2LXUA

Solution nmr structure of the eukaryotic rna recognition motif, rrm1, from the heterogeneous nuclear ribonucleoprotein h from homo sapiens, northeast structural genomics consortium (nesg) target hr8614a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
SHMGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of the eukaryotic RNA recognition motif, RRM1, from the heterogeneous nuclear ribonucleoprotein H from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8614A
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein H
total genus 22
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lxuA01
3THTA 2DIUA 2MZJA 1HD1A 3G6ES 1VC0A 4OZ1A 3B4MA 3K0JA 2RUGA 2DO0A 2XNRA 4WFAQ 4J5OA 2MZSA 1SJ4P 2DHSA 1YHQS 3MDFA 2MGZB 2DH9A 2DISA 1VQOS 1WTBA 3VAIA 3VALA 2JVRA 1WF2A 5DM6Q 2HVZA 2NLWA 3P49B 3EGNA 2M2BA 2XB2D 2HGMA 3DXBA 2RS8A 4ERDA 2O3DA 3P6YC 3MD3A 2BZ2A 2MKHA 2CQGA 1VQ4S 1XN9A 2DO4A 3G8SA 4IO9Q 3CTRA 1AUDA 3HHNB 5HL7Q 2MMYA 2AYEA 1M5VC 1A9NB 1QVFR 1P1TA 1M5OC 2NZ4A 3CD6S 5GAEU 1Q82T 3TP2A 1WWHA 1S79A 3G9CA 3Q2SC 3SXLA 2N3LA 4FXWA 4QU6A 2G1DA 1U1KA 5D78A 1OPIA 3CC2S 2DNKA 2E5IA 1YTYA 1DBDA 4WCEQ 2CPEA 4M5DB 1X5PA 3NS5A 1QVGR 2AYMA 3NMRA 2RRBA 3TO8A 2MZ1A 3EX7B 1U6FA 2F3JA 4WF9Q 3VAGA 2I38A 3UE2A 4U67Q 2MYFA 1U6BA 2EVZA 1D8ZA 1R8PA 4C0OC 3UCUP 3MUVP 3CC4S 1WF0A 1PO6A 3CCRS 1KQSR 3MURP 2LQ5A 1JJ4A 2HZCA 2YH1A 2CPIA 2M8DB 2KFYA 4YOEA 2CPZA 2CQ4A 2KYXA 2MQNA 2Q79A 1H2TZ 4WFNQ 2YKAA 4W92B 3NNAA 1X4FA 3HI9A 5LJ3Y 1HA1A 1X4HA 2YWKA 3IWNC 1IQTA 2DNGA 2LKZA 2E5HA 4TU9A 2CQ1A 2A3JA 2KH9A 1UFWA 3G96A 5FJ4A 4QPTA 2D9PA 3H2VE 1M5PC 3CCMS 2ERRA 1WG1A 5CYJA 2VOPA 2MKJA 2DNHA 1DRZA 3G4SS 1RKJA 4PRFA 1H2UX 1U1PA 3CMAS 1FT8A 1D9AA 1WHYA 3MD1A 2M70A 2DGXA 3CCVS 4F02A 2OSRA 2LMIA 3BO2A 4BS2A 2KT5A 1Q7YT 1VQ5S 1VQ8S 4QQBA 2CQIA 1X4DA 1JJ2R 4W90B 4Z2XA 2RQ4A 1G2EA 4ED5A 2MHNA 1F9FA 2KU7A 2HGNA 2DNRA 2MJUA 1WEYA 2AYGA 1X5SA 4WIIA 1M5KC 3VAMA 3H2UB 1HD0A 4RU2A 3PIPQ 2L08A 1FJ7A 5IM0A 1W2BR 3CCJS 5EN1A 5BJRA 3CCES 2FPHX 1YJNS 2F9DA 2CPFA 3SDEB 2CQDA 5HO4A 4PKDB 2MQMA 2KXFA 2XS2A 2DHAA 2MGZA 3CF5Q 1NU4A 1Q86T 2CQ2A 1CVJA 2MZRA 1S72S 2J0SD 5GADU 2DGSA 2QFJA 3THPA 3RW6A 1U2FA 2DIVA 2CPYA 3MOJB 3JB9k 1M90T 2LA4A 3MI7X 2ADBA 2VODA 2MQLA 1N88A 5CXTA 2KXNB 1VQ6S 1WG4A 2ADCA 1NJIT 3EGZA 3U1LA 1VQKS 2LA6A 3P3DA 1WEZA 2LECA 2RS2A 2E5JA 2LEAA 1DZ5A 1UW4A 3LQVA 2V94A 3I56S 5DDOC 2D3OR 2MSSA 4YB1P 2DH7A 3V4MA 3MUTP 2LXIA 1R8HA 2MKIA 3CMES 5MLCV 5IM0B 3ZZZA 2GHPA 4OZ0A 1SJRA 2RT3A 1WHWA 2KVIA 2MY8A 2JRSA 2CQHA 3R27A 1X4AA 1Q81T 3BO4A 2J76E 2DH8A 1UAWA 4EGLA 1VBZA 3NNHA 3CCQS 3RW7A 3I55S 1U1QA 2CQ3A 2U2FA 1KOHA 2DHXA 5H1SV 2KRRA 2RU3A 1YJ9S 2CQCA 3US5A 1SJFA 1FO1A 2G0CA 3PIOQ 4IOCQ 1U1MA 4TU8A 4TU7A 3R1HA 4C7QA 2MY7A 2M4MA 2MKCA 1X4EA 4YUDA 5LSOA 2GO9A 5D77A 2JWNA 1X5TA 5CA5A 3DLLQ 2DNPA 2CPJA 2DGWA 2DNOA 2XSFA 3CCUS 1P27B 2LCWA 3SDEA 2ZJRQ 1FXLA 3UD4P 4ZKAA 2QEXS 4A8XA 2JVOA 1OO0B 1O0PA 2KI2A 4F25A 2B0GA 2DB1A 1BY9A 3G71S 4LMZA 2DK2A 1VQPS 1FJCA 5DM7Q 5DDQC 2FHOB 2MQPA 1UP1A 2DNQA 4QU7A 1U1OA 2M9KA 3VAKA 2MPUA 3CC7S 1JMTA 2DNNA 2CPXA 3SMZA 4C4WA 2OSQA 1VC5A 2KRBA 1L3KA 1KC8T 2MZQA 2X1BA 2M8HA 2DNZA 3VF0B 4F26A 3B4DA 2DNYA 5IQQA 2VOOA 1YWXA 5JVGQ 2F9JA 1WELA 3S6EA 3BEGB 1K8AT 2M0GB 2L41A 3BS9A 4LJMA 2X1GA 2MQOA 3UCGA 2FC9A 2ZJQQ 1VQNS 1N52B 4CH0S 1ZZFA 3FEYB 4Y0FA 2KXHA 2X1AA 1WI6A 1RK8A 3VAFA 2L9WA 2RRAA 1DHMA 2EK1A 1VBXA 5LXRA 2U1AA 2N82B 1OIAA 2RNEA 3CCLS 3NNCA 2MSTA 3G8TA 2M7SA 3CPWR 2FC8A 3UCZP 2BOPA 2VONA 2LEBA 4IOAQ 1VQMS 3OW2R 2ZJPQ 5LJ5Y 1YJWS 2KG1A 3CUNA 1X5OA 1JJHA 2G4BA 2CQPA 3BO3A 2XNQA 1FJEB 3MXHP 1H2VZ 3S8SA 1N8RT 2KG0A 2PE8A 4Y00A 5DDRC 2CPDA 2XS7A 3L3CA 2DITA 1URNA 1YITS 1B7FA 1WEXA 2SXLA 2DGOA 1HL6A 3CXCR 3VAHA 4WKRA 2DNMA 4P6QA 3J7YU 1YIJS 1KOOA 2J0QD 1WHXA 2DHGA 1FHTA 1M1KT 1NO8A 2KM8B 2DNLA 2LYVA 4PR6A 4WFBQ 1U1LA 1VQ7S 1VQLS 2RVJA 2QA4S 2KN4A 3Q2TC 2K3KA 5ITHA 2M88A 2KHCA 2MXYA 1ZZNA 2M52A 2CPHA 3ULHA 2CJKA 3CULA 3R1LA 1K9MT 2DGTA 2K8GA 1U1NA 2E44A 2CQBA 1VBYA 3TYTA 5DETA 3CCSS 5GAGU 1WHVA 1YI2S 1SXLA 2N3OA 2X1FA 2CQ0A 2WBRA 2MKKA 1U1RA 2DGUA 2AD9A 5GVQA 5IFMA 5LSLA 4LIRA 2HYIB 1VC6A 2DGVA 1SJ3P 3UD3P 2JX2A 3S01A 5DDPC 2MKSA 1WG5A 4FXVA 2OTJS 1PGZA 2OTLS 2XS5A 3D2WA 2EK6A 1K73T 2I2YA 3ZZYA 2FY1A 1N54B 5LXYA 1VQ9S 2N7CA 4V19X 4UY8T 1WF1A 2MQQA 1X4BA 5GAHU 2MZTA 2DGQA 3J7ZT 2LXUA 1KD1T 2PEHA 2AYBA 1QM9A 2OIHA 4IUFA 5GMKa 3N9UC 5JVHQ 2RQCA 3U1MA 4CQ1A 2J8AA 1WI8A 3VAJA 2OJ3A 3FEXB 3IRWP 1ZH5A 2YTCA 1OWXA 1FNXH 3UWTA 1X0FA 1H6KX 2HGLA 2MJNA 4UQTA 2E5GA 4CIOA 3MUMP 2D9OA 4TLQA 4CH1A 1A7GE 3S7RA 2KM8C 3LPYA 2UP1A 2MB0B 2YH0A 3NS6A 3P5TL 1X4GA 1SJQA 1X4CA
chains in the Genus database with same CATH superfamily
3MHYA 4ALZA 5B0FA 2JFKA 2ZEJA 3PKYA 4OHVA 5JMNA 4K4TA 4RW9B 4LVOP 2VQFF 1U7LA 1VJQA 4Y28C 2DCUB 4X4SA 2F5GA 2HHHF 2QLBB 1MMDA 2DO0A 1HBMA 1X7VA 4OV1A 3DLEA 4J5OA 1S10A 2E9TA 3DM2A 4QPXA 2E29A 5I3UB 4DV5J 1SJ4P 2YQ0A 3MDFA 4CO4A 2ZC4A 1NK7A 4RBVA 3KJQB 4ZK7M 3VALA 3OLBA 4DPWA 4UUWA 3QRQA 4CYUB 1WNEA 3N6LA 2NLWA 1ZAWA 2R2TA 1S76D 1RP5A 3ZZ0A 4LFBJ 1TKTB 1I94F 3H0PA 3EVMA 2VB6A 4Q2LA 3G6XA 3AXMA 4QYRA 5LOQA 1KSPA 4JI4J 4DR4J 2HHWA 1IWAA 3BKUA 1ROFA 3GJQB 1VOMA 4JOUA 4DSLA 3CDUA 1IR1A 3MD3A 1HHTP 4NCAA 2OHDA 2MKHA 2H1YA 2C1EB 3TI0A 2P9GA 4DEZA 4DN0A 3SYZA 1XN9A 5F8LA 3P4UB 2AGQA 3B6BA 4X64F 4C8ZA 2VUGA 1R6YA 2BM1A 2HS0A 3FMBA 3GLJA 4TY8B 3QT8A 3SSQA 3I6PA 1A9NB 4JP8A 4U8YA 3AODA 3Q86A 1Q7LB 2HSEB 4M5MA 2F4VF 3U27A 3NMAA 2O5DA 8RUCA 3KJVB 5GAEU 4OYZA 2VJVA 3HSZA 2B9XA 1Q82T 1YJRA 2A1BA 4CWBA 3GSIA 2NUHA 3EE3A 1WWHA 1S79A 3GYNA 3KKFA 4MIWA 3TA1A 3TEHB 2YXLA 2EBEA 3Q2SC 4DV5F 4ICLB 3NY0A 2O67A 3LP1A 4EU0A 4A8YA 1GTEA 4FXWA 4UOFA 3TAMB 4YP3A 3TA0A 3W1YC 4ZVFA 2VG5A 5KFQA 4V1Ak 2DNKA 2E5IA 1IBMJ 2QLJB 2DJWA 3GWCA 2FZKB 3RAXA 4X4RA 2UVRA 4YHHJ 4B3TJ 3C15A 3EGVA 4YEAA 2PA8D 4LSLB 2W2PP 2QMUB 4Q7AA 1S6PA 4NLRA 2CA9A 3IG1A 3GG0A 3OR1A 2MZ1A 1IBMF 4Q43A 3EX7B 1U6FA 2F3JA 5F9LA 3HHLB 1U6BA 2MYFA 3OFGA 2EVZA 1D8ZA 4CLWA 4E8UA 2R8HA 4C0OC 3UCUP 3UDEA 3MR3A 1U2CA 1KDNA 1RDRA 1RGVA 4LF4F 2QYGA 2W7OA 2CRLA 4YY3F 2RRNA 2ZNZA 4B02A 3AJ2A 2VL1A 3HFVA 3QT5A 1S1UA 2XWYA 2ZH2A 1TMJA 3BGFA 2B4OA 3PYDA 3MURP 4JV5J 2IHR1 2W1BA 3MPDA 4EO6A 4LRAA 3M9MB 2YH1A 1HNXF 4A47A 5JJBA 1HLWA 3A1YG 2J9DE 1Z4UA 4HHUA 3OV7A 3R6GB 2MQNA 1C0UA 4W92B 4IOBA 2GS8A 2E5LF 4NZ0A 3HI9A 5DZ7A 4YR2A 1RT1A 2J5AA 5LJ3Y 4ITSA 2HBQB 3ELHA 3KK2A 1LOUA 5G4DA 1TP7A 5KG6A 2EWHA 2YPZA 4I7FB 2ZBRA 4MAKA 4O44A 4RW8B 2D3ZA 5D4OA 2CQ1A 4DUZF 1JLBB 3A12A 4TY9A 1IKWA 2WONB 4LVNP 2FVQA 1X9MA 4DCPB 5FJ4A 4USUA 5JUMA 3AJ1A 3H2VE 2ERRA 1X8DA 2LXFA 3IO1A 5G0RA 2QE5A 3K7RA 1WC4A 3MM6B 2VOPA 2MKJA 1IWGA 5D6GA 1TKZB 3W9IA 1H0HB 3CNQP 3TUPA 1N34F 3TJAA 5BR8J 1DJ0A 4MT1A 2XCPA 3WIUA 1U1PA 3ZTQA 1F3FA 1JQGA 4DX6A 2HLUA 5DJBA 2HHVA 3QSIA 1WHYA 2W8LA 1FFGB 2V5HG 3V6DB 2DGXA 5F8NA 1PSDA 1R27B 1NNDA 1YZ6A 2BE9B 2KT5A 4F67A 4KSEB 1RAFB 1FA0A 3QATA 5A8RB 2NSBA 2R4FA 1RWPB 1RHRB 1FK9B 3I9V9 5C25A 1VQ8S 1XMOJ 4LF8F 5GADI 4GKKJ 3KG1A 2NPFA 3I96A 1HR0F 1QUVA 1RT7A 2Q6BA 4DOZA 4F0MA 2FLNA 3DI6A 5ETSA 1OYEA 3A4TA 4RX6A 1KHWA 4LQ9A 5SZTA 1T11A 2B7CB 2ZZNA 2HHTA 2R7VA 2RE1A 2VPXB 2MJUA 3M8WA 2KVQE 4LFCJ 3WDOA 4GKKF 1X5SA 1ZTTA 1L3UA 1M5KC 3WQPA 4R25A 5K9FA 3VVTA 3MECA 3RZAA 1OSDA 3W9JA 2QA4G 3TANA 1NSPA 3IRXA 4M5KA 3N5BA 5B7WA 3M2VB 2HBYB 5KT4A 1KR4A 4WK1A 3FDSA 1TL4A 1CJKB 1XR5A 1QUPA 2I0XA 4R8UB 3KLVA 2DVIA 3CCES 3HVRA 4Z7YA 1SBRA 1HQUB 2F9DA 1IXKA 2CPFA 3SDEB 4R0JA 5HO4A 1QLNA 2C2ZB 1S6PB 2GIFA 2GGPB 1S97A 1Q86T 1S9EA 2HRYA 1UEVA 1HWKA 3QO9A 3V81B 2HFUA 5GADU 2HMIB 2DGSA 3FCVA 2QFJA 3NG8A 2CFXA 4LSNB 1CJVB 3ETOA 1MN7A 2CPYA 3BBCA 5KFRA 3VCDA 2AQ4A 1M1HA 4GVLA 4ZHRB 1UFKA 3MI7X 1Q8IA 3AOBA 3EPIA 1N5QA 2IYGA 1HPZB 2WVEA 3BGLA 3PYGA 3D5MA 4DBQA 3OLAA 3DOMB 2ILYA 4AL7A 1NMEB 2HS3A 2RQKA 3BH7B 3V4IA 3R2DJ 3EZUA 4YHHF 3NL0A 5HP1B 3KLFB 1VQKS 2LA6A 3P3DA 1WEZA 2CZ9A 1SH0A 4JI6F 2PMHA 3DHXA 4QR2A 5J1EA 5KOWA 1M0SA 3MPUB 4LRDA 5ADZA 1IJEB 5KFDA 2WAQD 2E5JA 2LEAA 2YNFA 1V3SA 3L95X 3LQVA 3O1LA 3OTBA 2PN6A 5KG3A 3TX0A 3W65A 5EWGA 3I56S 3AQPA 4PABA 1KN6A 5DDOC 2D3OR 1JXLA 2XSJA 3M6WA 2DH7A 3CJTA 3CW2C 4ZOSA 2IY5B 2J6SA 2LXIA 2VG6A 2W2OP 1TKZA 1EQMA 3W5XA 3KLGA 3HVAA 1FEEA 4USJC 2DR7A 3ZZZA 4K4XA 5EN1A 1OS5A 4LRFA 3IGVA 1HQUA 3UN3A 4DUYF 3R27A 3GV8B 1BQXA 1RT2B 1L3TA 2GJFA 4ETZA 4NI2B 1SKWA 4WWSA 1X60A 4K4SA 2H5JB 4RNOA 4X4QA 5KFJA 4C8NA 3P5BP 4QIVA 1KTVA 3KMQA 3ET6B 2ZDOA 3I55S 1UVJA 2CQ3A 3DRXA 1FWLA 2VHGA 2GMLA 4M5IA 3LW5C 2W24A 2GHWA 5BXIA 1Y9OA 1Z1ZA 2FJXA 3ADAC 1QSLA 3R7SB 4KKOA 1S59A 3TARA 2CQCA 1MWQA 1YRTA 3PACA 5EX3A 1Y4ZB 3US5A 2WOMB 1ZTWA 1FO1A 3D1QA 3FGVA 4K5SA 3RG6A 2HVDA 1ICEB 2VC1A 3PIOQ 1RT5B 1JLEB 2LQJA 4QBUA 4EMDA 5K8PA 1WD6A 4J9PA 4U7UD 1NBEB 2BANB 2NYIA 3QQCD 4YUDA 1VISA 5ETLA 4RO0A 1D1UA 4NA2A 1TL3A 3UDCA 1DARA 5E3AA 4NLQA 2C2MB 2DPIA 2CPJA 2DGWA 2DNOA 3LAMA 1HFEL 4USTA 3JSMB 4LQ3A 3D6MB 4K4YA 4H4OB 4HDGA 1EIYB 3H40A 3ENWA 1ZM3A 1OO0B 1NHVA 4NXNJ 2ZD1B 2EEYA 3RAMA 4F25A 3LO3A 4Y2AA 5KFVA 5ETNA 3OTOF 2DB1A 3WHIA 1TKXB 3HK2A 1RHUB 4ZVEA 4K0KF 7AT1B 1NK0A 2V0NA 3AA9A 1S0VA 2IRYA 4HI1A 3OL7A 4P2XA 4OMFG 5DQGA 3QIPB 1X9WA 3MAQA 2DNQA 1GMWA 1ZPWX 4K2XA 3ZTPA 3K59A 2Z57B 1N33J 1VQSA 1HW8A 1REVA 5A76A 2MPUA 3VAKA 2IM2A 4UW2A 2MHEA 4KQZA 5KFWA 5J2MA 3PVXA 2PDAA 3I5BA 2LVWA 3BGOP 3BSNA 3CC7S 1BXNA 2DNNA 2G9OA 2XLIA 3LWMA 2UV8G 1N33F 3PG9A 4ZCIA 1RSCA 4ED6A 5ETTA 4B9VA 1VR6A 3UPFA 4PQUA 1SVDA 1HBMB 1JKHB 2RDIA 2VFSA 2QA1A 3FBEA 3M1VA 3Q83A 1T9WA 3NBPB 1VC5A 1KC8T 4ENOA 4ZCLA 2FD2A 2MZQA 1RBOB 1QE1A 2CG8A 3D4JA 2M8HA 1NK8A 3E51A 4D3HA 5KFKA 1AFJA 2RILA 3MM8A 1TR0A 5D0GA 3B4DA 3R5DA 2KFNA 2FQQB 3LANA 5IQQA 2RSQA 2V67A 2VOOA 5HQ8A 5MAOA 4QWAA 5JVGQ 4FYVB 1VK8A 2JL9A 3CD7A 3FBBA 3BEGB 3I0RA 4FKYA 1AUSL 3S6EA 1B0TA 3DDKA 1YSJA 3KLGB 3EXYA 2Q66A 4LJMA 4YB5A 5AXNA 2MQOA 4DSIA 3C66A 3WX8A 2UVUA 2FC9A 1VQNS 3AAWB 3MPWA 2HBRB 4FNHA 1RTJA 4MKBA 2HHXA 2N4CA 2RDDA 4NLOA 3D3CJ 1MWYA 4Y0FA 4OX8A 3GJSB 3MPYA 1J5EF 1ZETA 2QSFA 2RRAA 1VBXA 3QRPA 4CYUA 5LXRA 2DYAA 1PBUA 3DLEB 4RR5A 2GO8A 1FCAA 4CH7A 4X65J 4OI0A 3UN5A 2RNEA 3CJ5A 3GFZA 3NOCA 2ZHOA 4X4UA 2MSTA 4CM0A 1XR7A 5CCMA 2W9BA 3HHKA 4KKOB 2XYGB 4PG4A 4XTTA 2RAQA 4N47A 3W8GA 4DCJB 1LV5A 5LT5A 4IOAQ 1VQMS 3OW2R 1DLOA 6FDRA 3L4BC 5LJ5Y 4RUBA 6AT1B 5DG7A 1YJWS 4W98A 2HURA 2L9NA 4FN5A 2L48A 2CZVC 2V6AA 2FB0A 3TA2A 3CUNA 2FDNA 4H4KA 3ZNJ1 4EO8A 4DR3F 1RT4B 2G13A 1AT1B 2BDPA 4I6WA 2BJDA 2XNQA 4PPDA 1H2VZ 1HNZJ 3OL8A 3OVAA 2RQMA 2HFZA 2JSXA 3L9ZA 4TY8A 2EC0A 1RADB 2F8EX 3BQ0A 3TZZA 1JLFB 3KNGA 3L7UA 3QLHA 3TJ9A 2DITA 3HX9A 4LFCF 1RAGB 3MCMA 2AHOB 1B7FA 4OZ2A 1TKXA 1IBCB 1KS2A 2ZITA 3TVKA 4YMEA 2PMWA 4TYAA 2WK4A 2ZOGA 5HI7A 2EC2A 3THVA 3AB4B 4QR1A 3D7SB 4IR9A 1P1LA 1LFWA 2LLZA 1SKSA 3LP0A 1KOOA 1SB6A 4OJHA 1S9FA 2F8MA 3R5JB 1URRA 3QFHA 1SUQA 2NREA 1F0XA 4DCOB 2IM1A 1F5AA 3EZOA 2CDRB 4AXIA 4WFYA 1WC5A 2DNLA 3GSDA 4MKVA 1RWOB 1S99A 3C16A 3BN7A 1VQLS 3IFEA 2Q6CA 2J6TA 4MK7A 4DG1B 1HI8A 4PQUB 2QA4S 2UXDF 3Q2TC 1UKUA 2VG7A 3I32A 1KFDA 4ZCKA 3NGDA 1UVIA 5ITHA 3QJPA 3M9OB 2GV1A 4DV7J 2V8DA 1M5SA 3MM5B 2Z2LA 2GA7A 2QX0A 3A8EA 3D3BJ 1MMNA 4OI3A 1DLOB 3M6XA 3N01A 2YKMB 2DGTA 2RJZA 3NAHA 2DHHA 1H3DA 1VBYA 2GVDB 1U6ZA 2VFUA 1VLOA 4O3OA 5DETA 4J9QA 5AXMA 1S1UB 2H5IB 3E3XA 1R89A 3DCAA 3GFHA 2VBYA 1XNRF 2X1FA 1SJ1A 3HT0A 1T05A 1I5OB 3J80Y 2HIYA 2BKPA 3M8PA 4ANCA 5GVQA 4U95A 2IM3A 5LSLA 3Q8QB 2AD9A 3QLHB 2E9RX 2PT0A 1SJ3P 4TLRA 1UVMA 2UUBF 1W2IA 2JX2A 4UZBA 4NLUA 5DDPC 5F0WA 4DR7F 3M8YA 2AJ4A 1S4FA 2AMCB 3MM9A 2HNYA 3A8IA 5IWAJ 3OJUA 4FXVA 1QDUB 2B6AA 4M5JA 5H9FJ 2H4YB 1U25A 4E2FB 3T5LA 2C42A 3KLIB 4BLGA 1JLBA 1C1BA 1P8GA 1T02A 4EK2A 3NWRA 1IKWB 3JYTB 1MROA 2C3PA 5D3GA 2FJAB 3FRYA 4LF9J 4GRSA 1NPPA 2OPSB 4G1IA 1S1XB 5FDLA 1N54B 3KK2B 5DZ6A 1N36F 3HFKA 2HK2A 2R42A 5L1JA 5J2NA 1GAOA 1VQ9S 1WF1A 4V19X 1KFSA 1I3OB 3CJKA 2WCXA 2DGQA 3BSCA 3W61A 2LXUA 4DV0J 1KD1T 2QT7A 1EETB 4A8MP 1QM9A 2Y1JA 2HWHA 3F44A 4IH6A 3LF0A 3KHHA 4ECVA 5GMKa 2BXJA 3DN9A 1AA1B 3JAMY 4AQYF 1TL7A 1BGXT 3N9UC 5JVHQ 4ANDA 4RU9A 1IKYA 2IJFA 2WVFA 4DR1J 2H51B 4KE5A 3MAAB 4EZ6A 4MKAA 3U1MA 1IBLJ 2AJQA 2RU9A 4DLEA 3ZNUA 4C8YA 3O2IA 1S9EB 1QAJA 4M5DA 1HMVB 1OQ6A 3FVYA 5CYMB 3TEGA 2CVIA 3VAJA 2OJ3A 4USMA 1EAYC 1T05B 3IAS9 5L8RC 5KFCA 1JLCB 2VKRA 3D68A 3I9ZA 2XZDB 5HQLA 4N5SA 4O23A 2QL5B 2HQIA 3CJQA 4WE1B 3PRBA 5AE3A 1FNXH 1HNZF 1HW9A 2COLA 2MJNA 1FXRA 3VQSA 2ZUGA 3UQSA 1BQNB 1FVQA 1YJ7A 2DXFA 2MQ8A 2D9OA 2X7IA 4ECXA 4KTQA 3GILA 3GV7B 4KR0B 4CH1A 1A7GE 3J81Y 1CQNA 1Q8BA 2AJ2A 3HJVA 4J9OA 4W4MA 2AV5A 3I31A 1DAXA 1RTHB 4OJ1A 4X62F 1WOSA 1HWUA 2MB0B 4I67A 3D54A 2C3UA 4I0WA 5A8WB 1GX5A 3PV8A 4J9SA 1TMMA 4KC5A 1DY3A 2AZ3A 4ECTA 4KGVB 2VU5A 1JLGB 2ZFHA 1RAEB 2MZJA 4KBIA 2HHUA 1B64A 1NDKA 1RHJB 2XI2A 4OZ1A 1VC0A 1YBTA 2M5YA 4PCQA 3K0JA 4DF4A 3SI8A 1U45A 1SC4B 1TK0A 2HZVA 2E1RA 2HRTA 2V8VA 2B51A 2E7WA 1IM6A 3HHLC 2R8GA 2F4FA 3R97A 3Q8SB 4QOTA 4YB6A 4PZVA 1FXDA 4OJGA 2XZTB 1WTBA 4DPUA 3QAEA 4OZ3A 1RWUA 3UD5A 4CO5A 4DX5A 3G86A 2E1CA 1Q16B 3F41A 4B3TF 4NA1A 2PI4A 1HWLA 2FJDB 3QRRA 2C28A 2UXBJ 2YWWA 3NOGA 2IAJA 1U09A 4YDDB 4DL2A 1WSRA 3MEEB 4JBCA 3C8YA 3BSOA 3DOLB 1VRQC 4DL3A 4NCBA 3DXBA 2XMUA 1TUVA 4Z7CA 2M3DA 3X1LB 4B3RJ 2YNHB 1T9VA 3P6YC 2J0WA 2UV8A 4NLGA 4CI0B 2HFNA 2ALZA 3H20A 4KV8A 1BQNA 1UZDA 2CQGA 3K17A 3OHAA 4G1QA 2DO4A 3G8SA 3K58A 1EARA 1GXTA 4F4WA 1AUDA 3HHNB 4YB7A 3CWJA 4L74A 4USIA 2QC3A 3V6JA 2HAFA 1FRMA 2OGUA 2VASA 1TAQA 3DRPB 1TL7B 4DFKA 4CLYA 4P73A 3VVUA 4ATNA 3KLEB 2Z56B 2OFHX 1RT2A 3JQJA 1JLGA 3DRYA 1YX2A 3AJDA 3Q8UA 3C14B 4WFXA 3GIKA 2Q3PA 2NSCA 4ZJQA 3K89A 2DR6A 4USHA 2N3LA 2R7WA 1SL1A 3BB5A 5KTQA 4J90A 1S1WA 4HVZA 4YN3B 4C6AA 3B82A 5KG7A 3EXCX 4Q44A 3MR7A 4GC6A 5F8JA 4ELUA 1SKRA 4DU8A 3Q8RB 3NS5A 3TWZA 3EUNA 1Q5VA 3LWLA 2GQ2A 4LF2A 8ATCB 1FKAF 2FLPA 2BQ3A 2KO1A 3O8WA 3D0GE 3VZIA 2A2DA 2OPRA 3BKFA 4WKYA 4HR2A 3VAGA 4X66J 1NAQA 2G0IA 3AD8C 4QWBA 3M1VB 4ZIVA 2WOMA 1WACA 1DTQA 3W2WB 1A0OB 5HLFA 1R8CA 1S1TB 2A6MA 3LH2S 4IFYB 4NOHA 4X4TA 2VQFJ 4K4ZA 4UY85 4H4OA 4OX6A 1S7HA 2RF2A 1D0EA 3DNCA 4CLSA 3U02A 2VV5A 2I6WA 3CCRS 5D8HB 3FMWA 3GIJA 1YG0A 3DRSA 4G1QB 1JJ4A 2CPIA 5ETKA 3VZHA 1FRIA 3OTOJ 1HNWJ 2WSFC 1UWBB 2FHJD 4KRWA 4L73A 2CPZA 3D0IE 3QT7A 4Y2CA 4FS2A 1TFWA 4KHPJ 2AX1A 3H90A 4OI4A 1WSVA 1T03A 2L3MA 2P6TA 4WFNQ 2YKAA 5H9FK 3CJSA 4X4OA 3BREA 1U0SA 5IC6B 3CIMA 4IDKA 3TJ8A 1I51B 3QGHA 1FRKA 2FJBB 1WDDA 1X4HA 1BMQB 2YWKA 3T1AA 2HHPA 5GAEI 3Q0AA 5KFMA 2HHHJ 4OQJA 1CC8A 1RCXB 4M94A 3IWNC 5BYSA 1T8EA 1IQTA 2LKZA 4DPYA 2E5HA 4TU9A 2ZDPA 4DI6A 3A3NB 5C24B 2KZZA 2F7VA 1K1QA 2B5JA 1UFWA 5KFIA 1VRTB 1KRPA 3MMAB 4QPTA 1M5PC 2HIQA 4URGA 3NGRA 2XY6A 4B9LA 1VBKA 4XAKA 3OR2A 4RW4A 1EP4B 4BC9A 1DRZA 4GKJJ 3JTOA 2IDEA 2V68A 1N5VA 3D1HA 3G4SS 3VGVA 4XDDA 1PAUB 1UA1A 4P9SA 1RKJA 4R5PB 2QJ3A 3B78A 3D28A 1FT8A 4A48A 3KLHB 2VJUA 1RT4A 5K8MA 4DR7J 4OZ5A 5M2UA 3W63A 2FZCB 3OFHA 2OPPA 2ZZMA 4C98A 2F1FA 1PC4A 1IBLF 1UJ6A 3MECB 4P71A 4S0MA 2IC3A 3KHRA 2LMIA 3BO2A 1FESA 3LAKA 4OYOA 2HRUA 3AHPA 3M7VA 2D1CA 4RLEA 3H5YA 2QYCA 2EPIA 4GMKA 1FNMA 4NMLA 3J7YI 2JC0A 2OMLA 1U02A 4QWCA 1JLAA 2J9CA 1SCJB 1G2EA 4KHRA 1UWBA 1F9FA 2E7XA 2NYHA 5FLXU 2V8GA 4DQPA 2QLWA 1XNRJ 4QYZJ 4CRJA 2H3EB 4ID8A 1QY7A 2AYGA 2FGCA 4C48A 3HP6A 5EGYA 3UVJA 2W9BB 2BJ8A 1NJXA 2VQEF 3VAMA 2V9WA 4F2SA 1SPBP 4FVCA 4NXMJ 5CQGA 3KOAA 1SL2A 4F4YA 1YRUA 2AP6A 3PIPQ 1XC9A 4I6AA 2VF3A 1NZAA 1G1XA 2YVSA 2VQEJ 2AJ0A 1HIYA 3IBFB 3CCJS 2EG1A 2WB1D 3IXQA 2FPHX 2RD5C 3D6HB 1NPRA 3FFIA 1E6YA 5B0CA 2C22A 4PKDB 3R5GA 3HT3A 2XS2A 2GC8A 2MGZA 3CF5Q 1NU4A 4J37A 1CS4B 2CQ2A 1CVJA 3LP2A 2CNNB 1S72S 4TKTA 3C6UB 4OX9F 2Z30B 1TL1A 2BR0A 3DM2B 1YDLA 3LUYA 2CWXA 2MDAA 5I3UA 1U2FA 2DIVA 1SV5B 1HI0P 1RWMB 1SQEA 3JB9k 2HBZB 3QGGA 2ADBA 1DQ9A 3MM5A 2A0FB 2MQLA 1HBUA 2EXUA 4TXSA 5A8KB 4PG6A 1XMQF 1UVLA 4CO1A 4YFUA 1BD6A 1GEHA 1YGYA 5HVGA 1LW0B 5KFHA 2KXNB 2NXCA 1LWEA 3L09A 3R7BB 3OHBA 5CXTA 1FJGF 1AZSB 4J9VA 1NUEA 1NJIT 2UU9J 3SCJE 4GVBA 3M30B 3QWPA 1NDCA 3AT1B 3RBXA 2WW4A 1UETA 5CYQB 5KFLA 4LSNA 5KFPA 3NRBA 2AGOA 1SL0A 2E5LJ 1T3NA 3BR9A 3B8HA 2FGOA 4LR8A 4PYAA 4DG1A 1WUUA 1X31C 1WJ9A 2NS1B 2LECA 1DZ5A 3GR0A 2K06A 1UW4A 2ZWPA 4OV6A 1LK5A 4DUTA 2J9EA 2OPQB 5DS7A 4QWEA 2MSSA 4JI0F 1ZM4A 1IJFB 3POTB 4YB1P 4IG0A 3V4MA 5DQIA 4DUZJ 1OJ4A 2LDIA 1VHIA 4O4GA 2YWGA 2HK3A 2PO4A 3K5PA 4ZJLA 4EYHB 4A8FA 3DU6A 3QGIA 4DWIA 1W25A 2MKIA 2W25A 5MLCV 5H9EK 3IAM9 4C0BA 2NZCA 4V19J 1U8WA 2GHPA 4ICLA 3RB0A 2KVIA 2MY8A 2AIRB 2JRSA 1N0VC 3W64A 2QL7B 3FFIB 2VG5B 2FHKA 3TZWA 2ATCB 2VH7A 1Q81T 1N6QA 3ITHB 4DS5A 2AZ1A 2CJQA 4QW9A 1OPZA 1UAWA 2VPWB 1P9YA 2DY1A 5D4PA 3CCQS 2BRLA 3RBEA 1OQ3A 2HAIA 1EETA 2KT3A 1BC6A 1KOHA 4F36A 1TFYA 4KJIA 4PWDA 3FRZA 4OYBA 1T9TA 2OEJA 3IWLA 1HNIB 2XBPA 3KK3A 3LALA 3K5LA 2P2CB 2XYPB 3EVWA 1HBUB 1B4SA 4ZA1A 1RAJA 1DQ8A 1GH8A 4QJVA 3A3OB 4NXNF 3J81U 2BQRA 5SUHA 2BKNA 5D3GB 4F8RA 4FDFA 1I1GA 1JLAB 2HWTA 4TU7A 4FF3A 4EBDA 2PC6A 2M4MA 4Q8FA 3MTKA 1T9YA 5IT0A 5A2QY 2HNYB 5LSOA 4NASA 4L3NA 4NRTA 2K1RB 5KFZA 5D77A 2JWNA 3O3LA 2XGQA 2ILZA 2NXJA 2XLJA 2R2SA 4F0HA 3QZ7A 3DLLQ 2VD3A 4YR0A 1XEZA 2WVBA 2IRXA 5A6PA 4K4WA 2ZJRQ 5FDLB 1I6JA 4DR5F 1DURA 1HBNB 2JVOA 3SQOP 1LWCB 2KI2A 1P6TA 4PG5A 4DV4F 3LP2B 2I5JA 3FNNA 1FTCA 3LP1B 4ED4A 5L39A 3H4BA 2ZH9A 1YBAA 3C3LA 2E1PA 3DC2A 2ZH5A 1VQPS 1EZZB 2D3O1 5DM7Q 1FJCA 5J1NA 3IG1B 5RUBA 3CDEA 5DDQC 1F5CA 1WC6A 2C2NA 4CLFA 4DV4J 4DSEA 4LF4J 4HT7A 1TTHB 2MQPA 3CDAA 4IFVA 4QU7A 4OZNA 4RWXA 3QFWA 4LF6J 1RT1B 2V63A 3LGNA 4PWUA 3FSXA 3G6YA 4BWMA 1U1OA 1AW0A 2GQCA 4PYDA 2D3UA 4USWA 4KIAA 1DQAA 3RB6A 3SMZA 3ILLA 2J0XA 2R3VA 3SCKE 1UTAA 1UW9A 1ACMB 4L75A 3J7Z5 1Y3KA 2KRBA 4PWDB 2VICA 1S77D 3CDWA 3HDSA 3I4PA 1IM4A 2L9DA 2X1BA 3GG1A 4HH0A 1RTJB 3GYGA 1U26A 3GZ7A 3M2UB 4X4VA 3Q8YA 4LF7J 4WTOB 3CCZA 4XO0A 1KEKA 1K8AT 4UT4A 1SIWB 1PJ7A 2M0GB 3EJMA 2CVEA 3OFFA 2X1GA 1KLMA 1Q8KA 1YK9A 3FBFA 1JK9B 2WVDA 2P6SA 1GMVA 2ZJQQ 3RTVA 4L72B 4O4GB 2DKOB 1YRXA 2HQ3A 2CG4A 2YQ1A 4I7FA 4O44B 2X1AA 1FD8A 1WI6A 4ZP9A 3VAFA 3CT9A 4KYZA 4ZS6A 3R6LB 4F04B 4MIBA 2GX8A 3W60A 4BCAA 2EK1A 4ETXA 4YS2A 2XQCA 4HACB 3M2VA 2N82B 1HHSA 1HWJA 3C14A 1JX4A 4QCLA 5DG8A 3VTIA 5HMWA 5KT6A 1FD2A 1UWAA 2ASDA 2BOPA 3D1OA 1S1WB 1IKVB 4JI1F 2FJEB 2ZJPQ 4NLWA 1V3RA 3I4HX 4RW6B 1JJHA 2BV3A 3KK3B 3IS9A 2VBWA 1S49A 2QMWA 3DMJA 2VKZG 5IT9Y 2UU9F 3SQGB 1CJVA 2QV6A 1S57A 2BKOA 1H7XA 5F41A 1N8RT 4JI7F 1IQZA 1KQFB 4EBEA 3RBZA 1J2VA 4PPZA 2EFPA 2Y3YA 3WC2A 1CJUA 2CPDA 2XMTA 2HMIA 1URNA 4FVMA 3BGRB 4IFYA 3BPDA 1VJWA 4J9UE 1FERA 3EM1A 3SCLE 3TRGA 1G6BA 4DL4A 3NS7B 5I3PA 1HL6A 1RXOB 5KFUA 2DCLA 4EI2A 4JI6J 1CJKA 4QR0A 3G8QA 4P6QA 2FLLA 2EFGA 3SCIE 4M5HA 3J7YU 2VBXA 4DV7F 1UA0A 4K4VA 3ILJA 2DHGA 1RU2A 1FHTA 2G2ZA 1OY6A 3AB2B 4ECRA 2V4JA 1FRLA 4NLTA 1FKPB 3KLFA 1BHNA 4WFBQ 4QWDA 4PXBA 2AJ1A 1VQ7S 1U1LA 2R7UA 3VR1A 4NLXA 5J1EB 4I68A 4OLOA 1FNOA 3N4WA 5AT1B 3ZTRA 2KHCA 3I0SB 2XMJA 1RTZA 5C24A 3T19A 2CPHA 4EUVA 2BJ1A 1M5HA 1N0UA 2CKWA 2G0JA 3ULHA 3MFHA 2CJKA 4QW8A 1Q78A 2KDOA 2V2KA 5KOXA 1EB0A 2ZKUA 4PAAA 1QTNB 2BX6A 2E44A 5KFXA 2IBOA 3DOKB 3QIDA 2ACMA 4ZHRA 3C16B 3ICLA 2FZGB 1WHVA 4UUXA 1SXLA 3JSYA 4AYBD 4DQRA 3OBIA 3RBDA 1QSYA 3T6JA 4RUHA 1HPZA 4ZVHA 1DTQB 4OYIA 5HAOA 2WBRA 3TUZC 4N7TA 2J7KA 4OHWA 1Y11A 3ENVA 1TKTA 2YNFB 3N6NA 3MFIA 4DR3J 1B70B 2DGVA 3KYLA 1Q53A 3KUHA 2XSJB 3TUIC 5EUHA 1RT3A 4H4MB 2GJIA 2GVDA 3O6QA 4L3KA 2I1RA 2A18A 5IXUA 5FIIA 2W9CA 1PGZA 1T03B 2VA3A 1UVNA 3UO0A 5ETMA 3LOUA 1RT5A 1NJYA 2QTWA 5C5JA 4DR1F 2HPUA 4X84A 2GFFA 4ZN1A 1DFDA 2YKNB 2XY5A 2E7VA 3BBBA 5GAHU 4ZVGA 4IG3B 4NLSA 3AA8A 4EWTA 4P7VA 2DY9A 3ET6A 4F3MA 4YQWA 2AGPA 1IR0A 4ELTA 1SH2A 1V3ZA 2OIHA 5HQMA 1P9QC 2DXEA 1N34J 4IUFA 1RHQB 3E01B 3M4XA 1AFIA 1BWEA 3KG4A 2UUAJ 1XIQA 3FC9A 2HG4A 2AWZA 3CJ3A 5KT5A 2NPIA 4LFAJ 1RKIA 5HN0A 3SFUA 2V8PA 4CO2A 4DZDA 2XMAA 1S1XA 2W4PA 3O5TB 4MIAA 4C8LA 5KFSA 2HFOA 4CQ1A 4J9NA 1ZA1B 2IJNA 1XQIA 4KHPF 1E6VA 4R5PA 1TK5A 2XHWA 4F4XA 1RTHA 1WI8A 1LNQA 2GMJA 3N6MA 2YTCA 1VFJA 1ZH5A 1OWXA 1JWWA 4FYYB 1LWXA 2UUWA 2Z2MA 4Y2KA 3BV8A 4WZQA 4NEZA 2KZMA 1GXUA 3PX6A 2ZNYA 3LGHA 1UJ4A 1ZAVA 1EQ0A 1NPKA 2HVEA 2ZD1A 3A8KA 3MAAA 3MEGA 3HHEA 3QT6A 4TLQA 5E3RA 1NKEA 3KNAA 3GJRB 4B3OA 4KY3A 4MK8A 1Q0NA 1RWWB 3OR1B 3S7RA 2KM8C 2PSZA 2DXDA 5CYMA 3MR6A 2B7BB 4UOCA 2UP1A 4JV5F 1WORA 4JB8B 2BE2B 3HVTB 4HTJA 4F2RA 3NS6A 1XK8A 1JNZB 2QIFA 3DGPA 5ETQA 5IQ6A 4DL5A 2FUG9 3KJVA 1VGYA 3K57A 1N32J 3D66A 2DIUA 3D67A 4ZIWA 2YKNA 1QD1A 2DRDA 4I6YA 5C42A 4IKAA 3M30A 2O1PA 4WZMA 4L6V3 5EX0A 4DMZA 2OEKA 3K5NA 4DV1F 1D09B 2RUGA 2HNDB 1JLQA 1S1VA 4BHQA 2XNRA 2BEFA 4KHMA 5BYQA 1PJ6A 2ACYA 2DHSA 1FKOA 2LP4A 4ZMMA 3NP5A 2MGZB 2DH9A 2DISA 4HT5A 1JIHA 3MZIA 3E8OA 1XERA 2YKQA 1WOOA 4HYKA 5L46A 1WF2A 1TL1B 3GONA 4QYZK 2HVZA 3RB4A 1N6QB 4UTGA 2APOA 2J9DA 3DU5A 4QIEA 1U47A 1SQGA 2FJVA 3P49B 4JI5F 1VHFA 3GU0A 3I0RB 3M2RA 5A0YB 3PO4A 3EGNA 2M2BA 3VV2B 4ELVA 2KHDA 1CLFA 1R43A 2W9CB 3JSBA 2HGMA 1TZ0A 3OFEA 1S6UA 2RS8A 5C2GA 4YR3A 2JZ5A 4ERDA 3IBWA 4HEA9 4WFZA 3W9HA 3WC0A 2FYXA 1JLFA 2FY8A 2G2YA 3GYXB 3VGUA 5D4NA 4ED8A 7FD1A 1VQ4S 1GK8A 2H54B 1S6OA 1REGX 4DJBA 4NCGA 1ULRA 3UDVA 2E1MC 1NK6A 5CABA 4IO9Q 1VDHA 3CGIA 3CTRA 5HL7Q 2UXBF 1RABB 2AYEA 3PEJA 1M5VC 1FRXA 1QVFR 3MMCA 3DI6B 3Q24A 2CNLB 2YNGB 3LPEA 4C8MA 3MEKA 2NZ4A 1FF2A 4G3IA 3HFZB 3ZZOA 2C2KB 1FK9A 4Y34A 4WIQA 4O3PA 4DV1J 1PAEX 3G9CA 3AD9C 1GNKA 1FEHA 1BLUA 4EZ9A 4DFJA 4QU6A 3L7PA 5IS2A 4LFBF 2KJVA 3OD2A 4MFBA 1GQEA 1SUQB 2LDYA 2VG7B 3CC2S 1M1GA 4DR4F 4P2FA 3KUEA 4TQSA 2ZHAA 4C9DA 5G0RB 1DBDA 2EFNA 4KFBB 2EFVA 1E6VB 1GXLA 1X5PA 2YX1A 2ZH8A 2GIRA 3QPIA 5DGBA 3FSIA 3NMRA 1FFSB 1TU0B 4B08A 3H59A 4DSJA 2GNKA 4AL6A 2RRBA 1VQYA 3NAIA 2IFXA 5CZXA 4LF5J 2EBGA 3J81j 2HVIA 4AD6A 4FF1A 4J9MA 1SH3A 3FCWA 2I38A 2V34A 2CJ9A 1R8PA 3JS9A 2GW8A 3CC4S 1Y5IB 1WF0A 1EJ7L 2LU1A 2EFOA 2IJRA 4ZPDA 2OUGA 5HVFA 1HBNA 4OJ3A 3HO1A 4JYAJ 1KQSR 1KP6A 2CZ4A 3CJ2A 3MCNA 3OL6A 2HZCA 3DHWC 2QMXA 4DN9A 5KT3A 2JHEA 1RT6B 2V2QA 5E41A 4YOEA 1CC7A 1MMLA 1TUGB 4UOGA 1RISA 2CQ4A 1JXVA 2G2OA 4NLDA 3Q8VA 1NK5A 2R7TA 3KLIA 5A2QU 1H2TZ 4IH5A 1R0AB 3NNAA 4FP9A 2V9KA 2F63A 1WC0A 8AT1B 2OPSA 3HKWA 4LF6F 1HA1A 3HCXA 1NRKA 3H4DA 4B9SA 3AOAA 2YKMA 1PBAA 5J2NB 2WSCC 2DNGA 4E0DA 2HVHA 1S6QB 5E5NA 2RDJA 2DEIA 4Y3CA 1S9GB 4JI0J 5KFTA 2XWXA 4Y2MA 2IC3B 2C2OB 2LU2A 3FSYA 3M2RB 1F9EB 1WG1A 4U6PA 2XLKA 2POKA 4NLYA 3QO9B 4LF9F 1S12A 3PR4A 2VPYB 2BUNA 1BUXA 2AEMA 4OI1A 4ZP7A 1GX6A 4DX8H 4R0EA 4PRFA 4URSA 5KFAA 3CMAS 2EKNA 2HFSA 2HQCA 4FZVA 4CLZA 3CMQA 2B4VA 3I82A 1JXEA 4IR1A 2M70A 4OHZA 2XGPA 1BWVA 3CIZA 1NB2A 1ZOTA 3D6TB 3KTQA 2GVZB 3JTNA 1RWXB 3LGMA 1Q7YT 4NXMF 2AKWB 4ZVRB 4G6VB 4QQBA 3P45B 5ETPA 1EKRA 3CO0P 4UQGA 1UL3A 2KB2A 2CQIA 5EHHA 3MMCB 1JJ2R 4W90B 1APSA 3CJKB 4Z2XA 3UNGC 4JI8J 1C1BB 2GQQA 4ED5A 2KU7A 3UN2A 3DLBA 1MNEA 4CT9A 2DNRA 3ILOA 4ANEA 1S0OA 4DQIA 1WEYA 4ZDNA 1IKXA 4F4KA 4N8NA 4WIIA 5IOLA 1CS4A 2PEBA 3P96A 1UMJA 4K7QA 4P52A 5LSRA 3C6UA 1UJ5A 3H2UB 4DUYJ 3N0VA 3PNIA 4RWWA 1W2BR 3LTOA 3SBMA 2X3GA 3KHGA 1N48A 1GFWB 2D41A 2H65B 2WONA 3DGVA 5A6WA 1V5IB 3PYFA 5THWA 2ZH1A 3RR7A 1IKYB 4B3SJ 1XMQJ 3C15B 3R5BA 4DSFA 4QIWD 2MQMA 2KXFA 2DR9A 4WE1A 1C4CA 1KTQA 2BA9A 5HK4A 4C0HA 1F6TA 3GCXP 1UEKA 1JJCB 1CJUB 2MZRA 2J0SD 4OHYA 3DMJB 3OXGA 3THPA 1RA7A 3PCOB 3OXFA 1RT6A 3T5HA 3DOKA 4PUOB 2MEWA 2N7YA 3ETMA 2LA4A 2OAUA 2PGCA 5T7LA 3TZXA 4ED2A 2KFZA 3GIMA 1QAXA 3V6DA 2W4DA 3K8WA 3NBPA 2ZM6F 2OH2A 3PHTA 4CTAB 2A10A 4ES3A 3MR5A 1V5VA 1AROP 5CZVA 1N5YB 1O6XA 2VFVA 4KPCA 5KG0A 3RB3A 2CJXB 1VQ6S 3FJ2A 3PW2A 2VPZB 2WSEC 1TUWA 5E0OA 1KONA 3JQKA 4IQXA 4GO5X 1RT7B 1WTFA 4ILRA 5FLXY 2WBMA 1CSJA 3R2CJ 5DO2A 5A8WA 3UR0A 4OX9J 3SSRA 5T41A 2R7XA 1JB0C 2XG8A 1ZYQA 2XHCA 2V4JB 2V94A 4I2QB 9RUBA 3ITHA 3T1HF 2ZOFA 2WHOA 3DRPA 3AFGA 2FVPA 2I9SA 2YY3A 5KFGA 2UVWA 1RT3B 3MUTP 1FI4A 2VBZA 4DXLA 1QTMA 1T9UA 1R0CB 3MMBB 4OIXA 4B3RF 1S9GA 2KTQA 1NXIA 3E2EA 1K0TA 3UFCX 3MCOA 1D3WA 4ZPVR 1SC6A 5B0EA 2ZOMA 1HYSA 4ILLA 3MEEA 3QIPA 4TN2A 1QJHA 3BZQA 3ENAA 3MM6A 2CQHA 3HXMA 4Q2MA 4Z37A 5B08A 1CULB 3HSJA 4DR5J 2PA3A 4NLVA 2IA0A 3M9NB 1HBOA 2OPQA 2J76E 3G82A 1YZ7A 3PHEA 2AX0A 4EGLA 3NNHA 1GTHA 4G1PA 4G65A 4FS1A 1HI1A 2HWIA 2Y1RI 3SV3A 4B9MA 2GHVC 1PYOB 4N8OA 3KFWX 5HBMB 3TNVA 3OVSA 1SC3B 3CB4A 1J5OB 1IR2A 4H4KC 5T7LB 4DDFA 1NH8A 3GIRA 1NJZA 1YJ9S 3BKTA 4UF4A 5D15A 2V8HA 2JEIA 4LBHA 3SIPB 2HQGA 2NCKL 3DOMA 1YJUA 2BJ9A 4C7QA 4KO0A 4O4RA 3R1HA 1KBRA 2I8EA 1NKBA 2AF6A 2RF2B 1X4EA 3GB0A 4M8LA 1PYSB 4JI7J 3MEGB 4I64A 5M2RA 1N56A 3UI3A 3NGTA 3W2WA 1XMBA 5HLFB 1VK3A 1U0HB 2KJWA 2UUTA 1P27B 1JNRB 2F40A 3SDEA 4AE5A 1FXLA 1H73A 3UD4P 2QEXS 2DPJA 2EW9A 4FXDA 4X4NA 4LF7F 1L3SA 4DPOA 2BE2A 2CUYA 2B0GA 4FYWB 4R8UA 5HATA 4ZLPA 1FRHA 4B3OB 1BY9A 2BM0A 3HF5A 2FLOA 4Y2IA 4CO0A 4LMZA 2DK2A 3IMQJ 4WU2A 4JV0A 4CDIA 5EWFA 3M8QB 1ZPVA 2OPRB 1LXNA 1R7IA 3K2YA 4HHJA 4NL5A 1XJWB 2ABYA 3A3PB 4P72A 4PG7A 3K5MA 3GFXA 3IA0A 2QSWA 3DDIA 2P8IA 3HSDA 1JMTA 5HMZA 5F8IA 3AXKA 1FRJA 3MPVA 1O51A 3PR5B 5JXSA 2A2CA 4K50A 1G4CA 2IBKA 4C4WA 1JLQB 3MTJA 4BWJA 1L3KA 3U7JA 4CTAA 4FBTA 1FJGJ 2K3IA 3AD7C 3H5XA 1VCTA 2DNZA 1FE0A 1UFLA 2UVVA 4A8SA 4DLGA 1MU2A 5ETOA 3HVTA 5M2PA 1YWXA 3TVZA 2G1HA 4O3QA 5F8HA 5LMNJ 2ROGA 3FK4A 3A13A 3RUBL 5GMDA 3BS9A 3SEOA 3DLGA 2WTFA 4LF5F 1Z2ZA 2Z8QA 1Q1KA 1H7WA 4EBCA 4B9UA 3UCGA 4BC7A 3W2VA 4NCGB 2F4VJ 4F50A 4I69A 1K0VA 3MM9B 2FTRA 1N52B 2VG6B 3M8PB 4CH0S 2QGFB 3ISNC 3MMBA 2V2ZA 1AYEA 1YJTA 3CVKA 4N77A 3TQEA 4ZN3A 5KFOA 2OI2A 4NYPA 2O01C 2OFGX 5KG4A 2HLTA 3Q8PB 3GQCA 1RK8A 1S0NA 5I42A 2N4DA 4H54A 1RI7A 2C3YA 2YNGA 3H98A 4NYZA 3OSPA 4AL5A 3T9ZA 3G6VA 1FDAA 1OIAA 3NNCA 5A0YA 2J7UA 2O66A 3KK1A 3NCQA 4DV2J 1OY9A 1L5UA 1YKWA 3DRRA 1NK4A 3MCSA 1CPZA 1TQLA 1RYSA 2YNIB 4DHVA 4KGXB 4OYXA 2RUSA 5EWEA 3M6VA 2CJAA 3PW0A 2FHJA 4ID5B 2KYZA 3FUYA 2B9WA 1X5OA 4MYTA 5HBMA 5DLFA 1J5OA 3PX0A 3KLHA 4WBFA 4NZ6A 4OYMA 2G4BA 2CQPA 2WB4A 5E33A 5GAHI 3QSYB 1FJEB 5F0UA 2UUAF 3MXHP 1E6YB 2C2EA 2XY7A 2VA2A 4ZCMA 1LW2A 3EYZA 3VGTA 3V6HA 2PE8A 1RE1B 3BN4A 1HHQA 3KDNA 3UR3C 3HHLA 2XM3A 4IRCA 2Y8YA 4DR6F 2GCFA 3CCTA 1PJ5A 1T7PA 3PJXA 2UXCF 2JLFA 1TL3B 4ZP8A 1WEXA 2YKPA 4CLUA 2SXLA 3AH6A 4WP3A 1T95A 2FVRA 1C2PA 1N36J 1FX2A 4WKRA 2J6UA 2BW7A 1VMBA 1JLCA 1XR6A 3I5CA 3JYTA 3ILIA 2VZ9A 1YIJS 1VQ5S 2HS4A 1D8YA 1BQMB 4DV3F 1M1KT 3BR8A 4IRDA 4LFAF 3ISND 1RAOA 3X3UA 5E3PA 1R0AA 3HZGA 4RNFA 5CYQA 3QAUA 4DFMA 2AT1B 4ZPBA 3ZZUA 4NPOA 4DV0F 1U49A 4WP8A 1JKHA 4DR2J 2KN4A 2Y1LB 4HKQA 5AJ3J 2R2UA 2PIIA 1LWFA 5IV4A 1SV5A 1C0UB 1WOPA 1QE1B 2MXYA 1L3VA 1RAAB 5F3TA 2WZ1A 3L7OA 3NXZA 4ZVPB 1HQ2A 4IYQA 5HROA 4C8OA 3CULA 2MKYA 5AXLA 1U1NA 1O5JA 1B0PA 1YBUA 1AZSA 2LQBA 3M32A 4K5RA 4P10A 4P74A 4CLPA 4DQQA 1ZS6A 4BBYA 5GAGU 2RHSB 2YWFA 3FZBA 2ZH4A 2B8QA 3M8ZA 1WDTA 3GE9A 3MOZA 2IVMA 3F56A 4Q5VA 2JNJA 2IMWP 1HKAA 1Q4RA 2CQ0A 4DR6J 5E3QA 3MEDB 1IVZA 3P8BB 3TOQA 4C3KA 4M95A 1U1RA 4ZPAA 4AQYJ 2BJEA 5KFYA 1F2HA 3KXDA 5IFMA 1U1QA 4LIRA 1HQEB 2ZVIA 3CDBA 4URQU 5K14B 3TVYA 5B0BA 2HYIB 3DLGB 4MJKA 5HVHA 3QNWB 1R6VA 4C8KA 3BGUA 3B54A 4JI3F 4X4PA 2YNHA 1R31A 2MKSA 4KGMA 4E98A 2DTJA 3MWBA 1WG5A 4MYUA 4WPAA 1U4BA 3E01A 4J9KA 4GO7X 3N5FA 5KG2A 2OTLS 2OTJS 2XS5A 3D2WA 3OL9A 2EK6A 3NCPA 1CJTB 1RACB 3POTA 4PXDA 1FVSA 3SV4A 2B9EA 1TKDA 4B3MF 3ZZYA 2BE7D 4X65F 1X0PA 5C25B 5LXYA 3JQMA 4PQAA 1B7YB 1NLKL 3JXOA 4CM2A 2K1RA 1C0TA 4PXCA 4B17A 2MQQA 4IH7A 2ASYA 3WZ0A 3KK1B 2H5EA 3AOCA 3J7ZT 4U96A 3J7A1 4OFZA 2PEHA 1G7CB 1RHKB 4J9LA 2AYBA 1Q95G 4TYBA 1TV6B 2VDHA 3J7AN 4NRUA 2YNIA 4OZLA 1IUJA 2HHQA 1G3OA 1IKXB 4O0IA 2BOAA 2DD8S 4ID5A 2JFDA 4ZPTR 4IFVB 4UZCA 1RTIA 3EGWB 3SZ2A 3PEHA 3Q89A 4NLPA 2OELA 3M05A 2GGPA 2JJ4D 2VC0A 3R3TA 2J8AA 2GVZA 4U9RA 2D74B 1YJVA 3C6TA 4EYIB 2PFFB 1VIOA 3T6BA 3DDNA 1UEUA 2ZE2B 3PJWA 2V4QA 3IRWP 3CCVS 1KWMA 3RYLA 4C97A 4ED3A 4WTYA 2IYIA 4DV2F 4I1TA 3UWTA 5I3QA 1HQEA 1YVFA 3N79A 3GV5B 1J5EJ 4X66F 4DL6A 4UQTA 3ONQA 4DR2F 2ZBQA 4CIOA 2F65A 2BRKA 2HQFA 2OMOA 6FD1A 1EHWA 2HNDA 4B9NA 4KGZB 4Y6IA 1B3TA 3ZZPA 2NXNA 1RZMA 3KJFB 2IVFB 2YH0A 1HWIA 1SJQA 4RBUA 3OSNA 3THTA 4RUCA 3OQ2A 2OD4A 2C2RA 4DFPA 5CD4A 2XI3A 5L38A 1C0TB 2GAGC 3PKMA 1HD1A 3G6ES 1D9DA 2ZBCA 3DRSB 3B4MA 4IDKB 4WU3A 5J1PA 2IRUA 3G87A 5HROB 1KVKA 2BJ7A 4HACA 4WFAQ 1NDPA 2CXEA 3G2XA 2MZSA 1VRUA 5U47A 1YHQS 1C1CA 1S48A 4WP9A 3T41A 3VQTA 2KT2A 2XMMA 4QZVB 1XBWA 4KGKA 2YX7A 1VQOS 3VAIA 4KPYA 2D7SA 5GAGI 1Y5LB 2AEJA 2CJBA 2JVRA 2ZUAA 4PG8A 4ES1A 5DM6Q 1WKKA 4B9TA 1LK7A 1Q5YA 4UOHA 5J2PB 1IBKF 4WK3A 1HYSB 1HMVA 1F1BB 1RTDA 4RJVA 2XB2D 1VIXA 2OLWA 5K14A 2EI5A 3EICA 2B5JB 5AE1A 2BYCA 1S7IA 2Z2YB 3NGSA 4CLKA 4LBPA 1FKOB 2O3DA 3D0HE 2Y1IA 2MLZA 3ENQA 4RW6A 5L9NA 5KFNA 2BZ2A 2QLXA 3NKYA 3Q23A 3RRKA 4I2QA 4N56A 2ATLA 1ZM2A 5FD1A 4FNIA 4LRCA 3WBZA 1KQGB 3PZPA 3OTEA 5HP1A 3PO5A 4N76A 5K8OA 4XPEA 4JI1J 3HD1A 5HJYA 4CLTA 4ZLNA 2EKYA 3OJSA 1PILA 2MMYA 4NWBA 3QWUA 2YWEA 2NQPA 1NHUA 2HHSA 2YKOA 3FCHA 4DX7A 1TK8A 2Y8WA 1P1TA 2CYYA 1RCOB 3I87A 4JUZA 3IM8A 4OHXA 1M5OC 1NB7A 2Z58B 3CD6S 3BM7A 2BANA 1SIZA 4F0KA 4JYAF 2Q43A 4M1KA 1TV6A 3FQKA 1FWPA 4NI2A 3TP2A 2BABA 2XTJP 2KL8A 1OY8A 2AEFA 3SXLA 4WJBA 3CJ8A 2R8JA 1A6LA 1RUSA 1K44A 4MK9A 4RKUC 1IN0A 3PFEA 2G1DA 2XMKA 4LR9A 1MW7A 5D78A 4ZVQB 2K7KA 2NUUG 1OPIA 4CNYA 1U1KA 2R7QA 3ISZA 2FHMA 3G82B 4OYAA 4WCEQ 3T1YJ 2HQDA 1MG7A 1YTYA 3SSSA 2CPEA 4M5DB 1QVGR 1VS3A 2JLEA 2E9ZA 2Y0SD 3CJ4A 1XTZA 1ZBTA 2AYMA 4Y65A 3BGRA 1RWNB 2IAJB 3TO8A 3T1YF 3U1NA 2BW2A 3IR5B 5CH7B 1RTDB 1LXJA 2ROEA 3IM9A 4WF9Q 3CSKA 1LEOA 3UE2A 4ED1A 4U67Q 4M5NA 1FDDA 1MWZA 4OI2A 4NEYA 4J7CA 2XO6A 1KVIA 3MUVP 2XEXA 4NX9A 1JLEA 4LBIA 4ZPCA 4ECWA 2ZC3A 4KO0B 1R3NA 2QRRA 2W7PA 2J7WA 4HTIA 1PO6A 1D9FA 3DLHA 1H72C 2DEJA 1K1SA 2IMOA 4RW8A 5AE2A 5L1IA 2LQ5A 1S6QA 1FDBA 4PWWA 4NE9C 1PCAA 3PDNA 5DQHA 4LRBA 2KFYA 2M8DB 2PFDA 4XIUA 1I94J 2Y9HA 5E3CA 4N41A 2GIQA 3EDRB 5F8GA 2KYXA 4GVBB 5KFBA 1EX8A 3BBFA 4NA3A 5A8KA 3PXGa 2Q79A 1FKPA 9ATCB 3R9LA 3UVJB 1FX4A 4ECUA 1X4FA 1NM2A 3M8SA 3ZZRA 3EVOA 2R9LA 1KKHA 2LEPA 4ECYA 3HSGA 4GC7A 4ILMA 2JEGA 3OUYA 3QJLA 3M8QA 3ZTOA 2ASLA 5I42B 2E66A 1Q8LA 3RRGA 4K0KJ 2A3JA 1U8SA 2KH9A 4M5GA 1YQHA 3GR1A 2ZHBA 3T1HJ 4KT0C 4YDXA 2ZH3A 3FQLA 4ZPWR 3G96A 1Z2LA 2D9PA 1H98A 3KG0A 4AUKA 5C2CA 3CCMS 3T5KA 2MLYA 2XMWA 4JI5J 5CYJA 1SQFA 3HPOA 2W8KA 3MM7B 1RA6A 4RNMA 1R8AA 2DNHA 2NXUA 4IRKA 3DOLA 2HEKA 3BQ1A 1RYRA 3C2PA 5CHCB 1T9XA 3MAHA 4C11B 1H2UX 3T3FA 2W2MP 5H9EJ 2GMHA 1D9AA 1R8BA 4DL7A 1TAUA 3MD1A 3WX4A 5B0DA 1RB0A 4M5LA 2XO7A 2OSRA 5BR8F 2FIUA 1LW2B 2Z2ZA 1HNIA 3ZTSA 4BS2A 4F02A 1TELA 2ROPA 3NLCA 3PW7A 2BVZA 2QL9B 2P5VA 1X4DA 4JV1A 3M8RA 5J2QA 3TR5A 1WKLA 2RQ4A 2R8KA 4F3QA 4DS4A 2MHNA 2JLGA 3BYPA 3ZC4A 3KLEA 2HGNA 2UUCJ 1HNWF 1OYDA 1VLYA 5IV3A 2CAJA 3BPSP 3DYAB 3AQOA 2W7AA 3LP0B 4LREA 3DRRB 2BACA 2RHQB 2JEFA 2W2QP 3OPKA 4IG0B 3V81A 4B3SF 1ITPA 1FE4A 1F60B 1HD0A 1ZAXA 4MH8A 5F8MA 3QMQA 1V6HA 5A8RA 3TAQA 4RU2A 3NGKA 2L08A 2UXDJ 1FJ7A 2W9AA 3HJFA 1B99A 5IM0A 3CO9A 1RBAA 4K2JA 1Y5NB 3FKBA 5BJRA 5F3ZA 4M63A 4QIGA 4QIFA 3DLKB 4OLPA 1YJNS 2HKEA 1VRTA 2X3DA 2LQ8A 2CQDA 2MTLA 2H4WB 2BBEA 3HHLD 1AB8A 1LWCA 2DHAA 2HNZB 2JEJA 1N5YA 2K7JA 3TX8A 1T3OA 2Y0BB 5KG1A 4FPIA 4I56A 4FYDA 4DSKA 3PFOA 4A8QA 4YY3J 3CD5A 1HR0J 2PD1A 3RW6A 1NHKL 1LKZA 2QZ8A 4AFFA 1PYTA 3MOJB 4WXWA 1M90T 3BYRA 4ZITA 1RWKB 4RNNA 5K20B 2VODA 1SI9A 2VIHA 2K2PA 1OMSA 5ETRA 2UUBJ 1N88A 1CQMA 2CDQA 3VGSA 2LFVA 2ZWOA 4DV3J 1WG4A 2PMZD 2ADCA 3CJ0A 2C3MA 2ZBPA 3UW1A 1UVKA 3EGZA 5KAKA 3U1LA 4RW9A 3QZ8A 4ECZA 5J2QB 3ZZTA 2AW0A 1V9OA 2HZAA 5E2QA 7FDRA 4BDPA 4JV2A 1BQMA 3T9NA 1CULA 2RS2A 3C19A 2ZZTA 2B6AB 3AY0A 4KAIA 4KB7A 3MMJA 4TVAB 1Y3JA 1NH7A 3CCWA 3TZYA 1Y00A 4AXJA 4FF2A 2HW3A 3BSAA 3H5UA 1HNVA 1EKSA 5K5MA 2ZVSA 3MR2A 4Q0BA 1SKUB 1XMOF 2R8IA 1R8HA 4LF8J 3CMES 3MMAA 1J27A 5IM0B 3UNYA 3IR7B 2W4CA 5D4LA 1U48A 1KLMB 4OZ0A 1SJRA 2RT3A 1WHWA 3TAMA 2W2NP 2ZH7A 1KVJA 4FKXA 3HMJG 1TVRA 1IBKJ 4MKYA 1KQKA 3LA0A 2FVCA 3MEDA 4LT6A 1X4AA 4OYPA 1H38A 2DRBA 2H9ZA 3EPGA 3KWMA 3BO4A 5LMUF 2DH8A 3NCRA 2RIJA 5L9XA 3IWXA 3H5SA 3KHLA 2YBVA 1VBZA 2JDJA 2UUCF 3FEZA 3KUGA 2E1AA 1NSKL 2XMVA 4MFBB 5BYRA 3RW7A 4AT1B 3CE8A 4DPXA 5KT7A 2U2FA 3PW5A 2V69A 2ZBIA 2DHXA 3W66A 1W26A 5H1SV 4XPCA 2B3TB 2KRRA 1GT8A 3EWGA 2IDLA 2RU3A 3EZ5A 1RTIB 5LM7E 1RAHB 4HI2A 3SQGA 3M2UA 1IKVA 3HHDA 2G0CA 5B09A 1SJFA 1U1MA 1S4EA 4IOCQ 4TU8A 1CJTA 4Q8EA 2OP5A 4MMOA 5K8NA 3K5OA 4TQRA 2MY7A 2VFTA 3CJRA 2MKCA 3GTYX 1X9SA 4OL8A 4OI6A 2GO9A 4DL0C 1Q79A 1UZHA 1F5BA 2CWKA 2EFQA 1X5TA 3W5YA 5CA5A 5HMXA 2GZOA 5T14A 4DU7A 2DNPA 2QG9B 3RRHA 4FBUA 3CCUS 2XSFA 2LCWA 2RH3A 3CEDA 5D0HA 4A4JA 2B9YA 3EMTA 4ZKAA 2OO4A 4A8XA 4DF8A 2CNOB 2JC1A 1O0PA 3BH6B 3H42A 1MN9A 1K47A 3F0NA 2XYHB 5LMNF 2CADA 3ZXWA 2FJWA 3IP0A 2V2VA 5IT4A 3G71S 4EEYA 3PRVA 2RB7A 4CT8A 2DR5A 4ES2A 3IR6B 3Q22A 5L1LA 4O3RA 2B8PA 4K59A 5DGAA 4I2PB 1RQ0A 1LFPA 4RPFA 3R5CA 3JAMU 1Y10A 2FHOB 5KT2A 2A6OA 3FBCA 3KJNB 1UP1A 3SFGA 2NXEA 2V4RA 2M9KA 4ED0A 1NJWA 2QA2A 4RZRA 3N28A 2BQUA 2B4PA 2ZH6A 1RBLA 5DRKA 1YLXA 4CO3A 1S0MA 2DRAA 1LWEB 3BDEA 4RL1A 1DTTB 3PTWA 3HZEA 2CPXA 2VFRA 3GJTB 1QAIA 2YQ3A 4NYOA 2YPYA 4F4AA 1MSWD 4P75A 4USKA 2OSQA 4WYLA 4P2MA 4RNHA 4F7VA 3A8JA 3PW4A 1VRUB 1LW0A 2EG2A 2UZAA 4P7TA 4ZVTB 1NSQA 3RGIA 5CD4H 2R7SA 3OTDA 4KH0B 3VF0B 4F26A 5J2MB 4K8RA 1UPMB 4A8KA 1REVB 3NEKA 5E7OB 1SC1B 2DNYA 4O3NA 3PM9A 1KLNA 2F9JA 1PC5A 1U2RA 1WELA 3DLJA 5J2PA 1KHVA 4JI4F 1O8BA 1N32F 4U7CA 4KV8B 2L41A 5HJXA 2OD6A 4Q45A 1RAIB 3M6UA 3HULA 5DG9A 5D0EA 3J80U 2B4UA 5KFEA 1QAYA 1TVRB 1HNVB 3D6FB 4X62J 1ZZFA 4ECQA 3FEYB 2CJYB 5KG5A 3PY8A 2JH3A 2YX4A 1ELOA 4PXEA 2KXHA 1C4AA 2R2RA 4X64J 4JI2F 2I5JB 2GJ2A 3GMGA 2IM0A 2L9WA 1RWVB 2P9CA 1DHMA 2MLXA 3IRXB 5C7PA 5EDWA 1VI7A 3W5ZA 2U1AA 3RAQA 1RU1A 2IA6A 3KMSA 1F2GA 4OX7A 3IC1A 4B3MJ 3FZ2A 3GCWP 5CAAA 5KFFA 3CCLS 3I0SA 1WKJA 5I4MA 2M7SA 3G8TA 3CPWR 1CBKA 2FC8A 2XULA 3PYEA 4LSZB 3O44A 4WYWA 4ZLLA 5L1KA 2LEBA 3UCZP 1NCLA 2WVCA 2VONA 1HARA 3H8YA 1F3VA 5GMEA 3W62A 3GFYA 1H74A 1FWKA 1U24A 3OXLA 1NDLA 4I4BA 4EFAC 5CCLA 2CNKB 4LF1A 2KG1A 2B56A 5LMUJ 1N4LA 1XNQJ 3HM9A 4K4UA 3R7NB 2OKQA 2WRMA 4DPTA 2R7RA 2Z4PA 3BO3A 4C3LA 3BJYA 3PJ9A 3TW0A 3S8SA 2Q1LA 2ZM6J 2KG0A 2ASJA 2HFVA 1B0VA 3OTCA 4A46A 4IQMA 4Y00A 5DLGA 5DDRC 4ZLJA 2XS7A 3L3CA 5IZHA 1YITS 3IGNA 3H25A 3H2LA 4PEOA 2AU0A 4NMXA 3H7HB 3RR8A 4CNZA 4PUOA 4H4MA 2DGOA 4ZVOB 1FTRA 3CXCR 3HKZD 2DBBA 3K8VA 4I2PA 3VAHA 2DNMA 2GAHC 5IC4B 1UCNA 2J0QD 1WHXA 4J9RA 3NWGA 2VDIA 5LL6d 3PX4A 1F9HA 3WIVA 1NO8A 2DT9A 5AXKA 4C2MA 2D69A 2KM8B 1T0TV 2LYVA 4PR6A 3DGPB 4OZJA 2RVJA 4IG3A 1ZA2B 1AXQA 2RKIA 4DV6J 4O3SA 1RJJA 1GMUA 2K3KA 3BQ2A 2BMBA 2IVYA 1CEZA 4LIWA 4RW7B 4CZCA 2M88A 3HLUA 4OYWA 3HVWA 4RUAA 4U7UK 1DTTA 2M52A 3TAPA 2QN6B 4TNOA 3ZFVA 5HMYA 3RU0A 1ZZNA 2YWHA 2V50A 3W8PA 4FF4A 3T5JA 2B43A 3BF4A 1XNQF 2OEMA 3UDLA 1PIEA 3GIIA 4HLBA 3R1LA 2K8GA 5D0RA 1K9MT 1OSCA 1XWLA 2CQBA 3V4IB 4JI3J 2R7OA 3CD0A 4RBTA 1ZM9A 4XK8C 3TYTA 1GMWD 4FYXB 3CCSS 4MTPA 4USVA 2XC9A 1EP4A 3GPAA 4FPRA 4NZ7A 2N3OA 1YI2S 1NKCA 1LQ9A 4D3GA 3JSRA 4LR7A 1PG5B 2MKKA 1LWFB 1N5SA 1S1TA 2DGUA 2H48B 2JOQA 3DXSX 3R5AA 2PI5A 3W3SA 2XCAA 3IN5A 3C46A 4DQSA 1NK9A 5AJ3F 1VC6A 3MGJA 4DV6F 3OR2B 4RW4B 1MLAA 2OPPB 2RMLA 2AJFE 3UD3P 2FVSA 3MF5A 3EDQB 4WXOA 4CCHA 3S01A 1FFWB 1TL5A 4L76A 4ECSA 2KKHA 3M32B 4DZ6A 1RLCL 2Z0GA 1CG2A 3NGUA 3VHQA 5IT9U 2LQ9A 2QO3A 3OT9A 5ETVA 1Y7PA 1R0BG 4IO1A 3F73A 4GKJF 4ZJOA 4ED7A 1K73T 3JSMA 1BE4A 3I5AA 4ZP6A 4A8WA 1T94A 4HL9A 2FY1A 2I2YA 2ZKTA 2ALYB 3QYYA 4J91A 3QJJA 2C2DA 3DYAA 5HANA 3OVBA 3RJMB 2N7CA 5C42B 3OUYB 3C6TB 5HSPA 1X4BA 5B0AA 4UY8T 2MZTA 3IS9B 1UPPA 3DFEA 3V5RA 1QSSA 1NZ8A 3JTPA 2RKIB 1S1VB 5B0GA 3W7BA 3ZO7A 4RW7A 1WC3A 4HDHA 1HBOB 2X51A 3D9BA 4XDCA 2QLFB 4KH1B 2W01A 3TUJC 1MROB 4C3MA 3V6KA 2IIHA 3MM7A 4HH1A 4CP5A 4U8VA 1RHMB 2QFIA 2RQCA 3KDOA 1Y0HA 3GP9A 2XZWA 3IBCB 1HNXJ 2IPOB 4Q0BB 4C11A 5IWAF 2J8SA 3R8YA 5F9NA 1KNZA 1PKUA 1N5TA 3DLKA 3FEXB 2CIMA 4JI8F 4P2SA 2UXCJ 1U0HA 2NR0A 4A8OA 1VYAA 4X2BA 2HNZA 1X0FA 1H6KX 3V2UC 4CLLA 2HGLA 4F3OA 4F4ZA 4KFBA 4HHHA 4O0NA 3MM8B 4ZVSB 1MU2B 1W7WA 2E5GA 3PRDA 3MUMP 2P9EA 3TQ1A 4LSLA 2BJ3A 4JI2J 3QGPA 1RLDA 2WW8A 1FDNA 3DKDA 3LPYA 4ER8A 2C3OA 3HD2A 3BDPA 4ZVUB 2ZE2A 3QBCA 1NSAA 1S5ZA 1C1CB 4LUBA 2F8HA 1NEEA 1WC1A 3W2VB 2DR8A 3P5TL 3S1TA 1X4GA 1X4CA 3VWSA
chains in the Genus database with same CATH topology
3MHYA 4ALZA 5B0FA 2JFKA 3PKYA 4OHVA 4K4TA 4RW9B 4LVOP 2VQFF 1U7LA 4Y28C 2DCUB 4X4SA 2HHHF 1MMDA 2DO0A 1HBMA 1X7VA 4OV1A 3DLEA 4J5OA 1S10A 2E9TA 3DM2A 4QPXA 2E29A 5I3UB 1SJ4P 3MDFA 4CO4A 2ZC4A 1NK7A 4RBVA 4ZK7M 3VALA 3OLBA 4UUWA 1WNEA 3N6LA 2NLWA 1ZAWA 2R2TA 1S76D 1RP5A 3ZZ0A 1TKTB 1I94F 2VB6A 4Q2LA 3G6XA 4QYRA 1KSPA 2HHWA 1ROFA 1VOMA 4JOUA 4DSLA 3CDUA 3MD3A 1HHTP 4NCAA 2MKHA 3TI0A 2P9GA 4DEZA 4DN0A 3SYZA 1XN9A 5F8LA 2AGQA 4X64F 4C8ZA 2VUGA 1R6YA 2BM1A 2HS0A 3FMBA 4TY8B 3SSQA 1A9NB 3I6PA 1Q7LB 2F4VF 3NMAA 3U27A 2O5DA 3KJVB 5GAEU 1Q82T 2B9XA 1YJRA 2A1BA 4MIWA 2NUHA 3GYNA 1WWHA 1S79A 3TA1A 3KKFA 2EBEA 3Q2SC 4DV5F 4ICLB 4A8YA 2O67A 3LP1A 4EU0A 1GTEA 4FXWA 3TAMB 3TA0A 4ZVFA 2VG5A 5KFQA 2DNKA 2E5IA 2DJWA 3GWCA 3RAXA 4X4RA 2UVRA 4YEAA 2PA8D 4LSLB 4Q7AA 1S6PA 4NLRA 3IG1A 3GG0A 3OR1A 2MZ1A 1IBMF 4Q43A 3EX7B 1U6FA 2F3JA 5F9LA 3HHLB 1U6BA 2MYFA 3OFGA 2EVZA 1D8ZA 4E8UA 2R8HA 4C0OC 3UCUP 3MR3A 1RDRA 1RGVA 4LF4F 2W7OA 2CRLA 4YY3F 2RRNA 2ZNZA 4B02A 3AJ2A 2VL1A 5J2MA 1S1UA 2XWYA 2ZH2A 3BGFA 2B4OA 3MURP 2IHR1 4EO6A 2YH1A 3M9MB 1HNXF 4A47A 5JJBA 3A1YG 2J9DE 1Z4UA 3OV7A 2MQNA 1C0UA 4W92B 4IOBA 2E5LF 4NZ0A 3HI9A 4YR2A 1RT1A 2J5AA 5LJ3Y 4ITSA 3KK2A 1LOUA 5G4DA 1TP7A 5KG6A 2EWHA 4I7FB 4O44A 4MAKA 4RW8B 3NGDA 2D3ZA 5D4OA 2CQ1A 4DUZF 1JLBB 4TY9A 1IKWA 2WONB 4LVNP 2FVQA 1X9MA 5FJ4A 5JUMA 3AJ1A 3H2VE 2ERRA 1X8DA 2LXFA 3IO1A 5G0RA 2QE5A 3K7RA 3MM6B 2VOPA 2MKJA 5D6GA 1TKZB 1H0HB 1N34F 1DJ0A 2XCPA 1U1PA 2HLUA 5DJBA 2HHVA 1WHYA 2W8LA 2V5HG 3V6DB 2DGXA 5F8NA 1PSDA 1R27B 1NNDA 2KT5A 4F67A 4KSEB 5A8RB 1FA0A 5C25A 1VQ5S 2NSBA 2R4FA 1VQ8S 3I9V9 1FK9B 4LF8F 5GADI 3KG1A 2NPFA 3I96A 1HR0F 1QUVA 1RT7A 2Q6BA 4DOZA 2FLNA 3DI6A 4RX6A 1KHWA 4LQ9A 5SZTA 2B7CB 2ZZNA 2HHTA 2R7VA 2RE1A 2VPXB 2MJUA 3WDOA 4GKKF 1X5SA 1ZTTA 1L3UA 1M5KC 4R25A 5K9FA 2QA4G 3MECA 3RZAA 1OSDA 3TANA 3IRXA 3N5BA 5B7WA 3M2VB 5KT4A 1KR4A 4WK1A 3FDSA 1TL4A 1XR5A 1QUPA 2I0XA 4R8UB 3KLVA 2DVIA 3CCES 3HVRA 1SBRA 1HQUB 2F9DA 1IXKA 2CPFA 3SDEB 4R0JA 5HO4A 1QLNA 1S6PB 2GGPB 1S97A 1Q86T 1S9EA 2HRYA 1UEVA 1HWKA 3QO9A 3V81B 5GADU 2HMIB 2DGSA 2QFJA 3NG8A 2CFXA 4LSNB 3ETOA 2CPYA 5KFRA 3VCDA 2AQ4A 4ZHRB 3MI7X 1Q8IA 3EPIA 1N5QA 2IYGA 1HPZB 3BGLA 3OLAA 4DBQA 3D5MA 2ILYA 4AL7A 2HS3A 2RQKA 3V4IA 3EZUA 4YHHF 5HP1B 3KLFB 1VQKS 2LA6A 3P3DA 1WEZA 1SH0A 4JI6F 2PMHA 3DHXA 4QR2A 5J1EA 5KOWA 1M0SA 5ADZA 5KFDA 3KHHA 1IJEB 2WAQD 2E5JA 2LEAA 2YNFA 1V3SA 3L95X 3LQVA 3O1LA 3OTBA 2PN6A 5KG3A 5EWGA 3OL7A 3I56S 3AQPA 1KN6A 5DDOC 2D3OR 1JXLA 2XSJA 3M6WA 2DH7A 4ZOSA 2J6SA 2LXIA 2VG6A 1TKZA 3KLGA 3HVAA 1FEEA 4USJC 2DR7A 3ZZZA 4K4XA 1OS5A 3IGVA 1HQUA 4DUYF 3R27A 3GV8B 1BQXA 1RT2B 1L3TA 4ETZA 1SKWA 4K4SA 4RNOA 4X4QA 5KFJA 4C8NA 4QIVA 1KTVA 3KMQA 2ZDOA 3I55S 1UVJA 2CQ3A 3DRXA 2GMLA 3LW5C 2W24A 2GHWA 2FJXA 1Y9OA 1Z1ZA 1QSLA 4KKOA 3TARA 2CQCA 1YRTA 3PACA 5EX3A 1Y4ZB 3US5A 2WOMB 1ZTWA 1FO1A 3D1QA 3FGVA 4K5SA 3PIOQ 2VC1A 1RT5B 1JLEB 2LQJA 4QBUA 5K8PA 1WD6A 4J9PA 2BANB 2NYIA 4YUDA 1D1UA 4NA2A 1TL3A 3UDCA 1DARA 5E3AA 4NLQA 2DPIA 2CPJA 2DGWA 2DNOA 3LAMA 1HFEL 3JSMB 4LQ3A 4K4YA 4H4OB 4HDGA 3H40A 3ENWA 1ZM3A 1OO0B 1NHVA 2ZD1B 3RAMA 4F25A 3LO3A 4Y2AA 5KFVA 3OTOF 2DB1A 1TKXB 3HK2A 4ZVEA 4K0KF 1NK0A 1S0VA 2V0NA 3AA9A 2IRYA 4HI1A 4OMFG 5DQGA 3QIPB 1X9WA 3MAQA 2DNQA 1ZPWX 4K2XA 3K59A 1VQSA 1HW8A 1REVA 3VAKA 2MPUA 4F2SA 2IM2A 4UW2A 2MHEA 4KQZA 5KFWA 3PVXA 2PDAA 3I5BA 2LVWA 3BSNA 3CC7S 2DNNA 2G9OA 3LWMA 2XLIA 2UV8G 1N33F 4ZCIA 4ED6A 4B9VA 3UPFA 4PQUA 1HBMB 1JKHB 2RDIA 2VFSA 2QA1A 3M1VA 3NBPB 1VC5A 1KC8T 4ZCLA 2FD2A 2MZQA 1QE1A 2M8HA 1NK8A 3E51A 4D3HA 5KFKA 1AFJA 2RILA 3MM8A 1TR0A 3B4DA 3R5DA 2KFNA 3LANA 5IQQA 2RSQA 2VOOA 5HQ8A 5MAOA 4QWAA 5JVGQ 1VK8A 2JL9A 3CD7A 3S6EA 3BEGB 3I0RA 3KLGB 1B0TA 3DDKA 1YSJA 2Q66A 3EXYA 4LJMA 4YB5A 5AXNA 2MQOA 4DSIA 3C66A 2UVUA 2FC9A 1VQNS 3AAWB 3MPWA 4FNHA 1RTJA 4MKBA 2HHXA 2N4CA 4NLOA 1MWYA 4Y0FA 4OX8A 3MPYA 1J5EF 1ZETA 2QSFA 2RRAA 1VBXA 5LXRA 3DLEB 4OI0A 2GO8A 1FCAA 4CH7A 2RNEA 3CJ5A 3GFZA 4X4UA 2ZHOA 2MSTA 2W9BA 1XR7A 5CCMA 3HHKA 4KKOB 4PG4A 4N47A 1LV5A 5LT5A 4IOAQ 1VQMS 3OW2R 1DLOA 6FDRA 5LJ5Y 5DG7A 1YJWS 2L9NA 4FN5A 2L48A 2CZVC 3CUNA 2FB0A 3TA2A 2FDNA 4H4KA 4EO8A 4DR3F 1RT4B 2G13A 2BDPA 4I6WA 2BJDA 2XNQA 4PPDA 1H2VZ 3OL8A 3OVAA 2RQMA 2HFZA 2JSXA 4TY8A 2EC0A 2F8EX 3BQ0A 1JLFB 3KNGA 3QLHA 2DITA 3HX9A 4LFCF 1B7FA 1TKXA 1KS2A 2ZITA 3TVKA 4YMEA 4TYAA 5HI7A 2WK4A 2ZOGA 3THVA 3AB4B 4QR1A 4IR9A 1P1LA 1LFWA 2LLZA 1SKSA 3LP0A 1KOOA 1SB6A 4OJHA 1S9FA 2F8MA 1URRA 1SUQA 2NREA 1F0XA 2IM1A 1F5AA 4AXIA 4WFYA 2DNLA 3GSDA 1S99A 3BN7A 1VQLS 3IFEA 2Q6CA 2J6TA 4MK7A 4DG1B 1HI8A 4PQUB 2QA4S 2UXDF 3Q2TC 1UKUA 2VG7A 3I32A 1KFDA 4ZCKA 1UVIA 5ITHA 3QJPA 3M9OB 2GV1A 2V8DA 1M5SA 3MM5B 2Z2LA 2GA7A 3A8E