3JTOA

Crystal structure of the c-terminal domain of ypbh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
b'DESADIIYQFHSFEDIIQLSESLQRIGITGGTVYHYDGQYFLSLEDLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVETIQTHFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adapter protein mecA 2
publication title Crystal Structure of the MecA Degradation Tag
rcsb
source organism Bacillus subtilis
molecule tags Protein binding
total genus 24
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jtoA00
2Y1RI 3JTPA 3JTNA 3PXGa 3JTOA
chains in the Genus database with same CATH superfamily
4NI2B 1GXTA 2DO4A 2Q79A 5I3UA 1BHNA 2RS2A 1UVLA 5IV4A 3GP9A 1GMWA 4ZP6A 4FNIA 3DXBA 2CPEA 2OPPA 5ETQA 4ZS6A 4M5DA 3IRXB 4JI4F 2A6MA 1YZ6A 4WPAA 2FJBB 3SQGB 1EHWA 2HVIA 2XWYA 3MURP 5IT9U 2ZOMA 1FRJA 1NSPA 3WX4A 4QWAA 2MZ1A 2FJWA 4YDDB 5L39A 5AJ3F 1Q16B 5DLFA 5AE2A 4FNHA 1JKHA 2QMUB 1RSCA 4M5KA 1JLQB 3ENQA 1IJFB 3POTA 3R3TA 2AJ0A 1HNXJ 3VR1A 1C0UB 3DLJA 2R9LA 3CUNA 2LXIA 4WFBQ 4TU7A 2BZ2A 5G0RA 1RZMA 3M30B 4LRAA 3MM8A 3KNGA 4RNOA 4F50A 2DR5A 5FDLA 3FSIA 1RWVB 2IVYA 1HWLA 5KG2A 1MN7A 4PG6A 3NCRA 4OX7A 3DLKA 5KOWA 2YX1A 4ICLB 1K0VA 1YX2A 4DOZA 1D9AA 4AQYJ 1OY8A 2DRDA 4DN0A 3MR6A 2XO6A 2HKEA 3OJSA 1S9GA 1FO1A 1J5EF 2CWXA 2J8SA 1XQIA 2EFPA 3P3DA 1OY9A 2DH7A 5E3AA 3L09A 3LOUA 3NP5A 4F0KA 1FKAF 4QIWD 4GO7X 1P6TA 5CD4H 3MUMP 1RWWB 2BQ3A 2XCPA 4J9RA 4RNFA 5DRKA 1EZZB 1FE0A 3ULHA 3PYEA 3NMRA 4Q45A 3CCES 2DPIA 4F0MA 3RB0A 1WEXA 1R8BA 1CC7A 5DS7A 3CD6S 5B0EA 4HTJA 1KVKA 2Y1LB 3Q89A 4F3MA 3BQ2A 4P71A 3TX8A 5KFGA 2IRUA 1A9NB 4YR0A 4FS1A 2KH9A 4A8OA 2RDJA 2FDNA 4N7TA 3AJ2A 4O0IA 1FERA 4K59A 3KG4A 1OYDA 1AFIA 2FJDB 4IFYA 3JSBA 2HRTA 2HFNA 2PIIA 4OYOA 3C14A 4J9VA 2QZ8A 2ALYB 4O3OA 4Z37A 3RBZA 1B0PA 4DXLA 5ETVA 1KQSR 3D28A 3UO0A 3Q0AA 4C0OC 4TLRA 5A8WA 1U1PA 1S1WB 3RW6A 7FDRA 1OYEA 2G0IA 5KFOA 1R6YA 2V6AA 4KGMA 2OMOA 5EGYA 4K4SA 4I6WA 4DR5J 1TKTA 2CZ4A 3PW0A 2HMIA 4LT6A 4F25A 2IAJA 1FDDA 4DV2F 1FJEB 2OPPB 4M5DB 1XBWA 4WZMA 2VFUA 3TVZA 4DV7F 1HNWF 5BYQA 3QRRA 4GVBB 4OI2A 5C2GA 1FRMA 2ZM6F 3TEGA 5F9LA 4KT0C 2XS5A 1NH8A 3W64A 4DHVA 2YKMA 4DU7A 2R2TA 5AE1A 5KG1A 1JKHB 1GAOA 3OTDA 1N32J 4PWUA 1NK0A 3PXGa 4L3NA 5C42B 2C3OA 4MIAA 2AW0A 1OSDA 1FFSB 3MGJA 3POTB 5D77A 4DL3A 4RW9B 4FPRA 2ASDA 4N8OA 3A8JA 2NYHA 4KSEB 2YQ1A 3GWCA 5G0RB 3W3SA 5EN1A 1YJVA 4I67A 3AAWB 3LA0A 2VA2A 5FDLB 2YNGA 4ES3A 3UPFA 2UUTA 4ZITA 4DR6J 2BJ9A 2CUYA 3GJSB 1N54B 3SCIE 2HS0A 2XZWA 1HIYA 3OW2R 4ELVA 3VGTA 4ZCLA 5KT2A 4NCGB 3B8HA 4MKVA 2P2CB 1ZOTA 3GV5B 5ETMA 2GVDA 2VA3A 3AOBA 1S6OA 2FY8A 2LYVA 4LVOP 2J9DA 4DR3F 1VQ4S 2QYCA 1HQ2A 3FRYA 3DLEA 2H54B 2I9SA 2QN6B 4B9UA 1ZPVA 2DR7A 2J6SA 4QYZK 4LBIA 4ZPVR 3N6MA 4ILRA 2AGPA 4H4KC 1FT8A 5KFYA 4QIVA 4UOFA 1EX8A 4USTA 1U6ZA 4ELUA 2DHAA 4G1IA 2Y1IA 4AD6A 3BEGB 1F5AA 2M5YA 1KTVA 3QT7A 4PXCA 1Y5IB 2N4DA 1PC4A 3RRGA 4X64J 3M8ZA 4ED8A 1S5ZA 3K5PA 4WFZA 4UOCA 3BH6B 2F9DA 3CD7A 2XYHB 4IFYB 2Y9HA 2BUNA 4FYYB 3J7ZT 5KFDA 3C14B 4CDIA 3QIDA 3TAQA 1RTJA 2V2ZA 3PYDA 1BQNA 4G3IA 2RILA 2UUBF 1VK3A 4J9PA 4KGXB 1P1TA 1FHTA 1CJTA 1TUWA 2XY7A 2HWTA 1X7VA 3OTCA 4WKRA 4DFKA 1DTQA 5KG3A 4JI4J 1AUDA 1TKTB 3VGVA 2X1BA 4TXSA 4DV4J 4DPYA 3NWGA 4IR1A 3D6HB 1NB7A 4P75A 3J7Z5 3UCUP 1PJ5A 2AJ4A 1NDPA 3ZZYA 4NWBA 1Y5LB 2BJ8A 2E9RX 3I4PA 1AZSA 3MPWA 4QW8A 1L3SA 4JI1J 5B0BA 2IC3A 3GIKA 1Q79A 1VQPS 2I5JB 4FKYA 3NS7B 1N34F 4FF4A 3PY8A 2KDOA 1BXNA 3JSMA 2D41A 2VG6A 1S12A 1SQEA 2DNGA 2R8IA 2YKMB 4TVAB 1GTHA 3LAKA 2NUUG 1RWPB 2VOPA 4KJIA 3ETMA 1KOHA 4QCLA 3FGVA 2KT5A 1D8YA 1U6FA 3C16B 4NPOA 5J2MA 1YJTA 1YRUA 2ZOGA 3IGVA 4LF7J 3DC2A 3CGIA 1OWXA 4D3GA 1RCXB 1HR0F 4EU0A 2OSQA 5KFBA 5DM7Q 1R8HA 3CMAS 4X4OA 3EVMA 1SJFA 1CQNA 1B64A 5A8RA 5D0RA 2VG5A 1FVSA 1ZM4A 2PO4A 1XMQJ 2B43A 3GCWP 1RTZA 1J5EJ 2DK2A 2QX0A 3HMJG 2BOAA 5A0YA 2AX1A 1IQZA 1MROA 4HLBA 1SIWB 2KFZA 3QGIA 2GVDB 1HNZJ 2UXDF 2I2YA 3TA0A 1HHQA 4QR0A 1RTHB 1WTFA 3FEYB 5HQLA 4IYQA 1SJRA 1T7PA 4OL8A 1KWMA 3R2CJ 3RU0A 1HPZA 4DR2F 2M9KA 4Y3CA 5J1NA 4RUBA 3V6KA 1UVJA 4B9SA 3CCZA 3DLEB 5L38A 5E33A 1H0HB 1NDCA 3C66A 2AZ1A 3QO9A 4UQGA 4KBIA 4C8NA 2QLFB 4DV5J 4PWWA 3SSRA 1Z1ZA 2EC2A 2M2BA 3N5BA 2JH3A 5HVFA 4XDCA 2CNLB 1H73A 2VUGA 4YY3F 2W2OP 1VQ8S 3BKTA 4ED0A 1PCAA 3HVWA 5A2QU 4DR7J 2M8DB 4P7TA 4URGA 2UUCF 2C2EA 4J91A 2V8PA 4KV8B 1GMUA 2ZBQA 2OPSA 4QYZJ 4QWDA 2CKWA 1RTJB 1BQNB 2MKJA 2CXEA 4DLGA 3LWMA 4IDKA 4YS2A 3GILA 4WF9Q 4G6VB 1CJTB 3CCJS 1CJUA 2W9AA 2L9NA 2MY7A 4C3KA 1TL5A 2Z2YB 5KFJA 4HDGA 4TYBA 3BREA 3IWLA 1HNWJ 1DTQB 3EPGA 1NZ8A 4KPCA 4OI0A 5DLGA 2KG1A 4A8QA 2E5LJ 2PA3A 3ZTSA 4AXJA 2AU0A 2RU3A 2DNOA 3TR5A 1H2TZ 2IC3B 1S1TA 2BVZA 1FKPB 3ILOA 3CD5A 4K4XA 4A8XA 2JOQA 2DYAA 4UW2A 3L4BC 1RT6A 1YZ7A 2PI4A 3ENWA 2M3DA 4NLSA 1QE1A 1U8SA 5THWA 5J2MB 1IBMJ 2OO4A 2Y1JA 4F3OA 3MEDA 2QV6A 1RTIA 3JQJA 4LF9J 3NGKA 2V2KA 4RU2A 4PQUA 1SC4B 3T5JA 2XLIA 1VRUA 3SSSA 4GKKJ 4X4NA 2R2SA 3CCLS 2QLXA 2IYGA 3J81j 2GMLA 4GVLA 3SI8A 5FIIA 2FHMA 5HMZA 5LL6d 3PFEA 3VAIA 4USJC 1KQFB 3UNGC 1MN9A 1D0EA 4A8KA 4R25A 3H4DA 5A0YB 3IWXA 4DR3J 2QTWA 3SCKE 3TNVA 3E2EA 1EP4A 4QWEA 3Q8PB 3H40A 2VC0A 4K2JA 4CTAA 3CCQS 1Y00A 5AT1B 1HI1A 4TQSA 1HPZB 4PR6A 4RR5A 3UCGA 3M8QB 1RE1B 5GAGI 1JIHA 5KAKA 3UFCX 2AGQA 2HIQA 2AEJA 1UW4A 1K1SA 1SVDA 1VBKA 5KT6A 3PHEA 2CZVC 3P96A 2OEKA 4RNHA 1JLEA 1JJ4A 3MOJB 3R2DJ 2IA6A 3HO1A 1QY7A 3QGHA 3IMQJ 3W65A 2HNZA 3KJNB 2IJNA 4R8UA 2J0WA 2DY1A 4USWA 4TY9A 4JV5J 2H5JB 1N4LA 1NNDA 3VGSA 3CJSA 4NA2A 3QYYA 2FIUA 1SXLA 3V5RA 4ED3A 3MM6A 4FDFA 5CA5A 2DISA 4IRKA 3ZXWA 2MMYA 3W1YC 1I1GA 1GH8A 1AROP 4WTOB 5L1KA 1PAEX 3R8YA 3HZGA 2XLKA 3DRPB 2F5GA 5CCLA 1E6YA 5F3ZA 4HYKA 3PYGA 3NBPA 3D9BA 2ZUAA 3Q24A 3VCDA 2LU2A 4Q5VA 4H4OB 3BS9A 4FYVB 4ZMMA 1YJRA 2G2OA 5T14A 5ETRA 4HEA9 2FD2A 4F4XA 3I55S 4N41A 4G1QB 4IO1A 4N8NA 3D66A 3U1LA 2KVIA 3GCXP 1RTDB 1N33J 4WWSA 3G96A 3QIPA 4DV0J 4J9SA 4CRJA 2V34A 2DGXA 1KTQA 4FYXB 3TUJC 3TUZC 4JYAJ 2BKNA 1HD0A 5K8MA 3L7PA 4NZ6A 2UVWA 3AD8C 4CM0A 2QLJB 2DT9A 1YDLA 3OSNA 1S1TB 1QJHA 3G2XA 3LANA 3M9NB 4F02A 1NBEB 3CDAA 2Z58B 4ZVUB 3MCOA 3BDEA 2XMAA 1U49A 2EPIA 1PILA 4BHQA 4B3MJ 2VBYA 1QE1B 2YKPA 4G1PA 4XTTA 3KUGA 1R0AA 4NYZA 3MEDB 1EQ0A 3CULA 4WFYA 2G0JA 1SUQA 3IBCB 4JI7J 4ED4A 1ZYQA 2B5JA 5A6PA 5H1SV 2HHQA 2PDAA 2QMXA 1VRUB 1QD1A 3MM7B 2BJ3A 4LQ3A 2G1HA 4LVNP 1RLDA 1IKYA 2L9WA 1AFJA 1TMMA 1FDNA 1RWMB 2RDIA 2FVCA 2NZ4A 3BGRA 2YKNA 3HFVA 4EUVA 3QSIA 4PPDA 1FJ7A 2H48B 3CIMA 3KHLA 4E0DA 3C15B 1YG0A 3CJKA 1TKDA 2LCWA 4ZHRA 3OTBA 4Z7CA 4XIUA 2WVCA 1PAUB 3D6TB 4ZP7A 3BYRA 2N82B 2AWZA 4BLGA 2YXLA 1WC4A 3CNQP 1RYSA 5GAHI 3K5OA 1Q8BA 2RE1A 2E1RA 4CO5A 3KK1A 3GB0A 4OZNA 1S1VA 4ENOA 1JLEB 2DGQA 2F7VA 2WW8A 3K5MA 1I6JA 1D9FA 1RAHB 3V6DA 9ATCB 2WSEC 4WE1A 4YY3J 3KLGB 1RU1A 2XTJP 2GX8A 1QTNB 1KLMB 2HNZB 2IBKA 3HHLA 4CQ1A 1ZAWA 1NU4A 1R89A 4KYZA 2RQ4A 5I42A 2A2DA 5EDWA 4KRWA 3MM6B 1JJ2R 2FY1A 1S9EA 3QAUA 5EX3A 1ZBTA 5LOQA 4RL1A 3QBCA 3LUYA 2V8DA 5KG0A 3FK4A 4L76A 1BGXT 4WCEQ 3M7VA 3PJ9A 2CJYB 1RT7B 2MSSA 2Y8YA 2RD5C 4ATNA 1E6YB 4PPZA 3NGUA 2ZH3A 2K06A 3NBPB 3AXKA 3B4DA 2W9CA 1TMJA 4J9OA 4DSKA 3FZ2A 3EM1A 4JV2A 5JUMA 3KLEA 3I82A 5HBMA 1RAJA 1ZPWX 5E3QA 3MCSA 2X3GA 2GIFA 2AJFE 3RR8A 5D15A 3H8YA 3LGMA 3KJQB 3QIPB 1IM4A 1XNRJ 4ECSA 1ZM3A 1YSJA 4DSIA 2IDLA 6AT1B 4QYRA 1XTZA 1JLGA 2BKOA 2R7QA 4DCJB 3PG9A 3IS9B 3HX9A 1B7YB 3CT9A 3Q86A 3P5TL 2W7AA 4RW8B 4XDDA 1CJVA 3TZWA 3MM9A 2CPZA 5C24B 4KHPJ 4ID5B 2D7SA 2RQCA 1RT5A 4LF4F 1UTAA 1Q5YA 3FEXB 4AL5A 4K4WA 1S72S 3NGSA 3R6LB 3ZZTA 3VAFA 4M63A 1HBMA 1R0AB 4M5IA 4LREA 2LECA 3FFIA 1RAGB 4J90A 2BE2A 3OVSA 3OFEA 4DU8A 1SUQB 1NRKA 4X4TA 2W01A 3OTOF 1KQGB 4EYIB 4ZK7M 2EKNA 4IOBA 4RW4B 2QA4S 5D0HA 2B7CB 3GTYX 1IKYB 4IFVA 4LF5F 2DIUA 4MAKA 3IBFB 1F6TA 2W24A 3DYAB 5JXSA 5H9EJ 3DM2B 5LMNF 3VVTA 2MZSA 1GMVA 2E7WA 2CQ4A 2NXUA 3TARA 4B02A 3H42A 4B3SF 4F04B 2K8GA 3QSYB 3CJKB 5DG9A 1FWKA 4K2XA 4C0BA 1PO6A 2CQIA 3UD3P 4H4MB 4ED1A 4ELTA 1DARA 4I2QA 1WC3A 4X66F 3PEJA 1UVKA 3WBZA 3W2VB 3LPYA 3D67A 4QU7A 4MK8A 3IN5A 2PD1A 3N9UC 4WP3A 1T9YA 1HBOA 2HNDA 4EBDA 3H20A 3K8VA 1LFWA 1XC9A 4KTQA 5GVQA 1S1VB 2GNKA 1LXNA 1NJIT 3ISNC 2GV1A 5EWFA 1NZAA 3I0RB 2GGPA 1FJGF 2F63A 3HHLB 3G9CA 4Y0FA 2R8JA 3AFGA 3PRVA 2HHVA 3J7YI 1XMOJ 1FD2A 3MTJA 3H25A 3HSZA 2HVDA 3DNCA 1S9EB 3UDVA 3PVXA 4KHMA 2RQMA 2Z2LA 5IWAF 4GC6A 3EZ5A 4OYAA 1N36F 3MMJA 2KZZA 1C0TB 1WHYA 2ZHBA 3R5DA 3MDFA 2Z4PA 2GMJA 1CULA 5KT7A 4NLGA 1MLAA 4B3RJ 1QSLA 2YKOA 1Y0HA 4ERDA 1GEHA 2MJNA 4XK8C 1YJUA 4JB8B 4UTGA 4MK9A 3KLEB 2XMVA 5HBMB 3BJYA 2DHGA 2MLZA 2ERRA 4NCAA 1LW0A 1U24A 4EEYA 5HI7A 4LRCA 4F4AA 4LFCJ 2R8GA 2AYEA 3Q2TC 3AY0A 1VK8A 5BXIA 1EAYC 3TUPA 3KDNA 3DFEA 4YQWA 4DUTA 1RAIB 2OJ3A 1M90T 3M32A 3L95X 4DUYF 2Q3PA 3K17A 1JLGB 2B9YA 2OMLA 2QYGA 2Z30B 1RJJA 4K8RA 3T6JA 2W4CA 1Q82T 2VV5A 1SH3A 3JYTA 4MTPA 2IIHA 2BANA 3MM9B 4WYLA 1Q53A 4M95A 1RT5B 4PG8A 2KT2A 3H2UB 3D7SB 4N76A 2B6AB 3M6UA 4FF2A 5LMUF 3TQ1A 3TAMB 1HBMB 4ZOSA 2U1AA 3MD3A 2BE2B 3LP0A 4DR4J 4LSZB 2RUSA 4HR2A 3AB2B 4DPXA 2ZBRA 2LQJA 4ZCMA 2DGWA 2MKYA 5BR8F 1A6LA 2RJZA 3C8YA 4OYPA 2P8IA 3ZTQA 4DV1J 1TUVA 1I5OB 2EBEA 3AQOA 3NS5A 5D4LA 1SKSA 4IFVB 3WC0A 4MMOA 3M8PA 3MPYA 2QA1A 2MZQA 1LKZA 2HHXA 2VQFF 5BYSA 1WHWA 2ZHAA 1DQAA 3UR0A 1C1CA 1CEZA 2QL9B 4X65J 3THVA 5F3TA 1X4BA 1FCAA 3G6XA 2IA0A 1IR2A 3QPIA 3SYZA 3I31A 2JEJA 3QQCD 4P2FA 4J9MA 1UFKA 3M8YA 3MTKA 4RBTA 3HHDA 2K1RA 1U48A 3Q8RB 2LA4A 1TL7B 2OKQA 4OX9J 3R5JB 3N28A 4NYOA 4OI1A 2GVZA 3OJUA 3UD4P 2H5IB 4C11A 2VQEJ 3RAMA 2PGCA 2IJFA 3H5XA 1G7CB 2FLOA 5HJXA 1FESA 4R5PA 1HBOB 1B99A 2HNDB 2EW9A 5IT4A 3LP1A 2YPYA 4MT1A 2WAQD 3DRYA 5DZ6A 4H4KA 5JVHQ 3DOLA 2IPOB 2WBMA 3HULA 2OELA 3FKBA 3KLFB 1T9UA 1P9YA 5IM0A 2GGPB 3QRQA 5CQGA 4M8LA 3QT8A 4DQQA 3E51A 3UDCA 2MZTA 4JV1A 4B9TA 1YITS 4QBUA 1NPKA 3RYLA 2N3OA 4C2MA 2NPFA 2DGSA 4RW7A 1RB0A 4PXDA 4FBTA 2UXCF 3C46A 2FJXA 1Q4RA 4DR1J 2OI2A 4L75A 1D3WA 2CRLA 2XLJA 3M2VB 1NK5A 4HHJA 1CULB 1XERA 3SQOP 2V68A 1T95A 5ETLA 1U26A 2HPUA 4ZA1A 1S0VA 2J0XA 2ZNZA 2NREA 1YIJS 2UU9J 2C3PA 4Q44A 1D09B 1IBLJ 1S7IA 3A8KA 2V8VA 2X3DA 1R8CA 3MEEA 4YB5A 2Z8QA 1SJ1A 3MOZA 2E1AA 3MF5A 2QT7A 2HFSA 1H2UX 1U2RA 3BGLA 2ZD1B 4BS2A 5M2PA 3G8SA 3N5FA 3M32B 1UMJA 3PW4A 1N5VA 4LF4J 1WDTA 2VFVA 1CJKA 1H6KX 4L6V3 4ZPAA 3JYTB 4ZVHA 1R3NA 1BY9A 2V67A 1W2IA 2BANB 3A8IA 4UUWA 3ZZOA 5A8KA 2HHWA 2RDDA 2HGMA 1DHMA 4M5HA 3GFXA 4OZJA 4PEOA 2Y8WA 2HAIA 3QAEA 1FJCA 3LP0B 4RU9A 2RF2A 4LF5J 2HVZA 3Q83A 2R7WA 2QE5A 2D9OA 4TNOA 1MW7A 5KT3A 3K57A 2RRAA 1F1BB 3JB9k 5F0WA 5LMNJ 4X4UA 1ICEB 3U1NA 2DNZA 2HQIA 3SMZA 2RU9A 2D3O1 1TR0A 3FQKA 3M8PB 3J81U 3T6BA 2NXCA 4PQAA 5A2QY 2VDHA 2YNIB 2JSXA 2MHEA 4F2RA 3CCTA 1C1CB 3UVJA 2O66A 1J5OA 4EWTA 5I3PA 2YH1A 5JMNA 3DLBA 2DCUB 2WVEA 3FC9A 3UNYA 4NXNF 3PO5A 4JI0J 2GQQA 3M6VA 2VPWB 1VQ5S 4MKBA 2KJVA 4MKAA 2J8AA 1MG7A 1GFWB 4C11B 3DHWC 4GMKA 1FFGB 4OYWA 3X3UA 4OYBA 3TVKA 3MR5A 1NB2A 3AJDA 3D54A 3LP1B 4YHHF 2UXBF 2OH2A 3HT3A 2CQ3A 2GCFA 3M1VA 2AYGA 4WYWA 4IO9Q 1SL2A 1DZ5A 2E5GA 2JLFA 3G6YA 3S01A 5IM0B 2JL9A 4CO1A 5D0EA 3H98A 1SKUB 4EO6A 3IP0A 3OV7A 3CMES 2M8HA 2DGOA 5L1LA 3EX7B 3NS6A 3OUYA 2W1BA 1ZH5A 1BWVA 4CLUA 4NZ7A 3CCUS 1RT2B 4FVCA 4C8YA 3ZZZA 5E41A 4EMDA 2QJ3A 1JWWA 2E5JA 2E5IA 3VTIA 4ZP9A 3H2LA 2GHPA 2CWKA 3T9ZA 1WKJA 2CQGA 3H5YA 1RWNB 1FRHA 2SXLA 5LSOA 2K3IA 1VLOA 3MD1A 4EBEA 4B3TF 1KVJA 1Q5VA 1SKRA 5KFEA 3IG1A 1WG5A 2PMHA 2CQPA 4LIWA 3Q8UA 4OI4A 1S9FA 2BJ1A 3MHYA 2ALZA 4LF8F 1IBKF 3W63A 1RHRB 1JXLA 4WK3A 1KDNA 4USKA 3VAMA 3PX6A 3DCAA 3GONA 4USMA 1NK7A 2DNLA 1RAOA 4QPXA 5D0GA 1U6BA 1BLUA 1NJYA 4TU9A 3U1MA 2FHJA 2GZOA 4ZDNA 4X4PA 2FZGB 4NLUA 2MZJA 5J2PA 3A13A 1MSWD 4TQRA 2BJEA 3BQ0A 3E01A 1M5SA 1S0OA 4PABA 1CJKB 3N01A 4ECTA 3EXYA 3R97A 5LMUJ 3DLGA 3JTPA 2AV5A 2QFIA 2XHWA 3QGGA 3AJ1A 5A8KB 2GA7A 3DOKA 1H98A 1FX4A 4V19X 1JLFB 2VBWA 2ZE2B 2X1FA 1GXUA 3NEKA 4KGKA 4TU8A 4FYDA 2RF2B 4K4ZA 4ALZA 1MWYA 5CHCB 2HBRB 3RB3A 4OX8A 1LV5A 1YJ9S 4MK7A 1SH0A 3QJLA 3NOCA 3W61A 5D3GA 2EFGA 2VHGA 2LMIA 5HO4A 1SJ3P 4DL4A 1VQSA 3KOAA 3BSAA 4W4MA 2ZFHA 2NSBA 3SXLA 3UVJB 1J5OB 1GXLA 3AH6A 3ITHA 1TZ0A 1RXOB 2WSFC 3B6BA 4YOEA 5CZXA 2ZJPQ 3LF0A 3ZZRA 3A1YG 3VALA 1HNIA 4QWCA 3G82A 3T1YF 5KFVA 1UA0A 2XI2A 3RRHA 2HVEA 2HVHA 1B0VA 2V94A 1NM2A 5FLXU 4JI2F 2CJBA 3GYGA 2FB0A 1VOMA 5IQ6A 4DF4A 4OHXA 4LUBA 3I0SA 1BD6A 3M1VB 1YGYA 1WSRA 2W25A 1B4SA 2CA9A 1TKZA 3LH2S 5HAOA 2XZDB 1YJWS 2ZUGA 1C2PA 3NY0A 1NDKA 3MM5A 3V4IA 4CP5A 2UXCJ 2L9DA 1R6VA 3OUYB 3NGTA 6FD1A 1V6HA 2VPYB 4DSJA 3CPWR 4P2MA 3JXOA 2GHWA 3DDNA 4GKJF 2JC1A 4KB7A 2PN6A 3M8RA 2PE8A 4O23A 3M8WA 3TW0A 1S6QB 1V3ZA 3DHXA 1DQ8A 3BPSP 1VCTA 3NOGA 4I1TA 4IRCA 3NLCA 4AUKA 1X8DA 4GRSA 3QATA 2IHR1 1GX6A 2GS8A 3EE3A 4HACB 2KXFA 2HK2A 1F60B 4B3OA 4DG1B 4ZVRB 1EJ7L 2QL7B 2KU7A 1I94J 2QC3A 1WD6A 4BCAA 1FWLA 2GJ2A 1L3TA 2NZCA 5DJBA 1VFJA 5KFZA 1HWIA 1KLNA 3BF4A 3ELHA 3VZHA 4EZ9A 5L9NA 3O6QA 5F8HA 3FCHA 4CCHA 1FWPA 3KK3A 3MUTP 1C0UA 3GU0A 4NLQA 2RSQA 1AT1B 2O01C 3GQCA 2DR6A 1WF2A 2AZ3A 1LK7A 3E01B 3M6WA 1K73T 3M30A 2KG0A 3ZFVA 3ONQA 5F9NA 1S6UA 1V3RA 2MQQA 4V19J 2L41A 2XSFA 1T9XA 1WOPA 3TX0A 3DLGB 1S99A 3TQEA 2B4OA 4DQRA 3DOKB 1N56A 2J7KA 4I6AA 4U8YA 1NSAA 2J7UA 1SC3B 2PC6A 1S0MA 4DPUA 1QAJA 3RBDA 2LA6A 3FNNA 4WZQA 3H0PA 3OXFA 2APOA 1KD1T 2VASA 1B3TA 2P9CA 4OHYA 4HDHA 4O4RA 2F8HA 3D2WA 4O44B 4C0HA 1YWXA 2RAQA 5F41A 4DUZJ 2B56A 2H4YB 5KFRA 1K0TA 2KO1A 2G1DA 4DV3J 5HMWA 3OLBA 4NZ0A 2M88A 1KHWA 1GQEA 1X4CA 4F26A 3CO9A 1HNIB 4EK2A 3TJAA 2ZVSA 4PUOA 1QSSA 1YTYA 1WKLA 1X0FA 1RBLA 5KFQA 8RUCA 2WW4A 3R5GA 4NLYA 3WX8A 2KTQA 2F4VF 3CVKA 4X4SA 2C42A 3I0SB 1TU0B 4HI2A 7FD1A 3I6PA 3KHRA 2HHHF 3RB6A 2AQ4A 3L7OA 2IM3A 1TKZB 2BXJA 4N5SA 1RYRA 1TFWA 3KFWX 2Q1LA 2LXFA 3V4IB 1RLCL 3T5KA 4B9MA 5K8OA 3KTQA 4RWWA 4IQMA 2UUAF 1FRIA 1S1WA 2EFNA 4K0KF 2E5HA 1UVIA 1HNVB 1MNEA 1OQ6A 4DL7A 3L3CA 4K4YA 4DV6J 4A8FA 3JQMA 1LWFA 1T3OA 4N77A 3MZIA 1NHKL 2Q66A 4X62F 4TY8B 4JI6F 2E66A 4LF6F 4WIIA 5F8LA 5HP1A 1OO0B 1IJEB 2ILZA 5ADZA 4GVBA 3Q8QB 1E6VA 2HFOA 1X31C 2IJRA 1NKCA 5HL7Q 4B3OB 1SC1B 3TZXA 1RHMB 3MAQA 3ENAA 4KC5A 1NPPA 2JC0A 4NXMJ 3HD2A 2D74B 2F9JA 5C42A 3NGRA 3IC1A 4Y34A 3MAAA 1X5PA 1H74A 1Y3KA 2VFSA 4RW9A 5E3RA 3KK3B 2XI3A 3BN7A 3BH7B 1DY3A 3CMQA 1X4HA 2VBXA 3JSRA 2KRBA 1PJ7A 4DL0C 1V5IB 2PT0A 5B0DA 2J6TA 3F41A 1RAEB 2E7VA 3J7AN 1X0PA 1WWHA 2L48A 2MQMA 3Q8YA 1HQEA 2VICA 3EXCX 3EGVA 1HMVA 1PC5A 2C22A 2QGFB 1JB0C 4NCGA 2YX7A 4ILLA 4JI8J 4I4BA 2HHPA 4MYUA 1REVA 4JI3J 2VFRA 1WF0A 2OHDA 1NAQA 2O5DA 4V1Ak 3BSOA 2OP5A 1IXKA 3QRPA 2CQ0A 4DFPA 1UL3A 4ZCKA 2IMOA 2ZKTA 2GMHA 4UY8T 3K58A 2UVVA 5L46A 2H5EA 4K5RA 4NYPA 2X7IA 5HROA 2DBBA 5KFAA 5B7WA 2HK3A 5DG7A 3FSXA 3MPVA 3K2YA 4FN5A 4CO4A 5ETOA 5G4DA 1XMBA 2DHXA 3BN4A 3PZPA 1QTMA 3DI6B 1FI4A 1WF1A 3WQPA 1VBYA 2IY5B 2IVFB 1B7FA 1WACA 3HFKA 2W2QP 4U7CA 3MECA 1H72C 4I6YA 2VJUA 2YKAA 1CC8A 4PUOB 4EFAC 3FRZA 5U47A 3DRRB 4WJBA 1HW8A 3WIVA 3K0JA 5KT5A 5CYQA 2YWHA 3NGDA 1MMNA 3ILLA 3H2VE 2C3UA 1R31A 2XBPA 4NLVA 4ED2A 3D3CJ 4NA3A 3BSCA 3P5BP 1UA1A 5L1IA 4GKJJ 3W8PA 1PIEA 4X4VA 3B78A 4KPYA 2RHSB 2FVPA 3LGHA 2V8GA 1X9SA 3LP2B 3W5XA 3S1TA 2BRKA 2GC8A 3E3XA 3MUVP 1HBUA 4GC7A 1UWBA 2K7JA 2W2PP 1LWFB 1Q0NA 2AYMA 2A0FB 2DNKA 3ICLA 4OHZA 2MXYA 5EHHA 3PFOA 3MMAA 2Y3YA 3BZQA 4BDPA 4I64A 3QFHA 4NLXA 4C6AA 2K2PA 2CFXA 2KJWA 5HP1B 3OR1B 2VH7A 3HHKA 5KFUA 3BO3A 2HEKA 4B17A 3CJ4A 3JTNA 3UQSA 1KFSA 1E6VB 1QAIA 3AD9C 1X5OA 2I5JA 2KKHA 3W5ZA 3LO3A 1QSYA 1EETA 4RNNA 4CI0B 3LTOA 3F44A 3LALA 5KFXA 1VIXA 3C6TA 3HHNB 2PFFB 3C16A 4OZ2A 3MAAB 3FJ2A 1M1KT 1BE4A 1G4CA 1UWAA 3CJRA 1HBNB 4OZ3A 1KR4A 2KB2A 2C28A 4YR2A 1BMQB 2H51B 1QAYA 5HQ8A 3OL8A 1S4EA 4M5MA 4X4RA 3T1HF 1NK6A 3H59A 1HQEB 1N52B 1X4GA 1S49A 1YHQS 5DDQC 3C19A 4OI3A 5K8PA 4MH8A 1HMVB 1HL6A 1VHFA 5ETSA 5KFHA 4C4WA 2I6WA 2VOOA 2ASLA 5HN0A 5DGAA 1KS2A 3VF0B 1RHUB 1BC6A 4FXDA 2AJ1A 3OL6A 4ZLPA 1REVB 3CJ3A 4LF1A 4A8SA 2CNNB 4JI5F 1RABB 3QMQA 1KQKA 5F8MA 1RTHA 1CSJA 5KFSA 4ER8A 2RHQB 1FKOB 5C5JA 4DS4A 4HH0A 3C3LA 1KP6A 1SL0A 4ZVSB 5KFTA 3H5UA 3KUHA 1S7HA 1U1NA 3GIJA 5HROB 1UCNA 3R5AA 4C8KA 1AUSL 1UVNA 2YWGA 4FKXA 3N4WA 1Q8LA 2WRMA 2PMZD 3EICA 4OMFG 4ANDA 3DOMA 4ECYA 3EGZA 5K14A 1F9HA 1FRLA 3CCMS 3L7UA 4LR8A 1C4AA 3MECB 5DQIA 4CO3A 4TLQA 9RUBA 2EG1A 4KGZB 5FJ4A 3FBEA 1JLAB 3G86A 2IM0A 4DQIA 2A6OA 2XB2D 4U67Q 3ZNJ1 3HHEA 2ADBA 5CYQB 4I0WA 3PM9A 2EWHA 2PMWA 4NL5A 4KV8A 2CPFA 3BDPA 2MQOA 3UN3A 2ZDPA 4KH0B 2EBGA 3JTOA 1TAUA 2RT3A 3GV7B 1K1QA 1TP7A 3MMCA 1MU2A 2LEPA 2HRUA 1QVFR 2OAUA 2EXUA 3CC2S 4HI1A 8AT1B 4K7QA 3K7RA 4HT7A 4DX7A 1M5PC 2F4FA 6FDRA 1HBUB 1UWBB 2D9PA 1JK9B 4LR7A 2MYFA 3FMBA 2JEGA 3MMAB 2BM0A 1GMWD 3SCLE 5CCMA 2X1GA 4USVA 4B08A 1U2FA 2RH3A 5AJ3J 2MTLA 3DDIA 1FXLA 4CLZA 4Y6IA 5IC6B 5ETNA 2LQ9A 2OTJS 3HKZD 2WCXA 2DH9A 4DSLA 3QGPA 2NLWA 1S1XA 1UJ5A 3TJ9A 5B0CA 2E9TA 2I8EA 1HYSB 1FKPA 4Y28C 1U1LA 5HLFA 1EETB 3SBMA 3J7YU 3DGPA 4U9RA 3BBFA 1IVZA 4U6PA 2OEMA 2C2NA 2JJ4D 2HQ3A 2BYCA 5K8NA 2J76E 3C6TB 2HG4A 1HNXF 3THTA 4BBYA 2VKZG 4YEAA 2VFTA 1VBXA 2ZJRQ 4MFBA 3JSYA 5IXUA 3AD7C 3BYPA 4S0MA 3I5AA 3CJTA 2XYPB 4P10A 3RZAA 4NLWA 4ITSA 3VHQA 2E1PA 3O5TB 3EVWA 3TI0A 3HK2A 1G2EA 2VG7A 4NOHA 1SV5A 4DX8H 1U2CA 2FGOA 5ETTA 4AQYF 1RWUA 3R9LA 3TEHB 3DKDA 1U47A 5M2UA 4NEZA 2DNHA 2NXJA 4IRDA 2OPRA 4PG7A 3K8WA 2ZC3A 4ID8A 1N48A 3CJQA 2BW7A 2GFFA 3TJ8A 2I0XA 3AOCA 2KXHA 2MQLA 2EI5A 3C2PA 2KT3A 4NLPA 2A18A 4ZVPB 1RHQB 3M8QA 3MEGA 2GHVC 3HT0A 1PGZA 3DLLQ 3VQSA 1UFLA 4DL6A 4OIXA 5HANA 3OHAA 1DBDA 2FJAB 2BJ7A 1LK5A 4P74A 1ZZFA 3DOMB 5K14B 3T41A 1HI0P 1F5CA 2YWFA 4QIFA 1WHVA 5DDOC 3M2RA 2QA2A 1URNA 2JVRA 1FTCA 3GJRB 1YKWA 2R7OA 4OZ5A 4EGLA 4J9KA 4DF8A 1S10A 2WHOA 1JLBA 4ZN1A 5CD4A 4RNMA 1WUUA 2YPZA 4O3NA 4UF4A 5T7LA 3GFZA 3NAIA 1LWCA 1SL1A 3DRPA 3NNAA 2AP6A 5HQMA 4NRTA 3ZZPA 3BGOP 3MMCB 1MU2B 4X2BA 2DD8S 1AXQA 1Z2ZA 4H4OA 2ROPA 1SB6A 2C2MB 3R7BB 2YQ3A 4DR5F 4DV2J 4U95A 2IVMA 3DRXA 2HHUA 2N3LA 3CB4A 5DGBA 4G1QA 4Q2LA 3HP6A 4DV7J 3MI7X 1FA0A 2DNNA 4CLFA 2J7WA 3D1OA 2ZM6J 3D6FB 3T19A 2X1AA 1RTDA 3B54A 2W2MP 3CDBA 3PW2A 1HA1A 2HNYA 3GR0A 2H65B 3FDSA 1SQGA 1S1XB 4C9DA 4DDFA 2EFOA 3ISZA 1UZHA 2R7TA 2QL5B 1WOOA 2UVRA 1N32F 2JEIA 5HLFB 1VQ6S 1WG4A 1EB0A 3DGPB 2O3DA 4WFNQ 4DPWA 4CH7A 2YBVA 3KLIA 1T05A 4I69A 3LGNA 4ZLNA 1XWLA 3VQTA 5T41A 3H4BA 1SJ4P 4QIGA 4MFBB 3KLHA 2W7PA 4DCPB 1M5HA 2HHSA 2YH0A 1QLNA 1TUGB 2C3MA 3MM7A 1EARA 4DR6F 3QNWB 2OTLS 4PAAA 3N6LA 3V81A 3D0GE 1P1LA 1W25A 2VG7B 1SV5B 4MJKA 3K59A 2DY9A 4O0NA 2BM1A 3MAHA 2BACA 4JI5J 3EDQB 2FVRA 1TK5A 3FCWA 2OPRB 3T9NA 4Q0BA 1KOOA 3W2WA 3G87A 2QFJA 3C15A 5HJYA 3BSNA 5AE3A 2LQ8A 1VBZA 3BGFA 2WONA 4ZVEA 2DH8A 2ZBCA 4F4ZA 1ZTTA 3MEGB 4NASA 2ZEJA 4CM2A 4RUAA 1Y4ZB 3MR2A 5B09A 1K8AT 1WC5A 3EYZA 3R7NB 2VODA 2AJQA 3PJXA 1ULRA 3VAGA 1PYTA 4Q43A 2EKYA 3CTRA 1C1BA 4U7UK 2V5HG 3R5CA 2LFVA 3KLGA 1TFYA 1WC1A 1VQ9S 1KLMA 2HZVA 2ZOFA 2KHDA 3CCVS 4X64F 3M2RB 2M52A 1TQLA 3KHHA 2KFYA 1Q1KA 1TTHB 1HQUA 4QR1A 1N0VC 2XYGB 2B4PA 2EFQA 1JLBB 1URRA 2ZWPA 2F40A 2UUBJ 1CBKA 1JX4A 3OLAA 5T7LB 1H38A 1RT7A 2DGTA 2XS2A 4K4UA 1LWCB 2D3ZA 2XZTB 4J9LA 3BBBA 1WI8A 4ZPDA 1NHVA 2CJQA 4Z2XA 2ZHOA 2LEBA 3CO0P 4DN9A 2CQDA 2JHEA 1VQYA 1R8PA 3I96A 2YWEA 4CO0A 4AL6A 2ZH1A 5E0OA 3MCMA 4ZJOA 4DX5A 3UWTA 4DV4F 4YB1P 1DTTA 4CYUA 2VKRA 1YQHA 1NKBA 5AXLA 1N34J 4JI1F 2HNYB 2ZC4A 3RG6A 2V8HA 1JLCB 2XC9A 4USUA 1UPPA 3QLHB 3O2IA 3CF5Q 2XO7A 4Q8FA 1L3KA 1NH7A 2OSRA 3IS9A 5DG8A 1FF2A 1RWKB 3LWLA 4ZLLA 2OPQA 2AX0A 3GMGA 1DLOA 4EO8A 1NK9A 4PZVA 2MQ8A 3WZ0A 4RW8A 5C24A 2YQ0A 4ID5A 3RAQA 4NX9A 3KLIB 1HR0J 2P5VA 4LF7F 1T05B 4M5LA 3I32A 2G4BA 2RKIA 5GADU 2GAGC 2Y1RI 4M5JA 1CS4A 1I3OB 2DXFA 4C8MA 4CLPA 3KLHB 1ZS6A 3WIUA 4CO2A 4QWBA 2O1PA 4NRUA 4M1KA 5D6GA 4I7FB 1JNZB 4OJHA 1S1UA 2KN4A 3TWZA 1XNQF 4RW4A 3V81B 5GMDA 1XMQF 4FF1A 4USHA 4QPTA 3DYAA 3TANA 2UXDJ 3DM2A 2HGLA 4R0JA 2G13A 1Q86T 2PI5A 2ZDOA 2KZMA 1HNZF 1PSDA 3W62A 2BKPA 5GMKa 1RI7A 3PNIA 2HFVA 4Q0BB 2QLBB 4DR2J 3W2WB 2X51A 2OUGA 1VYAA 4ZJQA 4LF2A 3PKMA 1IR1A 3SDEB 3ZTPA 3IAM9 2WONB 2B3TB 4H4MA 3BO2A 4F8RA 4ES1A 3W2VA 1WEZA 3QFWA 3OR2A 1XJWB 4GO5X 3EDRB 1NLKL 4Y65A 1UPMB 4DV5F 1U45A 5CAAA 3JQKA 1W2BR 4O3RA 4C3MA 1RT1B 1RK8A 2HZAA 1C1BB 1T9WA 1MMDA 3FUYA 2CPDA 5MLCV 2KI2A 2MKIA 3OBIA 1F3VA 3I0RA 5A6WA 1TK8A 5E7OB 1TL4A 3DRSB 2RRNA 5IT9Y 2UUCJ 2LEAA 1KKHA 2P6SA 4DR7F 4O4GB 3TYTA 1HQUB 2BQUA 1BUXA 2WB4A 1UJ4A 2IRXA 1N0UA 2NYIA 3NCQA 3CEDA 4DFJA 4WKYA 5JJBA 2JFKA 2CPXA 1S6PA 1BQMA 3CJ0A 1C0TA 2FQQB 5I3UB 3TAPA 3GV8B 4WU3A 1KNZA 4A4JA 1O8BA 3AA9A 1DFDA 4NMLA 5C25A 1LEOA 2DITA 2CQHA 2W4DA 1RCOB 3V4MA 3C6UA 3I4HX 2B7BB 1RP5A 4UZBA 1JXEA 3R1HA 5GMEA 5LSRA 3EGNA 5KG7A 4YUDA 1HLWA 4OV6A 3BV8A 2HBQB 2RMLA 1DTTB 2E5LF 4CYUB 1M5KC 1R27B 3BR9A 2AYBA 1VQKS 1RACB 3CCRS 4KE5A 5LJ3Y 2A3JA 4RZRA 4BWMA 1VQMS 2AJ2A 3RW7A 3W60A 1K47A 3ETOA 4BC9A 5ETKA 2OPQB 3BKFA 1VLYA 1WC6A 1DLOB 3GIRA 1WJ9A 2RRBA 4ED7A 1IBMF 2XGPA 2DO0A 3MM8B 1HW9A 1W7WA 2DEIA 3RBXA 1VGYA 2B6AA 4LF9F 1ZAXA 2RKIB 3TAMA 2MKKA 5MAOA 3DLKB 1CS4B 4GKKF 3PR5B 2ASJA 3MPDA 1V5VA 5D4NA 1WI6A 4ETZA 4ANCA 1DURA 3HXMA 1G3OA 4EYHB 1FDBA 2QIFA 4Y2AA 1S1UB 3FZBA 4HVZA 1S9GB 2JDJA 3CJ2A 3NNCA 2XULA 4B9LA 5IV3A 2V2QA 4J37A 4X4QA 4WTYA 1AYEA 3Q23A 1Y10A 2KYXA 3KG0A 3Q8VA 1S59A 3KDOA 2GQ2A 5CZVA 2DPJA 4ZCIA 3ZZ0A 3TO8A 1TL7A 2ABYA 2XMKA 2DJWA 3T5HA 1EIYB 1T8EA 4HHUA 2VF3A 2AT1B 1GNKA 4M5NA 1U0HA 2QA4G 3OR2B 4OHVA 2DNQA 2FLPA 2MKHA 2Z56B 2HQCA 1RHJB 1A7GE 4AE5A 1KBRA 4KHRA 2LU1A 1UZDA 2NXEA 4A48A 4JV5F 5F8IA 1KC8T 1WG1A 1APSA 4ZPBA 3KLFA 1KHVA 1SJQA 4OJGA 5KG5A 3IR5B 4FYWB 1S4FA 4Q2MA 1HWUA 2W9BA 3HKWA 1RU2A 1UEUA 2LQ5A 2RUGA 2WTFA 2CADA 1NJZA 1AW0A 5A8WB 3IAS9 2CNOB 3N0VA 4Q7AA 2DRAA 4U7UD 3G6ES 2A1BA 1NO8A 1S6PB 3M2VA 1BQMB 2PEHA 1N6QA 4CWBA 1WKKA 4UZCA 2ASYA 2COLA 3HFZB 2ZH4A 4R0EA 4EZ6A 2W8KA 3HVAA 2N7YA 2HMIB 3QJJA 5C25B 5CYJA 2IAJB 3DMJA 1YBUA 3IR7B 4LQ9A 4ECWA 3C6UB 1EQMA 2YWKA 4O3QA 1UETA 2ZBIA 2CVIA 1AB8A 3VAJA 4C98A 2R2UA 1FE4A 2MSTA 2HS3A 1ZA1B 1N33F 3BM7A 4DV0F 1EKRA 1IWAA 4JYAF 4ES2A 2ZNYA 2KM8C 2M70A 5EUHA 2R8KA 2ZD1A 5DZ7A 1XR5A 2BV3A 2KL8A 1P9QC 3KJFB 1XR6A 4DSFA 4OYMA 3P8BB 2HLUA 4B3MF 3IRWP 1KONA 4U96A 4OYIA 3IFEA 3EVOA 2KRRA 1IM6A 2R7RA 1O51A 4NCBA 1IKXA 2YNGB 2F65A 4JI7F 5ITHA 3MWBA 3UDEA 1XNQJ 2E9ZA 3N79A 3UW1A 1JJHA 2XQCA 1OPZA 2VC1A 1WORA 4DJBA 2R2RA 2LXUA 2WVFA 2BDPA 3CJ5A 2R7XA 4KY3A 1ACMB 4C7QA 2AGOA 1NKEA 3KMSA 3CJ8A 1U0SA 3D1HA 1FNOA 4F36A 5H9FK 4FVMA 2RVJA 2H4WB 3HF5A 1YBTA 2YNIA 2J5AA 3KG1A 3A3NB 3GSIA 2WOMA 5GAEI 3GFHA 3R5BA 3PYFA 3EUNA 1VHIA 1X4AA 1MWZA 1LW2A 1UAWA 2CYYA 5K9FA 1IBCB 1NHUA 4FXVA 1CQMA 2DRBA 2CQ1A 4MYTA 2MPUA 3V6HA 5KFFA 3CCSS 5DO2A 2PA8D 5HATA 2XMUA 3IO1A 1U0HB 3EWGA 3SFGA 5HVHA 1R0CB 2CQCA 2C2KB 4WP9A 3RR7A 1G6BA 4DQPA 2BJDA 1TV6A 4NLOA 1MMLA 1FXDA 2C1EB 2U2FA 1TAQA 3O1LA 5LXYA 5CABA 2GQCA 3JAMU 4KH1B 2IMWP 1AA1B 2CQBA 2CG4A 1QUVA 4UT4A 3D68A 2W9BB 3TZZA 1X5SA 1ITPA 1X60A 2CJ9A 3HHLD 1RT2A 4C8ZA 1YJNS 3D4JA 2V0NA 2Q6BA 2NR0A 2WVBA 1IKVA 2IBOA 5CXTA 1NUEA 3IM9A 4RLEA 4ECVA 2GW8A 2HBZB 1N6QB 1CPZA 1U09A 3EJMA 3NWRA 2RS8A 3DMJB 2W8LA 4LMZA 2M7SA 2V4RA 2LDIA 3MR3A 4IH7A 1AZSB 2D3UA 1XK8A 4IKAA 2WB1D 2E44A 1FEHA 1XNRF 2P9GA 2OD4A 3JSMB 2VG6B 1YRTA 2FVSA 4BWJA 2DKOB 1IUJA 1ROFA 5D78A 3QWUA 3K5NA 2ADCA 1N88A 1VQ7S 1SI9A 2AD9A 5KFNA 1FNMA 4PCQA 4KHPF 1S77D 2NS1B 3L9ZA 3CE8A 3F56A 4TYAA 2OIHA 3P45B 1T94A 2Z2MA 1IKXB 2FC9A 2WVDA 4XO0A 4USIA 3OTOJ 4IOAQ 1JLFA 1VI7A 5A8RB 2IFXA 2ZE2A 3NAHA 2VG5B 1BQXA 5HSPA 4OFZA 3M9MB 4KIAA 5ETPA 3DN9A 3PCOB 4CLWA 3S8SA 4RBUA 4CT9A 2KFNA 1V3SA 1MROB 2VB6A 4F4YA 3FEZA 4IH6A 4P72A 4ZN3A 2ZKUA 1S0NA 4LBHA 1O0PA 4RWXA 4B3SJ 1Y11A 2WOMB 2GJIA 3PV8A 2UVUA 3M05A 2V2VA 3MMBA 2ZZNA 3B82A 3KWMA 4C3LA 4F3QA 5KFCA 2LLZA 1LW2B 2QMWA 2XSJA 4U8VA 2AKWB 1YRXA 4X66J 3DU6A 3QO9B 2JVOA 1RT3A 2CAJA 3I5CA 5DQGA 5EWGA 2EC0A 4ZPCA 1NSKL 3W9IA 3HVTA 2CPYA 3RJMB 2JWNA 2QO3A 2ZZMA 4KFBA 3KKFA 2CPIA 3SV4A 3PX4A 3NL0A 4YFUA 3DU5A 3W8GA 3AODA 1FJGJ 5H9FJ 1T9VA 8ATCB 3R27A 2MHNA 1TV6B 2FPHX 2FTRA 2R8HA 3DDKA 4YB6A 2XY5A 5K5MA 2C2DA 1Q7YT 3TVYA 1ZM9A 4QJVA 1XMOF 2H1YA 2J9CA 3PRDA 4LFBF 3ET6A 5KG6A 1JXVA 4JP8A 3MR7A 4ZPTR 5IT0A 2OPSB 5IWAJ 3JS9A 3D6MB 1VC0A 1N36J 4A47A 3HLUA 3TOQA 4WFXA 1QUPA 3U27A 3BPDA 4ECXA 1JQGA 1RWOB 4IDKB 2N7CA 5IOLA 3BR8A 1IKVB 1VQNS 1S6QA 3TP2A 1CJUB 2R3VA 3HJFA 1ZAVA 1ELOA 2VIHA 3AQPA 4B3RF 3UN2A 2AHOB 3MEKA 1TVRA 3PHTA 2E29A 3MCNA 2OD6A 3GFYA 3V6JA 1RISA 1OIAA 1PKUA 4HACA 4URQU 2ZH9A 5LSLA 4DG1A 3OFFA 4LFCF 1L3VA 5KG4A 5IZHA 2JZ5A 3PO4A 4C48A 1FFWB 4OZ0A 3OL7A 5H9EK 2C2ZB 4DUYJ 4YDXA 4M94A 3MFHA 3RTVA 2C2OB 3KJVA 1RT6B 4PG4A 1CVJA 1F3FA 1WOSA 2J9DE 4W90B 2CVEA 2BE9B 1UVMA 1Y5NB 1S76D 3OSPA 3V2UC 1RTIB 2HWIA 2OFHX 4IUFA 3HSGA 2EVZA 4PQUB 1YI2S 4OQJA 3HD1A 2NSCA 3RUBL 2H9ZA 2Y0BB 3U02A 1ZA2B 4OJ1A 3NRBA 3U7JA 4DR4F 3AB4B 5BR8J 1Q95G 2YNHA 1MWQA 2QSFA 3NKYA 2P9EA 4FS2A 5L8RC 1WHXA 5CYMA 4Y2IA 1F9FA 4DV1F 5M2RA 4DL5A 3IA0A 4RO0A 5IC4B 2K3KA 3M9OB 2VQFJ 2DNMA 2VJVA 2XG8A 4O44A 3GYXB 3OXLA 1EP4B 2R4FA 4X65F 5J2NA 4K50A 2CNKB 4CTAB 1WELA 2OFGX 3FBFA 4P6QA 3LQVA 2VONA 3FMWA 3MMBB 2FUG9 1HKAA 1NDLA 4KAIA 4ZJLA 4WU2A 2XSJB 2JLEA 2VDIA 2ROGA 3ZTOA 4IQXA 5AXKA 5B0GA 2XNQA 4OX9F 2LP4A 1VDHA 1RT3B 2FJEB 2VQEF 5B08A 2A2CA 1FEEA 1T0TV 3HVTB 2IM1A 4B9VA 2XHCA 3GE9A 4KFBB 1LQ9A 2B8PA 3ZC4A 1N8RT 3PDNA 2DCLA 4R8UB 2XEXA 4Q8EA 2BE7D 1M1GA 2NPIA 2V50A 2HS4A 1U1MA 4EI2A 4DSEA 1NMEB 1T02A 1OSCA 2G2YA 1T9TA 2BEFA 3J80U 3Q2SC 3O44A 5SZTA 1EKSA 4P73A 3KXDA 3CDEA 3H5SA 4CLSA 1LNQA 4DQSA 5BYRA 1R8AA 1JMTA 2RQKA 3ET6B 4K4VA 3FCVA 1OMSA 2ZITA 2ZH2A 1VC6A 1HNVA 4DR1F 2XGQA 1CLFA 5EWEA 1Z4UA 5BJRA 3PW7A 1WEYA 1UFWA 1TK0A 1FDAA 3B4MA 1RBAA 5C2CA 3BB5A 1TVRB 3T3FA 3I87A 2GIQA 4P2XA 4F4KA 3N6NA 4TY8A 1Q8IA 2HAFA 2OEJA 5HMYA 1PBUA 1LOUA 4YMEA 1I51B 1M1HA 3UD5A 2UU9F 3CDWA 4A8WA 1IBLF 2FZCB 5F8JA 1R7IA 3OTEA 2YVSA 2J0SD 5C7PA 3UR3C 2GO8A 3PRBA 1Y3JA 1N5TA 4Y2CA 1HWJA 2HQDA 5KFKA 2B9XA 3KJVB 1FXRA 2DVIA 3M6XA 2H3EB 1RAFB 2JLGA 3K5LA 5KOXA 4PWDA 4JOUA 1HHTP 2JX2A 3ILJA 3GIIA 2IRYA 4I2PA 3W66A 3NXZA 2E1CA 3SCJE 2IDEA 4RUHA 3IR6B 5KFIA 3ZTRA 4ECQA 2HFUA 2A10A 2JFDA 1LWXA 2B5JB 3FBCA 2P6TA 4WXOA 2V9KA 1N5QA 2RIJA 2L3MA 1RA6A 3VZIA 2CZ9A 2BW2A 2YNHB 2FYXA 1RBOB 2GO9A 2WSCC 1SBRA 4FXWA 5CYMB 4J7CA 4DWIA 1VJWA 2XMJA 2R7UA 1UEVA 3BGRB 1RKJA 2YKNB 3GPAA 1OQ3A 4ZVGA 3US5A 3I56S 4FPIA 1X4EA 3TA1A 4PKDB 4I56A 1T11A 1SPBP 1HWKA 3LAMA 4IH5A 5EX0A 4QZVB 5J2NB 4ZPWR 3R1LA 4NXNJ 4ZHRB 4DL2A 1TL1A 3DLHA 2FHKA 1M0SA 2YKQA 4L74A 2FGCA 1HHSA 4DCOB 2R7SA 4JI0F 3CXCR 1FK9A 4YB7A 4HL9A 4M5GA 4TN2A 3DGVA 3K89A 2ZBPA 3DI6A 3E8OA 3KK1B 2ATLA 2CPJA 4YHHJ 3V6DB 2UXBJ 4WE1B 1VR6A 3GZ7A 1HFEL 5E3PA 1RA7A 4LIRA 4Y2MA 1OJ4A 4DZDA 1QAXA 3PIPQ 1T03A 2LDYA 3DRRA 3T5LA 3HSDA 2VBZA 2MQPA 1HI8A 5I42B 1IWGA 2L08A 2AMCB 1T3NA 4WIQA 5CH7B 4CNZA 4LFBJ 4YR3A 3TZYA 2EEYA 4LFAF 1LXJA 1XIQA 4OHWA 3M2UA 3OT9A 1CG2A 4OX6A 5E2QA 4LRDA 3P4UB 3W9HA 4UOGA 2ZH7A 1SCJB 4E8UA 2MJUA 3SSQA 3GLJA 3O3LA 4LRBA 3KYLA 4HH1A 3GJQB 5SUHA 3LP2A 2W9CB 2GJFA 2RNEA 3ZZUA 4B3TJ 1IR0A 5GAGU 1X4DA 4H54A 1B70B 2BABA 4X84A 1F2GA 3EGWB 4MIWA 3IBWA 4B9NA 2XMWA 1U25A 1PBAA 4LF8J 1IBKJ 2CJAA 5JVGQ 5FD1A 5KT4A 1IQTA 2HRYA 5DETA 1M5VC 3ZO7A 3OR1A 4W92B 1U02A 2LKZA 2N4CA 1KEKA 3CCWA 3QZ7A 1X4FA 4O3PA 4RW6A 1RKIA 4CLYA 1RT4A 3AT1B 2FHOB 2HW3A 2M4MA 1NK4A 2YX4A 4JUZA 1S48A 4CH1A 1RADB 4AYBD 2M0GB 1PJ6A 2FC8A 4QU6A 2FJVA 2UV8A 1RGVA 2OLWA 2ZJQQ 1HD1A 3VWSA 1CJVB 3MFIA 4OI6A 1N5YA 1HBNA 4O3SA 4PWDB 2B8QA 2FHJD 3R7SB 3SIPB 4DI6A 4I2PB 1F2HA 2ILYA 2Z0GA 2CJKA 2QRRA 3FFIB 1FD8A 1KN6A 1F9EB 3RRKA 2XMTA 3RAXA 3KK2A 3Q8SB 4J9QA 1OY6A 2KVQE 3H7HB 3IXQA 1SC6A 2WBRA 2PSZA 2IM2A 1KRPA 3PX0A 2DGUA 3OXGA 2V69A 1W26A 4J9NA 4J5OA 4C8LA 1GTEA 4RKUC 3FQLA 2QSWA 3GR1A 3RB4A 2XNRA 3UDLA 3S7RA 4ZLJA 4OYXA 1FKOA 2VD3A 2DNYA 1S97A 4DPTA 2UV8G 4IG0A 2ZVIA 2GIRA 4F2SA 3SZ2A 1TL1B 2J9EA 2W7OA 5I3QA 4KKOA 3I5BA 4I2QB 2HZCA 3RBEA 2ATCB 1FK9B 2ZWOA 2R42A 4L72B 4MIBA 2YNFA 1FVQA 3ILIA 3T1YJ 4CNYA 1ZM2A 2DNRA 1SQFA 2D69A 3KNAA 2ACMA 1L3UA 4OJ3A 3D0HE 2VPZB 1S79A 3FVYA 1RAAB 4JI2J 3TUIC 2AEFA 1K9MT 2DXDA 1KFDA 5F0UA 4ECZA 3WDOA 2Q43A 3KUEA 4KR0B 2R7VA 1VS3A 1JLAA 4FZVA 1T03B 4P7VA 1R43A 1WDDA 3VVUA 1UW9A 3LPEA 4KGVB 2FVQA 3VGUA 5L9XA 1U1RA 4UY85 3BBCA 3EPIA 3ADAC 1TKXA 3FBBA 3M2UB 1Q78A 4LJMA 1VIOA 1TELA 3A4TA 4N56A 3OQ2A 4ZIWA 1R0BG 2I38A 5I4MA 1J2VA 4QIEA 2AF6A 4NMXA 4PXEA 1U8WA 1UP1A 1U1QA 3AOAA 1RHKB 2WZ1A 1FTRA 5KFLA 4WP8A 3EMTA 1U7LA 2CQ2A 2HSEB 2DR9A 2O67A 2PEBA 4NEYA 1Q8KA 1VJQA 5GAHU 3OFGA 1S57A 2BMBA 2E7XA 3GYNA 2MGZA 4PG5A 3UCZP 4DZ6A 1LW0B 4LSLA 5A76A 2V4JA 3HM9A 2ROEA 3OVAA 4OZ1A 4NA1A 2EG2A 4PYAA 4C8OA 4RW6B 1I94F 5DM6Q 1HYSA 1RT4B 3G8TA 4W98A 4RX6A 3UE2A 2YY3A 1IKWA 3BGUA 5L1JA 3QT6A 2XWXA 3HPOA 1XR7A 4CT8A 2LQBA 1REGX 3GIMA 1D9DA 3HVRA 2DEJA 2G2ZA 4JV0A 3X1LB 1N5YB 3GSDA 2ZZTA 1ZETA 4ETXA 3HDSA 4RUCA 4A8MP 4F67A 4ECUA 4QW9A 1DQ9A 3CIZA 4DLEA 1Y7PA 1VRQC 1NPRA 4L73A 1SIZA 1D8ZA 2QG9B 3G6VA 3KK2B 1BWEA 3PR4A 5F8NA 4CZCA 1ZZNA 2MB0B 2DHHA 3AHPA 3A8EA 4F0HA 3CD0A 3G4SS 4D3HA 4I68A 4K4TA 3W5YA 3VV2B 4OV1A 4QOTA 1FNXH 3VAHA 2GAHC 3A12A 3JAMY 4URSA 2MKSA 1G1XA 2HWHA 3NNHA 3RGIA 1PG5B 4NLRA 4ILMA 4CH0S 4NLTA 1NEEA 4ZKAA 2B4VA 3W9JA 4OZLA 3LW5C 1RWXB 1JNRB 4RPFA 2K1RB 4DUZF 4IG0B 2HBYB 3SV3A 4LRFA 2WK4A 4KKOB 1UKUA 2QLWA 1FX2A 3PW5A 2GVZB 3OFHA 4DV3F 3IWNC 2VU5A 2HURA 3EZUA 2YNFB 4DX6A 4OYZA 4R5PB 4F7VA 3MPUB 2BBEA 1DAXA 5J1EA 4FF3A 2Y0SD 3DOLB 3BKUA 4CLKA 3WHIA 2DB1A 3QT5A 2F4VJ 4AFFA 4LFAJ 3SEOA 3IGNA 3BQ1A 1UJ6A 2HHHJ 2Z2ZA 3CDUA 5KTQA 2ACYA 5IS2A 4DFMA 2FLNA 1TKXB 4RW7B 1F5BA 2UUAJ 3OVBA 1LFPA 4K0KJ 4AXIA 1U1OA 1O6XA 5GADI 3PJWA 4TKTA 2D1CA 3OL9A 3IM8A 4DV6F 2I1RA 2VL1A 4IOCQ 2DNPA 3R6GB 4UOHA 4K5SA 5LM7E 4HTIA 4X62J 1Z2LA 2V63A 3HSJA 4JI6J 4LF6J 1PYOB 5D8HB 2CIMA 3NG8A 4AL7A 5E3CA 2MGZB 4ANEA 2KYZA 4ED5A 2HIYA 3VAKA 4KQZA 1QDUB 4IG3A 4LSLB 1GT8A 4WBFA 2V4JB 3G8QA 5B0FA 4AT1B 3MEEB 2OGUA 3PACA 3OHBA 5DDPC 1VRTA 3NCPA 2DXEA 1Y9OA 4NXMF 2F8EX 2KHCA 2ZH8A 2BA9A 4F4WA 4CLTA 2DGVA 3J81Y 1N5SA 4YN3B 4DS5A 3CC4S 1IKWB 2B9EA 2C2RA 4PYDA 1L5UA 2W2NP 4ZVTB 5IQQA 2BOPA 3DXSX 4C97A 4CLLA 3PKYA 1H2VZ 2CJXB 2KM8B 3NMAA 3P6YC 2UP1A 2MLXA 4XPCA 1QVGR 3THPA 2Q6CA 4WK1A 1SH2A 1H3DA 2IYIA 2KXNB 4DPOA 3AXMA 1KVIA 2UZAA 2BQRA 1J27A 2DIVA 4HT5A 1YK9A 3PEHA 2JRSA 3W7BA 1UEKA 1QM9A 4PXBA 3UI3A 4JI8F 1WTBA 4E98A 1NXIA 3PTWA 5IFMA 3M8SA 4JI3F 5LT5A 1RDRA 4FP9A 4KO0A 1F0XA 1Q7LB 2NCKL 3QZ8A 3HZEA 2VZ9A 3OD2A 2W4PA 2DR8A 3BO4A 3QWPA 3AA8A 5LXRA 5D4OA 3WC2A 4Y00A 2CDQA 2J0QD 1U1KA 3KMQA 5DQHA 5J2QA 4CIOA 3GG1A 2MEWA 5K20B 1WSVA 3HCXA 4LR9A 2J6UA 3CWJA 4RJVA 1RUSA 1X5TA 2MDAA 5J1EB 1PYSB 2G0CA 4E2FB 1YVFA 2CPHA 4HKQA 5HVGA 3TA2A 1TL3A 5HMXA 2DHSA 4OLPA 2CDRB 1D1UA 2XCAA 3KLVA 1U4BA 1H7XA 4ZVQB 3ZNUA 2C3YA 1Q81T 3TRGA 1LWEA 1P8GA 4JBCA 4BC7A 3GJTB 5KFWA 4LSNA 4L3KA 1NJXA 1A0OB 1FRXA 5GAEU 3M4XA 4WXWA 4NI2A 4ED6A 3D5MA 3J7A1 4ZVFA 3SFUA 2F1FA 3CSKA 3ISND 2QEXS 2YWWA 2ZH5A 1V9OA 3CW2C 3G71S 1DJ0A 1X9WA 2YTCA 4ZVOB 3D3BJ 3CC7S 4P52A 2F3JA 4G65A 3FSYA 3UN5A 3D1QA 3IG1B 3IRXA 3OPKA 2DTJA 4ZIVA 1YJ7A 3SQGA 1XN9A 2HGNA 3F73A 5J1PA 1NSQA 3S6EA 3KHGA 3PIOQ 3A3PB 3MXHP 1VISA 2EK1A 1H7WA 2PFDA 4FBUA 5LJ5Y 1JJCB 5RUBA 2E1MC 4UUXA 2HYIB 1YBAA 4YP3A 4A46A 1KSPA 2EK6A 3F0NA 1VC5A 1B0TA 4IG3B 2XY6A 2ZH6A 2B9WA 2BX6A 1HARA 3ENVA 1JLCA 2MLYA 4UQTA 1JLQA 1VQLS 3QLHA 4IR9A 5D4PA 1VRTB 1OS5A 2K7KA 4P9SA 5J2PB 2AEMA 2VPXB 4HHHA 5F8GA 1SKWA 3H90A 3EZOA 4RBVA 1C4CA 2BR0A 4J9UE 4QQBA 4ECRA 1ZTWA 1K44A 2XM3A 2LVWA 3D0IE 2FLLA 5DDRC 3P49B 5AXMA 4DEZA 2BRLA 4MKYA 1YLXA 1GK8A 1VQOS 2XS7A 1NK8A 3Q22A 2B0GA 2NQPA 5B0AA 4DMZA 4ICLA 1X9MA 4LBPA 2XMMA 3T1HJ 2UUWA 1WNEA 4I7FA 3O8WA 5AXNA 2F8MA 2HHTA 2Z57B 5E5NA 4P2SA 2HFZA 7AT1B 1GX5A 4Z7YA 1RQ0A 5KFMA 5FLXY 5D3GB 1OPIA 4WFAQ 4NE9C 1VMBA 2B51A 3I9ZA 2NXNA 3J80Y 2HQGA 2MKCA 1DRZA 3T1AA 4OLOA 1NCLA 4KO0B 2RB7A 2HQFA 1O5JA 5HK4A 3ITHB 3SDEA 2MY8A 4N47A 1FRKA 2MQNA 2FZKB 2AIRB 2EFVA 2NUHA 4DBQA 4Y2KA 4XPEA 2JEFA 3HHLC 3G82B 4XAKA 5J2QB 3QJPA 2HLTA 2POKA 3GG0A 1RT1A 4NLDA 3A3OB 2V9WA 3HI9A 1NJWA 4PRFA 3HJVA 1M5OC 2CG8A 3DRSA 5KFPA 4QR2A 1IN0A 1TL3B 1WC0A 4EBCA 2B4UA 4O4GA 3I9V9 2MZRA 1XEZA 1P27B 2D3OR 2V4QA 3MM5B 2G9OA 2JNJA 1LWEB 4ZP8A 4LSNB 4A8YA
chains in the Genus database with same CATH topology
1K1QA 1TP7A 1C0TB 3MMCA 1WHYA 1MU2A 1GXTA 2LEPA 2DO4A 2HRUA 2Q79A 4IDKB 3R5DA 2N7CA 2ZHBA 5I3UA 1QVFR 2OAUA 3MDFA 2RS2A 2Z4PA 3BR8A 1UVLA 3CC2S 2GMJA 5KT7A 4NLGA 1IKVB 4HI1A 1VQNS 4ZP6A 1S6QA 4FNIA 3TP2A 3HJFA 3DXBA 1ZAVA 1ELOA 2CPEA 3K7RA 3AQPA 4HT7A 1QSLA 2YKOA 1Y0HA 1M5PC 4B3RF 6FDRA 1HBUB 3MEKA 1TVRA 1UWBB 4ERDA 2OPPA 2D9PA 2E29A 4ZS6A 2MJNA 4M5DA 1JK9B 4XK8C 2OD6A 2MYFA 1YJUA 3KLEB 4MK9A 3GFYA 2XMVA 3FMBA 3V6JA 3IRXB 5HBMB 2JEGA 4JI4F 3MMAB 2BM0A 2FJBB 1RISA 3SQGB 3BJYA 1OIAA 2DHGA 2HVIA 2XWYA 3SCLE 3MURP 5CCMA 2X1GA 2ERRA 4B08A 4NCAA 1U2FA 1LW0A 2ZOMA 4URQU 1FRJA 2RH3A 2ZH9A 1U24A 4EEYA 3WX4A 5HI7A 4QWAA 1FXLA 4Y6IA 2MZ1A 5LSLA 2FJWA 4YDDB 4DG1A 2AYEA 5L39A 2R8GA 5AJ3F 1Q16B 3Q2TC 3AY0A 2LQ9A 2OTJS 3HKZD 1VK8A 3OFFA 4LFCF 5DLFA 1L3VA 5KG4A 5IZHA 2JZ5A 3PO4A 2WCXA 5AE2A 2DH9A 4FNHA 4DSLA 3QGPA 2NLWA 1S1XA 1UJ5A 5B0CA 2E9TA 3DFEA 1JKHA 2I8EA 4OZ0A 4YQWA 3OL7A 1HYSB 1FKPA 2OJ3A 1M90T 4YDXA 4Y28C 1U1LA 3M32A 5HLFA 3L95X 4M94A 4DUYF 1EETB 1JLQB 2Q3PA 3ENQA 1IJFB 1JLGB 3POTA 3DGPA 4U9RA 3J7YU 3R3TA 3MFHA 3RTVA 3KJVA 1RT6B 2B9YA 4U6PA 4PG4A 1CVJA 2OMLA 2AJ0A 2J9DE 1RJJA 3VR1A 4W90B 2JJ4D 1C0UB 2HQ3A 2BYCA 5K8NA 3DLJA 3T6JA 2J76E 2W4CA 2HG4A 3C6TB 2R9LA 3CUNA 1Q82T 1HNXF 2VV5A 3THTA 2LXIA 1SH3A 4WFBQ 4TU7A 3JYTA 2BZ2A 4MTPA 2CVEA 4BBYA 2VKZG 4YEAA 1UVMA 2VFTA 5G0RA 1Y5NB 1VBXA 2BANA 2ZJRQ 3M30B 3MM9B 4MFBA 4WYLA 1S76D 3OSPA 3V2UC 1RTIB 2HWIA 1Q53A 2OFHX 3JSYA 5IXUA 4IUFA 4M95A 1RT5B 3MM8A 3KNGA 4PG8A 2KT2A 4RNOA 4F50A 2DR5A 3H2UB 5FDLA 4N76A 3FSIA 2EVZA 4PQUB 2B6AB 1YI2S 4OQJA 2IVYA 2NSCA 3I5AA 3M6UA 1HWLA 5KG2A 4FF2A 5LMUF 3TQ1A 2H9ZA 4PG6A 3NCRA 3U02A 3TAMB 4OJ1A 1HBMB 4ZOSA 4OX7A 3DLKA 3RZAA 2U1AA 3NRBA 4NLWA 3MD3A 4ITSA 2BE2B 3LP0A 5KOWA 3U7JA 2YX1A 3AB2B 2HYIB 3O5TB 4ICLB 4DR4F 3AB4B 1K0VA 3TI0A 3HK2A 2LQJA 1G2EA 4ZCMA 2YNHA 2DGWA 2QSFA 2VG7A 4DOZA 3NKYA 2P9EA 1A6LA 4NOHA 1SV5A 2RJZA 1D9AA 5BR8F 3C8YA 4DX8H 4FS2A 5L8RC 1WHXA 2FGOA 5CYMA 4DN0A 1TUVA 4AQYF 1RWUA 4Y2IA 3MR6A 2EBEA 1F9FA 3AQOA 4DV1F 5M2RA 3NS5A 4DL5A 5D4LA 3IA0A 1SKSA 1U47A 3OJSA 1S9GA 5M2UA 4IFVB 3WC0A 4MMOA 3M8PA 2K3KA 3MPYA 2QA1A 3M9OB 2MZQA 2DNHA 1FO1A 4IRDA 1LKZA 1J5EF 2HHXA 2EFPA 2DNMA 2VQFF 5BYSA 2OPRA 4PG7A 1WHWA 3P3DA 2ZHAA 1DQAA 3K8WA 2XG8A 2DH7A 3UR0A 5E3AA 2ZC3A 4O44A 1C1CA 4ID8A 1N48A 1CEZA 3L09A 3GYXB 3THVA 2GFFA 3OXLA 1EP4B 5F3TA 3LOUA 2R4FA 1X4BA 2I0XA 1FCAA 4X65F 3NP5A 5J2NA 3G6XA 4K50A 2IA0A 1FKAF 4QIWD 4GO7X 3QPIA 4CTAB 1P6TA 2KXHA 2MQLA 3SYZA 1WELA 2OFGX 2EI5A 3I31A 4P6QA 3C2PA 2KT3A 3LQVA 5CD4H 2JEJA 3FMWA 2VONA 4NLPA 4J9MA 2A18A 3MMBB 3MTKA 3MUMP 2FUG9 4RBTA 2BQ3A 3HHDA 2K1RA 3M8QA 3MEGA 2XCPA 4KAIA 1U48A 4J9RA 3Q8RB 2GHVC 4RNFA 1PGZA 5DRKA 2LA4A 1FE0A 4WU2A 3ULHA 2XSJB 3DLLQ 2JLEA 2ROGA 3VQSA 2OKQA 4IQXA 3NMRA 5AXKA 4Q45A 3CCES 5B0GA 1UFLA 2XNQA 4DL6A 3N28A 4NYOA 2DPIA 3RB0A 4OI1A 3UD4P 3OJUA 4OX9F 1WEXA 4C11A 4OIXA 3RAMA 2PGCA 1RT3B 3OHAA 1DBDA 2IJFA 2FJAB 1R8BA 2FJEB 2VQEF 3H5XA 1G7CB 2FLOA 1CC7A 5B08A 5DS7A 1LK5A 3CD6S 1FESA 5B0EA 2A2CA 4HTJA 1FEEA 4R5PA 1HBOB 2HNDB 2EW9A 3HVTB 4F3MA 5IT4A 2IM1A 3LP1A 1ZZFA 3BQ2A 4B9VA 3GE9A 5K14B 2WAQD 3DRYA 5KFGA 3TX8A 4H4KA 4KFBB 2IRUA 5JVHQ 1A9NB 1LQ9A 1HI0P 3ZC4A 1F5CA 1N8RT 2YWFA 3PDNA 2DCLA 4R8UB 4QIFA 2XEXA 3DOLA 1WHVA 4YR0A 4Q8EA 2NPIA 5DDOC 4FS1A 2KH9A 3M2RA 4A8OA 2RDJA 2HS4A 1U1MA 2WBMA 2FDNA 2QA2A 1URNA 3KLFB 2JVRA 4DSEA 5IM0A 3AJ2A 1T02A 1FTCA 4O0IA 1OSCA 2GGPB 1FERA 4K59A 3KG4A 5CQGA 1AFIA 2FJDB 4IFYA 4M8LA 3JSBA 2R7OA 4OZ5A 2HFNA 2PIIA 4EGLA 4DQQA 4J9KA 3E51A 4DF8A 1S10A 3UDCA 2WHOA 2QZ8A 2MZTA 1JLBA 3Q2SC 3O44A 4JV1A 4B9TA 4O3OA 4RNMA 1YITS 5SZTA 4QBUA 4Z37A 1B0PA 3RYLA 4O3NA 2N3OA 4C2MA 3CDEA 3H5SA 2NPFA 4DQSA 2DGSA 5BYRA 5T7LA 1R8AA 1KQSR 4RW7A 3D28A 1JMTA 2RQKA 3GFZA 3Q0AA 4K4VA 3NAIA 1LWCA 4PXDA 4FBTA 4C0OC 2ZITA 4TLRA 5A8WA 1U1PA 2ZH2A 1SL1A 2UXCF 3DRPA 1S1WB 3C46A 3RW6A 2FJXA 1Q4RA 7FDRA 3NNAA 2AP6A 1VC6A 4NRTA 1D3WA 2CRLA 1HNVA 4DR1F 2XGQA 2XLJA 3ZZPA 3M2VB 5KFOA 1R6YA 1NK5A 4HHJA 1CLFA 3MMCB 1MU2B 4KGMA 2OMOA 5EWEA 4X2BA 2DD8S 5EGYA 4K4SA 1Z4UA 5BJRA 1AXQA 4I6WA 1Z2ZA 4H4OA 3PW7A 1WEYA 1UFWA 1XERA 2ROPA 1TK0A 1TKTA 1SB6A 2CZ4A 1FDAA 3PW0A 2HMIA 4LT6A 1T95A 2YQ3A 4DR5F 4F25A 3B4MA 2IVMA 3DRXA 3BB5A 1TVRB 2IAJA 2HHUA 1FDDA 2N3LA 3CB4A 1U26A 2HPUA 2OPPB 4DV2F 3T3FA 5DGBA 3I87A 2GIQA 1FJEB 4F4KA 3N6NA 4G1QA 4TY8A 1Q8IA 4M5DB 4Q2LA 4ZA1A 3HP6A 3MI7X 1FA0A 1S0VA 2DNNA 5HMYA 1XBWA 4WZMA 2VFUA 2J0XA 3TVZA 4DV7F 2J7WA 1HNWF 5BYQA 2ZNZA 3D1OA 4OI2A 1FRMA 1LOUA 3T19A 4YMEA 2X1AA 2NREA 1YIJS 1RTDA 2ZM6F 2C3PA 4Q44A 5F9LA 4KT0C 3CDBA 3PW2A 2UU9F 1HA1A 3CDWA 4A8WA 2HNYA 3GR0A 2XS5A 2V8VA 1IBLF 3FDSA 1NH8A 4DHVA 5F8JA 1R8CA 3MEEA 1R7IA 2YKMA 3OTEA 4YB5A 2Z8QA 2YVSA 1SJ1A 2J0SD 3MOZA 2E1AA 2R2TA 3UR3C 3MF5A 2GO8A 2QT7A 1S1XB 4C9DA 5AE1A 5KG1A 1JKHB 1GAOA 1H2UX 1U2RA 2EFOA 3OTDA 3PRBA 4PWUA 4DDFA 3BGLA 1Y3JA 2ZD1B 1N5TA 3ISZA 1NK0A 2R7TA 3PXGa 4L3NA 5C42B 2C3OA 2UVRA 5M2PA 4BS2A 1N32F 3G8SA 4Y2CA 2JEIA 3N5FA 1HWJA 4MIAA 3M32B 2AW0A 5HLFB 1VQ6S 1WG4A 1UMJA 1OSDA 3MGJA 3PW4A 5KFKA 3POTB 1N5VA 2B9XA 5D77A 3KJVB 1FXRA 2O3DA 2DVIA 4WFNQ 4DL3A 2VFVA 3M6XA 4RW9B 4CH7A 4FPRA 2ASDA 4N8OA 1H6KX 4L6V3 2JLGA 3K5LA 5KOXA 4ZPAA 4PWDA 3KLIA 4JOUA 3JYTB 1T05A 1HHTP 4ZVHA 2JX2A 4KSEB 3GIIA 1R3NA 2IRYA 4I2PA 1BY9A 3GWCA 4I69A 5G0RB 3LGNA 1XWLA 3VQTA 5T41A 2E1CA 3W3SA 1W2IA 1YJVA 2BANB 4UUWA 3H4BA 4I67A 5EN1A 1SJ4P 4QIGA 4MFBB 3SCJE 3KLHA 2W7PA 3ZZOA 3AAWB 5A8KA 4RUHA 2HHWA 2VA2A 3IR6B 5KFIA 1M5HA 2HHSA 2HGMA 1DHMA 4ECQA 5FDLB 2A10A 2JFDA 2YNGA 3GFXA 2B5JB 4OZJA 2P6TA 4WXOA 2YH0A 4ES3A 1QLNA 3UPFA 2V9KA 2UUTA 2HAIA 2C3MA 3QAEA 3MM7A 1N5QA 1FJCA 2RIJA 3LP0B 4RU9A 2RF2A 2L3MA 1RA6A 2HVZA 4DR6F 3VZIA 2OTLS 2R7WA 2QE5A 1N54B 3D0GE 3N6LA 1P1LA 1W25A 3V81A 3SCIE 2BW2A 2HS0A 2XZWA 2YNHB 2D9OA 4TNOA 1MW7A 2VG7B 5KT3A 3K57A 3OW2R 2RRAA 2GO9A 1SV5B 4ELVA 2WSCC 5KT2A 4MJKA 1SBRA 4ZCLA 4NCGB 4FXWA 3K59A 5F0WA 3JB9k 5CYMB 3B8HA 2BM1A 1ZOTA 3GV5B 4X4UA 4DWIA 1VJWA 2XMJA 3U1NA 2R7UA 1UEVA 2DNZA 3BGRB 1RKJA 3MAHA 2HQIA 3SMZA 2VA3A 2BACA 2YKNB 2RU9A 1OQ3A 1TR0A 3FQKA 4ZVGA 3M8PB 3US5A 3T6BA 3I56S 2FVRA 4PQAA 1S6OA 5A2QY 2YNIB 1X4EA 3TA1A 1TK5A 2LYVA 4PKDB 2OPRB 2JSXA 3T9NA 2MHEA 4I56A 4F2RA 4Q0BA 4LVOP 1KOOA 2J9DA 3CCTA 4DR3F 1C1CB 1HWKA 3W2WA 3LAMA 2QFJA 2O66A 4IH5A 1VQ4S 3BSNA 2QYCA 1J5OA 5EX0A 4EWTA 5I3PA 5AE3A 4KJIA 4QZVB 5J2NB 2YH1A 4ZPWR 3FRYA 3R1LA 3DLEA 1VBZA 4ZHRB 3DLBA 2DCUB 2I9SA 4DL2A 1TL1A 2WONA 2FHKA 3BGFA 3DLHA 4B9UA 1M0SA 1ZPVA 2DR7A 4NXNF 2YKQA 3PO5A 4ZVEA 2FGCA 2DH8A 2J6SA 2ZBCA 4F4ZA 1ZTTA 1HHSA 2GQQA 2R7SA 3M6VA 4JI0F 3CXCR 1FK9A 2VPWB 3MEGB 4YB7A 4ZPVR 4HL9A 4MKBA 1VQ5S 2KJVA 4MKAA 3N6MA 4RUAA 4ILRA 2AGPA 1Y4ZB 4H4KC 1FT8A 2J8AA 4TN2A 3MR2A 5KFYA 5B09A 4QIVA 1K8AT 3EYZA 2VODA 2AJQA 3PJXA 1U6ZA 4ELUA 3DI6A 1ULRA 3VAGA 4C11B 2DHAA 3DHWC 3E8OA 4Q43A 2EKYA 4G1IA 4GMKA 3KK1B 2Y1IA 2ATLA 3CTRA 1C1BA 3BEGB 1F5AA 4U7UK 3X3UA 2CPJA 2V5HG 3TVKA 3MR5A 3V6DB 3D54A 4WE1B 3R5CA 2M5YA 3LP1B 1KTVA 4YHHF 3GZ7A 1HFEL 4PXCA 3KLGA 1TFYA 2OH2A 2UXBF 5E3PA 1Y5IB 1RA7A 2N4DA 4LIRA 3HT3A 4Y2MA 2CQ3A 1PC4A 1QAXA 1VQ9S 1KLMA 2GCFA 3RRGA 3M1VA 2AYGA 3PIPQ 4WYWA 4IO9Q 1T03A 2LDYA 3DRRA 2ZOFA 3T5LA 1SL2A 1DZ5A 4ED8A 2KHDA 2VBZA 3CCVS 2MQPA 2E5GA 4X64F 1HI8A 3M2RB 2M52A 1TQLA 3K5PA 5I42B 2JLFA 3G6YA 2L08A 3KHHA 1T3NA 4WFZA 2KFYA 4UOCA 3S01A 5IM0B 2JL9A 1Q1KA 4CNZA 5CH7B 4CO1A 2F9DA 3CD7A 3H98A 4YR3A 4EO6A 3OV7A 4IFYB 3CMES 2M8HA 1HQUA 2BUNA 2DGOA 4LFAF 1LXJA 4QR1A 1N0VC 5L1LA 3J7ZT 5KFDA 4OHWA 3M2UA 3EX7B 3NS6A 3OUYA 2B4PA 1ZH5A 3QIDA 2EFQA 1CG2A 4OX6A 1JLBB 1URRA 5E2QA 2F40A 3TAQA 4NZ7A 1RTJA 1BQNA 3CCUS 1JX4A 1RT2B 4FVCA 3OLAA 2ZH7A 4C8YA 5T7LB 4E8UA 4G3IA 1H38A 2RILA 3ZZZA 2UUBF 1RT7A 2MJUA 5E41A 1JWWA 2DGTA 1VK3A 4J9PA 3SSQA 2XS2A 2E5JA 4K4UA 2E5IA 3VTIA 1LWCB 1P1TA 4ZP9A 3H2LA 2D3ZA 1FHTA 2GHPA 3O3LA 4J9LA 1WI8A 4ZPDA 3KYLA 3T9ZA 2XY7A 2CQGA 1NHVA 4HH1A 2CJQA 3H5YA 2HWTA 5SUHA 1X7VA 3LP2A 4Z2XA 1FRHA 2ZHOA 2SXLA 2W9CB 2LEBA 5LSOA 3OTCA 4WKRA 4DN9A 2RNEA 2CQDA 3ZZUA 2K3IA 2JHEA 3MD1A 1IR0A 5GAGU 1X4DA 4H54A 4DFKA 2BABA 4X84A 1VQYA 1R8PA 1F2GA 1DTQA 5KG3A 4EBEA 4B3TF 1KVJA 3EGWB 1AUDA 4MIWA 1SKRA 5KFEA 3IBWA 4B9NA 1TKTB 3I96A 3IG1A 1WG5A 2XMWA 1U25A 2PMHA 2YWEA 4CO0A 2CQPA 2X1BA 4LIWA 4TXSA 4OI4A 1S9FA 4AL6A 3MHYA 2ZH1A 2CJAA 5JVGQ 5E0OA 2ALZA 5FD1A 3NWGA 3UWTA 5KT4A 4IR1A 4LF8F 1NB7A 1IBKF 4DV4F 1IQTA 2HRYA 5DETA 3J7Z5 4YB1P 1M5VC 3UCUP 1JXLA 2AJ4A 3OR1A 1DTTA 4W92B 4WK3A 3ZZYA 4NWBA 1Y5LB 2LKZA 2N4CA 2VKRA 1KEKA 3VAMA 1YQHA 2E9RX 3CCWA 3QZ7A 3I4PA 1NKBA 3MPWA 4QW8A 3PX6A 1L3SA 1X4FA 3DCAA 5B0BA 2IC3A 3GIKA 5AXLA 4O3PA 1Q79A 1VQPS 4RW6A 4JI1F 2I5JB 1RKIA 2FY1A 1N34F 4FF4A 2HNYB 2ZC4A 1RT4A 3PY8A 2KDOA 1NK7A 2