3SCLE

Crystal structure of spike protein receptor-binding domain from sars coronavirus epidemic strain complexed with human-civet chimeric receptor ace2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
179
structure length
173
Chain Sequence
PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/viral protein
molecule keywords Angiotensin-converting enzyme 2 chimera
publication title SARS coronavirus: mechanism of host receptor adaptation and rational prediction of future evolution
rcsb
source organism Paguma larvata
total genus 28
structure length 173
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3sclE01
3SCLE 3BGFA 4L3NA 4ZS6A 3SCKE 3SCIE 4QZVB 3D0GE 4KR0B 2AJFE 4ZPTR 3D0IE 4KQZA 2DD8S 2GHVC 4ZPVR 4L72B 4XAKA 4ZPWR 3D0HE 5DO2A 2GHWA 3SCJE
chains in the Genus database with same CATH superfamily
4CLLA 1RT7A 4QR2A 4OZ0A 4DV4J 2LCWA 3NKYA 1RWNB 1UWBA 1FFSB 4ECUA 3NAIA 1X9MA 3A3NB 5J2QB 3C15A 1RT4B 1G6BA 2VJVA 2K3IA 2E1CA 2XMVA 2DGWA 3DGVA 3H25A 2JRSA 2DNZA 4CO2A 4CTAA 3TO8A 3AT1B 1OS5A 4HTJA 1U8WA 1YRUA 3PEJA 1AUDA 4EI2A 2OEJA 3A8KA 4DR2J 2V4JA 4ZITA 5A76A 4DQQA 1Q81T 4WKYA 2J0QD 2MQQA 1WC6A 4RNMA 4NMXA 4HACA 2N4CA 3P5TL 3TNVA 2E7VA 4KO0B 1DLOA 1FXLA 3QSIA 2JLEA 3E3XA 3V6DB 2YNIB 2YWGA 3I4PA 1NSAA 2F4VF 2DRDA 3QBCA 2K7JA 3TW0A 2DB1A 1MROA 2RDIA 4KGMA 1HI8A 2R9LA 1C0TA 3DGPB 3OTEA 3ZTRA 2DNRA 2DGVA 2XO7A 4ZVEA 1VHIA 3ISZA 1M0SA 5HL7Q 3AA9A 2XS5A 1TP7A 4DV5J 4IFVA 3GSDA 4TN2A 4QYRA 4C0HA 2VJUA 2OMLA 2H5JB 3BGRA 3HHLC 5GMEA 1SJ3P 3AOCA 4PWDB 2Q6CA 3IWLA 1VCTA 4ZVPB 3WC2A 3JSMA 2DCLA 4QYZJ 5F41A 4F2RA 4USTA 3QZ8A 4R8UB 4LBIA 3UFCX 2HVEA 3LAMA 5E33A 4C11A 4DZDA 2UXBF 1EETB 1J5OA 1X8DA 4F4YA 3I55S 5E3PA 1VQKS 2HQ3A 1WG4A 4QJVA 5KT2A 2UVUA 4ZP7A 3DMJB 3UD5A 3GSIA 1FKPA 3QJLA 3GR1A 3IA0A 3N01A 3PX0A 3TA0A 3ZTPA 4I6WA 5KFIA 4N8OA 4WCEQ 3BEGB 4DR5J 3JYTA 3Q24A 2FZKB 3M8YA 2BJ1A 4LF9J 4PQUB 2C2ZB 1RBLA 1RUSA 1HNIA 1WG1A 3V81B 1S49A 2M9KA 3M1VB 2AWZA 3FUYA 1BWVA 3MM8B 5RUBA 3UNGC 1V3RA 2R8GA 4I64A 3PYGA 4Y2MA 1OMSA 1Q7YT 3ZO7A 4YR3A 2UUBF 4IOAQ 4AUKA 3DHWC 1A9NB 2B5JB 4NLGA 2QTWA 3QO9A 3LA0A 2F3JA 1YBUA 4AE5A 2QMWA 4DV0F 3G82B 4DWIA 3OVBA 3JTPA 4F4WA 2I1RA 3SEOA 2H4WB 1REGX 3P4UB 1XIQA 1WEXA 2ASJA 3NOCA 4ZVOB 5BR8F 1Q86T 1N0UA 3Q8RB 2CFXA 3QT8A 2QV6A 4F4XA 4RBUA 1KSPA 2U1AA 4K50A 3M6UA 2XLJA 5EWEA 3KK3B 1YVFA 4B9MA 2PT0A 2OPSB 3D2WA 1EARA 4PCQA 4DSJA 1YJVA 4URQU 1T9VA 1GH8A 3EGWB 2LXUA 4JI1F 2OPQB 2HBZB 2CQ1A 4LFBJ 4C97A 4PYDA 2Y1RI 1LQ9A 3OTOJ 1N33J 3O2IA 3KLGB 2BE2B 1KONA 1HQ2A 5GAGU 3M9MB 3CJRA 3ZZPA 1X4GA 2DISA 4KY3A 4QBUA 5HROA 1S9FA 3HHEA 1R8PA 2JOQA 5HJYA 4MKYA 3V6HA 3BSOA 1NUEA 2EWHA 1RTIA 2HVZA 1N6QB 5C25A 5GAHI 5D78A 3ZNJ1 3T1HJ 4X4PA 2GX8A 1H74A 2I2YA 2HG4A 3GIMA 2AEMA 1KC8T 3LALA 3LQVA 2YKNB 3CMQA 3PYFA 3PV8A 1CPZA 4NLWA 3K17A 1Y5LB 2YH0A 4A8OA 5KG4A 3G6YA 1B64A 2WVCA 2XSFA 2HLUA 2FHOB 4LF4J 5J1PA 4G6VB 4WPAA 2E29A 1HD0A 4NXMF 1D9DA 3JXOA 4Q8EA 2GMLA 2D3O1 3N6LA 2J6TA 3VAIA 1SIWB 5IQ6A 4V1Ak 1JXLA 1MMNA 4ZVHA 4DCJB 3NGRA 4LF5F 1LKZA 1KLNA 3Q8YA 2YNGB 3H42A 5IQQA 4LF8F 2B0GA 3W61A 3GP9A 3AH6A 1J5EF 2HBYB 3DRRB 3JSYA 4CO3A 1RTHA 3GJQB 1ZTTA 1SV5B 4DXLA 4F67A 2OP5A 2FJEB 1KFSA 1B0PA 4WP3A 3L95X 5KFKA 1RWUA 1Q5YA 1KHWA 1HBMA 3BN7A 3R2DJ 4BLGA 1UEKA 5A0YB 1N56A 3UVJA 1JX4A 1H98A 3DLEA 1NDCA 2LKZA 4K4UA 2PFFB 4NRTA 2PMHA 1H38A 4UOHA 2D41A 1L3KA 2K1RB 4DX6A 1NMEB 4TY8A 1YJWS 3BGUA 3NEKA 4WXOA 4M1KA 1Y9OA 1LV5A 1TFWA 4LRBA 4Q43A 2IMOA 5F8LA 2V69A 4ZCMA 3K8WA 1RAIB 3MTJA 4GKKJ 4HH0A 4KT0C 4TQSA 3QNWB 4MKVA 2IRYA 2CQIA 3ZTSA 1TUVA 1IBLF 1HD1A 1BC6A 1CG2A 2OSQA 1RA6A 1RYSA 3DRYA 3SDEB 3QIPB 1S0MA 2AGPA 2C3PA 4HHHA 3HFVA 4ED3A 2UV8A 5ETPA 2CQ0A 4DR1F 2J7UA 3ZXWA 2DR8A 4TLRA 3R1LA 5IT9Y 2VFVA 2JFKA 1KOHA 2QA4S 2YH1A 1XMOJ 2DH7A 2FGOA 4USUA 3Q22A 4ILLA 5DRKA 3RAXA 1YI2S 2VONA 3IFEA 1U1RA 3JB9k 3KK2B 1RK8A 3F0NA 3CD7A 3R5BA 2C2EA 5F9NA 4IOCQ 3K5LA 1S0VA 2RILA 2AP6A 2IBKA 3OL9A 5HQLA 5HQMA 4DPTA 3K59A 3ZZOA 1Z1ZA 3MD1A 3CF5Q 1X4AA 5SZTA 2BJDA 2IBOA 2XLIA 1LW0A 3CSKA 3VAFA 2HHPA 5IM0B 4DV2F 5C42B 1RE1B 4O0IA 3H2LA 3CCRS 3UCUP 1REVA 2POKA 4CI0B 4Y2KA 2GGPA 2QIFA 3CJKA 3OFEA 3DLKB 3EDQB 4LF6J 2MQ8A 3WC0A 3SV4A 4ECWA 1S9GB 2OHDA 4NLTA 5KFXA 5CXTA 1CC8A 2MQNA 3KG1A 5GAEU 5HP1A 3DDNA 4PAAA 3VV2B 2IVMA 1VK3A 2E9TA 2XCAA 3GJSB 3HT0A 2DHHA 4NMLA 1JWWA 1TTHB 2NXJA 4RWWA 3BBBA 4ANCA 4YY3F 2RKIA 2W8LA 3E2EA 1TV6B 4CO1A 2VB6A 2VPZB 1YJNS 4MT1A 1U48A 5KFRA 3PG9A 4H4KC 5C2CA 4NZ0A 1T9UA 2W2NP 4WYWA 2JSXA 5KFUA 4DQPA 4DR4F 4PWWA 2C2RA 2QG9B 5E5NA 4X66F 4IUFA 4AXIA 4W90B 4J9OA 1T11A 3IRWP 4ID8A 3MOZA 2ZFHA 2ZD1A 4EGLA 3H5YA 3DRXA 4CLTA 1M5PC 4YEAA 4NASA 2MKKA 3O6QA 1R8CA 2Z57B 3NP5A 1JIHA 2MKIA 1RWPB 2HHHJ 2CQDA 4ECTA 1SJQA 1SH3A 3TUIC 3S6EA 3OXGA 2FJVA 4NLYA 2A0FB 5IV3A 3MM5B 4IFYB 5D0RA 4JI8F 4J37A 2R2RA 4MFBB 2VL1A 1PJ5A 3MMAA 4Z7CA 4JV0A 3ZZUA 1S12A 1X60A 1VDHA 2UUAF 4M5HA 4OYZA 1H6KX 1HR0J 2X1BA 3TWZA 2CYYA 1LXNA 4I7FA 1P27B 3THTA 1X7VA 2MZJA 1L5UA 2BMBA 2PIIA 1O0PA 4DUYJ 2ZE2A 3ZZ0A 4UQGA 5IWAF 3CD6S 4X62J 4UOFA 1HWUA 1CJTA 1U6FA 2AF6A 2EFNA 3HI9A 2B3TB 2B9YA 3D0GE 5GAGI 2OD6A 1LK5A 2HHSA 4N8NA 3CC2S 1SXLA 1L3SA 2XEXA 1JJ4A 2HHUA 3FZBA 1FD8A 3TR5A 2RDJA 3MMCB 1WKKA 1VOMA 5B0EA 4J7CA 4NZ7A 4ECRA 2ZDPA 2OAUA 4ZPDA 4MYTA 4KBIA 1IN0A 2ZH8A 3MPDA 2ZKUA 3GJRB 1KS2A 3TJ9A 1TL3A 4LRCA 4E8UA 1FX4A 2GVDB 1CJUB 4LSNB 1N34J 3QPIA 1EB0A 1FA0A 2WBRA 2CZ9A 1HBUA 5CYJA 1S59A 2VFSA 1ZAXA 2CJKA 4X4OA 1FWPA 2CAJA 3EWGA 2BRLA 5T41A 2XMMA 4K4WA 5IZHA 5M2PA 1S9EB 3MEDA 4B9TA 3HP6A 3EMTA 2HAIA 2V9KA 4P6QA 4M5NA 1XQIA 2JLGA 4KB7A 1DHMA 2A6OA 3AD7C 3BPSP 4B3OA 2Y3YA 3CO9A 4DFJA 3WIVA 5D0HA 3LGMA 2HVIA 4NCGB 4W98A 4IDKA 5D6GA 1YGYA 3PVXA 1WC4A 1ROFA 1JJ2R 1EAYC 3DLBA 4P75A 1TVRB 1UP1A 2VA3A 4JI2J 3DC2A 1NK8A 5DG9A 4NYZA 2VQEF 1ULRA 5ETSA 1RYRA 4JV2A 3TQEA 4N41A 5L39A 2HRTA 4ZA1A 2A2DA 3IRXB 3R7SB 4JI4F 4WU2A 1F1BB 5CYMA 5HLFA 1N5TA 2V4QA 4B3SJ 2GZOA 3PY8A 3KJFB 2DYAA 1LXJA 4B3RF 1F0XA 1TKTB 1FDAA 1C0UA 3WZ0A 4XO0A 2BANB 3KJVB 3HMJG 3VHQA 3IAS9 3QJPA 4CLYA 4FS2A 3E8OA 1Y7PA 4KE5A 2N3OA 2RHQB 3MURP 1J2VA 3QGHA 3HFKA 3P96A 2FZCB 2DGUA 5J2MB 4UZCA 2PSZA 1MU2A 4X64F 3NGKA 3TP2A 1NK9A 2Y1JA 2R3VA 5HMWA 3M6WA 1U02A 2FGCA 4OYAA 4HT7A 1MWZA 3G4SS 4PZVA 4AQYJ 3BH7B 4P9SA 3VR1A 1XNRF 3MCSA 1ZH5A 4UF4A 1NJXA 1WORA 5DZ7A 3OR1A 1OYDA 2FTRA 2GV1A 3MEGB 5CD4H 2RB7A 1VBZA 2AD9A 3JTOA 4ZVUB 1SKUB 2DIUA 1N36J 2DJWA 1TUGB 3HVAA 5KG6A 5KFJA 2QJ3A 5IT9U 4DCOB 2DR5A 1VR6A 4MK8A 1YJ7A 2CQCA 3HO1A 1S1UB 5BYRA 2F65A 1HBNA 4X84A 2QLJB 2JHEA 3FQKA 4Q44A 3AOBA 4DCPB 4X4VA 2I5JB 3I0RA 1VRTB 4DOZA 2CADA 1ZA2B 1NK7A 3PKYA 1FK9B 2M88A 3FBFA 3Q23A 4O3SA 1PC4A 5KFLA 3IC1A 3PIOQ 1SQEA 2FZGB 5GAEI 2C42A 1UVIA 4CIOA 4WZQA 1ICEB 3TYTA 3F41A 5EGYA 3S7RA 4B9NA 3JQJA 1IR1A 1VFJA 4DR6F 1FDNA 4KGZB 1T03A 2RJZA 3AHPA 2PD1A 2JX2A 2QYGA 4X2BA 4PPZA 1RWVB 2CJBA 3HHLA 2DNHA 1FWKA 4NX9A 3TQ1A 1QTNB 3ENAA 3BN4A 5EHHA 2XC9A 1VBXA 1XMBA 1LW2B 2FC9A 3A8IA 2RVJA 4I2QA 1KVKA 3CTRA 1GMWA 5ETKA 3W62A 4DPOA 3CCUS 4XPEA 4OZ1A 1S79A 4KHMA 4ZJLA 3FSXA 1LNQA 4CZCA 3D1HA 4OFZA 4ECVA 4DBQA 1T7PA 1BHNA 2WW4A 4PG5A 4E98A 4J9UE 2B6AB 3D54A 2QLWA 2ZOFA 1T9WA 2OKQA 4RO0A 3RRKA 1FRLA 2PE8A 5AT1B 1F9FA 4DV3F 2H3EB 5LM7E 5B7WA 3B82A 3KFWX 3CUNA 4IRKA 2HK3A 2ROEA 5F0UA 4PG8A 3OFHA 2IM2A 1KN6A 2HQCA 3GB0A 5K8PA 2QA1A 4J9RA 1V3SA 4JV1A 2GA7A 2GQ2A 1HW8A 3OVAA 2E5LF 2E9RX 1YX2A 2DXFA 1FJEB 1KBRA 1GNKA 3EVMA 3RYLA 2DNMA 2R2UA 4ID5A 4OYPA 2X51A 1HWIA 1R6VA 2N3LA 4K2JA 2R7WA 2AZ1A 3SFUA 1AUSL 3UN2A 3OL8A 3G71S 3VVUA 2ZUGA 2YX4A 5L46A 3FK4A 4QCLA 2AYGA 2CZ4A 3C15B 1CVJA 2AEJA 4HI1A 3VAMA 4MIWA 2GO9A 1C1CB 4NYPA 3TUPA 3MR7A 2E66A 1WF0A 4ILRA 4O3NA 2YNFA 4CTAB 4FPIA 2HEKA 2UXDF 2HFVA 1HARA 2CQ2A 4RU9A 2DY9A 4AL5A 2PMZD 4FVMA 5CABA 1ZPVA 2RS8A 1V9OA 2P6SA 1HNWJ 3IAM9 3HZGA 1S7IA 3C6TA 2HGMA 3CDEA 5I3UB 4JI3F 4DX8H 4HACB 2KM8B 2MQPA 4AD6A 3X3UA 1DLOB 1TL1A 3NS5A 1RWOB 4LRAA 3CJ5A 4TU9A 2J0SD 4LBHA 3VZIA 4DUZJ 1LWFA 2QN6B 3D28A 2AZ3A 3MD3A 2FHJA 3RBDA 3EGZA 2NPFA 2J9EA 2XCPA 5AXLA 2QLBB 1RTZA 3GPAA 3MPYA 2KRRA 4USWA 1I94F 2ILYA 1YG0A 4IFVB 1YITS 1RT6B 4DLGA 4X4UA 2WSFC 3OHAA 5KFAA 4OMFG 4IO9Q 3RZAA 2YBVA 3LP1A 2HKEA 3TVYA 3MPVA 2L9DA 2KJWA 5HVHA 1HNZF 3G6XA 2FY8A 3TJAA 2APOA 1UPMB 1KTQA 2HNDA 3DDIA 1D0EA 4KYZA 4ED4A 5ETLA 1S1VA 3MM9A 1J5OB 3Q89A 2UVWA 4IG3B 1PBAA 2QL7B 4USKA 3UCZP 1FEEA 1RTJA 5K8MA 4ZLNA 4GVLA 4G1QA 1DQ8A 2KHDA 3PZPA 2YWKA 5A8WA 4M63A 3MECB 3N6NA 1HNVB 1RKIA 1RT1B 4KFBA 4IYQA 3RG6A 1Y0HA 1GEHA 4DLEA 3W2WA 4M5IA 3FBEA 4ZN3A 2E1RA 2MLYA 5A8RA 5LSRA 2R7QA 3QSYB 3W9HA 5JVHQ 3DOMA 1RHQB 3T6JA 5GADI 4U7UD 2XMUA 1TKZA 3HXMA 3QATA 4IG0B 4D3GA 5IV4A 1K1SA 1VC6A 5LOQA 3CULA 1RCOB 9ATCB 4NLRA 4ECQA 3D0HE 2F9JA 4CRJA 1NK4A 2GFFA 3Q83A 3FKBA 2RS2A 4JI6F 3NG8A 4I6AA 3VQSA 1QAXA 1YKWA 2CJXB 4R0EA 4F36A 2MZRA 4XAKA 3IR7B 1GXUA 3TA1A 4F3MA 1R89A 1HNXJ 4NLDA 1Q8IA 2VKRA 3T5KA 2DH9A 5L38A 2W9CA 4B3MF 3OLBA 2YQ3A 1IKXB 3TAMB 4O44B 2KZMA 2XNQA 9RUBA 4A8XA 1N48A 4HL9A 1U26A 4KV8A 3J7YU 5L1JA 5SUHA 2CKWA 3DRPA 3OFGA 3R6LB 1AFIA 3C8YA 3LW5C 2P8IA 3PM9A 1UVMA 5KT4A 4NZ6A 1M5HA 2L48A 4FXDA 4RUHA 4P52A 2DR7A 4K7QA 1RLDA 2ROGA 2CA9A 3LGNA 2BJEA 2NSBA 1VK8A 4A8FA 2VFRA 1MN9A 4MYUA 3PDNA 3W3SA 1JLBB 2FPHX 1D8ZA 1OQ3A 5HROB 4I2PB 3LANA 3BH6B 5C25B 3EXYA 4OIXA 3FC9A 2C28A 1RTDA 1XMQF 4K4VA 2HQIA 1Q79A 2HFUA 2C3OA 1OO0B 3A3OB 1NDPA 3AQPA 3GILA 3N4WA 4BWMA 3H4BA 5D3GA 4WKRA 3AD9C 3IS9B 3N79A 2KXHA 3BKUA 5D4OA 1Q16B 2BACA 3FRZA 3VAGA 3NBPA 3NMAA 3M2UB 2QEXS 1XNQF 3T5JA 4L72B 1BD6A 1HQEA 2F7VA 3RW6A 4OJHA 3N0VA 3PACA 2AKWB 1ACMB 5CCLA 3TRGA 4DI6A 4OX9F 1VQ4S 3KTQA 4OV6A 5DZ6A 3Q8SB 3IWNC 4D3HA 2IA6A 3IWXA 5AXMA 2F4VJ 4FVCA 5KOWA 1HI1A 4KGVB 3W5ZA 5KFDA 2DNGA 4H4KA 4CLUA 1GFWB 2VH7A 2UU9F 2HVDA 4LBPA 2I8EA 1E6VB 2BM1A 2H65B 3CCVS 2W9BA 3QFHA 2CIMA 3V4IB 1VQ8S 4K5SA 4KHRA 1S76D 4OYWA 4UUXA 2IAJA 4GVBA 2FLNA 3IP0A 2UV8G 5B0AA 4ECSA 1TAUA 4Y6IA 1WACA 2MTLA 4KSEB 4OI2A 4TY8B 1CULB 4DFKA 1ZZFA 3IGVA 3M30A 2MGZA 4I4BA 2ZH4A 3KLFA 3I56S 5F8JA 2YXLA 2IVYA 3CVKA 1WC3A 2NXCA 3OSPA 4DS4A 2HQFA 1FO1A 1BMQB 1F9EB 2EW9A 2MKCA 4LRDA 1PBUA 5IS2A 5T7LA 2UVVA 1CJKA 1SC6A 1OSCA 3G2XA 3SXLA 1S6PA 2RE1A 2M8HA 3ZTOA 1PCAA 1X4CA 1VBYA 1LOUA 3FEXB 3DM2A 1IJEB 3E01A 2NPIA 4ZOSA 3CXCR 3GFYA 1URNA 1S6QA 1HQUB 1KRPA 3GIRA 4N7TA 6FD1A 1EQMA 1F6TA 1WHYA 2HNZB 3SSQA 4ZPAA 3C19A 4DUTA 3IM8A 2VPWB 1FFWB 3EPIA 1RI7A 2RNEA 1HBOA 2IA0A 4CLZA 1V5IB 3PR4A 4Y2CA 2LYVA 3UDVA 3O44A 1DTTA 2BOAA 3WBZA 3QGIA 2XO6A 4HR2A 3M6VA 2CPEA 3K58A 2KT3A 2UUBJ 1GX6A 3CCES 3CMAS 4DX7A 3T41A 5ETNA 3NNCA 4A8QA 3HVTA 3GONA 3KLEA 4Y2IA 2ZC3A 3CO0P 3KK1B 3DNCA 3GFXA 5ETOA 1LW0B 3DLGA 3FBCA 3ETOA 1KDNA 4ZK7M 1YJTA 4DSKA 1S77D 4DL6A 2C3YA 4DFPA 3KHHA 3L9ZA 4DV0J 2EKNA 2VKZG 1SJ4P 4FF3A 2NXUA 1REVB 3AQOA 2PGCA 2GGPB 4NEZA 1AT1B 4RUBA 1RA7A 1VQPS 5BR8J 3CJKB 2IM3A 2IYGA 5J2NA 2F1FA 1UTAA 2H54B 2D9OA 3ET6A 3MAQA 4I68A 1N4LA 3KLHA 5F3ZA 3FMBA 4M5JA 1JLAA 3OPKA 3J81Y 3DOKA 2VBYA 3AXMA 1ZM3A 1F2GA 3DLJA 5HP1B 2MXYA 1NRKA 4DMZA 1BQXA 5KFPA 4FF1A 5U47A 2EFGA 3LH2S 2X1FA 1FJGF 3MM6A 1YRTA 4JI1J 1N5QA 1BQMA 4NRUA 4DV6F 3KG4A 1QAJA 3EXCX 2Q1LA 1UW9A 5L1LA 4CM0A 5L1KA 2DNKA 4RLEA 1FHTA 1VS3A 2IFXA 1ZA1B 4N76A 4ED6A 2XG8A 3OXFA 3HX9A 1P9YA 3MUMP 5ETQA 2ALZA 2XWYA 1ZTWA 2IDLA 2YPZA 3SIPB 3VZHA 2OPRA 2GQCA 1NB7A 4QIGA 2RQ4A 2B4VA 1TMMA 1EQ0A 2QC3A 1RU1A 4USHA 4B08A 3RGIA 4DSLA 5HAOA 4DU7A 5HSPA 2V2QA 2C2MB 2PEBA 2Z58B 3BO3A 2X3DA 4NXMJ 3JSRA 4DV5F 3V5RA 2BEFA 1FDBA 1QLNA 4P72A 1I5OB 2AGQA 1VI7A 2VDHA 3PX6A 1HWKA 4Q8FA 3J7YI 4OI4A 4LF5J 2EC0A 1PJ7A 4HKQA 4I0WA 2ZBPA 3C16A 2CJ9A 2CPJA 1RAHB 1RGVA 2JNJA 4ETZA 4LJMA 4LF8J 4H54A 3BYRA 3C14B 2HW3A 1B0TA 2BQ3A 1J5EJ 1DRZA 1NBEB 1U6BA 1JKHA 3M2VB 1IKVA 3M32A 4OHYA 4CLWA 1OY6A 4GKJF 4LQ3A 4YB5A 3CJTA 3SQGA 4WTYA 1H2TZ 5F9LA 2HBQB 2XMTA 4RZRA 1FNOA 1IKYA 3EPGA 1L3TA 1RT5A 4FDFA 1KVJA 3V6KA 3KNGA 3CJ0A 4NA3A 4JI0F 4CT9A 4HYKA 1JLGA 5KFWA 4CCHA 1F5AA 2MMYA 3FMWA 5GMKa 5BJRA 3N5FA 2NQPA 1N5YB 4A8YA 2JZ5A 3TZZA 4LF9F 2G4BA 5D4PA 2ZH6A 3M6XA 4ANEA 1S1WA 1F5CA 1NJZA 5J1EA 3FRYA 2CG8A 1K47A 4ED7A 2R7OA 4KGXB 3BGLA 1TL7A 3PW4A 2J7KA 1FX2A 4HI2A 3TX0A 1O5JA 4O23A 5LMNF 1FTRA 3GFHA 3UN5A 5C24B 3MM7B 3NLCA 2GQQA 2PEHA 2BW2A 4DQIA 2ZNYA 2OGUA 4MMOA 4R5PA 1G7CB 3T6BA 2HMIA 3HHLD 4DR1J 1DTQA 4C8YA 2OLWA 2R42A 1C1BA 3PXGa 4DF8A 5DGBA 2CVEA 2MPUA 3THVA 1S1XA 4NCAA 4NLSA 2HAFA 2QLXA 4Q2LA 3D7SB 4TVAB 3DLLQ 2R4FA 3W8PA 2QLFB 1PGZA 3KHRA 4UUWA 2KXFA 1WNEA 1YJRA 4IDKB 1FXRA 3CJ8A 3SZ2A 3D1QA 3GJTB 1RHUB 2DVIA 4HEA9 4PG6A 2VODA 3OR2B 5K14A 4LFAF 3CD5A 1NEEA 2M70A 2FLOA 4QIWD 2BKPA 3TARA 1HYSA 2EFVA 4YS2A 4UOCA 3CCTA 2GHPA 1WHVA 5HLFB 3OBIA 4DV2J 4OI0A 2YVSA 1PILA 3M8QA 3VGTA 2JJ4D 2G0JA 4AL7A 2HBRB 4H4MA 1S1TA 1UEUA 1Q95G 2W7AA 1V3ZA 5K20B 2DY1A 2ZUAA 3LF0A 3PTWA 2VG7B 2ZOGA 5HBMB 1AB8A 2HGLA 2O3DA 1EIYB 3RAQA 2NUUG 4FS1A 2Q43A 1RAFB 4FYDA 2RT3A 3T1YF 3QIDA 1F3VA 2XGQA 1J27A 3HZEA 1KR4A 4YY3J 1U0HA 2W4PA 1WI8A 2Z0GA 2XI3A 2H5EA 1FVQA 4WBFA 3M8SA 3OR1B 2B7CB 2HFNA 2FD2A 3WHIA 1HW9A 4ZVFA 1G1XA 4DR4J 3DXBA 3TZXA 2YX1A 2FQQB 4X66J 2HNYA 3KMSA 1RSCA 2UP1A 1RXOB 3ILLA 1NHUA 1RU2A 2YNIA 3B78A 4DZ6A 1BXNA 1VQOS 1VQ5S 2IMWP 2MYFA 1UFKA 3QT7A 1ZM4A 3RUBL 3I0RB 3PJXA 1T3NA 4JV5F 5G0RB 1X9WA 3UCGA 3DGPA 1QSLA 2MDAA 4LQ9A 5E3AA 2FHJD 4A47A 2G1HA 2VQFF 1HMVA 2LDYA 3SSSA 3POTA 2V8VA 4JI8J 1VQMS 1NPRA 3M8ZA 2MSSA 4JP8A 4L3KA 4WE1B 2UUAJ 1NHKL 3HKWA 4OZ2A 4BC7A 2EPIA 3DI6B 4PWDA 4OI3A 2OPPB 4IH7A 5IOLA 3M9NB 4CQ1A 2Q66A 5B0FA 2MY8A 4R8UA 1NK5A 5GAHU 1BQNA 2MKYA 1ZOTA 2VZ9A 1P1TA 3DMJA 1X4HA 2RQKA 3QWUA 4I2QB 1IKWB 2W8KA 5CCMA 2ZJQQ 1H7WA 2IVFB 4YP3A 5KAKA 3J81U 5DM7Q 1LFWA 1OQ6A 5CZVA 4ZVGA 3HDSA 4TXSA 4PXEA 4PQUA 2WBMA 2Y1IA 2WVDA 1RHRB 3BF4A 4M8LA 3MFHA 3CCMS 1R0BG 5EX0A 4O3PA 2CVIA 2GJ2A 1KLMB 1Q4RA 3MM8A 1RT2A 3J7Z5 2GIQA 3V6JA 2IC3B 2QFIA 2ZJPQ 5AE2A 3K5OA 3RB4A 3L09A 1TAQA 3J7AN 4ID5B 4G3IA 1NSKL 4NXNJ 3LAKA 4QPTA 4UQTA 3W60A 4ELVA 3B54A 1N0VC 3GV8B 1RWWB 2VU5A 3EE3A 5DG7A 2YKOA 4USMA 2JC1A 1BLUA 1JLEB 2DITA 2WVFA 2WOMA 4OZLA 3G86A 1LK7A 1SCJB 1ZAWA 1YJ9S 1QTMA 3ZC4A 2YNFB 3CIMA 2OPSA 1QUVA 4ES3A 1T8EA 1U49A 4RUCA 1T9XA 5EN1A 4S0MA 3ISND 5EDWA 1YK9A 1EKRA 2VQEJ 4YDDB 1Z2LA 4H4OA 2FY1A 1AROP 2ASLA 2OH2A 2BXJA 1XTZA 2EFOA 4IOBA 5HI7A 4WF9Q 1N88A 2PA3A 2V50A 4ICLA 3KLGA 2BE2A 4JI4J 1FD2A 2VG6B 2CJAA 3D4JA 2W2QP 4LR8A 1WI6A 2R7SA 4B3RJ 2V34A 1XR6A 2E5IA 1VRUA 3QLHA 4WYLA 1VIOA 1N6QA 3KNAA 4ED1A 1RACB 1WOSA 5KFFA 1FXDA 2DEJA 2MEWA 4GC7A 5GMDA 4UW2A 2PI4A 5AJ3F 2CXEA 3MR3A 2ADCA 4F4ZA 4X64J 4QIEA 2Z56B 5K8OA 2EG1A 1A0OB 4WJBA 1PYSB 1TL5A 4ITSA 4USJC 5M2RA 4QIVA 4LRFA 4WFYA 3SMZA 4ANDA 1IVZA 2MHNA 4O4GB 4EUVA 4F4AA 1N5SA 1HR0F 1GX5A 3VGUA 2W2OP 4DV7F 4CLSA 2FHMA 4OJ3A 4ELTA 3KWMA 3Q8QB 3L7PA 3DCAA 5CYQB 1SH2A 3C2PA 3I32A 3CPWR 4WU3A 3H5UA 4AT1B 1FKOA 3W9IA 1S1VB 3FEYB 3DRRA 2BE9B 2V9WA 2MKSA 2FHKA 2CDRB 2BUNA 1RTJB 2H9ZA 2AT1B 3RRHA 3SFGA 2DO0A 4ZHRB 2NREA 5GVQA 1VJWA 3QGPA 3NOGA 4ZLPA 1VLYA 3D67A 1NDKA 4KR0B 3I6PA 5A0YA 3HSZA 4ZLLA 1PSDA 3HVWA 3RBXA 3RR8A 5E3CA 1M90T 1EKSA 3H20A 3MMBA 4OX7A 3UQSA 3HD1A 3ICLA 5B09A 2JC0A 1BWEA 4OZNA 1S7HA 2EXUA 4DX5A 5A8RB 1TKXA 5E0OA 3J80Y 3M8PB 4LT6A 2QMXA 2QSFA 3DOMB 5C5JA 5A6WA 4QZVB 2H48B 2M2BA 2AW0A 2D74B 3NMRA 4K0KJ 3SQOP 3MFIA 2VHGA 1AYEA 2DNQA 3U1NA 1VHFA 4DR6J 2P9EA 3HT3A 2HZVA 4L74A 1TKDA 2Q6BA 4AL6A 2LLZA 3FFIA 2KT5A 4KTQA 2XS7A 2ZZNA 4CNYA 6AT1B 2QO3A 3O5TB 2DO4A 3Q0AA 1OPIA 2GHWA 1FVSA 3A12A 4V19X 1VC5A 3SCIE 2RUSA 2KU7A 2D3OR 1Y5IB 2CNNB 2JWNA 2IIHA 2GCFA 5FDLB 1A7GE 3VAHA 2OFHX 3AOAA 2Z30B 4BWJA 1U1PA 4EZ6A 3NS6A 4CH7A 5A2QY 2Q3PA 4DV3J 3TUJC 4A8MP 4ZP6A 2DNPA 2MB0B 3D1OA 1HIYA 5AE3A 2ROPA 1R0AA 3AA8A 3FDSA 3KHGA 1QSSA 3MCNA 5I4MA 2E5LJ 4ECZA 2QL9B 2HWHA 4PPDA 3MR2A 1UJ5A 5F3TA 2BJ3A 5KG3A 4A48A 1Q78A 3ZZZA 5IFMA 1S48A 3CE8A 4ZJQA 1DY3A 4JI7J 2BRKA 1XBWA 1NM2A 3IR6B 3QRPA 3OL6A 1YBAA 1IBKF 3G8SA 4CM2A 5J2PA 3I96A 3MXHP 3DLKA 2HVHA 4J5OA 4OL8A 4K59A 3RB6A 2H4YB 2Z4PA 1FRIA 1XEZA 2PI5A 3X1LB 5D3GB 2AMCB 2IRUA 4N5SA 3FCVA 1FRKA 1U7LA 3OD2A 3ETMA 2UXDJ 3NBPB 2WTFA 4F04B 1FI4A 1Q8BA 2YNHB 3DRSA 1HQEB 3CCSS 1OY8A 1TV6A 4DN0A 1RADB 1LWEA 3PYDA 4JI3J 1UW4A 3MGJA 2P9CA 3AJ1A 3PW5A 4M94A 2HFZA 1U2FA 5LMUF 3HPOA 2L08A 4LF7F 4OJ1A 1N36F 2HWIA 3AJDA 4IH6A 3WIUA 4MIBA 4Q45A 3MUVP 3ZZYA 2BQUA 5CH7B 4DPWA 2WSEC 4NWBA 2WAQD 2G2ZA 2FVCA 2F8EX 4KAIA 4C2MA 2IAJB 2F8MA 3SV3A 5F8MA 1I94J 3MM5A 4IFYA 4Q0BA 1VQ7S 4OI1A 3MEEA 1PYOB 1R0CB 3F56A 4HDHA 2CDQA 3HD2A 3M30B 4FKYA 2AJ4A 2MGZB 1TUWA 3KLFB 1TFYA 4FBUA 4WFAQ 4DPXA 4HHJA 2DGOA 1HNZJ 4DS5A 1SH0A 4U9RA 1CJKB 4F3OA 1S6PB 3W1YC 5B0CA 5KFVA 4ZP9A 1X5TA 1X5OA 4NOHA 4R25A 1R8AA 3UN3A 1Z4UA 4M5DB 1IM4A 2CWXA 2WONB 2Z2MA 1MLAA 3NCPA 5I3PA 3ISNC 3Q2TC 5LT5A 4DV1F 4LVNP 2XI2A 1ZAVA 3HHDA 4BDPA 4WP9A 4DL5A 4USIA 1UWAA 4AFFA 1D3WA 4RW8B 5FJ4A 2C3MA 4ATNA 1XR5A 2GHVC 1DTTB 3US5A 5KFEA 1TK5A 3Q2SC 1U47A 2HLTA 2ERRA 1UVJA 4Q2MA 4KHPF 1WSRA 3D3CJ 2HIQA 2B8QA 4MKAA 1F3FA 3RB3A 5KFZA 4LSNA 3MI7X 2E5HA 4P74A 1FNXH 2QX0A 3KLEB 1X4DA 4URGA 4YR2A 1RT3B 3MAHA 4WFXA 3M8WA 3ZZRA 4B3TJ 2C22A 4B9SA 4ECYA 5D4NA 4WTOB 4LR9A 4A46A 1EP4B 2XSJB 2X1GA 1S9EA 4DG1B 3NL0A 3GYGA 4B3MJ 1U1KA 5KFBA 4PEOA 1GMVA 4A8WA 2BOPA 1JLAB 4F2SA 5E41A 3DOKB 4YUDA 5LXRA 1KWMA 3K8VA 1JLFA 5LJ5Y 3CJSA 2VG5B 3SBMA 2UVRA 4DSFA 1B3TA 1UA1A 2YWEA 1TVRA 3IBCB 2F63A 3NCQA 1JLQB 1LEOA 3I31A 3MR5A 3IMQJ 2BR0A 2DK2A 3RU0A 3NGUA 2D1CA 5JMNA 3TEGA 3PIPQ 1VQ9S 3SSRA 2W2MP 3S01A 2WRMA 1RHKB 4KRWA 2HS4A 4C8LA 3MAAB 1NCLA 5LXYA 3OSNA 2DNNA 1QVFR 1R7IA 1FEHA 3LP2B 3CJ4A 4TKTA 3FJ2A 3RJMB 3IO1A 2BANA 3KJVA 3K89A 2CNLB 2KI2A 1XMQJ 3BYPA 5KFNA 2M8DB 3KLIB 2AV5A 1NPPA 3TVZA 5J2MA 3J80U 1GQEA 2OEKA 2BE7D 3BR8A 1FWLA 3BO4A 5DLGA 2Z2ZA 5KG1A 1EZZB 3QRRA 4CO0A 1UZDA 7FD1A 1XNQJ 2XWXA 4FZVA 1Q8LA 3QT5A 4KIAA 3BJYA 2ZBRA 2V67A 1TL4A 5ETVA 1WHWA 2RF2B 2FVSA 1FCAA 4U96A 4OX9J 1IWAA 4HH1A 4J9PA 4FF4A 3MEGA 1IKVB 2M0GB 3B6BA 2ZHOA 4PUOB 1R3NA 4WFNQ 2KKHA 3W63A 2E5GA 2CG4A 1IKYB 2EG2A 1RT5B 3I5BA 2ZM6F 4FKXA 5H9EJ 2UU9J 3H8YA 4P7VA 5D4LA 2CQHA 4RW6B 2HPUA 2J9DA 3IN5A 2HQDA 1AZSB 5A2QU 1T9YA 2WVEA 5F8HA 1RAEB 1VRTA 2OJ3A 4NL5A 3QAUA 4ZPTR 3D66A 4TNOA 2A6MA 4ED0A 2IHR1 2CQBA 1XK8A 4BBYA 1S97A 1RB0A 3EYZA 1S6UA 1KQSR 4DL4A 2KB2A 1TL7B 4G1IA 2VICA 2KXNB 4K4YA 1K8AT 2LEBA 1A6LA 2DPIA 4F25A 3R5JB 4EBEA 2RAQA 2IYIA 4X4QA 4ED8A 2LEAA 4L3NA 1QE1B 1WTBA 1U24A 1Q82T 1ZM2A 2JFDA 1UKUA 1MSWD 3R5GA 5HJXA 2OTJS 2Q79A 1Y00A 2VA2A 4C9DA 1MW7A 4V19J 4YQWA 1DTQB 2PO4A 4OHWA 3GR0A 1C1BB 2QRRA 2ZH1A 2OEMA 2LVWA 4ZVQB 1RWKB 1S1XB 4ZJOA 3WQPA 1K73T 4QWCA 4K4ZA 2RMLA 3W2VA 2BJ9A 1F9HA 2B6AA 3ITHA 1CJVB 3GMGA 3ILOA 5KFOA 2XHCA 4F8RA 1NLKL 1AFJA 5DETA 3SCJE 5KT5A 2DGSA 2NS1B 1IR2A 4QU7A 4RL1A 5K14B 5CQGA 2W01A 3PEHA 2I9SA 2IPOB 2ZWOA 2GJFA 2CPYA 1G2EA 1C2PA 4ZIVA 4M95A 4YN3B 2ACMA 3P6YC 2V5HG 3LP0A 2ZH7A 3M8QB 2ZVIA 1EHWA 3H2VE 5JUMA 4H4MB 2W7PA 2OTLS 3PRVA 1S1TB 2MQOA 4NE9C 4RW4B 2P2CB 4A8KA 4KKOB 2JEIA 3MCMA 1VMBA 3U7JA 4E0DA 3QFWA 4PXBA 1SJRA 1KP6A 2VPXB 5GADU 2XYHB 2ZH5A 3KJQB 3M4XA 3VCDA 1C1CA 5KG2A 2COLA 3QMQA 3PRDA 5CD4A 4OX8A 2J7WA 3I87A 4TY9A 2KFZA 1TELA 3HKZD 1FJGJ 1RCXB 2FVPA 2MLXA 4RUAA 1YIJS 4Q5VA 1U0HB 3R5CA 1YTYA 3GG0A 3CW2C 1U0SA 2VV5A 4DV6J 3GCXP 1R43A 4NLQA 4RBVA 3CNQP 2VASA 2RQMA 1FESA 3EX7B 1GMUA 4MAKA 2NYHA 5K8NA 4O3RA 5I3UA 2YPYA 3VTIA 4ILMA 4TLQA 1GT8A 3S8SA 2HNYB 3OXLA 2HYIB 4OYOA 2YY3A 4LSLA 3TVKA 4FNHA 3T9NA 1NJYA 3I82A 2K3KA 1U2CA 2HFOA 4OZ5A 3VQTA 1VQSA 5I42B 1PAUB 2MZSA 2UUWA 4LVOP 4Q7AA 4JOUA 1HMVB 3POTB 3NGTA 3LOUA 3CJ2A 2B43A 1NZ8A 2U2FA 3A1YG 3D0IE 1WDDA 2LQJA 2DD8S 2YKMA 1RT6A 1T05B 5MLCV 5BXIA 1EJ7L 2N4DA 2O1PA 2ZBQA 1FRJA 3HK2A 2GS8A 1I51B 2ZZTA 3CC7S 2O67A 4JYAF 3OHBA 4EO8A 3JSBA 2CJQA 4GKJJ 2IJRA 3E51A 4YHHF 1BQNB 4CH0S 4IG3A 1JXEA 4B17A 1UJ4A 1JLCA 4RW9A 5FD1A 4PKDB 2ABYA 4X4TA 3FBBA 2YWFA 2Y0SD 3MECA 4YMEA 3AODA 1HNVA 2ILZA 1RT1A 4CLFA 4JI0J 3A8EA 2MQLA 4EYIB 2JL9A 3D6HB 5H9FK 4YDXA 1IBMF 1YWXA 4DL3A 2KDOA 2G13A 2BABA 2JEGA 3UDLA 4RJVA 4QW9A 3UD3P 4J9QA 4DSIA 1V5VA 4EYHB 5KFYA 4C7QA 3OTDA 3T5LA 2QA4G 3NAHA 5KFQA 1UAWA 5KG7A 1WC1A 4RNOA 5FLXY 1RT2B 3P45B 1VRQC 2EFQA 3R8YA 5LMNJ 4IG0A 1NDLA 4DHVA 2VDIA 1QUPA 3U02A 3V4MA 3AY0A 1GXLA 4ZDNA 4UY85 2ZH9A 2ZH2A 1DARA 3GG1A 4O4RA 2DGTA 5DO2A 3VVTA 2D9PA 4RW7A 4L6V3 3OTBA 4P73A 4LMZA 1RT7B 5HMZA 1X4BA 2QMUB 5HO4A 1HHQA 4L73A 2W25A 3EUNA 2DXEA 1UWBB 3G87A 3LPYA 4J9KA 2WSCC 2LDIA 1CS4A 1SL0A 1IKXA 1U1OA 3TAMA 2OSRA 4O44A 3TJ8A 1P8GA 2WOMB 1X9SA 3KLVA 2VOPA 4C0OC 4C8ZA 1HHTP 2FIUA 1HFEL 3BV8A 4IKAA 1Y4ZB 1NO8A 4UT4A 4OQJA 4UTGA 2CQGA 1YLXA 2V4JB 4H4OB 4F26A 4MKBA 4LFAJ 2UXCF 2WZ1A 3NY0A 4JI5F 1SC3B 3TA2A 1OSDA 1S0OA 4CO5A 3BKTA 1RKJA 4ICLB 2R7RA 1M1GA 4FPRA 3GIKA 3M2RA 1Z2ZA 4O3OA 2DGXA 3B4MA 2MZ1A 1MMLA 5IT4A 1JLBA 4OJGA 4I2PA 2F9DA 2MSTA 2GVZA 2UUCF 3KDOA 1VRUB 3QLHB 3H0PA 4LIWA 1MROB 2ALYB 4X4NA 4X65F 1T9TA 3UR0A 3GYXB 4FYVB 1C0TB 2LA6A 1E6YA 4IRDA 4ZN1A 4DL7A 1FNMA 1O8BA 4FYWB 2W9AA 1U45A 3L4BC 2ZWPA 4XDCA 3G96A 1RWMB 4QWBA 3IS9A 1QM9A 4J90A 3T1YJ 4K4SA 3I9V9 3BGRB 1FE4A 3EICA 3M2UA 1SUQA 1WKLA 5DM6Q 2XYGB 3KYLA 2FC8A 4PG4A 4MK7A 3R97A 2BV3A 3J7A1 2RU9A 2KG0A 4K4XA 2KVIA 4Y28C 1ZYQA 3TUZC 3OL7A 3JSMB 2ZKTA 3SCLE 1D9AA 1U1QA 3GQCA 2AGOA 1FKOB 4C11B 5L9NA 1ELOA 3MHYA 1OIAA 4OYBA 2GAHC 4UY8T 4ES2A 3QWPA 4ZPWR 2RRAA 2DHXA 1Y3KA 3EZUA 5B0GA 1FKPB 1CLFA 2KYXA 1L3UA 2YX7A 1E6VA 2J8AA 4JV5J 3IBFB 3V4IA 3K2YA 1FKAF 3PHEA 3JYTB 2VQFJ 3CCLS 3MMBB 3PO5A 3IXQA 1FERA 2DEIA 1TKXB 1HNIB 5KTQA 1CULA 1TR0A 4HT5A 2DHSA 2HGNA 2XB2D 4ELUA 1K0VA 1SKWA 3EZ5A 1KD1T 1HKAA 4WIIA 5KFMA 1Y5NB 4DU8A 2WHOA 3R3TA 2L9WA 4L75A 2DTJA 4LR7A 3FFIB 4Z2XA 2XMAA 4GO7X 2RQCA 3KG0A 2EKYA 3QO9B 5B08A 1N52B 4ER8A 2LQ5A 3AAWB 3VGVA 5JJBA 3VF0B 1K1QA 1IQZA 4DJBA 1HQUA 2EBGA 4N77A 2J8SA 4ZVSB 3ILJA 1SC4B 2LXFA 2CPFA 1HPZA 2HNZA 3PYEA 2VBWA 3FSIA 3W64A 3P49B 4RBTA 3NWRA 3IM9A 1WOOA 2DR6A 4NLOA 3GYNA 3HCXA 1QDUB 1N32F 1VQLS 1D8YA 4DR7F 4C3LA 1R0AB 2MLZA 1S72S 3CT9A 4TQRA 1CQNA 1JB0C 3KUGA 2ZEJA 5H9FJ 1RABB 3H98A 1FDDA 4F7VA 2HZCA 4EBDA 4PRFA 3KK1A 4IR1A 4WK3A 3H2UB 3MUTP 4ZPBA 3BR9A 4N56A 4AYBD 1B99A 2ZHAA 2FDNA 3FEZA 1SI9A 1RTIB 1VYAA 4J9NA 4DFMA 4MJKA 1LFPA 1YRXA 1NAQA 2Y0BB 4WFBQ 1YBTA 3I0SA 2NXNA 3G8TA 5J2PB 2LQ9A 4OZ3A 3K5NA 2XY5A 2DCUB 3PO4A 3BQ1A 2DT9A 1QY7A 3W9JA 3FGVA 4KPCA 4NA2A 1PKUA 3CD0A 2B9XA 3F44A 4PWUA 4XIUA 1S99A 2AHOB 4C98A 1HI0P 1FJ7A 3FQLA 5KOXA 1SL1A 3DRSB 1C4AA 2E1PA 2W2PP 3JQKA 1YSJA 2MZTA 1SC1B 5C2GA 3OLAA 1X0FA 1LWEB 2I38A 1R27B 2LMIA 4EO6A 2O5DA 4ZCLA 2RUGA 1F5BA 2EEYA 1RTHB 1RBOB 5AE1A 1D1UA 5DGAA 4BS2A 2Y1LB 1HBMB 1YHQS 2XYPB 3UVJB 3F73A 5AJ3J 3DLEB 5BYQA 3FVYA 5ADZA 4RU2A 3Q8UA 2FVQA 5CA5A 4Q0BB 4GRSA 1XN9A 3MEEB 3TAQA 3I5AA 2M52A 4K2XA 7AT1B 3DOLA 4I56A 2J6UA 4PYAA 5FLXU 1WWHA 1Y10A 3BDEA 2WK4A 2YKPA 4WWSA 4DV7J 4J9LA 5LSLA 2R2TA 4PG7A 1DJ0A 2YKAA 3O3LA 4A4JA 4USVA 5KFTA 6FDRA 4C8OA 3C14A 1UMJA 1WDTA 2YQ0A 2KJVA 3M2VA 2UXBJ 1VIXA 4NPOA 4FXWA 3BBCA 2J6SA 4N47A 1NZAA 3U1LA 2XMJA 2KG1A 4F4KA 4FYXB 3V2UC 2HS0A 3NGSA 4C8NA 2L9NA 1YZ6A 2JEFA 4XPCA 1SKSA 4IRCA 1M5SA 2BKOA 1RHMB 4LF2A 4KH0B 2K7KA 3KDNA 2L3MA 4DL2A 2XNRA 1N5YA 1VGYA 2E1MC 4P10A 2ADBA 4FYYB 1MG7A 1JJCB 1NKEA 2KFNA 4QIFA 3JS9A 1H2VZ 3A4TA 2CJYB 2KFYA 2BW7A 3LWLA 1QVGR 3RB0A 3I9ZA 3LPEA 4F02A 4HTIA 2VFUA 4RX6A 1X4EA 1YJUA 1RZMA 3RBZA 4IQXA 5E7OB 5BYSA 1YDLA 2KH9A 4F50A 5C24A 2RSQA 3MM7A 2DRAA 5F0WA 4ED2A 5H1SV 2CPDA 4LFCF 4OX6A 3DLHA 4NXNF 3L7OA 2A2CA 2G9OA 2RH3A 4DR3F 2KHCA 1W26A 4Y34A 5A8KA 4PQAA 3BSCA 3OUYA 3R5DA 1KVIA 4DV4F 4NI2A 5IXUA 1NK0A 2XHWA 4OHVA 1FRHA 3AD8C 2XMKA 4PR6A 3HJFA 2GMJA 4OV1A 3DKDA 2DKOB 1JLFB 1AW0A 2FLPA 4W92B 3PFEA 1F2HA 7FDRA 5A6PA 3QGGA 2ZVSA 3BS9A 2VOOA 3H40A 3QQCD 5E3RA 2P5VA 3GLJA 2RKIB 3KOAA 3M9OB 1X0PA 4LUBA 3ZZTA 3OR2A 4WFZA 4DR2F 1FT8A 2NR0A 3ONQA 2GIFA 4P2FA 2VBXA 2NYIA 1NHVA 4NLPA 4PXDA 2ACYA 3OJUA 2J0WA 2LA4A 1JMTA 2JDJA 2D7SA 3FCHA 1OWXA 4CWBA 1HHSA 1G4CA 1IBKJ 1SQGA 2ZD1B 5K5MA 1RQ0A 3RR7A 1WC5A 3QT6A 4KJIA 3DDKA 1H73A 5DJBA 2JVOA 5IC4B 4EK2A 2HK2A 2M7SA 4KH1B 1T95A 2AU0A 3HHKA 2G0IA 2GO8A 2VG7A 1DAXA 3BREA 5HBMA 2AJ0A 1DQAA 3NNHA 3M8RA 1S5ZA 3GCWP 3NCRA 1DFDA 2HRYA 2NCKL 2NLWA 3MMAB 1JNRB 1JNZB 2AJ2A 3OW2R 4NLXA 3Q86A 3PW2A 2DHAA 1V6HA 1U6ZA 3D6FB 4I7FB 4QOTA 4ZLJA 1PYTA 4PXCA 3T1AA 2XZWA 4LF1A 3CEDA 2J9DE 4ENOA 2FJXA 1CC7A 1VBKA 3OJSA 5F8GA 3C6UA 3OT9A 4B9VA 5B0DA 4FNIA 1W25A 2ZE2B 2CPXA 5LMUJ 5DS7A 4LF7J 1WJ9A 5DLFA 1WELA 5HMXA 2BQRA 4O0NA 1CJTB 4K8RA 1B70B 4X4SA 3T3FA 3N6MA 3LWMA 2HHWA 3IG1A 3CGIA 1U09A 1SB6A 5G0RA 2FJAB 2J9CA 4DR5F 1QD1A 2HS3A 5KFGA 4R0JA 5DDOC 2V8HA 4FP9A 4Y00A 3NWGA 2LP4A 1RDRA 4DDFA 2CWKA 4WE1A 3H7HB 5KG0A 4U95A 1D09B 4I67A 2B9WA 2KZZA 1TL3B 4K0KF 2EVZA 1LWCA 3DI6A 3O8WA 2J5AA 2OPPA 1RJJA 3OVSA 1B0VA 1IBLJ 1UPPA 2HRUA 2V68A 1HBUB 3BSAA 2ZBCA 1IQTA 4JB8B 2Y8YA 3T19A 4U6PA 3T9ZA 3UDEA 4NLVA 2W1BA 3CIZA 5LSOA 1VISA 2MY7A 3BKFA 1UZHA 1K9MT 1UA0A 4ZVRB 5HQ8A 2AYMA 2V6AA 3DXSX 2FJBB 1IKWA 2Z2LA 2GMHA 1S57A 2DBBA 3MEDB 4WP8A 1R31A 1KTVA 4DV1J 2ZNZA 2G2YA 3CDAA 5JXSA 4J9SA 3BM7A 3W2VB 1F60B 4B3OB 4C4WA 3ITHB 2I6WA 1K44A 3C66A 1B4SA 4ZPCA 1Q8KA 3R6GB 1WOPA 1BY9A 3DYAA 3MF5A 1HA1A 3UPFA 2Y8WA 3RAMA 1KLMA 4KHPJ 4DN9A 1X5PA 2YWWA 3PHTA 1SL2A 4OZJA 5EWGA 2IC3A 3Q8VA 4LFBF 4EZ9A 3RTVA 3KMQA 2ATCB 3D3BJ 3EM1A 3OTOF 2HHVA 1N33F 2BKNA 4CYUA 1JQGA 3OFFA 5CYMB 4QWDA 1UEVA 2XMWA 3ZNUA 3BDPA 3LP0B 4LSZB 4JI7F 3R5AA 4OYMA 1C0UB 4C3KA 1WKJA 3BSNA 3GFZA 3T1HF 1BUXA 5E2QA 3UD4P 3DFEA 5C7PA 1H3DA 2ATLA 3B4DA 1NH8A 1WTFA 5J2QA 3DN9A 1MU2B 2H51B 4TYBA 1WD6A 1RT4A 2HWTA 3M05A 4LF4F 1JLEA 1Q0NA 3GIIA 2Z8QA 2R8JA 1U1LA 1PC5A 1RWXB 1AA1B 4RPFA 2V63A 4XDDA 3SYZA 2V4RA 3P8BB 5THWA 4ZCIA 2HQGA 3UR3C 4X4RA 5CAAA 2ZHBA 1CSJA 4F0MA 1SVDA 1PG5B 3AFGA 1O6XA 1QAYA 2ASYA 4OHZA 4G65A 2X3GA 5D0GA 3BQ2A 4KO0A 2OD4A 2VG6A 5M2UA 1TK8A 3D6TB 2A1BA 3BB5A 1U25A 2QE5A 3V6DA 4LSLB 3BBFA 2BX6A 2QT7A 4FF2A 1HBNB 2JVRA 4WXWA 5DDQC 1HL6A 1UJ6A 3MPUB 1Q53A 1X4FA 1DBDA 2A3JA 2XBPA 2KT2A 2CQ4A 2V94A 2KO1A 3LUYA 4B9UA 2B51A 2W4CA 3KXDA 3CC4S 2V8GA 4RNHA 1W2BR 4CNZA 1SIZA 3VAJA 2GJIA 2E1AA 5HVFA 2RD5C 2X7IA 1HWLA 4DF4A 4MTPA 2YKMB 3PFOA 2SXLA 1VQYA 4O4GA 1FTCA 2D3ZA 4K5RA 2C2NA 5LL6d 1OY9A 2HHXA 2D69A 4RR5A 2B9EA 2DH8A 2AQ4A 2R2SA 2IY5B 4GKKF 4DSEA 1ZS6A 2HFSA 2A10A 1OPZA 1T3OA 1T03B 4J91A 2R7VA 5CYQA 2R7XA 2VC0A 1WEZA 3HHLB 5IWAJ 5ETRA 1EETA 4YFUA 2DHGA 5F8NA 1IWGA 4RW9B 1JLCB 3K7RA 4I6YA 3G6ES 4U8YA 2ZM6J 1PJ6A 4OHXA 2ZOMA 5HK4A 4ZHRA 1T94A 1VJQA 4IR9A 2HURA 1NJWA 5D8HB 2V2KA 3CDWA 1Y11A 3D9BA 2V2ZA 1Q5VA 4ES1A 2H1YA 1XMOF 2IM1A 2ZH3A 2WW8A 2JH3A 1KQGB 3MOJB 8AT1B 4BHQA 1M1KT 2Y9HA 3UI3A 4KQZA 5MAOA 1I1GA 2MZQA 3V81A 3M8PA 2RHSB 3H90A 3N5BA 1JXVA 3ILIA 4JBCA 3M1VA 2QFJA 5F8IA 4YB6A 3TEHB 2MJNA 3NRBA 4EFAC 1TK0A 1W2IA 2DNYA 3BO2A 1RAGB 3KJNB 4O3QA 4ZP8A 2B5JA 3MPWA 2N7YA 4B3TF 3EDRB 2ZC4A 3G82A 1X5SA 4RW7B 2RRNA 1RP5A 2QZ8A 2E44A 4Y3CA 2M5YA 1MMDA 2QSWA 3A13A 4Y2AA 4LF6F 5FDLA 2KTQA 1CS4B 3DU6A 4DPUA 3FNNA 4RKUC 1XWLA 4KC5A 2R8IA 4PABA 1RBAA 2NZ4A 4OLPA 2HSEB 3KK3A 2F5GA 2AJ1A 2KM8C 2XGPA 2GIRA 5B0BA 3TANA 2R8HA 3CCWA 3QAEA 3BGFA 3HSGA 3N28A 3CMES 2OPQA 1ZM9A 2AJFE 4GMKA 1NSQA 3C6TB 4ALZA 2FJDB 2BA9A 3M2RB 3BPDA 2VBZA 1R8HA 1KHVA 5EX3A 4A8SA 4QR0A 2G2OA 4QWAA 1TL1B 3H5XA 3DU5A 4IQMA 2C1EB 4FN5A 3H59A 2GVZB 2OUGA 2KRBA 2V0NA 3CJ3A 1LWFB 4E2FB 3Q8PB 2VC1A 2EI5A 3L7UA 4MH8A 2NZCA 1LWXA 2OFGX 1SKRA 4J9VA 3K57A 2RRBA 2YKNA 1E6YB 2HHHF 3LGHA 3THPA 3TZYA 1UL3A 1RISA 3MZIA 2WCXA 3P5BP 3ELHA 1RAOA 3EJMA 1QAIA 1B7YB 2G1DA 1KQKA 4C3MA 3GIJA 3PX4A 2CNKB 2GC8A 1XNRJ 3MTKA 2DPJA 1SUQB 1UETA 2YNHA 3EGNA 3I4HX 2BBEA 2XQCA 2XM3A 1VLOA 3LP1B 2DGQA 2B7BB 3PKMA 1C4CA 3J7ZT 2YNGA 1P1LA 1RAAB 1SQFA 5L8RC 2FB0A 4B9LA 3BGOP 5DDRC 1BGXT 2HNDB 3AB4B 4ZIWA 1WG5A 3MM9B 3R9LA 4DUYF 3HSDA 3MWBA 4RNNA 4X62F 1SV5A 4G1QB 1WHXA 4NYOA 4ZVTB 1KEKA 5G4DA 5A8WB 4DQRA 3NXZA 1S10A 2FVRA 3CDBA 4NLUA 1XJWB 1SBRA 2N7CA 1FRXA 2YWHA 4KFBB 4HVZA 3CDUA 4CLPA 3MDFA 3LTOA 3B8HA 4U7CA 3W2WB 1G3OA 2YQ1A 1ZZNA 5HN0A 3QYYA 1NKCA 3GU0A 1NNDA 1L3VA 1YQHA 2K1RA 4WK1A 2YTCA 4BCAA 5DDPC 5DQIA 1AXQA 3NGDA 2RIJA 5L9XA 2V8PA 1TKZB 2B4PA 1WEYA 2GAGC 2XZTB 1U1NA 4JYAJ 2E9ZA 3UW1A 3DHXA 1U1MA 4QW8A 3MCOA 1N34F 1NXIA 2OELA 1PAEX 4P71A 1IR0A 1MWQA 4C8KA 1Q1KA 4YHHJ 3H4DA 2J0XA 3RRGA 2BJ8A 3SDEA 3VGSA 3QIPA 2EK6A 2FUG9 3PJWA 2MJUA 3I5CA 2VF3A 1H2UX 4M5DA 3K0JA 5D0EA 3ZTQA 1FJCA 2WONA 3GWCA 1GK8A 1S0NA 4HDGA 3TX8A 3CWJA 3AXKA 1KKHA 1HPZB 1OJ4A 2W9CB 3U27A 1UFLA 1H7XA 3UNYA 1KNZA 4ZMMA 1IBMJ 3W7BA 4OYXA 4Z7YA 4KV8B 2W24A 1SPBP 2LU1A 3OV7A 3DRPB 3KK2A 1U2RA 2CZVC 4RW8A 4QQBA 1UVKA 5KT3A 1IXKA 2WB4A 3PW0A 4EU0A 1WF1A 4HHUA 4JI2F 4HLBA 2ZZMA 4I1TA 1MWYA 5ITHA 5KFCA 2LECA 2PN6A 4OYIA 4WIQA 1CBKA 1IUJA 3RW7A 1RT3A 5HANA 4EEYA 4MK9A 4P2SA 5IM0A 4QPXA 5C42A 4ERDA 4B3SF 2OMOA 2P6TA 3CB4A 1NPKA 2C2DA 4BC9A 1EP4A 5D15A 4ETXA 2XSJA 4TU7A 2R7UA 2CRLA 3I0SB 4M5GA 2R8KA 5ETMA 4DPYA 5LJ3Y 1RTDB 3WDOA 4DG1A 3GE9A 2NUHA 1DQ9A 4TYAA 3PJ9A 4WZMA 1SJ1A 5IC6B 1WUUA 1S9GA 2E7XA 3KUHA 1DZ5A 2BZ2A 4M5KA 2AX0A 2DNOA 2VG5A 2CPIA 1FFGB 3G6VA 1X31C 2E5JA 2BDPA 2BYCA 4ED5A 2ZITA 4AQYF 1TMJA 2LU2A 3BZQA 1P9QC 5H9EK 3WX4A 2UXCJ 4JI5J 3EGVA 2IDEA 1DURA 1S4FA 2I0XA 2X1AA 1JLQA 4CLKA 5CZXA 3JAMY 2JLFA 5KT6A 2H5IB 4QR1A 2MHEA 1I6JA 1VQ6S 3VWSA 4ZCKA 4LIRA 5AXNA 3CCQS 1R8BA 3TI0A 1RHJB 5L1IA 3D68A 2BJ7A 3MAAA 1H72C 1ZPWX 2UUCJ 1R6YA 3A3PB 3PRBA 3LP2A 3W65A 3HVRA 3T5HA 3R27A 2M4MA 1KOOA 3GV5B 1GAOA 2CPHA 5DQGA 4X65J 3RBEA 3TZWA 3EZOA 3FSYA 2W9BB 2PFDA 2M3DA 3TOQA 4FBTA 4U67Q 4IH5A 2A18A 3UWTA 3KLIA 4GVBB 3EVWA 2N82B 2MQMA 4CP5A 2GNKA 1YZ7A 2C2KB 1K0TA 4MFBA 4P7TA 3W5XA 3QRQA 3DOLB 1HLWA 3ENWA 3FZ2A 3MEKA 2K8GA 3ZFVA 1FF2A 3BQ0A 3UE2A 1NKBA 3PW7A 3GZ7A 4C6AA 1URRA 2NXEA 1WSVA 2RF2A 2CNOB 5CHCB 5T7LB 2OO4A 2ZJRQ 2ZBIA 2F8HA 1NU4A 4RWXA 2PDAA 4J9MA 3D6MB 4EWTA 2QA2A 1CEZA 1RAJA 2DR9A 4M5MA 1JK9B 3DM2B 3E01B 4PUOA 3CCJS 2CPZA 1M1HA 2LEPA 1S6QB 2LQ8A 2W7OA 5KFSA 2YKQA 3QZ7A 2F4FA 2LQBA 3GV7B 3LO3A 1TZ0A 1PO6A 1QSYA 1P6TA 4RW6A 4CT8A 1AZSA 2FJWA 1Q7LB 4G1PA 4F3QA 3W66A 2IRXA 1T0TV 3PNIA 1HBOB 3H5SA 4KPYA 3MMCA 4QU6A 3R1HA 3VALA 2LXIA 1FE0A 4JUZA 1CQMA 4MIAA 5EWFA 1JJHA 1KFDA 3K5PA 2KN4A 2FLLA 2JEJA 3QJJA 3WX8A 3HULA 5T14A 2XZDB 2RU3A 2GVDA 4F0KA 1CJUA 1HWJA 2K06A 3MMJA 3HVTB 2L41A 2XY7A 2B56A 3KHLA 1QE1A 3ENVA 2F40A 3DLGB 1NSPA 4JI6J 2PC6A 3ULHA 4C8MA 3IGNA 2HHTA 2RDDA 3R7NB 2W4DA 4YR0A 4YOEA 1GTEA 5I3QA 4NA1A 2QL5B 1S6OA 5A8KB 4C48A 2K2PA 3OUYB 5J2NB 3GTYX 4NI2B 1NJIT 1GMWD 3SCKE 3AB2B 3ET6B 3G9CA 5JVGQ 3KLHB 2HHQA 3W8GA 2O01C 2QGFB 4CH1A 4UZBA 2DIVA 2CQPA 2PMWA 2DNLA 1CJVA 3PR5B 3HLUA 4IO1A 1RLCL 4NCGA 2B4UA 1M5VC 1IM6A 2CUYA 1N32J 3NS7B 3FCWA 2OI2A 2WB1D 4ZPVR 5KG5A 4DR7J 1FRMA 3MM6B 1D9FA 1BQMB 2HZAA 2DXDA 1ZBTA 3S1TA 4OI6A 2HIYA 1HNWF 3ENQA 3HF5A 2UUTA 4ECXA 2AYEA 3IRXA 3HHNB 1OYEA 4GC6A 4NEYA 2XULA 2J76E 1MN7A 1XC9A 1S4EA 2XY6A 2IJNA 1TKTA 3OTCA 2OPRB 4DUZF 2C2OB 4RW4A 3G8QA 1B7FA 2VIHA 4KKOA 5HATA 3UO0A 4ZS6A 1NB2A 4ZKAA 1XR7A 3MR6A 4QYZK 2XTJP 5HVGA 2VUGA 2D3UA 3AJ2A 3EVOA 2EK1A 2FYXA 3KKFA 1UVNA 2VD3A 1IJFB 4DQSA 8ATCB 2BVZA 1M5OC 3C16B 3A8JA 4U8VA 2AYBA 5FIIA 2E7WA 1NH7A 3C6UB 5KT7A 1JKHB 2R7TA 1IBCB 4YB1P 3TAPA 2AEFA 3IR5B 1W7WA 4I69A 3M32B 2CQ3A 4P2MA 2UZAA 3C3LA 3SQGB 2WVBA 1ZETA 2VPYB 2NSCA 1U4BA 2LFVA 2KVQE 2Z2YB 1ITPA 4URSA 2GW8A 1H0HB 3W5YA 4B02A 1I3OB 2P9GA 1S1UA 2KL8A 3HFZB 3NNAA 4K4TA 3IG1B 2I5JA 2MKJA 4Z37A 5IT0A 1JLGB 5I42A 1PIEA 3K5MA 1KQFB 2BM0A 4F0HA 8RUCA 1UFWA 2C3UA 1FK9A 4AXJA 3C46A 3P3DA 1WC0A 1S1WB 5KFHA 5J1EB 4DL0C 5DQHA 3VAKA 5HMYA 1T05A 3JQMA 3M7VA 1LWCB 3CCZA 2EFPA 2B4OA 4FXVA 5E3QA 2ZDOA 4LREA 2VFTA 5ETTA 1QJHA 3U1MA 2V8DA 1TU0B 4KGKA 4RNFA 2B8PA 3ADAC 1EX8A 1N54B 2DRBA 3N9UC 2IM0A 4CDIA 4QWEA 5K9FA 2ASDA 1TQLA 1XERA 1VQNS 4R5PB 4OLOA 2HMIB 5EUHA 1WF2A 1SJFA 3UDCA 1LW2A 3SI8A 3HJVA 1BE4A 1UCNA 4EMDA 5AXKA 2EC2A 1HNXF 1APSA 5J1NA 4UOGA 2OIHA 3CJQA 1M5KC 3L3CA 2IJFA 3IBWA 3R7BB 4P2XA 4DEZA 2QYCA 2XLKA 4YB7A 3JTNA 1UVLA 3HM9A 2PA8D 4L76A 3PCOB 3R2CJ 4M5LA 3DYAB 5DG8A 3D5MA 2AJQA 2AX1A 1N5VA 4Y65A 4XK8C 2MKHA 2XS2A 3JAMU 1Y3JA 4EBCA 5D77A 4U7UK 1GTHA 2O66A 1T02A 1O51A 1GXTA 1NK6A 1HYSB 4CYUB 2V2VA 3KUEA 1N8RT 3J81j 4XTTA 2EBEA 1VC0A 1MNEA 2G0CA 3OQ2A 4TU8A 2KYZA 3O1LA 4Y0FA 4LFCJ 4GO5X 3HSJA 4W4MA 4CO4A 2AIRB 4C0BA 4NCBA 1U8SA 4DR3J
chains in the Genus database with same CATH topology
1TFYA 1RT7A 1NK4A 4QR2A 2GFFA 4FBUA 3NCRA 4OZ0A 4WFAQ 2LCWA 2RS2A 4HHJA 3NKYA 1DFDA 2HRYA 2NLWA 4JI6F 3MMAB 1JNRB 1JNZB 3NG8A 4I6AA 3VQSA 2DGOA 1QAXA 1UWBA 4DS5A 1SH0A 3OW2R 4R0EA 4U9RA 4ECUA 2MZRA 3NAIA 1X9MA 4NLXA 4F3OA 4XAKA 5J2QB 3IR7B 1GXUA 1S6PB 3PW2A 3TA1A 4F3MA 1R89A 1RT4B 1G6BA 4NLDA 2K3IA 2E1CA 2DHAA 5B0CA 5KFVA 1V6HA 1Q8IA 2VKRA 2XMVA 1U6ZA 4I7FB 4QOTA 2DGWA 3T5KA 2DH9A 4PXCA 4ZP9A 3T1AA 1X5TA 3H25A 1X5OA 2XZWA 5L38A 4NOHA 3CEDA 2J9DE 2DNZA 2JRSA 2W9CA 4B3MF 4R25A 2FJXA 1R8AA 1CC7A 4CO2A 4CTAA 3TO8A 1OS5A 1Z4UA 4HTJA 4M5DB 3OLBA 3OJSA 5F8GA 2YQ3A 1IM4A 1IKXB 1YRUA 2WONB 3C6UA 3PEJA 3TAMB 4B9VA 4O44B 2KZMA 5B0DA 2XNQA 1AUDA 2Z2MA 4FNIA 3NCPA 5I3PA 1W25A 4A8XA 2ZE2B 3ISNC 1U26A 2CPXA 2V4JA 4HL9A 4KV8A 5DS7A 3J7YU 1N48A 4DQQA 5L1JA 1Q81T 4WKYA 5SUHA 3Q2TC 5DLFA 2J0QD 1WELA 5HMXA 5LT5A 2MQQA 2BQRA 2CKWA 4DV1F 3DRPA 3OFGA 4RNMA 4LVNP 2XI2A 4X4SA 3T3FA 1AFIA 3C8YA 3LW5C 1ZAVA 3PM9A 2N4CA 3HHDA 4BDPA 4DL5A 3N6MA 3P5TL 3TNVA 4USIA 4KO0B 1UVMA 1DLOA 5KT4A 4NZ6A 1FXLA 4AFFA 1M5HA 3LWMA 2HHWA 3IG1A 2JLEA 1D3WA 2L48A 3CGIA 3E3XA 4FXDA 4RW8B 4RUHA 5FJ4A 1U09A 3V6DB 2C3MA 2YNIB 4ATNA 1XR5A 1SB6A 2GHVC 2YWGA 5G0RA 2DR7A 3I4PA 2FJAB 1DTTB 2F4VF 2ROGA 3LGNA 2J9CA 2BJEA 2NSBA 1VK8A 4A8FA 4DR5F 2K7JA 3US5A 3TW0A 5KFEA 1TK5A 2HS3A 5KFGA 2DB1A 1MROA 2RDIA 2VFRA 4MYUA 3Q2SC 1U47A 2HLTA 3PDNA 2ERRA 1UVJA 4R0JA 4Q2MA 3W3SA 5DDOC 4KHPF 1JLBB 2FPHX 2V8HA 4FP9A 4KGMA 4Y00A 1D8ZA 1OQ3A 3NWGA 2HIQA 5HROB 1HI8A 1RDRA 4MKAA 4I2PB 3LANA 2R9LA 4DDFA 1C0TA 3OTEA 3RB3A 5KFZA 4WE1A 4LSNA 3MI7X 2DNRA 2DGVA 5KG0A 2E5HA 1FNXH 2XO7A 4ZVEA 3KLEB 1X4DA 4URGA 4YR2A 4I67A 1RT3B 3MAHA 2B9WA 4WFXA 2KZZA 5C25B 1TL3B 4K0KF 3ISZA 2EVZA 3EXYA 1M0SA 1LWCA 3DI6A 4OIXA 3O8WA 3AA9A 3ZZRA 5HL7Q 2XS5A 2C22A 4B9SA 1TP7A 2J5AA 4ECYA 2C28A 2OPPA 4IFVA 1RTDA 1XMQF 4K4VA 2HQIA 1Q79A 3GSDA 5D4NA 4TN2A 2C3OA 1RJJA 1OO0B 3AQPA 3OVSA 4QYRA 3GILA 3N4WA 4BWMA 3H4BA 1B0VA 4C0HA 2OMLA 5D3GA 4A46A 1EP4B 3BGRA 3HHLC 2HRUA 4WKRA 1SJ3P 4PWDB 2XSJB 1HBUB 2Q6CA 3BSAA 2X1GA 2ZBCA 1IQTA 3IS9B 3N79A 3T19A 4U6PA 1S9EA 3T9ZA 2KXHA 4DG1B 3IWLA 3NL0A 4NLVA 5D4OA 1Q16B 3CIZA 1U1KA 2BACA 5LSOA 2MY7A 3FRZA 3WC2A 5KFBA 3JSMA 3VAGA 3NBPA 1K9MT 3NMAA 1UA0A 3M2UB 2QEXS 2DCLA 5HQ8A 1XNQF 2AYMA 4A8WA 4QYZJ 5F41A 1JLAB 3DXSX 3T5JA 2BOPA 4L72B 4F2RA 3QZ8A 5E41A 2FJBB 1IKWA 4R8UB 1BD6A 3DOKB 3UFCX 4YUDA 5LXRA 2Z2LA 1HQEA 2F7VA 3RW6A 2GMHA 3K8VA 3LAMA 3N0VA 4OJHA 5E33A 4C11A 2DBBA 3MEDB 1JLFA 2UXBF 1R31A 5LJ5Y 1EETB 1J5OA 1X8DA 3PACA 2VG5B 4F4YA 3I55S 1KTVA 5E3PA 1VQKS 2HQ3A 2UVRA 1WG4A 2ZNZA 4QJVA 5CCLA 5KT2A 4DSFA 2UVUA 4ZP7A 3TRGA 3CDAA 3DMJB 5JXSA 4J9SA 4OX9F 1UA1A 3BM7A 3W2VB 1F60B 4B3OB 2YWEA 1TVRA 1VQ4S 3ITHB 3KTQA 4C4WA 1FKPA 3Q8SB 3QJLA 3C66A 3GR1A 3IA0A 4ZPCA 3N01A 3IWNC 4D3HA 3NCQA 2IA6A 1JLQB 3PX0A 3I31A 3MR5A 3IWXA 1BY9A 3TA0A 3DYAA 2BR0A 3MF5A 1HA1A 5AXMA 4I6WA 2DK2A 4FVCA 4N8OA 5KFIA 3RU0A 3UPFA 5KOWA 1HI1A 3BEGB 4WCEQ 5KFDA 2DNGA 3RAMA 3JYTA 4H4KA 3Q24A 2D1CA 2VH7A 1KLMA 3PIPQ 2UU9F 4PQUB 1VQ9S 3SSRA 3S01A 2WRMA 4DN9A 2I8EA 1E6VB 2BM1A 1X5PA 3CCVS 4KRWA 1HNIA 1WG1A 2HS4A 2W9BA 3V81B 1SL2A 2CIMA 4OZJA 1S49A 3V4IB 4C8LA 5EWGA 2IC3A 1VQ8S 5LXYA 4LFBF 4K5SA 3OSNA 2DNNA 4EZ9A 3RTVA 3KMQA 2M9KA 1QVFR 4KHRA 1S76D 3OTOF 1R7IA 1FEHA 3LP2B 3CJ4A 4TKTA 4UUXA 1N33F 3M1VB 2AWZA 2IAJA 2HHVA 3FJ2A 3OFFA 2FLNA 3MM8B 5CYMB 3IO1A 2UV8G 2BANA 3UNGC 4QWDA 3KJVA 1V3RA 2R8GA 5B0AA 4I64A 4ECSA 1TAUA 1UEVA 4Y2MA 2KI2A 4Y6IA 2XMWA 1WACA 1Q7YT 3BDPA 4YR3A 2UUBF 4KSEB 4OI2A 4TY8B 4IOAQ 3LP0B 5KFNA 2M8DB 4DFKA 1ZZFA 3IGVA 4JI7F 3KLIB 4AUKA 3DHWC 3M30A 2B5JB 1A9NB 4NLGA 3R5AA 2AV5A 2MGZA 1C0UB 4I4BA 3TVZA 5J2MA 2ZH4A 3KLFA 4C3KA 3I56S 1GQEA 5F8JA 3QO9A 2IVYA 2F3JA 3BSNA 3CVKA 3BR8A 4AE5A 3BO4A 3GFZA 3OSPA 5DLGA 3T1HF 4DS4A 1FO1A 5KG1A 5E2QA 2EW9A 2MKCA 3UD4P 3DFEA 2QMWA 5IS2A 4CO0A 4DV0F 5T7LA 1H3DA 2ATLA 3B4DA 4DWIA 3OVBA 2UVVA 1NH8A 3JTPA 7FD1A 1SC6A 2XWXA 4FZVA 4F4WA 1Q8LA 1WTFA 1OSCA 2I1RA 3SEOA 5J2QA 3SXLA 3DN9A 4KIAA 1MU2B 1S6PA 3BJYA 2RE1A 4TYBA 2M8HA 1WEXA 1WD6A 1RT4A 2HWTA 3M05A 4LF4F 1JLEA 1TL4A 3GIIA 2ASJA 2Z8QA 5BR8F 2R8JA 1WHWA 1U1LA 1X4CA 2RF2B 2FVSA 1Q86T 1VBYA 1N0UA 1LOUA 1PC5A 1FCAA 3FEXB 3DM2A 1IJEB 3E01A 3Q8RB 4J9PA 4HH1A 4FF4A 2NPIA 4ZOSA 3CXCR 2CFXA 3GFYA 3MEGA 1URNA 1S6QA 1HQUB 4XDDA 2QV6A 1KRPA 3SYZA 4F4XA 2V4RA 4RBUA 1IKVB 6FD1A 1KSPA 2M0GB 2U1AA 4K50A 5THWA 3M6UA 4ZCIA 3UR3C 2XLJA 2ZHOA 4X4RA 5EWEA 3KK3B 1WHYA 2HNZB 4PUOB 2ZHBA 1CSJA 1R3NA 1YVFA 2KKHA 3SSQA 4WFNQ 2PT0A 4ZPAA 2OPSB 4B9MA 2E5GA 2CG4A 3D2WA 1IKYB 2EG2A 2VPWB 1QAYA 4PCQA 2ASYA 4DSJA 3EPIA 1RT5B 1YJVA 1RI7A 3I5BA 4OHZA 2ZM6F 4URQU 5H9EJ 2RNEA 1HBOA 2X3GA 3H8YA 4P7VA 5D4LA 3BQ2A 4KO0A 1GH8A 2OD4A 3EGWB 2VG6A 2CQHA 5M2UA 1TK8A 2IA0A 4RW6B 2A1BA 2HPUA 2LXUA 4JI1F 2J9DA 3IN5A 3BB5A 1U25A 3PR4A 2OPQB 4Y2CA 2CQ1A 2QE5A 2LYVA 4C97A 3V6DA 2Y1RI 1LQ9A 3O44A 1DTTA 3O2IA 4LSLB 3KLGB 3WBZA 3QGIA 2BE2B 2QT7A 5F8HA 1VRTA 4FF2A 2OJ3A 4NL5A 1HBNB 1KONA 2JVRA 3QAUA 4ZPTR 5GAGU 4WXWA 3M6VA 2CPEA 3M9MB 3K58A 4TNOA 5DDQC 1HL6A 2KT3A 1UJ6A 1Q53A 1X4GA 2DISA 1X4FA 3ZZPA 1DBDA 4ED0A 2A3JA 2IHR1 2CQBA 2XBPA 1GX6A 2KT2A 1XK8A 4QBUA 3CCES 5HROA 1S9FA 4BBYA 1S97A 3HHEA 1R8PA 3CMAS 2CQ4A 2JOQA 2V94A 3EYZA 4MKYA 2KO1A 3V6HA 3NNCA 3LUYA 3BSOA 1S6UA 4B9UA 2EWHA 3HVTA 4A8QA 2B51A 1KQSR 1RTIA 3KLEA 2W4CA 4Y2IA 2ZC3A 2HVZA 4DL4A 2V8GA 2KB2A 1N6QB 3CC4S 3KK1B 4RNHA 3DNCA 3GFXA 1W2BR 5C25A 1LW0B 3DLGA 3ETOA 5GAHI 4ZK7M 1YJTA 5D78A 4CNZA 4G1IA 1SIZA 4X4PA 2GX8A 2KXNB 3VAJA 4K4YA 2LEBA 1K8AT 4DSKA 2GJIA 2E1AA 2I2YA 1A6LA 2HG4A 1S77D 3GIMA 4DL6A 2C3YA 1KC8T 4DFPA 2DPIA 3LALA 3LQVA 4F25A 2YKNB 3KHHA 3PV8A 1CPZA 2VKZG 4NLWA 2RD5C 1Y5LB 1SJ4P 4EBEA 1HWLA 2IYIA 2YH0A 4X4QA 4ED8A 4MTPA 4A8OA 2LEAA 2YKMB 1QE1B 3PFOA 4L3NA 5KG4A 3G6YA 2NXUA 2SXLA 1VQYA 1WTBA 1B64A 2XSFA 2HLUA 4O4GA 1FTCA 1REVB 2D3ZA 3AQOA 4K5RA 1U24A 2FHOB 5LL6d 1ZM2A 2JFDA 2PGCA 5J1PA 1Q82T 2HHXA 2GGPB 4G6VB 1UKUA 2E29A 1HD0A 2DH8A 1RA7A 1MSWD 1VQPS 3CJKB 2IM3A 2IYGA 1D9DA 5J2NA 4NXMF 2F1FA 2AQ4A 4Q8EA 2R2SA 2OTJS 2Q79A 4GKKF 1Y00A 2VA2A 4DSEA 2D9OA 4C9DA 2A10A 1OPZA 3MAQA 1T3OA 1T03B 4I68A 1N4LA 1MW7A 2R7VA 2GMLA 4V19J 3N6LA 4YQWA 3KLHA 5CYQA 5F3ZA 2R7XA 1DTQB 3FMBA 2PO4A 2J6TA 3VAIA 1JLAA 4OHWA 2VC0A 3OPKA 3J81Y 1SIWB 3DOKA 3GR0A 5IQ6A 2VBYA 1ZM3A 1C1BB 1WEZA 1MMNA 1JXLA 4ZVHA 3HHLB 1F2GA 2QRRA 3DLJA 2ZH1A 5HP1B 4LF5F 2MXYA 1NRKA 1EETA 4DMZA 4YFUA 1BQXA 5KFPA 2DHGA 1LKZA 2LVWA 5F8NA 1KLNA 4RW9B 1JLCB 2YNGB 4FF1A 5U47A 5IQQA 3K7RA 1S1XB 4LF8F 4I6YA 1K73T 4QWCA 3G6ES 4K4ZA 2EFGA 3LH2S 2B0GA 2RMLA 3W2VA 2X1FA 1FJGF 4OHXA 2ZOMA 3AH6A 1J5EF 2B6AA 3ITHA 4ZHRA 1T94A 3GMGA 3MM6A 1YRTA 3DRRB 5KFOA 1N5QA 1BQMA 4NRUA 3JSYA 4DV6F 4IR9A 4F8RA 3KG4A 4CO3A 1QAJA 1RTHA 1NJWA 5D8HB 1ZTTA 1SV5B 2V2KA 3CDWA 2Q1LA 3EXCX 4F67A 1AFJA 5L1LA 5DETA 5L1KA 2OP5A 3SCJE 2FJEB 4ES1A 2DNKA 1B0PA 1XMOF 2IM1A 1KFSA 4RLEA 1FHTA 1VS3A 2ZH3A 2WW8A 2IFXA 5KT5A 2DGSA 2NS1B 2JH3A 3L95X 1KQGB 5KFKA 3MOJB 4N76A 1RWUA 4ED6A 2XG8A 3OXFA 4BHQA 1M1KT 4QU7A 1KHWA 3UI3A 1HBMA 3BN7A 5K14B 3HX9A 3MUMP 5CQGA 4KQZA 3PEHA 5A0YB 1I1GA 5MAOA 2I9SA 2ALZA 2MZQA 3V81A 2XWYA 1N56A 3M8PA 1JX4A 1H98A 1ZTWA 3N5BA 3DLEA 2CPYA 4JBCA 3M1VA 2QFJA 3VZHA 1G2EA 1C2PA 5F8IA 4YB6A 2LKZA 2OPRA 4K4UA 2GQCA 4M95A 2PFFB 4NRTA 2PMHA 2MJNA 3NRBA 1H38A 4EFAC 1NB7A 4QIGA 3P6YC 2D41A 1L3KA 2K1RB 2RQ4A 1TK0A 1W2IA 4TY8A 1YJWS 2B4VA 2V5HG 3LP0A 2DNYA 2ZH7A 3BGUA 3BO2A 3M8QB 4O3QA 4USHA 4WXOA 4B08A 3H2VE 4ZP8A 4DSLA 4M1KA 5JUMA 2B5JA 1Y9OA 4H4MB 2W7PA 1LV5A 1TFWA 2OTLS 1S1TB 3MPWA 2N7YA 4Q43A 2MQOA 3BO3A 2IMOA 4RW4B 5F8LA 4A8KA 4ZCMA 3JSRA 3K8WA 3MTJA 4KKOB 4B3TF 2JEIA 4HH0A 4DV5F 2ZC4A 4KT0C 3V5RA 1VMBA 3U7JA 1FDBA 4E0DA 4TQSA 1QLNA 4PXBA 1X5SA 1SJRA 4RW7B 2IRYA 2RRNA 2AGQA 2CQIA 1RP5A 1VI7A 3PX6A 1HWKA 2VPXB 1TUVA 5GADU 1IBLF 4Q8FA 2QZ8A 1HD1A 2E44A 4Y3CA 2ZH5A 3J7YI 2M5YA 1BC6A 4OI4A 1CG2A 2OSQA 2EC0A 1RA6A 3M4XA 1RYSA 3VCDA 3DRYA 1C1CA 3SDEB 1MMDA 4HKQA 4I0WA 3QIPB 2QSWA 5KG2A 2COLA 1S0MA 4Y2AA 2AGPA 2C3PA 3QMQA 4LF6F 2CJ9A 2CPJA 1RGVA 4ETZA 4LJMA 3PRDA 5FDLA 4ED3A 4H54A 2KTQA 2UV8A 4OX8A 2J7WA 3I87A 4TY9A 2HW3A 2KFZA 3DU6A 1B0TA 3HKZD 3FNNA 2BQ3A 2CQ0A 4RKUC 4DR1F 1DRZA 2J7UA 4RUAA 1YIJS 2FVPA 1U6BA 1JKHA 1XWLA 4Q5VA 3M2VB 3R5CA 1YTYA 4KC5A 2DR8A 1IKVA 2R8IA 4TLRA 3GG0A 3R1LA 3M32A 4OHYA 2NZ4A 2VV5A 4GKJF 5IT9Y 2VFVA 4LQ3A 1R43A 4OLPA 4NLQA 2JFKA 4YB5A 4RBVA 3SQGA 3KK3A 1KOHA 2AJ1A 2VASA 2KM8C 2RQMA 4WTYA 1H2TZ 5F9LA 2XGPA 1FESA 3EX7B 2GIRA 5B0BA 2XMTA 2QA4S 3TANA 4MAKA 4RZRA 1FNOA 1IKYA 5K8NA 2YH1A 2R8HA 4O3RA 3CCWA 5I3UA 3VTIA 3QAEA 3EPGA 2DH7A