2MHNA

Nmr structure of the first rrm domain of the protein rbm39 from homo sapiens
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
94
structure length
94
Chain Sequence
GHMNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 39
publication title NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 17
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mhnA01
2MZRA 2YWKA 3P49B 1K73T 2VODA 1VBYA 3ZZYA 4WFNQ 2XS7A 3H2VE 1L3KA 2AYMA 3R1HA 5LSOA 2KN4A 3MI7X 2L08A 1X4EA 1YJWS 2D3OR 2CPZA 2LMIA 2OIHA 3MUTP 2DK2A 1R8PA 5LXRA 1OO0B 1FJCA 1W2BR 1X5TA 1U1MA 3SDEB 1VQ9S 4WKRA 1U1QA 1JJHA 3U1MA 4YOEA 1M5KC 1YITS 5LJ5Y 2VOOA 3BEGB 3HI9A 5D77A 1D8ZA 2M0GB 4V19X 1P27B 1FJEB 2VOPA 3CPWR 2HZCA 3VAKA 2MY8A 2D9OA 1X4DA 3LQVA 1U2FA 1HD1A 1VQ7S 1OWXA 2WBRA 2OSQA 3NNAA 3TYTA 2MQQA 1WG5A 1X4CA 1S72S 1F9FA 2HGNA 2MZSA 3B4MA 1FXLA 1X4AA 3EGNA 4FXWA 2HYIB 2F9JA 3N9UC 1Q7YT 3BS9A 3G9CA 3CCMS 3ULHA 1VQKS 2JWNA 4C0OC 1FNXH 5DDOC 2GO9A 1M5PC 2ZJQQ 3CTRA 2RRAA 4UY8T 3K0JA 5LSLA 2M8DB 2D9PA 1UW4A 2OSRA 2MQOA 2MHNA 3P6YC 1BY9A 2MKSA 2B0GA 2CQCA 3P3DA 2ADCA 2U1AA 2EK6A 2CQ0A 2JVOA 2M4MA 4WF9Q 1WF0A 3PIPQ 2L9WA 1VQMS 4OZ0A 2DIUA 2RT3A 2Q79A 4FXVA 2AD9A 2MSSA 1N88A 2KXFA 2MXYA 2MKKA 3G96A 4IO9Q 2U2FA 1JMTA 2E5GA 1X4FA 2KT5A 3G71S 3S7RA 2AYBA 3BO4A 2F9DA 3SXLA 1SJFA 1PO6A 2FPHX 2CPDA 1WWHA 3TP2A 2KVIA 1VQLS 2K3KA 3UD3P 1U6BA 3IRWP 2N3OA 4BS2A 2K8GA 3J7YU 1Q82T 1SJ4P 1WHWA 2DHAA 2NLWA 5D78A 3CMAS 1PGZA 2KU7A 1RK8A 1WI6A 3L3CA 2RQ4A 3THTA 1X4BA 2DB1A 3SDEA 3CC7S 5GVQA 1VQ6S 3IWNC 2CPEA 2N7CA 2LEBA 2JX2A 2X1AA 1KOOA 2KG1A 4U67Q 2XNQA 1U1KA 1QVGR 2CQDA 2DGTA 2XSFA 4IOAQ 1U1LA 2GHPA 2CPYA 2MZJA 2LEAA 4Z2XA 1YTYA 3NS6A 2OTJS 2YH0A 3G8SA 2BOPA 1B7FA 2E5JA 3VALA 2MKHA 2LKZA 2MKCA 3I55S 2FY1A 4QPTA 3FEYB 2DNZA 2E5IA 1WELA 4QQBA 2LYVA 2VONA 1U1RA 1YJNS 3S01A 1YWXA 5CA5A 1N54B 3G6ES 5EN1A 5HO4A 1SJ3P 2DGQA 1NU4A 3MURP 3DXBA 2DNGA 4P6QA 1U1NA 1WEYA 3UCGA 3G8TA 1XN9A 2DNOA 2MB0B 1JJ2R 2DGVA 1DRZA 2M9KA 1VQNS 1M5OC 3G4SS 2MQMA 1U1PA 2MJUA 3CCVS 1Q81T 2DH9A 1YI2S 2XS5A 1N8RT 2DNHA 1U1OA 1VQ8S 1H6KX 5DM7Q 1SJQA 2J76E 5DDQC 1X5PA 4OZ1A 1WHYA 4M5DB 4WFAQ 1X5SA 3CUNA 2MKIA 3CULA 3R1LA 2CQ1A 3OW2R 1HD0A 4UQTA 3MXHP 3MOJB 3CD6S 1HA1A 2DNPA 2MJNA 4WCEQ 2LXIA 5JVHQ 1X4GA 3LPYA 4RU2A 1S79A 2KRBA 3VAIA 1KQSR 2DHSA 5DETA 2CPXA 2N3LA 1VQ4S 2DHXA 4F02A 3P5TL 5CXTA 2MGZA 2DNKA 2KM8B 2DGOA 2J8AA 3THPA 1QM9A 3MUMP 5IQQA 2ADBA 2X1GA 1WI8A 2MQPA 5ITHA 2MMYA 1VC5A 2CQ4A 2DHGA 2CQ3A 2BZ2A 4Y00A 3VF0B 2CQBA 3MDFA 2QEXS 1QVFR 2KI2A 2OJ3A 3EX7B 3EGZA 2YH1A 1VQ5S 1VQOS 2MKJA 4PKDB 1M90T 4F26A 1O0PA 5GAHU 3CCRS 2XB2D 2LQ5A 3UE2A 2KRRA 3D2WA 2DO4A 2M52A 2CPHA 3CCUS 1JJ4A 5H1SV 4PRFA 2JRSA 5HL7Q 1WF2A 2KH9A 3MD3A 2X1BA 2G0CA 1ZZFA 2X1FA 1KOHA 1X4HA 2M88A 3CC4S 1UAWA 3BO3A 2QFJA 1DZ5A 3VAHA 3BO2A 2MYFA 3H2UB 5LXYA 1N52B 1R8HA 1FHTA 1WG4A 2KFYA 2RUGA 2CPFA 1WHVA 2LXUA 5DDRC 3NNCA 1FJ7A 1YJ9S 1FO1A 5GAGU 2SXLA 1VBXA 2DNRA 2M2BA 3FEXB 2MZQA 3MUVP 3RW7A 1M1KT 1DHMA 4W90B 2OTLS 4TU8A 3CXCR 2N82B 2UP1A 3MD1A 4YUDA 3UWTA 5MLCV 3U1LA 4TU7A 3DLLQ 3B4DA 4F25A 4CIOA 1VQPS 4IOCQ 3J7ZT 2J0SD 5BJRA 1YIJS 3ZZZA 2KG0A 1IQTA 1WF1A 1WG1A 3NS5A 2M70A 4C7QA 3Q2SC 5GADU 5IM0B 2KXNB 4QU6A 3NMRA 1CVJA 1UFWA 1NO8A 3S6EA 2RQCA 2KXHA 2DO0A 3UCUP 2HGMA 2FC8A 2CJKA 4CH1A 2DNMA 2PEHA 2DGUA 3S8SA 2EK1A 3Q2TC 5FJ4A 2CQPA 2MZTA 2MY7A 2DGSA 3CCSS 1DBDA 2DGXA 2M7SA 3CMES 5JVGQ 1D9AA 2LECA 1SJRA 2G4BA 2M8HA 2RRBA 2CQGA 3R27A 1X0FA 2I38A 3VAGA 4LIRA 4ZKAA 4IUFA 3CCJS 5DM6Q 5IFMA 1H2UX 2YKAA 2DITA 2CQ2A 1SXLA 2DNNA 2V94A 1WHXA 2A3JA 3JB9k 4J5OA 3I56S 4WFBQ 2G1DA 5LJ3Y 4CQ1A 2ZJRQ 1VBZA 2I2YA 4ED5A 1U6FA 3HHNB 4LMZA 3CCLS 1AUDA 5CYJA 2E44A 1WEXA 1YHQS 2EVZA 1FT8A 2MSTA 1HL6A 3SMZA 2MZ1A 2RS2A 3TO8A 3V4MA 3CC2S 1ZZNA 3VAFA 2JVRA 2LCWA 1URNA 4Y0FA 1H2TZ 2E5HA 2HVZA 1RKJA 3CCQS 2F3JA 2MPUA 2FHOB 2RU3A 2DNYA 4QU7A 2YTCA 2L41A 2MQLA 2MQNA 3UD4P 3NNHA 3PIOQ 3CCES 2DNQA 2ERRA 1KC8T 4TU9A 1A7GE 2ZJPQ 2DH7A 4C4WA 2RNEA 1WEZA 2LA6A 4YB1P 4A8XA 1A9NB 3UCZP 1OIAA 1K9MT 1KD1T 4W92B 2CQIA 2QA4S 2O3DA 3US5A 2XS2A 1Q86T 5IM0A 4LJMA 1P1TA 1VC6A 1G2EA 3VAMA 4EGLA 1ZH5A 2J0QD 4TLQA 2AYGA 2CQHA 2FC9A 1X5OA 1K8AT 1M5VC 2KHCA 1NJIT 4WIIA 1H2VZ 3CF5Q 5GAEU 2DIVA 2RS8A 1WTBA 2AYEA 2CPIA 4PR6A 5GMKa 3RW6A 2MGZB 2DNLA 3VAJA 1VC0A 4ERDA 2CPJA 2DH8A 2DISA 1UP1A 5DDPC 2DGWA 2PE8A 2RVJA 2HGLA 4CH0S 2KYXA 2KM8C 1OPIA 2XNRA 2LA4A 2NZ4A
chains in the Genus database with same CATH superfamily
2YWKA 2UV8A 2HBYB 3WC0A 1JLAB 5LMNF 3MMBA 2I1RA 4ILRA 1U0HB 5LSOA 3NS7B 2LMIA 3DRRA 4I67A 2EG2A 1EJ7L 2Q6BA 4FYWB 5KTQA 4O44B 1S6QA 3LALA 3I4HX 5JXSA 3U1MA 4ZVUB 2BVZA 2M0GB 2IVMA 3K57A 2VOPA 3F73A 3VAKA 1X4DA 1JLQA 3MTJA 2WVFA 1S72S 1F9FA 4WP8A 2HYIB 3CCMS 3HZEA 1TFYA 2IPOB 4F3OA 3OLAA 3IXQA 2ZC3A 2XMVA 2M8DB 1FKPA 1U24A 4HTJA 2VF3A 2R7SA 2ADCA 1HI0P 3EWGA 1V3RA 1EETA 1RTIA 3BH7B 2BJEA 2Q79A 5A8WA 3WIUA 4HYKA 4C0BA 2BR0A 1KHVA 4DX7A 3M30A 3KLEB 3RAMA 3CJ5A 1WHWA 3PZPA 1ITPA 1PGZA 1WOOA 2FLNA 1RHMB 1RWWB 2WONA 3MPDA 3FSXA 2C2DA 3SDEA 5KFQA 4ILMA 3NOGA 2CPEA 4O3PA 1R0CB 5F8MA 3GCXP 4EBEA 2KG1A 4QYZK 4DS4A 2WRMA 2L9NA 3DGPB 1UL3A 4RW4A 4NWBA 3QSIA 4J9VA 2OTJS 1Y00A 5I42B 5A0YA 1N56A 5CA5A 4KGMA 3MAHA 4YR3A 1SJ3P 1NU4A 4F2RA 3EICA 4MKYA 4WIQA 4RBVA 1U49A 1JJ2R 1TKXB 1VQNS 2LDYA 1U1PA 2XS5A 1MMDA 2DNHA 2NYHA 3ENAA 2OPSB 1RT3B 4KIAA 3Q8PB 3CUNA 1BMQB 4NXNF 2NSCA 1QDUB 1B70B 1JLCA 3OUYA 1KQSR 2CPXA 4F02A 1TAQA 3R8YA 4AL5A 3PW2A 3PYEA 1EB0A 5IWAJ 1PCAA 4F4XA 4GVBB 2NXEA 4ZIWA 4Y00A 1XBWA 5KFIA 1PIEA 3HP6A 2A2CA 3M8RA 2GZOA 4P52A 2J7KA 1NDKA 1S9GB 2KRRA 3JSBA 5HQMA 4X4RA 1WF2A 2V69A 3OSPA 2F65A 2ZH7A 3LP0B 3L09A 3DI6A 5LXYA 1HMVB 4AFFA 4TQSA 2DNRA 3KOAA 4KBIA 2YNIA 3T9NA 4F2SA 3M9NB 2XULA 2W1BA 3MAAA 4YUDA 1DTTA 2P9GA 1BQXA 3JSRA 4C8NA 2NCKL 5H9EK 4OHVA 2RRNA 1S1WA 5CYMB 2I8EA 3AAWB 2ZKTA 1R43A 2IM0A 4I6YA 2FJXA 4K4XA 5E41A 1NO8A 5F8LA 3DXSX 3GJQB 2H5EA 4UTGA 2XMJA 3FGVA 4DFKA 5HLFB 2DGXA 3CMES 3EMTA 2LDIA 4TVAB 3OTOF 2G4BA 3C6UB 3HDSA 4LF8F 5LJ3Y 2I2YA 1P6TA 3PDNA 4OLOA 3OTOJ 2I6WA 3H0PA 3CC2S 2JVRA 3LP2B 2XC9A 3TR5A 4LF8J 1RWUA 4LRCA 2MPUA 5D4LA 2NQPA 2YTCA 4R5PA 3UD4P 1OS5A 2AMCB 1EKRA 3EPGA 3HFVA 4FF1A 3R9LA 4N47A 7AT1B 3RBZA 1T9WA 3UN2A 1Y11A 3US5A 3G8QA 3FRYA 3UN3A 3TJAA 1RCXB 3AA9A 5IS2A 4ED4A 4PUOB 5ETSA 3NY0A 4RBUA 1X9WA 3ZNUA 3T1YF 1G6BA 3CJ0A 1REVB 1OPIA 2LA4A 2NZ4A 4HDHA 4EO8A 2EKNA 1N36F 1RT4A 2CDRB 3T6BA 5D8HB 2ACMA 4O3NA 3QT6A 2BW2A 3T1YJ 2N4CA 4OYPA 3GU0A 4UZBA 4ZOSA 2ZITA 2HSEB 1R89A 4DCJB 4NLOA 1I51B 1OSCA 2VPWB 4NCAA 3PHEA 1OO0B 1N36J 1W2BR 2OHDA 2RQMA 3R97A 3EDRB 4R8UB 3FNNA 1FXRA 4KRWA 4RLEA 5F9NA 1T9VA 3Q8RB 2WOMA 2QLJB 2QGFB 2KVQE 4CYUA 3H5SA 2WBRA 4FP9A 2W2MP 3TYTA 1VK8A 1WG5A 2MZSA 1GTHA 5D0HA 1ZM2A 4RW6B 2ZEJA 4M8LA 1S1VA 5LSLA 1XC9A 2OPQB 3HF5A 4IG3A 5KFOA 2W01A 4OI0A 3EVMA 3PIPQ 2L9WA 3BGRB 2RF2B 3PNIA 5EX0A 4YN3B 4ETXA 2HHUA 3CDEA 3MCOA 4Q45A 3SFUA 5C24B 3SXLA 3W7BA 3ZTSA 3J7YU 1SJ4P 3UNGC 2G0JA 2Q3PA 1HI1A 1B0PA 3OFFA 3CC7S 1VQ6S 5EX3A 1RT5B 4Z37A 2FHKA 1XMOF 1S1TA 3V6DA 5THWA 4KGZB 2PGCA 1QVGR 5A2QU 2CJQA 4IOAQ 2IYGA 3K5NA 2HNZB 3MHYA 4ID5A 2LEAA 1XMOJ 4OYXA 3X1LB 2PEBA 2P9EA 1RB0A 1F3VA 3IM9A 3QFHA 4K7QA 3DXBA 3DLBA 4P6QA 1UEVA 3UCGA 4O0IA 2Z56B 1N5YB 3PR4A 4PWUA 2VG5A 3RUBL 4HACB 3DOLB 1H6KX 2FZCB 3M9OB 5LMUF 1CQNA 2R7RA 2AWZA 3I31A 2HNYA 3H4DA 1OSDA 3DRSA 1QE1A 5LMUJ 4ECUA 3D54A 4V19J 4DCPB 1VMBA 5EWGA 4Y2MA 2N3LA 2Y1JA 2R2UA 5KT4A 2DNKA 2Y0BB 1WI8A 3PV8A 4KGXB 2RE1A 2CKWA 2V67A 2CQ3A 2KI2A 1VQOS 1PKUA 2LQ5A 4Q8EA 3N5FA 4XIUA 4HHUA 1IBLF 2E29A 2JRSA 5ETRA 5AE3A 2X1FA 1BHNA 4DSEA 3E01B 3HSZA 3FBFA 3HD1A 4HR2A 3G6XA 2ZBPA 2HHVA 1FDDA 3VGVA 1SQEA 1H98A 1H3DA 2QG9B 2VZ9A 1HQEA 3TOQA 4F4WA 2F63A 1SL0A 1NK5A 1P9QC 2GHVC 4X62F 4NMXA 3PRDA 4DJBA 1SBRA 3AJ2A 4IOCQ 2HURA 4P71A 3T9ZA 1TK5A 2LQJA 4X62J 5ETVA 3CD7A 4DV1F 2HGMA 4CH1A 2EK1A 4KPCA 1IBMF 2MY7A 1TKTA 2M7SA 4BC9A 4EK2A 4DV1J 2HAIA 2M8HA 4MFBA 4USUA 3MOZA 1YKWA 4JI2F 2ASLA 1RXOB 3MEGA 1IBMJ 2NR0A 1FI4A 4J9RA 3GJSB 5RUBA 2EVZA 4JV0A 3SMZA 2HG4A 2LCWA 2VQEJ 2CADA 2G2YA 3K5MA 4ZCMA 3RBDA 2W4CA 1QAYA 2ZHOA 1T9YA 9RUBA 4WWSA 1ZA1B 1FK9B 3IO1A 3IBCB 3WQPA 2O3DA 3ONQA 1B0VA 2BV3A 3TAMA 2Q43A 3LUYA 4J9QA 3R3TA 4K4ZA 5FDLB 2XQCA 4A48A 3W5XA 4ZMMA 5A8RB 3O8WA 2AYEA 1NRKA 4J91A 4PXEA 3ZTQA 4ZDNA 2OFGX 1HYSB 1TP7A 3P96A 2KM8C 3TVYA 1C1BB 1IKXA 1BWVA 1NJZA 1ZA2B 1SQGA 2BANB 2WW8A 2CVEA 2GQQA 1FJCA 2HFSA 1NKEA 2ZZNA 3VQSA 2PFFB 3QMQA 3PFEA 1T0TV 3LANA 1BQMB 3HI9A 3UD5A 2MY8A 3LTOA 4X65F 1ACMB 4KFBA 3I9ZA 1Q8LA 3MMJA 3W8PA 3KJVB 4I69A 1UJ6A 4X65J 3HHEA 3CTRA 1RI7A 2ZBIA 2D9PA 3G6YA 2MQOA 1XEZA 2B0GA 3M8YA 1UVNA 2G2ZA 2YNGB 5A6PA 4FXVA 1TMMA 2KXFA 5AT1B 1GK8A 2PFDA 3UQSA 2GCFA 4TXSA 2HHPA 3MR5A 1WORA 2CNNB 4LVOP 1DQ8A 3EPIA 1U0HA 2OPPB 3BM7A 1VYAA 1BLUA 5HMZA 3A8KA 3TUIC 4O44A 1X4BA 4XK8C 1MLAA 1GXLA 3HJVA 3NBPB 1XWLA 3BSOA 1D1UA 3HULA 1VJQA 1R8CA 2XNQA 1SL2A 2G9OA 1GXTA 5B0BA 2VG6B 5AJ3F 2E9TA 3G86A 3QFWA 3NGDA 2EBEA 3M1VB 3HVWA 4K4WA 2DNZA 2F8HA 1YQHA 3BN4A 5CD4H 1N54B 5AJ3J 2V8DA 2JHEA 2DGQA 1CJTB 2FLOA 3J7A1 2DGVA 1DRZA 1GQEA 4DSFA 3W5YA 2V34A 1YI2S 8AT1B 3OV7A 1U1OA 5DM7Q 3M05A 2BJDA 4OV1A 4LF9F 3AODA 2BQUA 4TYAA 4M5DB 4UOHA 3W66A 3KLEA 2QYGA 2CQ1A 4CLFA 1KDNA 4WCEQ 4AYBD 2CAJA 2IM2A 1JKHB 3R5BA 3HHKA 4LF9J 4ED6A 2LP4A 4PQUB 3J80Y 4OZJA 5L46A 4OHWA 3DC2A 3THPA 2J9DE 2ADBA 3I87A 1K1QA 4YDXA 4N77A 3RB3A 1DFDA 3DGPA 2BZ2A 1U26A 2FLLA 3FMBA 4YS2A 1N6QB 2D1CA 3EXYA 2AP6A 3F41A 1UVMA 1FVQA 3KUGA 1WC1A 2X1BA 3UN5A 3DLEB 1KOHA 1UAWA 3M2VB 1XJWB 4OI2A 1TKXA 3TW0A 2BRLA 2EWHA 1R8HA 3M4XA 4JI6F 1UWBB 2OPSA 4K50A 1RT3A 4J9OA 1DTQB 3HLUA 3BQ0A 1HWJA 1KFDA 3N01A 1J27A 3BF4A 4JI6J 2R8IA 1RSCA 4F25A 5A6WA 4L76A 2CNOB 3A4TA 3IS9B 4USVA 5ETKA 3NGKA 3PM9A 1TAUA 2X3GA 4GVBA 4HH0A 2NSBA 3QBCA 5L1LA 2CUYA 1S9GA 1NSAA 2K06A 4NLVA 4O4RA 1ELOA 4CLLA 3R27A 3JSMB 2HHQA 4IRDA 2YKAA 4OX9F 3LP0A 3OJUA 3PEJA 5J2PB 2A3JA 2H54B 3SCLE 2P9CA 1HMVA 1S4FA 1KBRA 1YJUA 2E44A 2M5YA 3IAS9 1IWAA 3TA2A 4RJVA 3TZYA 4OX9J 2HVZA 3NRBA 1KTVA 3KHLA 2G1HA 4QU7A 1Y10A 4K5SA 4HI2A 3OBIA 5LM7E 4ZN3A 2ZJPQ 4QR2A 1Y5LB 1EAYC 1UZDA 5L9NA 1WTFA 5CYMA 4W92B 5DG9A 3IBFB 1Q86T 1U09A 3MEKA 4OYOA 2K2PA 2R8HA 2CQHA 3BQ2A 3A1YG 2BX6A 2Z4PA 2GMLA 3GZ7A 2BJ7A 3RTVA 3DLKB 4R0EA 3KTQA 1IKVB 1GX5A 5HLFA 2MGZB 2GMJA 4YY3F 4DQQA 5HAOA 4EBDA 1FFGB 2E66A 2GJIA 2FZGB 3K8WA 3PCOB 3C6UA 2RVJA 5E3AA 2XNRA 2GS8A 3ZZ0A 2QZ8A 1TK0A 3LWLA 1C2PA 3QATA 4YY3J 5KG4A 2AYMA 4GRSA 2BOAA 1F1BB 3LP2A 5HMYA 3CO9A 1X5TA 2GVDB 2YXLA 1IKYB 4YOEA 1RP5A 3THVA 5DG8A 2HZCA 5AE2A 1VQ7S 4DG1B 2HBZB 5HBMB 5ETTA 4DPTA 3FZ2A 2F9JA 4PUOA 4G1IA 4DBQA 4UY8T 1UW4A 2OSRA 4F4AA 2MHNA 2JH3A 4EU0A 4FYVB 4C8OA 2Z8QA 1RBLA 2C1EB 1YJ7A 5EGYA 5J2NB 1VQMS 2V2KA 1RT7B 3CMQA 4X4PA 1MN7A 1REVA 3I9V9 5B08A 3G96A 3QGHA 2KT5A 4DR3F 1CC7A 1UVKA 2AT1B 2FPHX 4BWJA 4K5RA 2Y9HA 4OZNA 4UUXA 2RH3A 4DV6J 4EZ6A 3T5LA 3M8PB 4R8UA 4X84A 5GVQA 4LREA 2DEJA 2AX1A 4U7UK 2PI5A 3CJKB 4U67Q 1U1KA 5T7LB 5KT7A 5C25B 3FDSA 4PAAA 4B3OB 4ZVHA 2A10A 2HWHA 2UVVA 3UDEA 5L9XA 1CPZA 4JUZA 4NA2A 1X9SA 4RW6A 1LK5A 1H38A 2HVIA 4I2PB 5KFXA 2OPQA 1TK8A 4DL0C 3H5UA 3CJSA 3BGRA 2MQMA 2GFFA 1YDLA 5CZXA 3TUJC 3AOCA 4QWAA 2RJZA 5C24A 1BD6A 4OZ1A 1WHYA 3LA0A 1X5SA 3QAEA 5DLGA 2XBPA 3TJ9A 4M5KA 2O66A 4DCOB 1TFWA 1U47A 1KP6A 4PG7A 2DY9A 4RU2A 2W25A 5KFTA 1P1LA 3KHRA 2IAJB 3FSIA 1RT5A 4UOFA 2V2ZA 3KG0A 1HIYA 1IR2A 4I6AA 2BQ3A 4MKAA 2MMYA 2MLZA 2ILYA 4K0KF 4JOUA 1VFJA 3MDFA 2GMHA 1VQ5S 2W9BB 5KFEA 2HRYA 3B82A 2ASDA 2ZUAA 3MPWA 2RUSA 4K0KJ 3CCUS 3ZC4A 1N0UA 1DLOB 1X4HA 3CIZA 1N5YA 3A3PB 4H4KA 1REGX 4HACA 1S12A 2AJ1A 3DOLA 4RKUC 2CPFA 3PR5B 3LP1B 5T14A 1AT1B 5H9FJ 5I3QA 4F8RA 4C3KA 3U1LA 4ALZA 4N41A 5ETNA 4OYWA 2HNDB 3DMJB 2CZVC 4N76A 4DEZA 4PG8A 3KLFB 4ZJOA 4U8VA 5GADU 4P7TA 2HIYA 2QL7B 3MM6B 2AQ4A 4P2XA 5ETQA 5C7PA 3DCAA 3S6EA 2KXHA 2UXBF 3FSYA 2KFNA 1RUSA 2DNMA 4RNMA 2P8IA 3IBWA 2MZTA 2OD4A 2RDDA 2UXBJ 4ZPBA 3Q22A 3E01A 4RW7B 4IUFA 4DFPA 2E1PA 1VBZA 1RWKB 3BGLA 5CYJA 4FKYA 4CO1A 1ZM4A 4XAKA 1FT8A 2IMOA 1NK0A 1PSDA 4WU3A 1U25A 1KS2A 1F6TA 3PW0A 3CCES 5FLXU 3GB0A 4NI2B 3PRBA 3I32A 2IVYA 2CNLB 1RZMA 3K5PA 4XDCA 2A6OA 3KNAA 1NMEB 3OR2B 1WKJA 3CDAA 2BA9A 3EM1A 1H2VZ 2ZNZA 3VVUA 4BWMA 6FD1A 2QL9B 3P8BB 4Z7YA 3B8HA 3JAMY 1K0VA 4ZN1A 2E1CA 3WX4A 4WE1B 3VGSA 3U1NA 4M5MA 4J7CA 3FJ2A 2HWTA 1VBYA 4ZS6A 4XPEA 2MEWA 2AIRB 3RBXA 4DL6A 4O0NA 2HWIA 1DQAA 5LOQA 4JI7F 4RBTA 1GEHA 4ZK7M 4LRDA 1B0TA 1EQMA 1MWYA 3OTCA 4B3MF 3QWUA 4DN0A 1KRPA 4V19X 3GYNA 1FK9A 3A3NB 1YRTA 3MCSA 1RQ0A 2D9OA 4OYMA 3OTEA 4JI7J 2YWHA 3EDQB 1VOMA 1G7CB 1MSWD 2HFVA 5FDLA 1KVJA 1YGYA 3M2UB 5A8RA 2D7SA 1BY9A 2MKSA 3K7RA 3LOUA 4YB7A 5IQ6A 4LSLB 4OZ0A 1HYSA 3NL0A 1TL7B 3FK4A 2UVRA 1C1BA 4J9LA 1IWGA 5KG7A 2KO1A 4DV3F 3BBFA 2N3OA 4BS2A 1FRMA 2NLWA 3CJRA 2BANA 1RTJB 4DL5A 2DTJA 3W2WB 3GCWP 3THTA 2IJNA 1LXNA 2AEMA 2B7BB 4DV3J 2OUGA 4NZ7A 1BQMA 3T19A 2VIHA 4FYDA 3PXGa 3M6WA 4P72A 2AZ3A 4WP9A 3NS6A 2LQBA 1NM2A 2ZFHA 4LBPA 2MHEA 1B7FA 3KJVA 3H42A 1T02A 1PC5A 2ZDPA 3N6MA 3QRPA 4RR5A 4QCLA 1SCJB 3NGRA 4ED8A 4NLYA 3DRPB 1U1NA 5DJBA 4A8QA 2YNGA 3C66A 4LF1A 3PYFA 3SI8A 3RB6A 5DGAA 1KQFB 1QSYA 5DDQC 5K8PA 2KHDA 5KFVA 2OPPA 3AHPA 2DNPA 2NXJA 2IA6A 4MYUA 1VRUB 2C3UA 3M2RB 4FN5A 4C8MA 1H72C 5KFKA 4LF4J 3AT1B 3K59A 3NBPA 2XZWA 2HVHA 1HBUB 1DAXA 4PXBA 3M1VA 1SI9A 2ZWPA 1RJJA 2QA2A 3PW4A 3NWRA 4YP3A 1X9MA 4OL8A 1CJTA 3TQEA 3V6KA 4DLEA 4PXDA 2IFXA 2DYAA 1V5VA 4IO1A 1FHTA 1LQ9A 4ZLLA 1HBNB 5KFZA 3BSCA 3VGTA 1RLCL 4AT1B 1VBXA 4M5DA 4WBFA 4UT4A 4QBUA 1PBUA 1SC3B 4ETZA 1DHMA 1HARA 4BHQA 2XI3A 1JKHA 4PQUA 1Z1ZA 1YIJS 2M70A 1J5OB 2WSFC 4QU6A 4M5IA 3A3OB 3KUHA 1TL5A 2CZ4A 2J9CA 4OMFG 4TKTA 3ZTRA 4DI6A 2AHOB 3BBCA 2RILA 2O67A 1SH3A 4ZHRB 4U9RA 3DLEA 6FDRA 3JQMA 4LIRA 1GNKA 2PMHA 5AXKA 3M2VA 2Z30B 3LAKA 4LFCF 5L38A 2VJVA 2ZD1B 1VRTB 1TL3B 2OMLA 1UWBA 4DR1F 3Q8QB 1DTQA 2HRTA 3MECA 1AFIA 4URQU 2PSZA 5F0UA 4LFCJ 3GYGA 2FHOB 3NAHA 4DR1J 1UA0A 4TY8B 1DY3A 5B0EA 4B9VA 3IS9A 1GMWD 1U8SA 2AJ4A 1Q4RA 1P1TA 4D3HA 3LWMA 1G2EA 1X5OA 2CZ9A 1S6OA 3AD8C 2NXUA 3D9BA 4FBTA 3NWGA 1VIOA 4ZJQA 3RW6A 1X8DA 2DNLA 2VDHA 3BBBA 2EEYA 3UVJB 3ZZUA 1P9YA 4U95A 3JSMA 2KYXA 4IDKB 3NMAA 5J2PA 1LFWA 5AXLA 3MFHA 4UW2A 4ITSA 3P49B 4F3MA 4NE9C 4USMA 4WFNQ 2R42A 1YJWS 5B0FA 3CCTA 2XCAA 4A8WA 4OYIA 1RAAB 3QT8A 5E33A 2HQDA 4ZVQB 2K3IA 1W7WA 5LJ5Y 4TNOA 2W24A 4JYAF 3SBMA 4GO5X 1P27B 3CPWR 1NK4A 1ZTWA 2PT0A 4AUKA 2CG4A 4DV7F 4O3QA 2PMWA 2E1AA 4JYAJ 3OVBA 4H4OB 4NLGA 2PMZD 3KK1B 3R5GA 1PYSB 4QJVA 3DLKA 4CLWA 4RNOA 4DV7J 1IKVA 4R25A 4ZCIA 2B4PA 2JC1A 4K4TA 1FDBA 2JVOA 3PFOA 3BKTA 3SSRA 3PW5A 4IOBA 3MZIA 3DDKA 2H1YA 2AYBA 3BO4A 1X31C 4DUYF 2F9DA 4X4NA 5L8RC 1VQLS 4CLSA 4CM2A 1Q82T 2Y1LB 3OD2A 2GVDA 2H9ZA 2UVUA 4DUYJ 4AE5A 1HNXJ 1IKYA 1S0NA 2ZH4A 3V6JA 4C98A 2CQDA 3ETOA 2W7OA 4DG1A 5IZHA 1JNRB 5HBMA 4NMLA 5A2QY 4KO0B 2E5IA 2LU2A 2EFQA 3G6ES 2FB0A 1JLFB 1FRKA 2ZNYA 2AEFA 5J2NA 2M9KA 1M5OC 2PC6A 1Q81T 4FPIA 2DH9A 3J7YI 1R7IA 1RT7A 3OT9A 5KFCA 2YWFA 1RDRA 2Q66A 1DJ0A 1L3UA 3H4BA 1F0XA 1RBAA 3OW2R 3ITHB 2DEIA 2YKQA 2JOQA 2B5JB 2B4OA 3MPVA 4I7FB 2HHXA 3M8PA 4B3TF 3D5MA 4DS5A 4QW8A 3M6VA 1FFWB 2HHWA 3CJKA 2CG8A 3PYGA 3MUMP 5T7LA 4KV8B 4N7TA 4RNNA 3UDCA 3AOBA 5C25A 1FWLA 2EFPA 3VF0B 4B3OA 1QVFR 2MLYA 5GAHU 1RBOB 1H7XA 2R8JA 4I2PA 5HL7Q 1R31A 2KH9A 1TTHB 4B02A 3CC4S 2QFJA 1ZETA 5EHHA 1N33F 1EQ0A 3G87A 3ZXWA 5BR8J 2Z2MA 2KFYA 2LXUA 4X4VA 5DDRC 1YJ9S 3EVOA 2Z2ZA 2H48B 3MUVP 1N33J 1FD8A 3H8YA 2QC3A 1VISA 1HQUB 2BRKA 4RU9A 1GMVA 2Y8WA 5LL6d 3PY8A 4DSKA 4P2MA 2UUWA 2IC3B 2IAJA 5ADZA 3LW5C 1VLOA 2V9WA 4KJIA 4PWWA 2OAUA 2ROGA 1SC4B 2B8QA 2WVCA 2JDJA 4ELTA 3K8VA 2GAHC 5DRKA 2W9BA 1MROB 2KYZA 2FC8A 1NK8A 2J7WA 2R8KA 1RAJA 3SSSA 2V4QA 2CJKA 3D28A 1S1TB 2IRXA 1DBDA 3N0VA 4FNHA 3CJ3A 1DLOA 4CNYA 4ZKAA 4OJ3A 3A12A 3D6TB 1T05B 1NHVA 5GAEI 1RT1B 4EFAC 2GJFA 2XMUA 1RAIB 1J5EF 4X2BA 2B9WA 3P5BP 1H2TZ 3GG0A 2JLGA 2AKWB 2R9LA 3BR8A 3PIOQ 2HK2A 1HHQA 2HNDA 3DMJA 1J5EJ 5D0GA 2F40A 3H5YA 3J7Z5 2C2RA 1RTZA 2HMIB 1K9MT 3SV4A 3KLFA 4PZVA 3MM6A 1U8WA 2HEKA 1CSJA 1LWFB 4CO0A 3PVXA 4NCBA 4B9NA 2RS8A 4IKAA 4KE5A 2RDJA 5IT4A 2YY3A 1JX4A 4RW7A 3T41A 4KR0B 1G4CA 5GMDA 4ZA1A 1NB7A 1NKBA 3GJRB 5F3TA 2ZH5A 4C6AA 5KFRA 2L08A 2NXCA 2F5GA 1T9TA 3H20A 2QLWA 4B17A 3OHBA 1U1MA 4OYAA 1U1QA 3SQOP 4YB5A 3IWXA 1KLNA 2UUCF 2XI2A 4NI2A 2N7YA 2W2NP 1NH7A 2QIFA 3C8YA 4EYHB 3MMCB 4PWDB 1Y0HA 2XYHB 3HK2A 1X4AA 2UUCJ 4C8YA 1PBAA 3GSDA 3TEGA 3AD7C 3OR2A 4O3RA 3D66A 1M5PC 2DRBA 4YQWA 1GFWB 1Y9OA 5B09A 3PX4A 2ABYA 5D4OA 2FY8A 2YQ0A 4KB7A 1RWPB 3IGVA 4WE1A 1FE0A 2DIUA 2RT3A 2AD9A 3EGVA 3C6TB 4IG0B 4WPAA 2PD1A 3G71S 2XCPA 3S7RA 1C0UB 1HNIB 3H5XA 2APOA 4B08A 3MFIA 1YJTA 4MFBB 4A8FA 1UETA 2ZZMA 1HNWJ 1VIXA 2F8MA 3M8SA 1KFSA 1AROP 3QT5A 2XSFA 1OYDA 4LBHA 2J6TA 2HPUA 3TUZC 1YTYA 1U7LA 3HPOA 1KSPA 4OYZA 4F0KA 1QTMA 1IN0A 2VFTA 1Q53A 3MGJA 1L3TA 1CJVB 3M2UA 5E3PA 2KTQA 2NS1B 1F9HA 1TV6B 3IGNA 4LSLA 1M0SA 3G4SS 3VZHA 1TL7A 2A2DA 2CJ9A 4ZLPA 1VQ8S 2DCLA 2I5JB 4F3QA 2C28A 1BQNB 3W9HA 4LF2A 3TVKA 3I6PA 2QA4G 4UQTA 3NGTA 5IOLA 2DD8S 3OL7A 4ED1A 5ETPA 1RTJA 3L9ZA 9ATCB 3W2WA 5HROB 3GWCA 5JVHQ 1NBEB 3ILLA 4Q7AA 1PG5B 4QWBA 4FS1A 4CWBA 2J8AA 4CRJA 1UFLA 2B9EA 1OJ4A 2X1GA 2MQPA 1T03B 2QEXS 3CD0A 4ECWA 1RA6A 2N4DA 1WDTA 4PKDB 4OI6A 2XB2D 3UDVA 5JMNA 1QTNB 4USIA 3NGSA 4CO4A 3MD3A 1ZZFA 3GIIA 3DRPA 2BKPA 2XSJB 1HW9A 1R0BG 4X4TA 2PA3A 3IA0A 2RUGA 4FYYB 1VRQC 3PW7A 4TQRA 3U02A 2QL5B 1AZSB 4AQYF 3KLIB 4QZVB 1TL1B 3GP9A 1LWXA 4O3SA 4UQGA 2UP1A 3NAIA 1VRUA 5HQ8A 3M2RA 2W4DA 1VQPS 4A46A 1FX2A 3MR2A 3OR1B 3K89A 3RR8A 2IY5B 1G3OA 2OEMA 2WBMA 5IM0B 4DR6J 1JLEB 3FUYA 5E3QA 1HBUA 4EYIB 1JB0C 2W9AA 2R7VA 5K5MA 1HHTP 1O6XA 3QIDA 1JLGB 5DG7A 3DM2B 3D1HA 3T5KA 4DQSA 1JNZB 3VR1A 4E8UA 2KDOA 5CHCB 4JV5J 2JL9A 1H2UX 4CT8A 4WFBQ 3QGIA 4OQJA 2XY6A 5F8IA 2F1FA 1HBNA 3SFGA 2QT7A 2AJQA 1UFKA 3MPUB 5HVGA 2RD5C 1KC8T 3PJ9A 3NOCA 1WEZA 1VQSA 4A8XA 2YWWA 1VLYA 2CQIA 4IRKA 1J5OA 4FF4A 1S97A 1I5OB 2B7CB 3IR7B 4DR7F 2FC9A 3H7HB 2ZVIA 1M5VC 4KHRA 1TMJA 3O6QA 6AT1B 3PTWA 3OFGA 5GMKa 3TA1A 3NLCA 4DR7J 4ZHRA 5G0RB 1P8GA 4USJC 3HSDA 3VHQA 1U2RA 2W4PA 3CNQP 3L95X 2V50A 5I3PA 4TY9A 4MTPA 2ZD1A 1VRTA 1TL3A 1OY6A 4Y6IA 3DNCA 4WZQA 3R1HA 5CH7B 2OKQA 3HSJA 3MM9B 2QFIA 3MUTP 2RKIB 4LRBA 3N79A 3O1LA 3FBBA 3OPKA 4TY8A 2XEXA 1NH8A 2QRRA 5KFFA 1V5IB 4NZ6A 4CLTA 1RTHB 3RRHA 3ILIA 2FHJD 3BN7A 4FXWA 1XMQJ 5C2CA 1IJEB 1N4LA 2HQFA 4A8YA 1FNXH 5IWAF 3JS9A 3IG1B 2JZ5A 1UTAA 2X7IA 1QLNA 4K8RA 4H54A 3JQKA 3TI0A 3P3DA 4OZ3A 4QIWD 2QSWA 3KLHB 3D0IE 2CQ0A 4JI5J 3UVJA 1FE4A 4IDKA 4HT7A 3KHHA 3HFKA 2DT9A 1JMTA 5E5NA 3K5OA 1Q0NA 1FA0A 2QA1A 3N28A 4ZVOB 3MTKA 3DHWC 3TUPA 3O3LA 2ZOFA 4MAKA 4M5NA 1SUQB 1ZAXA 2FVSA 4OZ5A 1KOOA 3D0HE 4IH5A 4NLSA 4Q43A 2KJWA 4WTYA 1UPPA 2ROEA 2CJBA 4Q2LA 2WHOA 4Z2XA 1HPZA 4F04B 2ALYB 1B3TA 3G8SA 4CNZA 4JP8A 4H4OA 4QQBA 3KK1A 1XR6A 4KGKA 4C8KA 2GO8A 3IP0A 2DNGA 2UXDJ 2B56A 3CCVS 1H74A 2R2TA 3CJ4A 3NG8A 4AL6A 2AJ2A 4BCAA 3VVTA 2CJYB 4B9SA 3EJMA 1RT6B 4NLXA 3LPYA 3VAIA 4DUTA 2VC0A 2ROPA 4QIVA 5D0RA 3TA0A 5BYSA 3D4JA 1LW0B 5K8OA 5ITHA 2HIQA 3I5AA 4G1PA 4ECXA 1R0AB 1RT2B 2FDNA 3W2VB 2YH1A 2YPYA 2GJ2A 1M90T 2ZOMA 1U02A 1D9FA 4KO0A 4FBUA 1RACB 1PYTA 2DO4A 3MCNA 1JJ4A 3GV5B 1JLFA 5B7WA 3FQLA 2CA9A 4C48A 5HP1B 3BO2A 2MYFA 1S6PB 1WJ9A 5KFPA 5ETOA 1PC4A 1WG4A 1M1GA 3D6HB 5F9LA 1PYOB 3DRYA 2PIIA 3FEXB 2MZQA 1RWXB 2BJ3A 1HBOB 2GIFA 3TX8A 3ITHA 2ATLA 2B5JA 4ZCKA 1VBKA 3UWTA 4E2FB 3E51A 3DN9A 4I7FA 2XMTA 4FYXB 4U7CA 2ASJA 4CIOA 5KT5A 5L1IA 4RNHA 3KMSA 2KG0A 2AGPA 2GVZB 2NUHA 4KV8A 2KXNB 5DQGA 1CVJA 1UFWA 2ZHBA 5C5JA 2K1RB 1FXDA 4Y2IA 2EG1A 1XNRJ 2VH7A 3CIMA 3RAQA 2AX0A 5FJ4A 2CQPA 1PAEX 3CCSS 3J80U 1HWIA 1EKSA 2LECA 3I0SB 2RRBA 2Z57B 3ENVA 3SIPB 3ET6B 3JB9k 2Y1RI 5DZ6A 1U6FA 2DKOB 1FCAA 1HWUA 2J7UA 4MIAA 5MAOA 1RLDA 2B43A 1ZZNA 2VHGA 3VAFA 5KFYA 4Y34A 1HQUA 3GFZA 2CJXB 2JEJA 2MQNA 2W8KA 4ANDA 2DNQA 2J9DA 4QIFA 2C3PA 2IC3A 2DH7A 1L3SA 5KG6A 1OIAA 1N5VA 1WC4A 2Y0SD 3BZQA 3IR5B 4ZPTR 1MROA 1NEEA 1B4SA 1I6JA 4DPWA 4I56A 1R3NA 3BH6B 3L4BC 3R7SB 3DLGB 1VC0A 2CPJA 3GSIA 1JXVA 4NLPA 1T05A 1XQIA 1RT1A 4DZDA 2MLXA 2XZDB 4LQ3A 3CCWA 1K73T 3C19A 1L3KA 2FYXA 2UUBF 5D4NA 2HS0A 3MEEB 3I0RB 3DDIA 1G1XA 2CWXA 3BEGB 2KB2A 2UUBJ 4I4BA 2HMIA 5FIIA 4LQ9A 4ANCA 5BXIA 5J2MB 2W2QP 3GIJA 4M63A 1VHFA 3GPAA 2D41A 1UWAA 1LWFA 1DQ9A 2JWNA 2ZZTA 1BWEA 4NRUA 1U48A 3C3LA 4WK1A 2JEFA 2AJ0A 5JJBA 5E3RA 4NXMF 2U1AA 1R6VA 2EK6A 3U7JA 3V81B 2P2CB 4FVMA 4ED0A 1Y7PA 1N88A 3MPYA 2MKKA 3ZZTA 4KQZA 2E5GA 4NXMJ 1VS3A 3HHDA 1SJFA 2CPDA 3TP2A 3UD3P 4KKOB 1ROFA 3UW1A 3IM8A 4P75A 1PJ5A 3L3CA 1ZAWA 4B9TA 2HFOA 4OI4A 2JX2A 2NZCA 1TUWA 1FDNA 3MMCA 4PWDA 3HFZB 2RSQA 4DXLA 2YQ1A 4NRTA 1RADB 1WC6A 2YH0A 2UVWA 2BOPA 5IT0A 2FY1A 3LGNA 2W2OP 1UMJA 4M5JA 1YJNS 3PKMA 3BDPA 2VFVA 4DF4A 3C46A 2DCUB 2B4UA 5KFUA 3Q86A 2PI4A 1FTCA 2WSCC 4WK3A 1RAHB 4YEAA 4DWIA 4LR7A 3C6TA 4IG0A 2ZE2B 4GKKJ 4WFAQ 1C0UA 5EUHA 1HNIA 4NOHA 1K44A 3MOJB 3CD6S 1RAEB 5T41A 2CFXA 1X4GA 2FGOA 3MR6A 5GAGI 5HANA 1Q8IA 4P2FA 3FRZA 2VQEF 4OV6A 4K4VA 3HT0A 2B3TB 4PXCA 1S7IA 5C2GA 3GFXA 3SCKE 4KC5A 4Y3CA 4LSNA 4A8OA 1O0PA 2P5VA 4GMKA 3UE2A 4M1KA 3R5DA 3G2XA 2LVWA 1CJVA 3FBCA 3TEHB 2CPHA 4LR9A 5H1SV 4CDIA 1WC5A 1UPMB 5IXUA 2Z0GA 1I94F 2M88A 3M6XA 2XYPB 1TV6A 3VAHA 1K47A 1S0OA 3H2UB 2VPXB 1NPKA 5KFMA 1RTDB 2V2QA 3QQCD 2EXUA 1HNVB 2GIRA 2I5JA 1JQGA 5KG3A 1BQNA 3CDBA 1LK7A 3R6GB 1I94J 1FKAF 5IV4A 1NJWA 3RW7A 4X66F 2OH2A 2BYCA 3UR3C 2FZKB 5MLCV 1O5JA 5D4PA 5HROA 1HKAA 3D67A 4FF3A 3BYPA 3D1OA 2XLIA 4X66J 4A8KA 2HQGA 3ZZZA 4HLBA 3NS5A 1T03A 3NMRA 3M32B 4NCGB 4MIWA 2HHHF 4CI0B 5J2QB 4ZP9A 2PEHA 3AB4B 3Q2TC 1V6HA 3ADAC 2HQCA 2HHHJ 4DSIA 2I38A 3VAGA 2UV8G 1N5SA 3CCJS 4JI1F 2XSJA 1SXLA 4LT6A 3Q24A 2R7XA 4U6PA 2ZM6F 1F5CA 4TYBA 1HL6A 2RS2A 1AZSA 2XGQA 4JI1J 4ANEA 3TAQA 4B3SF 5F8HA 3KLIA 3O2IA 4UF4A 1UEUA 1TL1A 2ZM6J 3HHLC 3Q23A 2L41A 1ZM9A 4QPXA 1T94A 4PEOA 4Q8FA 2B9XA 2IMWP 2BKNA 3DKDA 2FVRA 4B3SJ 1JJCB 4ZVGA 3UCZP 3OR1A 4H4KC 3D6MB 1IR0A 5IM0A 1JLEA 1MG7A 1UZHA 5E0OA 4KYZA 4W98A 4LIWA 1JLGA 3DM2A 1F5AA 1UA1A 4DQRA 3H98A 1SPBP 3VAJA 2NUUG 3VZIA 4MMOA 2GX8A 4QIGA 2HGLA 5B0AA 4DV5F 2WVEA 4MKVA 2O1PA 4K4UA 4NYZA 2ATCB 2XS7A 3H2VE 2OFHX 2YKOA 4EEYA 3W62A 4HKQA 4EO6A 4G6VB 1H0HB 4DV5J 3AOAA 1Q1KA 1C0TB 2FD2A 1T7PA 4A8SA 4DR5F 1SIZA 2AJFE 3L7PA 1NJXA 4OLPA 2R3VA 3FQKA 3ILJA 3TZZA 1HW8A 5LSRA 2C3OA 3MM7B 4I2QB 4DR5J 2JNJA 1V3SA 3TNVA 3S1TA 4B3RF 3ULHA 4URGA 4ICLB 5CD4A 3IWLA 4F4KA 3K0JA 2B9YA 3R2CJ 5G0RA 1WF0A 4B3RJ 5D6GA 1WD6A 2XHWA 3TZWA 4WZMA 4J9SA 1PILA 3B6BA 3W65A 3R5AA 1SKRA 1SKSA 1QAIA 4Y65A 3MM9A 4I68A 2RHQB 1RHKB 2FJDB 2RKIA 3I82A 1WI6A 2POKA 1R27B 2QV6A 4PPZA 2A6MA 2I9SA 1FX4A 5KG0A 3BREA 4FDFA 2DPIA 1NKCA 1KWMA 3ILOA 1Y3JA 3ZFVA 2HLUA 2M3DA 5SZTA 2XLKA 1RTHA 3MECB 2BE2B 3RB4A 3ZZOA 3H40A 4IH6A 4TLRA 2FJVA 2MKCA 2NPIA 3FEYB 1OYEA 1ZPWX 3IG1A 3D1QA 4IQMA 2GV1A 4P74A 4DV4F 1QSLA 1GAOA 4N8OA 1WEYA 3KLHA 2BQRA 2OO4A 2DNOA 5LMNJ 1Y5NB 1YZ6A 3A8JA 1ZTTA 3WBZA 1ZBTA 2IM3A 1FRLA 1SJQA 4DV4J 2DBBA 5ETLA 2J0XA 4HHHA 3LGHA 5AXMA 2HFNA 1HA1A 2JSXA 4I1TA 3KK2B 2V6AA 2ZH3A 4IH7A 3CVKA 3H59A 1SUQA 4WP3A 1S79A 2DHSA 1VQ4S 3QZ8A 2GC8A 1C4CA 3L7UA 2RQKA 4DHVA 3HO1A 4F50A 5FD1A 1UJ4A 2X3DA 5D3GB 3BR9A 3QYYA 3W9JA 2IDLA 4RNFA 3F44A 2ILZA 2D3O1 3CJ2A 4ZCLA 1ZAVA 4IRCA 4ED2A 2BEFA 3TQ1A 3U27A 2BXJA 1T9XA 5F41A 4NEZA 4K59A 4GKJF 1RAGB 4WFXA 4ECZA 3OTBA 4ECRA 1XIQA 2C22A 4QWCA 1GTEA 5JUMA 4GKJJ 5KFJA 4N8NA 2N82B 2IBKA 1VCTA 1RT6A 5CQGA 3B78A 3ETMA 2J0SD 3CD5A 5GAHI 3RRKA 3P4UB 1W26A 1LW0A 1RCOB 3CT9A 4GVLA 4JB8B 1R0AA 1RT2A 3W2VA 4EUVA 4KHPF 1AFJA 2WB4A 2XY5A 1ULRA 3MF5A 5C42B 3PO4A 1VHIA 5I3UB 1X60A 2FVQA 4KHPJ 5HP1A 1WACA 2F4VF 2WVDA 1S6PA 2VV5A 4ENOA 4P9SA 4YR2A 2G1DA 4CQ1A 1FKOB 3EGWB 4NXNJ 5IC6B 1MWZA 2PO4A 4HDGA 1N48A 1TUGB 1Q8BA 2W7AA 4G65A 2F4VJ 3VV2B 1HBOA 2E5LF 4ZPVR 2ERRA 4L72B 4QYZJ 2LA6A 1KD1T 4DV6F 2E5LJ 2V0NA 5A8KB 3HSGA 2BUNA 2QA4S 2GVZA 2XS2A 3MM5B 1URRA 1FNMA 2K1RA 3J7AN 2HZVA 1NNDA 2IJRA 5DQIA 3PEHA 3HZGA 2V4JB 1AB8A 4OJHA 2CPIA 4PR6A 1GT8A 3UDLA 3V2UC 4ZLJA 2AU0A 3I0SA 5K9FA 2DR9A 1M5HA 1UP1A 3TAPA 3ET6A 4EZ9A 1JWWA 4C2MA 3R7NB 3KK3B 2JJ4D 2VASA 5H9FK 2CNKB 2D3OR 2CPZA 1MN9A 2XG8A 2KL8A 4KHMA 4KH1B 4ECTA 4Q5VA 3ISZA 1K1SA 4W4MA 2H5JB 3WDOA 4HEA9 4F4YA 3JSYA 3BKFA 5J1PA 3NNAA 1JLBB 3R5CA 2EC2A 2MQQA 4CLZA 3B4MA 3RU0A 3WX8A 5HMWA 3N9UC 4U8YA 5D15A 4C0OC 5KG5A 5DDOC 4N5SA 4WXWA 2OEJA 1IR1A 3DLGA 1LOUA 4G1QB 5L39A 2HFZA 2IIHA 4DPUA 2MXYA 2ZVSA 7FDRA 1AYEA 4J9NA 5DO2A 4NEYA 4GO7X 1VJWA 2JLFA 1Q16B 3R7BB 3MEDB 3EE3A 1CS4B 4ZITA 3WC2A 4XTTA 3MEEA 3I0RA 4L73A 1S99A 1ZS6A 5B0GA 2N7CA 3PX0A 5H9EJ 3WHIA 1KLMB 3DOMB 2J6UA 4CM0A 4J90A 1U1LA 2GHPA 1XERA 3GV7B 5J2MA 2VG7B 2MZJA 1B64A 2V5HG 1S6UA 4LFAF 3N6NA 3O44A 3FCHA 4QPTA 1WELA 4LUBA 3QJJA 2R2RA 1SC1B 4DN9A 2L9DA 3MURP 2V4RA 4Y2KA 1R8AA 3IR6B 3G8TA 4LFAJ 2MB0B 3V81A 2BE7D 4ATNA 2GQ2A 1RYSA 1N8RT 4WXOA 1B99A 2HVDA 3OLBA 1LWEB 2MKIA 2VICA 3UNYA 2K7KA 4KKOA 4B9MA 1YG0A 1QUPA 4DU7A 4KPYA 5KT3A 2G13A 2KM8B 3EZOA 2DGOA 4JV1A 3ISNC 2QMWA 1LNQA 1QM9A 3LF0A 3OXLA 1RU2A 4NA3A 1IXKA 3UI3A 1GMUA 2NXNA 3CCRS 3BGFA 1TUVA 1VI7A 3D2WA 3BQ1A 1XK8A 2QTWA 1UVJA 4PRFA 3FKBA 3SCIE 3GFYA 3QLHB 4UOGA 2LFVA 4WU2A 2C42A 1TVRB 3CCZA 5HSPA 3BSNA 4YB6A 1X7VA 3FVYA 3OXFA 1N5QA 4DDFA 2ZC4A 2F8EX 2ZE2A 3GMGA 3BKUA 2AZ1A 2DHHA 4MKBA 2CWKA 1S9EB 3ZTOA 3HHLB 4DF8A 3KFWX 3RZAA 3CW2C 3J7ZT 1WKKA 2CIMA 2CJAA 5M2UA 1T9UA 4L3KA 5BYRA 5KFAA 2EPIA 2F4FA 1GMWA 3CEDA 4ES1A 4RL1A 2MKYA 4HT5A 5IT9U 2F7VA 1RABB 4NZ0A 1SJRA 3IRXB 2EFNA 4XO0A 3GILA 3FC9A 4USHA 4NLDA 1RTDA 1ZM3A 4ELVA 4LMZA 3HMJG 2ALZA 1HNVA 3OHAA 1WOSA 2QMXA 4F4ZA 2LQ9A 3TO8A 1S77D 2XWXA 1YRUA 4ECQA 3D7SB 4QYRA 2ZBRA 2BJ8A 3OTDA 2EKYA 4J9UE 4H4MB 2DR7A 2DNYA 2Z2YB 2ASYA 3AXMA 5HVFA 2DR8A 3MWBA 2HAFA 4M95A 3EXCX 3FEZA 1OMSA 4NLUA 2C2OB 4LF5F 2VFSA 3DDNA 3VAMA 3GIMA 1IBLJ 3M32A 4NCGA 4NX9A 1K8AT 5J2QA 4C9DA 4WIIA 2H4WB 5GAEU 4LF5J 2Y1IA 4NLQA 1OY8A 1OPZA 1A0OB 1RGVA 3DOKB 1NCLA 2MZRA 1CJUB 2G2OA 1SL1A 1SVDA 1UEKA 4USWA 3KKFA 1CULB 4X4QA 4Q2MA 2DVIA 1QAXA 3WIVA 2UU9F 3OSNA 2C2KB 2NREA 1VQ9S 1S1UB 2CDQA 3IC1A 3JTPA 1UVIA 1KHWA 1JXEA 2ZKUA 1EIYB 4LVNP 2DPJA 2YNHA 1T3NA 1D8ZA 3W63A 2QN6B 1E6YB 2UU9J 1FRJA 4OJGA 3T1HF 4LF4F 2C2ZB 1UJ5A 2YWEA 4CH7A 2HLTA 1X4CA 4NA1A 2JC0A 3RJMB 4ZPAA 4QWEA 1D8YA 2IDEA 4HL9A 1S0VA 4JI2J 3T1HJ 2EW9A 2XMMA 3M8ZA 2DRDA 3QRRA 5KT6A 2M4MA 3WZ0A 2OEKA 2B8PA 1L5UA 4DSJA 2HVEA 1SH2A 1UCNA 4MK9A 2JFKA 1PO6A 2AGOA 3D0GE 5CABA 3X3UA 3IRWP 1K0TA 1RYRA 5B0DA 4M5GA 3CMAS 2FHMA 4PQAA 4ZIVA 3D6FB 1C0TA 2ACYA 4M5LA 4C3MA 5D0EA 5HI7A 3IWNC 2LEBA 1H7WA 2FTRA 2FJWA 1Y5IB 4IFVB 1NSKL 3VGUA 2D74B 3G6VA 3C15B 4HI1A 2BJ1A 3MM7A 4I2QA 2V8PA 1YSJA 3DLJA 4WJBA 4ICLA 2BDPA 1U1RA 1YX2A 5HO4A 4RW9B 2DXDA 5F8GA 2VBYA 5K8NA 3C14B 4IFYB 4NLWA 4YR0A 1ZYQA 1IKWB 2IM1A 4Y2CA 2R7TA 3DGVA 1LKZA 4X64F 5DETA 4KSEB 4ZP6A 2XTJP 3KDNA 4OFZA 4MIBA 1VC5A 2KJVA 4X64J 2CQBA 3BSAA 3EX7B 2BE2A 4U96A 1Z4UA 2VL1A 4OX6A 1JLAA 1H73A 5EWFA 3IMQJ 4UUWA 2YKMB 3GE9A 2DRAA 2ZDOA 2VKZG 4Y2AA 2VD3A 4LF6F 2G0CA 1U2CA 1YJRA 1UKUA 2CVIA 3W8GA 1F2HA 4CLYA 3AD9C 3CE8A 3J81U 1WHVA 2GA7A 4LF6J 3NNCA 1FJ7A 1SB6A 1TKZB 4RUAA 2BJ9A 2IYIA 5HJYA 1NK6A 1CBKA 4O4GB 1SV5B 4ZVEA 1EX8A 3BPDA 5E2QA 1VQYA 3KK2A 3CXCR 2D3ZA 3KNGA 3FCVA 4EI2A 2YKNB 3DLLQ 2HHTA 2GAGC 3HCXA 4WTOB 4DX6A 5D3GA 3Q8SB 3TJ8A 3NCRA 4DOZA 2CYYA 3OL9A 5L1KA 4K4SA 2YBVA 3E3XA 5EDWA 1BE4A 1R8BA 2CQ2A 2DNNA 2V94A 5HMXA 1RKIA 1TZ0A 1HPZB 2ZJRQ 4ED5A 4ZLNA 5U47A 1WEXA 3FMWA 1RHUB 2QO3A 3R5JB 2GQCA 3M6UA 3TARA 1MMNA 3AQOA 1NSPA 3TVZA 5I42A 1KKHA 4CTAB 2FGCA 1MU2B 2QLBB 1KONA 1IQZA 1KVIA 2RHSB 1A7GE 2ZH2A 3QIPB 3CJ8A 4TN2A 2FVPA 3T6JA 4YB1P 4CCHA 1HNXF 1OY9A 2BABA 2Y8YA 4TLQA 1YZ7A 3HVAA 3OFHA 3NP5A 1NJIT 1C4AA 3R2DJ 4C3LA 4ED3A 3BPSP 4AXJA 4M5HA 4DV2F 3H2LA 4J37A 5C42A 1Q79A 1LFPA 5I3UA 2FJBB 2H3EB 3M8QB 1FNOA 2E1RA 4DV2J 1FKOA 1WSRA 2NYIA 4RWWA 3KJFB 2EC0A 1N34F 4RW8B 3SEOA 4ECYA 3MI7X 2OIHA 4L74A 4ILLA 2DK2A 4F7VA 1XTZA 2IVFB 1E6VB 4MT1A 2B6AB 1JJHA 2ZWOA 3KLGB 1N34J 4ZVTB 1M5KC 1YITS 3CDUA 3FFIB 4HTIA 4EMDA 5A8KA 4RO0A 2WW4A 1QJHA 5F8JA 3MM5A 1Q7LB 4M94A 2HGNA 3NCPA 1XMBA 2VUGA 4JV2A 4RX6A 2YX1A 4E98A 2RRAA 4F36A 1SIWB 2V4JA 2QYCA 4PG6A 3VTIA 1HI8A 4OX7A 4NL5A 2MSSA 1HBMB 2ZHAA 3FBEA 3RB0A 4S0MA 1WDDA 2VPYB 5DS7A 1U4BA 2QE5A 4ECSA 4P2SA 1MW7A 3KK3A 2DR5A 2WCXA 1Y3KA 5BR8F 4KAIA 2DHAA 1MNEA 2KU7A 1S76D 4DFMA 1D09B 2K7JA 2I0XA 3EUNA 2KZMA 2YKPA 2J9EA 4KTQA 1HLWA 5SUHA 3M8WA 1ZPVA 1JLBA 1RHQB 3HJFA 4K4YA 4X4SA 5K14B 4YFUA 4CLPA 2VONA 1FWPA 4B9LA 2XGPA 3QGGA 3QO9B 4DR2F 4CZCA 1U6ZA 2AF6A 4G1QA 4L75A 2VBXA 2HZAA 3GIKA 2DR6A 1L3VA 3C2PA 3OFEA 2J6SA 4DR2J 4LR8A 3MXHP 3J81j 2R7UA 1BC6A 3RR7A 2HK3A 2XMWA 3HXMA 1NAQA 3MEDA 1CS4A 2LXIA 2HS4A 2KRBA 4Q0BB 3KDOA 4ER8A 3BDEA 2OMOA 3QSYB 4DZ6A 5ETMA 5B0CA 4QR0A 1KLMA 3DOMA 2XM3A 2EFOA 3BJYA 3SV3A 2RMLA 2ZH9A 4DL2A 2WVBA 3ICLA 4AXIA 3JTOA 2VG7A 3G82B 1D3WA 1N32F 1YJVA 3I5BA 4YDDB 1RHRB 4F26A 4L3NA 2V8GA 3LAMA 3RAXA 2OP5A 2W7PA 4CP5A 1N32J 5CYQB 5F0WA 4DR3J 1OQ6A 2V2VA 3UO0A 2JEGA 4DLGA 3T3FA 3DU5A 5KFGA 2W9CB 1D0EA 4CO5A 5L1JA 3NKYA 5HJXA 1FO1A 5KOWA 3LH2S 2SXLA 1LWEA 3BYRA 3F56A 2V63A 2FIUA 4TU8A 4OJ1A 4DX8H 4FZVA 2ZH1A 3IAM9 2AGQA 4NASA 4OHXA 5K20B 1U45A 1GX6A 4QR1A 2XLJA 4PG5A 4C7QA 2HFUA 2WTFA 2RF2A 4RUHA 1GXUA 1RWOB 4V1Ak 1NLKL 3KXDA 2BBEA 2VFUA 2DGUA 3S8SA 4OHZA 5J1EB 3HKWA 2YNFB 1TR0A 3QLHA 3PHTA 4J9MA 2LXFA 3A13A 4AL7A 3I56S 1NK9A 1TVRA 3CJTA 2BMBA 4YMEA 4C97A 3PG9A 1CLFA 4E0DA 4C11B 2HNZA 1TL4A 2HQIA 3UR0A 3CWJA 2FVCA 4Y0FA 2E5HA 1AW0A 4WFZA 1RKJA 3I4PA 2L48A 3JQJA 3K58A 3HVTB 1AXQA 2MQLA 1S9EA 3NNHA 3HHLA 4K2XA 2RNEA 1A9NB 2XO6A 2AW0A 1HNWF 1BXNA 2FUG9 3GQCA 1ZH5A 1N0VC 2J0QD 3TANA 1Y4ZB 3GV8B 1EZZB 1A6LA 2KHCA 3V4IB 1N5TA 2FHJA 4DPYA 1LWCB 1FESA 3I5CA 2UXCF 3KJQB 1FERA 4JBCA 1CG2A 4PPDA 2QSFA 3IRXA 4ERDA 2HKEA 1DURA 2PE8A 3MR3A 1SKUB 4NLRA 1FWKA 4ZPDA 3SYZA 4LSNB 2UXCJ 5HVHA 1IBKF 2KN4A 3QWPA 4RUCA 1CQMA 4HHJA 3GR1A 5CCLA 4H4MA 1CJKB 1VDHA 3GTYX 4MK7A 4WKRA 2VOOA 1IBKJ 5D77A 2D69A 3H25A 1FJEB 1U2FA 2YQ3A 4XDDA 5KFNA 5CZVA 2VJUA 1RWMB 2CRLA 3EGNA 3SQGB 1WKLA 4IYQA 4ES2A 2COLA 1Q7YT 5KAKA 1QD1A 2PN6A 5M2PA 3BGOP 3POTB 2HW3A 1Q5YA 1NDPA 5DLFA 3W64A 1UW9A 3ENWA 4OZLA 4DL4A 3JYTB 2IA0A 3P6YC 1AUSL 3T5HA 4LF7F 1HHSA 4D3GA 2A0FB 4WF9Q 5M2RA 1TQLA 4ZPCA 1IM4A 1C1CB 1V9OA 5F3ZA 2DY1A 1S48A 3DOKA 1CJUA 4LF7J 5CCMA 1NPPA 1CULA 4OYBA 2KVIA 4J9KA 3C16B 2HQ3A 5D78A 4ES3A 1S49A 2ZOGA 2RQ4A 4IR1A 3HKZD 1OQ3A 1S1UA 4DL7A 2R7QA 1QUVA 2XZTB 1E6YA 2LEPA 1IM6A 4USTA 4IQXA 2FQQB 1F5BA 3SZ2A 4KH0B 3ZTPA 2LKZA 3IN5A 1PJ6A 4U7UD 3DYAB 4DR6F 3V5RA 3CJQA 3K2YA 2Y3YA 3AXKA 3DHXA 4CLKA 4JI8F 3GIRA 2GGPB 2D3UA 4WYLA 2OPRB 2IJFA 3BV8A 4EWTA 1FRIA 3GLJA 1S7HA 4JV5F 5AXNA 2H4YB 2YX7A 4B3MJ 2C2NA 2VQFF 4JI8J 4KY3A 1SC6A 4BC7A 2OI2A 3PACA 3MM8B 2XYGB 2DHXA 1NUEA 2VQFJ 4IFVA 1NHUA 1S9FA 2J8SA 3LGMA 4PABA 3MMAB 5DQHA 2VFRA 2V68A 5KG1A 1KR4A 3C15A 3EGZA 1RA7A 1YK9A 2QX0A 3GJTB 1YRXA 4EBCA 2FJAB 4QWDA 4RW9A 1EP4B 1IJFB 3D3BJ 1S1XB 3C14A 4DL3A 2DXEA 2L3MA 4IFYA 2W8LA 1KTQA 5GAGU 2FJEB 3A8IA 3W1YC 3RBEA 2BM0A 1W25A 3BB5A 4FVCA 3I96A 1RE1B 1IKWA 2HBQB 2XO7A 3KG1A 3B4DA 2XHCA 2H51B 4O3OA 2NPFA 2IRUA 1HWLA 1IQTA 3Q8YA 2E1MC 3Q8UA 2E7WA 4AD6A 3HD2A 3HHLD 2JLEA 3PO5A 1JXLA 3W3SA 3VCDA 4B9UA 4ZPWR 4PYDA 3M7VA 2YKMA 3P45B 5AE1A 1XMQF 1T95A 1X0FA 1F9EB 3QRQA 4X4UA 3Q83A 5DM6Q 2O01C 1LW2B 3Q8VA 1Q78A 4O23A 2HHSA 3HHNB 4PCQA 3CCLS 4JI5F 2C2EA 3OVAA 3MMBB 1O8BA 2VG6A 1TKZA 2MSTA 2EBGA 3KUEA 4ZJLA 3DRRB 2ZH6A 4O4GA 1SV5A 3CCQS 4A8MP 1S6QB 2P6TA 3UFCX 2VPZB 2KFZA 4FPRA 2YKNA 1LXJA 4UZCA 2XMAA 2A18A 1SH0A 4HH1A 2EFVA 2RU9A 1JLQB 1S0MA 2EFGA 4C8ZA 4LJMA 1EHWA 4GC6A 5HQLA 2KT3A 1TKDA 4Y28C 3NEKA 1RAOA 3CF5Q 3QT7A 2R4FA 2DIVA 4NPOA 2Z58B 1WTBA 1IBCB 1FKPB 5KFHA 3EYZA 4OI1A 4Z7CA 4DX5A 1EETB 1RWNB 1RTIB 5LT5A 2RB7A 1FD2A 1FDAA 5A8WB 1BGXT 4DQIA 2VODA 4NYPA 3CSKA 3M30B 2O5DA 2UXDF 1X4EA 3DFEA 5LXRA 2WONB 4CTAA 3SDEB 1N6QA 1MU2A 4CO3A 1Q5VA 3TX0A 1FEHA 2BE9B 3QIPA 3AFGA 3VQTA 1F3FA 1HD1A 4RW4B 2OSQA 1WC0A 5KFBA 2PA8D 4P7VA 5KT2A 1M1HA 4HVZA 4P10A 4DR4F 1JIHA 1NDCA 3PRVA 1KQKA 4WYWA 2GO9A 5A0YB 2BW7A 2ZJQQ 3W9IA 3W60A 1FF2A 3QNWB 1M5SA 3L7OA 3PX6A 2WB1D 4DR4J 2C3YA 1SQFA 2DJWA 1KN6A 1XR7A 3M8QA 3QAUA 2BM1A 4OIXA 4IO9Q 4C0HA 2FLPA 1X4FA 3Q89A 2ZUGA 4USKA 4RW8A 2WSEC 1WC3A 2K3KA 1U6BA 2K8GA 3AY0A 3JXOA 5IV3A 2MQ8A 1FRXA 1NXIA 4OI3A 3HM9A 1RK8A 1E6VA 1JLCB 2DB1A 3OUYB 2B6AA 2EI5A 5IC4B 1IVZA 3KLGA 4ECVA 3GG1A 3QZ7A 4DPOA 3FFIA 2X1AA 1CEZA 3KYLA 2MTLA 2DGTA 1KQGB 1FFSB 3N4WA 1Z2ZA 2RIJA 2RAQA 5KOXA 3VALA 2MKHA 3I55S 1CC8A 1Q8KA 2JFDA 4DUZF 4UY85 5EN1A 2OGUA 2B4VA 1XNRF 2C3MA 1XN9A 3NGUA 3DI6B 2E7VA 3LPEA 2ZBCA 1RAFB 4X4OA 3EVWA 1HBMA 4F0MA 4DUZJ 3KLVA 1F60B 2H65B 2RDIA 4I6WA 3KMQA 1NK7A 4ID8A 1O51A 2YNIB 2E7XA 4ZVRB 5E3CA 4LRAA 2IRYA 3MAAB 4FS2A 1DTTB 2R7WA 2VA3A 2XY7A 2MDAA 3HT3A 1HQ2A 5EWEA 2MGZA 3RRGA 4LSZB 1S1WB 5IQQA 5HK4A 2OD6A 2VA2A 2CQ4A 2HS3A 1W2IA 4GC7A 2OJ3A 1FVSA 3AH6A 1AA1B 2MKJA 5HN0A 4ZP8A 5K14A 1VGYA 5GADI 3NXZA 3FCWA 5KFDA 2WK4A 1YBTA 2BKOA 2V8VA 4DPXA 4KGVB 3QO9A 1MMLA 3BO3A 3UPFA 5FLXY 1DZ5A 4MJKA 1S59A 4K2JA 4IR9A 4P73A 4RUBA 3E2EA 2LQ8A 2VKRA 1LEOA 2M2BA 1VR6A 4XPCA 3H90A 5J1NA 3MD1A 2W2PP 4R5PB 4FF2A 5CAAA 3MCMA 4OZ2A 5GMEA 4Q0BA 5BJRA 5G4DA 3R6LB 1WF1A 3Q2SC 2RQCA 1Z2LA 2DO0A 3UCUP 3G82A 2QMUB 1NPRA 2DGSA 1WUUA 1YBAA 3ENQA 2Z2LA 2BACA 2CQGA 4OHYA 5CYQA 4DU8A 1YVFA 5IT9Y 4DQPA 3TZXA 4CO2A 4J5OA 2PDAA 1RT4B 4CLUA 2ZBQA 2W9CA 4JI0F 1S10A 4YHHF 1I3OB 3V4MA 3MAQA 4B3TJ 3BGUA 2OLWA 2YVSA 2XMKA 3A8EA 1YLXA 2F3JA 3V6HA 2AV5A 4JI0J 5KFLA 4YHHJ 1FJGF 3GYXB 2ZH8A 3JTNA 1X0PA 4LRFA 4C4WA 2WOMB 3ZNJ1 3KHGA 4MH8A 2Q6CA 4LBIA 3GONA 4CYUB 3OJSA 4I64A 1VC6A 4WFYA 1FJGJ 2H5IB 2IBOA 2JEIA 4G3IA 2E9RX 4PG4A 2LU1A 4FNIA 3CB4A 1S1VB 3CGIA 5J1EA 3HVRA 4IG3B 1XNQF 8ATCB 4R0JA 2YNFA 2DH8A 2DISA 4CH0S 4A4JA 1NDLA 5E7OB 3EZ5A 5F8NA 4J9PA 1EARA 2LLZA 3QGPA 4MK8A 1XNQJ 3F0NA 4ED7A 3ZZYA 4Q44A 3ELHA 4C11A 2YX4A 1HFEL 3K17A 3D68A 3KG4A 4DMZA 1R8PA 2VU5A 1NB2A 4GKKF 1FEEA 2B51A 3W5ZA 3HVTA 3AA8A 3V6DB 1TU0B 4NLTA 4RPFA 1SJ1A 2J0WA 3ZO7A 4L6V3 3GR0A 1HWKA 3LQVA 1OWXA 1HNZF 2GW8A 4ID5B 3AJ1A 1FXLA 3BS9A 3G9CA 4OX8A 3LP1A 1LV5A 1VQKS 2VBWA 1IUJA 3V4IA 2V9KA 3N6LA 2VB6A 1LWCA 2A1BA 1HNZJ 1GH8A 2XWYA 2CQCA 3TRGA 4DFJA 2QJ3A 2WAQD 3AB2B 3MR7A 3PKYA 2VG5B 1NZ8A 5KG2A 2R2SA 2C2MB 2UUAF 1J2VA 1R6YA 2U2FA 1WWHA 2HNYB 4ZP7A 1FRHA 4BDPA 2UUAJ 3DRSB 1QE1B 1NHKL 1YBUA 1CJKA 3DRXA 4BLGA 3RGIA 1I1GA 4ZVFA 3RYLA 3KJNB 3HX9A 3DU6A 4JI4F 2QLFB 3EZUA 1ZOTA 2CPYA 2GIQA 1QAJA 5KFSA 1V3ZA 3SQGA 2KZZA 2E5JA 4URSA 3POTA 1T3OA 2GHWA 1U0SA 2LYVA 1T11A 4FKXA 2CXEA 3S01A 1YWXA 1QSSA 4JI4J 3N5BA 3JYTA 3ISND 3CDWA 4JI3F 3VWSA 3Q0AA 4MYTA 1PJ7A 1NZAA 2MJUA 1C1CA 1XR5A 5BYQA 1VK3A 4JI3J 2J76E 3OQ2A 1D9DA 1X5PA 3PJXA 3AQPA 3CULA 1HQEB 3ZZRA 3R1LA 1HD0A 3E8OA 2YWGA 3C16A 2MJNA 4ELUA 3PJWA 3P5TL 5CXTA 4QOTA 3M9MB 1SKWA 2DHGA 5KFWA 4ZVSB 1MWQA 3DYAA 1JK9B 2IHR1 3OL6A 4A47A 1TKTB 2M52A 5K8MA 2YNHB 1UVLA 5I4MA 3OL8A 1RWVB 4LFBF 2J5AA 3SCJE 3W61A 3MEGB 5DGBA 5A76A 2GGPA 1N52B 4QIEA 2UUTA 2R8GA 2OPRA 4QW9A 2G0IA 2E9ZA 2KT2A 4PYAA 2WZ1A 2HRUA 4LFBJ 3J81Y 3LO3A 1S4EA 1M1KT 4W90B 2OTLS 2OELA 2X51A 1KEKA 3GFHA 4TU7A 3MM8A 2DXFA 1S5ZA 1Q95G 1RISA 4NYOA 4DV0F 2VDIA 4FXDA 4F0HA 3MMAA 1WG1A 1ICEB 7FD1A 3TAMB 4N56A 3RG6A 1DARA 3QJLA 3FZBA 2V8HA 8RUCA 4ZVPB 4BBYA 4RWXA 4DV0J 1TELA 1FTRA 3T5JA 3TWZA 1HR0F 3QJPA 1NJYA 5JVGQ 1D9AA 3ZZPA 3SSQA 4DSLA 1RHJB 3O5TB 3NCQA 1WNEA 3AJDA 1EP4A 1QY7A 5DZ7A 5IFMA 3CO0P 2DITA 2KKHA 1KVKA 1WHXA 1HR0J 1IKXB 2AEJA 3DLHA 2UZAA 2VC1A 1S1XA 1BUXA 1AUDA 1YHQS 2MZ1A 3K5LA 3D3CJ 1WOPA 1URNA 1RU1A 2GNKA 1KNZA 4CT9A 2QLXA 2RU3A 3OVSA 4F67A 3B54A 1NSQA 4TU9A 4UOCA 4I0WA 1APSA 3OXGA 4KFBB 3IFEA 4RZRA 2YPZA 4EGLA 2Q1LA 1WSVA 2AYGA 1F2GA 4C8LA 3KWMA 3PYDA 4WKYA 3QPIA 1B7YB 1PAUB 3JAMU 4KT0C 2R7OA 5HATA 3T1AA 1T8EA 1S57A 2VBZA 2P6SA 5DDPC 2DGWA 1LW2A 2HBRB 4AQYJ
chains in the Genus database with same CATH topology
2YWKA 1FKOA 2NYIA 2UV8A 4LQ3A 3CCWA 3FJ2A 4RWWA 3WC0A 1K73T 2HWTA 1JLAB 1VBYA 5LMNF 4ZS6A 2EC0A 3MMBA 4XPEA 1N34F 2I1RA 4RW8B 4ILRA 1L3KA 3SEOA 4DL6A 5LSOA 4ECYA 3MI7X 2HWIA 2LMIA 3DRRA 2OIHA 2EG2A 2UUBF 4I67A 1DQAA 2DK2A 5D4NA 4ILLA 2Q6BA 1XTZA 2HS0A 2IVFB 3MEEB 5KTQA 3I0RB 4JI7F 1E6VB 4O44B 4RBTA 1S6QA 2B6AB 1G1XA 3LALA 4ZK7M 1JJHA 3I4HX 5JXSA 1B0TA 3KLGB 3U1MA 1MWYA 3OTCA 4B3MF 1M5KC 1YITS 3CDUA 3QWUA 3FFIB 4HTIA 3BEGB 2KB2A 4DN0A 1KRPA 2BVZA 2M0GB 4I4BA 4V19X 2IVMA 3GYNA 3K57A 1FK9A 2VOPA 2HMIA 3MCSA 1YRTA 3F73A 3VAKA 1RQ0A 2D9OA 1X4DA 3OTEA 5A8KA 5FIIA 1JLQA 4LQ9A 1QJHA 5F8JA 3MM5A 5J2MB 3MTJA 1Q7LB 1S72S 1F9FA 2HGNA 2YWHA 4M63A 3GIJA 4M94A 1VOMA 3NCPA 1VHFA 2D41A 1XMBA 2HYIB 1LWFA 1G7CB 1MSWD 2VUGA 1DQ9A 3CCMS 4JV2A 3HZEA 2JWNA 4RX6A 1TFYA 5FDLA 1BWEA 2YX1A 1KVJA 4NRUA 1U48A 4F3OA 1YGYA 4E98A 3OLAA 3IXQA 2ZC3A 2RRAA 3M2UB 1SIWB 3C3LA 2V4JA 5A8RA 2QYCA 2XMVA 4WK1A 2AJ0A 4PG6A 2JEFA 2D7SA 2M8DB 1FKPA 5JJBA 1U24A 5E3RA 1BY9A 4HTJA 2MKSA 3K7RA 2R7SA 2ADCA 4NXMF 2U1AA 2EK6A 1HI0P 3U7JA 3VTIA 3V81B 1HI8A 1EETA 1V3RA 3LOUA 1RTIA 4FVMA 4OX7A 4YB7A 4LSLB 5IQ6A 2BJEA 4ED0A 4NL5A 4OZ0A 1Y7PA 1HYSA 3NL0A 2Q79A 2MSSA 1N88A 5A8WA 1HBMB 3MPYA 2ZHAA 3RB0A 2UVRA 1C1BA 2MKKA 2VPYB 3ZZTA 4KQZA 4HYKA 4J9LA 2E5GA 5DS7A 4C0BA 1U4BA 2QE5A 4ECSA 2BR0A 1VS3A 3HHDA 1KHVA 4P2SA 1SJFA 5KG7A 2KO1A 2CPDA 3M30A 3KLEB 4DV3F 1MW7A 3TP2A 3KK3A 3RAMA 2DR5A 3CJ5A 3UD3P 2N3OA 4KKOB 2WCXA 4BS2A 2VA3A 1Y3KA 5BR8F 1WHWA 1FRMA 2DHAA 2NLWA 1ROFA 2BANA 1MNEA 4KAIA 1RTJB 3UW1A 4DL5A 1PGZA 2DTJA 2FLNA 2KU7A 1S76D 2WONA 3FSXA 3W2WB 3L3CA 4DFMA 2K7JA 1ZAWA 2I0XA 3THTA 2C2DA 4B9TA 3SDEA 2IJNA 5KFQA 1LXNA 3EUNA 4ILMA 2KZMA 2B7BB 2CPEA 4O3PA 2HFOA 2YKPA 4OI4A 2J9EA 4NZ7A 2JX2A 5F8MA 4KTQA 1BQMA 4EBEA 3T19A 2KG1A 1FDNA 4DS4A 2WRMA 4FYDA 3PXGa 2L9NA 3MMCA 5SUHA 4PWDA 3M6WA 1UL3A 4RW4A 1ZPVA 4NWBA 2RSQA 1JLBA 3HJFA 4NRTA 3NS6A 2OTJS 2LQBA 1Y00A 2ZFHA 5I42B 2MHEA 2YH0A 4K4YA 2BOPA 2UVWA 1B7FA 4X4SA 5K14B 5IT0A 2FY1A 3KJVA 3LGNA 4YFUA 1T02A 2VONA 1UMJA 5A0YA 1N56A 1PC5A 1YJNS 5CA5A 3PKMA 4KGMA 3MAHA 3BDPA 2ZDPA 3N6MA 4YR3A 2VFVA 4DF4A 4B9LA 1SJ3P 3C46A 1NU4A 2DCUB 4QCLA 4F2RA 2B4UA 4ED8A 5KFUA 3QGGA 4NLYA 2XGPA 4MKYA 3DRPB 1U1NA 3QO9B 2PI4A 4RBVA 1FTCA 4DR2F 5DJBA 4CZCA 1U49A 1U6ZA 1JJ2R 2WSCC 4WK3A 4A8QA 2AF6A 1TKXB 2YNGA 4G1QA 3C66A 1VQNS 2LDYA 2VBXA 4YEAA 1U1PA 4DWIA 3GIKA 2XS5A 1MMDA 2DNHA 3SI8A 3RB6A 5DGAA 1KQFB 1L3VA 3C6TA 4IG0A 3C2PA 2OPSB 1RT3B 3OFEA 4KIAA 1QSYA 2ZE2B 5DDQC 3Q8PB 4WFAQ 3CUNA 1C0UA 5EUHA 2J6SA 1HNIA 5K8PA 4NOHA 2KHDA 3MXHP 2R7UA 1BC6A 5KFVA 3MOJB 3CD6S 4NXNF 3RR7A 2OPPA 2XMWA 3AHPA 2DNPA 2NSCA 1NAQA 5T41A 3HXMA 3MEDA 2IA6A 2LXIA 4MYUA 1VRUB 2C3UA 2CFXA 3M2RB 4FN5A 4C8MA 1JLCA 1X4GA 2HS4A 5KFKA 2FGOA 3OUYA 2KRBA 3MR6A 5GAGI 3K59A 1Q8IA 1KQSR 4Q0BB 2CPXA 3BDEA 3FRZA 4F02A 2OMOA 3NBPA 2VQEF 1TAQA 4AL5A 3PW2A 5B0CA 2XZWA 4K4VA 4QR0A 1KLMA 3DOMA 3BJYA 2EFOA 3SV3A 2RMLA 2HVHA 2B3TB 2ZH9A 4PXCA 1HBUB 4F4XA 4DL2A 3GFXA 3ICLA 4KC5A 3SCKE 4Y00A 4AXIA 3JTOA 2VG7A 1XBWA 4Y3CA 1D3WA 5KFIA 1N32F 3HP6A 1DAXA 2A2CA 4PXBA 1YJVA 4LSNA 3I5BA 4YDDB 3M8RA 4A8OA 4F26A 4L3NA 1O0PA 2P5VA 2V8GA 4GMKA 3M1VA 3LAMA 2J7KA 3UE2A 1SI9A 1S9GB 2KRRA 3RAXA 4M1KA 3JSBA 3R5DA 2OP5A 2W7PA 1RJJA 2LVWA 2QA2A 4X4RA 2CPHA 3PW4A 4YP3A 1X9MA 5H1SV 4OL8A 1WF2A 3V6KA 5CYQB 5IXUA 5F0WA 2Z0GA 1I94F 2M88A 3M6XA 3OSPA 1OQ6A 4DLEA 4PXDA 1TV6A 3VAHA 2ZH7A 2JEGA 1S0OA 3H2UB 2VPXB 3LP0B 3L09A 3DI6A 2IFXA 5LXYA 1HMVB 5KFMA 1RTDB 4IO1A 1FHTA 4AFFA 4DLGA 3T3FA 1HNVB 3DU5A 5KFGA 2W9CB 1LQ9A 2GIRA 2I5JA 4CO5A 4TQSA 5L1JA 1D0EA 5KG3A 1HBNB 5KFZA 1BQNA 3BSCA 3CDBA 3NKYA 1LK7A 1FO1A 5KOWA 3LH2S 1FKAF 2SXLA 1VBXA 2DNRA 1LWEA 4M5DA 4QBUA 3F56A 3KOAA 1NJWA 4KBIA 3RW7A 2YNIA 4X66F 4ETZA 3T9NA 4F2SA 1DHMA 2OH2A 2FIUA 3M9NB 2XULA 2BYCA 4TU8A 4OJ1A 3UR3C 4DX8H 1HARA 4BHQA 4YUDA 1DTTA 4FZVA 5MLCV 1O5JA 2P9GA 5D4PA 2XI3A 1BQXA 3IAM9 1JKHA 2ZH1A 5HROA 4PQUA 3JSRA 4FF3A 3D1OA 4C8NA 2AGQA 2XLIA 1Z1ZA 4OHVA 4OHXA 4A8KA 1YIJS 1U45A 1GX6A 4QR1A 2RRNA 2XLJA 3ZZZA 1S1WA 5CYMB 4PG5A 2I8EA 4HLBA 3NS5A 2M70A 4C7QA 1J5OB 3AAWB 2WSFC 2WTFA 1T03A 2ZKTA 4QU6A 1R43A 2IM0A 2RF2A 4I6YA 3NMRA 2FJXA 4K4XA 1TL5A 2CZ4A 2J9CA 4RUHA 3M32B 4NCGB 1GXUA 4OMFG 1NO8A 4TKTA 5E41A 4MIWA 5F8LA 2HHHF 3DXSX 4CI0B 5J2QB 2H5EA 4ZP9A 2BBEA 2PEHA 2VFUA 2DGUA 3S8SA 2RILA 4OHZA 3AB4B 3Q2TC 1V6HA 2XMJA 5J1EB 3FGVA 4DFKA 2O67A 5HLFB 3HKWA 2DGXA 3CMES 1SH3A 4ZHRB 4U9RA 2YNFB 2LDIA 3OTOF 2G4BA 3DLEA 6FDRA 4DSIA 2I38A 3VAGA 2UV8G 4LIRA 1TR0A 3C6UB 1GNKA 2PMHA 5AXKA 3M2VA 1N5SA 3CCJS 3QLHA 4JI1F 2XSJA 4J9MA 1SXLA 4LT6A 3HDSA 2LXFA 3Q24A 4AL7A 3I56S 1NK9A 2R7XA 4LF8F 1TVRA 4U6PA 5LJ3Y 3LAKA 2ZM6F 2I2YA 4LFCF 5L38A 1P6TA 1F5CA