4RBTA

Pdua k26a s40l mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGLGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization protein PduA
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Structural protein
total genus 22
structure length 89
sequence length 89
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbtA00
2G13A 3H8YA 3NWGA 4OLOA 2A1BA 3NGKA 3SSSA 4DDFA 3PACA 3MPWA 4OX8A 3SSRA 4P7VA 3VCDA 5L38A 3N79A 3SSQA 4P2SA 3BN4A 4RBVA 3CGIA 4RBUA 2A18A 4AXIA 4LIWA 2EWHA 3DN9A 4QIEA 4RBTA 4AXJA 3MPYA 4QIFA 5DJBA 2A10A 4OX6A 4PPDA 4QIVA 4P7TA 3IA0A 4QIGA 3CIMA 3DNCA 4OX7A 3I96A 4OLPA 3I6PA
chains in the Genus database with same CATH superfamily
4ED5A 2I2YA 3LP2A 4YB1P 2HHVA 1V6HA 1NSAA 2VONA 1E6VB 2ASYA 2CPEA 4DL2A 2CIMA 4KSEB 3U7JA 3T41A 3M8WA 3QT6A 4R25A 2CNOB 4GVBA 1ZA2B 3RAXA 2JX2A 4F3QA 2GO8A 2IJFA 2OFGX 3BN7A 2BR0A 4OX7A 3V6JA 2BQ3A 4OX9F 5HL7Q 1RWMB 2N3LA 3SDEA 3ETMA 2GW8A 1SJQA 2DHAA 3HHLD 3N0VA 4L75A 3CULA 2DBBA 3PTWA 4JP8A 3P8BB 1EB0A 4DV7F 4C9DA 4RNFA 4GO5X 4YUDA 3SV4A 4DOZA 1HHTP 1N4LA 2ZHOA 1IKVB 2VPYB 2R7QA 1FE4A 3CCES 5KFQA 5CA5A 5IWAF 2DNPA 2FC8A 4DV2F 3QSIA 3C19A 4OI4A 1XMQF 4PYAA 2RVJA 4B02A 2Y9HA 5CZXA 2MY8A 2HIYA 4B9UA 2VA3A 4ZVGA 3GV8B 1FD2A 1JNRB 2CQ4A 2RHQB 1NZ8A 4B3OB 5B0DA 3RGIA 2VOOA 1Q78A 3AFGA 4LREA 4BDPA 5E3AA 4J9KA 3WHIA 1Q79A 3A12A 4JI6F 5LT5A 3EXYA 4I2PA 4DZDA 1KWMA 2EWHA 2LXUA 2ZKUA 4B3MJ 3FZBA 1JLFA 4C6AA 1KP6A 5HP1A 4C11A 4OLOA 4FF4A 4DSKA 5AXKA 4K4UA 4KJIA 1RT7A 5ETKA 2GGPB 3LH2S 2RF2A 6FD1A 3M8YA 3MM7B 5B0FA 2YX7A 3CCQS 3M32A 4J9NA 4CT8A 3DMJB 2ZH9A 3BO2A 4Y2MA 4CP5A 3HPOA 1JLEB 3LW5C 3T5HA 2HNZA 3DGVA 1F9EB 1NJWA 1RHQB 3TVYA 2RIJA 3MOZA 4AYBD 1HBOA 4NI2A 2HLTA 2WSEC 3OV7A 1RKJA 2G0JA 5LJ5Y 5F8NA 2HS3A 4O3OA 3GFHA 1T95A 3C66A 2MQMA 2GJ2A 2G2OA 5L1KA 2ZWPA 4I2QB 3H4BA 4HI2A 2WHOA 1S7HA 4KKOA 4DU8A 3KJVA 4X66J 2JEFA 4DR3F 3TJAA 1Y4ZB 2HMIA 4ZPTR 3GILA 2KI2A 4LSNB 4OYMA 3MM5B 8ATCB 2YNGB 4ENOA 5E33A 2CQ3A 1VHFA 2YBVA 3M6UA 2KYXA 2XYGB 2R7OA 2CQ1A 2NXEA 2MB0B 2IM2A 4DUYF 2RU3A 2YX4A 4BC9A 2FLOA 4EU0A 3R7NB 2MJNA 2BW7A 3QIDA 1QVFR 5BXIA 3CMES 2RQ4A 5B08A 2CJ9A 1NJYA 1DLOB 3RB4A 2HYIB 2ZD1A 2KZMA 4OZLA 1S0VA 1S1UA 4U7UD 3UDVA 2GO9A 2IM0A 3GQCA 2JC1A 2H5IB 2BVZA 3UW1A 4DEZA 2VUGA 2EXUA 1P6TA 4NWBA 4EYIB 5KT6A 2ZHBA 3BQ1A 3BDEA 3D0GE 2FJBB 3J7YU 4JB8B 4ZP8A 3W3SA 3O5TB 2ZH8A 1RT6A 4Y2CA 2A2DA 1S10A 1QDUB 1S1TB 3OLAA 2D3OR 1GMWD 2V2ZA 4OYXA 2JFDA 4MK8A 1HL6A 3UCZP 4O3QA 1CJTB 4HT5A 1ZZFA 4FYVB 1UVJA 1K47A 2HVIA 1YJNS 3OJSA 1S76D 1P27B 4U7UK 2HEKA 3PJWA 2YKNB 4NLQA 2EC0A 3G6ES 1GK8A 1KVKA 4PWDA 1JXLA 1B99A 3CDUA 3CJKA 2OAUA 4OQJA 1H38A 2OIHA 4CCHA 3LGNA 3M30B 2OGUA 1TUVA 4PG5A 2BQUA 2P9CA 2E1RA 3CJ2A 1BWVA 1LWFB 5KFTA 5IT9Y 3D66A 2HSEB 2DNLA 1RT4A 3KDOA 4X4VA 4F50A 5AE1A 2W2PP 3JAMU 5I3UA 2JFKA 3DKDA 4JBCA 4PCQA 2ZC4A 1RTDA 5T41A 3TUZC 1O8BA 5IC4B 4I7FA 1WKLA 3ILOA 4S0MA 1N5SA 4NCGA 4Y3CA 5C5JA 1H7XA 4Y2IA 2AF6A 1S97A 3GSDA 3V5RA 4DV6J 3GP9A 4UUWA 4HDGA 1TKZA 1S6QA 4V19J 1KTVA 1LW0B 4ILRA 3N6LA 2YNHA 1NB2A 1JLAA 5HVGA 3L7PA 2W2OP 4O3NA 3BZQA 3QGGA 2HBYB 4OYWA 4L74A 2BJEA 5HVHA 3H90A 5KFOA 4DV4F 3EPIA 3U02A 2VC1A 4XPCA 4DV0J 3ZTSA 2E44A 3N9UC 3NS6A 1N48A 4WCEQ 1KEKA 1IWGA 1WSRA 1H0HB 1KQKA 1H74A 5C24A 1JLCA 1RK8A 5EHHA 4B9SA 1R43A 4UQTA 2ZEJA 2QL5B 1VLOA 1I6JA 1NAQA 3K7RA 1Q0NA 1B0VA 3KLGA 2D3O1 2ROGA 2YNIA 4AD6A 4PAAA 3F41A 4PXCA 4ZITA 2NXCA 2OI2A 3FFIB 4NRTA 1Y10A 3PO5A 5L9NA 4DWIA 5F8HA 4IOCQ 3QRRA 3DRXA 4MYTA 4L72B 1S1XA 1R89A 4WPAA 3PHEA 4MT1A 2IPOB 4F26A 1RU2A 1VQLS 2XWYA 1WF2A 1F3FA 3BR8A 3S8SA 4NLGA 1HQEA 1PCAA 4Z37A 4GKKF 3PX0A 4PZVA 2OPPB 2C42A 1FJ7A 2FGOA 4AL7A 2QG9B 2XMKA 1FK9B 3T6BA 1P1TA 2B6AA 1K9MT 4CNZA 4TU7A 2UVRA 4M5JA 1M5KC 2ERRA 4L76A 4NYZA 4M5KA 2C28A 1C0UB 3T5JA 4USKA 3BQ2A 4YY3F 2VZ9A 2CWXA 2AIRB 3M8PA 2B4OA 1I1GA 2F65A 4Q44A 1SH3A 3N5FA 1UFKA 2VG5B 3MEDA 3NY0A 3PDNA 1TKTB 4FS1A 3VAMA 2UVWA 1RJJA 2ZZNA 4UW2A 3NBPA 2CZVC 3IMQJ 1UVIA 4ELUA 5LL6d 1YLXA 3TNVA 1HWJA 4JOUA 1JNZB 1YX2A 5KG7A 2VODA 1UJ5A 4WE1B 1N32J 1VC0A 1IR2A 4JI5J 4OHZA 4LJMA 4NEZA 2UVVA 3HM9A 2HAFA 1U1MA 4I68A 1FCAA 3QGHA 2DNZA 4CM2A 4DSLA 4PQUA 2PEBA 4NLUA 4UY8T 2AJ2A 1SQEA 2G1DA 2RMLA 3J7AN 3ZZUA 4WFBQ 1S0NA 1KQGB 2VU5A 2R7SA 4DR4F 1F60B 1IQZA 3SZ2A 3E01A 3Q2SC 1CS4B 2R2RA 2WVCA 2DNRA 2LEPA 4KGZB 2UUAJ 1ZAVA 3MTKA 1U25A 2VG6A 4MIWA 1N6QA 4QR1A 5D15A 2UUWA 2MKJA 4R5PA 3RAQA 3CJ5A 2Y1RI 2QMWA 1U6ZA 1WC0A 4W98A 3EGZA 2GHPA 4AQYF 3R3TA 4N47A 5HLFA 3OVBA 1Y5NB 2IM3A 1V5VA 2OMLA 5J1NA 3CO0P 5KOXA 1URNA 3HZGA 4YFUA 3ZFVA 4FVCA 3ZZ0A 4F0MA 1VBKA 2A2CA 2K1RA 1MMDA 1WOOA 2OSRA 2UV8A 3PHTA 2HHXA 2FJEB 3M9OB 1QSLA 1MW7A 3MM9B 2C2EA 3KOAA 2XWXA 3MOJB 1UWBA 1RAAB 4CYUB 2QA2A 4AT1B 2IDLA 2KXHA 1R27B 4C2MA 4PUOB 3PEHA 3I4HX 4B3MF 1SPBP 3KK1B 3MR3A 1KR4A 4F4WA 4EUVA 2W2MP 4USIA 3VQSA 5DETA 3QT5A 3VGTA 3I6PA 4DN9A 3R27A 2VQFJ 1CJKB 2W7AA 2H65B 3I32A 4IFYB 1H73A 3RBEA 2AYMA 1XMOJ 3RB0A 5FLXY 1X5PA 1D09B 2HQIA 2XZDB 1HNVA 4WFZA 2WB1D 3KLHA 3SFGA 1GAOA 3NGUA 3R7BB 4P2SA 2DT9A 3MEGA 1D1UA 2DHGA 2CJYB 3KUHA 1LWEA 4TVAB 2QLJB 5JXSA 4PXEA 3QWPA 3C16A 1WOPA 4W92B 4NMLA 5G0RA 2DGUA 2OTLS 5J2PA 3MUMP 1NK0A 1HD0A 2BEFA 3HFKA 1VC6A 2YVSA 4RUBA 2IAJB 4ICLB 3LUYA 4F7VA 1BQXA 4H4MB 2BBEA 2UXCJ 1UWAA 3BV8A 3MAHA 4M5GA 1T03A 1S57A 2NR0A 5IT0A 3UNGC 1FNXH 1M0SA 4PG7A 4A8SA 2V9WA 3CTRA 1AA1B 1B7FA 2ZE2A 4J9RA 2PT0A 2QLWA 3DOKB 5GAHU 4J5OA 3K17A 2MTLA 2IC3B 3EVMA 1DJ0A 2V67A 3H40A 3DLEA 3ZNUA 4IG3B 3HSJA 5J2NB 4RW6B 5KFEA 2FYXA 3I56S 4KQZA 1U48A 1X0FA 2NSBA 1WTFA 3Q8PB 3C6TB 4I6AA 2IDEA 3ENQA 5IV3A 2XCAA 4F2RA 3UN2A 1NPPA 4L73A 3U27A 1L3KA 4QU6A 5CD4H 2O67A 3FUYA 3UPFA 7FD1A 1RBLA 3TRGA 2KVIA 1FKPB 3ISNC 4DV1F 1RYSA 2YWFA 3FRZA 1NCLA 3RAMA 4C8OA 1F5AA 1Q82T 1TK8A 2QA4S 3KK3B 1SI9A 1E6VA 3PEJA 2EW9A 3G8QA 1CJUA 3MAQA 3GZ7A 4FS2A 2HQ3A 4X4UA 1K0VA 3QZ8A 5LMNJ 5F8JA 4KO0B 2KKHA 2OPQA 4LBPA 4YR2A 4BBYA 3JS9A 3C8YA 4AL5A 3CCMS 1KLMB 1RCOB 5CYQB 1QUPA 2LEBA 4FYDA 1Y11A 1UVNA 3BBFA 2DGQA 2ZJPQ 2PFFB 3MAAB 3I4PA 4ZVHA 1HQUB 2K3KA 4CO0A 4NLTA 4LFBJ 4USWA 4UZCA 3SFUA 2RHSB 5HROA 1JB0C 1HHQA 5KFCA 3MFHA 2VJVA 4NLWA 2VV5A 3TARA 2RU9A 2V63A 5LXRA 5ETLA 3HX9A 2W8KA 4DV6F 2J9CA 3OD2A 4JI3J 3W62A 3IP0A 1FKAF 4NLOA 1ACMB 2BKPA 4CO3A 4B3OA 3ITHB 5A2QY 2ZH1A 1MU2B 4KPCA 2KHDA 2FLLA 2Q6BA 2D3ZA 4C0BA 3BB5A 2RAQA 5ETMA 3C2PA 1BD6A 2DHXA 2ATLA 1F5CA 3EMTA 3MPDA 4RZRA 2ZVSA 3S7RA 1UVLA 4ECVA 3HDSA 1M1KT 1GFWB 4OHWA 1ZAXA 3BBCA 4ALZA 2I5JB 1RE1B 5A8KA 1G3OA 2PMWA 1RHMB 3R97A 4JUZA 3PIPQ 3CEDA 4QIVA 3DLBA 1JMTA 5H9FJ 4HACB 3LANA 2AGPA 3MM7A 3UD5A 4USJC 1OIAA 1PO6A 4X4QA 5F8LA 2H4WB 1RI7A 4Y6IA 1NH7A 5DLGA 3AXKA 4AXJA 2HFZA 4I0WA 4FXDA 4ZVEA 5DG7A 2HRUA 4P7TA 4K4ZA 2X1BA 3THPA 1Q8BA 2OELA 3NOCA 2ASJA 1YRXA 1M5HA 1VQPS 2RQMA 2EFOA 3D1QA 3MF5A 1U47A 2JSXA 4RW7A 4I2QA 5MLCV 2CKWA 2A10A 4ATNA 3AB4B 5K8OA 1J5OB 5E2QA 3SQOP 2APOA 3PRBA 4OZ0A 2VH7A 1TZ0A 2J9EA 2AGQA 3D2WA 2UU9F 3NAIA 3VGUA 4LSNA 5KFHA 3PACA 2YNGA 4PABA 3JSMB 3OTDA 3KHHA 1YBUA 2QJ3A 3QJLA 3B54A 5ETQA 3RRKA 1P9YA 4F25A 3CGIA 2QA4G 1SJ1A 4ZJOA 1RP5A 1QSSA 3LAMA 3W2VB 1AXQA 1D0EA 4NX9A 3OHBA 4ZCLA 1ZPVA 2QL7B 1VRQC 2J7UA 3GCWP 5KFUA 2I6WA 3HHLC 2DNOA 4EZ9A 3L3CA 3PJ9A 2CNNB 1G7CB 3DRRB 4YB6A 2BANB 4DCOB 2ZFHA 3RYLA 1VBZA 1LWCB 2N7YA 1N32F 3M9NB 1S1TA 1ICEB 4JI5F 2HNYA 2XO6A 3SI8A 3OLBA 5KG2A 3FBEA 2BYCA 2HK2A 1WDDA 3FC9A 4NMXA 5IQQA 3PW0A 1YK9A 4PWUA 3MMCB 1RHRB 2COLA 3EVWA 4OI6A 4N8OA 2YKNA 5U47A 2UUAF 4JI8J 2VA2A 2VQEF 2FC9A 2GV1A 4K2XA 1HLWA 1NSKL 4J9UE 1ULRA 4KGVB 5B7WA 3IR6B 3M30A 3VVTA 4K4VA 3KLIB 5E0OA 4I1TA 4DR5J 2XSJB 1XK8A 2DGTA 1UZHA 1T8EA 1RXOB 2R7XA 3LWLA 2WSCC 2PGCA 2FZCB 3BEGB 3PV8A 3U1NA 2JH3A 1S6OA 2J0SD 1KKHA 4ILLA 2DY1A 3BPSP 4MFBA 4CLSA 3TZYA 3M8ZA 4LSZB 1X4AA 2WVEA 5LMUJ 2HFVA 2BRKA 1IBMF 3FK4A 2GVZA 3Q8VA 1BXNA 1R8HA 2C1EB 3AOAA 2B8PA 4O4GA 5HVFA 5T7LA 3NGKA 1SUQB 3Q24A 3AD7C 3BGRB 4FDFA 2Q3PA 2L3MA 3CDEA 1LW0A 3G4SS 1PBUA 1LNQA 4F3MA 5K8NA 3QFHA 1FEHA 3KG0A 2XULA 2H48B 2RUGA 4V19X 1TFWA 1MWYA 2F8HA 3W63A 1B7YB 4YB5A 2UV8G 5KT5A 2VQFF 1Y00A 2JNJA 4Y0FA 1RBOB 1CC7A 2XMAA 3US5A 1N56A 2DGOA 3LO3A 4IRDA 3ZZTA 3CMAS 2BJ1A 4A4JA 4U67Q 1B0TA 2WAQD 3T19A 1APSA 4B3SJ 2WK4A 4ECYA 4WP9A 2P9EA 1RU1A 1MMNA 2XLIA 1NK4A 4NLPA 2GAHC 4DFKA 1CJVB 2O1PA 1XWLA 2J7WA 4FF2A 4F4XA 4RU9A 3KYLA 3WDOA 2FZKB 3FFIA 1YQHA 5A8RB 4CLKA 4O3PA 3M05A 2EC2A 4TYAA 4EI2A 1CLFA 5IXUA 3OVSA 4MIBA 4NLDA 1R6VA 4PWWA 4HHHA 1UPPA 2UXCF 1PC5A 3THVA 1H2VZ 3M6VA 2F4FA 1EETA 4RW8B 3R2DJ 5A8WB 5FJ4A 2D41A 1PGZA 2MQ8A 4MYUA 4BLGA 3DC2A 3MD1A 3LAKA 2HZAA 3FBFA 3HF5A 1LW2B 1C1BB 2FDNA 1RWKB 4DL3A 3JQJA 3FQKA 4CNYA 2LU2A 3HSZA 2LEAA 4KHPJ 1WELA 1HBUA 2BJ7A 3GWCA 4LMZA 2MQPA 1S4EA 2EK6A 1PAEX 2ZKTA 5IOLA 2ALYB 3B6BA 1C0UA 4UOGA 4FPRA 1NDPA 1S9GA 2HZCA 4FP9A 2J0QD 1U1KA 4YHHF 1NMEB 2Z2MA 3W66A 1WEZA 3HULA 2Q43A 2X3DA 3CMQA 3V6KA 2CJAA 3LALA 2VG5A 4U95A 1TKTA 1QAJA 4KAIA 1FI4A 4I64A 4J9MA 3CWJA 2IFXA 5CQGA 2DVIA 1QM9A 3LP2B 4N77A 4FXVA 1U02A 2DHHA 1AZSA 4FKXA 4H54A 4WE1A 4JI7J 3LGMA 4ZPVR 3AQOA 3ZC4A 5EX3A 5KT7A 4ZPAA 5I4MA 2CDRB 4CLFA 2QO3A 4DLEA 1M5OC 4GVBB 1NH8A 3F0NA 2M8HA 3ILLA 1X5SA 1F9HA 2KL8A 4DSEA 2YKQA 3N5BA 4OHXA 4CH1A 2Z8QA 1UTAA 1CS4A 4QYZJ 3PNIA 2LLZA 3BKTA 1YG0A 3SDEB 3SCKE 1BC6A 4OYZA 2HQCA 3DU5A 3HHEA 2V69A 1Q8LA 3DM2B 1A7GE 1UJ6A 4QW9A 3UI3A 3R9LA 4LFBF 2HK3A 3PKMA 2PDAA 1NDKA 3TUPA 4GRSA 1SIZA 2W9AA 2GA7A 1T3NA 1NPRA 2MY7A 3BGUA 1KQFB 2LA6A 5HMZA 2Z56B 3OHAA 4JI3F 1FRHA 1QAXA 3LF0A 4AE5A 3J7YI 3ZZRA 3NWRA 3HVAA 4BCAA 1UKUA 2ALZA 5H1SV 4I67A 1U6FA 3RW7A 3MM9A 3D0HE 4CYUA 1LXNA 2L9NA 5ETRA 5HMYA 3QZ7A 1JKHB 5LSLA 4R8UB 2B5JA 3KK1A 1UPMB 2E1MC 3TJ9A 4NA1A 4IYQA 1JLFB 5IT9U 1RAHB 4NE9C 5HP1B 4C11B 3I87A 4DL7A 3GFZA 1QAYA 5DZ7A 3O3LA 5K20B 2J8SA 1MROA 1RT7B 3A3PB 3TR5A 4P7VA 2RF2B 1BLUA 3IM9A 3M8RA 2HAIA 1CJKA 3ADAC 2HHUA 4OIXA 2RS2A 3M32B 3JSBA 2AYGA 3EZUA 1X31C 1HNIA 1WHXA 5D6GA 1HBOB 3CSKA 4KYZA 2N3OA 3CF5Q 1JIHA 5L46A 3PYDA 2D9OA 4W90B 4ZVRB 3VAHA 2B9XA 1F2GA 1ZPWX 1RWXB 1G6BA 4QR2A 3OSNA 1N33J 3ENAA 1NZAA 2E7XA 5GVQA 2VKRA 4ANCA 2MPUA 4RBVA 5A6WA 4OHVA 1XN9A 1UEKA 2EEYA 4N5SA 1OY8A 3MEKA 3BH7B 1LEOA 1W2BR 4NYOA 1TU0B 4U6PA 2C22A 4ICLA 2C2NA 1NSQA 4ZLLA 3W65A 1VISA 1UFWA 5E41A 3T3FA 3CO9A 2LYVA 3M2UA 4RW4B 1NJIT 1JLQB 3X1LB 4ZLPA 1PYOB 1N36J 3DDKA 3S01A 2VB6A 1EZZB 2GS8A 1CULA 2V8DA 4IR9A 2KHCA 2IIHA 2ZH6A 4KB7A 3TVZA 4GKJF 2F40A 2DPJA 3VHQA 2ZNYA 2AU0A 1FNOA 3FRYA 5KT3A 4LF4F 3MZIA 4OYBA 2EPIA 1RA6A 1M5PC 4ZP7A 1VQ6S 5BYSA 2CPZA 4IG3A 5J2NA 1S1UB 4RW6A 3ZTQA 2H5EA 2YX1A 2ROPA 5IM0B 5DDRC 5IQ6A 4ZJLA 3HHNB 3K5PA 4ZVFA 3QBCA 2P2CB 2QZ8A 1HPZB 3W1YC 1HNXF 3IC1A 2J0WA 4KV8A 3Q0AA 3D1HA 2OFHX 2LECA 3GPAA 2N82B 2PE8A 1LFWA 1RBAA 2HFNA 4DR7J 1YVFA 3CJQA 3HLUA 4Q2MA 3I5CA 3MR7A 1KOHA 3UO0A 2RDDA 1NHKL 3PW4A 4V1Ak 1AUDA 3AD9C 1Q95G 2GZOA 4IRKA 4KO0A 3T1HF 2W01A 3U1LA 2QYCA 3J7Z5 4PWDB 4TQSA 1H72C 3CJRA 5CYQA 3G96A 4QWDA 2V94A 2VPXB 3CJKB 3BBBA 1VS3A 3WC0A 3L4BC 3CD5A 3OTEA 4DR5F 4OX9J 3NGDA 2XY6A 3MAAA 1NO8A 4NLYA 4NLVA 3L95X 4MJKA 2ADBA 1S4FA 4XK8C 1HQUA 4URQU 4P73A 1WKKA 2NXJA 4DV7J 5I3UB 2CQPA 5BYRA 1NEEA 4KT0C 2A6MA 5JMNA 4I7FB 2YNFB 3KLVA 3DRPA 3O6QA 3LOUA 2HBZB 1IVZA 1UEUA 5IWAJ 2KZZA 3BREA 4H4OB 3P3DA 2AWZA 4ZHRA 2FD2A 4J9LA 1XMQJ 1QAIA 4C8YA 4C8LA 1TKZB 4QU7A 2R2TA 2BKOA 2P6TA 3ITHA 4ITSA 1OY9A 3FCVA 3D6TB 3W60A 1TL3B 2H1YA 1X4DA 1NHUA 2YNHB 1JLAB 1SH2A 1R3NA 1S0OA 2NUHA 4Y28C 1OO0B 4UF4A 3PW7A 4QWBA 4F04B 2I5JA 2R8GA 1HBMB 1IXKA 1C2PA 4ZVPB 1V9OA 5D3GB 1XNQF 3TO8A 1U1RA 4M5NA 2U1AA 5C25B 4B3SF 2ACYA 4HACA 4TU8A 3OW2R 1DQAA 2D9PA 1KTQA 1NSPA 1RISA 5C24B 2PA3A 1B0PA 4CIOA 2LA4A 5H9FK 1FXLA 1RT2B 2DIUA 4K4SA 3VAKA 2AW0A 1VQ7S 1U45A 4Y65A 3FDSA 4JI0F 3ILIA 1S1XB 4BHQA 1J5OA 4OYPA 3ZTOA 2IM1A 4ZS6A 4KIAA 2VASA 1UJ4A 2YKMB 1RHKB 2B0GA 3C3LA 2HQGA 4B3RJ 3EDQB 4CI0B 4Q2LA 1FWPA 2WBMA 3Q8RB 4ID8A 3KJQB 3BQ0A 2AX1A 2ATCB 4WYWA 1RSCA 2Y0BB 1KFDA 4MKAA 5KFIA 1YSJA 1GMUA 3W5XA 2MZJA 1N54B 1JJCB 2R7WA 1PKUA 1N5VA 1QUVA 4OJGA 3GIKA 4ZCIA 1OQ3A 1VRUB 4MIAA 4JV0A 4CLUA 5CD4A 2XMUA 2W9CB 1EIYB 4DUYJ 3QPIA 5C7PA 5HO4A 9RUBA 3R1HA 3KHGA 2CZ9A 2IRYA 1X8DA 4WF9Q 5GMKa 1NU4A 3DRSB 4ZK7M 1NK8A 3BO3A 1PAUB 3M8PB 2XY5A 3E3XA 1TL1A 1U0HA 4HEA9 3EVOA 4ES3A 4LF8J 1MMLA 1YJ7A 4LF9F 4ETZA 2HS0A 3QLHB 1UL3A 2N4DA 2DRAA 4CLTA 3T5LA 2NSCA 4LBIA 3DRRA 3BSCA 3GR0A 2BANA 4YR0A 5ITHA 1VRTA 1RWVB 1OQ6A 2HKEA 1U49A 3LP1B 3WC2A 2ZJQQ 3KMQA 4DQPA 1C1CB 1IM4A 3DXBA 2RKIB 4IOBA 3CE8A 1XJWB 4PQUB 2W25A 3MMCA 3M9MB 1MLAA 4HH0A 5CAAA 3KUEA 5J1EB 4ECSA 1GTEA 3R5JB 5IZHA 1V3RA 3THTA 2VG6B 1N6QB 2C3MA 2R8JA 4IFVB 3SCJE 4R5PB 5GAHI 2YWEA 4HVZA 4KGXB 4WFAQ 2FGCA 2ZUGA 5KFRA 3VGVA 3KLIA 5KAKA 2RSQA 2D1CA 4OX8A 3ULHA 3D0IE 1ZM2A 2Z58B 2Q79A 2XSJA 2KRRA 5I42B 2HIQA 1HWKA 4FBUA 3NOGA 3NXZA 1YZ6A 3ISND 4OZ2A 4DQSA 3OBIA 4HTIA 3QMQA 5D8HB 3KLFA 1FVQA 3KK2B 3KKFA 1YZ7A 5KTQA 2WONB 4USMA 4TY9A 2K1RB 1JK9B 3HMJG 4O4RA 3K5NA 1U1PA 1G4CA 3HFVA 3M8SA 1XERA 1HW9A 3LTOA 4K7QA 4R0JA 3P49B 4XIUA 1UWBB 1SUQA 3R5GA 3BGRA 1OPZA 2K2PA 4I6YA 4WP3A 2PEHA 3PVXA 4WFNQ 1RAJA 2DNMA 5BR8J 4Q43A 4RO0A 4QOTA 3K59A 1FESA 1JJ4A 5ETPA 4A8XA 3BN4A 2YWGA 1Y9OA 4ECRA 5GADU 1X0PA 5LJ3Y 4DR1J 4D3GA 3T1YJ 3QRQA 3GR1A 3Q22A 2O3DA 4DV4J 2E1PA 2J8AA 2AEMA 3RJMB 5CHCB 3GONA 1F2HA 4DL0C 3CC2S 3SYZA 4ZJQA 3D9BA 3KDNA 3P5TL 2FVPA 1SVDA 4ZA1A 4OZNA 1WC3A 1CJVA 3RB6A 5A2QU 4IG0B 2CJQA 4OYAA 3MMAA 3CDAA 2YWHA 3MEGB 1WF1A 2DNKA 3K0JA 1S9FA 2M52A 4ID5B 3SCIE 1HR0F 2FHOB 1X4CA 5A8RA 2VFRA 3EZOA 3C16B 2AP6A 3UNYA 1X9MA 1HHSA 5G0RB 2ZH7A 4X64F 9ATCB 4Q8EA 4MK9A 2CQBA 1DQ9A 2J6SA 3NLCA 4EO8A 3POTB 2H9ZA 1WG5A 4RW8A 3P45B 5A8WA 5K8PA 3BM7A 4G1QB 5D4PA 3H5SA 1T03B 1OSCA 1C1BA 2MQQA 4GKKJ 2Z57B 1LWXA 1I94J 1DY3A 4ZOSA 3V4IB 2KM8B 2ZE2B 1K73T 3GFYA 4L3NA 1P9QC 2WOMA 2OEMA 3HVWA 3N01A 4USHA 3DI6B 3I55S 4ZPWR 2XO7A 3AJ2A 1PBAA 2WRMA 2ZWOA 3UD4P 1VQKS 3J81Y 5J1PA 2FPHX 5D0GA 2K3IA 2OD6A 1IJFB 4CH7A 1S7IA 1VI7A 3ZTRA 1Z1ZA 2CNKB 3BGOP 4YY3J 2H3EB 2AX0A 4OL8A 2J9DE 2KFNA 4ECUA 2B3TB 4DR7F 2CQHA 2HQDA 3TZXA 5DG9A 3NS5A 3UVJB 2GFFA 2DRBA 4X65J 1CSJA 2XS2A 5GMDA 5KFLA 4ZN3A 3I31A 5DRKA 1CJUB 1U1QA 4OI1A 1T9WA 2R8IA 1IBLF 2VC0A 3EUNA 2BKNA 3HXMA 2OPQB 3TA1A 4Q7AA 5G4DA 5B0EA 3BPDA 3DHWC 4X62F 4DR4J 4QJVA 3VAJA 2CG4A 2ZOFA 1VQMS 2J5AA 2B4VA 4RLEA 4O0IA 3VAIA 2IYIA 2E5LF 3EXCX 3DM2A 3JAMY 2G2YA 1FRKA 4QYZK 2A3JA 3JB9k 4ED7A 5AJ3J 3CDBA 4UZBA 4AQYJ 3FEYB 2BOPA 3G6VA 5HROB 4MKBA 2EKNA 3F44A 3EGWB 4CRJA 4WKRA 4HYKA 3D4JA 2XHCA 3G71S 1GX6A 2HRTA 2CPFA 2NZ4A 1IR1A 1WI6A 2WVBA 4NXMF 2DNQA 4J9PA 5IV4A 2QL9B 2FTRA 1SBRA 4K0KF 1YHQS 1SV5B 3D3BJ 1BE4A 2VFUA 2HHQA 3OXLA 1JKHA 2QA1A 2N7CA 4DI6A 4R8UA 2EG2A 2J6UA 1ZTWA 4EFAC 4EWTA 5HAOA 3VQTA 1C0TA 1WORA 1HFEL 2M4MA 4DFJA 2VOPA 3IA0A 5A8KB 3EICA 1TKDA 4H4KC 1DZ5A 2GVDB 5E5NA 1H6KX 3TAMB 1W7WA 3IFEA 4MKYA 4DV5F 4UOHA 1ZH5A 3GLJA 4ZVQB 2FLPA 1SCJB 5AE2A 4FYWB 4N8NA 1YJTA 1BQNA 2B9WA 8AT1B 5EX0A 1FRLA 1RA7A 4RBTA 4EO6A 2BV3A 2DK2A 4Y2AA 5CCMA 4F4ZA 3GG0A 3JTOA 2RRNA 3BKFA 1Q7LB 3SV3A 1NNDA 2E9TA 4RW7B 4CLZA 1WEXA 1RLDA 4MH8A 1QE1B 1WC1A 1OMSA 4JV2A 4PKDB 2K06A 3D54A 4B3RF 2MKCA 1RYRA 2QFIA 1ZAWA 3GYNA 5IFMA 2O01C 1IR0A 2UUBJ 4G1PA 1SQFA 3K8WA 1OY6A 5ETOA 4JI4F 1Y7PA 3SEOA 4RW4A 1JLQA 3GFXA 4FNHA 3IM8A 2OO4A 1UMJA 3M4XA 2AZ1A 3BYPA 1DAXA 3H42A 4Q5VA 4RUAA 4JV5F 2CXEA 4RWXA 4TY8A 4UTGA 4DS4A 4AFFA 2AYEA 4NLXA 1DURA 1NK7A 2DISA 4LRBA 3SQGA 1N5YB 1SC1B 3V6DA 2DRDA 3W64A 4DFPA 2LQBA 1FDAA 3KMSA 2AJQA 3W7BA 3LA0A 2ROEA 2KJWA 4QWCA 2R4FA 3C46A 1OYDA 3CCZA 5IM0A 1PIEA 2RNEA 1GTHA 1S12A 4LF8F 2OHDA 4LF7J 3M1VB 3HHDA 4LBHA 2ZZTA 4ZIWA 1HPZA 2V2QA 2QLXA 5KG1A 1VK8A 1UAWA 1UVMA 2C2RA 4L3KA 3MMBB 3IWLA 1Q4RA 2C3YA 2DGWA 4P10A 2HNYB 1M1HA 3CIMA 5H9EJ 5ETVA 4DV1J 4M5DB 1SL1A 2QT7A 5EWGA 1NRKA 1J5EF 3DCAA 2IRUA 1IKWA 2ZBIA 4M5HA 2JLEA 3UDCA 4KC5A 1I3OB 2VHGA 4ELTA 1N0UA 1RAEB 4LF6F 1RZMA 4QWEA 4YB7A 2XI2A 1WD6A 3G8SA 4X4SA 1FRMA 3FZ2A 3FEXB 3HD2A 2NYIA 2DEIA 2Q1LA 1RABB 3G6XA 5HQMA 4MKVA 4UY85 3T9NA 4WJBA 4OI2A 2DNGA 1B3TA 2WCXA 2GJIA 2FB0A 2V68A 2YNFA 2MLXA 2Y1JA 2FJXA 2QC3A 1RTJB 1HMVB 4MFBB 2KT3A 4DLGA 3BKUA 4PRFA 2GVZB 4DUZJ 1EKRA 5SZTA 4H4OA 4F36A 3UWTA 3H98A 1BWEA 4YDXA 2DD8S 5KFVA 4WFXA 3JXOA 4O4GB 4C0OC 5T7LB 1B4SA 2G13A 3FJ2A 2MGZB 2CJXB 3OR1A 5BR8F 2J7KA 1TL3A 3TANA 2FVSA 2W7OA 2G0IA 3WIUA 2FLNA 1JJHA 1IBKJ 4DR1F 3IWXA 5JVHQ 3T1YF 2HGLA 6AT1B 2DGVA 2HNDA 4LF1A 4L6V3 4N41A 1HBMA 4RU2A 3C6UB 1B64A 3Q89A 5D3GA 1TKXA 5C25A 1S48A 2MLZA 4OFZA 4WK3A 5EUHA 2YH0A 2AZ3A 1VCTA 1RDRA 2HGMA 3KTQA 5F9NA 3PZPA 4A47A 5HMXA 1XIQA 1O51A 4RNOA 4Z7CA 3HD1A 1RT2A 4U9RA 3M6XA 1EX8A 1KVJA 2DB1A 4YMEA 4DX7A 4FN5A 1TK0A 1GMVA 3S6EA 2MZSA 3MURP 3DYAB 4DX5A 2DH8A 4WP8A 3CCLS 3PRDA 1F1BB 2RT3A 1SKWA 1VJQA 4HDHA 4KHMA 1YIJS 4E2FB 2KG0A 5EWEA 4K5SA 2AKWB 2YKMA 1KFSA 3FKBA 2W1BA 2OPRB 1EETB 1ZTTA 3R1LA 4ZLJA 4CO2A 3T9ZA 4ZMMA 2UU9J 1L3TA 1I94F 5E3CA 2ILZA 3NS7B 1FXDA 1PJ7A 1PYTA 5ADZA 4D3HA 2JEJA 3TJ8A 1S79A 2PI4A 3MM8A 1VRUA 5I3PA 2Z2ZA 2CPIA 1HBUB 2W9CA 3D67A 1R7IA 2FVRA 3QJPA 1SJ4P 4LF5F 5KG6A 2DNHA 1S9GB 3DRSA 3EPGA 4OZ5A 4B9VA 1OYEA 2AHOB 1EP4A 2MYFA 5KFZA 2AJ1A 1HBNB 1YBAA 2YH1A 2EFVA 2BZ2A 1T11A 4IH6A 1Q53A 3M2VA 5K5MA 3HHLB 2XBPA 4FYXB 4G6VB 3D6FB 4DCJB 3QLHA 1T05B 2ZJRQ 5DQGA 2C3UA 2HFOA 3ET6B 4ECQA 5FIIA 2EFGA 1NHVA 4USUA 4X65F 4KRWA 1YTYA 1AZSB 3HO1A 3LP1A 4FF3A 1C1CA 2XLKA 4LIRA 4PG8A 3BF4A 4N56A 1LV5A 1F5BA 2DH7A 2WW8A 2HVHA 1HQ2A 2RKIA 1Y3JA 5DGAA 3G87A 4K4YA 5KFSA 4N76A 5J1EA 3CCWA 1L3UA 3A13A 3J7ZT 5FDLA 3JSYA 4F3OA 3CC4S 3OR2B 1H98A 2ZVIA 5CXTA 4CO4A 4IFVA 2VQEJ 4A8FA 4G65A 2V34A 1FWLA 4NZ6A 3PR4A 5B09A 5AJ3F 3FBBA 4UUXA 4LRCA 5I42A 5DG8A 4W4MA 3K58A 4FNIA 3AY0A 1I5OB 1TTHB 2HW3A 2FJDB 5KFFA 1JXEA 3JSRA 1RTZA 3NAHA 3RZAA 3GJQB 1FFWB 4NA3A 3KK2A 1T7PA 3HJFA 1FRIA 1O6XA 2WONA 4XO0A 3RR7A 2L48A 2A6OA 3K89A 3EM1A 4ELVA 3TEHB 1FFSB 5KG4A 1SJRA 4JI2F 2CPDA 3BS9A 4LVOP 1IBMJ 4K50A 4Y00A 3QAUA 4J9OA 1TL5A 3B4MA 4EGLA 1R0BG 1YJUA 4O44B 2K7KA 1VIXA 4OX6A 4X4PA 4CO1A 5DZ6A 2B5JB 2JC0A 2KJVA 5D4LA 5CYJA 1MN7A 1HIYA 3Q8SB 3NNCA 4KHRA 4JYAJ 2VF3A 1FJEB 1MROB 1HWIA 2Y1IA 3HVTB 2LCWA 2QMXA 4DPUA 2V6AA 4WK1A 1RLCL 1VJWA 2JL9A 4O3SA 4K2JA 4WTOB 2G4BA 4EBDA 4LR7A 5F8MA 2V5HG 4P2XA 2CZ4A 1NK9A 2V2KA 1HNIB 1M1GA 2HLUA 2QLBB 2ABYA 2MZ1A 2FVCA 3JYTA 4IG0A 4C0HA 4N7TA 4WFYA 1R6YA 4XDDA 4JI1F 2XMMA 2PIIA 2O66A 1Q7YT 4ID5A 3OFHA 1O0PA 2ASDA 2LP4A 3ZO7A 3H7HB 1H7WA 3QGPA 3NWGA 2DGXA 3GIIA 4EBCA 2ZDOA 2CG8A 1S6UA 4QIWD 1WACA 2PMZD 5HN0A 1NPKA 2GQQA 1UP1A 1NK6A 2UUBF 5ETSA 3UR3C 1RTIB 3P6YC 2GC8A 5KFBA 3POTA 2CRLA 3SBMA 1TAQA 1SKUB 1TUGB 1LOUA 1FJGJ 3N6NA 1M90T 3HP6A 4G1QA 3M2UB 1RT1A 1D3WA 4FF1A 2IMWP 2XZTB 3CB4A 3C14B 2FHKA 1CULB 3Q8YA 1N34F 1HI8A 2UUCF 2VD3A 2QSFA 3V4IA 4A8MP 3DGPB 2J0XA 2XM3A 3NMRA 4IO9Q 1ROFA 4O3RA 3Q86A 4FZVA 1QY7A 1FVSA 3DI6A 4C7QA 2NQPA 3DLJA 4X4TA 1RB0A 5HBMA 1MWZA 3KWMA 1SJFA 1NKEA 3C15A 2HHPA 2V4JB 3EE3A 4LF7F 5J2MA 3OJUA 1EHWA 2W4PA 3FSYA 4C48A 1WG1A 2JLFA 5KFMA 5HQ8A 4YHHJ 4DX6A 3MCOA 2IA0A 1HNZF 3TP2A 2R7RA 4KV8B 5J2QB 3UCGA 1SB6A 1SC4B 2MMYA 2ZC3A 1XR5A 1WHYA 2OEKA 4CLWA 3CPWR 3AHPA 4TNOA 4OI3A 3UCUP 1Z2LA 5DGBA 1ZM4A 4B3TF 2KFYA 1KLNA 3UVJA 2V8VA 3VALA 2E5HA 1FXRA 2OTJS 4NZ0A 3CJ8A 4ED1A 2HBQB 3MMJA 2B9EA 2WSFC 2B43A 1CVJA 3AH6A 4A8YA 3NGTA 1FNMA 1AT1B 1N52B 2RQCA 1B70B 1VC5A 4DPOA 2KG1A 1J27A 3HSDA 3TI0A 3RR8A 2FQQB 4LRDA 3IBCB 2RH3A 1LXJA 3B78A 2JJ4D 2F1FA 2PD1A 5BJRA 7FDRA 1KHVA 3RUBL 3R8YA 3F56A 1Q5VA 4AL6A 1T9UA 3DRPB 1WKJA 4HR2A 4DUZF 3MXHP 2G9OA 4WIQA 1TK5A 3KLEA 2GMJA 4CO5A 4ECTA 2IVMA 3LQVA 1S6PA 1PJ6A 2Q6CA 5A6PA 4ZHRB 4M94A 4HLBA 2FY1A 4NA2A 1EARA 2AYBA 1VQ8S 4EBEA 1SV5A 1VBXA 2BXJA 2JWNA 1IBKF 4ZVOB 4NEYA 3BSNA 2VPWB 4QWAA 2NXNA 3I9V9 2E5IA 4OI0A 2W9BB 3X3UA 3R5AA 2B51A 3GE9A 2OD4A 3CJ3A 2JOQA 3GIJA 4ZCKA 4JV1A 2UXBF 4F0HA 1V3SA 4E8UA 1UCNA 2GVDA 2GMHA 1WOSA 3TAMA 4AUKA 3T6JA 4FVMA 3B82A 2WZ1A 4CM0A 1ZETA 4DQIA 1MSWD 2CVIA 3IR7B 4KFBB 2BM0A 2XGQA 1VR6A 4F0KA 1UA0A 1OS5A 1YJWS 4TU9A 3AAWB 3GMGA 1S59A 2MKSA 2XMVA 1Y0HA 1RGVA 4BWJA 5L39A 1Q8IA 3H4DA 1YRUA 3TAPA 3OL6A 2RB7A 1QE1A 3AT1B 3QSYB 1HD1A 4WXOA 1TVRA 3HKZD 4LFAF 3H5XA 5DQIA 2DR9A 3G2XA 4LQ3A 1YRTA 3Q8QB 4QQBA 2F4VJ 5F3TA 1NUEA 4Q45A 1TAUA 4HL9A 5DM6Q 3GG1A 2FJWA 3TX0A 2WBRA 1R31A 1RAGB 1D8ZA 3BO4A 2LKZA 5GADI 1WHVA 1HNWF 2A18A 1FD8A 4ANDA 3R7SB 2DIVA 2L9WA 3BSOA 3MWBA 5D78A 1N5YA 1CBKA 2KT2A 4FBTA 4ILMA 2XLJA 2DR8A 2Z4PA 4GKJJ 5KFAA 4IH7A 2CQGA 2BE7D 3M6WA 3FVYA 2LMIA 3PJXA 3K5LA 4C3LA 1X60A 4LF4J 2FUG9 5CCLA 3OTCA 3TEGA 2OSQA 4KPYA 4K4TA 1RWOB 5M2UA 1TL1B 1U0HB 3MECA 1T02A 3M1VA 4USTA 3J80Y 1NDLA 4C8NA 2DJWA 5GAGI 1FKOB 5MAOA 3FMBA 4DR2J 4WYLA 1VRTB 1HNXJ 5A76A 4KH0B 1TP7A 2LDYA 3MMBA 2BE9B 1AROP 1T9VA 3DHXA 3I0RB 1OJ4A 3RBZA 2YQ0A 4DQQA 4F2SA 3CIZA 3TQEA 4NPOA 3FSXA 5SUHA 3BR9A 4M5DA 1W2IA 2FHJA 4YEAA 1Y5IB 3BGFA 4P75A 3AXMA 2NCKL 2YKAA 3D68A 2M7SA 3PRVA 4KY3A 2MLYA 5H9EK 4ZVSB 2DR7A 3J81U 2DXEA 4I6WA 1DARA 5EN1A 2RS8A 1DHMA 3ONQA 3T1HJ 4F8RA 2BJDA 1ZM9A 3GYXB 2HPUA 2OUGA 2Y3YA 2MZTA 1SQGA 3K57A 4J91A 3EWGA 2JVRA 4NOHA 3N28A 3RRHA 2PO4A 4RNHA 3CT9A 3BH6B 2MKIA 1FO1A 2A0FB 2NS1B 3HT0A 4X4RA 2RRBA 3DOLA 3KLFB 1T0TV 1RTJA 1HMVA 5KFJA 4ZCMA 5HANA 3DOMB 2WB4A 4ECXA 1YKWA 2JVOA 2BJ9A 4TN2A 4QW8A 2MGZA 1JJ2R 3D6MB 3SSQA 2M9KA 4LT6A 4IOAQ 2R7TA 2Z2LA 4WZMA 2Z30B 4HKQA 1F9FA 3OUYB 3V81A 4DPWA 4JYAF 1WHWA 3MEEA 1RTHB 3MCMA 2X51A 3ISZA 4R0EA 4C8ZA 3EGNA 1J2VA 2DR6A 4DF8A 3C6UA 1PSDA 2R3VA 2JDJA 2JRSA 2E5JA 1XNQJ 5L1IA 3SSRA 5HQLA 4NXNJ 3W61A 3KG1A 4A48A 2C2OB 2HWHA 1VLYA 5DO2A 2ASLA 1KN6A 4OHYA 5LM7E 5LOQA 3NEKA 2MXYA 1S99A 3GIMA 4FKYA 3PX6A 1PG5B 3OTOF 1U8WA 2HS4A 3MMAB 3MM6B 2R9LA 2VIHA 1HA1A 2E66A 3P96A 2EG1A 3PR5B 1KVIA 2ZBPA 3VF0B 3NP5A 3DYAA 3U1MA 1IKXA 2AT1B 3GJRB 3KJNB 1FJCA 1SL0A 4JI0J 5EGYA 3MHYA 1FJGF 1SKRA 2XMWA 3OL9A 1Q8KA 2OPRA 2KU7A 3ZTPA 3R5DA 4GVLA 3HSGA 1IKYA 3NL0A 5KFGA 1GH8A 3M8QB 2DEJA 2BRLA 4P71A 2UXDF 2RUSA 1ZBTA 4ZP6A 3F73A 4ED6A 3TZZA 2C2KB 1JX4A 1K8AT 1EAYC 2CPHA 2XTJP 3NRBA 4FPIA 2XSFA 2X1FA 3QO9A 2GQ2A 3IGNA 4C8KA 4P52A 1DTQB 3TX8A 3HKWA 2WOMB 2X3GA 5KFYA 1R0CB 1R0AB 4F4AA 1F6TA 3J7A1 3CJSA 3H25A 4P9SA 2CDQA 5B0AA 5LXYA 2HURA 1O5JA 1TQLA 1HBNA 1VOMA 2ZH4A 5DDPC 3VR1A 3VVUA 3HHLA 2RD5C 1BUXA 4ZIVA 5KT4A 2KM8C 3FEZA 4MK7A 1T05A 4EMDA 5LSRA 3KNAA 3RG6A 4LF9J 3ET6A 3CJ4A 7AT1B 1UEVA 2EI5A 2IY5B 4ERDA 2CFXA 1UFLA 1T9XA 3DLKA 2QTWA 5AE3A 1W26A 4BWMA 1Y3KA 5KFKA 1JLBB 3EX7B 3L7UA 3ENWA 5D4OA 1WEYA 3CCVS 2MJUA 1K1QA 2GIFA 3OR2A 1FEEA 1U6BA 5CYMB 1SH0A 1YJRA 2F3JA 2YKPA 3FSIA 1X5TA 4ED4A 3HK2A 2VG7A 3QQCD 4DG1A 1K0TA 5K9FA 3W9IA 1PC4A 2OPSB 5D77A 2DO4A 4PXBA 1X4BA 1S1VA 2EVZA 3K2YA 3NGSA 2UUTA 1S0MA 3TA2A 1IWAA 1FT8A 3CUNA 1FHTA 3HJVA 3WIVA 3AJDA 2PC6A 2KDOA 4FYYB 2AGOA 2E5GA 3L09A 2KFZA 3TQ1A 4UOCA 3D1OA 4PPDA 2HGNA 3MD3A 1XR6A 1X9SA 3QATA 3KFWX 3D5MA 3G8TA 2EFNA 1Q81T 6FDRA 4YR3A 2V4RA 1YJ9S 3NKYA 1U0SA 4RX6A 4HHJA 3LWMA 4O44A 2KO1A 1RUSA 4OV6A 2CWKA 1NXIA 1C0TB 2AQ4A 1FWKA 3HT3A 1SJ3P 5A0YB 2DNYA 4CZCA 1CQNA 4ZVTB 2DXDA 1XBWA 3MTJA 4MTPA 4WU3A 1GXLA 1VQ5S 1DQ8A 5DLFA 2F8EX 3PW5A 1WF0A 3HVTA 4EZ6A 5L9XA 1Q1KA 3VTIA 4RUHA 4HT7A 5L1JA 5DDQC 4CTAB 2V4QA 2VFTA 1TMJA 1BQNB 2MKHA 2F7VA 2DCUB 2Z2YB 4ZN1A 5LSOA 1HI0P 2N4CA 5B0CA 3BSAA 1NKCA 3FBCA 5IT4A 1EJ7L 3WZ0A 1X4HA 3KG4A 5K8MA 1GQEA 4LFCJ 3HI9A 3IRXB 2DITA 4MMOA 1Y5LB 1IQTA 2BDPA 4ETXA 1ZS6A 1UA1A 3W5YA 2PA8D 3T1AA 4DHVA 1HR0J 1SIWB 2RDIA 4RNMA 2F4VF 1RTIA 2R8HA 4X64J 2R2SA 5C42A 2LXFA 2DKOB 2V50A 5F8GA 3D28A 1U26A 2VPZB 2GHWA 1TMMA 3W2WB 3VAFA 3OQ2A 3DXSX 5E3QA 3OT9A 3C14A 4TY8B 2Y1LB 1GMWA 4A8WA 4ZP9A 4AXIA 3SQGB 4X66F 1BY9A 3V6DB 4RJVA 3OFFA 2DTJA 3L9ZA 1TFYA 3CW2C 3DGPA 1ELOA 1VHIA 4O0NA 2UP1A 3VGSA 2YWWA 3UN3A 3N6MA 4KR0B 1X5OA 1FA0A 5AXLA 2DXFA 2V4JA 3IO1A 4IH5A 1NDCA 5BYQA 2KXFA 1E6YB 2UVUA 4NCAA 1S1WB 1H2UX 2L08A 4M63A 1QTNB 4DR2F 3QYYA 4C98A 4CLLA 4ZPCA 4I69A 4ZPDA 5J2QA 1VQYA 2OMOA 2LXIA 1U7LA 3MI7X 1YJVA 3M2RB 3QNWB 4CQ1A 1KDNA 1KHWA 2YPZA 5AXMA 1HWLA 5F9LA 2FJVA 3A4TA 3A3OB 4EYHB 3GV5B 2GIQA 3KJFB 4A8KA 4PG4A 3IS9B 2OP5A 3PYGA 1IKWB 4RL1A 2E9RX 4PEOA 1U8SA 3IWNC 1I51B 1IBLJ 1BHNA 1RAFB 2Q66A 2KN4A 2RQKA 2IA6A 3ILJA 3WBZA 4X62J 1CQMA 2IYGA 1CPZA 4QYRA 5C2CA 1DRZA 2F9JA 2ZNZA 2LQ5A 4KH1B 4QCLA 2E5LJ 5B0GA 4WZQA 4DZ6A 3OFGA 2GNKA 5KFWA 2POKA 1XNRJ 4BC7A 4J9SA 1MG7A 1LK5A 2GJFA 4CDIA 1XTZA 4NASA 1HKAA 2HBRB 2FY8A 2LFVA 3ETOA 3IGVA 4QPTA 4QIGA 1U1NA 4NXMJ 3OR1B 1QVGR 3G9CA 3E8OA 4IDKB 2V8GA 4WWSA 4K0KJ 4EEYA 2IVFB 4ZLNA 5DS7A 2HHWA 1T9TA 1IKVA 1RHUB 4CWBA 4KTQA 3PKYA 3EYZA 2Y0SD 4DU7A 2W9BA 2CQCA 2HNDB 4OMFG 1SKSA 4TXSA 3AA8A 2IVYA 2EK1A 3VZIA 2ZHAA 4HHUA 5EWFA 1S9EB 2M0GB 1TKXB 4NXNF 1CC8A 2NZCA 2B9YA 1FRXA 2I38A 2BE2B 2E1CA 4KFBA 2BX6A 4DV5J 2MQOA 4XTTA 3NCPA 3ZZOA 1ZYQA 1U1LA 4X2BA 4DQRA 2G2ZA 1YGYA 4NCBA 3TA0A 2M3DA 4F67A 4DV0F 4LSLB 1P1LA 5DQHA 1YDLA 5GAEI 3BGLA 2G0CA 1RACB 3WX4A 4U7CA 1VQOS 2ZITA 3MR2A 4ANEA 4KGMA 2GGPA 1REVB 1GXUA 2B4PA 3D3CJ 2AMCB 1HI1A 4ZKAA 2KRBA 1NKBA 3DMJA 3RBDA 1NJXA 2KVQE 1JLEA 2YTCA 4ZPBA 4ED8A 1HYSB 8RUCA 2QIFA 1T9YA 5FLXU 1G2EA 4JI4J 2EFQA 1FX2A 1AYEA 2G1HA 5KFNA 1WG4A 3SXLA 2HWTA 4JV5J 2GCFA 3MM8B 3OTBA 3QFWA 2ZH3A 4DR6J 4U8VA 4K4XA 4UQGA 3PX4A 2BJ3A 2CAJA 4Y2KA 5K14B 1VQSA 4M8LA 3MM5A 1EP4B 4B9MA 5M2RA 3K8VA 1VIOA 3MCNA 3M2VB 4F02A 1SC3B 2DO0A 2E29A 1T94A 2LQ9A 4RWWA 3QIPB 3MUTP 3ZXWA 1FKOA 2MSTA 2AEJA 2VL1A 4M5LA 1D9FA 2DHSA 1TL7B 2YY3A 2R8KA 3AA9A 5CABA 1UETA 4B08A 4IO1A 3I0RA 5I3QA 4XAKA 4OZ3A 1DLOA 3DRYA 2PSZA 1XC9A 4ECZA 1WUUA 3UDLA 3IXQA 3JQMA 4Z2XA 1KQSR 2XMTA 3I5AA 3LP0B 4IR1A 3TW0A 2NREA 1G1XA 3VZHA 1WC6A 3IG1B 1J5EJ 3PYFA 2CADA 2QN6B 1VQNS 4DDFA 1TV6B 1REGX 5FDLB 2VFSA 4J90A 3EJMA 1HW8A 3OPKA 4RBUA 2EFPA 2M8DB 3DDNA 5JJBA 2HHHJ 1PILA 2QV6A 2VBYA 1VMBA 3RW6A 1NM2A 3KUGA 1KRPA 1CJTA 1JLGB 1ZZNA 4LF6J 3W9JA 3AOBA 2M2BA 3H5UA 4YQWA 4P74A 3R6LB 4WBFA 3G82B 1X4GA 3H2LA 4ED0A 4J9VA 2CJKA 3QGIA 5KG3A 3CNQP 5L8RC 1OSDA 2B56A 2HWIA 2XS7A 2JHEA 3AOCA 3NGRA 5KT2A 3DOMA 2I0XA 3I9ZA 1RT5B 2IBKA 5AT1B 2CPXA 4M95A 2GIRA 5FD1A 4RR5A 3OFEA 1LWFA 5C2GA 5THWA 1N88A 2L9DA 4B9LA 1GX5A 3HZEA 3OUYA 2GHVC 2IJNA 2NYHA 3IAS9 5JVGQ 4U8YA 2DY9A 4BS2A 1RTHA 4DSIA 1HWUA 4C4WA 2RILA 2J6TA 1R8CA 3QT8A 1Q16B 2BW2A 3W8GA 2ZBRA 1WJ9A 2GMLA 4DF4A 1KBRA 1FERA 2XNQA 4DSJA 4GC6A 1WSVA 1NB7A 2HFSA 1FF2A 3NNHA 1U4BA 2ZUAA 3PYEA 3P4UB 3JYTB 2E7VA 4LFCF 4O23A 1D8YA 1F3VA 3MM6A 4KE5A 2MKYA 2H5JB 3CCUS 5CZVA 3R2CJ 2W8LA 1PYSB 2V0NA 5GAGU 1XMOF 1N5TA 2KYZA 3RB3A 2MHNA 3I82A 3LPEA 3JTPA 3E2EA 3CD6S 1F0XA 2C3PA 2AV5A 3TUJC 2MZRA 4GMKA 4RW9B 2MZQA 2QRRA 4LF2A 3V4MA 1RWUA 1RT1B 4YS2A 3I0SB 4TKTA 2B7BB 2XS5A 1FDNA 5F41A 5CH7B 5RUBA 3M8QA 2XI3A 3UR0A 4DL4A 4DN0A 2C3OA 4K5RA 3I96A 2RRAA 2DCLA 4DS5A 2LDIA 4OZJA 4P72A 4ECWA 2CQIA 1VDHA 2AJ4A 2ZH5A 3N4WA 3DNCA 4J37A 1URRA 1H3DA 1DTQA 1V3ZA 1RQ0A 3DLGB 1RCXB 1R0AA 5KFDA 1X7VA 5F0UA 5HBMB 2JLGA 2XGPA 1FFGB 3GSIA 3C15B 4C8MA 5J2MB 4LF5J 1RAIB 1FE0A 1TL4A 2OPPA 2QYGA 3GJTB 1VK3A 5IC6B 1DTTB 4M1KA 4RNNA 1RHJB 1FK9A 1P8GA 3O2IA 4QBUA 3VWSA 4XDCA 5F0WA 3A8JA 4WTYA 2O5DA 3Q83A 2MKKA 4IRCA 3KHLA 3HCXA 2JEIA 2E1AA 4CH0S 1VGYA 2B8QA 1IBCB 3CCTA 1BQMB 1FTRA 1RT3B 2HQFA 1EKSA 2FJAB 5D4NA 2QMUB 3KNGA 1YI2S 4HH1A 1JLBA 2ILYA 5DJBA 3NMAA 2KXNB 1M5VC 2RJZA 2PI5A 4Q0BB 1CG2A 3BJYA 2W4DA 5CYMA 2KT5A 2VJUA 3J80U 3UE2A 3O1LA 2IJRA 3FCHA 4ZDNA 1LKZA 3N79A 1W25A 3PCOB 3PM9A 4ED3A 2QEXS 2J9DA 2OPSA 2YKOA 4XPEA 4DPYA 5LMNF 1XNRF 2R7VA 2MQLA 1AFJA 1H2TZ 1WI8A 3LPYA 1HARA 4PG6A 1U24A 2W7PA 3JQKA 3VAGA 2CQ2A 2WTFA 3KLEB 4DUTA 1S6PB 2L41A 3A1YG 2J76E 2PMHA 4MAKA 4EK2A 3J81j 3S1TA 4E98A 2OLWA 4GC7A 4GO7X 3NCRA 2ZM6J 2HZVA 4UT4A 1GT8A 4RKUC 4JI2J 4DMZA 3HVRA 1OWXA 3IR5B 4WIIA 4X84A 4P6QA 4RUCA 3AJ1A 2F63A 3EZ5A 4M5MA 2CQDA 1WC5A 4X4OA 5A0YA 3MDFA 4Z7YA 2HG4A 2XQCA 4ED2A 3R5CA 1IJEB 2K8GA 1U2FA 2F8MA 2ACMA 2P5VA 4DX8H 4ES1A 4PUOA 2GAGC 4CTAA 4TQRA 4USVA 4PXDA 1ZOTA 3CD7A 4I2PB 1KSPA 4NL5A 1R8BA 1L5UA 4DL5A 4DV3J 3ZZPA 1U2CA 3P5BP 2R42A 3FQLA 3IRXA 2LVWA 4JI1J 2WVDA 2NXUA 2DH9A 1GXTA 4OYOA 4LVNP 2XY7A 2HVEA 3MCSA 4J9QA 3Q2TC 3W9HA 3FCWA 4IFYA 3D7SB 1TVRB 2BQRA 3G6YA 2D74B 2MQNA 3H8YA 1AUSL 5IS2A 2A1BA 1FX4A 2HNZB 4DFMA 5L38A 4OZ1A 4NI2B 4YN3B 3ZNJ1 2HFUA 3CDWA 5DM7Q 4WKYA 3BYRA 1JQGA 1JWWA 4URGA 3W2WA 4X4NA 3SSSA 2CPYA 2VBXA 1R8PA 2CA9A 1YBTA 1QTMA 2KB2A 5HATA 3A8EA 2EBGA 4TYBA 5D0EA 4DR6F 4KKOB 3KJVB 1N34J 3TAQA 1V5IB 2UUCJ 1WWHA 2CUYA 3GB0A 5JUMA 2IAJA 2XHWA 2ZBQA 4M5IA 2HMIB 2Y8YA 4H4MA 4OYIA 2DPIA 4CT9A 3NG8A 2ZOMA 5DDOC 1X4FA 2XC9A 2HVDA 1E6YA 3MECB 3PXGa 1LFPA 4Y34A 1S1WA 4PQAA 3ZZYA 2CNLB 3H5YA 1HNZJ 1VYAA 1UW9A 2FVQA 3DOKA 1MN9A 2IC3A 3M2RA 2V8HA 4QPXA 3UQSA 2ZD1B 3PFEA 4DBQA 3PIOQ 1GEHA 2P8IA 1UZDA 3MGJA 4B3TJ 2JZ5A 3C6TA 1DBDA 3IS9A 3CXCR 4HI1A 3CC7S 1A6LA 1KD1T 3B4DA 2BUNA 1YITS 1Z2ZA 3DLLQ 2OH2A 4PR6A 5F3ZA 4P2FA 2HHHF 1WNEA 2VKZG 2NPIA 1RT6B 1VQ9S 3RTVA 3MFIA 1FKPA 1L3SA 5D0RA 4A46A 2C2ZB 1K1SA 3GIRA 4Q8FA 4TLQA 4OV1A 3KK3A 1VQ4S 2ZOGA 4K4WA 1VFJA 5ETNA 2V2VA 2MEWA 1VBYA 3O8WA 4JI8F 2QSWA 2FZGB 2AJFE 2P9GA 4A8QA 2X7IA 4TLRA 2M70A 3Q8UA 1TUWA 1YWXA 1S72S 3DOLB 2QGFB 3NNAA 4CLPA 2M88A 1KLMA 3AQPA 1A0OB 5E3RA 2H54B 3OSPA 3H0PA 2BABA 2WVFA 1FDBA 2LQJA 1LQ9A 3A3NB 2V8PA 2CYYA 2ZBCA 3V6HA 2HHTA 1TR0A 3TZWA 1NK5A 1FTCA 3OXGA 5B0BA 3DLHA 4DPXA 1UW4A 1RT4B 2ZH2A 4IDKA 5L1LA 3NCQA 1XEZA 4IKAA 1RWWB 3V81B 3AB2B 2CPJA 2BOAA 2LQ8A 5T14A 1RTDB 5LMUF 3MEEB 2X1GA 4NCGB 3H2VE 2UZAA 2HVZA 3AODA 4F4YA 2VICA 4DV2J 5E7OB 3FMWA 3K5MA 1S9EA 4C3MA 4H4KA 3DFEA 1NJZA 5HJYA 2UXBJ 4ER8A 3PY8A 3QRPA 4YDDB 1S6QB 1S49A 1SXLA 2KH9A 1MU2A 2KTQA 4QR0A 1KC8T 2BE2A 2GQCA 1N8RT 3TOQA 5AXNA 4CLYA 3R5BA 2ZDPA 4J7CA 1Q5YA 1IUJA 4KGKA 5HK4A 2BA9A 3QWUA 4JI6J 4LSLA 1S77D 2VBWA 2FHMA 5D0HA 1RWPB 2IBOA 4LR8A 2V9KA 1U1OA 1KNZA 2YPYA 1IKXB 2D69A 2R7UA 1REVA 3OXFA 2MHEA 2B7CB 2D3UA 4C97A 2IRXA 4HTJA 1AB8A 3PFOA 1A9NB 1BMQB 3T5KA 2ADCA 2IHR1 1JLCB 1FDDA 2QLFB 1HYSA 2D7SA 3TYTA 4LFAJ 3GYGA 1X4EA 1QLNA 3KLGB 1IKYB 2YNIB 4WU2A 2PFDA 3WQPA 1QD1A 5EDWA 2HRYA 2XMJA 4NZ7A 3Q23A 3H59A 2JEGA 4B17A 3CD0A 4NRUA 4P2MA 3SMZA 4K8RA 5KFXA 1TELA 1HNWJ 1IN0A 3QO9B 1EQ0A 3EGVA 3IBWA 4F4KA 4LIWA 3QAEA 2R2UA 4DR3J 4U96A 5K14A 1XMBA 1HQEB 3PO4A 4DCPB 1T3OA 3GCXP 1DFDA 2AJ0A 1ITPA 3HHKA 3JSMA 3DDIA 1QJHA 2AEFA 3SCLE 4IQXA 3W5ZA 4KHPF 1S5ZA 1ZM3A 1KONA 3QIPA 2U2FA 4WXWA 1U2RA 2B6AB 2EBEA 1TL7A 2F9DA 3GJSB 4QIFA 1MNEA 1OPIA 3B8HA 2LU1A 1EQMA 2QFJA 3RRGA 3W2VA 5KFPA 2OEJA 1AW0A 1N0VC 4I56A 3DLKB 2DR5A 2DGSA 3LP0A 2NPFA 3H2UB 4IQMA 1NLKL 3KHRA 3GV7B 2B4UA 3UFCX 2VFVA 3MEDB 3TUIC 4YOEA 2NLWA 4OLPA 3IG1A 3UDEA 3D6HB 2K7JA 3IAM9 3UD3P 1TV6A 4ES2A 2W2NP 3NBPB 4PYDA 4DJBA 1LWCA 4JI7F 1ZA1B 4ZVUB 3AD8C 4FXWA 2VG7B 4DG1B 1AFIA 4QZVB 2I9SA 5KG0A 3A8KA 2VDHA 2W2QP 1JLGA 4OJ1A 2HHSA 1S1VB 2E9ZA 2BJ8A 3M7VA 5KG5A 4B9NA 3ICLA 4URSA 2OKQA 1QSYA 3O44A 1XR7A 5HSPA 4C3KA 3GU0A 3G86A 2RDJA 3G82A 1D9DA 3ZZZA 3BDPA 3E01B 1RWNB 3VCDA 5GAEU 2XZWA 1X9WA 5ETTA 5M2PA 1FRJA 5HMWA 3IN5A 1WTBA 2WW4A 2ZM6F 3V2UC 1U09A 2VDIA 1GNKA 3MPWA 3CVKA 3A8IA 1RT5A 2YXLA 1UVKA 2M5YA 2C2DA 2YQ1A 1SC6A 3DU6A 1JXVA 3CJTA 5HLFB 2H51B 1N5QA 3PW2A 2XNRA 2XB2D 2I8EA 2PN6A 3OL7A 2FHJD 1RKIA 3CJ0A 2C2MB 4LRFA 4QIEA 3SIPB 3ELHA 2DYAA 3MUVP 3TVKA 4B9TA 3QJJA 3RBXA 2EKYA 2X1AA 1D9AA 2XEXA 2YQ3A 3PG9A 3FNNA 3I5BA 3R6GB 1L3VA 4LRAA 4DXLA 5KOWA 4DV3F 2W4CA 3IBFB 2ZZMA 2BM1A 3W8PA 2SXLA 4UOFA 2RE1A 3GTYX 1Z4UA 3OTOJ 4LUBA 2FIUA 2IMOA 5HJXA 4PPZA 1M5SA 3UN5A 2QE5A 3CCRS 2VBZA 4OJ3A 3H20A 3MPVA 3QT7A 1HNVB 5GMEA 4DSFA 2QX0A 5C42B 3KLHB 3IRWP 4RW9A 1SL2A 2XCPA 2XG8A 1KOOA 1IM6A 1N33F 2XYPB 3FGVA 1Q86T 3LGHA 2YWKA 1K44A 3I0SA 3DN9A 3JTNA 3KXDA 3OVAA 2Z0GA 2Y8WA 4DPTA 1LWEB 2CJBA 4NLRA 4NYPA 2UXDJ 1LK7A 2P6SA 1RADB 3E51A 5J2PB 2MSSA 1KS2A 3CCSS 3EDRB 3DLGA 4G1IA 1RAOA 4A8OA 2OJ3A 3MPUB 1N36F 4LQ9A 4K59A 1XQIA 4OJHA 3WX8A 2CQ0A 2CVEA 4RPFA 3RU0A 4LR9A 1LW2A 4I4BA 3K5OA 3MR5A 1DTTA 1WC4A 1C4CA 2W24A 3VV2B 2AD9A 2NUUG 2DNNA 3MR6A 1NBEB 4IUFA 2GX8A 3TWZA 2F5GA 1PJ5A 3DLEB 1R8AA 1BGXT 2BMBA 1BQMA 2H4YB 4DL6A 4KBIA 1RT3A 4NLSA 2MDAA 4YP3A 2XYHB 4E0DA 3ENVA 3HFZB 1C4AA 2BACA 2E7WA 1CEZA 1WDTA 3OL8A 3MPYA 5F8IA 4G3IA 1MWQA 5E3PA 3CCJS 2I1RA 5HI7A 4Q0BA 3L7OA
chains in the Genus database with same CATH topology
1O51A 4ED5A 4DL3A 4RNOA 3G9CA 3E8OA 2I2YA 1RT2A 3FQKA 3LP2A 4IDKB 4CNYA 4U9RA 2LU2A 2V8GA 4YB1P 3M6XA 4EEYA 2IVFB 5DS7A 1KVJA 2LEAA 2DB1A 2HHWA 1IKVA 4YMEA 2HHVA 1WELA 1V6HA 4FN5A 2VONA 1TK0A 4KTQA 3S6EA 1E6VB 2MZSA 1HBUA 2ASYA 3GWCA 3DYAB 2CPEA 3MURP 4DL2A 3PKYA 2DH8A 4LMZA 2MQPA 3CCLS 2EK6A 3EYZA 2ZKTA 2CIMA 3PRDA 2Y0SD 4KSEB 3U7JA 2W9BA 2CQCA 2HNDB 2RT3A 4OMFG 1SKWA 4R25A 1C0UA 1SKSA 4TXSA 3AA8A 3RAXA 4FPRA 4HDHA 2IVYA 2JX2A 2EK1A 2GO8A 4F3QA 4KHMA 1YIJS 3VZIA 2IJFA 2KG0A 5EWEA 2ZHAA 2OFGX 1S9GA 3BN7A 5EWFA 4K5SA 1S9EB 2HZCA 4FP9A 2J0QD 2M0GB 1TKXB 2YKMA 1U1KA 4YHHF 4NXNF 1KFSA 2Z2MA 2BR0A 2OPRB 1EETB 1CC8A 4OX7A 3V6JA 1WEZA 2B9YA 2BQ3A 1FRXA 1ZTTA 2I38A 2Q43A 3V6KA 3R1LA 2BE2B 4OX9F 5HL7Q 2CJAA 3LALA 2VG5A 2N3LA 4CO2A 2E1CA 3T9ZA 3SDEA 4KFBA 4ZMMA 1TKTA 1QAJA 2GW8A 1SJQA 2DHAA 2MQOA 3HHLD 3N0VA 4KAIA 4I64A 1L3TA 3CULA 2DBBA 1I94F 3NCPA 5E3CA 2ILZA 3ZZOA 4J9MA 1ZYQA 3CWJA 2IFXA 1U1LA 5CQGA 4X2BA 4DQRA 1YGYA 4DV7F 2DVIA 4NCBA 1FXDA 4C9DA 4RNFA 1QM9A 3LP2B 3TA0A 2M3DA 4F67A 4DV0F 4N77A 4LSLB 5ADZA 4FXVA 4D3HA 4GO5X 1P1LA 4YUDA 4DOZA 5DQHA 3SV4A 2JEJA 1HHTP 5GAEI 3BGLA 1N4LA 1S79A 2PI4A 4H54A 2ZHOA 4WE1A 3LGMA 1IKVB 4ZPVR 2VPYB 3MM8A 2G0CA 1VRUA 2R7QA 5I3PA 1FE4A 3AQOA 3ZC4A 3WX4A 5EX3A 5KFQA 3CCES 5CA5A 2CPIA 1HBUB 4U7CA 1VQOS 5KT7A 2ZITA 2W9CA 3MR2A 4KGMA 2GGPA 5IWAF 1R7IA 1REVB 2FVRA 2DNPA 1GXUA 2B4PA 4ZPAA 5I4MA 2FC8A 1HI1A 2QO3A 4DLEA 3QJPA 4DV2F 1M5OC 4OI4A 1XMQF 4ZKAA 1NH8A 1SJ4P 4LF5F 2RVJA 2KRBA 1NKBA 5KG6A 2M8HA 2DNHA 4B02A 3DMJA 1S9GB 1X5SA 2MY8A 3DRSA 5CZXA 3EPGA 3RBDA 4B9UA 4DSEA 2VA3A 2YKQA 4OZ5A 1NJXA 4B9VA 3N5BA 1EP4A 2MYFA 4ZVGA 3GV8B 1FD2A 1JLEA 1JNRB 4OHXA 2YTCA 2CQ4A 4ZPBA 4CH1A 5KFZA 4ED8A 2AJ1A 2Z8QA 1HYSB 4B3OB 2QIFA 4QYZJ 1HBNB 5B0DA 3PNIA 1YBAA 2LLZA 2YH1A 2EFVA 2BZ2A 2VOOA 4IH6A 1Q53A 3M2VA 5K5MA 3HHLB 1Q78A 1YG0A 3SDEB 3SCKE 1BC6A 1G2EA 2XBPA 3DU5A 4BDPA 3HHEA 4G6VB 1Q8LA 2EFQA 3DM2B 1A7GE 3QLHA 5E3AA 4J9KA 1T05B 1UJ6A 1Q79A 4QW9A 4JI6F 3UI3A 5LT5A 3EXYA 4I2PA 5DQGA 2ZJRQ 2C3UA 2HFOA 4LFBF 3PKMA 2EWHA 4ECQA 2PDAA 5FIIA 2LXUA 2EFGA 5KFNA 2ZKUA 3FZBA 1NHVA 1JLFA 1WG4A 4X65F 3SXLA 2HWTA 5HP1A 1SIZA 4C11A 4KRWA 1YTYA 1QVGR 4OLOA 2GCFA 3HO1A 2W9AA 4FF4A 3LP1A 4DSKA 5AXKA 4FF3A 3MM8B 4K4UA 4KJIA 3OTBA 2GA7A 1RT7A 1T3NA 2ZH3A 1C1CA 2XLKA 4LIRA 3BGUA 2MY7A 4PG8A 3BF4A 2GGPB 1KQFB 2LA6A 4N56A 3LH2S 2RF2A 6FD1A 5HMZA 3OHAA 4K4XA 1F5BA 2DH7A 1FRHA 4UQGA 2WW8A 1QAXA 3LF0A 3PX4A 4JI3F 4AE5A 2HVHA 3J7YI 2RKIA 3ZZRA 1Y3JA 3MM7B 5DGAA 4Y2KA 5B0FA 3HVAA 5K14B 2YX7A 4BCAA 1UKUA 3CCQS 4K4YA 3M32A 4J9NA 4CT8A 3DMJB 2ALZA 5KFSA 2ZH9A 1VQSA 5H1SV 4N76A 5J1EA 4M8LA 3BO2A 3MM5A 1EP4B 4Y2MA 4I67A 3HPOA 3CCWA 1JLEB 3LW5C 3T5HA 1L3UA 1U6FA 3RW7A 4B9MA 2HNZA 3J7ZT 5M2RA 3MM9A 3D0HE 3JSYA 5FDLA 4F3OA 1NJWA 3CC4S 3K8VA 1VIOA 3OR2B 3TVYA 2RIJA 3MOZA 4AYBD 1HBOA 1H98A 2HLTA 3M2VB 1LXNA 4F02A 5CXTA 4CO4A 4IFVA 2L9NA 5HMYA 2DO0A 2WSEC 4A8FA 3OV7A 2E29A 1T94A 1RKJA 2LQ9A 4RWWA 1JKHB 5LJ5Y 3QIPB 3QZ7A 5LSLA 3MUTP 1FKOA 5F8NA 2MSTA 2VL1A 4NZ6A 2HS3A 4R8UB 2B5JA 4O3OA 5B09A 3PR4A 1D9FA 5AJ3F 3GFHA 1T95A 3KK1A 2DHSA 3C66A 2MQMA 2E1MC 2YY3A 4UUXA 2R8KA 2GJ2A 5L1KA 4NA1A 3AA9A 4I2QB 3H4BA 4IYQA 1JLFB 4HI2A 2WHOA 5I42A 1S7HA 1UETA 4B08A 5HP1B 4C11B 4IO1A 3I0RA 5I3QA 3I87A 4DL7A 4KKOA 4XAKA 3GFZA 1QAYA 5DG8A 3K58A 1DLOA 3DRYA 4FNIA 2PSZA 3AY0A 1XC9A 3O3LA 4ECZA 3KJVA 1MROA 1RT7B 3UDLA 3IXQA 3TR5A 4Z2XA 2HW3A 2FJDB 1KQSR 5KFFA 4DR3F 1JXEA 2XMTA 3JSRA 3NAHA 4P7VA 2RF2B 1BLUA 3I5AA 3LP0B 3RZAA 3M8RA 2HAIA 1Y4ZB 4IR1A 3TW0A 4NA3A 2NREA 1G1XA 2HHUA 3VZHA 4OIXA 3KK2A 1T7PA 2HMIA 3HJFA 4ZPTR 1FRIA 2RS2A 3M32B 2WONA 3GILA 4XO0A 2KI2A 3JSBA 2AYGA 3RR7A 3IG1B 2L48A 4LSNB 3EZUA 4ELVA 3MM5B 2YNGB 5E33A 5KG4A 2CQ3A 1HNIA 1VQNS 1SJRA 4JI2F 1VHFA 1TV6B 2CPDA 3BS9A 4LVOP 5FDLB 1WHXA 4DDFA 2VFSA 3M6UA 4K50A 4Y00A 1HW8A 2KYXA 3QAUA 3OPKA 5D6GA 4J9OA 1HBOB 2R7OA 1TL5A 3CSKA 3B4MA 4RBUA 2N3OA 2EFPA 4EGLA 3CF5Q 2M8DB 3DDNA 1JIHA 2CQ1A 1YJUA 4O44B 2D9OA 5JJBA 4W90B 2K7KA 1VIXA 3VAHA 2B9XA 4OX6A 1F2GA 1ZPWX 4CO1A 1PILA 4X4PA 2QV6A 2MB0B 2VBYA 1VMBA 2IM2A 1G6BA 4QR2A 4DUYF 3OSNA 1KRPA 3RW6A 2B5JB 2RU3A 1NZAA 2YX4A 1JLGB 2FLOA 2JC0A 4BC9A 1ZZNA 4EU0A 2KJVA 2E7XA 5D4LA 5CYJA 2MJNA 5GVQA 2VKRA 2M2BA 3H5UA 4YQWA 2MPUA 3QIDA 4RBVA 5A6WA 1QVFR 4OHVA 1XN9A 3Q8SB 3CMES 3NNCA 2RQ4A 5B08A 2CJ9A 1NJYA 1DLOB 4N5SA 3MEKA 4KHRA 1W2BR 3RB4A 4NYOA 2ZD1A 1FJEB 2HYIB 1MROB 2KZMA 1HWIA 4OZLA 1X4GA 2Y1IA 3HVTB 3H2LA 1S0VA 1S1UA 2LCWA 4ED0A 4U6PA 2GO9A 2IM0A 3QGIA 2QMXA 3GQCA 2CJKA 2C22A 2JC1A 4ICLA 5KG3A 2BVZA 4WK1A 3UW1A 4DEZA 2VUGA 1VJWA 1P6TA 2JL9A 4O3SA 2G4BA 4NWBA 4EBDA 4EYIB 5KT6A 5L8RC 1OSDA 1UFWA 5E41A 2B56A 2ZHBA 5F8MA 3T3FA 2HWIA 2V5HG 3CO9A 3BQ1A 2LYVA 2XS7A 2JHEA 3BDEA 3D0GE 2CZ4A 3M2UA 4RW4B 2V2KA 1JLQB 1NK9A 1NJIT 3X1LB 4ZLPA 5KT2A 2FJBB 3DOMA 2I0XA 1HNIB 3DDKA 3J7YU 2HLUA 3S01A 2VB6A 4ZP8A 2ABYA 3W3SA 2MZ1A 2FVCA 3I9ZA 3O5TB 2ZH8A 1RT5B 2IBKA 2CPXA 4M95A 2GIRA 1RT6A 4Y2CA 2A2DA 5FD1A 4IG0A 3JYTA 1S10A 2V8DA 3OFEA 4C0HA 1LWFA 2KHCA 4IR9A 1S1TB 4WFYA 3OLAA 1R6YA 4XDDA 2D3OR 5THWA 2ZH6A 4JI1F 2XMMA 1N88A 2PIIA 4KB7A 2L9DA 4B9LA 3TVZA 2JFDA 2O66A 1HL6A 4MK8A 3UCZP 1Q7YT 4O3QA 4ID5A 4GKJF 4HT5A 3OFHA 1O0PA 1GX5A 2ASDA 1ZZFA 3HZEA 3OUYA 2F40A 1H7WA 3QGPA 3NWGA 1UVJA 2DGXA 2GHVC 2DPJA 2IJNA 3GIIA 4EBCA 2ZNYA 2HVIA 2ZDOA 2AU0A 1S6UA 4QIWD 1FNOA 3IAS9 1WACA 3FRYA 5JVGQ 1YJNS 5KT3A 3OJSA 4BS2A 1RTHA 2PMZD 4LF4F 4DSIA 1S76D 3MZIA 1HWUA 5HN0A 1P27B 2GQQA 2EPIA 1RA6A 1M5PC 1UP1A 4ZP7A 1NK6A 2UUBF 4U7UK 5BYSA 1VQ6S 2CPZA 2YKNB 3PJWA 1S1UB 4IG3A 4RW6A 3UR3C 5J2NA 4C4WA 2RILA 2H5EA 1RTIB 2YX1A 2ROPA 5IM0B 2J6TA 4NLQA 3P6YC 2GC8A 5DDRC 5KFBA 1R8CA 3POTA 2CRLA 5IQ6A 3G6ES 2EC0A 1Q16B 2BW2A 3HHNB 1TAQA 3K5PA 1LOUA 4ZVFA 4PWDA 2GMLA 4DF4A 3N6NA 1JXLA 1M90T 3CDUA 3CJKA 1FERA 2XNQA 4G1QA 3HP6A 2OAUA 4OQJA 1H38A 3M2UB 1RT1A 2QZ8A 1HPZB 2OIHA 4DSJA 1D3WA 4GC6A 4CCHA 1HNXF 3IC1A 3LGNA 3M30B 1NB7A 4FF1A 2J0WA 4KV8A 3Q0AA 1FF2A 3NNHA 3D1HA 2IMWP 1U4BA 1TUVA 4PG5A 3CB4A 2BQUA 2P9CA 2OFHX 2FHKA 2E1RA 3JYTB 3CJ2A 2LECA 4LFCF 1N34F 1LWFB 4O23A 5KFTA 1HI8A 5IT9Y 2N82B 2PE8A 1D8YA 1LFWA 2DNLA 2UUCF 2VD3A 1RT4A 2QSFA 3MM6A 3V4IA 4X4VA 4KE5A 2HFNA 4F50A 5AE1A 5I3UA 1YVFA 2JFKA 3HLUA 3CCUS 4A8MP 5CZVA 4JBCA 4PCQA 4Q2MA 2W8LA 2J0XA 2ZC4A 1RTDA 3NMRA 5T41A 3I5CA 3TUZC 1O8BA 4I7FA 2V0NA 5GAGU 1XMOF 4IO9Q 1ROFA 1N5TA 1KOHA 1N5SA 4NCGA 4Y3CA 5C5JA 3PW4A 4O3RA 1H7XA 2KYZA 4FZVA 2MHNA 3I82A 3RB3A 3E2EA 3JTPA 1QY7A 4Y2IA 1FVSA 3DI6A 1AUDA 4C7QA 3CD6S 2NQPA 1F0XA 2AF6A 2C3PA 2AV5A 3DLJA 3TUJC 4X4TA 5HBMA 1MWZA 3KWMA 1SJFA 1S97A 1NKEA 4IRKA 4KO0A 3GSDA 3V5RA 2MZRA 4GMKA 2HHPA 2V4JB 3T1HF 4LF7F 4RW9B 5J2MA 3OJUA 3U1LA 2QYCA 2MZQA 4UUWA 3J7Z5 4PWDB 4HDGA 4TQSA 2W4PA 3FSYA 1TKZA 2QRRA 1S6QA 1WG1A 5CYQA 3G96A 2JLFA 5KFMA 4QWDA 2V94A 5HQ8A 2VPXB 3CJKB 4V19J 1HNZF 2IA0A 1KTVA 1VS3A 3V4MA 1LW0B 1RT1B 1RWUA 4ILRA 3TP2A 3WC0A 3I0SB 4TKTA 3CD5A 3OTEA 2R7RA 2B7BB 3N6LA 2XS5A 1FDNA 5F41A 5CH7B 4DR5F 2YNHA 4KV8B 3M8QA 1JLAA 2XI3A 3UR0A 3NGDA 5J2QB 2XY6A 3UCGA 4DL4A 4NLYA 1NO8A 1SB6A 4NLVA 4DN0A 3L95X 4MJKA 2C3OA 4K5RA 3I96A 2ADBA 2MMYA 1S4FA 3L7PA 2ZC3A 4O3NA 3BZQA 2RRAA 1XR5A 1WHYA 2DCLA 3QGGA 4XK8C 4DS5A 1HQUA 2LDIA 4OZJA 3CPWR 4URQU 4ECWA 2CQIA 2BJEA 3AHPA 4TNOA 4OI3A 3UCUP 5KFOA 1Z2LA 4DV4F 5DGBA 1ZM4A 3EPIA 3U02A 4B3TF 5I3UB 2KFYA 2CQPA 2VC1A 5BYRA 1KLNA 4XPCA 1NEEA 2V8VA 3VALA 2E5HA 4KT0C 1FXRA 2AJ4A 2E44A 2OTJS 4NZ0A 2ZH5A 3N4WA 4I7FB 2YNFB 3DNCA 3KLVA 4ED1A 4J37A 3DRPA 1URRA 3O6QA 3MMJA 1H3DA 3N9UC 1DTQA 1V3ZA 3NS6A 1RQ0A 2WSFC 3DLGB 1N48A 4WCEQ 2B43A 1CVJA 3LOUA 3AH6A 1KEKA 1R0AA 4A8YA 1UEUA 5KFDA 1X7VA 5F0UA 2KZZA 3BREA 4H4OB 5HBMB 3P3DA 1H0HB 2AWZA 1KQKA 2JLGA 2XGPA 4ZHRA 2FD2A 4C8MA 1FNMA 4J9LA 5C24A 1QAIA 1JLCA 1RK8A 5EHHA 5J2MB 4B9SA 4C8LA 4C8YA 1FE0A 1R43A 1TL4A 2OPPA 4UQTA 1N52B 1TKZB 4QU7A 2RQCA 2R2TA 1I6JA 2P6TA 3ITHA 4ITSA 1NAQA 1VK3A 1DTTB 3K7RA 1VC5A 4M1KA 4RNNA 1B0VA 3KLGA 1TL3B 2ROGA 2YNIA 1FK9A 4DPOA 1X4DA 1NHUA 2YNHB 3F41A 4PXCA 1JLAB 1P8GA 1SH2A 1R3NA 3O2IA 4QBUA 2KG1A 3VWSA 4XDCA 1S0OA 3FFIB 3TI0A 2NUHA 5F0WA 3RR8A 4NRTA 4Y28C 1OO0B 4WTYA 2RH3A 2O5DA 1LXJA 3PO5A 2MKKA 5L9NA 4DWIA 3B78A 4IRCA 2JJ4D 5F8HA 3KHLA 4IOCQ 3PW7A 3DRXA 2F1FA 2PD1A 4QWBA 5BJRA 2JEIA 4MYTA 4L72B 1S1XA 1R89A 2I5JA 2R8GA 2E1AA 7FDRA 4CH0S 1VGYA 1KHVA 3PHEA 1HBMB 1IXKA 1C2PA 1V9OA 3CCTA 3F56A 5D3GB 1BQMB 1XNQF 4F26A