5AXLA

Crystal structure of thg1 like protein (tlp) with gtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
221
Chain Sequence
TREIYAEMRCIPPVVLRADGRNFKNTLSGLGFEKPYDKTFARAMADTAELFIKKSGLSPLFAYTFSDEISFLFTDLPFDGRVEKIDSVVASFLGSALTIKLRLEEPIAFDSRLVALQKEEIPEYFHRRQLEAWRNFVASWGYYALRNEGMGRNEAAKYLKRKKESEIHEMLFERGINLATLPSWQRRGVIISKEARKITQNWEIPKFKSEKGIPFLEKLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Transferase
molecule keywords tRNA(His)-5'-guanylyltransferase (Thg1) like protein
total genus 64
structure length 221
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5axlA00
3WC2A 5AXNA 5AXMA 4KGKA 4KGMA 5AXLA 5AXKA 3OTBA 3WBZA 3OTEA 3OTDA 3OTCA 3WC0A
chains in the Genus database with same CATH superfamily
3TZXA 4U7CA 3G8SA 3MF5A 4OZJA 1M5KC 3I9ZA 4RUBA 2ABYA 3C6TA 4U96A 3TAMA 5DDRC 5HMYA 1XR7A 1WI6A 1F9HA 3TJAA 4QWBA 1SCJB 2OSQA 2GFFA 3SSSA 4YY3J 1RT3A 3TNVA 2DIUA 1C0UA 1UJ6A 2ZZTA 1IBCB 1QDUB 1GNKA 2CPHA 2ZITA 3SEOA 1JNRB 4FN5A 3G6XA 1OSDA 2XHWA 4RU9A 4JV5J 3AJ2A 4RW9B 4WFZA 1RWOB 4L76A 4WFBQ 3V6DA 1NJWA 4C8LA 3EZ5A 4E8UA 2HZVA 4KR0B 3NXZA 2P9EA 4HT7A 3TEGA 4AQYJ 2GAGC 4OZ0A 5E3AA 1HBMA 3BN7A 1OY9A 3KLGA 3CPWR 2I8EA 3MAQA 4ECZA 2VPXB 1RAAB 5HO4A 3KHLA 1PO6A 3DRXA 5IS2A 4MFBA 1HWUA 4ED7A 3QNWB 2K1RB 4HH0A 3AOAA 4LVNP 4TQRA 3FVYA 4OX9J 3EGNA 1XNRF 2IAJB 3D3BJ 3EICA 3IP0A 1XBWA 2KI2A 3NCPA 5ETLA 4YUDA 3UCZP 4ED0A 1RE1B 2ZC3A 2WW8A 3FMBA 4R0EA 5K8MA 5KFXA 2VJVA 5KT5A 1T9VA 2DR8A 2HHUA 1S1UB 5HMWA 2J0WA 2AX0A 5B0AA 4JB8B 3KK1A 2B5JB 4MKBA 3KLIA 2MZ1A 1NSKL 3CO9A 1B0PA 1TUGB 2VBXA 4NYPA 4BC7A 1Y5NB 2CYYA 2DGTA 2HK3A 2NREA 2RE1A 3RRKA 2Z0GA 1HIYA 3PNIA 2C22A 4X4SA 4EU0A 4OI3A 3UR0A 4DUZJ 4HDGA 1NH7A 4F4XA 3RGIA 1CJKB 2CADA 2RB7A 2V69A 3OFGA 2BUNA 5I4MA 1RTJA 2VL1A 4MKAA 1URRA 1JIHA 4OJHA 2X1BA 4U95A 3QGHA 2HFSA 4KGXB 1RT7B 1HQEA 3R3TA 4N77A 4H4OB 2QL5B 2VUGA 5KOXA 4EZ6A 2V4JA 2ZFHA 5L38A 3MR5A 4MJKA 1RYSA 1REGX 3I96A 1NK5A 3J7AN 1YLXA 4C4WA 3RBZA 5B7WA 2D9PA 2V67A 4WIIA 3RG6A 4DCJB 1YQHA 1T02A 2C3OA 4EFAC 4DFKA 5HL7Q 2Y8YA 4DF8A 1N34J 2PFFB 3EJMA 3EYZA 1RTHB 1O5JA 1VQSA 5D4LA 3CULA 1J2VA 4K4WA 1N48A 2Y0SD 2C3UA 2R7QA 2BRLA 2OPPB 1X4AA 3PKYA 3M8PB 4JI0F 5D0HA 4DUYJ 3EUNA 3M2UB 5J2MA 1RT5B 2JLEA 2V2VA 3ENQA 5LSLA 1U1NA 1UP1A 2VBZA 4KBIA 2B4UA 3A1YG 2FD2A 2YKNA 2AJ1A 1IM6A 2M4MA 4DLEA 4ELTA 3BH6B 5HROA 1LWEA 2XTJP 1IQZA 1R8CA 4TNOA 3PW7A 1NSQA 3KLFA 1SC3B 4B3OB 4ZS6A 1S76D 2DNHA 3LPYA 5C42B 2DNOA 3D66A 5KT4A 2LQBA 1VQKS 3LA0A 4NLSA 1QLNA 2M52A 5K8OA 4P52A 5AJ3F 2NYIA 2G4BA 2NZ4A 1RISA 4NLPA 2O66A 5HATA 2J0SD 1H2TZ 3IBFB 4DU7A 2PO4A 2AEMA 1UAWA 1S6PA 3OTDA 2DH7A 1JLAA 2IRYA 2J7KA 3X3UA 2AX1A 2UU9J 4NA1A 2EG1A 3T1YF 1S7IA 2V94A 2OPQB 3OTOJ 2ZBRA 1X4FA 3W5XA 1FDAA 3W9HA 3W7BA 4NXNJ 2V8HA 3FBEA 1ZAVA 3TA2A 3HKZD 4I1TA 4F0HA 4I7FA 4USVA 4D3GA 1RHRB 2ZH7A 1S72S 2DR5A 3K5NA 3NEKA 3V6KA 4ETZA 4MH8A 4JI0J 3E8OA 4I68A 1SL0A 2DR6A 2OFGX 3MMAA 4CYUB 2B7CB 3QRPA 2VDHA 3EGWB 1TVRB 4HH1A 1VJWA 2C2EA 2XMMA 2AP6A 1N6QB 4NLVA 4J9RA 3P6YC 4PQUA 3IRXA 3TAPA 2OLWA 5K8NA 3DHWC 1ICEB 2W9BB 3AD7C 1EHWA 4IH6A 5I42A 2AYEA 2MLXA 3DRPB 3MURP 3A3PB 4LIRA 3KJFB 4NCGB 3PTWA 4XAKA 1XNQF 2FGCA 4DXLA 2VA2A 3N79A 1R0AA 2EG2A 2CQGA 1FJEB 4C3LA 4R8UB 4BCAA 2AV5A 2FHKA 1QTMA 3IWNC 4IFVA 4U6PA 4ELUA 5LM7E 2J6SA 3MEDB 2NQPA 4FXVA 4ZP9A 2IRXA 3J7ZT 1JLBB 1GQEA 2OHDA 2F8HA 4ZCIA 1LFWA 1F9EB 1K8AT 1PYTA 4XPEA 3HT3A 2UXBF 2GVDA 3MPVA 4ZVHA 4ALZA 5K14A 4BC9A 8RUCA 3QT5A 5FD1A 1CULB 3MM7B 1TL1B 3HFVA 4LF7J 5KFCA 1FESA 3HD2A 5BR8F 1MW7A 3OT9A 1HA1A 2DB1A 2VFVA 3DRSB 3DRRA 3GYGA 4DL4A 4JOUA 4JI3J 4X2BA 2DGVA 2G0IA 2MMYA 2JFKA 4ED8A 2HQCA 1CQMA 2DNPA 3RU0A 3LP1B 4X4PA 4I69A 3KMQA 2CQ2A 3DOKA 3GCXP 4JI2F 1U2FA 4K4XA 1O51A 4DQQA 4OZNA 3IBWA 3N28A 3R5GA 3ILJA 1VJQA 1CJUA 2FIUA 5J2QA 4FZVA 3DLKA 4HLBA 2J76E 1LW2B 5GADU 3PXGa 2BA9A 2MQ8A 3C6UA 1U1PA 3RAMA 4GKKJ 1XR6A 3U02A 1UCNA 4K8RA 1EKRA 3C15B 3BGLA 1JJHA 3ITHA 4JI1F 2E9ZA 4GKKF 2GVZA 1SBRA 2VH7A 1DBDA 4ZPBA 4A8WA 4IG3B 4HL9A 1FERA 1TKXB 1FO1A 4TU7A 1NHKL 4PXEA 1N6QA 5D4PA 4UOGA 5DZ6A 2UV8G 5CH7B 3W63A 3G6YA 3AA9A 3OFFA 4ZKAA 2C3PA 1KVJA 4CT9A 4USUA 5FLXY 3KK2A 1RTHA 3MM6A 3CMQA 3KLHA 3MPYA 2VODA 2KJVA 2NXNA 3MM9B 3G86A 1VYAA 1X0FA 1AA1B 1KSPA 4RNOA 4LF5J 4P7VA 3R1LA 5CABA 2RUSA 4HACB 2O5DA 1Q8BA 2RF2A 2K2PA 2ZKUA 4Y3CA 4Y00A 4B3RJ 1S49A 2CAJA 1U24A 2PD1A 3BR9A 3N6LA 3NBPB 1DFDA 1LWCB 2B3TB 4A8SA 1IKWB 2WHOA 4WE1A 1H7WA 1VK8A 4NA3A 4LF1A 3LP0B 4QW8A 3L7UA 4M5JA 3QMQA 2KJWA 4NMXA 2L41A 1Q7LB 3CJ0A 2F7VA 3RB3A 1MWYA 3MAAA 4ZJQA 2UUBJ 2DNKA 1G6BA 4JV5F 1NK4A 4PYAA 1LXJA 1Q0NA 3WDOA 3V4IB 4ZJOA 1IWGA 2Z2YB 4LBIA 2ZM6J 4PUOB 3W64A 2P2CB 1FKOB 2FYXA 4UOFA 3Q8VA 2OSRA 4DPTA 3MEEB 3NP5A 5LSRA 5DQGA 1V9OA 1BHNA 3MGJA 1X5OA 5HSPA 2IVYA 2Q79A 3GYXB 4UZCA 3F56A 1XC9A 3MMCB 2EK1A 1B4SA 4NXNF 4N7TA 4PKDB 1Q95G 1ZM3A 1CJUB 2IC3B 3SQOP 3MEDA 4EO6A 2RQCA 1LV5A 1C4CA 3FQLA 1K1QA 3WC2A 3BGRB 2EWHA 3HJVA 1WF2A 3POTB 4X62F 2LDIA 1VS3A 1L3UA 3FC9A 1WI8A 3ZZTA 1H2VZ 3OTCA 4TY8B 2BJ3A 4DEZA 4J9PA 4ZK7M 5MAOA 2HQIA 2WCXA 2IVFB 2BQUA 2DO4A 4EYIB 1G3OA 1T95A 2A18A 2IM0A 2E7XA 4M5MA 2DY9A 3KNGA 1V3RA 2KVQE 4USHA 4MFBB 1T8EA 3OBIA 1N32J 4YEAA 1RKJA 4RU2A 3ZXWA 2HHQA 1UPPA 1NDCA 1V3SA 2XSJB 4ZVOB 2CQ0A 3PM9A 1FJ7A 1I94F 2RUGA 2YNGB 4DFJA 2RKIA 3QO9B 3I9V9 1RHJB 2CXEA 1DLOB 2IVMA 4NMLA 4YR0A 5G0RB 1OPZA 1CJTB 1M5OC 3CC4S 3C6TB 3L7PA 2HSEB 4OV1A 2I2YA 3R97A 3D4JA 2YWEA 5LMUF 2Q6BA 1RT3B 4ID8A 4LF8F 3IS9B 3NY0A 1P27B 2W2NP 5B0FA 3I5AA 5KFWA 4RUHA 1WG4A 1BWVA 2YWWA 2FJDB 2HBZB 2V5HG 1TTHB 3H2UB 4QIGA 4QYRA 3T19A 4ECTA 1TL1A 1TK8A 4B3MJ 3D6TB 2JJ4D 3KYLA 2F8MA 1WJ9A 3ILOA 1X7VA 2H4YB 1YJ9S 3DRRB 3DRSA 3PV8A 3I4PA 3ET6B 3HHEA 3A13A 5KT7A 1KKHA 1RT6A 1ZS6A 4MAKA 2Q66A 3BKTA 2DGUA 1WACA 2VKZG 3ZNUA 4C0HA 5KG7A 3MHYA 1HI0P 4CLPA 1HD0A 1YZ6A 3CCTA 3N4WA 3G8TA 2XY5A 1IBLF 1PKUA 2MKHA 2ZBQA 4FDFA 4KRWA 2RF2B 3ZTPA 1RABB 1N0VC 3GIIA 5GAHU 5F0UA 1C0TA 1NJIT 4RBVA 3OR2A 4FF4A 5J2QB 5GAGU 2EFPA 3OTBA 5ETTA 1SH2A 3W8GA 3MDFA 4EMDA 2YH0A 1Q4RA 3DLEA 2DXEA 2VG5A 5DG8A 1WHXA 2R3VA 3IAS9 3K0JA 1WD6A 2ZH2A 1S7HA 4MYTA 3EDRB 1LK7A 3GJSB 2HHVA 1UEUA 1TKXA 2LEAA 1WKJA 3U1MA 1OYDA 5J2NB 4ZMMA 3MPUB 2EW9A 1KQFB 3GMGA 1FJGF 3GTYX 3GPAA 2ZH1A 4C97A 4RX6A 1AB8A 1R8PA 3MUMP 4ZLLA 2G2YA 2XY7A 1TKTB 2IC3A 3CNQP 3QQCD 4M63A 4ZPDA 3GV7B 3ISNC 3M7VA 2XLKA 2J6UA 2VJUA 4MK7A 1VRQC 4CQ1A 5IWAJ 4DV7J 2UXCJ 1GTHA 1T05A 4C8OA 4G1IA 3K5OA 3MR6A 1B7YB 1Z1ZA 1HNVA 3HO1A 3FCVA 2GHWA 3H42A 4F26A 2C2ZB 1LXNA 3D6MB 1AZSB 2DVIA 4UOCA 4DR5J 1T0TV 3PZPA 3T6BA 4F36A 5D8HB 2BE9B 4B3SF 2W2MP 1UJ4A 2X3DA 4MT1A 4QOTA 4WP8A 5CYQB 4ZLJA 5LT5A 4KH1B 1XMQF 1U2CA 3KG1A 1S1XB 3PRVA 4ED1A 4O0NA 1FEEA 1NPRA 1LK5A 2XO7A 4OZ5A 2B4VA 2MQOA 3Q8RB 2GGPA 1Q5YA 2QTWA 5D0GA 3BO4A 4RUCA 5ETNA 4ES2A 4CLWA 3PVXA 4V19X 2YNGA 2EBGA 1KQGB 1NZ8A 2JLFA 2LLZA 4NEZA 4TQSA 1RTIB 4DFPA 3C66A 5G0RA 3M2UA 5HLFA 3AAWB 2EXUA 2AJ2A 4B9NA 2DGQA 2D3UA 2MQNA 3IWLA 2ILZA 1A0OB 2G2OA 3H0PA 3DI6A 4JV0A 2AF6A 1RZMA 2H4WB 1R6YA 2WONA 2PEBA 1FK9A 2C2RA 4DV6F 5KG1A 2R7VA 4ZHRB 2J9DA 2RSQA 2JH3A 1BGXT 5D6GA 1XMOJ 4YQWA 3FCHA 2CJYB 2KG1A 1BXNA 5SUHA 2GV1A 1HNXJ 4C8NA 4IR9A 1S0NA 2KXNB 3WIVA 5KG2A 2E1MC 4FF1A 5B0GA 2MJUA 3JSBA 4PWWA 4CH0S 5A8KA 1TFYA 1FRHA 2CZVC 2J9CA 1N5VA 1QTNB 2WW4A 3I6PA 1XR5A 4TYBA 1JLCA 1S5ZA 1U25A 3RRHA 1GX6A 1IR1A 1YGYA 3ENWA 2G0JA 2NUHA 3BKUA 1KNZA 2MY7A 5ETMA 1T03A 4OZLA 1ZZFA 1RT5A 1GFWB 2MLZA 2KFNA 3VGUA 1BQNB 2ACYA 4P6QA 4DSLA 1PCAA 1D8ZA 2DNRA 2YKNB 1FD2A 2GZOA 5B09A 5J1PA 3HM9A 2ZHBA 2E1CA 3RW6A 2V8PA 4Y2IA 2I5JA 2YQ0A 5CQGA 4CLFA 4LF4J 3GONA 1EIYB 1LKZA 3IR7B 4LSLB 3ZZ0A 5KFKA 4WJBA 2KL8A 3W2WA 5IFMA 4RW4B 4QW9A 4OHYA 1SKUB 2MB0B 3OVSA 4DV4J 3NWRA 2ALZA 1NZAA 2DO0A 3QT6A 4ICLA 4BWMA 3EDQB 1UVIA 3S6EA 3ZTOA 1OQ3A 3BS9A 5D77A 5A2QU 2LA6A 2XHCA 3OTOF 4O3OA 2L9WA 3MCMA 2VASA 5FLXU 1M5VC 2MKYA 1XIQA 1RT4A 3PRBA 3P8BB 4AXIA 1X5SA 5ETRA 4LF9J 2PEHA 1I6JA 1JLGB 2DHGA 4TYAA 2VOPA 5D4NA 3Q0AA 4K59A 4OQJA 2EKNA 3RBEA 2HQFA 1P1LA 3DLKB 5H1SV 4M5IA 2EPIA 4AUKA 5HP1A 3AOCA 1ZAWA 3D1QA 4IKAA 2DR9A 2MPUA 4ZN1A 2EK6A 3BDPA 1RGVA 2R7RA 3C19A 3Q8PB 2VU5A 1S1TA 2R7TA 2ILYA 2V63A 4CO1A 2W7AA 3CDEA 6AT1B 1RU1A 3ZZOA 1S77D 2XMWA 3OJSA 3M8WA 2NPIA 3U27A 1S12A 1VFJA 5A8WA 3TANA 3PHTA 1SC1B 2M8HA 5DDOC 4DUZF 3LW5C 2FY1A 1S4EA 2A6OA 3TVKA 2EC0A 3JAMY 3UQSA 4XO0A 3I31A 1TL4A 2HZAA 3I5BA 4NLOA 2HWHA 2GIRA 5F8GA 4O4GB 3UI3A 3DOKB 2V4RA 4OX6A 2QE5A 3QZ7A 4HACA 1Q1KA 4O3NA 3AA8A 3DDNA 3GQCA 2VQEJ 3PX0A 1JMTA 4F3QA 1L3SA 2UXCF 4FBTA 2UUAJ 2Z30B 4OJGA 3ZZZA 4LRBA 2NR0A 4ZVSB 4I2QB 3HHLC 4ATNA 2PDAA 2VF3A 4RW4A 3ITHB 4RW6B 2KU7A 2QLBB 2PMHA 1N5TA 1QAXA 2C2MB 2E1AA 2ZUAA 1J5OB 2HMIA 3KLGB 1HI8A 1Q78A 2M3DA 2HQ3A 1RSCA 2G13A 1T7PA 1AT1B 4KAIA 2J6TA 4YMEA 1U8SA 1J5EJ 1KOOA 5KFRA 4IO1A 1T03B 3HZGA 4UZBA 3JAMU 3FNNA 4B3TJ 1UEKA 3LAKA 1S6UA 2EFNA 5I3PA 2RRAA 1K0TA 4I2PA 1WF1A 2LXIA 2RVJA 2WVCA 4QIWD 4CM0A 3LOUA 2EFOA 2A2CA 3TAMB 2W24A 2HPUA 2N4DA 1NPKA 3ILIA 1Y0HA 1UVJA 3LP2A 1DURA 1WF0A 3Q8UA 4DV3F 2BW2A 5BYQA 2Q1LA 4RNMA 2ATCB 2RJZA 3HULA 1Y11A 5HLFB 4LFCJ 4R5PA 4QIVA 4DFMA 1UWAA 1HQUB 2A10A 3PJ9A 4LR9A 4S0MA 3OSNA 4DV2J 4OI0A 1AUDA 3H2VE 3M2VA 3CD5A 5DDPC 3CSKA 2YKPA 3B54A 2KVIA 1VHFA 2CNKB 2SXLA 2Z56B 3H5SA 4NRUA 5CHCB 4CLKA 3MR2A 3KTQA 2QSFA 3M1VB 2W4PA 4OZ1A 2CDRB 1N52B 4USJC 2AGPA 3AY0A 1YJWS 5IWAF 4DV7F 1HWKA 2GA7A 1E6VB 2VG6A 5M2RA 3OPKA 4FPRA 2AYBA 4IRCA 3NGKA 3OVAA 2J9DE 3TA1A 4DLGA 4LF9F 1SQEA 2R8HA 1K73T 3A3OB 5D3GA 2AU0A 2Z8QA 5ETPA 5LOQA 3K58A 2R2TA 1TKZA 1U6BA 2WK4A 2GVZB 3BBCA 2YNIB 3ISND 4ED5A 1WDDA 1GXTA 2YWHA 4ED4A 1A7GE 2KG0A 4J91A 5LL6d 2BJ7A 5F8LA 1MN9A 4NLYA 3ZNJ1 5FJ4A 4ER8A 4U7UK 1HR0J 1RT4B 3HSDA 2BJ1A 2MZQA 5IV4A 1IR0A 1T9UA 2CPXA 1KHVA 4DV4F 3R8YA 5J2MB 4Q0BB 5AE2A 2HHXA 3UNYA 1JNZB 2FC9A 3BGUA 1Y00A 3G82B 4DCPB 2HFZA 8ATCB 2F4VF 1RT7A 2VFTA 4YB6A 2ZC4A 4PYDA 2NUUG 3A3NB 4DV6J 3EZUA 1TV6A 3H4BA 5HANA 5EGYA 2QFIA 2VD3A 3SQGA 2NXUA 4ILLA 3IN5A 3AFGA 1S1VB 3LP0A 4DPYA 7AT1B 4UY85 4Y2CA 1U45A 4QWEA 1RDRA 2IM3A 6FD1A 3TZZA 1F5BA 3QT8A 3WHIA 5CD4A 2Q43A 2R8GA 1WORA 4K0KF 4LQ3A 2XO6A 4PXBA 2CUYA 3DOLA 1HLWA 3OFHA 4IG0A 1VRTB 3M2VB 1TFWA 4C2MA 4DUTA 3RZAA 2M8DB 2WZ1A 3N6MA 3BO2A 4L73A 4MK9A 4OX9F 2VHGA 2CPYA 3BEGB 2EI5A 5LMUJ 2Z2ZA 4G65A 4DL2A 1RA6A 1U0HA 3NAIA 2XQCA 1KOHA 2IFXA 2HNYA 3MEGA 4OYIA 5DLGA 3GE9A 4IDKB 1RWXB 5GVQA 2OPRA 5ITHA 4ES1A 1VC5A 1EB0A 3Q23A 3NNCA 1QAJA 2KN4A 1B0TA 1L3VA 3EVWA 1U0SA 3HD1A 1RWNB 4C11A 3LQVA 2L9DA 3VVUA 2JWNA 3C8YA 3FBCA 4WK1A 5L1JA 3DXBA 2AGOA 2G9OA 1NJZA 2DRDA 2QO3A 3KK3A 2GC8A 2NPFA 2E7WA 3ISZA 4OZ3A 2IDEA 3PHEA 3FFIB 4CO3A 2HS4A 3AD9C 3G9CA 4D3HA 2K3KA 1VCTA 4F4YA 1BLUA 5IM0A 3QJPA 1RT6B 4F4KA 2HWIA 4X65F 2MZRA 1S6QB 3HSZA 1RAEB 1LOUA 2HHWA 3DRYA 4DPOA 3T5HA 2J8SA 4GVBB 4USMA 3RB0A 1RAFB 2R42A 4DSFA 2IMOA 2FLNA 1OQ6A 1U02A 4DL3A 4DU8A 2F5GA 4K50A 2CJXB 3D6FB 4EBDA 4ZA1A 4BWJA 4I6YA 3G71S 4ZN3A 5IZHA 3DDKA 2OI2A 2GVDB 4JI7J 3FJ2A 1H98A 2F8EX 4OV6A 4LBPA 1RHKB 3A8JA 3EVMA 5E3CA 3TJ8A 3HKWA 3UE2A 5F8MA 4DN0A 1HBOB 3LGMA 4WKYA 1R8AA 1HNXF 2WVFA 3P5BP 2WBMA 3DKDA 3FEZA 4XK8C 4AYBD 3M9NB 1N33J 3RUBL 2OP5A 4M5DB 4IG0B 2LQ5A 3AJ1A 4CLYA 4NWBA 5F9NA 3AT1B 4LSZB 3E51A 4ECSA 2KFZA 3ZC4A 1RTDA 1D3WA 3ET6A 2Y1JA 3BSNA 3J7YI 1IM4A 4ERDA 3PYFA 1HPZB 4NZ6A 4WBFA 4FP9A 4TY9A 3VGVA 1VGYA 3CJ4A 2HNDB 1JLQB 1QE1B 4OMFG 3G6ES 9RUBA 5HMZA 2MDAA 4DQRA 1U1OA 2POKA 2R7UA 3QAUA 1SJ3P 1VBKA 2HS3A 2BM0A 2RDIA 3MR7A 2R7WA 2IM1A 1SJRA 1AROP 1FK9B 2EKYA 3K8WA 5F8IA 1OO0B 4OL8A 3HLUA 4YOEA 2JX2A 3JQJA 5L9XA 3VHQA 1FJCA 4UT4A 4LF2A 1S59A 1AYEA 1HWJA 3CJRA 3BSCA 3IR5B 3P4UB 2GAHC 4C8ZA 4ILRA 1FD8A 1DHMA 4K4VA 1SXLA 1FTRA 1V5VA 2B9WA 2PSZA 3B4MA 4NZ7A 4YB1P 4ECYA 3FFIA 2QSWA 1BMQB 3MI7X 2RIJA 1LNQA 2XWXA 4NOHA 4I4BA 5ETSA 2I6WA 3H4DA 2D3O1 3DXSX 4IOAQ 2XG8A 1O6XA 2HYIB 1ULRA 1B64A 1S0VA 5LXRA 2ZOMA 3DNCA 5B0CA 3TQ1A 4C8YA 2KFYA 1X5TA 1SV5A 2QN6B 2CKWA 2R7SA 4DR6J 1UJ5A 5GMKa 1WEZA 1X4CA 2CQHA 4ECWA 2YQ3A 3WX8A 1REVA 3IR6B 2BR0A 2VDIA 4JV1A 2F4FA 2F3JA 2I5JB 1X4BA 2LKZA 2UXDF 3SV3A 2D1CA 1RHQB 2YPYA 1CJVB 3DGVA 4KKOA 2CPEA 1HNVB 3CJ3A 3C15A 4YB5A 1KQKA 3V5RA 1JX4A 4GKJF 3MPDA 3N6NA 3NGUA 2ZDPA 2LQ9A 5CCLA 1RAGB 3HCXA 4KV8B 5AXNA 4Q5VA 2DPIA 3GYNA 1HNWF 1QAYA 1JJCB 1CG2A 5ETVA 2E1PA 1NRKA 2A1BA 1TMMA 2AKWB 1HHSA 3R9LA 1JLCB 3BZQA 3TUJC 2PI4A 1EKSA 3MEEA 2DNMA 3M8PA 3MM6B 4LF4F 3FBBA 3UW1A 2KXHA 1QUVA 1RU2A 1RWWB 1FDNA 3EMTA 4ZPVR 3M2RB 4JI2J 2MQLA 3HF5A 2DGXA 1H74A 5BYRA 1PYSB 4FF2A 2BQ3A 2BJ9A 5L1LA 1N5QA 1OY8A 2UVRA 2LA4A 2FZCB 2XC9A 1U49A 2B9XA 1EAYC 3V6JA 4JV2A 5C42A 3MWBA 5DRKA 4E98A 4M5KA 5CCMA 4GC6A 1SB6A 4B9VA 5D0EA 2XB2D 4LMZA 4RW9A 1FKPA 2CQ3A 2V68A 5KFGA 3LH2S 3QWPA 5J1EA 3E01A 3GWCA 3PFEA 1Q8IA 3B4DA 2CQBA 3ONQA 2P6TA 4M5DA 5HI7A 1TUVA 1WEXA 3TW0A 5I3QA 1D9DA 2VFSA 2DNQA 4ZLNA 2K7KA 3JXOA 2QT7A 3BQ0A 3IM8A 1NJXA 1A6LA 2NXCA 3VAFA 2HRYA 4KSEB 1B99A 4PZVA 3MFIA 1HNWJ 1Q79A 1K44A 2JFDA 1SUQA 2V8VA 3NMAA 5KFOA 2D41A 2HFVA 3LUYA 3NGDA 3FCWA 2LQ8A 3KJNB 4P2XA 3ZTQA 1SKSA 4F02A 4Z2XA 1B3TA 1SIWB 3AHPA 5KFEA 4ID5A 3POTA 1HW8A 3VQTA 1T3NA 1IQTA 4JUZA 4A8QA 1U26A 3Q89A 2JLGA 2V6AA 2KT5A 1Q82T 1Y10A 4X66J 3KFWX 4K4SA 3DLGB 4WKRA 4DV0J 1ZA1B 1CC8A 1RLCL 2XWYA 4MTPA 2U1AA 1U4BA 2CPDA 4OHXA 3TUIC 1KRPA 1U09A 2OTLS 2W9BA 4WZMA 1FHTA 4NCBA 3BKFA 4QIFA 4EBEA 1B0VA 1CJKA 1PJ5A 4IOBA 5I3UB 2W7PA 2ZH8A 4DG1A 4YDXA 2E9TA 4I64A 1YKWA 1HKAA 2HBRB 1PBAA 5LSOA 4HT5A 2UV8A 3U7JA 4ZPCA 4F04B 2GMJA 4LRDA 7FD1A 4Y65A 1WEYA 3D1OA 1FCAA 2JNJA 1N8RT 2XY6A 4UTGA 1VHIA 4W90B 2HNZB 1HWLA 3HVAA 3KDOA 3AQPA 1T94A 3UPFA 3CD7A 3I5CA 1V6HA 3RB4A 4QJVA 2HFUA 2JVOA 3ETOA 5E2QA 2UUBF 4ZCMA 1IKXA 3E01B 1WOOA 1TP7A 2BANB 3GU0A 4KB7A 2HHHJ 4A8MP 2IBKA 1F1BB 1FWPA 2WB1D 4WCEQ 4IQMA 4PG4A 3HFZB 1Q53A 3C16B 2F63A 3CCWA 2XEXA 3GJRB 4F4AA 4RPFA 5A2QY 5L39A 5U47A 3THTA 4ZOSA 1HWIA 5KT2A 2LDYA 2QX0A 3SXLA 1UA1A 1C1CA 1RAHB 2CPFA 1F3VA 2FJBB 3TVZA 3W2VB 1KVKA 1NPPA 3TARA 1GXLA 4P2FA 2IYIA 4K4YA 3RAXA 2N7YA 3N01A 3J7A1 2BRKA 3LGNA 3M32A 1HHTP 4LUBA 4LFAJ 2PIIA 1RKIA 2LEPA 2MKKA 3KLFB 2XNRA 5HQ8A 3NL0A 3UCUP 1HD1A 3PW5A 2YKAA 2AZ3A 1RQ0A 1MU2A 5EHHA 3KJVA 3VV2B 5E33A 2IPOB 1MN7A 5SZTA 4K4TA 1TK5A 3A8KA 2GJ2A 5DG7A 1DTQA 2FVSA 5K14B 2RT3A 4B9LA 3Q86A 4ZP7A 1QSLA 2ZBCA 2QYCA 3UD3P 2GQ2A 3OHAA 3DLHA 3FRZA 5CZXA 4C9DA 3SFGA 1KTVA 1PAUB 2V34A 3QWUA 4RBUA 4XPCA 2YXLA 4PCQA 1IXKA 2J7WA 4RZRA 1XMQJ 4HHUA 3BPDA 4N41A 3H59A 4HYKA 5JUMA 1XJWB 4QPTA 1N5YB 1N54B 2BMBA 4A8XA 4G1QB 2H5JB 4LF8J 1RUSA 1NO8A 5D4OA 2KM8B 1HW9A 2J0QD 2AEJA 2YNIA 2DJWA 1VQOS 3FK4A 4NLQA 4ECXA 4USKA 4JP8A 5KFSA 3VR1A 1FE4A 3KJQB 2V8DA 4AQYF 3MAHA 4F0MA 3QSYB 4DR2J 1FKOA 1EETB 2B43A 2WVDA 5M2PA 2W9CB 2D69A 2ZH3A 4J9KA 2K1RA 2W9AA 4HI2A 3UD5A 3LP1A 1OY6A 1X60A 3KK2B 3H40A 3AODA 4HI1A 1RT2A 2CZ4A 2LCWA 3SCLE 4ZPAA 2BOPA 2RMLA 4X4TA 1YTYA 4CLUA 2X1FA 1CBKA 2ZH6A 2QZ8A 3THPA 2E5IA 3TVYA 1F60B 1XQIA 3BYPA 3GFYA 2KYZA 3B6BA 3VALA 4PWDB 1BWEA 2CIMA 2HVZA 2H48B 1VBYA 3GFXA 3G6VA 2OGUA 2IIHA 2W4CA 2YNHB 1NSPA 3DGPB 3NS6A 1WTFA 1LWCA 1RWMB 3K2YA 4W4MA 2LVWA 3F44A 1WHVA 2PC6A 2J7UA 3O3LA 4AL5A 1FFSB 1HBOA 4RW8A 3V6HA 4DX5A 1JLFB 2R8IA 4F7VA 3BO3A 5CXTA 4XDCA 4H4KA 2EEYA 4ZVRB 2UUAF 1FRIA 4CCHA 3DMJA 4O3PA 2QIFA 4NCAA 2DRAA 4NLDA 4DR7F 4GVLA 3W5ZA 4A4JA 1UVNA 1KONA 4YB7A 4YR3A 3KLHB 2ZWOA 1XMBA 3HHLA 3UCGA 3M6WA 4Q8EA 1FRMA 4WP9A 2W01A 4HTIA 1HPZA 4J90A 2CJQA 2ZM6F 3OVBA 1C1CB 2BOAA 3HZEA 3LGHA 1JLQA 1FTCA 1GTEA 1QE1A 2W2OP 1IN0A 3H8YA 4QWAA 1PC5A 3H5XA 4JI4F 4EUVA 2HURA 2UUWA 2GW8A 2JVRA 2DGOA 4P10A 2AHOB 3MCOA 2B7BB 3IS9A 3LPEA 2OEMA 4OLOA 4YN3B 1CLFA 1LW2A 5T7LB 1EP4A 1RWKB 1SJQA 4QCLA 2DGWA 2XYHB 4G1QA 1HNIA 2OFHX 2W7OA 2RHQB 4URGA 4TU8A 2OAUA 3QJJA 2HNZA 4I6AA 2CNNB 2JC0A 3OL9A 3LF0A 2B56A 4J5OA 2XCAA 1FX2A 1YHQS 1C4AA 1YZ7A 1XNRJ 2ZNYA 1KD1T 5IT0A 3TUZC 5C24A 3HI9A 3MMJA 5DLFA 2G2ZA 4UY8T 2PFDA 3RJMB 1WG5A 1P9QC 2V9WA 4X4NA 2OPPA 1H7XA 1UWBA 2IHR1 2HAFA 1RTJB 2HLUA 4HHJA 1HBNB 4DI6A 3QRQA 2H65B 2XLJA 1EQ0A 3IA0A 2JRSA 2C42A 4ITSA 1CC7A 1JKHB 1SI9A 4QBUA 3T1AA 2ZD1A 3IG1B 1LWFA 2DITA 1DZ5A 2NLWA 4B3OA 2B5JA 2QL7B 1CPZA 1Z2ZA 3GILA 1MMLA 4QQBA 3I55S 2F40A 3P96A 4P7TA 4KPCA 3ILLA 5F8HA 4X66F 3WC0A 4A47A 5L46A 3CCSS 3KK3B 2MGZB 2AYGA 1UFWA 2YKMA 3N5FA 4LRCA 4RJVA 3O1LA 2ROGA 4DL7A 3DLBA 3GJTB 3I32A 3O6QA 1R27B 3MTKA 2ZH9A 1RWVB 2I38A 3D3CJ 4B9SA 3KDNA 1VQ6S 5HJXA 2GIFA 2UU9F 1LFPA 1UZDA 4LVOP 1NHUA 3K17A 1N88A 1NNDA 1RK8A 1VLOA 3WX4A 2R4FA 5L9NA 4GVBA 3JYTA 3Q24A 1FFWB 1RAJA 2CQIA 1C0TB 5LMNJ 5HMXA 1X9MA 4DCOB 2RQMA 2V9KA 3LTOA 1LWEB 4NA2A 3GIRA 5A8RA 1RACB 2FJAB 3NS5A 4OYMA 3T1YJ 1HMVB 2CPIA 1R43A 5A6WA 2JEFA 4JYAJ 2HHTA 3IBCB 4JI8J 1S1XA 1VQ7S 4F8RA 3PG9A 5MLCV 4RW7A 5HQLA 1T9YA 2VG7A 2PA8D 3D2WA 3NNAA 4DR6F 2Z57B 1RWPB 3HHLB 2BJEA 4K7QA 2JC1A 1FT8A 5EWFA 4OI6A 2QA4G 1A9NB 3T9ZA 1UZHA 2W2PP 1YI2S 2H9ZA 2XNQA 3NCQA 4MKYA 4IYQA 4CNYA 3IC1A 3OXGA 3CXCR 4YS2A 5JXSA 4Y2KA 4I2PB 4KE5A 4GKJJ 4CIOA 3DU5A 5D0RA 1IKYB 1TL7A 4F50A 2R8JA 4ZCLA 2Z2MA 5EX3A 4A48A 2IJNA 5HROB 4GMKA 4Q2MA 3VGSA 2V50A 1YRUA 1JXEA 3IXQA 4A8YA 1N5SA 1D09B 2XZDB 2RQ4A 4DX6A 2XS5A 2HVIA 2VFRA 3VF0B 3W65A 1NB2A 3FDSA 1YJNS 4ECVA 3SYZA 4C7QA 2DCLA 7FDRA 3PY8A 3ENVA 5RUBA 3VWSA 1X5PA 3U1LA 4K4ZA 3M8RA 3KLEA 1TMJA 3HVRA 4QYZJ 4I6WA 2HLTA 1DJ0A 3UD4P 3B82A 1X31C 4OIXA 1X9WA 4PQUB 4WFXA 4Y2AA 3P5TL 4PRFA 2GJIA 5KT3A 3UDLA 3D7SB 2E5HA 4HR2A 5JVGQ 4UW2A 2JEJA 3J80Y 1Y3KA 4TVAB 1BY9A 1I3OB 4NEYA 1PSDA 4DSKA 2CQ1A 3NGTA 2Y1LB 3PRDA 1MROA 1DTTB 2VPYB 4ZVPB 1S9GB 5LXYA 2WTFA 1OSCA 4I7FB 5H9FK 2ZE2B 1XN9A 3OR2B 4KT0C 3CCLS 1IJEB 1RHUB 4P72A 1FNXH 5THWA 1DQ8A 1NDPA 5IQQA 3AB2B 1EP4B 3NGRA 3A12A 4NE9C 2DT9A 3R7NB 4BLGA 2YNFB 3THVA 4IFYB 4B3MF 1DQ9A 5D3GB 1FWLA 1ZOTA 1LWXA 2IRUA 3D9BA 4P75A 4TLQA 4EGLA 3V81B 1E6YA 4BBYA 3H90A 2OPSB 2QG9B 1YITS 2LFVA 2RDDA 4FYVB 1RXOB 4WFYA 1XMOF 4DV2F 2XMTA 4P2MA 2VG7B 4N8OA 5GAGI 4WPAA 4EZ9A 2FLOA 2X1AA 3DRPA 3ICLA 3GV5B 1O8BA 5KG0A 4DR1J 1U0HB 4UQTA 5DM6Q 3H5YA 4WK3A 3KHRA 1EJ7L 1TELA 2ZVIA 3VAJA 5H9EJ 3SV4A 2BDPA 4OHZA 4RO0A 2ZBIA 2F1FA 1S1WA 5HK4A 1G2EA 3PX4A 1UVMA 3KK1B 4A8OA 4CP5A 1EZZB 3EE3A 2P5VA 1IUJA 4QWDA 1PILA 2VA3A 2BKOA 1ZA2B 4USIA 5A8WB 1NKEA 1VQNS 3LAMA 1S79A 2GQQA 2X1GA 4P9SA 5HVHA 1KEKA 2C28A 2FB0A 1ZM2A 4PEOA 4N8NA 3V4IA 1N0UA 4AT1B 4EK2A 3UNGC 5CYQA 4Y6IA 3QIPB 1SPBP 1PGZA 1JXVA 2CJAA 2W2QP 1RBLA 3L7OA 2VONA 1RWUA 5EX0A 3QZ8A 1ZPWX 1WOSA 4OI1A 5KG6A 3TAQA 4DR7J 2L3MA 4PG5A 1GH8A 1Y5IB 2B8PA 5I3UA 5IT9Y 3OL6A 5ETOA 5HBMB 3CCRS 4WXOA 4PQAA 5DJBA 3JQKA 4P73A 5FDLB 2QMXA 1WSVA 4WU2A 5DS7A 4DR4F 4B9TA 4JI6J 3FEXB 1S1UA 2FTRA 2BE2A 2HGMA 2NXJA 3RRGA 1SIZA 3BGFA 4RUAA 1H72C 4ZVUB 1NLKL 1AUSL 2QL9B 5AXKA 3UDCA 1Q7YT 2V0NA 1JQGA 3CCES 5F9LA 1VBXA 3C2PA 4L3NA 4CLTA 4QZVB 3CCZA 3FGVA 2J8AA 3GR1A 4H54A 4WYLA 1TL5A 3ETMA 4LF6J 3CCMS 2B4PA 2FLPA 1FRLA 2J9EA 3BSAA 3G87A 4RW7B 4M5HA 1SL2A 3M6UA 1RT2B 1XEZA 4XTTA 5KFLA 2DGSA 2ZJRQ 1JJ2R 5A6PA 4IR1A 5IXUA 4DV5J 4QPXA 3HHKA 3I4HX 1PJ7A 3AXMA 4O4GA 4URQU 3KG4A 4CLZA 4CO5A 3VQSA 5IC6B 2RH3A 4LQ9A 5K9FA 2KH9A 3MMCA 5IT9U 4GRSA 3TP2A 2V4JB 2ZZMA 4WZQA 2ZE2A 3GP9A 1YJ7A 2RNEA 3MM5A 2AJ0A 2ZEJA 4FXDA 3NGSA 2W1BA 1N5YA 2VV5A 3DM2B 3OD2A 1YJUA 4FYXB 4KH0B 3CDUA 2MEWA 3MZIA 1FFGB 3M30B 1HQUA 4LT6A 2LEBA 2CNLB 2K7JA 1FWKA 2HWTA 2YWKA 3MAAB 2BYCA 2D74B 4F2RA 3PCOB 3QT7A 5DETA 1R89A 4O3RA 2DNGA 4ZVGA 2LXFA 3R6GB 2DXDA 4CTAA 4PUOA 4DF4A 1ZTTA 1S57A 4PPDA 1LW0A 1SC4B 1WUUA 1DTQB 4F4ZA 2ROPA 4PXCA 4FS2A 1KS2A 1RT1A 3PEHA 3QLHB 4C0OC 4IRKA 4C8KA 3CDBA 3NOGA 2CQCA 2DNNA 3AD8C 3W9JA 4IQXA 4K2XA 4ZLPA 2KRBA 2Z2LA 3FEYB 3HPOA 3H7HB 1S1WB 3UDEA 5EDWA 1R8HA 2B9YA 3CMAS 4J9QA 2AD9A 2OIHA 4FYDA 3M6XA 4RKUC 1Y4ZB 3AQOA 1DAXA 2BE2B 2MHNA 5H9EK 1VQ8S 3HHNB 3OW2R 1CJVA 3CD0A 4KKOB 4M95A 2VFUA 4KIAA 1CVJA 3SZ2A 1YVFA 3R5AA 4NLRA 5DG9A 4CH1A 5J2PB 4HVZA 3PO5A 3HMJG 3KNAA 3DOMA 4R5PB 3CCVS 4DR3F 5KFFA 1RBAA 2PT0A 4PAAA 2PMZD 3SCJE 3UN3A 2H1YA 3JSMB 5DZ7A 1N36J 5DQHA 3R2CJ 1UMJA 1K1SA 3NMRA 2BW7A 3PW0A 1R0CB 3M6VA 3I0SA 3QJLA 3GSIA 2BEFA 3OLAA 3HFKA 2KRRA 1TKTA 2R8KA 3SDEB 2ADBA 4TN2A 1U8WA 2B0GA 1NJYA 1GX5A 1DLOA 2IYGA 4DN9A 2V2ZA 3K7RA 3UO0A 1CJTA 3TUPA 2UP1A 4IFVB 3JTPA 2BBEA 5AE3A 2F4VJ 1NH8A 3MOJB 2VC1A 3MMBA 4DV5F 5DGAA 4KO0B 2CPZA 1AXQA 1FRXA 5LJ3Y 3MCNA 4NLWA 5T7LA 5GADI 1Z4UA 4NZ0A 3US5A 1UTAA 5M2UA 3GIKA 1CQNA 2OJ3A 1JWWA 4O0IA 1M1KT 2BJDA 5AE1A 3VAGA 4FS1A 2O67A 2QYGA 3IRXB 3R5BA 1FKAF 2OEJA 5L8RC 4EWTA 4CTAB 4X4OA 3UN5A 1J5EF 2FZKB 2WOMA 1KR4A 1SC6A 4Q7AA 1NBEB 3GIJA 2QLWA 4RR5A 4KHPF 4NLUA 3RR7A 1APSA 4NL5A 3CJKB 3HVWA 3PKMA 2O1PA 5T14A 2EVZA 4OHWA 4L75A 3M1VA 3LWMA 2JL9A 2MKSA 3FRYA 4DL6A 2FJXA 3OXLA 1WKKA 4ANCA 3QSIA 5KFZA 3OV7A 2Y1RI 2KT2A 3MM5B 4AD6A 1C0UB 4QIEA 2CG8A 4LRFA 5KG3A 3BDEA 2L08A 2QC3A 1LWFB 5AXMA 1K0VA 1FXRA 2XMAA 1CS4A 1QSSA 3QGPA 3NG8A 3AH6A 1R7IA 2YNHA 3DGPA 3L9ZA 2XI3A 3TJ9A 5CAAA 3CJTA 2XMVA 3ZZUA 1AZSA 3J81j 2WRMA 3C14B 1IR2A 1VDHA 1X4EA 2CA9A 2JHEA 3NLCA 2FC8A 3OUYA 5F8JA 1AFJA 1IBLJ 4WU3A 3AOBA 3M8YA 3QRRA 3W3SA 2DIVA 3SSRA 4JYAF 1UKUA 3T1HF 2MGZA 4RNNA 5F41A 3DCAA 1QM9A 2HRTA 2YWGA 1ZPVA 4RWXA 2DHXA 4Q43A 3FSIA 4Q0BA 1NU4A 3R5CA 5G4DA 2ZJQQ 2XI2A 1N36F 3BF4A 4LSNB 2JEIA 4AE5A 2ZBPA 1QAIA 2L9NA 3EX7B 3FZBA 1FEHA 4FPIA 2ZD1B 1IVZA 4AXJA 3J81U 1FX4A 4YP3A 4FBUA 4U8VA 1GMWA 4LF5F 4OYBA 1HFEL 1BQMB 2HBYB 3CF5Q 2ZH5A 1BE4A 3Q2SC 2O3DA 2YX1A 1HBUB 3EZOA 2KT3A 4DDFA 4FF3A 1DQAA 1NK7A 2E9RX 4C3KA 1KN6A 3BN4A 4A8KA 4LR8A 1ZM4A 3CIZA 4J9VA 3JSMA 4P2SA 1M5HA 2YKMB 2FDNA 1HBMB 2C1EB 1P6TA 4DV1J 3CD6S 4LRAA 2I9SA 5T41A 1JJ4A 3C16A 2OD4A 4JI1J 2Y8WA 4ZPTR 2HVHA 3JSRA 4ES3A 3OL8A 1KP6A 2ASDA 4KGKA 1RTIA 1CSJA 1U6ZA 1H0HB 4H4OA 5BR8J 2ZDOA 3BJYA 4EBCA 1YJRA 4G6VB 3RW7A 3D1HA 3L4BC 3MD1A 3OSPA 3CJ8A 2LU2A 2J0XA 2B9EA 4C11B 2D3OR 4GC7A 3IG1A 3T41A 4Z7YA 2DHAA 3RYLA 3UWTA 4EO8A 1BD6A 5AT1B 1UA0A 4NXMF 4KFBA 4TY8A 5B0BA 1N4LA 3H2LA 3MPWA 3C14A 3I87A 4HHHA 4IG3A 3X1LB 3GLJA 4DR2F 3DOMB 2DRBA 2MSSA 1FXLA 5K8PA 3L09A 5DDQC 5DQIA 2BANA 3R5DA 2I1RA 1WTBA 1XNQJ 5IM0B 2B6AB 2QJ3A 3IWXA 6FDRA 3TEHB 4N76A 1VRTA 1BQXA 3A4TA 4H4MB 1TKDA 2XCPA 2RD5C 4OFZA 3VAHA 2RKIB 3QO9A 3TWZA 5BYSA 3D67A 4WTYA 4B9UA 3SSQA 1MROB 4RBTA 4PABA 1K9MT 1W2BR 3DHXA 1U48A 1QVFR 2CJ9A 3QPIA 4DV0F 2IY5B 1WHYA 2JSXA 3CDWA 3GFZA 2M0GB 3CGIA 2AEFA 3M9MB 3NCRA 3T6JA 1C1BB 4DSJA 2HK2A 1NSAA 1D9AA 3EXYA 4UUXA 3TOQA 3OUYB 4ICLB 3W66A 2E5GA 3R2DJ 2W4DA 2MQQA 3KHHA 1YBUA 4YHHF 3KLEB 1E6YB 3QIPA 2G1DA 1WC1A 2W9CA 1N34F 5EN1A 2WSEC 1SVDA 3QIDA 2WAQD 2A0FB 3A8IA 3D5MA 2FHOB 3K5PA 2E66A 1Y3JA 4M5GA 4Q2LA 1RTDB 4RNFA 3S7RA 3DLLQ 3FQKA 1Q16B 5E3PA 1NMEB 1RJJA 4YY3F 4LSNA 2RILA 2XBPA 3MTJA 4DQSA 1HQEB 4I67A 1C2PA 3BREA 5HVFA 4F67A 1LQ9A 2GNKA 4NYOA 1ZH5A 2M2BA 1F0XA 4IRDA 4WIQA 1DY3A 5IQ6A 2HW3A 4IH5A 3VGTA 4CNZA 1N32F 3CB4A 4X4RA 5KOWA 2QEXS 3W9IA 4DX7A 2MTLA 5KFDA 3OR1B 3TI0A 3I0RA 4OLPA 3MCSA 4B3TF 4CT8A 1HL6A 2OPSA 3DMJB 4TKTA 3KXDA 4WFAQ 4DUYF 4F2SA 2DKOB 5D15A 3LWLA 3V2UC 4DX8H 1SKWA 4MIAA 1NB7A 2HHHF 5HQMA 1NUEA 2NS1B 1PJ6A 4ZCKA 2MXYA 4X62J 4PG6A 3A8EA 1TUWA 8AT1B 1OMSA 2GIQA 1FRJA 3H20A 2HHPA 5JMNA 1YIJS 4JI3F 4K4UA 3PYDA 4ENOA 1IBMJ 3U1NA 4H4MA 2QLJB 2RU3A 1NK8A 5FDLA 2UZAA 2A6MA 2DISA 1KQSR 3N5BA 4CWBA 3BM7A 2XM3A 5LMNF 1S9GA 1IJFB 5L1IA 3VAIA 1ELOA 2PN6A 2XMKA 3MM8B 2BZ2A 4DL0C 4X4QA 1AW0A 3SFUA 2B51A 2AQ4A 1CULA 1FE0A 3BB5A 3MM7A 4RW6A 4M1KA 3HHLD 1ZBTA 5KT6A 4OYXA 1HBUA 2ZHOA 1TVRA 3KOAA 3LANA 4IFYA 2HVDA 1QY7A 4KGZB 1S9FA 5C24B 4DS4A 3DFEA 2LQJA 3LALA 3ZTRA 2HBQB 2KZMA 1Q8KA 2WVBA 4HEA9 3QFHA 1D0EA 3NRBA 3G8QA 2GHPA 2VBWA 3JS9A 3OXFA 1ZETA 3CCJS 2MJNA 2FPHX 4B3SJ 3CDAA 5GMEA 4X4UA 1HHQA 2N4CA 4BDPA 2KDOA 2OPQA 4KHRA 3CO0P 2NXEA 2WSFC 3UN2A 3ZTSA 1JKHA 2Z4PA 4OYPA 3BQ1A 2MKIA 2AMCB 3DC2A 3CT9A 4BS2A 2Y9HA 2KYXA 3Q22A 3UR3C 1V3ZA 3SQGB 1X4DA 3LP2B 1NM2A 3TX0A 5C25A 3J7YU 1U1QA 2WSCC 1N56A 2E29A 4UF4A 4DQIA 1FXDA 2FVRA 3G2XA 3F0NA 4EEYA 2XLIA 2AJQA 2GS8A 3DLEB 2CJKA 2YX4A 2UVVA 3C3LA 2YX7A 3T3FA 4KJIA 5GAEU 2DXFA 2VB6A 3F73A 2XGPA 3DU6A 4X64J 3SMZA 5EWGA 3CJSA 3O8WA 2DNYA 2M7SA 1IKVA 3CIMA 3K5MA 3JTOA 2VBYA 1VQYA 3IFEA 1V5IB 2QRRA 3OJUA 1FDBA 3UFCX 2XMJA 3FZ2A 3NAHA 1KFDA 2EFVA 4UQGA 1F3FA 4M8LA 3DN9A 5HBMA 3SIPB 3R6LB 4ZP6A 4XIUA 1F5AA 2U2FA 3CJQA 3M32B 1UVLA 5A76A 2IMWP 3TYTA 2DBBA 4PG7A 4J9OA 5F0WA 4OI2A 1URNA 3KMSA 2XS2A 3PW4A 3I0RB 2GJFA 5B0DA 2IA6A 2O01C 1QSYA 2E5LF 4X4VA 2YKQA 4ZP8A 4PXDA 2F9JA 4C3MA 1WC5A 1VIXA 4OYAA 2FGOA 1Y5LB 5KG4A 2VZ9A 1S6QA 2IJFA 2UUCF 1BUXA 2H51B 1ZAXA 3R1HA 3MUTP 1NK0A 2GGPB 5KFJA 4MK8A 1W25A 3CTRA 3G4SS 4ZITA 4AL6A 3SDEA 2J5AA 1IKYA 1TL7B 1VIOA 3R7BB 3W2VA 3O2IA 5E0OA 4DJBA 5KFAA 2NSBA 2VPWB 3OLBA 1SUQB 3BYRA 4URSA 1TV6B 4LSLA 4WF9Q 3MUVP 1UVKA 2IA0A 3EVOA 3OL7A 4EYHB 5DM7Q 2MLYA 3VCDA 1R31A 1JB0C 4TLRA 2NSCA 1EETA 2PE8A 4K2JA 4M5NA 4KHMA 4C48A 1IBKJ 1W26A 4PWUA 3KJVB 3DOLB 2VQFF 4XDDA 1TQLA 2XZTB 2DK2A 1MWQA 3QBCA 2CRLA 1W2IA 1JLGA 4HTJA 1H6KX 2HFNA 3MM9A 3W1YC 3KHGA 1IKVB 4O4RA 2LYVA 2FVPA 4W92B 4F0KA 4C98A 2FVQA 2QLXA 2KTQA 1NDLA 3MECA 1F2GA 2ZOGA 1DTTA 1HQ2A 2OMOA 2OUGA 3M8QB 5CYMB 5JVHQ 3PO4A 1WKLA 3FMWA 4C0BA 1HNZF 2BKPA 3WQPA 2DEIA 3HX9A 2HQGA 3CVKA 3HDSA 5A0YA 1ITPA 1KWMA 2ACMA 4LF7F 2E44A 4QU7A 1YJVA 3MEKA 2WB4A 4N56A 2OKQA 1FVSA 1H3DA 1T11A 4O23A 1R3NA 3W2WB 3HT0A 2OD6A 2CNOB 3TQEA 2XULA 4M5LA 4DWIA 5KFBA 2CWXA 4NRTA 3MXHP 3R27A 1VRUA 3HP6A 1W7WA 1L3TA 2CVIA 1IKXB 1HI1A 1MG7A 5E7OB 3CCUS 3EXCX 2K06A 3HVTA 2JEGA 3EM1A 3ZZPA 2UXDJ 2HIYA 3OQ2A 1X4HA 3BBFA 4N5SA 2XGQA 3ADAC 1GK8A 2XSJA 3CE8A 2AWZA 3GG1A 1NK9A 3GFHA 2AT1B 1REVB 1M5SA 1S9EB 2E1RA 1ZTWA 1TL3B 2MZJA 1H73A 5KFNA 2L48A 5DO2A 2Y3YA 1GEHA 2BXJA 3CWJA 1P1TA 2RQKA 3BR8A 2ZUGA 4X64F 1NKCA 2BABA 4KFBB 1DRZA 1N33F 4WE1B 2ZWPA 2CWKA 1RI7A 1TAQA 4X65J 3NS7B 4O44A 4NXMJ 2N3LA 2YNFA 2AIRB 4RW8B 1PG5B 3J80U 1RB0A 4NI2A 4MIWA 1F6TA 3V81A 2C2KB 1GT8A 2D3ZA 1PC4A 1WC0A 5J1NA 4HDHA 2XSFA 2GX8A 3UVJA 3BSOA 4WXWA 5F3TA 2RRNA 3ZZYA 4K5SA 2FHMA 3TR5A 4IUFA 1TAUA 4V19J 3ULHA 1VMBA 2GMHA 3M05A 3PEJA 4L72B 1M1GA 4CO4A 4ETXA 1XK8A 3B78A 3CCQS 2HHSA 2HNDA 2RAQA 4PWDA 2OMLA 2F9DA 2EFGA 3SCIE 2RS2A 1I1GA 5K5MA 1EARA 1NHVA 1YRXA 1XWLA 4ZVTB 1TU0B 3IGVA 5B08A 2NCKL 1SJ4P 1G4CA 2ASLA 4LFBF 1UL3A 1PAEX 2W25A 4RL1A 4LR7A 3KG0A 2RDJA 2CZ9A 2DTJA 2V2KA 4J7CA 4LFBJ 1JLFA 3KUGA 3TX8A 4ECUA 3T5LA 3RR8A 1LEOA 5IC4B 2CJBA 4Y0FA 1T9XA 1VRUB 2CDQA 2MKCA 4ZVEA 5IV3A 4WFNQ 1RADB 4YHHJ 2F65A 3V4MA 4K5RA 3SI8A 4AFFA 2EC2A 2FHJA 3IAM9 4CDIA 1RLDA 2HGNA 3IMQJ 3M8ZA 4L3KA 3S8SA 2E5LJ 4U7UD 4R8UA 2LXUA 5LJ5Y 2DH8A 3JTNA 2HVEA 3N0VA 1QVGR 1ZM9A 2DH9A 2XYGB 2G0CA 2OH2A 4E2FB 4Y2MA 1S9EA 5KFMA 1I51B 4IO9Q 2HGLA 1FA0A 2WVEA 4ZHRA 2R7OA 2RHSB 2XMUA 3M8SA 3OR1A 1KTQA 2UUTA 4BHQA 1HMVA 3D28A 2VG5B 1Q86T 1C1BA 2IDLA 1BQMA 4LFAF 1VLYA 3O44A 1S6OA 4ZIWA 5ETQA 2PI5A 3D68A 4OX8A 3TA0A 4JI7F 4G3IA 1HYSA 2LU1A 2BM1A 3ZZRA 4FYWB 5C5JA 1MWZA 2GO8A 2COLA 4JI5J 1UETA 1KDNA 3HVTB 4NX9A 5GMDA 5KFIA 3T5JA 3CMES 4K0KJ 4OZ2A 1R8BA 2QMWA 4HKQA 1O0PA 4OYOA 4KPYA 2ZVSA 2MQPA 2HAIA 2PA3A 4CLSA 2CG4A 2MHEA 3MFHA 2R2SA 2P6SA 3JYTB 1TL3A 1T9WA 4KGMA 2DY1A 2HNYB 1MMNA 2BJ8A 2KKHA 4KY3A 4IDKA 4R0JA 3W61A 5HJYA 3LO3A 4U8YA 1SJFA 3O5TB 1E6VA 1NDKA 1YWXA 2VG6B 3NWGA 3WBZA 3P3DA 4F3MA 2BACA 2KB2A 3DLJA 3K89A 4Q44A 1VK3A 4RNHA 4C8MA 1PBUA 5J2PA 5K20B 3B8HA 3NNHA 2HFOA 4FVCA 4QR1A 3J81Y 3M30A 4J9NA 5J1EB 3DYAA 3PIPQ 3WZ0A 2KHDA 3G96A 2DNZA 1Z2LA 3QYYA 3RAQA 1R0BG 1D1UA 3UVJB 4LF6F 4M94A 1SH0A 2ASJA 3WIUA 2LP4A 4JBCA 3I0SB 3D54A 1JK9B 5KFYA 3ENAA 5HN0A 1M1HA 1WELA 2YQ1A 1VQ5S 3P45B 1S10A 3I56S 2DR7A 1KBRA 1UEVA 5KFVA 1UWBB 1J27A 2HQDA 2ZH4A 2FVCA 4DG1B 5KFHA 3BGOP 3MEGB 4OYZA 2AGQA 4MYUA 3G82A 3ZFVA 3K57A 3D0HE 4FNHA 4N47A 3QGIA 1S1TB 4DBQA 2N82B 4DHVA 4Z7CA 3H25A 3MM8A 3PR4A 4DL5A 1SH3A 1S0OA 1B7FA 1T3OA 4Y28C 3GCWP 1AFIA 2QMUB 3RBDA 2CVEA 4X84A 1VI7A 2Q6CA 1YBTA 2FZGB 3M4XA 3T1HJ 3DLGA 2N3OA 2OTJS 4DV1F 2BKNA 2YBVA 3CJKA 2AJFE 4RLEA 5C7PA 4TXSA 1TZ0A 3GR0A 1ZYQA 1U1LA 3EWGA 3K59A 2IAJA 1I94J 4MMOA 5D78A 1F2HA 2UXBJ 3KUHA 4NPOA 4KQZA 3M9OB 2MQMA 2FY8A 2DHSA 3PW2A 3HSGA 2UUCJ 2CQ4A 2YPZA 4CZCA 4JI5F 1VOMA 2MKJA 2GMLA 1VC6A 1FJGJ 1S0MA 3TZYA 2HIQA 4I2QA 4QYZK 2IBOA 1OIAA 2OPRB 2ZNZA 2R2UA 1KHWA 3NBPA 3QATA 3KLVA 2DPJA 4ELVA 2PMWA 3HSJA 2WONB 3NKYA 4JI6F 3H5UA 4CI0B 3PDNA 1Q8LA 1X4GA 3K5LA 5HAOA 2ZJPQ 1MNEA 2Z58B 4KC5A 4OJ3A 3V6DB 3EGZA 3EGVA 2HS0A 3H98A 4OJ1A 3MD3A 2KZZA 5BXIA 3GV8B 4A8FA 4LFCF 1T9TA 4FKYA 5A8KB 2VC0A 2N7CA 2OELA 1H2UX 2ZKTA 5H9FJ 3BPSP 2ASYA 3AJDA 4B9MA 2GCFA 2BV3A 2H5EA 1B70B 2FHJD 1SL1A 2B4OA 1F9FA 1NKBA 4E0DA 4ZVQB 1X8DA 4Y34A 2E7VA 2ZOFA 5AXLA 3Q8QB 1RCOB 2QA1A 3OHBA 1SV5B 4MKVA 4WTOB 5F3ZA 1KC8T 1D9FA 1QD1A 3AB4B 1FNOA 1VQ9S 3R7SB 1WNEA 2XS7A 1U7LA 1M5PC 3GB0A 1Q81T 1I5OB 1P9YA 5KAKA 1QJHA 1S97A 3AXKA 3PYEA 4DR5F 3W8PA 4OX7A 3VZIA 4DV3J 2NZCA 4P71A 4NLTA 1JLEA 1YX2A 2M70A 1MU2B 2P9GA 4WWSA 4DR3J 1CEZA 1J5OA 1MLAA 1F5CA 4U9RA 2RS8A 2B8QA 2MYFA 3VAKA 1U47A 2HMIB 2VOOA 4B3RF 4NCGA 1Y7PA 4ILMA 2VPZB 5CA5A 1YSJA 2CPJA 3OFEA 5KFTA 3TRGA 1U6FA 1OS5A 3CJ2A 1R0AB 4A46A 2Y1IA 4ZDNA 3IGNA 1GMWD 3GJQB 4FXWA 4DOZA 3M2RA 4ECRA 2UVWA 2V2QA 3E2EA 2X3GA 4OI4A 1NK6A 5GAHI 2DYAA 3C46A 1BC6A 1IWAA 4QU6A 4JI4J 1RTZA 2XZWA 3SCKE 3VAMA 5E3RA 2FQQB 3Q83A 4ED3A 4DSEA 1OJ4A 5EUHA 4KHPJ 1YRTA 3IM9A 2HEKA 1PIEA 2APOA 3RB6A 5F8NA 4ANEA 4R25A 1S48A 1UW4A 5CZVA 2YH1A 3MMAB 5KFUA 4CYUA 2GO9A 2GQCA 1FVQA 1KLMA 3CEDA 3FUYA 1RA7A 1FDDA 2QV6A 5HVGA 5KG5A 4U67Q 5KFQA 4FYYB 2C2OB 1VC0A 1MMDA 2D7SA 2C3MA 3Q2TC 1OPIA 1UFLA 1NXIA 1P8GA 4CLLA 3CC2S 1RT1B 1WC3A 1JLAB 2QGFB 3D0GE 3QLHA 4FNIA 4DZDA 3MR3A 3L3CA 3P49B 3IO1A 2JOQA 4P74A 1WOPA 1HBNA 4CH7A 3R5JB 1L3KA 1YJTA 3GG0A 4Q45A 2ZZNA 1FNMA 1IBMF 1FRKA 4DPXA 3KUEA 2W8KA 5ADZA 1X0PA 4FVMA 2M5YA 2GHVC 3M8QA 5CYMA 2CQDA 4ANDA 2C3YA 4DPWA 2ADCA 2FJVA 3QFWA 3RTVA 2FLLA 5CD4H 4PR6A 3D6HB 2CFXA 3KKFA 1S99A 2C2NA 3SBMA 1RAOA 2D9OA 4MIBA 5C2GA 2C2DA 3DM2A 5CYJA 1SKRA 1IBKF 1HNIB 2YY3A 2EBEA 4QR0A 3KWMA 1VQMS 2PGCA 2OEKA 3BQ2A 2RRBA 3FSXA 2DEJA 1SJ1A 1YG0A 2V4QA 4KV8A 4OYWA 1RP5A 4PG8A 4J9SA 2H54B 2WBRA 3PYGA 4IH7A 4UOHA 1WG1A 2VIHA 1MSWD 4ZIVA 3D0IE 5J2NA 2FJWA 4NLGA 1KVIA 2B6AA 2JDJA 1NEEA 5EWEA 2YVSA 3PJWA 4PPZA 1UPMB 2RU9A 1S4FA 3VVTA 5C2CA 2FJEB 5DGBA 1U2RA 2MZSA 1RAIB 2ALYB 1GMUA 5IOLA 1U1MA 2Y0BB 4EI2A 2QA2A 5ETKA 1KLNA 3DI6B 5A0YB 2Q3PA 1RHMB 4W98A 1X9SA 2IM2A 3TZWA 1Q5VA 5A8RB 1EX8A 3ELHA 2R9LA 3UDVA 1T05B 1H38A 4V1Ak 2VKRA 1FF2A 1VR6A 1YBAA 3Q8SB 2DD8S 3GSDA 4B17A 4B08A 1D8YA 2R2RA 3IRWP 5JJBA 4J9UE 3HK2A 3FSYA 1JLEB 2P9CA 1YDLA 1Y9OA 2G1HA 4DMZA 1RCXB 4JI8F 2UVUA 1FKPB 3GZ7A 4NI2B 3CUNA 4F3OA 2H3EB 1LW0B 5E3QA 3F41A 2HG4A 4YDDB 2V8GA 3JQMA 3PR5B 4G1PA 2IJRA 1VISA 2A2DA 2EFQA 4ZVFA 1WWHA 4KYZA 2FUG9 4O3QA 3S1TA 3TO8A 1WC4A 3FBFA 2M9KA 4AL7A 3BH7B 3VTIA 4C6AA 3DDIA 2CQPA 2MZTA 2KM8C 4ED6A 1NCLA 1EQMA 2AYMA 2VQEF 3MECB 2DNLA 4GO5X 5KTQA 4J9MA 2ATLA 3C6UB 1UW9A 2M88A 3BV8A 2E5JA 1M0SA 3KLIB 3MMBB 1GAOA 4KO0A 1JLBA 4IOCQ 3K8VA 1M90T 2YTCA 3JSYA 1GMVA 1ACMB 1HYSB 4Q8FA 4ID5B 2DCUB 3PFOA 1ZZNA 4DS5A 2KXFA 3RBXA 1JXLA 1QUPA 2K8GA 3CW2C 3HJFA 1TKZB 4ED2A 2AW0A 2MSTA 2XYPB 5I42B 1KFSA 3FKBA 1DARA 1WSRA 1VQLS 1HARA 3Q8YA 2BVZA 4QR2A 2QFJA 3PACA 4CM2A 2MY8A 1GXUA 2ROEA 3HHDA 3L95X 1VQPS 4L74A 4TU9A 1XTZA 1U1RA 5AJ3J 1BQNA 4J9LA 2NYHA 4NYZA 2BQRA 4F25A 5C25B 4O3SA 2QA4S 4DSIA 1IKWA 1OWXA 4USTA 2KO1A 1FI4A 2BE7D 3I82A 2ZHAA 2HRUA 1L5UA 4LJMA 4WYWA 2X7IA 4KGVB 4UUWA 1K47A 5FIIA 4DPUA 4Z37A 1WC6A 3DYAB 4L6V3 4FKXA 1S1VA 3PIOQ 1KLMB 1HR0F 4O44B 3W62A 2HZCA 1WHWA 2OO4A 3EPGA 2A3JA 1UFKA 2H5IB 2WOMB 4LIWA 2LMIA 2VICA 4RWWA 4NLXA 5E5NA 1RYRA 1OYEA 4USWA 5GAEI 3ZO7A 1VBZA 3OTEA 5L1KA 2K3IA 1U1KA 2YKOA 2I0XA 1G1XA 3NOCA 4YFUA 3QGGA 5E41A 4DQPA 2X51A 3W60A 3PJXA 4CO0A 5B0EA 1HNZJ 3T5KA 1R6VA 3QAEA 4I0WA 4ZJLA 4CRJA 4QWCA 3BGRA 1XERA 3HXMA 4I56A 5HP1B 1RBOB 1CS4B 1WDTA 4YR2A 5IT4A 2HKEA 3EPIA 4DR1F 3W5YA 4OHVA 1TK0A 3GIMA 3E3XA 4ZPWR 4CO2A 3BBBA 3MOZA 4F4WA 4LBHA 2ERRA 1TR0A 2AZ1A 3CJ5A 3S01A 4WP3A 2R7XA 2AJ4A 2LECA 1G7CB 4J37A 4B02A 4NASA 1SQGA 2KHCA 9ATCB 3T9NA 4H4KC 2VQFJ 4LREA 2JZ5A 2BX6A 3N9UC 4DR4J 4GO7X 2P8IA 1S6PB 1VQ4S 2QLFB 3CC7S 3J7Z5 1ROFA 5BJRA 3JB9k 5KFPA 3PX6A 4DZ6A 4ECQA 1YK9A 2W8LA 2YWFA 2DHHA 1SQFA 3VZHA 1NAQA 1PYOB 4KTQA
chains in the Genus database with same CATH topology
3G8SA 4U7CA 3MF5A 4OZJA 1M5KC 3I9ZA 5DDRC 2ABYA 3C6TA 3TAMA 5HMYA 1XR7A 1WI6A 1D9FA 1G1XA 4QWBA 2OSQA 3SSSA 2GFFA 1RT3A 3TNVA 2DIUA 1C0UA 1UJ6A 3SEOA 1GNKA 2CPHA 2ZITA 1JNRB 4FN5A 3G6XA 1OSDA 2XHWA 4RU9A 3AJ2A 4RW9B 4WFZA 1NJWA 4WFBQ 3V6DA 4C8LA 3EZ5A 4E8UA 4KR0B 4HT7A 2P9EA 4OZ0A 5E3AA 1HBMA 3BN7A 3KLGA 3CPWR 2I8EA 3MAQA 4ECZA 2VPXB 1PO6A 5HO4A 3KHLA 3DRXA 5IS2A 4MFBA 1HWUA 4ED7A 2K1RB 4HH0A 4LVNP 4TQRA 3FVYA 3EGNA 1XNRF 2IAJB 1XBWA 2KI2A 3NCPA 4YUDA 3UCZP 4ED0A 3FMBA 2ZC3A 2WW8A 4R0EA 5K8MA 5KFXA 5KT5A 2DR8A 2HHUA 1S1UB 5HMWA 2J0WA 2AX0A 5B0AA 3KK1A 2B5JB 4MKBA 3KLIA 2MZ1A 3CO9A 1B0PA 2VBXA 4NYPA 4BC7A 1Y5NB 2CYYA 2DGTA 2NREA 2RE1A 3RRKA 2Z0GA 3PNIA 2C22A 4X4SA 4EU0A 4OI3A 3UR0A 4HDGA 1NH7A 4F4XA 2RB7A 3OFGA 2BUNA 5I4MA 1RTJA 2VL1A 4MKAA 1URRA 1JIHA 4OJHA 2X1BA 3QGHA 1RT7B 1HQEA 3R3TA 4N77A 4H4OB 2VUGA 5KOXA 4EZ6A 2V4JA 2ZFHA 5L38A 3MR5A 4MJKA 1RYSA 3I96A 1NK5A 4C4WA 5B7WA 2D9PA 4WIIA 1YQHA 1T02A 2C3OA 4EFAC 4DFKA 5HL7Q 4DF8A 2PFFB 3EYZA 1RTHB 1O5JA 1VQSA 5D4LA 3CULA 1J2VA 4K4WA 1N48A 2Y0SD 2C3UA 2R7QA 2BRLA 2OPPB 1X4AA 3PKYA 3M8PB 4JI0F 3EUNA 3M2UB 5J2MA 1RT5B 2JLEA 3ENQA 5LSLA 1U1NA 1UP1A 2VBZA 4KBIA 2B4UA 3A1YG 2FD2A 2YKNA 2AJ1A 2M4MA 4DLEA 4ELTA 5HROA 1LWEA 1IQZA 1R8CA 4TNOA 3PW7A 3KLFA 4B3OB 4ZS6A 1S76D 2DNHA 3LPYA 5C42B 2DNOA 5KT4A 2LQBA 1VQKS 2NZ4A 4NLSA 1QLNA 2M52A 5K8OA 2NYIA 2G4BA 1RISA 4NLPA 2O66A 2J0SD 1H2TZ 2PO4A 3X3UA 1UAWA 1S6PA 3OTDA 1JLAA 2DH7A 2IRYA 2J7KA 2AX1A 4NA1A 2EG1A 3T1YF 2V94A 2OPQB 1X4FA 1FDAA 3W7BA 2V8HA 1ZAVA 3TA2A 3HKZD 4I1TA 4I7FA 4D3GA 2ZH7A 1S72S 2DR5A 3K5NA 3V6KA 4ETZA 4MH8A 3E8OA 4I68A 1SL0A 3MMAA 2OFGX 2B7CB 3EGWB 1TVRB 4HH1A 1VJWA 2C2EA 2XMMA 2AP6A 1N6QB 4NLVA 4J9RA 3P6YC 4PQUA 3IRXA 3TAPA 2OLWA 3DHWC 2W9BB 4IH6A 5I42A 2AYEA 3DRPB 3MURP 1XNQF 4LIRA 4NCGB 4XAKA 2FGCA 2VA2A 3N79A 1R0AA 2EG2A 2CQGA 1FJEB 4C3LA 4R8UB 4BCAA 2AV5A 2FHKA 1QTMA 3IWNC 4IFVA 4U6PA 4ELUA 2J6SA 3MEDB 4FXVA 4ZP9A 2IRXA 3J7ZT 1JLBB 1GQEA 4ZCIA 2F8HA 1LFWA 1K8AT 4XPEA 3HT3A 2UXBF 3MPVA 4ZVHA 4ALZA 4BC9A 5FD1A 3MM7B 1TL1B 5KFCA 1FESA 5BR8F 1MW7A 1HA1A 2DB1A 2VFVA 3DRSB 3DRRA 4DL4A 4X2BA 4JOUA 2DGVA 2MMYA 2JFKA 4ED8A 3RU0A 1CQMA 2DNPA 3LP1B 4X4PA 4I69A 3KMQA 2CQ2A 3DOKA 4JI2F 4K4XA 1U2FA 1O51A 4DQQA 4OZNA 3IBWA 3N28A 2FIUA 5J2QA 4FZVA 3DLKA 4HLBA 2J76E 1LW2B 5GADU 3PXGa 2BA9A 3C6UA 1U1PA 3RAMA 1XR6A 3U02A 3BGLA 1JJHA 3ITHA 4JI1F 2E9ZA 4GKKF 1SBRA 2VH7A 1DBDA 4ZPBA 4A8WA 4IG3B 4HL9A 1FERA 1TKXB 1FO1A 4TU7A 1N6QA 4PXEA 5D4PA 3G6YA 2UV8G 5CH7B 3AA9A 3OFFA 4ZKAA 2C3PA 1KVJA 4CT9A 5FLXY 3KK2A 1RTHA 3MM6A 3KLHA 3MPYA 2VODA 2KJVA 3MM9B 3G86A 1X0FA 1KSPA 4RNOA 4P7VA 3R1LA 2O5DA 1Q8BA 2RF2A 2K2PA 2ZKUA 4Y3CA 4Y00A 1S49A 2PD1A 1U24A 3BR9A 3N6LA 1DFDA 3NBPB 1LWCB 2B3TB 4A8SA 1IKWB 2WHOA 4WE1A 1H7WA 1VK8A 4NA3A 4QW8A 3LP0B 3QMQA 2KJWA 2L41A 1Q7LB 3CJ0A 2F7VA 3RB3A 1MWYA 2DNKA 1G6BA 4JV5F 1NK4A 1LXJA 3WDOA 3V4IB 4PUOB 1FKOB 2OSRA 3MEEB 3NP5A 5LSRA 5DQGA 1V9OA 3MGJA 1X5OA 2IVYA 2Q79A 3GYXB 3F56A 1XC9A 3MMCB 2EK1A 4NXNF 4PKDB 2IC3B 1ZM3A 2RQCA 1LV5A 4EO6A 3MEDA 1C4CA 3FQLA 1K1QA 3WC2A 3BGRB 2EWHA 1WF2A 3POTB 4X62F 2LDIA 1VS3A 1L3UA 1WI8A 3ZZTA 1H2VZ 3OTCA 4TY8B 4DEZA 4J9PA 4ZK7M 5MAOA 2HQIA 2WCXA 2IVFB 2BQUA 2DO4A 4EYIB 1G3OA 1T95A 2A18A 2IM0A 2E7XA 3KNGA 1V3RA 4USHA 4MFBB 1T8EA 3OBIA 4YEAA 1RKJA 4RU2A 2HHQA 2XSJB 1V3SA 1FJ7A 2CQ0A 3PM9A 1I94F 2RUGA 2YNGB 4DFJA 2RKIA 3QO9B 3I9V9 4NMLA 4YR0A 1DLOB 2IVMA 5G0RB 1OPZA 1M5OC 3CC4S 3C6TB 3L7PA 2I2YA 4OV1A 2YWEA 5LMUF 2Q6BA 1RT3B 4ID8A 4LF8F 3IS9B 1P27B 5B0FA 3I5AA 5KFWA 4RUHA 1WG4A 3H2UB 4QIGA 2FJDB 2V5HG 4QYRA 3T19A 4ECTA 1TL1A 1TK8A 1YJ9S 2JJ4D 3KYLA 2F8MA 1X7VA 3DRRB 3DRSA 3PV8A 3I4PA 3HHEA 5KT7A 1RT6A 4MAKA 2Q66A 2VKZG 2DGUA 1WACA 5KG7A 1HI0P 4C0HA 3MHYA 3G8TA 3CCTA 1HD0A 3N4WA 2XY5A 1IBLF 2MKHA 4KRWA 2RF2B 3GIIA 1N0VC 5GAHU 5F0UA 1C0TA 1NJIT 4RBVA 3OR2A 4FF4A 5J2QB 5GAGU 2EFPA 3OTBA 1SH2A 3MDFA 2YH0A 1Q4RA 3DLEA 2VG5A 5DG8A 1WHXA 3IAS9 3K0JA 1WD6A 2ZH2A 1S7HA 4MYTA 1LK7A 2HHVA 1UEUA 1TKXA 2LEAA 3U1MA 4ZMMA 5J2NB 2EW9A 1KQFB 3GMGA 2ZH1A 4C97A 4RX6A 3MUMP 1R8PA 2XY7A 1TKTB 2IC3A 4ZPDA 4M63A 3GV7B 3ISNC 2XLKA 2J6UA 4MK7A 4CQ1A 1GTHA 1T05A 4C8OA 4G1IA 3K5OA 3MR6A 1Z1ZA 1HNVA 3HO1A 2GHWA 2DVIA 4F26A 1LXNA 4UOCA 3PZPA 3T6BA 5D8HB 4B3SF 1UJ4A 5CYQB 4QOTA 5LT5A 1XMQF 3KG1A 1S1XB 4ED1A 1FEEA 1LK5A 2XO7A 4OZ5A 2B4VA 2MQOA 3Q8RB 2GGPA 3BO4A 4RUCA 4ES2A 4V19X 3PVXA 2YNGA 2EBGA 1KQGB 2JLFA 2LLZA 4TQSA 4DFPA 2ADBA 1RTIB 5HLFA 3C66A 5G0RA 3M2UA 3AAWB 4B9NA 2DGQA 2D3UA 2MQNA 3IWLA 2ILZA 3DI6A 4JV0A 2AF6A 2C2RA 1R6YA 2WONA 1FK9A 4DV6F 5KG1A 2R7VA 4ZHRB 2J9DA 2RSQA 2JH3A 1BGXT 5D6GA 4YQWA 3FCHA 2KG1A 5SUHA 2GV1A 4IR9A 4C8NA 1S0NA 2KXNB 5KG2A 2E1MC 4FF1A 5B0GA 2MJUA 3JSBA 4CH0S 5A8KA 1TFYA 1FRHA 2CZVC 2J9CA 1N5VA 3I6PA 4TYBA 1XR5A 1JLCA 1U25A 3RRHA 1GX6A 1YGYA 3ENWA 2NUHA 1KNZA 2MY7A 1T03A 4OZLA 1ZZFA 1RT5A 2KFNA 1BQNB 2ACYA 4P6QA 4DSLA 1D8ZA 2DNRA 2YKNB 1FD2A 5B09A 5J1PA 3HM9A 2ZHBA 2E1CA 3RW6A 4Y2IA 2I5JA 5CQGA 1LKZA 3IR7B 4LSLB 3ZZ0A 5KFKA 4WJBA 5IFMA 3W2WA 4QW9A 4RW4B 4OHYA 2MB0B 3OVSA 2ALZA 1NZAA 2DO0A 4ICLA 1UVIA 4BWMA 3S6EA 1OQ3A 3BS9A 5D77A 2LA6A 3OTOF 4O3OA 2L9WA 2VASA 1M5VC 1RT4A 3PRBA 4AXIA 1X5SA 2PEHA 1I6JA 1JLGB 2DHGA 4TYAA 2VOPA 5D4NA 3Q0AA 4K59A 4OQJA 3RBEA 1P1LA 3DLKB 5H1SV 2EPIA 4AUKA 5HP1A 1ZAWA 3D1QA 4IKAA 2DR9A 2MPUA 3BDPA 2EK6A 1RGVA 2R7RA 3Q8PB 1S1TA 2R7TA 2ILYA 4CO1A 2W7AA 3CDEA 3ZZOA 1S77D 2XMWA 3OJSA 2NPIA 3U27A 1VFJA 5A8WA 3TANA 2M8HA 5DDOC 4DUZF 3LW5C 2FY1A 3TVKA 2EC0A 3JAMY 3UQSA 4XO0A 3I31A 1TL4A 3I5BA 4NLOA 2HWHA 2GIRA 5F8GA 4O4GB 3UI3A 3DOKB 2V4RA 4OX6A 2QE5A 3QZ7A 4O3NA 1Q1KA 3AA8A 3DDNA 3GQCA 3PX0A 1JMTA 4F3QA 1L3SA 2UXCF 4FBTA 4OJGA 3ZZZA 2NR0A 4I2QB 3HHLC 4ATNA 2PDAA 4RW4A 3ITHB 4RW6B 2KU7A 2PMHA 1N5TA 1QAXA 2E1AA 1J5OB 2HMIA 3KLGB 1HI8A 1Q78A 2M3DA 2HQ3A 2G13A 1T7PA 4KAIA 2J6TA 4YMEA 1U8SA 1KOOA 5KFRA 4IO1A 1T03B 3HZGA 3FNNA 1K0TA 3LAKA 1S6UA 2EFNA 5I3PA 2RRAA 4I2PA 1WF1A 2LXIA 2RVJA 4QIWD 3LOUA 2EFOA 2A2CA 3TAMB 2W24A 2HPUA 2N4DA 1UVJA 1Y0HA 3LP2A 1DURA 1WF0A 4DV3F 2BW2A 5BYQA 2Q1LA 4RNMA 2RJZA 4R5PA 4QIVA 4DFMA 2A10A 1HQUB 3OSNA 4OI0A 1AUDA 3H2VE 3M2VA 3CD5A 5DDPC 3CSKA 2YKPA 2KVIA 1VHFA 2SXLA 3H5SA 4NRUA 5CHCB 3MR2A 3KTQA 2QSFA 3M1VB 2W4PA 4OZ1A 4USJC 1N52B 2AGPA 1YJWS 3AY0A 5IWAF 4DV7F 1HWKA 2GA7A 1E6VB 2VG6A 5M2RA 3OPKA 4FPRA 2AYBA 4IRCA 3NGKA 3OVAA 2J9DE 3TA1A 4DLGA 4LF9F 1SQEA 2R8HA 1K73T 5D3GA 2AU0A 2Z8QA 3K58A 2R2TA 1TKZA 1U6BA 2WK4A 2YNIB 3ISND 4ED5A 1GXTA 2YWHA 1A7GE 2KG0A 5LL6d 5F8LA 5FJ4A 4NLYA 4U7UK 1RT4B 4DV4F 2MZQA 1IR0A 2CPXA 1KHVA 2HHXA 5J2MB 4Q0BB 5AE2A 1JNZB 2FC9A 3BGUA 1Y00A 2HFZA 1RT7A 2VFTA 4YB6A 2ZC4A 2NUUG 3EZUA 1TV6A 3H4BA 5EGYA 2VD3A 3SQGA 2NXUA 4ILLA 3IN5A 1S1VB 3LP0A 4UY85 4Y2CA 1U45A 4QWEA 1RDRA 2IM3A 6FD1A 1F5BA 2Q43A 2R8GA 4LQ3A 4PXBA 3DOLA 4IG0A 3OFHA 1TFWA 1VRTB 3M2VB 4C2MA 3RZAA 2M8DB 3N6MA 3BO2A 4MK9A 4OX9F 2CPYA 3BEGB 2EI5A 4DL2A 1RA6A 3NAIA 1KOHA 2IFXA 2HNYA 3MEGA 5DLGA 3GE9A 4IDKB 5GVQA 5ITHA 2OPRA 1VC5A 4ES1A 3NNCA 3Q23A 1QAJA 2KN4A 1B0TA 1L3VA 4C11A 3LQVA 2L9DA 2JWNA 3C8YA 4WK1A 5L1JA 2AGOA 3DXBA 2G9OA 1NJZA 2QO3A 3KK3A 2GC8A 2NPFA 2E7WA 3ISZA 3PHEA 3FFIB 4CO3A 2HS4A 3G9CA 4D3HA 2K3KA 4F4YA 1BLUA 5IM0A 3QJPA 1RT6B 4F4KA 2HWIA 4X65F 2MZRA 1S6QB 2HHWA 1LOUA 3DRYA 4DPOA 3T5HA 3RB0A 4DSFA 2IMOA 2FLNA 1OQ6A 4DL3A 4K50A 4EBDA 4ZA1A 4BWJA 4I6YA 3G71S 5IZHA 3DDKA 3FJ2A 1H98A 2F8EX 5E3CA 3HKWA 3UE2A 5F8MA 4DN0A 1HBOB 3LGMA 4WKYA 1R8AA 1HNXF 4XK8C 2WBMA 3FEZA 3M9NB 4AYBD 2OP5A 4M5DB 4IG0B 2LQ5A 3AJ1A 4NWBA 5F9NA 4ECSA 3E51A 2KFZA 3ZC4A 1RTDA 1D3WA 2Y1JA 3BSNA 3J7YI 1IM4A 4ERDA 1HPZB 4NZ6A 4FP9A 4TY9A 1VGYA 3CJ4A 2HNDB 1JLQB 1QE1B 4OMFG 3G6ES 4DQRA 5HMZA 2MDAA 1U1OA 2POKA 2R7UA 3QAUA 1SJ3P 2RDIA 2HS3A 2BM0A 2R7WA 2IM1A 1SJRA 1AROP 1FK9B 2EKYA 3K8WA 5F8IA 1OO0B 4OL8A 3HLUA 4YOEA 2JX2A 5L9XA 1FJCA 1HWJA 3BSCA 3IR5B 4C8ZA 4ILRA 1FD8A 1DHMA 4K4VA 1SXLA 1FTRA 2B9WA 2PSZA 3B4MA 4NZ7A 4YB1P 4ECYA 3FFIA 2QSWA 3MI7X 3H4DA 2RIJA 2XWXA 4NOHA 4I4BA 3DXSX 4IOAQ 2XG8A 2HYIB 1ULRA 1B64A 1S0VA 5LXRA 2ZOMA 3DNCA 5B0CA 3TQ1A 4C8YA 2KFYA 1X5TA 1SV5A 2CKWA 2R7SA 1UJ5A 5GMKa 1WEZA 1X4CA 2CQHA 4ECWA 2YQ3A 1REVA 3IR6B 2BR0A 4JV1A 2F3JA 2I5JB 1X4BA 2LKZA 2UXDF 3SV3A 2D1CA 5DS7A 4KKOA 2CPEA 1HNVB 3CJ3A 4YB5A 1KQKA 3V5RA 1JX4A 4GKJF 5CCLA 3N6NA 5KFFA 2ZDPA 2LQ9A 4KV8B 5AXNA 4Q5VA 2DPIA 3GYNA 1HNWF 1QAYA 1CG2A 1NRKA 2A1BA 3TUJC 1HHSA 1JLCB 3BZQA 2PI4A 3MEEA 2DNMA 3M8PA 3MM6B 4LF4F 3UW1A 2KXHA 1QUVA 1FDNA 4ZPVR 3M2RB 2MQLA 3HF5A 2DGXA 5BYRA 4FF2A 2BQ3A 5L1LA 1N5QA 2UVRA 2LA4A 2XC9A 1U49A 2B9XA 3V6JA 4JV2A 5C42A 3MWBA 5DRKA 4E98A 5CCMA 4GC6A 1SB6A 4B9VA 2XB2D 4LMZA 4RW9A 1FKPA