2LEAA

Solution structure of human srsf2 (sc35) rrm
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A syn-anti conformational difference allows SRSF2 to recognize guanines and cytosines equally well.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Serine/arginine-rich splicing factor 2
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2leaA01
5HO4A 2RS2A 1FJCA 4W92B 2VONA 2CQGA 1QVGR 3B4MA 2XSFA 2MPUA 2FHOB 1SJFA 5JVGQ 3S7RA 2VOOA 2CQ1A 2A3JA 4UQTA 3UCZP 1M5VC 2L41A 1OO0B 2E5JA 2MQMA 2MSSA 2ZJQQ 3CCRS 1W2BR 2DISA 3SMZA 2MQPA 4WFNQ 4IOAQ 3EGNA 2KG1A 2MQLA 4QU7A 5IM0B 4M5DB 4LJMA 2MY7A 3BEGB 3NNCA 2CQCA 2E5HA 2K3KA 5CYJA 2DHGA 4UY8T 2MSTA 2DNYA 3UD3P 2V94A 3EGZA 3DLLQ 5DDOC 2LYVA 1FNXH 3MI7X 3VALA 3FEXB 1VQNS 2HYIB 2MZSA 2L08A 2U1AA 2CPFA 1P27B 1X4EA 2KG0A 1H2VZ 4A8XA 2J76E 4Z2XA 1KC8T 2DH9A 3Q2TC 2DNHA 2XNRA 3BS9A 1X4GA 2MHNA 2MKHA 1YJWS 2XB2D 2BOPA 2KM8C 4C0OC 2DHSA 1DRZA 2M8DB 1FO1A 2DNLA 2DGXA 1N8RT 2GHPA 2M7SA 1DHMA 1JJ2R 1WF2A 2E5GA 3CCES 2KYXA 3MUVP 1R8HA 4BS2A 2DK2A 2MKCA 3CC7S 3PIOQ 2AYGA 2CQDA 1SJQA 3LPYA 2LKZA 5DETA 3SDEA 1Q81T 2M9KA 5LSOA 2N7CA 1S79A 3G6ES 1VQ4S 3ULHA 1D8ZA 1ZZNA 4ERDA 2CPEA 2MZRA 2QEXS 1NU4A 4LIRA 3P3DA 3Q2SC 2LQ5A 1X4DA 1WHXA 5GVQA 2QA4S 2AYBA 3CPWR 1HL6A 2YKAA 2G4BA 4WFAQ 4IUFA 2DB1A 3CULA 4TU7A 2KXFA 2DGUA 1K9MT 2KM8B 1WEXA 2KXNB 3IWNC 1N88A 4OZ0A 1WHWA 3S01A 1X5OA 2MKKA 3CMAS 1SJRA 2RQ4A 1VBXA 1ZZFA 2JVRA 1VQ5S 1SJ4P 1WG5A 4C7QA 2J8AA 3J7ZT 2M0GB 2AYEA 2E44A 3K0JA 4Y00A 1JJ4A 1SXLA 2FC8A 1M5KC 2LECA 3VAIA 1VC5A 1UFWA 4CIOA 1YJNS 1F9FA 1U2FA 2MGZB 2OTLS 1VQ7S 4WIIA 2DNPA 3VAMA 2N82B 3R27A 4TU8A 4IOCQ 3CD6S 1P1TA 3S8SA 1WTBA 1VQ9S 2GO9A 2D3OR 4TLQA 1KOHA 1KD1T 3RW7A 2KVIA 3P49B 4WFBQ 3G8SA 1A9NB 1WF1A 1WEZA 2U2FA 3NMRA 2DGWA 5CA5A 2CPHA 1YTYA 1L3KA 2M52A 2OTJS 5D78A 1OIAA 5LJ5Y 2AD9A 2CQPA 4QQBA 1UP1A 1U1RA 2XNQA 2KHCA 2KXHA 1HD0A 1M90T 4V19X 2CJKA 2CQ0A 2JWNA 1OWXA 2PEHA 1IQTA 1JJHA 5IFMA 1H2TZ 2PE8A 2DNMA 1FT8A 1Q86T 2ERRA 1SJ3P 5CXTA 3UCGA 1O0PA 2DHAA 4LMZA 5DDRC 2CPDA 3H2VE 3MXHP 5DDPC 3VAKA 1U1KA 2K8GA 4CQ1A 1Q7YT 1M1KT 5BJRA 2SXLA 2OSRA 1URNA 3THPA 1UW4A 1M5PC 2MGZA 3FEYB 1DZ5A 2DGSA 2DIVA 2F9JA 2HGLA 5DM6Q 2LEBA 3BO3A 2KU7A 2OSQA 3CF5Q 3THTA 2KFYA 1U1MA 2J0SD 3PIPQ 2RQCA 3NNHA 2AYMA 1FXLA 3CXCR 4ZKAA 5GADU 2MYFA 3HI9A 5D77A 1B7FA 4CH1A 2Q79A 2LXUA 1U1NA 2NZ4A 4WKRA 3I56S 3UCUP 2YH1A 2LCWA 2ADCA 3CCQS 1VQ6S 2MY8A 2CPIA 1H2UX 2LMIA 3VF0B 5LSLA 1M5OC 3LQVA 4RU2A 3TYTA 4W90B 1S72S 2MB0B 2KH9A 2HGMA 2XS2A 1YHQS 2F9DA 2ZJRQ 5JVHQ 1WHVA 1VQ8S 1X4BA 3R1LA 2B0GA 2MZTA 2O3DA 2CQBA 2J0QD 4WCEQ 2RU3A 4U67Q 2LXIA 2DIUA 4TU9A 2XS7A 1YWXA 2D9PA 2LA6A 5DDQC 5GAEU 1U1QA 3MOJB 2VODA 2JX2A 3US5A 2MKSA 3UE2A 2KN4A 2NLWA 3SXLA 3MUMP 4PRFA 2MZQA 2KRRA 2N3OA 3MD3A 2MXYA 1DBDA 3N9UC 2RS8A 3DXBA 5LXYA 2EK6A 2EVZA 1BY9A 1JMTA 3TP2A 1X5PA 2FC9A 2XS5A 1VC6A 1AUDA 2X1GA 2CPXA 2N3LA 3BO4A 2M88A 3H2UB 1YITS 2DNOA 4F02A 3U1LA 3G8TA 2RUGA 3SDEB 4C4WA 1A7GE 1WELA 4PKDB 1WG4A 2EK1A 5IQQA 2DGTA 1WF0A 1VQMS 2CQ3A 2KT5A 5GAGU 2CPJA 5HL7Q 3U1MA 2WBRA 1NJIT 3IRWP 3TO8A 3HHNB 2MKIA 1WWHA 2YH0A 3MURP 3UWTA 2RVJA 2MQNA 1XN9A 3CMES 2RNEA 3CCSS 1Q82T 1U6FA 2CQ4A 1VC0A 3NS5A 3CCLS 4WF9Q 2DNRA 3MDFA 1RKJA 1WHYA 4P6QA 2I38A 3L3CA 1WG1A 3P5TL 2DNGA 5EN1A 3S6EA 5GAHU 3ZZYA 2L9WA 2M8HA 2CQHA 3NS6A 4ED5A 2X1FA 2M2BA 1KOOA 4YOEA 5ITHA 2OIHA 1QVFR 1G2EA 2DGOA 3G96A 3BO2A 1NO8A 1HA1A 2KI2A 5MLCV 2JRSA 2G0CA 1VQOS 2LA4A 1YIJS 4FXVA 1YI2S 1U6BA 2DNZA 3JB9k 1K73T 3CCUS 2DH7A 3MD1A 2KRBA 3G9CA 4QU6A 4YUDA 3D2WA 1U1OA 1X5SA 4CH0S 2UP1A 2HZCA 3G4SS 3CC2S 3CC4S 1CVJA 2YTCA 1VQPS 2MZJA 2DITA 2I2YA 1X4CA 3J7YU 2CQ2A 1RK8A 1KQSR 2RRAA 2FY1A 3VAFA 2HVZA 1PO6A 1VQKS 2CPYA 2G1DA 2DNKA 2MMYA 1D9AA 3VAJA 1U1LA 2YWKA 5DM7Q 1YJ9S 3G71S 3VAHA 1K8AT 3CUNA 2X1BA 2M70A 4YB1P 2F3JA 2HGNA 1X4HA 1H6KX 2VOPA 4IO9Q 1UAWA 3B4DA 1VBYA 4FXWA 2D9OA 3R1HA 5LXRA 1X0FA 2DGQA 2MQQA 2MJNA 1OPIA 2MZ1A 1FHTA 2JVOA 3OW2R 5LJ3Y 1WEYA 1QM9A 1PGZA 3CCVS 1X4AA 2DNQA 3I55S 1VBZA 2DO4A 2E5IA 2X1AA 1X5TA 4Y0FA 1U1PA 2QFJA 3NNAA 5IM0A 2FPHX 3VAGA 2DO0A 2LEAA 3P6YC 2DHXA 5FJ4A 2RT3A 4J5OA 1N52B 1FJ7A 4PR6A 1HD1A 3RW6A 3UD4P 1X4FA 1N54B 2DNNA 2MKJA 3MUTP 1R8PA 1WI8A 3ZZZA 4QPTA 3V4MA 2ADBA 2OJ3A 2BZ2A 2CPZA 2M4MA 4OZ1A 4F26A 1VQLS 1ZH5A 1FJEB 2MQOA 2DGVA 1WI6A 2DH8A 5GMKa 4F25A 3EX7B 3CCJS 2ZJPQ 5H1SV 2MJUA 3CTRA 3CCMS 2RRBA 2CQIA 4EGLA
chains in the Genus database with same CATH superfamily
2QSWA 2J6TA 1RT2B 5K8MA 1S6OA 2QSFA 3MECA 1MMLA 2GZOA 4PXBA 2QLWA 3ZTOA 3W8PA 2ZM6J 4DUZJ 4W92B 2VUGA 4XIUA 3T6JA 3IWXA 4M94A 3F0NA 1WSVA 1NPRA 1PYSB 4M5KA 5KFEA 2E29A 2XSFA 5LMNJ 2MPUA 1SJFA 2B9XA 3KJFB 3S7RA 4MT1A 1YBTA 2WRMA 5LMUF 1ZYQA 2FVSA 4CWBA 4A8MP 4RJVA 5DRKA 2A3JA 3UCZP 2AKWB 1FK9B 5I3UA 2LQJA 2VF3A 3CWJA 1S0MA 1ZM9A 2L41A 3CO0P 3H0PA 2MQMA 5L38A 3M6XA 3SSQA 2VDIA 2C3YA 3ADAC 5EX0A 2MSSA 4ZVPB 5GAEI 1REVA 2H5JB 4ZPBA 1NSQA 3UPFA 2MQPA 4ED3A 1N34F 2H4WB 3W5YA 3E01A 1BQNA 2FGCA 1KDNA 1IXKA 4RW8A 2DT9A 5IM0B 2F5GA 2Z2YB 2XMWA 2OO4A 4RW8B 1K0VA 5D0EA 5EUHA 2K3KA 4WPAA 3W8GA 1XNRF 4UY8T 4N41A 3NNHA 3LP0A 3KJVB 4YS2A 4PXCA 1E6VB 1ZA1B 2HK3A 3AODA 4F36A 5HMYA 4QIEA 2D3ZA 1PAUB 4UW2A 2Y1LB 3CJ5A 1S0NA 2E7VA 2AEMA 5A8KB 1A6LA 2K1RA 1RCOB 1JLEA 4AD6A 4CLTA 2C3OA 2FTRA 4TQSA 1RAHB 1BUXA 2MZSA 3EMTA 1JLEB 1X4EA 4KHMA 3IG1A 4P52A 4DL3A 1P9QC 5CZVA 1MMDA 3MMBB 1ROFA 1TK8A 2R7XA 4CO1A 5DG7A 3TNVA 1X4GA 3H5UA 3M7VA 3TUIC 4DV5F 2J7WA 1CEZA 2WOMB 2Y0BB 3KK3B 3PJXA 3GQCA 7FDRA 3DDKA 2FJDB 2KTQA 3SI8A 2J0WA 4NLPA 4KGXB 1FDBA 1HQEB 3MTJA 3TZZA 2G13A 4LF9F 2VC0A 2ZM6F 2J9CA 3N6NA 2M8DB 4WYLA 4K50A 2C42A 2CUYA 2DGXA 4BBYA 3GE9A 2XLIA 2V69A 3KLVA 2GHPA 1NK9A 1N8RT 3BSCA 4JI6J 2D3UA 4TVAB 1IQZA 3M32B 1DHMA 3UNYA 2UVWA 3B78A 2R7SA 1YJRA 3NBPB 1OYEA 2XMKA 2OPRB 3DLJA 5SZTA 3K2YA 1YRTA 1FRMA 2EI5A 3DGPA 1R89A 4JI0J 4DCJB 1RU1A 1T3NA 2HIYA 5HQ8A 2AYGA 1SJQA 5KG2A 3G6XA 3HVRA 2POKA 2I6WA 5DETA 1DLOA 4USHA 1Q81T 3OLBA 2YNGA 2G9OA 1S79A 3FRYA 4C11B 1RWPB 1AXQA 4NXNF 3ULHA 3GCWP 3QGHA 3BSAA 3UDCA 5F9LA 1ZZNA 2BA9A 4HH0A 5D4PA 1I6JA 4ERDA 3TUJC 2GO8A 4PWWA 1A0OB 3TAPA 3P3DA 1HNIA 2QLXA 4X4PA 3BH6B 4QYZK 5A0YB 4Y2MA 3CPWR 1S0VA 4X2BA 1FEHA 4C8LA 4DEZA 5EWFA 1QAJA 3OTDA 1MWYA 2I5JA 2LXFA 1YZ7A 4ETZA 2KXNB 2KM8B 4H4KA 3TAMA 1FXDA 2QGFB 1HYSB 4H4KC 4OZ0A 1HNXJ 1JLFA 1SJRA 2RQ4A 4ED6A 2IMWP 3D3CJ 3ZZPA 2XY7A 1EKRA 1M1HA 2XBPA 2J9DE 1RWUA 3HCXA 4CI0B 3NEKA 3K0JA 4IO1A 1BQNB 1SXLA 2J8SA 3SEOA 2FC8A 3L95X 3K89A 1UWBA 4LRAA 5I4MA 2AEJA 1OMSA 5F8HA 4MKYA 1YJNS 4RW4A 2C3MA 4Y2IA 1UWBB 4K0KJ 3UN2A 1K47A 1RQ0A 4RX6A 4ZDNA 2JH3A 4WIIA 1S97A 5KFMA 2DNPA 4ZPVR 5HP1A 4O44B 4Q2LA 4AQYF 4LF6J 3OFFA 1TP7A 3R27A 3LUYA 3TW0A 4TU8A 1S9GB 3KLIA 1P1TA 1PJ6A 3A3OB 4OHZA 2P9CA 2V4JA 3E8OA 3S8SA 2QLJB 4KRWA 1WTBA 1RTIA 3FBBA 1FFGB 1KOHA 2GCFA 2R2RA 1ZAVA 3ITHA 4KV8A 2KVIA 4DSIA 2J9DA 2WCXA 3I32A 4LVOP 4I6YA 4N56A 3NMRA 2XO6A 2ZITA 3ILIA 4O3QA 3H4DA 1QTNB 4WK1A 2CPHA 2B3TB 1SQGA 1L3KA 2RIJA 1FKOA 2BKOA 2DTJA 3OL7A 3J81Y 4RZRA 2QA2A 2XSJB 1SB6A 2Y9HA 5E7OB 1HI8A 4OYOA 4CTAB 2KXHA 4DDFA 1HD0A 1M90T 1Y0HA 3J7AN 2VFVA 2VU5A 2VG7B 4ZVGA 1PYTA 2IYGA 3FNNA 2LFVA 2DCLA 3MCMA 1C1BB 2Z8QA 3AD9C 4WTYA 4I2PB 2QN6B 1IQTA 2CAJA 2XWXA 3CJ3A 2PT0A 2I8EA 3C14A 4UOFA 4USTA 2IRYA 1VRTB 2RKIA 3ET6A 3HD1A 4BWMA 4Q43A 4JV1A 5KFWA 1FT8A 1V3SA 3BDEA 3C14B 3TEHB 5E41A 3T5HA 1FKAF 1H7XA 2HAIA 3LF0A 5B08A 2NPFA 1S6QB 1EP4B 2IJFA 4ELTA 4OQJA 2DHAA 4F0MA 5DDRC 3HK2A 1JLQB 3H2VE 5DDPC 3M8RA 4DV2J 3T1HJ 2XZWA 4GRSA 3VAKA 1T94A 4DI6A 1UA1A 1Q7YT 3PTWA 1QLNA 2CVIA 2QIFA 2SXLA 1DTQA 2NXJA 2BE2A 2OSRA 3N0VA 5L8RC 2BJ3A 3MM9B 1VQYA 3X1LB 1QD1A 1ZPWX 2YNHA 3GU0A 3CCWA 4I68A 4Q2MA 4ZVSB 1CLFA 1N36J 2E5LF 2DXEA 2LU1A 3FEYB 3GMGA 2MGZA 2FJXA 2UUCF 2F9JA 4HH1A 4XO0A 1JLBA 1H3DA 2YNIA 4K4XA 2ZWPA 1CJKA 3KUEA 1HNWF 2WHOA 2HQDA 2ZDOA 5L46A 2RQCA 1RWWB 2VQFF 1UEUA 2HWIA 3EDQB 3RRKA 3HKWA 4M5GA 1VISA 2Z4PA 4ZKAA 5GADU 2J9EA 4ECYA 1BMQB 4B9SA 3K5MA 4MYUA 4UOCA 3VVUA 1NJZA 4YR0A 5KFRA 2QL9B 2A18A 3D28A 3MFIA 1NSKL 3QATA 4TY8B 2LXUA 1TMJA 3P45B 4MIAA 4TYAA 4DF8A 4WKRA 3SQOP 1RDRA 2C22A 2J6UA 4ZVHA 2ABYA 2LCWA 4CLLA 5HP1B 2QFIA 4ZJQA 2OEJA 3FUYA 3LOUA 4TNOA 3T1YF 1MG7A 1FD8A 1IR0A 3TVYA 1LKZA 2NREA 2JFDA 2V8DA 4LT6A 3IRXA 4PEOA 4OI1A 5I3PA 4JI6F 2UUBJ 2E9TA 2CPIA 3LTOA 1WACA 1Y5LB 5D15A 3UW1A 3WX8A 3Q8RB 3W1YC 2NXEA 5KFHA 4OYIA 3MAHA 3SCLE 3KLEB 2C2EA 1TZ0A 2QX0A 5F8LA 5DG9A 2KKHA 3D54A 3L7OA 5DGBA 3PZPA 2DPJA 3TYTA 4W90B 3H40A 4R5PA 2MB0B 4LF7J 1EZZB 1HLWA 3QQCD 3N5FA 2HGMA 3DYAA 4RNOA 3PO5A 2XS2A 2D1CA 1YHQS 4DV3F 5KT6A 2UVUA 4U95A 2JFKA 1RWMB 4NLWA 4KFBA 1XNRJ 1TVRB 1WHVA 1RTJA 3MAQA 4P2MA 3JSYA 1X7VA 4NZ0A 1WJ9A 1SC4B 4WJBA 2HQFA 1EKSA 3R1LA 3NP5A 3BSNA 2O3DA 2BE9B 2G2OA 2W2NP 1RLDA 4QWCA 4WCEQ 1SQFA 2J0QD 3CW2C 4Q44A 1I51B 3KUHA 4FVCA 4OHYA 3CDEA 1G7CB 2DIUA 3MM7B 5L1IA 1C0UA 2XY5A 1XIQA 3WBZA 5L1JA 1YWXA 5FDLB 3W3SA 4F04B 1KR4A 4PWUA 1N36F 2E5LJ 1HQUB 3DFEA 5GAEU 2GAGC 1C0TA 4EU0A 4OZJA 1U1QA 2V34A 5E3AA 3MOJB 1NKCA 2HRUA 4K4ZA 1NKEA 2GVZB 2JX2A 3IS9B 4G6VB 2MKSA 1T9YA 4NA3A 3US5A 3JSMB 2MEWA 2BE7D 2EWHA 2R9LA 2Y1RI 3IMQJ 4OJ3A 2X3DA 1F0XA 4B02A 2AJQA 2DYAA 2EBGA 2HQ3A 2MZQA 5F41A 3EZOA 3QIPB 4KGZB 2W4PA 2JL9A 3NG8A 1UJ5A 2BANB 3UDVA 2DY9A 2ZH2A 2HQCA 4ZPDA 5K9FA 5K20B 1SH3A 4UT4A 2MXYA 1S7HA 4JI8J 1XBWA 1JLGA 2V8VA 3ZFVA 4PABA 1S9EA 2ZE2A 4QOTA 5KFLA 1FJGJ 3AH6A 1N0VC 1S77D 2RS8A 3DXBA 4BCAA 3M9NB 1WTFA 2EK6A 3MR7A 2ACMA 2EVZA 3BKFA 2VZ9A 3UQSA 3KK2A 5D0HA 2HVDA 4X4TA 3ILOA 4RNHA 2OELA 3A12A 2JSXA 1FDNA 3AJDA 1JJCB 2CPXA 3H7HB 4KPCA 2G2YA 2V4RA 3B82A 3MMBA 3RU0A 3LWLA 3PX4A 2A10A 1FCAA 2E1MC 2DHHA 2J5AA 3C6UA 3ISND 4MYTA 4OJ1A 4DPOA 5EGYA 1MW7A 3TZYA 4PWDA 4KQZA 1FEEA 1Z2LA 1JLAB 4F02A 1HWIA 1UJ6A 2UUWA 1WC6A 4NLSA 1WELA 2GGPA 4PKDB 2ZHBA 1UFLA 3HT0A 5A8WA 2CA9A 4DL2A 4OX9J 1WG4A 4LF1A 4RNNA 2YBVA 2E66A 3QAEA 2DGTA 3MPUB 2CQ3A 2VPWB 4W98A 1LW0A 2LQ9A 4Q7AA 5HL7Q 1YVFA 3GG1A 2GIRA 4LSLB 5IT9Y 3OL6A 1HWJA 1IBLJ 2ROPA 2BBEA 5GAGI 1ZTTA 4IH6A 3AXKA 4DZ6A 3TOQA 5C2CA 4Z37A 4WXWA 4FXDA 4KH1B 1HBUA 2WSFC 3HVTA 5L9XA 1PJ5A 1D9DA 1HW8A 3JSBA 3SQGA 4EBDA 3CMES 3I6PA 2P8IA 2ZZMA 2YNGB 3CCSS 2R8KA 1B4SA 2J0XA 4DPXA 4R5PB 1SL1A 1Q82T 4O3RA 4JI3J 3CCLS 3QRPA 1Y4ZB 2ASDA 5CHCB 3HZEA 1Q8BA 2I38A 1WG1A 3DMJB 1GAOA 2R42A 1TFYA 2Z58B 3ETMA 1AYEA 4U7UK 4DFJA 3A1YG 2XZTB 1RABB 2DNGA 3FBCA 4IDKA 4CLWA 3PW7A 2YQ3A 3CCTA 3IM9A 1XMOJ 4Q8FA 4HVZA 2UVVA 5KTQA 4KHPF 3J81j 3WIUA 2NYIA 4H54A 2Z2MA 3MFHA 5LMUJ 4Q0BB 2YX1A 4O4GA 1K0TA 3JYTB 2ALYB 4ED5A 3GJSB 1IKWA 4A8KA 2M2BA 2FJVA 4ZS6A 4YOEA 4I64A 4DCPB 2CJYB 2YKNB 3I82A 2ALZA 3G96A 3I0RA 3IR7B 1X60A 1UEKA 1U8WA 2HFNA 2ZH4A 4IFYB 2OGUA 4NYPA 2RUSA 1T02A 4ZN3A 4J9SA 1VQOS 4ENOA 1CJUA 3J81U 1BQXA 3O6QA 5D4OA 1SKSA 1Q8IA 3EJMA 2DNZA 4OI6A 2ZH5A 3CCUS 1VCTA 2BANA 4A46A 1IBKF 3CDUA 1TL3B 2R8HA 4QU6A 1U8SA 1S6UA 2ZUAA 3D2WA 3OL9A 4F8RA 2EFGA 2RRNA 5J2MA 2BABA 3NAHA 3QT8A 4K5SA 2CNKB 3BGRB 4OHXA 4P74A 3J7YI 4ER8A 2HZCA 4KGKA 1XR5A 1R43A 1ZAWA 2BKNA 1CVJA 2DEJA 2FJBB 4LF5F 1JWWA 1RAEB 4I7FB 2I2YA 3M2VA 5KFFA 2GJIA 1JKHA 2IAJB 1RK8A 3OTOJ 3NBPA 2PI4A 5BYRA 2FIUA 2ZKTA 1F60B 3BR8A 4DR1J 4P2FA 1BXNA 5E5NA 4DV7F 2XHWA 2HVZA 1PO6A 1N5SA 1FI4A 3H25A 3RB6A 2C28A 3LGNA 1VQKS 1N33F 3AOAA 4DV6J 2DNKA 2C2ZB 1D9AA 2MMYA 3MEDA 1B0PA 4M5LA 2V2ZA 1HQEA 5DM7Q 4PPDA 2BW2A 1EB0A 1ZA2B 1HFEL 1RT4A 4DV3J 2X1BA 2W9CA 3QMQA 6FD1A 5HJYA 4X4OA 1NM2A 3NWGA 1WSRA 1X4HA 1H6KX 1H74A 3DRPB 2O67A 3RBEA 2H48B 3DOLA 4OZNA 2UXCJ 1WOPA 1V6HA 2K7KA 1X8DA 4J9PA 3B4DA 2OH2A 2ASJA 1VBYA 3G82B 1Y10A 4FXWA 2Q6CA 4CLPA 1BWEA 4IOBA 1X0PA 4EFAC 2PIIA 4MK8A 5KFJA 1NMEB 2MJNA 2MZ1A 5DLGA 3DI6A 4ZCLA 2IVFB 1CJKB 5DZ6A 5JMNA 3UVJB 3OW2R 2YPZA 3VCDA 2UXCF 3OT9A 5ETSA 4ZPTR 1R8BA 5J1PA 1QM9A 1IKXB 2ACYA 1SQEA 3JQKA 4LF2A 4UUWA 3UNGC 1NK5A 1PGZA 1KNZA 1WC1A 1S1WB 2FLPA 4OLPA 5KFPA 4NMXA 1RAOA 2OMOA 1U1PA 4X4NA 1DTQB 2OLWA 2WB4A 2QFJA 1LNQA 3NNAA 4RW9A 1SL2A 4AQYJ 1VLYA 5IM0A 4NLXA 1IBKJ 3C46A 8ATCB 4RBUA 4A8WA 4USVA 2JEJA 2XULA 4DG1B 4J9MA 3WZ0A 4NZ6A 3PCOB 2YNIB 3FBFA 4B3TF 1JLCB 1VI7A 2DHXA 3KLIB 5M2UA 1XC9A 3GR0A 2JLEA 1KHVA 2BJ1A 4DQIA 3MGJA 4PR6A 3DNCA 5IXUA 2FJEB 2B7CB 2UZAA 2YNFB 4TLRA 1NEEA 2XMTA 4TN2A 2NQPA 3FMBA 2XQCA 2A2DA 3FK4A 2MTLA 3H5SA 4NRTA 5KG7A 4DX8H 4PG5A 5T7LA 2V2VA 5KG5A 4QW9A 5EHHA 4L73A 1GK8A 2V67A 2CPZA 3TANA 1L3UA 1VQLS 1JNZB 5AE2A 3BM7A 4JI7F 1ZH5A 1WI6A 2DH8A 3JSRA 2Q6BA 2UXBJ 1R8AA 3MM5B 4I1TA 4XDCA 1VJQA 4LR8A 3WQPA 5FLXU 1QY7A 2GV1A 3K17A 4AE5A 4L74A 1S1UA 4NPOA 4FS1A 2IM1A 1RBOB 3CTRA 1RWKB 2HAFA 3CCMS 1S1UB 4URGA 4KYZA 3ITHB 4KV8B 3N5BA 1YG0A 4GC6A 3BQ2A 2CQIA 2D41A 1C1BA 4EGLA 2BRKA 4J9KA 4AL6A 4NEYA 4LQ3A 4TQRA 2QMWA 1S99A 2RS2A 1X9SA 3QIDA 5D0GA 1PKUA 1BD6A 2HPUA 4HLBA 2MKYA 3R5GA 2FD2A 2ZH3A 1FFSB 3Q89A 1QVGR 1LOUA 2F7VA 3HSGA 4NE9C 5ADZA 8AT1B 4DV2F 3T1HF 1YRUA 4DFKA 3SV4A 1UVLA 1RHMB 4PG6A 1S10A 1GXTA 3GILA 2CQ1A 2IVYA 1RYSA 3AQOA 4XPEA 4X4QA 1XQIA 1OO0B 4LR9A 4ZCMA 1R3NA 4Y34A 1EIYB 1FESA 2KJWA 4M1KA 2KB2A 3M9OB 4YDDB 5L1LA 2HHWA 3V6KA 1W2BR 3BYRA 2DISA 3BYPA 1D09B 4WFNQ 4MMOA 1TU0B 2DXFA 2EFQA 2DR6A 2ZNZA 4DR3J 3P5BP 2HIQA 3G82A 1HNWJ 2DR9A 2AX1A 4CLSA 4AYBD 3MR6A 5KT5A 4BC9A 2VG5A 1TK5A 3BEGB 1DTTB 1ZM4A 2V5HG 1PC4A 2E5HA 2VG5B 5F3TA 5B0DA 4YR3A 2OPQA 2E7WA 2MSTA 4IRDA 3UD3P 1HNZJ 1RBLA 2V94A 4ZN1A 1QUVA 3ZNUA 2RHQB 5DDOC 2LYVA 1FNXH 3QFWA 3DLLQ 2E9RX 4KH0B 1Y9OA 2YKQA 3K8VA 5KG1A 3OTEA 3MPYA 4KHRA 2QL7B 1NLKL 1CULA 3FEXB 1B64A 4OX9F 3CJ4A 4TXSA 4WP8A 1VQNS 1C1CA 4IH7A 2HHUA 2YNHB 3TVZA 2CPFA 4C3LA 4JI7J 3CE8A 1H2VZ 3GCXP 1KKHA 1MNEA 5E3QA 1SV5A 3I0SB 4RKUC 1D3WA 4Z2XA 3K5NA 5AJ3F 2DH9A 4DR4F 3Q2TC 2NXNA 2XCAA 1RTDA 2XNRA 3M6WA 1W2IA 2ZVIA 1IUJA 2MKHA 4NA1A 4ZP9A 1FX2A 1ZTWA 2R7OA 4A8QA 1I1GA 1XR7A 1HWUA 5HMWA 3OTOF 2BOPA 1I5OB 4NLVA 2KM8C 2V4JB 3HVTB 4USJC 1KBRA 2ZC4A 1CS4B 1DQ8A 2DNLA 3V6JA 3ENQA 5ETRA 4GKJF 4RW6B 3AXMA 2DD8S 1TL7B 3RAQA 2COLA 2HNZA 4RW7A 3HFKA 4P7TA 2E5GA 3BKTA 2KYXA 5CCMA 4RO0A 4J9OA 4YB5A 3RAXA 1RCXB 1NB7A 3TUZC 2MKCA 3BGFA 1PBAA 5HMXA 3PIOQ 3LPYA 1IJFB 3MZIA 5I3UB 2BEFA 2DEIA 1QE1B 2LLZA 4QZVB 4UF4A 2M9KA 3NCQA 5LSOA 2XTJP 3IM8A 3B54A 5DZ7A 1QAIA 2B5JA 2IM3A 4F4KA 2XY6A 4YY3J 2XGQA 3G6ES 2R7UA 1KS2A 2GMLA 1NU4A 1JQGA 1RJJA 3UFCX 1HQ2A 3QYYA 4PG8A 2UUAF 4OZLA 1HQUA 1HMVA 4OFZA 4JI5J 4K2XA 1RWOB 3Q2SC 2B43A 2ZDPA 1VS3A 2D3O1 5C7PA 2Y0SD 4QYZJ 2HSEB 1RT7A 3OR2A 4IUFA 3F41A 2G4BA 3CULA 4F3MA 5J2PB 1VRTA 1M5SA 1IJEB 2KXFA 1K44A 2RKIB 3NWRA 1Q78A 4KKOA 4KO0A 4M5IA 2B4VA 4JB8B 1N88A 3KJVA 1S1TA 4HDGA 4JV0A 4O44A 1HBNA 4MK7A 4Y65A 3S01A 4ED8A 1EJ7L 2W7OA 2HNYB 3LAKA 5BXIA 4ZIVA 2OPSA 4J90A 2J8AA 4Q0BA 4E0DA 2Z57B 5HSPA 4CT8A 2OPPB 4Y00A 2MQ8A 2BDPA 1DQ9A 3H42A 4OYZA 2B8PA 3IG1B 4X62J 3RB4A 5KOWA 4F2SA 1RXOB 4K4UA 3LALA 1VDHA 1S1VA 2GVZA 3IS9A 4J9VA 3V5RA 2W9AA 1U2FA 3NGRA 4ZJLA 1AFIA 3EGVA 1PILA 3W2VB 2MGZB 2VICA 1VMBA 1TL1B 2OPQB 3AY0A 4M63A 2BOAA 3AOCA 1JLFB 5LSRA 5KFDA 2HG4A 4OMFG 2QLFB 2YKMB 3CD6S 3CIZA 1TKTB 2GNKA 4HI2A 4DSLA 4DR6F 4B3MJ 3R7SB 2HMIB 2D3OR 1XWLA 3D0GE 5E33A 2MHEA 2C2NA 4P10A 4WFBQ 1SJ1A 1WEZA 3U27A 4ILLA 2IDEA 3D4JA 3OTBA 3FCWA 4L75A 3W2WA 1YTYA 3HHKA 2DR5A 3D7SB 2JJ4D 4B3RF 2M52A 1SUQB 1PJ7A 5E0OA 1OIAA 1N32F 2HNDB 3KHGA 4OV1A 2CQPA 1KFDA 1GMWD 3GONA 3GJTB 2I1RA 2JZ5A 2W7AA 4OZ3A 1N5TA 4QQBA 3TJ9A 2WVCA 2XNQA 2KHCA 1U1RA 2FY8A 3CMQA 3R6GB 2C3PA 4LREA 1WOOA 3EVMA 3QT6A 2Q3PA 3H8YA 3PR5B 4V19X 3Q8YA 1YBUA 1VQSA 3OUYA 3H20A 2BACA 1JNRB 2CQ0A 2NSBA 2CG4A 3POTA 4DN0A 5KFOA 3MECB 4U7UD 1RAFB 1OWXA 1MN9A 2PEHA 2BE2B 2YWWA 3VWSA 3ZZOA 5CD4A 2I5JB 2PE8A 1MROA 1Q0NA 4M95A 4L72B 2DNMA 4YR2A 1LWFB 1NPPA 1YK9A 1YSJA 3SFUA 3TAMB 1HYSA 2CWXA 1SKWA 1MN7A 1OY9A 1HPZA 4PXEA 3UI3A 1RTZA 2R7WA 3HSDA 2VG7A 4DR3F 4XDDA 5DLFA 5RUBA 1RHJB 2BXJA 2QV6A 2XZDB 2K8GA 1U1KA 4LRDA 4CQ1A 4X62F 2KFZA 3QSIA 5BYSA 2F1FA 5BJRA 2JEFA 1VHFA 4F4XA 2IHR1 3MAAB 3ZZRA 1TAUA 3HT3A 4RW4B 3RGIA 2QJ3A 1UW4A 4IR9A 1RHRB 4RUBA 1M5PC 3IC1A 1T9WA 2C2KB 2RU9A 3PYEA 4EK2A 5JUMA 2LEBA 2XC9A 4QWAA 2I9SA 3BO3A 2HRYA 4ECRA 4HL9A 2H5IB 3PX0A 2WW8A 4K59A 2GQQA 4OYAA 3SSRA 3DGVA 3THTA 1J27A 5ETOA 3I4PA 3PIPQ 2VBXA 4RNFA 3A8JA 3M30A 2Q66A 5H9EJ 1J5OB 3KJQB 4OI3A 4WE1B 4USWA 2RDDA 2MYFA 1RTIB 3GIJA 5AJ3J 1FWKA 4ZJOA 4DR2J 2YNFA 2HEKA 1B99A 1B7FA 4CH1A 4B9MA 4ZA1A 2Q79A 5GADI 4NLDA 1XEZA 3GZ7A 3N01A 4FNIA 2Y1IA 3HJFA 4B3RJ 1FNOA 4N8OA 1JLBB 5A2QU 3UCUP 1WKLA 2PD1A 2NUUG 2ADCA 1FERA 1ICEB 2XEXA 4HHHA 3VGTA 1ACMB 1P6TA 5F0UA 3JAMY 4DUYF 2OP5A 2ZOGA 2CJAA 1NK0A 4JI2J 1FX4A 4C98A 2H4YB 4KFBB 4JUZA 2VBZA 1LK7A 2ZD1B 4CTAA 2MY8A 4PWDB 4U6PA 2PO4A 4OJGA 1H2UX 2O1PA 5C24A 2LMIA 2WSEC 4FBTA 3VF0B 4XTTA 4OJHA 2HBZB 2Y3YA 3B8HA 5C24B 2XLKA 2A1BA 5F9NA 1FKPA 2ZH1A 1IM6A 3PR4A 4LF9J 1Y3JA 2RAQA 4WP9A 3M32A 3W2WB 4MH8A 5C42B 3BB5A 4G1PA 2EKNA 5ETQA 4C8OA 2F9DA 4A47A 2ZJRQ 1WKKA 2OFGX 3QGIA 3PV8A 4M5MA 2KO1A 4XK8C 2WTFA 2H3EB 1SI9A 4YFUA 3MR5A 2M3DA 3C3LA 3C6TA 4GO7X 3CSKA 4X84A 4RWXA 3RYLA 2W8LA 2MZTA 3D5MA 4DWIA 4HR2A 4PUOA 2RU3A 2EFOA 4ZVFA 2GAHC 4WFZA 3TEGA 4C11A 3TJAA 2BQUA 4LBPA 2EC0A 2XS7A 1EARA 2D9PA 1RADB 1PG5B 2WB1D 1Y3KA 2ROEA 2VG6A 1C2PA 4ID8A 2W9BA 2UXDF 2OD6A 4GKKF 2GX8A 1C4AA 2DR7A 1SC1B 5HLFB 2KN4A 5IV3A 1HPZB 1S12A 4IDKB 3MCNA 3SXLA 4ES3A 3M2RB 4NCGB 4PRFA 5JXSA 1IKYA 2KRRA 5AXKA 4OIXA 4QWBA 3R97A 2VHGA 3OJUA 4LFCJ 1H7WA 3EICA 1GX5A 2WAQD 3C6UB 3GYGA 5KFYA 5A8KA 1RTHB 2IRXA 3NGKA 3N9UC 1FRIA 2WVFA 4N47A 3I87A 3GIMA 1IKVA 1F9EB 5LXYA 5IV4A 1Q53A 5A8RA 3HVWA 3SCKE 4NASA 1RT5B 4FYVB 1X5PA 5F8GA 2OAUA 1TL4A 3DDNA 5A8WB 4RW6A 2F8HA 4OYPA 4ETXA 3MMAA 1O8BA 4IFYA 1VC6A 4DPTA 3QIPA 3ZZTA 2DPIA 2NZCA 4FKXA 3H2UB 5T14A 4QR1A 1RTDB 2HBQB 3O44A 2FLOA 3HP6A 1FVSA 4KGMA 4LF4J 1MLAA 1T0TV 2K1RB 4L76A 4R8UA 3PKMA 3MMCA 4LIWA 5B0EA 1RI7A 4TY9A 2ZBPA 4LFBJ 5KFUA 4A8SA 3M6UA 4X65F 2PA3A 3G6VA 3T9NA 3QFHA 2EK1A 3D1HA 5LM7E 2MDAA 4N7TA 3ZXWA 5GAGU 5IWAF 1RHQB 2CPJA 4ANEA 4EBEA 3U1MA 3M1VA 1EX8A 2VPZB 3ENWA 4CNYA 3DRXA 2WVDA 2GVDA 4DQPA 3OJSA 1TFWA 3DMJA 2MKIA 2ZWOA 4OI2A 1WWHA 3SIPB 3VQTA 4FS2A 4DUZF 1NCLA 1NK6A 3H98A 4R25A 4YHHF 1JK9B 4F4ZA 3PY8A 4JI1J 4LF8F 2RVJA 2MQNA 4CH7A 1R0BG 3THVA 5H9FJ 5C25B 4QYRA 2RNEA 3D66A 2BMBA 4O4GB 5ETMA 4IFVA 1CQNA 2ZEJA 2BUNA 3WIVA 1HBMB 1NKBA 4WF9Q 2FVPA 4ATNA 4MFBB 1RKJA 1WHYA 1RWVB 1TR0A 2F8EX 3L3CA 3GV5B 2PI5A 4A8FA 2BJ7A 3KG1A 3W7BA 2PEBA 4JOUA 3OTCA 2VA3A 1F5CA 4HKQA 4JI0F 3DRSA 4PYAA 4QR2A 3MWBA 3Q8UA 1U47A 1EP4A 4PZVA 3DI6B 3OD2A 1EHWA 3ZZYA 2CQHA 2AZ3A 3NS6A 5J1EB 2XMAA 3HHEA 3HXMA 5CYMB 4DX6A 5HBMB 1QVFR 1G2EA 3I9V9 2H54B 2OPSB 1HI0P 1Q4RA 4P71A 3FFIA 5A0YA 4DR4J 1V5VA 1VIXA 2KJVA 1REGX 2R7QA 3HHLB 3MCOA 5THWA 3VGVA 3KK1A 3BSOA 4W4MA 4WU2A 3TVKA 3MR3A 2IRUA 1NBEB 4DQRA 1EQMA 2G0CA 4O3NA 1FRHA 2HHXA 3LANA 4K4SA 4NOHA 5KFQA 2Z56B 3DLBA 2LP4A 5K14B 4Q8EA 3W2VA 1V3ZA 5IT0A 2DH7A 4WU3A 3MD1A 4I6WA 3KNGA 4N77A 3G9CA 4O4RA 4RUCA 3QWUA 4Y6IA 4YUDA 1U1OA 5F8JA 2P9GA 4OX7A 3Q22A 4X65J 2CZVC 4HHUA 1B70B 2G1HA 4CDIA 1GT8A 3OSPA 2UP1A 1NZ8A 4DS4A 2YWHA 4R0JA 2FHKA 2NPIA 5IZHA 3G4SS 2R2SA 2VQFJ 1VQPS 3KLEA 3CJ0A 4B3OA 3M8PA 2MZJA 2VKRA 3WC0A 4JI2F 2G0JA 1RU2A 1X4CA 2KL8A 4OI4A 3Q8SB 4FVMA 1KQSR 3VHQA 3TJ8A 1J5EF 1WC4A 3VAFA 4DL4A 3LO3A 2GA7A 3IWLA 3A8KA 4YY3F 4BC7A 4LFAJ 1X31C 1TVRA 2VBWA 3MMJA 4C0HA 4XPCA 4WTOB 1TV6A 2YWKA 2R2TA 1C4CA 1S48A 3GB0A 3JTPA 1YJ9S 2J6SA 1CS4A 3EZUA 3W9JA 2DJWA 1NXIA 2YXLA 2M70A 3X3UA 4YB1P 2FHMA 3BPDA 4PYDA 2JLFA 1SH2A 4CYUB 4FF3A 4FYXB 2QL5B 1IKXA 4NLYA 4IO9Q 4C8KA 3KTQA 4MJKA 2YX7A 1S1WA 2AJ0A 1U6ZA 4ANCA 1PSDA 1AT1B 4DV4J 2DRAA 4FYYB 2FZCB 4M5HA 2DGQA 4EBCA 2XHCA 3VGSA 2MQQA 5LMNF 2HHVA 2YY3A 1FHTA 5KT3A 2JVOA 2HHPA 2HNYA 4F3QA 5JJBA 2VJVA 1WEYA 1U4BA 2W2QP 1UWAA 1RAIB 3EWGA 2W2PP 4X4VA 3DRPA 1W26A 4FP9A 1LWCA 1X4AA 3BH7B 4HACA 3I55S 2DO4A 4C0BA 1X5TA 4DV0J 4MFBA 1CC8A 2CYYA 4Q45A 1HNXF 1FE0A 2WVBA 2DVIA 2B6AA 4ICLA 5E3PA 4PQAA 3M2UA 4M5DA 3D0IE 4KKOB 3H4BA 2QA4G 5KG0A 3BGLA 2R2UA 5L9NA 3P6YC 2QT7A 4DR6J 2E1CA 2IC3A 2E1PA 2JC0A 1MWZA 1HR0J 2BYCA 2XG8A 1YZ6A 3W9IA 4C2MA 4B9UA 4B9LA 5FJ4A 1JXEA 4F3OA 5KFNA 1N52B 3EM1A 4LRFA 3ZZUA 1S4EA 1TUWA 3ETOA 1G4CA 3MEEA 2CNOB 3IR6B 1J5OA 1X4FA 1ITPA 1N54B 2E7XA 3M8QA 4H4MB 5AXLA 5HMZA 4RUAA 1CULB 2KFNA 1UA0A 1LWEB 3FJ2A 3M8QB 2O5DA 1G3OA 3CEDA 3R6LB 3V4IA 1RT6B 3M2VB 4LF6F 1LWEA 4DSEA 3ZZZA 4QPTA 1T3OA 1T03A 2OJ3A 1XNQF 1E6YB 1RAAB 3DOMA 2BZ2A 1KQGB 4OZ1A 3PRDA 3I0SA 1FJEB 2AP6A 2RD5C 4QIGA 4F25A 3EX7B 3NLCA 2BJ9A 2BJ8A 3IBWA 4MKBA 5IC4B 2MJUA 1IM4A 1SH0A 2HFSA 3T5LA 4YP3A 1Z1ZA 3R9LA 4EZ6A 2ZNYA 3NGSA 2HMIA 1V5IB 2CJXB 4DOZA 2V8HA 5DQGA 2GW8A 3HPOA 4ZP8A 3PO4A 2OEKA 1Y5IB 5HO4A 1L3VA 2CNLB 3PW4A 1KVKA 1FJCA 1UPMB 2FQQB 3E51A 3TA2A 1RSCA 2LDIA 4NYZA 2CQGA 1UFKA 2RMLA 4I69A 4J91A 4ED1A 2IYIA 1L3TA 2X7IA 1UW9A 4K5RA 4DCOB 3I5BA 2MLXA 3MM6A 3CDWA 3M6VA 5CYQB 4F67A 3T1YJ 4ED0A 4X4RA 3OFEA 2VOOA 2HZVA 1NH7A 5G0RA 3Q8QB 4Y2CA 4DS5A 3TUPA 2CJBA 1V3RA 2FZGB 4ZCIA 4JYAJ 2KT2A 1C0UB 4MKAA 1VLOA 1YJTA 2GFFA 4P9SA 4DXLA 3GLJA 3CCRS 2HBYB 1TUVA 4FKYA 5D0RA 4IOAQ 5DQHA 4ZHRA 3RJMB 1C0TB 2FJAB 3OFGA 1WORA 1IKVB 2KG1A 2MQLA 4QU7A 1EAYC 4CLUA 1FNMA 2KT3A 3NNCA 1R27B 3T41A 4WFYA 5K5MA 1H72C 2AX0A 1DJ0A 5AT1B 4RLEA 3RRHA 1CJTB 1D8YA 2DNYA 1KLMA 4ECQA 3EGZA 3HLUA 4M8LA 3BQ0A 3VALA 1LWCB 4DPWA 3NXZA 1IWGA 4RBVA 2V68A 3SFGA 2HVEA 3KLHB 4LSNA 5BR8J 1XNQJ 3A8EA 1M0SA 2XYHB 1P27B 4LSNB 5IWAJ 3NGDA 3CJKB 5J1NA 1Q8LA 1HHQA 4HDHA 1Y7PA 1NUEA 4A8XA 2Y1JA 2N4CA 5GMDA 1KC8T 3CO9A 2FVRA 1CPZA 4EYHB 3QGGA 1RWXB 2LQBA 2DNHA 3U7JA 4CO4A 4EO6A 4ZLJA 4AUKA 4Z7CA 2H5EA 3BS9A 4P2XA 3ENVA 3MR2A 1YJWS 3ZTQA 4DU7A 2AW0A 4IH5A 2YKMA 4LSZB 2HHTA 2OMLA 1ELOA 2V63A 3OLAA 4ZLLA 1WNEA 4X4UA 3CIMA 4C0OC 4RUHA 1PCAA 2DHSA 1FWPA 3SBMA 3I5AA 4G1IA 3NCPA 3FVYA 1Q8KA 4LUBA 3GIKA 1BWVA 5KG3A 2HQGA 3DLGB 3KKFA 4K2JA 6FDRA 4CO2A 4F4WA 1UETA 1JJ2R 1CJVA 2K7JA 3PEJA 1RKIA 4GO5X 5B0GA 1F5AA 3J80Y 3CCES 5HVFA 1TKZA 3MUVP 2OFHX 3PG9A 3KFWX 4BS2A 2DK2A 4KPYA 1O51A 2KZZA 3CC7S 3D1OA 5DS7A 3DGPB 2CQDA 4RL1A 4LF7F 5KAKA 1TAQA 4YN3B 1M5HA 2ZBRA 4A4JA 1KRPA 2ZHOA 2RDJA 5L1KA 3IN5A 4FF4A 3TQEA 4I2QB 4DV6F 2CPEA 2EFVA 3D9BA 3CT9A 2W9CB 2B9EA 1UZDA 2HNZB 4WKYA 4N8NA 1N0UA 2VV5A 4I4BA 4OX6A 2LQ5A 1X4DA 3D0HE 3VZIA 2V4QA 1LFWA 3OXFA 4ED4A 5E2QA 4USUA 2ZHAA 1P8GA 2YKAA 4RW9B 4LFCF 1ZOTA 2AEFA 2DB1A 4OHWA 2Q43A 1HBUB 1K9MT 1SL0A 2X51A 3SSSA 1IBLF 2Y8WA 3IWNC 1Z4UA 2B5JB 3LP2B 3KLGA 3B6BA 3L7UA 1WHWA 4DN9A 4USMA 2HHQA 5ETPA 2CJ9A 3DLKA 4F0KA 1ZZFA 4EZ9A 4KT0C 4DX7A 3CD0A 2EFNA 1WG5A 4C7QA 1RLCL 4JP8A 2M0GB 4C3KA 1FDAA 2E44A 2AYEA 3I0RB 4QIFA 5KFZA 3EZ5A 1HARA 2FHJD 2WONA 4K7QA 5T41A 1NSPA 1RHUB 1M5KC 2RQMA 3KDOA 2WONB 3JTNA 1U0HA 3VAIA 2LECA 1VC5A 1YJVA 4CIOA 1L3SA 4IG0B 5D3GA 5EWGA 3MHYA 2Y8YA 3DOKA 2OTLS 1VQ7S 4QWEA 4LF4F 1MWQA 2QA4S 3LP0B 2V8GA 2DXDA 1UVJA 3IFEA 1GMVA 2K3IA 2N82B 4I0WA 1U2RA 4ANDA 2R8JA 1RA7A 1G1XA 4JV2A 4IOCQ 3RG6A 3AAWB 1RA6A 4FYWB 2IA6A 4PPZA 4NCAA 2EW9A 2IDLA 1VQ9S 1T11A 2DR8A 2GO9A 2ILZA 4TLQA 3BBBA 2P6SA 1KD1T 3RW7A 1DFDA 2C2DA 3IA0A 2WSCC 4Y28C 1BQMA 4ZP6A 5AXMA 1QSSA 4FNHA 2KZMA 2U2FA 4HTJA 2CZ4A 2H65B 4DL0C 2VKZG 3VZHA 4DV4F 2DGWA 5CA5A 1QSYA 4LF8J 4ES1A 2XGPA 4D3GA 1I94F 2OTJS 2DCUB 3FKBA 1TKTA 5C5JA 2AD9A 2FVQA 4QCLA 1UP1A 3MMCB 2JOQA 2PMHA 4WP3A 2BJDA 2CVEA 2XSJA 4OX8A 3FCHA 3Q8PB 1VRQC 2UUBF 3K59A 4IG3A 4J9NA 3GIRA 2AJFE 2ZBCA 4IG3B 2IBKA 2HS0A 3DLGA 4P72A 2Z0GA 3NGTA 2HLUA 4CYUA 1CJVB 4DF4A 2P2CB 2YPYA 2RHSB 4M5NA 1F5BA 1UVNA 4Y2KA 1JJHA 1NDCA 2HNDA 3RAMA 1R6YA 2F63A 3MEGA 4EWTA 4ICLB 3MEDB 1SBRA 4U8VA 4ILRA 4NA2A 4CM0A 3BPSP 4JV5J 4DR5J 1PAEX 4ZVOB 4CLFA 1SJ3P 3GWCA 3NS7B 5EDWA 3HM9A 1R6VA 5CXTA 3KMQA 1RT4B 3KG4A 2BQ3A 4TU7A 3O1LA 3RR8A 3PDNA 4LMZA 1VFJA 3LP1A 2BQRA 1NJYA 1T05A 5J2QB 3JAMU 1JLGB 4IRCA 1K1QA 3DRYA 3G2XA 1GTEA 2CRLA 2FGOA 4RPFA 2KYZA 3QWPA 3BN7A 3QBCA 1S1VB 4RR5A 4GC7A 1U7LA 3KNAA 3CJQA 4WBFA 4CT9A 5KFKA 4IR1A 3UD5A 2DGSA 2DIVA 4ZITA 4DQQA 4V19J 2KU7A 2MLYA 3ZNJ1 1MU2B 1Q7LB 1RBAA 4ZVQB 2R8IA 2KFYA 2HWHA 3CF5Q 1U1MA 1Q1KA 3UR3C 1YJ7A 4P75A 1CQMA 1AUSL 2AYMA 1FXLA 4HT5A 3JXOA 2IM0A 4DV1J 1RT1B 3A8IA 1RTHA 1UEVA 5D77A 1AW0A 2AJ2A 2EFPA 2H51B 3BR9A 4ITSA 4NLRA 5DGAA 2HVHA 3HF5A 3HHLA 4KGVB 3AA8A 4F7VA 2WZ1A 5KOXA 2A6OA 2N4DA 3BGOP 1MMNA 1U1NA 3P96A 1LWXA 4ZOSA 2YH1A 3MMAB 4DX5A 3CCQS 4NMLA 1X9MA 2VDHA 1D1UA 2HS3A 3M30B 4LF5J 2ZVSA 2VPYB 4NI2A 4C6AA 4E8UA 1NAQA 1URRA 1HNVA 1RISA 1YGYA 4U96A 3MTKA 1XTZA 2XMMA 2ZFHA 3HX9A 3WDOA 4ECUA 1R0AA 3IXQA 2E1AA 2IVMA 4QIWD 5G0RB 5CQGA 4NLUA 5IOLA 2UU9F 4GVBA 5LSLA 3JTOA 1NHVA 4QBUA 3T6BA 2HZAA 1M5OC 1Z2ZA 5DQIA 2GHWA 3VR1A 4HTIA 2AJ1A 1VIOA 1S72S 5K8OA 2KH9A 4UOGA 2AGQA 4O3OA 3R8YA 4KJIA 1TTHB 5AXNA 3A3PB 4QW8A 1FDDA 1VQ8S 1RT7B 3OR2B 4BWJA 2LQ8A 2FB0A 2BX6A 2HKEA 1TV6B 2GS8A 1GEHA 2V2QA 2CQBA 1U09A 2AV5A 3OPKA 4LRCA 1NJXA 1NB2A 2AWZA 2L9NA 3WX4A 4U67Q 3JYTA 2PSZA 5HANA 4C8MA 3ILLA 2WK4A 3M8YA 4TU9A 3O3LA 2Z2ZA 3KLHA 3K57A 2A2CA 1MSWD 2W1BA 2DRBA 4OHVA 1OQ3A 3TZXA 5B0AA 4JI3F 2ZBQA 5J2NB 3QNWB 4A48A 2IJNA 1TQLA 3L4BC 3UE2A 2HS4A 3G87A 2XLJA 4JI5F 1S6QA 5FIIA 1NZAA 3R2CJ 2NLWA 2CXEA 4B3SF 4O23A 2N3OA 1RP5A 3LP1B 3W5ZA 1GX6A 1WDDA 3LGMA 2W8KA 1KVJA 1T95A 5J2QA 4K0KF 2RDIA 4L6V3 1B0TA 5A6PA 2CWKA 3PRBA 4XAKA 2ASLA 4ZVTB 4DLEA 4MIWA 4ZPWR 1BY9A 3ZC4A 3TP2A 1VK8A 3H2LA 4NLOA 3KK1B 3EPGA 2FC9A 2XM3A 3Q23A 1NSAA 3UN3A 1HKAA 5E3RA 5B0BA 1H0HB 1BGXT 3BO4A 4ZVEA 3D6FB 1OQ6A 1YLXA 2AGOA 1FVQA 1NNDA 1SUQA 3SZ2A 1YITS 2V50A 3DHXA 4MIBA 4CRJA 1UJ4A 3V81A 5BYQA 1RB0A 1C1CB 1LFPA 1D0EA 1W25A 5KG6A 1DLOB 1N32J 4C4WA 4J9LA 1A7GE 3TR5A 3V4IB 1RT6A 1NHKL 5ETKA 4B3OB 2JNJA 2R7TA 2KT5A 1HBMA 1GFWB 2WBRA 2ATCB 1NJIT 3DU6A 3HHNB 1WD6A 3KHHA 3KLFA 1MROB 5HQLA 3MPVA 3Q83A 2J0SD 2EKYA 3HO1A 3C15B 2BR0A 4S0MA 1S7IA 3FCVA 1N34J 1QSLA 2F4FA 4J37A 2XO7A 4H4OB 4C3MA 1XN9A 3CJ2A 1XMBA 4F50A 3UVJA 1KQKA 3J7Z5 3C19A 1G6BA 1U6FA 4DSJA 2VA2A 2F4VJ 4LR7A 2YWGA 3NS5A 2NXUA 3BREA 4OZ2A 1VC0A 3HULA 4I67A 1RE1B 2H1YA 4CP5A 4C48A 5HLFA 1JB0C 3IO1A 5LT5A 5KT4A 4B3SJ 2VL1A 1SCJB 5KFCA 2HWTA 2V6AA 1CSJA 1QE1A 3EDRB 2W24A 3HDSA 1KLNA 4Y2AA 1IKYB 4J9RA 3IGNA 4OYBA 1F2GA 4DG1A 1FFWB 1GXUA 2GMHA 1BC6A 2QO3A 3FSXA 3E2EA 1KVIA 2M8HA 3D6MB 3MM7A 2F8MA 2OPPA 1FJ7A 5C2GA 2HQIA 3NOCA 3PYGA 4ECWA 2AIRB 5A8RB 3UR0A 1NO8A 1VBKA 2BRLA 3QAUA 4CLZA 3BF4A 1HWLA 2KI2A 1V9OA 3Q24A 4DV5J 2ZZNA 4G1QA 1NRKA 2LA4A 1YIJS 2H9ZA 4ZVUB 4FXVA 1YI2S 1FRXA 1K73T 4B9VA 1UVKA 1ZAXA 2NSCA 2WOMA 1NDPA 2NXCA 2KRBA 2W2MP 5J1EA 2XI2A 3W9HA 3DM2A 4C97A 4M5JA 1RAJA 2ZD1A 2L3MA 2JHEA 1YDLA 2NCKL 2OHDA 3IBFB 3R7NB 4NX9A 2QC3A 3CC4S 2YTCA 4PQUB 2V2KA 1FD2A 1JKHB 2DITA 3GYXB 1JIHA 3NGUA 2D7SA 4O0NA 4DZDA 3H5YA 1XMQJ 1U45A 1XJWB 2E1RA 3MPDA 2CQ2A 2ZH6A 4K4TA 2R4FA 3EPIA 2FY1A 1TKZB 3EUNA 1PC5A 4C8ZA 4P7VA 4JV5F 3PJ9A 3QZ7A 1KEKA 4AL5A 2G1DA 5CH7B 4AFFA 1U1LA 3GJRB 3GYNA 3NCRA 4UZBA 2UXBF 1WUUA 3FSYA 4DUYJ 5H9FK 3BV8A 3G71S 4UZCA 3I31A 3M8PB 4IRKA 4ZIWA 3CUNA 1W7WA 3TZWA 4B17A 4OYWA 2YX4A 2F3JA 2YWEA 3POTB 1Y00A 3TX0A 4QWDA 1H38A 1LW0B 4HI1A 4I56A 1VRUA 4YB7A 2JEIA 2VOPA 3GPAA 1FKPB 2V0NA 3MM8A 2VG6B 2W9BB 1F6TA 2IA0A 1S76D 3GSDA 2D9OA 3PEHA 3PW2A 2FLLA 1TELA 5D3GB 2CFXA 2CIMA 3AB2B 3R1HA 4FPRA 5CZXA 3DRSB 3BGUA 4U9RA 3BQ1A 3CB4A 3BZQA 3A13A 2VONA 1GQEA 1MU2A 2VPXB 3RBDA 1S6PA 3SQGB 4N76A 5LJ3Y 5FLXY 2XMUA 4CLYA 2VH7A 3QO9A 4ID5B 4ZP7A 4ELUA 1KP6A 1RYRA 4OZ5A 1T05B 1N4LA 4HEA9 2IIHA 2EBEA 1B0VA 3O2IA 4CLKA 3DN9A 4Y0FA 4PG4A 3GV8B 3E01B 4Y3CA 1XK8A 2B56A 3M8WA 3NRBA 3BJYA 1T9TA 3ILJA 3VAGA 4OI0A 1NK7A 2DO0A 3AJ2A 4TY8A 3UDEA 1D9FA 3D3BJ 3DOMB 1Q95G 4C8NA 1B3TA 4WE1A 1VGYA 1QDUB 5ETLA 3FDSA 3M2RA 3J80U 2R8GA 2G2ZA 3PNIA 1HD1A 5K8PA 2UU9J 3LH2S 3UD4P 5CCLA 2DKOB 2QG9B 1R0AB 3MAAA 1RT1A 1ULRA 2DNNA 3LWMA 2EXUA 2ATLA 3AHPA 2VBYA 2APOA 1LK5A 3MUTP 1I94J 1IWAA 3V4MA 1NHUA 2ADBA 4DR1F 5D4LA 3DKDA 2DBBA 2D69A 2UV8G 3CJKA 1QUPA 1CC7A 3RRGA 2MQOA 2DGVA 5GMKa 3OR1A 3EXYA 5HJXA 3T19A 3CCJS 1T9XA 2KDOA 2ZJPQ 3DM2B 2RF2B 5H1SV 1AFJA 3PACA 2IPOB 3RUBL 2RF2A 3GJQB 4N5SA 3KUGA 1JXLA 5CAAA 2HK2A 3LGHA 1AA1B 3WC2A 3T1AA 4UOHA 4ILMA 1N5VA 2PN6A 4F2RA 1BQMB 2YVSA 3OXGA 3UDLA 3NMAA 1QAXA 1LXNA 5C42A 3GFHA 3R5BA 4BHQA 4RU9A 4NXMJ 2GIFA 3AA9A 3HHDA 3SV3A 4NCBA 2QYGA 2R7VA 3OVSA 3QPIA 1FKOB 3ZTPA 3B4MA 3M1VB 1LV5A 2ZKUA 1CG2A 1FRLA 2FHOB 2PMWA 3OXLA 3FEZA 4IYQA 5JVGQ 3PJWA 1SKRA 5J2NA 4YDXA 4DSKA 5HVHA 4DR7F 2WBMA 4ZCKA 2P5VA 4UQTA 3CVKA 1M5VC 3HVAA 4DFPA 2KVQE 1DARA 4DQSA 1N5YA 1LQ9A 4NLTA 1S1TB 2E5JA 2W4CA 3ISNC 1IBMF 5F8MA 2B9WA 1RT2A 1WKJA 3BKUA 2M5YA 2EPIA 5G4DA 3KJNB 2QRRA 5M2PA 4X64F 3ELHA 2ZJQQ 4JI1F 3SMZA 3DOLB 3TAQA 3MM9A 4PAAA 1XMOF 2CZ9A 1NK4A 3ISZA 4O0IA 3EGNA 3QSYB 3HKZD 2XMVA 1F2HA 3M2UB 1UCNA 4M5DB 1XERA 3MEGB 4LJMA 1LXJA 2FDNA 4ZVRB 5HATA 4F0HA 1VYAA 2MY7A 5IT4A 3KK2B 4J9QA 2F65A 3KOAA 2CQCA 3CCZA 3C6TB 3HZGA 3OQ2A 5CYJA 2DHGA 3GV7B 1YX2A 1ZBTA 3IAM9 5A6WA 3GIIA 1S6PB 4K8RA 2GJFA 2HLTA 1HIYA 3FGVA 4NLQA 3R2DJ 4ECZA 4WWSA 3FQLA 2AMCB 3RB3A 3MI7X 1REVB 2ZC3A 4D3HA 1F3FA 2CKWA 2PC6A 5KFAA 4CO3A 2O01C 2HYIB 2A6MA 3BBFA 5DJBA 3QLHB 2NR0A 2L08A 2U1AA 4L3NA 2CDQA 2CNNB 3LAMA 4MTPA 1E6YA 3NKYA 4ECVA 3QLHA 3CD5A 1PBUA 5KFBA 3F56A 2GQ2A 2J76E 1IN0A 2AJ4A 3BDPA 3CDAA 3K7RA 5E3CA 2Z30B 3N4WA 1KLMB 2XYGB 4B08A 2MHNA 2OPRA 3MPWA 4ZPAA 3K5LA 4AXIA 2XB2D 3U1NA 1XMQF 3RR7A 3AJ1A 4EO8A 1S9GA 2NYHA 5LOQA 1IR1A 7AT1B 4DPYA 4ECSA 1DRZA 1KFSA 2B4UA 2HHHF 4WIQA 1FO1A 2I0XA 4WFXA 3W65A 1N33J 1YKWA 3AOBA 2WVEA 3JQJA 4I2QA 4LRBA 3KYLA 2M7SA 3DYAB 1ZM2A 1FTCA 3N79A 3M9MB 2GVDB 3Q86A 3RB0A 3DU5A 2FLNA 1WF2A 1R8CA 2W7PA 2BW7A 2B9YA 4NI2B 2VQEF 1R8HA 4LVNP 3PHEA 5HROB 2C2MB 3IRXB 4KHPJ 1WC3A 3W5XA 5KFIA 3ZTSA 2LKZA 3SDEA 5B0CA 4EEYA 2B51A 3GFXA 3QJLA 2N7CA 3BN4A 5KFGA 4RNMA 4FF2A 2N7YA 3CJRA 1VQ4S 2HHSA 1D8ZA 2RE1A 3DLKB 2MZRA 4H4OA 3DRRA 3VTIA 2QEXS 5FDLA 4LIRA 5IT9U 4KR0B 2YQ0A 3HMJG 3IBCB 4CO5A 9RUBA 2AYBA 1WHXA 2B4PA 3A4TA 1SVDA 5EX3A 1H98A 5GVQA 3FBEA 1HL6A 2ZBIA 4KC5A 1VOMA 3T3FA 1RT3B 4KAIA 4WFAQ 1TK0A 4KO0B 1DQAA 4JI8F 2C3UA 1KONA 2DGUA 1TKXB 1WEXA 3PYDA 1FJGF 1RZMA 1YRXA 2GQCA 4AT1B 3OL8A 4MK9A 2GC8A 4HHJA 1IR2A 1F3VA 2W01A 1X5OA 4U8YA 3U02A 2MKKA 2OI2A 4P2SA 3TA0A 3FSIA 3CMAS 2JVRA 5GMEA 3EYZA 1VBXA 1VQ5S 1SJ4P 1BE4A 2W2OP 3J7ZT 5K8NA 4DMZA 1RACB 4K4WA 1DAXA 1IKWB 1HNIB 1FE4A 1LEOA 2ZOFA 4NEZA 4I6AA 4TYBA 2WW4A 2OEMA 2V9KA 5M2RA 1JJ4A 4B3TJ 3G8QA 4Q5VA 3KMSA 2HFVA 3DC2A 1UFWA 3R5DA 3R5JB 5HQMA 1F9FA 2RH3A 1PYOB 1HI1A 2YKOA 3I96A 1HWKA 3WHIA 1KN6A 2PFDA 2IAJA 2CJQA 4IKAA 1RGVA 1CJUB 1S57A 4GVLA 4A8OA 3VAMA 2RB7A 3K5PA 2AGPA 5IQ6A 2IC3B 4WXOA 2OD4A 3IP0A 4ZMMA 3OV7A 1B7YB 3DXSX 5I3QA 2GHVC 5F8NA 1OYDA 2RJZA 4JI4F 4X66F 5HN0A 1LW2B 3W66A 1T8EA 1R0CB 4ES2A 3GP9A 3OHBA 1JX4A 2L48A 1BHNA 1UZHA 4F4YA 4ECTA 2JLGA 1NJWA 1OY8A 2VB6A 5B0FA 4EYIB 3P49B 1EQ0A 4P73A 3G8SA 2PGCA 3DCAA 4NL5A 1A9NB 2VQEJ 1WF1A 1APSA 1ZETA 3LA0A 3S1TA 1FXRA 1TKDA 1FTRA 2QE5A 2L9DA 4LFBF 3CD7A 3ZTRA 4DPUA 3M4XA 2CG8A 3T9ZA 5D78A 1FA0A 3ET6B 5LJ5Y 5CYQA 4YMEA 3MM6B 3QZ8A 3KHRA 3V81B 1N48A 3V6DA 5FD1A 2VJUA 2ILYA 4FPIA 1K1SA 3IAS9 3D6TB 4J7CA 2R7RA 3PW0A 4CCHA 3V6DB 2XWYA 4YQWA 2VFUA 2GGPB 2UUAJ 3OUYB 3K5OA 3ONQA 5DG8A 3SYZA 2CJKA 1F9HA 3PFOA 4OYMA 4YHHJ 2JEGA 3QRRA 2ZUGA 1R7IA 3O5TB 2JWNA 4RW7B 2UUTA 3NOGA 3CJTA 3R3TA 1VJWA 4FZVA 5HI7A 1LWFA 4AL7A 5IFMA 1H2TZ 3G86A 5A76A 1J5EJ 4O3SA 3HSZA 4AXJA 1Q86T 1U24A 3W63A 1PIEA 1HBOA 2ZH9A 5H9EK 2ERRA 2V9WA 1RWNB 2QTWA 2XMJA 3D1QA 3UCGA 1O0PA 4DHVA 1HBOB 1FWLA 3HHLD 1FK9A 2CADA 2CPDA 1FRKA 3MXHP 4ELVA 3DRRB 3MOZA 2FHJA 5AE3A 2PMZD 4NLGA 3GFZA 1M1KT 4Z7YA 3CDBA 1IVZA 3FC9A 3N6MA 1URNA 2XYPB 2GJ2A 1AROP 3THPA 3QRQA 4IG0A 2QMUB 2YKPA 3I5CA 3T5KA 2IY5B 3DOKB 1DZ5A 5KFSA 3OSNA 1UVIA 2HGLA 5DM6Q 3JSMA 2OSQA 2EG1A 1KTVA 2QA1A 1Q5YA 4JI4J 3R5CA 2G0IA 2LVWA 4KTQA 2A0FB 2LU2A 5MAOA 5D6GA 2NS1B 3LPEA 1E6VA 3CXCR 4HT7A 1OS5A 1YBAA 2ZZTA 3MF5A 2FYXA 4YEAA 3HI9A 3L7PA 4MKVA 4CM2A 1KTQA 1Q16B 2FJWA 4IQMA 4IQXA 4FF1A 1Y5NB 3O8WA 3R5AA 5HAOA 3V6HA 2VFTA 2BV3A 2BJEA 4G65A 4DV7J 4DV0F 3EE3A 5IS2A 2NZ4A 3KDNA 4C8YA 5T7LB 3I56S 1TL1A 1OJ4A 4NWBA 4EI2A 4DL6A 2UVRA 4QJVA 4FYDA 3BBCA 3AQPA 2HHHJ 2E9ZA 3AT1B 2VIHA 4DFMA 3MM5A 3OBIA 5J2MB 3V2UC 1VQ6S 3KK3A 2VFSA 5IC6B 1UMJA 2B8QA 5F3ZA 4B9TA 2P6TA 1I3OB 3BGRA 1OSDA 1RUSA 5KG4A 3PYFA 3QJJA 5F0WA 3MEKA 1TUGB 4KY3A 2EG2A 1YJUA 4ALZA 3HJVA 3LQVA 4LFAF 4I7FA 4RU2A 3FZ2A 2F4VF 3EXCX 4DBQA 4G3IA 1X9WA 5KFVA 2ZH8A 1P9YA 2ZH7A 4E2FB 3NY0A 5JVHQ 3FRZA 1TMMA 1HNVB 1KHWA 4URSA 3OHAA 4WK3A 3W64A 3GFYA 4PUOB 1X4BA 5I42B 3KLFB 2PDAA 2J7KA 4ECXA 1GTHA 3PHTA 2B0GA 3CNQP 2AU0A 3I9ZA 1XR6A 4GMKA 4R0EA 4OL8A 2DY1A 2BKPA 3QO9B 4ID5A 1S4FA 2LXIA 4EMDA 3PVXA 4LQ9A 4K4VA 4CZCA 3FQKA 5HBMA 4URQU 3P8BB 2K06A 2LA6A 3KG0A 5DDQC 5HVGA 3PKYA 5KFXA 3F44A 2O66A 3CJ8A 4PXDA 2VODA 1JXVA 3MCSA 2ZOMA 3I4HX 2Z2LA 2IM2A 3TRGA 2BM0A 3F73A 5D8HB 3MUMP 5K14A 1QAYA 3M05A 2HRTA 3RZAA 1P1LA 2VASA 3TX8A 1HW9A 3MD3A 4DR2F 4ED2A 1UPPA 1DBDA 1Y11A 4F4AA 5U47A 4ZHRB 5GAHI 1HHTP 3Q8VA 2W4DA 3W60A 4GKJJ 1RT5A 1SIZA 2BM1A 2AZ1A 1UKUA 2YKNA 1HR0F 1JMTA 3C16B 5L39A 1EETA 3DLEA 4NRUA 2XS5A 1AUDA 1GNKA 2X1GA 3C16A 3OR1B 4X66J 2N3LA 2IFXA 4G1QB 4TKTA 4CNZA 2OUGA 3PX6A 2M88A 3C2PA 7FD1A 2FVCA 1OY6A 1Q79A 1QTMA 3AFGA 4R8UB 3HFZB 5A2QY 1BLUA 1S9EB 2QYCA 2DNOA 2ZE2B 2YQ1A 3P4UB 1GH8A 1SKUB 3U1LA 2UXDJ 3G8TA 2RUGA 3D6HB 3SDEB 4NXMF 4UQGA 3OVBA 1U0SA 5KFTA 5CD4H 4UUXA 2RSQA 3NAIA 5KT2A 4DSFA 5IQQA 1WF0A 4KSEB 1VQMS 3GG0A 4NZ7A 3QT5A 1VR6A 4DR7J 2VD3A 2LEPA 1TL7A 1S1XA 2IJRA 3K8WA 4BLGA 4DUTA 3JQMA 1J2VA 4CO0A 3TO8A 3IRWP 3K58A 4WZMA 3HHLC 3ICLA 3TQ1A 4UTGA 2PFFB 1IBMJ 2YH0A 3EVWA 1F1BB 3UWTA 1WC0A 5LL6d 3MURP 1S5ZA 2NUHA 3AD8C 1ZM3A 3VQSA 1CBKA 1H73A 1TKXA 3G6YA 6AT1B 4X4SA 3QT7A 3DLHA 1TL5A 1U48A 1U02A 3E3XA 4IFVB 4MAKA 3OVAA 4NYOA 2RILA 3UN5A 5C25A 2CQ4A 3Q0AA 1T9UA 2F40A 3GSIA 4HACB 1AZSB 2DNRA 9ATCB 3MDFA 1KWMA 2IBOA 2DRDA 2IMOA 3L09A 3DHWC 4I2PA 1AZSA 4P6QA 3ENAA 3ZZ0A 1VK3A 3MM8B 3P5TL 3RBXA 1HNZF 2C2OB 2HW3A 1O5JA 3FMWA 5ETTA 1DURA 1NK8A 4ED7A 5EN1A 3S6EA 1GMUA 4DL5A 1SC6A 2VC1A 2EEYA 4WYWA 1N5YB 1ZS6A 1N6QB 5GAHU 1S59A 3H90A 2CDRB 3N6LA 2BVZA 2L9WA 2QMXA 3AB4B 2XCPA 1S0OA 2JDJA 5D4NA 3M8SA 1JLQA 4J9UE 4PG7A 1HBNB 4B3MF 2HVIA 1RHKB 2X1FA 1KOOA 4DR5F 5ITHA 2OIHA 3ZO7A 1WOSA 2AHOB 2DGOA 2Q1LA 3BO2A 1LW2A 4ZPCA 1GMWA 3SCJE 2KHDA 4K4YA 3FFIB 1S9FA 1HA1A 3FZBA 1Q5VA 5MLCV 1DTTA 2JRSA 3PFEA 2P9EA 3JS9A 3UO0A 2HFZA 1S49A 4DLGA 3CJSA 3GTYX 3LP2A 3KLGB 3N28A 3AD7C 2R3VA 4NCGA 1KQFB 4O3PA 2FZKB 4U7CA 5BR8F 3JB9k 1U6BA 4YB6A 3D67A 1GXLA 1JLAA 3DDIA 3A3NB 1U49A 3HD2A 3T5JA 4KE5A 1HHSA 1X5SA 5AE1A 4L3KA 4CH0S 1NPKA 3GR1A 5DO2A 1N56A 3CC2S 1U0HB 3HFVA 4GVBB 2W25A 2C1EB 4USKA 1DY3A 1UTAA 1WC5A 1EETB 2PA8D 1SV5B 2QLBB 3DLEB 2MLZA 3J7YU 4DJBA 4C9DA 2J7UA 2XI3A 1VRUB 2RRAA 3RBZA 3D68A 2ROGA 1FRJA 3H59A 1KSPA 1IBCB 1U2CA 1TL3A 4E98A 5CABA 1U25A 4DL7A 2AQ4A 4FBUA 4FN5A 1UVMA 3L9ZA 2CPYA 4OLOA 1RTJB 2EC2A 3KXDA 4USIA 2FUG9 3VAJA 1AB8A 2KG0A 4PCQA 4KIAA 4OV6A 4QR0A 2UV8A 4LBHA 3SCIE 2D74B 3VAHA 1K8AT 5SUHA 1VHIA 4BDPA 2HGNA 1HMVB 3TARA 1NDKA 2V8PA 1S1XB 3EGWB 1N5QA 1UAWA 1RT3A 4B9NA 3H5XA 4NXNJ 2AF6A 5HROA 4LBIA 2C2RA 3TWZA 5LXRA 1X0FA 5KT7A 1YQHA 3QJPA 2K2PA 1OPZA 3VVTA 5EWEA 1OPIA 1O6XA 1WDTA 2GMJA 2HURA 3PRVA 3W62A 3TA1A 5F8IA 4HYKA 3RTVA 1CJTA 1RAGB 1UL3A 8RUCA 3R7BB 4GKKJ 1JLCA 2YWFA 2ASYA 1QJHA 3CCVS 2DNQA 1VBZA 4JYAF 3LW5C 2E5IA 2X1AA 4EUVA 3C66A 2HFOA 3EVOA 2LDYA 1R31A 1ZPVA 2VFRA 2B4OA 4WZQA 1L5UA 4ZLPA 5J2PA 5HK4A 1T9VA 2FPHX 2B6AB 3KWMA 4KBIA 1M1GA 3IGVA 3W61A 2OKQA 1T7PA 2LEAA 4OYXA 3M8ZA 3NL0A 3QGPA 2JC1A 4FDFA 3C8YA 2RT3A 4RWWA 2HBRB 1SIWB 4J5OA 3HSJA 3VV2B 3PM9A 1SC3B 1NDLA 5CYMA 4H4MA 5B09A 4X64J 3TI0A 2GIQA 3RW6A 1U26A 2HFUA 3OFHA 4RBTA 3J7A1 1NH8A 3MEEB 4PQUA 3KHLA 2AT1B 2MKJA 3PW5A 1R8PA 1WI8A 5ETNA 5ETVA 4V1Ak 4ZLNA 3PXGa 3CGIA 2M4MA 1T03B 4F26A 1FF2A 2X3GA 2UUCJ 4UY85 2B7BB 4LSLA 4KB7A 4A8YA 4DU8A 3IR5B 4JBCA 2RQKA 1OSCA 5I42A 5B7WA 4QPXA 4QIVA 3C15A 1N6QA 2QZ8A 4DV1F 2RRBA 4ZK7M 1SPBP 3VGUA
chains in the Genus database with same CATH topology
2QSWA 2J6TA 1RT2B 5K8MA 1S6OA 2QSFA 3MECA 1MMLA 4PXBA 1KNZA 2QLWA 4W92B 2VUGA 4XIUA 3T6JA 3IWXA 4M94A 5KFEA 2E29A 2XSFA 2MPUA 1SJFA 2B9XA 2FVSA 3S7RA 2WRMA 1ZYQA 4A8MP 5DRKA 2A3JA 3UCZP 1FK9B 5I3UA 2LQJA 3CWJA 1S0MA 1ZM9A 2L41A 2MQMA 5L38A 3M6XA 3SSQA 5EX0A 2C3YA 5GAEI 2MSSA 1REVA 4ZPBA 4ED3A 2MQPA 3UPFA 1N34F 3E01A 1BQNA 2FGCA 1IXKA 4RW8A 2DT9A 5IM0B 2XMWA 2OO4A 4RW8B 1K0VA 5EUHA 2K3KA 1XNRF 4UY8T 4N41A 3LP0A 3KJVB 4PXCA 1E6VB 5HMYA 4QIEA 2D3ZA 4UW2A 3CJ5A 1S0NA 5A8KB 1A6LA 2K1RA 1JLEA 2C3OA 2FTRA 4TQSA 2MZSA 4KHMA 1JLEB 1X4EA 3IG1A 4DL3A 1P9QC 5CZVA 1MMDA 3MMBB 1ROFA 1TK8A 2R7XA 4CO1A 5DG7A 3TNVA 1X4GA 3H5UA 3TUIC 4DV5F 2J7WA 1CEZA 2WOMB 3KK3B 3GQCA 3PJXA 7FDRA 3DDKA 2FJDB 2KTQA 3SI8A 2J0WA 4NLPA 1FDBA 1HQEB 3MTJA 2G13A 4LF9F 2VC0A 2ZM6F 2J9CA 3N6NA 2M8DB 4WYLA 4K50A 2C42A 2DGXA 1N8RT 4BBYA 3GE9A 2XLIA 3KLVA 1NK9A 2GHPA 3BSCA 2D3UA 1IQZA 3M32B 1DHMA 2UVWA 3B78A 2R7SA 1YJRA 3NBPB 2XMKA 2OPRB 3DLJA 3K2YA 1YRTA 1FRMA 2EI5A 3DGPA 1R89A 1T3NA 5HQ8A 2AYGA 1SJQA 5KG2A 3G6XA 3HVRA 2POKA 5DETA 1DLOA 4USHA 1Q81T 3OLBA 2YNGA 2G9OA 1S79A 3FRYA 4C11B 1AXQA 4NXNF 3ULHA 3QGHA 3UDCA 3BSAA 5F9LA 1ZZNA 1I6JA 2BA9A 4HH0A 5D4PA 4ERDA 3TUJC 2GO8A 3TAPA 3P3DA 1HNIA 2QLXA 4X4PA 5A0YB 4Y2MA 3CPWR 1S0VA 4X2BA 1FEHA 4C8LA 4DEZA 5EWFA 1QAJA 3OTDA 1MWYA 2LXFA 2I5JA 4ETZA 2KXNB 2KM8B 4H4KA 3TAMA 1FXDA 1HYSB 4H4KC 4OZ0A 1JLFA 1SJRA 2RQ4A 4ED6A 2IMWP 3ZZPA 2XY7A 2XBPA 2J9DE 1RWUA 3K0JA 4CI0B 4IO1A 1BQNB 1SXLA 3SEOA 5F8HA 2FC8A 3L95X 5I4MA 1UWBA 4ECYA 4MKYA 1YJNS 4RW4A 2C3MA 4Y2IA 1UWBB 1RQ0A 4RX6A 4ZDNA 2JH3A 4WIIA 1S97A 5KFMA 2DNPA 4ZPVR 5HP1A 4O44B 4Q2LA 4AQYF 3OFFA 1TP7A 3R27A 3LUYA 3TW0A 4TU8A 1S9GB 3KLIA 1P1TA 4OHZA 2P9CA 2V4JA 3E8OA 3S8SA 4KRWA 1WTBA 1RTIA 1KOHA 2GCFA 2R2RA 1ZAVA 3ITHA 4KV8A 2KVIA 4DSIA 2J9DA 2WCXA 3I32A 4LVOP 4I6YA 4N56A 3NMRA 3H4DA 2ZITA 4O3QA 4WK1A 2CPHA 2B3TB 2RIJA 1L3KA 1FKOA 2DTJA 3OL7A 3J81Y 4RZRA 2QA2A 2XSJB 1SB6A 5E7OB 1HI8A 4CTAB 2KXHA 1HD0A 1M90T 1Y0HA 2VFVA 2VG7B 4ZVGA 2IYGA 3FNNA 2DCLA 1C1BB 2Z8QA 4WTYA 4I2PB 1IQTA 2XWXA 3CJ3A 2PT0A 2I8EA 4Q43A 4BWMA 2IRYA 2RKIA 1VRTB 4JV1A 2E9ZA 5KFWA 1FT8A 1V3SA 3BDEA 2F4VF 5E41A 3T5HA 1FKAF 1H7XA 2HAIA 3LF0A 5B08A 2NPFA 1S6QB 1EP4B 2IJFA 4ELTA 4OQJA 2DHAA 5DDRC 3HK2A 1JLQB 3H2VE 5DDPC 3M8RA 2XZWA 3VAKA 1T94A 1QLNA 1UA1A 1Q7YT 2CVIA 2QIFA 2SXLA 1DTQA 2OSRA 2BE2A 3N0VA 5L8RC 3MM9B 1VQYA 3X1LB 1ZPWX 2YNHA 3CCWA 4I68A 4Q2MA 1CLFA 2E5LF 2MGZA 2LU1A 3FEYB 3GMGA 2FJXA 2UUCF 2F9JA 4HH1A 4XO0A 1JLBA 2YNIA 1H3DA 4K4XA 1HNWF 2WHOA 2ZDOA 2RQCA 2VQFF 1UEUA 2HWIA 3RRKA 3HKWA 2Z4PA 4ZKAA 5GADU 2J9EA 4B9SA 3K5MA 4MYUA 4UOCA 1NJZA 4YR0A 5KFRA 2A18A 3D28A 3MFIA 4TY8B 2LXUA 4MIAA 4TYAA 4DF8A 4WKRA 1RDRA 2C22A 2J6UA 4ZVHA 2ABYA 2LCWA 5HP1B 4TNOA 3LOUA 3T1YF 2NREA 1FD8A 1IR0A 3TVYA 1LKZA 2JFDA 2V8DA 4LT6A 3IRXA 4OI1A 5I3PA 4JI6F 2E9TA 2CPIA 1WACA 1Y5LB 3UW1A 3Q8RB 5KFHA 3SCLE 3MAHA 3KLEB 2C2EA 1TZ0A 5F8LA 5DGBA 5DG9A 2KKHA 3D54A 3L7OA 3PZPA 2DPJA 3TYTA 4W90B 3H40A 4R5PA 2MB0B 3N5FA 2HGMA 3DYAA 4RNOA 3PO5A 2XS2A 2D1CA 1YHQS 4DV3F 5KT6A 2UVUA 2JFKA 4NLWA 4KFBA 1TVRB 1WHVA 1RTJA 3MAQA 3JSYA 1X7VA 4NZ0A 4WJBA 3R1LA 3NP5A 3BSNA 2O3DA 4QWCA 4WCEQ 2J0QD 4Q44A 4OHYA 4FVCA 3CDEA 1G7CB 2DIUA 3MM7B 5L1IA 1C0UA 2XY5A 3WBZA 5L1JA 1YWXA 5FDLB 3W3SA 1N36F 1KR4A 4PWUA 1HQUB 3DFEA 5GAEU 1U1QA 1C0TA 4EU0A 4OZJA 3MOJB 5E3AA 4K4ZA 1NKCA 2HRUA 1NKEA 3IS9B 2JX2A 4G6VB 4NA3A 2MKSA 3US5A 3JSMB 2EWHA 2Y1RI 4OJ3A 1F0XA 4B02A 2EBGA 2HQ3A 2MZQA 5F41A 3QIPB 2W4PA 2JL9A 3NG8A 1UJ5A 2BANB 2ZH2A 5K9FA 4ZPDA 2MXYA 1SH3A 1S7HA 1XBWA 1JLGA 2V8VA 3ZFVA 1S9EA 2ZE2A 4QOTA 5KFLA 3AH6A 1N0VC 1S77D 2RS8A 3DXBA 4BCAA 3M9NB 1WTFA 2EK6A 2EVZA 2VZ9A 3UQSA 3KK2A 4X4TA 4RNHA 2JSXA 1FDNA 2CPXA 2V4RA 3B82A 3MMBA 3RU0A 3LWLA 3PX4A 2A10A 1FCAA 2E1MC 3C6UA 2J5AA 3ISND 4MYTA 4DPOA 4OJ1A 5EGYA 4PWDA 1MW7A 4KQZA 1FEEA 1Z2LA 1JLAB 4F02A 1HWIA 1UJ6A 2UUWA 4NLSA 1WELA 2GGPA 4PKDB 2ZHBA 1UFLA 5A8WA 4DL2A 1WG4A 4RNNA 3QAEA 2E66A 2DGTA 2CQ3A 2VPWB 1LW0A 2LQ9A 4Q7AA 5HL7Q 1YVFA 3GG1A 2GIRA 4LSLB 5IT9Y 3OL6A 1HWJA 2ROPA 2BBEA 5GAGI 1ZTTA 4IH6A 3TOQA 4Z37A 4WXWA 4FXDA 1HBUA 2WSFC 3HVTA 5L9XA 1D9DA 1HW8A 3JSBA 3SQGA 4EBDA 3CMES 3I6PA 2ZZMA 2YNGB 3CCSS 2R8KA 2J0XA 1Q82T 4R5PB 1SL1A 4O3RA 3CCLS 1Y4ZB 2ASDA 5CHCB 3HZEA 1Q8BA 2I38A 1WG1A 3DMJB 1GAOA 1TFYA 4DFJA 4U7UK 3A1YG 4IDKA 2DNGA 5D3GA 3PW7A 2YQ3A 3CCTA 4Q8FA 4HVZA 2UVVA 5KTQA 4KHPF 2NYIA 4H54A 2Z2MA 3MFHA 4Q0BB 1K0TA 2YX1A 4O4GA 3JYTB 4ED5A 1IKWA 4A8KA 2M2BA 2FJVA 4ZS6A 4YOEA 4I64A 2YKNB 3I82A 2ALZA 3G96A 3I0RA 3IR7B 2HFNA 2ZH4A 4IFYB 4NYPA 1T02A 4J9SA 1VQOS 1BQXA 3O6QA 5D4OA 1SKSA 1Q8IA 2DNZA 4OI6A 2ZH5A 3CCUS 2BANA 4A46A 1IBKF 3CDUA 1TL3B 2R8HA 4QU6A 1U8SA 1S6UA