4KGMA

Bacterial trna(his) guanylyltransferase (thg1)-like protein in complex with atp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
238
structure length
230
Chain Sequence
SIGDRMKRYENAYRIKLPERMPVIVRIDGAHFHTYTKGCAKPFDQDLAEAFWETCKYLAQNIMGAKLVYHQSDEISILITNYDKLTTQSWFENNLQKIASVSASMATAKFNEVMREKYPDKPLATFDGRAQVLPQDEVANYFIWRQQDASKNSISMVAQANFPHKQLLNGKDMQDKLMTEKNINWNDLPVWQKRGICIIKEFYRSRWSVDHETPIISKDREYVEQFVYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thg1-like uncharacterized protein
publication title Structural Studies of a Bacterial tRNA(HIS) Guanylyltransferase (Thg1)-Like Protein, with Nucleotide in the Activation and Nucleotidyl Transfer Sites.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Transferase
total genus 72
structure length 230
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04446 Thg1 tRNAHis guanylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kgmA00
5AXMA 3WBZA 5AXKA 3OTEA 3OTDA 4KGKA 4KGMA 3WC0A 3OTCA 5AXLA 3OTBA 5AXNA 3WC2A
chains in the Genus database with same CATH superfamily
3FUYA 4ZJLA 3H90A 3PYFA 3F73A 4B3RF 4LF8J 4USIA 5D3GA 1O6XA 5ETPA 4B3OA 1SUQB 2WVEA 3OT9A 3QT6A 3MPUB 3SSRA 1KHVA 3N79A 4NXMF 4LF9F 3UD5A 3CMAS 3CJ4A 3M2VA 2MKCA 2KZMA 3G2XA 4AFFA 4DX7A 5CYMA 1FNMA 1UKUA 1CJUB 3NS7B 4YMEA 1K1QA 1JLQA 4OYOA 5A8RA 3HJFA 2VICA 1X0PA 1Q7YT 1D1UA 1YJVA 1JLBA 4WP9A 4DWIA 1NHKL 2RT3A 3JTNA 3QJPA 1UVMA 4DQQA 2R7TA 1VRTA 3CCZA 3TUPA 1NM2A 4LR9A 1MWQA 4HL9A 4OQJA 4KE5A 2MQPA 3KFWX 2ZEJA 3PJXA 2N7CA 4MYUA 2DR6A 4NASA 4R0JA 3KK1B 1S1TB 1Z4UA 5L38A 4DQPA 2R7QA 4MKYA 2EKYA 4DJBA 4NCGB 1I1GA 3CCWA 5HMZA 1KNZA 1X4FA 2DTJA 4X65F 4F8RA 8RUCA 2ZDOA 2F9JA 4ZPBA 2E9ZA 3B82A 1KFDA 4ED4A 3PTWA 1U2RA 1REGX 5GMKa 3RR7A 2DNKA 3OJUA 1ACMB 5JVGQ 1X7VA 3H5SA 2IJFA 1HYSB 1TL4A 3AB4B 1DURA 2XGPA 2AEFA 3WHIA 2B7CB 1C1BA 2GJIA 4O4RA 3R5GA 1R8PA 1RUSA 1XMQF 4K0KF 4OJHA 5KFMA 1FKOA 2QC3A 3RB3A 3QGHA 5DQHA 5GADI 3UD3P 3TEHB 4YQWA 2FJDB 1TVRA 2WW8A 1Q78A 3MM6A 2BANA 2UVWA 1RAIB 4CYUA 2EWHA 4J37A 4RW4A 3C3LA 2EFVA 3VVTA 1S99A 3IM9A 2OLWA 4UTGA 4EMDA 1UEKA 1DZ5A 4TLQA 2W2PP 5AJ3J 1U02A 1CJTB 5CAAA 5KFRA 3QRQA 1QUPA 1FXRA 4LVNP 2YXLA 3J7Z5 6FD1A 1U2CA 1EB0A 1KQGB 2WB4A 4OX7A 3HM9A 1WKLA 1RT1A 4QCLA 1PBUA 2PEBA 4A48A 2ZITA 1IWGA 3JTOA 2CXEA 4EFAC 1F3VA 2J9EA 4OZNA 4G1QA 4DL6A 2ASDA 2VA3A 4FZVA 4LRDA 3MM5A 2YNGB 1BD6A 5JVHQ 3HVRA 3I82A 4DR3F 3KK3A 5GAGI 2F65A 4J90A 3UR3C 3RR8A 4ZLNA 2VUGA 2KRRA 4ECVA 1LQ9A 3BN4A 2A6OA 4U96A 3VWSA 2K3KA 1RWPB 3HVTB 3TUJC 2RNEA 4IG0B 2PE8A 3IA0A 2UXDJ 5KFLA 4NZ0A 4DCPB 1WI6A 4CH1A 3IWXA 4AL5A 1VC0A 3G6ES 2LQJA 2E5HA 3I6PA 1EETB 2ZVSA 2RE1A 2XMMA 1IWAA 3OXLA 4RW6A 2KG1A 3KK2A 3TO8A 2I1RA 2KG0A 4DI6A 5HQMA 3BR8A 5IT4A 1H73A 4DR1J 2LEAA 4I67A 1G7CB 2ACYA 3S6EA 1Q82T 3RU0A 2FTRA 4JI3J 3FDSA 2P6TA 3UD4P 4ZCKA 1VQSA 5B0EA 5KFPA 2G9OA 1Q5VA 2DNYA 3GR0A 1FE4A 2ZKTA 1N8RT 1B70B 3DOKA 3J81U 1AROP 4F4AA 4B9TA 1LWEB 1RAAB 1U8WA 1BUXA 1R0AA 3KLHA 1IKYA 4WYLA 4G3IA 4B9MA 4C8NA 3KLIB 2AX0A 4NZ7A 5DLGA 2J0QD 1T9VA 3ZZYA 1B4SA 3V81A 4DQRA 2JEJA 1UWBB 4P2MA 3UNYA 4PG5A 1PIEA 2DGXA 2K06A 1FF2A 1FRLA 5GAHU 1QTNB 1YIJS 3JXOA 4LMZA 3I31A 4DV4J 3G6XA 4OYZA 5F8HA 2WAQD 4WTYA 4M5LA 4K5SA 2KVQE 4PXBA 3BKFA 4F4XA 1AFJA 2CWKA 2BRLA 4DV2J 1GEHA 2J6SA 1S6QA 1C4AA 3A8IA 1NDKA 3J80Y 4AXJA 1D8ZA 1WC3A 3DLEA 2AQ4A 1LV5A 4LFBJ 2AJ4A 1KDNA 3QIPA 1GT8A 1GQEA 5HBMB 5D0HA 3ZTPA 4WWSA 4NA1A 4FYDA 4R25A 2HS3A 2GCFA 1S9GB 1RU2A 1B7FA 4ECUA 4AL6A 3EUNA 1SKUB 3PJWA 2Z2ZA 2I38A 3MXHP 4PWDA 3QRPA 1UPMB 1UFKA 2CPXA 5U47A 1ZAVA 3IGVA 3NNCA 1WC0A 1VQMS 1NSAA 2NSCA 5LMNJ 4AE5A 1LKZA 2HGMA 4X84A 1NK7A 2OAUA 2WHOA 3DDKA 3THTA 5DGAA 2LCWA 2FDNA 2BJ8A 2ZUGA 2JL9A 2OD6A 1ZBTA 4PXDA 3ITHA 1EZZB 1RT6A 1FKAF 4ED5A 3BGLA 4MFBA 3ILLA 5G4DA 1QE1A 2P5VA 2AZ3A 4QQBA 4DZDA 5G0RA 1G4CA 2BJ1A 1UZDA 3DNCA 3K17A 3JS9A 1SKWA 3GIIA 2FC9A 2DEJA 1HLWA 3CJSA 2HVIA 1S12A 1KN6A 5D3GB 3MECA 2KT2A 5I3UB 1N33F 2V34A 4FYVB 4ZVSB 3VAGA 2K3IA 2L9NA 1I94J 1JIHA 2XLIA 2DD8S 4LFAF 1M1GA 5CYMB 1HA1A 4EEYA 3DRXA 3LQVA 2EBGA 3OR2A 5C24B 4A8FA 4NZ6A 3G82B 4CT8A 4M5JA 4QIGA 2A0FB 5A8RB 1J5OB 1OQ3A 1WJ9A 2GW8A 3K2YA 1FERA 5AJ3F 1JLBB 4IFYA 2XC9A 1P9QC 3EGVA 4MIBA 4Q43A 3M1VB 4CTAA 1UPPA 1NLKL 4I2QB 4CP5A 1WHVA 3GPAA 1VBYA 2GQ2A 3X1LB 2YWGA 4NE9C 4DR7J 3ELHA 1X5SA 2RQKA 1UP1A 1PAUB 1HNZJ 1IBKJ 4MTPA 2MDAA 3ET6B 2OPPB 4CLYA 3TWZA 1B0PA 4MAKA 3TNVA 3IAS9 2IA0A 2VU5A 3BPDA 2H1YA 1S59A 2D3OR 1MN9A 3UNGC 5E0OA 4CLWA 4ANCA 3HKWA 1JKHA 5KG4A 2XMWA 1C2PA 3P5BP 1C1BB 3ENVA 2KHDA 5KFSA 2CQIA 3H20A 2DGVA 3EXYA 2GHVC 3T19A 1KRPA 2M5YA 3JSMA 4F67A 3OSPA 4LF7J 1SJFA 4P74A 1JNZB 3I56S 2RIJA 4NLVA 2CPJA 2PO4A 1MMDA 3CPWR 3UW1A 1U1MA 4RW7A 2AX1A 4MKAA 2VIHA 2ROEA 2FHJD 2HFNA 5HO4A 2I8EA 4DR1F 3GYGA 3MTKA 3LAMA 1RA6A 3F0NA 3N4WA 4JI3F 2KHCA 2PA8D 4GKJJ 2OKQA 2VG7B 3PV8A 2VBYA 2A10A 4C3MA 1WACA 2HZVA 2EEYA 5LM7E 2IA6A 1RSCA 1FDDA 3M8QB 4UT4A 2LA4A 3ZZRA 3VQTA 2DNNA 2C2NA 5DG9A 2GNKA 5KG6A 2AJ0A 4F0MA 1R8HA 1DTTA 3BQ0A 1RAHB 1TKZA 2DH7A 4USVA 3MEKA 4JI6F 1JNRB 3M9MB 1NRKA 3AQPA 3CDEA 5B7WA 3ZZZA 4ZLLA 2RF2B 5AXLA 2E1CA 5GMEA 4N77A 4DV4F 1T9UA 1SJ3P 1RHUB 4U7UD 2DYAA 5HLFA 2NPIA 1OO0B 1T9XA 2AEJA 4OHWA 1D09B 3C16A 1HBMB 3KK3B 1YQHA 1RZMA 5HQ8A 1RT7A 3T5KA 3K59A 1Q8LA 1WDDA 5ADZA 4ZP6A 1QVGR 4NLXA 5E2QA 2B8PA 2HWHA 3KMSA 1LNQA 2YKOA 4OJ1A 2K8GA 4ZIWA 4DPYA 1QVFR 1Y4ZB 1ICEB 4P2SA 1LWCA 1TUVA 4QOTA 4A47A 4LFBF 2HMIA 1FJCA 1JLGB 4Z7YA 2GAHC 5KFJA 2DCLA 2XCPA 1S1VB 4WP8A 4RW6B 1IQZA 2KFZA 2DVIA 3M8PA 2W9BB 1FNXH 4KHRA 3DM2A 1NZ8A 2FJXA 2OP5A 3P5TL 2HFSA 2YNFB 2A1BA 2RUGA 3W7BA 2CG4A 4USHA 3DOKB 3MEEA 5LJ5Y 3W8GA 1U48A 1V9OA 2N4CA 4ZPTR 3I55S 5LSOA 5B0CA 3TAQA 2XB2D 5F3ZA 3WQPA 3BSNA 4B3SJ 4IKAA 4U7UK 2GVDA 4DV6J 1OY8A 3V81B 3RG6A 3FBFA 4QIVA 2G0JA 3PKMA 4C8YA 3BR9A 1KR4A 1SIWB 1IKXA 3DOMA 3NNAA 2W9AA 1N5VA 4YB5A 4PKDB 1XBWA 1FK9A 2VONA 3OHAA 2VBZA 3G8TA 1VC5A 4HR2A 1QDUB 1F2HA 3PRDA 1NB7A 2GFFA 5M2RA 1YITS 1S6QB 1C0TA 4A4JA 3BYPA 4I6AA 3CCVS 4ENOA 2AJ1A 2PGCA 1I94F 3TX8A 3AAWB 4KHMA 4KB7A 2Q66A 2QSWA 1AUDA 5KFHA 4OI1A 3QIPB 1MLAA 4OZ0A 3RGIA 1S5ZA 2J0WA 2GX8A 2N3OA 1C1CB 2FHKA 1NK5A 3FCHA 1VOMA 2PN6A 2W1BA 4C8ZA 3C19A 4ECZA 3GFXA 1F2GA 3OFEA 1NJZA 5KFBA 2Y1RI 3R27A 2MSSA 2WBRA 1N48A 4DPTA 3BBCA 3J81j 2A6MA 3LWMA 2CQGA 5HMYA 1TKXA 3WC0A 2UV8A 3PJ9A 2HQCA 2ZNYA 3A3PB 4RUBA 2R7RA 2L41A 3NNHA 4DR7F 2E5GA 4NLPA 3AQOA 5KFQA 2LDIA 3R8YA 5L9XA 3ILOA 4G1IA 3W9IA 3J80U 2JEGA 1HNZF 1U0HA 2M7SA 2VPXB 2AYEA 1S48A 2CPIA 3WDOA 4CO3A 1RTIA 2EFNA 4B9VA 1IR0A 4X64J 1U6FA 3SYZA 4CLSA 1LXJA 1K73T 2PMWA 1YHQS 5G0RB 2CJYB 3VQSA 3MUMP 2Z30B 2UXBJ 4QYRA 4JI7J 2UVUA 2CPDA 1BWVA 2NXJA 3B4DA 1S7HA 1ZTTA 2VG5A 5B08A 5K8MA 1K9MT 1AW0A 3R1HA 1IUJA 4WU2A 3EVWA 3AODA 2JDJA 1Q86T 3NMRA 4ED2A 1KQSR 1T3OA 1SJ1A 4C8KA 2B8QA 4K4SA 1RHRB 4W90B 3NS5A 2ZOGA 3V4IA 3LF0A 2DITA 9RUBA 4JI2J 5T7LB 3NWRA 2JC0A 1TQLA 3TR5A 4AXIA 3U1LA 2GO9A 3QLHA 4LT6A 5IS2A 1JLCA 2EBEA 4QPTA 4IFYB 3RJMB 1JXVA 4DF4A 4OYWA 1UFLA 5JJBA 5D0EA 4KGMA 4NLTA 5E3RA 3JYTA 4ECYA 4TXSA 2J6UA 3CF5Q 1FRIA 1FJEB 2QLJB 4HH0A 4W98A 4F7VA 2DHHA 1GX6A 3TARA 2G0CA 2ZBPA 3I9ZA 3HT0A 3BKUA 5C42A 2OFHX 4XK8C 1RI7A 2NXCA 2W7PA 2XS2A 4D3GA 5M2PA 4U8VA 4B3TJ 3D5MA 4N7TA 5DQGA 3DHWC 1X4HA 3N01A 2YKMA 3FRYA 1EARA 1I5OB 2HIYA 2QMUB 4RNMA 1B99A 4TLRA 2W2QP 3IMQJ 3HD1A 2CQ4A 3M2UA 1O5JA 3QZ7A 3OPKA 2CQPA 1N34F 4YHHJ 1RBLA 2M8HA 3EX7B 3JSMB 1HARA 4C8LA 4ZPWR 1Q5YA 4DL7A 4QYZK 2FGOA 1MNEA 3CSKA 4ID5A 1TK8A 2F4VJ 3TVYA 5ETRA 2HHWA 2MZ1A 1RAOA 5DLFA 2Z58B 1YRTA 4C98A 2KXNB 4PCQA 3ETMA 1UVNA 1D9AA 2RILA 4OFZA 1RTJA 4ILMA 1RJJA 1PYOB 3EWGA 4RBVA 4YB1P 5L9NA 3EYZA 4HT7A 3QWPA 2EFQA 2FVPA 2HBYB 2DGUA 3MM8A 3OR1B 3MM7A 4DLGA 3HX9A 1FJGF 2ZHOA 2DRAA 2W4DA 3UCGA 3CMQA 3O8WA 3H2LA 2XBPA 3F56A 4S0MA 4B3SF 3PFOA 2VG6A 5J2MB 1UJ4A 4ZVFA 3HCXA 3MMBA 4DV6F 1YBTA 1PILA 2DXEA 2CNKB 1SKSA 2G2ZA 4USMA 2B0GA 2LKZA 1C0UB 3A13A 4ZVHA 4ES3A 3PY8A 3KJNB 4KHPF 2BJDA 5HLFB 4XPEA 4KC5A 3RW7A 2XGQA 1N6QB 2KFNA 3V6DB 4ZITA 2POKA 1RT7B 3P45B 4I64A 2XZTB 2P9CA 1KSPA 4RU2A 4ZVEA 3ONQA 3PW2A 4RW8B 3U1NA 1HQUB 1N5QA 1S79A 3PXGa 3D68A 3CD6S 2QN6B 2HMIB 4JI5F 1FA0A 2W2OP 4KR0B 4M1KA 2Z2MA 2C3YA 3D0GE 2IY5B 3D1OA 3N9UC 4MH8A 3NG8A 1VR6A 1WNEA 4CLTA 3LTOA 1BHNA 4Q0BB 2OH2A 2MPUA 2YWHA 2ZC3A 5A6PA 2G1DA 2R3VA 2QT7A 4CT9A 4ZMMA 3MEEB 1N5YB 4JV1A 1RWKB 1WC4A 3M6UA 4O0IA 3EGZA 1FE0A 2GS8A 3QFHA 2MQLA 2Y8YA 3EPGA 2GVDB 5HVFA 4FVMA 1N0UA 2E9RX 2C2RA 1ZAXA 1MROA 3ZZTA 2GO8A 4LR7A 1FX2A 4RBUA 5A76A 3K5PA 1R6VA 3P96A 5SZTA 5KOXA 3ISNC 5FLXY 5THWA 3EZUA 3W5XA 4X64F 2FVRA 4GC7A 5L1IA 3DRYA 3R6GB 2F5GA 1IKXB 3DOMB 4BDPA 3QAEA 4DHVA 2ZH5A 4K4YA 1FEHA 2UXBF 4JI7F 1XNRJ 3JQKA 2DGOA 1X4DA 3K5OA 2DPJA 4UF4A 2LYVA 1LWFB 4DR4J 2YNIB 1T8EA 1U4BA 5KFFA 1ZM4A 4ZHRA 4DLEA 2ZJQQ 3OTEA 1R6YA 2HHSA 4CLFA 1FD8A 1H38A 3LOUA 3PFEA 1FWKA 1E6YA 4WFBQ 5K14B 4I6WA 1B64A 4DX8H 2RSQA 2JH3A 1S9EB 1ZOTA 2XS5A 1Q81T 4RW9A 2DPIA 4JI2F 2NZCA 4KPYA 2CNLB 4NXNJ 2W25A 4FPRA 1PCAA 4KAIA 1HHTP 5HP1A 2HHXA 3BSCA 2W24A 2MKHA 2YH0A 2I5JA 4USTA 1NJXA 4ZJOA 3H4BA 2UV8G 4Y2IA 2MQQA 2QGFB 5I3PA 4HHHA 5EX3A 4L6V3 1HW8A 1Y5IB 5HVGA 4DG1B 2LQBA 2DNRA 2ASJA 3L3CA 4J7CA 2L9WA 3QGPA 1SKRA 2QO3A 5GAEU 4K4VA 3RRGA 3NL0A 3BF4A 1NH7A 1RKIA 2ZVIA 4OYXA 2OELA 4B3TF 1TAUA 1ZAWA 5IC6B 2IYGA 2JVOA 2PC6A 3UR0A 3PYDA 3P6YC 2XY6A 1B3TA 1KOHA 3R3TA 1JMTA 5H9EJ 1S10A 4FF1A 1GMVA 2KXHA 3QO9B 3GSIA 3DXBA 2VG5B 4YHHF 4OI6A 2DXFA 2H4YB 4KO0A 1F9EB 2FGCA 2V4JB 1TL3A 3MEDA 4DL3A 5JXSA 4NI2B 3ZTSA 3WBZA 3OV7A 3MUTP 3TJ9A 2OTJS 3VCDA 5B0AA 2HK3A 2L48A 2F4VF 5M2UA 4RO0A 1RT5B 5IZHA 1IXKA 4AYBD 3Q8QB 2BE9B 4RWWA 4GO7X 2CPEA 2QLBB 4OIXA 3HK2A 5H9FJ 2C2MB 3FBCA 1JJ4A 5RUBA 4WZMA 3CVKA 3K8VA 2COLA 3MR5A 4V1Ak 2DNOA 1TL7B 1UAWA 2V4QA 2ZH2A 1H7WA 3HMJG 1N0VC 3TP2A 2QTWA 3BB5A 4RKUC 3C15A 3FZ2A 2QLXA 3DI6A 4HKQA 1AZSA 4LREA 1APSA 1JXLA 4KPCA 1RTHB 1UMJA 5E3QA 1R43A 3GIKA 3O5TB 2EG2A 2NPFA 5E3AA 2FLNA 5D8HB 4M5NA 2YKMB 3FBEA 1VYAA 1RHQB 1TKTA 3AOAA 4ZP8A 4JV2A 1S6UA 4CO0A 2LLZA 1XNQF 1DQ9A 3SFGA 2CQ0A 3KMQA 2G0IA 3KDOA 3KLEA 2C3PA 5HSPA 1S0MA 4ICLA 3M8RA 1GTEA 1RAJA 5ETKA 1FI4A 4CO1A 2ZHAA 3ISND 2RJZA 3UVJB 4C11B 4C0BA 2JLGA 2DNZA 1KFSA 3ZZUA 3SDEB 4L74A 2E5JA 1SH3A 3HVAA 2W4PA 4FYWB 1VBKA 3HFKA 2FVQA 3H2UB 3CXCR 1P1TA 4DL2A 1WC5A 1BMQB 2DXDA 4YR0A 2KN4A 4DV7J 3L95X 2MY8A 4ZCIA 3WX8A 1YX2A 3VAJA 3MMBB 2HBQB 4URQU 1VMBA 2GQCA 1HNIA 1TV6A 3QJLA 2HNZA 3UCZP 5J2NB 1U6BA 2K1RA 2CIMA 4WTOB 2V8DA 2DRDA 2QZ8A 3BEGB 2CNNB 2F7VA 2APOA 4U7CA 1T94A 1UW9A 4DF8A 1H0HB 3I5AA 4R8UB 1XNRF 3Q23A 2HVDA 4G6VB 2E1MC 5HL7Q 1EAYC 3MMCA 2IFXA 1K47A 1Q8IA 5HROA 4LRBA 2ZFHA 2HNDB 5C25A 4DR4F 2MQOA 3C6TA 4TN2A 4BLGA 2ZD1A 3SZ2A 4DR6J 1NZAA 1DTQA 3GLJA 2BQUA 2M0GB 1OYDA 1RADB 1BQNA 2WVFA 3G8SA 4ZLPA 2EI5A 3DLGA 2RU3A 5AT1B 4IH5A 4KT0C 1OPZA 3D7SB 5DM7Q 2R8HA 1H72C 3OTOF 4DV1J 3FQLA 5KFYA 4RBTA 1FVQA 2MHEA 1V5IB 1YJNS 4NXNF 2DGTA 5BJRA 3QYYA 1SB6A 3HI9A 1VRQC 3SQGA 2HBRB 2QV6A 1YJ7A 3H59A 2IAJA 4KKOA 1U7LA 2G2YA 1RE1B 1GXTA 4HDHA 1BY9A 2E7XA 4OYMA 3SV3A 1NDPA 2J76E 2A2DA 2B5JA 1HIYA 1ZPWX 3RTVA 4H4KC 3PW4A 1Q0NA 3W66A 4QU6A 1JK9B 4FKXA 1YJ9S 1UA0A 4JP8A 4OZ2A 4EU0A 1SUQA 3PHEA 1CEZA 4N76A 1PYTA 5DS7A 2CUYA 2UVVA 4DBQA 3CJ0A 3M9OB 1S76D 2CJBA 2OPQB 2BMBA 3DN9A 2YNHA 3D3CJ 3KUEA 2CPYA 3P4UB 1ELOA 1EX8A 1UFWA 2X3GA 1RWXB 2RUSA 3SCJE 1U1PA 1N36J 2EC0A 2B6AB 2H54B 4PWUA 4OJGA 3L7OA 4C8MA 2BQRA 2DNPA 2WVDA 4W4MA 4DUTA 2RB7A 2ASLA 3K7RA 5IOLA 3QBCA 1WC6A 2ZM6F 3TYTA 5CZVA 1YZ7A 5KFAA 1PG5B 2UUCF 1UVKA 3MCOA 5FLXU 3OFGA 3QSIA 4K4XA 1S1TA 2HVHA 4WIIA 4LR8A 1KHWA 1J27A 4FYXB 2ZH1A 2NYIA 2FJEB 4NCGA 2DHGA 2HKEA 1OWXA 1WKKA 2BM1A 3IRXB 2I5JB 1RWOB 2RD5C 4TQRA 1WOOA 4ECXA 4N8NA 3V2UC 3N28A 1HR0J 1T9YA 4ITSA 4B02A 1M0SA 4IG3B 4OZ5A 4MKVA 4ZVOB 2ABYA 3GFZA 4F2RA 4RR5A 4O44B 3JSYA 4LF5F 1SJQA 2FQQB 2Z2LA 4F25A 2MXYA 1HYSA 4RNOA 4U67Q 3CJ3A 2VFVA 3DYAA 4BWJA 2VQFJ 3CGIA 4DEZA 1U49A 2B43A 1VLYA 4P2XA 1FDAA 1Q8KA 2EFGA 2EW9A 4YS2A 3KJQB 3NEKA 2XSJB 1M5SA 3W2VA 3U1MA 2NXUA 4DS4A 2PEHA 3ZZOA 3HJVA 3M8WA 4DR5J 4WKYA 3RAMA 4E2FB 3AD8C 3DDNA 4ZP9A 2NXEA 3GJTB 2IJRA 4RPFA 3VAIA 1PJ6A 1JJHA 4GMKA 1OSDA 4X4TA 3M2RB 3E01B 1CJTA 4P7TA 2AHOB 1Y7PA 2ZWOA 2JFDA 3NBPB 1RT4A 5KFGA 2ZBCA 4QIEA 4X62J 1S1WB 3K5NA 3PACA 3B6BA 3T5HA 1L3UA 5ETLA 1DAXA 3VGTA 2VD3A 4E8UA 2ZH7A 3R6LB 4KGKA 1Q95G 2BX6A 2V2QA 3AY0A 4WFXA 1N4LA 4ETZA 2CPHA 4DV7F 5HATA 1JQGA 3A3OB 2YNGA 3PNIA 4YOEA 4K59A 4DDFA 3D1HA 4RZRA 3NS6A 2Z0GA 2HWIA 2V9KA 1YJTA 3DI6B 2RQCA 2UUTA 4IQMA 4QJVA 2FC8A 2RKIA 4WZQA 3HVTA 3AD7C 1OY9A 2XZDB 4M5MA 3I87A 4HHJA 2L3MA 4IG0A 4ZCLA 3LPYA 3HHLA 2I6WA 4YFUA 4EBCA 2LXUA 3S01A 2XZWA 1EETA 2GZOA 2BEFA 4GVBA 2MKJA 1DARA 3IRWP 2NREA 1U25A 3KLEB 5K8OA 2N7YA 3DHXA 4ZJQA 3MFIA 1U1QA 2L9DA 4ICLB 1U09A 4OI0A 3SI8A 4WKRA 5D0GA 1UJ5A 3THVA 4EO6A 4LJMA 3EZ5A 2CRLA 4LF6J 2VV5A 5CHCB 2R2SA 2D3O1 2UU9F 2LP4A 4CO4A 2AU0A 2QIFA 2XHCA 3R5DA 3ZNJ1 2XM3A 3KLIA 3MOZA 4UZCA 3NCRA 3KLVA 3I4HX 2ZC4A 4DV1F 1U1NA 2FJAB 1RHJB 2B7BB 4CM2A 4KTQA 3FCVA 4OYAA 1UWBA 1DBDA 1JB0C 2BYCA 5D4PA 2ZHBA 1HMVB 4X66J 1U1OA 1KLMB 4WE1B 2B56A 3TQEA 2MZSA 4Q44A 1H2TZ 1IJEB 3N5BA 2H51B 1RISA 4J9UE 1MMNA 1XIQA 1L3TA 2F4FA 1TMJA 4NYPA 1WOSA 3TZWA 3BM7A 5KFNA 2VPYB 1T11A 5KFDA 1RAFB 4FVCA 2HNZB 3OTCA 2D7SA 4M5KA 2QLWA 3BJYA 3C66A 2V63A 2HHTA 5HK4A 5D4LA 1QJHA 1VQOS 2R8GA 3HSDA 1RWWB 1NU4A 1RLCL 3MMCB 5D78A 2V69A 4FNHA 2GGPB 4DMZA 5HBMA 2EC2A 1NAQA 1N36F 2ZD1B 2VBWA 4MK8A 2ZH6A 3V6JA 4ED7A 4IR1A 1F9HA 3KJFB 3BH6B 2QLFB 4KFBB 1BQNB 2MQNA 4Y6IA 3W2WB 2ASYA 2B9WA 2FD2A 3HFZB 1HNWJ 3L9ZA 1WD6A 4J9MA 1QAJA 3BV8A 1NBEB 1HD0A 3I0RA 1F5AA 3EE3A 4BBYA 2YWFA 4NLOA 2DHXA 2VFRA 4Y2MA 3EJMA 1RYSA 3LALA 1Z2LA 1FKPB 5KFTA 4KGZB 2IAJB 1XR7A 2FZCB 4ZDNA 1ZA2B 2GJ2A 2IDLA 3KYLA 1PO6A 1HR0F 2X1AA 2NSBA 2MHNA 1H2VZ 5IT0A 5K8PA 2X3DA 3TANA 3T1HJ 1RAGB 4M95A 1WUUA 2BKNA 2R7VA 3K89A 4KRWA 2OGUA 4H4KA 5I3UA 3W5ZA 3BPSP 4DL0C 2VZ9A 3NY0A 3OLBA 2LU2A 4LFCJ 2Z56B 2MKKA 4URSA 4H54A 3TQ1A 3T1YJ 3W1YC 1MMLA 5GMDA 2YNHB 2QA1A 3VGVA 3V5RA 5GAHI 1RU1A 4TVAB 2IVFB 4KIAA 3KOAA 4YB6A 3LO3A 5ETMA 1L5UA 5C24A 1SV5A 4DR5F 1ZZNA 3G82A 4YY3J 2ZBIA 3FEZA 1HBNB 1J5OA 1AUSL 2KU7A 4Q7AA 1WG4A 4GC6A 3CJRA 2WTFA 3JSBA 4RNNA 2JEFA 4WPAA 2NQPA 1HHQA 3OTDA 2ZJRQ 1T95A 2DR5A 3UN3A 3OLAA 3M1VA 2AP6A 1GXLA 1CULA 4I2QA 3R5BA 3N5FA 3QT8A 3DLBA 5HJXA 4EK2A 3CCUS 2Y3YA 1IBCB 1NKEA 1VDHA 4H4OB 2V6AA 1NSKL 3CJKB 3M8YA 2HRYA 3MPYA 2HLTA 2Y9HA 3POTA 2XLKA 1PJ5A 1NSPA 2OI2A 3ET6A 2OPPA 4AUKA 1ZPVA 4OJ3A 2DB1A 2ROGA 3DLJA 1T7PA 1NCLA 2IHR1 1RABB 1HHSA 5CQGA 1CQMA 4IR9A 4PUOB 2GMHA 1S6PB 2FIUA 2BJ9A 1MW7A 5CD4H 4CDIA 4X4QA 1BWEA 3DYAB 4F2SA 1P6TA 3PVXA 1UTAA 2W8LA 2FVSA 2BJEA 1X4CA 2L08A 5ETNA 1RT3B 2LQ5A 4WFAQ 5E3CA 3MR3A 3BQ2A 2C3MA 4H4MB 3W2VB 3H5UA 2PFDA 1TELA 3ICLA 3I0SA 3NGDA 2AW0A 3R7NB 4KBIA 3SBMA 3MD1A 5IM0A 4NWBA 2GMLA 1ZM9A 4DL4A 4NMXA 3KXDA 1DRZA 3MI7X 4LF4J 2VG7A 1GMWD 4LF6F 3FSYA 1RT4B 3FMWA 3M8QA 4DUYJ 2XMJA 4I2PA 2IIHA 4C97A 4OLPA 2FLPA 3RAXA 1NJIT 4NPOA 1QAIA 3L7PA 1WG1A 3CJ5A 2WRMA 2EK6A 1LFWA 4UQGA 1I6JA 2R2UA 4F3QA 2RF2A 1YBAA 4YR2A 2AIRB 4DV0J 2E1AA 4M94A 1HBMA 1RWNB 4EI2A 2YQ3A 1CJVB 2HQIA 2W2NP 1UEUA 4DPWA 3CC2S 1RGVA 4J9PA 4UOGA 4DSJA 3VZIA 2RKIB 2XG8A 4ZK7M 4GKKJ 4QBUA 1A6LA 3EVMA 2AGQA 4U6PA 2LQ8A 4OX9J 1VQ5S 2XI3A 3GIRA 3HHLB 1HWLA 3MHYA 2JEIA 4K7QA 3R7BB 3KNGA 1NK8A 4GVBB 1NO8A 2C22A 3M6XA 1JLGA 4DPUA 1DLOB 1EKSA 4OHXA 1S1VA 1IJFB 1UETA 5B0BA 1H6KX 3ADAC 3BGRB 1OYEA 3QQCD 2W9BA 2DGQA 2OMLA 4DCOB 3CIMA 2BM0A 1S0OA 2QL5B 1HWKA 3N0VA 4LSLB 1E6VB 2JC1A 2KRBA 5ITHA 2YNFA 2OEJA 1N54B 1GK8A 1FRJA 3HO1A 3OSNA 5CCLA 4M5HA 2MTLA 1EP4A 2G1HA 2R7UA 4XDDA 1DJ0A 3ILJA 2IMWP 1HPZB 4KJIA 3R2DJ 2VODA 2U1AA 3MR2A 4WFNQ 4ES1A 2MQMA 1R7IA 3M4XA 1W2IA 2YKPA 2C3UA 3SSSA 2CQ2A 3E3XA 3MAQA 2XY5A 4R0EA 3MUVP 4B3MF 1K0TA 1CLFA 4NCBA 4NOHA 3UN5A 1S0NA 2XHWA 2GC8A 4BC9A 4HHUA 4I7FA 2VKRA 1CS4A 3NCQA 1U8SA 1KQFB 3OBIA 1OJ4A 1SL2A 4KY3A 1P8GA 1YGYA 2XS7A 3R1LA 1SL0A 1FESA 2Y1LB 1NUEA 2J7UA 2MY7A 3RRKA 1HWJA 3T1HF 2IC3B 1RAEB 4LF8F 4WBFA 2OSRA 4EUVA 2DH8A 4EWTA 2DNMA 2O3DA 2VASA 2NZ4A 3H2VE 3V4MA 2NYHA 3BBBA 2RS2A 1FNOA 1VQPS 3JB9k 3K5LA 2XI2A 1LWXA 5CABA 3T1YF 5JUMA 3GG0A 1J2VA 3CJ8A 2RQMA 4K8RA 4QWAA 2HRUA 4QWBA 1C1CA 4ZN1A 5HN0A 2DNQA 1UZHA 1HNVB 4ZVGA 4YY3F 4CZCA 3CD5A 2MJNA 1OQ6A 3QPIA 4L76A 2CJAA 2ZE2B 4L3KA 2Q43A 8AT1B 3C6UB 1CBKA 2BVZA 4UOCA 3HHKA 4I4BA 3PIOQ 4IUFA 2K2PA 3PYGA 2OFGX 3Q22A 5DZ7A 1V6HA 1VRUB 1XEZA 3I0RB 1O8BA 2OIHA 2UUAJ 2UZAA 1Z1ZA 3K0JA 1HFEL 3R5CA 3CDBA 2CVEA 4J9NA 1IBLJ 5DDPC 4KH0B 3C2PA 4J9VA 3HSJA 1T9WA 1Y9OA 2M9KA 2ZH9A 5DDRC 5F3TA 1YRUA 2FHOB 3KHHA 1QM9A 4DV3J 3VV2B 1YDLA 3H4DA 5EWFA 1VQLS 3IC1A 1S1XA 5KG5A 4OV1A 4ILRA 2FJBB 2GIFA 2J6TA 1FJ7A 2EK1A 4C7QA 2BXJA 5KOWA 2VDHA 1P27B 5D6GA 2HFOA 1VJQA 1VQ7S 1CC7A 2R7SA 4CI0B 3CCTA 2KH9A 3ZTQA 1RQ0A 1Y00A 3IBFB 3TAMA 2V2VA 3G87A 5D4OA 1ZH5A 4NLRA 4LBIA 1YRXA 4IFVA 4DPOA 2QSFA 1WHWA 1SV5B 2R9LA 2GJFA 2OTLS 5H9FK 4PRFA 5LMUJ 2U2FA 4PQAA 4PABA 4C2MA 4JV5J 2C2ZB 2GIQA 3FEYB 4QR0A 3BO2A 6AT1B 5T7LA 4IH7A 2OPRB 2ZBQA 1S4EA 2K7JA 4LRCA 5J1EB 4F4KA 1RP5A 1CULB 2RAQA 4DUYF 5J2PA 3GFHA 2HHQA 3DOLB 4E0DA 2CJQA 4FNIA 1SPBP 5C2GA 4CQ1A 3RBZA 2PFFB 3UQSA 1F6TA 5KFIA 2P8IA 2QMXA 3BGOP 1PKUA 3IR7B 5A8WB 3POTB 1EIYB 2HHHJ 4K4ZA 3PRBA 1C4CA 1FT8A 2DGSA 4WYWA 3J7YU 4J9LA 2FUG9 3DCAA 2PSZA 3J7A1 3W8PA 5EWEA 2KVIA 5C2CA 4DV0F 3FMBA 2V94A 4J9KA 1YWXA 5ETQA 4C6AA 4Q8FA 4FXVA 3W9HA 4ETXA 3T5JA 4IH6A 2XEXA 1SQEA 3LPEA 4Y28C 2C28A 4A8WA 2QMWA 1X5TA 4QR1A 2XMTA 4C0OC 4GKKF 3HHDA 4DCJB 2UXDF 3D66A 3RB4A 2P9EA 1QD1A 2XNRA 3D0HE 3KUHA 1HWUA 3I0SB 4LSZB 4G65A 3OL7A 1S4FA 5FDLB 2R7WA 2YWKA 1UVIA 5IM0B 3Q8VA 3MMAB 5F8LA 2OEMA 1FCAA 3DFEA 2BKOA 5K5MA 5KFZA 3PEHA 1CPZA 1DFDA 4K0KJ 3D4JA 3A8EA 3KHRA 2I2YA 3OR1A 2CQ3A 4I2PB 3SCLE 4OZLA 2G4BA 1SIZA 3MURP 2KB2A 4FN5A 4O3PA 2DO4A 1R3NA 5J2MA 3UCUP 5A8KB 2DR9A 1YJRA 3MPWA 1C0UA 3KTQA 4C9DA 1KTVA 2D69A 4NEYA 2RVJA 4O3OA 3OUYA 4DFMA 1N6QA 5F9NA 3MWBA 2J0SD 4QYZJ 3V6DA 4Y2CA 4ANDA 1UL3A 4X4SA 3ZZPA 4HI1A 3DU6A 2V9WA 3SXLA 3MCSA 1HI8A 3NCPA 3EZOA 3TVKA 5EX0A 4WJBA 4DV2F 3KDNA 4RW8A 1HQUA 4LQ9A 1RTZA 1TL1B 4NX9A 3KUGA 2E1RA 2YPZA 1U45A 4I68A 3GILA 3PKYA 1SJRA 2IJNA 5EGYA 1SQFA 4URGA 2YKNB 2HNYA 2BJ7A 1PBAA 2ZZNA 5EDWA 1TZ0A 1G2EA 4N8OA 4Q0BA 3QGGA 2CG8A 4PQUB 2ALZA 3GE9A 5DZ6A 3H8YA 4HH1A 1K0VA 4ZPVR 3H25A 2RDDA 5KG7A 1N5YA 3MEGA 4K50A 1EP4B 2MLYA 1FWLA 3PEJA 1Q16B 1S6OA 2ZBRA 1YZ6A 1IR2A 1DHMA 3CCMS 5LMNF 1I51B 1WEXA 4WXWA 4AQYJ 4I0WA 2HAIA 2KFYA 2B4UA 4J9RA 2C2DA 5A2QY 3MAAB 1IBLF 2V8VA 3PW7A 4AT1B 2XY7A 4I7FB 3EGWB 3MF5A 1CS4B 4WIQA 1T03A 4A8YA 1R0CB 4DV3F 1NPKA 3TRGA 1HL6A 2J5AA 2RDJA 1XR5A 4N5SA 4L73A 4P7VA 4OYIA 5KFVA 3MD3A 3DRSB 1SH0A 2KT5A 7FD1A 4WK3A 2AKWB 2XMKA 4Q5VA 3G86A 1LWFA 3O2IA 4CLPA 2D3ZA 2YNIA 4B9LA 2B51A 4LIRA 1NDCA 2DR8A 2HHPA 2H5IB 3DMJA 3RAQA 1TFWA 4I56A 1M5KC 2ADCA 1D3WA 1HI0P 4USUA 2BE2A 5K14A 5F8GA 1O51A 2N3LA 3THPA 1O0PA 5DDOC 5IFMA 5IT9Y 5LMUF 5IWAJ 4P2FA 1S9EA 5KT3A 4F4YA 4JV5F 3BQ1A 1UJ6A 3Q8YA 4LUBA 4BS2A 3SQOP 3WX4A 3WIUA 2QX0A 2J8AA 5T41A 4K4UA 4F0HA 3S1TA 3BYRA 5K9FA 1HKAA 2VL1A 2G13A 1BQMB 3HHNB 3Q8RB 2BQ3A 2MB0B 1YJWS 3JAMY 1VIOA 3M8ZA 4DG1A 4MKBA 2HFZA 4P52A 2XQCA 3KJVB 5ETSA 2UUWA 2LXIA 1IBKF 2HHHF 3LP2B 1VQNS 1BXNA 1VK3A 1WF1A 1TAQA 4P10A 3AJ2A 4C4WA 1JLAA 2IMOA 3VAHA 1ZM2A 5CYQB 2DH9A 3G6YA 3U02A 1S1XB 1T05B 1D0EA 1RTDB 2Q1LA 3QO9A 2DBBA 2QA4G 4EGLA 4TY8A 2YBVA 1MU2A 5KG1A 1OMSA 5LSLA 5EN1A 3QFWA 2JX2A 3H98A 2H65B 2E1PA 1BLUA 3NGRA 2V4JA 4LF7F 1W2BR 4OZ3A 5D4NA 3TAMB 4NI2A 4QIWD 3A12A 3MR6A 3IWLA 2F9DA 2CQHA 2WSCC 4IFVB 1J5EJ 1JJCB 1WWHA 1RT5A 2KXFA 3K5MA 3FK4A 3IM8A 5L1LA 4GKJF 1FWPA 3LWLA 1N33J 1DQAA 4ZPAA 2X1BA 2MZQA 3LGNA 3JQMA 3DLKB 2JLFA 4O3SA 3KWMA 4N56A 2HGLA 2HK2A 1K1SA 4ALZA 5J2PB 2IBOA 2F63A 1TL7A 2Z4PA 4LFAJ 3NOCA 1ZM3A 4YN3B 1WHXA 3T6JA 1LOUA 2GQQA 3N6MA 2ZZTA 2E44A 2AZ1A 2BZ2A 4E98A 1NKCA 1QSYA 2R2RA 3DGPB 3AHPA 3PX4A 4O4GA 1RTHA 4DSLA 2XMUA 3K58A 4TU9A 3TOQA 2LU1A 4RX6A 2QEXS 1JLFB 2D1CA 2GVZB 2YWWA 3EDQB 3C46A 5KG0A 2YY3A 4ED6A 2HGNA 4F0KA 1WG5A 3HVWA 4Y65A 1VQYA 2MGZB 1KEKA 1YK9A 5F8IA 2C42A 3O1LA 3AH6A 4X4VA 5A0YB 1PJ7A 4XIUA 2KM8C 1F3FA 1Y11A 3LGMA 4RNHA 3M30B 2BABA 3AXMA 4AD6A 4BCAA 1RDRA 4QW8A 5GAEI 2D74B 3HF5A 3D6TB 3UVJA 1XMBA 4C11A 5EWGA 1LEOA 4KH1B 2LEBA 1U47A 1VQ9S 2W9CB 4ECTA 3S8SA 2DNGA 4MJKA 3SDEA 1XJWB 1IKWB 1U1KA 1PGZA 2V67A 1WSRA 2DK2A 1LW0B 4R5PB 5KFUA 4LBHA 3KLGA 2W2MP 3MGJA 1FFGB 4A8MP 2B4VA 4K2XA 2R7OA 2DIVA 4TKTA 3GU0A 4X4RA 3W60A 2R8IA 2AYBA 1TK0A 4Q2MA 3TZXA 3CO9A 3WIVA 1F5CA 5E5NA 1TUGB 5HMXA 1EHWA 4WK1A 5KTQA 2JHEA 2CZVC 4F4ZA 3BSAA 1EJ7L 4AQYF 2J0XA 1EQ0A 2KTQA 1VCTA 3D54A 3ZFVA 4IRCA 4PG7A 2QFIA 2NS1B 5J2NA 4MYTA 2NCKL 3TZYA 2GHPA 1HI1A 4B08A 8ATCB 3ENQA 3SMZA 1Y3JA 1SCJB 3GYNA 2WOMB 1KKHA 1S7IA 3OUYB 2AF6A 1LW2B 1YVFA 2C2EA 1HQEB 2BACA 4DV5J 2HQ3A 2Q6CA 2XULA 3D67A 1D8YA 1FHTA 3LA0A 4QW9A 4TYBA 3EXCX 5CA5A 3T5LA 5KG2A 4R8UA 3M6VA 1R89A 1HBOB 1ZETA 2VF3A 2KYZA 4HYKA 2DT9A 5IQ6A 1X5PA 2HNDA 4JI6J 1JLEA 1SC1B 2DNHA 2RHQB 2HVZA 1EQMA 4KV8A 3T9NA 1RT2B 3LUYA 4RUAA 4V19X 1S9FA 1H74A 4FS2A 3MCMA 4B9UA 1YJUA 2DNLA 3MM9B 2H3EB 4I6YA 3GG1A 5JMNA 3QWUA 4QZVB 4USKA 2A18A 2HNYB 2KKHA 2O01C 5A6WA 2YWEA 2PI5A 3C14B 2SXLA 2Q6BA 1FDNA 5IWAF 3TA0A 2R7XA 1GX5A 4F02A 2CAJA 4PG4A 3US5A 4LF1A 1PYSB 3O3LA 3CJQA 5AXMA 3LP1B 1EKRA 1P9YA 3GSDA 4ER8A 3T3FA 1S72S 2ILZA 3MEGB 3GFYA 2VJVA 3IBWA 4C8OA 2W7AA 4NRUA 3EPIA 3EM1A 3NAIA 4CIOA 2E9TA 1ZA1B 1A7GE 2LDYA 4WF9Q 4NLYA 2JVRA 3CCRS 1M5HA 3RB0A 4ZKAA 2C2KB 2ALYB 2F8MA 3RRHA 1S77D 2BJ3A 3M8SA 4HACB 2B4OA 3CCQS 3U27A 5I42A 3PX0A 2VA2A 3CCLS 2AYGA 3OD2A 2AJ2A 3FCWA 4ZP7A 5KFWA 2UP1A 1T03B 2NXNA 2Q3PA 1V5VA 1NHVA 5K8NA 5L46A 2OPQA 1FRXA 3FQKA 3CCES 1GTHA 3UE2A 4X4OA 3CB4A 1RCOB 5GADU 5CD4A 2B6AA 1MSWD 1H2UX 4FBTA 2DHSA 2QG9B 1TP7A 3NOGA 2ZH4A 2UXCJ 1S1UB 1VISA 5KFOA 2JJ4D 3DMJB 4OHYA 3Q86A 3T41A 4YP3A 3QMQA 4JV0A 1MN7A 1WKJA 2LECA 5HANA 2BE2B 3IO1A 1J5EF 4A46A 1NNDA 3GYXB 5A2QU 4FP9A 4XTTA 2AGOA 4U9RA 4IOCQ 2YX1A 3W63A 4B3OB 1Q79A 1RBOB 4DSFA 2XYPB 4OL8A 2CJKA 5E41A 2CFXA 1AFIA 2MZJA 3HKZD 3CE8A 3OL8A 4K4TA 2GIRA 3GJRB 3IRXA 3CIZA 4Y0FA 1ITPA 3M2VB 2ZOFA 3NGSA 1IN0A 3HDSA 3M6WA 3CJTA 4DN9A 4U95A 1GNKA 5F41A 3SCIE 2E5IA 3OFFA 4IG3A 4OZ1A 3C8YA 5KT5A 3TUIC 4O44A 1Q53A 1JLQB 4B17A 3KHLA 3GQCA 5F8NA 4NL5A 2VOPA 4DPXA 1VS3A 1LFPA 3L4BC 3R7SB 3D6FB 5GAGU 1TR0A 3ZTOA 1JLAB 2F1FA 4Q45A 1WTBA 1VRTB 2W8KA 1K8AT 5IT9U 3FSXA 3MOJB 2XSJA 1VI7A 4CO2A 5AXKA 4NA2A 1WOPA 2QA2A 4DOZA 4Y2AA 3TA1A 4TY8B 2YH1A 1MU2B 1VJWA 4EYHB 3FGVA 3SV4A 1JWWA 3M2RA 3AXKA 3E01A 3FFIA 3RZAA 3R5JB 3NBPA 2B4PA 3JAMU 4D3HA 1YKWA 1S1WA 4RL1A 3QT7A 3IR6B 3UO0A 4DFPA 2IDEA 3UDEA 4O3RA 3UFCX 2OMOA 3RBXA 2LVWA 2F3JA 5DGBA 4NMLA 5KT6A 1CQNA 4V19J 2AJQA 2C3OA 2Q79A 3NRBA 4ZS6A 4ZIVA 5B0GA 1FKOB 4EBEA 5BR8J 1VQKS 4XAKA 3FJ2A 2R42A 1TVRB 3MM6B 3VGUA 5FD1A 1KVIA 2BANB 3QT5A 2MKIA 4CYUB 3FEXB 4OYBA 3OW2R 2WW4A 4RW4B 3TUZC 2CQ1A 1VC6A 1B7YB 5HAOA 3BS9A 4YR3A 3W64A 1FXDA 2CADA 3DKDA 4O4GB 1CG2A 2NLWA 3K8WA 3AD9C 2FHMA 1TMMA 4NLWA 1F60B 2Y0BB 1KP6A 4OI2A 3GMGA 2J9DA 3IXQA 3AFGA 3Q24A 4FBUA 4YEAA 1K44A 2D3UA 5DRKA 4DV5F 1RT1B 2D41A 3I5CA 2M4MA 4IOBA 3RYLA 3PDNA 4FYYB 2JRSA 2AYMA 1FEEA 5GVQA 1NMEB 2O5DA 5CXTA 4ZPCA 4IRKA 2E29A 2V0NA 2IRYA 3AJDA 1KOOA 4YB7A 4G1QB 2ROPA 1W26A 1X4EA 3X3UA 1QUVA 3TA2A 3MM5B 4WFZA 1TU0B 3W61A 2RRBA 4P72A 3G8QA 4CLLA 4GO5X 4ECRA 2VPWB 3M9NB 1ZS6A 2IPOB 4RWXA 3HSZA 1VK8A 1U24A 2MKSA 5IC4B 1N34J 1UW4A 3KLGB 1HMVA 2E5LJ 1KLMA 4PG6A 4WE1A 4J9SA 3PG9A 4F4WA 1R8CA 4CLKA 3TI0A 3NMAA 4OX6A 2OPSA 3AOCA 3KK2B 1G1XA 4UY8T 2P6SA 4ANEA 2ACMA 2HIQA 5B09A 5EHHA 3O6QA 2FY1A 1FRKA 3MTJA 4QIFA 2OEKA 2IBKA 4ZVQB 2CWXA 2KT3A 1KD1T 5B0DA 3EVOA 2FLLA 1FJGJ 4ES2A 3ZZ0A 2RU9A 3ZXWA 3SIPB 1R0AB 3KLHB 1IKYB 3H42A 2Y1IA 1CVJA 5HVHA 1SBRA 2X51A 2C1EB 3K57A 3D3BJ 2GGPA 3CUNA 1FFSB 2R4FA 3CMES 3ZNUA 2H5JB 1M5OC 1JLEB 1SI9A 1KC8T 3PCOB 4OHZA 3D28A 5MLCV 2UUBJ 4KV8B 3JSRA 1X9SA 3KG4A 2UXCF 3W62A 4KFBA 4KHPJ 3E51A 7FDRA 3B78A 3R9LA 3VAMA 3TAPA 3D2WA 3W2WA 2M52A 2KJVA 2XTJP 1KLNA 2YTCA 3FRZA 2DY9A 2AT1B 2ZNZA 4DSIA 3IAM9 3CC4S 3WC2A 2WVBA 1FXLA 2JSXA 4CNZA 2AEMA 1V3SA 2NUUG 3HHEA 2N82B 3H40A 4TU8A 3AB2B 2MMYA 1FKPA 2B9YA 1OS5A 1PC4A 3DC2A 2W4CA 2JFKA 3TJ8A 3DLEB 4ED3A 4P71A 2IM3A 3VAFA 4JI5J 1GAOA 2XYGB 3GV5B 2Y0SD 3IP0A 1FVSA 4A8XA 4CRJA 1WEYA 5F9LA 2EKNA 4PXEA 1M1HA 2JLEA 1SC4B 1MG7A 1SL1A 1WEZA 4K2JA 4MIAA 3I4PA 2NR0A 3MCNA 1SC6A 4USWA 2XCAA 3CCSS 5C5JA 1H7XA 3W65A 5I42B 1JXEA 4I1TA 3QSYB 3DRRA 2QFJA 2CQCA 4PWDB 3CDAA 5CCMA 4RU9A 2O66A 3UN2A 3G96A 1RKJA 3V6KA 2GHWA 4NLDA 4RLEA 3BREA 5LJ3Y 3HSGA 2DEIA 1LXNA 3W3SA 4UZBA 2VOOA 1VIXA 1GXUA 2OJ3A 3HLUA 4BHQA 2CJ9A 1HBNA 3LP0A 1NJYA 3ITHB 2PMZD 4Y3CA 1RT6B 2QJ3A 4MFBB 2YPYA 1QE1B 2MZTA 1F1BB 1I3OB 1S49A 2BRKA 1DQ8A 3IG1A 4Y34A 1JJ2R 4L72B 2VHGA 2WZ1A 3IFEA 2H9ZA 4H4OA 3VF0B 1Y5LB 3MECB 5HI7A 2PT0A 2M70A 4UUWA 3CJKA 3BBFA 5L1KA 1XK8A 1RWUA 2FZKB 2QYCA 2IRUA 5BR8F 2BR0A 1Y5NB 2HFUA 2OUGA 4YUDA 5DG7A 3I9V9 2CA9A 5T14A 2WK4A 2IYIA 2VBXA 1N5TA 4M5IA 3FC9A 5EUHA 1ZYQA 3GONA 3QIDA 3GB0A 3OR2B 2RRAA 4HI2A 5LXRA 4PUOA 3OXFA 2ZH8A 1ZZFA 2FVCA 1S6PA 3Q8UA 3NGUA 3FNNA 1FX4A 2HG4A 2V2KA 3CDUA 1UWAA 2CQDA 1NH8A 1KVJA 4CWBA 1RT3A 4CTAB 3W9JA 3UPFA 4H4MA 1HD1A 4LRFA 2OO4A 4PPZA 4BC7A 1F5BA 1L3VA 1TL5A 4O0NA 5DJBA 2D9OA 4LIWA 4NLGA 5J2QA 2HBZB 5K20B 1AXQA 3KLFA 1V3ZA 3CNQP 3FFIB 4N47A 4ZVTB 1WORA 1PC5A 3EDRB 3G6VA 2RS8A 1KS2A 4F50A 4LF2A 2RMLA 1D9DA 5ETOA 1QSLA 3F44A 2J9DE 1JKHB 3EICA 2WCXA 1FO1A 2XO7A 3HP6A 3CULA 3DRPA 2E5LF 1U6ZA 1NXIA 3B54A 4PR6A 3SCKE 3GV8B 1GFWB 3R5AA 3VTIA 2AMCB 4XDCA 4RW7B 1RB0A 2V68A 3PW0A 1H3DA 4OI3A 2XWXA 1CJVA 2WONA 2EFPA 2RQ4A 1U2FA 3D6MB 3OTBA 5LOQA 2BOAA 4UY85 2KO1A 3IGNA 2IVYA 1KWMA 3LH2S 3FSIA 2HS0A 2UVRA 3P49B 2YX7A 1NK9A 2H4WB 4JI4J 2EPIA 4U8YA 1XQIA 2BKPA 1NK0A 1DLOA 1DTTB 2QE5A 2YQ1A 3KG1A 3P8BB 3E8OA 2BW7A 2GV1A 1TKZB 2W01A 1IM4A 2HYIB 1Y3KA 3PYEA 2GA7A 4LBPA 4UUXA 3BGRA 3MAHA 4ELTA 4DU7A 5SUHA 2UUBF 1U0SA 1HBUA 4JUZA 4DR6F 4LSLA 2LXFA 4CO5A 4DQSA 1E6VA 2KI2A 2DO0A 1M5VC 2KM8B 1IR1A 4ZA1A 4HLBA 2F8HA 2R2TA 3GP9A 3C16B 3BZQA 1X9MA 3VAKA 2K7KA 4BWMA 4A8KA 2FJVA 2J7WA 1XNQJ 2KZZA 3FBBA 4FDFA 4JI1J 1GMUA 3OXGA 1HPZA 1NEEA 2HQGA 2BBEA 2FLOA 2A2CA 2CZ4A 2MSTA 4CM0A 2G2OA 1WI8A 3OJSA 2LMIA 2Y1JA 1U26A 1Q8BA 1F0XA 1WDTA 2C2OB 4DX6A 2NUHA 4P75A 1F9FA 3GZ7A 2VC1A 1SVDA 1LWCB 4CLUA 4JB8B 2OPSB 1NK4A 5LT5A 2ZDPA 3M8PB 1IQTA 1LK7A 1RLDA 2IRXA 1M90T 3CD0A 1G3OA 2IC3A 3MDFA 4RNFA 5IXUA 3CW2C 2MLZA 4CH0S 3DM2B 2CNOB 1L3KA 1DY3A 9ATCB 3E2EA 3TVZA 5KFXA 5AE3A 4OX8A 3CCJS 2DIUA 4ED1A 3R97A 1UEVA 4J5OA 1AT1B 2ZZMA 2DHAA 3LGHA 1N52B 3CD7A 4M5GA 2XYHB 4IOAQ 1HNVA 3BGUA 2QYGA 1VHFA 5HJYA 2FPHX 4O3NA 2RH3A 4NEZA 2OD4A 2RHSB 2ZE2A 3VHQA 2ILYA 3RW6A 3C6UA 2BE7D 2WBMA 3TZZA 1R8BA 1X60A 3QNWB 4USJC 4OLOA 3GIMA 5LXYA 1VRUA 1FK9B 3PHTA 2J7KA 3TEGA 5KG3A 1XWLA 5AE2A 1WSVA 4FF2A 3N6NA 4X4UA 1C0TB 3MPDA 5D77A 3H7HB 4JI0J 4TQSA 4QWEA 1XMOJ 4ILLA 3BKTA 3PRVA 5H1SV 4NYZA 2BOPA 1KTQA 3B8HA 3MZIA 4UW2A 2D9PA 3VR1A 3Q2TC 1AA1B 4JI8J 4JYAJ 3OTOJ 3BO4A 2XSFA 2YKQA 5HMWA 2BA9A 2VFSA 2DCUB 1BQXA 5D0RA 1NKBA 2VQFF 5FJ4A 4WFYA 3BN7A 3NGTA 3DRRB 2R8JA 1VQ8S 3VALA 1X8DA 3UDVA 2GMJA 3HT3A 3VGSA 1T0TV 3GCWP 1TKXB 3G71S 4IDKA 2HZAA 2VKZG 2IVMA 4DSEA 1T02A 1NK6A 2H5EA 1VQ6S 1CJKA 1U0HB 4WP3A 3LP0B 3HXMA 4K4WA 4M5DA 3ZTRA 2PMHA 2CPZA 2OPRA 3VZHA 1HNXJ 1RTIB 5J1EA 1QSSA 3UDCA 3D9BA 4OYPA 4N41A 1YBUA 3OL6A 4X62F 4PWWA 3AT1B 2LA6A 3IG1B 4RUHA 3DOLA 3H5YA 4RUCA 2Z8QA 1OPIA 3B4MA 4LQ3A 5E33A 4LVOP 4ECSA 3TW0A 5A8WA 5F0UA 1QLNA 1PAEX 2JNJA 1VQ4S 4DR2J 5DDQC 3PX6A 4X2BA 5BYQA 3I96A 2ZM6J 4FF4A 1Q1KA 2AV5A 4F36A 2HPUA 2V8HA 3HD2A 2UUCJ 4AL7A 3OL9A 3V4IB 3D1QA 4W92B 4KGVB 3Q0AA 3GJQB 1R31A 4B9SA 4CNYA 2MLXA 4PAAA 2WSEC 3QLHB 1JLCB 4EZ6A 2XO6A 4F3MA 3F41A 2FJWA 3GIJA 3GV7B 4JI4F 4J9QA 4DN0A 3UDLA 4MT1A 3JYTB 4FKYA 3R2CJ 2BDPA 2HLUA 5KT2A 4J91A 2HQDA 5FDLA 1REVA 2I9SA 1BE4A 4IO1A 3MMAA 4LF5J 5J2QB 1B0VA 5C42B 1XERA 3LW5C 4MIWA 3KKFA 2XMVA 3KLFB 3HHLC 5J1NA 4O3QA 2N4DA 2DGWA 4C0HA 1KBRA 1T3NA 1NHUA 3NKYA 2EG1A 3HPOA 1IBMJ 3BO3A 1TTHB 2J8SA 3H0PA 3NAHA 4CLZA 1X4AA 4JI1F 3G4SS 2V50A 2LQ9A 1V3RA 3M2UB 5A8KA 2M8DB 3CTRA 1VBZA 4GRSA 1MWYA 1NDLA 1RBAA 2ZJPQ 3DRPB 2KL8A 4X66F 4ZN3A 4O23A 4A8QA 1QAYA 4ID5B 3DDIA 4XPCA 2CDQA 4DS5A 4HEA9 1AYEA 2ERRA 4P73A 2ADBA 3CJ2A 4ELUA 2EFOA 1FTCA 2WONB 3HULA 2VJUA 4ZLJA 1A9NB 2DY1A 2CJXB 3TJAA 1IKVA 1RTJB 3OVAA 1NSQA 1L3SA 5CZXA 3RBEA 5KT7A 3MM8B 3NLCA 3MM7B 1PSDA 4MK7A 1TL1A 4TY9A 3PW5A 2DR7A 1Z2ZA 3HZGA 4F26A 4LSNA 4F04B 5AXNA 2V5HG 1WHYA 4WCEQ 1TFYA 1A0OB 2FY8A 1NPPA 2F40A 3M7VA 2VG6B 1FTRA 4QWCA 2YKNA 1BGXT 3J7YI 4NLSA 5I3QA 2ATLA 4KGXB 4MMOA 5BXIA 1SQGA 4HDGA 1HBUB 4PQUA 1RHKB 2VQEJ 3ZC4A 4ECWA 4L3NA 4DX5A 2MYFA 2VH7A 4EZ9A 5BYRA 2VC0A 5B0FA 1HNWF 1M5PC 4ED8A 4PYDA 2E7VA 4A8SA 4OI4A 1ZTWA 3QATA 1X5OA 4PXCA 3HFVA 5D15A 2ZWPA 3M32A 3QAUA 2XWYA 2A3JA 2CKWA 2IM1A 3L09A 1N32J 5IV4A 3Q83A 4HTJA 5CYJA 1TKDA 3PR5B 1X31C 3CWJA 1N5SA 2X1FA 3BDEA 4IRDA 2HFVA 1Q4RA 3ETOA 4NLQA 4JI0F 3MAAA 3MR7A 1XMOF 3DXSX 2WB1D 3IR5B 4QU7A 1P1LA 2QL7B 2UU9J 2XLJA 4UQTA 4JOUA 2V8PA 1OSCA 5C7PA 3DRSA 3PR4A 4JI8F 2OSQA 4JYAF 1XR6A 4C3LA 3OFHA 3TX0A 2FZGB 2X7IA 2AJFE 4DUZJ 3T6BA 1M1KT 1GMWA 1YG0A 3MPVA 5L39A 1ULRA 4LFCF 2FB0A 5KAKA 3PZPA 5ETTA 4MK9A 3SFUA 3CC7S 3SEOA 3GR1A 3AA9A 4LRAA 4YDXA 3IS9A 1URRA 1S97A 3D0IE 1U1LA 1MROB 5L1JA 4P9SA 2LEPA 3PIPQ 1FD2A 1KVKA 1QAXA 3ISZA 4WU3A 4X4NA 3DLHA 1WF2A 3AJ1A 4DU8A 5F8JA 1N56A 1HNXF 1D9FA 2PIIA 4OZJA 1RWVB 1FRHA 4NYOA 4Y00A 2P9GA 1MWZA 5LSRA 4UOHA 1HW9A 2ZKUA 4WXOA 1XTZA 3Q8PB 1BQMA 1WELA 2V8GA 4OV6A 4K5RA 3IN5A 2BW2A 3SSQA 2RDIA 3BH7B 2IM0A 4ZVUB 1CJUA 2XNQA 2O1PA 3DGVA 2IM2A 2CZ9A 3KJVA 3A1YG 3AA8A 3Q8SB 3GJSB 1CC8A 3LP2A 3OVSA 1UVJA 5KFEA 3CO0P 2HQFA 3NP5A 4ZHRB 2B9XA 4DR2F 3DU5A 3WZ0A 2EXUA 3HHLD 5KT4A 1RACB 2E66A 5I4MA 5H9EK 1OIAA 1GH8A 1RCXB 1E6YB 2X1GA 5CYQA 2HHUA 1Y0HA 2Y8WA 3I32A 6FDRA 3GTYX 1OY6A 3NGKA 2PA3A 1T05A 2GAGC 1RTDA 4RW9B 4OHVA 3KK1A 4C3KA 1CSJA 3ILIA 2Z2YB 3FVYA 2LFVA 3ZO7A 3D6HB 4FPIA 3T9ZA 4ZVPB 5HP1B 1FFWB 4ZVRB 3A4TA 3Q2SC 1VHIA 2B9EA 3RUBL 2CQBA 4IDKB 4QPXA 1URNA 1S57A 3S7RA 3PO4A 2BUNA 1R8AA 4HVZA 4B3RJ 1RYRA 2KDOA 2F8EX 2HRTA 1WF0A 1CJKB 2JOQA 2M88A 2XMAA 3U7JA 1RHMB 4M5DB 2ATCB 4FXDA 4ATNA 4LF4F 2KJWA 2WVCA 3DLKA 1X0FA 5E7OB 1RXOB 1Q7LB 3JQJA 2V4RA 2HHVA 2QRRA 4EBDA 4NXMJ 4LF9J 1IBMF 5LL6d 2QL9B 1YLXA 2JWNA 1TUWA 4F3OA 2YKAA 2DRBA 1WC1A 3G9CA 2HEKA 3QZ8A 4IYQA 2AD9A 4Z2XA 5KFCA 1VFJA 4NCAA 3CT9A 1RWMB 4TU7A 4M8LA 4TYAA 1SJ4P 3DGPA 1TK5A 2PDAA 4KO0B 1B0TA 1TL3B 3MEDB 1HQ2A 5DQIA 4CH7A 3H5XA 1SH2A 1JLFA 2VPZB 4OMFG 3BGFA 2GVZA 1VLOA 3BSOA 2PD1A 3VVUA 1X4BA 3P3DA 2MGZA 1WTFA 2MEWA 4PZVA 2CVIA 3CEDA 3JTPA 2B3TB 4DFJA 5A0YA 2VB6A 1FDBA 3EMTA 4XO0A 5DO2A 1R27B 1HWIA 5IV3A 3DLLQ 7AT1B 4Y2KA 1S0VA 4OX9F 2YQ0A 3M30A 3ENWA 4X65J 1BC6A 2EVZA 4C48A 5HQLA 3J7AN 2ZH3A 2HSEB 2W7OA 3A8JA 1REVB 3PO5A 2HW3A 3UWTA 5MAOA 3J81Y 3C15B 2W9CA 3BDPA 2YVSA 4EYIB 1IKWA 1AZSB 2ZOMA 3HZEA 2V2ZA 1UCNA 2Z57B 1LW0A 4R5PA 2J9CA 2VQEF 1XMQJ 4GVLA 4PYAA 2O67A 1LK5A 5F0WA 1IM6A 4J9OA 5IQQA 1TKTB 2H48B 3MMJA 4ZPDA 4ELVA 2DKOB 1JX4A 4KSEB 2M3DA 4B9NA 2DISA 1RK8A 2AGPA 4NA3A 5F8MA 2VFTA 1NJWA 1N32F 3KNAA 1H98A 4CCHA 3OHBA 1FRMA 2CDRB 2HAFA 1RA7A 4QR2A 5CH7B 2PI4A 3J7ZT 3QGIA 4Q8EA 3V6HA 3LAKA 1T9TA 3I5BA 2M2BA 4ID8A 3AOBA 2OHDA 2WOMA 5J1PA 1VBXA 1LWEA 3O44A 4KYZA 1LW2A 3UI3A 1HQEA 3W5YA 3Q89A 4TNOA 4Z7CA 1UVLA 3KG0A 1HBOA 5FIIA 4FXWA 1IKVB 3NWGA 4JBCA 2MJUA 3IBCB 5KFKA 1YI2S 2BV3A 3RBDA 4DUZF 2AWZA 4G1PA 2R8KA 4DXLA 4A8OA 1RT2A 5ETVA 3ENAA 1ROFA 4LSNB 5DG8A 4P6QA 2HWTA 3MM9A 3N6LA 1XC9A 3FKBA 4DR3J 3IWNC 2I0XA 2WSFC 4HTIA 3L7UA 3QJJA 1X4GA 4ECQA 3C14A 1VGYA 1HNIB 3OVBA 4ERDA 1TV6B 3PM9A 2HVEA 4HT5A 3QRRA 3RB6A 2HURA 1G6BA 4DFKA 4I69A 1SXLA 3LP1A 3CDWA 4ED0A 2K1RB 2DJWA 4KQZA 2FYXA 4PEOA 2QA4S 2HS4A 3EGNA 2E7WA 5BYSA 3OQ2A 5DETA 4IO9Q 2YX4A 3GCXP 1UA1A 2VFUA 4NRTA 3A8KA 3M32B 3FZBA 3GWCA 5HROB 2UUAF 1SC3B 5C25B 4RJVA 3A3NB 3C6TB 1S9GA 3T1AA 4DQIA 4Z37A 4HACA 2P2CB 4ZOSA 1DTQB 1QY7A 2CYYA 2MKYA 4M63A 1AB8A 1W25A 1X9WA 3KHGA 4X4PA 5DM6Q 3ULHA 2MQ8A 3LANA 3M05A 4L75A 1KONA 4UOFA 4EO8A 3DLGB 1YTYA 2VDIA 4ZCMA 4Q2LA 2FHJA 4YDDB 4QWDA 2ZUAA 4FS1A 3NXZA 1R0BG 2HZCA 1XN9A 1N88A 2JZ5A 5L8RC 4B3MJ 5AE1A 4IQXA 3SQGB 4PPDA 4FF3A 1IVZA 1QTMA 2CPFA 4KKOB 5E3PA 1KQKA 4DL5A 1U1RA 1S1UA 2KYXA 1NPRA 4DZ6A 3MFHA 1Y10A 1YSJA 1W7WA 4DSKA 2B5JB 1NB2A 2RRNA 2MZRA 4NLUA 3IS9B 4PG8A
chains in the Genus database with same CATH topology
1V6HA 1H7XA 5I42B 1VRUB 1U4BA 1JXEA 4I1TA 1XEZA 5KFFA 3F73A 3DRRA 3I0RB 4B3RF 1ZM4A 4ZHRA 4DLEA 2QFJA 1O8BA 2OIHA 2ZJQQ 2UZAA 2CQCA 1Z1ZA 3CDAA 1HFEL 5CCMA 2O66A 4RU9A 3R5CA 3OTEA 3K0JA 4PWDB 4USIA 1R6YA 3CDBA 5D3GA 2HHSA 3G96A 1RKJA 2CVEA 3V6KA 2GHWA 1FD8A 1H38A 3LOUA 4B3OA 1SUQB 4NLDA 3PFEA 1E6YA 4WFBQ 4RLEA 5K14B 3BREA 4J9NA 4I6WA 1B64A 4DX8H 5LJ3Y 1LXNA 5DDPC 2RSQA 3C2PA 3W3SA 2VOOA 3SSRA 1VIXA 1Y9OA 1GXUA 1KHVA 2OJ3A 2JH3A 3N79A 2M9KA 4NXMF 1S9EB 3HLUA 1ZOTA 4BHQA 4LF9F 2ZH9A 5DDRC 2XS5A 1Q81T 4RW9A 1YRUA 2FHOB 5F3TA 2DPIA 2CJ9A 3CMAS 1HBNA 3KHHA 4JI2F 3CJ4A 3LP0A 3M2VA 2MKCA 1QM9A 4KPYA 2KZMA 4AFFA 1NJYA 2W25A 3ITHB 5CYMA 3H4DA 1FNMA 4FPRA 2PMZD 5EWFA 1VQLS 3IC1A 4Y3CA 4KAIA 1S1XA 5KG5A 1RT6B 1HHTP 5HP1A 4OV1A 1UKUA 4MFBB 4ILRA 2HHXA 2FJBB 3BSCA 2J6TA 1FJ7A 2W24A 2MKHA 1QE1B 2MZTA 2YH0A 1S49A 4YMEA 1K1QA 2I5JA 1JLQA 1NJXA 5A8RA 2EK1A 3H4BA 2BRKA 2UV8G 4Y2IA 4C7QA 2BXJA 2MQQA 1DQ8A 3IG1A 5KOWA 5I3PA 4Y34A 1JJ2R 3HJFA 4L72B 1X0PA 5EX3A 1Q7YT 1P27B 5D6GA 2HFOA 4L6V3 1VQ7S 1CC7A 1D1UA 1YJVA 1JLBA 2R7SA 1HW8A 1Y5IB 3CCTA 4CI0B 4DWIA 4DG1B 2LQBA 2DNRA 2RT3A 3IFEA 3JTNA 2H9ZA 2KH9A 3L3CA 4H4OA 2ASJA 3VF0B 1RQ0A 1Y00A 1Y5LB 2L9WA 3MECB 3TAMA 1UVMA 3QGPA 5HI7A 2PT0A 4DQQA 1SKRA 2M70A 2R7TA 2QO3A 1VRTA 3CCZA 5D4OA 4UUWA 3CJKA 4ES2A 5GAEU 1ZH5A 4NLRA 5L1KA 4K4VA 1YRXA 4IFVA 3RRGA 3NL0A 1XK8A 1RWUA 4DPOA 2QYCA 4HL9A 2QSFA 3BF4A 2IRUA 5BR8F 1NH7A 2BR0A 1RKIA 4KE5A 1Y5NB 4OQJA 1WHWA 1SV5B 2R9LA 2MQPA 3KFWX 2OTLS 3PJXA 4B3TF 2N7CA 1TAUA 1ZAWA 4YUDA 4PRFA 4MYUA 5DG7A 2U2FA 4PQAA 3I9V9 2IYGA 5T14A 2JVOA 4C2MA 2PC6A 3UR0A 2GIQA 4R0JA 3FEYB 1S1TB 3KK1B 4QR0A 3BO2A 1Z4UA 2WK4A 2IYIA 5T7LA 3P6YC 2VBXA 5L38A 1N5TA 4IH7A 5EUHA 2R7QA 2XY6A 1ZYQA 4DQPA 2EKYA 4DJBA 4MKYA 4NCGB 2OPRB 1KOHA 2K7JA 1I1GA 3R3TA 3CCWA 1JMTA 3GB0A 3QIDA 5H9EJ 3OR2B 5J1EB 1S10A 4FF1A 2RRAA 4F4KA 5HMZA 2KXHA 1KNZA 1RP5A 1X4FA 4HI2A 3QO9B 2DTJA 5LXRA 4PUOA 3OXFA 4X65F 2ZH8A 4F8RA 1ZZFA 2ZDOA 3DXBA 4DUYF 5J2PA 3GFHA 2F9JA 2FVCA 2VG5B 4ZPBA 2HHQA 1S6PA 2E9ZA 3B82A 1KFDA 3FNNA 3DOLB 4YHHF 4OI6A 4E0DA 2HG4A 2V2KA 3CDUA 2CJQA 1U2RA 4KO0A 4FNIA 4CQ1A 2PFFB 2CQDA 3UQSA 2FGCA 5GMKa 1NH8A 2V4JB 1TL3A 5KFIA 3MEDA 3RR7A 2DNKA 1KVJA 4DL3A 1RT3A 5JXSA 4CTAB 3OJUA 5JVGQ 1X7VA 3H5SA 3WBZA 3OV7A 2QMXA 3MUTP 2IJFA 1HYSB 3IR7B 1TL4A 5A8WB 3AB4B 1DURA 3UPFA 2OTJS 3VCDA 2XGPA 3POTB 4H4MA 5B0AA 2B7CB 4K4ZA 2L48A 1C1BA 2GJIA 2F4VF 1HD1A 3PRBA 4O4RA 1C4CA 5M2UA 1R8PA 1XMQF 2OO4A 4PPZA 4K0KF 4OJHA 1FT8A 5KFMA 1FKOA 3RB3A 2DGSA 4BC7A 4WYWA 1F5BA 3QGHA 3J7YU 4J9LA 1RT5B 2FUG9 5DQHA 5IZHA 1IXKA 4AYBD 5GADI 4YQWA 1TL5A 3DCAA 3Q8QB 3UD3P 2PSZA 1L3VA 4RWWA 2FJDB 3J7A1 4GO7X 5EWEA 2KVIA 1TVRA 2WW8A 4DV0F 1Q78A 3FMBA 2V94A 2D9OA 3MM6A 5DJBA 4J9KA 1YWXA 4LIWA 4NLGA 2CPEA 5J2QA 2BANA 4OIXA 3HK2A 5H9FJ 2UVWA 4Q8FA 4FXVA 4ETXA 2EWHA 4J37A 1JJ4A 4RW4A 1AXQA 3KLFA 3CVKA 4WZMA 1V3ZA 3K8VA 3FFIB 4IH6A 3T5JA 4N47A 2COLA 3C3LA 2XEXA 1SQEA 2EFVA 3MR5A 4Y28C 2DNOA 2C28A 4A8WA 1S99A 1UAWA 2OLWA 2QMWA 1X5TA 4QR1A 2V4QA 2ZH2A 2XMTA 4C0OC 4GKKF 1PC5A 3HHDA 1DZ5A 3G6VA 1H7WA 4TLQA 2RS8A 1KS2A 4F50A 3HMJG 1N0VC 3TP2A 2RMLA 1D9DA 1QSLA 2UXDF 3BB5A 4RKUC 3F44A 2J9DE 3RB4A 1JKHB 2P9EA 3FZ2A 5KFRA 2WCXA 2XNRA 2QLXA 3DI6A 1FO1A 4HKQA 1QUPA 1FXRA 4LVNP 3J7Z5 1APSA 2XO7A 3HP6A 6FD1A 1JXLA 3D0HE 1KQGB 3CULA 1HWUA 2WB4A 3I0SB 4OX7A 3HM9A 1U1OA 1RTHB 1RT1A 1UMJA 5E3QA 3DRPA 1R43A 4QCLA 3OL7A 1S4FA 5FDLB 3GIKA 2R7WA 2E5LF 1U6ZA 3O5TB 4A48A 2EG2A 2YWKA 4PR6A 1UVIA 2NPFA 2ZITA 3SCKE 3GV8B 5E3AA 5IM0B 2FLNA 3MMAB 5D8HB 2YKMB 3R5AA 3JTOA 5F8LA 3VTIA 1FCAA 3DFEA 1TKTA 4XDCA 4RW7B 5K5MA 4ZP8A 4EFAC 4JV2A 3PW0A 1S6UA 5KFZA 4CO0A 3PEHA 2J9EA 1CPZA 2LLZA 1XNQF 1DQ9A 1H3DA 4OI3A 4OZNA 1DFDA 3SFGA 4G1QA 2CQ0A 4DL6A 2ASDA 3KMQA 3A8EA 2XWXA 3KHRA 2VA3A 2I2YA 3OR1A 2WONA 2EFPA 2RQ4A 4FZVA 1U2FA 3MM5A 2CQ3A 2YNGB 1BD6A 3OTBA 5JVHQ 3KLEA 2C3PA 4I2PB 3SCLE 4UY85 2KO1A 3HVRA 4OZLA 3I82A 2G4BA 1S0MA 1SIZA 3MURP 2KB2A 3IGNA 2IVYA 4FN5A 4ICLA 4O3PA 3M8RA 2DO4A 1R3NA 4DR3F 3KK3A 5GAGI 3LH2S 3FSIA 2HS0A 5J2MA 1GTEA 3UR3C 3UCUP 2UVRA 3P49B 3RR8A 1RAJA 2YX7A 5A8KB 1NK9A 2EPIA 2VUGA 2KRRA 4CO1A 2ZHAA 4ECVA 3ISND 2RJZA 1LQ9A 3BN4A 2DR9A 1YJRA 3VWSA 4C11B 3MPWA 2K3KA 3HVTB 1NK0A 1C0UA 4C0BA 1DLOA 1DTTB 2QE5A 3KTQA 2JLGA 3KG1A 4C9DA 3TUJC 2RNEA 1KTVA 2DNZA 4IG0B 3E8OA 2GV1A 2PE8A 1KFSA 3ZZUA 1TKZB 3IA0A 1IM4A 5KFLA 4NZ0A 2HYIB 1Y3KA 1WI6A 3SDEB 2RVJA 4O3OA 3IWXA 4CH1A 2GA7A 2E5JA 4UUXA 4AL5A 3BGRA 1SH3A 1VC0A 3MAHA 3HVAA 3G6ES 4ELTA 3OUYA 2W4PA 4DFMA 2LQJA 1N6QA 2E5HA 3MWBA 3HFKA 1EETB 3I6PA 5SUHA 5F9NA 2J0SD 4QYZJ 2UUBF 1HBUA 2ZVSA 4JUZA 3V6DA 2FVQA 4DR6F 4LSLA 2RE1A 2LXFA 2XMMA 3H2UB 4CO5A 4DQSA 1E6VA 4Y2CA 2KI2A 3OXLA 1UL3A 3CXCR 1P1TA 4DL2A 4X4SA 4RW6A 3ZZPA 2KG1A 4HI1A 3DU6A 2DO0A 3KK2A 3TO8A 1M5VC 2I1RA 2KG0A 4YR0A 2KM8B 2V9WA 3BR8A 5IT4A 3SXLA 3MCSA 1HI8A 2LEAA 3NCPA 4ZA1A 1G7CB 2KN4A 4I67A 3L95X 2F8HA 2MY8A 4HLBA 4ZCIA 2ACYA 3S6EA 2R2TA 3RU0A 2FTRA 1Q82T 3BZQA 1X9MA 3FDSA 2P6TA 5EX0A 3TVKA 3VAKA 3UD4P 4ZCKA 2K7KA 4BWMA 4WJBA 1VQSA 5B0EA 5KFPA 3VAJA 4RW8A 4DV2F 4A8KA 2FJVA 2J7WA 2KZZA 1HQUA 2G9OA 3OXGA 1HPZA 1NEEA 2BBEA 2DNYA 2FLOA 3GR0A 3MMBB 4LQ9A 1FE4A 1TL1B 2A2CA 4NX9A 2CZ4A 2ZKTA 1N8RT 2E1RA 2MSTA 3DOKA 1U45A 1AROP 4URQU 1WI8A 4I68A 3GILA 4B9TA 1VMBA 1LWEB 2GQCA 3PKYA 1HNIA 3OJSA 1R0AA 2LMIA 1SJRA 1TV6A 2Y1JA 2IJNA 3KLHA 1IKYA 3QJLA 1U26A 1Q8BA 4WYLA 2HNZA 5EGYA 4B9MA 1F0XA 4C8NA 4G3IA 4URGA 3KLIB 2AX0A 2NUHA 2YKNB 4NZ7A 3UCZP 5DLGA 2J0QD 2HNYA 5J2NB 1U6BA 1F9FA 3GZ7A 2K1RA 2CIMA 3ZZYA 2ZZNA 2KFZA 5EDWA 2V8DA 2DVIA 2VC1A 1TZ0A 1G2EA 4N8OA 1LWCB 2QZ8A 3BEGB 3V81A 4DQRA 4Q0BA 2F7VA 2APOA 3QGGA 4U7CA 1T94A 2JEJA 4PQUB 2ALZA 4DF8A 1UWBB 3GE9A 2OPSB 1H0HB 1NK4A 3I5AA 4PG5A 5LT5A 3H8YA 4HH1A 2ZDPA 2DGXA 1FF2A 3M8PB 1FRLA 4R8UB 1XNRF 5GAHU 3Q23A 1IQTA 4G6VB 2E1MC 5HL7Q 1K0VA 3MMCA 1YIJS 4ZPVR 3H25A 4LMZA 1LK7A 3I31A 2IFXA 5KG7A 1Q8IA 5HROA 3G6XA 1N5YA 2IRXA 1M90T 3CD0A 1G3OA 2IC3A 3MEGA 4K50A 2ZFHA 3MDFA 2HNDB 4RNFA 5C25A 1EP4B 5IXUA 3PEJA 4CH0S 5F8HA 3DM2B 2WAQD 1Q16B 4DR4F 2MQOA 3C6TA 4TN2A 1L3KA 4WTYA 3QJPA 1S6OA 2ZD1A 4K5SA 3SZ2A 4PXBA 3E2EA 1NZAA 3TVZA 1DTQA 1DHMA 5KFXA 3CCMS 5LMNF 2BQUA 2M0GB 4F4XA 5AE3A 4OX8A 3CCJS 2DIUA 1AFJA 4ED1A 1BQNA 1WEXA 4WXWA 4I0WA 1UEVA 2HAIA 2KFYA 3G8SA 4ZLPA 2EI5A 2B4UA 3DLGA 4J9RA 2BRLA 4J5OA 2RU3A 4IH5A 4KT0C 2J6SA 2C2DA 1S6QA 1OPZA 2DHAA 2ZZMA 5A2QY 1N52B 1C4AA 3CD7A 1IBLF 5DM7Q 2R8HA 2V8VA 3PW7A 3J80Y 4AXJA 2XY7A 3OTOF 1D8ZA 3FQLA 4I7FB 3EGWB 3MF5A 5KFYA 3DLEA 4RBTA 1FVQA 4IOAQ 2AQ4A 2MHEA 1HNVA 3BGUA 1T03A 4A8YA 1VHFA 1LV5A 4DV3F 1YJNS 3TRGA 2AJ4A 2FPHX 1HL6A 4O3NA 2RH3A 4NXNF 2J5AA 2DGTA 1XR5A 2OD4A 5BJRA 3QYYA 4N5SA 1SB6A 3HI9A 3QIPA 2RDJA 4P7VA 3SQGA 5KFVA 1GT8A 2ZE2A 3MD3A 1GQEA 2ILYA 2QV6A 3DRSB 3H59A 5HBMB 3RW6A 2IAJA 3C6UA 4KKOA 1U7LA 2WBMA 1SH0A 1GXTA 4HDHA 4NA1A 4R25A 4FYDA 1BY9A 2HS3A 2KT5A 2E7XA 3SV3A 2GCFA 7FD1A 4WK3A 2XMKA 1S9GB 4Q5VA 1B7FA 2J76E 1R8BA 2A2DA 4ECUA 3G86A 1LWFA 4AL6A 3O2IA 4USJC 4OLOA 2B5JA 3GIMA 2D3ZA 2YNIA 3EUNA 4B9LA 2B51A 4LIRA 5LXYA 1ZPWX 3RTVA 1VRUA 1FK9B 4H4KC 2DR8A 3PJWA 3PW4A 2J7KA 2HHPA 4QU6A 1JK9B 2I38A 5KG3A 1XWLA 5AE2A 3DMJA 3RAQA 4FF2A 1YJ9S 1UA0A 3MXHP 4PWDA 1TFWA 4I56A 2CPXA 4EU0A 1M5KC 2ADCA 3N6NA 1D3WA 4X4UA 5U47A 1SUQA 1ZAVA 3IGVA 1HI0P 3PHEA 1CEZA 4N76A 3NNCA 2BE2A 1C0TB 5D77A 5K14A 1VQMS 5F8GA 1O51A 2N3LA 3THPA 4TQSA 2NSCA 4AE5A 1LKZA 2HGMA 5DS7A 4X84A 4QWEA 1O0PA 2UVVA 4ILLA 1NK7A 2OAUA 5DDOC 2WHOA 3DDKA 5IFMA 4DBQA 3THTA 5IT9Y 5LMUF 5DGAA 1S9EA 3CJ0A 5KT3A 4F4YA 2LCWA 3M9OB 3BQ1A 1S76D 2CJBA 2FDNA 4JV5F 2OPQB 1UJ6A 3DN9A 5H1SV 2YNHA 4NYZA 2ZUGA 2BOPA 4LUBA 2JL9A 4BS2A 2CPYA 2OD6A 1ZBTA 4PXDA 1KTQA 3WX4A 3B8HA 1ELOA 3ITHA 3MZIA 2J8AA 4UW2A 2D9PA 1UFWA 3VR1A 3Q2TC 1RT6A 2X3GA 1FKAF 5T41A 4K4UA 4ED5A 3BGLA 4MFBA 3S1TA 5G4DA 3SCJE 1U1PA 1QE1A 2P5VA 5K9FA 3BO4A 2EC0A 2B6AB 4PWUA 2XSFA 2YKQA 2VL1A 2BA9A 5HMWA 2VFSA 2DCUB 2G13A 4OJGA 3L7OA 1BQXA 4QQBA 1NKBA 5G0RA 1BQMB 4C8MA 2VQFF 5FJ4A 2BQRA 3HHNB 4WFYA 2DNPA 3BN7A 3DRRB 3DNCA 1VQ8S 2R8JA 3VALA 1X8DA 3Q8RB 1SKWA 3GIIA 2FC9A 2BQ3A 2MB0B 2GMJA 1YJWS 3JAMY 2HVIA 2RB7A 2ASLA 1VIOA 3K7RA 3HT3A 4DG1A 4MKBA 2HFZA 1KN6A 5D3GB 3KJVB 3MECA 2KT2A 2ZM6F 2UUWA 5I3UB 1TKXB 3G71S 2LXIA 4IDKA 1IBKF 3TYTA 5CZVA 1N33F 2HHHF 3LP2B 5KFAA 1VQNS 2VKZG 1VK3A 2UUCF 1WF1A 1TAQA 2IVMA 4DSEA 1T02A 1UVKA 1NK6A 3AJ2A 2H5EA 4C4WA 1JLAA 1VQ6S 2IMOA 3VAGA 2K3IA 2L9NA 3OFGA 3VAHA 4K4XA 3LP0B 3HXMA 1JIHA 4K4WA 1S1TA 1ZM2A 2XLIA 2DD8S 2HVHA 4WIIA 4M5DA 5CYQB 4LFAF 5CYMB 1HA1A 1KHWA 2PMHA 2DH9A 3G6YA 2ZH1A 2NYIA 3U02A 4EEYA 2FJEB <