3VAIA

Structure of u2af65 variant with bru3c5 dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
total genus 39
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vaiA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vaiA02
1WF2A 2X1AA 1M5KC 1VQ9S 2J8AA 2RRBA 5JVGQ 2XB2D 2X1BA 5H1SV 3CCVS 1YJ9S 4IOAQ 1WEYA 2ADCA 3SDEA 4OZ1A 1NU4A 2D9PA 3G4SS 2X1FA 2QA4S 3JB9k 4F02A 3BO2A 1DRZA 1X4CA 2KG0A 2ZJQQ 2XS7A 1DHMA 2LEAA 1VQ5S 2AYBA 2N82B 3MD1A 2OTLS 3SMZA 3MDFA 2MHNA 2CPXA 3TP2A 3MD3A 5DM6Q 2MY7A 3I55S 2HGLA 3TYTA 2KRBA 1YWXA 2SXLA 2CJKA 2J0QD 1OPIA 2RQCA 2N3LA 2M8HA 3CC2S 3HHNB 2GHPA 2DNLA 2B0GA 4C0OC 2M88A 2DNGA 5IM0A 3EGZA 1FT8A 1M5OC 3S01A 3H2UB 2MQPA 1VQOS 2DHAA 5DDQC 2OIHA 2DNMA 1K9MT 1WF1A 2VONA 4M5DB 1R8PA 3VALA 5CYJA 3I56S 2CPEA 1VC6A 2MGZB 4WFNQ 2LEBA 3PIPQ 1UW4A 5GMKa 3H2VE 4WFAQ 1WF0A 3CCES 2KH9A 1M90T 4Y0FA 1U1NA 2ADBA 3NNAA 3LQVA 5HL7Q 3MUVP 4LJMA 2L41A 1D8ZA 1FXLA 1VQ6S 1U1QA 1FJCA 3FEXB 3MUTP 1ZH5A 2CQ3A 2DNRA 5FJ4A 1RK8A 3VAGA 3Q2SC 3CCUS 4PKDB 4YUDA 1M5PC 2M8DB 1VC0A 2KFYA 2MZ1A 5HO4A 1JJ2R 2AYEA 2FC8A 4W92B 2KXNB 1X4GA 2MJNA 2DB1A 2M7SA 1WHVA 3L3CA 2G4BA 2DGTA 3S7RA 1L3KA 4QQBA 1H2UX 1U6BA 1RKJA 1KOOA 2DH8A 1N88A 1WEXA 5GAEU 2E44A 1U6FA 3CCJS 1S72S 2AYMA 3U1LA 1U1RA 2HVZA 2YTCA 4FXVA 4V19X 2OTJS 4A8XA 3NNCA 2DISA 3US5A 1QVFR 1YITS 4CH1A 1X5SA 5LSOA 3IRWP 2CPJA 3ZZZA 1U1PA 2DHXA 4PR6A 4LIRA 2HYIB 2JX2A 5ITHA 3VAFA 5EN1A 2MGZA 2ZJRQ 1QVGR 2DO4A 1H6KX 1B7FA 2KXHA 5DM7Q 2CQIA 3NS6A 2MSTA 5D77A 3ZZYA 2HGMA 2MYFA 2E5JA 4ED5A 2DNNA 2G1DA 2XNRA 2CQCA 3P3DA 4EGLA 2E5GA 2AYGA 4U67Q 4RU2A 3CMES 1PO6A 1WG5A 3G71S 4WF9Q 1VQ4S 2QEXS 2DGXA 2LMIA 2MKCA 2EVZA 4CQ1A 2DNZA 1X0FA 2CQDA 4WCEQ 1A7GE 2FHOB 1P27B 5GADU 1FNXH 2MKJA 1DBDA 1U1OA 2CPHA 3NS5A 1YIJS 3OW2R 5DDOC 2DGUA 1X4DA 1SJRA 2YKAA 3UCGA 1FJ7A 2LECA 2MSSA 2CPIA 1VQ8S 2RT3A 1N54B 3J7ZT 3CCLS 1U2FA 3VAMA 1NO8A 2DGQA 2LYVA 1K73T 2N7CA 2DGVA 2J76E 2NZ4A 3CUNA 2CPDA 2KHCA 2LA6A 2MQMA 3CTRA 2MKSA 4Z2XA 1YHQS 2M2BA 2M52A 2LQ5A 2JRSA 3EX7B 3J7YU 1VC5A 2AD9A 1U1LA 2DHGA 3P5TL 1U1MA 3DXBA 3HI9A 2DGSA 3S6EA 3UCUP 2RNEA 5D78A 5DDPC 3NMRA 2MXYA 2L9WA 2MZTA 3UD4P 3MUMP 3BS9A 2MKKA 1HD1A 3EGNA 2M0GB 5GVQA 5IQQA 4TLQA 3CC7S 3CCMS 2MZSA 3RW7A 3CXCR 1A9NB 1OIAA 2DNPA 1SJ3P 2U2FA 2KT5A 1VQLS 3B4MA 2KRRA 3VAIA 4IO9Q 1KQSR 2U1AA 5LSLA 2CPFA 2DNOA 1WTBA 4IUFA 2K3KA 2RS2A 4YB1P 3Q2TC 3G9CA 1X4FA 2YWKA 4UQTA 1M1KT 2I38A 4ERDA 1X5TA 1FO1A 2KXFA 1VQMS 2CQ1A 2OSRA 2A3JA 1X4AA 2JVRA 2YH1A 2QFJA 2MB0B 4CH0S 1VBXA 1QM9A 2RQ4A 1UAWA 3FEYB 4F26A 4ZKAA 3PIOQ 1OO0B 1K8AT 5LXYA 2MKIA 4J5OA 1WEZA 2MQOA 1WI6A 1NJIT 2MMYA 4P6QA 2CPYA 1R8HA 1UP1A 2UP1A 3SXLA 1P1TA 4QPTA 2DIVA 1SJFA 4QU6A 2LXUA 2K8GA 5IFMA 1WI8A 2CQHA 2RRAA 2DNKA 2KN4A 2MZRA 4F25A 1H2TZ 4TU8A 1N8RT 2N3OA 5LJ3Y 3CULA 2DHSA 3UE2A 2XNQA 2CQBA 4WIIA 2MY8A 4C7QA 5MLCV 2DH9A 2KG1A 2FY1A 3DLLQ 3MOJB 1WHWA 1VQ7S 1WHXA 1PGZA 2MQNA 3VAHA 4OZ0A 3CMAS 3MI7X 1O0PA 2XSFA 3ULHA 1WWHA 3CCQS 3G6ES 1X4HA 2DK2A 2RVJA 4UY8T 1BY9A 2CQ4A 4PRFA 5BJRA 1YTYA 1N52B 1YJNS 3V4MA 3CF5Q 5JVHQ 1VBZA 2V94A 4BS2A 2Q79A 1WELA 1JJ4A 2LCWA 3P6YC 2J0SD 1FJEB 2BZ2A 3VAJA 1UFWA 1OWXA 3G96A 1URNA 2G0CA 2DO0A 2RS8A 2MZQA 3G8SA 2VOPA 2XS5A 2DGWA 3THTA 2LKZA 3G8TA 1KD1T 4WKRA 2L08A 4TU9A 3TO8A 3CC4S 2MKHA 2CQGA 1ZZFA 2CPZA 2M9KA 3D2WA 3RW6A 1Q7YT 2MPUA 2RUGA 2EK6A 2YH0A 2GO9A 2MQQA 2WBRA 3LPYA 2VODA 2DITA 3CPWR 3U1MA 2KU7A 2DNHA 1AUDA 1VBYA 4IOCQ 3S8SA 1Q81T 3CD6S 2M70A 1KOHA 1HA1A 2DNYA 2F3JA 3MURP 2DIUA 5DDRC 4TU7A 3R1HA 3IWNC 2EK1A 1Q82T 4YOEA 2MQLA 1W2BR 2FPHX 5GAHU 5LXRA 1S79A 2F9DA 3UD3P 1XN9A 3BO4A 2XS2A 1D9AA 1G2EA 1ZZNA 2DGOA 1HL6A 5CA5A 2OJ3A 1FHTA 3R27A 4QU7A 2CQ0A 2OSQA 2LXIA 4C4WA 2CQPA 2E5HA 5CXTA 2CQ2A 2M4MA 2KM8B 2ZJPQ 1YJWS 1JMTA 3BO3A 2PE8A 3SDEB 2BOPA 3THPA 2D3OR 1SJQA 1KC8T 1VQKS 2DH7A 3CCRS 2PEHA 1VQNS 2F9JA 1X5PA 2D9OA 1X4BA 3N9UC 4FXWA 4Y00A 3VF0B 2LA4A 2E5IA 3B4DA 1SXLA 2DNQA 2ERRA 1DZ5A 2HZCA 1WHYA 1WG4A 4WFBQ 2I2YA 1CVJA 2NLWA 5LJ5Y 2JWNA 2KM8C 1X4EA 2MJUA 1M5VC 3CCSS 1WG1A 1F9FA 3R1LA 4LMZA 3NNHA 1Q86T 2X1GA 1YI2S 5IM0B 2VOOA 3VAKA 1U1KA 2KI2A 2O3DA 2HGNA 1JJHA 2KYXA 3K0JA 2MZJA 5GAGU 1H2VZ 4W90B 3MXHP 1HD0A 3UCZP 2KVIA 4CIOA 5DETA 1IQTA 1X5OA 2RU3A 2JVOA 3UWTA 2FC9A 3BEGB 1SJ4P 3P49B 1VQPS
chains in the Genus database with same CATH superfamily
1FFSB 4B3OA 3QIDA 4OHVA 4WTYA 3CJRA 4FF4A 4LF6F 2IYGA 2AZ3A 4U7UD 4LFCJ 2HWIA 3G4SS 1IKVA 3KJFB 2X51A 3MDFA 4PWUA 1TL3B 4JI3J 1IWGA 1P6TA 4F3MA 1TK5A 2DNLA 2W7AA 1GXTA 2M88A 4OL8A 3CD7A 3FBCA 4O23A 2XO7A 1K9MT 2XZTB 2HBRB 5KFAA 4B02A 2F1FA 3AHPA 4WE1A 4Y0FA 1SV5A 1UA0A 2PEBA 2KFNA 5KFMA 5SZTA 1FXLA 3W3SA 2BKNA 3CCTA 1S49A 1JLGA 1JJ2R 4CLPA 1D09B 2AYEA 5GAGI 4HDGA 1P1LA 1VCTA 4QYRA 3DLEA 4I64A 3P5BP 1IBLJ 3I0SA 1GMUA 3DRRB 5IV3A 5IWAJ 4OZ3A 2DEJA 1RCOB 1T05A 4DPTA 2IC3A 2WOMB 1UW9A 1BHNA 3ZZZA 4LIRA 4J91A 2O67A 1H6KX 3PJWA 4A46A 3NS6A 4WFYA 2AGOA 4F4ZA 2HRTA 1JK9B 1QAJA 2R3VA 2ZM6F 3QJLA 3CB4A 1VQ4S 3AH6A 3I87A 4WCEQ 1P27B 3MPUB 2VKRA 4UTGA 3M2RB 3NS5A 1RUSA 3HHKA 3GV7B 2HMIA 1NDCA 2RKIB 3HZGA 2MSSA 3MOZA 4UOFA 3U7JA 4X64J 4X62J 1NO8A 2N7CA 4YS2A 2XI2A 3UFCX 1T3NA 2A2CA 4ZJOA 1YHQS 2OKQA 1TAQA 1AROP 3VWSA 1VC5A 1TL5A 2GFFA 4ZLPA 4WYWA 3DXBA 3NAHA 3ITHB 3K5NA 2OO4A 4ECSA 3ENVA 2V5HG 2PDAA 5GVQA 2WHOA 4DG1A 2Q66A 2Z56B 1UJ5A 4NLSA 1HNZJ 3T19A 3B4MA 3W7BA 4X4QA 4IO9Q 2DNOA 6FD1A 2K06A 2DD8S 2VFUA 1REGX 5DLGA 2I38A 4K4YA 5C24A 3J7A1 3ZTPA 4E2FB 4N76A 4NMLA 1VBXA 3QJJA 4FKYA 4RW7B 3KUEA 3OVAA 2OEJA 1NJIT 1MWQA 4P72A 4EZ6A 2J5AA 3C15B 5EX0A 4ELTA 1JNRB 5IFMA 2ZHAA 1MSWD 1H2TZ 3A4TA 2AX1A 3R6LB 4TVAB 2HIYA 4DR6F 4JI0J 5EHHA 5M2UA 3KLIB 1RHMB 3WX4A 3C14B 1RU2A 2R7UA 2DPJA 3KK2B 4MFBA 1SC3B 2KT2A 5CABA 2BZ2A 1WC4A 4Y6IA 5HN0A 1U6ZA 4IRCA 4I68A 3DHWC 2OPQB 5D4PA 2KJWA 1TUGB 1NZ8A 4U7UK 2E29A 3K89A 4A8WA 5HANA 1DTTA 1IR0A 2YNIA 2B7CB 5AXLA 3N5FA 2AKWB 4TQSA 2ACMA 3FQLA 4ANEA 4KHRA 5HROA 1L3TA 5KFLA 2HFSA 1EP4A 1N5TA 4DPXA 2ZM6J 2HQIA 1KLMB 3M8PA 3MTKA 3VGVA 2CNLB 1U2CA 4U9RA 3DFEA 3ISNC 4M5GA 3BO3A 5IT9U 2ZITA 4IR1A 2XYHB 1N6QA 3EMTA 2GJFA 1J27A 2C1EB 2BJ3A 2B9WA 2D3ZA 2E66A 1VRQC 1HNWF 5IM0B 5D3GB 1FRXA 2O3DA 1NSPA 2Y8YA 3E51A 3IBWA 2FJVA 2NS1B 1X60A 3UN5A 2KVIA 2NZCA 1RT5B 3H90A 1DLOB 2HNZA 3NCPA 1MN7A 2RD5C 1BQNB 4KV8A 4XDDA 2VD3A 1MLAA 4FYWB 1VRUA 3JB9k 4Q8FA 2KG0A 1C4AA 1FNMA 4R8UB 3GE9A 2HPUA 3BGUA 1VRTB 1OPZA 3M7VA 2SXLA 1AZSA 3I5CA 3CC2S 4HT5A 4A8FA 1NHVA 1BQMB 5EWFA 2VONA 3SFUA 4PABA 5BR8J 3I56S 3M30A 3NAIA 2ZD1A 1IKWA 5GMKa 4U6PA 5IT4A 4DQRA 2KH9A 2WVFA 4USTA 1FERA 1RGVA 5L1IA 2C3UA 4ZP8A 1FJCA 3R3TA 2ZZTA 1CJTB 4ECVA 3AB4B 4DLGA 4ID5B 4DCPB 2DXFA 4JV1A 2KXNB 2MJNA 2AJFE 1NB2A 2DGTA 2AGPA 1FDBA 1RKJA 3N4WA 4RW6B 5G0RA 3A13A 3BSOA 1OQ3A 4ZLLA 3GTYX 3HF5A 1QAYA 1XNQF 2IVMA 2RDDA 4N41A 2W2NP 4Y2AA 1CJUA 1GMVA 2J6UA 4OYWA 4CO2A 3JXOA 4Q0BB 2W9CA 2Q6CA 1T9UA 4ZPVR 2ZH1A 3MEGB 2UZAA 4Z7YA 2EVZA 4CQ1A 3OFGA 3BZQA 1X0FA 3KLFB 1DBDA 3DOMB 3H4BA 4ECUA 1CBKA 2GGPA 1F6TA 5I3PA 5I42A 4XTTA 3MMBB 4HDHA 5J2MB 2P2CB 1CG2A 4L73A 2QE5A 2LA6A 2MKSA 2AT1B 4BLGA 3MWBA 3C46A 2AD9A 2V2KA 1RXOB 2HNDA 2RNEA 3VQTA 4GKJF 2OGUA 4RJVA 2BJEA 3LA0A 2JJ4D 1FEHA 4DUYF 2F7VA 4RNFA 2KT5A 3WIVA 1RWWB 3HXMA 2CPFA 5F8NA 2OD6A 5F3TA 3RJMB 4ERDA 1JLCB 3Q8VA 1BC6A 3CJ0A 3GWCA 2QFJA 2VBZA 4F26A 5DQHA 4CTAB 4QYZK 4DV0F 1LWFA 1KP6A 3M9MB 1NXIA 1FK9A 1WI6A 3NLCA 1UP1A 1F2GA 2XTJP 1YBUA 2ZH2A 2CQHA 3QWUA 4D3HA 4F25A 3QMQA 1TR0A 2HQGA 3MF5A 2VBYA 2KG1A 2N4DA 4DSFA 1WHWA 2IDLA 4JV2A 1QD1A 3G87A 1SL2A 3JAMU 4L75A 2ZOFA 3DXSX 4HHJA 2QLFB 5B7WA 4OYAA 3OXGA 5JVHQ 4LBIA 2NXUA 2EPIA 3GJQB 3M32B 2I5JA 4QR2A 1I3OB 5C5JA 1JLBA 4C0HA 3G96A 3DHXA 4JI1J 1HBUB 4NA2A 3TZXA 3KKFA 2W8KA 3QRRA 2YWFA 2FYXA 4H54A 1S1VA 2G9OA 1Q5VA 4KO0A 5E7OB 3ZTSA 2HAIA 3QSYB 3SQGA 4DV7F 3LPYA 2GZOA 4MIBA 1S97A 2GAGC 2YKOA 5EWEA 1RT3B 4IOBA 4LRAA 3MMJA 4LBHA 2A1BA 4MAKA 2JLEA 2FPHX 4C11A 2J9EA 3IAS9 2OD4A 2CZVC 4LR7A 1RHRB 3ZC4A 2B9EA 2HK3A 5GMDA 4PG7A 5THWA 3R2DJ 2E1MC 2LQ8A 3FRYA 3MEEB 3QO9B 2W4CA 1HBMB 2ZDOA 2BOPA 2LU1A 4K4XA 1VK8A 1D1UA 2YKMB 2MHEA 2C2NA 1L3VA 1C2PA 3JS9A 4Y00A 4ECWA 3DU6A 3IM9A 1KVKA 4YY3J 5HLFB 1UVMA 1RA6A 2ZBPA 2RQKA 1M0SA 4KH0B 5CZVA 4NCAA 3UDLA 3QRQA 2KYXA 2MZJA 5D4OA 2HK2A 2HHPA 1TKTA 2BBEA 3MXHP 1IR1A 3BQ2A 1J5OB 4NA3A 4MT1A 3X1LB 3L7PA 5H1SV 1CQNA 2ZJQQ 5KT6A 1OYDA 3HHEA 1N5YA 1GMWD 1PAUB 1YWXA 4C3LA 3PX4A 2N3LA 2M8HA 5KOWA 3FC9A 3KK3B 5LM7E 5LMNF 1OY6A 4PQUA 4B9LA 1EKSA 3GIRA 2DNMA 4YP3A 4WZQA 4MIAA 2RB7A 4B9TA 2XI3A 3OQ2A 3OHBA 3CCWA 4B3MF 4WFNQ 2YBVA 1TVRA 4ITSA 1VQ6S 4LQ3A 3MUTP 2ZWOA 2XLKA 3KFWX 3SSQA 4OHWA 5A8WA 1JXLA 4CLYA 3EZUA 2BANA 2G4BA 4OI4A 2ZH3A 1R6YA 4QQBA 2EC2A 1H2UX 1U6BA 2FUG9 1HW9A 2ZBIA 4DX6A 2WVBA 4ZP6A 4CT9A 5LSOA 4A8SA 4M5DA 2GV1A 1YZ7A 4CO3A 3OL7A 3VHQA 1UZHA 5DM7Q 2JFDA 4JB8B 2GX8A 2MSTA 1UMJA 3JQJA 3DM2B 3LGNA 5D0HA 4X4OA 1KFSA 1MW7A 4H4OA 4B3RJ 3KJVB 1FKOA 5KFCA 2PFFB 2W9AA 5LMUF 2NUHA 3DGPA 1OSCA 1UEUA 3SV4A 5DDOC 4LFAJ 1UWBB 3O2IA 4C2MA 3ILJA 3V6KA 1PC4A 1Q5YA 2R9LA 4ES3A 2J76E 3QGGA 4GKKJ 4E98A 2NZ4A 1C1BA 5CCMA 4Y2IA 1VI7A 3NOGA 4K8RA 4RKUC 2HZAA 5A8KA 3C3LA 4YHHF 4OHYA 3H7HB 2CJQA 4UZCA 4QW9A 3JSMA 1S1XB 5HVFA 3O6QA 3CSKA 2QL7B 2RDIA 4WWSA 5LSLA 1C1CA 2H51B 4PPZA 5A0YA 2XEXA 3FZ2A 1HNXF 4WJBA 4MK7A 4DL0C 5FLXU 4CO4A 2A3JA 3MR2A 2ZH7A 4CWBA 1G7CB 1H3DA 2LU2A 4MK8A 4PG5A 1NMEB 4X65F 4DSKA 3TANA 2RF2B 4DR3J 2KB2A 1PGZA 4K2JA 3VAHA 4N8NA 4LSNA 2R2SA 1F9HA 3T1YF 3ULHA 3C16B 2NXEA 4G1QA 3Q0AA 2EI5A 2ZC3A 1FKPB 1CJKA 3OL9A 3O5TB 1FKAF 1OWXA 1URNA 2KDOA 4DQQA 4JBCA 3G8SA 2DGWA 4K7QA 2OFGX 3QFWA 3NBPA 1P8GA 5EUHA 1CLFA 3D2WA 2HVHA 2WSCC 4H4MB 2D3UA 2MPUA 1XMOF 3IWXA 5D15A 3ZTRA 3LH2S 2FVQA 2DITA 3TQEA 4IFYB 2KU7A 3A8IA 2YNGB 4EI2A 2DIUA 2V2ZA 2BMBA 2OMOA 2AJ4A 2BVZA 3BGLA 1U0HB 4AXJA 4DSEA 4ZN1A 3G86A 1Z2ZA 2P5VA 2OPRB 4DUZF 2GMHA 1U26A 4JI4J 2OSQA 2AWZA 2XQCA 2CA9A 4ZVGA 2E5HA 3D6TB 1Q53A 1YG0A 5K14B 1JMTA 3C6TA 4ZIVA 3O8WA 2VFVA 3ZZPA 3CJ3A 4Q8EA 3AXKA 3CCRS 1JLEA 1RT2B 2G0JA 4TYAA 2HZCA 2VASA 1ZM9A 4I2QA 4DHVA 4K59A 1RLDA 2BQ3A 1SKRA 1RT7A 2WVDA 2KI2A 3WZ0A 3CD5A 1UJ4A 4KGXB 2I6WA 5D4NA 2ZKUA 1H7XA 1TL7B 1WDTA 3DLGA 1GTEA 2YWHA 5C42A 1QAIA 2RU3A 2BV3A 4OYZA 1M5KC 4XO0A 2RRBA 4K4TA 5MAOA 2IJRA 4JI7F 3OBIA 2CADA 3BO2A 1NPPA 3OFHA 2LEAA 1GAOA 2C2ZB 1VDHA 1Y3KA 2ASDA 1S6UA 1PC5A 3UPFA 5LSRA 4ES1A 3PM9A 2DYAA 4CYUA 4I0WA 3W2VB 1M5OC 3H42A 2UUCJ 4IDKB 4ECQA 2OIHA 5I3UB 2B51A 2Z58B 4Y34A 1PJ7A 3OSNA 2Y3YA 3HCXA 2LEBA 3QLHB 4TY9A 3QT6A 2L48A 1J2VA 4RNHA 4HACB 2ZOMA 2QA4G 3FEXB 1ZH5A 5FJ4A 2WAQD 3D28A 3W64A 3TZZA 2MZ1A 2W7OA 2FC8A 4C97A 3KJNB 5HATA 4PG4A 4YR3A 4DN9A 4DSJA 4DR7J 4NCGA 5J1NA 5RUBA 4JI8F 2DH8A 1JXEA 2GVZA 4RW8A 1GX5A 3LPEA 4M95A 2ZBRA 1VISA 1V3ZA 4P7VA 1LKZA 2UVWA 3EXCX 4JV5F 1TKZB 3ET6A 4B3SJ 2ZVIA 2V34A 1Q8LA 3ENAA 3KLHA 2HGMA 3UDVA 1YRTA 4KAIA 1U4BA 3CDWA 4GRSA 3MEKA 1KWMA 4KFBA 3H5SA 2MKCA 1SH2A 2Y1RI 1XR7A 2DR9A 1VS3A 5F9NA 1TV6B 4PWWA 2BKOA 1SJRA 2LECA 3MR7A 4DQIA 4DMZA 2DGQA 3DOKA 2HHWA 2JFKA 3CUNA 3HVRA 4USVA 3H98A 2B9YA 3FEZA 2M2BA 3QIPA 3LOUA 4DF8A 3EX7B 1M1HA 3NGTA 4DR4F 3ZO7A 1LFPA 1UVIA 2Y1JA 4NRTA 3UCUP 6FDRA 4FYXB 1M1GA 4QWEA 4LSLB 4OYMA 3MR6A 2BM1A 3CXCR 4LRFA 2NXJA 2LEPA 2VL1A 2RS2A 4M5JA 4WP8A 3TVKA 4FYVB 1M1KT 5CD4A 4L72B 5FDLA 2OP5A 5HVHA 2D69A 1R3NA 1K8AT 1R6VA 4Y28C 1KLNA 3PW2A 3DLHA 2UXCJ 1YKWA 4OYBA 3UN3A 3ADAC 3DRXA 4W4MA 2DRDA 2YNHB 2VDHA 4ELUA 2XNQA 4F4XA 4L3NA 4ZHRA 2EFVA 2YNFB 2G2OA 3IXQA 4OI0A 1F9EB 4K50A 2R7QA 2OLWA 5BJRA 3OFFA 1WC5A 1SC6A 3EDRB 2GS8A 3AD8C 4V19J 3QT7A 4MH8A 4PUOA 2J0SD 3TJ8A 5L39A 1YBAA 2E1CA 1C0UA 3L7OA 3PEJA 1FDAA 1RTDA 2P6SA 1KD1T 1PSDA 2RUSA 3A3NB 3QFHA 4NEZA 1LQ9A 2MQQA 4K5SA 5KG6A 3H2LA 3KK1B 1XC9A 2PIIA 2DRAA 2E7VA 4C6AA 2HQCA 2V9KA 2FLLA 4KH1B 3HSJA 4DR2F 1JKHA 2ATLA 3NKYA 1YJRA 3DLKB 4RUAA 1HIYA 3A8EA 2MLZA 1OSDA 3JSBA 4X4UA 1QTMA 1B7YB 3A3PB 2UXDJ 3PO4A 4C4WA 1GK8A 3C66A 5E3PA 3UI3A 1JLAB 2DRBA 3FBEA 1X4BA 4ZVPB 4IH5A 1DZ5A 3V6DB 4CP5A 2W1BA 1U02A 1NHKL 2Z0GA 4ZVOB 1VK3A 1VJQA 2VG7B 2VC0A 1TMMA 4OMFG 1LW2A 4OV6A 3AD9C 3DOLB 2XLJA 5AXKA 3SDEA 5HBMA 3W5ZA 7FDRA 4OIXA 2N82B 1MU2A 4DPOA 2RSQA 3TYTA 2XGQA 4N77A 2J0QD 3E01A 1RP5A 2W01A 4RW9B 2FHKA 1OS5A 3IR7B 3S01A 1CC8A 3UNGC 3MMAB 1YGYA 4IG3B 3U1NA 2BQUA 3KJQB 3DLJA 4HTJA 5ETTA 2YQ3A 3GMGA 2ADBA 2LDYA 4B9VA 3VAGA 1M5PC 3MHYA 1FDNA 5B0EA 4DFMA 4RUCA 5L9NA 4R25A 3Q22A 1TL3A 5J1PA 5HMXA 1N88A 1WEXA 3NGDA 5GAEU 2NSBA 1NKBA 1V5IB 3DRPB 2L9NA 3GB0A 1I94F 1YITS 4CH1A 4DWIA 4NOHA 4GMKA 1SQFA 3WHIA 5KFDA 3TA2A 4I56A 2JHEA 3UR3C 3QZ7A 3D6FB 4A8YA 1VGYA 1I51B 1NUEA 5L8RC 1L3UA 4C8ZA 1K0VA 1LW0B 1MWYA 1BMQB 5F0UA 3R5DA 3NXZA 2X3DA 3VGTA 1A7GE 3OR2B 1FNXH 1WC0A 2MKJA 1FD2A 4YMEA 4CO0A 4UQGA 2IAJA 3ZFVA 3DRRA 3MFIA 2PT0A 3NOCA 1N54B 3VAMA 2W7PA 2WOMA 3RU0A 2KHCA 2PMHA 3CMQA 1IBMJ 5KFZA 3QRPA 3G6YA 2BR0A 2ROEA 4FF1A 2B6AB 5E5NA 4DS5A 3A12A 4G65A 2IBOA 3GCWP 1MROB 4DXLA 5D78A 5DQIA 4B3TJ 4WBFA 2V2QA 3M4XA 2FZCB 5K8NA 2IM1A 1NK5A 1G6BA 3BH6B 3GYGA 3M2RA 3J7Z5 1RI7A 4FNIA 4JP8A 4Y3CA 3RB0A 1R8CA 2RKIA 4KRWA 1X4FA 2KL8A 3W9IA 2XO6A 1VQMS 4YFUA 1X4AA 2UUAJ 3LGHA 2BOAA 1WDDA 2D74B 1OO0B 2K1RB 4J5OA 1N36J 3LP1B 2F8HA 5KG0A 2DR7A 1P1TA 2HRUA 2LXUA 3M8RA 3EJMA 3ITHA 3KLGB 3LANA 4ZVRB 2F4VF 2Z2MA 1Q79A 2MY8A 3T5JA 4C7QA 3DLLQ 5I4MA 2MQNA 4IYQA 4J9PA 4ZVHA 4ZK7M 3CCQS 3RR7A 3TNVA 1BY9A 1S7HA 4IR9A 1JIHA 3V4MA 1HR0J 4O3QA 3OTOF 2Q79A 4KYZA 1A6LA 5M2PA 2IM3A 4RW7A 2DO0A 2RS8A 2MZQA 2ZH8A 3RRHA 4IKAA 2AIRB 4G3IA 1XMQF 3THTA 3R6GB 1F0XA 3C15A 2BE2B 3ZNJ1 2GO9A 1T0TV 4OHZA 4TLRA 1ITPA 1C4CA 3TUPA 1ZBTA 3KLIA 3CD6S 3P96A 1X31C 2F3JA 3CVKA 3N6LA 1F2HA 3M6VA 3PNIA 4YOEA 3PY8A 1FRKA 2MQLA 3C14A 4KBIA 3KK2A 1VLYA 1ZZNA 3LWLA 4E8UA 3GYXB 5GMEA 4DBQA 2Y1IA 3SCJE 4L76A 1HWUA 3HSDA 4DV4J 2CJAA 1S9EB 3THPA 1N34F 5L1LA 1KRPA 2F9JA 4HL9A 3N9UC 3GP9A 2DNQA 2VPYB 1RT4A 5KFGA 3SBMA 1F9FA 1S1TB 1XNRJ 2VOOA 4URGA 3BR8A 3BYRA 5A8RB 3CIZA 3J7YI 1H2VZ 2H3EB 2HHHJ 3QSIA 4CIOA 2AF6A 5DETA 1UZDA 1YRUA 2HS3A 1S0VA 3P49B 3OR1B 1KLMA 1WF2A 1BQXA 2XCPA 5JVGQ 1RWVB 1TELA 4TXSA 2W2OP 2B4UA 4I2PB 1RWPB 2B56A 3M8YA 1UL3A 3KYLA 5KG3A 2JC1A 2B8QA 5J2NA 2RQCA 1ZYQA 3HHNB 2XY5A 5IM0A 1AW0A 3MAQA 1VQOS 2GJ2A 5D3GA 2AJ2A 1WF1A 3HVTB 3PW5A 2HWHA 1IKXB 4DV1J 4DU7A 1HWIA 1S9GA 2H5JB 3PFEA 1CULB 4CO1A 3CCES 1RT5A 2EKNA 3EDQB 2DJWA 4LJMA 1DLOA 2KZZA 1RK8A 1T9TA 1BQNA 3PW4A 2M8DB 1R0AB 3OD2A 1WHVA 3AQPA 3GG0A 4I4BA 2H65B 4R8UA 5ETKA 4KQZA 4KJIA 1VRTA 2PGCA 4IFVB 4GVBB 1RWUA 3IR6B 3OVBA 3JTOA 4EYHB 1KONA 2ABYA 4A8XA 1BQMA 1I5OB 3E2EA 1U45A 5ETRA 1RB0A 5H9FJ 1N32J 2CG8A 3TAMB 2R42A 1FFWB 2KXHA 2CQIA 5ETOA 1Y5LB 2J8SA 4MTPA 3T1HF 4ED1A 2CJ9A 2EW9A 2V8PA 3GIKA 2FD2A 2K2PA 4J7CA 2RQMA 1S0MA 1CJTA 4WK3A 1SV5B 4ANDA 1ELOA 2Z30B 2CQDA 2J6SA 2ZH4A 1NKCA 3G8QA 4X4VA 1EKRA 2VQEF 5GAHI 4RW6A 2VZ9A 3BKUA 2B5JB 3PJXA 4KPYA 1VQ8S 1IUJA 2ZUAA 2HNYB 3I0SB 3AD7C 4M5KA 4J9QA 4A8MP 3NRBA 1T05B 2CVIA 4O4GA 1TFYA 3J7YU 3HSZA 3PDNA 1WKKA 1I1GA 1DFDA 2IJFA 2Q6BA 4Q0BA 2AU0A 5DJBA 5DDPC 4IQXA 3C6UB 4YB7A 3MUMP 3D1HA 3BS9A 3LW5C 1IWAA 4Q7AA 3KLFA 3QT5A 3DOMA 1FJGJ 4L3KA 3MMBA 2WZ1A 1KR4A 4NXMF 1GQEA 5KAKA 5J2MA 4BWJA 4EMDA 1FO1A 4KHPF 4U8YA 2CQ1A 2H4WB 2VJUA 4LRBA 1TAUA 2PMWA 1UAWA 1VIXA 1RLCL 2MKIA 4B9NA 2RJZA 2WB1D 3FCHA 4NA1A 4PWDB 1URRA 3HHLD 4F4AA 3A8JA 2F8MA 4ZCIA 4FNHA 4LT6A 5J2PB 2HBQB 4WIIA 4QIVA 4BCAA 2DH9A 4ZVQB 2VU5A 5HMWA 1YJ7A 1B0TA 2CNKB 3CDEA 4FYDA 4TN2A 1JLCA 2FIUA 1EQMA 4HHUA 2LCWA 4ZJQA 2CUYA 1B0VA 3SSRA 3AFGA 5D0RA 1SIWB 2ZBCA 2WBMA 5ETPA 3ZZ0A 4CTAA 2P9CA 1F5CA 4OZ2A 1WC3A 4USMA 2ROGA 4RBVA 4GC6A 3KHHA 3BREA 5BYSA 3TO8A 2VG6B 1HWKA 4LR8A 2FZKB 3N6MA 3KG0A 1Q7YT 5H9EJ 1E6YB 4NYOA 3V2UC 2MLXA 3EPGA 3U1MA 1U24A 4BHQA 1HI0P 1H72C 1F5BA 2NREA 3W63A 2YX7A 4K5RA 4ZCKA 3S8SA 2OFHX 5DZ6A 1H38A 4FKXA 4MKYA 2DXDA 2C28A 4Q44A 1IKYB 6AT1B 3EVWA 4K4UA 3M32A 5SUHA 4NZ6A 5GAHU 2OPSB 5F41A 1L3SA 1V9OA 1M5HA 2OJ3A 4MFBB 4NLYA 4DPYA 2HFOA 2IY5B 1HBNB 1HBUA 2F65A 1YBTA 3FGVA 4LBPA 2OPPB 2D3OR 5A2QY 3EGVA 4J9NA 3TAPA 2E5IA 2WONB 1CVJA 1WG4A 3VVUA 3OL8A 2YWWA 3IM8A 4ZMMA 3PJ9A 1RT3A 2GIRA 1Q86T 1WOPA 1U1KA 3BQ1A 1PKUA 3D1QA 3DNCA 2YNIB 4W90B 3TUZC 4F4KA 3UCZP 2W25A 1RWKB 1LV5A 3R5AA 3UWTA 1E6VB 2FC9A 4HEA9 3MEEA 3QO9A 2X1BA 1IBKJ 1WEYA 2B4OA 2DR8A 1HBMA 3GIIA 4EBCA 1HHSA 3M8PB 5AJ3J 4C3MA 2VPWB 4X2BA 4F02A 3M8QB 2XS7A 4P73A 1DHMA 2YKMA 3W61A 3LAMA 3TP2A 2ZWPA 4WP3A 1N6QB 4EK2A 1B70B 2E9TA 2GHPA 1IBCB 5CYQA 3BDEA 4NLTA 2P9EA 3ENQA 1W2IA 1XTZA 5DGBA 2QN6B 3KMSA 1SB6A 3GR0A 4CLKA 4F8RA 3DGVA 1J5OA 2FB0A 2AW0A 4OYOA 1HNIB 2E5LJ 4NLOA 4LF7F 4IH7A 4CM0A 3HULA 3ICLA 4NLVA 1MNEA 2BDPA 3PYDA 3TARA 2XWXA 1KKHA 4WZMA 2PFDA 4USJC 1NAQA 2VA3A 1FDDA 3CCJS 3KK3A 4A8OA 5HQ8A 4ED3A 1K0TA 4PPDA 4X4NA 1ZA1B 1AZSB 2APOA 3HD2A 4CNYA 4NYZA 1UVLA 1LWCB 5KFJA 4QR0A 3SCLE 1RJJA 2AMCB 4ZDNA 2CQCA 2H9ZA 4K4VA 3TVYA 1ZAXA 5LOQA 3IC1A 3TRGA 1NPRA 2PC6A 4WXOA 1WG5A 4WF9Q 1KVIA 4NPOA 3J80U 1XERA 4NXNJ 1DURA 5CCLA 3LO3A 1WOOA 2LQ9A 4FVCA 1GFWB 3LP0B 1FJ7A 3BV8A 4HHHA 5HMYA 2BJDA 2RT3A 3CCLS 2K7KA 2DY9A 2LYVA 1K73T 1BWVA 3RYLA 4ZLJA 3MAAA 2KVQE 4KKOB 4EEYA 4Z2XA 4F4WA 2D7SA 1WSVA 2JRSA 4RR5A 3HX9A 1AXQA 1Q4RA 3KJVA 4I69A 2AGQA 2HVDA 3MM7B 2WVEA 3ZZOA 5LL6d 1VQLS 2HS4A 1DQAA 3VAIA 1W26A 1QDUB 2VBWA 3D0IE 4IUFA 1Q8IA 1F5AA 1UWBA 3HSGA 4UQTA 2GGPB 1X9WA 1N5QA 1R8BA 1X5TA 2V4JB 2JVRA 1T03B 4NLGA 2IHR1 2RQ4A 3FEYB 3PIOQ 1EETB 1EB0A 1XMBA 3CDBA 2FVCA 3QBCA 4JUZA 4J9KA 1ROFA 3SXLA 4JI5J 1LNQA 1P9YA 2ZNZA 3IS9B 4KHMA 4NX9A 2RRAA 3GZ7A 4ETXA 2B43A 4OQJA 5LJ3Y 1S1XA 1HWLA 1TKXB 5DGAA 3TJAA 7AT1B 2AX0A 3GJTB 4ZLNA 4NEYA 1WC6A 2YKPA 1JLFB 1O0PA 2CDRB 4K0KJ 1TQLA 1V3SA 3IR5B 1NSQA 1LFWA 4IH6A 1GXUA 3VAJA 2V63A 4P10A 2LKZA 3TZYA 4FPIA 3H59A 3KHGA 5ETMA 3GFHA 2JEFA 2F40A 3D3BJ 1RWXB 4CZCA 1HNVB 4N7TA 2XBPA 3BKFA 1HQ2A 2RF2A 4LF2A 3U27A 5KFIA 1SKSA 4IOCQ 1NDPA 1TKDA 4ED6A 4TU7A 2EK1A 3C16A 2YKQA 4DV5F 2R2UA 5KFVA 4OYPA 1B64A 1FKPA 1XN9A 2XC9A 2MTLA 5B0FA 5DRKA 4DEZA 3QATA 1VBKA 1EQ0A 4QU7A 2VG5B 1N33F 5ETSA 3AJDA 2QYGA 1QTNB 5GADI 4H4MA 2EXUA 1JJCB 1VQNS 2E1PA 4QBUA 4EO6A 4IFYA 3RR8A 2JWNA 1BWEA 3IRXB 4DV2J 2YNGA 2E9ZA 3KOAA 3T6JA 5E3QA 2G1HA 3KUGA 3PG9A 1DTQA 1F3VA 2C42A 3OTEA 1FFGB 1O8BA 1RKIA 1HD0A 4GVLA 1IVZA 1UFKA 2OPRA 3LALA 1RAJA 3TAQA 3PXGa 4C11B 4F0HA 4QIEA 1VQPS 3PYFA 2BJ1A 4M63A 1Y3JA 5K14A 4F4YA 4YB6A 5KFSA 2QA4S 3RBEA 1RT6A 1S1WB 1VLOA 1S7IA 2BRLA 1RT2A 2GVDB 4MIWA 3M8SA 3T6BA 3K8WA 2HBZB 2KRBA 1UPMB 2OHDA 1G1XA 2HFUA 2YKNB 2PO4A 3MEDB 2XSJB 2C2DA 1ZETA 1S0OA 5DDQC 2PMZD 3HD1A 3NS7B 1AB8A 2ZNYA 3WC2A 4FBUA 4DDFA 4PCQA 4LF5F 3GLJA 2J6TA 3HM9A 1SC1B 2J9CA 4YR2A 1TK8A 1SIZA 2VFSA 1NKEA 2IDEA 4MK9A 3MUVP 1NJZA 4WFXA 1BLUA 3QAUA 1N0VC 4P2MA 4CRJA 5HO4A 4W92B 2DB1A 3HDSA 2OELA 4KIAA 3T1AA 1TMJA 2H1YA 3HJFA 4DV6F 1CS4B 3EE3A 1S72S 3HMJG 4FXVA 4LF6J 3W2VA 1QVFR 4IDKA 2EFOA 5KFNA 3SCIE 2H5IB 5I3UA 2CPJA 3TX0A 2V8VA 4HLBA 4X4PA 2HYIB 1KBRA 2ZJRQ 4USIA 1RAIB 3QLHA 1S77D 8ATCB 3B78A 1NH8A 1RYSA 4HACA 2NSCA 4HYKA 4CI0B 3VGSA 1TVRB 1FD8A 3CMES 4DX7A 4KR0B 4AQYF 2M3DA 3TJ9A 1HQUB 4RWXA 5GADU 1T95A 4RNOA 2RH3A 5HQMA 2F4FA 5KG2A 3DN9A 5A8WB 1X4DA 3PX0A 3T3FA 3TWZA 2EC0A 2CAJA 1XIQA 3J7ZT 4TKTA 3G6VA 3B54A 2XMJA 2VQFF 5KFWA 3RB6A 3CTRA 1N33J 1FVSA 1TKZA 3V81A 4WK1A 2B7BB 3R2CJ 2MKYA 1UWAA 3QAEA 5F0WA 2AEJA 1WNEA 2L9WA 2MZTA 1G4CA 3UQSA 3M6UA 1HD1A 3DMJB 2LFVA 2M0GB 5DG8A 4QIWD 2FHJD 1YJVA 3MECB 5IS2A 1TFWA 1TV6A 1Y7PA 4I7FA 4I6YA 2YWKA 4JI6F 2B4PA 3M05A 4MMOA 4OJGA 1LEOA 1LOUA 4ZPWR 5F8MA 2DBBA 3Q24A 2CPYA 3GYNA 3FBFA 2UP1A 1NK4A 3OUYB 5DO2A 3X3UA 1JWWA 1WI8A 1N48A 3W8PA 3GFYA 4CT8A 1JX4A 3JTPA 4TU8A 2DHSA 3AOCA 2EWHA 1J5EF 2GCFA 4S0MA 4LSLA 1TUWA 2I0XA 1PG5B 1VQ7S 4F7VA 2ZH6A 4GC7A 5CH7B 4ANCA 1NSAA 5IT9Y 5HSPA 1RU1A 4ETZA 3R8YA 1C1CB 1JB0C 3HPOA 4J9VA 3LGMA 5T7LA 3P6YC 1IR2A 3GILA 2C2EA 4KB7A 2XS5A 2XCAA 2UVRA 1HARA 3PR5B 3KMQA 1FESA 1SI9A 3BSAA 3T9ZA 2CQGA 2CPZA 2YNHA 5DQGA 4CCHA 4TY8B 5IZHA 2EK6A 4DV6J 4DPUA 2XM3A 1CPZA 3W5YA 4N56A 3ZZUA 4UY85 2QLJB 2YNFA 1QE1A 5L1JA 1Q82T 5DLFA 1V6HA 4ZS6A 2WVCA 3Q8SB 3MM9B 4ZPBA 2F9DA 4RX6A 1R0BG 1HL6A 1KHWA 4DR6J 4BC9A 2JLFA 1RAFB 2Z2LA 4UUXA 2C2RA 1ULRA 1FWPA 2CYYA 5U47A 2E9RX 1SJQA 4YDXA 4PYDA 1ZAWA 1EJ7L 3NBPB 3TA1A 4PEOA 3AA8A 3PYEA 5B0CA 1Z2LA 3IG1A 3KK1A 1KSPA 1OY8A 2KM8C 4OYXA 1M5VC 5KFXA 3CJTA 4PXDA 3OXLA 2YX1A 1S6PA 4NCBA 3MTJA 1VYAA 3ZZRA 4M8LA 2QX0A 2XULA 1T3OA 3DLKA 3PHEA 3D0HE 1HYSB 4FN5A 2J8AA 2F5GA 4M5MA 1ZTTA 4OZNA 2CJYB 2AEMA 1JLAA 2KTQA 1R0CB 2NUUG 3MMCA 2QLXA 2HHUA 5J1EB 1S99A 2UUBF 1L5UA 3V6DA 2MEWA 2V69A 1PYOB 2DNGA 4G1PA 4I2QB 2DHAA 4B9UA 5DG7A 3I32A 4DCOB 1CQMA 4P7TA 2GHWA 3KG4A 1TL1A 1HNWJ 5LT5A 3Q2SC 4C8LA 1VC0A 2ZEJA 4JYAF 3GCXP 1JXVA 3CT9A 2N7YA 3GJRB 4HH0A 5A76A 4O3OA 4OX8A 2E44A 1LXNA 5ETQA 4RW9A 1NNDA 2GIQA 4RUBA 2OTJS 1JQGA 3HT0A 1X5SA 3I4PA 3MMAA 3Q8QB 3RGIA 4IG3A 3VZIA 4TYBA 2JOQA 4U7CA 2ZHOA 5D0EA 3ILLA 3HFZB 5ETNA 3ZZYA 2KO1A 2HBYB 4ZP7A 3RZAA 3TX8A 4RU9A 4QOTA 3KWMA 1K1SA 1EX8A 1B0PA 2H54B 3NY0A 3RRKA 4ECRA 1S0NA 2GC8A 1RBOB 3FVYA 4RLEA 3IAM9 5CHCB 3JTNA 2YQ1A 1R8AA 5F8LA 5KG4A 3DRPA 4QIFA 2DGVA 2HSEB 1FX4A 3HLUA 1SH0A 1T9VA 2XLIA 3JAMY 4F2SA 2UXBF 1U1LA 4LF8F 3PV8A 2XZWA 5CAAA 5EX3A 3HI9A 3SZ2A 5IT0A 1VR6A 1FI4A 2ASJA 2COLA 2OI2A 3EGNA 4NLRA 2VJVA 2P8IA 1NPKA 1KQSR 1XNQJ 3PHTA 3AQOA 2DPIA 2CJXB 4UW2A 4OI1A 2H48B 2QV6A 1SH3A 2GHVC 2YPYA 4Y2CA 4ZVUB 4K4WA 4Y2KA 3FCVA 5E2QA 2H5EA 2WW4A 2IJNA 3HZEA 2JC0A 2B6AA 4P6QA 2R8GA 3B8HA 1MROA 3TZWA 2DT9A 1K44A 2UUBJ 3FDSA 1NK0A 1HHTP 1SL0A 3GG1A 1RHJB 2FY1A 2B8PA 1XR6A 4DL4A 3QQCD 4LFBF 1TUVA 3DDKA 2XSFA 4OI3A 4EBEA 1ZM4A 3CJ2A 1HPZB 2V94A 4BS2A 2XYPB 2UU9F 1HI8A 1JJ4A 4GKJJ 5J2QA 2ASYA 4ZJLA 2G0CA 2K1RA 1NJWA 4DUYJ 3HO1A 3WDOA 4JYAJ 3BN4A 1MMLA 5KT5A 1XEZA 3OL6A 3KLGA 3OTCA 4U95A 4KSEB 1B4SA 3D68A 1QY7A 4B08A 4DR1F 3KLEB 1ZA2B 2ZKTA 3CPWR 1UVKA 2NXNA 4DV0J 4EWTA 2NXCA 3OXFA 2K3IA 4EYIB 4QPXA 4KC5A 2LLZA 4LFCF 2EBEA 4AL6A 2R2TA 2HW3A 5LXRA 4O0NA 3DYAB 3M1VB 4QZVB 3BO4A 1G2EA 1WTFA 4R5PB 1T8EA 4JI3F 1KN6A 1O51A 1VMBA 2VC1A 2PE8A 2BE2A 1RTDB 3OV7A 4FZVA 4V1Ak 1KS2A 3AXMA 4J9MA 2HHTA 3KNGA 1BXNA 1QSSA 3T9NA 1WG1A 2BKPA 4HR2A 2QJ3A 4DX5A 4J37A 2DCUB 2X1GA 1YX2A 3HHLB 1U48A 3H5XA 1FXRA 2WSFC 5ETVA 3C19A 4KGZB 4DV7J 1IBLF 1RTJA 5IWAF 4NI2A 2AP6A 2V8DA 4OLOA 4ELVA 1S9EA 4U8VA 2RE1A 2UVVA 4ER8A 1UPPA 4DJBA 1APSA 1X8DA 3W66A 3PRVA 3R5JB 2OTLS 4L6V3 1ACMB 1FRMA 3TW0A 2R7TA 3WC0A 4KGVB 2MY7A 4HT7A 2CJKA 2ZBQA 3DRSA 1S1TA 4XAKA 2DCLA 2CPEA 4DV3F 2F63A 3J81U 2F8EX 3R97A 4DR5F 2UVUA 1S57A 3R7SB 5K8OA 5C25B 2IRUA 3OR1A 3W65A 1U1NA 2OUGA 1PBUA 2R7RA 4X64F 4X62F 1PIEA 3Q8YA 1UEVA 2BE9B 4I2PA 2W4PA 3L3CA 3QNWB 2YY3A 4F3OA 3PCOB 2OMLA 4NLXA 4ILMA 4CLLA 2VB6A 2BJ9A 4LRDA 1TZ0A 4KE5A 5KFBA 3HVTA 4PR6A 2RU9A 1QVGR 1RTHB 3F41A 3DI6A 1CULA 3N01A 1HMVB 3MM8A 4WP9A 2XNRA 3EGWB 5FLXY 2HKEA 1SQEA 2IVFB 1SCJB 3RUBL 5LMNJ 3G71S 2J9DA 1R0AA 3K5MA 2DNZA 4XDCA 4ZVFA 5IC6B 4B3MJ 3TUIC 3SSSA 3G2XA 4IFVA 4GVBA 3CGIA 2YKAA 3BGRB 4ZCMA 2BA9A 1U49A 4OZJA 2MQMA 3BBCA 4OZ5A 3TAMA 4JI0F 4XIUA 2Y8WA 4ED2A 4CNZA 3OFEA 1EAYC 2QFIA 1RCXB 1XWLA 3CEDA 2R8HA 4ED4A 3N5BA 1WC1A 4K4ZA 1QUVA 1RHKB 2V67A 5KFUA 1HBOB 5HQLA 3UR0A 3VTIA 1N5SA 3QGHA 2WSEC 4DFKA 2V4QA 2XWYA 3PO5A 2IRYA 3R7NB 3SQOP 5F3ZA 1C0TB 2B5JA 4B17A 2IAJB 2HNYA 1KNZA 3WIUA 2CRLA 5LMUJ 4RW4A 2UUWA 1NJYA 4NLUA 2AJ0A 1FTRA 3AB2B 1GMWA 1SL1A 3PACA 2FDNA 4QPTA 3EICA 2DIVA 1SJFA 4PG8A 4C8YA 4ZPTR 4NLDA 3C6UA 2AJQA 2PD1A 3MCSA 4U96A 1LK5A 2G0IA 2C2MB 3CMAS 1RDRA 1UETA 2DK2A 2RVJA 4DV3J 3HK2A 2GQ2A 1N52B 3FKBA 3VZHA 4YHHJ 3NCRA 4DR5J 4J9RA 3Q23A 3MM6B 3KXDA 5JMNA 1UTAA 3FSXA 4KTQA 1R31A 2X7IA 1NK9A 3IP0A 2VFTA 2V4RA 4PWDA 1HNXJ 3EM1A 1NZAA 3L4BC 4FVMA 3A3OB 5K20B 3GSDA 3HP6A 5J2PA 1PILA 2VODA 5AE3A 1VBYA 1Y5IB 2XYGB 3J7AN 4D3GA 4B9SA 2J7WA 2XZDB 2N4CA 4X65J 3RTVA 3H8YA 4FYYB 5HJXA 1RBLA 2ZE2B 2ZDPA 1Y10A 2CQPA 3T1YJ 5F8IA 4I67A 3IFEA 2VG6A 3W2WB 5BR8F 3NCQA 3QYYA 1E6YA 2D41A 3VVTA 1X5PA 2EFPA 1A0OB 2ERRA 1WHYA 2ZZNA 1SKUB 3H0PA 4F04B 4Z7CA 3ILOA 1W25A 3FSYA 4DS4A 4LMZA 3AT1B 2W8LA 4CM2A 3D4JA 3GR1A 1IKYA 4ID8A 3K0JA 4NMXA 3VGUA 5GAGU 2AHOB 2OPSA 4WIQA 1XMOJ 4ICLB 3BEGB 5JJBA 5E3AA 3RRGA 1HBNA 2X1AA 1VQ9S 3N6NA 2BABA 4DZDA 3GIMA 3ELHA 4PQAA 4F67A 2OPPA 1VIOA 1SC4B 1X4CA 4LSZB 2R8KA 5K5MA 2CPXA 2WONA 4DUZJ 3I55S 1RISA 3KHLA 2B0GA 2QG9B 3EGZA 1FT8A 1XK8A 1RT4B 4N8OA 4CLUA 5HP1B 3UVJA 2MGZB 5C7PA 3PZPA 3D7SB 3PYGA 1UW4A 1F1BB 3TQ1A 5L38A 3H2VE 1NK8A 5IOLA 1E6VA 4ZIWA 2IA0A 3MCOA 2VH7A 2A10A 1D8ZA 2ASLA 5KFQA 2CQ3A 3W60A 4YUDA 2KFYA 2ROPA 3IGVA 3M8QA 3UDEA 4AE5A 1YDLA 3Q8RB 3S7RA 3C8YA 1L3KA 2QSFA 3POTA 4V19X 4FBTA 3NNCA 5J2NB 4ECXA 2I8EA 4JI7J 3IRWP 1KDNA 4ED7A 2BX6A 4IG0B 4O44B 2DO4A 1R7IA 1V3RA 4EBDA 1HNIA 4ZVTB 1Z4UA 3RBZA 1S9GB 4U67Q 2ZH5A 1PO6A 1XBWA 2QEXS 3HHLC 4WXWA 3ZTOA 4QWDA 3D6MB 5IV4A 1YJUA 2CPHA 2QT7A 1S9FA 4QW8A 2PI4A 1S48A 3FRZA 2E1AA 2V2VA 2IMWP 2EFGA 2DGUA 2EFQA 4HVZA 1K47A 3G82A 4DU8A 3H40A 2HS0A 2HHQA 1WKLA 1Y4ZB 3UO0A 1RA7A 5AE2A 4N5SA 2C2KB 1CJVB 4QCLA 3CJKB 3JQMA 1LWCA 1S4FA 2LP4A 2CZ9A 1V5VA 4JI8J 5BYQA 2V8GA 5GAEI 2DGSA 1S12A 3NMRA 2MXYA 4XK8C 2MKKA 3CC7S 4JV5J 5DS7A 4IRKA 1T11A 3RW7A 1A9NB 1K1QA 4JI1F 2KRRA 2GA7A 2K3KA 3LP0A 5HK4A 2ALYB 2NYHA 4CLZA 2HLUA 2KXFA 1RT1B 1BGXT 2G13A 4BC7A 2DY1A 1Y0HA 3WBZA 2J7UA 4KKOA 5D4LA 2CJBA 3HVWA 2ZUGA 4LF4F 4G1IA 1R8HA 2C3OA 3N0VA 4QU6A 4O4GB 4WTOB 2N3OA 3QPIA 3M2VA 3ZZTA 3MM7A 5IXUA 3MI7X 1JLQB 1GH8A 1FE0A 1WWHA 3G6ES 2QMWA 4UY8T 3SEOA 4DR4J 1TTHB 1G3OA 3OPKA 3CF5Q 4CDIA 2IRXA 2V4JA 1P9QC 1T03A 4C8OA 4YEAA 5L46A 3LTOA 1IXKA 1EETA 4YY3F 3FBBA 1T94A 5E33A 1SJ1A 3Q8UA 2QZ8A 1Q78A 2XMKA 4F50A 3IBFB 4TU9A 3IS9A 1OJ4A 1F60B 4LIWA 4Q2LA 1RABB 3LUYA 1T7PA 1TKXA 1CC7A 4Z37A 4A8QA 1D0EA 3I0RA 1SBRA 5HI7A 1JLFA 2VKZG 1Q81T 2HEKA 4KY3A 4TQRA 3OVSA 3MURP 3RAMA 2Z4PA 2YPZA 3NWRA 2VFRA 2ILZA 1DARA 2QA2A 5KTQA 3RBDA 5B0AA 2LXIA 1OMSA 1KHVA 3FQKA 1Y00A 2FJXA 1W7WA 2ZJPQ 2GAHC 3Q89A 1YJWS 1U09A 4PG6A 3OT9A 1HNVA 3EZ5A 3PEHA 3ONQA 2NLWA 5AE1A 4AFFA 2DVIA 1SUQB 2BRKA 5KG7A 1YI2S 4J9UE 4AT1B 3D5MA 3JYTB 2IA6A 2XHCA 3MM5B 4J90A 4DL5A 1S76D 1RADB 3V4IB 2VG5A 1Z1ZA 4ZP9A 4Q5VA 1GX6A 3I96A 3DRYA 4C3KA 1DJ0A 2XB2D 2PA8D 1RTZA 2BW7A 2WK4A 4DR2J 4OX9F 4YQWA 2ZHBA 1RTIB 1KQFB 4MKVA 2FLPA 2XGPA 3FFIB 4DX8H 3KDNA 3NGRA 2R4FA 2HGLA 2A0FB 2O66A 2FTRA 2JDJA 3D67A 4X66F 3MFHA 3IRXA 4B3RF 4DQSA 3FSIA 3H4DA 3BYPA 4LF4J 5CYJA 3I9ZA 2HVEA 1VC6A 4XPCA 2HHVA 2X3GA 3PIPQ 1Q16B 1Y11A 4LFAF 4C8KA 4DCJB 2R7VA 2E7WA 3HKWA 4FXDA 3VQSA 4PKDB 4GKKF 4HI2A 2A18A 1S1WA 1X9SA 1T9XA 3QGPA 2M7SA 4M5HA 2VA2A 2HIQA 2GVDA 3I5BA 4UF4A 3S1TA 1RAEB 4LR9A 3WX8A 3CE8A 1U6FA 5C2GA 2YKNA 3MEDA 2HVZA 2XSJA 1REVB 2HQ3A 2FHMA 3A8KA 5KT3A 3ILIA 4ECZA 5CYQB 3VAFA 3M2UB 1N56A 4GO7X 2R7OA 3LAKA 1MMNA 2E5JA 3ISZA 3P3DA 4Q2MA 1D8YA 2XG8A 3R5GA 5CYMB 2FHOB 3PKMA 1YIJS 1LWEB 3OW2R 2LQBA 3P8BB 3I9V9 3BGOP 3UCGA 1CS4A 2HHXA 1TK0A 4A4JA 4AD6A 2NCKL 4QYZJ 2FVRA 4C9DA 1IJEB 3M9NB 4DR3F 1U8WA 5F8GA 2AV5A 1D9FA 5T41A 2LQ5A 5H9FK 1D3WA 1S6OA 2DHGA 3P5TL 2FJAB 3BDPA 4WKYA 3UD4P 1KTVA 1I94J 1VFJA 2M5YA 4AUKA 3PTWA 1HQUA 1OIAA 5IQ6A 2DNPA 2FJWA 4AL7A 2NQPA 3LP2B 2JEJA 1S1UB 2KT3A 4ECYA 3QJPA 5EDWA 4P2XA 4M94A 2YH1A 3DDIA 1Y5NB 1WEZA 3MAAB 2MQOA 3MPYA 2OPQA 4OX9J 2EEYA 2FGOA 3ZXWA 1KQKA 2QYCA 3EVOA 1NH7A 4NZ7A 4P71A 3DMJA 4X66J 5BXIA 4LUBA 3EYZA 3TVZA 3RB3A 2V6AA 4GO5X 1HQEB 4L74A 4JI4F 3MECA 4FP9A 3B6BA 2NYIA 3NGUA 4Q45A 1X4HA 2Z2ZA 2BJ8A 2DTJA 4MKAA 1YTYA 1YJNS 3GFZA 3R9LA 1WELA 3RB4A 4QWBA 1RAAB 3GU0A 2W9BB 2VOPA 1TP7A 2CNNB 4PZVA 3OUYA 3G8TA 2QL5B 2L08A 4EO8A 1RHUB 3CC4S 3CDAA 1ZOTA 2M9KA 3RW6A 4CLSA 1S6QB 3OSPA 2FJEB 2ZH9A 2Z57B 4URQU 1LK7A 4QWCA 3NG8A 1AUDA 4CLWA 4OJ3A 4LREA 2QSWA 1PBAA 3W8GA 4JI2F 1SQGA 1PJ6A 4M1KA 3CDUA 1YVFA 3NWGA 1S79A 2F4VJ 3I31A 1RE1B 2XS2A 3N28A 2DGOA 2L9DA 4FDFA 4R0EA 4B3OB 4AXIA 2ATCB 5CXTA 2UUCF 3DC2A 2HVIA 4ES2A 5ETLA 2JNJA 2RDJA 1IKVB 4TY8A 2WCXA 1NDKA 3OTOJ 3ZNUA 3GONA 4X4TA 3VF0B 5B0DA 5H9EK 1NB7A 3Q86A 2MJUA 2QLBB 3CCSS 4C8MA 1XMQJ 4PYAA 4F0KA 2GMLA 1GXLA 3MM9A 3NP5A 3BR9A 4DR7F 4WE1B 4WU2A 3K5PA 1SJ4P 4BDPA 4ID5A 2V0NA 2W2PP 4IO1A 1U2RA 2HQDA 2D9PA 1JLGB 3SCKE 1OQ6A 3WQPA 4B3SF 3L95X 4I6AA 3IGNA 2BACA 3DLEB 3EVMA 1ZS6A 4H4KC 7FD1A 1OPIA 4QIGA 4G6VB 2IC3B 4ED8A 3A1YG 5IC4B 3VALA 1N34J 1DTQB 3THVA 5KFOA 2EKYA 3E3XA 3ISND 2BUNA 2NPIA 1AYEA 1S59A 1HYSA 3BSNA 2D3O1 3MEGA 2L41A 8RUCA 2RILA 3UDCA 3K5OA 3KLVA 3UN2A 1NLKL 4ZN3A 1NK6A 3AJ2A 5T14A 5J1EA 1RT6B 2HMIB 3DLBA 1KOOA 3D66A 2RAQA 1VQYA 2AYMA 1ZPWX 4EU0A 4USKA 5EN1A 1PJ5A 1B7FA 1QAXA 2MYFA 3NEKA 3MPWA 3AOAA 2AYGA 2R2RA 2FJBB 2LMIA 3R7BB 4DG1B 4OX6A 4JI2J 2UXCF 2QMXA 2YQ0A 4HTIA 3W1YC 1FRJA 5C24B 3CJ4A 4W98A 1NBEB 3FMBA 2CPDA 3PRDA 4F0MA 4J9LA 2BQRA 1X7VA 2KYZA 1RHQB 3F0NA 1R43A 1EZZB 3OTDA 3MAHA 1DQ9A 5KFFA 1H0HB 1VJWA 1WD6A 4OLPA 1SKWA 3BBBA 1WJ9A 1NK7A 1NHUA 4CH7A 5IQQA 4TLQA 1SJ3P 3QZ8A 4XPEA 1PYSB 3BSCA 2PN6A 2EFNA 4C0BA 4YB1P 3T1HJ 3MCNA 3G9CA 1HI1A 2CDQA 5K8MA 3SYZA 3HT3A 3M6WA 4A48A 2KKHA 3GJSB 4PXBA 5E41A 9RUBA 2NR0A 3PFOA 3V81B 1AFIA 2VQEJ 3EZOA 2K8GA 2QO3A 3VR1A 2ZOGA 3UE2A 1FCAA 2R8JA 5MLCV 2UXDF 3SIPB 4O0IA 3OTBA 5KFTA 3CO0P 2ZZMA 1GEHA 3AOBA 1DTTB 4DQPA 1GT8A 1QSYA 1WKJA 4I6WA 2BEFA 1VBZA 1XJWB 1DAXA 5HROB 4I7FB 1H74A 1QLNA 1EP4B 3BF4A 3H20A 5EGYA 3BJYA 5I3QA 3U02A 3ETMA 3HJVA 1WORA 2YX4A 2UV8G 3FUYA 5KT2A 4NXMJ 2MKHA 4A47A 4KHPJ 2RUGA 2YH0A 5HLFA 1RSCA 1VHFA 1OY9A 4NE9C 1RAOA 1XR5A 4OYIA 2M70A 1KOHA 3PKYA 2XY6A 3R1HA 3IWNC 4IQMA 3MCMA 2GQCA 1HPZA 4C8NA 3IN5A 4MJKA 5CQGA 2PSZA 2QL9B 4A8KA 1QUPA 5CA5A 1KVJA 4LRCA 4P2SA 4Y65A 5T7LB 5B0GA 4M5IA 3D9BA 2HNZB 1FWLA 3MZIA 2B3TB 1JNZB 4KV8B 1H98A 1VRUB 3K2YA 2WB4A 3KLEA 4ZITA 3B4DA 2P9GA 4WFBQ 2Z8QA 2DR6A 1NSKL 4DL2A 1BE4A 5KG5A 3VAKA 3O3LA 2C22A 1QE1B 4NZ0A 2PI5A 1Q8BA 3M30B 4OX7A 3DYAA 3M1VA 2ZD1B 1IKWB 4Y2MA 4R5PA 2BM0A 1TL4A 1R89A 5KT4A 4I1TA 1FEEA 3H5UA 5CD4H 4OZ1A 5B08A 2FLOA 2UUTA 3D54A 1DRZA 1VQ5S 4DFPA 3MD1A 3SMZA 2MHNA 1CSJA 2RRNA 5D6GA 4CLTA 5CZXA 4N47A 3PRBA 5G0RB 1H73A 3IG1B 4DL6A 4DLEA 2QLWA 4C0OC 3J80Y 2MQPA 3H2UB 3HHLA 4OV1A 1QJHA 2H4YB 3LWMA 3DM2A 2FZGB 2FVSA 1FVQA 1O6XA 1S6PB 4WFAQ 1WF0A 2CFXA 3HFKA 3TR5A 3NNAA 1CJUB 3LQVA 2C3MA 1HLWA 3SFGA 2W9CB 3KTQA 3KHRA 3RBXA 3OJSA 2MQ8A 3CCUS 2IFXA 2DKOB 1IBMF 2YXLA 3T41A 2JLGA 1X4GA 2K7JA 2MLYA 3D3CJ 1RAGB 3JSRA 3MMCB 5I42B 4YR0A 3QGIA 4ZPDA 4B3TF 4FPRA 2W24A 2HG4A 1YRXA 3DDNA 1VQSA 2DHXA 1PCAA 1YJTA 3TUJC 1S10A 4OHXA 2W4DA 1HFEL 5C25A 1IM4A 2G1DA 5L1KA 1FF2A 2E5GA 2Q1LA 3T5HA 2HNDB 4LF9F 2R8IA 5HVGA 2UUAF 1RAHB 3RAQA 3QT8A 3W9HA 1YLXA 1PAEX 1TL1B 2CWKA 1N36F 1N4LA 4C48A 3R5CA 5B0BA 3CJ5A 2VHGA 3OHAA 4LF7J 5G4DA 2CPIA 3HFVA 4P2FA 4RO0A 3CO9A 4CO5A 4DUTA 1UFLA 5KFPA 1LWFB 1RZMA 1UVJA 3W5XA 1RTHA 3KDOA 1U7LA 1FK9B 3VV2B 2HFVA 3IA0A 1HMVA 4NLPA 3W62A 1FRIA 2JEIA 1HR0F 2RHQB 5KFYA 3FMWA 3P45B 4PXEA 3TA0A 3IBCB 1I6JA 2MZSA 3B82A 2WRMA 4MKBA 2U2FA 2J0XA 2GMJA 2QTWA 2U1AA 1WTBA 4ZVEA 2RMLA 1YK9A 3BGRA 5K9FA 5KFEA 2I5JB 1FRLA 2Y1LB 2HHSA 4X84A 1JLBB 1DQ8A 3K5LA 2FLNA 4RWWA 2XMMA 4OI2A 1H7WA 2DNKA 2KN4A 2MZRA 3LF0A 1S1VB 3RG6A 1UA1A 4KO0B 2CQBA 1YZ6A 3SQGB 1UCNA 4AL5A 1M5SA 2YWEA 2I1RA 1HBOA 3HVAA 2EBGA 1U0HA 3DU5A 1IN0A 1UEKA 4DV4F 1MWZA 2J9DE 4KGMA 1C0TA 3Q83A 4AYBD 1KQGB 5K8PA 4J9OA 3TOQA 4DSIA 1FJEB 3M9OB 3K58A 1Q8KA 1UFWA 4DI6A 2R7WA 3TEGA 2C3PA 5KOXA 4K4SA 1PYTA 3L7UA 5D8HB 3BB5A 5ADZA 1SPBP 1XNRF 5KT7A 3MPVA 2O01C 2Y9HA 3F44A 1N5VA 1DY3A 1FX2A 1ZZFA 3HHDA 1KFDA 2D1CA 1ZAVA 4RNNA 2HHHF 5FD1A 4USHA 2CG4A 1EARA 2WW8A 2RIJA 2WBRA 2DHHA 4F2RA 2QIFA 2DNHA 3D6HB 3CWJA 3BN7A 2Y0SD 1TL7A 4TNOA 1GNKA 2BE7D 5DDRC 2W2MP 3GQCA 1W2BR 1TKTB 3MM6A 3GV5B 4LF9J 2GO8A 2IIHA 1FHTA 2CQ0A 3T5KA 5J2QB 1WUUA 3BPDA 2CWXA 2CQ2A 2EG1A 2M4MA 3AA9A 3SV3A 3GPAA 3CCZA 2FY8A 2IMOA 2NPFA 4DV1F 1RWMB 2KHDA 3OJUA 3P4UB 1ICEB 4USUA 1N5YB 1KEKA 4UT4A 5KFKA 2IPOB 1HHQA 2P6TA 2IM2A 2IYIA 2I9SA 1IM6A 5F8HA 3M8WA 5D0GA 2B9XA 4PQUB 1JJHA 3DKDA 3JQKA 2UV8A 1IJFB 4ZA1A 1X5OA 4JOUA 5HAOA 4RBUA 4Q43A 3TI0A 2ZE2A 1VOMA 4OZLA 4IOAQ 3EUNA 4R0JA 3M6XA 3FJ2A 4ZPCA 3W2WA 1NU4A 2X1FA 1Q7LB 1N32F 4DV5J 3O1LA 2AYBA 2BANB 3MD3A 5DM6Q 2QRRA 2A6OA 4FF3A 4DL3A 4K2XA 4EFAC 3CJ8A 3W9JA 1VHIA 4MYUA 2VICA 2LXFA 3DCAA 3K57A 5F8JA 4M5DB 1R8PA 3UW1A 2XMTA 4ICLA 3NGKA 1FXDA 3CJSA 3D0GE 2HFZA 4DF4A 5HL7Q 4H4OB 4DFJA 1U1QA 1FKOB 1RTJB 2E1RA 2HQFA 1U8SA 3DGPB 4NI2B 1AUSL 1FE4A 2ACYA 3PW0A 2ILYA 3GIJA 9ATCB 4QJVA 4QR1A 1T9YA 5KG1A 4YB5A 2YTCA 4DPWA 3US5A 3T5LA 3AODA 5M2RA 2AJ1A 5HP1A 3E8OA 1C1BB 3DRSB 3I6PA 2MGZA 2HRYA 1FJGF 2R7SA 3H5YA 4DL7A 1RWNB 1BD6A 2DNNA 4YDDB 1QSLA 2Q3PA 5A8KB 4LVOP 2ZFHA 4QWAA 4KPCA 3JSMB 1NRKA 2BJ7A 4OJ1A 4O4RA 2GIFA 4RBTA 4WFZA 3K59A 4LF5J 1B99A 5A0YB 3NL0A 1S5ZA 2LQJA 1HKAA 1U2FA 3UD5A 2CIMA 2GNKA 2GJIA 3GV8B 4IG0A 4O44A 2M52A 3RAXA 2QA1A 4P74A 3ETOA 4CLFA 4O3PA 3S6EA 3BGFA 3DI6B 3H25A 3MM8B 4LQ9A 1NCLA 3CCMS 1UVNA 1HWJA 2DEIA 3AY0A 4LSNB 3CIMA 3BKTA 3Q2TC 3IMQJ 4DZ6A 3K17A 1FA0A 4G1QB 5A6PA 2OSRA 4RNMA 2BYCA 1NDLA 3K7RA 4CH0S 1CJKB 1CJVA 4E0DA 1QM9A 4AQYJ 3CJKA 5LXYA 2JH3A 2MMYA 4OFZA 1RACB 1D9DA 2DXEA 3Q8PB 4NLQA 4EUVA 3TEHB 4ILLA 5DG9A 4UOCA 2VQFJ 1AT1B 2B4VA 2VUGA 5JXSA 2J0WA 2LVWA 1LWXA 2MDAA 3EPIA 3PR4A 4LVNP 3G6XA 4O3SA 1RT1A 4NWBA 1O5JA 1WSRA 1Q0NA 4P9SA 1NM2A 3NMAA 2KJVA 4P52A 3OLAA 2FQQB 4LF1A 4RW4B 4PXCA 4NYPA 1X0PA 1B3TA 2C2OB 4WKRA 2Q43A 3BBFA 3C6TB 1Y9OA 4JI6J 2VDIA 4EZ9A 3K8VA 2FJDB 1JLEB 3GFXA 2HLTA 3CNQP 1GTHA 2AEFA 1RYRA 1MMDA 3KNAA 1JLQA 2VG7A 1IBKF 1RT7B 2IM0A 2W2QP 2ZC4A 2CKWA 2QMUB 5AJ3F 2VIHA 1T02A 2HWTA 1U0SA 3DOLA 3DLGB 2J7KA 1D9AA 5C42B 1J5EJ 1UKUA 1EIYB 3F73A 3MPDA 4H4KA 3SI8A 3KG1A 4ED0A 2JSXA 2V8HA 5F9LA 5JUMA 1FTCA 3O44A 3CD0A 1KC8T 1VQKS 2YWGA 2DH7A 2ALZA 2PEHA 3F56A 3I5AA 2XMWA 2E5LF 1AFJA 2I2YA 3V6JA 4RZRA 5LJ5Y 1X4EA 2YVSA 3L9ZA 4ALZA 4CYUB 4X4RA 2VF3A 1UJ6A 4J9SA 2HGNA 5E3RA 1MG7A 2A6MA 2VBXA 2FHJA 2QC3A 2XMUA 5HJYA 2O5DA 3CCVS 1YJ9S 5C2CA 3UNYA 2ADCA 1HW8A 4ZPAA 4ZVSB 2L3MA 3BH7B 3ENWA 1AA1B 2JEGA 4NCGB 2GVZB 4RW8B 1SUQA 2LDIA 2GQQA 1CEZA 2O1PA 5HMZA 4NXNF 2CVEA 3JYTA 5DZ7A 3MR5A 1Q1KA 3ET6B 2JL9A 4UUWA 3FCWA 3MM5A 5BYRA 2V50A 3NGSA 3KLHB 2HFNA 1LW0A 3V5RA 5A2QU 1M90T 3V4IA 5KFHA 3QWPA 2XHWA 1F3FA 3C2PA 2DNRA 3OR2A 2Z2YB 1U25A 4NLWA 4KFBB 3GSIA 2OEKA 1RTIA 3VCDA 5KFRA 2V9WA 4DSLA 3FFIA 2EG2A 4ZCLA 1WOSA 4NRUA 4NL5A 4KGKA 2OAUA 2CNOB 3U1LA 1U1RA 4HKQA 5AXMA 3DOKB 1NJXA 2G2YA 2DISA 2FVPA 2XMAA 1U1PA 1FRHA 2JX2A 5ITHA 4M5LA 3QIPB 2HAFA 2GW8A 3UVJB 2KZMA 5D77A 4ED5A 1WACA 4DOZA 2R7XA 4EGLA 4OI6A 2IBKA 2C3YA 4IRDA 4RU2A 2VV5A 2Y0BB 3L09A 2DGXA 4ATNA 4F3QA 1U1OA 2RHSB 4NASA 3D1OA 4JI5F 2CXEA 4F36A 1OYEA 1EHWA 4B9MA 3CJQA 5FDLB 1REVA 1YQHA 3LP1A 1ZM3A 3J81j 1FNOA 4UZBA 2POKA 3POTB 3KUHA 3M2UA 3EXYA 2AQ4A 4K0KF 1U1MA 2OEMA 4UOHA 4URSA 5E0OA 1ZPVA 3BM7A 4WU3A 5CYMA 4ZHRB 1LXJA 4BWMA 4P75A 1LWEA 4KT0C 3R5BA 2JZ5A 2ZVSA 4PUOB 2PA3A 1FWKA 2MB0B 3G82B 3CW2C 4ZKAA 1C0UB 1RWOB 1MN9A 3BPSP 5B09A 3V6HA 1N8RT 1TU0B 3CULA 1BUXA 1XQIA 2G2ZA 4RPFA 2V68A 3M8ZA 3MOJB 4MYTA 1WHXA 4OZ0A 3PVXA 4RL1A 3LP2A 1T9WA 3I4HX 4ZOSA 2UXBJ 4M5NA 4HI1A 4LF8J 5AT1B 1S1UA 4PRFA 2CQ4A 4WPAA 1JKHB 3I82A 4C98A 2A2DA 3FNNA 3JSYA 4DV2F 2XY7A 3EWGA 1ZM2A 1YSJA 2BXJA 4BBYA 3HKZD 3MR3A 3N79A 3IWLA 2XMVA 2E7XA 1IQZA 4HH1A 1NEEA 5FIIA 8AT1B 1HQEA 4RUHA 1RBAA 4FS1A 3ZTQA 5AXNA 3M2VB 4ILRA 5A8RA 3AJ1A 1HA1A 4X4SA 2DNYA 2AZ1A 5E3CA 1Q95G 2VPXB 1N0UA 4YN3B 3BQ0A 1RQ0A 5A6WA 3UD3P 2CZ4A 3PX6A 2WTFA 4FF2A 1LW2B 1KTQA 3R27A 4WYLA 2W9BA 1X9MA 4LFBJ 3PW7A 1R27B 4OJHA 2KM8B 1U47A 3SDEB 5HBMB 3J81Y 2DR5A 1S6QA 4FS2A 2UU9J 2VPZB 2D9OA 3MGJA 4FXWA 2LA4A 3IO1A 1SXLA 1MU2B 4O3NA 4ENOA 4USWA 2BW2A 2KFZA 1SVDA 1S4EA 3R1LA 3E01B 3NNHA 2HZVA 1IKXA 2HURA 1HNZF 3I0RB 4PAAA 4UOGA 2OH2A 1ZTWA 4DN0A 2FGCA 3OLBA 5EWGA 4DR1J 4JV0A 4ECTA 1IQTA 5L9XA 3AAWB 2JVOA 4O3RA 3FK4A 2IVYA 2QGFB 3FZBA
chains in the Genus database with same CATH topology
2XLJA 4ID5A 3QIDA 2V0NA 4FN5A 4OHVA 2J8AA 4WTYA 4B3OA 4FF4A 4LF6F 2IYGA 4IO1A 1ZTTA 1U2RA 5AXKA 4OZNA 3SDEA 5HBMA 7FDRA 2D9PA 1JLAA 2HWIA 1JLGB 3SCKE 1OQ6A 3G4SS 2KTQA 4OIXA 2NUUG 1IKVA 3MMCA 2QLXA 4B3SF 2N82B 3L95X 2X51A 4I6AA 2HHUA 3IGNA 2BACA 3MDFA 3DLEB 5J1EB 1S99A 4PWUA 1MU2A 4DPOA 2UUBF 1TL3B 1L5UA 4H4KC 3V6DA 2RSQA 3TYTA 2XGQA 4N77A 1P6TA 4F3MA 1OPIA 7FD1A 1TK5A 2J0QD 4QIGA 3E01A 2DNLA 1RP5A 4RW9B 2W7AA 2FHKA 1GXTA 1OS5A 2M88A 2DNGA 4G6VB 4G1PA 4OL8A 3CD7A 2IC3B 3IR7B 4I2QB 3S01A 4ED8A 3A1YG 2DHAA 1CC8A 3UNGC 4O23A 3MMAB 1YGYA 4IG3B 2XO7A 1K9MT 4B9UA 3VALA 5DG7A 3I32A 1DTQB 3U1NA 3THVA 2BQUA 1CQMA 5KFOA 3DLJA 4P7TA 4HTJA 2GHWA 2EKYA 5KFAA 3E3XA 2F1FA 2YQ3A 3ISND 4B02A 3GMGA 2BUNA 2NPIA 3AHPA 4WE1A 1HYSA 4Y0FA 3BSNA 2ADBA 1SV5A 1UA0A 2LDYA 4B9VA 2KFNA 3KG4A 3MEGA 5KFMA 2L41A 5SZTA 1FXLA 3W3SA 1TL1A 2RILA 3UDCA 3VAGA 5LT5A 3Q2SC 3CCTA 4C8LA 1M5PC 1VC0A 3MHYA 1S49A 1FDNA 1JLGA 3K5OA 1JJ2R 5B0EA 4JYAF 2AYEA 3KLVA 5GAGI 4DFMA 4HDGA 4RUCA 1P1LA 5L9NA 1NK6A 3CT9A 3AJ2A 2N7YA 4R25A 4QYRA 3DLEA 5T14A 4HH0A 5J1EA 4I64A 3Q22A 1RT6B 1TL3A 2HMIB 4O3OA 5J1PA 4OX8A 5HMXA 3I0SA 3DLBA 3DRRB 1KOOA 1N88A 1WEXA 3NGDA 5GAEU 2E44A 1VQYA 2AYMA 1LXNA 2NSBA 4RW9A 1NKBA 1NNDA 1ZPWX 4EU0A 1T05A 2GIQA 3DRPB 2OTJS 2L9NA 2IC3A 3GB0A 1I94F 2WOMB 4CH1A 1X5SA 3I4PA 3MMAA 3Q8QB 4NOHA 1YITS 4DWIA 4IG3A 4GMKA 3ZZZA 5KFDA 3TA2A 4LIRA 3VZIA 4I56A 4TYBA 5EN1A 2JHEA 3UR3C 3QZ7A 2JOQA 2O67A 1H6KX 2ZHOA 3PJWA 4A46A 4U7CA 1VGYA 4A8YA 1B7FA 3NS6A 4WFYA 1QAXA 5L8RC 3ZZYA 2MYFA 2AGOA 3MPWA 2KO1A 4ZP7A 4F4ZA 3RZAA 1L3UA 3TX8A 4C8ZA 4RU9A 1JK9B 1K0VA 4QOTA 1QAJA 1LW0B 2AYGA 3KWMA 1K1SA 1MWYA 2R2RA 2ZM6F 3QJLA 1B0PA 2FJBB 3CB4A 5F0UA 1VQ4S 3R5DA 3AH6A 2LMIA 3I87A 4WCEQ 1A7GE 4DG1B 3OR2B 3RRKA 4OX6A 1FNXH 1P27B 2MKJA 2VKRA 1FD2A 4ECRA 1S0NA 2GC8A 3M2RB 3NS5A 4YMEA 3HHKA 4CO0A 2UXCF 2QMXA 3FVYA 2IAJA 4UQGA 4RLEA 3GV7B 2HMIA 4HTIA 3IAM9 5CHCB 3ZFVA 3JTNA 2RKIB 3DRRA 3HZGA 2MSSA 1R8AA 5F8LA 3MFIA 3MOZA 3U7JA 2PT0A 5KG4A 1FRJA 1N54B 5C24B 3VAMA 3DRPA 1NO8A 3CJ4A 2W7PA 4QIFA 2N7CA 2WOMA 2DGVA 3RU0A 3FMBA 2CPDA 2KHCA 2PMHA 3PRDA 2XI2A 3UFCX 1T3NA 2A2CA 3HLUA 1SH0A 4J9LA 1YHQS 2OKQA 5KFZA 1TAQA 2BQRA 2XLIA 3G6YA 1X7VA 3JAMY 2BR0A 2KYZA 4F2SA 1R43A 3OTDA 1AROP 2ROEA 2B6AB 3VWSA 4FF1A 1VC5A 2UXBF 5E5NA 1U1LA 4LF8F 4DS5A 1TL5A 3PV8A 2GFFA 3MAHA 2XZWA 4ZLPA 4WYWA 2IBOA 1DQ9A 3DXBA 5KFFA 1H0HB 1VJWA 5EX3A 3NAHA 1WD6A 4OLPA 1MROB 3ITHB 3HI9A 1SKWA 3SZ2A 3K5NA 2OO4A 5D78A 5DQIA 5IT0A 1NK7A 4ECSA 3ENVA 3M4XA 2V5HG 1NHUA 5K8NA 4CH7A 2ASJA 2COLA 2PDAA 3EGNA 4NLRA 5GVQA 5IQQA 4TLQA 2WHOA 4DG1A 2IM1A 2Q66A 1NK5A 1UJ5A 4NLSA 1G6BA 1SJ3P 3T19A 3B4MA 3M2RA 3W7BA 4XPEA 1RI7A 4X4QA 4FNIA 4Y3CA 3J7Z5 3QZ8A 4IO9Q 1KQSR 2DNOA 6FD1A 3BSCA 3RB0A 2PN6A 2EFNA 1R8CA 4C0BA 2DD8S 2RKIA 4YB1P 3AQOA 4KRWA 3G9CA 2VFUA 2DPIA 1X4FA 5DLGA 2I38A 4UW2A 4OI1A 1HI1A 2CDQA 4K4YA 5C24A 2QV6A 1VQMS 4YFUA 3J7A1 1SH3A 5K8MA 3SYZA 2GHVC 3HT3A 1X4AA 3M6WA 4A48A 4N76A 4NMLA 1VBXA 4Y2CA 3QJJA 2D74B 1OO0B 2KKHA 4PXBA 4K4WA 4Y2KA 2K1RB 4J5OA 4RW7B 3LP1B 5E2QA 2H5EA 5E41A 2IJNA 2F8HA 3OVAA 3HZEA 5KG0A 1NJIT 2DR7A 2JC0A 2B6AA 4P6QA 2R8GA 2NR0A 4EZ6A 3PFOA 1P1TA 3V81B 2J5AA 5EX0A 2HRUA 4ELTA 1AFIA 3B8HA 1JNRB 2LXUA 3M8RA 2K8GA 1MROA 3ITHA 2QO3A 5IFMA 2ZHAA 2DT9A 1MSWD 3KLGB 3VR1A 2ZOGA 1H2TZ 3LANA 2AX1A 3UE2A 2F4VF 3FDSA 1NK0A 1HHTP 2Z2MA 1Q79A 2MY8A 1SL0A 3GG1A 4C7QA 1FCAA 3T5JA 2R8JA 5MLCV 2FY1A 4DR6F 1XR6A 4DL4A 3DLLQ 5I4MA 2MQNA 4IYQA 4J9PA 4LFBF 5EHHA 2UXDF 5M2UA 1TUVA 4ZVHA 4ZK7M 3KLIB 3DDKA 3WX4A 4O0IA 3OTBA 2XSFA 5KFTA 2ZZMA 3CCQS 3RR7A 1DTTB 3TNVA 4DQPA 4OI3A 4EBEA 1BY9A 1GT8A 1QSYA 1S7HA 1ZM4A 4IR9A 1JIHA 3V4MA 3CJ2A 2R7UA 4I6WA 1HPZB 1VBZA 2DPJA 2V94A 4O3QA 4BS2A 3OTOF 1DAXA 2UU9F 2Q79A 3KK2B 1HI8A 4MFBA 4I7FB 5HROB 1JJ4A 2KT2A 5J2QA 1QLNA 1EP4B 2ASYA 2BZ2A 1A6LA 3BF4A 5M2PA 3H20A 4Y6IA 2IM3A 5EGYA 2G0CA 2K1RA 5HN0A 1U6ZA 4RW7A 2DO0A 2RS8A 2MZQA 3BJYA 2ZH8A 4IKAA 3RRHA 3HO1A 5I3QA 3U02A 4G3IA 4IRCA 1XMQF 3THTA 4I68A 3WDOA 1F0XA 2YX4A 3BN4A 1MMLA 5KT5A 1XEZA 2UV8G 5KT2A 3OL6A 2MKHA 3DHWC 2OPQB 4A47A 3KLGA 3OTCA 2BE2B 4KSEB 1QY7A 2RUGA 2YH0A 2GO9A 5D4PA 2KJWA 4B08A 4DR1F 5HLFA 4OHZA 3KLEB 4TLRA 4U7UK 1VHFA 2E29A 2ZKTA 3CPWR 1UVKA 4A8WA 4EWTA 1C4CA 1XR5A 3OXFA 2K3IA 1ZBTA 3KLIA 4EYIB 3CD6S 4QPXA 2M70A 3P96A 4KC5A 1KOHA 2F3JA 1DTTA 1IR0A 2LLZA 2YNIA 3CVKA 3PKYA 2XY6A 3N6LA 3R1HA 3IWNC 3M6VA 4LFCF 3PNIA 2EBEA 4AL6A 4YOEA 2B7CB 4IQMA 5AXLA 3N5FA 3PY8A 1FRKA 2MQLA 2R2TA 4TQSA 2GQCA 3FQLA 1HPZA 4KBIA 2HW3A 4KHRA 4C8NA 3IN5A 3KK2A 5LXRA 5HROA 1L3TA 3DYAB 1VLYA 3M1VB 4MJKA 4QZVB 3BO4A 5KFLA 1G2EA 1WTFA 1EP4A 1N5TA 5CQGA 2PSZA 3L