5AXLA

Crystal structure of thg1 like protein (tlp) with gtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
221
Chain Sequence
b'TREIYAEMRCIPPVVLRADGRNFKNTLSGLGFEKPYDKTFARAMADTAELFIKKSGLSPLFAYTFSDEISFLFTDLPFDGRVEKIDSVVASFLGSALTIKLRLEEPIAFDSRLVALQKEEIPEYFHRRQLEAWRNFVASWGYYALRNEGMGRNEAAKYLKRKKESEIHEMLFERGINLATLPSWQRRGVIISKEARKITQNWEIPKFKSEKGIPFLEKLIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA(His)-5'-guanylyltransferase (Thg1) like protein
publication title Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Transferase
total genus 64
structure length 221
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5axlA00
5AXLA 4KGMA 3WC0A 5AXNA 4KGKA 3OTDA 3WC2A 3OTCA 3OTBA 5AXKA 3OTEA 3WBZA 5AXMA
chains in the Genus database with same CATH superfamily
2LXIA 3MTKA 1PJ6A 5IC6B 5KFNA 4LFCJ 1Y4ZB 2NPFA 5I42B 4URSA 1JMTA 1XNRF 1MNEA 4ZLLA 1FJEB 5AT1B 4YB1P 1HQUB 4OI0A 2HRYA 3TAPA 3K2YA 2B8PA 4G1QB 1VRQC 1DTQB 1ZAXA 2ZH2A 1Y00A 5SUHA 1H74A 2LQ5A 3MMCA 4FNHA 1RT6B 1N4LA 3ET6A 3VALA 2XULA 1FNMA 3D6TB 1LFPA 3JYTB 1HMVB 3ZTOA 2AD9A 2YWWA 3T9NA 3V6DA 1S0NA 2FJBB 4R25A 3CIMA 2Z0GA 5J2NB 3PJ9A 2E7XA 2XSFA 4DV0F 4DR5F 3M8PB 4ZN1A 2RQ4A 2ZJPQ 2FGCA 2QLJB 1P9QC 4NE9C 3WX4A 3VVUA 1JNRB 2KHDA 1O6XA 2AEJA 2HLTA 2XC9A 4H4KA 1K47A 1KSPA 1ZA1B 4OX8A 2HG4A 2ZH8A 4X64J 4OYZA 2ZE2A 3HHDA 2BRLA 4ANDA 2IAJA 2OP5A 2EKYA 4GO5X 1SQGA 1TK8A 2HQDA 2HQ3A 1HI8A 4ZLPA 1SJ3P 2OKQA 1F3VA 1N6QA 4NASA 4YDXA 1HA1A 3HHEA 2HVEA 3QAEA 3HVRA 2Z4PA 1YJNS 2GMHA 1EIYB 3KDNA 2J8AA 5DQGA 4Q8EA 1HYSB 1X9MA 2BM0A 2RRBA 1O0PA 4LVOP 2HFVA 3BR9A 4ZJLA 2UUTA 4J9RA 1KC8T 1OPIA 5FDLA 2GAGC 1UA1A 3HVTA 4C11A 3T6JA 4J9LA 3UD5A 1IQZA 2LQ9A 4JV5F 3M2VB 4HI1A 4NRUA 4ZLJA 4U96A 4E2FB 1IJFB 1WC1A 1WORA 2DR9A 1RWXB 4DV1F 4NZ7A 2M4MA 2JLFA 4TNOA 5KTQA 5KFWA 2IIHA 3TJ8A 3NOCA 4MT1A 4GC7A 3AJ2A 4UQGA 3RGIA 4CLSA 5IQ6A 3VVTA 3PY8A 5IOLA 1SKUB 1KRPA 2BJ8A 1S9FA 2AIRB 1VRUA 2ZUAA 1N54B 3KWMA 2D3O1 1GTEA 2ALYB 4EBDA 2F9JA 4QU6A 1BWVA 2BR0A 3RB6A 2BKNA 4G3IA 4DV2F 5E7OB 3HD2A 2CG4A 3VGUA 3RRHA 5T14A 2EFVA 5A8RB 1RT7A 1JLAB 1Y5LB 3IAM9 2YNHA 4DV0J 4DR5J 1EARA 4DS4A 2PEBA 3UD4P 5HMZA 1D0EA 4M5JA 4DPOA 1SI9A 1MROA 3CDAA 4WYLA 1GH8A 2O66A 4J9VA 5KFAA 1VQKS 1RGVA 3DN9A 2MZSA 4F0MA 4OZNA 1RT5A 4DX6A 2FJWA 3U1MA 4TU8A 1HW8A 4I6WA 4CQ1A 2EI5A 4LF6F 4ZCIA 4N77A 3N28A 3GILA 3CCES 2KYXA 3ZZTA 3HFVA 4RR5A 4F4ZA 2OPQB 2FHOB 2V4JB 2ROEA 4DL7A 3A8IA 3VGTA 2W1BA 1F2GA 5KFBA 3C14A 1HBNA 1ZM3A 1NNDA 1RE1B 3M8WA 3BH6B 1N0UA 2OSRA 1SH2A 2GIQA 2IYIA 2VKZG 4DR4F 1SPBP 2O5DA 1XEZA 1RACB 3OL9A 3K0JA 3NOGA 1PAEX 2YKOA 3CCLS 3CJ5A 2ASJA 3QZ7A 1B7YB 2YQ3A 3BM7A 2HHHF 2HNZA 3ENVA 4JV5J 2Y1IA 5ETPA 3T9ZA 4FYYB 4RPFA 1FK9A 2DRDA 4O44B 1XJWB 2YNGB 3MMBA 4LQ9A 2F63A 2BE9B 1IBMF 3LF0A 1ZM2A 3US5A 2A18A 5A6PA 1RZMA 2W9AA 4B3MF 3LP0A 2D9OA 1AUSL 1VISA 2IMWP 2L08A 2XCPA 5C7PA 3HCXA 4V1Ak 2LQJA 4Y34A 3FC9A 4NL5A 4FNIA 2YH1A 2DTJA 1FFSB 2YPZA 5LL6d 4CH0S 2M2BA 1OY9A 1X8DA 7AT1B 4PR6A 2KL8A 4EMDA 1S97A 5H1SV 4IO9Q 3U1LA 5J2QB 1TZ0A 1J2VA 4DSLA 1CSJA 4QPTA 3EGVA 4DV2J 1X4AA 2GQCA 2XMMA 3LANA 3MEDB 4M8LA 1NK7A 4CYUB 1MN7A 2C2OB 3FBFA 2DITA 3HDSA 3LP1B 3M05A 4KPYA 3IO1A 2VL1A 1QUPA 3D54A 1SCJB 1DZ5A 4DFKA 3R6GB 1LK5A 2DBBA 4B3RF 1U25A 3ETMA 1NK9A 1WG5A 3D6MB 2BRKA 1L3VA 3M8ZA 5F8IA 2DHSA 1J5OB 2ZOGA 2M5YA 1FRKA 1PYTA 1WSVA 4ZVUB 2CPDA 5D78A 1HBMB 3AOCA 1Y10A 3SQGA 2ZOFA 3OBIA 1B3TA 4NYOA 4RO0A 3CULA 2VG6A 4NLSA 1LFWA 3MECB 5CA5A 2EVZA 4J9NA 1UVMA 1URRA 2C2KB 2EEYA 2BVZA 2JEGA 3ICLA 4OHYA 5KG5A 2O3DA 2HHSA 3FSXA 3D2WA 3QATA 2FJEB 1ELOA 5EX3A 1S6PB 2B4OA 3BN7A 3EDQB 1LWFA 2X1AA 2EFQA 4KHMA 3J80U 1XMQF 4YB7A 2Q6BA 2IJNA 2CVEA 2HKEA 3VAGA 5L39A 3CUNA 3W9IA 4XPEA 4F67A 3RTVA 4OYIA 3WIUA 3FZ2A 2HHTA 4CTAA 2MLYA 5J1EA 1AFIA 5D77A 4LF5F 1X4HA 4BHQA 2NCKL 1WEYA 4M5HA 1IBMJ 3CJ8A 2MZRA 3THPA 3M1VB 2G1HA 3MM9A 2C2RA 1FX2A 2HZCA 4USIA 4Y2MA 1TKZA 3SV3A 4MIWA 2R2RA 4B3MJ 4ECUA 1NU4A 3M2RB 4I69A 4ENOA 1VBKA 1ZA2B 4TYAA 4EI2A 3D5MA 5KT4A 2V5HG 3ZZRA 1VC5A 2CQ3A 3VHQA 4TXSA 1OS5A 3KLEA 2XS7A 2EK6A 1L3UA 4KGMA 5A8KA 3KNAA 1TVRA 2PMHA 4DU8A 1RDRA 3JQKA 2MZJA 3RZAA 4ECRA 3HFZB 1H2VZ 2FVCA 4O3RA 3B6BA 2MKCA 4A48A 3K8VA 5D0HA 3BYRA 2DEJA 3QPIA 1YJUA 4IDKA 2JZ5A 5EX0A 3N79A 4N8OA 3IA0A 5GAGU 3HULA 4ER8A 3S1TA 1MWYA 2IYGA 2XYPB 3C46A 2QLBB 4TQRA 2QYGA 4FYDA 4ZPCA 3BO2A 4O3QA 4B3RJ 4YB6A 2ZNYA 4KHPF 2BJ9A 2AGPA 1F0XA 5J2MA 3A1YG 3J7A1 1CPZA 4ZIVA 4B3SJ 3NXZA 4ZVHA 2PFDA 5KOXA 1LW0B 3JSMB 2PC6A 4URGA 1TMMA 2J7WA 1Y5NB 3ZO7A 2E5GA 4FF1A 2OO4A 5B7WA 2ZH4A 4ZVQB 3D1HA 1PC5A 2XMAA 1U49A 4LVNP 4U9RA 2UUWA 4YHHF 4CLUA 1FKAF 3I31A 4AUKA 3BV8A 3P8BB 3PKYA 2KJVA 2WK4A 2KFYA 2KKHA 3Q8VA 1XMQJ 2KO1A 3G82A 3Q23A 3ENAA 4PKDB 2G13A 1MW7A 2GO8A 2R7XA 4DCPB 2WOMB 2PO4A 1KEKA 3FUYA 3MR2A 4PUOA 1JLEB 2LXFA 1FTCA 3T5KA 2GHVC 3ZZUA 1WOPA 1HQEB 2IRYA 4KH0B 5G0RA 1RT4B 1MMLA 3L7OA 4P75A 3OFHA 3RAXA 5H9FJ 3GZ7A 5AXMA 2DGUA 4W90B 3I0SA 4K5RA 1FNOA 4IFVA 5IZHA 4A8WA 1TUWA 2CPIA 5DLGA 2FLNA 1JLQA 3TO8A 3WQPA 3PJXA 4K2XA 4K4XA 1GEHA 1RAEB 4JI7F 2QN6B 5F0WA 5KFZA 4UOFA 3E2EA 3GG0A 3LGNA 1G7CB 2AMCB 3MEKA 2FHMA 4OZ0A 2PDAA 2HNYB 4CNZA 1BLUA 1TK0A 1Q0NA 3LPYA 2R9LA 2DNMA 3D7SB 2HS4A 3UNGC 5SZTA 4A8KA 4E0DA 3Q2TC 3W3SA 4UOGA 3PDNA 2DGVA 1N8RT 3GFHA 3IRXB 1VBXA 4WKYA 2DGTA 2AV5A 1IKYA 4KHPJ 2QMUB 3HJFA 2DXEA 2Z2MA 2ROPA 4DV3F 4H4OB 2ASLA 1X5OA 2K1RB 2HSEB 5C2CA 3BKFA 4LF7J 4R5PB 3QO9B 2FD2A 2ACMA 3IRWP 2MQQA 2CQ1A 4OJGA 1SH3A 4UUWA 1NK0A 1QTNB 1UAWA 2V2KA 1C0TA 5LMNF 4X4SA 5E3PA 3EXYA 3DMJA 5DDOC 2IVMA 1YGYA 4WPAA 3CVKA 1EX8A 1CLFA 2HLUA 2W8KA 1LWEA 1RTJA 1C1BB 4DL6A 1SQEA 2YBVA 4F2RA 4X4RA 1KOOA 2MLZA 2BABA 2VC0A 3Q22A 4ALZA 4HACA 3S7RA 3UR3C 1VQLS 4RW6A 5LT5A 3JSRA 3MPWA 1BXNA 4F4KA 3AJDA 1KQGB 1TELA 3JSYA 5E41A 1UFWA 3M7VA 1U6ZA 3ZTQA 3CB4A 4USMA 1TUVA 4TN2A 3CJKA 2GNKA 1EP4B 2FIUA 2WB4A 2A2DA 3KJVA 2EW9A 4KGZB 3I82A 5FIIA 3FCWA 2YTCA 1V5IB 2YX7A 4WK3A 4Q0BB 2IPOB 3H20A 1NBEB 4O4RA 1R6YA 4EBEA 4NLDA 4MFBA 4GKJJ 4YR3A 3PHTA 1U1KA 1M1KT 3HVWA 5GADU 5EN1A 3LWLA 2RJZA 3W62A 1RHUB 4DS5A 1ZETA 4C8MA 3Q8PB 5LSOA 2ASYA 2XMWA 3NWRA 4KE5A 2XMKA 4C98A 3IXQA 3FBEA 1MMNA 1RHRB 4J7CA 2BYCA 3L7PA 1Q95G 1KTQA 4WFXA 2R8HA 2UXDF 3D6HB 7FD1A 3PHEA 4JI7J 4KV8B 3DDIA 2KJWA 1KD1T 4PZVA 5EWGA 1OYEA 1FO1A 1VR6A 2BANB 3RB4A 2ADBA 3N5BA 1XMBA 2FJDB 1T9VA 3OXLA 3UWTA 2W4PA 3GU0A 2KTQA 2V2QA 5JMNA 1HKAA 5E33A 3NAHA 3D66A 1TMJA 1S12A 4IQMA 1KQKA 1WHYA 4OI3A 3PX0A 4DQRA 1X4FA 4I2PB 3Q0AA 1KDNA 1UA0A 5HJYA 5D4LA 4LFAJ 1QJHA 1HLWA 4ZHRA 3NBPA 4PG7A 3I56S 1F3FA 2E9ZA 4NLTA 3AD9C 3CCMS 1JK9B 5JJBA 2FZKB 5LMNJ 2E44A 1M5PC 3N4WA 2HFNA 3RR7A 1PG5B 1LXJA 3BBBA 4LJMA 2DNLA 1M5VC 2IHR1 4DPUA 3GWCA 3TAMA 2JSXA 2BJEA 2W2QP 1REVA 3QRPA 3MCSA 5T41A 2RQKA 4MAKA 1FVQA 3KG0A 4W98A 3TUPA 1T94A 5CHCB 1S1XA 3H2LA 1BQMA 4P72A 2JLEA 3C6UA 3OUYA 1XR5A 2X3DA 1RT3B 2CPZA 1BC6A 5BR8F 1WC6A 3GFZA 3HK2A 1MU2B 2Z8QA 1NDPA 2RAQA 3EVWA 1M1GA 1RKJA 4DV4F 2FHJA 2YPYA 1QM9A 2MHEA 2R42A 5BYRA 1RWWB 4OJ3A 3DLKA 3CCVS 2OTJS 5AXLA 2GVDA 2CQ2A 2Y8WA 4F7VA 2YKAA 2FLOA 2F8EX 2YNIA 3SDEA 1VLYA 1X31C 2WSFC 3NNAA 4O4GB 5GAGI 3P96A 1KBRA 4HLBA 2AJ0A 4X62J 3EZUA 3VTIA 2DCUB 4A4JA 2B6AB 2YWFA 4M5DB 4ZKAA 2VC1A 4DPYA 1U2FA 5E3AA 1X5PA 1HNVA 2CQHA 3MMAB 3HKZD 2LU2A 3GSIA 2WVDA 3H4BA 3I6PA 2HVZA 1QSSA 3BKUA 3MM5B 1RXOB 2GZOA 1E6VB 3MCNA 4K0KF 4YN3B 2ZD1B 4F50A 1V6HA 4OX7A 1Q78A 3ILJA 3E3XA 3CGIA 4DXLA 3PJWA 4RW9B 4QIEA 4GKKF 2Y0SD 1ZS6A 5J1NA 4YY3F 5JVHQ 2GGPA 3ZTPA 3CJRA 2D69A 2OLWA 2G0IA 4ID5B 5F8NA 1QD1A 3GE9A 1SKRA 3VAMA 1FA0A 4ZITA 4DI6A 2VQEF 3DRPA 1N52B 4WYWA 2CADA 3M8QB 4PWWA 5A0YB 4ZOSA 3BR8A 5B0CA 2DO0A 2HHWA 2DNYA 3TVYA 1K9MT 3OD2A 5CYJA 2E9RX 3HM9A 1MN9A 1Z2LA 5C2GA 2BEFA 1CJVA 2XZTB 1L3KA 1J27A 1RT7B 2YKNA 4ZPAA 3D68A 4IOBA 4C0BA 4U7CA 1WEXA 3NL0A 1VQOS 1LW2B 1XWLA 4GMKA 3QNWB 2NQPA 5IT0A 1KFDA 4Q7AA 4DN0A 4WIQA 2B5JA 4ES1A 4F2SA 4DV7F 4OI2A 3KJQB 3F41A 1KHWA 5RUBA 1RHKB 1RT5B 4R8UA 1HIYA 2GJFA 1VBYA 4DWIA 3EDRB 1R0AB 1JLBB 2E1MC 1HNIA 1S1TA 2NSBA 1U1NA 2MHNA 1Z4UA 4DV4J 2P8IA 3DOLA 2OPPB 4I2QB 8ATCB 3CCSS 3DHXA 3J80Y 2H5EA 4K4UA 2JFKA 2CNLB 2GO9A 3L09A 8RUCA 4HL9A 4UY8T 1WC0A 1HWJA 4FVMA 1D1UA 2U2FA 5KFTA 4PXDA 2ZHBA 4PYDA 4MK9A 5GMKa 2FHKA 5KFLA 1SJ1A 3QSYB 3KG4A 4OZ5A 4Y2CA 4EWTA 3MPUB 5D3GA 2O01C 5LJ5Y 4I4BA 1N33J 1WTFA 2HWIA 2BE2B 4M5MA 2HNZB 3DRXA 1BE4A 2MLXA 3WIVA 4ZVFA 1RK8A 3P3DA 2E1CA 2DO4A 4ILRA 3A4TA 2GCFA 1I51B 2NR0A 4EU0A 4MKAA 4GVBA 5U47A 1ACMB 3KLIA 1FK9B 2FVQA 4K0KJ 1WNEA 4KFBB 2BMBA 2K3IA 1LWCB 1T9WA 3TQ1A 2DGXA 4DG1B 4LQ3A 4UF4A 4C8KA 4R0JA 2RHQB 4NLVA 1M5SA 3OSNA 1EETB 3PNIA 1Q8LA 2DY1A 1VK8A 4TY9A 2DR6A 1LEOA 3MM7A 1T3NA 3AB2B 4Y2IA 3PYGA 3ITHB 2I5JA 4G1PA 1UZHA 4XO0A 1RHMB 4RW7A 1UWAA 2D74B 1VQ8S 1RWKB 4OFZA 1H98A 1RUSA 1F9FA 3MPDA 1IQTA 2V0NA 3LUYA 2N7CA 2HIQA 3WBZA 1YG0A 1FT8A 2KT2A 1XR6A 4QWBA 4C0OC 5D0RA 3DI6A 2WSCC 1FI4A 1EAYC 3KK1A 5KG1A 2HVDA 3D1QA 3EX7B 4PXEA 2MQNA 1L5UA 2FZGB 4RBUA 1KHVA 2ZJRQ 1R89A 4LRFA 3CJ2A 3ISNC 1IR2A 1QAXA 2C2ZB 4ECSA 2IRUA 2UXBF 4BWMA 1S49A 1U02A 4IH7A 5GADI 1UVKA 1KTVA 1GNKA 2RQMA 4DV7J 2HIYA 4WXOA 3MUMP 1T03A 2QL7B 3DC2A 3GQCA 1B4SA 5K14A 2NZ4A 5CYMB 2R8KA 1O51A 1S1WB 3M6WA 3MR7A 1RWNB 2MY8A 2QV6A 1YRXA 4MYUA 4ZJOA 3OVSA 1AW0A 2VG7B 1IBKF 1YQHA 1K73T 3QZ8A 2O67A 2IMOA 2KZMA 1SV5B 1OY6A 3PFEA 2VG6B 1IKXA 2LMIA 3AODA 5CCMA 1HBUA 3ISZA 1GX6A 1FKPA 4NEZA 1VQ4S 3Q89A 4K50A 3NY0A 3MD1A 1TL4A 2UVRA 3NGTA 5HROA 3P5BP 5E3RA 2RT3A 3M4XA 2JHEA 2BUNA 2M88A 3C19A 1JJCB 3R5GA 3BGUA 2JH3A 2K3KA 4F8RA 3PG9A 2WZ1A 3WX8A 2D1CA 3IP0A 4FF3A 4K4YA 2XS5A 4DQPA 4DU7A 2MGZA 5HVFA 3T1YF 4CTAB 2D7SA 1AFJA 3T1HF 2HZVA 4RZRA 3CMAS 4D3GA 1JLCB 1X4CA 3V81B 4CCHA 1WUUA 4LF8J 3D1OA 3I32A 2MPUA 4X84A 3QIPA 3PXGa 3SFGA 3W2VB 4I7FB 4W4MA 4GRSA 3KLEB 3PR4A 2C2EA 4CLZA 3LOUA 2EXUA 1PYSB 1S7IA 3M30A 4IFYA 3TVKA 2VA3A 4C6AA 2ZNZA 5KFXA 1DQ9A 4OJHA 4HKQA 3B54A 4QCLA 5F9LA 3ZZYA 3W66A 2WBRA 4RBTA 2RUGA 3ZTSA 4IDKB 4LR9A 5F8GA 1M5KC 4MK7A 2KU7A 1F9HA 4ILMA 1ZPVA 3LTOA 4IR9A 1IVZA 2X1FA 2UXBJ 2JWNA 3M2UA 2XY7A 1RCOB 3C16B 2DK2A 3CCUS 1YVFA 1TAUA 2AYBA 2YWEA 1PAUB 1I6JA 1GFWB 2X7IA 3K89A 3DDNA 2HWTA 3GPAA 1WHWA 2CQCA 1IBKJ 4IG0B 3W1YC 1AUDA 3X3UA 4P73A 4MIBA 4P71A 4Y28C 1SJRA 4I56A 1MLAA 2KB2A 3UDVA 2QE5A 1N88A 4E8UA 5I3QA 3M8RA 3ELHA 5C5JA 4PG5A 2JC0A 3NKYA 3QSIA 4FBUA 3J7AN 1NSKL 1GAOA 4B17A 1U1OA 2CFXA 4NEYA 3VAIA 1FVSA 4I6AA 1S9EA 1SL2A 3G6XA 1B70B 3NMAA 2AWZA 2LQBA 3RB0A 1DARA 2QA2A 4PQAA 2G0CA 2ZM6J 3QAUA 5F8MA 1S0OA 3U1NA 5DZ7A 3EVMA 1JLGA 1FFWB 2CPXA 1C0UB 2ZH7A 1MG7A 2C3PA 4RW8B 3QYYA 2X3GA 3EUNA 4DF8A 1RISA 2UU9F 3EMTA 1D3WA 2UP1A 2C2NA 4BDPA 3VGVA 1NK8A 1GTHA 4OI4A 2WVCA 2R7UA 1PBUA 3CCRS 3QIDA 1SIZA 3MMJA 2QTWA 3MZIA 1T8EA 3HHLC 1U0HB 4FDFA 2M8DB 2F8MA 4JV0A 1VIXA 3NS7B 4N47A 4IR1A 3IBWA 1RTIA 3KLVA 2NS1B 1S9GA 2DR8A 1P9YA 2YH0A 2J9EA 2JNJA 2JOQA 5F0UA 1VYAA 4Q2MA 3R5AA 3KK2A 2CQDA 5IWAF 5KFUA 5L38A 4JI8F 1CULB 3MM6B 1DFDA 1CJTB 3S01A 2E29A 5KT7A 3TWZA 5JXSA 2LP4A 4HDHA 1GXTA 2BE7D 1C4AA 1CVJA 4DFJA 2CZ4A 1I1GA 3DOMB 1J5EF 5HI7A 1ZM9A 5ETTA 1IKYB 4EYHB 4O0NA 1RBAA 5K8NA 5M2PA 2KM8C 2MXYA 3FSYA 4NCAA 3RR8A 2GAHC 2RILA 4J9PA 2YNFA 3OV7A 3PIPQ 5K5MA 4OIXA 1U26A 2W9CA 1AA1B 2AT1B 2CWXA 1U6BA 1NAQA 3ADAC 4NA2A 1HWLA 2IVYA 2P9EA 2XG8A 3GCXP 3OJUA 2U1AA 2AJQA 1QTMA 1NSPA 2XYGB 2O1PA 2B43A 4ICLA 4P7TA 3I55S 4C97A 2OPRB 1QVGR 2L3MA 4C8ZA 2A2CA 3B4MA 1RTDA 2LU1A 2GVZB 1LWEB 2C42A 4FZVA 2G2YA 1FE4A 3DRRA 4KB7A 2J0WA 2DVIA 1HR0J 5MLCV 1Q8IA 4AL6A 2H51B 3OLAA 2COLA 4NZ0A 1NLKL 1TKTB 4X4PA 2L9NA 4WFZA 1UCNA 3R3TA 5HO4A 2BOAA 2GFFA 4OYMA 2EFOA 3QGIA 1E6YB 4M5LA 1WD6A 2W7OA 2B9XA 2CJBA 4ECWA 1WDTA 2MJUA 3PX4A 4HT7A 3GR1A 3SCJE 1UETA 5HVHA 5HQLA 4DL5A 1SJ4P 5DZ6A 2UU9J 3PCOB 3MHYA 1YI2S 3N0VA 2HQCA 4Q8FA 4LR8A 4MFBB 1PCAA 4DR7F 2BA9A 4U8VA 1WKLA 4ECXA 3FCHA 3THVA 3GONA 2XMTA 4J5OA 1EB0A 3A8KA 1Q79A 5F8HA 1JLFB 1H6KX 2W9BA 4CM0A 4DL4A 1RLCL 4NLQA 1VQPS 2FGOA 5KFPA 2Y3YA 3CDBA 4FF2A 2V50A 4DPWA 1R7IA 4HEA9 3U02A 1VDHA 4DR6J 4TY8A 3EM1A 2LQ8A 2J7KA 5IWAJ 2GQQA 2HMIA 5D4OA 4JI8J 1QSLA 3SBMA 2AGOA 1RJJA 3H8YA 3RU0A 4PQUA 3NNCA 5A8WB 2XM3A 3CC7S 3DLHA 3TVZA 3S6EA 2HBYB 1NEEA 4CZCA 2R8GA 1YX2A 4BS2A 3MR3A 1T7PA 2FYXA 1A6LA 3BJYA 1J5EJ 4H4MA 3HHLB 3GIRA 1YZ7A 4C2MA 4DSJA 3AA8A 3FBBA 4F4WA 1WJ9A 1U24A 4NCGA 2VPXB 1IKVA 3CIZA 1EQMA 4XDDA 2Q6CA 1JNZB 3I87A 3NBPB 1CC7A 1T9YA 4O3NA 3QFWA 2VD3A 5KFEA 2JJ4D 1KFSA 1UWBB 4EYIB 3SIPB 3J81U 2DNQA 4X4NA 3K57A 1REGX 1ZYQA 3A3NB 1CS4A 5L1JA 2YKPA 1T9TA 2D3OR 1FJGJ 3KLGA 3W9JA 1R43A 2Y8YA 1DLOB 3T19A 4KGKA 1FEHA 2ZFHA 3I9ZA 1BQMB 1SL1A 4QYZK 3ZTRA 1KKHA 1SXLA 2KM8B 1R6VA 4TKTA 2IC3A 4O3OA 2RU9A 1RU1A 4P2XA 3CCJS 2IM3A 4JI1F 3QT7A 3R5JB 2MQPA 2B51A 5DQHA 3IN5A 4LSNB 3ZFVA 1WC5A 4DR7J 4QZVB 4G65A 1FDAA 3UO0A 4UT4A 2G9OA 4Q5VA 3FEYB 4B3OB 4FF4A 2KH9A 4WE1A 2FJAB 3F73A 3JS9A 1NHUA 3G86A 4DL0C 5L1KA 2YVSA 3KFWX 4JI4F 4F04B 4ZPBA 2V69A 3M6UA 2VZ9A 3DM2A 4DL3A 1W2BR 4DFPA 2NXEA 1IJEB 2XLIA 3JB9k 4NLPA 4IH5A 4IOAQ 3OTCA 4FPIA 3M32A 4NRTA 1UJ6A 2DNRA 5DM6Q 1R27B 3SEOA 1RA6A 2J0XA 2AEMA 5KFSA 1TK5A 1PSDA 3BO4A 3R7NB 2H5JB 2XNQA 4BC9A 2LFVA 2QFJA 3PW4A 3IWLA 3MFHA 2MZ1A 1IBCB 1RU2A 4ZP8A 2IA6A 4OX9F 3BPDA 3W2WA 2IBKA 3WZ0A 2GGPB 1VRTA 2YKMA 4RKUC 3CO0P 4KSEB 4LF9F 5KFMA 1NDKA 2DNKA 3ILLA 1VGYA 4C8YA 1FESA 5B0DA 4X2BA 5DJBA 1M5HA 4WCEQ 3W8GA 2OELA 1HD0A 4MKYA 2CIMA 5I3UA 4Y0FA 3OT9A 1KLNA 2EG1A 1P1TA 2OMLA 1X0PA 3AT1B 1CJVB 2AYGA 4JI5F 2RMLA 2YKNB 3ENWA 2DHXA 2CUYA 2F9DA 5CCLA 2OD4A 3I5BA 2W2OP 2A1BA 4B9LA 2VQFF 4X66F 4CLYA 3R2DJ 2R7SA 2V8VA 3DRSA 2Z2ZA 5K20B 4M5NA 3D0GE 1Q8KA 4FP9A 1HNWF 4CP5A 4R8UB 3NS6A 3IGNA 2DHGA 4L76A 3TX8A 3SQOP 3GP9A 4B3TJ 2JC1A 1HQUA 3BN4A 3GB0A 2R7RA 4ES3A 2POKA 3MEGA 2OAUA 4G1QA 4ZVTB 1HHSA 1OSCA 3CF5Q 2FDNA 1DTQA 5BXIA 1RT6A 2E5LF 4QQBA 3S8SA 1YJ9S 3CMES 3KMSA 5KFJA 1MMDA 2C1EB 1UTAA 3JYTA 3H5SA 1HMVA 3N6MA 5D3GB 4JI4J 3IAS9 4F3MA 3EPGA 3MEEA 3JXOA 3TEGA 2GHPA 5J2NA 5HBMB 3BDPA 1T05B 3DLEB 2ZH1A 2D41A 5IV4A 1FX4A 3M8PA 4GVBB 5KFQA 3KLIB 3J7Z5 1ZPWX 2HYIB 4KRWA 4U67Q 2DGOA 3HZGA 2E5JA 3UCZP 3PW7A 4I68A 4YUDA 4CO5A 1B0VA 4OI6A 3OQ2A 3LGHA 3TA2A 2DRAA 4K4WA 2GHWA 2DB1A 2KG1A 4GVLA 2QA4S 3UCUP 3AOBA 3BZQA 2YX4A 3NGDA 3GSDA 3UW1A 2F4VF 2VPWB 4NLUA 1XMOJ 5HLFB 3MTJA 1FRJA 4X4QA 4RW7B 4LF9J 4DBQA 2P2CB 4RNFA 4LF1A 5EHHA 2XSJB 2EKNA 4OZJA 2JEIA 5E0OA 3HHNB 2B4VA 1N36F 2JFDA 4JI5J 2GA7A 4K4TA 3CDUA 3T5LA 1HYSA 3MGJA 2ZJQQ 3DOKB 1FRHA 2OFGX 2VASA 1SB6A 2GW8A 2ZITA 4KO0A 4X66J 2UZAA 2E7VA 2CPJA 3HHKA 4M95A 1S99A 2X1GA 5B0FA 1IKWB 1H3DA 5AE1A 1KVJA 3DXBA 3QWPA 1JXEA 1Q82T 3F56A 3PW0A 2VG5B 3IS9A 2B0GA 1RAIB 4NXMF 2ATCB 3H4DA 1B64A 4DR1J 2F8HA 1X0FA 1TFYA 4JYAJ 3UVJB 4MKBA 3OL8A 3O1LA 2GJIA 2MJNA 4U7UD 3FFIB 2Z2LA 4B9SA 4UQTA 1HBUB 1I94F 2CKWA 2VKRA 1FKPB 4WTYA 1Z2ZA 3ULHA 2VONA 3TOQA 1APSA 1LWXA 1YSJA 1SBRA 2E5LJ 4OMFG 2NYHA 2Y9HA 3AOAA 3WDOA 4KKOA 3ZZZA 3BGFA 1HNZF 3MF5A 6FDRA 2LYVA 3KK3B 4ZS6A 1NKCA 3E01B 4ECYA 1YWXA 3FMWA 2PI5A 2Z56B 2RVJA 3O3LA 5A8RA 2GIFA 2LVWA 2CQ0A 2H3EB 1XNRJ 1JLAA 2MGZB 2G2ZA 4KPCA 1VFJA 3I4HX 4M5KA 5AXNA 2H9ZA 3C3LA 2ZDPA 3QWUA 3OL6A 3CTRA 4PPDA 2CJXB 2LCWA 3RBXA 4CLWA 1LQ9A 1NXIA 2RUSA 3NP5A 4ECQA 5DQIA 4F02A 1B0TA 2FY1A 3MXHP 3QIPB 3DNCA 3KLFB 2EK1A 1SQFA 1RT1B 1QE1A 2FQQB 4ATNA 3CXCR 4OV6A 1GT8A 1BD6A 1VI7A 2CVIA 2MB0B 3PRBA 3FJ2A 3AXKA 2CNKB 3ILIA 5LJ3Y 3I9V9 1UJ5A 4FYWB 4RWWA 4QWDA 4LSLB 4ZVEA 2HBQB 1VC6A 2OPQA 4A8MP 2V4JA 2PT0A 2UXCF 2KXNB 3UN5A 2WVFA 3M6VA 3MFIA 2J6SA 4JI3F 5KG6A 2WW4A 2PFFB 1N36J 2HNDA 2RD5C 4U95A 3OTDA 5KFOA 1SC4B 5C25B 3A13A 3N6LA 2FJXA 5LSRA 2CNOB 2A0FB 3ISND 5HQ8A 1CJKA 1VJWA 2YWHA 2HFSA 1WACA 1T3OA 1YJWS 2F65A 1PGZA 4LBPA 3D9BA 3GCWP 2ZEJA 3CD7A 1R3NA 1IWAA 4O44A 3GV7B 1FHTA 2YNGA 4NXMJ 2DH7A 4B9UA 4J9KA 1CC8A 3I5CA 5CXTA 2PN6A 1UKUA 2ZC4A 1UEKA 4L74A 4KT0C 2XMVA 4CO2A 2VH7A 3N01A 2VJVA 4ZCMA 4DFMA 1RKIA 5KFVA 1RT2B 1P27B 2AJFE 3G8SA 2YWGA 1BGXT 1TV6B 2IVFB 4P74A 4P7VA 1FJ7A 3ONQA 4NXNF 4EZ9A 2OIHA 5DGBA 1CBKA 4DN9A 4M5GA 4ED4A 4DR3F 1KP6A 1HNZJ 4F25A 3UD3P 2DH8A 5J2QA 3DCAA 5L1LA 2KVQE 3EICA 1C1CA 4PWDA 4DV1J 3G71S 5HQMA 1NJYA 2QA4G 4CYUA 3O2IA 3POTA 3PYEA 3LP1A 2VFVA 3DU5A 3D3BJ 4DSKA 4NLGA 5BYSA 3M6XA 1TKXA 4M1KA 4QYRA 1TQLA 4ECVA 1OO0B 2HBZB 1XNQF 2H4WB 1MWQA 2IM2A 2K06A 2Q79A 1RAFB 3FGVA 1Y0HA 2IA0A 1KLMB 3G2XA 3J81j 3AH6A 3R2CJ 4LRCA 1HPZB 1HBMA 1RTHA 4OYAA 4F4AA 3PR5B 3W5ZA 3PEJA 2H48B 2PA3A 4J9OA 1DTTB 2QT7A 2UXCJ 3QT6A 2R7QA 3O6QA 3MECA 4I64A 4JI3J 4DUYF 3R6LB 2BV3A 1RCXB 1AT1B 1VQYA 4J9UE 3OW2R 3SXLA 2WVBA 4UZCA 1IBLF 3FMBA 3SZ2A 2J9DE 2KRRA 4WXWA 1XTZA 1P8GA 3PYDA 3EGNA 5DM7Q 1NZ8A 3P4UB 1YTYA 3ENQA 1UPPA 4JI6F 3J81Y 2R2TA 4HHUA 2RS8A 2LLZA 4LF6J 4YMEA 2ZKUA 5D15A 3W65A 4A8OA 4IO1A 3G96A 1RABB 3M1VA 2HZAA 1UJ4A 1DQAA 3HFKA 2DHHA 2I1RA 3DU6A 3KUHA 2WW8A 3M2RA 5ETKA 2DXDA 4XDCA 1WKKA 3BEGB 4ED0A 1PC4A 3AY0A 2RHSB 3H0PA 2I2YA 5CH7B 3FVYA 1BY9A 2DCLA 1ZZFA 2LEBA 2Z30B 4DR4J 1W2IA 2XBPA 3BSOA 4NXNJ 3DRRB 1V5VA 2CPYA 2VODA 1N5QA 1YIJS 1CQMA 1FKOB 4PRFA 2VICA 3OXGA 1NO8A 1K1SA 3UR0A 2HHHJ 3EPIA 4PXCA 2CRLA 3MWBA 2Y1LB 2YY3A 1S77D 2H54B 2HQIA 1SJQA 4OLOA 3R1HA 1EKSA 5CD4A 3IG1B 5E5NA 4LBIA 1TL5A 3SCIE 2BKPA 2B7CB 2C3OA 4Q44A 5IT4A 2UV8G 3CCQS 1V3RA 2MEWA 2RKIB 2V9KA 1WI8A 1ZTWA 3HHLD 2ZDOA 4F36A 3RBDA 1ULRA 4NWBA 3PFOA 2AYEA 1XK8A 2B8QA 2XGQA 1S5ZA 3KUEA 2BBEA 1ZH5A 1LW0A 3TW0A 2CPFA 3JSMA 2V2VA 4QJVA 4I0WA 4TY8B 5E2QA 4ERDA 1UZDA 2HMIB 1O8BA 2AJ2A 2R7VA 5B09A 3O5TB 2OUGA 4DUYJ 3MM8B 1C2PA 5KT3A 3RB3A 2LDYA 3OHAA 5F3ZA 1WWHA 1HHTP 1UL3A 3A3OB 1S7HA 3U7JA 3BSAA 2G1DA 3R9LA 3GIIA 3TP2A 3T1AA 2CJYB 2WTFA 3DYAB 4QWAA 4HTJA 4YS2A 3FEZA 2DNPA 4H4MB 3KMQA 1GMVA 3NEKA 1L3SA 3H59A 5D0EA 2WOMA 5KAKA 4OJ1A 3B78A 1NUEA 2H5IB 3RW6A 1IKVB 4AQYF 2CPEA 5FLXU 3OR1A 4NZ6A 2CG8A 3KLHB 4HTIA 1JLEA 4OX6A 3PZPA 3LWMA 5KT5A 5LMUF 2ERRA 2OPSB 4ANEA 1HQEA 5HK4A 1NM2A 2JVOA 1N34F 1RT4A 1I3OB 4WIIA 2XZWA 2RB7A 2M7SA 3V5RA 2CJAA 5CYQA 2L48A 3FKBA 2ZBQA 1S6QA 3VR1A 1H7WA 3L7UA 4WFNQ 3QRQA 5H9EJ 2QSFA 1RWMB 1FEEA 4DHVA 1T9UA 2VDIA 1BUXA 2J0SD 4HT5A 1EZZB 1WHXA 1Q8BA 2HNYA 2B9WA 3A8EA 3GV5B 1RLDA 3LH2S 1RYRA 3RBZA 4F26A 4LF5J 2DNOA 1P1LA 2DGWA 2DPIA 2RSQA 3V2UC 4HHJA 3DLGB 4RX6A 1M90T 9ATCB 2C22A 3MI7X 3IRXA 2WONB 3AAWB 1X4EA 3P49B 3V6JA 2J6TA 1U2CA 4KTQA 1GK8A 3CWJA 2XYHB 3UDLA 3C6TB 4ZPVR 2W8LA 4H4OA 4FYVB 3RAMA 4PABA 4C8LA 3OTBA 3GIJA 2HRTA 1GMUA 1Q86T 2ILYA 4R5PA 2N4CA 1EJ7L 5AJ3F 1VBZA 3NRBA 2HW3A 2MQMA 4USTA 1UW9A 2GC8A 3HJVA 4Y2AA 1TL1B 4OLPA 4JBCA 5HJXA 2ZH3A 5LSLA 5M2UA 2MKHA 2AEFA 4ZVPB 3D3CJ 2V8HA 4YDDB 4UOCA 2QEXS 1V3SA 1FCAA 4DPXA 4OYWA 4CI0B 1H73A 5J2PA 3GYXB 1QVFR 4H4KC 1N5SA 1FE0A 1H38A 4X64F 1FTRA 5HAOA 1V3ZA 4WFYA 1GQEA 5B0AA 3W2WB 1VRTB 5DS7A 4TYBA 2MQLA 3KHGA 1V9OA 2L9WA 2G4BA 3KHLA 1F6TA 4AQYJ 1SUQB 3I0RB 1JX4A 4DSIA 4QR1A 3BGRB 2B4PA 4NOHA 1KR4A 3M8YA 3DLJA 4AYBD 5KFKA 3LPEA 1TFWA 2CA9A 2HRUA 1S6OA 5LMUJ 3DGPB 4WP3A 4X65F 1SKWA 3Q8UA 3AD7C 4NLYA 1VIOA 3DHWC 2QG9B 1S76D 2HFOA 2PA8D 4YHHJ 4LUBA 3BH7B 1D9AA 3C15B 4ETXA 3G4SS 2W4CA 5H9FK 1JJ2R 4OHXA 1K1QA 4P52A 3TEHB 5ETMA 2AZ1A 4KV8A 3WC2A 1FDDA 1B7FA 2W2PP 4EFAC 3T6BA 2DHAA 3VAKA 2BANA 3LO3A 2ZWPA 1U0SA 2FPHX 1BWEA 1SVDA 3D28A 1TUGB 2LDIA 4O3SA 1YDLA 4J90A 1NHVA 2SXLA 2ZVSA 3MEGB 2EBGA 4PPZA 1NJZA 4F0HA 2GJ2A 4CLFA 2OMOA 3JAMU 2AGQA 1NSAA 1DJ0A 2DD8S 3HT0A 5BYQA 4IQXA 2NXNA 2CJKA 4QW8A 3H2VE 1DHMA 4I2PA 1VHIA 4HR2A 2LA6A 1X9WA 4IRDA 2N4DA 1RQ0A 2P9GA 2RRAA 4WFBQ 2JLGA 3QQCD 5AJ3J 3MEEB 2AZ3A 1MWZA 2XY6A 3IMQJ 2WRMA 1WTBA 1ITPA 5D4PA 3MOZA 1S72S 4P2SA 1U8WA 4DQQA 2NREA 3ZXWA 4LT6A 2OEJA 5D6GA 1GMWD 3N6NA 1R8BA 2MSSA 2W2MP 4N5SA 4RW4A 4LSZB 2IBOA 2ACYA 1VS3A 5EWEA 1RT3A 1FRXA 3MMCB 4KR0B 4DV3J 3ET6B 1VQ9S 1UFLA 2QRRA 1NJIT 1WDDA 1MU2A 2OD6A 5DG9A 4R0EA 2HVIA 4H54A 2DY9A 4K5SA 3UN2A 5E3QA 3V6DB 1R8PA 2EFNA 1U45A 3BBCA 1IM6A 3GFYA 3Q8YA 4DEZA 3I5AA 2Z57B 2ZUGA 3A12A 4X65J 5KOWA 2UVWA 3CCWA 4O4GA 4P6QA 1SL0A 2P5VA 2B6AA 1YRUA 4PAAA 3PM9A 3EYZA 3CNQP 4M5DA 3E51A 2I0XA 3OPKA 3GJQB 4OL8A 2JEFA 2FVRA 2GX8A 1H0HB 4KO0B 4HHHA 4AD6A 2QSWA 1N0VC 2G0JA 2ZE2B 1SKSA 5KFCA 1IN0A 4J9MA 3MMAA 2IAJB 4O0IA 1RI7A 3BGLA 3AJ1A 3AD8C 4A46A 3F0NA 1KWMA 1CJUA 3IS9B 3MM5A 1E6VA 4EZ6A 2ZD1A 3OFEA 3R5DA 2CNNB 1TL7A 3W8PA 1QAIA 2UVUA 1N6QB 4TU9A 5KG7A 3KHRA 1VQ7S 4RW9A 1TAQA 1OQ6A 1FDNA 2BOPA 1NK5A 4W92B 3G8QA 5ETRA 4ID5A 2J9DA 3T5HA 3PVXA 3M9NB 2BZ2A 2F40A 3AQOA 4KY3A 5FDLB 7FDRA 3IBCB 3HVTB 2R4FA 2VF3A 3CDEA 4KKOB 4N8NA 4C11B 2MTLA 1IXKA 3M8QA 2UXDJ 5A0YA 5K8MA 2BQRA 3PTWA 2ZBIA 4ED1A 1O5JA 4MMOA 3WC0A 3NLCA 5CZVA 4P2FA 1JB0C 3KDOA 5KFDA 3ZZOA 3LALA 4QIFA 3HXMA 3OSPA 2PIIA 2EC0A 4X4OA 1RADB 3H5UA 1JKHA 1W7WA 3K5NA 2R2UA 2IFXA 4LF2A 1AZSA 3HPOA 1LW2A 2VV5A 3ZNUA 2XCAA 4JUZA 2B7BB 5DO2A 2AU0A 4YP3A 3TRGA 1Z1ZA 1R8AA 1VRUB 4LF4F 1DBDA 4I6YA 5CQGA 3K17A 1QE1B 4PYAA 3GV8B 4C9DA 1R0AA 3BSCA 3G9CA 4KIAA 2XB2D 1JLBA 2XWXA 3NAIA 2NUUG 1JQGA 1F2HA 1OMSA 4BC7A 2Q66A 1WHVA 2BJDA 2QLFB 2DJWA 1KVIA 1HWIA 2OPPA 4I2QA 3SSRA 5ADZA 2V8PA 2D9PA 4K7QA 3RUBL 2ZBPA 1B0PA 4DMZA 2YNHB 2WHOA 2MKKA 4ECZA 4ZIWA 2HNDB 2BJ1A 5C42A 4RUBA 1HI0P 3FEXB 1MROB 5JUMA 8AT1B 9RUBA 1N32F 1CJKB 2C3UA 4NMLA 1HHQA 2BE2A 3FRYA 2AX1A 2J8SA 1SC1B 2M3DA 4FXDA 1T9XA 4RBVA 3TI0A 3OR2A 1RWVB 2KT5A 3LQVA 3HSJA 5BR8J 1N5YA 4NLRA 1PJ5A 3U27A 4OZLA 3FQKA 4OHVA 1HNXF 1D9FA 1KS2A 3JTPA 2BDPA 4KFBA 2UUBF 4J9QA 3M9MB 1LWCA 1U1LA 1AROP 2V67A 1U4BA 4RLEA 4DG1A 2QGFB 5GMDA 1OQ3A 3C14B 1HBNB 3K5LA 1EETA 4MH8A 2C28A 2GMLA 1D8YA 1H2UX 5A6WA 3SCKE 3BYPA 2VU5A 3SI8A 2GS8A 3DLBA 3ITHA 4V19X 3A3PB 3AXMA 3P45B 4O23A 3JTNA 2KN4A 1TR0A 3BGOP 4C0HA 3BKTA 4ED6A 1HBOA 1AYEA 1H2TZ 3FQLA 1U1MA 1Y3KA 3CMQA 2NPIA 2CQPA 3EVOA 1IM4A 1KNZA 4CM2A 1C1CB 2E9TA 4PWDB 4QR0A 2A6MA 1FXLA 1Q1KA 1WF2A 3MMBB 5K8PA 3FCVA 2P6SA 3AB4B 3POTB 2J6UA 3TARA 1XN9A 3LP0B 3RAQA 1WF0A 3T3FA 2MKYA 2Z58B 2W4DA 4GKKJ 5GMEA 1LV5A 2ASDA 1TKXB 2ATLA 4J37A 4UW2A 4KH1B 5HL7Q 4YY3J 1VQNS 4ZVSB 5DG8A 4FXWA 2NUHA 3AHPA 4LF4J 3HF5A 4UOHA 4B3SF 5CYMA 1K0VA 4QIVA 1S1WA 4NYZA 4ETZA 2MKIA 2VQEJ 4YR2A 2VG7A 1RTHB 3GJSB 1NHKL 4N41A 4LFBF 1SV5A 2OEKA 4E98A 3C8YA 5L9XA 3C2PA 1RHQB 3DLLQ 4MKVA 4LRAA 3NG8A 2HHUA 4WU3A 3R1LA 2XNRA 5FJ4A 2FC8A 3DKDA 1VCTA 4MTPA 1BQNA 4UY85 3TX0A 4M63A 4DPTA 2R3VA 3NCQA 5FLXY 3VF0B 3BS9A 1N32J 4Q2LA 2MY7A 4AE5A 1NK6A 3OTEA 4USVA 2WCXA 4KC5A 2K2PA 1S1VA 4RNNA 3UPFA 4XK8C 4P2MA 2DNNA 1ZBTA 3HSZA 4A8QA 1F9EB 2HK2A 4DX5A 1TL3A 2KG0A 1HNXJ 2YWKA 3SQGB 4WF9Q 1KQFB 2UUBJ 3RG6A 5KT6A 3TZYA 1JLCA 3PW2A 3R8YA 1NPPA 1RBLA 3V81A 3D0HE 1W25A 3KYLA 3CC2S 5HP1A 5G4DA 1U7LA 3PEHA 3W2VA 4EK2A 1RAJA 5F8JA 4I7FA 1MSWD 2LKZA 3UDCA 5F9NA 3AA9A 3Q2SC 2V94A 3QRRA 1WC3A 3QGPA 2K8GA 2XZDB 2CJ9A 3CDWA 4JB8B 2IY5B 4ZCLA 1LWFB 2QMXA 2V8DA 3HMJG 2BQUA 2V4QA 1G4CA 4ED5A 5K8OA 2MMYA 3TJ9A 2PMZD 3VAFA 2QL9B 3UFCX 5MAOA 4WU2A 5J1EB 2VUGA 2BX6A 5F41A 5HANA 1W26A 3PIOQ 3CJTA 3MM9B 4B9NA 2F4FA 1TKZB 1T11A 2AX0A 1CEZA 4F4YA 2LEAA 4DV5F 4RNMA 2RQCA 1OYDA 4NLXA 2UUCF 3MURP 3C16A 3KUGA 3QBCA 5KFFA 1VJQA 2CDRB 3GYGA 3KOAA 2HHPA 3WHIA 3ILOA 5IS2A 2DT9A 5A8KB 4LF7F 1TVRB 4MIAA 4A8YA 2EC2A 4L6V3 4IG0A 3MAAA 1CG2A 3H5XA 5AXKA 3IWXA 3EE3A 3OFFA 2QIFA 4ID8A 1IUJA 4NLOA 2EWHA 4ZVOB 4LFBJ 1Q53A 1FWKA 1X5SA 3MAHA 5HATA 3FBCA 3DGVA 2ILZA 1PO6A 3W5XA 1NH7A 5B08A 3PYFA 4AXIA 2BXJA 3CW2C 5IM0A 3VCDA 2Y0BB 4JI0F 1B99A 5J2MB 1XR7A 4HDGA 1FERA 1PIEA 1I5OB 2R8JA 4EUVA 4ZA1A 3CJSA 1C0UA 4RW8A 3Q8QB 4MJKA 4PG8A 5DGAA 4CLLA 2E1RA 2DR7A 3OR1B 1FD8A 1HWUA 3R5BA 4PG6A 2VBYA 2KXHA 3JQJA 4WWSA 3VAJA 5GVQA 3ZNJ1 3D4JA 2HPUA 4LRBA 4GKJF 1GX5A 1ROFA 2QYCA 4IOCQ 4JV1A 2CJQA 1K0TA 3Q8RB 2CZ9A 1U0HA 5EWFA 1G1XA 4JOUA 4FKXA 3TA0A 1UVJA 5CYQB 5F8LA 4DSFA 4RU2A 2PD1A 1Q7LB 4ANCA 1FNXH 4HYKA 1S6QB 2J5AA 4EO6A 1M1HA 2PE8A 1S57A 4NMXA 4URQU 3T5JA 3G87A 2FLLA 3T41A 4OQJA 4DX7A 3UN3A 3OFGA 4WBFA 1QSYA 3JAMY 3G82B 1KVKA 3V6KA 2H1YA 3T1YJ 1CULA 2BM1A 3MM6A 1RHJB 3QLHA 3T1HJ 1CJTA 5HSPA 3K8WA 3V4IA 1NMEB 4KQZA 4PUOB 2HGNA 1VQ6S 3EGWB 4DV5J 4A8SA 5LM7E 4WK1A 5G0RB 3JQMA 2JEJA 3DOMA 3VZIA 2UUCJ 1ZAVA 2LEPA 3NNHA 4Y65A 1Q16B 2N7YA 3FSIA 4JV2A 3NMRA 3CJ4A 3BQ0A 3I0SB 2NZCA 1YBTA 4IFVB 2XI2A 4DCOB 1S1UA 1N5VA 1TTHB 1JLQB 4LFAF 4L73A 1SIWB 4K8RA 1S4EA 2HURA 3RYLA 2XWYA 2B56A 1FJCA 3K5MA 1ZOTA 2FVPA 2BACA 2A3JA 2R8IA 2HHXA 4YB5A 4EO8A 2DYAA 3GMGA 1NJWA 1Y9OA 4RNOA 1RAGB 4WKRA 2Q3PA 4OZ3A 2Q43A 2OPRA 1S4FA 2GVZA 5KFGA 4LIWA 5J2PB 3PO5A 1JIHA 4QPXA 4USJC 1TKTA 2IM1A 2FLPA 4JI0J 1RWOB 3KHHA 3FK4A 4KYZA 2F7VA 1EKRA 1F5BA 1E6YA 3IM8A 3CJ0A 3IFEA 3MUVP 2CQGA 1KN6A 3SV4A 2ALZA 3B4DA 2HGLA 4USWA 4Y2KA 1G6BA 2JRSA 4XAKA 2XQCA 3CD0A 1HW9A 4FVCA 4M94A 4G1IA 2XLJA 1YBAA 3EZ5A 1C0TB 4PXBA 3OL7A 4DR2F 3F44A 3DMJB 1YBUA 1UVLA 2QA1A 4PWUA 3GLJA 3L4BC 3PW5A 1U6FA 4AXJA 4X62F 1RAAB 1RTJB 3HI9A 2ADCA 1JLFA 3K5OA 4C3LA 4K2JA 3W64A 4HACB 4UZBA 3TUZC 4C3KA 4RW6B 5T7LA 2M9KA 3GJTB 5C24A 4JP8A 3Q86A 4NI2A 3IGVA 4NCBA 4ZCKA 4HI2A 3P5TL 1WC4A 4RUAA 3MPYA 3NWGA 3CJKB 2FJVA 3GIKA 4X4UA 1DURA 2EBEA 3KJVB 1FDBA 2VOPA 2QJ3A 3HSDA 2Y1JA 2A6OA 2J0QD 5A8WA 1XIQA 3LAMA 4BLGA 2F5GA 2KYZA 1RWPB 1R0CB 3PKMA 4ZJQA 3QJPA 4BCAA 2AQ4A 4CT8A 2Z2YB 3LAKA 4PEOA 3FDSA 3HHLA 4P10A 3BF4A 1S10A 2MZQA 3CJQA 3HX9A 5IT9U 1YITS 2GIRA 2DR5A 2RIJA 5HN0A 4ELTA 1U1RA 2DH9A 3OLBA 2P9CA 1HL6A 2ZHAA 4LBHA 4PCQA 2KFZA 4Z7YA 4N76A 2OFHX 2OHDA 1YKWA 3OHBA 1UWBA 3CSKA 2VBWA 3OTOF 1K44A 1Y7PA 3MOJB 3DRYA 4NPOA 3VGSA 1UMJA 1ZZNA 2HEKA 2QC3A 2WBMA 3H2UB 1Q4RA 2AJ4A 2G2OA 3HZEA 1DLOA 2OI2A 4LIRA 2VJUA 1VQSA 1QUVA 1OJ4A 4RW4B 2XY5A 1U8SA 4CRJA 2MQ8A 5DG7A 2F3JA 2V34A 4WP8A 5KFHA 3TYTA 2OJ3A 4Q45A 5BJRA 4ZHRB 4A8XA 5L9NA 2DIVA 3H98A 2YXLA 2HQGA 4EGLA 2E1PA 2UV8A 3W9HA 2HS3A 4J9SA 3G6YA 2DKOB 4TLQA 3O44A 4LSNA 2I8EA 1N5TA 1X7VA 2F1FA 3OJSA 3ZZ0A 4DR2J 4C8OA 2BJ7A 4LMZA 1M0SA 3HVAA 2C2DA 2FTRA 2KI2A 5ETSA 3VQSA 2CAJA 2FY8A 3TAMB 4B3OA 5KFRA 2NXCA 3EGZA 3B8HA 1REVB 4QIWD 4KBIA 5ETQA 3E8OA 5F3TA 3Q83A 2HWHA 1S1XB 2BJ3A 1N33F 2VOOA 3KNGA 1TKDA 3HO1A 3C6UB 2RNEA 3OUYB 1H7XA 4QBUA 1JJHA 1UP1A 5CABA 1F1BB 1N56A 1FRIA 2NLWA 2RF2A 4OYOA 1CJUB 5KG2A 4RUCA 3CD6S 3LP2A 2I6WA 3W63A 3DLKB 1TL7B 4QOTA 2GVDB 2HAIA 5DDQC 3DFEA 1DQ8A 2YNIB 3SDEB 3GR0A 3KKFA 5ITHA 2QZ8A 4Z37A 2VFSA 1X4BA 1DRZA 1VQ5S 4NYPA 1HNVB 3HP6A 2RH3A 1QY7A 1EQ0A 5GAHU 1NRKA 2ZWOA 1OPZA 4NX9A 3GG1A 4DQSA 2QMWA 2V2ZA 2XS2A 3OTOJ 4FS1A 3BREA 4DV6F 2N82B 3NGKA 1X9SA 1JKHB 2CPHA 3D6FB 2BW7A 5ETLA 4FYXB 1AZSB 2KHCA 1OIAA 4RU9A 4OHWA 5DDPC 2CZVC 5I4MA 3HT3A 4ZN3A 4QW9A 4Y3CA 4ZK7M 2ZZTA 5DLFA 2HS0A 1U1QA 4AL5A 4DLGA 2WB1D 1YZ6A 4LREA 1UFKA 4CO1A 3GTYX 3DRPB 1S59A 2AJ1A 4TLRA 1R0BG 2QFIA 2N3OA 2K7KA 3VV2B 3RBEA 1UVNA 2VFTA 4D3HA 2FB0A 4NA3A 3JSBA 2VFRA 5EUHA 3GJRB 2JX2A 5EGYA 3QGHA 3P6YC 4IG3A 4WTOB 4QWCA 4MK8A 1NDCA 5C42B 1U47A 3KG1A 5HMYA 1KOHA 2V6AA 1UVIA 3TAQA 2B5JB 2BW2A 1XQIA 2OSQA 3TZZA 3SSQA 5HBMA 1T05A 3DLEA 4EBCA 3OR2B 5I42A 5A2QU 1BQXA 5IXUA 1N5YB 4JI1J 1HNIB 4F4XA 1S1TB 4DJBA 5DDRC 2RDDA 3Q24A 5K9FA 2YQ1A 3DOLB 1RSCA 3SSSA 3MR5A 4B02A 1Y5IB 4V19J 3IC1A 4LF8F 2DGSA 1VOMA 3TUJC 1NCLA 1VHFA 3QMQA 2IDEA 2E7WA 1HI1A 2W2NP 2I38A 2XTJP 5HLFA 4ZDNA 5ETOA 4CLTA 5ETNA 1NK4A 2KRBA 2VPYB 4RWXA 4ITSA 2IDLA 2XSJA 2XLKA 1HBOB 2MKSA 3A8JA 4A8FA 2BQ3A 1UW4A 4I1TA 4CO4A 2CQ4A 4HVZA 4DUTA 1IR0A 3ETOA 3R7SB 4RUHA 3GYNA 4DV6J 3QT5A 3DOKA 4RL1A 1GMWA 4DZ6A 3AQPA 1ZTTA 4OI1A 1G2EA 4ZPTR 3H90A 4C3MA 2HHVA 3K5PA 1JXLA 1PJ7A 1T0TV 2VB6A 5KG0A 1IKWA 1AXQA 4OX9J 1U09A 3MM7B 4FXVA 1S79A 5IV3A 2I5JB 5CD4H 4IH6A 4ZP6A 3JTOA 2VG5A 2KZZA 2B3TB 2VBXA 2L41A 2E66A 2CDQA 3K7RA 3CD5A 3UVJA 3D0IE 2ZVIA 3FFIA 1OY8A 3DI6B 5LXYA 3IR7B 3TUIC 2PGCA 3KK1B 2M0GB 1WG4A 1F5AA 3H7HB 3UDEA 1BQNB 3R27A 5CAAA 3Q8SB 1U48A 1LXNA 2VQFJ 1QAJA 4L72B 4S0MA 4DZDA 1P6TA 4P9SA 2E5HA 3KK3A 4F0KA 3M2VA 1T03B 2ZM6F 3E01A 2GMJA 1Q5VA 5K14B 3RRKA 1S1VB 1HNWJ 2ABYA 5M2RA 2JVRA 2E5IA 1PYOB 1RYSA 3EXCX 4J91A 3HD1A 2ZH9A 1BMQB 1TL3B 1XERA 2B9YA 4N56A 2XMUA 3RRGA 2OGUA 3KTQA 3BBFA 4FN5A 1EHWA 2HGMA 1IKXB 3HLUA 2VHGA 4TU7A 2K7JA 1WEZA 5KFIA 3K58A 1LNQA 3KLFA 5HP1B 3CEDA 4DF4A 2X51A 1RT1A 2HAFA 4CO0A 5HROB 3CC4S 4CLPA 1WI6A 2UVVA 4L3NA 4F3OA 4X4VA 2C3MA 3PO4A 4LSLA 3VAHA 4CT9A 3BQ1A 2OTLS 1FFGB 3UE2A 3PRDA 2KFNA 3QT8A 2JDJA 2QLWA 4AFFA 3EZOA 2ZBRA 1DAXA 2OH2A 4IUFA 1QLNA 5L46A 1NSQA 5L8RC 2V9WA 3M9OB 4K59A 4RNHA 1HFEL 2MYFA 1A0OB 3BSNA 3NGUA 2DISA 5C25A 1OSDA 2DNGA 5IC4B 4DOZA 3TNVA 1UPMB 2PI4A 1WG1A 2RDJA 3SMZA 1ZAWA 2DEIA 2M52A 4K4VA 1Y11A 3QJLA 4DSEA 1RA7A 2KXFA 4KGXB 4EEYA 4ZPWR 5D4NA 2F4VJ 1JXVA 1NH8A 4PG4A 5HVGA 4ZVRB 4IYQA 2XHWA 3LW5C 2FVSA 1HQ2A 1XBWA 4WZMA 3M30B 4IFYB 3OXFA 2IM0A 1NJXA 3MAAB 4GC6A 2AP6A 3QGGA 3BPSP 2QX0A 2W24A 3THTA 3NCRA 2XHCA 1F60B 3VWSA 1JWWA 4YR0A 1X4DA 1RT2A 1TV6A 1FD2A 2W7PA 2XGPA 3DXSX 1D8ZA 1HR0F 4DDFA 1C4CA 2M70A 2AF6A 2RDIA 4OYPA 5IM0B 1S48A 2N3LA 3NGRA 3M2UB 2DPJA 4ECTA 1X60A 1HD1A 3TZXA 1RWUA 2B4UA 4FBTA 3V4MA 4N7TA 3SYZA 5B0BA 2J76E 5J1PA 5THWA 1FRMA 5GAHI 2BKOA 3O8WA 1SH0A 1YRTA 3J7YU 4Z2XA 2DRBA 1LOUA 3PACA 2AKWB 1D09B 2PMWA 2RE1A 4YOEA 4U7UK 5DRKA 6FD1A 4G6VB 1I94J 3BO3A 2HFZA 3MDFA 2QO3A 2XI3A 4XIUA 1WOSA 2V8GA 1VQMS 1KLMA 1XC9A 4CO3A 1HPZA 1S9EB 1D9DA 5LXRA 3UCGA 4DR6F 1DTTA 3N9UC 5KG3A 4KAIA 2C3YA 1WSRA 3MEDA 2J7UA 5AE3A 1JLGB 5GAEU 3HSGA 2YX1A 2P6TA 1URNA 1GXUA 2NXUA 1UEVA 1ICEB 3QJJA 2R2SA 4Y6IA 4MYTA 3QLHB 3G6ES 5IT9Y 2H65B 4ELVA 1FXRA 4UTGA 1K8AT 6AT1B 3V4IB 2QL5B 3NS5A 3PX6A 4B9MA 1DY3A 4WP9A 5KT2A 2J9CA 1RBOB 4QWEA 3MUTP 5A76A 2IJFA 3CJ3A 1FWLA 4ZVGA 5DETA 4M5IA 3VQTA 2VIHA 1J5OA 2XEXA 1FF2A 3L9ZA 1RTIB 3PRVA 1S1UB 5D8HB 5B0GA 1S9GB 4WJBA 3OVAA 3L3CA 3C66A 3SCLE 3BB5A 2FZCB 4QU7A 4ZP9A 4YFUA 4HH1A 1SC6A 2HHQA 2Q1LA 3KK2B 1HARA 1F5CA 3DDKA 2A10A 4ELUA 1VC0A 4Y00A 4C48A 2ZH5A 2NYIA 4K4SA 2ZHOA 2W25A 1FJGF 4QR2A 5E3CA 1M5OC 4YQWA 4B08A 2D3UA 4IKAA 3OVBA 4UUXA 1S6PA 3PV8A 2MQOA 2LXUA 1AB8A 1FKOA 2DXFA 4DUZF 3HKWA 3R7BB 3MCMA 3I4PA 3TQEA 3H42A 1QAYA 2OEMA 3EJMA 1H72C 4ZLNA 5HMWA 2XO6A 5JVGQ 4U6PA 4L3KA 2YNFB 3RW7A 1UEUA 4FPRA 2W9CB 2HVHA 1R31A 3IG1A 4TQSA 2XO7A 2ZC3A 5EDWA 4CH1A 4XPCA 2ZBCA 4FS2A 1FRLA 4ICLB 2RKIA 4I67A 3FRZA 2MDAA 2VBZA 1RTDB 1A9NB 5FD1A 1VLOA 3IR6B 4QIGA 3H40A 1WOOA 1LKZA 4CWBA 3X1LB 3CO9A 2NXJA 1Y3JA 2V63A 1YJ7A 4QYZJ 2HK3A 1CQNA 4DR3J 5T7LB 4BBYA 2V4RA 5C24B 4NI2B 3MD3A 4C8NA 4DQIA 3QFHA 2C2MB 2RU3A 2LECA 4OZ1A 2PSZA 1Q7YT 2HBRB 3UI3A 1TP7A 3GIMA 2QLXA 1FWPA 1NPRA 4AT1B 3MM8A 4OZ2A 2B9EA 2EPIA 3IR5B 3KXDA 2DNZA 4JI2F 1PKUA 1PILA 3DYAA 4IRCA 2KDOA 4ED3A 1XNQJ 2IRXA 4A47A 1LK7A 2W9BB 1ZM4A 1U1PA 4HH0A 5IQQA 3GFXA 4Z7CA 4KHRA 2EFPA 4X4TA 1WKJA 3W7BA 1U2RA 1G3OA 4WZQA 3KJNB 4CNYA 3D67A 3KLHA 5HMXA 3G8TA 4DLEA 4L75A 2OPSA 5D0GA 1WELA 2CXEA 3V6HA 1RB0A 3I96A 4ES2A 2L9DA 5CZXA 3B82A 2ZOMA 2MZTA 1NPKA 4PQUB 1QDUB 1PBAA 4RJVA 1IBLJ 3SFUA 2ZZNA 4OV1A 4KJIA 1RTZA 1T02A 4O3PA 1OWXA 4DUZJ 3UQSA 4DX8H 4JI6J 4B9TA 2PEHA 4WFAQ 1RAOA 2Y1RI 1R8CA 2IJRA 4XTTA 2V68A 5ETVA 4NCGB 1YJTA 3H5YA 2LA4A 4B9VA 4Q43A 4B3TF 2FHJD 3MCOA 1Q5YA 4U8YA 3TA1A 4K4ZA 2DGQA 1GXLA 3DLGA 4ZP7A 2HQFA 3KJFB 2VPZB 3R97A 2KVIA 4ZPDA 4TVAB 4ED2A 1WF1A 5AE2A 2E1AA 4ILLA 2WONA 2CWKA 2GV1A 3TANA 1A7GE 1CS4B 2I9SA 5A2QY 2CYYA 3KLGB 3MAQA 2WVEA 3K59A 3C6TA 3TJAA 1NKBA 3G6VA 3H25A 4DL2A 1T95A 2ROGA 1YK9A 2CQBA 1YLXA 1NB7A 1JJ4A 3CCZA 2UUAF 4IRKA 4USKA 4OYBA 1NB2A 1BHNA 3CCTA 1VMBA 2AW0A 3ZZPA 3UNYA 1TL1A 3CE8A 2IC3B 2MSTA 4LFCF 3VZHA 4OYXA 2X1BA 2RF2B 3IBFB 3MR6A 1NZAA 4LRDA 3BQ2A 2VDHA 3IM9A 4USUA 3LP2B 1VK3A 2APOA 2VFUA 3MPVA 2DNHA 2HFUA 4CDIA 2JL9A 2AHOB 1IR1A 2EG2A 2VA2A 4JI2J 4USHA 4CIOA 1XMOF 4WE1B 3FNNA 3LGMA 4DCJB 3RJMB 2RRNA 2K1RA 3L95X 3LA0A 3EWGA 5B0EA 4CH7A 3QO9A 5I3PA 3DM2B 1Q81T 4NLWA 1SUQA 3I0RA 1SC3B 5LOQA 3BGRA 1NKEA 5KFYA 4GO7X 4ED7A 3J7ZT 2MKJA 1RAHB 3DGPA 1FXDA 1S6UA 2FC9A 1S0VA 3M32B 2WSEC 4NA1A 2KT3A 3BDEA 2XMJA 1TU0B 2ZH6A 2EFGA 3NCPA 3FZBA 4OHZA 1C1BA 3J7YI 1X5TA 3C15A 3R5CA 1YHQS 2YKQA 1N48A 4BWJA 3CPWR 2FUG9 2AYMA 1HWKA 4C4WA 2W7AA 3N5FA 1R8HA 4YEAA 1S0MA 3W60A 2NSCA 2RS2A 3ZC4A 3TZWA 1IWGA 5KG4A 2GQ2A 5H9EK 1NDLA 2DIUA 2YKMB 1L3TA 1EP4A 2CQIA 5L1IA 1RP5A 4CLKA 4DR1F 3IWNC 1YJVA 4Q0BA 1YJRA 5I3UB 2R7WA 4JYAF 5IFMA 1SJFA 2ZZMA 2ZKTA 3CT9A 3M8SA 5GAEI 2M8HA 3W61A 4C7QA 4ZMMA 1N34J 4FKYA 3AFGA 4LR7A 4AL7A 4IG3B 1KONA 2D3ZA 1KQSR 4F3QA 2WAQD 3TR5A 2H4YB 3NGSA 3W5YA 3DRSB 2R7OA 2YQ0A 1X4GA 4ED8A 2R7TA 2UUAJ 4KGVB 2W01A
chains in the Genus database with same CATH topology
2LXIA 3SXLA 1YBAA 1T3NA 3AB2B 4Y2IA 3MTKA 3EZ5A 3ITHB 2I5JA 1C0TB 4PXBA 4G1PA 3OL7A 1IBLF 5KFNA 1Y4ZB 4XO0A 2NPFA 4RW7A 4DR2F 3FMBA 4URSA 5I42B 2J9DE 3SZ2A 1JMTA 2KRRA 4WXWA 1XNRF 1MNEA 1XTZA 1FJEB 2D74B 3F44A 3DMJB 1P8GA 1VQ8S 1UVLA 2QA1A 4PWUA 4YB1P 4OFZA 1H98A 3EGNA 1F9FA 1HQUB 5DM7Q 1YTYA 3ENQA 3PW5A 1U6FA 1IQTA 4AXJA 2V0NA 4JI6F 3LUYA 4X62F 1RTJB 2N7CA 2HIQA 3J81Y 3HI9A 4OI0A 2HRYA 1JLFA 2R2TA 2ADCA 3K5OA 3WBZA 1YG0A 1FT8A 2KT2A 3TAPA 4C3LA 1XR6A 3K2YA 2RS8A 4QWBA 2LLZA 4C0OC 4G1QB 4YMEA 2ZKUA 3DI6A 2WSCC 3TUZC 4C3KA 4RW6B 5T7LA 1DTQB 2M9KA 1ZAXA 3KK1A 5C24A 4A8OA 5KG1A 2ZH2A 4IO1A 3D1QA 3EX7B 3IGVA 3G96A 4NCBA 1Y00A 4PXEA 5SUHA 2LQ5A 2MQNA 3M1VA 4ZCKA 1L5UA 3MMCA 1UJ4A 4FNHA 4HI2A 1DQAA 3P5TL 1RT6B 3HFKA 4RBUA 1N4LA 2I1RA 4RUAA 1KHVA 3VALA 2ZJRQ 3DU6A 3MPYA 3NWGA 2XULA 1R89A 1FNMA 2WW8A 3CJ2A 3ISNC 3CJKB 3M2RA 2FJVA 3GIKA 1QAXA 4XDCA 1LFPA 4ECSA 2IRUA 4X4UA 2UXBF 4BWMA 3JYTB 1HMVB 1S49A 4IH7A 3BEGB 1DURA 2EBEA 5GADI 3KJVB 4ED0A 2AD9A 1PC4A 1UVKA 3AY0A 1KTVA 1FDBA 1GNKA 2RQMA 3T9NA 2VOPA 2I2YA 4WXOA 5CH7B 3FVYA 3MUMP 3V6DA 1BY9A 1T03A 2DCLA 1S0NA 1ZZFA 2FJBB 4R25A 3DC2A 2Y1JA 3GQCA 2LEBA 3CIMA 2J0QD 5K14A 2Z0GA 5A8WA 5J2NB 1W2IA 2NZ4A 2XBPA 3LAMA 5CYMB 3BSOA 2R8KA 1O51A 3DRRB 2KYZA 1S1WB 2CPYA 2VODA 3PKMA 1N5QA 3M6WA 1YIJS 3QJPA 4BCAA 2E7XA 2XSFA 4DV0F 4DR5F 4CT8A 3M8PB 2AQ4A 2MY8A 2QV6A 1YRXA 4MYUA 2C2RA 1CQMA 3OVSA 1FKOB 1AW0A 2VG7B 4PRFA 3OXGA 1IBKF 1NO8A 1K1SA 2RQ4A 1YQHA 2FGCA 3UR0A 2ZJPQ 3LAKA 1K73T 3QZ8A 3EPIA 3FDSA 1P9QC 4PXCA 2CRLA 2O67A 3HHLA 3WX4A 3MWBA 2IMOA 1JNRB 2KZMA 2YY3A 3BF4A 1S77D 1S10A 2KHDA 2MZQA 2HQIA 3HX9A 1SV5B 1SJQA 3PFEA 2HLTA 2VG6B 2XC9A 1YITS 2GIRA 4H4KA 1IKXA 1KSPA 2LMIA 2DR5A 2RIJA 5HN0A 5CCMA 4OLOA 4ELTA 1U1RA 2DH9A 3OLBA 2P9CA 1HBUA 4OX8A 3ISZA 1GX6A 2HG4A 3R1HA 1FKPA 2ZH8A 1VQ4S 1HL6A 2ZHAA 2ZE2A 4K50A 3IG1B 5E5NA 4PCQA 3HHDA 2BRLA 3MD1A 1TL4A 2UVRA 1TL5A 2KFZA 3SCIE 2IAJA 4N76A 2OP5A 2OFHX 2EKYA 4GO5X 5HROA 2B7CB 2C3OA 5E3RA 5IT4A 2RT3A 4Q44A 3M4XA 2UV8G 3OHBA 1UWBA 1TK8A 3CSKA 3CCQS 2JHEA 2BUNA 2M88A 1V3RA 2VBWA 3OTOF 1Y7PA 2RKIB 2HQ3A 2V9KA 3BGUA 1HI8A 3MOJB 3DRYA 2JH3A 1WI8A 4NPOA 2K3KA 4ZLPA 3HHLD 1ZTWA 1SJ3P 4F8RA 1UMJA 2ZDOA 2OKQA 1ZZNA 2D1CA 2WBMA 3RBDA 4FF3A 3H2UB 1Q4RA 1ULRA 4NWBA 2AJ4A 3PFOA 1N6QA 4K4YA 2XS5A 2AYEA 4YDXA 3HZEA 1HA1A 1DLOA 3HHEA 3QAEA 1XK8A 3HVRA 2Z4PA 4LIRA 1VQSA 4DQPA 2XGQA 1QUVA 2MGZA 3T1YF 1YJNS 4CTAB 2GMHA 4RW4B 2XY5A 1U8SA 2D7SA 1AFJA 3T1HF 5DG7A 4RZRA 3CMAS 2BBEA 2J8AA 5DQGA 1ZH5A 4Q8EA 1HYSB 1LW0A 1X9MA 3TW0A 2CPFA 2BM0A 2F3JA 3JSMA 2RRBA 1O0PA 4LVOP 1JLCB 3BR9A 4D3GA 4QJVA 4I0WA 1X4CA 4TY8B 3V81B 2UUTA 5E2QA 4CCHA 4J9RA 4ERDA 3D1OA 5KFHA 3TYTA 2OJ3A 1KC8T 4Q45A 2HMIB 1O8BA 1OPIA 5FDLA 3I32A 2MPUA 5BJRA 2R7VA 4X84A 3QIPA 1UA1A 3HVTA 3O5TB 5B09A 4C11A 4ZHRB 3PXGa 4A8XA 3T6JA 5L9NA 2DIVA 4J9LA 3H98A 3MM8B 1C2PA 1IQZA 2LQ9A 5KT3A 3SFGA 4EGLA 4JV5F 2UV8A 3W2VB 3RB3A 3M2VB 2HS3A 4HI1A 4J9SA 3G6YA 4I7FB 2LDYA 4NRUA 3OHAA 4TLQA 3O44A 5F3ZA 4LSNA 1WWHA 1N5TA 2I8EA 1X7VA 2F1FA 1HHTP 3OJSA 3KLEB 3ZZ0A 3PR4A 5HP1B 1UL3A 2C2EA 1S7HA 3U7JA 1IJFB 3BSAA 2G1DA 2DR9A 4DV1F 3GIIA 4NZ7A 3TP2A 3T1AA 3LOUA 2M4MA 4C8OA 2WTFA 3DYAB 4QWAA 4HTJA 3M30A 4IFYA 4LMZA 1M0SA 3FEZA 3HVAA 2JLFA 3TVKA 2C2DA 2FTRA 2KI2A 2VA3A 3VQSA 3TAMB 4B3OA 5KFRA 2ZNZA 5KFXA 2DNPA 3EGZA 4TNOA 4H4MB 1DQ9A 4OJHA 4HKQA 5KTQA 5KFWA 3B8HA 3KMQA 1REVB 4QCLA 4QIWD 4KBIA 3E8OA 5F3TA 4GC7A 3AJ2A 4UQGA 3C3LA 2HWHA 1L3SA 1S1XB 3H59A 5F9LA 3ZZYA 1N33F 2VOOA 3KNGA 1TKDA 2WOMA 5KAKA 4OJ1A 3B78A 2WBRA 3C6UB 2RNEA 1IKVB 4RBTA 3HO1A 3RW6A 5IQ6A 4AQYF 3PY8A 2RUGA 2CPEA 3OUYB 1H7XA 4QBUA 4IDKB 1KRPA 1JJHA 1UP1A 3OR1A 5F8GA 1S9FA 1M5KC 1VRUA 2KU7A 4MK7A 4NZ6A 3KLHB 1N56A 4HTIA 1N54B 3KWMA 1JLEA 4OX6A 3PZPA 1FRIA 2NLWA 3LWMA 1ZPVA 4ILMA 5KT5A 5LMUF 2ERRA 2OPSB 1GTEA 2RF2A 4IR9A 1HQEA 4EBDA 5KG2A 2F9JA 2X1FA 4RUCA 2JVOA 1N34F 3CD6S 1RT4A 2JWNA 3LP2A 4WIIA 4QU6A 3M2UA 2XY7A 2XZWA 2DK2A 3CCUS 3RB6A 2RB7A 2BR0A 2M7SA 3V5RA 3DLKB 2CJAA 1YVFA 4QOTA 2L48A 5CYQA 1TAUA 2AYBA 2YWEA 4G3IA 4DV2F 1S6QA 5E7OB 2HAIA 2CG4A 3VR1A 3RRHA 1H7WA 5T14A 5DDQC 3DFEA 2EFVA 5A8RB 1I6JA 1DQ8A 2YNIB 3DDNA 1RT7A 3SDEB 1JLAB 1Y5LB 4WFNQ 3IAM9 2YNHA 2HWTA 3GR0A 3KKFA 4DS4A 2QSFA 5H9EJ 1WHWA 2CQCA 3UD4P 1FEEA 4IG0B 5ITHA 4DHVA 5HMZA 1D0EA 4DPOA 1AUDA 1SI9A 3X3UA 1MROA 3CDAA 2QZ8A 4Z37A 4WYLA 2J0SD 4MIBA 2VFSA 4HT5A 1GH8A 1WHXA 1Q8BA 2O66A 4Y28C 1X4BA 1SJRA 2HNYA 2B9WA 4I56A 1DRZA 5KFAA 2KB2A 1VQKS 1RGVA 3DN9A 1VQ5S 3A8EA 4NYPA 3GV5B 2QE5A 1N88A 2MZSA 4E8UA 5I3QA 3M8RA 3LH2S 1RYRA 4OZNA 4F26A 1HNVB 2DNOA 5C5JA 2RH3A 3HP6A 4PG5A 1P1LA 2DGWA 2DPIA 1QY7A 2JC0A 3NKYA 5GAHU 2RSQA 1RT5A 3V2UC 2FJWA 4HHJA 4FBUA 1NRKA 1GAOA 3U1MA 4TU8A 1HW8A 3DLGB 1OPZA 4I6WA 4NX9A 4RX6A 3GG1A 1M90T 4DQSA 4B17A 1U1OA 2CFXA 4CQ1A 2EI5A 2QMWA 2C22A 3MI7X 3VAIA 4LF6F 1FVSA 4I6AA 3IRXA 2WONB 3AAWB 1S9EA 1SL2A 3G6XA 1X4EA 2XS2A 4ZCIA 3V6JA 2J6TA 4N77A 3P49B 3NMAA 3N28A 4FS1A 3GILA 3BREA 4DV6F 2AWZA 4KTQA 3CCES 2LQBA 3RB0A 1DARA 2KYXA 3ZZTA 2N82B 2QA2A 3NGKA 4PQAA 1X9SA 4F4ZA 2G0CA 2FHOB 2OPQB 3CWJA 1JKHB 3UDLA 3QAUA 2V4JB 2CPHA 5F8MA 3C6TB 1S0OA 4ZPVR 2W8LA 4H4OA 2ROEA 3RAMA 4DL7A 2KHCA 3U1NA 1OIAA 4C8LA 3OTBA 4RU9A 3GIJA 1JLGA 2CPXA 1F2GA 4OHWA 1C0UB 5KFBA 2ZH7A 5DDPC 2CZVC 1HBNA 2C3PA 1Q86T 2ILYA 3QYYA 4RW8B 2X3GA 1ZM3A 3EUNA 5I4MA 1NNDA 4R5PA 4DF8A 2N4CA 3HT3A 1N0UA 2OSRA 1RISA 1SH2A 5AJ3F 4QW9A 2UU9F 4Y3CA 1D3WA 4ZK7M 2GIQA 2UP1A 2IYIA 5DLFA 2HS0A 1VBZA 2VKZG 3NRBA 1U1QA 2HW3A 4AL5A 4BDPA 2MQMA 4DR4F 2GC8A 4DLGA 2O5DA 2WB1D 1NK8A 4Y2AA 1TL1B 1XEZA 1GTHA 3OL9A 4OLPA 3K0JA 4OI4A 4JBCA 4CO1A 2R7UA 3CCRS 2YKOA 3CCLS 2ZH3A 3QIDA 5LSLA 1SIZA 3MMJA 5M2UA 2MKHA 3CJ5A 2ASJA 3DRPB 3QZ7A 3MZIA 2AJ1A 2YQ3A 3BM7A 2V8HA 4YDDB 2HHHF 1T8EA 4UOCA 2QEXS 1V3SA 2HNZA 3HHLC 1FCAA 3ENVA 4TLRA 2Y1IA 2N3OA 2M8DB 2F8MA 4JV0A 4CI0B 3T9ZA 1VIXA 2K7KA 3RBEA 1UVNA 4N47A 2VFTA 3IBWA 4D3HA 3GYXB 5J2PA 2FB0A 4IR1A 4NA3A 1QVFR 3JSBA 2VFRA 4H4KC 5EUHA 1RTIA 3KLVA 1N5SA 2NS1B 2JX2A 1S9GA 5EGYA 1FE0A 1FK9A 3QGHA 4O44B 1H38A 3P6YC 4X64F 2YNGB 2DR8A 3MMBA 4LQ9A 1FTRA 2YH0A 1IBMF 3LF0A 2J9EA 4IG3A 1ZM2A 3US5A 2A18A 4QWCA 1V3ZA 4WFYA 1GQEA 4MK8A 5A6PA 5C42B 2JOQA 2W9AA 5F0UA 1U47A 5B0AA 4Q2MA 3R5AA 3KK2A 4B3MF 3KG1A 3W2WB 5HMYA 2CQDA 3LP0A 2D9OA 1VRTB 5IWAF 5DS7A 4TYBA 2MQLA 5KFUA 1KOHA 2IMWP 5L38A 1UVIA 4JI8F 3TAQA 2L08A 3KHGA 2XCPA 2B5JB 3MM6B 1V9OA 1DFDA 2L9WA 2G4BA 3KHLA 2LQJA 3S01A 1SUQB 2BW2A 3I0RB 1JX4A 2OSQA 2E29A 4Y34A 5KT7A 4QR1A 3BGRB 4DSIA 2B4PA 3SSQA 5JXSA 4NOHA 1KR4A 4NL5A 4FNIA 5HBMA 2YH1A 2DTJA 1T05A 3DLJA 3DLEA 4AYBD 4EBCA 5KFKA 3OR2B 5I42A 4HDHA 5LL6d 4CH0S 1TFWA 2M2BA 1BQXA 5IXUA 2HRUA 1S6OA 1N5YB 1GXTA 4X65F 1SKWA 1X8DA 1HNIB 1C4AA 4F4XA 1CVJA 4PR6A 4DFJA 1S1TB 2CZ4A 1I1GA 4DJBA 5DDRC 3Q24A 1J5EF 5K9FA 5HI7A 1ZM9A 1S97A 5H1SV 4IO9Q 4NLYA 1IKYB 1VIOA 3DHWC 4EYHB 1S76D 3U1LA 3DOLB 5J2QB 2HFOA 3SSSA 1TZ0A 2PA8D 5K8NA 5M2PA 2KM8C 2MXYA 3MR5A 4B02A 1J2VA 4LUBA 1Y5IB 4DSLA 1CSJA 4V19J 3FSYA 4QPTA 3IC1A 4NCAA 4LF8F 3RR8A 1D9AA 1X4AA 2GQCA 4ETXA 2RILA 3G4SS 2XMMA 3LANA 2W4CA 2DGSA 3MEDB 1JJ2R 4J9PA 1VOMA 4M8LA 3TUJC 1NK7A 2YNFA 3OV7A 3PIPQ 5K5MA 4OIXA 4OHXA 1K1QA 1U26A 2W9CA 2DITA 1VHFA 3QMQA 3HDSA 2E7WA 3LP1B 1U6BA 3M05A 4KV8A 4KPYA 1HI1A 1NAQA 3IO1A 4NA2A 1HWLA 2I38A 2VL1A 2IVYA 1QUPA 3WC2A 2P9EA 1FDDA 2XG8A 3D54A 2U1AA 3OJUA 5HLFA 4ZDNA 1B7FA 2AJQA 1DZ5A 1QTMA 2O1PA 4DFKA 4EFAC 3T6BA 2DHAA 1LK5A 2B43A 2DBBA 2KRBA 4ICLA 2BANA 3VAKA 1NK4A 4B3RF 3LO3A 4P7TA 2VPYB 3I55S 4RWXA 4C97A 4ITSA 1U25A 2FPHX 2OPRB 2XSJA 1BWEA 1NK9A 1QVGR 2XLKA 1WG5A 3D28A 1HBOB 2BRKA 2L3MA 1L3VA 4C8ZA 2MKSA 2A2CA 2LDIA 3B4MA 5F8IA 1RTDA 2DHSA 4O3SA 4A8FA 2LU1A 1J5OB 1NHVA 1LWEB 2C42A 1UW4A 2SXLA 2ZVSA 4FZVA 2BQ3A 2ZOGA 1FE4A 3MEGB 2EBGA 2M5YA 4PPZA 1NJZA 3DRRA 4I1TA 1FRKA 2J0WA 4KB7A 4CO4A 2DVIA 2CQ4A 2CPDA 2GJ2A 5MLCV 1Q8IA 4HVZA 5D78A 2OMOA 4AL6A 3OLAA 2COLA 2AGQA 4NZ0A 1HBMB 1TKTB 1IR0A 4X4PA 1DJ0A 3ETOA 2L9NA 4WFZA 3SQGA 2ZOFA 2DD8S 4RUHA 3R3TA 3GYNA 5BYQA 4IQXA 3OBIA 5HO4A 3DOKA 2GFFA 4NYOA 2CJKA 4QW8A 2EFOA 3AQPA 3H2VE 1ZTTA 4OI1A 3QGIA 3CULA 1DHMA 1E6YB 2VG6A 4I2PA 1G2EA 4NLSA 2LA6A 1WD6A 2W7OA 2B9XA 2CJBA 4ECWA 4ZPTR 1X9WA 4C3MA 1LFWA 2HHVA 3MECB 5CA5A 2EVZA 3K5PA 4J9NA 2MJUA 3PX4A 4HT7A 1JXLA 1UVMA 3GR1A 4IRDA 2N4DA 3SCJE 1URRA 1UETA 1RQ0A 2P9GA 4DL5A 1SJ4P 2RRAA 2VB6A 4WFBQ 2JLGA 5KG0A 3MEEB 1IKWA 1AXQA 2BVZA 1U09A 2JEGA 1MWZA 3ICLA 2XY6A 2WRMA 1WTBA 4OHYA 3MM7B 5KG5A 4FXVA 5D4PA 2O3DA 3MHYA 3MOZA 1S72S 1S79A 2HHSA 1YI2S 2I5JB 4P2SA 3N0VA 5CD4H 3FSXA 3D2WA 4IH6A 4Q8FA 4ZP6A 3JTOA 4MFBB 2VG5A 4DR7F 2BA9A 2FJEB 2KZZA 2B3TB 1ELOA 4DQQ