3JTOA

Crystal structure of the c-terminal domain of ypbh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
DESADIIYQFHSFEDIIQLSESLQRIGITGGTVYHYDGQYFLSLEDLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVETIQTHFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Adapter protein mecA 2
publication title Crystal Structure of the MecA Degradation Tag
rcsb
source organism Bacillus subtilis
total genus 24
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jtoA00
2Y1RI 3PXGa 3JTNA 3JTPA 3JTOA
chains in the Genus database with same CATH superfamily
2A0FB 5D4PA 2VQEF 3W5YA 2HBRB 3FVYA 4ES2A 4RBTA 4ED3A 3R5AA 1RU2A 2PE8A 2UXCJ 4DDFA 1T02A 4OJHA 2ZHBA 4IFYA 2ZHOA 2ADCA 2RILA 4RUBA 3PG9A 3KDOA 5C24A 1ZTWA 1Z1ZA 2CQGA 5G0RA 1T9WA 4K4VA 3HVAA 3UDLA 4KR0B 1RHUB 4OYOA 3FFIA 4NXNF 3J7AN 3CGIA 2KU7A 3DC2A 1NPPA 2CJBA 2IM2A 4DV1J 3OFHA 1FRJA 2L41A 4YFUA 2WCXA 4X4UA 1WDTA 3C16A 1SIWB 2NXCA 1L3UA 4DSKA 3BBFA 4OZ5A 4F67A 3MEGB 4NEYA 3N0VA 3DDIA 2E9TA 2VBYA 4F04B 1YJRA 4ICLA 3HJFA 2H3EB 2PSZA 2DIVA 1NHUA 2BE7D 2R3VA 4B9LA 3FEYB 1X7VA 3KLFB 3AA9A 4PXBA 3VGVA 2JLEA 3R6GB 4F0KA 4JI6J 2MB0B 2GCFA 5BJRA 3QYYA 1FK9A 3NRBA 5F8GA 4Y2KA 1JLEA 4WTOB 3MOJB 3K8WA 2FHMA 2LQ9A 2OAUA 2JEJA 3MMJA 3OTDA 1HBUB 2IRXA 2B9WA 2JJ4D 1ULRA 4AXJA 4RU9A 4QQBA 3FC9A 4URQU 4DSIA 4DSEA 2C42A 3DHWC 2CPDA 4ZLPA 3F56A 2IBOA 4RW4B 1BQMB 4DR4J 5MAOA 2AF6A 2CJAA 4NOHA 5KFQA 1TKXB 3TVZA 1KSPA 3ZZUA 1U6BA 3D0HE 2VUGA 4B3RF 2QFJA 1Q78A 1VDHA 3RJMB 4DX8H 2BW7A 4GKKF 2GMHA 3MFIA 1EKRA 2MXYA 4KPCA 4DS5A 2B6AA 1RTIB 3M8PA 4R0JA 1FJ7A 4LVOP 2WK4A 4LT6A 1PKUA 1RB0A 1PAUB 2ZZMA 3DKDA 1HWUA 4GVLA 3TAPA 1VIOA 3R97A 5KFEA 4Q2MA 4PWDA 1U02A 4U67Q 3SYZA 3U02A 5IT0A 2BA9A 3AXMA 3K57A 3CW2C 1YHQS 3NL0A 3EPIA 4WFZA 3A8JA 2XSJA 3JSRA 2RB7A 2NUUG 1Y11A 2UUBJ 3TP2A 4LJMA 3CD5A 4DL0C 1WNEA 4DL5A 2NUHA 4N77A 3JQMA 3RB4A 4DV5F 2W9BB 3THVA 3DCAA 3VCDA 4UT4A 3GJQB 1T9UA 5LXRA 4ZVFA 1XEZA 1UZHA 3NKYA 1OMSA 1T7PA 4PUOA 4CT8A 4DSLA 3SBMA 1VLOA 1UPMB 4QU6A 1TK8A 3IAS9 4BHQA 2HVHA 1SQFA 4ZVTB 2R42A 2A2DA 2VFVA 1TV6A 3Q8PB 4K4ZA 2O3DA 1XBWA 3FKBA 4B3MJ 1NHVA 3EGNA 1S0VA 4KAIA 2YKPA 2JZ5A 5DRKA 4ED8A 1PJ5A 3TQEA 1WORA 1CJUB 2FVCA 3D5MA 4K2XA 4ZP8A 3MUMP 1ZZNA 2HRUA 4ZLLA 4DL3A 2E29A 2N4CA 1FJEB 3ZC4A 4DG1B 2IJNA 4NRTA 5HATA 2DGVA 5HVGA 5D4OA 3DRPA 1U1RA 1IKWA 4LSNB 4C11A 1JLQB 2IJFA 3LWMA 2HFOA 3QAEA 2C2MB 2LDIA 2ZKUA 1U7LA 4HVZA 2YXLA 3J81j 2WB4A 3S6EA 3PRBA 4EMDA 2F7VA 3MR7A 4BS2A 1H7XA 4H4KA 1BUXA 3T19A 1N5YA 2YNFB 1RAEB 3VWSA 5D3GB 5HROA 1NKBA 1N32J 2VONA 3PFEA 4J9NA 2HBZB 2CJXB 1SH2A 4J9QA 3QRRA 3SMZA 5A2QY 2BJEA 3M1VB 4GC6A 5AJ3J 2HPUA 1MU2A 1YX2A 3AFGA 2ZKTA 1KLMA 3W9IA 2CRLA 3CSKA 4LRBA 1PCAA 1RWXB 4ECWA 4GO7X 3JTOA 2MKJA 4Y0FA 4EI2A 1HMVB 1WWHA 2V63A 4PYDA 3Q86A 2LVWA 1HQ2A 1X4GA 3M2VB 4WYWA 2E5JA 1Q81T 3FK4A 2G0JA 2M52A 2CNLB 2LXUA 1YSJA 3E51A 2AYBA 3W8GA 4XO0A 1DURA 1OYDA 4NLWA 2BJ3A 2QV6A 3EMTA 5F8NA 4MK9A 4KBIA 4WZQA 3QWUA 3CCVS 5K14A 2W01A 1HNWF 3J7A1 1IKVB 3HFVA 1IKXA 1PYSB 7FD1A 5DGAA 2DO4A 3ILOA 4DSFA 1JLAB 1CLFA 3GJTB 3DLHA 1JLFA 1SC1B 1RXOB 2DITA 1I5OB 2XBPA 4RWWA 2OH2A 2V67A 2AKWB 1QLNA 3HPOA 5CYMB 3DXSX 1J5OA 2C3YA 3A1YG 4C6AA 2GHWA 4ZK7M 1FE0A 3QT8A 4J91A 4NPOA 1RJJA 2ALZA 3AD8C 5ETMA 2Z56B 1IR1A 2G9OA 4ZN3A 5L46A 3A3PB 3W2VA 1Q5YA 4TLQA 2B4OA 3HI9A 2ZH4A 1VRUB 3PCOB 5LOQA 4TU7A 3TVKA 2ZH9A 4WP3A 1BD6A 2QFIA 4ES3A 3BDEA 4V19J 2RF2A 5F8IA 2HNZB 3NAIA 1YI2S 2DNRA 4RUAA 5F8JA 2HAIA 2BZ2A 1X9MA 2R8IA 3GPAA 1R0AB 4PPZA 1IBCB 3BO2A 2CUYA 3Q89A 2XO6A 3CCRS 3T1AA 3IRXA 2J6TA 3W7BA 1HHSA 3BGUA 4ZIVA 2ZNYA 3OFEA 1IQTA 2GO8A 2CNNB 3DM2B 4NZ7A 3L09A 3S8SA 4PXEA 4O4RA 4I64A 1L5UA 5B0AA 4QWCA 1Q8BA 4NX9A 5JMNA 5K9FA 4JI2J 1TKTB 4DWIA 4RW8A 3GQCA 3FSXA 2QSFA 4P73A 2M9KA 1ZA1B 4X62F 1HNIB 4BWJA 1N5VA 4C3LA 3IBCB 2BYCA 3FRYA 5HQMA 1KC8T 3NMRA 2HHXA 1RAJA 1NBEB 1MMDA 4BC9A 4DPOA 1X8DA 4RU2A 2O1PA 4KYZA 4K59A 2AX0A 3KFWX 1Z2ZA 1AXQA 3UR3C 4KGKA 4RNFA 5DG8A 1JJCB 1N34J 4DUZF 2CVIA 1KN6A 4XAKA 4LRAA 3VAJA 4IOAQ 5DQIA 1Y4ZB 2WOMB 3K5PA 1NJWA 2EFGA 5E7OB 2YPZA 1TL7B 3KK3A 3ILJA 3CIZA 2JC0A 4PRFA 1X4AA 1MMLA 2I2YA 2UVVA 1RA7A 1HPZB 4IFVB 5U47A 3GONA 3CO0P 5CH7B 4ALZA 2H5JB 2F8HA 2PA8D 1L3SA 3SEOA 3K59A 3KDNA 5L8RC 3DMJB 2HZAA 3KWMA 2QTWA 2JOQA 4NZ0A 4IO9Q 1O0PA 3T5HA 4WU3A 2D7SA 2RQCA 3MPYA 4I2PB 4LIWA 2RQKA 4IDKA 3G4SS 4DF4A 3Q8RB 1N33F 1RA6A 3AD9C 3RAMA 3AB2B 2E66A 3HMJG 4XPCA 3RB0A 4LREA 5ETNA 2QL7B 1M5SA 3QFWA 1PBUA 3IGVA 4X4QA 1BQNB 3CDUA 1C1BB 1V5VA 2VICA 2IJRA 5KG0A 1BQXA 4EBCA 4I7FA 4P75A 1YRXA 2CPEA 2H5EA 3UNYA 2MZRA 2MHNA 2IA6A 1XNQF 3R8YA 3LTOA 1O6XA 1U0HB 2OSRA 2WVBA 5G4DA 2YX1A 4A4JA 1CS4B 2VC0A 1TL5A 4N56A 5B0BA 4RW7B 2XYPB 1RZMA 1Y9OA 5A76A 1KR4A 4TVAB 3N5FA 3RBXA 1W26A 4F0HA 3CNQP 2JDJA 1LW2B 2GA7A 4RNNA 1UA1A 4LF5J 1UP1A 2AWZA 4DV3F 2MY8A 4G65A 2MKHA 1LEOA 3D54A 1SCJB 1HHQA 3Q8YA 3EX7B 4CCHA 4F02A 2QZ8A 4M94A 3RB3A 3BQ0A 4GRSA 4O3PA 3OSNA 2G1HA 1FTCA 3VHQA 3Q8UA 4ECVA 3SZ2A 3V4IB 4KPYA 3D4JA 4DL6A 1U1KA 1YIJS 2MZ1A 3V6DA 2MZQA 5KFTA 3GIMA 2B9XA 3MCSA 4L73A 3PYDA 3TARA 3IM9A 1VK3A 1VRTA 5GAHU 1AUSL 4KE5A 5I4MA 4IR9A 4CP5A 3OLBA 3MURP 4LF4F 5KFIA 4CQ1A 5KT4A 4BDPA 3VAHA 3EDRB 4C97A 5IC6B 1R0CB 2FZKB 5KFOA 4UY85 5J2NA 5KFCA 4JI4J 1RADB 2KG0A 4QYZK 3M7VA 3CDEA 4P72A 2AJ2A 2QO3A 2ABYA 2I6WA 3RAQA 4RW9A 1NK5A 1NAQA 3OR2B 4JV2A 1IUJA 4Q0BA 3M8RA 4G3IA 2GNKA 4U6PA 1WHYA 2FPHX 2VODA 4RUCA 4OX8A 2YVSA 3PTWA 2JLFA 2VJVA 3B8HA 5CYJA 4USWA 1ZOTA 5SZTA 2QLFB 2IM0A 3AOAA 4O0NA 4LF9F 4OLPA 4UW2A 2HKEA 1R6YA 2YX7A 3FSIA 4DQQA 1TKZA 2OI2A 1UW9A 1K0TA 4K4YA 3H2VE 3MMCA 5EGYA 4ILMA 2DPJA 4Q8FA 4EO8A 3OTEA 5E3PA 2CDRB 1V5IB 3UD3P 5J2MB 1FT8A 3CCQS 1SJ1A 2AJ4A 2RSQA 2HHUA 3V5RA 3MOZA 4EO6A 2FVPA 1IBKJ 2IM1A 2EFQA 4I2QB 2WVDA 5L9NA 4J9UE 4M5GA 3KLVA 4JI3J 3TANA 2XB2D 3KLGB 4KB7A 4P7TA 4YB1P 1DJ0A 3UQSA 3IR7B 4J9SA 3PJXA 2APOA 2VL1A 8ATCB 4NMLA 1M5VC 1A9NB 3BBCA 5KG4A 3MEEB 2HQCA 2VF3A 4KQZA 2J0SD 4OL8A 1YJNS 1EZZB 1WELA 4M5HA 3RRHA 3DOLB 2HHHF 1CBKA 3GV7B 4J7CA 5IV3A 1JLBB 1H72C 1FRLA 1UL3A 2P5VA 3BZQA 2QJ3A 4Y28C 1F9HA 1X5PA 1E6VB 3I9V9 3J7ZT 2PEHA 3TX0A 2VOOA 5KG6A 3OVAA 4YP3A 3SFUA 2DYAA 1WKLA 1U26A 4LBHA 3BKFA 3ISZA 4O0IA 4EZ9A 1JKHA 1LWEA 3NCPA 5A8RA 3E2EA 1RAAB 3KG0A 4OIXA 4H4OA 5THWA 2V2VA 2ZM6F 1HQUA 1A0OB 3N01A 3PX4A 1RAFB 2KL8A 4CH7A 1K0VA 4PQUB 3A3OB 2VZ9A 2R2SA 2BANA 4ERDA 2ZH7A 2VBXA 1SUQA 2HQDA 5IT9U 4NXMF 2ZC3A 2LECA 2VPWB 1K1QA 2H51B 3IXQA 4CO5A 4OHZA 4NXNJ 3GIIA 5HSPA 2EVZA 2QT7A 5ETVA 3HKZD 2V6AA 4LQ3A 2ROEA 4WWSA 4Q2LA 2QE5A 2DCUB 3GB0A 4B08A 3CTRA 3HF5A 2XO7A 3M8QA 1Y3KA 3SCIE 4DR7F 3D66A 2CWXA 5KFDA 4FZVA 5A8WB 3TRGA 4KHPF 3SQOP 5CZXA 1NRKA 1FKOA 3NXZA 5B0FA 3KMSA 2DXDA 2UV8G 1DQAA 3D9BA 3HHEA 5H1SV 1C4CA 2MDAA 2AEMA 3G6VA 2BABA 4IH5A 2Y1JA 2CAJA 3ETOA 1D3WA 3PDNA 1IVZA 1RT3B 4F3OA 3HD1A 4MIWA 1HIYA 1F5CA 3QBCA 3D6MB 3UN3A 1SI9A 1TK5A 8RUCA 3AXKA 1NSKL 3M6WA 2XMKA 3FQLA 3QO9B 2ZHAA 2UUWA 3TAMA 4EGLA 4DF8A 3C2PA 1CPZA 2CNOB 3CDAA 5F8HA 4N76A 3N6MA 4DV6J 1N36F 2EXUA 3L7UA 3TEGA 3TUPA 2BE2B 5KFRA 4GKKJ 4OYXA 3OVSA 4U95A 5DM7Q 5KT3A 4MYTA 1TUWA 2I5JB 1MW7A 4TKTA 2GGPA 3PACA 4A48A 2ZITA 2LU2A 1W2BR 1IR2A 1UWBA 2W7PA 3DOMB 2WBMA 5F0WA 3PVXA 3CCTA 4ENOA 3HK2A 4USUA 1RLCL 5LJ5Y 1FD8A 2R2TA 1HI1A 1T9TA 5M2UA 1AB8A 1VFJA 4O4GA 4N7TA 3ISND 4I69A 1S9EB 2B3TB 4DOZA 1LWCA 7AT1B 4WP8A 4B9SA 1DHMA 5GAEI 4URSA 2Y0BB 5LSLA 5ADZA 1RTJA 3NS7B 2J9DA 1RBAA 1RHQB 4MMOA 4TU9A 4MKVA 5L9XA 1WF1A 4DR1J 2BJDA 4DV5J 1Y5NB 3QZ8A 1FTRA 1S1XB 1T3OA 1YJ9S 2ZH2A 4DCPB 3P3DA 3QPIA 4QWEA 2OPRB 3PKYA 2QLXA 2BOAA 3MAAB 5DQHA 3NGDA 3UWTA 1AZSB 1WEXA 4WFYA 3M05A 3FJ2A 4FF3A 3R7SB 3M2UB 4M5JA 4RBVA 1RAOA 3PR5B 1DZ5A 4LF6J 4WP9A 4Q43A 1K8AT 3MMBB 1V3RA 2VG7B 2HNYA 1U49A 4NI2A 3SSSA 5CYQA 2FLOA 3E01A 1LWFA 3QSIA 3JTPA 3C14B 3QFHA 2ATLA 2PFFB 3LAKA 3BB5A 1RT6B 4AD6A 4FVCA 4P71A 2O01C 1YJWS 1QSSA 5HVFA 5HP1A 1WC3A 4EFAC 1BE4A 4U8YA 3TUZC 1EP4B 2NS1B 3QIPB 2MEWA 2AHOB 3BSNA 3L4BC 1NK8A 1SKWA 2QLJB 1GTEA 5AT1B 3GTYX 1GTHA 3T9ZA 4OHXA 1FVQA 1Q5VA 4LF1A 1B7FA 4KHMA 1REVB 5GMKa 3R1HA 2BX6A 3MTKA 4ID5B 3MECA 1VS3A 3VZHA 3GG1A 5HVHA 3HLUA 2GJ2A 2CA9A 4PEOA 2XMMA 3CCJS 2YWWA 5DQGA 4L74A 3BQ1A 4R5PB 3M32A 2R2RA 3KMQA 4L3NA 1S1UA 2BKNA 2EFNA 2CJKA 3TI0A 1K44A 2F9JA 2UXBF 3HVTA 2FVSA 3PKMA 3KNAA 4FKYA 2LEBA 3CB4A 2KFYA 2XLKA 2ZZTA 4ANEA 2HQFA 1HBNA 2ZFHA 2K7JA 2RRNA 5CD4H 5HK4A 1S6QA 2J8SA 3ETMA 3AJ1A 2AEFA 3ENWA 4U7UD 1FXLA 1ICEB 3MTJA 1R6VA 2E5GA 4YHHF 4IOCQ 2Z57B 4WIQA 1N54B 1OPIA 1N48A 3JTNA 1CJTA 1C0TA 4ZVPB 3G96A 2B43A 1U1OA 2CNKB 2NZCA 2ZNZA 4F2RA 4CLLA 4LSNA 3IA0A 3QJPA 1RHRB 4EBEA 2E5LF 1YBUA 5ETTA 2GIFA 4BWMA 1MSWD 2A18A 2G4BA 4NE9C 4TYAA 4DPWA 2HURA 1N5QA 1B7YB 1O5JA 5BR8F 4ID8A 1S1TB 4LIRA 5ITHA 4F4XA 2MQOA 2UUCJ 1HD0A 4DN9A 4F3QA 2VDIA 2VPYB 4FP9A 2NSBA 5HMWA 3MF5A 4PG8A 4P74A 4ECRA 4KHRA 4FBTA 4WFNQ 3VF0B 3IBFB 1NPKA 2XGQA 2P8IA 2YNHB 4I6AA 3CO9A 2KDOA 2WW4A 3U1NA 2XS7A 3ENVA 2DXEA 1B64A 1HI8A 3EVWA 1D1UA 3I0RA 2Q6BA 2D69A 1F9EB 1PO6A 2WRMA 4K4XA 4DPXA 4IRKA 4NZ6A 3ZZOA 3HHLA 3ITHA 1N0VC 3DFEA 4Q45A 1QAIA 4JV5F 2VJUA 4MFBB 1REGX 4USJC 3EICA 1HNVA 3O3LA 4QW8A 1C1CA 3OUYA 5HI7A 1HARA 4ANCA 3LP1B 3D1QA 5F41A 2N4DA 1Y00A 5KFZA 2CZ4A 1QSLA 1K9MT 4M5NA 2AT1B 2CFXA 1X4DA 4HHHA 3LQVA 4L75A 4GKJF 4JI5F 4OI0A 1RT4B 2GMJA 3PO4A 5L1KA 1YVFA 4USMA 1S5ZA 4PPDA 1AUDA 5EDWA 1HW8A 2HYIB 2QA4S 1TELA 5I3UB 4X4VA 2OEMA 1F3FA 1SJ3P 1EETA 4FVMA 4CYUB 4ES1A 1RAIB 3OVBA 4K0KF 3K89A 2LQ5A 5CZVA 2YPYA 4ILRA 4ZDNA 2XY5A 1MWQA 3LPEA 2HHSA 2AMCB 4FYXB 1UJ5A 1RT5A 2I0XA 2EFPA 3DRRA 4ETZA 2PFDA 4K4UA 1BGXT 2LQBA 2FHJA 3IG1A 3BS9A 1XERA 2OEJA 1ACMB 2AZ1A 1F9FA 3D67A 4X62J 2UXDJ 3IC1A 3Q8VA 2WW8A 1RT2B 1XNRJ 4J5OA 2KFNA 5EN1A 5KFNA 3CCMS 2WONA 2DNPA 2MHEA 2D41A 2V69A 5LSRA 1VJQA 3LA0A 3G87A 1NB7A 3K5NA 2AJFE 4O3OA 2A10A 4C3MA 3TQ1A 1TL3B 5K5MA 2IBKA 4MIAA 3OFGA 4C0HA 4F26A 1AYEA 1Q53A 2X1AA 2XC9A 4ZA1A 2ZOMA 2OTLS 3RR8A 4ZPDA 2XMWA 2PMHA 4X84A 1HW9A 1A7GE 5HQ8A 2G2YA 3DRSB 2VH7A 4QWBA 5MLCV 3PV8A 3KJVA 2DNKA 3C66A 1FVSA 2FVRA 1WSVA 5IQQA 2MQ8A 3TW0A 2DGXA 4UUXA 2UU9F 1OO0B 3OBIA 4R8UA 2W2OP 4X2BA 2DHXA 1R8PA 1V6HA 2DHHA 4QYZJ 2CQBA 4QIEA 2X7IA 3W9JA 2BQ3A 4EEYA 1FWLA 2GX8A 3HKWA 2COLA 1Q16B 3FNNA 3B82A 5K8PA 3LO3A 2M4MA 2CPXA 4ZVGA 3FBEA 2E1AA 2HZCA 4H4MB 3QATA 4Y34A 2ZE2B 4N8OA 3H20A 1VJWA 3HFKA 5CAAA 3V81A 3JAMU 3M30A 2GQCA 3Q23A 5EUHA 3NGRA 4HACA 4UOCA 5AXMA 2W7OA 1HNZF 1N88A 1VBZA 1YBTA 3R5JB 4LF2A 3JSBA 4WXOA 4UQTA 4KTQA 2FJBB 3BPDA 4O3NA 2FYXA 4Q44A 5FJ4A 2V4JA 1RHKB 2OMOA 4J9MA 4ECYA 1TP7A 3NNAA 2CQ2A 3R5CA 1F2HA 2ADBA 2K06A 1YLXA 3T3FA 3AJDA 2ZD1B 4DFPA 5J2QA 4YOEA 4B9MA 4WZMA 3FMBA 2JWNA 3SFGA 2P6TA 3MHYA 4TN2A 1WKKA 4KKOB 3FBCA 5IM0B 2M3DA 2BJ1A 2FJAB 3DHXA 2HRYA 3CJ0A 3KLHB 4JI0F 2KG1A 5E2QA 3RYLA 3UVJB 4WE1A 3NWGA 3BGOP 3M8YA 4I6YA 4WBFA 2E5IA 3TJ9A 1NK4A 1M1KT 2A1BA 3B54A 2A2CA 1APSA 4X4RA 3VGUA 3VVUA 4X4NA 4O44B 3MM8A 1TZ0A 1WJ9A 2BJ9A 3N5BA 4IG3A 3KOAA 1G1XA 2Q1LA 3HCXA 4KGVB 4HL9A 5B0GA 5D6GA 4L76A 3D6FB 2RT3A 1MMNA 2OPSA 1RAGB 2HNDB 3A8IA 3HZEA 1GT8A 3I5CA 1JLCB 2QLWA 3MM7B 1RQ0A 2GW8A 1S99A 4E98A 3KLEB 4M5DA 5KFMA 3U27A 5F3ZA 4YDDB 4OHYA 3QSYB 2KVQE 3Q2SC 3NNCA 2XY6A 3CJKB 3MCOA 2YKNB 3C8YA 1S6UA 4KO0B 4DSJA 4NCGB 4QIWD 2DNYA 3SV4A 3FSYA 4RL1A 3LP2B 1TVRA 4OHVA 2XEXA 3D3BJ 2MPUA 3SXLA 4DJBA 3S01A 1JLGB 2DR7A 1RK8A 4N47A 3OR1B 4ZJLA 4ZPVR 1S1VB 2OIHA 2MZTA 4OX9J 3HHNB 2IC3A 1FJGF 5IWAF 1Q7YT 1YGYA 4IOBA 2MZSA 3M6XA 3DDNA 4C8KA 3MPDA 2KT3A 2UUTA 2AYMA 1H3DA 2A3JA 2NPIA 4KT0C 5LJ3Y 5D4NA 4RW6A 2FIUA 2DH9A 5LL6d 3NG8A 4CH1A 4NEZA 5C5JA 5D78A 2ILYA 4Y2MA 3CMAS 2OTJS 4OI1A 4ECZA 4KV8A 4GVBB 4A8WA 1SL2A 3QGIA 1T9YA 1JWWA 1JNZB 3KUHA 5LT5A 2VKZG 2RKIB 3D6TB 2DGSA 2F4VJ 3AOBA 4QIFA 3LGNA 3MEDB 1QE1B 2F5GA 1KLNA 3PJ9A 1NMEB 3KXDA 4OJGA 5T7LA 4X64J 1NPRA 3J7YU 1GQEA 2XHWA 4ZP7A 2AJ1A 4CTAB 1HBMA 2SXLA 1XR6A 2Q43A 1WC1A 4PG5A 1CULA 5J1NA 1NM2A 2KJVA 2ROGA 4UF4A 2B5JA 2D74B 4ZMMA 5A8KA 1DTTA 4I6WA 1KQSR 4DLGA 1R8CA 1RWMB 1JXVA 2V8GA 3I6PA 3SDEA 3H7HB 2DR9A 3CCSS 2JLGA 3H5YA 2HHHJ 4DFMA 2AP6A 3AD7C 1S9GB 3PX6A 4EYIB 1RKIA 4YR0A 4NYZA 5FD1A 1MROB 1RT1A 3KHRA 3KK2B 4USKA 3Q2TC 4ZP9A 4Z37A 2R8HA 4NRUA 5FLXU 4OI6A 1RAHB 3FGVA 2YKOA 3R1LA 2EPIA 3CJQA 1SV5B 3I32A 1RTZA 4DR2J 4YQWA 1ZH5A 3X1LB 3WIVA 2FJXA 1WC0A 1HBOB 3Q22A 3M2RB 4DV4F 2QSWA 4JYAF 1MLAA 1Q1KA 2VFTA 2AYEA 1WG5A 3DGPB 1JJHA 1Q0NA 2AJQA 3KKFA 2NXEA 2HFSA 1DARA 3R7NB 2V8PA 4LF7F 2YH0A 4QPXA 2RHQB 2LEPA 2VA3A 4NLVA 4WFXA 1F3VA 2OFGX 4IG0A 3TX8A 9RUBA 2OPQA 2C2DA 3SQGB 5AE2A 1I6JA 4QWDA 1UMJA 3QT7A 1WD6A 1NK9A 2J0XA 4I67A 3JYTA 3HFZB 1LQ9A 4DR7J 1F2GA 4OZNA 2W2NP 3QLHB 2IA0A 3O2IA 3OTBA 1O8BA 5GAGI 3ENQA 3POTA 4DLEA 1GXUA 4KFBA 1RYSA 1CJKB 3W2WA 2X3GA 4Y65A 1T05A 2WVFA 3ZXWA 2V4RA 1HYSB 2FGCA 5AXLA 1FKAF 2VOPA 4DR6F 4PWWA 2G2ZA 3QT5A 2HHTA 2NYIA 3QGGA 1SKUB 5E33A 2H9ZA 4A8FA 1GK8A 3QIDA 4TY8A 1TKDA 5KFFA 3BGRA 1ZA2B 3QRPA 1CJVA 2RVJA 4DV2F 4JI8J 3HHDA 2LQJA 1H98A 1S6PB 3PW7A 4ZS6A 2HWIA 3MAHA 4FBUA 2V8HA 4ILLA 1D9AA 4DI6A 3SV3A 1QM9A 2ATCB 2YH1A 3GYXB 2M88A 5HBMA 1ELOA 1NLKL 1RCXB 2GJFA 3NNHA 1YKWA 3DLKA 4WF9Q 4IFYB 4IRCA 1OY8A 3P96A 2DEJA 2R7SA 5C24B 1N36J 1X31C 2AEJA 1P6TA 1VGYA 5G0RB 1TAUA 1MWZA 3FFIB 5EWEA 1HI0P 1GEHA 1UWAA 3HP6A 4OYBA 1LW0A 3I9ZA 2OFHX 1HWKA 1UVLA 5DLFA 4B9VA 5D0EA 3CMQA 1S97A 1EARA 3MMAA 3GMGA 3BO3A 3SIPB 3ULHA 3AB4B 4ICLB 3I0SA 2JFDA 4MKAA 2V9KA 2ZC4A 3IO1A 6FDRA 1YJTA 5K8NA 3MPWA 3VTIA 5KT2A 1UW4A 2HBYB 1I1GA 1UEVA 1FK9B 1TQLA 1NDCA 2Z2ZA 2UXCF 4B9NA 4PWUA 1JLEB 2Z0GA 4LUBA 4X4TA 2RU3A 4MJKA 4RPFA 2VC1A 1B3TA 2PI4A 1T03B 4C8ZA 4OMFG 1IKYA 1I51B 2BJ7A 3PRDA 2PMZD 3MCMA 1DFDA 1QY7A 1FJCA 1GX5A 4U7UK 2FVQA 4ZJOA 3PYFA 4OZJA 1S72S 4JI7J 4LR7A 1BY9A 1CQNA 2FUG9 4BCAA 3G6ES 3OFFA 1IR0A 2B6AB 5EX3A 3G8SA 3M8PB 2Y8WA 2FY8A 3EXCX 1R7IA 2PI5A 1BXNA 4I0WA 5JXSA 3NEKA 3AQOA 3T5LA 1EAYC 2E9ZA 1WC6A 1VC0A 1OIAA 4PWDB 3FBBA 3F41A 3U1LA 3AODA 2ASJA 1V9OA 1RTDA 3CJ8A 4USIA 3GZ7A 2XSJB 3GFXA 4N41A 4B17A 1G3OA 4CT9A 3CJ4A 4CLZA 4C9DA 4ZVHA 1NH7A 5KG2A 1HR0J 3V6KA 2EFVA 2EBGA 3NBPA 2F3JA 2LLZA 2UXBJ 2H48B 2F40A 3FRZA 4DR4F 1B0PA 1H73A 2ZBIA 2AQ4A 2ZBRA 4DZ6A 4EYHB 4PUOB 2B0GA 3OXLA 5HL7Q 2Z58B 4YHHJ 4YB5A 2FC9A 4A47A 3AT1B 3EZ5A 1TV6B 1M1HA 3RW6A 2KHDA 2JC1A 3IWNC 2ZUAA 1NJXA 2W2PP 4TLRA 2GQ2A 2AGOA 1SQGA 2RAQA 2ERRA 4ZVRB 3H25A 3MDFA 2CZVC 2PD1A 3DRYA 5IFMA 1EHWA 3QGPA 3QZ7A 2MGZA 2UUAJ 1KP6A 2E5LJ 2BOPA 4ZVSB 2RNEA 2J6UA 1C2PA 1FO1A 1RE1B 4PYAA 2P9CA 1UAWA 1QAXA 2OO4A 3DRPB 2DRDA 1IKWB 2MQLA 1H2TZ 2D9OA 1UFWA 5DETA 4C11B 2UUBF 1KQKA 3H5SA 5A2QU 4GMKA 5CHCB 1FKPA 3HZGA 4JI1J 1OSCA 4ZCIA 2LDYA 1KVKA 1N5YB 5HROB 3IWXA 5KFJA 3QT6A 2P9GA 3W3SA 4O3RA 3N9UC 3OJUA 3RZAA 2RS8A 1MU2B 4A8OA 2WZ1A 4A8XA 1KLMB 5GADU 5IV4A 2GC8A 2EG1A 1N56A 2VPZB 2RDIA 3ILIA 4CLKA 2M70A 2O67A 1LOUA 4CO2A 3FBFA 5ETLA 4B3MF 2HVIA 5HMZA 3GP9A 2I1RA 1NCLA 2GV1A 3HULA 3VGSA 3EGWB 4KH1B 4OYIA 3G82A 1HFEL 2ZH3A 2EBEA 5GMDA 1HWIA 2LA4A 3HSDA 5C2CA 4ECSA 3D7SB 1FXDA 4NCBA 4KGZB 2HK3A 3DI6A 2IMWP 1R43A 2YNGA 4JI5J 1E6YA 3W63A 2ZH6A 1KTQA 2RUSA 3H5XA 3NLCA 2YTCA 2V4QA 1F5BA 1X5OA 2PIIA 3CD0A 3EGZA 4QWAA 3AAWB 4ZCMA 3P4UB 5CABA 4MK7A 4H4KC 1TMJA 2Q6CA 3C15A 5K14B 3CD7A 1ZM3A 4FYYB 1EX8A 2J6SA 4K0KJ 1IKXB 2CJYB 1EKSA 4B3OA 2MMYA 1KHWA 4CRJA 1UEUA 1JLFB 4PXDA 1RWUA 2GHPA 1N32F 3NCRA 4FXVA 2YKQA 1VQOS 5IT4A 3KJNB 2Y8YA 2K3IA 1R89A 1RTHA 1X4HA 5AJ3F 1M0SA 2QX0A 5C42A 1J5OB 3GV5B 2W9CA 4WTYA 3BYPA 1ITPA 4M8LA 1FRKA 3JSMA 2NYHA 2VASA 1TFYA 3A12A 2AJ0A 2EC2A 5CCMA 1XMQJ 4P6QA 4K50A 4Y2CA 1LXJA 3VV2B 2Z4PA 4HH0A 1AW0A 3UN5A 1U09A 3W60A 3W2VB 5DDQC 1RU1A 4QIGA 1N52B 3RBEA 1Q95G 5KTQA 3QGHA 2FLPA 4V1Ak 3ONQA 2QA4G 2KM8B 5F9LA 2IPOB 2QRRA 5F8MA 1NKEA 4MKBA 3WZ0A 5J1EA 1W7WA 2UVRA 3OTCA 4N8NA 1UETA 2R4FA 4C0BA 1GXTA 4OZ0A 2FC8A 3FEZA 2OD4A 3EUNA 3O44A 4PABA 4DX6A 1U45A 2DK2A 3A4TA 3PNIA 4F4YA 1NJYA 3IRXB 2H54B 3U7JA 3S7RA 4ED6A 4RNMA 2UU9J 1U4BA 4LRCA 2GVZA 4Y3CA 2LKZA 3MM5A 4NWBA 2OPPA 3EDQB 1QUVA 1NUEA 2IHR1 2C2RA 1RT2A 2OMLA 4K4TA 1OYEA 1FNOA 4AUKA 4FNIA 3TO8A 4UZBA 4MAKA 1RWPB 4RW8B 2QYCA 4P52A 4OFZA 2X51A 3OL8A 1CG2A 2QA2A 4IQMA 2KM8C 3TA1A 5H9FK 3I55S 2ILZA 4UOFA 2CQ3A 2XCPA 1XQIA 4LFAJ 3GSIA 2CQHA 4BC7A 1VQSA 2DHSA 5AE1A 2DD8S 1YJVA 2VU5A 1X4BA 1KBRA 2U1AA 5EHHA 4U8VA 4DV7J 4WU2A 3H5UA 3O1LA 3SCLE 1ZAXA 1CEZA 1FEEA 4Z2XA 2E1CA 3LF0A 3ILLA 3J81Y 2B8QA 4J9PA 2KYZA 3T1HF 3TA2A 1UVKA 3KK3B 5C2GA 3VAFA 4G1QA 3ZTSA 3CT9A 3W5ZA 4QU7A 2XNQA 2J5AA 2HVEA 5LMUF 4JI0J 1TL1A 3Q0AA 1ZPVA 3LOUA 2G0CA 3VQSA 5CXTA 2HWTA 4JV0A 2LXIA 3MPUB 1YDLA 3CD6S 4LQ9A 2MKKA 1R27B 4C8MA 3W62A 4F4KA 1IWGA 4CO0A 5B0CA 1FCAA 4LR8A 3C3LA 3PX0A 2IRYA 1WHVA 5DLGA 2P9EA 5KFGA 4IDKB 5BYRA 4L6V3 2M0GB 1BHNA 3VAGA 1FX4A 2B4UA 2X1GA 5M2PA 2JH3A 3BQ2A 2W8LA 2F65A 1Q79A 2JNJA 3NAHA 3PJWA 4PG4A 2XS2A 2JX2A 5SUHA 4AQYJ 3JAMY 1IXKA 1N34F 1Y7PA 1VHFA 4C3KA 2IFXA 3KJQB 2B9YA 4ZVEA 3AJ2A 3J80Y 4I7FB 1XIQA 4ZN1A 1WEYA 1QAYA 1QD1A 2FTRA 2J7WA 4NL5A 4FS1A 2R7QA 3Q83A 4K2JA 1NK6A 1AFJA 1Q7LB 4YY3F 4OYZA 1VQYA 1Z2LA 5F8LA 2FLLA 2WSEC 1T3NA 1IBLJ 3BEGB 1FRMA 5HJXA 2ZJQQ 2W4DA 2PN6A 2IAJB 2C3MA 4C8YA 2W9AA 4OV1A 2HSEB 3I82A 4LSLA 3H2UB 1KS2A 5KFKA 2BR0A 1VC6A 1JJ2R 3GFYA 3ZZPA 2JVRA 2RH3A 1ZBTA 2B7BB 3V6DB 3LGHA 1HWJA 1RUSA 1SB6A 2BV3A 2IM3A 5EWFA 3PEJA 5RUBA 2VBZA 1OY9A 4NLUA 1L3TA 2W2MP 2B51A 2GAGC 2ZOFA 2X1BA 1ZM4A 3DLJA 2QMUB 2VQFF 1TL4A 4L72B 5J2NB 3A13A 2UZAA 4ZVQB 2YKMA 4PG6A 3EXYA 3DLEA 2R7RA 3G71S 4CO4A 1HNXF 3WDOA 3PO5A 5CA5A 3FCVA 1YWXA 2KHCA 1Q8LA 1NK0A 1NHKL 2VG6A 2XMVA 4RW9B 4OZ2A 4LF5F 3FCHA 4X4OA 4Q0BB 3ET6A 3K2YA 2ZEJA 4FDFA 1ZM9A 3UE2A 1SJFA 1SKSA 2EKNA 3HXMA 3CJ2A 2BVZA 5DGBA 2K1RA 3CJTA 4LFCJ 2E7WA 3AHPA 2R2UA 3QNWB 4OZ3A 2RQMA 2KZZA 1Z4UA 3N79A 1JQGA 1RT7A 4B3TJ 4DR3F 3E8OA 1TKZB 5KOWA 3MMCB 1ZETA 3MGJA 4JYAJ 3GCWP 3CXCR 3BKTA 4M63A 2KH9A 1UTAA 3LGMA 2V8DA 3UD4P 1WTBA 4DL7A 2L48A 1BLUA 3Q8QB 4D3GA 2R9LA 4X66J 1FX2A 4OQJA 3MM9A 1F6TA 4ZHRA 2H4YB 1N0UA 2EW9A 2KZMA 1D0EA 1VQNS 3H0PA 2HQGA 3GIRA 1YITS 4DX5A 2DGWA 2MJUA 2ZVSA 4F4WA 2ZZNA 5D0HA 4ED7A 2DGOA 2DT9A 3MAQA 1YJ7A 4WK3A 3UDEA 3GWCA 4HT5A 2QA1A 4ZPBA 1IJEB 4FN5A 5AXKA 3CMES 2R8JA 3I87A 2AZ3A 3M6UA 3DYAA 1VHIA 1NNDA 3K0JA 3NOGA 4F7VA 1KQGB 1Y3JA 1KEKA 1LKZA 1Y0HA 5FDLA 3OD2A 3EZOA 4C7QA 1WOPA 1P1LA 4HLBA 3IS9A 4AL5A 1B0VA 2ACMA 1HBOA 3R5BA 4KGMA 2AYGA 3M8SA 4FKXA 3T1YJ 2V2KA 3EE3A 3KUGA 1JKHB 1LWEB 2NQPA 5A8RB 5I42A 1N6QA 4A8KA 2E1RA 4G1IA 3BGFA 3GCXP 2VFRA 2D3UA 3R27A 4H4OB 3O5TB 1HLWA 2I9SA 1S57A 1GMWD 4DN0A 1HQUB 5LM7E 5KG1A 5DG9A 4J9VA 3MWBA 2OKQA 3AH6A 4JUZA 1KWMA 1C0UA 4QPTA 2BANB 9ATCB 4HR2A 1SUQB 5A0YA 2I38A 4NLQA 2K7KA 5D8HB 5B0EA 1ROFA 4K5RA 5IXUA 2IY5B 3I56S 2R7TA 1NO8A 3T41A 1DRZA 4UTGA 5IZHA 3WX4A 2HS0A 1U8SA 3I5BA 1YJUA 2MZJA 1F5AA 1HL6A 2JEGA 2OP5A 2KI2A 3M8QB 2XGPA 3NGTA 2Z30B 5KFLA 4QJVA 4EU0A 3AY0A 5LMNJ 3UNGC 2B9EA 4ZIWA 3BF4A 1FKOB 2HFVA 4E0DA 4ED1A 5HQLA 5FIIA 2ZH1A 1RBLA 2D1CA 4ETXA 4ZOSA 1PC5A 1S79A 4FYDA 3DOKA 4RNHA 4AE5A 3ELHA 4C0OC 3JB9k 5C25A 2HMIA 1JB0C 4DV0J 2V8VA 4UUWA 1PAEX 2YQ3A 3C6TA 5AXNA 5BYQA 3B4MA 3OQ2A 4ZCKA 3GR0A 2DY1A 3L95X 4JP8A 3TAMB 3CPWR 3K17A 3R2DJ 1RACB 4PQAA 4Y6IA 1OQ3A 1HQEA 2FHKA 3ZO7A 4K4SA 5KFAA 2C2KB 3NS6A 2UVUA 2KRRA 4BBYA 1VQ6S 1SC4B 3BKUA 4X65J 3JQKA 2VG5A 3BH7B 1S49A 3TUJC 1G7CB 1D8ZA 3A3NB 4O3SA 1MG7A 2GGPB 3BR8A 5H9EK 2CQ0A 5F0UA 3R9LA 1ZM2A 1UWBB 4OX6A 4CO3A 2GVDA 1DLOA 1SIZA 1ZAWA 2CQCA 1FDDA 2PEBA 3MPVA 4H54A 3DLLQ 2VQEJ 3DLGA 4DR5F 4O4GB 4TQRA 2ZBPA 2CPJA 1I3OB 3MR3A 1LWCB 3UCZP 2BDPA 2YWGA 2RMLA 3GFZA 5HJYA 2DRBA 2CQIA 1GFWB 5GMEA 2NXNA 1JXLA 3UDVA 1XMOF 1LFPA 3LP0A 3C6UA 5HLFA 3KK1A 1RTJB 4J9OA 2DNNA 1B99A 2KYXA 2Z2LA 1T03A 2PT0A 1U6FA 3I31A 2DIUA 2WVEA 1DTQB 1N8RT 3KLIA 3LH2S 2BM1A 3G86A 4NLGA 3VR1A 1F1BB 4ZJQA 4F3MA 3MR2A 2YWFA 2HVZA 3GJSB 4ELUA 4DV6F 2W2QP 3GIJA 3G6XA 2RHSB 1JNRB 3PHEA 1S1WA 1S7HA 1W2IA 2HIQA 2HNYB 4NI2B 4FXDA 5CYQB 4B3SF 1PJ7A 3E01B 1LWFB 3LPYA 3OV7A 1NJZA 3I4PA 3TZYA 5HP1B 3DNCA 3PW0A 3P6YC 1OQ6A 3SI8A 1UFLA 1L3VA 1CQMA 3EWGA 4B9UA 4CLYA 2XQCA 2XMTA 3NY0A 1HD1A 3V2UC 1WF2A 3GFHA 2K3KA 2MLYA 4P10A 4A8MP 4GC7A 3MD3A 1ZAVA 4DR1F 3MECB 3G8QA 3HVRA 3EYZA 3FZ2A 4FF4A 2G2OA 4M5MA 4ED4A 5L1IA 5I3PA 3QAUA 1FHTA 2DGUA 1MNEA 4Y2IA 3M32B 3H98A 4B3RJ 2MY7A 1DY3A 1S1UB 2CPIA 2DTJA 2DCLA 4LF6F 4M5LA 4FPRA 3HVTB 3BSOA 3MEGA 6AT1B 3CUNA 2XMJA 1LK5A 3NP5A 1HBNB 4AFFA 2DPIA 2ZH5A 3LW5C 5JVHQ 2R7WA 2C2EA 1S6QB 3DXBA 2R7XA 1UKUA 3H40A 4CM0A 4ZPWR 3KLFA 1WOOA 5ETPA 4CLSA 5HANA 2PA3A 4QBUA 3RG6A 1IBMF 1VQ4S 2YX4A 1CJTB 1C0TB 4YR3A 1X9SA 4W92B 3CIMA 1MN9A 2GAHC 4MK8A 4EBDA 3JS9A 4TNOA 5H9FJ 2LP4A 1U48A 1WACA 3P5TL 2C2OB 2F8MA 2E5HA 4DS4A 1HBUA 4RO0A 4CLTA 1UVIA 4OZ1A 1LNQA 1X0FA 4W4MA 4CLPA 1M5PC 4DQIA 2HEKA 2HG4A 3AOCA 1R3NA 4RW4A 5KFSA 4XPEA 1BQMA 2WBRA 1BWVA 1NZAA 2H5IB 3P8BB 1EQ0A 1KVJA 1DBDA 1AA1B 4HT7A 1M5OC 1TKXA 3ICLA 4LRFA 4JOUA 4ED0A 1RWVB 1VIXA 5IC4B 3WHIA 3R7BB 3THTA 4DCJB 4AL7A 2DHGA 4HDHA 3OHBA 1PC4A 2BJ8A 4CH0S 2DNZA 2CVEA 1U24A 1VISA 2A6OA 3VGTA 3CDBA 2BRLA 1RTIA 3W9HA 4NMXA 4WKRA 3L7PA 2GIQA 3QQCD 1FEHA 3K58A 2GMLA 3I0RB 3CC2S 4Q8EA 4YR2A 1QJHA 2XMUA 1OPZA 3HT3A 1S0OA 2D3ZA 2CPHA 3HHLB 3ITHB 3CCES 3FZBA 4ECTA 1HNVB 1KRPA 3GV8B 1CC7A 1C1CB 2HGLA 3OUYB 1V3ZA 3TNVA 1T9XA 3TR5A 1HA1A 2C3OA 2JRSA 1FWKA 3I96A 3ADAC 2BMBA 2EKYA 1KVIA 2NSCA 2W9BA 4U7CA 4L3KA 2DR6A 2GHVC 1EETB 2UUCF 2LQ8A 3BV8A 5F3TA 3B78A 1V3SA 2OGUA 3D6HB 2QN6B 2ZOGA 3UI3A 2NXUA 1RT5B 2VB6A 3DRRB 3GR1A 5DDOC 1XC9A 2RE1A 3IG1B 3HHLC 1CJUA 2CQDA 1OS5A 1GAOA 3PIPQ 3W65A 5GAHI 1TK0A 4ECXA 1LK7A 4CLWA 3U1MA 4J9RA 4HDGA 2WONB 1Q86T 4DG1A 4MKYA 1WUUA 2RDDA 5T14A 3HD2A 3G2XA 4RNOA 2L08A 2CIMA 1VQKS 3B6BA 1IM6A 1JLQA 3AQPA 1I94F 5HO4A 3BJYA 1IJFB 4NA2A 2ASDA 1HNWJ 2NXJA 3DU6A 1JX4A 5BXIA 3BPSP 2YNFA 4ER8A 3TYTA 4PG7A 5D3GA 4A8YA 5C7PA 1XTZA 3T1HJ 2HGNA 4QYRA 1P8GA 1NB2A 1WDDA 2XSFA 1G2EA 3W64A 1UVMA 5LMUJ 3WQPA 4QW9A 3M1VA 2Z8QA 2FLNA 4LFBF 3KJVB 1FI4A 3IM8A 4DL2A 2QMWA 2RS2A 1TFWA 4R8UB 4WK1A 2RRBA 3IFEA 3UDCA 3WBZA 2CQ4A 1B0TA 1SH0A 1HMVA 1UZDA 3LANA 3VAKA 3M2VA 4LMZA 2PMWA 2UXDF 4HI1A 1C4AA 4I56A 1XNRF 1D09B 1ZS6A 3R5GA 4F2SA 3T5JA 2BEFA 2W4PA 2RQ4A 3MM6B 2H65B 1KNZA 4CLUA 4QOTA 3V81B 1QDUB 3M30B 2CG8A 3S1TA 2J9CA 4RZRA 4DUYF 4HACB 1SL0A 1RSCA 4S0MA 2WAQD 1UVJA 1IKVA 2VIHA 2N3LA 4HH1A 3R3TA 2V50A 3M9NB 1JLAA 2YWHA 2V4JB 4J90A 1GH8A 2XZTB 1HWLA 1RCOB 2OHDA 5KG3A 3THPA 1H2UX 4QR1A 1WHWA 3TVYA 5GAEU 4QIVA 4IRDA 4TXSA 1Q82T 1FERA 2EEYA 5CYMA 1LV5A 3IR6B 2RRAA 5J2QB 1P27B 2WSCC 1SJ4P 4P2FA 1R0BG 3MD1A 4RWXA 3PW2A 2EC0A 2C3PA 2V34A 4YY3J 1YRUA 4ED5A 3NS5A 1KFSA 2HAFA 4IYQA 3BM7A 1VCTA 2MYFA 2OSQA 3KUEA 4XK8C 4WE1B 3C46A 3R2CJ 1NKCA 3GSDA 4IUFA 2C1EB 1VRUA 4QZVB 4DCOB 1K1SA 1U2RA 3KNGA 3B4DA 2ZDPA 3MM8B 3HSJA 4ZPTR 1VQPS 2R8KA 4IG3B 2FD2A 2HNZA 2F1FA 3ZZZA 1T8EA 2R7UA 4OLOA 2FY1A 4NLPA 1XN9A 4LBIA 2HGMA 2XLIA 4DUZJ 4TU8A 2OPSB 3V4MA 4OX7A 2FZCB 3RUBL 3ZZYA 4HTJA 4DU8A 1R0AA 1RWOB 5HMYA 2NZ4A 5ETQA 2VD3A 3PW5A 1S4FA 5M2RA 2DNLA 3SCJE 2CG4A 4M5DB 2IIHA 2ASYA 2EK6A 1RI7A 4OYMA 3DM2A 1B4SA 4C8LA 2V68A 2YWKA 2VQFJ 3FUYA 2DH7A 2KXHA 3RAXA 4OYAA 4KSEB 2N3OA 2XHCA 1HNXJ 1ZPWX 1TVRB 2UV8A 3I5AA 1TKTA 2IVMA 2IRUA 4C98A 1UEKA 2AW0A 2HLUA 5KFUA 3IN5A 4RKUC 3OSPA 2IC3B 2Y1IA 4XTTA 1HNIA 1P9QC 1N33J 3TWZA 1QVFR 5L38A 2IAJA 2CQPA 1JK9B 2KO1A 2HZVA 4RW6B 4Q7AA 3TAQA 5KG5A 3LWLA 2J9DE 2XTJP 1K73T 2MJNA 4KV8B 5DS7A 3TOQA 2HWHA 3PRVA 4DR3J 2WOMA 2HHQA 3ZFVA 1HKAA 4XDDA 2GIRA 1RWNB 1Y5IB 4M5KA 1TL7A 4CO1A 3MR5A 2FQQB 2VFSA 4ECUA 2E9RX 3QRQA 4E2FB 3D28A 2BKPA 3KHGA 2QL5B 1HPZA 4IFVA 1GNKA 1XNQJ 4D3HA 2VKRA 3ZZ0A 5K8MA 4YUDA 3TZZA 5T7LB 1W25A 3KG4A 3DMJA 1RYRA 2XI3A 1HBMB 1U2FA 3UO0A 2M2BA 1CULB 4I2PA 4P2SA 4DV3J 5IOLA 4OX9F 3RW7A 4WFBQ 2OJ3A 3E3XA 2B5JB 4ANDA 5A8KB 2W7AA 2HHVA 1DTTB 2HBQB 1B70B 3K8VA 3GLJA 4R25A 5E5NA 2R8GA 3TUIC 2MLXA 4NLYA 3SDEB 1PG5B 1P1TA 1TAQA 4RJVA 1BQNA 5DJBA 1FA0A 4DUTA 2DNHA 3LAMA 1C1BA 1DAXA 1WC5A 2BW2A 3FMWA 3H2LA 1RT1B 3D1HA 4B9TA 4FF1A 2KFZA 3SSQA 3D0IE 3IWLA 5BYSA 3DU5A 4LF4J 1H7WA 3Q8SB 2F4VF 5H9EJ 4NA1A 5ETOA 2VA2A 3OTOF 3GILA 2KT2A 1P9YA 1U0HA 3G9CA 5CCLA 1QAJA 1CS4A 3M9MB 1WHXA 3MXHP 4X64F 3PHTA 4RW7A 1SBRA 3RTVA 1K47A 5E3AA 4K7QA 3W66A 3CEDA 1J5EF 1S77D 5E0OA 2O66A 4DPYA 2FHOB 1PJ6A 1LW2A 5J2PB 2MQQA 3N6LA 1RKJA 3PFOA 4YN3B 4K8RA 2CADA 4RBUA 3M6VA 1YRTA 4IG0B 3F0NA 3GU0A 4EK2A 2IYGA 1F0XA 2Q66A 2OPQB 2CKWA 1S10A 5D77A 4M5IA 2F8EX 4ZLNA 3VAIA 2QLBB 4NYPA 1NXIA 2LA6A 3JYTB 1RWKB 4LF9J 3V4IA 1SQEA 2M5YA 2ASLA 3F44A 3POTB 3GJRB 4KFBB 1FWPA 3W2WB 1VC5A 2QMXA 1T05B 5CQGA 2W24A 3GIKA 3H4BA 1FXRA 5D0GA 4ZKAA 4YB7A 2GO9A 4YS2A 4TY8B 2JFKA 4DR2F 2GFFA 3BGRB 2P6SA 5I3QA 5EWGA 4J9LA 1CJVB 2QEXS 1U6ZA 2ALYB 4AT1B 1KTVA 4O3QA 1IQZA 1VRQC 3HDSA 5JJBA 3GG0A 4IH7A 3A8KA 2BACA 1LXNA 3OR2A 5HBMB 1R31A 2G13A 3VALA 3BO4A 4KIAA 1EIYB 2GJIA 3DLKB 2F4FA 2CPYA 4ZP6A 1FFSB 2YQ1A 1S59A 2V94A 1KOHA 1Y5LB 2L3MA 1DQ8A 4IR1A 2KT5A 4CI0B 4NLSA 3ZZRA 1A6LA 1XR7A 4FPIA 3QJJA 3CVKA 3K5OA 4OJ3A 1LW0B 3D1OA 1G4CA 3TZXA 2L9WA 1SC3B 4QR2A 1MWYA 5J1PA 4F0MA 4ELTA 4QCLA 2PO4A 1NU4A 3PY8A 5LSOA 5KG7A 3BH6B 4WKYA 3CJRA 4CM2A 4JBCA 4DR5J 3MMAB 2DR8A 1MN7A 4WCEQ 4TQSA 5J2MA 4P2XA 4KJIA 4K5SA 2HS3A 4P7VA 3I0SB 4FF2A 5B0DA 3NOCA 2ZM6J 4I2QA 1NSPA 4JI8F 1EQMA 1XMOJ 2J7UA 3H90A 3EM1A 5KAKA 3KLGA 3QJLA 4NLRA 2AGPA 5KFPA 4NXMJ 3SCKE 5HMXA 3DDKA 2YNIB 3MEEA 2ZUGA 1NH8A 4OYPA 1UCNA 4HTIA 3M8ZA 3HX9A 1PILA 3RB6A 3DN9A 1IKYB 4LR9A 3PEHA 3DOLA 4J9KA 1JLBA 3O6QA 4KHPJ 2MLZA 4B3SJ 1E6VA 2N7CA 4P2MA 1T95A 2G1DA 1XJWB 3BBBA 3OXFA 2C22A 3IRWP 1FD2A 2CJQA 4LSZB 4CNYA 3NMAA 2Q3PA 1R8BA 3HM9A 1WG1A 1PBAA 3KHHA 2XM3A 4E8UA 2ZJPQ 2GS8A 3VQTA 3EPGA 5JVGQ 4HKQA 3L3CA 4IKAA 3V6HA 1Q8KA 4YB6A 1SVDA 4FYWB 4OHWA 2XYHB 4DQRA 4ITSA 1OSDA 3K5LA 1YG0A 1X0PA 3MZIA 1AT1B 4PQUA 3RGIA 2OLWA 1L3KA 2XY7A 1KKHA 1Q4RA 1VQ5S 2AIRB 1RLDA 1URNA 1RTDB 3P45B 4C2MA 1DTQA 3W1YC 2LMIA 2DGQA 4C4WA 4FYVB 4G6VB 1PYTA 1UFKA 4U9RA 3IP0A 2BBEA 3NBPB 3FEXB 1UPPA 3RBZA 4ZLJA 4LF8F 4AL6A 3K7RA 4HYKA 1CVJA 2HIYA 4USHA 5B08A 3ZTQA 5KT6A 3R5DA 5IT9Y 7FDRA 5A8WA 2RIJA 3H59A 1SJRA 4DQSA 3M9OB 3MEKA 1YQHA 1RHMB 4UY8T 4NLDA 3C16B 3OLAA 5KFXA 2CQ1A 1FRHA 4JI7F 3EVMA 3MR6A 4NA3A 2H4WB 2IVYA 2IYIA 4I1TA 1F60B 1IBMJ 1IM4A 4KH0B 1U1PA 4ZPAA 1Q8IA 3HT0A 2MQMA 3V6JA 1T94A 2CJ9A 1RT3A 2J0QD 2HFNA 1YTYA 1VI7A 4DPTA 4TY9A 1YBAA 2MGZB 4USTA 2Z2YB 4WXWA 1LWXA 2CWKA 3TEHB 2RDJA 4FXWA 2CDQA 1KD1T 4ZITA 3RU0A 3QO9A 2KXFA 1PGZA 1U47A 2N7YA 2BKOA 4A46A 3EJMA 3IGNA 1VYAA 1RABB 2IVFB 1AFIA 1VK8A 4GO5X 1HR0F 3VAMA 2BQUA 1FKPB 8AT1B 1WOSA 4DEZA 2BE2A 3OL7A 3Q24A 1FE4A 1HHTP 3KHLA 2I5JA 2MKSA 2M8HA 4USVA 2C2NA 4MTPA 4PAAA 3WC2A 4DV1F 3DOMA 2XS5A 2EFOA 2FJVA 2DRAA 5K8OA 1NDLA 2ZDOA 1KONA 1S9EA 3OPKA 1RWWB 1G6BA 3CWJA 1AROP 1T9VA 1EB0A 5E3RA 1FRIA 1FFWB 4RUHA 4I68A 1UA0A 1TR0A 3CDWA 2WSFC 3G82B 1FRXA 2UUAF 1XK8A 4C8NA 4JI6F 4ED2A 2J9EA 2K2PA 4F8RA 1UJ6A 1X4EA 1NDKA 3DI6B 3RBDA 1S1XA 2YNGB 5KFHA 1E6YB 1GX6A 4ZCLA 5F9NA 2VFUA 5B7WA 2OPRA 1H74A 3LALA 1S4EA 2DY9A 3MAAA 2LEAA 1R8HA 4I4BA 1AZSA 2M7SA 4F4ZA 2YY3A 2JSXA 3M2UA 1M90T 2DISA 4JI1F 3C15B 5KT5A 5JUMA 2Z2MA 3MMBA 4CWBA 4B3OB 2VG7A 3R6LB 4CNZA 3GE9A 2HS4A 2JL9A 2D3O1 2MKYA 4RLEA 4KRWA 3C14A 1S9FA 1X4CA 2GQQA 2KTQA 3BSCA 1RT6A 1X5TA 1RTHB 3ZTOA 2ZH8A 2D3OR 2DH8A 1JIHA 5C42B 2DXFA 2W9CB 2HHPA 2AV5A 3JSMB 5KOXA 1EP4A 3QIPA 1D9DA 1TUGB 2N82B 1U1NA 2DHAA 2GZOA 4Y2AA 2C2ZB 2QYGA 3HHKA 5GAGU 4EUVA 2XZWA 2LXFA 1I94J 1REVA 2FGOA 3ENAA 3OJSA 4ID5A 4ATNA 4MT1A 2F63A 2VBWA 3BR9A 4X4SA 5LXYA 1RHJB 4W98A 3JSYA 4DBQA 4EWTA 4NLXA 3G6YA 5IQ6A 1T11A 5BR8J 5J1EB 3L7OA 2ZWPA 2XI2A 1RBOB 4DFJA 4R5PA 2JHEA 3NGKA 2E1MC 3OHAA 4LFBJ 2EI5A 3PZPA 1N5TA 2NCKL 3D68A 4UZCA 4URGA 1S0NA 3W61A 2GVZB 5DZ7A 1FNXH 3F73A 3MM5B 2XLJA 2OPPB 5KFWA 1FDNA 5AE3A 2HVDA 3CF5Q 1GMWA 4BLGA 2AGQA 2W25A 3NCQA 4C48A 2X3DA 4JV5J 1XMQF 1LFWA 3CC7S 3H42A 2LU1A 4NYOA 4HHJA 2NLWA 2XCAA 2Y9HA 3KYLA 1J27A 5ETKA 1VQ9S 3M4XA 1VQLS 3J7YI 2JVOA 4DUYJ 2AU0A 2KVIA 1SXLA 4GKJJ 2DEIA 4PKDB 3J81U 2CXEA 4KC5A 1WI6A 2DNGA 2UP1A 5T41A 2L9DA 3CCLS 4IO1A 4DPUA 1NZ8A 1OY6A 4Q5VA 1RISA 1FF2A 2LYVA 4FS2A 1NDPA 1S1TA 3CJ5A 4DHVA 2E7XA 2E7VA 3HSGA 2JEFA 4A8QA 5CD4A 1U8WA 2KN4A 2YNHA 4RR5A 4G1QB 2J8AA 4DMZA 2DR5A 4ZVOB 4UOGA 2HHWA 1TL1B 4HI2A 1KOOA 3UD5A 2EG2A 2OEKA 2DNMA 3HO1A 3TZWA 5D4LA 3M8WA 6FD1A 1RP5A 3C19A 4P9SA 4WYLA 4MFBA 3SSRA 1T0TV 4OI3A 3MI7X 1KFDA 3LP1A 3EVOA 3L9ZA 3MM6A 4TYBA 3MCNA 1IWAA 1VQ7S 2V0NA 4YMEA 5K20B 1FDAA 2WVCA 1RT4A 3J80U 4LFAF 2O5DA 1YZ7A 1H0HB 2ZBCA 1VR6A 4IH6A 3W8PA 4OJ1A 1TUVA 5E3QA 2RF2B 2VV5A 1D8YA 3UPFA 1N4LA 5I3UA 1RDRA 2QC3A 3IMQJ 4DV7F 3UFCX 4LVNP 4CYUA 3CCUS 2RU9A 2IMOA 3NWRA 2I8EA 2J7KA 5KFYA 1BWEA 2D9PA 1DQ9A 1GMUA 3PR4A 4NLTA 4LRDA 3OL6A 1U1LA 4WJBA 1X9WA 2B4PA 1YK9A 2BE9B 4RX6A 2AX1A 1QTMA 2DBBA 4ZVUB 1RGVA 4EZ6A 4ELVA 5L1JA 4NLOA 3CULA 4N5SA 5DDRC 1ZTTA 1VBXA 1GMVA 1JJ4A 2LFVA 3T9NA 4F50A 1XMBA 1NEEA 3N6NA 3BSAA 2WTFA 2BRKA 1GXLA 1HNZJ 3D2WA 1TL3A 4YDXA 3CE8A 1FNMA 3PXGa 2H1YA 4LSLB 2YWEA 1KDNA 2XMAA 4W90B 1KQFB 1J2VA 1PIEA 3IR5B 4AQYF 3DRSA 3DRXA 1JXEA 2U2FA 1CC8A 4X4PA 2B56A 3UN2A 3MUVP 1PSDA 3ISNC 2B4VA 1N5SA 1NK7A 3OW2R 3CCWA 4YEAA 3DLBA 2XNRA 4PXCA 1SC6A 3RR7A 3P49B 2BM0A 1SL1A 3PIOQ 2R7VA 2F9DA 4M95A 2MTLA 2YKMB 2EWHA 4H4MA 3DLEB 2OD6A 2ZE2A 2KB2A 4UQGA 2E44A 4CIOA 4JI2F 4DZDA 2MQPA 1H38A 2BQRA 2VG6B 3CC4S 4WFAQ 1IBLF 2FB0A 3RRKA 4Z7CA 5D15A 2Y1LB 3ET6B 2FJDB 3OT9A 2W8KA 3JQJA 1TU0B 4O23A 1WSRA 2RUGA 2CPZA 5DDPC 2ZJRQ 2XWYA 2RD5C 2K1RB 1IN0A 2ZVIA 4OYWA 4DQPA 2QL9B 1X5SA 2KJWA 3ZNUA 2OUGA 2CPFA 3A8EA 3H4DA 5E41A 3FDSA 1WF0A 2ZD1A 1UJ4A 1QSYA 3OTOJ 1RT7B 4G1PA 3T5KA 1VBKA 1URRA 1WKJA 1UVNA 2HLTA 3TJAA 1U2CA 3MUTP 4HEA9 1S0MA 2YBVA 2P2CB 4M1KA 4KKOA 5IM0A 1O51A 3D0GE 1U1MA 2B7CB 1J5EJ 2VDHA 5DG7A 3J7Z5 5EX0A 2IDLA 3KLHA 3IAM9 3CJ3A 3N4WA 2M8DB 3UVJA 3PYGA 3ZZTA 3MM9B 1FJGJ 5IWAJ 2W4CA 4ZHRB 3T6JA 3UR0A 2J76E 2Y1RI 4HHUA 5KT7A 2E1PA 3BN4A 4IQXA 2ZBQA 2XULA 1SJQA 4C8OA 4O44A 2X1FA 2Y0SD 5A6PA 2C3UA 4F36A 1FDBA 1R8AA 1VOMA 3TA0A 2MKCA 2HNDA 2V2QA 1WG4A 1JLCA 2VHGA 4KGXB 4XIUA 3MFHA 3DYAB 3MM7A 2DNOA 4DX7A 2QGFB 4NASA 2BXJA 2QG9B 1VMBA 3KLEA 1NJIT 4Z7YA 3NGSA 4NCAA 4LFCF 2HFZA 3BN7A 3GYGA 2FDNA 3FQKA 5FDLB 1S48A 1QVGR 1JMTA 1YZ6A 2DB1A 1QUPA 1WI8A 3CJKA 3IS9B 4B3TF 5ETSA 2YKNA 4CLFA 1VBYA 4KO0A 1NSAA 1OWXA 1VRTB 3UCUP 2MSSA 3O8WA 2V2ZA 2R7OA 1CSJA 3WX8A 3G8TA 4NCGA 1FESA 3LP2A 2HQ3A 3GYNA 2MKIA 1KHVA 5I42B 1N6QB 1QTNB 1JLGA 5J2PA 1ZZFA 2W1BA 2LCWA 1PYOB 3OR1A 1S1VA 4ECQA 4X66F 1WC4A 3HVWA 4JV1A 2A6MA 2ZWOA 3KTQA 2Q79A 1D9FA 1C0UB 2K8GA 5B09A 2NREA 5A0YB 5HAOA 4J37A 2NPFA 4QR0A 3EGVA 2RJZA 4PZVA 3EZUA 4GVBA 4OV6A 1VLYA 2XYGB 1S6OA 5ETRA 2UVWA 1SH3A 3P5BP 3D3CJ 2RKIA 2HW3A 3HSZA 2MSTA 3MEDA 1QE1A 1NSQA 4A8SA 2HFUA 2HQIA 2PC6A 3CJSA 2L9NA 4FNHA 3FCWA 2JEIA 4DU7A 1X4FA 4DXLA 1SKRA 4DV4J 1BC6A 3QMQA 1VQMS 3ZTPA 1M1GA 2DGTA 3RRGA 2BUNA 3T6BA 3T1YF 3PYEA 2KXNB 2YKAA 2OELA 4CTAA 3DOKB 3AA8A 3US5A 5E3CA 2C28A 4LF7J 2WB1D 4UOHA 2IDEA 2WHOA 5C25B 2HMIB 5DO2A 2HK2A 4CZCA 3TJ8A 1S7IA 4JI4F 2G0IA 4XDCA 3C6TB 3JXOA 3HHLD 5GADI 4K4WA 4PR6A 2DNQA 2KKHA 2J0WA 2QIFA 3WC0A 4WIIA 3OL9A 1BMQB 2ACYA 2KRBA 2XWXA 1XR5A 2CZ9A 4DL4A 1S9GA 4OI4A 2AD9A 2DJWA 2XZDB 1XWLA 1MROA 1HQEB 3NGUA 4ZPCA 3KK2A 3W5XA 3IBWA 4R0EA 1X60A 4DR6J 3H8YA 3DGVA 2VG5B 3WIUA 3PW4A 2MQNA 1SV5A 5LMNF 1OJ4A 2DVIA 5DM6Q 5GVQA 3UCGA 1S76D 5L1LA 4CDIA 3M2RA 4DV2J 2GVDB 5D0RA 4DFKA 1DLOB 1VQ8S 4LBPA 3BYRA 5KFBA 2DO0A 4MIBA 3DGPA 3OXGA 1S12A 4V19X 5FLXY 3DLGB 3UW1A 3VZIA 3N28A 3K5MA 5IS2A 1M5HA 2FHJD 3LUYA 1IBKF 2B8PA 4Y00A 4OZLA 4AXIA 4WPAA 4KY3A 2PGCA 4DV0F 1FFGB 2YNIA 1U25A 3LP0B 3C6UB 5HLFB 3KK1B 4JI3F 3BDPA 3HJVA 3SQGA 1Y10A 4U96A 5DZ6A 1WEZA 3BREA 2VPXB 1TTHB 2V9WA 1M5KC 2ROPA 2V5HG 4LF8J 3PM9A 1H6KX 2FJWA 1H2VZ 3QLHA 2YQ0A 1EJ7L 1SPBP 2CYYA 3KLIB 2PDAA 2XG8A 4OI2A 1U0SA 4PCQA 3VVTA 2DKOB 3CCZA 1ZYQA 2Y3YA 2EK1A 3I4HX 5KFVA 1CJKA 4AYBD 1HYSA 2FJEB 3KJFB 4F4AA 4JB8B 1S1WB 5HN0A 4X65F 3ZNJ1 5L39A 2FZGB 1U1QA 3QWPA 3KG1A 3BGLA 4F25A 3ZTRA 2POKA 4MH8A 2HRTA 3X3UA 1TMMA 2NR0A 1WTFA 4MYUA 5A6WA 4B02A 1S6PA
chains in the Genus database with same CATH topology
1N54B 2LXIA 4RW7A 1SBRA 3RTVA 5E3AA 1OPIA 5D4PA 2VQEF 1N48A 3CD6S 4LQ9A 2MKKA 1R27B 3CEDA 4C8MA 1J5EF 3FVYA 4ES2A 3JTNA 4RBTA 4ED3A 4F4KA 1S77D 5E0OA 2O66A 4CO0A 5B0CA 2FHOB 1C0TA 3R5AA 1LW2A 5J2PB 1FCAA 3G96A 3C3LA 2MQQA 3PX0A 2B43A 2IRYA 3N6LA 1RKJA 3PFOA 1WHVA 2PE8A 5DLGA 4DDFA 1T02A 4RBUA 1U1OA 2P9EA 5KFGA 3M6VA 4OJHA 4IDKB 5BYRA 4L6V3 2ZHBA 2M0GB 2ZNZA 4IFYA 4F2RA 2ZHOA 3VAGA 2ADCA 4LSNA 3IA0A 1YRTA 4IG0B 2B4UA 2X1GA 2IYGA 2RILA 5M2PA 1F0XA 4EBEA 3QJPA 2E5LF 2Q66A 2OPQB 2JH3A 3BQ2A 4BWMA 1MSWD 2CKWA 1S10A 5C24A 2A18A 5D77A 2W8LA 1ZTWA 2G4BA 1Z1ZA 2CQGA 2F8EX 4TYAA 3VAIA 1Q79A 5G0RA 4K4VA 1N5QA 3HVAA 4NYPA 3UDLA 4KR0B 3NAHA 2LA6A 3JYTB 3FFIA 4NXNF 3PJWA 4PG4A 1O5JA 2XS2A 3CGIA 2JX2A 5BR8F 4ID8A 2KU7A 3V4IA 1SQEA 5SUHA 3DC2A 2M5YA 2ASLA 3F44A 2CJBA 2IM2A 1S1TB 3JAMY 4LIRA 3POTB 1IXKA 5ITHA 1N34F 4F4XA 2MQOA 1Y7PA 1HD0A 4DN9A 1VHFA 3OFHA 1FRJA 4KFBB 4C3KA 2IFXA 4F3QA 3W2WB 2VPYB 2B9YA 2QMXA 4FP9A 1VC5A 2L41A 4YFUA 2WCXA 2NSBA 4ZVEA 4X4UA 1SIWB 3AJ2A 1T05B 5HMWA 3MF5A 5CQGA 4PG8A 4ECRA 2W24A 1L3UA 4DSKA 4OZ5A 3GIKA 4KHRA 3J80Y 3H4BA 4FBTA 4F67A 4I7FB 1FXRA 4WFNQ 3MEGB 3VF0B 4ZKAA 3N0VA 4YB7A 2XGQA 2YNHB 2GO9A 4I6AA 3CO9A 2E9TA 2KDOA 4TY8B 3U1NA 2JFKA 2VBYA 2XS7A 1WEYA 1QAYA 3ENVA 4DR2F 1B64A 2FTRA 1HI8A 2GFFA 1YJRA 2J7WA 4ICLA 1D1UA 3BGRB 2P6SA 3I0RA 5I3QA 3HJFA 2Q6BA 2PSZA 5EWGA 4J9LA 4NL5A 2DIVA 4FS1A 1NHUA 2QEXS 1U6ZA 4B9LA 2R7QA 3FEYB 1PO6A 1X7VA 1NK6A 3KLFB 2WRMA 3AA9A 1AFJA 4PXBA 4K4XA 1Q7LB 1KTVA 4NZ6A 4IRKA 3ZZOA 2JLEA 3HHLA 4YY3F 3ITHA 4O3QA 1N0VC 3DFEA 1IQZA 2MB0B 2GCFA 4Q45A 1QAIA 5BJRA 3HDSA 5JJBA 3GG0A 3QYYA 4JV5F 4IH7A 4MFBB 1VQYA 1FK9A 1Z2LA 4USJC 5F8LA 2BACA 1LXNA 1HNVA 2FLLA 2WSEC 3NRBA 3OR2A 3O3LA 5F8GA 4QW8A 4Y2KA 1C1CA 5HBMB 3OUYA 1T3NA 5HI7A 1HARA 1JLEA 3LP1B 1R31A 2G13A 3VALA 3D1QA 3BO4A 3MOJB 3K8WA 4KIAA 5F41A 2FHMA 2LQ9A 2OAUA 2JEJA 2N4DA 3BEGB 2GJIA 3DLKB 1FRMA 1Y00A 3MMJA 3OTDA 5KFZA 1HBUB 2CZ4A 1QSLA 2ZJQQ 2IRXA 2CPYA 2W4DA 1K9MT 4ZP6A 2PN6A 2CFXA 2B9WA 2JJ4D 1ULRA 4AXJA 4RU9A 4QQBA 2V94A 2IAJB 1X4DA 4URQU 4DSIA 2C3MA 1KOHA 4DSEA 4C8YA 2C42A 3DHWC 2W9AA 1Y5LB 2CPDA 3LQVA 4GKJF 2L3MA 4OV1A 4ZLPA 4JI5F 3F56A 4OI0A 1RT4B 2GMJA 2IBOA 4RW4B 3I82A 4LSLA 1BQMB 3PO4A 5L1KA 1DQ8A 1KS2A 3H2UB 1YVFA 5KFKA 4IR1A 5MAOA 2BR0A 2AF6A 2KT5A 1VC6A 4CI0B 4NLSA 4PPDA 3ZZRA 3GFYA 1JJ2R 2CJAA 1AUDA 5EDWA 1A6LA 1HW8A 2HYIB 3ZZPA 4NOHA 2QA4S 5KFQA 2JVRA 1TKXB 1XR7A 3TVZA 2RH3A 1ZBTA 2B7BB 5I3UB 3V6DB 1KSPA 3QJJA 3ZZUA 4X4VA 3CVKA 1U6BA 3K5OA 4OJ3A 1HWJA 3D0HE 1LW0B 1SB6A 2VUGA 3D1OA 1SJ3P 1EETA 4FVMA 2BV3A 2IM3A 4B3RF 2QFJA 4ES1A 1Q78A 2L9WA 4QR2A 5J1PA 1MWYA 3OVBA 4K0KF 4DX8H 4ELTA 4QCLA 2PO4A 2LQ5A 1NU4A 5EWFA 3PY8A 5LSOA 5KG7A 4GKKF 3PEJA 5CZVA 2VBZA 2GMHA 4ILRA 4NLUA 4ZDNA 2XY5A 4WKYA 3MFIA 1L3TA 2MXYA 2B51A 4DS5A 2B6AA 4JBCA 2ZOFA 2HHSA 3MMAB 2DR8A 4WCEQ 4TQSA 1RTIB 3M8PA 5J2MA 2X1BA 4R0JA 1FJ7A 4KJIA 1UJ5A 4LVOP 4K5SA 1RT5A 2I0XA 1ZM4A 2HS3A 2EFPA 3DRRA 2WK4A 4ETZA 4P7VA 4K4UA 4LT6A 3DLJA 1BGXT 2LQBA 2FHJA 3IG1A 3BS9A 2VQFF 3I0SB 4FF2A 1TL4A 4L72B 5J2NB 5B0DA 2ZZMA 1HWUA 4I2QA 2UZAA 4JI8F 3TAPA 1XERA 2J7UA 1F9FA 1VIOA 2YKMA 3IC1A 4PG6A 4Q2MA 5KFEA 3EXYA 3DLEA 2WW8A 1RT2B 5KAKA 2R7RA 4J5OA 4PWDA 3KLGA 3G71S 4CO4A 1HNXF 4U67Q 2KFNA 3WDOA 3QJLA 4NLRA 3U02A 5IT0A 5KFNA 3SYZA 3CCMS 3PO5A 5EN1A 5CA5A 2WONA 2BA9A 1YWXA 2DNPA 2KHCA 3K57A 1YHQS 1Q8LA 1NK0A 2MHEA 2AGPA 3NL0A 2VG6A 2D41A 2XMVA 4RW9B 5KFPA 3EPIA 4WFZA 3SCKE 5LSRA 2XSJA 4LF5F 3FCHA 5HMXA 3DDKA 2RB7A 3JSRA 2YNIB 1NB7A 2NUUG 3K5NA 3MEEA 2ZUGA 4X4OA 1NH8A 4Q0BB 2AJFE 4O3OA 3TP2A 2A10A 4LJMA 3K2YA 3CD5A 4DL0C 4HTIA 1WNEA 4DL5A 1ZM9A 2NUHA 3HX9A 4N77A 3UE2A 1PILA 4C3MA 3TQ1A 3RB6A 3RB4A 4DV5F 1TL3B 4K4SA 5K5MA 2IBKA 4MIAA 1SJFA 3DN9A 1SKSA 2W9BB 1IKYB 3HXMA 3PEHA 3THVA 3DCAA 3OFGA 3VCDA 3CJ2A 2BVZA 5DGBA 3DOLA 4C0HA 4J9KA 4F26A 1Q53A 2K1RA 2X1AA 2XC9A 4ZA1A 2ZOMA 5LXRA 2E7WA 4ZVFA 2OTLS 1JLBA 3RR8A 3AHPA 1XEZA 3O6QA 2R2UA 4ZPDA 2XMWA 3NKYA 2PMHA 2RQMA 4X84A 2KZZA 1HW9A 1T7PA 1A7GE 4PUOA 4CT8A 5HQ8A 1E6VA 4DSLA 2N7CA 3DRSB 1Z4UA 2VH7A 3N79A 1RT7A 1T95A 2G1DA 4DR3F 3E8OA 4QWBA 1TKZB 5KOWA 4QU6A 3OXFA 5MLCV 2C22A 3IRWP 1TK8A 3MMCB 3IAS9 4BHQA 2HVHA 3PV8A 1FD2A 2CJQA 3KJVA 3MGJA 1ZETA 4CNYA 2DNKA 3NMAA 3C66A 1FVSA 2A2DA 2VFVA 1TV6A 3CXCR 3Q8PB 2FVRA 4M63A 4K4ZA 5IQQA 2Q3PA 1R8BA 2KH9A 2O3DA 3LGMA 3TW0A 3HM9A 2V8DA 2DGXA 4UUXA 1WG1A 3KHHA 2UU9F 3UD4P 1OO0B 1XBWA 4E8UA 3OBIA 2ZJPQ 4DL7A 1WTBA 2L48A 4R8UA 3VQTA 1NHVA 3EGNA 2DHXA 4X2BA 3EPGA 5JVGQ 4HKQA 1R8PA 1BLUA 1V6HA 3L3CA 3Q8QB 1S0VA 4KAIA 2YKPA 2CQBA 4IKAA 4QYZJ 4QIEA 4D3GA 2R9LA 3V6HA 2JZ5A 4OQJA 5DRKA 4ED8A 2BQ3A 4EEYA 4YB6A 3MM9A 2GX8A 4OHWA 4DQRA 4ITSA 1OSDA 3K5LA 4ZHRA 1N0UA 1X0PA 1YG0A 2EW9A 2COLA 2FVCA 3D5MA 3HKWA 1Q16B 3FNNA 3B82A 5K8PA 3LO3A 4K2XA 1D0EA 2KZMA 3MZIA 2M4MA 2CPXA 1VQNS 4ZP8A 4ZVGA 1YITS 4PQUA 3MUMP 2E1AA 2HZCA 4H4MB 4Y34A 2DGWA 2MJUA 2HRUA 2ZVSA 1ZZNA 4DL3A 2E29A 4F4WA 2ZE2B 2OLWA 2ZZNA 2N4CA 4ED7A 2DGOA 1L3KA 2XY7A 2DT9A 1Q4RA 1VQ5S 1FJEB 3ZC4A 4DG1B 2IJNA 4NRTA 3MAQA 1URNA 2DGVA 1RTDB 4N8OA 5D4OA 3DRPA 1VJWA 3H20A 1U1RA 1IKWA 3HFKA 4WK3A 3V81A 3M30A 2GQCA 4LSNB 4C2MA 3GWCA 1DTQA 4C11A 2LMIA 3Q23A 1JLQB 2DGQA 5EUHA 4HT5A 4C4WA 2IJFA 3LWMA 4UOCA 2HFOA 3QAEA 5AXMA 2W7OA 4G6VB 1HNZF 2QA1A 2LDIA 1IJEB 2ZKUA 4ZPBA 1U7LA 4FN5A 1N88A 5AXKA 4U9RA 1VBZA 4HVZA 3CMES 3JSBA 4WXOA 2BBEA 2WB4A 3NBPB 3S6EA 4UQTA 3FEXB 2R8JA 4KTQA 2FJBB 3I87A 3M6UA 3PRBA 4O3NA 4Q44A 3DYAA 4LF8F 2F7VA 4AL6A 1NNDA 3K0JA 5FJ4A 4BS2A 3K7RA 4HYKA 1H7XA 4H4KA 1CVJA 4USHA 2V4JA 5B08A 3T19A 5KT6A 1N5YA 2YNFB 3R5DA 3VWSA 2OMOA 5IT9Y 7FDRA 5D3GB 5HROA 5A8WA 1NKBA 1KQGB 4J9MA 4ECYA 1TP7A 1Y3JA 3NNAA 2CQ2A 2RIJA 3H59A 1KEKA 1LKZA 2VONA 1Y0HA 3R5CA 5FDLA 2ADBA 3PFEA 4J9NA 1SJRA 4C7QA 4DQSA 3T3FA 2ZD1B 3M9OB 1SH2A 3MEKA 4DFPA 1P1LA 4J9QA 4HLBA 3SMZA 3IS9A 1YQHA 5A2QY 4UY8T 4AL5A 4NLDA 2BJEA 1B0VA 3M1VB 3OLAA 4GC6A 5J2QA 4YOEA 1HBOA 2HPUA 5KFXA 2CQ1A 4B9MA 1MU2A 1FRHA 2ZKTA 4JI7F 3FMBA 1KLMA 4WZMA 2JWNA 3SFGA 2P6TA 3MHYA 3R5BA 4KGMA 3MR6A 4NA3A 2CRLA 3M8SA 2AYGA 4TN2A 2V2KA 5IM0B 2IVYA 3CSKA 4KKOB 2IYIA 1JKHB 1LWEB 4I1TA 2NQPA 1F60B 2M3DA 2FJAB 5A8RB 3DHXA 2HRYA 4ECWA 1IM4A 3CJ0A 5I42A 1N6QA 4A8KA 1U1PA 4ZPAA 1Q8IA 4GO7X 3KLHB 2E1RA 2MQMA 4G1IA 4JI0F 3JTOA 3V6JA 1T94A 2CJ9A 3BGFA 2MKJA 2VFRA 1RT3A 2KG1A 2D3UA 3R27A 2J0QD 5E2QA 3RYLA 4H4OB 2HFNA 3O5TB 1YTYA 4Y0FA 1VI7A 1HMVB 1WWHA 4TY9A 2I9SA 4WE1A 3NWGA 4DN0A 1YBAA 1HQUB 2MGZB 4I6YA 2LVWA 1X4GA 5KG1A 3M2VB 4WYWA 2E5JA 4WXWA 5DG9A 2E5IA 3MWBA 2OKQA 3AH6A 1NK4A 1M1KT 4JUZA 2A1BA 1Q81T 2RDJA 4FXWA 2CDQA 2M52A 1KD1T 2A2CA 1APSA 1C0UA 4X4RA 3RU0A 2LXUA 3QO9A 1YSJA 3E51A 4QPTA 2AYBA 2BANB 4X4NA 2KXFA 4O44B 3MM8A 1DURA 1TZ0A 4XO0A 1PGZA 4NLWA 2N7YA 3N5BA 1U47A 1SUQB 2QV6A 5A0YA 2I38A 4NLQA 4IG3A 3KOAA 2K7KA 1G1XA 5D8HB 5B0EA 4A46A 1ROFA 2Q1LA 4K5RA 5IXUA 3IGNA 4HL9A 5B0GA 5D6GA 5F8NA 3I56S 4MK9A 2R7TA 2IVFB 2RT3A 1AFIA 1MMNA 4KBIA 4WZQA 2OPSA 1NO8A 1VK8A 4GO5X 1DRZA 3QWUA 5IZHA 3WX4A 2HS0A 2HNDB 5K14A 1U8SA 3CCVS 1FKPB 3HZEA 3VAMA 2BQUA 1HNWF 3J7A1 1GT8A 3I5CA 1IKVB 3I5BA 1IKXA 1JLCB 1YJUA 2QLWA 2MZJA 4DEZA 7FD1A 2BE2A 5DGAA 2DO4A 1F5AA 1HL6A 3MM7B 2JEGA 2OP5A 4DSFA 1RQ0A 2KI2A 3M8QB 1JLAB 2GW8A 1CLFA 3OL7A 2XGPA 1S99A 4E98A 3KLEB 3Q24A 4M5DA 3DLHA 5KFMA 1JLFA 3U27A 1FE4A 1HHTP 5KFLA 3KHLA 4QJVA 4EU0A 2I5JA 3AY0A 5F3ZA 3UNGC 2MKSA 2DITA 4YDDB 2M8HA 2XBPA 4MTPA 3WC2A 3BF4A 4OHYA 3Q2SC 4DV1F 3NNCA 2XY6A 1FKOB 4E0DA 4RWWA 4ED1A 2OH2A 3CJKB 3DOMA 1QLNA 2XS5A 5FIIA 3HPOA 2EFOA 2YKNB 3C8YA 5CYMB 3DXSX 1S6UA 2FJVA 4KO0B 2ZH1A 2C3YA 1J5OA 3A1YG 4DSJA 2D1CA 2DRAA 2GHWA 5K8OA 4ZK7M 4ETXA 1FE0A 4NCGB 4QIWD 1PC5A 2DNYA 4ZOSA 1S79A 3SV4A 4FYDA 3DOKA 3FSYA 2ZDOA 1KONA 3LP2B 1S9EA 4NPOA 1RJJA 3OPKA 1G6BA 4RNHA 1TVRA 4OHVA 2ALZA 3CWJA 4AE5A 2XEXA 1AROP 2MPUA 3SXLA 4C0OC 4DJBA 5E3RA 3S01A 3JB9k 1JLGB 2DR7A 1FRIA 1RK8A 5C25A 2HMIA 4RUHA 4N47A 3OR1B 4I68A 1UA0A 2G9OA 4ZPVR 1S1VB 1TR0A 2OIHA 2MZTA 1JB0C 3HHNB 2V8VA 3CDWA 4UUWA 2WSFC 3W2VA 2YQ3A 2IC3A 1FJGF 3C6TA 5IWAF 1Q7YT 1FRXA 5AXNA 1YGYA 4IOBA 5BYQA 4TLQA 2MZSA 2B4OA 3B4MA 3M6XA 3OQ2A 3DDNA 3HI9A 4C8KA 2KT3A 2UUAF 2ZH4A 1XK8A 2UUTA 4C8NA 1VRUB 2AYMA 4ZCKA 1H3DA 4JI6F 4ED2A 2A3JA 2J9EA 2K2PA 3GR0A 4TU7A 2NPIA 1UJ6A 4KT0C 3TVKA 1X4EA 5LJ3Y 5D4NA 2ZH9A 3DI6B 4F8RA 3RBDA 1S1XA 2YNGB 4RW6A 5KFHA 1E6YB 3L95X 3TAMB 1BD6A 4ES3A 3CPWR 3BDEA 2FIUA 2DH9A 1GX6A 5LL6d 4ZCLA 5F9NA 3NG8A 2VFUA 4CH1A 4V19J 4PQAA 2RF2A 5F8IA 2HNZB 2OPRA 5B7WA 3LALA 5C5JA 5D78A 3NAIA 4Y6IA 1OQ3A 2DNRA 1HQEA 2ILYA 4RUAA 4Y2MA 1YI2S 2LEAA 3CMAS 2FHKA 1R8HA 4I4BA 2OTJS 2HAIA 2BZ2A 5F8JA 5KFAA 4OI1A 2M7SA 4KV8A 4ECZA 4F4ZA 4A8WA 1SL2A 2YY3A 1X9MA 2R8IA 2JSXA 3NS6A 2UVUA 3M2UA