3VAIA

Structure of u2af65 variant with bru3c5 dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vaiA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vaiA02
2BZ2A 3Q2SC 1DHMA 2DNQA 4C7QA 3MUVP 5HO4A 2FHOB 2JWNA 3VAMA 2CQBA 5LSLA 3UWTA 2MKKA 3SXLA 3S7RA 1CVJA 2L08A 1U6BA 1SJQA 3B4DA 3TYTA 1QVFR 2CQDA 2ZJPQ 1X5SA 2V94A 1WG1A 2N82B 3J7ZT 3FEXB 2AYEA 2CQ1A 2FPHX 4OZ0A 3G6ES 1VC6A 3ZZYA 5HL7Q 1X5PA 2FC8A 2E5JA 1RKJA 2KHCA 1JJ4A 1VQKS 1PGZA 1L3KA 1WG4A 4IUFA 2QEXS 2MKCA 5JVHQ 2EVZA 4BS2A 2YTCA 2HGMA 3LPYA 1N88A 4LIRA 2NZ4A 2MZ1A 2CPZA 1KOHA 1YTYA 2M0GB 2RU3A 4QU7A 3CMAS 1WWHA 2DNZA 5LSOA 3D2WA 1A9NB 1X4HA 1D8ZA 1X4GA 2OTJS 2RRAA 1ZH5A 2PE8A 1RK8A 2LA6A 1AUDA 1K9MT 3TP2A 3BO3A 1BY9A 1VQOS 1VQ7S 3I56S 1SJFA 1N54B 2E44A 1YJNS 2I38A 3UD4P 3SDEB 2DGVA 3R1HA 1WF0A 2LXIA 2G0CA 4YOEA 5LJ3Y 2LXUA 4CH1A 3MD1A 2DGWA 3ULHA 2RS8A 3G8TA 2HZCA 2JVOA 2RRBA 3R27A 1ZZNA 1X4FA 2MZTA 2CPDA 2CQIA 5D78A 1D9AA 2MZJA 2DK2A 1X4DA 1U1QA 1WHVA 2YKAA 3I55S 4CIOA 4Y0FA 2OTLS 2A3JA 4WIIA 2M7SA 3UD3P 2HVZA 1KOOA 2KRRA 1DZ5A 1KD1T 1WEXA 3LQVA 4A8XA 4WFNQ 4PR6A 1YWXA 4IOAQ 2LYVA 4UY8T 4YB1P 1H2TZ 3CTRA 2KG0A 5H1SV 1KQSR 2YWKA 3CUNA 3Q2TC 2OIHA 3ZZZA 2J0QD 3P3DA 2HYIB 2YH0A 2DGSA 3THPA 2DH8A 4V19X 1VQPS 2J76E 2DGTA 2MHNA 3CCMS 3VAJA 1X5TA 1F9FA 1FO1A 3EX7B 1WG5A 2XB2D 2EK6A 1WF1A 3CC4S 1NO8A 1FHTA 2PEHA 2KI2A 1WHWA 5CA5A 2CQPA 2O3DA 4IOCQ 2L9WA 2DHGA 3CCRS 1U6FA 2AD9A 2M8HA 2ZJQQ 3EGZA 3G9CA 4QQBA 5DETA 2XS5A 1DRZA 2LQ5A 4Y00A 3V4MA 1U1KA 2EK1A 3IWNC 2DNKA 2CJKA 3S8SA 2JX2A 2KM8C 3VAKA 3VAFA 1PO6A 1VQMS 3CCUS 1Q81T 1N52B 2LCWA 3TO8A 2MXYA 1DBDA 2E5IA 4TU9A 4W92B 1JJ2R 2M8DB 1UP1A 1FT8A 3VAGA 2CPFA 5GADU 2YH1A 1VQ8S 1U1LA 1VQ6S 3NMRA 2KRBA 3U1LA 5LJ5Y 4ERDA 2MZRA 2K3KA 1QVGR 3VAIA 2XNQA 1WELA 1SJ3P 5GMKa 1SXLA 4FXVA 2DHXA 3G71S 4LJMA 4WKRA 3CCSS 3CULA 4WF9Q 2K8GA 3RW6A 2VOPA 3U1MA 1U1MA 1HL6A 2F9JA 3UCUP 3OW2R 3CC2S 1JJHA 4WFAQ 1YHQS 2BOPA 1WEZA 2MYFA 5D77A 4F26A 2DNRA 4J5OA 4F02A 1OIAA 2E5HA 1VBXA 1K73T 3B4MA 5CXTA 2MQNA 1VQ5S 1G2EA 2DNGA 2LMIA 1Q82T 2J8AA 1VQ9S 1OPIA 3CCLS 4TU8A 5MLCV 3MI7X 3PIPQ 2CPXA 3J7YU 3JB9k 2MQOA 4PRFA 1UAWA 2CPYA 3K0JA 2DGXA 2OJ3A 3CPWR 2ADCA 4ED5A 2ERRA 2SXLA 3CCJS 2DNLA 1SJRA 1Q7YT 4RU2A 4W90B 2MKJA 2RT3A 2MSSA 2RUGA 1WHYA 2X1GA 1YIJS 4EGLA 2DIVA 4F25A 2VONA 1WF2A 1QM9A 1FNXH 2DB1A 2LEAA 5BJRA 3CCVS 4UQTA 1H2UX 1M5VC 5FJ4A 5DDPC 2DGQA 1HD1A 5GVQA 1IQTA 2B0GA 5IFMA 2RS2A 2J0SD 1VQ4S 2CPJA 2DIUA 2HGNA 2CQ0A 1SJ4P 1X4EA 2U2FA 2DITA 2D3OR 4QPTA 3VALA 1R8HA 1VC0A 2D9OA 4QU6A 3H2VE 4P6QA 2GO9A 1FJCA 3FEYB 2MZSA 2KG1A 2QFJA 2F3JA 4PKDB 1FJ7A 3CCQS 3S6EA 5IM0A 3UCGA 2MZQA 3MUMP 1K8AT 2XS7A 3S01A 3NNCA 2DHSA 4Z2XA 1JMTA 1URNA 3EGNA 3P5TL 2CQGA 5IQQA 2CPHA 3SMZA 3IRWP 1N8RT 1M90T 4TLQA 1A7GE 1X4CA 2OSQA 1FJEB 1VC5A 2DNNA 3NS6A 3BEGB 2DNMA 3US5A 3P6YC 2DNPA 2JVRA 1WTBA 2KFYA 3MOJB 3DXBA 1WHXA 1W2BR 3CMES 4WCEQ 5DM6Q 1O0PA 1YI2S 5GAGU 3MURP 2X1FA 2JRSA 2I2YA 2KXFA 2MQPA 2QA4S 5DM7Q 2CQHA 1U2FA 2LEBA 3RW7A 2MJNA 2GHPA 3P49B 2M70A 2KM8B 2RQ4A 3CF5Q 5GAHU 2DH9A 2MGZA 4IO9Q 2LKZA 1R8PA 1U1RA 2G4BA 1VBYA 2AYGA 2MMYA 1UFWA 4CH0S 3CC7S 1M1KT 2DNOA 2OSRA 2MSTA 1M5PC 2WBRA 2DNHA 1XN9A 2CPEA 2ZJRQ 2VODA 2M88A 1FXLA 2VOOA 2MQMA 5ITHA 3N9UC 1P1TA 3HI9A 3NNAA 2N3OA 1WI8A 2CQCA 3MD3A 2MKHA 1VBZA 2CQ3A 2XS2A 3CCES 3G8SA 1B7FA 2MY8A 1S72S 4C4WA 4CQ1A 2LA4A 2G1DA 2U1AA 5CYJA 1M5OC 2DGUA 3HHNB 3CXCR 1U1NA 2MKSA 3MDFA 2DGOA 2N3LA 1Q86T 1U1OA 2DO0A 3MXHP 1P27B 1OO0B 2M52A 3H2UB 5JVGQ 4FXWA 1ZZFA 4LMZA 2CQ4A 3VF0B 3UCZP 2KYXA 2MQLA 2RQCA 3MUTP 2E5GA 2N7CA 2AYBA 2X1AA 3PIOQ 5LXYA 5IM0B 2RVJA 2MB0B 1WI6A 1X5OA 2M9KA 3NNHA 5DDQC 1YJWS 1YJ9S 3NS5A 1S79A 1M5KC 2MJUA 3UE2A 2FC9A 4M5DB 4OZ1A 1UW4A 3BS9A 2MQQA 2UP1A 2X1BA 2XSFA 2KT5A 2M2BA 2L41A 1WEYA 5DDOC 2LECA 2DO4A 3G4SS 2AYMA 1U1PA 5DDRC 3VAHA 2ADBA 1VQLS 2KN4A 1X0FA 1KC8T 2MPUA 2MY7A 3BO2A 1X4AA 3SDEA 2HGLA 1OWXA 3THTA 4C0OC 1HA1A 2KXNB 2CQ2A 2DH7A 4WFBQ 2DNYA 4ZKAA 1H6KX 2KU7A 2CPIA 3L3CA 2KXHA 1H2VZ 2F9DA 5GAEU 5LXRA 2KH9A 2DHAA 3G96A 4TU7A 2M4MA 2XNRA 1HD0A 3DLLQ 2FY1A 2MGZB 1X4BA 1NU4A 2Q79A 4U67Q 2DISA 3CD6S 1YITS 2RNEA 1NJIT 1VQNS 4YUDA 5EN1A 2D9PA 3R1LA 3BO4A 2KVIA 2MKIA 2NLWA
chains in the Genus database with same CATH superfamily
1VFJA 1S9EB 2XMJA 1UJ5A 4CT8A 1S1WB 2JWNA 4ECQA 4X64F 4FYDA 2GQCA 4G1PA 3D67A 4GRSA 1FF2A 3P4UB 1TMMA 4OJHA 3KLEB 4JBCA 2R4FA 5B0DA 3QGPA 2E5JA 1NK0A 2ZM6J 3FCHA 4P74A 4EO6A 2WVEA 3HVAA 5L9XA 1TU0B 2M0GB 3CMAS 3QO9B 4ZLJA 4ILMA 3MEGA 1X4HA 4BHQA 1AUDA 1XBWA 2GGPA 1BY9A 3OUYA 1C1BB 2V8DA 1UVJA 4EO8A 2EFGA 5KG3A 2PFFB 4NXNF 2AWZA 3NS7B 2HNDB 2DGWA 2PEBA 5IV4A 3GJSB 3KG0A 3B82A 2QLWA 2MZTA 5KFZA 1RTHB 4DPUA 1D9AA 4LSZB 4PWWA 1NLKL 2Y3YA 1AXQA 2ZH2A 1OJ4A 1YWXA 2NUHA 4PG8A 1RHJB 3PJWA 4DUTA 4NLQA 3UR3C 4OZ5A 2UU9F 5C25A 1SL1A 4ED6A 4YFUA 2DHGA 3UN5A 2M8HA 1ZTWA 4P2FA 1OY8A 1D8YA 3LWMA 1Q0NA 2EK1A 1HQEB 4DQRA 4HH1A 4CP5A 2FJWA 2DD8S 2XY5A 1PO6A 2YY3A 2E9ZA 2MXYA 4W92B 3LP0B 5L1JA 4EUVA 3QGGA 2YPZA 4LFAF 3PV8A 2C1EB 2WW4A 1OQ6A 1Y5IB 4OI0A 1NH8A 1RAOA 3RW6A 1GTEA 5T7LB 1HHSA 2JEGA 3OLAA 3A8JA 1FXRA 3A1YG 3T1HF 1R6YA 3CD7A 5E3AA 4GVBB 3D6TB 1IKXB 3PG9A 4HI2A 3T1YF 3NWGA 2J7UA 1R3NA 4OI6A 2R7UA 3CCJS 3EJMA 2DVIA 2RUSA 1SV5A 3M2UB 3KTQA 2K06A 4IFVA 3KJVB 2UVUA 2H3EB 3BQ1A 1RT7A 1VBKA 1SH3A 5IFMA 2J0SD 3J7AN 5CABA 1VC0A 5G0RB 2GO9A 2UXCF 3MM8B 2QFJA 4L73A 4K4WA 1GMUA 2DHSA 1URNA 1RLDA 1ZETA 1M1GA 4DN0A 3FBEA 2R2UA 1VC5A 1PG5B 3PW5A 2A2DA 4P71A 3HD1A 3DXBA 3D3BJ 3NMAA 2EFNA 1HNIA 4MFBB 4CDIA 3MM7B 3OD2A 1RHKB 3LWLA 2ZH3A 5KFTA 4E8UA 1R8PA 3LOUA 1KDNA 4F4XA 4DV4J 2VODA 4MH8A 3TZZA 2G0JA 2DCLA 2CQCA 3OSNA 4A48A 2AJQA 2IHR1 2XO7A 3FDSA 2DYAA 1VRTA 3J80Y 1IXKA 1A6LA 3Q23A 1U1NA 2CJXB 3HZGA 4GKJJ 1W25A 2Z8QA 3AD7C 1QUPA 5EGYA 1XNQF 2N7CA 2H51B 5AJ3F 1AZSB 4NLDA 3QT7A 4KO0B 3MPVA 3V6JA 4NLWA 3TWZA 2W25A 2QMUB 3HHLA 1X0FA 4X4UA 1RACB 3K5LA 1T05A 1HNZF 2HNZA 2V34A 4KFBB 3C16A 3T5HA 4DV5J 3UN2A 3PACA 2RDJA 3DM2A 3D6MB 1RT6A 4LBPA 4ED8A 4JI2J 3R5AA 4QIVA 2UXBF 2ZHBA 2JEIA 4DN9A 1AA1B 3VGSA 1REVA 2WVFA 4MKAA 2BZ2A 1LW0B 2LQ9A 4HHJA 3PJ9A 4NA3A 2KJVA 5ETLA 1WDTA 4P73A 2ZHAA 1R8AA 4RUHA 1UWBB 2XMTA 2UUTA 1WG1A 1JLCA 1DQAA 2C2KB 1JJ4A 1FJGJ 1Q78A 4LF2A 3A8KA 3RAQA 3MHYA 1QAXA 1H7WA 9ATCB 3G87A 1NM2A 1ZPWX 1MROB 4IO1A 2VJUA 3H5XA 2ZHOA 3D2WA 1O5JA 4USKA 4ZLPA 3NKYA 2J7WA 3P96A 4Z7CA 1DURA 2RDDA 3V81B 1SJFA 2W1BA 3Q8VA 3KK1A 3UD4P 3R1HA 3FSXA 2UUBF 4WK1A 4JI5F 2C2ZB 5C42B 4ID8A 3MEDB 2HZCA 4PXEA 4EK2A 1T8EA 2AW0A 2UV8G 3DHXA 2CPDA 5IT9Y 2CQIA 1LW2A 4ED0A 4BLGA 2E66A 3ENVA 4WPAA 2M7SA 3GFXA 3UNGC 2IFXA 1MU2B 4LRFA 4L3KA 4FZVA 3RBXA 1KQSR 3HVTA 1WDDA 5KFQA 2W9BA 5H9EK 1JXLA 1ZBTA 2W8LA 1WG5A 2XGQA 3EZUA 4OYMA 4F0MA 1UW9A 5J2NA 2YQ0A 1RYSA 2XHWA 4EWTA 2ZDOA 5KFLA 1ZYQA 2CJKA 2XGPA 1GMVA 4ECXA 2UZAA 2PDAA 3CCUS 1TUWA 4NMLA 2W8KA 4CLZA 2HVHA 3PX4A 1PAUB 1S6UA 4UQGA 2K1RA 2POKA 3U1LA 4XPEA 4HR2A 3HSGA 1U48A 2FD2A 3DLHA 1VS3A 1SJ3P 1TUVA 2FY8A 2IIHA 3I0SA 4WF9Q 3KMQA 4KJIA 2W7OA 1EJ7L 2YWFA 4L72B 2E5HA 2MQNA 1IKYB 3CCLS 4A4JA 1H98A 3BDPA 2IA6A 3K0JA 2IVFB 1YJTA 1S77D 4X66J 1N33F 1SQEA 5CCLA 1X60A 1DAXA 2NUUG 3N6LA 3OTCA 4ZA1A 3QNWB 5CD4A 1T95A 2DJWA 5ETQA 4D3HA 1S9GA 4F2RA 2NXEA 4DR6F 3A3NB 3M6UA 4UQTA 2B4VA 2OO4A 3UDVA 1IQTA 3BSAA 2ABYA 2CQ0A 2Z2ZA 3VALA 2D9OA 5KG7A 1UVKA 3HK2A 4P6QA 1FJCA 2MZSA 2CJBA 5C7PA 4USJC 2MZQA 4C8NA 2XS7A 3S01A 3OR1A 5A2QY 2KO1A 4Z2XA 3JTPA 4ID5A 3K17A 3MMAB 2YX1A 3AA8A 2ZE2A 1HI0P 5D4OA 4F50A 5D0GA 4M95A 1LWXA 2X3GA 3P6YC 3D68A 4A8SA 5D15A 4YB5A 2UUWA 1YI2S 3OL8A 3MURP 1FK9A 1R0BG 4NCAA 3KHRA 3I96A 4NXNJ 4NWBA 4MK7A 2HK3A 1BE4A 2BKOA 4CH0S 4S0MA 4O44B 3CC7S 1M1KT 2WBRA 3EWGA 5ETPA 5HANA 5F8JA 2BJDA 3CCES 4DSLA 3NL0A 4M94A 2MY8A 4U96A 2VZ9A 3AOBA 3TA2A 4GO7X 2ZD1A 1FKPA 4EYIB 2BE7D 4RW6A 2Y8YA 2JEFA 3MXHP 3AOAA 2FHMA 2F40A 3UPFA 2HHSA 2MQLA 4YN3B 1HR0F 4DBQA 1B70B 1JLEA 2UU9J 1IM4A 1S4EA 3PIOQ 1JLBA 3R5GA 5LXYA 5HK4A 3NNHA 1VI7A 5DDQC 2WB4A 3V2UC 2DXFA 3M8PA 1CSJA 2PMHA 2L41A 2W2MP 1WC5A 3BBFA 1QLNA 2HIQA 2P9EA 2ZDPA 1S1XB 3I31A 4BWMA 4LFAJ 3H7HB 3MAAA 2OAUA 4J9SA 2GAHC 2L3MA 2IAJA 1X9MA 1VJWA 2CA9A 1U6ZA 2DR9A 1BXNA 4ZLNA 4LF1A 3T1HJ 1JQGA 2KVIA 1RA6A 3PNIA 1FWPA 3V6DB 1KTVA 5ETSA 3CO0P 1CULA 3T1YJ 4XO0A 3KKFA 1V3SA 1SJQA 3EPIA 4OZ0A 1RUSA 2J7KA 3HX9A 2G2OA 1Q8LA 5H9EJ 2KL8A 4WYWA 3M9OB 4KV8B 1N88A 4NLTA 1HBNB 1LK5A 3W65A 4I2QA 1HWJA 4O4RA 3H98A 1YJUA 2VBWA 3M8ZA 4DLEA 3H59A 5I3PA 3MMBA 4B9UA 2UXCJ 3R5DA 5AE3A 5I42A 4DR3F 3AQOA 3TQ1A 4TY9A 3LGHA 2GVDB 4FKYA 4NI2A 2HVZA 1S6QB 1DFDA 5A8WB 4XTTA 2QSWA 1CS4A 1BUXA 4WKYA 3H20A 4B9LA 1WKLA 4PG7A 3WX4A 3THPA 3H40A 4DV3J 1ZM4A 3EUNA 5KFXA 4HH0A 1UWAA 4FP9A 2AJFE 1WF1A 1FHTA 4P2SA 4WXWA 3QBCA 1CC7A 4OHXA 5CHCB 5J2QA 3G9CA 4P2MA 2NXJA 2WVBA 4QIFA 2V4JA 2FLNA 1RSCA 1UPMB 4PUOA 3MEGB 2GGPB 3PFEA 3OUYB 2MEWA 4AE5A 2CRLA 1S0NA 2JLEA 5A0YA 8AT1B 7FD1A 1XNQJ 1WELA 3HDSA 1DTQA 1W26A 1T3NA 5AJ3J 5SUHA 3A3PB 2PC6A 1NRKA 1WEZA 2O67A 1H3DA 3MAHA 4IRKA 1IWAA 2UXDF 3BYPA 5FLXY 1HW9A 2GMHA 1KBRA 2HHPA 4TU8A 1ZM9A 3MI7X 3NGKA 2ROEA 2F8HA 1HNZJ 2AJ2A 3ZZ0A 1DARA 3HVWA 5LSRA 3M1VA 2RILA 5DQIA 1U4BA 1PIEA 1U26A 3OFGA 1F3FA 2RT3A 5C25B 4NEYA 4BCAA 1IR0A 2UXBJ 1SH0A 2FYXA 3CDEA 3JAMY 5FIIA 5ADZA 1HWKA 1SJ4P 2U2FA 2FJVA 2O01C 5KG0A 4G3IA 4B9NA 4PKDB 1ULRA 4PXDA 1Q8BA 1K1QA 1EHWA 2DXDA 1L3TA 3UCGA 2RH3A 4CLKA 1K8AT 5DRKA 3KUEA 5D0RA 5IQQA 2RF2A 3H42A 2OSQA 2N7YA 1NB7A 3US5A 1BLUA 1WHXA 2M3DA 4EYHB 2CAJA 1HQ2A 1TKZA 2FJAB 2V2VA 2QA4S 3I5BA 2YKMA 2GW8A 4NXMF 2P5VA 3PEJA 4AYBD 2GC8A 2BE2A 1UFWA 3P5BP 1SV5B 4ES1A 1QAJA 3HHLC 1FD8A 2JJ4D 2MQMA 2ZNZA 3VZIA 1HBMA 5KAKA 4IFVB 2G2YA 1D1UA 1RT7B 3EICA 1S10A 2NREA 3GMGA 1TVRA 2ZWPA 4TKTA 2PN6A 3HMJG 4ZPDA 1MN9A 3SI8A 4USIA 2KT2A 1YJWS 3JTOA 2DCUB 5HROB 4X4SA 2EC0A 2F63A 1XIQA 2CKWA 2VPWB 2ADBA 1VQLS 4DFKA 2MY7A 4J9KA 1RAEB 2FGCA 3SDEA 3PXGa 3QZ7A 2WVDA 1CQMA 1HNIB 1HA1A 2XWXA 2QA2A 2DH7A 4DXLA 1BMQB 2VJVA 2CJAA 5L1LA 4TU7A 4K5RA 3D3CJ 2NPFA 1FWLA 3GYGA 4R25A 3DOLA 4JI1J 3AQPA 2KFZA 5KT6A 3SBMA 2DNQA 1LWCA 4N7TA 3T1AA 1VRTB 1L3UA 1QVFR 4ILRA 4UT4A 1PC5A 2HSEB 3PRVA 2AYEA 4DPYA 4ZJLA 3M05A 3ICLA 2KHCA 4I4BA 4LRCA 4OYWA 4N56A 3AFGA 3MFHA 2NSBA 4DR6J 1S6OA 1FRLA 4MKYA 1VQ7S 1N54B 3HHLB 2OFGX 1U2RA 5HAOA 4IG0A 1JXVA 4JB8B 2DGVA 4WFZA 4PG4A 1T05B 2HNZB 1EETA 1F2HA 3C16B 1L3SA 3N28A 3NEKA 3DM2B 4HL9A 3L09A 2VL1A 3HHKA 1RT6B 4AL6A 1WHVA 3NOCA 4KB7A 1BQMA 1AROP 4KHMA 1TV6A 1REVB 2M5YA 3O1LA 3OTEA 4WBFA 3DOMA 5AE1A 5H1SV 2D7SA 5KFFA 2BQ3A 2J0QD 2IM1A 3FQKA 4ITSA 3H8YA 1WOOA 2JFDA 3NGSA 3PRBA 3CCMS 1JLCB 1FRXA 3EX7B 1NDPA 3N6NA 4KKOA 2L9WA 1FESA 3NAHA 2BJ3A 4H4KA 4HDGA 3V4MA 1HWIA 2VFUA 1TK0A 3VAKA 2ZOMA 2WRMA 2NYHA 2AMCB 3BPDA 1JWWA 3T41A 3UNYA 1R7IA 2B8PA 3KK1B 1SIWB 4Y2CA 1DJ0A 3AB4B 5GMKa 4QWDA 4WKRA 3IAM9 1HL6A 3ZZRA 4ES3A 5F0UA 4XDCA 4WFAQ 1LW2B 1UL3A 4LBIA 3H25A 4BC9A 4IYQA 1D0EA 1VQ9S 1CJTA 4PZVA 3HVTB 2W9BB 2OJ3A 4ED5A 2ERRA 1GQEA 4RW8A 1SJRA 2RB7A 1WC3A 4OI3A 2FGOA 1WKJA 5J2NB 4PG5A 3BN7A 1AYEA 4OYIA 1ZM3A 3SSQA 4ALZA 5ETOA 4N41A 4NA1A 4WFYA 4AD6A 4FDFA 3GZ7A 1CJUB 4QR1A 3DU5A 1QDUB 2K1RB 2EW9A 3CCQS 3S6EA 4OHVA 4DPWA 1CEZA 3NCPA 2NQPA 1KQKA 2RDIA 5KFIA 2B9XA 1ITPA 1JMTA 3I0SB 1SI9A 4FN5A 3T9ZA 1G1XA 2CPHA 5F41A 3PYFA 3DOKA 2GV1A 1S57A 3WIUA 4LUBA 3CMES 3BGUA 2BM0A 3Q89A 1SCJB 2HHHF 5KFNA 3M8SA 3P49B 6FDRA 3PKMA 4Y2IA 4DR3J 2MMYA 1SJ1A 3NG8A 2PGCA 4CLPA 2DNOA 2ZH1A 4J9VA 5I3QA 2CG8A 3MF5A 4DG1A 3TQEA 1VBZA 3PM9A 4OMFG 4RNFA 3UDEA 3FSIA 1S9GB 3QRPA 4C11A 2E1RA 2Z58B 2U1AA 3JQJA 1MG7A 1UFLA 1ACMB 1MMNA 2UUAF 3BSOA 2J9DE 1YJ7A 4EBDA 2AEMA 3UCZP 2R8HA 2ACMA 4HTIA 2AYBA 3W9JA 3QGIA 1OSCA 2PIIA 5CYQA 2ZOGA 4NLVA 3OR1B 4LF7J 1YJ9S 3NS5A 3BN4A 4M5DB 5AXNA 4ID5B 3AD8C 1AT1B 5HVFA 2A2CA 2X1BA 2G13A 2ZE2B 3L4BC 3NY0A 3GP9A 4ANDA 1V3RA 1LWFA 4DU8A 1S12A 2CQ2A 1FK9B 2L48A 4HVZA 2F9DA 1S1TA 3VV2B 2RD5C 3UDCA 4B3MF 2OHDA 4DJBA 2ZITA 3L7OA 2DEIA 2FVPA 1PJ6A 4X65F 1BD6A 2VPZB 2J0WA 1FI4A 3HKZD 5C2CA 4NASA 4AXIA 1TAQA 4ZP9A 4LF4F 1BQNA 2UXDJ 2D41A 1VOMA 1UETA 2ZD1B 1FKPB 1U6BA 4RW6B 1LKZA 3WX8A 1PGZA 1L3KA 4QYZK 1JLEB 3OPKA 4Y65A 3I4PA 1JLBB 1UEUA 4UOGA 3LPYA 1UVIA 3CSKA 3IR5B 4M5LA 3M8PB 1SKRA 1RWPB 4ZIVA 3T19A 1PSDA 2CDQA 3LAKA 4ZCLA 3OL7A 3QWPA 3MAAB 3VQTA 2Z57B 2QRRA 3PHTA 4FYVB 2IAJB 3OTOF 4TXSA 4JI8F 2ALYB 2I8EA 2IRYA 1X4DA 1U1QA 1SL0A 2V8VA 5BXIA 2MLXA 3BDEA 1NHVA 5EX3A 3AXMA 4MJKA 4OYZA 1MMDA 3I9V9 2KVQE 4K2XA 4URQU 4PEOA 1CULB 3CD0A 2E1AA 4M8LA 4NXMJ 2LLZA 3MM5A 2CJYB 4J9NA 2KI2A 2JDJA 2CQPA 4TNOA 4ZVPB 2AD9A 4HEA9 2ZJQQ 5DETA 3CB4A 3D0HE 4Y00A 2ALZA 3MTKA 2KM8C 3VAFA 3UFCX 3OBIA 4I2QB 1CLFA 2V8PA 2PO4A 2E5IA 5GADU 4KRWA 4A46A 4MAKA 2GS8A 3QSYB 3MMBB 3SV4A 1FD2A 2MZRA 4BBYA 1WC4A 3KXDA 5ETMA 1H38A 4Q8EA 3W66A 4USVA 1Q16B 5I42B 4I69A 3I4HX 4R8UA 1T3OA 2EWHA 4NI2B 1F9HA 2HHXA 1K73T 1QUVA 3W61A 4YEAA 1OPIA 1S1WA 1CS4B 1J5EF 3O5TB 1NK9A 1DTTA 1GX5A 2W01A 4I64A 4U9RA 3CPWR 4AL7A 3T5JA 1RA7A 1S0MA 4G1QA 2C2DA 2WTFA 4LQ3A 3L95X 2VONA 1WF2A 3IM8A 5GAEI 1FNXH 3AHPA 2E7WA 4HI1A 3CCVS 1NK5A 4DL7A 2FDNA 2V4JB 2YNFA 4PUOB 2RS2A 2XULA 2YKNA 2CPJA 3FRZA 2VKRA 1D3WA 2I0XA 3PFOA 2CNOB 4LR8A 1UZDA 5A0YB 3E51A 1DTQB 1FKAF 3NNCA 4EZ9A 5KG4A 1D9FA 4ZLLA 1WC0A 2F65A 2EFPA 2HPUA 1OPZA 2JVRA 2QX0A 5KOWA 3FCWA 3WC2A 5GAGU 2B9YA 4O3RA 5JUMA 2ZBRA 4NZ0A 2FZKB 2VG6A 1Y11A 2KM8B 4DOZA 2R8KA 3KFWX 5GAHU 2VV5A 4UOHA 2NXUA 4IO9Q 2WW8A 2EG1A 1S59A 2AYGA 4QWAA 1R89A 1RHQB 3M1VB 3O8WA 3FK4A 2BQRA 3CT9A 1KS2A 1RCOB 4Q0BA 2J6SA 2F7VA 4Q2LA 1F60B 4D3GA 3ZTRA 2Q3PA 1UTAA 1KP6A 2Z2MA 2Y1RI 4IH5A 2HMIA 7AT1B 3C66A 3WC0A 2DGOA 2VG7A 1OO0B 2EBEA 2VQEF 1VHFA 3FZ2A 3W2VA 1HW8A 5BYSA 4NLRA 2E7XA 3L7UA 4RUCA 3OHBA 4LRDA 4QYZJ 4FKXA 4TN2A 3FC9A 1XJWB 3PY8A 4IDKA 2OP5A 3K5MA 3BBCA 3EDRB 3W3SA 2BABA 5DDRC 4X4NA 3BH7B 3CJ8A 5DQHA 2ZZTA 1KC8T 2V69A 3BF4A 3CCTA 5F0WA 2ZZNA 1TKZB 3ENAA 1PILA 4C0BA 2R8JA 1N5QA 2YKMB 2GHWA 3GR0A 4IRCA 1HD0A 4DZ6A 3DLLQ 2ILYA 2DISA 2BE2B 3BKUA 2DR6A 2RNEA 4MIBA 3QRQA 2QG9B 1J5OA 3IBFB 2MKIA 3JQKA 5L38A 1HBMB 4USWA 4EFAC 1N48A 3EGWB 5I3UA 4RWWA 1VGYA 3S7RA 1TVRB 1TR0A 3FEXB 1FERA 1VC6A 3HT0A 2KYZA 1EQMA 3MM6A 1WG4A 4CO4A 2QFIA 2OFHX 2C3UA 3KUGA 1N34J 4J9QA 2PFDA 3OXFA 1F5AA 2CPZA 2P8IA 4H4OA 4O0IA 2DNZA 2L9NA 3EZOA 4Y2KA 5LSOA 3KHHA 2E5LJ 3BO3A 4AT1B 3DRSA 4LT6A 4YDXA 3MPWA 4I7FA 4KPYA 3SDEB 1SH2A 3CIMA 4C2MA 4QWEA 1YVFA 2HAIA 4DL6A 5LJ3Y 2LXUA 4CH1A 3Q8YA 1UKUA 3KUHA 4DPXA 2RJZA 4H4KC 1FTRA 4C8MA 1NJXA 3R27A 3EXCX 5D4NA 3I55S 2V8HA 3DOLB 4DHVA 1PBUA 4DQQA 4N77A 3LQVA 3HO1A 4UY8T 2CZ9A 3BKFA 1LWCB 4JOUA 2OPSA 2YWKA 3H5SA 2YKQA 3ZZZA 3KK3A 2HHHJ 1FVSA 2DGTA 2HFVA 2ZC3A 2W2OP 2XB2D 2YNIA 4OV1A 2XC9A 2HHQA 5CA5A 1BWVA 4OIXA 1QSLA 4IOCQ 3PYEA 4YQWA 3QSIA 2KZZA 1WTFA 2H9ZA 4IKAA 4LVNP 2W2PP 4KGMA 2R7VA 2YQ1A 3OVAA 1IM6A 2BUNA 4C6AA 4DQIA 1P9YA 4TU9A 4KGVB 1JKHA 4IG0B 2KRBA 4DR1F 5KFRA 2IVYA 3DRXA 4LF9F 1DQ8A 1TKDA 5B0FA 1EETB 4DL0C 3NCQA 3OW2R 2BOAA 5IOLA 3LUYA 3OVBA 2OI2A 4CH7A 2EPIA 4RR5A 2MYFA 2Y1LB 1R8CA 3L9ZA 2W4PA 5AXMA 3B4MA 1BQMB 4ZVEA 1TV6B 2HZVA 3RRKA 1XWLA 1UCNA 1KR4A 5L1KA 2CPXA 5DLFA 3LW5C 1B4SA 4RW4A 4KPCA 5F8IA 2W9CA 2DNLA 1S5ZA 4B3MJ 4TY8A 4C98A 1GH8A 2JC0A 4KKOB 2V4RA 2LDYA 4X65J 4TYBA 5E3QA 1Q5YA 1PYTA 4X4QA 3KJFB 4OHWA 1M5VC 1HD1A 1Y5NB 2QL7B 2VFRA 3KHGA 1XMOF 2BEFA 1K0TA 3GV5B 5EDWA 2XEXA 2I5JA 1NB2A 4ZOSA 1HARA 4J9RA 4PQUA 4ZMMA 5M2RA 1XTZA 2W24A 4JI0J 5BYQA 3BH6B 3M4XA 3EGNA 2Z2LA 1JNZB 4DR2F 1PCAA 4UUXA 1N4LA 2OPQA 1VYAA 1S97A 3TZYA 2R7OA 2ZC4A 4K0KJ 2KXFA 1CJTB 3BGLA 3RYLA 4RW8B 3OTOJ 4JI8J 2R2RA 1XN9A 4G6VB 4RLEA 1RISA 3BKTA 4UOFA 3DGPA 1HNXF 3MD3A 4ZHRA 5KFOA 5MAOA 3DLJA 5KFKA 3BGFA 5IT9U 2BW2A 2IY5B 3CXCR 1PAEX 3MDFA 3H4BA 3MECA 1KQGB 2VF3A 2R8GA 4CLWA 2C42A 2Q66A 3GU0A 2AZ3A 4B02A 4YR2A 3JQMA 3CJKA 1B0PA 5KT2A 2QLXA 3UE2A 2H54B 3DOKB 4JV5J 1N0VC 1WEYA 5DDOC 5DO2A 2VICA 5HBMA 1U1PA 2G9OA 4CNZA 4CTAA 1DQ9A 3EVOA 3THTA 2WK4A 2KXNB 1H6KX 2KU7A 1TP7A 2KH9A 1SKSA 2XWYA 3TVKA 1X0PA 4QIEA 4U67Q 3ISZA 2ZH9A 2AHOB 4YUDA 2CZVC 4ECZA 2D9PA 1HI1A 3KWMA 3PJXA 3Q8PB 4DG1B 2VFSA 1DHMA 3JS9A 2R7SA 4O3PA 4DL5A 5LSLA 4C11B 1LXNA 4DL2A 2ZUAA 4YDDB 4DR4J 1RDRA 3SYZA 5E2QA 5JVHQ 4I6YA 5CYQB 1U49A 4MT1A 2R42A 2Y0BB 3MMAA 1A9NB 5C24A 5F8LA 2HURA 3KG4A 3NGTA 1PJ7A 3TP2A 2VBYA 4DR5J 5B7WA 3U27A 3MMJA 2GMLA 1G6BA 1LWFB 5HSPA 2ACYA 4HTJA 2ZBQA 4NCBA 2G2ZA 5KFEA 2HLTA 1WACA 2VIHA 1X4FA 5J1EA 4LVOP 5HATA 1WORA 3CIZA 3MEKA 1B0VA 4LR7A 3AT1B 1QY7A 3MCOA 1NKEA 3KHLA 2XMAA 3C6TA 3LO3A 1F6TA 2CXEA 2ASDA 1BQNB 3CTRA 3TZWA 3VGUA 4CO3A 3CUNA 1TZ0A 2HYIB 2J76E 3PW4A 5ETVA 3CC4S 3H90A 5K8MA 5U47A 1IBMF 2F4VJ 4ED2A 1S99A 3ILJA 1N36F 2DNKA 3S8SA 4ZJQA 2QLBB 4YS2A 3J81U 4J9PA 2AQ4A 3CCZA 2VASA 1UP1A 3NLCA 3VAGA 3GLJA 1M1HA 1VQ8S 5ETKA 2GHVC 2WHOA 4XK8C 2B7BB 4DV6F 3AODA 4OX7A 3G71S 5A8KA 4KHPF 5L46A 4J7CA 4A8KA 3ZC4A 1D9DA 3PYDA 4KGXB 3BBBA 1YHQS 2IRXA 2DT9A 2HQIA 2DNRA 4F02A 4YB7A 1LWEA 5B0BA 3PTWA 2D3UA 3M9MB 4FBTA 2QA1A 4F4ZA 4FF1A 4NZ6A 4C0HA 2B43A 5IT0A 2HK2A 1JXEA 2GQ2A 1Q8IA 1YSJA 2D69A 3MM5B 2CWKA 1KKHA 3K7RA 2X1GA 5T14A 2IJRA 4F25A 3AB2B 4ZCKA 4ZVHA 4HKQA 3QGHA 2DB1A 2FHKA 3V6HA 5BJRA 2MHEA 2C3OA 4C3MA 1RP5A 1T0TV 2GZOA 2R3VA 1FDBA 2HGNA 2HKEA 4CI0B 4RUBA 4ED4A 4USUA 2HQDA 2R7QA 3T3FA 2J6UA 4ILLA 4F4AA 3G8QA 2KG1A 2HWHA 1YX2A 4RU9A 4RNNA 1GXUA 2DPJA 1IBLF 1K0VA 3ZFVA 3UQSA 3M2VA 1TL7A 3NCRA 1WKKA 4R8UB 5KT3A 2PT0A 3BEGB 2DNMA 2ZUGA 4I0WA 1KTQA 1RAIB 1LNQA 2R9LA 2LFVA 4C3LA 3C46A 4IRDA 2IM0A 3W5ZA 2MJNA 1DTTB 4MYUA 2M70A 4LF6F 2RQ4A 3EGVA 3JSYA 1Y7PA 3IXQA 2ZBCA 4G1QB 3ET6A 2OSRA 3EPGA 2CPEA 4DX8H 2M88A 2VDHA 2AKWB 3ETMA 4PAAA 2FJDB 4C4WA 2R7XA 5K8PA 2RMLA 2YNFB 2YWWA 4O3SA 4DL4A 2AIRB 2YKNB 3ONQA 3HKWA 2IRUA 4F04B 4MMOA 1GXTA 4U7UD 4RWXA 2HFUA 4PWUA 5KTQA 2E1MC 2E5GA 1T9YA 3BR8A 4CYUA 2UVVA 2IPOB 1U24A 2RVJA 1CQNA 2AF6A 4JP8A 1NHKL 2DRDA 4Y2AA 1YJVA 1XMQF 1U0HA 2KT5A 2M2BA 1RU2A 1NSQA 3NAIA 1SQFA 4J9MA 1RZMA 3BR9A 3TRGA 3M6VA 2HG4A 3AJ1A 4EBEA 2FVRA 3QAUA 2XCAA 4DR1J 4LF9J 2VG6B 2A6MA 2ASLA 4B9TA 3GWCA 2NYIA 3LP1A 3DCAA 3RB0A 1QD1A 2BJ9A 1CJKA 2C2OB 4Q0BB 3OTDA 5HMYA 4I1TA 4PG6A 2XZWA 3MUVP 1EIYB 5HO4A 1P6TA 2B9EA 2HMIB 5IC4B 1U8SA 3F73A 5EWGA 2CQDA 2Q6CA 2VG7B 3IWXA 3RB4A 1X5SA 1KQFB 2FPHX 2FC8A 3QQCD 4JV1A 5FLXU 3W2VB 2MKCA 2CJQA 4BS2A 1RADB 4RW9A 2YWHA 2RQMA 5M2UA 4DV1J 3VCDA 1Y0HA 2D3O1 1X4GA 1ZH5A 4FVCA 2PE8A 1PBAA 2LA6A 1EB0A 4I67A 4P10A 4IDKB 1VQOS 5LL6d 2RU9A 4C8ZA 3DYAA 2E44A 1XMOJ 2FTRA 2G0CA 1SUQA 3FFIA 2VH7A 3G6VA 3JAMU 1CC8A 1V9OA 5CQGA 3E2EA 1KWMA 5D78A 4BDPA 4LFBF 3R3TA 4DR7F 4ZN1A 4DR2J 1J5OB 1M5SA 3GV7B 3IWLA 7FDRA 3C2PA 3K2YA 4YB1P 3TJ8A 5I3UB 1FA0A 1RT5A 2ZH7A 3R8YA 1FDAA 1RI7A 3Q0AA 2MHNA 1HBOA 1NO8A 1WHWA 3MM6B 3PO5A 3UW1A 3CCRS 1K1SA 5IS2A 2XS5A 1RAAB 1HNXJ 5HROA 2ZZMA 3IWNC 4WP9A 1XR5A 4H4OB 4DUYJ 3NGDA 5AXKA 1TFYA 4DV7J 1VLYA 1P9QC 3TO8A 4ZJOA 1Q1KA 1IVZA 3DLBA 1FRIA 3DRSB 4GO5X 1U1LA 3LH2S 2R7TA 4I7FB 2K2PA 4CWBA 1Y3JA 1QVGR 4J90A 2XNQA 3I9ZA 3GONA 4WZMA 4LJMA 5SZTA 3CULA 4JI7F 2E9RX 1JJHA 4K50A 4TQSA 4I6WA 5D77A 1NUEA 3TVYA 1XNRF 3R2CJ 4PYAA 1NKCA 2DNGA 1FE0A 1Q82T 1UVLA 4KBIA 3IP0A 2B7CB 2OPSB 3EM1A 3KK3B 1R0CB 1RTIA 2B5JA 1QAIA 1GTHA 5ETTA 4NX9A 1VQSA 3IA0A 2YNIB 2P6TA 3OFFA 1GEHA 2BANA 2QGFB 3HP6A 4K4XA 2BKPA 1ZAXA 1BHNA 4F0KA 4QU6A 3DLEA 4DCJB 3HPOA 3DFEA 1JKHB 2Q6BA 3QYYA 1UPPA 1PKUA 1S1VA 3R97A 4R0EA 1OY6A 1KHVA 3U02A 4U7CA 1RWKB 4OL8A 4TLQA 1TK8A 2VB6A 3W9IA 1XK8A 4OI1A 2AJ1A 4ENOA 1W2BR 3OSPA 5AE2A 4Q2MA 4K4VA 3WBZA 5DM7Q 2VPXB 3PYGA 1N5YA 1T9TA 4ZVTB 4B9MA 2COLA 4RW4B 1RT2A 2W9CB 4TY8B 2MSTA 1HPZA 2ZJRQ 3BQ0A 1IJEB 5ITHA 3N9UC 2JLGA 5CD4H 1WI8A 2XCPA 4ZDNA 2WB1D 3IMQJ 1T9XA 4CLFA 3D1OA 3WHIA 1RBLA 4U8YA 1N56A 1IBKF 4Y28C 2FZCB 2W7PA 2OMLA 5E3PA 3ELHA 3GCXP 5K20B 4JYAF 2KYXA 3UVJB 2V8GA 2LXFA 3LANA 2I5JB 4OZJA 4PQUB 1RBOB 2KJWA 1IBMJ 4F4KA 1N36J 3GIRA 1B64A 1WSVA 1RB0A 3HSDA 3LAMA 2OH2A 3Q8QB 2OPQB 1GFWB 2MPUA 4ZVUB 2IYIA 4NRTA 1H74A 5FD1A 4WFBQ 4RZRA 3M6WA 3GFZA 4DV6J 2XNRA 1VR6A 4KHPJ 3PX0A 5FDLA 3Q22A 3QJPA 3ISND 4WTOB 2IDLA 4F67A 4CZCA 3DGPB 3QFWA 4ZHRB 3LA0A 4QBUA 3ZTSA 1IR1A 2H4YB 1F5BA 4URGA 2H4WB 2C2NA 1FEEA 1CVJA 1X31C 1CJUA 1T02A 4OLOA 3MECB 5HL7Q 1V5VA 4W98A 3Q8RB 2PSZA 3C15A 2EVZA 1URRA 3J7Z5 2YTCA 3OJUA 1YKWA 4WFXA 3CJKB 5E5NA 2RU3A 1WWHA 1D8ZA 2CJ9A 3DRPA 2DTJA 1X8DA 1KSPA 4B17A 5HBMB 5K8NA 1R27B 4CTAB 3JSBA 3W8PA 4A8WA 4DF8A 2HEKA 3LPEA 2JVOA 3NGRA 1IBLJ 2DY1A 1R31A 1LV5A 4WIIA 1DZ5A 2BDPA 1PYSB 2BE9B 2J6TA 5DLGA 1RT4A 1IBCB 4FPRA 5GMEA 4NYZA 5K14A 4X64J 2VC0A 4IFYA 2HHUA 4LF6J 2C2MB 2W4DA 2HFSA 1F9FA 1Y3KA 4EBCA 2EK6A 3H0PA 4RX6A 3PX6A 5B0AA 2C28A 3N5FA 3EGZA 1RU1A 1UEKA 3RAXA 1FVQA 2AZ1A 2LQ5A 1U1KA 4M5DA 1S1UA 1RABB 5C24B 2AEFA 3TJ9A 1N52B 2JHEA 4I2PA 2NXCA 2CPFA 3A12A 3TNVA 1B3TA 3I5CA 3Q86A 3ZTOA 2BW7A 1FFWB 2K3KA 3RBEA 4M1KA 4DSEA 1SXLA 4FXVA 2DBBA 3U1MA 1LOUA 5J1EB 3J81Y 3IR7B 4NZ7A 3GSIA 2Z0GA 2YKPA 4X62F 1Z1ZA 2ZKUA 4J5OA 2W2QP 1OIAA 3QLHA 3C6TB 4LF8F 3R6GB 4ES2A 3G6YA 3MGJA 4EEYA 3PCOB 1EX8A 4NPOA 4DV4F 3WQPA 2Y9HA 4B9SA 1EP4A 2MSSA 1VCTA 2RUGA 1NNDA 2XYHB 1Q7LB 2HRTA 3KLHA 1NH7A 1QM9A 1FRMA 2LEAA 4USHA 5HMWA 3Q8SB 2CG4A 4ED7A 2HVDA 2PI5A 3KOAA 2DIUA 1F2GA 3CD5A 1RWUA 4QW8A 3RUBL 4KAIA 4ER8A 3HHEA 2AV5A 2F3JA 4DMZA 2XMUA 3GJTB 3ILIA 2AGQA 4CM2A 1RT1A 3P45B 3E01A 4M5NA 3RU0A 2FLLA 5A8KB 5C2GA 1U2CA 3SQGA 1N8RT 4GC6A 3X3UA 3BQ2A 4U95A 3MOJB 1O6XA 2KTQA 4LREA 1RTZA 1LWEB 1U09A 1MWQA 4DV5F 4MIAA 4Y2MA 3RW7A 3RRHA 4JI2F 4P2XA 4YMEA 3R9LA 1M5PC 2QSFA 4LFBJ 3MM9A 4DR7J 3QJLA 2VOOA 3AA9A 3HI9A 1RAFB 3NNAA 4MIWA 2NR0A 3EVWA 4P72A 3GQCA 4LFCF 1VISA 1S72S 1HHQA 4CQ1A 2LA4A 2VUGA 3MR6A 2MKSA 1P8GA 2WSFC 1TL4A 1HNWF 4HYKA 2HZAA 3BM7A 1AFJA 4FXWA 3DRRA 1FJGF 2RQCA 3WZ0A 1Q5VA 3ENWA 3T6BA 3GIJA 2YNGA 4IOBA 4XDDA 4ECTA 4OZ3A 4FPIA 3BPSP 2K7JA 3SCJE 1EAYC 4XIUA 2MJUA 4OZ1A 2F1FA 1UW4A 3M2VB 1TL7B 4KC5A 2MQQA 3MR5A 3PHEA 1WOPA 2HW3A 4JI3F 2KN4A 2MDAA 3C14A 4NE9C 2PA3A 3O44A 5C5JA 2QA4G 1OWXA 2HFNA 2BRLA 5F8NA 3NRBA 3GPAA 1NJYA 2OPPA 5GADI 3KJQB 2AJ0A 3BGRA 1TQLA 3ET6B 2GIFA 2V2ZA 2OKQA 2PD1A 3Q2SC 3SEOA 1XERA 2KZMA 3HXMA 3W5YA 1RAJA 3UO0A 5F3TA 3GV8B 1KONA 4DDFA 3HJFA 4F8RA 4IG3A 3M8WA 3DMJA 2XQCA 3O2IA 1FRHA 4CYUB 3KLFA 1FXDA 1FDNA 2GCFA 3ZNUA 2QMXA 3V6KA 1RHMB 1I3OB 1U0HB 2BA9A 2ZBPA 2BXJA 5A76A 3FVYA 1KLMA 2GIQA 2VG5B 3M32A 2IBOA 4R0JA 2EFOA 3LP1B 1AFIA 3BREA 1ICEB 1KD1T 5BR8F 4ZVRB 1CJKB 4WFNQ 4PR6A 1FRKA 3SIPB 2A0FB 3FQLA 1NSKL 3KG1A 3Q2TC 2Y1IA 2HRYA 3Q83A 4X66F 2OPRA 4PPDA 4QWCA 1VQPS 1QJHA 4KR0B 3G6XA 5EUHA 5L8RC 5KFSA 5GAGI 4H54A 2XZTB 1U6FA 3SCIE 4RW9B 5GAHI 4QQBA 5DGAA 1OQ3A 3FBFA 3C19A 5ETNA 2B4OA 2ROGA 4USTA 4DS4A 3T5LA 1IBKJ 4YB6A 4OZ2A 4XAKA 4NL5A 3DYAB 5DG8A 4JYAJ 3H4DA 1N5VA 1SUQB 3FFIB 2UUBJ 4HACA 4JI5J 2FVCA 4O0NA 2KHDA 2OD6A 3MR3A 3MMCA 4Z7YA 4TYAA 1U1MA 3R5BA 5LOQA 3CC2S 3UN3A 2HQFA 3CGIA 1UMJA 1S4FA 2MLZA 3MR2A 1LK7A 1EKRA 1NSPA 2VQFF 3NXZA 4F3OA 2CZ4A 4QW9A 2XMKA 1G2EA 2KDOA 1YBTA 2I6WA 4MYTA 3G86A 3TA0A 1RT5B 3VGTA 2CVEA 3F44A 4ICLA 2IC3A 2QTWA 2B4UA 2XZDB 4CO2A 2IVMA 3GCWP 1HBOB 1Q7YT 3B78A 2FIUA 3HD2A 1J2VA 1T9UA 4YR3A 4CO1A 3JYTA 3UD5A 4KH0B 2FVSA 1R8HA 5D6GA 3M9NB 4KGZB 3M30A 3ZZPA 3CMQA 1U0SA 4RJVA 2BACA 3D6HB 1NJZA 3LTOA 3KLGA 5E0OA 2CADA 1RYRA 1V5IB 1YQHA 3RB6A 3NS6A 1NHUA 1JNRB 1O0PA 1M0SA 3TUJC 4K5SA 5LMNF 3OFEA 2X1FA 2CQHA 2YX4A 1TKXA 4C8YA 2BKNA 3FZBA 3KMSA 3GYNA 1S76D 1MSWD 1RTIB 2B5JB 2FHJD 3GFYA 1N33J 4NLYA 2DNHA 2C3YA 5GMDA 3U7JA 5CCMA 1MNEA 1XR7A 3W9HA 1MN7A 4WWSA 2XO6A 2BANB 4OHZA 4WE1A 4FNHA 2W4CA 3CJ0A 2EXUA 1RAGB 3G2XA 1EZZB 4RUAA 3QFHA 1T03B 4HT7A 2CDRB 2Z30B 4RNOA 2DPIA 5THWA 2RHSB 2QYCA 3SZ2A 1RWMB 3VF0B 2Y1JA 3DLEB 1GMWD 1YZ6A 3HLUA 1SIZA 1S1VB 4ELVA 2MB0B 2WONA 4AXJA 1VQYA 1XC9A 4PPZA 4UZCA 2UP1A 5EX0A 1N5SA 1HWUA 3VQSA 4CRJA 2AYMA 3GIIA 2GJ2A 1Q53A 3KDOA 1I1GA 1TTHB 2ROPA 2DHHA 4E2FB 1N5YB 3GG0A 5KFDA 4L74A 4ANCA 4ECWA 2FY1A 1RT2B 2QJ3A 4NYOA 1S6PA 2IMOA 3MWBA 1XEZA 4OZLA 5EHHA 1HPZB 4X62J 1RKIA 3KLVA 1C0TA 1RHUB 4OYAA 2H5JB 2ASYA 2BV3A 2PA8D 3FJ2A 4LF8J 2HBZB 4DV3F 4LF5F 4WTYA 3W5XA 5HQLA 3B4DA 2V94A 2J8SA 1X5PA 1Z4UA 4PQAA 1VQKS 3DXSX 3A8IA 1HIYA 5HVHA 5B08A 1HR0J 3IAS9 3M7VA 2LU1A 2HGMA 2RKIA 1FX2A 1HI8A 4DL3A 3PDNA 1C0UA 1H7XA 2RRAA 4UOCA 3SSSA 1K9MT 4C3KA 2VU5A 2XI3A 5B0EA 1HFEL 2V9KA 1T9VA 3AJ2A 2DXEA 3MD1A 3ITHA 2C3PA 2HVEA 5HLFA 2C2RA 2HFOA 2N4CA 3IBWA 5FDLB 2YKAA 4CIOA 2A3JA 3ADAC 3TANA 2KRRA 4ZP7A 3DDKA 2J5AA 1G3OA 3CJ2A 2HS0A 1EQ0A 2BM1A 2YKOA 3B8HA 2CUYA 1PYOB 3IR6B 3DLKA 3K5OA 3EDQB 2NXNA 2RQKA 1NZ8A 2GO8A 4K4TA 3VVUA 3C15B 4IH7A 3MEEA 2OEMA 2BJ1A 3POTA 4PXCA 4C8KA 3FRYA 3EMTA 3V4IA 4LFCJ 3DRPB 4C8OA 3GILA 3RAMA 1Q81T 2MQ8A 1HNWJ 3N5BA 2WOMA 1TL1A 4ERDA 1VJQA 2BX6A 4CM0A 1HYSA 4IH6A 3FBBA 3TX0A 2D74B 2HBYB 4ZPBA 1SKWA 1JLAA 3PKYA 4CLLA 4JI3J 2LMIA 4K59A 2J8AA 4ZVGA 3QWUA 1RT4B 4DWIA 3HULA 2RE1A 5E3RA 2VFTA 3PIPQ 2R8IA 4Q44A 3DDNA 4WP3A 1UAWA 2CIMA 2JSXA 2IA0A 5K14B 6FD1A 4IFYB 1X9WA 2XG8A 5ETRA 2ZH4A 2QC3A 4A47A 4FNIA 4E98A 5KFWA 3QT6A 3FKBA 4P7TA 4LRAA 3I6PA 4IR1A 2GAGC 4LIWA 1REGX 5A8RA 2ZH6A 5IT4A 1JLFA 4OYPA 1WUUA 5DDPC 1S1UB 2B0GA 1QTNB 2D3OR 4OX9F 3CO9A 4I2PB 3H2VE 3TUZC 2JH3A 4Q8FA 1FTCA 1TKTA 4DFJA 3TEGA 3BJYA 4J9LA 3MPDA 2XLKA 4Y3CA 3THVA 1C4AA 3RR7A 3BB5A 4FF3A 2YBVA 3ETOA 2QN6B 3QLHB 4X4OA 2JRSA 3EE3A 1QE1A 4ZPCA 3B54A 3HCXA 5E7OB 2HIYA 4I6AA 2RRNA 3PRDA 2GFFA 4JI1F 1VLOA 4ANEA 1EP4B 1FXLA 2FHJA 4A8QA 3KLHB 4U7UK 5BR8J 4ED3A 2MKHA 5K8OA 3I5AA 2XS2A 3HSZA 4DPOA 5HJYA 3HHNB 1GT8A 3M2RA 1WD6A 2N3LA 1I94F 2M52A 2YX7A 4CLTA 2CQ4A 1SKUB 3AD9C 4ZVOB 1YRUA 3WIVA 4OZNA 5LMUF 3ZTPA 3ISNC 1WI6A 4X2BA 2M9KA 1RT1B 2EC2A 3E01B 1GMWA 1HBUA 3IGVA 3QJJA 5DQGA 1RT3A 3SQGB 2C22A 4ZS6A 1HNVA 3D0IE 3H5UA 3BO2A 5F3ZA 2HS4A 1KLNA 1NDKA 4W4MA 1ZA2B 1N6QB 4RKUC 1H2VZ 4DU7A 5LXRA 3DLGA 3GIKA 1NJWA 4N76A 5B0CA 1IN0A 2HQ3A 1YITS 3MM9B 3CE8A 1RTJB 2HWIA 1B99A 3I82A 2BRKA 2VQFJ 2N4DA 1YZ7A 2JLFA 2FHOB 2VD3A 5KG6A 3UWTA 3C6UA 3DNCA 1KN6A 1NAQA 3NBPA 4DX6A 3J7ZT 1Y9OA 3DRRB 1HQUA 1KEKA 1CBKA 3G82A 1SQGA 4M5IA 5KT7A 2WAQD 2YNGB 3CDBA 5LM7E 1T9WA 4LSLA 2ZH8A 2NZ4A 2LU2A 5IWAF 1MMLA 2YNHA 2LQJA 1S0OA 2P9GA 2J0XA 3BSNA 2EFVA 3OFHA 4ZN3A 2DY9A 2VFVA 3C14B 3GG1A 4HT5A 3TAPA 4P7VA 4XPCA 3CJQA 3W1YC 2VDIA 4LSNA 3TVZA 2O1PA 4N5SA 4F7VA 1QSYA 4L76A 3BYRA 2OPPB 4M5HA 1NEEA 3BGRB 4Y0FA 2VC1A 5KT4A 4TQRA 4A8MP 1PC4A 1RWVB 4PCQA 1NDLA 4RNMA 4IOAQ 3VTIA 4R5PA 2JNJA 4TLRA 5LMNJ 2HHWA 2JL9A 4ETXA 4OLPA 3P3DA 3K89A 4MK9A 2YH0A 2BJEA 5KOXA 2FUG9 2HRUA 3EYZA 1FO1A 4DFMA 2E29A 1KHWA 4NA2A 2O3DA 4IG3B 3DMJB 3UI3A 1WNEA 3KLFB 1RE1B 3RG6A 1UZHA 2R2TA 4FS2A 2XMWA 2JX2A 4AL5A 2V4QA 8RUCA 3IBCB 1FX4A 4EMDA 1OYDA 4KGKA 1KLMB 4ELUA 1VQ6S 3KDNA 1EKSA 1VIOA 2PI4A 3J7YI 4ZP6A 5HP1A 2DHXA 3M32B 2VKZG 3C3LA 3UCUP 4CLYA 4QIGA 3PEHA 4QOTA 3OXGA 2E7VA 4O3NA 2GMJA 4ZPVR 1S9FA 5J2MA 5DS7A 2LDIA 5MLCV 3CW2C 3JB9k 2CPYA 5CH7B 2SXLA 2OPRB 2GNKA 2AP6A 3LP2A 1C1CA 3T6JA 4O4GA 4W90B 2CNLB 4GVLA 2YPYA 3TR5A 1YIJS 2HWTA 4F3QA 4JI6F 4F36A 1JLGA 1Q95G 3K5PA 3K8VA 4YHHF 3EVMA 1B7YB 3MTJA 1YBAA 4K7QA 3FMWA 1IQZA 1N0UA 1VQ4S 4DSKA 4UY85 4H4MA 2NS1B 4LF5J 2GX8A 2IJFA 2FVQA 4OV6A 3M8QA 2ZOFA 5KFAA 1RAHB 3ILLA 1U45A 4B08A 4YY3F 4LF7F 1CG2A 4HACB 5CZXA 4KYZA 3P5TL 3MMCB 1FFGB 4X4PA 2IBKA 4NLGA 1X4CA 3TX8A 1WTBA 2KFYA 5AXLA 1XMBA 4V19J 2I2YA 2HVIA 1U2FA 4LBHA 3SCLE 1SL2A 3TUIC 4ICLB 2IC3B 3KK2A 3A8EA 1FE4A 2G4BA 1CPZA 1VBYA 4ETZA 4RBUA 1WC1A 1W2IA 2YWEA 2B4PA 2OMOA 1TAUA 3JSMA 3G8SA 3CWJA 4NRUA 2G1DA 1M5OC 1IKWA 3TOQA 1K47A 1E6VA 3JYTB 4NOHA 1SBRA 3H2UB 3WDOA 3M30B 3DHWC 1VHIA 3FGVA 1H0HB 3OV7A 1CJVA 1HMVA 3KLGB 1S79A 3CDAA 3W2WA 3K59A 2MKYA 1LEOA 3M8YA 3W64A 2Y8WA 5KG1A 5DZ7A 2QL9B 3RGIA 5KG2A 1H73A 5L9NA 1Q8KA 2DR7A 2ZVSA 4B3RF 3TJAA 1TKXB 2V2QA 4B3TF 4N8NA 2QV6A 1RBAA 4B3OA 1X4BA 3CD6S 5HVGA 4WK3A 1VQNS 2V6AA 4F4YA 4WE1B 4C7QA 1TK5A 3I0RA 3ZZUA 2H48B 3D0GE 5IZHA 2J9DA 1WC6A 4QR2A 2HBRB 1NCLA 5KFHA 2XY6A 3GFHA 3PR4A 1T11A 3MPYA 3IGNA 3BZQA 2UUAJ 2CQ1A 3VGVA 5DGBA 5RUBA 2HQGA 4ZPWR 3HT3A 5J1PA 4GKKF 3PW0A 2WONB 1G4CA 2MZ1A 2UUCF 1KOHA 1ZS6A 4QU7A 4WIQA 2OTJS 2F5GA 2P2CB 4V1Ak 1RK8A 5D4LA 1GXLA 3DN9A 3I56S 1O51A 2YVSA 3IC1A 1VMBA 1JJCB 1KNZA 4OX9J 4DLGA 1YJNS 2LXIA 4YOEA 3IRXA 2RS8A 4ZPAA 2HNYA 3HJVA 1WJ9A 2BVZA 1YBUA 2MZJA 1JB0C 1S6PB 4WYLA 2OTLS 4U8VA 1Y00A 3TEHB 4DPTA 1LFWA 1WEXA 1GAOA 2NSCA 5A6WA 1C0TB 3D54A 1H2TZ 4LF4J 2OIHA 2A6OA 5BYRA 4FF2A 4V19X 4CNYA 2J9CA 2B6AA 1X5TA 2DRAA 3UVJA 3CJSA 2W7AA 3NWRA 3GJQB 2QE5A 2RKIB 3QIDA 1C0UB 2GQQA 2XTJP 3KLIA 3DU6A 3TAMA 3R2DJ 1UA1A 4FYYB 2YH1A 1I94J 2YQ3A 2VPYB 1GNKA 4DS5A 3AJDA 5LT5A 3R7NB 5LMUJ 3ITHB 3RBDA 3CCSS 2GVZA 2K8GA 3AH6A 2FJEB 4ED1A 4ZVFA 1RGVA 5HLFB 4F2SA 3CEDA 3DGVA 2RIJA 4Y6IA 4OX8A 2ZVIA 3SFUA 1TL5A 3QIPA 2VA2A 1NPRA 3FCVA 3RB3A 3DKDA 4K4SA 2OLWA 2CFXA 1WSRA 2V63A 4L6V3 2MQOA 1YK9A 2DGXA 4ECYA 3DLKB 3QATA 2FLPA 1AB8A 4K2JA 3MEEB 3FNNA 1S7HA 2BMBA 3POTB 4DV0F 3HFVA 1H2UX 1YG0A 4NYPA 4MTPA 2EBGA 1RTDA 3V4IB 1R8BA 1X4EA 4Q5VA 2RHQB 4M5KA 2WOMB 1TL1B 2EKNA 1FRJA 1HYSB 1NZAA 4UZBA 4NLOA 2VBXA 1GK8A 2CQGA 5IWAJ 1OS5A 4KIAA 1U7LA 1IKVA 4RNHA 1A7GE 3MCSA 2E9TA 4JV0A 5KFYA 1U02A 1N32F 4A8OA 2ATLA 1JLAB 3KNGA 4A8YA 3HM9A 1VRQC 3SSRA 5F9NA 2MQPA 4DFPA 1J5EJ 3CF5Q 1UA0A 2Z4PA 4DV2F 4F4WA 2FZGB 5DZ6A 4C8LA 3O6QA 4B9VA 3QPIA 3R5CA 2A18A 1C4CA 5A8RB 1JLFB 2WSCC 4HHHA 5KFUA 2HHVA 3PW2A 1U1OA 1ZAWA 2DO0A 3FBCA 5JVGQ 3TZXA 2QO3A 4OI2A 3MUTP 2F4FA 2X1AA 1DY3A 2W2NP 1N34F 1TKTB 3QZ8A 2AGPA 4P9SA 1NKBA 1X5OA 2XSJA 2F8MA 2EFQA 1M5KC 3DI6A 2FC9A 1W7WA 2E5LF 2KB2A 2P6SA 4O23A 1X7VA 5D0HA 2LECA 2DR5A 4UTGA 3E3XA 4AFFA 3NOGA 1B0TA 2OGUA 4QJVA 3N4WA 2H65B 1XQIA 4M5GA 4ZIWA 2E1CA 1M5HA 4ECRA 1R0AA 1HKAA 1QE1B 5D0EA 3G96A 1NU4A 2Q79A 2FQQB 2C3MA 1ELOA 2LVWA 3R1LA 4I56A 3CDWA 3D9BA 1NPPA 8ATCB 1FKOA 3F56A 1QSSA 4EU0A 4ECUA 5J2PA 2MKKA 3SXLA 5DG9A 4DQSA 3M2RB 3D7SB 3ZZYA 1JK9B 4DCPB 2VQEJ 3LF0A 2QEXS 1FCAA 4K8RA 4ZVSB 5KT5A 2C2EA 4ELTA 4JI6J 3FSYA 1YTYA 3B6BA 1HBUB 4YHHJ 3OHAA 1RT3B 4K4ZA 3J7A1 1NK7A 5KFJA 1HNVB 2DEJA 2MTLA 1WF0A 1LFPA 3ZO7A 3DDIA 3ULHA 2XLIA 2I1RA 4YY3J 2Z2YB 1ZZNA 1BC6A 3IS9A 2WBMA 3DLGB 1KVIA 4BC7A 3SQOP 1APSA 2IM2A 2DK2A 4L3NA 3CNQP 2LEPA 4WZQA 1T94A 4DEZA 3W60A 1DLOA 4OFZA 4CO5A 2LYVA 2ZWOA 2X7IA 1RWNB 4DI6A 1U47A 4M5MA 3C6UB 3R6LB 1I51B 4RW7A 4OJ1A 3NBPB 3AOCA 2HS3A 2RAQA 2D3ZA 1HQUB 3HFZB 3G82B 3N79A 3JXOA 1S0VA 4FXDA 3GE9A 3K57A 4LSLB 1DRZA 2GJFA 2YNHB 3LALA 4EZ6A 2QIFA 3ZZTA 1VQMS 4G65A 2LCWA 1JJ2R 4Q7AA 3JSRA 3NMRA 3E8OA 2ZEJA 3MCNA 4WP8A 4LSNB 4JI0F 3VR1A 3R7SB 2V9WA 2VOPA 2VA3A 4FYWB 5CYMA 1Y4ZB 1NPKA 1FNMA 4OQJA 4F26A 4ECSA 2ASJA 2IYGA 1NDCA 5CXTA 1VBXA 4FVMA 4CO0A 4K0KF 4IQXA 4R5PB 4C9DA 4WU3A 4JI4F 3J7YU 3HFKA 3IM9A 4B3RJ 2ADCA 4B3TJ 4NCGA 2VHGA 1TMJA 4GMKA 3IG1A 1NSAA 2FB0A 1ZPVA 4NLXA 4DX5A 2CVIA 1YDLA 4UUWA 5KFMA 2Y0SD 2DGQA 1VK8A 3U1NA 3SV3A 1E6YA 4RPFA 1LQ9A 3FEZA 4Y34A 3MAQA 2DITA 3IO1A 2AJ4A 1OYEA 2NPIA 3FEYB 1AUSL 3I87A 3N0VA 5F8GA 2VG5A 4PXBA 4MK8A 2H5EA 5IM0A 3CDUA 1NMEB 2FLOA 5HP1B 5KG5A 3H5YA 4GKKJ 4ZCIA 9RUBA 4PWDA 3OR2A 2UUCJ 4B3SF 2JOQA 4JV5F 4HLBA 3SMZA 3IRWP 3CJ3A 5IQ6A 3M8RA 2DNNA 5D3GA 3H2LA 2L9DA 4KH1B 1ROFA 4J91A 5J2MB 1JLQA 2DR8A 2F8EX 1S48A 3D28A 2GHPA 1NK6A 4IQMA 1VRUA 2MGZA 2XI2A 1S7IA 1TL3A 3IFEA 3LP2B 2V0NA 3RR8A 1C1CB 4NLUA 2B9WA 1HWLA 5H9FK 4O4GB 5HMZA 4K4YA 1UVNA 5G4DA 1UJ6A 2B51A 1FDDA 4X84A 4K4UA 1S9EA 1JLGB 2N3OA 2QT7A 3PW7A 2CQ3A 1I6JA 4OJGA 5KFBA 4FYXB 4DQPA 3GR1A 2DGUA 4DR4F 1YJRA 3CJRA 2BJ8A 1YGYA 4J37A 1Q86T 4H4MB 3KLEA 3W63A 3UDLA 1LXJA 3M8QB 1SC6A 1P1LA 4OX6A 2QLJB 3QMQA 1SVDA 5J2QB 2XM3A 1IWGA 2ZKTA 3QO9A 3GSDA 1NXIA 2DO4A 1C1BA 3L7PA 4DR5F 2Q1LA 3HZEA 2QLFB 4NLSA 3M6XA 2HGLA 4WJBA 4UW2A 2P9CA 4LR9A 1IUJA 4ZKAA 2HNDA 1KFDA 3TARA 2DHAA 2R7WA 4I68A 3KK2B 1RTHA 4MKBA 4PYDA 1NJIT 2UV8A 1UEVA 3BO4A 3A13A 5F8HA 1FWKA 3JSMB 3MR7A 3VAMA 2KT3A 1Z2LA 3RTVA 4KHRA 3OQ2A 4O3OA 3T9NA 3UR0A 1IKWB 2L08A 3TYTA 1E6VB 2DRBA 3PZPA 1O8BA 3W7BA 3RZAA 1YLXA 3TUPA 2AU0A 1CJVB 4CLSA 2F4VF 1RCXB 2X3DA 2BBEA 1FEHA 4LIRA 1HMVB 1HQEA 4DV0J 4RBVA 4IR9A 3W2WB 1Y10A 2CYYA 3T5KA 1VK3A 1HLWA 5JJBA 3QAEA 3LP0A 1VIXA 2I38A 4AQYF 3HHDA 2X51A 4O3QA 2HLUA 2RRBA 3MZIA 3CJ5A 5E41A 4P52A 4DSJA 3TW0A 4FS1A 5T7LA 1T7PA 4B3OB 4DCOB 1ZM2A 2R2SA 2RF2B 3VVTA 4QWBA 3V5RA 1MW7A 4GVBA 5HQMA 5M2PA 4UF4A 1N32J 4ATNA 6AT1B 4A8XA 1IKXA 3KYLA 1QAYA 1R6VA 3I0RB 2KG0A 2DKOB 1T03A 2AT1B 2QYGA 1WOSA 2XHCA 2DGSA 4ZK7M 1F1BB 3QT8A 1L3VA 3OL9A 3OXLA 3D4JA 1F9EB 2H1YA 3M2UA 3D66A 5A6PA 4DSFA 4DV2J 4Q45A 3N01A 4ZCMA 2IMWP 5CZVA 4C97A 4U6PA 4OJ3A 2B3TB 2ILZA 3KJVA 2FJXA 1N5TA 1SC4B 1VDHA 2ZH5A 2NZCA 5G0RA 2M8DB 3MCMA 1FT8A 2QMWA 3MM8A 2B56A 2W9AA 3VAIA 3F0NA 2LP4A 3IRXB 3K8WA 5IXUA 1UFKA 4L75A 1TELA 2HNYB 2BJ7A 3TA1A 1RLCL 1OSDA 4QCLA 4DUZF 3RJMB 4KQZA 5DJBA 1KVKA 4MFBA 3MM7A 2G0IA 1IR2A 4P75A 2Q43A 1OY9A 2HBQB 4PRFA 4OHYA 3J81j 5HN0A 3OLBA 3CJTA 3DC2A 5D8HB 1KFSA 5EWFA 5E3CA 2B6AB 2ZM6F 4TVAB 2Z56B 5J1NA 3MPUB 4CLUA 1WHYA 3EZ5A 1HHTP 4DSIA 1V3ZA 2G1HA 4G1IA 5H9FJ 2YXLA 2V2KA 3KLIB 3TAMB 4PABA 2AEJA 1KVJA 1SB6A 1RWOB 2AX1A 2OEJA 3IN5A 1Y5LB 4YR0A 4GC7A 3MUMP 1AZSA 4KT0C 1RWXB 2GVZB 4KO0A 4LQ9A 5DG7A 1TFWA 4KSEB 2RSQA 1M90T 2IM3A 5D4PA 2DNPA 3I32A 3SFGA 4M63A 3QIPB 2J9EA 2KFNA 1UJ4A 2B8QA 3MOZA 4KFBA 2LEBA 3A4TA 2JZ5A 2DH9A 3J80U 2XY7A 4NEZA 2LKZA 3HVRA 1YRTA 2APOA 5JXSA 4KE5A 3R7BB 1ZAVA 5KFPA 1P1TA 5HQ8A 2PMZD 1LW0A 2IJNA 2E1PA 1QTMA 2GA7A 3A3OB 3RRGA 1B7FA 1ZA1B 5L39A 4NLPA 3DOMB 1RTDB 2MLYA 3GIMA 1UWBA 1P27B 5HMXA 2K3IA 2WSEC 2V50A 3S1TA 3R5JB 1Q4RA 3C8YA 1V6HA 2ZBIA 4OYBA 4DV1F 3VWSA 1MROA 2A10A 4X4RA 2H5IB 2CNKB 1RXOB 3D1QA 2FJBB 3ZXWA 1IKVB 1MWYA 3G4SS 3P8BB 3VAHA 3V81A 4AUKA 2WCXA 2XYPB 1X9SA 1KRPA 5C42A 2DNYA 2JC1A 3MEDA 4X4TA 3L3CA 1MLAA 1OMSA 1TUGB 2M4MA 5JMNA 1A0OB 3FMBA 1IJFB 3W62A 2ATCB 3Q24A 5F9LA 2QZ8A 3N6MA 3OTBA 2LQ8A 5HI7A 5HJXA 1MU2A 4DZDA 3JTNA 1S49A 4QIWD 4ZVQB 3ZNJ1 2CQBA 4YP3A 4JI4J 2AX0A 2K7KA 4M5JA 2ZJPQ 2UVRA 4KY3A 4E0DA 2N82B 1NK4A 3G6ES 1RKJA 2XBPA 4Z37A 4IUFA 4ZP8A 2V68A 3D1HA 3BV8A 2D1CA 2XSJB 2JEJA 4CT9A 1F5CA 4DUYF 2BR0A 2OEKA 3DI6B 1Q79A 4RL1A 3GB0A 4DV7F 3OVSA 3NGUA 1XMQJ 4QYRA 2EG2A 5KFGA 2HAFA 2QL5B 3AAWB 4FBUA 4JUZA 3G8TA 1R0AB 2WVCA 1ZTTA 3AXKA 2WZ1A 3GJRB 4B3SJ 1SC1B 3VHQA 3UD3P 4C48A 4A8FA 1KOOA 1MWZA 4J9OA 2HHTA 1U25A 4HHUA 2YWGA 1IKYA 1EARA 1F3VA 1FKOB 2HQCA 3MFIA 4GKJF 5J2PB 2DH8A 2R7RA 4FF4A 3VAJA 3X1LB 4BWJA 2PEHA 1L5UA 1U8WA 3OJSA 3F41A 4F3MA 2O5DA 2XMMA 5I4MA 4OI4A 3CJ4A 1DBDA 4N8OA 1C2PA 5LJ5Y 2OELA 1N6QA 1K44A 5E33A 2EKYA 2I9SA 2GJIA 3ZZOA 5B09A 5K5MA 3IS9B 4J9UE 2F9JA 2HFZA 3K58A 3CCWA 5T41A 2BOPA 4X4VA 1RWWB 1GX6A 1RTJA 1VQ5S 1BWEA 1DLOB 2V5HG 1JIHA 3LGNA 4OYXA 4KTQA 4RO0A 3Q8UA 4MKVA 4HDHA 1G7CB 1S1TB 3W8GA 4DF4A 3PVXA 5K9FA 5IC6B 3EXYA 4QZVB 4RW7B 4O44A 2ZFHA 2VBZA 3D6FB 4RU2A 2MKJA 1D09B 4EGLA 2DIVA 4ECVA 2XLJA 1JX4A 5KFCA 1FNOA 5A2QU 5FJ4A 5GVQA 2ZNYA 2GIRA 4QPTA 3HF5A 3VZHA 2BYCA 1J27A 2XYGB 3D5MA 4N47A 5L1IA 3K5NA 1Z2ZA 3NP5A 1FJ7A 3KNAA 5B0GA 1NK8A 4DX7A 3PO4A 5CYMB 3QT5A 4JI7J 2CNNB 1FJEB 4NMXA 4LRBA 3SCKE 1XNRJ 5IV3A 3OT9A 3ZTQA 4WCEQ 5DM6Q 2KKHA 3OL6A 1S1XA 1SPBP 3TI0A 4AQYJ 4JV2A 5KFVA 2A1BA 3GTYX 2LQBA 1U1RA 5CAAA 4NCGB 3BGOP 4QPXA 1AW0A 3ENQA 2NCKL 3RBZA 3IG1B 2JFKA 4RBTA 1UVMA 1RHRB 3FUYA 3ILOA 4EI2A 4Q43A 4OYOA 3GYXB 3DRYA 3V6DA 4URSA 1NBEB 5CYJA 1RQ0A 3AY0A 1E6YB 2OD4A 2EEYA 4USMA 3QRRA 4CCHA 3BSCA 2O66A 1H72C 1ZZFA 4LMZA 5EWEA 4F0HA 1I5OB 3KJNB 1ZOTA 5IM0B 3TAQA 2V67A 4KV8A 3LGMA 1F0XA 3O3LA 2UVWA 4PWDB 1BGXT 5F8MA 1XR6A 1HBNA 3BS9A 3HHLD 3OR2B 2CWXA 4WXOA 2EI5A 2XSFA 3CVKA 1R43A 4WU2A 2BQUA 2PMWA 5D3GB 1PJ5A 2OUGA 4ZITA 2AGOA 1X4AA 4QR0A 2IDEA 1SC3B 1JLQB 4C0OC 2XMVA 2CPIA 2KXHA 5GAEU 5AT1B 1VRUB 2MGZB 2GVDA 1TL3B 3HSJA 1FFSB 1YRXA 4DUZJ 4ZPTR 5EN1A 1S6QA 5A8WA 1RJJA 3PR5B 1BQXA 2NLWA
chains in the Genus database with same CATH topology
4WE1B 1TAQA 1S9EB 1VFJA 4ZP9A 2XMJA 4C7QA 4LF4F 1BQNA 4ZHRB 3I0RA 2D41A 1UJ5A 3ZZUA 3D0GE 1S1WB 4CT8A 4QBUA 5IZHA 2J9DA 2JWNA 1VOMA 4X64F 4ECQA 4FYDA 1UETA 1F5BA 4QR2A 4URGA 1FEEA 2GQCA 5KFHA 2XY6A 4G1PA 2ZD1B 3GFHA 1FKPB 3PR4A 1CVJA 1U6BA 3MPYA 4RW6B 1LKZA 1FF2A 1T02A 4OJHA 4OLOA 3IGNA 3BZQA 3KLEB 2CQ1A 5DGBA 3MECB 2R4FA 4JBCA 3QGPA 5B0DA 5HL7Q 2E5JA 3Q8RB 1NK0A 2PSZA 1PGZA 1L3KA 3FCHA 1JLEB 4ZPWR 3HT3A 3OPKA 4Y65A 2EVZA 5J1PA 4EO6A 1URRA 1JLBB 3I4PA 3J7Z5 4GKKF 1UEUA 3HVAA 2YTCA 3PW0A 5L9XA 3LPYA 2WONB 3OJUA 1UVIA 3CSKA 2MZ1A 2UUCF 4WFXA 1KOHA 3IR5B 3CJKB 5E5NA 2M0GB 2RU3A 4QU7A 3CMAS 1WWHA 3M8PB 3QO9B 4ILMA 3MEGA 1X4HA 1D8ZA 1SKRA 2OTJS 2CJ9A 3DRPA 3T19A 2DTJA 1X8DA 1PSDA 1RK8A 1KSPA 4BHQA 1AUDA 1XBWA 4B17A 2GGPA 5HBMB 1BY9A 3OUYA 1C1BB 5D4LA 1GXLA 5K8NA 3DN9A 3I56S 1R27B 1O51A 4CTAB 2V8DA 2YVSA 3IC1A 1VMBA 3JSBA 1UVJA 1KNZA 4EO8A 4DLGA 1YJNS 2EFGA 5KG3A 4A8WA 4DF8A 2CDQA 2PFFB 4NXNF 2LXIA 3LAKA 4ZCLA 2AWZA 4YOEA 3OL7A 3QWPA 3IRXA 2HNDB 2DGWA 3VQTA 2RS8A 2JVOA 3KG0A 2QRRA 3B82A 2QLWA 4ZPAA 2HNYA 2MZTA 3OTOF 2IAJB 5KFZA 2BVZA 1RTHB 1D9AA 4TXSA 4JI8F 2MZJA 2I8EA 2IRYA 1U1QA 1X4DA 1JB0C 1S6PB 4WYLA 1SL0A 1R31A 1LV5A 2OTLS 4WIIA 1Y00A 1AXQA 2V8VA 2ZH2A 1LFWA 1DZ5A 1WEXA 2BDPA 1GAOA 2J6TA 2NSCA 5A6WA 1YWXA 5DLGA 1C0TB 1RT4A 3BDEA 1NHVA 4FPRA 3D54A 5EX3A 1H2TZ 4NYZA 4MJKA 2NUHA 2OIHA 1MMDA 3I9V9 5K14A 4K2XA 4URQU 5BYRA 3CD0A 4FF2A 2E1AA 2VC0A 4IFYA 4M8LA 4V19X 4PG8A 2HHUA 3PJWA 4CNYA 2J9CA 4NLQA 2B6AA 2LLZA 2W4DA 3UR3C 1X5TA 1F9FA 2DRAA 4OZ5A 1Y3KA 4EBCA 3MM5A 2EK6A 2UU9F 4J9NA 2KI2A 4RX6A 5C25A 1SL1A 4ED6A 3PX6A 2JDJA 2CQPA 5B0AA 4TNOA 2DHGA 4YFUA 2C28A 2AD9A 2W7AA 4HEA9 2M8HA 2ZJQQ 3N5FA 1ZTWA 3EGZA 5DETA 3RAXA 2QE5A 3CB4A 3D0HE 1D8YA 1FVQA 2LQ5A 4Y00A 3LWMA 1U1KA 2EK1A 4M5DA 2RKIB 1HQEB 4DQRA 2ALZA 3MTKA 4HH1A 2FJWA 1S1UA 2KM8C 3QIDA 2DD8S 3VAFA 3UFCX 5C24B 1C0UB 2XY5A 2GQQA 3OBIA 1PO6A 4I2QB 2YY3A 3KLIA 3DU6A 1CLFA 1N52B 3TAMA 2E9ZA 2MXYA 2JHEA 2PO4A 2E5IA 4I2PA 4W92B 3LP0B 5L1JA 4EUVA 1UA1A 2CPFA 3QGGA 5GADU 2YH1A 4KRWA 4A46A 4MAKA 3TNVA 3I5CA 4LFAF 2YQ3A 3MMBB 2VPYB 3SV4A 1GNKA 1FD2A 2K3KA 2MZRA 4BBYA 3PV8A 4DS5A 3RBEA 1OQ6A 1Y5IB 1H38A 4M1KA 4DSEA 4Q8EA 4OI0A 5LT5A 1Q16B 1SXLA 4FXVA 2DBBA 1NH8A 3ITHB 3RBDA 3CCSS 5I42B 2K8GA 3AH6A 3RW6A 4I69A 2FJEB 3U1MA 1GTEA 4ZVFA 1RGVA 4ED1A 1LOUA 5HLFB 5T7LB 4F2SA 1HHSA 3I4HX 2JEGA 5J1EB 4R8UA 3J81Y 3OLAA 3CEDA 1T3OA 3IR7B 4NZ7A 1FXRA 3A1YG 2RIJA 2Z0GA 3T1HF 2EWHA 2YKPA 4Y6IA 4X62F 4OX8A 1Z1ZA 2HHXA 1R6YA 2ZKUA 3CD7A 4J5OA 5E3AA 1OIAA 3SFUA 1K73T 1TL5A 1QUVA 3QIPA 3QLHA 3C6TB 1IKXB 2VA2A 4YEAA 3RB3A 1OPIA 1S1WA 4K4SA 2OLWA 1J5EF 2CFXA 3O5TB 4HI2A 4LF8F 1NK9A 4L6V3 2MQOA 3T1YF 3NWGA 1DTTA 1GX5A 4ES2A 2J7UA 3G6YA 4I64A 2DGXA 4U9RA 1R3NA 3CPWR 4AL7A 3T5JA 4ECYA 4OI6A 2R7UA 3MGJA 3DLKB 3CCJS 4EEYA 1RA7A 1S0MA 4G1QA 2DVIA 2C2DA 4NPOA 2FLPA 1SV5A 4DV4F 2WTFA 3M2UB 4LQ3A 3L95X 4B9SA 1EP4A 2MSSA 2RUGA 3KTQA 1NNDA 1Q7LB 3KLHA 1NH7A 1WF2A 3MEEB 5GAEI 2VONA 3FNNA 1QM9A 1S7HA 1FNXH 3POTB 1FRMA 3AHPA 4DV0F 2E7WA 2LEAA 4HI1A 4IFVA 4USHA 5HMWA 3CCVS 3Q8SB 1NK5A 1H2UX 1YG0A 2CG4A 4ED7A 4NYPA 3KJVB 4MTPA 2EBGA 2FDNA 2V4JB 3BQ1A 4DL7A 1RT7A 1RTDA 2UVUA 2YNFA 3V4IB 2PI5A 1SH3A 5IFMA 2RS2A 4PUOB 2J0SD 1R8BA 2XULA 2YKNA 3KOAA 2CPJA 2DIUA 1F2GA 3CD5A 3FRZA 1X4EA 2VKRA 1RWUA 4QW8A 4Q5VA 1D3WA 1VC0A 5G0RB 4KAIA 2I0XA 3PFOA 2GO9A 2UXCF 3MM8B 3HHEA 2WOMB 2AV5A 2F3JA 4DMZA 2QFJA 1TL1B 4K4WA 2XMUA 5A0YB 3E51A 2AGQA 1FRJA 1HYSB 1DTQB 1FKAF 1NZAA 1RT1A 3RU0A 3E01A 3NNCA 4NLOA 2DHSA 2FLLA 5A8KB 2VBXA 1URNA 2CQGA 4EZ9A 5KG4A 1OS5A 1D9FA 1ZETA 4KIAA 3SQGA 1N8RT 4DN0A 4GC6A 1U7LA 1IKVA 4RNHA 2R2UA 1A7GE 3X3UA 1VC5A 2EFPA 3MCSA 2HPUA 2E9TA 4JV0A 5KFYA 2A2DA 3BQ2A 3PW5A 1OPZA 1N32F 4A8OA 2JVRA 2ATLA 1JLAB 3MOJB 3DXBA 2KTQA 5KOWA 3KNGA 4A8YA 3HM9A 1LWEB 3NMAA 3WC2A 5GAGU 1U09A 2EFNA 1HNIA 4MFBB 3SSRA 2B9YA 5F9NA 2MQPA 4O3RA 4DFPA 3MM7B 5JUMA 4DV5F 4MIAA 4Y2MA 4NZ0A 3RW7A 2VG6A 3LWLA 2KM8B 4DOZA 3CF5Q 3KFWX 5GAHU 2ZH3A 2VV5A 2R8KA 5KFTA 2NXUA 4IO9Q 4E8UA 3RRHA 2WW8A 1UA0A 1R8PA 2EG1A 2AYGA 2Z4PA 4JI2F 4QWAA 1R89A 4YMEA 3M1VB 4DV2F 3LOUA 4F4WA 3O8WA 2BQRA 4F4XA 3CT9A 1KS2A 2QSFA 1M5PC 4C8LA 3O6QA 3MM9A 2VODA 3QJLA 4B9VA 2VOOA 3AA9A 3QPIA 3HI9A 4Q0BA 2J6SA 4MH8A 3R5CA 3NNAA 2F7VA 2DCLA 4MIWA 2CQCA 4Q2LA 3OSNA 2A18A 2NR0A 1C4CA 5A8RB 4A48A 1F60B 4D3GA 2AJQA 1JLFB 2Q3PA 2WSCC 3GQCA 2IHR1 4LFCF 1S72S 2Z2MA 5KFUA 4CQ1A 2Y1RI 4IH5A 2LA4A 2HMIA 2HHVA 2XO7A 3PW2A 3C66A 2VUGA 3FDSA 1VRTA 3WC0A 1IXKA 1A6LA 3J80Y 3Q23A 3MR6A 1U1NA 2MKSA 1P8GA 3HZGA 2DGOA 1W25A 2VG7A 2WSFC 1TL4A 2Z8QA 1HNWF 1U1OA 1ZAWA 2DO0A 1OO0B 4HYKA 3BM7A 5JVGQ 1AFJA