2LXUA

Solution nmr structure of the eukaryotic rna recognition motif, rrm1, from the heterogeneous nuclear ribonucleoprotein h from homo sapiens, northeast structural genomics consortium (nesg) target hr8614a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
SHMGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein H
publication title Solution NMR Structure of the eukaryotic RNA recognition motif, RRM1, from the heterogeneous nuclear ribonucleoprotein H from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8614A
rcsb
source organism Homo sapiens
total genus 22
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lxuA01
2MMYA 3BO2A 2MQNA 2RNEA 1FT8A 3RW7A 2A3JA 3CUNA 1WG5A 2M2BA 2KYXA 1WI8A 1Q81T 3UWTA 4RU2A 1X5SA 1SXLA 3VAMA 2DIVA 2MZRA 1FNXH 2FC9A 4LIRA 2DO0A 1OO0B 2JRSA 2X1BA 2CPYA 3G8SA 1FJEB 3THTA 1WHXA 2LYVA 2RS2A 1VQNS 1U6BA 4YOEA 2MZTA 1X4BA 3R1HA 1VQOS 2QA4S 2KFYA 2MSSA 3BS9A 3UCZP 3G96A 1JMTA 2HVZA 4EGLA 2OJ3A 5EN1A 2YKAA 2KU7A 1KQSR 3BO4A 3I56S 3RW6A 1WF0A 2XS7A 1YWXA 2RS8A 4M5DB 2LKZA 5CXTA 2JX2A 1N8RT 1OIAA 2CQBA 2L9WA 2RQCA 2X1FA 1ZH5A 3NS5A 3CMES 1HD0A 3K0JA 3ULHA 1VQMS 2DB1A 3MD3A 2MKCA 2U1AA 4F02A 2YTCA 5GADU 3J7ZT 3NNHA 2DH9A 3VF0B 3IWNC 1DZ5A 2KXNB 3MOJB 2RVJA 2LEBA 2CQ2A 3EGNA 2YWKA 1WHVA 1WEXA 5BJRA 1WEYA 5CA5A 2DGOA 2XNRA 3CCUS 2MKSA 3NNCA 2FHOB 4CH1A 1JJ2R 1UW4A 4QU7A 3P6YC 1DHMA 3OW2R 2CPDA 4TU9A 2MY7A 1YHQS 3UE2A 1X0FA 4TU8A 4W92B 2LXUA 2MQPA 3L3CA 2DNLA 2KT5A 4YB1P 3Q2TC 3SMZA 1UFWA 1WG4A 3S7RA 5MLCV 2DIUA 1U1OA 2KHCA 3FEXB 2E5HA 1XN9A 4OZ0A 2DNKA 5DM7Q 2LCWA 2DISA 2BOPA 2NLWA 2PEHA 2KI2A 2DGTA 1WHWA 3HI9A 2HYIB 2LQ5A 3MURP 1VQ7S 2MZQA 1QVGR 2HGMA 2N82B 2ADBA 3G4SS 2KXHA 4IOAQ 1FO1A 1M1KT 3G9CA 2DNZA 1D8ZA 5HO4A 2QFJA 4UY8T 4WKRA 3CC7S 1ZZNA 2MPUA 3VAFA 2LA6A 3UCUP 1NO8A 4C0OC 2XB2D 2F3JA 2KRRA 2L08A 2ADCA 1U1QA 4FXVA 2CQCA 1M5KC 3P49B 2F9JA 5LSOA 3CC2S 3MDFA 2G4BA 2LXIA 1NU4A 4ZKAA 5LXYA 1OPIA 2E5IA 1WI6A 2DHSA 2KXFA 3NS6A 2DNGA 3DLLQ 3EGZA 4IOCQ 2CPJA 2M70A 2MQLA 2MJUA 1VQ5S 1X4DA 1U1NA 1X4FA 3ZZYA 3ZZZA 2I38A 3CC4S 1P1TA 2DNHA 4U67Q 4LJMA 4OZ1A 4BS2A 2VOOA 2OSQA 3H2VE 4Y0FA 5DDOC 1N88A 3CF5Q 3EX7B 4ERDA 1JJ4A 4WCEQ 3MUTP 3UD3P 1WTBA 1YJ9S 1DRZA 1K9MT 3TP2A 1WF1A 1YI2S 2X1AA 4ED5A 1X5OA 2FC8A 3CMAS 2F9DA 2BZ2A 1WF2A 5GVQA 2HGLA 4PKDB 2DHXA 1W2BR 3CCJS 4PR6A 4WFNQ 1RK8A 2MKKA 2PE8A 2M9KA 3S8SA 1FHTA 3D2WA 4Y00A 2GHPA 3G6ES 3CXCR 5D77A 2D9OA 4TU7A 1M5PC 3I55S 3N9UC 3VAIA 2OIHA 2DGUA 1OWXA 1A9NB 2M0GB 1KC8T 1B7FA 1R8PA 2DGSA 3VALA 3US5A 4C7QA 1Q82T 1P27B 3CD6S 4J5OA 2CPHA 2KH9A 2VONA 2OTLS 1VQ9S 1K73T 1X4AA 2DGWA 3CCQS 2JWNA 3SXLA 2DK2A 2V94A 3VAHA 1FJCA 1X4EA 2MQQA 1UP1A 3HHNB 2DHAA 2CPEA 5GAHU 2LA4A 2B0GA 3MI7X 1U1LA 3B4MA 3PIOQ 3MD1A 1ZZFA 4IUFA 2KRBA 1YJWS 5ITHA 2MHNA 1SJRA 1VQPS 1WHYA 1U1PA 3LQVA 2CQGA 1VBXA 2ZJQQ 2WBRA 4F26A 4YUDA 2D3OR 1A7GE 2DGQA 2CPXA 3CPWR 1X5TA 2JVOA 3R27A 1HD1A 2M4MA 1VQKS 1H2UX 1U1MA 3JB9k 2RT3A 5IQQA 1G2EA 1X4CA 1H2TZ 2MQOA 1M5VC 2YH1A 2KN4A 1YITS 1Q7YT 2DGXA 5H1SV 2RRBA 1H2VZ 1VQ4S 2SXLA 5IM0A 2CPFA 1KD1T 1YTYA 1RKJA 1NJIT 2DNQA 3UCGA 2MJNA 2FY1A 2CQHA 1AUDA 2KG1A 2CQ0A 2KVIA 1PO6A 2EK6A 3CTRA 5JVGQ 3MUVP 3CCVS 2DNRA 1N54B 2XSFA 1SJ3P 4A8XA 2DH8A 2M8DB 1U1RA 2EVZA 3VAGA 4WFBQ 1VC0A 1H6KX 2RQ4A 1WEZA 3IRWP 2HGNA 1HA1A 4QQBA 2KM8B 3SDEA 1VC5A 4Z2XA 2RU3A 2AYGA 2M7SA 1U6FA 1WELA 2J0QD 3V4MA 1VQ8S 2YH0A 3U1LA 3BEGB 1Q86T 2MGZA 1U1KA 5FJ4A 1U2FA 1D9AA 1IQTA 3CULA 2LEAA 2ZJRQ 3CCES 3MUMP 4QPTA 4QU6A 2VODA 1F9FA 2OSRA 3G71S 2CQ3A 3R1LA 1SJFA 1CVJA 4UQTA 1URNA 3S01A 2N3OA 1FJ7A 2E5JA 1X4HA 5DDRC 2I2YA 3S6EA 5LJ5Y 3H2UB 4FXWA 3P5TL 2MZSA 5LXRA 3NNAA 3TO8A 2NZ4A 2AD9A 5GAEU 4CIOA 1M5OC 2DO4A 2CQIA 2DITA 3PIPQ 2E44A 1QM9A 2LMIA 1K8AT 2CPZA 1VQLS 2MQMA 5JVHQ 1VBYA 3J7YU 1N52B 5DM6Q 4LMZA 2XNQA 4TLQA 3CCMS 1WG1A 5DDPC 2DNNA 2AYEA 2JVRA 2CQPA 2O3DA 2ERRA 2UP1A 4WF9Q 5GAGU 5HL7Q 3NMRA 2DNOA 2DNYA 2VOPA 2MXYA 2G1DA 5IM0B 1FXLA 3U1MA 2MZ1A 3TYTA 4F25A 2K3KA 1HL6A 2N3LA 2FPHX 2RRAA 2AYBA 1KOOA 5IFMA 2CQDA 2RUGA 4V19X 3CCRS 2XS2A 2DGVA 4WIIA 2N7CA 2DNPA 4CQ1A 1M90T 2DHGA 2MKIA 2M8HA 2K8GA 2MZJA 1SJQA 1YIJS 1R8HA 2AYMA 3Q2SC 5LJ3Y 3CCSS 1S72S 1VBZA 3SDEB 1JJHA 1X5PA 3P3DA 3G8TA 3BO3A 1YJNS 5LSLA 1S79A 2EK1A 3MXHP 2GO9A 2CQ4A 2E5GA 1DBDA 2G0CA 2J76E 2ZJPQ 4PRFA 2MKHA 2QEXS 2MGZB 2DNMA 1SJ4P 1VC6A 2OTJS 2MKJA 4C4WA 1BY9A 2KG0A 1KOHA 1VQ6S 2J8AA 1X4GA 1QVFR 3FEYB 2X1GA 1UAWA 5CYJA 3VAKA 2LECA 2MB0B 2Q79A 2XS5A 4P6QA 3DXBA 1L3KA 1O0PA 2M88A 5D78A 2MSTA 2U2FA 1PGZA 3CCLS 3THPA 4IO9Q 4WFAQ 2M52A 3UD4P 5GMKa 2MY8A 2DH7A 2CPIA 2J0SD 2MYFA 2L41A 5DDQC 4CH0S 2CQ1A 3LPYA 2HZCA 3VAJA 2CJKA 4W90B 1WWHA 2KM8C 2D9PA 5DETA 3B4DA
chains in the Genus database with same CATH superfamily
4DV4J 4QWCA 1AFIA 1R27B 2JEJA 1JXEA 3CDEA 1DFDA 1P1LA 3M2RA 1SV5A 4I6YA 3C6TA 4DPOA 4X66J 2R7OA 1LQ9A 1S5ZA 1NK0A 1U6BA 1RLCL 4ECTA 3Q23A 1FJGJ 3I4HX 3M8SA 3KOAA 1OSDA 3NKYA 2LU2A 3JAMY 3FC9A 5CXTA 2HLTA 2WVCA 3FMWA 3V6DA 3CJ4A 3CCTA 1IBMF 3J7ZT 2LEPA 3R7SB 3MOJB 1AUSL 3IR7B 2MTLA 4LF2A 5BYQA 3UI3A 4K0KJ 3BQ2A 2MKSA 2CWKA 1S6OA 2QC3A 3MR3A 1N0UA 4M5GA 3L3CA 1PKUA 2KT5A 3Q2TC 2ZZMA 1FRHA 2ZZNA 2XI3A 3GJSB 2DCLA 5F8HA 3BQ1A 1KNZA 5DM7Q 1XIQA 3SCJE 4CLZA 4LSNB 2AZ1A 2RAQA 4ECYA 3KLFB 2B9YA 2HGMA 1MWYA 2R8JA 3OL9A 4YHHF 2I8EA 4F4AA 3PHTA 5KOXA 2BANA 3BSCA 3MGJA 5ETNA 4WTOB 1KFDA 2B8QA 1IBKF 2BYCA 2BKPA 3EGZA 1Y00A 4AE5A 2HHWA 1VQSA 2KJWA 1X4FA 3O8WA 4MJKA 1N0VC 2RF2B 2E9TA 4ERDA 3WX8A 3BGLA 1Z2ZA 5DGAA 3ISNC 3UN5A 2X1AA 4ED5A 2GQ2A 2ALYB 2VPXB 4TKTA 4DR4J 2GVDB 2IMOA 1VISA 2MKKA 3CD7A 2R9LA 3S8SA 1R3NA 4F0MA 4ED7A 5EDWA 1LW2A 3CJ0A 5F41A 2DY1A 3TAMA 2DGUA 4R5PB 1XK8A 1J5OA 4NZ6A 2JHEA 4JYAF 2H5IB 4ZCIA 3CCQS 2Z2ZA 2V2QA 1X4EA 3A8IA 4LF7J 2B5JA 3QGHA 3DGVA 3FSXA 4NRUA 3UD5A 3DXSX 2C2ZB 4J91A 1VQPS 1U1PA 4IYQA 5H9FJ 5KFJA 5SZTA 4F0HA 1XMOJ 1X9MA 4X4TA 3OL6A 4HT7A 1DJ0A 1WC0A 2EC0A 4PG6A 1G2EA 1RAJA 3FCVA 1N5YB 3HLUA 4KHMA 2F4FA 3GIIA 2GMHA 1NH8A 2AJ2A 2PN6A 3VAGA 5ETRA 2JFKA 5CH7B 2HGNA 5IWAF 2HAIA 4Z7CA 2QL7B 3V4MA 4G1IA 3B82A 1BQNB 1FI4A 5A8KA 3FSYA 1HPZB 2JNJA 1HARA 4RUCA 3QJPA 2V6AA 1MN9A 1HWJA 4C8NA 3QJJA 2RILA 1EX8A 3NCQA 3Q24A 1TL1B 4WK1A 3MCMA 4KKOB 3TA0A 2BDPA 2AW0A 2NPFA 1WTFA 4ETZA 4RW9B 1BQMA 4DL6A 1LW0B 4CT8A 2XGQA 4ID5A 3KUGA 1PIEA 3U1MA 3Q8QB 4X62F 2AYBA 1DQ8A 3HVTB 4DV5J 3BREA 3CJTA 3IS9A 2R7RA 2MKIA 2V68A 3KHGA 2VQEJ 2QJ3A 3EZOA 4OJ1A 4J9LA 3Q8RB 1DBDA 3A3NB 5D0EA 3Q83A 1VQ6S 2X1GA 2EKYA 1IKVA 4NYPA 3H7HB 3GTYX 3GU0A 4I2PB 4LFCJ 3C15A 2ZHAA 4O44B 2VG6B 4CNYA 1IKWB 2OGUA 4RW8A 4OYWA 3KNGA 3HHLD 4MFBB 3H40A 3EVMA 1JLEA 5KFGA 3M8PA 2HFNA 2Y1RI 1YJ7A 4K2XA 2M2BA 2A1BA 3M8WA 4B9SA 1FRMA 1HBMB 3OPKA 1D0EA 5EHHA 2DT9A 3IG1B 3OHBA 3W5YA 1XEZA 2GHVC 4DR2J 1RKIA 4EFAC 2HNDB 1KQSR 1ZETA 1MROA 1ZAVA 4X4NA 4UQGA 1QUPA 2VDIA 1ZTTA 2HIQA 1ZA2B 1AT1B 3BPDA 4ZITA 4C3LA 1LWEB 5IOLA 3Q8UA 4B02A 1LWFB 2YKQA 4NASA 1WEXA 1WEYA 3W66A 4ED6A 3MAHA 4ECXA 4TYAA 1NK9A 1Y5NB 3PKYA 1S9FA 3IA0A 2W4PA 3DKDA 1KHWA 1NSAA 1E6YA 2ZH2A 4I7FA 2PEHA 2DGTA 3CJ3A 2WTFA 2LQ5A 4C8MA 4ALZA 3TOQA 5IT0A 4DN9A 2WVDA 5L46A 5I3UB 2G13A 4ZPDA 1U47A 1MNEA 5KFWA 1Y4ZB 3KK2B 5F0WA 1T9TA 1CULB 5LXYA 4EEYA 2QN6B 4DR3F 4DV3F 2W8KA 3MCSA 4IOCQ 1NZ8A 3A3OB 1MG7A 1Y3JA 5DS7A 4AL7A 5KFVA 4DFPA 3FCHA 5DLGA 3Q89A 2V4JB 2IC3A 2E29A 2EXUA 4F4WA 1X5OA 2ZOGA 1CJVB 3MR7A 4JV5F 4C3MA 4KHRA 2YNHB 4ED3A 3C46A 3D2WA 4M5HA 5D77A 2P9EA 4KH0B 3VR1A 2GIQA 3L9ZA 4ED0A 5HROA 2YNIA 1VQ9S 3OLAA 3KUEA 3R5CA 3WZ0A 2C42A 1FRKA 3CB4A 3K5OA 3TZZA 2CG8A 4JB8B 2C2EA 1YBTA 3GJTB 1U2CA 2HLUA 2A0FB 3T1YF 4J9NA 1YJWS 2XM3A 2ZUGA 4OI2A 1OSCA 1OY8A 3GQCA 2UVUA 3G87A 3OSNA 2I9SA 3FDSA 4DLEA 2DHHA 2IIHA 2O5DA 1GXLA 1YITS 3TNVA 1EJ7L 4NCBA 5KFDA 2XZDB 5B0EA 2P9GA 2HMIA 4DL5A 3CTRA 1S0NA 3H4DA 1RUSA 1N33J 1GEHA 3JYTA 2ZD1A 2OPRB 2M8DB 1U1RA 2HQ3A 2C3OA 4ZLPA 3SDEA 1B0PA 1KVIA 4Z2XA 1U02A 2AYGA 4JV2A 5HVGA 3EPGA 2RHQB 1UA0A 4DL4A 2JOQA 3U1LA 1Q86T 1V3SA 3BM7A 2CYYA 2HFVA 3CULA 2MDAA 1RHRB 2ZJRQ 3HSJA 2N3OA 1FJ7A 2E5JA 1S6QB 2ZHOA 3HX9A 4TNOA 3JS9A 2WB1D 4NXMJ 2MZSA 4OV1A 4QW9A 3GWCA 2NZ4A 5A76A 2NXCA 2DRAA 4H4OB 5E41A 2ZM6F 3EXCX 1N5SA 1NAQA 2HQDA 1QUVA 2W9CB 5AJ3F 3OTDA 1VGYA 4M5NA 1S1XB 4OYAA 1SH2A 2AJ0A 3D6TB 1BGXT 3GV7B 1C0TB 2J9DA 3BJYA 4G6VB 3U27A 2WW4A 4NLQA 5M2UA 4R0EA 2XHCA 3G82A 5HK4A 2XCAA 1RTIB 2IAJB 2M8HA 4HH1A 3T19A 5LJ3Y 5LSLA 1S79A 2QFIA 1TK5A 2G0CA 2E5GA 1S9EA 5E0OA 2CAJA 4U8VA 4YDXA 4P2FA 3N4WA 2MKJA 3OR2B 2EBGA 4JI1F 2R7XA 4OHXA 1X4GA 1YQHA 4CP5A 1KHVA 3D3BJ 1FKOB 3I87A 2CVIA 2PFFB 1RWMB 4DV0F 1HWUA 3J81j 2DH7A 2F1FA 4IFVA 1T7PA 4WP9A 3ZZUA 2E7WA 3I82A 3FQLA 2CNLB 2N7YA 2MQNA 3M1VB 3AQPA 5CQGA 5KTQA 2WK4A 2Y3YA 4TLRA 4ZJLA 4R0JA 1IXKA 2BOAA 1X31C 3TJ9A 1R43A 4YY3F 2HVZA 4IR9A 1TV6B 1HR0F 3DOLA 3T6BA 4JI0F 2BRLA 1IR1A 1JKHB 3KK3B 3FCWA 5KFZA 5I42B 1ZM4A 5ETLA 3MECA 3EPIA 3MD3A 4LF6J 4MKVA 3LA0A 4DBQA 3GILA 4J9MA 1Y5IB 2XMAA 1RHJB 2ZH8A 4ILLA 5D4PA 1C1BB 5KG5A 7AT1B 1VBKA 3K8VA 1WD6A 1TR0A 2Y9HA 4ZA1A 4QW8A 4KV8A 3OLBA 1ZA1B 3MEDA 1BD6A 4I56A 2ADBA 3ILLA 1JLBB 4UY85 4OV6A 4X66F 1LEOA 2DNZA 1ZTWA 3LWLA 2F3JA 1M5KC 3PW4A 1FJGF 2I0XA 4FF4A 2B7CB 1UJ5A 1OQ3A 2VBXA 4ZVGA 1WOSA 3ZZZA 4OZ1A 1MWQA 3VVTA 2GMLA 2P2CB 2XWXA 4ECQA 4WJBA 3C16B 3EVOA 2KYZA 4B9VA 3HD1A 4K0KF 1ZM2A 3R2DJ 1ZM3A 1HNZJ 3A1YG 1S7IA 4I68A 4I6WA 1AZSA 4PKDB 5IT9U 3D6HB 2OEKA 2AMCB 2PE8A 1HNWJ 1S1WA 3KG1A 3QBCA 4NLSA 2IM0A 3SZ2A 3E01A 5KOWA 1IBCB 4RKUC 3DOKA 1AFJA 5IZHA 1Q82T 4QR1A 4RU9A 1G6BA 4FZVA 4Y28C 4OJHA 4RUAA 2C22A 4RO0A 4CO1A 3M6XA 4BLGA 2NR0A 2C2NA 4IUFA 2A10A 5ITHA 4AUKA 1JLGB 3IMQJ 3WIUA 1GNKA 2ZDPA 4R8UB 2XZTB 2UUAF 1X5TA 2ILZA 3PXGa 1HD1A 5C25A 3H42A 3MM9A 4Q43A 2EFQA 2UUBJ 2MQOA 3QRQA 2WB4A 4MKBA 1VQ4S 2F5GA 5KFCA 2KDOA 1YK9A 5FDLA 1OY6A 2WVEA 3BGRB 1SCJB 3UVJA 4MTPA 1S59A 3JTPA 2R2RA 2XSFA 3NLCA 3OL7A 4L6V3 4DR4F 2D41A 3NL0A 1ZBTA 1VC5A 3DLBA 1IUJA 1X8DA 3FVYA 4J9QA 1U2FA 3A12A 2LEAA 4YMEA 1BWEA 2N4DA 3PW5A 4NEYA 2BJ3A 2VBWA 3FBBA 1RWOB 4DF4A 5BXIA 2MLZA 2QYGA 3VWSA 3K58A 4ZVPB 4K50A 5GAGI 3Q22A 3TEGA 2CQIA 1FKPA 3CE8A 4X65J 3IP0A 4DSFA 2ROPA 2Q6CA 2XCPA 2XNQA 5F8MA 5HVHA 1TU0B 1KQFB 3D1QA 3IWLA 2XHWA 3KKFA 2OEMA 1I94F 3AAWB 4O4GB 3MEGA 2OKQA 2RUGA 4KHPF 4DUYF 4JOUA 4JI3F 4WIIA 2N7CA 3BKFA 1WOOA 3O3LA 2KVQE 3KYLA 3JTNA 2IM2A 4DPTA 2GVZB 3OT9A 4K4XA 1GMWD 5DQHA 1JLFA 3TX8A 3NAIA 3SIPB 2F8HA 2DR8A 2E9RX 1RWUA 1U6ZA 5F9NA 2J8AA 4N7TA 3NGTA 5KFOA 1AA1B 5A0YB 5CYJA 5KFUA 5CHCB 3TVKA 4RW7A 1PGZA 4OI3A 4ETXA 3AJDA 4PABA 3QWPA 3E2EA 1NHKL 4PQUA 5A8WB 3ZZPA 4TY9A 2AGOA 2CXEA 1F9HA 3FZ2A 4LFBF 2B9WA 3MPDA 1TKZB 1NCLA 2XMWA 2FJAB 1JK9B 4NA3A 3M30A 4XO0A 2AGQA 3R1HA 2ZBPA 1TAUA 2BMBA 4DR6J 4DV5F 4U7CA 4PEOA 1CS4A 1RWNB 5EWFA 3SYZA 1U09A 4DS4A 2ZBIA 1EETB 1OY9A 1TK8A 1V5VA 1NK8A 4UOCA 2OPQA 3HDSA 3RYLA 3T6JA 5F8LA 2ZVIA 1S1TA 5D4LA 2B8PA 1SVDA 3LF0A 2MY7A 4ANCA 1Y7PA 1X0FA 1S6PB 1FTRA 3M6VA 4K7QA 1NLKL 1UFWA 1RWKB 1A6LA 3KJVB 3NXZA 1AROP 1T9XA 4YFUA 3PNIA 4WZMA 3CJ5A 3C2PA 3C14B 3AXKA 3DI6A 4ATNA 1O6XA 4C0HA 2KXHA 4RW4B 2CNKB 4WKRA 1B4SA 3IXQA 2CDRB 3UCUP 5E7OB 2CQCA 2J7KA 4IO1A 1LXJA 5M2PA 4ECRA 1OPIA 1IVZA 2UV8G 2FHKA 2ACYA 4ZCLA 4LF5J 3Q86A 4IRCA 3QGIA 1U1NA 4OZ2A 1IQZA 3IBFB 4BS2A 4O3NA 2V8GA 2EFVA 2XY5A 4Y0FA 4OZ3A 2FVQA 2ATCB 1WTBA 2EI5A 4ICLB 2UZAA 4RL1A 4KGVB 2IYGA 4CCHA 5DO2A 3PM9A 1ZAWA 4LF8F 2VPZB 5B08A 4OLOA 2Z2MA 2B4OA 2DGSA 2J7UA 3DLEA 2BJDA 3GE9A 1CBKA 3EVWA 3M6UA 1X4AA 3K17A 1MSWD 4AYBD 3QRRA 3NS7B 3MI7X 1Q4RA 3GIJA 4MH8A 1T03B 3LAKA 3M32B 3R5BA 2RB7A 2DR9A 2CQGA 1MU2B 2ROEA 1S9GB 3W2VA 2DVIA 2CFXA 1F6TA 1NJYA 4ZN1A 4PXBA 1TTHB 3NWGA 1XNRJ 1SIZA 2WSFC 2HAFA 4OZJA 1T9YA 2CPFA 2CQHA 5DQIA 2W4CA 1AUDA 5B0FA 5LM7E 2CQ0A 3PCOB 2EPIA 3OTCA 1CC8A 2FB0A 2LDYA 2DNRA 2Y8WA 4DV7F 1CPZA 4DCOB 1RGVA 4WFBQ 3DRYA 4X4OA 4ZN3A 1WORA 1ZS6A 4HTJA 2OUGA 1RABB 2FLPA 4JI4J 4QJVA 4CZCA 4WXWA 3QRPA 4F0KA 2PI4A 3QT7A 1LV5A 4K5RA 2XO7A 3MM7B 3BGOP 3PRDA 2OO4A 2EC2A 1SL0A 2GMJA 5DDRC 2AV5A 2ASLA 5D15A 4NXNJ 5LJ5Y 3H2UB 3JSMB 3H25A 1S4FA 2AEFA 3BYRA 2HIYA 3PIPQ 4ID8A 5K14A 1RT3A 1JX4A 5FLXU 5EX0A 1WG1A 5KG1A 2R7WA 3KNAA 2CQPA 2O3DA 4JV0A 2UV8A 2ERRA 3KDNA 4K4SA 3NMRA 1HFEL 2DNYA 2JLFA 3ONQA 2EBEA 5HLFB 4KGXB 4A4JA 3IFEA 2R8HA 5KFTA 4ZPVR 4A48A 4CQ1A 1M90T 4ZHRB 5D4OA 2K8GA 1U0HB 4KRWA 2ZBRA 2AP6A 3IAS9 1HBOB 3FK4A 2O66A 1SC6A 3C66A 4DX7A 4DJBA 1LWCB 1XNQJ 4HKQA 4DQRA 4F3QA 2RDIA 2Q79A 5C24A 1RT6A 2AJFE 1VLOA 2CKWA 4F50A 3IGNA 5U47A 4MK9A 5HN0A 4DV2J 1O5JA 5KFIA 4NWBA 3R5DA 4RUHA 2F8EX 1SI9A 1RTHA 3TJ8A 5GAEI 1N4LA 4RX6A 2QA2A 1C0UA 3UWTA 3G8SA 1RAGB 1SQEA 2XMUA 2QMXA 1G7CB 4X64F 3ET6A 1H7WA 2WW8A 4NCGA 5K8NA 3BO4A 2XS7A 3T1HF 5LL6d 1AYEA 4DX5A 2LKZA 4M63A 1TL3B 1L3SA 3JAMU 3C6UA 1JLAB 2YWEA 2ZBQA 3OTOJ 1IWAA 2DH9A 2XGPA 1FKAF 3DYAB 3NCRA 4FYWB 4B3TF 4ZLLA 1C4CA 3H5YA 2R8KA 4CH1A 3IN5A 4B3OB 3G6XA 3HSGA 5A8RA 2CPDA 5BYSA 3UE2A 4RZRA 3H2LA 2HS3A 4A47A 1FRXA 3FFIA 4FNIA 3HVWA 2HBZB 4NOHA 3S7RA 1B70B 2I1RA 3FEXB 2W7PA 3PW2A 4FF1A 2Y1IA 2HFSA 2HNYA 1FF2A 1VDHA 4GC6A 1HQUA 1LOUA 4CO2A 2BX6A 2PSZA 4YS2A 5ETKA 2RSQA 3R3TA 4JI2F 3KLGB 3QSYB 3PACA 4Z37A 2JEFA 3V5RA 2LXIA 1UVMA 2E5IA 3KDOA 3OFGA 3NS6A 4JI7F 5T7LB 4J9SA 2QTWA 4KBIA 3TVZA 2FDNA 2I38A 4KPCA 2DNHA 3V4IB 5HVFA 3PRBA 3DLKB 5I4MA 4CTAB 2HHQA 4QIGA 3HHLC 4OX6A 2FC8A 2FZKB 2F9DA 4KY3A 4DQPA 2L3MA 1KP6A 3F44A 1XBWA 2GCFA 5K9FA 2YBVA 3MWBA 1R8PA 2R3VA 1JLCA 3BN4A 4J5OA 4JI5F 3HKZD 1GFWB 2JWNA 1JLQA 3EDQB 4LVNP 3QLHA 2QLJB 1K44A 4GKKF 4EK2A 5H9EK 1A0OB 4NL5A 4BWMA 4ZMMA 4HDHA 4Q5VA 3FSIA 5HBMA 1BUXA 1N5VA 1YG0A 1RT7B 3MAAA 4ZVHA 2D74B 3OXLA 4O3QA 1NK5A 2Q1LA 2DPJA 4PCQA 1DTTA 5IQQA 4U7UD 4LSLB 4UUWA 1S1VA 1ZAXA 3NG8A 1YTYA 3FMBA 2HBRB 2XO6A 1EHWA 5EX3A 5J2MA 1MW7A 1XERA 2G2YA 1HNZF 3JSBA 4A8FA 4IG0B 2J6UA 2ZDOA 4B08A 1NB2A 1FVSA 4IG3B 1EKSA 1IKXB 3GFZA 4X84A 5KFPA 4M5JA 1U1KA 5D0GA 4IFYA 2WZ1A 2P6TA 4QPTA 2A2DA 2OSRA 3ZO7A 1UZHA 4DX6A 1RT4B 4FXWA 2NXJA 1RISA 1SUQB 3H8YA 4ZCMA 1HQEB 4JI6J 4OI1A 2DO4A 4U7UK 2DJWA 1QM9A 3HP6A 1GH8A 3BR9A 5A6PA 3BV8A 3N6LA 4Y2IA 4UF4A 1GAOA 4I64A 3TRGA 4DL7A 3H90A 3NBPA 4OHZA 1T8EA 2ABYA 4LRAA 2FPHX 1WC4A 3OSPA 1FE0A 2W9BB 3QAUA 3KLIA 5CCMA 1UTAA 1UZDA 1EP4A 2D3ZA 4LRCA 4DR1J 2A6MA 3RBXA 4FKYA 4OHVA 4M1KA 4Q8EA 2LQBA 1PC4A 3L4BC 5JXSA 2CQ4A 1C4AA 3H4BA 3SCLE 4Z7YA 2CZ9A 2MGZB 3KG4A 4KYZA 3MEEA 3CIMA 4CDIA 4DUZJ 4USWA 4KSEB 2ZE2B 4KR0B 1Y3KA 1N48A 3MMBA 1RT1B 5CYQB 4P71A 1T05A 2YX1A 5LMUJ 2BE2A 1KLMA 1QE1A 2OELA 1FFGB 4O23A 4DLGA 3V81A 2HZCA 9ATCB 1TVRA 3OFEA 2MMYA 4Y65A 5EUHA 4C11B 3LAMA 1GQEA 3IM9A 4JI8F 1RTDB 1FKOA 4DFKA 4RU2A 3ZZOA 2V8DA 2CPYA 3FBCA 4HR2A 1WHXA 2LYVA 2DR5A 1YVFA 3EXYA 4B3SF 5ETVA 4KO0A 2ZNZA 3HKWA 1Q0NA 2R2UA 3HT3A 2HBYB 2OPSB 4E98A 3BGFA 1HYSA 3D9BA 2QV6A 3R7NB 4FVCA 1RWXB 3PHEA 2RD5C 4PWDA 2BE9B 3W5ZA 2N4CA 3THVA 4OX9J 4ZLNA 1DZ5A 5E33A 3DFEA 4V19J 3EGNA 3LH2S 3QPIA 2VJUA 2PGCA 1N5QA 4GO7X 3SQGA 2HZVA 1HBUA 3DGPB 3PRVA 1YHQS 4A46A 5EWEA 4DPWA 2GA7A 1PYOB 3L09A 5AXLA 4I67A 5CYMB 1YJRA 1UEUA 4OHYA 4MKAA 4OZ0A 4M5LA 4NLDA 2V50A 2CNOB 1VK8A 1NSPA 2B3TB 1LWXA 3BR8A 1DLOA 2QX0A 5AE2A 1HNIB 1CJTA 3P49B 4DR6F 2E7XA 3HCXA 2DEIA 1N34F 4RLEA 1GX6A 3DRRA 4N8NA 5L1IA 2DHSA 4DPUA 2KXFA 3FZBA 2HHPA 2HS0A 5HQLA 4U67Q 1MWZA 3LP1A 3QIDA 4M8LA 3T9ZA 3EX7B 2F7VA 3R2CJ 2MQ8A 4RNMA 2QMUB 3GG0A 4LF4F 1N6QA 2DHXA 1W2BR 4WFNQ 3E3XA 2JC1A 3HO1A 2J5AA 4ES2A 3G6ES 3N6NA 4BWJA 4LUBA 5M2RA 2B43A 1A9NB 2QSWA 2OTLS 2EEYA 3MM6B 4O3PA 4RW6A 2XSJB 5GAHU 1FX4A 2VASA 2UUCJ 3B4MA 1NSQA 5ETOA 2C2MB 1YJTA 3I0RB 4Q0BA 1RTJB 2HNZA 2W2QP 1D1UA 3QWUA 3ZTOA 2YNGB 4PXEA 1DQAA 2W24A 1KLNA 5E3RA 5L1LA 3VGUA 2CA9A 1W26A 5H1SV 3ICLA 1PYTA 2DNQA 2MJNA 2HHSA 1OYEA 1GT8A 2LP4A 1HKAA 2CZVC 1PO6A 1JLGA 4ECUA 4R8UA 2FY8A 3DDIA 1N54B 4LR9A 3PW0A 4ZIVA 2B4VA 1TELA 1EB0A 1DY3A 2C3PA 3GIKA 3DLGA 1UVNA 1R0CB 5HATA 1CVJA 4IR1A 4LRBA 1RBOB 2NZCA 4FF2A 3L7PA 3PX4A 1WC5A 2AD9A 2VG7B 5GAEU 1M5SA 1TL7B 3R6LB 1RT2A 3ITHA 2DITA 2XLJA 1NJXA 2VFUA 1ITPA 1VBYA 3QT5A 4MK8A 3WDOA 5F8IA 1VHFA 1VHIA 5HJXA 4EI2A 2H3EB 3ZNUA 2UXBJ 1SKWA 1SQFA 1T9WA 4ZVOB 3TYTA 3C19A 2QLWA 1J2VA 5B0GA 1MN7A 4URSA 4ECZA 3R97A 2F63A 4M5DA 1VBZA 4N47A 2OHDA 2GO9A 3O1LA 4A8WA 4K4VA 2V9WA 4PRFA 4H4MB 4NYZA 4C8OA 2P5VA 1YZ6A 5IV4A 3DRPA 3KLVA 4EBDA 1NXIA 3FEYB 4P6QA 4DI6A 4PZVA 2MSTA 4IO9Q 3BB5A 3UD4P 1RHUB 1FDBA 2ILYA 4DV6F 2E1CA 1JJCB 1IBLF 2D9PA 1RSCA 1KDNA 1HBNB 3W1YC 5KFSA 4J9OA 2OEJA 2HQFA 4RPFA 1M0SA 2YNFA 5J2QA 3TAQA 2ZUAA 2VF3A 3M05A 3TEHB 8RUCA 1MMLA 1FJEB 3PX6A 4OI0A 1JXVA 3HHLB 4LIWA 2XQCA 3G96A 1JMTA 5KFBA 4I2QA 1N32J 3NOGA 2KU7A 1GTEA 4GVBB 3AQOA 3IRXB 2F4VF 2OMLA 3A3PB 5G0RB 4NEZA 2L9WA 2RQCA 4DN0A 3QGGA 2AEJA 2H54B 1CG2A 3OR1B 1SIWB 4QBUA 1RB0A 1AW0A 1XNQF 2RVJA 3NOCA 1RAEB 3KLEA 1L3TA 2H48B 5KFAA 2OPPA 3K2YA 4ZPAA 3W2WB 4EMDA 4WE1B 1RHKB 4YB1P 4DSKA 2V0NA 8AT1B 2FJBB 5E3CA 3CO0P 3FQKA 1GX5A 3U1NA 4LFAF 3BBCA 2NLWA 1WHWA 4DEZA 3MFHA 3M2RB 1SV5B 3C6TB 3OFFA 2B4UA 4NLYA 1RP5A 1QSSA 3ISND 1R6VA 2KB2A 1FD2A 4QIVA 3GR0A 1S49A 3V6DB 3JQKA 2ZC4A 4N77A 4J9KA 2H5JB 1VRUA 1P1TA 2OSQA 3H2VE 3R5GA 3JQMA 3MM8A 2I5JA 1JXLA 1RAIB 1J27A 3W3SA 4WP3A 4CO3A 1YJ9S 3FRZA 2BACA 4B3RJ 3BF4A 4N8OA 4DXLA 3W8GA 5HMZA 4OIXA 2GHPA 5HI7A 4C97A 2QLBB 1M5PC 2YQ0A 3N6MA 4URGA 4NLWA 1WKKA 4MIAA 2MLXA 1P27B 2VONA 3I5CA 4DL3A 3LGHA 2DK2A 4DZ6A 3HHNB 4ZS6A 2BANB 1T3OA 3KK1A 3R9LA 2WRMA 4B9LA 2V2VA 2E7VA 1BHNA 3LQVA 1HW8A 4IH6A 2BM1A 1A7GE 5B0AA 3GMGA 4OZNA 3I9V9 3D4JA 4WYLA 2HS4A 1U1MA 2Q3PA 3HMJG 2KN4A 4CLYA 1KD1T 1NJIT 3PG9A 4WU3A 2GHWA 4F04B 2DYAA 3MMJA 1CJUA 5JVGQ 1WKJA 5G4DA 1TKDA 4WP8A 3AOBA 1H6KX 3NGKA 1HA1A 4LQ9A 1UVIA 1LW2B 4USTA 2KFNA 3TAMB 3EYZA 1U6FA 1J5OB 1FE4A 2XULA 4RJVA 1S12A 4UQTA 3S01A 3LGMA 1XMQF 1C1CA 1REGX 1VR6A 2B5JB 4N76A 5LXRA 1PCAA 2BR0A 1KS2A 3TUZC 3M2UA 1PJ6A 4YDDB 2YWHA 2X51A 4KGKA 2VG5A 2WOMA 3J80Y 1K8AT 3K7RA 3GG1A 2P8IA 5L1KA 3OUYA 1RT5A 1NK4A 4NZ7A 1FDAA 4XK8C 4C8ZA 4K59A 1UEKA 2G1DA 3HSDA 1PJ7A 1KBRA 2FHMA 4MAKA 1BE4A 1HL6A 4EO6A 4N5SA 3MR5A 5HQ8A 2G0JA 2HHHF 3CCRS 2DHGA 4NZ0A 7FDRA 5HP1A 4ZLJA 3RTVA 1LKZA 1X5PA 5LMNF 4CH7A 3MXHP 4HLBA 3I6PA 3PJ9A 1SJ4P 1VC6A 5A8KB 4GKJF 2B9XA 5E3QA 1BY9A 3W61A 1QVFR 3PYFA 2BABA 1HNXF 3SCIE 4F4XA 4L75A 2X7IA 2J6TA 2Q6BA 3CCLS 4ELUA 3CCWA 3TX0A 3RZAA 4DHVA 4B3MF 3K57A 1REVA 2MYFA 3B54A 4QYRA 1BQMB 1MMNA 1U8WA 1UKUA 1LWCA 2R7UA 4ID5B 1X5SA 5F3ZA 5KT3A 1VQOS 3UCZP 2H51B 2CRLA 2W8LA 3IGVA 2GJ2A 1HWKA 3OQ2A 1I51B 4EO8A 2HQCA 4QWEA 3NS5A 2V8VA 3K8WA 1HQ2A 2UXDF 3M2VA 4BHQA 2U1AA 4YR3A 4WIQA 2H1YA 3PDNA 5T14A 2RKIA 2KZMA 5KFYA 1IKVB 2ZH5A 1RU1A 3BDEA 3FKBA 4L72B 5KFHA 3HJVA 2GZOA 5D8HB 1DHMA 5H9FK 5D0HA 3T9NA 3C15B 4F2RA 4QR0A 1PILA 5LMUF 4ILRA 4MMOA 4RW8B 3HFZB 1JLEB 1IBMJ 2NXUA 1TMJA 3R8YA 3M8PB 5FIIA 2R8GA 2XWYA 2BOPA 1TKTA 3RU0A 3H5UA 1VQ7S 4NRTA 3K59A 2V69A 1GK8A 1H72C 1FO1A 2BEFA 3UDLA 2XMTA 3KXDA 2QFJA 3BSNA 2Z8QA 1APSA 4DSLA 1B0TA 2HKEA 3SQOP 4PUOA 2O67A 1MROB 2RDJA 4ZKAA 2AT1B 4NPOA 5DRKA 5KFRA 1WI6A 4LQ3A 4L3NA 3MM5A 2UXCF 5JUMA 1F0XA 4YHHJ 3BSAA 2QL9B 3DC2A 3UD3P 2YKMA 3PYDA 1LFPA 3KFWX 2DXFA 2CJ9A 2MHEA 2CZ4A 5GADI 2QIFA 3KLHA 4X4QA 1IBKJ 3HXMA 2LFVA 1SQGA 3TZXA 1HHQA 4QR2A 1NDPA 4UOGA 3AOCA 2UUWA 3SCKE 1FRIA 3WC2A 1E6YB 3QIPA 2VQFF 2CUYA 3M8YA 3O6QA 1VK3A 4O4RA 4I7FB 1HMVA 2KH9A 1RDRA 2GO8A 1TUWA 2V94A 1DARA 1RHMB 4UUXA 2KKHA 3AD7C 1SL2A 3RAMA 1DQ9A 1XR5A 4BC7A 2QGFB 3MD1A 1BQXA 1ZZFA 4ZIWA 3V6JA 5J1EA 5CCLA 1QSYA 6AT1B 4K4WA 1CEZA 4DR5F 3SBMA 4IRKA 2WVFA 5KFMA 4YR2A 5C5JA 2RRBA 4LF9F 2IC3B 2C3YA 3UNGC 5DLFA 3HVAA 4OYIA 1RT7A 2DEJA 2DH8A 4N56A 4OYMA 4UZCA 4NI2A 2JFDA 1RZMA 1GMUA 3I4PA 3Q8SB 2YH0A 4RWXA 2W4DA 5HROB 5D3GA 2YNIB 2UVRA 4G3IA 2VODA 4ED8A 1QY7A 3NRBA 1NKEA 3N28A 2ATLA 3I0SA 3PR5B 5ETTA 2HRTA 4DL0C 3TJAA 4OYBA 5IWAJ 2QL5B 2NSBA 4ELTA 2E44A 1Y0HA 1UVKA 4WU2A 3D1HA 1IJEB 5DDPC 2HHTA 2DNNA 2B6AA 3I32A 4DF8A 4CYUA 4MK7A 1KONA 1HHTP 3UPFA 1OYDA 4GO5X 3TUIC 3ZFVA 1JNZB 2ZH6A 1T9VA 1U49A 2HMIB 2PMHA 3RG6A 2BXJA 2ASJA 4ZPBA 2BKNA 3JYTB 2ZD1B 4Y3CA 2PMZD 1Z2LA 2OFHX 3EGVA 2AYMA 4XPCA 3SDEB 4TY8A 4J90A 4USKA 4D3GA 4DMZA 3QO9A 3IWXA 1O8BA 4C4WA 2AEMA 5IS2A 2V9KA 4X62J 5DG8A 3VAKA 5HAOA 3DRSA 3FEZA 2IVMA 2CPIA 4RBUA 2GGPA 1RXOB 4DG1A 1FTCA 3A8EA 3AB4B 4XPEA 3GJRB 4J9PA 4AQYF 2KM8C 2M5YA 2C28A 3D6FB 2ZH1A 3CD5A 1B99A 5E3AA 1WI8A 1KFSA 2MZRA 1RBAA 1YSJA 3UR3C 2RS2A 1VQNS 4D3HA 1X4BA 2KFYA 5JJBA 4X4PA 5KG0A 3DLJA 2OJ3A 1KSPA 4DR7J 2YKAA 2FIUA 4LBIA 4WXOA 3G82B 3RW6A 1XWLA 3PFOA 1UETA 1UWBA 3H0PA 2AWZA 4XDDA 3PO5A 2Z57B 2DPIA 4LREA 1ZH5A 3N5BA 3LP2A 3K0JA 1S1UA 1S9EB 1J5EF 4QIEA 3L7UA 2V5HG 3T5LA 1T95A 2HBQB 1F1BB 3RB3A 3P6YC 4YB5A 4CLPA 5EWGA 4IFVB 1S4EA 3P5BP 1UPMB 1FFSB 3EGWB 3G8QA 1TKXA 2DNKA 5J2PA 1N36F 1IJFB 3D28A 4P9SA 3HI9A 3QMQA 3D67A 4IOAQ 2NYHA 1K0VA 3CD0A 4C0OC 2ADCA 4KGZB 1ELOA 2RDDA 3MDFA 2VL1A 3I5BA 4QYZJ 2CPJA 2HVEA 1VQ5S 1FWKA 4EZ9A 3MECB 3R5JB 5LOQA 5KT7A 1R8BA 4L3KA 3CF5Q 3BSOA 1XMBA 3DOMA 4ENOA 2XEXA 2V8HA 3EE3A 2YWGA 3MUTP 3DM2A 3BKUA 4DX8H 3V6HA 4XDCA 2KFZA 3D54A 2BZ2A 2IJNA 1GMWA 2JEIA 4DR3J 4DV3J 1KTQA 3PR4A 1Q8KA 2M9KA 2HG4A 3MR6A 2D9OA 5B09A 4USIA 2W2NP 5IC4B 2EFPA 3KJFB 1QAYA 4KV8B 4KB7A 3D3CJ 4WZQA 2HPUA 3MEDB 4KPYA 2FUG9 3KHRA 2CPEA 1G4CA 2GJFA 1CJKA 4JV5J 2HSEB 2V8PA 3SSSA 4CRJA 3RRKA 4C3KA 5KG3A 2ZJQQ 1FK9A 2D3OR 4F3MA 2OAUA 3POTA 3ZTPA 3GCXP 2KZZA 1VRTA 1H7XA 4NA1A 2RT3A 3KMQA 5HMXA 3LP0A 1H2VZ 5IM0A 3VQSA 4QWAA 3T1YJ 1RJJA 2RU9A 4WKYA 2RH3A 3W62A 3PO4A 3PX0A 3OFHA 1AZSB 4AD6A 3BPSP 2HEKA 3QJLA 2QT7A 1S1WB 1U4BA 4P10A 1WELA 3UR0A 3E01B 5RUBA 2AU0A 3DOKB 3BEGB 4NCAA 4HHJA 1NH7A 1UCNA 3RUBL 3CJKA 3HD2A 3B8HA 5K8OA 2XMJA 3MMAA 1NHVA 4W98A 4WFZA 3JTOA 3O2IA 5IC6B 3ILOA 3UO0A 2LVWA 2OH2A 2JLGA 1R6YA 3RBZA 2H65B 5I3QA 3GZ7A 5JVHQ 4B9MA 2AQ4A 2J8SA 5C25B 3MM9B 4DPXA 2VFRA 4CNZA 3M8QA 2JSXA 5FDLB 5BR8J 4DV1F 2K3KA 4R25A 1M5HA 1R0AA 2W25A 1XJWB 3AJ1A 3CMQA 2VPWB 1HNVA 1KRPA 1UPPA 1IWGA 2ZM6J 4KIAA 4ZVTB 1S72S 3G8TA 4J9VA 5AJ3J 2KT2A 3UDCA 1PSDA 2Z2LA 3UN3A 4JBCA 4DV4F 2QRRA 2DTJA 2J9CA 1URRA 2QSFA 4ZDNA 3QYYA 5GMDA 3M9MB 3HFKA 2FJDB 2U2FA 2Y8YA 3THPA 3CJ2A 4M5MA 4P73A 1FKPB 3K5LA 3OTEA 5AXNA 5AT1B 1WWHA 4USMA 3B4DA 2CWXA 4GMKA 3DRXA 5L39A 4JI1J 3DDNA 2VC0A 2A3JA 2FJEB 2VIHA 4WK3A 1WG5A 4H54A 3HF5A 1FNXH 4DV0J 4LIRA 2JRSA 1OO0B 5K8MA 2C3UA 4G1QA 3MEGB 2WVBA 4IDKA 1BMQB 1JQGA 1RA6A 2RS8A 2FHJD 2Z30B 1WACA 1JLFB 2CQBA 4F8RA 2IDEA 3FGVA 4CWBA 2YPYA 3CDAA 4C0BA 5GADU 3IAM9 1HLWA 5K20B 3OXFA 1FRJA 1E6VA 2KXNB 3ZNJ1 4YY3J 5KT4A 2VH7A 1K1SA 3QNWB 4RW7B 3AB2B 1H38A 2DGOA 1HR0J 2FHOB 4JI0J 2B56A 2GV1A 3E8OA 2UVVA 1LFWA 3GFYA 3JSYA 3BN7A 3DU5A 4PQUB 3BKTA 2YKNA 4YP3A 1Q8LA 5MLCV 3M6WA 4QPXA 2CJBA 2HYIB 1TQLA 4OZ5A 2VPYB 3MURP 5ETQA 4Y34A 4J9UE 1VLYA 3M30B 3TQEA 1QLNA 3IBWA 1M1KT 1D8ZA 1NRKA 3CW2C 2MPUA 2XB2D 2EWHA 1IR0A 2BJEA 1CS4B 2F9JA 3J81Y 4NYOA 1Q7LB 4M94A 2FLNA 5KT2A 2BVZA 2QLFB 2HZAA 4FF3A 2OPQB 1RACB 3BBFA 2B51A 2CJXB 4TYBA 1S1TB 4P7TA 4WCEQ 1DRZA 4O3RA 3M9NB 1NJZA 2NUUG 4LF7F 1B7YB 3TA1A 3CMAS 4IQMA 2ZFHA 4Q2MA 4KJIA 1L3VA 3NY0A 4KC5A 2JZ5A 3CDUA 3N9UC 4U95A 1OWXA 2K7KA 3MCOA 2M0GB 1B7FA 1XMOF 3BDPA 3VALA 3TA2A 3T5JA 3SXLA 3DI6B 3MHYA 2OMOA 6FDRA 2IM1A 2B0GA 2POKA 3C8YA 1T94A 4L73A 3CDWA 5CZXA 4UT4A 2MHNA 4OYPA 1F60B 2V34A 1PAEX 3DMJA 3KMSA 3MCNA 2ZH3A 3CJQA 3R27A 5THWA 3IBCB 1TZ0A 5DZ6A 1Q7YT 2XYGB 2R42A 4KAIA 2JEGA 1Q1KA 2W2OP 1S0OA 1UVLA 1W25A 4HACA 2WONA 1TL4A 3UW1A 3CCVS 1TP7A 1SJ3P 2UUAJ 2BJ9A 2EVZA 4QWDA 1VC0A 1VJWA 2Z56B 3C3LA 1X60A 2KM8B 2Y0SD 4I69A 5SUHA 3GJQB 1NK7A 2CADA 5C42A 3O5TB 4HI1A 2XC9A 2RQMA 3HSZA 2YQ3A 3DLEB 5FJ4A 1D9AA 2FD2A 3R1LA 1SJFA 1RTZA 2HWIA 1IKYA 1W2IA 3MMCA 3VZHA 2EW9A 4RBVA 5J2NA 5E5NA 1Q16B 4OFZA 3A13A 1U2RA 2HFZA 3W2VB 2W9AA 5DM6Q 2VQEF 3EZUA 4EZ6A 3VCDA 4NMLA 3OJUA 3FUYA 4J37A 3H20A 1ZOTA 4F25A 5F8GA 3Q0AA 4V19X 2XS2A 2HFOA 5D4NA 3D0GE 3KTQA 4ZPCA 2DRDA 1S97A 1YIJS 4LFCF 2IPOB 3BO3A 4EYIB 1SPBP 2MKHA 2OI2A 4LBPA 2VDHA 4ZP8A 2KG0A 3PYGA 1I94J 5F8JA 4KHPJ 5AE1A 4DUYJ 2HK2A 4JI3J 4K4ZA 2O1PA 4WFAQ 2M52A 1RE1B 5GMKa 3I31A 2QLXA 2CVEA 2Z58B 2GQCA 5DDQC 1SC3B 4DR2F 3CGIA 5F0UA 5K14B 4X2BA 4CH0S 1RT3B 2CQ1A 1NNDA 3MR2A 3BO2A 2RNEA 3A4TA 4FBTA 5KFQA 3HHDA 4LSNA 3TUPA 2KYXA 2WSCC 3KLFA 1SXLA 4AT1B 2XLIA 2DO0A 3CDBA 3THTA 5D6GA 3EUNA 4YOEA 3SFGA 2QA4S 4ZJOA 2GAHC 4KFBB 4ZVRB 5KG7A 1OS5A 1YWXA 2RQKA 2RRNA 4LFBJ 2JX2A 1TAQA 3TANA 4WYWA 2LQJA 3LUYA 4OX7A 1H73A 1Q53A 3ULHA 1VFJA 3ZZTA 3AH6A 2ZOMA 3NNHA 3PEHA 2RF2A 2WBMA 5C24B 1RT6B 2CJQA 4L74A 5CA5A 2E66A 2M3DA 2YXLA 3NNCA 4QU7A 3I96A 5J1NA 3QZ8A 2GVDA 4CT9A 4RWWA 2DNLA 1ZPWX 4XTTA 1RTHB 3B78A 4R5PA 2LCWA 2W1BA 1B64A 1N56A 1C0UB 1NB7A 3R7BB 1UW9A 1UFLA 1HWLA 3CT9A 3FRYA 3CC7S 2LA6A 1NO8A 3ET6B 2FVCA 4NCGB 2HVDA 4DR7F 3CJSA 1PJ5A 4MT1A 1NU4A 1FERA 1WC3A 1U26A 3K89A 2HFUA 4ECVA 3BZQA 4YB7A 2MQLA 1H74A 2MJUA 4YR0A 3C6UB 3QSIA 1ROFA 4H4KA 4EBCA 4FPRA 2DY9A 2VC1A 1TUGB 4F3OA 3GYGA 1N5YA 5HJYA 1DURA 4G65A 3L7OA 3TP2A 1WF1A 1YI2S 2CG4A 2CNNB 3NGRA 2ZH4A 3EICA 5A8RB 1WF2A 2IA0A 2ZKUA 3FFIB 3NGUA 3HM9A 2UUTA 2GW8A 1RYSA 4CLSA 1FFWB 5EGYA 5GAHI 1P9QC 4J9RA 1S99A 4B9UA 2K06A 4HHUA 1BQNA 2HNYB 1OMSA 1HQUB 1HPZA 2DGWA 1UA1A 4USJC 3J7A1 4DPYA 3CSKA 1UP1A 1WSVA 3N79A 2R2TA 3OV7A 1TL1A 4KKOA 1SJRA 4LF8J 5DG7A 2WBRA 4I1TA 1IN0A 4RW9A 1N33F 4Q2LA 1EARA 1UMJA 1LW0A 4EWTA 2VV5A 4FS1A 4K5SA 2M4MA 5KG6A 3JB9k 2F8MA 5ETSA 1T02A 3HK2A 2YVSA 2FY1A 1ACMB 1R89A 1EQ0A 4HH0A 1BLUA 3HVTA 3BQ0A 5A2QY 4F2SA 4A8XA 4NXMF 3K5NA 3VGTA 4RUBA 2IJFA 4W4MA 1V3ZA 5C2GA 4QQBA 1SC4B 2RIJA 1EZZB 2J0QD 3W9HA 3IO1A 1JLCB 5KFXA 3OBIA 3OD2A 3ILIA 4O3SA 1JLQB 1FDDA 3PTWA 3PW7A 3K5MA 3QLHB 1U45A 1GMVA 2JL9A 2VJVA 4DV7J 3EWGA 3EDRB 2E1RA 3P5TL 4C98A 3NNAA 5ETPA 4I2PA 1M5OC 4O44A 5HBMB 2VG6A 4UZBA 1IKWA 3MAAB 4ZPTR 4MFBA 3LOUA 1TUVA 4TLQA 2AYEA 3P45B 4MYUA 5CD4A 3J80U 4F67A 4WF9Q 2UVWA 1DTTB 5HL7Q 2B7BB 3GIMA 1S1VB 1U25A 2Y0BB 4EBEA 1HBMA 2R2SA 3IG1A 5J2MB 2BW2A 2HNDA 2DNPA 2IM3A 3QZ7A 3HHEA 1FWPA 1XTZA 4NLRA 1RAOA 3Q2SC 5DZ7A 1YJNS 2EK1A 3GB0A 4TXSA 2AX0A 1ULRA 2J76E 4ED4A 1FEHA 4FYDA 4K4YA 4IFYB 2XBPA 1LWEA 1Y10A 4BC9A 1LWFA 2XS5A 5F8NA 4I0WA 3AXMA 1QAIA 3IR6B 4YEAA 2BV3A 1F9EB 4K4UA 4CM0A 1G3OA 3LWMA 2ZZTA 3ZXWA 1V6HA 2LDIA 2R4FA 2L41A 3H5XA 3LPYA 3O44A 1Q78A 5L1JA 3F73A 3MF5A 3U7JA 1FVQA 3RW7A 4DSIA 1X9SA 2IRXA 2OLWA 1QAXA 2VKZG 1DTQB 1Q8BA 2ZEJA 3CJ8A 1L5UA 3J7YI 4LF6F 4FBUA 1YRTA 3NBPB 4PG4A 3T5HA 5BR8F 2MZTA 3TARA 5I3UA 3KG0A 5EN1A 2RE1A 4X4SA 3KLIB 3DN9A 1EP4B 3KK2A 1WF0A 2CDQA 1CULA 1SL1A 1D9FA 1OIAA 4NMXA 1F3FA 3MPYA 5DGBA 9RUBA 3PFEA 3MEEB 2K1RB 2YTCA 4Y2AA 3SEOA 4X64J 2V4JA 3CWJA 4FKXA 2CQ2A 3CCZA 2YWKA 1WHVA 2R7SA 3MMBB 2XNRA 3WC0A 3CJRA 1TMMA 2IVFB 3T1HJ 1CJVA 2AJ4A 4TU9A 1T05B 2XTJP 3D0HE 2BE2B 2YNHA 2MQPA 2FTRA 1CLFA 1KLMB 1QE1B 3G6VA 3V81B 3GYXB 4UOHA 1TVRB 2H4YB 3ZTQA 1CC7A 3CEDA 2VHGA 4OHWA 4B3TJ 3W8PA 2MZQA 2GAGC 2D3UA 3NAHA 4ER8A 3VHQA 4DSEA 2IJRA 1UJ6A 3MPVA 3AT1B 4KO0B 4FXVA 4WBFA 1D09B 2YKOA 4RNOA 5E2QA 2FLLA 2HHXA 1Y5LB 2RHSB 1FD8A 5L8RC 1HYSB 2DNGA 2JDJA 1HNWF 3T5KA 1QAJA 1S57A 2GC8A 4Y2MA 1VOMA 1KR4A 4PWDB 4TQSA 4JI2J 2FVSA 2Z2YB 2R8IA 3DHXA 3SQGB 1HBUB 3QFWA 2HRYA 1NM2A 4NLOA 5IV3A 3OHAA 2OPRA 1Q5VA 4JI7J 5KT6A 1FNMA 4MYTA 2E9ZA 4NLPA 3VAIA 3HT0A 4CLLA 4FS2A 1RWPB 7FD1A 4C7QA 2MKYA 3CO9A 4PG5A 4MKYA 1DLOB 1VJQA 4DU8A 5T41A 2W7AA 2UUBF 1S6QA 3KHHA 1CJTB 2YPZA 3M7VA 4K2JA 2UU9J 2C1EB 5CAAA 1SKUB 4WFXA 1DAXA 1VBXA 4BBYA 4DQSA 3DRRB 4O0IA 2VB6A 3JXOA 3TW0A 4H4OA 4OYXA 5IT4A 1CSJA 4O0NA 1RCOB 2JVOA 4JI5J 2ACMA 3RAQA 4UW2A 2W9CA 1H2TZ 1S1XA 4LVOP 2HVIA 3LP1B 4GKKJ 1PBAA 1D8YA 5DJBA 1KN6A 2IBOA 1C0TA 3GCWP 4RNFA 1N6QB 1RTIA 2IAJA 2RQ4A 2YQ1A 2APOA 5DQGA 2QE5A 4X4RA 2FGOA 1VQ8S 4X65F 4M5IA 2HRUA 3GV5B 4V1Ak 3KUHA 3OR2A 1F9FA 1URNA 2KO1A 4RW6B 1I1GA 1X4HA 1JWWA 1NSKL 2G2ZA 2ZC3A 4HL9A 2IMWP 2DXEA 2DD8S 1F3VA 1RLDA 4Q0BB 2HNZB 3KJQB 1YRXA 3WHIA 5HSPA 3M1VA 2JVRA 3K5PA 5IXUA 4B9NA 2UP1A 2V67A 4DOZA 2IRUA 5A6WA 2BJ7A 4F4KA 3ZTRA 3DDKA 1QDUB 3LGNA 2G9OA 2ZWPA 2N3LA 1BC6A 2XLKA 1NDLA 3VTIA 4MIBA 2XMVA 1UJ4A 4LF1A 4KE5A 1TV6A 3AA8A 1PAUB 1RAAB 5GMEA 4PXDA 2MZJA 4QIWD 4C6AA 3JSRA 2ASDA 1JKHA 3NMAA 3KK3A 2BBEA 4DS5A 5I42A 2XMKA 1G1XA 1O51A 3QQCD 2D7SA 3DLGB 4TQRA 1VI7A 1KQKA 3NEKA 2FLOA 2DKOB 2J7WA 4FP9A 2M88A 1S77D 1L3UA 4A8KA 3VGVA 4CLTA 1SKRA 1V3RA 5LT5A 5B0DA 1RT2B 3ITHB 4OI4A 2HVHA 1C1BA 4ECSA 2PT0A 4W90B 3CUNA 1EAYC 2FVPA 1YLXA 1PBUA 3J7AN 3BGUA 3LPEA 2QO3A 1VMBA 2KHDA 1IM4A 1JLBA 3GPAA 2FVRA 2OFGX 1CQMA 2FJXA 3M8ZA 1F5CA 3I56S 3X1LB 1RBLA 1HHSA 5D0RA 4M5DB 1VCTA 4C8YA 4OQJA 3LTOA 4A8SA 1NJWA 4JI8J 1WDDA 3KWMA 2DB1A 4ANDA 2IY5B 4PQAA 1IR2A 3DRPB 3C16A 2AX1A 4B3SJ 2JJ4D 5BJRA 1ZYQA 2AF6A 1D3WA 3IM8A 3QATA 5KFLA 1SBRA 3DCAA 4ANEA 4EYHB 2NUHA 4CO5A 1D9DA 4USVA 3AJ2A 1BWVA 1YZ7A 3UDVA 1TL5A 1WDTA 2KI2A 2DR6A 2YNFB 2LXFA 5J2QB 4LF5F 1B0VA 2F65A 2N82B 4YN3B 1SB6A 2C2RA 1XC9A 1PG5B 1ZM9A 3GSIA 3LW5C 2QA1A 4I2QB 3RB4A 3CC2S 3CIZA 5L9XA 3NP5A 1WOPA 4C8KA 4AFFA 4RNNA 2XY6A 3M8RA 3DLLQ 3ELHA 3CC4S 2BM0A 4NE9C 4I4BA 4LJMA 2A6OA 5L9NA 2EFGA 1N88A 3S1TA 3KLEB 3BGRA 1S6UA 1N34J 2AJQA 1N5TA 2OPPB 3Q8PB 3GFHA 5GVQA 4ED1A 4DQIA 2HGLA 4GC7A 5KG4A 3CCJS 4E0DA 2HWHA 1RCXB 2QZ8A 1M1GA 2OIHA 3PEJA 3P8BB 2VUGA 2Q43A 3D1OA 4NLTA 2XI2A 3US5A 4O3OA 1XNRF 4F36A 5HANA 4LF4J 2AKWB 1MMDA 2AJ1A 1JIHA 3AHPA 2HWTA 2VFTA 3FBFA 3IR5B 3UDEA 2NXEA 3D0IE 1YGYA 2ZITA 2VU5A 3P4UB 4USUA 1VQKS 2Q66A 4NLUA 4QIFA 2IDLA 1VRUB 2BE7D 4L76A 4JI4F 1UVJA 2DGXA 2CIMA 3QAEA 2SXLA 3MM8B 1RKJA 2I5JB 3UCGA 2KJVA 4CI0B 4QCLA 4AXIA 1VQYA 2A2CA 4O4GA 4LSZB 4NXNF 3PV8A 3R5AA 4Y6IA 2W2PP 2V4RA 2ZWOA 2GVZA 2K7JA 1NHUA 4P2XA 2M7SA 2OD6A 2BKOA 1TFWA 4QU6A 1WJ9A 5LSRA 3AD8C 3G71S 1NEEA 5A0YA 1T9UA 4LR7A 3ILJA 3LANA 3IC1A 4DQQA 3KK1B 1LK7A 2ROGA 3LO3A 3TO8A 1R8AA 4CIOA 4CO0A 1KVKA 4AXJA 3EZ5A 1PYSB 5A8WA 1VQLS 3J7YU 3MTJA 3CCMS 4IOBA 4ZVEA 2D1CA 1Y9OA 2NXNA 1YJVA 1TKZA 3T1AA 1KTVA 2ASYA 4EUVA 3W9IA 2C2DA 4CLWA 1FWLA 4CM2A 4ZCKA 3SFUA 1CJUB 4HT5A 2Z4PA 3SSRA 4Q44A 3VV2B 3OVSA 2GIFA 1P9YA 3P3DA 3N01A 4DV2F 3TUJC 1EETA 1VIXA 1Q8IA 4PYAA 3AODA 1HI0P 3V2UC 2FYXA 4HHHA 2RMLA 2QEXS 3AOAA 4GRSA 2O01C 4DU7A 2ZH9A 3ENVA 4CLUA 2LECA 1C1CB 4OJGA 4PWUA 3MPUB 1L3KA 3JQJA 3FBEA 3H98A 1OPZA 4F7VA 1K47A 1S6PA 3M2UB 2VG5B 2WOMB 5AXMA 3KJVA 3SV4A 1B3TA 1QTMA 2QYCA 3OUYB 4X4UA 1RT5B 1NKBA 3UNYA 3MEKA 4PXCA 1WKLA 1ICEB 2CJYB 4KQZA 3WQPA 3C14A 2DIVA 1Z4UA 2X1BA 3OTOF 2BUNA 2BQ3A 4RW4A 3RB6A 1X9WA 4DV6J 3RBEA 2MSSA 4RR5A 2FZCB 3AY0A 1IBLJ 4PPZA 3W60A 4IKAA 3HVRA 5HP1B 1N8RT 4PWWA 4P2SA 4WTYA 3CMES 5AE3A 1HD0A 2MLYA 4ZP6A 2MKCA 2XZWA 3QT6A 2EFOA 3VF0B 3ZTSA 3OTBA 4KFBA 2AHOB 4ICLA 4QOTA 2F4VJ 5KFEA 4AL6A 3TZWA 1REVB 4TU8A 3G86A 2LXUA 2HK3A 1VRQC 2RJZA 3NGDA 3SMZA 3T3FA 4K8RA 1WUUA 2E5HA 2W2MP 1YRUA 1OJ4A 4LBHA 4KH1B 5MAOA 1QVGR 4KT0C 2BA9A 2F40A 2ZHBA 3G4SS 3MZIA 4UY8T 1ZZNA 5K5MA 2WCXA 2K2PA 1QD1A 1T03A 1YX2A 1U1QA 3M32A 2WAQD 4JP8A 3ZZRA 1GTHA 1MU2A 3QGPA 4LFAJ 1S9GA 3RJMB 5B7WA 1VYAA 3J81U 5CZVA 2D69A 3M2VB 2E5LJ 2VA3A 1FCAA 2H5EA 3RR7A 2RKIB 1CQNA 5L38A 2P9CA 3R6GB 4Q8FA 3UN2A 4BDPA 4P2MA 2NYIA 4F4ZA 2YX7A 2XG8A 1F5BA 1H0HB 4PPDA 3CXCR 2PEBA 3I55S 2HURA 2G2OA 2Z0GA 2RUSA 1TKTB 2J0WA 3MM7A 1SKSA 2I6WA 3TZYA 2R7QA 3VAHA 3M4XA 2XYHB 2MQQA 3RGIA 5F9LA 1H3DA 1F2HA 1U1LA 3JSMA 1RA7A 1YBUA 2KRBA 1ZPVA 4PUOB 1WHYA 4LRDA 4B9TA 3H59A 3MPWA 1NDCA 3MM5B 1VS3A 3SSQA 1UEVA 4F4YA 1H2UX 1FXRA 1X4CA 4DFJA 2YH1A 3OXGA 2LU1A 1S76D 1AB8A 5HLFA 2KG1A 2YKMB 4PYDA 2KVIA 3PZPA 3KLHB 1EIYB 2MEWA 4ZHRA 1HI1A 4PAAA 5ETMA 4FDFA 2Y1LB 1WEZA 3IRWP 1JNRB 1U0HA 4I6AA 2PA8D 4JI6F 2H4WB 1NMEB 3QIPB 2RU3A 3DLHA 2ZKTA 1HBOA 1SJ1A 8ATCB 3D7SB 3LALA 1AXQA 1HMVB 1Q79A 4IH5A 3ETOA 1KVJA 4FYXB 3HZGA 2GX8A 2G0IA 2PIIA 3S6EA 3A8JA 2QA4G 5J1EB 2GS8A 1YKWA 2JLEA 2UU9F 3BYPA 3IS9B 2LMIA 2CPZA 2MQMA 4DR1F 4HYKA 1U48A 1HWIA 5GAGU 1XMQJ 2DNOA 2IYIA 1U8SA 2MZ1A 4U8YA 4DUZF 5CD4H 2GJIA 4ZVFA 4ZK7M 2CQDA 3N0VA 2DGVA 5H9EJ 2IRYA 4IH7A 1NDKA 2J0XA 4ED2A 1RI7A 1SJQA 1R8HA 4NI2B 2ZNYA 1JJHA 1TL3A 2LQ9A 4S0MA 2QG9B 2GNKA 2H9ZA 3W64A 2VD3A 2ZJPQ 1JLAA 4FYYB 2DNMA 2YWWA 5D3GB 2A18A 3DHWC 3VVUA 1RWWB 2PD1A 3DYAA 4FPIA 1UAWA 2MB0B 2HHHJ 4A8OA 2K3IA 3I0SB 3VQTA 1M1HA 4B3OA 1JB0C 2X3GA 2VFVA 4PG7A 2XMMA 5LMNJ 1S10A 1HI8A 1RYRA 3A8KA 3WX4A 4GKJJ 1WC1A 3RR8A 2BRKA 1I5OB 2FJVA 1FT8A 2B6AB 4U9RA 4CYUB 1HNXJ 5CABA 2BW7A 4ES3A 1FNOA 3AD9C 1Q81T 1S7HA 3VAMA 1W7WA 2PFDA 4B3MJ 3KLGA 4OX9F 2E1PA 3SI8A 1Z1ZA 5K8PA 5JMNA 4ZOSA 4NA2A 3W65A 2FJWA 4TY8B 4M95A 1SH3A 3DNCA 5T7LA 4N41A 2GQQA 1VQMS 3QO9B 1DTQA 2AIRB 1NK6A 3N5FA 3V4IA 2PMWA 4HVZA 3DLKA 4QWBA 3G2XA 2KT3A 4C48A 4CTAA 2OD4A 3CCUS 2ZH7A 3DRSB 3SV3A 2COLA 1JJ2R 3UFCX 5E3PA 3OW2R 1K1QA 4OLPA 1VIOA 2GGPB 2PDAA 1RAHB 1EQMA 4DG1B 1T3NA 3KHLA 2UXDJ 1WG4A 1U1OA 2KHCA 2C3MA 2K1RA 2ALZA 4DCPB 1WSRA 4J7CA 2AZ3A 4DDFA 3L95X 1FESA 4JYAJ 2D3O1 1H98A 4FVMA 1NKCA 2YWFA 1T0TV 1P8GA 3PKMA 3ETMA 1QJHA 4MIWA 5HO4A 3NWRA 2HQIA 4M5KA 2KRRA 2L08A 1LNQA 3PJWA 3PVXA 3TWZA 1NZAA 2G4BA 3ENWA 4ECWA 1UWBB 2BJ1A 4DZDA 4CLFA 2V4QA 1FX2A 1BXNA 4QZVB 3LP2B 3MOZA 3HPOA 3RAXA 1S1UB 2M70A 3D5MA 4NLGA 2C2OB 1HW9A 4P52A 3GIRA 1RQ0A 4LSLA 3NCPA 5DDOC 2VBZA 4RBTA 1K9MT 5IT9Y 5HMWA 3VGSA 2L9NA 2UXCJ 4A8YA 3WBZA 4IG0A 3D66A 2EFNA 2UUCF 4Y00A 1RHQB 4FYVB 4IG3A 3J7Z5 3EM1A 1TKXB 4ZJQA 3HULA 4FXDA 1IKXA 2W01A 2WHOA 5J2PB 1U24A 4DCJB 1K73T 1Y11A 3MTKA 4OYZA 2LA4A 1RT4A 2EG1A 2VBYA 5J1PA 3ENQA 3PIOQ 3F0NA 1SUQA 1HQEA 2YY3A 5B0CA 2VQFJ 4F26A 2NSCA 2DGQA 2FZGB 1Q5YA 1TFYA 2CPXA 4DUTA 4DL2A 4AL5A 3D68A 1NPPA 1M5VC 4LR8A 1LXNA 4B17A 4HDGA 3DOMB 4DWIA 4DSJA 3HZEA 2J9EA 2R7TA 5DG9A 3DM2B 2VZ9A 5B0BA 5F3TA 2IFXA 2EK6A 2W9BA 3MUVP 2FHJA 2ZVSA 4DR5J 3RB0A 1GXTA 3GV8B 5A2QU 4LT6A 3B6BA 4ILMA 4OZLA 4E2FB 4LF9J 1YBAA 2MGZA 3X3UA 1IQTA 3D6MB 2IA6A 2CQ3A 3RBDA 2PC6A 2ZE2A 3T41A 2UXBF 1CJKB 2I2YA 1RU2A 1RT1A 5CYQA 1S0MA 2C2KB 3TQ1A 1FK9B 4KTQA 2PA3A 2DCUB 3POTB 1N52B 1R7IA 1VRTB 2YX4A 2IBKA 3W9JA 2FQQB 4C11A 3LP0B 1RTDA 2MXYA 3OL8A 5IM0B 3G6YA 1R31A 3H5SA 2ZOFA 4NLVA 4TVAB 1V5IB 5KFKA 2FGCA 3V6KA 4ZPWR 6FD1A 2NQPA 3E51A 2DRBA 2BQUA 3I5AA 2Y1JA 4ES1A 2BQRA 1PC5A 2GFFA 3CCSS 3NGSA 3MAQA 2OPSA 3Q8YA 4ZVQB 3PY8A 1I3OB 5I3PA 1RADB 1KWMA 4GVLA 4DFMA 4H4KC 1XQIA 1LK5A 3RRHA 4LRFA 3FNNA 3VZIA 2B4PA 3KJNB 3DXBA 3CJKB 4K4TA 1O0PA 3CNQP 3MMAB 1X7VA 4P75A 3DGPA 4NLXA 2IVYA 3P96A 4QYZK 5FD1A 4Y2KA 1N32F 5CYMA 1FDNA 2JC0A 3DOLB 5KT5A 4WPAA 3MFIA 3ISZA 3TI0A 4ZVSB 1UWAA 2E1AA 4G1PA 4JV1A 4URQU 3M8QB 2NCKL 3F41A 2FC9A 1GXUA 3BH6B 1U7LA 1HNIA 1F2GA 4WFYA 4ZP9A 5ADZA 3BS9A 3F56A 4EGLA 1R0AB 1FXDA 3ZZ0A 3TR5A 1HNVB 4AQYJ 3ZC4A 3OVBA 3AFGA 1QTNB 1RWVB 2X1FA 2CJAA 3EMTA 2EG2A 1U0SA 2HW3A 1NPKA 4F02A 5AXKA 3IWNC 2IHR1 5IQ6A 2LEBA 4CLKA 2X3DA 2V2KA 1UW4A 4HTIA 1QSLA 4W92B 2WSEC 1J5EJ 3W63A 4EU0A 2DIUA 1EKRA 1R0BG 1XN9A 4UOFA 1I6JA 2DISA 4U96A 3MM6A 4A8MP 4OI6A 2XSJA 4BCAA 4OYOA 3G9CA 4G1QB 1S0VA 3VAFA 5LSOA 3EJMA 3GR1A 4IDKB 1NPRA 3WIVA 1NBEB 3I0RA 4B3RF 1RTJA 2DBBA 1N36J 2YNGA 2YKPA 1WC6A 5C2CA 4ELVA 2VA2A 1X4DA 4NX9A 3ZZYA 1KEKA 1MLAA 2VOOA 1XR6A 1E6VB 4X4VA 3HFVA 1YJUA 3QT8A 1UFKA 1JJ4A 5BYRA 1YDLA 1NUEA 1UL3A 3QFHA 1XR7A 2EKNA 2LLZA 4YB6A 3I9ZA 4PR6A 1RK8A 1FHTA 4C2MA 2XYPB 1TK0A 2YKNB 4Q45A 4TU7A 1WNEA 1KKHA 1KC8T 3OVAA 1HIYA 4FN5A 4JUZA 3CD6S 2L9DA 4ITSA 1V9OA 2CPHA 3RRGA 1OQ6A 3PJXA 2W7OA 2NREA 2V63A 3U02A 1FJCA 4CO4A 2G1HA 2DHAA 5HQMA 3UQSA 1FRLA 3DU6A 2VG7A 2ZBCA 5KFFA 1TL7A 3UVJB 4ZVUB 2V2ZA 5KFNA 4ZP7A 4YUDA 2L48A 3W7BA 2PO4A 2HHVA 1FA0A 3CPWR 3PYEA 3FJ2A 2E1MC 3GLJA 5HMYA 3M9OB 2BJ8A 1SC1B 2E5LF 1K0TA 2GIRA 1C2PA 1SH0A 3ENAA 3W5XA 3GP9A 4OMFG 4HI2A 4KGMA 3ADAC 4OX8A 3GONA 4RNHA 2KL8A 4H4MA 4XAKA 4FNHA 2B9EA 1F5AA 2KTQA 2QMWA 1P6TA 4U6PA 3CCES 3MUMP 4E8UA 5C7PA 2DR7A 3OJSA 2DXDA 5KG2A 4C9DA 4P74A 2LQ8A 5FLXY 2PI5A 3GYNA 3BH7B 3DMJB 3Q8VA 4LMZA 1HBNA 1X0PA 4TN2A 2VICA 2OP5A 3TAPA 4OL8A 4A8QA 2HHUA 1FEEA 4C8LA 2VOPA 1FXLA 2NS1B 2J6SA 3HHLA 3GSDA 2RRAA 5KAKA 2VFSA 1KOOA 2R7VA 4Q7AA 5IFMA 2AGPA 2J9DE 2JH3A 2P6SA 2WONB 4HACB 4GVBA 4XIUA 3IRXA 2XY7A 5G0RA 1R8CA 4P7VA 4WWSA 1Q95G 5C42B 1T11A 3BBBA 2HQGA 3HHKA 4USHA 2OTJS 3OR1A 1S48A 2NPIA 4DV1J 4OJ3A 3AA9A 1KOHA 3TVYA 4IRDA 1RAFB 4IQXA 1IKYB 5D78A 3CVKA 3MMCB 1KQGB 4UTGA 4HEA9 4YQWA 5J2NB 3HJFA 2MY8A 2VKRA 3W2WA 2J0SD 4WE1A 4Y2CA 3GFXA 4P72A 3VAJA 2CJKA 1IM6A 4PG8A 5DETA
chains in the Genus database with same CATH topology
5GAEI 2C28A 4QWCA 1N4LA 1R27B 1AFIA 4RX6A 2ZH1A 3CD5A 2JEJA 3CUNA 1JXEA 2FVPA 2QA2A 1C0UA 3CDEA 1DFDA 5E3AA 1WI8A 5KG1A 3UWTA 3BGUA 2QO3A 1P1LA 3M2RA 1SV5A 2MZRA 1YSJA 3C6TA 4I6YA 1KFSA 1VMBA 4DPOA 2KHDA 1IM4A 3G8SA 2R7OA 1JLBA 1LQ9A 3UR3C 2RS2A 1VQNS 1NK0A 4D3HA 1U6BA 1X4BA 1SQEA 2FVRA 2KFYA 2OFGX 1CQMA 2XMUA 2FJXA 5JJBA 4X4PA 2QMXA 1G7CB 5KG0A 3Q23A 4ECTA 3DLJA 2OJ3A 4X64F 1KSPA 1H7WA 2WW8A 2YKAA 4NCGA 3I4HX 1F5CA 2FIUA 5K8NA 3BO4A 4WXOA 3I56S 3RW6A 3X1LB 3M8SA 1XWLA 2XS7A 3KOAA 3PFOA 1HHSA 1OSDA 3NKYA 1UETA 3T1HF 1UWBA 2LU2A 3JAMY 4M5DB 5LL6d 2LKZA 5CXTA 2AWZA 4M63A 2HLTA 4XDDA 1TL3B 3PO5A 4C8YA 4OQJA 1L3SA 3FMWA 2DPIA 4A8SA 3V6DA 1ZH5A 3N5BA 3LP2A 1NJWA 1S1UA 3K0JA 3CJ4A 3KWMA 1S9EB 2DB1A 3C6UA 1JLAB 3CCTA 1J5EF 2YWEA 4QIEA 1IBMF 3J7ZT 2DH9A 4PQAA 2LEPA 2XGPA 3DRPB 1FKAF 3DYAB 3MOJB 2V5HG 2AX1A 3IR7B 3NCRA 3T5LA 3UI3A 2JJ4D 5BYQA 4B3TF 1C4CA 1T95A 5BJRA 1ZYQA 3BQ2A 2MKSA 2AF6A 3H5YA 2R8KA 4CH1A 3IN5A 1D3WA 4B3OB 3G6XA 3RB3A 3P6YC 4YB5A 5A8RA 2CPDA 5KFLA 1SBRA 3DCAA 5EWGA 5BYSA 4EYHB 1S6OA 2NUHA 4IFVB 3UE2A 4RZRA 3H2LA 4CO5A 3MR3A 2HS3A 4A47A 1FRXA 3FFIA 4FNIA 1N0UA 1D9DA 3HVWA 3L3CA 2KT5A 3AJ2A 3Q2TC 4NOHA 2ZZMA 3S7RA 1FRHA 1TL5A 2ZZNA 2XI3A 2I1RA 3EGWB 1TKXA 3FEXB 3G8QA 2W7PA 2DCLA 5F8HA 3BQ1A 2DNKA 5DM7Q 1KNZA 3PW2A 4FF1A 5J2PA 2Y1IA 1N36F 1IJFB 2KI2A 3D28A 2HNYA 2YNFB 3SCJE 1FF2A 2LXFA 3HI9A 1HQUA 4LSNB 4GC6A 1LOUA 5J2QB 4ECYA 1B0VA 4LF5F 3QMQA 3KLFB 2B9YA 2HGMA 1MWYA 2PSZA 4CO2A 2N82B 2R8JA 3OL9A 4YHHF 2RSQA 1SB6A 2I8EA 2C2RA 4IOAQ 5KOXA 2BANA 3R3TA 1XC9A 4JI2F 3KLGB 3BSCA 3MGJA 1K0VA 1ZM9A 3CD0A 3LW5C 2QA1A 3PACA 4C0OC 4I2QB 2ADCA 4Z37A 3RB4A 2JEFA 3V5RA 1ELOA 3CC2S 3CIZA 3MDFA 2LXIA 5L9XA 3NP5A 2VL1A 1UVMA 1KFDA 1IBKF 4C8KA 2BYCA 4AFFA 3I5BA 2E5IA 4RNNA 4QYZJ 3OFGA 3M8RA 2XY6A 3DLLQ 3NS6A 4JI7F 1Y00A 5T7LB 4J9SA 3EGZA 2CPJA 1VQ5S 4AE5A 2HHWA 4KBIA 3TVZA 4EZ9A 1VQSA 2FDNA 1X4FA 2KJWA 3MECB 2I38A 3CC4S 2BM0A 3O8WA 2DNHA 1R8BA 4I4BA 4LJMA 5KT7A 5L9NA 3V4IB 2EFGA 4MJKA 1N0VC 1N88A 3CF5Q 3PRBA 3BSOA 1XMBA 3DLKB 3DOMA 2RF2B 5I4MA 2XEXA 2V8HA 4CTAB 2E9TA 4ERDA 2YWGA 3S1TA 3MUTP 2HHQA 3BGLA 3DM2A 1Z2ZA 5DGAA 3ISNC 3KLEB 3BGRA 4DX8H 3V6HA 4XDCA 2KFZA 1S6UA 2X1AA 4QIGA 4ED5A 3HHLC 4OX6A 2AJQA 1N5TA 2GQ2A 2FC8A 2OPPB 3D54A 2F9DA 2BZ2A 3Q8PB 2VPXB 2IJNA 3GFHA 4TKTA 5GVQA 4ED1A 4DQIA 2HGLA 2JEIA 1KTQA 2IMOA 4GC7A 4DQPA 3PR4A 5KG4A 2L3MA 3CCJS 3F44A 2MKKA 3CD7A 1XBWA 2R9LA 4E0DA 2M9KA 3S8SA 1R3NA 2HWHA 2HG4A 2GCFA 4ED7A 3MR6A 5K9FA 5EDWA 1LW2A 2D9OA 2QZ8A 3CJ0A 5B09A 5F41A 4USIA 2OIHA 3PEJA 3TAMA 2DGUA 3MWBA 1XK8A 4R5PB 4NZ6A 1J5OA 2KTQA 2EFPA 2VUGA 2Q43A 3D1OA 4NLTA 1R8PA 2XI2A 2JHEA 1QAYA 1JLCA 3US5A 3BN4A 4J5OA 4O3OA 4JYAF 4KV8B 4JI5F 3HKZD 4KB7A 1XNRF 4ZCIA 3CCQS 2JWNA 4WZQA 1JLQA 2HPUA 1X4EA 4LVNP 3MEDB 4KPYA 2FUG9 3QLHA 2CPEA 3KHRA 2B5JA 3QGHA 4GKKF 3FSXA 1MMDA 2AJ1A 3SSSA 1JIHA 4NL5A 4NRUA 3AHPA 2HWTA 3DXSX 4BWMA 3RRKA 4ZMMA 4HDHA 4Q5VA 3FSIA 2VFTA 1VQPS 1U1PA 5HBMA 3IR5B 4IYQA 4C3KA 5H9FJ 1N5VA 1YG0A 5KFJA 5SZTA 1RT7B 5KG3A 2ZJQQ 1FK9A 4ZVHA 2D3OR 4F3MA 3D0IE 2D74B 3OXLA 2OAUA 3POTA 4O3QA 1X9MA 1NK5A 1YGYA 2ZITA 4X4TA 2KZZA 1VRTA 3OL6A 4HT7A 2Q1LA 2DPJA 1VQKS 1H7XA 1DJ0A 2Q66A 4NLUA 4NA1A 4PCQA 4QIFA 2EC0A 1DTTA 2RT3A 5IQQA 4PG6A 1G2EA 1VRUB 3KMQA 4JI4F 5HMXA 1UVJA 4LSLB 1RAJA 2DGXA 3LP0A 2CIMA 4UUWA 3QAEA 1H2VZ 1S1VA 1ZAXA 2SXLA 5IM0A 1N5YB 3NG8A 3MM8B 1YTYA 2I5JB 3FMBA 3VQSA 1RKJA 3UCGA 2KJVA 3HLUA 4CI0B 4QWAA 4QCLA 4AXIA 1RJJA 2RU9A 4KHMA 1VQYA 4WKYA 2A2CA 3GIIA 2RH3A 2GMHA 4O4GA 5EX3A 3PO4A 5J2MA 3PX0A 1MW7A 3OFHA 1NH8A 1XERA 4NXNF 1HNZF 3JSBA 4A8FA 3PV8A 2PN6A 3R5AA 3VAGA 3QJLA 2QT7A 4Y6IA 2V4RA 2JFKA 5CH7B 2HGNA 4IG0B 1S1WB 1U4BA 2J6UA 2K7JA 2ZDOA 5IWAF 1NHUA 4B08A 1FVSA 4IG3B 2HAIA 2M7SA 1WELA 3UR0A 3E01B 1IKXB 3V4MA 2OD6A 2AU0A 3DOKB 3GFZA 3BEGB 3B82A 1BQNB 4G1IA 4X84A 5KFPA 4NCAA 1TFWA 5A8KA 1U1KA 3FSYA 4IFYA 2P6TA 1HPZB 4HHJA 4QPTA 5LSRA 2A2DA 4QU6A 1HARA 2OSRA 3G71S 1NEEA 4RUCA 1NH7A 5A0YA 3QJPA 1HWJA 3LANA 4C8NA 3CJKA 1RT4B 3B8HA 4FXWA 3IC1A 3QJJA 2RILA 4DQQA 3NCQA 1LK7A 2ROGA 5K8OA 2XMJA 3KK1B 3Q24A 3MMAA 1RISA 1TL1B 3LO3A 3TO8A 4WK1A 1R8AA 1NHVA 1SUQB 3H8YA 3TA0A 4KKOB 4WFZA 1HQEB 4ZCMA 4CIOA 3JTOA 4OI1A 2BDPA 2AW0A 4CO0A 2DO4A 3O2IA 2NPFA 1WTFA 4U7UK 2DJWA 1QM9A 4AXJA 4ETZA 2LVWA 4RW9B 2OH2A 3HP6A 3EZ5A 2JLGA 1R6YA 5A8WA 1VQLS 5I3QA 3GZ7A 1GH8A 1BQMA 5JVHQ 4DL6A 3J7YU 1LW0B 4B9MA 3BR9A 3MTJA 5A6PA 3N6LA 3CCMS 2AQ4A 5C25B 4Y2IA 3MM9B 4IOBA 4ZVEA 2VFRA 2D1CA 1Y9OA 4CT8A 1GAOA 4I64A 1YJVA 4CNZA 3M8QA 1TKZA 3T1AA 1KTVA 2XGQA 2ASYA 2JSXA 4ID5A 3TRGA 4DL7A 4EUVA 3U1MA 5FDLB 2C2DA 4DV1F 3NBPA 3Q8QB 2K3KA 4OHZA 1T8EA 2ABYA 2FPHX 3OSPA 4ZCKA 4X62F 3SFUA 4R25A 1FE0A