3JTOA

Crystal structure of the c-terminal domain of ypbh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
DESADIIYQFHSFEDIIQLSESLQRIGITGGTVYHYDGQYFLSLEDLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVETIQTHFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adapter protein mecA 2
publication title Crystal Structure of the MecA Degradation Tag
rcsb
source organism Bacillus subtilis
molecule tags Protein binding
total genus 24
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jtoA00
3JTOA 3JTPA 3PXGa 2Y1RI 3JTNA
chains in the Genus database with same CATH superfamily
3QMQA 1TKZA 3MFHA 3IRWP 2VFRA 3M9OB 5T14A 1CJUB 1F6TA 2QEXS 3BPSP 3MEGA 1RHJB 1LK5A 1PO6A 1KQFB 3TRGA 1RA6A 1IKVA 3K2YA 3RBEA 4LFCF 4HDHA 3TVKA 2VJUA 2AHOB 2GMLA 2MZJA 2AGQA 3IA0A 2UU9F 1WC5A 3HSDA 4OL8A 2FB0A 2B5JA 2G1HA 5H9FK 2ZWPA 4DSFA 3GYNA 1KWMA 4OHYA 2V67A 4ZVPB 2H4YB 3H59A 1ZS6A 2HMIB 3SSQA 3NWGA 3VAJA 2EK1A 2QYGA 3QJLA 2N4CA 1VQLS 3C19A 2HNYA 2D3OR 2VH7A 5F8LA 4JI8J 2BA9A 2GJFA 3IGNA 5HP1A 1DLOA 3D6TB 1IKXB 1T9VA 3GJQB 3IBCB 4B9TA 4X62F 2V63A 3DLGA 5EGYA 4F25A 3A8IA 1FVQA 1UWBB 2EG2A 4FNIA 4WCEQ 2V4QA 2W2MP 4JB8B 2DCLA 4KHPF 1C0TA 3TQEA 4ZHRB 2BRLA 1SV5A 1B0TA 1H7XA 1AT1B 3HMJG 2CQPA 3LW5C 1RXOB 3DNCA 2LU2A 2LVWA 1ZM9A 1VQ5S 4JI0J 2ASYA 1YJNS 5FD1A 2HBQB 2F5GA 2DNQA 4NYPA 3J7A1 3H25A 3GIKA 3V6DA 1WOPA 2FVPA 4EGLA 2HNZB 1SKRA 3TQ1A 1OY9A 2BKPA 1AFJA 2CPDA 1ZA2B 2G2YA 4USUA 1KSPA 2Z57B 3PHTA 2KXFA 4M94A 2VB6A 2F40A 2YX7A 3OW2R 1GMWA 1L3SA 4IRDA 4IDKA 5DG9A 4JYAF 3CTRA 2RU3A 2DK2A 1RT7B 1FKPA 2RT3A 1HNWJ 5J2NB 4QPXA 2A2CA 3H7HB 3VVTA 3DMJB 1M5PC 3LQVA 5FDLA 3QFWA 4C11B 5HJYA 4FS1A 4K4SA 4NASA 3HDSA 3A12A 1RWXB 3UI3A 3QATA 1DRZA 3HP6A 2BVZA 2JHEA 3PEHA 4MTPA 3CGIA 1FE0A 1PC5A 2VBXA 2FLPA 4FF1A 3TNVA 2J9EA 1RGVA 3NS5A 5CYQA 1N4LA 3DOKB 1MU2B 3B82A 1RWKB 2GO8A 4M5DA 1PYSB 2FTRA 1P1LA 2KG1A 1O0PA 3D3BJ 1FTRA 2OIHA 4QCLA 3C16A 3IWXA 4OHZA 3KNGA 4CNZA 1EETB 1XQIA 2QFIA 2CQDA 4CQ1A 2ASJA 2G0IA 4K4WA 4CLUA 3MM5A 3PKMA 3KLVA 2GVDB 4J9RA 4DS4A 1R6VA 3ITHA 4DFMA 2ZNZA 4AL6A 4ZLLA 1N36J 1U2FA 3M05A 1L3TA 1HLWA 4IOAQ 3QAUA 1VQYA 1GX5A 3JTOA 2I1RA 3CWJA 1MWZA 4DEZA 2CJBA 2ERRA 4FYXB 1PJ7A 2EFPA 2L9DA 5GMEA 2FJBB 2ZWOA 1H74A 3BGUA 2IM1A 3MM8B 2J5AA 1RBOB 5EX3A 1HW8A 2B9YA 3J7AN 4LR8A 2ZH6A 4KTQA 2UVWA 2VKZG 4IFVB 3RB0A 4NXNJ 5F0UA 3DLLQ 2VKRA 2WRMA 2HBZB 3KLFA 1RLCL 3M1VA 1NKBA 2RB7A 3FC9A 4ES2A 2HHHJ 5DDPC 2C28A 3M2VB 2VFTA 3DC2A 1B7YB 2M88A 3G96A 3AJ2A 2EC0A 1S9GB 1VBYA 3TYTA 3D0HE 4K8RA 2YNHB 3KXDA 1RAOA 1IN0A 5DM6Q 4O3RA 5KFTA 5HANA 3MUTP 5AE2A 4P75A 1C2PA 4PWDB 4PRFA 1NDPA 1IKWB 1RI7A 4ZIVA 2NSBA 4HT5A 2YWKA 2HPUA 3CT9A 1KVKA 3H2UB 1X4CA 5B0AA 5CAAA 5CXTA 3AHPA 2Z0GA 3OHBA 5L38A 3ZZUA 2HNDB 3UDLA 1QE1B 4LIRA 1S0MA 2E66A 4U8YA 1TKZB 3MR6A 4PUOB 3V5RA 2V4JA 3KUGA 1B7FA 3H4BA 3C8YA 2E9ZA 2OO4A 4DPUA 1LW0A 3MEGB 3OJUA 1K1SA 4QQBA 4C2MA 5HVFA 1T0TV 1RKIA 2V2ZA 4JV5F 3D0GE 4XPCA 2UXBF 1S1TA 2YKMA 1A6LA 4F67A 2B5JB 4DV4F 3ZZYA 3ICLA 2Q6BA 2B8QA 1RWNB 2G2ZA 2I0XA 4ZLNA 3Q24A 1RJJA 4A8OA 4ZCKA 3EX7B 4B9UA 4JI1J 1R8BA 3L95X 1SBRA 2HNYB 3GJRB 3FCVA 4WP8A 3QJPA 2JVOA 2B7BB 1DLOB 3EM1A 4K4YA 4HDGA 4DV6F 4K5RA 2VF3A 2FVQA 1O6XA 3S6EA 4Q2LA 2QYCA 5B0GA 1C0TB 2B4PA 1Y3JA 3NG8A 3RB4A 1U48A 5KOWA 2X1FA 3MM6A 4ZP8A 4XTTA 2CRLA 2J9DE 1RDRA 3KJFB 2BANB 2G4BA 4OZ5A 1J5EF 2EFQA 2N7CA 5HK4A 1U0HA 3BV8A 3QRRA 2Z58B 4ZVGA 4YB5A 1H98A 5KTQA 4IH7A 1NSQA 4O3OA 5DLGA 3H40A 4M95A 2F8HA 1SIZA 3IM9A 4DL3A 4UZBA 2KT5A 1Q5YA 2CWKA 3UVJA 3CNQP 4JV5J 1DQ8A 4XAKA 2UXBJ 4DR6F 1SUQA 4C48A 3G9CA 1NNDA 1Y5NB 4IDKB 4DF4A 4DV4J 4DR7F 1CVJA 1FKPB 5AXKA 3C14A 3L3CA 4X4QA 5FDLB 2CVEA 2M8DB 3HO1A 2C2KB 5IT9Y 5CZXA 1OYEA 3N6LA 2CVIA 1BE4A 1PILA 4PPZA 1Q8KA 6AT1B 2N7YA 2M4MA 4IOCQ 2AJQA 5DS7A 4DV6J 4NLXA 3A1YG 2QIFA 2I8EA 4NL5A 5ETKA 2JX2A 5CYQB 5HQLA 2OHDA 4ELUA 4M5DB 3OT9A 4J5OA 4O23A 4JI6F 1NRKA 1LXNA 2ILYA 3DI6A 3C16B 5C5JA 4CCHA 4PKDB 1J5EJ 3UQSA 4WFNQ 2BE9B 3NL0A 1Y0HA 2W2QP 4P52A 4RNHA 3MM5B 2GMJA 3HJFA 2QFJA 1TV6A 4ECXA 2ZOFA 3TVZA 2NPIA 3HKZD 1QAYA 4QYZK 1JLCB 2R7WA 3GU0A 4EI2A 2DR6A 1U0SA 2XZWA 3VTIA 1D0EA 5BXIA 2DD8S 2YPYA 2IA6A 3I5AA 2YWEA 4BC7A 4C3KA 1FRHA 2IJRA 1PC4A 1JXVA 3WQPA 3P45B 1WTFA 2JEIA 2V2QA 2W24A 4JV1A 2OP5A 1AUDA 5M2UA 2CPEA 1XERA 1URNA 4N8OA 4USJC 2E5IA 3I32A 3TARA 3A3NB 4DL5A 2A6MA 2NS1B 2W4DA 3PTWA 5CA5A 3KLFB 3M1VB 3ILOA 4JI6J 1W26A 3EVMA 4N5SA 4HL9A 4R0JA 1GTEA 4UOHA 2C2RA 3N6MA 2J7UA 3DRRA 1T8EA 3UD3P 3BKFA 1ICEB 1NK0A 4LF4F 2YVSA 4X65J 4JUZA 4O4RA 3H20A 1RWPB 2ZEJA 3D5MA 4EBCA 1OQ3A 4CYUB 1Z4UA 2ACYA 2M0GB 2BJDA 2VQEF 2A0FB 2MDAA 2ZFHA 5I3QA 1RABB 4O3NA 1WKKA 2JSXA 2NYIA 1SI9A 2MZTA 1R7IA 5ETVA 1CJTA 1WF0A 3J80U 2C2OB 4NRTA 4C8MA 4OHXA 3MM7A 2FZCB 5F8MA 4UY85 2V4JB 3PKYA 5EN1A 1IR2A 2C42A 2C3MA 3PW0A 1RT6B 2LXUA 1LW0B 3O6QA 4MIAA 4C6AA 2LEAA 1SL2A 4KR0B 3R3TA 2JJ4D 3ISNC 4NZ0A 3HSJA 4ZVSB 4RU2A 4F4KA 4IOBA 2JC0A 4ID5A 1D9FA 2EKYA 5ETSA 4L76A 1S1TB 2YKMB 4DL4A 2L3MA 1QY7A 4P73A 3R5BA 5KT4A 3IGVA 5G4DA 1S12A 2HHQA 1Y11A 4RZRA 2V8GA 4LF5F 3BKTA 4F02A 4HI2A 1R8HA 2HRUA 3SMZA 2ZHOA 4ILRA 4YR2A 4YR0A 2HIYA 1Y3KA 4CDIA 2RVJA 2CZ9A 4FBUA 2MMYA 1IJFB 1O8BA 4F4XA 3KMQA 2EG1A 4V1Ak 1PJ6A 5L9XA 1W7WA 2QMXA 3PYDA 3A8JA 3M7VA 2VQEJ 3OL9A 2M9KA 2FD2A 4BHQA 3PIOQ 4MKBA 5HSPA 2ZBRA 2AYMA 2BW2A 3TJAA 1KD1T 2JLEA 2DYAA 1PYTA 3QT7A 4OJGA 3MM6B 1H6KX 1ZBTA 4FKYA 4KV8A 4Q2MA 4MYUA 2VPYB 5E5NA 1RHUB 1KLMA 4CP5A 1U0HB 4MK8A 1OPIA 3MAAA 2LEPA 2FY8A 2IHR1 1FRJA 3PJXA 3DHWC 1IKYA 1ZZNA 2R8GA 3MR7A 2NYHA 4A48A 4CLFA 3EVWA 2Q66A 5F3ZA 4OV1A 3UVJB 3P3DA 5KFSA 2OPRA 4PCQA 2XNRA 2JEJA 2MQ8A 4A8SA 1M90T 3PYFA 2IM2A 1A7GE 2G1DA 3KKFA 1XEZA 1FE4A 3W5YA 2COLA 2QO3A 4DG1A 3C14B 4I67A 2HGLA 5DM7Q 3M8WA 3I0RA 4J37A 2CJKA 1VHIA 3CVKA 3QT6A 4OQJA 2UUWA 5HO4A 3G8TA 2AGOA 3ZO7A 4UT4A 1WG5A 3UR0A 1VJQA 1NBEB 2QLJB 2E1RA 4PABA 1OYDA 1OSDA 2QLBB 2VDIA 5JXSA 1TL4A 1S9EB 1X5OA 1XMOJ 3MCOA 3LTOA 4RNNA 3ENVA 4TKTA 3VQTA 2HLUA 4DLGA 3GP9A 2EKNA 4P2XA 3MZIA 1U02A 4TNOA 5KT6A 3DI6B 2DXDA 1VC5A 3I96A 1FJGF 3UE2A 2V50A 2DRBA 2DT9A 5KG5A 3QO9A 1B64A 2PMZD 5CD4H 4G1IA 3SCKE 3NCPA 4ED7A 1FDAA 2DH8A 5D0GA 4KIAA 4RNFA 3WIVA 2XMTA 1WD6A 5ETOA 1OY8A 1RTHB 2EXUA 1N34F 3THVA 2OJ3A 2AV5A 3AB4B 3O2IA 1TV6B 2HFVA 2PMWA 1GK8A 1WSRA 2GQ2A 3SCLE 4F2SA 4O0NA 1FJEB 3MWBA 1W2BR 3LP2A 1JNRB 3MMAA 2KFNA 4PG6A 1ZAVA 4A8FA 1E6YA 5F41A 3D6MB 1VQMS 3NKYA 4MKYA 2BZ2A 2XMMA 1TUWA 3I5CA 4DMZA 1VQ6S 2F8MA 2WSFC 4YDXA 2X1BA 3RW7A 2QL9B 1X8DA 3G8QA 2HKEA 3BR9A 2YNFB 3AD7C 4YB7A 4Z37A 1RWMB 7AT1B 5EWEA 5ETRA 2R2SA 3THTA 4FPIA 2OD4A 1U49A 4ES1A 3PNIA 2RHQB 3OJSA 2HVHA 4ID8A 1RKJA 2H1YA 2M8HA 3CCVS 2XS2A 4DX8H 1D9DA 1S10A 2DHGA 1FJGJ 1S59A 2DEIA 1KVIA 3NGTA 4V19J 1N5YA 2CQBA 3K17A 2KRRA 5IQQA 5KFKA 3AOBA 5I42A 4DU7A 1XBWA 1N34J 5KFNA 3B8HA 2AZ1A 4DZDA 3HVAA 3KG0A 1V3ZA 2C3OA 5IXUA 1VBXA 2M5YA 2W01A 4WIIA 3CD5A 4Y34A 2HSEB 4BBYA 1CJTB 2DR7A 3V4MA 1KC8T 3CSKA 3DXSX 3MM7B 2GNKA 2B9WA 1S0NA 4KT0C 2HWHA 4P7TA 5GAHU 5SZTA 1LKZA 3MD3A 4B3SF 3IM8A 2J7KA 4I2QA 3QFHA 1IBCB 3Q83A 3UDEA 4HLBA 1SL0A 2XULA 3Q0AA 3LANA 1RZMA 4EK2A 4ID5B 3JSRA 2HGMA 2VFVA 2LQBA 1D09B 4TLRA 2CQ2A 2G0JA 2MHNA 4WU3A 3W9HA 2PGCA 2GGPA 3D66A 1UVKA 3CJ2A 5B09A 1TP7A 2FVRA 2DNMA 4OYWA 4A8KA 3N28A 2FHJD 3SV4A 1NZAA 2WSCC 3BDPA 4N41A 2A6OA 2GZOA 2BQRA 4CH7A 4DV0F 3AQOA 5IM0B 3N6NA 1F9FA 3T5LA 3Q8QB 2W2NP 3W8GA 3AJ1A 4X4VA 2BOAA 1GNKA 1NEEA 3HF5A 1BMQB 2VPXB 4OYPA 4DV3F 2FJEB 3HI9A 4FN5A 1S1VB 4OJ1A 4KGKA 2XCPA 3KHGA 3UCUP 4KV8B 2XBPA 4YY3J 3PFEA 5I3UA 1KLMB 4WK3A 3MHYA 2CNLB 5EX0A 4HT7A 3MAAB 4RBUA 1C1BB 2K2PA 1R6YA 4OI1A 3VCDA 4B3SJ 1HNIB 1KR4A 3IFEA 5IC4B 1VS3A 1IKYB 4TY9A 4K4ZA 2K3KA 5F0WA 3P8BB 1TK0A 4S0MA 3K5OA 3HVRA 5KFBA 4DR4J 1TKXA 2OPRB 1MSWD 1PG5B 4CLPA 3ZZZA 4KO0A 4NXMF 1TAQA 3PZPA 3NBPA 4DG1B 2Z2MA 2HRYA 4LUBA 4Z2XA 1JLEA 1KP6A 2GIFA 1F2HA 4KGZB 1UZHA 1WOSA 2D1CA 4XPEA 4DQSA 3I0RB 2OEKA 1AUSL 3CIZA 5HMYA 4DOZA 4F0HA 4ZA1A 1SJ1A 5LXRA 2MKJA 2UVUA 1UEKA 4QYZJ 2W4PA 3W66A 2E5JA 3Q8UA 2P6SA 2R7UA 4C8ZA 3UD5A 2IM0A 7FDRA 3RU0A 3OR1A 5HVGA 4UTGA 4CO1A 1UPMB 3QWPA 3TA2A 4WFAQ 1VQNS 2HWIA 1U1NA 4OYMA 2RS2A 3R9LA 5JVHQ 1NK6A 2MYFA 3QO9B 3CMES 4FF4A 3I55S 1HNXF 3IG1A 1LNQA 3KDOA 5KFWA 2J0QD 3E01A 2OMLA 2DNRA 2ZHBA 4PPDA 2PIIA 2AJ1A 1KOHA 1OMSA 1KTVA 4NMLA 1FEEA 1AB8A 4QU7A 2E9RX 4G1QA 3GSIA 3K59A 3R6GB 3C66A 4RL1A 5HVHA 4ZPDA 5D77A 3KJQB 4UF4A 3H4DA 1OY6A 3BGLA 3LP2B 4NXMJ 2E5GA 3MMAB 4KBIA 2QTWA 3ET6A 4URGA 2K06A 1WDTA 4GKJJ 1RT4A 2PDAA 2NLWA 1E6YB 4FP9A 1SJ3P 3DYAB 3QLHA 5G0RA 4DN9A 2QL5B 4Y6IA 2DHXA 1DJ0A 5E2QA 3A8EA 1XC9A 2C3UA 4FXVA 1IR1A 1GMUA 3EE3A 5HI7A 1KLNA 1XR5A 2XI2A 4YB1P 3M4XA 2UXDF 2XQCA 4B3TF 4GVLA 4J9MA 2EI5A 3TR5A 3U27A 1W2IA 2J0SD 2ATLA 4MMOA 4WFYA 2XLKA 3UO0A 4JP8A 1RUSA 5CABA 4DX6A 3KHRA 2ALZA 1RCOB 4DV2F 5KG6A 3ELHA 2H54B 1GMWD 5KG4A 2VICA 1U1RA 3NS7B 1HARA 5HQ8A 5C2CA 3JSYA 1LWCA 5I42B 4DU8A 1RTZA 3CDBA 1EJ7L 4RUHA 1U8WA 5IWAF 2XWXA 4AE5A 3C2PA 1IQTA 2CQ1A 1BQXA 1BGXT 3AB2B 1VK8A 1X5SA 1GMVA 1HD1A 2I38A 2UUTA 2EFVA 3QRQA 2XC9A 4W4MA 1LW2A 1WHYA 3JTPA 4KAIA 4LF7F 5EHHA 3F41A 3MCSA 5AXLA 1VISA 3VAMA 2AP6A 3NMAA 5KFPA 1F0XA 3MFIA 3A13A 1UVNA 1FRMA 2R7OA 1UVJA 3MTJA 3CJ5A 5M2PA 2PSZA 4I2QB 3BH7B 3CO0P 2NR0A 2HVIA 3IS9A 5BR8J 4WZQA 3M8PA 2KL8A 4PG5A 3BN4A 4CH0S 4PG7A 2VOOA 2UUBF 1KN6A 5AT1B 1VQSA 3AOAA 1DY3A 4DLEA 4N56A 2FPHX 4GKKJ 3GILA 1JQGA 4DV2J 2GGPB 4DL0C 7FD1A 2LDIA 3V2UC 3UN3A 4CTAA 4CLWA 4IG3B 4ANEA 2XLJA 4MH8A 1WC1A 4ZITA 4R8UB 2R42A 3S1TA 3BQ2A 4HH0A 3MURP 3FKBA 2HBRB 3QSYB 1ZH5A 1WKJA 2I9SA 4J9VA 4HACA 3FZBA 3HHKA 3KUHA 3M6UA 2PA3A 3DGPA 3MDFA 1S0VA 3W5ZA 2KHCA 2QGFB 2X3DA 1WOOA 3LP1A 3W8PA 4F0MA 3NS6A 4NEYA 3W2WA 4DF8A 2EPIA 5DJBA 1R8PA 2OSQA 4U7UK 2HIQA 5IV4A 3PJ9A 4KH0B 4AD6A 4EO6A 4LF7J 3ZTQA 1ZTTA 4ICLA 3GMGA 4EMDA 5A76A 4DS5A 2MLZA 2Y8WA 1T3OA 4XDCA 2OPSA 2B7CB 5LSLA 2BACA 4O0IA 5LMUJ 1NM2A 1X0FA 3M6XA 1BQMB 3TEGA 2WBRA 2DGTA 4KPCA 2P2CB 3GR0A 2WTFA 1TKXB 4TYAA 5LL6d 1HYSA 2IC3A 2OPQA 4KO0B 3WX4A 1NK5A 1EZZB 3GYGA 1L3VA 2QL7B 3NBPB 5KFAA 1RU2A 4K4XA 2NZCA 3TWZA 2PMHA 1JLEB 1DTQA 1YI2S 2GO9A 4N8NA 1WKLA 4NA1A 4QWEA 4XK8C 3GFZA 3EICA 4PG8A 4QIWD 1Q7YT 3TJ8A 1VRUA 3AH6A 3UR3C 2RE1A 4RW8B 4K0KF 2DR8A 2EWHA 3OFGA 5KFVA 4QBUA 4PQAA 2H65B 2KRBA 1JX4A 1HNVA 4C3LA 3JB9k 1RADB 4FXDA 2MKCA 2PT0A 2OEJA 3NGDA 9RUBA 2YKQA 3QYYA 2DISA 2B9XA 2HQGA 2LQ5A 2DHSA 4B3OB 2VA2A 4P72A 4Q43A 1Q8IA 3MUMP 2A1BA 1VYAA 4YUDA 3IG1B 2IIHA 4B9MA 2RNEA 3E01B 3KHHA 1QJHA 1QTNB 4KYZA 2XCAA 1NKCA 2XYGB 2F3JA 1FNXH 1TL1A 4OJ3A 5KG1A 2BJ3A 2LXFA 3RUBL 3LF0A 3PX0A 3DDNA 4DV7J 4G1QB 5HMWA 3HHDA 2EFOA 2Y0SD 1HL6A 3FJ2A 3K5MA 3UFCX 4WFBQ 2MQPA 4M8LA 2ZH2A 2QJ3A 1PCAA 2OH2A 2AJFE 3ET6B 4JI2F 1RT4B 1PSDA 3RRKA 2QT7A 3MOJB 3LPYA 2YQ0A 1P9YA 3SV3A 3DM2A 2DO0A 1K1QA 3QLHB 5G0RB 2Y9HA 2DHHA 4P2FA 3ISZA 1PBAA 1Q82T 2M70A 5D78A 5L39A 3UWTA 2BJ7A 3MD1A 1XK8A 4OX9J 1W25A 3SFGA 4EBDA 1Y5IB 1K9MT 1HBUA 2IDLA 4L6V3 5IQ6A 5F8JA 2HQIA 5K8PA 1NK4A 4DL6A 2L9NA 3ETMA 3KJVA 5EWFA 2J0XA 3JTNA 3PDNA 5GAEI 5LXYA 4J91A 4NCAA 4FKXA 3HSGA 1V5VA 4OZLA 1C4AA 2B6AA 5A8WA 5BYSA 3HLUA 3BPDA 2HZAA 5ETMA 2W9BA 2BUNA 2FJDB 1LWCB 1TQLA 4JI5F 3GE9A 4DJBA 2CUYA 3RR8A 5F9LA 1YDLA 4PQUB 2V9KA 4MFBA 3VALA 2WB4A 1MMLA 4UZCA 2JC1A 4YMEA 2XMKA 3B6BA 3U1LA 1MNEA 1LW2B 1GFWB 1XNQJ 1N88A 1I1GA 2ALYB 4JBCA 3OSPA 4OYXA 3BEGB 2XWYA 4M5IA 1HQEA 2KT2A 2Z30B 4C0HA 1SQFA 5HN0A 4XDDA 5HQMA 3GSDA 4M5MA 3E51A 4KB7A 4LRAA 3ULHA 2MSSA 2BQUA 4QR0A 1S7IA 3M8PB 2MQMA 1TK5A 4DCOB 2C2ZB 1K47A 5ADZA 2YNGA 2XSFA 4LFAF 2E1AA 1YWXA 3MR2A 2IRXA 4Y28C 3KLEB 4ELTA 4QW8A 2PC6A 3CDAA 5KFEA 5A6PA 2W9CA 3OTBA 2QSWA 3TP2A 5LJ3Y 1I94F 1HQUA 4CTAB 3D9BA 2RAQA 1RWWB 3AY0A 1RTIA 5EWGA 2HLTA 1U1OA 2N3OA 1MN9A 5AJ3J 4JI4F 2L48A 4K7QA 2N4DA 1Q78A 2C3YA 2HFUA 3TX8A 3IR7B 3FFIB 4PEOA 2VBYA 4CIOA 3T5KA 4HACB 1VC6A 3W9JA 1R8CA 2W1BA 3DGPB 1KQSR 3LP1B 1HQ2A 4U7UD 2R3VA 3W2WB 1DQ9A 2CIMA 2V5HG 4R25A 2AD9A 4Y2IA 4WWSA 2ZBIA 2F8EX 1V9OA 4ICLB 3POTA 1N5VA 2AWZA 4QZVB 3WX8A 2GAHC 2OPSB 3T5HA 4X4UA 2D9PA 1YZ6A 5A8RA 2MJUA 3SSSA 1NZ8A 4ED0A 2EEYA 3R5DA 3UNYA 1YRTA 2KJVA 4LFAJ 4DCPB 4MYTA 5B0EA 3W63A 2IC3B 3HKWA 5DDQC 2OPQB 3A3OB 3ZXWA 2WONA 3SI8A 1Y4ZB 3P96A 2V8DA 1S1WA 2WZ1A 4JI7F 4M63A 5DG8A 2HVZA 2QE5A 2YX4A 1RT7A 1DTQB 3IN5A 1KEKA 2QX0A 2E7WA 4NI2A 2V68A 2AX0A 5LMNJ 4JI4J 4C11A 4DR1J 4HEA9 2E1PA 3BS9A 1T9YA 1VRUB 4DR2F 2O01C 2FDNA 1EARA 1P1TA 2W8LA 3RJMB 2Q3PA 2HVDA 5GAEU 1HNVB 1HNZJ 1SB6A 4IG0A 3J7Z5 3R7BB 4K2JA 4H4KC 4TU8A 5BJRA 5A6WA 1GEHA 1U45A 2FIUA 3P4UB 5LOQA 3QQCD 2AJ2A 4Q7AA 3PR4A 2KM8C 1BHNA 2RQ4A 5DLFA 2NREA 3R2DJ 3I4HX 1TFYA 1REVB 3PX4A 3HHLA 4LBIA 2UUCF 4Y0FA 1TR0A 3KJNB 5FIIA 4ZLJA 3PRDA 2XHWA 1TL1B 1YK9A 3EGZA 5GMDA 1IBLJ 1K44A 3RRHA 2CPYA 5KFLA 1SH2A 4OX8A 5B08A 4J9QA 4ZKAA 4ED2A 3JXOA 2GIQA 3DFEA 1J27A 2IBOA 5ETLA 4M5KA 1LWFA 1MG7A 1JKHA 2VBZA 3PRBA 4DSKA 4LRDA 5E41A 1TKTA 2GW8A 1YVFA 2WHOA 2LKZA 4F50A 4E0DA 3G86A 1LEOA 2YPZA 4DR2J 2CG8A 2RUSA 3GV7B 2ZDPA 4A8MP 2IMWP 1HBUB 3NEKA 3PRVA 3DCAA 2U2FA 2CZ4A 2AEMA 4DUYJ 1JLQB 1IWAA 5F8NA 3S8SA 1WEYA 1MN7A 2BBEA 1SC3B 4LR9A 4RJVA 3DHXA 4ECSA 3R8YA 2F9DA 1IBKF 2DVIA 1U25A 2Z56B 2QMUB 2CJAA 4YOEA 1JJHA 3D6HB 2B6AB 4OLOA 3D2WA 5A8WB 3NP5A 1JXLA 2DXFA 1XN9A 2UUCJ 2OSRA 5J2MA 1KDNA 4USVA 1Z2LA 2YWHA 3HSZA 2ZC3A 3CUNA 3AD9C 3IO1A 5GAGU 3QIDA 1X4DA 2OFHX 3BGOP 4DR3F 5KG0A 4BC9A 4MFBB 2E29A 3BJYA 1FTCA 4PWDA 2ZDOA 1T9XA 3I5BA 3VZHA 4X84A 2FYXA 1G3OA 1NPKA 3MAQA 1OWXA 2YKAA 2MY7A 1M1KT 4YHHF 1QE1A 1KQKA 4TQSA 1HQEB 4PUOA 2Z8QA 1XWLA 1RHMB 1VQPS 4X66J 4I7FA 2HQCA 4ED1A 5CCLA 2FVCA 1UP1A 2HS4A 2V34A 4NWBA 3H5YA 2YNGB 5CD4A 2GX8A 4IO9Q 1U6BA 2AX1A 4AXJA 2WOMA 3MCMA 1WTBA 2BJ9A 3C15B 2AU0A 2JNJA 2W9CB 2UXCJ 1F3VA 2IBKA 1IBMJ 5J1EA 2DY9A 1IBKJ 2E44A 1HQUB 1EQ0A 4X4SA 4L72B 6FD1A 2W9AA 1RTIB 3PJWA 3IWLA 5C25A 3DU5A 2CJYB 3W7BA 4FVMA 4O3QA 3VV2B 3EZUA 3VVUA 4BWMA 3L4BC 4CO4A 3FK4A 2DNOA 3G87A 2XY7A 1RA7A 2R8HA 2JVRA 1YJVA 3GIMA 3ZZTA 1ZTWA 2DITA 1HBOA 3UW1A 2BV3A 4KC5A 1GTHA 2QA1A 5AE3A 2AF6A 3AT1B 4W98A 4LRBA 2KJWA 3LAMA 5CYMB 2ZH9A 1PYOB 4USMA 2HEKA 1JLGA 5DG7A 3DDIA 3POTB 3JAMU 2XG8A 3CXCR 2BANA 2XMWA 4RW7A 2XMUA 2HQFA 4I2PB 3IBWA 5A8RB 4WPAA 4I68A 1JJCB 1UCNA 3DLKA 1WHXA 1U2CA 2W7PA 4LFCJ 1VQ9S 1KONA 1J2VA 1APSA 2LQ8A 2AYBA 1VIXA 2CPIA 1FI4A 3WIUA 2BJ1A 2X1GA 3CCJS 2WONB 2UU9J 1M1HA 4USIA 5HMXA 3GR1A 1S1WB 3TVYA 4UY8T 5F9NA 4QIEA 2ABYA 2IYIA 1RAJA 4B9SA 4NI2B 2PA8D 1H73A 1ZETA 1UETA 1XR7A 4OZJA 2IVYA 1WSVA 2JOQA 4HVZA 2QG9B 5CHCB 4J9SA 1SJFA 3K7RA 3SQOP 2B4VA 1TMJA 3ENAA 1T05A 4X62J 4IG0B 5DO2A 3HVTA 5E3RA 5DQIA 4JI3F 4WFXA 3CO9A 4KHPJ 1Q53A 1VIOA 4Q44A 3PACA 4YN3B 4NZ6A 2PD1A 3H0PA 4ZCMA 2FJXA 3D68A 1MW7A 2HG4A 2H9ZA 2IRUA 2O67A 3T41A 3HHLB 2X1AA 3IBFB 4J9LA 1H2TZ 4I6YA 3RGIA 3V81A 2ZC4A 3BYPA 1YIJS 4MK7A 3V4IA 4RNOA 1WI8A 4L3NA 1X7VA 3EGVA 4GRSA 4AT1B 2E5LF 4OZ2A 2FC8A 2YXLA 3D28A 5K20B 3Q8VA 1NHVA 4FYYB 2YNIA 2B51A 3Q8YA 2HS0A 4WFZA 3OR2A 2F63A 4E98A 3HXMA 1SC4B 1CQMA 2MB0B 2GIRA 2W2OP 2BKNA 4JYAJ 1JLCA 1HA1A 5KG2A 2CNNB 3B4MA 1LWFB 4IH5A 2ZUGA 3U7JA 3WDOA 5GVQA 1JKHB 4HHJA 3QSIA 1VLOA 5AXNA 3A4TA 1TKTB 3M30B 3T6JA 5CZVA 2ADBA 4C9DA 3VAKA 4RWWA 1GX6A 4OHVA 4HTJA 1HHSA 4DWIA 3TOQA 5I4MA 1X60A 3GJTB 3TUPA 3C6UA 4IR1A 4PXEA 3SIPB 3JYTA 5A2QY 3DKDA 2HHTA 1HI1A 4CO0A 2K1RA 5IS2A 4W92B 3KLIA 4Y00A 2PEHA 3HT0A 1TL7B 3E3XA 2DB1A 2ZH5A 1WC4A 1VQOS 1X9SA 5K8OA 3CD7A 5J2MB 4DBQA 4HTIA 5KFGA 1NSAA 4I4BA 4ZVHA 1KFDA 4TY8A 4CYUA 1A9NB 1NUEA 3HX9A 2CYYA 1T9UA 2CA9A 4X64F 4HYKA 4JV2A 4PG4A 2UP1A 3I56S 2XGQA 4ZP9A 1EB0A 3BO3A 2QN6B 3TANA 5DQGA 3NGSA 3CMQA 4CLZA 1E6VA 4LT6A 2C1EB 2ZZNA 4XO0A 3P6YC 1FD8A 4FF2A 2SXLA 3T1HF 2VDHA 2QZ8A 4U6PA 2ZD1B 4I7FB 2M7SA 1QLNA 1RT6A 4OYZA 3GV5B 2AEFA 1WNEA 2ZZMA 2WOMB 5GMKa 5C42A 1KQGB 3R1LA 3LP0A 5J1EB 3MPUB 3SSRA 3NNHA 3N79A 5FLXY 1FD2A 2CPJA 4K4TA 1UW4A 5KFHA 3VGUA 1FNOA 3OTOF 4DR5F 3AJDA 4F4ZA 3O5TB 4KKOA 3OL6A 3M32A 5C25B 2VC0A 1XNRF 2JZ5A 1L3KA 2MPUA 5DDRC 3HK2A 5HLFA 3T1YF 4CO3A 4ILLA 4KGMA 5IT4A 1NCLA 1SVDA 1HBOB 3GIJA 2AMCB 2ASDA 3BSCA 4IRKA 2WVFA 2YKNA 4WZMA 3VAIA 4I6WA 1NK8A 1SCJB 2XZDB 4OI6A 3TUIC 3VAGA 2NXJA 3FUYA 3AD8C 3NXZA 2XO7A 1JLGB 4FZVA 2Y0BB 1U09A 3SEOA 2POKA 1WF1A 4LR7A 1F1BB 3FMWA 2EVZA 4LF1A 3PW5A 4RW7B 3FQLA 1X4FA 3W2VB 2C2EA 4ECVA 1H2VZ 3DLKB 5IV3A 2BR0A 5CH7B 2EC2A 2BQ3A 1HFEL 3Q23A 4QYRA 1X9MA 5HBMB 2DEJA 1S77D 2DGVA 2E9TA 5ETNA 2F4VF 1SIWB 2MTLA 1RTDA 1H72C 3GIIA 4LMZA 3CJSA 4ERDA 2CDRB 2XZTB 1U47A 2EBGA 4F4WA 4JOUA 1CC8A 2L08A 3EZ5A 1RT2A 3NCRA 1R31A 4EZ9A 2RQKA 2W8KA 4H4MA 3US5A 3THPA 5KT2A 5T41A 2FUG9 3PIPQ 2JLFA 4TLQA 4B9LA 2XB2D 1T05B 4IKAA 3L7UA 1YG0A 1FNMA 3HVTB 1S9EA 4QPTA 1XMQF 4WU2A 1PJ5A 3T6BA 1YHQS 2YWFA 4FYWB 1QUVA 3RG6A 1NB7A 1CULA 4X4OA 1EKRA 3P5TL 1NDLA 3O3LA 5L1JA 2QLWA 3OD2A 2ZZTA 4R0EA 1NSPA 3V81B 1NJXA 4JV0A 1UW9A 4K59A 1R0CB 1HD0A 2A3JA 4ZVTB 4RR5A 5KFQA 2IJFA 4I56A 3V4IB 4RX6A 1OIAA 5IFMA 3MGJA 3SZ2A 2DNKA 1B0PA 5HAOA 1RTHA 2KXNB 2E1CA 1NPPA 3TI0A 2HGNA 2X7IA 2YNIB 4ED3A 3OR2B 3DLHA 4DR6J 1VR6A 3G6YA 2DKOB 2PN6A 2YWGA 5K14B 4DR7J 3OXLA 2FLOA 1I51B 2DGSA 4LF2A 4QIGA 1RWUA 2D41A 2VPWB 3GYXB 3NY0A 5B0BA 4EUVA 2HFNA 2AYGA 5FJ4A 2LQJA 1VGYA 1R27B 1Q0NA 1U1KA 4LF6F 1EQMA 1RCXB 4M5GA 1GXLA 3Q2SC 3KLGA 3SCJE 4X4TA 1FFSB 1S4FA 3OL8A 1X5PA 3C6UB 2YNFA 4ZVFA 1XTZA 3JYTB 3VGSA 3TA0A 3DOLA 1VQ8S 2CXEA 2O5DA 2W2PP 2K1RB 2JEGA 1XR6A 3KLIB 4IR9A 3H2VE 4USTA 3GLJA 2JFKA 1BY9A 2Y1JA 4URQU 3M6WA 5MAOA 1NDCA 4Z7CA 1Q1KA 1YJ7A 2XGPA 2UV8A 2OUGA 2HHXA 2E7XA 3FBEA 4ZDNA 4C7QA 3VR1A 2RQCA 4TY8B 4Q45A 2MZ1A 2BYCA 3PVXA 2VZ9A 2WVCA 3KLHB 4CT8A 2B43A 1PAEX 1G7CB 1RISA 1NAQA 3D1QA 1FWKA 4QWDA 3T1AA 3JQJA 2VFUA 2BJ8A 3AODA 1QSSA 2UUAF 2RUGA 3O8WA 4L74A 4NRUA 1E6VB 4ZVQB 1YRUA 1L5UA 2DPIA 3K58A 4G6VB 3TO8A 4BCAA 3KDNA 1PBUA 1FDBA 1CS4A 1WUUA 3BKUA 1Y10A 3ZZ0A 5I3PA 4LF6J 2V6AA 2C2NA 1C1CA 3F56A 1KS2A 4ZP7A 3GZ7A 3BB5A 1HMVA 2FHJA 3DRPA 2C3PA 4Y2AA 1OQ6A 3N01A 5D0HA 2VG5A 3FCHA 3DLJA 4B3RF 4UOGA 5C42B 3QPIA 4MAKA 4QIVA 5B7WA 1S7HA 1D8YA 5DGBA 3LP0B 2XY6A 3WC2A 4I69A 1M1GA 2ZVIA 2BRKA 4PXDA 3UDCA 2KN4A 3RBZA 1FESA 4GO7X 2ZBPA 4P74A 4KKOB 4X4PA 4LF4J 3UDVA 1CG2A 3M32B 1JLBA 1FRKA 1HKAA 4FS2A 5IC6B 5L8RC 5HLFB 5IM0A 1B99A 1M0SA 3L7OA 1SH0A 2KXHA 5AE1A 1S72S 4IUFA 3MM9B 3PO5A 1WELA 1HR0F 4DFKA 4OI0A 4Y65A 5F8GA 3IC1A 4NOHA 2YKNB 1FFGB 4PWUA 2FHOB 2V8HA 3D0IE 3CIMA 4X4RA 4JI8F 2Q1LA 2UUAJ 3CJ8A 2ZH1A 4PXBA 4ZOSA 2L41A 2IFXA 4A8YA 1BQNA 1S1VA 2V4RA 5KFJA 4I1TA 1FVSA 4NX9A 3A3PB 2DNPA 2R2UA 1CJVB 1B0VA 2IAJA 5GADI 3LGHA 1C1BA 2LEBA 4CLKA 1UJ6A 3EDRB 1T9WA 3NAIA 5KFDA 1HNIA 4KPYA 3KNAA 3ILJA 4DPOA 2ROGA 2DIUA 2ZJRQ 1LQ9A 5GAHI 2H48B 5A0YA 2NXNA 4ZJOA 2HYIB 1FDDA 2DIVA 1SXLA 4J9NA 4B3RJ 4Z7YA 4JI0F 2IVMA 3QIPA 2BKOA 4B9NA 4D3HA 1WORA 3QGHA 2VC1A 1RTDB 4KHMA 4G65A 5F8HA 2W7AA 1HPZA 1U1MA 4LF5J 3JQKA 1F9EB 4KSEB 3RBXA 4V19X 1TZ0A 4I6AA 1RT2B 1FRLA 4MJKA 2BMBA 4H4MB 1FEHA 3GJSB 1TFWA 3PFOA 5JJBA 1N5QA 2BJEA 3I4PA 3N4WA 2QA2A 4AUKA 1HNWF 2MJNA 4NLTA 2MGZA 1HR0J 3H90A 1A0OB 1URRA 1M5VC 1UMJA 3ENWA 4P6QA 2B4UA 3QZ7A 1LXJA 3OBIA 2MXYA 1CULB 4KHRA 1FKOA 3T9NA 2HHSA 3T19A 1V6HA 3UCGA 5KG3A 1JJ2R 1IM6A 4R5PB 3NGKA 4NPOA 3OXFA 2VHGA 4FPRA 3CCZA 1DARA 3CCUS 2QRRA 2ZJPQ 3FRZA 3J81Y 1EIYB 2OMOA 2HFOA 2XMVA 3QT5A 4DPYA 2W7OA 5B0DA 4WYLA 4OYBA 1JXEA 3BO4A 3DLEA 3KTQA 3PW4A 2Z4PA 1UJ4A 4C3MA 2VUGA 4E8UA 4DSIA 4FYVB 3WC0A 3D54A 2OTJS 2HQDA 1QDUB 1QVFR 2PFDA 4USWA 4P71A 2DH9A 3MI7X 5J2QA 3CC7S 2KB2A 2VU5A 5B0FA 4GC7A 1GT8A 1S76D 4B02A 1B3TA 1RQ0A 1FJ7A 5KFYA 4ECRA 4U7CA 1RWVB 3C3LA 1LFPA 4RU9A 3DYAA 4U8VA 1UEVA 3HFZB 3TZZA 1N36F 2XS5A 2FY1A 4DSEA 3KLGB 3GTYX 1U1QA 1R8AA 4LSNB 3TZXA 4OX6A 4YP3A 3D3CJ 1K73T 2OPPA 3AQPA 1WG1A 2AEJA 2AZ3A 3DOLB 5F8IA 1U6ZA 3EXCX 1UFKA 2GQQA 3G8SA 2BE2A 2MQLA 1VOMA 3CCTA 1SKSA 3N5FA 2F4FA 3FSIA 2UZAA 3ZTOA 4FVCA 1PGZA 2W4CA 4IRCA 4OZNA 1RT1A 2DHAA 3QWUA 3M8SA 1VQ7S 4QOTA 1SC1B 4O44A 2Q79A 1QSYA 1P6TA 4NXNF 4H4OA 1Q86T 4FXWA 1JK9B 1ZAXA 1WHWA 3DRYA 4XIUA 2HHHF 4CM2A 5K5MA 1GXTA 4CLLA 3LUYA 4U67Q 1YJWS 4ZJLA 1NXIA 3MECA 2V94A 2ACMA 3AA9A 1NU4A 2ZVSA 2RF2B 1FCAA 3W9IA 5LM7E 5GADU 3MPYA 3FEYB 2BABA 1NHUA 4O3PA 3IRXA 1TUGB 2R7TA 4D3GA 3EXYA 1IVZA 1CS4B 4EEYA 1C1CB 3X3UA 3HHLD 1NJIT 2P9CA 4P7VA 3FRYA 4QW9A 3BQ1A 2YH1A 3TJ9A 4DXLA 1AW0A 1HMVB 3QT8A 3DRPB 2VG5B 1D1UA 4EYHB 4LVOP 1X4BA 2YTCA 3BF4A 2WBMA 3DXBA 2HAIA 2ZH8A 1F9HA 1I5OB 3KK2A 1N0UA 3GIRA 1RK8A 3FBFA 4YS2A 2MZQA 4DX7A 3FQKA 2AIRB 4GC6A 3KUEA 5CQGA 4IG3A 4WP9A 2CFXA 4ECTA 5H9EJ 2DRDA 5ETQA 4R8UA 1JLBB 2WVBA 2VPZB 1F60B 1T3NA 1C0UA 5E33A 5D4PA 2QSFA 2HZVA 3DGVA 1VCTA 2RDDA 3H42A 2QLXA 2F7VA 4QWAA 4C0OC 4RW4B 2DNYA 3G2XA 2KM8B 4J90A 2J7WA 2NUUG 4NE9C 1VDHA 4G1PA 1HI0P 4JI1F 2ZE2B 2XY5A 1NK9A 1OJ4A 2ZH4A 3NCQA 3HVWA 2G13A 4LBHA 1BQNB 3K5LA 2JEFA 1RT5A 1X4HA 1NDKA 4HH1A 2NXCA 2HHWA 3R2CJ 4OYIA 1X0PA 2IAJB 3HFVA 4GO5X 3Q89A 5LT5A 3NLCA 3R5GA 4DPTA 4P10A 3EJMA 4DL7A 2ZM6F 2DBBA 1BQMA 3BYRA 1FO1A 5A0YB 3CDUA 2DGXA 1JLAA 2WW8A 1P27B 1NHKL 3GQCA 1HHQA 1WACA 3QIPB 1TTHB 3JAMY 4YQWA 4W90B 4RKUC 5K8MA 1Q95G 5KT5A 1HPZB 1RE1B 4DQIA 1NH7A 6FDRA 1PIEA 4DL2A 1IKVB 5D4NA 3BR8A 4EYIB 2R8IA 3FSYA 5KFMA 1JWWA 4DPXA 4ATNA 4DV0J 4RW8A 3T3FA 2HZCA 1S79A 1WG4A 4CRJA 2MGZB 3LGNA 1HWUA 3G6VA 2IYGA 3QRPA 2R9LA 4DV3J 3V6JA 3PX6A 3CJQA 2RRBA 5B0CA 2LCWA 5HP1B 2DGQA 1FKOB 2YY3A 2DTJA 4B3OA 5KFUA 2QA4G 4DN0A 3DLGB 3DOMA 3VQSA 2ZBQA 5SUHA 3CC2S 2KI2A 1SPBP 1FDNA 3HJVA 4TU7A 1T7PA 1SV5B 5IZHA 2ZM6J 3WHIA 3DLEB 3RAMA 4LF8F 2YBVA 1TAUA 4NLSA 1S5ZA 2Y3YA 1ITPA 3J81j 1N33F 1I3OB 2RSQA 1QM9A 1X9WA 3LH2S 5J2QB 3K8WA 1S99A 2MY8A 2KT3A 3V6DB 3PM9A 2BDPA 3UNGC 4DV1F 5C2GA 3PYEA 2VA3A 2ZBCA 3RB6A 2D3UA 1S97A 1RAEB 4YR3A 4WK1A 2CNOB 1X4GA 2V8VA 2DCUB 1S1UA 2OPPB 3IAS9 3QGGA 2B0GA 4J9OA 4NYZA 2DGWA 2ASLA 2KFZA 4CM0A 5D6GA 4C0BA 3GFYA 1M5SA 3VHQA 3OFEA 2XI3A 2ZH3A 1BD6A 2R2RA 3M8ZA 4AQYF 2BE2B 2JRSA 2R4FA 2LA4A 3OTEA 3CJ3A 1N52B 3MF5A 4DFPA 1NJZA 3MPVA 1JLFA 1FJCA 4ITSA 2WVDA 5T7LA 1RT1B 1HNXJ 2HHUA 2J6UA 4O44B 1IXKA 1MWQA 2KU7A 3CJKA 3J7ZT 1Q8BA 4H4OB 1S6OA 4ED5A 1G4CA 2BW7A 4DUZF 1QAJA 2RH3A 4OI2A 5RUBA 1M5HA 1WC6A 1Z2ZA 1XMBA 4PQUA 1D9AA 4HHUA 3JSMA 4QWBA 4LF8J 1UVLA 2XS7A 3MECB 3VAHA 4ZVEA 3BZQA 4X65F 3J7YI 1FK9A 1MMDA 1VJWA 2UVVA 1N33J 3BSAA 2LXIA 1S6QA 4ZVOB 1HWIA 5K9FA 3D67A 3PR5B 4OHWA 3FMBA 4ZPBA 1T9TA 3I87A 4DV1J 5DGAA 2KKHA 4CT9A 3R5CA 1S9FA 4WKYA 2GA7A 3IRXB 2V2KA 1RAFB 3NOCA 3SDEA 3ITHB 1MROA 4OZ1A 1LV5A 2FZGB 2U1AA 3IWNC 1TELA 1WEZA 4X2BA 2DXEA 4O3SA 3KWMA 1CEZA 1Q8LA 2UXDJ 4F2RA 2ZNYA 1R0BG 1TK8A 4B3TJ 1DBDA 4KGXB 3OVSA 4QWCA 3TW0A 4DPWA 4OIXA 2ZOGA 4ECZA 3O1LA 3KLEA 3KK2B 4AQYJ 2OFGX 2XMJA 5L1KA 1S49A 4HHHA 2OELA 4DQRA 4ZPTR 3CCRS 5HATA 3LPEA 4TU9A 3CE8A 5D15A 4ZJQA 5ITHA 3K0JA 1UJ5A 5BYRA 2HURA 2YH0A 2Z2ZA 1L3UA 1C0UB 2XMAA 1YRXA 4DUZJ 5KAKA 5D8HB 2RQMA 1LOUA 3FFIA 3SQGA 3NGUA 2VIHA 3I6PA 5IWAJ 3CULA 2OI2A 2RHSB 3CD0A 2XM3A 3N5BA 1ZZFA 3CD6S 3S01A 1TKDA 3B4DA 1WDDA 3RTVA 3CCQS 4NZ7A 1RT5B 5H9FJ 3TAPA 4ETZA 2AT1B 2DNZA 1X31C 2FLNA 3GPAA 1RACB 1N54B 3CDWA 1U2RA 5MLCV 1TMMA 3B54A 1R0AA 3IP0A 4LFBF 2DNHA 2VV5A 2CADA 2GS8A 1N0VC 1RBAA 3LWLA 4N7TA 1JLAB 2UUBJ 1NH8A 1OPZA 3S7RA 2XHCA 3MEEA 3MUVP 4LBPA 3NNCA 3SCIE 1WEXA 4NLUA 2Z2LA 2ILZA 3BO2A 1IJEB 3L7PA 3ONQA 3W61A 3KMSA 3PO4A 5D4OA 3ZNUA 3M8YA 1ZAWA 2OD6A 2GHWA 4DQPA 5U47A 5DDOC 3TUZC 1Y5LB 2WVEA 3IR5B 3W1YC 1RTJA 3CJ4A 1S6UA 5IT0A 3VGTA 3OSNA 4TN2A 2IVFB 4ALZA 2X51A 1H0HB 4FF3A 2C2DA 3RBDA 2J6TA 2VL1A 4DHVA 3BM7A 1NMEB 3D6FB 1HBMA 3V6KA 4ZVRB 2FHMA 2DGOA 5ETPA 2LYVA 3I31A 3HD1A 5J1PA 4A46A 4M5HA 4WTYA 1V3RA 3OFHA 1FF2A 8AT1B 1B70B 4MK9A 1ZM3A 3HHEA 2V69A 3LOUA 4J9UE 1YJTA 5LSRA 3MR5A 3DOMB 1REVA 2J6SA 2Y1LB 1HWKA 3FEXB 3G6ES 1XMOF 5THWA 3MR3A 1XIQA 2XO6A 4USKA 2IDEA 4LFBJ 3J7YU 1P9QC 2F9JA 4YDDB 2GFFA 5KT3A 4MT1A 5KG7A 3IXQA 4M5NA 2AGPA 4NA3A 1ZPWX 1IR0A 4ZK7M 3BGRA 3Q86A 4I64A 1FKAF 3CMAS 1T11A 4ZN3A 3ZC4A 1RWOB 1N56A 1RB0A 3PYGA 1RU1A 1MLAA 2GVZA 3SFUA 1YSJA 3EVOA 1B4SA 4U95A 3BBFA 2R2TA 2H3EB 3GCWP 3NRBA 1SUQB 2M3DA 5L1LA 2HFSA 1Y00A 4UUXA 3DN9A 4KGVB 1S1UB 4K0KJ 2FHKA 3U1MA 5KFCA 5EUHA 4RUBA 4BLGA 4CLTA 4ECYA 1JLQA 4RLEA 4NLGA 1WHVA 1VI7A 2KYXA 2JL9A 2HVEA 3MMCA 2BXJA 1R43A 3LA0A 3M2UA 1KFSA 1NLKL 3AFGA 1EX8A 2DR9A 2H5JB 3RAQA 1JLFB 3BBBA 1QAXA 2IMOA 1U4BA 3EDQB 3PXGa 2M2BA 5T7LB 4OI3A 3RYLA 3SXLA 4DUTA 1AFIA 1IWGA 3CJKB 3H5SA 3I82A 1NB2A 3O44A 4URSA 4MIBA 3BDEA 1GQEA 3MEDA 3JSMB 1UVMA 2KTQA 1FK9B 1DFDA 3PEJA 4UQTA 3E2EA 1S6QB 3C6TA 3KFWX 5HL7Q 4JI2J 4DQQA 2KYZA 3PW2A 2EBEA 1P8GA 1UTAA 2DO4A 3E8OA 4RUAA 2B4OA 1N6QA 2UVRA 3SDEB 1H3DA 1MROB 1FA0A 3KHLA 2Q43A 2FZKB 3OHAA 3PV8A 1YBTA 3WBZA 2FLLA 4EBEA 1GAOA 3OTCA 1F5AA 3RRGA 2H5EA 3NGRA 4A8WA 2OEMA 5L1IA 1HWLA 3V6HA 1T95A 1BWEA 4B08A 1KVJA 3HCXA 1CSJA 3C15A 2A18A 4LSZB 4B3MF 1AZSA 3J80Y 2VONA 4F3QA 2PI4A 2M52A 5DZ6A 5J1NA 1YJ9S 3K5PA 3OVBA 1HHTP 1EP4A 2OLWA 3KK1A 2IA0A 3M2RA 4K50A 2GQCA 4K5SA 3W3SA 4WXOA 3U02A 2XSJA 3OLBA 1CQNA 2EFNA 4DV5F 2ADCA 3SBMA 1VRTA 1H7WA 2A2DA 1U7LA 4JI5J 3CCWA 4OV6A 4MKVA 3FVYA 2AW0A 3SQGB 2FJWA 4CNYA 2CPXA 2QC3A 1K0VA 2CZVC 3DRRB 1YX2A 3OUYA 3DU6A 5GAGI 4EFAC 4EWTA 4QIFA 1H2UX 1K8AT 5CYMA 1ZYQA 4L3KA 2HRTA 1KHWA 1EKSA 2VJVA 4Y2KA 1TUVA 3HHLC 4WXWA 1FT8A 1SQEA 2AJ0A 2RIJA 5JUMA 4OFZA 3HM9A 8ATCB 1UFLA 2AKWB 4NMXA 2P6TA 3VF0B 2GCFA 4I2PA 2RKIA 2KFYA 1R0AB 1RT3A 2IPOB 2LFVA 4Q5VA 1FXRA 3OXGA 3KK3A 3HZGA 4K4UA 3BGFA 2RRNA 1OO0B 2C22A 2D3O1 2MHEA 3RZAA 4YY3F 5AXMA 3HPOA 3CC4S 3MEEB 3TAQA 3CJRA 5F3TA 2G2OA 1RAAB 4B3MJ 3NMRA 3AOCA 4CO5A 4WF9Q 1M5OC 2WW4A 3ADAC 1I94J 2NPFA 1C4CA 1DTTA 4LRFA 2MKIA 4UQGA 4LVNP 4ZVUB 3IMQJ 4DR4F 1RTJB 2XLIA 5KFZA 3CW2C 3CF5Q 4DV5J 3GFHA 4WYWA 2BM1A 2O1PA 3KOAA 4FYDA 2ZH7A 1MMNA 2VODA 1U1LA 3FZ2A 1K0TA 3A8KA 3FBBA 1HBMB 1TVRA 2YQ1A 2KHDA 1Q79A 1RP5A 3K89A 1RYSA 5DETA 3QJJA 4FNHA 4MKAA 2E7VA 2NUHA 3HULA 1SKUB 4ZP6A 2MLXA 4ZMMA 4DDFA 3DDKA 1YGYA 3QGPA 4NLVA 1JIHA 4NYOA 1RHRB 2FGOA 2XYHB 3G4SS 4NCGA 3PHEA 1SJQA 4KY3A 3OLAA 1RYRA 5HJXA 4A8QA 2CQ0A 5HMZA 3MEKA 2CJ9A 2GC8A 4Y2MA 2CWXA 2D7SA 2OGUA 3BGRB 1TL3A 4F0KA 4PYAA 3TZYA 3UCZP 2D9OA 5KFXA 4JI7J 3EGWB 1HBNA 4RBVA 4RPFA 4UOFA 2GVZB 3D7SB 4J7CA 2GV1A 2OAUA 1ZPVA 1CPZA 2VQFF 4RO0A 4B9VA 5D0RA 2NXUA 2ZKTA 4C97A 3M30A 4A4JA 1U26A 4LQ3A 5DZ7A 1WF2A 4O4GA 2D3ZA 2XEXA 4GKJF 1LK7A 4WKRA 4C8KA 1U24A 3R1HA 2I6WA 1YTYA 1AYEA 3I0SA 2VG7A 4Y3CA 2HFZA 3OV7A 2JDJA 3MMCB 3M2UB 4KJIA 2N3LA 2KVQE 1R3NA 2C2MB 1ZOTA 2GHPA 3LAKA 3OFFA 1TL7A 2KVIA 3I9V9 4X4NA 2OTLS 3PW7A 2FQQB 2D69A 2HS3A 5HROA 2ROPA 3LO3A 1YJUA 3G71S 1NSKL 2YX1A 4WE1A 4NLWA 5JMNA 3CDEA 5C24A 3GONA 1RHQB 2VFSA 1GXUA 5LSOA 3MEDB 3JSBA 1JJ4A 1G1XA 4NEZA 3W65A 3P49B 4C8OA 3C6TB 2R7VA 2NCKL 1KKHA 4AYBD 1X5TA 1PAUB 2PE8A 2NZ4A 4RNMA 4OYOA 3VAFA 1TL5A 2VQFJ 1N6QB 3GG1A 2EK6A 1UFWA 5KT7A 4YFUA 2ZD1A 5A2QU 1O51A 2IJNA 3RW6A 4HI1A 1AROP 3MMBA 1CC7A 2L9WA 4CH1A 2ZOMA 2CJQA 3EZOA 2R8KA 2CQGA 4P2MA 2YWWA 3TAMA 1DURA 4CZCA 1AZSB 1BC6A 2GJ2A 3BN7A 1YBAA 3UN2A 2B9EA 3HFKA 3M8QA 4NA2A 2V9WA 3QBCA 2PEBA 2I5JA 3FBCA 5BR8F 2E5HA 1BLUA 1EP4B 3KK1B 2J8AA 3M2RB 3Q8RB 1N8RT 3EGNA 1NO8A 1VQ4S 2XSJB 5J2PA 4ECUA 4BDPA 3KG1A 1VRTB 3R7NB 1YZ7A 1I6JA 1HWJA 3MOZA 1J5OA 1D3WA 4GKKF 4ZCLA 2RU9A 4DR3J 3QGIA 2MQQA 2JH3A 4RW6A 3M9NB 5L9NA 4J9KA 4ER8A 4N76A 2CKWA 3OUYB 1UPPA 2J8SA 1AA1B 1S1XA 1QD1A 5CYJA 1N5YB 1PKUA 4IH6A 2K3IA 2JLGA 9ATCB 1YBUA 5M2RA 2LECA 3DRSA 3R97A 1G6BA 4YHHJ 1WC0A 4B17A 2XTJP 3PG9A 4L73A 2MQOA 3BSOA 3MTKA 4H54A 4IFYA 3ETOA 4KH1B 3W2VA 3R6LB 2RKIB 4ZN1A 3BSNA 1RT3B 4ED6A 1FRXA 2DJWA 3H5UA 1NJYA 5H1SV 4K4VA 3ZTRA 3KK3B 4AFFA 4KQZA 2OKQA 4IQMA 3NWRA 1FERA 5EDWA 1VQKS 3EWGA 2J9CA 4KFBA 1KHVA 4ANCA 2Z2YB 5HBMA 5FLXU 3QZ8A 1VRQC 3TA1A 2LLZA 3ZTSA 2ZITA 1NK7A 2O3DA 5LMUF 2X3GA 4NLQA 5E3CA 1UKUA 2MZSA 1DTTB 4KRWA 2HQ3A 2DPJA 1F3FA 4PWWA 3PY8A 4MIWA 2GJIA 3W64A 2HK3A 1QVGR 1QUPA 4DZ6A 2R8JA 4ED4A 3VGVA 4HKQA 5KOXA 2VG6A 2BOPA 4WP3A 3CJ0A 4OZ3A 2MEWA 4IO1A 2CAJA 4WTOB 1LWEA 2HBYB 3FCWA 2K7KA 2H4WB 1TVRB 2Y1IA 5E3PA 3N9UC 1TU0B 3TUJC 3H2LA 4ZPCA 2CG4A 3EPGA 1QSLA 3NAHA 2KH9A 4ECQA 3CCMS 2XNQA 1ELOA 1FWLA 5A8KA 3VWSA 1UEUA 2B56A 3OQ2A 2CPFA 1S4EA 2P9EA 2KZZA 1KNZA 4ECWA 3CEDA 5BYQA 2HW3A 3G82A 2Q6CA 5KFRA 2MKYA 3D1OA 1KRPA 4YB6A 3MAHA 4EZ6A 1N5TA 2APOA 2AQ4A 2CPZA 2HHVA 1SJRA 4WIQA 4NCGB 2NSCA 2PFFB 3EPIA 4PR6A 1BUXA 3ZTPA 3ENQA 5DQHA 1FHTA 1RAIB 4F3MA 5I3UB 1TL3B 2VASA 4TVAB 4WBFA 3R7SB 3MCNA 5K14A 4A47A 1HBNB 5IT9U 1EHWA 2IM3A 5L46A 4K2XA 2VD3A 4QR2A 5KFFA 1X4EA 4DV7F 1MWYA 4PYDA 2HK2A 4LJMA 5D0EA 2UV8G 3GV8B 3HHNB 2YKPA 4C8YA 1FXDA 2D74B 4RBTA 1YLXA 4WJBA 1ZM2A 4O4GB 2GAGC 2H5IB 2YQ3A 3U1NA 3GWCA 2BEFA 3I0SB 2VG7B 3LGMA 4ES3A 2CNKB 4JI3J 3RAXA 1G2EA 2XYPB 2RRAA 2DNLA 3GB0A 2DRAA 1UAWA 3NNAA 3FGVA 4LIWA 3TZWA 4OX9F 4RUCA 4TQRA 4OJHA 3DRXA 3EUNA 2WK4A 3QAEA 4IQXA 4E2FB 3K8VA 5HROB 3OR1B 5LJ5Y 4WE1B 1N48A 5C24B 4KE5A 1VHFA 3KLHA 2E5LJ 4OZ0A 1NKEA 1M5KC 4ELVA 1UL3A 1CJKA 3CCSS 3CCLS 1NPRA 2CPHA 4ED8A 2DNNA 2P8IA 4I0WA 3AA8A 3FNNA 3GFXA 4RW9A 4LQ9A 3TX0A 1IQZA 4N47A 2ZHAA 1DZ5A 1CLFA 4QU6A 1ULRA 1HI8A 3B78A 3UPFA 3GG0A 3T5JA 1R89A 4ZIWA 3T9ZA 1SQGA 4F04B 4LRCA 4U96A 1VK3A 3MMBB 3RR7A 1XNQF 3KG4A 1IUJA 1S48A 5E7OB 4TXSA 2I2YA 1VC0A 3TAMB 1RSCA 3MPDA 4YEAA 1X4AA 3ZNJ1 1KTQA 3M8RA 1F5CA 2RMLA 5D3GA 1KBRA 3M8QB 2DR5A 3BH6B 3VZIA 2I5JB 2LDYA 4EO8A 4CWBA 2CQ3A 3BQ0A 1CBKA 4BWJA 2P9GA 1S0OA 1Q7LB 4LREA 5C7PA 1T94A 3MMJA 4DSJA 3P5BP 2IRYA 5J2PB 4DCJB 2F65A 4AL5A 4ZS6A 4M5JA 2WSEC 2RS8A 1J5OB 3LALA 3UN5A 4CI0B 2GHVC 3MM9A 4RW6B 5E3QA 4X64J 4LSLA 1T03A 1S6PA 2FC9A 4ZPVR 1F5BA 1S1XB 4NCBA 3CJTA 5AJ3F 2CQHA 3IAM9 2RJZA 1WI6A 4AL7A 1QTMA 3DRSB 4LF9F 3H8YA 2PI5A 3W5XA 4N77A 4PZVA 3T1HJ 4F36A 4NLPA 1FXLA 4Q0BA 1CJVA 2K7JA 4IFYB 5CCMA 1Q81T 2LQ9A 3EMTA 2ZJQQ 1YQHA 5E0OA 3ZZPA 3AXKA 1DAXA 5H9EK 1Q4RA 4GVBA 3HZEA 4KFBB 1YJRA 5IOLA 1Q16B 5D4LA 4F4AA 3Q8SB 1SH3A 2MKSA 2KG0A 4L75A 4P2SA 4DSLA 2PO4A 3JS9A 4ZLPA 4C98A 1KOOA 1CJUA 3CB4A 3IS9B 2DGUA 2FGCA 4HR2A 3R5JB 1SKWA 4PAAA 3OTOJ 4DR5J 2EFGA 1RHKB 3X1LB 4OX7A 4C8NA 1IM4A 1XNRJ 2VG6B 3L09A 2VOPA 3NOGA 3EYZA 1LWEB 2WB1D 3T1YJ 4ANDA 2K8GA 2WAQD 1FWPA 1U8SA 3WZ0A 2O66A 2G9OA 2YKOA 2FJAB 1WWHA 3DLBA 3SYZA 2HMIA 4QJVA 4CO2A 1ZA1B 1BXNA 4NLDA 1FX2A 5LMNF 4FBTA 4ZCIA 4DR1F 1UA1A 1DHMA 1RAGB 3M6VA 2KO1A 5A8KB 4OI4A 2Y8YA 1D8ZA 2AYEA 2NXEA 3OVAA 2GMHA 3W60A 4LF9J 4DI6A 4UOCA 1IKXA 4UW2A 3ILIA 3G82B 2QMWA 2CQCA 4R5PA 2R7XA 2J9DA 1HNZF 1Q5VA 2JWNA 3ZZOA 3H5XA 4F26A 1UWBA 1RBLA 1VMBA 3Q8PB 3Q2TC 2BE7D 1VLYA 4ZHRA 1V5IB 5K8NA 1T02A 2B8PA 2DH7A 1VBZA 1N5SA 3AXMA 2CQIA 1SL1A 4OLPA 1RAHB 2MKHA 3MPWA 3RB3A 4NLRA 4ETXA 3ILLA 2F4VJ 4P9SA 4U9RA 4OMFG 1ROFA 2BX6A 1Y9OA 1UA0A 2HNZA 1AXQA 1IBLF 3D1HA 3H98A 3HT3A 5JVGQ 1U1PA 1NJWA 3D4JA 2RILA 3MXHP 1QAIA 1DQAA 1HYSB 1FRIA 1F2GA 4UUWA 4F8RA 4J9PA 4LSNA 3KYLA 2KZMA 2R7SA 1ZM4A 5J2NA 2A10A 4QR1A 4USHA 3DMJA 2B3TB 1XMQJ 2CQ4A 4EU0A 1YKWA 2E1MC 1EAYC 4G3IA 1SC6A 3JQMA 5DRKA 4DFJA 2AJ4A 2H51B 1OSCA 4F4YA 1HIYA 1JMTA 3J81U 2LMIA 4M1KA 2LP4A 1UWAA 4ZPWR 3I9ZA 4DUYF 3QNWB 2EW9A 5KFOA 2P5VA 4PXCA 4OYAA 3DOKA 1MU2A 4IYQA 4F7VA 2J76E 5ETTA 1UVIA 1REGX 2DNGA 3K57A 1XJWB 2ROEA 2JFDA 1V3SA 3Q22A 1JNZB 2F1FA 3GCXP 2IY5B 1CJKB 2V0NA 4NLYA 2LA6A 5KFIA 2Y1RI 1EETA 3L9ZA 4Q8EA 1WJ9A 3OL7A 3R5AA 2WCXA 2RF2A 3FDSA 4RW9B 1N32F 1LFWA 1HW9A 3M9MB 1S57A 3HD2A 1VBKA 1O5JA 2LU1A 1GH8A 2GVDA 4CLSA 2FJVA 4TYBA 3C46A 2W25A 1ACMB 3FEZA 3OPKA 4Y2CA 8RUCA 2CJXB 3N0VA 2MSTA 3FSXA 4BS2A 2G0CA 3F0NA 3DM2B 2RDJA 1BWVA 2DY1A 2QV6A 2QLFB 4NLOA 4F3OA 3OTDA 5E3AA 3CCES 4A8XA 3F73A 5D3GB 4X66F 2QA4S 1RLDA 2ATCB 2VBWA 1UZDA 3BBCA 2HWTA 3MM8A 2MQNA 1WC3A 3TEHB 2HHPA 4ILMA 2MKKA 1OS5A 2J0WA 4IFVA 3G6XA 3KJVB 3PCOB 4H4KA 2UXCF 1SJ4P 2KDOA 1IBMF 3ISND 3W62A 1VFJA 4DX5A 3AAWB 3CPWR 3K5NA 1Z1ZA 4LSLB 4RW4A 1T03B 4Q8FA 2ZUAA 3M2VA 1S6PB 4C4WA 4FDFA 2MZRA 4AXIA 3UD4P 1Y7PA 2N82B 4C8LA 2MLYA 2CDQA 2ZE2A 2W9BB 1LWXA 3ZZRA 3BREA 1FX4A 1S9GA 1FFWB 1N32J 2YNHA 1YITS 2RDIA 2R7RA 2FVSA 4CLYA 2V2VA 2NQPA 2BM0A 2V8PA 1H38A 1IKWA 3LWMA 4Q0BB 4ZPAA 1JB0C 3F44A 3IR6B 4RWXA 2ZKUA 3R27A 1U6FA 4GMKA 4GVBB 3ZFVA 2HNDA 2HAFA 4M5LA 2RD5C 4ENOA 2R7QA
chains in the Genus database with same CATH topology
5EUHA 5DDRC 3HK2A 3QMQA 2J0QD 3E01A 1TKZA 5HLFA 3T1YF 4ECYA 1JLQA 4CO3A 3MFHA 4ILLA 4RLEA 4NLGA 1WHVA 2OMLA 1VI7A 2DNRA 2ZHBA 4PPDA 3IRWP 2PIIA 2KYXA 2JL9A 2AJ1A 3MMCA 2VFRA 1KOHA 2BXJA 4KGMA 1R43A 5IT4A 3M9OB 5T14A 3M2UA 1KTVA 4NMLA 1KFSA 1HBOB 1FEEA 3GIJA 4QU7A 2E9RX 2ASDA 3BSCA 4IRKA 2QEXS 3MEGA 4G1QA 1LK5A 1PO6A 2YKNA 1KQFB 3TRGA 3K59A 3C66A 2DR9A 1RA6A 1IKVA 3K2YA 4ZPDA 1JLFB 3RAQA 5D77A 4WZMA 3VAIA 3RBEA 1QAXA 4I6WA 4OI6A 1NK8A 4LFCF 2IMOA 1U4BA 3H4DA 3TUIC 3VAGA 4HDHA 3BGLA 3PXGa 3LP2B 3TVKA 2E5GA 2M2BA 3MMAB 5T7LB 2GMLA 4OI3A 2MZJA 4KBIA 2AGQA 3IA0A 2XO7A 3RYLA 1JLGB 4URGA 3SXLA 4FZVA 1RT4A 2PDAA 2UU9F 1U09A 2NLWA 3SEOA 1E6YB 2POKA 4OL8A 2FB0A 4FP9A 1AFIA 2B5JA 1WF1A 3CJKB 4DSFA 3H5SA 3GYNA 4OHYA 3I82A 3FMWA 2EVZA 1SJ3P 3O44A 3PW5A 4RW7B 3FQLA 1X4FA 3W2VB 4URSA 3DYAB 3QLHA 4MIBA 5G0RA 4Y6IA 4DN9A 2DHXA 3H59A 1DJ0A 2C2EA 4ECVA 5E2QA 1H2VZ 2HMIB 3SSQA 3A8EA 3BDEA 1XC9A 1GQEA 3NWGA 2C3UA 3VAJA 4FXVA 3DLKB 3MEDA 3JSMB 2EK1A 5CH7B 2BR0A 5HI7A 2BQ3A 1HFEL 3QJLA 2N4CA 3Q23A 1VQLS 1KLNA 4QYRA 2HNYA 2D3OR 2VH7A 1XR5A 1UVMA 5F8LA 1X9MA 2KTQA 2XI2A 1FK9B 1DFDA 3PEJA 2BA9A 4YB1P 3M4XA 2UXDF 4UQTA 3IGNA 1S6QB 3C6TA 5HBMB 5HP1A 3E2EA 1S77D 2DGVA 4B3TF 1DLOA 3KFWX 4J9MA 1IKXB 2E9TA 5HL7Q 2EI5A 3TR5A 4DQQA 2KYZA 3PW2A 2EBEA 3U27A 1P8GA 2F4VF 1W2IA 4B9TA 4X62F 2J0SD 3DLGA 5EGYA 1SIWB 2ATLA 4MMOA 4WFYA 4F25A 1RTDA 3GIIA 2XLKA 4LMZA 2DO4A 3E8OA 1FVQA 4RUAA 2B4OA 4ERDA 1UWBB 1N6QA 2EG2A 3KHRA 4FNIA 3SDEB 1H3DA 4WCEQ 2V4QA 2ALZA 1U47A 2UVRA 1MROB 2DCLA 4DV2F 4KHPF 1FA0A 5KG6A 3KHLA 2Q43A 2EBGA 1C0TA 3OHAA 4F4WA 3PV8A 4ZHRB 2BRLA 4JOUA 1SV5A 3WBZA 1CC8A 2L08A 2FLLA 1B0TA 1H7XA 3HMJG 2CQPA 3EZ5A 1RT2A 4EBEA 5KG4A 3NCRA 3LW5C 1GAOA 1R31A 3OTCA 1F5AA 4EZ9A 2RQKA 2W8KA 4H4MA 1U1RA 3US5A 1HARA 5HQ8A 3RRGA 2H5EA 3THPA 5KT2A 3DNCA 2LU2A 2LVWA 5T41A 4A8WA 1ZM9A 2FUG9 3JSYA 3PIPQ 2JLFA 1VQ5S 4TLQA 5L1IA 4B9LA 1HWLA 2ASYA 1YJNS 3V6HA 2XB2D 1T95A 1BWEA 5FD1A 1T05B 4B08A 1LWCA 5I42B 1KVJA 1CSJA 4IKAA 2DNQA 2A18A 1YG0A 4NYPA 1FNMA 3CDBA 3HVTB 4B3MF 3J7A1 3H25A 3GIKA 4RUHA 3V6DA 3J80Y 1S9EA 2FVPA 2VONA 4EGLA 5IWAF 2XWXA 4QPTA 1XMQF 4F3QA 2HNZB 4AE5A 2PI4A 2M52A 4WU2A 1SKRA 3TQ1A 3T6BA 3C2PA 1IQTA 2CQ1A 1BQXA 5J1NA 1BGXT 1YHQS 1AFJA 2YWFA 2CPDA 1VK8A 3AB2B 1YJ9S 3K5PA 1QUVA 1KSPA 3OVBA 1NB7A 1HHTP 4X4OA 1EP4A 1X5SA 2KXFA 2OLWA 3KK1A 2IA0A 1HD1A 3P5TL 2I38A 3M2RA 2VB6A 2F40A 2UUTA 4M94A 4K50A 2EFVA 2GQCA 2YX7A 3O3LA 2XC9A 4K5SA 3OW2R 3W3SA 4WXOA 3U02A 1L3SA 5L1JA 2QLWA 1LW2A 4IRDA 1WHYA 4IDKA 5DG9A 2XSJA 3OLBA 1CQNA 2EFNA 4R0EA 4DV5F 2ADCA 1VRTA 3JTPA 4KAIA 4LF7F 1H7WA 3V81B 5EHHA 4JYAF 3CTRA 2RU3A 1NJXA 2A2DA 4JV0A 1U7LA 3F41A 4K59A 1HD0A 2A3JA 2DK2A 1RT7B 3MCSA 1FKPA 2RT3A 5AXLA 5KFQA 3CCWA 5J2NB 3VAMA 2AP6A 2IJFA 3NMAA 3FVYA 2AW0A 4I56A 4QPXA 2A2CA 5KFPA 1F0XA 3V4IB 3SQGB 3DMJB 4RX6A 1M5PC 3LQVA 2FJWA 5FDLA 1OIAA 3MFIA 5IFMA 1UVNA 3MGJA 4CNYA 3SZ2A 2DNKA 1B0PA 4C11B 1FRMA 2R7OA 2CPXA 1RTHA 1UVJA 4FS1A 3MTJA 4K4SA 1K0VA 2CZVC 3CJ5A 3DRRB 5M2PA 3HDSA 2PSZA 4I2QB 3OUYA 2KXNB 2NR0A 3DU6A 5GAGI 4EFAC 4EWTA 2HVIA 3UI3A 3IS9A 4QIFA 2E1CA 1DRZA 3TI0A 4WZQA 3M8PA 3HP6A 2HGNA 2BVZA 2YNIB 2JHEA 3PEHA 3OR2B 1H2UX 4ED3A 4MTPA 3DLHA 4PG5A 3BN4A 4CH0S 3CGIA 4PG7A 2VOOA 3G6YA 2UUBF 1KN6A 1FE0A 2PN6A 1K8AT 2YWGA 5CYMA 1PC5A 1ZYQA 1VQSA 5K14B 2VBXA 1KHWA 3OXLA 4Y2KA 1TUVA 3HHLC 4WXWA 4DLEA 1FT8A 4N56A 1SQEA 2FLPA 2FLOA 2AJ0A 2DGSA 2FPHX 4QIGA 1RWUA 2D41A 2RIJA 4FF1A 3TNVA 5JUMA 2VPWB 3GILA 2J9EA 1RGVA 3NS5A 5CYQA 3GYXB 4OFZA 5B0BA 3DOKB 1N4LA 1MU2B 3HM9A 4EUVA 2GGPB 2HFNA 1UFLA 3B82A 2GO8A 4DL0C 2P6TA 4M5DA 3VF0B 7FD1A 2AYGA 2LDIA 2FTRA 3V2UC 5FJ4A 4CTAA 2GCFA 2LQJA 1VGYA 4I2PA 1R27B 2RKIA 4IG3B 2KFYA 1P1LA 2KG1A 1U1KA 1R0AB 1RT3A 1O0PA 4LF6F 4Q5VA 2XLJA 1FTRA 4MH8A 1GXLA 1FXRA 2OIHA 3OXGA 3KK3A 4QCLA 3Q2SC 4R8UB 3S1TA 3KLGA 3IWXA 3HZGA 3SCJE 4K4UA 3BGFA 4OHZA 4X4TA 4HH0A 3KNGA 2RRNA 4CNZA 1OO0B 1EETB 1S4FA 3MURP 3BQ2A 2C22A 3OL8A 2MHEA 3RZAA 1X5PA 3C6UB 4YY3F 2YNFA 2CQDA 4ZVFA 5AXMA 3HPOA 1XTZA 3MEEB 3JYTB 3TAQA 3CC4S 4CQ1A 5F3TA 1ZH5A 3TA0A 2ASJA 2I9SA 3NMRA 3DOLA 1VQ8S 4CO5A 4WF9Q 1M5OC 2O5DA 2K1RB 3FZBA 3HHKA 4K4WA 3M6UA 2PA3A 3DGPA 3MDFA 3MM5A 1S0VA 2JEGA 1XR6A 2NPFA 3PKMA 1C4CA 2KHCA 3LP1A 3KLIB 3KLVA 1DTTA 3NS6A 4IR9A 4J9RA 4DS4A 2MKIA 3W2WA 4DF8A 3H2VE 3ITHA 4DFMA 2ZNZA 2JFKA 1BY9A 4UQGA 4AL6A 2Y1JA 4LVNP 4URQU 3M6WA 1U2FA 3M05A 2EPIA 5MAOA 1L3TA 5DJBA 1R8PA 4DR4F 1RTJB 2XLIA 1Q1KA 2OSQA 4U7UK 2HIQA 5KFZA 2XGPA 3CF5Q 4EO6A 3GFHA 4WYWA 4IOAQ 2UV8A 3QAUA 1VQYA 2BM1A 2O1PA 3KOAA 4FYDA 2HHXA 2ZH7A 1ZTTA 1GX5A 1MMNA 2I1RA 3CWJA 3JTOA 4ICLA 3GMGA 2E7XA 1U1LA 3FZ2A 2VODA 1MWZA 4DS5A 1K0TA 4ZDNA 4C7QA 4DEZA 3VR1A 2RQCA 1T3OA 4XDCA 2CJBA 4TY8B 1HBMB 4Q45A 2MZ1A 2OPSA 2ERRA 2BYCA 2B7CB 5LSLA 3PVXA 2VZ9A 2BACA 1TVRA 4O0IA 2KHDA 2EFPA 3KLHB 1Q79A 2L9DA 1X0FA 1RP5A 2FJBB 4CT8A 2B43A 1RYSA 1G7CB 1RISA 3M6XA 5DETA 1BQMB 1NAQA 3BGUA 2WBRA 3D1QA 4QWDA 2DGTA 3T1AA 3QJJA 4FNHA 4MKAA 2IM1A 3MM8B 2J5AA 3GR0A 2WTFA 2NUHA 2VFUA 1TKXB 5EX3A 1HW8A 2B9YA 1QSSA 4TYAA 4ZP6A 5LL6d 4ZMMA 2IC3A 2ZH6A 1HYSA 2UUAF 2RUGA 4KTQA 3O8WA 2OPQA 4KO0B 2UVWA 3WX4A 1NK5A 1L3VA 4DDFA 3DDKA 1E6VB 1YGYA 4NRUA 3QGPA 1YRUA 2VKZG 1L5UA 2DPIA 4IFVB 4NLVA 3K58A 3NBPB 4G6VB 5KFAA 4K4XA 3TO8A 4BCAA 3RB0A 1JIHA 4NYOA 5F0UA 2PMHA 3DLLQ 1FDBA 1JLEB 2VKRA 1DTQA 1YI2S 2WRMA 3KLFA 2FGOA 3M1VA 2GO9A 4N8NA 1NKBA 2RB7A 3G4SS 4NA1A 4NCGA 3ZZ0A 4QWEA 3PHEA 5I3PA 1SJQA 4ES2A 5DDPC 3OLAA 4XK8C 2C28A 1RYRA 3M2VB 1C1CA 3GFZA 4A8QA 2VFTA 3F56A 1KS2A 3DC2A 2CQ0A 4PG8A 5HMZA 3MEKA 2CJ9A 4ZP7A 4QIWD 2M88A 3GZ7A 1Q7YT 3BB5A 2GC8A 1VRUA 3AH6A 3G96A 3AJ2A 2EC0A 3UR3C 2RE1A 4Y2MA 1HMVA 2FHJA 2D7SA 3DRPA 2C3PA 4RW8B 4K0KF 1S9GB 3BGRB 4Y2AA 1OQ6A 3N01A 1VBYA 2DR8A 2VG5A 3TYTA 3D0HE 1TL3A 2EWHA 2YNHB 3FCHA 3OFGA 3DLJA 5KFVA 4QBUA 3UCZP 1IN0A 5DM6Q 2D9OA 4PQAA 4O3RA 5KFXA 4B3RF 5KFTA 5C42B 3QPIA 4MAKA 2KRBA 1JX4A 1HNVA 3EGWB 4C3LA 3JB9k 4QIVA 5B7WA 1S7HA 1HBNA 3MUTP 1D8YA 5DGBA 4RBVA 3LP0B 4FXDA 2MKCA 5AE2A 2PT0A 2XY6A 1C2PA 3WC2A 4I69A 4PRFA 4PWDB 1IKWB 3NGDA 2BRKA 4PXDA 2GV1A 3UDCA 1RI7A 2OAUA 2YKQA 3QYYA 1ZPVA 2DISA 1CPZA 2VQFF 4B9VA 2B9XA 2KN4A 2NSBA 2LQ5A 4HT5A 2YWKA 2HPUA 1FESA 2NXUA 4GO7X 2DHSA 4B3OB 3CT9A 2ZKTA 4C97A 3M30A 3H2UB 4A4JA 4KKOB 2VA2A 4X4PA 1U26A 4Q43A 1X4CA 4LQ3A 5B0AA 1CG2A 1Q8IA 3M32B 3MUMP 5CXTA 2A1BA 3AHPA 1JLBA 1FRKA 1WF2A 2Z0GA 3OHBA 5L38A 4O4GA 3ZZUA 4YUDA 2D3ZA 3IG1B 2HNDB 2XEXA 3UDLA 1QE1B 4FS2A 4GKJF 4LIRA 4B9MA 1LK7A 2RNEA 3E01B 2E66A 1S0MA 4WKRA 5L8RC 4C8KA 1TKZB 1U24A 3MR6A 1QJHA 3KHHA 3R1HA 5HLFB 4PUOB 5IM0A 1YTYA 3V5RA 1M0SA 3I0SA 2VG7A 2XCAA 4Y3CA 2V4JA 3L7OA 1SH0A 2KXHA 1NKCA 5AE1A 2HFZA 1S72S 2F3JA 4IUFA 3MM9B 3OV7A 1FNXH 3PO5A 1B7FA 1WELA 1TL1A 2JDJA 3MMCB 4OJ3A 5KG1A 3H4BA 1HR0F 2LXFA 3C8YA 3M2UB 2E9ZA 4DFKA 4OI0A 3LF0A 4KJIA 4Y65A 2OO4A 1LW0A 3PX0A 5F8GA 3DDNA 3IC1A 2N3LA 3MEGB 4G1QB 5HMWA 4NOHA 3HHDA 2EFOA 2Y0SD 1HL6A 2YKNB 1R3NA 3OJUA 3FJ2A 4PWUA 3K5MA 1ZOTA 2FHOB 2GHPA 3LAKA 3OFFA 2V8HA 3D0IE 3CIMA 4X4RA 2KVIA 4JI8F 3UFCX 1K1SA 2Q1LA 4QQBA 4WFBQ 3I9V9 4C2MA 2ZH1A 2MQPA 2OTLS 4PXBA 4ZOSA 4X4NA 4M8LA 2L41A 2ZH2A 2IFXA 3PW7A 4A8YA 1RKIA 4JV5F 2OH2A 1BQNA 1S1VA 3D0GE 2HS3A 2V4RA 4XPCA 2UXBF 5HROA 1S1TA 2AJFE 4JI2F 1RT4B 2YKMA 1A6LA 1PSDA 5KFJA 3RRKA 2ROPA 3LO3A 4I1TA 1YJUA 2QT7A 3G71S 4F67A 1FVSA 4NX9A 2B5JB 4DV4F 2YX1A 4WE1A 4NLWA 3MOJB 2DNPA 3LPYA 3ZZYA 3ICLA 2R2UA 3CDEA 5C24A 2Q6BA 1B0VA 3SV3A 2IAJA 3DM2A 5GADI 2DO0A 1C1BA 2LEBA 1K1QA 1UJ6A 3QLHB 5G0RB 3NAIA 5KFDA 2I0XA 3ISZA 2VFSA 1HNIA 4KPYA 1Q82T 3KNAA 1GXUA 4DPOA 2M70A 5D78A 5L39A 5LSOA 3UWTA 1RJJA 4A8OA 3MEDB 3Q24A 2ROGA 2DIUA 3MD1A 1XK8A 3JSBA 4ZCKA 3EX7B 4B9UA 1R8BA 1W25A 3L95X 1SBRA 2HNYB 3SFGA 2ZJRQ 4EBDA 1Y5IB 1K9MT 1JJ4A 1LQ9A 1G1XA 5GAHI 5A0YA 3P49B 1HBUA 3QJPA 2JVOA 4L6V3 4C8OA 2B7BB 3C6TB 5IQ6A 2HYIB 2R7VA 1FDDA 5F8JA 2DIVA 1SXLA 4J9NA 1DLOB 4AYBD 4JI0F 2HQIA 4K4YA 2IVMA 1X5TA 3QIPA 5K8PA 4HDGA 4B9NA 4DV6F 1NK4A 4DL6A 4K5RA 2PE8A 4D3HA 2L9NA 3QGHA 2NZ4A 2VC1A 1RTDB 4KHMA 4RNMA 2FVQA 5F8HA 3KJVA 3VAFA 5EWFA 1TL5A 2J0XA 2W7AA 1N6QB 1HPZA 1U1MA 3S6EA 4Q2LA 3JTNA 2QYCA 3PDNA 5GAEI 5LXYA 5B0GA 3GG1A 2EK6A 4NCAA 1UFWA 1C0TB 4KSEB 5KT7A 2B4PA 4V19X 1TZ0A 4YFUA 1Y3JA 2ZD1A 3NG8A 4OZLA 4I6AA 3RB4A 1U48A 1C4AA 5KOWA 2X1FA 3MM6A 1RT2B 2B6AA 4ZP8A 1FRLA 4MJKA 1O51A 2IJNA 5A8WA 5BYSA 3RW6A 4H4MB 1FEHA 3HLUA 1AROP 2CRLA 4HI1A 2J9DE 1TFWA 1RDRA 3MMBA 1CC7A 3PFOA 5JJBA 2L9WA 4CH1A 2BANB 2G4BA 2ZOMA 2CJQA 4OZ5A 1J5EF 2R8KA 2EFQA 2W9BA 1N5QA 2CQGA 2BUNA 2N7CA 2BJEA 3I4PA 3N4WA 2QA2A 1LWCB 2FJDB 4AUKA 3TAMA 1TQLA 4JI5F 4ZVGA 4YB5A 3GE9A 1HNWF 2MJNA 4NLTA 2MGZA 1H98A 4DJBA 1DURA 4CZCA 3RR8A 1BC6A 2GJ2A 1URRA 5KTQA 4IH7A 3BN7A 1M5VC