2LEAA

Solution structure of human srsf2 (sc35) rrm
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Serine/arginine-rich splicing factor 2
publication title A syn-anti conformational difference allows SRSF2 to recognize guanines and cytosines equally well.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2leaA01
2EK6A 2DGXA 1WHVA 3P3DA 1DZ5A 2CQDA 4C4WA 4WKRA 2MKCA 4RU2A 2LA4A 2DNKA 4YB1P 2N3OA 1U1MA 1N52B 2MGZB 1YJ9S 2MZTA 2M8DB 4YUDA 1WF2A 2MKJA 5MLCV 3FEYB 3P5TL 4CQ1A 2DGSA 3VAKA 2ADBA 2KG1A 2E5GA 5DM7Q 2M4MA 4F26A 5LSOA 1VQ5S 3R1HA 2E5JA 4TU8A 1VQKS 2MQMA 3LQVA 1X5SA 1VQPS 2MXYA 3NS6A 4F25A 3SXLA 1SXLA 3EGZA 3TP2A 2U2FA 2MGZA 3R1LA 2XS2A 3NNAA 1WHWA 3BEGB 4J5OA 1KQSR 4CH1A 2DGWA 2DNGA 3ZZZA 1SJRA 3CCES 3HHNB 3CCMS 2CPFA 1M90T 3US5A 5LXYA 3MXHP 1JJ4A 1YJWS 3MOJB 3MURP 5JVGQ 1Q86T 2FPHX 5IFMA 4M5DB 1WF1A 2J76E 1S72S 2XB2D 1O0PA 2FC9A 3MUTP 3FEXB 2YKAA 1YTYA 2YTCA 2KT5A 2DGUA 4W92B 1P27B 1H2VZ 1SJQA 2YWKA 2N82B 1HL6A 4PKDB 3NNHA 1X4EA 4WF9Q 3BO4A 2KXHA 2RUGA 2DHAA 2MMYA 1PO6A 2MQQA 2EVZA 2RT3A 2D9OA 3MUVP 2RRAA 2AD9A 1D9AA 3UWTA 2CPEA 5CXTA 1ZZFA 3S01A 2Q79A 1CVJA 1UW4A 5CYJA 5ITHA 2X1GA 3CUNA 1U1OA 4WIIA 3EX7B 1WG4A 1U6FA 2DIUA 1WI8A 3VAJA 3VAHA 4FXWA 2ZJRQ 5DDPC 4Z2XA 2JRSA 2PE8A 2AYGA 3U1MA 2LEBA 2RRBA 2DNPA 5LJ3Y 2CQGA 3Q2TC 2ADCA 1U1RA 2MHNA 1UAWA 1UFWA 1A7GE 4TLQA 4WCEQ 2DGQA 5CA5A 2CPHA 5EN1A 3CTRA 3VALA 2KRRA 2CPYA 3JB9k 4EGLA 2YH0A 1Q81T 1Q82T 2G4BA 2M0GB 3BS9A 2AYEA 4PR6A 2VODA 2HGNA 1DHMA 2KH9A 2ERRA 3CCVS 3HI9A 3G71S 3Q2SC 4FXVA 3DLLQ 3CC4S 2DNMA 3EGNA 5IM0B 5GVQA 1N54B 1U1KA 1KOOA 3MI7X 4Y00A 3L3CA 2XS5A 3NNCA 1WTBA 1VQOS 2V94A 2YH1A 1FHTA 2LXIA 2DHGA 3G4SS 2MYFA 2HGLA 3J7YU 2DISA 1RK8A 2AYMA 1BY9A 2MSSA 3UD3P 4OZ1A 5IM0A 2A3JA 2MKKA 1IQTA 2KXNB 3OW2R 2MQLA 1U1PA 1PGZA 2SXLA 2X1BA 3CPWR 2FHOB 3UCUP 3CMAS 2HZCA 1VQ9S 5GAGU 3UD4P 4UY8T 1SJFA 1H2TZ 2ZJPQ 1X0FA 3RW6A 4CIOA 2PEHA 1X4FA 2LECA 3V4MA 5LXRA 2I2YA 2DH7A 3G8SA 1K8AT 3DXBA 5GAHU 4C7QA 1RKJA 2DNQA 2F3JA 2CQIA 2JWNA 2JVOA 2LYVA 1WHYA 1YITS 1R8PA 1X4BA 1K9MT 1A9NB 1YIJS 3N9UC 4LJMA 3S8SA 3K0JA 1F9FA 1KC8T 1URNA 2DITA 1WG5A 2KG0A 1HA1A 1U1LA 2DNZA 3CXCR 2G0CA 1H6KX 3G6ES 2DNHA 2X1AA 2RU3A 3CCUS 2BZ2A 4LIRA 2DH9A 2VONA 1G2EA 3I55S 3G96A 4IUFA 2CQ1A 2LQ5A 2CQ2A 2CPXA 2CQHA 2EK1A 3P6YC 5GMKa 2U1AA 1AUDA 1YHQS 2VOOA 4QU7A 3LPYA 1ZZNA 1P1TA 1X5OA 2VOPA 2XNRA 2OIHA 2CPZA 1FXLA 1FJEB 2DH8A 2JX2A 5GADU 5HO4A 2CJKA 1SJ4P 4YOEA 4UQTA 2F9DA 2BOPA 3BO2A 1DBDA 5BJRA 2I38A 3MDFA 2CPDA 2G1DA 3B4MA 1VC5A 3S7RA 2NZ4A 3CF5Q 3I56S 3S6EA 1OO0B 2E5HA 2KRBA 2KN4A 2MZ1A 2M8HA 1NU4A 1R8HA 2M7SA 3MD3A 5FJ4A 3CCLS 2X1FA 2DGVA 5IQQA 4ERDA 4CH0S 3VAFA 1WI6A 1X4CA 2MY7A 2MKSA 3UCZP 5HL7Q 1K73T 4C0OC 2QFJA 2DNRA 4WFNQ 1WELA 1VQ6S 1WG1A 1FT8A 2M2BA 2KYXA 2O3DA 1X4HA 2DNNA 3NS5A 1KD1T 4LMZA 2MZQA 2OSQA 2LMIA 2KI2A 3MUMP 1FO1A 1S79A 2KM8B 2RS2A 2M88A 5DM6Q 2CPIA 1WWHA 2XS7A 2M9KA 2FY1A 4U67Q 2K3KA 3ULHA 1X4DA 4IOCQ 2E5IA 1W2BR 2DO4A 1FJ7A 2LEAA 3CCRS 3G8TA 2RQ4A 2OTLS 4IOAQ 2N7CA 2UP1A 1N88A 1M5KC 2B0GA 1DRZA 1OWXA 3R27A 4TU7A 2CQ3A 3CC7S 1WHXA 2DGTA 4P6QA 3CCSS 3J7ZT 1VBYA 2J0SD 2NLWA 2XNQA 3ZZYA 4WFBQ 2M52A 3SDEB 2CQCA 2KU7A 5DDQC 1VQ7S 1JJHA 3MD1A 1JJ2R 2MZRA 2KVIA 3CC2S 1QVFR 2ZJQQ 1U1NA 3VAIA 2KHCA 2LCWA 3CMES 2CPJA 1OIAA 2KFYA 2D9PA 1VC0A 3VF0B 3BO3A 2CQ0A 2L08A 2MPUA 1X4GA 1FJCA 3NMRA 1X5TA 2DO0A 4QPTA 3TO8A 1B7FA 2QEXS 1VBZA 1VQ8S 1VQNS 3IRWP 3TYTA 3SDEA 1VQLS 5LJ5Y 1U2FA 4A8XA 2RQCA 4W90B 1YI2S 4WFAQ 1WEYA 3G9CA 4QU6A 2MZJA 2MY8A 3U1LA 2MQPA 2LA6A 2J8AA 1Q7YT 4ED5A 2MJUA 2HVZA 1UP1A 2DNLA 1VC6A 3VAGA 2LXUA 4F02A 1QVGR 4OZ0A 1VBXA 3H2VE 2DB1A 4Y0FA 3CCQS 1WEZA 1M1KT 1NO8A 2K8GA 2MJNA 5GAEU 2L9WA 5D77A 2DHSA 4TU9A 2MB0B 2FC8A 2HYIB 2MKIA 4PRFA 2DNYA 1SJ3P 3UE2A 1HD0A 1YJNS 3UCGA 2KM8C 2DHXA 2OJ3A 2QA4S 3P49B 1X5PA 1ZH5A 2CQPA 2GHPA 3B4DA 2KXFA 4BS2A 3CD6S 2MQNA 2MKHA 2RVJA 5DDRC 2N3LA 1FNXH 2GO9A 1WF0A 2HGMA 3CCJS 2DGOA 1X4AA 3CULA 3IWNC 1M5PC 4QQBA 1VQ4S 2MQOA 3PIOQ 1U6BA 2JVRA 5LSLA 1N8RT 2DIVA 3PIPQ 1M5VC 3D2WA 2E44A 2L41A 4V19X 2D3OR 2M70A 2CQBA 5H1SV 5DDOC 2CQ4A 1L3KA 2OTJS 5D78A 2OSRA 3RW7A 3THTA 2DK2A 2XSFA 1YWXA 2RNEA 1JMTA 1H2UX 1WEXA 1VQMS 1HD1A 5JVHQ 3H2UB 2MZSA 3VAMA 2AYBA 2J0QD 1NJIT 2DNOA 5DETA 1XN9A 3SMZA 1M5OC 1OPIA 1U1QA 4ZKAA 3THPA 1QM9A 2LKZA 2MSTA 4IO9Q 2F9JA 2RS8A 1KOHA 2WBRA 1D8ZA
chains in the Genus database with same CATH superfamily
1NUEA 1SQGA 3PW0A 2OLWA 2DNKA 3IC1A 2OD4A 4TYBA 2AT1B 1YBAA 3D0IE 3G82B 4NASA 3EMTA 2DXEA 2YKOA 2JEIA 1CJTB 2W01A 3BGOP 1WD6A 4F25A 1LXJA 1SXLA 4Q43A 2FZCB 4WFYA 4J5OA 1TL3A 4CTAB 1KQSR 1NK4A 3FBBA 2CPFA 1RXOB 3DOKA 2R8JA 1KP6A 3FMBA 3DN9A 4L76A 1WF1A 3ITHB 5GAHI 1O0PA 2QO3A 1C1CB 3NAIA 1RAGB 1OS5A 2BX6A 1JX4A 3DOMB 4B3OB 2CWKA 2B56A 3AOAA 1RU2A 4R8UA 3GJSB 1XQIA 5KFWA 1RU1A 3J7A1 4LFCF 5DZ6A 1S1XB 4YHHF 5GAEI 2CPEA 2RKIB 1MN9A 2VKRA 3GCXP 2GIRA 4CO4A 1MMLA 2UVRA 4OYIA 2IBKA 2F4FA 3NG8A 2OELA 1WI8A 5GADI 5IQ6A 4RJVA 4EMDA 1SJ1A 4ETZA 3BSOA 3M6WA 1DFDA 4GO5X 1IKWA 1CQNA 3JTNA 4O44A 3V2UC 3NOGA 2VA2A 4X65J 2G4BA 2DY9A 3GONA 1PAEX 4PR6A 3FCVA 2HGNA 4Y2KA 2KH9A 7FD1A 3CEDA 3AOCA 5HP1B 3PRDA 2C2ZB 4RW4A 4NMLA 3G4SS 2ZH7A 4U7CA 2AZ1A 1RTIB 3RGIA 2AYMA 4N5SA 2A3JA 2ZBPA 2IM2A 3JQJA 3BZQA 2KZMA 3S1TA 1HBUA 4AL7A 2B9WA 2W25A 1U02A 5BYQA 1FKOB 3HMJG 2HBQB 2J6SA 1WHYA 3PVXA 3UNYA 3V81B 3MF5A 5A8RB 2VUGA 2WB4A 4IFYA 2VPWB 4ZCMA 2G0CA 1UFKA 1IKXA 3I4PA 4LIRA 3I55S 4ED1A 3C6UB 1R0AB 1MWZA 2HHHJ 4NXMJ 1P1TA 2CPZA 5A6WA 4BLGA 3T3FA 4EUVA 3Q0AA 1YDLA 4F04B 3B4MA 3IAM9 3SCKE 2ACYA 4L72B 4NCAA 4ECXA 4KHRA 1J5EJ 1KQGB 2HBZB 3T9ZA 3KDOA 5H9FJ 2B7CB 3ENVA 6AT1B 2Y1JA 3MM9A 4B3SF 4A46A 3GLJA 2KM8B 2GIQA 1T9TA 2R3VA 2XHWA 3ULHA 3MFHA 1F0XA 2OTLS 2IPOB 2ZH3A 1ZAWA 2C2EA 3O2IA 4GMKA 3UD5A 2DRAA 3EXYA 4P6QA 3M1VB 3LP1B 3CCSS 2FJAB 2ZITA 2XO7A 1IM4A 1EETB 3MD1A 2DTJA 3OBIA 4OX6A 3CCWA 4M1KA 3MM6A 2CUYA 3FBEA 5LSRA 3MEEB 2J9CA 3LP2A 2J6TA 2YWEA 1WC5A 3MMJA 2GJ2A 1WOPA 3OUYA 3QQCD 4ECWA 3HFKA 3G9CA 3FRZA 3MOZA 4AQYJ 1XMBA 2BM1A 2R8HA 2W7PA 3C19A 2W8LA 4PEOA 5C25B 2DB1A 5L8RC 1WEZA 3WX4A 5IV3A 3EUNA 3MTJA 3ET6B 3NXZA 1F2HA 1RJJA 1CULA 2C42A 3MZIA 4WXWA 5A76A 4PABA 1YJNS 2NREA 2DHXA 3CJ5A 4DF8A 3OFFA 3CCJS 3TX0A 1RUSA 4R5PA 4CLYA 1RT5A 1L3UA 5KFPA 1WOSA 3DDNA 2XYGB 1V9OA 1NLKL 1RT6B 2AGQA 4K50A 3THTA 4MT1A 4F7VA 2DK2A 1S0NA 1HYSB 3BH7B 2QZ8A 3QO9A 4JI6F 3VAMA 4LT6A 2J0QD 1BMQB 1GMVA 3VQTA 1SIZA 5DGAA 2WVDA 5EX0A 2OPRB 3KJVB 3UI3A 2WONA 3H5XA 2MHEA 4J9KA 3WX8A 4AD6A 1XMQF 2FIUA 4A4JA 5EWEA 1Y11A 2H4YB 1W7WA 1VQ5S 3L09A 4JYAF 2E7XA 3GV5B 3LH2S 4X62J 5L9NA 4IDKA 1P9QC 4ZLLA 3V6KA 4K4VA 4JI0J 3HULA 3AD9C 1CJTA 3NWRA 4ECYA 4ZPAA 3IA0A 3CVKA 4OHXA 4U8YA 4OHVA 2ZDOA 1JB0C 1RTJB 3ILIA 4P2FA 1KTVA 2Q66A 2DY1A 4TY8B 1EZZB 2YKAA 4CTAA 1YTYA 2YTCA 4J9SA 1KVJA 2Y0BB 3BO4A 2ZC4A 1TVRB 3ITHA 1FVSA 1C1CA 3M05A 1AYEA 3PEJA 1LFWA 2AD9A 2H5JB 1K47A 4DSKA 3DOMA 1UVJA 4B3OA 5ITHA 4KHPF 3FCWA 4YR3A 1QAIA 2Q6CA 2NYIA 4F4XA 4AT1B 1S1XA 2LEBA 3ZTRA 4WCEQ 3ILLA 4YY3J 1Q81T 2APOA 1D09B 4XPCA 3QT5A 4CLTA 4NLYA 2K7JA 3R97A 1Y10A 5BR8F 4LF8F 3R5BA 4ZA1A 1ZTTA 3CCTA 1U1KA 3KJFB 2AP6A 3DLGB 1GMWA 1VJQA 4MMOA 3TQEA 2CVEA 2HHPA 5E5NA 4ECTA 1SIWB 5HP1A 4OX9J 3R3TA 2HSEB 2OP5A 1QUVA 4O3OA 3CMAS 3NCRA 1SJFA 2HLTA 1RTIA 3M30B 4C7QA 3C16B 3V6DB 1WDTA 2EFNA 2CAJA 1Q5YA 4XO0A 2VJVA 1FKOA 4N8NA 3V6HA 3QGGA 3HSDA 2LQ9A 2G2YA 1VI7A 3V81A 3RR7A 5A8RA 1XEZA 1EX8A 5L9XA 2I9SA 4Y6IA 1F5AA 4LRBA 1JXVA 1IJEB 2BM0A 3GYGA 5THWA 2FHMA 2W2NP 3DLEB 3I5CA 3AJDA 2IVYA 2O1PA 3C6UA 4H4KC 2J6UA 3S7RA 4Y65A 1R0AA 2OFHX 4FP9A 1S4FA 5HSPA 2WVCA 4JI1J 3TVKA 1B3TA 3MTKA 1RLDA 2A18A 3VAFA 4UF4A 2KZZA 2QFJA 2W8KA 1NXIA 3DMJB 2OMOA 2W4CA 1RHMB 3DOLB 4AXIA 1S1UB 3PCOB 2LMIA 2F8EX 4IOCQ 3GV8B 1OSCA 2YWGA 2V8DA 3G8TA 4IOAQ 4DQSA 4P52A 3IGVA 1DRZA 3KG4A 1VOMA 5J1PA 1J5OB 4NMXA 3FKBA 1BQMB 3SDEB 5DDQC 1U24A 3V5RA 2KVIA 4H4KA 2BJ3A 2YKNB 3M1VA 1PBUA 1B7FA 4DPYA 1VQ8S 1DARA 1EETA 1W2IA 3MEEA 2ZH9A 3PRVA 3QGPA 1NPKA 2R7QA 3NY0A 1S4EA 4OZ0A 3H2VE 4ZK7M 1VHFA 2K8GA 2L9WA 3HSJA 3CDEA 3UR0A 3OXFA 2FC8A 4DV4J 4PRFA 4DR6J 3ISNC 1WNEA 2MKYA 5C25A 1X5PA 1HARA 1GX5A 1Z2ZA 4UOFA 3ET6A 4ENOA 4DI6A 2G0JA 3CE8A 4JI3J 4B9NA 4WTOB 2J9DA 2OEKA 4MYUA 5KFBA 3HD2A 1ZM9A 1L3KA 1L3TA 2HHTA 2DVIA 3GFXA 5HQLA 2EFVA 2V8PA 3GG1A 1YWXA 3GCWP 4M5LA 4B3RF 2HHUA 5JVHQ 4ZPDA 2KFZA 4OJ1A 1XN9A 1RT6A 4DX8H 1HYSA 4ZVPB 3Q89A 1VGYA 2UUBF 4WKRA 4QIVA 2KKHA 2N3OA 1N52B 3CIZA 4N76A 2CDQA 2M8DB 4IH5A 3JSMB 2OPRA 3KJVA 1XR5A 1ZBTA 2ADBA 2K1RB 2ZNZA 4KKOB 5HANA 1RTZA 3I9ZA 1NH7A 1I51B 4M5HA 1VQYA 1YLXA 4NZ6A 2LEPA 2EPIA 1R6YA 4N77A 1NK9A 3CCMS 1LWFB 5H9FK 1F3VA 1ICEB 4ZIVA 7AT1B 1TU0B 4ZCLA 4E2FB 3GPAA 1HNIA 1TZ0A 3N01A 3U7JA 1NKEA 2FVPA 1RTJA 1K1SA 2KJVA 3BGFA 4YR0A 4TY8A 4E0DA 1XNRJ 1HWKA 3M9MB 3DI6B 1H3DA 1D9AA 3Q23A 4B9TA 3UWTA 3GYXB 1BHNA 2Z58B 1N5SA 1SL0A 1TVRA 5ETRA 4Q5VA 1Q5VA 4R0EA 4OI1A 3PO4A 3MR6A 1F60B 1D0EA 4J9UE 2AGPA 4TLQA 1HI8A 2GA7A 5HMXA 4ZP7A 1HFEL 2NZCA 2VBZA 4C8KA 3QJPA 2DXFA 3BBCA 4ZPCA 2O66A 4K4UA 2R7TA 3H7HB 3ENWA 2F4VJ 4BC9A 4M94A 4OFZA 3EGNA 3OXLA 3PRBA 1KOOA 1DTTB 4ES2A 1BE4A 1HNVB 2Q1LA 1FRXA 4MIAA 1KVKA 5D0GA 3D3BJ 4K2XA 4RNNA 3VR1A 3J7YU 5AE1A 2CNNB 3OL8A 3K57A 2MKKA 3PHTA 5CHCB 1E6VA 1Q53A 2BRKA 2MQLA 3DLGA 1FK9B 4JV1A 3RG6A 5M2UA 2VH7A 1U8WA 2NXJA 1HR0F 3TJAA 3V4MA 4NLSA 2C28A 4NYOA 5EGYA 3K5PA 4P75A 2GMLA 4ED4A 1RAOA 2DITA 1WG5A 1DQAA 2FD2A 4RL1A 3M30A 4CM0A 4USWA 3C16A 3DDIA 1RHJB 3PFOA 2RU3A 5L1LA 4ZPTR 3V6DA 5F8GA 2CQ2A 2EK1A 1C4AA 4N41A 1T3NA 3MECB 4QU7A 3FC9A 1Q1KA 1ZAXA 4OL8A 1B0PA 4WP9A 4ES3A 1SJ4P 1URRA 3OVAA 5BJRA 5IOLA 4JUZA 4A8MP 1SB6A 4HH1A 3CF5Q 2MDAA 4DUZJ 4J7CA 3DLEA 3M8RA 3RB6A 2M3DA 4WFXA 5I3UB 4ILRA 3CJ8A 1JLBB 2HIYA 5E33A 2O3DA 5FDLB 2DNNA 3OL9A 2WCXA 3NAHA 3PTWA 2ZEJA 1Y00A 1SH2A 2XZDB 4MFBB 3I96A 3DMJA 2AWZA 4F3QA 3DOLA 1RA6A 1S1UA 4I6WA 4DR4J 2W9BB 3ZZYA 1IR1A 1UPMB 1REGX 3VGSA 1VHIA 2KHCA 3EWGA 1U0HB 2YQ0A 4F36A 3IWXA 3O6QA 1FKPB 3N28A 1J5OA 3NMRA 1OY6A 1H72C 1BQMA 3DXSX 3SDEA 5G0RB 5K8OA 1N36F 3HP6A 2JDJA 3N6NA 1WEYA 3JS9A 4DUYF 3G6XA 2YKNA 3TA2A 4P73A 2HW3A 2F40A 3DCAA 5HMZA 4ES1A 2HK3A 4RW6A 3FBCA 4BWMA 2CKWA 2LXUA 4WYLA 2B7BB 4RW7B 4Y0FA 3R7NB 2MJNA 3UN3A 2AIRB 3K5OA 3J80U 4ZP6A 3EVMA 3A12A 4ED7A 4ANDA 1IJFB 1GEHA 2PEBA 1RLCL 2FTRA 2E5LJ 1GH8A 1G3OA 3NGDA 2V9WA 3SQOP 4GKKF 3D28A 3U02A 3R5GA 4JI4F 1HW8A 2VV5A 3PIPQ 3GIJA 1M5VC 2L41A 2AJ2A 3MPVA 2D7SA 3KMQA 1NBEB 4KAIA 4QYZJ 1X8DA 4DQPA 1HD1A 2AYBA 1YBTA 3LWMA 2VQEJ 4JV5F 4CZCA 1KLNA 1OPIA 4ECVA 4X64J 1HQ2A 4ECRA 4ZVEA 9RUBA 2XGQA 1S9GB 4PG6A 2VHGA 2IRYA 4YB1P 2RDIA 3I87A 2MGZB 3ZC4A 4KGKA 5EHHA 2WTFA 4DG1B 3NS6A 2QX0A 4L73A 4NL5A 3SXLA 5DLGA 2F8HA 3C15B 2EW9A 1JNRB 3JSMA 5KG4A 4IG3B 3TRGA 2K1RA 1CS4B 2JFDA 4KKOA 4ZVSB 4Q44A 2ZOMA 2G2OA 2XY7A 1S72S 2QT7A 1NB2A 2CXEA 5HQ8A 5C2GA 1LWFA 2VICA 5DGBA 3CJSA 4OV1A 4Y2IA 1PBAA 2DR7A 2NS1B 3JSBA 4LR8A 1CEZA 4IRDA 1UW4A 5CYQB 3A1YG 1LQ9A 4ECSA 1Y5NB 2LQ8A 1AFIA 1LOUA 3DI6A 3Q2TC 1GX6A 1IM6A 5KT2A 5F8LA 3CTRA 4CLUA 2CPYA 2WZ1A 3B54A 4ZN1A 3CJ2A 1DHMA 1OQ3A 3A8KA 3F73A 1X9MA 4NLVA 4DL4A 2DHGA 4HH0A 2XI2A 2W1BA 5I3PA 1SUQB 2R7RA 4DUTA 3D7SB 4CNYA 3H5SA 4QYRA 4CLKA 1DTTA 1HNVA 2H65B 2XTJP 1M0SA 1ZS6A 4UZBA 3L95X 2HKEA 4Q8EA 4LRCA 3TZXA 3WQPA 2MQ8A 2DNQA 2CQIA 5F8MA 1FK9A 4DN9A 4RO0A 2DKOB 4DV7F 3OV7A 2BKNA 4JI2J 2QLBB 3G6ES 2IAJB 2DH9A 1G2EA 3O3LA 2E1RA 3TUZC 1WACA 4M63A 3ZFVA 2COLA 4CH7A 2QL9B 2ZZTA 3N0VA 4X66J 1QUPA 2CJKA 1R0CB 1TUVA 3JYTA 3BO2A 5IT9U 1YK9A 3KLHB 1RWOB 1C0TB 3MECA 3CDBA 3MR3A 5KFZA 2F65A 4HDHA 2F8MA 2RMLA 3AD8C 5DG9A 2KL8A 5HL7Q 1CSJA 4C0OC 1X4HA 1KD1T 2MZQA 1Y5LB 2RS2A 3PX4A 5KG3A 1RTHB 1FERA 2M9KA 3QIPB 1PJ7A 3W63A 3CCRS 5I3UA 1JLBA 3CGIA 5FDLA 1IBKF 3R27A 2QJ3A 2B5JB 4K59A 1IBMJ 2J0SD 1MMDA 2M52A 5BYRA 1JJHA 4CT9A 4B3MF 3K5LA 2W9BA 4DN0A 1X5TA 1FJGJ 1SH0A 4NLPA 2RIJA 5KFJA 5KFFA 5E2QA 4KFBB 3IXQA 1C4CA 2UXDF 1E6YB 4QU6A 1U0HA 3VVTA 5B0DA 1UPPA 4NEZA 1FKPA 2AEJA 4C2MA 1IXKA 5DQIA 1VRQC 2JLGA 1UMJA 1SC1B 1I94F 5G0RA 2UU9F 1BGXT 3HO1A 1M1KT 2QA1A 5ETLA 2XY5A 3QZ7A 4QR1A 2ASYA 4NA1A 1U45A 4RW7A 2ASLA 3B4DA 3M8PB 2MKHA 2CJQA 1IN0A 3GU0A 2UXCF 1X4AA 2CG8A 1VQ4S 3D0HE 4USUA 1GQEA 3HZGA 3D6FB 3X3UA 1P8GA 3RBZA 2AEMA 3RU0A 5C2CA 3H2UB 4CP5A 1KONA 1I6JA 3CD5A 3D3CJ 4KC5A 2XBPA 4XAKA 3KKFA 2UVVA 1EB0A 3U27A 4USIA 3TX8A 2AKWB 2KO1A 2BRLA 2Y1RI 2AQ4A 3D5MA 2MZTA 1JJCB 2XZWA 3DLBA 4NX9A 2M4MA 4F26A 2XMUA 1S9GA 1GK8A 3BBFA 1K0TA 5A2QY 2F5GA 2U2FA 2MGZA 2AJ4A 4TN2A 3BQ2A 3QNWB 1FRHA 1XMOF 3CCES 4PUOB 1TTHB 2ZM6F 5J2PB 2FGOA 4DG1A 2V2VA 4NXNJ 1AXQA 1NHUA 3C15A 4M5DB 1VRTB 3DGPA 4F4ZA 4IG3A 2DGUA 1CS4A 2AGOA 3DLHA 1WC1A 3W8GA 4N8OA 4WF9Q 3LWLA 3KK3A 2CNOB 2WB1D 4CO3A 3M6UA 4FPRA 2HRYA 3FBFA 1ZZFA 3D1HA 4LVNP 1NJWA 4B02A 1FRKA 4WIIA 3KG0A 3A3OB 3ZTPA 2GVZB 4J91A 1U6FA 2FVCA 3I5AA 3DM2B 3NL0A 5EWFA 2IBOA 3SIPB 5CYQA 4HR2A 1IBLF 4LRDA 2W24A 3R2DJ 3BBBA 1JK9B 3UFCX 2DHHA 2F63A 3H59A 2YKPA 3CCVS 1JKHB 3ENQA 4DV2F 1S5ZA 5E3CA 3CJ4A 1SQEA 4C8MA 4QWCA 2AMCB 1D9DA 3NNCA 1WTBA 2HHQA 3OTEA 4FZVA 4LF6J 1UVKA 3TWZA 2VQFJ 4J9VA 1XK8A 1KN6A 3AJ2A 3OW2R 2SXLA 2WW4A 3H5UA 4LFBF 2OD6A 2FJVA 1HWIA 2L9DA 4GC6A 1SUQA 4EBDA 2MLXA 3A8IA 3MEKA 1CPZA 2F3JA 2ABYA 4AL6A 2BJ7A 4J9NA 1RWMB 3THVA 2PD1A 1Q16B 4QYZK 1JXEA 1VMBA 5K5MA 2VDIA 4TVAB 1KC8T 4HVZA 4PYDA 3GIMA 2E66A 2P6TA 1XWLA 1SI9A 3VVUA 2WOMB 3WZ0A 4IRCA 1ZM3A 1GMWD 2WVEA 4WE1B 1T9WA 4WBFA 4JOUA 2P9EA 2FLOA 2IAJA 3T1HF 2F9DA 1RA7A 2I38A 1NSQA 2WVBA 1NEEA 2KYZA 3ZNUA 3DYAB 2KRBA 5IZHA 2UVUA 4ERDA 1UEVA 1REVB 2LDIA 3KLHA 3BM7A 1K73T 2HAIA 2C3YA 4NYZA 1XBWA 3FEZA 1C0TA 2PIIA 2GAGC 4ZVFA 3PEHA 3QRRA 3FSXA 2LEAA 5CZVA 2FJEB 4LFCJ 1XTZA 2UP1A 3K59A 2GQQA 4YHHJ 4LFAJ 2GVDB 3QT7A 5K8PA 2CQ3A 2VD3A 2E29A 1RTHA 1KDNA 3K5NA 3QIPA 2OHDA 1R8BA 4OX8A 5E3RA 1OSDA 4CWBA 4FF1A 4NLTA 2BOAA 2W4DA 4J9QA 3EPIA 3KLFA 2B5JA 3DLKB 4X4PA 1DY3A 5LJ5Y 5D4PA 3I82A 4D3HA 3EVWA 1DURA 2CZ4A 2J7WA 3L7PA 1VBXA 4KFBA 1TK0A 1E6YA 3LW5C 1AT1B 1WJ9A 1RAEB 3E8OA 5DG8A 4A47A 3H8YA 3FNNA 1N5VA 2HHWA 3ENAA 1MN7A 3UE2A 4CCHA 2FLNA 4DR5F 1FE4A 3GZ7A 5ETPA 5C24B 2KXFA 2VZ9A 2B8PA 3OFHA 2B51A 4OZLA 3B78A 5DDRC 1FNXH 5L46A 2ZVSA 4P7TA 1KS2A 4RWWA 1HBNB 2B9YA 4LRFA 1MSWD 3M8PA 2D3OR 5DG7A 4RW8B 2HFNA 1LWEB 3RW7A 2GV1A 1F3FA 2RNEA 1WEXA 1Z1ZA 3ZZUA 3GIKA 3ILOA 3T9NA 4HTIA 2OFGX 2PFFB 2PI5A 4LBPA 4U8VA 1KOHA 5DRKA 3MGJA 2CDRB 1DQ8A 4Q2LA 2V4JB 4RU2A 2CWXA 1CBKA 3HSGA 1NDPA 3CB4A 2BA9A 4HLBA 3D6HB 5C42A 1Y4ZB 5T14A 2DCLA 2V9KA 5J2NB 2DGSA 1VQKS 4USMA 1NJXA 2HZVA 1I1GA 3HVWA 2BE9B 2K3IA 3LTOA 4A8YA 1SV5B 4NZ0A 2QL5B 3CJKB 1UETA 3QLHB 4GVLA 2XO6A 3MURP 2Z2LA 4B3SJ 2C3PA 3ONQA 1S6OA 2I5JA 1HPZB 3MCNA 4FNIA 1HBOB 4PUOA 1ZA1B 3NLCA 2VU5A 3GR0A 5J2PA 2NXCA 4DCPB 3NNHA 4M5DA 4DFJA 2PGCA 2PI4A 1VRTA 2QG9B 1MU2B 2MQQA 1RABB 3MUVP 1NM2A 2YNHB 4L75A 3PX6A 3ZZ0A 2RU9A 2V8HA 1KEKA 1T9YA 5IWAF 4N56A 4LF1A 4RPFA 4DV5F 1EKSA 1NKCA 2EFPA 1DJ0A 1NDCA 2GGPB 3OSPA 3K5MA 2GVZA 5CA5A 5KOWA 2W7OA 2YH0A 3BS9A 3VWSA 3DM2A 3CJ3A 3VZIA 4PXCA 3A3NB 2OEMA 1HQUB 1WORA 4LF7F 3HI9A 4FYXB 2IFXA 2VG5B 4K5RA 1FDDA 4FXVA 2BQ3A 2VB6A 2ZBRA 3KUHA 4K4ZA 5DLFA 5J1NA 1OYDA 5HLFB 4O0IA 2QC3A 4OLOA 2V63A 4X2BA 2MYFA 1JKHA 5K14B 4ETXA 2ZBQA 1U47A 1S59A 1ZOTA 2GQCA 3CPWR 2X1BA 2K06A 3UD4P 4UY8T 4F4YA 2ZVIA 3RW6A 4NA2A 2C22A 1F1BB 1J5EF 1TMJA 2GMHA 1N32F 4HHHA 4JI6J 4XDCA 2JWNA 1JNZB 1R8PA 3IMQJ 3IR6B 5M2RA 1SH3A 4RUBA 2BMBA 3IS9B 3MAHA 4ZHRB 5KT5A 4DS4A 4PG5A 1XMQJ 4UT4A 1AUDA 1YGYA 4K2JA 1FDBA 2XNRA 2QYGA 4JYAJ 4NZ7A 1V3ZA 1PYSB 2WOMA 2QMUB 2DBBA 1YQHA 1X9SA 4NLOA 4L3KA 4WE1A 5E3QA 2XGPA 2DGVA 2G9OA 5KFRA 1X4CA 5CABA 3P96A 3BPSP 3DYAA 2PO4A 4LR9A 1NJZA 3HVAA 3H5YA 2IHR1 4U67Q 3H4DA 3D68A 3UW1A 1REVA 2AF6A 1TQLA 2J7KA 3L9ZA 1PILA 2ZHBA 3KNGA 2DR9A 4KY3A 4KHPJ 3BN7A 5KFNA 2XNQA 1FF2A 2CQCA 4DQIA 1ZETA 2G1HA 1JJ2R 4DZ6A 1U1NA 3RB4A 2GVDA 2IC3B 2JJ4D 4JI7F 3TYTA 1KSPA 3BGLA 4EYHB 4A8XA 2HFOA 2IJRA 3GE9A 3MPWA 3DNCA 1G4CA 5LOQA 1VISA 3MCOA 3DLKA 2O01C 5BR8J 4LF8J 2O5DA 1Q4RA 4BC7A 1SKUB 3JQMA 1FI4A 2W4PA 4ZOSA 3JTPA 2MKIA 4ZLJA 2IM1A 3RTVA 2GHPA 1QSYA 3HT0A 3CD6S 5DO2A 3QIDA 1SKWA 2XCAA 3ETMA 3HJFA 1X7VA 1HBMA 3NOCA 3R7BB 4ZP9A 2R7UA 3NGKA 5CCMA 5C24A 3AD7C 2KHDA 2D1CA 2CQBA 2OTJS 3QYYA 1LW2B 2ZUAA 2BQRA 3K8VA 1HBNA 3QFWA 2XI3A 1N48A 3PW7A 1NJIT 1N56A 4RW8A 2ZBIA 3PM9A 4WZQA 1WUUA 1LWEA 1NZAA 2IRXA 3X1LB 1T11A 1DZ5A 4C4WA 3OL6A 1MLAA 1RWUA 4QIWD 1RACB 4BBYA 3D67A 2QLJB 4ED3A 4AYBD 4YUDA 4BCAA 3HKZD 3OTCA 2AHOB 2PFDA 1K44A 3R1HA 4RLEA 3LQVA 2V4JA 3AOBA 2PMHA 2J7UA 3I0RB 1TKZA 1FX2A 2XS2A 4EBEA 1QY7A 3OXGA 3CJRA 5J2NA 5K9FA 2G0IA 3MXHP 2LDYA 3FZBA 3W9JA 3PYDA 4TLRA 3MOJB 5EX3A 1N5TA 1Q86T 1EQ0A 3FQKA 1SV5A 4C3KA 5ADZA 3SFGA 1ZA2B 3CDWA 3CJKA 4URQU 2BE7D 3QLHA 1CC7A 4RW9B 4EO8A 4G65A 4C6AA 2OAUA 3T1YF 3UPFA 3FRYA 4EWTA 4LSZB 2BXJA 3IO1A 1HPZA 4OMFG 1HBOA 1TK8A 2Z2YB 2QRRA 4OJGA 1TL5A 5KFVA 2DIUA 2HNZB 3R8YA 2VC1A 3VAJA 2YNHA 1WDDA 2DNPA 4KJIA 2ADCA 3HD1A 5F0WA 2OO4A 3QMQA 2BVZA 3JB9k 5KFKA 2RE1A 3QWPA 2GGPA 4ID5A 1O5JA 4ZPVR 4USKA 3MI7X 1R8CA 3OVBA 4LR7A 3DRRB 2LXIA 1HQUA 2ZWPA 3ADAC 2XQCA 2VG5A 3O8WA 4OHZA 2KXNB 2VBWA 3VGTA 2GHVC 2HQFA 1U1PA 2EBEA 1VQ9S 5HLFA 1V6HA 3TAMB 2ZNYA 5K14A 3RR8A 3PYFA 2DH7A 4X4QA 1RHRB 4B3RJ 5GAHU 2FJWA 2ASDA 1YIJS 1YJRA 4LJMA 3D66A 1ZYQA 1B99A 2UUBJ 3QGHA 1UJ5A 5FLXU 1H38A 3PW4A 2ZH2A 3KHLA 4D3GA 2H4WB 1HI0P 4KGMA 3IRXB 3IS9A 4ZHRA 5KFYA 3SCJE 5GADU 1DLOB 2NXNA 1L5UA 1DQ9A 2LQBA 2OGUA 2BJ8A 4AE5A 4DPTA 3M6VA 3SV3A 4DS5A 3UDVA 2MY7A 2GO8A 2Y1LB 2EC0A 1VQ6S 1Q78A 3GJTB 2CG4A 2N4CA 1FO1A 2XMVA 4DR1F 2J9DE 3DRPB 2RQ4A 3FVYA 5G4DA 1M5KC 2R4FA 3QT6A 1N6QB 2NLWA 4K4WA 2HHVA 1VQ7S 1ACMB 4QWDA 1T94A 4TYAA 5KFEA 1T0TV 2LCWA 2HZAA 3CMES 3FJ2A 3SZ2A 3ZZPA 2QEXS 1VBZA 3IRWP 4WXOA 1GNKA 1RBAA 4P2XA 3KWMA 1LWCB 1X9WA 1ZM4A 2MZJA 2IC3A 2LA6A 2NUUG 2HVIA 4BWJA 4I4BA 2BANB 2MJUA 3W5ZA 1VC6A 3VAGA 1Q7LB 4Q45A 1YJTA 3BYRA 3KK2B 4L74A 2IY5B 3Q8QB 3HXMA 1EP4B 5HMYA 1HD0A 1RWNB 1ZH5A 2CQPA 2XY6A 2MQNA 2YKQA 3G2XA 1BC6A 1HR0J 3BH6B 1W26A 4P74A 4DL2A 4X4UA 3LA0A 2VPZB 3IBWA 3SBMA 1RAJA 3GMGA 2Q43A 3UN2A 4RBTA 1PKUA 3FFIB 4KBIA 2D3ZA 5DETA 5HQMA 3CD0A 4NI2B 1PG5B 1QM9A 4CO0A 1ZPVA 4QIFA 3Q22A 1LW2A 4IYQA 5H9EJ 3P3DA 3N79A 4HT5A 1HNZF 4I7FB 5KFTA 4JV2A 4DL5A 4RBUA 4U7UK 1VQPS 2HQIA 3C2PA 4FF3A 1RCOB 3L4BC 3FZ2A 1UZHA 1Y5IB 5HI7A 1QTNB 2OKQA 4C8NA 1YJWS 1TUWA 1GXUA 2L48A 3I0RA 2ZE2B 1RWPB 1WSVA 4DPOA 1FKAF 2Q3PA 5ETMA 3NEKA 3TEHB 2B9XA 1H2VZ 4OZJA 4WKYA 4PXBA 1T9XA 2QIFA 2FJXA 2V4QA 4ED6A 1B7YB 2A6MA 2ROEA 1HWUA 1LV5A 2JEJA 3M8WA 4KHMA 4RW9A 2Q79A 2X1GA 3MAAB 3AODA 3PKYA 2BYCA 1FFWB 4NLUA 2VC0A 1VDHA 4XDDA 1UVIA 1SKRA 3VHQA 1N36J 2ZH6A 1NRKA 1RB0A 4DSLA 4DUYJ 2GW8A 2XYPB 3EVOA 4IO1A 4PAAA 2MHNA 1MG7A 3H4BA 2YPYA 3BF4A 4PG7A 5CCLA 1NDKA 2HK2A 2HNZA 3VQSA 3BV8A 4NLGA 4NLXA 2R7SA 3Q8YA 2ERRA 2AJQA 3QRQA 2R8KA 1ROFA 4MKAA 1UA1A 2RB7A 1H73A 1VQOS 1FDNA 5L1IA 3EYZA 3ZTOA 3E3XA 2FVQA 4PXDA 4GKKJ 4DMZA 4OZ1A 3PYEA 1Y9OA 1LWXA 4F2RA 4ZVRB 5GAGU 2KT3A 3DRRA 1P9YA 3JSRA 4LF4F 4PG4A 2BQUA 1S0VA 2D41A 1RKJA 4ZJQA 3VZHA 1RT7B 2PMZD 1TKDA 3UDLA 1HNWF 1OMSA 4JV5J 2YXLA 2DR5A 3TAMA 4KH1B 4EEYA 3HVTB 3CDAA 3W1YC 2NYHA 5KG1A 1HA1A 1U1LA 4H4OB 2H5IB 1H6KX 2X1AA 3PW2A 2GC8A 5KG2A 1R31A 3TW0A 3QJJA 3G87A 4FVMA 4FF2A 1WKKA 1YHQS 4DV1F 4P2SA 3J7Z5 2ALYB 1X5OA 2OEJA 1PJ5A 1KFSA 3RB3A 2XLIA 2A2DA 4QWAA 1X60A 1UW9A 2QFIA 3AQOA 3MDFA 3CW2C 3KJQB 3IRXA 1OO0B 4C8ZA 2KN4A 4N47A 3EZ5A 2IA0A 1R7IA 1S49A 1DLOA 2X1FA 2HS3A 2QSWA 1WI6A 2CFXA 3UCZP 4A48A 3FDSA 3FSYA 3O1LA 3OTOF 3R2CJ 1RAHB 1H7XA 2B9EA 1WWHA 1IWAA 1B0TA 4A8KA 1FJ7A 4EBCA 1PCAA 1OWXA 4YR2A 4DLEA 3M9NB 3HK2A 5I3QA 5KFGA 3OJUA 3DRPA 2E5LF 2NSBA 4ZLPA 2DXDA 3NBPB 2IDEA 4DQRA 3V6JA 4MKVA 2KFYA 2D9PA 4QIGA 1S6PB 4KT0C 1N6QA 4O0NA 4XTTA 4J9OA 2D3UA 2ATCB 4XK8C 1U2FA 3G82A 1YI2S 4OYMA 5GAGI 5CZXA 2FZGB 2P8IA 4X4TA 4ZVHA 2EFGA 2UZAA 1N33F 2VQEF 2ALZA 4B9MA 1LWCA 2CJ9A 4FKXA 2HFVA 2H54B 2BANA 2RSQA 3F0NA 4ED8A 2VFVA 4ELTA 1S10A 3TZWA 2N3LA 4RBVA 4TQSA 4LQ3A 1EP4A 3CULA 5EUHA 2CNKB 1M5PC 1CG2A 3BR8A 1TR0A 2V4RA 3D2WA 1BD6A 1RTDB 3I4HX 4K4TA 2AW0A 4TKTA 4NLRA 2RKIA 5D78A 5HROB 2G13A 2YWFA 3AY0A 3WC0A 1S77D 3Q8RB 1RT2B 2CJXB 4DR2F 2C2RA 4DR7F 1RHUB 2HQCA 5B0GA 2UUCF 4HYKA 4ELUA 2F9JA 2RS8A 4F2SA 1YJVA 4LF2A 1JIHA 2AJ0A 2YQ1A 2DGXA 1HWJA 1ZAVA 3FFIA 4DL6A 3T5KA 2QV6A 1U1MA 4TY9A 4NI2A 2VFRA 1TKXB 3TA1A 4TU8A 3OVSA 2XLJA 2VFSA 2BKOA 4I7FA 4MH8A 3JAMU 4ALZA 1KQKA 2YNGB 3US5A 5LXYA 2NSCA 4UQGA 4RKUC 4K4YA 1B64A 2FLLA 3FEXB 1FTRA 3R6LB 4CI0B 4K0KF 1GAOA 1SJQA 1XR6A 1IBKJ 5U47A 3UDCA 4Z7YA 2ZE2A 2MMYA 3ZZOA 3GTYX 2ZD1B 3WC2A 3M8SA 4UUWA 2CA9A 4DHVA 4E8UA 3S01A 4FXDA 4B3MJ 3E51A 3DRSB 4HKQA 2RHQB 1WG4A 1U49A 2QTWA 2QA4G 2UXDJ 3EDQB 4DV0J 5LJ3Y 2BJ9A 2J8SA 5HMWA 3HF5A 3TVYA 5AJ3F 2Z2MA 3EGWB 3C46A 5EN1A 1I94J 2UU9J 2EG2A 2M0GB 5F8IA 3RBDA 4Z37A 1Q95G 3B82A 3Q2SC 1H0HB 4YFUA 1NK7A 3SCLE 2Z0GA 4K7QA 3EPGA 4MK8A 3GB0A 4Y00A 4C8YA 2W2OP 1FEEA 4KIAA 4B9VA 3Q24A 2C2MB 2O67A 3NMAA 4F4WA 4X4OA 3ZO7A 2VJUA 3HVRA 1NPPA 4FYYB 2UXCJ 1BY9A 1FRIA 2W9AA 3LANA 3DLJA 4DL3A 2HZCA 2EWHA 1UFLA 1MW7A 2Y8YA 3DRXA 3BQ1A 1VK3A 1QSLA 2UXBF 3LP1A 5KFMA 5D8HB 4OLPA 1KNZA 4CDIA 3KNAA 1HNXF 2IYGA 2RUSA 4DCJB 2OI2A 3DGVA 2KG0A 5KT6A 2B43A 1RT1B 1RT7A 2E7VA 3QAUA 3I6PA 3T6JA 2AEFA 4IUFA 5H9EK 2MEWA 2LQ5A 3W60A 2CPXA 2CQHA 3TARA 2WW8A 3HVTA 4YB5A 4YEAA 2R2UA 3GSIA 4H4OA 2C3MA 4K5SA 5D0EA 2HWHA 4B9UA 4DV3F 1HLWA 5HO4A 4O44B 3PDNA 3EM1A 1YBUA 3AA8A 2CRLA 1A6LA 2KJWA 5T7LB 3S6EA 1XMOJ 2ZM6J 2CZVC 2LQJA 5IQQA 4RW4B 5KG0A 3J80Y 2BKPA 1PC4A 1S6QB 2BV3A 1B70B 2ACMA 5AXMA 4QWEA 4YDXA 3TUJC 2HNYB 2E1PA 5KOXA 5L39A 1W2BR 3J81Y 3K89A 1VLOA 4NOHA 4AFFA 4WFZA 4X84A 4MKBA 4WFBQ 2KU7A 2LU1A 8RUCA 3CC2S 4JI5F 3ISZA 2CPJA 5AE3A 5SZTA 3HPOA 1PAUB 2MPUA 5CD4A 3IFEA 4ECUA 2EI5A 2D69A 4QW8A 2BW7A 1IBLJ 1VQNS 1JLAB 4DPWA 1VQLS 4QBUA 6FDRA 3NBPA 3A13A 1S6PA 4HACB 1U2CA 2J8AA 5GMDA 4DV2J 2ZKUA 4F4AA 4F02A 5HK4A 1UZDA 1UVNA 3TZYA 1KKHA 1S48A 1HQEB 4USTA 1GTEA 5AXNA 4Z7CA 3HJVA 1VQSA 3H98A 3VV2B 1FXRA 4NRTA 4LFBJ 4WU2A 3LAKA 2IM0A 2GQ2A 2RVJA 1T02A 4K4XA 2DRDA 2WK4A 1O8BA 1KTQA 4MKYA 5RUBA 2AZ3A 2XWXA 2B4UA 1N8RT 2DIVA 4P71A 1P1LA 2BJEA 4DF4A 2KVQE 3Q8VA 4MAKA 2M70A 3LPEA 3O44A 1UKUA 2OSRA 4NLWA 4MK9A 4BDPA 2DNOA 4U6PA 1RTDA 4I64A 2R7VA 3NS7B 1YRTA 3C14B 1IR2A 3HZEA 5HROA 2M5YA 1F9EB 5BXIA 5HVGA 1RT2A 3T1HJ 1NH8A 4YB7A 5J2QB 2GNKA 1WF2A 1WOOA 2JEFA 3R5DA 2KG1A 4U7UD 3PYGA 2CADA 3JTOA 4UTGA 3TJ9A 3KMSA 2J5AA 2XEXA 3BEGB 3F56A 1TKXA 4X4RA 4FYDA 1GT8A 2GCFA 3HHNB 5KG5A 4MJKA 2JFKA 4O3PA 2VG7B 1FRLA 2J76E 1A0OB 2IYIA 1YKWA 3PR4A 2CYYA 2YNGA 2N82B 2I6WA 2A10A 2GZOA 1RT5B 2CNLB 1UWBB 1V5IB 2RT3A 3KYLA 2LP4A 2UUAF 1MWYA 3MMCB 4ZVOB 3W64A 2ZD1A 3HHLD 2MTLA 3IR5B 3TQ1A 3KFWX 2C2DA 5KG7A 4WP8A 3K58A 2AYGA 1NMEB 3AJ1A 3B8HA 2RRBA 4ZCKA 1IWGA 4L3NA 4DV6J 2HFSA 2L9NA 4WWSA 3DRSA 5KG6A 4CLWA 3AAWB 3OL7A 5JUMA 2VFTA 2AYEA 1PIEA 2QSFA 3DLLQ 4DCOB 3K8WA 4P72A 4DR3F 5IT9Y 1XNQJ 1R43A 5IM0B 3RAXA 4B17A 4DR5J 4O23A 4IDKB 4TNOA 3TJ8A 4RNFA 3SQGB 2ZBCA 3KOAA 2ZWOA 4C48A 3UD3P 1LK7A 4Q2MA 3NCPA 4OHWA 4CIOA 2YX7A 3ZZRA 3G8SA 2LYVA 4X4NA 2FJBB 3K0JA 1EIYB 4G6VB 1NZ8A 1S1WB 2HVEA 2FJDB 4DFPA 2BE2B 2DNHA 2J0XA 4I6YA 2OPSB 1MMNA 4N7TA 4V19J 1X31C 2CQ1A 3SCIE 4I2QB 1TK5A 4LFAF 2E9TA 1SBRA 3TNVA 1M5SA 4M5IA 4KYZA 1RT1A 4O3NA 4F3MA 5KFHA 2BJ1A 2JX2A 1L3SA 5LMUF 4UQTA 4LF5F 2E1MC 4EU0A 2WSEC 2NZ4A 1Q8KA 4F50A 4KGXB 2XMKA 2MZ1A 3J81U 2M8HA 2M7SA 3MMBB 3C8YA 1TELA 1NKBA 3I0SB 2MKSA 5SUHA 3RRKA 5KFXA 3T5JA 2QLWA 2K7KA 5T7LA 5EDWA 3H42A 3UN5A 4B08A 5HVFA 2C1EB 1S6QA 3Q8PB 2E5IA 5KFCA 3O5TB 5E3PA 2I8EA 2F1FA 2HNYA 2P2CB 3H0PA 2H48B 3OHBA 1SC6A 2EKYA 5IWAJ 1TL1B 5AT1B 3W2VB 1D9FA 2ZJQQ 1Z4UA 3VAIA 4DV5J 1TP7A 4NPOA 1FCAA 3W7BA 1QLNA 2WRMA 2B8QA 2XCPA 4WFAQ 1JLQB 2HRUA 3U1LA 2MQPA 1OPZA 4LF7J 4A8SA 3OJSA 2R2RA 1X0PA 1JLAA 2A0FB 2HHXA 1QVGR 2VASA 1U4BA 3HHDA 5D77A 4IG0B 4IFVB 2DHSA 1FX4A 4HACA 3GIIA 3QJLA 2FHKA 1YRXA 4KV8B 2R7OA 2Z4PA 2GFFA 1SJ3P 3UCGA 2C2OB 4OI6A 3SFUA 5T41A 1SC4B 1YJ7A 1TAUA 4BS2A 4H4MB 2NQPA 2VPYB 3N4WA 1HQEA 4QW9A 3OPKA 4BHQA 3IWNC 3OT9A 1N32J 4FS1A 4B9LA 2OMLA 4ZJLA 4B3TF 4V19X 1IKVB 4USVA 3BSNA 4OI0A 2W2PP 2E7WA 2YPZA 4GC7A 1JMTA 4G1IA 4RZRA 2G2ZA 2WHOA 2MZSA 1R89A 4LSNB 1M5OC 5M2PA 5KFLA 4J9MA 4C8OA 2R2TA 3W9IA 2MSTA 1UJ6A 4OYPA 2WBRA 3CO0P 4FNHA 2OPQB 2VA3A 1OY9A 2CJAA 4ICLB 4OYZA 3C14A 1YJUA 5CYMB 3BGRB 3FEYB 4WJBA 4R0JA 3VAKA 5DM7Q 1O51A 2MQMA 3T5HA 1MNEA 4OJHA 3PKMA 3HFZB 2V8VA 4GKJF 2HVHA 2XULA 5J2QA 2ZH1A 1N34F 5IT0A 2DNGA 1F9HA 3UR3C 5DQGA 1T95A 2NXEA 1JJ4A 2XG8A 5IFMA 4F0HA 3OD2A 5F9LA 3PJWA 3R5AA 1BUXA 4FDFA 1QE1B 2VG7A 2KXHA 4P9SA 4ATNA 2FYXA 1N0UA 3OFGA 3ZNJ1 3L7UA 4XPEA 3LGHA 5CXTA 5IV4A 4WZMA 3QGIA 2YWWA 4Y2CA 4JI7J 1UWBA 2VIHA 2HAFA 2JZ5A 2ZJRQ 1WSRA 2B6AB 2HBRB 5E0OA 4EZ9A 3M32B 4NCBA 2RJZA 1UFWA 3MMCA 5CH7B 1R3NA 1IUJA 4KQZA 4IQXA 2OUGA 1NB7A 1B4SA 3ZTQA 3G71S 3ICLA 4OX7A 3VCDA 1RBLA 1KWMA 4RR5A 5GVQA 3T19A 2QMWA 2X7IA 3HX9A 4AL5A 3IGNA 4RX6A 3I9V9 1RSCA 3BN4A 3GR1A 4YN3B 4KPYA 5IXUA 5IM0A 1IQTA 2BR0A 1IR0A 1TL7B 4MFBA 1NNDA 3WIVA 2FHOB 1MWQA 3D6MB 2X3GA 1Q79A 1HNIB 1Y7PA 2PEHA 5JJBA 3SQGA 2LECA 3D6TB 4FF4A 2DEJA 5DJBA 4JB8B 2JVOA 1JXLA 1X4BA 4DLGA 3MFIA 3Q8SB 4CLSA 3N9UC 4I67A 3P45B 5LMNF 2XSJB 4CLLA 3GP9A 1XERA 2VONA 1ITPA 2HFZA 4I0WA 3HSZA 2ILZA 1FA0A 3P6YC 5KFDA 1S1WA 3RAQA 3T41A 4CO1A 2BE2A 2UVWA 2OPSA 4PWUA 4WK1A 4I2QA 2HVDA 1VC5A 2YBVA 3AXKA 4RNOA 3SI8A 4TQRA 3CIMA 4CLZA 1M1HA 2IIHA 3QFHA 2ZOFA 4YDDB 3CCLS 1RT3B 4CH0S 1S12A 3MPDA 2BUNA 4WFNQ 1WELA 3CSKA 1SC3B 3MPUB 3NS5A 4OYOA 4LMZA 2H9ZA 2HLUA 2KI2A 3MUMP 1VCTA 3MMBA 3ETOA 1FTCA 3T1YJ 1E6VB 2JL9A 2K3KA 1X4DA 3I0SA 1UWAA 2N7CA 4FYVB 3W8PA 2PSZA 4KGVB 1D8YA 3EXCX 2IRUA 1WHXA 1RAAB 3UDEA 1VBYA 2JEGA 4FPIA 4MK7A 2KDOA 3TR5A 3VGUA 2MZRA 1C0UB 1OIAA 4ZDNA 1VC0A 1X4GA 2DO0A 2AV5A 1TL1A 3GQCA 3W2VA 3PO5A 1N5YB 3OSNA 2ZFHA 4USHA 4FVCA 3FGVA 1B0VA 3RBEA 3BPDA 3RUBL 2FGCA 2L3MA 4A8FA 3CCQS 1JLQA 1U0SA 1S1TB 5ETOA 1RAIB 4OZNA 2DPIA 2KM8C 1XC9A 3SEOA 4LF9F 1C2PA 4OJ3A 1BWEA 4IG0A 4IFVA 2XHCA 3UO0A 2IDLA 4LBIA 5F3ZA 4KV8A 4USJC 5LSLA 4G3IA 2VG6B 3RYLA 2LLZA 1FRJA 4H4MA 4ZJOA 1RYRA 2CQ4A 2QLXA 1LNQA 4HL9A 4DL7A 1Q8IA 3KLIB 2KTQA 4NCGB 3QAEA 3MEDB 2V6AA 4OIXA 3MWBA 2Q6BA 5K8NA 1IKVA 2HQGA 4QPXA 2YNIB 1HIYA 2MB0B 2EK6A 4DSIA 1WHVA 1RE1B 1UVLA 2MKCA 2LA4A 3KHHA 5DZ7A 1U26A 2RQKA 4LSNA 2RQMA 5D0RA 3P5TL 2GS8A 5LSOA 4ZIWA 2OPQA 2DT9A 1FXDA 1X5SA 4ICLA 2YX1A 3TP2A 4NYPA 4RW6B 4OI4A 3W62A 3R1LA 3LUYA 3QSIA 5F3TA 2XMWA 5CYMA 1OQ6A 2C3OA 3BGRA 5B7WA 1S9EB 2UV8G 3H25A 3EJMA 3UQSA 4PQUB 2VL1A 2MLZA 2XB2D 2HPUA 3MUTP 4DR1J 1T03B 4NLQA 1RZMA 1EHWA 2W2MP 3M6XA 3NGRA 1HL6A 4PKDB 2RUGA 2KT2A 4U95A 3TAQA 1Y3JA 4U9RA 2EVZA 2D9OA 1S97A 1H74A 5CD4H 1KLMB 5CQGA 1QE1A 4JI8F 4IR1A 1Z2LA 2X51A 2NXUA 3DU6A 5CYJA 2PDAA 3TA0A 3CUNA 1LFPA 2RHSB 3AA9A 2ZUGA 3TUIC 1FD2A 5J2MB 4DJBA 4FXWA 1FFGB 1ZPWX 2CQGA 4OI3A 1U1RA 3GIRA 3LP0B 3M2RB 3D1OA 4P7VA 5EWGA 2NPIA 2GHWA 2B6AA 3W5XA 3RRHA 1D3WA 3M32A 2PC6A 1F5BA 2B4OA 3CJQA 3CC4S 2DNMA 1HI1A 4HHJA 1UJ4A 3BGUA 3M2VB 1F6TA 2V94A 4ZVQB 2HGLA 2VKZG 1RK8A 2MSSA 4WYWA 5DS7A 2ZC3A 3UCUP 3DRYA 2WAQD 4PWDB 2I2YA 3QT8A 8ATCB 1K8AT 4KRWA 3DC2A 1TL7A 3I32A 4OI2A 1LK5A 1VIXA 1HKAA 1F9FA 1YVFA 1URNA 2Z30B 4WK3A 4O3RA 1RAFB 3M4XA 4IH7A 3GV7B 4C98A 3M9OB 1TKTB 1HHSA 3K7RA 5F8JA 1HNZJ 4GVBB 4MIBA 3TI0A 2XSJA 4OV6A 3OFEA 3C66A 1QD1A 3LGMA 2YWHA 2QYCA 2HMIB 2CPDA 2XLKA 3I56S 4DU8A 3OTBA 4I2PB 1R8HA 4DDFA 2B3TB 5KFUA 4J9RA 5JMNA 3GFHA 4FS2A 1T9UA 2CIMA 4C8LA 1U09A 2V68A 1JLFB 1KHWA 2VFUA 1Q0NA 2HBYB 1NK8A 4NWBA 1RT3A 2FY1A 3MEGB 2RDJA 2FZKB 4L6V3 4EZ6A 4ZN3A 1WKLA 2IMWP 2FLPA 2DPJA 2WSFC 3D0GE 4DPXA 3R5CA 2K2PA 4TU7A 3FQLA 3PY8A 1U25A 3QRPA 4MYTA 3PFEA 5L38A 3IM9A 2R7WA 1FJCA 5K8MA 2RH3A 5HN0A 1Y3KA 3NGUA 1C0UA 1JLGB 2JLEA 2ZH4A 5FD1A 2E9RX 3IN5A 1ULRA 4QOTA 2DNLA 4C9DA 4X65F 2A6OA 1N5YA 4YP3A 3JYTB 3AHPA 4DOZA 3DHWC 2RDDA 3HM9A 4ZMMA 3J7AN 1ZTWA 1RKIA 4NLDA 2HYIB 3BSCA 1KRPA 2FHJA 3ISND 8AT1B 2HFUA 3E2EA 1VIOA 4IR9A 1S1TA 4LF4J 2DGOA 3OTDA 3NRBA 1JQGA 4RUCA 4CO2A 1C1BB 1I5OB 4ZVGA 2E44A 4YS2A 3GILA 1HNWJ 4O4GB 3IG1B 1RHQB 2MLYA 2Z8QA 4QCLA 2Z2ZA 3EZUA 2V2ZA 4OYWA 4A8QA 2YX4A 4I69A 2FVSA 1VR6A 2VG6A 3THPA 5E7OB 2ASJA 3KLIA 4NCGA 1M1GA 3HKWA 4DV1J 2CQDA 3MEDA 4M95A 5A0YB 1LKZA 4EYIB 3SYZA 2PA8D 4PWWA 4OYAA 1KQFB 3BKUA 4EFAC 3IWLA 2BACA 2YNIA 2HHHF 1FNOA 4NXMF 2E5JA 1YZ6A 3J7YI 5D3GB 2A2CA 4I6AA 1D1UA 2UV8A 4RUAA 2JSXA 3EGZA 1UEUA 2QN6B 4IOBA 4JP8A 3OTOJ 1FESA 3AFGA 3PJ9A 3H20A 2N7YA 4QWBA 2FC9A 5E3AA 2R9LA 2RF2B 1RWVB 1S9EA 5D4OA 2XWYA 3BKFA 1GXTA 2E1CA 3LGNA 2QA2A 4PQUA 1CC8A 4HEA9 4IKAA 4HI2A 1PO6A 3MMAB 1T9VA 1T03A 3MHYA 5K20B 2HIQA 2F7VA 1CVJA 1QDUB 3M8ZA 4OHYA 3EX7B 2P9CA 1AB8A 2W2QP 5KFIA 1KLMA 5FLXY 4NA3A 3OR1B 1U48A 3N6LA 2R8GA 2P9GA 2DGQA 3M2UB 5DQHA 1N33J 2KRRA 5J2MA 4DU7A 3BREA 1QJHA 1S1VB 3W2WB 1QTMA 4AQYF 2DCUB 4LREA 1RQ0A 4QR0A 4Q7AA 3LP0A 3M2RA 1N54B 3OLBA 2Y9HA 4Q0BB 4F0MA 3P4UB 5D0HA 3TOQA 1Q8LA 1RWXB 2GJIA 3M2VA 1PGZA 1Y0HA 5CAAA 3DGPB 2V8GA 3SSRA 1CLFA 4KTQA 5D4LA 2I1RA 2EXUA 2HEKA 4RNMA 5HBMB 4DR2J 4DR7J 4CLPA 3KK3B 3A3PB 2UUCJ 2HRTA 1RI7A 4W4MA 4PWDA 4ZVUB 3QPIA 3CXCR 5KTQA 1VLYA 1ELOA 4XIUA 5LL6d 2POKA 3AT1B 2ZH8A 1FEHA 1HHQA 2HS0A 3LOUA 1VYAA 4PQAA 4M8LA 1TKTA 1FXLA 5HAOA 2V67A 2DH8A 3CO9A 4YOEA 4ED0A 4GVBA 3I5BA 4DXLA 2G1DA 2JNJA 4LVOP 4FN5A 3PV8A 3G86A 3VGVA 5D6GA 3QZ8A 3MCSA 3MD3A 2LFVA 3Q86A 4AXJA 3TANA 4X62F 3FCHA 5KFSA 2HMIA 1YZ7A 3BJYA 3NGSA 4JI0F 3LAMA 3CCZA 4DBQA 1WG1A 3GG0A 9ATCB 2P6SA 4TXSA 4K0KJ 3L7OA 4I2PA 2WVFA 2RD5C 2CPIA 2XS7A 4FYWB 2ROPA 3TZZA 4S0MA 3DFEA 5KT4A 3A8EA 2NPFA 1SKSA 2OH2A 2B0GA 1NK6A 3SSQA 1JLFA 3CC7S 4G1PA 1NDLA 1RGVA 3MEGA 4ANEA 1TV6B 2WSCC 3PX0A 2CQ0A 3CJ0A 1SL1A 4LQ9A 5AJ3J 1EKRA 3KLGB 4F4KA 4KO0B 2IVMA 4W90B 2NR0A 1SVDA 1GFWB 3PZPA 2VBXA 3CJTA 2FUG9 4YY3F 1Q7YT 1G7CB 4ED5A 1EAYC 3LF0A 3F41A 4I68A 1NO8A 4OYBA 1JLGA 2ZZMA 3TUPA 3IBFB 1LEOA 3AB4B 4QR2A 3MM5B 2CJYB 5A8WB 2ATLA 1KR4A 4URGA 3UVJB 2Y3YA 3EICA 4H54A 3RJMB 5F0UA 3D1QA 3BB5A 1JWWA 4OX9F 4C3MA 2IJNA 2UXBJ 1U6BA 2MQOA 4ILMA 2HURA 5D15A 1MU2A 4DX5A 3C3LA 1HNXJ 2CJBA 5B0CA 1SCJB 1N5QA 1CJKB 5AE2A 1C1BA 1IQZA 3SMZA 1IKYB 3AXMA 4UUXA 4O4GA 5B0EA 3IG1A 4URSA 2V34A 3PNIA 1FDAA 4NEYA 3E01B 4CM2A 3KLFB 1NK0A 1KHVA 2QL7B 4RWXA 4DV3J 1KVIA 2MKJA 4YQWA 1S7IA 1G1XA 3RRGA 5A0YA 3NP5A 2DR8A 2HHSA 1T05B 4WTYA 1WHWA 4DV0F 1PYOB 2C2KB 1M90T 3EGVA 5D3GA 4JI1F 5JVGQ 5B0AA 3NWGA 1TFYA 4DX6A 4KB7A 1EJ7L 4IRKA 4PPDA 4LSLB 1HMVB 2GIFA 2GMJA 2J9EA 2RF2A 2RRAA 4JI5J 4UOHA 2EG1A 4G1QB 1RHKB 4Y3CA 3MMAA 1LW0B 3VAHA 2KFNA 1FVQA 2VDHA 3EE3A 4Z2XA 4K8RA 3HFVA 2CZ9A 5LM7E 1EARA 1UAWA 2ZHOA 3EDRB 1VJWA 2BABA 3DU5A 1L3VA 2LVWA 5C42B 2AX0A 3OR1A 2C2NA 1T3OA 1AROP 4KSEB 2W9CB 3M2UA 1V3SA 1RT4B 2JH3A 2ZOGA 3IM8A 3KK1B 4DWIA 4HT7A 2YH1A 1S1VA 2YQ3A 3D54A 3W2WA 3W65A 1FHTA 4X4VA 4I56A 1TAQA 5L1JA 4DV4F 4UZCA 4DR6F 1J2VA 4ED2A 4ANCA 2IM3A 2I5JB 1WC4A 4Q0BA 3LO3A 5I4MA 4LBHA 4JI3F 1RYSA 1H98A 3HCXA 3M7VA 3H2LA 3U1NA 2YKMB 4DSJA 3QSYB 3W66A 3V4IB 1KBRA 1A9NB 1O6XA 2HNDB 4GO7X 1V5VA 3SV4A 4ER8A 3CMQA 3MR7A 4PCQA 2DNZA 3R7SB 3BSAA 3BDPA 1QAJA 1YRUA 5HBMA 2HWTA 5B0FA 2EFOA 3G96A 1OJ4A 3DKDA 2LXFA 2U1AA 4CO5A 4M5GA 3LPYA 2HWIA 2OIHA 5F9NA 3D4JA 3M8YA 4MTPA 3KXDA 2DYAA 4K4SA 2XC9A 2FVRA 1TMMA 4DL0C 2H5EA 2HQDA 1NCLA 5LT5A 2DNRA 1FT8A 2M2BA 1BQXA 5AXKA 2UUWA 5HATA 3BKTA 4CYUB 4RNHA 4LIWA 4MIWA 3GJQB 4EK2A 3DDKA 1TFWA 3ZTSA 4V1Ak 1UVMA 3HDSA 3J7ZT 2UUAJ 1GXLA 3IR7B 2H1YA 1XNRF 3G6VA 3WHIA 3AQPA 1K1QA 1QVFR 5F41A 3VF0B 1QAXA 4HTJA 4RU9A 4QPTA 2QMXA 4JV0A 5F8HA 2RQCA 4HI1A 3B6BA 3JSYA 2GAHC 4WIQA 1TV6A 3IAS9 3I31A 1UCNA 1FWLA 2DEIA 1DAXA 3KLGA 4DR3J 4PYAA 3NCQA 1UP1A 4KO0A 1FWKA 2P5VA 1RDRA 2VF3A 4JBCA 4ZCIA 1WKJA 4CLFA 1QAYA 2F4VF 2JLFA 2KB2A 5I42B 3WDOA 3JAMY 2QA4S 2R2SA 4WU3A 1R27B 5ETNA 1WC3A 1BQNB 3R5JB 3MM5A 2GO9A 2AU0A 2EC2A 4DSFA 5A8WA 1S7HA 2FY8A 2BW2A 3PIOQ 2JVRA 2Z57B 1HHTP 3UVJA 4YMEA 2AJFE 3EZOA 3TAPA 2DJWA 1FNMA 2E9ZA 1OYEA 1SQFA 4ZKAA 1CJUB 4KGZB 1CJKA 2QGFB 5ETVA 4B9SA 5KFOA 1G6BA 1IKYA 1YJ9S 5LMUJ 4ID8A 3M8QB 4LF5J 1NSKL 5MLCV 2PMWA 2D74B 2E5GA 3J81j 4C97A 3E01A 5GMEA 4UOGA 2MXYA 5KT3A 1CJVB 2ZHAA 4JI4J 3ZZTA 4DPUA 3NNAA 5J1EB 4KH0B 1U2RA 3ZZZA 1EQMA 3QBCA 4DUZF 1AZSB 2OPPB 1J27A 5ETTA 1APSA 4EO6A 4DV6F 2D3O1 3C6TB 3KHRA 4C11B 3Q83A 1F5CA 1T05A 1GMUA 2KT5A 2A1BA 4W92B 1P27B 4CNZA 1XNQF 1HBMB 3GJRB 4EI2A 3POTB 1YSJA 2HQ3A 2V69A 2HG4A 4ZS6A 4PG8A 2XZTB 4DR4F 4M5NA 4R25A 3WBZA 1RBOB 4LSLA 1HMVA 4QZVB 2XYHB 1YG0A 1AW0A 4UW2A 3JXOA 2PE8A 1RWWB 3U1MA 1KFDA 1MROB 3FSIA 4G1QA 1A7GE 1LW0A 4EGLA 1Q82T 3N5BA 3PG9A 5A2QU 1NPRA 2DD8S 1PC5A 3HHLB 4X4SA 3OHAA 2EFQA 2XS5A 1TKZB 4OYXA 4LUBA 3IP0A 1VRUB 2Y1IA 3T5LA 5HJYA 4NRUA 4C3LA 4ZITA 2DISA 2W9CA 3OLAA 1DTQB 1OY8A 1RT4A 3W61A 2CVIA 4O3QA 1RP5A 3KK1A 4B3TJ 4I1TA 1K0VA 1CQMA 2ZJPQ 1X0FA 3T6BA 5E41A 2PT0A 1X4FA 3DXBA 3AH6A 3N5FA 4KE5A 1JLEB 4ITSA 2X3DA 3H40A 1K9MT 1ZM2A 2Y0SD 1U6ZA 3MAQA 2QE5A 3JQKA 5A8KB 5C5JA 5ETKA 1IVZA 1FE0A 2YKMA 2XMTA 1GTHA 2Y8WA 2FQQB 3CCUS 1PSDA 3BR9A 1SPBP 3V4IA 4X64F 2HNDA 5GMKa 3BQ0A 3NGTA 4ZLNA 1WTFA 3BYPA 1T8EA 2VOPA 2BJDA 4LRAA 3PXGa 4CT8A 3PW5A 2YNFB 3MR5A 1BWVA 2JHEA 1UL3A 4GKJJ 2AJ1A 1N34J 3KK2A 5B08A 3DHXA 4P10A 4PPZA 1UEKA 2E1AA 4ID5B 1AUSL 1NSPA 2RAQA 1NU4A 2NUHA 3MCMA 1WC0A 1S99A 5KFAA 4DV7J 4A8WA 2W7AA 3UNGC 2M88A 3KTQA 4YB6A 4FBUA 4NE9C 1N88A 1SL2A 2R42A 2R7XA 2Z56B 5KFQA 4ILLA 3NKYA 1T7PA 4CYUA 4J9LA 2V0NA 4OZ3A 2HS4A 2IA6A 3BO3A 2L08A 2ILYA 3HHKA 1W25A 3TO8A 4DFKA 2NCKL 3WIUA 2DRBA 1M5HA 3RBXA 1VFJA 1S9FA 1NHVA 3SSSA 3MM7B 2EEYA 4DX7A 1Q8BA 2HVZA 3CD7A 2VBYA 4DZDA 1I3OB 3KLEB 5IS2A 2XMMA 1FRMA 3VTIA 2FDNA 2LU2A 2RRNA 4HDGA 2ZKTA 4OZ2A 1VBKA 2YVSA 1S0MA 2GJFA 2UUTA 5MAOA 2RILA 1RISA 1JLCB 5ETSA 5I42A 4QQBA 1AFJA 2DR6A 3HT3A 3W5YA 3OR2B 1RADB 1YX2A 3AB2B 3A4TA 1BQNA 5DDOC 4OQJA 3MM8B 4DEZA 4FBTA 2XSFA 5LMNJ 3MAAA 1VQMS 3ILJA 2VPXB 4O3SA 1V3RA 1QSSA 4F0KA 1U1QA 1FFSB 4M5MA 4QJVA 4IO9Q 2AX1A 2IJFA 1D8ZA 1IBCB 1NAQA 4JI2F 5KT7A 4ZP8A 5B09A 7FDRA 2FHJD 1CJUA 3PACA 4UOCA 1TL3B 4CQ1A 3RZAA 3BDEA 1RWKB 3DOKB 4X66F 1UTAA 2I0XA 4ECZA 4WPAA 2JOQA 1PJ6A 5A6PA 2JC0A 4Y2AA 3M8QA 4CH1A 2FB0A 2DGWA 1SJRA 3P8BB 5F8NA 2GX8A 3QATA 4DFMA 4W98A 4ECQA 2ZH5A 1CJVA 2FPHX 3CNQP 4R8UB 2J0WA 5J1EA 3H90A 1AZSA 2OPPA 4IQMA 3ZXWA 4DSEA 2YWKA 3PJXA 1X4EA 1R6VA 3C6TA 4C11A 3D9BA 2DHAA 1TL4A 2XMJA 1WC6A 3HHEA 4O4RA 4J90A 1IBMF 1BXNA 1IKWB 1U1OA 3HHLC 3POTA 4UY85 5DDPC 3A8JA 1S6UA 2JRSA 3PHEA 1P6TA 2ZDPA 1FJGF 2CPHA 1NJYA 3VALA 2WBMA 2ZZNA 4E98A 2C3UA 4F67A 3MR2A 2VODA 1MROA 2BBEA 2N4DA 1H7WA 5HJXA 1N0VC 4J9PA 4FKYA 3L3CA 4LF9J 2XM3A 1HBUB 3GFYA 5IT4A 4Y34A 3KUEA 3HHLA 1S76D 3FMWA 1VRUA 3K17A 4ZPBA 5D4NA 5ETQA 2PN6A 3GSDA 4C0HA 1H2TZ 3CDUA 1HWLA 5LXRA 4IFYB 4Q8FA 4C0BA 2B4PA 1DTQA 4F8RA 1IKXB 1YITS 3S8SA 4U96A 2H3EB 5IC6B 4M5JA 3KUGA 1TUGB 1JLEA 3QWUA 2BDPA 1XJWB 2BZ2A 2V2QA 4P2MA 1S57A 5A8KA 1R0BG 2VOOA 1ZZNA 1FJEB 2BOPA 1DBDA 3Q8UA 5KAKA 3FK4A 2E5HA 1LXNA 3LALA 3MM9B 1XR7A 2YNFA 4M5KA 5FJ4A 4RUHA 5JXSA 4OZ5A 5BYSA 2KYXA 2EKNA 1N4LA 3TVZA 4NXNF 2OSQA 3KHGA 3T1AA 3W3SA 1S79A 1VK8A 4PZVA 5DM6Q 1FWPA 1RCXB 1VS3A 2H51B 4KR0B 2DO4A 3HLUA 4A8OA 2V50A 3PR5B 1NK5A 3MPYA 3MM6B 4JI8J 4GRSA 4AUKA 3LP2B 1FD8A 4ZPWR 2DGTA 4HHUA 3CT9A 4ZVTB 5C7PA 2EBGA 3OUYB 3RAMA 1AA1B 2V2KA 3KDNA 3R9LA 6FD1A 2B4VA 1BLUA 3KG1A 5L1KA 1HW9A 5HVHA 3G6YA 4IH6A 1S0OA 3KJNB 3KLVA 3IBCB 2QLFB 4ELVA 2MY8A 1PYTA 3R6GB 1CULB 1R8AA 4Y28C 3GWCA 4F3OA 4QIEA 5GAEU 4TU9A 3MM7A 5AXLA 1NHKL 3W9HA 4R5PB 2DNYA 1NSAA 2PA3A 2ROGA 2OJ3A 4J37A 3P49B 3OQ2A 1UA0A 4LF6F 3KLEA 5IC4B 3N6MA 2BEFA 1WF0A 2HGMA 2VQFF 2IMOA 3ELHA 4Y2MA 5FIIA 4WP3A 3FUYA 4PXEA 3QO9B 4DQQA 5B0BA 2V5HG 1F2GA 1U7LA 1U8SA 2JC1A 5H1SV 3K2YA 2IVFB 3TEGA 2XMAA 3RB0A 3G8QA 3P5BP 3GYNA 3F44A 4CRJA 2WONB 1JLCA 1H2UX 4KPCA 3OR2A 3GFZA 2R8IA 2LKZA 3MM8A 2YY3A 3CWJA 1XIQA
chains in the Genus database with same CATH topology
2KO1A 3HKWA 2DGXA 1HWJA 1ZAVA 2BRLA 2CQDA 3MEDA 4M95A 3FFIA 4DL6A 3PW0A 2OLWA 2Y1RI 2DNKA 5A0YB 1LKZA 3IC1A 3T5KA 2AQ4A 2OD4A 4EYIB 2QV6A 3SYZA 4TYBA 1U1MA 2PA8D 3D5MA 1YBAA 4TY9A 2MZTA 3D0IE 1KQFB 4EFAC 3IWLA 2VFRA 2XZWA 1TKXB 2BACA 3DLBA 4NX9A 3TA1A 2YNIA 2HHHF 2JEIA 1FNOA 2YKOA 4NXMF 2M4MA 4F26A 2XMUA 1S9GA 2E5JA 4TU8A 3OVSA 3J7YI 5D3GB 2XLJA 2A2CA 4I6AA 4F25A 1WD6A 5A2QY 2UV8A 1D1UA 1K0TA 1LXJA 4RUAA 1SXLA 2JSXA 3EGZA 1UEUA 2U2FA 2MGZA 2VFSA 2AJ4A 4I7FA 4Q43A 4TN2A 4WFYA 4J5OA 1TL3A 4IOBA 4CTAB 3BQ2A 1KQSR 4MH8A 1FRHA 4ALZA 1NK4A 1XMOF 3CCES 4PUOB 1KQKA 2CPFA 2YNGB 3US5A 5LXYA 5J2PB 2ZM6F 2NSCA 3DOKA 2FGOA 4DG1A 1FESA 2R8JA 3FMBA 3DN9A 4UQGA 1AXQA 1NHUA 4M5DB 1WF1A 3ITHB 3H20A 4RKUC 5GAHI 4K4YA 1VRTB 1B64A 1O0PA 2N7YA 2QO3A 2FC9A 1C1CB 4QWBA 3DGPA 4F4ZA 3FEXB 2FLLA 1FTRA 4CI0B 5E3AA 3NAIA 2R9LA 4IG3A 2RF2B 1OS5A 2DGUA 3DLHA 1S9EA 2AGOA 5D4OA 4K0KF 2XWYA 1GAOA 1SJQA 1XR6A 1JX4A 4N8OA 1GXTA 2E1CA 5U47A 4B3OB 3LGNA 4WF9Q 2QA2A 3UDCA 4PQUA 1CC8A 2ZE2A 4HEA9 2B56A 3LWLA 4IKAA 4HI2A 4R8UA 2MMYA 1PO6A 3ZZOA 3MMAB 2ZD1B 5KFWA 1T03A 3KK3A 3WC2A 3J7A1 3MHYA 2WB1D 4CO3A 3M8SA 3M6UA 2HIQA 4FPRA 1S1XB 4LFCF 2HRYA 2F7VA 4YHHF 4UUWA 5GAEI 4DHVA 2CPEA 2RKIB 4E8UA 1ZZFA 3D1HA 3S01A 1CVJA 4LVNP 1NJWA 4FXDA 2VKRA 4B02A 4OHYA 2GIRA 4CO4A 1MMLA 1FRKA 4WIIA 3E51A 3EX7B 2UVRA 3KG0A 3DRSB 2IBKA 2P9CA 4HKQA 3NG8A 1WG4A 1U6FA 1U49A 1WI8A 2FVCA 5GADI 5IQ6A 5KFIA 1KLMA 3I5AA 3DM2B 2QA4G 1SJ1A 3NL0A 5FLXY 4ETZA 5EWFA 3BSOA 2IBOA 4NA3A 3M6WA 3OR1B 1U48A 3N6LA 5LJ3Y 1DFDA 5CYQA 2R8GA 5HMWA 2P9GA 1IKWA 3HF5A 4GO5X 1CQNA 3TVYA 5AJ3F 1IBLF 2DGQA 2W24A 2Z2MA 3M2UB 5DQHA 3EGWB 3JTNA 3C46A 5EN1A 4O44A 3V2UC 2KRRA 2VA2A 5J2MA 3BREA 2EG2A 1QJHA 2G4BA 2M0GB 1JK9B 5F8IA 3RBDA 3UFCX 1S1VB 4PR6A 3W2WB 1QTMA 4AQYF 2HGNA 3H59A 2YKPA 4Y2KA 4Z37A 2KH9A 2DCUB 3CCVS 7FD1A 3CEDA 1JKHB 1RQ0A 3B82A 5HP1B 3ENQA 3PRDA 3Q2SC 4DV2F 5E3CA 1H0HB 4YFUA 4QR0A 3SCLE 3CJ4A 4Q7AA 1SQEA 1NK7A 2Z0GA 3LP0A 3M2RA 4RW4A 1N54B 4C8MA 4NMLA 4QWCA 3EPGA 4MK8A 3GB0A 4Y00A 3NNCA 1D9DA 4C8YA 1WTBA 1FEEA 4KIAA 3OLBA 4B9VA 2HHQA 3OTEA 3Q24A 4FZVA 4Q0BB 2O67A 3NMAA 4F4WA 4X4OA 3G4SS 2ZH7A 4U7CA 1UVKA 3HVRA 3TOQA 1Q8LA 1RTIB 2GJIA 2AYMA 4N5SA 1BY9A 1XK8A 1FRIA 2A3JA 2W9AA 1KN6A 3AJ2A 3OW2R 3LANA 3DLJA 3M2VA 2SXLA 3H5UA 4DL3A 1PGZA 2OD6A 4LFBF 1Y0HA 2FJVA 2HZCA 2IM2A 3BZQA 2EWHA 2KZMA 2V8GA 3S1TA 3SSRA 1HWIA 1UFLA 1HBUA 4AL7A 2L9DA 1CLFA 1MW7A 2B9WA 4GC6A 2W25A 4KTQA 5D4LA 3DRXA 1SUQA 4EBDA 3BQ1A 1VK3A 1QSLA 2I1RA 2UXBF 5BYQA 1FKOB 3LP1A 3HMJG 5KFMA 5D8HB 3MEKA 1CPZA 2F3JA 2ABYA 2J6SA 4AL6A 4RNMA 4OLPA 5HBMB 1KNZA 4J9NA 1WHYA 3PVXA 3THVA 2PD1A 3KNAA 1Q16B 1HNXF 1JXEA 1VMBA 2IYGA 5K5MA 3KK3B 3V81B 3MF5A 5A8RB 1RI7A 1KC8T 4PWDA 2VUGA 2WB4A 4HVZA 3QPIA 4IFYA 2VPWB 2KG0A 5KT6A 3CXCR 3GIMA 5KTQA 4ZCMA 1VLYA 2E66A 2G0CA 1IKXA 1RT1B 2B43A 2P6TA 1RT7A 3I4PA 3QAUA 4LIRA 3I6PA 3I55S 1ELOA 3T6JA 4XIUA 1XWLA 5LL6d 4ED1A 1SI9A 4IUFA 2WOMB 2POKA 3WZ0A 4IRCA 2LQ5A 2CPXA 2CQHA 3TARA 3C6UB 2WW8A 3HVTA 2ZH8A 1FEHA 4YB5A 4YEAA 1ZM3A 2HS0A 3LOUA 1R0AB 1MWZA 4WE1B 2R2UA 4H4OA 1P1TA 4JOUA 2C3MA 4K5SA 2P9EA 2FLOA 2CPZA 2HWHA 4PQAA 4B9UA 4M8LA 5A6WA 2IAJA 1TKTA 3T3FA 1FXLA 3T1HF 4DV3F 2DH8A 5HO4A 3CO9A 4EUVA 4O44B 4YOEA 2F9DA 3PDNA 1RA7A 3Q0AA 4ED0A 3AA8A 2I38A 2CRLA 3I5BA 2G1DA 3B4MA 3IAM9 3SCKE 2ACYA 1NEEA 4L72B 2KYZA 4LVOP 1A6LA 2KJWA 4FN5A 3PV8A 5T7LB 3S6EA 3G86A 4ECXA 4NCAA 3DYAB 5D6GA 4KHRA 2KRBA 5IZHA 3MCSA 3QZ8A 2UVUA 2CZVC 3MD3A 2LQJA 4AXJA 4ERDA 5IQQA 1UEVA 4RW4B 3TANA 5KG0A 3J80Y 4X62F 1KQGB 1PC4A 3FCHA 1REVB 5KFSA 2HMIA 1S6QB 3T9ZA 3BJYA 2LDIA 2BV3A 3KLHA 3BM7A 4JI0F 3TX8A 1K73T 5H9FJ 3LAMA 2HAIA 3CCZA 2C3YA 4DBQA 2B7CB 1XBWA 4NYZA 3FEZA 1C0TA 5AXMA 1WG1A 3GG0A 4QWEA 2PIIA 4YDXA 2P6SA 3ENVA 4TXSA 3TUJC 2HNYB 2Y1JA 3L7OA 3MM9A 4I2PA 4B3SF 2RD5C 4A46A 5KOXA 2KM8B 4ZVFA 2CPIA 2GIQA 2XS7A 2XHWA 2ROPA 5L39A 3ULHA 3PEHA 1W2BR 3DFEA 3FSXA 5KT4A 3A8EA 3MFHA 1F0XA 2LEAA 5CZVA 2FJEB 2OTLS 1XTZA 3J81Y 2UP1A 3K59A 2NPFA 2ZH3A 1ZAWA 1SKSA 2C2EA 2OH2A 2B0GA 2GQQA 3O2IA 1NK6A 3SSQA 1JLFA 4NOHA 4GMKA 4AFFA 5K8PA 4WFZA 2CQ3A 4X84A 2DRAA 3CC7S 3EXYA 4P6QA 3M1VB 2VD3A 3LP1B 2FJAB 2ZITA 2E29A 3CCSS 1RTHA 4G1PA 2XO7A 1RGVA 3K5NA 3QIPA 1IM4A 1R8BA 3MEGA 4MKBA 4WFBQ 2KU7A 4OX8A 5E3RA 2LU1A 1EETB 1OSDA 2DTJA 3MD1A 3OBIA 4FF1A 4OX6A 3CCWA 3CC2S 1TV6B 4JI5F 3ISZA 4NLTA 2W4DA 2CPJA 4M1KA 2WSCC 3MM6A 3PX0A 5AE3A 4J9QA 2CQ0A 5LSRA 3MEEB 5SZTA 2J9CA 2MPUA 3CJ0A 3IFEA 2YWEA 3LP2A 3HPOA 1SL1A 2J6TA 4ECUA 3KLFA 2B5JA 2EI5A 1IQTA 3DLKB 4QW8A 4LQ9A 3MMJA 2GJ2A 3OUYA 1VQNS 3KLGB 1JLAB 4F4KA 1VQLS 4X4PA 4QBUA 5LJ5Y 6FDRA 4KO0B 2IVMA 4ECWA 4W90B 2NR0A 5D4PA 3HFKA 3NBPA 3G9CA 3I82A 4D3HA 3PZPA