2LEAA

Solution structure of human srsf2 (sc35) rrm
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A syn-anti conformational difference allows SRSF2 to recognize guanines and cytosines equally well.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Serine/arginine-rich splicing factor 2
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2leaA01
1WWHA 2M9KA 5DM7Q 2AD9A 2MQLA 1WG5A 1JJ4A 5HO4A 3MD3A 3VAMA 1ZZFA 3CCSS 2YTCA 1Q86T 2MSSA 5DETA 2U1AA 5LXRA 1W2BR 2X1GA 4IO9Q 3TYTA 2AYBA 2CPJA 3IRWP 3CC4S 2YH0A 3ZZYA 2DIUA 2KM8C 2DNYA 4YUDA 1X4HA 3U1LA 4F26A 2N3OA 2UP1A 2KN4A 4F25A 4LJMA 3EX7B 2OSRA 3SMZA 4QPTA 1YWXA 3VAIA 2LXIA 4C7QA 2LXUA 2V94A 5DDQC 2CPXA 2G0CA 2RRBA 4QU6A 2CPIA 3S6EA 3J7YU 3J7ZT 3CCVS 2J8AA 1IQTA 5IQQA 2N3LA 4IUFA 4M5DB 3NS6A 1AUDA 1WHWA 4QQBA 1U1KA 5DDRC 2KXNB 2ZJQQ 3UE2A 2PE8A 2JWNA 3CCLS 3G8SA 3I56S 2DHGA 3MURP 2MSTA 2CJKA 2KHCA 4CIOA 2E5JA 1SJ3P 2VOOA 2CPYA 3H2VE 2KRRA 4CQ1A 1X4AA 2X1FA 1FNXH 2J0SD 1YITS 4Z2XA 1PO6A 2DH8A 2KH9A 2DNZA 2XNQA 3ZZZA 3UD3P 1PGZA 1WEZA 4WFAQ 3MI7X 3LPYA 2CQ2A 2KYXA 1U6BA 4WKRA 3S01A 3MUVP 1WG4A 1YHQS 2DGSA 2DNMA 4F02A 2XS2A 2CQ3A 3CMES 4QU7A 2DO4A 1VC0A 1CVJA 4C0OC 2KXHA 2EK1A 2MQQA 5JVGQ 4WFNQ 2MZRA 1WHXA 2GO9A 2MXYA 1ZH5A 1VQNS 3G4SS 3S7RA 2X1BA 1N88A 1WELA 2CQCA 3LQVA 5LJ5Y 3MUTP 2HGMA 4P6QA 5H1SV 1NU4A 3I55S 3Q2SC 2D3OR 3G9CA 1K8AT 4UQTA 2JVOA 2M2BA 5D77A 1WHYA 1FJEB 2KG0A 1U1OA 2N7CA 1A7GE 1WI6A 2MY8A 1HL6A 4UY8T 5FJ4A 3VF0B 2NLWA 3FEXB 3CD6S 1FJ7A 4BS2A 4CH0S 1DHMA 1X4DA 2MY7A 2BOPA 1VC5A 3UCUP 1FJCA 2LECA 1KOOA 2DH7A 1VQ7S 4YOEA 4C4WA 2RT3A 1G2EA 1WHVA 1YTYA 1X0FA 5LXYA 2RS2A 1DRZA 2HYIB 3S8SA 2D9PA 2CQPA 2AYGA 3VALA 1X4BA 2A3JA 2LKZA 1VQKS 2M0GB 1SJQA 2E44A 1DBDA 1K9MT 1R8HA 4Y00A 2KM8B 1H2VZ 1F9FA 2ZJRQ 3SDEB 1U1MA 2CPEA 5GAGU 4TU7A 3DLLQ 5ITHA 2VOPA 1FO1A 2QA4S 2M70A 2CQIA 3BS9A 1URNA 2DISA 2KFYA 2O3DA 3CUNA 3NNHA 2LCWA 1FXLA 4IOAQ 1QVGR 3TO8A 4OZ1A 5LSOA 1B7FA 3MOJB 3CC7S 3SDEA 3CCES 1VQMS 2MGZA 2DNQA 2YKAA 1Q82T 2B0GA 3CMAS 3JB9k 2DNHA 2MB0B 1P27B 2CPFA 1WEYA 3CCQS 3THTA 2KU7A 1X4CA 2LQ5A 2I38A 3CCJS 2F3JA 2XB2D 3NNCA 3PIOQ 2MZJA 3UD4P 3CC2S 2RS8A 3K0JA 5HL7Q 2DNGA 3VAFA 1N54B 1M90T 1OPIA 5DDPC 4U67Q 2M52A 2SXLA 1SXLA 1R8PA 3MXHP 1UW4A 1X5SA 1X5PA 1ZZNA 1N8RT 1HA1A 2MJUA 1FHTA 1YIJS 2KVIA 4TU9A 2M88A 2MYFA 2FC8A 1SJRA 5EN1A 3THPA 2MZSA 2YH1A 2RQCA 1KQSR 1UP1A 3SXLA 1VQOS 4FXVA 1BY9A 1U2FA 4TU8A 3RW6A 3US5A 2U2FA 2HGLA 3UWTA 5CA5A 2MGZB 3VAHA 5CYJA 3G96A 2X1AA 3L3CA 1M5PC 3CULA 1X4EA 1OWXA 2OTJS 3P49B 3UCGA 3NNAA 2ZJPQ 4ZKAA 3CCRS 2LA6A 1M5KC 4IOCQ 2XS5A 2MQMA 1WTBA 1XN9A 5DDOC 2KT5A 4PRFA 3G8TA 1NO8A 1WF0A 1DZ5A 2HGNA 4J5OA 1RKJA 2MMYA 5IFMA 2GHPA 2DNNA 2ERRA 3B4MA 1VC6A 1KC8T 3EGNA 4YB1P 1YI2S 3OW2R 2HVZA 1WF1A 2OSQA 1H6KX 3CCUS 1Q7YT 1VBXA 1U1QA 3D2WA 2DGUA 1L3KA 4RU2A 1U6FA 3UCZP 2NZ4A 3R27A 2EVZA 1U1PA 2J76E 1HD1A 2DNPA 1X4FA 1WI8A 1YJNS 1VQ8S 3VAGA 1KD1T 2DGVA 2K3KA 2JRSA 1HD0A 1S72S 2YWKA 3MUMP 2CQBA 3V4MA 1X4GA 2CPDA 4W92B 5IM0A 4FXWA 2HZCA 2DHSA 2LA4A 5CXTA 1P1TA 2DGXA 4LMZA 1YJWS 3CCMS 2RVJA 2MKCA 3B4DA 2LMIA 1VQ9S 2L08A 3NS5A 3DXBA 1JJ2R 1JJHA 2FHOB 2DHAA 2RUGA 2F9DA 2DIVA 2KI2A 1M5OC 2DGQA 3FEYB 1U1RA 5JVHQ 2N82B 3CF5Q 2DHXA 1QVFR 2MQOA 2MKJA 2DITA 4ERDA 2K8GA 2L9WA 2OTLS 3IWNC 2OJ3A 3BO3A 1QM9A 2CQ0A 2DH9A 3TP2A 2CQ4A 2MKHA 4WCEQ 1WG1A 3HI9A 2D9OA 1Q81T 5D78A 2DO0A 3G6ES 2FPHX 2DGWA 5MLCV 2MZ1A 1VBYA 1H2UX 2E5HA 2DB1A 3CPWR 4WFBQ 3BEGB 2QEXS 2MKIA 2XSFA 2PEHA 2AYMA 4EGLA 2DGOA 3P5TL 5IM0B 2DNLA 4PKDB 1X5TA 2M7SA 1VQ5S 2ADCA 1NJIT 3HHNB 4ED5A 2M4MA 1U1NA 1SJFA 2DNKA 5GVQA 3Q2TC 2Q79A 1U1LA 1RK8A 1UFWA 4Y0FA 1OIAA 2EK6A 3MDFA 2KG1A 2KRBA 1VBZA 1S79A 1VQPS 3R1HA 2OIHA 2J0QD 1M5VC 1A9NB 2MJNA 2LYVA 2XNRA 2BZ2A 3G71S 3CTRA 2CQGA 2WBRA 2RU3A 2JVRA 2E5IA 3N9UC 2MPUA 3P3DA 1WEXA 2CQ1A 3CXCR 5GAHU 2XS7A 2AYEA 2DNRA 4CH1A 4V19X 3PIPQ 1JMTA 2CPHA 4TLQA 5GAEU 2QFJA 1YJ9S 2RNEA 1VQ6S 2VODA 2MQPA 2E5GA 1H2TZ 3BO4A 1M1KT 1D9AA 1K73T 3EGZA 5GMKa 3VAJA 2ADBA 3H2UB 2I2YA 2DGTA 2MZTA 2JX2A 2CQHA 4WF9Q 3R1LA 5GADU 2DNOA 4OZ0A 2KXFA 3MD1A 2VONA 5LSLA 1VQLS 2LEBA 1SJ4P 1OO0B 1X5OA 2LEAA 3U1MA 2M8HA 2DK2A 1UAWA 2F9JA 3ULHA 1VQ4S 2FC9A 1KOHA 2MZQA 2CPZA 1O0PA 3VAKA 5DM6Q 4A8XA 3P6YC 3BO2A 2RQ4A 4W90B 1D8ZA 2MKKA 2MQNA 1FT8A 2CQDA 2M8DB 2MHNA 2RRAA 3RW7A 3NMRA 2G1DA 2L41A 1N52B 4WIIA 4LIRA 2G4BA 2FY1A 4PR6A 2MKSA 5BJRA 1WF2A 5LJ3Y
chains in the Genus database with same CATH superfamily
5CABA 2BANB 5LT5A 3UN3A 2AD9A 1GXUA 2Z2MA 2GGPB 1WG5A 2Q1LA 3B54A 2C3YA 3GIIA 1NUEA 4WPAA 2LDIA 3MR5A 2P5VA 4IO1A 4XK8C 4GVLA 4M5JA 5I4MA 1IXKA 2PA3A 1T3NA 3C66A 2O5DA 3DYAB 2FIUA 5DETA 4OI6A 1IKYA 1YG0A 1MG7A 3R5DA 2DVIA 3DLBA 1WKLA 2HRUA 3O2IA 1MROA 2F40A 3GU0A 3FFIA 2XTJP 2DR9A 4JYAJ 3TX0A 2IM3A 4FBTA 2VKZG 2P6TA 3D6TB 3ZZYA 2XHWA 3I96A 3BBCA 1WDDA 3C15A 3AH6A 2JOQA 2DNYA 1ITPA 3MEDB 1QUPA 2HWTA 3PXGa 1VQYA 2GMJA 3Q22A 3SMZA 1ZS6A 3T1YF 2JC0A 4MFBB 1RYRA 2LQBA 4C7QA 2AJFE 2H5IB 1J2VA 3BSAA 4DX6A 2CPXA 5E7OB 1NJXA 1HQ2A 1SVDA 4ZVTB 4QU6A 2NQPA 3CJ8A 3CCVS 3CNQP 5CCLA 5B08A 5KFSA 3A3OB 5IQQA 2N3LA 4I2QB 4Q2LA 3WC2A 2EW9A 1EETB 4M5DB 1JXVA 1RJJA 3UDEA 3X3UA 2HFNA 1AUDA 1SQGA 5DDRC 3JYTB 2FJAB 3KJNB 1RLDA 2RDDA 4DR6F 2EEYA 2YKOA 2GIQA 4JP8A 1VRTB 2DD8S 2YQ1A 5L9XA 3SIPB 2XM3A 3K57A 4YY3J 3V81B 3A8KA 4M5NA 4UUWA 5L1JA 5J2MA 4WZMA 5F8IA 2XYPB 3AB4B 1B7YB 3SI8A 3I56S 3MURP 4DL3A 1LXJA 1LK5A 1Z4UA 2DHHA 2GJ2A 2MSTA 4ECRA 2Q6BA 3RB3A 1W2IA 4JYAF 1OQ3A 2CJXB 3QT5A 5ETVA 5DRKA 4O3RA 1SJ3P 4N56A 4PWDA 3GFXA 4DSLA 1ZM3A 4PG7A 4OX6A 1UMJA 5HMYA 5EX0A 4CQ1A 1NSAA 5BXIA 1XBWA 4GO7X 1FNXH 4ZCIA 1GT8A 1HHQA 4DFMA 2VQEJ 2CWXA 5FDLA 2ZOMA 2DH8A 3T1HF 4ELVA 2COLA 3CMQA 1SKWA 2UUWA 3HKZD 2HHTA 3TNVA 4ED7A 5HROA 4ES1A 3BDEA 2KVQE 3NG8A 3FJ2A 8AT1B 3EDQB 4R5PA 2G0IA 2FJDB 4YHHF 1PGZA 1TL3B 1TMMA 1N5TA 5KFAA 7FD1A 5E3PA 2AZ3A 2Z2LA 2DY9A 3LPYA 2KYXA 5E41A 4B9TA 2CG8A 3K5PA 3UVJB 3DOLA 4MFBA 2DNMA 3M30A 5ETOA 2ZFHA 3MR2A 3GR1A 3DOLB 2J0WA 1FK9A 5IT9Y 2WRMA 3DHXA 4TNOA 5HMZA 4LFAJ 1CVJA 1AB8A 1RQ0A 1FX2A 4CLTA 2PFDA 2W1BA 3M2VA 1GX6A 3TUZC 1HBNB 3OHBA 3L09A 4KIAA 4EYIB 1H3DA 3HVRA 2EI5A 3C6TB 3E8OA 3R5BA 1WHXA 2BJ8A 2RAQA 3KNAA 1ZH5A 2E1AA 2ZDOA 4ETZA 4I1TA 4AXJA 3GCWP 5MAOA 3EXCX 3NGKA 5CD4A 3MR7A 4N5SA 3ZTSA 2DTJA 3S7RA 4WK1A 3BYPA 3T5LA 2IFXA 3JAMY 1BWEA 1TAUA 3HKWA 4ICLA 4JI3J 4MIWA 3LQVA 4ZVPB 3QFWA 2HGMA 5KFIA 5KFBA 1NBEB 5DG8A 2R8IA 1RT6B 2DXDA 4M95A 4DLGA 5J1PA 4JV1A 4NI2B 1GXLA 3KG0A 3LW5C 2HFUA 2HNZB 1K8AT 2HHHJ 3GR0A 2UUAF 4I67A 1F5AA 2QJ3A 1QAJA 2A2CA 2JVOA 4USJC 2H48B 2NPFA 4RNNA 2CJAA 3R2DJ 2N7CA 4ED6A 1HQEA 4HTJA 4IFVB 2C28A 4KO0B 4ZLJA 5FJ4A 4G1QA 3GFYA 4K4TA 3TUJC 4F2SA 2ZD1A 3FEXB 3MM9A 4HEA9 4DR4J 2XI2A 2HHQA 1OSDA 5KFRA 4NA3A 1DAXA 2IVYA 2MY7A 5KAKA 2UVWA 3O8WA 3QO9B 1VRTA 2OKQA 5ETNA 2NXJA 2PSZA 3TWZA 2Y1JA 3K59A 4NMXA 1AYEA 1UW9A 3PR4A 5HLFB 1MROB 5J1NA 1PIEA 1Q5VA 3BGRB 4DV6J 2YQ3A 3A3NB 2HK3A 2W4PA 2HNYB 1HQUA 3FNNA 1HPZB 1X0FA 4JI0F 4MK9A 3M8QB 4X4SA 4NRTA 3HT3A 3EYZA 2VQFJ 3FCHA 2R8HA 2FLLA 4PAAA 1YLXA 1RWNB 2FD2A 1IUJA 4NLRA 1K1QA 1GFWB 3TX8A 4CLFA 5K14A 2IJNA 1FE0A 4N8OA 2D9PA 2DY1A 2W2PP 2RD5C 3BGUA 4DMZA 1RT1A 5A8WB 3VALA 3R2CJ 3TRGA 4Y2AA 2HFVA 4M5KA 4CDIA 5KFEA 3D1QA 3R5AA 1VQKS 1MWZA 4IFVA 4BWMA 1F5CA 1WKKA 1DBDA 3TVZA 1LFPA 2HBQB 1IKXB 3SCLE 2PI4A 2WVDA 3OR2B 4PYAA 2L3MA 1UZHA 1N4LA 3KYLA 5KFZA 1DY3A 2JH3A 1F9FA 1ZM4A 1R0AB 1FFGB 3DOMB 3MAQA 1IBKJ 4ZPBA 1P1LA 3K8VA 1RWKB 1EQMA 2XMKA 1L3VA 3LH2S 1CS4A 2QA4S 1C2PA 3DRSA 2EC0A 4ZPVR 4K5RA 1NCLA 3BYRA 1CJUA 2CQIA 4ZPTR 2NXCA 2DISA 1RCXB 3AQOA 3D1HA 3D28A 2KFYA 1PJ5A 3QGIA 2LCWA 1GXTA 2RB7A 3BKUA 4J9OA 3M1VB 5LSOA 4DV4F 2F65A 4W4MA 3N4WA 4KFBA 3CCES 4DJBA 2HAIA 1FDAA 4ZITA 4ES2A 4DSFA 1JLEA 2A2DA 1Q82T 4JOUA 4KV8B 2B0GA 4WXWA 3LOUA 4RUHA 4OV1A 4ZP7A 4P52A 2DNHA 3C15B 3DLGA 1QE1B 2K2PA 3CCQS 1WEYA 4I69A 2HS3A 1RDRA 4DCOB 5KFHA 4LSZB 4TQRA 1X4CA 3QGPA 2BJ7A 2I38A 3T9NA 3PY8A 4LSLA 4DV2F 4RWXA 1J5OB 3NNCA 1RTHA 4F36A 3CIMA 3AD7C 1SC4B 1SC6A 2R7QA 2HRYA 1UWBA 2HBZB 1RAGB 1CJVA 1RABB 3DMJB 2D3O1 3BKFA 2Z0GA 3RTVA 4ZJLA 3DNCA 5B0GA 3PVXA 2R7XA 3PTWA 4NCGA 3PO4A 2EFOA 4KFBB 1FTRA 2NXUA 4Y2IA 4Q2MA 3K5OA 3BGLA 4PPDA 1FD2A 1OPIA 4Y65A 1WKJA 4TVAB 2IVFB 4PZVA 3EGVA 4U67Q 2LQ9A 1VISA 3KK2B 3T5KA 4I0WA 4DPYA 2R8KA 4H4OA 2R8JA 3ETOA 5HMXA 3DRRA 1WTFA 3R7BB 4D3HA 2IM1A 5L38A 1UPMB 2FJWA 3ZZTA 2DRAA 1I94J 3C3LA 4ECWA 1FHTA 3NMAA 1EQ0A 4HDGA 3UDLA 1TKDA 2M88A 3DLJA 5U47A 3M6XA 3P45B 4F3MA 5EN1A 1YBUA 5L8RC 4IR1A 3UNYA 4LFCJ 2GZOA 2A0FB 2I9SA 1UP1A 4GVBA 4TY8A 3SXLA 4EUVA 2CNLB 4ECXA 3RB4A 4FXVA 3QRRA 3TQ1A 2B5JB 3KUGA 1Q79A 4JI6F 4KJIA 1SQEA 4QWAA 1HI8A 3US5A 2J7KA 2U2FA 1EETA 2HGLA 4R8UA 2Q66A 2PT0A 3OR1A 3L7UA 3G96A 2X1AA 1NMEB 1RLCL 3DLEB 1XR5A 5KFKA 3T3FA 5HLFA 3J7A1 1RT7A 2XMUA 3PYGA 1X4EA 3N01A 3MMBA 1FXRA 4K4YA 2UUAJ 1IWAA 4U7UK 3P49B 1KS2A 3BJYA 1JLFB 1S7IA 4PYDA 3TUPA 4ENOA 4TN2A 4PCQA 2RQKA 4OYIA 4ZKAA 4QYRA 5T14A 2XWYA 3QLHA 3C16B 1M5KC 2XS5A 1NB7A 4GVBB 4FYDA 4ZN1A 2GMHA 1RTZA 4CM0A 3QQCD 4ANCA 3JQJA 5HQMA 3AJDA 3DOMA 3IWNC 5EDWA 1KRPA 3IP0A 4B3TJ 3JQKA 2BKOA 1HNVA 2W8KA 2LDYA 1NPPA 3MMJA 2OJ3A 1S4FA 3KLEB 1NLKL 4NEYA 5CH7B 3GE9A 1H0HB 4Q0BB 5DLGA 3RAXA 4C2MA 4ZVEA 4Q43A 2O01C 3N28A 1VC6A 5KFQA 3W62A 2B7BB 3HZGA 1YI2S 2D69A 5K8NA 3V6KA 4CTAB 1RU2A 3CT9A 2HVZA 2V4JB 2OSQA 4RW4B 4AUKA 2OPSB 1NK0A 1FFWB 1XMQJ 1VBXA 3VTIA 1RBOB 1XMOF 3EPIA 1AW0A 2JSXA 1RT3B 2E5LF 5KG4A 2NZ4A 2B7CB 1CJVB 3DMJA 3D54A 2E66A 1FRMA 1TKZB 2AJ4A 2QSWA 1S1WA 3ADAC 3D67A 4IH5A 2DNPA 3OTDA 4URQU 2G0JA 1VFJA 1WC4A 1VS3A 4WFZA 3TEGA 3QZ7A 4DN9A 1WI8A 1IJFB 3PV8A 2GIFA 2W25A 1YJNS 2J6UA 4IR9A 3FSYA 3B82A 1WC0A 4TLRA 3CW2C 2JRSA 3LA0A 3L9ZA 3MPYA 3PJ9A 1PAUB 2FJXA 4AD6A 2CQBA 1WOSA 2PGCA 3EVOA 4ZLLA 2ZM6F 1HNZJ 1T9UA 1XNQJ 2JFKA 2NUUG 4OZLA 5K20B 1X4GA 2ZWOA 2IY5B 2CPDA 1JLCA 2X3DA 1TL5A 4DPWA 4KHPF 4OV6A 2KYZA 2GIRA 2IHR1 2V50A 5CXTA 4NXNJ 4LMZA 4P2SA 1XMQF 2KFZA 2FHJA 4LVNP 1TVRA 4IOAQ 4GKKJ 1TV6B 3B4DA 3M6UA 1HPZA 2L08A 2AEMA 2XMJA 3KK1B 1RT6A 1U2CA 2HEKA 3DXBA 4RW9A 4F3QA 1XTZA 4YN3B 1CC8A 1PYSB 2Z4PA 2WSEC 3F44A 1JLAB 3M8YA 4ZN3A 3CJSA 2DHAA 4BC7A 4ES3A 2DIVA 3VGSA 4ECTA 1HNIB 1M5OC 1UVIA 1QD1A 2AHOB 3ZFVA 3GB0A 3QGGA 1GMVA 4UT4A 4M63A 2VZ9A 2CYYA 3OVSA 3WQPA 1GQEA 2DHXA 4DHVA 5D6GA 3HJFA 2MQOA 3HVTB 2MKJA 4A8FA 2C2OB 2DITA 5D0GA 2MLZA 4OYPA 2OTLS 1S9FA 1EP4B 1YTYA 1LW2B 3PACA 1ZETA 1P8GA 3FBBA 1QM9A 2AZ1A 3OL7A 2NREA 3CD7A 3TP2A 4ZCMA 3H5YA 2B4UA 4RW7B 3SFUA 4WCEQ 1WG1A 1E6VB 2FGCA 2MQ8A 2Z56B 3G6YA 3TZXA 3MEGA 5KT5A 3VR1A 2HHXA 5F8JA 2QTWA 3T41A 3TVKA 4ER8A 2ZHBA 2FPHX 5ETTA 3KDOA 1RUSA 3D6HB 1UEVA 1BUXA 2MZ1A 1VBYA 1HWLA 1NZAA 3U7JA 2N4DA 1K1SA 2NCKL 3HHDA 1IBLF 3K2YA 1U0HA 3GSIA 1RT7B 4LR9A 2MKIA 4LF6J 1F2HA 1HBOB 4RUCA 3FQKA 3P5TL 3KJVA 4LFCF 2OH2A 1TZ0A 3GONA 4WYLA 4DV5F 4F4WA 1APSA 2M7SA 4QW9A 4RWWA 3OT9A 3Q8VA 1HHSA 4R8UB 2IAJA 9RUBA 4J9VA 4ED5A 2M4MA 1U1NA 4ZPAA 3AD9C 1EP4A 1JLQA 1SH2A 3A3PB 4KT0C 1OIAA 3BPDA 2EK6A 4FVCA 2KG1A 2XMTA 1LWEB 2AWZA 2KRBA 4H54A 1S1WB 4HH0A 3P8BB 5A8RA 4FP9A 3RAMA 4ZJQA 2ZH2A 2E9RX 1CQMA 1V3RA 9ATCB 4A8KA 2J0QD 2RU9A 2XLIA 2OIHA 3PKMA 2Z58B 2F63A 4LBIA 4OHXA 3MWBA 4DQIA 1QAYA 1S12A 3I9ZA 4USMA 3VVUA 3WIVA 2HHWA 1LFWA 5DZ7A 2R7RA 1VCTA 2ASJA 2DJWA 2YX1A 1FKOB 4LSNB 5KFUA 2CQGA 3AD8C 1U6ZA 3O5TB 2RU3A 3CD6S 1F9HA 3A8JA 2RUSA 3N9UC 2YBVA 1SQFA 2IRXA 3CGIA 4DUYF 1SC1B 2QFIA 2MPUA 2RHQB 1TVRB 2BUNA 3P3DA 4OJ1A 3OTOJ 2PI5A 2GJFA 5DZ6A 2CJYB 2CQ1A 4LR8A 2CIMA 3NGUA 4CH1A 3K5MA 4JI8F 1EKRA 4LRBA 1AT1B 1JMTA 3TAPA 2HG4A 4NLOA 2GVDB 5IXUA 3NOCA 4IDKB 3IA0A 3RAQA 3F41A 3AXMA 1TL4A 3LWMA 2BEFA 2XSJB 1IKVA 2LQJA 1FE4A 3BO4A 1FKPA 4B3SJ 3ISNC 1UPPA 2GA7A 3PKYA 3PX6A 3OXLA 4FPRA 4KH1B 4P9SA 3SZ2A 4R25A 3H2UB 3FFIB 4IRDA 5A6WA 2DGTA 2RSQA 5D8HB 1BWVA 3POTA 3QBCA 2CQHA 1N48A 1JK9B 1T9WA 1S4EA 2DNOA 2KXFA 3PCOB 4Z37A 1CQNA 1H38A 2ZBQA 4OQJA 4OJHA 3SSSA 3DGVA 3G87A 4KR0B 2IYGA 4QYZK 3KOAA 4JI2J 3OSNA 3BPSP 5A8KA 3FEZA 5F0UA 4U96A 4I2PA 2UV8G 2E7WA 2M8HA 2VD3A 3UDVA 4EI2A 2E7XA 3IR6B 1TK8A 1KTQA 3VVTA 4RL1A 1X9MA 4A46A 1RB0A 2G13A 2QLBB 4OMFG 5D0RA 3KHLA 1UJ4A 4QR1A 4CYUB 1XJWB 4PWDB 4C8NA 1TL7A 4MYTA 2QRRA 3ISND 3VAKA 1EX8A 1C0UA 2ZVIA 1MMDA 1G3OA 1U24A 3QGHA 3NCQA 4DUTA 2MQNA 4UOHA 1RT5B 1R0BG 1Q0NA 1V5VA 2QMUB 2RMLA 4NYZA 4USIA 4DX5A 4ZA1A 2GV1A 1LOUA 1N52B 3K58A 4H4OB 4DV7J 2EG1A 3QFHA 5DQIA 4E2FB 5KFPA 2QYCA 1OQ6A 3OHAA 3QLHB 4HH1A 4QJVA 3D7SB 4LF4J 4I6WA 4PR6A 1YITS 4M5DA 3DM2B 1S0VA 1RT1B 1RWWB 5A8WA 5EHHA 2ZOFA 4I68A 5LJ3Y 4JI4F 3NGSA 2LP4A 3KHGA 2MQLA 3D5MA 4WP3A 5KT2A 1JJ4A 3MD3A 5A8KB 1UETA 2F8EX 3ETMA 3KDNA 1ZZFA 4F67A 4MH8A 2YTCA 1VLYA 1B4SA 1T3OA 3LO3A 1BXNA 4I4BA 1Q86T 2QG9B 3CJ0A 3OTBA 1UVNA 1OS5A 1EZZB 1WD6A 4HVZA 3AY0A 3ILIA 4PG6A 5B0BA 2U1AA 3G82B 5LXRA 1FRJA 1J5OA 1Q8BA 3AXKA 4NYPA 2KT2A 2KL8A 2X1GA 3N5BA 4ZP9A 4ZLPA 3D6FB 3ILJA 3TAMB 2CPJA 4C0HA 1FRHA 4USUA 3SCKE 2YH0A 5B0AA 1JKHB 2DIUA 2QO3A 5KFNA 5KFDA 3CDWA 5GADI 1GNKA 3NCRA 3Q8RB 3M9MB 1KQFB 5KG2A 4DF4A 2FQQB 5CYQB 4C48A 3J7AN 3LAMA 2HS4A 3Q8QB 2ZD1B 4P74A 4LJMA 3PX0A 1FEHA 4QPTA 2EKYA 1YWXA 2LXIA 1Y11A 2LXUA 2V94A 1XIQA 3BM7A 7FDRA 2IDEA 2XCAA 2G0CA 4DX7A 2ZH3A 1HKAA 2RRBA 2CPIA 3J7YU 3J7ZT 2B51A 2B43A 4OYXA 1FRLA 4FXDA 4F0KA 5ADZA 2W9BA 4RW4A 4EYHB 3SBMA 3NY0A 3M9NB 3RG6A 2XO7A 4HI2A 1PYOB 2XZTB 2W2MP 2W8LA 4IUFA 4QQBA 3W5ZA 1MLAA 4C98A 4DQSA 1FXDA 3LALA 3U1NA 3C6UB 5C24A 4FYVB 2I5JA 2PE8A 3UE2A 4UF4A 1HBUB 5H9FJ 3PW7A 4Q0BA 2JWNA 3CCLS 4BDPA 5I42A 1D9FA 1WSRA 5F8GA 2XMVA 5AXKA 3P4UB 3ILLA 4ZP6A 2KHCA 4HT5A 4H4MB 1ZAVA 2B6AA 3GMGA 4XPEA 4CIOA 3KHRA 2E5JA 2F8HA 5KT7A 1D9DA 1S76D 4OFZA 2B9XA 2EBGA 2KT3A 2AKWB 2FGOA 4NASA 1JXLA 2QSFA 2E1MC 3CD0A 4IQMA 2Y8WA 3EZOA 1KBRA 2KRRA 4YB7A 2APOA 1X60A 3Q8PB 2BDPA 1X4AA 2UUCJ 2R3VA 3HVWA 2HHPA 5J1EB 5H9EK 1S72S 1BGXT 1NK5A 2BRLA 1ZTTA 4JI8J 3BKTA 1PO6A 4O0NA 4TQSA 2BR0A 1LEOA 4KYZA 5F3ZA 1S1TA 3OFFA 2XNQA 2ZH5A 3H5UA 4LQ9A 3DU6A 2HFZA 3RUBL 3TEHB 4ECYA 2D41A 1GX5A 2QL9B 4WJBA 1K0VA 2F7VA 4FN5A 3VQTA 4PUOA 2WCXA 4MIAA 4P7VA 1WEZA 4ZJOA 3R7NB 1IN0A 2VHGA 3MI7X 4MIBA 4PEOA 4F0MA 3ZTPA 5AE1A 2XMWA 3CDAA 5A2QU 3HT0A 3QSYB 4ED3A 4JI7F 3QNWB 3K7RA 3PX4A 4R0EA 3S01A 3HFZB 1YSJA 3MUVP 1YHQS 3TVYA 4KGKA 2CQ3A 3CMES 3EM1A 3HJVA 4R0JA 1QDUB 3RRKA 2B56A 3GZ7A 4JV0A 2OEMA 3PYEA 4AQYF 2HURA 2IDLA 2RE1A 2E1CA 4RR5A 3DRRB 3ENQA 2AEFA 4P72A 4GMKA 1S0OA 3IG1B 5JVGQ 4CNZA 2YWGA 4LRAA 5B0FA 2MZRA 4F4ZA 1AUSL 5F8LA 2CZVC 2GO9A 2W2OP 4J9UE 3TA0A 4BC9A 2MXYA 1N6QB 1DFDA 1PYTA 3H59A 4K0KJ 1KHVA 1FRIA 2OMOA 2XBPA 4QWBA 3BDPA 2FJEB 1N88A 1WELA 2J9CA 4DQQA 2C2EA 3LGHA 1NPKA 2CNKB 2YQ0A 3IGVA 3MUTP 3GCXP 1HWUA 3JTPA 4P6QA 4OL8A 1RZMA 1SB6A 3M8ZA 2BABA 4PXEA 2OPRB 5H1SV 5DQHA 3Q2SC 1Y3KA 3I0SB 2XO6A 1RAFB 4GKJF 4IFYB 2M2BA 1FJEB 1WHYA 2H51B 3H42A 1R3NA 3HHKA 4USWA 2H54B 4NA1A 2BE9B 2B3TB 2C2NA 1S1VA 2MY8A 2ROEA 4FS2A 4MKVA 1YK9A 4I56A 4IRKA 1G6BA 2HLTA 2OD6A 3JSMB 5LM7E 1RYSA 4UZBA 5IT0A 5I3UB 2NS1B 2W9CA 2C22A 2BOPA 5HSPA 3B8HA 2JEGA 1RAEB 1VC5A 5CHCB 2ZE2A 3MM6B 4ZP8A 5C2CA 2DH7A 2LECA 2HNZA 2QIFA 3H98A 4K0KF 5HANA 4YOEA 2FLPA 3TUIC 1IM6A 1VJQA 2KJWA 5DGAA 2IBKA 2PDAA 5HROB 5KFYA 1ELOA 4NLPA 3AJ1A 3CE8A 2V4QA 3DLHA 3UDCA 4J9QA 4ATNA 5HMWA 2EC2A 4AQYJ 1F9EB 3LWLA 3IMQJ 2CQPA 2ZZNA 3KK1A 1MWQA 2GS8A 4PWUA 1NK7A 2ZUAA 1N32J 1RWVB 5HBMA 3C6TA 3AAWB 3CWJA 4FDFA 2M0GB 1RTIB 1SJQA 3NGTA 4NLUA 3BREA 4DV6F 3MOZA 4B3MF 1K9MT 2UV8A 4QIFA 2BJEA 4DL7A 3JSMA 1C1BA 2YKQA 4YEAA 3FSIA 1NKCA 4CCHA 3MM5A 3PZPA 4WTOB 1I51B 4PG4A 2CPEA 5GAGU 3EDRB 5CCMA 4TU7A 4ED4A 5ITHA 4J9PA 2C2RA 2OFHX 2VOPA 2Y3YA 5FLXY 4DR3J 4DF8A 4OX7A 1VK8A 3DI6A 4KB7A 2XY5A 1JLFA 3R6LB 3DI6B 4DL2A 3NNHA 1UFKA 3M8SA 2HHHF 1FXLA 3BB5A 3PDNA 2VFVA 3NKYA 2R42A 1RACB 2C2ZB 4MMOA 3D6MB 3OFGA 3MOJB 3Q89A 1IWGA 2HAFA 3FBCA 3SDEA 2IRYA 1VQMS 3GJSB 4CLZA 4DOZA 4UY85 1NEEA 2ASYA 1NZ8A 2N4CA 1U7LA 3M30B 2Z2YB 3PRVA 5GMEA 4DPXA 5DO2A 1P27B 5IS2A 4CRJA 3DDNA 4DSKA 3FZBA 2BVZA 2HNDB 2KB2A 2KU7A 2LQ5A 1VMBA 3ITHB 3KG1A 3THTA 2OI2A 3AQPA 4QIGA 3PIOQ 3BH7B 1FRXA 1R89A 4U9RA 5IC6B 4EMDA 4NLXA 3UN5A 3KK3B 5JXSA 1SIZA 3UD4P 4IH7A 5LSRA 2HQCA 3M6WA 1FNMA 4B3MJ 5HL7Q 6FDRA 2DNGA 3VAFA 3PO5A 1REGX 4BWJA 1R0AA 5FD1A 2DR8A 1ZPVA 2DCUB 4EFAC 1MMLA 2BA9A 4OYZA 3U02A 1N32F 3ENWA 1H72C 5IV3A 4LFBJ 1JLGB 5J2NB 1YJTA 3GQCA 2M52A 4M94A 1O5JA 3MM6A 1GEHA 2NXNA 2SXLA 1LK7A 1SH0A 2VBXA 1NM2A 4HHUA 4XDDA 2KFNA 3W8GA 2W7OA 3OUYB 1FDNA 4HKQA 1IKWB 1PC4A 1HNVB 1N8RT 4O44B 2H4YB 1YIJS 4IRCA 4AXIA 4QR0A 2MYFA 4LF7J 1TL1B 3MAAB 2BBEA 5CYQA 4DL4A 3V6DA 2DPIA 2R7VA 5H9EJ 4RKUC 3O3LA 2RQCA 4ECVA 3V81A 3V6DB 1QE1A 3LANA 5HP1B 2FTRA 4TYAA 4JI5J 3A8EA 2RF2B 4OYBA 5K8OA 3DXSX 5DGBA 1U2FA 2FUG9 2RQMA 4AL5A 3KLGA 1XMOJ 2WSCC 1SKUB 3IM8A 3IS9A 4X4PA 3HM9A 2AGQA 5CYJA 1KNZA 4X4RA 3SQOP 4AL6A 3L3CA 3EUNA 3C6UA 1TMJA 4OHZA 5C24B 3J80U 1M5PC 1RU1A 4C8YA 4YB6A 1OWXA 3EVWA 2CJBA 1HWIA 1RAOA 4QWEA 4ED1A 2YKNA 1CJKB 1BHNA 1EAYC 1P9QC 3R9LA 1UVJA 4DR6J 1HFEL 1I1GA 4B3RJ 3CCRS 4J9NA 1WTBA 1YJUA 2FHJD 3UR3C 2A18A 3IM9A 1PKUA 3HXMA 2CUYA 3BGFA 2B6AB 4UTGA 5KFWA 3JXOA 4WP8A 3KUEA 3J81U 3I31A 1FVQA 1FJ7A 2AJ1A 2MMYA 5KFCA 5KFXA 2HQGA 1R7IA 2P9EA 4UZCA 3DYAA 4AE5A 1L3SA 1KLNA 4TXSA 2K7JA 3HSDA 1WNEA 3GG1A 3A8IA 5T7LA 4ECUA 1U09A 2HVEA 1FA0A 4WU2A 4CYUA 1KC8T 2X3GA 1FWKA 4OLOA 1DQ8A 3WX4A 5C7PA 4CO4A 3OVAA 2LXFA 3FCVA 3GG0A 4M5GA 3R3TA 1OYDA 1WF1A 1C0TA 1DTTA 2W2QP 2WW4A 3QIPB 1TU0B 4J9SA 2ZBPA 1VHFA 1Q7YT 3DRPA 1U1QA 2QA4G 2BJ1A 3OTEA 2DGUA 5B7WA 1L3KA 2DEIA 1U6FA 3M1VA 4QR2A 4DV4J 2EVZA 4P71A 5F41A 5HJYA 2UXCF 3W65A 3GYNA 2FZGB 4LT6A 3MMAA 1IQZA 3BGRA 2CVEA 3UI3A 1X4FA 1D0EA 2HHSA 1N5VA 1RBAA 2HWHA 1RI7A 2P2CB 2JEJA 2K3KA 1KKHA 3H90A 3GILA 4L3NA 2RRNA 3R97A 3WHIA 1IBKF 1MU2A 2J7WA 3PR5B 2YWKA 5A6PA 3MUMP 2GQ2A 3EMTA 2JEFA 3TZYA 1RHQB 3KLFB 4W92B 3ELHA 1WOPA 2NYIA 2VPZB 2W9AA 2LA4A 4W98A 2DGXA 3D0GE 3ET6A 4L6V3 3FRZA 4O3PA 1YJWS 2NPIA 3IGNA 1PJ6A 4OX9F 1YJRA 3JTNA 1SL1A 5CQGA 3NS5A 4CZCA 1JJ2R 4A8OA 1QTNB 2C1EB 3AB2B 2FHOB 5B09A 3TJ9A 4KC5A 4NLWA 1XR7A 3LF0A 3D1OA 4QW8A 1TUGB 3HD1A 3LP0A 2GW8A 3MPDA 1VBKA 4NWBA 4USKA 4JI0J 2Y1LB 3AOAA 2KI2A 4P75A 4CO3A 1D09B 2DGQA 2V5HG 3FEYB 2RKIA 4EO8A 2VA2A 2JFDA 2J5AA 1T9VA 5JVHQ 5LMNF 1LWEA 4DV5J 2RF2A 2BOAA 4DV0F 2WK4A 1UCNA 2R4FA 4QZVB 1FKPB 2IC3A 5G4DA 3RGIA 2HZVA 3GJRB 4J9MA 1RKIA 3LAKA 1NRKA 1ULRA 1IBLJ 4B3RF 3AA8A 3RRGA 1RADB 4E8UA 4YS2A 5IWAJ 2XMAA 3G82A 2V2QA 3EPGA 2CDRB 2DH9A 2PEBA 2ZC4A 3H2LA 2CQ4A 4M5MA 3OL9A 5E3QA 1N5YB 4RNFA 1FD8A 3FUYA 2WAQD 4CWBA 2C3OA 1DQAA 2WB4A 3ZXWA 4F8RA 4AL7A 1RXOB 4OI2A 2WONA 3WC0A 3NS7B 3I9V9 2JL9A 1U0SA 3IS9B 3W5XA 4LRCA 3KMQA 1H2UX 4RNMA 2E5HA 2DB1A 2V8DA 3QWPA 4WFBQ 1YDLA 2FVSA 1DLOB 2J9DA 1D8YA 2W01A 2PEHA 3DDIA 3IAM9 1RHUB 2DGOA 3A4TA 5IM0B 4B9MA 2ZZMA 4LQ3A 4ZVFA 1IKVB 2HQFA 4X66J 4NE9C 2XLKA 4XAKA 4IG0B 1T9TA 1LW0A 2D7SA 2ADCA 1M5HA 5HP1A 3GP9A 5E33A 1TQLA 3UPFA 1HQEB 1IBMJ 3I4PA 4WU3A 4KTQA 2VFSA 2Q79A 5J2QB 2VASA 3CCTA 1U1LA 4IKAA 1S6UA 2GX8A 1GK8A 2XG8A 4NI2A 4CLUA 1OPZA 3THVA 5HAOA 3W60A 3MZIA 1BE4A 5AJ3F 4DR1F 5EWEA 2W4DA 2XGPA 2EPIA 1Z2LA 1XR6A 2VQFF 1VQPS 3BF4A 2BW2A 3UN2A 4J9KA 2XY7A 1N36F 1N36J 5J2MB 1MWYA 2XCPA 5I3PA 4NXNF 2LYVA 2E9TA 2ZHAA 2XNRA 2NZCA 3G71S 2ZBRA 4EBCA 1JLAA 4Y6IA 1Y00A 2NSBA 1FWLA 3CCZA 6AT1B 1HNZF 2L48A 3HFVA 3OPKA 4U7UD 1IVZA 3GPAA 1S1TB 3HSZA 1IBMF 4JI2F 3UD5A 2HHUA 2BMBA 4U8VA 2H5EA 5GAHU 2XS7A 4DUZJ 4LF8J 2DNRA 2WOMA 1SCJB 1FK9B 3QAEA 3BBBA 5J2PB 4I6AA 2YXLA 3PIPQ 4WWSA 4DS4A 1YJ9S 4HLBA 2RNEA 5C25B 1URRA 4CLWA 2WHOA 2MQPA 3ZZ0A 1VIXA 3M2RA 4X4TA 3OUYA 1KVIA 4FKXA 4O4GA 4ANEA 3M8RA 2CA9A 5CYMA 1RAJA 3M05A 1X9SA 1KVJA 1WC5A 1I3OB 1YRUA 1K73T 1F6TA 1V9OA 5E0OA 1ZTWA 3VAJA 2ADBA 1LKZA 4JI3F 3C14B 4ZVRB 4MAKA 2MZTA 1CEZA 2OEKA 3EZUA 3DKDA 1KP6A 2GVZB 4MKBA 3V5RA 1TUVA 3PJWA 4KGMA 5GADU 2FLNA 2MLYA 1X31C 2FHMA 2ILZA 3LP0B 3MD1A 4OZ0A 3ZTQA 1R8CA 4DCPB 5LSLA 4RU9A 3V4IB 4C8OA 2VONA 5IWAF 5C2GA 4KY3A 2V63A 5FDLB 1T94A 3KMSA 4B9LA 1TAQA 1X5OA 1XNRF 2E1RA 1KHWA 4DUYJ 1UAWA 1B3TA 3MM7B 1NSPA 3PNIA 2RDIA 2F9JA 3ULHA 2UXDF 1SL2A 3F56A 1S59A 3FKBA 4USHA 2IVMA 1RWMB 3DGPB 3TANA 4M8LA 1KOHA 1R27B 3OV7A 1O0PA 3DC2A 4ZMMA 1BLUA 2R7OA 1F0XA 2VG7B 3GV7B 1K0TA 4NZ7A 1D8ZA 2L9DA 1S6PA 2LQ8A 2R7SA 1FT8A 2CQDA 3MEDA 4J9RA 3QYYA 2YKMB 1ICEB 3CB4A 3EE3A 2B4PA 2B9WA 2L41A 4URSA 1Q95G 2OD4A 3OW2R 1ACMB 4JV5F 3DU5A 3MCMA 4C11B 4DZDA 1HYSB 1KQGB 4X4UA 3WBZA 4CO2A 1KQKA 1C1CB 4M5HA 2M9KA 2AJQA 5D3GA 1LV5A 4G65A 1X0PA 1RISA 2VC1A 3BH6B 5CZVA 4YFUA 3SCJE 2VUGA 4LVOP 3R5CA 2YX7A 3C19A 3CCSS 4I7FB 5KFFA 1U45A 2ALYB 2PIIA 2ZNYA 2CG4A 1V3ZA 3EICA 2MSSA 2GCFA 3A13A 3QO9A 4L3KA 1R8AA 2IJRA 2J9DE 3MEEA 5C42A 4U6PA 4K4ZA 1VGYA 4N41A 4YQWA 1S6QA 3HHLA 5ETRA 1XMBA 4IO9Q 2Q43A 2RIJA 4L74A 1N0UA 1R0CB 1TKXA 1GMUA 2BJ9A 2JC1A 3IRWP 4YP3A 4LF6F 2LVWA 3HVTA 2CFXA 1DARA 1NAQA 2DBBA 2Q3PA 3NAHA 3KG4A 5KT3A 2KHDA 2KM8C 2WVCA 5HBMB 1DQ9A 3EWGA 3A1YG 4Q7AA 3U1LA 2KN4A 3VWSA 4NPOA 4F25A 1SUQA 2OSRA 1FWPA 2MLXA 3W9IA 3GV5B 1N34F 1SL0A 3VAIA 1MNEA 2ZH4A 3JSYA 4CLSA 2W7PA 1ZPWX 2YWHA 4DLEA 4JUZA 2C3UA 3S6EA 5L39A 2GQCA 2B4VA 1JJCB 5A0YA 2GGPA 2AJ0A 1PSDA 2MTLA 2WVFA 5KT6A 4IG3A 3PW0A 2ZH7A 4ID5A 3NS6A 2LEPA 1WHWA 4RNHA 1QSLA 1U1KA 4X4NA 1Q53A 1U25A 2C2DA 1JIHA 2YY3A 3DLEA 3I0RB 1GMWA 1RGVA 1B70B 2ZBIA 3MAHA 5LMUF 1Y0HA 3H7HB 5HN0A 4ZPCA 4A8YA 2WB1D 4A8SA 4O3OA 2M3DA 4XO0A 3H40A 2DHGA 4X62F 2XHCA 3KLIA 5SZTA 5F8NA 1SKRA 4LR7A 4Y2MA 2ZUGA 2AMCB 1JXEA 2KJVA 4X4QA 1HBMB 1U2RA 4LSLB 2ABYA 2GO8A 4IOBA 4O3NA 1S48A 3MPUB 2VOOA 3AA9A 3GYGA 3W61A 5A2QY 4UUXA 2VG6A 5G0RB 4DXLA 4DQPA 3ENAA 3H2VE 3J81Y 1F2GA 2OPRA 5IZHA 1IKWA 2YWFA 5SUHA 2VDHA 3IC1A 3RB0A 3K8WA 5LL6d 3ZO7A 2UVVA 2DNZA 3O1LA 3OSPA 3N0VA 4KKOA 3BQ2A 4OHYA 1HARA 2ZH1A 2ASLA 2VFRA 3ZZZA 3MHYA 1KLMA 1BQNB 1RHMB 3P96A 4ZLNA 1HW9A 4LREA 5BYRA 3MPVA 2W9BB 4WFAQ 5B0EA 4G1PA 3MGJA 1VHIA 5GAGI 2CQ2A 1N0VC 1U6BA 4WKRA 4DDFA 3NGRA 3CJ2A 3OXFA 2DGSA 3T1AA 2XS2A 2ZBCA 1OSCA 4QU7A 1L5UA 2VL1A 4X64F 1VC0A 4IG0A 4B9UA 3M32B 2XEXA 4JB8B 5I42B 4N76A 3ITHA 2UXDJ 3SFGA 3TI0A 2K1RB 2QA2A 2ZDPA 2J6SA 4K4XA 4NLTA 1TK0A 2AU0A 3H5SA 3MCNA 1TKXB 2MQQA 2IAJB 2KDOA 1N33F 1CJKA 2FJBB 4WFNQ 1JLEB 4NLGA 2BW7A 2A1BA 2P9GA 5F0WA 3FDSA 1MN9A 2CZ4A 3NWGA 4KKOB 3R5JB 3G4SS 2KKHA 1VQNS 4ALZA 2FDNA 4O4RA 5D4OA 5K5MA 1IR0A 2FYXA 3D66A 2OPQA 3RYLA 4CLKA 2CQCA 3M8QA 2F4FA 3OBIA 5FIIA 3MPWA 1SJ1A 3CJ4A 2OAUA 5LJ5Y 2OFGX 1CJTB 1C0TB 1QAIA 1JQGA 3H25A 2RDJA 2VIHA 2JJ4D 2D3OR 5A0YB 4C8ZA 3V6HA 4EU0A 3W9HA 3B78A 3CJTA 1JKHA 2KG0A 1U1OA 5C5JA 1MSWD 1M1HA 1WI6A 2CVIA 4UY8T 4WIQA 3VF0B 2NLWA 4CP5A 2PMZD 4BBYA 1LWCA 1Y7PA 3CVKA 4G1QB 3QWUA 3ZZPA 5CD4H 1RHRB 2QGFB 4KHMA 3GJQB 1UKUA 2BQ3A 4C8LA 3ZC4A 1VR6A 1G4CA 3UR0A 3E3XA 4O3SA 2CKWA 1FJCA 4CT9A 4LF2A 1TP7A 1HNXF 5GAHI 4KH0B 1AZSA 5H9FK 3LP1A 1G2EA 4JI4J 1BQXA 3I87A 1WHVA 3AOBA 3ILOA 1UZDA 3OTOF 3AODA 2VPYB 3D4JA 5E5NA 5HVGA 5LXYA 4ED0A 1L3UA 4ICLB 1HHTP 4B9NA 2GHWA 4LF5F 4PXDA 3ET6B 1W7WA 2FVCA 4QIVA 2RS2A 1DRZA 4X84A 2BXJA 4DU8A 1T0TV 4DV1J 2XMMA 1QJHA 2EBEA 1MN7A 3PRBA 2F1FA 1X4BA 5IV4A 3ZZRA 1LWFA 3OXGA 3ZNUA 4KRWA 3CJKB 2E44A 1YZ7A 3M2VB 1VRUA 3NBPA 2HIYA 3KJFB 2D3UA 2ROPA 4NYOA 5K8PA 1O6XA 4Y00A 4O4GB 2KM8B 4YHHJ 1H2VZ 1TL1A 3TZWA 1E6YA 2YNFA 3OD2A 3MMAB 4BHQA 2VICA 2ZJRQ 3SDEB 2V6AA 3T19A 3TOQA 3W1YC 1U1MA 3DLLQ 4F2RA 2ZOGA 4OHVA 3H8YA 3PYDA 1FO1A 4Y34A 4QCLA 1RAIB 5BYQA 5D0EA 4EEYA 4HACA 1T95A 2IRUA 3OVBA 3N6LA 4WBFA 1URNA 4QPXA 5ETQA 4LF9J 5KFVA 3T5JA 1CJUB 3CUNA 1EHWA 1X9WA 2UXCJ 1QTMA 1HYSA 2EWHA 1FKOA 2CRLA 3D68A 3Q83A 4LSNA 4E98A 4MT1A 3TO8A 3TARA 1QVGR 2HMIB 4FF4A 3VCDA 2J7UA 4OI3A 5E2QA 2V67A 2OPSA 1EJ7L 5D4NA 3CC7S 2K06A 3AT1B 5LOQA 4CTAA 4DCJB 4LF9F 2IM2A 4U95A 3C14A 2IMWP 4GC6A 1QLNA 2DR6A 5AT1B 4GKJJ 3E51A 3IRXA 1IKXA 2R2SA 4YR0A 3MTKA 5LMUJ 1RTIA 2V69A 4CLLA 3L7OA 1UL3A 3H0PA 2XQCA 3CCJS 1O51A 4NLYA 2V9WA 3N6NA 1EKSA 4NLVA 3KTQA 2B9EA 1GTHA 3KNGA 3TZZA 5BYSA 2KZMA 1VLOA 1S1UB 4TYBA 2O1PA 5DG7A 1RBLA 1S49A 1S77D 1C4CA 3GTYX 3CC2S 1U8WA 2RS8A 3K0JA 3AJ2A 1OYEA 1Z1ZA 3LP2A 1QSYA 5EWGA 3NOGA 4K59A 2YWEA 5DDPC 3POTB 3T6JA 3T1YJ 2OLWA 4JI7J 5BR8F 4DV3J 3FCWA 3MMBB 3H4DA 4ZDNA 3QJPA 1C4AA 1SXLA 2PFFB 2WONB 4C8MA 2HBRB 2Y0BB 3PM9A 1HLWA 1X5SA 1ZA2B 3ZZUA 3G6VA 1CULA 1RWPB 3EVMA 3M4XA 2H4WB 1RAAB 4RW7A 5KG3A 2R2TA 2MJUA 1ZZNA 1UVLA 1OMSA 3CO9A 4O23A 2KVIA 1U47A 3LGMA 1WC3A 2FC8A 1IJEB 1SJRA 3MM5B 3THPA 4CLYA 1VDHA 1UA0A 2HVIA 3CJRA 2HVHA 3W63A 3EZ5A 4OHWA 1CC7A 1VOMA 5DLFA 4G3IA 1HBOA 1YVFA 1BY9A 1MMNA 1LWFB 1TELA 4P73A 4TU8A 2VF3A 1RCOB 3AHPA 3MR3A 1LW0B 1NK9A 3RW6A 4DR4F 2O66A 5D4PA 4UOGA 2MGZB 4ECZA 3BV8A 3W2WB 4QIEA 4DPUA 3GIRA 1S1XB 3EGWB 3Q0AA 1F3FA 1QY7A 3CO0P 3VQSA 4OZNA 4ZOSA 4DU7A 5EX3A 3CULA 2JLGA 2VC0A 2DYAA 2A6MA 3QT7A 4RX6A 1TK5A 3NNAA 4LFBF 2ACYA 2OTJS 1CG2A 1S7HA 2Y9HA 5KG0A 4NEZA 1AZSB 1LW2A 5IT4A 1UJ5A 2XYHB 2MQMA 4RLEA 1XN9A 5DDOC 2KT5A 3I32A 5M2PA 4Y2KA 1X7VA 4PRFA 3J80Y 1NO8A 3R7SB 2LLZA 1DURA 3NEKA 3VHQA 3BSOA 1SI9A 2Q6CA 3KKFA 3M9OB 1WC6A 4ETXA 1SKSA 3MMCA 3T9ZA 1HNIA 4DR7J 4NZ6A 1S10A 3SCIE 5IFMA 2WOMB 2WVEA 1D3WA 5KG6A 3MM8A 1JLBA 2LFVA 1YZ6A 4I7FA 1TL3A 1UFLA 1U0HB 3W66A 3EGNA 2R2RA 4YB1P 2RKIB 3LGNA 3I0SA 1RT2B 1W26A 5IT9U 2V34A 2ALZA 3VV2B 2ZKUA 2UUTA 2QL5B 3IXQA 2R7UA 1TV6A 2ZVSA 1FTCA 3IFEA 3SQGA 2HQIA 4HACB 1AROP 4AT1B 1BQMA 4PXCA 2HVDA 4RU2A 1B0VA 3UCZP 5THWA 3R27A 1S1UA 2IMOA 1I6JA 4IH6A 2AGPA 4EK2A 1U1PA 4FF2A 3SEOA 1N6QA 1LQ9A 1S6PB 2ZM6J 2BJ3A 3DLKB 4USTA 2MHEA 2RH3A 3VZHA 3NGDA 1VQ8S 1YBAA 1ZM2A 3HSJA 4UOCA 1CS4B 4G6VB 2VG5A 4J37A 3VAGA 5J2QA 1KD1T 1FX4A 3MCSA 4HYKA 8ATCB 3QSIA 4JI6J 2ATCB 3HFKA 3PYFA 1HD0A 4H4MA 2GFFA 4MK8A 4F04B 1P9YA 2VBZA 3M32A 4L76A 1LWCB 2QZ8A 3G8QA 5IC4B 5JMNA 1TKTA 3VZIA 4DG1B 3MR6A 4HT7A 2V8GA 3MM7A 4XTTA 1IKYB 1F5BA 2HFSA 3OR2A 4USVA 4Y3CA 1HI0P 5IM0A 1NJZA 1PC5A 2VA3A 1TFWA 1FFSB 3QMQA 2HZCA 3VGVA 2JDJA 1PAEX 4ITSA 4LF4F 3CCMS 2OPPB 2RVJA 2IBOA 2MKCA 3D0HE 4ZVGA 4KGVB 2LMIA 2ZEJA 1XQIA 5E3CA 2GVZA 1VQ9S 1H73A 2BANA 1CPZA 1CJTA 3IBFB 3GIKA 2KZZA 1PBUA 1WC1A 2K3IA 3KLHB 4ED8A 1WUUA 4CI0B 2EXUA 4KQZA 5D3GB 4CM2A 4F4XA 1B99A 1Y9OA 1SV5B 4RNOA 3OLBA 1VJWA 5DQGA 1KDNA 2H65B 1U8SA 1AXQA 1DTTB 2J0XA 2RUGA 3QIPA 4GO5X 4OJ3A 5E3RA 1ZA1B 4RBTA 5KFLA 3WZ0A 3HD2A 1JB0C 2CZ9A 3FRYA 2HIQA 1U1RA 2E29A 4FS1A 5KFJA 1KEKA 1Q8LA 2DR5A 2AEJA 3D3BJ 3N5FA 3HSGA 2L9NA 2C42A 4ERDA 2K8GA 2L9WA 1IBCB 2G4BA 1JX4A 2IJFA 3BO3A 1ZAXA 4RW8A 4MKAA 3IO1A 1N34J 4F4KA 3ZNJ1 1C0UB 5F8HA 1UEKA 1WDTA 3OFEA 2WZ1A 3T5HA 3HI9A 3FBEA 1S9GB 2D9OA 1FCAA 2AJ2A 4WK3A 4Q5VA 3K5LA 4OZ2A 1S99A 4F7VA 1RHJB 5GAEI 4LIWA 4DQRA 2MDAA 2PC6A 3DRPB 2BV3A 1FERA 6FD1A 3G6ES 4F3OA 2B8QA 4NX9A 3IR7B 1S57A 4KGZB 4RBVA 3OR1B 4FF1A 2UVRA 2ZKTA 4OYWA 3CPWR 2B5JA 4ZVHA 2QEXS 3IG1A 5EUHA 2XSFA 2VPXB 2AYMA 2QYGA 2DNLA 2W7AA 1X5TA 4Y28C 4F4AA 3HPOA 4P2FA 1UA1A 2ZH8A 2N7YA 1VQ5S 1N5QA 3KLGB 1ZBTA 3N6MA 4EBDA 1NJIT 2BKNA 1VYAA 4RW6A 3SYZA 3BBFA 3RR7A 5A76A 2CADA 2DNKA 5GVQA 2I8EA 4B17A 1NHVA 2IA6A 4JV5J 1HWKA 3MFIA 1RK8A 2V2KA 4Y0FA 1HW8A 2FY8A 3DLGB 4ED2A 1DLOA 1R8BA 1ZAWA 3A12A 1FEEA 2HFOA 4ZCLA 3F0NA 3KUHA 3KLIB 3R1HA 3UVJA 4ZHRB 5DG9A 1RHKB 2UUBJ 2UUBF 1EARA 2O67A 4IYQA 4HR2A 4EZ6A 1ZOTA 2G2ZA 5L1LA 1KTVA 2BZ2A 4ZCKA 2DXEA 1S9EA 2QV6A 2WVBA 4P2MA 3E2EA 2JVRA 2E5IA 4DPTA 2DT9A 1Q8IA 4WFYA 3ZZOA 4C3LA 4PQAA 5AE2A 3TJ8A 2P8IA 4L72B 1Q8KA 1YJ7A 2LU1A 3I6PA 4KSEB 4A4JA 1AFJA 2AX0A 3F73A 1VIOA 3MCOA 1NXIA 4X4OA 3GV8B 4V19X 3KLVA 2G2YA 4FNIA 4TLQA 5B0DA 1NK6A 2XLJA 1VQ6S 2VODA 4ZK7M 1SUQB 2I1RA 4B3OB 3DOKA 1T05B 3BR9A 2E5GA 4KPYA 1C1BB 2YWWA 1KR4A 4U7CA 3X1LB 1H2TZ 2A10A 3D9BA 1M1KT 3HP6A 3AOCA 4KGXB 4Y2CA 1NSQA 1SV5A 3GFZA 5AXNA 3EGZA 2VG5B 5GMKa 1S0NA 2FVRA 4G1IA 2IIHA 1RSCA 3KLHA 2I2YA 4FBUA 2FB0A 3P5BP 3KK2A 3RBXA 2F8MA 3D0IE 4UW2A 1XERA 3MEEB 1AFIA 4KBIA 3ONQA 2XULA 4LF8F 3J7Z5 1VQLS 1AA1B 1RAHB 1GMWD 3T6BA 3W2WA 2LEBA 4QIWD 1SJ4P 4EBEA 2E9ZA 4ZS6A 3SQGB 2AQ4A 4D3GA 2HNYA 2DK2A 4GC7A 1RWUA 1ZM9A 3Q24A 2QLFB 4DR5J 3CDUA 2X51A 1Y10A 2GJIA 4I6YA 1VQ4S 1UVMA 3MEGB 4OIXA 2R8GA 3R8YA 2MZQA 5DM6Q 5K9FA 4A8XA 2I0XA 1G7CB 5I3UA 2XSJA 4C0BA 2RQ4A 4J9LA 2YNIA 4WE1A 4NA2A 5F9LA 3PW4A 3MM9B 5KG5A 1L3TA 2FJVA 2MKKA 2NSCA 4DR1J 1DTQA 3CJQA 3W8PA 2M8DB 5ETPA 2MHNA 5J2PA 3NBPB 3NMRA 2GNKA 4OI4A 1QUVA 3CDBA 2UVUA 1RA7A 2AT1B 2H5JB 3FGVA 5K8MA 4YDDB 4ZPDA 4LF5J 4OYMA 4LFAF 1RE1B 2MKSA 4ID5B 5BJRA 2V2ZA 2NR0A 3HK2A 1WWHA 5DM7Q 3HHLD 3DM2A 4WTYA 5HO4A 2OPPA 3HMJG 3VAMA 1RT3A 2JLEA 5T7LB 3RJMB 5KFOA 4N8NA 4HHJA 3V4IA 1E6VA 5ETKA 2UUCF 3LTOA 4EO6A 3MM8B 1Q4RA 5M2UA 2HZAA 1RTJB 5KFMA 2J6TA 3BZQA 1W2BR 4K4SA 1K44A 3T1HJ 5ETSA 3TYTA 2AYBA 1K47A 4DFJA 2HKEA 3ZTRA 3U27A 4DV7F 3CC4S 3DHWC 3GIMA 1H98A 3DGPA 2W9CB 2AF6A 3BN7A 5CYMB 4C3MA 4YUDA 1DTQB 3KLEA 1X4HA 2V2VA 1X8DA 3GSDA 4QBUA 2N3OA 1D1UA 2E5LJ 2UP1A 2CNNB 2EFNA 1Y5LB 3EX7B 2ZH9A 1KN6A 2DRBA 1WSVA 5C42B 2DPJA 5DDQC 3I82A 3DN9A 4DFPA 3VGUA 4DR7F 2Z8QA 1BQMB 4DBQA 4X62J 3OL6A 3HVAA 2J8AA 4PWWA 3PHEA 4Q45A 1IQTA 2XC9A 4A47A 3RBDA 4DR5F 4R5PB 1TKZA 4K2XA 3FVYA 1N33J 3GYXB 2Y8YA 1S9EB 1KFDA 2QL7B 4XPCA 2KXNB 2F4VJ 2ZJQQ 2XZDB 5ETMA 2V8PA 1JLCB 4LUBA 1T11A 2EFGA 3G8SA 4NCBA 3RBZA 2BKPA 4ZIWA 1OJ4A 1F60B 3OQ2A 2CJKA 5C25A 4O44A 1REVA 1U02A 2OELA 1VRUB 1KFSA 4YR2A 1RTDA 2DCLA 4Z7CA 4UQGA 1CLFA 2CPYA 3R5GA 5T41A 2AGOA 2ASDA 2H9ZA 4B3OA 4NLQA 4DS5A 2HRTA 1NNDA 2X1FA 1PG5B 2D74B 5RUBA 2J0SD 1T9XA 4Z2XA 4TY9A 2CXEA 4NLDA 3TA2A 2KH9A 4DX8H 4KHRA 1HBUA 3C16A 5F3TA 1T8EA 1RA6A 3NL0A 2Y1IA 2UU9J 1TTHB 3M7VA 2AP6A 2QT7A 3QT6A 5JJBA 3G86A 4MTPA 4WYWA 4ECSA 2BQUA 3UD3P 1NJYA 4I2QA 1UEUA 4K5SA 1HBNA 4OX8A 3ISZA 2J9EA 2QMXA 2G1HA 4ZPWR 3UQSA 4PQUA 3OJUA 4H4KC 3V2UC 3LUYA 1WG4A 1Q1KA 1REVB 2GHVC 2ZWPA 3WX8A 3NCPA 4F02A 1NHKL 2YNHA 4RW8B 1E6YB 2YNFB 3CJ5A 2DO4A 1BD6A 5EGYA 4M1KA 2K7KA 1CULB 4TKTA 1T7PA 4YY3F 5BR8J 4DV3F 4IFYA 2DR7A 4C0OC 2JNJA 3FQLA 4NLSA 5HI7A 4RW6B 2KXHA 2EK1A 4IQXA 2QC3A 3TAMA 3D3CJ 1R6YA 4JV2A 2DXFA 3C8YA 4DR2F 4H4KA 3CDEA 2VBYA 2A6OA 2R9LA 2PO4A 4AYBD 4BLGA 1VRQC 4M5IA 1R6VA 2E7VA 3LP2B 2VB6A 4YMEA 2X1BA 4DV2J 3ENVA 3LPEA 5B0CA 1YKWA 1SH3A 1PJ7A 2V4JA 4QWCA 2POKA 1NU4A 1RWXB 4J7CA 3I55S 3Q8YA 1UVKA 4LBHA 4Q8EA 3RU0A 3G9CA 2AW0A 2VPWB 3HO1A 1R31A 4ILMA 1V3SA 1U26A 4UQTA 5D77A 3I5AA 4K4UA 1B64A 4XDCA 3KK3A 4DSEA 1A7GE 4HI1A 2H3EB 1NH8A 1HL6A 2QN6B 1FI4A 1RTHB 3JTOA 2BE7D 2G2OA 1S6OA 5E3AA 3M8PA 2JLFA 3R6GB 3W7BA 3G6XA 3OLAA 1PCAA 4BS2A 4CH0S 1DHMA 1X4DA 2R2UA 2Y1RI 4JI5F 2I5JB 3WDOA 4HTIA 4DSIA 2VJUA 5KOWA 4DPOA 3UCUP 2HMIA 1KOOA 5HQ8A 1VQ7S 2QX0A 4ANDA 3HHLB 4C4WA 4OJGA 2RT3A 4DUZF 3EJMA 1B0PA 4A8WA 3BN4A 3BSCA 2UXBJ 1FRKA 2YKNB 4EWTA 3UW1A 4O0IA 3MEKA 4MJKA 1YQHA 3QRQA 4ZIVA 3IWLA 2CWKA 3W2VB 4KAIA 2VH7A 2ZH6A 2HYIB 5AXLA 4QWDA 1S5ZA 2HSEB 3K89A 3S8SA 4MKYA 3SSQA 2AYGA 5ETLA 1Y5NB 3EXYA 2I6WA 3NLCA 2JZ5A 1RT2A 2A3JA 3J7YI 4ZVOB 2LKZA 3DRSB 2HS0A 2BYCA 2QLXA 3GWCA 1MU2B 1XNQF 2QE5A 3KFWX 3UFCX 2HK2A 4WFXA 5AJ3J 2YNGB 1HNXJ 1R8HA 3M2UA 4A48A 3BGOP 3FK4A 5AE3A 4YR3A 1XEZA 4I64A 4OZ5A 1FJGJ 2VBWA 2C3PA 2UU9F 3GLJA 4ILRA 3W2VA 2BRKA 4PQUB 1VI7A 4C3KA 5IQ6A 4ZVQB 2M70A 4ID8A 4PG5A 4X66F 4RZRA 3BS9A 4RUBA 4Q44A 2C2KB 3UNGC 1YGYA 3BSNA 1LNQA 1J5EF 4B9SA 2O3DA 2KO1A 1BQNA 4K4WA 4F50A 1F1BB 3FC9A 2EFQA 3HDSA 2YVSA 1NDLA 4OZ1A 2PMWA 1B7FA 4P2XA 2ZZTA 1HQUB 2C3MA 1NH7A 3KLFA 4OZ3A 2HPUA 1Y4ZB 2P6SA 2GAGC 2DNQA 4GRSA 2YKAA 4DI6A 2MGZA 4EZ9A 2R7TA 3QPIA 3KJQB 1UJ6A 2C2MB 2OMLA 4FYYB 3CMAS 2YNGA 3JB9k 3DCAA 5F8MA 3MECB 3I5BA 4DL0C 2MB0B 5HVFA 1JLBB 2B4OA 2CPFA 1OY8A 1P6TA 3B6BA 4FYWB 5IOLA 2FHKA 2CJQA 3W5YA 4C9DA 3H5XA 4HL9A 3MAAA 2F3JA 2HQ3A 4S0MA 1TFYA 1S6QB 3NP5A 4F4YA 2XB2D 4NMLA 2MKYA 2MZJA 4B3TF 4I2PB 1SC3B 4V19J 1H74A 1RP5A 2FZKB 4F26A 2GAHC 2VDIA 2BQRA 3DRXA 4V1Ak 2R7WA 1N54B 3I0RA 1HR0J 4GKKF 2IPOB 1M90T 1YRTA 3KXDA 4N77A 5GMDA 2V4RA 3V6JA 2ZITA 2NXEA 4C8KA 2ZHOA 2HHVA 1ROFA 3GIJA 4ELUA 5KG7A 1R8PA 5D15A 4X64J 4OI0A 3MXHP 4X2BA 2VG6B 2WW8A 2K1RA 1UW4A 4HHHA 1FNOA 4PG8A 1YBTA 1T02A 4OX9J 1QSSA 4LRFA 2VFTA 3M8PB 1X5PA 4OYAA 3MMCB 1HA1A 3QJJA 4CO5A 4KO0A 2XZWA 2F5GA 4TU9A 3HLUA 2D1CA 1HMVB 2VV5A 4WXOA 2MZSA 1TUWA 4U8YA 3PRDA 3PHTA 2YH1A 1KQSR 1XK8A 1VQOS 2G9OA 2ZNZA 2IA0A 1O8BA 4RPFA 1M5SA 3IRXB 3NXZA 4UOFA 2P9CA 3WIUA 1JLGA 2YPZA 4MYUA 1KLMB 3MTJA 1HWJA 3FZ2A 1RTJA 2HQDA 2WBMA 3UWTA 5CA5A 2VQEF 3VAHA 1I94F 3RZAA 1UWAA 5CAAA 3OTCA 1A0OB 2OO4A 1U49A 3PJXA 4WP9A 5EWFA 4NCGB 3BQ0A 4Q8FA 1Z2ZA 3Q23A 1B0TA 3S1TA 4C6AA 1A6LA 3MF5A 3UCGA 2Z2ZA 3NWRA 4P7TA 2ZJPQ 3TR5A 5A8RB 1NB2A 3E01A 1RT4B 2OUGA 4X65F 1Q5YA 1YJVA 4OZJA 5JUMA 3IR5B 4FZVA 1N56A 4QYZJ 2LA6A 2V9KA 4YB5A 4C11A 4IOCQ 2HNDA 2ZE2B 5M2RA 3JSBA 1WOOA 4CO1A 3G8TA 1RTDB 4E0DA 3M2RB 1WF0A 2E1PA 1N5YA 1DZ5A 4NRUA 2XYGB 3ICLA 2HGNA 1Y5IB 2NUHA 2YKMA 2GVDA 3DFEA 4ZVUB 2VKRA 4L75A 4C97A 4DR2J 4DSJA 4J5OA 1RKJA 2JEIA 3IBWA 4NZ0A 4N47A 1S1VB 1M1GA 2GHPA 2DNNA 2RJZA 2CNOB 2D3ZA 1NDCA 1FDDA 2ERRA 3B4MA 4NXMJ 4CO0A 4K8RA 4B02A 2PN6A 1GH8A 2W4CA 5D4LA 4K7QA 2OP5A 3IWXA 4FF3A 5KFTA 3TA1A 4RUAA 2VFUA 4L73A 1VK3A 1Q78A 3HHLC 1NHUA 5KT4A 1H6KX 1KONA 2GMLA 2FLOA 3CCUS 2Z57B 3D2WA 1U4BA 2DEJA 2EKNA 2WSFC 1PILA 3HX9A 3JYTA 3CIZA 2OGUA 4J90A 3NRBA 3PFOA 2J76E 5L46A 3Q8SB 1NK8A 1HD1A 3LP1B 1NDKA 3I5CA 4OYOA 4ZVSB 2XWXA 2PMHA 5KFGA 3Q86A 1RWOB 2QLWA 3C2PA 2DGVA 1TL7B 3NAIA 1OY6A 1M0SA 3JSRA 2V0NA 3V4MA 3DOKB 1T05A 4FNHA 1F3VA 3DDKA 2AX1A 3CD5A 3M2UB 4LRDA 4M5LA 3KJVB 4LF7F 1DJ0A 4FXWA 2BACA 2ZC3A 1NPRA 2DHSA 3CJKA 3TJAA 1P1TA 2MEWA 4B08A 2VJVA 1NK4A 2HBYB 2OHDA 1XWLA 1IM4A 3L7PA 1Q7LB 1NDPA 3IAS9 5L9NA 2J8SA 3HCXA 2BM0A 1RT4A 5D0HA 1V5IB 4RJVA 3QJLA 2BM1A 3CEDA 2EFVA 1KVKA 1HIYA 3W64A 1JJHA 3FSXA 1VQSA 2XGQA 4DV1F 3G2XA 3HHEA 4O3QA 1YX2A 2UZAA 3SV4A 4NXMF 2XI3A 2F4VF 2DRDA 1HI1A 2GQQA 2BE2A 1JNZB 3TW0A 2F9DA 3FMWA 4QOTA 4RBUA 1R43A 1HR0F 3FMBA 4ELTA 4ZHRA 1UTAA 3QATA 2FVQA 5AXMA 3L95X 3QAUA 1Y3JA 4FVMA 5HATA 4CNYA 4NL5A 5J1EA 2N82B 3CF5Q 2IC3B 1QVFR 3K5NA 4N7TA 3RB6A 4TY8B 3H4BA 3RRHA 5F9NA 3MFHA 2PD1A 1NJWA 1XNRJ 1NSKL 2QA1A 3O44A 4WKYA 3KHHA 4X65J 3JS9A 1HMVA 4YDXA 3HULA 5HVHA 3TAQA 2RHSB 1SBRA 1EIYB 2CQ0A 4RW9B 4OI1A 4CH7A 1IR1A 1NKBA 2FVPA 2MKHA 8RUCA 3PW5A 2ROGA 2BJDA 4RO0A 1T03B 1Q81T 4DWIA 4DL6A 1S1XA 5D78A 2DO0A 3QZ8A 5L1IA 1HNWF 1EB0A 3BR8A 2WTFA 2DGWA 3GJTB 5MLCV 1WACA 1TR0A 2HLUA 1MW7A 3CSKA 1N5SA 3BEGB 5DS7A 1Q16B 3HF5A 3RBEA 1J5EJ 4EGLA 3PEHA 3W3SA 5CZXA 4PKDB 4J91A 1SPBP 1S97A 4JI1F 1UWBB 2CJ9A 4DR3F 4B9VA 2YNIB 4WE1B 4AFFA 3HHNB 3IBCB 3PFEA 4FPIA 4F0HA 2W2NP 1JWWA 1SJFA 3KWMA 2V8HA 1SIWB 3Q2TC 5KOXA 3AFGA 1BMQB 5HK4A 1UFWA 5HJXA 3L4BC 2AIRB 3MECA 4NOHA 1G1XA 3MDFA 2X7IA 2YNHB 3E01B 3I4HX 4DN0A 1VBZA 3K17A 1S79A 4PUOB 3QT8A 3C46A 2Y0SD 4MK7A 3M6VA 4KPCA 5FLXU 4A8MP 1M5VC 2AV5A 2OPQB 3OL8A 3O6QA 1A9NB 2MJNA 2CDQA 2FZCB 3FBFA 3BQ1A 4CLPA 1JNRB 1OY9A 1YRXA 3TQEA 3QIDA 3CTRA 4BCAA 4KHPJ 2Z30B 2XY6A 1J27A 2WBRA 4LF1A 5J2NA 1U48A 4ILLA 2IM0A 2NYHA 4CT8A 5KTQA 2ATLA 1WJ9A 2M5YA 3OJSA 4PPZA 2UXBF 2QMWA 5L1KA 1XC9A 2QLJB 1WEXA 1T9YA 3CXCR 2AYEA 3JAMU 5HQLA 1S9GA 3SV3A 1BC6A 1IR2A 4JI1J 2CPHA 5GAEU 3SSRA 2QFJA 2EG2A 2VU5A 1RT5A 4PABA 3HZEA 4DG1A 1LXNA 5KG1A 1ZYQA 1PBAA 3CJ3A 1H7XA 1FDBA 4Z7YA 4KE5A 2BX6A 2H1YA 1D9AA 1JLQB 4B3SF 1HBMA 3CCWA 2OEJA 4URGA 2DKOB 4KV8A 1HNWJ 1KSPA 1GAOA 3DLKA 4P10A 1H7WA 2JX2A 4WF9Q 4DV0J 2CAJA 3R1LA 2YPYA 2BE2B 5K14B 4DEZA 3RR8A 4DFKA 1LWXA 2JHEA 2YX4A 3W9JA 1NKEA 4K50A 1OO0B 1KWMA 2ILYA 4DZ6A 2HW3A 2LEAA 3H20A 7AT1B 1FJGF 3U1MA 4WZQA 2W24A 4OLPA 4IG3B 1C1CA 2V8VA 4LBPA 3PG9A 3VGTA 2RILA 2B8PA 3GFHA 3M8WA 5DJBA 5G0RA 2IYIA 4XIUA 3J81j 5LMNJ 2FC9A 3PW2A 1T03A 4K2JA 3Q8UA 4A8QA 3IN5A 2CPZA 3OFHA 5I3QA 2PA8D 2KTQA 1FF2A 1FESA 1CSJA 3BO2A 2HWIA 4DL5A 3P6YC 2EFPA 1FKAF 4W90B 2V68A 1TKTB 3QRPA 4FYXB 1S0MA 2B9YA 2VG7A 4IDKA 4X4VA 3DRYA 3N79A 4K4VA 2RRAA 1W25A 3RW7A 2G1DA 4FKYA 3ZTOA 1CBKA 4NCAA 3UO0A 2LU2A 4WIIA 1I5OB 2ACMA 1GTEA 2GC8A 3JQMA 2YKPA 4JBCA 4LIRA 1QAXA 1WORA 4HDHA 2FY1A 3PEJA 4PXBA 1V6HA 4ECQA 1WF2A 1FVSA
chains in the Genus database with same CATH topology
2BANB 5LT5A 2AD9A 1GXUA 2Z2MA 2GGPB 1WG5A 2Q1LA 3GIIA 2C3YA 2LDIA 3MR5A 2P5VA 4IO1A 4XK8C 5I4MA 1IXKA 2PA3A 1T3NA 3C66A 2O5DA 3DYAB 2FIUA 5DETA 4OI6A 1IKYA 1YG0A 3R5DA 2DVIA 3DLBA 2HRUA 3O2IA 1MROA 2F40A 2DR9A 3FFIA 2IM3A 4FBTA 2VKZG 2P6TA 3ZZYA 2XHWA 3I96A 3AH6A 2JOQA 2DNYA 3MEDB 1QUPA 2HWTA 3PXGa 1VQYA 2GMJA 3Q22A 3SMZA 3T1YF 2JC0A 4MFBB 1RYRA 2LQBA 4C7QA 2AJFE 1J2VA 3BSAA 2CPXA 5E7OB 1NJXA 4QU6A 2NQPA 3CCVS 5CCLA 5B08A 5KFSA 5IQQA 2N3LA 4I2QB 4Q2LA 3WC2A 2EW9A 1EETB 4M5DB 1RJJA 1AUDA 3X3UA 2HFNA 3JYTB 5DDRC 2FJAB 4DR6F 2YKOA 2GIQA 3K57A 1VRTB 2DD8S 1R0AB 5L9XA 3V81B 4UUWA 5L1JA 5J2MA 4WZMA 5F8IA 3AB4B 3SI8A 3I56S 3MURP 4DL3A 1LXJA 1LK5A 1Z4UA 2GJ2A 2MSTA 4ECRA 3RB3A 2Q6BA 1W2IA 4JYAF 1OQ3A 5DRKA 4O3RA 1SJ3P 4N56A 4PWDA 3GFXA 4DSLA 1ZM3A 4PG7A 4OX6A 1UMJA 5HMYA 5EX0A 4CQ1A 1XBWA 4GO7X 1FNXH 4ZCIA 1GT8A 4DFMA 5FDLA 2ZOMA 2DH8A 3T1HF 4ELVA 2COLA 1SKWA 2UUWA 3HKZD 2HHTA 3TNVA 4ED7A 5HROA 4ES1A 3BDEA 3NG8A 3FJ2A 4R5PA 4YHHF 2FJDB 1PGZA 1TL3B 1N5TA 5KFAA 7FD1A 5E3PA 2Z2LA 3LPYA 2KYXA 5E41A 4B9TA 3K5PA 3DOLA 4MFBA 2DNMA 3M30A 3MR2A 2ZFHA 3GR1A 3DOLB 2J0WA 1FK9A 5IT9Y 2WRMA 3DHXA 4TNOA 5HMZA 1CVJA 1RQ0A 3M2VA 1GX6A 3TUZC 1HBNB 3OHBA 3L09A 4KIAA 4EYIB 1H3DA 3HVRA 2EI5A 3C6TB 3E8OA 3R5BA 1WHXA 3KNAA 1ZH5A 2E1AA 2ZDOA 4ETZA 4I1TA 4AXJA 5MAOA 2UVRA 3EXCX 3NGKA 4N5SA 2DTJA 3S7RA 4WK1A 3T5LA 2IFXA 3JAMY 3HKWA 4ICLA 4MIWA 3LQVA 5DG8A 5KFBA 2HGMA 5KFIA 3PVXA 2R8IA 1BWEA 4M95A 1RT6B 4DLGA 5J1PA 4JV1A 1GXLA 3KG0A 3LW5C 1K8AT 2HNZB 2UUAF 4I67A 3GR0A 1F5AA 1QAJA 2A2CA 2JVOA 4USJC 2NPFA 4RNNA 2CJAA 2N7CA 4ED6A 1HQEA 4HTJA 4IFVB 2C28A 4KO0B 5FJ4A 4G1QA 3GFYA 4K4TA 3TUJC 4F2SA 2ZD1A 3FEXB 3MM9A 4HEA9 2XI2A 2HHQA 1OSDA 5KFRA 4NA3A 1DAXA 2IVYA 2MY7A 5KAKA 2UVWA 3O8WA 3QO9B 1VRTA 2OKQA 2PSZA 2Y1JA 3K59A 3PR4A 1MROB 5J1NA 3BGRB 2YQ3A 3FNNA 2W4PA 2HNYB 1HQUA 1X0FA 1HPZB 4JI0F 4MK9A 3M8QB 4X4SA 4NRTA 3HT3A 3EYZA 2FLLA 3FCHA 2R8HA 2FD2A 4NLRA 1IUJA 1K1QA 3TX8A 5K14A 2IJNA 1FE0A 4N8OA 2D9PA 2RD5C 3BGUA 4DMZA 1RT1A 5A8WB 3VALA 3TRGA 4Y2AA 5KFEA 3D1QA 3R5AA 1VQKS 1MWZA 4IFVA 4BWMA 1F5CA 1DBDA 3TVZA 1LFPA 2PI4A 1IKXB 3SCLE 3OR2B 2L3MA 1N4LA 3KYLA 5KFZA 2JH3A 1F9FA 1ZM4A 3MAQA 4ZPBA 1P1LA 3K8VA 2XMKA 1L3VA 3LH2S 2QA4S 1C2PA 3DRSA 2EC0A 4ZPVR 4K5RA 4ZPTR 2CQIA 3D28A 2DISA 3AQOA 3D1HA 2KFYA 3QGIA 2LCWA 1GXTA 2RB7A 4J9OA 3M1VB 5LSOA 4DV4F 3N4WA 4KFBA 3CCES 4DJBA 2HAIA 1FDAA 4DSFA 4ES2A 1JLEA 2A2DA 1Q82T 4JOUA 4KV8B 2B0GA 4WXWA 3LOUA 4RUHA 4OV1A 4ZP7A 2DNHA 3DLGA 1QE1B 2K2PA 3CCQS 1WEYA 4I69A 2HS3A 1RDRA 5KFHA 4TQRA 1X4CA 3QGPA 3T9NA 2I38A 3PY8A 4LSLA 4DV2F 4RWXA 1J5OB 3NNCA 1RTHA 3CIMA 1SC6A 2R7QA 2HRYA 1UWBA 3DMJB 2R7XA 3RTVA 2Z0GA 3DNCA 5B0GA 4NCGA 3PO4A 2EFOA 4KFBB 1FTRA 2NXUA 4Y2IA 4Q2MA 3K5OA 3BGLA 4PPDA 1OPIA 1FD2A 4Y65A 2IVFB 3KK2B 4U67Q 2LQ9A 3T5KA 4I0WA 2R8KA 4H4OA 2R8JA 3ETOA 5HMXA 3DRRA 1WTFA 4D3HA 2IM1A 5L38A 2FJWA 3ZZTA 2DRAA 3C3LA 4ECWA 1FHTA 3NMAA 4HDGA 3UDLA 1TKDA 2M88A 3DLJA 5U47A 3M6XA 4F3MA 5EN1A 4IR1A 2I9SA 4TY8A 4EUVA 1UP1A 3SXLA 4ECXA 3RB4A 4FXVA 3TQ1A 2B5JB 4JI6F 1Q79A 4KJIA 1SQEA 4QWAA 1HI8A 3US5A 2J7KA 2U2FA 1EETA 2HGLA 4R8UA 2Q66A 2PT0A 3OR1A 3G96A 2X1AA 5KFKA 3T3FA 3DLEB 1XR5A 5HLFA 3J7A1 1RT7A 2XMUA 1X4EA 3N01A 3MMBA 1FXRA 4K4YA 4U7UK 3P49B 1KS2A 3BJYA 1JLFB 4TN2A 4PCQA 2RQKA 4ZKAA 4QYRA 5T14A 2XWYA 3QLHA 1M5KC 2XS5A 4FYDA 1NB7A 2GMHA 3DOMA 5EDWA 1KRPA 1HNVA 2W8KA 2LDYA 3MMJA 1S4FA 3KLEB 5CH7B 3GE9A 1H0HB 4Q0BB 5DLGA 3RAXA 4C2MA 4ZVEA 4Q43A 2O01C 3N28A 1VC6A 5KFQA 2B7BB 3HZGA 1YI2S 3V6KA 5K8NA 4CTAB 3CT9A 2HVZA 2V4JB 2OSQA 4RW4B 4AUKA 2OPSB 1NK0A 1VBXA 3VTIA 1XMOF 3EPIA 1AW0A 2JSXA 1RT3B 2E5LF 5KG4A 2NZ4A 2B7CB 3DMJA 3D54A 2E66A 1FRMA 1TKZB 2AJ4A 2QSWA 1S1WA 4IH5A 4RW9A 4URQU 2DNPA 3OTDA 4ZMMA 1VFJA 1XNQF 3PV8A 1VS3A 4WFZA 4DN9A 1WI8A 1IJFB 1YJNS 4IR9A 2W25A 2J6UA 3FSYA 3B82A 4TLRA 3MPYA 2JRSA 2FJXA 2CQBA 2PGCA 2ZM6F 2JFKA 2NUUG 4OZLA 1X4GA 2CPDA 1JLCA 1TL5A 4KHPF 2KYZA 2GIRA 2IHR1 5CXTA 4LMZA 4P2SA 1XMQF 2KFZA 2FHJA 4LVNP 1TVRA 1TV6B 3B4DA 3M6UA 1HPZA 2L08A 2XMJA 3KK1B 1RT6A 3DXBA 4F3QA 1XTZA 1CC8A 2Z4PA 2WSEC 3F44A 1JLAB 2DHAA 4BC7A 4ES3A 2DIVA 4ECTA 1HNIB 1M5OC 1UVIA 3ZFVA 3GB0A 3QGGA 4M63A 2VZ9A 2CYYA 3OVSA 1GQEA 2DHXA 4DHVA 5D6GA 3HJFA 2MQOA 3HVTB 2MKJA 4A8FA 2DITA 2OTLS 1S9FA 1EP4B 1LW2B 3PACA 1ZETA 1P8GA 1QM9A 3OL7A 2NREA 3CD7A 3TP2A 4ZCMA 3H5YA 2B4UA 4RW7B 3SFUA 4WCEQ 1WG1A 1E6VB 2FGCA 3G6YA 3MEGA 5KT5A 3VR1A 2HHXA 5F8JA 3TVKA 2ZHBA 2FPHX 1UEVA 2MZ1A 1VBYA 1HWLA 1NZAA 3U7JA 2N4DA 1K1SA 3HHDA 1IBLF 3K2YA 1RT7B 2MKIA 1HBOB 4RUCA 3FQKA 3P5TL 3KJVA 4LFCF 2OH2A 1TZ0A 4WYLA 4DV5F 4F4WA 1APSA 2M7SA 4QW9A 4RWWA 4R8UB 1HHSA 2IAJA 4ED5A 2M4MA 1U1NA 4ZPAA 1EP4A 1JLQA 1SH2A 4KT0C 1OIAA