1SI9A

Boiling stable protein isolated from populus tremula
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
TRTPKLVKHTLLTRFKDEITREQIDNYINDYTNLLDLIPSMKSFNWGTDLGMESAELNRGYTHAFESTFESKSGLQEYLDSAALAAFAEGFLPTLSQRLVIDYFLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of the Thermostability of SP1, a Novel Plant (Populus tremula) Boiling Stable Protein.
pubmed doi rcsb
molecule tags Plant protein
molecule keywords stable protein 1
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1si9A00
2HLUA 3LGNA 1V3ZA 2ZDPA 2GA7A 1ULRA 3HHLC 5B08A 1TUVA 2OD6A 3KNGA 2KT2A 5B0FA 2AJ1A 2LDIA 1MWYA 2BUNA 1SQEA 2ASYA 3T9NA 3BGUA 2Q3PA 3BR8A 3FMBA 2XMTA 1X8DA 2HFNA 2XMJA 4A47A 3QMQA 1N5TA 3QGPA 4NL5A 3KG0A 2PD1A 2GO8A 5F0WA 4EFAC 2N4CA 1S6UA 2QLXA 1SB6A 1FVSA 2FTRA 2K7KA 2XMVA 3GZ7A 1TR0A 3CJKA 1TL5A 4OJHA 2QLWA 1Y3KA 2N7YA 2XMKA 3MZIA 2K1RA 3WDOA 1FVQA 1YRXA 2XMWA 3BM7A 1YJTA 3LGMA 3E8OA 3TNVA 4OJ3A 2XMUA 2G9OA 2XMMA 5B0CA 3BB5A 5B0BA 2OD4A 4ZOSA 1YJVA 2ROGA 3HDSA 2W4DA 4NPOA 4Y2IA 2OKQA 2OFHX 2BJEA 3DCAA 2CRLA 3FRYA 4QOTA 4Y2MA 5B0AA 1FE0A 5A6WA 1U7LA 2AJ0A 1CPZA 2FHMA 2GFFA 5K9FA 1APSA 2VV5A 2BBEA 2FIUA 1LQ9A 3I9ZA 5B09A 4YDXA 2HFOA 3KKFA 3LO3A 1Q8BA 4HL9A 1RJJA 2RMLA 1FESA 2IYGA 2ROPA 1W2IA 2KYZA 1N5SA 1XBWA 1FEEA 1KQKA 3DXSX 1X7VA 2W4PA 1FD8A 3BF4A 2KT3A 1OSDA 3UDCA 2LQBA 1GXUA 1YG0A 2OMOA 2RILA 1YJRA 3MCSA 4HI1A 2L3MA 1Q8LA 4F67A 3F44A 4A4JA 3BN7A 4DL0C 1K0VA 4FNHA 1FE4A 2IYIA 3HHLA 1AFIA 4A48A 3KG1A 5T7LB 1JK9B 2PGCA 5B0DA 1Q4RA 2N4DA 1TL4A 3FGVA 4OIXA 5A6PA 1N5VA 5KAKA 1AFJA 2ZDOA 1QUPA 2AP6A 5T7LA 1URRA 4A46A 2VH7A 2K7JA 3VTIA 4OJ1A 1OQ6A 3CJKB 1Q53A 2EW9A 2K2PA 3HX9A 4U9RA 1CC8A 1VQYA 2K1RB 2ROEA 2FB0A 1Y3JA 4DPOA 1KVIA 3BDEA 2GGPB 4Q2LA 4Y2KA 1CC7A 2HIQA 3K7RA 2BJDA 1KVJA 2QIFA 2QYCA 1P8GA 2AW0A 3HF5A 4FNIA 2BYCA 4DN9A 1Y9OA 4HH0A 2ACYA 1N5QA 1P6TA 2RSQA 2JDJA 4HI2A 2GGPA 2W4CA 4YEAA 1GXTA 5B0EA 2KKHA 5F0UA 3HFKA 5IXUA 3HHLD 1VQSA 2GV1A 3HHLB 2GCFA 5B0GA 1IUJA 1WD6A 1S6OA 2HQIA 3IWLA 1R6YA 4HH1A 2OP5A 1OQ3A 2OFGX 2RU9A 3IWXA 3TRGA 4ZA1A 1MWZA 2LQ9A 1TZ0A 1YJUA 1Y0HA 1JWWA 1OPZA 1AW0A 1X0PA 2IFXA 4OJGA 3TOQA 1SI9A 2LXFA 4Q2MA 2HLTA 2OAUA
chains in the Genus database with same CATH superfamily
4XK8C 3KFWX 2Y0SD 3GR1A 4LF8F 4YN3B 3THTA 4YHHJ 2JEJA 3KNGA 4LFCJ 3CW2C 3QO9A 3TZYA 1LWEB 4Q7AA 1T3OA 5F8MA 4B3MF 4DPTA 4G3IA 3HSGA 2HNDB 3I0SA 1DY3A 2BOAA 3NBPA 5ETSA 1X8DA 4ECYA 3MM5B 3DU5A 2UVVA 1HBOB 4R5PB 4NYPA 4KSEB 1RAAB 1RWXB 3CDEA 4NASA 2W8LA 1WC0A 1S6UA 1DRZA 4USTA 1FKPB 1TR0A 2L48A 2XGPA 1E6VA 1LEOA 1XJWB 1NCLA 2XMKA 2XZWA 4Y00A 3PEJA 3W65A 5KT4A 3QRRA 2GJ2A 3SFUA 2XC9A 4PUOB 2ZH7A 3RW6A 4DV2J 1A0OB 2CNNB 2LA4A 2B9YA 1N36F 2OPSA 4DPUA 4IR1A 2C3OA 2YNIA 3TUJC 2ROGA 5DZ6A 5EX0A 1LW2B 1R43A 5A8RA 1F0XA 4EU0A 4TQRA 1X5PA 3F73A 1XR7A 3DOKA 5EUHA 5DM6Q 2W9BB 3J81Y 3S8SA 1FXDA 3MI7X 2ZC3A 3MPDA 2F3JA 2J9EA 4TLRA 3PIOQ 1S6PA 3C16B 2DD8S 2Q6BA 4MT1A 3TEGA 4DSJA 1FT8A 2JLEA 1RTJA 1WDTA 2KVIA 3I9ZA 1WG4A 4PPZA 2BKPA 2CZ9A 1YRTA 1Q8BA 3KUGA 1HNWF 2IYGA 4LRCA 2YWGA 1OIAA 2BV3A 3LANA 1GMVA 3UFCX 1L3KA 4TN2A 2ZD1B 3IR5B 4F3MA 4M94A 2ZOGA 2V2VA 3CDAA 3DN9A 3DI6A 5D78A 3CJTA 2W9AA 2IM1A 4PG7A 2Y1LB 2HHQA 2FVQA 1HIYA 3OR1B 4LVNP 5G0RA 3TJ8A 1FK9A 1Z2ZA 2ILYA 2HK3A 1D9FA 2PI4A 3A3OB 4O4GA 5DG7A 2ZZMA 1G2EA 2BEFA 3BN7A 5HMXA 1FXLA 2WVFA 4K0KJ 4P75A 3OVSA 1R27B 3G6XA 3OW2R 2HQDA 4Q45A 3QZ7A 1M5VC 1AFIA 1EX8A 4F50A 2VICA 3W3SA 3AXMA 1GQEA 2VODA 1EETB 1TL4A 3FGVA 4F8RA 2XSJB 5A6PA 2DR6A 3TW0A 5L9NA 2ZDOA 4X4NA 1VK3A 2CJ9A 2DHXA 1S1VB 3KLFA 1ZZNA 4OI3A 4B3SJ 1XR6A 2NXEA 4CNYA 5FDLB 4YUDA 3BGOP 2VH7A 3VTIA 1HBNB 4ZPWR 2B8QA 3MM9B 2JH3A 5A0YA 3ZZZA 1S49A 4ZKAA 2R7VA 3H20A 4PYDA 5E41A 2B4VA 2LEPA 4C0BA 3V6JA 2XYGB 3NS5A 1MU2A 4ZPDA 3NEKA 4DR7F 1EQ0A 2IMWP 2MZRA 1JQGA 1NDLA 2C2MB 2E29A 5CABA 3M8RA 4F4XA 4UY8T 2JOQA 1KNZA 2X1FA 2WB4A 1HWJA 4HACA 4RPFA 4RW6A 2BM0A 3H42A 4GO7X 2HHUA 5E3AA 3C16A 3T1HJ 1S5ZA 1U0HA 3VAHA 1F5CA 1D3WA 4HTIA 4XDDA 2DY1A 1GXTA 4DSLA 4F04B 1SIZA 2DYAA 2XY5A 2EG2A 5CZXA 5KT7A 1YI2S 4OYWA 1N32J 3TARA 3Q8YA 1RAEB 4Y28C 3D6HB 5CQGA 4R8UA 3W64A 3QGGA 4O3NA 1J2VA 3MEDB 2WAQD 4DHVA 4TU8A 4HH1A 4MYUA 3CDWA 3DRPB 3GYGA 4CWBA 4CH7A 1MW7A 4UOFA 4OQJA 1UJ5A 1WELA 1Y0HA 2DNGA 2JNJA 2MSSA 2OI2A 1HHQA 2Z56B 4AT1B 4OI0A 4WFXA 1S6PB 2IFXA 2MKSA 3MMCA 4XPCA 3Q24A 5FIIA 2OAUA 5IWAJ 2HLUA 1GTHA 5K14A 3MURP 4C2MA 4QIVA 1S97A 3QRQA 4CO4A 2UUWA 3DLGB 3OD2A 5LOQA 1H0HB 3KJVA 1X9WA 2W7PA 4JV1A 4K4UA 2AMCB 2CQ2A 4ZVUB 5F9LA 4PEOA 1YJ9S 2RNEA 3V81B 3CCLS 3V6HA 5DRKA 1N5TA 3CJ8A 1FRJA 2GO8A 3TZWA 4ZPBA 1Y4ZB 3CO0P 1KTQA 3FRZA 3NS6A 1RWOB 2QZ8A 5F0WA 2K7KA 3BYPA 1SPBP 1HWUA 3FBBA 3KLVA 2C2OB 2MZTA 3CD7A 4FN5A 4EGLA 1LWCA 1SKWA 3W2VA 4RNNA 4KC5A 3W63A 2W9BA 2XMMA 3BB5A 3AB4B 5IT9Y 2DEJA 5B0BA 1Y10A 2BX6A 1RT3B 2MJNA 2W1BA 2VFTA 3OSPA 5IM0B 1JLAA 2DY9A 5BYQA 3OUYA 2IHR1 1M5PC 3FK4A 2AV5A 4Y2MA 3GE9A 2VA2A 1RHRB 1Q78A 3N01A 3DOKB 4QR1A 2G1DA 4EO6A 3IBFB 2CADA 3ETOA 1EQMA 4ZITA 1WEZA 2V4JB 2YNGB 4M5IA 4KH0B 3BKUA 1S9EA 1RU1A 5K5MA 1S7HA 3WHIA 5H9EK 3DHWC 1K0TA 3MMBA 4DSIA 3J7YI 2LECA 3QT6A 3BPSP 2DR9A 2RQ4A 4AD6A 4DUYF 5HANA 3LOUA 4KV8A 3QJLA 1F5AA 4PXBA 1GXUA 4LF4J 3C14B 1X60A 4WE1A 8RUCA 3X3UA 5C42A 1TKTA 3VQSA 4DPXA 5EWFA 3J80Y 4TU9A 2FHJA 3A12A 1WJ9A 1QJHA 4OZJA 5KG5A 1DQ9A 3AJ1A 3L4BC 5E3CA 3UE2A 4DN0A 2VG7A 2WVBA 3GCXP 3DM2B 2AIRB 1QDUB 4C8OA 4K4ZA 4HLBA 3KTQA 4LSLA 4ZK7M 1I6JA 2KM8C 4H4OA 1L3SA 3KHRA 3M6WA 4EZ6A 1B7FA 1UL3A 2CJQA 3K17A 4K4SA 4JV0A 5JUMA 2MGZB 4N76A 1S1TA 3D54A 3A3NB 3N9UC 4DFJA 4Y3CA 2CIMA 1URRA 4ZIWA 3UDVA 4DZ6A 2QT7A 2FJXA 4K50A 2KHDA 2WONA 2KFYA 1C0UA 5HL7Q 2K3IA 4FP9A 4Q2LA 2OEKA 2DJWA 4XAKA 2COLA 4QPXA 2Y9HA 3PZPA 3PIPQ 1JLEB 1ZAWA 2KZZA 4USJC 1PKUA 2ZHBA 4OYXA 4FNIA 1C2PA 1WG5A 2BYCA 4ZP6A 3R1HA 1FDDA 2VBZA 3FBFA 1RI7A 4M5JA 1LXNA 3ISNC 4ZVEA 1I3OB 2VFRA 4X84A 4QWDA 4F4KA 4RNMA 2J6TA 1S0NA 4KKOB 1PAEX 3CXCR 1IWGA 1PYSB 4RW8B 2VPYB 4Q0BA 1U25A 3GILA 2VPWB 4DV7J 2OIHA 4IRKA 2OTJS 1T9XA 4KE5A 1GTEA 1N34F 3N28A 2WW4A 1G3OA 1AT1B 2BJ8A 1PGZA 3K5PA 4O44B 1HNIB 2AJ2A 5F8HA 4DXLA 5F8IA 2BQUA 2DH8A 3TI0A 1TZ0A 3KUEA 3C14A 1ZM3A 4WE1B 3BO3A 1R0CB 3SEOA 2V2ZA 1BQNA 1M1GA 4IYQA 4NCGA 1JMTA 2OGUA 1F9FA 2IVYA 4WFBQ 2PO4A 2AGPA 1X4FA 5B08A 4Q8EA 1S1WB 1GK8A 4ICLA 1RT2A 3OTCA 1QAXA 3V6KA 3HHDA 3TANA 5K14B 3Q22A 1FX2A 5H1SV 5J2MA 3HXMA 3PX0A 2PMWA 2OSQA 2KFZA 1V5IB 3B4MA 1BGXT 1FRIA 1M0SA 5L39A 5KFUA 3VAKA 5FDLA 4Q43A 1TL5A 1ZA1B 2AEJA 5C24B 1GT8A 1Y3KA 1NUEA 3OQ2A 3C46A 4C98A 2G0CA 3BN4A 1L5UA 3KLEA 3H5YA 2DRDA 5F3TA 4DL7A 2GVZA 3HDSA 2KDOA 2ACMA 5HJXA 1GX5A 4Y2CA 3W2VB 2RF2A 3CC2S 4QBUA 3E01A 3RUBL 5F8JA 5KFYA 5KFMA 2P6TA 3HSJA 1YBUA 3FMWA 1XMOJ 4ZVPB 3JTOA 1PCAA 1S1TB 3IM8A 4KBIA 3OFEA 4LT6A 3T1AA 5GADI 4RKUC 2NPFA 2NUHA 3OL8A 4B9SA 2P2CB 1IR1A 1RT5B 3THPA 2C3PA 3P49B 1FDBA 3SV3A 2DNLA 1HMVB 1IBCB 1ZM2A 3NKYA 5HO4A 2ROPA 5J1NA 2IA6A 2J9DE 1MNEA 4PWWA 1XNQJ 1SJQA 3DXBA 4IRDA 3MEEA 2KG0A 1FEEA 1UVNA 1QM9A 3KLIB 2GZOA 4J9PA 1NK4A 1FJEB 3FFIB 1SJ4P 5GAHI 2HWIA 4MKYA 1IBMJ 1QD1A 3DDNA 4TNOA 4DV3F 4JI6F 4C8LA 1C4AA 2FD2A 2XYHB 3BGFA 1SH2A 3EZOA 3PHEA 1NNDA 1H7XA 3EPGA 3UD5A 4QU6A 1FFGB 2IAJB 2M88A 2WBMA 3RAMA 4CLTA 2Q66A 3L09A 5IS2A 3D28A 1BUXA 2IJFA 3BS9A 3ET6A 3OL6A 3CUNA 5IZHA 2QSWA 4I6YA 1C0UB 2XI2A 3QBCA 4QIEA 5C2GA 2B5JA 2RHQB 4EEYA 3UCUP 2FJVA 4PXCA 5B0DA 2MKJA 3FEXB 4WWSA 1LK7A 2MMYA 2FYXA 2J5AA 1T3NA 2F4VF 4OIXA 2AEFA 3HLUA 2XZDB 4B02A 3OTOJ 4DR2F 1H2VZ 4MJKA 2CPJA 2RD5C 4I68A 3RB3A 2ADCA 4LR9A 3GJRB 3R5AA 1A9NB 2CQ3A 2RRNA 1Q53A 1H2TZ 4AE5A 2V8VA 3M05A 4EZ9A 2GGPB 4KFBA 1RAJA 3UD3P 3UNYA 2CG4A 1JLBB 2FZCB 2AX0A 3QLHA 3JYTA 3UWTA 2CXEA 2CQ0A 2ZUAA 2I6WA 3KJNB 4YR2A 3OFGA 4EWTA 1M5OC 3LQVA 4A8MP 1KTVA 1MMDA 4PKDB 2XWXA 1U1KA 4CM2A 4R0JA 1JLEA 3NWGA 4NCBA 1U24A 2MHNA 4UF4A 4FDFA 1R7IA 2MY8A 2W4CA 3IAS9 2ATLA 1U1PA 1OYEA 3AD7C 4DR3F 5IT4A 2MQ8A 1TK0A 3HHLB 3SDEA 1S0VA 1PYTA 3Q0AA 2LXIA 1CS4B 5KG0A 4DQQA 1EHWA 1KP6A 3UCGA 2Y0BB 3FSIA 2MY7A 2HNZB 2RDIA 2RU9A 4ES2A 4U8YA 4J7CA 4USKA 2NQPA 4KYZA 2I5JA 1JIHA 1FERA 2CYYA 4ILMA 5IOLA 3GIIA 4K59A 2J7WA 4DX8H 5LMNJ 4LFBF 4WTYA 2R7UA 3QGHA 3FMBA 4DV1F 4F02A 2VC1A 4J5OA 2GA7A 5J2QA 1WHVA 3HCXA 2UVUA 1LWFB 2ZH2A 3FDSA 3M30B 1MWYA 2BA9A 3NWRA 4P2XA 2J6SA 2YBVA 2GX8A 2LEAA 5CYQA 3RGIA 5A8WB 2FGCA 2X1AA 2HFNA 3DRRB 2DBBA 1NSAA 5I3QA 4X62J 5LMUF 2QSFA 1U09A 4CDIA 1TKDA 2PD1A 1Y5NB 2B4UA 3G6YA 1HKAA 1X4DA 4KRWA 3CJQA 5HAOA 2MQOA 5A0YB 2G4BA 4BWMA 1U48A 1EAYC 3RB4A 4QU7A 3CPWR 1RK8A 3NP5A 4M5GA 1GMUA 1X5OA 3PG9A 4Y6IA 1LW0A 3E8OA 2IVMA 4ZVGA 2EFPA 1VBXA 3W7BA 1XERA 3PVXA 2XHWA 2D9OA 4CTAB 3CCMS 1Q82T 5HI7A 2ASJA 2E9RX 3M2RB 4PUOA 3G2XA 4DPYA 2OFHX 3OJUA 4JYAF 2WBRA 5AT1B 3ENQA 3KOAA 3JSMA 1I94F 1KLMA 5AE3A 2W2OP 1KONA 1T9WA 2MLXA 3M6XA 4ER8A 1WC1A 5K9FA 2JRSA 2YX1A 1K73T 4PQUB 2BBEA 1FWLA 4XTTA 1TK5A 3I0RB 1BY9A 1Q16B 2DNMA 3NOCA 4P9SA 4ANDA 4B9MA 1U0SA 4LSNB 4M8LA 5ETOA 2OPPA 3NY0A 4X62F 2EI5A 3B78A 3R5CA 2H3EB 4Q44A 4R8UB 2NUUG 3SCJE 2JFDA 4EBDA 2CUYA 4LRDA 5G0RB 3QYYA 1ZTTA 3ZZTA 4OYMA 1L3UA 4HACB 4RW6B 3AODA 2ZM6J 2UXCF 1S4EA 3G8SA 1UFWA 4ZVSB 1UA1A 3RR7A 1YG0A 1Y00A 2DR7A 5LXRA 1T7PA 4LFBJ 3PDNA 4DL4A 2YKNB 2HGMA 2IJNA 1R8BA 2DO0A 2I0XA 2XSFA 3AB2B 5F41A 3BSNA 2R8HA 1JLCA 3DLGA 4QWEA 3KJVB 2WSEC 1K8AT 1T94A 2GVZB 1DAXA 3UI3A 3EICA 2IYIA 3HHLA 1LW2A 4K2JA 3SDEB 4DCOB 4RUAA 1NJYA 1MU2B 2KJVA 2IDEA 1FXRA 1QSSA 2UU9J 1RTHA 4ECZA 2KZMA 4K4TA 1WKKA 2Z4PA 4NA1A 2BE9B 3AOCA 1O0PA 2F4FA 2HEKA 3OR1A 2IPOB 5T7LA 4TYBA 1WTBA 4C3LA 1NJIT 4I67A 3D1HA 4BHQA 1KLNA 4X4QA 2K7JA 4RUBA 2LU2A 4OJ1A 2BQ3A 3ET6B 1UW9A 3KLFB 4ZVRB 2RDJA 2R7OA 4AFFA 1RTDA 3ZZPA 2FB0A 2LVWA 3O3LA 4I6AA 2HMIA 1GX6A 1U1OA 1YBAA 3W8PA 3L7OA 1VI7A 4WCEQ 2IBKA 3DRSA 1V9OA 2HK2A 2WVEA 3EDRB 5DLGA 3VVTA 4RL1A 3K5MA 2APOA 3MMAA 1NPKA 3TX0A 1BQMB 3TAMA 5KOWA 4DN9A 4USVA 2R42A 2V8PA 4OHXA 3HK2A 1UZHA 4LF6J 1OJ4A 2JHEA 4DCPB 4F0KA 4B9TA 3I56S 5CYMA 3C6UB 4ID5B 2MXYA 3V4MA 4RJVA 1HBMB 2U2FA 3HJVA 3OTOF 3HHLD 2YX4A 4ECQA 3V6DA 4C8ZA 3MAAB 3CJ0A 3I32A 2DNRA 6AT1B 2EC0A 3N4WA 3I5CA 3CD0A 3SZ2A 2WHOA 2HQIA 4A8WA 2CWXA 1U49A 4QCLA 3FQLA 1R0AA 2F8HA 3FSYA 5AXKA 1ZYQA 4CNZA 4KIAA 5FJ4A 1EJ7L 2D41A 4NA3A 4ENOA 3CDBA 1RCOB 2HNZA 2AYMA 1SI9A 2W25A 5GADU 3BZQA 1K9MT 4JI6J 1IBMF 1CJVA 1NXIA 1CVJA 1IKXB 1ULRA 2HYIB 4NI2B 4IH6A 3VCDA 4DV5J 1VQ8S 1EKRA 1YX2A 2NS1B 2XG8A 1CJKB 2IIHA 2YWKA 3OXFA 1XNQF 1VQLS 3KLGB 3DFEA 3ELHA 4OZ5A 4PG4A 3HT3A 1HD1A 3S01A 2OELA 1U6BA 1TL1A 4P2MA 4EBCA 5CYQB 4DR4F 5IT0A 3BGRB 3KMQA 5HLFB 4CRJA 2XCPA 4A8QA 3VHQA 2QE5A 1S0MA 2R7SA 2SXLA 3SIPB 1NJXA 2DGUA 5D4PA 1YRXA 3WQPA 2HHTA 1RUSA 2J8AA 4HVZA 1IBLJ 1SUQA 2NPIA 1HA1A 1LWCB 2WB1D 2W4DA 1WORA 1PAUB 2QTWA 3L95X 2XQCA 1RA6A 3GJQB 4DR5F 1LXJA 2CQ4A 5GAGU 5ETKA 1U8SA 2P9EA 2YTCA 3JQKA 1WOOA 1RT4B 4QZVB 1N0VC 4QR2A 2XMAA 4ED6A 3RBEA 2HHXA 4NLTA 4X4TA 4DL3A 2FIUA 1H72C 4KV8B 1YJWS 3IR7B 4X4RA 1RHMB 3FBEA 4LF9F 4IG0A 3P8BB 2FLLA 2DNPA 1F3VA 1XMQF 3J7A1 1V3RA 1FESA 4B3RJ 2MKCA 4GKKF 2M3DA 1M5HA 1YDLA 1NSPA 1ZH5A 1KLMB 3CJSA 2NSBA 4QWBA 1SJ3P 2W4PA 1WUUA 4OYPA 5AXNA 3CJ3A 2QA2A 1VYAA 1DZ5A 2LKZA 2PA3A 2PDAA 2FVCA 3LWMA 1B64A 2IMOA 4DF4A 3NL0A 3MPUB 1JLGB 1S57A 5HN0A 4P7VA 3VZIA 1KFDA 1M1KT 1IKXA 4FNHA 2E1MC 2IRYA 1HQEA 4HHUA 4P2SA 3N6MA 5KFTA 3VAMA 3V6DB 1VQOS 1JKHB 2Z0GA 2R2RA 1HWIA 2VG5B 4L72B 1WHWA 4JB8B 4CT9A 1N34J 4D3HA 1HHTP 4M5MA 3DRXA 1FJGJ 1R0AB 3OHBA 4GMKA 1TK8A 4A8SA 3HVWA 4KGVB 4PQUA 4V1Ak 4C8KA 4CLZA 3FZBA 4RNHA 5EWEA 1RWPB 2C2RA 2I8EA 1WOPA 4DPOA 3ENWA 2M9KA 2O3DA 3CCTA 4ID5A 3R6LB 1EZZB 2R2SA 2OPSB 5HMWA 1KVJA 4TY8B 2L9DA 3ZTPA 5HROA 3EE3A 1XN9A 3JSMB 2MLYA 4W98A 2O01C 2HBZB 2LU1A 2ZZTA 3H98A 4HH0A 3W9IA 1P6TA 1OWXA 2FPHX 2R4FA 5SZTA 3KLHA 4EYIB 2ZBIA 3SMZA 1N52B 2CJYB 1EB0A 4X66J 4YQWA 3PX6A 3G4SS 1VQ7S 2DNZA 1FJ7A 4N77A 3K5LA 4PCQA 5F0UA 4QWCA 3GIJA 1HI0P 4CO5A 2BQRA 2HHHF 2CQGA 3R27A 3NNAA 4F25A 5D3GB 2UUAF 3IRXA 5K8PA 2AD9A 3QGIA 2Y3YA 2CDRB 3IFEA 2AGOA 2E5LJ 1R6YA 3MAQA 3A8IA 4LF5F 3GFYA 3K57A 4WFZA 2OFGX 4C8NA 3DGPB 1DTQA 1FHTA 1QAJA 1JWWA 1OPZA 3VAIA 1REVA 1JNRB 3M1VB 5IC6B 2JEIA 4IFVA 2EKNA 2LP4A 1CULA 3T6JA 3PRVA 4EK2A 3N5BA 4DUYJ 3CJ4A 1SKRA 3FJ2A 4ED5A 2E5JA 4NEZA 1YWXA 4ATNA 4R25A 2AJ1A 2LDIA 4ED4A 5L46A 2BUNA 2EK1A 2MKHA 2VU5A 2Q3PA 3OT9A 1E6YA 3I87A 3QGPA 3KG0A 3LAMA 4LF6F 2P6SA 2XY6A 2QL9B 4LSZB 2FTRA 5KFKA 4HEA9 3HKZD 1Q7YT 1VQ5S 4B9UA 2B6AB 1RISA 3OXLA 3W8GA 1S1WA 2CPZA 4ICLB 4MFBB 1TU0B 2UUCF 5E5NA 4DQPA 1OY6A 1HNZJ 3EPIA 5B0CA 4UTGA 4IG3A 4WXWA 3E3XA 3V4IB 3BEGB 1B0PA 3KDNA 1UPPA 2IM0A 2NSCA 2OD4A 4ZOSA 3DMJA 2GMHA 1RHJB 4RW9B 1RBOB 4QQBA 2FDNA 1WEXA 3GFZA 3EGVA 3AH6A 1HI1A 2WVDA 2GQ2A 1V5VA 2HGNA 2PN6A 4OHZA 1FE0A 2AJ0A 3Q86A 2CKWA 1BMQB 3VR1A 1F1BB 3PRDA 1WEYA 2BANA 3H90A 4HT7A 2UU9F 4DSFA 2HFOA 2M4MA 5CYJA 4Q0BB 2ZBQA 4ZVHA 1LWEA 1UJ6A 2NXCA 4DLGA 3L7PA 2MJUA 3PM9A 2ZH1A 1XBWA 3MM6B 2DNHA 3DDKA 5LJ5Y 2Y1IA 3KMSA 1QAYA 4U96A 2ZM6F 4MYTA 2UXCJ 4HTJA 3JSBA 4WFAQ 2V9WA 1JJ2R 5CHCB 1F2GA 3BH6B 4RLEA 3T1YF 3F44A 4DS4A 1L3VA 3NS7B 3M8ZA 5L9XA 1URNA 5C7PA 4LFAJ 1UCNA 5JVHQ 4X4SA 2YWHA 1JX4A 1RTZA 2Y8YA 3LF0A 5KG7A 2HQCA 3MR6A 1NLKL 2G2YA 3N6NA 1TL3B 2H4YB 3A1YG 5F8LA 2O5DA 3NLCA 3MD3A 3QLHB 4BS2A 4NZ7A 1PIEA 1X5SA 1N6QA 4ANEA 4KHRA 1PSDA 4C3MA 3Q23A 2ADBA 3O1LA 2VZ9A 3M4XA 2L9NA 3BR9A 5IT9U 3SSSA 4KHPF 2ZZNA 3BDEA 3FSXA 3GR0A 3FCVA 2PIIA 2MYFA 1IKWA 5AXMA 2DCLA 2Z2MA 3DNCA 4C11A 4KJIA 4RUHA 3OSNA 2XO7A 2VC0A 2YWFA 2FLNA 3I6PA 3MXHP 1YJ7A 4RU9A 2YNFA 2O66A 3R2CJ 2XHCA 1YZ6A 4OYBA 1YITS 3IGNA 1TFWA 4DMZA 5HP1A 3MECB 4OX9J 4NEYA 1RHKB 2GGPA 2GS8A 4KFBB 4LREA 1QE1A 2UZAA 3PW7A 2KH9A 3OR2B 3W5YA 1U45A 2B5JB 1QAIA 3R7BB 2YKQA 3JXOA 3F56A 3D6MB 1NSQA 2XLKA 1WD6A 2EC2A 3GFHA 2I2YA 2OEMA 3SQGB 2CJBA 3AJDA 2G13A 3D7SB 3DOLA 3OVBA 4NZ0A 4MK9A 3MEGA 4FPRA 4WK1A 3UDLA 2HHVA 5D15A 3H4DA 2XLIA 2FJBB 1V3ZA 3CC7S 3QT8A 2Z2LA 1YTYA 1N8RT 2KT2A 3ZTQA 2W2PP 2MKKA 1ZAVA 1ZPWX 4MIAA 3Q2SC 3VGSA 4K2XA 1H6KX 1K47A 2H9ZA 4ZN1A 1WSRA 1KWMA 2XMTA 4J9RA 3AOBA 1U1QA 2NXUA 1P9YA 2V8HA 3Q8PB 4X2BA 1IBKF 2JC1A 2LDYA 4JI5J 3MUTP 5I42A 2OSRA 2ASDA 3BKTA 1Q7LB 5J2QB 3TVZA 1TKTB 3D0GE 5A2QU 1RCXB 2B4PA 3K5OA 3ITHA 1UW4A 1WC3A 1RU2A 1DURA 3POTB 5J1EB 1XIQA 4DR1J 3MGJA 1YJVA 2ZHOA 3ONQA 5IFMA 2Q6CA 2J0SD 2H5JB 5HQ8A 4M1KA 3HO1A 1Y11A 4G1PA 2CNLB 3OV7A 1VRUB 2UVRA 2QMWA 2Y1RI 4OZNA 1LK5A 4E8UA 1HFEL 1IKYB 4P10A 2RKIB 4UQTA 2MTLA 4JI5F 4G65A 3OL9A 1HBUB 2IA0A 2F4VJ 4P2FA 2A0FB 1H98A 1RTIB 5E7OB 2QA4G 1RTDB 2MB0B 2CA9A 1DJ0A 2ILZA 4CLUA 2DCUB 4IDKA 3GMGA 1S10A 1AUDA 2QA1A 5BXIA 3GLJA 4ZPVR 2B43A 1QSYA 3RRGA 2DRBA 2VA3A 3DXSX 3B8HA 3CJ5A 1KC8T 3LP1B 2PMZD 2ZH8A 3BSOA 2C3YA 2QMUB 3CTRA 3NCRA 2R7XA 3QRPA 3JSRA 2KHCA 2M70A 5KFCA 1YJRA 4LSNA 3R7SB 5KFRA 1T03A 1C1CA 3RB6A 4NLRA 4F2RA 1R0BG 1VQ4S 2F5GA 1N88A 3GV7B 5CAAA 2UP1A 1VRQC 1N6QB 2KU7A 3C6TB 3EZ5A 1ITPA 1LKZA 2UV8G 5IV3A 3SXLA 3PJWA 3GP9A 4CLLA 4YR3A 3ZO7A 5DLFA 1VHFA 4P74A 4UZBA 3FCHA 1XMOF 2BR0A 4DV4F 4DUTA 4X64J 2VBYA 4B3OA 2R7WA 2LQ5A 2KO1A 1CC8A 5KFHA 1M5SA 1Y3JA 3PYEA 4RW4A 1N56A 1CC7A 4GRSA 2ZE2B 5I4MA 2HKEA 3S6EA 1KOHA 4F4WA 1UEKA 5KT5A 2QL5B 1AYEA 4KHPJ 1FA0A 4UUWA 3C3LA 1RGVA 1DLOB 3J7AN 3TVKA 5MLCV 4Y34A 4N8OA 3QT5A 3SCLE 5KFEA 4N47A 4X4VA 4NOHA 3R7NB 1X4GA 5GAEU 2CJAA 4B3MJ 4L3NA 3DLEB 3NGSA 1WF0A 2VG7B 3H4BA 1RZMA 2OUGA 1VLYA 4WYWA 3C15A 1HQUB 5KG3A 2CQIA 2V2QA 4OI1A 2LEBA 2MZQA 2FVSA 5AE2A 1MSWD 1B4SA 2FQQB 2QO3A 2DEIA 3EM1A 4LFAF 3GB0A 2J0WA 3RW7A 3AXKA 1BLUA 2ALZA 3FCWA 4AYBD 5CD4H 1SKUB 2F8MA 4TQSA 2F1FA 2RQMA 3T1YJ 2C3UA 2XS2A 3N0VA 4QYRA 3ZC4A 5HMZA 2DHAA 1F60B 3HHKA 1PO6A 2VQFJ 3ZNJ1 3UR3C 1TUVA 2MQMA 3UDEA 3HKWA 2IY5B 1SQEA 1T9VA 2ASYA 4L3KA 4OZ0A 4O3OA 4N56A 4FS2A 3Q8QB 3O5TB 4OHYA 2GW8A 4NL5A 4F4ZA 3IO1A 5A2QY 4P52A 2NR0A 3I0SB 2N4CA 4WP9A 5DZ7A 1SB6A 4Z7CA 5DS7A 5HMYA 1U47A 1U2CA 1TL7B 3IP0A 5AXLA 1O5JA 1YZ7A 2QLWA 1WHXA 1SH0A 1TV6A 4C0HA 1HL6A 3GTYX 1YJTA 5LT5A 4IOBA 5HLFA 2XMUA 3ZZ0A 4DR6F 4J37A 4CH0S 1EP4A 4NLYA 2GHVC 3I4PA 4Q8FA 2M5YA 4K5SA 4OYZA 4ELTA 3ZTOA 2VG5A 4C8YA 4X4OA 4LBPA 2YKOA 3PO4A 1HNZF 1U1NA 2MZSA 2ZD1A 2CPEA 3H2VE 1WC6A 3QPIA 1SV5B 5I3PA 4AXIA 1FJCA 2AYEA 1U7LA 2MPUA 4OYIA 3T6BA 3QWPA 4CYUB 4IDKB 2J9CA 1SJRA 1CJVB 1DARA 3MPYA 5DQHA 3L9ZA 4OI4A 3WIUA 2VOPA 3QQCD 4WP3A 3V5RA 3U1MA 2W2QP 4ZPAA 4YDDB 4ZCMA 2XEXA 1F5BA 3V2UC 1FDAA 3OTEA 2KN4A 4OI2A 2YKMB 2UUTA 4WIIA 4ZDNA 1HQ2A 5L8RC 1VRUA 5M2PA 4UQGA 4DWIA 1U4BA 3AJ2A 3FVYA 2ZWPA 2H65B 4LF4F 2VKZG 4I7FB 3UPFA 4NLUA 1SCJB 2RILA 1TP7A 1FTCA 4K4YA 1XTZA 5D0HA 5EX3A 2JEFA 1M90T 1T02A 1R8PA 4LMZA 2E1RA 2X1GA 3C66A 4JOUA 2L41A 2IAJA 3IBWA 3IG1A 4LF5J 3M9MB 3GPAA 1HQUA 2UUAJ 4QIWD 1Q4RA 2R7TA 4F26A 2LLZA 3GU0A 3HMJG 4NLDA 3CGIA 5G4DA 5KFXA 2OO4A 3UNGC 4F0MA 3Q89A 4F4AA 3AD8C 4X66F 1ZAXA 1RT6A 4A46A 2J7UA 5HVGA 1SH3A 3HX9A 1IN0A 4MFBA 5IQ6A 1U2FA 4WU2A 1YSJA 2YQ1A 3RAQA 2R7QA 3BV8A 4DLEA 4MAKA 5JMNA 4FBUA 1FO1A 1BE4A 3J7YU 1FWPA 3NAIA 2JEGA 3NMRA 2D1CA 1RYSA 1Q1KA 2CPDA 3PYDA 5LSOA 2JLFA 4C97A 3E01B 3NNHA 3N5FA 4UOGA 3T41A 4H4MA 3HZEA 1V3SA 4TU7A 1ICEB 1NK0A 4UY85 2PSZA 1D1UA 4FYYB 2KTQA 2FHJD 4J9VA 3QT7A 3O6QA 3ENAA 2MKYA 3IXQA 3PNIA 1U1RA 1BWEA 2VASA 2HRTA 3EZUA 3M1VA 5IXUA 1N5YA 2E7XA 3MTJA 3SCIE 2BW2A 1VS3A 2AGQA 1H74A 1T05A 1DTQB 2ZOMA 3OJSA 3CD6S 3MM6A 5IWAF 4OMFG 3EVWA 2KFNA 1KEKA 3ISND 3DC2A 4LUBA 4O23A 4ZJOA 3HULA 2JVOA 4WIQA 3TUIC 3HD1A 5IM0A 4W90B 2VKRA 4IH7A 4J91A 2EPIA 3AT1B 2D3UA 3CVKA 1LWXA 3DRRA 4QIFA 4WP8A 1W7WA 5D77A 1SC3B 2B7CB 2RVJA 2HURA 1TKXA 2DHSA 1UFKA 1FNMA 1RHUB 2DXFA 3I0RA 1SC4B 5KFAA 1NK8A 1VOMA 1REVB 2AF6A 3NNCA 1TUGB 3EYZA 3BQ2A 2PE8A 4AL6A 4ZCKA 2AYGA 2OHDA 2ZEJA 2KG1A 5SUHA 1RT7B 3O2IA 3DGPA 3PXGa 1EP4B 5M2RA 1TL3A 2CQHA 4OHVA 2B51A 2DGVA 5U47A 4FVMA 3G6ES 1XMQJ 3T1HF 3AOAA 4B3RF 4HDGA 3G9CA 2VFVA 1UWBA 2A3JA 2H4WB 5M2UA 1YGYA 2Q79A 3CJKA 4YB7A 3T19A 5KFJA 1JNZB 1NK6A 3IRWP 2HS4A 2V0NA 3MM9A 3MOJB 5T14A 1XNRF 2V34A 4RNOA 4ZN3A 3AHPA 1U8WA 4RBTA 1R8HA 4NLVA 4DR5J 3M6UA 2CNOB 3PFOA 1PC4A 3NGUA 4IO1A 4R0EA 3RJMB 4XPEA 1S76D 4QYZJ 2WOMA 2VB6A 3ZZYA 5I3UA 3DRPA 1I51B 4PYAA 2NYHA 2VPZB 3R6GB 2YKMA 2CRLA 5HROB 1M1HA 2GJIA 4X64F 4F4YA 4QOTA 3PTWA 1Q86T 1FKAF 4J9QA 3CT9A 1D8ZA 1CPZA 1FD2A 1QY7A 1EKSA 4QIGA 5HVFA 1BD6A 4IFVB 3LWLA 4DQRA 3T5KA 1FX4A 2KRRA 1ZM4A 2OPRB 5JXSA 2V4QA 4OZ3A 3WZ0A 4IRCA 3QATA 3ZNUA 2Y1JA 2J0QD 1TKZA 4KGXB 4U95A 3QJPA 1W2IA 2KYZA 3CD5A 3VGVA 1VJWA 3LALA 2HHSA 1DFDA 2E44A 5HVHA 4C9DA 1AB8A 3IG1B 3PACA 1KQKA 4DG1B 2DNOA 2HVHA 2QFJA 4DV5F 3RBDA 2CQPA 1LFPA 1OO0B 2W7OA 2CG8A 2UUBJ 2UV8A 1UPMB 5KFDA 8AT1B 2OMOA 2ZHAA 1ZBTA 3M32B 4USUA 4RR5A 3TYTA 3J81j 1VGYA 2G2OA 2B9XA 5DDOC 3D3BJ 2QG9B 1RWUA 3OFFA 4L6V3 2I1RA 2OJ3A 5K8NA 3RBXA 4F3QA 3GIKA 4FF1A 3HP6A 3DLHA 1HNWJ 3F41A 3BPDA 5T7LB 5IQQA 4ZP8A 3QAEA 1SJ1A 3VF0B 4PAAA 3EGNA 4FZVA 5ETVA 2J0XA 1E6YB 2XI3A 1WC4A 4DFKA 1W2BR 2HZVA 3RB0A 2ZJQQ 1RWNB 2CFXA 1SBRA 3EWGA 2RRAA 1NPRA 1VIOA 2BVZA 5H9FK 4FF4A 4H4MB 4KY3A 1ROFA 1E6VB 2F9DA 1JLCB 2VUGA 3ILLA 2VHGA 1IKVB 3KDOA 4M95A 4I2QA 1VC5A 4ILRA 1NHVA 3P6YC 1N33F 2GIFA 3TR5A 1U26A 4CLPA 2HIYA 5EWGA 4DV2F 5GMKa 2DIVA 3VWSA 3LP0B 4ZVFA 3G86A 5GAHU 1NZ8A 2X51A 3H59A 1FCAA 1IM4A 3I9V9 4FVCA 4NLXA 5E3RA 5IV4A 5L38A 5F8GA 3KLGA 1P8GA 1FF2A 3VVUA 3OUYB 5E3PA 3GQCA 3VAGA 4I2PB 3W2WB 2EFGA 4TYAA 1IBKJ 3ILIA 3M6VA 2K3KA 2OLWA 3KHGA 3BGRA 4L76A 4RBVA 4Z37A 4O4RA 1JLFA 2VFSA 2BANB 3I31A 3W5ZA 1XMBA 4ED0A 5CZVA 3QIPB 2XCAA 1NEEA 5E2QA 2ZH4A 5KG1A 4W4MA 1VK8A 1FTRA 1VQSA 3T9ZA 2V6AA 4DDFA 2VG6B 4I4BA 2F40A 4EI2A 4BDPA 2V63A 1S6OA 5LSLA 3QSIA 3FFIA 2D3ZA 5I3UB 3IMQJ 3CCSS 4L74A 4ZA1A 2DNQA 1CJUB 2P9GA 3FBCA 4CLWA 4JV5F 4YR0A 5ETTA 1NKBA 1X4HA 2BRLA 1PJ6A 2YKAA 2EKYA 3M32A 3MR2A 1VBKA 4HHHA 5JJBA 1AW0A 2RKIA 3FNNA 2VQEJ 2D3OR 2C2KB 3Q8UA 4OV1A 1RT5A 2DTJA 3J7ZT 3JTNA 1ACMB 3D2WA 1IM6A 1P9QC 3M2UB 4ECUA 3ENVA 3MM8B 5D0EA 5C5JA 4WZQA 1IJFB 1Z1ZA 3T5JA 1BQMA 4OFZA 3TAMB 1G1XA 1SUQB 2H48B 5D4OA 3FEZA 2AT1B 3IA0A 1S12A 4DU8A 3DI6B 1NSKL 3N79A 4DL2A 3PW0A 4BC9A 1CJTA 4PG5A 5BYSA 3PW5A 4USMA 3S7RA 4XIUA 5KFWA 1MG7A 2GNKA 1HBMA 3SFGA 2VBXA 2XMWA 4ZJLA 2D3O1 1I94J 2DGSA 4GO5X 3VALA 4JYAJ 1JXVA 3OTBA 4QJVA 1J5OA 1RE1B 2L9WA 1NKEA 4KTQA 1BC6A 1JLQA 5KFIA 4DF8A 3MF5A 1RB0A 2NREA 1HBUA 1V6HA 1VLOA 2F9JA 2HVEA 3MOZA 3MM7B 2CQ1A 3P5BP 4PZVA 1S9GA 2CVIA 3E2EA 1X4CA 5DDQC 3T5HA 1NH7A 1O51A 3UN3A 3QWUA 4PWDA 1QE1B 1Q5VA 1FK9B 1KN6A 1IKYA 3CE8A 4J9SA 4BBYA 3FKBA 2E5GA 1NB2A 2YKPA 4OLPA 4A8OA 4CO2A 1IXKA 3PY8A 2CPYA 4RWWA 2V50A 1N5SA 1R6VA 1RT1A 4OHWA 2P5VA 4ID8A 2VDHA 2R3VA 4LIWA 5LL6d 1NDPA 4H54A 1WKJA 2BRKA 1OSDA 1C1CB 4DV1J 4RWXA 5F3ZA 5HQMA 2W2NP 5D0RA 4F36A 4OYOA 4AQYF 4F2SA 5D0GA 4A4JA 2C2NA 1XC9A 4PABA 4E98A 3WC0A 1PC5A 3VGTA 3MM8A 3RTVA 4JV2A 4ECWA 1AA1B 2W2MP 3BO2A 1SQFA 2PI5A 2RF2B 4MK7A 1FFWB 5A8WA 1MLAA 4ALZA 2VD3A 3V81A 3ZZUA 1GNKA 1GMWA 1MROB 4ELUA 3SV4A 4GKJJ 1A7GE 2VONA 4I2QB 2QA4S 4CCHA 1B0VA 1F9HA 3UO0A 2NZ4A 2RJZA 2D7SA 2MZJA 2ATCB 3GFXA 3B4DA 3DHXA 1HYSB 3KJQB 4G1QA 2BJ7A 1SXLA 4U9RA 5C24A 4IUFA 2D69A 3CWJA 4AUKA 2N3LA 1C0TB 1RAIB 3BQ0A 3BYRA 1NK7A 2GMJA 2DKOB 3GONA 4ZCIA 4RBUA 3HVTA 3TA2A 3D68A 2XSJA 5J1EA 2AJFE 4A8XA 5HBMA 2UUCJ 2CVEA 3K89A 1B99A 4HDHA 1RXOB 1CS4A 4KB7A 2CPFA 3HZGA 1K1QA 3MEDA 4UW2A 4O3SA 3D9BA 1ZA2B 3S1TA 1TUWA 5AJ3F 5E33A 3QSYB 3I5BA 2RSQA 1VQ6S 2FUG9 2P9CA 4B08A 4O4GB 1VQNS 4HI2A 4J9OA 3TA0A 1UWAA 2FJWA 1YIJS 1SIWB 2E1PA 2F8EX 2XBPA 5HATA 1TTHB 3HFKA 3OTDA 4DR2J 4GC6A 1KD1T 4ILLA 3GSDA 3SSRA 3CMAS 3K59A 1T9YA 2Z2YB 3JQJA 4LBIA 2XTJP 1YLXA 2B9EA 5B0GA 3GSIA 4O3QA 4WFNQ 4DOZA 3CCRS 2PC6A 2QX0A 1BXNA 4JI3J 4DUZJ 4V19X 3KK1A 3TRGA 3IWXA 2ZKTA 4E2FB 3HVRA 1MWZA 4USHA 1KVKA 2AYBA 4FF2A 2LQ9A 1YJUA 3TAPA 2BXJA 2EEYA 3LW5C 2Z2ZA 1LWFA 3IR6B 3P5TL 2B3TB 2MDAA 2E5LF 1HW8A 2I5JB 4P7TA 5LXYA 2ZNZA 2B6AA 2DHGA 2F63A 3KWMA 3PJ9A 3AQPA 2AEMA 3LP0A 2HHHJ 1TQLA 2XULA 3TEHB 4NLGA 1B0TA 1ZETA 1Q79A 2Z57B 3LPEA 3CCUS 4LF7F 2JFKA 2BJ1A 3PW2A 4CTAA 2HPUA 3DYAA 4U67Q 3K0JA 3DLKA 1AZSB 2W9CA 1K44A 2DH9A 3JS9A 2DNYA 2V94A 4EFAC 3GZ7A 3NRBA 2R9LA 3LA0A 3GIMA 3MM7A 2WONB 1FKOA 4OJHA 2NLWA 2B7BB 2EFVA 4ECVA 1X9SA 1SL0A 3WDOA 4F0HA 5LJ3Y 1BHNA 2GO9A 4OX8A 3TNVA 3LGMA 1JLQB 3M2RA 2V5HG 5ITHA 3HVTB 2ZWOA 3C15B 5C2CA 5DQGA 5ETMA 7FDRA 1JLBA 3H2UB 4FKXA 4IKAA 4OX6A 4NXNF 3PKMA 4OV6A 4L73A 4NRTA 3GG0A 4GVBB 1XEZA 2B9WA 2WW8A 3R2DJ 4FKYA 2XNQA 5EN1A 2GQQA 4NX9A 4LR8A 4W92B 3R8YA 1RWWB 1FJGF 4EUVA 4LF1A 5B7WA 4OX7A 3PO5A 1WOSA 4O3PA 4X65J 1R3NA 4YDXA 4RW8A 3RRKA 4JBCA 3KKFA 3G82A 1C1BA 1FDNA 3LO3A 4ELVA 3DMJB 3JQMA 3RU0A 2VOOA 2KI2A 4LBHA 4RW7A 2HWHA 3TZZA 2FZGB 2DVIA 5D4NA 5J2NB 1HD0A 1KDNA 1S6QA 2V9KA 3D6FB 4PWUA 3GV8B 4USWA 3OVAA 3C2PA 3G96A 5H9FJ 3Q8RB 2WRMA 3MMJA 1MWQA 3H40A 2RQCA 2PA8D 2HBRB 4C48A 3CCQS 5DO2A 3CIZA 3IM9A 4ZJQA 1HNVB 1OY8A 1WACA 2JSXA 5D4LA 1B3TA 3DU6A 5K8OA 4GKKJ 1LV5A 1VMBA 1QTNB 2H5IB 4NMLA 4NLSA 4CT8A 5GMDA 4LF9J 4DV0J 4DL6A 5GAGI 1WSVA 1S72S 2PFFB 3NXZA 4M5LA 2P8IA 1Y5LB 4DV7F 3OPKA 4JI0J 1RADB 1NK5A 3CC4S 1ZS6A 1RQ0A 1ZPVA 3MCMA 9RUBA 5DETA 4FYDA 1UKUA 2C3MA 1OQ6A 3ZFVA 3DLBA 2EW9A 1VBYA 2A18A 4FYXB 3KG4A 1S1XA 1KVIA 2J6UA 4ZS6A 1IBLF 3MMAB 2BJ3A 4YMEA 1X31C 1SVDA 1T9TA 2ZC4A 4ZLLA 4UT4A 5KFPA 4NXMJ 2XGQA 3CCVS 1N5YB 2MQNA 2VF3A 2JX2A 4IFYA 2AW0A 5LSRA 1TVRB 3AA8A 3TWZA 4C8MA 4C7QA 4EO8A 2IRXA 5DQIA 4IR9A 2XS7A 1SJFA 1RAOA 1Z2LA 3G8QA 3THVA 4B3TJ 3MEGB 1DQAA 4IG0B 2RE1A 4L75A 2RB7A 2V4JA 1D09B 1BQNB 4NCGB 1LNQA 2ZITA 2DH7A 3C19A 2R8KA 4ZHRA 2YWEA 4I56A 1X0FA 3ITHB 1WHYA 2E7VA 3BBBA 2MLZA 2ZBPA 2G0IA 1RT2B 1G4CA 1U6ZA 2OP5A 3HFZB 1UP1A 1OQ3A 3SSQA 3U1LA 3UN2A 2ZH5A 1VQKS 1WI6A 2ZNYA 3R3TA 2PEHA 3DRYA 4MKVA 4PXDA 2DNNA 1VHIA 3QFWA 2WCXA 3PR5B 3MPWA 4YB6A 2AQ4A 1IQTA 1NHKL 3TOQA 1VDHA 2BKOA 2R8IA 1XQIA 4U8VA 1RTJB 1DTTB 3BBCA 1FRMA 2C28A 4NMXA 3EXYA 3W5XA 2HVZA 5DGAA 1XNRJ 3CB4A 1TKXB 4O0IA 5THWA 3T9NA 2M0GB 3BGUA 1RA7A 3JAMY 2J8SA 1PJ5A 4LSLB 1UVLA 1Z4UA 2M7SA 4YY3F 1S79A 1T11A 4KH1B 3D67A 1VBZA 1SQGA 2FHOB 2RU3A 1RAHB 4IOAQ 1U2RA 1MMNA 4ZVOB 2K06A 2KT5A 2HWTA 1NHUA 1TL1B 2AWZA 2WK4A 3FEYB 2HFVA 5CCLA 3HHEA 1KKHA 5K8MA 2CJXB 2GAHC 2RHSB 3DGVA 3HT0A 2Z58B 3TJ9A 1UETA 1WF2A 4P6QA 5KG4A 5DG9A 3H25A 5J2MB 4ED7A 3KJFB 4DX5A 2QEXS 3MUVP 3SQGA 2HNYB 1CLFA 2OKQA 4XDCA 1WKLA 3DCAA 4LQ3A 1NRKA 5HJYA 2CQBA 1R8CA 3O44A 3FQKA 5A8RB 2Z8QA 2A10A 5L1JA 4QW8A 4JI8J 2DB1A 3TUPA 3SCKE 2BM1A 2RUSA 3SYZA 4DS5A 5EGYA 2DR8A 2CJKA 1YBTA 2J7KA 4YY3J 2RMLA 1S6QB 5DDPC 1T9UA 2CQDA 2ASLA 3G6VA 2IJRA 3MHYA 1RYRA 2XY7A 4YB5A 2AJQA 1VQMS 3JAMU 1X9MA 1HHSA 1TAQA 3NMAA 1IR2A 3BSCA 2BZ2A 1HBOA 4R5PA 1KHVA 5FLXU 2OEJA 4IFYB 3ISZA 1VQPS 2KT3A 2JVRA 3UDCA 4ED8A 1UVKA 3RYLA 2OPRA 3H0PA 4WBFA 3WX8A 3MR7A 2WSFC 5HK4A 3R9LA 3TX8A 4ZLJA 1CEZA 4WF9Q 1UZDA 1HPZB 2L3MA 2XZTB 3LP1A 2HGLA 4I0WA 4NLWA 4CLFA 3I96A 4DX6A 2ZH3A 3R1LA 1KRPA 4K4VA 3M2UA 1F2HA 4AL7A 1IKVA 3A8KA 4B9LA 2EXUA 2WOMB 1HNVA 1CSJA 4ZHRB 1JK9B 2CPXA 4FYWB 4P72A 4TKTA 3R97A 3HVAA 4C3KA 1RAFB 3BSAA 3NOGA 1EARA 1DHMA 2QGFB 3DYAB 3ZZRA 1JJHA 1NK9A 1JJ4A 3VV2B 4B3TF 4CM0A 3PKYA 2E9ZA 2EVZA 2LCWA 3CJKB 1R8AA 2BKNA 5KFQA 4DR1F 2HW3A 3H8YA 2ROEA 1GXLA 3MEKA 2FC8A 4TY8A 4URGA 4RW7B 1XK8A 1WI8A 2GHWA 2A2CA 1LFWA 1RT3A 2FLOA 2HS0A 1N48A 4NXMF 4BLGA 4KO0A 3AY0A 1RLCL 2BABA 5HSPA 4I69A 1A6LA 2GHPA 3IN5A 1SL1A 1N0UA 4DR7J 2QYCA 2R8GA 2F7VA 2M52A 2V67A 2G1HA 3Q8VA 5C25B 1TFYA 4BCAA 3HSDA 1N5QA 3BREA 3PFEA 5D6GA 1JB0C 4QWAA 1T03B 5LMUJ 2CAJA 3U27A 4PQAA 4DQIA 4IQXA 4JI0F 3A13A 1RSCA 4DV0F 3W1YC 1NKCA 3B54A 2MQQA 3IWLA 3RRHA 4RNFA 2GVDB 2H54B 3KK3B 2VBWA 1S1VA 2W7AA 5LMNF 3H5XA 1YRUA 4AXJA 5BR8J 4GC7A 4OZ2A 3M8SA 2CPHA 5L1IA 1NH8A 4ZMMA 2DISA 3NCPA 3QFHA 2LXFA 3QAUA 4M5NA 4Q2MA 3M9OB 2AU0A 2NXJA 2BMBA 3LGNA 2ZJRQ 2PFDA 2AZ1A 2BACA 1JXEA 3JSYA 5HQLA 2YQ3A 3B82A 2OD6A 3Q83A 4KPCA 2A2DA 2FZKB 2D74B 1C4CA 3TVYA 2OMLA 4Z7YA 5BYRA 4DR3J 2DGTA 3TQ1A 3V4IA 1RTHB 3JTPA 2LQ8A 2XMJA 3P4UB 3UVJB 3QMQA 2C2EA 1KHWA 2Z30B 4G1IA 1UA0A 1FI4A 2MZ1A 1KFSA 2CZ4A 1WC5A 2QLXA 4ECRA 1H3DA 2W24A 4FF3A 2ZJPQ 4MK8A 4KGZB 5KFZA 4J9KA 4CQ1A 4NA2A 3P96A 2KJWA 3UR0A 4PRFA 2DR5A 5K20B 5D3GA 5KG2A 1IKWB 4YS2A 4KGKA 4ANCA 4NRUA 2OPPB 2DPIA 2YNHB 3PYGA 2RH3A 1N36J 4KT0C 4NPOA 4IG3B 2QYGA 1CJTB 4NYZA 3MMBB 3DOMA 3GWCA 4DBQA 1TL7A 2B0GA 4CLKA 3M9NB 2UVWA 3KLHB 4OZLA 2XM3A 2C2ZB 1O6XA 2VIHA 4C0OC 1S9EB 2ZVIA 3CCES 3K2YA 4KKOA 4LRFA 4ZVQB 3EXCX 1UVJA 2AZ3A 2KXNB 2BE2A 3KXDA 3TZXA 2YH1A 3L7UA 5E0OA 3G8TA 4U7UK 2R8JA 1IJEB 1H7WA 4FPIA 5EHHA 5KFNA 1T05B 4LF7J 2H1YA 2YH0A 4DQSA 3CSKA 1ELOA 1TELA 3O8WA 3OFHA 5BJRA 3M2VA 2W8KA 2QC3A 4I64A 2R2UA 2DK2A 3EMTA 3MFHA 1YVFA 1X4AA 4M5DA 4YHHF 3BDPA 1KBRA 3BF4A 1HPZA 1P1LA 1XR5A 1JXLA 2WZ1A 1UFLA 8ATCB 4DV3J 3CO9A 4O3RA 5CH7B 3NAHA 5KG6A 2QJ3A 2MQPA 1GFWB 3C8YA 4M63A 4JI7J 2VFUA 5RUBA 4X4UA 2NXNA 3SQOP 4J9UE 4DL0C 3JB9k 2CDQA 1K0VA 4G1QB 1REGX 2DXDA 2IC3A 4DUZF 1HR0F 4JI3F 3KK2B 4DCJB 2FC9A 4JI1F 1T0TV 3MAAA 2MGZA 4A48A 3PR4A 2AHOB 2PGCA 1QTMA 1HI8A 1O8BA 3D1OA 5KFLA 2KB2A 5AE1A 1W25A 3MCNA 2GVDA 4KO0B 2YVSA 3H7HB 1FEHA 1Y7PA 4CYUA 4LRAA 3K58A 1YHQS 4FXDA 1VRTB 4K0KF 2HVIA 5C25A 2N3OA 1VISA 1IR0A 1KQFB 3CF5Q 3M8PB 1F6TA 1UEVA 2DGOA 2QRRA 1S1UB 4CH1A 1FRXA 2MSTA 3X1LB 4CLYA 4NLQA 2HAFA 4JI4F 2UXDJ 2D9PA 2BW7A 4OZ1A 2BE7D 2HQ3A 4I6WA 1ZTWA 1CJKA 4F7VA 2HMIB 3A8JA 4DL5A 2YPZA 2QIFA 3CEDA 3NBPB 3MD1A 2EK6A 3MECA 3MPVA 1UTAA 1SC1B 2DO4A 1DQ8A 2XWYA 3ZZOA 4ZLPA 3T3FA 2BOPA 2ACYA 4M5HA 1PJ7A 2QLFB 2W9CB 1UWBB 3HM9A 3IGVA 2M8HA 4I1TA 1VQ9S 4E0DA 4MKAA 3EVMA 2Y8WA 2Q43A 2BE2B 4RX6A 3CDUA 3M8QB 4C11B 1VR6A 2GV1A 1DBDA 2N7CA 2GCFA 3AD9C 2RS2A 3H5UA 4YP3A 4N7TA 3UW1A 2C22A 1RACB 2V8DA 3ULHA 2C2DA 2ZFHA 3T5LA 3IWNC 2KM8B 2NYIA 1B7YB 5HP1B 5BR8F 3RG6A 2NCKL 2AKWB 2JJ4D 3LGHA 2HQGA 2IRUA 3IS9A 1W26A 3ZXWA 4EMDA 1WG1A 5KFOA 1MN7A 1Q8KA 2ZVSA 2LFVA 4DFPA 3U1NA 1NAQA 1TKZB 1ZZFA 4P73A 2WSCC 4TXSA 3VAJA 1QVFR 4P71A 1KQSR 1X4EA 3BR8A 5GMEA 2E66A 1KQGB 2W01A 4JUZA 2HHWA 4ED2A 3UN5A 5L1KA 2QL7B 2AX1A 4QW9A 4LR7A 4Q5VA 2DIUA 3MUMP 3DDIA 5GVQA 5GAEI 2XO6A 1S7IA 3OLBA 1RT4A 3IBCB 4WKRA 2Q1LA 3QNWB 4LRBA 4ZPCA 2E5HA 4ED1A 3W60A 2G9OA 4DZDA 3E51A 3KHHA 4C4WA 1PBAA 3MM5A 1CQNA 1NU4A 2YXLA 1T95A 5MAOA 4Y2IA 1N4LA 3KK3A 3OBIA 2GIRA 3QIDA 1GH8A 2UXBJ 5FLXY 3FRYA 3CMQA 2JC0A 5J2PB 4ETXA 1FKPA 4A8KA 5J2NA 2YNFB 2GQCA 5A6WA 2FHMA 1HMVA 3HI9A 2HHPA 5LM7E 1GAOA 1LQ9A 3PJXA 4DX7A 4ITSA 4M5KA 4B17A 3W62A 3C6UA 5B09A 3J7Z5 1YJNS 3GCWP 1S77D 2RIJA 3DLEA 2V69A 3A4TA 2CQCA 4DG1A 4N8NA 2O67A 2B4OA 4HHJA 1S9FA 1KSPA 3CULA 3OHAA 2ZE2A 5DJBA 4PR6A 3IAM9 4GVBA 4Y65A 4OX9F 1P1TA 2H51B 4QYZK 2GIQA 1X7VA 2QFIA 1PYOB 4WFYA 1VCTA 2V8GA 1HNXF 1F9EB 4FBTA 3FC9A 2VJUA 3TP2A 4CP5A 2VQEF 3MMCB 1OYDA 2HZCA 3PHTA 3KK2A 3SBMA 4F67A 4KPYA 4RZRA 4UUXA 1VFJA 1NPPA 2ZH9A 2MHEA 1NM2A 2CZVC 3BKFA 1HBNA 4JP8A 1UVIA 4JV5J 4DR4J 4WXOA 3GIRA 4DSKA 3K8WA 4NI2A 1FE4A 1TMMA 3KLIA 4AL5A 1RABB 4WPAA 2HZAA 3KG1A 2PMHA 5T41A 2PT0A 4ZIVA 4XO0A 3DKDA 3M8YA 2VPXB 3D1QA 3TQEA 3RBZA 3U02A 4N41A 3CJRA 5KAKA 4RO0A 2B56A 3VQTA 1QUPA 2AP6A 3WBZA 2YWWA 2J9DA 2DT9A 3W66A 3C6TA 2JZ5A 9ATCB 1TVRA 2DGQA 1N54B 1VIXA 2HRUA 3NG8A 3EGZA 5I42B 4YB1P 3MR5A 3D0HE 2K2PA 4DFMA 2DXEA 2K1RB 3N6LA 3WIVA 1J27A 1RWMB 1VRTA 1DTTA 1H2UX 4MKBA 5KFBA 1FFSB 2HQFA 3CMES 3HFVA 1VJQA 1UJ4A 2BJDA 2CWKA 4QR0A 2XS5A 1GMWD 2B8PA 2JL9A 2KL8A 4LJMA 1P27B 5KT6A 1K1SA 5J2PA 1Y5IB 2ZBRA 4H4KA 3VZHA 1N33J 2GC8A 4HT5A 1WNEA 3QJJA 4BC7A 4CI0B 1JLGA 2JDJA 3AFGA 4ES1A 2HRYA 2QLBB 2ZOFA 2RS8A 4KR0B 2FY8A 4TVAB 2YNGA 4YEAA 5B0EA 2J76E 2KKHA 4C6AA 1RTIA 2FJAB 1FWKA 2KVQE 1VC6A 7FD1A 2VL1A 4IO9Q 1FRHA 1S48A 1NBEB 4U7UD 1Q95G 1IUJA 3LP2B 2DHHA 4S0MA 2GMLA 4PPDA 4URSA 3US5A 3M2VB 1FNOA 1UMJA 3TO8A 3OL7A 2LQJA 2DITA 2HFZA 3KUHA 1JLAB 1HYSA 4H4KC 2N82B 2VJVA 1IWAA 2I9SA 4IH5A 5KFVA 4MIWA 3W9HA 1X0PA 1VC0A 2QLJB 4DPWA 4OJGA 3EUNA 2OH2A 4UOCA 1SC6A 2BJ9A 4USIA 5A8KB 1NMEB 2HLTA 2RT3A 1S99A 3FZ2A 3FUYA 5KT2A 2UUBF 3HD2A 2ZDPA 5KFFA 3PYFA 4A8YA 3KHLA 1N32F 3AA9A 1RLDA 1HWKA 4EBEA 1SL2A 2DGXA 3D4JA 4JI2J 3BGLA 1J5EJ 3JYTB 1CULB 3G87A 2FGOA 1RBLA 4H4OB 3CCJS 1F3FA 2WTFA 4ZP7A 3ZTRA 4K8RA 2X1BA 3IC1A 3R5JB 1HW9A 4FXVA 4O0NA 4A47A 4J9LA 1M5KC 2I38A 4BWJA 1NJZA 1QVGR 1U0HB 2KXHA 5L1LA 1RT6B 3DLJA 4ZLNA 4LF2A 2E1CA 5F8NA 1U1MA 4A8FA 3NGDA 3P45B 3M7VA 3MFIA 1NDCA 1FVQA 1CQMA 1KS2A 3BM7A 1IQZA 3ICLA 4OJ3A 3TA1A 3GV5B 1NB7A 1TV6B 3PRBA 1HWLA 1S59A 2G0JA 2YY3A 2V4RA 4U6PA 3EX7B 4PG6A 2BJEA 1CJUA 4WJBA 4WYLA 1RT1B 1WWHA 2VDIA 2MEWA 4B3SF 5JVGQ 2HNYA 3R5GA 1T8EA 1FNXH 1APSA 4GVLA 4I7FA 2HBQB 3OXGA 1WTFA 1RHQB 2ABYA 2YX7A 4K5RA 4ECTA 3OR2A 3NCQA 3R5DA 4NYOA 3QIPA 1RJJA 3LTOA 4HL9A 1H38A 2AJ4A 3B6BA 2R2TA 3VGUA 4CO3A 4IQMA 2DNKA 4D3GA 1J5EF 4JI2F 4V19J 3BBFA 4WKYA 2X3GA 5DDRC 1SV5A 4ZP9A 4OL8A 1BQXA 1FRKA 1FD8A 2YKNA 3D5MA 3PX4A 6FD1A 3BQ1A 3MAHA 4YFUA 1QLNA 1D9AA 3MCSA 4HI1A 5CXTA 1HLWA 3WC2A 4ZPTR 4B9VA 2EFQA 5ETRA 4DU7A 3I4HX 2BDPA 1I1GA 2C42A 2IM3A 6FDRA 3TAQA 2HS3A 5KT3A 2E7WA 1YK9A 2QMXA 4HR2A 4RW9A 3LH2S 2ZUGA 4X65F 2N4DA 3A8EA 3UVJA 3WX4A 1RDRA 4ETZA 1N5VA 2JWNA 3DLKB 3EDQB 3MWBA 5HBMB 1PILA 1FRLA 1G7CB 1Q8IA 2V68A 2FY1A 3CIMA 3DOLB 1RP5A 1S9GB 2E1AA 4OI6A 4DI6A 3BO4A 4NLOA 3Q8SB 1D0EA 1U1LA 2PEBA 4WZMA 2LA6A 4DSEA 2RAQA 5A8KA 1Q0NA 4NXNJ 2EBEA 3HPOA 3D6TB 3MCOA 4K7QA 4ZCLA 1OS5A 1NDKA 3ZTSA 2IBOA 1AROP 4IOCQ 3RAXA 2O1PA 3POTA 3K7RA 4NCAA 1J5OB 2FJEB 4LVOP 3K8VA 1C0TA 4MH8A 3H2LA 2LMIA 4ZVTB 4JI8F 4RUCA 4FYVB 5ETPA 3LP2A 2IM2A 4DEZA 3DOMB 2M8DB 3UQSA 4OYAA 1WF1A 1MN9A 2RRBA 4CZCA 3UD4P 5CD4A 2G2ZA 3R5BA 4TY9A 2FLPA 4Y2AA 5KOXA 1D9DA 1HNIA 3BJYA 3DM2A 5DG8A 4DJBA 4ECSA 3D0IE 4LFCF 4LF8J 1L3TA 2A6MA 2EG1A 1TMJA 1ZOTA 4QPTA 4M5DB 2OTLS 3LUYA 1MROA 3ILOA 4Z2XA 1EIYB 4CO1A 4NE9C 2ZKUA 1H73A 4TLQA 5CYMB 3W61A 5F9NA 1KOOA 3MTKA 1U6FA 2KXFA 2EBGA 3RZAA 5J1PA 4J9MA 3I82A 3CNQP 1HNXJ 1MMLA 4J9NA 1QSLA 5A76A 1FKOB 3HHLC 2XLJA 3I55S 2HAIA 3G71S 3PCOB 5B0FA 1SKSA 3DRSB 2EWHA 1OPIA 4OLOA 3HJFA 2H5EA 2ZH6A 3KLEB 5H9EJ 1EETA 3KNAA 1PBUA 2HFSA 4PXEA 5KTQA 2K8GA 1G6BA 4KGMA 5AJ3J 2C1EB 4FS1A 2RQKA 2NZCA 1RT7A 4X4PA 2XMVA 3F0NA 4DV6F 1FVSA 4B3OB 1PG5B 2N7YA 3MZIA 2E9TA 2F65A 2K1RA 2E5IA 2FJDB 2KRBA 2FHKA 3J80U 2UXBF 4NZ6A 4K4XA 2EFOA 3GJTB 3CCZA 3VAFA 4HYKA 2GJFA 4ED3A 4MTPA 4EYHB 3HHNB 2QV6A 3U7JA 1JKHA 4O44A 1NJWA 3A3PB 3GJSB 3KK1B 3W9JA 2FVPA 4PG8A 4ES3A 4DR6J 4CLSA 1ZM9A 1DLOA 3ADAC 4NWBA 1UEUA 2X7IA 2YNHA 3D3CJ 5B0AA 3UCZP 1WDDA 2HFUA 2L08A 2GFFA 4KHMA 1Q81T 4GKJF 2VV5A 2X3DA 2DPJA 3I5AA 3ILJA 4URQU 2FVRA 1I5OB 2OPQB 2ALYB 4U7CA 2MQLA 2RDDA 4ERDA 2CNKB 1S4FA 2YNIB 4HKQA 4RW4B 3IRXB 2IDLA 3OLAA 3HSZA 4NLPA 4AQYJ 1LOUA 2U1AA 5ADZA 1X4BA 2POKA 1GEHA 1AZSA 3PV8A 3RR8A 2VQFF 3LAKA 3LPYA 2EFNA 2LQBA 3TUZC 2LYVA 4N5SA 1TAUA 1B70B 1RAGB 1CBKA 1C1BB 2RUGA 1Q8LA 2GAGC 1RBAA 1OSCA 4WU3A 1JLFB 3GG1A 3M8WA 1JJCB 3NGRA 3NGKA 4UZCA 2V2KA 3M8PA 1RWVB 3BH7B 3MEEB 3PEHA 4Y0FA 2XYPB 1RKJA 1AUSL 1OMSA 2WVCA 3QO9B 5ETQA 2HVDA 3AQOA 3L3CA 3GYXB 2CPIA 4MMOA 5KFGA 4FXWA 4WTOB 1Q5YA 4MIBA 4F3OA 2HNDA 3AAWB 5KFSA 1D8YA 2HG4A 2ERRA 3GYNA 1AFJA 1YKWA 3D66A 5IC4B 1QUVA 3P3DA 3DLLQ 4RU2A 1XWLA 3EGWB 4UOHA 2IC3B 1YQHA 4J90A 1AXQA 1HQEB 1VQYA 2ZBCA 3G82B 1HARA 7AT1B 3PW4A 2XB2D 5ETLA 3SI8A 5DM7Q 3MR3A 1U02A 2DGWA 4Y2KA 1BWVA 4KQZA 2HIQA 2YQ0A 2IVFB 4B9NA 3M30A 2A6OA 3W2WA 3KYLA 2QN6B 1RKIA 3NGTA 4JI4J 2UXDF 1NO8A 3HF5A 4G6VB 3EJMA 2MKIA 3K5NA 4DV6J 1Y9OA 3MDFA 2HSEB 3M8QA 5CA5A 1NZAA 3J81U 1X5TA 1S0OA 2XNRA 3Q2TC 4DV4J 1IVZA 3CJ2A 4LQ9A 1OY9A 4CO0A 2OPQA 5DGBA 4CIOA 1CG2A 4K4WA 2KYXA 4PWDB 2R7RA 2DRAA 1R31A 1KR4A 1LW0B 5E3QA 3H5SA 1R89A 1UAWA 4ECXA 3QZ8A 3ETMA 4JI1J 4I2PA 2LXUA 5ETNA 2YPYA 1HR0J 5EDWA 2VG6A 4LIRA 1RWKB 4KAIA 5FD1A 3IS9B 3TJAA 2JLGA 3CCWA 2HBYB 2M2BA 5CCMA 5C42B 4JI7F 3EVOA 4YOEA 5D8HB 2A1BA 1S1UA 1UVMA 1S1XB 4WK3A
chains in the Genus database with same CATH topology
4XK8C 3KFWX 2Y0SD 3GR1A 4LF8F 3THTA 2JEJA 3KNGA 3QO9A 1LWEB 4Q7AA 1T3OA 5F8MA 4B3MF 4G3IA 3I0SA 2HNDB 3NBPA 1X8DA 4ECYA 3MM5B 3DU5A 1HBOB 4R5PB 4NYPA 4KSEB 3CDEA 2W8LA 1S6UA 1DRZA 1FKPB 1TR0A 2L48A 2XGPA 1E6VA 2XZWA 5KT4A 2XMKA 4Y00A 3PEJA 2GJ2A 3SFUA 2XC9A 4PUOB 2ZH7A 3RW6A 1N36F 2LA4A 2B9YA 2OPSA 4IR1A 2C3OA 2YNIA 3TUJC 2ROGA 5EX0A 5A8RA 1LW2B 1R43A 4EU0A 1F0XA 4TQRA 3F73A 1X5PA 4DL7A 1XR7A 3DOKA 5EUHA 5DM6Q 2W9BB 3J81Y 3S8SA 1FXDA 3MI7X 2ZC3A 2F3JA 2J9EA 4TLRA 3PIOQ 1S6PA 2DD8S 2Q6BA 4DSJA 1FT8A 2JLEA 1RTJA 2KVIA 3I9ZA 1WG4A 4PPZA 1YRTA 1Q8BA 1HNWF 2IYGA 2YWGA 1OIAA 2BV3A 3LANA 3UFCX 1L3KA 4TN2A 2ZD1B 3IR5B 4F3MA 4M94A 2ZOGA 3CDAA 3DN9A 3DI6A 5D78A 2W9AA 2IM1A 4PG7A 2HHQA 2FVQA 4LVNP 3OR1B 2PI4A 5G0RA 1FK9A 1Z2ZA 2ILYA 1D9FA 2ZZMA 4O4GA 1G2EA 5DG7A 3BN7A 5HMXA 1FXLA 3OVSA 1R27B 3G6XA 3OW2R 4Q45A 3QZ7A 1M5VC 1AFIA 4F50A 3W3SA 1GQEA 2VODA 1EETB 1TL4A 3FGVA 4F8RA 2XSJB 5A6PA 5L9NA 3TW0A 4X4NA 2ZDOA 1VK3A 2CJ9A 2DHXA 1S1VB 3KLFA 1ZZNA 4OI3A 1XR6A 4CNYA 4YUDA 5FDLB 2VH7A 3VTIA 1HBNB 4ZPWR 5A0YA 3MM9B 2JH3A 3ZZZA 4ZKAA 1S49A 2R7VA 3H20A 5E41A 2B4VA 2LEPA 4C0BA 3V6JA 3NS5A 4ZPDA 1MU2A 4DR7F 2IMWP 2MZRA 3M8RA 2E29A 4F4XA 4UY8T 2JOQA 1KNZA 2X1FA 2WB4A 1HWJA 4RW6A 2BM0A 4GO7X 2HHUA 5E3AA 3VAHA 1F5CA 1D3WA 4HTIA 4XDDA 1GXTA 4DSLA 1SIZA 2XY5A 2EG2A 5CZXA 5KT7A 1YI2S 3TARA 4Y28C 4R8UA 5CQGA 1CEZA 3QGGA 4O3NA 1J2VA 3MEDB 2WAQD 4DHVA 4TU8A 4HH1A 4MYUA 3CDWA 3DRPB 4CH7A 1MW7A 4OQJA 1UJ5A 1WELA 1Y0HA 2DNGA 2MSSA 4OI0A 4WFXA 1S6PB 2IFXA 2MKSA 3MMCA 4XPCA 3Q24A 5FIIA 2OAUA 2HLUA 1GTHA 5K14A 3MURP 4C2MA 4QIVA 1S97A 4CO4A 2UUWA 3DLGB 3KJVA 1H0HB 2W7PA 4JV1A 4K4UA 2CQ2A 5F9LA 1YJ9S 2RNEA 3V81B 3CCLS 3V6HA 5DRKA 1N5TA 1FRJA 2GO8A 2UVVA 4ZPBA 1Y4ZB 5F0WA 1KTQA 3FRZA 3NS6A 2QZ8A 2K7KA 1HWUA 3KLVA 2MZTA 3CD7A 4FN5A 4EGLA 1LWCA 1SKWA 3W2VA 4RNNA 4KC5A 2W9BA 2XMMA 3BB5A 3AB4B 5IT9Y 5B0BA 2MJNA 1RT3B 2VFTA 3OSPA 5IM0B 1JLAA 5BYQA 3OUYA 2IHR1 1M5PC 2AV5A 4Y2MA 3GE9A 2VA2A 1Q78A 3N01A 3DOKB 4QR1A 2G1DA 4EO6A 3ETOA 1WEZA 2V4JB 2YNGB 1S9EA 5K5MA 1S7HA 3DHWC 1K0TA 3MMBA 4DSIA 3J7YI 2LECA 2DR9A 2RQ4A 4DUYF 3LOUA 4KV8A 3QJLA 1F5AA 4PXBA 1GXUA 4WE1A 3X3UA 5C42A 1TKTA 3VQSA 5EWFA 3J80Y 4TU9A 2FHJA 4OZJA 1QJHA 5KG5A 1DQ9A 3AJ1A 5E3CA 3UE2A 4DN0A 2VG7A 3DM2B 4K4ZA 4C8OA 4HLBA 3KTQA 4LSLA 4ZK7M 1I6JA 2KM8C 4H4OA 1L3SA 3KHRA 3M6WA 4EZ6A 1UL3A 2CJQA 4K4SA 4JV0A 5JUMA 2MGZB 4N76A 1S1TA 3D54A 3N9UC 4DFJA 4Y3CA 2CIMA 1URRA 2QT7A 2FJXA 4K50A 2KHDA 2WONA 2KFYA 1C0UA 5HL7Q 2K3IA 4FP9A 4Q2LA 2DJWA 4XAKA 2COLA 4QPXA 3PZPA 3PIPQ 1JLEB 1ZAWA 2KZZA 4USJC 2ZHBA 4FNIA 1C2PA 1WG5A 2BYCA 4ZP6A 3R1HA 1FDDA 2VBZA 1RI7A 1LXNA 3ISNC 4ZVEA 2VFRA 4X84A 4QWDA 4F4KA 4RNMA 2J6TA 1S0NA 4KKOB 3CXCR 4RW8B 4Q0BA 2VPYB 1U25A 3GILA 2VPWB 2OIHA 4IRKA 2OTJS 4KE5A 1GTEA 1N34F 3N28A 1G3OA 1PGZA 3K5PA 4O44B 1HNIB 5F8HA 5F8IA 2BQUA 2DH8A 3TI0A 1TZ0A 4WE1B 1ZM3A 3BO3A 3SEOA 1BQNA 4NCGA 4IYQA 1JMTA 1F9FA 2IVYA 4WFBQ 2PO4A 2AGPA 1X4FA 5B08A 4Q8EA 1S1WB 4ICLA 1RT2A 3OTCA 1QAXA 3V6KA 3HHDA 3TANA 5K14B 3Q22A 5H1SV 5J2MA 3HXMA 3PX0A 2KFZA 2OSQA 3B4MA 1BGXT 1FRIA 1M0SA 5L39A 5KFUA 3VAKA 5FDLA 4Q43A 1TL5A 5C24B 1GT8A 1Y3KA 3OQ2A 3C46A 4C98A 2G0CA 3BN4A 1L5UA 3KLEA 3H5YA 5F3TA 3HDSA 2KDOA 1GX5A 4Y2CA 3W2VB 2RF2A 3CC2S 4QBUA 3E01A 5F8JA 5KFYA 5KFMA 2P6TA 3FMWA 3JTOA 4LT6A 1S1TB 4EEYA 4KBIA 3OFEA 3T1AA 5GADI 4B9SA 4RKUC 2NPFA 2NUHA 3OL8A 1RT5B 3THPA 2C3PA 3P49B 1FDBA 3SV3A 2DNLA 1HMVB 1ZM2A 3NKYA 5HO4A 2ROPA 5J1NA 2IA6A 2J9DE 1MNEA 1SJQA 3DXBA 4IRDA 3MEEA 2KG0A 1FEEA 1UVNA 1QM9A 3KLIB 4J9PA 1NK4A 1FJEB 3FFIB 1SJ4P 5GAHI 2HWIA 4MKYA 4C8LA 3DDNA 4TNOA 4DV3F 4JI6F 1C4AA 2FD2A 3BGFA 3PHEA 1SH2A 1NNDA 1H7XA 3EPGA 4QU6A 2IAJB 3RAMA 2M88A 2WBMA 2Q66A 3L09A 5IS2A 3D28A 2IJFA 3BS9A 3OL6A 3P6YC 3CUNA 5IZHA 2QSWA 4I6YA 1C0UB 2XI2A 4QIEA 2FJVA 2B5JA 3UCUP 4PXCA 5B0DA 2MKJA 3FEXB 1T3NA 1LK7A 2MMYA 2J5AA 2F4VF 4OIXA 3HLUA 4DR2F 4B02A 3RB3A 2ADCA 1H2VZ 4MJKA 2CPJA 2RD5C 4I68A 1B7FA 3R5AA 1A9NB 2CQ3A 2RRNA 1Q53A 1H2TZ 4AE5A 2V8VA 3M05A 4EZ9A 2GGPB 4KFBA 1RAJA 3UD3P 2CG4A 1JLBB 2AX0A 3QLHA 3JYTA 3UWTA 2CQ0A 4YR2A 3OFGA 4EWTA 1M5OC 3LQVA 4A8MP 1KTVA 1MMDA 4PKDB 2XWXA 1U1KA 4R0JA 1JLEA 3NWGA 4NCBA 1U24A 2MHNA 2ATLA 1R7IA 2MY8A 2W4CA 3IAS9 1U1PA 4DR3F 5IT4A 1TK0A 3HHLB 3SDEA 1S0VA 3Q0AA 2LXIA 5KG0A 4DQQA 3UCGA 3FSIA 2MY7A 2HNZB 2RDIA 2RU9A 4ES2A 2NQPA 2I5JA 1JIHA 1FERA 2CYYA 4ILMA 3GIIA 4K59A 2J7WA 4DX8H 4LFBF 4WTYA 3QGHA 3FMBA 4DV1F 4F02A 2VC1A 4J5OA 2GA7A 5J2QA 1WHVA 2UVUA 1LWFB 2ZH2A 3FDSA 3M30B 1MWYA 2BA9A 2J6SA 5CYQA 2GX8A 2LEAA 1T7PA 2X1AA 5A8WB 2FGCA 2D3OR 2HFNA 3DRRB 2DBBA 5I3QA 5LMUF 4ED5A 2QSFA 1U09A 1TKDA 2PD1A 1Y5NB 2B4UA 3G6YA 1X4DA 4KRWA 2MQOA 5A0YB 2G4BA 4BWMA 1U48A 3RB4A 4QU7A 3CPWR 1RK8A 3NP5A 1X5OA 4Y6IA 1LW0A 3E8OA 2IVMA 4ZVGA 2EFPA 1VBXA 3W7BA 1XERA 3PVXA 2XHWA 2D9OA 4CTAB 3CCMS 1Q82T 5HI7A 2ASJA 2E9RX 3M2RB 4PUOA 4JYAF 2OFHX 3OJUA 2WBRA 3KOAA 3ENQA 3JSMA 1I94F 1KLMA 5AE3A 1KONA 3M6XA 1K73T 5K9FA 4PQUB 2JRSA 2YX1A 2BBEA 1TK5A 3I0RB 1BY9A 1Q16B 2DNMA 4B9MA 4LSNB 4M8LA 4X62F 2OPPA 2EI5A 3B78A 3R5CA 4Q44A 4R8UB 2NUUG 3SCJE 2JFDA 4EBDA 5G0RB 3QYYA 1ZTTA 3ZZTA 1L3UA 4RW6B 2UXCF 3G8SA 1UFWA 1UA1A 3RR7A 1YG0A 1Y00A 2DR7A 5LXRA 3PDNA 4DL4A 2YKNB 2IJNA 1R8BA 2DO0A 2HGMA 2I0XA 2XSFA 3AB2B 5F41A 3BSNA 2R8HA 1JLCA 3DLGA 3KJVB 2WSEC 1K8AT 1T94A 1DAXA 3UI3A 2IYIA 3HHLA 1LW2A 3SDEB 4RUAA 1NJYA 1MU2B 2KJVA 1FXRA 1QSSA 1RTHA 4ECZA 2KZMA 4K4TA 2Z4PA 4NA1A 1O0PA 3OR1A 1WTBA 4I67A 5T7LA 4TYBA 1NJIT 4C3LA 3D1HA 4BHQA 1KLNA 4X4QA 2K7JA 2LU2A 4OJ1A 2BQ3A 3KLFB 2RDJA 2R7OA 4AFFA 1RTDA 3ZZPA 2FB0A 2LVWA 3O3LA 4I6AA 2HMIA 1GX6A 1U1OA 1YBAA 3L7OA 1VI7A 4WCEQ 2IBKA 3DRSA 1V9OA 5DLGA 3K5MA 2APOA 3MMAA 1BQMB 3TAMA 5KOWA 4DN9A 4OHXA 3HK2A 2JHEA 4B9TA 3I56S 5CYMA 3C6UB 4ID5B 2MXYA 3V4MA 1HBMB 2U2FA 3OTOF 3HHLD 2YX4A 4ECQA 3V6DA 4C8ZA 3CJ0A 3I32A 2DNRA 2EC0A 3N4WA 3I5CA 3CD0A 3SZ2A 2WHOA 2HQIA 4A8WA 1U49A 4QCLA 3FQLA 1R0AA 2F8HA 3FSYA 5AXKA 1ZYQA 4CNZA 4KIAA 5FJ4A 2D41A 4NA3A 3CDBA 2HNZA 2AYMA 1SI9A 2W25A 5GADU 3BZQA 1K9MT 1IBMF 1CVJA 1IKXB 1ULRA 2HYIB 3VCDA 4IH6A 1VQ8S 2NS1B 2XG8A 2YWKA 3OXFA 1XNQF 1VQLS 3KLGB 3DFEA 4OZ5A 4PG4A 3HT3A 1HD1A 3S01A 1U6BA 1TL1A 4EBCA 5CYQB 4DR4F 5IT0A 3BGRB 3KMQA 5HLFB 2XCPA 2QE5A 1S0MA 2R7SA 2SXLA 1NJXA 2DGUA 5D4PA 1YRXA 2HHTA 2J8AA 4HVZA 1SUQA 2NPIA 1HA1A 1LWCB 2WB1D 2W4DA 3L95X 4DR5F 1RA6A 1LXJA 2CQ4A 5GAGU 1U8SA 2P9EA 2YTCA 4QZVB 1RT4B 4ED6A 1N0VC 4QR2A 3RBEA 2HHXA 4NLTA 4X4TA 4DL3A 2FIUA 1YJWS 4KV8B 3IR7B 4X4RA 4LF9F 4IG0A 2FLLA 2DNPA 1XMQF 3J7A1 1V3RA 1FESA 2MKCA 4GKKF 2M3DA 1M5HA 1ZH5A 1KLMB 2NSBA 4QWBA 1SJ3P 2W4PA 5AXNA 3CJ3A 2QA2A 1DZ5A 2LKZA 2PA3A 2PDAA 2FVCA 3LWMA 1B64A 2IMOA 4DF4A 3NL0A 1JLGB 5HN0A 1M1KT 4P7VA 3VZIA 1KFDA 1IKXA 4FNHA 2E1MC 2IRYA 1HQEA 4P2SA 3N6MA 5KFTA 3VAMA 3V6DB 1VQOS 1JKHB 2Z0GA 2R2RA 1HWIA 2VG5B 4L72B 1WHWA 4CT9A 1HHTP 4D3HA 3DRXA 1R0AB 3OHBA 4GMKA 1TK8A 4A8SA 3HVWA 4PQUA 4C8KA 3FZBA 4RNHA 5EWEA 2C2RA 2I8EA 4DPOA 3ENWA 2M9KA 2O3DA 3CCTA 4ID5A 2R2SA 2OPSB 5HMWA 1KVJA 4TY8B 2L9DA 5HROA 1XN9A 3JSMB 4QWEA 4F2RA 2O01C