3SCLE

Crystal structure of spike protein receptor-binding domain from sars coronavirus epidemic strain complexed with human-civet chimeric receptor ace2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
179
structure length
173
Chain Sequence
b'PFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Angiotensin-converting enzyme 2 chimera
publication title SARS coronavirus: mechanism of host receptor adaptation and rational prediction of future evolution
rcsb
source organism Paguma larvata
molecule tags Hydrolase/viral protein
total genus 28
structure length 173
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3sclE01
3SCLE 2GHVC 3D0HE 3SCIE 2GHWA 4ZPTR 2DD8S 3SCKE 3D0GE 4ZPWR 3SCJE 2AJFE 4L3NA 4ZS6A 3D0IE 4XAKA 4KQZA 4L72B 3BGFA 4ZPVR 4QZVB 5DO2A 4KR0B
chains in the Genus database with same CATH superfamily
2R7WA 4NLUA 2HQIA 2G1DA 4DUTA 4ECSA 4OI6A 3M6XA 1VQ6S 2HW3A 3H5XA 2EXUA 1RK8A 1NDLA 2KVQE 3FBBA 3MPVA 2KXNB 4ECRA 1RTIB 5H9FK 2J0XA 1VQSA 1HBOB 3GILA 3KFWX 3R8YA 4AXIA 1GMUA 2CJXB 3R6GB 4KB7A 4PKDB 3ZTPA 2OTLS 3THVA 4MJKA 4DPXA 3IFEA 1YJ7A 3FEYB 1RTHB 3IWNC 2CWKA 3CCSS 2PEBA 1GH8A 4OYBA 3KHGA 4GVBA 4LRBA 2H48B 1APSA 4ILMA 1TK8A 4F0MA 3VAKA 4DUYJ 3M32B 5BR8F 2AJQA 3L3CA 4QIWD 1Y7PA 2OPPA 4WTYA 1YJVA 3EZUA 2BANB 4NXMJ 2M2BA 2CPHA 1FE0A 2AEJA 1K8AT 2DNHA 4NA3A 4ECXA 2CNNB 5J2NB 2HVHA 2GMHA 3V4IA 2HQ3A 3HLUA 1LK7A 4RUCA 1YKWA 4F36A 2FIUA 2YX4A 1NK6A 4O44B 3UDCA 3PJWA 3L9ZA 3GONA 3PJXA 1RAOA 3J80U 3SV3A 5G0RB 3RB6A 2KM8B 1HA1A 2C2NA 3DRSA 5IT4A 1M1GA 1H7WA 4UF4A 4CT8A 1I5OB 4CT9A 5HP1B 4LR7A 2CWXA 5HMWA 2XGQA 1J5EJ 1S6PA 1I94J 4N8OA 2L08A 3O44A 5JMNA 1NK7A 2B7BB 1FTCA 5LMNJ 4ANDA 3NGDA 4HVZA 2Z2LA 4AD6A 4J9SA 1HI0P 4WCEQ 2BQUA 3NCQA 3JAMU 4LF5F 5LSLA 1KDNA 3D3BJ 1UVIA 4U7UD 1RAHB 4X4QA 1D9DA 1WKKA 2VA2A 1WHWA 2RDDA 3DI6A 1IBMJ 1QUVA 3CD5A 1SUQB 3TJ9A 4LSNB 3QSIA 3E8OA 3GP9A 5C42A 4IG0A 1YLXA 5F41A 5ETKA 3GTYX 3FNNA 3UCZP 1U1PA 3FSIA 1N32F 2P5VA 5JVHQ 2E5LJ 2MLXA 1Z2ZA 1YRXA 5EUHA 1Z4UA 5DQGA 2IRXA 3NXZA 3FDSA 3FRYA 5CYQA 1IR0A 4QU6A 1HQEA 2DNYA 4LF4F 4DPYA 2QA4S 5AE3A 5E41A 4A8SA 2MSSA 3Q22A 4WTOB 2EC0A 4DR3F 2AJ1A 1M5KC 5DM7Q 2J7UA 4TN2A 5BXIA 3FJ2A 1SJRA 1O5JA 1M1HA 4GVBB 5C2GA 3R7BB 4KGKA 2RS8A 4HLBA 5K8OA 2ATLA 3GJRB 3ZTSA 4H4OB 2U1AA 2ZH4A 3AD7C 1FRJA 3M8YA 3CWJA 3HT0A 2ZH9A 1X4FA 4CO2A 2W4DA 3BYRA 1KNZA 2OPPB 4RX6A 7FDRA 5I3UA 2Z58B 2ZBCA 2R7UA 4ECYA 3TQEA 3SEOA 5DM6Q 2KJWA 2BR0A 1VS3A 2KT2A 2BM1A 3M1VA 1DTTA 3W64A 3UNYA 2JL9A 1GQEA 3HVAA 3V4IB 4TU9A 3A8EA 2K2PA 2NLWA 1U7LA 2GVZA 1NMEB 1DZ5A 4DCOB 2HURA 3J80Y 2J9DA 4TYBA 1SKUB 3FZBA 2CNOB 1HWJA 3SCIE 3P6YC 4OI3A 4CLFA 3UVJA 2HZAA 4RU2A 4WPAA 1JXLA 3OFGA 1S6PB 3NNHA 3MMBA 1WD6A 9RUBA 3E01A 2DHHA 1HR0J 3PW0A 3RB4A 4NCBA 1QM9A 2B43A 3BREA 5J2QA 3OTOF 4Q5VA 3B78A 1R0AA 1OPZA 4ATNA 4OL8A 3JAMY 3R5AA 3B4DA 2IFXA 5CA5A 4QW8A 4E0DA 1TAUA 1TELA 2D3O1 1D9FA 4ED4A 2ATCB 2V4JA 3MM6A 1AZSA 2C42A 3DI6B 5GAGU 5RUBA 4YR0A 1AB8A 3EDRB 2FDNA 4I67A 4IG0B 2IMOA 1KHVA 2F5GA 3PRDA 4FPRA 3DRRA 3KG0A 4AFFA 5CCMA 2E5JA 1C0TA 2WSCC 1T3OA 4DR5J 1FTRA 3CCES 3R5BA 2V5HG 3MCNA 2V2QA 2F8EX 3G6YA 1I3OB 2HFOA 4WFBQ 1ZETA 4ZCLA 5CYQB 2Z4PA 1H2VZ 4JI4F 2MZRA 4K59A 2HAIA 3D1HA 5A2QU 1HQEB 2R7VA 3DLKA 4CIOA 2KG1A 4OX7A 1FWKA 2AX1A 4M8LA 5C5JA 2BJ9A 4P2FA 3NLCA 2AU0A 3MEGA 3IO1A 3LOUA 1UPPA 5BJRA 1UL3A 3IBWA 4DG1A 1JIHA 1XR6A 3PRBA 2G1HA 2GQ2A 4IH7A 4KFBA 1NKBA 2DEJA 4J37A 3A13A 3QT7A 2GZOA 3OUYA 2VIHA 3W65A 2MQLA 1S4EA 2VOOA 1GAOA 2QLBB 1U02A 1WF0A 4ITSA 4KHPJ 2HFVA 3UCUP 1VBYA 3SDEA 4ED0A 5I3UB 1H0HB 3NAIA 3GIJA 2XQCA 2ZVIA 4LF4J 1FNXH 4KTQA 3ILOA 1N0UA 3SV4A 3M1VB 1DTTB 1NK5A 3HSJA 4ED3A 4C8ZA 3JYTB 4Z7YA 4ED8A 2ILZA 2JNJA 3VAIA 1XERA 1RAGB 1L3SA 2GVZB 3R5JB 2H51B 4F4WA 1IKXA 2JJ4D 2BQ3A 1D1UA 2WRMA 2KHCA 2JEFA 3UVJB 1N48A 3DDIA 3MCOA 2HEKA 2Z57B 3MMBB 3E01B 2R9LA 1YRUA 1HBNA 3P4UB 5J2QB 4CP5A 2HNZA 4BLGA 3I9ZA 1UP1A 1R0AB 2VJUA 1S9GA 4MYTA 5K14A 2LQ5A 5A6PA 2LA6A 3PIPQ 5DS7A 4NA1A 4UOCA 2V4JB 3MM6B 5B0FA 3BH7B 1AZSB 1RB0A 3HF5A 2BBEA 3A8IA 2P6TA 3UWTA 1EX8A 3HZGA 1NHUA 2OD4A 3P49B 4FXDA 2WW4A 1N0VC 3DRRB 1C0TB 2W7PA 1TUVA 1F1BB 2W1BA 5B0GA 5B0AA 1RLCL 2CNLB 4X64F 2KZMA 4B9VA 5IM0A 1JLAA 1WWHA 2QJ3A 1FRXA 3SSRA 3DRPA 4LBPA 4A8WA 1D0EA 5A2QY 3R6LB 1IJFB 1HARA 3HVTA 1IKVA 3DLKB 4LFCF 1FF2A 3OPKA 3CC4S 2DGWA 1RWKB 3I87A 4EI2A 3MEGB 4DOZA 4C3KA 4DG1B 4UOFA 1M1KT 4H4KA 3SCJE 3B54A 4KFBB 1IWAA 1EETA 4DPOA 5DO2A 3R1LA 5KFAA 2XM3A 4PG4A 3OUYB 3V6DA 1F60B 4MK8A 3QWUA 2Y8YA 1VQ9S 1T7PA 3AH6A 2ZJQQ 2B51A 3Q0AA 1BQXA 5EHHA 3G9CA 5KFZA 1FDBA 4JI4J 3SCLE 2CPYA 1W2IA 1UVMA 5HO4A 2CQCA 2H54B 5KOXA 2VQFJ 3CCQS 1NO8A 4ZPAA 5IT9U 6FDRA 3P8BB 3HVRA 3JSYA 5HI7A 5G4DA 2JX2A 3W60A 4YQWA 2FVQA 1LXNA 2EG2A 3KJFB 1DHMA 4W90B 3L7OA 1G7CB 1IKXB 1LV5A 1AW0A 5LM7E 2E5GA 1FT8A 2FJDB 3LP2A 2CZ9A 2J9DE 4NMXA 4YHHF 4WXOA 4HDHA 4M94A 2RF2A 2R42A 3AB2B 1NJWA 3EXYA 1HBNB 1ZOTA 4KV8A 4RBTA 2HNZB 1XJWB 4DFKA 2YY3A 1RQ0A 1S9GB 2NXEA 5K14B 2ZOMA 2XBPA 3CCJS 4DV7J 1RHJB 2VF3A 1X60A 1MNEA 1KQFB 3T3FA 2V6AA 1S6QA 5F9NA 1NXIA 3F0NA 3CULA 3CD0A 2DNRA 3QFWA 1VHFA 4Y28C 3T1YF 1SKSA 2PGCA 1ZZNA 4OLOA 4YS2A 2UZAA 1X9WA 3G96A 2OD6A 1H74A 2IA6A 4OYIA 4HEA9 1VQOS 2BW7A 5IM0B 2W9AA 1U45A 3LAKA 1JLAB 4OV1A 4B9MA 4QWDA 2YWEA 4FF4A 3BSAA 3GYXB 2BV3A 5CQGA 4E8UA 4K4VA 4K5RA 3DRPB 1B7YB 4F4ZA 3CCWA 2CADA 3M6UA 4J7CA 4Y2MA 1B0VA 1RISA 2XSJA 1NKEA 3DLLQ 1UPMB 4Q44A 3HVTB 1IKVB 3RRKA 5ITHA 1MW7A 2VFSA 2I5JA 1UWBA 2GX8A 5DLGA 1UEVA 4K2JA 3T9ZA 1RTDA 4DQIA 4LVNP 5DDPC 1FFSB 1S10A 2GIQA 2D7SA 3GB0A 2UUAJ 4C8OA 1EETB 4DQPA 1X4DA 4L72B 4FYVB 4QZVB 4DDFA 3V6DB 4C0OC 4UZCA 3TO8A 4X64J 2W9CA 2F63A 4DUZF 3GCXP 1MMNA 1JLFA 4JI5J 1F3FA 3LW5C 2Y0SD 3J7A1 1QVFR 8RUCA 4R8UA 2NREA 1EB0A 1RP5A 1T94A 2JFDA 1SQFA 3GQCA 4LFCJ 3UW1A 3GSIA 1DFDA 2E7XA 2W7AA 4PAAA 2CJYB 3OBIA 1C2PA 1TL5A 5J1NA 4X4NA 2KFYA 3BGFA 3LP2B 3TAPA 3GE9A 4B3MF 4EBEA 2FZKB 2E5HA 3JSBA 3QBCA 2RF2B 4NEYA 3RBXA 3OL6A 2XG8A 1WTBA 4FP9A 1WOPA 4DLGA 4KV8B 2WSFC 4QR2A 3MM9A 2QGFB 2ZH8A 4I0WA 1OY6A 1EJ7L 1RBLA 4RBVA 1KRPA 5E2QA 2XS7A 4JI6J 2RILA 1FKOA 4ZIVA 1SC6A 1WF2A 3ISNC 2XHCA 1B70B 1S6QB 2I2YA 2DEIA 1NH8A 4ZLJA 4DPTA 4N56A 1WACA 1RT7A 2YX1A 1YVFA 3A3OB 4DQSA 3PCOB 3SBMA 2FC8A 2A6MA 1OQ3A 3CE8A 4RNNA 1PBUA 3IBCB 1TFYA 4IFVA 5LL6d 2EFVA 3MFIA 2ZE2A 3KUHA 4YHHJ 1C0UA 1E6YA 4WKRA 2O5DA 3LUYA 4TQRA 3T5HA 2H5JB 4DBQA 3W9IA 3OFEA 1GTHA 5E3QA 3KLHA 2MJNA 4G1IA 2AMCB 1KOHA 3D2WA 2XSJB 2XI2A 5L1IA 4QPXA 2ZNZA 2MKHA 2HAFA 2V8DA 2XS5A 3T1HF 2I5JB 1UWBB 5KFJA 2W2MP 3ZC4A 1RTDB 2B8PA 4P2MA 4OZLA 1S59A 1PYSB 3JQMA 1HKAA 2HRUA 1KSPA 1O8BA 2I0XA 1FJ7A 2W9CB 3RYLA 1S76D 1Y9OA 1JLFB 3C8YA 4Z37A 4O0NA 5LOQA 2J7KA 4CWBA 4JI0J 4DR4F 3ZO7A 3UR0A 1VOMA 4NOHA 4R8UB 5D6GA 3OL8A 1QSSA 4IUFA 2FVCA 2YNGA 3HX9A 1RA7A 4B9LA 3M05A 5D3GA 4J9VA 3H5YA 1GXLA 2IVYA 5KFLA 3AD8C 3PJ9A 5A6WA 3O6QA 1MSWD 1XMOF 2EVZA 1UFWA 2RIJA 1HLWA 4HDGA 3KKFA 2VUGA 5HLFA 2R8HA 3H4BA 3TUIC 3ISZA 4IOBA 2MZTA 3BKFA 3ILLA 2Z8QA 4LF8F 5LSOA 2GQCA 3ETOA 1S9EA 1VJQA 4PWWA 3MM9B 1H6KX 2FGOA 3MDFA 3CF5Q 3GV5B 4WKYA 3VZIA 3L7PA 1FKOB 1R89A 2KN4A 2GV1A 3RAQA 5HANA 3AXKA 3VQTA 3DU6A 1RT7B 4AL7A 1W26A 1YJNS 2LQBA 3Q8SB 4IFVB 3WX8A 2ZE2B 1SH0A 5FIIA 4DXLA 1RACB 4B3MJ 5D4PA 1E6YB 1F5CA 1XIQA 2NUHA 5A76A 4QWCA 1OIAA 5KG1A 1KQGB 2GJIA 1SH3A 3TVZA 2EFNA 1IBKF 3VWSA 4DN0A 2IBKA 4DSKA 1BHNA 2K8GA 3KLHB 2B56A 2YX7A 4FF2A 1NNDA 2UVWA 3T5JA 2FVPA 4OJ3A 4JV0A 5CHCB 3NNCA 3N0VA 4R0JA 3CJSA 1RA6A 3S1TA 4Y65A 4BHQA 2DNGA 1R8CA 2PIIA 4HHUA 3BO4A 1ZM2A 4KSEB 4A8YA 2W24A 2AEFA 3O2IA 5FDLB 4ED6A 3ZNUA 3RB3A 3GSDA 5E3PA 4YFUA 1URNA 1TUGB 1UJ4A 4OZ0A 3J7YU 1RDRA 1UW4A 2QT7A 2RQKA 2OPSA 4A8QA 4CO4A 5AXNA 4QOTA 2JC1A 1VK8A 1E6VA 4RUBA 1FKPA 1TVRA 3OL7A 4DPUA 1CJUA 2ASJA 2VZ9A 1JX4A 3CDBA 3EM1A 5KFCA 4CRJA 1NU4A 3T1HJ 5D3GB 1RABB 4NLTA 3MUTP 3PTWA 3CC2S 1SB6A 3V5RA 3J81U 4UT4A 4K0KJ 3IWLA 1KLMA 2VPZB 3QO9A 2R8GA 2HGMA 3UR3C 2XYPB 3GYGA 5HLFB 2OLWA 3P96A 3BYPA 4DEZA 3I4PA 1V5IB 3CJ5A 5DETA 4USUA 4DHVA 2FLNA 1S9EB 4KGVB 3MGJA 2ABYA 3QJJA 3CD7A 1U48A 1WF1A 4USTA 2RHQB 3W5ZA 4B9SA 1M0SA 5L38A 4B3TJ 5GMDA 4V19J 4ID8A 2F3JA 1GMWA 2U2FA 4FYYB 1U6FA 3PX0A 1HNXF 4F4YA 1XMOJ 3ZTOA 3ZNJ1 4KJIA 4W92B 1R0BG 2ZHOA 3D6HB 1IXKA 1OWXA 4NLRA 3FBFA 2C3MA 1F3VA 3VGTA 2CG8A 4LF8J 3Q89A 4P75A 2EFOA 3GG0A 2CRLA 4HKQA 1BD6A 2AT1B 4ZVRB 3PV8A 5K8MA 5E33A 2V2VA 3FCHA 1PJ7A 2FJBB 1WC5A 3MPWA 2KJVA 2YQ1A 3W8PA 3M9MB 3PM9A 4MIAA 5IOLA 1U1MA 1IBCB 3BZQA 3LA0A 5CD4A 3Q23A 5EX0A 2D41A 2KFZA 3KJNB 1FJGF 3MECB 1VDHA 4JV5J 3TANA 4I6WA 3VAMA 2C2EA 1HPZA 3R5GA 2L41A 2MQ8A 1CC8A 3BS9A 4ZP8A 5HVHA 4O3PA 4DWIA 1PC4A 4FXVA 2OPSB 2ACMA 3EE3A 2UUTA 2RQMA 3MR2A 1ZAWA 3OTCA 5CYJA 1XMBA 3PEJA 1FE4A 1E6VB 3RU0A 1U6ZA 1FKPB 1TVRB 1IQZA 1CJUB 1IBLF 2R8IA 2XMWA 4J9UE 1OJ4A 1PCAA 4FKYA 3BGRA 3C2PA 1UFKA 2DNNA 4C98A 3O1LA 1EHWA 1WG4A 2LEAA 5J1PA 3TOQA 2QSWA 4Q2MA 5L9NA 1L3VA 3J81Y 4ID5A 2GFFA 3KK3A 2OSQA 3EXCX 3ZZZA 2NXJA 4NI2A 1MN9A 1KLMB 1GEHA 3QO9B 2BJDA 4OX8A 4ICLA 2I6WA 2R2TA 1S9FA 3CGIA 2OPQA 1SJ1A 1HNVA 2VBYA 4O4GA 3X1LB 2UVVA 4P71A 1T9XA 3OJUA 2F4VJ 3AFGA 2GHWA 2ZZTA 4UTGA 2QA2A 2OIHA 2FLPA 4O4RA 4EBDA 4EZ9A 1S49A 4ANCA 2W2OP 3CVKA 1QSYA 1S0MA 1JMTA 3KDNA 1D9AA 2F8MA 1ZTTA 4ELVA 3UO0A 2FC9A 1PJ6A 4ZK7M 3RAXA 2V8VA 3M9NB 3K2YA 3MI7X 4M5JA 3NS7B 4GC7A 2LMIA 1H3DA 2ZH2A 1VBXA 2MKYA 1VISA 3QLHA 5HROA 1Y00A 2XLIA 3QGHA 4M5NA 1RZMA 3MCSA 4N5SA 3K5MA 1IR2A 2R7XA 2CJ9A 4WF9Q 4ZVTB 1NB7A 1ZM4A 1AUSL 1QSLA 4FVCA 3VALA 4OHZA 3GG1A 5IV4A 4N8NA 3C16A 2RS2A 3K7RA 4F50A 3MMAA 4HH1A 2HHXA 4EWTA 1Q86T 2OPRB 4RW8A 3KLEA 2OSRA 2O1PA 3C15B 4P9SA 1HNXJ 1GTEA 2CAJA 5D0EA 1RADB 3VQSA 5KG2A 3H20A 3DDNA 3I9V9 2BUNA 5CZXA 3I6PA 3EZ5A 5KG3A 5D4LA 1HPZB 3KYLA 5H9EK 4A8OA 3QWPA 2IJNA 3UDEA 1YBTA 4P73A 1I1GA 4FDFA 4U67Q 2W8LA 1OS5A 2L3MA 2P9GA 2GJFA 3K89A 3H40A 1MMLA 3OW2R 2XB2D 1R0CB 2C3OA 2UXDF 1QD1A 2MLYA 3SYZA 3DU5A 4K5SA 1RHKB 3HXMA 1HQUA 3BGRB 4PYAA 4IQMA 4NLYA 4KGXB 3MTJA 4ZVHA 1FJGJ 1RAEB 4N7TA 3M6WA 4NLDA 4ID5B 3G8SA 2JLEA 3KK3B 2AW0A 2J0QD 4NI2B 3CPWR 4NWBA 1DTQA 4ICLB 4LBIA 2IBOA 3TEGA 2OPQB 1ZAVA 1HNVB 2DK2A 5GADU 4O4GB 3M9OB 1QUPA 3BPDA 3ELHA 4NPOA 2CJQA 4O3OA 5GAHI 1LNQA 5HQMA 1HL6A 2NUUG 3HHLC 2RSQA 4TKTA 4ECQA 3TX0A 3BDPA 4DL4A 5DG8A 3G8QA 3RW6A 3KHHA 1S1VA 1YZ6A 4K2XA 1RAJA 4ED1A 4DSEA 3BGUA 2Q6CA 4O3RA 3HJVA 3MF5A 2AJ2A 2HKEA 3W8GA 3Q8UA 2ZC3A 4K4TA 1N8RT 2MSTA 5ETTA 1M5OC 1NJXA 1Q95G 4WE1A 4JB8B 3FGVA 2Y1IA 2RU3A 1FA0A 2LXFA 1UAWA 1Z1ZA 3PHTA 3ZZPA 4WP9A 1Y0HA 5EWEA 2CPIA 5HJYA 2QA4G 3EX7B 4IR1A 5HROB 1T9VA 2LP4A 3W2WA 3AJ1A 3PW5A 2WAQD 4TQSA 3RUBL 4WU3A 5FD1A 2JZ5A 1S48A 2CQIA 5DG9A 1IR1A 2ZC4A 4XPCA 4LF7F 1HYSA 3C16B 1D3WA 2AYGA 3QT6A 3TX8A 3MMAB 1NK4A 4X4VA 3MCMA 1R3NA 3OHBA 2OKQA 3DRYA 4RW8B 3NGKA 3KLEB 1DQAA 4DX7A 3FC9A 1R43A 1U47A 1HWUA 3D68A 3MURP 3D1OA 4AT1B 3DFEA 4NZ0A 2VKZG 3V6KA 3KK1A 4DR6F 1F2GA 2BJ8A 3PX6A 2RE1A 2IRYA 2HQGA 2HNDB 3NOGA 4IRKA 2MKKA 2QC3A 2E29A 4B3SF 4GRSA 1G3OA 3OT9A 5KFSA 3K0JA 3AOCA 3HD2A 4LRCA 5KFVA 2BJEA 4ZVQB 5DDQC 1V3SA 1HQUB 3CCTA 2WTFA 2IPOB 2EW9A 3US5A 4DPWA 1ZA2B 3I5AA 2KYXA 3CCUS 4J90A 1RJJA 5IQQA 2YNIA 2KT5A 3EVOA 4KPCA 3HULA 1DTQB 1VC0A 3KLVA 2IC3A 1UA0A 1S6UA 2V68A 4NZ7A 4HT7A 2C28A 1PJ5A 1SL2A 1S1VB 2UXDJ 3I55S 2DHGA 5EN1A 3L4BC 5I42A 3WC0A 4X4RA 1U0HA 1WC3A 4LMZA 5D8HB 4C3MA 1WEZA 1XQIA 1DAXA 2QN6B 3QSYB 1FFGB 3GIMA 5EDWA 3DDKA 3TARA 2DPIA 2J5AA 1CS4A 2QL7B 4OMFG 3M8SA 4EO8A 3Q8YA 3ULHA 5K8PA 4WE1B 2DGTA 4UZBA 5ETLA 4ZIWA 4Y2KA 1IM6A 1DQ8A 2FVSA 4C9DA 2KZZA 2CVIA 4GMKA 1J27A 1Q81T 4USHA 3MUVP 4Q8EA 3HZEA 2N7YA 2RDIA 3QAUA 3W2WB 1S79A 3H2VE 2UUCF 2LU1A 3Q8PB 1YQHA 1N34J 1HYSB 4L3KA 4GKKF 2AX0A 4MKBA 5KFQA 4M63A 1CPZA 2C22A 4XDCA 1RT4A 4I2QA 5A0YA 2FY1A 3R9LA 1YJTA 5F3TA 1JWWA 2W4PA 2M52A 4YDXA 4B02A 5IXUA 1RXOB 1IKYA 3V6HA 4A8MP 3QFHA 3C6TA 4B9NA 6FD1A 3KK1B 1YZ7A 3KNGA 2LU2A 1ELOA 1TK0A 4C8LA 3NBPA 4TNOA 3PW4A 2UP1A 4DL2A 1SIWB 3UN3A 2W4CA 2DR8A 2DCLA 5EGYA 4DSFA 1ZTWA 1G6BA 4MIWA 3GIKA 4WP8A 3BDEA 2VOPA 4YB6A 2G0IA 2QL5B 4LF7J 2PC6A 1S0OA 4OHYA 2IHR1 2C2DA 3SCKE 1Q8KA 1T95A 4BBYA 2KXHA 4G1PA 4Y2AA 4USJC 4OZNA 5KG4A 4RNMA 2EPIA 3VAFA 3D28A 3M4XA 4WZMA 1FDDA 1X4GA 1NAQA 4QWAA 4QWBA 4QQBA 5DJBA 2YNIB 5HMZA 2DKOB 1Z2LA 2DH8A 2MY7A 5F8LA 3AOBA 4X66J 1S0NA 3PDNA 4RU9A 1SIZA 4RBUA 4DR6J 1VI7A 1K1QA 2IC3B 3DGPA 1U0SA 3IC1A 4J9KA 5I4MA 1VFJA 4BWJA 4XTTA 2KU7A 1P6TA 3OVSA 4B3SJ 4RUHA 4P7TA 1S0VA 2RQ4A 3KJVB 2CJAA 5I42B 3A8JA 2RUGA 1TMMA 3HI9A 1U0HB 2H9ZA 3GMGA 2CQDA 3MPDA 1T03A 1HWLA 4CO3A 2XWYA 5ETMA 1CS4B 5HBMA 2G2ZA 3DOMA 2ZEJA 4Q0BA 2YWHA 2DRDA 1TL7A 3HFZB 4F3QA 3V2UC 2FTRA 1VHIA 3UN5A 4U95A 2ZUGA 4JYAF 2HFZA 4ZPCA 3Q24A 2VFRA 1NPKA 2ADCA 4QPTA 4EEYA 1NZ8A 4J9NA 4MT1A 4XO0A 1K9MT 3X3UA 3N01A 5DQIA 2WCXA 2DJWA 1BC6A 1C1BA 3BSNA 4ZLNA 3HDSA 3ONQA 1J2VA 1KONA 2V69A 2RD5C 4CLWA 2HS0A 4DU7A 1X5SA 1RT4B 4I2QB 2HGLA 3DRXA 3KXDA 1YI2S 1ZH5A 2O3DA 1SJ3P 4OYAA 1C4CA 2CDRB 2EK1A 1IKYB 4J9RA 1PGZA 3VHQA 3C6TB 2HFNA 2HVIA 5BYQA 5AE2A 1L3UA 2DXFA 3A12A 2RHSB 4NRTA 2UUCJ 2CQ3A 3VZHA 2DTJA 3TAQA 3MR5A 5DRKA 3IP0A 3T5LA 2XMUA 1KVIA 3M8ZA 1WORA 2V4RA 3W1YC 3JTOA 4GKKJ 2FLOA 3N28A 4YY3F 1HW8A 4C11A 1UZHA 3O5TB 4W4MA 2MDAA 4ZN3A 1UTAA 2ZVSA 1MWYA 2DRAA 3M8PB 2B4UA 2IM1A 3OTBA 3UFCX 1SH2A 3DGPB 3BB5A 1WG5A 3P3DA 2LA4A 3NMAA 3W9JA 4FVMA 1NK8A 3N6LA 4HACA 2ERRA 5IC4B 1N54B 1LWFA 4ECWA 3KHLA 1UJ6A 1RBOB 1JKHA 3TNVA 2D74B 3KTQA 1RHQB 4CO0A 1CQMA 5GAGI 2HLUA 1YITS 4EU0A 3IM8A 1T03B 2XLKA 1C1CA 3MD3A 2AYEA 3HHLA 3ZXWA 2E1PA 3CJ4A 4QWEA 2KTQA 5HBMB 3DOMB 4YUDA 4Q0BB 2DXDA 1FRHA 1TL7B 4Y2IA 2J76E 3BO2A 3WX4A 2VQEF 4WBFA 2XTJP 2GAGC 4DL6A 2B9XA 3PRVA 3AA9A 4K4XA 1NLKL 2DNOA 1RTJB 2EBGA 4XIUA 1H72C 1QAJA 2XS2A 3ZTRA 2ROEA 4K4ZA 2W2NP 3G6ES 4RW6A 5E3RA 4ETZA 4I68A 4RO0A 3H90A 4ZVGA 3SMZA 3LGHA 2XYHB 1OY8A 2A2CA 4WIIA 4D3HA 4MKAA 2K06A 2R7QA 5KFBA 2M0GB 1OYDA 3EZOA 2OJ3A 2AV5A 3BBFA 2KO1A 3MPUB 1HIYA 1RUSA 3ENVA 4RUAA 5U47A 5AE1A 3UQSA 2VKRA 2P8IA 4DQRA 1HNZF 3MEKA 1VQ4S 1LEOA 3VV2B 4RR5A 2LQ8A 1KFDA 1XNQF 2X1FA 2D1CA 4JYAJ 3NAHA 2YWGA 1XBWA 2Y0BB 4DU8A 4CH0S 5MLCV 4CCHA 5JUMA 1WC1A 1B3TA 4QYZJ 5L46A 4ED2A 2NYIA 2DPJA 3CC7S 3SZ2A 2GIRA 1V5VA 5GMKa 3T5KA 5KFUA 2CZVC 3WHIA 2DGSA 3I82A 4OLPA 3D4JA 1RT5A 3AD9C 2HGNA 5FLXU 3NCRA 1WDDA 1KEKA 1B7FA 2K7KA 5DDRC 5HMYA 2AQ4A 4I6YA 4C11B 4ILRA 1GXUA 1Q7YT 1ICEB 1W2BR 1KBRA 1FEHA 4ECZA 4DFPA 3AODA 3NL0A 1X8DA 2DGXA 2VBZA 2EFGA 5AXLA 4KH1B 3NY0A 7FD1A 3NMRA 2MJUA 1RT6A 1NSPA 3DOLA 3TVYA 2GHPA 1RWXB 1HMVA 3MR7A 4DV0J 1LWFB 2AGQA 1M5VC 3AA8A 3OR1A 1JKHB 3NG8A 2AHOB 4PQAA 3AOAA 2YXLA 1NKCA 1JLGA 2V94A 5F0WA 4P10A 2ZHBA 2I8EA 3LQVA 4C8YA 1N6QA 5A8KA 4BC9A 4J9OA 1C1CB 3HHLB 2NSBA 1XWLA 5GVQA 5KFMA 3GIRA 1UJ5A 2YNHA 4PG5A 3ENAA 3POTA 2ASYA 1RTZA 2DR7A 1WDTA 4X65F 1GMWD 1B4SA 1JXEA 2ZFHA 2ASDA 4C0BA 4ZJQA 1SL0A 3M8QA 5KT5A 2FHJA 2BX6A 3TZZA 3B6BA 5LXRA 3OLAA 1P9QC 1AXQA 2HBZB 4RW6B 2BMBA 2RH3A 3ZFVA 1WC4A 3IN5A 2PMWA 2VV5A 3BQ1A 5CYMA 4HHJA 5D0RA 1X5TA 3TQ1A 1UETA 1HD0A 3ENQA 1QAYA 1XR5A 5HK4A 4WFXA 2ZJPQ 4Z7CA 4K4SA 2ALYB 3ILIA 4LSLA 3LF0A 2L9NA 1IQTA 3IR7B 5IWAF 1XMQF 3G86A 3KMSA 2VQEJ 2R4FA 2YTCA 2HVZA 1K1SA 2AKWB 4ES1A 2OFGX 4YOEA 2W9BA 2IDLA 1A7GE 3G82A 2VC1A 3ZZTA 3S8SA 5L39A 3NS6A 4ZVSB 1KP6A 2PT0A 3G8TA 2KM8C 5KAKA 3BJYA 4FBUA 4FYDA 2OELA 2CQHA 1TL1A 4YEAA 1A9NB 3PYDA 1PYTA 4DFMA 2JRSA 2W2PP 2ZHAA 4KYZA 2W01A 2AJ4A 3WIVA 2YH0A 1WHVA 5GMEA 2UU9F 1KTQA 1RT1A 1RT5B 4DI6A 3E51A 3OSNA 4X62F 5T14A 1VQ5S 4PG8A 4OIXA 3K17A 3W61A 3BR9A 1U09A 4CI0B 2E5IA 3T6JA 1MG7A 1QAIA 3UD3P 3BQ2A 2L9DA 3IRXA 1HNZJ 4DZDA 4C3LA 1OO0B 2ZWPA 3NP5A 4DV6F 2OEMA 3ADAC 4G65A 3R7NB 3PFOA 3MPYA 2R3VA 4LF1A 1RT6B 2J6TA 2QLWA 4R25A 3DOLB 1BY9A 4JV2A 3DRSB 5KFKA 3G6VA 2MPUA 3DXBA 2C2ZB 1HQ2A 3IBFB 3OR1B 2UVUA 5BR8J 1NH7A 3TZXA 1JLGB 4DX6A 1VLOA 1Q8BA 4DX5A 1N6QB 5A8KB 1GNKA 2XGPA 2J8SA 1M5SA 4FYXB 2QLXA 4N76A 3POTB 5KG5A 3D3CJ 4K4WA 2PI5A 4ZVUB 2BQRA 3H59A 1FD2A 1REGX 4CLUA 1RWVB 2ZH3A 4DSLA 5LJ5Y 2NZ4A 3M8QB 4G1QA 3CT9A 2UXCF 3RB0A 1VIOA 4BCAA 3CJ8A 3HMJG 1B99A 4P7VA 4C8NA 1NSAA 5C42B 2ZH7A 4FBTA 3Q83A 3CTRA 3AT1B 4ZJOA 4ERDA 2QE5A 2HHWA 1WI8A 2GC8A 2FJAB 5LSRA 2A6OA 2OAUA 2DB1A 4X84A 2DH9A 5CYMB 3PEHA 1RGVA 3R3TA 2XMAA 5T7LA 1YG0A 3JS9A 4G3IA 4PWDA 1FXLA 1NPPA 4ZP6A 4LIRA 4PUOA 4F2RA 5KFHA 3N9UC 4HI1A 1D8ZA 2C2RA 4LF5J 4ZS6A 1NJYA 4E98A 3PXGa 3LPEA 4X65J 4OFZA 2QO3A 2OI2A 1FHTA 5F8GA 2DGQA 2W9BB 3G82B 2V63A 2FJWA 3W66A 4DZ6A 4ECTA 2WBRA 1RAIB 4CLPA 3BBBA 2IA0A 4UUWA 1TL1B 3RG6A 1RCXB 5SZTA 4DL5A 1N32J 2F40A 2HZCA 1IJEB 2HPUA 5KFXA 3R27A 3UDLA 3RAMA 1RT1B 3H7HB 1JJCB 3HHDA 3D6TB 3PKYA 1DLOA 3OLBA 5I3PA 2ASLA 1U8WA 4NLPA 4XK8C 1JJHA 4J5OA 3IRXB 2JVOA 1VYAA 1T0TV 5IWAJ 3QIDA 2YKMA 2A2DA 2Z56B 5KT6A 2HQDA 1P1LA 4DR3J 3OHAA 1TAQA 4K4UA 4DV3F 3QIPA 4A46A 1O6XA 2VDIA 1CJTA 5B7WA 1O0PA 3PYFA 4WK3A 2ROPA 2IJFA 3GR1A 2KRRA 4U8YA 1RKJA 2HS3A 1EQ0A 2QMWA 1S1WA 2PO4A 1PIEA 2XY5A 5K20B 3UD4P 5KTQA 8AT1B 1SI9A 3DXSX 3EVWA 2E7VA 3OV7A 5IC6B 4R5PA 3BSOA 2EG1A 1QVGR 1FCAA 2BOPA 5LJ3Y 5B08A 2V4QA 2Y1JA 2AP6A 2HWIA 4RL1A 4F26A 4DV6J 1MLAA 2BM0A 4MFBA 4G1QB 4NXNF 3I56S 3V81A 2IIHA 2HFSA 3MOJB 3FVYA 2AJ0A 1JLCA 3HSGA 4O0IA 3RR8A 2G9OA 4CH1A 2YWWA 3NWGA 1U6BA 3QNWB 1VMBA 2CPDA 4J9QA 1YBAA 4WFYA 3DHWC 3FBCA 2HNYA 2ZH6A 2V8GA 2HZVA 5T7LB 3OTOJ 1NSKL 4ZCMA 5F3ZA 1NK9A 4PUOB 5SUHA 2MEWA 3BPSP 3EMTA 3AAWB 4M1KA 4MK7A 5B0CA 2NR0A 2BJ3A 3I0SA 3ITHA 3KG4A 2QYGA 2EFQA 5D77A 2UXCJ 3T6BA 2B9YA 2HHHF 2WSEC 3D0HE 4OX6A 2WVFA 3CD6S 4QBUA 1FESA 5KG6A 2FZCB 3OXLA 4ZCIA 3WDOA 4Q2LA 4C7QA 2H5IB 2XZDB 4P52A 1MROA 4F2SA 3CJRA 3R97A 3FCWA 4EBCA 4CLLA 3CB4A 4YB5A 3NEKA 3FQKA 2CYYA 2DRBA 2V9KA 2ALZA 5GAEU 3UE2A 3JSMA 4LFAF 5L1LA 1DLOB 4L73A 4PABA 1VC5A 3SDEB 3N5FA 1VR6A 4URSA 4PQUA 5H9FJ 3PR4A 2E1MC 2DH7A 3CMES 1VQPS 1HHQA 2FHMA 4F4AA 4C97A 3R2CJ 2BW2A 2YKMB 4LVOP 5BYSA 2X1AA 3SSSA 3I5BA 3KNAA 3HCXA 3A1YG 3QIPB 2F4FA 3SQOP 3U1MA 4Z2XA 4IR9A 2QZ8A 1AFJA 3JSRA 1CJTB 5D78A 1VC6A 1DY3A 4KRWA 2DYAA 2O01C 2OEJA 1ZZFA 3SFGA 4NL5A 1S1TA 5DZ6A 5EWFA 3DC2A 1QY7A 4I1TA 3B82A 3OXFA 4FYWB 1QJHA 1W25A 2DNZA 4R5PB 1Q8IA 3DKDA 4MTPA 4NX9A 2LFVA 1YX2A 3FCVA 4DUYF 4PYDA 1RTIA 3BBCA 4TVAB 2QEXS 3WZ0A 3KUGA 2EC2A 2BABA 2IM3A 1EP4A 2VG7A 2RDJA 4DV3J 1VQLS 1KC8T 3V81B 3GCWP 5IQ6A 2Y3YA 5KT3A 1MWQA 4ETXA 1JLCB 5DQHA 4YN3B 1JLQA 2JOQA 2FGCA 1S5ZA 2UVRA 2MQNA 1U1OA 5A8WA 2LEPA 1RE1B 4NE9C 4TYAA 2D3OR 1F6TA 2CIMA 2DISA 3ENWA 4DV1F 2FVRA 5M2UA 1LFWA 1NPRA 2QA1A 4UQTA 2HNYB 5KFGA 3NGRA 2V8PA 5HSPA 1J5EF 3TAMA 2BE9B 1S7HA 3QATA 5B09A 1RU1A 3I0SB 3ITHB 4N77A 2RKIA 4KGMA 2ZDPA 2VFTA 2F7VA 1KFSA 4NXNJ 2OP5A 1FRMA 1TMJA 3L09A 2AEMA 1T3NA 1U1LA 1F5AA 4LR9A 3GV7B 3UD5A 1MROB 4FF1A 1BQNA 4EYHB 2JEGA 2BRLA 2X1GA 2OH2A 2GCFA 2QLFB 2P9EA 4OI2A 3ZZYA 2DIUA 3LTOA 3CJQA 3JSMB 5C24A 2ZOFA 2R2RA 2QX0A 2RRNA 2GVDA 2E7WA 3U1NA 3QGPA 1J5OA 4JOUA 3E3XA 3QYYA 4IKAA 5LMUF 3C46A 4PQUB 2G2YA 4F25A 1GFWB 2X3DA 1CULA 3LP0A 3JTPA 5IFMA 4GVLA 5IT9Y 1FJEB 2MTLA 1TUWA 3MAAA 1RHRB 3FMBA 1OPIA 4A47A 2AYMA 3P5BP 1EAYC 1GMVA 2C1EB 1S57A 2G0JA 1S1TB 1U2FA 2FJVA 3H2UB 1WOSA 1Q7LB 3UDVA 3CDAA 4LFAJ 3VAJA 1AYEA 3CNQP 3HSZA 1Q4RA 4O3NA 2LXIA 1M90T 1X0PA 4EYIB 2JWNA 4IOAQ 3AQOA 4HR2A 3RBEA 3G87A 3SFUA 4FPIA 1Y5LB 2Z0GA 4MIBA 1RBAA 2XO7A 2DBBA 5C2CA 1EP4B 2VG7B 4LJMA 3PYGA 1EARA 3M2VA 4FF3A 5J1EA 1UFLA 2KHDA 3F41A 4UQGA 3ZTQA 3FKBA 3TUJC 1CEZA 2BVZA 3EICA 3IR6B 3PACA 1RAFB 1LXJA 4MKVA 4H4KC 3MTKA 5ETVA 4KBIA 1JLQB 2YVSA 2XMTA 5A8WB 3DLHA 1UVKA 4KHRA 1X0FA 2JDJA 4R0EA 1NEEA 5CABA 1T9UA 1UCNA 5CXTA 4CTAA 2VB6A 3M6VA 4PWUA 1FI4A 3H4DA 4H4OA 2DNQA 2FD2A 3TAMB 4TLQA 1HR0F 2LEBA 2RKIB 4CLZA 4FN5A 4UW2A 2LDYA 3ZZUA 3RR7A 3I5CA 2FZGB 3T1YJ 3LH2S 4PCQA 3IM9A 1BQNB 2Y1LB 2D9OA 2JH3A 4I7FA 2R7TA 2A3JA 1RT2A 2KL8A 4ZCKA 2OFHX 4DV1J 2RT3A 1R8PA 5C24B 4WU2A 3CIMA 4OZJA 5ETRA 4DCPB 3NOCA 1TL4A 2GVDB 1J5OB 4DR5F 5JVGQ 3DLJA 4DSIA 1NB2A 4RJVA 3LANA 1CULB 3LP0B 2HHPA 5D4NA 4PXEA 3EWGA 3G2XA 3HHKA 4USVA 4XDDA 3MAAB 2GO9A 5D4OA 1M5HA 1OYEA 3EUNA 2MQQA 2XNRA 2V50A 3JQJA 2LKZA 1B0PA 1TKZA 2ZBQA 2KDOA 2WBMA 3KLIA 5D0HA 5THWA 4OZ3A 2M5YA 1YRTA 1FRIA 3D6MB 5CD4H 3CCVS 1VQMS 4DUZJ 1KWMA 3IRWP 1H2TZ 2KFNA 4H54A 4ZVFA 2CPEA 4YMEA 5LMUJ 4CNYA 3MR6A 4LQ3A 2B9WA 4ZPVR 1ACMB 4L75A 1WKJA 3HHLD 3EGNA 4KHPF 2GAHC 1WHYA 2XULA 2QFJA 2PFFB 3M2VB 5J1EB 2W7OA 3D0GE 3Q2TC 1HD1A 4IOCQ 1X9MA 1FJCA 3P45B 2HHSA 2QTWA 1YHQS 3D67A 2R7OA 4N41A 3PW7A 3TP2A 5C7PA 3DMJA 4J9PA 3HM9A 3DOKA 2PMZD 4H4MA 4J9MA 3BGLA 2CQ4A 1C0UB 5LT5A 4IH6A 1VQNS 1Q78A 1GXTA 3QGIA 1N36F 4JUZA 2V34A 2MKJA 2R8KA 3FBEA 3AQPA 3B4MA 3AJDA 2WW8A 4CTAB 3MFHA 5KFWA 1ZPWX 3J81j 4OQJA 2QIFA 2CFXA 2FLLA 1T9TA 4NLWA 4LSZB 3NNAA 1TQLA 2RAQA 3FRZA 2K7JA 2VU5A 1DJ0A 1WEYA 2RRBA 4X4OA 1XC9A 3ZZ0A 4IRDA 4OJHA 2MYFA 1CBKA 2PDAA 4CYUA 1U26A 2PA3A 1MMDA 1RHMB 2H3EB 4CLYA 3N6NA 2RVJA 5DGAA 4ED5A 3JYTA 4I7FB 3VAHA 1FNMA 1NHKL 1RT2B 3QT8A 3EYZA 4K50A 5D0GA 3EGVA 2DGVA 4IDKA 1RKIA 3N4WA 3IG1A 1HBMA 2DHXA 1SC1B 1VK3A 2H4WB 4AXJA 4OJGA 4X2BA 3DYAA 4PG6A 5HN0A 4ZP9A 1KOOA 1T11A 5KFPA 1JXVA 1LFPA 4YR3A 1NDKA 4DS4A 2CQBA 2YNGB 2XZWA 5DGBA 3TUPA 5GADI 2HBQB 4KE5A 3DLBA 4CLKA 2AZ1A 5KFRA 2Q1LA 4BC7A 2D9PA 1TKZB 3FUYA 3OR2A 1Y4ZB 2GGPA 3KLIB 1FXDA 3QAEA 3ZZRA 2ZKUA 2G4BA 2Y9HA 2FJXA 5CZVA 1P1TA 2G2OA 1FKAF 2HHTA 3K58A 5ETQA 2PE8A 5IZHA 4KKOA 4DR4J 2BJ7A 2ZUAA 4IH5A 2MZQA 3DNCA 3PYEA 4B08A 3MM7A 4DL0C 1PYOB 3M8RA 3W62A 8ATCB 1S77D 1FFWB 1S99A 4FS1A 3VGUA 1JQGA 2BDPA 2YNFA 5KFOA 1LWCA 1TV6A 3L95X 1DURA 1X7VA 3DMJB 2FHJD 2VQFF 9ATCB 3DOKB 3RJMB 4H4MB 3C66A 3BSCA 3IA0A 2VPXB 4NLGA 1WUUA 3HKWA 3N5BA 4DR2F 2QRRA 4NLQA 4RKUC 3HT3A 4FXWA 2P9CA 2FYXA 2GNKA 4U7UK 3BKUA 4KO0A 3HPOA 4M95A 3QJLA 2L9WA 4TU8A 5KFEA 2ZD1A 4F0HA 2HG4A 1U49A 2XI3A 2XMKA 3KHRA 3PW2A 1KR4A 2MZSA 3FEXB 2YBVA 3OVAA 4KH0B 2QMUB 3H42A 1M5PC 4QU7A 2CPJA 2H4YB 3W2VA 4DV7F 3EPGA 3RRGA 1H98A 4CYUB 2IAJA 3C3LA 4QR0A 3OXGA 3Q86A 2AD9A 1P9YA 2GJ2A 1N36J 4IDKB 4CM0A 2HQFA 2A18A 1IBKJ 2FQQB 1HBMB 3IG1B 1AA1B 1EIYB 1Q5VA 3MHYA 1HWIA 2KT3A 4K8RA 3HJFA 2GW8A 2HBYB 2ZH1A 1D8YA 3DYAB 2C2MB 3HKZD 2F9DA 2DR5A 2NYHA 1U2RA 1FRKA 2QG9B 2V2ZA 2EFPA 4DL7A 1BQMA 2KXFA 3GR0A 1OY9A 2XNQA 2GMLA 3EPIA 2N4DA 4DN9A 5I3QA 5HAOA 2Q3PA 4W98A 3GYNA 4NASA 2N4CA 4OI0A 2M70A 2A1BA 1P27B 3PFEA 3I4HX 2KYZA 3OR2B 2GGPB 3GZ7A 1CJKA 4GO5X 4CO5A 3NGSA 1QLNA 3NS5A 2DCUB 1F0XA 1H2UX 2VFUA 3VR1A 2OMLA 3KOAA 3MD1A 1R31A 2JHEA 2UUAF 4CZCA 2BKOA 5A8RA 3G4SS 2FB0A 3QRPA 1BLUA 4KKOB 4E2FB 2CQ2A 2WZ1A 1MU2A 4PPDA 2YWKA 4WYLA 2M8DB 3MM7B 1PBAA 2RU9A 1K47A 3IWXA 4TY8A 4ZOSA 3VVUA 4X4PA 4DV4F 4C8MA 4I6AA 2MQPA 1N5TA 4JI5F 5B0BA 4B3OA 3K5OA 4OV6A 4NLSA 2YNFB 3KK2A 1LWCB 3E2EA 1TV6B 1KQSR 2KG0A 4L3NA 4Q7AA 1UA1A 4DJBA 2DO0A 4OYWA 2YQ3A 3MUMP 4RNHA 5ETSA 3I0RA 1EKSA 1S1UA 1R27B 5LXYA 3N79A 4YB7A 1TK5A 2D69A 1CJVA 1LW2A 1VGYA 4PPZA 1KQKA 2YPZA 2CPZA 1LOUA 5KT2A 1S12A 1HI8A 4AYBD 5F0UA 2V2KA 1S97A 3NKYA 2AWZA 4USIA 1RWMB 3Q8VA 1JNRB 3TWZA 3CJ0A 4KO0B 3S01A 1LQ9A 4Q43A 4KC5A 2ZD1B 5K8NA 2OO4A 2B6AA 3M2UA 1URRA 2BZ2A 4F4KA 3W2VB 3CJ2A 3ETMA 2Q79A 4JI6F 2IAJB 2QSFA 3MOZA 2J0SD 1QTNB 3LP1A 1REVA 3MM8A 1Q8LA 3VF0B 3LGNA 2B9EA 2J0WA 3R1HA 3MEEA 1OSCA 2CA9A 2LLZA 4Y00A 3MZIA 4L74A 4DR2J 3UPFA 3GFZA 4K4YA 1K0VA 1IWGA 2FY8A 3THTA 4CNZA 4JI1F 4LFBF 2HWHA 1SJ4P 2HIQA 1SL1A 3F73A 4GC6A 4U6PA 2I38A 3CMAS 1CG2A 3KUEA 2XLJA 3HK2A 1V3ZA 1BQMB 2WVDA 2NPIA 1X4HA 5KOWA 3A3PB 2C3PA 3B8HA 3D9BA 4QIEA 2W25A 3PO4A 4Y6IA 2MZJA 1FK9A 1IVZA 1CJKB 2XZTB 4AQYF 1DARA 1SPBP 1QDUB 5M2PA 1NDPA 4G6VB 3AJ2A 1BGXT 2YWFA 2Z2YB 1RWUA 4F4XA 4DR7F 1WSRA 1CVJA 2COLA 4F7VA 5A8RB 1WTFA 1T9WA 2OHDA 1WI6A 2L48A 3TZYA 1MU2B 4DV2F 3MMCA 1DRZA 3KJQB 3UNGC 1Y3JA 4C4WA 1V6HA 4LF6F 1PKUA 4TY8B 1IBLJ 4MH8A 4KQZA 3JXOA 2N3OA 2R2SA 4B3OB 1NK0A 2AIRB 4LREA 4JI0F 1CLFA 4CDIA 2JSXA 3RZAA 4RZRA 1IKWA 3KK2B 4QIFA 1S1XA 2FJEB 2UXBF 2OGUA 2K3KA 2V8HA 3I0RB 1R8BA 5DG7A 4LR8A 1KVJA 1JK9B 1S1UB 1Q79A 1N52B 5E3CA 2UV8A 1CJVB 1LW2B 1CQNA 3BN4A 4YR2A 1FNOA 3TW0A 3S7RA 3QLHB 3MM5A 4M5HA 1G2EA 2ZITA 4RLEA 2K1RA 4O3SA 4KPYA 2M4MA 3HVWA 1V9OA 2MQMA 2YKPA 1D09B 4O23A 4ZJLA 4DR1F 3EDQB 4DV4J 2CDQA 3EJMA 3BN7A 4WIQA 2B6AB 3M2UB 2P6SA 4URGA 3W7BA 1N88A 2DNPA 3CO9A 3PNIA 5KFDA 3AB4B 3D1QA 4NYOA 2EWHA 2HMIA 3IR5B 4AE5A 3LP1B 3MM8B 1REVB 3BO3A 1F9EB 3GLJA 2DR9A 3MEEB 2VONA 3HFVA 2M8HA 4L6V3 2PA8D 2ZBPA 2VBXA 3DN9A 4OZ1A 4I2PA 2IVMA 4U96A 1JLBA 4ED7A 1R8AA 4F67A 2JLFA 2VG5A 1TKTA 3W63A 1X5OA 4RWXA 2I1RA 1SV5A 1FDNA 2PSZA 5CH7B 2YPYA 4K7QA 4OI4A 4ZPTR 4TU7A 4V19X 1FK9B 4RW9A 1A6LA 2NXCA 2M88A 3K59A 3U27A 3O8WA 1UKUA 1SQGA 1JNZB 3ET6A 4NLVA 1TR0A 1SC3B 5E0OA 3A8KA 4ZVOB 5DDOC 2B3TB 4JI1J 4LFBJ 4ZVPB 4A48A 2ZZMA 3MMCB 2V9WA 4FKXA 2DY9A 1B64A 4USMA 4ZMMA 2ZOGA 3AXMA 1BXNA 4Y3CA 2VHGA 1YIJS 1GT8A 4ELTA 4LIWA 2JC0A 4C48A 5HVFA 3CCLS 1IKWB 2FPHX 2R7RA 2OUGA 5HL7Q 2XSFA 2CVEA 2F1FA 1U25A 1S1XB 3MAHA 2Q66A 2ZM6F 4ELUA 1Y11A 1MN7A 4AQYJ 3CJKA 1HHTP 2KKHA 2ZBRA 3C14A 1FWLA 2XWXA 4CO1A 4WFAQ 4DV5F 5FDLA 4DR7J 4ANEA 2WVEA 3MM5B 5AXKA 1R8HA 4K0KF 4UUXA 2A10A 2K1RB 4DV2J 4ZPDA 2DIVA 3BGOP 1JJ2R 4QCLA 1UWAA 4LF6J 2J9CA 3PIOQ 4ZLPA 2CQPA 2GQQA 4CH7A 5E7OB 2CQGA 3ZZOA 4MMOA 4ZPWR 1ZS6A 3K5LA 3PX4A 4EZ6A 3D6FB 4IQXA 4ES2A 2JVRA 1P8GA 1FX4A 2G0CA 3UN2A 3R5DA 3CUNA 3UCGA 3BR8A 5KT4A 3CXCR 1JJ4A 1KHWA 1L5UA 2HMIB 2GS8A 2HVEA 4ZN1A 2UXBJ 3Q8QB 2HQCA 2BRKA 4EGLA 4B3TF 1RHUB 3CW2C 3NGUA 4ZKAA 1IM4A 4TY9A 3EGZA 2VPYB 3K57A 2XO6A 3F56A 3RBZA 3QZ7A 1H73A 4C8KA 3GU0A 4PEOA 1YSJA 3IXQA 1PAUB 3GJSB 1L3TA 2JFKA 2E44A 4DR1J 4I2PB 4JP8A 3NCPA 2BEFA 2D3ZA 1JLBB 3RGIA 2RJZA 5T41A 2VG5B 4USKA 3LGMA 1TKTB 1LW0A 3IGVA 4I69A 2DITA 1SV5B 2RQCA 4HTIA 3KLGA 5DZ7A 4F3OA 4M5GA 4L76A 2UUWA 2M9KA 4RW9B 1VLYA 2BXJA 4RNFA 1V3RA 1WKLA 1Y10A 2IYIA 1ZAXA 1AUDA 3ET6B 3OJSA 4JV5F 4CM2A 4CLSA 4A8XA 1QAXA 4QIGA 3TR5A 4EUVA 2D3UA 1YJWS 1HNWF 4J9LA 1R7IA 4JBCA 1SJFA 2CG4A 1SBRA 2IVFB 4NYPA 4KT0C 2J6SA 1SCJB 1F9FA 3OTDA 4DCJB 3IAM9 2EBEA 2G13A 2J8AA 4KGZB 3WBZA 2CUYA 1U1KA 1ZM3A 4LRAA 1NM2A 4DLEA 2QMXA 4JI7F 3RRHA 3ICLA 3BV8A 1ULRA 1BWEA 3CJKB 1U4BA 3C14B 1S6OA 1FRLA 2V0NA 4FNHA 3I96A 3PO5A 1SKRA 1N5VA 3MECA 2M7SA 4M5MA 1S4FA 4WP3A 4OYZA 1VQ7S 4QR1A 4LRDA 4OYMA 1PAEX 3HSDA 2LYVA 3DHXA 4PXCA 3OQ2A 4B3RF 5D15A 2RB7A 3D7SB 1X4BA 3QRQA 2R7SA 4I4BA 2MQOA 3HO1A 2BACA 1UVLA 1ZPVA 2BA9A 2MKSA 2F4VF 3IMQJ 2RMLA 1SKWA 1Y3KA 1AFIA 4MKYA 5A0YB 2HYIB 4NCGA 3M30A 3M8WA 2ZM6J 3VAGA 3CDEA 5C25A 3QGGA 3MXHP 4FS2A 3HP6A 5JJBA 1ROFA 4HTJA 4DV5J 1WELA 2JLGA 2KVIA 4U7CA 4DSJA 3A4TA 3NBPB 1HI1A 1XTZA 1Q16B 1QE1A 3S6EA 3MEDA 2BYCA 2HK2A 3TA1A 1PILA 2V67A 3Q2SC 4PXBA 1PSDA 4HL9A 5AJ3F 2WOMA 1S7IA 1KS2A 3SQGA 1LW0B 3U02A 1YTYA 1NSQA 4WXWA 2DO4A 4AUKA 2WB4A 1IN0A 3KLGB 3I31A 5E3AA 5IV3A 3TA2A 1UEUA 1VRQC 2PD1A 1KN6A 2YQ0A 4JV1A 1U8SA 2N7CA 2N82B 2RUSA 2AJFE 5J2MA 2XCAA 1G4CA 2BOAA 2KH9A 2PN6A 1XEZA 1T05A 1RWOB 4QYRA 4DX8H 4CQ1A 5H9EJ 1IUJA 3T1AA 3CDUA 2FHKA 4C0HA 3ILJA 2CJBA 1X31C 4YDDB 2EK6A 3LALA 5E5NA 2VBWA 1RU2A 3JQKA 4P2SA 2CNKB 2B5JA 4X4UA 1BUXA 3C19A 1U2CA 4ER8A 3TI0A 2I9SA 2DHSA 2MKIA 3FEZA 3MAQA 3GJQB 1RAAB 2OPRA 4MK9A 4C2MA 1Y5NB 2E1CA 2H1YA 1H7XA 3C15A 2YKNA 1FEEA 3GWCA 3LAMA 2ZBIA 2AZ3A 1HNWJ 2W8KA 2DGOA 3BKTA 2XYGB 2BE2A 4I64A 2MMYA 6AT1B 4RNOA 3IAS9 3SXLA 3TEHB 1X5PA 1C1BB 2CQ1A 1VIXA 2HWTA 3RW7A 4NMLA 1YJUA 4ENOA 1RWPB 4XAKA 1GK8A 4JI7J 2B0GA 4UOHA 2EKYA 4NCGB 3M30B 3T19A 2ZKTA 1U1RA 2ILYA 5C25B 2GO8A 5KFFA 1WOOA 2DT9A 3H25A 1Q5YA 5L1JA 2C3YA 2DNLA 4ZVEA 3TA0A 5ETNA 1NZAA 3R5CA 2ZJRQ 4ECVA 2J7WA 2HRYA 1QE1B 4IFYA 1WHXA 3MEDB 3H0PA 2NXNA 2HFUA 4B3RJ 2MZ1A 1VRTA 4P74A 5HJXA 2NS1B 1X4EA 1T8EA 4YB1P 1PC5A 2WOMB 3D54A 5K9FA 1FO1A 2A0FB 4I56A 3IS9A 1LWEA 3VCDA 3SQGB 4NLOA 5KT7A 2RRAA 3SIPB 1BWVA 1RWWB 2MGZA 4B17A 1FVQA 1T9YA 3KMQA 1X9SA 5KG7A 5KFNA 3FZ2A 2GMJA 3VVTA 4DS5A 4ALZA 4YP3A 1W7WA 5J2MB 3FSXA 4A8KA 4NRUA 1NJIT 4BDPA 2ACYA 2B7CB 4UOGA 2XMVA 4OYOA 3L7UA 1T05B 3BQ0A 1PG5B 4HACB 3QZ8A 2OMOA 3KG1A 1RCOB 3TYTA 3R2DJ 3FSYA 3LO3A 3DM2A 3D66A 3PR5B 1UW9A 4TXSA 2XEXA 1OSDA 5AJ3J 3GFHA 2RNEA 4B9TA 2KI2A 3K5PA 2NPFA 2NCKL 1UVNA 4YY3J 2B5JB 2LECA 1VJWA 4GO7X 3GJTB 1CSJA 2VD3A 3WQPA 4DQQA 2ZNYA 3IGNA 4OHVA 5F8IA 4IG3A 1UVJA 1HBUA 3H98A 2AYBA 2DR6A 1NUEA 4ZP7A 5HVGA 3RBDA 2YKNB 3CEDA 5L9XA 1SJQA 4LF9F 2YKQA 3JTNA 5H1SV 4FZVA 2HHVA 2E1RA 3A3NB 2BE2B 3BM7A 1Q1KA 1HNIA 2LXUA 5B0DA 4JI2F 1EZZB 3H2LA 2HNDA 4JI8F 1FERA 1K44A 1YJ9S 2MB0B 2KRBA 2ADBA 2NSCA 3Q8RB 3M7VA 3GIIA 2UUBF 1ZM9A 4KIAA 5F8HA 4EMDA 5GAEI 1XR7A 4AL5A 3QT5A 4PRFA 4LRFA 3CIZA 1XN9A 3QMQA 1WG1A 1Y5IB 4HT5A 3TJAA 4D3GA 1VCTA 1LWXA 4EO6A 4DFJA 3R7SB 2F65A 1N5QA 4IFYB 2QFIA 5F8MA 4QIVA 4F0KA 3HD1A 3V4MA 1VRUA 1XK8A 1VRTB 1JLEA 2YKOA 3TVKA 3QRRA 4A8FA 5FLXY 5AT1B 2Z30B 5HATA 1FX2A 1NRKA 2VL1A 3K8VA 4AL6A 3D5MA 1LWEB 3IS9B 3TRGA 2QLJB 1JB0C 2BE7D 2IMWP 3CJTA 3W5YA 2X1BA 1VBZA 2MGZB 1N34F 5L8RC 2LQJA 5KG0A 1XNQJ 1VBKA 4WFZA 1SXLA 5EWGA 4ZLLA 2X7IA 2R2UA 4USWA 2BKPA 1N5YA 2AGOA 1YBUA 2JEJA 2Q6BA 2WB1D 2XHWA 3PZPA 1ZA1B 1BE4A 1YJRA 1RLDA 2HS4A 4QYZK 3SI8A 3K8WA 1HMVB 1KKHA 2OTJS 2Z2MA 1TTHB 2VODA 3QJPA 4FNIA 3N6MA 2XY6A 3DM2B 1EKRA 2WVBA 1I6JA 4IRCA 3QQCD 1FVSA 2LQ9A 4ZHRA 4V1Ak 3PKMA 2LDIA 4OJ1A 5K5MA 1WC0A 1QTMA 2VG6A 4P6QA 1HHSA 4B9UA 1ITPA 4WK1A 2E66A 2YNHB 5IS2A 4EFAC 1X4CA 1WJ9A 1FDAA 1N56A 1TFWA 5FJ4A 1OQ6A 4IG3B 3LWMA 2IDEA 2J9EA 1HBUB 2BJ1A 1PO6A 2CPXA 1R6YA 1O51A 2C3UA 2PI4A 3ISND 3BH6B 2XCPA 4HI2A 2VICA 3J7Z5 2H5EA 1TKXA 4X66F 2XC9A 1K73T 4M5DA 1HNIB 3U7JA 5HQ8A 4MAKA 2IM2A 2HK3A 5ETPA 1NHVA 4RW7A 5ADZA 2CKWA 1SC4B 2F9JA 2IM0A 4PG7A 2GIFA 2J6UA 4ZPBA 1SQEA 3J7ZT 3K5NA 1YK9A 2DY1A 4LSLB 3OSPA 1HFEL 3H5SA 2CJKA 2POKA 5ETOA 7AT1B 3QPIA 2E1AA 4M5LA 4A4JA 3PVXA 4RPFA 5L1KA 4LF9J 1U1QA 5DLFA 1N5SA 4OYPA 1BMQB 4ECUA 4F04B 3PG9A 3CMQA 3OTEA 1VRUB 4JI2J 1JLEB 1ZYQA 4JI8J 2GA7A 1HWKA 3OFHA 2FUG9 2HHUA 4M5KA 2UV8G 1G1XA 4QJVA 4WWSA 3KJVA 3CCMS 4CLTA 1KD1T 4BS2A 1Q53A 2UUBJ 2BKNA 4OZ5A 1XMQJ 3G6XA 2HIYA 4ZITA 2QYCA 3TJ8A 1SVDA 4PXDA 4NYZA 1F5BA 2M3DA 1N5YB 4F8RA 3JB9k 4O3QA 5KFIA 2MLZA 2NXUA 5CCLA 3GPAA 2Q43A 4IYQA 2CZ4A 3UI3A 1UEKA 4Q45A 3CCRS 4RWWA 1XNRF 2EI5A 1KTVA 2DHAA 1TL3A 2UU9J 1H38A 3GFXA 1T02A 4WYWA 4X62J 1TP7A 4ZHRB 3FFIA 4HYKA 2AF6A 2HLTA 2VG6B 4X4TA 1FXRA 2XMJA 4GKJF 4RW4A 3OVBA 2MY8A 4JI3F 3MMJA 3NGTA 4ZA1A 2APOA 2MKCA 3FMWA 5F9LA 3F44A 3HHNB 1RT3A 3VTIA 4WZQA 3G71S 2R8JA 2WONA 2C2KB 4HHHA 4NZ6A 2XY7A 1UMJA 4IO9Q 3W3SA 1TKXB 2LCWA 1DQ9A 3H5UA 4M5DB 2DGUA 1VQ8S 1YGYA 1K0TA 4F3MA 2XMMA 3DLGA 1YDLA 1R6VA 2O66A 3H8YA 3CO0P 3D0IE 4LBHA 4RW7B 2ZDOA 4DF8A 3OD2A 4PR6A 4UY85 4PWDB 3PHEA 5BYRA 1TZ0A 2DNMA 4PZVA 2E9TA 1F9HA 4OYXA 1YWXA 4OX9F 3HFKA 1KVKA 1WC6A 3KLFA 4DMZA 4U8VA 1N33F 4OI1A 2PFDA 3C6UA 2E9RX 2VJVA 4NCAA 1AT1B 2CXEA 4LT6A 1LK5A 3M2RA 3M8PA 4Y0FA 3MR3A 3LWLA 4UY8T 4Y34A 2IJRA 2QV6A 5HQLA 5KFYA 4TLRA 3DLEA 1S72S 2SXLA 4OHWA 4J91A 2CQ0A 1FWPA 3W5XA 1Q0NA 1ZBTA 1X4AA 5M2RA 1LKZA 2EKNA 1RYRA 4NLXA 2VFVA 3EGWB 5KFTA 3KWMA 2YH1A 4U9RA 2Z2ZA 1KLNA 4ZDNA 2YKAA 4KAIA 5IT0A 1NDCA 2X51A 5J2PA 4QW9A 2VASA 2PMHA 5B0EA 2MXYA 5GAHU 3P5TL 1A0OB 1TU0B 1GX6A 2WVCA 1AROP 3DCAA 4M5IA 4Q8FA 3GFYA 2IRUA 1GX5A 3AHPA 4ES3A 2EEYA 2JEIA 1S1WB 2K3IA 3V6JA 3RTVA 5AXMA 4ILLA 2VPWB 1TL3B 1RTJA 1WNEA 3T9NA 2B4OA 2DXEA 5F8NA 3FFIB 1I51B 4WFNQ 1EQMA 4IO1A 1U24A 4WJBA 2PEHA 4RW4B 3CSKA 2B8QA 3FK4A 2IYGA 1RI7A 3I32A 3AY0A 3U1LA 2WHOA 2WK4A 3PY8A 4DL3A 1U1NA 2MHEA 2VH7A 3WIUA 1RYSA 3CJ3A 1RT3B 5EX3A 1Q82T 3OL9A 1HBOA 2CPFA 5CAAA 2X3GA 4MFBB 2IY5B 4KHMA 4NXMF 2VDHA 1HW9A 2LVWA 2WONB 3J7AN 2E9ZA 2VA3A 4LF2A 3MWBA 1DBDA 2HSEB 3LPYA 2Y1RI 1XNRJ 3VGVA 3VGSA 1L3KA 3CCZA 4P2XA 1RTHA 2O67A 4KR0B 3NRBA 2ZZNA 3KDOA 2N3LA 3DLGB 3SSQA 1OMSA 5F8JA 2HBRB 3DGVA 1MWZA 2ZWOA 3CDWA 4DV0F 3EVMA 4GKJJ 2NZCA 4X4SA 4LUBA 4MYUA 3FQLA 3M32A 4JI3J 3BEGB 1VQYA 3HHEA 4BWMA 1I94F 5HMXA 3WC2A 2DNKA 3KLFB 2DD8S 5LMNF 3J7YI 2VC0A 2FHOB 3TUZC 3C6UB 4Y2CA 2BANA 2W2QP 4EK2A 4OZ2A 2GHVC 3M2RB 2Y8WA 4N47A 2HHQA 3TZWA 3OFFA 1TKDA 1N4LA 5J2NA 2F8HA 1IBMF 1RWNB 3DLEB 2QL9B 4P72A 4NEZA 4O44A 1NBEB 5MAOA 4OHXA 1CC7A 2ZH5A 2HVDA 5G0RA 1UZDA 4HH0A 4S0MA 2B4PA 2NQPA 4KY3A 2AGPA 1FD8A 5HP1A 2OEKA 2KB2A 2E5LF 4OX9J 2C2OB 4URQU 1F2HA 4NA2A 1RSCA 3BF4A 2H65B 2P2CB 4XPEA 3T41A 1N33J 2ROGA 1NCLA 1VQKS 4C6AA 3O3LA 2MHNA 3NWRA 4DF4A 5J2PB 2HHHJ 3W9HA 2HRTA 1NJZA 5JXSA 3THPA 4LQ9A 1WSVA 1WEXA 3GV8B 2DVIA 2B4VA 1C4AA 1B0TA 1SUQA 4LSNA 4F02A
chains in the Genus database with same CATH topology
3M9MB 2R7WA 1SV5A 4NLUA 1FDNA 5SZTA 2PSZA 3PM9A 2HQIA 2G1DA 4MIAA 5CH7B 1U1MA 4DL5A 4ECSA 3BZQA 2F40A 2HZCA 4OI4A 1IJEB 4OI6A 3Q23A 2HPUA 3M6XA 3R27A 5EX0A 5KFXA 4ZPTR 3UDLA 1VQ6S 2HW3A 3RAMA 1RT1B 4TU7A 3H5XA 4V19X 3HHDA 1RK8A 2D41A 2KFZA 1FK9B 3PKYA 4RW9A 1DLOA 1FJGF 3OLBA 3MECB 3MPVA 2KXNB 4ECRA 1A6LA 1RTIB 5I3PA 2M88A 2ASLA 3K59A 3U27A 3O8WA 1UKUA 2J0XA 4NLPA 4XK8C 3TANA 1JNZB 4NLVA 4I6WA 3VAMA 2C2EA 1TR0A 1HPZA 1JJHA 5E0OA 1VQSA 4J5OA 2L41A 5DDOC 3IRXB 1HBOB 2B3TB 2JVOA 1CC8A 3BS9A 3GILA 3KFWX 3QIDA 4ZP8A 4A48A 2YKMA 2A2DA 4O3PA 5KT6A 4DWIA 1PC4A 4FXVA 2OPSB 4AXIA 2ZZMA 3MMCB 4KB7A 4PKDB 1P1LA 2OTLS 3OHAA 2V9WA 3THVA 1TAQA 2UUTA 1B64A 2RQMA 4K4UA 3MR2A 4MJKA 1ZAWA 3OTCA 3IFEA 4DV3F 4ZMMA 3QIPA 2ZOGA 5CYJA 4A46A 3FEYB 1XMBA 3PEJA 1FE4A 4Y3CA 5B7WA 1E6VB 1RTHB 1O0PA 1YIJS 3RU0A 3IWNC 1GT8A 4ELTA 1U6ZA 1FKPB 1TVRB 3CCSS 4LIWA 4WK3A 2JC0A 2ROPA 1IQZA 1IBLF 2R8IA 2XMWA 2IJFA 1GH8A 3GR1A 2KRRA 3CCLS 1IKWB 2FPHX 1RKJA 2HS3A 2R7RA 2QMWA 1S1WA 5HL7Q 3KHGA 2PO4A 2XSFA 2CVEA 3BGRA 1APSA 2F1FA 3C2PA 2DNNA 4C98A 2XY5A 1U25A 3O1LA 4ILMA 1S1XB 3MAHA 3UD4P 1WG4A 2LEAA 1TK8A 3VAKA 2Q66A 2ZM6F 5J1PA 4ELUA 3TOQA 5KTQA 2QSWA 4Q2MA 5L9NA 3CJKA 3M32B 1L3VA 1SI9A 3DXSX 3J81Y 5BR8F 4ID5A 1HHTP 2KKHA 2GFFA 3OV7A 3KK3A 2OSQA 2AJQA 4R5PA 3EXCX 3ZZZA 3BSOA 2XWXA 2EG1A 4CO1A 3L3CA 4QIWD 1KLMB 1QVGR 4WFAQ 1FCAA 1Y7PA 2BOPA 3QO9B 2BJDA 4DV5F 5FDLA 4OX8A 4ICLA 2OPPA 4WTYA 5LJ3Y 5B08A 5AXKA 3MM5B 2V4QA 3CGIA 1R8HA 1YJVA 2R2TA 1S9FA 3EZUA 2OPQA 2BANB 2Y1JA 4K0KF 1SJ1A 4UUXA 2AP6A 1HNVA 2A10A 2VBYA 2K1RB 2HWIA 4ZPDA 2DIVA 4F26A 2M2BA 2CPHA 4O4GA 3X1LB 2UVVA 1FE0A 1K8AT 2DNHA 1JJ2R 4NA3A 4QCLA 2BM0A 4ECXA 4MFBA 4G1QB 2J9CA 3OJUA 3I56S 4NXNF 3PIOQ 3V81A 5J2NB 4ZLPA 2CQPA 2GQQA 2HVHA 4CH7A 2GHWA 5E7OB 2GMHA 3MOJB 2CQGA 3V4IA 2HQ3A 3ZZOA 4MMOA 3FVYA 2QA2A 4ZPWR 2AJ0A 3HLUA 1JLCA 3K5LA 3PX4A 1LK7A 4O0IA 3RR8A 4EZ6A 2G9OA 4RUCA 4IQXA 2OIHA 4ES2A 2FIUA 2JVRA 2YX4A 1P8GA 4CH1A 2FLPA 2G0CA 1NK6A 4O4RA 3NWGA 4EBDA 4O44B 4EZ9A 3UDCA 3PJWA 3R5DA 3CUNA 1U6BA 3UCGA 3PJXA 3BR8A 5KT4A 3SV3A 3CXCR 1JJ4A 1KHWA 1S49A 5G0RB 1L5UA 3RB6A 2KM8B 1HA1A 1VMBA 2CPDA 3CVKA 4J9QA 2HMIB 3DRSA 5IT4A 1YBAA 1QSYA 1S0MA 1JMTA 4WFYA 3Q8QB 1H7WA 2BRKA 1D9AA 3DHWC 2F8MA 1ZTTA 4EGLA 4CT8A 4CT9A 4B3TF 5HP1B 4ELVA 2FC9A 2HNYA 4ZKAA 2V8GA 5HMWA 2XGQA 1IM4A 5T7LB 2ZH6A 1S6PA 4TY9A 4ZCMA 4N8OA 3EGZA 2VPYB 3K57A 2L08A 3O44A 4ZK7M 5F3ZA 1NK9A 1NK7A 4PUOB 2B7BB 3F56A 5SUHA 1FTCA 3RAXA 2V8VA 3NGDA 3AAWB 3M9NB 4HVZA 4M1KA 3K2YA 2Z2LA 4MK7A 3MI7X 5B0CA 3QZ7A 4C8KA 2NR0A 4J9SA 4GC7A 2LMIA 1HI0P 1YSJA 1H3DA 2ZH2A 1VBXA 3I0SA 3ITHA 4WCEQ 3IXQA 3KG4A 2BQUA 3NCQA 3QLHA 5HROA 2EFQA 1L3TA 5D77A 5LSLA 4LF5F 2JFKA 1Y00A 2E44A 2XLIA 3QGHA 1UVIA 4I2PB 3T6BA 2B9YA 4X4QA 3MCSA 4N5SA 3NCPA 1D9DA 2HHHF 2WSEC 3K5MA 3D0HE 2D3ZA 4OX6A 3CD6S 2VA2A 4QBUA 1WHWA 2R7XA 1JLBB 1FESA 5KG6A 2CJ9A 2RJZA 3OXLA 4WF9Q 5T41A 1NB7A 3DI6A 1ZM4A 2VG5B 3WDOA 4ZCIA 4Q2LA 1QUVA 3CD5A 3LGMA 4C7QA 1QSLA 4FVCA 3VALA 1SUQB 4OHZA 1TKTB 1MROA 1LW0A 4LSNB 4F2SA 3GG1A 3IGVA 4I69A 4N8NA 2RS2A 2DITA 1SV5B 3E8OA 3K7RA 2RQCA 4EBCA 4F50A 3MMAA 5C42A 4HH1A 4HTIA 4IG0A 3KLGA 4F3OA 2HHXA 3CB4A 4YB5A 3FQKA 4EWTA 1Q86T 2CYYA 2OPRB 2UUWA 4RW8A 5F41A 3KLEA 2V9KA 2M9KA 5GAEU 2ALZA 2DRBA 2OSRA 3UE2A 3JSMA 2O1PA 3FNNA 3UCZP 4LFAF 1U1PA 3FSIA 4RW9B 5L1LA 1DLOB 1N32F 2P5VA 1VLYA 1GTEA 5JVHQ 1Z2ZA 1YRXA 5EUHA 2BXJA 4RNFA 1VC5A 1V3RA 3SDEB 1IQTA 1Z4UA 3VQSA 3N5FA 5DQGA 5KG2A 4URSA 2IYIA 2IRXA 3H20A 1ZAXA 3DDNA 3I9V9 2BUNA 5CZXA 1AUDA 3FDSA 3I6PA 5H9FJ 3PR4A 4PQUA 2E1MC 3EZ5A 5KG3A 2DH7A 3FRYA 1HPZB 5CYQA 5D4LA 3OJSA 4JV5F 3KYLA 3CMES 1IR0A 4QU6A 4A8OA 3QWPA 1VQPS 2FHMA 2IJNA 4A8XA 1QAXA 4C97A 4QIGA 3TR5A 2BW2A 4EUVA 2YKMB 2D3UA 4LVOP 1HQEA 1I1GA 5BYSA 2X1AA 1YJWS 1HNWF 4J9LA 1R7IA 4U67Q 2DNYA 4LF4F 3SSSA 2W8LA 1OS5A 4JBCA 1SJFA 3I5BA 2CG4A 1SBRA 2IVFB 2QA4S 2L3MA 2P9GA 4NYPA 5AE3A 3KNAA 3H40A 5E41A 1MMLA 3A1YG 3QIPB 4KT0C 3U1MA 4Z2XA 3OW2R 4A8SA 2QZ8A 4IR9A 2J6SA 2XB2D 2MSSA 1AFJA 3Q22A 1F9FA 3OTDA 3IAM9 2EC0A 2C3OA 3JSRA 4DR3F 2EBEA 2UXDF 2G13A 2AJ1A 1M5KC 2J8AA 5DM7Q 2J7UA 5D78A 3WBZA 1VC6A 4TN2A 3SYZA 4KRWA 3DU5A 4K5SA 1U1KA 3FJ2A 2O01C 1SJRA 3HXMA 1O5JA 1ZM3A 1ZZFA 3SFGA 2QMXA 1HQUA 4NL5A 4DLEA 1S1TA 3BGRB 4JI7F 4IQMA 4KGKA 4NLYA 2RS8A 5EWFA 3DC2A 3RRHA 3ICLA 1QY7A 4I1TA 3B82A 3OXFA 3MTJA 4ZVHA 1QJHA 1ULRA 1BWEA 4HLBA 5K8OA 2ATLA 3CJKB 3M6WA 4NLDA 4H4OB 4ID5B 3G8SA 1W25A 2JLEA 2U1AA 2AW0A 2DNZA 3KK3B 1U4BA 2J0QD 4R5PB 2ZH4A 1Q8IA 1FRLA 1S6OA 2V0NA 4FNHA 3I96A 3CPWR 1FRJA 3PO5A 1SKRA 1N5VA 4MTPA 4NX9A 3CWJA 3MECA 4DUYF 4NWBA 1DTQA 2ZH9A 1X4FA 4CO2A 2W4DA 1RTIA 2M7SA 4ICLB 1KNZA 2OPPB 4RX6A 7FDRA 1S4FA 2IBOA 2QEXS 1VQ7S 3WZ0A 5I3UA 4QR1A 2OPQB 1ZAVA 1HNVB 2DK2A 5GADU 2BABA 2ZBCA 2R7UA 2IM3A 4O4GB 3M9OB 4ECYA 1EP4A 2VG7A 1QUPA 2LYVA 3SEOA 5DM6Q 4NPOA 2KJWA 2BR0A 2CJQA 3DHXA 4PXCA 3OQ2A 4O3OA 5GAHI 2RDJA 4B3RF 1VS3A 1HL6A 2RB7A 2KT2A 1X4BA 2BM1A 2NUUG 3M1VA 1DTTA 3HHLC 2RSQA 4TKTA 3V81B 1KC8T 4ECQA 1VQLS 2R7SA 3BDPA 2JL9A 1GQEA 3HVAA 4DL4A 5DG8A 3G8QA 5IQ6A 3RW6A 3KHHA 1S1VA 4I4BA 5KT3A 3V4IB 2MQOA 4TU9A 3A8EA 4ETXA 1JLCB 5DQHA 3HO1A 2JOQA 1JLQA 2BACA 2FGCA 4K2XA 1UVLA 1ZPVA 2BA9A 2K2PA 2NLWA 2UVRA 2MKSA 1RAJA 2MQNA 4ED1A 2F4VF 4DSEA 2RMLA 1U1OA 1U7LA 1SKWA 5A8WA 2LEPA 3BGUA 4TYAA 1DZ5A 3J80Y 1Y3KA 2Q6CA 1AFIA 4MKYA 2D3OR 5A0YB 4O3RA 2J9DA 4TYBA 2CIMA 3MF5A 2HYIB 2DISA 3ENWA 3FZBA 4NCGA 3M30A 4DV1F 2FVRA 5M2UA 1LFWA 1HWJA 3SCIE 3P6YC 4OI3A 2ZC3A 4K4TA 3VAGA 2QA1A 4UQTA 3CDEA 1N8RT 4RU2A 5C25A 2HNYB 1JXLA 3OFGA 3QGGA 3MXHP 1S6PB 4FS2A 3NNHA 2MSTA 3HP6A 5JJBA 1M5OC 1NJXA 3MMBA 1WD6A 4WE1A 3E01A 1ROFA 3FGVA 2Y1IA 3PW0A 3RB4A 1QM9A 4HTJA 5KFGA 4NCBA 2B43A 2RU3A 1WELA 2JLGA 3BREA 1FA0A 2KVIA 5J2QA 1J5EF 4U7CA 2LXFA 3OTOF 4DSJA 1UAWA 1Z1ZA 4Q5VA 3NBPB 3TAMA 1HI1A 1S7HA 5B09A 3B78A 1XTZA 1R0AA 1Q16B 3I0SB 3ITHB 1QE1A 3S6EA 3ZZPA 1OPZA 4N77A 4ATNA 3MEDA 2RKIA 4OL8A 2BYCA 3JAMY 1Y0HA 3R5AA 3B4DA 2IFXA 2CPIA 2ZDPA 4KGMA 5EWEA 5CA5A 4QW8A 3EX7B 2QA4G 2VFTA 4IR1A 5HROB 2F7VA 3TA1A 1PILA 1KFSA 4E0DA 1TAUA 3W2WA 2OP5A 1FRMA 3AJ1A 3PW5A 1D9FA 3Q2SC 4PXBA 2V4JA 3MM6A 1PSDA 2WAQD 3L09A 4HL9A 5AJ3F 4TQSA 2WOMA 2C42A 1T3NA 1U1LA 1F5AA 4WU3A 5FD1A 3DI6B 2JZ5A 1S48A 5GAGU 2CQIA 5DG9A 1KS2A 4YR0A 3GV7B 2ZC4A 3SQGA 1MROB 1LW0B 4XPCA 4LF7F 4FF1A 1BQNA 3U02A 1YTYA 1HYSA 4EYHB 1D3WA 2FDNA 4WXWA 2JEGA 2AYGA 4I67A 2DO4A 4AUKA 2BRLA 3MMAB 2WB4A 3TX8A 1NK4A 1IN0A 4IG0B 3KLGB 2IMOA 4X4VA 1KHVA 4FPRA 2X1GA 3I31A 3DRRA 1R3NA 3KG0A 3PRDA 5E3AA 1XMQF 3OHBA 4AFFA 5CCMA 2E5JA 2GCFA 2OKQA 3DRYA 2OH2A 3TA2A 1C0TA 2P9EA 4OI2A 2WSCC 1UEUA 1T3OA 2PD1A 3ZZYA 2DIUA 4RW8B 3NGKA 1FTRA 3KLEB 1KN6A 1DQAA 3JSMB 5C24A 4JV1A 3CCES 3R5BA 2ZOFA 1U8SA 2R2RA 2V5HG 1R43A 2N7CA 1U47A 2RRNA 2E7WA 2N82B 3U1NA 2AJFE 3QGPA 5J2MA 1HWUA 1J5OA 2XCAA 2F8EX 4JOUA 3E3XA 3G6YA 3QYYA 4IKAA 3MURP 2KH9A 3D1OA 2PN6A 5LMUF 3C46A 4PQUB 2HFOA 1XEZA 4WFBQ 1ZETA 4ZCLA 4F25A 5CYQB 3DFEA 4NZ0A 1T05A 2VKZG 2Z4PA 4QYRA 4DX8H 3V6KA 3KK1A 1H2VZ 4DR6F 4CQ1A 4JI4F 1F2GA 5H9EJ 1IUJA 3T1AA 3CDUA 2FHKA 4C0HA 3LP0A 2MZRA 3JTPA 4K59A 2HAIA 5IFMA 3PX6A 2CJBA 3D1HA 5IT9Y 1HQEB 2IRYA 2RE1A 1FJEB 2HNDB 4IRKA 2R7VA 3DLKA 4CIOA 2MKKA 2KG1A 4YDDB 3FMBA 2E29A 4B3SF 4OX7A 1OPIA 2AX1A 2EK6A 1G3OA 3LALA 4A47A 2AYMA 4M8LA 5E5NA 5C5JA 5KFSA 2VBWA 3K0JA 3NLCA 2AU0A 3MEGA 3IO1A 5KFVA 4P2SA 2BJEA 3LOUA 5BJRA 1UL3A 3IBWA 4DG1A 2B5JA 4X4UA 5DDQC 1JIHA 1V3SA 1XR6A 3PRBA 3TI0A 2GQ2A 1HQUB 4IH7A 4KFBA 3CCTA 1S1TB 1U2FA 2I9SA 2WTFA 2DHSA 2MKIA 3FEZA 1NKBA 2EW9A 3MAQA 3H2UB 2FJVA 3US5A 4J37A 1Q7LB 3CDAA 3OUYA 3I5AA 3VAJA 2KYXA 1Q4RA 3CCUS 4O3NA 2LXIA 2MQLA 1RJJA 5IQQA 2OPRA 2YNIA 2VOOA 4MK9A 1GAOA 1M90T 2KT5A 4C2MA 1Y5NB 2E1CA 1H7XA 1X0PA 1WF0A 4EYIB 4ITSA 2JWNA 4IOAQ 2YKNA 3UCUP 1DTQB 1VC0A 1FEEA 3AQOA 1VBYA 3GWCA 3SDEA 3LAMA 3KLVA 4ED0A 2IC3A 1UA0A 5I3UB 3RBEA 1H0HB 3NAIA 3GIJA 3SFUA 1Y5LB 2Z0GA 4MIBA 2ZBIA 1S6UA 2XO7A 2DBBA 1EP4B 2VG7B 1FNXH 2W8KA 4LJMA 2DGOA 3M2VA 4FF3A 4NZ7A 5J1EA 1UFLA 2BE2A 2KHDA 4HT7A 3F41A 4KTQA 4UQGA 4I64A 3TUJC 1N0UA 2MMYA 2C28A 2BVZA 1CEZA 3SV4A 3IR6B 3PACA 4RNOA 1LXJA 1DTTB 3IAS9 3M1VB 3SXLA 1NK5A 4ED3A 4H4KC 1SL2A 3MTKA 1S1VB 1X5PA 1C1BB 4C8ZA 4KBIA 3JYTB 2CQ1A 4ED8A 1JLQB 1VIXA 2HWTA 2ILZA 2YVSA 3RW7A 3I55S 2DHGA 3VAIA 1XERA 4NMLA 5EN1A 2XMTA 5I42A 1YJUA 1L3SA 5A8WB 3WC0A 4X4RA 3DLHA 4LMZA 5D8HB 4XAKA 4C3MA 1WEZA 1UVKA 1DAXA 2B0GA 4F4WA 1IKXA 4KHRA 2EKYA 3GIMA 5EDWA 3DDKA 4NCGB 3TARA 2DPIA 2J5AA 3M30B 2JJ4D 2BQ3A 4OMFG 3T19A 1D1UA 2ZKTA 1X0FA 2JDJA 2WRMA 1U1RA 4R0EA 1NEEA 2KHCA 3M8SA 2ILYA 4EO8A 2JEFA 1N48A