1SI9A

Boiling stable protein isolated from populus tremula
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
TRTPKLVKHTLLTRFKDEITREQIDNYINDYTNLLDLIPSMKSFNWGTDLGMESAELNRGYTHAFESTFESKSGLQEYLDSAALAAFAEGFLPTLSQRLVIDYFLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords stable protein 1
publication title The Structural Basis of the Thermostability of SP1, a Novel Plant (Populus tremula) Boiling Stable Protein.
pubmed doi rcsb
molecule tags Plant protein
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1si9A00
2IYIA 4A48A 3QMQA 4A46A 2KT2A 2ZDOA 5F0UA 3KG0A 2VV5A 2W4DA 4DN9A 2BUNA 2GO8A 2AJ0A 3HHLC 4Q2MA 5B0GA 2OFGX 3BM7A 4ZA1A 1MWYA 3I9ZA 4HH1A 2GFFA 3BN7A 3HFKA 3HX9A 1Q53A 3E8OA 3HF5A 1APSA 2XMKA 4EFAC 5T7LB 3DXSX 1S6OA 1CC7A 2G9OA 1CPZA 3CJKA 2HFOA 1VQSA 1FVQA 2RMLA 2N4DA 2ZDPA 4DPOA 2ROPA 3LGNA 3DCAA 3UDCA 1YRXA 1V3ZA 3FMBA 1Y0HA 2GV1A 2OD4A 1FEEA 1KVIA 4Y2MA 3HDSA 4HL9A 2K7JA 2K1RA 1W2IA 1AW0A 2HQIA 3MZIA 1S6UA 4NPOA 2CRLA 2QYCA 2GGPA 3BDEA 1OQ6A 2VH7A 5KAKA 2XMVA 1YG0A 3IWXA 1RJJA 2LQBA 5A6WA 1TL4A 3VTIA 2LDIA 4FNHA 1CC8A 2LXFA 3FGVA 4QOTA 1TL5A 2LQ9A 2XMJA 1FE0A 3TOQA 4OJ3A 2N4CA 2EW9A 4HI2A 1OPZA 5B09A 2OAUA 4DL0C 1IUJA 1YJTA 2BJEA 4HI1A 5T7LA 3HHLD 2BBEA 2BJDA 2L3MA 2N7YA 1XBWA 2AW0A 3QGPA 3KNGA 2HFNA 3BF4A 1FVSA 2ASYA 1URRA 1Y9OA 1YJRA 2OFHX 1Y3KA 2RU9A 2KT3A 5B0DA 3IWLA 5F0WA 2OD6A 3HHLB 2FHMA 1X7VA 1Y3JA 2RSQA 3K7RA 3TRGA 1OQ3A 2PD1A 1YJUA 1P6TA 2KKHA 4OJ1A 2ACYA 3GZ7A 1FD8A 2XMTA 4U9RA 4YEAA 5A6PA 4Y2KA 1Q8LA 2IFXA 4F67A 3BR8A 3T9NA 3FRYA 1GXTA 3LGMA 2Q3PA 1K0VA 3KKFA 1YJVA 1U7LA 5K9FA 1ULRA 4NL5A 1AFIA 2HLUA 1X0PA 4Y2IA 1N5QA 3MCSA 2JDJA 2PGCA 1OSDA 2GA7A 2QLWA 2QLXA 2XMMA 4OJGA 2FIUA 4A47A 1JWWA 5IXUA 4OJHA 1JK9B 2FTRA 3WDOA 2W4CA 1AFJA 4Q2LA 3F44A 5B0FA 1N5VA 2BYCA 3BB5A 5B0BA 2OP5A 1KVJA 2XMUA 2AP6A 1SQEA 1Q8BA 2QIFA 2ROEA 5B0CA 3CJKB 3KG1A 1TZ0A 2FB0A 2GCFA 2HLTA 1LQ9A 2RILA 3BGUA 4A4JA 2AJ1A 2OMOA 5B0AA 3HHLA 1SI9A 1TR0A 3LO3A 4HH0A 3TNVA 2K7KA 2OKQA 4YDXA 1FE4A 1TUVA 2KYZA 2IYGA 1KQKA 1N5TA 1Q4RA 2XMWA 2ROGA 1VQYA 4ZOSA 1GXUA 1QUPA 1R6YA 2K1RB 1P8GA 1FESA 5B0EA 1MWZA 5B08A 1X8DA 2W4PA 2GGPB 2HIQA 4OIXA 1SB6A 1WD6A 1N5SA 4FNIA 2K2PA
chains in the Genus database with same CATH superfamily
3H7HB 2VUGA 5L9NA 4CP5A 3MM5B 2W9CA 1PJ6A 3D7SB 1Q16B 3EZUA 3PW7A 3QT7A 4ES3A 3CD7A 1KQSR 2UVRA 1FVQA 3DRRA 3EX7B 4DV0J 5CZVA 5GAGU 2W9AA 4ZLLA 4ES1A 2WB1D 4DR5J 1W2BR 4KGVB 2YWHA 4BC9A 2C1EB 2LXIA 2J8SA 5F8GA 1K73T 3BSCA 4X4UA 4LBHA 3MM5A 2JRSA 2G1HA 3HHKA 4NE9C 2APOA 1AT1B 2JJ4D 2XLJA 1RTJB 2CQHA 2ZVIA 5IT0A 3WQPA 4DL5A 2RRBA 3PKMA 5SUHA 3EICA 1UPMB 2VICA 3DHWC 2MB0B 2PMWA 1MLAA 3DRPB 5JJBA 3P45B 4DR3J 1GMVA 3AOBA 1KLNA 2FB0A 2FLPA 4UUWA 3FBCA 4DV4J 3PEJA 4G6VB 4K4ZA 1VBKA 3DRPA 4W98A 2A2DA 1SH3A 4QCLA 3HSDA 2B3TB 2B0GA 4PXEA 2HS3A 3V6DB 2MMYA 1RWPB 1UFWA 4QIFA 3UDCA 1N4LA 2Q6BA 1FEEA 3KYLA 1GMUA 3W62A 4DCJB 5CYMB 2QYCA 2FJXA 3GFZA 3JQKA 5KFRA 3E51A 3QJLA 1QJHA 3V6DA 2AZ1A 2D3O1 1EKSA 2AW0A 3ITHB 3MM7B 4CDIA 2Y1LB 1TK5A 4DU7A 1VS3A 1U26A 6FDRA 2NR0A 3SV3A 5J2NA 1QAIA 2XCAA 1WOPA 5CYMA 2J0SD 5IZHA 1HBOB 3T41A 2NYIA 3PO5A 7AT1B 4BWMA 1HHTP 1HWIA 4A8SA 2HFSA 4NXMJ 5EDWA 3ITHA 5B0BA 3MM7A 4ERDA 3DFEA 4E0DA 2O5DA 1FERA 4EWTA 1HBOA 1RTHB 1FJ7A 1D3WA 3MTJA 4A46A 4LRAA 4OV1A 5D77A 4M5GA 3MAQA 3BM7A 1MSWD 4EGLA 4B3SJ 4KBIA 5DZ6A 3IC1A 3KTQA 2BW7A 2DR9A 2G1DA 2KJWA 3S1TA 1RTHA 5LMUF 2Y0BB 2FVSA 5LMNF 4PPDA 1TFYA 2LQ5A 2FVCA 5CCLA 1RBLA 1RGVA 3POTA 3S7RA 2LCWA 3KFWX 5KFUA 3QZ8A 4DR4F 2C42A 1KKHA 4CQ1A 2XNQA 4G1PA 3JB9k 4M95A 2CPZA 2IFXA 3HZGA 2U2FA 1GXTA 2F63A 3D4JA 5KT5A 3KJQB 4ANDA 1M5HA 3PRDA 4RPFA 2FIUA 4KQZA 4F26A 4IQXA 3HULA 5J1EA 1P9YA 4OHZA 2VFSA 2LEPA 3JQJA 2NXEA 3NAIA 1M5KC 4TQRA 4FKYA 3AOCA 2W4DA 1A7GE 3GV7B 3TYTA 5T7LB 3UNGC 4G65A 4C8OA 4LR8A 3DLEB 2YWGA 4FVCA 2HNYB 1NJYA 2J0XA 4RW4B 3AQOA 4LVNP 5B09A 2HNZA 5T7LA 2B6AB 1SL0A 2BV3A 2QYGA 4O4RA 3KLHA 2ZH7A 3DLEA 2E7XA 3M8YA 5FDLB 2NSBA 2HNYA 3HI9A 1U2CA 4RW4A 2CJBA 2E1AA 1XNQF 1JWWA 2Z2LA 2B6AA 3LQVA 3GLJA 3VAMA 4F3QA 1WC3A 1SVDA 1AA1B 3X3UA 2DY1A 5FDLA 4ZP9A 1NJIT 2C3MA 1U0HB 1MMNA 4FBUA 4KPYA 4JUZA 4OYAA 3AXKA 1RWUA 3NCRA 4M5MA 4I67A 4L73A 1T11A 1RHKB 2CWXA 4ENOA 3P4UB 4NPOA 4YB7A 1SUQA 2AYGA 5LSOA 1SL2A 3VQSA 2M7SA 4LF2A 4DXLA 3H5YA 1U6BA 4WZMA 1U0HA 2HMIB 2OJ3A 4IRDA 1CG2A 2N4CA 2KDOA 3C6TB 1NKCA 3TX8A 3W8PA 1CQNA 2VPYB 3JAMU 1FRKA 1NHVA 3T9ZA 1B0PA 3CJQA 3EPIA 2FZCB 5BR8F 3R2DJ 1S57A 1AUDA 3M6UA 1FRHA 3Q8SB 3PDNA 2HMIA 4NLGA 3HD1A 1UEKA 1K1QA 1JK9B 3C6TA 2VQFJ 1UETA 5ETVA 1H7XA 3KG4A 2C2DA 4WWSA 3M8PB 2ZH3A 4OI3A 7FDRA 2UUBJ 2DGTA 2EVZA 1U49A 1Y5NB 3MPUB 2Z30B 4DSKA 3QYYA 4I6YA 4AFFA 1M90T 3P49B 3T1YJ 5ADZA 1XNRJ 4CO5A 3HT0A 3QAEA 2VBWA 2HVDA 3Q2TC 2Q79A 4FYVB 5A0YB 3M8PA 1O6XA 4YR0A 2M5YA 3G71S 1C2PA 3QO9B 1KTQA 2MHNA 1VR6A 5F3ZA 1S4FA 4KHMA 3KLVA 4TQSA 3G8TA 2HAFA 4K4TA 1NB7A 1N6QB 2M0GB 2OD6A 1RA6A 1C4CA 3SI8A 2ABYA 1QD1A 2NPIA 3BO4A 3ULHA 3JS9A 1NHKL 2VBYA 2QN6B 1BXNA 2GA7A 3MR2A 2ACMA 4CO4A 4I64A 1RT2B 5L46A 1N6QA 5JMNA 4DV1F 3D66A 1TR0A 2CYYA 4OHYA 2VG6B 1VDHA 4B3RJ 4PCQA 5HN0A 2ZKTA 1GNKA 3C6UA 1WHWA 2ILYA 1HQ2A 1BC6A 3R7BB 4NEYA 4XAKA 2GX8A 2DNRA 1RHRB 1SKSA 4N76A 1B99A 4EFAC 3W5XA 2V67A 2VG6A 1JLGB 3CC4S 2F3JA 3NGRA 4JI2J 1Q5YA 2YKPA 1D9DA 1GQEA 4KB7A 3HSJA 3QSYB 4X4OA 2EC0A 2DH7A 2XGQA 1JLGA 5KG7A 2XHWA 1U25A 4WK1A 1VQ7S 3EJMA 1A0OB 1S0VA 3DOKB 2ATLA 1VQKS 2GHPA 3CDEA 3SCJE 3CT9A 1ZZNA 1FNMA 2NXNA 2FTRA 1LXNA 3M8ZA 5CH7B 5DG8A 2G0JA 5DS7A 3K5OA 3MDFA 1W26A 3KDNA 1VBXA 2JEJA 2XZTB 1VQ9S 2CFXA 1ZOTA 1TKXB 2VKZG 1YJNS 3A4TA 4KFBA 1JLCA 3CCQS 2CPFA 5HJXA 4ETXA 2PI5A 2V9WA 4X62J 2R3VA 1MWYA 2DH8A 4U95A 2BDPA 4JI4J 3Q8RB 4YS2A 2LEBA 2C28A 2EFGA 5HLFB 1F1BB 3CDUA 1TKXA 1VIOA 1XIQA 4N8OA 1J27A 5KAKA 1GFWB 3CD6S 1L3VA 3VTIA 5IWAF 1X9WA 3K89A 1HA1A 1KS2A 5D0EA 2OO4A 3QAUA 2XY5A 5HLFA 4TU8A 2R7RA 3ZZUA 2YQ1A 4P74A 5F8LA 2FHMA 3I82A 3RYLA 2EFVA 2MZTA 2QMWA 1UVMA 1EQ0A 1MMLA 3W61A 5D78A 3GIMA 1RT5B 3KUHA 3AD7C 2H48B 5KFKA 2FHKA 4PG4A 1FJGF 2HBRB 1BQNB 2WZ1A 4ZCIA 5KFNA 3KXDA 4OZNA 2P2CB 4Y2CA 2PMZD 4DHVA 1X0FA 2HFZA 2QV6A 4WBFA 1D0EA 1R27B 1CPZA 2KHDA 4ED4A 3P5BP 3CJ2A 3BH6B 2BKPA 5I3QA 2BOAA 3VGUA 3H98A 1RWVB 2BX6A 2IA0A 4WK3A 1R8AA 1RWWB 1BQNA 4DUZJ 4DX8H 3LWLA 3QLHB 4OJ3A 2VFTA 3CCMS 1MW7A 3BBBA 5F9LA 1BWVA 3I87A 1WF2A 2PSZA 2B9YA 3R5DA 4RW9B 3A3NB 3D3CJ 2NREA 4PQUB 2YWWA 4XO0A 4OZ2A 4WTYA 2ZE2B 3UQSA 2WW4A 3R27A 1X7VA 4DV5F 4NYOA 2A0FB 4W90B 5F41A 2IM0A 3RR7A 3IAS9 3J7YI 1MN7A 4ZP8A 3ZNJ1 3PG9A 2LA4A 2PGCA 4BC7A 2DXDA 1WSVA 3F44A 4FF4A 1MMDA 2YH0A 3SEOA 2V0NA 3BGUA 2POKA 2RB7A 4PQUA 1HR0J 2ZE2A 2K7KA 4B3MF 5SZTA 4J9SA 2BXJA 3MHYA 2RUSA 2XHCA 3G4SS 4UOHA 1NKEA 3QNWB 5T41A 1VOMA 2D1CA 4PAAA 3SDEB 1F9FA 5ITHA 1S77D 1CC7A 1BMQB 5KFFA 3TARA 4PWWA 5U47A 2V9KA 5F9NA 3BREA 3NKYA 5CXTA 2CJXB 1RYRA 1VRUA 1FDDA 1I51B 2VDIA 1N8RT 2P9CA 3PO4A 1TELA 2RKIA 2UUCJ 4ZIWA 5HQMA 5GADI 2DRAA 1S99A 1YBTA 2C3YA 3KWMA 3NS7B 3UCGA 4IFYB 3VF0B 2HQCA 4NXNJ 2FJEB 2YX4A 3SDEA 2Z57B 4WKRA 3W9IA 2C2NA 5DLFA 3OTBA 2B51A 4IR1A 3H25A 2RQKA 4HDGA 4HACB 1UPPA 4LVOP 4ZVOB 1XERA 4IFYA 3MEKA 2V4RA 5IXUA 1N56A 4HHJA 3GJTB 4FF3A 2XY7A 2VA2A 1S9EB 2HGLA 1OY6A 2OEMA 1KRPA 1R8PA 2H5EA 2UV8A 3OL7A 2GQ2A 2UXCF 2K1RB 4OLOA 1HMVB 4HACA 3W1YC 5MLCV 4ZVEA 2HURA 2QA1A 2XTJP 2LU2A 4ALZA 3LPYA 1S9EA 2ZOMA 2CQ4A 1E6VA 3DDKA 1LWFB 1YRXA 3JYTA 1H2VZ 4UW2A 2AYMA 4DV7F 2K1RA 2AWZA 5E3PA 1S6UA 4IH5A 1IWGA 1SIWB 1HMVA 4R5PB 3CCTA 3CMES 1JB0C 3F41A 4ED2A 1S0NA 1FTCA 4QU7A 2UXDJ 5E3RA 1HKAA 3NS6A 3D9BA 3AD9C 1XR7A 1LWFA 3CCVS 5BXIA 3M6WA 2ZH9A 2XWYA 1IKVB 1WWHA 4AYBD 3OT9A 3GYNA 2PEBA 5HROB 4C3LA 4K0KF 4WPAA 5IS2A 1PC5A 3I0SB 2LXUA 2E1PA 1NDLA 2JDJA 3BKFA 3R5BA 4M5NA 6FD1A 1Q7LB 4QR0A 1T9VA 2WVCA 1G7CB 4M94A 4DR6F 1SJFA 3OTDA 4CLLA 1IKVA 1UAWA 4FN5A 2HHWA 3N6NA 5DDRC 5HQ8A 4Q5VA 2AJ0A 2Y8WA 4FKXA 1LWCB 3WC2A 3CCES 2YNIB 1TL3B 1T9XA 4B9UA 3AFGA 3B4MA 2DGSA 3T1HJ 5E2QA 2UV8G 3I0RB 4R25A 3M05A 2BQRA 2KXFA 3O5TB 1ZETA 2XNRA 3PX4A 5DQHA 4ZVTB 2YNIA 1S1XB 3FK4A 2KT5A 2W2MP 1T9UA 3NWRA 8AT1B 3K8VA 5G4DA 3I0RA 1FF2A 2E5HA 3C19A 4HVZA 2NUUG 4LRFA 4B3OB 1TKDA 4WCEQ 1EZZB 1GK8A 2QLXA 3GWCA 4A47A 2YX1A 2W4CA 1SXLA 1S1XA 4ER8A 3KUEA 3M8SA 4X66F 5I3UB 4WZQA 1VBZA 4DBQA 2UUTA 5B0EA 3D6TB 1JLEB 3U1LA 3GIRA 2ZDOA 1U0SA 3TAPA 1VQNS 4GC7A 1MWQA 1S59A 1T02A 1NCLA 5I3UA 3QJPA 1Q82T 4IG0B 5C25A 3IA0A 1WTFA 1UA1A 5AJ3J 1JLEA 1OQ6A 2H65B 2WSEC 1OS5A 5LJ5Y 2FD2A 2UP1A 3EDQB 1S72S 3TZWA 2BBEA 1S1TB 4X4RA 1XBWA 2FZGB 2FHJA 4A8OA 4DF4A 3VVUA 4IG0A 4CLSA 5CABA 5HQLA 1WC4A 3M6VA 3K7RA 1F5BA 1NSAA 1RI7A 4F50A 2MKYA 2MKIA 4DOZA 1RHUB 4R0EA 4GVLA 1H2TZ 1HNWF 2HGMA 4F2SA 4NWBA 3CO9A 2V4QA 2GMLA 2DGUA 2C2KB 4FS1A 3D68A 4ED8A 3TA1A 5IFMA 4ZS6A 2HVIA 2A2CA 2ZVSA 3E2EA 3SCKE 1M1HA 3UR0A 4NLOA 1CVJA 4JI7J 2P6SA 1N32J 4OZJA 3BKTA 4CO0A 3MPVA 3RRHA 4ILLA 3CTRA 2PT0A 3N5FA 5KFEA 5F8NA 3MEGB 2YNGB 3GPAA 4ZP7A 3UD5A 2LMIA 1D9AA 4USKA 2C2ZB 4QIGA 2RAQA 4YB5A 3DLKB 2WBMA 4N56A 2DISA 3FGVA 4ZCMA 1WEZA 3IR5B 2YH1A 3VHQA 2B43A 4AE5A 1X4HA 5HMZA 4I2QB 2YNFB 1YJRA 4J5OA 5LXYA 1L3KA 3MEGA 5K8MA 3QRPA 2YNGA 2WVBA 1RISA 1NZ8A 2QX0A 5LSLA 3DLKA 1Q5VA 5LL6d 5L1KA 2ZITA 1SJ1A 3MGJA 3ZTSA 1FA0A 4N77A 3ETOA 2D69A 1PILA 3FNNA 3BQ0A 1RE1B 3UD3P 3RRKA 1OWXA 2ROEA 4TY9A 2CNOB 4DL6A 4JI5F 1M5VC 3IBFB 4HDHA 4OX9J 2RNEA 3DI6B 4U7UK 2OIHA 4HTIA 4ZITA 4U8VA 2JC1A 3MMJA 3I4PA 3TANA 3DOLB 4F3MA 1R31A 3AB2B 1RHQB 4NLXA 3UD4P 3IRXA 1I94F 3NMAA 4TYBA 3DKDA 4JV5F 2K3KA 4O3SA 4L3NA 4GKKJ 2KFZA 4CCHA 3DI6A 2DITA 1QVFR 3K5LA 5HBMB 1IQTA 2JL9A 4QJVA 2E9TA 3Q2SC 4K4XA 3PKYA 3H0PA 3LP2B 3N6LA 1LOUA 4DZDA 2WB4A 2VASA 3MM9B 1N48A 3ZTRA 4B3TJ 2ZEJA 3MEDB 5HBMA 4DV0F 2L48A 5KFTA 2DVIA 1KWMA 4DR5F 4WP8A 3S8SA 3LP2A 3MR3A 3BBFA 3N0VA 2NS1B 3ZTPA 1ZM9A 3MM9A 2L9DA 4C4WA 1B4SA 1H38A 1E6YB 3MEDA 2AJ2A 2HFVA 3HJVA 1PBAA 4EMDA 1KTVA 3CDAA 4F4AA 3NGUA 3ZZRA 1U1PA 5D15A 2R8HA 2QZ8A 5LOQA 2LLZA 1E6YA 2XBPA 2Q6CA 3W2WB 2BZ2A 2K7JA 3SSSA 4DR3F 4ZK7M 2DT9A 3CWJA 3DM2B 3L7PA 4C3MA 4ZP6A 3HHDA 1GXLA 1RBOB 5GVQA 1IKXB 1RTZA 3J7A1 1WI8A 2DD8S 6AT1B 4H4MB 5FJ4A 3MEEB 3W2WA 3CXCR 1UJ4A 5F8HA 1I1GA 4UY85 3BR8A 2MY7A 2WHOA 1H0HB 3C16B 2UZAA 1Y5LB 2W01A 1OSDA 3RAQA 1TMJA 1VISA 1IKXA 3LALA 4C8KA 4H4MA 4MT1A 3MEEA 1F60B 3GILA 4ZPVR 1IR0A 3TEHB 2HHTA 2MKJA 4X4NA 3MOZA 4BLGA 4YY3J 2FPHX 2KL8A 5E5NA 1X5TA 3MCNA 1F9HA 3MD3A 3NP5A 4EBEA 4L6V3 1UEUA 4NXMF 4TU9A 1XMOJ 4P52A 2VA3A 4DX7A 3W8GA 2ZBCA 2CVIA 2DGXA 3ICLA 1BHNA 2XYPB 3GQCA 3TJ8A 3A8JA 2X1GA 3MFHA 4B3SF 3G6ES 3GR0A 1FKAF 2HQFA 3PEHA 3OD2A 5D8HB 4JYAJ 1HI8A 2VKRA 4NYPA 4HEA9 4OZ3A 2FGOA 1KHVA 5ETLA 1JX4A 4N5SA 4CNYA 3MI7X 5H1SV 2BE7D 4O3RA 5D3GA 5HATA 3THVA 2BMBA 4C8ZA 2F5GA 1TUVA 2OEKA 1N5TA 4YOEA 3KHGA 4U96A 4FNIA 3DXBA 1G3OA 3DDIA 4WTOB 2OFGX 5CHCB 2GIFA 3J7YU 3IGVA 3QT8A 2QL9B 3EPGA 5ETSA 3TUIC 3OHAA 4RBTA 5AE3A 1C1CB 3SSQA 4C8LA 1XK8A 2HZVA 4TNOA 4MMOA 3BYPA 3Q86A 1F6TA 2A10A 3V6HA 2RF2A 3KUGA 1JLFA 4NLRA 4F8RA 4OYBA 3Q8YA 2UXBJ 2CXEA 2DY9A 1BD6A 4ZN1A 3C8YA 3MCOA 3QIPA 1C1CA 4J9RA 4ZJLA 2DNKA 2ZOGA 3KJNB 4USMA 5F3TA 5HVHA 2KKHA 2E29A 2ZD1B 1F9EB 1NMEB 3NGTA 2FLNA 5GADU 3QGIA 3TQEA 2ZM6J 1NM2A 4PQAA 1XEZA 3ILIA 1YHQS 1LQ9A 2YWKA 3OLBA 1BLUA 4PYDA 1IBKJ 1EETB 1VLOA 4K59A 1CULB 2ZD1A 4AT1B 2DH9A 1R8HA 2B8QA 2PC6A 4DV3J 2KVQE 3D6MB 1RTDB 4PR6A 1S5ZA 3UN3A 1VRTB 1EETA 5KOWA 4LSNB 1AW0A 1CULA 3V4IB 4NMXA 1DTTB 3A8KA 4KGXB 1U4BA 3B8HA 1RTDA 2CJYB 2OGUA 2HWTA 3HHLD 4DPWA 4M5HA 1RBAA 3CULA 1VRTA 3VWSA 4LSNA 2HBZB 1TKTB 2VU5A 2RSQA 2JC0A 3GFXA 2MLZA 2B56A 3CJ3A 3F0NA 1U1KA 1LW2A 1B64A 4ZLPA 2CJQA 5C42B 2E1CA 4Q2LA 3ISND 2EKYA 2GW8A 1NDKA 1S79A 1EAYC 3PHTA 3BSNA 4ED6A 2DTJA 2HQGA 3I5CA 5ETMA 2Q1LA 2EPIA 2J0WA 1GXUA 2DB1A 1CQMA 1DBDA 2F8MA 5ETPA 1VFJA 4EO8A 1U1LA 3IFEA 4O0IA 5C42A 5K14B 3ENAA 3PX0A 2ADCA 1S9GB 1IQZA 1R6VA 2HFOA 3UNYA 4GO5X 1NLKL 2ROPA 3ZZTA 3KK2B 3DLLQ 1Y0HA 4Y28C 4FP9A 3W66A 3I56S 3DNCA 3J81j 3AAWB 1MG7A 4OL8A 2YKMA 3CC7S 4DSEA 4QPTA 2IC3B 2X3DA 2UUBF 5K14A 3D6HB 3ILLA 3CCJS 4XIUA 4CT8A 3OL9A 5IV3A 2LQJA 1S9GA 2GQCA 4DS5A 3RAMA 2QRRA 4DSLA 3FUYA 2DGWA 2KFNA 1JLQB 1SV5B 3KK2A 4YUDA 3JSBA 2CZ4A 1GX5A 5D0RA 1XNRF 2DR8A 3TVYA 3M2UB 2IC3A 1H72C 1W7WA 2RHQB 5DG9A 4KSEB 5GAHI 2NYHA 2GCFA 1JLQA 1SV5A 4PKDB 1KFSA 1Q78A 4R0JA 1XMQJ 4YDXA 3GJRB 1WG1A 3M2UA 1V5IB 3NRBA 4NLPA 1FRIA 1H73A 3CCUS 2XY6A 3FC9A 3UW1A 4NRTA 3CCSS 2RS8A 3RRGA 3QPIA 2BUNA 3TJ9A 2CPXA 3PX6A 3IS9B 1UWBA 3HX9A 1Q53A 3NMRA 4OX8A 2J9DE 1IXKA 1MN9A 1S49A 3KMQA 2GV1A 1VYAA 3DC2A 5KG5A 1KD1T 2QLFB 5KFMA 5EUHA 3PV8A 3SQOP 2Y1IA 5A6WA 3PM9A 1CC8A 4B3RF 3IS9A 3S6EA 1SJ4P 4J9UE 3BF4A 4EBDA 1SKWA 4LR7A 4OHXA 1W25A 4L74A 2I5JB 2HFUA 2W8KA 4CTAA 1NPRA 2LKZA 2X1FA 2IJFA 4AXJA 2K06A 1CJVB 4JI2F 3H5XA 1R3NA 3CIMA 3GG1A 4IH7A 4USTA 3TNVA 3BN4A 2I5JA 3FRZA 2QA4G 4OZ1A 1JJ2R 3ETMA 1DTQB 4NLUA 1DLOB 2XSJB 2QFJA 1HNVB 2J9CA 2GMJA 2HS4A 2RQMA 4MIAA 1K47A 4ECVA 4TY8B 2OD4A 2DR5A 4NOHA 1DTQA 2LDIA 2XSJA 3IM9A 3HHNB 2QSWA 1QVGR 2DK2A 4XPCA 3R3TA 3KNGA 2YKAA 2ERRA 4JI1J 2HFNA 1WEYA 1URNA 4HT7A 3G9CA 4TY8A 2AV5A 4JI4F 2FJVA 3FEZA 1V3SA 3PR4A 3QBCA 4J9VA 1HARA 1KVKA 5KG0A 2OP5A 3Q22A 2EG2A 1QTMA 4USVA 1SH2A 4KAIA 4UTGA 2KXNB 1R7IA 2R2TA 3RB3A 4TYAA 3I6PA 4DV2J 4P71A 2DR6A 2R7SA 2ZNZA 3FSYA 3EXYA 3GMGA 1SKRA 1M1GA 2J6SA 3SBMA 3J80Y 4HH1A 2XG8A 4FYDA 4Q0BB 3I4HX 1SJQA 2HQ3A 2JZ5A 2VG5A 2GHWA 4ECZA 4QYZJ 3VR1A 1V3ZA 4ES2A 5CQGA 1PYOB 4QR2A 2HHSA 4M63A 4OX6A 3FFIB 2LQ9A 2FZKB 1FE0A 2R8GA 4PG7A 3W5YA 4Q0BA 2IBKA 4EEYA 2BJDA 2QT7A 2ZBPA 3LF0A 3CVKA 1NSKL 2ZZMA 5JXSA 1YJUA 2KJVA 4BS2A 3VCDA 2EFNA 3FFIA 2IPOB 3BV8A 3OJUA 1TL1B 4QWAA 4KE5A 2V4JB 1B0VA 4DUZF 3R7NB 2ZUAA 2QIFA 2Z2ZA 4M8LA 3CJKB 1S1UB 4CM2A 3MM8B 5AE2A 3DGVA 4L3KA 3GE9A 2E9RX 1Z4UA 2XI3A 2LA6A 1TL1A 4JI0J 4NLSA 1NDPA 3DGPA 3I9ZA 2V4JA 2XMKA 3CJKA 2Z0GA 3MM8A 3EZOA 5KG4A 2RE1A 2DNGA 3RW7A 1TK8A 3L7UA 1LEOA 1LW0A 1EARA 4X4TA 1LK7A 5CZXA 1NK8A 1HR0F 1C0TA 3BS9A 1FRLA 2MQOA 1UTAA 5C5JA 1EQMA 1IR2A 2B4VA 4NCBA 5KOXA 1ZM3A 2OFHX 2P9GA 1HBUA 1OYDA 4ZVHA 2HHXA 3HO1A 1Q8LA 4LIRA 3K5MA 1R8BA 4ID5A 2WSCC 1HWLA 3T5LA 1BQXA 2HLUA 1M5PC 5DDPC 2UUCF 3T19A 4OYZA 2LP4A 2AP6A 2DPIA 2UU9J 3R5CA 2L08A 3DN9A 2DBBA 1RLCL 1SI9A 2H9ZA 4GKJJ 5L39A 4EK2A 1N5SA 3MR6A 3LH2S 4ZVSB 4RBUA 1RB0A 3ENQA 3BSAA 4ZDNA 2VPWB 1N5YB 4UF4A 3ONQA 5DDOC 5H9EJ 2F40A 2FUG9 3PCOB 4FDFA 5DZ7A 4AQYJ 2VJVA 3GCWP 1NPKA 3MOJB 4XPEA 4KHRA 4HI2A 3W5ZA 2MZJA 1N5YA 1R0CB 4WP9A 1YKWA 2W9BB 1S48A 5RUBA 2B9XA 3WBZA 4LF4J 4FPIA 5A76A 3Q0AA 4W92B 4PXDA 4CZCA 4YQWA 2G13A 2AD9A 2BJ7A 2V6AA 5L1IA 4NZ7A 4J9OA 2ZZNA 3QFWA 2HYIB 2W7PA 4NA3A 3KLGB 3AJDA 2R7WA 2BANB 2UXDF 3O1LA 4F04B 3OR2B 4IOBA 2NXCA 1AFIA 3DRSA 5IC4B 3R2CJ 1FWPA 2KTQA 5T14A 4C11A 2P8IA 4LMZA 2V94A 2MDAA 3NBPB 1ZTTA 1V9OA 2CQ1A 4NASA 4DFKA 4J9MA 2BANA 1PG5B 2J76E 4CLKA 4WE1B 2JLEA 3OR2A 3N6MA 3NY0A 2KRBA 4OYMA 3OBIA 3C3LA 2UUAJ 3WIVA 4Z37A 4ECTA 1OPZA 5M2PA 4X4VA 3NBPA 3PW0A 3MFIA 2Y9HA 4DWIA 4LF7J 5AT1B 1V3RA 1Y00A 4C9DA 2D9PA 3OUYB 1EP4B 2GO9A 2CDQA 1FFWB 2NZ4A 3T1HF 4Q8FA 2QLWA 3X1LB 4ICLB 4FXWA 1KVJA 2FHJD 4X84A 1YJ9S 2FY1A 2LU1A 4ELVA 2SXLA 4RJVA 3SYZA 4IUFA 2IYGA 2W2PP 3BO3A 3OUYA 1EP4A 2XZDB 4OZLA 1S9FA 2V8PA 4H54A 1N52B 4A48A 4UOCA 2J6UA 4ICLA 4DFMA 3L09A 4ED3A 1VMBA 4BHQA 4KHPJ 2MQPA 2M88A 2JFDA 5HP1B 4O3OA 1TVRB 2QJ3A 1VLYA 3PJWA 1Q79A 1ZYQA 4Y2AA 1HD1A 3U27A 2ZH8A 5J2QB 2YVSA 1YIJS 3G2XA 2CRLA 1OMSA 3R6LB 4P2XA 4DSFA 3RJMB 2DO0A 4JV0A 5HP1A 1TVRA 2QL5B 4OZ0A 2Z8QA 5HK4A 1YJ7A 4DFPA 4YB1P 3IBWA 1A6LA 5J2QA 2DHXA 4URSA 4X4PA 2PD1A 2R7VA 1NXIA 4JB8B 3CEDA 5KFXA 4ETZA 2AJQA 5M2RA 3L7OA 2MZ1A 3ZZPA 5AJ3F 5HVGA 4O3PA 1WTBA 3B4DA 2KYZA 3FSIA 4CO3A 1Q8KA 2AU0A 1IKWB 3U1NA 2XC9A 1F5AA 1RQ0A 2KG0A 2QLJB 2KN4A 2AX1A 2BOPA 2XEXA 5K8PA 3VVTA 2GJIA 1HW8A 4DPXA 2IVYA 4HHHA 3G8SA 5IOLA 1QSLA 5EX0A 1IKWA 1JMTA 1U6FA 3IWXA 3C46A 1D8YA 4KH1B 4ZJOA 4GO7X 4C3KA 2Q43A 4JI7F 2YWFA 1XC9A 5KFCA 1N32F 2PFFB 4DX5A 3WHIA 3THTA 2K3IA 3GTYX 1HNZJ 2ZJRQ 3H2UB 3R1HA 2QL7B 2Q3PA 1T95A 1DFDA 1RSCA 4QYZK 1RTIA 5CAAA 5KT6A 5HMXA 1S10A 2DHHA 4KGZB 1DQ9A 1O0PA 3Q8VA 3TO8A 2IVMA 4ZLNA 5AXNA 2X51A 2WK4A 2H54B 5J2NB 1YGYA 4NZ6A 4DJBA 3BSOA 1Q1KA 4UY8T 3ET6A 3KLEB 1SQFA 5CCMA 3FSXA 2GFFA 3TVZA 3PJ9A 2BJ1A 2G9OA 1KONA 1YBUA 5M2UA 3VAKA 4JP8A 3D5MA 3GIKA 2DHAA 5GAHU 4P73A 1UW4A 4MH8A 1DQAA 2D3OR 3J81U 2VQEJ 3HP6A 2C22A 2C2OB 3VAFA 3KLEA 4CYUB 1VQOS 4OX9F 2CVEA 5BYRA 2IRUA 5KT7A 1ZZFA 2JLFA 2V2KA 3CJ0A 2OMLA 3IWLA 3IGNA 1VGYA 4ZJQA 2BA9A 5FD1A 4V19X 2H1YA 1B3TA 3G86A 4DR1J 5A6PA 3LGMA 3OFGA 2AT1B 4M5KA 4CYUA 4GKKF 3KLFB 4ED0A 2DGOA 1FX4A 3O44A 3OXFA 2CPEA 3OTEA 1YRTA 1PBUA 2RILA 3POTB 2ASLA 1CJUB 1NK4A 2H4WB 2R7OA 5GMEA 3CJ8A 3UDEA 2WONA 1VQ4S 2W4PA 2EFPA 1BQMA 5J2MB 1S6QB 1NHUA 5F0UA 4B3TF 3KLFA 4IRCA 3RZAA 2FLOA 1HFEL 1AUSL 1TAUA 2L9WA 1WORA 1CJUA 3K8WA 1JIHA 3NOCA 3K0JA 2AMCB 5J1EB 5HJYA 5CYJA 1C0UB 2F4FA 4ECXA 3T5KA 3CJSA 3FCHA 1S6PB 3BDEA 2NZCA 4O44B 5J2MA 2ZH5A 1S6QA 4CH0S 3W9JA 3E3XA 3PVXA 5LJ3Y 3TX0A 3OV7A 2DCLA 2OELA 2AGPA 1UVLA 3W7BA 3RBDA 1KHWA 2MKKA 3D2WA 1Z2ZA 1C0UA 4EO6A 2DNYA 2YQ3A 4OV6A 1FRJA 1RT3B 2HZCA 2Z4PA 1S6PA 3O6QA 3UCUP 4O44A 2GVDB 3ZFVA 3HXMA 3TQ1A 5H9EK 2M70A 1X9MA 1U1NA 2HNZB 5A8KB 3D28A 2GNKA 3BH7B 1T3NA 2XO7A 1RT3A 1FDNA 2N7CA 3KLHB 4RNHA 2GVDA 1ACMB 1RAGB 2KXHA 1HWJA 3QJJA 2HRYA 3I9V9 5LM7E 5A8KA 4DL7A 3DCAA 2VPZB 3R8YA 1REGX 1YZ6A 3KHLA 1FX2A 4F7VA 3GV5B 2ZHOA 5KFVA 4G3IA 2WTFA 2CUYA 4J91A 4ZVUB 3PACA 2RQCA 3K2YA 4YY3F 1N36F 1I5OB 1RT1B 4GRSA 4M5DA 2HEKA 2RJZA 1NB2A 1UJ5A 4LBIA 3HFZB 1ZPVA 2XI2A 4J9NA 5C2CA 3B6BA 3VGSA 3TZYA 3PYGA 1SUQB 2PMHA 1JNRB 1X5OA 1XMOF 2HBQB 2OPSB 1FJGJ 3WDOA 5LSRA 1T03B 5KG6A 1RT1A 2FJAB 4OFZA 3RBZA 2KYXA 1Y11A 4HTJA 1UP1A 3PW5A 2RRNA 5I3PA 2MSSA 5DO2A 1UW9A 4OIXA 2L9NA 3HZEA 4ZPBA 5A2QY 4LSZB 3T5HA 1VJWA 2CJ9A 4QW8A 1FXDA 1KBRA 2IM1A 2OPSA 2E7VA 3R5AA 1T03A 2DGVA 2R2RA 4JYAF 1HHSA 3AQPA 3MM6B 2J7UA 2OSQA 3BGLA 2NSCA 4LREA 2EC2A 1JLBB 3I31A 2ILZA 2VH7A 2XULA 1VI7A 4D3HA 1TL4A 1J5EJ 4KIAA 3R5GA 3Q8QB 3GU0A 2ZH6A 2EKNA 2E1MC 5DDQC 4HI1A 2HHUA 3MM6A 2KT3A 4I7FA 3HHLB 2DNOA 3AD8C 1JLBA 1HPZB 3A12A 1YJWS 2VBZA 1RP5A 1T94A 1X4BA 4OMFG 5JUMA 3UI3A 3NGKA 2JVRA 4YDDB 1HNIB 3SCLE 4OI4A 5B7WA 3CSKA 4LRBA 2O67A 2MLYA 2NPFA 2M4MA 3OVAA 2AX0A 3R9LA 3LP1B 3HHLA 3P8BB 3C14B 4CO2A 2IDEA 2HZAA 2UXBF 5BJRA 2F4VF 1HPZA 3NS5A 1IKYB 4CM0A 2HKEA 4QU6A 1P27B 2BE9B 4A8WA 1HNIA 1EB0A 2VC1A 4ZVFA 5E3CA 3BKUA 3M9NB 1WHVA 3OHBA 3GYXB 2YPYA 4GMKA 1NNDA 3DU5A 4J9KA 1IM6A 3LP1A 4QIVA 2ZM6F 3C14A 1IKYA 4C0HA 3QGHA 4A8FA 4B9MA 2RS2A 1IBKF 4RW8B 3C6UB 3QFHA 1T05B 1YJTA 2JLGA 1YI2S 2E44A 4LIWA 1XJWB 5DM6Q 3Q23A 4B02A 1AXQA 1O51A 4DV3F 3N01A 4LF1A 1UVNA 3US5A 4E8UA 2P9EA 4RW8A 4QW9A 4FYYB 1X0PA 5C2GA 3N4WA 1T05A 2RHSB 2YWEA 4LF5F 4MYTA 3CMAS 3G82B 2YTCA 1RWXB 2JEIA 4U67Q 1UA0A 1FEHA 3MXHP 2E9ZA 1F3FA 3R97A 2PFDA 4DV7J 4MKVA 4I6AA 4ZN3A 4LRDA 4K8RA 3A13A 3V81B 1JNZB 4RUBA 2CG8A 3G82A 3CGIA 4ED1A 3B54A 2GVZB 3ZTQA 3HVTB 4B9NA 2IVFB 1C1BB 3AJ2A 3UN5A 3V6JA 2O1PA 1NUEA 4KFBB 4JOUA 1JLCB 2R2SA 3LTOA 3J7ZT 3V81A 4ZPAA 2FQQB 2CQIA 3TUZC 1WG5A 2VG7B 2GVZA 3HVTA 2H51B 4ZVRB 1C1BA 3GR1A 5CD4H 1U7LA 2ZBRA 3N9UC 1R89A 2CNKB 5EGYA 5D4OA 5H9FJ 4UZBA 2L41A 1RWNB 3HVAA 5GAEI 2VG7A 1N88A 3QIDA 3M6XA 3PR5B 1G6BA 2OPQB 3VALA 3FBBA 1KLMB 4FF2A 3D1QA 1SB6A 3QMQA 5KFAA 2BACA 3GJQB 2P5VA 3LPEA 5B0GA 3PHEA 5AXKA 4HKQA 2EI5A 4WJBA 4U7CA 4P7VA 1NBEB 1NRKA 2EK1A 4LUBA 2OPQA 1P9QC 4DSIA 5HAOA 4F36A 2J7KA 4B17A 1KLMA 4LF6J 2CADA 1XMQF 3ZZ0A 4DQPA 4RO0A 4X65J 4C0BA 3RGIA 3CE8A 4RL1A 5AXLA 4Q7AA 2FY8A 1SIZA 1K1SA 3ENVA 3W2VB 5D4LA 3DYAB 4LF8F 1NH7A 3H4BA 2RQ4A 1YJVA 4P7TA 3L3CA 2R7TA 2VOPA 2OSRA 1HWKA 3RR8A 4MTPA 3BB5A 3NNAA 1TZ0A 1KDNA 2JFKA 3LO3A 3W2VA 3DYAA 1QUPA 3QRQA 4PABA 1KSPA 2V5HG 4YR3A 4A8YA 2CPYA 2DKOB 1ICEB 3M4XA 1M1KT 3LW5C 4KRWA 3V2UC 2OTJS 2FYXA 4S0MA 3HPOA 4LT6A 4RR5A 3GB0A 3UFCX 2C2RA 5KFBA 4NLTA 1GAOA 3C15A 2KM8B 2CQGA 2B7BB 4OZ5A 1HNWJ 2OPRB 4DR2J 2DJWA 1U1OA 2DEJA 1J2VA 2V63A 4BCAA 4HT5A 1VRUB 2RKIB 1NJZA 3BGFA 4A8KA 5FIIA 3PFOA 2BVZA 2XWXA 4Z7YA 2BABA 3N79A 2WAQD 3KMSA 2R42A 1RHMB 2OPRA 2KFYA 4DFJA 1X5SA 3PRBA 3EDRB 2OKQA 4X4SA 3OSPA 4DMZA 4JI1F 4A8QA 3TW0A 1OO0B 2K2PA 1UVIA 1LWXA 4FXDA 3R7SB 1H3DA 3MPDA 3QGGA 1U09A 4YR2A 2CG4A 1YRUA 5D0GA 3SMZA 4W4MA 3CC2S 1RACB 1ZPWX 2J9DA 4QWCA 1RJJA 2LQBA 4A8XA 1DZ5A 4DV2F 1N33J 4CH1A 2VFUA 4B9VA 2MQ8A 1NO8A 4USIA 1DRZA 1ZBTA 4DCOB 1E6VB 4FZVA 2IM2A 1P6TA 4DL3A 1SCJB 4F0KA 2R4FA 2DNMA 3JYTB 4ZPWR 1FFGB 4F0MA 2YX7A 4K4SA 4NYZA 3WZ0A 1NPPA 3QWPA 1S7IA 5KFGA 3IM8A 1M5OC 5L1LA 3LANA 1HD0A 3SXLA 2OMOA 3GONA 1FE4A 4ECYA 4ECRA 2X1BA 2ZBIA 4LQ9A 3P3DA 1Y5IB 5DQIA 4BWJA 4J9PA 2MY8A 1EHWA 5FLXY 2I38A 3B78A 1D8ZA 2N4DA 2W2NP 4OHVA 3EUNA 1M0SA 5LXRA 2M2BA 2FJDB 4GVBB 4P2SA 1R43A 3ZC4A 1SJRA 2XB2D 2I6WA 2AQ4A 3M8QA 2JEGA 4U6PA 4F25A 1S76D 4HLBA 1Y9OA 2XLIA 4H4KA 2XYGB 1NK5A 4JI0F 4ATNA 1QSSA 2XYHB 4FXVA 1OQ3A 2RT3A 2VONA 3HSGA 4GVBA 3K5NA 4OI0A 2EFQA 4EYIB 4YB6A 1UFKA 1R0AB 4Y6IA 3MAAB 1CJKB 5CD4A 3T5JA 2E1RA 1WHYA 1Y10A 1WG4A 2XMUA 5B0CA 2QC3A 4Y34A 1WF0A 5KFPA 2HW3A 2IM3A 1Q4RA 3FBEA 3VAHA 2CKWA 1P8GA 2C3PA 4DUYJ 4EYHB 3OW2R 1ZM4A 1RCOB 1R0AA 2FVQA 3FQLA 1RTJA 3MAAA 4R8UB 2AJFE 1CJKA 5IC6B 2GAHC 3IR7B 2CQBA 2OI2A 1RAIB 4LSLB 3DLBA 1OSCA 4YHHF 3PYDA 2V34A 4J9QA 1FO1A 1RWOB 2UU9F 2HBYB 3UPFA 1SQGA 1L3TA 2HHQA 3W9HA 4R8UA 1BWEA 1WKKA 2CQDA 4GKJF 3UCZP 4RBVA 4LSLA 3M2VB 1URRA 4U7UD 1G1XA 3OXLA 3TI0A 2O01C 3I5AA 2EWHA 1UEVA 3PTWA 4DR7J 3M8RA 5C25B 5K9FA 4AQYF 2RDJA 2J6TA 2D7SA 3BQ1A 2HIYA 5KT4A 4IYQA 3VV2B 1FI4A 3DU6A 3M2VA 3C2PA 2MPUA 3CF5Q 3FEYB 4JV2A 3THPA 1RDRA 4B9TA 4LF4F 5E3QA 3U7JA 3BYRA 2QG9B 3RBXA 2G2YA 3OR1B 1GX6A 1VQ6S 1FRMA 3OJSA 3OL8A 5ETNA 4DV6J 1LKZA 3JAMY 2EXUA 5HI7A 3HDSA 2MXYA 1RT4B 3O2IA 2GQQA 3RUBL 4K4VA 4QOTA 5H9FK 2GIQA 2QGFB 4TXSA 3KJFB 3HVWA 3AXMA 2ZH2A 5HMWA 1RKIA 3OR1A 3OQ2A 2YQ0A 2MJUA 1N34J 3JTNA 3G87A 4BDPA 1N54B 2AYEA 2PA8D 2QEXS 5IT9Y 5FLXU 4J7CA 2CQ3A 2ACYA 3UN2A 1FD8A 1RT4A 4ZHRB 3GP9A 4KJIA 3T9NA 4PWUA 4F3OA 4DS4A 2RRAA 3WC0A 3UDVA 3K58A 3MR7A 3CD0A 3AA9A 2AGQA 3QZ7A 4LFCJ 2XZWA 5L1JA 5IV4A 2UUAF 3FZBA 3EGZA 3IN5A 4F4XA 4I1TA 4ZHRA 5E41A 1VHFA 5F8JA 2IAJB 4ZMMA 2X3GA 1RHJB 4LF7F 2UUWA 4MJKA 2VB6A 2JX2A 4KT0C 3AA8A 3HKZD 4USUA 3CJRA 1PO6A 1VQMS 3IXQA 5HVFA 3OVBA 2WSFC 2VJUA 2ZDPA 3EXCX 2VOOA 4LFAJ 5EN1A 1KVIA 2DYAA 1TKZB 2RDIA 2N82B 2IAJA 1XTZA 2RVJA 4ED7A 2MQMA 1IJFB 4CLWA 1Q7YT 2XS7A 4UT4A 3PYEA 3QT5A 3IRXB 2LYVA 2FJBB 4KHPF 3KJVB 1TKZA 1NU4A 2Z2MA 2ATCB 2BRKA 2FVRA 1AROP 2R9LA 4ZLJA 4PZVA 2BYCA 5KG2A 3LUYA 4CO1A 5L38A 1HBNB 4ECWA 1FT8A 2HK2A 2G2OA 2XM3A 1WHXA 2VC0A 1V5VA 2ASJA 4K2JA 2AEMA 3KJVA 4TLQA 4WFNQ 2B8PA 4IOCQ 1VRQC 4LF9J 4PEOA 1NEEA 4N47A 2MSTA 4KV8B 3LWMA 2IRYA 1NK0A 1L3SA 1HL6A 2RIJA 4IG3B 1HBNA 2V8VA 1U48A 4DPOA 4OI1A 2BJ3A 5BYSA 4AL6A 2CQ0A 1QLNA 3MPYA 1RT6B 3RTVA 2XMJA 1H2UX 4KV8A 1AB8A 4WYLA 2B9EA 4B9LA 4IG3A 1QY7A 3CNQP 1S97A 2K8GA 2XSFA 3VAGA 2ZWPA 2WOMB 4ECUA 2Y1JA 2HSEB 1JXEA 4DZ6A 3GFYA 1RT6A 1ULRA 2FC8A 1U45A 4AL5A 2ZNYA 3TUJC 3RB4A 2LQ8A 1L5UA 2COLA 3TWZA 3JSYA 3OXGA 2CIMA 2WOMA 3IRWP 3FCWA 4NCAA 3P5TL 2B4PA 2WVEA 1EX8A 3RG6A 2ASDA 1XWLA 2H5IB 3LAMA 3EMTA 3IP0A 1WD6A 1X5PA 2QE5A 2DNPA 3GIJA 3HMJG 4V19J 1HIYA 3GJSB 1HNZF 1HYSB 2W7OA 1GMWD 5IT9U 2NXJA 3KK1B 2PE8A 3D1OA 1S0OA 2XQCA 1VC6A 4N7TA 5KT2A 4DV4F 3VGVA 3H2LA 4OYWA 3BPDA 3I5BA 2JHEA 3ZXWA 5GAEU 2HQIA 4E98A 2CZVC 4KGMA 1HYSA 1Y7PA 1JQGA 4I6WA 3H2VE 3KK1A 4JI8J 2DEIA 2HHPA 1KEKA 1RWMB 3GSIA 3GIIA 3ZTOA 4KO0B 4IFVB 3ELHA 3KHHA 4RLEA 2CPIA 3IO1A 4EZ9A 2XGPA 5HANA 3CIZA 4WIQA 1RAAB 2VZ9A 2EG1A 4JI3J 5A0YA 2VQEF 3K17A 5GMKa 1F3VA 4KO0A 1FRXA 1WC5A 3M9OB 4IFVA 1NSPA 3QO9A 1ZAXA 5AE1A 1VQ5S 1NK9A 3I32A 3D3BJ 1FDAA 4M5IA 3JTOA 4Q45A 2A6OA 3MUMP 1ZS6A 4DR1F 3BN7A 2ZH4A 3BGRB 1VQSA 2B5JB 2CQ2A 4O3NA 4J9LA 3BR9A 3MECB 5D3GB 2HHHJ 2Z56B 2GJ2A 4USJC 3CB4A 1RT2A 5KG1A 4K4UA 3BGRA 2W24A 2B5JA 3GSDA 4MKYA 2AF6A 1DURA 3MECA 2HRUA 5D4PA 1IBLJ 4I68A 3GZ7A 4KR0B 1KOHA 5KFSA 1HBMB 3BQ2A 1U2FA 2A18A 4CLYA 2CAJA 2RF2B 2D3ZA 2MZRA 1JLFB 3IBCB 1WC1A 4NCGB 1YLXA 3ZZYA 5HL7Q 1H7WA 1JKHB 4URGA 3QIPB 1SKUB 3D0IE 1RKJA 1AYEA 1HBMA 2V8HA 3VAJA 1RU2A 3DRXA 4P9SA 4ECSA 4RNOA 4DQQA 2BKOA 3HF5A 4NCGA 4M1KA 3CMQA 4DPYA 2KO1A 3IR6B 2BE2B 3DOKA 5DGAA 1JKHA 2RDDA 4CLFA 1L3UA 4HL9A 2F9JA 1LWEB 1U24A 3BO2A 4MK9A 1QSYA 3EZ5A 3S01A 1IBMJ 3MUVP 2KG1A 3K5PA 4C0OC 2MLXA 1ROFA 3H40A 2G0IA 3K57A 4C8NA 4DCPB 2BE2A 3GYGA 1R8CA 4UQGA 3H90A 2DXEA 5DGBA 1RLDA 4CWBA 2R8KA 5GMDA 2F8HA 2QSFA 1LWEA 4PG5A 2OEJA 2I8EA 1HNXJ 2D41A 3DRYA 3H5UA 4OX7A 1AFJA 4LFBJ 3D67A 3OTOJ 5EWEA 4PPZA 2KH9A 1NK7A 4X64J 2DPJA 1V6HA 4PWDB 2ZC4A 4MFBB 4M5LA 4NMLA 2E66A 4OYOA 1LW2B 3HHEA 1U8SA 1XR5A 2G4BA 4AUKA 3DMJB 1YX2A 4PYAA 5C24B 1UZDA 3BPSP 2DRDA 1T3OA 1GTHA 1TUWA 1IM4A 4PWDA 4MFBA 5KFHA 4KKOB 1O8BA 1RT5A 4IKAA 4DL0C 4MK7A 4JBCA 1WKJA 3M32B 3QGPA 3JSMB 5EWGA 3DMJA 2ALZA 1TUGB 5C24A 2KU7A 2EBEA 5HO4A 4C98A 2ZUGA 1FNOA 3F56A 1JJCB 2HK3A 1KN6A 4KKOA 3H42A 3V6KA 3MR5A 2YKMB 2BR0A 2XMMA 3G6YA 4MYUA 5EX3A 3M32A 3T1AA 2JSXA 3JSMA 1J5EF 4URQU 4DL2A 1Q81T 2CPDA 3UE2A 3LA0A 1OJ4A 2BEFA 3OPKA 3RB0A 3QLHA 2QA2A 3AY0A 4D3GA 2VQFF 2ZC3A 1LNQA 4P72A 4RW9A 1RAJA 2EFOA 3AH6A 3HFKA 1D09B 1HHQA 2OH2A 2FVPA 2VD3A 3G6XA 1RK8A 4MIWA 1OIAA 4Y2MA 4PRFA 3T1YF 2QTWA 1VK8A 3MMAB 1TL5A 3TA2A 3FMWA 4QWDA 1F2GA 3HVRA 1FXRA 3CCZA 1UWBB 2VHGA 1JJ4A 4JI6J 3MD1A 2JNJA 2DNLA 2RUGA 4O3QA 1K0TA 3IG1B 3ILJA 4NEZA 4ANEA 5IT4A 1U1MA 4RW6B 3MMAA 4C48A 5DG7A 5DJBA 3D6FB 3E01B 1T8EA 3ZNUA 5KFOA 1N5VA 4IO1A 1Q8BA 3KG1A 2F7VA 2HLTA 4WIIA 1T9WA 5AXMA 2AJ1A 1X4GA 2V2VA 3VZHA 3D0GE 4QR1A 1GEHA 3IG1A 2AZ3A 3KLIB 4CLPA 1HI0P 4RW6A 3TUPA 1IN0A 3H8YA 3TP2A 3TEGA 2CQPA 2KT2A 4CTAB 1MU2B 1D9FA 3E01A 2C2MB 2W2OP 3FQKA 1WNEA 3JQMA 2MYFA 1KFDA 3RBEA 2N3OA 4ZVQB 1NH8A 1FTRA 2HHVA 4K7QA 4XTTA 3MURP 2IJNA 1IBCB 2H5JB 3M8WA 3KLIA 2OUGA 2VPXB 3MUTP 2XMVA 1MU2A 3Q24A 2LFVA 1TK0A 3B82A 4DI6A 2A6MA 2F1FA 1FK9B 4KH0B 2GAGC 1GH8A 4WFZA 2DNNA 2IMOA 2XMTA 4U9RA 3F73A 4RUHA 4EI2A 5HMYA 2F8EX 2KZMA 2ZKUA 1FK9A 3Q89A 3GCXP 2M52A 1RUSA 2JOQA 2RU3A 2AGOA 4R5PA 2CA9A 3CO0P 1WKLA 2WRMA 2X7IA 1RADB 2LVWA 2VV5A 3M30B 2O3DA 1QM9A 1BY9A 2E5LJ 4IRKA 5HROA 1U47A 2IBOA 3I0SA 4X62F 4Q8EA 3D1HA 1A9NB 4RUCA 2I0XA 3H4DA 3M30A 1YK9A 2ZFHA 1S7HA 2UVWA 2L3MA 3EWGA 3SIPB 3G8QA 4WU3A 3IMQJ 2J5AA 1FJEB 3SFGA 4DU8A 2VG5B 2AHOB 3FBFA 1NDCA 1YTYA 3DOMB 3HJFA 3QSIA 1WUUA 1LWCA 5L9XA 4K2XA 1PGZA 5E3AA 4ANCA 1TL3A 1DHMA 4OI6A 4ID8A 4XDDA 4LF6F 4TKTA 4RX6A 3EGNA 4X65F 3DHXA 1VQYA 3DOMA 2F65A 4ZVPB 4RKUC 1VQPS 1EIYB 3MPWA 4DPUA 5KFZA 3PFEA 1PYSB 4ITSA 3DXSX 3O3LA 3H59A 4MAKA 1B7FA 3FMBA 4OYIA 3TZZA 4B3OA 1REVB 2R8JA 2H4YB 1VJQA 3NOGA 3KNAA 5KFLA 4IO9Q 4CH7A 5L8RC 1D1UA 4DLGA 1RYSA 3DGPB 2M8DB 2ASYA 3GV8B 2YPZA 2ADBA 1ZAWA 4Y0FA 1B70B 2OPPB 1UZHA 4YEAA 2G0CA 1REVA 1UVJA 2CNNB 3FCVA 1LW0B 3LAKA 2DRBA 5JVHQ 1C0TB 4OJHA 1VCTA 3H20A 2AEFA 3W60A 4P2MA 4F2RA 4F4KA 2NQPA 4USHA 4HH0A 2OPPA 1IWAA 3JSRA 1KC8T 2ROGA 1H6KX 4TLRA 1MWZA 5ETRA 1HBUB 4DSJA 4DR2F 2PDAA 3WIUA 4RZRA 1N0UA 1S1TA 1X4AA 2FC9A 2J9EA 3HSZA 4ID5B 1F0XA 2VF3A 3SQGB 1DAXA 4C97A 2V68A 5J2PB 1TP7A 2GZOA 4DG1B 3W3SA 4OYPA 1VHIA 2UVUA 2GIRA 4UZCA 4MKBA 1Q0NA 3FVYA 1UFLA 4CNZA 4YMEA 5KFQA 1KNZA 5G0RB 3SQGA 1S1WB 4X2BA 1U8WA 2VDHA 4XDCA 5J2PA 3FEXB 3UO0A 4UOGA 4WXWA 4DG1A 1FD2A 4ILRA 3NL0A 1ELOA 2A1BA 3EE3A 4NLWA 4NXNF 4AXIA 1ZAVA 3QT6A 4IOAQ 4ZPDA 1FJCA 1UJ6A 4OJGA 1FHTA 5G0RA 1S1WA 3SCIE 1PJ7A 2MTLA 1WEXA 1TMMA 3CPWR 1Q86T 2HWIA 2V8DA 2KVIA 4YFUA 4KPCA 1N33F 2CWKA 1EKRA 1WACA 3G96A 4EBCA 2HIQA 2GS8A 5I4MA 4TU7A 4I2QA 2JH3A 2YNFA 2XMAA 4WXOA 4F4YA 2RMLA 3RAXA 2AIRB 1WELA 4ZCKA 1WF1A 4QYRA 4Z7CA 1FCAA 2BRLA 4ELUA 4L76A 4NI2B 3JTPA 4WFAQ 2M3DA 3J80U 2A3JA 2IRXA 2ALYB 2PA3A 4UQTA 3W63A 3DRSB 3UDLA 1CS4B 1PKUA 1X4CA 4C11B 3T3FA 1ITPA 5B0DA 1WC6A 2MZSA 4J37A 2W25A 2HVEA 4KGKA 4NI2A 1CJTB 2B4OA 3DOLA 1YSJA 4Y3CA 3NEKA 1IVZA 3KKFA 3OTCA 1FDBA 2PI4A 3MCSA 4OLPA 4FF1A 1CS4A 2YKOA 2M9KA 2AKWB 2ZBQA 5LMUJ 2DNZA 2BM1A 1ZM2A 5LMNJ 2W2QP 4A4JA 4LR9A 3CW2C 2C3OA 3TVKA 1KQKA 1CJTA 2R2UA 2BJ9A 1JXVA 5KFIA 4DUTA 5THWA 4DR4J 3UR3C 4P2FA 3CCRS 4NA1A 5A8RB 4P10A 1XR6A 4USWA 4PXBA 1CLFA 5DETA 4TN2A 3CJ4A 5D4NA 2I9SA 1PCAA 4KTQA 2HG4A 4G1QB 1IR1A 2BQ3A 1TQLA 4ELTA 1HI1A 2EW9A 1RU1A 2PIIA 5A8RA 2OAUA 4H4OB 2ZHAA 4DUYF 2NXUA 3HLUA 1WOOA 4LQ3A 3C66A 1T9TA 2RH3A 2HWHA 3NNCA 1LXJA 4G1QA 3M1VB 4AL7A 1X4FA 4H4OA 4DDFA 1PYTA 2LDYA 2NCKL 5HSPA 2DNHA 1SC1B 2V2ZA 4GC6A 3DM2A 4CLZA 3M1VA 3HK2A 3MAHA 2MZQA 2NUHA 3PJXA 4DN0A 2DR7A 1S6OA 4DR7F 2E5GA 2N3LA 3R5JB 3KOAA 5KT3A 1TAQA 3IWNC 3T6JA 3OL6A 3CD5A 1N36J 1XNQJ 3C16A 3AHPA 4RNFA 3T6BA 2ZZTA 1CBKA 2N7YA 1H74A 4Y65A 4YN3B 5I42B 2RU9A 1VK3A 2MQNA 4FYWB 1SJ3P 1BE4A 1X4EA 1B0TA 3EM1A 3I96A 5J1PA 4DV6F 2O66A 4Y2IA 1FKPB 1M5SA 8RUCA 1QAJA 1SC4B 2ZOFA 5B0FA 2Y1RI 5I42A 2WVDA 2JWNA 3EVWA 5B0AA 2VL1A 4CT9A 3WX4A 1XQIA 2ZJPQ 1N34F 3D0HE 1XMBA 1H98A 4OHWA 1X60A 3TAMB 3MF5A 1B7YB 3M7VA 4WFBQ 1FKPA 1UCNA 4QIWD 2E5IA 5BR8J 4ILMA 4K4YA 3U1MA 4NX9A 1RTIB 1HW9A 3L9ZA 1TL7B 4Z2XA 2IJRA 3AB4B 1JLAB 4A8MP 4LFCF 2MEWA 3TAMA 4QIEA 3FZ2A 1WOSA 3EVOA 3NCQA 1YVFA 3ET6B 1RAEB 1TL7A 5IQ6A 4RNMA 1JLAA 3W65A 1VC5A 2FLLA 3HT3A 4XK8C 1LFPA 4I2PB 3V4MA 4O4GB 1S12A 4LFAF 1CEZA 2CJAA 3L95X 2F4VJ 3PNIA 1RZMA 3CCWA 3BJYA 1TTHB 3DLHA 2Z58B 4P6QA 2JVOA 3Q8PB 1TFWA 1X31C 1HWUA 4N8NA 3NG8A 4LRCA 1UVKA 1WSRA 5KG3A 1FFSB 3KDOA 4I2PA 4UUXA 2WVFA 4O4GA 2IYIA 4WFYA 2HRTA 3GG0A 2IMWP 1RABB 3E8OA 5K5MA 4FVMA 1ZA2B 3DLGB 2BJ8A 3MCMA 4F0HA 2UVVA 1Y4ZB 2LXFA 4RUAA 2WONB 1I6JA 4EUVA 2B4UA 4DV1J 1T0TV 1BQMB 2QA4S 4DLEA 2OLWA 1JJHA 1GMWA 4DEZA 5KFDA 1FVSA 4LF9F 2Y0SD 1Y3KA 3SFUA 1NAQA 2V8GA 3DLGA 3TRGA 4CI0B 4RWXA 4LF5J 2CPHA 1N5QA 1FKOB 2HS0A 1WC0A 1P1TA 1U6ZA 1OPIA 2BKNA 5GAGI 3A8EA 1GTEA 1UL3A 4C8YA 1S1VB 1U2RA 3V4IA 1DTTA 2HVHA 2DXFA 1VIXA 3PRVA 1TV6B 2HVZA 3JXOA 3AODA 1FKOA 2QMXA 1KP6A 3ILOA 1TKTA 1LFWA 2ZH1A 1S1VA 3HD2A 1VBYA 1TV6A 1NSQA 1PIEA 4FNHA 2I1RA 3SZ2A 1YWXA 1NK6A 4NLQA 1RA7A 3OVSA 3MTKA 2MGZB 2P6TA 3BGOP 2J7WA 1U1QA 2PEHA 4IH6A 1JXLA 4DPTA 2HGNA 3A3PB 2RD5C 4HYKA 3SSRA 5KTQA 1G4CA 3DDNA 2DIVA 1CSJA 2MGZA 2W7AA 1RWKB 4M5DB 4K4WA 5IWAJ 4JI8F 3Q8UA 1QAYA 3M9MB 2NLWA 2D74B 2ZJQQ 1S0MA 2BQUA 2R7UA 2C2EA 4HR2A 4ZIVA 4J90A 3ZZZA 1ZH5A 2HAIA 1I3OB 2DHGA 2DIUA 5IM0B 1U02A 4B08A 2IY5B 2DNQA 3OLAA 2MJNA 4CRJA 2VBXA 2IHR1 4JI3F 3RW6A 1U1RA 1W2IA 2ZHBA 4EU0A 3VZIA 3QRRA 4AD6A 2X1AA 3D54A 3CUNA 4OI2A 2EBGA 3BEGB 4OQJA 4LF8J 5IM0A 2R7QA 1LV5A 4TVAB 2BJEA 4NRUA 4N41A 1OY9A 3FDSA 3Q83A 1OY8A 4ZPCA 5A8WB 4I0WA 1HQEB 1P1LA 3CCLS 1DJ0A 1HQUB 5EWFA 3ADAC 4KC5A 1J5OB 2KRRA 4CIOA 2HHHF 2LECA 3FJ2A 2J0QD 4QQBA 2CZ9A 5JVGQ 5A8WA 4DQIA 4RW7B 1HQEA 3RB6A 2IA6A 5E7OB 4BBYA 1KQFB 1HQUA 4I7FB 3V5RA 2F9DA 3ENWA 3HCXA 2GJFA 4QWBA 9RUBA 1J5OA 4U8YA 2I2YA 1MROB 3P6YC 4E2FB 1X9SA 4DX6A 1G2EA 3HHLC 3VGTA 1IBLF 4O23A 5DM7Q 1TU0B 4DV5J 3OFFA 3J7AN 3NWGA 4RW7A 3LGNA 3I55S 1CJVA 3TJAA 5K8OA 2B9WA 3HM9A 1QUVA 2CPJA 4C2MA 3J7Z5 4DF8A 1MROA 4DQSA 3ISNC 2HQDA 4B3MJ 1SL1A 4KYZA 4C8MA 3CDBA 3OFEA 2IIHA 1NKBA 1AZSB 1Y3JA 5C7PA 1DY3A 1EJ7L 1SPBP 1DLOA 4Y2KA 1XN9A 2U1AA 2OHDA 2YBVA 2XS5A 1HNVA 1QAXA 3CJ5A 2FHOB 4IDKB 4Q44A 4IR9A 5DQGA 1ZTWA 4KY3A 1BGXT 3WX8A 1VQ8S 1AZSA 4F02A 1MNEA 1IBMF 5ETKA 4HHUA 3VAIA 4F4WA 1DQ8A 2E5JA 2KI2A 2GGPB 2DCUB 3RU0A 1RCXB 4IDKA 1NJXA 7FD1A 4ZA1A 3L4BC 1APSA 3K59A 4YP3A 1QDUB 2YNHB 1HNXF 5EHHA 4MIBA 2EK6A 4WP3A 4WU2A 1Q8IA 2KHCA 3PY8A 4LFBF 3OTOF 4PG8A 2GGPA 1LK5A 2XCPA 2XS2A 4ED5A 1KQGB 2GHVC 3HFVA 3TR5A 3MMBB 2VODA 1IUJA 1DARA 1KOOA 4X64F 2YNHA 2UXCJ 3LP0B 2LEAA 1PJ5A 2H3EB 3TAQA 4ZCLA 1UKUA 2MQLA 2Y8YA 4M5JA 4F67A 2VIHA 4FPRA 3UVJB 4QPXA 4NL5A 3MMBA 2MQQA 4EZ6A 2V69A 2V2QA 4K50A 2CDRB 3LP0A 4P75A 4UOFA 5D6GA 2OTLS 3W64A 4MKAA 5E33A 3NCPA 3A1YG 3LGHA 2MKCA 4DQRA 3UVJA 1UMJA 4FS2A 1RAHB 1QTNB 1RAFB 2W8LA 2W1BA 4WF9Q 4RU2A 3EVMA 3QATA 1C4AA 5F8MA 4K0KJ 4ZKAA 4L72B 2YKNB 2DGQA 3H5SA 1HLWA 5A2QU 2Z2YB 3NGSA 3N28A 5E0OA 3CDWA 5J1NA 4NLYA 5CYQB 1FWLA 1BUXA 4DR6J 1SH0A 2J8AA 4G1IA 2PN6A 3PZPA 4WYWA 3A3OB 1S1UA 4RNNA 1F5CA 2R8IA 4K5SA 4LJMA 1NJWA 2ZWOA 4WFXA 2YKNA 4FYXB 1ZA1B 5F0WA 3M2RB 3IAM9 1RXOB 1T7PA 4OJ1A 1SBRA 1PAUB 4I4BA 5CYQA 1K0VA 4RWWA 3TA0A 2QLBB 2MHEA 2PO4A 5D0HA 1UWAA 2R7XA 3KHRA 2FGCA 3M2RA 1RAOA 4LBPA 3AT1B 4NZ0A 3AOAA 4ZOSA 1R6YA 4JI6F 1X8DA 1YITS 1RT7B 4YHHJ 3KG0A 4DN9A 2YKQA 1GT8A 2M8HA 4DL4A 4CLTA 3A8IA 1O5JA 1K44A 2XLKA 1PC4A 2HPUA 4IQMA 4C7QA 1FNXH 3PW2A 3GFHA 3PXGa 2MKHA 1RT7A 1QE1B 3NNHA 5KFJA 4X66J 2HNDB 2AJ4A 2FDNA 1N0VC 1R0BG 3ISZA 3ZO7A 3BDPA 2E7WA 3U02A 2BM0A 3EGVA 4ZVGA 3PIOQ 3EYZA 3MWBA 1QE1A 3PW4A 3UWTA 1K9MT 1Z2LA 2HNDA 5F8IA 2FJWA 5CA5A 1WI6A 2BW2A 2QMUB 3C15B 3LOUA 4OYXA 2Q66A 1S4EA 3HKWA 1WJ9A 4X4QA 4NLDA 2KM8C 1KR4A 4QBUA 2JEFA 3O8WA 4L75A 2KB2A 2W9BA 4K5RA 4Q2MA 3AJ1A 8ATCB 3QQCD 2CQCA 2Y3YA 3OSNA 2WBRA 5ETTA 2DHSA 2GC8A 5ETOA 5DRKA 4QWEA 1VC0A 4PG6A 5K20B 3TZXA 4F4ZA 1YDLA 2D9OA 4PUOB 1YG0A 4RU9A 3PYFA 2WCXA 1PSDA 3KLGA 2GMHA 1PAEX 4Y00A 3NXZA 3NAHA 2E5LF 3OFHA 4MK8A 1SC3B 3MMCB 3PIPQ 4ECQA 4PUOA 2XO6A 1K8AT 2CJKA 1WDTA 2EEYA 2D3UA 2VFVA 4WE1A 9ATCB 1IJEB 3MMCA 5B08A 5LT5A 3J81Y 1VQLS 1YZ7A 4NA2A 1FWKA 2GO8A 2VFRA 2C3UA 1X4DA 1NZAA 4I56A 2WW8A 5KFYA 1FXLA 3ZZOA 1Q95G 4JV1A 5DLGA 2MKSA 1WDDA 3NGDA 2YXLA 1YBAA 3MZIA 3BZQA 4V1Ak 4I69A 4O0NA 3P96A 3SV4A 1OYEA 4JI5J 3FKBA 4Q43A 3TOQA 3KK3B 2QO3A 3NLCA 2AEJA 4PXCA 1SC6A 4ZPTR 3CJTA 5ETQA 1T9YA 2QFIA 4C6AA 2B7CB 5K8NA 3R1LA 5KFWA 2IDLA 4CLUA 3R6GB 3G6VA 1YQHA 1I94J 1F2HA 3FRYA 3EGWB 3BBCA 2CNLB 2AYBA 4H4KC 3KK3A 2YY3A 4JV5J 4NLVA 2W9CB 4QZVB 3VQTA 2V50A 4B9SA 1SQEA 5MAOA 3DRRB 3M8QB 2DO4A 4FBTA 3N5BA 5BYQA 3QWUA 1Z1ZA 2XMWA 1FESA 5IQQA 2G2ZA 2KZZA 3DLJA 4WKYA
chains in the Genus database with same CATH topology
4A8WA 5E5NA 2LVWA 1HNIA 2VUGA 2VV5A 3M30B 5L9NA 1X5TA 3MM5B 2O3DA 2VC1A 1QM9A 1BY9A 4ZVFA 2W9CA 5E3CA 3MD3A 1Q16B 3EZUA 3NP5A 3M9NB 1WHVA 3OHBA 3GYXB 3PW7A 4ES3A 3CD7A 4GMKA 1KQSR 4EBEA 4IRKA 2UVRA 4L6V3 1FVQA 1NNDA 3DRRA 3EX7B 3DU5A 4J9KA 3LP1A 4QIVA 5HROA 2ZM6F 5CZVA 1U47A 1UEUA 5GAGU 2W9AA 4NXMF 4TU9A 4ES1A 2WB1D 2IBOA 3I0SA 1W2BR 4X62F 1IKYA 2YWHA 4BC9A 4C0HA 4Q8EA 3D1HA 3QGHA 2VA3A 4A8FA 2LXIA 4B9MA 1A9NB 2RS2A 5F8GA 4RUCA 2I0XA 3H4DA 1IBKF 3M30A 3BSCA 1K73T 4RW8B 3C6UB 4X4UA 2ZBCA 3MM5A 2JRSA 1T05B 1YJTA 2CVIA 2ZFHA 1S7HA 2APOA 3HHKA 2DGXA 2UVWA 2JJ4D 2XLJA 1RTJB 2CQHA 2L3MA 3ICLA 2JLGA 3GQCA 1YI2S 2E44A 2X1GA 4LIWA 3G8QA 5DM6Q 3MFHA 4B02A 3Q23A 4WU3A 5IT0A 2J5AA 1AXQA 1O51A 4DV3F 1FJEB 3SFGA 2VG5B 4B3SF 3N01A 3G6ES 3GR0A 4DL5A 2RRBA 3US5A 1FKAF 1UVNA 3PKMA 4E8UA 3PEHA 5D8HB 2P9EA 1HI8A 1YTYA 2VKRA 5SUHA 3HJFA 1LWCA 5L9XA 4RW8A 4NYPA 4HEA9 4QW9A 2FGOA 1X0PA 3DHWC 4K2XA 1PGZA 2MB0B 1KHVA 3N4WA 5E3AA 1JX4A 3DRPB 1T05A 4N5SA 5JJBA 1TL3A 1DHMA 2J6TA 4OI6A 4ID8A 4XDDA 4LF6F 4CNYA 3MI7X 4TKTA 5H1SV 4O3RA 1KLNA 4RX6A 3EGNA 2FB0A 2YWEA 4UUWA 4X65F 4MYTA 2FLPA 4LF5F 5D3GA 3CMAS 3THVA 2YTCA 4C8ZA 1TUVA 3DHXA 1N5TA 2JEIA 4YOEA 4U67Q 1VQYA 1UA0A 1FEHA 3KHGA 3PEJA 4G6VB 3DOMA 4RKUC 1VQPS 3MXHP 3MPWA 4FNIA 2E9ZA 5KFZA 3DXBA 1G3OA 4K4ZA 3DRPA 3PFEA 2OFGX 5CHCB 2A2DA 1SH3A 4I6AA 4ITSA 3J7YU 4QCLA 3IGVA 2B3TB 2B0GA 3DXSX 3O3LA 2HS3A 4PXEA 2MMYA 3V6DB 3H59A 3V81B 4MAKA 1UFWA 1JNZB 3EPGA 4QIFA 3TUIC 3OHAA 4RBTA 1B7FA 3UDCA 1N4LA 3FMBA 1C1CB 5AE3A 2Q6BA 3CGIA 3SSQA 4ED1A 4C8LA 1FEEA 1XK8A 3KYLA 4TNOA 5CYMB 4MMOA 4B3OA 3HVTB 4B9NA 1REVB 2QYCA 2FJXA 2R8JA 3GFZA 2A10A 2IVFB 3V6HA 1C1BB 3AJ2A 3V6JA 3KNAA 2RF2A 5KFRA 5KFLA 1JLFA 4IO9Q 4CH7A 2O1PA 4NLRA 4F8RA 3E51A 3QJLA 4KFBB 1QJHA 4JOUA 1JLCB 5L8RC 1D1UA 2R2SA 4DLGA 3V6DA 1BD6A 3J7ZT 3V81A 2AW0A 3C8YA 3ITHB 3MM7B 1RYSA 4ZPAA 2M8DB 2ASYA 3GV8B 1TK5A 3QIPA 2ADBA 1C1CA 1ZAWA 2CQIA 4Y0FA 1VS3A 3TUZC 1U26A 2DNKA 6FDRA 4J9RA 2NR0A 3SV3A 2ZOGA 2OPPB 5J2NA 1QAIA 1WG5A 2VG7B 2XCAA 5CYMA 2J0SD 3HVTA 4YEAA 2KKHA 5F3TA 5IZHA 2G0CA 1REVA 2E29A 1HBOB 1UVJA 2NYIA 3PO5A 1C1BA 2ZD1B 3GR1A 5CD4H 1U7LA 3N9UC 1LW0B 3LAKA 2DRBA 4BWMA 2FLNA 5GADU 1HHTP 1HWIA 3QGIA 1R89A 5JVHQ 1C0TB 4A8SA 4OJHA 5EGYA 5EDWA 5D4OA 3ITHA 5H9FJ 3MM7A 5B0BA 3H20A 4PQAA 1XEZA 4ERDA 3DFEA 2L41A 1YHQS 1LQ9A 2YWKA 3HVAA 3OLBA 5GAEI 4F2RA 4F4KA 2NQPA 4USHA 1BLUA 2OPPA 4HH0A 2VG7A 4E0DA 1N88A 1EETB 3JSRA 3M6XA 3QIDA 3PR5B 1G6BA 2O5DA 2OPQB 1KC8T 1FERA 3VALA 2ROGA 4EWTA 1H6KX 4TLRA 1HBOA 1RTHB 4K59A 1MWZA 2ZD1A 1KLMB 1HBUB 4DSJA 4FF2A 2DH9A 1R8HA 1SB6A 3D1QA 1FJ7A 3QMQA 4DR2F 1D3WA 2PDAA 5KFAA 4RZRA 3MTJA 4A46A 4OV1A 2BACA 1N0UA 2P5VA 1S1TA 5D77A 2PC6A 1X4AA 2FC9A 5B0GA 3MAQA 3BM7A 1MSWD 3PHEA 4EGLA 2J9EA 4KBIA 4ID5B 1F0XA 5AXKA 3SQGB 1RTDB 4HKQA 3IC1A 1DAXA 4C97A 3KTQA 2EI5A 4PR6A 5J2PB 4WJBA 4U7CA 4P7VA 1TP7A 2DR9A 1NRKA 2G1DA 2KJWA 2EK1A 1VRTB 4DG1B 1EETA 3W3SA 5KOWA 4LUBA 2OPQA 1P9QC 4LSNB 4DSIA 3S1TA 1RTHA 2J7KA 2UVUA 1AW0A 5LMUF 2GIRA 4B17A 1KLMA 3V4IB 2FVSA 5LMNF 1DTTB 1XMQF 4MKBA 3ZZ0A 4DQPA 3FVYA 1UFLA 4CNZA 4PPDA 1TFYA 2LQ5A 4YMEA 2FVCA 4C0BA 1U4BA 5CCLA 5KFQA 1KNZA 1RGVA 3B8HA 5G0RB 3CE8A 3POTA 3S7RA 2LCWA 1S1WB 3SQGA 1RTDA 3KFWX 4X2BA 2HWTA 3HHLD 5KFUA 4XDCA 5AXLA 4Q7AA 3QZ8A 5J2PA 3FEXB 4DR4F 2C42A 1SIZA 3CULA 4CQ1A 1VRTA 1K1SA 4WXWA 4DG1A 1FD2A 3VWSA 3ENVA 4LSNA 2XNQA 3W2VB 5D4LA 1TKTB 4ILRA 3NL0A 2RSQA 4G1PA 2JC0A 1ELOA 2A1BA 3DYAB 4NLWA 4LF8F 1NH7A 3GFXA 4AXIA 4NXNF 2B56A 1ZAVA 3CJ3A 3JB9k 3H4BA 4M95A 2CPZA 2IFXA 4IOAQ 3HZGA 1U1KA 2U2FA 1GXTA 2RQ4A 1YJVA 1LW2A 4ZPDA 1B64A 4P7TA 5KT5A 3L3CA 4ZLPA 2CJQA 2R7TA 1FJCA 2VOPA 5C42B 2OSRA 1HWKA 1M5HA 3PRDA 2E1CA 1UJ6A 2FIUA 4OJGA 4KQZA 5G0RA 4F26A 3RR8A 4IQXA 1FHTA 1S1WA 4Q2LA 3ISND 4MTPA 3BB5A 3SCIE 2EKYA 5J1EA 3NNAA 2GW8A 1S79A 1TZ0A 1WEXA 3CPWR 1Q86T 3BSNA 2JFKA 4ED6A 2HWIA 2V8DA 3LO3A 2KVIA 4YFUA 4OHZA 2DTJA 2VFSA 3W2VA 1N33F 2LEPA 3I5CA 2Q1LA 3DYAA 2EPIA 2J0WA 1GXUA 2DB1A 1QUPA 1WACA 1CQMA 3NAIA 1DBDA 2F8MA 1U1LA 1VFJA 4EO8A 1M5KC 4TQRA 3G96A 4EBCA 2HIQA 3IFEA 4O0IA 1KSPA 5I4MA 2V5HG 4YR3A 5C42A 4A8YA 5K14B 2W4DA 1A7GE 4TU7A 3GV7B 4I2QA 2JH3A 2YNFA 3PX0A 3TYTA 2CPYA 2ADCA 5T7LB 1S9GB 3UNGC 3M4XA 1M1KT 1IQZA 2HFOA 4WXOA 4GO5X 2RMLA 4F4YA 4C8OA 3RAXA 3LW5C 4KRWA 1WELA 4ZCKA 2ROPA 3ZZTA 3V2UC 3KK2B 3DLLQ 2OTJS 3DLEB 1WF1A 1Y0HA 4QYRA 4Y28C 1FCAA 2BRLA 4ELUA 2YWGA 4FP9A 3HPOA 3I56S 3DNCA 4LT6A 4FVCA 3AAWB 3JTPA 2HNYB 2YKMA 4WFAQ 4OL8A 3CC7S 2M3DA 1NJYA 4DSEA 2J0XA 3GB0A 4QPTA 2IC3B 4RW4B 2A3JA 2UUBF 5K14A 2IRXA 3UFCX 2C2RA 3CCJS 3AQOA 5KFBA 4NLTA 4XIUA 1GAOA 4LVNP 2PA3A 4UQTA 5B09A 4CT8A 2HNZA 3DRSB 3UDLA 3OL9A 2KM8B 2CQGA 2LQJA 5T7LA 1S9GA 2GQCA 2B6AB 3RAMA 4DS5A 2QRRA 1SL0A 4DSLA 1X4CA 2B7BB 4OZ5A 2BV3A 4C11B 2DGWA 3T3FA 2KFNA 4O4RA 1JLQB 1SV5B 2OPRB 3KK2A 5B0DA 4YUDA 3KLHA 2MZSA 2DJWA 3DLEA 2W25A 3JSBA 4J37A 2ZH7A 2CZ4A 1GX5A 1U1OA 1XNRF 2DR8A 4KGKA 2E7XA 3TVYA 3M2UB 5FDLB 2B4OA 2NSBA 3DOLA 1J2VA 1YSJA 4Y3CA 2HNYA 3HI9A 4BCAA 4HT5A 1VRUB 4RW4A 2IC3A 2CJBA 3KKFA 3OTCA 1FDBA 2PI4A 2ZZMA 2RKIB 1NJZA 3BGFA 4A8KA 2E1AA 5FIIA 3PFOA 3MCSA 4OLPA 1XNQF 2BVZA 2XWXA 1JWWA 2BABA 3N79A 4FF1A 2YKOA 2M9KA 2Z2LA 5DG9A 2WAQD 3KMSA 4KSEB 2B6AA 5GAHI 3LQVA 3VAMA 2DNZA 4F3QA 2GCFA 2BM1A 1JLQA 1SV5A 1ZM2A 2OPRA 4PKDB 1KFSA 2KFYA 4DFJA 1Q78A 4R0JA 4A4JA 1X5SA 3PRBA 3X3UA 2C3OA 2OKQA 4YDXA 4X4SA 3TVKA 1WG1A 1KQKA 4DMZA 3OSPA 3M2UA 5FDLA 2R2UA 4ZP9A 3NRBA 4JI1F 4NLPA 4A8QA 3TW0A 1FRIA 1OO0B 5KFIA 3CCUS 2K2PA 2XY6A 1NJIT 4K4VA 3UW1A 2C3MA 1UVIA 5THWA 4NRTA 3UR3C 3CCSS 1MMNA 2RS8A 3RRGA 3QPIA 4FXDA 2BUNA 4FBUA 3CCRS 1H3DA 2CPXA 3PX6A 4NA1A 3IS9B 3QGGA 1UWBA 1U09A 5A8RB 4KPYA 1XR6A 4YR2A 4JUZA 3HX9A 1Q53A 4PXBA 2CG4A 3NMRA 1CLFA 4OX8A 2J9DE 5DETA 1IXKA 4TN2A 1S49A 3CJ4A 5D4NA 2I9SA 1RWUA 3NCRA 1YRUA 3SMZA 4KTQA 4I67A 3KMQA 2GV1A 2HG4A 3DC2A 5KG5A 1KD1T 3CC2S 4NPOA 4YB7A 1ZPWX 5KFMA 1SUQA 5EUHA 5LSOA 1SL2A 2AYGA 4G1QB 2J9DA 4QWCA 3VQSA 3PV8A 1RJJA 2LQBA 1TQLA 2M7SA 2Y1IA 5A6WA 3H5YA 2BQ3A 1U6BA 4WZMA 4A8XA 3PM9A 1CC8A 2HMIB 4ELTA 1DZ5A 2OJ3A 4IRDA 4B3RF 1HI1A 1CG2A 3IS9A 2N4CA 2EW9A 4DV2F 5A8RA 2PIIA 2OAUA 4H4OB 2ZHAA 2KDOA 3S6EA 4CH1A 2VFUA 4DUYF 3C6TB 4B9VA 1NKCA 2NXUA 1SJ4P 3TX8A 3HLUA 1CQNA 2VPYB 1NO8A 3BF4A 4USIA 4LQ3A 3C66A 4EBDA 1SKWA 1DRZA 1ZBTA 1FRKA 1NHVA 3T9ZA 1B0PA 3EPIA 2RH3A 4OHXA 1W25A 5BR8F 1E6VB 2I5JB 4FZVA 2HWHA 2IM2A 3NNCA 2W8KA 1P6TA 4DL3A 1LXJA 4CTAA 1AUDA 4G1QA 2R4FA 2DNMA 3M1VB 2LKZA 4ZPWR 3JYTB 2X1FA 2IJFA 4AXJA 3M6UA 1FRHA 4AL7A 3Q8SB 3PDNA 2HMIA 4NLGA 2YX7A 4K4SA 4NYZA 4JI2F 1X4FA 4H4OA 4DDFA 3WZ0A 1K1QA 3QWPA 3H5XA 1JK9B 1R3NA 2LDYA 3C6TA 5KFGA 3CIMA 1UETA 1H7XA 1M5OC 3GG1A 3KG4A 5L1LA 3LANA 4IH7A 1HD0A 3SXLA 2C2DA 2DNHA 2OMOA 3M8PB 2ZH3A 4OI3A 3TNVA 7FDRA 2DGTA 4GC6A 1FE4A 3DM2A 1L3SA 2EVZA 2I5JA 3BN4A 4ECYA 1U49A 3FRZA 4ECRA 2X1BA 2ZBIA 4LQ9A 3M1VA 3P3DA 1Y5NB 1Y5IB 5DQIA 2QA4G 4OZ1A 4BWJA 4J9PA 1JJ2R 4DSKA 2MY8A 1DTQB 3HK2A 3QYYA 4NLUA 4I6YA 4AFFA 1DLOB 5FLXY 2XSJB 2QFJA 1M90T 3MAHA 3P49B 2MZQA 5ADZA 1HNVB 4CO5A