3JTOA

Crystal structure of the c-terminal domain of ypbh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
DESADIIYQFHSFEDIIQLSESLQRIGITGGTVYHYDGQYFLSLEDLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVETIQTHFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the MecA Degradation Tag
rcsb
source organism Bacillus subtilis
molecule tags Protein binding
molecule keywords Adapter protein mecA 2
total genus 24
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jtoA00
3PXGa 3JTPA 3JTNA 2Y1RI 3JTOA
chains in the Genus database with same CATH superfamily
2GJIA 3TZWA 1S1TA 5KFEA 1HNVA 1IBLF 3SV3A 2HVHA 2LEAA 1PBAA 4CLLA 3SCJE 4UUXA 3SFUA 2XHWA 4O3NA 3C16B 4ICLB 3PYFA 1Q8KA 5HMWA 4N76A 1TL5A 4U7UK 1HHSA 5LJ3Y 4DUZF 1UVNA 3EDRB 4B3MJ 2VFVA 2RF2A 1T9YA 2V9KA 4RNOA 4JI6J 1V3SA 2C2NA 2GHWA 3DKDA 3KMSA 4OZLA 3LPEA 2DH8A 1GEHA 2QL7B 4Y2AA 2DCUB 4DLEA 1I6JA 2I6WA 1I51B 3NY0A 5KT7A 2FVSA 4ID8A 2ZDPA 3CC7S 1JLBB 2HQDA 2IMWP 1VQ4S 4OJ3A 4WIQA 4USWA 3A3PB 1NSAA 1FO1A 3BGLA 3MCSA 4OV6A 2XM3A 3K7RA 5AJ3J 1JLAB 2KFYA 3BQ1A 2E29A 2RT3A 1VC5A 3O1LA 3V6DB 2E7VA 4LSNB 4ZVFA 5DZ6A 3T1YF 3OHBA 2GHPA 5HBMB 1FDNA 4DFPA 4J9RA 3EMTA 2WB4A 5LJ5Y 4CO2A 4CRJA 5KFCA 4G1QB 3ZZRA 1YQHA 2YY3A 1R0CB 2GVDA 4EO6A 1FE4A 1X5SA 1EKRA 5B08A 4EEYA 2CUYA 1UA0A 1YJTA 1KOHA 1U6BA 1VLOA 2YKNA 3MD1A 1F5CA 5IM0B 5IWAJ 3PXGa 1KDNA 2EG2A 3GJSB 2N82B 4E0DA 4OI4A 3QT7A 3OVSA 1D0EA 3TZYA 5LOQA 4NLUA 2IAJB 1PAEX 3LUYA 3K89A 4TYAA 2AEFA 4FYXB 5J1NA 1NHVA 2ZDOA 4OJGA 4A47A 5DGBA 3WX8A 1QM9A 1BXNA 3M2RA 3BQ0A 1R0AB 2CJKA 4QBUA 4RW6B 4KV8A 1W2IA 2EFGA 4QYZK 2C2DA 2V8GA 1B0TA 1RT5B 4LF9J 1M5SA 2EVZA 4DV3F 2OFHX 2N4CA 2I9SA 3HFKA 4NRTA 2XY5A 4DPYA 1N33F 1VK3A 5FIIA 2PI4A 4F02A 3HSZA 1BQNB 1L5UA 2LLZA 3H2VE 2KZMA 1QAIA 4OHVA 2VONA 2XB2D 3OV7A 5I3UA 2DGOA 1FDAA 2EBGA 4LQ9A 3JTPA 4HT5A 4ANDA 1RTIB 5KFPA 4DV2F 1HLWA 3CJTA 3V4MA 1TV6B 4E8UA 2D3O1 3PRDA 2HGLA 1V5IB 1EETB 4DR4J 3HCXA 4WP9A 1NU4A 3MFHA 3KUGA 5KFYA 3EYZA 3A4TA 5KFLA 1X9MA 2DH9A 4X65F 3CB4A 3IXQA 1B99A 4DR7J 3PX6A 3EPGA 2RHQB 4WXWA 4YN3B 4OX8A 3J7YI 1JJCB 1GX6A 4ZPVR 1QE1B 4OQJA 1FCAA 5GAEI 3TZXA 4NL5A 3L3CA 2OIHA 4A8YA 4PCQA 1RT7B 1UZHA 2ASYA 3UDCA 2GJFA 3NCRA 5CZXA 4F04B 5I42B 2AJQA 3BGOP 4X2BA 5C25A 2HWHA 4OLPA 1RUSA 2IJFA 4M5KA 3P49B 1FJ7A 2M8HA 4LR7A 4YS2A 1UVLA 2BJDA 1FTRA 3PCOB 1U24A 1LK5A 2JSXA 2AT1B 5D4PA 2QX0A 2VB6A 4X4RA 4DR1F 5L38A 2Z2LA 1I94J 1Q8IA 2MQNA 1HBMB 3ENQA 4ECTA 3FBCA 4DL0C 1S7IA 1N5YB 3CD6S 2J7KA 3PNIA 3C6UB 2W8KA 1HWIA 1UJ4A 5C2CA 4J5OA 1SBRA 1Q8LA 5DO2A 1CC7A 1RWNB 2WVEA 3AODA 1RWWB 2QJ3A 4QR0A 4AUKA 2E9TA 4OX9F 2HLTA 3HP6A 1PJ5A 1RE1B 4LRAA 4CLUA 1V3ZA 3L09A 4ZVGA 2C3PA 3OLAA 2KVQE 1VIXA 4RW9A 5U47A 3GSIA 4NA1A 4TVAB 4IH5A 5KFRA 1S12A 4FYVB 3TRGA 1TMJA 2CDRB 4ZP9A 2KO1A 4UOGA 1M5HA 3C2PA 2HRYA 2OMOA 3GCXP 4OYIA 1YZ7A 1QSSA 1SJ4P 1CVJA 2HVZA 4A8XA 2ZH6A 4G65A 1RT6A 4ED3A 2MQ8A 4P2MA 4P7TA 4IG0B 3G82A 3NBPB 1T9TA 4R8UA 1HI1A 4DQQA 3HZEA 1HNVB 5KFUA 4CZCA 3HPOA 5F3TA 5DS7A 5T7LA 1Y4ZB 2HAFA 1RAGB 4YDXA 3DLEA 4JI0F 3PVXA 2JC0A 3G82B 1QY7A 1SKUB 3NBPA 1KBRA 4QIVA 2XS7A 2F9DA 3IR6B 1QJHA 3D9BA 4NLQA 5KFNA 4FXDA 1XNQJ 1HYSA 2ZUAA 2JZ5A 4IDKB 2OPRA 1N5TA 1P1TA 2F8EX 3TX8A 4LIWA 3QBCA 4B3TF 3BN4A 1VI7A 4RX6A 5G0RB 4WFXA 4WZQA 2GAHC 2RD5C 2DR5A 1CULA 1E6YB 3SMZA 1H7XA 2DO0A 4DX7A 4OV1A 1W25A 3Q8RB 2KXHA 2OJ3A 1C1CA 2ZBCA 4K8RA 1ZA1B 2R7WA 1OO0B 1WI8A 4GRSA 2V0NA 4X66J 1JKHB 2UUBJ 1FFGB 4K4SA 4R8UB 4X4VA 1WACA 4IG0A 3ZXWA 1OSCA 2XO7A 5D3GA 3LWLA 5CABA 3FZ2A 4P2SA 4URSA 2YNHB 3WBZA 4O3OA 3JSMA 2CPDA 5B0AA 5RUBA 1BGXT 1LWEA 2HFVA 3AA8A 4GMKA 1XN9A 4DMZA 5F9LA 4Q45A 4JI5F 3NL0A 5KFSA 4F4YA 3T1YJ 1QTNB 2AZ3A 4USUA 4A46A 2AZ1A 2PIIA 3AJ1A 1F1BB 2GZOA 3BN7A 1SQEA 3F73A 1J5OA 2NYHA 1F0XA 1TVRA 3UE2A 3D6FB 5J1EA 2BJ8A 2VC1A 2J0WA 2FHJA 5AXNA 3RB6A 1IXKA 3POTB 1BMQB 2ZZMA 1HKAA 1NM2A 1AYEA 1R8BA 1TUGB 3MM8A 3UQSA 1FXLA 4FF1A 3DU6A 3LAKA 4ILRA 3NLCA 4Q44A 1NH8A 1J2VA 2BE7D 5DRKA 4ID5A 5C24B 1D9AA 1GMWA 1YJ7A 1RKIA 4NCAA 2M70A 3LTOA 3HMJG 2Z4PA 3G87A 2UUCJ 2V4QA 3E51A 1B64A 1XWLA 5FDLB 2R3VA 1PC4A 5AXKA 3T19A 1WTFA 3M8WA 5KG1A 1NJYA 2HLUA 2IJNA 1CLFA 5IC4B 2CQIA 1Q7YT 3R7BB 3QIPB 5HVGA 2J9DA 5D4OA 1HMVA 5DZ7A 3Q0AA 3CCRS 3MUTP 1KONA 3UI3A 2PA8D 1RP5A 3BH7B 3ET6B 3QT5A 3M9MB 1N5YA 4EZ9A 2E5JA 4WFZA 4EO8A 1ZAWA 2N4DA 1QE1A 2NXUA 1IM4A 4F7VA 5CA5A 4N56A 2E1PA 4B9VA 2RNEA 1PYOB 3DLKA 2ADBA 5KG7A 5GAGU 3MMBB 3VAJA 4FXWA 3K5PA 1YJNS 5HL7Q 1EETA 2C2KB 2N3LA 1RAJA 2XMTA 2HHUA 4K4XA 4BLGA 4QYRA 3PJ9A 2Y1JA 2IAJA 3BPDA 4LUBA 1CG2A 1WHVA 2OUGA 3DLKB 4FF2A 4XK8C 3QRPA 3H90A 2KJWA 3O6QA 5EWEA 2XNRA 2WTFA 1IKYA 1HA1A 3R5AA 2PEBA 4QU7A 2DR9A 3TA2A 3V2UC 1U48A 1GXLA 3FCWA 3OL7A 1U45A 1PGZA 4NLPA 3M8ZA 1JX4A 2ZOGA 1RU1A 5F8JA 1RT5A 1VJWA 2V5HG 2BXJA 4DUZJ 4PABA 2CQCA 2XC9A 1X4BA 5IOLA 1S77D 4QWDA 2PA3A 1YJWS 3HT3A 4QCLA 2HPUA 2XWXA 4I6YA 4XDDA 1XR6A 2AYEA 1WOOA 3H5UA 3KFWX 3T1AA 2DIVA 4OYPA 1NK5A 3GIIA 2R42A 3FEZA 4ENOA 4ED0A 3DI6B 2YKAA 4P2XA 3KLIB 1CJUA 3KUHA 2HYIB 3OTCA 3TZZA 3GE9A 2PFFB 4F3QA 1TK8A 3OFGA 4DSKA 1WC0A 2OSQA 3MR3A 4IUFA 5IM0A 2LA6A 3MPVA 4WE1B 4B17A 4GKKJ 5D15A 3HKWA 3PKMA 2AX1A 5KT3A 1A9NB 4EBDA 2BX6A 2WCXA 3VGSA 4YP3A 2W7OA 4OX9J 4LF7J 2JLFA 2DR8A 2UZAA 3F0NA 3CW2C 1SV5A 2EFVA 3US5A 4G1QA 3D1HA 2QA2A 1WJ9A 2LQ8A 2HBQB 3ADAC 2N7YA 4OFZA 3FUYA 3WHIA 4CM2A 5GADI 4JI2J 3QWUA 3HDSA 3SZ2A 4OI2A 1NK9A 4IH7A 1TKDA 3VGVA 4P10A 3BKUA 3DRPA 3GQCA 5D77A 3V6DA 1U1KA 1HNWF 1ZZFA 4URQU 4PG4A 1Y00A 4ED2A 2BKOA 1RAIB 4KYZA 1D09B 2JOQA 1T8EA 3K8WA 2XGQA 1ZETA 4WTOB 1S0MA 1RAEB 2HRTA 2GGPA 1QVGR 3BYRA 1KS2A 1NJZA 2MKJA 4M5DB 2U2FA 3I4HX 3UDLA 2LXIA 3SBMA 1RT1B 4CNZA 1EARA 2XI3A 3ZTOA 4GVLA 3OHAA 1CULB 1E6YA 3RTVA 1QDUB 1YK9A 2B6AB 4ECQA 1VQNS 3R2CJ 1RISA 3VZIA 1AFJA 2PT0A 4EBCA 5KTQA 2JWNA 2R2SA 4LF4F 4LFBF 4DV0F 4K5RA 2CPYA 2UUTA 3EVWA 3MGJA 3N6MA 4A8WA 4DSEA 1YJUA 4IOAQ 4J9VA 4WFNQ 2POKA 1VC6A 3M6WA 3KK1B 2GQQA 3AAWB 3R9LA 5A8RB 4DCPB 1ZPVA 1S10A 1N6QB 2DT9A 3CIMA 3UCUP 1NPRA 3ZZOA 1N48A 2IM0A 1S7HA 3A12A 4L76A 4ZPWR 1WUUA 1FRHA 1ROFA 4FPIA 4M5LA 3S6EA 3JYTB 3D3CJ 1NSKL 4X62J 1T9UA 2CXEA 2JFDA 3QO9B 1RT6B 3OXFA 4DV5F 4ELUA 2XMWA 4RNNA 4CO4A 1XMQJ 4OYMA 3T5LA 4YR2A 2ZEJA 3MPUB 2FVCA 1HPZA 1ZM3A 3DHXA 1SL2A 4C8YA 2AJ2A 2M9KA 4ZP7A 5F3ZA 3RBEA 3FJ2A 3DXBA 5ETQA 4DV7F 1P9QC 4JV0A 5KFDA 1S9EB 4CO1A 4J9OA 1TL3B 2I5JA 1U09A 4BCAA 1RT3A 1WC4A 2D1CA 2HMIA 3HJVA 5ETKA 2C2ZB 2FJBB 1A6LA 2OEKA 3H20A 3W62A 4GC6A 1XMOF 2MZQA 4QQBA 3VAFA 3N79A 4Y28C 2N3OA 2GVZB 2LXUA 3TANA 4JI1J 4Y3CA 4Q7AA 3R6GB 3EUNA 3EWGA 1F3VA 1FK9A 1VHFA 3NKYA 4DZ6A 2XQCA 3RB4A 3K5OA 2AD9A 1HBMA 1Y9OA 4RU2A 2YWKA 1RU2A 2YWFA 1RCXB 2CQBA 3KG1A 4O44A 4JUZA 2GMJA 4OYAA 5DLGA 2F1FA 2HWTA 3BDPA 4X4SA 2MZJA 1AUDA 2GVZA 5GVQA 2FVQA 1MG7A 4TLQA 1V6HA 3JB9k 2ZBRA 1TKZB 3A3NB 3PFEA 2FGCA 1M1GA 1C0UB 5IQ6A 1DHMA 4DR6J 1MSWD 4UQGA 3OSPA 1H0HB 3RR7A 4PWWA 1Y3KA 3TUZC 1Q8BA 3C15B 2VZ9A 3W2WB 1QAJA 1WG1A 1KHWA 1QSLA 1T7PA 2OTLS 3MAQA 4BS2A 1AFIA 1NNDA 5GAHU 3HHLA 2LQ9A 2UV8G 4UZBA 2OPPA 1CPZA 1WF1A 3ISZA 3VALA 3HT0A 2HFUA 5EDWA 3D0HE 3JS9A 3GFHA 1RTIA 1YZ6A 3OFFA 4I69A 4D3GA 1JLQB 4EK2A 4RNFA 5KFOA 2UXCJ 4DR2F 4ZVHA 1T3OA 2IM1A 5CHCB 5I3UB 4UY8T 1WG4A 3NG8A 1X31C 1X5TA 4X4QA 2IM3A 3VGUA 1KLNA 4HR2A 2W7AA 4DFKA 1LW0A 3D0GE 4C7QA 2KXFA 1EX8A 1H74A 3DMJB 4NYZA 3T1HF 4JV5F 1LOUA 2IBOA 1Y10A 3MM5B 2J7WA 2K7KA 5IQQA 3ZNUA 1D9DA 4OJ1A 2HGMA 2H65B 2HFSA 4KV8B 3J80Y 2R9LA 1FNMA 3GILA 1VQLS 3U1MA 3K5LA 2K7JA 5EN1A 4NA3A 3AOBA 4MK8A 2V34A 2E5IA 3R5CA 3W9JA 1Z2ZA 2HQFA 1XC9A 1Y11A 2MKCA 3BB5A 3KG4A 4TY8A 1TQLA 1RT1A 2E9RX 2HHHF 3ILJA 4YY3F 4LFAF 1GNKA 5KFQA 2ZH2A 1DTQB 5HATA 1PYSB 3L7OA 1YSJA 1NDCA 3NOGA 4QWEA 4DUYJ 3VAHA 1WEZA 3DDNA 4F26A 1G4CA 3I87A 2B4OA 3PYGA 3VCDA 2RQCA 2BJ9A 4RBVA 1CEZA 4XAKA 2NXNA 3EJMA 4WCEQ 1SI9A 1S4EA 1E6VB 2DB1A 4L3KA 4LT6A 4GO5X 2CJ9A 2GIRA 2GVDB 2XMUA 1X4HA 3M7VA 5E3PA 4AYBD 2DGUA 3QAEA 1RTJB 4P72A 2G2OA 5KOXA 1VOMA 4DQIA 2LQ5A 3OR1B 5BYRA 1SV5B 2HZVA 1HR0J 4KHMA 3CE8A 4C8MA 1NAQA 2DBBA 4CP5A 5D8HB 4I67A 3CO0P 4JI1F 4ERDA 3BO2A 2HIQA 2FD2A 5IT9U 1FWKA 4HI1A 1BHNA 2LECA 3IC1A 3L4BC 2JEFA 1OMSA 3EXCX 4ZA1A 5E3CA 2W2OP 5KFVA 3GV8B 2F40A 4F3MA 4PAAA 1KQSR 1VQ6S 2DO4A 2HS3A 1C1BB 3UR0A 2NSBA 4B02A 2QO3A 1GMUA 4LR9A 4P52A 5K14A 3H42A 3CCES 4L75A 1T05B 3Q23A 2CQ4A 1VS3A 3AJ2A 1A7GE 4B9LA 1U25A 4LF6F 1BY9A 4J9UE 5BR8F 3SIPB 2ATCB 2RF2B 1NZAA 5IT0A 5F8GA 3CC4S 2KJVA 2M7SA 2VJUA 4ZN3A 3KYLA 4Y2IA 2VICA 5LMNF 1N36F 4ICLA 1TTHB 2ASJA 4B9MA 2NZ4A 4U95A 2XSFA 4KAIA 5DDOC 2VG6A 4DUTA 1I94F 3ITHB 3SSRA 2VDHA 4QIEA 2UVVA 4Q43A 1JNRB 1FVQA 1HWLA 2BUNA 4NLSA 5F8IA 4D3HA 2BABA 2HNDB 4AXIA 3HVWA 1K9MT 2BJEA 1JLCA 1JLFB 5D0RA 4BBYA 2CPHA 1SUQB 4HH0A 4NXNJ 3BR8A 4IQXA 4EUVA 3J81j 5ADZA 1L3UA 4K2JA 3EVOA 3E8OA 1B4SA 2CJQA 1D3WA 3N9UC 1HBUB 5IZHA 5AJ3F 1SKSA 4KHPF 1HBNA 3NGSA 4LF2A 5LXRA 3M6UA 5M2PA 4HI2A 5DG9A 4N5SA 3MMBA 2V4RA 1SKWA 4M1KA 1Q7LB 1URNA 5DQHA 1AW0A 2DNMA 4Y6IA 4KSEB 4HACA 2EFPA 1WKKA 3P4UB 2WVBA 4NXNF 3TYTA 3T6JA 2D3ZA 3KJQB 4ZMMA 3DMJA 2R7QA 3F44A 1S76D 2WW8A 2CWXA 2DY9A 2V50A 2BJ3A 4C0HA 1X5OA 2RE1A 3PACA 4RL1A 1FJCA 3PY8A 2RDJA 4EBEA 3IN5A 2BOAA 3RJMB 2NXEA 4Y2KA 3VVUA 5KT5A 4LRCA 2XLIA 2HQCA 2QA1A 4DCJB 4JI2F 4F67A 4RW8A 1T94A 4EZ6A 3M8YA 2PMZD 5A6PA 2M88A 3GU0A 3M8SA 3QQCD 5KFJA 4DPTA 4X66F 4MK9A 2UUBF 1N33J 4L6V3 2YTCA 3FDSA 3W7BA 3HHLB 4PZVA 2Y8YA 1HNXF 4GKJJ 1G7CB 2BKPA 3MR2A 4DU8A 2KHCA 4ES1A 4W4MA 3H4DA 1TKXB 3DLJA 5CCLA 4LF6J 3P5BP 2OAUA 2CPIA 2HVEA 1W26A 2QIFA 3GYNA 5K8PA 5MLCV 4X4OA 8ATCB 5J2PA 2NREA 2QGFB 4B3TJ 3HI9A 2FJDB 1PAUB 2MZTA 1LWXA 5AXMA 3PZPA 1C4CA 1NRKA 2LU2A 1S5ZA 1TVRB 4RBTA 3MEDB 1NO8A 1CJVA 1EJ7L 3GV5B 2EXUA 3L7PA 1HNXJ 4I2QA 2A18A 1P8GA 1JXLA 2R8KA 2CG4A 1LNQA 4I0WA 3DOLB 3GIJA 4IYQA 5J2QB 4CTAB 4KKOB 3KLFB 1BWEA 1BC6A 2BMBA 2BANB 4DR5F 1R8AA 3UDEA 2V2VA 4ECWA 4DI6A 3DYAA 2E5LJ 2J9CA 5D3GB 5K9FA 5ETPA 1S1UB 3I9ZA 1OY8A 3OLBA 1XNRF 3PYDA 3MR5A 3UVJB 3R8YA 2IDLA 5LM7E 3R5GA 5H9FJ 1S9GB 2KT3A 5I3PA 3KK2A 2RDDA 4F2SA 4LF8F 1V9OA 3CJ4A 1CBKA 3TUJC 3EVMA 2SXLA 4IO1A 3M1VB 3R1LA 4B3OA 1ACMB 2HGNA 2GHVC 3DM2A 1UAWA 3MR7A 4S0MA 4F25A 1S49A 1YI2S 3IS9A 4LIRA 2AP6A 5IXUA 2ZHAA 2ZH7A 1YRTA 4X4PA 1UFKA 1VRTA 3MECB 2Y0BB 1HPZB 4KR0B 4DSIA 4ZLJA 4C9DA 2HZCA 4KH0B 1UETA 2ZBQA 4OYOA 4OHZA 3CCTA 2ZJRQ 2IMOA 2YQ0A 4IDKA 2W8LA 2QA4G 4M5NA 1HYSB 2DPIA 4NI2B 3MPYA 1UPPA 2W25A 5KG5A 4KHPJ 2V2ZA 3ZTRA 3KTQA 1NMEB 1CC8A 4QZVB 4OIXA 4OJHA 4B3MF 3H5SA 2YNFA 5DGAA 2UXBF 1RWUA 2B4UA 4JI5J 1NLKL 2F5GA 1RCOB 1SIZA 2XY6A 4ECZA 3FSIA 1FT8A 3I0SA 1K1QA 3O3LA 1FRJA 4C11B 3KK1A 1HL6A 4ZLLA 4UW2A 1N6QA 3AJDA 3PRVA 5HANA 1NHUA 2HFOA 1N56A 2V8VA 1IBLJ 4NCGB 8AT1B 3D1OA 4WK3A 2YNGB 2P8IA 3PHTA 3QZ7A 1U26A 5DDRC 2RIJA 1R43A 3HSGA 2B6AA 1S0NA 4CO5A 1PYTA 2GAGC 3HF5A 4JP8A 2W2PP 4Y34A 4NLRA 3KDOA 2J0SD 3PW4A 1YIJS 5IT9Y 2QFIA 1SC3B 3DRRA 4CO3A 1I1GA 3FZBA 3RBDA 1RYSA 4KFBB 1VGYA 2HK2A 2JFKA 4DDFA 2HEKA 2V8HA 4ZK7M 5L46A 4IRKA 2ALYB 3DRXA 2LDIA 4ZN1A 4OHYA 4PPDA 2W9AA 4DR4F 1RZMA 3GYGA 3IBFB 2I2YA 4DV6J 1M5VC 1S6QA 1RB0A 2RVJA 4A48A 3Q8PB 2BVZA 4TNOA 1U0HA 4JV2A 1KQFB 1HNIA 4HEA9 3CJSA 3N28A 3TA0A 1AT1B 5HQLA 4DFJA 1RAOA 1YBUA 4PXBA 3TAMA 2GFFA 2DNPA 4CYUA 4DX6A 2CPJA 4J9LA 4CQ1A 1WEYA 2XI2A 3BS9A 5ETVA 4I64A 1BUXA 2DJWA 4OI3A 3K59A 5DLFA 3M9NB 4UY85 2JH3A 2XSJA 4LBIA 3QSYB 2ZNZA 5CYQA 2JVRA 5D0EA 4OZ0A 3LF0A 1XERA 2I8EA 2FVPA 2CYYA 3KLIA 5KG0A 3P45B 2W9CA 3BSOA 2FLLA 2DH7A 3DI6A 3FRYA 5HVHA 2DRAA 4RU9A 4WIIA 3LALA 2KH9A 1UEVA 3RUBL 4C8LA 4M8LA 2YPZA 3H25A 2G0IA 1O6XA 1VK8A 2OEMA 3QNWB 4DPXA 1QAYA 3TR5A 2QC3A 3MPWA 2P6TA 3FMBA 1RQ0A 1WC5A 1D8ZA 2NPIA 5A8WB 3FK4A 2B0GA 2E1AA 3LQVA 3GV7B 1WWHA 4CLSA 2B9XA 4PQUB 2F8MA 4CLPA 5KOWA 4XPEA 1REVA 2ALZA 2W9BA 4V19X 3DU5A 3MHYA 1BWVA 2O5DA 3NGTA 2VQFF 3SFGA 3V81A 5C2GA 4R5PB 2VG7A 2CA9A 2IRYA 2Z0GA 3AB4B 3GTYX 1FXDA 4CLFA 2UV8A 4PG8A 3PTWA 3OL6A 3MM7A 2B4VA 5KFKA 2DNZA 3HLUA 5ETTA 4QWBA 1UEUA 5C7PA 1SQGA 4DG1A 4WF9Q 4DV6F 2MQMA 1WNEA 2DHHA 3PX4A 2QA4S 3AQOA 3MCOA 4WFYA 1B0VA 4MTPA 1UWBA 2XG8A 2RKIA 2VG5B 2G1DA 2A10A 2IHR1 1LWFA 3J7Z5 4AE5A 1H6KX 2EK1A 1HW8A 1U7LA 1S1XB 1T11A 4NRUA 3R97A 2UU9J 4B9SA 3R7SB 3S8SA 2B9WA 1HMVB 2VBZA 1WEXA 4N47A 3W61A 2UP1A 5IV4A 2K8GA 4GVBA 6FD1A 1DURA 2JJ4D 4CDIA 2FHJD 1OIAA 3CJ2A 1K73T 2B3TB 3EE3A 4MT1A 4HT7A 2CJXB 4C0OC 4AQYF 1VC0A 1FFWB 1AZSA 4KBIA 1CQMA 1IKVB 2FVRA 3Q2TC 1Q1KA 5EHHA 1T3NA 4QPXA 4OX7A 5DQIA 1TUWA 3WX4A 5H9FK 3JTOA 2CVIA 4LVOP 4ZVOB 3C14B 4J9PA 3GJRB 2CQPA 2Y3YA 5M2RA 2EI5A 2VC0A 4AT1B 5F8LA 3Q8YA 2XEXA 3G9CA 3PG9A 4ES3A 2CADA 1S1WA 3GONA 3NWGA 5GMDA 5K5MA 3BPSP 2P2CB 2L9NA 3AB2B 4RUAA 2F4VF 4FKYA 3POTA 2RILA 2XGPA 4LREA 2AQ4A 5EUHA 2MEWA 3HZGA 2HQGA 4M5IA 5J1EB 2DHSA 3Q24A 5A6WA 4NYOA 1LXNA 5ETNA 2EBEA 4ILLA 2E66A 2I0XA 2VFRA 1U1RA 1G3OA 2U1AA 3CTRA 3QPIA 1KD1T 3IG1B 1P6TA 1LWEB 1Y5IB 4U67Q 2PO4A 1TELA 1OWXA 2RH3A 2J7UA 3KKFA 1SIWB 3NMAA 5HQ8A 3P96A 1GXUA 2MHNA 3PEHA 2FTRA 2KG0A 3EZOA 1NEEA 2RS8A 5DG8A 5D0HA 5SZTA 4X4NA 2RDIA 4RJVA 2BJ1A 2JDJA 1URRA 1U2CA 1C1CB 1JLGB 3LP2A 3NGDA 3HVRA 4ZCIA 4HYKA 3CCSS 1O5JA 2AMCB 3ULHA 2ZH3A 3GJQB 4X4TA 4LF4J 1WF0A 2M4MA 1UKUA 1S97A 5SUHA 2MJNA 2V8DA 4A4JA 8RUCA 5KFXA 1IWGA 1FWLA 4RW7A 2XMJA 1NK4A 1LEOA 2WSCC 3OUYB 1WI6A 2BA9A 3TARA 5T41A 4USIA 1LXJA 3THVA 1W2BR 3C3LA 3JSRA 4PR6A 1X4CA 1MMLA 4YMEA 3P3DA 5LMUF 4L74A 2XLKA 5L9XA 4K2XA 3KJVB 5T7LB 3AT1B 3U02A 4RKUC 5DG7A 2VPWB 3ZTPA 2AWZA 3CCLS 3A8JA 2BOPA 2HW3A 5EGYA 1X4GA 2FY1A 4F4XA 1ZA2B 4MH8A 3BO4A 1FFSB 3CSKA 4X84A 5J1PA 3TQ1A 4UT4A 3U1LA 3QT8A 2W4PA 3FGVA 2JHEA 2DNYA 1HWJA 3A13A 5F41A 3MAAA 2MSTA 3I9V9 1C4AA 1REGX 2DY1A 4YB6A 2VH7A 2J6TA 2EC0A 3E2EA 4LF7F 2IFXA 1QVFR 2ZHBA 1IWAA 4KT0C 2DISA 4Y00A 2Q66A 2BYCA 4HLBA 4I7FA 4JI4J 3FEYB 2A1BA 2ZD1B 4FP9A 3FFIA 1EQMA 2JLGA 3QRRA 1N5VA 3HM9A 4DPOA 3MI7X 3H4BA 1S1VA 3CD0A 2DHXA 4GC7A 1N34J 2MTLA 2H54B 4MMOA 4H4OB 3DRSA 4PWDB 1FX4A 3D2WA 4FS1A 5J2MA 1RWVB 4RBUA 3W8PA 3KJFB 3NGKA 3PM9A 1R3NA 2CDQA 4C3KA 1UFLA 1X9SA 1EQ0A 2AJ1A 3K0JA 3IGVA 2DNNA 1RACB 2HS0A 2ZH8A 2Y1RI 3SDEB 1VQPS 2UVUA 3E3XA 1WORA 4G6VB 1G2EA 1Q5YA 3W64A 4PUOB 1QD1A 4G3IA 4Q0BA 1LWCB 3NCQA 3ETOA 2VQFJ 2YH0A 5GAHI 2AW0A 3FQLA 3BYPA 1RHKB 4KY3A 2G1HA 1TL4A 1RWMB 1S99A 5I3QA 1C0TB 2QLFB 1VQ7S 2EK6A 4HTJA 1VR6A 1RAFB 2BM0A 1N52B 2R7UA 4NLOA 3D28A 3MWBA 4CT9A 4DX5A 2L41A 3M4XA 1TL7B 5M2UA 2MJUA 2FZKB 4C97A 2UUAF 3MTJA 4ECYA 4KJIA 4IQMA 4WKYA 1YRUA 1SL1A 3QJJA 1HI0P 3CD7A 4X4UA 1RTHA 3ELHA 1OY6A 1DRZA 2EKYA 1UEKA 2IM2A 3IGNA 1ZM2A 1WC3A 5IT4A 4AL5A 1U2FA 3G86A 3RRGA 1DBDA 4NZ7A 4B9TA 1IBMF 4O4RA 3OL9A 2HURA 2FJEB 2EWHA 3TNVA 4NZ0A 3HHKA 1BQNA 2W2MP 3IAM9 4DV5J 3CDAA 3ZZUA 4X64F 4RNMA 4I7FB 2KRRA 2XULA 2W2NP 3MMCA 2IA6A 1N88A 3Q89A 1YDLA 4Q8EA 1HQUB 2CQ1A 2B51A 3D1QA 1F3FA 4I4BA 2VKZG 5JVGQ 4RW6A 4OHXA 2GS8A 4N77A 1MROA 1Z1ZA 5HLFB 1R0AA 1PILA 2YH1A 1UVJA 1S6PB 3SSSA 2M8DB 2DRDA 3JQJA 2B5JB 2B7BB 1H98A 5B7WA 3MMAB 3N4WA 3SSQA 1IJFB 3DDKA 2QEXS 2D41A 2E5GA 3IRXA 2VV5A 1N5SA 3WZ0A 5AE3A 1B3TA 2AJFE 2BBEA 4KE5A 1JLEB 3TEHB 2BACA 3AD8C 4ED6A 3WIVA 1UMJA 2UUWA 4B08A 1DLOB 1ZOTA 3M32A 1MU2A 2ZWPA 3G6YA 1R7IA 4NXMJ 1IQTA 1HWKA 2YKNB 2ZFHA 4Q2MA 4LFAJ 4QWCA 1SJ3P 2HHHJ 1RBLA 4I6WA 5KT6A 2OPSA 5D4NA 4LVNP 4JI6F 2FIUA 3NMRA 2KM8B 2YNIB 2X3GA 3KHHA 1S0VA 4M5HA 3CUNA 4PYDA 3FEXB 2W24A 3KWMA 3DOMB 5KFWA 2FHMA 1PO6A 2G9OA 1PG5B 1VBXA 2ZM6F 3CDBA 5HBMA 4DV1J 2VOOA 2LFVA 3CJ5A 2KZZA 2XYGB 3OJUA 1T9VA 4OLOA 4A8OA 1OSDA 1H2TZ 2QLXA 5C42A 3OTBA 1X5PA 3OL8A 3OXLA 1SC6A 5GMKa 4F50A 4PRFA 1JLBA 3BGFA 3KOAA 2V94A 5HAOA 2GIFA 2YKPA 5KFMA 2KL8A 2ZE2A 5KAKA 3LP0B 3NRBA 3J7ZT 1L3TA 5ITHA 3ZZPA 3EM1A 2E44A 1KLMA 3PHEA 2YKMB 5BXIA 4EMDA 2ROGA 4LF5J 1VBZA 1OYEA 4ZVEA 3M2VB 2YKMA 4KH1B 1MWYA 1P9YA 2IYGA 1FKPA 2LYVA 2UUAJ 2WVCA 2XBPA 3OR2A 3QZ8A 2V67A 3G96A 1S1TB 3G4SS 1FF2A 2IBKA 2Y9HA 2VQEF 2C42A 3GLJA 3O44A 2MKHA 4FPRA 4NOHA 5E3RA 1SH2A 3D6MB 4DR5J 3UWTA 4IH6A 1P27B 1ITPA 1XNRJ 3H2UB 1KNZA 2KKHA 4Y65A 3HD2A 2ZKUA 3PIPQ 4IR1A 2PFDA 2E7WA 2JNJA 1HBOA 1SQFA 4MFBA 4ZPDA 3BZQA 4YQWA 3ICLA 1AB8A 3NS7B 1AZSB 3HHLD 2DITA 2IRXA 3J81Y 3I56S 1U47A 2R2TA 2BQRA 3MEEB 3PR4A 2HAIA 1UVIA 2MQQA 1S79A 2F63A 3W5ZA 3CMQA 2AJ4A 2GA7A 1HFEL 3FBFA 3H59A 5F8HA 1H38A 3TVKA 1IM6A 4ALZA 4C6AA 2FDNA 1MU2B 5ETSA 2Z56B 1NJWA 1DLOA 2CQ0A 3KG0A 1CSJA 4P71A 1TFYA 3AFGA 2FHKA 3AOAA 4ZDNA 2HHQA 4DS5A 3CJ3A 4FBUA 1NUEA 3OW2R 2V2KA 4ZJLA 3I0RB 2JEIA 2MDAA 1UZDA 2HHVA 3FC9A 3JXOA 1S6PA 2D9PA 2XTJP 3NS6A 4N8OA 3SEOA 5BYQA 2E1CA 2WONB 1EP4A 2KT2A 2B8QA 5J2NB 1VQYA 2VG7B 3CC2S 1FDDA 4ZVUB 1R6VA 3ENWA 4ED1A 1R8HA 1PJ7A 2HFNA 5B0EA 3GMGA 2MMYA 4C8NA 1Q0NA 3SCKE 2GQ2A 1U2RA 2MSSA 4JI0J 2CJYB 3PFOA 2DCLA 3OTOF 4MIBA 4PG6A 3CCZA 4OZ1A 5CZVA 5D78A 3UPFA 2NQPA 2D3OR 3GIKA 4ZP6A 4UZCA 1QUVA 3IFEA 5ETLA 3QGGA 5E3QA 3JAMU 2C2RA 4M94A 1RT4B 4LSLA 4P74A 1J5EF 1SCJB 2X3DA 4XPCA 1PKUA 2UVWA 4ZHRB 4UOCA 1DTTA 9ATCB 3RRKA 2KXNB 2HS4A 3OTOJ 3QT6A 2ACMA 1KRPA 2PI5A 5CD4H 2EFOA 4DV4F 5B0DA 1YBAA 3DN9A 3MAHA 2V4JA 4FYYB 1FI4A 3PKYA 1CQNA 3IBWA 4CLZA 1NPKA 1Z2LA 3CDUA 1N36J 3RBZA 2L9WA 3D54A 5HROA 3KK3B 4F2RA 1C0TA 1N0UA 2VFTA 5KFFA 2E5HA 4NMXA 3J7A1 1NKCA 3DOKB 2E5LF 1CJTB 1PC5A 4DOZA 3G6VA 2EG1A 2HKEA 3IP0A 1ZAXA 4USKA 3GR0A 3W66A 4F0KA 2XYPB 3NCPA 4CM0A 3KLVA 1T95A 2WB1D 1AA1B 1BQMB 2CQDA 2OELA 2VA3A 2NZCA 1FKOA 2UXDF 3JSBA 2QMWA 1DJ0A 3BJYA 3LGHA 4NEZA 4OI6A 4I2PB 4AD6A 2K3IA 3QFHA 4IOBA 4QPTA 4WFBQ 1Q5VA 4PPZA 3W2VB 3P8BB 4LRFA 3KDNA 4EWTA 3HFZB 2YPYA 4WP3A 1EB0A 3GG1A 4KFBA 2HNYA 3C46A 3DRRB 4ELVA 4KC5A 1IKXA 3M6XA 1KFSA 1OQ3A 5LSOA 3BKFA 4JI3J 4KGMA 3I82A 1JWWA 2YNGA 4A8MP 2K06A 1GT8A 3G2XA 4V19J 3ZZZA 3UD3P 3CJKA 2UUCF 1RDRA 1YRXA 1XBWA 4PXDA 3QJLA 2YKOA 3IBCB 4Y2MA 4DHVA 4KO0B 2I38A 1XTZA 1UCNA 3QGHA 2MHEA 1GMWD 1BD6A 1RWPB 4ECSA 1T03B 3AY0A 1L3VA 4LFBJ 3H0PA 3HSJA 5IC6B 1DARA 4O3PA 1V3RA 1HI8A 2LQBA 4YR0A 4MKYA 3N6NA 3TOQA 3ZFVA 3SI8A 2LA4A 4XDCA 2CG8A 5GADU 3A8IA 3MR6A 2WBMA 3D5MA 4MKAA 5H9EK 2AHOB 3S01A 2XS5A 1SC1B 4JI8J 1YBTA 2H4YB 3OBIA 4TY9A 4ATNA 2HNZA 3I5BA 2ZH1A 1UFWA 2A6OA 3W5YA 4DXLA 1U0SA 3M2UA 1LFWA 1NH7A 4CCHA 3IS9B 4PEOA 2LEBA 2BRLA 1NDPA 4JV5J 3DM2B 5E0OA 3M8QA 4MJKA 3LP2B 2QYCA 3CMES 5CYMA 4B3OB 5HP1B 2B7CB 3GG0A 2JX2A 1Q86T 3DLGA 1VQ8S 1RK8A 4H4KA 3FKBA 2AJ0A 2CRLA 2ZOFA 3UO0A 4C48A 4OX6A 1N5QA 2QN6B 4DSFA 3UCZP 1JB0C 3BR9A 3RU0A 2KN4A 1X9WA 4F4KA 4N7TA 1ZBTA 4WPAA 4YHHF 1XQIA 2ZKTA 2UXCF 2PE8A 4WKRA 1RLCL 1TL1B 2IC3A 4YUDA 3J81U 4U7CA 4QYZJ 1NZ8A 5J2QA 3DOLA 4CNYA 2B9YA 4CH7A 1NPPA 1Q4RA 3GZ7A 4WK1A 1CJVB 1TAQA 1Y5LB 2DGXA 2E7XA 3HVTA 2G2YA 3QLHB 4RO0A 4R0JA 3GYXB 3N5BA 1CJKA 3UN3A 3U1NA 4YR3A 1X4DA 3PO5A 2YX4A 1VIOA 2HHSA 2GQCA 3JSYA 4ZVQB 4U8VA 4IOCQ 1IBKJ 4EI2A 2C2EA 3OTEA 1H3DA 3M30B 4K59A 4ZLNA 3CF5Q 2MY8A 1RTDA 2C1EB 2MZRA 1RTZA 3DHWC 3CJ8A 1MN9A 1MLAA 2O3DA 1FE0A 2WSEC 3C14A 4MYUA 4C98A 2HSEB 1AXQA 5B0CA 1FKAF 1APSA 2VOPA 2DR6A 1TMMA 4RUCA 3B78A 1WSVA 2BRKA 2HVDA 1SB6A 1WOPA 3A8EA 3KLEA 4DV3J 2KRBA 3B6BA 4ES2A 4B3RJ 4ZCLA 3MTKA 4MYTA 2EC2A 2JRSA 2DNHA 3OT9A 1LK7A 5GAEU 1CS4B 2LU1A 3EZUA 5LXYA 3G6XA 1WC1A 3CPWR 1XMOJ 2MQPA 3X3UA 3CD5A 3RB3A 2RQMA 2AU0A 2FLOA 4UOFA 3PW0A 3H7HB 4DL3A 1S1XA 4Z7CA 1I3OB 1O51A 2A2CA 5KG3A 2RKIB 2VG5A 4Z2XA 1JJ2R 2ZBPA 1GFWB 1WHYA 3G6ES 4A8QA 3JAMY 2MZ1A 1UA1A 1RKJA 3S7RA 1LW2B 2VBXA 3DGVA 4USVA 1VQ9S 1FX2A 5CH7B 1U1MA 4E2FB 2HVIA 4YB5A 2X51A 4MFBB 1X4FA 3G8QA 3VAKA 1KHVA 4X62F 3IR5B 2Q3PA 1KP6A 2DEIA 3MM7B 4H4MA 5L8RC 3VGTA 3PO4A 2FLPA 2W7PA 3IWLA 1RHUB 2AEJA 2JEJA 4LFCJ 4A8KA 2P6SA 2F8HA 1HIYA 2J76E 2HNDA 3S1TA 4DR1J 3T1HJ 4W90B 2OSRA 3DRYA 1AROP 1IUJA 2XMMA 1Q78A 4AXJA 2W9BB 2XZDB 1KTQA 1ZM9A 2IA0A 1S6OA 3BREA 2R8GA 1TP7A 1MN7A 2WRMA 1CJKB 4DV0J 5THWA 3VAGA 1Q81T 1UWAA 3QLHA 3LOUA 1FKPB 5A8WA 1NDKA 3IR7B 3H2LA 5E5NA 1VMBA 2DPJA 5KG2A 5KT4A 2OGUA 3G8TA 3AHPA 3ILOA 4H4KC 3LPYA 3SCLE 4Z37A 3UD5A 2FB0A 4NXMF 2VBYA 3W3SA 2GMLA 4J90A 2OTJS 3SQOP 4DL5A 1OJ4A 1FVSA 4TLRA 3I55S 3HK2A 1K0VA 1X4EA 3F56A 3DLGB 5HJXA 3T9ZA 1TKTA 1AUSL 2OPQB 2DIUA 3AD7C 3LO3A 4LJMA 1T03A 4WFAQ 2H1YA 3VZHA 3M05A 3TJAA 5CYMB 4KO0A 2VPYB 3LP1B 2DXFA 2CZVC 2Y8WA 5A0YB 1FRLA 1R0BG 7FDRA 4P75A 3CJKB 2MGZB 1VJQA 2H48B 2KTQA 2XCAA 4LF9F 4ZP8A 5LMNJ 2ZJQQ 3FBBA 5E7OB 4FVMA 1UPMB 1HNIB 2CQ2A 2IDEA 4U7UD 4F0HA 4RZRA 2H5IB 3BGRA 2ASLA 2ZNYA 1GTEA 2QV6A 2BDPA 2WSFC 1SC4B 2QT7A 4ZIVA 2OPSB 1JK9B 3OXGA 2AYGA 4O0NA 2J9EA 4K0KJ 2CAJA 3R5BA 4OYWA 3BKTA 1WSRA 3HFVA 5E3AA 2B56A 3BM7A 1EAYC 4KGKA 5DJBA 2BV3A 1TFWA 2FZGB 1JIHA 1SKRA 3W2VA 1B7YB 4HH1A 4DL7A 2O67A 2YKQA 3VVTA 3PJXA 1RXOB 1DAXA 3D3BJ 3R7NB 3RGIA 4ANEA 5AXLA 1N54B 4X65J 1YX2A 5H9EJ 4KIAA 3W65A 3MEKA 1DTQA 4DV7J 3UNYA 2ZH4A 2C28A 1FKOB 3TI0A 1U8WA 4M5MA 1F9EB 1FD2A 3DFEA 4F36A 2DXEA 1M1KT 2MQLA 1TZ0A 2W01A 3MZIA 2AIRB 1PJ6A 5AE1A 2CPFA 3K2YA 4G1PA 4KHRA 4NCGA 4MAKA 1VRUB 4ECRA 4JV1A 1R6YA 2K2PA 4ZPTR 2MGZA 2CFXA 3M8PB 4WYWA 2J8AA 5A0YA 3MMCB 4ZCKA 2LXFA 4MKBA 4ETXA 2ATLA 2ZC4A 5JMNA 2EPIA 5KFBA 2DGVA 3V5RA 2QSFA 2A0FB 5A2QU 4KRWA 3TVZA 4DL2A 2YNFB 3MM9A 2B43A 1WG5A 3DDIA 4O4GA 4I56A 2UVRA 1QSYA 1KFDA 1U1PA 4K4YA 2DHGA 2DGWA 2QG9B 1VQ5S 4DN9A 3QATA 1BQMA 3EDQB 3PJWA 5D4LA 3GFXA 2D74B 2Q43A 4IKAA 3OPKA 2GNKA 1A0OB 1RT4A 4LSLB 1HHQA 2G0CA 1N34F 2CQHA 1KR4A 2YWGA 4HHUA 4EYIB 4ZITA 1XR5A 4G1IA 1HQEA 2JEGA 2VF3A 4NLYA 2G0JA 4ZPCA 5KFTA 3I6PA 2PDAA 3O5TB 4WTYA 5EX3A 3KLHB 1VQMS 1U1NA 1NSPA 1HNWJ 1RLDA 1RBAA 1N4LA 5HJYA 2ZM6J 4DV1F 2PD1A 2Z2YB 5B0GA 3RAQA 1FWPA 3H98A 1KTVA 5D0GA 5GAGI 1RWOB 1LWCA 3LGMA 5L1KA 1H2UX 1EP4B 2F65A 3O8WA 4DS4A 1TAUA 3ZTQA 4O44B 3CDEA 5L39A 3CMAS 2VU5A 4K4UA 4HVZA 1IQZA 2DD8S 1X8DA 2WHOA 3IO1A 4CLKA 5KFGA 2Z8QA 3AQPA 3KXDA 2RHSB 4USHA 4IFVA 2OFGX 3WQPA 1LW2A 4HHJA 3CCVS 3AOCA 3MEDA 2DNKA 2KVIA 1TR0A 2YX1A 3A1YG 1NJIT 1WDDA 4HL9A 1MWZA 1IJEB 4DR7F 5J2PB 2CNKB 3GIMA 3FFIB 3MEGA 1RT3B 2MPUA 3QMQA 4J91A 2VL1A 5KFAA 1S9EA 2KI2A 2DEJA 4DR3F 3BBBA 1FEHA 4K4TA 2PGCA 3MEEA 2VKRA 4P73A 4DF8A 3JQKA 3J7YU 2WONA 1F6TA 2BE9B 1RBOB 2QMXA 2Z57B 3MAAB 4WBFA 3HO1A 2AYMA 4LF8J 5E2QA 3KLEB 2DNGA 2GMHA 2CNNB 1VYAA 2BE2B 3I0RA 4NX9A 1EKSA 2NR0A 2KHDA 2OI2A 2QYGA 3PX0A 2QLJB 1N32J 3R1HA 2WAQD 4GO7X 1RI7A 2NSCA 3QGIA 2IVYA 5HMXA 5LT5A 1U1OA 3VV2B 5T14A 2DVIA 2XNQA 4DCOB 3EXYA 1LFPA 3NGUA 3KMQA 4ED4A 1M5OC 4YEAA 3OR2B 2LCWA 3O2IA 5ETRA 3HVTB 3FRZA 3MFIA 1S48A 3A8KA 4NASA 3MOZA 3CEDA 4RW7B 1GXTA 3M2VA 3IWXA 3EGWB 3NAIA 3IM8A 3SQGB 3J80U 3HJFA 1I5OB 1F2HA 3W8GA 2ERRA 2QRRA 3AA9A 5GMEA 2J0QD 1TL1A 5IWAF 1RA6A 3U27A 5DM7Q 3LP0A 3TUPA 2OKQA 3QAUA 4OZ3A 3ZO7A 2MQOA 1NCLA 1JLCB 2CQGA 3HHLC 5JVHQ 5D6GA 1UL3A 3DXSX 2AF6A 4ANCA 2VIHA 3BSCA 4RWWA 1T9WA 2O1PA 4BWMA 5FJ4A 3GSDA 2O66A 4KB7A 3GIRA 2J6UA 4K4ZA 2EW9A 2VG6B 3CJQA 5C42B 3IRWP 3KJNB 4UUWA 2RS2A 9RUBA 2AGOA 3CWJA 3GWCA 3GJTB 3MF5A 3FQKA 2RJZA 1JJ4A 4FVCA 4J9NA 3EGZA 4M5GA 2HNZB 1JJHA 1R89A 4URGA 1SH0A 2WOMA 2XWYA 2H4WB 2W4DA 4PXEA 2VFUA 2B8PA 3SQGA 3FMWA 1KQKA 1XEZA 2MY7A 2XS2A 3H5XA 3BF4A 3AXMA 2CZ4A 1KKHA 1J5EJ 4LRBA 4OZ2A 2WK4A 3CIZA 2XMAA 2FHOB 1X0FA 2NYIA 4Y0FA 3BGUA 4DL6A 4WE1A 3NGRA 3TAQA 1DFDA 5DDQC 2R7VA 2X1BA 4TU7A 5H1SV 2NXJA 1TUVA 2HZAA 1NKBA 1JLEA 2NUHA 2XZWA 4I1TA 2EEYA 5HVFA 2H51B 3RR8A 3HSDA 4RLEA 4TKTA 3TP2A 1F5AA 2XMKA 4BC9A 4FN5A 2CQ3A 2NXCA 3QRQA 1XMBA 2R8IA 4LFCF 2W2QP 2Z58B 5CAAA 1RTJA 3V6JA 1LV5A 4Q8FA 2FJXA 2YNIA 3RAXA 4DN0A 2HFZA 4U96A 4ECXA 1NK0A 3D4JA 4F4ZA 3CNQP 3E01B 4GVBB 4QW9A 2HNYB 2W4CA 2BW7A 3BBCA 4E98A 2KU7A 3CDWA 3LGNA 3MEGB 5A2QY 4NYPA 4LBHA 3OVBA 4CH1A 3D6TB 2G13A 4C2MA 3MD3A 3ISNC 2YWHA 3KNGA 3M32B 3IWNC 3L9ZA 5EWFA 1YJVA 2MKIA 4I2PA 2XLJA 4Q5VA 1NKEA 3EICA 4CWBA 3LA0A 3RRHA 2ZBIA 5L1LA 3R6LB 4DG1B 3MMAA 1U1QA 2L3MA 1SPBP 4IR9A 4IG3B 4YDDB 2GO9A 5IFMA 1FRMA 3QFWA 2BR0A 1UW4A 3TVYA 1MROB 4AL7A 4I6AA 4FYWB 1Y5NB 4R5PA 4J9QA 4DV2J 2VUGA 4IO9Q 3CGIA 3V81B 1K8AT 1JNZB 1OPIA 1Q79A 2Z2ZA 1VCTA 1R27B 1VHIA 2EKNA 4OYBA 4PWUA 4P9SA 3KLHA 2VPXB 1HW9A 2MKYA 4P2FA 5HO4A 5HROB 4BC7A 1HQEB 4PQUA 4DPWA 2ZJPQ 1X7VA 3UR3C 5JUMA 2V4JB 1TK0A 4NLGA 3ENVA 4Q0BB 2BZ2A 2J6SA 2ZZNA 4DF4A 3D6HB 1JXEA 1YWXA 1RWXB 3SDEA 1R31A 3SV4A 3R5JB 1M0SA 4ZHRA 4JYAF 4PG7A 2YVSA 3TAPA 4YOEA 3W60A 2D69A 3M6VA 2W9CB 2GV1A 2F4VJ 3WC2A 3NNHA 4Y2CA 4O4GB 1TL7A 1ZTWA 2KFZA 3C15A 3MM9B 4ELTA 3VWSA 1ZAVA 2V68A 3MMJA 2COLA 2N7CA 4B9NA 1KVJA 4A8FA 2CNLB 4FXVA 1XMQF 2E1MC 2V9WA 1G1XA 4OI0A 1LKZA 2Z2MA 3TW0A 2QFJA 2P9CA 1WELA 1YVFA 3PW7A 1ZH5A 4DFMA 1J5OB 1FERA 1X4AA 1Z4UA 4F4AA 3CCJS 1YLXA 4ZCMA 4PUOA 3ENAA 3CXCR 3HHDA 4OYXA 7FD1A 1H73A 1DQ8A 2FQQB 4IG3A 4NE9C 1U0HB 5A76A 2YNHA 7AT1B 3JSMB 1NK6A 3ETMA 3NWRA 3FCVA 2HHPA 2DNLA 1FEEA 4NWBA 1EZZB 1FA0A 2MLXA 1S6QB 1S57A 4QIFA 4FBTA 2HHWA 1TK5A 3OFEA 1FJGF 1JKHA 4DV4J 3KJVA 4QR2A 3UW1A 2VA2A 3GB0A 2C3MA 1IBCB 4FF3A 1BQXA 3SCIE 5JXSA 4YFUA 1HNZF 3E01A 1SJFA 3FNNA 3ISND 3H5YA 1N0VC 3I5AA 1YGYA 3ZZTA 3VAMA 2WVFA 1VFJA 3BGRB 4R25A 3K5MA 2HG4A 1KC8T 2OD6A 3CVKA 1FJGJ 5G0RA 1M90T 1HBOB 2Z30B 2R7OA 3VQSA 2M5YA 2YWWA 1P1LA 3NS5A 3JQMA 3LAMA 4JI3F 1FD8A 5CQGA 3CCQS 4K4WA 2FZCB 2RSQA 2ZHOA 3BDEA 3LP1A 3JYTA 5FLXY 4UOHA 4DQRA 5CXTA 1IN0A 1DY3A 4F3OA 3T6BA 2H3EB 4UF4A 2RRAA 4QIGA 5F9NA 3LWMA 3HHNB 3N01A 4K50A 1WDTA 2MKKA 4FNIA 5LMUJ 2V6AA 1IBMJ 2YBVA 2MLYA 4C3LA 2WOMB 2RB7A 4CLWA 5ETOA 2MB0B 4F8RA 2QLBB 4M63A 2RMLA 1VRTB 2RUSA 3AH6A 3MECA 4U6PA 3OSNA 4O3SA 1MMNA 3CULA 5AT1B 2RU3A 5MAOA 1FRIA 1NK8A 2XCPA 1JLGA 2D3UA 2FC9A 4O23A 2PEHA 1VBKA 5HK4A 3B4MA 1S9GA 3OFHA 1DQAA 3NNAA 2P9GA 5DQGA 4B3SF 5BYSA 3DRPB 2V8PA 2HBYB 3K57A 1PCAA 3C6UA 2DNOA 2P9EA 4IRDA 1BLUA 4H4MB 2KYZA 2FY8A 3TO8A 4MKVA 2VHGA 3DOMA 2A2DA 3PEJA 5CD4A 2R8HA 1IR1A 2NS1B 4CTAA 4PQAA 2QMUB 3KLFA 4BWJA 1XIQA 2LEPA 4NLDA 1OS5A 4QJVA 1HWUA 2E1RA 3EZ5A 4KGZB 1HNZJ 2G4BA 4USMA 2FUG9 4ECUA 1W7WA 5F0UA 5C25B 4C8KA 5HN0A 4QOTA 2CZ9A 2HQIA 1QLNA 5I42A 3BEGB 4FKXA 2Y0SD 1Q16B 1RT7A 3HKZD 1LWFB 1UTAA 5E41A 5AE2A 1O8BA 2DNRA 1YHQS 4QW8A 2WBRA 1ZM4A 3CJ0A 3SYZA 1M5KC 1CS4A 5B0BA 3MXHP 2ROEA 5G4DA 3IRXB 2IRUA 4K0KF 4USJC 2BE2A 2CKWA 1MW7A 1UVMA 1HHTP 2K3KA 2L08A 4CIOA 4DEZA 1IKVA 1D9FA 1KQGB 1C2PA 4RR5A 4JB8B 3KHLA 3F41A 1S9FA 4NEYA 4NLXA 5CCMA 1PBUA 2FC8A 3HHEA 4QWAA 1FXRA 1SL0A 2BKNA 3FCHA 1HQUA 2CIMA 1GX5A 3WC0A 3I5CA 3NEKA 4NLTA 1VLYA 3VR1A 3Q8QB 3CO9A 1NK7A 2HBRB 4MIWA 1FDBA 3UD4P 1VBYA 1REVB 2FLNA 2R7SA 4TQSA 1IKYB 4CT8A 4AL6A 1UWBB 1D8YA 4OMFG 4UQTA 1KSPA 4BDPA 4C4WA 2ZWOA 1NHKL 4IFVB 1GMVA 4C3MA 3M2RB 1HBNB 2F3JA 2CVEA 2IC3B 2MYFA 2W1BA 1OQ6A 2Q6CA 4ZVPB 2EFNA 2QZ8A 2YX7A 4W98A 2KT5A 1XNQF 2VBWA 5HI7A 2RUGA 1RAAB 1JLFA 2CWKA 2BQ3A 4ED8A 2AYBA 1ELOA 3I32A 3RAMA 3VQTA 3BSNA 2P5VA 3C19A 3T3FA 4B3RF 2RRBA 4FZVA 4XTTA 4UTGA 3ET6A 3ITHA 2M0GB 2PN6A 3DCAA 2FYXA 3DC2A 2QSWA 2AX0A 2XSJB 1RJJA 2XYHB 3M8QB 2ZVSA 3K58A 2V63A 1YKWA 1XJWB 3UN5A 4DBQA 4CLYA 2I1RA 1FRXA 3OQ2A 4X64J 1JMTA 3TAMB 4CYUB 3VHQA 2A6MA 2VQEJ 1Q82T 1IBKF 3DLLQ 2CPZA 3AD9C 4O0IA 2RU9A 3RBXA 5EWGA 2BEFA 1XK8A 1H2VZ 2B4PA 2IVFB 3B8HA 3D68A 4DUYF 3L7UA 2H5EA 2WW4A 2ADCA 3CCWA 2ZC3A 5K8MA 5K14B 4HHHA 4ZPAA 4LSNA 1K0TA 4ID5B 4LRDA 2X1AA 1C1BA 4XO0A 4DSJA 4PWDA 4F4WA 1H7WA 3EGVA 1PSDA 2MXYA 1FESA 2EFQA 2IJRA 3GCWP 4YY3J 2VPZB 3QYYA 5CYQB 3MM8B 1ZS6A 2ZD1A 1ICEB 4GKJF 2JC1A 2AV5A 4WWSA 2ZVIA 1ZTTA 4ZVSB 3R2DJ 1HARA 2F4FA 3D67A 3M8PA 2DKOB 1G6BA 3NAHA 1VRUA 2OLWA 4C0BA 3Q86A 3W9IA 3CT9A 2KG1A 1WHWA 3VTIA 2GX8A 1NJXA 4OHWA 3I4PA 4DSLA 1FTCA 2IYIA 2O01C 4L73A 1F60B 4NLVA 4WJBA 3TUIC 2HBZB 4JI7J 2CJAA 2QL5B 3C16A 1E6VA 4FYDA 4WYLA 4WZMA 5FLXU 3N6LA 4HKQA 4HDHA 1F9FA 4CO0A 2R8JA 3I0SB 2KFNA 4JI8F 4BHQA 1Y3JA 2Y1IA 4LQ3A 4WP8A 2ROPA 4EYHB 4NA2A 2Q1LA 4TU9A 5L1IA 1NB7A 3AXKA 3OUYA 2XY7A 1F9HA 4FNHA 3EGNA 4DZDA 3TX0A 3GP9A 3V6HA 2NCKL 3K8VA 4DLGA 5KG4A 3PR5B 3MDFA 3I31A 3C66A 2QE5A 2ZH9A 2LMIA 3NP5A 4AFFA 3PW5A 2C2OB 4YHHJ 2B9EA 1WD6A 3DOKA 1KOOA 2KYXA 3ONQA 2UU9F 1XR7A 4C11A 3MOJB 1Y0HA 2BJ7A 2QLWA 3DLEB 4WXOA 5K20B 3FSXA 4ILMA 2M2BA 2RQ4A 3NOCA 3UDVA 1TKTB 2OPQA 5B09A 1YJ9S 3PRBA 1SJQA 2ZH5A 2ILYA 1S1UA 4EFAC 5DM6Q 2R2UA 1K47A 4FF4A 3DYAB 2X1FA 1JLQA 4ZOSA 2FGOA 3ZZ0A 4ED5A 2DGSA 4NI2A 3L95X 3PW2A 1U4BA 2BW2A 3P6YC 2BANA 2UXBJ 4J9MA 2YQ1A 3DLHA 2PSZA 2R7RA 1DTTB 3T5HA 3IG1A 3PV8A 1SVDA 1K1SA 5CYJA 3KLGA 3B82A 4TU8A 5LSRA 1S72S 4RW9B 3IM9A 3OJSA 1U1LA 3QGPA 2R7TA 2D7SA 1S59A 2VDIA 3W63A 2OO4A 1KWMA 1C0UA 2AGQA 2Q6BA 1S1WB 2J5AA 3M8RA 3ZTSA 3D0IE 3GFYA 1TKXA 2MKSA 3UVJA 2A3JA 3THPA 2DR7A 2RRNA 4ZPBA 1HR0F 1KVIA 1UJ5A 3T41A 4KTQA 5J2NA 1YTYA 4C8OA 2YXLA 4RW4A 5C5JA 4V1Ak 2L48A 3KHRA 1RADB 3BQ2A 3VAIA 3K17A 1HD1A 1T02A 1NBEB 1FK9B 4CH0S 6FDRA 4I2QB 3CCMS 4I68A 4YB1P 3HVAA 2V2QA 4ZKAA 2ASDA 1B7FA 2PMWA 1KVKA 1NB2A 3GFZA 1KEKA 4RUBA 2LKZA 3T5KA 1WC6A 3Q22A 4LBPA 1IR2A 2D9OA 1WF2A 2OD4A 3N5FA 1VISA 2NUUG 4KGVB 5IS2A 1ULRA 2JL9A 4TQRA 5A8KB 5I4MA 4XIUA 3GPAA 2HMIB 3Q8SB 2ILZA 2RAQA 4LF5F 1TL3A 3OD2A 4JBCA 5E33A 1MMDA 4HACB 2BQUA 1HD0A 1T0TV 1Q95G 3ZC4A 4QR1A 2K1RB 1JQGA 3MUVP 4JI4F 3QJPA 2DGQA 3THTA 2UXDJ 2ABYA 5KFHA 3DLBA 2AKWB 3Q2SC 2FJWA 2VFSA 2ZITA 1ZPWX 3IAS9 4OZ5A 5F8MA 1EIYB 1TV6A 2DTJA 4P7VA 3BO3A 1SUQA 3MM6A 3SXLA 3FVYA 4QIWD 4M95A 3R5DA 3I96A 1RTDB 2YWEA 3Q8UA 1JXVA 1RHMB 3M30A 1U49A 4AQYJ 2PMHA 4HDGA 2DK2A 1MNEA 1SJ1A 5A8RA 3RYLA 5HQMA 4DR2J 4MK7A 2CJBA 4YB7A 5DETA 4L72B 3MURP 1UW9A 4ER8A 3UNGC 1UJ6A 3BBFA 3ZNJ1 3TQEA 6AT1B 3V4IA 2H5JB 1S6UA 2OHDA 3H40A 2C3YA 1F2GA 2DYAA 1IKWA 4OYZA 5EX0A 2IPOB 1HBUA 4WU2A 4ED7A 4NPOA 1KLMB 4NLWA 2XO6A 3UN2A 4DPUA 1QUPA 2NPFA 4DQPA 4JOUA 4GKKF 1T05A 1M1HA 3DGPA 2ZE2B 3N0VA 2C22A 2J0XA 4K7QA 4DJBA 2HHTA 1WHXA 2PC6A 1YG0A 4L3NA 2R4FA 2HK3A 1RGVA 4RUHA 4J9SA 1RABB 5HP1A 2BM1A 1H72C 3M9OB 1SXLA 2R7XA 5BJRA 1QTMA 3PIOQ 3CCUS 1MWQA 3RW7A 3R3TA 4Z7YA 2HHXA 1FHTA 3PYEA 1RAHB 3C6TA 1IVZA 3M2UB 4KGXB 2KDOA 3OR1A 1OY9A 1R8CA 3OTDA 4OL8A 1WOSA 3X1LB 3D66A 4DL4A 2HRUA 2F9JA 1EHWA 3QSIA 4W92B 3C6TB 4U8YA 3ZZYA 1HQ2A 2XHCA 4J9KA 4DR3J 1K44A 1UP1A 1U6FA 5BR8J 2DGTA 2GCFA 1JLAA 2KB2A 4USTA 2VASA 4U9RA 3IA0A 2X7IA 2OEJA 2XZTB 2C2MB 3HXMA 1RA7A 2G2ZA 1CJUB 4P6QA 2J8SA 4O3QA 1FNXH 2IVMA 3IMQJ 3KUEA 2DXDA 4ZVTB 5KG6A 3LW5C 4OZJA 3DGPB 5KT2A 3EPIA 3WDOA 2NLWA 1UVKA 1VDHA 2L9DA 1FRKA 3HX9A 2JLEA 2MZSA 4B9UA 2B5JA 3PDNA 3JTNA 4OZNA 1RHJB 1VRQC 2ACYA 1IKWB 5K8NA 2F7VA 2QTWA 3TJ8A 5HLFA 4LMZA 1VQOS 2DNQA 5K8OA 4ZIWA 3V4IB 2APOA 4MIAA 3FBEA 1IKXB 3ILLA 1OYDA 5L9NA 4H54A 3MM5A 5B0FA 1X0PA 5LL6d 4M5JA 2HWIA 2Y1LB 4FS2A 5KFIA 1VQSA 2ZOMA 1L3SA 3LH2S 1M5PC 2H9ZA 2QL9B 2KM8C 5FD1A 4K4VA 3MM6B 5F0WA 4J37A 5F8NA 4ZS6A 3G71S 1U8SA 2FPHX 1WTBA 4FDFA 4TY8B 1RHQB 3W1YC 2IY5B 4DQSA 3P5TL 3W5XA 3EX7B 4J7CA 4LSZB 3BV8A 1RTHB 3B4DA 1VQKS 1B0PA 2K1RA 5HMYA 2AGPA 4TXSA 4DR6F 1GH8A 1NXIA 1Y7PA 2LQJA 4Q2LA 4QU6A 4O3RA 1CJTA 3QWPA 1ZZNA 1U6ZA 1KN6A 4F0MA 2RQKA 3KHGA 3U7JA 3M1VA 2M3DA 5KFZA 3QIDA 1IR0A 4RNHA 4ETZA 5A8KA 1LW0B 5IV3A 3OVAA 3KK3A 2GO8A 4JI7F 4C8ZA 3KK2B 3QIPA 3TA1A 2FJVA 4CLTA 2VD3A 2JVOA 4LF1A 2GC8A 1RYRA 1RT2B 4ZVRB 1ZYQA 4KQZA 1GK8A 3V6KA 4RPFA 1DQ9A 1LQ9A 3R27A 2DRBA 3BSAA 2GJ2A 2HQ3A 2WZ1A 4ITSA 5FDLA 2OMLA 3KNAA 3NNCA 4KKOA 1S4FA 2OPPB 4RWXA 1FNOA 4RW4B 5HSPA 1J27A 1L3KA 2GW8A 4KPYA 5LSLA 1SH3A 3MCMA 3T5JA 1Q53A 2GIQA 5C24A 4IFYB 5J2MB 1BE4A 1GQEA 2DHAA 3D7SB 4N41A 3DRSB 4H4OA 2C3UA 3J7AN 3ILIA 4TN2A 1T9XA 4OI1A 4LR8A 3W2WA 1S1VB 5L1JA 2VODA 3C8YA 3T9NA 2YQ3A 2LVWA 2J9DE 4HTIA 5JJBA 3GR1A 3K5NA 3RB0A 3MPDA 3Q83A 2WVDA 1WKJA 1TKZA 1F5BA 1V5VA 5ETMA 3RZAA 4ZLPA 4JYAJ 1GAOA 2CPEA 4IFYA 4PG5A 3CJRA 3KLGB 2CPXA 2LP4A 4N8NA 3NXZA 1D1UA 3HULA 4A8SA 4ZJOA 1GTHA 1N32F 1X60A 3RG6A 1RWKB 4WU3A 4IRCA 3FSYA 1O0PA 4NMLA 4RW8B 4B3SJ 1WKLA 1U02A 4ZJQA 1B70B 1RT2A 1DZ5A 1R8PA 3UFCX 2FJAB 2MLZA 4NZ6A 3TWZA 2CNOB 5DDPC 4PYAA 3UCGA 2IIHA 1RSCA 2XMVA 4R0EA 3W9HA 4EU0A 4NCBA 3TJ9A 1OPZA 2I5JB 1N8RT 3LANA 2AEMA 3DNCA 3HD1A 1RHRB 3VF0B 4CI0B 2LDYA 1S0OA 2ZZTA 2C3OA 1NSQA 5HMZA 4PKDB 4DWIA 1PIEA 4K5SA 3B54A 4DU7A 4ECVA 3MCNA 3Q8VA 1SJRA 4PXCA 3A3OB 4EGLA 2VJVA 4TYBA 1NDLA 2M52A 2OPRB 3H8YA 3QO9A 1YJRA 3G8SA 2V69A 1FJEB 2X1GA 2ZUGA 3TEGA 4M5DA 2E9ZA 3RW6A 2R2RA 3BH6B 1TU0B 2Q79A 2GGPB 2HIYA 3MUMP 2OH2A 1YITS 4KPCA 3WIUA 2OP5A 4DX8H 1QAXA
chains in the Genus database with same CATH topology
2GJIA 1S1TA 5KFEA 1HNVA 1IBLF 3SV3A 2HVHA 2LEAA 3SCJE 4UUXA 3SFUA 2XHWA 4O3NA 4ICLB 5HMWA 4N76A 1TL5A 4U7UK 1HHSA 5LJ3Y 4DUZF 1UVNA 2VFVA 2RF2A 2V9KA 4RNOA 1V3SA 2GHWA 3KMSA 4OZLA 4Y2AA 2DH8A 4DLEA 2DCUB 1I6JA 5KT7A 2FVSA 4ID8A 2ZDPA 3CC7S 1JLBB 2IMWP 1VQ4S 4OJ3A 1FO1A 3BGLA 3MCSA 2KFYA 3BQ1A 3K7RA 1VC5A 1JLAB 2E29A 2RT3A 3O1LA 3V6DB 4LSNB 4ZVFA 3T1YF 3OHBA 2GHPA 5HBMB 1FDNA 4DFPA 4J9RA 2WB4A 5LJ5Y 4CO2A 5KFCA 4G1QB 3ZZRA 1YQHA 2YY3A 4EO6A 4EEYA 1FE4A 1X5SA 5B08A 1UA0A 1YJTA 1KOHA 1U6BA 2YKNA 3MD1A 1F5CA 5IM0B 3PXGa 2EG2A 4E0DA 2N82B 4OI4A 3OVSA 1D0EA 4NLUA 2IAJB 3LUYA 4TYAA 1KSPA 5J1NA 4A47A 5DGBA 1NHVA 2ZDOA 4OJGA 1QM9A 3M2RA 3BQ0A 1R0AB 2CJKA 4QBUA 4RW6B 4KV8A 1W2IA 2EFGA 2C2DA 2V8GA 1B0TA 1RT5B 1M5SA 2EVZA 4DV3F 2OFHX 2N4CA 2I9SA 3HFKA 4NRTA 2XY5A 1N33F 1VK3A 5FIIA 2PI4A 4F02A 1BQNB 1L5UA 2LLZA 3H2VE 2KZMA 1QAIA 4OHVA 2VONA 3OV7A 5I3UA 2DGOA 1FDAA 2EBGA 4LQ9A 3JTPA 4HT5A 5KFPA 1RTIB 4DV2F 3V4MA 1TV6B 4E8UA 3PRDA 2HGLA 1EETB 1X9MA 1NU4A 3MFHA 3EYZA 5KFYA 5KFLA 2DH9A 4X65F 3CB4A 3IXQA 3PX6A 3EPGA 4WXWA 4OX8A 3J7YI 1GX6A 4ZPVR 1QE1B 4OQJA 1FCAA 5GAEI 3L3CA 4NL5A 2OIHA 4A8YA 4PCQA 1RT7B 2ASYA 3UDCA 5CZXA 3NCRA 5I42B 2AJQA 4X2BA 5C25A 2HWHA 4OLPA 2IJFA 3P49B 1FJ7A 2M8HA 1UVLA 2BJDA 1FTRA 1U24A 1LK5A 2JSXA 5D4PA 4X4RA 2VB6A 4DR1F 5F8NA 5L38A 2Z2LA 1Q8IA 2MQNA 1HBMB 3ENQA 4ECTA 4DL0C 1N5YB 3CD6S 2J7KA 3PNIA 3C6UB 2W8KA 1HWIA 1UJ4A 4J5OA 1SBRA 1Q8LA 5DO2A 1CC7A 4AUKA 4QR0A 2E9TA 4OX9F 2HLTA 3HP6A 1V3ZA 3L09A 4ZVGA 2C3PA 3OLAA 1VIXA 4RW9A 5U47A 4NA1A 4IH5A 5KFRA 3TRGA 4ZP9A 2KO1A 1M5HA 3C2PA 2HRYA 2OMOA 1QSSA 1SJ4P 1CVJA 2HVZA 4A8XA 2ZH6A 1RT6A 4ED3A 4P7TA 4IG0B 3NBPB 4R8UA 1HI1A 4DQQA 3HZEA 1HNVB 5KFUA 4CZCA 3HPOA 5F3TA 5DS7A 5T7LA 1Y4ZB 4YDXA 4JI0F 3DLEA 3PVXA 2JC0A 3NBPA 1QY7A 4QIVA 2XS7A 2F9DA 3IR6B 1QJHA 4NLQA 5KFNA 4FXDA 1HYSA 2JZ5A 4IDKB 2OPRA 1N5TA 1P1TA 2F8EX 3TX8A 4LIWA 4B3TF 3BN4A 1VI7A 4RX6A 5G0RB 4WFXA 4WZQA 2RD5C 2DR5A 1E6YB 3SMZA 1H7XA 2DO0A 4OV1A 1W25A 3Q8RB 2KXHA 2OJ3A 1C1CA 2ZBCA 2R7WA 1OO0B 1WI8A 2V0NA 1JKHB 4K4SA 4R8UB 4X4VA 1WACA 4IG0A 2XO7A 1OSCA 5D3GA 3LWLA 3FZ2A 4P2SA 4URSA 2YNHB 3WBZA 4O3OA 3JSMA 2CPDA 5B0AA 1N36F 1BGXT 1LWEA 5F9LA 3AA8A 4GMKA 1XN9A 4DMZA 4JI5F 4Q45A 3NL0A 5KFSA 4F4YA 4A46A 2PIIA 3AJ1A 3BN7A 1SQEA 3F73A 1J5OA 1F0XA 1TVRA 3UE2A 5J1EA 2VC1A 2J0WA 2FHJA 5AXNA 3RB6A 1IXKA 3POTB 2ZZMA 3MM8A 1R8BA 1FXLA 3UQSA 3DU6A 3LAKA 4ILRA 3NLCA 4Q44A 1NH8A 1J2VA 5DRKA 4ID5A 5C24B 1D9AA 1RKIA 4NCAA 2M70A 3HMJG 2Z4PA 2V4QA 3E51A 1B64A 1XWLA 5FDLB 1PC4A 5AXKA 3T19A 1WTFA 5KG1A 1NJYA 2HLUA 2IJNA 1CLFA 2CQIA 1Q7YT 3QIPB 2J9DA 5D4OA 1HMVA 3Q0AA 3CCRS 3MUTP 1KONA 3UI3A 2PA8D 1RP5A 3M9MB 4EZ9A 2E5JA 4WFZA 4EO8A 1ZAWA 2N4DA 1QE1A 2NXUA 1IM4A 5CA5A 4N56A 4B9VA 2RNEA 3DLKA 2ADBA 5KG7A 5GAGU 3MMBB 3VAJA 4FXWA 3K5PA 1YJNS 5HL7Q 1EETA 2N3LA 2XMTA 1RAJA 2HHUA 4K4XA 4QYRA 2Y1JA 2IAJA 4LUBA 1CG2A 1WHVA 3DLKB 4FF2A 4XK8C 2KJWA 3O6QA 5EWEA 2XNRA 2WTFA 1IKYA 1HA1A 3R5AA 4QU7A 2DR9A 3TA2A 3V2UC 1U48A 1GXLA 1PGZA 3OL7A 1U45A 4NLPA 1JX4A 2ZOGA 1RT5A 1VJWA 2V5HG 2BXJA 2CQCA 2XC9A 1X4BA 1S77D 4QWDA 2PA3A 1YJWS 3HT3A 4QCLA 2HPUA 2XWXA 4I6YA 4XDDA 1XR6A 2AYEA 3H5UA 3KFWX 3T1AA 2DIVA 1NK5A 3GIIA 3FEZA 4ED0A 3DI6B 2YKAA 3KLIB 2HYIB 3OTCA 3GE9A 2PFFB 4F3QA 1TK8A 3OFGA 4DSKA 2OSQA 3MR3A 4IUFA 5IM0A 2LA6A 3MPVA 4WE1B 4B17A 3HKWA 3PKMA 2AX1A 5KT3A 1A9NB 4EBDA 4YP3A 2WCXA 2W7OA 2JLFA 2DR8A 2UZAA 1SV5A 2EFVA 3US5A 4G1QA 3D1HA 2QA2A 2N7YA 4OFZA 5GADI 3QWUA 3HDSA 3SZ2A 4OI2A 1NK9A 4IH7A 1TKDA 3V6DA 3GQCA 3DRPA 1U1KA 5D77A 1HNWF 1ZZFA 4URQU 4PG4A 1Y00A 4ED2A 2JOQA 1T8EA 3K8WA 2XGQA 1ZETA 1S0MA 2GGPA 1QVGR 1KS2A 1NJZA 2MKJA 4M5DB 2U2FA 3I4HX 3UDLA 2LXIA 1RT1B 4CNZA 2XI3A 3OHAA 3RTVA 1E6YA 2B6AB 1VQNS 4ECQA 1RISA 3VZIA 1AFJA 2PT0A 4EBCA 5KTQA 2JWNA 2R2SA 4LF4F 4LFBF 4DV0F 4K5RA 2CPYA 2UUTA 3MGJA 4IOAQ 3N6MA 4A8WA 4DSEA 1YJUA 4WFNQ 2POKA 1VC6A 3M6WA 3KK1B 2GQQA 3AAWB 1N6QB 5A8RB 1ZPVA 1S10A 2DT9A 3CIMA 3UCUP 3ZZOA 1N48A 2IM0A 1S7HA 4ZPWR 1FRHA 1ROFA 3JYTB 3S6EA 2JFDA 3QO9B 1RT6B 3OXFA 4DV5F 4ELUA 2XMWA 4RNNA 4CO4A 3T5LA 4YR2A 2FVCA 1HPZA 1ZM3A 3DHXA 1SL2A 4C8YA 2M9KA 3RBEA 4ZP7A 5F3ZA 3FJ2A 3DXBA 4NLGA 4DV7F 1P9QC 4JV0A 5KFDA 1S9EB 4CO1A 4J9OA 1TL3B 1U09A 2I5JA 4BCAA 1RT3A 2D1CA 2HMIA 2FJBB 1A6LA 4GC6A 3H20A 1XMOF 2MZQA 4QQBA 3VAFA 3N79A 4Y28C 2N3OA 2LXUA 3TANA 4Y3CA 4Q7AA 3EUNA 3NKYA 3RB4A 1FK9A 1VHFA 2AD9A 1N5YA 3K5OA 1HBMA 1Y9OA 4RU2A 2YWKA 2YWFA 2CQBA 3KG1A 4O44A 4JUZA 2GMJA 3BDPA 5DLGA 2F1FA 2HWTA 4X4SA 2MZJA 1AUDA 2FVQA 5GVQA 4TLQA 1V6HA 3JB9k 1TKZB 3PFEA 2FGCA 1MSWD 1C0UB 5IQ6A 1DHMA 4UQGA 3OSPA 1H0HB 3RR7A 1Y3KA 3TUZC 1Q8BA 2VZ9A 3W2WB 1QAJA 1WG1A 1KHWA 1QSLA 1T7PA 2OTLS 3MAQA 4BS2A 1AFIA 1NNDA 5GAHU 3HHLA 2LQ9A 2UV8G 2OPPA 1WF1A 3ISZA 3VALA 5EDWA 3D0HE 3GFHA 1RTIA 3OFFA 4I69A 4D3GA 4RNFA 1JLQB 5KFOA 4DR2F 4ZVHA 1T3OA 2IM1A 5CHCB 5I3UB 4UY8T 1WG4A 3NG8A 1X5TA 4X4QA 2IM3A 1KLNA 2W7AA 4DFKA 1LW0A 3D0GE 4C7QA 2KXFA 4NYZA 3DMJB 4JV5F 3T1HF 1LOUA 2IBOA 3MM5B 2J7WA 2K7KA 5IQQA 1D9DA 4OJ1A 2HGMA 4KV8B 3J80Y 2R9LA 1FNMA 3GILA 1VQLS 3U1MA 3K5LA 2K7JA 5EN1A 4NA3A 4MK8A 3R5CA 2E5IA 1Z2ZA 1XC9A 3KG4A 2MKCA 3BB5A 4TY8A 1TQLA 1RT1A 2E9RX 2HHHF 4YY3F 4LFAF 1GNKA 5KFQA 2ZH2A 1DTQB 3L7OA 1YSJA 4QWEA 3VAHA 1WEZA 3DDNA 4F26A 2RQCA 3I87A 2B4OA 3VCDA 4RBVA 1CEZA 4XAKA 4WCEQ 1SI9A 2DB1A 1E6VB 4LT6A 4GO5X 2CJ9A 2GIRA 2XMUA 1X4HA 5E3PA 4AYBD 2DGUA 3QAEA 1RTJB 5KOXA 4DQIA 4FF1A 1VOMA 2LQ5A 3OR1B 5BYRA 1SV5B 4KHMA 3CE8A 4C8MA 1NAQA 2DBBA 5D8HB 4I67A 4JI1F 4ERDA 3BO2A 2HIQA 2FD2A 4HI1A 2LECA 3IC1A 3EXCX 4ZA1A 5E3CA 3GV8B 5KFVA 2F40A 4F3MA 1KQSR 2DO4A 2HS3A 1C1BB 3UR0A 2NSBA 4B02A 2QO3A 5K14A 3CCES 1T05B 3Q23A 2CQ4A 1VS3A 3AJ2A 1A7GE 4B9LA 1U25A 4LF6F 1BY9A 3CC4S 5BR8F 2RF2B 5IT0A 1NZAA 5F8GA 2KJVA 2M7SA 3KYLA 4Y2IA 5LMNF 4ICLA 2ASJA 4B9MA 2NZ4A 2XSFA 4KAIA 5DDOC 2VG6A 1I94F 3ITHB 3SSRA 2UVVA 4QIEA 4Q43A 1JNRB 1FVQA 1HWLA 2BUNA 4NLSA 5F8IA 4D3HA 2BABA 2HNDB 4AXIA 3HVWA 1K9MT 2BJEA 1JLCA 1JLFB 4BBYA 2CPHA 1SUQB 4HH0A 3BR8A 4IQXA 4EUVA 5ADZA 1L3UA 3E8OA 3N9UC 2CJQA 1D3WA 5IZHA 1HBUB 5AJ3F 1SKSA 4KHPF 1HBNA 5M2PA 5LXRA 3M6UA 4KPYA 4HI2A 5DG9A 4N5SA 3MMBA 2V4RA 1SKWA 4M1KA 1Q7LB 1URNA 5DQHA 1AW0A 2DNMA 4Y6IA 4KSEB 2EFPA 4NXNF 3TYTA 3T6JA 2D3ZA 4ZMMA 3DMJA 2R7QA 3F44A 1S76D 2WW8A 4C0HA 1X5OA 2RE1A 3PACA 1FJCA 3PY8A 2RDJA 4EBEA 3IN5A 4Y2KA 5KT5A 2XLIA 4F67A 2QA1A 4JI2F 4RW8A 1T94A 4EZ6A 2PMZD 5A6PA 2M88A 3M8SA 5KFJA 4X66F 4MK9A 2UUBF 4L6V3 2YTCA 3FDSA 3W7BA 3HHLB 1HNXF 1G7CB 3MR2A 2KHCA 4ES1A 3H4DA 1TKXB 3DLJA 5CCLA 2OAUA 2CPIA 4X4OA 3GYNA 2QIFA 5MLCV 5K8PA 5J2PA 2NREA 3HI9A 2FJDB 2MZTA 5AXMA 3PZPA 1C4CA 1NRKA 2LU2A 1TVRB 4RBTA 3MEDB 1NO8A 3GV5B 3L7PA 4I2QA 2A18A 1P8GA 1JXLA 2R8KA 2CG4A 3GIJA 4I0WA 3DOLB 5J2QB 4IYQA 4CTAB 4KKOB 3KLFB 1BWEA 1BC6A 2BANB 4DR5F 1R8AA 4ECWA 3DYAA 2J9CA 5D3GB 5K9FA 3OLBA 1S1UB 3I9ZA 1XNRF 3MR5A 5H9FJ 4LF8F 3KK2A 1S9GB 2KT3A 5I3PA 4F2SA 1V9OA 3CJ4A 3TUJC 3R1LA 4B3OA 2SXLA 4IO1A 3M1VB 2HGNA 2GHVC 3DM2A 1UAWA 4F25A 1YI2S 1S49A 3IS9A 4LIRA 2AP6A 5IXUA 2ZHAA 2ZH7A 1YRTA 4X4PA 1VRTA 3MECB 4DSIA 1HPZB 4KR0B 4C9DA 2HZCA 4OHZA 1UETA 2ZJRQ 3CCTA 2IMOA 4IDKA 2W8LA 2QA4G 1HYSB 2DPIA 3MPYA 2W25A 5KG5A 3KTQA 1CC8A 4QZVB 4OIXA 4OJHA 4B3MF 3H5SA 2YNFA 5DGAA 2UXBF 1RWUA 2B4UA 1SIZA 2XY6A 4ECZA 3FSIA 1FT8A 3I0SA 1K1QA 3O3LA 1FRJA 4C11B 3KK1A 1HL6A 1N6QA 4UW2A 1NHUA 2HFOA 1N56A 2V8VA 4NCGB 3D1OA 4WK3A 2YNGB 3QZ7A 1U26A 5DDRC 2RIJA 1R43A 2B6AA 1S0NA 4CO5A 3HF5A 4Y34A 4NLRA 2J0SD 5IT9Y 3PW4A 1YIJS 4CO3A 3DRRA 1RYSA 1I1GA 3FZBA 3RBDA 4KFBB 1VGYA 2JFKA 4ZK7M 4DDFA 4IRKA 2V8HA 3DRXA 2LDIA 4OHYA 4PPDA 2W9AA 4DR4F 2I2YA 1M5VC 1S6QA 2RVJA 4A48A 3Q8PB 2BVZA 4TNOA 4JV2A 1KQFB 1HNIA 4HEA9 3N28A 4DFJA 3TA0A 4PXBA 3TAMA 2GFFA 2DNPA 2CPJA 4J9LA 4CQ1A 1WEYA 2XI2A 3BS9A 4I64A 2DJWA 4OI3A 3K59A 5DLFA 3M9NB 4UY85 2JH3A 2XSJA 2ZNZA 5CYQA 2JVRA 4OZ0A 3LF0A 1XERA 2I8EA 2FVPA 2CYYA 3KLIA 5KG0A 2W9CA 3BSOA 2FLLA 2DH7A 3DI6A 3FRYA 2DRAA 4RU9A 4WIIA 3LALA 2KH9A 1UEVA 4C8LA 4M8LA 3H25A 1VK8A 1QAYA 3TR5A 3MPWA 2P6TA 3FMBA 1RQ0A 2NPIA 1D8ZA 5A8WB 2B0GA 2E1AA 3LQVA 3GV7B 1WWHA 2B9XA 4PQUB 2F8MA 5KOWA 4XPEA 1REVA 2ALZA 2W9BA 4V19X 3DU5A 3MHYA 2O5DA 2VQFF 3SFGA 3V81A 4R5PB 2VG7A 2IRYA 2Z0GA 3AB4B 4PG8A 1FXDA 2UV8A 3OL6A 3MM7A 2B4VA 5KFKA 2DNZA 3HLUA 4QWBA 1UEUA 4DG1A 4WF9Q 4DV6F 2MQMA 1WNEA 3PX4A 2QA4S 3AQOA 4WFYA 1B0VA 4MTPA 1UWBA 2XG8A 2RKIA 2VG5B 2G1DA 2A10A 2IHR1 1LWFA 3J7Z5 4AE5A 1H6KX 2EK1A 1HW8A 1U7LA 1S1XB 4NRUA 4B9SA 3S8SA 2B9WA 1HMVB 2VBZA 1WEXA 4N47A 2UP1A 2K8GA 6FD1A 1DURA 2JJ4D 2FHJD 1OIAA 3CJ2A 1K73T 2B3TB 1VC0A 4HT7A 4C0OC 4AQYF 4KBIA 1CQMA 1IKVB 2FVRA 3Q2TC 1Q1KA 5EHHA 1T3NA 4QPXA 4OX7A 5DQIA 3WX4A 3JTOA 2CVIA 4LVOP 4J9PA 2CQPA 5M2RA 2EI5A 2VC0A 5F8LA 2XEXA