5AXLA

Crystal structure of thg1 like protein (tlp) with gtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
221
Chain Sequence
TREIYAEMRCIPPVVLRADGRNFKNTLSGLGFEKPYDKTFARAMADTAELFIKKSGLSPLFAYTFSDEISFLFTDLPFDGRVEKIDSVVASFLGSALTIKLRLEEPIAFDSRLVALQKEEIPEYFHRRQLEAWRNFVASWGYYALRNEGMGRNEAAKYLKRKKESEIHEMLFERGINLATLPSWQRRGVIISKEARKITQNWEIPKFKSEKGIPFLEKLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA(His)-5'-guanylyltransferase (Thg1) like protein
publication title Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Transferase
total genus 64
structure length 221
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5axlA00
3OTCA 3WBZA 3WC2A 5AXKA 3OTDA 3OTBA 5AXNA 5AXLA 5AXMA 4KGKA 3WC0A 3OTEA 4KGMA
chains in the Genus database with same CATH superfamily
1CJTA 3C19A 1UKUA 4JI4F 2W7PA 4DLGA 1YBUA 4HDGA 2ZUGA 1T9YA 3R6GB 1S76D 2CNNB 4E98A 3IG1A 3M6UA 1RAFB 4Q43A 4RBTA 1FXLA 1S9GB 4OX6A 4KSEB 2A3JA 2LXUA 3ZZRA 2RRAA 3SZ2A 3ITHA 4DV0J 4DV1F 4HH0A 3D1QA 4URSA 4YEAA 1RHMB 3CJKA 3RW6A 2CQIA 2XYHB 1VS3A 3BH6B 2VPZB 3FMWA 4BBYA 4DR1J 1VBXA 1NK7A 1U02A 2ALYB 1Y9OA 1OPZA 1S0MA 5FD1A 3UD4P 2RAQA 2N4DA 5EWFA 3I0SB 3VHQA 4K4VA 3TRGA 4ICLB 3RB6A 1RHQB 2AWZA 4Y2IA 4EWTA 3D3CJ 5SZTA 4RL1A 5J2NA 1K0VA 2MDAA 4K4ZA 1D8ZA 4QYRA 4JI2F 1HD0A 2IMOA 1QTNB 4PZVA 1MSWD 2VC1A 5DQHA 2MYFA 1U0HB 3NMRA 2M2BA 3M2RB 2MZ1A 2VG6A 2HSEB 3AA8A 4YB1P 2E1CA 1GH8A 1PG5B 3NAIA 4IRKA 4WF9Q 2Q43A 3NL0A 3CO9A 4QPTA 3ENQA 1S1XA 1N33J 3CC2S 1ZYQA 1I94J 2BOPA 2FB0A 4DR3J 3KK1B 4B08A 3QO9B 2KFNA 1WSVA 1RZMA 4X65J 3SCKE 4PYDA 4X66J 1NH8A 1W26A 3W63A 3CD7A 1N36F 4FPRA 2HHTA 4C7QA 2WB4A 4GO5X 4Z7YA 1X5PA 2Q79A 2EKYA 4DFJA 4WZQA 1BXNA 2OSQA 4DFKA 2W9AA 4KGZB 4F4XA 4C6AA 4F4KA 4MIAA 5G4DA 5T7LA 1NK6A 1BMQB 4FNHA 1F5AA 2CQGA 2XMKA 5B0FA 1NUEA 2ZBRA 1RT4B 3N6NA 2AIRB 4J9NA 2Z57B 2WBMA 5LMNJ 3IGVA 3EZ5A 2XSFA 2WVBA 5DQIA 2VG7A 4EZ9A 2QE5A 5HVGA 4FXDA 2YWWA 5BR8J 3J81j 3KOAA 5KTQA 1JLQA 2CQPA 5IT9Y 3H40A 3LP0B 3MM6A 4DXLA 3PZPA 3GSDA 3A8EA 4X84A 1EHWA 1GNKA 4DX5A 4CH1A 1H3DA 3GJRB 2DBBA 1D9FA 2WHOA 2XCPA 2CJAA 5D0GA 2OUGA 3PX4A 3R27A 3MAAB 1SKSA 3T3FA 4DUYF 3RGIA 3CNQP 4IH6A 1M1HA 3QT6A 4OI6A 4TKTA 3W64A 1RT2A 2CG8A 2WVCA 4JI0F 2V2QA 5HP1B 3HKZD 4CH7A 3J7Z5 1DZ5A 4NWBA 1YJWS 4AL7A 3HFZB 2RF2B 2OO4A 2CPDA 5D8HB 4DV4J 4ED5A 3HVTA 3R2CJ 3N0VA 4ZDNA 3KLGA 1J27A 1U1PA 3IN5A 3G8SA 8RUCA 1MROB 3G6XA 4Z2XA 2MLYA 4OX8A 2E5IA 1U6ZA 1IVZA 5DG7A 3UI3A 5E33A 3CVKA 3GP9A 2MGZB 3UDLA 4NCGB 4ECUA 1VQLS 1ZTTA 4A46A 2OPSA 2CQ4A 2R8JA 4ECXA 4ANDA 1SL2A 1RADB 3PHTA 5F8GA 3G8TA 3OUYA 3R1HA 3TOQA 4ENOA 4JI6J 2VU5A 2B56A 1VFJA 3NNHA 4IOBA 1ZM2A 4FZVA 1S1TB 3KUGA 3BQ0A 1S4EA 4ANEA 1LQ9A 5GAGI 1S7IA 5DDRC 1OY6A 4JOUA 4DQQA 5RUBA 2BE9B 4DV6J 4CT9A 1BWVA 2ZBPA 4F4ZA 2HRTA 3M1VA 1K1SA 3TVKA 4LF1A 1EETA 4K59A 4ED7A 1S6QB 3R7NB 2CYYA 2P9GA 4NLRA 2FDNA 1H2TZ 2DGTA 3A8IA 2A2DA 3CXCR 1VRTB 3LUYA 1X4GA 4NEZA 2HRUA 3BGRA 1CULA 4ZMMA 3RAMA 3T1HF 4JI1F 3K57A 4LREA 2DHHA 3BBFA 3DRSA 1B70B 1VLYA 2CPHA 2NYIA 1FDBA 4D3HA 1LWEB 5A76A 1WEXA 4ZCIA 1TAUA 4DPYA 1YG0A 2ROGA 4G6VB 4FNIA 1RT6B 2C3MA 3TZYA 2JFKA 1X0PA 3UQSA 3C14B 5IQ6A 2DCUB 3SV3A 3H5SA 2KH9A 3P49B 4FPIA 2HVIA 1KVIA 2UVUA 2F3JA 4LF5F 1PBAA 1S48A 2CQDA 4B9NA 2ZJPQ 1Y3KA 2HFVA 3B4MA 3CW2C 3IRXB 3KMQA 4KKOA 3MEGA 1RWUA 4M5LA 2KO1A 1F60B 1D9DA 2POKA 3EMTA 1SH0A 2CVEA 3CEDA 1N5YA 2WVFA 4JI7J 2OFHX 4NRTA 1Y5NB 4LSNB 1XN9A 1W7WA 1CLFA 3W2VB 3AH6A 2VOPA 4XAKA 3THTA 5LXRA 3HK2A 5ETKA 4MFBA 2BJ1A 2BKNA 1PC5A 1BQMA 2JH3A 4V1Ak 1EZZB 1WNEA 1CBKA 2WOMB 1PIEA 1DLOB 4YY3F 3EVMA 2ZWOA 4QWCA 5U47A 3Q8VA 2HG4A 1TL3B 3VVTA 2UP1A 4ED4A 3DRPA 3BEGB 5KFSA 2C1EB 3P8BB 5HAOA 4DQSA 1M1KT 1NSPA 2HNDB 3DDIA 2BUNA 5EDWA 4CM0A 4K0KJ 2KFYA 1NCLA 3IA0A 2CADA 3OR1B 1XNQJ 1NPRA 1FKOB 3IC1A 4YMEA 4AQYJ 4USMA 3ULHA 2HZAA 4FKYA 3IRWP 3DI6A 4XIUA 4LVNP 1VIXA 2R7VA 4J9VA 3H0PA 4Y2CA 3EXYA 4OQJA 4LSLB 2CQ0A 1JJHA 2KVIA 7AT1B 4KC5A 4LF7J 4FYDA 1OYDA 4NMLA 2R8IA 3GE9A 2RDIA 3SFGA 2YPZA 4OMFG 4QR1A 3EPGA 2OPQB 4AT1B 4ICLA 1FRJA 5KOWA 5JMNA 3THPA 2HNYA 2AJ2A 4W4MA 2V8VA 2BE7D 3L9ZA 4AL5A 1S6PB 1X9WA 2QC3A 5DZ6A 3JQJA 1RKIA 5CYQB 1GXTA 5EWGA 2SXLA 4G1QA 1U0HA 2EG1A 2APOA 2DXEA 2HHUA 2ROEA 1RAAB 4RW6B 1LWFA 2HBZB 4IRDA 4LIRA 2R7TA 3ZZYA 1A7GE 2AX1A 3DM2B 3HCXA 1O5JA 2YWHA 3KK1A 5HROB 3G86A 2ZE2B 5DM7Q 3OVAA 3CJTA 4FVMA 4P2SA 2YH0A 4Y65A 1FF2A 2KDOA 3RW7A 1IKWA 4GKKJ 3QGPA 1IBLJ 4RZRA 1NPKA 3HZGA 1T9VA 4NXMJ 1RU1A 3HHLB 5CYMB 5AXKA 5AE3A 2IJFA 1F5CA 3FEZA 3RB4A 1HBOA 2M70A 2ILYA 2W7OA 5HMXA 2LFVA 1U1MA 3G82A 3MMAB 4K4XA 4GVBA 4A8YA 2XC9A 5B0CA 4LJMA 3BH7B 3FFIB 2W9CA 5D4PA 2CNKB 2J8AA 4CLYA 4OIXA 3P5TL 3DMJB 2X3GA 2CDRB 2IM3A 1CG2A 2AT1B 1IKXB 3AAWB 1TL1B 3MM7B 1NO8A 3QATA 2ZM6F 4CTAB 2DPIA 3EGZA 2D9PA 4ZVSB 1LEOA 2QA1A 3HD1A 2LEPA 5GAHI 1UW9A 4M5JA 3HM9A 5KT7A 4OX9F 4CLWA 4WTOB 4N8NA 2E7WA 1ZPWX 3NCQA 2DNMA 1HQ2A 3UDCA 2O1PA 5D0EA 1ZA1B 2VH7A 3HHLC 2VBYA 4R0EA 1FJCA 3NWGA 2ZJRQ 4I68A 3C15B 3CD5A 1X5TA 1VI7A 3O1LA 5JXSA 1Q16B 2F7VA 3GTYX 2W9BA 5KT3A 2HRYA 3SQGB 2R4FA 5E3RA 2YXLA 3LW5C 3JTOA 3TWZA 1PC4A 4DF8A 3EGWB 2NQPA 3DOKA 2FZGB 4ECSA 5ITHA 1BQNB 2GVDA 4L3KA 3CDUA 5DGAA 2D3ZA 1NZ8A 3CJ2A 2DXFA 4HDHA 2YNIB 5K8MA 3SI8A 3RB3A 2F4FA 3J7A1 3CDAA 4B3SF 5KFNA 3NMAA 2FJAB 3E3XA 1VQ5S 2RHQB 1T9WA 1SIZA 3P45B 2R7SA 3IR5B 1ZZFA 2BKPA 1H0HB 5CZVA 1J2VA 3MEEB 3MCSA 4A8SA 3W7BA 1IBCB 2JOQA 1IR0A 4OJHA 3CJ4A 1N0UA 5H1SV 2FC9A 2VQEF 2PSZA 3QJLA 2M3DA 3DLLQ 2CPFA 2EBEA 4JV0A 2X1AA 3F73A 2D1CA 1Q1KA 1YJTA 4GC7A 4CLZA 1H74A 4LUBA 3DLKB 5A8RA 5ETNA 5G0RB 2Z2YB 2RQMA 4OLOA 1GAOA 1RXOB 3FQLA 2XNQA 3LOUA 3OFFA 3U1NA 4ZLPA 2Z30B 4DS4A 1PILA 4OHWA 1V3RA 3MMCB 4LVOP 4LRBA 4WFBQ 1WI8A 3WBZA 2C28A 3HMJG 2UUWA 1HPZA 4LF4J 3D6TB 3I55S 3QFWA 1N32F 2MQLA 2KHCA 5HK4A 4F04B 1LK5A 2PA8D 3LWLA 2XZTB 1RT6A 2MKSA 1YRTA 1S7HA 2C2KB 2IVMA 4BC7A 3SSRA 3LGNA 4C48A 2DGXA 4N5SA 1HWIA 2XYPB 2E1RA 2AGPA 4FYXB 1HW8A 2W24A 4CWBA 2ZKTA 2J6TA 3HI9A 1YJ9S 3D0HE 3KFWX 1IWGA 1X31C 1T3OA 2QT7A 5DQGA 4DPUA 1QAYA 3PFOA 4PWDA 4C11A 4DSLA 2J7WA 3QAUA 1LFWA 5LL6d 1BHNA 1F3VA 1REVB 3GJQB 1AFJA 4ETZA 2PIIA 1R43A 4NZ0A 3JSRA 1ZA2B 5IQQA 4HH1A 4X4VA 1JNZB 2P8IA 2AHOB 4LSZB 4RJVA 4LF6F 2P6TA 4BS2A 2HFSA 3FRZA 1KR4A 4DOZA 4OYMA 1HNZF 4B3RF 3CJQA 2XLKA 4ITSA 3B8HA 2J0WA 4IQMA 1EKSA 4P7TA 2C2RA 3CWJA 4HTIA 3CO0P 3AD9C 1I5OB 1NJWA 3TZZA 2DNQA 4WIIA 4KAIA 1SUQA 3M30B 2HNZA 4F67A 4AFFA 3UNYA 1S9FA 5F0WA 2MLZA 1NK0A 1UVIA 2BRKA 2AEFA 3RG6A 5JUMA 3OR1A 1U1RA 1ELOA 4RW4B 3ILIA 2VF3A 1RAGB 2QJ3A 2R2RA 4DN0A 3V4IB 2RIJA 3FSXA 3NLCA 1TU0B 4DV0F 1YJ7A 2MQPA 2AKWB 4IFVA 4ZIWA 2W2QP 2F9JA 4ZVUB 2RQCA 2HHHJ 3IBWA 4DR1F 3O8WA 2OLWA 3KLFA 2K1RB 3W8GA 2OMLA 4NLOA 2E1PA 4C3KA 1KFSA 3R5CA 4NXNJ 2VFRA 3D9BA 2ZFHA 1U45A 4F3QA 7FD1A 3R7SB 3S8SA 3VF0B 2YVSA 2Z4PA 3CJ3A 1T03A 3KK2A 4KHRA 1FRMA 3RB0A 5L8RC 1S49A 4V19J 1S6PA 4C2MA 3H7HB 3MR6A 2VKRA 2LXIA 1KWMA 3DLEB 3JSMA 3MTJA 4X4NA 2AW0A 1JLBB 3KMSA 1UAWA 2HVZA 3RJMB 2GIRA 3RRKA 2XQCA 4RUCA 1UW4A 1JLFB 3D54A 2EWHA 3QWPA 5BYRA 3M8QA 4P9SA 2ZH3A 1N33F 5HBMA 1WC1A 3I0RB 1AYEA 3DM2A 4IDKB 2QZ8A 5IM0A 5HROA 1L3UA 2ZE2A 4RX6A 1HFEL 4X65F 1SH2A 4QYZJ 4IH7A 4X66F 1IXKA 4ZHRB 2VV5A 3DLJA 2V8DA 1LKZA 2JRSA 2H51B 1R8CA 4Q0BA 1F0XA 4TQRA 3I87A 1QY7A 3AFGA 5KT2A 1U2RA 1ZETA 2F4VJ 3BV8A 5K8OA 2E5JA 1Y5IB 2DGWA 3VGSA 1HQUA 4JI3J 1S0OA 3FJ2A 2YKAA 4F26A 1VOMA 1WC6A 3TAPA 4ZITA 4CO2A 3BM7A 3FSYA 1M90T 3Q8YA 5LMNF 1SQFA 4F4AA 3M9OB 3PW2A 3HVWA 2RDDA 3DMJA 3IWXA 2JVRA 3DOMA 3PACA 2HQFA 2M0GB 4P72A 5BR8F 2DNOA 2MSTA 1VCTA 2GW8A 2BABA 1TL1A 5KFPA 5ETPA 4TU9A 5I3UB 4XK8C 4EYHB 4CLLA 3K8VA 4QU6A 2DEIA 3CGIA 4UUWA 2Y1LB 2YX7A 3DC2A 3UR0A 4MIBA 1RGVA 2ZITA 3QMQA 1XK8A 2M9KA 1RWVB 2XULA 2DPJA 4DF4A 3NGSA 4DSIA 3LP2B 4OLPA 2IIHA 4DPOA 3O2IA 2Z0GA 2ZWPA 3ZNJ1 3PCOB 3R5DA 3ZZOA 1TZ0A 5L38A 2LQ5A 1S1VB 3D6MB 1KQKA 4OV1A 4WP9A 4X62J 2Y8WA 3MR7A 1NK8A 1AFIA 2XMJA 1JQGA 2VFSA 4I2QB 4WIQA 2DRBA 2EI5A 2LKZA 3ILLA 5T14A 1U0SA 2J0XA 4NLQA 4JB8B 2IPOB 2XMVA 3LAMA 4B9MA 1WG1A 2Y1RI 2QLJB 2BJ9A 5KG0A 3ZZ0A 4OJGA 1SIWB 3RZAA 4ER8A 3EGVA 3IXQA 3KLHA 3UW1A 1RJJA 3TUIC 4ZP7A 2C22A 1H2VZ 1DY3A 1VQ9S 2VJUA 1SI9A 3K58A 3JB9k 3R5JB 3ISZA 4DV6F 3N79A 4KGKA 1WG5A 4I1TA 3PM9A 3DRRB 1R8PA 3HSZA 2CDQA 4OV6A 4HI1A 3OVBA 5AE2A 1RT1B 1ACMB 1HNIB 3DLKA 2HMIA 4NRUA 2K8GA 3W65A 1HIYA 4ZVRB 2DGOA 5B0AA 4OZ3A 2JLFA 3CPWR 2FZKB 2GC8A 4G1IA 1VRUA 4KPCA 5CZXA 4AL6A 3Q23A 3Q89A 3H2UB 2LECA 1MMLA 1XNRF 3RTVA 2OH2A 3RR7A 4NYOA 5KAKA 5AE1A 1EP4A 4TU8A 4ZPAA 2F65A 5LSRA 3NWRA 4B9SA 1U6FA 1UPMB 1JLAA 1SVDA 2VFVA 4GVLA 3UO0A 2RKIB 1GMWD 3CCTA 3PHEA 4YB6A 1IWAA 1VISA 3GIKA 4DL0C 4RNNA 1KQSR 2QSWA 3OTOJ 3RYLA 2Z56B 2V4JA 4U8VA 3KLEB 4W90B 1FDAA 1FO1A 3M2VA 4X4RA 2C3OA 1X5SA 4YB5A 1QD1A 1N48A 4TY8B 4N8OA 2OEMA 1M5SA 4A8QA 4NE9C 2JEJA 2AQ4A 2R7QA 4KE5A 3MFHA 3V6HA 1B4SA 2H4YB 1YJRA 2ATCB 3FCHA 1TKZB 2KT3A 4RW9A 2CQ1A 2GV1A 2VIHA 4USIA 2FTRA 2MPUA 4JI7F 3CIZA 4MJKA 2CKWA 4RNHA 4K7QA 4DN9A 2G4BA 2WSEC 3EDRB 4OX7A 1S9EB 1RBOB 3FMBA 2AD9A 2MEWA 2RVJA 1QAXA 5EN1A 1FE4A 1UTAA 4AUKA 5A8WB 3CDWA 3IS9A 3EM1A 1H72C 2GHVC 5GADI 1PYTA 4ALZA 1ITPA 3ZZUA 2D3O1 3M6VA 5DRKA 2NREA 4PQUB 4QWEA 4O3RA 2VFTA 2W1BA 3DOLA 4ES1A 3MCMA 5F9NA 2OIHA 2DNGA 4DX8H 3GCXP 2FY1A 5IZHA 5C24B 4RW4A 1NEEA 3L7PA 2WW8A 1XNQF 3V6KA 2LEBA 1OIAA 4CNYA 3QAEA 2R7OA 4AQYF 1U1NA 4C0HA 2DRAA 1RTJA 2W01A 2XI2A 4LQ3A 1VQ6S 3GYXB 3OTCA 3OL6A 2ZVSA 1FJGJ 3D3BJ 2V68A 2YKOA 3K5LA 2EFPA 3CMAS 3FEYB 4HI2A 4PG5A 1FXRA 1H73A 4LF7F 2AJ1A 4WP8A 1KQFB 4Q2MA 2CJXB 3HSDA 4KH0B 3D6FB 2YNHA 2DYAA 3ADAC 5C42B 3OR2B 5GAEU 2C2EA 1Q81T 4N77A 4C0BA 1RK8A 1YDLA 4ILRA 1NKBA 5E7OB 3CF5Q 1WOOA 1SL1A 2ZBCA 3V81B 2OSRA 4HVZA 1DQAA 2AP6A 1F2GA 4ZPCA 1N5SA 1Q95G 2AJFE 2V2VA 2WONB 2R8KA 4QIFA 1MLAA 4IO1A 3HT3A 1WHYA 1FKPB 1SBRA 5KFKA 1KTQA 4P10A 3KJVB 1N52B 1P8GA 2VD3A 2VB6A 1XMOF 4DV3J 4C98A 1DTQB 2V9KA 2BACA 3HPOA 3R6LB 3PIOQ 1Y11A 2BANB 4I6WA 2ZD1A 1TL7A 2V4RA 4I64A 1VLOA 2CPJA 3PRBA 1G1XA 4Q5VA 1FNMA 3D5MA 4MK9A 4RW8B 3QRRA 2HQGA 1IM6A 3KNAA 4J9MA 2AEMA 2HZCA 1KHWA 4RWWA 3EDQB 2DNRA 3IMQJ 3KHHA 2GVZB 4GKKF 4K2XA 1AZSA 1X5OA 3BYRA 1OO0B 2HS0A 2IDEA 4I69A 2OJ3A 1G6BA 1BGXT 3L95X 1VK8A 1UFLA 4O4GA 2Y0SD 1HI8A 2ZUAA 2FIUA 5ETTA 2YWKA 1BLUA 2PN6A 1T9TA 1IBMJ 5DM6Q 2XO7A 5KT4A 3Q8RB 3KLIB 2W2OP 4RW7A 3CD6S 1GTHA 2HZVA 3ENVA 2IAJB 1X60A 3IM9A 1LW2A 3CJRA 5KFZA 3OTBA 3FC9A 5K14B 3N01A 1IKVB 1QAJA 3SCIE 1TUVA 4V19X 3KUHA 5J2MB 3OQ2A 4TXSA 4PWWA 4K2JA 1SKWA 3MR2A 4GC6A 2W2PP 1KLMB 2IRXA 1EIYB 1IR1A 1AA1B 2IHR1 4X4UA 3TJAA 5KFDA 1NH7A 1X0FA 3QT8A 1N8RT 4EMDA 2JLGA 2NSBA 3W1YC 1WDTA 3W66A 1Y7PA 3CCZA 4W92B 1QSLA 2RE1A 2YX4A 1XR7A 3DLGB 3MUTP 5FDLB 4EBCA 5H9FK 2VDHA 2KXHA 2QLXA 3PFEA 1JLCA 2LU2A 1FTCA 3H5UA 2DKOB 1ZPVA 2CPZA 3B82A 2HHXA 4KGMA 4HHUA 1VQMS 1UWBA 1U1QA 1Q0NA 3W60A 1T11A 3QLHB 4DZ6A 2J0SD 4EEYA 4ZPTR 2CQCA 3MECB 2CNLB 1FFGB 2CJBA 2YQ0A 4DU8A 1HD1A 1U1OA 1TUGB 2IC3A 4CO5A 1T3NA 1JX4A 2MKHA 2J8SA 3M8PB 1C1CA 3CUNA 2BE2B 1HI1A 4ILMA 1NRKA 3NBPB 2K7KA 5ETQA 5KFTA 1NJZA 4KB7A 2D74B 1EJ7L 1R89A 3AHPA 4RR5A 1JWWA 4CO3A 1XMQJ 3W2WA 1TMMA 1CS4A 2WBRA 6FDRA 4NMXA 2B6AB 2CWXA 4FXVA 3QSIA 4RU9A 1I51B 2KVQE 2YKQA 3MI7X 1KVJA 1BQXA 4WWSA 2XYGB 4QJVA 4NLTA 1WEZA 3F44A 3T5LA 5J2QB 2V34A 3HSJA 4QU7A 1J5EJ 2EG2A 3M2UB 3CB4A 2PMHA 1FVSA 4ZJLA 4IYQA 2ACYA 1VBYA 1UA1A 2FVPA 1HMVB 3BO2A 3VR1A 1RT1A 1TK5A 4L75A 2LA6A 3A3PB 3HF5A 4KFBA 2B5JA 4QQBA 2OAUA 1FJEB 2QMWA 4FN5A 3PEHA 3E01B 1TP7A 3O3LA 3MF5A 1FK9B 4C8YA 2F8EX 1FXDA 3BGUA 3PVXA 1Y5LB 5K9FA 2XWXA 3CJSA 2XHWA 4H4OA 2QTWA 1FCAA 1GMWA 1KS2A 3IWLA 2ZH8A 3POTB 5BYSA 4FDFA 2UU9F 1P9QC 1HNXJ 4ERDA 4J9QA 1IBKF 4B3OB 1W2BR 1XMBA 1EX8A 3SDEA 4CLUA 3CD0A 2V50A 4ZP6A 1U48A 5KFQA 1JXEA 4QIVA 1Y00A 1Y3JA 2E1AA 2GIQA 3OXFA 3PRDA 3JQKA 1NB7A 1FVQA 1C2PA 3SCJE 4DL4A 5ETSA 1VK3A 3TQ1A 3DCAA 1R7IA 2RUGA 3BF4A 4P6QA 4Q8EA 1HNVB 1RHUB 2CG4A 3FBBA 3K5NA 1LXNA 2XEXA 3GFYA 2UXDJ 4K8RA 4NLSA 3UCZP 2JVOA 1EARA 4PXBA 2CNOB 5HO4A 3Q2TC 1AW0A 4MIWA 1JLGB 3EVWA 4USHA 1BUXA 3HJFA 4F7VA 2QA2A 2R8GA 5C25B 4KJIA 3VGTA 4DPTA 2PMWA 4WFXA 4NASA 5J2PA 3HVAA 1UVLA 3D4JA 1S77D 4JYAF 2R2TA 3R8YA 4Y34A 3DLBA 3S7RA 3IP0A 4NLWA 4C8KA 2HGNA 1XQIA 2VONA 3U27A 1T05B 1CC7A 2RT3A 5B08A 2FLLA 2OTJS 2MZJA 3PJWA 4OI1A 3O5TB 1YQHA 2NPFA 1GK8A 2D3UA 4RUBA 3RBXA 2GMHA 4FS1A 1YI2S 2XS2A 1N6QA 3GIMA 5EX3A 3I6PA 2DHSA 4K50A 2XMUA 3U02A 4OZ2A 2E7VA 3NKYA 3SSQA 2V69A 2KM8B 1HW9A 1C4CA 5EWEA 3KYLA 2DNYA 4DV2J 2VL1A 4Y00A 1C1BB 2OD4A 2QLWA 1B64A 3CMQA 2JFDA 5LMUF 2HLUA 1UETA 4IG0A 3C6UA 3MPUB 3TUJC 3IBCB 1HBNB 4ETXA 4A8OA 3QJJA 2HHHF 1M0SA 4J9LA 4ECYA 1NDKA 4UOFA 4P74A 3W8PA 4HYKA 4IH5A 2FVRA 2LXFA 3J7AN 3EGNA 4JV2A 1RSCA 4R5PB 2EW9A 1FHTA 4MT1A 1F9FA 4YHHJ 3AB4B 3RBZA 5KFRA 3VZIA 2UZAA 4C8LA 1WWHA 3C46A 2HFUA 3FZ2A 2NXNA 3BSAA 2V2ZA 4LF9F 2E5LJ 4IOAQ 2IMWP 1RAEB 1JLEA 2JNJA 1DTQA 1S1WA 2BANA 1DAXA 3TA1A 2KM8C 1RWXB 4MKAA 3BSNA 4RU2A 2NLWA 1FE0A 2NZCA 3TZWA 4FYWB 5F8HA 4G3IA 4ZLJA 2RDJA 4HTJA 5E0OA 1O0PA 1E6VB 2ZNYA 3T5JA 4NEYA 3FCVA 5HJXA 1I6JA 1L5UA 2MHNA 3VAGA 2DR5A 4MYTA 5B0BA 1PAEX 4DV5J 1VDHA 2HGLA 3FGVA 1TV6A 1J5OA 4IRCA 4OI0A 4O3OA 1N4LA 5I3PA 2WK4A 4OZJA 4CM2A 5I4MA 1E6YB 2GS8A 3L09A 1PSDA 3IWNC 4XDDA 4JI3F 4HLBA 2YKMB 3OSNA 2EFOA 3CCRS 3ET6B 5L1IA 1ZM9A 4WYWA 3MM8A 2UV8G 2BBEA 2XBPA 2V8PA 1RT5A 3BKFA 3BREA 3ZZPA 3GV5B 2R2SA 1Q7YT 2HBQB 3W61A 4KBIA 2C3YA 2V5HG 1VQ4S 3OJUA 1CQNA 3KHRA 2ZJQQ 1ZAWA 1JK9B 2H5JB 4H4KC 4ECWA 2LU1A 2CPXA 4ZPWR 4NCAA 2VPXB 1DTTB 3H25A 3OD2A 1QSYA 2YPYA 5F8MA 2A2CA 3UN5A 4UQGA 4M5DA 3UFCX 1U26A 3DLGA 2LVWA 3MEDA 2HQIA 3JTNA 2XS7A 2DNZA 2Z2LA 3TUZC 2HFOA 3UVJA 3I5AA 2JEFA 2R8HA 4QIEA 4XTTA 5M2UA 3CCJS 1FRHA 1WSRA 1N88A 2KTQA 2CWKA 5FIIA 4I2PB 1NLKL 3W62A 3G6VA 1G2EA 4WYLA 1D0EA 4ZK7M 1PCAA 3V6DB 4OYIA 2AV5A 4QYZK 3KG1A 4M8LA 4MKBA 4CO0A 4DX6A 3DRXA 3M8YA 3FZBA 4DV1J 2FY8A 5D3GA 3DRYA 1Q53A 4F8RA 2DR6A 4NYPA 1FJ7A 4NPOA 4X62F 1CJKB 1CSJA 3PYDA 4NLPA 2DITA 3MM9B 4RNFA 1DJ0A 1UVMA 2MTLA 3EVOA 2DJWA 1WC3A 3MEKA 5AJ3J 3ZC4A 3QIPA 7FDRA 3MHYA 2B51A 5B0EA 1QM9A 3NS7B 5GMEA 2HGMA 4LF8J 4ID5A 5A8KB 1X4DA 1YBAA 2RB7A 2PFDA 2NSCA 1R0AA 2BJ8A 4WU2A 3TA2A 2A6MA 3DGPA 4I67A 2UUAJ 4KPYA 1TKTA 3T9NA 2DK2A 2M4MA 4Y3CA 4YFUA 2B0GA 2Y8YA 1SJFA 1JXLA 4M5NA 1SQGA 3Q8SB 4IG3A 1UEUA 4J37A 2HPUA 4PG6A 5KFJA 2XLIA 4B3TF 2BZ2A 2CJ9A 2AYEA 1TKXB 2VBXA 3C16B 3MTKA 2L41A 1VBZA 1PGZA 4ZVHA 1UFKA 4ED3A 3GQCA 3HXMA 1SCJB 2GQ2A 2J0QD 1T0TV 2PT0A 2I1RA 1QVFR 4M94A 2M52A 3GCWP 3ZNUA 4UY8T 1X8DA 5L39A 3C66A 1KTVA 1KLNA 2WTFA 2BW7A 3M9MB 1KOOA 3POTA 2F63A 1LXJA 1JJ2R 2YNFA 3O6QA 3I82A 2GMLA 4ECQA 2U2FA 1VQPS 3MWBA 4IQXA 2VQFJ 1KONA 2XHCA 1YK9A 3AA9A 4K4SA 1QDUB 3K7RA 2MHEA 4WZMA 1YRUA 2XM3A 4DV7J 5LT5A 1IKYA 3BR8A 4IFYB 1RTDB 1HL6A 2GJIA 2YWFA 3BS9A 3R97A 2AU0A 2UUTA 4DQRA 2GX8A 1FEHA 1FDNA 4LR7A 3ZTSA 1KBRA 3HVRA 1SB6A 2J5AA 5A6WA 3UE2A 1TFWA 3GILA 4K4YA 2VG5A 2EXUA 1YX2A 1V5IB 1XJWB 3OHBA 4LFAJ 2D69A 2VOOA 1UJ4A 4CO1A 4QIGA 3KG4A 3MM5A 5KFIA 4LRFA 3J81U 1QAIA 4PAAA 2KG1A 3GSIA 4NI2A 4ELVA 4CP5A 3PV8A 2RH3A 1TUWA 5A0YA 2RHSB 4OHVA 2J7KA 3FCWA 4ZVEA 4DG1B 5HVHA 1KQGB 1U49A 1NJXA 2RJZA 5E3QA 1U4BA 2U1AA 1C0TA 2YQ1A 2V67A 1NK4A 3U7JA 2YY3A 3C2PA 3NAHA 1U8SA 4QPXA 2ZZMA 3Q86A 1S72S 1IQTA 3HKWA 4ZVFA 1Q7LB 3DYAA 2OKQA 1K9MT 3OL7A 1ICEB 3BDEA 1HYSA 2L9DA 4DSFA 4DL5A 1N56A 3NNAA 2W8KA 1R8BA 3Q83A 1FFWB 2XMMA 3CCMS 2FHJD 4DEZA 5F8IA 4F0HA 1FNOA 2QV6A 2FGCA 1KHVA 2V2KA 2PGCA 4O44B 2IYGA 1KRPA 1PKUA 1RP5A 5AXNA 1SC3B 1CJVA 3C6TA 2H5IB 2DO4A 2F8MA 3MPYA 4U7UK 3EJMA 2R7XA 2ZH7A 4ED2A 2ZC4A 2AYMA 1MU2B 4B3MF 4D3GA 2R7WA 2FLPA 1S59A 1HBNA 1C0UA 3F0NA 4Y6IA 4HACB 3T1AA 1HBMB 2KB2A 2E9RX 2VBWA 1T95A 2RRBA 5IS2A 5IV3A 4R8UA 1D1UA 4KO0A 3K8WA 4PUOB 3VVUA 4K4WA 1FWLA 1S1UB 2KRBA 4Q8FA 2PO4A 1FA0A 4GO7X 1YZ7A 2OFGX 2N3LA 1UEVA 1N0VC 1HQEB 1RWNB 3MCOA 2OPRA 4H4MB 4EUVA 4DZDA 4KH1B 3T1HJ 2GHWA 2RS2A 4CQ1A 3AQOA 5KFGA 3CJ0A 4DV3F 3T6JA 1WJ9A 5HMZA 4JP8A 3EZOA 2KXNB 3JYTA 2C2DA 1DFDA 4ZPVR 2DNKA 2QIFA 4MK8A 3RAXA 1HBUB 4KV8B 3D0GE 1RAIB 3SV4A 3G2XA 5D4NA 3RUBL 1RAJA 3LGMA 1XEZA 3CULA 3H4DA 1N5QA 4Y2KA 3EUNA 2RS8A 2NZ4A 2EPIA 2Y0BB 4X4QA 3OW2R 1CJUB 2HW3A 2DGSA 1NSKL 5I42A 4LF5J 1G3OA 3HFKA 3ZXWA 3I31A 4C3LA 5HMYA 1VR6A 4DR4J 2BM0A 3BQ2A 4EBEA 3MOJB 1N5VA 4U9RA 4DS5A 1B0TA 2YKMA 2KT5A 3CC7S 2MY8A 4DCJB 1HNWJ 1FWKA 2ZOMA 2D41A 5J1EB 3OXLA 2QL7B 1NHVA 3F41A 2YKNA 2ASDA 2DCLA 1RAHB 2FD2A 3M32B 2L08A 4U6PA 3FKBA 1WI6A 2HK3A 1NM2A 2NR0A 3B54A 2GFFA 1V5VA 1DARA 2M8HA 1S97A 2I9SA 2KHDA 3KLVA 3KK3A 2J76E 2A0FB 5KFUA 1TFYA 5LM7E 3JSYA 2HVHA 1FFSB 4DUZF 2JLEA 4WE1A 2XMWA 4OYWA 2IA6A 2V9WA 1LW0B 3VAKA 1OMSA 3O44A 3SCLE 4DR7J 3Q8UA 1CJTB 3LPEA 1RBLA 3N5FA 2DHAA 4EZ6A 1SPBP 1SV5A 2CQ3A 3ONQA 4I2PA 2DH7A 3IG1B 2DB1A 5CQGA 4QCLA 4U8YA 1F9HA 3GFXA 3UCGA 4NZ7A 3VAFA 1NZAA 2XG8A 2H3EB 1OYEA 3TAMA 3LA0A 2MQMA 5KFAA 4YN3B 3ITHB 1H38A 3GYGA 1RI7A 2GQCA 2BQ3A 3CJKB 1CJKA 4KIAA 1VC0A 1RLDA 3MM9A 2GIFA 2KT2A 3CC4S 3CDEA 3R5GA 4P71A 2ZH1A 4ZPDA 2LCWA 1XMQF 4CLTA 4UZBA 5HLFA 4UT4A 2DNHA 1K73T 2G2YA 4F36A 3DXBA 1LWXA 3PYFA 4LRDA 2MZSA 1UCNA 3DDKA 3T9ZA 4X4SA 1NDCA 3UWTA 1S9GA 3OT9A 2VG6B 3TJ8A 1RKJA 1DQ9A 3HULA 3FUYA 2Q66A 3UD3P 1YIJS 4UQTA 1KP6A 5F8JA 3PW0A 1S1XB 3VAJA 3K17A 5KG3A 4J9OA 2MZQA 3CCUS 4LF2A 3PKMA 2UVVA 2IJNA 1LK7A 5FJ4A 4OHZA 4E2FB 2BR0A 3PY8A 1QJHA 3VAHA 1WC5A 3RRGA 3I0SA 3CSKA 3OVSA 1X9SA 4ZA1A 4KGXB 5T7LB 3NGRA 3E8OA 5C2CA 1C4AA 5JJBA 3TR5A 1RABB 3LPYA 4QW9A 3DKDA 1XWLA 2VG7B 1Q5YA 4PCQA 2CPEA 4I6YA 3WHIA 3GJSB 3M2RA 2EC0A 3IM8A 3NGKA 5ETOA 5H9FJ 5CABA 1GX5A 3MGJA 1R6VA 3MM6B 1FX4A 1PAUB 2UXDF 5DJBA 1OSCA 2HS4A 1CQMA 4DR5F 2MKCA 8ATCB 3QO9A 1EB0A 1TKDA 3NRBA 5DDOC 2JJ4D 3BYPA 4U67Q 2BA9A 1RT2B 2XMAA 4PG7A 4DUTA 2MJUA 4Z37A 1B0PA 1WF1A 3AODA 3HVTB 3BBCA 3KLGB 4O0IA 1FNXH 3HHLD 4F4YA 5A6PA 1YVFA 2FHJA 1BY9A 4NA2A 3VZHA 4YQWA 2DGVA 5F8NA 1RT4A 1Z1ZA 5ETVA 4P2MA 1SC4B 2R3VA 2IA0A 5HQ8A 2E5HA 2J9DA 4URQU 3UCUP 1IJEB 1U7LA 4DFMA 3CCWA 2A10A 2MQQA 2OPSB 3LP0A 3OUYB 1A6LA 2RMLA 4DMZA 5L1JA 3R7BB 3TP2A 1LNQA 4RO0A 3HHNB 2W8LA 1MU2A 2I38A 3MAAA 5CH7B 3SYZA 4ZP8A 3HHDA 1DRZA 3BQ1A 3MURP 5E3AA 2XY5A 2WSFC 4HHHA 3NS5A 4A8FA 3BO4A 5HP1A 2HHPA 5ETLA 2WW4A 2VQEJ 4DHVA 5KFXA 4USWA 1H6KX 2RF2A 3D28A 2QEXS 1HA1A 1YJNS 4RWXA 4ED0A 4OI2A 2NXCA 4YDXA 1EETB 4PUOA 3MUMP 1RE1B 1MROA 3PX0A 4YHHF 2UUBJ 2YWEA 3PTWA 5DDQC 5I3QA 2G0IA 1HHSA 3FVYA 4H4MA 4R0JA 2LMIA 2OI2A 2PEHA 2MGZA 1SJQA 3BGRB 4NCGA 1CULB 5IWAJ 2VA2A 2CPYA 2E5LF 4GMKA 3KDOA 1Z4UA 2P9EA 4YS2A 5K8NA 4M1KA 2PFFB 2B9XA 4C8OA 5M2RA 2V0NA 1UVJA 4TLRA 3Q8QB 1AB8A 5F9LA 3OLAA 2Q3PA 1PJ5A 1HARA 1FESA 2FJXA 5GAGU 1S1TA 4NLUA 2QA4G 1Q8KA 2GA7A 3HO1A 2ZBIA 1VBKA 4RUAA 4DV5F 2XY7A 1ZBTA 4AXIA 3EZUA 3CMES 1WELA 3K5MA 4ZIVA 4ID8A 4LFCF 3H42A 4CIOA 2WVDA 1DQ8A 3TEGA 1S4FA 4NYZA 2JX2A 3OJSA 2XSJB 1S6QA 3CJ5A 3UPFA 4WXWA 4M5MA 3GU0A 4KKOB 1RBAA 1GTEA 1VRTA 5L1KA 5J1EA 2I5JB 1N5YB 3C3LA 3TO8A 1FTRA 4W98A 3G87A 4MTPA 2BQUA 4C97A 3S01A 1S12A 2FVSA 1K0TA 1LWEA 4OYXA 1HNZJ 4B3RJ 1BQMB 2EVZA 2VA3A 1MW7A 3I56S 2DH8A 1UPPA 4EO6A 4OFZA 4F25A 4J91A 2X7IA 3SQOP 3GFHA 1YBTA 3DRPB 5F8LA 3C14A 5D4OA 1APSA 2P9CA 2PI5A 1M1GA 3FK4A 5LSOA 4ED8A 1N5TA 2G0CA 3QWUA 3PJ9A 3AJ1A 4HKQA 2RILA 3BO3A 1RA6A 1SJRA 5EX0A 4ECVA 4OJ1A 1UJ5A 3PYGA 2G2ZA 3BN7A 3R1LA 3IRXA 3BPDA 5HI7A 1MN7A 1KN6A 1ZAVA 3AD8C 1U24A 1XTZA 3D68A 5B0GA 4L72B 3KUEA 1OY9A 4C4WA 3LWMA 1AT1B 2UVWA 3OXGA 3DI6B 3G9CA 2XY6A 4EBDA 2UXCJ 3SFUA 3WC0A 5KG2A 4G1PA 2GAGC 2LEAA 4L74A 5HJYA 4S0MA 1X4HA 2CJYB 4LSNA 3W2VA 4J9KA 2B43A 5D0RA 2OPPB 3IR6B 2W4PA 1P9YA 3OL8A 5AJ3F 2CPIA 5IC4B 4QBUA 2PC6A 1TVRB 2WOMA 1BC6A 1DLOA 4DX7A 4AD6A 3IAS9 3I9ZA 1TL3A 2UUCJ 2OP5A 1T02A 4LF8F 4TY9A 1LFPA 4KHMA 1MWQA 2EFQA 3N6MA 2HNYB 2HNDA 3N5BA 2OTLS 2VICA 1V9OA 2K2PA 1R31A 2UUAF 3CCLS 1RHRB 2EC2A 4ZN1A 4NLVA 2FJDB 4G1QB 4LQ9A 1FRLA 1FKOA 1YWXA 2GAHC 1S99A 3FSIA 4LRAA 4CH0S 1DHMA 2E9TA 2IRUA 1WDDA 3S6EA 5EHHA 2B8PA 4I0WA 2NXEA 3IO1A 2GCFA 3KTQA 1RAOA 1LWFB 1Z2ZA 4I7FB 3B4DA 4DI6A 1UVKA 1UEKA 5D0HA 2V4QA 3RBEA 1X7VA 1R6YA 5GVQA 4IO9Q 3SBMA 3V5RA 3H90A 4FBTA 4LSLA 5F3TA 4WK3A 4L73A 2HKEA 1IKWB 5H9EJ 2R7RA 4OHYA 4FBUA 1XERA 1VQ7S 3V6JA 2NPIA 4LRCA 2MZRA 1T9UA 3N6LA 3ZTRA 3BKTA 3KHLA 2OPQA 4JI8J 2LYVA 3W9JA 3MPWA 3PNIA 1HBOB 1NJIT 2LLZA 4QIWD 9ATCB 2GJ2A 1KEKA 2ILZA 2VQFF 4NLXA 4TLQA 5DG9A 2CQHA 3G82B 1M5KC 2VJVA 2RU3A 4GVBB 1RTIB 4DV7F 5CYQA 4C9DA 4HHJA 2W9CB 2LA4A 4O3SA 4IOCQ 1WG4A 5J1PA 4Q2LA 4DCPB 3Q22A 4Z7CA 1PBUA 2MSSA 4YB7A 4YP3A 4BDPA 2P2CB 1FERA 4RW6A 1RHJB 3J81Y 4K4TA 4MKYA 1ROFA 5J1NA 2Y1JA 1SJ1A 3MR3A 3CT9A 4LFAF 1I94F 4ECRA 4DR3F 4CRJA 5ADZA 4X64J 4EGLA 2GMJA 2GJFA 3HHLA 5CYMA 3BPSP 4DL6A 1JNRB 1YKWA 1BWEA 4ZOSA 2QL9B 4U96A 4RNOA 4FF4A 2W9BB 4JV5J 1SC6A 3GLJA 2CZVC 3MMAA 2JZ5A 4FXWA 3TEHB 1VGYA 1PJ6A 4TQSA 1S0NA 2YKPA 2J9DE 1NU4A 3FFIA 3TVZA 5DLFA 2C3PA 2DD8S 2HQ3A 3DOKB 3MAHA 2B8QA 2GVDB 1RYRA 1FD2A 2X51A 3PRVA 1Y0HA 1IKXA 4EU0A 1RWWB 2RQKA 2B4UA 3MM7A 2HK2A 2E66A 2IVFB 4JUZA 3ENAA 4YR3A 4CTAA 2AJ0A 3EPIA 5GAHU 4KTQA 3I9V9 3T5HA 1D9AA 3H2LA 2DVIA 5KFVA 1RWKB 1UVNA 4ILLA 2ZBQA 3RR8A 2Q6CA 4KT0C 2QL5B 1JJCB 2LDIA 2H9ZA 1B99A 1FD8A 3LTOA 2IDLA 3MMJA 5CCLA 3DXSX 5THWA 3OFHA 2FHMA 3C15A 3NGDA 4CLKA 2ZHAA 4DV4F 4O23A 1R27B 1L3KA 5MLCV 4A4JA 5K20B 3MPDA 1X4AA 3SQGA 5A2QU 4UY85 5A8RB 1K8AT 5IFMA 4WFNQ 2BM1A 1FKAF 2ZDOA 3ICLA 2JEGA 1VJWA 1BQNA 3OBIA 1MN9A 1HWJA 2E29A 1B0VA 3L7UA 5LJ3Y 1IQZA 5CD4A 1R0BG 3NY0A 1XNRJ 2E44A 2W2MP 5LOQA 2YNIA 4X4PA 1U8WA 1HPZB 3BGFA 2XNRA 3FRYA 4B9LA 4JI6F 4L6V3 2A18A 2DR9A 4USJC 2QX0A 5D78A 1RWOB 5GMKa 2J6UA 3WIVA 4J5OA 2QYCA 2QA4S 3MEEA 1G7CB 1WOPA 2LQ8A 3MXHP 4OL8A 3A3OB 2KN4A 1Q86T 3QZ7A 3QFHA 1RT3B 1UA0A 2ASYA 2P6SA 2XSJA 3ISND 2FHKA 2MKJA 4C0OC 4DR4F 4ZJOA 3PO5A 5ETMA 4PWDB 4C11B 2OGUA 4CYUB 5G0RA 2YH1A 3MR5A 1WD6A 1HNWF 2I5JA 1S5ZA 3IGNA 3MMCA 1Y4ZB 2DHXA 2QLBB 3NCRA 3R3TA 1NK9A 4BWJA 5KFMA 5IOLA 1VQSA 4ZVQB 4PWUA 2H5EA 1RUSA 4CLFA 2BXJA 3GG1A 4IUFA 1GMVA 3VQSA 5FLXU 1M5OC 2BJEA 1EQMA 2WZ1A 3DN9A 3WC2A 3T1YJ 1NJYA 2VPWB 4IKAA 5HMWA 2OEJA 1PYOB 2KG0A 3UNGC 5AXLA 2RD5C 3QGGA 5CAAA 3ISNC 2B4OA 4DR7F 4WXOA 3GYNA 4DSJA 1SUQB 2HNZB 1CC8A 5HSPA 1ULRA 2EK6A 4YOEA 4DSEA 2C2ZB 2BJ3A 4LBPA 1EKRA 2EFNA 1O6XA 2JDJA 2KL8A 1NB2A 3HZEA 2KI2A 2KRRA 9RUBA 2MKYA 3D66A 3OTEA 4A8MP 4DLEA 5HQMA 5C2GA 1LWCB 1P27B 1X4BA 3D1HA 4URGA 1WUUA 5LSLA 4WFZA 1VQ8S 2RSQA 4PG8A 2N4CA 1REVA 3AD7C 1XR6A 1Q82T 1QTMA 2MXYA 3SSSA 4NL5A 4ELUA 1YTYA 4IFVB 3ETOA 1WKKA 1FRXA 5CD4H 4TU7A 4Q45A 1HKAA 2OPPA 1Q8LA 2R9LA 5DO2A 4X4OA 3KLFB 3I5BA 3KHGA 3GWCA 1TVRA 1RTHB 4DU7A 4I4BA 1NPPA 1VC5A 5F3ZA 3PXGa 4L76A 3AXKA 4WFAQ 2QSFA 3H5YA 2FVQA 2EBGA 2GNKA 1NHKL 2FZCB 4NA1A 1T03B 3KK2B 2QMUB 1YLXA 3M30A 3B78A 2K7JA 1RDRA 3OPKA 4K0KF 1MG7A 3K2YA 1XMOJ 1RTZA 1HHQA 2G2OA 4ZLNA 2L48A 3JSMB 3TAQA 2CZ4A 3M9NB 4TVAB 3A1YG 5E5NA 2O5DA 2XCAA 1KSPA 5E3CA 3V4IA 2BRLA 2CRLA 4I7FA 1VJQA 3M8QB 5HBMB 4HL9A 5IM0B 2R2UA 2E9ZA 1OPIA 4LR9A 4BC9A 2HHWA 1WACA 3OSPA 3LP1B 2HHSA 2K1RA 1QUPA 1R3NA 1S79A 2F9DA 4Q0BB 2KU7A 1UL3A 2BDPA 3LH2S 3R5AA 1HI0P 4LBHA 3EX7B 4NLGA 1XC9A 3H20A 2I2YA 4F0MA 2Q6BA 2B9EA 4DR2J 1D09B 4AXJA 1HQUB 2HVDA 5DETA 3DLHA 3M4XA 1D3WA 3J80U 3J7YU 1X4EA 5KFHA 1RTIA 4OI4A 3UDVA 2WB1D 1KOHA 5E3PA 2B7BB 3DLEA 1NSAA 3U1LA 1JLBA 3VQTA 3B6BA 3DOMB 1WEYA 4U95A 1OQ3A 3MZIA 3VWSA 4ZVGA 2HFZA 1ZH5A 1U1KA 2ZKUA 1Q8BA 2HAIA 3NGUA 2HFNA 1JLFA 1SJ3P 2DGUA 2L9NA 4HT5A 4WKRA 3I0RA 3NOGA 2AZ3A 4IDKA 1YSJA 1EQ0A 3G71S 5KFOA 5HN0A 3ILJA 4O3QA 3PW7A 4ZHRA 5KT6A 4WK1A 1RYSA 1IBLF 4PKDB 2YBVA 1MNEA 3W5XA 4NXMF 4X4TA 5KG6A 1T9XA 5T41A 2D7SA 2DRDA 1GXLA 1N54B 2CJKA 4DL3A 4GKJJ 1OWXA 1RQ0A 4RBUA 1DBDA 4OZLA 2QO3A 2PI4A 5KG1A 4DJBA 3M8SA 2HHQA 2GQQA 2YTCA 1NDLA 3KNGA 3ZTPA 3SIPB 2UXBJ 3DHWC 4ZJQA 4ZVTB 1VC6A 4MK7A 3FNNA 4NZ6A 4O4RA 4DSKA 1NK5A 4H54A 1L3TA 2BX6A 2DNLA 5L9NA 2DEJA 4JI5J 4USVA 1UWAA 3W9IA 3US5A 4PPDA 4ZPBA 1JB0C 3JQMA 5I3UA 1NDPA 4A47A 5KOXA 2FPHX 2XO6A 3WZ0A 2KZMA 1QUVA 3TNVA 4B02A 3M7VA 3KLHB 4ED6A 3ZZTA 3AOBA 4B9UA 4P2XA 1L3VA 1XBWA 2DXDA 2AF6A 3BZQA 1K47A 4WU3A 2FJBB 2XGPA 4OZ1A 5DDPC 1ZOTA 3LP2A 1WTFA 2FC8A 4B17A 1HWUA 2KJVA 2OMOA 2CZ9A 1IN0A 4YR0A 2M5YA 2UUBF 2HMIB 3EXCX 3NNCA 2ALZA 1S1VA 4TYAA 4YDDB 1VRUB 2MKKA 2BQRA 1MMNA 3OFGA 1HR0J 3AY0A 4KHPJ 4DWIA 5IWAF 3HJVA 5KFCA 3UN3A 4I2QA 1XIQA 4Q7AA 1RCOB 2KXFA 4QR0A 2ADCA 1KKHA 3QRPA 1EP4B 1SKRA 2I8EA 4P75A 3BGLA 2UU9J 4TYBA 3EICA 3P3DA 1IBKJ 2ASJA 2AJ4A 1JLAB 1U2CA 3VV2B 2PEBA 4USTA 3VGUA 3E2EA 2GHPA 5F41A 4FS2A 2COLA 4I56A 3GIJA 3V2UC 4ES3A 2ZC3A 5KFFA 5LJ5Y 4CZCA 2V4JB 1RT3A 1FX2A 2Z2ZA 3LF0A 3M2VB 1FRIA 1NAQA 3PW5A 3Q0AA 3DRRA 1YGYA 2G1HA 1YITS 2CA9A 1WKLA 5KG7A 3GMGA 3FEXB 3KDNA 1HNIA 3AJ2A 1N34J 1QLNA 2NUHA 3I32A 4UOCA 1KD1T 3WX4A 2N7YA 4CYUA 1TL4A 3A8JA 1GMUA 4RW9B 3CTRA 1GXUA 3MD3A 3W5YA 1RT7B 3TYTA 2M8DB 1FI4A 1JJ4A 4JYAJ 4LF4F 3RRHA 3K5OA 1UJ6A 3QRQA 2DHGA 4ES2A 2GGPB 2AYGA 3A4TA 3GV7B 4OYAA 2RKIA 4HEA9 2WVEA 3G96A 1F3FA 3LALA 2Y9HA 3IS9B 4X2BA 2JC0A 1SJ4P 4DPWA 4M5KA 4AE5A 1I3OB 2NXJA 2L3MA 1H7WA 3KLEA 3DOLB 2FHOB 3QBCA 2ZDPA 2R42A 3NGTA 2XWYA 5KT5A 4TY8A 4DCOB 1F2HA 4J9PA 3CCSS 4DQIA 1LWCA 1RTJB 4K4UA 2IM1A 1TKZA 1WF2A 2QYGA 1M5PC 2FYXA 2B9WA 3GIRA 1Q78A 2UXCF 3UD5A 4RPFA 5LMUJ 1LV5A 2F5GA 2P5VA 3GIIA 2Z8QA 2RQ4A 2JL9A 3IBFB 2BJ7A 4LFBJ 1SL0A 1WKJA 3BSOA 4N41A 5JVGQ 4PQAA 4RKUC 1URNA 5DG8A 1S9EA 4OJ3A 2V6AA 2YNHB 1RTHA 3HT0A 1QSSA 4OI3A 5A8WA 5GAEI 2CUYA 2IBKA 5JVHQ 5GADU 3VAIA 3S1TA 2UUCF 5IT0A 1WTBA 3TJ9A 2XS5A 4PQUA 1G4CA 2VASA 4LF9J 3LQVA 2HEKA 4F50A 2ZHBA 3J7YI 3CIMA 5C24A 2W7AA 2PMZD 2ZD1B 2VKZG 2PE8A 1TL7B 1NMEB 3ZFVA 1S6UA 4QWDA 2OELA 2W2NP 5KFBA 2VC0A 5EUHA 3K89A 1QE1B 3U1MA 4WFYA 3Q2SC 1A9NB 4A8XA 4DR6J 1JKHB 4WBFA 1NKEA 3H4BA 3HD2A 3D7SB 1I1GA 3P4UB 2ZEJA 1VHIA 4NOHA 1GX6A 1CVJA 2LQJA 1AZSB 3LP1A 4A48A 5C42A 3OR2A 4O3PA 3I4PA 4O4GB 4Y28C 3PO4A 2C2MB 3ZZZA 2KYZA 5B7WA 3V81A 3MAQA 1LOUA 4C3MA 2KFZA 2YNGB 4JI8F 3DNCA 4NXNF 1SQEA 2VODA 2W25A 2WONA 3PIPQ 1P1TA 4RW7B 4PR6A 1FKPA 2HQDA 1Y10A 3HDSA 3KJVA 1LW2B 3F56A 1GT8A 1IM4A 2M88A 2AGQA 4HT7A 4CI0B 2IM0A 1H2UX 3IR7B 4QW8A 4BLGA 4Y2MA 3MOZA 4RW8A 2EK1A 1TL5A 3H59A 1TK8A 2CQBA 1H98A 1RB0A 1OJ4A 4RNMA 3FDSA 4E0DA 2ROPA 2XGQA 2IM2A 4M5IA 2BOAA 3NXZA 4RBVA 2O67A 6FD1A 5K8PA 1VHFA 2GVZA 3ILOA 2NS1B 4F3MA 3G6ES 1OQ6A 2VZ9A 3WIUA 3I5CA 4X64F 4ELTA 4OYZA 1WF0A 4QR2A 3CE8A 1JLCB 3LGHA 1NBEB 4QOTA 3K59A 2PA3A 1UWBB 2F4VF 2C2NA 1M5VC 5HL7Q 2LQBA 5H9EK 3KLIA 5D77A 2ADBA 4JV5F 2GO9A 2IC3B 4K5SA 3BKUA 2IAJA 1TMJA 4OZ5A 1WC0A 1C1CB 5ETRA 5K14A 1IKVA 4UZCA 4NX9A 2O3DA 1GQEA 3QSYB 1W25A 4F2RA 3JAMU 1WHXA 5J2MA 1TQLA 4M63A 3OTDA 2KZZA 3KJQB 1F5BA 1RU2A 2QFIA 3AT1B 1KLMA 1S57A 1XR5A 3W2WB 4KYZA 1CS4B 2E5GA 4JBCA 3ETMA 1S10A 4DQPA 2B9YA 1FEEA 5FDLA 2MZTA 1ZM4A 2WRMA 3EWGA 2AX0A 4JI4J 3MMBB 2Y3YA 1S6OA 1Q5VA 3DU5A 2V63A 3DHXA 1OSDA 2OD6A 4U7CA 3QLHA 4XO0A 3P96A 1P1LA 1Q79A 3GONA 4E8UA 5A2QY 3MECA 2KKHA 3A13A 3J7ZT 5D4LA 4KFBB 4B3TJ 2B5JB 2K3IA 4OYOA 4LR8A 3PR4A 3M8PA 3QJPA 3D1OA 2BE2A 3AJDA 4P73A 3WX8A 3NBPA 1GEHA 1IR2A 2CXEA 1WORA 2C2OB 1V3ZA 3MPVA 4PABA 5KFLA 4H4OB 3PG9A 2NXUA 1IJFB 1KNZA 2DTJA 2VUGA 2B6AA 3AOCA 3PYEA 4L3NA 3T5KA 2WSCC 3KJFB 3SDEB 4PEOA 3QT5A 3KJNB 5J2QA 3W9HA 5KFWA 1VMBA 4ECZA 4JI2J 2X1FA 3W3SA 2C3UA 2DNNA 3M2UA 4O0NA 1A0OB 2JWNA 4WP3A 1HMVA 4DPXA 3M6WA 5CA5A 3BBBA 2ZHOA 3GPAA 1NHUA 3KG0A 2HWTA 3BN4A 2IY5B 5IC6B 1PO6A 5HANA 3E01A 2EEYA 5D15A 1FK9A 4J90A 4EO8A 4LT6A 2OHDA 2AEJA 1O51A 4NLYA 1RT7A 1N36J 2ZZNA 5J2PB 4ZS6A 3KWMA 4FYVB 5FLXY 4MAKA 1T8EA 4FF3A 2L9WA 2F1FA 2BV3A 4B3OA 1UFWA 2GGPA 4N47A 4F3OA 4BWMA 3T1YF 3PDNA 4M95A 4J7CA 4UOHA 2B4PA 1VRQC 5CXTA 4KY3A 3TI0A 3PW4A 1TTHB 4PG4A 1N6QB 3X3UA 4J9SA 3OTOF 2VDIA 1Q8IA 4DDFA 4CDIA 5D6GA 1W2IA 4CO4A 3T19A 4B9VA 4FF2A 1HNVA 2DIVA 4A8WA 3ZO7A 1FRKA 4ATNA 4PRFA 2G9OA 4G65A 2CJQA 5IT9U 3JTPA 2DGQA 2BJDA 1JLGA 2E7XA 4DUYJ 4B3MJ 1U6BA 1EAYC 5C25A 2MMYA 4IG0B 3C6UB 4P7VA 4JI0J 3N28A 2I6WA 4FF1A 5E2QA 3EYZA 1K44A 2BVZA 1T05A 4PXEA 1M5HA 4KR0B 3JXOA 1AROP 2RUSA 1ZAXA 3G4SS 3H5XA 5L46A 2IVYA 2XI3A 2VFUA 3M8ZA 3L4BC 2QN6B 4KRWA 2IFXA 1T94A 3QNWB 4MYUA 2LQ9A 3D2WA 1KDNA 4O3NA 4PPZA 2B3TB 4USKA 3NS6A 4UW2A 2X1BA 1SH3A 3CCVS 2BYCA 3TW0A 2JC1A 1JLEB 1YJUA 2DR7A 1S1WB 3ELHA 4N7TA 4ZCKA 4EYIB 2XMTA 2DY1A 1UZDA 4TNOA 1C1BA 1QE1A 3UR3C 2FQQB 4OYPA 2AYBA 1JKHA 1FJGF 3HLUA 3I4HX 2CFXA 3M6XA 3HSGA 2QFJA 4ZP9A 3BDPA 1VQKS 1TV6B 3A12A 1J5OB 1RHKB 3Q8PB 3DU6A 3H98A 2I0XA 3GJTB 3A8KA 3JSBA 3J80Y 4R5PA 3H8YA 1REGX 2YNGA 3THVA 4FKXA 3SEOA 5HATA 2ZH2A 4USUA 1NSQA 5IV4A 4DR2F 5KG5A 2VBZA 1U2FA 1NXIA 1YJVA 4YUDA 3MM8B 2ZVIA 3RU0A 4JI1J 3BGOP 3TZXA 4MKVA 4LMZA 3K0JA 3WQPA 4UTGA 1RT5B 2MY7A 1FDDA 2ZH9A 5C7PA 2HURA 2B4VA 1K1QA 4H4KA 3SXLA 2R7UA 5E41A 1GFWB 4A8KA 1E6VA 1V3SA 5EGYA 5KFEA 4DUZJ 3GG0A 4M5DB 2RNEA 2CQ2A 2F40A 2CVIA 3MEDB 2JEIA 4CCHA 2IYIA 1VIOA 5MAOA 3UVJB 3X1LB 3QT7A 3MDFA 2D9OA 4MH8A 1VQNS 4GRSA 1FT8A 4I6AA 2EKNA 4ZN3A 1O8BA 1X9MA 5KG4A 2HQCA 4YR2A 2UVRA 1X4FA 1E6YA 4P52A 4GKJF 3I96A 1KVKA 5AT1B 1HLWA 2K3KA 2VPYB 1IBMF 2MQNA 2RRNA 5DGBA 2DT9A 2HBRB 2HIQA 5AXMA 2ZOGA 3ET6A 3V4MA 2FVCA 4AYBD 5D3GB 2HLTA 4XPEA 3E51A 2G13A 2UXBF 3D67A 3M05A 4ZCLA 4WPAA 3PX6A 2PDAA 3VTIA 3BR9A 4BHQA 4UOGA 3QIPB 3LANA 4JI5F 1DTTA 4YY3J 1YZ6A 4NA3A 2DH9A 2HWIA 4DBQA 4ID5B 2IRYA 3R5BA 1B7YB 4ZKAA 2BKOA 1IUJA 3ENWA 2XZDB 3BSCA 5DZ7A 3QIDA 1R0AB 2XLJA 1KFDA 5HVFA 1JXVA 4LBIA 2WAQD 3MMBA 2YQ3A 2LP4A 4MMOA 3DGPB 4OZNA 1TKTB 3TQEA 4FYYB 2V94A 2FUG9 2H4WB 1JIHA 4U7UD 2LDYA 2C42A 2MKIA 3DFEA 3V6DA 2BMBA 3NEKA 2MJNA 4QWAA 2V8HA 4IG3B 3OFEA 3GB0A 4FP9A 5F0UA 2EFVA 2K06A 3LAKA 3QGHA 4UUXA 4WTYA 4EFAC 3N9UC 3L3CA 2YX1A 3HP6A 3RBDA 1R8AA 1HR0F 3OV7A 4KHPF 2FGOA 5L1LA 3PJXA 1WOSA 3R2DJ 1KC8T 5DLGA 1R0CB 4NCBA 3GFZA 4PXDA 1OS5A 2HYIB 3T6BA 3VCDA 1U09A 1ZS6A 2QLFB 4ECTA 3BB5A 3G6YA 2YNFB 2FJWA 3ZTOA 2H48B 5A8KA 4FVCA 1HWLA 1ZM3A 4ANCA 1H7XA 2NUUG 5J2NB 3W5ZA 3OLBA 1V6HA 3QGIA 1IKYB 4PYAA 5IXUA 2XZWA 1J5EF 1BE4A 2NCKL 5IT4A 2QMXA 3CCQS 2G0JA 4Q44A 2N7CA 3H2VE 4DL7A 5DS7A 4EK2A 3PR5B 3RAQA 1RA7A 1ZZNA 2VG5B 3IFEA 1U1LA 3K5PA 3G8QA 1N34F 3A3NB 1TKXA 4IR9A 1VQYA 3FBEA 3C16A 1AUDA 4DR5J 2M7SA 1TK0A 3MM5B 3P6YC 1WHWA 1TAQA 2FJEB 4ZVOB 4RUHA 2UV8A 4ZVPB 5B09A 2QRRA 1D8YA 4NI2B 3R9LA 3CCES 5A0YB 2Z58B 2KYXA 2DNPA 2PD1A 1C0TB 4XDCA 2HAFA 5BYQA 1OY8A 1URRA 3OHAA 1RLCL 2A6OA 4KQZA 2ZOFA 2W4CA 1UMJA 2DO0A 1WHVA 4OZ0A 1HNXF 3MUVP 3AXMA 2RU9A 2J7UA 5M2PA 3DYAB 3BJYA 4RLEA 1F9EB 1HYSB 1RISA 5CHCB 2VHGA 5GMDA 4LIWA 3CJ8A 4IFYA 2ABYA 1RTDA 2MB0B 2NYHA 1TR0A 5SUHA 1RWMB 2HS3A 1TELA 5K5MA 2G1DA 1MWZA 1UZHA 2XB2D 2BW2A 2FJVA 1JLQB 1AUSL 2AMCB 2N82B 5CCMA 1B7FA 3MD1A 3CDBA 1CJVB 3LO3A 2HBYB 3C6TB 3QYYA 4C8ZA 2QG9B 2H65B 2ZH6A 2ZM6J 1HHTP 4J9RA 1MWYA 3AQPA 2ERRA 2E1MC 4M5GA 3VAMA 3M8WA 2W4DA 4OX9J 2EFGA 4DFPA 4ZLLA 3HX9A 4LFBF 4DG1A 2DY9A 1U47A 1C0UB 3PKYA 5L9XA 2XTJP 2ZH4A 2HWHA 3GR0A 4NLDA 2MQOA 2ZNZA 1RWPB 2QGFB 1MMDA 4F2SA 4OHXA 4N76A 4R8UB 4KO0B 2HIYA 3FBCA 3QPIA 3HHKA 3FBFA 1T7PA 2BEFA 2ACMA 1BD6A 1UP1A 3GR1A 3SMZA 4C8MA 3TUPA 2KJWA 2Y1IA 3M8RA 2OPRB 3D6HB 4CT8A 3GV8B 2MLXA 3IAM9 1HWKA 2D3OR 1PYSB 4C8NA 4QWBA 3FQKA 1S0VA 4O44A 4EI2A 3TX8A 2H1YA 3JYTB 4ED1A 3UN2A 4WCEQ 2GO8A 2J9EA 1VYAA 4KGVB 4DV2F 4B3SJ 3MFIA 4IR1A 3Q24A 2AZ1A 2JHEA 2F8HA 1VQOS 1X4CA 2JSXA 4DR6F 1FWPA 3QZ8A 2Q1LA 3HFVA 2WCXA 1U25A 2HVEA 2AJQA 2J6SA 5CYJA 4HACA 4Y0FA 3ZTQA 1HBMA 5LXYA 2Z2MA 4LFCJ 5I42B 4PXCA 3M1VB 1CEZA 3TA0A 1AXQA 3VGVA 1DURA 3N4WA 1R8HA 1ZTWA 1S1UA 4F02A 3UDEA 3TARA 3NP5A 4J9UE 1HQEA 4N56A 2IBOA 3L7OA 2FLOA 3NCPA 1SKUB 1SC1B 2H54B 1YRXA 2V8GA 2YKNB 1CPZA 3QQCD 3D0IE 3DRSB 2A1BA 4JV1A 2ATLA 3T41A 2CIMA 1N32J 2DISA 5BXIA 1HBUA 4KV8A 3KK3B 1Z2LA 1B3TA 3JS9A 3DGVA 1NNDA 3MCNA 2O66A 2N3OA 3AB2B 2ZH5A 1NKCA 2X1GA 8AT1B 4WE1B 4K5RA 1YHQS 3DDNA 1RCXB 3HHEA 4UF4A 2OEKA 6AT1B 5C5JA 1CJUA 5B0DA 3C8YA 1Q4RA 1WC4A 1SV5B 4B9TA 1L3SA 3NOCA 3TVYA 2J9CA 3TX0A 4F4WA 2ASLA 2DR8A 2MQ8A 3KXDA 4OYBA 4Y2AA 1F1BB 4CLSA 1PJ7A 3MEGB 2GZOA 5BJRA 3TAMB 3KKFA 2HHVA 4BCAA 4WKYA 1SXLA 3JAMY 3WDOA 2YWGA 4P2FA 2DIUA 3M32A 4M5HA 1P6TA 4WJBA 4HR2A 4CNZA 5KFYA 3VALA 3GZ7A 4TN2A 2O01C 4LF6J 4ZCMA 4F0KA 5HQLA 3TANA 2FLNA 4MFBB 4R25A 4CLPA 1QVGR 3EE3A 2AGOA 2X3DA 3P5BP 2B7CB 1RACB 3NG8A 3AOAA 4XPCA 4QZVB 4DL2A 3OL9A 1JMTA 3PEJA 1LW0A 5HLFB 2ZZTA 2CAJA 2IJRA 1F6TA
chains in the Genus database with same CATH topology
1YGYA 4TU8A 2BQ3A 1YITS 4ZPAA 3CJKB 5LSRA 5KG7A 4KIAA 1UKUA 1VC0A 4JI4F 4B9SA 2W7PA 1U6FA 3FEXB 3GMGA 1HNIA 1JLAA 3AJ2A 3MM9A 4DLGA 2VFVA 4HDGA 1QLNA 2ZUGA 2NUHA 3I32A 4UOCA 1KD1T 2RKIB 3CCTA 3WX4A 3PHEA 2KT2A 3CC4S 3CDEA 4YB6A 2N7YA 1S76D 1TL4A 4RW9B 4E98A 3IG1A 3M6UA 4Q43A 4RBTA 3CTRA 1FXLA 3GIKA 4DL0C 4RNNA 1S9GB 2ZH1A 1KQSR 4OX6A 1GXUA 4KSEB 4ZPDA 2QSWA 2LCWA 2A3JA 3MD3A 1XMQF 3RYLA 2V4JA 3KLEB 4W90B 1RT7B 2LXUA 3TYTA 3ZZRA 2RRAA 1FDAA 1FO1A 5HLFA 3M2VA 4X4RA 3SZ2A 2DNHA 2M8DB 1K73T 1JJ4A 2C3OA 3ITHA 1X5SA 4YB5A 4DV1F 4LF4F 4HH0A 1N48A 3D1QA 4TY8B 3RRHA 3K5OA 4N8OA 1UJ6A 4URSA 1M5SA 2DHGA 4YEAA 3DXBA 3CJKA 4A8QA 3RW6A 2CQIA 1VS3A 4ES2A 2GGPB 2JEJA 2AQ4A 2AYGA 2R7QA 2VPZB 3GV7B 4KE5A 3MFHA 3FMWA 3V6HA 2RKIA 4HEA9 4BBYA 2MZSA 3DDKA 1VBXA 3G96A 3LALA 3T9ZA 1NK7A 1YJRA 4X4SA 3IS9B 3FCHA 1TKZB 4X2BA 2KT3A 4RW9A 2CQ1A 2JC0A 1SJ4P 1Y9OA 1OPZA 1S0MA 2GV1A 3UWTA 4AE5A 4USIA 2FTRA 5FD1A 1S9GA 2VG6B 1RKJA 2MPUA 3UD4P 4JI7F 2N4DA 2L3MA 3CIZA 1DQ9A 5EWFA 1H7WA 3I0SB 3KLEA 2Q66A 4K4VA 3TRGA 3DOLB 3UD3P 2FHOB 4MJKA 2CKWA 1YIJS 2ZDPA 4UQTA 4RNHA 5F8JA 4ICLB 3PW0A 4DN9A 3RB6A 1S1XB 2G4BA 2XWYA 2WSEC 5KT5A 3VAJA 2AWZA 4Y2IA 4OX7A 1S9EB 4TY8A 4EWTA 5KG3A 3FMBA 2AD9A 4J9PA 3CCSS 5SZTA 2RVJA 4J9OA 5J2NA 2MZQA 1QAXA 5EN1A 1FE4A 1K0VA 2MDAA 4DQIA 4AUKA 3CCUS 1LWCA 5A8WB 4K4ZA 1D8ZA 3CDWA 3PKMA 4QYRA 1RTJB 4JI2F 1HD0A 3IS9A 2IM1A 1TKZA 1WF2A 2IJNA 1M5PC 2UVVA 4K4UA 2IMOA 2B9WA 1MSWD 2VC1A 5DQHA 2MYFA 2GHVC 1LK7A 5FJ4A 4OHZA 5GADI 3NMRA 2M2BA 1Q78A 3M2RB 4ALZA 2BR0A 2UXCF 3ZZUA 2VG6A 2MZ1A 3PY8A 1LV5A 1QJHA 2P5VA 3VAHA 3GIIA 2Z8QA 3M6VA 5DRKA 2NREA 4PQUB 2RQ4A 4QWEA 3AA8A 3I0SA 3RRGA 2JL9A 4O3RA 2VFTA 3CSKA 3DOLA 4YB1P 1SL0A 3BSOA 2E1CA 1GH8A 3OVSA 3NAIA 4ES1A 1X9SA 5JVGQ 4N41A 4PQAA 4RKUC 5F9NA 4IRKA 4WF9Q 2OIHA 4ZA1A 2Q43A 3NL0A 2DNGA 3CO9A 4QPTA 4DX8H 3ENQA 1S1XA 1URNA 5T7LB 3CC2S 2FY1A 3E8OA 5IZHA 5DG8A 1ZYQA 1S9EA 5C24B 4OJ3A 2YNHB 4RW4A 1NEEA 3L7PA 2BOPA 2WW8A 2FB0A 1RTHA 3V6KA 2LEBA 1XNQF 3KK1B 4B08A 3QO9B 1OIAA 2KFNA 1QSSA 4CNYA 1C4AA 3QAEA 4OI3A 2R7OA 5JJBA 4AQYF 5A8WA 3SCKE 5GAEI 1U1NA 1NH8A 4C0HA 2DRAA 3TR5A 3LPYA 2IBKA 1RTJA 5JVHQ 5GADU 3CD7A 4QW9A 3VAIA 1N36F 1XWLA 2VG7B 3S1TA 4FPRA 2UUCF 2HHTA 4PCQA 4C7QA 2XI2A 2CPEA 2WB4A 4LQ3A 4GO5X 1VQ6S 4I6YA 5IT0A 3GYXB 3OTCA 1X5PA 1WTBA 3M2RA 3OL6A 2ZVSA 2XS5A 2EC0A 2Q79A 2EKYA 4DFJA 4PQUA 3NGKA 2YKOA 5H9FJ 4WZQA 2OSQA 1GX5A 3MGJA 3K5LA 4DFKA 3MM6B 2EFPA 2W9AA 3CMAS 3FEYB 2VASA 4HI2A 4PG5A 3LQVA 4F4XA 1FXRA 4F50A 4F4KA 2ZHBA 4MIAA 4LF7F 2UXDF 3J7YI 2AJ1A 3CIMA 5DJBA 1OSCA 5G4DA 5T7LA 1KQFB 1NK6A 4Q2MA 5C24A 2HS4A 4FNHA 2YNHA 1CQMA 1F5AA 2CQGA 5C42B 4DR5F 2W7AA 2XMKA 3OR2B 2MKCA 5GAEU 2PMZD 2ZD1B 2VKZG 5B0FA 2C2EA 3QO9A 2PE8A 1RT4B 1Q81T 3N6NA 4N77A 4C0BA 1RK8A 1TKDA 3NRBA 5DDOC 4ILRA 3ZFVA 1NKBA 4J9NA 5E7OB 1S6UA 4QWDA 2WBMA 3CF5Q 1SL1A 2JJ4D 3IGVA 3EZ5A 2XSFA 2VC0A 5KFBA 5EUHA 2ZBCA 4U67Q 1QE1B 2BA9A 4WFYA 3U1MA 2VG7A 5DQIA 4EZ9A 2QE5A 3Q2SC 1RT2B 3V81B 2OSRA 1A9NB 4HVZA 1DQAA 4A8XA 2AP6A 1F2GA 4ZPCA 4PG7A 4FXDA 1N5SA 1JKHB 2AJFE 3KOAA 5KTQA 2WONB 1NKEA 2R8KA 4QIFA 1JLQA 2CQPA 4IO1A 3HT3A 1WHYA 3H4BA 5IT9Y 2MJUA 4Z37A 3H40A 1B0PA 3LP0B 3MM6A 1FKPB 1WF1A 1SBRA 3PZPA 5KFKA 1I1GA 1KTQA 3GSDA 3HVTB 3KJVB 3A8EA 1N52B 1P8GA 2VD3A 4X84A 4O0IA 3KLGB 1FNXH 1GNKA 4NOHA 1GX6A 2VB6A 1XMOF 3HHLD 4F4YA 5A6PA 4C98A 1CVJA 1YVFA 2V9KA 1DTQB 1H3DA 2FHJA 2LQJA 2BACA 3LP1A 4A48A 1BY9A 4NA2A 3HPOA 5C42A 2DBBA 3VZHA 4YQWA 3OR2A 2DGVA 2BANB 3PIOQ 4I6WA 2ZD1A 5F8NA 1D9FA 4O3PA 3I4PA 1RT4A 2WHOA 2XCPA 2V4RA 1Z1ZA 4I64A 2CJAA 3PX4A 4O4GB 2CPJA 3R27A 2IA0A 3PRBA 4Y28C 5HQ8A 1SKSA 3T3FA 3PO4A 2E5HA 4DUYF 1G1XA 2J9DA 4Q5VA 3ZZZA 4URQU 4IH6A 1FNMA 1IJEB 3UCUP 1U7LA 2KYZA 4OI6A 4TKTA 3D5MA 4MK9A 5B7WA 1RT2A 3MAQA 4RW8B 1LOUA 4C3MA 3V81A 4DFMA 2KFZA 2YNGB 4JI8F 3DNCA 4JI0F 4NXNF 3CCWA 2A10A 1SQEA 5HP1B 2VODA 2MQQA 3HKZD 2W25A 4CH7A 3J7Z5 1DZ5A 2OPSB 3KNAA 4NWBA 2WONA 4J9MA 1YJWS 3PIPQ 1P1TA 2HZCA 4RW7B 4AL7A 1KHWA 4RWWA 3LP0A 4PR6A 1FKPA 2RF2B 2OO4A 2CPDA 2DNRA 5D8HB 3HDSA 4ED5A 3HVTA 3KJVA 1S97A 3N0VA 3OUYB 1LW2B 1A6LA 4ZDNA 3KLGA 2RMLA 1U1PA 3F56A 1GT8A 3IN5A 3G8SA 3KHHA 4DMZA 5L1JA 1IM4A 2M88A 4GKKF 4K2XA 3TP2A 1X5OA 2AGQA 1MROB 4HT7A 1OO0B 2HS0A 2IM0A 4CI0B 3G6XA 4Z2XA 4I69A 4OX8A 2OJ3A 1H2UX 1G6BA 2E5IA 1BGXT 3IR7B 1U6ZA 4QW8A 3HHNB 3L95X 4Y2MA 1VK8A 2W8LA 1MU2A 1UFLA 3MOZA 4O4GA 2I38A 1HI8A 2Y0SD 5CH7B 5DG7A 3SYZA 4ZP8A 3HHDA 3UI3A 1DRZA 3BQ1A 5E33A 3CVKA 3MURP 5E3AA 2MGZB 2XY5A 2FIUA 2WSFC 3UDLA 2YWKA 4RW8A 2EK1A 1TL5A 3H59A 1BLUA 4NCGB 2PN6A 3NS5A 2CQBA 4ECUA 1TK8A 1H98A 4A8FA 5DM6Q 3BO4A 5HP1A 4RNMA 2XO7A 1VQLS 2HHPA 3FDSA 4A46A 5KT4A 3Q8RB 1ZTTA 3KLIB 2OPSA 2CQ4A 2R8JA 2ROPA 4E0DA 2XGQA 4ECXA 2IM2A 4DHVA 4RW7A 3CD6S 5KFXA 1GTHA 1SL2A 3ENVA 1H6KX 2RF2A 2IAJB 3D28A 4RBVA 2QEXS 1HA1A 2O67A 5F8GA 1YJNS 4RWXA 6FD1A 3OUYA 1LW2A 3G8TA 4ED0A 3R1HA 5K8PA 3TOQA 1VHFA 4OI2A 5KFZA 4YDXA 4PUOA 1EETB 3OTBA 3MUMP 2B56A 2NS1B 1VFJA 5K14B 4F3MA 3G6ES 1OQ6A 3N01A 1IKVB 2VZ9A 1MROA 3I5CA 4X64F 1QAJA 4ELTA 3NNHA 4IOBA 3SCIE 1WF0A 4QR2A 3PX0A 1TUVA 4V19X 4YHHF 1ZM2A 3CE8A 1JLCB 2YWEA 5J2MB 4FZVA 1S1TB 3OQ2A 5DDQC 4TXSA 3BQ0A 5I3QA 1SKWA 1HHSA 4QOTA 3K59A 2PA3A 1LQ9A 3FVYA 1UWBB 3MR2A 4H4MA 5GAGI 4GC6A 4R0JA 2LMIA 2PEHA 2MGZA 1KLMB 1SJQA 5DDRC 2IRXA 2F4VF 3BGRB 4NCGA 2IHR1 2VA2A 1M5VC 4X4UA 2CPYA 4JOUA 5HL7Q 2LQBA 5KFDA 1NH7A 4DQQA 2E5LF 1X0FA 1N8RT 3KLIA 4GMKA 2JLGA 2NSBA 1Z4UA 1Y7PA 5D77A 3CCZA 2ADBA 4W92B 2P9EA 1QSLA 2GO9A 5K8NA 4JV5F 4M1KA 2IC3B 2RE1A 4K5SA 4CT9A 4F4ZA 2YX4A 2IAJA 2PFFB 3M1VA 1XR7A 2B9XA 4C8OA 5M2RA 3DLGB 1K1SA 4OZ5A 2V0NA 3TVKA 1UVJA 4TLRA 3Q8QB 3MUTP 5FDLB 4EBCA 1EETA 1C1CB 4K59A 5K14A 4ED7A 5F9LA 1IKVA 2KXHA 3OLAA 1S6QB 2Q3PA 4NX9A 2O3DA 2QLXA 3PFEA 1HARA 1GQEA 1W25A 1FESA 2CYYA 2P9GA 4NLRA 2FJXA 2FDNA 1H2TZ 1JLCA 2LU2A 1FTCA 1WHXA 2DGTA 5GAGU 5J2MA 1S1TA 1TQLA 2A2DA 3H5UA 3OTDA 4M63A 4NLUA 3CXCR 2KZZA 1ZPVA 2CPZA 3B82A 2HHXA 4KGMA 1F5BA 1VRTB 3LUYA 1VQMS 1UWBA 1X4GA 2QA4G 1U1QA 2GA7A 3HO1A 2HRUA 2ZBIA 3QLHB 1KLMA 2J0SD 4EEYA 4ZPTR 3BGRA 4ZMMA 3RAMA 2CQCA 3MECB 4RUAA 4DV5F 3T1HF 2XY7A 4JI1F 1XR5A 1ZBTA 3W2WB 4AXIA 3EZUA 3CMES 3K57A 2CJBA 1WELA 1HD1A 3DRSA 2E5GA 3K5MA 4JBCA 1U1OA 4ID8A 2IC3A 1VLYA 4CO5A 4LFCF 1T3NA 2CPHA 1JX4A 2NYIA 1FDBA 4D3HA 4CIOA 1DQ8A 1LWEB 1S10A 4DQPA 2B9YA 1FEEA 1S4FA 2MKHA 5FDLA 3M8PB 1C1CA 1ZM4A 2MZTA 4NYZA 2JX2A 2BE2B 3CUNA 1WEXA 2WRMA 3OJSA 2XSJB 1S6QA 4ZCIA 1TAUA 1HI1A 2AX0A 4CH1A 4ILMA 1NRKA 3CJ5A 1YG0A 3NBPB 2ROGA 2K7KA 3MMBB 4G6VB 4WXWA 3UPFA 5KFTA 4FNIA 4KKOB 1S6OA 1RT6B 3DU5A 2C3MA 1NJZA 3DHXA 1GTEA 1OSDA 1VRTA 5L1KA 2OD6A 4KB7A 4U7CA 2D74B 4DR7F 2JFKA 1X0PA 3QLHA 3UQSA 4XO0A 5J1EA 1R89A 3P96A 1P1LA 2I5JB 3AHPA 1Q79A 4E8UA 5IQ6A 5A2QY 3MECA 1N5YB 3C3LA 2DCUB 2KKHA 3TO8A 1JWWA 4CO3A 1FTRA 3SV3A 3W2WA 3H5SA 2WBRA 3J7ZT 6FDRA 2KH9A 3P49B 2HVIA 1KVIA 2B6AB 5D4LA 4MTPA 2BQUA 2UVUA 4FXVA 4KFBB 2B5JB 2F3JA 2K3IA 4RU9A 4LF5F 4C97A 3S01A 2FVSA 1K0TA 1LWEA 2YKQA 3MI7X 3PR4A 3M8PA 1S48A 1KVJA 3QJPA 1BQXA 3D1OA 2BE2A 2CQDA 4B9NA 1BQMB 2EVZA 2ZJPQ 1Y3KA 3B4MA 4QJVA 4NLTA 2VA3A 1WEZA 1MW7A 3IRXB 3NBPA 3F44A 3I56S 3T5LA 2DH8A 3KMQA 4EO6A 5J2QB 4OFZA 4KKOA 4F25A 3MEGA 1RWUA 1V3ZA 4QU7A 3MPVA 2KO1A 1F60B 5KFLA 1D9DA 2EG2A 2POKA 3GFHA 3M2UB 4H4OB 3CB4A 1SH0A 2PMHA 3DRPB 1FVSA 5F8LA 2CVEA 4IYQA 3CEDA 2ACYA 1N5YA 1VBYA 5D4OA 1UA1A 1APSA 2P9CA 2FVPA 2PI5A 2NXUA 1IJFB 1HMVB 1KNZA 5LSOA 3BO2A 3VR1A 2OFHX 1RT1A 1TK5A 4NRTA 4ED8A 1Y5NB 4LSNB 2DTJA 1XN9A 1N5TA 2B6AA 2LA6A 2VUGA 3HF5A 1CLFA 3W2VB 4KFBA 2B5JA 2G0CA 3QWUA 4QQBA 3AH6A 2VOPA 4XAKA 3AJ1A 3THTA 5LXRA 4HKQA 2OAUA 3HK2A 2RILA 3BO3A 1RA6A 1SJRA 4MFBA 1FJEB 2QMWA 4FN5A 3PEHA 5EX0A 4L3NA 4ECVA 3E01B 1PC5A 4OJ1A 3T5KA 1BQMA 2JH3A 1UJ5A 1TP7A 2WSCC 3O3LA 3BN7A 1WNEA 3SDEB 3R1LA 3MF5A 2WOMB 3IRXA 1FK9B 4C8YA 5HI7A 1DLOB 4YY3F 5J2QA 1KN6A 1ZAVA 4QWCA 2F8EX 5U47A 1FXDA 3BGUA 1U24A 1XTZA 5B0GA 2HG4A 1TL3B 5KFWA 3PVXA 1Y5LB 2UP1A 4L72B 1VMBA 4ECZA 2X1FA 3W3SA 5K9FA 2C3UA 2XWXA 3LWMA 2XHWA 4C4WA 2UVWA 3OXGA 2DNNA 3M2UA 3DI6B 4H4OA 3G9CA 2XY6A 3DRPA 1FCAA 3BEGB 4EBDA 5KFSA 1KS2A 3IWLA 3SFUA 3WC0A 5KG2A 2JWNA 2ZH8A 4G1PA 3POTB 2LEAA 5BYSA 1HMVA 4DQSA 1M1KT 3M6WA 2HNDB 5CA5A 1X4HA 2UU9F 1P9QC 2ZHOA 4LSNA 4J9QA 1NHUA 4ERDA 1IBKF 2BUNA 5EDWA 3KG0A 4B3OB 1W2BR 2HWTA 1XMBA 3W2VA 3BN4A 2KFYA 4J9KA 2B43A 2OPPB 3IA0A 3IR6B 2W4PA 1PO6A 3OL8A 3E01A 3OR1B 5AJ3F 2CPIA 4QBUA 2PC6A 3SDEA 1TVRB 2WOMA 1FK9A 3CD0A 4ZP6A 1FKOB 3IC1A 4EO8A 1BC6A 1DLOA 4LT6A 4YMEA 1U48A 5KFQA 1JXEA 4QIVA 3IAS9 3ULHA 3I9ZA 1TL3A 1Y00A 1O51A 1Y3JA 4NLYA 1RT7A 2E1AA 3IRWP 2OP5A 2ZZNA 2GIQA 3OXFA 1T02A 4LF8F