1PO6A

Crystal structure of up1 complexed with d(tagg(6mi)ttaggg): a human telomeric repeat containing 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine (6mi)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/dna
molecule keywords 5'-D(*T*AP*GP*GP*(6MI)P*TP*TP*AP*GP*GP*G)-3'
publication title Structure-based incorporation of 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine into the human telomeric repeat DNA as a probe for UP1 binding and destabilization of G-tetrad structures
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2003-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1po6A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1po6A02
2AYMA 4LMZA 4WKRA 2DHGA 2CPFA 4UY8T 3UCZP 3R27A 1FJCA 2M7SA 1PO6A 4CIOA 1YJ9S 3VALA 1WHYA 3R1HA 4WCEQ 3CUNA 3FEXB 3V4MA 2NZ4A 2XS7A 1D9AA 3U1MA 3CCRS 2SXLA 1UW4A 3NS5A 4J5OA 4F02A 4F26A 2M52A 2RRBA 2F3JA 2DISA 2KXHA 5GAHU 3CCLS 2ZJQQ 3UD3P 2E5GA 2EK1A 3G96A 2CPDA 1X0FA 1JJ2R 1WF1A 3G9CA 1VQ6S 3H2UB 2E5JA 2DNNA 2M4MA 2RT3A 1R8HA 1SJFA 2DGQA 2EK6A 4IO9Q 2ADBA 5D78A 3CPWR 1S79A 1X5PA 2CPXA 3ULHA 3P3DA 2L41A 1K73T 2LA4A 2LA6A 2OSRA 1WHWA 2J0QD 2DO4A 1G2EA 2GHPA 5DM7Q 2LXUA 2NLWA 1D8ZA 3CXCR 1VBZA 2MKSA 1U6FA 2LKZA 2UP1A 3TP2A 1VC0A 5CXTA 1B7FA 2DNGA 2DNZA 2CPEA 4Y00A 3VAHA 2RQCA 4PR6A 3UE2A 2L9WA 2DITA 2N3OA 1VQLS 5DM6Q 3ZZZA 3BEGB 3LPYA 1R8PA 3VAGA 2JX2A 1JJHA 1WHXA 4LJMA 2CJKA 1UAWA 2X1BA 3B4MA 1A9NB 1WG4A 2FC9A 2KM8B 2VONA 5LJ3Y 1Q7YT 1NO8A 1X4GA 2DH7A 1H2VZ 2M9KA 2XS5A 3BS9A 2RRAA 2MPUA 1DRZA 1PGZA 1WHVA 2FHOB 2EVZA 3NS6A 5MLCV 2DH9A 1BY9A 2PE8A 2J76E 5CA5A 2OTJS 5IM0B 2QFJA 3UCGA 1N52B 1HA1A 2HGLA 2CQDA 3D2WA 2N3LA 3FEYB 4V19X 1U1NA 3Q2TC 2MZRA 2DGSA 1VQ9S 1ZH5A 2CPIA 3S01A 3UCUP 3SMZA 2O3DA 3UWTA 3CF5Q 1P1TA 1VQ4S 1OIAA 1VC5A 3CTRA 4M5DB 1W2BR 2DGUA 2JVRA 3P5TL 1M5OC 1M5PC 1FXLA 2DGWA 2DGTA 1WG5A 1FHTA 2MB0B 1U1KA 2VODA 3VAJA 2CPHA 1WWHA 1DHMA 3TO8A 1U1PA 2U1AA 3OW2R 5H1SV 2DNKA 2M70A 3LQVA 1YJNS 1ZZNA 2DIVA 5HL7Q 3L3CA 4C7QA 3MUTP 2LMIA 1HD1A 2CQ3A 2OSQA 1FJEB 1XN9A 2DK2A 2XNQA 1URNA 1X5SA 2LYVA 3H2VE 3S6EA 2E44A 3B4DA 2MMYA 3IRWP 3HHNB 2DNMA 1VQKS 2DNHA 4YB1P 2HVZA 4OZ0A 1NJIT 2XSFA 2CPYA 1SJ3P 1M1KT 3MDFA 2BZ2A 1M5KC 1QM9A 3SXLA 2OIHA 1VQPS 5GAEU 4C4WA 1U1QA 2KFYA 2DHXA 2MHNA 2ZJRQ 2MJUA 2LXIA 2MZSA 1H2UX 2DIUA 1H6KX 4ED5A 2FY1A 5FJ4A 4Z2XA 3ZZYA 1VQ7S 1RKJA 4CH1A 3U1LA 4CQ1A 2XS2A 1OWXA 2MZ1A 2G0CA 3MD1A 2MGZA 1YI2S 2JRSA 1KQSR 3S8SA 4ERDA 2D3OR 2U2FA 4C0OC 1QVGR 3PIOQ 5DDPC 3BO2A 3VAIA 2RS2A 2MQNA 1A7GE 5DETA 3BO3A 3CMES 1U1RA 2MGZB 2MY8A 4ZKAA 1WG1A 2X1FA 1P27B 2LQ5A 2MQOA 1O0PA 3NNHA 2KHCA 1VQMS 3MURP 2BOPA 3SDEA 1Q82T 1YTYA 4TLQA 1WTBA 2V94A 3G6ES 2HGMA 3RW7A 2AYGA 1X4HA 2KXFA 3CCJS 4WIIA 3SDEB 2KG0A 3CCVS 1JJ4A 1VQNS 1ZZFA 2JWNA 2DO0A 4QU7A 3I56S 1RK8A 5LJ5Y 2MKIA 1VQ5S 4QPTA 1X4BA 1WEXA 2CQCA 1OPIA 4P6QA 2HZCA 2CQ2A 5LSOA 1DBDA 1U1OA 1U2FA 4IUFA 2CQBA 4YOEA 2RNEA 2G4BA 3MOJB 4F25A 2DH8A 1X4DA 1CVJA 2QEXS 3EGZA 2KU7A 1F9FA 3G4SS 2LEBA 2N7CA 2J0SD 2VOPA 1K8AT 2VOOA 2DNLA 3CCES 4EGLA 1WEYA 2YKAA 5HO4A 3CD6S 5GADU 3THTA 5IQQA 2DGOA 1M90T 2D9OA 5GAGU 5ITHA 4BS2A 2DHSA 2ZJPQ 2MKCA 3G71S 2DHAA 2KG1A 3MD3A 2XB2D 1SJ4P 2YWKA 4OZ1A 1N54B 4LIRA 5D77A 1X5TA 2X1AA 2AD9A 2MQMA 3CCQS 2B0GA 2DNRA 2AYBA 2CQHA 2K8GA 2M8HA 1N8RT 2CPZA 1X4FA 3IWNC 2MZQA 2KI2A 2F9DA 3CCSS 4UQTA 1VQOS 1YJWS 1KD1T 1KOOA 1FJ7A 2KT5A 2MXYA 1S72S 2MKKA 2CPJA 2YTCA 3VF0B 4Y0FA 4W90B 2OJ3A 4WF9Q 2G1DA 1DZ5A 4W92B 2DNQA 1Q81T 1WELA 2N82B 3MI7X 4TU7A 3UD4P 2D9PA 2DNPA 1YIJS 3PIPQ 2MZJA 2FC8A 3G8TA 1X5OA 1H2TZ 1IQTA 2KN4A 1X4AA 5EN1A 2F9JA 2MQPA 1FO1A 4YUDA 2CQIA 5JVGQ 2KM8C 4IOCQ 1WI6A 2YH0A 5DDQC 3VAKA 1FNXH 4RU2A 2L08A 1L3KA 2DGXA 2KVIA 2HGNA 4FXVA 1YHQS 5GMKa 1K9MT 3K0JA 3TYTA 2MQLA 1N88A 2RS8A 3EX7B 5LXRA 2RVJA 3US5A 1SXLA 3BO4A 2X1GA 5CYJA 2LECA 2GO9A 2A3JA 2OTLS 3S7RA 1KC8T 3J7YU 1VBYA 5DDRC 3Q2SC 2CQPA 2FPHX 2KYXA 2KXNB 4U67Q 1QVFR 2DB1A 1X4EA 3NNAA 1OO0B 2RU3A 1SJQA 3NNCA 1KOHA 4WFBQ 1U6BA 2RUGA 1YITS 3N9UC 3CMAS 2KRRA 4QQBA 2HYIB 1HD0A 1UFWA 3G8SA 2CQ4A 1U1MA 1U1LA 2MYFA 2ERRA 3P6YC 1VBXA 5BJRA 2ADCA 3MUVP 2LEAA 3THPA 3NMRA 1AUDA 4TU8A 3CULA 2M0GB 2KRBA 3JB9k 1Q86T 3VAMA 3HI9A 2CQ0A 2PEHA 2MY7A 2XNRA 3P49B 3J7ZT 4A8XA 3R1LA 1JMTA 1NU4A 1WI8A 3MXHP 1WF2A 2CQ1A 2I2YA 4IOAQ 2AYEA 2MKJA 4WFAQ 4PKDB 2M88A 2DGVA 4FXWA 5IM0A 3CCMS 2WBRA 2MZTA 4QU6A 1YWXA 1HL6A 4WFNQ 2Q79A 1UP1A 2MKHA 2KH9A 2QA4S 5LXYA 2DNYA 3DLLQ 5LSLA 2MJNA 2MQQA 4PRFA 2E5IA 2I38A 2RQ4A 3DXBA 2J8AA 5IFMA 1WEZA 2JVOA 5JVHQ 3VAFA 3CC7S 1FT8A 5DDOC 3CC4S 3MUMP 3EGNA 3RW6A 1M5VC 2MSTA 3CC2S 2E5HA 2MSSA 4CH0S 1VQ8S 4TU9A 3I55S 2DNOA 1X4CA 2YH1A 2K3KA 1SJRA 2M8DB 3CCUS 2CQGA 2LCWA 2M2BA 1VC6A 1WF0A 5GVQA
chains in the Genus database with same CATH superfamily
1JLGB 4JI7F 3MEGA 3AD7C 1SIWB 1W7WA 2E7VA 1FDBA 1M5SA 3AODA 5KTQA 3A4TA 1Y0HA 2HNZB 1SKSA 3T5HA 5D0EA 5H9FJ 4NCAA 1JJ2R 1N32J 2ZVIA 5LMNJ 4C8YA 2HWIA 3BSNA 1SJFA 5J1NA 1DTQA 2X3GA 4MYTA 1D0EA 3W2VA 3M8SA 4ATNA 1RHRB 2OSRA 1WHWA 4CTAB 4DZDA 3OHBA 4PXCA 2NLWA 3EMTA 1GH8A 2EXUA 1VBZA 1LKZA 2BE2A 1FFWB 2CNOB 2VL1A 1IKVB 3TX8A 4YDDB 3N5FA 4C6AA 3MAAA 2AJ0A 1ZBTA 1HHSA 3D5MA 4CCHA 4WU2A 1APSA 2QG9B 2R42A 2EW9A 1I6JA 2A18A 3JTOA 1N5YA 1XMQJ 1BMQB 1O6XA 2Z58B 1SIZA 3HJVA 5EWGA 2M9KA 3T5JA 4LF9F 3H20A 1SUQB 4OHYA 2E1RA 2HGLA 1VGYA 2YVSA 3E01A 3ZTRA 4H4MB 1P1TA 2CNKB 3EZOA 2R3VA 2GGPA 1WC5A 4EWTA 2Y1JA 3VAJA 4J9SA 1D1UA 2B56A 1IR2A 2Y1IA 4Y6IA 4ECRA 1HNXJ 4JI5J 3S6EA 3U02A 3ZZRA 5AXLA 1M1KT 2FVRA 2YWHA 2OIHA 4ILMA 3D6HB 1EQ0A 1KQFB 2LXIA 3EDRB 5E33A 2OLWA 4PWDA 3R9LA 1MWQA 2XY7A 2RE1A 2KDOA 1UJ6A 3J7A1 2Q6BA 2I5JB 3UN2A 1NLKL 4C0OC 4X62J 4MIAA 4ANDA 2MQNA 1XQIA 1JLCA 2P6TA 5H9FK 2X1FA 1QDUB 2MQOA 3HCXA 3VQSA 4OIXA 3AJ2A 1LW0B 5CYMA 3TZZA 1T05A 2YKMB 2HPUA 4NLSA 2RJZA 2AGQA 1KP6A 1LFWA 4NLQA 3ZZUA 1JJ4A 1S1UA 3CCVS 1AA1B 3DLEA 4OYZA 2GIFA 3EJMA 3NL0A 3RUBL 2G1HA 4HACB 2EI5A 2BQRA 2E7WA 1LV5A 1IWGA 4YOEA 3VQTA 4G3IA 3HZGA 5AXNA 4A46A 1S6QA 2PI5A 2YKPA 4QIEA 4E98A 4B9TA 5ETLA 1QJHA 4DR5F 2VOPA 3KK2B 2C28A 1FD2A 3THTA 1SH0A 2JLGA 2D9OA 2IPOB 5A8WB 5F8MA 2GIRA 2DHAA 2YWGA 1ULRA 4F3QA 2UVVA 1GEHA 4ZVPB 1UVJA 3CCTA 4HH0A 3HFKA 4ILLA 2F9DA 2OO4A 3QZ8A 2QJ3A 1FJ7A 2MXYA 1NPKA 4BWMA 4A8QA 3AOCA 1NRKA 3I0RA 4W90B 4WF9Q 2P2CB 5HQ8A 3V4IB 1IJEB 1GT8A 5HQLA 2V4JB 1KS2A 4ZMMA 1C1BB 2OELA 1UA0A 3NGUA 5EN1A 2NSCA 1CJUA 2MQPA 3I5BA 2HZVA 4NA2A 5JUMA 4M5LA 1DARA 3DM2B 1UVNA 3TYTA 2HK3A 5C5JA 3T1YF 5CYJA 1WKKA 3DLKB 1UVLA 1FA0A 4ZS6A 4NXMJ 3NNCA 3QSIA 4M5IA 4ZDNA 4QQBA 2R8KA 4B9MA 2YX1A 3K5OA 4GKKF 1MLAA 3FSYA 2ERRA 3MECA 2LQ9A 5BJRA 2HS0A 2YWFA 2UUBF 3BGRB 4QR0A 3FZBA 4ED6A 3GV5B 1HWIA 2ZBPA 3DRRA 5KFYA 4A8XA 3R1LA 2E9RX 3NMAA 2QLBB 2JEIA 2OI2A 3CCMS 3W9JA 5IM0A 2R4FA 1O8BA 2MZTA 3B54A 2GV1A 2F63A 1FRHA 1HARA 2AJFE 4PRFA 1CJKB 2XBPA 3QLHB 1HWKA 1RCOB 2HHPA 1EKSA 4B9LA 5D0GA 3V5RA 3CC4S 3AD8C 3KLEB 4CH0S 3JAMU 1X4CA 2HNYA 1UWAA 3I0SB 2M8DB 4FVCA 2M2BA 3FBEA 3HKWA 4ZVEA 2ZUAA 2R8GA 2CPFA 3UCZP 4ZVUB 3OTBA 2UV8A 4JV5J 3OT9A 2J6UA 1KEKA 4O3QA 3D54A 3MAHA 1LEOA 4F04B 2CDQA 4CP5A 4Q8EA 4DJBA 1RTJA 1PYOB 3D1HA 4ENOA 4ECYA 3L7UA 3QT7A 2J0WA 4YS2A 1SC6A 2HVHA 1ZOTA 2LXUA 5DQIA 1U25A 3KLFA 2CNLB 3NY0A 4DN9A 3I32A 1S12A 2CPEA 4ZP6A 3IO1A 3N4WA 5LM7E 4RKUC 2C2RA 2BW7A 1RBLA 1IUJA 2KM8B 1Q7YT 1NO8A 4JYAJ 3NWRA 1RT6A 3W5XA 3HX9A 4AFFA 2CJBA 1BY9A 1R7IA 2J76E 2O01C 3GB0A 1Q7LB 2XLKA 2DRDA 4I7FA 2B8QA 4FZVA 4LRDA 5ETNA 4NCBA 1JKHA 4LUBA 4QYZK 2IAJB 1XNQJ 1ZH5A 2HNDB 2ZWPA 1NK7A 3S01A 3RRHA 2JL9A 4UTGA 4MKAA 4NZ7A 3ET6A 3DKDA 2DGUA 1CJTA 3MM6A 4WXWA 3CJ5A 2IYGA 4NLWA 3W3SA 1GAOA 1OS5A 3C16A 4GC7A 3IG1A 5KFDA 5HL7Q 4KGZB 2PA3A 5B0BA 3DC2A 4UOHA 4KBIA 5FDLB 3QGPA 3J80U 1F2GA 5ETTA 3HO1A 3PX4A 2VDHA 2O5DA 5D4NA 4DFKA 3PKYA 3FBCA 3CD7A 4DS5A 3JQMA 2BJ9A 2AZ1A 2EKNA 3ILLA 4MK7A 1S99A 3JQJA 1Q4RA 3GIMA 3BREA 4CDIA 5KFEA 1IBKF 1A7GE 1HBNA 1U7LA 2CXEA 1D09B 1TL1A 2QL7B 2CVEA 1T9YA 5B0GA 2D41A 1YTYA 1KQGB 5C42B 4DBQA 2W9BB 2KXFA 3TJ9A 4AL5A 1NSPA 1TKZB 5CYQB 2ZHOA 4DV7J 1CSJA 4QPTA 2ZZNA 4I64A 5IT4A 1GQEA 4USWA 3DHXA 1HNZJ 1RBOB 1QUVA 4RBTA 5D8HB 2GMJA 1N34J 1BE4A 1U6ZA 1MWYA 2DHSA 2MKCA 3PNIA 3RRKA 5IV4A 1BHNA 2OPSB 1NBEB 3PG9A 4RW4A 2DNRA 2AYBA 5RUBA 2RF2A 3CCSS 2KFNA 5D4OA 3CT9A 4YN3B 1ZS6A 4Q45A 1JLAA 4IFYA 2BDPA 2Q66A 2PA8D 1XMOJ 1X7VA 1Y3JA 2A2CA 2JLFA 2MZJA 3SQGA 1K47A 3I6PA 2F9JA 4OLPA 1WI6A 2R8JA 4ED0A 3NGTA 4R0JA 1NM2A 4F4YA 4J7CA 2MQLA 2VG7B 3EX7B 5DG9A 4LF5F 1S1TA 2AQ4A 4RW7A 5D3GA 1VBYA 4OX8A 3BQ0A 5C24B 4UW2A 3IN5A 3N5BA 1U45A 1DAXA 1YJTA 2XLJA 3C66A 4U9RA 1IBLJ 4NCGA 2XYHB 4FBTA 3DYAB 2Y1RI 3HF5A 3V6KA 1VJWA 2BE9B 3HI9A 3MMJA 4LF6F 4YMEA 3UR0A 1FE4A 1WF2A 5B0EA 4H4OA 4NWBA 3HFZB 4QU6A 1RWKB 4F36A 1QLNA 2MKHA 3WHIA 2MQQA 1ZM2A 4MFBA 2OGUA 3OVSA 2HG4A 2P8IA 2DNOA 4PG8A 4PABA 5BR8J 1S59A 3MR7A 1N0UA 3A3NB 2EFVA 1BQXA 2H5IB 2OPQA 2RDJA 3MTJA 3FEXB 1WKJA 3D0IE 3POTA 4AXIA 2NXNA 2XGQA 2PMZD 2RRBA 4HI2A 3DMJB 5IC6B 2BKNA 2HBQB 3L9ZA 3CIMA 3EXYA 2W9CA 2DEIA 3PXGa 4FKYA 4P2XA 2VICA 3MEDB 2ADBA 2QYGA 3OTOJ 1UWBB 4C98A 2J0QD 1EARA 5HI7A 4LFBJ 1RTIB 2R2SA 2P9GA 4OI0A 1U2CA 5CH7B 2YBVA 2KZZA 1Y5IB 7FDRA 3VAHA 1PILA 1L3UA 3KDNA 1PSDA 1REVB 3QPIA 2W7AA 3UDLA 2C22A 1HQEB 3TQEA 3U27A 4P73A 4M95A 2VONA 2XYGB 3E51A 1DLOB 3K8VA 4ZLLA 4ELVA 2M5YA 3SSRA 3FVYA 2EVZA 1TUGB 2OTJS 2DR8A 1PBAA 3RG6A 3RAMA 2GNKA 2PD1A 2IBOA 4IDKA 3CD0A 4L6V3 2L9DA 4XDCA 3KYLA 1WWHA 4ZVSB 4OYPA 1RBAA 5E3CA 2CDRB 4KE5A 2H4WB 2KVQE 2C2NA 3ITHA 4C7QA 5KFSA 4PWUA 1PG5B 2NXUA 3N0VA 4LF7F 4X2BA 1RT5A 3W61A 2P5VA 1ZAWA 2BJDA 4B3SJ 1EZZB 1TUVA 5F0UA 3EZ5A 1ZYQA 4OI2A 3G82A 1J5EJ 2MHNA 4TQRA 3BGLA 3H5YA 2AEJA 4GRSA 2JC0A 3MD1A 4H4KC 5B0AA 1UVIA 4ZK7M 2HHUA 3A8JA 4OYMA 2OD6A 3S8SA 2W7PA 2Z2ZA 1GMWA 1U1RA 2CAJA 2MY8A 1CC7A 4IO1A 1XEZA 3U1NA 3M05A 3MM7A 2ZFHA 2AYGA 4HH1A 3M30B 4M1KA 4DUZJ 2KG0A 2JWNA 4ES2A 1B3TA 4G1QB 4NLDA 4USTA 3UDEA 4KH1B 5AXKA 2C3UA 5LSOA 4IUFA 2CQ2A 3DLGB 2XZDB 2YPYA 3DXSX 3B78A 2J9DE 2QEXS 1YKWA 4ZITA 4TY9A 3MM9B 5T7LA 1RT3B 4JI2J 4F2SA 1RB0A 3CD6S 4WXOA 1HBOA 1CJVB 2C2KB 2W25A 1I51B 4L76A 2KJWA 2ZJPQ 3DGPA 4JI4J 3CDAA 2XO6A 4ETZA 1FCAA 4LF8J 2AEFA 9RUBA 2ZE2B 3IWNC 1RWVB 3TAPA 2XI3A 3ZNJ1 2KT5A 4OX9J 2MKKA 2XTJP 4Y2KA 5SZTA 2XWYA 1DZ5A 3R6GB 3IAS9 2LQBA 3PEHA 3K5NA 1S7HA 2FC8A 4NEYA 1ZAXA 2HK2A 2QMUB 2RU9A 1C0UB 4C8ZA 4YUDA 2KM8C 1U09A 1MG7A 5EHHA 1BD6A 4FXVA 3OLAA 1RWWB 4X4OA 4QW9A 2OFHX 4NI2B 3BYRA 3MR2A 3FEZA 3JSMA 4OYBA 4AL7A 4USUA 1MMDA 2W9AA 3AQOA 2V2ZA 3TZXA 1C1CB 1TL7A 2IC3A 4EBDA 1NHKL 1TAUA 4CLLA 1AZSB 4DFMA 3KK1B 1VISA 4ELUA 1EIYB 2MY7A 1RA6A 1WUUA 4WP9A 3M8PA 1YK9A 4PKDB 3CJQA 3BKUA 3WIVA 1TL3A 2NS1B 2FGCA 4IH6A 2MJNA 4EYHB 2M3DA 2JVOA 3K5LA 1PAUB 1SL1A 5HJYA 1HQ2A 2YWWA 3PO5A 4J9OA 4YR3A 1JLGA 4DPTA 2RIJA 1AT1B 2K3KA 2C1EB 2HFVA 1VC6A 5BYRA 1NDKA 2UXCF 4JI7J 1U0SA 2O1PA 5DRKA 4ZCKA 4UY85 1HYSA 3F44A 2HNZA 3A1YG 4M5NA 3CCWA 2BJ1A 1RWXB 3CCRS 2XEXA 1B0VA 5EDWA 4F02A 3EWGA 3KG4A 1NDLA 3W8PA 2QTWA 3HHLA 3OPKA 2FJWA 1LNQA 3G87A 4CTAA 2EK6A 2HMIB 5GAHI 5K14B 3LWMA 4A8OA 2AU0A 2HQ3A 2IA0A 1IKVA 3C3LA 3OFFA 4HHJA 4LBPA 1GX5A 5AXMA 3KMSA 5D0HA 4C11B 2UUCJ 2PGCA 3KLIB 1F60B 3LUYA 3M6XA 4Y00A 1KHVA 1OQ6A 1SH2A 4PR6A 1HPZB 4RUHA 2DITA 1F1BB 3A13A 4ZCLA 5E2QA 4YP3A 1SKRA 2EC2A 4Z7CA 2IM2A 2VHGA 3I87A 3J7AN 3PW7A 4Y28C 4G1IA 4OZLA 4LF9J 1OQ3A 2FJAB 1HA1A 4H4MA 1U1NA 4URQU 2BJ3A 1H7XA 2WW4A 1RT7A 1WDDA 2HBZB 3DLBA 4X4RA 4K4VA 3TVZA 2PDAA 2DGTA 1X9MA 3IXQA 2VODA 3JTNA 4OYAA 3DDIA 2DR5A 1KFSA 4J91A 5FLXU 3LQVA 4DDFA 3JQKA 3PFOA 2HVDA 3G86A 3VTIA 2JZ5A 4NYZA 2B6AB 3OUYB 1QAJA 3DDNA 3G6VA 1R8BA 1NK6A 1RU2A 8ATCB 5THWA 4C8LA 3JSYA 2VC0A 4KIAA 3BPDA 2I5JA 3T6BA 2IIHA 4DG1B 4RNOA 3ZTSA 4MKYA 1KQSR 5DG8A 4HI1A 4M63A 5F0WA 1GFWB 1LW0A 2IDLA 3BDEA 1FKOB 1VR6A 1CS4B 2BOPA 3MURP 1NKEA 4LBHA 3RRGA 4HACA 1NB2A 3CJ3A 3M1VA 2RHSB 1FX4A 3IP0A 1X0PA 3SDEB 1F0XA 3NOCA 3ENVA 4GMKA 1KONA 3VVTA 4C3LA 3SFGA 2W4PA 2ROGA 2RNEA 3QFWA 4UZBA 3IBFB 4MKVA 3KK2A 1RHMB 3TEGA 1YBTA 4K59A 4JBCA 1T9TA 4KY3A 5A8WA 1K8AT 4Y2CA 3OXLA 5HAOA 4U8YA 3OHAA 3I82A 1B99A 1G7CB 1NZAA 1XNRF 2WTFA 3TNVA 4CNZA 2M8HA 2HIYA 3MCNA 2HHQA 3V4IA 5G4DA 2WVDA 2V4JA 3VGVA 3PACA 2UVRA 4DV0J 1Q81T 4R0EA 1I94J 4C97A 4J9NA 4K4SA 1X4AA 5K20B 4IOCQ 2FYXA 2QGFB 2BX6A 3PYEA 3M4XA 2XI2A 4CLPA 3DLKA 4KTQA 1FEEA 4E8UA 1VJQA 3C14B 1PCAA 2E1AA 3R5BA 1EB0A 1RT2B 2EG2A 2FPHX 1TUWA 4ZPBA 1WORA 2IDEA 3N9UC 4B3TF 3A3OB 3OQ2A 4GKKJ 2ADCA 4YR2A 3T3FA 1UFLA 2MLYA 4DV4J 3O8WA 2KRBA 2UUBJ 1K1SA 1CLFA 3O1LA 3P49B 2VFVA 3IGNA 1CJKA 3QLHA 1H98A 4X4TA 4Q44A 2WBRA 2G2OA 4DXLA 2V8VA 5GMDA 2KH9A 2HIQA 2B5JB 1MMNA 2YXLA 2FHJA 3O5TB 3KLEA 1EP4B 2ZH2A 3RTVA 3FDSA 3SSSA 2GCFA 3I0SA 3LPEA 2RHQB 3BGUA 3EE3A 3KNAA 1VRTB 3ZNUA 2HVIA 3CCUS 3TA0A 1LXJA 4UY8T 5B0FA 4EZ6A 3WDOA 2OH2A 3TUIC 3VALA 2XS7A 4TVAB 2CG8A 3QT5A 2AP6A 1IN0A 3F0NA 3CDUA 5GMEA 4AYBD 4J9UE 5KFHA 2GQCA 2CPDA 3G9CA 1CULB 4NYPA 1GXTA 2M4MA 4DUTA 2PC6A 1X5PA 3G6XA 1YBAA 3QWPA 3KWMA 2LA6A 4NOHA 2ATLA 3OSNA 3VZIA 1S77D 4DLGA 1U0HB 1G3OA 3GR1A 4P9SA 4LQ3A 1TAQA 5DLGA 2VV5A 2EWHA 4F4AA 1RA7A 3UDCA 3LPYA 1F6TA 2MLXA 1JJHA 4DV3F 2I1RA 4L72B 2KKHA 5L9NA 2FHOB 3NS6A 4M5KA 2IAJA 1JWWA 4J9QA 2CQDA 3DCAA 4JV2A 4I2QB 3Q2TC 1KTVA 1URRA 2Z56B 4PXDA 3O3LA 2P9CA 2DGWA 4NRTA 5BXIA 1U1PA 1UW9A 5F8NA 2M70A 2ZWOA 5FDLA 1F3FA 2N4DA 4U7UK 2PT0A 3RB6A 3J81j 2YQ3A 4M94A 3RAXA 1N5SA 2KFZA 2DNMA 1F9HA 3MDFA 2V8HA 5KFVA 4XIUA 4N7TA 2HHVA 3IR7B 3UN5A 1RAGB 3FSXA 1NJYA 3ZZYA 4RU9A 3HVAA 1NKCA 4DR1F 2FJVA 1YDLA 5F8HA 2GVZA 2QT7A 1BQMB 3BH6B 4O23A 1U8WA 2ZC3A 3H5XA 2RKIB 1FESA 1QUPA 3BPSP 2UXDF 4PQAA 3TZWA 1IBKJ 4ZKAA 2CJ9A 2LQ5A 2QA4G 2VF3A 4DR7F 1CQNA 3NNHA 3Q83A 1AB8A 3DOMA 4DV2F 1TKZA 3HP6A 5CYQA 4TLQA 3H40A 2DXDA 3H90A 4A8KA 3CCJS 2AT1B 1VQNS 1ZZFA 3G8QA 2AGPA 4OHWA 4HYKA 1DQAA 2DPJA 3FKBA 1T8EA 2HZCA 2A6MA 4ECXA 1UKUA 1Y4ZB 3H42A 1PJ7A 4KGVB 2DD8S 3GYNA 3TUJC 2HBRB 4NLUA 4AUKA 4GO7X 2W8KA 4TY8A 4UOCA 3G4SS 1IM6A 3CCES 5HO4A 1UPPA 2ZZMA 1IBCB 1RAFB 2J9CA 3NAHA 4CLSA 3M8QB 4Q2MA 4JI3J 4NXNJ 2ATCB 3TRGA 2CIMA 2B0GA 2OPRB 1J27A 1UEUA 3ILOA 4USMA 1RI7A 3FQKA 5EX0A 5KFWA 1F3VA 5EWEA 4LRCA 3TW0A 4F4KA 2YTCA 2CZVC 1EJ7L 3I31A 2PFDA 5KG3A 2ZBRA 2D69A 2VG7A 1FNXH 1C0TB 4LRFA 1JNZB 4X64F 2CFXA 2XMAA 4ZCIA 2HHHF 4TLRA 4J37A 2A3JA 1HBUB 2K06A 4P10A 2VG5A 3TOQA 3C6TB 4JI0J 1YRTA 2CZ9A 4E0DA 3J7YI 2BOAA 1SB6A 2HYIB 1YGYA 1UFWA 2J7UA 2FJXA 3DYAA 2ZBCA 3ELHA 4DQRA 4A8FA 4NLOA 4ZJLA 3KHGA 2JH3A 1NU4A 1WDTA 3OL6A 5KG1A 2O67A 4O44B 2VD3A 3TAQA 1HNWF 4Y2AA 1FTRA 3S1TA 3VVUA 3BM7A 2YH1A 4F8RA 1WF0A 2BRLA 2AYMA 4WKRA 1YSJA 5DGAA 2ZZTA 1GX6A 2UV8G 1VLYA 4C8OA 2AEMA 3DMJA 1XR5A 1HHQA 5HVGA 3B82A 3LP2B 3H7HB 4DR3F 3MEDA 3CCLS 1QSSA 5IT9Y 2ABYA 1LK5A 2LLZA 3Q22A 3SFUA 1UWBA 4EMDA 2ZC4A 1HR0J 1HQUB 5HMWA 2AKWB 1RTIA 5KAKA 3ULHA 4KO0B 1LW2B 2DO4A 2GHPA 1M0SA 1HNIB 1VBKA 4OJHA 5KFRA 4CWBA 4USHA 1S57A 1REVA 1S0OA 1NPPA 2FZGB 3UE2A 4ZIWA 4HDHA 4O0NA 1DLOA 4IR1A 3HMJG 2X1BA 3KUGA 1TKXB 2WRMA 5A8KB 3Q8UA 1IBMJ 3JSBA 3D66A 2VG6A 1BQNB 2V8PA 4ED3A 2G0JA 3KHHA 5E0OA 3F56A 4F4XA 1IKWB 3SMZA 2VBWA 4RW9B 3OFGA 2B9YA 2V63A 1U1KA 5KFZA 3TO8A 2EEYA 2WONB 4LR9A 4PAAA 3EM1A 1ZZNA 3L3CA 1Q8LA 3I96A 4FYXB 5L1IA 1R31A 2LYVA 3E2EA 3HSDA 2DNHA 4P2MA 4LF7J 2XSFA 3ADAC 3AJ1A 4B9SA 2KHDA 2VH7A 4WP3A 5CABA 3W8GA 3KHLA 4ZJOA 1H6KX 5FJ4A 4CH1A 2QL9B 4M5GA 4C9DA 2HBYB 4NLYA 5DDPC 2RS2A 2LFVA 1X9WA 2B4OA 2ZH3A 1P27B 1QAXA 2BQUA 3CDWA 5J2NB 4DL3A 1NJZA 4ED2A 2AIRB 4G1QA 3FRZA 5HN0A 3HD2A 3DLGA 2D3O1 2B7BB 1OPIA 3D67A 3X3UA 1L5UA 5KFFA 2ZDOA 3MM9A 3N6NA 1RT3A 1N33J 5KT5A 1CJVA 2QLFB 2BM1A 1Z4UA 3C2PA 3PO4A 1Y00A 1MU2B 4FXDA 4HHHA 3GP9A 2ZE2A 4K4WA 3R5DA 1X9SA 1B70B 1N8RT 4IRKA 2W1BA 2EFNA 1D9DA 3TX0A 3IGVA 2L9NA 1T03A 3UNYA 4W98A 3MF5A 4ALZA 5F41A 2HWHA 3MI7X 2WSFC 1F2HA 2FJBB 1P9QC 3OSPA 2BUNA 2ROPA 3MPYA 5KT4A 1VIXA 3LP0B 5IC4B 4YB5A 4EFAC 1YHQS 2BM0A 4NI2A 1TMMA 1SXLA 4ECSA 4QW8A 2E9ZA 1KC8T 3BSAA 4KB7A 4OJ1A 1OO0B 2K2PA 2YNFB 1TKTB 1N5VA 3AAWB 1AZSA 2MYFA 4MKBA 3KLHB 4DL5A 3FK4A 2V2KA 5B09A 4HLBA 4K2XA 4X84A 3GJSB 4P7TA 2HRYA 4OX7A 2UXBF 2ZH8A 3FCHA 3FRYA 3D7SB 3SCLE 3MCSA 1XERA 2XSJB 3AH6A 1UP1A 4DCPB 2J7WA 2I38A 1FNMA 5DDOC 4I67A 3F73A 1NSQA 5ETRA 1OYDA 3CC2S 1TMJA 3OTCA 2LQ8A 2HLUA 2FLNA 2G2ZA 2IA6A 1WOSA 1S9FA 4WFYA 3J81U 2M7SA 1I5OB 5A6WA 2UXCJ 2K3IA 4LSLB 2H4YB 2IRUA 4FP9A 3HSJA 3ZXWA 3BGFA 4DX7A 2RQMA 5DQHA 2VFUA 3GYGA 2F65A 4I4BA 2EK1A 1VQ6S 4O3OA 5DG7A 1T0TV 5D78A 1S79A 2I0XA 3FBBA 5A0YA 1Y7PA 5F3ZA 2OEJA 3KLIA 3ISZA 1KRPA 5L8RC 2BEFA 2QLXA 2LVWA 3Q8RB 1WOPA 1DTTB 1HPZA 4DV6F 3FSIA 1VC0A 4B3RF 1B7FA 3CCZA 3KK3B 1FF2A 1VS3A 3R7BB 4IOBA 1RYSA 5DM6Q 1TQLA 3UQSA 3EDQB 1UAWA 1WJ9A 2BRKA 1H2VZ 3NG8A 2GC8A 3QT6A 4EYIB 4B3OA 3GYXB 2WVEA 2PO4A 2Z2YB 4X4VA 1VHFA 3IBCB 3W2WA 4WFXA 4FF4A 1TVRB 1S1VB 4K0KJ 3ETOA 3N79A 3QNWB 1Q95G 3E3XA 1Y5NB 3MMBB 4B08A 3VCDA 2W2MP 1P6TA 2VJUA 4JI8F 3MUTP 1HD1A 1UZDA 2QLJB 2B6AA 2QL5B 1M5HA 4FN5A 2WVBA 3MMAB 1Q0NA 3W60A 3CB4A 2VASA 5KFBA 2WW8A 2J0XA 1M5KC 3OR2B 4JP8A 5GAEU 4I1TA 2KFYA 3AQPA 4KFBA 2MZSA 3IR6B 2OUGA 2FY1A 3TUPA 3PV8A 2G0CA 3MR5A 4DV5F 3V6JA 4D3GA 2HQFA 2FZKB 4MK8A 3PIOQ 1FKOA 4FF2A 3BGOP 1CS4A 3HDSA 3H0PA 1WG1A 4QOTA 5IT9U 3PW0A 3ZZPA 4WTOB 1Q5YA 2HQCA 3SDEA 4PPDA 4A48A 4YY3F 3MAAB 2R9LA 3NEKA 3VHQA 3JTPA 2C2EA 4LVNP 3TI0A 4O4RA 1RXOB 4NLVA 2MKIA 5DLFA 3N6LA 3MOJB 4P72A 1TKDA 5ETMA 3DOKB 2MLZA 3GCXP 4FNIA 1HWLA 2DNLA 4KHMA 1O5JA 1M90T 3E01B 1IR1A 4C8KA 3RYLA 4A47A 1S5ZA 1TU0B 1S7IA 4G6VB 2NREA 2GGPB 3GMGA 4RX6A 2AD9A 3I9ZA 1FEHA 2DR6A 3IWXA 4I56A 3K89A 2GQ2A 3NGRA 4LFAF 1X4FA 1VQOS 2L3MA 4KHRA 4Y34A 3TQ1A 4ILRA 1WC3A 3PZPA 1SBRA 4PCQA 4F7VA 3SCKE 3Q86A 2VKZG 3G8TA 1Y3KA 1IQTA 2KN4A 3K59A 1FO1A 5JVGQ 3GWCA 4FYWB 4ZPVR 1EAYC 4X62F 4JB8B 3C14A 2CA9A 2RS8A 1LWEB 1RT2A 4XAKA 5LXRA 3US5A 2X1GA 3R5CA 1DURA 5DDRC 3ILJA 2WVCA 3ETMA 4ZVTB 3CSKA 2W8LA 3CGIA 4DR4F 2XMKA 3G8SA 4PG6A 3SEOA 5DS7A 1VBXA 5HQMA 1VFJA 4V19J 4ZVHA 4TU8A 2RILA 5KT6A 1CC8A 1F9EB 2UU9F 3QIPB 1EP4A 5HVFA 4ES1A 3J7Z5 2ZHBA 4DQSA 4UOGA 1FDAA 5KT3A 2LDIA 1N6QA 5JVHQ 3JYTB 4KT0C 3RW6A 1K0TA 4TU9A 4PQUB 3WIUA 3GR0A 4LMZA 1JLQB 1FDDA 1RHJB 1YJ9S 2JDJA 1LOUA 5HATA 1PAEX 4X65F 1NHVA 4X4PA 3ZTQA 3RBDA 2Z2LA 4CLUA 4J5OA 4AXJA 5A2QY 3QGIA 2F3JA 3A12A 2QMWA 3ISNC 5KFOA 2WCXA 2E5GA 2EBEA 2BKOA 2EPIA 2HRUA 4OYWA 2ZNZA 2GQQA 3ILIA 3ZC4A 3HHEA 3CIZA 4P2SA 3PR4A 1UZHA 1N5QA 1U0HA 2IJRA 2ILYA 3QO9B 4NXMF 4P7VA 1RAIB 1HWUA 2E5LF 2XZTB 2HQDA 3MR3A 3PTWA 5HP1B 1QSLA 2F40A 2F4VF 2RDIA 2NUUG 1RACB 2VBZA 4GVBB 4DQQA 3IMQJ 1UPMB 4DI6A 1TFWA 2BJ7A 3OLBA 1V3ZA 5D6GA 3EPGA 4DV3J 2J7KA 2GVDB 4W4MA 3QGHA 2OKQA 3DRRB 4BDPA 1PGZA 1WHVA 4I2QA 2PE8A 5HK4A 5IM0B 4ECWA 2W2QP 4TNOA 4Q43A 2F4FA 3GIIA 4OJGA 2B4UA 4TKTA 1RHUB 2NZCA 2DGSA 1R27B 4YB7A 1GMWD 5HROB 1VQ4S 2GX8A 4M5DB 2J9EA 3MZIA 1AROP 4K4ZA 1IKYA 3UPFA 3LGHA 2HHSA 4DWIA 2CQ3A 4ID5B 3RBZA 4YHHJ 1BXNA 3SYZA 3A8KA 3RU0A 3FC9A 1ICEB 3H2VE 1NK5A 3CEDA 3ZO7A 3H5UA 4OJ3A 1NEEA 1M1HA 4WIQA 3AFGA 1MNEA 5IV3A 3NS7B 5F8LA 2W4CA 4KGXB 2DIUA 2E1CA 5IZHA 2WOMB 1PJ5A 1BQMA 3H59A 3UO0A 1TK0A 1FK9B 2RKIA 3QZ7A 5IXUA 5KFXA 2DRBA 5CCMA 2D3OR 3QMQA 1QVGR 4ECVA 5KFQA 5HANA 2XMWA 3CE8A 2ZM6F 3BJYA 2UXDJ 4QIWD 4DR7J 1IR0A 1XTZA 3AOBA 1U8SA 3IWLA 3D0GE 3I5AA 4URSA 4RBVA 3ZTPA 5CD4A 1U26A 4JYAF 4Y3CA 4OX6A 3TA2A 3I56S 2BJEA 5M2UA 2XHWA 1X4BA 4QYZJ 1VQSA 2ZH7A 1FI4A 1DBDA 2NXCA 1GXUA 1Q78A 1RKIA 1RT6B 4MIBA 5KFGA 4LIWA 3QJPA 3OTDA 1S0MA 2CRLA 3BR8A 3P96A 2JOQA 2OPRA 2V4RA 4PG4A 3G71S 1ZA2B 1HNVB 3MD3A 4KH0B 4DF8A 2YWKA 4ID8A 1YJUA 2YX7A 4Z37A 5GAGI 2AJ2A 2K8GA 1FRMA 2VFTA 4WZQA 3BB5A 1KFDA 1KOOA 4ER8A 3AXMA 5K9FA 5HBMB 2V8GA 2CPJA 1T95A 4CO5A 2EC0A 3CO9A 3KJNB 1H3DA 3T41A 4R8UB 2FLLA 2I6WA 4FKXA 5D4LA 4LR7A 3FGVA 1HBUA 3AD9C 2ZD1B 2IM0A 2AWZA 3SCJE 3C6TA 1B0PA 3W5ZA 5ETVA 3RJMB 1OY6A 1T9WA 3TR5A 4OZ5A 5F9NA 2WZ1A 3D6TB 1RTHB 4Q0BA 2EFPA 4HL9A 4CLKA 1QVFR 1KWMA 1DQ9A 1G4CA 4RNMA 3C19A 2OEMA 2CQ4A 3PRDA 1VRQC 2V50A 4IKAA 4I6AA 3THPA 3IAM9 1SQEA 3JB9k 5J1EB 4ZPWR 2IMOA 2PEHA 4HEA9 1HNZF 4NMLA 3J7ZT 1VI7A 1H38A 2QN6B 3HHLD 3I9V9 4IOAQ 2MKJA 3LGNA 5KFIA 3BH7B 3QYYA 1S4FA 2BW2A 2JJ4D 1SKUB 1T9XA 2D3ZA 4J9KA 4OHVA 1QTMA 1WEZA 2AJ1A 4YDXA 2DPIA 4USVA 3KXDA 3G6YA 1HNWJ 4FS2A 2GJIA 4R25A 2AJ4A 3L09A 1ACMB 5ETSA 1VK8A 1SKWA 4RW4B 3V6DA 1F5CA 4WE1B 3LP2A 3CUNA 3GFXA 1JLAB 2VJVA 3OTEA 3KNGA 4KAIA 3T1HF 4C0BA 1JIHA 1UTAA 5JXSA 3TVYA 1Y9OA 3UD3P 1HQUA 1REGX 4RUCA 4FYYB 1W25A 4DR3J 3H2UB 4AT1B 4KO0A 1R8HA 1HNIA 4DOZA 2R7WA 3P3DA 4ZP9A 2H3EB 5F8IA 1R0AB 2PMWA 5D3GB 4ZPAA 2BABA 3CXCR 3OVAA 2GZOA 2UP1A 1JXEA 1RAHB 4HHUA 5I3UA 2X3DA 3AJDA 3QRPA 1TKXA 3ZZZA 3LANA 3I4PA 2JX2A 4DL6A 1QAIA 1GTEA 1WHXA 5B7WA 1S0VA 3B4MA 2V9KA 5KFUA 3CJKB 1BQNA 1X4GA 3P4UB 1RSCA 2ACMA 1DRZA 2ZOFA 2ZH9A 4IQXA 3SQOP 2N3LA 3HLUA 3GZ7A 4RW9A 4L3KA 5IQ6A 1OYEA 2WONA 5BR8F 1N4LA 2XO7A 4MTPA 3P5TL 2XQCA 1VCTA 4OI1A 1AYEA 5K8OA 2YX4A 1UETA 2CADA 2JFKA 1YJNS 1XR6A 2EFGA 2AF6A 3X1LB 1FJEB 4P52A 1VK3A 1RGVA 1LWCB 1SI9A 1CPZA 1OSCA 4OI6A 1RQ0A 1QM9A 1S1WA 4RW8A 1T3OA 4UZCA 2VA2A 4AD6A 3FMWA 3TUZC 1VQ7S 3T9ZA 1NK0A 4DSIA 4LFBF 3DRPB 1YI2S 3W64A 3C6UA 2QO3A 2U2FA 3ICLA 3BO3A 5A2QU 2C2MB 2MGZB 3QATA 3FUYA 5J2NA 2XM3A 4Q8FA 4X4QA 2E29A 3LGMA 5D4PA 4QWDA 5KFTA 2VQFF 4WIIA 4K4UA 4C2MA 1P8GA 3M2VB 5LJ5Y 3KFWX 1RT4B 4CM0A 3PJWA 2YQ1A 3C15A 4LSNA 1IM4A 2GW8A 2BBEA 4LBIA 4KPCA 5BYQA 2V34A 3PRVA 4PYDA 4OL8A 4EBEA 5ITHA 4BS2A 4O4GA 1YJ7A 3MM5B 1A6LA 1TV6B 5KFPA 4S0MA 1UJ5A 3CCQS 3QIDA 2E1MC 3GSDA 1R6YA 1YJWS 2BQ3A 3AOAA 1S72S 3W9IA 3TZYA 3PVXA 3CJ0A 1XWLA 4TU7A 4G65A 2D9PA 2OHDA 3MMCB 3LP0A 3MHYA 4WPAA 2XGPA 3M2UB 2IBKA 3ZFVA 4J90A 7FD1A 3PM9A 3Q8YA 4ETXA 1AXQA 3G82B 3R2CJ 1SL2A 2JEGA 3SCIE 2FHJD 1QE1B 1JK9B 2RD5C 5J2QB 2RVJA 1S9EB 3K8WA 1V5IB 3KKFA 4JI6F 1CEZA 1TKTA 2FLPA 4PXEA 4WU3A 5LMUF 1GTHA 2W2OP 3ZZOA 5LOQA 3KLHA 4DUZF 4NLRA 1DQ8A 3BN4A 5A6PA 3NRBA 4K4YA 3GIKA 3M6WA 3MUVP 2AV5A 3W1YC 2UZAA 3NMRA 3JAMY 3KLGB 4TQSA 2XSJA 3TA1A 5KOXA 5AJ3J 2CQ1A 2BR0A 2UXBJ 4JI2F 3B8HA 4LFCF 1YWXA 2VDIA 3BV8A 1TELA 2UUAF 3DLLQ 4QR1A 1PJ6A 3PY8A 3DXBA 1NK8A 2GAGC 1Q53A 4JI1J 1E6YB 3CC7S 1FT8A 1MW7A 2K1RA 4LF8F 3EGNA 4B17A 1M5VC 2MSTA 3DNCA 3MEEB 2MSSA 1O51A 4ED1A 5BYSA 1L3SA 3DGPB 1RT1B 4F0KA 4EK2A 4DL7A 5GVQA 4OYIA 4LSLA 3P8BB 3DRYA 5C7PA 3R27A 1RAEB 3R7SB 1UEKA 1G6BA 3R8YA 3R1HA 2ZH5A 4DX5A 2A2DA 2SXLA 1SV5A 3SIPB 4P75A 4IG3B 3U7JA 4CRJA 2BXJA 4DSLA 3GONA 4IG0A 3IR5B 3OD2A 1WF1A 4L3NA 4NLGA 2XG8A 1UCNA 3Q8SB 3THVA 5KFLA 4OZJA 1G2EA 1DTTA 1BWVA 4QZVB 2CYYA 5DM7Q 1RE1B 4IQMA 1PC4A 3M9MB 3KK3A 1U6FA 3R5AA 3JSMB 4QIGA 4C48A 5E3QA 2CJAA 4DV6J 2DNGA 4B3RJ 1WNEA 3KHRA 2QSWA 2ZITA 4RPFA 4WP8A 3RAQA 3DOLB 4NZ6A 1HBMB 2CJKA 3ZTOA 4DSKA 5KG5A 1KNZA 3GV7B 1WG4A 2FC9A 5LJ3Y 4JOUA 1Q16B 4FDFA 1TVRA 3M32A 4OI4A 2QFJA 1S1VA 2AZ3A 2JHEA 2XLIA 3J80Y 3Q8QB 3TAMB 1VQ9S 3FJ2A 3MMBA 2HWTA 3FCWA 1VYAA 3CF5Q 2HFZA 4RWXA 4ZN1A 3CJ8A 2PFFB 1R8AA 5DGBA 2DNKA 3MMAA 4JI8J 2QSFA 2DK2A 1RZMA 2B51A 4IRDA 2OP5A 3OR2A 3IRWP 1FWPA 1HYSB 2Y9HA 4YB1P 1NH7A 4Y2IA 3VV2B 4YFUA 4DUYJ 1FWKA 1R89A 3LW5C 5K8PA 4ED4A 3KJQB 2Z4PA 3Q8PB 2F5GA 3HHLB 3E8OA 2XS2A 2WB4A 1VRUB 4K5RA 4XPCA 4DV5J 4KGMA 2HURA 1MN7A 2C3MA 3BO2A 2UUCF 3KJFB 2K7JA 3NBPB 4F3MA 5CHCB 4OFZA 5KFMA 4ZVGA 2LDYA 4MH8A 1KLMB 1SPBP 3TARA 4OZNA 3TWZA 2J5AA 4YY3J 3M8WA 1S9GA 3H25A 2DY9A 3DOKA 5KG6A 4PPZA 3LALA 4ZLPA 4RWWA 2OMLA 2R7RA 2R8HA 1NNDA 3B6BA 5L39A 1CVJA 1K0VA 1Q8BA 2KU7A 1J2VA 4EGLA 2ROEA 5KG4A 3KUHA 2YKAA 3K7RA 1Z2LA 5B0DA 4DQIA 1HMVA 5HMYA 2PN6A 3M2RA 4L73A 4O3NA 1RT7B 3EVWA 2C3YA 1N54B 4LIRA 1BC6A 3IFEA 2V2VA 1HI1A 2VKRA 1YZ7A 3PDNA 4UQTA 1TP7A 1YJRA 4LFAJ 1GMVA 5DZ6A 2IVYA 3WZ0A 3NCPA 2YPZA 2DNQA 1Q1KA 2RSQA 4ICLB 3KMQA 1FXDA 2YNGB 1LWEA 4RU2A 5H9EJ 1FVQA 3QBCA 2DGXA 2HGNA 2AMCB 4GKJF 5GMKa 1QSYA 3LTOA 3K0JA 3EICA 1TL5A 1P9YA 4ZP7A 3CJ4A 3AA8A 4OZ3A 4ZPTR 3S7RA 1NK9A 1WC6A 3MFIA 2QC3A 2DY1A 1Y11A 2MTLA 4M8LA 1HD0A 4ECTA 4DR4J 4I6YA 1RLDA 3QJJA 2J6SA 4DPWA 5K8MA 3M1VB 4DFPA 3QIPA 4B3MF 1WC0A 3KG1A 3Q24A 4ZLJA 3VAMA 1DJ0A 4CLTA 1FRIA 2I2YA 2UU9J 2YKNB 1SUQA 2N7YA 3DU6A 2ZBIA 2B8PA 5E5NA 3JSRA 3QAEA 1FRXA 5LXYA 2DNYA 3JYTA 2GA7A 3IC1A 5LSLA 3MFHA 4V1Ak 1RWUA 3V2UC 1RABB 4PQUA 4ZCMA 1RISA 3R7NB 3ENWA 3D28A 4OMFG 1JLQA 1R0CB 2GIQA 2RB7A 4DV0F 4LRBA 4OYXA 3HJFA 1I94F 2F8EX 4CO0A 4NLTA 4CH7A 1WHYA 4F0MA 1S1XB 1UW4A 2O66A 4X65J 2XWXA 2WSEC 5GAHU 3A8EA 2R7OA 2XMJA 2DCUB 3QO9A 4IH7A 1F5BA 2DGQA 2FZCB 5A76A 2HFOA 1NAQA 3RZAA 3NCQA 1K73T 2LA4A 4GVLA 3QJLA 5HP1A 4I68A 2VPXB 2UVUA 4GVBA 4C8NA 3ZZ0A 2E5LJ 1ZTWA 5H9EK 1HLWA 3CJSA 4FNHA 5CXTA 3D1OA 2YKMA 3CVKA 2GMLA 4DV4F 4MAKA 2F4VJ 1XJWB 1VQLS 3UNGC 4QYRA 3OR1B 2C42A 2GVDA 3CMQA 1RADB 1Y10A 3WBZA 1T7PA 2UUTA 3GJQB 1A9NB 1FFSB 1GMUA 1S6UA 4ELTA 4FVMA 3LOUA 2MPUA 2GHWA 2NR0A 1S6PB 5MLCV 5CA5A 3MR6A 4KSEB 3Q8VA 4ZOSA 4NLPA 5AE3A 2KTQA 5HROA 4LF1A 4V19X 4M5DA 3LA0A 4I0WA 9ATCB 3ENQA 3R5GA 2DVIA 5J2PB 2QMXA 4DR5J 3D6FB 1FERA 3L7OA 2JVRA 1M5OC 1M5PC 4FS1A 1FHTA 4ID5A 5M2RA 4HVZA 5A8RB 2XNQA 1X5SA 3B4DA 3P5BP 1VQKS 3O2IA 4OZ0A 2VFSA 1C1BA 2BZ2A 1YBUA 2WOMA 3M6UA 3SXLA 1L3VA 2OMOA 3VGSA 2DHXA 1SH3A 1H2UX 1FK9A 3GU0A 2FHKA 1RTZA 3DM2A 3EYZA 4FPIA 2VA3A 4NE9C 4DPXA 2MZ1A 3C46A 1V5VA 4ERDA 3NOGA 2MHEA 4OQJA 1EKRA 1UJ4A 2NPIA 4CI0B 3OFEA 5F9LA 3T1YJ 3ENAA 2OPPB 5DO2A 3CDEA 5KT2A 4CT9A 2ZM6J 4EZ9A 3CDBA 1D9FA 2V94A 3RW7A 3BGRA 5I42B 4L75A 2FY8A 4MJKA 3IRXB 5AE2A 4P6QA 5EX3A 4X4SA 1N36F 1V9OA 4H4KA 4DPYA 2KZMA 4B9VA 3WC0A 2WB1D 4Q2LA 1HNVA 3SSQA 4JV0A 4A8SA 4F4WA 4F67A 3H2LA 2RUSA 4OZ1A 2Z0GA 2HS4A 2CQHA 5HBMA 2XHCA 2Q3PA 1RWPB 1HIYA 4DR2F 3UDVA 4A8WA 1PC5A 2R8IA 2BE7D 4MYUA 1WELA 3LP1B 1FRLA 2NUHA 4R8UA 1X5OA 3R2DJ 1H74A 1LWFB 1M1GA 1HFEL 2ZD1A 3V6HA 3VAKA 3RR8A 2KVIA 3QT8A 4ZIVA 2YNHB 4RUAA 1RTHA 2IHR1 2CZ4A 2GVZB 2APOA 2VBXA 3K58A 3HK2A 3Q89A 2GO8A 2GHVC 1NMEB 2KXNB 3PW4A 4U67Q 3FNNA 4U6PA 3WX4A 1SJQA 1K44A 3DRSB 2P9EA 3FFIB 1YITS 1T94A 4EO6A 1Q8IA 3PYFA 3DOMB 4NA3A 5IS2A 3CJRA 5G0RB 5J1EA 2YKQA 3SV4A 3GPAA 3SI8A 3UI3A 1J5OB 2FTRA 1ZETA 2VIHA 2XULA 4NASA 2F8HA 2DT9A 1VMBA 2AYEA 4X4NA 1YRUA 2VU5A 4HKQA 1S4EA 4Y65A 4WFNQ 4USIA 4DV1F 1SVDA 4AQYF 1RCXB 1BWEA 3HHLC 4TY8B 4JI3F 2HNDA 2C3PA 5LSRA 2FVQA 1TR0A 4LT6A 4NXNF 5I3QA 3QFHA 2BA9A 1U48A 3D3BJ 4WE1A 2CQGA 2FVSA 3MCMA 3EGVA 3CJTA 1SQGA 1HI8A 2H9ZA 1LWXA 3HHDA 3O6QA 3T9NA 3GV8B 4RZRA 4D3HA 4U95A 2Z2MA 4JUZA 1JB0C 1GNKA 2G0IA 3MM8B 4DU8A 3HHKA 3W65A 1VDHA 3O44A 2FD2A 5KFNA 3T1HJ 1E6VB 2XYPB 5ETKA 4CLYA 1X0FA 3HVTB 2DRAA 2RT3A 2G13A 1R0AA 1WD6A 3HT3A 3DU5A 4JI0F 2B9EA 4DCJB 1RTDB 2R2TA 1D8ZA 1XK8A 2VG5B 4FYDA 1U02A 4DF4A 5L1JA 3MPDA 4FYVB 2DNZA 2RQCA 5C42A 2W9BA 2N3OA 3QWUA 4R5PB 3CJKA 2CJYB 4M5MA 1EX8A 5KT7A 1R6VA 5E41A 4LF2A 2Y1LB 5CCLA 4WBFA 2HSEB 5FLXY 2XS5A 2Y0BB 1RDRA 3BSCA 1RAAB 2DH9A 1N52B 4WTYA 5IT0A 5ETOA 4IH5A 3M8RA 2Q1LA 2CPIA 1AFIA 2NCKL 3KJVB 2H5EA 1A0OB 3DRXA 3GILA 5C25B 2VPZB 2OFGX 4RJVA 4NL5A 2OPSA 5T14A 1DHMA 2U1AA 4KYZA 4Z7YA 3HULA 1LWCA 2A10A 2F1FA 2ASYA 3ZZTA 2BMBA 2Z30B 3PW2A 1VQPS 3UN3A 4C3MA 1HR0F 2R7XA 1T02A 3DRPA 2OD4A 4YB6A 2MGZA 3SV3A 4PYAA 4ZPDA 2W4DA 1SC4B 3VAIA 1FKPB 5C24A 3K5MA 3MOZA 1JJCB 2H1YA 1NH8A 4LF5J 2WHOA 3AHPA 4F50A 1KVKA 4CLZA 1DY3A 4CYUB 1WTBA 3HKZD 3M2VA 3G6ES 3KUEA 2RQKA 4FPRA 3A3PB 1NKBA 1BLUA 1X4HA 1RT4A 4DFJA 2IY5B 4QU7A 1IBMF 2VQFJ 3M8YA 1VQ5S 2FQQB 1WEXA 4ZHRB 2CQCA 1SJ1A 2W24A 3AA9A 1NJXA 2KYZA 5L9XA 1R8CA 1YLXA 2VPYB 4F25A 4NLXA 4I2PB 4BC7A 4KKOB 1RAOA 3OV7A 2E9TA 4N56A 4U7CA 5T41A 4LF6J 2Y8YA 2MQ8A 2VG6B 1Z2ZA 3MM5A 3UFCX 1TV6A 2DHHA 4DLEA 1OPZA 1DFDA 3PYDA 3HFVA 1LK7A 5ETQA 4O3SA 3NGKA 3F41A 2E66A 2EFOA 1WOOA 4F3OA 4K4XA 1KD1T 2QA2A 1N56A 2Q43A 3MMCA 3VF0B 2V5HG 4Y0FA 3M2UA 3GG1A 3M7VA 2N82B 2DNPA 1YIJS 1V6HA 1RYRA 3DI6B 2J6TA 3GLJA 4XDDA 1QE1A 5J2QA 4FF3A 5DZ7A 2YY3A 3K17A 1S9EA 2QRRA 1IQZA 1ZM9A 1FTCA 4IRCA 4K50A 2CVIA 2E1PA 2OTLS 3J7YU 2CJQA 1QAYA 2LU1A 3PFEA 2PIIA 1FWLA 1ELOA 3TVKA 1L3TA 3FZ2A 2DB1A 1X4EA 4JI6J 1RU1A 2RU3A 1T11A 4B02A 5LMUJ 5E3PA 3CMAS 7AT1B 2PI4A 3H4BA 2AGOA 4QWCA 3KLGA 1FVSA 1HQEA 2DXEA 3DLJA 1D3WA 2YNIB 4LF4F 1IVZA 1JLFB 1XBWA 3BYPA 5HMZA 1N33F 1Q86T 3K5PA 3UR3C 2BANB 1EETB 4LQ9A 1FNOA 3CD5A 4WFAQ 3N28A 2ZH4A 4ZVFA 1E6YA 2QA4S 4LFCJ 2A0FB 3D4JA 3MEEA 2UUAJ 2MKYA 3DFEA 3QRQA 1RT1A 2H54B 3IM8A 2NPFA 4FF1A 1XMBA 2FIUA 2E7XA 4DR6F 2CWXA 3PEJA 4ANEA 2VPWB 1X8DA 1XC9A 1SJRA 1KSPA 2XMTA 4CLFA 2MMYA 1VOMA 1GK8A 2XCPA 4IG3A 1T03B 3BF4A 4F26A 2M52A 2JC1A 1HW8A 3N6MA 4U8VA 4J9MA 2ZJQQ 1IKXB 4G1PA 4N77A 4EEYA 4HTIA 3CPWR 3CNQP 1RWMB 1U49A 3MPUB 4K4TA 3UVJB 1AW0A 2HW3A 3MCOA 5CAAA 2AHOB 2Q6CA 1ZPWX 1B7YB 1R3NA 4NA1A 4K8RA 1TL4A 3DOLA 3M30A 1HBMA 2L9WA 4OLOA 4XTTA 4QIVA 3VAGA 1KR4A 5L46A 4ZVRB 2QYCA 5B0CA 1WKLA 1NUEA 2DH7A 3BS9A 2RRAA 2WVFA 1SC1B 3TAMA 3PW5A 3OXFA 3D2WA 2J8SA 2QZ8A 2XCAA 3PCOB 5J2MB 2JFDA 2BV3A 4PZVA 4UUWA 5D15A 3UWTA 3BR9A 4ZVQB 1FXLA 2MB0B 4DSJA 4WWSA 2VQEF 4DSFA 5H1SV 5KG0A 5GADI 5DJBA 5HLFB 1MROB 3LWLA 3G2XA 3VR1A 2HVEA 1W2IA 5EUHA 5F8GA 1NPRA 1XR7A 4XO0A 1C0UA 2GJ2A 6FD1A 2HQGA 1YQHA 3IS9B 1VRUA 4ED5A 4F2RA 2L48A 1RKJA 2MEWA 2QA1A 4RW6B 2JRSA 3NBPA 3TEHB 5A0YB 3GFZA 2EKYA 3CMES 2YKOA 2NYIA 3BSOA 1KLMA 2ASJA 3DHWC 2ZKTA 4GO5X 2B3TB 2HHTA 1C1CA 4Q5VA 3KLVA 3CO0P 3RB0A 1SC3B 2KB2A 2AJQA 4KR0B 3PKMA 2EFQA 1KQKA 4PUOB 1JLBB 3HD1A 1OY9A 4KV8B 3KK1A 3IM9A 4CLWA 4MT1A 2IYIA 2B9WA 1U1OA 2DEJA 3D68A 2G2YA 2ZH6A 1U47A 4KQZA 4B3OB 3EGZA 4K0KF 4QR2A 3V81B 1F9FA 5U47A 4N47A 4QIFA 1WEYA 5GADU 3KG0A 2JLEA 3W2WB 4K2JA 3RBEA 3W62A 2VFRA 2KG1A 3EXCX 2XB2D 3RB4A 2X1AA 1X5TA 5KFKA 4RNHA 2CPZA 4LR8A 3M6VA 4ECQA 2FVCA 4BC9A 2V0NA 3BDPA 3H98A 3HT0A 1B64A 4BCAA 2OJ3A 2G1DA 1FKAF 4W92B 1FD8A 4ICLA 2ZNYA 4C8MA 3UD4P 1LXNA 1MN9A 2YNGA 3Q0AA 3KOAA 2HRTA 2CQIA 3W5YA 1NDCA 4KFBB 4KRWA 1L3KA 4WK1A 1WSRA 5M2PA 3M9OB 2HMIA 5K14A 1K9MT 4J9RA 1RHKB 1YZ6A 1SQFA 4GKJJ 3W66A 3OXGA 5EWFA 1JQGA 2BACA 2HHXA 3T5KA 4AL6A 1NB7A 1CQMA 3A8IA 3RB3A 3T5LA 4C11A 3NGDA 1ROFA 4NX9A 3PX6A 2EG1A 2IVMA 2V2QA 2JEFA 4ES3A 2DR7A 4IR9A 3P6YC 4KHPF 2LEAA 2UVWA 1IXKA 1UEVA 4BHQA 1Q8KA 1FJGF 2YKNA 4EU0A 2Y0SD 2CQ0A 4CT8A 4B3MJ 3MPWA 1WI8A 5HVHA 4USKA 2DGVA 2OAUA 3VWSA 1NK4A 2BVZA 4N8NA 1TK8A 1SL0A 4PXBA 3EPIA 4HT7A 2OEKA 2VB6A 2XY6A 1VHIA 3VGTA 1G1XA 4OV1A 2RQ4A 1JLEB 3KDOA 3NXZA 5IWAF 2ZOGA 4X66F 3L4BC 3TANA 4PWWA 4B9UA 2DR9A 4RNNA 3P45B 3BZQA 4QBUA 5ADZA 5E3AA 4B9NA 2DHGA 4IFVB 3OJSA 3HXMA 1S1XA 1C4CA 3OJUA 3V4MA 3AXKA 5EGYA 3MEGB 3U1MA 3OUYA 4FBUA 2ZDPA 1Q79A 4CO1A 2QIFA 3H5SA 2KXHA 1NCLA 1N32F 2V67A 4DCOB 5LMNF 3G96A 4N41A 1KN6A 4DG1A 1RUSA 1D8YA 4YQWA 2XC9A 2ACYA 4CZCA 5KFCA 3MEKA 3D3CJ 3Q23A 2CNNB 1DTQB 2YQ0A 3W2VB 1SCJB 1PYSB 1PYTA 3OR1A 2DJWA 5D0RA 2BE2B 2FUG9 3OFHA 4NPOA 2I9SA 1OSDA 2HQIA 1WC4A 3BEGB 1XMQF 1H73A 2LQJA 4LJMA 1N48A 1S6PA 2NSBA 2KT2A 5HMXA 1ZM3A 4WFZA 4L74A 1N5YB 1FE0A 3GJRB 3BKTA 3BKFA 3UCGA 4UT4A 5J2PA 4KJIA 2FB0A 3GCWP 3BQ1A 1KBRA 2ILZA 2XMVA 3M9NB 4PEOA 4DL4A 4O0IA 1N6QB 4EI2A 4F0HA 1UVKA 2ALZA 1WG5A 1HW9A 1PIEA 1OMSA 5A8RA 1NSKL 1MWZA 1HNXF 4JI5F 1XNRJ 2ZBQA 3ISND 4RO0A 3JXOA 3WC2A 1URNA 1S10A 3HHNB 3LAMA 3BBBA 4C0HA 3R3TA 2D7SA 4DX6A 2HKEA 4K5SA 4C4WA 1U1QA 4UUXA 2ZH1A 1ZAVA 2WSCC 3L7PA 2XMUA 4OHZA 2LU2A 2R7QA 5CD4H 4QPXA 4DSEA 1OWXA 3D0HE 2F8MA 3GG0A 4USJC 2KJVA 4PWDB 3DLHA 3AT1B 3R6LB 2OPPA 3GFYA 3FQLA 3PHTA 2XY5A 1GXLA 4NEZA 1X60A 1JLCB 5I42A 5I4MA 2KHCA 1VQMS 1K1QA 3MPVA 4N76A 1S49A 2HGMA 3IRXA 3QSYB 5CYMB 1KVIA 4RLEA 1T05B 3OL9A 4B3TJ 1RK8A 5E7OB 3EUNA 1S1UB 4PG5A 3DLEB 5F3TA 1U24A 3GIJA 3LF0A 5AT1B 1N36J 2B5JA 2HFNA 2V69A 3TJ8A 8AT1B 1S6QB 2N7CA 4HR2A 5IOLA 2YWEA 2Z8QA 1S0NA 2A1BA 5IQQA 4UQGA 1TTHB 2C3OA 1VRTA 5AE1A 4QWAA 5LT5A 4YHHF 1IKYB 2D1CA 2ZHAA 4BLGA 3GFHA 2KO1A 4U96A 3AB4B 2KI2A 3LP1A 4OV6A 3GE9A 4DR2J 1UMJA 1LWFA 5JJBA 3I0RB 4ZLNA 1S76D 2YNHA 1CULA 2YH0A 3IBWA 2ZVSA 1ZM4A 1NHUA 1CJUB 1QTNB 4E2FB 4M5JA 1N88A 2IJNA 2AX0A 4DL2A 3BO4A 2HZAA 2GO9A 1P1LA 4NZ0A 3DRSA 3VGUA 3FFIA 4URGA 5K8NA 1T9UA 2NXJA 4TN2A 2BYCA 1RHQB 3R97A 1KOHA 5G0RA 3QGGA 1BGXT 2KRRA 3MAQA 3QRRA 1U1LA 3GJTB 4CNYA 1J5OA 2D74B 3CULA 2M0GB 1C4AA 3MECB 4J9LA 1S6OA 1JXLA 2A6OA 1N5TA 2R7TA 3HSZA 2XNRA 1JMTA 2GAHC 3MXHP 3HPOA 2B43A 1HL6A 2Q79A 3J81Y 3NP5A 4XPEA 3T19A 1WTFA 1HWJA 4XK8C 1H7WA 4DV1J 3EZUA 4AQYJ 2V4QA 2J8AA 1NDPA 5IFMA 2KL8A 1WC1A 4ZP8A 4HT5A 2E5HA 2XMMA 2VBYA 5F8JA 2VZ9A 3QAUA 1S48A 3MM8A 2HNYB 1FJCA 4JV5F 2V6AA 1PO6A 4DL0C 5ETPA 1H0HB 4CIOA 1I3OB 5HSPA 4WCEQ 2NZ4A 4DQPA 1D9AA 2RRNA 1E6VA 4P71A 3D6MB 3HVTA 2WAQD 2DISA 2BJ8A 2FJDB 2FDNA 2DNNA 4TYAA 1YVFA 1RTDA 4O3PA 2W01A 4N8OA 4H54A 1FRKA 1RTJB 4DR1J 1ITPA 1VQYA 2QE5A 2ZKUA 3I4HX 1YJVA 3OVBA 4Q0BB 3PHEA 1V3RA 3TP2A 4R5PA 1OJ4A 2FLOA 3KLFB 2VC1A 4TYBA 4RL1A 1U4BA 1UVMA 2NQPA 2D3UA 1YX2A 1R8PA 3GQCA 5K5MA 4DV2J 1TFYA 3FMBA 4NYOA 4LREA 3L95X 2CWKA 3WX8A 3R5JB 4J9PA 4Q7AA 2RDDA 3KJVA 2I8EA 1LFPA 4UOFA 1XNQF 3FEYB 5C25A 1F5AA 3UCUP 3M8QA 4I7FB 1VC5A 1W2BR 1JKHB 2IM3A 5L38A 4ZA1A 1IWAA 1NSAA 1QD1A 2CPHA 3ET6B 3CJ2A 1CJTB 4J9VA 1CG2A 3MM6B 4ZJQA 3D9BA 5KOWA 1YG0A 3LO3A 1Q5VA 3V6DB 4CO4A 1YRXA 3C16B 1VLOA 2HEKA 3IG1B 3WQPA 2N4CA 1NJIT 4LRAA 3JS9A 1SJ3P 4I69A 2KT3A 2RMLA 2HFSA 1VIOA 2ZJRQ 1C0TA 6AT1B 4DMZA 1FKPA 4DX8H 4TXSA 1ZPVA 3NLCA 2HAFA 3FBFA 4DPUA 4RBUA 4X64J 4CYUA 1I1GA 4QCLA 2C2OB 2JNJA 4LSZB 2HHHJ 4ZVOB 2V68A 2R7UA 1PBUA 3HZEA 3I5CA 1HBNB 2BKPA 3NKYA 2P6SA 1TL1B 4OI3A 4ZHRA 5I3UB 4DV7F 2R7VA 3NCRA 2HHWA 4I2PA 4KKOA 2LXFA 1U2FA 2CQBA 2IM1A 3H4DA 2B7CB 2G4BA 1AUSL 2CG4A 2JEJA 4O44A 3NWGA 3LAKA 2LEBA 2J0SD 3HM9A 1N34F 2DGOA 5GAGU 4ED7A 2ZUGA 1V3SA 3EGWB 4ITSA 4F4ZA 4WJBA 2W2NP 1SJ4P 3W9HA 3RBXA 4MMOA 1JX4A 3EVMA 4A4JA 2MQMA 4ZN3A 2MZQA 4O3RA 2QLWA 2IVFB 3FCVA 2RF2B 3DI6A 1XMOF 3W7BA 4OHXA 5CZXA 3GTYX 2IRXA 4IFYB 1H2TZ 3IA0A 1FX2A 1S1WB 4AE5A 4RW8B 4RNFA 5DDQC 3SQGB 2L08A 4ECZA 1QY7A 1B0TA 5KFAA 1LW2A 4C3KA 4DHVA 2CKWA 3RR7A 3C6UB 2EBGA 3ONQA 1LQ9A 2HS3A 4EBCA 2CQPA 1AFJA 2KYXA 1S1TB 4RUBA 4RW7B 2GMHA 2DYAA 4WFBQ 1KDNA 4QWBA 2K7KA 2YNIA 1HHTP 1RWOB 1JLFA 4Y2MA 1IBLF 4N5SA 1B4SA 1OY8A 3PJXA 2V9WA 2BANA 1EETA 1R43A 3MTKA 1NZ8A 1AUDA 3NAIA 5A8KA 4DEZA 4MIWA 4LF4J 4QJVA 2CJXB 4NCGB 1UL3A 2ZOMA 3K2YA 2DCLA 2ASLA 1RWNB 3C15B 3CWJA 4UF4A 2HLTA 4LSNB 4H4OB 4KPYA 2IFXA 1IKWA 3VAFA 2QFIA 4O4GB 3I55S 4DZ6A 4MFBB 4ED8A 4DR6J 2LCWA 4HDGA 3UW1A 1KLNA 2R2UA 4OZ2A 3SZ2A 2IMWP 5KG7A 2OPQB 3D1QA 3NS5A 1RJJA 5JMNA 2CUYA 3KTQA 1IKXA 3POTB 4BWJA 1S97A 3MGJA 2E5JA 5B08A 4MK9A 3OTOF 4IO9Q 1C2PA 2LEPA 2CPXA 2W9CB 3UVJA 2L41A 2ASDA 3DGVA 1FXRA 4DS4A 1RAJA 1JXVA 2MKSA 1T3NA 4X4UA 2LKZA 1KTQA 5E3RA 3MWBA 2JSXA 5FIIA 8RUCA 5FD1A 2FVPA 1KKHA 2POKA 3AY0A 5AJ3F 2FGOA 3RGIA 2WK4A 1HKAA 4ANCA 3T1AA 4WYLA 1EHWA 4KC5A 3BQ2A 5MAOA 3EVOA 2R2RA 1ZTTA 4P74A 2X7IA 4JI1F 2H51B 5J2MA 1UFKA 2HFUA 3GIRA 2AW0A 3HVWA 1MU2A 5CZVA 1MSWD 2MZRA 1H72C 2IJFA 3TJAA 4JV1A 3T6JA 2O3DA 3H8YA 1FFGB 1OIAA 2H48B 3CTRA 2K1RB 5J1PA 5SUHA 5HLFA 1MROA 4RR5A 4IDKB 2FJEB 3OBIA 3OL8A 3OW2R 5LL6d 2VQEJ 1EQMA 2DIVA 4CO3A 4WZMA 2LMIA 2OSQA 2VUGA 3PRBA 1XN9A 3VZHA 2E44A 3ITHB 4B3SF 1Z1ZA 5KFJA 4A8MP 2HVZA 1W26A 3IS9A 5DQGA 2CPYA 1J5EF 1SV5B 1RT5B 5CQGA 2DBBA 4EO8A 2MJUA 4NRUA 3QQCD 3LH2S 4RW6A 2PSZA 2RH3A 2PEBA 4Z2XA 4IG0B 4HTJA 3U1LA 4CQ1A 5GAEI 3BBFA 1RLCL 5L1KA 1WSVA 1PKUA 2GS8A 4P2FA 2MDAA 5DETA 3DN9A 3UD5A 5C2GA 4YR0A 4WYWA 4I6WA 4LVOP 2Y3YA 5HJXA 5KG2A 1O0PA 2YNFA 4NMXA 4PUOA 1JLBA 2DKOB 1Q82T 4KV8A 4CO2A 4OYOA 2Y8WA 4IYQA 6FDRA 2DO0A 1ZA1B 3MM7B 3HSGA 3V81A 2G9OA 2H65B 1JNRB 2DH8A 4YEAA 1X4DA 1RP5A 3NGSA 2J9DA 3M32B 2F7VA 2Z57B 2VOOA 2LP4A 3CW2C 1U2RA 3BBCA 4DN0A 3N01A 4GC6A 4JI4F 5T7LB 3M8ZA 1HBOB 4A8YA 1HI0P 2AX1A 5D77A 4WKYA 4BBYA 3PJ9A 4QWEA 2XZWA 1TZ0A 4OX9F 2C2ZB 3AB2B 4DUYF 2DXFA 2C2DA 1NXIA 1CBKA 2NXEA 4DU7A 2B9XA 1FDNA 3PIPQ 5C2CA 1Y5LB 2DTJA 2W2PP 1FRJA 2X51A 1T9VA 1NJWA 2B4VA 2W7OA 5L1LA 1WACA 1R0BG 3PYGA 2ALYB 1N0VC 3DDKA 3BN7A 2LECA 3C8YA 3Q2SC 3W63A 2ZEJA 2H5JB 2V8DA 1KVJA 3NNAA 1U6BA 2IRYA 2RUGA 2R7SA 4EUVA 1UA1A 1U1MA 2COLA 2WBMA 1X31C 1XIQA 3HVRA 3SBMA 4KHPJ 4DPOA 1TL7B 2PMHA 3OL7A 2RAQA 4KGKA 1S9GB 2HAIA 2IC3B 1FJGJ 4M5HA 2B4PA 3PR5B 3PX0A 4U7UD 1TK5A 2M88A 4FXWA 3GSIA 1JLEA 3M8PB 4ZPCA 2QV6A 2E5IA 2GJFA 1TL3B 1IJFB 2NYHA 4ECUA 3MUMP 1HMVB 2UUWA 4PG7A 3M2RB 1KHWA 2QX0A 5IWAJ 2GFFA 1VQ8S 2FHMA 4X66J 4WK3A 4K7QA 4CM2A 4IFVA 1MMLA 1BUXA 3K57A 5I3PA
chains in the Genus database with same CATH topology
1VK8A 1SKWA 4RW4B 1JLGB 3V6DA 3TA0A 4JI7F 3MEGA 1F5CA 1LXJA 4UY8T 5B0FA 4EZ6A 3WDOA 4WE1B 1VOMA 1SIWB 2OH2A 3TUIC 2XCPA 4IG3A 3VALA 3LP2A 1FDBA 3CUNA 3GFXA 1JLAB 2XS7A 1T03B 3BF4A 1M5SA 3OTEA 3KNGA 2AP6A 1IN0A 4KAIA 5KTQA 4F26A 2M52A 3CDUA 1Y0HA 2HNZB 3T1HF 1SKSA 4AYBD 4C0BA 2JC1A 3T5HA 1HW8A 1JIHA 3N6MA 5JXSA 3TVYA 5H9FJ 4J9MA 5KFHA 1Y9OA 2ZJQQ 3UD3P 2GQCA 1HQUA 2CPDA 4NCAA 4RUCA 1JJ2R 1W25A 3G9CA 3H2UB 4NYPA 1GXTA 4KO0A 1IKXB 2M4MA 4G1PA 1R8HA 4C8YA 2HWIA 3BSNA 1SJFA 5J1NA 4N77A 4EEYA 4HTIA 3CPWR 1HNIA 1DTQA 2PC6A 4DOZA 2X3GA 1X5PA 3G6XA 4MYTA 1D0EA 2R7WA 3P3DA 1YBAA 3QWPA 3W2VA 3KWMA 4ZP9A 3M8SA 1U49A 4ATNA 2LA6A 2OSRA 1WHWA 4CTAB 5F8IA 1R0AB 3OHBA 4NOHA 4K4TA 2ATLA 4PXCA 5D3GB 2NLWA 3OSNA 3VZIA 1S77D 1AW0A 2HW3A 1GH8A 4ZPAA 2BABA 3CXCR 4DLGA 1VBZA 1G3OA 3GR1A 3OVAA 1LKZA 2BE2A 2UP1A 1JXEA 4LQ3A 2VL1A 1IKVB 2Q6CA 3TX8A 1TAQA 4YDDB 3N5FA 1ZPWX 1R3NA 4NA1A 5DLGA 2VV5A 1TL4A 2AJ0A 3DOLA 3M30A 1HBMA 5I3UA 2EWHA 2L9WA 4OLOA 1ZBTA 1RA7A 1TKXA 1HHSA 3ZZZA 3UDCA 3LANA 4QIVA 3D5MA 4CCHA 3I4PA 3LPYA 4WU2A 1APSA 3VAGA 1KR4A 2JX2A 1JJHA 2EW9A 4DV3F 2A18A 4DL6A 1I6JA 1QAIA 3JTOA 1GTEA 1WHXA 2I1RA 5B7WA 1N5YA 4L72B 2QYCA 1S0VA 3B4MA 5B0CA 2V9KA 5KFUA 3CJKB 1BQNA 1X4GA 2DH7A 1SIZA 5EWGA 2M9KA 3T5JA 3BS9A 2RRAA 2KKHA 4LF9F 5L9NA 1DRZA 2ZOFA 3TAMA 2FHOB 3NS6A 3PW5A 2IAJA 3OXFA 1JWWA 3H20A 2ZH9A 1SUQB 4OHYA 4J9QA 2E1RA 4IQXA 2HGLA 2CQDA 3D2WA 3DCAA 2N3LA 3HLUA 3GZ7A 1VGYA 2QZ8A 4RW9A 5IQ6A 4JV2A 4I2QB 3Q2TC 1KTVA 1URRA 2YVSA 3E01A 2XCAA 4PXDA 3O3LA 5J2MB 2JFDA 4H4MB 2BV3A 2P9CA 4UUWA 3UWTA 3BR9A 1P1TA 2WONA 5BR8F 1N4LA 2XO7A 4MTPA 2GGPA 3P5TL 1FXLA 2DGWA 4NRTA 2MB0B 4OI1A 4EWTA 2Y1JA 3VAJA 4DSJA 5K8OA 2VQEF 4DSFA 2YX4A 1U1PA 5H1SV 4J9SA 5KG0A 1UETA 2M70A 5FDLA 5GADI 1D1UA 5DJBA 5F8NA 2JFKA 5HLFB 1YJNS 1XR6A 2EFGA 2N4DA 4U7UK 1MROB 2AF6A 3LWLA 2PT0A 3X1LB 3VR1A 3RB6A 1FJEB 2B56A 1W2IA 2YQ3A 2Y1IA 4Y6IA 5EUHA 5F8GA 4M94A 4ECRA 3RAXA 3S6EA 3U02A 1N5SA 2KFZA 1VK3A 1RGVA 2DNMA 1LWCB 1SI9A 3ZZRA 1CPZA 5AXLA 1OSCA 1XR7A 4XO0A 4OI6A 1M1KT 2FVRA 2YWHA 3MDFA 2V8HA 1C0UA 1RQ0A 1QM9A 5KFVA 2OIHA 1S1WA 2GJ2A 6FD1A 4XIUA 4RW8A 1T3OA 2HHVA 3IR7B 4ILMA 1YQHA 3IS9B 2LXIA 1KQFB 1VRUA 2VA2A 3FMWA 3FSXA 4ED5A 1NJYA 4F2RA 5E33A 2L48A 2OLWA 4PWDA 3TUZC 3ZZYA 1VQ7S 4RU9A 3HVAA 2XY7A 1RKJA 1NKCA 2RE1A 2KDOA 4DR1F 2QA1A 3T9ZA 1UJ6A 1NK0A 4DSIA 2FJVA 4LFBF 4RW6B 3DRPB 1YI2S 3J7A1 2JRSA 3NBPA 5F8HA 3C6UA 2Q6BA 2QT7A 2I5JB 1BQMB 2QO3A 4O23A 2U2FA 4C0OC 5A0YB 3H5XA 2ZC3A 4MIAA 3GFZA 2MQNA 2EKYA 2RKIB 1FESA 3ICLA 3BO3A 3CMES 1QUPA 1JLCA 2MGZB 2P6TA 2UXDF 4PQAA 2YKOA 4ZKAA 5J2NA 2NYIA 3BSOA 4Q8FA 2CJ9A 1KLMA 4X4QA 2ASJA 2X1FA 2LQ5A 2QA4G 2E29A 2MQOA 4DR7F 3DHWC 2ZKTA 4GO5X 3LGMA 3VQSA 4OIXA 1CQNA 2B3TB 3AJ2A 1C1CA 5D4PA 1LW0B 4Q5VA 3NNHA 2HHTA 5CYMA 3KLVA 3DOMA 3RB0A 2KB2A 4DV2F 1TKZA 1T05A 2AJQA 2YKMB 4KR0B 3HP6A 5CYQA 2HPUA 4TLQA 3PKMA 2EFQA 3H40A 4NLSA 2RJZA 1KQKA 2AGQA 4QWDA 4NLQA 1LFWA 4A8KA 5KFTA 3ZZUA 4PUOB 3CCJS 1JLBB 2VQFF 4WIIA 4K4UA 4C2MA 1JJ4A 1S1UA 3CCVS 1VQNS 1P8GA 1ZZFA 3G8QA 3DLEA 4KV8B 2AGPA 4OHWA 3NL0A 3KK1A 3M2VB 5LJ5Y 4HYKA 2EI5A 2BQRA 1DQAA 2E7WA 2DPJA 3KFWX 1RT4B 1LV5A 2IYIA 1T8EA 2HZCA 2B9WA 1U1OA 3PJWA 4YOEA 3VQTA 4G3IA 3HZGA 5AXNA 4A46A 4ECXA 1UKUA 1Y4ZB 1S6QA 2PI5A 2YKPA 2ZH6A 2DD8S 1U47A 4QIEA 3GYNA 4KQZA 3TUJC 4E98A 4B9TA 4B3OB 4NLUA 3EGZA 4AUKA 4K0KF 4QR2A 3V81B 4GO7X 4LSNA 2W8KA 1IM4A 1F9FA 1QJHA 4TY8A 2GW8A 4UOCA 2BBEA 5U47A 3G4SS 4DR5F 4N47A 2VOPA 5BYQA 3CCES 3KK2B 4QIFA 1WEYA 5HO4A 4OL8A 5GADU 4EBEA 3KG0A 2JLEA 3W2WB 2C28A 1FD2A 3THTA 2ZZMA 1SH0A 2JLGA 2J9CA 2D9OA 3RBEA 3NAHA 5ITHA 4BS2A 5A8WB 4O4GA 5F8MA 3MM5B 2GIRA 3M8QB 4Q2MA 1A6LA 2DHAA 1TV6B 2VFRA 3EXCX 2KG1A 2XB2D 2YWGA 1ULRA 3RB4A 4F3QA 5KFPA 2UVVA 2X1AA 1X5TA 3TRGA 2CIMA 1UJ5A 5KFKA 4RNHA 3CCQS 2B0GA 2OPRB 1UVJA 3QIDA 3CCTA 2E1MC 4HH0A 3GSDA 3HFKA 2CPZA 4ILLA 3M6VA 4ECQA 1UEUA 2F9DA 2FVCA 2OO4A 1R6YA 4BC9A 1RI7A 3FQKA 5EX0A 5KFWA 1YJWS 2BQ3A 3QZ8A 5EWEA 1FJ7A 2MXYA 4BWMA 1S72S 2V0NA 3TW0A 4F4KA 4A8QA 3H98A 3BDPA 1NRKA 3I0RA 2YTCA 1B64A 4BCAA 4W90B 2OJ3A 4WF9Q 2CZVC 2G1DA 1FKAF 5HQ8A 3V4IB 1IJEB 4W92B 1FD8A 3I31A 3CJ0A 3PVXA 1XWLA 4ICLA 1GT8A 2ZNYA 4C8MA 4TU7A 1LXNA 2D9PA 3UD4P 3MMCB 3LP0A 2YNGA 2V4JB 3MHYA 1KS2A 4ZMMA 3Q0AA 1C1BB 2XGPA 3M2UB 1UA0A 2IBKA 3KOAA 3ZFVA 5KG3A 5EN1A 2NSCA 7FD1A 3PM9A 2MQPA 2CQIA 3I5BA 4ETXA 1AXQA 2VG7A 1FNXH 1C0TB 4KFBB 4KRWA 1SL2A 1L3KA 4WK1A 4NA2A 5M2PA 3M9OB 5JUMA 2HMIA 2JEGA 5K14A 3SCIE 1DARA 2FHJD 3DM2B 1QE1B 1K9MT 1JK9B 1JNZB 3TYTA 4J9RA 1UVNA 5C5JA 4X64F 2RD5C 2CFXA 5J2QB 3OXGA 2RVJA 4ZCIA 2HHHF 5EWFA 3T1YF 5CYJA 4TLRA 4J37A 2BACA 2A3JA 3DLKB 2HHXA 1HBUB 1S9EB