4KGMA

Bacterial trna(his) guanylyltransferase (thg1)-like protein in complex with atp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
238
structure length
230
Chain Sequence
SIGDRMKRYENAYRIKLPERMPVIVRIDGAHFHTYTKGCAKPFDQDLAEAFWETCKYLAQNIMGAKLVYHQSDEISILITNYDKLTTQSWFENNLQKIASVSASMATAKFNEVMREKYPDKPLATFDGRAQVLPQDEVANYFIWRQQDASKNSISMVAQANFPHKQLLNGKDMQDKLMTEKNINWNDLPVWQKRGICIIKEFYRSRWSVDHETPIISKDREYVEQFVYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thg1-like uncharacterized protein
publication title Structural Studies of a Bacterial tRNA(HIS) Guanylyltransferase (Thg1)-Like Protein, with Nucleotide in the Activation and Nucleotidyl Transfer Sites.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Transferase
total genus 72
structure length 230
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04446 Thg1 tRNAHis guanylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kgmA00
3OTCA 3OTDA 3WBZA 3WC2A 5AXMA 4KGKA 3WC0A 5AXNA 5AXLA 4KGMA 5AXKA 3OTEA 3OTBA
chains in the Genus database with same CATH superfamily
3TQ1A 2ATLA 1QUVA 4EO8A 3HD2A 1H38A 3J7Z5 1IWGA 2YKOA 3R2DJ 4RBTA 3FKBA 3NXZA 2LDYA 5F8HA 5BYSA 2DH8A 1NLKL 2BW2A 2IMOA 4WIIA 1Q5VA 2HAFA 1FO1A 1TMJA 5DG9A 3LP0B 3W9HA 1ZA2B 2IFXA 1RJJA 3DM2B 1RABB 1HNZJ 3RGIA 3VZIA 1CJTB 3IXQA 3HF5A 5KFNA 1TK0A 1VFJA 2L41A 3M05A 4CH7A 2MJNA 1IBMF 2DTJA 2K2PA 4DSEA 1W26A 5F0UA 2ZKUA 3OR2A 1QVGR 1VC6A 1EAYC 3FSIA 2DO4A 4ED0A 4RO0A 4I69A 2V6AA 3DN9A 1ITPA 1IJEB 2CQ1A 2HIYA 3HSJA 2V4RA 1A0OB 3CEDA 5IWAF 3FGVA 2DT9A 1YKWA 3NNCA 1HQEA 4FS1A 3MCNA 2GIQA 5E41A 2A10A 1QE1B 4I6AA 4ZPCA 3QT7A 1NSAA 3QGIA 3ZTRA 2DRDA 2E5LJ 2VJUA 4FDFA 3OTOJ 2QLBB 4WK1A 3KLEB 5CXTA 4M8LA 1SC3B 3TZZA 5GMEA 1FTRA 1FWPA 1S1VB 3OFGA 1JLGB 2DNOA 2DGXA 3BEGB 2ALYB 5BYRA 3GPAA 4C8YA 2GX8A 1U1OA 4DPYA 3W5YA 4OX9J 2NPFA 2ILYA 3IBWA 4A8FA 4P75A 2V9KA 3OUYA 1SQFA 2V2ZA 2LXUA 1C0UA 1FJCA 1S59A 4HTIA 1WSVA 3HHLD 4NLXA 2E1AA 3UPFA 3B6BA 5D15A 2PE8A 2V4QA 1RT3B 1RLCL 2V4JB 3G96A 2DHSA 2IVFB 1F9FA 4P2MA 2X3DA 1FE0A 2ZH5A 3O6QA 1FRJA 4DR6J 3MM8B 4C8KA 1FFGB 4LUBA 3UI3A 4TU8A 1SJ1A 3ZTQA 5K14A 4NLSA 3V5RA 1R0AB 5L1KA 4CYUB 3IG1B 4O4RA 3TA1A 1U0HB 2N3LA 4F4WA 2AMCB 3K5NA 2FJDB 4DCPB 1K44A 1T9XA 5CCLA 4OZNA 3RAXA 2KXHA 5CCMA 5KFLA 3LW5C 1NJWA 4ZVHA 3EZ5A 1KC8T 4KRWA 3BQ0A 3D0HE 1PGZA 3NOGA 4U7CA 4CTAA 1KNZA 3O1LA 2QFIA 1R6VA 1HBNB 4MMOA 5L9XA 1WHYA 3DRPB 1Y10A 2JLGA 4EBEA 4ZK7M 2APOA 1XR6A 1F2HA 5ETTA 5LMUF 3LP2A 2E5IA 5K8PA 2R7OA 2AGPA 1T3OA 2YX7A 4B3MF 4FS2A 4CO4A 4CP5A 3UDLA 2HNZB 1RWWB 3G82B 2MKYA 2MLXA 3T41A 5IC4B 1X0FA 4YY3F 1YTYA 1HNXF 3VAFA 2BE2A 2JZ5A 2R7SA 4UW2A 1AFIA 2MSTA 4NEZA 4EYIB 3DOMB 4X4PA 1OWXA 1M0SA 3IFEA 2E7VA 3HFZB 2JH3A 2VBZA 1UVMA 1RKJA 4WP3A 2LQ9A 3GG1A 4X84A 1N4LA 2DB1A 5ETSA 1AZSB 4NLQA 3ENWA 1MMLA 2R3VA 5SZTA 4ICLA 1RK8A 4J9MA 1TELA 3Q8SB 3CCMS 1FDDA 1P8GA 3KG1A 3OR1B 3DOLB 4ZVSB 1ULRA 2VPZB 1R8CA 3H59A 1RT2A 1IBKJ 3V81A 2HZCA 2F40A 3G6VA 3ENVA 2FLLA 3LWMA 1PG5B 2DHAA 3MEEA 2ALZA 3MFIA 2QL7B 4I6WA 1IJFB 4Z2XA 3QO9A 2YKQA 5I42B 4J9OA 3W2WA 3A8EA 4ZCMA 1AUDA 1GNKA 4WWSA 3GV7B 3M8WA 4KQZA 4BCAA 1FJ7A 3NMRA 4RUAA 1NK4A 4J7CA 4OLOA 4GVBB 1VQ7S 1VLYA 1L3TA 2QT7A 2I6WA 1C0TB 4FBTA 3TUIC 4OJ3A 1AUSL 1I51B 7FDRA 2W9BA 3HCXA 2F65A 4O23A 2KFZA 2J6UA 1SH0A 2VFRA 3QT5A 4IQXA 1UJ6A 2RSQA 3B78A 1YJVA 5IXUA 2AJ1A 4JV2A 4C11A 1BHNA 1SUQB 4JI6F 4C3KA 3OTEA 2WHOA 3JQKA 3GWCA 1Q78A 3WZ0A 3MPUB 3CCQS 3BGLA 4OX6A 2AEMA 5ADZA 2DNNA 4CH0S 3FBBA 4ZKAA 3AB2B 3CGIA 3WX4A 4NXNJ 2JVOA 4LBHA 3OLBA 2HGNA 1OY9A 3LP0A 1WC6A 3VALA 3DM2A 3RAQA 5HK4A 4BLGA 2LQ8A 1CJTA 2HKEA 2W24A 2MHNA 3M7VA 5K5MA 4JI5J 4KH1B 1KR4A 2F9JA 4L74A 2ROPA 3WIVA 2J8AA 3FFIB 1TKXB 2LA6A 2C3MA 3EUNA 3GFZA 3KKFA 2RAQA 4C97A 3H2VE 3CCSS 2W01A 1FX4A 1PJ5A 3PY8A 1KS2A 4ZCKA 2RILA 1S77D 2ZOGA 3FZBA 1TUGB 4UOFA 2K3KA 1W2IA 3GYNA 2BQ3A 3CW2C 3G8TA 2FVCA 4AQYJ 4X66F 2M0GB 2LA4A 1FRKA 1S4FA 1QE1A 3GJTB 3NS7B 5KG2A 4RW9B 3LA0A 1RBOB 2J9DA 1KWMA 1XNQJ 1TV6B 4A8WA 3NNHA 2PI5A 2OPQA 2OMOA 4LSNA 2MQLA 1KRPA 2RJZA 3Q8VA 5GAHI 2NXCA 4U8YA 1KVIA 1F9EB 3A8KA 3KLEA 2D3UA 2HQIA 4W90B 5A8WB 1S1VA 2UXBJ 3BO3A 1JLGA 3SV4A 4O3SA 3M8QB 3BR8A 3KLGA 3GONA 4F26A 1KQGB 4DF8A 1VRUB 4TN2A 4YOEA 2BUNA 2Y1JA 3HM9A 5B7WA 1UEKA 2KT3A 2RKIA 1NKEA 2EKYA 5H9FK 2H48B 1O51A 2COLA 2CDQA 4TQRA 3ITHB 4I1TA 4C8ZA 1RT6A 4A8SA 2YKMB 1UA1A 1RT3A 2V4JA 1GTEA 2MMYA 5KFSA 3ULHA 3OW2R 2HVZA 3GE9A 4DSJA 2YNHB 2ASDA 1F1BB 3MDFA 1CBKA 3MM8A 4B3OB 2CPXA 4PRFA 4CLSA 3ZTOA 4P6QA 1N0UA 1R0AA 3IG1A 4KHMA 4MKBA 2CZ4A 1U0HA 1BWVA 3HK2A 1S6PB 2CPEA 4DZ6A 3ELHA 3CCWA 4HEA9 2NXEA 2JEGA 4PZVA 3OLAA 3CJKA 4GKKJ 1SXLA 2MQMA 1MWQA 2U2FA 3EM1A 3TJ9A 1OMSA 1SB6A 4MKVA 1SKWA 3Q89A 4I7FB 4P52A 3K89A 1MN9A 5LSLA 1LNQA 4ZN1A 4G1IA 1HBNA 3L7OA 4O3OA 2BYCA 3DRPA 4A48A 3F44A 2CUYA 2C2NA 5LT5A 5HANA 2MXYA 1S4EA 1LWXA 3D28A 3PRVA 3B8HA 1HFEL 2RH3A 2G2YA 3FCVA 1SBRA 3RRHA 2HNZA 3G82A 3ISND 5BJRA 2A6OA 3RG6A 4K5RA 4J9LA 3KJQB 5B09A 2K7JA 3GV5B 2BJDA 1MROB 3DOMA 1RT1B 3RR7A 3JS9A 4RW8A 4CRJA 2CYYA 4X4TA 1X8DA 3NRBA 1NHUA 2PIIA 4B9MA 4NLYA 3EICA 3BH7B 4ED3A 4RR5A 1AZSA 2PSZA 1U1LA 1QAJA 2CQ3A 4JI2F 2R7QA 4KHPJ 4EU0A 1Z1ZA 1Q4RA 3ZO7A 2EFVA 5CD4A 3IGNA 3PFEA 1AFJA 3OR1A 3DOLA 4ZP7A 3ONQA 2OELA 3E51A 1ZPVA 1NAQA 1TL4A 3N6NA 2PA3A 5C7PA 2R8JA 1SJRA 4B9VA 3D1HA 2XG8A 3TARA 4KGVB 3VAGA 3MM6B 3TQEA 3J81U 5KFBA 2EXUA 2V8VA 2DJWA 1VMBA 4C0BA 2G1HA 1R8HA 3US5A 2LKZA 4AUKA 4GVBA 4H4KA 3OV7A 1IUJA 4DUYJ 1U6ZA 4P72A 4QWAA 1GXTA 3FSYA 4CLYA 3V2UC 1RAAB 5A2QU 1Q82T 4WYLA 5KFYA 3N5BA 2GAHC 4DF4A 2GC8A 3LOUA 5KFEA 5LSOA 1TTHB 3PEHA 5DM6Q 2RD5C 3BPDA 4NCAA 4ETXA 3HP6A 4AL6A 1Q79A 1WF2A 3OVBA 3HSDA 4V19X 1REVB 4OYWA 2OFHX 4YHHF 5CYQB 2B8PA 4P9SA 4I67A 1SIZA 2XMMA 3GJQB 4DV1F 4FF3A 2MPUA 4CT8A 4IFYB 4O3QA 4X64F 5H1SV 2V2QA 5DLGA 2HW3A 5BR8F 4N7TA 4BHQA 4KGZB 1EB0A 5HJXA 4KGKA 4B02A 2PGCA 2CVIA 3RZAA 1S9EB 3OXLA 4QIEA 1KLNA 5B0GA 3D67A 4IG3A 1WD6A 4DL6A 3FFIA 1TKXA 1U8SA 2LFVA 1RT4B 3DRRB 4DR5F 2AT1B 2D3O1 2L9WA 2HFNA 4X4RA 3NAHA 4NA2A 2VJVA 3KDNA 5GAHU 3MM9B 1N32F 4USVA 2EG1A 2XZWA 2JC1A 2QX0A 3W65A 1SJ4P 1X5TA 3K17A 2RE1A 4IO1A 4AT1B 4WJBA 1VC0A 1NSQA 1PCAA 1HHQA 1WG5A 5JUMA 1FNOA 4PPDA 3TA0A 2MSSA 4RW9A 1J2VA 4X4SA 1NRKA 1U0SA 1DRZA 5EWEA 1TV6A 2RS2A 2R7RA 2GJIA 1CLFA 4DV4J 4AYBD 1WF0A 3BB5A 3PYGA 5GADI 2RS8A 1TU0B 3PFOA 3I0SB 4ANDA 1VQPS 4Z37A 2DNQA 2C2EA 5L39A 1C1BB 3M8QA 1B4SA 3EZUA 3EXCX 2XO7A 3N4WA 2BM0A 2EFOA 1VRUA 4DV3J 2QN6B 3GMGA 3MR5A 2V50A 2RMLA 1H3DA 1TKDA 2FHKA 3J80U 2CJYB 5J2PB 4RNMA 2E1MC 4MJKA 1IBLJ 4YP3A 2LQBA 4CLKA 1FXDA 1R8BA 4F4YA 1M5OC 2YKMA 3H4BA 2QRRA 2W9CB 3BPSP 4C3MA 4Y28C 2YNHA 1FCAA 1RWVB 3QJLA 4GC7A 3TANA 2J0SD 3D5MA 1KKHA 1T94A 4B3OA 6FD1A 3NWGA 4I68A 1FRLA 5G0RB 1Y5NB 2FGCA 5G4DA 2E9TA 1RP5A 2YH0A 4LF8F 5HBMB 2E5JA 3W61A 1TAUA 2C2KB 2QA4S 4A4JA 3JAMY 2GMHA 2ERRA 2BKNA 3IRWP 2I1RA 1R7IA 2DNGA 3HXMA 4V19J 4ES3A 3AHPA 4OYMA 2QO3A 3KHLA 4K50A 1HBOB 2R7VA 4ELTA 3GJSB 4I7FA 3M2RB 4GC6A 1KQSR 2XI3A 3NP5A 2YKPA 3H20A 4M5GA 5D4OA 2XULA 1UW9A 4CO5A 1NCLA 1SV5B 2R7WA 4WFNQ 1T0TV 1RAFB 4DV5F 2ADCA 2UXDF 2YPZA 2KG1A 4LJMA 1GMWD 3QJPA 4Q0BB 2CXEA 5H9EJ 3FDSA 4AD6A 2UUBF 1SIWB 2LQJA 5JMNA 2UUAJ 2CAJA 1PYTA 3S8SA 2DNYA 2VPWB 2KTQA 1X4HA 2YH1A 1N88A 5C2GA 5L1JA 1FDNA 1MLAA 1DAXA 3EZOA 3TEHB 2XLJA 3A8JA 3QMQA 1NH7A 1D8ZA 2AYGA 4J5OA 1U1NA 5B0DA 1Y9OA 1CQNA 1MROA 4OFZA 2Z2LA 4Y00A 2E66A 4FYWB 2CQHA 1FVSA 3T19A 2E5HA 1F6TA 4JUZA 2M8HA 3NGDA 2EG2A 3N6LA 2DGTA 2JEJA 1RGVA 2DITA 3IO1A 1WTBA 1N34J 1NK9A 2K7KA 2W8KA 1DTQA 4M5JA 2QV6A 4HACB 4Y2IA 3MPDA 5GVQA 3GYXB 2GAGC 2OLWA 2FY8A 4RNOA 1JJ2R 5KFAA 1HWJA 4O3PA 4YS2A 4LIWA 4PG7A 1TVRA 1KOOA 2UUWA 4K4UA 1WKJA 2O01C 4FNHA 3M8PB 2JSXA 1KEKA 2OEJA 3MM6A 2RNEA 3K5LA 1RSCA 1YJ7A 4MKAA 2DNHA 2C3UA 2MDAA 3GLJA 4YUDA 4X4VA 2CKWA 1U1QA 1CJVB 2BJEA 1VQ9S 4Q44A 3D3BJ 5I3QA 3DDKA 1RB0A 2XGQA 4BBYA 2HURA 1H73A 4OHYA 2IRUA 3PX0A 4NYPA 1F0XA 2HHUA 5D0GA 4Y2KA 1X7VA 2YNIA 1WI6A 2AJFE 5DJBA 3VGSA 3CPWR 3OSPA 3CD7A 3P3DA 3QZ7A 1KQKA 3HX9A 1NJXA 4ZP8A 2WVDA 4B3SJ 1YK9A 4TVAB 1WEYA 3DOKB 1V5VA 4NYZA 1REVA 1QJHA 3CWJA 3H25A 4LF4F 3PJWA 3TJAA 3EPIA 2A3JA 3KLHB 2VQFF 1UA0A 1NB2A 1N54B 3EGWB 5T14A 3B82A 3T1HJ 4PG5A 4IFYA 1NDKA 1UEVA 2DGUA 3W2VB 2DO0A 4F2SA 4USTA 3OFEA 2KFNA 3THVA 3A12A 1BQMB 1Q0NA 4KY3A 2XYGB 1IKYB 2IIHA 1N56A 1S9EA 2FLOA 3C46A 1T9VA 5DRKA 3GB0A 4LF5F 4DUTA 2CWKA 2PMZD 3L3CA 1RT4A 5LJ3Y 5HQMA 4DR7J 2QIFA 1RT7A 2DH9A 2G1DA 2DRBA 1PYSB 3CF5Q 5GADU 4MYTA 1GAOA 4W4MA 4DU8A 2Q66A 3ZC4A 1T11A 2UP1A 3IWLA 3H90A 1S0NA 1YBTA 3LANA 2J9DE 3NGKA 4ZDNA 3W8PA 3NCRA 3BN4A 1VRTB 2DNZA 5ETOA 1X4BA 2RUSA 2XLIA 2MTLA 4DV6J 2BR0A 1U26A 3U1NA 1TL1B 3Q8PB 5BXIA 4RPFA 3SQGB 4ZLJA 2FLNA 3I0SA 2FJBB 2ZJPQ 2DD8S 2IJNA 2QL5B 3T9NA 4FP9A 4USMA 4LFBF 4PG6A 4F2RA 3MTKA 1KQFB 4ID5A 5DG8A 2P2CB 2EEYA 4FKXA 1WEZA 1VBXA 4XK8C 5J2PA 5AXKA 4USKA 4K2XA 1RZMA 2HEKA 2PC6A 3BDPA 4JI7J 3H40A 4GKJJ 9RUBA 1RU1A 3H5XA 4LF6J 5L38A 2V8DA 1BGXT 3F41A 5J2QB 3X3UA 2HRUA 1MG7A 3MMJA 4FXDA 4RWXA 1PO6A 2DNKA 2GIRA 1FJEB 1KLMA 4DX8H 2I2YA 2XMUA 2BVZA 2KZZA 5JVHQ 2QA1A 4M1KA 2QSWA 5G0RA 4YMEA 2MQNA 1XNRF 2G2ZA 4F3MA 2DPIA 5DLFA 1S1UB 5HBMA 2V2VA 1WORA 1YJ9S 3LPYA 3I4HX 1UVJA 2RRBA 5LMNF 3C6UB 1UVKA 2VFUA 4ES2A 3BH6B 4RWWA 4A8YA 2VPXB 4B08A 3JSBA 1PAEX 3BBCA 1PSDA 3PG9A 1FD8A 1HBOA 1FX2A 2GGPB 4RKUC 2YNGB 2XCPA 3GYGA 4OI4A 1WDDA 3CUNA 2OGUA 5D8HB 1YJWS 1SV5A 2PFFB 3WC2A 2JFKA 2G0JA 1JIHA 5IT9Y 3JQMA 4JI0F 4Q0BA 3I4PA 3NCPA 4DR3J 5I4MA 1VQSA 2GNKA 1U45A 3BGRB 5IQQA 4LRDA 3D1OA 1SI9A 1UVLA 5HVGA 4WU2A 4OI3A 3B4MA 3H7HB 2WRMA 5BYQA 3TOQA 1G7CB 4OYIA 5HN0A 1OY8A 4J91A 2FJXA 3EGVA 1BY9A 3BJYA 1VQMS 3QJJA 4H4KC 4ZP9A 4K0KF 4Z7YA 1UZDA 2W7OA 4YEAA 1HD0A 2IYIA 2U1AA 3MMBA 3I55S 4TU7A 2CJ9A 5KG1A 8ATCB 2HNDB 1F3VA 4QYZK 2P9CA 5HAOA 1IM6A 3KDOA 4M94A 4FYYB 2LEAA 2XLKA 3M9OB 1RHMB 3TA2A 2GZOA 4UY8T 3SV3A 3ZZPA 3BM7A 3CCZA 2V8GA 4DFMA 5E33A 1HPZA 2ZH4A 3RBXA 4DJBA 1HNVB 1M5VC 3M8PA 1VJQA 1M1GA 3CJ5A 3OXFA 1RADB 1XR7A 3TAPA 3EJMA 2AW0A 2JEIA 3W66A 4X62F 2KFYA 4DL4A 2VUGA 4JI8F 2HBZB 1CJVA 1XJWB 3CSKA 3KLIB 3MEGB 1UKUA 2HGMA 2J6SA 2NS1B 3VV2B 3I5CA 2DIVA 3J7AN 1YGYA 2PN6A 3SQOP 4F3OA 1NK8A 4HYKA 4CLTA 5A8KA 1TKZB 3R8YA 4EZ9A 4ID8A 4KFBB 2MQQA 1WHXA 1FVQA 3DOKA 4DQIA 3KNAA 1QSYA 3R1HA 2AJQA 3BF4A 2NREA 4B9TA 2AZ3A 2EFQA 2ZUAA 3MAAA 1T9UA 1RHKB 1EZZB 3ET6B 2YWWA 2M9KA 1UZHA 1J5EF 5DETA 2J6TA 4FF2A 4OYBA 3GIMA 1M5SA 3CNQP 2ZH3A 3C14B 3CDEA 4QIGA 3W2VA 1VBYA 2HS3A 1RTJA 1U09A 3U27A 1BQMA 3LP1B 1YZ7A 3DU5A 1L3VA 5F8NA 2YQ0A 3W63A 3NGRA 2YPYA 2MYFA 1OIAA 4WKRA 3R1LA 2DHXA 3PKYA 3TAMB 4M63A 1X5PA 2LYVA 4OHWA 1H7XA 1CJUB 5IV3A 3MXHP 4GVLA 4L72B 3R5JB 1HKAA 5AT1B 2A2CA 1NJYA 4DQQA 4U9RA 2DEIA 4DI6A 4DUZF 4KPYA 2M8DB 3G8SA 3QAEA 3DRSB 1JXEA 1VRTA 2R8KA 2JLFA 3A1YG 3FNNA 1U24A 2H5EA 2ZNYA 5AJ3F 3AODA 1XWLA 3MR2A 1OO0B 4QPXA 2NCKL 4HHUA 1TL7B 2ACYA 1X4EA 3Q8UA 2HZVA 2KVQE 5AE3A 5ETMA 4G1PA 2YTCA 1NDCA 3EVMA 1P6TA 2M7SA 2WB1D 1JWWA 3QZ8A 2ASJA 4RNFA 2FGOA 3SZ2A 3PV8A 4Y6IA 2BBEA 1FTCA 1VQLS 3RW6A 5EX3A 2Y9HA 4ZVOB 4CIOA 3NS6A 3BO2A 2BDPA 3PVXA 1E6VB 5D4LA 4A8OA 3W62A 2MGZB 2XWXA 2CQDA 2IC3A 2PD1A 3JSMB 4LVOP 3EGNA 3CJ4A 2CWXA 3M9NB 4DR4F 2D3ZA 3PEJA 3PX4A 3Q0AA 4WZQA 2RU9A 4GMKA 1I94F 4H4OB 4ECVA 3MPYA 4DPXA 1D9AA 2BOAA 2AEFA 1WC5A 1S1UA 1NZAA 1AT1B 1Y5LB 4H4MB 4FF4A 2EW9A 5F0WA 1JLCB 2FYXA 3C6UA 4X65F 2R8HA 3UO0A 1BMQB 1S6QB 4EBCA 5K20B 4F4XA 3C3LA 1RUSA 2FD2A 4NA1A 2NSBA 1HHTP 2YNGA 2NQPA 1YZ6A 5A0YB 1U6BA 2GCFA 2VG5B 4ED5A 1XMQF 3ILIA 5M2PA 2GVZB 3MPWA 4ECXA 2ZJQQ 2KHDA 1I94J 3L7UA 1HWIA 2Z56B 1UWBB 2IJRA 2W2OP 4Q43A 3GP9A 2RQCA 3BGRA 1WDTA 1Q16B 4PKDB 3HT0A 1LWFB 4MFBA 4N76A 1VISA 4ERDA 2PEBA 1T05B 5EDWA 1KSPA 3QAUA 2DGSA 2C22A 2WAQD 3RB0A 1SVDA 1FT8A 2R2SA 2FIUA 2HHQA 2E9RX 1VQ6S 3S6EA 4QWBA 5HROB 2QJ3A 5CYJA 3CCTA 3BKTA 3PRBA 2JOQA 3Q8QB 2IM0A 1XMBA 5T7LB 4DDFA 3RRKA 2FTRA 1VK8A 3UCUP 3CCUS 3U7JA 2HNDA 5KFKA 1LW2A 2KI2A 4K4ZA 2B51A 1HWUA 1ZPWX 4I6YA 3MMAA 3ADAC 3QGPA 3IC1A 5HL7Q 1GMWA 1RAGB 2NYIA 2XSFA 1HQUB 2IYGA 4FF1A 5KFWA 1RAEB 1F5CA 2KU7A 3QPIA 3MUTP 1HNVA 2OPPA 2V2KA 1WOOA 5IFMA 1ZS6A 5C25A 1UWAA 7AT1B 1JKHA 1XMOJ 1LOUA 4OLPA 4E8UA 1Z2ZA 3UE2A 3MF5A 3H98A 2WSEC 3FCWA 3KLIA 5KG7A 2HIQA 3MEGA 2ZH9A 2GV1A 4LT6A 1DBDA 1X31C 2UXCJ 2WVFA 2QYGA 4XPCA 4A46A 1S1XA 4HT5A 4DL2A 4KFBA 2HHPA 3HFVA 2P9GA 1O8BA 1S99A 3OHAA 4OMFG 1T9TA 1KVKA 2BA9A 4OZLA 2RU3A 1RBLA 4HHJA 3MEDB 2BXJA 1EX8A 1C1CB 4YR3A 1YVFA 4JB8B 2KRBA 4LF1A 1OSCA 1UETA 2HFSA 1RHRB 3NLCA 2CZVC 4OYAA 4NXMJ 3EE3A 1N36J 3ZXWA 2JX2A 1CULA 1YBAA 3HVTB 2MY7A 5KG5A 2KJWA 2GQCA 2QMUB 2BW7A 1CS4A 4JYAJ 4G6VB 1GEHA 1A6LA 3CDBA 4WPAA 4LRFA 2C1EB 4JV5F 5GAEI 2DISA 1RTDA 4DOZA 3CMES 4M5IA 1R3NA 3V6DB 2IVYA 3VAKA 3MD3A 3TAMA 2JL9A 1VBKA 4QIWD 4RJVA 3P4UB 4KR0B 3ZZOA 2QZ8A 3OTBA 1HYSB 1E6YB 4QIFA 3M6WA 3OD2A 2W2NP 3DLEA 1H2TZ 1MMDA 2FPHX 1IKXA 5KTQA 3OJUA 4LR8A 5KFZA 2ATCB 3DRSA 3HVWA 1U2FA 1LFWA 4IG0B 4G65A 3P6YC 5DDOC 1RT5B 3HJVA 2HHVA 1Q53A 1Q5YA 2KH9A 3BQ1A 4LVNP 3NGUA 5K9FA 3JTOA 4J9QA 1RYSA 4CLLA 5D3GB 2FVSA 3H4DA 2HFOA 2R9LA 1VQ5S 3HO1A 1T9YA 2BE7D 1IQTA 5L9NA 2R42A 2WVBA 1NKCA 2DGQA 3BBBA 3UQSA 2VOPA 2HYIB 3AB4B 1TL7A 2A18A 2ZBRA 2C2ZB 1V3RA 2ZHBA 2K1RB 1NSPA 2F7VA 3BYRA 2ZKTA 4JV0A 2R8GA 1VGYA 1C4CA 3UN5A 3O3LA 3CCES 3K7RA 4K4VA 3V4IA 2XBPA 3FK4A 1ZTWA 1E6VA 3C66A 1CVJA 4AFFA 4NA3A 2I38A 2AJ2A 3FEZA 2PA8D 2MGZA 1X4CA 2GIFA 1HARA 3JSMA 1ZM4A 1GX5A 2XO6A 2DXEA 4DBQA 3QGHA 5HMXA 1HNWF 1UCNA 3IWNC 4DQPA 1B64A 2G2OA 2B9EA 5E3PA 1OPIA 1TFYA 1RDRA 4PYDA 1NPPA 4H4MA 1G2EA 4GRSA 2E5GA 3QATA 1VIXA 4WP9A 1JLCA 2J0QD 1TR0A 2D69A 1NO8A 2C2RA 1XC9A 1S6QA 1IQZA 2Q79A 3E3XA 4OYZA 4B3RJ 4FVCA 4A8MP 3MOZA 3PACA 5AXMA 1S72S 3TP2A 3SEOA 1PKUA 5B0BA 1WWHA 2Z30B 2C28A 4CO0A 4WKYA 2VG5A 4OHXA 4ZMMA 3UR3C 3GR1A 4LSLB 1B0PA 2OHDA 2C42A 3JTNA 2HS0A 3W9JA 3UCGA 1BUXA 3T1YJ 1S10A 3OQ2A 1D09B 3ZNUA 4DV7J 1WI8A 2HQGA 3DYAB 1FFSB 2RQMA 3NWRA 1LXNA 1S0VA 1IKWB 1UTAA 1T05A 4B9UA 2BJ3A 5ETQA 1RQ0A 4DR2F 4DL0C 3HHDA 3HT3A 4K8RA 3ISNC 1LW0B 3HSZA 2FLPA 1Q86T 4XO0A 3GQCA 3I31A 1S7IA 3JQJA 2MLYA 4BWMA 4DMZA 1G3OA 1N52B 4KV8B 4DS5A 1TK5A 1VI7A 1UVIA 2VA3A 5T7LA 3RJMB 4OV1A 3LUYA 1X0PA 4KHRA 1FK9A 3D66A 3ICLA 2KG0A 1HNZF 3C2PA 4X4OA 2QLWA 2D3OR 4LIRA 5MAOA 1MU2A 5DQIA 4WIQA 5F8GA 4DR2J 3CMAS 2XB2D 2J9CA 4IQMA 5KFOA 1IWAA 1HQUA 4M95A 4I4BA 1BLUA 3H2LA 1NK6A 4CLPA 4KJIA 2FJWA 4G1QB 1GXUA 2Q43A 5IOLA 1K0VA 4FN5A 2BQUA 1Y0HA 3OL8A 2M88A 1UFWA 3RBZA 2G4BA 3DMJA 3BQ2A 1APSA 2AF6A 3DC2A 1Y11A 2ZVSA 1FEEA 3BSNA 2GS8A 3MURP 5H9EK 1FEHA 2YQ3A 1T03B 3UD4P 2GVDB 1TMMA 1NEEA 2ZWPA 2E5LF 1HMVB 3M8SA 1IN0A 3OTOF 4FXWA 4HT7A 2IM1A 2B43A 3SCLE 2OPRB 3NS5A 1XQIA 3GFHA 2XMWA 5F8MA 5GAEU 1Q8BA 3MEDA 1AROP 2K3IA 3NGSA 4KGXB 4NPOA 2L9DA 3CTRA 3DLKA 3KFWX 4OJGA 2XSJB 4OX9F 3CCRS 1KN6A 2DGVA 1G4CA 3JYTB 1L5UA 1F9HA 1FRIA 5EWFA 4ECTA 4EO6A 3K5PA 2BEFA 2OTJS 3TWZA 4FBUA 4F4AA 1NNDA 4KH0B 2CPIA 1V5IB 4CO1A 3BDEA 4KO0B 3TO8A 3GJRB 4DR6F 2DGOA 3H0PA 4LBPA 4O0NA 1IM4A 1WEXA 1YHQS 2RIJA 2MKKA 5A6PA 2AGQA 1E6YA 3I56S 1LKZA 2C2DA 3AAWB 3IMQJ 1SKUB 4WFXA 3ISZA 3SBMA 3H42A 1H74A 3IA0A 4ZPVR 2YBVA 1RWKB 4DSFA 3C6TB 5F9LA 4Q5VA 4FPRA 3KUHA 1RA6A 1QAYA 5D3GA 3NAIA 3MZIA 2C3PA 1GMVA 4TXSA 1VLOA 3RB4A 1XIQA 3A3PB 4ETZA 1J27A 4U67Q 3D54A 4QCLA 3H5SA 1A7GE 5KFJA 3UVJB 4N56A 3CD6S 1IR1A 5FDLB 2UU9J 4K4WA 3DGPB 4IKAA 4CDIA 1FI4A 2F8EX 3TEGA 2B9YA 2VV5A 5KG3A 2UVWA 3TUJC 2QGFB 1EQMA 3D0IE 3PHEA 1Z2LA 5DS7A 1WC0A 4V1Ak 1SCJB 2CJKA 4NMXA 4CNYA 4R5PA 2HVEA 5LM7E 4AXIA 2WONB 2EI5A 3QGGA 3AD7C 2DCUB 3PYEA 1UFLA 3IGVA 5K8MA 1PAUB 4LRCA 3OTCA 2V68A 3LF0A 3R5DA 2PFDA 3EGZA 4KGMA 1U2RA 4FYXB 2CQ2A 2W1BA 2ZC4A 4HR2A 2AD9A 1WKKA 1RBAA 2MZRA 2CJAA 4MK8A 3I6PA 4A8XA 5HVHA 3PW2A 4PWDB 1EJ7L 4HI1A 5D6GA 2OSQA 2NXUA 1HHSA 4FYDA 3CMQA 1KBRA 3OVAA 1IBKF 2PMHA 4NLUA 2FVRA 2FHJD 5HSPA 3DI6A 5F8LA 5LOQA 4JI4F 4I2PB 5IS2A 4RU2A 5HP1A 1NHVA 1PBAA 3IRXB 3DDNA 1NB7A 4TYBA 3T5LA 1V3SA 1D9DA 2LECA 3IR7B 5HQ8A 1FE4A 2VG6B 4Y2AA 2XY7A 3EWGA 3IR6B 4ELVA 4LSLA 1Q8LA 4EWTA 1HD1A 1S1TB 3SFUA 5D4NA 1N8RT 3NG8A 3P8BB 4CO2A 3DYAA 2IA6A 3M30B 4OHVA 1AXQA 3HMJG 1RAIB 1RTHA 1VHFA 7FD1A 2W7AA 4JI4J 1GTHA 3ETMA 4UF4A 2B4OA 3H5YA 4U96A 4IFVB 3KNGA 2OTLS 2NUHA 4LFCF 4DPTA 1KVJA 4KV8A 4OQJA 3THTA 4NXNF 4ZJOA 1QSSA 2C2OB 1Y3JA 4AL7A 5AE1A 4LF9J 2ZH8A 3MM5A 5EWGA 2UZAA 4JI1J 5KFGA 4UOCA 1URNA 5EUHA 5L46A 1UJ5A 3ZZ0A 1JB0C 5DQHA 2HG4A 4JI5F 3BGUA 2J8SA 1S7HA 1F2GA 5DGBA 4ZPBA 2CJBA 2YWHA 4LFAJ 4NMLA 1IBCB 2ZH7A 4EI2A 5KOWA 1N5VA 4G1QA 5J1EB 4LFCJ 4C2MA 2NPIA 2GHWA 3SIPB 2LCWA 4KTQA 4AQYF 2XYPB 2F1FA 1B0VA 1FFWB 4DR1J 1ZM3A 4ALZA 2FZGB 3A3NB 2VICA 4QOTA 1RWXB 3AOCA 4P74A 4KKOB 2HFZA 1XNQF 1GH8A 4XPEA 1T03A 5THWA 2GVDA 4RUCA 4NCBA 1CG2A 4DV0J 1W7WA 3Q22A 1HMVA 2FY1A 4QR2A 5HO4A 2LEBA 3L95X 1VIOA 2D9OA 1RACB 1H2VZ 3EXYA 5LXYA 2OPRA 2UXBF 2VKRA 1VHIA 1BC6A 1OSDA 5ETVA 3OPKA 2XZDB 3QQCD 1S1WB 2A1BA 3PKMA 2XSJA 4YDDB 1GK8A 3P5TL 1N5YB 3JYTA 1X4DA 1AB8A 3RBDA 2WB4A 4IO9Q 1VQKS 4OV6A 1JQGA 2HRYA 4M5NA 3HZEA 2NLWA 1X4AA 4E2FB 2HLTA 1JLQB 2O67A 2QMXA 2QLJB 4M5KA 2YKNB 4J9UE 2BZ2A 3R5BA 4KO0A 3OVSA 4ZLNA 2XMKA 4OI0A 1RAHB 2LEPA 2QLFB 1B7YB 1FKOB 3N5FA 4F50A 1GX6A 1VR6A 3F0NA 2LVWA 4CH1A 2AX1A 2DBBA 2EBEA 1OQ6A 1TL3B 2RHQB 2WW4A 3R6GB 2AJ0A 4GKKF 2HQFA 1K0TA 2YQ1A 4ZPDA 3I0RB 4UUWA 4MT1A 2VBWA 3O2IA 4PR6A 3C6TA 2E29A 4DFJA 1TUVA 2OAUA 5K8OA 2J7WA 1WUUA 3R5GA 2GW8A 2CNLB 3G6ES 3R5CA 2VZ9A 2MKIA 1ZM2A 1U1RA 2ZM6J 2H5JB 5A6WA 3GCXP 2WSFC 3CIMA 4CYUA 1ZH5A 5FDLA 3R9LA 2Y1LB 3DGPA 2CFXA 3BBFA 4C48A 5J1PA 4XTTA 1FRHA 2BX6A 4PYAA 1D0EA 2Y0BB 1RHUB 4DLGA 3H8YA 2DHGA 1DQ8A 1F3FA 2BM1A 4IR1A 3DHWC 3K5MA 2H54B 4QR0A 3R7BB 1UMJA 1VDHA 2WONA 2F4VJ 2QG9B 2RDJA 3J81j 1K9MT 3D3CJ 3KUGA 2P9EA 3AD9C 2JNJA 2Y8YA 2IRXA 2Q1LA 1QLNA 1N33J 1WTFA 5LSRA 4ITSA 3G9CA 2KO1A 4IOCQ 2DY1A 3KK2B 2OEKA 2VC1A 2E44A 4BDPA 4U7UD 2RUGA 4PWDA 4KHPF 4FKYA 2MJUA 2F8MA 2FZKB 5CYMB 3N0VA 3NMAA 1RI7A 4NRTA 4LQ3A 3VCDA 2ZH6A 3OL9A 2XY5A 1DZ5A 2JWNA 2EC2A 1K73T 3IRXA 2JEFA 2VB6A 3HFKA 2BV3A 2CQ0A 1I5OB 3TRGA 1X9MA 3I5AA 2VG6A 2LQ5A 5FLXU 3KK1B 4HL9A 1YG0A 1S1TA 1S6OA 1XEZA 5LJ5Y 3MCMA 3W1YC 4DUYF 5F8IA 4B3TF 4BC9A 2M4MA 1U6FA 4YB7A 5KFTA 3M30A 3ILJA 2H1YA 4ZPWR 2ILZA 2HQDA 4NWBA 4NZ0A 2VC0A 2L08A 2JRSA 1ZTTA 1QAXA 2H4YB 5I42A 2L9NA 4NLTA 4IFVA 4MAKA 5K8NA 1KONA 3D0GE 3IWXA 2ZOMA 2D41A 1K1QA 2GJFA 2HHXA 1SC1B 3VF0B 2XMJA 3H2UB 1P9QC 2VFVA 1C0TA 4ELUA 5DDQC 4B3TJ 1EKRA 2AU0A 2OFGX 1FXRA 1SH3A 2Q6CA 2CJQA 2KYZA 2ZVIA 4HVZA 2W4DA 1SUQA 2BE2B 2RQ4A 2ZC3A 2ACMA 1M1HA 2AJ4A 3N6MA 5KT5A 3BN7A 3UCZP 3MUVP 4DS4A 2Y1RI 3DLHA 2K06A 3A4TA 5AE2A 3LGMA 3QT6A 1U1MA 1WC3A 1NK0A 1TFWA 5KFRA 4L75A 2I5JB 3PIPQ 1FNMA 4ICLB 4CWBA 4Z7CA 3VAJA 2UV8G 3TZXA 1R89A 2YY3A 3PZPA 4KKOA 2X1AA 2VBXA 2LXIA 4ECUA 1RT2B 1QAIA 3J81Y 4PWUA 1NH8A 4DV4F 3HHNB 2XMVA 4LF7J 2O66A 4UUXA 1ELOA 2N4CA 2OI2A 4D3GA 2VQEJ 4WXOA 2XMTA 5KFQA 5ETLA 1U7LA 4A8QA 3CULA 2GMLA 4RNHA 3TR5A 2DNPA 3IS9B 4X4UA 4AL5A 2V34A 3K8WA 4DV3F 1F60B 4Q8EA 3BR9A 2CQIA 5A2QY 1S1WA 1R0BG 2UVVA 4IDKB 3TI0A 2GO8A 1N5YA 4PEOA 2CG8A 2HPUA 2AYEA 1M5KC 1V9OA 2HHSA 3SSQA 3AQPA 1IBLF 4USHA 3U1MA 4OIXA 1WC1A 4OJ1A 5DM7Q 3NCQA 2YKNA 4CCHA 1ZYQA 4C11B 3QFWA 4ZVUB 4NASA 2ASYA 2UUCJ 4WBFA 1WJ9A 3TUPA 2QFJA 4ZVFA 1MNEA 3PO5A 5A8WA 3J7YU 2MZJA 3ZZUA 5F3ZA 1U2CA 2BRKA 3J7ZT 1FKOA 4ER8A 3CIZA 1N5QA 4TNOA 3CCJS 3HHEA 2E9ZA 4D3HA 2VFSA 4WE1B 4UOHA 3AD8C 1TL3A 2BKPA 2VFTA 3IAM9 2VD3A 1A9NB 2FHMA 3UNGC 2VDIA 2F8HA 3PJ9A 1JK9B 1TUWA 3BZQA 3KHHA 3CXCR 3I32A 3ITHA 3I0RA 1NHKL 5IT0A 5E3QA 5F3TA 4N41A 4URSA 4OJHA 1YI2S 2V9WA 3BGFA 1M5HA 2DCLA 4IYQA 4ECSA 1ZM9A 2XGPA 2XI2A 4KT0C 5KG0A 1S6PA 1H7WA 2UUAF 4F7VA 1GQEA 1S9GB 2V63A 1YRTA 1ZZNA 1QSLA 2CPDA 2DR5A 2D74B 2WK4A 3H5UA 1IBMJ 2L48A 2OPQB 4M5LA 3VGUA 2RF2B 4LSNB 3FQLA 2VKZG 1EP4B 2CQBA 1O6XA 4IH6A 4ENOA 2BJ7A 3SI8A 3KK2A 4CNZA 4DG1B 1QTMA 3J80Y 1S9FA 5DZ7A 3KLGB 4Y3CA 5KT7A 5CQGA 4NCGB 5IWAJ 5E3AA 2ZUGA 2D7SA 1R6YA 1N34F 2AYMA 5FD1A 4F3QA 1AW0A 4NEYA 2EC0A 2OSRA 1VK3A 4J9RA 5B0AA 2RKIB 5CYMA 2X51A 1ZAXA 1NBEB 2DKOB 2IAJB 4Y65A 4ZVTB 2CPZA 2KKHA 3D6FB 2DRAA 4MIWA 3CO9A 1RT6B 3HULA 1RT1A 1BE4A 1P1LA 2KT5A 2M5YA 3MGJA 2NUUG 1BQNB 2R7XA 2QTWA 4ZCIA 1RHJB 4X4QA 1HI0P 3R27A 3KK1A 3ILOA 1SQGA 4EGLA 4QYZJ 2UVUA 1FD2A 3PIOQ 1QVFR 5DGAA 1F5BA 2KB2A 4KBIA 3ETOA 3NEKA 2X1GA 1U49A 2X3GA 4LR7A 3UWTA 3WBZA 1UFKA 4C8OA 2AYBA 2FHOB 4J37A 1HR0F 5AXNA 3LQVA 4HH0A 3CJKB 2NSCA 2E1PA 2DYAA 4K4YA 4WU3A 1UP1A 5KFPA 1M90T 4B3SF 3DXSX 4RZRA 2BRLA 2P8IA 4ANCA 4O0IA 3DHXA 1J5OB 2QMWA 1VQNS 1SJ3P 1OJ4A 4ECWA 3OJSA 3RR8A 2M52A 2EFPA 2QYCA 4X2BA 2QL9B 4HTJA 2FHJA 4ZVQB 2IA0A 1YJRA 3CJRA 3Q23A 1LK7A 4NLOA 2AQ4A 4OYPA 3KTQA 2ZOFA 1RXOB 3T1HF 3NY0A 4NI2B 3OL6A 2XEXA 1WELA 3KOAA 4Y34A 1BD6A 1PJ6A 1WG4A 1HR0J 4WFBQ 3N79A 1YRXA 3BV8A 2LP4A 3CCLS 2BANB 5J2NB 3ZNJ1 2HS4A 3MWBA 1TAQA 3M2VB 1FF2A 4B9NA 4OZ3A 2ZJRQ 2FJAB 2PMWA 1DQAA 4DR7F 4RW8B 3KJVB 4OYOA 3WHIA 3E2EA 5CYQA 1YRUA 1UJ4A 1JJHA 3JXOA 1YBUA 2DNMA 2NXNA 2KYXA 1T95A 5LMUJ 2ZNZA 3J7A1 2R7UA 1EETB 2GHPA 2I5JA 2R2TA 1ZAWA 1RWOB 4B3MJ 4EZ6A 2O5DA 1SC4B 2ABYA 5KFXA 4ILLA 4MKYA 4FYVB 2V69A 4N77A 2IDLA 4OZJA 1DLOB 2VH7A 4C8NA 4YY3J 1HNXJ 2D1CA 4DV6F 2G0IA 4ATNA 3DKDA 3CE8A 2CJXB 3CC4S 3DRRA 5JVGQ 2W2QP 2XZTB 2R7TA 3IS9A 3MM9A 3GFYA 4PPZA 3TAQA 2DR6A 1R43A 3SCJE 4Q45A 2GHVC 3D1QA 4QWDA 2ZZMA 4MIBA 4IDKA 2CPYA 2EFGA 4EK2A 2HFUA 5KG4A 4ZJQA 4QYRA 1T7PA 2B7CB 2CNKB 4JI7F 5M2UA 4GKJF 3UNYA 4LF6F 2XS7A 5IM0B 3DGVA 3CJ0A 2FC9A 2ZITA 4NLPA 2KJVA 1IVZA 3M8YA 4TLRA 1VQ4S 1WSRA 3U02A 1EARA 4UQTA 5CH7B 4DL3A 2JJ4D 4URGA 3M9MB 1LK5A 1C1BA 4F04B 2HVDA 4EUVA 2B6AB 3PTWA 2XNRA 5F8JA 4USUA 4Y0FA 1T3NA 2W8LA 4YFUA 1ROFA 3K0JA 3UDEA 2OUGA 3DU6A 4WE1A 2DK2A 2EK6A 3EVOA 3MCOA 2F9DA 3E8OA 2LLZA 2OEMA 3GIRA 3RB3A 2DPJA 2W9CA 4LRAA 3T6JA 6AT1B 4JI6J 1SH2A 3KWMA 4IG3B 4O4GB 2VIHA 1EIYB 4U7UK 3X1LB 2ZZTA 3BREA 1SL1A 4DR3F 4DU7A 2JFDA 5RUBA 2G13A 3RAMA 1S9GA 1RTZA 3PDNA 2W4PA 9ATCB 2ZDPA 1R0CB 4TQSA 4ZS6A 2CDRB 2Z0GA 1UPPA 4RW4B 4MK7A 3LTOA 3M2RA 5IC6B 2RF2A 2I8EA 4KE5A 2HHTA 1U47A 1EP4A 2IJFA 4OX8A 2YNFB 4QBUA 2WVEA 1NKBA 1JLAB 5EHHA 1FWLA 4RL1A 4TY9A 2HVHA 3FEXB 2C2MB 3DLGB 3WIUA 4DG1A 3AOBA 4NCGA 1RA7A 2RRAA 3LPEA 2B8QA 3BYPA 5EN1A 4X66J 4O3NA 1HI8A 2UVRA 3HVRA 2E7XA 2Z2ZA 4WFAQ 2IAJA 4ILRA 4CT9A 5FIIA 1RYRA 4DN9A 4N5SA 4R0EA 3TYTA 4Q7AA 5JJBA 3EX7B 2QLXA 3PR4A 3RW7A 3KJNB 3QSYB 3W5ZA 3ZTPA 4OL8A 2WBRA 2GFFA 2MQ8A 1BQNA 1VJWA 3LGNA 4R25A 2HGLA 4ZHRB 1ACMB 4XDDA 4R0JA 4N8OA 3NBPB 4OI1A 4PABA 3UW1A 4U8VA 1UW4A 3T3FA 3HD1A 2BABA 4M5HA 1DHMA 4ES1A 4PAAA 3MFHA 3DXBA 3K8VA 4HACA 1IKVB 3T9ZA 4F4KA 4ZITA 4UY85 4URQU 4AXJA 4F02A 2MEWA 3HVAA 4DFKA 1L3KA 3W64A 4NE9C 3PX6A 5KFHA 3SMZA 1J5OA 1WG1A 1X9WA 3RYLA 1ICEB 3QIDA 3TVYA 4JOUA 4CLWA 2HSEB 2HK2A 4HDGA 3R2CJ 3ZTSA 2CA9A 4RU9A 5D77A 5KAKA 4YDXA 3CD0A 3GIJA 3HHLB 4LR9A 5ETRA 1WNEA 2NZ4A 4NI2A 2PI4A 1U4BA 4GO5X 2J0XA 3VAMA 4L3KA 1QUPA 2HZAA 4MK9A 3S01A 2FQQB 2BANA 5B0CA 4PXBA 5J2NA 1O0PA 4BWJA 2GQQA 3ZZTA 2RQKA 3M2VA 1JLEB 2YWFA 2E7WA 3PRDA 3KJVA 3KLHA 4Q2LA 4DFPA 1SJQA 1FDBA 2K8GA 5HVFA 1FDAA 3BO4A 2VG7B 1JJ4A 1VQ8S 2NZCA 3WDOA 1EETA 3CDAA 4DSIA 2V5HG 3FZ2A 2X7IA 5CZVA 1Q7YT 4LMZA 3CJTA 1W2BR 1DTQB 5GAGI 4IUFA 2W7PA 1DLOA 2FZCB 2ZE2B 4ED1A 4P10A 1IKYA 5E3CA 3KXDA 3FBEA 1XR5A 1B0TA 4QU7A 1Q8KA 1QY7A 4C8MA 2H51B 4NLVA 2B7BB 3I9ZA 1TVRB 2CVEA 4WTOB 1KD1T 4DL7A 2OKQA 4DPOA 4DCOB 4WCEQ 3PM9A 2IPOB 2YWKA 5E0OA 1NMEB 3AXMA 1RCXB 1CJKB 2XM3A 4QWEA 3MAQA 2R2RA 2W2MP 4JI2J 2EWHA 1ZAVA 3VQSA 3W3SA 4E98A 3UDCA 1YJTA 3LGHA 3G6XA 3DNCA 1RCOB 4CLZA 4WF9Q 4WZMA 3AH6A 3CJQA 3C8YA 3F73A 1HBMB 4UQGA 2YNIB 2OH2A 2VL1A 5IM0A 1XN9A 4ZCLA 1REGX 1Y00A 4B9SA 4I2QB 3O8WA 4QJVA 1TL1A 3LAMA 2G0CA 3VHQA 2YXLA 3TZWA 4ZOSA 3L4BC 1N6QB 3SQGA 3DRXA 2R2UA 2XS5A 2E1RA 2Y1IA 2MKCA 1VQYA 1IR2A 2B6AA 1MWZA 2C3YA 5F9NA 1JNRB 4I56A 3V6HA 3RB6A 4NYOA 3FUYA 2H3EB 2AV5A 3S7RA 2IBOA 1NZ8A 3M2UB 3K5OA 5I3UB 4X4NA 2N82B 3KHRA 5J2QA 1FWKA 1OYDA 3R5AA 3M32B 2PDAA 4ZA1A 1S12A 4PQAA 3VGTA 2M70A 3U1LA 1DTTB 3N01A 4O4GA 3D68A 1RT7B 4OZ0A 3P45B 4YHHJ 2WW8A 2H9ZA 2BJ9A 1N5SA 1X60A 2B0GA 2V94A 4DV1J 1Q81T 2H5IB 2P5VA 3PNIA 4OI2A 1NPRA 4J9NA 2MZQA 4L6V3 4X64J 1LQ9A 2OD6A 3RUBL 3BKUA 5BR8J 3CT9A 2Z8QA 4RW4A 2GGPA 3JAMU 1Q8IA 4LREA 1P9YA 4PUOB 2HK3A 4OI6A 2RDDA 1Q1KA 3OBIA 5HI7A 3V4MA 2GJ2A 3AJ2A 4P73A 4OZ2A 1NSKL 3EDQB 2YNFA 3VWSA 3FBFA 1JLAA 2CADA 4DR5J 4EEYA 3KMSA 2KXNB 4ZIWA 3DLGA 4F36A 4EMDA 4RW6B 1ZOTA 1N32J 4P7VA 4DZDA 1JLBB 4CM0A 2HLUA 5HLFB 2XHCA 4KIAA 2RRNA 2Z2YB 4ID5B 1HNIB 3CO0P 4Q8FA 4Y2MA 2MZTA 5F41A 2XWYA 1K47A 3NL0A 1T9WA 1H98A 1OS5A 3UR0A 1U1KA 2Y3YA 5T41A 4TYAA 1LFPA 3T6BA 5HATA 3GILA 1RWMB 3AFGA 4RBVA 4KPCA 2B4VA 3FC9A 4F8RA 2EPIA 1KLMB 1XMOF 4CI0B 2JVRA 4ZN3A 3O44A 3GIIA 1EKSA 2IDEA 1PIEA 3BSCA 4ZHRA 4J9PA 3NBPA 2WZ1A 2YVSA 4CO3A 3OSNA 2VU5A 3NOCA 1VS3A 3ZZZA 1WOSA 5A8RB 3DRYA 2J76E 1QDUB 4WYWA 1T8EA 2UXCF 4TLQA 3W7BA 1IKVA 3HJFA 3GSDA 4QW9A 1YJUA 3KK3B 4ED6A 3G86A 1V3ZA 1MMNA 2HWHA 2MKHA 2Z4PA 3PW0A 1JXLA 2HHWA 1OYEA 1Y3KA 2FC8A 4F67A 2RDIA 5DG7A 2OIHA 1PBUA 3HKZD 3QFHA 4C8LA 2CPFA 3LWLA 3QNWB 3AJDA 3FMWA 1QM9A 4HI2A 3HHLA 4LF8J 4NXMF 1N36F 4DEZA 3IM9A 1R27B 2VODA 2Q6BA 4NZ7A 3D6HB 2VONA 4JYAF 1LXJA 2BMBA 1CC8A 1R31A 1TKZA 1ZETA 5EX0A 4L73A 1CC7A 1RWNB 4CQ1A 4NZ6A 5GAGU 2CQCA 1JLEA 2V67A 2YX1A 2AKWB 5IZHA 4FZVA 2MLZA 3M6UA 2Y8WA 3ENAA 3GSIA 3UN3A 1FESA 4I64A 1U48A 4DV5J 2UXDJ 4C6AA 2N7YA 3MMBB 1D3WA 2RHSB 3ET6A 3FRZA 3FVYA 2VG7A 2QSFA 2XHWA 1SC6A 2DGWA 2UUBJ 5FJ4A 4O3RA 4ED4A 1D8YA 1M5PC 2ZBPA 3C14A 4R8UB 2ZE2A 3LP1A 3OT9A 4UZCA 3PYFA 3QRPA 2KXFA 3IBCB 1HPZB 1L3SA 2DNLA 4DX6A 4YB1P 2NR0A 1JX4A 1CJUA 1YJNS 2IM3A 4CLUA 1HW8A 5HMYA 3CC7S 2VPYB 3IBFB 1CQMA 1CJKA 3L7PA 4IRKA 3FEYB 4O44B 3VGVA 1NK7A 4KC5A 5HMWA 5C24B 3PW5A 4BC7A 3DLJA 1AYEA 3K59A 3SSSA 2PO4A 2B4UA 1GFWB 4K2JA 4S0MA 3K57A 2MB0B 3KYLA 3P49B 1HBMA 5SUHA 2XNQA 1JXVA 1YIJS 1S48A 2M3DA 3GZ7A 5A8KB 4DX7A 2A2DA 4I2QA 2KM8B 4NLDA 4CLFA 3W9IA 3P5BP 4USWA 3AT1B 1MSWD 1N6QA 5HQLA 1FRXA 2KN4A 2WBMA 2ZEJA 3EPGA 2W25A 3KG0A 4ECRA 2IVMA 1WF1A 2PT0A 3GR0A 1SPBP 1RKIA 2B56A 3MAAB 1FJGF 2C3OA 4TY8B 2W2PP 1K1SA 2ZWOA 4F0HA 3Q83A 1SL2A 2DHHA 3AJ1A 2ZFHA 1VC5A 3E01B 3VQTA 1JJCB 3TZYA 1B7FA 4B3RF 3M2UA 4KB7A 3IAS9 4J9VA 5I3UA 3C19A 5KT3A 1RTJB 4C9DA 2MKSA 3L09A 4K4TA 2AEJA 3M32A 1XK8A 3I9V9 3VAHA 3HI9A 1DTTA 3MEKA 2ASLA 3UFCX 1D1UA 4DXLA 4LF4J 4ECZA 2VQFJ 4H4OA 2WSCC 2B9XA 2R4FA 3Q2SC 2DR7A 4KAIA 4NX9A 3T1YF 1FJGJ 4DV7F 4K5SA 5DO2A 3AA8A 4LF2A 1KHVA 1Q7LB 1W25A 1LWEB 2OD4A 5U47A 3B54A 1HI1A 2J0WA 4K7QA 4F0MA 3VTIA 2CNOB 2LU1A 5J1NA 3KLFB 2QEXS 4W98A 1TKTB 3BS9A 3M6VA 2VF3A 2JLEA 8RUCA 4WXWA 4PUOA 5C42B 4ZPTR 5A0YA 4LRBA 4YB6A 5CHCB 2BOPA 3IR5B 3VVUA 5M2RA 4LF5J 2V0NA 4PXEA 2AP6A 1HL6A 1WACA 1CEZA 2GVZA 3B4DA 3GIKA 3D7SB 2BACA 3M4XA 1UWBA 4RW6A 2KVIA 2QC3A 4LSZB 1JLBA 1UEUA 1XTZA 2R8IA 3TVZA 5HLFA 1LWFA 5L1IA 4MH8A 1HIYA 1HNIA 5IT9U 4FVMA 5CAAA 1YX2A 2N7CA 3SCIE 5KT2A 2B5JB 2BJ1A 3UD5A 1WKLA 2VBYA 3DFEA 1CSJA 5HROA 3NKYA 4WP8A 4MTPA 2IC3B 3V6KA 1RWPB 3EVWA 2W4CA 2FDNA 4DPUA 4EYHB 3G6YA 5E7OB 2XMAA 2IMWP 1UAWA 4DPWA 1YDLA 3TX0A 4DX5A 4K59A 2HQ3A 3NNAA 2Z57B 5A8RA 4DCJB 4LFBJ 1NPKA 2CPJA 3HSGA 3WQPA 2XQCA 1DY3A 2XC9A 2YWEA 4ECYA 2VDHA 6FDRA 1EQ0A 4Y2CA 5MLCV 3K58A 4ZJLA 2CRLA 4YB5A 4P7TA 3R6LB 3RU0A 1JMTA 3V6JA 3KK3A 3M8RA 4IOAQ 4ZLPA 3UD3P 3A3OB 3CCVS 4TKTA 3FCHA 3VVTA 5J2MB 3RBEA 3W5XA 2WOMB 4HLBA 5C2CA 2G9OA 2ZD1B 2VASA 1TK8A 3KMQA 1HW9A 5KOXA 1XNRJ 3JSYA 2VOOA 3P96A 2J9EA 2ZBQA 3MR7A 2XYHB 4DV2F 5CD4H 4PXCA 5AXLA 4J9SA 4ILMA 3R7NB 1R8AA 2IM2A 5LMNJ 4MFBB 3CVKA 3QIPB 2FB0A 4E0DA 4OYXA 2GA7A 1H0HB 3R7SB 2HQCA 4IH5A 1GMUA 2ZHAA 3Q86A 3AOAA 2B4PA 2B9WA 4RBUA 1KHWA 3MAHA 4YQWA 1N0VC 4IRDA 3CD5A 3W8GA 1C1CA 1V6HA 4JI0J 3VR1A 2F63A 4YR2A 2FJEB 1LW2B 1S49A 2I9SA 3CC2S 3HVTA 4DV2J 3QRQA 4QR1A 2NYHA 4H54A 3MMAB 4DQRA 3QWUA 4R8UA 3G71S 3Q2TC 2BE9B 1RLDA 5L8RC 1VQOS 1BQXA 1DJ0A 2HAIA 1UVNA 4P71A 1S97A 3GV8B 1NM2A 3IN5A 2W9AA 4NLGA 2WVCA 5KFMA 8AT1B 5DDPC 3V6DA 2OPPB 3PR5B 1RAOA 4DN0A 3M1VB 5C25B 3LALA 4CM2A 3KHGA 1NDLA 1LWCB 1JKHB 4K0KJ 2UU9F 1B99A 1WHVA 1EHWA 2XY6A 3QLHB 1D9FA 1SL0A 1HYSA 5H9FJ 1YSJA 4O44A 4ECQA 1RHQB 3UN2A 2IRYA 4DHVA 2GMJA 1QTNB 1VOMA 5C5JA 2DVIA 1CPZA 5C24A 1X5OA 4IRCA 1BWEA 1PYOB 1HWKA 2KL8A 3MM7B 3CJSA 2LU2A 4IG0A 2HRTA 3PO4A 1S0OA 1RT5A 5I3PA 3WX8A 1QD1A 1AA1B 1S1XB 1BXNA 1VBZA 5E2QA 1MN7A 2DXDA 1VRQC 5D0RA 4I0WA 5KFVA 3ENQA 2CQPA 1Q95G 3PCOB 4RUBA 2LDIA 3FQKA 2A6MA 2K1RA 4C3LA 4OHZA 4X62J 2YWGA 1XERA 4TY8A 2HFVA 3TUZC 4JI8J 1N5TA 2DEJA 4C4WA 3TNVA 2UUTA 3D6TB 3E01A 4LQ9A 5KFCA 1CULB 2P6SA 3DCAA 4OX7A 3MR3A 1CS4B 3PW4A 2ZHOA 4U95A 3ZFVA 4G3IA 2N3OA 2KHCA 1TP7A 5LXRA 1RTDB 1FKAF 1OY6A 2HBRB 3SXLA 2OP5A 4OZ1A 3PW7A 2QE5A 3G8QA 1PJ7A 3ZZYA 4M5DB 1S6UA 2ZDOA 2JDJA 4N47A 3NGTA 1T02A 3Q8YA 1ZBTA 3Q8RB 1J5EJ 2O1PA 1Y7PA 1FRMA 1LWEA 3DLEB 1KTQA 3FSXA 2HVIA 3C16B 3KLFA 2V8PA 1IKXB 1HQ2A 1MWYA 4DSKA 1TKTA 2KZMA 4UT4A 2D9PA 3G4SS 1HWLA 1F5AA 1NDPA 2F3JA 5C42A 3POTB 4ZVGA 1XBWA 4F25A 1B70B 1RU2A 2HNYB 4PQUB 2MKJA 2LMIA 3EMTA 3F56A 5B0FA 1PC5A 1TL5A 1DURA 2HMIB 4HH1A 3MR6A 1KFDA 4J90A 4LF9F 4ZLLA 3LO3A 4JI1F 2RVJA 1YWXA 2M2BA 3OHBA 3HDSA 1IKWA 2A0FB 2JC0A 3EDRB 4XIUA 4DUZJ 3KG4A 3OFHA 1DFDA 5E5NA 3N28A 2B5JA 2MZSA 4QU6A 1KOHA 5KFUA 3MECB 1LW0A 2J7UA 3V4IB 4MYUA 4DSLA 4XAKA 4FPIA 4LFAF 3QT8A 3SSRA 3MPVA 4QIVA 1RTIB 3HHKA 5ITHA 5AJ3J 3AY0A 3R3TA 4UZBA 2HBQB 1WOPA 3HHLC 1HBUB 1KFSA 2X1FA 3N9UC 2J5AA 3MUMP 2ROGA 1JLFB 3SFGA 2MQPA 2ZBIA 4LBIA 4DR1F 2Y0SD 2FVPA 2HWTA 3PXGa 3CB4A 1KTVA 4DQSA 3TX8A 4DV0F 4HKQA 4QW8A 3MMCB 3CDWA 5LL6d 2OPSB 3T5HA 3G87A 2CIMA 4KSEB 3QBCA 5J2MA 2WOMA 2FUG9 3L9ZA 4A47A 2F5GA 3GU0A 2ZD1A 4B17A 4DR4J 1ZA1B 3SDEB 2AIRB 3BGOP 2QA2A 1S76D 3TJ8A 4ED7A 5KFFA 1RE1B 1SKSA 2IY5B 3OTDA 4X65J 2LXFA 3QIPA 2Z58B 4BS2A 1DARA 1TQLA 4RNNA 2BKOA 1U02A 2BJ8A 3C15B 4L3NA 1VYAA 3FBCA 3FMBA 1RWUA 2YKAA 1U1PA 3DLLQ 3I82A 5D0HA 1Y4ZB 3MTJA 1XMQJ 3AXKA 5ETNA 5CABA 1RISA 3K2YA 2F4FA 2DH7A 4RW7B 3LH2S 2V8HA 3JTPA 4ZP6A 1FKPB 1S5ZA 5IQ6A 4FNIA 3OL7A 1S79A 4PXDA 1FK9B 4UTGA 4ZIVA 1I6JA 3KLVA 4FXVA 2UV8A 4Q2MA 3A13A 2KT2A 2XTJP 5KFDA 5D0EA 1L3UA 1MU2B 3O5TB 3G2XA 4QPTA 4ZVPB 3D2WA 4NLRA 4MIAA 4ZVEA 4EFAC 1LV5A 1WHWA 2ZM6F 3T1AA 3M1VA 1LWCA 1N48A 2EBGA 5GMKa 2YX4A 4L76A 1FNXH 3QLHA 2HHHF 4TU9A 2QA4G 4F0KA 4CZCA 4F4ZA 3DMJB 1VCTA 2OO4A 4WK3A 4KYZA 2AX0A 3EYZA 2AWZA 1FXLA 3M8ZA 2F4VF 2H65B 3MM7A 4NRUA 1YLXA 3CDUA 3MHYA 3I87A 2HWIA 3HZGA 3J7YI 4AE5A 3OR2B 2VA2A 1G6BA 3CJ2A 1NJIT 1N33F 4ZPAA 5E3RA 3VAIA 4QQBA 1MW7A 2KDOA 2CQGA 1FERA 3UVJA 2FJVA 3QYYA 2RT3A 4USIA 1S0MA 4ED2A 2HHHJ 5DZ6A 5A76A 4HDHA 1M1KT 1HQEB 5GMDA 3DLKB 1H2UX 3OXGA 4WTYA 1U8WA 3SYZA 1IR0A 1UPMB 5KT6A 5CA5A 3HPOA 3VZHA 3OFFA 2CPHA 3T5JA 3DDIA 1YQHA 2FVQA 4NOHA 2WTFA 4J9KA 4PWWA 1SQEA 1SKRA 4B9LA 4JBCA 4JI3F 2RB7A 2O3DA 4WFYA 3IM8A 5ETPA 1X4FA 1X5SA 4M5DA 2DR8A 4DWIA 5IT4A 3TVKA 4N8NA 4C0HA 3WC0A 3ZZRA 5HJYA 5D78A 3MCSA 4PCQA 3BSOA 4NLWA 3OUYB 1NXIA 5HMZA 4IOBA 1C0UB 1Y5IB 3JB9k 3C16A 2ZH2A 4NL5A 5B0EA 3TW0A 2BQRA 2X1BA 4I2PA 1C2PA 2POKA 3POTA 4JV5J 4JI3J 5B08A 3AA9A 2HNYA 1PC4A 4PQUA 1FHTA 4K4XA 2AHOB 3HLUA 3GTYX 4P2SA 2HMIA 5K14B 1X9SA 3CJ3A 5EGYA 4ZVRB 4DLEA 1OQ3A 2Z2MA 3LAKA 2CQ4A 3UDVA 3D6MB 2MQOA 2HBYB 4R5PB 2VHGA 4ED8A 3RRGA 2ZH1A 3R97A 3MECA 3KJFB 2EK1A 3FJ2A 5CZXA 1TZ0A 4IH7A 4CTAB 2L3MA 1KDNA 2H4WB 1RTIA 4JP8A 4ANEA 1NUEA 5IV4A 2NXJA 1JNZB 4C98A 1R8PA 1HBUA 2E1CA 3SCKE 1B3TA 3LP2B 2DNRA 3MD1A 3D4JA 5DDRC 1JLFA 3BSAA 4C7QA 4K4SA 4W92B 1NJZA 3DLBA 2WCXA 2EFNA 4QWCA 1RAJA 2MHEA 4EBDA 2B3TB 4XDCA 1PILA 3I96A 4IR9A 5ETKA 3THPA 2CNNB 2DXFA 4YR0A 1GXLA 3JSRA 2IHR1 1H6KX 3MI7X 3CJ8A 4P2FA 1SJFA 3DI6B 4HHHA 2IBKA 3MMCA 2DR9A 2CG4A 4LF7F 3ILLA 5FLXY 4C0OC 1HA1A 5HP1B 2OPSA 4P2XA 3FRYA 2VQEF 3PHTA 1NK5A 2XCAA 2GQ2A 3QSIA 5J1EA 2J7KA 1Z4UA 3QWPA 1S57A 4YN3B 3T5KA 1P27B 2P6TA 2JHEA 3AQOA 4OZ5A 5D4PA 2N4DA 3A8IA 3IP0A 3I5BA 1HNWJ 4RLEA 1LEOA 3S1TA 3PYDA 3Q24A 2OMLA 1C4AA 5KG6A 4RUHA 1FA0A 3SDEA 2CZ9A 5JXSA 1U25A 4JV1A 1H72C 1KP6A 2KRRA 4U6PA 1GT8A 2DIUA 2SXLA 1P1TA 1I3OB 3GCWP 2ADBA 4RX6A 3RTVA 1X4GA 2ROEA 4WFZA 3V81B 2EKNA 4M5MA 3QRRA 1RTHB 2MZ1A 4QZVB 5KFIA 3C15A 4USJC 2PEHA 3MEEB 2EVZA 2UUCF 2Q3PA 1O5JA 2XS2A 3D9BA 2AZ1A 1G1XA 1K8AT 3QO9B 3W2WB 2I0XA 1NU4A 1DQ9A 2OJ3A 1OPZA 3HKWA 1IXKA 4RW7A 1WC4A 1YITS 1FKPA 1ZZFA 3W60A 4PG8A 3GG0A 3MM5B 4UOGA 2MY8A 5L1LA 1I1GA 2W9BB 2ZZNA 2GO9A 2AGOA 3MOJB 1HLWA 2KM8C 4A8KA 1UL3A 1JLQA 3PJXA 3KUEA 4PG4A 4DL5A 3GFXA 2DY9A 5DQGA 2ZBCA 4GO7X 5KT4A 1URRA 3BKFA 3M6XA
chains in the Genus database with same CATH topology
1UVJA 4ID5B 2RRBA 1HNIB 1H2VZ 3C6UB 5LMNF 3TQ1A 3EXYA 2ATLA 4Q8FA 5LXYA 1QUVA 4Y2MA 4EO8A 2MZTA 2OPRA 1UVKA 2VFUA 5F41A 2UXBF 1H38A 3J7Z5 2VKRA 4ES2A 2XWYA 4RWWA 4A8YA 1BC6A 1OSDA 3NL0A 2VPXB 4B08A 2YKOA 3JSBA 1H98A 1OS5A 4RBTA 2LDYA 3OPKA 5BYSA 1PSDA 3UR0A 5F8HA 1FD8A 2DH8A 2BW2A 1HBOA 2IMOA 4WIIA 1S1WB 2GGPB 4RKUC 1U1KA 2A1BA 5T41A 2XSJA 3PKMA 4TYAA 2YNGB 2XCPA 1LFPA 1FO1A 3T6BA 4YDDB 3P5TL 4OI4A 3GILA 1N5YB 4RBVA 3JYTA 3CUNA 1X4DA 5DG9A 2B4VA 3LP0B 3RBDA 5D8HB 4F8RA 2WB4A 2EPIA 4IO9Q 2IFXA 1YJWS 1KLMB 1SV5A 1VQKS 1RJJA 4CI0B 3DM2B 2JVRA 1XMOF 2PFFB 3GIIA 3O44A 2HRYA 3BSCA 3VZIA 3HZEA 2NLWA 3IXQA 4ZHRA 1X4AA 3HF5A 3WC2A 4J9PA 2JFKA 5KFNA 2HLTA 3NBPA 1TK0A 2YVSA 4CO3A 1VFJA 2L41A 1JIHA 5IT9Y 3M05A 1JLQB 4CH7A 2O67A 3OSNA 4JI0F 2MJNA 1IBMF 2QMXA 2DTJA 4Q0BA 2K2PA 2YKNB 3I4PA 3NCPA 5F0UA 4DSEA 2ZKUA 3OR2A 1VS3A 5I4MA 1QVGR 3ZZZA 1VQSA 5A8RB 2GNKA 1U45A 2BZ2A 3R5BA 3BGRB 1VC6A 3DRYA 4KO0A 2J76E 3OVSA 5IQQA 3D1OA 1SI9A 2XMKA 4OI0A 4WYWA 1UVLA 3FSIA 2DO4A 4ED0A 1T8EA 2UXCF 2LEPA 4TLQA 3W7BA 4WU2A 4OI3A 4I69A 1IKVA 3DN9A 1IJEB 1FKOB 3N5FA 4F50A 3HJFA 2CQ1A 3GSDA 4QW9A 1GX6A 1YJUA 3KK3B 3B4MA 4ED6A 3G86A 2V4RA 1V3ZA 2LVWA 3CEDA 1MMNA 2HWHA 2WRMA 5BYQA 5IWAF 2MKHA 2Z4PA 3PW0A 1JXLA 4CH1A 2AX1A 2DBBA 3FGVA 2DT9A 2HHWA 2EBEA 3TOQA 1OQ6A 3NNCA 1HQEA 1Y3KA 2FC8A 4FS1A 1G7CB 4F67A 5HN0A 2RDIA 1TL3B 5DG7A 2OIHA 2GIQA 3HKZD 2DRBA 2FJXA 1BY9A 5E41A 2AJ0A 2A10A 4GKKF 3BJYA 1QE1B 1VQMS 3QJJA 4H4KC 4ZP9A 4C8LA 1K0TA 4K0KF 4I6AA 4ZPCA 4ZPDA 2W7OA 4YEAA 1HD0A 2IYIA 3I0RB 2U1AA 3MMBA 4UUWA 3I55S 2CPFA 3QGIA 3LWLA 2VBWA 3O2IA 4PR6A 3C6TA 3FMWA 1QM9A 2E29A 4TU7A 2CJ9A 5KG1A 4DFJA 1TUVA 4HI2A 2OAUA 3HHLA 2HNDB 4NXMF 5K8OA 1N36F 2J7WA 4DEZA 2GW8A 2P9CA 3G6ES 4WK1A 4M94A 3R5CA 1R27B 2VZ9A 2MKIA 1ZM2A 3KLEB 5CXTA 2VODA 2Q6BA 2LEAA 2XLKA 1U1RA 3M9OB 4M8LA 4NZ7A 1FTRA 5A6WA 2VONA 3OFGA 1S1VB 3TA2A 4JYAF 2WSFC 1JLGB 2DNOA 2DGXA 3CIMA 3BEGB 4UY8T 1ZH5A 1LXJA 3SV3A 1CC8A 3ZZPA 1R31A 3BM7A 5BYRA 1TKZA 5FDLA 1ZETA 3CCZA 3DGPA 2CFXA 2V8GA 4DFMA 5J1PA 4C8YA 5E33A 5EX0A 1HPZA 1FRHA 2GX8A 1CC7A 2ZH4A 1D0EA 1U1OA 4DLGA 4CQ1A 3H8YA 4DJBA 4NZ6A 2NPFA 1HNVB 2DHGA 5GAGU 2CQCA 2ILYA 3IBWA 1JLEA 1M5VC 4A8FA 1DQ8A 2YX1A 3M8PA 2V9KA 2BM1A 4IR1A 5IZHA 3DHWC 4FZVA 3OUYA 3K5MA 3M6UA 4QR0A 2LXUA 1C0UA 3CJ5A 3OXFA 1FJCA 1XR7A 1UMJA 1FESA 3TAPA 2WONA 4I64A 4HTIA 1U48A 2RDJA 2AW0A 2N7YA 3MMBB 4X62F 2JEIA 1D3WA 1K9MT 3HHLD 3FRZA 3FVYA 2KFYA 4DL4A 2VG7A 2E1AA 4NLXA 3UPFA 2QSFA 2VUGA 2XHWA 4JI8F 2PE8A 2V4QA 1RT3B 3CSKA 2P9EA 2V4JB 3G96A 3KLIB 2DHSA 1SC6A 3MEGB 2DGWA 2IVFB 1UKUA 2HGMA 1F9FA 2J6SA 2IRXA 5FJ4A 4O3RA 1FE0A 2Q1LA 1QLNA 2ZH5A 1D8YA 2NS1B 1M5PC 3O6QA 1FRJA 1WTFA 3I5CA 5LSRA 3MM8B 4ITSA 2DIVA 4C8KA 3G9CA 4R8UB 4LUBA 1YGYA 3UI3A 4TU8A 2KO1A 4IOCQ 1SJ1A 2PN6A 3KK2B 5K14A 4NLSA 3V5RA 1R0AB 4F3OA 2VC1A 5L1KA 2ZE2A 3IG1B 2E44A 4O4RA 3LP1A 1NK8A 4BDPA 4HYKA 3TA1A 2RUGA 2N3LA 5A8KA 1TKZB 4F4WA 4PWDA 4KHPF 4EZ9A 4ID8A 2KXFA 4KFBB 2MQQA 2MJUA 1HPZB 2F8MA 3K5NA 2FJDB 1WHXA 1L3SA 1FVQA 2DNLA 3DOKA 4DQIA 3KNAA 4YB1P 1QSYA 3R1HA 2NR0A 5CCLA 4OZNA 5CYMB 3RAXA 3N0VA 2KXHA 5CCMA 3NMAA 2AJQA 1JX4A 1RI7A 5KFLA 3BF4A 3LW5C 1NJWA 4NRTA 4ZVHA 1YJNS 2IM3A 3EZ5A 1KC8T 4KRWA 2NREA 4B9TA 4LQ3A 2EFQA 3BQ0A 1HW8A 3VCDA 2ZH6A 3OL9A 5HMYA 3CC7S 2XY5A 3D0HE 1PGZA 2VPYB 1CQMA 1DZ5A 3L7PA 2M9KA 3FEYB 2JWNA 4O44B 1J5EF 4IRKA 4U7CA 5DETA 1K73T 3IRXA 2JEFA 2VB6A 2J6TA 4CTAA 4FF2A 1NK7A 3HFKA 1KNZA 4KC5A 3O1LA 3GIMA 5HMWA 2BV3A 2CQ0A 1M5SA 5C24B 3PW5A 3TRGA 4BC7A 1HBNB 3DLJA 4MMOA 5L9XA 3K59A 1WHYA 3DRPB 1X9MA 3SSSA 2PO4A 2ZH3A 2B4UA 3I5AA 2JLGA 3CDEA 4EBEA 4ZK7M 2VG6A 2APOA 4QIGA 3W2VA 2LQ5A 3KK1B 1XR6A 1VBYA 2HS3A 4HL9A 3LP2A 1RTJA 3K57A 5LMUF 2E5IA 5K8PA 1U09A 2MB0B 3KYLA 3U27A 1YG0A 1HBMA 3P49B 1BQMA 5SUHA 2XNQA 1S1TA 1S6OA 1YIJS 3LP1B 1XEZA 1S48A 5LJ5Y 2R7OA 2M3DA 3DU5A 3GZ7A 4DUYF 2AGPA 5A8KB 1L3VA 2A2DA 5F8NA 1T3OA 4I2QA 2YX7A 2KM8B 4B3MF 5F8IA 4NLDA 4FS2A 4B3TF 4CO4A 4BC9A 2M4MA 1MSWD 1U6FA 3UDLA 1N6QA 4YB7A 2MYFA 1FRXA 2KN4A 5KFTA 1OIAA 2HNZB 3M30A 3R1LA 4WKRA 2WBMA 2DHXA 3PKYA 3EPGA 2W25A 3TAMB 4M63A 1X5PA 1X0FA 2LYVA 3KG0A 4OHWA 1H7XA 4ECRA 4YY3F 1YTYA 1HNXF 2IVMA 3VAFA 1WF1A 2PT0A 3GR0A 3MXHP 2BE2A 4ZPWR 2JZ5A 2ILZA 2R7SA 1RKIA 2B56A 4UW2A 4NWBA 1FJGF 1AFIA 4NZ0A 2VC0A 2C3OA 2L08A 2JRSA 2MSTA 4TY8B 1ZTTA 4EYIB 4L72B 1K1SA 4X4PA 2A2CA 1QAXA 1OWXA 1SL2A 1NJYA 3AJ1A 2ZFHA 1VC5A 1M0SA 5I42A 3IFEA 4DQQA 2L9NA 4U9RA 4NLTA 3E01B 2JH3A 3VQTA 4IFVA 4MAKA 2VBZA 4DUZF 4KPYA 5K8NA 1UVMA 1RKJA 2M8DB 3G8SA 1KONA 3D0GE 2LQ9A 3GG1A 2ZOMA 3IWXA 4X84A 1B7FA 1N4LA 4B3RF 2D41A 1K1QA 3M2UA 2HHXA 3QAEA 2DB1A 3DRSB 1JXEA 4KB7A 3IAS9 3VF0B 1VRTA 5I3UA 2XMJA 3H2UB 1P9QC 5KT3A 1RTJB 2VFVA 1C0TA 4NLQA 3ENWA 2R8KA 5DDQC 4ELUA 4C9DA 1MMLA 2JLFA 2MKSA 3L09A 5SZTA 4K4TA 3A1YG 4ICLA 1RK8A 3FNNA 3M32A 4J9MA 1U24A 1XK8A 2H5EA 2ZNYA 5AJ3F 3I9V9 2AU0A 3Q8SB 3HI9A 3VAHA 3CCMS 1XWLA 3MR2A 2OFGX 1FDDA 1DTTA 1FXRA 1P8GA 3KG1A 1SH3A 3OR1B 1OO0B 3DOLB 3MEKA 2ASLA 2Q6CA 4QPXA 3UFCX 1ULRA 2CJQA 2VPZB 1D1UA 1R8CA 3H59A 2KYZA 4ECZA 1RT2A 4H4OA 3V81A 2WSCC 2B9XA 2HZCA 4HVZA 2W4DA 2R4FA 2ACYA 1X4EA 3Q2SC 4KAIA 2DR7A 2F40A 4NX9A 1SUQA 3T1YF 2BE2B 3G6VA 3ENVA 2FLLA 3LWMA 4DV7F 4K5SA 5DO2A 2RQ4A 2DHAA 2ZC3A 3AA8A 5AE3A 3MEEA 1KHVA 2AJ4A 2ALZA 3N6MA 4G1PA 3MFIA 2YTCA 5KT5A 1Q7LB 1W25A 3BN7A 1LWEB 3UCZP 2OD4A 4I6WA 5U47A 1P6TA 3MUVP 1IJFB 2M7SA 1HI1A 2WB1D 4DS4A 4Z2XA 2Y1RI 3QO9A 2YKQA 2J0WA 5I42B 4J9OA 3DLHA 1JWWA 3W2WA 3A8EA 3QZ8A 2ASJA 3VTIA 4RNFA 4ZCMA 1AUDA 2LU1A 2FGOA 5J1NA 1GNKA 3SZ2A 3PV8A 3KLFB 4Y6IA 2BBEA 5AE2A 3GV7B 2QEXS 4KQZA 4BCAA 3LGMA 1FTCA 1VQLS 3RW6A 1TKTB 1U1MA 1FJ7A 5EX3A 3NMRA 3BS9A 3M6VA 1NK0A 4RUAA 1NK4A 2JLEA 5KFRA 4CIOA 3NS6A 3BO2A 4WXWA 2BDPA 1TFWA 4OLOA 3PVXA 1VQ7S 1VLYA 1L3TA 2QT7A 1E6VB 1C0TB 4PUOA 2I5JB 5C42B 4ZPTR 5A0YA 4FBTA 5D4LA 4A8OA 3PIPQ 1FNMA 4YB6A 5CHCB 3TUIC 2BOPA 3IR5B 4ICLB 2MGZB 2XWXA 2CQDA 2IC3A 2PD1A 3JSMB 5M2RA 3VAJA 4OJ3A 2UV8G 4LVOP 2V0NA 3EGNA 1R89A 2YY3A 4PXEA 7FDRA 2AP6A 1HL6A 1WACA 2W9BA 3PZPA 3CJ4A 1CEZA 4O23A 2KFZA 3B4DA 4KKOA 2J6UA 1SH0A 2VFRA 2X1AA 3GIKA 3M9NB 2VBXA 4DR4F 2D3ZA 2LXIA 2BACA 3PEJA 4ECUA 3PX4A 3Q0AA 4IQXA 4WZQA 1UJ6A 2RSQA 1RT2B 2RU9A 4GMKA 3B78A 1YJVA 4H4OB 1I94F 5IXUA 2AJ1A 3M4XA 4ECVA 1UWBA 1QAIA 4JV2A 3MPYA 3J81Y 4PWUA 1NH8A 1D9AA 4C11A 4DV4F 3HHNB 1SUQB 4RW6A 4JI6F 2KVIA 2XMVA 4C3KA 1S1UA 3OTEA 1JLBA 1UEUA 1XTZA 2WHOA 1NZAA 2R8IA 2O66A 3GWCA 3TVZA 5HLFA 1Q78A 1Y5LB 3WZ0A 4H4MB 4UUXA 1ELOA 2N4CA 1LWFA 5L1IA 4D3GA 4MH8A 3CCQS 4FF4A 2EW9A 5F0WA 1JLCB 1HNIA 4WXOA 3BGLA 2XMTA 3C6UA 4FVMA 4OX6A 4X65F 5KFQA 2R8HA 1U7LA 4A8QA 3CULA 2N7CA 1S6QB 2GMLA 5ADZA 2DNNA 4RNHA 3TR5A 2DNPA 4CH0S 3SCIE 3IS9B 5KT2A 2B5JB 4X4UA 4ZKAA 4AL5A 4EBCA 3AB2B 4F4XA 3CGIA 2VBYA 3K8WA 4DV3F 3C3LA 2FD2A 1F60B 4Q8EA 3WX4A 3BR9A 2CQIA 3DFEA 4NA1A 2NSBA 5A2QY 1HHTP 1S1WA 1CSJA 2JVOA 2UVVA 4IDKB 2YNGA 5HROA 3NKYA 3TI0A 3OLBA 2NQPA 2GO8A 5A0YB 1N5YA 1U6BA 2GCFA 2HGNA 2HPUA 2VG5B 2AYEA 1M5KC 3LP0A 4MTPA 2IC3B 3V6KA 4ED5A 1XMQF 3VALA 3DM2A 3RAQA 1V9OA 2HHSA 2W4CA 2FDNA 4EYHB 3SSQA 5M2PA 3G6YA 5E7OB 2W24A 3MPWA 2IMWP 3AQPA 1IBLF 4ECXA 4USHA 2MHNA 2ZJQQ 3U1MA 5K5MA 2KHDA 4OIXA 1UAWA 1HWIA 4OJ1A 5DM7Q 3NCQA 2YKNA 1UWBB 1KR4A 2F9JA 4CCHA 4K59A 1ZYQA 2HQ3A 4C11B 3NNAA 4Q43A 2ROPA 5A8RA 2RQCA 2ASYA 3BGRA 2CPJA 2XC9A 2J8AA 1Q16B 4PKDB 3FFIB 1TKXB 2LA6A 2YWEA 2C3MA 4ECYA 3EUNA 3GFZA 1LWFB 3KKFA 4ZVFA 6FDRA 2QFJA 4Y2CA 1MNEA 4C97A 5MLCV 3PO5A 5A8WA 3H2VE 4MFBA 3K58A 4N76A 3J7YU 3CCSS 2MZJA 3ZZUA 5F3ZA 4ERDA 2BRKA 2CRLA 1T05B 3J7ZT 5EDWA 4YB5A 1KSPA 3QAUA 4P7TA 2DGSA 1FKOA 2C22A 3PY8A 2WAQD 1KS2A 4ZCKA 3RU0A 3RB0A 1JMTA 3V6JA 3KK3A 3M8RA 4IOAQ 2RILA 1S77D 1FT8A 2ZOGA 3FZBA 2R2SA 2FIUA 4ZLPA 2HHQA 3CIZA 1N5QA 2E9RX 2K3KA 1W2IA 3UD3P 1VQ6S 4TNOA 3CCJS 3GYNA 2BQ3A 3S6EA 3HHEA 3G8TA 2E9ZA 4QWBA 2FVCA 4D3HA 2VFSA 3CCVS 4X66F 2M0GB 4WE1B 5HROB 4TKTA 2LA4A 1FRKA 3FCHA 1S4FA 1TL3A 2VFTA 3IAM9 5CYJA 5J2MB 2VD3A 3CCTA 1A9NB 3RBEA 2FHMA 3PRBA 1QE1A 3UNGC 2JOQA 2F8HA 2WOMB 1JK9B 3Q8QB 2IM0A 3BZQA 5KG2A 3KHHA 4RW9B 4HLBA 1XMBA 3CXCR 2G9OA 2ZD1B 3I32A 2J9DA 2VASA 3ITHA 3I0RA 5T7LB 4DDFA 1TK8A 3RRKA 2FTRA 1TV6B 1VK8A 4A8WA 3NNHA 5IT0A 3KMQA 5E3QA 1HW9A 3UCUP 2PI5A 2OPQA 5KOXA 2OMOA 4LSNA 3JSYA 3CCUS 3U7JA 5F3TA 2HNDA 2VOOA 5KFKA 1LW2A 4N41A 2KI2A 2MQLA 3P96A 4URSA 1KRPA 4K4ZA 2RJZA 2B51A 5GAHI 2J9EA 4OJHA 1KVIA 1YI2S 4DV2F 2V9WA 1HWUA 5CD4H 3KLEA 1ZPWX 4I6YA 4PXCA 2D3UA 2HQIA 3MMAA 5AXLA 4J9SA 4ILMA 1R8AA 2IM2A 3BGFA 1M5HA 4W90B 2DCLA 5A8WB 1S1VA 4MFBB 3CVKA 3QGPA 3IC1A 3QIPB 4IYQA 3BO3A 1JLGA 4ECSA 5HL7Q 3SV4A <