4KGMA

Bacterial trna(his) guanylyltransferase (thg1)-like protein in complex with atp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
238
structure length
230
Chain Sequence
SIGDRMKRYENAYRIKLPERMPVIVRIDGAHFHTYTKGCAKPFDQDLAEAFWETCKYLAQNIMGAKLVYHQSDEISILITNYDKLTTQSWFENNLQKIASVSASMATAKFNEVMREKYPDKPLATFDGRAQVLPQDEVANYFIWRQQDASKNSISMVAQANFPHKQLLNGKDMQDKLMTEKNINWNDLPVWQKRGICIIKEFYRSRWSVDHETPIISKDREYVEQFVYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thg1-like uncharacterized protein
publication title Structural Studies of a Bacterial tRNA(HIS) Guanylyltransferase (Thg1)-Like Protein, with Nucleotide in the Activation and Nucleotidyl Transfer Sites.
pubmed doi rcsb
source organism Bacillus thuringiensis
total genus 72
structure length 230
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04446 Thg1 tRNAHis guanylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kgmA00
5AXKA 3WC0A 4KGMA 3OTBA 5AXLA 3OTDA 5AXMA 3OTEA 5AXNA 3WBZA 3WC2A 4KGKA 3OTCA
chains in the Genus database with same CATH superfamily
2YX7A 1YJTA 1Y4ZB 3RRKA 4RBTA 3OW2R 3W9JA 2JSXA 2CYYA 2D3UA 5F8GA 4C8LA 1RT2B 3OL9A 1AFJA 4HACB 2ZHOA 5HLFA 3D54A 1K44A 1TKZB 4ED8A 3KHGA 1RTJA 5IT4A 1Q81T 4B08A 1RHQB 1WJ9A 4ZPTR 1JLBB 3OTBA 1T95A 3KLIB 1YX2A 1HR0J 1K1QA 1FX4A 4ZVOB 4HI1A 2QA4G 4CTAA 4Y2IA 2J5AA 3GSDA 2C2ZB 2V69A 2KM8C 3W61A 3IS9B 1K1SA 3RBDA 3IBFB 2HFNA 1NUEA 3WX4A 2D69A 1TMMA 1Z2LA 1D8YA 4DFKA 3HT0A 2MGZA 2DR6A 3HMJG 3KK2A 2OHDA 4UOHA 1Q1KA 4WYLA 3TJAA 3K2YA 4DWIA 2ZH4A 3JQMA 1Q4RA 4ED0A 5KFAA 3V4MA 3QT5A 3LALA 4WE1A 4DJBA 1CJUA 2BX6A 4WP9A 1Q78A 4DV0F 3DGPB 1LXJA 3PO5A 4B9NA 1SH3A 5ETRA 5E0OA 3TO8A 1BQXA 3D2WA 3QJLA 5A8KB 3ZTSA 5H9EK 2DNLA 3L9ZA 1IVZA 1N36F 2L41A 3NOCA 5I42B 4CYUB 5CXTA 2B4OA 4LF8F 1JLGB 2Y1JA 1HW9A 1N0VC 3I96A 1WHYA 5B0EA 2HAFA 1A6LA 2K7KA 3RRGA 4JI3F 5L9NA 1Q95G 3G9CA 1VI7A 5AE3A 5MAOA 2EKNA 3TEHB 3BZQA 3ZFVA 2R8KA 1T05A 1ZS6A 3WC2A 4FDFA 5DDQC 5F8LA 3OTEA 2X51A 2DNYA 3IBWA 3VHQA 3OVAA 2R8IA 4TNOA 2XMAA 2UU9F 4WFBQ 1B7YB 3CJ4A 3QIPB 3H25A 3WZ0A 3BDEA 4USKA 1T9XA 3QLHA 3Q89A 1NSKL 2A0FB 2BUNA 1S7IA 1S72S 2ASJA 2F4VF 1HBUA 1KQGB 3I0SA 1Q5VA 2R8GA 4IR1A 3VVTA 4OJ1A 4YB6A 2RF2A 2V8PA 3C19A 1CJVA 4P2XA 3T1HJ 2VQEF 3OTDA 1CBKA 4DV3F 4ZVFA 4LFAF 2ZBPA 2YNHA 3OLBA 2E1MC 1VRUA 2RS8A 3OUYA 3TAPA 4ZJLA 4OYWA 4W4MA 4JV5F 2VB6A 4XPEA 2JOQA 1NEEA 2FYXA 3QT8A 4WK3A 4N8NA 3A4TA 2B8PA 2MQPA 4YFUA 2KJWA 4U96A 1RHKB 4DV7F 1TU0B 4Y34A 1N54B 4TU9A 4QWBA 3EE3A 3DLEB 1JJ2R 2FZGB 1RT6A 4O23A 1S10A 4ATNA 2BABA 3MF5A 3CC7S 3DFEA 4X4PA 1SIZA 1PSDA 1T11A 1GQEA 2VASA 4LF1A 4A48A 1UW9A 3P3DA 1APSA 3CIZA 1J5EF 2UXBJ 3WDOA 1KFDA 5HROA 3ILJA 1S6UA 4KGMA 2R7SA 1F5CA 2W25A 1P1LA 4QJVA 5B7WA 3I9ZA 4X4QA 2ROPA 1HNWJ 1IBLF 4YR0A 1HBNB 5KFUA 3FDSA 3E01B 1JJ4A 1SI9A 2FIUA 1H6KX 3FBBA 1RISA 1DLOB 3PX4A 2F7VA 3BH6B 1Y7PA 4KAIA 2F3JA 3R6GB 3DDKA 4DV6J 1N5TA 2HNZA 3UN5A 2PFDA 3G71S 5HMXA 1XNQJ 1VQ6S 3L7OA 3AQOA 2DGTA 2D9PA 4F4YA 3UN3A 1TK5A 2UUBF 1SJFA 2C3UA 1ZOTA 1N4LA 4GO7X 3HSDA 2JHEA 2XY6A 5F9LA 3IG1B 2BJEA 2EPIA 3R5JB 1WF0A 1AT1B 4BHQA 1RAGB 5KFSA 1RLDA 2BOPA 3OHBA 3HDSA 1TL3A 3OL7A 1B64A 3O1LA 3D6HB 3W5XA 4D3GA 2FVSA 4TLQA 3U02A 2AJ2A 1IBMF 1HPZA 2IJNA 4RO0A 1RAIB 5KFXA 1DTQB 2QMXA 4ECRA 1NDCA 4ECWA 1YZ7A 4Q8FA 3GMGA 1PIEA 2IY5B 4QBUA 3CULA 2KJVA 2CZVC 1DTTB 3HCXA 1S6PA 1XMQJ 2C3YA 4F4KA 4OMFG 3GE9A 1ZPVA 2BKOA 3HVTB 2ZHAA 3KJVA 3Q22A 2DKOB 4FKXA 2FLNA 1N8RT 3HSZA 2GHVC 4NLVA 2CQCA 3CIMA 5LL6d 3RB0A 4IR9A 3KNAA 3CC2S 3D67A 4NYOA 1Q16B 3OR1B 5CA5A 5GMEA 1LKZA 2WB4A 4J9MA 3BV8A 4TY8B 2NXEA 2GW8A 4F3MA 4C8KA 1VBZA 4IFVB 1RT3B 3IGVA 2DHSA 4ZPBA 3VZHA 2CQHA 2OSQA 4LVNP 3FUYA 4P75A 4LF9J 2OPQB 1V3ZA 4KFBA 1F1BB 5BYSA 3DRSA 2B5JB 3ENAA 1M5VC 5D6GA 3P5TL 4G1IA 3HJVA 4DPUA 3K17A 1WG5A 3K5PA 4ZCLA 5I3UA 1IJEB 2EFQA 2V2VA 2GA7A 1Q8IA 3A8JA 5A2QY 5DDRC 2QMWA 5DG9A 4WFAQ 1FXDA 4RKUC 3ISNC 2J6SA 2YNGB 5JVHQ 1FKPA 1KLNA 4L74A 1A7GE 2F8MA 2W2NP 3OXFA 3U1MA 4JI7F 1EQ0A 1K0TA 2FHJD 5CAAA 4X4TA 4N7TA 4OZ1A 2XLIA 5RUBA 2WBRA 3K7RA 4ZKAA 1D8ZA 1TUWA 1YIJS 2ZFHA 5JMNA 4OJ3A 4FPRA 1FJEB 1RHJB 1FFGB 3PHEA 5B0FA 3OSPA 1KFSA 1FFSB 2HW3A 3RGIA 1SVDA 3M9NB 4WFNQ 1NAQA 3M1VA 3FSYA 3MM6A 4IQMA 1YK9A 3VTIA 2G1DA 2AEFA 1HD0A 4OV1A 4RW8B 1SQEA 2YWKA 3C8YA 1KVIA 2QFJA 2VHGA 3I4HX 4N8OA 3M2UA 5D4OA 2PA3A 5C24B 1C4AA 4X4SA 1Q86T 4DV4J 3BBBA 1YJRA 4R8UB 2EFVA 3UI3A 4NMXA 3JSRA 2FLLA 1BQNB 4WYWA 2DHXA 2F1FA 2V0NA 1QUVA 3CF5Q 3AD7C 4DV5F 2HWTA 2YKMB 2IBKA 3D1QA 2HNDB 2XWYA 4OZ2A 3FKBA 2VQFJ 3FBCA 1LFPA 3EZ5A 4JOUA 3IR6B 1LW2A 3HVAA 4G1QB 2NUHA 2GVZA 5K8PA 1KD1T 2ZE2B 4ANCA 2HPUA 4O0NA 2DEJA 2F9JA 4B3MJ 4IH6A 3IGNA 2XSJA 2R2TA 1NH7A 1WKLA 4TY9A 4FYYB 3L09A 4GC6A 1VFJA 4C9DA 2DNHA 4BS2A 2Y8YA 3NCRA 3BH7B 1U49A 1S1XB 3MR7A 4OJGA 2K1RB 1TKXB 2EBEA 4HL9A 4ZLPA 5J2NA 3VAMA 3RRHA 1P27B 3AXKA 1JLQB 3R7SB 1FTCA 4JI1J 2PI5A 4CLWA 3D1HA 2YKNB 4J9VA 4RW9B 6FDRA 1GMUA 5F0WA 3I56S 4Y65A 3HHLD 1Q7YT 2DXEA 4AT1B 3K5NA 3ADAC 3L3CA 3RBZA 4DQSA 2XNQA 1FFWB 4DL5A 4GVBB 4AXJA 2WSCC 3SSQA 1C0TA 3MEDA 5J2QA 4NEYA 4HVZA 1UTAA 4P9SA 2QTWA 2AJQA 2R7WA 3R1LA 2RQMA 2NXJA 1CJTB 4HTJA 2YNFB 2MYFA 4N56A 1TELA 3RU0A 1K73T 4HACA 5KFMA 1TKZA 2O67A 3GWCA 4XAKA 3RJMB 3H20A 3MI7X 4OX6A 3Q0AA 1FDAA 2XGQA 4M63A 1JLBA 1ZAVA 3KLIA 5EDWA 5E3PA 5LXRA 4HI2A 2PEHA 4QOTA 3SMZA 5KT2A 5LOQA 2UVWA 2EVZA 3IS9A 1X4GA 4IH7A 2V5HG 1SBRA 5ETOA 2UVVA 1DJ0A 3BGUA 3PG9A 4ZVPB 4B3SJ 3KLGB 5I4MA 4EFAC 6FD1A 7FDRA 2R8JA 5HP1A 1X9MA 4ZJQA 4DV0J 3MTKA 1C1BB 3JYTB 2Z57B 1HNZF 5HANA 4E8UA 5HJYA 1UA0A 4ZLNA 1T0TV 5J2PA 3CDEA 2BQRA 1WDDA 3DGPA 1TUVA 2PI4A 4DZ6A 1GK8A 2HK3A 2BE2B 4CQ1A 3N01A 2W8KA 1EIYB 2KVQE 5SZTA 2DIVA 1ZTWA 2VDHA 4KH0B 4DN0A 3J7A1 5A8KA 2CDRB 5D8HB 4DN9A 3NCPA 5I42A 3KLFB 4CYUA 1MG7A 2LQ9A 1LWXA 2QZ8A 3ZZ0A 4GRSA 1X9SA 1OY8A 3ENVA 1IBKJ 4C97A 1QM9A 2ZH2A 1BHNA 4BWJA 3BR8A 2HQIA 2OUGA 4EWTA 4DX7A 2GIQA 2HQCA 3OR2B 2APOA 5JUMA 1L3KA 2CZ4A 4X62J 2HVDA 1GH8A 4ANEA 4ZP9A 2VONA 3CCJS 2MZJA 2EFPA 4OJHA 3MEKA 2IJRA 4KSEB 3QIPA 5KFBA 3CUNA 1U6FA 5DG8A 5T7LB 5MLCV 3AJ2A 3SDEB 1S79A 4H54A 1QLNA 5DM6Q 5H9FJ 1K47A 1WC6A 4QIVA 3SQOP 4QWDA 3L95X 2YQ3A 3JSYA 1TKTA 4ZN1A 3DOLA 4OZLA 2MB0B 2HHHF 4JV5J 4RUBA 5IWAJ 3T5KA 3LAKA 4NXNF 4QYZK 1HNVB 2OMLA 4QWCA 4I69A 2MHNA 1XIQA 3PTWA 2HBYB 1UCNA 4EBCA 3H0PA 2RHSB 2J7KA 5L1KA 3OSNA 3RAMA 1JQGA 4LF5J 2E5IA 4NA3A 1B7FA 4O0IA 4MJKA 5FLXY 1P6TA 4IUFA 3PJ9A 5IT9Y 4FXDA 3C6UB 8ATCB 5K20B 4E2FB 2DNZA 3PFEA 1N5QA 1D09B 1TR0A 1DFDA 2WW8A 4CLSA 4CLUA 4LBIA 2OTJS 1JLEB 2R7RA 1Y00A 3SV4A 2O3DA 4ZJOA 2XZTB 2XBPA 3SSSA 1S4EA 2DGVA 1FWLA 4OZNA 1KHWA 2YY3A 3J80U 1IM4A 3H5XA 1Y10A 3DXBA 2LQ5A 5HL7Q 2X1BA 4LMZA 2CVIA 3CJSA 2M70A 4LBHA 1NDLA 2Q1LA 4DL3A 4PXBA 1XK8A 1HBNA 2V8VA 1F3VA 2CNNB 3BO4A 3V2UC 3CSKA 4RR5A 5LJ5Y 4MK9A 2JNJA 4XDCA 3O44A 1FE4A 3JSMB 1ZM9A 4HDHA 4G1PA 5A0YA 1KQKA 3DU6A 1DLOA 2FVRA 2YTCA 1RAHB 4LF6J 2H5IB 4R0EA 1NU4A 3C46A 2PT0A 4I68A 2UV8G 2DPIA 1DQ8A 3MR2A 4F0HA 4DSIA 4M5KA 3O2IA 2IHR1 3R27A 4PG8A 2ZJRQ 2NSCA 1R6VA 3QO9B 3IG1A 4P7TA 3GFZA 2W24A 1B99A 2AHOB 2J7WA 2RDJA 4JBCA 2HHVA 4C0BA 3HHLA 1U1MA 3N4WA 1IWAA 1R8HA 1MWYA 3FMWA 4P72A 2QA2A 2BV3A 3V6HA 2XC9A 1RQ0A 1DTQA 2JEFA 2XMWA 3HKWA 1GNKA 2MDAA 2F65A 3ZTPA 4I2QB 4RL1A 3A8EA 2VICA 2J9DA 1DTTA 4L6V3 3M2RB 3M05A 4K4SA 2XZDB 4FBUA 5ETQA 2GO9A 3OHAA 5F0UA 1OWXA 2ZWPA 2NZ4A 3D0GE 3HVTA 1XEZA 3PIPQ 1WKJA 4O4GB 2ALZA 3KLHB 1P9QC 1NSAA 4O3QA 3UD4P 1S57A 4P2FA 4WIIA 1FJGJ 5CD4H 1ZM4A 1Q8LA 3T1YF 2JLEA 2DHGA 2NPFA 3OR1A 5L1JA 2ASDA 5KFKA 4TY8A 3Q2TC 2RB7A 2QLWA 2C1EB 4NXMJ 3EICA 4IFVA 1RT3A 5CYMB 4HT5A 1JXEA 4IG0B 4Y0FA 2OPSB 2J7UA 2Y0SD 1GAOA 2FJXA 1UL3A 2X3DA 5AT1B 1JJHA 3NNHA 1RAJA 3KK3A 1ZH5A 1LXNA 2EEYA 3TUPA 2L08A 4NLWA 4CO3A 3QRPA 1O51A 1DURA 2LXFA 2HVEA 2PMHA 3ITHB 1SCJB 2J0SD 2AW0A 2D3O1 2B5JA 1AROP 4WJBA 2EC0A 2AYGA 4X84A 5DGBA 1C4CA 2LMIA 5EHHA 2IJFA 2HBRB 2UUAJ 1HQUB 2RE1A 3CCQS 5M2UA 1CC8A 4OYIA 1S9FA 5J1NA 2H5EA 2L9NA 4B3OA 2BJ8A 3I5BA 1TFWA 2R2SA 2YNGA 2VJVA 4K4YA 2N3OA 1NK0A 2CKWA 4I7FB 2VFUA 2XS7A 1WD6A 1V6HA 1RWUA 3A3OB 1HI0P 1SJ3P 1NK6A 4M5JA 2HZAA 4IFYB 4P7VA 4MK8A 4BWMA 2C2RA 4F02A 2CUYA 3PX6A 1X0PA 3OQ2A 3HVWA 2R3VA 5T14A 4PQUA 4I6AA 4V19X 2BYCA 1YLXA 1UEUA 1F6TA 3LP1A 2E7XA 1NJIT 4N76A 3M9MB 2B6AB 4RW8A 4C11B 4DI6A 3DLGB 4PWUA 4NZ0A 2I2YA 4DR6J 5C24A 3MXHP 1PG5B 1HHTP 2OMOA 2C2MB 2X1AA 2O01C 2V4QA 4R8UA 4DUZJ 2E1AA 4NI2B 2QSFA 4G65A 4NLOA 1BQNA 3W2WB 1U1LA 2H3EB 1IUJA 3FZBA 3UWTA 1PGZA 4N41A 4DV2J 3TA1A 2YKMA 3NG8A 4C0HA 2HNDA 4F4AA 4Q8EA 1TL1A 2GMJA 4EUVA 2K06A 3UDCA 5B0CA 1HYSB 3QAUA 3T5HA 5GMDA 2MKSA 2BRKA 3ENWA 1GX6A 3A8IA 1SIWB 3FRZA 2BZ2A 1F3FA 3O6QA 4G1QA 4DR4J 2QE5A 1FO1A 2NR0A 4OI1A 4DCPB 2ZBRA 1QSYA 5DZ6A 4DR1F 3J7AN 2AEMA 1H3DA 4Z7YA 1O5JA 3BREA 3OD2A 4IG3A 1VQOS 4MTPA 1WG1A 2IAJB 2I8EA 1GXLA 1XNRF 5LMUF 1REGX 2IDEA 1S1XA 3KK1B 2K1RA 1TKXA 3RG6A 1D9AA 4DFJA 4CLKA 1H2TZ 1SV5A 4QIWD 4FNIA 3GG1A 1JLQA 4YY3J 1KVJA 2RRNA 5H9EJ 5FD1A 4WWSA 2YKNA 5L39A 4RW9A 5AE1A 3F0NA 1VQYA 4F04B 3W5YA 2LYVA 1EARA 2J9EA 3BJYA 3VGVA 5L46A 2QLBB 1N33F 1VQ9S 3SXLA 2VA3A 3RW7A 2NYHA 4GVBA 5G0RB 3N79A 4DUYF 3AH6A 2W9BB 3DRPB 3AY0A 3TI0A 4ES2A 4GO5X 1OYEA 2WVBA 3PNIA 4WKRA 4KQZA 3CCES 1ZZFA 4F2RA 3I31A 1CJTA 2GGPA 2YNFA 1VBXA 2R7TA 3C2PA 3KDNA 1WEXA 2WW4A 3IWNC 2F63A 3IAS9 4ECQA 2N82B 2MQNA 1FXRA 2KXHA 1VQLS 1NHVA 2X7IA 4ELTA 4DSKA 4LF4F 4AXIA 1RLCL 1S0VA 1S6QB 4M95A 4RBVA 3J7Z5 1S5ZA 4KGKA 1C0UB 2VG7B 2ZH6A 5DG7A 3VAFA 2UP1A 2DNRA 2ZHBA 3FEXB 1XQIA 3TARA 5A2QU 1X5PA 1U2FA 5K9FA 3VQTA 1DRZA 4F4ZA 4ITSA 3IA0A 1KLMB 2NQPA 4C98A 5DDPC 3GYXB 3TR5A 2M7SA 4OZ3A 1WI8A 4JI0J 3HSGA 1H7WA 1M5SA 2XHCA 1C1BA 3NCQA 5DGAA 3AA8A 3HZEA 2O1PA 3JYTA 2OPPB 2G13A 2UXDJ 2XYHB 3D5MA 2AGQA 3Q83A 3EVMA 5D77A 3V6JA 3PW7A 5LM7E 3OTOF 3SCKE 3EZOA 2BE2A 3MURP 1H0HB 5AXLA 2P5VA 1W2BR 3G86A 1NZ8A 2CWXA 3K8WA 3OVSA 4K4WA 1YJ7A 2XEXA 3KLFA 1FD2A 2WB1D 4UF4A 3V81B 3FCHA 1V5IB 3D66A 5KOWA 4M5LA 5HI7A 1ZM2A 2XULA 4X4UA 3F44A 1TV6B 1HR0F 4UOFA 3I6PA 4OLPA 1GTEA 3OR2A 2E9ZA 4XIUA 1HNIB 1N5VA 3PKYA 5KFLA 4F50A 3GONA 2KHCA 1M1HA 4EZ9A 5G4DA 1UFWA 4L72B 4NOHA 4IKAA 4M5DA 2QYCA 1EAYC 3FEYB 1YDLA 2YWWA 4MFBB 1ZZNA 4LT6A 1RZMA 4MIWA 4KPCA 1T9TA 1PYOB 5IT0A 5CYJA 3RB4A 2DO4A 1OY6A 3AJDA 1H7XA 2DVIA 2HBQB 4KHRA 4O44B 3H2UB 3TA0A 3TVYA 3Q8VA 2VL1A 2QYGA 5KFYA 2J6UA 5D0HA 2P9CA 4Y2CA 3JS9A 1UMJA 5CCLA 2IDLA 3T6BA 3GYGA 1JLFB 5F3ZA 4IRCA 1W25A 1YG0A 3RBXA 2LFVA 3FSIA 4C0OC 1DQ9A 3C6UA 5B0GA 4WP8A 4RJVA 1PYTA 1E6YB 3KJQB 4CO2A 2MQOA 2QN6B 3TUIC 3TZWA 2B8QA 4IO9Q 1JLEA 2Y3YA 5KFCA 1XR5A 4U7UD 4ECVA 1D9DA 3S7RA 2FVPA 4F3QA 4ZVGA 2RKIB 3DN9A 1FD8A 4ER8A 3QZ8A 2G0CA 5D15A 1T03A 1J27A 1MMNA 3EZUA 3IMQJ 4LSLB 4R25A 1Q79A 3R8YA 2IM2A 2DH8A 3M2VB 4USWA 8RUCA 1HW8A 2E66A 1T9YA 2MPUA 1UWBA 4ZMMA 1KQSR 4WCEQ 4AYBD 3QJPA 2KL8A 2CDQA 2XLKA 3OV7A 2PEBA 3IRWP 3JSMA 3T1HF 4Y2AA 3PW4A 3S8SA 7FD1A 4PG6A 4I6WA 3QGPA 2XI2A 2ZH8A 3H7HB 3CTRA 2ILZA 3I82A 2X1GA 5KT4A 2CNKB 3ILIA 2BRLA 2KYZA 1T94A 4NLRA 1F2GA 3CDBA 4QZVB 4OL8A 4FYDA 4UZBA 2UUTA 1VISA 3QO9A 4ZVEA 3NGSA 4DS5A 2H9ZA 1BLUA 4KGZB 3B4DA 2HBZB 1RWVB 4NLXA 3KG4A 2BA9A 5CD4A 4X64J 5DLGA 3CJQA 3AODA 4CH1A 3AB4B 4DHVA 1N6QA 2UXBF 1KP6A 1HL6A 1MWQA 3D0IE 1UEVA 4ZVUB 1VRTA 1N56A 4WU2A 2YWHA 3HKZD 2HIYA 2BACA 3DHXA 1TP7A 3W2VA 4I2QA 1VHFA 5AE2A 5DZ7A 3UD5A 2LLZA 2Q6CA 2FLOA 3M2RA 3VGUA 1IXKA 2NPIA 5B0DA 3WQPA 3HD1A 3MPDA 1NJYA 4LF7J 4A46A 3CJ0A 5DQIA 3CDAA 2RUGA 4BC7A 4Z7CA 5A8WB 1TL4A 4DSFA 3KLHA 3SQGA 1HQEA 3I5CA 3ZZPA 2CFXA 1TVRB 1GMWA 1EP4A 3TJ8A 1W7WA 2DHHA 2C22A 4DV6F 4A8FA 2KXNB 4J9PA 4GVLA 5K5MA 2JFKA 1XNQF 3QIDA 3VAKA 4I2PB 4EYHB 3HZGA 2D1CA 1YJWS 5H9FK 1WI6A 3FBFA 1MMLA 2OSRA 3B8HA 4CLTA 1VQ5S 4N47A 2DY9A 1FA0A 1NRKA 3SYZA 1RHMB 4IG0A 2OPSA 1XTZA 3EYZA 5CYQB 4XK8C 1WTBA 5ETNA 4YR2A 4PUOA 1SH2A 4F0KA 2R7OA 5HO4A 1PJ5A 3ITHA 4LR9A 1M0SA 2ZITA 3C16B 2M0GB 1UVKA 3KLEA 4K0KJ 4YUDA 1X7VA 3K0JA 1TK8A 1UKUA 8AT1B 2HHXA 2EKYA 3R5GA 4KO0B 2CRLA 2WVFA 3JB9k 1Q53A 1TTHB 1HQUA 1KOHA 2B7BB 1RWOB 2KFNA 2VFVA 1KKHA 1VQNS 3Q86A 1EZZB 1XMQF 1N34J 2GO8A 4G3IA 3Q24A 3OFEA 3MUVP 4KIAA 3TP2A 5AXNA 1NMEB 4PG5A 1G1XA 2KTQA 3DLHA 3D6MB 4W98A 4I7FA 4IDKB 5FLXU 5IT9U 2FPHX 2G2ZA 3TRGA 2CQ0A 2Z30B 1UJ5A 5F9NA 3TAQA 4IFYA 2MSTA 3CXCR 2E5HA 1SC4B 3TX0A 2KYXA 3GJRB 2IM0A 2LA6A 2AWZA 4J9NA 1RK8A 3MCSA 4DZDA 2MLYA 2RS2A 1HWLA 4UY8T 2DIUA 3ONQA 1VYAA 4DU7A 3E3XA 4DPXA 1Q7LB 2CVEA 2HGNA 3ILLA 4PABA 1CC7A 1LWEA 2KT5A 4C11A 4NYPA 3DLGA 4LF9F 2QLXA 4QU7A 4A8WA 3OFHA 1X4HA 2JC0A 4DQQA 1U1PA 3BN4A 1NLKL 2Q43A 3QBCA 4M5HA 4LBPA 2RQKA 2G9OA 3I0RA 2MKKA 2DO0A 1MN9A 2LDIA 3FNNA 2W9CB 1DHMA 4NI2A 3BEGB 1FEEA 2GQQA 4AQYJ 1U8WA 3S1TA 3CNQP 3BPSP 3W2WA 4O3RA 1DBDA 3KG1A 1M5PC 1XMBA 3VALA 2J8SA 2E9RX 3I55S 3JTNA 3KXDA 2ACMA 4CO0A 3DC2A 2IVFB 3ULHA 5T41A 2J0XA 1MROA 3MMBB 4OIXA 1HYSA 5HSPA 3MM7B 4J9SA 1U25A 4WXWA 2JL9A 3ZXWA 4IH5A 2QV6A 2YKOA 3BO3A 3EGNA 2V2QA 4HKQA 3TOQA 2FTRA 5E7OB 3DRXA 2H54B 1UFKA 3BO2A 3F73A 3RUBL 3GV5B 3RW6A 2GC8A 2V50A 1WKKA 2ZVSA 3T9NA 3KOAA 2BJ7A 2IAJA 1U0HB 4AD6A 5KT5A 2DJWA 1N52B 4F25A 3D9BA 5KFZA 3KK1A 4ZP7A 3FFIB 4LSNB 1HBMB 2E5JA 2D7SA 1P8GA 3LP0B 4XO0A 4DX6A 3LTOA 1R8AA 1H98A 5F8HA 3CCLS 4KBIA 1ZETA 4K7QA 4DV4F 1OS5A 3AOAA 3ET6B 1CS4A 1R8PA 2IM1A 2B0GA 1EKSA 4PPZA 2QL5B 1VGYA 4TVAB 4PWDB 1FEHA 2O5DA 2ZNZA 2OD6A 3CCVS 2E5LF 4QPTA 3DM2A 1Y9OA 1EQMA 1ZYQA 5G0RA 3S6EA 3E51A 2W9BA 2EFNA 3DRPA 1CSJA 3B6BA 3BYRA 3GYNA 3NGUA 4DG1B 2V68A 1VCTA 2Y8WA 1IR0A 3MR3A 3Q8YA 2G0JA 5C7PA 3W1YC 2A2DA 2DRBA 4R5PB 4C8NA 1HMVB 2J6TA 4KHPJ 4DCJB 3FMBA 1SL0A 2HQDA 4DV1J 1Y3JA 4B3MF 1FX2A 4UY85 3UVJB 3N6LA 2K8GA 2PIIA 3M8YA 4J90A 7AT1B 2HWHA 4JI2J 2LVWA 2XMMA 3DDIA 2ZZNA 4DFMA 3MM9B 5FDLB 1S6QA 2YNIB 4F26A 2AYBA 4Q5VA 1C0UA 4DX5A 4DL4A 4B9VA 4C8OA 3V4IA 3AD9C 4CDIA 1QAJA 2UVRA 4ICLB 2OEJA 3S01A 1VC5A 2Y1IA 3QNWB 1QAXA 2ACYA 4DR3J 5D0EA 1FK9B 4JI1F 3RB3A 2F5GA 4ZCKA 3KJNB 4M8LA 1S99A 1NDPA 4DSLA 1KLMA 3TAMB 1YKWA 4PZVA 4TQSA 3DYAA 1X31C 3IRXB 2CPXA 4OHVA 3CMES 3MEGB 4ED4A 3DCAA 3GR0A 3OTCA 3IR7B 4DSJA 1UW4A 5HMWA 2MY7A 3TA2A 4X2BA 1BE4A 4OQJA 2BQ3A 1RT7B 4LRCA 3MFIA 4ENOA 3IP0A 1ZA2B 2LECA 1QY7A 5HQMA 2EI5A 1TZ0A 4CI0B 4FBTA 1YVFA 5JVGQ 1PJ6A 5C25B 4KKOB 1MW7A 1PKUA 2MMYA 3KUEA 3V81A 1RAOA 4YB5A 2KT2A 2Q79A 3AT1B 3ETOA 2N7CA 4DBQA 4USJC 5KG7A 2WOMA 1UPMB 1TV6A 1PBUA 4MKBA 2MLZA 2VOPA 4OYOA 4F7VA 4U9RA 1QE1B 3NNAA 4ZCIA 5ETKA 4WKYA 4QWAA 2HRTA 4WF9Q 1RTIB 3SBMA 5EX0A 3H90A 1X0FA 2F4FA 3U27A 3QPIA 2MKCA 4QPXA 1HNIA 1WF2A 3NEKA 1WOOA 4ZP6A 2MQ8A 4RNHA 4AL5A 3H8YA 1QVGR 4AUKA 2OEMA 2BJDA 4B9UA 2BJ9A 5KT6A 3FJ2A 4B3SF 2XMJA 2J0QD 4MFBA 3LGHA 1N48A 2V67A 1S77D 2LU1A 4U7CA 3JTOA 1IQZA 4YB1P 2VA2A 1FRLA 2CJKA 4TYBA 4B9SA 3IWLA 3PHTA 5M2RA 1QAIA 3HO1A 2AX0A 2IM3A 2U2FA 1RBLA 5HVGA 2P9GA 3DOMB 3MMAB 1WOSA 4ZOSA 3PX0A 3DRRB 1NB7A 3ZNJ1 3CJTA 2OEKA 4K5SA 3QWUA 3MPWA 5F3TA 3N6NA 4X4OA 4KTQA 2BR0A 5FIIA 4P6QA 1RT4B 1JLFA 2HHTA 4WZQA 4ZVQB 3BGOP 2HAIA 2RVJA 4ILLA 5GADU 1IBKF 4KT0C 4XTTA 2B7CB 2XCPA 3DMJA 4K4XA 1E6YA 3MTJA 3H5UA 4JYAJ 2OH2A 2AX1A 4CIOA 3DI6B 4RNOA 4JI8J 2H4YB 2ZOGA 2OPRB 5GADI 2E1PA 4IO1A 1KOOA 4X62F 3BGFA 2RKIA 5K14A 1EETB 2XZWA 3MAAA 2K3IA 1H73A 1XR7A 2LU2A 4HDGA 3K5LA 1RCOB 4LSLA 1NK5A 4WIQA 1RTJB 4ELUA 4RZRA 3M2VA 1HWJA 3GV7B 3Q8QB 2FC8A 2V63A 5KG5A 4P2SA 3M8QB 2B4VA 2MJNA 2HG4A 2P6TA 3CDWA 4EBEA 1F9FA 1F60B 3G8TA 4LQ3A 2HRYA 1U09A 4ID8A 1LWCA 3KNGA 3G6XA 3FVYA 3GIJA 4ZIWA 5IWAF 2K3KA 2FHMA 3C3LA 4CO1A 2CADA 2FVQA 4OHWA 2H51B 2PSZA 2VIHA 3U7JA 4ZPDA 3EVOA 2UXCJ 2DNOA 1UETA 5IM0A 3MECB 2FQQB 2A2CA 4LF5F 3EXYA 2VG5A 4TU7A 5AXMA 2AV5A 1NK9A 1FRJA 1F9EB 2CQ3A 3LWMA 3CO9A 4MKYA 2ILYA 4YN3B 4OX9J 5HN0A 1I6JA 5D4NA 2KU7A 3QFHA 2FD2A 2DITA 3K5OA 2XNRA 1ACMB 3TW0A 3ZZYA 2RJZA 1QDUB 3K59A 4EO8A 3OXGA 2YWEA 4YR3A 4PYAA 1T3NA 2IRXA 4CNZA 2B51A 4I56A 1MN7A 5HQ8A 2ZJPQ 3M8SA 2R8HA 4IYQA 1QSLA 2WRMA 5E3QA 5E3CA 1WG4A 1DY3A 2PO4A 4DLGA 2QG9B 2E9TA 1F0XA 3CDUA 2A6MA 4I1TA 2RDIA 1RTHA 5D78A 1H72C 1GXTA 1SL1A 2OD4A 2DCUB 3P6YC 2XYGB 5J1EB 2VDIA 3G82B 1BC6A 4LF6F 1SPBP 1TVRA 3W62A 4ED6A 3G6YA 1PC4A 5KFJA 3VVUA 2PFFB 4S0MA 4PPDA 2MEWA 3NWRA 1OY9A 1X5OA 3G2XA 4DR2J 4OI3A 4WFZA 3T9ZA 2IBOA 4RPFA 2FUG9 2RDDA 1SC6A 3IM8A 3QAEA 5KFFA 4DSEA 1HKAA 1HBUB 2L9WA 2N7YA 3M7VA 5CYQA 2F8HA 3RTVA 2VPYB 4PXCA 1XR6A 3B54A 3BDPA 4HR2A 2M9KA 5BR8J 2B9WA 3V6DA 4FXWA 4A8SA 4IOAQ 1UEKA 1VRUB 4YB7A 4B3TJ 4TYAA 5H1SV 1GTHA 2B3TB 4LR8A 2W2OP 3C16A 1KHVA 3A13A 1C2PA 4J9RA 2BBEA 3C15A 2UUCJ 3LF0A 4F8RA 4JI6J 1C1CA 1FF2A 5E2QA 3UCUP 1SXLA 5B0BA 1XN9A 1JNZB 3E8OA 5K8OA 1HARA 1U6ZA 3RR8A 3OJUA 5IZHA 1TKDA 1OSDA 2MKJA 5HK4A 1NZAA 1G6BA 2AJ4A 3IO1A 2QGFB 3W65A 2DGWA 1NO8A 2E29A 5L1IA 3AFGA 5C5JA 5KFQA 1U47A 1UJ4A 2P6SA 3QRQA 4RW6B 1X4BA 1FJGF 5EWGA 1HWIA 2H4WB 3ZZTA 1KVKA 2FHKA 3T19A 4M5NA 4YMEA 4ZVHA 4ERDA 2IRYA 3FQLA 5ETPA 5L8RC 2HQGA 3H40A 4JV0A 2BXJA 4MKAA 4MH8A 2HFSA 2CWKA 4J9KA 3EXCX 2KVIA 4NXMF 4E98A 1YRUA 3MR6A 3DLJA 1VIOA 1FHTA 1TFYA 1WEYA 3G8QA 3WBZA 2N4DA 4TKTA 4BDPA 1R0BG 3PR4A 1JIHA 1E6VB 3J81U 5KTQA 2DB1A 2KO1A 5IFMA 1WELA 2D9OA 2MZ1A 4Y2KA 1YTYA 2R2UA 3PYFA 4HHJA 2GMHA 2OKQA 2CQ4A 2W9CA 3MPUB 4B02A 4Y00A 1NKBA 2DGUA 2UUAF 2EK6A 2A1BA 4C4WA 1YBAA 1S76D 3B82A 5KFIA 1YJNS 4DL6A 2CJ9A 1VS3A 3PACA 1MWZA 3MMBA 4QYRA 1SJ4P 3MM7A 4P2MA 5IQQA 4BC9A 2X3GA 4J37A 2W1BA 1B0VA 3TZZA 3KMSA 3GCXP 3CT9A 1UVLA 4F4XA 2YKAA 2L48A 3MMCA 4C7QA 1S49A 5EUHA 1WACA 3WHIA 4OYMA 1FKOB 4ECZA 3KWMA 1KR4A 1U2CA 2HYIB 2BE7D 2QO3A 4L75A 1IBCB 1U0HA 3LQVA 2KKHA 4ZVTB 4EEYA 2KG1A 2NSBA 1VQ8S 2DNMA 4YOEA 3FFIA 4LSNA 4A4JA 4A8MP 2DGXA 3TX8A 2B9XA 3R9LA 2W2MP 1TUGB 3LP0A 5F8JA 3GLJA 2VOOA 1N0UA 2XY7A 3EX7B 3H5SA 3I9V9 4DR6F 3NY0A 2DISA 5AXKA 3D3CJ 1JLCA 2E5LJ 4UT4A 2GHWA 3ET6A 1L3VA 3GJQB 4DUZF 1A9NB 1YRXA 2Z0GA 1X9WA 2CJXB 1R8BA 2NYIA 4A8YA 4PWDA 2EG2A 5GAHI 2CJYB 1RU2A 3CD0A 4DV2F 3I4PA 4URSA 2AF6A 1YJVA 1ZTTA 4P73A 3CJ3A 4FYXB 2VH7A 3KHHA 2ZD1B 1UZDA 3AHPA 3FBEA 3NS6A 1F2HA 2PE8A 1YGYA 2FZCB 2WSFC 2YWGA 1A0OB 4ETXA 4DR4F 3DRSB 2JEGA 4R5PA 1D3WA 1FJ7A 1HMVA 2CQ2A 3NGTA 2IC3B 2XMTA 4EO6A 3T3FA 2NXCA 5GAEI 1AW0A 3ZZRA 3UVJA 1G2EA 4USUA 3BS9A 1FDDA 1JXLA 2GX8A 5FDLA 3HFKA 1PAUB 3W63A 5KT7A 2BQUA 1X8DA 4FNHA 3CCWA 2WVDA 1SKWA 4UUWA 4KV8B 1JMTA 4PXEA 2GJIA 4ES3A 1CPZA 4DPOA 1D0EA 2ERRA 4P71A 4ICLA 2CQPA 1RT1B 3M32B 3RZAA 4F2SA 3M4XA 3K58A 4YY3F 1FK9A 4KJIA 2C2NA 4O3OA 2DGQA 2NXUA 2VUGA 3HI9A 4X65J 1XWLA 4KY3A 5DQHA 3CJKB 4WBFA 4USHA 3RAXA 4CT9A 2K2PA 2FJEB 3MEGA 4LIWA 1SL2A 2VF3A 2VV5A 3FZ2A 1AA1B 2AT1B 3NL0A 3R5DA 5D4LA 3IBCB 1EJ7L 1I5OB 4UTGA 1NJWA 1LFWA 2HRUA 1K0VA 4K50A 2MJUA 1RT7A 1F9HA 1IKXB 4HHUA 1AFIA 1RT2A 2RILA 4O3PA 1FVSA 2XS2A 2YPYA 1CQMA 1FJCA 3HHEA 2M5YA 4MMOA 2R42A 2V34A 3W60A 2OIHA 2FHOB 1NNDA 3HULA 1YITS 2I9SA 2PC6A 1UZHA 3MM5B 2GIRA 1CLFA 2QC3A 2W7AA 4X4RA 3K57A 1NPKA 3MFHA 1BWVA 4AL6A 1QE1A 3NXZA 5THWA 5ITHA 3LWLA 2GAGC 4BLGA 2XO7A 1RTIA 2ATLA 2HURA 2RNEA 1LW2B 3KUGA 3B78A 4NX9A 4DX8H 4U95A 3GCWP 4TLRA 4EYIB 4DF8A 4USMA 5BJRA 4UOGA 3GV8B 1N88A 2ASYA 4FYWB 1BD6A 2AD9A 2J9CA 1TAQA 1FNOA 4PR6A 1G7CB 4NLPA 3GB0A 4JI0F 4Z37A 4RX6A 4RWXA 2OJ3A 3HHDA 3CO0P 4N77A 5B0AA 2UXDF 4F3OA 1WNEA 2Y1LB 2OP5A 5HVHA 3TNVA 3M9OB 3TANA 5LMNJ 3DOMA 3VCDA 2Z2ZA 3MMAA 4WTYA 3DRRA 2MZQA 1JLGA 4NLGA 1U7LA 1N5SA 2F9DA 3TZYA 5D3GB 2XMUA 1VQPS 2V6AA 2B9YA 4NL5A 1RT4A 3JQKA 4B3RJ 2OI2A 2QIFA 2HFZA 2WONB 1RAFB 4RNNA 4ZHRB 5DDOC 2W7PA 1Q0NA 1RU1A 2HIQA 2BKNA 1RAAB 1RSCA 4M5MA 3CPWR 4QCLA 4ID5B 2F40A 5LSRA 3HX9A 3LW5C 5DJBA 3DI6A 4DPWA 3FC9A 2ZH1A 1PILA 3GU0A 2CPJA 1PAEX 4FXVA 3UNYA 1EETA 1B70B 2VBWA 3J7YU 2GCFA 4KPYA 1OQ3A 1UPPA 1OIAA 3NGRA 2RRAA 1T7PA 3R5AA 3H2VE 4FYVB 2AYEA 1MU2B 1VHIA 5K8MA 2VC1A 3M8QA 4Q2LA 3J7YI 4Q2MA 3EDRB 1VLOA 3PYDA 3BM7A 1UA1A 4B9TA 2KI2A 1RAEB 1OPIA 3N6MA 4Q44A 4ZLJA 5AJ3J 2DTJA 2JFDA 2Z8QA 1FRKA 1H38A 2GAHC 4DL2A 4ZP8A 1XC9A 4KR0B 2VPWB 3UCZP 4Q7AA 1HD1A 3DLEA 3MECA 3DXSX 2RU9A 4OFZA 5HP1B 2C2OB 3SFUA 2AP6A 1YRTA 1RTDB 5C42B 2OFHX 3ZO7A 2FGOA 3N5BA 2ZC4A 4Q0BB 1S1WB 5J2PB 2XM3A 4F67A 1N5YB 3PCOB 2BJ1A 4DOZA 4OYZA 4WXOA 3C6TB 1P1TA 3L7UA 2MQQA 3LO3A 2ZBQA 1KDNA 4G6VB 2YPZA 1N32J 3BKFA 3WIUA 1U6BA 2AKWB 2E5GA 2DEIA 3WIVA 4NYZA 4DLEA 3CC4S 2D74B 2G2YA 3E01A 5DQGA 4XPCA 4RW7B 1RKJA 5IXUA 5IC6B 5A76A 2WK4A 2ALYB 3MZIA 1HWUA 1SUQB 2IVYA 2H1YA 2Y1RI 3D1OA 2IIHA 1L3UA 2YQ0A 4DEZA 3LGMA 5J1EA 2XI3A 2IPOB 3G82A 3TQEA 2VFTA 2IA0A 3MPVA 2GHPA 5F41A 4ECYA 4NA2A 1WC1A 3FCWA 3BBFA 4JP8A 1OO0B 1XMOJ 3I87A 3P45B 4WK1A 4LRFA 3D3BJ 3W9HA 5J2MB 2XGPA 1REVB 3PYGA 4JI5J 4K2JA 2M8DB 4HHHA 1CULB 1CQNA 2VBXA 3SCIE 3EUNA 3Q8PB 1Y0HA 3NAHA 4QIEA 5HJXA 1TKTB 3R97A 1U2RA 4YHHJ 2CNOB 3DOLB 2AMCB 2XMKA 4OYPA 4X64F 1AYEA 1FWKA 1MMDA 3KMQA 1B0PA 4CP5A 4C3MA 1P9YA 3X3UA 1Q8BA 3GJTB 3OVBA 3G6ES 2V9KA 1S1VB 5SUHA 4TQRA 4UZCA 3PM9A 1EKRA 2BMBA 1T3OA 3UO0A 1Z2ZA 3PR5B 2J8AA 2YVSA 2V8GA 2ZM6J 1URNA 5A6WA 4LF7F 1VDHA 1ZM3A 2W4DA 5D4PA 3DLBA 3NS7B 1B3TA 4A8OA 4LFCJ 1QAYA 2MTLA 3IC1A 4RW6A 3DNCA 4B9MA 2EC2A 3G87A 1W26A 1G4CA 3RBEA 1Z4UA 1R89A 2JRSA 3GIMA 4NE9C 3H2LA 1FNMA 3QATA 3SZ2A 2JLFA 1NXIA 4DQPA 3W9IA 3KUHA 1UVNA 3CCRS 1KC8T 1KTQA 4RU9A 2OPQA 4EMDA 2KG0A 4GKJJ 1DQAA 3HP6A 4C48A 2E7VA 2IMWP 4I4BA 4ELVA 2RT3A 4CO4A 5A0YB 1RTZA 3ZZOA 3PIOQ 4GKKJ 1E6VA 2CQ1A 4GMKA 2W01A 4F36A 5LSLA 3NMRA 4HH1A 5B08A 1UAWA 4K0KF 2JVRA 4P74A 1TL7B 5CZVA 1RI7A 4ILRA 2ROEA 4TN2A 2JH3A 4Q45A 1JK9B 2GFFA 1L3SA 4FS1A 3BR9A 3I32A 4P10A 2QEXS 1N34F 3EVWA 4QU6A 5CH7B 1UP1A 3M6UA 5EX3A 1NJZA 5FJ4A 4MYTA 3HHLB 4PXDA 1ELOA 1R27B 1R0AB 1HNXJ 4CWBA 3JQJA 2H48B 2KFZA 1TK0A 2GJFA 1RHUB 2KFYA 1FKOA 3GFXA 3OBIA 1GT8A 3QT6A 5KAKA 1T02A 4QWEA 1BGXT 3BGRB 1VQ7S 5ETLA 2VBYA 3MCNA 2GIFA 3MPYA 2W7OA 1VQ4S 4W90B 3ZNUA 3NMAA 2EW9A 3DDNA 1BQMB 1RBAA 1RA6A 4HYKA 1NB2A 4UW2A 3R2CJ 1SKSA 4NPOA 4DMZA 1HQ2A 4HT7A 2CQBA 1AUDA 3D68A 2V9WA 4UUXA 4HEA9 2XHWA 3THVA 4NEZA 4KYZA 1FRXA 4AQYF 1NHUA 4I67A 4QW9A 4LSZB 4X66F 1NDKA 1YBTA 2HZCA 3HSJA 1OYDA 2ZD1A 2P9EA 3KK3B 2ZE2A 1S0MA 2QL9B 4Y6IA 3PW2A 2DXDA 3GZ7A 1VRQC 4USTA 4JI4J 4OI6A 4K59A 4NLDA 3G4SS 4FF3A 1WC0A 2IC3A 2ZH7A 2FGCA 1R6YA 3QT7A 2W4CA 3IR5B 1KBRA 3NAIA 4LRAA 4DR7J 3OT9A 2XYPB 1GFWB 3ZTQA 1ZPWX 4Q43A 3EGVA 2V8HA 5BXIA 4CCHA 1OSCA 4B3OB 3OPKA 4KV8A 4OYXA 2R9LA 4KE5A 1NK8A 3M8WA 1M5KC 4ZLLA 4LRBA 1RT1A 1RA7A 2MSSA 3HFVA 3M32A 4FN5A 1LOUA 2WSEC 3AJ1A 5HMZA 1U48A 4ED2A 1LQ9A 1VC6A 1YJ9S 3PFOA 2I6WA 1MSWD 2VBZA 5HMYA 3CJKA 3L7PA 3GSIA 3ILOA 2IMOA 3UPFA 2ADBA 5C2GA 4PQUB 1KQFB 3Q8UA 1U1QA 5C2CA 3LP1B 4WP3A 2ASLA 3POTB 2AU0A 2C28A 4YDXA 1IKVB 1BY9A 2CPZA 5KG1A 3QSYB 1IKXA 2HLTA 2CA9A 2DNPA 3G96A 3U1LA 2CPIA 1XBWA 4Y3CA 4J91A 2KM8B 3SIPB 4N5SA 1GMWD 3BQ0A 1YHQS 3QGGA 4PG4A 4KHPF 4MK7A 2CG8A 4LIRA 2OGUA 4DV1F 2J0WA 3Q23A 4PG7A 1S9GB 5F8NA 4J7CA 1J2VA 3EPGA 4JI2F 2FLPA 1UVJA 3MM5A 4M5IA 2M88A 1RWWB 3CB4A 1K9MT 3D4JA 3R7BB 1TL1B 4HLBA 4NLYA 2JLGA 1I94J 2ABYA 2DGOA 1HI1A 4DQRA 3T1AA 2QLJB 1K8AT 2HHUA 3KLGA 4DR3F 1R8CA 1CVJA 3HK2A 4J5OA 2WVEA 3VF0B 3BBCA 4A47A 3MCMA 1AXQA 2RUSA 5HAOA 3JSBA 4AFFA 3TVZA 1U1RA 1EB0A 3NGKA 4OYBA 4QIGA 4IG3B 3N28A 4DQIA 4V1Ak 3H59A 1VK3A 3P96A 3AQPA 1VR6A 1TMJA 1LV5A 3MGJA 2QX0A 2M52A 3FK4A 2XMVA 2CIMA 5KFEA 2ADCA 1SV5B 5A8RB 3CD7A 1S7HA 4FF2A 4H4OB 3KG0A 2ZVIA 1RACB 3SEOA 5D3GA 2JZ5A 2RQ4A 3ICLA 1FWPA 3HJFA 4Y28C 1RYSA 4NA1A 2PMZD 2OO4A 3LAMA 4LUBA 2WONA 3UQSA 1FRIA 4ZHRA 2IA6A 5GMKa 3PV8A 2YX1A 4ID5A 3TWZA 3LA0A 1NK4A 4O4RA 1FE0A 1LWFB 2HQ3A 2MKIA 5BYQA 3R1HA 1X4EA 3ISZA 4A8XA 2OFGX 2YQ1A 5T7LA 5D0GA 3JAMY 2GGPB 4CNYA 2HNYB 2XWXA 1X4DA 3SDEA 4DCOB 2Y9HA 3M8RA 1T9UA 1U1OA 2F8EX 2KRBA 4X4NA 1IKWB 2U1AA 2BEFA 4LVOP 1MU2A 2E44A 2HHWA 4Z2XA 4NLSA 2PGCA 4CH0S 1TAUA 3CCTA 2QJ3A 2B43A 1LK5A 3MOJB 2A6OA 4ZVRB 2VFSA 3NBPB 1HNVA 4NCAA 2M4MA 3R5BA 2KT3A 2G0IA 4M1KA 2J76E 2ZNYA 3WC0A 1ITPA 4QW8A 3PRDA 3D6TB 2QSWA 2HWIA 2QA4S 2RQCA 4QR1A 1JKHB 2C42A 1IR1A 3KHRA 1TQLA 4U8YA 2EBGA 3BQ2A 1H2VZ 1RTDA 5C42A 2P8IA 4FF4A 3CJ5A 4MYUA 4Q0BA 1S1WA 4JYAF 2G4BA 1N5YA 4P52A 3ZZUA 5ETTA 1V3SA 4PAAA 3C6TA 3F56A 1N36J 5A6PA 1WC3A 4PYDA 4JI8F 2BE9B 2DD8S 4LJMA 1O6XA 4LF8J 3M8ZA 1PC5A 5IV3A 1U8SA 3J81Y 4JI3J 2WHOA 4ECUA 2HGLA 3KYLA 1B0TA 3SI8A 2AJ1A 2HEKA 1S1UB 4RW7A 1EHWA 3BSCA 3SSRA 2HK2A 3VZIA 1SUQA 4CT8A 4NLUA 3PJWA 3N5FA 1UVMA 1JWWA 1WSRA 4IRKA 2W4PA 2UU9J 3CCZA 4DF4A 1URRA 1Y11A 2JC1A 4FKYA 5I3QA 3W3SA 4NZ7A 3GR1A 2LP4A 3CD5A 4KGXB 3PDNA 2UXCF 2MXYA 3VQSA 1XJWB 4M5DB 2F4VJ 4OHYA 4OZ5A 5J2MA 2XB2D 3PO4A 1REVA 1ZBTA 3QJJA 3ETMA 2R4FA 3EPIA 4RU2A 1CULA 2YBVA 2VQEJ 4OV6A 2FHJA 3IM9A 4DV3J 4OX9F 4LFAJ 1UWAA 4F4WA 3PEHA 2AJ0A 2OAUA 4MIAA 3NGDA 4JUZA 3SCLE 2FY1A 3DLLQ 2N3LA 4FF1A 4DV7J 4JB8B 2JEJA 2HS4A 2RH3A 1PCAA 2DXFA 1S1VA 5KFGA 2RD5C 4H4KA 3W8GA 3H4BA 2DNGA 3TUZC 4O4GA 2HFOA 3VWSA 3MR5A 1S59A 3GP9A 4M94A 4EI2A 3MUMP 1YJUA 2Q6BA 3A12A 3I5AA 1J5EJ 1KSPA 3ZZZA 3M6XA 1NSQA 4B17A 3FSXA 3PJXA 2PN6A 3W64A 3SV3A 1T03B 4PQAA 2CG4A 2PMWA 1V5VA 2QFIA 1IBLJ 1WORA 4DFPA 1X4AA 3EDQB 3CMQA 5CYMA 4DR2F 1H2UX 4UQTA 2V4JB 2VPZB 1O0PA 1UWBB 2IYGA 2ZH5A 1AZSB 2EFGA 4DPTA 2LXUA 4ZVSB 1FXLA 1H74A 2CXEA 1M5HA 3IFEA 2MZSA 4ED5A 1FT8A 2FY8A 2V4RA 4QQBA 5BR8F 3TJ9A 3HHKA 2KZZA 4DL0C 3KLVA 2GZOA 3P49B 4B3TF 2MQMA 3QWPA 2UUBJ 5KFHA 3VGTA 4NWBA 1X5SA 3MM8B 1TL7A 5LT5A 1PBAA 2UUCF 1RADB 2DRAA 1R3NA 2YXLA 2C3MA 1MNEA 3HF5A 4JI6F 2NZCA 1W2IA 2LKZA 3TEGA 2BJ3A 2GJ2A 3HM9A 3CE8A 1FTRA 4OX7A 2ZOFA 3QFWA 3AA9A 2HHPA 3BQ1A 3TUJC 2CQDA 3NLCA 2BKPA 3MWBA 1IBMJ 1HLWA 2UZAA 3WX8A 3GQCA 1WHXA 2BANB 2UVUA 3MAHA 2I5JB 1R0AA 3KKFA 1WWHA 4OZ0A 1N6QB 4ZA1A 2LCWA 1VRTB 3AOCA 4A8QA 3W2VB 3T6JA 4NCGB 2B9EA 5GAGU 1LK7A 2M3DA 2VD3A 4RNMA 1SC3B 2ZH3A 3BGRA 3DLKB 2AQ4A 2ZZTA 3PY8A 1SKRA 2B6AA 2MHEA 4MIBA 2LQJA 4ECSA 2ZDPA 2MKHA 2DNNA 1IKYB 2Z2MA 1NKCA 1Q8KA 1YBUA 3Q8SB 1BQMA 1FNXH 3SQGB 2ZBCA 5GAGI 1HQEB 3DRYA 2Q66A 1J5OB 1EP4B 3AB2B 1HHSA 2FJAB 3UW1A 3EMTA 1XERA 3P5BP 2QMUB 4EBDA 4OX8A 3D0HE 2AIRB 4X66J 2I38A 5EWFA 1X5TA 1U26A 3DOKB 4BCAA 9RUBA 2WAQD 3M30B 1U0SA 1RXOB 3JTPA 2OTLS 1I1GA 4WZMA 4DUTA 2VU5A 4PRFA 2CPEA 1SKUB 2H5JB 2KZMA 2ROGA 3DKDA 4D3HA 1O8BA 2L9DA 4PUOB 2W8LA 4K4UA 2VC0A 3MEEB 3CJ2A 4RW4B 3QZ7A 3PKMA 2L3MA 4CLZA 3CWJA 3KLEB 3UR0A 5EN1A 5E3RA 1MLAA 4QR0A 4J9LA 1OQ6A 2DK2A 2NCKL 5DRKA 4R0JA 5I3PA 1L3TA 3LP2B 1HBOB 1LNQA 2HZVA 2VKRA 3SFGA 3R3TA 4NASA 4ED7A 4WFXA 5M2PA 4JI7J 2HKEA 2HVZA 3TQ1A 1U1KA 1S9EB 1T9WA 1SJQA 4KB7A 4C6AA 1S6OA 1S4FA 1NK7A 2BM1A 3W66A 4KGVB 4ZITA 3GJSB 2CPFA 1SJ1A 1BXNA 3OFFA 2VG6B 2DR9A 2XY5A 4BBYA 3H5YA 3DHWC 2NS1B 2KHDA 3R5CA 3W7BA 1WDTA 2P2CB 1KRPA 3HD2A 1S1TB 2JJ4D 5DM7Q 2OLWA 2BW2A 1U1NA 5BYRA 3ELHA 2C3OA 4OYAA 2KRRA 3POTA 1IKVA 1LWEB 3DU5A 4C3KA 3U1NA 1R43A 2LQ8A 3D6FB 1T9VA 3J7ZT 4RNFA 3G6VA 2RU3A 3IN5A 1RP5A 1IJFB 1WC5A 1JLAB 2DRDA 4FVMA 1ZAWA 2A10A 3I0RB 2R7XA 1EX8A 1KEKA 4CO5A 2DNQA 3A8KA 1LW0B 4DV5J 4OHZA 3TYTA 1DARA 4ZS6A 1DAXA 5KOXA 2NUUG 1JJCB 1S9GA 4ANDA 3BSNA 1RJJA 1F5BA 2N4CA 2VG7A 2CZ9A 5EGYA 1V9OA 2EG1A 4LFBF 3GTYX 5KFNA 1FERA 1MROB 2FC9A 1Q5YA 1RWPB 2BW7A 2FJVA 2CPYA 3LANA 1HI8A 4ZN3A 2JEIA 1GXUA 3BKTA 3V6KA 2EK1A 5LXYA 4NZ6A 4E0DA 2GMLA 1GEHA 3C14B 3VAIA 2VKZG 2W9AA 2VJUA 4O3SA 4KRWA 2GS8A 2DH7A 4X65F 4ILMA 2DHAA 3KDOA 2V2ZA 5KFDA 2EXUA 2OPPA 4LREA 2HGMA 3UNGC 5KFTA 2XSFA 3ISND 1WSVA 3GIIA 2E1CA 1RDRA 1SQGA 2LEAA 4AL7A 1RCXB 1RT5B 2NLWA 2MQLA 5KG3A 4DDFA 3L4BC 2B56A 2GVDB 2E7WA 4NMLA 3UE2A 4PWWA 1IQTA 4IRDA 3OLAA 4L73A 1SB6A 5A8RA 4JV1A 4H4OA 1Y5LB 2RAQA 1X60A 2CAJA 5E3AA 1CS4B 2ZWOA 5B09A 3LH2S 3PVXA 3OFGA 3CCMS 5HBMB 4K8RA 2I0XA 5HVFA 2NXNA 3H4DA 4K4ZA 1NBEB 2HMIB 3M8PB 2FVCA 3DM2B 3NKYA 2AZ1A 2IRUA 2AEJA 2HQFA 4NLQA 5CCMA 1LWFA 1ULRA 2WZ1A 4OHXA 4L3NA 4C8ZA 4OI2A 4FPIA 4DR5F 3O5TB 2HFUA 3T5JA 2HNYA 3OL8A 5KFVA 1VLYA 2R7UA 3CVKA 4I64A 3MD1A 2GQ2A 4F0MA 1RUSA 2DYAA 1LEOA 3BGLA 1RE1B 4OLOA 3DGVA 1IKWA 1VMBA 2YH0A 2DBBA 5E41A 5L38A 4O44A 4FP9A 1FRMA 2XS5A 2JVOA 3NBPA 2ZC3A 1WF1A 2I1RA 5DLFA 1NHKL 2PDAA 1QTMA 2HHQA 2JX2A 2YWFA 1PJ7A 4H4MB 3V4IB 3W8PA 1U02A 1YQHA 2XQCA 2LEBA 4B9LA 2YX4A 3R7NB 5LMNF 3CMAS 2BDPA 4CLYA 1QJHA 1IR2A 3MDFA 1D1UA 2XLJA 2FJWA 3G8SA 1CJKB 2AGOA 3IAM9 3THTA 1JKHA 2ZH9A 1HNZJ 4ECXA 4K5RA 3DYAB 3AXMA 4B3RF 2RHQB 3CGIA 2DR8A 1FVQA 3GILA 1IN0A 2O66A 4CH7A 4DPYA 1VQMS 5CHCB 3FGVA 2NREA 1RYRA 4AE5A 5HLFB 4OZJA 2W2PP 3NRBA 2E1RA 1M5OC 2UUWA 5DO2A 3UCGA 1FKAF 4ZCMA 2MLXA 2CPDA 2K7JA 1JNRB 2H65B 2SXLA 2V94A 3TZXA 4EGLA 1YZ6A 4OI4A 2ZJQQ 5IC4B 5JXSA 4C3LA 1OMSA 2V2KA 4CTAB 2A18A 1S1UA 3AAWB 2WOMB 2FZKB 4TXSA 1JB0C 1GX5A 2ATCB 3M6WA 3N9UC 4FVCA 4MT1A 4TU8A 2DGSA 3ENQA 2HFVA 4ZDNA 5CQGA 3BPDA 2MGZB 3H42A 1B4SA 3D28A 1QUPA 5ETSA 3KK2B 1SQFA 5AJ3F 1CEZA 3LPEA 5E33A 3NNCA 9ATCB 2R7VA 1NJXA 2VZ9A 3HPOA 6AT1B 2HSEB 2CPHA 3IXQA 3M6VA 3UDEA 4WPAA 1FDBA 3A3PB 4WE1B 3O3LA 4RWWA 1CJUB 2R7QA 2EWHA 5KG2A 3K89A 2HHHJ 3MD3A 3UN2A 1ZA1B 4U8VA 3CW2C 4NXNJ 4ALZA 3P8BB 2GNKA 2J9DE 4PCQA 1ICEB 4NRTA 4CM0A 2Z4PA 4JV2A 2QL7B 3VGSA 1RWXB 4CLPA 1N32F 5EWEA 1I51B 3CCUS 1VIXA 1UVIA 3MMJA 4EZ6A 3ZTOA 3C66A 3PYEA 2JWNA 2KH9A 3KFWX 3O8WA 1OPZA 3HT3A 2R2RA 4U67Q 2DR7A 3X1LB 2HVHA 1NM2A 5A8WA 1T05B 3DMJB 2DY1A 1Y5NB 1UFLA 2XCAA 5U47A 2DT9A 2W2QP 3GIKA 2BM0A 1HWKA 4HTIA 4I2PA 5K14B 2PA8D 2CJAA 3MAAB 3FQKA 2ZZMA 3NP5A 3QLHB 1XMOF 1NKEA 1YSJA 1QSSA 4WTOB 4J9UE 4RBUA 4DL7A 3I0SB 2V4JA 4JI5F 4OI0A 1WHWA 2ZKUA 3UD3P 1NSPA 4RUCA 1FESA 1R31A 3JAMU 1AZSA 2RF2B 3EWGA 1CJVB 2ZKTA 2M2BA 5HATA 3ZC4A 5LSOA 3MOZA 5L9XA 2G2OA 4RUAA 2DCLA 1HA1A 2C2KB 2Q3PA 3FRYA 4PEOA 1HHQA 2YNHB 1I3OB 3JXOA 5IQ6A 1RABB 5KFWA 1RWKB 4IQXA 4YHHF 3OUYB 5D0RA 1R7IA 1LWCB 3VAJA 3V5RA 3UR3C 1WUUA 1HIYA 5KG6A 1U45A 4KO0A 1RWMB 2EFOA 3RR7A 3CCSS 1NPRA 5DETA 1RGVA 4USIA 3MM8A 4EK2A 2CQGA 1PYSB 5IM0B 2XTJP 4C8YA 3KJFB 1FI4A 2FB0A 2VG5B 4GC7A 3BB5A 1RT6B 1G3OA 4DXLA 2C2EA 4CM2A 2ZUGA 1RKIA 2X1FA 3QRRA 1D9FA 3T41A 2ZM6F 4IDKA 1QD1A 4K4VA 4FS2A 3HLUA 5KG0A 5HROB 3OL6A 2BANA 1RBOB 4LFCF 2C3PA 1VJQA 2I5JA 2Z58B 2VPXB 3PRBA 4MKVA 4YDDB 3EGWB 4UQGA 5KT3A 4ZPAA 2MKYA 1CG2A 3BYPA 4NCGA 3KHLA 5CZXA 2KDOA 5K8NA 1GMVA 3THPA 1HNWF 4IOBA 3DLKA 4Y2MA 1KNZA 1TL5A 1YWXA 2A3JA 3PW0A 4FZVA 4GKJF 1RTHB 1IKYA 3GFYA 5JJBA 4IOCQ 1IM6A 2HNZB 3MUTP 1IWGA 4V19J 5E5NA 4L76A 2WCXA 3T1YJ 1J5OA 2YH1A 4U6PA 4GKKF 3A3NB 4YQWA 1M90T 2CNLB 2RMLA 4CZCA 2WVCA 5ADZA 3QYYA 3VAGA 3BKUA 5ETMA 3DOKA 3M30A 3LPYA 3EJMA 3PRVA 3E2EA 2BOAA 2AGPA 4RLEA 1ROFA 3H98A 1BUXA 1TL3B 1NH8A 4CRJA 2M8HA 2POKA 3BN7A 3KTQA 3V6DB 5KFRA 3MEEA 2JDJA 4LF2A 3D7SB 3OJSA 1HPZB 1SC1B 4RW4A 3EGZA 2HHSA 3MAQA 2WBMA 3RAQA 1HNXF 3P4UB 1X4FA 1S6PB 2QT7A 3OXLA 3C15B 3AOBA 1Y5IB 2Y0BB 3GG0A 1VBKA 1F5AA 1HBOA 3LP2A 2OELA 1C1CB 4ZK7M 3QQCD 1RB0A 4YEAA 3LGNA 2MY8A 2XO6A 3KJVB 1HBMA 4K4TA 1KONA 4W92B 1SH0A 3PXGa 1DZ5A 3T5LA 1S0OA 2LEPA 1S9EA 4ZPCA 4RUHA 1KS2A 1SJRA 2QRRA 5GAHU 4H4KC 1JX4A 1KWMA 4LR7A 5IOLA 1VOMA 5KFPA 3RYLA 3PEJA 2HVIA 3BSAA 2DNKA 2MZTA 5DS7A 2VG6A 2G1HA 4EU0A 2LDYA 1WHVA 3B4MA 3CD6S 3R2DJ 2Z56B 3RB6A 2ZBIA 1Y3KA 2CJBA 2MZRA 5KG4A 3A1YG 2CQIA 1VK8A 4DG1A 1S1TA 3UDLA 3HFZB 5GAEU 4O3NA 4KFBB 3MHYA 5HQLA 5LJ3Y 2ZUAA 4LQ9A 3FCVA 2BVZA 1AB8A 1RHRB 2RIJA 2HS3A 4WFYA 3N0VA 2ZEJA 1OJ4A 4L3KA 2FJDB 1T8EA 4ZIVA 5ETVA 3US5A 1NPPA 2COLA 4I0WA 3CJ8A 4JI4F 1Z1ZA 1JLAA 5I3UB 3Q8RB 4KH1B 1M1GA 4QIFA 4M5GA 4J9OA 1LW0A 2QLFB 4WU3A 4LFBJ 1BWEA 3MM9A 2YNIA 2UV8A 1YI2S 4UOCA 4DR7F 4X4VA 3UFCX 5F8IA 1FKPB 4C8MA 3K8VA 4XDDA 2GV1A 3EM1A 1X4CA 4QR2A 2Z2YB 3NWGA 3F41A 1RWNB 2YKQA 3HXMA 2RSQA 1KTVA 3W5ZA 3IWXA 1S48A 4DR1J 1KN6A 2IFXA 1JXVA 1U24A 3TAMA 3C14A 4HH0A 3MMCB 4J9QA 1WC4A 3IRXA 4KC5A 1M1KT 4URQU 3VAHA 1AUSL 5J1PA 3LOUA 4YP3A 1XNRJ 1FDNA 2QA1A 3Q2SC 5LMUJ 4CLLA 4ZPVR 3GFHA 3HHLC 3M1VB 3MM6B 1VC0A 4YS2A 1RT5A 4NRUA 4ES1A 3VV2B 2HLUA 4ZPWR 2AJFE 3M2UB 2GVDA 3GIRA 3BF4A 4PKDB 3NOGA 5IS2A 2B4UA 1BMQB 5CABA 4DS4A 5C25A 4KKOA 2V8DA 2VODA 2IVMA 4ECTA 1ZAXA 4U7UK 1WTFA 2AYMA 1N33J 1R0CB 5L1LA 2DH9A 4NLTA 2CJQA 1VBYA 1JLCB 3CEDA 2WTFA 3BSOA 5HBMA 2HS0A 3PW5A 2YKPA 4DUYJ 2KB2A 1FRHA 2HMIA 3M8PA 1S12A 3ZTRA 2FDNA 2DR5A 5GVQA 1I94F 4DR5J 2VQFF 2GVZB 3NS5A 2IYIA 1PO6A 2RRBA 2GQCA 4ETZA 2B4PA 4ED3A 3R6LB 4DU8A 3HVRA 3MCOA 3AD8C 1U4BA 5F8MA 1WEZA 1UJ6A 4K2XA 2DPJA 1QVFR 2XSJB 4URGA 1S97A 4LF4J 1HFEL 4I6YA 2VFRA 2LQBA 3QGIA 1VQSA 4ED1A 1Q82T 4C2MA 1V3RA 3PZPA 3HHNB 1VQKS 2KXFA 4CLFA 3LUYA 5J2NB 4MAKA 3QSIA 2Z2LA 4H4MA 1S0NA 1WOPA 4KHMA 5IV4A 4LRDA 4A8KA 5KFOA 2XG8A 2D3ZA 1QTNB 2AZ3A 4QYZJ 2LA4A 3QMQA 2D41A 3GPAA 3TVKA 2FJBB 2PD1A 2LXIA 3K5MA 1CJKA 1NCLA 4NCBA 1FCAA 3VR1A 2KN4A 2ZOMA 2C2DA 1L5UA 1VJWA 4USVA 3SCJE 1C0TB 3J80Y 2ZDOA 3MEDB 3OTOJ 2D3OR 3J81j 5J2QB 3UDVA 3QGHA 3FEZA 3CJRA 2OPRA
chains in the Genus database with same CATH topology
3H40A 2YX7A 1QSYA 4JV0A 1YJTA 1Y4ZB 2FHJA 3RRKA 2BXJA 4RBTA 4OX9F 4MKAA 4DR1F 2JSXA 2CYYA 4MH8A 2D3UA 3OW2R 5F8GA 4C8LA 1H3DA 4F4WA 1O5JA 3BREA 3PEHA 1RT2B 3EXCX 2KVIA 2AJ0A 4J9KA 4NXMF 4E98A 4IG3A 3OL9A 1AFJA 1YRUA 1VQOS 2ZHOA 4MTPA 2OAUA 5HLFA 3D54A 3MR6A 4MIAA 3DLJA 1TKZB 4ED8A 1VIOA 1FHTA 3KHGA 1WG1A 1RTJA 2I8EA 2IAJB 5IT4A 1TFYA 1WEYA 1GXLA 3G8QA 3NGDA 1Q81T 3WBZA 4B08A 4JUZA 2N4DA 1XNRF 5LMUF 4OI0A 4TKTA 3SCLE 4BDPA 2FY1A 3DLLQ 2N3LA 4ZPTR 1JLBB 3OTBA 4FF1A 1S1XA 1T95A 3KK1B 3PR4A 2K1RA 1TKXA 3KLIB 1JIHA 1E6VB 1D9AA 5KTQA 1K1QA 2DB1A 4DFJA 2KO1A 2QA4G 4HI1A 2JEJA 5IFMA 4CTAA 2HS4A 1H2TZ 1SV5A 1WELA 4QIWD 2D9OA 2MZ1A 4Y2IA 4Y2KA 2J5AA 1YTYA 2RH3A 2R2UA 3GSDA 4FNIA 3GG1A 2KM8C 4HHJA 1JLQA 3IS9B 2GMHA 1KVJA 1S1VA 2RRNA 5H9EJ 1K1SA 2OKQA 5FD1A 2YKNA 2RD5C 4H4KA 5KFGA 5L39A 3RBDA 2CQ4A 3H4BA 2W9CA 2DNGA 4RW9A 5AE1A 2HFNA 3TUZC 3WX4A 4O4GA 2HFOA 3VWSA 3MR5A 1VQYA 4B02A 1Z2LA 4Y00A 1NKBA 1D8YA 2DGUA 2UUAF 2LYVA 2EK6A 4DFKA 4M94A 2A1BA 4C4WA 1YBAA 3MUMP 1S76D 3B82A 2MGZA 1YJUA 2Q6BA 3I5AA 2J9EA 3HMJG 5KFIA 1YJNS 1KSPA 4DL6A 3BJYA 2CJ9A 1VS3A 3ZZZA 3KK2A 3PACA 1N33F 3M6XA 1VQ9S 3SXLA 1MWZA 1Q1KA 3MMBA 4B17A 4QYRA 4WYLA 3FSXA 1SJ4P 2VA3A 3PJXA 2PN6A 3RW7A 3MM7A 3K2YA 4DWIA 2ZH4A 5G0RB 3N79A 5IQQA 4BC9A 1Q4RA 2X3GA 4J37A 4DUYF 3AH6A 3SV3A 2W9BB 1B0VA 3KMSA 3DRPB 1T03B 4PQAA 3AY0A 3CT9A 4ED0A 2CG4A 5KFAA 3V4MA 3TI0A 3LALA 4ES2A 4GO5X 4WE1A 4DJBA 1UVLA 4F4XA 2YKAA 4DFPA 2L48A 1X4AA 3PNIA 3MMCA 4WKRA 4C7QA 5CYMA 1S49A 4KQZA 1WACA 5EUHA 3CCES 4DV0F 1Q78A 1ZZFA 4F2RA 1LXJA 4DR2F 1H2UX 4UQTA 3PO5A 4B9NA 1SH3A 1FKOB 2V4JB 4ECZA 2VPZB 3I31A 5E0OA 3KWMA 2GGPA 1KR4A 2YNFA 3TO8A 1VBXA 1O0PA 3C2PA 2R7TA 1UWBB 2IYGA 2ZH5A 2HYIB 2EFGA 1BQXA 1WEXA 2LXUA 3IWNC 1FXLA 3IAS9 1M5HA 4ECQA 3D2WA 3IFEA 2N82B 2MZSA 3QJLA 4ED5A 5A8KB 2QO3A 2MQNA 1FXRA 2DNLA 2KXHA 1VQLS 1FT8A 3LQVA 2KKHA 4EEYA 1N36F 2KG1A 2V4RA 1NHVA 2NSBA 2L41A 4ELTA 5I42B 1VQ8S 4QQBA 5CXTA 4DSKA 2B4OA 4LF8F 5BR8F 4LF4F 1JLGB 2DNMA 2Y1JA 3FFIA 4LSNA 4YOEA 3HHKA 4A4JA 4A8MP 2KZZA 4AXIA 1S0VA 4DL0C 1S6QB 2DGXA 3KLVA 1HW9A 3TX8A 1N0VC 3I96A 1WHYA 5B0EA 4M95A 4RBVA 2B9XA 1A6LA 4B3TF 2MQMA 3QWPA 2K7KA 3P49B 3J7Z5 3RRGA 4KGKA 4JI3F 1C0UB 2VG7B 5KFHA 3LP0A 2ZH6A 5DG7A 5F8JA 2VOOA 1N0UA 2XY7A 4NWBA 1X5SA 3VAFA 3EX7B 5L9NA 3MM8B 2UP1A 3H5SA 3I9V9 5LT5A 3G9CA 4DR6F 2DNRA 1VI7A 2ZHBA 5AE3A 5MAOA 2UUCF 2DRAA 1R3NA 3BZQA 3FEXB 3ZFVA 2R8KA 2C3MA 1MNEA 3HF5A 2DISA 4JI6F 1T05A 3WC2A 5AXKA 3TARA 1JLCA 1W2IA 2LKZA 2GHWA 1L3VA 1X5PA 5DDQC 5F8LA 4DUZF 2GJ2A 3HM9A 3OTEA 3CE8A 2X51A 1FTRA 1YRXA 2Z0GA 1U2FA 2ZOFA 4OX7A 3AA9A 1X9WA 1A9NB 1R8BA 2DNYA 5K9FA 3VQTA 1DRZA 3IBWA 4ITSA 3OVAA 4F4ZA 2NYIA 2HHPA 1KLMB 3IA0A 4A8YA 2NQPA 4C98A 3BQ1A 5DDPC 2R8IA 4PWDA 4TNOA 2EG2A 2UU9F 3GYXB 5GAHI 3TR5A 3TUJC 4WFBQ 2CQDA 3CJ4A 2M7SA 3NLCA 3CD0A 3QIPB 4DV2F 3I4PA 4URSA 2AF6A 1YJVA 1ZTTA 1WI8A 3H25A 3CJ3A 3MWBA 2UZAA 3GQCA 1H7WA 3WZ0A 1M5SA 3BDEA 2VH7A 3KHHA 1C1BA 2ZD1B 3NCQA 5DGAA 1WHXA 2BANB 3AA8A 2O1PA 3HZEA 3QLHA 2OPPB 3AHPA 3JYTA 2UVUA 3NS6A 3MAHA 2I5JB 2G13A 1R0AA 3KKFA 2BUNA 3D5MA 1WWHA 2AGQA 4OZ0A 5D77A 3V6JA 1N6QB 1S72S 2ASJA 2F4VF 4ZA1A 3PW7A 1HBUA 2LCWA 2PE8A 3OTOF 1YGYA 1KQGB 1VRTB 3I0SA 2WSFC 2YWGA 3SCKE 2BE2A 3MURP 4A8QA 4ETXA 1H0HB 2R8GA 3DRSB 4DR4F 4IR1A 5AXLA 2JEGA 2P5VA 4OJ1A 3W2VB 4R5PA 1D3WA 3T6JA 1FJ7A 4YB6A 1HMVA 2CQ2A 1W2BR 2RF2A 4NCGB 3G86A 2VQEF 3OTDA 2IC3B 3K8WA 5GAGU 3OVSA 1LK7A 2XMTA 4DV3F 2M3DA 4K4WA 2VD3A 4ZVFA 4EO6A 4RNMA 4LFAF 2ZH3A 3OLBA 2YNHA 3BGRA 3DLKB 3T3FA 2AQ4A 5GAEI 1AW0A 3ZZRA 2E1MC 3PY8A 1VRUA 2XEXA 1SKRA 2RS8A 1G2EA 2B6AA 3KLFA 2MHEA 1FD2A 4MIBA 3OUYA 2LQJA 4ECSA 2ZDPA 1FDDA 3BS9A 2WB1D 3TAPA 2MKHA 2DNNA 1IKYB 2Z2MA 1NKCA 3V81B 4JV5F 2VB6A 3FCHA 4XPEA 1JXLA 3Q8SB 2GX8A 5FDLA 2JOQA 1NEEA 3HFKA 5KOWA 5KT7A 1BQMA 5HI7A 1FNXH 2XULA 1ZM2A 2ZBCA 4WK3A 1X8DA 3SQGB 1HQEB 5GAGI 2BQUA 3DRYA 3CCWA 4FNHA 4N8NA 2Q66A 4X4UA 1SKWA 4UUWA 4KV8B 2MQPA 4YFUA 1J5OB 3F44A 1TV6B 2KJWA 1JMTA 4PXEA 2GJIA 4ES3A 1HR0F 4DV7F 1CPZA 1EP4B 4DPOA 1D0EA 4Y34A 3AB2B 1HHSA 3I6PA 2ERRA 1N54B 4TU9A 4QWBA 2FJAB 4ICLA 2CQPA 4OLPA 3UW1A 1RT1B 3DLEB 3M32B 1GTEA 3RZAA 3M4XA 1JJ2R 4F2SA 1XERA 3K58A 4EBDA 3OR2A 4YY3F 4OX8A 1RT6A 1FK9A 3D0HE 4O23A 2E9ZA 1S10A 4ATNA 2I38A 2BABA 3MF5A 5EWFA 4KJIA 4O3OA 3CC7S 1X5TA 2DGQA 3DFEA 2NXUA 4XIUA 1U26A 3DOKB 4BCAA 2VUGA 2WAQD 3HI9A 4X4PA 1SIZA 1HNIB 1XWLA 1PSDA 1GQEA 1N5VA 3M30B 5KFLA 3PKYA 4F50A 5DQHA 2VASA 2KHCA 3CJKB 4A48A 3JTPA 3P3DA 4EZ9A 1APSA 2OTLS 5G4DA 1UFWA 3CIZA 4USHA 1I1GA 4L72B 4NOHA 4IKAA 3RAXA 4WZMA 4CT9A 1J5EF 2K2PA 3WDOA 4M5DA 2FJEB 2QYCA 3FEYB 3MEGA 4LIWA 1SL2A 2VV5A 4PRFA 3FZ2A 2CPEA 4MFBB 1KFDA 5HROA 1ZZNA 3NL0A 2KZMA 3R5DA 2ROGA 5D4LA 4LT6A 4D3HA 1O8BA 2L9DA 1NJWA 1LFWA 4MIWA 4PUOB 2W8LA 4K4UA 1S6UA 2VC0A 4KGMA 2R7SA 5IT0A 1F5CA 5CYJA 2W25A 3CJ2A 1P1LA 3MEEB 2HRUA 3RB4A 4RW4B 4QJVA 1K0VA 5B7WA 2MJUA 3I9ZA 2ROPA 4X4QA 3QZ7A 1RT7A 4K50A 4F4KA 3PKMA 1IBLF 4YR0A 1IKXB 2L3MA 1HBNB 3CWJA 3KLEB 2DO4A 1AFIA 1RT2A 5KFUA 3UR0A 5EN1A 5E3RA 3FDSA 1H7XA 2DVIA 4KHRA 4O44B 3H2UB 3TA0A 3TVYA 4QR0A 4J9LA 3E01B 1OQ6A 2DK2A 2RILA 4O3PA 2VL1A 1JJ4A 1FVSA 1SI9A 5KFYA 2XS2A 1CQMA 2FIUA 1FJCA 1H6KX 3HHEA 4R0JA 5DRKA 2M5YA 5I3PA 1L3TA 3LP2B 1HBOB 2J6UA 4MMOA 1RISA 2P9CA 1DLOB 2VKRA 3PX4A 2F7VA 3SFGA 1Y7PA 4Y2CA 3R3TA 4KAIA 2F3JA 3DDKA 2OIHA 1UMJA 5CCLA 2FHOB 1N5TA 1NNDA 1YITS 2HNZA 2I9SA 2PC6A 4ED7A 4WFXA 5M2PA 3T6BA 3G71S 1JLFB 3MM5B 2GIRA 5HMXA 5F3ZA 1CLFA 2HVZA 2W7AA 3TQ1A 1VQ6S 3L7OA 4X4RA 3AQOA 1U1KA 4IRCA 1S9EB 3K57A 1SJQA 4KB7A 3MFHA 1W25A 1YG0A 2DGTA 1S6OA 1S4FA 2D9PA 3FSIA 4F4YA 1TK5A 4C0OC 1NK7A 2UUBF 1DQ9A 2BM1A 1QE1A 3C6UA 5B0GA 5THWA 4AL6A 1SJFA 2C3UA 1E6YB 1ZOTA 5ITHA 3LWLA 1N4LA 2XO7A 4GO7X 4CO2A 1RTIA 2MQOA 2JHEA 2XY6A 2ATLA 2CPFA 1SJ1A 2RNEA 1LW2B 3TUIC 5F9LA 3IG1B 3B78A 4NX9A 2BJEA 4IO9Q 1JLEA 2EPIA 4DX8H 1WF0A 3OFFA 4BHQA 5KFCA 2VG6B 2DR9A 1XR5A 4ECVA 5KFSA 2XY5A 1D9DA 4BBYA 3H5YA 3S7RA 2FVPA 4TLRA 4ZVGA 4F3QA 4EYIB 3DHWC 2BOPA 2RKIB 2NS1B 2KHDA 3DN9A 3OHBA 4DF8A 3R5CA 5BJRA 3HDSA 1FD8A 3W7BA 3QZ8A 3GV8B 1TL3A 2G0CA 1T03A 1N88A 2ASYA 1MMNA 3OL7A 1BD6A 1B64A 3EZUA 1KRPA 3O1LA 2AD9A 4LSLB 1S1TB 2JJ4D 4D3GA 5DM7Q 2FVSA 2J9CA 1TAQA 1FNOA 4PR6A 1G7CB 4R25A 4NLPA 2OLWA 2BW2A 1U1NA 3GB0A 1Q79A 4TLQA 4JI0F 3U02A 4Z37A 1IBMF 2IM2A 4RX6A 2DH8A 5BYRA 2C3OA 3M2VB 4RWXA 1HPZA 2KRRA 1HW8A 2IJNA 3HHDA 3POTA 2OJ3A 2E66A 1IKVA 1LWEB 2MPUA 5KFXA 1DTQB 3DU5A 4N77A 4C3KA 2QMXA 5B0AA 1UWBA 2UXDF 4ECRA 3U1NA 1R43A 4ECWA 4F3OA 4Q8FA 1WNEA 3J7ZT 3GMGA 2OP5A 4ZMMA 4QBUA 3TNVA 1KQSR 3CULA 4RNFA 2KJVA 2CZVC 3M9OB 3G6VA 3TANA 4WCEQ 4AYBD 3QJPA 1DTTB 2RU3A 1S6PA 3IN5A 1RP5A 1IJFB 2CDQA 2XLKA 1JLAB 2C3YA 4FVMA 3DOMA 4OMFG 3GE9A 3OV7A 3VCDA 3IRWP 1ZAWA 1ZPVA 2A10A 3I0RB 3MMAA 3JSMA 4WTYA 3T1HF 2R7XA 1KEKA 4CO5A 3DRRA 4Y2AA 3HVTB 2DNQA 2MZQA 1LW0B 1JLGA 3PW4A 3S8SA 4NLGA 4OHZA 1U7LA 2ZHAA 3TYTA 7FD1A 1N5SA 2F9DA 4I6WA 4PG6A 3QGPA 2XI2A 3KJVA 2ZH8A 3Q22A 1DARA 4ZS6A 5D3GB 2FLNA 1DAXA 5KOXA 1N8RT 2NUUG 2XMUA 2GHVC 1VQPS 1S9GA 3CTRA 3BSNA 1RJJA 2B9YA 1F5BA 2ILZA 2N4CA 4NL5A 1RT4A 3I82A 2VG7A 2X1GA 5KT4A 5EGYA 4NLVA 1V9OA 2EG1A 4LFBF 5KFNA 2CQCA 2QIFA 2HFZA 2WONB 2BRLA 3CIMA 1FERA 4RNNA 2KYZA 1T94A 1MROB 2FC9A 4ZHRB 5DDOC 2W7PA 4NLRA 5LL6d 3RB0A 2HIQA 4IR9A 1F2GA 3CDBA 2FJVA 3KNAA 3CC2S 2CPYA 3LANA 4NYOA 1HI8A 1Q16B 4QZVB 3CPWR 4QCLA 3OR1B 5CA5A 2JEIA 4ID5B 1LKZA 4OL8A 1GXUA 3V6KA 2EK1A 4FYDA 5LXYA 2F40A 4NZ6A 2UUTA 2WB4A 5LSRA 4J9MA 3HX9A 3LW5C 3QO9A 4TY8B 4ZVEA 2GW8A 3DI6A 5DJBA 4F3MA 4E0DA 2GMLA 4C8KA 1VBZA 2ZH1A 4DS5A 2H9ZA 1BLUA 1PILA 4IFVB 1RT3B 3VAIA 3IGVA 2VKZG 3B4DA 2CPJA 2W9AA 4O3SA 4KRWA 2DH7A 2DHSA 4ZPBA 4FXVA 4NLXA 1EETA 3VZHA 4X65F 4ILMA 2DHAA 3KG4A 2BA9A 2VBWA 3J7YU 5KFDA 2CQHA 2GCFA 2OSQA 4LVNP 2OPPA 4KPYA 5DLGA 2HGMA 3UNGC 4CH1A 1OQ3A 5KFTA 2OPQB 3AB4B 4DHVA 1V3ZA 4KFBA 2XSFA 1OIAA 3ISND 1N6QA 3GIIA 2UXBF 1HL6A 1RDRA 2E1CA 2LEAA 4AL7A 2RRAA 1T7PA 3D0IE 3R5AA 1UEVA 1RT5B 3H2VE 5BYSA 1VRTA 2NLWA 1N56A 2MQLA 5KG3A 4DDFA 4WU2A 2YWHA 3DRSA 2B5JB 3HKZD 2BACA 2AYEA 1MU2B 3DHXA 1TP7A 3W2VA 5K8MA 2B56A 1M5VC 5D6GA 2VC1A 3P5TL 3M8QA 4I2QA 4Q2LA 1VHFA 5AE2A 3J7YI 4Q2MA 2LLZA 2E7WA 2Q6CA 4G1IA 2FLOA 4NMLA 3M2RA 3UE2A 3BM7A 1UA1A 1IXKA 2NPIA 1IQTA 1WG5A 3K5PA 5B0DA 4IRDA 4ZCLA 4B9TA 5I3UA 1IJEB 3OLAA 2KI2A 1SB6A 1NJYA 1OPIA 5A8RA 4JV1A 3N6MA 4Q44A 4H4OA 1Y5LB 4A46A 2EFQA 3CJ0A 5DQIA 3CDAA 2GA7A 2RUGA 1Q8IA 4BC7A 5A8WB 5A2QY 1TL4A 2DTJA 4DSFA 5DDRC 3KLHA 2JFDA 3SQGA 2Z8QA 5E3AA 1HQEA 3I5CA 2QMWA 1FRKA 3ZZPA 5DG9A 2CFXA 1TVRB 1H38A 4WFAQ 5B09A 3LH2S 3PVXA 3OFGA 1FXDA 4RKUC 1EP4A