1SI9A

Boiling stable protein isolated from populus tremula
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
TRTPKLVKHTLLTRFKDEITREQIDNYINDYTNLLDLIPSMKSFNWGTDLGMESAELNRGYTHAFESTFESKSGLQEYLDSAALAAFAEGFLPTLSQRLVIDYFLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords stable protein 1
publication title The Structural Basis of the Thermostability of SP1, a Novel Plant (Populus tremula) Boiling Stable Protein.
pubmed doi rcsb
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1si9A00
3BDEA 3HHLC 2HLUA 2ROEA 2VV5A 3HFKA 3KKFA 2FB0A 4OJHA 1CC8A 1YJUA 3TNVA 4U9RA 2XMJA 5B08A 2FIUA 3KG1A 1XBWA 3HHLD 3HX9A 4F67A 1SI9A 1JK9B 2PD1A 1X0PA 4HL9A 1N5SA 2KT3A 2K7JA 1KVIA 1W2IA 1RJJA 5B09A 3FGVA 2N7YA 1OPZA 4OJGA 2GFFA 1AFIA 1CPZA 2FTRA 3IWXA 3BM7A 5F0WA 1Q4RA 1ULRA 2RILA 4EFAC 5B0CA 2GGPB 4NPOA 1U7LA 1YJRA 2RU9A 1CC7A 2GCFA 2IYIA 1YG0A 2GGPA 2LXFA 1WD6A 2AJ0A 2HLTA 2IYGA 2HIQA 2K1RA 2XMVA 2OD4A 3HHLA 2OAUA 5K9FA 5B0DA 2QLXA 4ZOSA 3TOQA 2QLWA 2AJ1A 3FMBA 2EW9A 4A4JA 5T7LB 4HH0A 2OP5A 1YRXA 3BB5A 1S6UA 1MWZA 1LQ9A 2KKHA 3E8OA 1FVQA 3BN7A 1YJVA 5T7LA 1KQKA 2RSQA 2W4DA 2FHMA 3BGUA 1Y0HA 2OKQA 2QYCA 2ZDPA 1OSDA 2OD6A 4ZA1A 1N5VA 1Q8BA 1S6OA 1FVSA 2BBEA 4A47A 5B0BA 1FE4A 5IXUA 2XMMA 2BJDA 2BJEA 4YEAA 1AW0A 2GV1A 3LGNA 2KT2A 1P8GA 1P6TA 1VQSA 5A6WA 2AP6A 4HI1A 2K2PA 4QOTA 2BYCA 1Y3JA 3MCSA 3QMQA 2ROGA 2GA7A 3HDSA 1FEEA 2ASYA 3F44A 2OMOA 4DN9A 2IFXA 2K7KA 2LQ9A 1R6YA 3I9ZA 4FNHA 3HF5A 1SQEA 4OIXA 2HFNA 3LGMA 1AFJA 3CJKB 2ZDOA 1X8DA 4Y2KA 2ACYA 2JDJA 3DCAA 1KVJA 4OJ3A 4HH1A 3MZIA 3QGPA 4Q2LA 2RMLA 2HQIA 3KG0A 3KNGA 1GXUA 3K7RA 4Q2MA 1APSA 2L3MA 1N5TA 3UDCA 1TZ0A 4FNIA 5A6PA 1OQ3A 2W4CA 3BF4A 2ROPA 4HI2A 1FE0A 1YJTA 4OJ1A 2CRLA 2XMWA 1FESA 2QIFA 2KYZA 1GXTA 2G9OA 1K0VA 3TRGA 2BUNA 3BR8A 3WDOA 1IUJA 2VH7A 3DXSX 2Q3PA 5B0EA 1Y9OA 4Y2MA 2XMTA 4A48A 1QUPA 1Q8LA 2GO8A 1N5QA 1SB6A 1VQYA 3GZ7A 3IWLA 4DPOA 2XMKA 2LQBA 2XMUA 2AW0A 2N4CA 1JWWA 4YDXA 1URRA 1Q53A 2LDIA 3FRYA 3CJKA 4NL5A 3LO3A 1FD8A 4DL0C 1OQ6A 1X7VA 5B0GA 5B0FA 2OFGX 2N4DA 5KAKA 2W4PA 5B0AA 4A46A 3T9NA 1TR0A 1TUVA 3HHLB 2K1RB 3VTIA 2OFHX 1Y3KA 2HFOA 5F0UA 4Y2IA 1TL5A 1MWYA 1V3ZA 2PGCA 1TL4A
chains in the Genus database with same CATH superfamily
1FDBA 3JQJA 4OJHA 5THWA 3R7SB 3ENAA 3Q8SB 1SI9A 3KJVB 3D1HA 3TYTA 2XMAA 2F1FA 1ZM3A 2HHXA 3CCUS 3OQ2A 4IOAQ 2ZBIA 4K4ZA 2FJEB 1GXLA 3R5JB 3CDUA 4CLWA 3JYTB 4UZCA 4L76A 2GIFA 5KG4A 2VBYA 4HHHA 1L3SA 2W2OP 2FHOB 3AB2B 3IS9B 5B0BA 5K8MA 3I0SA 3PX6A 4PG5A 1KNZA 3HSGA 3A3OB 2YWWA 1RT4A 2XO6A 1YBTA 2DH9A 2C2EA 1NEEA 3K0JA 3G6ES 3MCMA 4J9MA 5EWEA 3PHTA 1IUJA 4B9SA 3V6HA 1MROB 5D8HB 4CM2A 1X4FA 4Z7CA 4ZPBA 4QYRA 5CD4H 2XC9A 1M5OC 3UD4P 5KT2A 3J81Y 2HVEA 1NSKL 2DPJA 5H9FK 1T9TA 2ZD1A 5IQQA 3P5TL 3IGVA 2OTLS 3M4XA 3QIDA 2YWHA 2GJIA 2FC9A 2E1MC 2RRBA 2XLKA 1R27B 5KG2A 1AUDA 1OO0B 1S1UA 4PG4A 3GV7B 3TW0A 1S6UA 1IR0A 2V6AA 3PYEA 3AOAA 4USWA 4KHMA 2B3TB 4DCPB 1KBRA 2XM3A 2KT2A 5KG0A 2B4UA 1OYEA 1RYSA 3I96A 1FT8A 1HL6A 2MQNA 1DARA 1ICEB 1EARA 2HQCA 4BC9A 4XO0A 1G3OA 4JBCA 4RW4B 4P72A 1ZYQA 1QTNB 2MLXA 2ZWOA 2NZ4A 1B70B 1LFPA 2LU2A 3LWLA 2GVZA 2QLFB 1Z2ZA 5FD1A 3CVKA 4DV0F 1DZ5A 3C15A 5HBMB 2DGOA 3Q89A 3HI9A 5KAKA 1PAUB 2H5IB 4GMKA 1ROFA 3H2LA 3B4MA 5IS2A 3Q8QB 4I2PA 4MIWA 1M5SA 3BDEA 1PJ5A 5KFNA 1FRLA 1TFWA 4ZHRA 1BHNA 2Y8WA 1LW0A 3MPDA 1SUQB 3OBIA 2MJNA 5G0RB 4JI4F 2OD4A 3VQSA 3A8JA 2XSFA 3BB5A 1FXDA 4WBFA 2W9BB 2E5LJ 3FSYA 3DOKA 3CJSA 3HLUA 5CA5A 1DQAA 2ZHAA 2Q6CA 2X7IA 2KFYA 4M94A 1FO1A 4URSA 1TKXA 2VPWB 4FVMA 1I94F 1C4AA 4OHWA 3GE9A 2NSBA 4OJ1A 2DIVA 1SKWA 2BM1A 1RXOB 2MHNA 5L1LA 3C14B 2VKRA 1EIYB 5J2QB 3KK3A 3AJ2A 1QAXA 4OZLA 2KT5A 2OTJS 1Y3KA 4ES1A 4MMOA 3ENQA 4GO7X 1UZHA 1R6VA 3JAMU 2WBMA 1X4BA 1TAQA 1HI8A 2J9DA 3POTB 5F8LA 1NPKA 4RW7B 1IBCB 4M5KA 3DDIA 1T02A 3UPFA 1S9FA 1Q1KA 4RLEA 4ECYA 2CNOB 1U1NA 2AJ2A 2GO9A 5HN0A 2YKOA 3UCGA 1OSDA 3DU5A 3HVTB 2BJ9A 1Q8BA 3T3FA 3N79A 2BJDA 2IAJA 5IM0B 4KFBA 1C1BB 1NDCA 2FZCB 1REVA 2D7SA 3RR7A 4CH1A 1O51A 2HHSA 3ILOA 2XYHB 4C0OC 2ZBQA 1RT7A 3UO0A 1N0VC 4DL4A 2XQCA 3IR6B 5AXMA 5B0EA 4EBEA 1M5KC 2N4CA 3TZXA 5ETQA 5K8PA 3SV3A 2FHJA 2KG1A 2R2UA 2V8HA 5BR8J 2VODA 3TO8A 2ADCA 1WACA 1WOOA 1S57A 5D0RA 2NR0A 4RW8B 1Y10A 4MYTA 3V81A 5C2GA 4F25A 1PBAA 2DGXA 1AB8A 1YQHA 5FDLA 1LK5A 1RT5A 2DGTA 2HIQA 1UWBA 1Q5YA 3BSCA 1Q82T 3T5LA 3ILJA 5A76A 1BLUA 4PYDA 3OT9A 2BE2B 3ETOA 2DT9A 2GV1A 4ED4A 2YQ0A 2DY1A 1NSQA 5A2QY 4FN5A 2AJ4A 5GMEA 3DLKA 4C0BA 3HDSA 1T9UA 2VQFF 5KFBA 3AT1B 3MEEB 3BH7B 3HK2A 4X4TA 4I4BA 4E8UA 3G96A 1JLFB 4BHQA 4QR2A 2H4YB 4V1Ak 2FLPA 3BZQA 2ZOMA 3BGRA 2KTQA 5ETMA 2HK3A 1S4FA 2W01A 2WBRA 1C4CA 3AAWB 1U09A 3DI6A 4F3QA 4OV6A 4Q0BB 1EP4B 2VDIA 2R2TA 1DRZA 1H3DA 4DV5J 4CLYA 1M5PC 2GFFA 2KO1A 2NYIA 2VQEF 4KGVB 2HGMA 1HWIA 1TTHB 1YK9A 1DLOB 1M90T 1R8PA 3I5AA 2MY7A 4ZKAA 3N6MA 2NREA 3G86A 2W2NP 3C3LA 2J0WA 2B5JA 1J5OB 4USMA 3GJQB 2UUAJ 2QL5B 3W62A 4CNZA 3OW2R 4WP3A 4WPAA 4MFBA 3LANA 4HH1A 3O5TB 1M5VC 2C3YA 4PUOA 4U7UK 3T1HF 2HKEA 2B9XA 1VC0A 4UOFA 4RJVA 3MMBA 4LFCF 2LVWA 4WFZA 4OX8A 2MKSA 3WDOA 1U45A 3QYYA 4A48A 2YWKA 1WKLA 2QSWA 3EGZA 4DX7A 1XNQJ 2YWGA 8RUCA 4RKUC 4B3OA 1JJHA 1TUVA 2LFVA 1SJ3P 3VQTA 3LPYA 4ZCKA 5F0UA 2QZ8A 2FHJD 2IDEA 1RA7A 1RT2A 2ZHOA 2C2KB 1X0PA 2G1DA 3KJVA 4ZCIA 3L95X 2UXBJ 1FRIA 4PQAA 3LAMA 2FVQA 2FJBB 3E01B 4RU2A 5KFIA 1WI6A 4RX6A 4OZ1A 3N5FA 3N0VA 2CFXA 2D3ZA 3IS9A 3R97A 3QLHA 2FVRA 4QWDA 3ILLA 4CO0A 2LQ9A 4DSKA 1XTZA 3CJKB 4JI8J 4Y2CA 3NBPA 5CCMA 1C0TB 5HK4A 3QGHA 1WELA 1YJTA 3SQOP 4EBCA 3PFOA 3GZ7A 2MTLA 5LXYA 4MAKA 5DQGA 4DR5J 1FHTA 3HJVA 1IKXA 3O44A 2ZE2B 5HLFB 2FLNA 2AX0A 2E66A 1KLMB 4YB6A 1MMNA 2YH0A 2V4QA 4LRAA 1HI1A 2KDOA 1UW9A 1LNQA 2UV8A 2DGVA 5K9FA 1AA1B 2L9WA 4PXCA 1KD1T 1KQKA 1U6BA 4IRKA 3HSDA 3GFXA 3X1LB 4RW9B 4ZS6A 1GX5A 4NLQA 1N5YB 4ECZA 4ZLPA 2DRAA 1VRUA 3H0PA 1HR0J 3J81j 3KJQB 3NXZA 5L38A 3JAMY 1GMVA 3EGVA 2W7AA 1S0OA 2CQIA 1VJQA 4U7UD 1OSCA 2V8PA 5CCLA 4ZLNA 4ZPDA 5I3UB 4IFYB 2EFQA 1AROP 4M8LA 2J9EA 2RQKA 1IJFB 3P4UB 4FF4A 2N7CA 1N5SA 1ZH5A 4NWBA 3DHXA 4LF6F 2GAGC 3W66A 2V94A 2L9DA 1F5BA 1RHRB 1VHFA 5I42A 2UUAF 3JTPA 3GV5B 2ZNZA 2W4DA 2L41A 3SCLE 1UVKA 1C0UB 3TEHB 3HPOA 3IM9A 4DV7J 2VU5A 5KT7A 1WG1A 2E1AA 2RRAA 1VRQC 2VFUA 1FNOA 1F2HA 3T5JA 1OS5A 3IA0A 3NCRA 3FEYB 5KFWA 1APSA 1U47A 2ZH4A 5DJBA 1Q7YT 1N54B 3OTOF 2IPOB 5KFMA 1F9HA 4A8OA 4J9NA 4R5PB 3WC0A 2FVSA 1S1TA 3C14A 2YPYA 2XNQA 3HHDA 4LSLB 2FY8A 1UFWA 3BGOP 4DX8H 2XWYA 3DXBA 2ATLA 2IDLA 4NE9C 1Q86T 5DQIA 5CHCB 1ZTWA 5KT6A 3O6QA 1ULRA 4NXMJ 2WHOA 1WD6A 1S76D 1VYAA 1XJWB 2VA3A 4JOUA 1BY9A 4B9NA 3HD2A 4F4ZA 2RNEA 4X64J 3BSNA 1FNXH 1V3SA 4CIOA 2XI3A 1DJ0A 3MF5A 3WHIA 3UDVA 2NPIA 1UVMA 1DHMA 4NCBA 3B4DA 1WKKA 2IBOA 2ZEJA 4YUDA 4HVZA 4F0HA 4ETXA 2HEKA 5GMDA 5KOWA 1BGXT 1T11A 3M2RA 4A8XA 2HZVA 1NZ8A 4PABA 5AJ3J 1WC1A 1MW7A 5GVQA 2X51A 3PYDA 4CLFA 2KJWA 4RW8A 2V4JB 5L9NA 3RRGA 5U47A 2R7XA 1M1HA 2KZMA 5E3QA 1S1WB 1U6FA 2M2BA 2E44A 2M7SA 2BX6A 4ZPWR 1IBKJ 1KS2A 5KFYA 2OKQA 3BREA 2ZFHA 3M8PB 1IBLJ 1KN6A 3W8GA 3OTBA 1FJ7A 2WVFA 2AU0A 1CQMA 3FJ2A 4K5RA 4L3KA 2BJ7A 3DYAB 3CCRS 3HM9A 2QL7B 4QW9A 2DNLA 3RB6A 3DKDA 3MEEA 4B9MA 4ZDNA 2VIHA 3UDCA 4DR6J 3DU6A 2YKMB 2JFDA 1NU4A 1JLFA 3NNCA 2BANB 3NAHA 2ZZTA 1SQGA 5EHHA 2ASJA 3UD5A 2B4OA 2EK6A 3CD6S 6AT1B 3B54A 4QR0A 2AEMA 3PJ9A 1UVJA 1V3ZA 1FCAA 2CXEA 4OYIA 3KHLA 1EP4A 3ZNJ1 2ZZNA 2PMWA 2IBKA 1HW8A 1T3NA 4Z2XA 4IOCQ 3QFHA 3BKFA 1IQZA 2R7QA 4ZPCA 4NCGB 4OI2A 1Z4UA 4WFAQ 1LWXA 1WKJA 4GC6A 2XS7A 4V19J 3MM5B 3GG1A 3ZTSA 2VC0A 3BN4A 1CJVA 3QWUA 4PYAA 1NPPA 2CPHA 2I6WA 5K14B 2RF2B 3I55S 3MZIA 1V9OA 1D1UA 5DETA 1HD1A 5BJRA 3CDWA 4NRTA 1GAOA 3HZEA 3A4TA 3C6TB 2IJNA 4OHZA 2VFVA 3VF0B 3CPWR 3IWLA 2LQBA 3BBFA 4MIBA 3M8QB 1WC0A 1IJEB 2B6AB 2B56A 2KZZA 1W7WA 2AEFA 3RBZA 4JV5J 1SC4B 2MQOA 4MT1A 2QMWA 2F5GA 1U1LA 4MK9A 3GSIA 2PGCA 4CWBA 4Y0FA 3HFKA 2OI2A 3WX4A 1S5ZA 1RTDB 2F4VJ 1LWEB 5DDPC 4IH5A 3CMAS 5IWAJ 4B3MJ 2RILA 1ZAWA 1HBOB 4KHRA 3GB0A 3HFZB 3DLGB 3E01A 2DNYA 2OPQB 2O67A 3CJ8A 4M5LA 1NRKA 3QT8A 4DUYJ 2RUGA 4C7QA 2LECA 2YNIA 3OR2A 2VONA 3E2EA 2NSCA 1NKEA 3T6JA 1QAJA 2HVIA 5T14A 3AXMA 4ZVGA 2KRRA 3RBXA 4YR0A 1FI4A 2YTCA 4ID5A 3ZTPA 1R8HA 4IG0A 1OYDA 2IM3A 4JP8A 3NS6A 2XS2A 4H54A 1GK8A 4ED6A 1SCJB 2QMXA 3VVUA 1I3OB 1QLNA 3OLBA 5L1JA 3IRXA 1WHYA 4DSFA 3VGUA 1HNVB 3DRSA 1M5HA 2IY5B 3TX8A 4DS5A 4DUZJ 3T9NA 5IT4A 2BMBA 3CJTA 3GONA 3US5A 3A3NB 4F0KA 3HULA 3PW7A 2M4MA 3GR1A 4OQJA 2FDNA 4YQWA 3VCDA 2I5JB 4DWIA 5F41A 2DNQA 1PILA 2XS5A 1SL1A 3R5GA 3U27A 3DNCA 4JYAJ 2J76E 1WEZA 4DPUA 4ECSA 2AJFE 2IYIA 3PJWA 2AJ0A 4CLUA 4KV8A 2V8VA 4ELTA 3MR7A 2QL9B 2AT1B 5ETOA 2JEIA 3MMAB 1X9SA 2A0FB 3ZO7A 2XULA 2X1BA 2QO3A 1YDLA 5KFTA 1PYSB 2F9JA 4DSJA 3KG0A 1N5YA 3FSXA 1DBDA 2Z4PA 3FNNA 1W2BR 5KG3A 4FYDA 5ETPA 1WEXA 2H5JB 1HBMA 5DGAA 2SXLA 5KFFA 3KMSA 3I0RA 2RIJA 4A8YA 2AW0A 2KG0A 3SI8A 4C6AA 3EDRB 1YVFA 4I2QA 1QD1A 4R25A 4DHVA 4WWSA 1AUSL 4IFYA 1HBNB 4IQMA 1NZAA 3UWTA 4JI1F 3FK4A 1XERA 1H38A 2GQQA 4LT6A 1R0CB 4Y2AA 5T41A 3CDBA 2W9AA 3A12A 3OJSA 4UOCA 2D69A 1MMLA 4ENOA 3U1NA 2N3OA 3WX8A 1JLCB 2ZDPA 3NP5A 1WWHA 2V63A 4C48A 5DDOC 1C0UA 1GMWD 1RKIA 3QFWA 3L3CA 5KFZA 4AL6A 3NLCA 1RCOB 4EUVA 2M5YA 2DNMA 4KJIA 4X4VA 1HQUB 2QEXS 4PXBA 4QZVB 3THPA 1S12A 1SL0A 3QWPA 4PG8A 3CCZA 2A1BA 2IVMA 2E5IA 1DTQB 1UAWA 3H4BA 3R6LB 2XZTB 3GYXB 2D9OA 3HT3A 4J9UE 4ZN1A 1REGX 3PJXA 4JI5J 1SQFA 2OFGX 4M5MA 3Q2SC 1BQMB 1K44A 4X66J 4N41A 1TFYA 3W8PA 3FUYA 3NCQA 1SC6A 4WYLA 4F26A 2J0XA 2XG8A 4HL9A 1U2FA 2K7JA 2KH9A 3C6UA 1CJKA 3TJ9A 1DTTA 4J9OA 4PEOA 4LMZA 4KY3A 2PFFB 3HHLA 2HBYB 1EKRA 1RTHA 4ILLA 2E9RX 5D4OA 1MMDA 3TARA 5HJXA 2R42A 3NGUA 2J0SD 2KXHA 1P9QC 1PSDA 2N82B 5I3PA 3SYZA 1CSJA 1JKHB 2QC3A 2I0XA 4F4WA 2J9CA 2V9WA 3N4WA 5ETTA 1J5EF 4K0KJ 4FDFA 4OIXA 3CC7S 4M5DB 2JDJA 1XNRJ 1RAJA 5IT0A 4RU9A 5JJBA 1T3OA 2W8KA 4LVNP 2AKWB 2ZZMA 4HI2A 2PDAA 1WG4A 3CCQS 3B78A 5J2MB 1SJ4P 3SMZA 3PHEA 1HHQA 3KUGA 1KVKA 1UEVA 2N4DA 4LF8F 1KHVA 3FBFA 3DM2B 4JYAF 3V6JA 2YNGB 2NUHA 2HHWA 3PO4A 3C46A 4LF5F 3W2VB 1TKDA 3AODA 5B08A 4S0MA 4NA1A 2ERRA 2UXCJ 1KP6A 3OR1B 4ZVOB 4JUZA 1GFWB 5A8KB 2V4JA 2HGLA 4ELVA 3H98A 2EFPA 3PW4A 3CJ0A 2OHDA 3L4BC 1S1WA 1VK3A 4I6WA 2HBRB 2CQ4A 2MKYA 2ZH9A 2R7WA 2H5EA 1YKWA 3GJTB 2B4VA 3VHQA 3M8PA 1N6QB 1WUUA 3TP2A 2GA7A 2XZDB 2LCWA 3S1TA 3HXMA 1EQ0A 2ZBPA 5DG8A 4I6YA 1ZPVA 3DYAA 2ZBRA 2X3GA 2RKIB 1H73A 4C8NA 3RBDA 1UVNA 2CPJA 3ZC4A 3R3TA 1YITS 3M2UB 3KK2A 4DDFA 1IBMJ 4NLVA 5A6PA 4XK8C 2Q43A 1ZM9A 4EMDA 2H65B 2YKMA 4DQRA 1U26A 3BV8A 4Y2MA 2BANA 1WC4A 5L1KA 2H4WB 4MYUA 1WHXA 1IKYA 5B0AA 1CG2A 4TXSA 2E1CA 4JI0J 2DNOA 3FFIB 1N88A 2MLYA 1FK9B 4R8UA 5E5NA 1RE1B 3SFGA 3EUNA 2E7VA 2JX2A 3R7NB 2X1AA 1WTFA 4FYYB 2MB0B 3FMBA 1FVQA 1YJVA 4NA2A 4ZPAA 4K4YA 5KT3A 2HRYA 4RZRA 3R6GB 1VMBA 3HCXA 3M2VA 3MM7B 3EWGA 2WRMA 2DO4A 4M5NA 1R6YA 4HYKA 4DFKA 1JJCB 4HACB 2C2NA 3GIKA 2RF2A 4CLPA 4F4YA 4ED7A 3RRHA 4FKYA 1SJ1A 1G6BA 1QE1B 3CCSS 3AHPA 3WIVA 2ATCB 3LALA 4LFBJ 4U96A 2DEJA 5CYQB 3N6LA 3MEGA 3C6TA 3WIUA 2C2MB 2IM2A 2E1RA 2WVBA 4NLDA 1NM2A 1K47A 5I3QA 3QAEA 2XCAA 2XMKA 2H9ZA 3TZZA 2B6AA 2JZ5A 2HZAA 4HDHA 2Z30B 2Y1RI 4AL7A 3KDOA 4FNHA 2COLA 3OSNA 4YR2A 4FS2A 2AF6A 4U9RA 3EZOA 2R7RA 4N77A 1RTDA 5LXRA 2XCPA 2HBZB 4F2RA 1YJWS 1LWEA 1VQLS 4TNOA 4JI6J 1YI2S 5KFGA 3SCKE 2V50A 2ZUGA 4CH7A 1BD6A 1RUSA 3ELHA 5F8JA 2P9GA 2RT3A 1FDDA 4DG1B 4DCOB 1XIQA 2MHEA 2BYCA 4GKKJ 1F5AA 1NK6A 4C9DA 3DCAA 4J9VA 4FYVB 1OJ4A 3M6UA 1HPZA 4Q7AA 4ECUA 2XY7A 3RRKA 2Y0SD 3EVMA 3GTYX 1S77D 3MI7X 3BJYA 4GC7A 3OHBA 4DSLA 3Q23A 1HNVA 1R8AA 1IWGA 3H4DA 3TI0A 3C16B 2UU9J 5IV3A 3KKFA 4YR3A 2PC6A 2YQ3A 1F9EB 3MM6B 5H1SV 1JJ4A 3FCVA 2L08A 4O0NA 2HW3A 3CC2S 2QYGA 2NZCA 1RTIB 4NPOA 1KONA 5A0YB 4IUFA 3Q0AA 3T1YJ 4DL5A 1LW2B 2A18A 3QBCA 2XHCA 5CYMB 4U7CA 2EC2A 3MMAA 4L73A 2IM0A 4NZ0A 2HRUA 2V2ZA 4OYXA 1UPPA 2LQ8A 1VQ5S 3RBEA 1JQGA 3VZIA 1Q5VA 1XEZA 1KKHA 2W25A 3R5AA 2QSFA 1K0TA 3EXYA 3X3UA 2RQCA 3GIIA 4ZIWA 5F8GA 4C8LA 3J7ZT 3CJ5A 4YMEA 1HWJA 2VH7A 3GIJA 3PNIA 3ET6B 3DGPA 1UZDA 4H4OA 3M32B 2C3MA 1FDAA 2F4FA 3A8EA 5C25B 2AMCB 5DZ7A 4JI7F 3EJMA 1SC1B 2ZVSA 2W4PA 1TL7A 2RD5C 2HHVA 2Q79A 4DR7F 3OXLA 1HQEB 2LQJA 4EO8A 2DYAA 3NNAA 1AFIA 1EX8A 3UVJB 2ZOGA 3GCXP 4WU3A 3PR5B 3SQGB 2DR6A 4WU2A 1VFJA 2HQGA 2BRLA 4KPYA 4IR9A 4ZVQB 2YVSA 1ZA2B 1GH8A 1YGYA 3D9BA 2VHGA 1QSYA 5C7PA 4DU7A 5KG7A 3D68A 4KR0B 4Q2LA 1KR4A 2HQIA 1HQUA 4NCAA 5EN1A 1NH8A 4P71A 1DTQA 2BKOA 5CXTA 3H8YA 1A6LA 1UA1A 2G2ZA 2HMIB 1DAXA 3K58A 2B8PA 4M5GA 2AYBA 1URRA 4J91A 1FJEB 1G1XA 2KVQE 3AD7C 3JTOA 3VGSA 4FYXB 3F0NA 4OZJA 1SL2A 1A0OB 1O6XA 4JI2J 1HIYA 1RI7A 2AWZA 1CC8A 4RNHA 4DL6A 2MZTA 4B3SF 2W1BA 5D4PA 4ZCLA 5EDWA 3I0SB 2NS1B 3D4JA 4GKJF 2CJKA 4F04B 3AD8C 2YKAA 2YNHB 2CYYA 4EYIB 1BC6A 5T7LB 4WKRA 1CS4A 1HD0A 3K5MA 5CZXA 4IG3B 3QATA 1PO6A 2DKOB 1R43A 2BJEA 1RTJA 1HYSA 5KT5A 4X62F 2V8GA 3VGVA 3BQ2A 4LBPA 4PWUA 4DV1J 1RHUB 3T1AA 4DFJA 4OZ3A 3AJ1A 4NZ7A 3NS5A 2QN6B 1GNKA 4OLPA 3OL9A 3FCWA 2QTWA 1WG5A 3OV7A 2JHEA 2ZD1B 4DFPA 2FJWA 1N36J 2DHAA 5D6GA 2UUWA 4N8NA 1RAIB 3K2YA 3JSRA 3TJ8A 2J6TA 2YXLA 2KVIA 2CQPA 1IQTA 3Q8PB 4J5OA 4ZVSB 3J7YU 2KN4A 3DM2A 4ZP8A 2JLGA 2VBWA 1QY7A 2D1CA 2VV5A 2FIUA 3W2VA 4ITSA 5JVGQ 3DHWC 3EVWA 1PJ7A 4OHVA 2O3DA 5A8KA 2BZ2A 4K5SA 2K1RA 4NLYA 1RU1A 4F2SA 3VR1A 5ETRA 1E6YB 2JC0A 3U7JA 2HWHA 2ILYA 2HAIA 1U8WA 3CD0A 2GVZB 3CIZA 5C42A 4DV6J 5E0OA 2FGCA 6FD1A 2AQ4A 2G13A 4OX9F 1U2CA 2LA6A 1N48A 4I2PB 4IH7A 4UUXA 1WJ9A 3M2UA 5BYRA 1FE0A 4RNOA 3ISZA 1FA0A 1UFLA 4IRCA 2LEBA 3RTVA 4X65J 2DNRA 1C2PA 4LFAF 1HA1A 3I82A 1S99A 1TP7A 1HNZJ 2ADBA 2A6OA 3JB9k 3CCMS 2CZVC 4AUKA 1C1CA 2HNDA 5SUHA 1FK9A 3DOKB 1T8EA 4NXNF 2H1YA 4C8OA 1Q4RA 1EQMA 2FVPA 5E3RA 1LXJA 3QNWB 3MEKA 3ZZ0A 3KHRA 1H72C 2AJ1A 1QVFR 4OYOA 1Y00A 3KLEA 4NYOA 1TKXB 5MLCV 3OVBA 1AT1B 2Z2ZA 1JB0C 1PKUA 3LGNA 5AE2A 1WHVA 3MM7A 5KFAA 5LMNF 5HMXA 3K57A 5LSLA 2MKHA 3VV2B 3H90A 3R27A 1E6VB 1XR7A 4V19X 1SPBP 4KO0B 1QE1A 2W4CA 2Z58B 3H42A 2OMLA 2LDIA 4J9LA 1RAOA 2QA4S 1OQ6A 2CQ1A 1H2UX 3WZ0A 1R0BG 3MPYA 1Z2LA 1R7IA 4H4KA 1KFDA 3V4IA 4HHUA 4DUTA 2IHR1 2PD1A 1NDLA 2IAJB 4KFBB 1U2RA 2EFNA 3D0IE 1S1XA 4C2MA 2KHCA 3LF0A 1D09B 1ZZFA 5HMYA 1RAFB 1NDPA 1B0TA 4H4MA 1REVB 3EE3A 1Q8IA 2F3JA 2H51B 5EX3A 4EZ6A 5FLXU 5K8OA 1RT7B 4K8RA 3T9ZA 4A8MP 2O1PA 1VBKA 4QIVA 2AGOA 3BGFA 4DG1A 5DGBA 1LEOA 4WTYA 3LW5C 4AD6A 2RS8A 3SCIE 2I1RA 5D4NA 1VQ8S 4YOEA 2J0QD 1VC6A 3NWGA 4BLGA 2L3MA 3TEGA 3CJ4A 3GG0A 4FNIA 5KOXA 2W2PP 3DOLA 3V81B 4QR1A 1WF1A 1XR6A 1EKSA 2XBPA 3E51A 4C4WA 5FDLB 3EYZA 4ER8A 4CLLA 1YX2A 1YWXA 5AT1B 1TK8A 1RT3B 3PYGA 3RYLA 3SSRA 2AJQA 3C16A 5E3PA 3CEDA 2MEWA 1D8ZA 1RTIA 2VJVA 2O01C 2LXFA 3VTIA 2ZJQQ 2UUTA 4Q45A 4C11B 2VPZB 4UY85 3HHNB 3HO1A 4A47A 2UXDF 4ZJLA 3JQKA 2Q66A 5A6WA 1SV5A 3QT5A 2YQ1A 1S1VB 3RW6A 2CJYB 5E3AA 4URQU 1JXVA 2VFSA 1NSAA 3OHAA 1PIEA 3L7OA 2AGPA 3DI6B 4TVAB 3BO2A 1X60A 3RZAA 1NO8A 2DXEA 2ZHBA 1RBAA 2JRSA 3JSYA 1KLNA 4RUHA 4CM0A 4N47A 1K1QA 1FRXA 2P6SA 1NK8A 3PRBA 4G1QB 3M9MB 1Y7PA 3T5KA 3MECB 5J1EB 1VQPS 2HSEB 1IVZA 2GC8A 2ZKTA 4WP9A 1W25A 4KAIA 1HNIB 2GIQA 2WONA 4NLSA 4JI4J 5DQHA 4M5JA 3Q8YA 1HW9A 4MFBB 3AOCA 3QJJA 1RADB 3MMBB 1NJWA 4C8KA 1WF2A 4OI1A 3VWSA 2HS0A 2MKJA 3ZTOA 2E7WA 2CJ9A 4TY8B 4OJ3A 3PX4A 3QGPA 5JVHQ 1I94J 4OYBA 4B3OB 3TZWA 2BEFA 3KXDA 4EK2A 3HHEA 1RT2B 1U1QA 1O8BA 3LUYA 1IR1A 2ZH8A 1YZ6A 1RAGB 3GCWP 1MLAA 2HMIA 1WC3A 2W9CA 4WFBQ 3GQCA 1RHMB 2QE5A 3PTWA 2NXJA 2BQRA 1RZMA 4ECTA 3IP0A 1OMSA 2Z0GA 3HKZD 4KKOB 4J9KA 2C2OB 1ZAVA 4LF4F 4HT5A 1KVIA 1RJJA 3QLHB 5D78A 3QO9A 3J7YI 2RU9A 4K4WA 2YNHA 3LGHA 4LQ3A 1VI7A 2HFZA 2PEBA 2J6SA 2FJAB 5T7LA 3NBPB 4XPEA 3RB3A 3R5BA 2DRDA 7FDRA 4CTAB 1FE4A 4PPDA 4IG3A 4DQIA 1S49A 4QQBA 4HTJA 2LXIA 3N6NA 5KFHA 3KLGB 4DN0A 2CQCA 4TU8A 1N32F 2HPUA 3CJRA 2RDDA 3OFHA 2FPHX 1B99A 2NXNA 1RACB 3TAQA 3O3LA 2B7CB 5HMWA 5L8RC 2G2OA 1IKXB 3NNHA 4ZVRB 4LF1A 2VG5A 2G0CA 2J8AA 2ROPA 2MSSA 2AYGA 2G9OA 1M0SA 5FIIA 3MUVP 3H2VE 5JMNA 2VC1A 4B9UA 3A13A 1R31A 1YRTA 3GFHA 2AYEA 5KFEA 4CO2A 3ZFVA 1WOSA 4PKDB 3MOZA 3ICLA 4I64A 4WXOA 5H9EJ 4DX6A 3H40A 4NYZA 3TA2A 4A4JA 2BXJA 2HFSA 2HS3A 3HSJA 4DZ6A 1VRUB 1E6YA 2YKNA 1FVSA 3AA9A 3MAHA 1H0HB 3CDAA 1TMMA 2VQFJ 4IDKA 4PQUB 1RAEB 1HBUB 1SQEA 4LR7A 2XEXA 5HANA 3TX0A 4F0MA 2DD8S 2H48B 4MKAA 1A7GE 2IRXA 3VAFA 4C0HA 3ETMA 4D3GA 4NLUA 3UCZP 1UCNA 3S01A 1Q53A 2K8GA 2HWTA 3MCNA 3GJRB 2CQ3A 1TAUA 1XMOF 4NLXA 4P52A 5I42B 5FLXY 4RWWA 4KIAA 1HNXF 1RAAB 2ZC4A 5IV4A 2MKIA 4K4SA 2MSTA 2VQEJ 1FF2A 2B4PA 4F4AA 3G9CA 2ZOFA 1BQNB 3A3PB 2DNKA 1R8BA 3ZXWA 2MPUA 4ZVPB 5CH7B 4LIWA 2XLIA 4Y6IA 3CGIA 2MQPA 1D9FA 2BABA 2EVZA 3MUTP 2WSEC 3HD1A 4XAKA 3D5MA 3TQEA 1RQ0A 4EEYA 2R7TA 4I6AA 1QTMA 1S1TB 3T1HJ 3DLBA 2CJAA 3H2UB 3S6EA 4LFCJ 4L6V3 4AQYF 2G1HA 3KNAA 5RUBA 1E6VA 4YDDB 1G4CA 4KO0A 1PC4A 3D2WA 5F3ZA 2XO7A 2X3DA 4CO3A 1RT1A 2RVJA 3K5PA 4N8OA 5DG9A 2XLJA 3UN3A 2V34A 2EI5A 3W1YC 3M1VB 4HEA9 1DQ8A 2C3UA 2OFHX 4M1KA 2J5AA 1UETA 3W9HA 4ANDA 5KFJA 2O5DA 2BKPA 1GTHA 1CJUA 3FGVA 3LP0B 2G0IA 2GCFA 4PCQA 2GVDA 1HWKA 3U1LA 1Z1ZA 2V69A 3JXOA 3D1OA 2PI4A 2YY3A 1CJTB 2FHMA 4DV3F 4OMFG 3DLJA 1NJYA 4P7TA 4ECVA 4BS2A 4HI1A 4B9TA 2RE1A 2C2ZB 2ZWPA 3PKMA 4CDIA 2Z2LA 3PW5A 1IXKA 3VAIA 1NJXA 1IN0A 3LH2S 4FPIA 3M2RB 2F8EX 1AYEA 4FS1A 3ONQA 5A8WB 4LF7F 4ZITA 3BYPA 3MTJA 5IOLA 1HLWA 2M3DA 2VFTA 2M52A 2ZKUA 4UOGA 4FPRA 2PT0A 4HR2A 3DFEA 1SKUB 2FJDB 2FLOA 1RT3A 2DHGA 3G8QA 1AXQA 2MQQA 2XNRA 2EPIA 4DCJB 5F8HA 1PBUA 1VK8A 5B7WA 1GTEA 4QPXA 3JSMA 1JXEA 5AXNA 3W7BA 2MDAA 2E5JA 4B02A 4C11A 1JXLA 2HVHA 1URNA 4Q5VA 1EETB 3HMJG 2RJZA 2IA6A 2KXNB 4ZVTB 3IR7B 2GHWA 1RAHB 2RQMA 1S1VA 1FEEA 3G82A 1L5UA 1M1KT 5DDRC 3CD5A 1ZM4A 2CADA 4LR9A 2DR8A 3OJUA 2GO8A 3KUEA 1S10A 4CH0S 2V2QA 1NSPA 1RK8A 5DRKA 4N56A 1VRTB 4WP8A 1PGZA 2FQQB 4G1QA 3OUYA 4RPFA 2E29A 4C3KA 3MECA 5J1EA 1V5VA 1QM9A 2PO4A 4K50A 3MMCA 1VR6A 1MNEA 3MM8A 4LF6J 3IBWA 1N4LA 1HNIA 1CJVB 3O8WA 3DN9A 4C3LA 4OI6A 1VHIA 4MIAA 1S97A 2V8DA 2LDYA 2EFVA 4BWMA 4XDDA 1S0MA 2R8IA 4B3TF 2ALZA 2JEFA 2OJ3A 2JLEA 4DPYA 1VDHA 1VQSA 1HWUA 4LBHA 3ZTQA 4WK3A 3D66A 3QMQA 5KFKA 2DGUA 3MAAA 3KLHA 1LWFA 4QU7A 4DR3F 4J37A 1X8DA 1TK0A 4AL5A 4TY8A 1FX4A 2HHHF 2VA2A 3CJ2A 4DR2F 1KEKA 2U1AA 3OTOJ 4AXJA 2DH7A 2BM0A 1KHWA 4TLRA 3CIMA 2J7WA 3V5RA 3NOCA 2LA4A 1Q0NA 2AHOB 3GU0A 3OFFA 4USTA 4YDXA 2CNNB 4NOHA 4N5SA 3FZ2A 2WOMA 1OY9A 1U24A 1LWCB 2FB0A 2U2FA 1UP1A 2P9EA 5DM6Q 2YNIB 5D0EA 4KKOA 4FVCA 3OR2B 5GAGU 2QFIA 4X4RA 1K1SA 1T94A 3VVTA 3FMWA 2CZ9A 1YJRA 4ANEA 4GVBA 2Y1LB 5DS7A 3UNYA 3JSBA 3ZZUA 3V6DA 3BM7A 5GADU 3QSIA 4X4OA 3TA0A 1DFDA 4QCLA 3RAMA 3I4PA 1T9XA 4ID5B 4YHHF 4IG0B 2G0JA 3LP1A 3BQ1A 4OFZA 3I31A 4E98A 5M2RA 4CTAA 2OIHA 1BQXA 3IRXB 3OD2A 1VLYA 3KLGA 3I9ZA 3DRSB 5D15A 1R0AB 2C2RA 4ZJQA 2RMLA 3LPEA 3AA8A 1FRKA 3OL8A 2WVCA 3GFZA 4PAAA 2UUBF 3ZZYA 2A6MA 2G2YA 5HSPA 4LF9J 1WF0A 3CCJS 1N33F 1Y9OA 1QUPA 2K06A 2XHWA 3IRWP 3RAQA 3GR0A 5LT5A 4GRSA 1RT6B 1TR0A 2PA3A 3MHYA 2F8HA 4BWJA 4TQSA 2NXUA 4KV8B 1VC5A 2HLUA 1TMJA 2CWKA 2CPFA 4TKTA 1UJ4A 2CPXA 3PRVA 3PVXA 1P1LA 2WVEA 2WW8A 4QU6A 1H6KX 1S4EA 4O3PA 3EPGA 3D0HE 1NBEB 4KH1B 3W65A 1VBYA 3R1LA 4ES2A 3FKBA 1NUEA 1T9WA 4B17A 5L46A 1MU2B 2XMMA 4YFUA 1KC8T 1WSVA 1HBMB 2VUGA 3QSYB 1J2VA 4M95A 3I0RB 4O0IA 4PQUA 1TUWA 3HF5A 4O23A 1T95A 1B4SA 1HBUA 1TUGB 3NY0A 2DHSA 4FF2A 1TQLA 4I2QB 4UTGA 1WORA 3LTOA 1U6ZA 2DVIA 5KFVA 3R8YA 3G6XA 3MTKA 3Q8RB 1JLBA 2DR9A 3OTCA 1V6HA 4USJC 1YJ9S 4KE5A 3ZZTA 2PI5A 3F73A 4HKQA 2YPZA 3AXKA 2F40A 2IVFB 2DY9A 1LK7A 4EGLA 4PG6A 2HNYB 5E7OB 4R0JA 2CG4A 2QMUB 3FBCA 1FRHA 3D6MB 1RHKB 2BW2A 2HHUA 1BQNA 5LJ3Y 2VPYB 2GNKA 4RNNA 3BGLA 3GJSB 3DLLQ 3CMQA 3UW1A 4ZA1A 3Q24A 3FQLA 2C3OA 2AGQA 1KOOA 2VG7A 1P8GA 4JB8B 1F2GA 3UD3P 3SEOA 5KFDA 2GZOA 5LMUF 1NCLA 1UJ5A 4U8YA 4RW6A 3DOMB 4NZ6A 5L1IA 2DR5A 5F8MA 1FFSB 2FLLA 1U0HB 3C6UB 1CJKB 1DTTB 3M9OB 1GQEA 1HNWF 1H2TZ 4X4UA 2IIHA 3HHLB 1RTHB 2AEJA 3M1VA 4P2SA 5HVGA 3ZZRA 4F36A 4OI3A 3W5YA 1NK9A 1JK9B 4G65A 2ZH3A 2OEKA 3QT7A 3LP0A 2NXEA 2OUGA 4YB5A 1FX2A 4OZNA 2HLTA 2QG9B 5B0DA 4NMLA 3MURP 1GT8A 4CCHA 4KGXB 2ZH6A 1RU2A 4CRJA 2YNFA 2OEJA 1LXNA 2CPDA 4RUAA 3Q83A 1CJTA 3P45B 4ECRA 4PXDA 3S7RA 2BDPA 5D0HA 2BA9A 4QOTA 2C28A 1TL1B 1O5JA 4LF9F 3LOUA 3D6HB 2APOA 4E2FB 3BBCA 3N28A 5KFXA 1N5TA 2E9TA 3JQMA 2ILZA 4JV2A 2LXUA 3G8TA 3BR8A 5A8WA 3HFVA 4QBUA 4QYZJ 3UNGC 2UP1A 3GIMA 1Y11A 3FRYA 1X5SA 2A2CA 3IN5A 5IC6B 1LOUA 2AX1A 4O3NA 3W61A 1TKZB 3R5CA 2HWIA 4X84A 4ZP7A 5IT9U 3HSZA 3EPIA 1ELOA 1QJHA 2WTFA 3B6BA 3IAM9 5F9NA 4LSNB 3BR9A 3PKYA 3K5NA 4DEZA 5HQ8A 1RWWB 3AB4B 3W9IA 4I67A 2Z56B 3F41A 4YY3F 2Y0BB 4ZPTR 2KKHA 3BO4A 2LQ5A 1UVIA 3KK2B 2BJ1A 1X4HA 2P8IA 1SIZA 2XGPA 3V2UC 1EETA 1X5PA 2KFNA 3W3SA 1NKBA 1TVRB 3OXGA 2CUYA 4Y2KA 1IKYB 2D41A 5ETLA 4PWDB 3MPWA 4J9SA 1GXUA 1YZ7A 2PEHA 4AE5A 1RWPB 2R8KA 3BYRA 1I51B 3MFHA 4ZVEA 3M05A 2KYZA 4R8UB 1VISA 1FKPB 2CA9A 1D3WA 1NK5A 4OYWA 1S9GB 4OZ5A 2VOOA 2YBVA 3ISNC 3G87A 4O3SA 2V9KA 3PX0A 4O44A 2ZJRQ 2GMJA 3MPUB 3CCVS 2DGWA 4WFXA 3NGDA 1VRTA 3P5BP 1WC5A 3HHLC 2A10A 5J2PA 2MQ8A 1RWKB 4JI1J 1TKTA 2R4FA 2Z57B 1RHQB 3GP9A 3BQ0A 1WSRA 4URGA 1RA6A 5HMZA 1S9EB 2ASDA 4ZK7M 3W60A 2RAQA 4WK1A 2XYPB 4L75A 3M2VB 2EG2A 3NGTA 4DV2F 5CYJA 3PEHA 4I7FA 3OFGA 5HAOA 4QW8A 5GAGI 3NCPA 2OGUA 4WE1A 3FBEA 5DM7Q 2MJUA 1JLGB 3ILIA 3MEGB 1VQ7S 5GADI 2MY8A 4ATNA 2ASYA 5KG6A 2QRRA 1U02A 2V67A 4OX7A 4B3RF 3ZNUA 4KHPF 3BPSP 1WEYA 2B51A 1UW4A 1MWQA 2ZM6F 4XIUA 4LSZB 4KTQA 2Y1IA 2MZSA 1QDUB 2XMWA 3QRPA 3TA1A 3DXSX 3CUNA 3MD1A 4RNFA 2ZITA 2CJXB 4DL2A 1Q81T 4A46A 1JIHA 1ZETA 4WZQA 2B0GA 3P49B 2HHQA 2HFUA 4FF3A 4P75A 1T03B 2R3VA 1LWCA 3JS9A 3B82A 3B8HA 2ZNYA 1RHJB 2H54B 4MTPA 1H7WA 4ED1A 1U48A 3PY8A 1VQNS 2QA2A 5K8NA 4TLQA 4HT7A 3H25A 4F4XA 2POKA 1HPZB 2BE9B 5E3CA 2CQDA 1ZOTA 2EKYA 5DLFA 1OIAA 1J5EJ 3MDFA 4NI2A 3HVRA 4D3HA 2M8HA 2K7KA 2WSCC 5J1NA 1PCAA 1R0AA 3BH6B 4RL1A 4TU9A 4UQGA 3PEJA 1CLFA 1VS3A 4YB7A 5K5MA 3CTRA 4MJKA 2BUNA 4QWBA 1N5QA 4DL7A 4LF8J 1H7XA 4ED0A 5A8RB 5FJ4A 1RT6A 4LVOP 4LF5J 2V2KA 4A8SA 4ZCMA 5GAHU 2W7PA 1XBWA 3UCUP 1NK4A 1VLOA 3NMRA 2HNZA 3PYFA 1D9DA 2OLWA 2L48A 1Q16B 4KT0C 3G6YA 2QLXA 1EB0A 3R1HA 2HQ3A 4CYUA 4RUCA 4P2MA 4IRDA 1AW0A 2UV8G 1GEHA 1MU2A 2CWXA 3MCSA 3L7UA 3DGPB 4H4OB 1RABB 2QFJA 4K4TA 3CCTA 3D7SB 2PA8D 1SBRA 4G6VB 4CT9A 1TL7B 3BSOA 2PMZD 4ZVUB 3RR8A 3TRGA 5C24B 4DPTA 4JV0A 4ZN3A 4DPOA 3G8SA 4NMXA 3NOGA 3R9LA 3UI3A 4IO9Q 3SV4A 1NAQA 2AIRB 2HFOA 4X4NA 3PR4A 2B9EA 3M8WA 4Y34A 1KQGB 2KHDA 4OYMA 2P6TA 3K17A 3EX7B 4ZMMA 1YJ7A 3L9ZA 2HNYA 1JLEA 2JFKA 4ZVHA 3A8IA 3IBFB 1T9VA 3KHHA 2D74B 2NPFA 3U02A 1EAYC 1LQ9A 3E3XA 2JVOA 2CJBA 2QGFB 2ASLA 2B9YA 2CKWA 1S6QA 3MWBA 4OZ2A 4QWAA 5CAAA 5IFMA 1U1MA 2QV6A 1L3TA 2BW7A 4EO6A 2IJRA 3K5LA 3R7BB 2YH1A 5C5JA 4TYAA 1MN7A 5KG1A 2HG4A 4B08A 3FEZA 3SCJE 1NMEB 1V5IB 5AE1A 3DOMA 4KB7A 3TVKA 4NLRA 5IT9Y 3MD3A 4IH6A 1XR5A 3PDNA 1U0HA 2VPXB 4ZP9A 3KLFA 4LF2A 5KFQA 4DF8A 3BO3A 2J7UA 1CS4B 2HURA 1YTYA 1S0VA 3G4SS 1RTJB 1HYSB 1RWVB 2KM8B 1JLAA 3TAMB 1RCXB 3EZ5A 2NQPA 4IKAA 2OPSB 1CULB 1X4CA 2R7OA 4C8MA 1CBKA 2CIMA 3CT9A 5L9XA 2RSQA 3K59A 1UVLA 1NLKL 1N56A 1IM4A 5MAOA 1HKAA 2E5LF 4LUBA 4NX9A 1Y5LB 1N8RT 2XSJA 1S6PA 2VF3A 5F8IA 3CWJA 5SZTA 1TL1A 4NLTA 4LQ9A 1G2EA 2RHQB 3I5BA 5CZVA 2RHSB 2CVEA 3NKYA 1X4DA 2C3PA 4DFMA 5EX0A 5ETNA 3UQSA 4A8KA 2ALYB 4J9QA 1GXTA 1UJ6A 2QT7A 1X31C 1YLXA 1F0XA 2BOAA 5GAEU 1RGVA 2ZJPQ 3KG4A 2J8SA 2K1RB 3Q86A 4P7VA 8AT1B 1VGYA 3LQVA 3KFWX 4OX6A 2DH8A 4ERDA 2C2DA 1X9WA 2VICA 3KK1A 1TKZA 2MZ1A 4F67A 4L72B 1UFKA 4Y00A 2BRKA 4ZP6A 1FWLA 4K2XA 1U7LA 3FDSA 4PPZA 3AD9C 1TU0B 4LSNA 4KH0B 3W5XA 1SVDA 5C42B 2EW9A 1J27A 4NLOA 1R3NA 4LR8A 1VQKS 3KDNA 1B3TA 3BGUA 2IVYA 2WVDA 4CO5A 2X1GA 1O0PA 3CW2C 3TUIC 4YB1P 1U1RA 3VAMA 2WCXA 3RJMB 3Q8UA 5AXKA 1SKSA 3JYTA 2VOPA 3EGNA 2HFNA 1TVRA 2CPIA 1F3FA 3W9JA 3D0GE 1QSLA 2QLJB 4PWDA 3QJPA 1PAEX 2CAJA 2NUUG 2DBBA 1C1CB 3RGIA 4ILMA 2HNDB 3P6YC 2G4BA 1Q95G 3HKWA 5LL6d 3A8KA 3P8BB 4E0DA 3K89A 1SH2A 1FKPA 2HHPA 4JI7J 2Y9HA 1S9GA 1NHKL 5F3TA 1VQOS 4OI0A 3ISND 4OYZA 4DR7J 2HK2A 3HP6A 1Y5IB 3KLEB 2OEMA 2ROEA 5BR8F 2XMJA 1IKWB 3HHLD 1MROA 4U8VA 3F56A 1S9EA 3QGIA 2HFVA 2VFRA 4ZPVR 2KM8C 4X4SA 1BWVA 2ACMA 1FD2A 5KFPA 1L3VA 5KTQA 3O2IA 5AE3A 4O4GB 2PFDA 3G6VA 3LP2B 1JLGA 3K8WA 1Y3JA 3OLAA 4GO5X 1ZM2A 1F5CA 1CQNA 4UF4A 2J7KA 5HVHA 4U95A 3FEXB 2MLZA 4OV1A 5DO2A 3V4IB 3UN2A 4EZ9A 5D0GA 1S1XB 4K4UA 2D3UA 4HLBA 4FXWA 2M0GB 3TUZC 4H4MB 5E41A 4RW4A 2P9CA 3J7AN 3PXGa 1BUXA 2OO4A 2KL8A 4B3SJ 2DHXA 3SDEB 1T03A 1YJUA 2PE8A 5BXIA 3OTDA 4GKJJ 1FKOB 3THVA 1FTCA 3PG9A 4LRFA 4DV5F 4W98A 2OSRA 4BC7A 5HBMA 1KSPA 4RUBA 4XDCA 1N34J 1X5TA 5GAHI 1NHVA 2OPRB 1KTQA 3T19A 4MK7A 5D3GB 5HL7Q 3QJLA 2B8QA 4X62J 4RBUA 2DR7A 1RWNB 3BPDA 3M8ZA 1FWPA 2AP6A 3DOLB 3J7Z5 1SUQA 1F6TA 4WKYA 2FC8A 5G0RA 3CXCR 4ED3A 2YKQA 2D3O1 3ZZPA 1YIJS 2M8DB 2W9BA 5H9EK 3AH6A 3N9UC 2MXYA 1JLQB 3NG8A 4USVA 4J90A 1U8SA 3PZPA 2XY5A 4WIIA 1U49A 5KFLA 4BCAA 5KFSA 2W7OA 4UT4A 2IJFA 1OY8A 5A8RA 2VL1A 1NK0A 1XNQF 4CT8A 5J2NB 3QAUA 1HI0P 2RU3A 3V6KA 1IWAA 4DF4A 1FFGB 4A8WA 3MM9B 2YX7A 2KXFA 5J2QA 1SV5B 5HROB 3IR5B 1SJQA 2UXBF 3KUHA 1XMQJ 2XMVA 1PYTA 1RWUA 3MOJB 1Y4ZB 1QUVA 1R8CA 2QYCA 4DXLA 4RBVA 1ZS6A 2AYMA 3POTA 1FFWB 3SBMA 1S7HA 3KHGA 2A3JA 4Q8EA 3CJQA 1RISA 4RW7A 2DNZA 1RLCL 3QIPB 3QZ8A 1D0EA 4OX9J 1XQIA 4ECWA 3DLHA 3M8RA 2LU1A 4J9PA 1UPMB 1EHWA 3HVTA 4ICLB 2MQLA 1S72S 4JI8F 5IM0A 4IO1A 4ECQA 2QIFA 1Q7LB 1JX4A 4H4KC 4LFAJ 2W24A 3TANA 1C1BA 1FJGJ 5C24A 3QGGA 2PIIA 2WONB 2CPZA 3M8SA 1UMJA 3NGKA 3R2CJ 4DR5F 3GPAA 3TVZA 3DDKA 1GX6A 1X0FA 4WF9Q 1AZSB 4NXNJ 3AJDA 1A9NB 5JUMA 3UN5A 3UR3C 5F0WA 4X4PA 2QA1A 2IRYA 1FKAF 2HGNA 4USKA 3TOQA 3CMES 1YRXA 4OL8A 2BACA 2EG1A 4DZDA 4USIA 2H3EB 2FVCA 2RS2A 2IA0A 5LMNJ 2Y3YA 2V2VA 5H9FJ 1B7FA 1ZZNA 2XTJP 2W9CB 5IQ6A 2CQ2A 3ADAC 4GVLA 4HTIA 4CLTA 2BE2A 1HR0F 4Q8FA 9ATCB 3RUBL 4W4MA 3DRYA 2HRTA 1PC5A 1DY3A 3SFUA 3QO9B 3FVYA 1FXLA 3IAS9 4NL5A 1Q8KA 3DC2A 3D54A 1VJWA 2K3KA 1RBOB 3GILA 4DS4A 4UZBA 5LOQA 3HHKA 1N34F 3KYLA 3TAPA 2EC0A 5GAEI 4ZVFA 2FUG9 4PG7A 4QIFA 1NK7A 3D1QA 3TAMA 4HHJA 2OPSA 2C42A 1CULA 4Q0BA 5BYQA 4WFNQ 3SZ2A 2FYXA 4LIRA 2VG5B 1F3VA 2O66A 1RSCA 3GYNA 2ROGA 3DRPB 4DV7F 1DLOA 1IKVB 5EUHA 3W63A 2ZDOA 3IO1A 4DR4J 3S8SA 3CJ3A 2IRUA 1KRPA 3TZYA 4F3OA 2QJ3A 1F60B 1H98A 3MGJA 1J5OA 1P27B 1WNEA 1FESA 3K5OA 1VQMS 3GWCA 3EXCX 4YN3B 5HP1B 2R9LA 2ZH2A 4DI6A 5DLGA 1S48A 3IC1A 1TL4A 4UW2A 2BQ3A 1SH3A 1XMQF 2NCKL 3NRBA 2YKNB 2VASA 3VAGA 3RB4A 1VOMA 3PV8A 4IDKB 4I0WA 1NPRA 4KGKA 1UWAA 4DPXA 4W90B 1CC7A 4NXMF 4ZOSA 4OYPA 2WB1D 2UXDJ 3FC9A 2UVVA 3MEDB 2F7VA 2GX8A 4ALZA 4NYPA 2VBXA 4K4VA 4YEAA 3DDNA 1VQ9S 4DQPA 4NLWA 2K2PA 2BJ3A 4X64F 3VAJA 2JC1A 3CC4S 4U67Q 2RRNA 1KFSA 1GMWA 5HQLA 2GMLA 2ZH5A 1FJGF 2AV5A 2R8JA 2ZH7A 2GQCA 2KB2A 3M8YA 3RU0A 1KQSR 3RW7A 3EM1A 4O3RA 4K59A 1SJRA 2YX1A 1FXRA 3OFEA 2DISA 2PSZA 3I32A 3CJKA 3C2PA 1FD8A 1CVJA 2LKZA 1C0TA 4PXEA 2D3OR 4ZJOA 2KI2A 4Y2IA 1LKZA 2MMYA 5AJ3F 1HHTP 1IKWA 2JEGA 3VAKA 4MKYA 3M6WA 2FTRA 3DMJB 2VBZA 2GS8A 1NKCA 5B0CA 2GGPB 2E7XA 3IG1B 4LRCA 2W8LA 2MKKA 2EXUA 2IC3B 2ZE2A 5HLFA 2AZ3A 1MG7A 3TWZA 1IBKF 1OPIA 4G1PA 2ZUAA 3R2DJ 1KLMA 4O4GA 1IBLF 2CNKB 3LP2A 1RT1B 4ED5A 1U1OA 2GMHA 3CDEA 3LGMA 2DXDA 3MCOA 1RYRA 2NXCA 4DOZA 5CD4A 2PN6A 3MAQA 1ITPA 1ZA1B 4Q2MA 2DXFA 5KT4A 2BE7D 3HZGA 3EDQB 2W2MP 2BOPA 3OL7A 4RW9A 4DR6F 4ETZA 2BVZA 1CJUB 2FJXA 4QIEA 4IQXA 1FTRA 4I68A 4MKVA 2UVWA 4A8QA 4C3MA 2GVDB 4B9VA 1Y5NB 4ES3A 1NB7A 3G71S 2VDHA 1RBLA 3CCLS 2EWHA 4LF4J 3UE2A 1S79A 4USUA 3SDEA 2CJQA 1FKOA 4DJBA 4DLGA 2KRBA 1X4GA 2KYXA 1S7IA 4C98A 2HBQB 5E33A 4EU0A 4ED2A 2WZ1A 2HAFA 3PFEA 1H2VZ 2OAUA 4XTTA 1BMQB 2QLWA 2OPRA 5I3UA 4DQQA 3E8OA 1CEZA 3FCHA 5D3GA 4AFFA 5BYSA 3M30B 3Q8VA 4DR4F 4P74A 1JNZB 3NGRA 1N32J 3PRDA 2HHTA 1OWXA 5HI7A 4UQTA 1NB2A 3FQKA 1P9YA 5EWFA 4JV1A 2GQ2A 2JWNA 2VG6B 3VALA 4ZLLA 3HJFA 1SH0A 3L7PA 3PW2A 2CQBA 4WZMA 3EICA 2FJVA 1JLQA 2J6UA 1PG5B 3P3DA 1KQFB 1P1TA 4DLEA 4RO0A 4PR6A 3JSMB 4FZVA 3UR0A 4EBDA 3KJNB 2E5GA 2MGZB 3QRRA 1K9MT 3ENWA 1EZZB 3NEKA 4C8YA 4JV5F 2HZCA 4M5HA 5M2UA 5J2NA 3T41A 2JNJA 4R5PA 4N76A 3MM9A 1R89A 4OJGA 2LEPA 1U25A 1SKRA 3HVWA 4ZLJA 2F4VF 5LSRA 4EWTA 2EFGA 4LSLA 5HROA 2V4RA 1YG0A 5IWAF 4B3MF 3G82B 3T6BA 3CB4A 3GLJA 1RB0A 1HMVB 2M70A 3FZBA 4A8FA 1WI8A 2JL9A 4UOHA 3VGTA 4DUYF 1TV6B 4Z37A 2DNNA 2Z2MA 2WSFC 1KTVA 4I56A 3NMAA 2PMHA 3QIPA 2DB1A 3I5CA 1RP5A 4K7QA 4CZCA 1FDNA 2ABYA 2I9SA 3OUYB 1UA0A 1WDDA 3FSIA 4ICLA 4BBYA 4KQZA 4FYWB 4QWEA 3MMCB 2IMWP 3MM8B 1VQYA 1XMOJ 3D67A 5DG7A 3J80U 9RUBA 4WTOB 2JEJA 3ITHB 4FKXA 4DUZF 1HNXJ 2DEIA 4KSEB 4TQRA 2DNGA 3H5UA 4EI2A 3M6XA 1D9AA 1AZSA 1FERA 4F02A 2RH3A 4NA3A 2R2RA 3DLEB 1ZTTA 3MAAB 3KLHB 1S0NA 1LWFB 3DRRB 2A2DA 3SSSA 1M1GA 4F7VA 3AOBA 3OSPA 3H5YA 1S6OA 4Q43A 5IXUA 5DZ6A 4AT1B 4ANCA 4L74A 1U0SA 3CF5Q 4AQYJ 1KOHA 2LLZA 2WOMB 5KFOA 3I4HX 3BF4A 2BR0A 1DQ9A 3BKUA 3QZ7A 1SIWB 4NLPA 3ULHA 3ZZOA 3IXQA 1JWWA 4KGZB 1XC9A 4B9LA 1HHSA 4RWXA 1TELA 4KBIA 4GVBB 3V6DB 3RAXA 2UZAA 1G7CB 2DITA 2DHHA 2VZ9A 4CQ1A 1QAYA 3LP1B 2EKNA 5ETKA 4F50A 2CDQA 1W2IA 2HS4A 1JJ2R 5HATA 3H59A 3O1LA 2VKZG 4QYZK 2YX4A 5LSOA 4DV3J 4ELUA 5HVFA 8ATCB 3I87A 2OD6A 3L09A 1D8YA 2XYGB 2NYHA 2E1PA 4CLZA 1MN9A 2QX0A 1VBZA 1FWKA 3DRPA 1NNDA 2N3LA 4AXIA 1IKVA 3GIRA 1F1BB 4NCGA 4X2BA 3MXHP 6FDRA 4LF7J 3MM5A 4F4KA 4WJBA 4L3NA 2B9WA 5F9LA 4DSEA 5EGYA 1Q8LA 5K14A 4FXVA 4DU8A 4DPWA 5HP1A 3A1YG 4JI5F 3I56S 4DV4J 3GMGA 3TQ1A 4X66F 4ED8A 3BBBA 1YBUA 4P73A 2X1FA 4ZIVA 2EK1A 5K20B 2KT3A 3M8QA 1QSSA 3IWXA 3PIOQ 3GV8B 3CO0P 2Z2YB 5KG5A 4DL0C 3NL0A 1GMUA 5E2QA 1VCTA 4QJVA 3CO9A 5KFCA 3BN7A 2I38A 1RTZA 1BWEA 3MEDA 4K2JA 2QLBB 3THTA 1P6TA 5ITHA 2B43A 4TU7A 1HBOA 3DLGA 2OPQA 3ZTRA 1JLBB 4LRBA 4O4RA 3ENVA 4K0KF 1XNRF 2DK2A 1FRJA 4I69A 3MR6A 2F65A 4P9SA 3W5ZA 4C97A 1PYOB 1PJ6A 2DJWA 3H20A 3TVYA 1ZBTA 2MZRA 3MPVA 4J9RA 1RWXB 5ETSA 4K4XA 1X4EA 4LJMA 2HQFA 1MWYA 1U4BA 3UDLA 3K8VA 3C66A 2DTJA 3KG1A 1ZPWX 3J7A1 2RDJA 1U1PA 2VG7B 4DSIA 4Y3CA 3GSDA 4PWWA 2UXCF 1TL3B 3LA0A 2BV3A 4QIWD 2FHKA 3SSQA 3DMJA 1T7PA 5GMKa 1K8AT 2GGPA 3IG1A 4BDPA 3W2WB 3HVAA 3PACA 4B3TJ 4RW6B 2IC3A 3G2XA 3TUJC 2I5JA 2GHPA 2R7SA 1VIXA 4KC5A 2HIYA 3AQOA 3D6TB 4DR3J 3EZUA 2HHHJ 4DR2J 2OPPB 1B64A 3PIPQ 2JSXA 2MZJA 4O3QA 4CNYA 2W2QP 4JI3J 4LRDA 5D77A 1IBMF 1ZAXA 3PW0A 4RR5A 1LV5A 2E9ZA 3OXFA 4X4QA 2XZWA 3CD7A 1N52B 1BE4A 3SXLA 4Z7YA 5LM7E 3C19A 3PO5A 2CNLB 1QAIA 1TL5A 1VQ4S 2YWEA 1UKUA 4WYWA 2YNFB 4JI0F 4IFVB 3KLIB 1I1GA 1RDRA 2LP4A 2OH2A 4EFAC 1I6JA 2BJ8A 4KYZA 1W26A 4ILRA 2K3IA 2KFZA 1KDNA 3OPKA 3IFEA 4YHHJ 3UFCX 3IM8A 3TR5A 3PM9A 1UL3A 5G4DA 5F8NA 4PZVA 1B0PA 2DIUA 3NAIA 4R0EA 2RDIA 1HBNA 1X9MA 4OHXA 3AY0A 3M30A 1WTBA 4I1TA 1T9YA 4W92B 2WAQD 1BXNA 2GJFA 3Q22A 1B7YB 3MMJA 2WK4A 3BS9A 4RNMA 2KU7A 4TY9A 3J80Y 2UUBJ 3KNGA 1JLCA 2HQDA 1L3KA 2VG6A 2JJ4D 4UUWA 2ZBCA 5HJYA 1RKJA 1N33J 1NJZA 1NDKA 4DV4F 5DDQC 4LFBF 2ZH1A 2CPEA 5ADZA 1HWLA 4DQSA 1SB6A 1T05B 2V0NA 1SC3B 1Q78A 4CO1A 5B0GA 2F63A 2OELA 2MGZA 4IR1A 2KJVA 2Q1LA 4MKBA 4ID8A 1LFWA 3IWNC 2I2YA 4KGMA 4ECXA 3HX9A 4QIGA 2M88A 2UUCJ 2R8HA 2CZ4A 4CLKA 3DRXA 3VAHA 3I6PA 5JXSA 1BQMA 3CE8A 2FZGB 4JI6F 3GFYA 2R8GA 4HH0A 2D9PA 1MWZA 3TJAA 1HMVA 3BSAA 2RUSA 5KFRA 4OI4A 2BKNA 4QWCA 1TV6A 4G1IA 5HQMA 2DNPA 1RT4B 4GKKF 1AFJA 4O44B 4DMZA 4NEZA 3EMTA 1UEKA 5J2PB 2DNHA 2CRLA 1TKTB 3QPIA 1JKHA 4CLSA 3QQCD 3KLVA 4DL3A 4YP3A 4U6PA 4NRUA 4AYBD 4M5DA 4CP5A 1NJIT 1K73T 4I7FB 3HT0A 4FBTA 2V68A 3ITHA 1WHWA 4WE1B 2UU9F 4XPCA 2EEYA 3LWMA 5J2MA 4YS2A 3DGVA 3BDPA 1OPZA 4NASA 2VB6A 2B7BB 2IM1A 3DLEA 3R5DA 1S1UB 2L9NA 4MH8A 7FD1A 2ZVIA 1YJNS 2YNGA 4J7CA 3T1YF 1T0TV 4OHYA 2JOQA 3DRRA 4M63A 1Y0HA 5C2CA 4QPTA 1V3RA 3EVOA 2DPIA 3OR1A 3MR3A 5ETVA 1WOPA 2P5VA 4JI3F 5LMUJ 5IZHA 3NS7B 3M7VA 2R7UA 3WBZA 4EYHB 5CABA 2DGQA 1L3UA 2DCLA 1N6QA 2HYIB 3I9V9 1K0VA 2JLFA 3N01A 2Q3PA 3NGSA 2XMTA 1HNWJ 2NLWA 3C15B 2V5HG 5I4MA 2GW8A 3MR5A 2RKIA 1XK8A 5B0FA 5AXLA 2Q6BA 4LREA 1VBXA 1VQ6S 4KPCA 1XWLA 1RWOB 3M6VA 1MSWD 3D3CJ 4DX5A 1HQ2A 3IBCB 4F8RA 2EFOA 4ZHRB 2CVIA 2HVZA 3D28A 3N5BA 1LW0B 1XN9A 2FY1A 4NI2B 2CDRB 4P2XA 4FP9A 1SXLA 1N0UA 2OP5A 4IOBA 1FRMA 3FFIA 3J81U 4O3OA 4DBQA 3W64A 2DRBA 3CULA 3H5XA 4FBUA 4CI0B 2YWFA 4TN2A 3F44A 4DN9A 2DO0A 4Y28C 1DURA 4WIQA 2XGQA 2WW4A 3CCES 1TZ0A 2R2SA 3CNQP 2XWXA 3KJFB 4DR1J 2HNZB 3KK3B 5IC4B 4HACA 3NWRA 4C8ZA 1RLDA 2UUCF 2GHVC 1X7VA 4OLOA 1SJFA 3UDEA 2DGSA 3EGWB 5EWGA 2FD2A 4NEYA 5KFUA 5M2PA 5CYQA 3VZHA 4JI2F 2OSQA 1XMBA 1U1KA 2BQUA 2QA4G 4CYUB 1KWMA 3IGNA 3MR2A 2IMOA 5B09A 2FZKB 4IYQA 3OVSA 2JH3A 4NLGA 1TK5A 4HDGA 3FBBA 4YY3J 2CQHA 4G3IA 2IYGA 1YHQS 3AQPA 4FXDA 4RBTA 1YSJA 2C22A 4KRWA 2CQ0A 3T5HA 2AD9A 2CQGA 1WDTA 2VJUA 4FF1A 2P2CB 3QRQA 1IM6A 2OMOA 1I5OB 4CO4A 4Y65A 2LEAA 4DV1F 2ACYA 1JNRB 1VIOA 4OZ0A 4F3MA 7AT1B 3P96A 3CCWA 3U1MA 3OVAA 1QVGR 1OY6A 1HFEL 3AFGA 1N36F 1JLEB 4M5IA 3CSKA 2ZC3A 3KWMA 3GYGA 2MZQA 4WXWA 3TNVA 2LYVA 1WC6A 2MYFA 4WCEQ 2JVRA 1S6QB 4LBIA 1X5OA 1FNMA 1JMTA 1RWMB 1HARA 1RT5B 3MFIA 4DV2J 3KTQA 1TL3A 1UWBB 4TYBA 1Q79A 3W2WA 1NH7A 3MM6A 1N5VA 2BBEA 3BKTA 3DLKB 3D3BJ 2I8EA 3RG6A 5A0YA 4B3RJ 4KHPJ 2IFXA 3H5SA 4P6QA 2ZM6J 1LW2A 5CQGA 2Y1JA 3KLFB 2FGOA 2OPPA 3LAKA 4DV6F 5HO4A 5L39A 5CYMA 3WC2A 3MUMP 2EBEA 2F9DA 4P2FA 3WQPA 1OQ3A 2CPYA 2XB2D 2Z8QA 2HVDA 2UVRA 3KOAA 1H74A 3TUPA 1B0VA 3BGRB 1F9FA 1EJ7L 2XMUA 1YRUA 3BEGB 5J1PA 1UTAA 3OL6A 4X65F 2MQMA 1FEHA 1JLAB 3ZZZA 3PCOB 4N7TA 3Q2TC 1IR2A 1HNZF 3V4MA 2C1EB 2EBGA 2UVUA 4USHA 4DV0J 4WFYA 3H7HB 3ET6A 3M32A 4IFVA 2XSJB 4P10A 2N7YA 1S6PB 1X4AA 3KLIA 1S59A 2F8MA 1CPZA 5C25A 1ACMB 2GAHC 3KMQA 4PRFA 3M9NB 5D4LA 2RB7A 3RB0A 3SIPB 4OYAA 2XI2A 1HQEA 2YKPA 2B5JB 1UEUA 2CG8A 1NXIA 2GIRA 3UVJA 3SQGA 4PUOB 1FJCA 1KVJA 4DR1F 4UY8T 2RQ4A 2J9DE 3K7RA 2Y8YA 4Q44A 5LJ5Y 3D6FB 3IMQJ 2DCUB 2VD3A 2MKCA 2R7VA 3KK1B 5A2QU 2GJ2A 2LMIA 3C8YA 3JTNA 3QT6A 1T05A 2E5HA 3LO3A 3OTEA 2M9KA 2AZ1A 1YBAA 1NHUA 4MK8A 3FRZA 2XY6A 2WB4A
chains in the Genus database with same CATH topology
1FDBA 3HHKA 3PO4A 3C46A 2E29A 4C3KA 1N34F 4LF5F 4OJHA 5THWA 3KYLA 3MECA 5J1EA 3W2VB 1TKDA 5B08A 3TAPA 1QM9A 4NA1A 3Q8SB 2EC0A 1SI9A 2PO4A 3D1HA 5GAEI 3MMCA 3KJVB 2ERRA 4K50A 1MNEA 4ZVFA 3OR1B 3TYTA 4JUZA 2F1FA 3MM8A 2FUG9 1ZM3A 2HHXA 5A8KB 3IBWA 2V4JA 1N4LA 1HNIA 3CCUS 2HGLA 4ELVA 3H98A 3O8WA 3DN9A 3OQ2A 2EFPA 2ZBIA 3CJ0A 4C3LA 3PW4A 4IOAQ 4K4ZA 4PG7A 4QIFA 4I6WA 1S1WA 1VK3A 2FJEB 1GXLA 4OI6A 1NK7A 3CDUA 3D1QA 3TAMA 4HHJA 3JYTB 2OPSA 4MIAA 1S97A 2V8DA 5KG4A 2C42A 2LDYA 2VBYA 2EFVA 4Q0BA 1L3SA 2CQ4A 2FHOB 4BWMA 3AB2B 4XDDA 3IS9B 1S0MA 2ZH9A 5BYQA 2R8IA 2R7WA 2ALZA 2H5EA 4B3TF 2JEFA 2OJ3A 2JLEA 4WFNQ 3SZ2A 5B0BA 2B4VA 4LIRA 2VG5B 5K8MA 3M8PA 3I0SA 3PX6A 1N6QB 4PG5A 1VQSA 1HWUA 1KNZA 2O66A 4WK3A 3GYNA 3QMQA 2ROGA 2GA7A 3DRPB 2LCWA 3S1TA 3TP2A 5KFKA 3HXMA 2DGUA 4DV7F 1DLOA 1IKVB 5DG8A 3KLHA 4I6YA 1LWFA 1ZPVA 5EUHA 4QU7A 3DYAA 4DR3F 1RT4A 2ZDOA 1X8DA 2X3GA 3IO1A 4J37A 2RKIB 1TK0A 4AL5A 4C8NA 3S8SA 4TY8A 3CJ3A 3RBDA 1UVNA 2CPJA 2IRUA 3ZC4A 1KRPA 3R3TA 4F3OA 2HHHF 2VA2A 2DH9A 3CJ2A 4DR2F 1KEKA 2U1AA 1YITS 2C2EA 1F60B 4AXJA 3M2UB 3KK2A 2DH7A 1H98A 2BM0A 1KHWA 4DDFA 1NEEA 3K0JA 4TLRA 3G6ES 3MGJA 3CIMA 4NLVA 5A6PA 2J7WA 1J5OA 3V5RA 1P27B 4J9MA 4XK8C 1FESA 3K5OA 1WNEA 1VQMS 2Q43A 5EWEA 1ZM9A 3GWCA 2YKMA 3EXCX 1IUJA 4DQRA 4B9SA 1U26A 4Y2MA 3V6HA 2BANA 2LA4A 1MROB 3OFFA 5L1KA 4YDXA 5D8HB 4MYUA 1WHXA 1IKYA 4NOHA 4N5SA 5HP1B 3FZ2A 5B0AA 1X4FA 2R9LA 1CG2A 2ZH2A 2WOMA 4QYRA 4ZPBA 5DLGA 5CD4H 4TXSA 2XC9A 2E1CA 1M5OC 1S48A 3IC1A 5KT2A 3UD4P 3J81Y 1U24A 2DNOA 1TL4A 4UW2A 2BQ3A 3FFIB 1N88A 2DPJA 1SH3A 1LWCB 2U2FA 2FB0A 1XMQF 2ZD1A 1UP1A 2P9EA 3NRBA 2YKNB 3P5TL 3IGVA 1FK9B 5IQQA 5M2PA 5DM6Q 2YNIB 4R8UA 2VASA 5E5NA 2OTLS 3VAGA 4KKOA 4FVCA 3OR2B 5GAGU 3M4XA 3SFGA 3RB4A 3QIDA 1VOMA 3PV8A 4X4RA 2YWHA 1K1SA 2GJIA 1T94A 2E1MC 2FC9A 2RRBA 3EUNA 4IDKB 4I0WA 3FMWA 2XLKA 4KGKA 1YJRA 3ZZUA 2JX2A 5DS7A 4W90B 1CC7A 1R27B 3JSBA 5KG2A 3V6DA 1AUDA 3BM7A 5GADU 4X4OA 1OO0B 1S1UA 4PG4A 3TA0A 2X1AA 3GV7B 4NXMF 1WTFA 2MB0B 4ZOSA 1DFDA 4QCLA 3FMBA 3RAMA 3I4PA 4ID5B 3TW0A 2WB1D 4YHHF 1S6UA 4IG0B 1FVQA 1IR0A 1YJVA 4NA2A 3LP1A 3BQ1A 4ZPAA 4KHMA 4OFZA 3I31A 3MEDB 4E98A 2F7VA 2B3TB 2UVVA 2GX8A 4ALZA 5M2RA 4NYPA 2VBXA 4K4YA 4K4VA 4YEAA 5KT3A 2KT2A 3DDNA 4CTAA 1VQ9S 4DQPA 2HRYA 4NLWA 4RZRA 2OIHA 2K2PA 5KG0A 1BQXA 3IRXB 4X64F 3VAJA 1VMBA 2JC1A 1VLYA 3M2VA 3MM7B 3CC4S 2WRMA 3KLGA 2B4UA 2DO4A 3I9ZA 1RYSA 1R6YA 1FT8A 3I96A 1HL6A 2MQNA 4U67Q 4HYKA 1DARA 3DRSB 4DFKA 2RRNA 3GIKA 1KFSA 1R0AB 2RF2A 2C2RA 2GMLA 4F4YA 4ED7A 2RMLA 2ZH5A 3RRHA 1FJGF 4BC9A 4XO0A 1G3OA 2AV5A 4JBCA 1SJ1A 1FRKA 3AA8A 4RW4B 3OL8A 2ZH7A 2GQCA 3GFZA 2R8JA 1G6BA 1QE1B 3CCSS 2KB2A 3AHPA 3RU0A 3ZZYA 1ZYQA 1KQSR 3RW7A 2UUBF 3LALA 5CYQB 3N6LA 2NZ4A 1WF0A 3C6TA 3MEGA 2IM2A 1LFPA 2E1RA 4O3RA 4K59A 3CCJS 2LU2A 4NLDA 3LWLA 1N33F 1SJRA 1Y9OA 2YX1A 1FXRA 5I3QA 1QUPA 3QAEA 2XCAA 3OFEA 1Z2ZA 2XMKA 5FD1A 2DISA 2PSZA 3I32A 2XHWA 3CVKA 3IRWP 4DV0F 3CJKA 3RAQA 1DZ5A 3GR0A 3C2PA 5HBMB 1FD8A 5LT5A 2DGOA 1RT6B 2H9ZA 3HI9A 5KAKA 2B6AA 4GMKA 1ROFA 2JZ5A 1CVJA 1TR0A 2LKZA 2PA3A 3H2LA 2F8HA 1C0TA 3B4MA 3MHYA 4HDHA 4PXEA 4BWJA 5IS2A 2D3OR 4TQSA 3Q8QB 2NXUA 2Y1RI 2KI2A 4I2PA 4MIWA 4KV8B 4Y2IA 1VC5A 4AL7A 1M5SA 4FNHA 3BDEA 2COLA 1LKZA 2HLUA 4YR2A 3OSNA 2MMYA 2CPFA 4TKTA 1UJ4A 2CPXA 2AF6A 5KFNA 4U9RA 5AJ3F 4FS2A 1HHTP 1FRLA 3PVXA 1P1LA 2R7RA 2WW8A 1IKWA 4N77A 3VAKA 1RTDA 5LXRA 2JEGA 4ZHRA 2XCPA 1TFWA 4QU6A 4F2RA 1YJWS 4MKYA 3M6WA 1LWEA 2FTRA 1H6KX 3DMJB 4O3PA 3EPGA 2VBZA 1NKCA 3D0HE 4TNOA 1VQLS 5B0CA 1LW0A 2GGPB 1SUQB 3OBIA 1YI2S 2E7XA 2MJNA 3IG1B 5G0RB 5KFGA 4JI4F 2W8LA 2OD4A 2MKKA 3SCKE 2ZUGA 3VQSA 4CH7A 1VBYA 2XSFA 2IC3B 1BD6A 3BB5A 3R1LA 1FXDA 4ES2A 2ZE2A 2W9BB 5HLFA 5F8JA 1IBKF 2P9GA 1OPIA 2RT3A 4G1PA 4B17A 1MU2B 1FDDA 2XMMA 4DG1B 4YFUA 1KC8T 3FSYA 3DOKA 1KLMA 4O4GA 1HBMB 1IBLF 3HLUA 2VUGA 2MHEA 5CA5A 1DQAA 2ZHAA 2BYCA 3LP2A 1J2VA 1RT1B 4ED5A 2Q6CA 4M95A 1U1OA 3I0RB 1F5AA 4O0IA 4PQUA 1NK6A 2KFYA 2GMHA 3CDEA 3HF5A 4O23A 4M94A 1T95A 3LGMA 4C9DA 1HBUA 1RYRA 3DCAA 4DOZA 2PN6A 3MAQA 2DHSA 1FO1A 4URSA 1TKXA 2VPWB 4FVMA 4Q2MA 5KT4A 4FF2A 3HZGA 3M6UA 1I94F 1C4AA 1HPZA 1TQLA 4I2QB 4OHWA 4Q7AA 3GE9A 2NSBA 2BOPA 4ECUA 2XY7A 3OL7A 4OJ1A 2DIVA 1SKWA 3RRKA 1U6ZA 2DVIA 2BM1A 2Y0SD 4RW9A 5KFVA 4ETZA 4DR6F 2MHNA 5L1LA 1S77D 3MI7X 2VKRA 2BVZA 3G6XA 3BJYA 4GC7A 5J2QB 3OHBA 2FJXA 3MTKA 3Q8RB 4QIEA 4DSLA 3Q23A 4IQXA 1FTRA 1JLBA 4I68A 2DR9A 3KK3A 3OTCA 1HNVA 3AJ2A 1QAXA 1R8AA 4OZLA 1V6HA 2UVWA 4A8QA 2KT5A 4USJC 4C3MA 3H4DA 4B9VA 1YJ9S 2OTJS 1Y3KA 4ES1A 4KE5A 1Y5NB 4MMOA 3TI0A 4ES3A 1NB7A 3ENQA 3G71S 4GO7X 3ZZTA 2PI5A 3F73A 4HKQA 3CCLS 2EWHA 3KKFA 4YR3A 2PC6A 2YQ3A 3UE2A 2F40A 3MM6B 1S79A 2WBMA 2IVFB 5H1SV 1JJ4A 1X4BA 1TAQA 1HI8A 3SDEA 1LK7A 2CJQA 2L08A 4EGLA 2HW3A 4PG6A 2HNYB 2J9DA 3POTB 5E7OB 3CC2S 1FKOA 4R0JA 4DJBA 4DLGA 2CG4A 2KRBA 5F8LA 1X4GA 1FRHA 1RTIB 2KYXA 4C98A 4RW7B 4NPOA 1KONA 5A0YB 4IUFA 2BW2A 3Q0AA 2HHUA 5E33A 4EU0A 4ED2A 1T02A 3UPFA 1BQNA 1Q1KA 5LJ3Y 3PFEA 1S9FA 1H2VZ 2OAUA 4RLEA 2VPYB 4ECYA 4DL5A 1LW2B 2QLWA 2GNKA 4RNNA 2OPRA 3BGLA 5I3UA 4DQQA 3E8OA 2A18A 1U1NA 3DLLQ 2GO9A 5HN0A 1CEZA 3FCHA 2YKOA 5D3GA 4AFFA 3UCGA 5BYSA 1OSDA 3UW1A 3M30B 3DU5A 3HVTB 4ZA1A 5CYMB 1Q8BA 4U7CA 3T3FA 3Q24A 4DR4F 3FQLA 2C3OA 2AGQA 3MMAA 3N79A 2BJDA 2IAJA 5IM0B 1JNZB 1KOOA 1P8GA 2VG7A 4KFBA 1F2GA 2IM0A 3PRDA 4NZ0A 2HHTA 1OWXA 2HRUA 5HI7A 1C1BB 3UD3P 3SEOA 1VQ5S 4UQTA 3FQKA 1REVA 5EWFA 3RBEA 2D7SA 3RR7A 5KFDA 4CH1A 3VZIA 1O51A 1XEZA 2HHSA 5LMUF 4JV1A 1UJ5A 4RW6A 2GQ2A 4C0OC 2JWNA 2VG6B 2W25A 3VALA 1RT7A 3R5AA 2QSFA 1K0TA 1N0VC 4NZ6A 3HJFA 1SH0A 3EXYA 3L7PA 3IR6B 3X3UA 2RQCA 4DL4A 3PW2A 3GIIA 5L1IA 2DR5A 5F8MA 2CQBA 5F8GA 4WZMA 4C8LA 3J7ZT 5AXMA 2FLLA 2FJVA 1JLQA 3CJ5A 2J6UA 4YMEA 1HWJA 2VH7A 3GIJA 3PNIA 3P3DA 1KQFB 5B0EA 3DGPA 1P1TA 4DLEA 4H4OA 3M32B 2C3MA 3C6UB 4PR6A 1FDAA 3JSMB 4EBEA 1M5KC 2N4CA 1DTTB 3A8EA 4FZVA 5C25B 3M9OB 1GQEA 3UR0A 4EBDA 1HNWF 2E5GA 1H2TZ 5K8PA 4X4UA 4JI7F 3SV3A 2MGZB 2FHJA 2ZVSA 2W4PA 2KG1A 2R2UA 2V8HA 1K9MT 3ENWA 3HHLB 4C8YA 2VODA 1RTHB 2RD5C 3M1VA 2HHVA 3TO8A 4P2SA 4JV5F 2ADCA 2HZCA 2Q79A 1WACA 3OXLA 4DR7F 3ZZRA 5M2UA 1HQEB 5J2NA 4OI3A 2NR0A 4RW8B 4MYTA 2LQJA 1NK9A 1JK9B 3V81A 4F25A 4R5PA 4EO8A 4N76A 3MM9A 2DGXA 1R89A 2ZH3A 3NNAA 4OJGA 2LEPA 1AFIA 1U25A 1SKRA 1YQHA 3HVWA 2F4VF 5FDLA 5LSRA 4EWTA 2ZOGA 1LK5A 3LP0A 2EFGA 4LSLA 1RT5A 4YB5A 5HROA 2V4RA 4WU3A 1YG0A 2DGTA 3PR5B 4OZNA 3SQGB 2HLTA 5IWAF 2HIQA 4B3MF 1UWBA 4WU2A 3T6BA 3CB4A 1VFJA 4NMLA 5B0DA 3MURP 1GT8A 2BRLA 1HMVB 4CCHA 2M70A 4KPYA 2ZH6A 3FZBA 3BSCA 1Q82T 4IR9A 3T5LA 4A8FA 1WI8A 2YNFA 1BLUA 1LXNA 2JL9A 2CPDA 4RUAA 2BE2B 3ETOA 4PXDA 4ECRA 4DUYF 2DT9A 3S7RA 2YVSA 2GV1A 1TV6B 4Z37A 2DNNA 2BDPA 2Z2MA 2BA9A 2WSFC 1KTVA 5A2QY 4QOTA 1GH8A 1YGYA 4FN5A 4I56A 2AJ4A 3NMAA 3DLKA 4C0BA 1TL1B 2C28A 3HDSA 1QSYA 1O5JA 2PMHA 2VQFF 4LF9F 3LOUA 5KG7A 5KFBA 2APOA 3QIPA 1T03A 4KR0B 2DB1A 3I5CA 3MEEB 3N28A 4Q2LA 1KR4A 2HQIA 1RP5A 4CZCA 1FDNA 2ABYA 1HQUA 2I9SA 3HK2A 5KFXA 1N5TA 3OUYB 2E9TA 4X4TA 4I4BA 1UA0A 4NCAA 5EN1A 1NH8A 4E8UA 3FSIA