5AXLA

Crystal structure of thg1 like protein (tlp) with gtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
221
Chain Sequence
TREIYAEMRCIPPVVLRADGRNFKNTLSGLGFEKPYDKTFARAMADTAELFIKKSGLSPLFAYTFSDEISFLFTDLPFDGRVEKIDSVVASFLGSALTIKLRLEEPIAFDSRLVALQKEEIPEYFHRRQLEAWRNFVASWGYYALRNEGMGRNEAAKYLKRKKESEIHEMLFERGINLATLPSWQRRGVIISKEARKITQNWEIPKFKSEKGIPFLEKLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA(His)-5'-guanylyltransferase (Thg1) like protein
publication title Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein
pubmed doi rcsb
source organism Methanosarcina acetivorans
total genus 64
structure length 221
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5axlA00
3OTEA 5AXKA 4KGKA 5AXLA 4KGMA 3WC0A 5AXNA 3WC2A 3OTDA 3OTCA 3WBZA 3OTBA 5AXMA
chains in the Genus database with same CATH superfamily
2QSFA 1C0TA 4DF4A 1ZM2A 3T41A 1H7WA 4NLPA 2E1MC 4AUKA 5MLCV 2M70A 2BANA 1NHVA 3MR3A 3BB5A 1N88A 2E9TA 2FVQA 2LQ9A 3FNNA 4OJ3A 1RAJA 2HSEB 2KKHA 3QWUA 2V8DA 3KFWX 3MM5A 3W1YC 1Y11A 4G1QB 1HIYA 3BEGB 2RQ4A 3VAHA 2MPUA 1U49A 4DL5A 4RW9B 2EG2A 4KHPF 3N5BA 2V63A 1UPMB 2YH0A 2HNYA 2Q66A 2VKRA 3PACA 2OLWA 3QSYB 3OUYA 4I4BA 2LA6A 3IRWP 4ZVHA 3OTBA 3UNGC 3CD6S 2NXNA 3WIVA 4CLWA 4DV1J 2RT3A 1Q0NA 1H2UX 5KFSA 3K57A 2D3O1 1RT7A 2E7VA 2F9JA 1VLYA 3ZZTA 4M95A 3MD1A 3TAQA 1RSCA 3JXOA 4MKAA 1HNZJ 2V4JB 1WELA 2DR9A 3CC7S 3QBCA 2GQCA 2JVRA 2POKA 1TZ0A 2BE9B 3PRBA 2V69A 2IBOA 1S57A 4WTOB 2EI5A 2O01C 4KQZA 3POTA 5KFGA 4K2JA 3T6BA 3PX6A 2RD5C 4R8UA 2V50A 1CEZA 2WK4A 2HVZA 2KM8B 3VZIA 1HPZA 3G71S 2AX0A 1NSPA 2J7UA 1MWQA 4OHVA 3FUYA 2KZMA 1NU4A 3FFIA 4B3RF 3PY8A 3LA0A 3DOLB 1HBNB 1S1XA 1NKCA 3QRQA 3H98A 3AQPA 4I2PB 3CCUS 4U7CA 3TVYA 2B6AB 2ASYA 3CMAS 1F2HA 4DV7F 1YHQS 4CO5A 2GHPA 4QYZK 1JQGA 3BKUA 4LF6F 2DR6A 2CZVC 1T0TV 5HROA 3D6HB 3ZO7A 4MYTA 1T7PA 1NJZA 5HP1A 1FVSA 4B9TA 1YBTA 1SBRA 2M2BA 3DXBA 2XMVA 4WKRA 4IQMA 4EBCA 3LP1B 3UW1A 3H5YA 4C3MA 3PDNA 1VQ5S 2YNHA 3KYLA 3P49B 2UUWA 1BQNB 1JLAB 1RUSA 1HW8A 4P7VA 2YWFA 5KG5A 2G4BA 2HNDB 3CWJA 4JV1A 3T1HF 1YJNS 2CPZA 5I42A 1S6QB 2RU9A 3TX8A 2EC0A 4BC7A 4FPIA 2E1AA 1WF1A 3CCZA 4JI6J 3NGSA 3LP0B 2Y9HA 1HNIB 5IV3A 4YFUA 4UOHA 3PCOB 3GV7B 1L3SA 1N34F 3MFHA 1FXRA 4KGKA 4M5GA 2W2MP 1JLEB 1D3WA 4ZVUB 3GLJA 1DFDA 4F0MA 5H9FK 4DI6A 3K59A 1HWJA 2Z58B 2VBWA 2OIHA 3DGPB 4WFBQ 1VC6A 4B3MF 1F6TA 5D78A 3DU5A 2QMUB 1ITPA 1HWUA 2QFIA 1N32J 1UEUA 3Q83A 2WBRA 1AXQA 3FRYA 3DRPB 3I32A 1FDAA 2BQUA 2O66A 1P9QC 3TOQA 4F7VA 5LT5A 4ED1A 4TXSA 2ZJRQ 2BJ9A 4YB5A 1W25A 2H48B 3DFEA 3T1AA 4OZLA 4CO4A 5J1EA 1JLBA 1S7HA 3CIZA 1TMJA 3GR0A 4OHXA 1GMWD 1FRLA 2E29A 2CQHA 4XTTA 2OH2A 4AQYJ 1LKZA 4HL9A 1S59A 2CDQA 2P9EA 4QYRA 1IUJA 1T9TA 2ADCA 1NMEB 5D0EA 5DZ6A 4A8WA 1VJWA 1KRPA 2KXHA 3D4JA 2MY7A 1ZBTA 1NAQA 3DM2B 4WK1A 1U24A 4J91A 2XGQA 2QT7A 3X1LB 1LWEB 1PSDA 1RHMB 4ECVA 1K8AT 4YDXA 1MU2B 2R8HA 1NJWA 4GKJF 4ELVA 5D4LA 4NMLA 3KNGA 3VAMA 1HNVB 3BQ2A 2EBEA 2OPSA 1VQOS 4YY3J 1ZPVA 5KT5A 2QGFB 1X4AA 1Q86T 5LSOA 2UVVA 6FD1A 4F4KA 5KG7A 2XCPA 4QIVA 2XMUA 3RB3A 3J7AN 3TUIC 1CLFA 3BSNA 3LWMA 3A8KA 5KT7A 3DHWC 4KJIA 1KBRA 1Q7YT 4ZN3A 3W2WA 3PKMA 1LWFA 2VOOA 1U2CA 2FZCB 3N01A 2KXFA 3ZTQA 1RISA 3IGVA 1T05B 2HMIA 1PIEA 1P1TA 4RJVA 4I6YA 2YQ3A 4U67Q 1T11A 2UZAA 4QJVA 1H38A 5CABA 4OX9J 3MPWA 3N6LA 3DLEA 3OXFA 2MKKA 4TQRA 4IH6A 1B7YB 2B9EA 3AD8C 1V6HA 1BMQB 5ETPA 1WDDA 1VRUA 3MECA 2CG4A 2Y3YA 2ZDPA 2YNIA 5HBMB 2QSWA 3ZZPA 4ENOA 3VHQA 4WBFA 4F36A 2R3VA 3UWTA 3VAKA 1SQEA 2F4FA 3QT8A 4Y28C 3QGGA 2IM2A 1S79A 5F0UA 1HYSA 3MPVA 2HHQA 1WORA 1IXKA 3W64A 1VC5A 5DETA 3TQEA 4ECXA 2UXCF 1JX4A 4RZRA 2LU1A 5HSPA 3A8JA 3GIRA 4HACB 1SKRA 2DH8A 1U1PA 3GONA 3ITHA 3TAMA 2W4CA 1S0OA 1CSJA 4F4ZA 2EW9A 2HS3A 2IAJA 2F5GA 2IDLA 3VAFA 3CCMS 2C3PA 4KGXB 5D0HA 1QVGR 2W9BA 4DL0C 1VJQA 4LFAF 2HGMA 1U8SA 2DBBA 4NYOA 4RWXA 3ZTOA 2GHWA 2BW2A 2DHAA 4J9VA 2KO1A 3AOCA 4EBDA 2W8KA 1WNEA 4DFMA 1OQ3A 4DZDA 1UCNA 3IBWA 1NK6A 1RHUB 1AT1B 4JI3F 2DRAA 4TY8A 1TR0A 2XZWA 2ZH2A 4ZIVA 4CNYA 4J9UE 4DR6J 4CCHA 2ASDA 3NAHA 1WI8A 1WF0A 2HGNA 3GR1A 2WVCA 4P6QA 3WHIA 1MMLA 2IIHA 1X0FA 3HHLD 3W5YA 3I55S 4ID8A 3UVJA 4PWUA 1WDTA 2IMWP 2G0IA 3BBFA 1RWOB 4DL3A 3OHAA 1RCXB 3H59A 4KGMA 4L3KA 1K1SA 1TVRB 2XWXA 4DFJA 4FBUA 2F4VF 3JQMA 3H7HB 3AJ2A 2WVBA 1JJHA 2W1BA 3MEDB 4O3RA 3DI6A 2C22A 1VS3A 2KFYA 2EFQA 1SC6A 3AB2B 4AFFA 3MM8A 3BSAA 3UD3P 2BM1A 2CVEA 4M5DB 4YHHF 1SJQA 1HLWA 5J2NB 4ICLB 3S7RA 2DHXA 3N0VA 3T5JA 4RKUC 3G8SA 1FF2A 4GVBB 4ZP7A 1OWXA 2AHOB 5DZ7A 4NCAA 1K47A 5LJ3Y 1X4BA 4OZ0A 1DAXA 1N6QB 1C1CA 4C0HA 2BZ2A 4CI0B 3GJQB 3PRVA 4ZMMA 5LSRA 1DHMA 2CFXA 2GAGC 2R2TA 3OR2B 2KT3A 2ZJPQ 3HJVA 3BO2A 1RTDA 1UFLA 3V6HA 4PQUB 3LP2A 2VB6A 2GIFA 3MOZA 4O4GB 1DTTA 2GQQA 4LIWA 2W9CB 3G96A 4ECTA 1RHQB 3PX0A 2P9GA 4O3NA 3D0IE 2B5JA 1AROP 3LUYA 1L5UA 3VR1A 1Y5NB 2ZUAA 1M5SA 3NOCA 3DLBA 1SUQA 3KHHA 2FLLA 1YQHA 4WP3A 4F4WA 4ZVSB 2VG6A 4AL6A 3PFEA 2FTRA 2CKWA 3L9ZA 2XCAA 2ZM6J 1S72S 5KG1A 4FXVA 2RU3A 4BLGA 3QPIA 2NXCA 2JOQA 5GAHI 2QIFA 3GFXA 3Q8UA 3P6YC 1SKWA 1Z1ZA 2W8LA 3G4SS 2DH7A 1FFWB 1PAUB 2ABYA 5E0OA 3QAEA 5DQHA 1RDRA 1ZETA 1S1UA 2HIYA 5KFEA 4ZCLA 1MN7A 2XYHB 2BXJA 3HP6A 3BF4A 1KC8T 3MM9B 2D3ZA 1BXNA 3BKFA 4P2FA 5B0BA 3PJXA 2OHDA 1VQKS 3H4DA 4P73A 3CJQA 4ECYA 4LFBJ 2Y8YA 4OLPA 3F73A 2VBYA 3ONQA 4F4YA 3HFKA 4A8QA 2N3LA 2MJNA 2IJFA 3JQJA 3T5KA 4RO0A 4JBCA 4PKDB 5L9XA 1Z4UA 2BEFA 3AT1B 4ZJLA 3TJ8A 2VIHA 4IRCA 5EWFA 2RKIA 4DR1F 3ENWA 3VQSA 2DIVA 3AD9C 3DU6A 2I8EA 2GJ2A 1P9YA 1Q16B 4Q44A 2ZBRA 2H5JB 4ED6A 2W01A 3ISNC 1JXVA 2PMZD 4MIBA 5I4MA 2WVDA 4O0IA 4LQ3A 3OTOF 1R0AA 1R8BA 1S9EA 3CD7A 3PJWA 5AE3A 3VWSA 1YRUA 3V6KA 2M4MA 4TYBA 4ZVFA 1FD8A 8ATCB 1IJEB 2VDHA 1KKHA 3KK2A 1LOUA 5AE1A 4NLTA 4R25A 3N6MA 3IS9A 3ULHA 1LNQA 1TKZB 3K5NA 4UOGA 1B70B 2OUGA 2RE1A 2FZGB 1PILA 3S01A 5I3UA 2BACA 2J9CA 4FN5A 1Q8BA 2A6MA 5GMEA 3FBCA 1HNWF 2XMWA 4WF9Q 3OT9A 5H9EK 3CJTA 4NYZA 3AA9A 2FHKA 4J9SA 4ECSA 2FVCA 4ED0A 3KK1A 5CYMB 3VGSA 4U96A 1UW9A 2YPZA 2KDOA 2ALYB 2ILYA 4K50A 4ER8A 4IYQA 1QUPA 3NOGA 1TELA 1NRKA 4BHQA 3MOJB 4H54A 1T95A 4A47A 3FJ2A 1R0CB 1LWCA 2FHJA 3M8QB 3BGLA 3KHRA 1SCJB 3NNAA 1R7IA 1Y3KA 2KYXA 4QIWD 1W2IA 4OZ3A 3CO0P 2FY1A 3LTOA 5LJ5Y 3KJVB 5IQ6A 1TFYA 2CNKB 3CTRA 3ZXWA 1PG5B 2GIQA 1PJ6A 4X62J 1TKDA 1SL2A 2ROEA 3TX0A 3B8HA 4LF8J 2XMJA 3HMJG 4IG3B 1UKUA 3BSCA 1Q8KA 2QYCA 1TQLA 2Z56B 4UUXA 1FX4A 4B9NA 2E9ZA 4ZOSA 2BJEA 2BQ3A 3QLHA 2ATCB 5HMYA 1RHRB 2XO6A 4EYHB 1FKOB 1OPIA 1U09A 4PUOA 2PT0A 4LSZB 3TVZA 5L46A 4PWWA 4ZPTR 2V8HA 4P71A 1IKXB 2HKEA 3HSGA 2OFGX 2RQMA 2H9ZA 5E5NA 3DC2A 2KTQA 5KFZA 3RB4A 3SIPB 5IOLA 2VZ9A 3OTEA 5C7PA 5I3QA 1HQEA 4C98A 3MMAA 3D1OA 2IMOA 4KHPJ 4TNOA 4DQQA 1R8PA 2YKNA 1P6TA 2DNKA 3MMBB 4AL7A 3ET6A 2V2ZA 5CA5A 1T03B 4OI2A 4QCLA 5GVQA 1NBEB 3LF0A 2HNZA 5ETKA 2PGCA 1UJ4A 4IOCQ 1LW2B 4UUWA 3W8GA 2XLIA 2OTLS 2B8PA 2P5VA 4MK9A 3NWGA 3J7ZT 3MM7A 5DGBA 1A0OB 2LQ8A 2C42A 2QZ8A 2X3GA 4WCEQ 4CNZA 3FC9A 1C1BA 4Q8FA 4DS4A 4ED7A 3CCQS 1BE4A 4RW8A 3HDSA 3D2WA 2CPHA 3CCTA 2HAIA 2GZOA 3T5HA 1KTQA 4C6AA 3GPAA 2Z8QA 2ZBPA 2H3EB 3UE2A 2HZAA 4AXIA 5GAGI 4NXMF 3BR9A 1J5EJ 2YKOA 2EXUA 2NXEA 1YI2S 2PD1A 1TL5A 1JXLA 4CLKA 3VQTA 1MG7A 3DLKB 2YWHA 1W2BR 4QU6A 2ZBQA 4ES2A 5KFNA 1HBMA 4KHRA 2CZ9A 1FKAF 5IC6B 2I1RA 2J9DA 2YNGA 1OO0B 5E3RA 3SQGA 3GB0A 1NSQA 3SV3A 2HQCA 5CCMA 4USKA 4LF6J 3TJAA 2J5AA 5K5MA 4KTQA 1F5CA 3M32A 2UV8G 4XDCA 1WF2A 3FCVA 3E8OA 3D6FB 4C3KA 2LQJA 3V4IA 1WTFA 4X4RA 1X5TA 4DR4J 1U2FA 2BUNA 4I2QB 1WEYA 1E6YB 3MM6A 3LAMA 2ASJA 1BUXA 5BR8F 1B0VA 4K5SA 1XERA 1JLGB 2QLFB 2I5JA 4WE1A 1S7IA 4DUYF 1LW0B 1CPZA 4C97A 3OJUA 4CLLA 3CEDA 4YB1P 1QD1A 4UZCA 5B0GA 3RB0A 1X4FA 3C2PA 1SXLA 2D9OA 1CJVA 2B7CB 3C6UA 3SSSA 3T1HJ 1PYOB 1PO6A 1NHKL 5E3CA 2D3UA 1HR0F 3I4PA 4IFYB 2YY3A 1EIYB 4RW6B 1U0HB 2NXUA 3M30A 3TW0A 3JSYA 4AYBD 4B3OB 4QWCA 1RT4A 2DRDA 3GIKA 2QX0A 4USWA 3TAPA 3MZIA 3F44A 4NLSA 3NS7B 5HN0A 1N5TA 3CE8A 1I6JA 2VQEJ 1CJTB 3HKZD 5EX0A 4QWDA 1O0PA 1XIQA 2XS7A 1LFWA 3EGWB 2GCFA 1LV5A 1IBCB 3MTJA 2KH9A 4M94A 3KMQA 5HATA 5G0RA 4QU7A 3RTVA 2XO7A 2CAJA 5B09A 2PMWA 2K7JA 2LEBA 1KFSA 4L73A 1C0UB 5C42A 1OSDA 3O1LA 1TKTA 1GAOA 3BN4A 1JIHA 2WAQD 3P3DA 2FC9A 3T6JA 1KDNA 2LKZA 4C9DA 3IG1B 1XMOF 4NRUA 4NXNF 4LF4F 2MHEA 2EK6A 1FDBA 1U02A 2RB7A 4ANCA 2F8EX 3DOKB 4N8NA 3SSQA 2KT2A 4ZKAA 2LXUA 2AEJA 1CJKA 1S0VA 5KT6A 1M5KC 2W4DA 4LF7F 1RP5A 4JI7J 4B3SF 2GVDA 2VG7A 2FJEB 4MJKA 3NXZA 4ZJQA 2AJ1A 4NA3A 2VA3A 1IQZA 3EM1A 1GMVA 3KLIA 4DG1B 1PBUA 2RQCA 3AOAA 1S9FA 4KIAA 1TUWA 4MFBB 4DR3F 2LA4A 3T5LA 2O3DA 4B08A 4KR0B 5FLXY 4GKJJ 1S99A 2N4CA 3BQ1A 2RRNA 4RW7B 1BQMB 2IC3B 5EUHA 3QIDA 3QRRA 3OSNA 4JI1J 4KHMA 1WC5A 5KG0A 3CO9A 1OYDA 3M2UA 4PWDB 1X5PA 5I3PA 4DR2F 1R31A 2RRBA 3RBDA 3IWXA 2G9OA 3GG0A 4BC9A 5GAEI 5D15A 1H72C 5F8MA 1GNKA 5EGYA 5DDOC 2R4FA 3QFHA 2M8DB 4F3MA 4EZ6A 5K8MA 4ECQA 1HMVB 5C25B 5AE2A 2DR7A 1ZYQA 1PYSB 4NA1A 4A8FA 5KFAA 2XBPA 2GJIA 2XULA 1WG1A 2BMBA 1NNDA 3PO4A 4IR9A 5L8RC 4DPYA 3M8SA 4FDFA 2HQ3A 3IO1A 2GHVC 2H65B 4R5PB 1RT3B 2JFKA 1RXOB 3EX7B 2UUBF 1XEZA 4FYWB 1D9FA 3N5FA 4KO0B 1F9HA 1RWUA 3RBZA 2GMHA 4F0HA 4OV1A 5LMNJ 4F0KA 3FQKA 3TP2A 4WJBA 3IR6B 3NY0A 3DRSB 4I69A 2GIRA 1NM2A 3QWPA 2K06A 4F25A 4RBVA 5CZXA 2VHGA 1WOSA 2DTJA 5JVGQ 4XPCA 1N5YB 5KFQA 3BR8A 4USTA 3SXLA 2UXCJ 4KH1B 5HANA 3W65A 2KN4A 2CNOB 4X65F 3V6JA 2JSXA 4Q7AA 1A7GE 1TFWA 4LREA 2B0GA 2OPPA 1CJUA 2MY8A 5T41A 3G9CA 3NLCA 4ANEA 1T02A 1RAAB 2E5HA 4I7FB 2QFJA 1RYRA 1RJJA 4ED4A 1JKHB 3AOBA 4LSNB 2KL8A 1ZS6A 2LFVA 3OLAA 1KNZA 1KVKA 3KG0A 2VQFF 1XMBA 2K1RA 3F56A 1B0PA 4IO1A 3NGRA 2FJDB 3MCOA 1F3VA 3ZZZA 2LEPA 3D9BA 1WKJA 3CJSA 1PAEX 1IJFB 4JI3J 5T7LA 4ES3A 1KVIA 2DPJA 1S9GB 2B4OA 1U1NA 1K0VA 3QMQA 5KFBA 4DR7J 3DRXA 4J9OA 2DNLA 4IDKB 4IO9Q 4HTJA 4B9UA 1TL1B 4USUA 4DPTA 3OVBA 3NS5A 5K8NA 2OPQB 4USIA 3TZZA 5H1SV 4UOFA 5KFIA 3V6DB 4LF5J 2F4VJ 2I0XA 1VRTB 3C8YA 3G82B 3W2VB 4DV2F 1OY8A 2ACYA 5IXUA 4JI4J 1IQTA 4BCAA 1E6VA 4DHVA 5HVHA 2AU0A 1R6VA 2C28A 2Z2MA 1T8EA 3V2UC 2FLNA 3R27A 3I5AA 4K4VA 4WPAA 3QQCD 1IKYB 3BYRA 1QUVA 3CCLS 1ICEB 3Q8VA 2GQ2A 4QPTA 1M1KT 3X3UA 4X66F 2CQBA 4JOUA 1EQ0A 5IM0B 2RAQA 3NRBA 1OMSA 1FK9B 3IP0A 3V4MA 2W7AA 2CPFA 2EFGA 2NREA 4J5OA 2BVZA 3QATA 3KLFB 3I0SB 2H4WB 2E1PA 2K2PA 5C24A 3C6TA 2FC8A 1EJ7L 2DGSA 2KXNB 1NSKL 1MW7A 1KLMB 4OI3A 2IPOB 1YRXA 2ZDOA 1EB0A 3QO9A 1XJWB 3AA8A 3DMJA 4Q43A 1GTEA 3FBFA 1D8YA 1Q8IA 2XMTA 2VG5A 5JXSA 1WC3A 3MEEB 2R7VA 1RTHB 1Y3JA 2ZWOA 3DRRB 4DV4J 3NCPA 4HTIA 2ZNZA 3FEXB 4Q2MA 3MR6A 2KFNA 1B64A 3KJFB 2QA1A 3LGHA 3R5AA 4JI8J 5BYSA 5E41A 2FYXA 1URNA 3D1QA 4ECWA 4HHJA 4FXWA 1GTHA 1RWWB 2E7WA 3BO4A 4LF2A 1BC6A 1XR6A 1N5VA 2A2DA 5IS2A 5DDRC 3HM9A 2WW8A 2NPFA 2N4DA 3RAXA 2Y0SD 1FVQA 1F9FA 2Z57B 3C15B 3JB9k 2OI2A 3G6VA 3FSYA 2NYHA 3L7OA 3HVRA 2MLYA 2XSJB 5IZHA 2YKMB 4U6PA 2ERRA 3CDEA 1I51B 4USHA 1TV6A 3DOMA 4UY8T 2IM3A 2ZH7A 1TAUA 3K5PA 4OYOA 4NYPA 4C2MA 5DO2A 3BGRB 3W61A 4F67A 1U0SA 2LCWA 2MKJA 1H74A 2FY8A 5KT4A 2A0FB 4IH7A 1XR5A 2OD4A 3BM7A 1LXNA 4PXEA 3W8PA 2KRBA 1IVZA 1M5HA 2KJWA 3CCJS 1S10A 4LSLA 2V8VA 2EVZA 3CJKA 3SV4A 4C0BA 2ZH4A 4ELUA 4AL5A 3FGVA 2RVJA 3DRYA 2YWEA 2AF6A 3KUGA 3KG1A 1JLFB 1S1WB 2D7SA 2VD3A 2MLXA 3I96A 4K4UA 2WONA 4DV3J 2CUYA 3PW4A 4KFBA 2Q1LA 4KPYA 3BDEA 1NZ8A 1YGYA 1NK7A 4XO0A 2D9PA 1FTCA 1FKPA 1K44A 2QMWA 2GX8A 1REVA 4C8LA 7AT1B 3O6QA 2PFFB 4USMA 2GFFA 4EO6A 1FRHA 4UT4A 4DU7A 3IBCB 2D1CA 4F26A 2DGTA 2IY5B 3UN3A 3DLGB 3PW7A 3NG8A 3ETMA 1FJGF 3PEHA 4Q8EA 1U25A 1KQSR 2FLPA 3EXYA 1EQMA 1U6FA 4ZCMA 5FJ4A 2BX6A 2MSTA 3C3LA 3P5TL 4AD6A 1RAOA 1TKXB 1RAFB 5AXKA 1DURA 1SL1A 1YDLA 2CPYA 1RT1A 4HHUA 4B3TF 3EGZA 5D0RA 3EVWA 4URSA 2UU9F 1S76D 3EGVA 4DQPA 2ZC4A 3JYTB 5DS7A 2GMLA 3CJ5A 2VFRA 4DJBA 2C2MB 5HJYA 5DDQC 5J2PB 1CS4B 4Y2AA 1ULRA 4ZVEA 4AXJA 4URQU 3O2IA 4F04B 2BRLA 4ZPVR 4UQGA 3NMRA 4FP9A 3W9JA 2OSRA 2NCKL 5A0YB 4DS5A 2XMKA 3OTCA 2ZJQQ 5B7WA 3T9NA 1ZPWX 2BJ1A 4NWBA 4OV6A 4L74A 1A6LA 1EHWA 3NBPB 4DQSA 1V3RA 3I0RB 3MEGB 2P6SA 4ZN1A 2ZD1A 1H98A 4P2MA 3S8SA 2XQCA 2J6UA 3H2UB 5IT0A 2Z30B 4P7TA 3K5OA 4RX6A 1APSA 4AT1B 4PYDA 3SCLE 2A6OA 3KLGA 4DSEA 2FLOA 3MGJA 1GFWB 1EP4B 4CTAB 3QGHA 3TZYA 2JX2A 2XHCA 3M8WA 4ZVTB 2VV5A 3V81B 2ILZA 4ZITA 3HI9A 2NLWA 2MQNA 3HVTA 1EETA 4L6V3 2FB0A 1CQMA 2C2KB 1N5QA 1WWHA 4IRKA 2D74B 3NMAA 3PHTA 3CW2C 1NJIT 2ALZA 4ATNA 3PEJA 2UXDF 2D41A 4I6WA 3VCDA 1NKBA 8RUCA 4IFVB 2IHR1 3J80U 5CYMA 4CLFA 4Q0BB 1UZHA 3PM9A 2DK2A 2QYGA 4GVLA 1IKWA 2MHNA 4KH0B 2GO9A 3ENAA 2VH7A 1UJ5A 4OYMA 5F8IA 4DSLA 3VALA 4WU2A 4NZ7A 3OR1B 5KG4A 4GO5X 3I5BA 3P45B 3SEOA 2BDPA 1IKVB 3M1VA 3MAAA 4J9KA 4LR8A 4BBYA 4V19X 3GIMA 1H3DA 3ZNJ1 4B9VA 3Q2SC 2FDNA 1NB7A 5KFDA 3IR7B 4ZK7M 2VKZG 3ZTPA 2QLBB 5GAHU 2Z2LA 5KFJA 1SH0A 3SDEA 2G1HA 1S0MA 3ILLA 4ZP9A 5J2MA 3UR0A 2PI4A 5CQGA 3E01A 2V4QA 3Q22A 2DY1A 3V5RA 2J7KA 3F0NA 3D28A 3R6GB 3QJJA 2XS5A 3W3SA 4DN0A 3R6LB 3EXCX 2PDAA 5BR8J 2M0GB 3UFCX 4ED5A 3EZOA 2C2DA 1C0TB 1ZAXA 3MF5A 3PYGA 4Y65A 3KJNB 5HLFA 1RTZA 3AHPA 3WC2A 2VFSA 2BANB 1LQ9A 4O44B 2R2UA 5ETNA 2JHEA 5DDPC 1LFPA 2MKHA 3PIOQ 3KWMA 2QLWA 2W2PP 1AUDA 3LWLA 3MM5B 1HR0J 1Q79A 1WC0A 4WXOA 2AJ0A 1N52B 2HS0A 3VZHA 2U1AA 5M2UA 4TVAB 3M6XA 3PHEA 4GKKF 3EDRB 1RB0A 4JI0J 2HNYB 3MEKA 2CPDA 3W7BA 1B99A 1N8RT 3OUYB 5A8KA 3O8WA 3NNHA 5JUMA 3HHNB 4GC7A 5K14A 3GSDA 2AJ2A 5ETTA 2JC1A 1HI8A 3WZ0A 1CC8A 2HQIA 3R1HA 4DR5F 2HLUA 1RT7B 2A1BA 3TRGA 4U7UK 3G6XA 2J8AA 1CQNA 4QBUA 1HL6A 1GQEA 4D3HA 1VYAA 3IFEA 4KV8A 1TL7A 3ZZ0A 4ZCKA 2VU5A 3QJPA 4K8RA 1AFIA 3K5LA 1RHKB 6FDRA 1VQ4S 3BZQA 1N5SA 1Q5VA 3L09A 3G86A 2WZ1A 2C3YA 4L72B 5KFTA 2M88A 1XMOJ 4NL5A 1FE4A 3D3BJ 5CYQA 1DQAA 2IRYA 2NZCA 1PJ7A 4R8UB 2R2SA 3D6MB 2K7KA 3OVSA 2JZ5A 4IG0A 2CQGA 1HPZB 1X4GA 4OYBA 4KRWA 4ANDA 4HDHA 4LF7J 4NCGA 4PQAA 3FFIB 3MCNA 2PA8D 2V8GA 1CULB 2QLJB 4N5SA 1QLNA 1S1XB 1REGX 4PR6A 1JWWA 2COLA 1TL3A 3U1NA 4C8ZA 4ITSA 4J9MA 2MQ8A 4CRJA 3SCIE 1VGYA 1WUUA 3CVKA 3WDOA 2CPJA 4QZVB 1YJRA 5HROB 4FF4A 3UO0A 3SZ2A 1RACB 1IR0A 5KFXA 3JSMA 5HP1B 2RHQB 4ZLLA 4H4KA 2HHVA 2UUAF 1J5OA 5KOWA 3JAMY 3G87A 2WVFA 2UV8A 1M1HA 1MNEA 3IN5A 5A8RA 1JLQA 2YNHB 2XSFA 1VQYA 1BGXT 2HFOA 4DR2J 4HDGA 4F4XA 5HI7A 2DGOA 4M5JA 4CM2A 2CQDA 3PXGa 1QM9A 2DXFA 5IWAF 3GJTB 1BWEA 1NJXA 2NZ4A 1S1TA 1UTAA 5I42B 3G6ES 4LRAA 1HNXJ 1YITS 3C19A 1XR7A 3FEYB 9RUBA 2HGLA 3N28A 2R42A 4ERDA 5SUHA 1QJHA 3EJMA 1H2TZ 3HF5A 3SMZA 3ADAC 4HI1A 3HT3A 2AKWB 1U47A 1ZZFA 2M3DA 2ZUGA 1B0TA 3TR5A 1QAJA 5KFFA 3MR7A 2UUCF 2X1AA 3MTKA 1IBMJ 2BV3A 2CA9A 5LL6d 2P8IA 1D9DA 2ZBIA 5SZTA 1KVJA 1IBKF 1L3TA 5J2QA 4TQSA 3M6WA 1DZ5A 1HBUA 3DKDA 2ZZMA 3MWBA 1M5OC 1Q53A 2QLXA 4TY9A 4A8MP 3MAHA 3AD7C 5HMXA 1S5ZA 4ZVRB 2E5IA 2GS8A 5GAGU 4M8LA 2J0WA 1RLCL 3NGTA 2ZNYA 3ZFVA 3BPDA 5AJ3J 3VVUA 2E5GA 1O51A 4X65J 2M7SA 1FO1A 5K20B 2JRSA 3M8RA 5J1EB 1JLBB 2IA6A 3ZTSA 3TUJC 3H8YA 2OPRA 2PSZA 1RWNB 4RR5A 3A8EA 1FCAA 5KT3A 3GCXP 1WKLA 4CLZA 3EDQB 2VQFJ 2OTJS 5L1IA 3HFZB 5DM6Q 1RA7A 3MFIA 2R8GA 3I9ZA 4B02A 4FS1A 1XNQJ 4DV6F 2I6WA 3P5BP 3TI0A 2AMCB 5M2RA 2KZZA 2QN6B 1HHQA 1CC7A 1EKRA 1WHWA 4YOEA 2LLZA 3OL7A 2AGOA 3E3XA 1Y5LB 3CCES 2AJ4A 3E2EA 1DTQA 2OPSB 2MQPA 1X7VA 4ZA1A 4DN9A 3BREA 1EX8A 3A4TA 2R7QA 4TLQA 3DXSX 2MQLA 4DSJA 3LW5C 2VJVA 1MSWD 4CO0A 2DHHA 2DVIA 4OZ2A 4YUDA 2HVIA 5HAOA 1S6UA 3PG9A 4H4OA 5C2CA 4RNHA 4ECUA 2E44A 1BD6A 3SFUA 2HQFA 5C25A 5DRKA 3MMCA 2HHHF 2HFSA 5KT2A 2DNMA 1NK4A 4KB7A 1OYEA 4DV2J 2MKCA 1LWFB 3G8TA 4C8KA 2HK2A 5CXTA 5D6GA 3RRGA 4Y2IA 3BPSP 4JP8A 3WX4A 2PE8A 5FDLA 3BGUA 5D3GA 2GA7A 3FEZA 4JV5J 2JVOA 2HK3A 2V68A 3HZGA 1X0PA 1U6ZA 1VQSA 3DLEB 2A10A 1W7WA 1GXUA 1VRUB 3MECB 3EVOA 1KSPA 2RMLA 4X66J 2YNIB 1KN6A 4F02A 2XZDB 2VICA 3H40A 4M5KA 1FRIA 1SJ1A 4H4KC 3MPUB 1RCOB 3AQOA 2NPIA 4UQTA 3P8BB 3U27A 2ZHOA 3UQSA 1WOOA 2FZKB 4G3IA 4DL2A 1HBOA 3EMTA 5L1JA 2V2KA 2O67A 3CDUA 3EWGA 3UR3C 4NE9C 1N32F 2HZVA 1HYSB 2WB1D 2FGCA 4PPDA 3H5UA 4I68A 1VI7A 2ZZTA 3KTQA 4OLOA 1I94J 1HKAA 3MUMP 5LXYA 1F1BB 2ZE2A 3J80Y 2RS8A 3ITHB 2FGOA 4CO3A 4C11A 1PBAA 2IAJB 1L3VA 1VQMS 2BW7A 1SKUB 2Q6BA 4FKXA 1TTHB 2W9BB 3FSIA 4DCPB 4L76A 2WW4A 4CYUA 1X9WA 2YWGA 7FDRA 4CH0S 4BWMA 5AXNA 3CJ4A 2RQKA 4LVNP 5HJXA 2G2ZA 1WD6A 1X5SA 3RAMA 1YIJS 3LQVA 3MURP 3TWZA 4C8NA 1V5VA 1FHTA 4ZPCA 4LJMA 4TY8B 3BS9A 2L41A 1IR1A 1X4CA 3HT0A 3ZZUA 4IDKA 2L08A 3BKTA 4FZVA 1LWXA 4EEYA 4ZP6A 1GMWA 1LXJA 5CZVA 1JLCA 1S4FA 4DPXA 2QL9B 3CDAA 5GAEU 1YSJA 1U1KA 2I9SA 5D4NA 3UVJB 2IDEA 1T3NA 3JTOA 1UFKA 2AX1A 4QPXA 1R0BG 3IAM9 1K0TA 1S97A 3HHDA 2AZ1A 2CQIA 1RI7A 5HQ8A 5BYQA 1VFJA 3OJSA 1J2VA 1RTJA 2JWNA 1WEZA 2F8MA 3DI6B 2H54B 5KG6A 4W90B 2XEXA 4YP3A 1IN0A 3MM8B 1S1VA 3NEKA 1TK5A 2IA0A 3FMWA 4OX9F 3UN5A 1FWPA 1SPBP 2DHSA 3NCRA 2F65A 4ILRA 2XLJA 1T3OA 2UXBJ 2YXLA 4NLYA 4OJGA 2YWKA 3IWLA 4O3OA 1C1CB 2RDJA 4LBIA 1KHVA 1R8AA 1XNRJ 1T9VA 4FNHA 2BRKA 3FDSA 1N36F 4BWJA 4RNFA 3BO3A 3K8WA 3KK3B 3LP2B 2BJ8A 2LMIA 2CJBA 1PGZA 1NPRA 1DTTB 3CMES 2KVQE 1N33F 2JNJA 1JJ4A 4EMDA 5LM7E 4B17A 2E9RX 2KG1A 3BYPA 3BBCA 5J1NA 1NO8A 1SQGA 2DKOB 4OI0A 1SUQB 3IGNA 4RW4B 1FJGJ 2C3MA 4Z7CA 1R8HA 5JMNA 2DCLA 4E2FB 4DDFA 1OY9A 4K4YA 2VG6B 3M2VA 2OAUA 3ICLA 1U4BA 3GIIA 3PX4A 4P2XA 4DUZJ 3OL8A 1SJFA 2ROGA 1DLOA 2V6AA 1UEVA 4B3TJ 2XYGB 4USVA 2JEIA 3PO5A 1NCLA 5T14A 4ID5A 3VAJA 4OFZA 1SV5A 2QE5A 5L38A 1P1LA 3H25A 1S1UB 3RZAA 1F0XA 4MKYA 1V3ZA 2B4VA 1OIAA 4RL1A 4CT8A 2C2ZB 1HARA 4DLGA 3CPWR 2BKPA 3LALA 2XI3A 2G13A 2H5EA 2W4PA 5LOQA 4ETXA 4DV5F 4ZLNA 4I67A 3KUHA 4ED3A 4DV0F 2C2EA 5B08A 4YR2A 2J6SA 4NI2A 5A2QU 2OO4A 2OKQA 1ZM4A 3IM9A 2DNGA 1YJ7A 4OJHA 3ELHA 2RKIB 5F8GA 4EU0A 1R43A 2KB2A 4MH8A 2OMOA 2DYAA 4P9SA 1NSAA 3TUZC 2RDDA 1IBLF 1RWVB 5DM7Q 5D4PA 5DLFA 1QY7A 1R0AB 4JUZA 2NSCA 1S9EB 4LUBA 5GADI 2RF2A 4WYWA 2AJQA 2ZVSA 2VDIA 3LPEA 2LQBA 3NP5A 3LANA 3HHLA 2KJVA 2D3OR 3KK2B 3QIPA 3C14A 4DL6A 1TUGB 2LQ5A 3IS9B 3R5JB 5DQIA 4JV2A 1NDPA 2QJ3A 2UXDJ 1RT2A 4ZVQB 5KFLA 4KT0C 5M2PA 2GGPA 2ZFHA 4QOTA 2CQ4A 2VPYB 1FFGB 2ZEJA 4A46A 3KK1B 4XAKA 3TA2A 2E5JA 5AT1B 1RAGB 2HW3A 1VMBA 4NLXA 2Z4PA 4NLVA 2CPXA 3MUTP 2CQ2A 3M9MB 1M0SA 2CQ3A 2CQ1A 1S0NA 1U26A 4ZPBA 1ZM9A 4JI5J 2AGPA 2CWKA 1M1GA 3DDIA 4A8YA 2PA3A 3U02A 4ILMA 4Y34A 2XY5A 4I1TA 3D3CJ 3E51A 2QA4S 4HT7A 3DYAA 2RDIA 4PXBA 2QO3A 2BA9A 2KG0A 1V5IB 3VGUA 1RTIA 1RLDA 4N8OA 4K4ZA 1W26A 5F9LA 1UJ6A 2OFHX 1S49A 3PW5A 2YKPA 2NYIA 4OYAA 3M9OB 2HIQA 3TYTA 1Y7PA 3QLHB 5FLXU 1KP6A 2R8JA 2WOMA 3FBBA 3QT5A 5D0GA 1N4LA 3Q86A 4PUOB 1AA1B 5A0YA 2MKSA 5E7OB 2MLZA 4D3GA 2JFDA 1QE1A 3KLHA 5JVHQ 3L4BC 4ES1A 1YJ9S 1KD1T 6AT1B 1DQ9A 4UTGA 1LK5A 4ZPDA 1Y00A 4LBHA 1G1XA 4Y6IA 4UF4A 1QSYA 4J9PA 2ACMA 1VQ6S 3OFEA 4C7QA 3GWCA 1HQEB 1FTRA 1BY9A 3MMAB 2C2NA 1N48A 4G6VB 3GU0A 2IBKA 2YKNB 2GJFA 4CTAA 4DBQA 3ET6B 2HS4A 4KKOA 3H2VE 3CNQP 2X3DA 1TAQA 3Q8QB 2IJNA 2HNZB 1NDCA 1YWXA 1RT5A 4DX7A 1X60A 2E5LJ 3EE3A 4K0KJ 2LYVA 3IC1A 3W63A 1KEKA 3CMQA 4N76A 1SC1B 4DF8A 1T94A 1CBKA 2VF3A 2W2OP 3BSOA 1Z2LA 3MM7B 1C1BB 4J7CA 3ENVA 3M4XA 3KLEA 1NUEA 4RW8B 1FWKA 3A8IA 2G1DA 1K9MT 1VQLS 2AD9A 2Q79A 1WHXA 1JJ2R 3AJ1A 4EBEA 1NHUA 1YBUA 3O5TB 2B56A 3P96A 1ZTWA 2YNFA 1EARA 2A2CA 5HVGA 3TO8A 4ECRA 1RKJA 4RPFA 2R2RA 4G65A 3C16A 1M90T 1RU2A 2XNRA 4QYZJ 1NK0A 4X64F 3UDVA 3J81j 1HBMB 1X5OA 1QVFR 1UP1A 2FQQB 3R5GA 2YNGB 2MQOA 1SB6A 1XBWA 1UWBB 4ZPAA 2VUGA 3D6TB 1Q78A 3HHLC 4OYIA 2NSBA 1HHSA 1RWMB 3M32B 4YB6A 3V4IB 2EG1A 4A8SA 4JYAJ 4NRTA 2XMAA 2UUAJ 3MM6B 4KBIA 2MZ1A 2HYIB 1PC4A 4WE1B 2I5JB 3FZ2A 4X4VA 4Q5VA 2HVDA 3CULA 3HVWA 3PRDA 4I64A 2Z2ZA 3B82A 2KHCA 1S77D 4DCJB 4O44A 1M5PC 3D7SB 3J7A1 1H6KX 2LVWA 2DXDA 2QEXS 2V0NA 2NXJA 2ZC3A 4XDDA 5IWAJ 2VFVA 1YJUA 1YJVA 1CJVB 3C6UB 2GVZA 4TU7A 2AYGA 4WKYA 1NXIA 5K9FA 3M7VA 4LRBA 3IWNC 1FESA 3DLLQ 5U47A 2JJ4D 2J8SA 3M30B 4DPWA 1B4SA 2H1YA 4KGVB 1MLAA 1WHYA 1VHIA 4RNMA 5H9FJ 1RT4B 3A1YG 2ZHBA 3L7UA 2U2FA 3OFFA 2HFUA 1X4DA 2UUCJ 4WFAQ 2B9XA 2R7TA 1S6PA 3IRXA 3Q24A 4WFYA 3BH7B 1F2GA 1RAEB 2PC6A 4MIWA 1IBKJ 1NB2A 2HHXA 5LMUF 5KFYA 1T9YA 4I56A 5G0RB 5HQMA 1UEKA 3MPDA 1GK8A 1MWZA 4W92B 4Z37A 2ROPA 4X4SA 2FJWA 1MROA 4EFAC 2G0CA 5C42B 5HMWA 4WU3A 1TKTB 1HQUA 1YBAA 1DY3A 3HXMA 4DLEA 2CJAA 2DXEA 2FHOB 1AZSA 4OZ1A 4DWIA 1J5EF 1FT8A 4ZP8A 4NLQA 3R1LA 3OFGA 3J7YI 2JLGA 1P8GA 1CJKB 3EYZA 2OEKA 1CULA 1X9SA 4PXCA 1YVFA 2GVDB 5IC4B 4P10A 1FRMA 2VG7B 5A8WA 3R7BB 3D68A 3OBIA 2DNRA 2HVEA 3KLIB 3UI3A 3ZTRA 5A76A 1FRXA 3CJ3A 4DV6J 1JB0C 1TMMA 4M5MA 3A3OB 1PCAA 4DXLA 4B3RJ 3GIJA 4FBTA 4DR4F 5HK4A 1ZAVA 5E3PA 2BE2A 4EI2A 1TP7A 2CQ0A 1TK8A 2R7UA 2FIUA 3RU0A 1VQ9S 2DJWA 4DV7J 3CC4S 3W62A 3SQOP 3R3TA 5DG8A 1FJ7A 3M2UB 2AZ3A 4G1PA 3VF0B 1YK9A 1VBKA 2ZVIA 4K7QA 1EZZB 1QAIA 1FI4A 2EC2A 1N0UA 2RRAA 2PI5A 1QTNB 4RWWA 2MGZA 1XWLA 2HHHJ 5F8NA 2X7IA 4FVMA 4CIOA 2R7WA 4LRCA 2QA4G 1UAWA 1UVMA 3M05A 3HULA 4NLGA 4QWEA 1YZ6A 2IYGA 1GT8A 5ADZA 1Y9OA 2OEJA 3UCZP 4IKAA 5A2QY 5C5JA 3DLHA 4OYZA 3TZXA 2CDRB 2MZSA 4QIEA 2VQEF 4Y2CA 4G1QA 5KFVA 4X4QA 3RAQA 2AT1B 4RW9A 2BM0A 3GP9A 5IT9Y 3CC2S 4QR1A 2YH1A 5RUBA 3IA0A 2DR8A 2OSQA 1KS2A 1HWLA 1HHTP 2PEBA 2YX7A 2LEAA 1N34J 3H5SA 3PR5B 3FCHA 1KOOA 4LQ9A 3B6BA 1C2PA 2HWHA 4LFCF 1XMQF 2H4YB 2BYCA 2DCUB 2I2YA 3KHLA 1FERA 3TNVA 4HKQA 3CGIA 5K8PA 4TYAA 5DJBA 2OJ3A 3CCVS 2EKNA 2B4PA 2MJUA 2WVEA 2Q43A 4B3MJ 2V4JA 2HHSA 4C8MA 2R8KA 1YJWS 2OPPB 1WG5A 2E1CA 1CJUB 3D67A 2XLKA 3M9NB 4JI7F 2FVSA 3RR7A 1HW9A 1YJTA 5B0FA 2K1RB 4MTPA 1R6YA 2NS1B 1S6OA 2W9AA 3UNYA 3R8YA 4J90A 1QAXA 2C3UA 1V9OA 2WB4A 1RZMA 3UDCA 2MB0B 4P52A 5T7LB 4RBUA 1NDLA 1V3SA 3DOLA 4Y0FA 1HBNA 2VBZA 5C2GA 2WSCC 4I2PA 3THPA 1WJ9A 1WC4A 2KU7A 2B6AA 5FIIA 2AYEA 3HKWA 4JI1F 1IM4A 3IAS9 5F8LA 2CJXB 1URRA 3US5A 1Y0HA 1JXEA 2DO0A 1SL0A 1XQIA 1MMDA 2AP6A 2R7OA 3MPYA 5THWA 3R7NB 2ZH6A 1U7LA 4ILLA 1FX2A 3KDOA 2BKNA 2IM0A 3LP1A 4J9RA 4DQRA 2RS2A 2K8GA 2N3OA 3PYEA 1DQ8A 2CJKA 1BQNA 1JLAA 2PEHA 4TLRA 1E6VB 3QJLA 2DT9A 1VK8A 5J1PA 2HNDA 1G3OA 3GTYX 2KHDA 3LGNA 4LVOP 2B43A 5KAKA 3I9V9 1NZAA 3HSJA 3GG1A 2P2CB 2QA2A 1RWKB 1S6QA 3DCAA 4J9NA 5HO4A 1FE0A 2BJ3A 3OTDA 2I38A 1NDKA 5B0EA 2MQMA 2ZH9A 3LP0A 1HNIA 2XMMA 5EDWA 5LMNF 1U1LA 1N36J 5GMDA 3NGKA 1KQFB 3A12A 4MK7A 4HT5A 4NX9A 2NUUG 2L9NA 1ZM3A 3VAIA 5E3AA 5KG3A 4NEZA 1U48A 1JLEA 3R97A 2MXYA 5C24B 3C6TB 4K2XA 1N33J 4WP8A 4CDIA 3QYYA 4N56A 4NPOA 1H7XA 2XC9A 3ISND 1O6XA 2M52A 2MMYA 4X4UA 1WTBA 3DGPA 3PIPQ 3QO9B 3DMJB 4FNIA 3CD0A 3CB4A 3DRPA 4M63A 2VG5B 4P74A 4X4PA 2DHGA 2CRLA 2LDIA 3AXMA 4CLTA 1VK3A 3HSDA 1DBDA 4YB7A 4QQBA 1WEXA 1NH8A 1Y5IB 4U9RA 1AW0A 4LFAJ 5A6WA 3GJRB 1ZA1B 3OFHA 1VR6A 3K17A 3CUNA 1XC9A 2XYPB 3EICA 4DR7F 4V1Ak 2V8PA 3RW7A 3DM2A 1DARA 2HBZB 1Q81T 3LAKA 3D5MA 3ILJA 4NOHA 1LWEA 2JLFA 4DV5J 4UY85 4DV0J 5LSLA 1MU2A 2C2RA 4LRDA 4R0EA 3B4MA 1O8BA 3RR8A 3K5MA 1TV6B 2Y1JA 2HWIA 2R8IA 2FVPA 4OI1A 1HNVA 3DOMB 3QAUA 5HMZA 5IFMA 4FKYA 3A13A 1FJEB 4LF5F 5IT4A 3MDFA 3NL0A 1X9MA 4U8YA 2W25A 2MKIA 1IBLJ 1WG4A 2W7OA 1GX5A 1U1OA 4JI4F 4C3LA 2JEJA 5CAAA 4A48A 2D69A 1UVJA 2RSQA 1N54B 4LF9F 4M5NA 2EFVA 3KXDA 3NGUA 2KM8C 1OJ4A 3T1YF 5H9EJ 2B9YA 5KFKA 2DH9A 1X4HA 2DB1A 4Y00A 2MZQA 4LSLB 1A9NB 3CJKB 4DPOA 3AJDA 2B3TB 1N56A 1T05A 1FEEA 3ENQA 3SCJE 1S48A 2KYZA 3VGTA 1SC3B 2X1FA 1GXLA 4YHHJ 4OYXA 2VA2A 4QW9A 1RBLA 2FD2A 4FVCA 3KK3A 3EPGA 3K2YA 4K4SA 4K4WA 2V9KA 4Y2MA 1XN9A 2JEFA 4RUCA 4U95A 4IRDA 2ZZNA 1SI9A 2WONB 3UN2A 4KFBB 5HBMA 3TA1A 3DDNA 2DNNA 1FKPB 2HURA 2V34A 1YG0A 1REVB 2B7BB 4S0MA 3GYNA 5AXLA 2V2QA 1RAHB 1WHVA 2BJ7A 4RW4A 1AYEA 1VQ8S 2HBRB 4ECZA 4DFPA 3BBBA 2HG4A 2RJZA 4DV4F 4MIAA 3H20A 4HACA 4BDPA 4CWBA 5ITHA 1S12A 1RAIB 3LPYA 4IQXA 3AB4B 4EZ9A 2F40A 3BGFA 4JI8F 3GYXB 1RT1B 4YS2A 2RILA 1ROFA 3HLUA 4FF1A 3W66A 3SBMA 1TL4A 4IOBA 2LXIA 1UW4A 1Q82T 2A18A 4NLOA 3T19A 3UD5A 3JAMU 4RUBA 5MAOA 4YMEA 2BQRA 4B9SA 2L48A 4NZ6A 1NEEA 2HQDA 3GILA 4QIFA 2VODA 2CNNB 2CPIA 2CWXA 3Q8YA 1D8ZA 2ZD1B 3GMGA 5FD1A 2V2VA 2DIUA 5CD4H 1UA1A 3FKBA 3W5XA 1UVKA 3PYDA 4RBTA 1FFSB 2VOPA 2WSEC 1LEOA 3KLGB 4PRFA 4WIIA 4MYUA 4C4WA 4V19J 4RU2A 3QZ8A 2CXEA 4W4MA 2F7VA 4F3OA 2HLTA 4HYKA 1QAYA 1GH8A 4EK2A 3CT9A 4O23A 1NPPA 1TVRA 3TZWA 4DR1J 3HVTB 4PPZA 2XI2A 1EETB 4LMZA 1UVIA 4PCQA 3JS9A 2IJRA 3OXGA 3MEDA 4ZLJA 2ZKTA 4DEZA 3JTPA 4A8OA 2DNZA 3OTOJ 3N79A 2IM1A 5BJRA 2MTLA 1PKUA 3M8PB 4C0OC 2CQPA 4M5DA 1PC5A 3RRKA 3ETOA 3FBEA 4U8VA 1G4CA 5J2NA 4IR1A 3Q2TC 4ICLA 2FHJD 4DQIA 3D66A 4GVBA 3M8ZA 4ED8A 4DV3F 2F8HA 2B4UA 2HEKA 4QW8A 1IKWB 2GNKA 3QGPA 3VGVA 1N6QA 3TJ9A 3PJ9A 2M8HA 3FVYA 2DITA 3WC0A 1HNWJ 3KG4A 4H4MB 3OR2A 4DZ6A 2B9WA 4FPRA 4QR0A 3M1VB 4FYVB 4LIRA 3AAWB 5E2QA 4GO7X 3MAAB 3CDBA 4PQUA 4X64J 1L3KA 2C3OA 2YX4A 4O4GA 4E8UA 3RJMB 4L3NA 1KONA 2VASA 4DX8H 2W9CA 2WTFA 3D0HE 5DG7A 1JMTA 1VIXA 1AUSL 3SDEB 4PG6A 3NGDA 5J2MB 2L3MA 3A3PB 5KFPA 3N4WA 3E01B 1NK5A 5CCLA 1G2EA 2FJXA 5KTQA 2ASLA 2GAHC 4OX8A 4XPEA 1UVLA 3CD5A 5KFCA 2B8QA 1RADB 1H2VZ 1QSLA 3FK4A 2ATLA 1VBZA 2BJDA 3CF5Q 2WHOA 2ADBA 2ZHAA 4LBPA 2BR0A 2C1EB 5HLFB 4MKVA 2QV6A 1M5VC 3N6NA 4N77A 2CPEA 2N7YA 1H73A 2P6TA 1WC1A 3KMSA 1FNXH 3R5BA 1DRZA 4C48A 3BH6B 2YTCA 2CZ4A 4OHWA 2XZTB 4F4AA 4OZNA 1T9XA 3I5CA 4X4TA 3MM9A 3K8VA 1SJ4P 3OVAA 3UCGA 2L9DA 1Q95G 1FRJA 5GADU 4NEYA 5BYRA 3TA0A 1ZZNA 3HX9A 4P75A 4F2SA 2JEGA 2X1BA 1X31C 2DGWA 2AGQA 1UVNA 5A8KB 2LDYA 4ZHRB 1DJ0A 3FRZA 1KFDA 5K14B 1NK9A 1RWXB 2BBEA 3MCSA 3UDEA 5LXRA 1SH2A 1Y4ZB 5LMUJ 1SIZA 2E66A 3DDKA 4UW2A 1NLKL 4HLBA 2GW8A 3H4BA 3PW2A 2IFXA 2EFNA 3G8QA 3HSZA 5L1KA 3H5XA 2W2QP 3M2RB 4I6AA 2J7WA 3D0GE 3H42A 4KV8B 1WSRA 1TL7B 4A8XA 3Q8RB 2OMLA 4XIUA 1NH7A 5HQLA 1TKZA 2HRYA 3EZUA 2LXFA 3CJ2A 4B9MA 2ZOFA 4QR2A 1RU1A 3NNCA 3MCMA 5CYQB 2PMHA 2HRUA 1NKEA 2HHPA 2HBQB 4IG0B 3CCWA 1OQ6A 1T9UA 2NUHA 2ZH5A 1VDHA 4NCGB 1YX2A 5E3QA 2AV5A 2FVRA 5DG9A 4JV0A 1FRKA 1UWBA 2AQ4A 1TL3B 2VFUA 2FHMA 4NXMJ 2N7CA 2UVRA 3NAIA 4TN2A 3M8QA 1SC4B 1LK7A 4WZQA 2EFPA 1PJ5A 2EKYA 5DLGA 4NA2A 3JSMB 2Z2YB 1RT6B 2O5DA 3KUEA 2HQGA 4MT1A 1J5OB 3SYZA 2DEIA 1HFEL 3KJVA 3T9ZA 4B9LA 2MSSA 3ZZYA 4ZJOA 3HFVA 2V67A 1RHJB 3EVMA 3FSXA 5A8RB 3M8YA 3HD1A 5F9NA 1JLQB 1EKSA 4IG3A 1G6BA 2W7PA 3I4HX 3A3NB 1UFWA 4DUYJ 3HHKA 2M9KA 3H90A 4A4JA 1UMJA 2UP1A 1FKOA 1S1TB 3PTWA 4LT6A 2HFNA 4JI2F 3BJYA 5B0DA 5ETQA 1NPKA 4A8KA 3CXCR 1IKXA 4NZ0A 4FS2A 1FXDA 2MZRA 3VAGA 4P2SA 4JI0F 4K4XA 4WFNQ 1U45A 1CG2A 3HCXA 1JK9B 2P9CA 2WBMA 4W98A 3PR4A 4P72A 3W5ZA 2MDAA 3BV8A 2MYFA 4WIQA 3MMBA 4NMXA 3SCKE 4GMKA 3T3FA 3AXKA 2AIRB 4RNOA 1T03A 4OJ1A 4CLYA 2VC1A 3OD2A 2AW0A 3CIMA 2M5YA 4LF1A 3LOUA 4O3QA 3QFWA 1XTZA 5J2QB 3AY0A 3SSRA 3IBFB 1HBUB 4PG5A 4FYYB 2XGPA 4LFCJ 1FDNA 1XMQJ 1LW2A 2RUSA 2GO8A 1YLXA 5EWEA 3W60A 3RW6A 4ZS6A 4DSKA 3K89A 3J81U 4HH1A 1UZDA 2Q6CA 2MQQA 3DGVA 1ZOTA 1N0VC 2HVHA 4Z2XA 3IMQJ 4PAAA 1Q1KA 3HPOA 4ZLPA 3ZZRA 3HZEA 2OPRB 2KRRA 3TEHB 1F3FA 3OL6A 4NCBA 1T9WA 3TANA 1U1QA 2Y0BB 1D09B 2Q3PA 3JSRA 5ETSA 1GMUA 3POTB 2OEMA 3IM8A 4NXNJ 4QWBA 4LF4J 4FF3A 2OELA 1VC0A 2R7XA 2X1GA 1Q4RA 4ZVOB 1RK8A 3DLKA 4ZVGA 2DNPA 3RRHA 4B3SJ 4ZPWR 4YDDB 4CZCA 5F3ZA 2ZH3A 1HA1A 3VTIA 5D4OA 3W9IA 1DTQB 5GMKa 3EUNA 1RA6A 4O0NA 4KY3A 2OP5A 3THTA 3KLVA 1HWIA 4DPUA 4DR3J 4NLRA 2DGUA 5EX3A 4X4NA 2R7RA 2QG9B 4H4OB 4XK8C 3JSBA 4I2QA 1E6YA 3ISZA 1JLGA 3L3CA 1JNRB 1LW0A 3MMCB 4ZDNA 2EWHA 2DNHA 3OLBA 3QGIA 1HNXF 4F2RA 1QTMA 1HI1A 3TQ1A 2FPHX 3L7PA 4PZVA 2XTJP 5KOXA 4F8RA 2PIIA 4DL7A 4M5IA 5FDLB 5D3GB 2PO4A 4EO8A 2NR0A 3BGOP 3PVXA 3UD4P 1C4CA 1JJCB 4IFYA 4URGA 5CH7B 4RW6A 2RNEA 3K0JA 2HPUA 1U0HA 2F63A 1IBMF 1KR4A 3DLJA 4O3PA 4B3OA 2XWYA 1H0HB 4ELTA 2YVSA 4K5RA 2YKAA 4OZJA 1TUVA 1HBOB 1CJTA 2UUBJ 1VIOA 1GEHA 4UOCA 2DO4A 1GXTA 4YN3B 3R9LA 2Y1IA 4OX6A 3AH6A 3RBXA 5ETVA 3IR5B 1HWKA 4DV1F 4RLEA 2ZBCA 2F3JA 3GSIA 3M6VA 2CG8A 3I82A 5AJ3F 4TU8A 3J7YU 4OYWA 2QTWA 2ZE2B 1ELOA 4C11B 1HNZF 1C0UA 1OS5A 2E7XA 1C4AA 2FUG9 2AWZA 2ZKUA 4N7TA 5G4DA 1KWMA 4Q45A 4CYUB 2F9DA 4J9QA 2BKOA 5IV4A 2F1FA 3P4UB 1SJ3P 4N47A 2YPYA 3IG1A 3MI7X 4CH7A 1J27A 3Q8SB 4OI6A 3CDWA 3D1HA 4OL8A 3QT7A 3DOKA 5F8HA 4M1KA 1XNQF 2ZITA 2DNYA 4DX5A 1HQ2A 4RNNA 2J6TA 1Q5YA 1KQGB 2IRXA 2KFZA 1UL3A 4ZCIA 1OY6A 2Y1RI 2ZH1A 2K3KA 2FJBB 4DG1A 3JQKA 4Y2KA 1JLCB 4MFBA 3KDNA 5ETRA 4OX7A 5KFHA 2Z0GA 4ETZA 3OQ2A 3RG6A 4CT9A 2J0QD 3FZBA 3FQLA 4N41A 4RW7A 3O44A 1BQMA 4F50A 2IC3A 3RBEA 3JTNA 2BE7D 3AFGA 3QSIA 4CLSA 2IYIA 3OL9A 4I0WA 4IOAQ 1IR2A 1Y10A 2EPIA 3BQ0A 4NLWA 3I56S 3PKYA 4ED2A 3Q89A 1EAYC 1RTJB 4PWDA 1IWGA 5CYJA 1RABB 2G2YA 2XB2D 2PFDA 1P27B 1BHNA 3C66A 4EUVA 4LF9J 4GC6A 4JV5F 1S1VB 2RUGA 3T1YJ 1HMVA 3OV7A 4X2BA 4PG4A 4HI2A 2VBXA 2DR5A 2J76E 4OIXA 4PYAA 1X4EA 4DUTA 3W2WB 1U2RA 3WIUA 4HR2A 1U1MA 2E1RA 2CNLB 4JI6F 1KQKA 2HMIB 2J0SD 4RU9A 3M6UA 3VVTA 4NLDA 2G2OA 5EWGA 1I3OB 1VCTA 4F3QA 4R5PA 1BQXA 3QZ7A 1RT3A 2K3IA 3CJRA 2YKQA 2DEJA 4KO0A 3R2CJ 2CIMA 3MAQA 3CSKA 3O3LA 2DRBA 4YEAA 2MEWA 9ATCB 2LECA 3DRSA 1I94F 3MXHP 1GX6A 1O5JA 5KFWA 5KFUA 4G1IA 2H5IB 4KYZA 1SH3A 5CHCB 2EEYA 4PXDA 1N5YA 1FXLA 3C46A 3M2VB 5K8OA 4KPCA 4CQ1A 4DL4A 1WC6A 5DGAA 1K73T 4Z7YA 1DLOB 4KSEB 5ETOA 3TAMB 3OHBA 3EPIA 1YKWA 2HFVA 2RIJA 3LH2S 2CVIA 3OXLA 4I7FA 3I6PA 1JKHA 1WSVA 2W2NP 5L9NA 1WACA 3R2DJ 4ID5B 4LSNA 3RUBL 4R0JA 4AQYF 2J9DE 4FF2A 4WYLA 2EFOA 1SV5B 1FA0A 5EN1A 1SQFA 4DX6A 1FNOA 4KGZB 2XY7A 2FJVA 2PN6A 2YX1A 3KJQB 2UVWA 2Y1LB 1AB8A 1RE1B 2R7SA 1D9AA 1S9GA 1FJCA 3GYGA 4CO1A 2ZWPA 4WXWA 1R8CA 1YZ7A 2XHWA 4NI2B 1I5OB 1NK8A 2BOAA 3DHXA 4OI4A 4O4RA 2CQCA 1TL1A 1OPZA 2VFTA 4YY3F 3QRPA 2OPQA 1L3UA 2SXLA 1FNMA 4LR9A 3Q8PB 1FDDA 1MN9A 2HBYB 2L9WA 3RYLA 2W24A 2RH3A 1U6BA 2AEFA 4Y3CA 3GFHA 2RF2B 4UZBA 3B78A 3PV8A 1YTYA 3V6DA 4DMZA 5EHHA 2OD6A 2YBVA 2AYMA 1VRTA 3Q23A 3HHLB 4MK8A 3G82A 2KI2A 2JH3A 1VQNS 4U7UD 4EWTA 3W2VA 3QIPB 3C14B 2QL7B 2UXBF 1F5BA 2QC3A 4WWSA 1IWAA 3N9UC 5DQGA 2QRRA 1UETA 1VISA 3EZ5A 2IVFB 4BS2A 1RT2B 4ZVPB 1XNRF 1U8WA 4WP9A 2GGPB 2VC0A 1HD1A 3MD3A 2YQ0A 1IKYA 2XNQA 4CH1A 2MZJA 3DNCA 1RBOB 2HRTA 2OGUA 3VV2B 5B0CA 3QNWB 4J37A 1I1GA 5IM0A 3ZZOA 1FK9A 3B4DA 4QWAA 3OW2R 2ZOMA 3HVAA 4C8OA 2AYBA 3KLFA 3I0SA 4M5LA 3J81Y 1UWAA 1RTDB 2IVYA 2AJFE 2DGQA 3UDLA 2JL9A 5CD4A 4TU9A 1Q7LB 2BOPA 2XM3A 5ETLA 1SVDA 1KLMA 1TU0B 3DYAB 4DUZF 2B5JB 1F5AA 3LGMA 1PYTA 3GJSB 4IH5A 1RYSA 4K4TA 1RTIB 4HHHA 1FWLA 2CADA 2G0JA 4EGLA 3U7JA 2EBGA 4CLPA 1RWPB 3NKYA 5F41A 1ZAWA 4DCOB 3MEEA 1RTHA 4FXDA 3DRRA 1VLOA 3R5CA 3QT6A 4KAIA 3G2XA 1B3TA 2GV1A 5HVFA 4MMOA 4WK3A 3K58A 2WOMB 3CJ0A 3ILOA 4E98A 1FD2A 3MR2A 2BABA 2WSFC 3W9HA 2X51A 4PG7A 2VJUA 2UU9J 1HI0P 1QE1B 3KLHB 2DY9A 3GV8B 3FCWA 3CCSS 4ZIWA 3ILIA 3KNAA 1BLUA 5F8JA 3OSPA 3GZ7A 5HL7Q 3I31A 1ZH5A 3WX8A 4OMFG 4DR6F 4AE5A 3R5DA 1F9EB 3GV5B 1WI6A 3C15A 4X84A 2EK1A 4PG8A 5KG2A 2DD8S 1VQPS 2XSJA 1UA0A 2UVUA 1X8DA 4WFZA 2YKMA 3PFOA 2JLEA 4KKOB 3B54A 4HEA9 3RGIA 1RT5B 5BXIA 2XS2A 4LRFA 4K59A 3BGRA 3ZNUA 2YWWA 3DN9A 3GFYA 1QDUB 1KLNA 3HK2A 5L39A 4FYDA 4RUHA 3M8PA 2IVMA 5IT9U 2HZCA 4CLUA 2NQPA 3KLEB 4HVZA 2H51B 5D8HB 2V4RA 2IRUA 1K1QA 2YNFB 1RBAA 5A6PA 2LP4A 2KVIA 2JDJA 2QMXA 5I3UB 4H4MA 1VQ7S 3BDPA 4YQWA 4DU8A 1BWVA 3G6YA 1JLFA 1S1WA 2MKYA 3C16B 3LO3A 3CCRS 7FD1A 4O3SA 3NS6A 1KHWA 2CYYA 4DSIA 3WQPA 4JI5F 3U1LA 1Z2ZA 1RQ0A 8AT1B 3U1MA 5KFOA 4J9LA 5KFMA 2GC8A 4DFKA 3Q0AA 3H2LA 4HH0A 3PNIA 4PEOA 3MMJA 1B7FA 2V5HG 1Q8LA 3D54A 1UPPA 1D1UA 1LWCB 1XK8A 2CJYB 3DLGA 5B0AA 1YRTA 4E0DA 1NJYA 2HWTA 2WRMA 3R7SB 3BN7A 1HD0A 1R89A 2HAFA 4MKBA 1QSSA 1F60B 3SI8A 4WTYA 1MMNA 3SFGA 2ZM6F 1U1RA 1TKXA 3K7RA 2VPXB 4GRSA 1SIWB 3CJ8A 2AEMA 3GQCA 3S6EA 2DPIA 3PW0A 2HHTA 1KTVA 3HD2A 2ZOGA 5L1LA 2HHUA 4YR0A 3JYTA 2YQ1A 1TK0A 4TKTA 3PYFA 4LR7A 4IUFA 5J2PA 1CS4A 4WZMA 4ALZA 3RB6A 2B51A 2KT5A 2GVZB 1KOHA 1VBYA 3EGNA 3OPKA 4C8YA 5JJBA 4JI2J 2VL1A 5F0WA 3GFZA 4L75A 1ZA2B 2RHSB 4KC5A 5D77A 3KKFA 2DISA 3HHEA 3S1TA 2ZH8A 4CM0A 2APOA 3MHYA 3THVA 3NBPA 2GMJA 4LFBF 3I0RA 3MEGA 4OHYA 3ZC4A 2JC0A 4ZHRA 3MUVP 1D0EA 2HHWA 2Y8WA 1S6PB 2E5LF 4K0KF 3IRXB 2C2OB 4YR3A 3UPFA 1CVJA 3TUPA 4GKKJ 2LU2A 3FMBA 1OSCA 5AXMA 5E33A 3KOAA 4PABA 1EP4A 1SKSA 3HO1A 3M2RA 4EYIB 2WCXA 1RGVA 3V81A 2XY6A 1MROB 3J7Z5 4QIGA 5KFRA 3AODA 4DR5J 2J9EA 1G7CB 1HQUB 1ZTTA 2VONA 4CO2A 4X4OA 2DGVA 4OHZA 1VRQC 2QL5B 1AZSB 1VOMA 4IFVA 3IXQA 5F3TA 2R9LA 4Q0BA 2J0XA 1AFJA 2VPZB 3TEGA 2CJQA 5A8WB 1WKKA 4WFXA 3HJFA 3OR1A 1R27B 4CP5A 3NCQA 4NLUA 4OQJA 1SJRA 3TVKA 1VBXA 3GCWP 2FJAB 1IKVA 4NASA 2DNQA 1IM6A 1R3NA 3MR5A 2DGXA 2N82B 1RKIA 4DOZA 3F41A 1RT6A 3PZPA 1JNZB 1S4EA 3I87A 4Q2LA 4JYAF 1VHFA 2CJ9A 3WBZA 2BE2B 3L95X 2DNOA 2VPWB 4OYPA 3H0PA 1WOPA 4JB8B 3NWRA 3SQGB 4MAKA 1FEHA 1MWYA 2UUTA 4OZ5A 4KE5A 3UCUP 3TARA 2A3JA 4RUAA 4X62F 4USJC 2V94A 3KHGA 4FYXB 4LF8F 4M5HA 2V9WA 1ACMB 2HFZA 5IQQA 5ETMA 3GE9A 2MZTA 2O1PA 4DSFA 2MGZB 2XG8A
chains in the Genus database with same CATH topology
2QSFA 5KTQA 1PGZA 2ASLA 1NNDA 3PO4A 1C0TA 4DF4A 4OX8A 1DTTB 1ZM2A 3CMES 4XPEA 1H7WA 4IR9A 4NLPA 1UVLA 3CD5A 5KFCA 1N33F 5L8RC 3M8SA 2E1MC 4AUKA 2HQ3A 3IO1A 5MLCV 1H2VZ 2M70A 1JJ4A 2GHVC 4R5PB 1QSLA 2BANA 1RT3B 2JFKA 2E9RX 4B17A 1NHVA 3EX7B 3MR3A 2ATLA 2UUBF 1XEZA 1VBZA 1D9FA 3BB5A 3N5FA 4KO0B 1N88A 2KG1A 1RWUA 2FVQA 2E9TA 2BJDA 3CF5Q 2LQ9A 2GMHA 2WHOA 3FNNA 4OJ3A 2ADBA 1RAJA 5J1NA 1NO8A 2KKHA 2ZHAA 2BR0A 1SUQB 4OI0A 4OV1A 3IGNA 4RW4B 3QWUA 2C3MA 3FQKA 3TP2A 5HLFB 2V8DA 1R8HA 4WJBA 3KFWX 3MM5A 3IR6B 2DCLA 2QV6A 1M5VC 3DRSB 4I69A 3N6NA 4N77A 2CPEA 4DDFA 4K4YA 2GIRA 2VG6B 2N7YA 3M2VA 2P6TA 2OAUA 3KMSA 1FNXH 3QWPA 3ICLA 4G1QB 3R5BA 1U4BA 1DRZA 3BEGB 4F25A 3GIIA 3PX4A 2RQ4A 3VAHA 2MPUA 2YTCA 1U49A 4DL5A 4RW9B 2CZ4A 4OHWA 3OL8A 1SJFA 4RBVA 5CZXA 2EG2A 2ROGA 1DLOA 4KHPF 1UEVA 3N5BA 4OZNA 3I5CA 2DTJA 5JVGQ 4X4TA 4XPCA 2YH0A 2HNYA 1N5YB 5KFQA 2Q66A 3BR8A 2JEIA 3SXLA 3PO5A 2VKRA 3MM9A 3PACA 3K8VA 5T14A 1SJ4P 2OLWA 3OUYA 3OVAA 4I4BA 4ID5A 3UCGA 2KN4A 2L9DA 2LA6A 3VAJA 1FRJA 4OFZA 3IRWP 1SV5A 4X65F 3V6JA 2QE5A 2JSXA 5GADU 4ZVHA 3OTBA 4Q7AA 3UNGC 5L38A 3CD6S 1P1LA 3H25A 5BYRA 3TA0A 1ZZNA 1S1UB 3HX9A 1A7GE 3RZAA 1TFWA 2B0GA 4F2SA 2RT3A 2JEGA 1F0XA 1H2UX 5KFSA 4MKYA 2X1BA 3K57A 1V3ZA 2DGWA 2OPPA 2B4VA 1OIAA 2MY8A 2AGQA 5T41A 3G9CA 1RT7A 4CT8A 3NLCA 1T02A 1HARA 2E5HA 4I7FB 2F9JA 2QFJA 1RYRA 1UVNA 4DLGA 1RJJA 1JKHB 5A8KB 3CPWR 2LDYA 1VLYA 4LSNB 4ZHRB 1DJ0A 3ZZTA 3FRZA 4M95A 1KFDA 3LALA 2XI3A 2G13A 3MD1A 3OLAA 3TAQA 2H5EA 3KG0A 1KNZA 2W4PA 5K14B 1NK9A 4MKAA 2BBEA 4ETXA 3MCSA 2VQFF 4DV5F 4ED3A 2V4JB 4I67A 1XMBA 4DV0F 2K1RA 3F56A 1WELA 5LXRA 1B0PA 1SH2A 2DR9A 3CC7S 1Y4ZB 4IO1A 2C2EA 2GQCA 1SIZA 2E66A 3DDKA 5B08A 2FJDB 4UW2A 2JVRA 2POKA 1TZ0A 4YR2A 3ZZZA 2J6SA 3PRBA 2LEPA 2IBOA 4HLBA 2GW8A 3H4BA 2OO4A 3PW2A 2IFXA 2OKQA 1ZM4A 2EFNA 2EI5A 2DNGA 3G8QA 3NNHA 2O01C 5L1KA 1IJFB 4OJHA 3H5XA 4KQZA 3M2RB 3POTA 5KFGA 4I6AA 2RKIB 5T7LA 4EU0A 1R43A 5F8GA 2KB2A 2J7WA 4ES3A 3T6BA 4MH8A 3PX6A 1KVIA 2OMOA 2DPJA 1S9GB 2RD5C 3D0GE 4R8UA 1CEZA 2B4OA 1U1NA 4KV8B 3TUZC 2WK4A 1IBLF 1K0VA 2HVZA 2KM8B 4A8XA 3Q8RB 3QMQA 5DM7Q 5D4PA 3VZIA 5DLFA 2OMLA 5KFBA 1HPZA 3G71S 2AX0A 2J7UA 4XIUA 3DRXA 1NH7A 4J9OA 4OHVA 1QY7A 2DNLA 1R0AB 1TKZA 4IDKB 2NSCA 2HRYA 1S9EB 4LUBA 4JUZA 4HTJA 5GADI 4IO9Q 1TL1B 3EZUA 2RF2A 2LXFA 4WYWA 4B9UA 2AJQA 3CJ2A 1NU4A 4B9MA 2ZVSA 3OVBA 3FFIA 3NS5A 4B3RF 3PY8A 5K8NA 2LQBA 2ZOFA 3NP5A 4QR2A 2OPQB 3NNCA 3LANA 5CYQB 2PMHA 3DOLB 1HBNB 1S1XA 1NKCA 3HHLA 2KJVA 3H98A 2HRUA 3AQPA 4I2PB 3CCUS 1NKEA 4U7CA 2D3OR 2HHPA 4USIA 3TVYA 4IG0B 3CCWA 3KK2B 3QIPA 5H1SV 4DL6A 2B6AB 1OQ6A 2NUHA 2ASYA 2ZH5A 3CMAS 2LQ5A 3IS9B 5KFIA 4DV7F 1YHQS 5DQIA 4NCGB 4JV2A 4CO5A 2GHPA 3V6DB 5E3QA 4LF6F 2AV5A 5HROA 2CZVC 1RT2A 2FVRA 2I0XA 5DG9A 4JV0A 1FRKA 1VRTB 4MYTA 3C8YA 4KT0C 5KFLA 1T7PA 5M2PA 1NJZA 2GGPA 1UWBA 5HP1A 1FVSA 4B9TA 2ZFHA 4QOTA 2AQ4A 2CQ4A 2VPYB 1TL3B 2VFUA 2FHMA 3W2VB 4DV2F 1SBRA 2N7CA 2ACYA 5IXUA 2UVRA 2M2BA 4A46A 1IQTA 4BCAA 1E6VA 3KK1B 4DHVA 2AU0A 4XAKA 3TA2A 3NAIA 2E5JA 2HW3A 1VMBA 4NLXA 4TN2A 3M8QA 2Z4PA 3DXBA 2C28A 2KZMA 1LK7A 4WZQA 2XMVA 2EFPA 4NLVA 2EKYA 2Z2MA 1T8EA 4WKRA 4IQMA 2CPXA 5DLGA 4EBCA 3V2UC 4NA2A 3LP1B 2FLNA 3UW1A 3JSMB 3R27A 3MUTP 3I5AA 3H5YA 1RT6B 2CQ2A 4C3MA 3M9MB 2O5DA 4K4VA 3PDNA 1VQ5S 2YNHA 3KYLA 1IKYB 3P49B 1QUVA 3CCLS 1M0SA 2UUWA 1BQNB 1JLAB 1HW8A 2CQ3A 4P7VA 2CQ1A 1J5OB 1S0NA 1U26A 3SYZA 2GQ2A 2YWFA 5KG5A 1HFEL 4QPTA 4ZPBA 1ZM9A 2G4BA 2AGPA 3KJVA 2HNDB 4A8YA 3T9ZA 3CWJA 4B9LA 2MSSA 2PA3A 3ZZYA 1M1KT 4JV1A 3X3UA 4X66F 3U02A 2CQBA 3T1HF 1YJNS 4JOUA 3FSXA 5A8RB 5IM0B 3NRBA 2CPZA 4Y34A 5F9NA 4ILMA 1JLQB 2XY5A 1FK9B 5I42A 1S6QB 4I1TA 4IG3A 1G6BA 2RU9A 3TX8A 3V4MA 2W7AA 2EC0A 4BC7A 2CPFA 2EFGA 2NREA 4J5OA 2BVZA 2E1AA 1WF1A 2W7PA 3E51A 3CCZA 3I4HX 4HT7A 3KLFB 3DYAA 3I0SB 2QA4S 2RDIA 4PXBA 2QO3A 2BA9A 1UFWA 3LP0B 2KG0A 2K2PA 1HNIB 5C24A 4YFUA 1RTIA 3C6TA 2FC8A 2M9KA 3HHKA 4N8OA 4A4JA 4K4ZA 1UMJA 5F9LA 2UP1A 1UJ6A 1FKOA 1S1TB 3GV7B 1L3SA 2DGSA 2KXNB 1N34F 4LT6A 2OFHX 1S49A 3MFHA 1MW7A 3PW5A 2HFNA 4JI2F 2YKPA 3BJYA 1KLMB 4OI3A 5B0DA 1FXRA 2NYIA 4KGKA 1YRXA 4A8KA 3M9OB 2HIQA 2ZDOA 3TYTA 3CXCR 3QO9A 1IKXA 3AA8A 1JLEB 4NZ0A 1D3WA 4FS2A 1Y7PA 3QLHB 3DMJA 1FXDA 2MZRA 3VAGA 4Q43A 1GTEA 2R8JA 2WOMA 1D8YA 1DFDA 4P2SA 1Q8IA 2XMTA 4JI0F 4K4XA 1N4LA 2VG5A 4PUOB 5JXSA 3K59A 4WFNQ 5A0YA 3MEEB 2R7VA 1RTHB 1Y3JA 2MKSA 1HWJA 2VBWA 5E7OB 1U45A 3DRRB 2OIHA 1CG2A 4D3GA 4WFBQ 1JK9B 1VC6A 2JFDA 1QE1A 2P9CA 3NCPA 2WBMA 4HTIA 3KLHA 4B3MF 5D78A 2ZNZA 5JVHQ 3FEXB 4ES1A 4Q2MA 1YJ9S 3DU5A 1KD1T 3MR6A 3PR4A 1HWUA 2KFNA 1DQ9A 1B64A 1UEUA 1LK5A 2WBRA 2MDAA 1AXQA 4ZPDA 1Y00A 2MYFA 3DRPB 3FRYA 3I32A 2QA1A 3MMBA 1FDAA 3R5AA 1G1XA 3SCKE 2BQUA 4Y6IA 2O66A 1P9QC 4GMKA 3TOQA 5BYSA 3T3FA 5LT5A 4ED1A 4TXSA 5E41A 1URNA 2ZJRQ 4RNOA 1T03A 4OJ1A 3D1QA 1QSYA 2VC1A 4ECWA 2AW0A 3CIMA 4YB5A 4J9PA 1VQ6S 2M5YA 1W25A 3OFEA 4C7QA 4HHJA 3LOUA 4FXWA 3GWCA 1HQEB 1FTRA 3DFEA 4O3QA 1BY9A 1XTZA 1GTHA 3MMAB 4OZLA 3T1AA 5J2QB 3AY0A 3SSRA 2E7WA 4CO4A 1HBUB 4G6VB 4PG5A 1N48A 2XGPA 1FDNA 5J1EA 2IBKA 1JLBA 1LW2A 2YKNB 3BO4A 1BC6A 1S7HA 2GO8A 3CIZA 1XR6A 4CTAA 3GR0A 4DBQA 1N5VA 2HS4A 5EWEA 2A2DA 4OHXA 4KKOA 3H2VE 3RW6A 4ZS6A 5IS2A 4DSKA 1FRLA 2E29A 5DDRC 4HH1A 3HM9A 2Q6CA 2CQHA 1TAQA 3Q8QB 2MQQA 2WW8A 2IJNA 2NPFA 2OH2A 1ZOTA 2N4DA 1LKZA 2HNZB 1FVQA 1F9FA 1YWXA 1N0VC 1RT5A 2Y0SD 3G6VA 3RAXA 4HL9A 3FSYA 2CDQA 2P9EA 2HVHA 4QYRA 4Z2XA 3L7OA 1IUJA 3HVRA 2ADCA 2LYVA 2XSJB 3IC1A 1KEKA 5IZHA 4N76A 1Q1KA 2YKMB 4U6PA 3HPOA 4A8WA 1VJWA 4ZLPA 4DF8A 1T94A 3ZZRA 2ERRA 3CDEA 3HZEA 1KRPA 2KXHA 4USHA 1TV6A 2MY7A 2OPRB 1ZBTA 1NAQA 2KRRA 3DM2B 3BSOA 1Z2LA 3DOMA 3OL6A 4WK1A 4UY8T 3MM7B 4NCBA 1U24A 2IM3A 2ZH7A 3TANA 1U1QA 1TAUA 1C1BB 2XGQA 2QT7A 3K5PA 3X1LB 4NYPA 1LWEB 4C2MA 5DO2A 1PSDA 2Q3PA 4ECVA 1K8AT 3JSRA 3ENVA 4YDXA 3BGRB 3M4XA 3KLEA 1MU2B 4F67A 2R8HA 3POTB 4RW8B 1NJWA 2LCWA 4GKJF 4QWBA 2G1DA 2MKJA 1K9MT 1VQLS 2AD9A 2Q79A 4FF3A 1WHXA 5D4LA 4ELVA 4NMLA 5KT4A 1JJ2R 1VC0A 3KNGA 3AJ1A 3VAMA 4EBEA 1NHUA 2X1GA 2R7XA 1HNVB 3BQ2A 4IH7A 2EBEA 1XR5A 2OD4A 3O5TB 2B56A 2OPSA 1VQOS 1Q4RA 3BM7A 1LXNA 1RK8A 3P96A 3DLKA 2YNFA 1ZPVA 1ZTWA 4ZVGA 4PXEA 2DNPA 3RRHA 2A2CA 3TO8A 4ZPWR 2KRBA 4YDDB 5KT5A 4ECRA 4CZCA 1X4AA 1Q86T 5LSOA 1RKJA 2UVVA 1M5HA 6FD1A 2KJWA 5F3ZA 3CCJS 4F4KA 5KG7A 2XCPA 1HA1A 2ZH3A 4QIVA 2R2RA 1S10A 1M90T 4LSLA 2V8VA 3VTIA 5D4OA 2EVZA 1DTQB 3CJKA 3SV4A 4C0BA 5GMKa 2XMUA 3EUNA 1RA6A 2XNRA 3RB3A 2OP5A 3THTA 3KLVA 3TUIC 4QYZJ 1NK0A 1HWIA 2ZH4A 3BSNA 1CLFA 4X64F 3LWMA 4ELUA 5KT7A 3DHWC 4NLRA 4AL5A 4KJIA 2DGUA 3FGVA 1HBMB 1X5OA 1QVFR 5EX3A 1UP1A 2RVJA 3DRYA 1Q7YT 2YWEA 2AF6A 4X4NA 2YNGB 3KG1A 3W2WA 2MQOA 3PKMA 1LWFA 1JLFB 1SB6A 1S1WB 1XBWA 2VOOA 1UWBB 2R7RA 2D7SA 4ZPAA 4H4OB 4XK8C 3N01A 2VUGA 2VD3A 3JSBA 4I2QA 2KXFA 1E6YA 3I96A 1RISA 3IGVA 1T05B 4K4UA 2HMIA 1Q78A 3ISZA 1P1TA 1JLGA 2WONA 3HHLC 3L3CA 1JNRB 1LW0A 3MMCB 4ZDNA 3PW4A 4KFBA 2EWHA 2NSBA 2Q1LA 4I6YA 4KPYA 2DNHA 2YQ3A 3BDEA 1HHSA 4U67Q 3M32B 2UZAA 4QJVA 4YB6A 3OLBA 1YGYA 3QGIA 1H38A 1NK7A 4XO0A 3MPWA 2D9PA 1FTCA 3N6LA 3V4IB 1HNXF 4F2RA 1FKPA 1QTMA 2EG1A 1HI1A 3DLEA 4A8SA 3TQ1A 4NRTA 3OXFA 2QMWA 2MKKA 2GX8A 1REVA 4TQRA 4C8LA 2FPHX 4IH6A 3O6QA 1V6HA 2PFFB 3L7PA 3MM6B 4KBIA 2GFFA 2MZ1A 4EO6A 5KOXA 2HYIB 1FRHA 4F8RA 2PIIA 1PC4A 4DL7A 1VRUA 4WE1B 2I5JB 3FZ2A 3MECA 4X4VA 2CG4A 5FDLB 4Q5VA 2D1CA 5D3GB 3CULA 3HVWA 2ZDPA 2DGTA 4F26A 2YNIA 3PRDA 5HBMB 2QSWA 3ZZPA 3DLGB 3PW7A 3NG8A 4I64A 3B82A 2PO4A 4EO8A 2NR0A 2KHCA 3PVXA 1S77D 1FJGF 3UWTA 3UD4P 4O44A 1M5PC 3PEHA 3VAKA 1C4CA 4Q8EA 3J7A1 1U25A 1KQSR 2FLPA 1H6KX 2LVWA 3EXYA 1U6FA 4IFYA 4URGA 2QEXS 5CH7B 4ZCMA 5FJ4A 1SQEA 4RW6A 2V0NA 2MSTA 2RNEA 3C3LA 3K0JA 2HPUA 2ZC3A 3P5TL 4XDDA 2VFVA 1YJUA 4Y28C 1IBMF 1KR4A 1YJVA 1TKXB 3QGGA 5AXKA 3C6UB 2IM2A 1DURA 1S79A 3DLJA 1SL1A 5F0UA 1HYSA 3MPVA 2HHQA 2CPYA 4O3PA 4TU7A 4B3OA 2AYGA 2XWYA 4WKYA 1IXKA 1H0HB 5K9FA 1RT1A 4ELTA 1VC5A 2YVSA 4K5RA 2YKAA 4B3TF 3EGZA 5DETA 3IWNC 4OZJA 4URSA 2UU9F 1FESA 4ECXA 4DQPA 1S76D 2UXCF 2ZC4A 1JX4A 1TUVA 3JYTB 3DLLQ 4RZRA 1HBOB 5DS7A 2LU1A 5U47A 2GMLA 2JJ4D 3CJ5A 1SKRA 2VFRA 2DH8A 1U1PA 4DJBA 1VIOA 3M30B 3ITHA 3TAMA 5DDQC 2W4CA 4UOCA 1S0OA 1CSJA 5J2PB 2DO4A 2EW9A 4F4ZA 4Y2AA 2HS3A 1ULRA 1GXTA 4ZVEA 1WHYA 2IAJA 2Y1IA 4OX6A 3AH6A 3IR5B 4AXJA 1HWKA 4RNMA 3CCMS 3VAFA 4URQU 2C3PA 5H9FJ 1RT4B 3A1YG 3O2IA 2ZHBA 4DV1F 2BRLA 4RLEA 2ZBCA 2U2FA 4ZPVR 1QVGR 4UQGA 3NMRA 2F3JA 3M6VA 3OFFA 2W9BA 4FP9A 4DL0C 4LFAF 3I82A 2OSRA 4DS5A 5A0YB 2XMKA 2HGMA 5AJ3F 4TU8A 3J7YU 3OTCA 1X4DA 4WFAQ 2ZJQQ 1U8SA 2B9XA 3T9NA 2DBBA 1S6PA 2ZE2B 4NYOA 5B7WA 4RWXA 1ZPWX 2R7TA 1ELOA 3IRXA 4NWBA 4C11B 3Q24A 4WFYA