1KBRA

Crystal structure of unligated hppk(r92a) from e.coli at 1.55 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPATLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
publication title Dynamic Roles of Arginine Residues 82 and 92 of Escherichia coli 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase: Crystallographic Studies
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2001-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1kbrA00
2BMBA 3QBCA 1CBKA 2QX0A 4M5MA 1RTZA 1G4CA 4M5IA 4M5NA 1DY3A 5ETLA 4M5GA 1HKAA 1F9HA 1Q0NA 3KUGA 3ILLA 3UD5A 4CYUB 5ETKA 3IP0A 1HQ2A 4PZVA 4M5HA 4F7VA 1TMMA 4M5JA 4CWBA 1EQ0A 5ETMA 1RU1A 1TMJA 2F65A 4M5KA 5ETVA 1IM6A 3ILIA 3HCXA 5ETSA 1RB0A 3HSZA 2CG8A 4CYUA 3HSJA 5ETQA 3UDVA 4CRJA 3HD2A 5ETOA 3ILJA 4M5LA 3KUHA 5ETTA 1EX8A 1KBRA 1RAOA 3KUEA 3HT0A 3HSGA 3ILOA 1EQMA 3MCMA 5ETPA 5ETNA 5ETRA 3HD1A 3UDEA 3MCOA 1RU2A 2F63A 3HSDA 4AD6A 3MCNA
chains in the Genus database with same CATH superfamily
4PXCA 2RB7A 5D0EA 4CYUB 3IGVA 5M2UA 3KK2A 3NAIA 3SIPB 2IM2A 3KOAA 1O0PA 5DZ7A 2W7PA 1B7FA 2EG2A 4L76A 2UUCF 3JB9k 4QYZK 1T9WA 4L74A 3KHRA 4OJ1A 4UZCA 2HNZB 3H42A 3FK4A 4C11B 7FDRA 2EBEA 4J9PA 4C7QA 4QZVB 2UVRA 2C2DA 4RW6B 5CYJA 1IBKF 2QEXS 2V63A 5KFKA 2GHPA 2DR6A 4EBCA 4YEAA 1YG0A 2CNOB 4QU6A 2KVIA 3H2UB 5FDLA 1GXTA 2HBRB 3PX6A 2YKQA 3WIUA 2GVZB 1JLFA 1FFGB 4E0DA 4FBTA 1R3NA 3M8WA 1XR6A 2F3JA 3PCOB 1DY3A 2XMVA 2YQ0A 2Z4PA 2HHPA 4J7CA 3IWXA 1ZM4A 5G4DA 1S0MA 2FHKA 2J0XA 2BJ9A 1X0PA 4Z37A 2CZ9A 3S8SA 4JI8F 4ZLJA 2LEBA 4NE9C 4EZ9A 1A9NB 2HGMA 1Q86T 3FC9A 2DPIA 1P1LA 4CO2A 3ADAC 3N6LA 3EICA 2MPUA 4X4VA 2BW7A 4EO6A 4MAKA 2F4VF 2RDJA 4RW8B 1FVSA 4OQJA 4O3QA 1S1WA 3OV7A 4X4RA 2HNZA 3TA0A 3MI7X 3WX4A 3LUYA 1Z2LA 1ITPA 4RW6A 2VFTA 1FE0A 3M1VB 1LWFB 1DQAA 1FJGJ 3EM1A 3GIIA 4IG0B 3HFKA 3B78A 4PPDA 2CNNB 2H1YA 2IVYA 5L1JA 4K50A 3BQ0A 1N48A 3IM8A 3HX9A 4I6YA 2GVZA 4LSZB 1QDUB 3DLEA 3FEZA 1VQLS 3WDOA 2C2NA 2DKOB 4I56A 2IFXA 3KLGB 3OHBA 2DRDA 5AJ3J 4LF5F 6FD1A 4NXNJ 3TUJC 4PYDA 1K0TA 2VU5A 4QIEA 5IC6B 2C3PA 3AD9C 1G4CA 2BE9B 3G71S 2DY1A 1D0EA 4A47A 4P2SA 4V19X 2H5EA 1TL7A 4N47A 1NK6A 1E6YA 2MZJA 3MMAA 2HEKA 1NSKL 4RW8A 4J5OA 2WB1D 1HNVA 1NDPA 4DSJA 3MPYA 1SQEA 2V5HG 2HFVA 5L9NA 2W9BA 3OFFA 2XMWA 3M1VA 4B02A 2CVEA 1YGYA 1QTNB 4USTA 3IG1B 5KG0A 5A0YA 3FFIB 3UCZP 4JUZA 4V1Ak 2PSZA 1RGVA 4N76A 5J2MB 2GO9A 3MMBB 2ROEA 5HROB 2DR8A 2KXNB 3E51A 4RNMA 4ID8A 4TY9A 3MAHA 4K4WA 4I0WA 4NXMF 1NJYA 1K0VA 1IWGA 3M4XA 1NM2A 1X9MA 2ZUAA 4ES2A 1XJWB 3CC7S 3KLFA 2ZVSA 2DGTA 2XNQA 5HMYA 3A3NB 4DV1J 2L9NA 1DARA 3DU6A 2AZ1A 4KHPJ 4DPXA 2C3MA 2HQCA 2MZ1A 2B3TB 4ZPWR 3QT8A 4DR5F 2MXYA 1C4AA 3QRRA 1Y5LB 2JLEA 2CG8A 4G1PA 2JRSA 1NMEB 4Q2LA 1IKVA 1FXDA 5EGYA 3ENQA 4K7QA 3TAPA 4CH0S 2F63A 3MF5A 3Q24A 2F8HA 4C0BA 4DSEA 3P3DA 3IG1A 5F0UA 1XMOJ 2VBYA 4YB7A 2ABYA 3BDEA 4QIWD 1BC6A 3Q86A 5LL6d 4H4MB 2DNYA 2V2ZA 3D68A 3OSNA 5J2MA 3EWGA 2CJYB 2K3IA 2DJWA 2WSFC 2ZZMA 3K7RA 2RS2A 1YWXA 2AX1A 2B8QA 4DJBA 1SL0A 2C2RA 3M2VB 1XNRF 3AFGA 3KWMA 3MR6A 5HQLA 3CCRS 3ZNUA 2B7BB 3HHLA 4O44B 4ZP7A 4AQYF 4AL6A 4KAIA 1KNZA 4WIQA 1VQKS 1H38A 4TLQA 1JIHA 2UZAA 4I2PA 2DGXA 3VQSA 1OYDA 1S6OA 2VOPA 4MTPA 2Z56B 2WBMA 4USUA 5B0FA 3V5RA 5J1EB 4C8MA 1QSLA 4QW9A 1YK9A 4JI7F 5IT9U 1O6XA 1NAQA 4P6QA 3ZZRA 5F9LA 1QY7A 4OZLA 4HHUA 3JTNA 1DURA 4A8KA 4K2XA 1HIYA 2BE7D 1C1BB 4G65A 3G6YA 1S5ZA 4I4BA 3I0RA 1FWLA 3CIMA 4ZITA 3RRGA 2HKEA 1TL1A 2AX0A 4TYBA 4BCAA 5KFSA 2HBZB 4FYYB 1WF0A 1AUSL 5I3UB 2ZOFA 3N6MA 2XCAA 1NEEA 2XBPA 4W92B 2KVQE 1TKXB 3F0NA 3M2VA 2HFUA 3G2XA 4P73A 1LW0B 2CQCA 2KYXA 3UE2A 4ZVOB 2BQRA 1PJ5A 2IAJA 5DDQC 4O44A 3W62A 3K5MA 1Y11A 2CUYA 3PZPA 4JI2J 4ZVRB 2P9CA 2QO3A 3UD3P 2R9LA 5L38A 2MGZB 1W26A 2FJAB 2BXJA 2UVUA 4Y2CA 1YJVA 4NXNF 5HBMB 5IT9Y 3I9ZA 2MHEA 1VQOS 4DSKA 1SKUB 4NA2A 1KEKA 2DH9A 3L7PA 2MEWA 2WZ1A 4CLLA 1QLNA 1Y0HA 3KK3A 1KBRA 3ZTSA 2HFOA 1VQNS 4DQRA 1WC1A 1WC5A 3NGDA 3HO1A 4NLSA 1RKIA 3IAS9 2KZMA 2YNFA 4M94A 1U7LA 2W9CA 5B08A 1AZSB 2LA4A 2OPPB 4J90A 4ZVPB 4IOBA 1T9TA 1HBUB 1SC4B 1ZM2A 5KOWA 1WELA 2ZHBA 4LVNP 4DUTA 2VKZG 4B3OA 4MYTA 2BJDA 1R43A 2B9YA 4FYXB 4IFYA 4I6AA 4LF1A 3JYTA 2DD8S 3J7AN 2RKIB 4MIWA 2CPXA 3RBZA 1T9VA 4C8KA 4LSNB 1FEHA 2CPFA 4B08A 2V2KA 1T05B 1KHVA 4DPOA 2DCLA 2J6TA 1FJEB 2KXHA 4U7UD 4BWJA 1Y3JA 1S7IA 2IRUA 1JJHA 2QIFA 1HW8A 1RDRA 4FN5A 4ZVFA 1CJKA 1CSJA 3SBMA 3PEJA 5F8GA 1MNEA 3N79A 1D1UA 2WSEC 1BLUA 4OYPA 4IQMA 4W4MA 1D09B 3ENAA 3AXKA 4RBVA 3BB5A 4MKVA 1HYSB 3UQSA 3DDNA 1AZSA 2ZEJA 3IFEA 2R8GA 4NLVA 1L3KA 2OD6A 1UPMB 4OZ5A 2DTJA 3OR2A 3W61A 3TJAA 2W24A 4YN3B 2DR7A 3MURP 2DGSA 3MM5A 3CEDA 3UO0A 3ZO7A 4ZK7M 2RKIA 1HWUA 5CCLA 1K9MT 1CULA 2XS2A 2IA6A 2MTLA 3ZTQA 4DR4J 1MMLA 3AH6A 4KKOA 2BM1A 1PC4A 2J5AA 3P6YC 4E2FB 1UVIA 3DRRB 3TOQA 4WZMA 3AODA 5DO2A 3U1MA 4GVLA 4MKYA 1SI9A 2VQFJ 1JXLA 1KHWA 2DGVA 4DV6J 4LF9F 2H51B 4WP3A 4F3OA 2EFQA 2IBKA 2R8IA 4JI6F 2Y8YA 5KFAA 1N36J 2MZTA 3VVUA 4MFBA 2ZKTA 3FUYA 2VC0A 2ASDA 2MKCA 1HYSA 3LOUA 3POTB 4IRKA 4EBEA 4MJKA 1MWZA 1DLOB 3E2EA 2ZNZA 2E44A 5KFNA 2C2KB 2YX1A 2MKSA 1YZ6A 5E41A 5CYQB 5B0AA 2UXCF 3KYLA 1VK3A 3QO9B 2HQGA 2ZOMA 5DJBA 2KHCA 5MAOA 3V81B 1HR0F 2D3ZA 2AKWB 2DO0A 2D69A 4L6V3 2MB0B 4AXJA 1R8BA 2AMCB 3ZTPA 3K0JA 1IQZA 1YSJA 2JFKA 3T1YJ 4N77A 2ATCB 3ONQA 1KLNA 3D6MB 3E01B 5E7OB 1JNZB 1PKUA 1RWWB 4B9LA 4H4KC 3TX8A 3Q89A 4I1TA 2KFNA 2H65B 5F3ZA 5KT3A 2DNLA 3SDEB 1QAJA 1U49A 3F73A 4DV7F 5K8NA 3JQKA 4C3KA 1Z2ZA 4QJVA 4QU7A 3NCPA 4E98A 2PI5A 3KLEB 1ZH5A 3D1HA 2ILZA 4DXLA 2L3MA 4C8OA 2A6OA 2Q6BA 1DLOA 2CQHA 3GFHA 5L46A 4F0KA 2KYZA 3TJ8A 2Y3YA 1Q0NA 3ILLA 2BX6A 2O67A 4HI2A 5CYQA 4B3SF 2VG5B 1VOMA 3JTOA 3VGUA 2DYAA 1X4DA 3QO9A 2RUGA 5F8JA 3V81A 4IDKB 5IM0B 4IR9A 4ED4A 2Q66A 3NOGA 2RU3A 4CLTA 2XSJA 2RRBA 3TW0A 1RWPB 5BXIA 3J7YI 5D77A 3L4BC 4C9DA 3BO2A 2AEJA 3NCQA 1R8CA 4C0OC 1D8YA 4RUAA 4TLRA 2YKOA 2RVJA 3OL9A 1RQ0A 5H9EJ 3M8QB 3BGOP 3PFEA 4C98A 4USVA 3KDOA 5AE2A 3TVZA 2PO4A 1UWBB 1B64A 4FBUA 3KLEA 4O3SA 4XIUA 1VCTA 1EETB 2CDQA 5HMXA 2ASYA 4OLPA 1TMMA 2M52A 1YX2A 5K5MA 5RUBA 4ECSA 5KFGA 1N33J 5CCMA 3T5LA 5F0WA 5BJRA 1GXUA 2AWZA 4NX9A 3TAQA 2B5JA 5FLXU 2VDHA 1QAIA 4X66F 1KN6A 1RABB 2BZ2A 1QVFR 4F50A 2QT7A 2G2ZA 5JXSA 2VG5A 1LK7A 4WXWA 2JVRA 3PW4A 3EGVA 3GWCA 3FZ2A 2W2MP 4OZNA 1JWWA 4DV2F 3CCLS 1RZMA 1TVRB 2Z2ZA 5DLFA 3IRXB 3D6FB 5IS2A 2I1RA 1S4EA 4H4OA 3D4JA 3BM7A 5HP1B 3CCZA 6AT1B 3HVRA 3QAUA 4HTIA 1HNXJ 4Y00A 5DG8A 4USJC 1T11A 4ZPDA 1RWXB 3CDEA 5GMKa 4USIA 1TUWA 1T03A 4GO5X 2BKNA 4IG3B 2FVQA 3G4SS 4OX8A 3PNIA 1XBWA 4Y2KA 4OYXA 4UY8T 1Q7LB 4Q2MA 2HGNA 2F4FA 3SYZA 3AOAA 1UWBA 1C0UB 2ADBA 2LQ5A 3W2VA 4M5KA 5FLXY 1EETA 2J9DA 2BJEA 2BUNA 2RHSB 4GKJJ 2BJ3A 2FC9A 3CO9A 2IMWP 4EFAC 4EU0A 3GV8B 2MKYA 3MM6A 1KQGB 1N56A 1N5YB 3CJKA 4ZLNA 3KXDA 4DV5F 1S6QA 4KV8A 5ITHA 3BEGB 2R2TA 3CSKA 2QE5A 5D4NA 1IKWB 1FHTA 4XPEA 3BGRB 4OJHA 2HWIA 4FF3A 4DV4F 3BR9A 3ZZTA 1LFPA 3FVYA 4IH5A 1TAQA 1U4BA 2G0CA 4F0HA 1TVRA 3TUPA 2J9DE 1BD6A 1FRHA 1MSWD 2UUTA 4ILRA 2GIRA 3LP2A 3MR2A 5D0GA 1WEYA 4HT7A 1HNZJ 5KG2A 3IM9A 2LU2A 2KJWA 3CDBA 2AJ1A 1PBUA 1WSRA 3FCHA 1JLAA 3T1HF 2E5LF 2V6AA 4KHMA 3KG1A 2LQ8A 1FESA 2B56A 3MEDB 2AJFE 4F4WA 3K2YA 2VL1A 4U7CA 4IKAA 3MHYA 4RU2A 3VAKA 3ILIA 4QWDA 5KFOA 3EGZA 1UZHA 2NQPA 3FCVA 1H2VZ 2QX0A 2QLFB 3R1LA 2HK3A 1Y10A 3P4UB 4NI2B 1Q95G 3FKBA 1PYOB 1UEVA 2CJAA 5IQ6A 3TWZA 4L3KA 3G96A 2NXJA 3K5OA 4Y3CA 4YFUA 2C3OA 1UW9A 2D9OA 4DZ6A 5ETVA 5LJ3Y 2E7WA 1RYRA 2UVWA 2LDYA 1W2IA 3NGSA 1SXLA 4USWA 2BE2A 1V9OA 1F9HA 2CA9A 3QQCD 1VDHA 1HNIB 2IVFB 3S6EA 3V6DB 3ETOA 1S97A 1VQMS 2OPRB 5LT5A 4HH1A 1OY8A 3BBCA 3FMBA 2VPYB 4GKKJ 4OYOA 3GFYA 2YKAA 4RL1A 3VZIA 4X4NA 1Q79A 3OR1B 2YXLA 5HSPA 3WC0A 4YB1P 3V6JA 4OI0A 2B0GA 2QSFA 3LWLA 4RBTA 4O3RA 5KT6A 4JYAF 2CFXA 3CDUA 3M30B 8AT1B 3UPFA 5LMUF 1YBAA 4IUFA 1D9DA 3RU0A 3HSJA 3KNGA 1X5PA 3OL7A 3EVOA 2VBWA 1S0VA 1IBMJ 1LNQA 1P9QC 3UVJA 1S9EB 2LDIA 2CDRB 5IC4B 5K14A 4K0KJ 5ETMA 3HVWA 4L73A 3T3FA 1T9YA 2R7SA 4KH1B 3NXZA 2BW2A 4M5DA 2XC9A 2IYGA 1Q5VA 3TUIC 2OIHA 3J81U 2F7VA 1IBCB 3IWNC 1X31C 1HKAA 4DL2A 2JWNA 1U45A 4HL9A 3TAMB 3MMJA 5F9NA 1VBYA 3GSDA 2EFNA 1HNIA 4LF7J 8RUCA 3V6DA 3GILA 1UFWA 4G6VB 1VIXA 4D3HA 2RT3A 3QT6A 2XG8A 2WVDA 4ATNA 3NWRA 3CD7A 4AXIA 2M70A 2JL9A 3DI6B 2ZZNA 2QLXA 4Y6IA 2XTJP 5C25A 3TUZC 1IR1A 4LF4F 2KB2A 1X0FA 2Q1LA 2WW4A 1HHQA 4OJGA 1C4CA 1R8PA 3JSYA 1SB6A 4PXBA 2VD3A 4HEA9 1WEZA 2HW3A 3J81Y 3W5ZA 3CJ3A 4O4RA 2QTWA 4B3TF 2IJFA 2SXLA 4X62F 1TFWA 2RQ4A 3PRVA 3RR8A 1LWEA 2VZ9A 2HQ3A 2RQKA 3EXYA 2OEJA 3J7YU 4DR2F 3NNAA 3TQ1A 3ITHB 1HBNA 3ZFVA 2WVFA 4ZKAA 4K4UA 5DM6Q 2QN6B 1OWXA 7AT1B 2J9CA 3DM2B 3AJ1A 1RXOB 2MZRA 3CD0A 5CABA 3K5NA 2L41A 3W9HA 3GB0A 5CD4H 1U1KA 1NB2A 3GLJA 1EP4A 4ZOSA 3F41A 2LCWA 5B0DA 2EK1A 4RR5A 2ZH9A 4ZVEA 3K5PA 1LOUA 1PAEX 1FTRA 2ZD1A 1WI8A 4DUZF 1KOOA 4CLYA 3MECB 5F8LA 4R5PB 2M4MA 4X4SA 2GFFA 5E3PA 1LXNA 3DMJB 3SQGB 5KFLA 3L95X 4K4SA 1WD6A 3QSIA 1F5CA 2LXIA 4OZ0A 2XCPA 1G1XA 1TL4A 2R7WA 1KKHA 4WFXA 4K4TA 3N5BA 1XNQJ 5DRKA 1DTTB 1JQGA 1Q5YA 4PG7A 2ZH5A 3BR8A 2CJKA 1A0OB 5I3QA 4A8FA 2BEFA 1YQHA 1LWCA 1S1VA 2VBZA 2EFOA 2LECA 3U7JA 4PG6A 2HAFA 4ZPBA 2K1RA 5LSRA 2V2QA 1HBMB 3DM2A 5LSOA 3JXOA 1YBTA 5DG7A 1VYAA 4RPFA 3OFGA 2F40A 3BGFA 3W7BA 4DPUA 4C3LA 2G9OA 3HJFA 3BKTA 2ZITA 1ZTWA 4M5GA 3H90A 3SI8A 3E3XA 4N7TA 1Y5IB 2WOMA 2GQCA 3D0IE 4WYLA 1KRPA 5I3PA 3KG0A 2ZWPA 1P9YA 3SQGA 4ZJOA 4DFJA 3I87A 3T5JA 1IVZA 1JJCB 2FJEB 1BWEA 1YI2S 4M8LA 4RUBA 2Y1RI 4X64F 2NPIA 3ENVA 2K3KA 3CPWR 5HANA 1BY9A 1UL3A 4LSLB 1TUVA 2OMLA 4LFCF 5GAEI 3H5YA 3G6XA 1YJNS 4R25A 1M90T 2QYGA 2A1BA 3PG9A 3B4MA 2ZWOA 2AJ0A 3IBCB 1HBMA 1RT2B 5ETSA 1RBOB 3GIRA 4JI3J 1FRLA 2RQMA 2UUAJ 3GIKA 5HLFB 4DHVA 4KPCA 3OTEA 4YY3J 3GU0A 1X4BA 4O4GB 3K89A 2GX8A 2IY5B 3CJ5A 4B3MJ 2I5JB 2VG7B 2DEJA 4N41A 2WVEA 4YB6A 1NUEA 4C0HA 3DDKA 2MQLA 1ROFA 2JFDA 2XSFA 2PI4A 2UU9J 5IV4A 2NS1B 3PFOA 2LMIA 5A2QU 1EHWA 2HFNA 3QJLA 3SCJE 3PW7A 2FIUA 4B9UA 1VQSA 2B6AB 5KFEA 1WHVA 4LSLA 2CPHA 1RT5B 2R2UA 3MAQA 1MN9A 2VOOA 2JEGA 3A8IA 4HHJA 4RNFA 2BKOA 2W8LA 5F8NA 5M2RA 3X3UA 1E6VB 2BBEA 1RT2A 2EPIA 5G0RB 4LF2A 5L1LA 2MLYA 2GO8A 2JJ4D 2KM8C 3H2VE 4ZMMA 4AE5A 1S1XB 2HFZA 4DS5A 1WORA 1HPZA 2HHHJ 2B9EA 2X51A 1TR0A 4O4GA 5F8HA 2DNQA 4KO0B 2I5JA 5A2QY 5KFWA 1OIAA 4LF8J 2DHSA 3CCVS 2XY7A 1TL3B 1UVMA 4ED8A 2HFSA 1O5JA 3OQ2A 4J9SA 3UDCA 4TN2A 3MPUB 2RNEA 1J5OB 3WC2A 1TL5A 1TQLA 3V4IA 4DSLA 4DX5A 3ZZ0A 2WK4A 4NLGA 2HNYA 2CNLB 2QC3A 3PHTA 2FHMA 1UVNA 4U8VA 3K17A 4C8NA 2XB2D 2XI3A 1E6VA 4N56A 2BMBA 2IM3A 5G0RA 2CADA 4HKQA 4ZVSB 2ZBRA 1QJHA 1YIJS 1RHMB 3CJ8A 4DG1A 3BN7A 4Y0FA 2F8EX 4O23A 3EPIA 1RP5A 4LVOP 4AUKA 5GAHI 3X1LB 3HHKA 3L9ZA 4KO0A 4WBFA 5I42B 2DBBA 3R5GA 4OHZA 2ZE2A 3TVYA 2FUG9 4ER8A 4CO5A 4ID5A 3W2WB 1BQMA 3C14B 1IWAA 2XMMA 2LQJA 1KONA 1VMBA 4JI5J 3KLIA 2O1PA 1XMQF 2ZBQA 2YY3A 5K20B 2BABA 4DL5A 2FHOB 2XMJA 2XY5A 2NPFA 3RR7A 3C6TB 4OI4A 3FBEA 4EI2A 1TFYA 2ROPA 2FVCA 2QSWA 3UN3A 4C97A 1RT6B 4CM2A 3EZUA 2Z58B 1VJQA 3H40A 3QIDA 1Y00A 1W2BR 3QLHB 4OI2A 4F25A 1T8EA 2KM8B 4I67A 2Z2MA 2VFVA 4Z2XA 4LFBF 1JLEA 2HHWA 4TKTA 4F4YA 2OH2A 4LJMA 3A1YG 3VWSA 1NXIA 3DLJA 2JHEA 1DBDA 1C0TA 4IO1A 1X4EA 3EUNA 1RCXB 1IBLF 1R0AA 3RZAA 2OI2A 2LEAA 2GNKA 3ZTOA 1RHQB 3NWGA 2XMAA 1S77D 3R27A 1SCJB 3HSDA 4OYMA 4WE1B 5LMNJ 1CJVB 2B4PA 2MZQA 4DCOB 1ACMB 1GT8A 3LH2S 4F2RA 3KK1B 4RWWA 1RWOB 4O3PA 4DFKA 1JLBA 2CWXA 3G8QA 3FGVA 4RZRA 4XTTA 4F4AA 4A8QA 2BKPA 4IH7A 3KHLA 3JTPA 2DITA 3M6VA 1K1SA 1M5KC 4ZIWA 5L9XA 1UW4A 3HSGA 5T41A 1RT6A 4DUYF 5DDRC 4JI4J 4ZJQA 2AGPA 1PSDA 2Z8QA 2DRAA 3QLHA 3C6UB 1N5QA 4JI1F 1MWQA 4ELTA 3VGVA 4UT4A 5LXYA 5C42B 5JVGQ 1IKXB 1HQUB 3TQEA 2HVHA 2YKNA 4DU7A 3KMSA 5HI7A 2I38A 1NSAA 3EE3A 3Q8SB 1IUJA 4ZN3A 1F1BB 2RJZA 4CT8A 3QT5A 2VG6B 4ZVGA 5BR8F 2YNHB 2FJDB 1U48A 2OAUA 3M32B 2GMHA 2ZFHA 1X9WA 4PUOA 3GG0A 3IS9B 1S0OA 1CJVA 4I7FB 4ZCLA 4DR6J 2H9ZA 5HL7Q 3LP0B 4ANCA 3GIJA 1S1UB 1WDTA 4NRUA 2IC3B 3M8ZA 2XY6A 1TAUA 3PACA 5A8RB 2E66A 1NPPA 3WX8A 5GAEU 3UNGC 2V8HA 5I4MA 3TJ9A 2HWHA 1RTJB 2MY8A 1F3FA 5C5JA 1KSPA 1YRUA 3LPEA 3JSBA 3RAMA 4HH0A 2WB4A 1APSA 6FDRA 3C6UA 3PXGa 3A8JA 1ZOTA 1T7PA 4Z7CA 3F56A 3FEXB 5C42A 3J7A1 3EJMA 5A6PA 4CO3A 1H7XA 3DRXA 1FK9B 4ZPVR 2ACMA 1MMNA 3BN4A 4J9VA 3QFWA 1AT1B 1NKCA 2KDOA 2E7VA 2HVEA 3RJMB 2VA3A 3NS6A 2R7QA 1IKYB 3KJNB 2RRNA 3QT7A 4IFVB 2AYBA 4WIIA 4UOGA 4ZCKA 4G3IA 2MJUA 3CJRA 3KJVA 2GJFA 4DOZA 5L8RC 4DZDA 1S1UA 5LSLA 3AJ2A 1N5SA 1Y4ZB 4Q43A 1WWHA 3CJTA 3W66A 3RRHA 5A8RA 4FYDA 3ZC4A 2E1RA 2HHTA 3CVKA 3DGPB 3KLHB 1HWIA 1P1TA 3NBPB 1MLAA 2UUCJ 2M8DB 2I8EA 3TO8A 5IZHA 2V8DA 1RTJA 3C2PA 4K8RA 4RWXA 3Q8UA 1S72S 3DHXA 4ZA1A 2PMWA 3O44A 3HT0A 5B0GA 2QLWA 3VALA 1F2GA 3KJQB 1IBKJ 3TNVA 4UUWA 2C22A 2P6TA 5U47A 2UVVA 1NRKA 1WTBA 3H5UA 2N3LA 5KTQA 1SC6A 2CQPA 4WXOA 4DCJB 1HMVA 2DNGA 4M5NA 1WG4A 4QIVA 4C8LA 3SV4A 1YJTA 3VZHA 4DR1F 1IKYA 1NJIT 1KLMB 4ECZA 4U9RA 4IFVA 3Q8YA 3C16B 1RBLA 3CULA 4UTGA 1HBOB 3GQCA 1HHTP 2BJ8A 1N32F 2QLBB 1KQFB 2F65A 1NU4A 5EHHA 2ZH8A 2WCXA 3LA0A 9ATCB 4JI8J 1PYSB 2HMIB 4R8UB 4AT1B 1M1HA 3LGHA 4M5HA 3NBPA 3TZWA 2F4VJ 1S48A 3C19A 3HD2A 2OPQB 3VTIA 3NS5A 1RT3A 4W90B 5H9FJ 1B7YB 2VA2A 2E29A 4L75A 2GHWA 4NLPA 1RWKB 3SCIE 2VQEF 3HHLD 3I0SA 2N7CA 2HS3A 2RF2B 2R42A 5HK4A 5KFDA 1RADB 3NP5A 1U26A 3QWPA 2B4UA 3I5CA 1V5VA 1S6PA 5GAHU 2VJVA 1RAGB 1RJJA 4DCPB 1DZ5A 1QE1A 1SH0A 4G1QB 4BC9A 2D3OR 1GH8A 4ECTA 3F44A 4TY8A 1KLMA 3DN9A 3RGIA 3IGNA 3MCNA 4LF5J 3C16A 3D0HE 3O2IA 5HQMA 1HBOA 3HLUA 2BQ3A 3OTDA 3UR0A 1HQEB 4BBYA 2PN6A 3GFXA 3MMCB 4BHQA 2GIQA 3JSMB 1LXJA 1J2VA 2C2OB 2X1FA 1R7IA 1Q7YT 2IHR1 1UTAA 3MOJB 5K8MA 3T19A 2R7XA 1V3SA 2AJ4A 4J9UE 4CTAB 3O6QA 5J2PB 5AXLA 4DV3F 2OPQA 1DTQA 1FKPB 3H98A 4R0JA 1VQPS 2YQ3A 1OPIA 1ZPVA 3QATA 3DKDA 3KK2B 5J1NA 4DR3F 4MYUA 2GVDA 3HCXA 2PFDA 1SPBP 4KGXB 3KTQA 3BSCA 4P72A 1D3WA 3QJPA 4DV0F 1OMSA 4NWBA 1I94F 3R2CJ 4MT1A 2B8PA 5DETA 1AROP 1NJWA 4LT6A 5E5NA 3B4DA 2DISA 2O66A 1WOOA 1FNXH 4L3NA 1RT7A 1T94A 4OZ1A 1YBUA 4ZDNA 1D8ZA 4Y65A 1D9FA 1Y9OA 5FIIA 3AQOA 3PY8A 2XHWA 1CVJA 4NXMJ 4YOEA 1RE1B 5FDLB 3MMCA 3QGHA 2KL8A 5SUHA 2X7IA 2R8HA 1WG5A 5EWEA 4QQBA 3KHHA 3CC2S 4DL4A 2EVZA 1RTIA 2ZH3A 1IR0A 3MEKA 3DYAB 3DRSA 2FLOA 2EKNA 1JNRB 2JEJA 2Z2YB 3GJSB 3MM9B 4DR5J 1FKPA 3N0VA 1S9GB 4J9MA 1FF2A 1DQ9A 2E1CA 4Y2MA 4LBHA 4DN0A 3LF0A 1YDLA 1S1WB 3R3TA 2MMYA 4OX9F 4ED5A 1Q4RA 2R7RA 4DX7A 3HHNB 1HARA 4Y34A 2MSSA 2XM3A 4OHXA 2AEFA 2M5YA 2UP1A 2M9KA 3ZZPA 1TV6B 4GC6A 3OSPA 5L39A 2DRBA 5EUHA 3PJXA 2QV6A 2AQ4A 2ZH6A 1XNRJ 4WP8A 4DLEA 3K57A 3DLEB 3V4MA 1JX4A 3T6JA 2HNDB 1D9AA 1SUQB 4AQYJ 3HFZB 2OHDA 1VRUB 2MKKA 3DYAA 4ECXA 3MM9A 2DXEA 1FD2A 3Q8QB 4FVMA 1Y5NB 1S9GA 2DNNA 4A8OA 1BMQB 4J91A 2UXDF 4PG5A 2FJVA 4KY3A 2AGQA 1F2HA 2CNKB 3HVTB 3FQKA 1UA0A 1VFJA 4ED7A 4JI7J 1HNWF 3HHLC 1TL7B 3MXHP 1JJ2R 1E6YB 4DR7F 3MMAB 5KT4A 2G13A 3AQPA 1HNVB 1RWVB 2PC6A 5J2QB 4QBUA 1L5UA 1KTQA 3JAMU 3PR5B 1HD0A 2QMUB 1S1TB 1CQNA 2W9BB 1A7GE 3G8TA 2V4QA 2KI2A 2OTLS 2NXEA 1BQNA 2FPHX 1UJ6A 4OIXA 1TV6A 4PWDB 2H48B 4UZBA 1YZ7A 1Q78A 5A0YB 2J76E 2IRYA 3VQTA 4J9QA 1KDNA 3VAHA 2HNDA 1VBXA 4X4OA 2I0XA 1SUQA 3D1OA 4UOHA 3CCQS 2BYCA 4M5MA 3OL8A 4EBDA 1VRUA 3MUTP 2LLZA 2ZJRQ 1ULRA 2HVDA 1OYEA 1RUSA 3N28A 2E9RX 1Y7PA 4U95A 4OLOA 5E3RA 1NKEA 3KLFB 5A8WB 3BH7B 1QD1A 4RBUA 3HVTA 3FSYA 3JAMY 4IYQA 2UUBF 1SH2A 3H59A 2Y0BB 3TI0A 4DSIA 5KFXA 3KHGA 3LO3A 1FJCA 1FD8A 1HI1A 4Q0BB 2RAQA 4UOFA 3D5MA 5J2QA 4M5IA 2VC1A 2KFYA 1L3TA 1KP6A 1IKVB 2XGQA 1S1TA 1MW7A 1WG1A 4OMFG 3TZXA 2FHJD 1VS3A 4FVCA 4F4KA 5KT7A 4EYHB 1SJ3P 4PWDA 1VBKA 5A6WA 3Q8RB 5KFUA 4ICLA 3PTWA 1S10A 1SJRA 4OYAA 4C48A 4JB8B 5JMNA 1UCNA 3W9IA 2XS7A 2BOAA 4XPCA 3DC2A 3M05A 2O3DA 2Z2LA 2AEMA 4QCLA 3WBZA 3BQ1A 3P96A 4TU8A 4DPTA 4DFPA 5A8WA 3HHLB 2R7UA 3CT9A 5DDPC 1M5VC 3Q83A 1IJFB 1RTHB 1REGX 2HRUA 2ZM6F 5LOQA 1H73A 4I2PB 4WU2A 4Q0BA 4B17A 3NAHA 3M8SA 2BJ7A 2FGCA 2AU0A 2ZH2A 2EK6A 4ECVA 3EDRB 3M9NB 1RWNB 1YVFA 3QRQA 2IM1A 3QZ7A 5CAAA 3H5XA 4PYAA 3MUMP 3RTVA 5D8HB 4JI0F 2YKMA 2MQ8A 1VC5A 2E5IA 1S59A 5KG4A 4RUCA 3FJ2A 4OYWA 2CKWA 1NKBA 3EPGA 1X4HA 2GW8A 3ZZYA 2MYFA 3I0RB 3OD2A 5KG6A 2DNHA 1F0XA 4PKDB 4LQ9A 1TL1B 3HF5A 4MK7A 1ICEB 1XN9A 1CJUA 4J37A 4PWWA 1JLCA 1FJ7A 4IO9Q 2B9XA 2OFHX 4LR7A 3CJSA 5B0EA 1U2RA 2W7OA 3G82B 3RUBL 1NHUA 4WJBA 1EIYB 1FRJA 1WC6A 1R8HA 4YR2A 5AXMA 2MHNA 3GSIA 2IAJB 4F36A 2NSBA 4DS4A 1RTHA 4P10A 1U1LA 4LF9J 2CQ3A 2OD4A 1PJ6A 2YX7A 2POKA 1AYEA 1WUUA 3MM8A 3LW5C 4ECWA 5KFRA 4JI6J 2PIIA 4UOCA 3MPDA 1U1OA 1G2EA 3AB4B 2BVZA 1BWVA 2NXCA 3KLVA 4ZP9A 1FE4A 1X4GA 4FYWB 3B6BA 3R97A 4O3NA 3MR5A 3ETMA 2NSCA 3UD4P 3KK3B 4FKYA 3QSYB 3L7OA 5CA5A 2K8GA 2FZKB 5KFHA 2UXCJ 4WK1A 2YNFB 2FVPA 4B3RF 1Q8IA 2NLWA 2W9CB 2DXDA 1WNEA 5AXNA 1HR0J 3OLAA 3ZZOA 5T7LA 4K4VA 1KVKA 1SH3A 2X1BA 4N8NA 3PYDA 1SV5B 2BANA 4B3OB 4P74A 2AJ2A 3G82A 3TEGA 3UWTA 3I32A 2JDJA 2C2EA 4IFYB 1FA0A 4FXDA 2BRLA 4AL5A 2ASJA 4H54A 3JYTB 2P5VA 2A18A 2EFGA 1AFIA 4URSA 1JJ4A 5ETRA 5EN1A 4OI3A 3B54A 2BJ1A 3LANA 3PX4A 4DV7J 4CO4A 1ZAVA 3IWLA 3KG4A 1WOSA 1BUXA 1RISA 1U6BA 2FLNA 3HK2A 1VRQC 4TU9A 3QBCA 3HT3A 3CCTA 1S12A 3PO5A 2WSCC 2V0NA 1YRTA 4KT0C 1CJKB 4Q5VA 2CPZA 3M2RA 5B09A 1NCLA 2E7XA 1S4FA 3DNCA 2LXUA 3BO3A 2EEYA 4B3SJ 1V5IB 1B70B 1X5OA 3R5AA 2V4JA 1TUGB 2OFGX 2IBOA 4HDHA 3OR2B 1SV5A 3R5DA 2DNPA 4I2QA 1T3NA 4B9MA 3MM5B 4CLUA 2AJQA 2CQ4A 2APOA 4RLEA 4YR3A 4JBCA 3ILJA 2V94A 3TYTA 2AF6A 2JX2A 2V8PA 5EX0A 3MCSA 4HT5A 1CULB 2FY1A 1R27B 2AYEA 3CCSS 4F4XA 4YHHF 1WF2A 4KKOB 5DS7A 2BM0A 1V3RA 4ANEA 3OJSA 4F26A 3J7Z5 4CI0B 2CRLA 2OSQA 3QIPA 2KT3A 5LXRA 3RG6A 2X1AA 2HBYB 4S0MA 2IYIA 4ILLA 5GADI 2PEHA 4A4JA 3H4BA 3PM9A 4ECYA 3FBFA 1R0CB 2QL7B 3NEKA 4K2JA 1CBKA 4DPWA 4KGMA 2QLJB 4LFAF 4FZVA 4X66J 4OHWA 3OLBA 5C2CA 3IO1A 3MEGA 3U27A 3ZTRA 1U1NA 4MFBB 5CD4A 4DLGA 2E1MC 4USHA 3OVAA 4DV2J 3R7BB 3ZXWA 4M95A 4JOUA 3L7UA 4GO7X 4RX6A 3NMAA 2O01C 3PIPQ 1FVQA 2Q43A 1P27B 1KWMA 1U09A 1F6TA 1DFDA 2HHQA 3GV5B 1FNMA 3K59A 2EC2A 4Q8FA 4LUBA 4G1IA 2YWGA 4J9RA 1LKZA 1YJ7A 2QFIA 3MZIA 5DQGA 1NK0A 4EO8A 5DLGA 4DEZA 2AD9A 1PAUB 5AT1B 1M1GA 4WFNQ 5HAOA 2DHAA 3DOKA 3CGIA 2J6UA 2FY8A 3SZ2A 2B51A 3QWUA 1PC5A 1GMVA 3BSNA 2HIYA 2NXUA 2NCKL 4DV5J 1KOHA 2HQDA 3ILOA 1RT1A 3OTCA 2FVRA 1WKKA 2OJ3A 1TTHB 5A8KA 1YJRA 3BV8A 3QGIA 1TKZA 1HHSA 1U0HA 3A8EA 2FLLA 1JLGB 1X4FA 1MROB 4YDDB 4KB7A 4I6WA 4DV4J 2WTFA 2XZWA 5KG7A 3W8GA 2DIUA 3BSAA 2LKZA 2ZH7A 1GK8A 1GMWA 2AZ3A 1N0UA 3FBCA 2YNGB 3PHEA 1ZM9A 3OL6A 1SJ4P 3WIVA 3UR3C 4WK3A 3T1HJ 3N01A 2DHHA 2E5LJ 1V6HA 1SIZA 1PG5B 2YNIA 4WF9Q 4X4QA 3PW0A 3T9ZA 1FKAF 2XSJB 1ELOA 5CYMB 3DOMB 1RHRB 3A12A 3IR7B 2HZVA 2HURA 3UD5A 4D3GA 4DU8A 4HACB 4DSFA 1JLQB 2KFZA 1AW0A 3LP1A 3GFZA 4UQGA 2RIJA 2J7KA 1Z1ZA 5HQ8A 2XLJA 2FHJA 2HS0A 2RD5C 3MAAB 3G9CA 5J2NA 1KVJA 2KRRA 1U47A 2R2RA 1YTYA 3C15B 4CLKA 2XWYA 1CC8A 1JLGA 3GR0A 4IRCA 5EX3A 1MROA 2F1FA 4PQUA 1U6ZA 1NBEB 1ZA2B 3IR5B 3GTYX 3NG8A 1M5OC 3W5XA 4QW8A 3FCWA 4F2SA 3KJFB 3H5SA 2WW8A 4NA3A 1JK9B 2YNGA 2B5JB 1NPKA 2B7CB 2B9WA 1RAJA 2XYGB 3VAJA 1K44A 2JNJA 3EMTA 2FYXA 4ES3A 3CD6S 3V6HA 4JV1A 1CPZA 1REVB 2QA2A 4JV5F 3CD5A 3HHDA 2VIHA 1Q8BA 9RUBA 3NKYA 2C2ZB 4OJ3A 1N8RT 5CYMA 3DOMA 4X4TA 4USMA 4H4OB 4RW7B 3I5AA 1EARA 2UV8A 4HACA 1JLQA 3TA2A 4YB5A 1WC3A 2NUUG 1UVLA 4JYAJ 3D7SB 2P2CB 2YVSA 1T03B 1XR5A 5LMUJ 3A8KA 1CEZA 3MAAA 1NDKA 3C66A 3W9JA 3C15A 1H72C 2VDIA 5JJBA 3MFIA 2BQUA 2DH8A 3I55S 2W01A 4X4UA 1NSQA 3W2VB 1UP1A 1LQ9A 3W64A 4M63A 4NMXA 2X3GA 2DR5A 4QYZJ 1ZM3A 3MM6B 1KQSR 1UKUA 3CJKB 1VGYA 1S6QB 4KV8B 2LYVA 4KPYA 3K8VA 2HZAA 3OXLA 1N34F 4UQTA 1F9FA 2CVIA 2V67A 1WHWA 3Q8PB 2R8KA 4CLZA 2RDDA 3R9LA 5H9EK 2YWKA 3BSOA 3MEEB 2V34A 1RB0A 2WVBA 4Y28C 3OTOF 3OBIA 2VICA 2CJQA 4DDFA 4X65F 1REVA 3SSQA 2ALYB 2GV1A 1FTCA 2FTRA 1CJTA 2XYPB 3Q23A 3I5BA 4FNHA 3BBBA 3LP2B 4RW7A 4ZVQB 4WFAQ 2CPEA 4NCGA 1K47A 1RU2A 1JLAB 1VR6A 4LF4J 4C4WA 4NZ6A 2NR0A 2OLWA 3OUYA 4PG4A 1UAWA 3I6PA 3U1NA 3NNHA 5ETOA 1TU0B 5E3QA 3H4DA 1AFJA 3W3SA 2EC0A 4R0EA 4EK2A 4B3TJ 3D28A 1XK8A 2CQ0A 3A13A 1YJWS 2D41A 4X62J 1O8BA 1U2FA 4ETXA 3R2DJ 2V68A 2BRKA 5IWAF 2KT2A 3C3LA 5SZTA 2XLKA 2AYGA 2UXBF 3R5CA 3FDSA 4DR2J 3GIMA 4CYUA 5HJYA 1RAIB 3MEEA 3B82A 4J9NA 2IPOB 4A46A 4ZN1A 2N3OA 4CO0A 1GEHA 2J0WA 4MK9A 3BPDA 2B43A 2BE2B 1OSCA 1W7WA 4C11A 3RBXA 2ZVIA 7FD1A 4DUZJ 2VFUA 1TMJA 4NZ0A 2JZ5A 5GADU 1WDDA 1B0PA 5M2PA 2N4CA 4LREA 3CE8A 2OTJS 1IQTA 1I51B 1FERA 1UPPA 4NASA 5IXUA 2DHXA 5E2QA 1RBAA 3US5A 1YJ9S 4KTQA 2IM0A 4A8YA 4WTOB 5KFVA 2ZZTA 5IT4A 3UVJB 2H5IB 2V8GA 2CJXB 1KQKA 5FJ4A 1UFKA 2LFVA 5K14B 3OVBA 1FNOA 3UN2A 4M5DB 5KFYA 3JSRA 5C24B 2AW0A 4PWUA 2VODA 3PKYA 4DQQA 1I1GA 3W65A 2XHCA 4F67A 2GGPB 4ZPCA 1VHFA 4RU9A 3AXMA 3VF0B 1HD1A 3EXCX 1ZAXA 4CH7A 1LWFA 4OHYA 4P9SA 4IG0A 5CHCB 2LQBA 2K7KA 4WKYA 2HGLA 2HWTA 5T14A 4J9OA 3IAM9 3CNQP 3D3CJ 2J8AA 4X64J 2FJBB 1DQ8A 5C25B 3W8PA 4EMDA 1TK8A 1U2CA 2A2CA 4P2XA 3HM9A 2J6SA 2CPJA 2D1CA 4L72B 2EI5A 4A48A 4LFCJ 3KLGA 4LRCA 2ZKUA 4QWBA 3HXMA 3RB0A 1J5EF 1HWJA 3PYFA 3PJ9A 2IA0A 4IRDA 2W9AA 5F8IA 3R5JB 4Y2IA 3SFUA 2ZC3A 3QRPA 4PXEA 1LWEB 2QMWA 1GMUA 1B3TA 2OSRA 4KIAA 5KFCA 5C24A 3P5TL 1I6JA 2DK2A 3L09A 5DDOC 3BGUA 4XAKA 2QGFB 2GGPA 2CAJA 5HVGA 1HBNB 1WKJA 4AYBD 4ZCIA 2FJWA 3C8YA 2YX4A 1IJEB 4FXWA 5D0RA 4ZCMA 3M8PB 4EGLA 1EP4B 1H2TZ 3SFGA 1U1PA 2RHQB 3EDQB 3FFIA 1UJ5A 2L9DA 3HI9A 1LV5A 3BF4A 2ZD1B 3FNNA 2HG4A 3D6HB 5A76A 2XMTA 2PMZD 3BPSP 1KFSA 2OKQA 3MMBA 5IQQA 5HROA 2EWHA 2PFFB 1SKWA 5IOLA 1FCAA 2Y8WA 5KFZA 1VQ5S 2XEXA 4BWMA 5B7WA 4TNOA 5D0HA 1PGZA 1UVKA 5LJ5Y 4LBPA 1LWCB 5HVFA 1S1VB 4C3MA 1LK5A 1XTZA 3UNYA 4BS2A 3AD7C 3D6TB 1DJ0A 2COLA 5DZ6A 3C46A 2K1RB 2Y1IA 4ITSA 3M8RA 1GX6A 3R6GB 3AB2B 1P8GA 2JLGA 2Z57B 4QIGA 1VBZA 2IJRA 2NZ4A 3M8PA 3HZEA 1F3VA 3DFEA 3FSXA 2V4RA 2W8KA 2EG1A 1WHXA 4E8UA 2XQCA 2B4OA 1UWAA 4I64A 2PT0A 2ZC4A 1AUDA 4H4MA 2WOMB 3ZNJ1 1RHUB 4BLGA 2ZJQQ 1FEEA 1FJGF 2PD1A 2O5DA 2XGPA 2GC8A 4P75A 1VLYA 3PX0A 3OFEA 4EUVA 1J27A 1LFWA 1Y3KA 1FX4A 1N4LA 4HTJA 3S7RA 3NGRA 1X7VA 5AJ3F 5AE1A 2U2FA 1RLCL 2JOQA 3M2UB 1WC0A 2OMOA 2PDAA 4OZ3A 1TKDA 2LVWA 4YDXA 1RI7A 1CQMA 2EW9A 3PR4A 5J1EA 4MH8A 4CP5A 1NB7A 2BACA 4B9SA 2HQFA 4O0IA 1WSVA 1VJWA 2YWEA 3H0PA 1U1MA 1RAOA 2CZ4A 1C1BA 1XMQJ 1S7HA 2IJNA 4TQSA 4QIFA 1PBAA 2D7SA 5KFFA 2FZGB 3ULHA 5I3UA 4Q44A 3CO0P 3V2UC 1IXKA 4FF2A 2VONA 1TKXA 1XQIA 1X9SA 1NK7A 2JVOA 2K2PA 3MWBA 1BE4A 1MWYA 1LW0A 1EKSA 5K9FA 3QGGA 5KG1A 3MFHA 2W4DA 5EWGA 2PEBA 4LFBJ 1VIOA 1UMJA 2MGZA 1KC8T 3CDAA 2VFSA 5HBMA 3QMQA 4UW2A 3M2UA 2VH7A 2M8HA 4P7VA 2HHVA 3MTJA 1IBLJ 1NJZA 2QJ3A 4FNIA 3LAKA 2P9GA 1PYTA 1KD1T 2RU9A 1UJ4A 3N6NA 4DV1F 1X4CA 2CQIA 3BKUA 4KHPF 4CQ1A 3Q22A 1SBRA 4MKBA 1HPZB 5D3GB 2FD2A 1NJXA 3GJRB 2N4DA 2MZSA 3BO4A 4KC5A 3P49B 1U8SA 3EGWB 3DGVA 5KT5A 5DQIA 2GA7A 4ECQA 5FD1A 2RILA 3A3OB 1T9UA 3TP2A 3CJ0A 2OPPA 4W98A 4F8RA 1QM9A 1N0VC 2DGOA 1HW9A 1HBUA 4J9LA 1B0VA 5KG5A 2MDAA 3I4HX 2IRXA 1XMOF 1KTVA 1JXVA 2OPSB 4ECUA 4EZ6A 2KKHA 3VGSA 4DUYJ 1ZBTA 2HRYA 3DRYA 3GCXP 3HKWA 4KR0B 2DGUA 2V9WA 1PJ7A 3V4IB 4QWAA 4JI1J 3JS9A 3NGTA 5BYQA 5L1KA 2C42A 2HNYB 1U02A 2GQ2A 3IN5A 5IT0A 4LSNA 4DL7A 2RS8A 4NL5A 5GMEA 4K5RA 4IR1A 1F5AA 5D4PA 1T05A 2JH3A 3I31A 5KFQA 3QPIA 4ZLLA 5BR8J 3GONA 3VAMA 1CC7A 1GTHA 2M2BA 3GJTB 1JXEA 4LBIA 4EEYA 4DG1B 3UDLA 5D3GA 4M5JA 3HMJG 2E1PA 3AAWB 5D15A 1LWXA 4A8SA 3AJDA 4PRFA 2OEKA 3AOCA 4KYZA 3HVAA 1S6UA 3NOCA 4KGKA 4A8MP 1AA1B 2ZE2B 3D3BJ 2PA8D 1ZTTA 4ID5B 3D67A 1BQMB 4IQXA 1S9FA 1BGXT 4MMOA 2OPSA 2ZJPQ 1XIQA 4BC7A 1SJFA 1VC0A 3KLIB 2NYIA 2HQIA 4ZJLA 3BZQA 1Q8LA 3PIOQ 1QSSA 3MUVP 2QL9B 3H20A 3CCES 1TK0A 2MJNA 1VLOA 2YKPA 1XWLA 2HSEB 1URRA 1NK5A 2Q79A 4P2FA 3D54A 2Q3PA 4Q8EA 4ED3A 5KFTA 3DRRA 4YR0A 2XYHB 1VI7A 1H74A 2RRAA 2XZTB 3UCGA 4JI2F 1JLEB 3CCMS 3OFHA 1RU1A 1FRKA 3GE9A 2W2OP 3H2LA 1FT8A 3SCLE 1C0TB 5CQGA 1MN7A 4TYAA 3ICLA 2VKRA 2QL5B 3BYPA 2FDNA 1IN0A 4DQSA 1R0AB 3WQPA 2CPYA 3POTA 4UY85 4Z7YA 1RCOB 2E9TA 2OGUA 3T6BA 4WU3A 4U6PA 2VPZB 3AA9A 2U1AA 1R8AA 4Y2AA 3K5LA 1AXQA 3P45B 1U0SA 4Q45A 3LPYA 3LGMA 3FQLA 3S1TA 1JLBB 1AB8A 2KTQA 5ETPA 1T3OA 3FRZA 3M6WA 1U25A 2DY9A 1FRXA 1V3ZA 1WKLA 2MKJA 3QNWB 1RK8A 1U1QA 4GMKA 4C8YA 1EB0A 2LA6A 2EFPA 4F0MA 4IH6A 3HJVA 3E01A 4QWEA 4P7TA 4ZLPA 1SKRA 1WTFA 4OYBA 2X3DA 5HMZA 4DR1J 1NHVA 2X1GA 3SDEA 4WPAA 1NK8A 1NO8A 2YKNB 3LAMA 3IC1A 4J9KA 4LMZA 4BDPA 1S49A 2MQQA 1N32J 3D9BA 1I3OB 5C2GA 1C1CB 1IM6A 1CLFA 2D9PA 1YKWA 3M7VA 3N4WA 2HVIA 3IMQJ 1FX2A 2WVCA 3EVMA 2IDLA 4LR9A 4PUOB 4ZVHA 3OXFA 4KSEB 2I6WA 2LEPA 2L48A 1S99A 3P5BP 3UCUP 3S01A 4FXVA 3JQJA 4F02A 3VR1A 1IR2A 3SQOP 3EX7B 2XI2A 3FMWA 1QUPA 3DLLQ 1Z4UA 4HR2A 4IDKA 2VFRA 2JLFA 1FXRA 5IM0A 2VQEJ 1N6QB 1RYSA 2DO4A 4WTYA 4I68A 4QPXA 1RTDB 1P6TA 3D0GE 1VC6A 3G6ES 5ETNA 3OXGA 4K4ZA 1NNDA 3LALA 5B0CA 4KGZB 2WAQD 4OYZA 3DXSX 3FBBA 3H8YA 3MM7B 1WF1A 3OTBA 1BHNA 2Y1LB 4OX6A 3NGUA 2GHVC 1UEKA 1MG7A 2VASA 1A6LA 3M8QA 3IBWA 1B0TA 3HZGA 2W25A 4FDFA 3PRBA 2YBVA 2A10A 3UW1A 4DR4F 4CT9A 3GYNA 3THVA 2YPZA 1IM4A 3DCAA 2A0FB 2DNKA 1K1QA 4HLBA 3VAGA 1C1CA 4NRTA 2VQFF 4CNYA 3RB3A 2MQNA 3I4PA 3AT1B 1EAYC 4QPTA 3BDPA 4CZCA 3RBEA 3BKFA 4FPIA 4ZP8A 3I9V9 1N52B 3NLCA 4DV6F 3OJUA 2NXNA 4WFZA 3KJVB 5JVHQ 2NZCA 4FPRA 2CQ1A 4DV3J 4RO0A 2L08A 3I56S 1N36F 1OSDA 4ZPAA 2FZCB 1ZPWX 4DR3J 2YWFA 1N6QA 2RSQA 1N5TA 3M6UA 3SSSA 3W63A 3IRXA 3GCWP 1RTDA 4DV0J 2H3EB 3GMGA 3VAFA 1M0SA 5HP1A 1WJ9A 2M3DA 3GG1A 5IV3A 1I94J 2PE8A 2AGOA 2HRTA 3VAIA 1VQ7S 3TEHB 3R1HA 1WEXA 2KG1A 4DL0C 4FF1A 2VV5A 3MM7A 3CJ4A 3SMZA 1URNA 2VJUA 4H4KA 3WZ0A 4WP9A 4IG3A 2V2VA 3NY0A 1WACA 3T1YF 4CLWA 3L3CA 4EWTA 3ELHA 1OY9A 4DBQA 4PEOA 4OL8A 1C0UA 3O3LA 2DNRA 1HMVB 4WFBQ 1HI0P 2ZDOA 1FKOB 2ZHOA 5B0BA 1N5YA 3OVSA 1Q8KA 2KH9A 3BREA 2QA4S 2CQBA 4ZP6A 3OT9A 2YWWA 2XLIA 4KFBB 1IKWA 2HPUA 3UDEA 3BGRA 1H98A 2G2OA 4NLDA 2KO1A 4RKUC 1NZAA 5DQHA 1VK8A 2DNZA 3IA0A 2ZBPA 4OX7A 2G0JA 2DH7A 3AOBA 4OI6A 1WHYA 2PA3A 3CJ2A 4A8XA 5ETKA 3G8SA 1RAFB 1H2UX 3OHAA 2GJIA 3RW7A 1UVJA 4NLQA 1RT3B 2E1AA 5DG9A 4OX9J 3BGLA 1C2PA 2HVZA 2QRRA 1VRTB 3PW2A 3MEDA 1VHIA 2ZOGA 3O1LA 1SC1B 3CCUS 3I0SB 2HS4A 4RW4B 2C3YA 1Q1KA 1ZYQA 4ENOA 4CWBA 3IRWP 4KQZA 4NEZA 1PO6A 2VF3A 1S6PB 1X4AA 4RUHA 4KGVB 2KT5A 1NLKL 2W2NP 3DDIA 4X4PA 1FKOA 1QE1B 2E5JA 3HFVA 1NK4A 1VQ6S 1CS4B 3ENWA 4TY8B 4NI2A 4OV1A 4C6AA 1PIEA 1FFSB 2AHOB 2GIFA 4KFBA 4CLSA 2C28A 1M1KT 1Q53A 2HHSA 1QSYA 3H25A 3SEOA 2W7AA 3G6VA 4WZQA 3UN5A 1ZS6A 2UXDJ 1S0NA 1EZZB 2ILYA 2J8SA 1QAXA 1N54B 3GPAA 2OUGA 1N33F 1FDNA 4MIBA 1HNWJ 2DEIA 1CG2A 4CM0A 3TANA 1OJ4A 1SL1A 3M9OB 5KFJA 4ED2A 4DR7J 2MSTA 2FB0A 2AT1B 1DTQB 2F8MA 3EYZA 5GAGI 1RHKB 2Z0GA 4N5SA 1VRTA 2OPRA 2GVDB 2IMOA 2PGCA 4K4XA 1EQ0A 2W2PP 2IDEA 3D66A 1TKTB 4RW4A 2C1EB 3J81j 1KS2A 2Y1JA 2RMLA 2HAIA 3OR1A 1M5HA 1SJQA 1NPRA 4DF8A 1HNXF 4F04B 2JSXA 4FP9A 3A3PB 4V19J 4RW9B 3AD8C 3HKZD 2HYIB 3RB4A 1CS4A 3M30A 3RW6A 1RT7B 4OHVA 3PVXA 2N7YA 5H9FK 1NK9A 3DLKB 3DOLB 3CXCR 2JC0A 1S9EA 3LQVA 1ZETA 3D1QA 4LQ3A 4GKJF 2DGQA 1UA1A 3GR1A 1XMBA 4KH0B 1RTIB 5D78A 1YRXA 2HBQB 4ED1A 2UUBJ 2XWXA 5E33A 3D2WA 1SKSA 4F7VA 2J0QD 4NEYA 1OS5A 1UEUA 3Q2SC 3K8WA 3TAMA 3DRSB 2WHOA 3CWJA 3KUEA 2ACYA 4ECRA 2Y0SD 4MKAA 3ET6B 4LF6J 2LQ9A 3ISND 2FVSA 1TKTA 3NGKA 5HATA 4TQRA 5BYRA 3RRKA 4FYVB 4PQAA 4O3OA 4DN9A 1S79A 1HNZF 3DI6A 1RWMB 2BV3A 3MDFA 1Q82T 4DL3A 4RW9A 2ATLA 1HL6A 1TZ0A 2G1HA 1FDAA 3QFHA 1EX8A 4HVZA 3VHQA 5IFMA 1NH7A 3FZBA 3MCOA 3CW2C 4TU7A 3RYLA 1VQ8S 3DLKA 3DOLA 3R8YA 3GP9A 2WONB 3MR7A 3EZOA 1F60B 1UETA 2ZH1A 2A3JA 4M5LA 1VQ9S 4LRBA 2KU7A 1VISA 2C2MB 2W1BA 2ZHAA 4CIOA 4DL6A 2DCUB 2F9DA 4NPOA 4NLXA 4DF4A 4CO1A 4DFMA 2CQGA 3MTKA 4WCEQ 4F4ZA 1TK5A 2ZM6J 4X84A 3SCKE 3AY0A 4AL7A 1YLXA 3ITHA 4NCAA 5E3AA 5GMDA 3E8OA 2BDPA 3ET6A 1OPZA 2KG0A 3RBDA 4I69A 3AA8A 4JI0J 1KVIA 4XO0A 1HFEL 1S57A 1TP7A 3THTA 2DB1A 2YWHA 1NDCA 3CF5Q 1F5BA 2G4BA 3MECA 4R5PA 2GMJA 3CUNA 1SQGA 2P8IA 1QTMA 4U96A 3DMJA 1JMTA 3FRYA 5THWA 2MQPA 4GKKF 1BQNB 2DNMA 1WC4A 2VHGA 4XDCA 4WYWA 2WONA 4YS2A 4JP8A 1PCAA 4ZVTB 4DX8H 4ANDA 1DTTA 1HQ2A 3U1LA 2MLZA 3MPVA 2MQOA 1S76D 2ALZA 3Q8VA 4MIAA 2V69A 2CWKA 3VCDA 3GZ7A 4QOTA 1IBMF 4QR0A 1SC3B 4F3MA 1T0TV 2WBRA 1L3UA 2OP5A 4K0KF 2F9JA 5MLCV 4TXSA 5J1PA 1H0HB 2IIHA 3PV8A 1OY6A 2J9EA 2W4CA 3KFWX 1OQ3A 2EKYA 4YUDA 2MY7A 4CLFA 4LF7F 4LIRA 4B3RJ 4QR2A 3SV3A 5HN0A 4FKXA 4B9TA 4RNNA 3ZZZA 2DHGA 4YMEA 3BQ2A 4AD6A 2QYCA 5D6GA 5ETLA 3KNAA 4GRSA 3A4TA 3PKMA 2F5GA 4ICLB 4KBIA 1WI6A 3CMES 4WWSA 4DX6A 3M6XA 1GQEA 1FDDA 1RSCA 4MK8A 3MGJA 1GMWD 4NCBA 2BA9A 2CIMA 5KT2A 3Q2TC 2ZBCA 3R7NB 2PMHA 2KRBA 4YQWA 2KZZA 4X2BA 2DIVA 5DGAA 2XO6A 1N88A 2EXUA 2K7JA 2OO4A 5EDWA 4NLYA 3ISNC 2Y9HA 5HLFA 4OZ2A 3T9NA 4OI1A 3R5BA 2VPWB 1OQ6A 2V8VA 1RTZA 2VG7A 2DPJA 2DGWA 3M9MB 2ERRA 4CH1A 1T02A 2ZUGA 4LF6F 1N5VA 3T41A 3CJQA 2V9KA 2YKMB 2QA4G 1G6BA 2R4FA 3DLGB 1XC9A 4PPZA 4PR6A 2A2DA 4DPYA 1UZDA 2H4WB 4P71A 2GMLA 3PW5A 1X5TA 4LRAA 4OFZA 4IOAQ 2NYHA 2B6AA 3KUHA 3VV2B 1CJUB 5L1IA 1JLCB 1RHJB 2VPXB 1RT5A 5HMWA 2ZH4A 2G2YA 3KUGA 4KJIA 3QAEA 4YHHJ 4FS1A 2VB6A 1SJ1A 2N82B 4DI6A 1SIWB 4ZIVA 3HULA 2E5HA 3QYYA 2LP4A 3BYRA 2DR9A 2XO7A 2VBXA 2LXFA 1QVGR 1EQMA 5GAGU 1MMDA 1XNQF 4KRWA 3TZZA 4XK8C 3I82A 3O5TB 2NREA 4NLTA 5DGBA 2FGOA 2QG9B 3IR6B 2KN4A 1S1XA 2FC8A 2G0IA 3W1YC 4ERDA 4URGA 1GX5A 2L9WA 2XZDB 1NSPA 4RJVA 2Q6CA 2GAHC 3P8BB 3PEHA 1SVDA 3MM8B 4LFAJ 3I96A 2HHUA 3DXBA 4C2MA 2QFJA 2HK2A 3MD3A 4U67Q 1U24A 1GAOA 5F3TA 4ELVA 1RAHB 3RAXA 3N9UC 4ELUA 2JEFA 5K8OA 1I5OB 4YP3A 1KFDA 4P2MA 1TL3A 3DLHA 4ZS6A 3TARA 3DLGA 4XDDA 1F9EB 3PJWA 2E5GA 3T5HA 4IOCQ 1FI4A 2GS8A 5ETQA 5CZVA 1J5OA 2KHDA 2CJ9A 2KJVA 5AE3A 1GFWB 5EWFA 1U8WA 4AFFA 3BS9A 4A8WA 3W60A 2CPIA 5T7LB 1PILA 4NYZA 1B4SA 4CNZA 4CCHA 3PO4A 3CCJS 1M5PC 2BANB 2J7UA 2FQQB 3QZ8A 2ZDPA 3UI3A 3N5FA 5KFBA 1FRIA 2YH1A 4HYKA 1JB0C 5LM7E 1R6VA 2WRMA 4JV0A 4ETZA 1KR4A 2OEMA 3TR5A 4FF4A 1HLWA 5K8PA 3DHWC 1Q16B 3PYGA 4ILMA 2K06A 3FEYB 2C3UA 1FWPA 1BXNA 4PABA 2DNOA 3NMRA 2MLXA 4K5SA 1X60A 5I42A 5HVHA 4UF4A 5D4OA 4JI3F 4KE5A 3GV7B 2UUAF 1DAXA 3W2WA 2XMKA 2GZOA 5CH7B 3OW2R 3NNCA 1O51A 4PZVA 3C14A 2CJBA 5E3CA 3M2RB 5KFMA 4YY3F 3WHIA 1Q81T 5ETTA 2AIRB 2QA1A 3BH6B 1GTEA 4TVAB 3H7HB 4B3MF 1VQYA 1RWUA 2V4JB 2LU1A 3C6TA 2UU9F 1EJ7L 3MCMA 1ZA1B 4NLRA 1X5SA 4I2QB 3THPA 1XR7A 1RA7A 1ZZFA 5DM7Q 4ZPTR 3NL0A 5HO4A 5H1SV 3LWMA 1NDLA 2OELA 1FFWB 1VQ4S 1HA1A 3RAQA 4CDIA 1RLDA 4USKA 1U1RA 3QJJA 4NMLA 1RACB 2JEIA 3B8HA 1FWKA 3QIPB 1BQXA 1L3VA 2NUHA 3IXQA 4UUXA 1HWKA 3GYXB 4WE1A 3DU5A 2AYMA 3AHPA 2ZBIA 5JUMA 2HHHF 4OV6A 2BOPA 2R7OA 3BBFA 3KK1A 3KKFA 1OO0B 2R8JA 1FRMA 2YQ1A 3MEGB 2H5JB 4RNHA 4F3QA 2CPDA 4LF8F 4ZVUB 4JV5J 4NYOA 4K59A 3JQMA 3CC4S 1B99A 3KDNA 3MD1A 1R6YA 4PG8A 3G87A 3EVWA 1K8AT 2CQ2A 3EZ5A 1SQFA 4NZ7A 3M8YA 3RB6A 3T5KA 2UUWA 4U8YA 1LW2B 1IKXA 1HQUA 1NH8A 1W25A 3K58A 2GJ2A 5KFIA 3DRPB 3SXLA 4CRJA 2R7VA 1TELA 3DOKB 1RAAB 4U7UK 2VG6A 1G3OA 1WOPA 4O0NA 2A6MA 2YNHA 5C7PA 3O8WA 1RA6A 3M32A 2HLTA 1RT1B 4DQIA 2QMXA 1LEOA 1N34J 3IS9A 2XULA 1R0BG 3TRGA 4I7FA 5A8KB 3LP0A 2JC1A 1TKZB 1U0HB 2I9SA 2IC3A 2HZCA 4NOHA 3FSIA 3OTOJ 2G1DA 1HI8A 3HSZA 2J7WA 4X65J 4B9VA 3G86A 2HLUA 1YJUA 1XEZA 3NCRA 2RH3A 1GXLA 4OZJA 4PXDA 4JI5F 1NZ8A 2GQQA 2RE1A 5KAKA 2RQCA 2J0SD 2GAGC 1NHKL 5GVQA 2ADCA 3GJQB 2D74B 4NLWA 2D3UA 3MR3A 2YNIB 5AXKA 1LW2A 1G7CB 2Z30B 3LGNA 2BR0A 5ADZA 2CZVC 1FK9A 3DRPA 2QZ8A 2H4YB 2MKHA 1RT4B 5CZXA 3TZYA 3CMAS 2FJXA 4DMZA 2YTCA 4DQPA 3LP1B 2ASLA 3HP6A 4OYIA 3CIZA 5IWAJ 4QYRA 2HHXA 4LIWA 1H7WA 3MPWA 5J2NB 2UXBJ 3R7SB 2UV8G 3HHEA 1RAEB 3TVKA 3IP0A 1X8DA 2EFVA 4ES1A 1GNKA 1EKRA 4URQU 4GVBB 3TA1A 4PQUB 3HPOA 1R89A 3HDSA 2XMUA 4C8ZA 1QUVA 5D4LA 4PCQA 2CG4A 3DGPA 3KLHA 5LMNF 4RNOA 2W2QP 1RKJA 3Q0AA 1H6KX 1U6FA 1ZAWA 2ZNYA 8ATCB 3DLBA 3VGTA 2YPYA 4QWCA 2P6SA 3W5YA 3TX0A 4NLUA 4ZHRB 2B4VA 3CDWA 1UFLA 1SL2A 1FDBA 1R31A 1QAYA 3OPKA 1YITS 3J7ZT 1FXLA 2DXFA 2MQMA 3UDVA 5CXTA 1H3DA 1T9XA 3ISZA 4LRDA 3CB4A 2ROGA 2M0GB 2D3O1 2EBGA 4LR8A 2W4PA 2E9ZA 1JKHB 3PRDA 2XNRA 2DT9A 2AP6A 1RT4A 4JI4F 1XERA 1T95A 3IBFB 2KXFA 2V50A 2YH0A 4HDGA 5F8MA 4KHRA 3PYEA 1M5SA 1MU2B 4NYPA 3J80U 4HI1A 1HWLA 2FLPA 3QGPA 2I2YA 4B9NA 4PAAA 4GVBA 3R6LB 2VUGA 1DHMA 2GCFA 2IVMA 2HMIA 4CLPA 4R8UA 2P9EA 2M88A 2R2SA 4ED6A 5KG3A 4GC7A 3SSRA 4DR6F 2DVIA 1L3SA 2XS5A 4FS2A 3NRBA 4JV2A 2AV5A 4ZHRA 3CMQA 1FO1A 4QR1A 2RDIA 4WFYA 2RF2A 1CJTB 3PDNA 4ALZA 3EGNA 1ZZNA 5KFPA 4P52A 3U02A 1JKHA 4WKRA 3J80Y 2MKIA 4Q7AA 2M7SA 4NCGB 4EYIB 2H54B 4G1QA 1DRZA 1YHQS 4NLOA 5BYSA 3MOZA 3CCWA 3OUYB 5E0OA 1MU2A 2R3VA 3VVTA 3LTOA 4LRFA 3NS7B 4K4YA 3V6KA 5HJXA 3KMQA 1J5EJ 1HQEA 5KOXA 4ED0A 3UFCX 3HD1A 2CQDA 3JSMA 2CYYA 4DWIA 4M1KA 3ZZUA 1JLFB 2R7TA 2RUSA 3T1AA 2CXEA 4HHHA 3GYGA 4NA1A 4N8OA 2HIQA 3BJYA 1K73T 3CTRA 4CTAA 5F41A 5J2PA
chains in the Genus database with same CATH topology
2BMBA 3QBCA 1CBKA 2QX0A 4M5MA 1RTZA 1G4CA 4M5IA 4M5NA 1DY3A 5ETLA 4M5GA 1HKAA 1F9HA 1Q0NA 3KUGA 3ILLA 3UD5A 4CYUB 5ETKA 3IP0A 1HQ2A 4PZVA 4M5HA 4F7VA 1TMMA 4M5JA 4CWBA 1EQ0A 5ETMA 1RU1A 1TMJA 2F65A 4M5KA 5ETVA 1IM6A 3ILIA 3HCXA 5ETSA 1RB0A 3HSZA 2CG8A 4CYUA 3HSJA 5ETQA 3UDVA 4CRJA 3HD2A 5ETOA 3ILJA 4M5LA 3KUHA 5ETTA 1EX8A 1KBRA 1RAOA 3KUEA 3HT0A 3HSGA 3ILOA 1EQMA 3MCMA 5ETPA 5ETNA 5ETRA 3HD1A 3UDEA 3MCOA 1RU2A 2F63A 3HSDA 4AD6A 3MCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMB A;  3QBC A;  1CBK A;  2QX0 A;  4M5M A;  1RTZ A;  1G4C A;  4M5I A;  4M5N A;  1DY3 A;  5ETL A;  4M5G A;  1HKA A;  1F9H A;  1Q0N A;  3KUG A;  3ILL A;  3UD5 A;  4CYU B;  5ETK A;  3IP0 A;  1HQ2 A;  4PZV A;  4M5H A;  4F7V A;  1TMM A;  4M5J A;  4CWB A;  1EQ0 A;  5ETM A;  1RU1 A;  1TMJ A;  2F65 A;  4M5K A;  5ETV A;  1IM6 A;  3ILI A;  3HCX A;  5ETS A;  1RB0 A;  3HSZ A;  2CG8 A;  4CYU A;  3HSJ A;  5ETQ A;  3UDV A;  4CRJ A;  3HD2 A;  5ETO A;  3ILJ A;  4M5L A;  3KUH A;  5ETT A;  1EX8 A;  1KBR A;  1RAO A;  3KUE A;  3HT0 A;  3HSG A;  3ILO A;  1EQM A;  3MCM A;  5ETP A;  5ETN A;  5ETR A;  3HD1 A;  3UDE A;  3MCO A;  1RU2 A;  2F63 A;  3HSD A;  4AD6 A;  3MCN A; 
#chains in the Genus database with same CATH topology
 4PXC A;  2RB7 A;  5D0E A;  4CYU B;  3IGV A;  5M2U A;  3KK2 A;  3NAI A;  3SIP B;  2IM2 A;  3KOA A;  1O0P A;  5DZ7 A;  2W7P A;  1B7F A;  2EG2 A;  4L76 A;  2UUC F;  3JB9 k;  4QYZ K;  1T9W A;  4L74 A;  3KHR A;  4OJ1 A;  4UZC A;  2HNZ B;  3H42 A;  3FK4 A;  4C11 B;  7FDR A;  2EBE A;  4J9P A;  4C7Q A;  4QZV B;  2UVR A;  2C2D A;  4RW6 B;  5CYJ A;  1IBK F;  2QEX S;  2V63 A;  5KFK A;  2GHP A;  2DR6 A;  4EBC A;  4YEA A;  1YG0 A;  2CNO B;  4QU6 A;  2KVI A;  3H2U B;  5FDL A;  1GXT A;  2HBR B;  3PX6 A;  2YKQ A;  3WIU A;  2GVZ B;  1JLF A;  1FFG B;  4E0D A;  4FBT A;  1R3N A;  3M8W A;  1XR6 A;  2F3J A;  3PCO B;  1DY3 A;  2XMV A;  2YQ0 A;  2Z4P A;  2HHP A;  4J7C A;  3IWX A;  1ZM4 A;  5G4D A;  1S0M A;  2FHK A;  2J0X A;  2BJ9 A;  1X0P A;  4Z37 A;  2CZ9 A;  3S8S A;  4JI8 F;  4ZLJ A;  2LEB A;  4NE9 C;  4EZ9 A;  1A9N B;  2HGM A;  1Q86 T;  3FC9 A;  2DPI A;  1P1L A;  4CO2 A;  3ADA C;  3N6L A;  3EIC A;  2MPU A;  4X4V A;  2BW7 A;  4EO6 A;  4MAK A;  2F4V F;  2RDJ A;  4RW8 B;  1FVS A;  4OQJ A;  4O3Q A;  1S1W A;  3OV7 A;  4X4R A;  2HNZ A;  3TA0 A;  3MI7 X;  3WX4 A;  3LUY A;  1Z2L A;  1ITP A;  4RW6 A;  2VFT A;  1FE0 A;  3M1V B;  1LWF B;  1DQA A;  1FJG J;  3EM1 A;  3GII A;  4IG0 B;  3HFK A;  3B78 A;  4PPD A;  2CNN B;  2H1Y A;  2IVY A;  5L1J A;  4K50 A;  3BQ0 A;  1N48 A;  3IM8 A;  3HX9 A;  4I6Y A;  2GVZ A;  4LSZ B;  1QDU B;  3DLE A;  3FEZ A;  1VQL S;  3WDO A;  2C2N A;  2DKO B;  4I56 A;  2IFX A;  3KLG B;  3OHB A;  2DRD A;  5AJ3 J;  4LF5 F;  6FD1 A;  4NXN J;  3TUJ C;  4PYD A;  1K0T A;  2VU5 A;  4QIE A;  5IC6 B;  2C3P A;  3AD9 C;  1G4C A;  2BE9 B;  3G71 S;  2DY1 A;  1D0E A;  4A47 A;  4P2S A;  4V19 X;  2H5E A;  1TL7 A;  4N47 A;  1NK6 A;  1E6Y A;  2MZJ A;  3MMA A;  2HEK A;  1NSK L;  4RW8 A;  4J5O A;  2WB1 D;  1HNV A;  1NDP A;  4DSJ A;  3MPY A;  1SQE A;  2V5H G;  2HFV A;  5L9N A;  2W9B A;  3OFF A;  2XMW A;  3M1V A;  4B02 A;  2CVE A;  1YGY A;  1QTN B;  4UST A;  3IG1 B;  5KG0 A;  5A0Y A;  3FFI B;  3UCZ P;  4JUZ A;  4V1A k;  2PSZ A;  1RGV A;  4N76 A;  5J2M B;  2GO9 A;  3MMB B;  2ROE A;  5HRO B;  2DR8 A;  2KXN B;  3E51 A;  4RNM A;  4ID8 A;  4TY9 A;  3MAH A;  4K4W A;  4I0W A;  4NXM F;  1NJY A;  1K0V A;  1IWG A;  3M4X A;  1NM2 A;  1X9M A;  2ZUA A;  4ES2 A;  1XJW B;  3CC7 S;  3KLF A;  2ZVS A;  2DGT A;  2XNQ A;  5HMY A;  3A3N B;  4DV1 J;  2L9N A;  1DAR A;  3DU6 A;  2AZ1 A;  4KHP J;  4DPX A;  2C3M A;  2HQC A;  2MZ1 A;  2B3T B;  4ZPW R;  3QT8 A;  4DR5 F;  2MXY A;  1C4A A;  3QRR A;  1Y5L B;  2JLE A;  2CG8 A;  4G1P A;  2JRS A;  1NME B;  4Q2L A;  1IKV A;  1FXD A;  5EGY A;  3ENQ A;  4K7Q A;  3TAP A;  4CH0 S;  2F63 A;  3MF5 A;  3Q24 A;  2F8H A;  4C0B A;  4DSE A;  3P3D A;  3IG1 A;  5F0U A;  1XMO J;  2VBY A;  4YB7 A;  2ABY A;  3BDE A;  4QIW D;  1BC6 A;  3Q86 A;  5LL6 d;  4H4M B;  2DNY A;  2V2Z A;  3D68 A;  3OSN A;  5J2M A;  3EWG A;  2CJY B;  2K3I A;  2DJW A;  2WSF C;  2ZZM A;  3K7R A;  2RS2 A;  1YWX A;  2AX1 A;  2B8Q A;  4DJB A;  1SL0 A;  2C2R A;  3M2V B;  1XNR F;  3AFG A;  3KWM A;  3MR6 A;  5HQL A;  3CCR S;  3ZNU A;  2B7B B;  3HHL A;  4O44 B;  4ZP7 A;  4AQY F;  4AL6 A;  4KAI A;  1KNZ A;  4WIQ A;  1VQK S;  1H38 A;  4TLQ A;  1JIH A;  2UZA A;  4I2P A;  2DGX A;  3VQS A;  1OYD A;  1S6O A;  2VOP A;  4MTP A;  2Z56 B;  2WBM A;  4USU A;  5B0F A;  3V5R A;  5J1E B;  4C8M A;  1QSL A;  4QW9 A;  1YK9 A;  4JI7 F;  5IT9 U;  1O6X A;  1NAQ A;  4P6Q A;  3ZZR A;  5F9L A;  1QY7 A;  4OZL A;  4HHU A;  3JTN A;  1DUR A;  4A8K A;  4K2X A;  1HIY A;  2BE7 D;  1C1B B;  4G65 A;  3G6Y A;  1S5Z A;  4I4B A;  3I0R A;  1FWL A;  3CIM A;  4ZIT A;  3RRG A;  2HKE A;  1TL1 A;  2AX0 A;  4TYB A;  4BCA A;  5KFS A;  2HBZ B;  4FYY B;  1WF0 A;  1AUS L;  5I3U B;  2ZOF A;  3N6M A;  2XCA A;  1NEE A;  2XBP A;  4W92 B;  2KVQ E;  1TKX B;  3F0N A;  3M2V A;  2HFU A;  3G2X A;  4P73 A;  1LW0 B;  2CQC A;  2KYX A;  3UE2 A;  4ZVO B;  2BQR A;  1PJ5 A;  2IAJ A;  5DDQ C;  4O44 A;  3W62 A;  3K5M A;  1Y11 A;  2CUY A;  3PZP A;  4JI2 J;  4ZVR B;  2P9C A;  2QO3 A;  3UD3 P;  2R9L A;  5L38 A;  2MGZ B;  1W26 A;  2FJA B;  2BXJ A;  2UVU A;  4Y2C A;  1YJV A;  4NXN F;  5HBM B;  5IT9 Y;  3I9Z A;  2MHE A;  1VQO S;  4DSK A;  1SKU B;  4NA2 A;  1KEK A;  2DH9 A;  3L7P A;  2MEW A;  2WZ1 A;  4CLL A;  1QLN A;  1Y0H A;  3KK3 A;  1KBR A;  3ZTS A;  2HFO A;  1VQN S;  4DQR A;  1WC1 A;  1WC5 A;  3NGD A;  3HO1 A;  4NLS A;  1RKI A;  3IAS 9;  2KZM A;  2YNF A;  4M94 A;  1U7L A;  2W9C A;  5B08 A;  1AZS B;  2LA4 A;  2OPP B;  4J90 A;  4ZVP B;  4IOB A;  1T9T A;  1HBU B;  1SC4 B;  1ZM2 A;  5KOW A;  1WEL A;  2ZHB A;  4LVN P;  4DUT A;  2VKZ G;  4B3O A;  4MYT A;  2BJD A;  1R43 A;  2B9Y A;  4FYX B;  4IFY A;  4I6A A;  4LF1 A;  3JYT A;  2DD8 S;  3J7A N;  2RKI B;  4MIW A;  2CPX A;  3RBZ A;  1T9V A;  4C8K A;  4LSN B;  1FEH A;  2CPF A;  4B08 A;  2V2K A;  1T05 B;  1KHV A;  4DPO A;  2DCL A;  2J6T A;  1FJE B;  2KXH A;  4U7U D;  4BWJ A;  1Y3J A;  1S7I A;  2IRU A;  1JJH A;  2QIF A;  1HW8 A;  1RDR A;  4FN5 A;  4ZVF A;  1CJK A;  1CSJ A;  3SBM A;  3PEJ A;  5F8G A;  1MNE A;  3N79 A;  1D1U A;  2WSE C;  1BLU A;  4OYP A;  4IQM A;  4W4M A;  1D09 B;  3ENA A;  3AXK A;  4RBV A;  3BB5 A;  4MKV A;  1HYS B;  3UQS A;  3DDN A;  1AZS A;  2ZEJ A;  3IFE A;  2R8G A;  4NLV A;  1L3K A;  2OD6 A;  1UPM B;  4OZ5 A;  2DTJ A;  3OR2 A;  3W61 A;  3TJA A;  2W24 A;  4YN3 B;  2DR7 A;  3MUR P;  2DGS A;  3MM5 A;  3CED A;  3UO0 A;  3ZO7 A;  4ZK7 M;  2RKI A;  1HWU A;  5CCL A;  1K9M T;  1CUL A;  2XS2 A;  2IA6 A;  2MTL A;  3ZTQ A;  4DR4 J;  1MML A;  3AH6 A;  4KKO A;  2BM1 A;  1PC4 A;  2J5A A;  3P6Y C;  4E2F B;  1UVI A;  3DRR B;  3TOQ A;  4WZM A;  3AOD A;  5DO2 A;  3U1M A;  4GVL A;  4MKY A;  1SI9 A;  2VQF J;  1JXL A;  1KHW A;  2DGV A;  4DV6 J;  4LF9 F;  2H51 B;  4WP3 A;  4F3O A;  2EFQ A;  2IBK A;  2R8I A;  4JI6 F;  2Y8Y A;  5KFA A;  1N36 J;  2MZT A;  3VVU A;  4MFB A;  2ZKT A;  3FUY A;  2VC0 A;  2ASD A;  2MKC A;  1HYS A;  3LOU A;  3POT B;  4IRK A;  4EBE A;  4MJK A;  1MWZ A;  1DLO B;  3E2E A;  2ZNZ A;  2E44 A;  5KFN A;  2C2K B;  2YX1 A;  2MKS A;  1YZ6 A;  5E41 A;  5CYQ B;  5B0A A;  2UXC F;  3KYL A;  1VK3 A;  3QO9 B;  2HQG A;  2ZOM A;  5DJB A;  2KHC A;  5MAO A;  3V81 B;  1HR0 F;  2D3Z A;  2AKW B;  2DO0 A;  2D69 A;  4L6V 3;  2MB0 B;  4AXJ A;  1R8B A;  2AMC B;  3ZTP A;  3K0J A;  1IQZ A;  1YSJ A;  2JFK A;  3T1Y J;  4N77 A;  2ATC B;  3ONQ A;  1KLN A;  3D6M B;  3E01 B;  5E7O B;  1JNZ B;  1PKU A;  1RWW B;  4B9L A;  4H4K C;  3TX8 A;  3Q89 A;  4I1T A;  2KFN A;  2H65 B;  5F3Z A;  5KT3 A;  2DNL A;  3SDE B;  1QAJ A;  1U49 A;  3F73 A;  4DV7 F;  5K8N A;  3JQK A;  4C3K A;  1Z2Z A;  4QJV A;  4QU7 A;  3NCP A;  4E98 A;  2PI5 A;  3KLE B;  1ZH5 A;  3D1H A;  2ILZ A;  4DXL A;  2L3M A;  4C8O A;  2A6O A;  2Q6B A;  1DLO A;  2CQH A;  3GFH A;  5L46 A;  4F0K A;  2KYZ A;  3TJ8 A;  2Y3Y A;  1Q0N A;  3ILL A;  2BX6 A;  2O67 A;  4HI2 A;  5CYQ A;  4B3S F;  2VG5 B;  1VOM A;  3JTO A;  3VGU A;  2DYA A;  1X4D A;  3QO9 A;  2RUG A;  5F8J A;  3V81 A;  4IDK B;  5IM0 B;  4IR9 A;  4ED4 A;  2Q66 A;  3NOG A;  2RU3 A;  4CLT A;  2XSJ A;  2RRB A;  3TW0 A;  1RWP B;  5BXI A;  3J7Y I;  5D77 A;  3L4B C;  4C9D A;  3BO2 A;  2AEJ A;  3NCQ A;  1R8C A;  4C0O C;  1D8Y A;  4RUA A;  4TLR A;  2YKO A;  2RVJ A;  3OL9 A;  1RQ0 A;  5H9E J;  3M8Q B;  3BGO P;  3PFE A;  4C98 A;  4USV A;  3KDO A;  5AE2 A;  3TVZ A;  2PO4 A;  1UWB B;  1B64 A;  4FBU A;  3KLE A;  4O3S A;  4XIU A;  1VCT A;  1EET B;  2CDQ A;  5HMX A;  2ASY A;  4OLP A;  1TMM A;  2M52 A;  1YX2 A;  5K5M A;  5RUB A;  4ECS A;  5KFG A;  1N33 J;  5CCM A;  3T5L A;  5F0W A;  5BJR A;  1GXU A;  2AWZ A;  4NX9 A;  3TAQ A;  2B5J A;  5FLX U;  2VDH A;  1QAI A;  4X66 F;  1KN6 A;  1RAB B;  2BZ2 A;  1QVF R;  4F50 A;  2QT7 A;  2G2Z A;  5JXS A;  2VG5 A;  1LK7 A;  4WXW A;  2JVR A;  3PW4 A;  3EGV A;  3GWC A;  3FZ2 A;  2W2M P;  4OZN A;  1JWW A;  4DV2 F;  3CCL S;  1RZM A;  1TVR B;  2Z2Z A;  5DLF A;  3IRX B;  3D6F B;  5IS2 A;  2I1R A;  1S4E A;  4H4O A;  3D4J A;  3BM7 A;  5HP1 B;  3CCZ A;  6AT1 B;  3HVR A;  3QAU A;  4HTI A;  1HNX J;  4Y00 A;  5DG8 A;  4USJ C;  1T11 A;  4ZPD A;  1RWX B;  3CDE A;  5GMK a;  4USI A;  1TUW A;  1T03 A;  4GO5 X;  2BKN A;  4IG3 B;  2FVQ A;  3G4S S;  4OX8 A;  3PNI A;  1XBW A;  4Y2K A;  4OYX A;  4UY8 T;  1Q7L B;  4Q2M A;  2HGN A;  2F4F A;  3SYZ A;  3AOA A;  1UWB A;  1C0U B;  2ADB A;  2LQ5 A;  3W2V A;  4M5K A;  5FLX Y;  1EET A;  2J9D A;  2BJE A;  2BUN A;  2RHS B;  4GKJ J;  2BJ3 A;  2FC9 A;  3CO9 A;  2IMW P;  4EFA C;  4EU0 A;  3GV8 B;  2MKY A;  3MM6 A;  1KQG B;  1N56 A;  1N5Y B;  3CJK A;  4ZLN A;  3KXD A;  4DV5 F;  1S6Q A;  4KV8 A;  5ITH A;  3BEG B;  2R2T A;  3CSK A;  2QE5 A;  5D4N A;  1IKW B;  1FHT A;  4XPE A;  3BGR B;  4OJH A;  2HWI A;  4FF3 A;  4DV4 F;  3BR9 A;  3ZZT A;  1LFP A;  3FVY A;  4IH5 A;  1TAQ A;  1U4B A;  2G0C A;  4F0H A;  1TVR A;  3TUP A;  2J9D E;  1BD6 A;  1FRH A;  1MSW D;  2UUT A;  4ILR A;  2GIR A;  3LP2 A;  3MR2 A;  5D0G A;  1WEY A;  4HT7 A;  1HNZ J;  5KG2 A;  3IM9 A;  2LU2 A;  2KJW A;  3CDB A;  2AJ1 A;  1PBU A;  1WSR A;  3FCH A;  1JLA A;  3T1H F;  2E5L F;  2V6A A;  4KHM A;  3KG1 A;  2LQ8 A;  1FES A;  2B56 A;  3MED B;  2AJF E;  4F4W A;  3K2Y A;  2VL1 A;  4U7C A;  4IKA A;  3MHY A;  4RU2 A;  3VAK A;  3ILI A;  4QWD A;  5KFO A;  3EGZ A;  1UZH A;  2NQP A;  3FCV A;  1H2V Z;  2QX0 A;  2QLF B;  3R1L A;  2HK3 A;  1Y10 A;  3P4U B;  4NI2 B;  1Q95 G;  3FKB A;  1PYO B;  1UEV A;  2CJA A;  5IQ6 A;  3TWZ A;  4L3K A;  3G96 A;  2NXJ A;  3K5O A;  4Y3C A;  4YFU A;  2C3O A;  1UW9 A;  2D9O A;  4DZ6 A;  5ETV A;  5LJ3 Y;  2E7W A;  1RYR A;  2UVW A;  2LDY A;  1W2I A;  3NGS A;  1SXL A;  4USW A;  2BE2 A;  1V9O A;  1F9H A;  2CA9 A;  3QQC D;  1VDH A;  1HNI B;  2IVF B;  3S6E A;  3V6D B;  3ETO A;  1S97 A;  1VQM S;  2OPR B;  5LT5 A;  4HH1 A;  1OY8 A;  3BBC A;  3FMB A;  2VPY B;  4GKK J;  4OYO A;  3GFY A;  2YKA A;  4RL1 A;  3VZI A;  4X4N A;  1Q79 A;  3OR1 B;  2YXL A;  5HSP A;  3WC0 A;  4YB1 P;  3V6J A;  4OI0 A;  2B0G A;  2QSF A;  3LWL A;  4RBT A;  4O3R A;  5KT6 A;  4JYA F;  2CFX A;  3CDU A;  3M30 B;  8AT1 B;  3UPF A;  5LMU F;  1YBA A;  4IUF A;  1D9D A;  3RU0 A;  3HSJ A;  3KNG A;  1X5P A;  3OL7 A;  3EVO A;  2VBW A;  1S0V A;  1IBM J;  1LNQ A;  1P9Q C;  3UVJ A;  1S9E B;  2LDI A;  2CDR B;  5IC4 B;  5K14 A;  4K0K J;  5ETM A;  3HVW A;  4L73 A;  3T3F A;  1T9Y A;  2R7S A;  4KH1 B;  3NXZ A;  2BW2 A;  4M5D A;  2XC9 A;  2IYG A;  1Q5V A;  3TUI C;  2OIH A;  3J81 U;  2F7V A;  1IBC B;  3IWN C;  1X31 C;  1HKA A;  4DL2 A;  2JWN A;  1U45 A;  4HL9 A;  3TAM B;  3MMJ A;  5F9N A;  1VBY A;  3GSD A;  2EFN A;  1HNI A;  4LF7 J;  8RUC A;  3V6D A;  3GIL A;  1UFW A;  4G6V B;  1VIX A;  4D3H A;  2RT3 A;  3QT6 A;  2XG8 A;  2WVD A;  4ATN A;  3NWR A;  3CD7 A;  4AXI A;  2M70 A;  2JL9 A;  3DI6 B;  2ZZN A;  2QLX A;  4Y6I A;  2XTJ P;  5C25 A;  3TUZ C;  1IR1 A;  4LF4 F;  2KB2 A;  1X0F A;  2Q1L A;  2WW4 A;  1HHQ A;  4OJG A;  1C4C A;  1R8P A;  3JSY A;  1SB6 A;  4PXB A;  2VD3 A;  4HEA 9;  1WEZ A;  2HW3 A;  3J81 Y;  3W5Z A;  3CJ3 A;  4O4R A;  2QTW A;  4B3T F;  2IJF A;  2SXL A;  4X62 F;  1TFW A;  2RQ4 A;  3PRV A;  3RR8 A;  1LWE A;  2VZ9 A;  2HQ3 A;  2RQK A;  3EXY A;  2OEJ A;  3J7Y U;  4DR2 F;  3NNA A;  3TQ1 A;  3ITH B;  1HBN A;  3ZFV A;  2WVF A;  4ZKA A;  4K4U A;  5DM6 Q;  2QN6 B;  1OWX A;  7AT1 B;  2J9C A;  3DM2 B;  3AJ1 A;  1RXO B;  2MZR A;  3CD0 A;  5CAB A;  3K5N A;  2L41 A;  3W9H A;  3GB0 A;  5CD4 H;  1U1K A;  1NB2 A;  3GLJ A;  1EP4 A;  4ZOS A;  3F41 A;  2LCW A;  5B0D A;  2EK1 A;  4RR5 A;  2ZH9 A;  4ZVE A;  3K5P A;  1LOU A;  1PAE X;  1FTR A;  2ZD1 A;  1WI8 A;  4DUZ F;  1KOO A;  4CLY A;  3MEC B;  5F8L A;  4R5P B;  2M4M A;  4X4S A;  2GFF A;  5E3P A;  1LXN A;  3DMJ B;  3SQG B;  5KFL A;  3L95 X;  4K4S A;  1WD6 A;  3QSI A;  1F5C A;  2LXI A;  4OZ0 A;  2XCP A;  1G1X A;  1TL4 A;  2R7W A;  1KKH A;  4WFX A;  4K4T A;  3N5B A;  1XNQ J;  5DRK A;  1DTT B;  1JQG A;  1Q5Y A;  4PG7 A;  2ZH5 A;  3BR8 A;  2CJK A;  1A0O B;  5I3Q A;  4A8F A;  2BEF A;  1YQH A;  1LWC A;  1S1V A;  2VBZ A;  2EFO A;  2LEC A;  3U7J A;  4PG6 A;  2HAF A;  4ZPB A;  2K1R A;  5LSR A;  2V2Q A;  1HBM B;  3DM2 A;  5LSO A;  3JXO A;  1YBT A;  5DG7 A;  1VYA A;  4RPF A;  3OFG A;  2F40 A;  3BGF A;  3W7B A;  4DPU A;  4C3L A;  2G9O A;  3HJF A;  3BKT A;  2ZIT A;  1ZTW A;  4M5G A;  3H90 A;  3SI8 A;  3E3X A;  4N7T A;  1Y5I B;  2WOM A;  2GQC A;  3D0I E;  4WYL A;  1KRP A;  5I3P A;  3KG0 A;  2ZWP A;  1P9Y A;  3SQG A;  4ZJO A;  4DFJ A;  3I87 A;  3T5J A;  1IVZ A;  1JJC B;  2FJE B;  1BWE A;  1YI2 S;  4M8L A;  4RUB A;  2Y1R I;  4X64 F;  2NPI A;  3ENV A;  2K3K A;  3CPW R;  5HAN A;  1BY9 A;  1UL3 A;  4LSL B;  1TUV A;  2OML A;  4LFC F;  5GAE I;  3H5Y A;  3G6X A;  1YJN S;  4R25 A;  1M90 T;  2QYG A;  2A1B A;  3PG9 A;  3B4M A;  2ZWO A;  2AJ0 A;  3IBC B;  1HBM A;  1RT2 B;  5ETS A;  1RBO B;  3GIR A;  4JI3 J;  1FRL A;  2RQM A;  2UUA J;  3GIK A;  5HLF B;  4DHV A;  4KPC A;  3OTE A;  4YY3 J;  3GU0 A;  1X4B A;  4O4G B;  3K89 A;  2GX8 A;  2IY5 B;  3CJ5 A;  4B3M J;  2I5J B;  2VG7 B;  2DEJ A;  4N41 A;  2WVE A;  4YB6 A;  1NUE A;  4C0H A;  3DDK A;  2MQL A;  1ROF A;  2JFD A;  2XSF A;  2PI4 A;  2UU9 J;  5IV4 A;  2NS1 B;  3PFO A;  2LMI A;  5A2Q U;  1EHW A;  2HFN A;  3QJL A;  3SCJ E;  3PW7 A;  2FIU A;  4B9U A;  1VQS A;  2B6A B;  5KFE A;  1WHV A;  4LSL A;  2CPH A;  1RT5 B;  2R2U A;  3MAQ A;  1MN9 A;  2VOO A;  2JEG A;  3A8I A;  4HHJ A;  4RNF A;  2BKO A;  2W8L A;  5F8N A;  5M2R A;  3X3U A;  1E6V B;  2BBE A;  1RT2 A;  2EPI A;  5G0R B;  4LF2 A;  5L1L A;  2MLY A;  2GO8 A;  2JJ4 D;  2KM8 C;  3H2V E;  4ZMM A;  4AE5 A;  1S1X B;  2HFZ A;  4DS5 A;  1WOR A;  1HPZ A;  2HHH J;  2B9E A;  2X51 A;  1TR0 A;  4O4G A;  5F8H A;  2DNQ A;  4KO0 B;  2I5J A;  5A2Q Y;  5KFW A;  1OIA A;  4LF8 J;  2DHS A;  3CCV S;  2XY7 A;  1TL3 B;  1UVM A;  4ED8 A;  2HFS A;  1O5J A;  3OQ2 A;  4J9S A;  3UDC A;  4TN2 A;  3MPU B;  2RNE A;  1J5O B;  3WC2 A;  1TL5 A;  1TQL A;  3V4I A;  4DSL A;  4DX5 A;  3ZZ0 A;  2WK4 A;  4NLG A;  2HNY A;  2CNL B;  2QC3 A;  3PHT A;  2FHM A;  1UVN A;  4U8V A;  3K17 A;  4C8N A;  2XB2 D;  2XI3 A;  1E6V A;  4N56 A;  2BMB A;  2IM3 A;  5G0R A;  2CAD A;  4HKQ A;  4ZVS B;  2ZBR A;  1QJH A;  1YIJ S;  1RHM B;  3CJ8 A;  4DG1 A;  3BN7 A;  4Y0F A;  2F8E X;  4O23 A;  3EPI A;  1RP5 A;  4LVO P;  4AUK A;  5GAH I;  3X1L B;  3HHK A;  3L9Z A;  4KO0 A;  4WBF A;  5I42 B;  2DBB A;  3R5G A;  4OHZ A;  2ZE2 A;  3TVY A;  2FUG 9;  4ER8 A;  4CO5 A;  4ID5 A;  3W2W B;  1BQM A;  3C14 B;  1IWA A;  2XMM A;  2LQJ A;  1KON A;  1VMB A;  4JI5 J;  3KLI A;  2O1P A;  1XMQ F;  2ZBQ A;  2YY3 A;  5K20 B;  2BAB A;  4DL5 A;  2FHO B;  2XMJ A;  2XY5 A;  2NPF A;  3RR7 A;  3C6T B;  4OI4 A;  3FBE A;  4EI2 A;  1TFY A;  2ROP A;  2FVC A;  2QSW A;  3UN3 A;  4C97 A;  1RT6 B;  4CM2 A;  3EZU A;  2Z58 B;  1VJQ A;  3H40 A;  3QID A;  1Y00 A;  1W2B R;  3QLH B;  4OI2 A;  4F25 A;  1T8E A;  2KM8 B;  4I67 A;  2Z2M A;  2VFV A;  4Z2X A;  4LFB F;  1JLE A;  2HHW A;  4TKT A;  4F4Y A;  2OH2 A;  4LJM A;  3A1Y G;  3VWS A;  1NXI A;  3DLJ A;  2JHE A;  1DBD A;  1C0T A;  4IO1 A;  1X4E A;  3EUN A;  1RCX B;  1IBL F;  1R0A A;  3RZA A;  2OI2 A;  2LEA A;  2GNK A;  3ZTO A;  1RHQ B;  3NWG A;  2XMA A;  1S77 D;  3R27 A;  1SCJ B;  3HSD A;  4OYM A;  4WE1 B;  5LMN J;  1CJV B;  2B4P A;  2MZQ A;  4DCO B;  1ACM B;  1GT8 A;  3LH2 S;  4F2R A;  3KK1 B;  4RWW A;  1RWO B;  4O3P A;  4DFK A;  1JLB A;  2CWX A;  3G8Q A;  3FGV A;  4RZR A;  4XTT A;  4F4A A;  4A8Q A;  2BKP A;  4IH7 A;  3KHL A;  3JTP A;  2DIT A;  3M6V A;  1K1S A;  1M5K C;  4ZIW A;  5L9X A;  1UW4 A;  3HSG A;  5T41 A;  1RT6 A;  4DUY F;  5DDR C;  4JI4 J;  4ZJQ A;  2AGP A;  1PSD A;  2Z8Q A;  2DRA A;  3QLH A;  3C6U B;  1N5Q A;  4JI1 F;  1MWQ A;  4ELT A;  3VGV A;  4UT4 A;  5LXY A;  5C42 B;  5JVG Q;  1IKX B;  1HQU B;  3TQE A;  2HVH A;  2YKN A;  4DU7 A;  3KMS A;  5HI7 A;  2I38 A;  1NSA A;  3EE3 A;  3Q8S B;  1IUJ A;  4ZN3 A;  1F1B B;  2RJZ A;  4CT8 A;  3QT5 A;  2VG6 B;  4ZVG A;  5BR8 F;  2YNH B;  2FJD B;  1U48 A;  2OAU A;  3M32 B;  2GMH A;  2ZFH A;  1X9W A;  4PUO A;  3GG0 A;  3IS9 B;  1S0O A;  1CJV A;  4I7F B;  4ZCL A;  4DR6 J;  2H9Z A;  5HL7 Q;  3LP0 B;  4ANC A;  3GIJ A;  1S1U B;  1WDT A;  4NRU A;  2IC3 B;  3M8Z A;  2XY6 A;  1TAU A;  3PAC A;  5A8R B;  2E66 A;  1NPP A;  3WX8 A;  5GAE U;  3UNG C;  2V8H A;  5I4M A;  3TJ9 A;  2HWH A;  1RTJ B;  2MY8 A;  1F3F A;  5C5J A;  1KSP A;  1YRU A;  3LPE A;  3JSB A;  3RAM A;  4HH0 A;  2WB4 A;  1APS A;  6FDR A;  3C6U A;  3PXG a;  3A8J A;  1ZOT A;  1T7P A;  4Z7C A;  3F56 A;  3FEX B;  5C42 A;  3J7A 1;  3EJM A;  5A6P A;  4CO3 A;  1H7X A;  3DRX A;  1FK9 B;  4ZPV R;  2ACM A;  1MMN A;  3BN4 A;  4J9V A;  3QFW A;  1AT1 B;  1NKC A;  2KDO A;  2E7V A;  2HVE A;  3RJM B;  2VA3 A;  3NS6 A;  2R7Q A;  1IKY B;  3KJN B;  2RRN A;  3QT7 A;  4IFV B;  2AYB A;  4WII A;  4UOG A;  4ZCK A;  4G3I A;  2MJU A;  3CJR A;  3KJV A;  2GJF A;  4DOZ A;  5L8R C;  4DZD A;  1S1U A;  5LSL A;  3AJ2 A;  1N5S A;  1Y4Z B;  4Q43 A;  1WWH A;  3CJT A;  3W66 A;  3RRH A;  5A8R A;  4FYD A;  3ZC4 A;  2E1R A;  2HHT A;  3CVK A;  3DGP B;  3KLH B;  1HWI A;  1P1T A;  3NBP B;  1MLA A;  2UUC J;  2M8D B;  2I8E A;  3TO8 A;  5IZH A;  2V8D A;  1RTJ A;  3C2P A;  4K8R A;  4RWX A;  3Q8U A;  1S72 S;  3DHX A;  4ZA1 A;  2PMW A;  3O44 A;  3HT0 A;  5B0G A;  2QLW A;  3VAL A;  1F2G A;  3KJQ B;  1IBK J;  3TNV A;  4UUW A;  2C22 A;  2P6T A;  5U47 A;  2UVV A;  1NRK A;  1WTB A;  3H5U A;  2N3L A;  5KTQ A;  1SC6 A;  2CQP A;  4WXO A;  4DCJ B;  1HMV A;  2DNG A;  4M5N A;  1WG4 A;  4QIV A;  4C8L A;  3SV4 A;  1YJT A;  3VZH A;  4DR1 F;  1IKY A;  1NJI T;  1KLM B;  4ECZ A;  4U9R A;  4IFV A;  3Q8Y A;  3C16 B;  1RBL A;  3CUL A;  4UTG A;  1HBO B;  3GQC A;  1HHT P;  2BJ8 A;  1N32 F;  2QLB B;  1KQF B;  2F65 A;  1NU4 A;  5EHH A;  2ZH8 A;  2WCX A;  3LA0 A;  9ATC B;  4JI8 J;  1PYS B;  2HMI B;  4R8U B;  4AT1 B;  1M1H A;  3LGH A;  4M5H A;  3NBP A;  3TZW A;  2F4V J;  1S48 A;  3C19 A;  3HD2 A;  2OPQ B;  3VTI A;  3NS5 A;  1RT3 A;  4W90 B;  5H9F J;  1B7Y B;  2VA2 A;  2E29 A;  4L75 A;  2GHW A;  4NLP A;  1RWK B;  3SCI E;  2VQE F;  3HHL D;  3I0S A;  2N7C A;  2HS3 A;  2RF2 B;  2R42 A;  5HK4 A;  5KFD A;  1RAD B;  3NP5 A;  1U26 A;  3QWP A;  2B4U A;  3I5C A;  1V5V A;  1S6P A;  5GAH U;  2VJV A;  1RAG B;  1RJJ A;  4DCP B;  1DZ5 A;  1QE1 A;  1SH0 A;  4G1Q B;  4BC9 A;  2D3O R;  1GH8 A;  4ECT A;  3F44 A;  4TY8 A;  1KLM A;  3DN9 A;  3RGI A;  3IGN A;  3MCN A;  4LF5 J;  3C16 A;  3D0H E;  3O2I A;  5HQM A;  1HBO A;  3HLU A;  2BQ3 A;  3OTD A;  3UR0 A;  1HQE B;  4BBY A;  2PN6 A;  3GFX A;  3MMC B;  4BHQ A;  2GIQ A;  3JSM B;  1LXJ A;  1J2V A;  2C2O B;  2X1F A;  1R7I A;  1Q7Y T;  2IHR 1;  1UTA A;  3MOJ B;  5K8M A;  3T19 A;  2R7X A;  1V3S A;  2AJ4 A;  4J9U E;  4CTA B;  3O6Q A;  5J2P B;  5AXL A;  4DV3 F;  2OPQ A;  1DTQ A;  1FKP B;  3H98 A;  4R0J A;  1VQP S;  2YQ3 A;  1OPI A;  1ZPV A;  3QAT A;  3DKD A;  3KK2 B;  5J1N A;  4DR3 F;  4MYU A;  2GVD A;  3HCX A;  2PFD A;  1SPB P;  4KGX B;  3KTQ A;  3BSC A;  4P72 A;  1D3W A;  3QJP A;  4DV0 F;  1OMS A;  4NWB A;  1I94 F;  3R2C J;  4MT1 A;  2B8P A;  5DET A;  1ARO P;  1NJW A;  4LT6 A;  5E5N A;  3B4D A;  2DIS A;  2O66 A;  1WOO A;  1FNX H;  4L3N A;  1RT7 A;  1T94 A;  4OZ1 A;  1YBU A;  4ZDN A;  1D8Z A;  4Y65 A;  1D9F A;  1Y9O A;  5FII A;  3AQO A;  3PY8 A;  2XHW A;  1CVJ A;  4NXM J;  4YOE A;  1RE1 B;  5FDL B;  3MMC A;  3QGH A;  2KL8 A;  5SUH A;  2X7I A;  2R8H A;  1WG5 A;  5EWE A;  4QQB A;  3KHH A;  3CC2 S;  4DL4 A;  2EVZ A;  1RTI A;  2ZH3 A;  1IR0 A;  3MEK A;  3DYA B;  3DRS A;  2FLO A;  2EKN A;  1JNR B;  2JEJ A;  2Z2Y B;  3GJS B;  3MM9 B;  4DR5 J;  1FKP A;  3N0V A;  1S9G B;  4J9M A;  1FF2 A;  1DQ9 A;  2E1C A;  4Y2M A;  4LBH A;  4DN0 A;  3LF0 A;  1YDL A;  1S1W B;  3R3T A;  2MMY A;  4OX9 F;  4ED5 A;  1Q4R A;  2R7R A;  4DX7 A;  3HHN B;  1HAR A;  4Y34 A;  2MSS A;  2XM3 A;  4OHX A;  2AEF A;  2M5Y A;  2UP1 A;  2M9K A;  3ZZP A;  1TV6 B;  4GC6 A;  3OSP A;  5L39 A;  2DRB A;  5EUH A;  3PJX A;  2QV6 A;  2AQ4 A;  2ZH6 A;  1XNR J;  4WP8 A;  4DLE A;  3K57 A;  3DLE B;  3V4M A;  1JX4 A;  3T6J A;  2HND B;  1D9A A;  1SUQ B;  4AQY J;  3HFZ B;  2OHD A;  1VRU B;  2MKK A;  3DYA A;  4ECX A;  3MM9 A;  2DXE A;  1FD2 A;  3Q8Q B;  4FVM A;  1Y5N B;  1S9G A;  2DNN A;  4A8O A;  1BMQ B;  4J91 A;  2UXD F;  4PG5 A;  2FJV A;  4KY3 A;  2AGQ A;  1F2H A;  2CNK B;  3HVT B;  3FQK A;  1UA0 A;  1VFJ A;  4ED7 A;  4JI7 J;  1HNW F;  3HHL C;  1TL7 B;  3MXH P;  1JJ2 R;  1E6Y B;  4DR7 F;  3MMA B;  5KT4 A;  2G13 A;  3AQP A;  1HNV B;  1RWV B;  2PC6 A;  5J2Q B;  4QBU A;  1L5U A;  1KTQ A;  3JAM U;  3PR5 B;  1HD0 A;  2QMU B;  1S1T B;  1CQN A;  2W9B B;  1A7G E;  3G8T A;  2V4Q A;  2KI2 A;  2OTL S;  2NXE A;  1BQN A;  2FPH X;  1UJ6 A;  4OIX A;  1TV6 A;  4PWD B;  2H48 B;  4UZB A;  1YZ7 A;  1Q78 A;  5A0Y B;  2J76 E;  2IRY A;  3VQT A;  4J9Q A;  1KDN A;  3VAH A;  2HND A;  1VBX A;  4X4O A;  2I0X A;  1SUQ A;  3D1O A;  4UOH A;  3CCQ S;  2BYC A;  4M5M A;  3OL8 A;  4EBD A;  1VRU A;  3MUT P;  2LLZ A;  2ZJR Q;  1ULR A;  2HVD A;  1OYE A;  1RUS A;  3N28 A;  2E9R X;  1Y7P A;  4U95 A;  4OLO A;  5E3R A;  1NKE A;  3KLF B;  5A8W B;  3BH7 B;  1QD1 A;  4RBU A;  3HVT A;  3FSY A;  3JAM Y;  4IYQ A;  2UUB F;  1SH2 A;  3H59 A;  2Y0B B;  3TI0 A;  4DSI A;  5KFX A;  3KHG A;  3LO3 A;  1FJC A;  1FD8 A;  1HI1 A;  4Q0B B;  2RAQ A;  4UOF A;  3D5M A;  5J2Q A;  4M5I A;  2VC1 A;  2KFY A;  1L3T A;  1KP6 A;  1IKV B;  2XGQ A;  1S1T A;  1MW7 A;  1WG1 A;  4OMF G;  3TZX A;  2FHJ D;  1VS3 A;  4FVC A;  4F4K A;  5KT7 A;  4EYH B;  1SJ3 P;  4PWD A;  1VBK A;  5A6W A;  3Q8R B;  5KFU A;  4ICL A;  3PTW A;  1S10 A;  1SJR A;  4OYA A;  4C48 A;  4JB8 B;  5JMN A;  1UCN A;  3W9I A;  2XS7 A;  2BOA A;  4XPC A;  3DC2 A;  3M05 A;  2O3D A;  2Z2L A;  2AEM A;  4QCL A;  3WBZ A;  3BQ1 A;  3P96 A;  4TU8 A;  4DPT A;  4DFP A;  5A8W A;  3HHL B;  2R7U A;  3CT9 A;  5DDP C;  1M5V C;  3Q83 A;  1IJF B;  1RTH B;  1REG X;  2HRU A;  2ZM6 F;  5LOQ A;  1H73 A;  4I2P B;  4WU2 A;  4Q0B A;  4B17 A;  3NAH A;  3M8S A;  2BJ7 A;  2FGC A;  2AU0 A;  2ZH2 A;  2EK6 A;  4ECV A;  3EDR B;  3M9N B;  1RWN B;  1YVF A;  3QRQ A;  2IM1 A;  3QZ7 A;  5CAA A;  3H5X A;  4PYA A;  3MUM P;  3RTV A;  5D8H B;  4JI0 F;  2YKM A;  2MQ8 A;  1VC5 A;  2E5I A;  1S59 A;  5KG4 A;  4RUC A;  3FJ2 A;  4OYW A;  2CKW A;  1NKB A;  3EPG A;  1X4H A;  2GW8 A;  3ZZY A;  2MYF A;  3I0R B;  3OD2 A;  5KG6 A;  2DNH A;  1F0X A;  4PKD B;  4LQ9 A;  1TL1 B;  3HF5 A;  4MK7 A;  1ICE B;  1XN9 A;  1CJU A;  4J37 A;  4PWW A;  1JLC A;  1FJ7 A;  4IO9 Q;  2B9X A;  2OFH X;  4LR7 A;  3CJS A;  5B0E A;  1U2R A;  2W7O A;  3G82 B;  3RUB L;  1NHU A;  4WJB A;  1EIY B;  1FRJ A;  1WC6 A;  1R8H A;  4YR2 A;  5AXM A;  2MHN A;  3GSI A;  2IAJ B;  4F36 A;  2NSB A;  4DS4 A;  1RTH A;  4P10 A;  1U1L A;  4LF9 J;  2CQ3 A;  2OD4 A;  1PJ6 A;  2YX7 A;  2POK A;  1AYE A;  1WUU A;  3MM8 A;  3LW5 C;  4ECW A;  5KFR A;  4JI6 J;  2PII A;  4UOC A;  3MPD A;  1U1O A;  1G2E A;  3AB4 B;  2BVZ A;  1BWV A;  2NXC A;  3KLV A;  4ZP9 A;  1FE4 A;  1X4G A;  4FYW B;  3B6B A;  3R97 A;  4O3N A;  3MR5 A;  3ETM A;  2NSC A;  3UD4 P;  3KK3 B;  4FKY A;  3QSY B;  3L7O A;  5CA5 A;  2K8G A;  2FZK B;  5KFH A;  2UXC J;  4WK1 A;  2YNF B;  2FVP A;  4B3R F;  1Q8I A;  2NLW A;  2W9C B;  2DXD A;  1WNE A;  5AXN A;  1HR0 J;  3OLA A;  3ZZO A;  5T7L A;  4K4V A;  1KVK A;  1SH3 A;  2X1B A;  4N8N A;  3PYD A;  1SV5 B;  2BAN A;  4B3O B;  4P74 A;  2AJ2 A;  3G82 A;  3TEG A;  3UWT A;  3I32 A;  2JDJ A;  2C2E A;  4IFY B;  1FA0 A;  4FXD A;  2BRL A;  4AL5 A;  2ASJ A;  4H54 A;  3JYT B;  2P5V A;  2A18 A;  2EFG A;  1AFI A;  4URS A;  1JJ4 A;  5ETR A;  5EN1 A;  4OI3 A;  3B54 A;  2BJ1 A;  3LAN A;  3PX4 A;  4DV7 J;  4CO4 A;  1ZAV A;  3IWL A;  3KG4 A;  1WOS A;  1BUX A;  1RIS A;  1U6B A;  2FLN A;  3HK2 A;  1VRQ C;  4TU9 A;  3QBC A;  3HT3 A;  3CCT A;  1S12 A;  3PO5 A;  2WSC C;  2V0N A;  1YRT A;  4KT0 C;  1CJK B;  4Q5V A;  2CPZ A;  3M2R A;  5B09 A;  1NCL A;  2E7X A;  1S4F A;  3DNC A;  2LXU A;  3BO3 A;  2EEY A;  4B3S J;  1V5I B;  1B70 B;  1X5O A;  3R5A A;  2V4J A;  1TUG B;  2OFG X;  2IBO A;  4HDH A;  3OR2 B;  1SV5 A;  3R5D A;  2DNP A;  4I2Q A;  1T3N A;  4B9M A;  3MM5 B;  4CLU A;  2AJQ A;  2CQ4 A;  2APO A;  4RLE A;  4YR3 A;  4JBC A;  3ILJ A;  2V94 A;  3TYT A;  2AF6 A;  2JX2 A;  2V8P A;  5EX0 A;  3MCS A;  4HT5 A;  1CUL B;  2FY1 A;  1R27 B;  2AYE A;  3CCS S;  4F4X A;  4YHH F;  1WF2 A;  4KKO B;  5DS7 A;  2BM0 A;  1V3R A;  4ANE A;  3OJS A;  4F26 A;  3J7Z 5;  4CI0 B;  2CRL A;  2OSQ A;  3QIP A;  2KT3 A;  5LXR A;  3RG6 A;  2X1A A;  2HBY B;  4S0M A;  2IYI A;  4ILL A;  5GAD I;  2PEH A;  4A4J A;  3H4B A;  3PM9 A;  4ECY A;  3FBF A;  1R0C B;  2QL7 B;  3NEK A;  4K2J A;  1CBK A;  4DPW A;  4KGM A;  2QLJ B;  4LFA F;  4FZV A;  4X66 J;  4OHW A;  3OLB A;  5C2C A;  3IO1 A;  3MEG A;  3U27 A;  3ZTR A;  1U1N A;  4MFB B;  5CD4 A;  4DLG A;  2E1M C;  4USH A;  3OVA A;  4DV2 J;  3R7B B;  3ZXW A;  4M95 A;  4JOU A;  3L7U A;  4GO7 X;  4RX6 A;  3NMA A;  2O01 C;  3PIP Q;  1FVQ A;  2Q43 A;  1P27 B;  1KWM A;  1U09 A;  1F6T A;  1DFD A;  2HHQ A;  3GV5 B;  1FNM A;  3K59 A;  2EC2 A;  4Q8F A;  4LUB A;  4G1I A;  2YWG A;  4J9R A;  1LKZ A;  1YJ7 A;  2QFI A;  3MZI A;  5DQG A;  1NK0 A;  4EO8 A;  5DLG A;  4DEZ A;  2AD9 A;  1PAU B;  5AT1 B;  1M1G A;  4WFN Q;  5HAO A;  2DHA A;  3DOK A;  3CGI A;  2J6U A;  2FY8 A;  3SZ2 A;  2B51 A;  3QWU A;  1PC5 A;  1GMV A;  3BSN A;  2HIY A;  2NXU A;  2NCK L;  4DV5 J;  1KOH A;  2HQD A;  3ILO A;  1RT1 A;  3OTC A;  2FVR A;  1WKK A;  2OJ3 A;  1TTH B;  5A8K A;  1YJR A;  3BV8 A;  3QGI A;  1TKZ A;  1HHS A;  1U0H A;  3A8E A;  2FLL A;  1JLG B;  1X4F A;  1MRO B;  4YDD B;  4KB7 A;  4I6W A;  4DV4 J;  2WTF A;  2XZW A;  5KG7 A;  3W8G A;  2DIU A;  3BSA A;  2LKZ A;  2ZH7 A;  1GK8 A;  1GMW A;  2AZ3 A;  1N0U A;  3FBC A;  2YNG B;  3PHE A;  1ZM9 A;  3OL6 A;  1SJ4 P;  3WIV A;  3UR3 C;  4WK3 A;  3T1H J;  3N01 A;  2DHH A;  2E5L J;  1V6H A;  1SIZ A;  1PG5 B;  2YNI A;  4WF9 Q;  4X4Q A;  3PW0 A;  3T9Z A;  1FKA F;  2XSJ B;  1ELO A;  5CYM B;  3DOM B;  1RHR B;  3A12 A;  3IR7 B;  2HZV A;  2HUR A;  3UD5 A;  4D3G A;  4DU8 A;  4HAC B;  4DSF A;  1JLQ B;  2KFZ A;  1AW0 A;  3LP1 A;  3GFZ A;  4UQG A;  2RIJ A;  2J7K A;  1Z1Z A;  5HQ8 A;  2XLJ A;  2FHJ A;  2HS0 A;  2RD5 C;  3MAA B;  3G9C A;  5J2N A;  1KVJ A;  2KRR A;  1U47 A;  2R2R A;  1YTY A;  3C15 B;  4CLK A;  2XWY A;  1CC8 A;  1JLG A;  3GR0 A;  4IRC A;  5EX3 A;  1MRO A;  2F1F A;  4PQU A;  1U6Z A;  1NBE B;  1ZA2 B;  3IR5 B;  3GTY X;  3NG8 A;  1M5O C;  3W5X A;  4QW8 A;  3FCW A;  4F2S A;  3KJF B;  3H5S A;  2WW8 A;  4NA3 A;  1JK9 B;  2YNG A;  2B5J B;  1NPK A;  2B7C B;  2B9W A;  1RAJ A;  2XYG B;  3VAJ A;  1K44 A;  2JNJ A;  3EMT A;  2FYX A;  4ES3 A;  3CD6 S;  3V6H A;  4JV1 A;  1CPZ A;  1REV B;  2QA2 A;  4JV5 F;  3CD5 A;  3HHD A;  2VIH A;  1Q8B A;  9RUB A;  3NKY A;  2C2Z B;  4OJ3 A;  1N8R T;  5CYM A;  3DOM A;  4X4T A;  4USM A;  4H4O B;  4RW7 B;  3I5A A;  1EAR A;  2UV8 A;  4HAC A;  1JLQ A;  3TA2 A;  4YB5 A;  1WC3 A;  2NUU G;  1UVL A;  4JYA J;  3D7S B;  2P2C B;  2YVS A;  1T03 B;  1XR5 A;  5LMU J;  3A8K A;  1CEZ A;  3MAA A;  1NDK A;  3C66 A;  3W9J A;  3C15 A;  1H72 C;  2VDI A;  5JJB A;  3MFI A;  2BQU A;  2DH8 A;  3I55 S;  2W01 A;  4X4U A;  1NSQ A;  3W2V B;  1UP1 A;  1LQ9 A;  3W64 A;  4M63 A;  4NMX A;  2X3G A;  2DR5 A;  4QYZ J;  1ZM3 A;  3MM6 B;  1KQS R;  1UKU A;  3CJK B;  1VGY A;  1S6Q B;  4KV8 B;  2LYV A;  4KPY A;  3K8V A;  2HZA A;  3OXL A;  1N34 F;  4UQT A;  1F9F A;  2CVI A;  2V67 A;  1WHW A;  3Q8P B;  2R8K A;  4CLZ A;  2RDD A;  3R9L A;  5H9E K;  2YWK A;  3BSO A;  3MEE B;  2V34 A;  1RB0 A;  2WVB A;  4Y28 C;  3OTO F;  3OBI A;  2VIC A;  2CJQ A;  4DDF A;  4X65 F;  1REV A;  3SSQ A;  2ALY B;  2GV1 A;  1FTC A;  2FTR A;  1CJT A;  2XYP B;  3Q23 A;  3I5B A;  4FNH A;  3BBB A;  3LP2 B;  4RW7 A;  4ZVQ B;  4WFA Q;  2CPE A;  4NCG A;  1K47 A;  1RU2 A;  1JLA B;  1VR6 A;  4LF4 J;  4C4W A;  4NZ6 A;  2NR0 A;  2OLW A;  3OUY A;  4PG4 A;  1UAW A;  3I6P A;  3U1N A;  3NNH A;  5ETO A;  1TU0 B;  5E3Q A;  3H4D A;  1AFJ A;  3W3S A;  2EC0 A;  4R0E A;  4EK2 A;  4B3T J;  3D28 A;  1XK8 A;  2CQ0 A;  3A13 A;  1YJW S;  2D41 A;  4X62 J;  1O8B A;  1U2F A;  4ETX A;  3R2D J;  2V68 A;  2BRK A;  5IWA F;  2KT2 A;  3C3L A;  5SZT A;  2XLK A;  2AYG A;  2UXB F;  3R5C A;  3FDS A;  4DR2 J;  3GIM A;  4CYU A;  5HJY A;  1RAI B;  3MEE A;  3B82 A;  4J9N A;  2IPO B;  4A46 A;  4ZN1 A;  2N3O A;  4CO0 A;  1GEH A;  2J0W A;  4MK9 A;  3BPD A;  2B43 A;  2BE2 B;  1OSC A;  1W7W A;  4C11 A;  3RBX A;  2ZVI A;  7FD1 A;  4DUZ J;  2VFU A;  1TMJ A;  4NZ0 A;  2JZ5 A;  5GAD U;  1WDD A;  1B0P A;  5M2P A;  2N4C A;  4LRE A;  3CE8 A;  2OTJ S;  1IQT A;  1I51 B;  1FER A;  1UPP A;  4NAS A;  5IXU A;  2DHX A;  5E2Q A;  1RBA A;  3US5 A;  1YJ9 S;  4KTQ A;  2IM0 A;  4A8Y A;  4WTO B;  5KFV A;  2ZZT A;  5IT4 A;  3UVJ B;  2H5I B;  2V8G A;  2CJX B;  1KQK A;  5FJ4 A;  1UFK A;  2LFV A;  5K14 B;  3OVB A;  1FNO A;  3UN2 A;  4M5D B;  5KFY A;  3JSR A;  5C24 B;  2AW0 A;  4PWU A;  2VOD A;  3PKY A;  4DQQ A;  1I1G A;  3W65 A;  2XHC A;  4F67 A;  2GGP B;  4ZPC A;  1VHF A;  4RU9 A;  3AXM A;  3VF0 B;  1HD1 A;  3EXC X;  1ZAX A;  4CH7 A;  1LWF A;  4OHY A;  4P9S A;  4IG0 A;  5CHC B;  2LQB A;  2K7K A;  4WKY A;  2HGL A;  2HWT A;  5T14 A;  4J9O A;  3IAM 9;  3CNQ P;  3D3C J;  2J8A A;  4X64 J;  2FJB B;  1DQ8 A;  5C25 B;  3W8P A;  4EMD A;  1TK8 A;  1U2C A;  2A2C A;  4P2X A;  3HM9 A;  2J6S A;  2CPJ A;  2D1C A;  4L72 B;  2EI5 A;  4A48 A;  4LFC J;  3KLG A;  4LRC A;  2ZKU A;  4QWB A;  3HXM A;  3RB0 A;  1J5E F;  1HWJ A;  3PYF A;  3PJ9 A;  2IA0 A;  4IRD A;  2W9A A;  5F8I A;  3R5J B;  4Y2I A;  3SFU A;  2ZC3 A;  3QRP A;  4PXE A;  1LWE B;  2QMW A;  1GMU A;  1B3T A;  2OSR A;  4KIA A;  5KFC A;  5C24 A;  3P5T L;  1I6J A;  2DK2 A;  3L09 A;  5DDO C;  3BGU A;  4XAK A;  2QGF B;  2GGP A;  2CAJ A;  5HVG A;  1HBN B;  1WKJ A;  4AYB D;  4ZCI A;  2FJW A;  3C8Y A;  2YX4 A;  1IJE B;  4FXW A;  5D0R A;  4ZCM A;  3M8P B;  4EGL A;  1EP4 B;  1H2T Z;  3SFG A;  1U1P A;  2RHQ B;  3EDQ B;  3FFI A;  1UJ5 A;  2L9D A;  3HI9 A;  1LV5 A;  3BF4 A;  2ZD1 B;  3FNN A;  2HG4 A;  3D6H B;  5A76 A;  2XMT A;  2PMZ D;  3BPS P;  1KFS A;  2OKQ A;  3MMB A;  5IQQ A;  5HRO A;  2EWH A;  2PFF B;  1SKW A;  5IOL A;  1FCA A;  2Y8W A;  5KFZ A;  1VQ5 S;  2XEX A;  4BWM A;  5B7W A;  4TNO A;  5D0H A;  1PGZ A;  1UVK A;  5LJ5 Y;  4LBP A;  1LWC B;  5HVF A;  1S1V B;  4C3M A;  1LK5 A;  1XTZ A;  3UNY A;  4BS2 A;  3AD7 C;  3D6T B;  1DJ0 A;  2COL A;  5DZ6 A;  3C46 A;  2K1R B;  2Y1I A;  4ITS A;  3M8R A;  1GX6 A;  3R6G B;  3AB2 B;  1P8G A;  2JLG A;  2Z57 B;  4QIG A;  1VBZ A;  2IJR A;  2NZ4 A;  3M8P A;  3HZE A;  1F3V A;  3DFE A;  3FSX A;  2V4R A;  2W8K A;  2EG1 A;  1WHX A;  4E8U A;  2XQC A;  2B4O A;  1UWA A;  4I64 A;  2PT0 A;  2ZC4 A;  1AUD A;  4H4M A;  2WOM B;  3ZNJ 1;  1RHU B;  4BLG A;  2ZJQ Q;  1FEE A;  1FJG F;  2PD1 A;  2O5D A;  2XGP A;  2GC8 A;  4P75 A;  1VLY A;  3PX0 A;  3OFE A;  4EUV A;  1J27 A;  1LFW A;  1Y3K A;  1FX4 A;  1N4L A;  4HTJ A;  3S7R A;  3NGR A;  1X7V A;  5AJ3 F;  5AE1 A;  2U2F A;  1RLC L;  2JOQ A;  3M2U B;  1WC0 A;  2OMO A;  2PDA A;  4OZ3 A;  1TKD A;  2LVW A;  4YDX A;  1RI7 A;  1CQM A;  2EW9 A;  3PR4 A;  5J1E A;  4MH8 A;  4CP5 A;  1NB7 A;  2BAC A;  4B9S A;  2HQF A;  4O0I A;  1WSV A;  1VJW A;  2YWE A;  3H0P A;  1U1M A;  1RAO A;  2CZ4 A;  1C1B A;  1XMQ J;  1S7H A;  2IJN A;  4TQS A;  4QIF A;  1PBA A;  2D7S A;  5KFF A;  2FZG B;  3ULH A;  5I3U A;  4Q44 A;  3CO0 P;  3V2U C;  1IXK A;  4FF2 A;  2VON A;  1TKX A;  1XQI A;  1X9S A;  1NK7 A;  2JVO A;  2K2P A;  3MWB A;  1BE4 A;  1MWY A;  1LW0 A;  1EKS A;  5K9F A;  3QGG A;  5KG1 A;  3MFH A;  2W4D A;  5EWG A;  2PEB A;  4LFB J;  1VIO A;  1UMJ A;  2MGZ A;  1KC8 T;  3CDA A;  2VFS A;  5HBM A;  3QMQ A;  4UW2 A;  3M2U A;  2VH7 A;  2M8H A;  4P7V A;  2HHV A;  3MTJ A;  1IBL J;  1NJZ A;  2QJ3 A;  4FNI A;  3LAK A;  2P9G A;  1PYT A;  1KD1 T;  2RU9 A;  1UJ4 A;  3N6N A;  4DV1 F;  1X4C A;  2CQI A;  3BKU A;  4KHP F;  4CQ1 A;  3Q22 A;  1SBR A;  4MKB A;  1HPZ B;  5D3G B;  2FD2 A;  1NJX A;  3GJR B;  2N4D A;  2MZS A;  3BO4 A;  4KC5 A;  3P49 B;  1U8S A;  3EGW B;  3DGV A;  5KT5 A;  5DQI A;  2GA7 A;  4ECQ A;  5FD1 A;  2RIL A;  3A3O B;  1T9U A;  3TP2 A;  3CJ0 A;  2OPP A;  4W98 A;  4F8R A;  1QM9 A;  1N0V C;  2DGO A;  1HW9 A;  1HBU A;  4J9L A;  1B0V A;  5KG5 A;  2MDA A;  3I4H X;  2IRX A;  1XMO F;  1KTV A;  1JXV A;  2OPS B;  4ECU A;  4EZ6 A;  2KKH A;  3VGS A;  4DUY J;  1ZBT A;  2HRY A;  3DRY A;  3GCX P;  3HKW A;  4KR0 B;  2DGU A;  2V9W A;  1PJ7 A;  3V4I B;  4QWA A;  4JI1 J;  3JS9 A;  3NGT A;  5BYQ A;  5L1K A;  2C42 A;  2HNY B;  1U02 A;  2GQ2 A;  3IN5 A;  5IT0 A;  4LSN A;  4DL7 A;  2RS8 A;  4NL5 A;  5GME A;  4K5R A;  4IR1 A;  1F5A A;  5D4P A;  1T05 A;  2JH3 A;  3I31 A;  5KFQ A;  3QPI A;  4ZLL A;  5BR8 J;  3GON A;  3VAM A;  1CC7 A;  1GTH A;  2M2B A;  3GJT B;  1JXE A;  4LBI A;  4EEY A;  4DG1 B;  3UDL A;  5D3G A;  4M5J A;  3HMJ G;  2E1P A;  3AAW B;  5D15 A;  1LWX A;  4A8S A;  3AJD A;  4PRF A;  2OEK A;  3AOC A;  4KYZ A;  3HVA A;  1S6U A;  3NOC A;  4KGK A;  4A8M P;  1AA1 B;  2ZE2 B;  3D3B J;  2PA8 D;  1ZTT A;  4ID5 B;  3D67 A;  1BQM B;  4IQX A;  1S9F A;  1BGX T;  4MMO A;  2OPS A;  2ZJP Q;  1XIQ A;  4BC7 A;  1SJF A;  1VC0 A;  3KLI B;  2NYI A;  2HQI A;  4ZJL A;  3BZQ A;  1Q8L A;  3PIO Q;  1QSS A;  3MUV P;  2QL9 B;  3H20 A;  3CCE S;  1TK0 A;  2MJN A;  1VLO A;  2YKP A;  1XWL A;  2HSE B;  1URR A;  1NK5 A;  2Q79 A;  4P2F A;  3D54 A;  2Q3P A;  4Q8E A;  4ED3 A;  5KFT A;  3DRR A;  4YR0 A;  2XYH B;  1VI7 A;  1H74 A;  2RRA A;  2XZT B;  3UCG A;  4JI2 F;  1JLE B;  3CCM S;  3OFH A;  1RU1 A;  1FRK A;  3GE9 A;  2W2O P;  3H2L A;  1FT8 A;  3SCL E;  1C0T B;  5CQG A;  1MN7 A;  4TYA A;  3ICL A;  2VKR A;  2QL5 B;  3BYP A;  2FDN A;  1IN0 A;  4DQS A;  1R0A B;  3WQP A;  2CPY A;  3POT A;  4UY8 5;  4Z7Y A;  1RCO B;  2E9T A;  2OGU A;  3T6B A;  4WU3 A;  4U6P A;  2VPZ B;  3AA9 A;  2U1A A;  1R8A A;  4Y2A A;  3K5L A;  1AXQ A;  3P45 B;  1U0S A;  4Q45 A;  3LPY A;  3LGM A;  3FQL A;  3S1T A;  1JLB B;  1AB8 A;  2KTQ A;  5ETP A;  1T3O A;  3FRZ A;  3M6W A;  1U25 A;  2DY9 A;  1FRX A;  1V3Z A;  1WKL A;  2MKJ A;  3QNW B;  1RK8 A;  1U1Q A;  4GMK A;  4C8Y A;  1EB0 A;  2LA6 A;  2EFP A;  4F0M A;  4IH6 A;  3HJV A;  3E01 A;  4QWE A;  4P7T A;  4ZLP A;  1SKR A;  1WTF A;  4OYB A;  2X3D A;  5HMZ A;  4DR1 J;  1NHV A;  2X1G A;  3SDE A;  4WPA A;  1NK8 A;  1NO8 A;  2YKN B;  3LAM A;  3IC1 A;  4J9K A;  4LMZ A;  4BDP A;  1S49 A;  2MQQ A;  1N32 J;  3D9B A;  1I3O B;  5C2G A;  1C1C B;  1IM6 A;  1CLF A;  2D9P A;  1YKW A;  3M7V A;  3N4W A;  2HVI A;  3IMQ J;  1FX2 A;  2WVC A;  3EVM A;  2IDL A;  4LR9 A;  4PUO B;  4ZVH A;  3OXF A;  4KSE B;  2I6W A;  2LEP A;  2L48 A;  1S99 A;  3P5B P;  3UCU P;  3S01 A;  4FXV A;  3JQJ A;  4F02 A;  3VR1 A;  1IR2 A;  3SQO P;  3EX7 B;  2XI2 A;  3FMW A;  1QUP A;  3DLL Q;  1Z4U A;  4HR2 A;  4IDK A;  2VFR A;  2JLF A;  1FXR A;  5IM0 A;  2VQE J;  1N6Q B;  1RYS A;  2DO4 A;  4WTY A;  4I68 A;  4QPX A;  1RTD B;  1P6T A;  3D0G E;  1VC6 A;  3G6E S;  5ETN A;  3OXG A;  4K4Z A;  1NND A;  3LAL A;  5B0C A;  4KGZ B;  2WAQ D;  4OYZ A;  3DXS X;  3FBB A;  3H8Y A;  3MM7 B;  1WF1 A;  3OTB A;  1BHN A;  2Y1L B;  4OX6 A;  3NGU A;  2GHV C;  1UEK A;  1MG7 A;  2VAS A;  1A6L A;  3M8Q A;  3IBW A;  1B0T A;  3HZG A;  2W25 A;  4FDF A;  3PRB A;  2YBV A;  2A10 A;  3UW1 A;  4DR4 F;  4CT9 A;  3GYN A;  3THV A;  2YPZ A;  1IM4 A;  3DCA A;  2A0F B;  2DNK A;  1K1Q A;  4HLB A;  3VAG A;  1C1C A;  4NRT A;  2VQF F;  4CNY A;  3RB3 A;  2MQN A;  3I4P A;  3AT1 B;  1EAY C;  4QPT A;  3BDP A;  4CZC A;  3RBE A;  3BKF A;  4FPI A;  4ZP8 A;  3I9V 9;  1N52 B;  3NLC A;  4DV6 F;  3OJU A;  2NXN A;  4WFZ A;  3KJV B;  5JVH Q;  2NZC A;  4FPR A;  2CQ1 A;  4DV3 J;  4RO0 A;  2L08 A;  3I56 S;  1N36 F;  1OSD A;  4ZPA A;  2FZC B;  1ZPW X;  4DR3 J;  2YWF A;  1N6Q A;  2RSQ A;  1N5T A;  3M6U A;  3SSS A;  3W63 A;  3IRX A;  3GCW P;  1RTD A;  4DV0 J;  2H3E B;  3GMG A;  3VAF A;  1M0S A;  5HP1 A;  1WJ9 A;  2M3D A;  3GG1 A;  5IV3 A;  1I94 J;  2PE8 A;  2AGO A;  2HRT A;  3VAI A;  1VQ7 S;  3TEH B;  3R1H A;  1WEX A;  2KG1 A;  4DL0 C;  4FF1 A;  2VV5 A;  3MM7 A;  3CJ4 A;  3SMZ A;  1URN A;  2VJU A;  4H4K A;  3WZ0 A;  4WP9 A;  4IG3 A;  2V2V A;  3NY0 A;  1WAC A;  3T1Y F;  4CLW A;  3L3C A;  4EWT A;  3ELH A;  1OY9 A;  4DBQ A;  4PEO A;  4OL8 A;  1C0U A;  3O3L A;  2DNR A;  1HMV B;  4WFB Q;  1HI0 P;  2ZDO A;  1FKO B;  2ZHO A;  5B0B A;  1N5Y A;  3OVS A;  1Q8K A;  2KH9 A;  3BRE A;  2QA4 S;  2CQB A;  4ZP6 A;  3OT9 A;  2YWW A;  2XLI A;  4KFB B;  1IKW A;  2HPU A;  3UDE A;  3BGR A;  1H98 A;  2G2O A;  4NLD A;  2KO1 A;  4RKU C;  1NZA A;  5DQH A;  1VK8 A;  2DNZ A;  3IA0 A;  2ZBP A;  4OX7 A;  2G0J A;  2DH7 A;  3AOB A;  4OI6 A;  1WHY A;  2PA3 A;  3CJ2 A;  4A8X A;  5ETK A;  3G8S A;  1RAF B;  1H2U X;  3OHA A;  2GJI A;  3RW7 A;  1UVJ A;  4NLQ A;  1RT3 B;  2E1A A;  5DG9 A;  4OX9 J;  3BGL A;  1C2P A;  2HVZ A;  2QRR A;  1VRT B;  3PW2 A;  3MED A;  1VHI A;  2ZOG A;  3O1L A;  1SC1 B;  3CCU S;  3I0S B;  2HS4 A;  4RW4 B;  2C3Y A;  1Q1K A;  1ZYQ A;  4ENO A;  4CWB A;  3IRW P;  4KQZ A;  4NEZ A;  1PO6 A;  2VF3 A;  1S6P B;  1X4A A;  4RUH A;  4KGV B;  2KT5 A;  1NLK L;  2W2N P;  3DDI A;  4X4P A;  1FKO A;  1QE1 B;  2E5J A;  3HFV A;  1NK4 A;  1VQ6 S;  1CS4 B;  3ENW A;  4TY8 B;  4NI2 A;  4OV1 A;  4C6A A;  1PIE A;  1FFS B;  2AHO B;  2GIF A;  4KFB A;  4CLS A;  2C28 A;  1M1K T;  1Q53 A;  2HHS A;  1QSY A;  3H25 A;  3SEO A;  2W7A A;  3G6V A;  4WZQ A;  3UN5 A;  1ZS6 A;  2UXD J;  1S0N A;  1EZZ B;  2ILY A;  2J8S A;  1QAX A;  1N54 B;  3GPA A;  2OUG A;  1N33 F;  1FDN A;  4MIB A;  1HNW J;  2DEI A;  1CG2 A;  4CM0 A;  3TAN A;  1OJ4 A;  1SL1 A;  3M9O B;  5KFJ A;  4ED2 A;  4DR7 J;  2MST A;  2FB0 A;  2AT1 B;  1DTQ B;  2F8M A;  3EYZ A;  5GAG I;  1RHK B;  2Z0G A;  4N5S A;  1VRT A;  2OPR A;  2GVD B;  2IMO A;  2PGC A;  4K4X A;  1EQ0 A;  2W2P P;  2IDE A;  3D66 A;  1TKT B;  4RW4 A;  2C1E B;  3J81 j;  1KS2 A;  2Y1J A;  2RML A;  2HAI A;  3OR1 A;  1M5H A;  1SJQ A;  1NPR A;  4DF8 A;  1HNX F;  4F04 B;  2JSX A;  4FP9 A;  3A3P B;  4V19 J;  4RW9 B;  3AD8 C;  3HKZ D;  2HYI B;  3RB4 A;  1CS4 A;  3M30 A;  3RW6 A;  1RT7 B;  4OHV A;  3PVX A;  2N7Y A;  5H9F K;  1NK9 A;  3DLK B;  3DOL B;  3CXC R;  2JC0 A;  1S9E A;  3LQV A;  1ZET A;  3D1Q A;  4LQ3 A;  4GKJ F;  2DGQ A;  1UA1 A;  3GR1 A;  1XMB A;  4KH0 B;  1RTI B;  5D78 A;  1YRX A;  2HBQ B;  4ED1 A;  2UUB J;  2XWX A;  5E33 A;  3D2W A;  1SKS A;  4F7V A;  2J0Q D;  4NEY A;  1OS5 A;  1UEU A;  3Q2S C;  3K8W A;  3TAM A;  3DRS B;  2WHO A;  3CWJ A;  3KUE A;  2ACY A;  4ECR A;  2Y0S D;  4MKA A;  3ET6 B;  4LF6 J;  2LQ9 A;  3ISN D;  2FVS A;  1TKT A;  3NGK A;  5HAT A;  4TQR A;  5BYR A;  3RRK A;  4FYV B;  4PQA A;  4O3O A;  4DN9 A;  1S79 A;  1HNZ F;  3DI6 A;  1RWM B;  2BV3 A;  3MDF A;  1Q82 T;  4DL3 A;  4RW9 A;  2ATL A;  1HL6 A;  1TZ0 A;  2G1H A;  1FDA A;  3QFH A;  1EX8 A;  4HVZ A;  3VHQ A;  5IFM A;  1NH7 A;  3FZB A;  3MCO A;  3CW2 C;  4TU7 A;  3RYL A;  1VQ8 S;  3DLK A;  3DOL A;  3R8Y A;  3GP9 A;  2WON B;  3MR7 A;  3EZO A;  1F60 B;  1UET A;  2ZH1 A;  2A3J A;  4M5L A;  1VQ9 S;  4LRB A;  2KU7 A;  1VIS A;  2C2M B;  2W1B A;  2ZHA A;  4CIO A;  4DL6 A;  2DCU B;  2F9D A;  4NPO A;  4NLX A;  4DF4 A;  4CO1 A;  4DFM A;  2CQG A;  3MTK A;  4WCE Q;  4F4Z A;  1TK5 A;  2ZM6 J;  4X84 A;  3SCK E;  3AY0 A;  4AL7 A;  1YLX A;  3ITH A;  4NCA A;  5E3A A;  5GMD A;  3E8O A;  2BDP A;  3ET6 A;  1OPZ A;  2KG0 A;  3RBD A;  4I69 A;  3AA8 A;  4JI0 J;  1KVI A;  4XO0 A;  1HFE L;  1S57 A;  1TP7 A;  3THT A;  2DB1 A;  2YWH A;  1NDC A;  3CF5 Q;  1F5B A;  2G4B A;  3MEC A;  4R5P A;  2GMJ A;  3CUN A;  1SQG A;  2P8I A;  1QTM A;  4U96 A;  3DMJ A;  1JMT A;  3FRY A;  5THW A;  2MQP A;  4GKK F;  1BQN B;  2DNM A;  1WC4 A;  2VHG A;  4XDC A;  4WYW A;  2WON A;  4YS2 A;  4JP8 A;  1PCA A;  4ZVT B;  4DX8 H;  4AND A;  1DTT A;  1HQ2 A;  3U1L A;  2MLZ A;  3MPV A;  2MQO A;  1S76 D;  2ALZ A;  3Q8V A;  4MIA A;  2V69 A;  2CWK A;  3VCD A;  3GZ7 A;  4QOT A;  1IBM F;  4QR0 A;  1SC3 B;  4F3M A;  1T0T V;  2WBR A;  1L3U A;  2OP5 A;  4K0K F;  2F9J A;  5MLC V;  4TXS A;  5J1P A;  1H0H B;  2IIH A;  3PV8 A;  1OY6 A;  2J9E A;  2W4C A;  3KFW X;  1OQ3 A;  2EKY A;  4YUD A;  2MY7 A;  4CLF A;  4LF7 F;  4LIR A;  4B3R J;  4QR2 A;  3SV3 A;  5HN0 A;  4FKX A;  4B9T A;  4RNN A;  3ZZZ A;  2DHG A;  4YME A;  3BQ2 A;  4AD6 A;  2QYC A;  5D6G A;  5ETL A;  3KNA A;  4GRS A;  3A4T A;  3PKM A;  2F5G A;  4ICL B;  4KBI A;  1WI6 A;  3CME S;  4WWS A;  4DX6 A;  3M6X A;  1GQE A;  1FDD A;  1RSC A;  4MK8 A;  3MGJ A;  1GMW D;  4NCB A;  2BA9 A;  2CIM A;  5KT2 A;  3Q2T C;  2ZBC A;  3R7N B;  2PMH A;  2KRB A;  4YQW A;  2KZZ A;  4X2B A;  2DIV A;  5DGA A;  2XO6 A;  1N88 A;  2EXU A;  2K7J A;  2OO4 A;  5EDW A;  4NLY A;  3ISN C;  2Y9H A;  5HLF A;  4OZ2 A;  3T9N A;  4OI1 A;  3R5B A;  2VPW B;  1OQ6 A;  2V8V A;  1RTZ A;  2VG7 A;  2DPJ A;  2DGW A;  3M9M B;  2ERR A;  4CH1 A;  1T02 A;  2ZUG A;  4LF6 F;  1N5V A;  3T41 A;  3CJQ A;  2V9K A;  2YKM B;  2QA4 G;  1G6B A;  2R4F A;  3DLG B;  1XC9 A;  4PPZ A;  4PR6 A;  2A2D A;  4DPY A;  1UZD A;  2H4W B;  4P71 A;  2GML A;  3PW5 A;  1X5T A;  4LRA A;  4OFZ A;  4IOA Q;  2NYH A;  2B6A A;  3KUH A;  3VV2 B;  1CJU B;  5L1I A;  1JLC B;  1RHJ B;  2VPX B;  1RT5 A;  5HMW A;  2ZH4 A;  2G2Y A;  3KUG A;  4KJI A;  3QAE A;  4YHH J;  4FS1 A;  2VB6 A;  1SJ1 A;  2N82 B;  4DI6 A;  1SIW B;  4ZIV A;  3HUL A;  2E5H A;  3QYY A;  2LP4 A;  3BYR A;  2DR9 A;  2XO7 A;  2VBX A;  2LXF A;  1QVG R;  1EQM A;  5GAG U;  1MMD A;  1XNQ F;  4KRW A;  3TZZ A;  4XK8 C;  3I82 A;  3O5T B;  2NRE A;  4NLT A;  5DGB A;  2FGO A;  2QG9 B;  3IR6 B;  2KN4 A;  1S1X A;  2FC8 A;  2G0I A;  3W1Y C;  4ERD A;  4URG A;  1GX5 A;  2L9W A;  2XZD B;  1NSP A;  4RJV A;  2Q6C A;  2GAH C;  3P8B B;  3PEH A;  1SVD A;  3MM8 B;  4LFA J;  3I96 A;  2HHU A;  3DXB A;  4C2M A;  2QFJ A;  2HK2 A;  3MD3 A;  4U67 Q;  1U24 A;  1GAO A;  5F3T A;  4ELV A;  1RAH B;  3RAX A;  3N9U C;  4ELU A;  2JEF A;  5K8O A;  1I5O B;  4YP3 A;  1KFD A;  4P2M A;  1TL3 A;  3DLH A;  4ZS6 A;  3TAR A;  3DLG A;  4XDD A;  1F9E B;  3PJW A;  2E5G A;  3T5H A;  4IOC Q;  1FI4 A;  2GS8 A;  5ETQ A;  5CZV A;  1J5O A;  2KHD A;  2CJ9 A;  2KJV A;  5AE3 A;  1GFW B;  5EWF A;  1U8W A;  4AFF A;  3BS9 A;  4A8W A;  3W60 A;  2CPI A;  5T7L B;  1PIL A;  4NYZ A;  1B4S A;  4CNZ A;  4CCH A;  3PO4 A;  3CCJ S;  1M5P C;  2BAN B;  2J7U A;  2FQQ B;  3QZ8 A;  2ZDP A;  3UI3 A;  3N5F A;  5KFB A;  1FRI A;  2YH1 A;  4HYK A;  1JB0 C;  5LM7 E;  1R6V A;  2WRM A;  4JV0 A;  4ETZ A;  1KR4 A;  2OEM A;  3TR5 A;  4FF4 A;  1HLW A;  5K8P A;  3DHW C;  1Q16 B;  3PYG A;  4ILM A;  2K06 A;  3FEY B;  2C3U A;  1FWP A;  1BXN A;  4PAB A;  2DNO A;  3NMR A;  2MLX A;  4K5S A;  1X60 A;  5I42 A;  5HVH A;  4UF4 A;  5D4O A;  4JI3 F;  4KE5 A;  3GV7 B;  2UUA F;  1DAX A;  3W2W A;  2XMK A;  2GZO A;  5CH7 B;  3OW2 R;  3NNC A;  1O51 A;  4PZV A;  3C14 A;  2CJB A;  5E3C A;  3M2R B;  5KFM A;  4YY3 F;  3WHI A;  1Q81 T;  5ETT A;  2AIR B;  2QA1 A;  3BH6 B;  1GTE A;  4TVA B;  3H7H B;  4B3M F;  1VQY A;  1RWU A;  2V4J B;  2LU1 A;  3C6T A;  2UU9 F;  1EJ7 L;  3MCM A;  1ZA1 B;  4NLR A;  1X5S A;  4I2Q B;  3THP A;  1XR7 A;  1RA7 A;  1ZZF A;  5DM7 Q;  4ZPT R;  3NL0 A;  5HO4 A;  5H1S V;  3LWM A;  1NDL A;  2OEL A;  1FFW B;  1VQ4 S;  1HA1 A;  3RAQ A;  4CDI A;  1RLD A;  4USK A;  1U1R A;  3QJJ A;  4NML A;  1RAC B;  2JEI A;  3B8H A;  1FWK A;  3QIP B;  1BQX A;  1L3V A;  2NUH A;  3IXQ A;  4UUX A;  1HWK A;  3GYX B;  4WE1 A;  3DU5 A;  2AYM A;  3AHP A;  2ZBI A;  5JUM A;  2HHH F;  4OV6 A;  2BOP A;  2R7O A;  3BBF A;  3KK1 A;  3KKF A;  1OO0 B;  2R8J A;  1FRM A;  2YQ1 A;  3MEG B;  2H5J B;  4RNH A;  4F3Q A;  2CPD A;  4LF8 F;  4ZVU B;  4JV5 J;  4NYO A;  4K59 A;  3JQM A;  3CC4 S;  1B99 A;  3KDN A;  3MD1 A;  1R6Y A;  4PG8 A;  3G87 A;  3EVW A;  1K8A T;  2CQ2 A;  3EZ5 A;  1SQF A;  4NZ7 A;  3M8Y A;  3RB6 A;  3T5K A;  2UUW A;  4U8Y A;  1LW2 B;  1IKX A;  1HQU A;  1NH8 A;  1W25 A;  3K58 A;  2GJ2 A;  5KFI A;  3DRP B;  3SXL A;  4CRJ A;  2R7V A;  1TEL A;  3DOK B;  1RAA B;  4U7U K;  2VG6 A;  1G3O A;  1WOP A;  4O0N A;  2A6M A;  2YNH A;  5C7P A;  3O8W A;  1RA6 A;  3M32 A;  2HLT A;  1RT1 B;  4DQI A;  2QMX A;  1LEO A;  1N34 J;  3IS9 A;  2XUL A;  1R0B G;  3TRG A;  4I7F A;  5A8K B;  3LP0 A;  2JC1 A;  1TKZ B;  1U0H B;  2I9S A;  2IC3 A;  2HZC A;  4NOH A;  3FSI A;  3OTO J;  2G1D A;  1HI8 A;  3HSZ A;  2J7W A;  4X65 J;  4B9V A;  3G86 A;  2HLU A;  1YJU A;  1XEZ A;  3NCR A;  2RH3 A;  1GXL A;  4OZJ A;  4PXD A;  4JI5 F;  1NZ8 A;  2GQQ A;  2RE1 A;  5KAK A;  2RQC A;  2J0S D;  2GAG C;  1NHK L;  5GVQ A;  2ADC A;  3GJQ B;  2D74 B;  4NLW A;  2D3U A;  3MR3 A;  2YNI B;  5AXK A;  1LW2 A;  1G7C B;  2Z30 B;  3LGN A;  2BR0 A;  5ADZ A;  2CZV C;  1FK9 A;  3DRP A;  2QZ8 A;  2H4Y B;  2MKH A;  1RT4 B;  5CZX A;  3TZY A;  3CMA S;  2FJX A;  4DMZ A;  2YTC A;  4DQP A;  3LP1 B;  2ASL A;  3HP6 A;  4OYI A;  3CIZ A;  5IWA J;  4QYR A;  2HHX A;  4LIW A;  1H7W A;  3MPW A;  5J2N B;  2UXB J;  3R7S B;  2UV8 G;  3HHE A;  1RAE B;  3TVK A;  3IP0 A;  1X8D A;  2EFV A;  4ES1 A;  1GNK A;  1EKR A;  4URQ U;  4GVB B;  3TA1 A;  4PQU B;  3HPO A;  1R89 A;  3HDS A;  2XMU A;  4C8Z A;  1QUV A;  5D4L A;  4PCQ A;  2CG4 A;  3DGP A;  3KLH A;  5LMN F;  4RNO A;  2W2Q P;  1RKJ A;  3Q0A A;  1H6K X;  1U6F A;  1ZAW A;  2ZNY A;  8ATC B;  3DLB A;  3VGT A;  2YPY A;  4QWC A;  2P6S A;  3W5Y A;  3TX0 A;  4NLU A;  4ZHR B;  2B4V A;  3CDW A;  1UFL A;  1SL2 A;  1FDB A;  1R31 A;  1QAY A;  3OPK A;  1YIT S;  3J7Z T;  1FXL A;  2DXF A;  2MQM A;  3UDV A;  5CXT A;  1H3D A;  1T9X A;  3ISZ A;  4LRD A;  3CB4 A;  2ROG A;  2M0G B;  2D3O 1;  2EBG A;  4LR8 A;  2W4P A;  2E9Z A;  1JKH B;  3PRD A;  2XNR A;  2DT9 A;  2AP6 A;  1RT4 A;  4JI4 F;  1XER A;  1T95 A;  3IBF B;  2KXF A;  2V50 A;  2YH0 A;  4HDG A;  5F8M A;  4KHR A;  3PYE A;  1M5S A;  1MU2 B;  4NYP A;  3J80 U;  4HI1 A;  1HWL A;  2FLP A;  3QGP A;  2I2Y A;  4B9N A;  4PAA A;  4GVB A;  3R6L B;  2VUG A;  1DHM A;  2GCF A;  2IVM A;  2HMI A;  4CLP A;  4R8U A;  2P9E A;  2M88 A;  2R2S A;  4ED6 A;  5KG3 A;  4GC7 A;  3SSR A;  4DR6 F;  2DVI A;  1L3S A;  2XS5 A;  4FS2 A;  3NRB A;  4JV2 A;  2AV5 A;  4ZHR A;  3CMQ A;  1FO1 A;  4QR1 A;  2RDI A;  4WFY A;  2RF2 A;  1CJT B;  3PDN A;  4ALZ A;  3EGN A;  1ZZN A;  5KFP A;  4P52 A;  3U02 A;  1JKH A;  4WKR A;  3J80 Y;  2MKI A;  4Q7A A;  2M7S A;  4NCG B;  4EYI B;  2H54 B;  4G1Q A;  1DRZ A;  1YHQ S;  4NLO A;  5BYS A;  3MOZ A;  3CCW A;  3OUY B;  5E0O A;  1MU2 A;  2R3V A;  3VVT A;  3LTO A;  4LRF A;  3NS7 B;  4K4Y A;  3V6K A;  5HJX A;  3KMQ A;  1J5E J;  1HQE A;  5KOX A;  4ED0 A;  3UFC X;  3HD1 A;  2CQD A;  3JSM A;  2CYY A;  4DWI A;  4M1K A;  3ZZU A;  1JLF B;  2R7T A;  2RUS A;  3T1A A;  2CXE A;  4HHH A;  3GYG A;  4NA1 A;  4N8O A;  2HIQ A;  3BJY A;  1K73 T;  3CTR A;  4CTA A;  5F41 A;  5J2P A; 
#chains in the Genus database with same CATH homology
 2BMB A;  3QBC A;  1CBK A;  2QX0 A;  4M5M A;  1RTZ A;  1G4C A;  4M5I A;  4M5N A;  1DY3 A;  5ETL A;  4M5G A;  1HKA A;  1F9H A;  1Q0N A;  3KUG A;  3ILL A;  3UD5 A;  4CYU B;  5ETK A;  3IP0 A;  1HQ2 A;  4PZV A;  4M5H A;  4F7V A;  1TMM A;  4M5J A;  4CWB A;  1EQ0 A;  5ETM A;  1RU1 A;  1TMJ A;  2F65 A;  4M5K A;  5ETV A;  1IM6 A;  3ILI A;  3HCX A;  5ETS A;  1RB0 A;  3HSZ A;  2CG8 A;  4CYU A;  3HSJ A;  5ETQ A;  3UDV A;  4CRJ A;  3HD2 A;  5ETO A;  3ILJ A;  4M5L A;  3KUH A;  5ETT A;  1EX8 A;  1KBR A;  1RAO A;  3KUE A;  3HT0 A;  3HSG A;  3ILO A;  1EQM A;  3MCM A;  5ETP A;  5ETN A;  5ETR A;  3HD1 A;  3UDE A;  3MCO A;  1RU2 A;  2F63 A;  3HSD A;  4AD6 A;  3MCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...