4C9DA 2VONA 3WQPA 2KRBA 3GONA 2IC3B 1M5SA 3C2PA 2AU0A 1UVMA 1F2GA 1CJKB 1F3VA 2FB0A 5A8RA 4YS2A 2A6OA 1S0VA 2EW9A 3A8KA 4OHXA 2VPXB 3VF0B 1FD2A 4K4TA 1OO0B 3SBMA 4DFJA 2ROPA 2HKEA 2KZMA 1GNKA 1IXKA 1Q16B 1ELOA 3T6BA 4DZ6A 4HTJA 5HMXA 2MGZA 4DUYF 3NCRA 2JX2A 4ZPBA 2DVIA 1MMDA 1OY9A 3H98A 2AJ4A 2DH9A 2EFQA 3UDCA 2OIHA 3R2CJ 2XQCA 1FFWB 4NLQA 3R7NB 1BQNA 2HZCA 4BS2A 5KT2A 3BO3A 3TRGA 1WC6A 2MHNA 1DTTB 1KLMA 2ZZNA 4OI3A 1I94F 3KLFA 3FBCA 4MIBA 1WC3A 4ZS6A 5G0RA 2GHWA 3HLUA 2CNNB 4J9MA 2BJDA 4H54A 5DJBA 3NOCA 1NSQA 3POTB 1WEXA 3BDPA 4DSIA 1F1BB 5K9FA 1NO8A 1U8SA 1H2UX 1G7CB 2F8EX 4KQZA 2VIHA 1N34F 1R43A 2ZBIA 4IYQA 1VQLS 4RNMA 3PX0A 2E5LF 3ZTPA 4DMZA 1FDDA 2COLA 1K47A 1PKUA 2B9YA 3EVOA 5IC6B 1WDTA 3EX7B 1IQTA 3DOLA 3MFIA 4LSLB 2PMHA 1S7IA 2RHQB 1WC5A 2J9DA 2XY6A 4C8LA 3NBPA 5HK4A 3W3SA 4Y0FA 1R7IA 4DUZF 1KQKA 4OZ5A 5B08A 2R8HA 3BPDA 4MYUA 4PXCA 2UP1A 2B4PA 4EO8A 2A2CA 1M0SA 3AOBA 3FMWA 1DARA 5ETQA 4DV7F 4JI0F 3OR2B 2R2RA 2XMAA 4F50A 3R6LB 2DD8S 2ZHOA 3HJVA 2B5JA 1ICEB 4ZIWA 3WHIA 2VA3A 4ZLJA 1TK5A 2IBOA 3PACA 2PFFB 2L08A 3OXLA 1FRKA 3VAJA 1S7HA 2F40A 3A13A 4AXIA 2OMLA 2MZ1A 3M8RA 4FS1A 3AFGA 4ZP8A 5IM0B 1QM9A 3B8HA 3NNHA 3R5AA 4G6VB 1CULA 4RO0A 1Q5YA 2JVOA 4ZKAA 4ZA1A 1KFDA 2N7YA 4TU7A 1SKRA 2XBPA 1YBAA 4OLOA 1NKBA 1S0OA 2WSFC 3MAAB 3KLIB 2W7OA 4KR0B 1EB0A 1F2HA 2QSWA 4EZ9A 1RT3B 4EO6A 3V6KA 4Q0BB 4A8MP 4F2SA 1EARA 3TR5A 1T9VA 3P3DA 1CJTB 4Z7YA 2DRAA 4C8OA 1X60A 4WE1B 5BYQA 2BUNA 1VQ4S 5K20B 4XIUA 1IWAA 2AJFE 5JJBA 4MTPA 2B8QA 4K0KF 3F44A 1AZSB 2JRSA 1FNMA 4NOHA 1SI9A 1DTTA 1QSLA 2ACMA 2EEYA 2XS2A 3WC2A 4ZVSB 2WVCA 4MH8A 5CXTA 2ZH6A 1S1WB 4I6WA 1UTAA 2PMWA 1VYAA 4WZQA 4J90A 5CYJA 4J37A 5E41A 1JLAA 2DGXA 5MAOA 2OPQA 4GKKF 2M88A 4O3SA 4DN9A 1N34J 4Y2MA 2VQFJ 3VGUA 3MCOA 4U7UK 3LW5C 1Q4RA 2RSQA 1NHKL 3QGIA 5E33A 4DL6A 2W2NP 3GCWP 2XMWA 1YJWS 1NK9A 2CZ4A 3M2RB 3O8WA 2N4DA 2HMIA 1RJJA 1U1OA 3OUYB 1YG0A 1WI8A 2GMLA 2DH8A 3FSYA 2K7JA 2V69A 4JI1J 2Q6CA 4F4WA 2F8HA 2RU9A 3MM8A 1RGVA 2E66A 3AA9A 4ZCLA 3QNWB 4G1QB 1RWPB 2RRBA 2DJWA 2VD3A 3OHBA 3A3OB 1K1QA 2NUHA 1WHXA 3MECB 2AIRB 3ZZOA 4QYZJ 1NUEA 5J2PB 1T0TV 5KFGA 2D3OR 1RXOB 2M8HA 2I6WA 2YX4A 4DL4A 1VQ5S 2BJ9A 4JP8A 3PO5A 2HZAA 5B09A 2YVSA 4EMDA 1RWVB 3K5PA 5L1IA 2IHR1 4IFYB 4I6AA 3GYXB 2MSSA 1RAEB 2PD1A 2QO3A 2OFGX 3CIMA 3MMJA 4OFZA 2JEFA 2R7XA 5J2NB 5HROB 4C3LA 5KFAA 4AUKA 2FQQB 2XMVA 1APSA 3KG4A 4UUWA 2IJRA 3IM9A 2W9BA 4RUCA 3KJNB 3GMGA 1HW8A 2GAHC 4P71A 4TYBA 1YRTA 1LWEA 4NEYA 5HAOA 3QFWA 2W9CA 2OPQB 2Y8YA 5KFCA 2LEBA 5F9LA 1SJ3P 1ZM3A 4RW6A 3SCKE 2I8EA 2CQ3A 3GFHA 2EWHA 3CD5A 3KJFB 3ET6B 3JQKA 1LW2A 1XMBA 4J9NA 3EGNA 3OVSA 1GMWD 1SJ1A 3CDUA 4KO0A 4DR3F 5J1EB 3EXYA 2JFKA 1ZBTA 4HACB 5GADI 1N54B 4R5PA 1AFJA 1SJ4P 2R7QA 1NDKA 5FJ4A 3LAKA 3Q2SC 3T1YJ 1PJ7A 4LFAJ 3KLIA 1RUSA 1Y10A 4Y65A 3TJAA 1IKXA 2N82B 1LWXA 1Y0HA 1XWLA 3CJQA 2Q43A 1V6HA 1FFGB 2XYPB 1PAUB 1UFWA 3I6PA 3PXGa 2MQPA 3RAQA 4QIVA 4NXNJ 1U02A 5IQQA 4B9NA 4V19J 3I0SB 5DZ7A 3SV3A 1FTRA 3H2UB 3TAQA 2ZJRQ 4I4BA 4HHJA 4IKAA 5D4PA 1ZYQA 3KK3A 2UUAF 3CEDA 4BC9A 1Q8LA 3B4MA 1RT2A 2W7AA 2YWWA 2DHXA 2HIYA 4FXWA 2VQEF 2JJ4D 1Y5IB 1TV6A 2RUSA 4DHVA 5C2GA 1MN9A 4ITSA 4USKA 3GJQB 2M52A 1Y4ZB 3QSIA 3UD3P 3M6VA 4QYZK 1CC7A 3LUYA 4QWBA 5KG7A 4IQXA 2LXFA 2ZJPQ 2F4VJ 1XQIA 2V4RA 2RKIA 4LREA 1PJ5A 3QO9A 1FKOA 2HK2A 4CO2A 4DL2A 1HBNA 1X5PA 2MQNA 2WB1D 4KKOB 4P72A 2OEJA 3H7HB 3RZAA 5LMNF 4DV2F 4USVA 3PFEA 1BQMA 2PFDA 3JAMU 3BQ0A 2DR8A 4DSLA 3PYDA 5IC4B 3DOKB 4DX7A 2I0XA 3F73A 4RNOA 1QVGR 2HHSA 1FVQA 2ABYA 2NXJA 2YNIA 3HVTB 3P96A 1IBKJ 3GLJA 4F0KA 2D7SA 4USTA 4HI1A 1FDNA 3PEJA 3TQEA 1SH0A 4YFUA 3LWLA 4DPYA 3PW4A 1OWXA 3W2WB 2C2EA 1KLMB 1XJWB 4LMZA 4ICLA 9ATCB 5D0RA 1TL4A 1TQLA 4O4GB 1FK9A 4KC5A 4GC7A 1H38A 3ADAC 3CJ8A 3LOUA 2JC0A 3FBFA 4WJBA 5HBMB 4A8KA 3DOMB 2Q66A 2Y3YA 5FDLA 1FJCA 1C0UA 2C22A 3ZTOA 1NMEB 3KMSA 1Q7YT 2QMUB 3ZTSA 1B64A 1HL6A 2YKMB 4KH0B 3HJFA 1Y7PA 1GQEA 4MK9A 5IWAJ 3IWXA 2M9KA 3MMBB 2HIQA 3NG8A 2IM0A 3OTBA 4WWSA 4PR6A 4F25A 4WCEQ 1DFDA 2IAJB 2PIIA 2R3VA 3BGRB 3S6EA 2UXDF 3DFEA 3OJSA 2FZCB 1IVZA 2VBZA 3EUNA 4N77A 4NL5A 2YKMA 1VQKS 4O3OA 3FZBA 3UR0A 3RB4A 4DR7F 4FYVB 5D4NA 1RB0A 3RB3A 2W24A 2R4FA 4K59A 3ULHA 1D9DA 2HBRB 2NPFA 2Z2MA 3MHYA 3J81Y 3CCTA 1LV5A 4EFAC 3KMQA 3A4TA 2MLYA 3BS9A 4ZDNA 2HEKA 1UPPA 3C6UA 3QJJA 3CJ5A 1RTHA 3CCZA 4I68A 1TR0A 4F67A 2YWGA 2JNJA 4DSFA 1RYSA 1T8EA 4JV2A 2UXBF 1JB0C 4AXJA 2ZHAA 4IG3B 2V8DA 1RHJB 2HQFA 1MNEA 4IRCA 4R8UA 3TWZA 4DV2J 1RAGB 4ZVTB 2CNLB 4OJ3A 5LSOA 2LU1A 1M90T 3TUIC 2K3KA 1QE1A 2CDQA 3LALA 3N5BA 3BSNA 4LQ3A 4BC7A 2PDAA 1RWWB 4I7FA 2GHPA 3KFWX 2AEJA 2FVQA 4PXEA 2G1DA 5KFFA 4YB7A 2X3GA 2VOPA 1PAEX 5A0YB 1JLQA 2JVRA 3PR4A 3DDNA 3N0VA 2RD5C 4PG7A 3MR2A 4B9VA 5AXKA 1YJ9S 2CPXA 3FEZA 4P73A 1HNVA 1JJ2R 4W4MA 5HN0A 3IGVA 2KT5A 1BD6A 2PA3A 4K7QA 3TI0A 4HHHA 1J27A 4ED0A 1RT1A 4MYTA 4PWDA 4DQQA 3W2VB 1VS3A 3TVKA 2R7VA 2FYXA 3ISNC 1HPZB 2MTLA 3SIPB 2XY7A 4JI4F 2J5AA 2ZBRA 4ID5B 4MFBA 2MZJA 3A8IA 3SSRA 3MCSA 2GJFA 1C0TB 2RIJA 4RUBA 4A48A 2RF2B 2Z58B 1VQ7S 4KGVB 1I94J 3VAHA 2HW3A 1R31A 1X4EA 4I2PA 4NA2A 1TK8A 3HSGA 1EP4B 2DXEA 5KFVA 1WF2A 1UW4A 5HQLA 1UFKA 3R7SB 2RJZA 4F02A 2CQPA 1EP4A 2WAQD 3EPGA 2ZH2A 4QIGA 3D9BA 1ZA2B 4TN2A 2QL7B 3QLHA 3OV7A 3BN4A 1DRZA 2F4VF 2O5DA 2RF2A 2D3UA 2NXEA 2WK4A 2KXHA 2CPYA 1IR0A 3HVAA 4Y3CA 2VG5B 3MCNA 3UDEA 1WWHA 2VPZB 3ZC4A 4X4OA 2IRUA 4OZNA 4RUHA 3G87A 3BH6B 3DRPB 3ONQA 3CCUS 3GV5B 3N9UC 4LFBJ 4MKBA 1VQ8S 3K0JA 4K50A 1R27B 2UXBJ 1H74A 1XERA 1DY3A 2FDNA 1UMJA 2VG7A 2W1BA 2XI3A 3M32A 5DM6Q 2HHHJ 1BLUA 4ED6A 2J0QD 2DGWA 1HNVB 2BOAA 3RAMA 2FVRA 4XTTA 1NK7A 4IH7A 1JNRB 4DV0J 1IKWB 4NLGA 1FHTA 1UW9A 1ULRA 4I7FB 1T11A 2B8PA 2ZOGA 1UFLA 3DDKA 3RU0A 3VWSA 4C3MA 3TZXA 2JEGA 2P6SA 5L39A 2OPRA 4LFCJ 1JJCB 1XR6A 3BV8A 3CC2S 4OJHA 4ECXA 1HHQA 4CYUA 2VC0A 4ES3A 1I1GA 1U1PA 1P9YA 2XMTA 3B78A 2B3TB 4I2QA 4ECYA 3IA0A 1UP1A 3SCLE 5KOXA 2WVDA 1H7XA 3Q8UA 4FNHA 2R2UA 4YHHJ 2W2MP 4JI0J 2W8LA 3M9MB 2ZNZA 4Q2MA 3FBEA 3MMCA 1N6QB 3LF0A 5E3CA 3JSMB 1OSDA 3M8QA 3W7BA 4KAIA 2W9AA 4AL5A 2HGNA 3BSOA 3MEDA 2GMJA 4HEA9 3OW2R 2BQUA 2AT1B 3MM8B 5DG8A 2A3JA 3M6WA 4WP3A 2BE7D 4YN3B 3BEGB 1DLOB 5HVGA 1LWFB 3IWNC 1E6YB 1JKHA 2YKOA 1TL7B 3Q22A 1WSVA 1B0TA 1TUVA 3CNQP 2KHCA 2NSBA 1VQNS 2W01A 1T3NA 1GMVA 1HWUA 3NGSA 5G4DA 4E8UA 1DTQB 4PWUA 2J9CA 4URGA 3QRQA 4DSJA 3FRYA 2MZQA 3IP0A 1FJGJ 5H9FK 1HW9A 4TY8B 2UUBF 3NGDA 1ZZNA 2WVFA 2CJXB 1TELA 3H20A 4I6YA 2FHOB 1WOSA 2RMLA 3HKWA 4LR8A 2BACA 4K4ZA 1KVKA 2VG7B 2WSCC 2AJ2A 3IR5B 1S1WA 4RW4A 3DLJA 4ED1A 4ED2A 3L7UA 1HMVB 4IO9Q 2J0SD 4FBUA 1FRLA 4E98A 3M2UB 3G6VA 1NSPA 1OJ4A 2DRDA 5FIIA 2FTRA 2XGPA 2MLZA 4B02A 3CCVS 1VJQA 2CJKA 2FLLA 2J7UA 3QLHB 2K8GA 3LP0B 2YPZA 3F41A 4EK2A 4Z7CA 3QBCA 3Q8YA 2KH9A 4AD6A 4DV0F 4GKJJ 1GMUA 1S10A 2NZ4A 3J7YI 3DOKA 5EUHA 4YR0A 4E0DA 4S0MA 2ZH5A 5L1KA 1MSWD 1NZAA 2RT3A 3M1VB 1TKZA 5KFEA 1OY8A 4M63A 4Y28C 1RWXB 3IS9B 1X4GA 3ZZPA 4X4UA 3QO9B 4JI7J 3K5LA 2ZVSA 2ZKTA 1CQNA 4CDIA 2DCUB 2RKIB 2DNPA 1SUQB 2LYVA 3QFHA 2IA6A 1U24A 3C14A 1HPZA 2QN6B 3RYLA 3J7Z5 2UV8G 1FEHA 3HPOA 2ZH7A 4TKTA 1SXLA 2H5EA 4JI3J 1B99A 2F9DA 4ELVA 4DPTA 2YPYA 4PPZA 3C3LA 5I3UA 2BA9A 4ZPWR 1SUQA 2XI2A 4LR7A 3L3CA 2NLWA 3I32A 1U6BA 2RH3A 3VQSA 4ANEA 3OT9A 4QWEA 2IYGA 5GADU 3NAHA 4DV3J 1NKCA 4AFFA 3TZYA 3KUHA 4XPCA 4OHVA 1GT8A 5GMKa 2PGCA 3AOAA 2RRNA 3H0PA 2DIVA 3J7AN 3IR7B 5BJRA 1IKVB 1VHFA 5B0DA 2O66A 2EFPA 4EGLA 4R8UB 4N56A 1VI7A 1N8RT 3LP0A 5RUBA 4C48A 2ZE2B 2ZH1A 3R1LA 4ZVEA 1UZHA 4DR6F 2G1HA 1YX2A 1RA7A 2DNMA 3R97A 5GAGU 3FRZA 2YNHB 2DO4A 4TLRA 2WBMA 5BXIA 2KKHA 1FCAA 4JV5F 3PKYA 1WF1A 4XO0A 2XO6A 3A1YG 4F4YA 3TUPA 3TVYA 1WG4A 2GZOA 2H5JB 3KLEA 3S1TA 2PI4A 4RW6B 1U0HA 1K0TA 2XCAA 3EXCX 4URSA 1RWKB 3HZEA 5E3AA 2W9CB 2E5HA 2G2ZA 1YRUA 1DHMA 4JI6F 3UR3C 3QZ7A 1NRKA 2H1YA 2HK3A 4HL9A 1IKYB 1QJHA 3QRRA 3E8OA 3PDNA 2LMIA 4DCJB 2GO8A 3L95X 1O51A 1RU1A 2PEHA 4YQWA 3G4SS 3UVJA 4AL6A 5HROA 2E44A 4X64F 4NYOA 2WONA 4UT4A 5IFMA 4FVCA 2F5GA 2P9GA 1O5JA 4GVLA 3BSCA 3W66A 3MZIA 1N5QA 2DNNA 3W9JA 5LT5A 3DGPB 2UVUA 4C3KA 4LJMA 1RTZA 3CTRA 2OO4A 1VLOA 1RISA 1I6JA 2V8HA 3MECA 5L8RC 3JYTA 4TY8A 4DSKA 3KJQB 4HH1A 5FD1A 1WHWA 4N76A 1NDLA 2HS3A 3OFHA 4ZCIA 2BQRA 1NJZA 3OR1B 3CVKA 3CE8A 3PIOQ 3EWGA 2APOA 4FF3A 3TZWA 3H42A 5ETLA 1Q86T 1YBTA 2IJNA 1K1SA 1TL7A 1V5IB 1RAJA 2CQCA 1GXLA 4QPTA 2ZITA 3I0RA 6AT1B 3NOGA 3CCES 4PUOA 2DGVA 4EBCA 4QW9A 3ILLA
chains in the Genus database with same CATH topology
1U1NA 3IWLA 1MU2B 4KKOA 1N88A 2ZD1B 3ENWA 2YNFA 2FC9A 1X8DA 3ITHB 2OPPB 2E5GA 1X0FA 1NJIT 4DQRA 2HFZA 1QAXA 4WYLA 1LOUA 3D1HA 1HHTP 3QGHA 2HAIA 3QPIA 2XS5A 4I2QB 1UEVA 4RNHA 1VQPS 3D0IE 1U1MA 1TV6B 2FJWA 5C24A 3QWUA 5DGBA 1G6BA 4Y2IA 3RRKA 1X5TA 4ECTA 1U26A 5B0BA 1XEZA 4Z2XA 5I42A 1U48A 3BQ1A 3I5AA 3DNCA 3E51A 3CCLS 3HX9A 2UVRA 4ERDA 3PFOA 2HNDA 2V5HG 5DLGA 3QMQA 1RA6A 3KKFA 4CZCA 1SL2A 4R5PB 5KFNA 4JI1F 2HLUA 4OLPA 5C5JA 3QGGA 4DS5A 1GX6A 4GC6A 5T7LA 5L1JA 3T5JA 1YJNS 1UA1A 1RT6B 1A7GE 4DL0C 2XHWA 3LQVA 3DLKA 5KFSA 1HBOA 2B5JB 2JWNA 5DG7A 1GX5A 1QTMA 2B6AA 3I55S 4DQIA 3D28A 3UQSA 3K57A 1ROFA 2KDOA 4LVOP 5A0YA 1C4AA 3VAIA 2YNFB 1XMOF 1ZPWX 2EBGA 4NLSA 4B08A 4Q5VA 2DR5A 2QV6A 2R8JA 5D78A 3T19A 2RNEA 1F60B 1WI6A 4CH7A 1XBWA 2FHMA 3V81A 1X9WA 4Q8FA 1CG2A 1RT7A 1V9OA 3OBIA 5CH7B 2ZZNA 4X4QA 2DGTA 1KQSR 3UCUP 2JSXA 5B0EA 3H25A 1NK6A 2FJVA 2IYIA 3OR1A 4EEYA 1XR7A 4HT7A 4CH1A 3H5SA 4Y00A 1H3DA 2DHGA 2RDIA 2VC1A 5F8JA 3SFGA 4X65F 2DNGA 3CMES 1HI8A 4CI0B 1S1TB 2GGPA 5C25B 1X9SA 4J9SA 1Q81T 3NKYA 3C6TB 1S6QA 4C98A 4WFXA 2IAJA 3BGRA 4JUZA 3PVXA 2LECA 4J9QA 1S6QB 3G6XA 1UVJA 5KFBA 2M70A 2R2SA 4A47A 1AROP 1R8HA 3DRSB 3DMJA 4MK7A 1S1TA 3SFUA 2PMZD 3SQGB 3Q8SB 1FK9B 4L3NA 1QAJA 1X4HA 2BABA 3AB2B 3HZGA 4H4OB 1C1CB 3RBDA 2LEPA 3FQLA 3W2WA 2FLNA 2FHJA 4Q43A 3HK2A 3GFXA 3OXGA 2ZE2A 1VJWA 3TA1A 4QPXA 1T3OA 2R8GA 1KR4A 1Z2ZA 2WCXA 3V81B 2E9RX 3KNAA 4ZPTR 2J7WA 7FDRA 4OMFG 3NS5A 5FDLB 5BYRA 3SDEA 4NLVA 3NRBA 4BBYA 2B4OA 3TX8A 2JLFA 4PQAA 3OQ2A 5GAHI 1IBKF 2ZDPA 5A8KA 2EFOA 1QUPA 4HT5A 3H4DA 4HH0A 1KOHA 4Q45A 1FD8A 1Q7LB 3O2IA 1HNIB 3HHDA 4N8NA 5E3RA 3T3FA 2SXLA 4Y34A 2OD4A 2WRMA 2CQGA 1QAIA 3IBWA 3V6HA 3C66A 1G3OA 4B9SA 1VQSA 3NL0A 3DC2A 5T7LB 4JI7F 3GILA 1NB7A 2BANB 1JLEA 1L3UA 1FRXA 5E3QA 2J6UA 5J2MB 5L9XA 5AE1A 1IJFB 3MEEA 2FJEB 2HHWA 3DOLB 2EFGA 2B4VA 4GKJF 5HQ8A 4LSNB 2MKCA 3IN5A 3UPFA 4PPDA 1PO6A 1LKZA 2B7BB 1K73T 2F8MA 4CIOA 3ETOA 5DQIA 2L48A 4YR2A 3HHLC 3KLFB 1R89A 5AE2A 2DNRA 2WOMA 2KG1A 3CO9A 2VFVA 1UEUA 5J2QA 2B51A 1CSJA 2J0XA 2K2PA 1RI7A 4H4MA 3UFCX 5EWGA 2KN4A 2LCWA 2Q3PA 3JTPA 4NWBA 2FHKA 3PJXA 1VRTA 4F4KA 3DI6B 4BHQA 5HP1B 5LSLA 3V6JA 4J9LA 5DLFA 1FESA 3H5XA 2EKYA 3UW1A 4QWCA 2QA2A 2F1FA 3G8QA 2M5YA 5LMUF 1MU2A 5K8NA 4CH0S 1JWWA 5KFIA 2ALZA 2VV5A 5HLFB 2MHEA 2PT0A 3VAFA 2HNZB 2F3JA 1BY9A 3QIPB 1UJ4A 4FP9A 2HWTA 4MIAA 4R25A 3JSBA 4A8SA 2FJBB 5B0CA 2AX1A 3OTDA 2EI5A 1N33F 1UVKA 5IQ6A 1UJ6A 4PXBA 2GMHA 4DPOA 2ZJQQ 3CJ0A 4FPRA 1LWEB 2ASJA 2V2KA 1HI0P 3GFYA 4B9MA 3M30A 1EETA 1TL1A 3VR1A 3KG0A 4PRFA 2N7CA 5DQGA 1VC0A 3CMAS 4W90B 1HNZF 2GHVC 3I0RB 1FXLA 4F3QA 4C8KA 2G4BA 1S9GA 4F2RA 2FJDB 1LWCA 2ASLA 1QUVA 2HMIB 2EPIA 3WDOA 2OPRB 2HQ3A 1KRPA 3M8SA 1N52B 2EVZA 5EN1A 4FVMA 2M3DA 1FNOA 2ZOMA 4YMEA 4EUVA 3UD4P 1LQ9A 3JYTB 4NLRA 3HFKA 4G1QA 2V8VA 1N5TA 1N4LA 4DF4A 3BGFA 3DRRB 4DOZA 4FF1A 3CULA 4XDCA 2E1AA 3SCJE 3IRWP 2KFNA 5IT0A 2AGQA 3R5DA 5J2QB 3UWTA 5EWFA 5LJ5Y 1YTYA 2VBWA 2FVCA 5CZVA 4IG0A 3LPYA 1XTZA 2HVZA 4K5RA 1LW0A 1UWBB 1WTFA 1Z2LA 4WF9Q 3CC4S 1BWEA 3GR1A 5IZHA 1U6FA 1YJTA 3M2VA 4R0EA 1T94A 4JOUA 4Q0BA 3V2UC 1DQ9A 2O1PA 2ZBCA 4LFCF 2HRUA 2DR9A 4Y2AA 3D54A 4ALZA 1OPZA 4LQ9A 4B9LA 1JXEA 2W4CA 2WOMB 1J2VA 5F8MA 1UKUA 1Q8IA 2KYZA 2V0NA 5IM0A 2AGPA 4WFAQ 2CPEA 5EX3A 2HHVA 2MQMA 4CO5A 3ENQA 2XB2D 2IBKA 4U9RA 1YITS 4D3HA 4KHRA 4K4SA 5F3TA 1T03A 1S99A 3IAM9 3OPKA 2MJUA 1X5SA 5LXRA 1DQ8A 3M6UA 3MM6B 2HGMA 1M5HA 1SC6A 2GO9A 2NR0A 5J2MA 3N5FA 2DRBA 3MFHA 3TUZC 3MEGB 1LXJA 5EDWA 3HVWA 5FLXY 1NK0A 1N0UA 3ISND 5I3UB 1WHVA 3K8WA 2BQ3A 3N79A 5DS7A 1C1BA 1UA0A 3NCQA 4BCAA 3TAPA 3AY0A 1KVJA 1DAXA 2MSTA 3PEHA 3I87A 4X4NA 2HHQA 3SCIE 1SKWA 2E7WA 1HNIA 4N8OA 2LA6A 3NWGA 4WKYA 2BE2A 2MKJA 3QJLA 3AQPA 2W4PA 2CFXA 4KE5A 4PCQA 5D4LA 2I2YA 4QCLA 3NBPB 4A46A 1HWJA 3L7PA 4RW4B 4F4ZA 4USIA 3N6NA 5EX0A 3AHPA 3THVA 3O5TB 4AL7A 3DMJB 4I64A 2BJEA 5GAEU 1U1QA 1D8YA 2G9OA 3BB5A 4NCGB 3V4IA 1VC5A 1PC4A 1UJ5A 3N6MA 4H4OA 1RT5B 4MAKA 1Q8BA 2DHAA 4TY9A 3TA2A 3H4BA 1C2PA 2CQ1A 3MOJB 4RBUA 1DJ0A 3QJPA 1P9QC 4IUFA 1HBUA 5HBMA 3HHLA 3KK2A 4C7QA 3ISZA 4Q7AA 4EYIB 3KG1A 2Q6BA 1NK5A 2XZWA 3RAXA 1ZETA 1DTQA 2FPHX 2LXIA 2DISA 2VG6B 4O44A 3CJKB 1LWCB 2D9PA 3HVTA 2JDJA 2VODA 4LVNP 4DFPA 4U6PA 1BQMB 3RTVA 4QIFA 2BBEA 3VZIA 3PW0A 1R0AB 3UNGC 4WTYA 3M8QB 1RWUA 4ELUA 1H2VZ 4H4KC 2D41A 1N6QA 3IFEA 2DPJA 3IG1A 3VALA 3KYLA 5J1NA 1UVLA 2CJQA 1RQ0A 4ED5A 4I67A 4B3MF 2HG4A 1TKTA 1G1XA 1Q78A 3WC0A 4L72B 5EGYA 2ROEA 3DRPA 4NA1A 4C97A 5KAKA 1RT2B 3BREA 2FUG9 1FE4A 1FRIA 3QGPA 4WU3A 2KFZA 4OJGA 2HWHA 5AXMA 2GQCA 2EFNA 4ECRA 2O3DA 2K1RB 4IRDA 4NRTA 4ES2A 1RTJA 4QIWD 5A2QY 2YNGA 2HNDB 3QAEA 3M32B 4X66F 3VCDA 1RK8A 2QMWA 5A8WB 1SIZA 2NXUA 2YKPA 3VQTA 4NLUA 1ZH5A 2POKA 3I5BA 3R27A 4NLXA 4FNIA 2FHJD 4QBUA 1NAQA 3N4WA 5CZXA 2DTJA 4CNYA 1KEKA 2HFNA 5KFOA 3EYZA 4DR5F 2E1MC 4LUBA 4NZ7A 4RX6A 2ASDA 4DS4A 1S6PA 3PNIA 4A8OA 2M4MA 3IG1B 1RTJB 2L9WA 1N5YA 2AW0A 3MAHA 3MTKA 3U1MA 4PXDA 3DLLQ 3AJ2A 2ZD1A 4DQSA 1JLEB 2YKQA 4DF8A 2XMKA 3FJ2A 2ZZMA 4LFBF 4IOAQ 3SXLA 1D9FA 4IDKA 1QE1B 2MJNA 1HQUA 2DPIA 4DL5A 5DQHA 3TO8A 2CQ0A 4HKQA 4TU9A 2LKZA 1TKTB 3O3LA 3TNVA 5ADZA 3DLEA 4U7CA 4ED8A 2OMOA 2VBYA 1W2IA 1F5AA 4B3TF 1U2RA 2XMJA 1W25A 4DFMA 2KT2A 4RUAA 2FD2A 3IGNA 3I31A 4EZ6A 3KK2B 1TKXB 3DYAA 1VK8A 4MMOA 5BR8F 4ZMMA 5IT9Y 3ZFVA 1RT5A 3ZZUA 4C8ZA 2WONB 4IO1A 4IH6A 3LH2S 2Z4PA 1S9EB 1IKYA 1C1CA 1QAYA 1RKJA 1FRMA 3G96A 3E01A 2GJIA 3CCWA 4HVZA 4IR9A 3V6DB 3ZZTA 3SQGA 4OV1A 3PX4A 3K2YA 1S76D 1RDRA 1P1TA 4O23A 1S72S 1JX4A 2BVZA 2Y1JA 1TP7A 2KO1A 2UV8A 1XNQF 5ITHA 1FE0A 3DHXA 1Y00A 4X4VA 2E7XA 2L3MA 2R7WA 4DWIA 2I5JB 3HT3A 3DOMA 2VKRA 3HMJG 2AJQA 5M2PA 2V8GA 3MEKA 2JLEA 3EZUA 5LJ3Y 4B17A 2RQMA 1SKSA 4J9RA 4OX6A 2V4QA 3AJ1A 2Y1IA 3LAMA 4QQBA 1R8AA 3K7RA 1TK0A 2CJAA 3O6QA 3J7YU 2KYXA 2GA7A 4USHA 2FY1A 4CT8A 1T03B 1JLBB 2XSFA 1K8AT 3N28A 3D1QA 1C1BB 3DN9A 5KFRA 3NNAA 4DLEA 1U4BA 2P9CA 4P6QA 3KK3B 4WU2A 3MI7X 5JUMA 1Q82T 4YB5A 5L9NA 3MEGA 3CDEA 3Q8PB 4K2XA 4QWDA 2Q1LA 1KS2A 5B0FA 2CPJA 3DRYA 3M1VA 2HVIA 4RW7A 3OL6A 4RNNA 2JLGA 3T9ZA 4EBEA 4RLEA 2GJ2A 1CLFA 3BF4A 4FXDA 3H2LA 4O3PA 5E7OB 3AB4B 2M0GB 5F8GA 2C3YA 3CIZA 2ILZA 4XAKA 4JYAF 3F56A 2JEIA 2DNYA 2VFSA 1WNEA 3ICLA 3J80Y 4LIRA 2C2DA 2C3PA 2W25A 2BM1A 2L41A 5KFUA 2K1RA 3CWJA 2D9OA 3Q8QB 3KLVA 4RW9A 3ZZZA 2PC6A 4MKYA 1RKIA 3I9ZA 1QSSA 1N32F 4HI2A 2AJ1A 2CQBA 5F8IA 1K9MT 3P49B 1P27B 1KHVA 5EWEA 4K4YA 3PX6A 1HNXF 3K8VA 2CJ9A 5F8LA 2MQQA 1PGZA 2LQJA 3DRRA 4WFZA 1KLNA 3DLHA 5J2PA 1MROA 3GFZA 4CO4A 2FC8A 3E01B 4QOTA 4WFYA 1R3NA 2HHXA 2W9BB 4NYPA 1V3ZA 2P9EA 1X4BA 5T14A 1CEZA 5C42A 1DURA 1ZAVA 4TXSA 2KB2A 1TKDA 3I82A 1LWFA 5CQGA 1HR0F 3MM5B 4ZOSA 5HLFA 2R7UA 1VBYA 4ZK7M 2IMOA 2B56A 4X84A 1U47A 3GG1A 2RU3A 2ADBA 2E1RA 5CA5A 4DL3A 2HFOA 3LP2A 3U7JA 3IO1A 4GO5X 2J0WA 4WIIA 4OX8A 1OSCA 1MROB 1JLAB 4M5DB 1TVRB 3DLEB 3QWPA 5D77A 2MXYA 1LK5A 3EPIA 1M5PC 4KFBA 3LWMA 4O0IA 3L09A 5CCMA 3OUYA 4ATNA 3JAMY 3A8EA 5M2UA 2K7KA 1Q79A 4NLTA 5KFHA 4AYBD 2M7SA 2Z8QA 4NXNF 1QY7A 2LDIA 2A2DA 3TYTA 3V4IB 2XMUA 1VQOS 2M8DB 5DM7Q 1M5OC 1NKEA