4RBTA

Pdua k26a s40l mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGLGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Propanediol utilization protein PduA
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 22
structure length 89
sequence length 89
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbtA00
3IA0A 3CGIA 2A1BA 4OLOA 4OX6A 5DJBA 4DDFA 3I96A 2A10A 4P7VA 3NGKA 4OX8A 4P2SA 3SSRA 3VCDA 4OX7A 5L38A 4P7TA 2G13A 4AXIA 3N79A 2A18A 4PPDA 3CIMA 4QIGA 3PACA 4AXJA 3MPYA 4RBVA 4LIWA 3SSQA 3DN9A 3SSSA 3H8YA 4QIVA 3BN4A 3MPWA 3DNCA 4RBTA 3I6PA 4RBUA 3NWGA 4OLPA 4QIEA 4QIFA 2EWHA
chains in the Genus database with same CATH superfamily
1W25A 3LGNA 3N4WA 2WRMA 2W7PA 2UXBJ 3KDNA 2ZITA 3UVJA 1QY7A 3I0SA 1LWEB 1OPIA 1NUEA 4LF4J 3AOCA 1XNRF 5F8MA 2HQFA 3H0PA 4R8UB 4IOBA 2JOQA 1R43A 2E5LF 3HK2A 2FHJD 1NK4A 3DKDA 1WOOA 3DXBA 3OFHA 2LKZA 1NK5A 3QSIA 3AJDA 1OO0B 5CYQB 2BEFA 4B9VA 4C8YA 2NUHA 4OMFG 4PR6A 3HSJA 2CJBA 4NMXA 2CPYA 3M9MB 4LSNA 2BZ2A 2I38A 3NKYA 3VGTA 4IFYA 3NY0A 2FZCB 4ZCLA 3M7VA 4RLEA 4MT1A 3THPA 1LWCB 2H9ZA 4LBPA 4EMDA 1N34F 3JYTA 3IWLA 2UUBF 3RB3A 4YMEA 2D9OA 3S1TA 2PFFB 2MSSA 1V3RA 4ES3A 2VKZG 1X31C 3HHLC 2RVJA 4R0JA 1JXLA 1PO6A 1KLNA 4I6WA 3QT6A 2CDQA 1ROFA 2KU7A 1MSWD 3O6QA 1FNXH 1F2GA 1H7XA 1WG4A 3BSAA 3ELHA 2E7WA 4ZPDA 5HP1A 2NYIA 3EXCX 3QWPA 1PJ6A 3JTOA 1NK9A 3OUYB 1KD1T 2OPSB 2CPDA 4LBIA 1WF2A 1TMJA 4HYKA 1FK9A 1NMEB 3OFFA 5IOLA 3GV7B 3H20A 1DTTA 4KGVB 2OEMA 1R0BG 4U9RA 5JXSA 5A6PA 3PW2A 1KHWA 5CCMA 3AXMA 2V2QA 2YX1A 4HVZA 3SCLE 1RHRB 4M5IA 4CYUA 3CJSA 4NLDA 1UA1A 3NL0A 1B3TA 2XMMA 4C8OA 3I56S 5GVQA 4WTOB 3MEKA 3NCRA 2N7CA 1AZSB 3KYLA 4CTAB 1WC4A 1X0PA 5A8RB 2A0FB 3MCMA 4NLVA 3I87A 4ECQA 3MR7A 3KFWX 4LREA 1YRUA 5KOWA 4DV6J 4AE5A 2KZZA 2XGPA 4LFBF 2E9RX 3I31A 3QJLA 2V67A 4N76A 1HNVA 3PV8A 2JHEA 4MYTA 4FKXA 3EDRB 2WONA 5LSOA 3ZNJ1 3NGKA 1HQUA 2BQRA 1AFIA 5AE1A 2IDEA 4BS2A 1Q82T 4G1QA 1RK8A 2WVEA 4AUKA 4MKBA 2EK1A 2CA9A 4I2PB 4A47A 1B0TA 4PEOA 3P96A 3V5RA 4Y0FA 4DPWA 4X4VA 2PI5A 4WTYA 4DL7A 1AW0A 1Z2ZA 3KLHA 4LRAA 5EX0A 1S6PB 3DN9A 4EO8A 3SYZA 2JDJA 2MYFA 2MZJA 1W2BR 4PG6A 3T41A 2P9EA 4OX7A 2KN4A 4NCGA 1LWXA 2QL9B 2UV8G 2MZTA 1W2IA 4PXEA 3EZOA 4KH1B 1JK9B 3LP0A 3T6JA 2VG5A 4YFUA 1RQ0A 1PSDA 4X66F 4LSLB 2ZH8A 2ZD1B 2HZVA 3FEXB 1LQ9A 3P8BB 4JI3J 2VFVA 4J5OA 3G8SA 2RKIB 1VQMS 1Y5IB 1TU0B 4DU8A 4R5PA 1YGYA 2FGOA 1M5VC 2L9DA 1FESA 1DTQA 4OYBA 2KM8B 2CYYA 1YZ6A 2J7WA 2XSJB 1RKIA 1SIWB 4ZK7M 4DR1J 1X9SA 1EJ7L 3D6MB 2ZBCA 4RW7A 3LP2A 2DRDA 2OIHA 5A8KB 1TR0A 1PYSB 3US5A 2AJ2A 2IJFA 1SKSA 2CQ1A 2FJDB 1VRQC 3NXZA 4FVMA 2CPHA 1F6TA 2I8EA 3DI6B 4TY8A 1N32J 3VZHA 4ZVEA 4MKYA 1RE1B 3K5PA 2V8GA 1HD0A 1HPZA 1H0HB 2ROGA 1RISA 1JJHA 2JEFA 2WB1D 2EFOA 4GKJF 1Q78A 3VAHA 1HI1A 5C42B 4J9OA 1KNZA 2AU0A 2HHPA 2IM0A 4KT0C 1C0UA 1C1BB 4I56A 4F26A 1CULB 2NQPA 2DHSA 5DG8A 1S97A 4KBIA 5SZTA 4PUOB 2HNZB 3UDCA 4QIFA 1NSKL 3NRBA 3R5AA 4BCAA 2CADA 4DWIA 4KH0B 1S6QB 5MAOA 4WCEQ 3GG1A 1PAUB 5CYJA 2DR8A 2M3DA 4KFBB 3E01B 2YKAA 1NSQA 3SCKE 3GIMA 1U6ZA 2MQLA 2KO1A 4NLPA 1U1KA 1TK5A 1SL2A 4F2SA 1N0UA 3KHLA 2M8HA 3QIPA 1X4DA 3CJTA 3QAEA 4C11A 4R25A 1PBUA 1KFDA 1UPMB 2E1MC 2GHPA 4MKVA 4JUZA 4B3TJ 3NGRA 1RHMB 2Q6BA 5CABA 2XMAA 1CJUB 3M6VA 4ZIVA 1L3UA 2ZKUA 3IR6B 3RR8A 4B9LA 4WF9Q 3ETOA 3E8OA 4USVA 2RRBA 3SMZA 3WC0A 1MN9A 1XK8A 4OV6A 3GR1A 2OD6A 2E29A 4KHPF 2BJ9A 4ZJLA 1W26A 3IMQJ 4CM2A 1ZM4A 1Q53A 1TK0A 3L7UA 4I68A 3NBPA 1N5YA 3O8WA 5AXKA 3I5AA 3VAKA 3FEYB 2BW2A 2F40A 4ZVUB 1NJZA 4C3KA 2N7YA 2VFUA 3AB4B 3UVJB 1UMJA 2RE1A 3I0SB 3UDEA 2I6WA 2ACMA 2VG6A 3PTWA 2DR5A 2W25A 4CLUA 3GB0A 2HHWA 1MU2A 4DN0A 1MN7A 4X64J 1LWFA 1HWKA 4JI4J 4USJC 1IWGA 1TKDA 2HBZB 4YR0A 3L95X 2EC2A 4Q5VA 4LUBA 1ACMB 5DG7A 4W98A 3CD5A 4QW8A 4NWBA 4ID5A 2VBZA 2H1YA 4RX6A 1RWNB 2DGSA 3CJ2A 4LF2A 5HMYA 2LXIA 4LSNB 4DFPA 4IFYB 3CDAA 2B9XA 3BKTA 4DR3J 1J5EJ 5LXYA 2ZVSA 2KJWA 4BBYA 3IGNA 4I1TA 3JYTB 5F0UA 4V1Ak 2DR6A 5HAOA 3HP6A 2VG7B 1I94J 3MCSA 4A8SA 1D8ZA 4NLTA 4FKYA 4K4WA 5ETTA 4YY3J 1QAIA 4KY3A 2CJQA 1PCAA 2V9WA 1BD6A 5ETLA 4ZPBA 1IKWA 4DDFA 2GHWA 1TUWA 2EKYA 1Q8KA 1QLNA 4OIXA 2DNYA 3TWZA 3CF5Q 4RWWA 2GJFA 1IBLJ 1BMQB 5DM6Q 4DR2J 2HSEB 3OQ2A 1FK9B 2AJ0A 2MDAA 2N4CA 3DFEA 1DTTB 3TAMA 3ZTRA 2OJ3A 1FD8A 1ZAWA 3RBXA 3NOCA 2RQKA 1NB2A 2XCAA 2IIHA 1UW9A 2CJAA 4CYUB 2UVWA 4LF1A 2CJ9A 1S6UA 4P75A 4ZVHA 5I3UA 2BANA 1UKUA 1RI7A 3OXGA 1N88A 2RB7A 3HT3A 2YNHA 3UO0A 5GMKa 2MQQA 1TFWA 2LDYA 2LQ8A 1XR5A 1FWLA 3NLCA 4JI0F 1GMUA 5DDQC 2O3DA 3A12A 1I51B 4LF8F 2IVFB 4FXDA 5D0HA 2XHWA 1HNVB 3M30A 3J81j 3IWXA 1K1QA 5KFNA 1SKRA 3I32A 2WONB 3DU6A 5KT4A 2GVDA 5DS7A 2VICA 2MB0B 4BDPA 4G1QB 2KT3A 1QSSA 4FNHA 4TU9A 4OLPA 3W2WA 9RUBA 1Q79A 3IWNC 2HWTA 4AL6A 4CLPA 1Q1KA 2QA4G 4DR4J 3KLHB 5SUHA 1WG5A 3PACA 1BE4A 2VQEF 1LXNA 1Q8LA 1RWWB 4CLWA 1SIZA 2GJ2A 4JI1J 4JYAJ 1JLEA 1RDRA 3DM2A 3CJ4A 1DRZA 3VALA 3MPVA 4NCGB 3DRSA 4M5MA 2HQ3A 5LMNJ 4CLSA 2J0QD 1B0PA 2K3KA 3LP0B 4I64A 3H40A 1FTCA 2MKSA 2VG5B 1IJEB 2A2CA 3LWMA 1ZETA 1ZAVA 5CAAA 3NWRA 3HSZA 2IMOA 4M1KA 1GTEA 3TP2A 4K5RA 2M70A 4CQ1A 1C1CB 4R5PB 4EYIB 1S79A 2BX6A 1DTQB 4NRUA 4DCOB 1H6KX 4OZ1A 4DN9A 1NDPA 2DGXA 5E2QA 3MUTP 3DCAA 2NPFA 2BW7A 4RW7B 3LP2B 1XN9A 3BDPA 2RIJA 3AT1B 3SQOP 1S59A 3NS7B 2MQPA 2RU9A 3Q8QB 4RUBA 3P5TL 1S77D 3MZIA 4ZVQB 4DUYF 4HTJA 2RD5C 1FERA 1P1LA 2QRRA 4TY8B 1IWAA 2CQ0A 4C9DA 4DXLA 1NJIT 2IYGA 1HPZB 1Y3JA 2PO4A 1OWXA 3NS5A 4A4JA 2QZ8A 1XMQF 1EQMA 3I5BA 3IM9A 2R3VA 5KT6A 2APOA 3NGUA 1S1VA 2CQBA 2KB2A 3PW5A 1SJFA 1C0UB 4U7UD 1KRPA 2W2OP 4RNMA 1NHVA 1IBKF 2F7VA 4B9UA 1VRUA 3D5MA 1WJ9A 1JQGA 3T1HF 1K0VA 3DLKA 3MHYA 3Q24A 4O3SA 4ZLLA 3W65A 2E1PA 2P2CB 2C3MA 4DQSA 1APSA 1CEZA 1M1GA 2XEXA 3CCQS 4ECTA 4DPOA 1F60B 2YNIA 2C42A 5CYMA 4LF5J 1T7PA 4NA2A 4KB7A 3NOGA 1X9WA 3U7JA 2QIFA 4NZ7A 3MR3A 1WC6A 2IVMA 2Z2ZA 2YKOA 1N6QA 3R6GB 3QIPB 1RU1A 3PEJA 4C11B 1S9GA 4ZVTB 4DSEA 3C6TA 4OZ2A 1KONA 4H4OA 5H9EK 4QIVA 5B09A 3BV8A 3X1LB 4PXDA 4ZVGA 4IRCA 3FVYA 2UVRA 3Q8YA 1MROA 1NB7A 3FFIA 1MW7A 1WWHA 3SQGA 2HHUA 3CCZA 4ZP6A 1FTRA 4ILRA 1OIAA 3N6NA 4H4MA 1EZZB 4HEA9 4N41A 2NUUG 3AOAA 1XWLA 4I6YA 4CWBA 5AJ3F 3NBPB 1N5YB 2GO8A 1YJWS 2ZBPA 4DQIA 1NJWA 4OI2A 1QAXA 3LO3A 1SJQA 3KHGA 5HBMA 2ZUGA 1LFWA 3JQKA 3BGLA 1GXUA 3K59A 2VG6B 4CO4A 5KT3A 1MU2B 1AA1B 4C6AA 3DDKA 4A8YA 1M5PC 2RUGA 1LWFB 2Z58B 1VLYA 1U47A 1HL6A 5F3TA 1SJRA 5EUHA 1D3WA 4LF7J 2DGWA 2JFDA 1R31A 3A4TA 2IDLA 3ZO7A 4ID5B 3OTDA 5BR8F 4H4KC 3IBCB 1N48A 5HN0A 1IBCB 1IVZA 1HHTP 4ZVSB 1XMOJ 4CLKA 1S0VA 2AP6A 3R7BB 3TZXA 2QYCA 1HR0J 3A8IA 2QMWA 4LVOP 3FQLA 2UXDJ 3SSRA 2G0JA 4MK7A 4WFZA 1KSPA 3FRYA 4FYDA 2CVIA 1BQMA 1DQ9A 2DNHA 2ADBA 4JI5J 4DSJA 3CDBA 2CVEA 1QDUB 1DHMA 2VKRA 5L38A 4RU2A 3CCJS 1KQKA 4K4ZA 3ZTPA 3PO5A 2GIRA 4WYWA 2MQOA 3PX4A 3UI3A 1VJWA 2N3OA 2Q66A 2YWHA 5KFGA 1IKWB 3S7RA 4WFYA 2DNLA 5BYQA 2BVZA 1KVKA 2XMJA 3AHPA 3F41A 1WHYA 3RUBL 4OL8A 3DRRA 2W1BA 4DG1A 3U1NA 3NAHA 2ZEJA 2DGQA 3ITHA 1M0SA 1RUSA 2DH9A 3T1YJ 1KKHA 4UQGA 5D6GA 3H90A 2NCKL 1OY9A 3OV7A 4B3MF 4DLGA 1IR1A 2E5IA 2JJ4D 2C3PA 4TYBA 4UY85 5I3UB 2BANB 4C48A 2PE8A 4ZS6A 3R7SB 5KFZA 2YNHB 2QV6A 3M2RA 4KJIA 1NAQA 3M30B 3C46A 1HFEL 4WWSA 2HAIA 5CCLA 1S1XA 1VQ6S 4QWCA 3HMJG 3FC9A 1U2FA 1V3SA 1RKJA 1YVFA 3PW0A 4OYAA 3R5BA 4ZHRA 2J6SA 3OR2A 4NLQA 2ZDOA 2WB4A 2LXUA 3W2WB 1U1LA 2RHSB 3X3UA 2PMHA 3GV5B 2ZH2A 2LA6A 2AGPA 3D1QA 1N54B 2ATCB 3EUNA 3B4MA 2K1RA 1KS2A 1VQSA 3P6YC 2IAJA 2HHVA 1T95A 5JJBA 1FO1A 5L39A 2VBXA 3DRSB 2HHHJ 4QZVB 1IM6A 2DHGA 2FJAB 3R5GA 4JV2A 4EBEA 1UJ5A 1LK5A 1CSJA 4BWJA 2J6UA 2KT5A 3HLUA 3TAQA 4K4TA 1SC6A 2EK6A 2PDAA 1D09B 4IOCQ 2LVWA 2MJNA 1UW4A 4O3NA 3SXLA 2OPRA 4DZDA 3H2VE 1M5OC 1RAEB 1RBLA 2W2QP 3N28A 2XLJA 2ALZA 4CP5A 3BDEA 2ATLA 5KT2A 1Q5VA 4O44A 4DV3J 4KQZA 2J9EA 1SC3B 5I4MA 1HI0P 1S6OA 2DB1A 1NPKA 1WF1A 3FRZA 1UETA 5HANA 3QATA 1X4EA 3AD8C 3GFZA 4GO7X 1U1NA 2BM1A 3I0RA 2V50A 1UFLA 1HNZJ 2MQNA 1ITPA 2QFIA 3HDSA 5JUMA 1N33F 1OYDA 4O3PA 2V2VA 1SJ4P 5KAKA 4ZVOB 2UV8A 3D6HB 2ZH9A 2DCUB 4OHYA 1TUVA 1QAYA 1S1VB 3HD2A 2I5JA 2BV3A 3H25A 4YB7A 3HX9A 3TVKA 3QJJA 4NXMJ 3HVTA 2ZM6F 3OW2R 3AFGA 5KFQA 3CUNA 1VRUB 1V6HA 1U7LA 3AD7C 4FYYB 5B0BA 1TAUA 3DLKB 1U1MA 8AT1B 2C3YA 2QMUB 3F44A 2ROPA 4ECZA 3WHIA 2BE9B 3RB6A 1FHTA 4B9MA 5CYMB 3DDIA 2FDNA 3R6LB 4WXOA 1REVA 2JLFA 3EPIA 2D3O1 1YKWA 2AEFA 1N6QB 4UF4A 1IQTA 3TVZA 3OJSA 3KLEB 1S9GB 3BJYA 2W7OA 4C7QA 2YKNA 2Y3YA 1YRXA 3GTYX 3EGZA 3C66A 2GVZB 1SPBP 5KFHA 1MROB 5E0OA 3ETMA 3FFIB 5KFAA 1JXVA 5CZVA 3W8PA 5FLXU 3SQGB 4RBTA 3GJRB 3T19A 3CCMS 1QSYA 5IWAJ 4I4BA 1LW2A 1E6YA 2Y8YA 2I9SA 1S57A 3VVTA 4ECUA 1NSAA 3DC2A 4KPYA 4H4MB 4LFAF 1C4CA 3ZZRA 2IFXA 1U2CA 4OQJA 4CLLA 4NZ0A 4J9KA 3SCJE 3TA2A 3O2IA 2WOMA 2GMHA 1YI2S 1UEUA 2OO4A 3FMBA 5HBMB 2E1RA 3H2LA 1OSDA 2B9YA 1KVJA 1FVSA 4JI6J 3GU0A 3JSBA 2XGQA 1FJGJ 3MEGA 2A3JA 2BACA 4H54A 5J2PA 4DR5F 5K9FA 3CJ5A 2HVEA 4PWUA 3ILJA 1T9VA 2XULA 3BQ2A 4QYZK 2H51B 4Z2XA 1R6YA 2QLJB 2RF2A 2HVIA 5KFRA 2GZOA 3DMJA 3MUMP 4TU8A 3O3LA 1XBWA 4HI2A 2CWKA 2O66A 2C2DA 4ANDA 3JSRA 4JP8A 4CH1A 1U1QA 5HJYA 2DPIA 1YJNS 4PWWA 4NXNF 1BQMB 4USWA 2KM8C 3TUZC 4XPEA 2YPYA 3W61A 5E3QA 1TV6A 4WKRA 4ZMMA 1HW8A 1X60A 2DKOB 2Q6CA 5G0RA 2B4OA 5GADU 4DSKA 4M5NA 3M8PA 1RWXB 3MMCA 3ZXWA 4WK1A 2R7RA 3RYLA 4Y28C 4KO0A 4OYXA 4KE5A 1R6VA 2KH9A 1G7CB 2DH8A 3S01A 5FLXY 1HHSA 5LT5A 2DVIA 1HNWJ 4NLRA 3Q0AA 4OJGA 2EKNA 3D3CJ 3K0JA 4DI6A 1A0OB 3DRRB 3OT9A 2R7VA 1BWVA 4DG1B 3Q8RB 1VLOA 3FZ2A 2KKHA 3Q8PB 4F4ZA 2Z0GA 4Q2MA 2RRNA 3ITHB 1XNRJ 1RHUB 1EHWA 1GFWB 4YB1P 4UOGA 2YWEA 2E5LJ 1SL0A 3VAMA 2G1DA 1RTIA 5DDRC 5E5NA 1U1RA 4C8NA 1D9AA 1GXLA 2YQ3A 3I4PA 2OSRA 3A3PB 3QGIA 5J1NA 5LMUF 3J80U 2IRUA 2W9CA 5DGBA 2MMYA 1S99A 2FHKA 3M2RB 2KYZA 2Q1LA 2O67A 3CC4S 4UZCA 2W7AA 2ZH6A 1KLMA 3Q8SB 2FQQB 3CJRA 1CJKA 2ZHOA 1N34J 1RJJA 3LP1A 3PIOQ 2UUBJ 1FWPA 1SV5A 5D4NA 4F7VA 4WFNQ 2BQUA 2DNMA 1ZOTA 1TL3A 1EP4A 5GMEA 4K5SA 5F9LA 2PT0A 2DGVA 3IN5A 4ZHRB 2VF3A 5KFWA 2J0XA 2HWIA 4Q0BA 3OR2B 4MIWA 4A8WA 4AYBD 2QSWA 3R27A 3N5FA 3TQEA 5ETSA 3TZZA 3QBCA 4JB8B 1UEKA 1F5CA 3QRQA 3NNHA 2IJNA 1F5AA 2JEIA 1ZA1B 4ED5A 3AA9A 1RTDB 1VJQA 3GQCA 1VQYA 3W66A 3AAWB 2K1RB 3AOBA 3MPWA 4ED4A 3K5OA 2MKIA 1VC6A 3D1OA 4HKQA 2IAJB 3V2UC 3KUGA 5CXTA 4LR8A 1AROP 1Y9OA 3UWTA 3P5BP 2K06A 1U25A 5LJ3Y 4RKUC 5B0GA 2BXJA 2XNRA 3BGRA 4EGLA 4A8QA 5KG1A 2J6TA 1VQLS 2CZ4A 3QFHA 3BO4A 4ETXA 3TZWA 3UN5A 3K58A 2FYXA 1RAFB 4PKDB 3QRRA 3F0NA 2VQFF 4JV1A 4QR1A 3ENWA 1SCJB 4PG5A 3KHHA 2W01A 1WHVA 3H42A 4KTQA 1WTBA 3NAIA 1VBXA 1F9FA 2C2MB 4O44B 2QC3A 4H4KA 1H2VZ 3QT7A 3J80Y 4F4AA 3M8YA 3HO1A 4CNZA 3FCHA 3DGVA 4WP8A 4IUFA 2J7KA 4CH7A 1JWWA 4ZDNA 2K7KA 2QT7A 3I0RB 4NYPA 1JB0C 2FJBB 5DQHA 4Q7AA 3ZZPA 2LLZA 3VAGA 1UZHA 5DDPC 5CD4A 3GYNA 4M5HA 4AXJA 1JLFA 2CNNB 4LIRA 1T11A 1WC5A 4ED6A 2I5JB 4Q43A 3HCXA 2HFZA 4PAAA 4Y2AA 2G2ZA 3HVTB 4K4VA 5F8NA 4EBCA 4P9SA 4DS5A 3VV2B 2DIUA 2QMXA 3MM8A 2LEBA 2VASA 4C4WA 3CCVS 2F5GA 3RAMA 3FSYA 2UUAF 1SJ3P 1UJ4A 1URRA 5E3PA 3TX8A 4B3RF 3AQOA 2C28A 2OTLS 1R8CA 1REVB 3NWGA 4F50A 2QLFB 4UZBA 3MD3A 4B9TA 2HYIB 2VUGA 4K4XA 1RSCA 3CMAS 2YKNB 1N5TA 2AYEA 1I6JA 3OL8A 2CZVC 3FSIA 1X5TA 5DETA 3ZZUA 4P72A 3BH7B 2W2MP 3CJKB 2VJUA 4GKKF 3QQCD 4DV4F 1FE0A 3HVAA 4GRSA 1LW2B 1E6YB 2C3UA 4K0KJ 3ZC4A 2B8PA 3EVMA 5H1SV 3PRDA 4FXVA 5AXMA 5D3GA 3BN4A 2ZJRQ 3R5DA 2GO9A 2M0GB 2F63A 4GKJJ 2WOMB 2C2ZB 3FK4A 3EVOA 4MIAA 5EWEA 1YX2A 2C2RA 3B54A 4LJMA 4EWTA 1RT6A 1YQHA 2IPOB 3L7OA 1UZDA 2E5HA 2AT1B 3VGUA 3MEGB 4K2XA 2QJ3A 5J2PB 5CA5A 1JJ4A 3HJVA 3KNGA 4IH7A 1DY3A 4TXSA 1Y3KA 4NLWA 3ZZZA 3K89A 3D6TB 3AJ1A 2RF2B 1QVFR 3DMJB 1VCTA 5HMWA 2CPFA 2B6AA 4MMOA 2V4RA 3OLAA 5F8GA 3D67A 4NZ6A 2BMBA 2XYGB 3HJFA 5D8HB 3CCTA 3W64A 3WX4A 2Y0SD 3JSMA 4OYOA 1IKXA 3H5XA 1O0PA 1RT3A 3B4DA 1SB6A 3PNIA 1JXEA 2X1AA 3IP0A 1D9FA 1DLOB 3OPKA 3KK1A 4M95A 1KQSR 1TV6B 4J9VA 2QO3A 4FDFA 2LP4A 1S1WA 5LM7E 3ENAA 3EVWA 5B0CA 1CJVA 1Y5NB 1U48A 1TL5A 4C3LA 3FBEA 3L4BC 3MMCB 2X1FA 3WX8A 4KO0B 2BE2A 1ZM3A 5K8MA 3RB4A 2GW8A 1LNQA 3CJ0A 4DFKA 4ZKAA 3AXKA 2B9EA 1VQ5S 1KHVA 1SUQA 3BSCA 3MDFA 1PKUA 1X7VA 8ATCB 3IAS9 4NA3A 2V2ZA 2LMIA 3DXSX 1S4FA 5A8WA 3CDUA 3C15A 2W9BA 3TARA 3SIPB 2ASLA 1RTIB 3VGSA 1HNIA 5DLFA 5HQLA 2N4DA 3V4IA 3QGGA 3MR2A 3WZ0A 4F02A 4J7CA 1BQXA 4ZCKA 3LF0A 4OHWA 1L3SA 3QIDA 3DLBA 1RHQB 3C14A 2DYAA 2LDIA 3F56A 2W9CB 1NLKL 3OR1A 2GCFA 3T9NA 2DISA 4OI6A 1KLMB 1CG2A 2A18A 2H3EB 1CJKB 2V8PA 2R8JA 3LP1B 1SV5B 1XTZA 2RSQA 4X4QA 1BHNA 1TL3B 1EP4B 2AJQA 3TEHB 4CLZA 4OX8A 4C8MA 3CDEA 4Q0BB 3LQVA 2Z57B 3Q2SC 2EW9A 4XAKA 1CLFA 1P6TA 5AE3A 4FF1A 3WC2A 1TL1A 5J2NA 2XB2D 2DNZA 4PPZA 4DV1J 4QWEA 2RT3A 3OSNA 3CCRS 1R27B 2JL9A 5HSPA 1WTFA 3MR6A 2GAHC 1WUUA 2Z2LA 3G8TA 2AF6A 4JI8F 1T05A 1MNEA 2A2DA 4CO1A 5KOXA 3MR5A 4MJKA 3PDNA 5J2MB 1WF0A 5C7PA 1N32F 5HVGA 3BGRB 1WNEA 4I2PA 1T03A 3RAQA 4Q45A 5JVGQ 5KT5A 1TKXA 4QOTA 2ZHBA 3WIVA 4FS2A 4DS4A 1HI8A 3UR3C 3OHBA 3W8GA 4OI3A 3T9ZA 2DY9A 4RNNA 3QSYB 1R0AA 1WKLA 1VQ4S 3VAIA 2X7IA 3NP5A 1WOSA 1UVIA 1BGXT 3M9OB 4KAIA 3SFUA 3HZGA 3QGHA 2DNKA 2KXNB 3KG4A 1EETA 3EZ5A 3CXCR 1X9MA 3CPWR 1FRXA 2J9DE 3GILA 4MAKA 4K4SA 2V8HA 2EFGA 5E7OB 2LQ5A 2FC9A 4UW2A 4AFFA 2FUG9 4ZJOA 2VA3A 4OZLA 1FRHA 5DGAA 4I7FA 4RW6A 1WHXA 2FY8A 3TRGA 4BHQA 3M6XA 3GYXB 1JLFB 4M5LA 4HDHA 5D15A 2VBYA 1YBUA 4LF9J 1H73A 2VPWB 2VQEJ 3HZEA 3KWMA 1QD1A 2M2BA 2R8HA 4IRDA 2VIHA 2HNYB 3DOLA 5I3QA 3R5JB 5A2QU 3MM8B 2AW0A 1UL3A 4TYAA 3CW2C 4X4TA 3VQSA 1QM9A 3N5BA 4TLQA 2KRBA 2J76E 3HF5A 3TUJC 2M5YA 2KDOA 5HMZA 1N0VC 5JMNA 1PJ7A 1SQEA 4MTPA 4DQPA 4GC7A 4P52A 4ZPAA 4PRFA 1M5SA 1I3OB 2MLZA 1R7IA 2OH2A 1NCLA 5KFMA 1NKEA 2L41A 4XDCA 1J2VA 2X51A 3R97A 3GJQB 5HROA 4PUOA 1IUJA 3CO9A 4JI4F 3R7NB 4MH8A 3JB9k 1RWMB 4FF2A 1HWUA 3SSQA 5KFOA 3EM1A 3OTEA 3CIZA 2ASDA 3M6UA 3GZ7A 3MMBA 3JXOA 4CO2A 4WFBQ 4DR3F 3BBFA 5D3GB 1B99A 1P9YA 1XMQJ 2CXEA 4Z7YA 2ERRA 4QJVA 3R5CA 1MWQA 3FGVA 3K5MA 4HH1A 2AKWB 3D3BJ 1NZAA 4N77A 4HTIA 1WDDA 2VC1A 1I94F 1RT6B 2WK4A 2COLA 1IBKJ 1CBKA 4O4RA 1WSRA 2UP1A 4TKTA 3KK3A 1G3OA 4DV7F 5BXIA 1KFSA 1MWYA 1RBAA 5ETOA 1T9WA 4YY3F 2EBEA 5HLFA 1KOHA 1RAGB 1TMMA 1OY6A 3MPUB 5A2QY 1FFWB 1CC7A 1MMDA 3RGIA 2B6AB 4RL1A 2CPZA 1Q7LB 1RZMA 1PC5A 2QA4S 4ELTA 2XZTB 4Y2MA 1IBLF 3PJWA 4P2MA 4DR2F 3JSMB 2SXLA 2GJIA 2GGPA 4I0WA 1YG0A 4ALZA 1G1XA 1IKXB 1ULRA 1RT3B 1JX4A 2WW8A 1QAJA 1FFSB 4URGA 4LQ3A 4NX9A 1D1UA 2BDPA 2ROEA 4NA1A 2ILZA 4PPDA 1HW9A 4UOHA 4Y2KA 2FJVA 3KK1B 4MK9A 2UXCF 1SH3A 2D3ZA 3MAHA 1S1WB 1NEEA 4NLYA 1CJVB 4HH0A 2V4QA 2Y1RI 3D4JA 4X62J 1OQ6A 2Z2YB 2BE2B 4ZPWR 1YWXA 1SXLA 3QNWB 3TAPA 5GMDA 2JNJA 2OPPB 2RRAA 1SUQB 1NRKA 2GHVC 2VG7A 3QO9A 1H74A 1X4HA 2Y9HA 2VZ9A 1ZA2B 3O44A 2FC8A 3PXGa 1RWKB 3ENVA 3EDQB 4E2FB 5A8WB 2Y1IA 3C15B 2W9BB 1Q81T 2YNFA 2ZNYA 1UP1A 1VQNS 1HNIB 2LA4A 2YKMA 1Y4ZB 4DV5J 4YDXA 3V4IB 3EJMA 3M2UA 2B5JA 2LQJA 3ILOA 4DCPB 4DHVA 1VQ8S 4DR4F 5L1JA 3EZUA 2HMIA 5BR8J 3OD2A 4DUZF 3IAM9 3C14B 2GQ2A 4IG3A 2R8GA 1UWAA 4OYMA 3GG0A 4JI1F 3OR1B 5L9XA 5DQIA 4KV8A 2AJ4A 2P9GA 3Q22A 4OYZA 5EHHA 4WIQA 1F2HA 1NBEB 3BR8A 5LMNF 2RQCA 4ES1A 4K2JA 2H54B 1X5SA 2XS2A 4ATNA 3ISZA 4M5DA 3BPDA 2RDJA 3SBMA 3DOMB 2E5JA 3JTNA 4C8LA 1XR7A 3HSGA 3MOZA 3T5JA 1TL1B 2HZCA 3I5CA 2ZH4A 1WI6A 5J2NB 3VAJA 2HQDA 4CH0S 2DPJA 2XMVA 3AA8A 5LJ5Y 1RT2A 4EBDA 2ZKTA 5FIIA 1WDTA 4F3QA 5C24A 3H4DA 1CJTA 3JTPA 1VISA 3T5LA 3PYGA 1T05B 4ANCA 1TKTA 1VIOA 1RWOB 3KLGA 2IA0A 3MEDA 4QR2A 4PZVA 1UVNA 2PFDA 4RO0A 5CQGA 2XZDB 4HT5A 1T03B 4FNIA 3PJ9A 3UNGC 2V4JA 4DPYA 3HM9A 1TKXB 1S49A 3C8YA 4P7TA 3TO8A 1X8DA 3IGVA 1YIJS 1NPPA 3G2XA 1PGZA 2H4YB 2PN6A 3OTBA 3R2DJ 2Y1JA 3OL9A 1R0AB 4ID8A 1X4FA 3AY0A 2AJ1A 1UJ6A 4D3HA 2YKPA 2FLNA 2LEPA 5D77A 1B7FA 2EFQA 4RUAA 1EETB 3G8QA 3MEEA 3IR5B 2EFNA 2DXFA 4USUA 4LF5F 2ZVIA 1UA0A 1NPRA 3JQJA 1BC6A 2M4MA 1GXTA 7FDRA 1C1CA 2RDDA 2KZMA 1QUVA 4J9LA 2QLWA 2RH3A 4I7FB 4ES2A 4RW6B 2B51A 4P2XA 3J81U 1VR6A 1VHFA 1U24A 4EEYA 4Q44A 2CNLB 1GT8A 4FF4A 2MZSA 1FEHA 4CT8A 2MTLA 3D6FB 5J1PA 2P6SA 2OHDA 2V69A 4NE9C 3VCDA 1S0NA 1A9NB 3DOLB 2JFKA 2OFGX 2XZWA 4ZCMA 1YLXA 2VFTA 3OL6A 1U0SA 2BUNA 2HLUA 1TFYA 3TJ8A 3UQSA 2NZCA 4LVNP 3KUEA 2ZNZA 3POTA 3HFZB 2O01C 1T0TV 2IC3A 3RRGA 4BLGA 5DZ6A 3I6PA 2C3OA 4LF6J 1R89A 3CC7S 4X4NA 1BQNB 2POKA 5KFXA 4C0OC 4YR3A 2AHOB 1KOOA 2DHHA 2ABYA 3PKMA 3C16A 1ZM9A 2LFVA 5HROB 3M05A 1VI7A 2L48A 4OZJA 5HQMA 3HXMA 1UAWA 3KK2A 1FXDA 5F8LA 2AMCB 1FCAA 3A8JA 4WKYA 4LF7F 1PYOB 2DT9A 1WHWA 4EU0A 4K4YA 2OEKA 2Y0BB 1HWJA 1RAJA 2R7QA 1RCOB 2H48B 3C3LA 2MJUA 4QR0A 4C97A 1A7GE 3LH2S 3DDNA 3MMBB 1N33J 2A6MA 2DO4A 5IM0A 1HR0F 2NZ4A 5F8HA 4UUWA 4LMZA 1EB0A 2UXDF 4FXWA 2EI5A 3VWSA 3IG1A 4I2QA 2JZ5A 2ZM6J 4XIUA 2DHXA 4JI5F 3VTIA 1AFJA 1HLWA 3KK3B 2L3MA 1NH8A 3PHTA 5H9FJ 2P8IA 3DLHA 4DSFA 2VU5A 1K47A 2LYVA 2VBWA 1IR0A 5HLFB 2FY1A 4ELVA 4NPOA 1IBMJ 2BJ1A 3IC1A 3SV3A 5L8RC 2JVRA 4UUXA 2G1HA 1SC4B 4LFCJ 1HARA 1U02A 1U8SA 3GP9A 1AUDA 2CG8A 3NGDA 4ZP9A 3U27A 1YHQS 4DV2J 5C2CA 4J9PA 2ZH3A 2OSQA 2GGPB 2GMJA 5L1KA 2HFUA 3CWJA 4B02A 1S5ZA 3D1HA 2W8KA 4PXBA 3PR4A 7FD1A 5D4OA 1NKBA 4RR5A 2R42A 3BBBA 1VK3A 1FNMA 3EE3A 2QFJA 3K7RA 2V94A 3A3OB 1SQGA 2R7TA 1FRIA 1U45A 1LKZA 1RXOB 1T9TA 4WXWA 4CCHA 3TVYA 2B4VA 1XIQA 2P5VA 4P2FA 3PG9A 4OX9J 4MYUA 5KFDA 4B08A 4LFAJ 2OUGA 3TA0A 2HBQB 1X4BA 2XTJP 4K7QA 2WVFA 1VK8A 5KG0A 2VL1A 2B43A 2HLTA 3V4MA 3PVXA 4P6QA 3QO9B 2QN6B 3UD4P 2OKQA 4U8VA 2C2NA 1R8BA 4QIEA 2DNOA 4GO5X 1EAYC 4L73A 1L3KA 4NEZA 2FVSA 2YNFB 3J7Z5 4ED1A 1HNXJ 4I6AA 4JV5J 2W4DA 1X4AA 1WC3A 2YKMB 2DO0A 2UVUA 1RBOB 5C25A 4IFVA 3M2UB 2B5JB 2W4PA 1HMVA 2CFXA 2QYGA 2J0SD 5J1EA 2HMIB 1VDHA 2DK2A 1RYSA 4IG3B 2B3TB 1FKAF 4E0DA 1JLGA 3ISNC 3G87A 3TX0A 2AZ1A 3IRWP 4KV8B 3W9JA 5HO4A 4ANEA 1RT7A 1S12A 2HHHF 2IVYA 5KG4A 5D4LA 2LCWA 4NXNJ 5DZ7A 2L9NA 3MTKA 4GVBA 2MLXA 1G2EA 2EVZA 1WORA 4M5DB 4N47A 1YJ9S 4L76A 4Y34A 3D54A 1JLAA 4CNYA 5IT4A 4Y00A 2V5HG 2RMLA 3W62A 3NS6A 5DDOC 2NSCA 4JI7J 1RT2B 4DV3F 2DRAA 4EYHB 1AYEA 1EKSA 4NRTA 3U1LA 5C24B 1CJTB 4IQXA 2OLWA 1VBYA 5L9NA 2VDHA 2RUSA 3RB0A 1HQEB 1TKTB 4DCJB 3IO1A 2CZ9A 5KFJA 3G6ES 4PWDA 3G6VA 3KLGB 3CC2S 1HNZF 3MEDB 2IBOA 5KFVA 4ELUA 2PA3A 1LW0A 3KG0A 4OZNA 2RQMA 2V4JB 2YXLA 1K1SA 3U02A 2QG9B 1RADB 3WBZA 3BS9A 2CPEA 5EWFA 2C2KB 1IR2A 2UU9F 5DRKA 3BB5A 4A8KA 2ZOGA 4X4PA 2ADCA 4B3SJ 3GR0A 3ET6A 4ICLA 1HWIA 4NXMF 4F0KA 4W4MA 2EC0A 1GMWA 1B64A 4C0BA 2AZ3A 2ASYA 1OPZA 1UTAA 2JC0A 3MEEB 2JEJA 2K2PA 1RACB 4U7CA 3CMQA 2KFNA 3BZQA 1NHKL 4OZ3A 2DJWA 3T3FA 5K14A 3UNYA 2ZWPA 4ILMA 2W9AA 4CT9A 4NLSA 5THWA 4GC6A 3GIKA 4MK8A 2FHMA 4IO1A 1IN0A 3NG8A 2B56A 3D2WA 2Y1LB 5E3RA 1F9HA 5KFCA 3ENQA 2FJXA 5HL7Q 4AL7A 2C2EA 3VQTA 3G71S 4D3GA 1CVJA 4QYRA 4DX7A 4JI2F 1FKPA 3BKFA 1FDDA 4WZQA 2WTFA 4EK2A 5IWAF 4F25A 1MMLA 1XNQF 2XI2A 2RILA 2OP5A 3TA1A 4DPUA 1F3FA 1ZM2A 3POTB 2KXHA 2IMWP 3RRHA 1FXLA 2KG1A 2R7WA 2IC3B 2H65B 2BOPA 1HA1A 2MQ8A 2NXJA 4TNOA 2YWGA 4KSEB 1X0FA 1FJGF 3QWUA 1FFGB 4YDDB 2FVPA 3C16B 5EWGA 3BGFA 3OL7A 1SL1A 2VDIA 1QTNB 4WBFA 4J9RA 3KK2B 3G82A 2D7SA 5D0RA 2VFSA 5ETKA 3KLIB 3U1MA 2F4VJ 4OJ1A 2KL8A 4USIA 4ECWA 2GIFA 2Z8QA 1SQFA 5FDLA 3HT0A 4ECYA 1OY8A 2ZJQQ 5U47A 2HK3A 3KLEA 1ELOA 2XBPA 1H38A 3IR7B 1KDNA 5IM0B 2Z4PA 3J7ZT 2XLKA 4KGXB 3L9ZA 5KFTA 1PIEA 4DV0F 3RBEA 1U8WA 3SI8A 2GVZA 4LRBA 3IG1B 4OYPA 4I2QB 3HD1A 2OPQA 2J8SA 1ZPWX 3I55S 4BC7A 3HHEA 2NPIA 3GCWP 1X4GA 3DHXA 1UWBA 3H5SA 3BPSP 4U95A 3EGWB 3D0HE 3CIMA 1XQIA 4W90B 2UUAJ 1H72C 1TQLA 3KUHA 4DFMA 1HNWF 4B3RJ 2HHXA 1DBDA 4Z7CA 3Q8VA 2N3LA 1R0CB 3MXHP 2L9WA 1YTYA 1F5BA 3EMTA 4PCQA 5AE2A 4RNHA 2XS5A 2AX0A 2G0IA 3GIJA 2CAJA 1WI8A 3A1YG 3ILLA 3BYPA 1JMTA 1OSCA 4F8RA 4DL6A 5KG6A 2ASJA 4TY9A 2WVBA 4DX8H 3ZTOA 2XHCA 3B82A 3QZ7A 4GKKJ 4DV4J 2JEGA 4QIWD 4C8ZA 3W5XA 1FDNA 4DF4A 3B6BA 3V6HA 3HVWA 3E2EA 3QRPA 1FT8A 5ETVA 4USTA 2OMOA 2GQQA 3W5ZA 5F9NA 2CNKB 4DR7J 2HHSA 2QLXA 4ER8A 3N6LA 2MKHA 2DNPA 1HD1A 5KFBA 1YRTA 4WU3A 3AH6A 4RBUA 4DL5A 1HIYA 2GFFA 3PYFA 1NZ8A 4J91A 2FVQA 3A13A 2BOAA 4U96A 3UDLA 2J8AA 5C25B 4C8KA 4IFVB 1QJHA 1M90T 1HMVB 5J1EB 2BQ3A 4Q2LA 2YBVA 4DR6J 5A0YA 5ETNA 4Y65A 3MTJA 4IYQA 4UTGA 3RW7A 3FNNA 1JLGB 4QW9A 3H8YA 1SVDA 2EEYA 3QZ8A 3PW4A 1RT7B 2VB6A 2LU2A 3QLHA 1HBMA 1S4EA 1D0EA 3DU5A 3HKZD 3QT5A 1XC9A 3TI0A 1X4CA 2XY7A 2V0NA 5CHCB 4GVBB 1H2TZ 1HQ2A 2KVIA 5D0GA 1JLAB 2XMUA 3HPOA 2CG4A 1PBAA 1U2RA 3IM8A 1V3ZA 3ILIA 1V5IB 1E6VA 2J9DA 2XG8A 5DJBA 2GAGC 3KJNB 2C22A 1KWMA 2HVZA 2M88A 1LK7A 1YDLA 1YITS 1A6LA 3H4BA 1ZTWA 3LOUA 3PFOA 1S0MA 4MKAA 2IM2A 2AIRB 5G4DA 2RQ4A 1RAOA 4PWDB 4L75A 4F4KA 2PEHA 4IQMA 2CQ3A 1LW0B 2MHEA 2D1CA 3W60A 5KFSA 3MGJA 4WP9A 3QMQA 1JJCB 2WVDA 2EBGA 2JX2A 3L3CA 4LR7A 1YJRA 2GQCA 2G13A 1PAEX 5T14A 2DD8S 4NLXA 4KGZB 1RTDA 3EXYA 1IM4A 3ADAC 3ET6B 4ICLB 1GEHA 2HWHA 2ZH7A 2EWHA 3MURP 5I3PA 2A6OA 2OAUA 3LW5C 2UVVA 1JLCA 3GV8B 4ETZA 5EX3A 4J9QA 4JOUA 1FEEA 4FYVB 4ZP7A 1VC5A 1DQAA 3CSKA 4L72B 3M8SA 3MFHA 5L46A 1FX4A 4V19X 1XERA 1VGYA 2R7SA 2IYIA 1F3VA 3Q83A 5K14B 1Y5LB 2ZUAA 4MFBA 5KFYA 4LT6A 2AYMA 2DHAA 1T3OA 4KKOA 4YHHJ 5HQ8A 2MXYA 1D8YA 1L3TA 1KR4A 3EGNA 2YVSA 1FJ7A 5CZXA 2IY5B 3BO2A 3NCPA 1LOUA 3QFWA 3TANA 2UUCJ 2AD9A 2G2OA 4JI8J 2DXEA 2CJYB 2MY8A 2HBRB 2V68A 1FKPB 2KTQA 3UW1A 5LL6d 4E98A 4ZITA 3V6DA 2R2UA 4MIBA 2FPHX 5GAEU 2UUWA 4K0KF 3BEGB 2R7OA 2DXDA 3UPFA 3DLLQ 4ZLJA 1WEZA 1NK7A 4IKAA 3GWCA 3FBBA 3W2VA 1GMWD 1MG7A 3DOKA 1VQOS 4N8OA 1WELA 4X2BA 1ZZFA 2XY6A 1VBKA 2B9WA 1UCNA 1VRTA 1RHJB 2D41A 5BJRA 3G4SS 3DLGA 3MD1A 3T5HA 1GQEA 1RT1A 2AJFE 2Y8WA 3G82B 3ICLA 4KGMA 3QPIA 3VAFA 4F0HA 2HVDA 3MFIA 3GSIA 4F2RA 3CB4A 4IH6A 2EFVA 2K7JA 3NMAA 2B4PA 5FDLB 2BJ3A 3KOAA 1NSPA 2M8DB 3OTOF 1FWKA 2HRTA 3IBFB 4I69A 2LQ9A 4FYXB 2AEJA 3G9CA 1BWEA 5IC6B 3GYGA 1KN6A 4WJBA 1HBNA 4ECRA 4WU2A 1QUPA 4EI2A 2YWFA 2BJDA 1S1TA 4S0MA 1XEZA 5B08A 3PO4A 4JV0A 3CJKA 3TEGA 3C6UA 2AQ4A 2OPQB 1H98A 4AQYF 3TUIC 1MMNA 4L6V3 4O4GB 2VHGA 3I4HX 3EX7B 1UWBB 2NLWA 4G1PA 3N79A 3BGOP 3GSDA 1Q95G 1P9QC 2OGUA 4O3OA 2DR7A 4CZCA 2XSFA 5IQQA 2G0CA 2VV5A 3LUYA 3OJUA 1MWZA 4TQSA 1FKOA 2NREA 3VHQA 4UY8T 1GMVA 2XNQA 4TVAB 3K8WA 2DR9A 1KBRA 2YKQA 2DCLA 1RTHA 4C3MA 4X65F 1Q8BA 2QSFA 5IT9U 2M52A 2AGQA 3KJQB 2VJVA 1S1UA 1Y00A 1O5JA 3KXDA 3M8WA 5IC4B 2RU3A 2ZWOA 4EZ9A 2YWKA 4UOCA 1QVGR 3G96A 2YH1A 2DGTA 3H2UB 3Q89A 4B3OA 1FF2A 3H59A 2H5IB 4KHRA 4YEAA 2WVCA 2HQIA 1WC1A 4CM0A 5KG2A 1FD2A 3ZTQA 1FX2A 2ZC4A 3MM9A 5M2PA 2IM3A 2BRKA 1R8AA 1U4BA 5B0EA 3G6XA 4RUCA 3FJ2A 3N01A 3D66A 2HAFA 1DLOA 2X1BA 2LXFA 2KJVA 3LAMA 4USHA 2NXCA 1FDAA 1IJFB 4KHMA 4CDIA 4DV7J 2DGUA 2PMZD 3V6JA 4QQBA 3H7HB 4DFJA 3H5YA 3A3NB 3CJQA 3V6KA 2F8MA 4PG7A 2WBMA 2NR0A 4DV1F 1N36J 6AT1B 3M8ZA 2GC8A 4OZ0A 4NMLA 2G2YA 5A0YB 5H9EJ 2PIIA 5AT1B 1OYEA 2QA2A 5HP1B 2JRSA 4LR9A 2YWWA 2HFVA 1HYSA 2BR0A 1H2UX 4O0IA 4DL4A 3IS9A 3W1YC 1EX8A 2DGOA 3QLHB 4J9NA 3MMAA 2JLEA 1RT5A 1HBMB 2MKKA 4LIWA 3QAUA 5L1LA 2W2PP 3GIIA 3NEKA 3PM9A 2YX7A 1SBRA 1NKCA 2J5AA 3FMWA 2UXCJ 2DRBA 5K8OA 1S9EA 4DUTA 5IT9Y 3E3XA 5GAEI 3TUPA 3MAQA 4KRWA 1K0TA 3CMES 2KRRA 4NYZA 2EG1A 1E6VB 3THVA 4OJ3A 1U1PA 4PQAA 5J2QA 5A76A 5HMXA 4ZN3A 4K59A 4WPAA 1Y7PA 3SSSA 2WZ1A 2VPZB 1L5UA 2CKWA 4OHZA 4HDGA 3RAXA 4DEZA 4ILLA 1HQUB 2V63A 3NCQA 3T6BA 2KVQE 2WCXA 1T9XA 1KTVA 1ZTTA 1Q7YT 4ZN1A 2ZZMA 2NYHA 2E44A 5D0EA 3CCES 4FPRA 2PA8D 5DLGA 1CS4A 2NS1B 5D4PA 3QT8A 2D74B 4DUZJ 4LF9F 4ENOA 3KHRA 1HBUA 1K73T 4PYAA 3N0VA 3W9HA 1DQ8A 2BBEA 4Z37A 5KG5A 3OVBA 4NLGA 1T9YA 3KLFA 1JLCB 1TP7A 4A8FA 5J2MA 4KYZA 2B7BB 3L7PA 2Q79A 2HIQA 1LV5A 1VFJA 1M5HA 3Q8UA 2FB0A 2ZH5A 1I1GA 1WG1A 3BF4A 4M63A 4QU6A 3GLJA 5E41A 2MQMA 3Q23A 4ZVRB 1TL4A 2YH0A 3R3TA 4OFZA 4MFBB 3MM5A 3KMSA 4KKOB 3R1HA 4IDKA 3FSXA 4LFBJ 4ERDA 1H7WA 4KR0B 4EUVA 3OBIA 3BSNA 4HI1A 1DURA 1FXRA 3TJAA 2E9TA 2RS2A 4FBUA 3NNCA 4DSIA 1FA0A 1VOMA 3BREA 3MMJA 1XJWB 2R2SA 3RBZA 2DBBA 1GK8A 3V6DB 2J7UA 4OLOA 1RLCL 1PC4A 2CQPA 1YSJA 5ADZA 3M4XA 2CJKA 1AUSL 1DZ5A 3W2VB 3D68A 3W5YA 1IKYA 5LSRA 3HHLA 3DOKB 1G4CA 3K8VA 3BM7A 2DNRA 5IT0A 1DARA 4N7TA 2HNYA 1VRTB 4YQWA 4ED8A 2VPYB 5M2UA 4NCBA 3DLGB 3HI9A 4QWAA 3KJFB 2DEJA 1R8HA 3VVUA 3CNQP 1RT1B 3VR1A 2LQBA 2W24A 3M32A 4F4WA 3FBFA 1F0XA 4X66J 4A8XA 1PG5B 4ZVFA 4QIGA 1RB0A 3PEHA 1Z2LA 3PX0A 5DO2A 5GADI 3CT9A 1FI4A 5KFEA 5HVFA 5KT7A 1QE1A 2UXBF 2H4WB 3ULHA 4LF4F 4LQ9A 2AYBA 2V2KA 1HBNB 5MLCV 4N56A 3OVAA 4IO9Q 7AT1B 3JAMU 3OXFA 4OJHA 2CQ4A 4IR9A 1PYTA 2MLYA 4P10A 2GV1A 1S1TB 4P74A 3BGUA 3C6UB 2R7XA 2L08A 4QU7A 4RZRA 1Z1ZA 1PJ5A 3QGPA 2DNQA 1RT4A 1T3NA 4DZ6A 1S48A 1GX6A 3HKWA 1NK0A 4K4UA 3NMRA 4X62F 4ZPVR 1TVRA 3DLJA 4K50A 1JKHA 1JLBA 3H98A 2MZQA 4HR2A 2W2NP 2A10A 3P45B 3TOQA 3TW0A 1W7WA 1FKOB 1Z4UA 3RW6A 4ZPCA 3E51A 4BC9A 3ISND 5IQ6A 2D69A 2GA7A 3D0GE 4QCLA 1IXKA 1NDLA 1RTHB 1RWUA 2Q43A 3QYYA 4HACA 1NXIA 4USKA 1U6FA 4P2SA 4F3MA 2HHTA 3CEDA 4QBUA 3S6EA 1S1UB 1TUGB 1XR6A 4DV5F 2E7VA 1YBAA 5AXNA 3J7YU 1XMBA 2FIUA 1TK8A 3W3SA 1BY9A 5B0AA 3WDOA 4ECSA 5EDWA 2QA1A 4B3OB 5F8JA 1NDKA 4EO6A 3MM9B 2WHOA 2U2FA 1B0VA 2ALYB 4F4YA 1FJEB 1ZPVA 1U0HA 4PQUA 3UD5A 4PYDA 4DBQA 1ZYQA 4WFAQ 1V9OA 2EFPA 1YK9A 3BR9A 2J9CA 3HFVA 1HBOA 2CJXB 3JAMY 4RW9A 3BSOA 1Q16B 2VH7A 2HNDA 4KHPJ 1EKRA 2HHQA 3CDWA 2ACYA 2I2YA 4AL5A 1TTHB 1JNZB 3NGTA 4J90A 4XTTA 2GX8A 4DV6F 4DL0C 2RNEA 4Y6IA 3OFGA 1IKVA 4NEYA 3M8QA 3DYAA 1VBZA 1KQFB 3GFXA 4ECVA 4DU7A 3FQKA 1WKKA 2QL5B 2HZAA 4YS2A 2OPPA 3V81A 4C98A 3TJ9A 4PG4A 3R8YA 2F9JA 1DFDA 4G3IA 4B9SA 4OYWA 2HURA 3S8SA 3MOJB 1HYSB 2CQ2A 1R8PA 3IS9B 3TAMB 3MMAB 1RT5B 1AB8A 3I82A 2DNGA 4ECXA 2C1EB 3UDVA 1UEVA 1J5OA 4URQU 1WD6A 3UR0A 2DH7A 2K3IA 1S9EB 3CD0A 3MPDA 2HQCA 3MCOA 2B0GA 1RA6A 3K5NA 1U1OA 3AD9C 4XO0A 4ED0A 3B8HA 1BXNA 1T9UA 3BKUA 5J2QB 2H5JB 2R9LA 1N5QA 2AX1A 3DRYA 4QWBA 5ETPA 1NJXA 3R2CJ 2R4FA 3CVKA 2KHCA 3CGIA 4Y2IA 3RG6A 4JI3F 4QYZJ 4DMZA 2GVDB 1LXJA 2FLPA 2XMTA 3DOMA 4L3KA 5IV4A 4X4RA 2VD3A 2VOOA 1RABB 4R0EA 2G9OA 2RAQA 4DR1F 5KFIA 3MM7A 1CS4B 4ZJQA 2JC1A 3FKBA 2ZDPA 2YPZA 4ZA1A 1HBUB 2HVHA 2KFYA 3BQ1A 1Q86T 3CCWA 1NNDA 2LU1A 1OJ4A 1JLEB 3DM2B 4TLRA 3RJMB 5HVHA 3KLFB 3CJ8A 4N8NA 4URSA 3SFGA 2HRUA 1KEKA 1M1KT 4FN5A 1CPZA 3GPAA 4X84A 3EWGA 5EGYA 3GE9A 4ITSA 4JBCA 3GCXP 2XC9A 3MECA 1KVIA 3CD6S 4AD6A 3CTRA 3ZZOA 4ED2A 4OI0A 1Y10A 4B17A 4LF6F 3DLEA 3MM5B 3N6MA 4KGKA 4TN2A 3I9ZA 5K8PA 4IDKB 5T7LA 4JI0J 5IV3A 4DX5A 4CLFA 4O0NA 4LF8J 4GMKA 2V8DA 3VF0B 2OI2A 2ZZTA 1UFKA 3PKYA 4J9UE 1ZH5A 1RA7A 3C2PA 1MLAA 1AT1B 4WE1A 3HFKA 4YB5A 2PC6A 4DOZA 3W63A 2YTCA 3PRVA 3TZYA 2P6TA 1YJ7A 1K8AT 2HGNA 4NYOA 1GX5A 2R7UA 5F3ZA 3J7YI 3MI7X 4B3TF 1IKYB 2UU9J 3HHLB 1NJYA 1VQKS 4BWMA 3M1VA 1YBTA 4QWDA 2HGLA 5GAHU 4O3QA 5IXUA 5GAGU 2HEKA 2Z56B 1C2PA 3IBWA 1RWPB 2BKNA 3KKFA 3AB2B 4ZLNA 4NI2A 1RAIB 1P1TA 1FRLA 3M32B 1J27A 3J7A1 1IBMF 2E5GA 4X4SA 3TNVA 5FJ4A 2YNIB 3IRXA 4A8OA 5DG9A 1VQ9S 1DAXA 8RUCA 4LFCF 2ZFHA 5KG3A 2B8QA 4PABA 5BYSA 2KXFA 1QE1B 3MF5A 2CPXA 4DV2F 1BQNA 2KT2A 2CIMA 3C6TB 4H4OB 4ZOSA 2MEWA 3SZ2A 4X64F 3DRXA 1WEXA 1NU4A 3C19A 2A1BA 2JSXA 2O1PA 5K8NA 3R1LA 4DSLA 3M9NB 4CLYA 3UFCX 4HL9A 4F0MA 3EYZA 2IA6A 4IOAQ 3SEOA 2V34A 3EPGA 3P4UB 4DUYJ 4JI2J 2DNNA 1RT4B 2BYCA 1P8GA 1XNQJ 5KTQA 2DY1A 3HHLD 4OX9F 4XPCA 1TVRB 3LANA 2DEIA 1N5VA 1JKHB 3WIUA 1J5EF 2PGCA 1GAOA 2D3UA 1JLBB 2OEJA 1S10A 2V8VA 4P7VA 3JS9A 3MAAA 3BN7A 5FD1A 3LPEA 3OLBA 4A48A 1S7HA 2OELA 2HW3A 1SC1B 4J37A 2EXUA 4HACB 3T1HJ 1HNXF 2FGCA 4ED3A 4JV5F 1VMBA 3AODA 3FDSA 3H5UA 1Q4RA 2BKPA 1N52B 3G86A 2R2RA 3LGMA 3MM6A 1NDCA 2MKJA 3BQ0A 4RUHA 1N5SA 1OMSA 1FVQA 3EGVA 2MZRA 1RCXB 1RAHB 1IQZA 4ZCIA 1JJ2R 2DTJA 1KC8T 4F36A 1GNKA 1VC0A 3MUVP 4LBHA 1SJ1A 1S0OA 3CE8A 4CO5A 1VQPS 3IXQA 2E66A 4DV0J 1FJCA 1N56A 3A8EA 4ED7A 1U0HB 4F3OA 2QE5A 4PQUB 3SDEA 1KTQA 4YP3A 1G6BA 3HVRA 3L09A 3OHAA 4FF3A 2YY3A 4I67A 3K57A 1HBOB 3HHNB 1ZAXA 3TQ1A 4RW9B 5HI7A 2HNDB 2Q3PA 2OMLA 2KFZA 2IBKA 4HHHA 2BA9A 4E8UA 1S9FA 4NOHA 1VS3A 2W8LA 4Y3CA 4JI7F 3SCIE 1IKVB 2OTJS 3KJVA 3M8QB 3DYAB 5AJ3J 1VQ7S 2VOPA 2KHDA 3FZBA 4RW4A 3V81B 3ONQA 5BYRA 2V9KA 2XQCA 3FUYA 4IH5A 1T94A 2ZE2A 3CCLS 1REGX 1X5OA 4FYWB 4YUDA 3M6WA 2MY7A 1X5PA 1T8EA 3PHEA 3LALA 1P27B 1U09A 2H5EA 2JVOA 4P71A 3MCNA 4Q8EA 2AV5A 1TAQA 2XYHB 3EICA 1J5OB 3BYRA 3O1LA 4AXIA 4B3SF 1Y11A 2KG0A 2D3OR 3OTCA 1LFPA 5E3CA 3UN2A 4JYAF 2P9CA 5KFKA 2MGZA 1TKZA 3J7AN 2WAQD 1NO8A 5IZHA 1S1XB 2NXNA 2MPUA 1UFWA 2FZKB 4O23A 2R2TA 3PCOB 5GAHI 4PXCA 3I9V9 3GFYA 5GAGI 2CPIA 2ZOMA 4X4OA 4CO3A 5L1IA 3DRPA 3B78A 3TYTA 2IRXA 5KFLA 3GJSB 1LEOA 1Y0HA 3LGHA 3MM7B 1C0TA 4NLOA 2OFHX 2F9DA 2BJ8A 4NLUA 2X3DA 5ETMA 4Q8FA 4ZP8A 4DPTA 1HQEA 3W7BA 1AXQA 3P49B 5K5MA 1K44A 2HIYA 4XDDA 4LRFA 4G65A 4USMA 1GTHA 1CQNA 4OZ5A 4RW8A 3RZAA 1SKWA 2AEMA 4AT1B 3O5TB 1PILA 3ZFVA 1RHKB 1SH0A 4EZ6A 2XY5A 1SI9A 3R9LA 2HKEA 3MECB 4B3MJ 3Q2TC 9ATCB 3PW7A 3LTOA 5LOQA 4FPIA 3FCWA 3KMQA 1F1BB 3M2VA 3DLEB 2OPRB 4G1IA 1TELA 3THTA 1RP5A 2F1FA 1KP6A 5T7LB 2W4CA 2XS7A 2R8KA 5F0WA 3D28A 1UPPA 1GH8A 4WYLA 2VODA 1SH2A 4NASA 1O8BA 3ZTSA 1TL7A 1JLQA 3JQMA 1NK8A 1C4AA 3PX6A 2F4VF 2PEBA 3LAKA 4WE1B 4HT7A 4U7UK 2FJEB 5C5JA 3D7SB 3KLVA 4DQRA 4CRJA 3LA0A 2ZHAA 2BRLA 2XYPB 1ZZNA 5LSLA 1ZBTA 4K8RA 5E33A 4J9MA 4O3RA 4CO0A 4M5GA 4YOEA 3M1VB 2XM3A 1V5VA 2CQCA 3DGPA 2MZ1A 3OXLA 4OYIA 1EARA 2IJRA 2QGFB 4NI2B 5EN1A 4DJBA 2MHNA 3UCUP 2BABA 3IFEA 2JWNA 4PG8A 3JSYA 2B7CB 2FHOB 2C2OB 1WEYA 1SKUB 1Q5YA 2XWYA 4V19J 1QTMA 4KPCA 1RTJA 6FD1A 2AYGA 3IRXB 4KIAA 3BO3A 4RPFA 3W9IA 3GONA 2IM1A 1RGVA 2IRYA 4C0HA 2X1GA 5HJXA 3A8KA 3MPYA 2ZH1A 4KC5A 2R8IA 2FZGB 3WQPA 3ZZ0A 4QPTA 2E1CA 3DNCA 2J0WA 2QLBB 3KLIA 2MKYA 3PFEA 4HHUA 5I42A 3K5LA 4RBVA 5CH7B 3ZZYA 2FHJA 6FDRA 2BM0A 1FRMA 1CC8A 1Q8IA 4QPXA 3UD3P 1HWLA 3AQPA 3BH6B 2CWXA 1XMOF 2FVCA 2YNGA 2XI3A 1ICEB 2RDIA 2F65A 4A46A 4G6VB 4IRKA 1EQ0A 4NCAA 5ETQA 3RR7A 2XCPA 1YJVA 4DR7F 2U1AA 4TQRA 3N9UC 3MWBA 3MAAB 1UVMA 3J81Y 2O5DA 2VA2A 4IG0A 3PY8A 3PZPA 5JVHQ 2BJEA 2VPXB 4OV1A 1S76D 2MKCA 4OI1A 3PYEA 3AJ2A 4LRDA 4M94A 1B70B 3HHKA 2YQ0A 4YR2A 3ZZTA 2CQGA 3K17A 2CQDA 4LRCA 4WIIA 3MM6B 4L74A 1YJUA 4FZVA 4DR6F 4OI4A 1WACA 2K8GA 2GS8A 3UN3A 4HLBA 2KI2A 5IS2A 2I1RA 3OTOJ 1TZ0A 5B0FA 1S7IA 2DIVA 1LWEA 1U6BA 2CQIA 4YB6A 3CCUS 2G4BA 2E9ZA 4R8UA 3T1YF 3D9BA 1B7YB 3F73A 2MSTA 2DITA 3VZIA 1O6XA 3SDEB 1RAAB 3CO0P 5CYQA 1BLUA 4AQYJ 2RJZA 3I96A 5G0RB 4RU9A 2IHR1 4FBTA 3FCVA 4ZPTR 1I5OB 3M8PB 2HK2A 4J9SA 4DL2A 2XO6A 3PJXA 2JH3A 1OQ3A 2HGMA 1FE4A 2FTRA 3KJVB 3RU0A 1UVJA 4B9NA 3OVSA 1LWCA 4M5JA 5LXRA 4RW4B 1EIYB 4F04B 1KQGB 2ZE2B 1WSVA 1YJTA 3T5KA 3UCGA 1U26A 1T02A 3IA0A 1FRJA 3UE2A 3M8RA 1JNRB 4TU7A 3OSPA 4DR5J 4X65J 1D9DA 4DL3A 4Y2CA 2CQHA 5RUBA 1Q0NA 5K20B 5IFMA 1M1HA 4CLTA 2GIQA 5C2GA 3CD7A 5KFFA 4FVCA 1BUXA 1RLDA 3FBCA 5HATA 3OUYA 3GFHA 3TR5A 2OPSA 2MGZB 4U6PA 4OHXA 1TKZB 4U67Q 3CULA 2FVRA 1N4LA 1S72S 2BE7D 2XO7A 3GIRA 2RS8A 1UVKA 4FS1A 1FRKA 5M2RA 1RTZA 4CIOA 2YQ1A 4DF8A 2QEXS 4C2MA 4OX6A 4N5SA 2VC0A 1UVLA 1NHUA 4L3NA 3QJPA 3DRPB 1L3VA 1AZSA 5F8IA 4CTAA 4F4XA 2QL7B 5A8RA 4ZVPB 4YHHF 3CCSS 2LECA 3CJ3A 4HHJA 3PIPQ 5D78A 4RWXA 3SV4A 1CQMA 1C0TB 2UZAA 4U8YA 3GMGA 2HRYA 4WZMA 4DQQA 3OFEA 2UUCF 2AGOA 4W92B 4M5KA 2FLLA 2HS4A 2PMWA 3HHDA 3KTQA 4OHVA 2BKOA 2M7SA 4YN3B 4RW8B 3RRKA 2CRLA 1NH7A 2RHQB 4WK3A 2XMKA 2HFOA 2ZBRA 2EG2A 2CPJA 3G6YA 1VIXA 1WKJA 2F8EX 4NL5A 2ZBQA 1NK6A 3P3DA 2FJWA 1S6PA 4CI0B 4GVLA 3M2VB 5LMUJ 3BBCA 3VGVA 2WBRA 4F67A 5A6WA 4RNFA 2CNOB 4IR1A 2QTWA 5CD4H 4P73A 2B4UA 3LPYA 2ILYA 5E3AA 5T41A 1O51A 4LSLA 1TL7B 2NXEA 2ZD1A 1JLQB 3D0IE 1HHQA 4UT4A 1RYRA 5H9FK 3UCZP 2N82B 2WSEC 2RKIA 2LEAA 1N8RT 4A8MP 2CUYA 1M5KC 2FLOA 2XSJA 3KDOA 3NNAA 2E1AA 1VHIA 3T1AA 4ZIWA 3Q86A 5KFUA 2JLGA 2ZOFA 4ZLPA 1OS5A 1R3NA 4LSZB 4RNOA 5KFPA 5A8KA 5AXLA 4UOFA 5ITHA 2D9PA 1HKAA 3PR5B 2HBYB 3DGPB 1URNA 2I0XA 3FEZA 4DLEA 1NM2A 2HS0A 1FNOA 3KNAA 2OD4A 4DX6A 3DI6A 2YX4A 3PYDA 2E7XA 5DQGA 2UUTA 1YZ7A 1WC0A 3GJTB 2F8HA 1F9EB 2WSFC 1WOPA 4WFXA 1RTJB 1ZS6A 2PSZA 1VYAA 2CDRB 2VQFJ 5C42A 2HQGA 5B7WA 2Z30B 3KG1A 1B4SA 4FP9A 2Z2MA 2HS3A 1C1BA 2VFRA 4JI6F 3PRBA 5ETRA 2NXUA 2XMWA 1CULA 3NGSA 5B0DA 2HPUA 2HNZA 2F3JA 2XWXA 2GMLA 3LWLA 1RU2A 3K2YA 3ZNUA 2F4FA 1S6QA 1QSLA 5I42B 4KFBA 3E01A 2ZZNA 2VONA 2EPIA 3RBDA 1K9MT 2X3GA 5KG7A 1H3DA 2PI4A 2NSBA 2V6AA 2WSCC 2GNKA 3DHWC 4M8LA 2YNGB 3HSDA 4X4UA 5HK4A 3HULA 4XK8C 1RWVB 1JIHA 1CJUA 4UQTA 4WP3A 2ZC3A 1FDBA 2XLIA 2PD1A 4IG0B 2HG4A 2AWZA 3RTVA 2ZJPQ 2ZBIA 4O4GA 2FD2A 2QX0A 1DJ0A 4RJVA 2KYXA 5DM7Q 2HFSA 5F41A 2HFNA 4EFAC 1N36F 2M9KA 2BJ7A 1U49A 2WW4A 4DPXA
chains in the Genus database with same CATH topology
4H54A 1HARA 1W25A 1U8SA 4DR5F 5J2PA 3LGNA 1U6FA 4P2SA 4F3MA 1AUDA 3N4WA 5K9FA 2HHTA 2WRMA 3NGDA 3CEDA 3CJ5A 4QBUA 4ZP9A 3U27A 2W7PA 1YHQS 3S6EA 4PWUA 4J9PA 2ZH3A 2ZITA 1S1UB 1XR6A 2XULA 3BQ2A 1QY7A 3I0SA 4DV5F 1LWEB 2OSQA 4Z2XA 1R6YA 1OPIA 2GGPB 2GMJA 1XNRF 1YBAA 5F8MA 5AXNA 2RF2A 2HVIA 5KFRA 3J7YU 1XMBA 5L1KA 3CWJA 4R8UB 2FIUA 4IOBA 2JOQA 3DMJA 4B02A 3MUMP 1BY9A 1R43A 3D1HA 2W8KA 5B0AA 4PXBA 2FHJD 2E5LF 3WDOA 3HK2A 4ECSA 5EDWA 3PR4A 2QA1A 1NK4A 4TU8A 7FD1A 4B3OB 5D4OA 3O3LA 5F8JA 1XBWA 4HI2A 3DXBA 1NKBA 3OFHA 2O66A 2C2DA 2LKZA 1VK3A 1NK5A 1FNMA 2QFJA 3K7RA 1OO0B 4EO6A 5CYQB 3MM9B 2V94A 2WHOA 3JSRA 4B9VA 4C8YA 2R7TA 2NUHA 4OMFG 4PR6A 4CH1A 2U2FA 1U1QA 1FRIA 2CJBA 1U45A 1LKZA 4WXWA 2CPYA 4CCHA 3TVYA 2DPIA 1YJNS 4NXNF 1B0VA 1BQMB 2B4VA 3M9MB 4F4YA 1FJEB 1ZPVA 2P5VA 4LSNA 2KM8C 2BZ2A 2I38A 3NKYA 3TUZC 4XPEA 4PQUA 4IFYA 4DBQA 4MYUA 5KFDA 4B08A 5E3QA 4WFAQ 1ZYQA 4ZCLA 1TV6A 3TA0A 4ZMMA 1V9OA 2EFPA 1X4BA 4WKRA 3BR9A 2J9CA 4RLEA 1HBOA 1HW8A 2Q6CA 3JAMY 5G0RA 2B4OA 3THPA 1LWCB 2H9ZA 1VK8A 4RW9A 5GADU 3BSOA 1Q16B 5KG0A 2VH7A 2VL1A 2B43A 4DSKA 3W3SA 2HLTA 2HNDA 1N34F 3JYTA 3M8PA 3MMCA 3V4MA 3IWLA 2UUBF 3PVXA 2HHQA 3CDWA 4P6QA 4WK1A 2R7RA 3RYLA 4Y28C 2ACYA 4KO0A 2I2YA 4KE5A 3RB3A 3QO9B 4YMEA 2KH9A 1JNZB 4AL5A 2D9OA 1G7CB 3S1TA 2PFFB 3UD4P 2DH8A 2OKQA 2MSSA 3S01A 2GX8A 4DV6F 1V3RA 4DL0C 2RNEA 5FLXY 4Y6IA 1R8BA 4QIEA 2DNOA 1HHSA 4ES3A 5LT5A 2VKZG 3OFGA 1IKVA 4GO5X 2DVIA 3M8QA 3DYAA 4NLRA 1VBZA 3Q0AA 1L3KA 4OJGA 1KQFB 3GFXA 4ECVA 3HHLC 3FQKA 2FVSA 2YNFB 2RVJA 4R0JA 3J7Z5 4ED1A 1JXLA 2OPPA 3V81A 4C98A 4I6AA 1PO6A 1KLNA 3K0JA 4I6WA 2CDQA 2W4DA 1X4AA 3DRRB 1ROFA 2YKMB 4PG4A 2R7VA 2DO0A 2KU7A 2F9JA 2UVUA 1MSWD 1DFDA 4G3IA 4DG1B 4B9SA 3O6QA 1FNXH 5C25A 3Q8RB 1F2GA 1H7XA 3S8SA 3FZ2A 4IFVA 3MOJB 1WG4A 3M2UB 2KKHA 3BSAA 2B5JB 3Q8PB 2CQ2A 4F4ZA 1R8PA 2Z0GA 4Q2MA 2RRNA 3ITHB 2W4PA 1HMVA 2CFXA 2J0SD 5J1EA 3IS9B 4YB1P 2HMIB 2DK2A 2E7WA 2YWEA 1RYSA 3TAMB 4ZPDA 1SL0A 3MMAB 4IG3B 1RT5B 3VAMA 5HP1A 2G1DA 1RTIA 2B3TB 2NYIA 5DDRC 1FKAF 3EXCX 3QWPA 1JLGA 3ISNC 4E0DA 3JTOA 5E5NA 1NK9A 3OUYB 1U1RA 3I82A 1KD1T 4C8NA 2DNGA 2OPSB 3IRWP 2CPDA 4ECXA 1D9AA 4KV8B 5HO4A 1WF2A 4HYKA 1UEVA 1RT7A 1J5OA 1FK9A 4URQU 1WD6A 3UR0A 2HHHF 2DH7A 2K3IA 3OFFA 3GV7B 3H20A 1DTTA 1S9EB 1GXLA 2YQ3A 2IVYA 3CD0A 3I4PA 2OSRA 4U9RA 5JXSA 5KG4A 3QGIA 5J1NA 5D4LA 5LMUF 2LCWA 2B0GA 2IRUA 2W9CA 5DGBA 5A6PA 3PW2A 1KHWA 5CCMA 2MMYA 1S99A 1RA6A 2FHKA 3M2RB 2YX1A 2KYZA 4HVZA 3K5NA 1U1OA 4XO0A 2L9NA 2Q1LA 3MTKA 4ED0A 3B8HA 3SCLE 1G2EA 2EVZA 4NLDA 4M5DB 4N47A 1UA1A 2O67A 3NL0A 3CC4S 5J2QB 1YJ9S 2XMMA 4C8OA 2R9LA 2W7AA 1N5QA 2ZH6A 3I56S 5GVQA 1KLMA 3Q8SB 2AX1A 4Y34A 3D54A 3DRYA 3MEKA 3NCRA 2N7CA 1JLAA 2ZHOA 4QWBA 3KYLA 4CNYA 4CTAB 5IT4A 1RJJA 1X0PA 4Y00A 3LP1A 3PIOQ 2V5HG 1NJXA 5A8RB 1SV5A 5D4NA 2R4FA 4NLVA 3I87A 3CVKA 4WFNQ 4ECQA 2KHCA 2DNMA 1ZOTA 2RMLA 2BQUA 1TL3A 1EP4A 3KFWX 1YRUA 3NS6A 4K5SA 3CGIA 5F9LA 5DDOC 2PT0A 2DGVA 2NSCA 5KOWA 3IN5A 4Y2IA 4JI3F 4AE5A 4ZHRB 1RT2B 5KFWA 4QYZJ 2KZZA 4DMZA 2J0XA 2HWIA 2XGPA 4DV3F 2DRAA 2E9RX 4LFBF 4Q0BA 3OR2B 1LXJA 2FLPA 4EYHB 4MIWA 2XMTA 3DOMA 4A8WA 3I31A 3QJLA 4AYBD 4NRTA 4X4RA 4N76A 1HNVA 3U1LA 5C24B 2QSWA 3PV8A 3R27A 4IQXA 3N5FA 2JHEA 2OLWA 1VBYA 4MYTA 5L9NA 3RB0A 2VD3A 2VOOA 2WONA 1HQEB 5LSOA 1F5CA 1TKTB 3NGKA 3NNHA 4R0EA 2G9OA 1HQUA 3IO1A 2IJNA 1F5AA 4DR1F 2BQRA 5KFIA 2JEIA 5AE1A 5KFJA 3MM7A 3G6ES 4ED5A 1AFIA 4PWDA 3AA9A 4BS2A 2JC1A 3KLGB 3G6VA 1Q82T 1RTDB 3CC2S 3GQCA 1HNZF 1VQYA 3MEDB 4G1QA 1RK8A 4AUKA 2ZDPA 4ZA1A 2IBOA 5KFVA 4ELUA 1HBUB 2PA3A 4MKBA 2HVHA 1LW0A 2EK1A 3AAWB 2K1RB 3KG0A 4I2PB 4OZNA 4A47A 2RQMA 1B0TA 3MPWA 2KFYA 3BQ1A 1Q86T 3CCWA 3P96A 3V5RA 2V4JB 3K5OA 2MKIA 1VC6A 3D1OA 4Y0FA 4HKQA 4X4VA 1K1SA 3U02A 2IAJB 1NNDA 2LU1A 3V2UC 1JLEB 2PI5A 5CXTA 3DM2B 4TLRA 3WBZA 1AROP 2R8JA 4WTYA 4DL7A 3BS9A 2CPEA 3KLFB 1Y9OA 4N8NA 4URSA 3SFGA 3UWTA 1AW0A 2HRUA 1KEKA 5EWFA 1M1KT 1Z2ZA 4FN5A 1U25A 5LJ3Y 3KLHA 4RKUC 1CPZA 5B0GA 4X84A 2UU9F 5DRKA 3BB5A 5EGYA 2ZOGA 3GE9A 4ITSA 4X4PA 5EX0A 4A8KA 1S6PB 3DN9A 4EO8A 2ADCA 3SYZA 2BXJA 2JDJA 2MYFA 3GR0A 3BGRA 4JBCA 4EGLA 4A8QA 2XNRA 4ICLA 1HWIA 2MZJA 5KG1A 2J6TA 1VQLS 2CZ4A 1W2BR 4NXMF 2XC9A 3BO4A 4ETXA 4PG6A 3MECA 1KVIA 2EC0A 2P9EA 4OX7A 2KN4A 3CD6S 3K58A 4NCGA 2UV8G 3CTRA 1B64A 2MZTA 4PKDB 4C0BA 3ZZOA 4ED2A 2VQFF 1W2IA 4PXEA 2ASYA 1OPZA 4OI0A 1JK9B 3LP0A 4JV1A 4QR1A 3T6JA 2JC0A 3ENWA 4B17A 4LF6F 4PG5A 3DLEA 3MM5B 2VG5A 4YFUA 1RQ0A 1PSDA 4X66F 4LSLB 3KHHA 2ZH8A 1WHVA 2ZD1B 3MEEB 3N6MA 2K2PA 4KGKA 4TN2A 1WTBA 3I9ZA 2JEJA 3NAIA 4KTQA 3FEXB 5K8PA 4IDKB 5T7LA 1VBXA 1F9FA 1LQ9A 4U7CA 4O44B 2KFNA 2VFVA 4J5OA 3BZQA 3G8SA 2RKIB 1VQMS 1Y5IB 4GMKA 2V8DA 4H4KA 1H2VZ 2DJWA 3J80Y 5K14A 3T3FA 1M5VC 4R5PA 1YGYA 2FGOA 2L9DA 1FESA 3VF0B 3HO1A 1DTQA 4ILMA 4CNZA 2W9AA 3FCHA 2KM8B 3PKYA 2CYYA 2J7WA 4IUFA 2XSJB 4CT9A 1ZH5A 4NLSA 1RA7A 2J7KA 5THWA 1RKIA 4CH7A 3C2PA 4GC6A 1JWWA 3GIKA 1SIWB 4WE1A 3HFKA 4ZK7M 4MK8A 4ZDNA 2FHMA 2K7KA 2QT7A 3I0RB 4IO1A 4NYPA 1JB0C 1IN0A 3NG8A 1X9SA 2B56A 3D2WA 2FJBB 2ZBCA 5E3RA 5DQHA 4RW7A 3LP2A 4Q7AA 2OIHA 4YB5A 2PC6A 5A8KB 5KFCA 1TR0A 4DOZA 3ZZPA 3ENQA 2FJXA 3US5A 5HL7Q 2IJFA 1SKSA 2YTCA 2LLZA 4AL7A 2CQ1A 2C2EA 3VQTA 3VAGA 2FJDB 2P6TA 3G71S 4D3GA 1K8AT 1CVJA 4FVMA 2CPHA 2HGNA 5DDPC 4QYRA 2I8EA 3GYNA 4NYOA 4JI2F 1FKPA 1GX5A 4AXJA 2R7UA 3DI6B 5F3ZA 1FDDA 1JLFA 4LIRA 3J7YI 4WZQA 4TY8A 4ED6A 2WTFA 3MI7X 5IWAF 3VZHA 4B3TF 2I5JB 1IKYB 4F25A 4Q43A 3HHLB 1NJYA 2HFZA 4ZVEA 4MKYA 1MMLA 1VQKS 2XI2A 3K5PA 2RILA 1XNQF 2OP5A 2V8GA 4BWMA 1HD0A 3M1VA 1HPZA 4Y2AA 3TA1A 1H0HB 3HVTB 2ROGA 4QWDA 2HGLA 5GAHU 4K4VA 5F8NA 4EBCA 1ZM2A 4O3QA 1RISA 1JJHA 3POTB 5IXUA 2JEFA 5GAGU 4DS5A 2KXHA 2IMWP 2DIUA 3RRHA 2WB1D 2QMXA 2EFOA 3MM8A 1C2PA 3IBWA 2KG1A 1FXLA 3KKFA 2R7WA 2IC3B 3AB2B 2BOPA 4GKJF 1HA1A 2LEBA 1Q78A 3VAHA 1HI1A 2VASA 4C4WA 5C42B 3CCVS 1P1TA 4J9OA 1FRLA 1KNZA 2AU0A 2HHPA 2IM0A 4KT0C 3M32B 4TNOA 1C0UA 1C1BB 3RAMA 2YWGA 3FSYA 2UUAF 3J7A1 4I56A 1SJ3P 1IBMF 2E5GA 4KSEB 4X4SA 1X0FA 1UJ4A 1URRA 4F26A 1FJGF 5E3PA 3TNVA 3QWUA 2YNIB 5FJ4A 3IRXA 4YDDB 3TX8A 2NQPA 2DHSA 4A8OA 5DG9A 1VQ9S 5EWGA 2FVPA 4B3RF 1DAXA 5DG8A 3AQOA 3BGFA 3OL7A 4LFCF 2C28A 2ZFHA 1S97A 4KBIA 5SZTA 2OTLS 1R8CA 1SL1A 1REVB 4PUOB 5KG3A 3NWGA 2HNZB 4F50A 3UDCA 4J9RA 4QIFA 4BCAA 3NRBA 3R5AA 5BYSA 3KK2B 3MD3A 4B9TA 2KXFA 4DWIA 1QE1B 3MF5A 2D7SA 2CPXA 4DV2F 2HYIB 1S6QB 2VFSA 2VUGA 3KLIB 1BQNA 5MAOA 4K4XA 2KT2A 4WCEQ 3GG1A 5CYJA 2DR8A 2M3DA 3U1MA 4KFBB 4OJ1A 3CMAS 4USIA 2YKNB 3E01B 1N5TA 2CIMA 2Z8QA 2AYEA 3C6TB 4ECWA 3OL8A 1I6JA 4H4OB 2YKAA 2CZVC 4ZOSA 5FDLA 3SZ2A 4X64F 3DRXA 4ECYA 3SCKE 3GIMA 3FSIA 2ZJQQ 1WEXA 1NU4A 1U6ZA 2MQLA 2KO1A 1X5TA 2A1BA 4NLPA 5U47A 1U1KA 1TK5A 1SL2A 5DETA 3ZZUA 2JSXA 2O1PA 5K8NA 3R1LA 4F2SA 1N0UA 4DSLA 3M9NB 3KHLA 2M8HA 3QIPA 3UFCX 1X4DA 3KLEA 4HL9A 1ELOA 2XBPA 3QAEA 1H38A 3IR7B 4C11A 3CJKB 3EYZA 5IM0B 4R25A 2IA6A 3SEOA 4IOAQ 2Z4PA 1KFDA 3J7ZT 3EPGA 4GKKF 2XLKA 2E1MC 4DV4F 1FE0A 1RT4B 2DNNA 3HVAA 2GHPA 2BYCA 4JUZA 5KFTA 1P8GA 1LW2B 4DV0F 1E6YB 3RBEA 2C3UA 3SI8A 1TK8A 2Q6BA 3ZC4A 5KTQA 3HHLD 3IG1B 3M6VA 1L3UA 4I2QB 4OX9F 4XPCA 1TVRB 2ZKUA 3IR6B 3LANA 5H1SV 3RR8A 3PRDA 4B9LA 4WF9Q 1N5VA 3ETOA 1JKHB 1J5EF 3E8OA 4FXVA 5AXMA 2PGCA 1GAOA 2OPQA 2RRBA 5D3GA 2D3UA 3SMZA 3BN4A 3WC0A 1JLBB 3I55S 1ZPWX 2ZJRQ 3R5DA 2GO9A 2M0GB 1XK8A 4BC7A 3GR1A 3HHEA 1S10A 2WOMB 2V8VA 2NPIA 2OD6A 2E29A 4P7VA 4KHPF 4MIAA 1X4GA 5EWEA 3DHXA 1UWBA 3H5SA 3BN7A 2C2RA 3EGWB 1ZM4A 3D0HE 4LJMA 5FD1A 4EWTA 1Q53A 3CIMA 3OLBA 4W90B 1RT6A 1YQHA 1TK0A 1TQLA 4A48A 3L7OA 1S7HA 2E5HA 4DFMA 2HW3A 4I68A 1HNWF 3MEGB 4J37A 2HHXA 1DBDA 3NBPA 4K2XA 1N5YA 3O8WA 5J2PB 5AXKA 5CA5A 2N3LA 3I5AA 1HNXF 1JJ4A 2FGCA 4ED3A 3VAKA 3FEYB 3MXHP 4JV5F 2BW2A 3KNGA 4IH7A 2L9WA 1VMBA 2F40A 1NJZA 4TXSA 4C3KA 1Y3KA 4NLWA 1YTYA 2N7YA 2VFUA 3AB4B 3FDSA 1UMJA 2RE1A 3ZZZA 3I0SB 1F5BA 3H5UA 1Q4RA 4PCQA 5AE2A 4RNHA 2VG6A 2DR5A 1N52B 2W25A 3GB0A 3AJ1A 2XS5A 2HHWA 1MU2A 3G86A 2RF2B 2R2RA 2AX0A 3LGMA 3MM6A 1QVFR 2MKJA 4DN0A 4RUHA 3BQ0A 1N5SA 3GIJA 3DMJB 1WI8A 3A1YG 1LWFA 5HMWA 2B6AA 1HWKA 2CPFA 4MMOA 1FVQA 1JMTA 4USJC 2V4RA 1OSCA 1TKDA 3OLAA 5F8GA 4NZ6A 2MZRA 4F8RA 3HJFA 4DL6A 5D8HB 5KG6A 3CCTA 1IQZA 2ASJA 4TY9A 4ZCIA 4YR0A 1JJ2R 3L95X 2DTJA 3WX4A 1KC8T 4Q5VA 2Y0SD 4LUBA 3JSMA 5DG7A 1GNKA 4DX8H 3CD5A 1IKXA 1VC0A 4QW8A 3H5XA 3MUVP 1O0PA 4NWBA 1RT3A 1SJ1A 3B82A 3QZ7A 1S0OA 4ID5A 3CE8A 2JEGA 2VBZA 3B4DA 4QIWD 4CO5A