2LEAA

Solution structure of human srsf2 (sc35) rrm
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
b'MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/arginine-rich splicing factor 2
publication title A syn-anti conformational difference allows SRSF2 to recognize guanines and cytosines equally well.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2leaA01
1R8PA 3L3CA 3CCLS 2N3LA 3LPYA 2YWKA 2A3JA 1WI8A 1WHYA 4F26A 2MZ1A 2ADBA 3CMAS 2MQPA 2X1AA 2I38A 3RW7A 2XB2D 2JRSA 1D9AA 2XS7A 3PIPQ 3NNAA 2CQPA 2MYFA 4A8XA 1WELA 2D9PA 5DM6Q 5BJRA 1X4HA 4IOCQ 2MQMA 5GAHU 2EK6A 2CQ2A 2X1GA 2DHSA 4WFAQ 2DHGA 1NO8A 1YIJS 1U1RA 2G0CA 1WHXA 2MZTA 4QU6A 2DH9A 2VOPA 1SJ4P 2MSSA 2DNQA 1VQPS 1FNXH 2MQLA 2M70A 2BZ2A 5GADU 2J8AA 2JVRA 1YTYA 1QM9A 1K9MT 2YH0A 4FXVA 2GO9A 2K8GA 2MZRA 2CPXA 4WFBQ 4EGLA 3JB9k 1OWXA 3CCUS 2KM8C 1OO0B 4LMZA 3S6EA 2DNPA 2G1DA 4WCEQ 3CPWR 1VQ9S 1WF1A 4PRFA 2DNKA 2KG1A 2QA4S 1QVFR 5EN1A 4ZKAA 1VC5A 1JJ2R 2FC8A 3P5TL 5CXTA 3NS6A 4U67Q 3I56S 2DNLA 1HL6A 4ED5A 2RVJA 1HD1A 2X1BA 3MUVP 4F25A 3VAHA 4YOEA 2LKZA 2BOPA 1JJHA 1ZZNA 3G6ES 2MSTA 2J0SD 1A7GE 1WF0A 1WHWA 3UCUP 1G2EA 2SXLA 1KOOA 3G9CA 3MD1A 4OZ0A 5JVHQ 2F3JA 3D2WA 2PE8A 2UP1A 1FJCA 4CIOA 3SMZA 3CTRA 3MOJB 1URNA 1U1OA 1S72S 3NNCA 3VAKA 2KN4A 3CCMS 1DRZA 3G4SS 3MDFA 2EVZA 3MD3A 2CQBA 2K3KA 1D8ZA 2CQIA 2KRBA 1U6FA 3G71S 2VODA 3NS5A 1X4FA 2OTJS 3BEGB 3VAMA 2DNYA 2KXHA 3FEXB 3ZZZA 3VAIA 1SJQA 2U1AA 2LXIA 3BS9A 5GVQA 2MKCA 2MKJA 3B4MA 2LYVA 2QFJA 1WEZA 2MQNA 2DNMA 3VAGA 1FHTA 1H6KX 3EX7B 5DM7Q 2DH7A 3CULA 1U6BA 2RUGA 2V94A 2CQCA 1K8AT 2AYMA 3THTA 4QU7A 2DISA 2DNZA 2DGSA 2M88A 1NU4A 2MY8A 3LQVA 4FXWA 3MI7X 5MLCV 2CPZA 3J7YU 3MXHP 1VBZA 1IQTA 3G8TA 2AYEA 4OZ1A 1S79A 2KM8B 2XNQA 1X4BA 3SXLA 3SDEB 1YITS 3P3DA 2MQOA 4IOAQ 3UD3P 1YHQS 1U1NA 2OJ3A 1DHMA 2CPYA 1CVJA 2E5HA 2KRRA 2J76E 2MHNA 2F9DA 2FPHX 1WG1A 1X5PA 1YJ9S 1A9NB 2F9JA 1AUDA 2MKHA 1X5OA 1U1PA 3R27A 1VBYA 1VQ7S 3SDEA 1FT8A 3VALA 2KYXA 4TU8A 2DIVA 2KVIA 2MY7A 4TU9A 3I55S 2J0QD 1N54B 4Z2XA 2MGZB 3UE2A 2ZJPQ 1X5SA 1WF2A 2DHAA 4PKDB 3U1LA 2GHPA 2L9WA 3IRWP 4W90B 2HGMA 4YB1P 2MKSA 5FJ4A 1VQLS 1M5OC 5D77A 2DNHA 3ZZYA 1FJEB 5DDPC 4LIRA 2DNGA 3UWTA 2MGZA 1U1KA 2RQCA 3BO3A 4LJMA 2M2BA 1ZZFA 5DDQC 2VOOA 1FXLA 1SJRA 4CQ1A 3G8SA 1OPIA 5LXRA 5HO4A 3EGNA 5CYJA 2B0GA 1H2TZ 4UQTA 2JVOA 1KD1T 1M1KT 4F02A 2CQ3A 3R1HA 1WEXA 1HA1A 3S01A 2DITA 2DGOA 1X4GA 1M5PC 2Q79A 2CPIA 3CC2S 2RQ4A 3H2VE 2DGXA 2RNEA 2OIHA 2CPDA 1VQKS 3HI9A 3UD4P 2MB0B 1JMTA 1U2FA 1VQ5S 2XS5A 5IFMA 2M0GB 1DBDA 2MKIA 1L3KA 1VQ8S 2MZSA 4IUFA 2VONA 2DNRA 2DK2A 3BO4A 2DH8A 3G96A 2OSQA 1YWXA 2M9KA 1RKJA 4QPTA 2DO0A 2DGVA 1X4DA 2LMIA 3CCJS 2M7SA 1YI2S 1P1TA 2KHCA 4WF9Q 1OIAA 2LA4A 2LXUA 1QVGR 3UCGA 5LJ3Y 2RRBA 2M4MA 1B7FA 1KQSR 2E5JA 2JX2A 2LA6A 2LQ5A 3IWNC 3DXBA 3CMES 2CQ0A 2MPUA 4C4WA 2OSRA 4CH1A 1WHVA 4TLQA 1VQNS 2E5IA 3TP2A 2MQQA 4W92B 1VQMS 2D9OA 2DGTA 4M5DB 3HHNB 2EK1A 2CQGA 3OW2R 1JJ4A 3PIOQ 2CJKA 2FHOB 1Q7YT 1KOHA 3CUNA 1Q86T 3VAFA 1X4CA 1FO1A 3RW6A 2ADCA 5DDRC 2CQDA 3CCVS 2ERRA 2G4BA 3BO2A 1SJ3P 2RS8A 2MZJA 3P49B 1UFWA 1Q81T 4QQBA 3ULHA 3MURP 5CA5A 4Y00A 3H2UB 4C0OC 5IQQA 2DHXA 3P6YC 2PEHA 2CPJA 2JWNA 2N82B 2YH1A 2L41A 1VC6A 3UCZP 1F9FA 1SXLA 2DO4A 4C7QA 1WTBA 2HGLA 2LEAA 3FEYB 3CCQS 2I2YA 1Q82T 2CPHA 5GAEU 1UAWA 3Q2SC 3CD6S 2N7CA 2HZCA 3TYTA 1N52B 2CPEA 3J7ZT 1XN9A 4BS2A 2KXFA 2NLWA 3S7RA 2RS2A 5DDOC 5LJ5Y 5DETA 1WEYA 1BY9A 2AD9A 1VQ4S 2HGNA 5LXYA 2KH9A 2DNNA 2O3DA 3MUTP 2MXYA 1R8HA 4RU2A 1VQ6S 5H1SV 2CPFA 1SJFA 4P6QA 2CQHA 2XS2A 3US5A 4WIIA 3VF0B 4YUDA 1X4AA 2KXNB 3MUMP 2ZJQQ 4Y0FA 5JVGQ 1M5VC 2KI2A 1RK8A 1KC8T 2RU3A 1H2VZ 1U1LA 1YJWS 5HL7Q 1NJIT 1X5TA 3CXCR 3B4DA 3V4MA 4J5OA 2RRAA 2MZQA 2DIUA 2KFYA 2RT3A 4PR6A 4TU7A 3DLLQ 1N8RT 4ERDA 1O0PA 1FJ7A 5LSLA 1P27B 4IO9Q 3R1LA 2DNOA 3CCSS 2LECA 1U1QA 5GMKa 2KG0A 1X4EA 2D3OR 2NZ4A 3CF5Q 1VC0A 1M90T 2DGWA 2YKAA 3S8SA 3NNHA 3NMRA 1U1MA 1W2BR 3EGZA 2U2FA 2FC9A 5LSOA 1H2UX 1UW4A 2L08A 2HYIB 2LCWA 1X0FA 1N88A 1VBXA 2CQ4A 2AYGA 1ZH5A 3Q2TC 1K73T 2WBRA 3N9UC 2X1FA 2M52A 2XNRA 2CQ1A 3TO8A 1PGZA 2M8DB 4WKRA 4WFNQ 2LEBA 3THPA 2KT5A 2DGUA 4UY8T 3CC7S 1WWHA 3VAJA 2E44A 5ITHA 2N3OA 3CCES 3U1MA 3CC4S 1UP1A 2E5GA 1WI6A 1VQOS 1WG5A 1M5KC 5D78A 5IM0B 3K0JA 1WG4A 1HD0A 2M8HA 2MJNA 2KU7A 1YJNS 2MMYA 2MJUA 3CCRS 2FY1A 2HVZA 2YTCA 2AYBA 2QEXS 2XSFA 2DGQA 5GAGU 1DZ5A 2DB1A 2MKKA 1PO6A 2OTLS 5IM0A 4CH0S 2ZJRQ 4V19X
chains in the Genus database with same CATH superfamily
4PG5A 1QUVA 3NGTA 1R3NA 2R7QA 4C8YA 2OPQA 1EP4B 1WELA 2BX6A 4ZN3A 4UW2A 2ZZNA 3LGNA 5MAOA 1NO8A 2YKPA 2MSSA 5CZXA 1UFLA 2VBWA 1FNXH 3TA0A 3NGRA 3ILLA 3QAEA 5KFLA 4NYOA 3QSYB 1RT7A 2MZRA 2E9RX 3ET6B 4OI2A 2YY3A 5CYQA 1Y5NB 1LWFA 1TUVA 2YWWA 1S0MA 4R5PA 1UZHA 5IQ6A 3SV4A 3JS9A 2X1BA 3KLVA 1JJHA 2OMLA 4X65F 1A7GE 1F0XA 2QL9B 3M6XA 3P96A 1S10A 3L4BC 2LU2A 4DL2A 4F4XA 4FS2A 2HEKA 3R7BB 1RXOB 3BQ2A 2JL9A 1R8AA 1RTJB 2B9EA 2OAUA 1CS4A 2G9OA 4FP9A 2FYXA 3D6MB 2P8IA 3JTNA 3NS5A 2R7WA 4JBCA 3BEGB 1T3OA 4R8UB 2FJDB 4CLPA 2R8IA 3FZ2A 1U7LA 4N47A 2ZOFA 4U9RA 1RAFB 4DLGA 3EX7B 3J81j 1EHWA 4CWBA 1FX2A 1JLEB 5J1NA 3QT8A 4OYBA 3MPWA 1NAQA 2UUBF 2GAHC 1FKAF 1OQ3A 2KM8B 1S6PA 2DR6A 4HHJA 4NWBA 3DRRB 4P2XA 1X5PA 3MCOA 1AUDA 2DCUB 1JLQB 4DN0A 4Q44A 2CVEA 3WX4A 3BBFA 5K8NA 3I55S 5EX3A 5IS2A 1VI7A 3K57A 3IR6B 4J91A 3H2LA 3L7UA 1FJEB 2GVZA 2FGOA 3J7AN 3ZTRA 4AL5A 4JB8B 1T94A 2QC3A 2ZH8A 3TEHB 2R2RA 4H4KC 4WP3A 1Q8KA 1KEKA 4ZVQB 3PEJA 3KNGA 1M1KT 3EJMA 4MH8A 3V81B 1KLMA 3BH7B 4KY3A 1WC3A 4DL4A 2OIHA 5KFYA 1VQKS 3ZTPA 3W63A 1I6JA 2F65A 3QIPB 4WU3A 1RCOB 4A8MP 2R42A 2MZSA 3R5CA 4MT1A 3QZ7A 1HBUA 1PYSB 1X4DA 3QATA 4DV4F 1JNRB 1KS2A 4I68A 3GV5B 1S1VA 2IAJB 4TLQA 3QT5A 4WE1B 1QAIA 3OW2R 3EZOA 3VAFA 4KV8B 4GO5X 3M30A 4DR1J 4ZPBA 3QGPA 7AT1B 3H7HB 3IAM9 3AXMA 1PJ6A 1RWXB 4I67A 2HBYB 2EW9A 3BKFA 4BS2A 1SH3A 5B7WA 1D1UA 3W5YA 3QYYA 5B0CA 1D09B 4J7CA 2XLIA 4NA1A 3IWLA 4RU2A 2F7VA 1IQZA 3IN5A 4Y0FA 1RK8A 2A6MA 3D68A 2PC6A 1K44A 4OJGA 5K8OA 1RAJA 4U96A 3CCSS 1Q16B 5E3PA 2J7KA 1Q5VA 2EG1A 2HFUA 1M90T 2GCFA 1VMBA 3S8SA 3NNHA 4AL7A 1QE1B 5F9NA 1YK9A 2OPPB 1IKYA 3DOKB 2G1HA 3GJTB 2V2VA 2ZD1A 3T19A 1XNQJ 2YPZA 2XNRA 2V9WA 4WBFA 2Z2YB 5JUMA 4O4RA 2W2MP 3THPA 1RT5A 4M95A 1X60A 3CCES 3M2RA 3D6FB 3FSYA 4S0MA 4DZ6A 2BA9A 1WOSA 1V3RA 3DYAB 3H42A 1TL7A 1PJ7A 2ZWPA 5IM0A 4DFPA 4FNHA 2RJZA 3LUYA 3SQGB 1Y5LB 2GV1A 1O51A 2XO6A 2HKEA 2HHHF 3BKTA 1ZPVA 2XS7A 4QR0A 2H5IB 4O23A 1VK8A 5C24B 2WB1D 1YIJS 3K89A 3M2UA 4UT4A 3PW7A 4DL6A 4DV1F 3JQJA 5GADU 5A8KB 2K8GA 3BYRA 1NPPA 3MEDA 1KP6A 3DKDA 2GX8A 1QSSA 2ZZTA 2YNHA 2W9AA 3CPWR 3QJPA 2ROPA 1FX4A 3J80U 2AW0A 2R7OA 3H98A 2ZUAA 2G0IA 3CVKA 1KOOA 2FLPA 4C0HA 2Q66A 2PFDA 2UP1A 4NZ6A 3W65A 5L1JA 1CJVB 2GIFA 2J0XA 2FHJD 3MD3A 1F9HA 3G71S 2VODA 2H4YB 2VG6B 4A47A 3OSNA 3LP1B 3R8YA 3RRGA 5F8GA 2HS4A 1OYDA 1YSJA 2V63A 5DM7Q 3UO0A 3K5OA 3W2VA 2V94A 3R5BA 1T9VA 1S49A 3BREA 1VYAA 4JI4J 3SCJE 1OQ6A 3J7YU 5HJXA 5B0GA 1I51B 1SL1A 2DJWA 4OYWA 2D3ZA 4IOAQ 1KHVA 2E5HA 4Y2MA 2YKNB 2V4RA 2MKHA 1RLCL 2K1RB 1IXKA 4FKXA 4IH7A 4DPXA 1UKUA 4KE5A 3SDEA 4B3MF 2V50A 4C8ZA 3QPIA 5ETOA 3MR6A 3RJMB 2N4CA 3HD1A 1UWBB 2DHAA 2JDJA 4F04B 2CVIA 2RIJA 5DLGA 5FJ4A 3FCVA 5D77A 4ZVOB 3AQOA 4DWIA 1ZZFA 1LOUA 2D3UA 2ASLA 1BWEA 1LW2A 2V4QA 1YQHA 3CDBA 5HQ8A 3DRSA 4J9KA 1DLOB 3R1HA 3I5AA 4ZDNA 4NCGB 2YWGA 3JQKA 2AGQA 2DR5A 4DSKA 1YRTA 1NK7A 2GS8A 1KWMA 1G7CB 2BACA 2IC3A 2HLUA 3B8HA 2C3PA 2QYCA 2DNRA 5HVFA 3G96A 4AYBD 1YWXA 3VGVA 2DGVA 4K59A 3ZO7A 1OIAA 2VPZB 4AXIA 2LXUA 4LFBF 4DUTA 4JI5F 3I9V9 4J9MA 2LA6A 4LSNA 3LALA 1UVMA 3CMES 2OUGA 2CJXB 2ZM6F 1TQLA 1LK5A 5DQHA 3KHLA 1MROA 4XPEA 3W1YC 1Q8BA 3RW6A 3IM8A 3T9ZA 2MZJA 4DFMA 1HNZF 1MWYA 5KT6A 5L8RC 2UUAJ 1E6VA 1J27A 2IA6A 3SV3A 4PQUB 3GZ7A 1Q79A 3NGDA 4J9QA 1IKWA 4YB6A 3K5LA 2DO4A 4BWMA 3T5LA 4RW4B 5GAEU 2RQMA 4NLUA 1ACMB 3J7ZT 3S7RA 3EE3A 2GJFA 5KG0A 3V4IB 4DS5A 5ETKA 1TMMA 2HIYA 3TVYA 3MMAA 1URRA 2GHVC 4TN2A 4OI4A 1FF2A 1F9EB 3QRQA 4HACA 4OI6A 3ILJA 4IOBA 1EIYB 3GFXA 3LOUA 3GV7B 3FEZA 1KFDA 1RWVB 4BWJA 3IM9A 1RHKB 3GIIA 3P4UB 4TU7A 4KBIA 4K5SA 2LU1A 2QO3A 1H3DA 3HSZA 2R8GA 3T1YJ 4Z7CA 3OPKA 2GVDA 2WSCC 1SV5B 1ZH5A 3Q2TC 4P74A 1TKXB 2ZNZA 3PR5B 4E0DA 1SH0A 2NXJA 1D3WA 1LWCB 2C3OA 2KT5A 3UDEA 4OI1A 5ITHA 4CLSA 1Y3JA 2QJ3A 2M8HA 3UI3A 2W8KA 1YJNS 3TX0A 3PW0A 2W2PP 1HWKA 4Y2KA 1SKUB 4I2PB 2FJVA 2ZJRQ 4DG1A 2MLZA 3TNVA 3PW5A 1RT3B 1DFDA 4F26A 3DGPA 3BBCA 5L39A 3AD9C 9RUBA 1TVRB 3M8QB 1B3TA 1EX8A 3PO5A 4YDXA 3HJFA 5LMNJ 2BQ3A 1XK8A 4G1QA 2PI4A 1W7WA 3NRBA 5E5NA 3K2YA 3EDRB 2CZ4A 2JSXA 4X4SA 1UJ4A 3BGRB 1QAJA 2R7TA 5I3PA 2JVRA 4YY3J 2AZ1A 4CLTA 1U0SA 2VC1A 2ZH7A 2Z0GA 1WF1A 4ZKAA 5DS7A 1XR6A 1JKHA 4DFJA 2RVJA 2IM1A 2LQ8A 1GTEA 3E3XA 4TYBA 3G6ES 1WF0A 1G2EA 4JI1J 1HNWJ 4X4UA 5EX0A 1HMVB 1FFSB 1H7WA 4D3HA 4TY8B 2QL7B 1AZSB 1RHQB 1V6HA 4N8NA 1J5EJ 1SKRA 3CJQA 3LGHA 3QAUA 1IKVA 2OPRA 1RGVA 4OYZA 4JV0A 2XCAA 2UVVA 3HHLA 2DNZA 2IRUA 1JX4A 4N8OA 1TL5A 3E2EA 3HXMA 2MQOA 3UD3P 3FRZA 1BQNA 2VC0A 1CVJA 1C0UB 3RG6A 2LDYA 1HPZA 1X5OA 2FHJA 2HWTA 4BBYA 4WFYA 2ZZMA 5DG8A 1HW8A 2KVIA 2BJ8A 4MFBB 4XO0A 3MEKA 2B8PA 1SB6A 1X5SA 4NPOA 2BMBA 4W90B 2VICA 1M5OC 1L3SA 3D28A 1HIYA 4ECRA 1R8CA 4NMXA 2BQRA 3ZC4A 3UN3A 3BO3A 1SKWA 2HHSA 2UUWA 4DQQA 3FSIA 1HYSB 5HMXA 2I0XA 2UVRA 5CYJA 4MYTA 2HFOA 4K4VA 2HHQA 1NDPA 2ZITA 3OHBA 3LP2B 1T9XA 2GO8A 3W61A 3TUJC 2VFTA 5K14B 2AJ1A 3H2VE 4HT7A 1EB0A 2CPDA 3P5BP 5ETTA 3KK3B 4CO5A 4O3NA 5BR8F 2BJ7A 1SIWB 4DCPB 2GAGC 2VBXA 5A8WA 1HWJA 4ZLPA 1BE4A 1IKXB 4O4GB 4TQRA 2JX2A 4M5HA 3AB4B 4F7VA 3DXBA 3EMTA 4RW8A 2HVIA 2N7YA 2E5IA 4GKKJ 1RAHB 1KRPA 1LWXA 2UXDJ 3HHNB 4M5GA 4UZCA 3SCIE 2CJYB 4A46A 5CH7B 3H2UB 1TZ0A 5KFZA 4WXOA 6FDRA 2B7CB 4FVMA 4RZRA 4ZCMA 4ZMMA 2KO1A 3UN5A 4DEZA 2VA3A 1T05B 3Q89A 3GIKA 1F5AA 5LXYA 4A8KA 2C28A 1RAAB 4HDHA 4WFXA 3KJNB 2B56A 1X4AA 2KXNB 5DG7A 1KVIA 4PG6A 4LFCJ 3PYFA 5J1PA 1U1LA 4DBQA 3M8PB 2OD4A 3OL6A 4Y3CA 3OVSA 1FTCA 5J2PB 1GX6A 4OHWA 5KAKA 1FJ7A 2VBZA 4IO9Q 2LECA 3RRKA 1J5OA 4E8UA 3HDSA 3PX0A 3JTOA 1W2BR 1HW9A 3MR5A 1X0FA 1VBXA 2J6UA 2UXBF 2RDDA 2AIRB 1YX2A 3OR1B 3QJLA 2MLYA 2ZUGA 4YP3A 2WRMA 4USTA 4R8UA 4UOCA 2QEXS 1C4CA 1S0VA 1S76D 3A8EA 5GAGU 2DB1A 1SQEA 1OSDA 2XMJA 4LSZB 2BVZA 1HR0F 3AJ2A 3M9NB 1SC3B 1WHYA 2H5JB 4ALZA 2M3DA 1SC6A 1HQUB 1RT4A 3JSBA 3MEGA 3WDOA 3TZZA 2MYFA 5B0EA 4CNZA 3GR1A 4P72A 4I7FB 2IA0A 3M8YA 1UVJA 2VOPA 3GFZA 1WDTA 1SKSA 4ZVUB 1WKJA 2CPXA 3ZZTA 1UW9A 1PBUA 5CD4A 1B0VA 4A48A 1P8GA 4J9RA 4ELUA 1F5CA 5SZTA 2JEIA 1VC5A 4U67Q 5M2UA 4J37A 4OYAA 3LP0A 4OJ1A 4F4KA 5ETLA 1M5SA 2Y0SD 2LQJA 1K0TA 3QLHA 2UZAA 4RLEA 3UCUP 5D4PA 1TMJA 2IVMA 1T9UA 1Y10A 2PE8A 1FJCA 2R7XA 2KDOA 1URNA 1U1OA 5AXMA 3EXYA 2EVZA 3CJTA 1RWUA 1REVA 4M5NA 4CM0A 4RNOA 2LP4A 3W5XA 3GLJA 1M1HA 3B4MA 2QFJA 1C0TA 2B4PA 4YR0A 2B6AA 4HH0A 1E6YB 2AZ3A 1U6BA 3BH6B 3LAMA 1RADB 1YRXA 2C42A 4X64F 3KLIA 4C2MA 4JOUA 1XMQJ 3I5CA 3A12A 4DUYJ 1S79A 4LF9J 2B4OA 3C6TB 4C6AA 1PYOB 4B3SF 3KLHA 3MAQA 1DTQB 2ZH9A 3X3UA 3I9ZA 4LRAA 1U1PA 3R27A 2KYXA 3ZZRA 1S4EA 4FYXB 4DPWA 2OH2A 3DOLB 4OX9J 2GHPA 1TAUA 2KJWA 1NJXA 5F8NA 3DLBA 1HNXJ 2V6AA 3PEHA 1IWGA 4OHXA 5F3TA 5I42B 2E29A 3MM9A 4Y2IA 1UFKA 2RH3A 4MK8A 1L3TA 3MR2A 2EBGA 4ZVPB 1N36J 2B0GA 3GU0A 2P6TA 4QYZJ 1U47A 2L9DA 2OMOA 3O1LA 3D4JA 4QCLA 4EI2A 1Y00A 4ER8A 4N76A 1UJ5A 3KFWX 5J2NA 1FVQA 4JYAJ 4MIWA 4IRCA 3FZBA 5IFMA 2BQUA 4EZ6A 2V4JB 1UEVA 5I4MA 2OSQA 4QPTA 3LAKA 1UA0A 5L46A 4IH5A 4RWWA 3CGIA 3DOKA 4LSLA 4DPUA 4LRDA 4Y6IA 2BOAA 2QIFA 5L1IA 1LW0B 4C4WA 4DUZJ 3RBEA 1P6TA 2HS3A 2FQQB 4K4YA 2E5LF 4Z37A 5DDRC 5EGYA 4CI0B 4AT1B 1UPPA 1OJ4A 3KJQB 4F4WA 5HMZA 3IMQJ 4ANCA 4IR1A 3RGIA 1H72C 1XQIA 1R6VA 3Q2SC 4ECVA 2C2KB 2N7CA 1NSAA 3D6TB 3FCHA 5DETA 2QMXA 1YKWA 4L76A 2EC0A 2DNNA 4F67A 1PKUA 4Y65A 3VZIA 1PG5B 2ZVIA 3IA0A 3DMJB 3D6HB 3ICLA 2ACYA 3HT3A 4IRKA 4ZJOA 3IBFB 2QSWA 3CXCR 2XMWA 2ZNYA 4J5OA 1TV6B 2DR7A 2DIUA 4XDDA 1OMSA 3U7JA 2GQQA 2OP5A 1PSDA 4F4AA 4NLYA 1A6LA 4ED1A 3TAMA 3MPUB 4LF7F 1IVZA 4Q0BB 1RTZA 2VFSA 1DTTA 4RW7B 3KDNA 1FKOB 4RUHA 5LSOA 1UW4A 3GPAA 2HYIB 1QSLA 4ATNA 3LW5C 4DSEA 2IM2A 1SI9A 3SCKE 1XMOF 1NM2A 2X7IA 2OPSB 1CJVA 2RDIA 4L6V3 1KKHA 3TUPA 4ZA1A 2VG6A 4ED6A 3MM5A 3GSIA 2OO4A 3O8WA 3RTVA 5D4LA 2CG4A 3I4PA 2UXCJ 2XTJP 2MKKA 1PO6A 3I87A 3PY8A 2OPQB 3CW2C 4C97A 2B9YA 2YWFA 4LR7A 2VHGA 3NMAA 3GYGA 3IGVA 4DOZA 1QD1A 4JI0F 2I38A 2Q6CA 2XB2D 5E0OA 3GFHA 3CJRA 1X4HA 2MQMA 1EJ7L 4W4MA 1JLAA 1RT7B 1UETA 2CUYA 1RWMB 2DT9A 2YKQA 1LWFB 5JXSA 3NGUA 2DNQA 3CSKA 4R5PB 1RZMA 3LWMA 1OY8A 3PW2A 4GO7X 2UVWA 1N32J 4WYLA 4ENOA 4CH7A 3DU5A 2DNKA 2KG1A 4ES2A 1NCLA 5EN1A 5DGAA 3AOCA 1FJGF 2FC8A 2DNLA 5L1LA 4B9NA 3QGGA 4YOEA 3PHEA 1ZZNA 5AE3A 3CD0A 1N6QA 5ETVA 3RBXA 3HFZB 1GXTA 3A13A 2Y1IA 3B6BA 2GGPA 5C25A 3CCMS 3G4SS 3KLFA 5DQIA 3FBFA 4J90A 3AA9A 3BBBA 3J7A1 5AE1A 3EVMA 2L3MA 4A8FA 2BJEA 2NZCA 1FHTA 3PJ9A 4DF8A 5F9LA 1FFGB 4LRFA 4N5SA 1K8AT 3FC9A 2BE7D 5IWAF 3AHPA 1S6PB 3ZZPA 2FZGB 4HTIA 4NLPA 3RB0A 4ETXA 2RHQB 1TKTA 4ZN1A 2ZE2B 1FDAA 3NWGA 3OTOJ 1KDNA 1YHQS 1S7HA 5CQGA 1NK6A 3D0GE 3R9LA 4BDPA 3GG0A 4X62F 4EU0A 1UL3A 1VQ7S 1FT8A 3HKZD 3TJ9A 3V6DB 2EC2A 5I3UA 2GVZB 4K4ZA 1N54B 2VBYA 2J9DE 4C48A 5HMWA 4ILLA 2O1PA 2OD6A 4I4BA 4WFZA 3GYNA 4IYQA 4RNNA 3ZZYA 2MGZA 5IOLA 3LTOA 3JQMA 1KLMB 5KFFA 2UV8A 3F0NA 4NXMJ 3EGNA 1Y3KA 5B0BA 3CJ3A 2XWYA 3AD8C 3SCLE 1KD1T 4JI6J 4Q8EA 3NP5A 2FHMA 1R89A 2Q79A 3HVTA 5KFUA 2RNEA 4DR7J 3W9HA 1HBUB 2AHOB 3MGJA 4IG3B 5KFBA 4EUVA 1S1VB 3F41A 1RKJA 1F1BB 5DZ6A 5IV3A 3QBCA 3CCJS 3Q8SB 2W7OA 1V5VA 4NZ7A 2HNDA 2LDIA 3PG9A 6FD1A 4Q5VA 4W92B 3V2UC 1JJ4A 1LWCA 1TKDA 3PDNA 1FO1A 3HP6A 2F4VJ 3BR8A 1JXEA 1HBNA 5CA5A 1U02A 3WHIA 2PEHA 4L72B 2JWNA 4NLGA 3K5PA 2YNGA 3L95X 2F8EX 3CDAA 2LEAA 1WKKA 5HBMA 3HULA 1UAWA 3CD6S 4RW6B 2HZCA 3IR7B 3R97A 4GC7A 5DDOC 2QT7A 2KH9A 1TVRA 4FDFA 4LQ3A 2CQHA 4DQRA 1CG2A 2VPYB 2YQ1A 4QIGA 4YN3B 2WW8A 2IDEA 5E3QA 2YBVA 5CZVA 3H5YA 3GB0A 2J9DA 2G0JA 1IKYB 1U25A 2KG0A 3OV7A 3KDOA 2BV3A 1VC0A 5KG2A 2ZD1B 2HRYA 3ONQA 1I1GA 5KFIA 2HSEB 2U2FA 1RT5B 1O6XA 5C42A 4KGXB 2PO4A 3TZWA 1FEEA 3MEEB 3M2RB 3QJJA 2X1FA 2DD8S 3RAMA 3CCWA 2PGCA 4WFNQ 4UOHA 2XI3A 4ZP9A 1TL7B 5KFKA 4TY8A 4J9OA 1RAOA 4K4UA 3HHKA 5IM0B 2R4FA 2HQIA 1HHTP 5KG6A 3T9NA 4U7UD 4YQWA 1TFYA 4HI2A 3CCLS 1IR2A 2YWKA 2R7SA 1IBMJ 3J7YI 2EPIA 2DRBA 4PAAA 3TEGA 3OTCA 3KHRA 1VHFA 3LANA 2X1GA 1WD6A 3MEDB 5HI7A 4UF4A 5KFAA 3AFGA 3T5HA 1N0UA 4B3OA 4LF5J 4DR6J 2B4VA 2C3MA 4F0HA 4USUA 5H9EJ 1V5IB 3CJ5A 2HPUA 4ZCIA 2I1RA 4KC5A 1I94J 5H9FK 1KNZA 3CTRA 1Y7PA 2FUG9 4DV0J 2CNNB 1S1WA 2EFOA 4WU2A 4N77A 1D0EA 1SJQA 2VH7A 3W2VB 1SL2A 4JV5J 2HFNA 3JYTA 2MKJA 4ZVFA 4HKQA 1TK0A 1XR7A 2POKA 5FLXY 2IY5B 3GMGA 2CQCA 5KG1A 4LF8J 2YWEA 1NJYA 3EGVA 5G4DA 4LF4J 4G6VB 3MI7X 2KT2A 3MOZA 1IKXA 2DXDA 4ES3A 2QA1A 4WK3A 1WC5A 1X4BA 1RYRA 3SDEB 5BYRA 4DR1F 3I96A 1RTDA 5E3AA 4QW9A 2MQ8A 3CMQA 2HRUA 1U4BA 2D74B 4YMEA 3LWLA 3VALA 2OKQA 4I2QA 4J9UE 1W25A 2LEPA 3BZQA 3UDVA 2AMCB 2BEFA 3Q8QB 3Q86A 2RKIA 1LW2B 5E3RA 1RA6A 1SIZA 3VGTA 2MKSA 3PYEA 4DV2J 4F8RA 3DRSB 3KUGA 1U1KA 3LPEA 5DO2A 1T05A 4MKBA 4ED3A 4HR2A 4PZVA 4C3MA 3IAS9 4PWDB 2DITA 2I5JA 2HHXA 1RISA 2IC3B 2HIQA 4IQMA 2KB2A 2HG4A 1SQGA 4LBHA 4XPCA 1VQ5S 5KFDA 2HS0A 4QWEA 5JMNA 2HHTA 1Q8LA 4TVAB 4HH1A 2EI5A 1PIEA 3NY0A 3PACA 4LSNB 5IT4A 2BW2A 1XNQF 3D3CJ 1FRMA 1HBOA 1FD8A 2HQGA 2NXNA 2FDNA 3UCGA 2BM1A 2ROGA 4NLRA 2FVRA 4A8WA 3T3FA 3AODA 1U6ZA 3MZIA 3TP2A 4KHPJ 4DV6J 3TVZA 4X66J 2FHOB 5HP1A 2ERRA 1B0PA 1IKWB 2MTLA 4UUWA 4OZ3A 2YQ0A 1GMUA 1R0AB 3DDNA 3QGHA 3NOCA 4DLEA 3HZEA 1NK4A 1CEZA 5A0YA 3RAXA 1VC6A 1T03A 4C7QA 3F56A 1UMJA 4Y2AA 3FKBA 1FE0A 1IR1A 3ENVA 2B4UA 1N52B 1KQFB 4PCQA 3KYLA 2KXFA 3MMAB 1WEYA 1MMNA 2E7VA 2FD2A 4NLXA 1VQ6S 3M9MB 4I7FA 1KTQA 3PX4A 2RB7A 1XC9A 1U8SA 1N5YA 1NHKL 2KZZA 1ZA1B 2EG2A 2R8KA 4NXNJ 2ZC4A 2G2OA 2AEFA 1HQEA 2ATCB 1O0PA 1WSVA 2DNOA 2H9ZA 3UN2A 4F2RA 2VL1A 2ZC3A 4UOFA 1U2CA 1ROFA 2JEFA 4A8QA 2OI2A 4U8VA 2QN6B 2MDAA 3L7PA 2GW8A 3N4WA 5CAAA 3T1AA 2N3OA 4DR5J 1QUPA 3BKUA 2YXLA 1N0VC 5E33A 4HL9A 2XBPA 1WI6A 1M5KC 2C3UA 5D78A 1YLXA 4DG1B 3L09A 3HK2A 4JI4F 3QMQA 3R5AA 1DQ9A 2OTLS 4Y2CA 5D4NA 1B70B 3FNNA 4WYWA 4B17A 3VGUA 2C2DA 4LIWA 1SUQA 2AX1A 2DBBA 5B0AA 4ECUA 3G82B 4G1QB 4O44A 4B3MJ 1NB7A 5HQMA 2ZKTA 3IG1B 4OX7A 4AD6A 2LXFA 3D66A 1IUJA 1VIOA 1WHXA 4OJ3A 3M8ZA 2IIHA 4JI7F 1GX5A 3UNYA 2YNFA 1YTYA 1K9MT 2YH0A 4HHUA 4EGLA 2DTJA 4X4NA 5M2RA 2YKMB 2OFGX 5AE2A 1GTHA 2P9CA 3MAHA 1R0CB 4WCEQ 4ZP7A 3E51A 2L48A 1DY3A 4C11B 3NS6A 4USJC 4LBIA 2DRDA 4QYZK 4HLBA 2VA2A 2MSTA 4MIBA 1T8EA 4OYPA 5E7OB 1TFWA 5THWA 5J2QA 2QFIA 4CIOA 2Y8YA 4FYYB 2W8LA 2XZDB 1WACA 3OHAA 5F3ZA 1G1XA 2CQBA 5EWFA 3DRXA 1IKVB 2CDQA 2KXHA 4WK1A 2Q1LA 3AAWB 3TX8A 3UR3C 4ECXA 4JI3J 4GVLA 3CJ8A 2V4JA 1SC4B 2C2ZB 2W24A 4XIUA 4L74A 2W7PA 4OI3A 2ILZA 4C3KA 5K20B 3Q22A 1DARA 4DI6A 1NKCA 1HPZB 5A76A 2AJFE 3B78A 2UUAF 2CWKA 2MHNA 2F9DA 1DURA 1A9NB 3CCZA 1IBCB 2B9WA 2XHWA 4DDFA 2Y1LB 1RTIA 3OL9A 1APSA 3FBBA 2CIMA 3WIUA 1HNVA 3DDIA 3OLAA 1B0TA 1JQGA 2L9WA 4B9LA 3IRWP 3TARA 3QFHA 4NLOA 1VOMA 1GNKA 3MECA 3H20A 3OTBA 3C66A 1UWAA 1JLFA 4XK8C 1CSJA 3UPFA 4EBEA 4KH1B 3PJWA 3CD7A 2YNIA 4ECWA 1MWQA 5HO4A 4ES1A 1NH7A 4IFYB 4CZCA 3CE8A 2FVPA 3D0HE 5CYMA 3I0SA 4EZ9A 4M5JA 2RD5C 4ZHRA 1MU2A 4U7CA 3M6UA 4M8LA 2HQDA 4EEYA 1VQ8S 1ELOA 2DK2A 5A8WB 4K4XA 3T1YF 3TWZA 2WOMB 1SL0A 2R2TA 5SUHA 2A6OA 2QE5A 3MMBA 4DSLA 2KHCA 4ZPAA 4Y28C 4CTAB 1R0BG 3HD2A 2IBOA 4CM2A 1QSYA 3CB4A 3CCVS 3CJ2A 4MKYA 1RWOB 3HZGA 5GAGI 1IR0A 4A8OA 2OLWA 2ZFHA 1RKIA 1WTBA 3ENQA 2D3O1 1F2HA 2I9SA 2Z4PA 1NSPA 3OR2A 4PG8A 5LMNF 4URGA 2EKYA 2RS2A 1TK8A 4DV7J 4GMKA 2O3DA 1NDLA 1GMWD 4YY3F 2M5YA 1VQYA 3MUMP 4CLZA 2RU3A 1H2VZ 2DCLA 4ETZA 1YJWS 3PVXA 1QDUB 1LQ9A 1NJIT 3JTPA 1WOPA 1J5OB 2XY6A 4JI2J 4RL1A 4MKVA 4LFAJ 1S6OA 4QJVA 4TNOA 3DLLQ 1U26A 1X4EA 3RR8A 5LT5A 4WXWA 2HQCA 4PXDA 2PD1A 1VRTA 4JI1F 1HNWF 2J6TA 1JXVA 4KPYA 1U45A 3TZXA 4QR2A 2AYGA 3W2WA 4RX6A 3VTIA 3A4TA 4UY85 2WBRA 2M52A 4F50A 4ZOSA 1J5EF 1N56A 4OIXA 1YJRA 5U47A 3CC7S 3DLKA 3D67A 1Q78A 1WG5A 1HD0A 2MJNA 1FVSA 4UQGA 4NASA 1JB0C 2ACMA 1DZ5A 3ETMA 2NXUA 1WUUA 4V19X 1RT4B 1RB0A 3MEGB 1WDDA 2BDPA 1RWKB 3J7Z5 1N4LA 2MZ1A 3FUYA 1RU2A 2X1AA 1GAOA 2BRLA 2XWXA 2LVWA 4CT9A 3NNAA 4NLTA 4MIAA 2PA3A 5DJBA 2ZE2A 2FTRA 2I6WA 2MZTA 4Q45A 2FLOA 2QYGA 4NLWA 3IBCB 1ZAVA 4CO3A 3BB5A 2BZ2A 3LP0B 3HO1A 3V6DA 3AOAA 1ZETA 2UU9J 5CCLA 2E1CA 3S6EA 4PRFA 3QLHB 2CG8A 1PC4A 3GP9A 1HL6A 2BJ9A 2ZHOA 2ALYB 3MUVP 2LKZA 1ZTTA 2W1BA 1WHWA 4OLPA 1REVB 4GRSA 3MOJB 5HSPA 4KFBA 1FI4A 2KRBA 3PYDA 1C0TB 1YBAA 2CNLB 3A3OB 3ZZZA 2B6AB 3KJVB 2LXIA 3VCDA 2HFSA 2DPJA 1WEZA 2DNMA 4IG3A 1NHUA 3HSJA 1AW0A 3LH2S 3PRDA 3KLIB 2ZH4A 2OFHX 2Z2LA 2AYMA 3UW1A 1VR6A 4GKKF 2CYYA 3MTJA 2H48B 2UXDF 3KLHB 3H4DA 4PWUA 3IRXB 2WB4A 4KIAA 4NEZA 1YITS 3BDEA 4GC6A 1U1NA 1XBWA 4OV6A 2QLFB 1YJ9S 3DNCA 3Q0AA 5FIIA 1P1LA 2BJ3A 5LM7E 5ADZA 5HQLA 3PFEA 3THVA 3NCPA 3MM9B 4H4KA 3PX6A 1SCJB 1AT1B 4YB1P 2W2NP 3W7BA 2CZ9A 2ATLA 4PWWA 1HI1A 3N6LA 3MPYA 2JEGA 3M7VA 3EICA 4RW6A 2JNJA 4C8MA 3TQ1A 1SJRA 4QZVB 3G2XA 1OPIA 4LFCF 4OYXA 2E9TA 5KT7A 5J2NB 1N34J 2JLGA 2L9NA 4F02A 1N48A 2HNZA 1RP5A 3JSRA 2NXEA 2IRYA 2DGXA 4UTGA 4FF1A 2BJ1A 4OFZA 3HI9A 2V8GA 2VKZG 2KL8A 3GCXP 3R3TA 4J9NA 1TKZA 1XEZA 4O0NA 2XC9A 5DLFA 2M9KA 3HLUA 4LSLB 2DO0A 2P2CB 2WSFC 4K5RA 2M7SA 1YI2S 2EWHA 5D3GA 1BQMA 4DU8A 1N33J 3A8KA 1BGXT 3HFKA 2OSRA 1WHVA 3MEEA 1REGX 2CJAA 2WVDA 2D9OA 4ID5B 1Y4ZB 1Q86T 2AV5A 3P49B 4EBCA 4B3TF 1PILA 2DHXA 3Q23A 3KK2B 1VDHA 3MAAA 1SXLA 2HRTA 1RCXB 8RUCA 3NAHA 1UZDA 1WOOA 4LR8A 2CPEA 2NLWA 5M2PA 2ILYA 4MYUA 1UEKA 4DQSA 1S9FA 2B3TB 4G1PA 2OHDA 2K2PA 1S12A 3UFCX 1RT2A 3PKMA 3BV8A 5FDLA 3UQSA 2WVBA 2XI2A 1DQ8A 4PG4A 3D1OA 5H9EK 3TAMB 1TL3A 2F40A 4B9SA 1DTTB 1YGYA 1EETA 4HHHA 2A0FB 3UR0A 2V2ZA 2ZH3A 1VK3A 4FF3A 4A4JA 5KFJA 1K47A 2ALZA 1IBLJ 1ZA2B 8AT1B 4KB7A 3EUNA 2F8HA 3MM5B 3GYXB 3ENAA 1GMWA 3R2CJ 1N5TA 1UP1A 3W60A 3K0JA 3M1VB 1FNMA 3I82A 3CCRS 3T1HJ 2AJ2A 4B02A 1S1TA 2BJDA 4CH0S 4OZJA 1UA1A 1XMQF 5IXUA 3FMBA 2ZDOA 4DUYF 3LPYA 3RZAA 3TR5A 1FDBA 4LF9F 3UNGC 1V3ZA 1VHIA 3R5JB 3CMAS 1JLAB 2CDRB 3PIPQ 2QGFB 5BJRA 4J9PA 3QZ8A 2FY8A 5A2QY 3FCWA 5I3QA 2DHGA 4KR0B 2KJVA 1M0SA 1SJ4P 4OX9F 1VQPS 2VJUA 2M70A 2J8AA 1HNXF 2QRRA 2JC1A 1S6QA 2GO9A 3NGSA 2NS1B 4QWBA 2GZOA 1RABB 4AUKA 1OWXA 1N6QB 4CO4A 1N36F 3Q8UA 4ZJQA 4F25A 3CIMA 4CLFA 4OZLA 2PDAA 2GGPB 4CP5A 5C25B 4M63A 4IG0B 3KLFB 3UDCA 3V5RA 4ECSA 2R3VA 5JVHQ 4USHA 1NSKL 4JYAF 4DS4A 4RBUA 3DLGA 1G4CA 3WQPA 1S97A 3BN4A 1S59A 4OX8A 4PWDA 4NE9C 3ZXWA 4KYZA 1UVLA 3IXQA 1P9YA 4N56A 3VAIA 2W9CB 3B82A 4FPIA 2LYVA 3CO0P 3DOMA 2OGUA 3VAGA 1ZYQA 2C2EA 4PQAA 1EKSA 4R0EA 1RDRA 4DUZF 1TKTB 2MY8A 4K8RA 2K3IA 5CD4H 2BE9B 3SZ2A 1FRIA 1VRUA 2AGPA 1GK8A 3EM1A 2RE1A 3TQEA 4R0JA 4X2BA 3NWRA 4ZVSB 3BGOP 1DHMA 1MSWD 3FK4A 5I3UB 2HVHA 1MMDA 1WG1A 1WSRA 3M6VA 2E7XA 2BYCA 4ANEA 4FYDA 3HM9A 3OQ2A 4TYAA 1NH8A 3FQKA 1HI0P 1UVKA 2LLZA 2V2QA 1R0AA 2NPIA 2UUCJ 4FYWB 2MGZB 2B43A 1X7VA 4RUCA 3LA0A 5B08A 2KFZA 1HARA 4ZPWR 1VS3A 3GIMA 2W4DA 2XMTA 3MTKA 2R7UA 1FXLA 2R2SA 5ETSA 2FJEB 3HVTB 3G8SA 2QA4G 1JXLA 2K7JA 2UUTA 3H5XA 2NSCA 2E1RA 5D0HA 2XMAA 2DGOA 4KHRA 5LSRA 3POTB 5KFPA 2RQ4A 2W7AA 3H25A 2V34A 3ISND 1JMTA 5B09A 1NMEB 3GSDA 2HNDB 2BUNA 1RU1A 2LA4A 4XDCA 1QVGR 4KTQA 4ZLJA 3DLJA 2RRBA 2M4MA 1B7FA 2PEBA 3W8PA 5K8MA 2LQ5A 1WORA 1Z4UA 3R7SB 4BCAA 1HBNB 2R9LA 4EBDA 1EARA 3C16A 5KFWA 4M5DB 3DM2A 4KKOA 4OZ2A 2IVFB 2CJKA 3SSSA 4FBUA 5DRKA 1CC8A 1U0HA 2YNGB 4BLGA 1VISA 5A8RA 5IQQA 2WONA 3UDLA 5HBMB 4I6AA 2V5HG 5KT4A 4LREA 2F8MA 1AB8A 4RPFA 1XJWB 1ZAWA 3VQTA 3ELHA 3CCQS 1HQ2A 3G82A 1B4SA 4D3GA 2RF2A 2HGNA 3NKYA 2VF3A 2IM0A 3KXDA 3HCXA 3IG1A 4DPOA 4CO0A 3WZ0A 4WIIA 1CJUB 4PXEA 1N32F 3QIDA 5AT1B 3RB6A 4IRDA 1HWLA 4K4SA 1K1QA 4NCBA 5ETRA 4DCJB 1JK9B 2MZQA 3PXGa 4O3SA 4ZK7M 3CIZA 4B9UA 1CPZA 3M2VA 2YKMA 1MLAA 4PPDA 5C42B 4K7QA 3NOGA 4C11A 2ZKUA 2WVFA 3I0RA 1GT8A 4ZP8A 4DQIA 2PT0A 1VLOA 2AGOA 1OPZA 2ZH2A 2CADA 2CJQA 1GMVA 3I4HX 4JV1A 3P45B 2JHEA 2G2ZA 4IFVB 2ZBPA 2JH3A 4YEAA 4M94A 3GG1A 4YB5A 3OJSA 2WVEA 2XYPB 2DXEA 3CJKA 2A2CA 2FY1A 3DGVA 3OVBA 3BGLA 4NI2A 4DSIA 3O5TB 3VWSA 4MJKA 1Q8IA 3N79A 2V8DA 2BE2A 4O3RA 1S7IA 1WI8A 4U6PA 3OTOF 2ADBA 3GFYA 4USWA 5A6WA 2F63A 4JI8J 1D9AA 4DV3J 2CQPA 4A8XA 2D9PA 2HK2A 4MAKA 2W9BA 4QIVA 4B3OB 4DCOB 2WSEC 1GH8A 2DR9A 3QT7A 4LRCA 3N6NA 3NCQA 1PAUB 3TAPA 2MQLA 4Y34A 1NKEA 1WC6A 5HROA 3CCUS 2ZEJA 3GCWP 3PNIA 1N5QA 1O8BA 3P5TL 4ZVGA 4NXMF 1VRQC 1AFJA 3RBDA 4JI6F 2GMLA 2VQEF 2XZWA 3FRYA 3PO4A 5E3CA 4P71A 3D2WA 4C8LA 5H9FJ 1U2RA 1S1WB 4DR7F 2AJ4A 4IFYA 3BQ1A 4RUBA 3ETOA 3NNCA 5HAOA 3JYTB 2J9CA 1X4FA 2HFZA 3A1YG 5GVQA 1S9GB 4IH6A 5KT2A 3H90A 2V8PA 2CNKB 4PYDA 1K0VA 4X4QA 3ITHA 2WOMA 3THTA 4CYUA 3DXSX 1S9EB 3C8YA 3VVTA 4ECTA 1RTDB 4FXWA 4USIA 3MXHP 2F4VF 2JFDA 2QZ8A 4CTAA 4I2QB 1MN7A 3I6PA 1U24A 3R5GA 3G87A 2HW3A 2V8VA 1Y11A 3N0VA 2RKIB 4FYVB 2BBEA 2DYAA 2WVCA 1RSCA 4C8OA 5CABA 2I8EA 2ZJPQ 1T0TV 2E9ZA 2XLJA 1AXQA 2X3GA 3ISNC 3ZNJ1 2V8HA 5DDPC 2RQCA 1Z1ZA 4L3KA 3FDSA 2I5JB 3AB2B 5KFSA 2YPYA 3PR4A 3KMQA 1HA1A 5D15A 2DY9A 4WZQA 3KMSA 4DR3J 1L5UA 2MB0B 3ADAC 1U2FA 3AJDA 2GQ2A 4DJBA 1HBOB 4BC7A 4FBTA 1FXRA 3AH6A 3R6GB 3BO4A 1ZM9A 2Y1RI 1NDKA 3G8QA 2FJAB 5KTQA 3AXKA 4KRWA 4XAKA 4E2FB 4AFFA 4EK2A 5HP1B 4V1Ak 4MK9A 1LWEA 5HANA 4U8YA 2EFVA 1J2VA 4WP8A 2CQGA 1Q7YT 5A0YB 1F3VA 2OELA 1RAIB 1LXJA 5EUHA 1T03B 2CJ9A 3OUYA 1X0PA 4RJVA 3W9JA 2N82B 1CQMA 3QRRA 5D0EA 3S1TA 1IBMF 4QIFA 1FE4A 2WHOA 2PMWA 2CPHA 3DDKA 4A8SA 3TYTA 3A8JA 3OBIA 3QO9A 1VIXA 4E98A 4OYOA 5KFOA 1N5YB 3EDQB 1H98A 4P6QA 2NREA 4OQJA 2XMMA 5F0UA 3GTYX 2KFNA 2ZJQQ 1HQEB 1S77D 4LF5F 3MM6A 4CNYA 4DR6F 3QQCD 2IHR1 1ZBTA 2Q3PA 2BANA 4I6YA 1IJEB 3KG4A 3D0IE 1N5VA 4PR6A 4DX8H 2YVSA 1BUXA 2QLJB 4PABA 2D1CA 3T41A 4KO0B 5J1EA 3FJ2A 1I94F 2FVQA 1U1MA 4LR9A 4B9MA 3EGZA 2L08A 1CULB 4DV0F 1KLNA 3J81U 3M4XA 3OXFA 4O3OA 1Y9OA 4JV5F 1F6TA 4Q8FA 2VDIA 1WWHA 2DKOB 2F1FA 3MF5A 3D3BJ 3U1MA 4ZPCA 4LRBA 3KJVA 3ZTSA 2MMYA 5K5MA 4LF8F 4LUBA 1SUQB 2E1MC 2HVZA 3BR9A 3MWBA 3OFEA 4DV5J 1F5BA 4X4PA 4LF4F 4KGZB 4O44B 1JWWA 4H4OA 3MR3A 2COLA 5T41A 1DQAA 1RT1A 2A3JA 2VZ9A 2X51A 1SBRA 5ETNA 2IFXA 2FLLA 2FGCA 1Z2LA 2BABA 2Q43A 3IRXA 2H1YA 1GFWB 3K5NA 3DRPB 2KKHA 2V69A 2YNFB 2DHSA 4WFAQ 1U1RA 2QTWA 3K7RA 3CD5A 1Y5IB 1IBKJ 3DU6A 2HZVA 4G1IA 2EEYA 5AJ3J 1O5JA 4DV2F 5A6PA 3F73A 2VQFJ 1H0HB 2NSBA 4URSA 3IS9A 4OL8A 3ZTOA 3MFHA 4EO6A 5CXTA 4TXSA 5J2QB 1HD1A 2R7VA 3PW4A 1U09A 4DL0C 4XTTA 1UCNA 2J7WA 1NK8A 1KFSA 3KK1A 1BWVA 1CBKA 5KFHA 1BC6A 3TUIC 2K3KA 1D8ZA 2FZKB 4O3PA 2EBEA 3BS9A 4ID8A 1WC1A 4DR2J 4JUZA 1L3VA 3SSQA 3P8BB 1XNRJ 4PXBA 1D9FA 1TL4A 2DGSA 4U95A 1NU4A 4KHPF 4DV6F 1CJTA 4X66F 3EPGA 1VBZA 1VJQA 3G8TA 2R2UA 5LOQA 1UJ6A 1DAXA 3OD2A 1RTIB 2OJ3A 5D0RA 2OEKA 2IYGA 1HNVB 4ID5A 2FPHX 3RAQA 1VBYA 4PUOB 4FF4A 4TU8A 3SSRA 3JAMU 2MY7A 3MECB 3CDEA 3KK2A 1JLFB 1R31A 4R25A 3FSXA 3H5SA 4MTPA 4MMOA 2BKPA 2YNIB 3QFWA 1Y0HA 1IM6A 3CWJA 2QSFA 4KAIA 4JV2A 2M2BA 3BQ0A 4CCHA 3HHLD 5CYMB 3I0SB 4YR3A 4URQU 1H2TZ 3AD7C 1D8YA 4ZHRB 2PSZA 1MU2B 2HLTA 3S01A 4NXNF 2ROEA 3V6HA 3R2DJ 3W9IA 1PJ5A 3I5BA 2K7KA 3DI6B 3MMBB 2PI5A 1SH2A 2B9XA 1CLFA 1C4AA 3D1HA 2PN6A 2LMIA 1S0NA 3U1NA 5DG9A 4ED2A 1FNOA 4DR5F 5LMUJ 3K17A 4WJBA 3MMJA 2AEJA 6AT1B 4NEYA 5KFEA 4FS1A 3OT9A 2NR0A 1X4CA 3B54A 2ADCA 1EKRA 4ZCLA 1RHJB 3M1VA 4C3LA 3C6UA 3OR2B 1GEHA 3T5KA 2L41A 4ED4A 1FERA 3D54A 2DEJA 3PM9A 2HBRB 3CEDA 3VQSA 3D7SB 2XY5A 4H54A 1YJVA 4JI7J 2RRNA 2IJFA 4USKA 2F4FA 4N41A 2OEMA 4DR4J 3M32A 4ZLNA 2NUHA 3US5A 1NPRA 4YUDA 3NAIA 4USVA 5JVGQ 1JJCB 1FWPA 3U02A 1D9DA 1SC1B 4CLYA 3V4MA 2RRAA 3NS7B 2E66A 1VRTB 3AY0A 3G6YA 4RWXA 4ICLA 2D3OR 4B3RJ 3W2WB 3KNAA 2ABYA 2YKAA 3NMRA 2BW7A 3CDUA 3EZ5A 4QIEA 2C3YA 2FC9A 2XMVA 3MMCA 4ITSA 4IG0A 1HWIA 1FEHA 3DLKB 4FZVA 4ED7A 4K0KJ 1NEEA 1PGZA 3BPSP 4HEA9 3IO1A 2LEBA 2H5EA 4UY8T 4DQPA 2VFVA 2QLWA 1ZPWX 1IN0A 4JI3F 3E8OA 4DL3A 3CC4S 5B0FA 4C8KA 3RB3A 2W4PA 3O3LA 3HMJG 3PV8A 2W9CA 3NEKA 2YTCA 2E7WA 1XERA 4F2SA 1NZAA 3CO9A 4UZBA 4P2MA 4P75A 3NCRA 4PEOA 3C14A 1ZS6A 3LGMA 3HF5A 4RUAA 3C46A 1AA1B 3RW7A 1X9WA 1RBAA 5C2GA 1S99A 3SEOA 4RBTA 1RYSA 1ZOTA 4Q7AA 1LNQA 3Q8RB 3K59A 1PC5A 2HVDA 4GKJJ 4NRUA 3F44A 3AOBA 2FJWA 2DH9A 3NL0A 3UVJB 4PXCA 1VBKA 4YHHJ 2WZ1A 5BYQA 3PTWA 4DPYA 1HWUA 4AQYJ 1BLUA 2PFFB 3FQLA 4HVZA 3HX9A 1TL1A 3QGIA 4LF6J 1B64A 2HQ3A 4AXJA 4ED5A 1ITPA 3KOAA 3BYPA 4KFBB 2C2NA 2W2QP 3NGKA 2XO7A 2XGPA 4TY9A 4LBPA 3A3PB 3G9CA 3MD1A 1T02A 4OZ0A 2QMUB 2AU0A 3L9ZA 3HJVA 1DRZA 1U6FA 5KT5A 2OTJS 3POTA 2C2MB 3LO3A 2Y0BB 3EGWB 1FKPA 2QLXA 1CQNA 1H6KX 4ED8A 2JEJA 3MCMA 4GVBB 2VASA 1XWLA 4NA2A 5KOWA 2XSJA 1C1BA 3CJ4A 3HSGA 4RU9A 3C15A 4ZPTR 1SQFA 1JLBA 2V9KA 2VIHA 4IO1A 3NBPA 3QNWB 2WTFA 4K4WA 3SXLA 3BSNA 4MKAA 3P3DA 1NK5A 1QTMA 4NZ0A 4RBVA 2FB0A 1HBMA 3W8GA 2P9EA 3HHLC 4M5DA 5T7LA 2Z30B 3GONA 3N01A 1RTHA 3GJSB 2ASYA 2DIVA 2LQ9A 4K2JA 2HWHA 3DLEB 1C1CA 1WNEA 4F4ZA 4RW9A 2DXFA 4DV7F 1VQLS 1FRKA 3AQPA 3TA1A 1A0OB 2DHHA 5HLFB 4DL5A 3KLEB 2HNZB 2IVYA 5DDQC 4QWAA 2HMIA 5KFXA 3FFIA 2NCKL 1Q1KA 4ZPDA 3OLBA 1HNIA 3M6WA 3V6KA 2O5DA 4JI2F 3W64A 1M5PC 4X65J 3OTDA 4HTJA 3HFVA 4DSFA 4LFAF 1CJUA 2AQ4A 1S1UB 2X3DA 1TKZB 2GIQA 1CJKA 4EFAC 2M0GB 1UTAA 1L3KA 2VONA 2VFRA 5D3GB 1X9MA 3QRPA 1BQMB 5EHHA 2A10A 3Q24A 1MNEA 2VG7A 3M8SA 3N6MA 2K06A 5K8PA 2JLEA 4WF9Q 5IT9Y 2XYGB 2ZH6A 4ILRA 2XMUA 2J5AA 2PIIA 2CA9A 1QLNA 1NBEB 2HVEA 2MPUA 4CH1A 4O0IA 1VQNS 3TVKA 2BR0A 2DGTA 3JSMB 2VUGA 2UUBJ 3PIOQ 4IFVA 3O6QA 1KOHA 3MAAB 5D4OA 1BMQB 4ZVHA 1W2IA 2RS8A 3ULHA 4WTYA 2ZVSA 3KLGB 3PHTA 1R43A 2RSQA 2KYZA 2IRXA 2QA2A 3HHDA 2N4DA 3UCZP 4I6WA 1F9FA 5C2CA 4IR9A 2Y8WA 4EMDA 2B5JA 1NKBA 3MPDA 1I3OB 1BY9A 2WBMA 1RT2B 5FDLB 1B99A 2ZH1A 2QX0A 1PBAA 1KSPA 3RUBL 2XGQA 3N28A 1RACB 1NNDA 2W2OP 3VVUA 2CFXA 4PPZA 4PYAA 1TL3B 2UU9F 1KC8T 4Q2MA 1EETB 1RJJA 1YVFA 1RAGB 4TLRA 2CJBA 1JLGB 4HDGA 3D1QA 2ZHAA 1YBUA 2W25A 4J9LA 1EQ0A 4B9TA 5G0RA 4OYIA 3N5FA 1VGYA 1T11A 1S1XA 1JLCA 1FK9A 5D8HB 3MPVA 2QV6A 4KSEB 3N9UC 2DRAA 4DV4J 2D7SA 2P6SA 3CNQP 4IDKA 1GXLA 4DU7A 1S1TB 1T95A 2E5GA 2GJIA 1VQOS 4WIQA 4QW8A 3A3NB 1S9GA 7FDRA 2HNYB 2J0WA 4LVNP 2VKRA 3MM7A 1Z2ZA 3OL7A 5IZHA 4TQSA 2CWXA 2NXCA 2HHWA 2AX0A 1S9EA 1YDLA 2FVCA 2VPXB 5A2QU 1RUSA 2HK3A 2XY7A 4M5LA 2JRSA 3DRYA 4ZVEA 3FVYA 4C0BA 4I1TA 5GAHU 3V6JA 2QG9B 1S6QB 2V0NA 1EP4A 3OFFA 1KTVA 1QM9A 2YX4A 4FN5A 3IBWA 2KM8C 3WC0A 1AUSL 1TTHB 2VV5A 3A8IA 2IBKA 3KWMA 3ET6A 1N34F 4FXDA 3H0PA 3OFGA 4ECQA 1HLWA 3DLGB 4NYPA 2W01A 3WIVA 2P5VA 1RWPB 2J0SD 5KT3A 2NYHA 2F3JA 2CRLA 3Q8VA 3SFUA 5KFTA 2XCPA 3KHGA 2IPOB 1VLYA 1S72S 4O3QA 3BSAA 3DOMB 5L38A 1BHNA 2DNYA 1Q4RA 2FJBB 3FEXB 1RTJA 3MCSA 4NRTA 3I32A 2RU9A 4I69A 1NLKL 3MM8B 3FGVA 4C9DA 5KG4A 2DH7A 3W62A 2VU5A 1N33F 2XQCA 1VRUB 4QU7A 1TELA 2GMJA 3HPOA 2V2KA 1NJZA 4B3TJ 1ULRA 2CPZA 2ZWOA 2D69A 2R8HA 2IMWP 1IQTA 1JLEA 1S48A 4ZIWA 3SQOP 3W3SA 3BSCA 2HHHJ 2VFUA 2AKWB 3R7NB 4QBUA 4F3MA 3BF4A 4RNMA 4N7TA 3M05A 5HJYA 1RBLA 5CCMA 1TUWA 3DRRA 4Z2XA 3PZPA 1HKAA 1TK5A 1WF2A 3WC2A 1JLQA 1FXDA 3DHXA 4DV1J 4J9SA 2DNHA 3U27A 4LIRA 4WPAA 2B8QA 2VOOA 1YBTA 4F4YA 5KFGA 1BQXA 4AE5A 4M5MA 4UQTA 5HVGA 4NLDA 1WEXA 1X4GA 3EXCX 2A18A 4AL6A 4ZVTB 1S5ZA 1X31C 5L9XA 4ILMA 2IJRA 3V81A 4USMA 2XYHB 1T3NA 4FPRA 1RHMB 3GV8B 2O01C 2JOQA 1IBLF 4KO0A 3QIPA 4CO1A 3IWXA 4OZNA 3C16B 2MEWA 3DM2B 4KKOB 1CULA 3IWNC 2HBQB 3Q8YA 2CQ0A 5D0GA 1U0HB 1JNZB 5A8RB 2WONB 2IAJA 2R8JA 3T1HF 2CQDA 3SFGA 3ZTQA 1SJ3P 3ENWA 1UFWA 4QQBA 3MURP 2VD3A 5EWGA 5F0WA 4WE1A 1XR5A 4F0MA 2ZHBA 4YB7A 3E01B 4FKYA 5J2MB 4KV8A 2ASJA 2J7UA 4DZDA 3EYZA 5KOXA 2RF2B 1Q82T 1IWAA 1NDCA 4HYKA 4UOGA 4H4MB 2HAFA 4DX7A 3EPIA 1VQ4S 1FWLA 1WC4A 3MUTP 1R8HA 2CPFA 1SJFA 4EO8A 3NXZA 3VF0B 3DRPA 3N5BA 3DFEA 4KT0C 1S6UA 3PFOA 1RT6B 1AYEA 3M2VB 1ZAXA 3H5UA 3JXOA 1U49A 3SYZA 3QWPA 2FJXA 3OJUA 3KJFB 5ETQA 2CKWA 3I0RB 2JZ5A 1XIQA 2NZ4A 1FRXA 3CF5Q 2MLXA 2EFQA 1C2PA 2DGWA 5FD1A 4L3NA 4YS2A 3HT0A 2JFKA 3X1LB 4X4VA 5HATA 2LCWA 2HBZB 2XG8A 5BXIA 3GR0A 4IKAA 1QE1A 2Z56B 5C7PA 5F8IA 1F3FA 2OPPA 2CQ1A 3TO8A 2DVIA 2M8DB 4WKRA 4LFBJ 1PAEX 4JI5J 3KKFA 2Z8QA 3CJKB 1I5OB 4NI2B 4DPTA 4CT8A 2ZM6J 3Q8PB 1WG4A 3GJRB 4YR2A 2R7RA 2KU7A 2LQBA 2BE2B 2PMHA 1RWWB 1YG0A 4L73A 2QL5B 1HNZJ 4EYHB 4TKTA 3DYAA 2VG5B 1R8PA 4M5KA 7FD1A 2W9BB 2O66A 3VV2B 1P9QC 2EKNA 4LF2A 1RHRB 5L9NA 3SQGA 5DM6Q 4NYZA 3OL8A 3ZZ0A 2PMZD 2BM0A 2CQ2A 3LF0A 1B7YB 2UUCF 5KFCA 3T6BA 5HROB 4QU6A 2HWIA 1KONA 4PUOA 1H74A 5C24A 1FRJA 4WFBQ 2JC0A 2IDLA 3OSPA 4LMZA 4MK7A 2G1DA 2QA4S 1QVFR 5C5JA 4NLSA 5A8KA 3KHHA 1NZ8A 1MWZA 4LQ9A 4OMFG 1RAEB 2ZBCA 2PA8D 1TR0A 4DSJA 1WC0A 3J80Y 2GMHA 1FTRA 2RMLA 1LEOA 2O67A 1WJ9A 2J6SA 1FFWB 2FZCB 4DF4A 1UVNA 2KN4A 3MDFA 1JIHA 2CQIA 5E41A 1FA0A 3WBZA 2CNOB 5HN0A 1YJ7A 4UUXA 2XLKA 3ITHB 1VJWA 3K8WA 1LV5A 5LL6d 1F2GA 4P7VA 1PCAA 5DZ7A 3GIJA 2MQNA 3DI6A 4CYUB 2B7BB 4ANDA 1QJHA 5AXLA 1EZZB 3LP1A 1ZM4A 2DISA 2M88A 2KT3A 3GIRA 3LQVA 3DLHA 4OI0A 2GJ2A 3H4BA 3PCOB 2YKOA 2AJ0A 2XZTB 4G65A 1Q5YA 3K5MA 1VFJA 3IR5B 2KHDA 3HVWA 1MG7A 2H3EB 3QSIA 4NL5A 3FBCA 4P7TA 2JLFA 5CYQB 2EFPA 2YKNA 3UE2A 3RB4A 2K1RA 4C98A 4X84A 1WTFA 5AXNA 2HGMA 2DNGA 3H59A 3UWTA 2AF6A 5B0DA 3TA2A 1UWBA 3SI8A 4X4TA 4CQ1A 4ZS6A 3ZZOA 5K9FA 1RE1B 2WK4A 2JVOA 3PRVA 4WTOB 4ZCKA 1CS4B 1OSCA 1T9YA 2RQKA 3HVRA 2CPIA 3G86A 3Q83A 4ZJLA 4CLUA 1DLOA 3FMWA 3K58A 1EAYC 4NCGA 5KFVA 1FDNA 4QPXA 2VB6A 2DH8A 1G6BA 3T5JA 2RDJA 1LWEB 1OYEA 4LT6A 4WZMA 4ZIVA 1KVKA 5F8JA 1KHWA 4QOTA 2G13A 5JJBA 4ZVRB 4DMZA 1QTNB 3O44A 2HQFA 4W98A 4NCAA 4K4TA 3OUYB 2EK1A 4RO0A 3CJSA 4DXLA 5D6GA 2RAQA 2G4BA 5HMYA 4G3IA 5ETMA 1Q7LB 4Y00A 4C0OC 1Q95G 3G6XA 3UD5A 5F8MA 1HHSA 3QO9B 1NRKA 4JI8F 2HGLA 2RUSA 1CC7A 4DV3F 2QMWA 4PQUA 3IP0A 1RLDA 4OHYA 2KTQA 4ZLLA 1XN9A 5HK4A 3W5ZA 2HAIA 2NYIA 3NG8A 1LKZA 3MM6B 4RW4A 2MXYA 2BANB 2XS2A 5IV4A 2ZBRA 4YDDB 3V4IA 5HL7Q 2VQEJ 2D41A 4WWSA 5GMDA 3UVJA 5J1EB 2RHSB 2KFYA 3TANA 4CLKA 4U7UK 1N8RT 3GILA 1U1QA 4ELTA 5GMKa 3O2IA 4QIWD 2BXJA 5BR8J 4QWDA 1U8WA 2XM3A 2LFVA 1N88A 2CQ4A 1Q0NA 1S57A 5IC4B 1YZ7A 4NLQA 2APOA 1SV5A 2E44A 1TKXA 3M30B 1TAQA 3EVOA 4H4OB 3ISZA 4RKUC 4OLOA 1RT1B 2AYBA 2XSFA 1V3SA 4ZITA 1F60B 2BRKA 2GFFA 4GVBA 4IQXA 3D9BA 3L3CA 2N3LA 2DEIA 2ZOMA 1ZM3A 2CAJA 5KG5A 1UVIA 4I2PA 4FNIA 4CRJA 1RT3A 4IOCQ 2E1PA 2G0CA 3GWCA 1M1GA 3M8QA 3PRBA 3IS9B 2GIRA 2WCXA 3QT6A 3KTQA 1Q53A 3CT9A 1K1SA 4FXVA 2IJNA 2XMKA 2B51A 5GADI 4NLVA 2DNPA 2F5GA 3BGRA 1VQ9S 2HHVA 3DLEA 4RNHA 1JJ2R 1ZTWA 3BPDA 3VAHA 1NSQA 3KUEA 1YRUA 3KK1B 2OEJA 2VDHA 2VPWB 3EVWA 4DX5A 5HLFA 2Q6BA 4QR1A 3KLEA 1V9OA 2Y3YA 4B9VA 3SMZA 4DR3F 2YWHA 2AEMA 1TU0B 3VAMA 1S1UA 4DX6A 2UXBJ 4OJHA 1W26A 4LVOP 1HMVA 2U1AA 2WAQD 2Z2ZA 2UVUA 2KVQE 2MKCA 2FHKA 2XEXA 1MMLA 4CDIA 2IMOA 3TZYA 1AZSA 4J9VA 3VR1A 1CJTB 5KFMA 4P2SA 3ZNUA 4KH0B 1WKLA 3K8VA 3OVAA 2AP6A 1T9TA 5MLCV 2C1EB 1HR0J 4K2XA 2AYEA 3BM7A 2ZDPA 2XNQA 3NLCA 4P9SA 1SJ1A 1X8DA 2KRRA 3M2UB 3JSMA 1OY9A 2A2DA 2F9JA 4OYMA 1RWNB 3RBZA 3PJXA 3VGSA 5KG3A 1C0UA 3BGUA 4TU9A 2Z57B 3KLGA 2YNHB 5IC6B 1H38A 4PKDB 3U1LA 1H7XA 4MFBA 4OV1A 1XTZA 2YQ3A 1NJWA 2VJVA 1HHQA 5EWEA 2CQ3A 2C22A 3EWGA 2DY1A 1HYSA 3PKYA 3JSYA 3CC2S 1FDDA 1KBRA 3UD4P 5KG7A 2H65B 4Z7YA 5L1KA 3LP2A 2XS5A 1DBDA 2CZVC 5K14A 1RA7A 1R7IA 3H40A 3DHWC 4KJIA 1JLGA 4DFKA 4NX9A 3CDWA 3KK3A 1XMBA 4NOHA 3IGNA 5DQGA 3TOQA 5LJ3Y 2BKNA 1KQSR 2P9GA 1KVJA 3C19A 3W66A 1RI7A 3TAQA 5CHCB 1VQMS 4X64J 2YX7A 3C6UB 4O4GA 2J9EA 1IJFB 3RRHA 3TW0A 2EFGA 9ATCB 2E1AA 4DV5F 1T9WA 3G6VA 4B3SJ 5KFQA 4I56A 3P6YC 4BC9A 1QY7A 2YH1A 4P52A 3DCAA 4HT5A 3SBMA 3M9OB 2IM3A 2HFVA 1UEUA 2XHCA 2XULA 2HNYA 3AJ1A 4B08A 1H73A 4WP9A 4Q2LA 3M32B 1NHVA 3BN7A 3OTEA 3HHEA 5GAEI 4X4OA 1OS5A 5LJ5Y 3M8RA 4NA3A 1IBKF 5H1SV 5AJ3F 1GQEA 2VQFF 4F3QA 1BD6A 1QAXA 2W4CA 4YFUA 2ZOGA 4ICLB 4OHZA 2RT3A 3OXGA 4F3OA 1KQKA 4ERDA 2GC8A 1P27B 3M8PA 1RBOB 3MMCB 4L75A 2AWZA 5J2PA 2C2RA 4DN9A 2JJ4D 4RR5A 3L7OA 1H2UX 1YZ6A 4I64A 3CCTA 1AROP 5EDWA 3VZHA 5F41A 1MROB 2DR8A 2DGUA 3VAJA 3BDPA 4DR2F 2MHEA 1ZM2A 3WX8A 1TP7A 1AFIA 3HKWA 1KQGB 1E6VB 1XNRF 3OR1A 2ZH5A 2E5LJ 1S0OA 3C14B 2DGQA 5IT0A 3MM8A 3DC2A 2RILA 1NK9A 2MQPA 3ILOA 4P73A 1N5SA 1FD2A 3CJ0A 5ETPA 3RU0A 2EK6A 3TJAA 1YJUA 3GQCA 2HZAA 1HQUA 2G2YA 2GA7A 4HACB 1TL1B 3BGFA 2FIUA 1NPKA 2AJQA 4KGKA 3JB9k 1OO0B 1TUGB 1G3OA 4M1KA 1PYTA 3I56S 1MW7A 4P10A 1FCAA 4ECZA 4EYIB 1KR4A 2BOPA 4ECYA 1LXNA 3RYLA 4ED0A 4QWCA 2GVDB 1SVDA 1KN6A 2SXLA 5KFRA 4LF7J 2V68A 2A1BA 1HFEL 3FBEA 1FKPB 3MHYA 3VAKA 3HVAA 1FESA 1ICEB 1OY6A 1VQSA 2MKYA 1R6YA 3J81Y 1XMOJ 1GXUA 2Y9HA 2XSJB 1C1BB 1S4FA 5RUBA 3C15B 1JLBB 3NBPB 1T7PA 2J8SA 1FWKA 4V19J 3CULA 4Q43A 2RUGA 1M5HA 1YJTA 5LMUF 3OXLA 2H51B 2HURA 3R5DA 5BYSA 3DGPB 3MCNA 1FRLA 4KQZA 1E6YA 1HBMB 5T7LB 4OZ1A 2UXCF 1RTHB 2CPYA 4JI0J 2J76E 2Z58B 2C2OB 1HI8A 3IFEA 1NXIA 2EXUA 3KG0A 2UV8G 1C1CB 1L3UA 8ATCB 3C6TA 3SIPB 4RW9B 4QYRA 3GE9A 1EQMA 2J0QD 1DTQA 4WKYA 3E01A 1LFPA 1VCTA 5J2MA 1JKHB 4ELVA 2HMIB 4LF1A 3FFIB 3KG1A 3QWUA 4DR4F 3DOLA 3MR7A 3TUZC 4KHMA 1HNIB 4LJMA 2KZMA 4H4MA 3BSOA 1FJGJ 5LXRA 3TRGA 4CO2A 3H8YA 2YX1A 3GJQB 5I42A 1CJKB 4FVCA 5AXKA 4PG7A 1BXNA 1RT6A 3OFHA 4B3RF 4OHVA 2ZBQA 2VG7B 3C3LA 3PYGA 1NK0A 2MKIA 2IYIA 2OPRB 4IUFA 2EFNA 3KUHA 2NQPA 5IT9U 3RR7A 3ILIA 3HHLB 3C2PA 1P1TA 2HHPA 4EWTA 4K0KF 3AA8A 3ZFVA 4M5IA 2E5JA 3D5MA 1QAYA 4X4RA 3ZZUA 4FF2A 1R8BA 2GQCA 3TJ8A 4KGMA 3AT1B 5IWAJ 2H54B 1BQNB 3T6JA 2MQQA 4RNFA 4DHVA 5GMEA 5HVHA 4NMLA 3CUNA 4BHQA 4JP8A 4I0WA 2Y1JA 1LW0A 3BO2A 1Q81T 2WW4A 2NUUG 2B5JB 3BJYA 2CPJA 1U48A 2HHUA 4X62J 3MFIA 2DPIA 5F8HA 1LK7A 4KGVB 3I31A 3FEYB 2I2YA 1X9SA 2ASDA 1R27B 2VG5A 3JAMY 3VHQA 1SPBP 4GKJF 4CLWA 5E2QA 2BKOA 5F8LA 2AD9A 4ZP6A 5GAHI 2Z2MA 3HSDA 1IM4A 4DL7A 4F36A 4YHHF 3M8WA 2NPFA 4OX6A 1M5VC 2KI2A 4AQYF 2V67A 1UPMB 3TI0A 3EZUA 1MN9A 1X5TA 3B4DA 3IC1A 4LF6F 2CXEA 3DMJA 2GNKA 2ZBIA 4CLLA 5G0RB 4A8YA 1NB2A 1NUEA 4K50A 5LSLA 3R1LA 4ZPVR 1RHUB 1S1XB 1JLCB 1FK9B 1LFWA 1TV6A 2GHWA 3R6LB 2QLBB 4IDKB 4RW8B 1K73T 2H4WB 1FRHA 4F0KA 4Q0BA 2FLNA 5KFNA 4OZ5A 4RW7A 1FKOA 4KPCA 5DGBA 3DN9A 4HI1A 1DJ0A 5FLXU 2FVSA 2AT1B 2MJUA 2OPSA 3MM7B 1RQ0A 5T14A 4P2FA 4C8NA
chains in the Genus database with same CATH topology
2B9YA 4LVNP 2VKRA 5IXUA 2YWFA 3MM7A 3FMBA 2ZDOA 1Z2ZA 3LPYA 3OL7A 4DUYF 5IZHA 4PG5A 3RZAA 3TR5A 4TQSA 3NMAA 1FDBA 1QUVA 3IGVA 4LF9F 4DOZA 3UNGC 1R3NA 2R7QA 1V3ZA 2HHWA 2AX0A 3CMAS 1JLAB 4C8YA 1S9EA 2FVCA 2VPXB 2OPQA 4JI0F 1EP4B 2XY7A 2I38A 2Q6CA 2XB2D 2JRSA 3DRYA 5E0OA 3PIPQ 4ZVEA 3GFHA 3FVYA 4C0BA 1WELA 5BJRA 4J9PA 1X4HA 4UW2A 4I1TA 3QZ8A 2ZZNA 2MQMA 5GAHU 5A2QY 3LGNA 5I3QA 3V6JA 1S6QB 1JLAA 1RT7B 1NO8A 2DHGA 2V0NA 4KR0B 5MAOA 1EP4A 2KJVA 1M0SA 1UETA 3OFFA 1KTVA 2DT9A 2YKQA 1SJ4P 2YKPA 1LWFB 4OX9F 5JXSA 2MSSA 5CZXA 1UFLA 2DNQA 1VQPS 2VBWA 1FNXH 3TA0A 3CSKA 2M70A 4R5PB 2J8AA 3LWMA 1HNXF 3QAEA 2QRRA 1QM9A 2YX4A 5KFLA 4NYOA 2JC1A 1S6QA 2GO9A 4FN5A 1RT7A 3PW2A 2MZRA 2NS1B 4GO7X 4QWBA 2E9RX 3IBWA 4AUKA 1OWXA 2UVWA 4OI2A 2KM8C 2YY3A 5CYQA 1Y5NB 3WC0A 4WYLA 1LWFA 1TUVA 4CH7A 3DU5A 2DNKA 2KG1A 1S0MA 4ES2A 1N6QB 4R5PA 5EN1A 4CO4A 5DGAA 1FJGF 2FC8A 5IQ6A 2VV5A 2DNLA 5L1LA 3SV4A 1N36F 2IBKA 3KWMA 4B9NA 3QGGA 1N34F 4FXDA 2X1BA 4F25A 3OFGA 4YOEA 3KLVA 4ECQA 3PHEA 3CIMA 3DLGB 1JJHA 4NYPA 4OZLA 1ZZNA 2PDAA 2GGPB 5AE3A 3CD0A 5C25B 2P5VA 2OMLA 4M63A 1N6QA 4IG0B 4X65F 2J0SD 1A7GE 1F0XA 3KLFB 3M6XA 3P96A 5KT3A 1S10A 3UDCA 3V5RA 4ECSA 2LU2A 5JVHQ 2F3JA 1GXTA 2CRLA 4DL2A 4USHA 4F4XA 4FS2A 4JYAF 3SFUA 5KFTA 2XCPA 3KHGA 4RBUA 4DS4A 3DLGA 1VLYA 3BQ2A 2Y1IA 2JL9A 1S97A 2GGPA 1R8AA 1RTJB 3BN4A 5C25A 1S72S 4O3QA 3CCMS 4OX8A 4PWDA 3G4SS 2OAUA 3KLFA 5DQIA 3BSAA 2G9OA 1UVLA 4FP9A 5L38A 2R7WA 3JTNA 3NS5A 3IXQA 4JBCA 3BEGB 2DNYA 1T3OA 3AA9A 1Q4RA 2FJBB 3FEXB 4N56A 3VAIA 4R8UB 2FJDB 1RTJA 3J7A1 5AE1A 2W9CB 3MCSA 3B82A 2R8IA 3FZ2A 4NRTA 3I32A 2LYVA 2RU9A 1U7LA 4I69A 4N47A 2L3MA 4A8FA 2BJEA 3DOMA 2ZOFA 4U9RA 3VAGA 1FHTA 4DF8A 3MM8B 1ZYQA 4DLGA 5F9LA 2C2EA 3EX7B 3FGVA 4PQAA 4C9DA 5KG4A 2DH7A 4N5SA 1N33F 4R0EA 1JLEB 5J1NA 1K8AT 1RDRA 1VRUB 5IWAF 4DUZF 1TKTB 4QU7A 2GMJA 3AHPA 1S6PB 3HPOA 3ZZPA 2V2KA 3MPWA 1NJZA 1ULRA 2MY8A 4HTIA 2CPZA 1NAQA 2UUBF 2K3IA 2R8HA 2IMWP 4NLPA 3RB0A 5CD4H 1IQTA 3SZ2A 1JLEA 1S48A 1FRIA 1VRUA 2AGPA 4ETXA 1FKAF 1OQ3A 2KM8B 1TKTA 2RE1A 2ZE2B 1FDAA 4R0JA 3NWGA 4X2BA 1S6PA 3W3SA 3BSCA 1YHQS 1S7HA 1DHMA 1MSWD 4HHJA 5CQGA 1NK6A 4NWBA 5I3UB 2HVHA 3D0GE 3DRRB 2VFUA 1MMDA 4BDPA 1WG1A 1X5PA 3M6VA 2E7XA 2BYCA 4QBUA 1AUDA 4F3MA 3BF4A 3GG0A 4X62F 2DCUB 4RNMA 1JLQB 1UL3A 4EU0A 1VQ7S 4DN0A 1FT8A 4Q44A 4FYDA 2CVEA 3HKZD 3HM9A 3M05A 3OQ2A 3WX4A 3V6DB 4TYAA 1NH8A 5CCMA 3FQKA 1HI0P 1UVKA 5K8NA 2LLZA 3I55S 5I3UA 1R0AA 2NPIA 4K4ZA 1N54B 2VBYA 3DRRA 5EX3A 5IS2A 4Z2XA 2J9DE 2MGZB 3PZPA 5HMWA 1VI7A 3K57A 1TK5A 2B43A 1X7VA 4RUCA 2O1PA 1WF2A 2OD6A 3WC2A 1JLQA 4ILLA 4I4BA 1FXDA 3DHXA 4WFZA 3GYNA 3IR6B 4IYQA 5B08A 2KFZA 1HARA 3H2LA 4ZPWR 4J9SA 2DNHA 3U27A 3ZZYA 4RNNA 1FJEB 1VS3A 4LIRA 2FGOA 3GIMA 2MGZA 4AL5A 2W4DA 2XMTA 1T94A 3MTKA 5KFFA 1KLMB 2R7UA 2ZH8A 2VOOA 1FXLA 2UV8A 2R2SA 2FJEB 3HVTB 3G8SA 2R2RA 2QA4G 4F4YA 4H4KC 1JXLA 2K7JA 5KFGA 3EGNA 1Y3KA 5B0BA 3CJ3A 2UUTA 1KEKA 1BQXA 4AE5A 4UQTA 2XWYA 3PEJA 3SCLE 3H5XA 3KNGA 1KD1T 1M1KT 2NSCA 2E1RA 4NLDA 1WEXA 4MH8A 4Q8EA 3V81B 1KLMA 1X4GA 2DGOA 3NP5A 2FHMA 4KHRA 3EXCX 5LSRA 1R89A 2Q79A 2A18A 3HVTA 4AL6A 5KFUA 3POTB 5KFPA 2RQ4A 2W7AA 2RNEA 3H25A 5L9XA 4DL4A 2OIHA 5KFYA 4ILMA 1VQKS 3ISND 1JMTA 1HBUB 3V81A 5B09A 3MGJA 1T3NA 1I6JA 4WU3A 3QIPB 4IG3B 5KFBA 4A8MP 3GSDA 2MZSA 3R5CA 4FPRA 4EUVA 3GV8B 3QZ7A 1S1VB 3F41A 2HNDB 1RKJA 1HBUA 2O01C 2JOQA 1IBLF 1X4DA 4KO0A 2BUNA 3CCJS 3QIPA 4CO1A 4DV4F 3Q8SB 1JNRB 1KS2A 3IWXA 4I68A 4OZNA 2W7OA 3GV5B 2LA4A 4XDCA 1QVGR 4KTQA 3DLJA 3DM2B 1S1VA 4KKOB 2HNDA 2IAJB 2M4MA 2RRBA 4NZ7A 1B7FA 5K8MA 2LQ5A 2LDIA 1Z4UA 3IWNC 4BCAA 2CQ0A 6FD1A 1HBNB 4TLQA 2R9LA 4Q5VA 1JNZB 4EBDA 5A8RB 4W92B 2WONB 4WE1B 5KFWA 3V2UC 4M5DB 1QAIA 3DM2A 4KKOA 2IAJA 2IVFB 3OW2R 1JJ4A 2R8JA 2CJKA 3T1HF 1LWCA 3SSSA 3VAFA 1TKDA 3PDNA 1FO1A 3HP6A 4FBUA 5DRKA 1CC8A 2CQDA 3BR8A 4KV8B 3SFGA 1SJ3P 3ENWA 4GO5X 1JXEA 1UFWA 4QQBA 3MURP 1HBNA 2VD3A 2YNGB 5CA5A 5A8RA 5EWGA 5IQQA 2WONA 3M30A 4WE1A 5F0WA 3UDLA 5HBMB 1XR5A 4I6AA 2ZHBA 2V5HG 4ZPBA 5KT4A 3QGPA 4YB7A 2PEHA 3E01B 4L72B 2F8MA 2JWNA 5J2MB 4KV8A 1ZAWA 3VQTA 3K5PA 4NLGA 2ASJA 2YNGA 2J7UA 3IAM9 3L95X 2F8EX 3EYZA 5KOXA 3CDAA 2LEAA 2RF2B 5HBMA 3CCQS 1Q82T 4HYKA 1UAWA 4I67A 2EW9A 3CD6S 4RW6B 2HZCA 3IR7B 4H4MB 4BS2A 4GC7A 5DDOC 1SH3A 4D3GA 3EPIA 5B7WA 2RF2A 2QT7A 1D1UA 1VQ4S 2HGNA 3NKYA 2KH9A 3QYYA 5B0CA 2IM0A 1TVRA 4LQ3A 3MUTP 2XLIA 4NA1A 1R8HA 3IG1A 3IWLA 4RU2A 4DPOA 2F7VA 4CO0A 1IQZA 2CPFA 3WZ0A 1SJFA 4EO8A 2CQHA 4DQRA 4WIIA 1CG2A 3DRPA 3VF0B 2VPYB 3N5BA 3IN5A 4QIGA 3DFEA 2WW8A 4KT0C 4Y0FA 4PXEA 1S6UA 5E3QA 1RK8A 3PFOA 1N32F 1RT6B 3QIDA 3M2VB 1ZAXA 3RB6A 3H5UA 5CZVA 4IRDA 1HWLA 1U49A 1K1QA 3H5YA 4NCBA 3SYZA 4K4SA 3QWPA 3GB0A