3JTOA

Crystal structure of the c-terminal domain of ypbh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
DESADIIYQFHSFEDIIQLSESLQRIGITGGTVYHYDGQYFLSLEDLGSHTAEGVVAVLAEYGNPTTLTIYRLQEYGKLIMDGNAVETIQTHFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the MecA Degradation Tag
rcsb
source organism Bacillus subtilis
molecule tags Protein binding
molecule keywords Adapter protein mecA 2
total genus 24
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jtoA00
3PXGa 2Y1RI 3JTPA 3JTNA 3JTOA
chains in the Genus database with same CATH superfamily
3EMTA 3UDCA 4P7TA 3RTVA 3IM8A 1Q5VA 4DQQA 4DSEA 1IBKF 5GVQA 2OPQB 4IFYA 1SJFA 1T3NA 2OKQA 1V5IB 1QTNB 2Z8QA 2CPYA 4PYAA 5IQQA 2CWKA 3QIDA 2Z2LA 3C8YA 4PXEA 5E7OB 4NXNF 5HP1A 4CO3A 1CEZA 2POKA 3C14A 3UFCX 4C3MA 1KLMB 3EGNA 3H2UB 5IT0A 4BS2A 2DNLA 4DPOA 3NNAA 1CS4A 1S97A 4DV5F 3I31A 4PRFA 2O3DA 1Z2LA 4OJ1A 1RBOB 2B5JA 1DTQA 4KFBB 1KQFB 1YIJS 3IWNC 1JJCB 3HHLB 4JV1A 1MROA 4WFAQ 3MMAB 1CC7A 3QMQA 2EK1A 1CJUB 1D9AA 1NPKA 2DNYA 4P10A 4YY3F 2W7PA 2RDIA 3D9BA 2DEIA 1IR0A 3MOJB 5FD1A 4OZ3A 3PO4A 3Q89A 4JBCA 5C24A 3J81U 3DRYA 3TUZC 4C7QA 4B3SF 4PG6A 2IYGA 2UU9F 4FBTA 3IR6B 3EZ5A 3GV7B 2A1BA 3BBFA 2VQEJ 4JV5J 2MZ1A 1U4BA 1MN7A 2OPPA 3BH7B 3DLKB 1DHMA 1FA0A 1SQGA 2M5YA 3R2CJ 5KG7A 2G9OA 5CYMA 4F50A 1TV6A 2B8QA 3MTJA 3QRPA 4QWAA 5J1NA 3RU0A 2XG8A 4DUYF 2BE7D 2ASDA 2DYAA 2GHPA 3M2RB 1ZBTA 1TR0A 4WP3A 4ECYA 2W2MP 2UXDF 4KQZA 2CNNB 2PEBA 4ZPAA 2VJUA 3MAHA 3C6TA 3D6FB 5DETA 2ZITA 5D15A 1ZA1B 2VPYB 2XULA 1WKKA 1NK8A 3IBCB 3R1LA 2HNYB 4LQ9A 5DG7A 2A6OA 2DCUB 3S8SA 2LXIA 3GV8B 5AJ3F 3D28A 2DH9A 4ED2A 5H9FJ 3PW5A 2DGVA 4JI1F 1SIZA 5GADI 4R0EA 1OY9A 1YJ9S 1FXDA 3KLGB 4F3OA 1UVIA 3B54A 4WZMA 2Z0GA 4C0HA 2XYPB 2W9CB 5KFJA 2DRBA 4JB8B 1SQEA 4N47A 4JI2J 2FJEB 1XMBA 2OLWA 4DOZA 4HVZA 2V63A 3EZOA 4ZN1A 1UPMB 2IC3A 4ES2A 1N0VC 1RWMB 1LWFA 1SJQA 4U9RA 3TUIC 1Q82T 2IAJB 1YZ6A 1RA7A 2CQHA 4OX7A 5L1KA 1U8WA 2AGPA 1FRIA 2DNOA 3UO0A 5BJRA 1JLFA 2VG6B 1N0UA 2R8GA 1ZM2A 1L5UA 4CLWA 5DLFA 5H9EJ 2V34A 2KT3A 1HNXJ 3PYEA 1U6FA 4RW8A 1O6XA 1CULA 2JVOA 2IVFB 4Y6IA 3PW4A 2K2PA 4FYYB 3W5YA 1M5PC 3WHIA 1QDUB 3CCMS 5IFMA 3RJMB 1SC4B 2AZ3A 3GYGA 3VGVA 4DZ6A 2UUBJ 3PX4A 1U0HA 1VC5A 1HI0P 3FFIA 6FDRA 5AJ3J 5KFCA 4WZQA 3EXCX 2J9DE 1VLOA 3SQGB 1UETA 1JJHA 5CYJA 5T14A 1I94F 3W2VA 4CCHA 2KYZA 1Y9OA 2KH9A 4M5LA 4DG1A 4UQGA 3OXFA 1RHMB 2CYYA 3CD0A 3R7NB 3CCES 3VALA 1KLMA 1Q5YA 2KRRA 2MLXA 2OGUA 3QBCA 3NS7B 2AYEA 2WHOA 4DR6F 5SUHA 1S9EA 1C1BB 2U1AA 5KG1A 1Q8KA 2V6AA 4X65J 1BWEA 2JLGA 2FHJA 2YNGB 2P6TA 3D66A 3MD3A 3P8BB 4DR1F 1PC5A 2EFPA 4KFBA 4OZ1A 4WF9Q 4WK1A 2VKRA 2AWZA 4CO1A 4FPIA 4KGKA 1G3OA 3TA2A 2BQUA 2GO9A 2RE1A 4UW2A 2ZH2A 2GVDB 3K17A 2NCKL 1RLDA 1F0XA 1F9HA 3W62A 3V4IA 2V94A 3FCHA 3TX0A 2QL5B 1AUDA 2WONB 1IKWA 1AB8A 1I94J 3KLIA 4KBIA 1N4LA 3DYAA 1CLFA 5GAGU 2MQNA 3PO5A 2BABA 4KGMA 4DV2J 1WORA 3GZ7A 2VBZA 4WE1A 2HQ3A 4UUXA 4R8UA 5F9NA 4P52A 2VQFF 4ED6A 3WX8A 1DRZA 1TV6B 2JRSA 3RBEA 1RAJA 3SCJE 4ZVPB 3FRYA 1LFWA 3O5TB 4LBHA 1W7WA 5LMNJ 2VG7B 5D0RA 1HQUB 3F0NA 2RUSA 4LF4F 7FD1A 3NY0A 4Y00A 4YS2A 1PJ7A 2OMLA 4DFJA 3BKTA 2DNNA 3M8RA 2GC8A 3DU5A 2B9WA 1Q8LA 2BRLA 2DT9A 2HNDA 2ZE2A 3E51A 3PJWA 4FXWA 4GO7X 3W65A 4ID8A 3K5LA 2FJVA 2B9YA 1NDPA 5K8NA 3AJ2A 2GNKA 3DXBA 4NLXA 2ASJA 4U8VA 1AZSB 2AKWB 4DPTA 2XM3A 3M8QB 4KHPJ 3AY0A 1LW2B 3UE2A 3VWSA 2PEHA 3IGVA 1O51A 1S0MA 1E6YB 1S7IA 3WDOA 4JI6J 5ETPA 4M95A 3PIPQ 1MWZA 4O23A 2DHSA 2IHR1 4KR0B 2R7VA 2XMJA 4PEOA 1VHFA 5KFAA 2ZZMA 1XBWA 5CD4H 3OTOJ 1JQGA 2GQCA 1N5TA 1UJ6A 4ANDA 3L7UA 2OH2A 1GQEA 4ILRA 1RGVA 3DC2A 2J6SA 3MM8B 1HQUA 1RKIA 2WSFC 3BGRA 3D5MA 2E5LJ 3MR6A 2CQDA 5F0WA 2C22A 4RWXA 3C3LA 2KFNA 3X3UA 1K0VA 5A0YA 1J2VA 3ZZOA 1X4EA 3OR1B 5IS2A 1NK0A 4LF7F 2QYCA 4J9PA 3TEGA 2EFGA 4AFFA 4DFPA 3GIKA 4IG3B 5L1LA 4LRCA 1NSAA 1HQEA 2QEXS 1U02A 2MHEA 3W9JA 1R43A 1TL7B 1M5HA 3BQ0A 2V9KA 2LYVA 3A3PB 1S4EA 2FGCA 3ILOA 1P9QC 4Q2LA 3SQGA 3TNVA 4Y2IA 3OVSA 2XYGB 4X84A 2FB0A 2GCFA 1KQKA 1QVGR 4ZDNA 3OFFA 2OMOA 2C42A 1S1XA 3H5SA 1SKUB 2MJUA 2HFNA 1OPIA 4IQMA 3TO8A 5GMEA 3TP2A 4GKJF 2AJ1A 1SXLA 2NXUA 3JSBA 4K4ZA 4QW8A 4DV6J 5E5NA 1SIWB 4IG0A 4HI1A 2GQQA 1S9EB 2CPJA 3MM7B 2YNHB 1RQ0A 2JC0A 4WFXA 3HLUA 2QN6B 3FCWA 5F3TA 1U24A 2XSJB 2YWKA 5LM7E 1JX4A 5D8HB 2MHNA 3M2VA 4KV8A 4DUZJ 1UL3A 4FZVA 4P75A 4F7VA 3OTOF 4DQPA 4ZVGA 4WIIA 4ZPVR 3FBBA 4J9SA 1HR0J 2JDJA 1RT6A 2P6SA 2DIVA 4YDXA 4UOFA 4JI6F 4CP5A 2R7RA 1TL4A 5IQ6A 5KTQA 1NM2A 2NPIA 5J2NB 3OVAA 1TFWA 5KT2A 4K4TA 3TARA 3M6UA 1RWPB 3FVYA 4FXVA 2HFSA 4DZDA 3GB0A 2ASYA 2QGFB 3VAIA 3OTDA 3AQPA 2D3OR 1EARA 2LEPA 5KFBA 1RT5A 2F9DA 3NGKA 1GXLA 3JQKA 2PO4A 4AL6A 2HZVA 2B4VA 3FZBA 4M1KA 3PVXA 3W61A 3LP0A 1NJIT 1KKHA 3F41A 1NZAA 4TY8A 1I6JA 3QLHA 4HHUA 1H98A 2W8KA 3LQVA 1GMVA 2EFNA 3Q23A 3TAPA 1M5OC 1KHVA 1HFEL 2AEFA 2E5IA 5F8HA 2QYGA 1O8BA 2F5GA 2PC6A 2QV6A 4OYIA 5B0GA 3DLKA 1SUQA 1NHVA 3LP2B 2OSQA 4JI5F 4HT7A 1GT8A 2OEMA 2QT7A 3L7PA 2ZHOA 4HACA 3RG6A 1S1WB 1OSCA 1VQSA 2PA3A 3FEZA 4OZNA 4XIUA 4DL6A 2E66A 1B0VA 5KG5A 2QFJA 2X7IA 4ZVQB 3UVJB 4ZMMA 1F3FA 5RUBA 1RTDA 5CYQB 3GJRB 1CULB 2HEKA 2B4UA 2HAFA 4F0HA 4F04B 1NPPA 1S6PB 3H5XA 2BV3A 3NOCA 3KUGA 4CQ1A 1R89A 4LFBF 2YKAA 3D1OA 1H0HB 2VH7A 2ILZA 4O4GB 4U8YA 4DI6A 2D41A 5DQGA 4MK9A 5ETLA 5EDWA 1VC6A 1BUXA 2RIJA 1ITPA 1FVSA 2DXDA 1VFJA 4URSA 3UD5A 3VQSA 3AJDA 2RNEA 4U7UK 3R97A 3VAJA 2HHXA 3N6NA 2YH0A 4ED7A 4NLVA 2DGXA 2VU5A 1CC8A 3VTIA 5GAGI 2F4VF 2AGQA 4WWSA 2V8DA 4LF7J 2ABYA 1S6QB 2CZ4A 3I5AA 2R7UA 3HFZB 1F60B 4U95A 4JYAF 5HATA 5IXUA 2MZTA 2VFUA 3D68A 4DL3A 4K4XA 2Z2MA 4P7VA 3D7SB 2HBQB 3HT3A 4M5DA 4B3TJ 3U1MA 2HZCA 1H6KX 3HJVA 2ATLA 1SJ3P 3R5DA 4DFMA 4A8OA 1IXKA 3VZHA 3J7A1 2ZWPA 4AUKA 4JYAJ 3FRZA 1TVRB 5DZ6A 5DM7Q 1Q8BA 4N7TA 5EX0A 3NMRA 2YPZA 3FBEA 4CT9A 4F0MA 1X4BA 4QU7A 3HKWA 4NLSA 4C98A 4L73A 4FBUA 2BVZA 3W5XA 2ZUAA 2DD8S 3DLGA 3BJYA 4WJBA 1XC9A 1YLXA 1QE1B 4F26A 1B64A 3I4PA 5DG8A 4MIBA 4R5PA 4RW6B 2XLIA 2VBYA 3JSMA 4LR8A 4NI2B 3GV5B 2HHHF 1SBRA 1JLCB 1VBKA 2H4YB 4GVBB 3EVWA 3CF5Q 3TX8A 2J7UA 2IJFA 2KU7A 4DX7A 3DM2A 4QIGA 1X4FA 1SJRA 3RW7A 1DTTB 1KR4A 1HI8A 1NDLA 3MUTP 5LOQA 4EBCA 2G2OA 3I9ZA 2B4PA 2M88A 2GFFA 3IS9A 1HBMB 1S1VB 2ZJQQ 3I82A 3OUYB 2KFZA 2H5JB 1AZSA 1PYTA 1W26A 2HK3A 2PA8D 3BPSP 3N79A 3CO9A 3SBMA 3UI3A 5KT5A 3CMAS 2J76E 3LANA 5KFHA 5L1JA 4DR4J 1GH8A 4PQUB 1RWOB 2Y8YA 1UWBB 4B3MJ 2UXBJ 2YKOA 5CD4A 2WVDA 3GG0A 2BKOA 1RTJA 2VHGA 1RAIB 4LF2A 2BA9A 1QJHA 2L9DA 1ZM4A 2KVIA 3KK1B 4RW7B 3FC9A 2CDRB 3UN3A 3JYTA 4QWDA 2NREA 1RACB 2N4CA 3HX9A 8RUCA 3OSPA 3QWPA 4JUZA 2I9SA 3H5UA 4DX6A 4X65F 2AJ0A 3DFEA 2QL7B 2L9NA 3PKYA 4F4WA 1V9OA 2OJ3A 2YXLA 5I4MA 2VG7A 1X4CA 2EG2A 4HTIA 2R8JA 2A0FB 2HFOA 2GX8A 2V2ZA 3U27A 3HZEA 4OYPA 2RKIA 2MMYA 2BW2A 1S6PA 1V6HA 3K7RA 3QGHA 1ZAXA 2MXYA 2IIHA 1HBUB 3E01B 3MR7A 1TKXB 3SQOP 3U1LA 4DR2J 3CCQS 2IM1A 3ICLA 3Q8VA 3EWGA 2P2CB 3U02A 3FMBA 3SFGA 5HVFA 5MAOA 4OYWA 1RXOB 3G86A 3KJQB 3CNQP 5KFWA 4B9NA 4W92B 4DX8H 4M94A 1GXUA 3PR4A 5HVHA 1VQOS 2GVDA 4PXDA 2C2KB 2FHKA 4K59A 3KK2B 3KMQA 2C1EB 3IO1A 4M5IA 2FJDB 4TXSA 2ZC3A 3CD7A 3OFEA 4YDDB 3AD9C 2ZJPQ 1AW0A 2HWHA 2V2VA 3MM9A 2GGPA 2OSRA 3WBZA 3OQ2A 4Y2CA 3TZXA 3K57A 3IG1A 4DQSA 1DQ8A 3HK2A 3C19A 5IC6B 3G6VA 3DNCA 3RUBL 2OI2A 1JMTA 5DRKA 3HFKA 4JOUA 4C11B 5JUMA 1N32J 1JLEB 5CHCB 3CUNA 3OFHA 1WG4A 2LDIA 2V8VA 2LA6A 3H59A 3FMWA 3NGDA 2PMHA 2WB4A 4TU7A 2BXJA 2AJFE 2CADA 2ZOFA 4FVCA 4ZN3A 2KKHA 3ENAA 2I2YA 3KDNA 4ERDA 3PTWA 2XMUA 2DIUA 2Y1IA 3CDBA 3MPWA 3US5A 3PY8A 3ETMA 2N7CA 4GC6A 1RT7B 1U8SA 3BKFA 4R5PB 2Y8WA 1LW0A 2HURA 2FUG9 2EKNA 4ER8A 4LF6J 5H9EK 4DR4F 1AROP 1S1UB 4EI2A 2G2ZA 1Q86T 4PWDA 3ZNUA 3QLHB 5IV3A 3B4DA 1FX2A 2EFQA 2OTLS 2Q3PA 3S1TA 5AE1A 1IBMF 3TAQA 3KWMA 3V2UC 4WU2A 2ZH1A 1N32F 4ZPDA 2HBRB 5IWAJ 5KFSA 2EFOA 5BR8F 4Q0BA 2BJ1A 4G1QA 4DL7A 2DNMA 4IOBA 4PG4A 1YWXA 2N3OA 1OSDA 1N5SA 1RT1A 4NXNJ 4UOCA 3A1YG 4IQXA 2VOPA 1OWXA 1VOMA 2Q43A 5EUHA 4NEZA 2KJVA 5CZXA 2QMUB 3SFUA 5HQ8A 4A8MP 5K8PA 3G6YA 3K58A 5I42B 3UCUP 1RTDB 4QU6A 4X4TA 3L4BC 2CPEA 2R7XA 4WU3A 4XPEA 1H2TZ 4CLUA 2I6WA 2AT1B 3SV3A 3POTB 2HFVA 1HWJA 2DNKA 2PMWA 3MR5A 1N48A 2E29A 3OPKA 4H4OA 4KGZB 4L76A 5A8RB 2R7SA 1MNEA 4L3NA 4PQAA 3KHLA 2KZZA 3J80Y 4LF5J 3MGJA 1IBCB 2HKEA 4TU8A 4XK8C 1UJ5A 4USUA 4BC7A 4BHQA 3H4DA 4JI4J 5D3GB 1O5JA 2B8PA 1JLBB 4WBFA 2HRUA 5ETQA 3NCRA 2RMLA 4ZLLA 2BQRA 3LUYA 3ONQA 4FF1A 1NK6A 3PJ9A 4I68A 4IFVA 3U7JA 5IV4A 2AHOB 3GIIA 5GADU 2W9CA 1T9XA 2DR6A 3FJ2A 4OZ0A 2XBPA 3GPAA 2XS5A 3KJNB 4ECTA 4IR9A 2L9WA 3M30A 4HDHA 4FYDA 1RLCL 2HS4A 2B4OA 1J5OA 4ZCLA 4I67A 4I2QA 5KG4A 2VFTA 3CMQA 3M7VA 4NYPA 2J8AA 1SUQB 1N34J 2OPRA 1IVZA 5ADZA 3BGOP 1JLGB 4F4KA 2UXCJ 1S6UA 2EEYA 1TK8A 2LCWA 3SMZA 4RL1A 4X4UA 1N8RT 2YKNA 1F2HA 2GIQA 2UUCJ 1ZPWX 1DTQB 2V2QA 2NXCA 4AL7A 1T9VA 1FKPB 1R3NA 3NEKA 5THWA 4J9VA 2DH7A 4Z2XA 1YTYA 3AOAA 4KYZA 1FF2A 3CO0P 4DV0F 2V69A 4OI6A 5KT7A 1PSDA 4WP8A 1KTQA 1UW9A 2Z56B 1C0UA 2EWHA 1FESA 3OJUA 1VYAA 4ECWA 3WC0A 2K1RB 3KG0A 5D0GA 3R3TA 1SVDA 4DPWA 2CUYA 3DRPB 3Q8PB 3HHDA 1N6QB 3GMGA 4CT8A 1CJVB 4R25A 4QWBA 5LT5A 1K44A 4OYXA 4WYWA 1YJVA 5K14A 1RJJA 5DDRC 4FN5A 1QSLA 2E1AA 1S4FA 4ZK7M 5CZVA 4M8LA 1XIQA 1OY8A 2W2QP 3M8PA 5J2QB 1QTMA 1K73T 1KBRA 2BJ3A 4GVLA 1UWBA 5C25A 5DQHA 4JI0F 2FLLA 1VGYA 3QGIA 2WK4A 4PAAA 1M5SA 4ZLNA 3NS6A 4CNZA 3LPEA 1LXJA 5B09A 1NDCA 1WUUA 2CPHA 2JLFA 1U1OA 3AOBA 5SZTA 4YP3A 2YWWA 4LRFA 4L3KA 3UD4P 3KK3B 3BM7A 3ZNJ1 3ZTOA 4N5SA 4LF9F 3JYTB 3DOKB 3GE9A 1UFLA 4YHHJ 2AZ1A 5ETKA 5T7LA 3MMJA 2R2TA 2FY8A 3DOLA 3KG4A 4F67A 2PFDA 4MK8A 1A6LA 1JLQA 3D6HB 4B3TF 3CJ8A 3P6YC 4OLPA 2OAUA 1YG0A 4NI2A 1CJVA 1KONA 1JLCA 1XMQJ 1Q8IA 2BDPA 2APOA 1PG5B 3H8YA 4TN2A 1FERA 1WF1A 2B3TB 3FKBA 1C4CA 4HI2A 2R2RA 2OHDA 6FD1A 2M8HA 2F4FA 1VRTB 2RQKA 5DQIA 4F4XA 4C3LA 2W25A 4P9SA 2YKQA 1NDKA 3D0IE 2ZD1A 3NGRA 3I0SB 1OIAA 2FDNA 2CQGA 3UW1A 5B08A 3CD6S 2A2CA 1FJCA 3UDVA 3M8SA 1X0PA 1S57A 3P5TL 2D9PA 3DLBA 2COLA 4P2XA 5A8KB 2NS1B 2O67A 1G1XA 4PXCA 1UAWA 2HBYB 1AA1B 3EGVA 3QGGA 1E6VB 1HNIB 1OYEA 1R8CA 2M2BA 2YWFA 4USHA 5KFRA 3TOQA 3ITHA 2P9EA 1IBLJ 2FLOA 5ETRA 4UY85 2LEAA 1J5OB 4H4KC 1MMLA 4IOAQ 1HNZF 2MLYA 4EZ6A 2HIYA 1N5QA 2Z2ZA 4TNOA 1UZDA 2XY5A 4O44A 1ZM3A 1ZTTA 5FLXU 1VI7A 1T9UA 2KM8B 3MFHA 3WQPA 5B0BA 4JV2A 3G2XA 1OQ3A 3Q83A 5D4PA 4Q5VA 2E5GA 2NSCA 2YNIA 2RU3A 1YJRA 4K7QA 2ZM6F 3ILIA 4QYZK 2ZD1B 3NMAA 1VMBA 2M9KA 1RT3B 2H48B 4FYWB 1Q78A 4LR9A 2ZOMA 5KFZA 3W66A 2DR5A 1Q4RA 4OMFG 3I6PA 5H1SV 4BWMA 4NLRA 3DGVA 1D3WA 3H90A 4W4MA 5DDPC 5EWEA 1LV5A 1T05A 1IKWB 1MLAA 2FQQB 4CYUB 2HHPA 4J9UE 2B7CB 3T6JA 1BQMB 5LJ3Y 1RBLA 1FRJA 1XMOJ 4RW8B 1TK5A 4ZVOB 1Q53A 2PE8A 1UKUA 2BM1A 2MKKA 2C2MB 4NLPA 2JFDA 2O66A 3L09A 2HNZA 4F4AA 2AJQA 2VV5A 1NH7A 4QR2A 2UUAF 2EC0A 4FS2A 4HT5A 3OTEA 3JB9k 4B08A 2FVPA 3GG1A 4HEA9 4USJC 4EO8A 4K4WA 2XMMA 4DG1B 2V0NA 2HRYA 3V81A 3TI0A 1KD1T 2VOOA 4QCLA 1RHRB 1CQNA 3CJQA 1FT8A 3KLFB 3M2UA 3MFIA 2MGZB 2HQDA 3VAHA 3CW2C 2ALZA 4GRSA 3O2IA 2KTQA 2MQQA 2B0GA 1R8AA 2YWGA 5AXLA 1TKZB 3A8JA 3GIMA 5KFDA 1FDBA 5DLGA 1GK8A 4LIRA 5HAOA 3OL8A 3HP6A 1VQKS 1XNQJ 1U0HB 1F1BB 2OD6A 1MMNA 3GR1A 1KQSR 3OXLA 1KS2A 2DISA 2CDQA 3M1VA 5HANA 5KFOA 3N4WA 4DUTA 1TL3B 3EDRB 1XJWB 5G4DA 4DLGA 3GCWP 1DQ9A 1FWLA 3IP0A 1R8BA 3S6EA 2YTCA 4OHXA 4OX8A 5IOLA 1GTEA 3VF0B 3M9OB 2DO4A 2P9GA 3CVKA 2VG5A 5KFFA 3MPDA 1T0TV 3FZ2A 4G65A 3Q0AA 2NXJA 1X9MA 4IRCA 1RABB 2DY9A 4O4RA 5HBMB 4USTA 4HTJA 3ZZYA 2UVUA 1D0EA 2AF6A 3MM9B 1GMUA 1RI7A 1XERA 3DRRB 3JTNA 1S1WA 1FX4A 1OS5A 3W1YC 1EP4A 5LMUJ 2UXBF 2HQIA 2NUUG 3B78A 4CNYA 2RSQA 2DNHA 1UA1A 2CQ4A 4CO2A 4D3HA 2MB0B 2G1DA 3G4SS 3ZO7A 4DR7J 4AXIA 1S9FA 3G82A 1TL7A 2J0SD 4MIAA 1YKWA 2FJAB 1X0FA 3E2EA 2ZOGA 2C28A 3RBZA 4QIFA 1VCTA 3MR3A 4WFBQ 2VODA 1BC6A 2V8HA 4ECQA 5KOWA 5D4OA 1S1XB 1J27A 1XR6A 2DGWA 4KC5A 3MMAA 1X5TA 1BGXT 3HVWA 2JWNA 4ZJQA 4KH1B 3GWCA 1L3KA 3I4HX 1TK0A 2R2SA 2IJRA 3ISNC 2J9DA 4YOEA 3TWZA 4RLEA 1PO6A 1FKOB 4N8OA 3DMJB 4BC9A 1X4AA 3MM7A 5KFEA 3O3LA 1NXIA 2BJ9A 2FD2A 3DDNA 4B9VA 1TAQA 2CAJA 2H5EA 1RT3A 2IAJA 2AX1A 2ILYA 3MMCA 2HHQA 1PGZA 1NJWA 3M2VB 4TYBA 3CSKA 3WX4A 4ZVEA 4KY3A 3M8QA 1MU2A 5HMYA 2QLJB 3SCKE 3QAEA 3NRBA 3NBPB 2FLNA 3QT6A 3GILA 5I3UA 2JNJA 4FXDA 4CM0A 3MXHP 1LWXA 3MAAA 1H38A 1NLKL 2GAGC 2ZNYA 4PXBA 3MCNA 4A8XA 5IT4A 1UFKA 1HKAA 4ZVTB 3M9MB 4KTQA 4K50A 1WSVA 5ETSA 3AQOA 3IRXA 4P2SA 4FVMA 4DSIA 1GTHA 1VRQC 9RUBA 2ERRA 2AMCB 2NZ4A 2HVDA 1A0OB 3GTYX 1RWXB 2FZGB 3UPFA 3UN2A 4OJGA 1QAYA 4UUWA 4ZHRA 3AXKA 4J37A 4URQU 2C3YA 3SYZA 2HPUA 3SV4A 4AQYF 3BDPA 1C1CA 1X5OA 2UV8G 4C8ZA 2DNPA 2VPXB 2W1BA 5EN1A 1O0PA 2PFFB 2VC0A 3OUYA 2RH3A 5ETVA 5M2UA 4M5KA 1RYRA 1D9DA 3JQJA 2ZKUA 1PAUB 1NCLA 3W5ZA 3ZZPA 4XO0A 5K9FA 4NLUA 4PG5A 4URGA 3IWXA 2E1PA 5C25B 2ZBPA 4P71A 2OIHA 3UNYA 1MWQA 4TLQA 1AUSL 1Y10A 4G1PA 3IM9A 3NLCA 4RNOA 2V67A 2KL8A 3RB0A 1VHIA 1N36J 3IFEA 4GC7A 2CIMA 2BOAA 4C48A 2V4QA 2JLEA 2XMKA 1IKYA 2JEGA 4ZVRB 1TUWA 2DGUA 3AA8A 4KAIA 2W24A 5KFTA 4ANEA 2GA7A 2GMHA 2QIFA 3MECA 4NLOA 4R0JA 4EGLA 4EO6A 5HROA 3PRDA 1WDTA 2B7BB 3W7BA 4Y0FA 5BYQA 3EM1A 2NPFA 5L39A 1NK4A 3H98A 4RW4A 1S0VA 5IWAF 1EB0A 1H2VZ 4KO0B 5BR8J 3EE3A 4UOGA 3CCVS 3ZZUA 2V2KA 2DGTA 3T1YJ 2K1RA 1DZ5A 2DNZA 2HZAA 1T7PA 5A0YB 3N5FA 3PYFA 1S48A 4E8UA 2ZBCA 3BB5A 3PJXA 5I3PA 4DR7F 4DPXA 8AT1B 1H72C 2VFSA 1RUSA 5K8OA 4JI8J 2VF3A 3TANA 2HAIA 3CPWR 4JI1J 2VASA 3PM9A 3J7AN 1P9YA 3QZ7A 1N5YA 1EX8A 3KLVA 2XLKA 4LSNA 3MF5A 1ZA2B 1Y3KA 2B9EA 3AD8C 3S7RA 4DDFA 3HMJG 4ED5A 5LSRA 1QD1A 2ZDOA 2FJWA 2DHAA 1U7LA 2X1BA 2HQFA 5EHHA 4TQRA 3PW2A 4IDKA 2XZDB 4OV1A 3GCXP 3M9NB 1V3ZA 1FRKA 3IMQJ 1NAQA 1U6ZA 3CWJA 4NXMF 1REGX 1W2BR 1RWWB 3VZIA 4OI3A 1VBYA 4OX9F 1NK9A 3MCMA 2HS3A 5KG2A 2HHHJ 4MKYA 3H4BA 1RT4A 2VQEF 3QJJA 3MUMP 1NNDA 1CQMA 3NOGA 1YI2S 2WOMB 1SC3B 5HI7A 1GX6A 1RZMA 3K8WA 1PJ5A 1NZ8A 4C3KA 3BGUA 2BE2B 2HIQA 3CJRA 4OHZA 4O4GA 1NRKA 3HHLD 4UZCA 2BR0A 4CH0S 2PN6A 3G8QA 4M5DB 2HBZB 3EZUA 1RT7A 2V68A 4MKAA 3I32A 1LW0B 2IBOA 2EBEA 1BQNB 1P6TA 2FTRA 2MZRA 4KT0C 3SXLA 5KFXA 3HM9A 4KKOB 4WK3A 4UTGA 1Q79A 3R5GA 3HJFA 3TVKA 4LVNP 4OHVA 4K4SA 3QO9B 2RS8A 5BYRA 4ZA1A 3MEGA 1VQ6S 1EJ7L 2VG5B 3FGVA 3AT1B 4O3RA 2ZC4A 4XAKA 2BKPA 5GMKa 4BWJA 5J2MB 1RB0A 4RUHA 4X4SA 4Z37A 5CA5A 3KNAA 2Y3YA 4G1QB 5E41A 2HHVA 2D3UA 1SH2A 1ZZFA 2EW9A 2VB6A 3BKUA 3GONA 4ZVFA 1R0AB 4OV6A 1K9MT 4P73A 3NNCA 2IMOA 3T5LA 5HJXA 4LVOP 1U47A 5H9FK 3OR2B 1YRTA 4JI0J 3UQSA 4QW9A 4X66J 2GQ2A 4NLDA 3LW5C 3MAQA 1IBLF 2K7JA 3G71S 2R4FA 3KKFA 4CO4A 4LRDA 2QA4S 1BMQB 4IG3A 4XTTA 1V3RA 2I1RA 3GU0A 1WEYA 4MFBA 1HQEB 3W8PA 1L3UA 4DN9A 3R6GB 5C42B 4PQUA 2D9OA 4BBYA 5LMNF 2OP5A 3DLHA 1L3TA 3R27A 3V6HA 1VQMS 3DLEB 4DL4A 1OO0B 5ETMA 1JK9B 2XY6A 1YVFA 4DL2A 1S1TA 3PX0A 1KTVA 2FVCA 4K8RA 2E5JA 3M32B 2JFKA 3BSAA 3OSNA 4DV2F 1HQ2A 1R31A 2PD1A 3O44A 1F5AA 3RBXA 5A2QU 4QYRA 1M1GA 4TVAB 2LKZA 3D3BJ 4IG0B 1FNMA 2QMWA 4RJVA 1BQXA 3OV7A 1VQNS 4B3RJ 3CGIA 3KNGA 3ULHA 3J7YU 4U67Q 1Y5NB 3WZ0A 2YPYA 3B82A 3F44A 3UVJA 1YJ7A 4FP9A 5F9LA 5F8GA 3T5HA 2FLPA 3VV2B 3J81Y 1IWAA 4DR1J 1IR1A 3NWGA 1WEZA 2H3EB 3FK4A 4YB5A 1FXRA 2XO7A 3HHLC 3C14B 1FE0A 1TZ0A 2RKIB 3RB4A 2E7WA 4NMLA 4IDKB 2W9BB 1FXLA 2C3UA 2QC3A 2MGZA 2VICA 2I38A 1TMMA 4NZ7A 3TA0A 4K4VA 1XMQF 1HA1A 2R7OA 1B70B 4NE9C 4UZBA 3KJVB 2HHTA 4GMKA 1NUEA 3JSYA 1UVNA 4F02A 1VQ7S 1DJ0A 4OZ2A 5LMUF 1X4GA 2BBEA 1X31C 3M1VB 3TYTA 3Q8RB 3OLBA 4USIA 3BYRA 1GAOA 3BSCA 5E0OA 3MEDA 2KYXA 4OX6A 3MM5B 2W4DA 1IM4A 5FLXY 4LBPA 4LF9J 2FVSA 2EI5A 2G2YA 3E01A 4OZ5A 2ZZTA 2HGNA 4B9TA 2A18A 4NOHA 1WG1A 1P1LA 3FSXA 4N77A 3KDOA 4AL5A 3MD1A 3CDUA 1ROFA 2XO6A 1FVQA 2IVYA 1TL1B 2YQ3A 2HW3A 3CJ0A 2ZBQA 2V50A 1FNOA 3BN7A 4F3QA 1UP1A 2KG1A 4ZOSA 1JXVA 1FDDA 3GJQB 3TZYA 3H20A 3DOMA 5KFYA 4G3IA 3DOKA 1IKYB 2MSTA 2K06A 4V19J 2IM3A 2MZSA 2DNRA 2AIRB 1RK8A 1D8ZA 2IRXA 1MWYA 1RU1A 1TQLA 2LP4A 3G87A 3HD1A 3IBWA 4WXWA 3R7SB 4CLTA 2EXUA 1FTCA 2FIUA 2QSWA 4U7CA 1G6BA 2W8LA 1WKJA 2V5HG 4N8NA 4RW9A 3P4UB 2I5JA 2QA4G 4MMOA 4KGXB 4Y34A 1TUVA 5AT1B 3CJ2A 4LBIA 1YJNS 4UY8T 3DM2B 2VKZG 2RAQA 1DTTA 3A8EA 1RT2B 4GKKJ 4I6WA 3GFZA 4TQSA 4XPCA 1ZYQA 2G0CA 4QWEA 1WOOA 1HNWJ 1ULRA 2YVSA 3LP1A 2ZEJA 3HXMA 4KGVB 3IWLA 4LMZA 1VLYA 3LGHA 4EEYA 1R0CB 1EKSA 2M52A 3DDKA 4FDFA 1P8GA 4K5RA 4M5NA 4OZLA 1M5VC 1HBUA 3T1AA 3TAMB 1T95A 3FBCA 3KHHA 4EWTA 2XGPA 1LFPA 1Q16B 3LO3A 2C2NA 1WC1A 3T6BA 3TR5A 4CO5A 1PJ6A 2DHGA 1W25A 2QG9B 3QPIA 4DUYJ 4ZVUB 5IM0B 4LFCJ 4NRTA 4KHPF 1TVRA 1B7YB 1X7VA 2JSXA 1JLFB 1EAYC 2VG6A 5IZHA 5HQLA 3V6DB 2MLZA 4DWIA 3EGWB 3FNNA 1X4DA 2MQPA 2XMTA 4DBQA 3R7BB 2MTLA 3Q22A 4M5JA 3BO2A 4R8UB 2WBRA 1K47A 4IOCQ 4CM2A 1U0SA 5B0AA 3TZWA 2CQPA 2CJBA 1JLBA 3K5OA 4E2FB 3FQKA 4YY3J 5HROB 1HLWA 1X4HA 1XN9A 2NZCA 4YR0A 3G96A 1HD0A 2LVWA 4J9NA 1JXEA 2JOQA 4RBTA 2CQ1A 2YNFA 4I2PA 3SSSA 2JEIA 3WIUA 1KLNA 4TLRA 2DR9A 4DPUA 2DGSA 3HHKA 3SEOA 3M30B 3MCSA 1M1HA 1FFSB 2BJDA 2FZCB 3POTA 4Y2KA 4DXLA 1S1VA 2PDAA 1VR6A 2HLUA 3BGFA 2HVZA 3RAMA 1APSA 1BWVA 1RAEB 1RCOB 2WAQD 1MROB 4J7CA 3CCJS 1CSJA 1SB6A 1KDNA 1C0TA 1BD6A 2OPRB 2QJ3A 3MM6A 3GR0A 3BF4A 2A2DA 3NS5A 3PACA 4WFYA 5ETTA 1DY3A 2EPIA 2LQ9A 3TVYA 3CCUS 2FJBB 4I1TA 5CQGA 2CQCA 2KI2A 3KLEA 3M4XA 5C2CA 5EGYA 5HLFB 2QZ8A 3MEEB 2HFZA 4M5HA 3T41A 1S77D 3UWTA 3CEDA 4IUFA 4OL8A 1Q1KA 2XSFA 4CDIA 3MM5A 3ZTSA 4NYOA 1R0AA 2JHEA 1HBOA 2EC2A 3CCZA 5LL6d 4Q45A 4DFKA 4MYUA 3C2PA 4RNHA 3V4MA 3W8GA 4NCGB 4YB6A 1M90T 3JXOA 1DQAA 1R8HA 1ZAWA 2CJ9A 2KO1A 5T7LB 2DPJA 4DSJA 3NXZA 4QIWD 4J9LA 4X62F 1RADB 3SDEB 1VQLS 2RDDA 4RNNA 1UZHA 5CXTA 1RHUB 3I56S 4KIAA 1XNRF 3HHNB 1LWFB 3MM6B 4ILMA 1DURA 4FF2A 1VRUB 4QYZJ 1RTZA 1H3DA 1S1UA 3D3CJ 2DJWA 3RRKA 1L3SA 2DR8A 4PYDA 1CJTB 3NP5A 4MTPA 5GAEU 1NPRA 3SI8A 3NWRA 2Z57B 2CPZA 5HJYA 4ED8A 4E98A 2R7TA 4AD6A 4CLSA 3CJ3A 2RQMA 3ZZTA 2HG4A 2V4RA 4TYAA 1WNEA 2YKMA 4ID5B 1WC3A 4H54A 4IFVB 1DAXA 1SV5B 1SKRA 1FD2A 2NXEA 3P45B 4ZPBA 2YNHA 5M2RA 1TELA 4NCGA 1URRA 2AYGA 4ED1A 1SC1B 4A8QA 4I56A 1RWKB 3RBDA 4QR1A 4ECUA 2X1FA 4A48A 1UEKA 2XS2A 2H4WB 2B43A 4IRDA 2W7AA 2CVEA 2MY7A 3LWMA 4PUOB 5L9XA 4DHVA 1WWHA 3H2VE 3M2RA 4I64A 4N56A 4LF8J 1FDAA 1G4CA 5M2PA 3THVA 3DU6A 4IRKA 4QIVA 2B5JB 1IJEB 1T94A 5KG0A 3BH6B 3D0HE 4NA3A 2AX0A 5LSOA 2KFYA 5D0HA 4NLGA 1FEEA 2MQLA 3HI9A 3AJ1A 4HH1A 2R7WA 1UEUA 1HWIA 2C2ZB 2RF2A 3P96A 4B02A 5B7WA 4AQYJ 1AXQA 1YDLA 2D3ZA 2CG4A 2F4VJ 3OTCA 2GIRA 5A6WA 2BM0A 2X51A 2QMXA 3GYXB 5CH7B 1WDDA 2ZFHA 2UVRA 3LWLA 4M5MA 4QPTA 3NKYA 1T03A 4ETXA 1DFDA 5LJ5Y 4DV3J 2LQBA 3BREA 1PCAA 1D9FA 1R8PA 3H0PA 1OPZA 2BZ2A 2CPXA 4ILLA 1VRTA 4OFZA 2QE5A 3HZGA 1D09B 3CIZA 3ITHB 4B3RF 3DRSB 3ENWA 5CABA 3SIPB 2JEFA 4K0KF 3NCPA 5L46A 3PW0A 1U49A 1WC5A 1TKTA 3QAUA 5DO2A 2N82B 1N33J 2FVRA 2RUGA 4BDPA 1SL1A 1T3OA 3R8YA 3V4IB 1UVMA 2DKOB 4DU8A 4JI5J 9ATCB 3VVTA 5HMWA 4WCEQ 4ELUA 2M0GB 2Y1JA 1VQ8S 3T1HJ 2GZOA 1CS4B 4TKTA 4ZIWA 1FHTA 1HWLA 3CTRA 4NX9A 2WZ1A 2J0XA 1U2RA 3LTOA 3K59A 1KVJA 3EX7B 4FKXA 1CPZA 3AB2B 4C8MA 4YQWA 4NWBA 4OYMA 1XMOF 3I0RA 1FRHA 1PBUA 2RQ4A 4DV1F 1VBZA 4LFAF 2CQ0A 3K2YA 3PKMA 4CWBA 5LXYA 4OHYA 3CCTA 4ZKAA 2KN4A 4FYXB 5JMNA 4DV0J 4JI3J 2IA0A 3LAKA 2XCPA 4U6PA 1CVJA 2DY1A 4DLEA 2W4PA 3I9V9 3D6TB 1WI6A 4QWCA 3HVRA 4J9QA 4DV7F 4LQ3A 4DV7J 4IO9Q 2VFVA 4JI4F 1YRUA 4FF4A 1XNRJ 4X4QA 4RUBA 5DDOC 3KTQA 2WTFA 1U1KA 2DHXA 5JJBA 4ZCMA 2BANA 1DBDA 3PX6A 4LF6F 5E33A 5HVGA 3EJMA 2VBWA 4F4YA 3D67A 3OR1A 1RAGB 2MQ8A 3W3SA 1RP5A 4Q8FA 3UCGA 3L3CA 2M3DA 3IXQA 2CKWA 2Q1LA 4C0BA 2CQBA 2LEBA 1JJ4A 1HHQA 1HNZJ 3C46A 2GJFA 2DH8A 1KVIA 3LAMA 2HMIB 3FEYB 3I0RB 3PRVA 2JVRA 3KLIB 4Q44A 4DV6F 3K5PA 1V5VA 3ET6A 3MZIA 3EVMA 1NBEB 4LIWA 4F4ZA 2E5HA 4QZVB 2KDOA 2BOPA 3Q2TC 2F9JA 3KJVA 3H40A 4M5GA 4B3OA 3HULA 1U48A 1N88A 3S01A 4X4OA 3T5JA 1HYSB 1V3SA 1SH3A 1VIOA 4KHRA 2RD5C 3KYLA 4NLTA 1WOPA 3IGNA 2LU2A 3MMCB 4FNIA 1F5BA 3LP2A 4P2MA 4WYLA 3KG1A 5FIIA 3JAMY 3NAHA 5K14B 3PYGA 4O3OA 5D6GA 4A8WA 2FHJD 2ASLA 2HQCA 3AFGA 5JVGQ 1TFYA 4CI0B 3L9ZA 1PKUA 4NXMJ 1R6YA 1XTZA 2B56A 4NA1A 4O3PA 4WKYA 3HVAA 3GLJA 3RYLA 1SKSA 2J7WA 2CNOB 1FKAF 5ETNA 1S72S 4OI2A 2VUGA 4OYBA 2LXUA 4EK2A 4B9MA 4RBVA 3PW7A 4J5OA 4DR3F 2PMZD 3RAQA 4BLGA 1T05B 5ITHA 3A8KA 4WE1B 2U2FA 5J2NA 4EBDA 3KHRA 3PZPA 3H2LA 5GAEI 5KT3A 1FK9A 4LRAA 5K5MA 5B0CA 5K8MA 4ZS6A 4DSKA 2CNKB 2IY5B 3CDAA 4EYIB 4ZHRB 1NHUA 1JLQB 4PPZA 3SZ2A 3JSMB 3OT9A 1IBKJ 2JL9A 3KUEA 3TQEA 1FFGB 5BXIA 3OBIA 4LFCF 2YNIB 3T1YF 4HHJA 1XQIA 4FKYA 4TY8B 4K2XA 2O01C 1OJ4A 1DLOA 4HR2A 4NEYA 2RB7A 2A6MA 2F8EX 4WFZA 4JP8A 1NSQA 4ZITA 2BE2A 1GX5A 2JEJA 2NXNA 4CIOA 2VFRA 5E3PA 4CLPA 1H7WA 4L75A 2PSZA 1S59A 2XTJP 2ZHBA 2ZM6J 4PG8A 4EYHB 3CCWA 4OIXA 4HDGA 4DQRA 2HK2A 5E3AA 2PT0A 2WVEA 3LA0A 1HNWF 1TKZA 2D7SA 1VDHA 2N3LA 1MW7A 2Y0BB 3I87A 3NBPA 2IRYA 3PYDA 5HN0A 3I5CA 3PEHA 1UVLA 2B9XA 2XC9A 2RDJA 4KPYA 2QSFA 3N01A 3TUJC 1FJGF 4H4MB 2VQFJ 3DGPB 1CG2A 3JS9A 2BKNA 2GAHC 3L95X 2RILA 1HBNA 2QLWA 3MWBA 3H7HB 4DF4A 1N33F 1FE4A 1ZM9A 2UZAA 1S0NA 4I6AA 1YSJA 5AE2A 4A8FA 2GO8A 4RX6A 2W2PP 3MPUB 1FO1A 4QBUA 4K4YA 3EYZA 4UT4A 1QVFR 3ZTRA 4ICLA 5KG6A 3ZZZA 3T3FA 2HQGA 1PILA 1T9YA 1X8DA 1WC6A 2O5DA 1S7HA 1OY6A 1CJKB 3BR8A 3M2UB 3Q8UA 4FNHA 4MAKA 4ZP8A 3G6ES 1VQ5S 5CYQA 4C8NA 3BBBA 1QY7A 2AP6A 2L08A 1YX2A 3GIRA 3JQMA 1U25A 4XDDA 4Y28C 1W2IA 1U1MA 1N34F 3R2DJ 3M05A 2Y1LB 1NH8A 2CJQA 3AA9A 4PKDB 1YJTA 3ZTQA 1RWNB 2HMIA 1FJGJ 2Z2YB 2RQCA 3W2WA 1QAIA 2NSBA 2MZJA 1VRUA 2MEWA 2XCAA 4ATNA 2D1CA 1C0TB 4B3OB 4G1IA 3OVBA 3HSZA 2EK6A 3D2WA 1B4SA 1GXTA 3CJKA 1B0TA 3PIOQ 1NU4A 2OEKA 4AYBD 2K3IA 3QATA 4IH7A 1WSRA 5DS7A 1EETA 4A47A 2HVHA 4RUCA 5KT4A 3KK2A 3CC2S 4LF5F 4LJMA 1U1QA 2DXEA 5J2PB 2CPDA 4ICLB 1HNVA 2XLJA 2KRBA 3DXSX 1RT4B 4Z7CA 2OD4A 3MECB 1SL0A 1WTBA 2KB2A 3BQ2A 4DL5A 2DNGA 4DV4F 4OYOA 3BDEA 5HP1B 3MCOA 3LPYA 2AU0A 3IN5A 1RT6B 2RRBA 4LSLA 1F9FA 2KXHA 1MU2B 5BYSA 1JJ2R 2PI4A 1TKXA 1KEKA 2BJ8A 3KOAA 1Q81T 1X5SA 2V4JA 4LUBA 2WBMA 2NQPA 1EHWA 1R6VA 3OTBA 1AT1B 2CFXA 3SCLE 4DF8A 1TMJA 2WW4A 2CRLA 2X1GA 3CJ4A 4LRBA 4NRUA 1VQ4S 3GYNA 3A3NB 3UNGC 4C8LA 4ZJLA 5I3QA 5KFGA 4U7UD 4KE5A 3HKZD 2R8HA 2D3O1 4QQBA 2HRTA 3IRXB 1ELOA 1GNKA 5C24B 3J81j 4DSFA 1S0OA 1YBTA 2XYHB 4KJIA 3C16B 5D0EA 4UOHA 2VDIA 1DLOB 2L41A 2DO0A 3KLHB 3KK1A 3C66A 3IBFB 4J9MA 3RB3A 4K0KJ 4F36A 4NYZA 3IS9B 5E3RA 1RA6A 1U6BA 4O0NA 1Y7PA 2PGCA 2K7KA 2J6UA 3PG9A 1WF2A 2KVQE 2YWEA 3A3OB 3OFGA 2ZH5A 5C5JA 3ETOA 1S76D 2BW7A 3O6QA 4MJKA 1TL1A 1UW4A 3J7YI 2E1CA 4DV3F 2IDEA 1FWPA 2ROGA 2CQIA 3R5AA 4DQIA 1B0PA 1RTJB 2R42A 2XMAA 2VDHA 1TKTB 2G0IA 3DOMB 1R7IA 4O3NA 4EMDA 2MQOA 1Y0HA 1GMWA 3H25A 2WRMA 3VAGA 1FEHA 4DR6J 4CLYA 3DHWC 1BHNA 3J7Z5 2CNLB 5HL7Q 5E2QA 5HQMA 2AEMA 1JKHB 2G13A 1Y00A 3MR2A 1JB0C 2Q6BA 1HD1A 4LT6A 2AQ4A 1U45A 2R9LA 1KVKA 2G1HA 3KHGA 1KN6A 4OQJA 3BZQA 4GKKF 1VQPS 2FY1A 3AB4B 1S79A 3BO3A 4X4VA 3MPVA 1FKOA 4YR2A 3K5NA 4ED0A 3PHEA 3THPA 1UMJA 3QT5A 4RKUC 2UUAJ 3DKDA 3HF5A 3HHEA 1A7GE 4C97A 4WPAA 3ZFVA 1D1UA 4F2SA 2ZZNA 2HHSA 3G8TA 4Q8EA 2Q6CA 7AT1B 2DPIA 5A76A 1UWAA 3MMBB 1I51B 3PCOB 4KH0B 4ZVSB 1ZZNA 1IJFB 2DGQA 3ENVA 4OYAA 3OL9A 3QQCD 3MEKA 1WD6A 1IM6A 1VK8A 4RU9A 2OFGX 3CXCR 5B0FA 3M8ZA 2ZHAA 4Y3CA 4C2MA 3V6DA 2J8SA 1SH0A 4F3MA 2NR0A 2HHUA 2JZ5A 3MURP 3QIPB 3CCLS 1PC4A 2XEXA 3I96A 4PWWA 2G4BA 3FEXB 5DG9A 1F6TA 1SJ1A 2UUTA 1KOOA 1Q0NA 2HNYA 3CIMA 3PFOA 5CCMA 2MKHA 4LF1A 5J2PA 3P3DA 1I3OB 2QA2A 3NGTA 1FI4A 2HSEB 1Y11A 5HMXA 2AW0A 3BEGB 3ZC4A 4O3QA 2LXFA 2E1RA 1HI1A 2J0WA 3EUNA 2E5LF 3UN5A 4NLWA 1Q7YT 3CDWA 3QSYB 3THTA 2DRDA 2MY8A 3KXDA 4LSLB 2AYMA 4PWUA 4ZP6A 2MYFA 3IC1A 3PR5B 4EZ9A 4OZJA 2M70A 5CYMB 1LXNA 3ZZ0A 2YQ0A 4NZ6A 3TVZA 5KFPA 2F3JA 2E9RX 1D8YA 2XI2A 1F3VA 4FF3A 3Q8QB 2M8DB 2UXDJ 1F9EB 2CJYB 2ZVSA 1RT1B 1UPPA 3HCXA 3QYYA 4PCQA 8ATCB 3JSRA 2YKNB 1LK5A 1PAEX 3QFHA 2QRRA 4JI3F 1RBAA 3SCIE 5KG3A 4C8YA 4YR3A 3M32A 1R27B 2YWHA 2W9AA 3NG8A 1K1SA 5KAKA 2B6AA 2J5AA 3N6MA 4LFAJ 4EBEA 2VA3A 4H4OB 3ISND 5IC4B 2CJXB 5A8RA 4ECZA 1QUVA 3IAM9 3R6LB 4USWA 1Q95G 5D4LA 2KZMA 2GW8A 2X3GA 1FWKA 2XMWA 5KFNA 4Q0BB 2E44A 1U1LA 1RHKB 3CCRS 1ZPVA 2R7QA 1FK9B 2WB1D 2YX7A 1Y4ZB 3T9NA 4DV4J 1CJUA 2H65B 1WJ9A 3BSOA 1N6QA 1NMEB 4P74A 3CE8A 4YB7A 3HDSA 2C2EA 2N7YA 3GP9A 4C11A 3C15B 2IDLA 3VVUA 1C4AA 1VISA 3VAFA 4DR2F 3RAXA 2CQ3A 3HVTA 1U09A 2KT5A 2LQJA 1N5VA 2J9EA 3QFWA 1TTHB 3PXGa 3W60A 3Q86A 3KLHA 5LSLA 2GJIA 1REVA 3TQ1A 4P72A 1QLNA 2VPZB 3V6JA 3HFVA 1CJTA 4YHHF 1JLGA 3ILLA 4MFBB 5KFIA 1LWCB 4AE5A 2QLXA 4J90A 3KJFB 4DCOB 1RYSA 1EQ0A 5F3ZA 1ACMB 5I3UB 3K8VA 1URNA 2F40A 2BACA 1ZTWA 3WIVA 1AYEA 2LFVA 2M7SA 4RUAA 2OPSB 3QT7A 1S6OA 4HLBA 4RW9B 4EFAC 2RHSB 4P2FA 1WC4A 5KT6A 4S0MA 3EDQB 3J80U 2OPQA 1H2UX 1IN0A 2BMBA 3AODA 3GFXA 3LH2S 4GO5X 4HHHA 1VIXA 4IKAA 4ECSA 3KLFA 4ED3A 4IR1A 3C6TB 4N41A 3CB4A 4RWWA 1JWWA 2WOMA 4A8YA 2EFVA 2ZUGA 1QM9A 2CVIA 3LP1B 3UCZP 2DBBA 1HW8A 2H9ZA 2LECA 1HNXF 1YGYA 3LGMA 5C42A 2AEJA 2XMVA 5MLCV 2KJWA 2XHWA 4UQTA 3GJTB 1YITS 2J9CA 3VQTA 3KMSA 1VJWA 3NGUA 3ADAC 2UVWA 1VQ9S 1I1GA 2WONA 3MEEA 1HW9A 4C4WA 3BSNA 3VCDA 1RU2A 5J1EA 1RT2A 1E6VA 1HNIA 1Z1ZA 2HFUA 2GMLA 2I0XA 4MKBA 4X66F 2YH1A 4V19X 3PHTA 2K3KA 3KUHA 2MDAA 2LQ5A 1J5EF 2BJ7A 2HHWA 3AOCA 4HL9A 4X2BA 4USMA 1EETB 3BN4A 2G0JA 2XGQA 4LSZB 3DHXA 2J0QD 3CMES 1NSKL 2YBVA 1BY9A 2OTJS 1MSWD 3JAMU 2OUGA 1TKDA 1U26A 2ADCA 3JTOA 5KOXA 3NCQA 1QAXA 3MM8A 4F8RA 2SXLA 2YX1A 1FNXH 4NA2A 3N6LA 2P5VA 2YNFB 4I2PB 2ZBRA 3QJPA 1YBAA 2ZDPA 1N56A 2QO3A 3CC4S 2NYHA 2QFIA 4CTAA 2H5IB 2V4JB 5A2QY 5KFQA 4DR3J 4JV0A 2ZH6A 2UVVA 4X4PA 3OHAA 3M6VA 5FJ4A 3I0SA 1IQZA 5EX3A 1E6YA 3TJ8A 2QA1A 5CCLA 5AXMA 5GAHI 3BPDA 4GKJJ 3AXMA 3QJLA 3W9IA 5HMZA 3IR7B 4C8KA 2DGOA 4L72B 5A8KA 1YRXA 1SV5A 2ACMA 2BUNA 2ROPA 4NZ0A 3W63A 3T5KA 2XY7A 1VC0A 3C15A 4DSLA 1F5CA 2LMIA 4ELTA 2GV1A 1WACA 2RJZA 4DR5J 5DM6Q 2QTWA 2RS2A 1G7CB 5KFUA 3MMBA 4OX9J 5L1IA 1A9NB 2FZKB 2IC3B 2IM0A 4ITSA 2PI5A 1MN9A 1FJEB 3SSQA 3D4JA 4ANCA 4L6V3 1IBMJ 3M8PB 5J2QA 1PYOB 1T11A 1M1KT 2WSCC 1EP4B 3A8IA 3JTPA 4TU9A 2CJKA 3BYPA 1LWCA 4IYQA 3HPOA 3G6XA 3I55S 2HYIB 1DARA 1UCNA 1Y5LB 2MSSA 1TUGB 4HH0A 1RHJB 4UF4A 3QZ8A 3RRGA 1VBXA 2HNDB 3DYAB 4N76A 2JJ4D 1B99A 2RF2B 5F41A 4NCBA 1VK3A 2MZQA 3D0GE 1XR7A 2ZH8A 4RNMA 2FPHX 3IAS9 2LQ8A 4KSEB 1JKHA 1EKRA 1SPBP 1PYSB 4WP9A 2BE9B 4ED4A 4OLOA 1UEVA 2GS8A 1RSCA 2O1PA 2C2RA 1Z2ZA 2MKSA 3VGTA 4CLLA 1QSSA 1T03B 4ES1A 2ZVIA 2WVCA 3R5CA 3BR9A 3OLAA 1IKXB 3BBCA 1QAJA 3NL0A 1MMDA 2RHQB 2J7KA 4P6QA 3FSIA 5G0RB 2ZBIA 3DRSA 3EXYA 3MDFA 3VR1A 1LK7A 1B3TA 2IBKA 2MKYA 2ROEA 2FC8A 1FFWB 2C3MA 3MEDB 2LA4A 2XSJA 1NK5A 2XNQA 3FCVA 1YBUA 4B9UA 1WC0A 3EICA 4I2QB 4KHMA 4ES3A 4DV1J 7FDRA 3RR7A 1LW2A 2YNGA 3W9HA 1WELA 1HARA 2MKCA 3BO4A 4DUZF 4W90B 4PG7A 1KHWA 1HYSA 4ALZA 1S9GA 2IMWP 3TEHB 3B4MA 2GJ2A 3M8YA 5F8MA 1F2GA 3J7ZT 2R8IA 2VIHA 1HHSA 2C3PA 2CJAA 2FHOB 2YKMB 3MAAB 3V6KA 4DN0A 4FPRA 1SQFA 2VBXA 4J9OA 5E3CA 1NB7A 1WKLA 1RT5B 4KB7A 3EPIA 3X1LB 3B6BA 3HSDA 4RO0A 3TAMA 3FBFA 3P49B 5KFVA 5HK4A 4DCPB 1NSPA 2FGOA 4FS1A 3NGSA 1RDRA 3D6MB 4GVBA 1HBOB 3UR3C 1T02A 2F1FA 3VGSA 3CC7S 3GFHA 3F56A 2UUCF 3WC2A 1TL3A 2DEJA 2HGMA 5G0RA 1L3VA 3EGZA 3DDIA 1WOSA 4USKA 2K8GA 5F8NA 4PUOA 5D77A 3OHBA 2VA2A 1AFIA 2ZH4A 1BXNA 3K0JA 3HVTB 3GSIA 1RCXB 1JIHA 1NHKL 3FQLA 5AE3A 2E1MC 2C3OA 2F65A 4ZLJA 3Q8SB 2DR7A 2Y9HA 4HACB 1REVB 2HGLA 2XNRA 4WXOA 2BYCA 1RTIB 1UA0A 2W4CA 2GHVC 2VL1A 4DPYA 4HYKA 4F0KA 1S10A 2YKPA 3H5YA 3QRQA 4RU2A 3IA0A 1ZH5A 1LNQA 2XWXA 4H4KA 2GHWA 3W64A 4Q2MA 2FC9A 1YJWS 4ZCKA 4QJVA 2H51B 1SJ4P 1IKVA 3GQCA 2FYXA 1XK8A 3G82B 1ZAVA 4B9SA 1IR2A 1B7FA 1BQMA 1S12A 1X60A 2B6AB 3UDEA 1KNZA 1TL5A 3LALA 2GIFA 2CXEA 2KT2A 2NYIA 4OYZA 2AV5A 4RPFA 5A8WA 3UD3P 5L38A 3DRRA 5LXRA 4A8SA 2HNZB 4PPDA 2X1AA 1RAOA 1WHVA 1RWVB 2MKJA 2WSEC 2UUWA 3CJTA 3HD2A 3DN9A 1K1QA 3OD2A 3QGPA 4MH8A 4YMEA 3SDEA 1I5OB 1FRXA 4JI7J 1NKCA 4KO0A 3DMJA 4QPXA 3PNIA 2QX0A 1FTRA 1J5EJ 3RGIA 1WEXA 3C6UB 1SKWA 1RTIA 3IRWP 4V1Ak 3T9ZA 4O3SA 3DRXA 4Z7YA 4MIWA 3K89A 4OJ3A 2MPUA 1M0SA 2BANB 3ISZA 4CYUA 1NJYA 4DS4A 5JVHQ 2JC1A 2W2NP 3T1HF 1RHQB 2IPOB 2VPWB 2Q79A 4LSNB 1IKXA 1WHXA 5HLFA 1T9WA 4G6VB 4F25A 6AT1B 2BRKA 1NEEA 3OW2R 5KFMA 3O8WA 3R9LA 2FVQA 3DLLQ 2Z58B 5GAHU 2Y1RI 3IG1B 2C2OB 3DLJA 3ZXWA 1UVJA 3AHPA 1JLAB 1RTHA 3ET6B 4ETZA 3V81B 3H42A 3FUYA 4Q43A 4NLYA 1PBAA 2IFXA 2OPSA 4A8KA 5DGAA 3A4TA 4O44B 3N28A 2ZKTA 2DK2A 1IUJA 1U2FA 3B8HA 4CZCA 1WHYA 2R8KA 1KFDA 3CT9A 4DS5A 3QT8A 2XHCA 2XS7A 3MOZA 1LKZA 4YEAA 4NCAA 1RISA 2HWIA 1HMVB 2JX2A 2IYIA 2R2UA 1HPZB 1ZOTA 3MUVP 4NMXA 4MT1A 3ZZRA 2OFHX 2ZNZA 2P8IA 3PRBA 4OI1A 4I0WA 3QNWB 2DRAA 4CLZA 4DCJB 3A12A 5A6PA 1SL2A 2UU9J 5HSPA 3RR8A 4LFBJ 1S49A 3N0VA 2MQMA 4RW7A 4WTYA 2D69A 1T9TA 2WVBA 2AJ4A 1X9WA 1ICEB 4MKVA 4A4JA 2VC1A 2EVZA 4RZRA 4X4NA 1HL6A 2CPFA 3DLGB 3EVOA 3I5BA 4ZPCA 5L9NA 2RRAA 3TZZA 4ZVHA 1GEHA 2VJVA 2WCXA 4OI0A 3M8WA 1UVKA 2E7XA 2KM8C 2HWTA 4K2JA 4OJHA 4DV5J 2ADBA 2ALYB 1U1RA 2XZWA 4U96A 1RAHB 4Y2AA 5T41A 1LWEA 2PIIA 3V5RA 5CAAA 2ATCB 2MKIA 1R0BG 3M6XA 1HWKA 1WHWA 4IH5A 2DTJA 3N9UC 4I69A 1TU0B 1HMVA 1N54B 3BQ1A 4I4BA 5J1PA 1IKVB 4L74A 1VS3A 4IO1A 4IH6A 5D4NA 4AXJA 5F8IA 3EPGA 1U1NA 3W2WB 2GMJA 5F0UA 2QL9B 2OELA 1X5PA 3BS9A 3GIJA 2DVIA 1WI8A 4ZLPA 2F8MA 4RW6A 2EKYA 1GFWB 1KQGB 1LQ9A 2P9CA 3CD5A 2F63A 4JI2F 4CH7A 2RT3A 2YQ1A 4BCAA 5C2GA 1QSYA 1AFJA 2J6TA 2QLFB 3AH6A 1HR0F 2E9ZA 3RW6A 4IFYB 4ZPWR 5J1EB 2OO4A 5J2MA 2BX6A 4ECXA 3R5BA 1S1TB 5KFLA 2XQCA 1HNVB 2DXFA 1HBNB 4LREA 2BEFA 3C6UA 4A46A 1IWGA 4RBUA 4B3MF 4B9LA 3HO1A 1C1CB 2H54B 2Y0SD 3HSJA 1WG5A 5AXNA 1PIEA 2R3VA 1NKBA 5HBMA 5GMDA 4JI8F 2XWYA 4OHWA 3R1HA 5D78A 5DDQC 1KFSA 2E9TA 1TAUA 4CO0A 1X9SA 2FJXA 2CZ9A 2RRNA 1JNZB 4QOTA 4DJBA 4DMZA 4DL0C 1N52B 4KV8B 4ZJOA 2EBGA 3VHQA 2CZVC 3R5JB 1Y3JA 3QRRA 3NNHA 2WW8A 3QIPA 4ZPTR 3DI6B 1FKPA 4YUDA 2DB1A 2JH3A 3RZAA 1RE1B 3BGLA 1XNQF 4NASA 4PZVA 4ECVA 3TRGA 3FFIB 4J9KA 3QWUA 3DLEA 3OL7A 3KLGA 1JLAA 1RTHB 3IR5B 1YJUA 5EWFA 2UP1A 3CDEA 2ZH7A 4B3SJ 2RVJA 4CRJA 1N36F 4RNFA 5D3GA 3MI7X 1SC6A 4JV5F 1Q7LB 4MYTA 4Y2MA 3CJSA 1LOUA 3CJKB 3TJ9A 1Y5IB 1CBKA 5B0DA 3SSRA 3F73A 4XDCA 2N4DA 4ZP9A 3PEJA 4C0OC 2YY3A 3E8OA 1UFWA 4CLFA 2V8GA 3N5BA 5JXSA 1LEOA 2CPIA 2KHCA 2OPPB 2D74B 5I42A 3T19A 1BQNA 3TW0A 1YZ7A 1FD8A 3GFYA 2YX4A 3HSGA 3L7OA 4ZIVA 2ZJRQ 4X64J 1T8EA 2IJNA 1JLEA 1QUPA 2L48A 2RU9A 3D1HA 1S5ZA 4D3GA 4WKRA 1RKJA 4DU7A 5KFKA 1S9GB 1KP6A 2F7VA 1MG7A 3D1QA 5DZ7A 4W98A 4WIQA 4I6YA 2VZ9A 3M6WA 3G9CA 3MHYA 5F8LA 2DCLA 4H4MA 2ZH9A 5A8WB 1YQHA 3DGPA 4K5SA 4I7FA 1KSPA 3Q8YA 1NJZA 3LGNA 4RW4B 3W2VB 2M4MA 3OXGA 4C9DA 5B0EA 3CCSS 2HVEA 4NPOA 5E3QA 4X4RA 4J9RA 4C8OA 4PWDB 2QLBB 3MTKA 2Z4PA 1EQMA 3OR2A 5IT9Y 4LF4J 1S6QA 2ACYA 3PFEA 4ELVA 2LLZA 2IA6A 4TY9A 1BE4A 4EUVA 2C2DA 1CJKA 1UJ4A 1RWUA 5C7PA 2ZH3A 3VAMA 2HS0A 4ECRA 2V9WA 2AJ2A 2CQ2A 1FRLA 2KHDA 2F8HA 4NL5A 1N5YB 4DEZA 2CWXA 5L8RC 4USVA 4PR6A 3VGUA 2VD3A 2NUHA 1K0TA 1OQ6A 3TJAA 3P5BP 1XR5A 2IVMA 3AD7C 4C6AA 2CG8A 3PDNA 1K8AT 1P1TA 1RAFB 4KKOA 2LU1A 4LR7A 1YK9A 2UV8A 1YHQS 4RR5A 4DR5F 2H1YA 3G8SA 4QIEA 3TUPA 3QO9A 1IQTA 3LOUA 1FCAA 4QR0A 2W7OA 1OYDA 1QE1A 2DHHA 3U1NA 2B51A 3HHLA 5DGBA 3A13A 3BGRB 1EIYB 1H73A 2AYBA 4JI7F 1OMSA 1FRMA 2GGPB 2L3MA 3DOLB 3GJSB 2HLTA 3TA1A 3PV8A 3ZTPA 4CLKA 4ENOA 5IT9U 1ZETA 1KRPA 5AXKA 1SI9A 1KWMA 2OEJA 1UTAA 3O1LA 4KPCA 1VQYA 1WF0A 2I8EA 3UDLA 2KG0A 4X64F 1U1PA 1G2EA 1KC8T 3Q24A 2ZE2B 1EZZB 3VAKA 1C2PA 4YB1P 3RB6A 3DI6A 2VONA 4LF8F 4Q7AA 1HBMA 1NO8A 2EG1A 4ZP7A 1C1BA 4MK7A 1KOHA 5DJBA 5EWGA 1S99A 2UUBF 1NJXA 3ELHA 4M63A 4F2RA 3CULA 1SCJB 2GVZA 2V8PA 4J91A 5FDLB 5IM0A 3E3XA 2NLWA 1WTFA 4DX5A 1JXLA 2W01A 3KK3A 3MEGB 1M5KC 2A10A 2KXFA 1GMWD 3RRHA 4K4UA 3K5MA 3DCAA 4WTOB 1HWUA 3KLEB 2ZWOA 1ZS6A 1FJ7A 4O0IA 3C16A 3Q2SC 4AT1B 1P27B 1NB2A 3AAWB 2XI3A 4Y65A 2BQ3A 1VJQA 1H7XA 2IRUA 4PABA 5ETOA 1LWEB 2AD9A 3FSYA 2IM2A 1FDNA 3CJ5A 3ENQA 3LF0A 3MPYA 2DITA 3D54A 3QSIA 1JNRB 1TP7A 2X3DA 4B17A 2WVFA 3FDSA 4WFNQ 2FHMA 3ILJA 4FYVB 4KRWA 4OI4A 3BV8A 1HIYA 2MJNA 3KFWX 1H74A 4CTAB 4E0DA 4NLQA 5U47A 5K20B 3NAIA 2W2OP 2HVIA 2GVZB 5FDLA 2XB2D 2CA9A 5HO4A 4X62J 1HHTP 2BJEA 4HKQA 5F8JA 3UR0A 1HPZA 4ZCIA 2W9BA 4I7FB 3GSDA 2Q66A 1XEZA 1Z4UA 2I5JB 3HT0A 2Z30B 1C0UB 1XWLA 4EU0A 1RAAB 2A3JA 3LP0B 1BLUA 4YN3B 3DRPA 1NK7A 3OJSA 2UXCF 2AGOA 2KXNB 4YFUA 4CH1A 1U2CA 2DNQA 2LDYA 2E7VA 3OL6A 1NKEA 4ID5A 2XZTB
chains in the Genus database with same CATH topology
3UDCA 4P7TA 3RTVA 4DQQA 4DSEA 1IBKF 5GVQA 2OPQB 4IFYA 1SJFA 1T3NA 2OKQA 2Z8QA 2CPYA 5IQQA 3QIDA 2Z2LA 3C8YA 4PXEA 5E7OB 4NXNF 5HP1A 4CO3A 1CEZA 2POKA 3UFCX 4C3MA 1KLMB 3EGNA 3H2UB 5IT0A 4BS2A 2DNLA 4DPOA 3NNAA 1S97A 4DV5F 3I31A 4PRFA 2O3DA 1Z2LA 4OJ1A 2B5JA 1DTQA 4KFBB 1KQFB 1YIJS 3IWNC 3HHLB 4JV1A 1MROA 4WFAQ 3MMAB 1CC7A 3QMQA 2DNYA 1D9AA 2EK1A 4YY3F 2W7PA 2RDIA 3MOJB 1IR0A 5FD1A 3PO4A 4JBCA 5C24A 4B3SF 3DRYA 3TUZC 4C7QA 4PG6A 2IYGA 2UU9F 4FBTA 3IR6B 3EZ5A 3GV7B 2A1BA 2MZ1A 1U4BA 2OPPA 3DLKB 1DHMA 1FA0A 2M5YA 5KG7A 2G9OA 5CYMA 4F50A 1TV6A 3MTJA 4QWAA 5J1NA 3RU0A 2XG8A 4DUYF 2ASDA 3M2RB 2GHPA 4ECYA 1ZBTA 1TR0A 2UXDF 4KQZA 4ZPAA 3MAHA 3C6TA 5DETA 2ZITA 2VPYB 2XULA 1NK8A 3R1LA 2HNYB 4LQ9A 5DG7A 2DCUB 3S8SA 2LXIA 3GV8B 5AJ3F 3D28A 2DH9A 4ED2A 5H9FJ 3PW5A 2DGVA 4JI1F 1SIZA 5GADI 4R0EA 1YJ9S 1FXDA 3KLGB 4F3OA 1UVIA 4WZMA 2Z0GA 4C0HA 2W9CB 5KFJA 2DRBA 1SQEA 4N47A 2FJEB 1XMBA 2OLWA 4DOZA 4HVZA 2IC3A 4ES2A 1N0VC 1SJQA 1LWFA 4U9RA 3TUIC 1Q82T 2IAJB 1RA7A 2CQHA 4OX7A 5L1KA 2AGPA 1FRIA 2DNOA 5BJRA 1JLFA 2VG6B 1N0UA 2R8GA 1ZM2A 1L5UA 5DLFA 5H9EJ 2KT3A 1U6FA 4RW8A 2JVOA 2IVFB 4Y6IA 3PW4A 2K2PA 1M5PC 3CCMS 5IFMA 3PX4A 1VC5A 1HI0P 3FFIA 6FDRA 5KFCA 4WZQA 3EXCX 2J9DE 3SQGB 5CYJA 1UETA 1JJHA 5T14A 1I94F 4CCHA 2KYZA 1Y9OA 2KH9A 4DG1A 4UQGA 3OXFA 2CYYA 3CD0A 3CCES 3VALA 1KLMA 2KRRA 2AYEA 2WHOA 4DR6F 5SUHA 1S9EA 1C1BB 2U1AA 5KG1A 1BWEA 2JLGA 2FHJA 2YNGB 2P6TA 3MD3A 4DR1F 1PC5A 2EFPA 4KFBA 4OZ1A 4WF9Q 4WK1A 2VKRA 2AWZA 4CO1A 4KGKA 1G3OA 3TA2A 2BQUA 2GO9A 2RE1A 4UW2A 2ZH2A 1F0XA 3V4IA 2V94A 3FCHA 1AUDA 2WONB 1IKWA 3KLIA 4KBIA 1N4LA 3DYAA 1CLFA 5GAGU 2MQNA 3PO5A 2BABA 4KGMA 3GZ7A 2VBZA 4WE1A 2HQ3A 4UUXA 4R8UA 5F9NA 2VQFF 4ED6A 1DRZA 1TV6B 2JRSA 3RBEA 1RAJA 3SCJE 3FRYA 1LFWA 3O5TB 2VG7B 1HQUB 4LF4F 7FD1A 4Y00A 2OMLA 4DFJA 2DNNA 3M8RA 2GC8A 3DU5A 2B9WA 1Q8LA 2BRLA 2DT9A 2HNDA 2ZE2A 3E51A 3PJWA 4FXWA 4GO7X 3K5LA 4ID8A 2FJVA 2B9YA 2ASJA 5K8NA 3AJ2A 2GNKA 3DXBA 4NLXA 3M8QB 3AY0A 1LW2B 3UE2A 3VWSA 2PEHA 3IGVA 1O51A 1S0MA 1E6YB 3WDOA 4M95A 3PIPQ 1MWZA 4O23A 2DHSA 2IHR1 4KR0B 2R7VA 2XMJA 1VHFA 5KFAA 2ZZMA 1XBWA 5CD4H 1UJ6A 1N5TA 2GQCA 2OH2A 1GQEA 4ILRA 1RGVA 3DC2A 2J6SA 3MM8B 1HQUA 1RKIA 2WSFC 3BGRA 3D5MA 3C3LA 3MR6A 2CQDA 5F0WA 2C22A 4RWXA 2KFNA 3X3UA 1K0VA 5A0YA 1J2VA 3ZZOA 1X4EA 3OR1B 5IS2A 1NK0A 4LF7F 2QYCA 4J9PA 2EFGA 4AFFA 4DFPA 3GIKA 4IG3B 5L1LA 1HQEA 2QEXS 2MHEA 1R43A 1M5HA 3BQ0A 2V9KA 2LYVA 2FGCA 4Q2LA 3SQGA 1P9QC 3TNVA 3OVSA 4Y2IA 1QVGR 1KQKA 4X84A 2FB0A 2GCFA 4ZDNA 3OFFA 2OMOA 2C42A 1S1XA 3H5SA 4IQMA 2MJUA 2HFNA 1OPIA 3TO8A 3TP2A 4GKJF 2AJ1A 1SXLA 2NXUA 3JSBA 4K4ZA 4QW8A 5E5NA 1SIWB 4IG0A 4HI1A 2GQQA 1S9EB 2CPJA 3MM7B 2YNHB 1RQ0A 2JC0A 4WFXA 3HLUA 5F3TA 1U24A 2XSJB 2YWKA 5D8HB 1JX4A 2MHNA 3M2VA 4KV8A 1UL3A 4FZVA 3OTOF 4DQPA 4ZVGA 4WIIA 4ZPVR 4J9SA 2JDJA 1RT6A 2P6SA 2DIVA 4YDXA 2R7RA 4JI6F 1TL4A 5IQ6A 5KTQA 2NPIA 5J2NB 3OVAA 1TFWA 5KT2A 4K4TA 3TARA 3M6UA 4FXVA 3FVYA 3GB0A 2ASYA 3VAIA 3OTDA 3AQPA 2D3OR 2LEPA 5KFBA 1RT5A 2F9DA 3NGKA 1GXLA 4AL6A 2PO4A 2B4VA 3FZBA 4M1KA 3PVXA 1NJIT 3LP0A 3F41A 1NZAA 4TY8A 1I6JA 3QLHA 3Q23A 1H98A 2W8KA 3LQVA 3TAPA 2EFNA 1M5OC 1KHVA 1HFEL 2E5IA 5F8HA 1O8BA 2PC6A 5B0GA 2QV6A 3DLKA 1SUQA 1NHVA 3LP2B 2OSQA 4JI5F 4HT7A 1GT8A 2QT7A 3L7PA 2ZHOA 1TK8A 4XIUA 1S1WB 1OSCA 1VQSA 2PA3A 3FEZA 4OZNA 1IBLF 4DL6A 2E66A 1B0VA 5KG5A 2QFJA 4ZMMA 1RTDA 5CYQB 2B4UA 3H5XA 1S6PB 4LFBF 2BV3A 4CQ1A 1R89A 2YKAA 3D1OA 1H0HB 2VH7A 2ILZA 4O4GB 5DQGA 1VC6A 2D41A 4MK9A 5EDWA 2RIJA 1FVSA 1VFJA 4URSA 3VQSA 2RNEA 4U7UK 2HHXA 3VAJA 3N6NA 2YH0A 4ED7A 4NLVA 2DGXA 1CC8A 3VTIA 5GAGI 2F4VF 2AGQA 2V8DA 2ABYA 1S6QB 2CZ4A 3I5AA 2R7UA 1F60B 4JYAF 5IXUA 2MZTA 2VFUA 4DL3A 4K4XA 2Z2MA 4P7VA 3HT3A 4M5DA 3U1MA 2HZCA 1H6KX 2ATLA 1SJ3P 3R5DA 4DFMA 4A8OA 1IXKA 3VZHA 3J7A1 4AUKA 3FRZA 1TVRB 3NMRA 5DM7Q 1Q8BA 5EX0A 4X2BA 4CT9A 1X4BA 4QU7A 3HKWA 4NLSA 4C98A 4FBUA 2BVZA 2DD8S 3DLGA 3BJYA 4WJBA 1XC9A 1QE1B 4F26A 1B64A 3I4PA 5DG8A 4MIBA 4R5PA 4RW6B 2XLIA 2VBYA 3JSMA 3GV5B 2HHHF 1SBRA 1JLCB 3CF5Q 3TX8A 2J7UA 2IJFA 2KU7A 3DM2A 4QIGA 1X4FA 1SJRA 3RW7A 1DTTB 1KR4A 1HI8A 3MUTP 4EBCA 3I9ZA 2B4PA 2M88A 2GFFA 3IS9A 1HBMB 1S1VB 2ZJQQ 3I82A 3OUYB 2KFZA 2PA8D 3UI3A 5KT5A 3N79A 3CO9A 3CMAS 5L1JA 1N33F 2J76E 3LANA 5KFHA 1GH8A 4PQUB 1UWBB 2YKOA 3GG0A 1RTJA 2BA9A 1QJHA 2L9DA 1ZM4A 2KVIA 3KK1B 4RW7B 3JYTA 4QWDA 2NREA 2N4CA 3HX9A 3OSPA 3QWPA 4JUZA 2I9SA 3H5UA 4X65F 2AJ0A 3DFEA 2L9NA 3PKYA 4F4WA 1V9OA 2OJ3A 5I4MA 2VG7A 1X4CA 2EG2A 4HTIA 2R8JA 2HFOA 2GX8A 3U27A 3HZEA 2RKIA 2MMYA 2BW2A 1S6PA 1V6HA 3K7RA 3QGHA 1ZAXA 2MXYA 1HBUB 3E01B 1TKXB 3U1LA 3CCQS 2IM1A 3ICLA 3U02A 3FMBA 3SFGA 5MAOA 3G86A 5KFWA 4B9NA 4W92B 4DX8H 4M94A 1GXUA 3PR4A 1VQOS 4PXDA 2FHKA 4K59A 3KK2B 3KMQA 3IO1A 2FJDB 4TXSA 2ZC3A 3CD7A 3OFEA 4YDDB 2ZJPQ 1AW0A 2HWHA 3MM9A 2GGPA 2OSRA 3WBZA 3OQ2A 4Y2CA 4DQSA 3K57A 3IG1A 1DQ8A 3HK2A 3G6VA 3DNCA 5DRKA 1JMTA 4C11B 3HFKA 4JOUA 5JUMA 1JLEB 5CHCB 3CUNA 3OFHA 1WG4A 2LDIA 2V8VA 2LA6A 3H59A 3FMWA 3NGDA 2PMHA 2WB4A 4TU7A 2AJFE 2ZOFA 4FVCA 4ERDA 2KKHA 2XMUA 2DIUA 2Y1IA 3CDBA 3MPWA 3US5A 3PY8A 2N7CA 4GC6A 1RT7B 1U8SA 4R5PB 1LW0A 2FUG9 4DR4F 1AROP 1S1UB 1Q86T 4PWDA 3QLHB 3B4DA 2EFQA 2OTLS 2Q3PA 3S1TA 5AE1A 1IBMF 3TAQA 3KWMA 3V2UC 4WU2A 2ZH1A 1N32F 4ZPDA 5BR8F 5KFSA 2EFOA 4Q0BA 4G1QA 4DL7A 2DNMA 4IOBA 4PG4A 1YWXA 2N3OA 1OSDA 1N5SA 1RT1A 4UOCA 3A1YG 4IQXA 2VOPA 1OWXA 1VOMA 2Q43A 5EUHA 5HQ8A 2KJVA 5CZXA 3SFUA 4A8MP 3UCUP 5K8PA 3G6YA 3K58A 5I42B 1RTDB 4QU6A 4X4TA 2CPEA 4WU3A 4XPEA 1H2TZ 3SV3A 3POTB 1HWJA 2DNKA 3MR5A 1N48A 2E29A 3OPKA 4H4OA 5A8RB 2R7SA 1MNEA 4L3NA 4PQAA 3KHLA 2KZZA 3J80Y 3MGJA 4TU8A 4XK8C 1UJ5A 4BC7A 4BHQA 5D3GB 1O5JA 1JLBB 2BQRA 2HRUA 3NCRA 2RMLA 3LUYA 3ONQA 4FF1A 1NK6A 3U7JA 4I68A 4IFVA 3GIIA 2W9CA 5GADU 3FJ2A 4OZ0A 2XBPA 2XS5A 4ECTA 4IR9A 2L9WA 3M30A 4HDHA 4FYDA 2HS4A 2B4OA 1J5OA 4ZCLA 4I67A 4I2QA 5KG4A 2VFTA 4NYPA 2J8AA 1SUQB 2OPRA 5ADZA 1JLGB 4F4KA 1S6UA 2LCWA 3SMZA 4X4UA 1N8RT 2YKNA 2GIQA 1ZPWX 1DTQB 4AL7A 5THWA 1FKPB 1R3NA 4Z2XA 2DH7A 1YTYA 1FF2A 4OI6A 1PSDA 1KTQA 1C0UA 2EWHA 1FESA 3OJUA 4ECWA 3WC0A 2K1RB 3KG0A 3Q8PB 3R3TA 1N6QB 1KLNA 3DRPB 3HHDA 3GMGA 4CT8A 4R25A 4QWBA 5LT5A 5K14A 4WYWA 1YJVA 1RJJA 5DDRC 4FN5A 1QSLA 2E1AA 1S4FA 4ZK7M 5CZVA 4M8LA 3M8PA 5J2QB 1QTMA 1K73T 5DQHA 1UWBA 5C25A 4JI0F 2FLLA 1VGYA 3QGIA 2WK4A 1M5SA 3NS6A 4CNZA 1LXJA 5B09A 2CPHA 2JLFA 1U1OA 5SZTA 4YP3A 3UD4P 3KK3B 3BM7A 4N5SA 4LF9F 3JYTB 3DOKB 3GE9A 1UFLA 5T7LA 3MMJA 2R2TA 3DOLA 3KG4A 4F67A 4MK8A 1A6LA 1JLQA 4B3TF 3P6YC 4OLPA 2OAUA 1YG0A 1KONA 1JLCA 1Q8IA 2BDPA 2APOA 3H8YA 4TN2A 1FERA 1WF1A 2B3TB 1C4CA 4HI2A 2R2RA 6FD1A 2M8HA 2RQKA 1VRTB 5DQIA 4F4XA 4C3LA 2W25A 2YKQA 3D0IE 2ZD1A 3I0SB 1OIAA 2FDNA 2CQGA 3UW1A 5B08A 3CD6S 2A2CA 1FJCA 3M8SA 1X0PA 3P5TL 2D9PA 3DLBA 2COLA 5A8KB 2NS1B 2O67A 1G1XA 4PXCA 1UAWA 3QGGA 3TAMB 1E6VB 1HNIB 2M2BA 1R8CA 2YWFA 5KFRA 4USHA 3TOQA 3ITHA 2P9EA 2FLOA 4UY85 2LEAA 1J5OB 4H4KC 1MMLA 4IOAQ 1HNZF 4EZ6A 1N5QA 4TNOA 2XY5A 4O44A 1ZM3A 1VI7A 2KM8B 3MFHA 5B0BA 4JV2A 1OQ3A 5D4PA 4Q5VA 2E5GA 2NSCA 2YNIA 2RU3A 1YJRA 2ZM6F 2ZD1B 3NMAA 1VMBA 2M9KA 1RT3B 1Q78A 2ZOMA 5KFZA 2DR5A 1Q4RA 4OMFG 3I6PA 5H1SV 4BWMA 4NLRA 1D3WA 5DDPC 5EWEA 1LV5A 1T05A 1IKWB 2HHPA 2B7CB 3T6JA 1BQMB 5LJ3Y 1FRJA 4RW8B 1TK5A 1Q53A 2PE8A 1UKUA 2BM1A 2MKKA 4NLPA 2JFDA 2O66A 3L09A 2HNZA 2AJQA 2VV5A 1NH7A 4QR2A 2UUAF 2EC0A 4FS2A 4HT5A 3OTEA 3JB9k 4B08A 2FVPA 3GG1A 4HEA9 4USJC 4EO8A 4K4WA 2XMMA 4DG1B 2V0NA 2HRYA 3V81A 3TI0A 1KD1T 2VOOA 4QCLA 1CQNA 1FT8A 3KLFB 3M2UA 3MFIA 2MGZB 3VAHA 2ALZA 3O2IA 2KTQA 2MQQA 2B0GA 1R8AA 2YWGA 5AXLA 1TKZB 3GIMA 5KFDA 1FDBA 5DLGA 4LIRA 3HP6A 3OL8A 1VQKS 1KQSR 2OD6A 1MMNA 3GR1A 3OXLA 1KS2A 2DISA 2CDQA 3M1VA 5KFOA 3N4WA 1TL3B 5G4DA 4DLGA 1DQ9A 3S6EA 1R8BA 2YTCA 4OHXA 4OX8A 3M9OB 1GTEA 3VF0B 2DO4A 2P9GA 3CVKA 2VG5A 5KFFA 3FZ2A 1X9MA 3Q0AA 4IRCA 4O4RA 5HBMB 2UVUA 4HTJA 3ZZYA 1D0EA 2AF6A 3MM9B 1RI7A 1XERA 4TQRA 3DRRB 3JTNA 1S1WA 1OS5A 1EP4A 2UXBF 2HQIA 2NUUG 3B78A 4CNYA 2RSQA 2DNHA 1UA1A 2CQ4A 4CO2A 4D3HA 2MB0B 2G1DA 3G4SS 4AXIA 1S9FA 2J0SD 4MIAA 2FJAB 1X0FA 3E2EA 2ZOGA 2C28A 4QIFA 3MR3A 2VODA 4WFBQ 1BC6A 2V8HA 4ECQA 5D4OA 1S1XB 1XR6A 2DGWA 4KC5A 3MMAA 1X5TA 1BGXT 3HVWA 2JWNA 1TK0A 1KNZA 3GWCA 1L3KA 3I4HX 4YOEA 2R2SA 3ISNC 2J9DA 4RLEA 1PO6A 1FKOB 4N8OA 3DMJB 4BC9A 1X4AA 3MM7A 5KFEA 3O3LA 2FD2A 3DDNA 4B9VA 1TAQA 2H5EA 1RT3A 2IAJA 2AX1A 2ILYA 3MMCA 2HHQA 1PGZA 1NJWA 3M2VB 4TYBA 3CSKA 3WX4A 4ZVEA 3M8QA 1MU2A 5HMYA 3SCKE 3QAEA 3NRBA 3NBPB 2FLNA 3GILA 4FXDA 3MXHP 1H38A 2ZNYA 4PXBA 4A8XA 5IT4A 3M9MB 4KTQA 4K50A 3AQOA 3IRXA 4P2SA 4FVMA 4DSIA 1GTHA 2NZ4A 2ERRA 3UPFA 4OJGA 1QAYA 4UUWA 4ZHRA 3SYZA 4J37A 4URQU 2C3YA 2HPUA 3SV4A 4AQYF 3BDPA 1C1CA 1X5OA 2UV8G 4C8ZA 2DNPA 2VPXB 5EN1A 1O0PA 2PFFB