4RBTA

Pdua k26a s40l mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGLGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Structural protein
molecule keywords Propanediol utilization protein PduA
total genus 22
structure length 89
sequence length 89
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbtA00
3SSSA 2EWHA 3VCDA 3MPYA 4QIEA 4AXJA 4PPDA 2A1BA 3DN9A 3CGIA 3SSQA 3I6PA 3SSRA 3DNCA 5DJBA 4QIFA 4QIGA 4DDFA 3BN4A 4P7VA 4P7TA 4LIWA 3PACA 4OX6A 3H8YA 3IA0A 3NWGA 4OLOA 4RBTA 4AXIA 4QIVA 4OLPA 5L38A 2A18A 2G13A 2A10A 4OX7A 4RBVA 3N79A 4RBUA 3MPWA 4P2SA 4OX8A 3I96A 3CIMA 3NGKA
chains in the Genus database with same CATH superfamily
3DCAA 4KV8B 2DNKA 2QO3A 1ZA1B 1MWYA 2UXBJ 4TY9A 2W9BA 2BJ3A 1NHUA 3HHNB 2BKOA 3FBCA 3L3CA 5A8RA 3CCMS 4DR2J 1NB2A 3DRPA 2ATLA 4FPRA 4N41A 4G1QB 2FC9A 4LFAF 2AZ3A 4KE5A 3PIPQ 3M32B 1FF2A 2P8IA 4K8RA 5I3QA 2Q3PA 2XSJB 2H4WB 3FK4A 2WZ1A 4LRFA 2Z2LA 3MGJA 2FHKA 4B17A 2R2TA 1KWMA 5DGAA 1UMJA 4LF5F 4CO4A 2HWIA 2W4DA 1HKAA 2W7AA 3JTNA 1IBLJ 4OV6A 1VQSA 2E1PA 4BHQA 1R6YA 2B43A 1RU1A 2DNGA 1KQFB 2RU3A 3DXBA 4FKXA 2J0SD 2YQ1A 2LVWA 5EWGA 1RZMA 1G2EA 3R2DJ 2DY1A 4B9SA 4Q2MA 3D1OA 2N7CA 1LXJA 2QGFB 4DCJB 1Q82T 3MPYA 3NOCA 4ECSA 4NL5A 4OYXA 4LRAA 1C4CA 1U7LA 1WTBA 4KGZB 2LEPA 2AQ4A 5D8HB 2CPDA 4LF4F 1Y3JA 2X1GA 2XY7A 1KC8T 4U67Q 2C2OB 3T6JA 3VAGA 2M88A 3ZO7A 2AIRB 2G0IA 2YWEA 4R8UA 2VOPA 3OHAA 4RBTA 4ZLPA 2M3DA 4Y3CA 1WF0A 5C5JA 3TQEA 3VZIA 3KLIB 4DV1F 2RQMA 4OMFG 5M2PA 2VB6A 3CPWR 2M8DB 3P49B 1KVIA 3EGVA 3A3OB 4DL0C 3GIKA 3CULA 4JI5J 3CJ2A 4DL5A 2YBVA 4IFVA 4IH6A 1T9TA 4HVZA 4N76A 2QLJB 1Q1KA 1M0SA 3CCTA 4CIOA 1JLAB 3FBBA 2DNPA 2H48B 2XMJA 3PEJA 2EC0A 2UVUA 3BGUA 4NOHA 1L5UA 4WZQA 5L8RC 4TNOA 2L3MA 3ILJA 4ZVFA 3TQ1A 3M8SA 1OPIA 2FJXA 3KOAA 1S76D 3I5CA 1RABB 3B78A 1U1KA 4LIWA 3I56S 2J8AA 3HHKA 3OD2A 1X5PA 1KFSA 1ZS6A 1T95A 1UPPA 2DCUB 3NWGA 1QD1A 5L9XA 4X65F 2HMIA 2XS2A 3THPA 1SL2A 1PYSB 1ACMB 2JNJA 3FSYA 1X9WA 4U7UD 4KGVB 2HNYB 4ENOA 3HT3A 2QL9B 2RE1A 1UWBA 1DQ8A 5T7LA 3POTA 5D4OA 5LXYA 5EUHA 1WUUA 3WHIA 5SZTA 1QSYA 3JAMY 1GAOA 2DCLA 2CWXA 2WB4A 5G4DA 3NL0A 1RTIA 4YQWA 3G86A 1MNEA 4LSNA 4FYXB 2YKQA 1NO8A 2BABA 4JI0F 4PRFA 4TQSA 2Z8QA 2GQ2A 3FRYA 1YRUA 1U0HA 4J9RA 3P96A 2AGOA 3DRRA 2HBZB 3M30A 2HG4A 1I94J 3MMBB 3KLHA 1UPMB 3MMJA 3DHXA 4FS1A 5D4PA 2DY9A 1XMBA 4LSLB 1JJ2R 3M6UA 4JOUA 1IR1A 2VASA 7AT1B 3C6UB 5BYSA 2XHWA 2XSJA 1AFJA 4KGXB 2AEFA 3IBWA 3ITHB 5J2NA 2H51B 4NLVA 2ZH5A 2AMCB 2WSCC 4RNFA 1SQGA 2VBZA 2CYYA 3CMQA 2A6OA 9RUBA 2R8GA 2P2CB 1DFDA 2J5AA 5KG4A 2WTFA 2QX0A 2QFIA 3PCOB 1RTDB 2D7SA 1VC5A 3CJRA 3HVRA 3UCUP 1N32J 1NLKL 2WBMA 3LALA 4IYQA 3OPKA 5F8NA 4RUHA 1TVRB 3HCXA 3TUPA 1R8PA 2VFSA 1UEVA 4ZVOB 4AYBD 4FF1A 2CZVC 5HQ8A 2OSRA 1S6PB 2N4CA 2B4OA 2UV8A 4J9VA 4CLUA 3CCQS 3OXFA 1X5OA 3GR1A 2ASJA 1KP6A 3NGUA 4NA2A 3CD5A 3CO9A 3W2VB 4NLGA 3HO1A 5C2CA 3E2EA 3GSIA 2DGWA 5HJYA 5ETOA 1LWCB 5GMEA 2DR9A 4P75A 2Y8WA 2OFGX 4M8LA 5L1JA 1YJNS 3MEEA 5C42A 2GFFA 3QO9B 4Q8FA 3FGVA 1NK4A 4QCLA 1EP4A 2N7YA 2V8VA 4ZITA 2FVRA 3U7JA 2DHHA 4FXWA 4U96A 3HJFA 4Y34A 4DS4A 5I3PA 3AA8A 4NASA 2KH9A 2IMWP 4LF9F 1CS4A 4CLLA 2XCAA 3LWLA 2FLNA 5IT0A 2DPIA 3BQ2A 4L6V3 3OLBA 2QG9B 1XMOJ 1YZ7A 1P1TA 4EMDA 1HI0P 1OSCA 1QLNA 1NCLA 1VQ5S 3CC7S 5E41A 3V6DA 1TK8A 3UCZP 3OV7A 1XJWB 1RI7A 1YRXA 1WWHA 2HQFA 2CJQA 2XMKA 2VG5B 3QWUA 1Q79A 1RWWB 1HI1A 3HSZA 2PD1A 3DC2A 4GVLA 1U2FA 5E3RA 3ZXWA 1IKXA 3B82A 2K7KA 2HMIB 3SCIE 3LOUA 1CSJA 3B4DA 2F9JA 4HHJA 3DLLQ 2IM2A 4LF4J 1CPZA 3M2VA 3OL9A 3D0GE 1TELA 4F04B 1S1UA 2JLGA 2CPEA 2GO8A 1RT3A 1GXUA 1PILA 2GNKA 5KT6A 5GAHI 1VBKA 1HPZB 1X0PA 5A2QU 3M8ZA 3M8PB 2C2KB 4FDFA 4JI0J 2J7KA 2VG7A 4LF6F 2C2MB 4CH7A 2QA2A 4DXLA 4HYKA 3PZPA 4J5OA 1HI8A 2KT2A 3G6VA 1XTZA 1U1OA 3GJSB 3LTOA 2C1EB 4ZVEA 2ZNYA 1JLCB 1RBLA 3KLGB 2ZH3A 3OFGA 4K4YA 3QLHA 5A8WA 4DS5A 2LU2A 4KJIA 2OI2A 4DN9A 4BLGA 4Z7CA 1WNEA 3IG1B 4JI7J 4AL7A 3P3DA 1RGVA 4PG5A 1SC6A 3C6UA 1RT7B 4KR0B 1RBAA 2DNRA 3HFVA 1M5VC 5DDRC 4Y00A 3KK3B 4DPTA 2HFNA 2Z0GA 3A8IA 4PPDA 1T9VA 2DJWA 2DNOA 5HI7A 4YB5A 4DV0F 4KHMA 2CXEA 3OSNA 3SSQA 2VQEF 2GMHA 5KFPA 2EPIA 4M94A 4TU7A 3CCLS 3FZBA 1M1HA 2IM1A 4HACA 5KFIA 3RBEA 4DR7J 2FB0A 7FDRA 1Y10A 2BR0A 1Q81T 2MQNA 3OR1B 2W2NP 3HP6A 4JI4F 1YITS 3K8VA 3ONQA 3MAQA 1B4SA 3PX4A 1N5YB 1RJJA 2FVPA 4DSIA 4WP8A 1X9MA 4MFBA 4QWBA 1KVJA 2C3UA 1V3SA 4PEOA 1N48A 3QJJA 4OX7A 1G3OA 2W9CB 2JH3A 1WHYA 3JSBA 3F41A 4I68A 5LSOA 3GV5B 3CB4A 3FSXA 4CNZA 3W2VA 3TJ8A 1U1NA 1XK8A 5LM7E 1HQEA 3I4PA 4HT5A 3SDEB 4A47A 4I1TA 3IR6B 1GQEA 2KXNB 1F9EB 3W3SA 4P2MA 3CC4S 2IAJB 1N34F 1TTHB 3BM7A 1XBWA 1DQ9A 1HBUA 1WDTA 2BE2A 2ZH9A 2CPYA 5F8JA 1N6QA 1OYDA 3BGRA 4GMKA 4USJC 4PABA 2CQDA 1QJHA 4PYAA 2KL8A 2AEJA 4MK9A 5LL6d 3ZZ0A 2KU7A 2YKAA 4DUTA 4YHHF 4G3IA 1Y5LB 3BB5A 4YB1P 1FJCA 1YK9A 3T5HA 4QIVA 4DV2F 2OFHX 1NPPA 5H9FK 1S48A 2YNHB 5DM6Q 4WFAQ 1C0TA 2VUGA 3PW2A 4ZVQB 5L1LA 2CNLB 3AA9A 2LXUA 3W9HA 2BQRA 5GAEI 3GWCA 3AHPA 4MYUA 4RW6A 1LWEB 4K4VA 1UZDA 2D74B 2DO0A 1TR0A 3MUMP 5K8MA 4L76A 1Y00A 3N4WA 2PFFB 2GJIA 2V34A 3FEYB 2Z2YB 3VAFA 1KOHA 2VBXA 4JI7F 1ZZFA 3TRGA 1RT1B 2L08A 5CQGA 3JAMU 4FF3A 4KKOB 2HVHA 2D69A 4B9VA 3JTOA 3V2UC 1HQUA 4UQGA 1NK0A 3EGWB 4O4RA 2CQ1A 3K5MA 3O2IA 5EWEA 2LQ9A 4NYPA 3IR7B 2RDIA 1RT3B 3BPDA 3R5AA 4OZ5A 3OUYB 4KHRA 3UFCX 4UZBA 3LP1B 2ZBIA 3M8PA 3SQOP 2K06A 5HL7Q 4FVCA 2VG7B 4KFBB 2BM0A 4DPWA 2A10A 2FJAB 4F36A 5J2QA 3C8YA 1DLOA 2IIHA 3KLFB 4LF8J 4OIXA 1N32F 4KBIA 1JKHB 2K3KA 2KDOA 3C16A 3IS9A 1I3OB 5HLFA 4R0JA 5LMUF 1VRTA 1TL3B 1UJ4A 1M1GA 2NXCA 5KFVA 1OY8A 4A8OA 5KFXA 5IM0A 4IRCA 1IKWA 2CPJA 2BE7D 2GAHC 3TVYA 4S0MA 2RSQA 2VD3A 3GJQB 2IYIA 4OZ0A 2V4QA 3GILA 1NPRA 4OHXA 2F40A 4YR0A 2GJFA 1T3NA 2IDLA 2ZITA 2ZOFA 4JYAJ 4DV4F 4DOZA 3R27A 5KFEA 1ELOA 4B3SJ 3BDEA 4PYDA 2V2KA 4WFNQ 3SCJE 2H54B 1MG7A 2PO4A 3BJYA 2KZMA 4ED3A 2QIFA 3UN5A 3CWJA 2FC8A 3GG1A 3VAIA 1WI6A 1X4AA 4LRDA 4PQAA 4D3HA 2GX8A 5U47A 1RT6B 1WEXA 3BREA 3BGLA 1GNKA 5EGYA 4HTIA 1DJ0A 1VHIA 1JMTA 1EIYB 3AH6A 4C0HA 5C25A 3VQSA 3BS9A 3LGMA 1KDNA 3N6MA 4MFBB 2MSSA 1ZZNA 1B0TA 4C11B 4ZHRB 5MAOA 4X64F 3H5SA 3BSAA 4WFZA 4X4TA 1CQNA 1NBEB 3MM5A 4P71A 5BYQA 4EO8A 3AD8C 2AGQA 1U1RA 2GZOA 5I4MA 5ETKA 1OPZA 1JQGA 3U27A 3Q23A 1C0UB 2VC1A 1SJ3P 1OWXA 2FGOA 3EVMA 1PC5A 2VFVA 4F0MA 1TL1A 4QPXA 1JLFA 2BJ7A 4AQYF 1KSPA 1VQ6S 5DJBA 1OY6A 1RLCL 2XBPA 3AXKA 1TK5A 4B9MA 2H9ZA 2HVIA 1PBUA 2YQ3A 3I0RA 2BW2A 3N5FA 3DLEA 3DRSA 3OVAA 3H8YA 3IRXB 2HVZA 2QMWA 3BF4A 4EBEA 2C2EA 1NSQA 1Z2ZA 4C8OA 4N7TA 2JC0A 3LP2B 4NLQA 2D1CA 1U1MA 1ZM2A 1VC0A 2Y3YA 2YWHA 3PW5A 1PJ6A 3AAWB 4YB7A 3NGTA 4ICLB 2R8KA 3ZFVA 2F4VF 4KH0B 3TZZA 3UPFA 5HN0A 5AXLA 2HZAA 4USIA 3PJXA 4AUKA 4RW9A 2B8PA 1WTFA 2VDHA 5BYRA 3W65A 1H0HB 2FD2A 3CO0P 4JI8F 4XPEA 3PIOQ 4DV3F 1FCAA 3B4MA 1D3WA 4JB8B 4NLPA 1MN9A 2DNQA 3ZTPA 4ETXA 5LT5A 5F8LA 4Q45A 2L9DA 5RUBA 3RRHA 4QIWD 4Q44A 2RNEA 4RW7A 3G96A 5D15A 2JSXA 4LF9J 1U8WA 1C1CB 1SIWB 2WAQD 3L7PA 3U1LA 2FPHX 4L74A 1B0PA 3WX4A 3IC1A 3HFKA 4X4UA 2GGPA 3CCVS 4NLSA 1TFYA 3MEKA 1YHQS 4JI5F 1YI2S 4BC7A 4NCGB 3PTWA 4LF8F 2BE2B 2ZH8A 3NGKA 2W4PA 4C98A 1YSJA 2MHEA 4CQ1A 3ISND 3PHEA 4ZPWR 2DR8A 5CYQA 1H7WA 5HK4A 4PXEA 2PIIA 4J7CA 4Y2MA 1Q16B 3W5XA 1PYOB 3EDRB 3LPYA 2PA8D 3MCNA 4B02A 1JLQB 4F7VA 2KG0A 4BWMA 4DUZF 4B3TF 5GADI 3T5LA 3KHRA 4R25A 1FDBA 1TZ0A 6FD1A 4LMZA 4KPCA 4O3QA 3DI6A 2KM8C 2HLUA 1NJWA 4GO7X 4HL9A 4AXIA 3DHWC 3KMQA 1VQLS 1T9YA 3M8WA 4G1PA 1NM2A 4DL7A 2LMIA 4N47A 3RGIA 3GFYA 2CJAA 2CZ9A 4NZ0A 1N4LA 2XLKA 2DTJA 3A8EA 3UR0A 3W5YA 4KH1B 3I4HX 2JX2A 1HFEL 2QSWA 3DOLA 3OXGA 1SL1A 2HNYA 3TZWA 3EE3A 3TA1A 1MU2A 3R9LA 1XR7A 4QPTA 2EEYA 3PVXA 3NCRA 1FD2A 3FQLA 1E6VA 1RAIB 4CLKA 4QWCA 4K0KF 3Q86A 1ULRA 2NUHA 2PDAA 2KVIA 1D9DA 1QE1B 3L4BC 4AQYJ 5HMZA 4CNYA 1RT5B 2FJDB 2YNIA 3KK1B 2UUAJ 1JLFB 4ES2A 4XTTA 5GADU 4JI4J 2NYHA 2QMUB 1H98A 2IJFA 3MURP 3AJ2A 3MMBA 4DR7F 4JV5J 4C2MA 2ASLA 1GMVA 3KXDA 3I9V9 2K8GA 2M8HA 1VLYA 3IBCB 4CM2A 2JFKA 1ZOTA 3Q8PB 3D2WA 2BQ3A 2BZ2A 2ADCA 1WC4A 3HVAA 4U8YA 5GMKa 3T5KA 2XZTB 3JXOA 3MWBA 4IG3A 4NRUA 1X4CA 2HFZA 3F0NA 4NLDA 5KT5A 4DR5J 3RB4A 1U09A 4P9SA 3KJQB 5H1SV 4LBHA 5KG3A 4J91A 3ADAC 4DU8A 1UVLA 3QRPA 1QTMA 1IUJA 1HD1A 4CLYA 4OI0A 1JJCB 2DO4A 5B0FA 4ED6A 1UVNA 1BLUA 1P9YA 4WIQA 3M05A 1RT6A 3FCHA 3QT5A 2WVEA 4PQUA 1DARA 2XWYA 2R7SA 3GSDA 3UNGC 2HZCA 3VQTA 1KOOA 4RUBA 4RW7B 4C11A 3TAQA 4N5SA 1FNXH 2FHJA 4RO0A 1RTHA 2RDJA 2DIVA 3H2VE 4YR2A 2QMXA 2ZEJA 2EFQA 3P45B 3HX9A 2BRLA 4ZCKA 4K4SA 5IFMA 2NSCA 3LP0A 5IV3A 3KJVA 1VHFA 1Q7YT 4DSLA 3MM6A 3Q8RB 1HMVA 4FKYA 1TL1B 4H4OB 4F02A 1VK3A 2E5IA 2V4JA 4ECRA 3D5MA 1RWOB 3I6PA 3HZEA 1F60B 1KHVA 2CADA 3DLEB 4CYUB 4F3MA 2OJ3A 1GMWA 4JI2J 2BA9A 3W63A 4F2SA 5CYQB 4LUBA 1GMWD 4FN5A 2R2RA 4NXMJ 3M2RB 2L48A 2OTLS 3C15B 1KLNA 2W9AA 4KO0B 1S0MA 3IA0A 1EARA 4NYOA 3CJ5A 1OQ3A 1Z4UA 2CJXB 2DEJA 2OPQA 2WONB 3HM9A 1HNXF 1AFIA 4NX9A 4RPFA 5K8OA 5KFMA 2XMMA 2C3PA 4KHPF 5B0DA 1EB0A 2CVIA 1QAIA 2J9EA 1VISA 2VFUA 1RACB 2V94A 1IWGA 2I8EA 2CJBA 3J7YU 1XERA 1YLXA 4R5PA 2VBWA 4IR1A 3CCUS 2E9TA 2K2PA 1BQMA 3D9BA 3C14A 4RNMA 2HFVA 4JV0A 5F9NA 1NK8A 1BUXA 3IFEA 1J27A 2MY8A 2HIQA 4WK1A 1EAYC 1MU2B 1VQ8S 1JIHA 1S6OA 1NSAA 2RS2A 3VAKA 3M9OB 3AB4B 1HWKA 3GONA 4Z2XA 1LWCA 5AJ3F 4B9NA 1RUSA 2YH1A 2K1RA 1VMBA 1YX2A 2CPXA 4DJBA 4TQRA 4K4XA 2YKMB 3AOBA 3MM8B 3OTDA 1U4BA 1TKTB 4DSJA 1CC7A 2UUBJ 3GYGA 4WYWA 4JI1J 2E5GA 2MPUA 3KLGA 2LQ8A 3RJMB 2ZUGA 4LFAJ 2H65B 3SSSA 4DUZJ 3T1HF 1PAUB 4OI6A 2W7PA 2MEWA 2MJNA 4KC5A 3N6LA 4UUXA 4CLPA 3CNQP 4LQ9A 1RHUB 2DXDA 2R7QA 3SSRA 3QGHA 3FMWA 3G6XA 2HHTA 1A6LA 2OSQA 2PN6A 4I6YA 4DDFA 1VRUB 2ZHBA 1RWMB 3QRQA 4RKUC 4JI6F 1R0AA 4ZPDA 1PIEA 2E1RA 4HACB 3OR2B 4LBIA 4ZJLA 2ZH6A 1IBLF 8RUCA 4NXNJ 1KN6A 2M70A 4J9MA 1R8BA 3JTPA 2L9WA 2FJVA 2VPYB 4WIIA 5AT1B 3CXCR 2UP1A 1KEKA 3HSGA 3E3XA 4UQTA 4USWA 1WI8A 5HMYA 4C8KA 1PAEX 3HK2A 1LW2A 4OJ3A 4B3OA 2BMBA 3LAMA 4AT1B 1IKYA 1KONA 2WOMA 4OQJA 2ATCB 5IV4A 2X1AA 3K5NA 1CJUA 5A0YA 1UETA 3HHLC 4P6QA 2LDIA 4DF4A 3SFUA 1J5EJ 3GE9A 3H20A 2BEFA 2UUAF 3LP0B 3KJVB 1H6KX 1EETA 1MWQA 5I42A 3FCWA 3D67A 3MM6B 4DV4J 1RT5A 2NUUG 3KK1A 3CMAS 2IRUA 3GPAA 4DWIA 4OZ2A 1VYAA 1R7IA 1XNRJ 2MLYA 3C2PA 4CI0B 3OT9A 1Q5VA 2O01C 2B9YA 5B7WA 3Q0AA 2BKNA 2YX4A 2P9GA 3W60A 3T19A 2R2UA 2QTWA 1GX5A 3H2UB 5AE1A 2O1PA 3GQCA 3LA0A 1FEEA 1F5AA 1RAEB 2RRBA 1TL5A 3DYAA 2ILZA 3IMQJ 5DO2A 4AE5A 4YMEA 1FKPB 4NWBA 4NZ7A 4ZPTR 2EFVA 2AX1A 1HBNA 4PXDA 2BANA 2ACMA 2GHPA 1Y5IB 2YTCA 3CJ3A 3O6QA 1WKJA 2DNHA 4HHHA 3J80U 4U6PA 3J7A1 1FRJA 2EFOA 2GW8A 2QV6A 3BPSP 4ID8A 4P72A 4ZN3A 2FY1A 1CEZA 1DTQB 1TQLA 3AXMA 2HBRB 4X65J 1CJKB 2HRYA 3K5PA 3PXGa 5KG5A 2XMWA 2EXUA 4I67A 5J1EA 2JEJA 3GFZA 3TX0A 3VVUA 1CVJA 3V4IA 1NXIA 2Y0BB 4DG1B 4X4NA 3NCQA 4TYAA 4WTOB 2BKPA 3TARA 5IT4A 2FVSA 1XNQJ 3IO1A 1RB0A 4QBUA 4FXDA 3BGOP 3NAIA 3L9ZA 4DR5F 1NHVA 2F4VJ 3ZZYA 4P10A 2GAGC 2HQGA 2YWGA 3MEDA 5DDPC 1X4GA 4KV8A 5HROB 4ZVTB 3H7HB 3D66A 3M1VB 5AE3A 4HI2A 4J9QA 2QL5B 2AJFE 2QYGA 2DT9A 1VJQA 4MKVA 1RWPB 1RWVB 2BRKA 2B0GA 4AXJA 4RU9A 2AJQA 1WC5A 1T11A 2OEMA 4I2QB 4I7FA 4O23A 1FX4A 2R7WA 2ZHAA 4DFMA 4F4ZA 1JLGB 3FUYA 5HP1B 3RR7A 3A8KA 2DHAA 3DGPB 3CJTA 3SCKE 2X1FA 1R8AA 2EBGA 4UY85 2ZJQQ 3QJLA 4RNHA 3RAMA 2ZD1B 3GIJA 5JMNA 4OX6A 1DBDA 5C7PA 2R4FA 3I9ZA 4JI6J 4QYZJ 2XS7A 1JLEA 4M5MA 4ED7A 4DQRA 4DL4A 1YJUA 3TI0A 4OYPA 3NS7B 3RW7A 4B9UA 5CHCB 4RX6A 4WFBQ 3P5BP 2BJ8A 4XDDA 4JI2F 5E3QA 2XCPA 3C14B 1ZAWA 3T1YJ 1O51A 3D6TB 5KT3A 4F2RA 2K3IA 1E6YB 2V8PA 2AV5A 2YX1A 5HATA 1BWEA 3IAM9 3OW2R 2HAIA 2C42A 4MIBA 1B7YB 1HWLA 5F0UA 5B0GA 2DH7A 3LAKA 2I38A 3ZZPA 3OUYA 4OI1A 3V6HA 1V3ZA 3W9IA 1RTIB 1VQOS 1HHTP 2YWFA 2K1RB 5F8GA 4U7CA 3QMQA 1S5ZA 4ES3A 3E51A 3EMTA 5HVHA 1OIAA 4ILMA 2WVCA 3QT8A 4CH1A 2HZVA 2AYMA 4IRDA 1M5OC 4WWSA 1N0VC 5HLFB 1FFSB 2VFTA 2VA2A 3DM2A 3M6XA 4IFVB 2MZQA 4CO5A 3M8QA 1H72C 3RTVA 3MAHA 1UA1A 3TUIC 3LP2A 5J2MA 5DLGA 1RYSA 2E9ZA 4GKJJ 3CDAA 3JSMA 1TP7A 1ZYQA 4LSZB 1SI9A 2FUG9 2KHDA 3I82A 1M5HA 3G82A 3OBIA 5AXMA 4ALZA 2VKRA 4LR7A 4NEYA 5KFSA 1SXLA 4UTGA 3PJ9A 1W2BR 2DRAA 2QLFB 3H42A 3W7BA 4Z7YA 4WTYA 2XYGB 1RADB 3CJSA 3ENQA 2FYXA 2LKZA 1SPBP 3PDNA 4TN2A 4DU7A 2J7WA 5LXRA 2AGPA 1KQSR 2OTJS 4DV3J 2QA4G 4DPOA 3R8YA 3O5TB 3F73A 3FEXB 4NLUA 1U25A 8AT1B 5J1EB 3SYZA 1OSDA 1UFKA 4CLWA 2DKOB 3IBFB 4LVOP 3RBXA 2VDIA 1OO0B 3R6GB 2DB1A 1FFGB 2V8GA 2XMVA 2C3YA 5KAKA 2L41A 2MKJA 3ZTRA 5M2UA 2CQ0A 3MR3A 4R8UB 1DRZA 2ACYA 3S1TA 2CQBA 1DHMA 4GKJF 2R7UA 3EX7B 5KT7A 1C0UA 4L3NA 1YJ9S 2LA6A 1CJTA 2YKPA 1JLBB 1S9GA 1D09B 4PZVA 5G0RB 3TJAA 1VBZA 4URSA 3DRYA 4LR9A 1IM6A 2KRRA 1HQ2A 2M5YA 2XWXA 2YXLA 1X5SA 3KLHB 3T9ZA 5KFAA 2CQPA 4BCAA 2NCKL 4RW4B 2R8IA 3CCES 1UFWA 1JLGA 3IM8A 3Q8YA 1FA0A 3QIDA 4NEZA 1FD8A 1RAGB 2J0WA 2R42A 3D1QA 4FPIA 1U49A 3ITHA 3NP5A 5KFKA 3DOMB 1HNVA 2HK2A 4EU0A 3X1LB 2N4DA 3FKBA 4Y2CA 5BR8F 5F41A 5IQ6A 2R7XA 1VRQC 3VWSA 1N88A 1HWUA 2B9WA 1TMJA 2UVWA 4B3MJ 1IBKF 1RAAB 3G87A 1HA1A 2F63A 2OHDA 4O3OA 1YDLA 4F0HA 1MWZA 4C7QA 1O0PA 2RD5C 3TX8A 4DPYA 2C28A 1O6XA 2FGCA 3T1HJ 4B08A 2W8LA 3CCSS 4MH8A 1RTJB 4LF7J 3DOKA 4I69A 4DLEA 3ETMA 1KRPA 1ZA2B 3GJRB 2ADBA 2JVOA 2LQ5A 4WFXA 2DGSA 1HWIA 2JL9A 4ZVRB 1RBOB 2DHXA 2YNFB 3DGVA 3OQ2A 5B0EA 4ANDA 2YQ0A 3RW6A 1NK5A 3Q2TC 4LREA 1V3RA 3MMCB 2CRLA 1N54B 3M1VA 2ZH2A 2IFXA 2NREA 4FYYB 2LECA 2B4VA 5K14B 4DL6A 4ZP6A 4LRCA 3TZYA 4ZVPB 1SC3B 1ZM3A 3W64A 5EDWA 4LQ3A 1SH0A 2MSTA 4KSEB 1Q8BA 2HK3A 2M52A 3QLHB 4I2PA 1FNMA 2XMTA 5HP1A 1Q53A 1F9FA 2DNNA 1NDCA 4MAKA 1REGX 4QIEA 4YFUA 4YY3J 1JWWA 3CCZA 1FERA 5A8KA 1Q5YA 2QRRA 3M6VA 3O3LA 2GQQA 4PG6A 1UWAA 2B9EA 1IWAA 2WB1D 5L1KA 5CD4A 3OXLA 3VGTA 2EFNA 4LBPA 5KFNA 3FMBA 3J7AN 1U26A 1H2UX 1BHNA 3EPGA 3D4JA 3MOZA 3PW0A 2XO6A 4FVMA 4PPZA 2VZ9A 4RWXA 4EBCA 4ECQA 1P6TA 2AYBA 3NBPB 4QR1A 4IOBA 2ZH7A 1RAHB 1UW9A 2A18A 1GXLA 1HL6A 1AYEA 1R8HA 5CZVA 2GMLA 3HPOA 4FS2A 4UW2A 1FHTA 3OFHA 4FF2A 4CLTA 1HBOB 2DIUA 1E6YA 3V81B 2FDNA 1B7FA 4J37A 4ZPCA 2HVDA 2XMUA 3ZZOA 4UOHA 2AJ1A 1S72S 3FBEA 1RTHB 2Z56B 4FF4A 2WVBA 5KFLA 2XB2D 4XO0A 2R7TA 1HW9A 1FDAA 1PYTA 1ZAVA 4RLEA 1VFJA 1XMOF 4V19X 2V68A 1EKSA 5ETNA 4WK3A 3GV7B 2HNZA 1RAOA 1S7HA 1Z2LA 5ETTA 4DR4F 1YKWA 4CO3A 3RR8A 3NMRA 1S9GB 5G0RA 2VQEJ 4O3SA 3DFEA 2V4JB 3DLGB 2OH2A 1LWFA 4OZ1A 2VG6A 2HFOA 1OQ6A 1Y5NB 1SJQA 3DM2B 5E3CA 1NKEA 3HJVA 3DRPB 1X60A 3BH6B 1TUVA 4ED0A 2OIHA 4M63A 1WOPA 1T0TV 2MKYA 4NMLA 2NZ4A 2UZAA 4PUOB 1IVZA 2EFGA 4IG3B 2B6AA 2Z4PA 1K1SA 3KK3A 1BY9A 2ZWPA 5D6GA 3RB3A 1U1QA 2RHSB 4YHHJ 3QZ7A 2Q66A 1ICEB 4F3QA 1BMQB 1MROB 2KT3A 2PMZD 2DNZA 5THWA 1SQEA 2AKWB 3H90A 2JRSA 1M1KT 4JYAF 2OGUA 2G2OA 1FRLA 4K7QA 1WC1A 4OYBA 3TAPA 2DR5A 2MZRA 1AA1B 2E5LJ 3MD3A 4P73A 2ZZTA 4RW6B 2FZGB 2I6WA 3T3FA 5J2PA 4OYMA 3IP0A 1SIZA 1EQ0A 2CZ4A 4ECXA 3KLVA 4E0DA 4LF7F 2HURA 4OZJA 1FRIA 1S1XA 2N3LA 5FLXY 3ISNC 2MTLA 1TKXB 2W9CA 4YOEA 1U1LA 1QAYA 1KLMB 4HDGA 3U02A 1RP5A 4PWDA 3QATA 1A9NB 1RXOB 4ZP9A 1HYSB 1RHKB 5M2RA 3B54A 4TXSA 4QWAA 1GX6A 4PAAA 2A2CA 3R5JB 1S6QB 2DH9A 3H59A 1AZSB 3H98A 2AEMA 5IOLA 2HHWA 1SBRA 3PW4A 2KHCA 3R5BA 4F4KA 2P6SA 2G0JA 1GFWB 3A1YG 3CW2C 1T9XA 3PHTA 4ZPBA 3S8SA 1NSKL 1S0OA 4ETZA 3JYTA 1YBUA 3M2RA 4I2PB 2CA9A 1TL3A 1VRTB 5HMXA 1RWXB 2EK1A 3ILLA 4KO0A 3R7NB 3UD4P 2KI2A 5IM0B 1RHRB 1CQMA 2Z57B 4JV2A 3CEDA 1FRHA 4CZCA 3NGRA 4KGMA 4WKRA 5D0EA 2MGZB 1NK6A 2MQLA 3GR0A 2AF6A 3ETOA 5CABA 5HVGA 3D54A 2ZDOA 4LFCF 2DGUA 5C2GA 3T9NA 3LW5C 4DV1J 2U2FA 3RB6A 2HNDA 2B4UA 2XI2A 1VK8A 3PFEA 3S7RA 2E1CA 2DVIA 4N77A 3OR2A 1IQZA 1BC6A 2FLOA 1IXKA 2VKZG 2ZVSA 3TAMB 2UUWA 3W2WA 4N56A 2ZM6F 4PWUA 4DV5F 1DZ5A 3DLHA 4ID5A 3AT1B 3RUBL 3NS5A 3CT9A 1WDDA 3EXYA 2BJEA 4WYLA 2B5JA 2YKNA 2XSFA 3E01A 4C0BA 4EGLA 4ZS6A 1T02A 3J7ZT 1SJFA 2WOMB 2LYVA 1KS2A 5DM7Q 1R31A 2F4FA 3NGSA 5H9EK 2EFPA 4XPCA 5F0WA 4ES1A 3VV2B 1DTTB 1FKOA 4KFBA 1SCJB 3S01A 2GQCA 4O3PA 1L3UA 3QRRA 5BXIA 4TVAB 1WOSA 3KLFA 4DR2F 1TKTA 2LXFA 1Q86T 1B0VA 2KFZA 3IS9B 4DR3F 1T8EA 1U0HB 2EG1A 2VG6B 3PNIA 2MY7A 1XQIA 1H3DA 3HZGA 1WSVA 3CF5Q 1B70B 4PCQA 5IS2A 3EVWA 4CH0S 4C8NA 2JEIA 1SV5B 4ANCA 1HWJA 1F3FA 3UD5A 5DG9A 1NJZA 1HW8A 4DL2A 2MQ8A 2RH3A 2FLPA 4OYAA 4X4QA 2ZHOA 3LGHA 3QBCA 1WC6A 1FKPA 3Q8SB 4EWTA 3CMES 2BANB 4DQPA 3R5CA 1ZTWA 1N33F 5J1NA 1DAXA 3DLBA 4OFZA 4MKYA 2LQBA 1U2CA 4DV7J 2IA6A 1VJWA 4IDKA 1I1GA 4EK2A 1K47A 4CLFA 1TK0A 3ENWA 2W4CA 3IAS9 4V1Ak 4H4KC 2FJBB 3SZ2A 4IOCQ 1U45A 4QWEA 3SCLE 5T7LB 1XWLA 3D6MB 1MMDA 3KHGA 3G4SS 4DFKA 3V4IB 1NK7A 1SKRA 3G71S 3SEOA 1U8SA 2IM0A 4A8XA 3C3LA 1K1QA 1FTRA 5KOWA 1K9MT 3F56A 1B99A 3M2UB 2R7VA 3MR7A 4PWDB 2Y1RI 4OX9J 2J9DE 3KFWX 3HLUA 3BBFA 3EZOA 1NKBA 2DNLA 3EYZA 4WXOA 4A8FA 5KG6A 3UW1A 2KM8B 4Q8EA 4KQZA 3C19A 1QVGR 1FI4A 1LWFB 2O67A 4TLQA 4TYBA 1SJ1A 3BO3A 5DGBA 2QLWA 3GYXB 2KJWA 5FIIA 2AD9A 3I5AA 1VCTA 2EVZA 1FVSA 3CDUA 4BWJA 3T1AA 1RWNB 3ET6B 4IH7A 4A8YA 1LW0A 3MMAA 3CDBA 3MTJA 4P74A 4HH0A 5FDLB 1WG5A 1FDNA 4Y28C 3IWNC 2CQCA 5J2NB 2ABYA 4QYRA 1HBNB 4FXVA 3BYPA 5I3UA 2RKIB 1T03B 1VBXA 2I5JA 1P9QC 3J81U 2QT7A 1O8BA 2MGZA 3Q8VA 3A3NB 4OJ1A 2GIQA 2GVZA 2WCXA 2RMLA 4DR4J 3M4XA 1ZM9A 4BDPA 3UD3P 1PSDA 4NI2A 3FSIA 4NMXA 2UVVA 2N3OA 1TVRA 1PKUA 2CNKB 3R5DA 2OMLA 3BGFA 4GO5X 2C22A 1FFWB 3KG0A 1SQFA 4A8QA 1KBRA 3JS9A 4DFJA 3GIRA 4J9KA 1RQ0A 3KK2B 1S1WB 3LO3A 1EZZB 1N5SA 2HYIB 3E01B 2HQCA 1SC1B 3TEHB 4DI6A 5HQMA 1HNIA 4RW8A 4TY8A 1SH3A 2CG8A 5KFTA 2R7RA 2CAJA 1HPZA 2Z2ZA 1LNQA 1K8AT 3NRBA 2CQIA 2PT0A 5HROA 2GC8A 4IQXA 3MI7X 3TNVA 1UEUA 1T05B 4OYWA 3MEEB 3ZTSA 5C42B 2XO7A 4X2BA 1LK5A 3PO4A 4L72B 2V8HA 4EI2A 4RBUA 4J9NA 4IUFA 1GH8A 1JLCA 2J76E 3M6WA 4NLXA 2XYPB 1VS3A 3KHLA 1N36J 2COLA 1OMSA 2CPIA 2G1HA 3K59A 1K73T 1Q8KA 3FBFA 2QA4S 2RUSA 1R6VA 1X31C 3I5BA 3LANA 4OYZA 2ZH1A 2NZCA 5HBMB 1XMQJ 3QJPA 3KMSA 1U1PA 4IKAA 2GV1A 5DDQC 1RYRA 1J5OA 4DBQA 3WX8A 1PJ5A 1RT4B 3K0JA 2ZZMA 5D4NA 1Y3KA 1VGYA 3QSIA 4HR2A 3MEGB 4IQMA 2AJ4A 3SMZA 1NNDA 4DX7A 2UU9J 3O44A 1K0TA 2BYCA 2YKOA 1RISA 4C8LA 2WVDA 4FNIA 4C0OC 2W24A 5T14A 2ILYA 3M2VB 3H40A 1R0CB 5A76A 2Y1JA 1N52B 5KFCA 2JOQA 2PMWA 3G6ES 1KHWA 3PY8A 3DLKA 1FXDA 2V69A 3CVKA 2VICA 1J5EF 3W9JA 2ALYB 2GHVC 3M2UA 4ZLLA 2A1BA 3OTOF 3P8BB 2QC3A 4Y2IA 3HSJA 2BJ9A 2E5HA 2JLFA 5KG2A 1VQYA 1JLBA 1L3KA 5B0CA 2B4PA 4CLZA 1UL3A 3GU0A 1XNRF 1UW4A 3N6NA 2CIMA 1VQ7S 3VR1A 1D1UA 2FZCB 4TLRA 1VOMA 4K5RA 2OPRA 5C24A 2YWWA 1EKRA 3FDSA 1F6TA 3HVTA 4F4XA 2NPFA 1GMUA 3G8QA 1SV5A 3HSDA 2BOAA 4RW4A 3K58A 5J2MB 1YQHA 2HGMA 3RAXA 3WIUA 2G13A 4GVBB 2PA3A 5KFBA 4MK8A 3OFFA 4ZA1A 1P27B 2HFSA 4F4AA 1LV5A 2DPJA 4ED1A 1NU4A 4KT0C 2WONA 5JVHQ 2HKEA 3CD7A 1BQXA 2I5JB 4HT7A 2UXDJ 4F67A 4G1IA 4ELTA 1JJ4A 4URQU 2FY8A 3W1YC 1UKUA 3GG0A 3ZZTA 3KUHA 4X62J 2BW7A 2DGQA 4OHWA 2EG2A 3LF0A 3VALA 1KTVA 1WKLA 4WE1B 3EZ5A 3HF5A 1L3TA 3D68A 3HHLB 5JVGQ 1N5YA 5LMNF 1TL7B 2R9LA 1ZM4A 3MD1A 4P52A 1YTYA 2PGCA 4QR0A 4K4WA 3W5ZA 3NNHA 3C66A 3EUNA 2QN6B 4HLBA 2OPPA 3LPEA 4AL6A 2BQUA 3EICA 1CJVB 2OELA 2R7OA 4HI1A 2SXLA 5H9FJ 5K8PA 3JQJA 3PRVA 5DG8A 1CJTB 4NCBA 3PKYA 4BC9A 4H4OA 4ED2A 1FO1A 4GC6A 2AW0A 1HNXJ 2W9BB 4W90B 4F50A 2WRMA 3I96A 4NLYA 2CQGA 1WF2A 5L9NA 1R43A 5KTQA 3V6JA 4LFCJ 1S0VA 2ZC3A 2HPUA 1A0OB 2ZWOA 4EFAC 4YR3A 1DLOB 1HR0F 3BGRB 4Q0BB 3MM8A 1UVIA 2DXEA 2P6TA 1F3VA 2CWKA 2Q6BA 3C15A 3K17A 4H4MA 1VQMS 1FTCA 1WG1A 3OL6A 4PR6A 1S9EB 4F4WA 5DDOC 2C2NA 2RKIA 1OS5A 1RT2B 3HI9A 5B0BA 5B09A 2IJRA 2IVYA 3R6LB 2KJVA 2RDDA 2VBYA 2CJ9A 2BVZA 4MT1A 5KFRA 2G1DA 1LWEA 3N9UC 2NSBA 5B08A 3BBBA 3DXSX 3KJNB 3LUYA 5D0GA 3ZZRA 2D3ZA 2MZTA 4EO6A 1WD6A 2DR7A 4IRKA 4PXCA 4MKBA 3A8JA 3K7RA 4M5HA 1BQMB 3OL7A 2MKHA 1HQUB 5IT9U 1S77D 1UFLA 2NYIA 1ITPA 1HBMB 1S1WA 2ROPA 1HBOA 3MFHA 2D9OA 2B8QA 3QT7A 3TA0A 3C6TB 5DZ6A 5GAGI 1RWKB 2LEAA 2KG1A 2LU1A 4FZVA 4B3SF 3UO0A 4UF4A 4C8MA 1MLAA 4LSNB 1MW7A 2V5HG 2W01A 4P7VA 1EETB 1C4AA 1I51B 2E1MC 4QZVB 1LFPA 3K5LA 4XAKA 5CAAA 2GIFA 3FFIA 4ER8A 2UVRA 2NLWA 5CCMA 3MHYA 4LF6J 2KFYA 5ETMA 5CA5A 2BOPA 2O66A 2ZH4A 1TAQA 1REVB 2ZE2B 2HS0A 2K7JA 1JK9B 3IRXA 1H38A 4K2JA 1S57A 3U1MA 3HVWA 1XR5A 2OKQA 3ILOA 4M5LA 4NLWA 2XMAA 1HNZJ 2JHEA 1VQKS 2HQIA 3AY0A 3NNCA 5IQQA 4GC7A 5JJBA 1ZBTA 1X5TA 3DYAB 2H5JB 2HGNA 3GB0A 3AOCA 2J9CA 3H5XA 2BDPA 3S6EA 3NOGA 2HVEA 2DEIA 1RTZA 4ZKAA 4RW9B 1NJYA 4MKAA 1WSRA 4Q43A 4UOGA 3RB0A 3D1HA 4DUYJ 1KVKA 3ZTOA 2VONA 1OJ4A 2RB7A 5GVQA 1M5PC 1S49A 3GLJA 1X4EA 3MCSA 4M5DB 4PG8A 5AXNA 2MMYA 2ZNZA 3AJ1A 3EGNA 4O3RA 2LFVA 2AJ2A 2PC6A 1LW2B 2EW9A 4RZRA 1VQ4S 2ZUAA 4X4OA 2Q43A 3AFGA 4ZHRA 4I64A 3UR3C 3OJSA 4K4UA 4F0KA 2B7BB 3RBDA 3RU0A 3QGIA 4USKA 4A8KA 1ZPWX 3GFXA 5E2QA 4OI2A 2CVEA 2DXFA 3WIVA 2W8KA 3CCJS 2DD8S 2NXNA 3VZHA 4TU9A 2XULA 1FXLA 6FDRA 1URNA 3BN7A 1YIJS 4EBDA 4OHYA 5E0OA 1TU0B 3DLGA 4KTQA 4K4TA 1ZETA 4L75A 4CO2A 2ZBRA 4YP3A 4WCEQ 1U02A 3GCWP 5D0HA 3BEGB 4RUAA 3DRSB 1NEEA 3IWXA 3EWGA 3HT0A 4YEAA 4YS2A 3T5JA 1FEHA 3R97A 4I2QA 1N56A 3KYLA 5CD4H 1H73A 5KFQA 1JB0C 2Z30B 3H5YA 3KG1A 1LKZA 1Q8IA 2HFUA 4DQIA 5HJXA 2ZOMA 3KLEB 2HS3A 5BR8J 1FESA 1S9EA 3BKFA 4I0WA 2WSFC 2OMOA 5ETQA 2LLZA 4ZMMA 5DQHA 4ECWA 3MR5A 2R8JA 5KT2A 1WG4A 2CQ4A 4NE9C 4LF1A 1RKIA 4TKTA 2Q6CA 5CCLA 5DQIA 4WF9Q 3TYTA 1QM9A 1NHKL 1B3TA 4UY8T 2G9OA 1CC8A 1CJKA 4K2XA 1NKCA 4W98A 4NRTA 4U7UK 1IKXB 4HHUA 5F3TA 2MQMA 4CRJA 2V8DA 1FWLA 5DG7A 2AHOB 4KPYA 1DURA 1X4FA 2IBKA 3DOLB 2MKKA 2VV5A 5BJRA 3SI8A 1S6PA 2VPWB 2MKIA 4B3TJ 3PKMA 4QJVA 1UA0A 1WEZA 4UOFA 1SJ4P 3MUTP 1X4DA 3BZQA 2VJVA 3CJ0A 2LEBA 2KYXA 1PCAA 5KG0A 4NLOA 4DZDA 1NZAA 3BSCA 3KDOA 3N01A 3V4MA 2MB0B 3J80Y 1SKSA 4DPUA 2KYZA 4X4VA 4DCOB 1UCNA 3A13A 2OPSA 1EP4B 3MM7B 3FFIB 4CLSA 1FE0A 5GAHU 4FYWB 1BQNA 1LWXA 2D3OR 2RF2B 3MECA 1T94A 1UEKA 4IO1A 1YZ6A 1REVA 2ZE2A 2A0FB 1IBMJ 3DGPA 1IKVA 1JLQA 3NCPA 2HBYB 2ZVIA 4DMZA 4RNNA 4QW9A 5E7OB 2J0QD 4LVNP 1RT2A 2LA4A 4ZIVA 1RT7A 1XNQF 1GTEA 2V6AA 1T03A 3BKUA 3MOJB 1D0EA 1APSA 2BUNA 1QSLA 2DNMA 2QLBB 4OJGA 3BN4A 2CFXA 3MAAB 4O44A 4USVA 2HNDB 2DRBA 4C8YA 3P4UB 5D4LA 3P6YC 1FVQA 5B0AA 1U6BA 4Q0BA 4IDKB 5GMDA 2HQ3A 3SV4A 1PBAA 2XNQA 2HHQA 2KXFA 2AP6A 4UUWA 3OR1A 1FJ7A 4PQUB 3SFGA 1RWUA 3IGVA 2O3DA 3PEHA 3QIPB 5LOQA 3MZIA 2HRUA 4KGKA 4OV1A 1T7PA 5IWAJ 3C6TA 3UN3A 1X9SA 2JVRA 4HEA9 3TANA 4WU2A 3IR5B 1Y7PA 2DGXA 2W2OP 2WW4A 2RQ4A 3EGZA 3DMJB 1NSPA 3B6BA 3TZXA 3QSYB 2V9WA 2FLLA 4UOCA 2CQ3A 2UXCF 2CPHA 2FJWA 2EKYA 2YNIB 4PKDB 2P9EA 3JB9k 4C8ZA 1R3NA 2J0XA 1FNOA 2DK2A 3JQMA 2Y1IA 2XLJA 2KVQE 5A6WA 3CUNA 1UVKA 2CJYB 3IG1A 3DDIA 3QYYA 2OD6A 4G1QA 1N6QB 2MLXA 2YPYA 3T1YF 4ECVA 5LMNJ 2ZC4A 4H54A 5FDLA 2WW8A 2WBRA 3OTCA 4LT6A 1GTHA 4CDIA 2KTQA 2BBEA 4EZ6A 3UVJB 3TVKA 3OTBA 1PC4A 2I2YA 3IN5A 4B3MF 3HFZB 2EC2A 1RHMB 1CG2A 3CJKA 4ED4A 4ZJQA 2D3O1 1TAUA 3R7SB 1D9FA 2QA1A 1U2RA 3TEGA 2XG8A 5D78A 2XY5A 2HHVA 3D28A 4M5NA 2RJZA 5KFWA 3US5A 4URGA 1PG5B 1JNZB 2E7VA 3MCOA 4M5KA 2PFDA 5KFHA 1MMNA 2PI5A 2EBEA 1XC9A 2C2ZB 3D3CJ 3THVA 1Y0HA 5KFJA 2HGLA 3AODA 4KKOA 4EZ9A 4DPXA 4NLTA 5DQGA 3AJDA 4QYZK 2AZ1A 3M9NB 3ILIA 5F8HA 2F9DA 3KUEA 2OEJA 4I56A 3BSOA 3PJWA 4ILRA 4QU6A 1LK7A 1YVFA 1NMEB 1F5BA 2V50A 3CJQA 4Y2AA 2F1FA 4USTA 1FRKA 1KFDA 1Y11A 2DRDA 3PM9A 2DITA 1YG0A 4X62F 3MXHP 2W25A 1FWKA 2OPSB 1U24A 3GTYX 4Q2LA 2VQFJ 3I87A 2APOA 2E7XA 2YNGA 4WPAA 2C2DA 1H2TZ 2BV3A 2KB2A 3DN9A 5DS7A 2CJKA 2KRBA 2J6UA 3K2YA 3PV8A 4YY3F 4JP8A 3PW7A 3KLEA 3BBCA 3JSYA 4USHA 2F8EX 1R8CA 1IJEB 5F9LA 2M4MA 5HBMA 3MUVP 5KFFA 2M0GB 2J6TA 3VGVA 2Z58B 4ZOSA 1C2PA 1N0UA 2NXEA 2XTJP 2VL1A 3WBZA 4CT9A 5KFOA 4B3RF 2CPZA 4O0IA 5E3PA 3OJUA 4N8OA 5LJ5Y 3MFIA 2OUGA 2NPIA 3CSKA 2VPXB 4JI8J 4A4JA 2HHHJ 4WBFA 5FLXU 1UTAA 3W62A 3QPIA 1TFWA 2BM1A 1HR0J 1YRTA 4RUCA 1KQKA 3I32A 1AT1B 4X4RA 1TMMA 1WHXA 5K5MA 1ROFA 3OVSA 2XC9A 1H7XA 2OAUA 4IH5A 2POKA 3V5RA 1FJEB 1HNIB 4RW8B 4TY8B 1Z1ZA 3Q8QB 5D3GB 4K59A 1CJUB 2QEXS 3ULHA 2BACA 3SBMA 1H74A 2DYAA 5EX0A 4EEYA 4ZN1A 4JI3J 2HNZB 3J81Y 5K14A 3EJMA 5FD1A 1U47A 2MJUA 2V63A 3MM7A 3ZZZA 4ZJOA 4ZVHA 4F8RA 5A6PA 4ZCIA 1AB8A 1WEYA 2RF2A 4C3KA 1QUVA 4DX6A 1IBMF 3DRRB 3M30B 4M5JA 4DUYF 3HVTB 1UAWA 1IN0A 1TKZB 3K57A 1V9OA 3VAMA 2MYFA 4HTJA 4OX8A 4RWWA 4HDHA 3CIMA 4C3MA 4JV1A 1O5JA 5L1IA 2GMJA 2FTRA 2ZBCA 6AT1B 2IHR1 2IRXA 5CXTA 4P2FA 3UWTA 2F8HA 3LWMA 4K4ZA 3EXCX 3FJ2A 1R0AB 2CNOB 1JXEA 3AOAA 4OYOA 3MEGA 2HHXA 4C9DA 4I6WA 4X4PA 1Y9OA 4MYTA 5J2PB 3JQKA 1JXVA 5KG1A 4AL5A 1K44A 5ETLA 1T9WA 1BXNA 2RT3A 2OLWA 4EUVA 2IC3B 3PRBA 2LP4A 3Q89A 2F7VA 4Q7AA 2JJ4D 1S1XB 2QE5A 1RA6A 4DZ6A 3BQ1A 4CO0A 1TKXA 2OO4A 2GS8A 3P5TL 4MIWA 4PG7A 3SQGB 4ELUA 4C4WA 4UZCA 1HARA 3NY0A 3WZ0A 2OPPB 4AFFA 1UJ6A 1YJRA 5JUMA 5I42B 1GXTA 4MIAA 1S59A 2XHCA 4ZVSB 2EWHA 3MEDB 1NH8A 2AYGA 4W92B 2WK4A 3FC9A 2Z2MA 2MQQA 4DSFA 5SUHA 1RCXB 5T41A 5LSLA 2E5LF 1N5VA 1WOOA 2E66A 1WORA 2HWTA 3I0RB 1IBKJ 4B9TA 3WC0A 1I94F 3IXQA 9ATCB 1NDKA 4NPOA 2C3OA 1RLDA 4E2FB 3A4TA 3HKWA 4GVBA 1U6FA 2B6AB 5D0RA 3WDOA 3GIMA 4O4GB 3BR9A 5DETA 2JZ5A 4QOTA 3PX6A 1MROA 8ATCB 1CLFA 2ZBPA 1FX2A 1TV6B 2AX0A 3HXMA 3PX0A 2A3JA 4DL3A 1PJ7A 3MTKA 1LQ9A 3PYGA 2VPZB 3V6DB 1N33J 1RTDA 2VH7A 1JLEB 2HHHF 1WHVA 5LSRA 3HHLD 1NK9A 3H4DA 4WE1A 2C2RA 5L46A 3UDCA 3BYRA 3HHLA 5HAOA 3TUZC 3DRXA 1VIXA 2E29A 4CTAA 4HKQA 4ZLNA 2E1AA 3W8GA 1S9FA 2ZDPA 4OHZA 3W2WB 4Y0FA 4DV2J 1Q0NA 2FJEB 2MLZA 2MXYA 2G2YA 3FCVA 4ID5B 2LCWA 4E8UA 3UDEA 3MR6A 5LMUJ 4A8SA 4AD6A 1NPKA 2KO1A 3CDWA 4KAIA 3BH7B 1CJVA 3E8OA 3HD1A 2IVFB 2AU0A 2H5IB 4GRSA 4IG0A 4DX8H 1QY7A 4P2XA 2RQKA 1G7CB 2FHOB 1E6VB 2ZJPQ 4J9PA 3NNAA 3EPIA 3OSPA 1M5KC 1AZSA 1V5IB 2A6MA 2HSEB 1QTNB 2EKNA 2W2MP 4MJKA 5EHHA 1QE1A 3GFHA 2VQFF 2XY6A 1NB7A 3C46A 2UUBF 1AROP 1L3VA 1AUDA 1L3SA 2NR0A 2XGQA 3G2XA 2VOOA 1R27B 2GA7A 3UNYA 2RUGA 5ITHA 2R8HA 3IM9A 1J5OB 2B7CB 2HHUA 5A8WB 2IRYA 4A8MP 4Y6IA 4H4MB 1KR4A 5EWFA 1X4HA 4JUZA 2I9SA 2MZJA 2AWZA 3VCDA 4DEZA 1N8RT 1CS4B 2RRAA 4RJVA 3I0SA 2VA3A 1B64A 5HQLA 1TUWA 3JSMB 4CP5A 1EJ7L 1A7GE 1SKUB 1S1VB 2FQQB 2CDRB 3DI6B 3ELHA 3MM9B 4QR2A 2ROEA 2QZ8A 4I4BA 4ED8A 2UXCJ 2IVMA 1AW0A 3RBZA 1WC3A 3SXLA 1VIOA 4L3KA 1JNRB 3L09A 1R89A 4ECZA 4MK7A 4ECUA 1S4FA 3EM1A 2RAQA 1HD0A 3AQOA 4QWDA 4DF8A 2F65A 3J81j 5L38A 3KNAA 3UI3A 3PO5A 1FE4A 2GVDB 5AE2A 3UDVA 2IC3A 3EZUA 2Q79A 2X7IA 1HHQA 4P2SA 4JV5F 2ERRA 1FK9A 1SUQA 2X3GA 1S12A 1P1LA 5D3GA 1T3OA 2CDQA 1RHQB 2VHGA 1X0FA 3GMGA 1DTTA 1FKOB 3DKDA 3L95X 2HLTA 2HQDA 4PXBA 4NA3A 4WKYA 2IYGA 1CULA 3GYNA 4QIGA 2E9RX 2ZBQA 2IBOA 3VAHA 1FJGJ 1HNWJ 3R2CJ 3WC2A 5E33A 2KXHA 4CM0A 3QNWB 3AQPA 1SJRA 2IM3A 3HDSA 4CWBA 1N36F 2QLXA 3QAUA 2MZSA 2JEFA 3M8RA 1RA7A 1MMLA 4ANEA 2B9XA 3JSRA 2L9NA 1XMQF 3TWZA 2G2ZA 3MDFA 2ZZNA 4DR6F 5CYMA 3HHDA 3RG6A 4B9LA 4M5GA 7FD1A 1S1TB 1D8YA 4OZNA 3TW0A 2UU9F 1Y4ZB 4G65A 4D3GA 2ZJRQ 4M5DA 1G6BA 1UVMA 1G4CA 4K50A 5E3AA 4CTAB 4CT8A 2Y9HA 1YBAA 3TOQA 3NXZA 3W61A 3CC2S 1S0NA 2XYHB 2BJDA 2I1RA 2QFJA 4GKKF 2RIJA 1HLWA 1RU2A 3KK2A 4FBUA 2E44A 4CCHA 2GCFA 3ENVA 1FWPA 4OI3A 4IFYB 2RILA 1HMVB 5MLCV 2RVJA 3FVYA 3MPDA 2IAJA 2ZKTA 3KWMA 3MF5A 4PWWA 3NLCA 3N0VA 4X66J 3A3PB 3H5UA 2B56A 4B3RJ 2W2QP 3KLIA 2DH8A 3PR5B 3HHEA 2CG4A 1NDPA 3H0PA 2ZOGA 5J2QB 1YJWS 3QT6A 2KZZA 3DDKA 1Q95G 4QU7A 1BQNB 2FZKB 4U8VA 4C6AA 2H1YA 4CO1A 2HEKA 4UT4A 1LW0B 3MMAB 2XM3A 4ZP7A 2UV8G 3RAQA 5H9EJ 2XS5A 2FVQA 4OYIA 1SH2A 4O4GA 1IKVB 1JLAA 4MTPA 4F4YA 3DOMA 5KT4A 3KG4A 5CYJA 5I3UB 2V4RA 1IR2A 1KQGB 2JWNA 2VIHA 2V2QA 1C0TB 3PACA 4ZDNA 3IWLA 4DQQA 4YDXA 1S1VA 3MM9A 2PMHA 3HMJG 4ERDA 2GVZB 2DHSA 2V2ZA 2XEXA 4LR8A 3BQ0A 3PYFA 2V67A 1SL0A 2VC0A 4DX5A 4ZLJA 1I6JA 4WJBA 5IT9Y 2MQOA 4M95A 3NG8A 4RBVA 3CD6S 4F3OA 2DGTA 4JI3F 3OHBA 5D77A 4X84A 1JXLA 2XQCA 4R5PB 2G0CA 2H4YB 1M5SA 1EX8A 1RTJA 3FRZA 3Q83A 1S6UA 1Q7LB 4NCAA 2ASDA 2GO9A 3J7Z5 1IQTA 1WELA 3QIPA 4QQBA 1K0VA 3O8WA 3VAJA 5AXKA 3NGDA 4IG0B 3PFOA 2MQPA 1IBCB 3LP1A 2HAFA 3CE8A 5IWAF 2UUTA 2W2PP 4ZP8A 1EHWA 5F3ZA 2HHSA 1RCOB 1ZH5A 3FEZA 4ZPVR 4A8WA 2X1BA 4LFBJ 3LGNA 1CULB 4ZVGA 2F5GA 3CJ8A 5DRKA 1BE4A 1PO6A 3MECB 3ENAA 2OPRB 1N5QA 4R0EA 2IMOA 5C24B 2N82B 2ZKUA 3N79A 4U95A 3MPWA 4USMA 4DLGA 3IRWP 1YBTA 4PUOA 2CUYA 1Q4RA 2ROGA 4OHVA 1KTQA 3TA2A 2F8MA 3D7SB 3MCMA 2D41A 4FBTA 4O44B 5HANA 2HHPA 5F8IA 2X51A 4DV6J 5K9FA 1U0SA 1ZTTA 4WZMA 1RK8A 2KKHA 1C1BB 2DBBA 2GIRA 2QL7B 3KTQA 3OLAA 1FRXA 1WJ9A 3NS6A 4DR1J 1IR0A 5C25B 2B3TB 3POTB 1IKYB 1SVDA 4DSKA 2MZ1A 3PG9A 1F9HA 2WHOA 1OY9A 1UZHA 3O1LA 1XR6A 2PEHA 5A0YB 4X4SA 2UUCJ 3R5GA 1RHJB 2E7WA 3LQVA 2XI3A 4WXWA 3QFHA 5HSPA 2J9DA 1OYEA 3LH2S 3N28A 2GGPB 2EK6A 2J6SA 1NDLA 3PYDA 3QFWA 3GP9A 4ZCMA 4V19J 3QZ8A 4NCGA 1ZPVA 2D3UA 1W2IA 2FVCA 2FHMA 3QO9A 3I31A 3L7OA 2HWHA 3R7BB 1NH7A 4LIRA 3J7YI 2D9PA 2NXJA 4I7FB 2YNGB 4E98A 3H4BA 4LSLA 4QIFA 1W26A 5LJ3Y 5KG7A 1VQPS 1VLOA 1NJIT 4KRWA 1HNZF 1GK8A 4ICLA 4XK8C 1W25A 3UVJA 2NQPA 3VVTA 3BO2A 5CYMB 5ETVA 5K20B 1KD1T 1JX4A 3BSNA 3CJKB 1QVFR 3X3UA 3HKZD 5EN1A 2BJ1A 1MN7A 1NAQA 2M2BA 1AXQA 1BD6A 1DTQA 1WHWA 1S97A 5KFZA 2VG5A 3D6FB 5IXUA 3G8SA 3KJFB 3FZ2A 3MPUB 5KFDA 3SIPB 2OD4A 1V6HA 3TAMA 4OJHA 2O5DA 3THTA 2V2VA 1BWVA 4DSEA 4TU8A 2PE8A 1KLMA 3Q8UA 4X64J 2XNRA 1DY3A 2VFRA 1XEZA 2J7UA 3CDEA 1F1BB 2WVFA 3Q2SC 4OZLA 4YUDA 1HYSA 4K5SA 3NMAA 1VC6A 4IFYA 4DFPA 4DR6J 2YPZA 5ETPA 2IY5B 1S6QA 1YJ7A 2W1BA 4YB6A 3I55S 4I6AA 2UXDF 4HH1A 1LOUA 4LF2A 4JBCA 1WF1A 3VF0B 3HD2A 1FDDA 1VR6A 3CD0A 5HO4A 4OL8A 5KFYA 3CCWA 3VGUA 1S79A 4LF5J 2QSFA 2YH0A 3ZC4A 1VDHA 3D0HE 3FQKA 3JYTB 3D0IE 4XDCA 5ETRA 1FXRA 3TO8A 3QAEA 1S99A 3B8HA 5IC4B 3W66A 1TKZA 2MDAA 3HULA 2XLIA 3FNNA 5DZ7A 2ASYA 4ZPAA 5DLFA 1SKWA 2KN4A 2YY3A 2V0NA 1GEHA 1H2VZ 2ZD1A 4NA1A 5E5NA 1WKKA 4K0KJ 2LXIA 4DCPB 2VODA 2IPOB 2V9KA 5EX3A 4IO9Q 4FNHA 5A2QY 3G82B 1X7VA 4RU2A 4WP9A 1UP1A 1WACA 3KNGA 4ZIWA 2PI4A 3K89A 3OTOJ 4RR5A 4JI1F 5CH7B 2RU9A 3R3TA 3K8WA 4BS2A 2I0XA 4A46A 1HNWF 1NUEA 1RSCA 1FJGF 4WFYA 5JXSA 4ECYA 2BXJA 1C1BA 4ILLA 1U48A 1EQMA 2HRTA 5KFUA 4FP9A 1HBMA 4J9OA 3KHHA 3NKYA 1S1UB 2B5JB 2YKNB 3EVOA 1AUSL 1RDRA 1S4EA 2M9KA 4FYVB 4ZVUB 5IC6B 2DR6A 4OZ3A 4L73A 1F2GA 2H5EA 3ICLA 3GJTB 4ATNA 3A12A 4MMOA 3T41A 3ZZUA 1Q78A 3V6KA 2NS1B 4F26A 1UJ5A 2CNNB 4DV7F 4EYHB 4LFBF 3NWRA 1P8GA 1S7IA 2DHGA 3DNCA 3DU5A 5ADZA 3G6YA 1CBKA 3BO4A 5FJ4A 5IZHA 2OEKA 3TJ9A 1HIYA 1IJFB 1HHSA 4KIAA 4KYZA 4NZ6A 3ZNJ1 1VBYA 3M8QB 2A2DA 2UXBF 5GAEU 4GKKJ 1YJTA 3PR4A 1D9AA 1YGYA 4KB7A 4U9RA 2FIUA 3GIIA 3TP2A 3DLJA 4N8NA 2KFNA 3D3BJ 4J9SA 4OX9F 1N5TA 4LJMA 3RZAA 3AD9C 2Y8YA 5K8NA 1QDUB 2AJ0A 2IA0A 2NXUA 2ALZA 2OPQB 4IR9A 2VU5A 2R3VA 2MKSA 1TKDA 2H3EB 2J8SA 1RE1B 2XZDB 1FRMA 3D6HB 2VJUA 2Y0SD 2CQHA 1W7WA 3CGIA 4M5IA 2FHJD 4Q5VA 4O0NA 4DR1F 2IDEA 1D8ZA 4NLRA 4X66F 1M90T 2KT5A 2JDJA 5J1PA 3UQSA 2QYCA 2R2SA 2HBQB 5CZXA 3G9CA 4NYZA 3BDPA 3SQGA 2P9CA 2RS8A 4Y2KA 3BKTA 2Y1LB 1VQNS 3OFEA 4KY3A 1KNZA 2LDYA 2YVSA 3Q24A 4YN3B 3SDEA 1HQEB 1N34J 4ECTA 2MKCA 1V5VA 4RL1A 3QWPA 1PGZA 2RHQB 2BE9B 2EI5A 1F2HA 2DGVA 2PEBA 2PSZA 3MMCA 1QUPA 3QQCD 3UN2A 2RQCA 1XN9A 4DV6F 1T05A 1HBUB 2X3DA 2VF3A 5A8RB 4DHVA 4CYUA 4DR3J 1JJHA 4DN0A 3R1LA 2XZWA 1RAJA 4F25A 1JKHA 3C16B 3GV8B 1QAJA 3ET6A 2GHWA 1RAFB 3M7VA 3M32A 3H25A 2JLEA 3ZTQA 3MR2A 1R0BG 3NAHA 3L7UA 2DGOA 3R1HA 1IKWB 3CJ4A 5L39A 1T9UA 1F0XA 2RRNA 2YX7A 1HNVB 4ITSA 2YNHA 1RKJA 1LXNA 4J9UE 4C48A 1Q8LA 1URRA 1TV6A 2B51A 1NZ8A 3EDQB 3KUGA 3ZNUA 4ED5A 3OVBA 3RRKA 2MHNA 5KOXA 4W4MA 1VQ9S 2Q1LA 4OLPA 4WU3A 1VRUA 3MAAA 3NEKA 3OTEA 4J9LA 2CPFA 2G4BA 4NI2B 3DU6A 2AT1B 5GAGU 3VTIA 4H4KA 1TUGB 1RT1A 3QGPA 1FKAF 1U6ZA 3G8TA 1QSSA 2QJ3A 1G1XA 1F5CA 3DDNA 3DOKB 3W8PA 1SC4B 1GT8A 4G6VB 4Z37A 2DNYA 2F3JA 3RRGA 3T6BA 3V81A 1BGXT 2YNFA 4DQSA 4IOAQ 3CIZA 4B3OB 3UE2A 4YDDB 4Y65A 2GJ2A 4DV0J 3GCXP 4OI4A 3KDNA 3MM5B 2JC1A 3ISZA 3UCGA 2XGPA 1I5OB 3DMJA 2C3MA 2U1AA 5AJ3J 1WC0A 2JEGA 3F44A 1LEOA 2WSEC 2YKMA 4WP3A 2AYEA 3TVZA 2CKWA 1J2VA 3TR5A 4ZCLA 3K5OA 1SB6A 1XIQA 3N5BA 3PRDA 4NXNF 2E5JA 2LQJA 3WQPA 3OL8A 4NXMF 2ZFHA 3UDLA 4PG4A 4XIUA 3AD7C 3VHQA 3QGGA 5A8KB 3CTRA 3I0SB 1TL4A 2HS4A 3CCRS 3SV3A 1S10A 2UUCF 4EYIB 1VI7A 3MPVA 4C97A 1QAXA 4FYDA 1DQAA 4M1KA 4BBYA 5HMWA 1UVJA 1RT4A 4KHPJ 2M7SA 4USUA 3U1NA 3M9MB 2OP5A 1S1TA 1X4BA 3NBPA 1X8DA 3H2LA 2HIYA 5KFGA 4ZK7M 4P7TA 1KKHA 2CQ2A 2GVDA 5HVFA 3TUJC 2W7OA 2P5VA 3BV8A 2BX6A 4RNOA 3AB2B 3Q22A 4LRBA 1YJVA 1NRKA 1ZAXA 2DISA 1UWBB 4OLOA 1TL7A 3BR8A 2IJNA 3DLKB 3IGNA 4QW8A 4C3LA 2ZM6J 4DV5J 1NJXA 1FK9B 1SUQB 1YWXA 4DG1A 1MSWD 2JFDA 3GZ7A 4ELVA 1LFWA 1C1CA 1IM4A 5F8MA 3VGSA 2HW3A 4O3NA 2YWKA 4J90A 1FT8A 3KKFA 3PYEA 5ETSA 3M8YA 3RYLA 4A48A
chains in the Genus database with same CATH topology
3DCAA 4KV8B 2DNKA 2QO3A 1MWYA 4TY9A 2W9BA 1NHUA 3HHNB 3L3CA 3CCMS 5A8RA 3DRPA 2ATLA 4FPRA 4N41A 4G1QB 2FC9A 4LFAF 4KE5A 3PIPQ 3M32B 1FF2A 5I3QA 2Q3PA 2XSJB 4B17A 5DGAA 2Z2LA 3MGJA 2FHKA 2R2TA 4LF5F 1UMJA 4CO4A 2HWIA 2W4DA 2W7AA 3JTNA 1VQSA 4BHQA 1R6YA 2B43A 2DNGA 1KQFB 2J0SD 3DXBA 5EWGA 2LVWA 1G2EA 4B9SA 4Q2MA 3D1OA 2N7CA 1LXJA 1Q82T 3MPYA 4ECSA 1C4CA 1U7LA 1WTBA 2LEPA 2AQ4A 5D8HB 2CPDA 4LF4F 1Y3JA 2X1GA 2XY7A 1KC8T 4U67Q 3VAGA 3T6JA 2M88A 2YWEA 4R8UA 2VOPA 3OHAA 4RBTA 4ZLPA 2M3DA 4Y3CA 1WF0A 5C5JA 3VZIA 3KLIB 4DV1F 2RQMA 4OMFG 5M2PA 2VB6A 3CPWR 2M8DB 3P49B 1KVIA 4DL0C 3GIKA 3CULA 3CJ2A 4DL5A 4IFVA 4IH6A 4HVZA 4N76A 1Q1KA 1M0SA 3CCTA 4CIOA 1JLAB 2DNPA 2XMJA 3PEJA 2EC0A 2UVUA 3BGUA 4NOHA 1L5UA 4WZQA 5L8RC 4TNOA 2L3MA 3TQ1A 4ZVFA 3M8SA 1OPIA 2FJXA 3KOAA 1S76D 3I5CA 3B78A 1U1KA 4LIWA 3I56S 2J8AA 3HHKA 1X5PA 1KFSA 1T95A 4X65F 2DCUB 3NWGA 5L9XA 2HMIA 2XS2A 3THPA 1SL2A 1X9WA 3FSYA 2HNYB 3HT3A 2RE1A 1UWBA 1DQ8A 5T7LA 3POTA 5D4OA 5LXYA 5EUHA 5SZTA 1QSYA 3JAMY 1GAOA 2DCLA 2WB4A 5G4DA 3NL0A 1RTIA 4YQWA 3G86A 1MNEA 4LSNA 2YKQA 1NO8A 2BABA 4JI0F 4PRFA 4TQSA 2Z8QA 2GQ2A 3FRYA 1YRUA 4J9RA 3P96A 2AGOA 3DRRA 3M30A 2HG4A 3MMBB 3KLHA 4FS1A 3MMJA 3DHXA 5D4PA 1XMBA 4LSLB 1JJ2R 3M6UA 4JOUA 2VASA 3C6UB 5BYSA 2XHWA 2XSJA 1AFJA 3IBWA 3ITHB 5J2NA 4NLVA 2ZH5A 2WSCC 4RNFA 2VBZA 2CYYA 2R8GA 1DFDA 2J5AA 5KG4A 2WTFA 1RTDB 2D7SA 1VC5A 3HVRA 2WBMA 3LALA 4IYQA 3OPKA 5F8NA 4RUHA 1TVRB 1R8PA 2VFSA 1UEVA 4AYBD 4FF1A 2CZVC 5HQ8A 2OSRA 1S6PB 2N4CA 2B4OA 2UV8A 3CCQS 3OXFA 1X5OA 3GR1A 2ASJA 4NA2A 3HO1A 3W2VB 3CD5A 3CO9A 4NLGA 3E2EA 2DGWA 1LWCB 2DR9A 2OFGX 4M8LA 5L1JA 1YJNS 3MEEA 5C42A 2GFFA 3QO9B 4Q8FA 3FGVA 1NK4A 4QCLA 1EP4A 2N7YA 2V8VA 2FVRA 3U7JA 4FXWA 3HJFA 4Y34A 4DS4A 5I3PA 3AA8A 4LF9F 2KH9A 2IMWP 2XCAA 3LWLA 5IT0A 2DPIA 3BQ2A 4L6V3 3DLBA 1QLNA 1P1TA 1HI0P 1OSCA 1VQ5S 3CC7S 5E41A 3V6DA 1TK8A 3UCZP 3OV7A 1APSA 1RI7A 1YRXA 1WWHA 2XMKA 2CJQA 3QWUA 2VG5B 1Q79A 3MR5A 1HI1A 5E3RA 2PD1A 3DC2A 2HHQA 1U2FA 1IKXA 3B82A 2K7KA 2HMIB 3SCIE 3LOUA 1CSJA 3B4DA 2F9JA 4HHJA 3DLLQ 2IM2A 1CPZA 3M2VA 3D0GE 1S1UA 2JLGA 2CPEA 2GO8A 1RT3A 1GXUA 1PILA 2GNKA 5KT6A 5GAHI 1HPZB 1X0PA 3M8PB 2J7KA 2VG7A 4LF6F 4CH7A 2QA2A 4HYKA 3PZPA 4J5OA 1HI8A 2KT2A 3G6VA 1XTZA 1U1OA 4ZVEA 2ZNYA 1JLCB 2ZH3A 3KLGB 3OFGA 4K4YA 3QLHA 5A8WA 4DS5A 2LU2A 4KJIA 4DN9A 1WNEA 3IG1B 4AL7A 3P3DA 1RGVA 4PG5A 1SC6A 3C6UA 1RT7B 4KR0B 2DNRA 1M5VC 5DDRC 4Y00A 3KK3B 2HFNA 2Z0GA 4PPDA 2DJWA 2DNOA 5HI7A 4YB5A 4DV0F 4KHMA 3OSNA 2VQEF 3SSQA 1J5OB 2GMHA 5KFPA 2EPIA 4M94A 4TU7A 3CCLS 3FZBA 2IM1A 5KFIA 3RBEA 2FB0A 7FDRA 2BR0A 1Q81T 2MQNA 3OR1B 3HP6A 4JI4F 1YITS 3K8VA 3ONQA 3MAQA 3PX4A 1N5YB 1RJJA 2FVPA 4DSIA 1X9MA 4MFBA 4QWBA 1KVJA 2C3UA 1V3SA 1N48A 3QJJA 4OX7A 1G3OA 2W9CB 2JH3A 1WHYA 3JSBA 3F41A 4I68A 5LSOA 3GV5B 3CB4A 3FSXA 4CNZA 3W2VA 1U1NA 1XK8A 3SDEB 1HQEA 3I4PA 4HT5A 4A47A 2KXNB 4I1TA 3IR6B 1GQEA 3W3SA 3CC4S 2IAJB 1N34F 3BM7A 1XBWA 1DQ9A 1HBUA 2BE2A 2ZH9A 2CPYA 5F8JA 1N6QA 3BGRA 4GMKA 4USJC 2CQDA 1QJHA 4MK9A 5LL6d 3ZZ0A 2KU7A 2YKAA 4YHHF 4G3IA 1Y5LB 3BB5A 4YB1P 1FJCA 3T5HA 4QIVA 4DV2F 2OFHX 1S48A 2YNHB 5DM6Q 4WFAQ 1C0TA 2VUGA 3PW2A 5L1LA 3AA9A 2BQRA 2LXUA 5GAEI 3GWCA 3AHPA 4MYUA 4RW6A 1LWEB 4K4VA 2D74B 2DO0A 1TR0A 3MUMP 5K8MA 2PFFB 1Y00A 3N4WA 2GJIA 3FEYB 3VAFA 1KOHA 2VBXA 1ZZFA 3TRGA 1RT1B 2L08A 5CQGA 2HVHA 4FF3A 4KKOB 4B9VA 3JTOA 3V2UC 1HQUA 4UQGA 1NK0A 3EGWB 4O4RA 2CQ1A 3K5MA 3O2IA 5EWEA 2LQ9A 4NYPA 3IR7B 2RDIA 1RT3B 3R5AA 4OZ5A 3OUYB 4KHRA 3UFCX 3LP1B 2ZBIA 3M8PA 5HL7Q 4FVCA 2VG7B 4KFBB 2BM0A 2A10A 2FJAB 5J2QA 3C8YA 1DLOA 3KLFB 4OIXA 1N32F 4KBIA 1JKHB 2K3KA 2KDOA 3IS9A 5HLFA 4R0JA 5LMUF 1TL3B 1VRTA 1UJ4A 5KFVA 4A8OA 5KFXA 5IM0A 4IRCA 1IKWA 2CPJA 3TVYA 2RSQA 2VD3A 4OZ0A 2IYIA 3GILA 2V4QA 4OHXA 2F40A 4YR0A 1T3NA 2ZITA 2ZOFA 4DV4F 4DOZA 3R27A 5KFEA 1ELOA 3BDEA 2V2KA 4WFNQ 3SCJE 2KZMA 2PO4A 4ED3A 2QIFA 3CWJA 2FC8A 3GG1A 3VAIA 1WI6A 1X4AA 4D3HA 4PQAA 2GX8A 5U47A 1RT6B 1WEXA 3BREA 3BGLA 1GNKA 5EGYA 4HTIA 1DJ0A 1JMTA 3AH6A 4C0HA 5C25A 3VQSA 3BS9A 3LGMA 1ZZNA 3N6MA 4MFBB 2MSSA 1B0TA 4C11B 4ZHRB 5MAOA 4X64F 3H5SA 3BSAA 4WFZA 4X4TA 1CQNA 3MM5A 5BYQA 4EO8A 1U1RA 2AGQA 5I4MA 1OPZA 3Q23A 3U27A 1C0UB 2VC1A 1SJ3P 1OWXA 2FGOA 1PC5A 2VFVA 1TL1A 4QPXA 1JLFA 4AQYF 1KSPA 1VQ6S 5DJBA 2HVIA 1TK5A 2XBPA 4B9MA 2H9ZA 2YQ3A 3I0RA 2BW2A 3N5FA 3DLEA 3DRSA 3OVAA 3H8YA 3IRXB 2HVZA 2QMWA 3BF4A 4EBEA 2C2EA 4C8OA 1Z2ZA 2JC0A 3LP2B 4NLQA 2D1CA 1U1MA 1ZM2A 1VC0A 3PW5A 2YWHA 2R8KA 4YB7A 3AAWB 4ICLB 2F4VF 3ZFVA 3UPFA 5HN0A 5AXLA 4USIA 3PJXA 4AUKA 4RW9A 5BYRA 1WTFA 1H0HB 2FD2A 4JI8F 4XPEA 3PIOQ 4DV3F 1FCAA 3B4MA 1D3WA 4NLPA 2DNQA 4ETXA 5LT5A 5F8LA 4Q45A 2L9DA 3RRHA 4QIWD 4Q44A 2RNEA 4RW7A 3G96A 2JSXA 1C1CB 1SIWB 2WAQD 3L7PA 3U1LA 2FPHX 1B0PA 3WX4A 3IC1A 3HFKA 4X4UA 2GGPA 3CCVS 4NLSA 1TFYA 3MEKA 1YHQS 1YI2S 4BC7A 4NCGB 4LF8F 2BE2B 2ZH8A 3NGKA 2W4PA 4C98A 1YSJA 2MHEA 4CQ1A 3ISND 3PHEA 4ZPWR 2DR8A 5CYQA 1H7WA 4PXEA 2PIIA 3ZZYA 4Y2MA 1Q16B 4B02A 2RU3A 3LPYA 2ASLA 2PA8D 4JI5F 4UY8T 1JLQB 2KG0A 4BWMA 4DUZF 4B3TF 5GADI 3T5LA 3KHRA 4R25A 1FDBA 1TZ0A 6FD1A 4LMZA 4O3QA 2KM8C 3DI6A 1NJWA 2HLUA 4GO7X 4HL9A 4AXIA 3DHWC 3KMQA 1VQLS 4G1PA 4DL7A 2LMIA 4N47A 1N4LA 3GFYA 2CJAA 4NZ0A 2XLKA 2DTJA 3A8EA 3UR0A 3I4HX 2JX2A 1HFEL 2QSWA 3DOLA 3OXGA 1SL1A 2HNYA 3TA1A 1MU2A 1XR7A 4QPTA 3PVXA 3NCRA 1FD2A 3FQLA 1E6VA 4QWCA 4K0KF 1ULRA 2NUHA 2PDAA 2KVIA 1D9DA 1QE1B 5HMZA 4CNYA 1RT5B 2FJDB 2YNIA 3KK1B 1JLFB 4ES2A 5GADU 1H98A 2IJFA 3MURP 3AJ2A 3MMBA 4DR7F 4C2MA 3GIMA 3I9V9 2K8GA 2M8HA 1VLYA 3Q8PB 4ILLA 2JFKA 1ZOTA 3D2WA 2BQ3A 2BZ2A 2ADCA 3HVAA 5GMKa 3T5KA 4NRUA 3MWBA 4IG3A 3RB4A 2ADBA 1X4CA 2HFZA 4NLDA 5KT5A 1U09A 5H1SV 5KG3A 1UVLA 1QTMA 1IUJA 1HD1A 1UVNA 4OI0A 2DO4A 5B0FA 4ED6A 1BLUA 3M05A 1RT6A 3FCHA 4PQUA 1DARA 2XWYA 2R7SA 3GSDA 3UNGC 2HZCA 3VQTA 1KOOA 4RW7B 3TAQA 4C11A 1FNXH 4N5SA 2FHJA 1RTHA 2RDJA 2DIVA 3H2VE 2QMXA 2EFQA 3HX9A 2BRLA 4ZCKA 4K4SA 5IFMA 2NSCA 3LP0A 3KJVA 1VHFA 1Q7YT 4DSLA 3MM6A 3Q8RB 1HMVA 4H4OB 1TL1B 4F02A 1VK3A 2E5IA 2V4JA 4ECRA 3D5MA 3I6PA 3HZEA 1F60B 1KHVA 2OJ3A 3DLEB 4F3MA 2BA9A 4F2SA 5CYQB 4LUBA 4FN5A 2R2RA 3M2RB 2L48A 2OTLS 1KLNA 2W9AA 4KO0B 1S0MA 3IA0A 4NYOA 3CJ5A 1OQ3A 1Z4UA 2OPQA 2WONB 3HM9A 1HNXF 1AFIA 4NX9A 5K8OA 5KFMA 2XMMA 2C3PA 4KHPF 5B0DA 2CVIA 1QAIA 2J9EA 2VFUA 2V94A 2I8EA 2CJBA 3J7YU 1XERA 4R5PA 2E9TA 2VBWA 4IR1A 3CCUS 2K2PA 1BQMA 4RNMA 1NK8A 4JV0A 5F9NA 3IFEA 1VQ8S 2MY8A 2HIQA 4WK1A 1MU2B 1JIHA 1S6OA 2RS2A 3VAKA 3M9OB 3AB4B 1HWKA 4Z2XA 1LWCA 5AJ3F 4B9NA 2YH1A 2K1RA 1VMBA 2CPXA 4DJBA 4TQRA 1U4BA 4K4XA 2YKMB 3OTDA 3MM8B 4DSJA 1TKTB 1CC7A 4WYWA 2E5GA 2MPUA 3KLGA 2ZUGA 3T1HF 3SSSA 4OI6A 2W7PA 2MJNA 4KC5A 3N6LA 4UUXA 4LQ9A 2R7QA 3SSRA 3QGHA 3FMWA 3G6XA 2HHTA 1A6LA 2OSQA 2PN6A 4I6YA 4DDFA 1VRUB 2ZHBA 4RKUC 4JI6F 1R0AA 4ZPDA 2E1RA 3OR2B 2ZH6A 1IBLF 1KN6A 2M70A 4J9MA 1R8BA 3JTPA 2L9WA 2FJVA 2VPYB 4WIIA 3CXCR 2UP1A 1KEKA 3E3XA 4UQTA 5HMYA 1WI8A 4C8KA 3HK2A 1LW2A 4OJ3A 4B3OA 3LAMA 1IKYA 1KONA 2WOMA 4OQJA 2X1AA 3K5NA 5A0YA 1UETA 3HHLC 4P6QA 2LDIA 4DF4A 3SFUA 3GE9A 3H20A 2UUAF 1UVMA 3LP0B 3KJVB 1H6KX 1EETA 5I42A 3MM6B 1RT5A 2NUUG 3KK1A 3CMAS 2IRUA 4DWIA 1R7IA 3C2PA 4CI0B 2O01C 2B9YA 5B7WA 3Q0AA 2YX4A 2P9GA 3T19A 2R2UA 1GX5A 3H2UB 5AE1A 2O1PA 3GQCA 3SI8A 1FEEA 1F5AA 2RRBA 1TL5A 3DYAA 2ILZA 5DO2A 4AE5A 4YMEA 1FKPB 4NWBA 4NZ7A 4ZPTR 2EFVA 2AX1A 1HBNA 4PXDA 2BANA 2GHPA 2YTCA 1Y5IB 3CJ3A 3O6QA 2DNHA 4U6PA 1FRJA 2EFOA 2GW8A 2QV6A 4ID8A 2FY1A 1DTQB 1TQLA 2HRYA 3K5PA 3PXGa 5KG5A 2XMWA 4I67A 5J1EA 2JEJA 3GFZA 1CVJA 3V4IA 4DG1B 4X4NA 3NCQA 4TYAA 3TARA 5IT4A 2FVSA 3IO1A 4QBUA 4FXDA 3NAIA 4DR5F 1NHVA 2YWGA 3MEDA 5DDPC 1X4GA 4KV8A 5HROB 3M1VB 5AE3A 4HI2A 4J9QA 2AJFE 2DT9A 2BRKA 4RU9A 2B0GA 4AXJA 2AJQA 4O23A 4I7FA 4I2QB 2R7WA 2ZHAA 4DFMA 4F4ZA 1JLGB 5HP1B 3RR7A 2DHAA 3SCKE 2X1FA 1R8AA 2EBGA 4UY85 2ZJQQ 3QJLA 4RNHA 3RAMA 2ZD1B 3GIJA 4OX6A 1DBDA 2R4FA 3I9ZA 4QYZJ 2XS7A 1JLEA 4ED7A 4DQRA 4DL4A 1YJUA 3TI0A 3RW7A 4B9UA 5CHCB 4RX6A 4WFBQ 4XDDA 4JI2F 5E3QA 2XCPA 1ZAWA 1O51A 5KT3A 4F2RA 2K3IA 1E6YB 2YX1A 2AV5A 1BWEA 3IAM9 3OW2R 2HAIA 2C42A 4MIBA 1HWLA 5F0UA 3OUYA 5B0GA 2DH7A 3LAKA 2I38A 3ZZPA 3V6HA 4OI1A 1V3ZA 1HHTP 1RTIB 1VQOS 2YWFA 2K1RB 5F8GA 4U7CA 3QMQA 4ES3A 3E51A 1OIAA 4ILMA 4CH1A 2AYMA 4IRDA 1M5OC 1N0VC 5HLFB 2VFTA 2VA2A 3DM2A 3M6XA 4IFVB 2MZQA 4CO5A 3M8QA 3RTVA 3MAHA 1UA1A 3TUIC 3LP2A 5J2MA 5DLGA 1RYSA 2E9ZA 3CDAA 3JSMA 1TP7A 1ZYQA 1SI9A 2FUG9 2KHDA 3I82A 1M5HA 3OBIA