2HNDB

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
422
structure length
394
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 113
structure length 394
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB03
3KMSA 3NKYA 4DG1A 5EWFA 5J2QA 5L1IA 4ED1A 3LP1B 4IG3A 5F8HA 1JLBA 4ECQA 4LQ3A 3DLEB 3C6TB 2OPSB 3H5YA 3V81B 4EBCA 2HMIA 4ZVFA 5DLGA 3KK2A 2WOMA 1KHWA 2WK4A 5C24A 1S1TB 1EETB 2XGQA 4R8UA 4PUOB 1C1BA 4JV1A 2UVRA 1S49A 3UPFA 3KOAA 4ZPCA 5EWEA 4ZMMA 3BSNA 1JLAB 3IRXA 1TKTB 4Q0BA 3PW5A 4KKOA 5DG9A 3M8PA 4Y2CA 4ED0A 3T5KA 2ILZA 5KFGA 4TQRA 5HBMA 5KFMA 2VG7A 2HNDB 3PW0A 2W8LA 3H98A 3V6KA 4RW7A 1TL3B 1RT2A 2HWIA 4YP3A 1HMVB 1RT3B 2OPSA 3DRRB 3OHAA 4RW8A 3BSAA 3IS9B 1HQEB 1QUVA 3QIPB 2WOMB 3IGVA 2OPQB 1EETA 3QO9B 2E9ZA 1HYSA 4KB7A 3V6DA 3PJXA 4KHRA 1VRUB 5C5JA 3BGRB 4G1QA 2R8KA 1DTTB 5KFZA 4K4XA 2IBKA 2HNYB 1FKOA 4Q0BB 2VG6B 1J5OA 4G3IA 4FS2A 1SV5B 3M8PB 5KT6A 4EBEA 1IKVA 3PW7A 5KFUA 1DTQA 1S10A 4IRCA 4IFYB 5KFFA 1C0UA 2VG7B 2HNZB 1N5YB 5KFIA 1QAJA 4IH5A 2XGPA 3NBPA 3Q8QB 4NLGA 2IM0A 1TKXB 1RT7A 3KK1A 4MH8A 3LP1A 5J2MB 1JLBB 2V9WA 1C1CA 1TL1A 2C2EA 1S6QB 3V81A 1T03A 3OL9A 2BANB 1LWCB 3MEDB 1NHVA 4Q8EA 3KLFA 1QE1B 4YQWA 1VRUA 3GIIA 2R2RA 2AGPA 3KHLA 4QW8A 3GIKA 2W9CB 5KFRA 1FKOB 4O3OA 2FVQA 1RTDA 3MF5A 3SFUA 4F50A 4PQUB 5KFNA 2WTFA 2JLEA 2UUTA 4QPXA 1TKTA 4ECRA 4IFYA 3M8QB 4QWAA 2XCPA 4X2BA 1N4LA 4Q43A 1N5YA 3V4IB 5HBMB 4QW9A 1C1CB 1HMVA 1RT3A 1S6QA 3DRRA 5KT3A 3E01B 2ASDA 1W25A 5JUMA 4EEYA 4ECUA 3KLFB 1XR6A 3I0SA 1T05B 4ZHRB 4NLQA 2D3ZA 1LWFB 4O44B 1S9GA 4ZVGA 4WXWA 3BGRA 4G1QB 3IG1B 1DTTA 2OPPA 4PQUA 1D0EA 2YKMA 3QLHB 1S48A 3H59A 2HNYA 5F8MA 5KG7A 1EP4A 4EYHB 3DRSB 1SV5A 2ZD1A 2R2UA 2C2DA 3NL0A 2BRLA 2B43A 3V6JA 3IGNA 5J2QB 3D5MA 4IG3B 1JIHA 3QZ7A 2UUWA 1LWEB 1SH2A 5J2MA 1JX4A 3KK2B 2XC9A 5KG1A 1S1TA 5KG3A 4O4RA 2R8HA 4MKAA 4XPCA 1RT6A 1WNEA 5DG8A 5KFYA 4O4GB 3DLGA 4O3QA 4ED8A 4NCGA 3E51A 4NZ0A 4IR1A 4WZQA 2ILYA 2IA6A 1JLAA 3IRXB 3FSIA 1RT5B 2JEJA 3DRSA 1HARA 4ZVHA 5F9NA 3MEEA 3CJ0A 4KAIA 3H5XA 3RBEA 4KHMA 3GIMA 4J9NA 3BREA 3GIJA 4MIBA 3H40A 3V4IA 3KLIA 5DQIA 4HYKA 5FDLA 4ED3A 4I2QB 4DL6A 2AGQA 4RW8B 2UVUA 3DLKB 1HQEA 4KFBB 3Q8RB 2JC0A 2I5JB 1S6PA 5KFSA 3E01A 2IAJA 2R2SA 1DLOA 1FKPB 4RUCA 5EDWA 3SFGA 4Y3CA 3LP2B 5L1KA 4J9LA 4ED2A 3IG1A 4NLRA 5KT7A 3CWJA 3MEEB 4O3NA 3MR3A 4ZP9A 1GX6A 3DOLA 3KMQA 1JLEA 3GV5B 4K4WA 5KFKA 2DPJA 2BR0A 1SUQB 5KG6A 1TV6B 2ASLA 3KHRA 2WCXA 3MEDA 4ZPAA 3BJYA 1DLOB 1FKPA 2IMWP 4WFYA 5KFVA 1RAJA 3I5CA 2FLPA 2IM2A 3I5AA 2OPRB 3LANA 2R8JA 1RT6B 2J6SA 4NCGB 1S4FA 3H5SA 1RTDB 3JSMA 5I3UB 3NGDA 2YKNA 4H54A 4TXSA 1RTIA 2VG5A 1JLEB 4DG1B 4NRUA 5EUHA 5DGAA 3QGGA 3KLIB 2ZE2A 1KLMA 1S1UA 3C6TA 2AGOA 1NHUA 1HPZB 1JXLA 5J2NA 1S0OA 5C24B 4NLOA 3V6HA 3I0SB 3RB6A 3JYTA 2W7OA 3M9NB 1S9GB 1C0TB 5EWGA 2WRMA 2C22A 1N56A 3EZUA 2YKNB 5F8IA 4RNMA 3RAQA 4ECXA 1MMLA 1NNDA 4IFVB 1JLFA 4XO0A 4KV8A 3RBDA 4RW6B 3CIZA 4K50A 4Q45A 4RW4A 4YR3A 2YNHB 1RT2B 4H4MB 1S1UB 4MFBB 2AX1A 5KFDA 3OL8A 4IQXA 2FLNA 5DQHA 1TV6A 4WFZA 2OPQA 5J1EA 3CJ5A 1RTHA 2DPIA 2IC3A 3DI6B 4GC6A 3DYAB 2C2RA 3DLGB 4IR9A 4I7FB 4TY9A 4WXOA 4Y2AA 4IH6A 4F4ZA 1RT5A 4J9SA 4B3OA 3OL6A 1JLFB 5I42B 3G6VA 3TVKA 4EO6A 5KG2A 1IKVB 5KFTA 1C0UB 3KNAA 4DL7A 2R8IA 3FFIA 2O5DA 2VG5B 5K14A 5HLFB 1T94A 3GV7B 3H4DA 4DL5A 1RYRA 3CDWA 3RB0A 4MFBA 4I2QA 1TKXA 1SH0A 2AWZA 1QAIA 4TYAA 3VQSA 5F8GA 3DLKA 5KFPA 5KFBA 3HKWA 3Q8SB 4MK8A 1S6PB 1T03B 5KG5A 2YNGB 4O3RA 2EC0A 3DI6A 2D3UA 2QE5A 4JV2A 4K4ZA 3T5JA 3JYTB 1JLQA 2JC1A 3PVXA 4IRKA 4QWBA 2F8EX 2FVRA 2E9TA 3OL7A 5I42A 1VRTA 5CYQB 4IFVA 3CJ3A 1BQMA 1JLGA 4KV8B 3DDKA 4J9QA 2FJXA 2B6AB 5HP1A 3SI8A 4WE1B 2FJVA 3Q8PB 1S1VB 5C25A 4H4MA 4TY8B 4ID5A 3MR5A 2V0NA 3BSCA 4NYZA 4F4WA 4FBTA 4K4VA 4ED7A 2UVWA 2D7SA 5J1EB 4ECVA 3OSPA 1LWFA 2YNIA 3QGHA 4DL2A 4O44A 1T3NA 3DYAA 1S1WA 3KLGA 1RT4B 2RDJA 3RB3A 3CDUA 3H2LA 2OPPB 2IJNA 3LAMA 5KFXA 3LP0A 5CYQA 4IDKB 4NLTA 1BQMB 1JLGB 4IKAA 4PWDA 4R5PB 2HAIA 3FDSA 3KHHA 3QGIA 4J9PA 4ECYA 2V4RA 5HP1B 4IG0B 3FFIB 1MU2B 1R0AB 2FVCA 2RDIA 4QWDA 3N6NA 2ALZA 2JEGA 3HVTA 4RU9A 1UWBA 1LW0B 1LWEA 1S1XB 4ID5B 3FQKA 5L1LA 1HPZA 3QZ8A 1RA6A 3BR9A 1S97A 2GC8A 3BQ0A 4ECWA 4NLUA 2AQ4A 2W8KA 4O4GA 4ZP8A 3DM2B 3DOKB 5DQGA 5DLFA 5KG0A 1XR5A 1IKYA 3CDEA 4KSEB 5F8JA 2XCAA 4IG0A 4RW4B 1R0AA 5DG7A 2WHOA 3KLVA 4DL4A 1JLCA 1FK9B 4WYWA 4GC7A 2FLLA 1LW0A 1S1XA 2WONA 4WE1A 4FBUA 2WB4A 4Q8FA 4RW9A 3T5HA 1REVA 4OL8A 2IM1A 2I5JA 3LALA 1RTHB 2D41A 3MTKA 4EO8A 3BQ2A 2IAJB 3RB4A 2J6UA 4TYBA 4RNFA 3HVAA 1HQUA 3ISND 3I5BA 3MFHA 2W7PA 4NLXA 3KJVA 2HWHA 3LP2A 2BE2B 3UQSA 5F9LA 3BSOA 4QWEA 4F4YA 2RKIB 4ICLB 1RT4A 2B5JA 2RF2A 2BQ3A 2ATLA 2OH2A 3ISNC 5F8LA 3LP0B 3KK3B 4IRDA 3G6XA 4I2PA 4ZP7A 2W9AA 3DLEA 2W9BA 1IKXA 4LSLA 4PWDB 3M9OB 5HLFA 5F8NA 2WONB 5T14A 3OHBA 1U09A 5J2PB 4RW9B 3HVTB 4NLYA 5KFAA 4J9MA 4O3PA 2YNGA 1K1QA 4JV0A 2CJQA 1KHVA 1HNIB 3PW4A 1ZETA 1TP7A 4URSA 3LAKA 4KKOB 4URQU 2BQRA 2FJWA 4ICLA 4RNNA 5I3UA 3DOKA 1VRTB 4J9OA 2ZKUA 4M95A 3TQ1A 1RTIB 1IKXB 4LSLB 3CVKA 3IS9A 2J6TA 2B6AA 2FVPA 3FRZA 4TLRA 1S1VA 1KLMB 2ZE2B 5C25B 5HROA 3QIDA 5DGBA 5KFCA 5J2NB 1HNIA 1CSJA 3GQCA 1J5OB 4NLSA 3N6LA 2UVVA 4LSNB 1C0TA 4MK9A 1S1WB 3KLGB 1DTQB 5C42B 1K1SA 2BE2A 4Q44A 1IM4A 4ECSA 2VA2A 3KLHA 3KLEA 4K4SA 2B5JB 2RF2B 1BQNA 1TKZB 3OLAA 3NAHA 4ED6A 4R5PA 4RW6A 1S9EB 4M94A 5KT4A 4I2PB 1I6JA 3RAXA 2IJFA 4K4UA 1TL1B 1LWCA 4URGA 2YNHA 3HVWA 4O3SA 4ECZA 1UWBB 1XR7A 1QE1A 2V4QA 3MFIA 4ZVEA 5J2PA 2XI2A 2GIQA 4ZPBA 3G6YA 4DL3A 3PW2A 2W9CA 3PR4A 1IKWA 4KO0B 3H4BA 2IC3B 4LSNA 4IH7A 3QYYA 4KE5A 3UDLA 3OLBA 4I7FA 2R2TA 4FS1A 5KFEA 4MK7A 2I1RA 2XI3A 4KBIA 4WZMA 5CYMB 3KLHB 2IM3A 5KT5A 4B3OB 4MIAA 1BQNB 1TKZA 3ITHB 1YVFA 3C6UB 3DMJB 4RNHA 4MKBA 2BRKA 4DEZA 1HNVB 3BQ1A 2AX0A 4JUZA 4RUAA 5K14B 3T5LA 2HMIB 4YMEA 2JEFA 3DRPB 1FK9A 5D3GA 2CKWA 1C2PA 4RNOA 4ZHRA 4PUOA 4YR0A 3KHGA 3CJ2A 3H5UA 2GIRA 5HROB 4NRTA 3UR0A 2VA3A 1IKWB 4KO0A 4K4YA 4QWCA 5JXSA 4TN2A 1N6QA 1RYSA 2YKMB 3QLHA 4WFXA 1JLQB 3T19A 3HHKA 5KFOA 2FVSA 3I0RB 2RKIA 3OSNA 4NLVA 3ITHA 3C6UA 3DMJA 3KLEB 3KK3A 4RW7B 4WYLA 4RZRA 1S9FA 1HNVA 2W9BB 3NAIA 4U6PA 1S9EA 4EYIB 4HKQA 3MEGA 5D3GB 2YNFA 4NLPA 3QO9A 4R0EA 3ICLA 1HYSB 3EPIA 2BQUA 3V6DB 4TY8A 4LQ9A 5KFQA 1GX5A 3MECA 5KFHA 3IN5A 1N6QB 1RTJB 5KG4A 2ASJA 2VG6A 1ZTTA 2YNIB 1LW2B 4J9RA 3I0RA 1RA7A 3TAMA 5KFLA 2HNZA 3PR5B 5KT2A 1SH3A 5CYMA 4IDKA 2JEIA 5FDLB 4J9KA 3NMAA 4YR2A 1RT7B 4H4OB 3KK1B 1ZTWA 4XPEA 4KFBA 3PZPA 3GV8B 3T1AA 3FQLA 2YNFB 1MU2A 2BANA 1C1BB 3MR2A 3DRPA 3N6MA 4NLDA 1TVRA 1JKHB 5KFWA 3MECB 1Z4UA 2AU0A 1RTJA 3PJWA 3G86A 1TQLA 5L1JA 1S0MA 3PHEA 4TQSA 1RT1A 3TAMB 5C42A 3M8QA 3DM2A 2HNDA 4EBDA 2E9RX 3DOLB 1TL3A 2QV6A 1IKYB 3D28A 1D1UA 4H4OA 4ZP6A 1SUQA 3MR6A 3QIPA 3CO9A 2C28A 3EPGA 3GYNA 1JLCB 5KFJA 1TVRB 4K4TA 3MEGB 2XWYA 1JKHA 4NLWA 1T05A 4R8UB 2R8GA 1OS5A 1REVB 2OPRA 3GILA 1S0NA 4U7CA 3M9MB 3JSMB 3CJ4A 4Y34A 5L9XA 1HQUB 1RT1B 1EP4B 3KJVB 4F4XA 4ECTA 1LW2A 1RDRA 4ZPDA 1N48A 2ZD1B 4IOBA 3NBPB
chains in the Genus database with same CATH superfamily
3MM8B 5ETTA 4DG1A 1R7IA 2G0IA 4IQMA 4M8LA 1WDTA 3LP1B 4ZIVA 1FA0A 5E7OB 2OPSB 1OWXA 3V81B 3M32B 5LM7E 2QA4S 4CM0A 4OJ1A 1S1TB 1IBKF 3CSKA 2DTJA 1AB8A 1EZZB 2UVRA 3MMBA 4X4PA 2VICA 5IV4A 1YRXA 1FFGB 2CQPA 4B17A 2G2YA 3BSNA 1DARA 2D3O1 1SC4B 1EJ7L 1VMBA 4F36A 3M4XA 3T6BA 2J0QD 1S57A 3TANA 2ILZA 4CIOA 5HBMA 5KFMA 2HNDB 2FJAB 2MKHA 3GG1A 3PW0A 1TK5A 4RW7A 1TFWA 4KJIA 3DRRB 1CJVB 3AXMA 3IS9B 1QUVA 2WOMB 2Z2MA 2OPQB 1EETA 3QO9B 1ELOA 4L6V3 3ILIA 3ZXWA 4DN9A 4ETXA 5F3ZA 2ZH2A 4FZVA 1WC5A 3Q8UA 2MTLA 5I3PA 5L46A 4QR1A 3GZ7A 5KFZA 2CZVC 4K4XA 4N5SA 1FKOA 2XMKA 4HTJA 3OD2A 4EBEA 1IKVA 1WC4A 2Y1RI 1DTQA 1VBKA 3A12A 3KUHA 5SUHA 1C0UA 3W5XA 2LQBA 2ZH7A 1N5YB 4DQSA 4AUKA 2DNZA 4KY3A 2QX0A 4C3KA 4DV0J 4MH8A 3LP1A 3NLCA 4IYQA 2LYVA 4WIQA 4CTAA 4KPYA 1Q78A 3V81A 1T03A 2FC8A 3EDRB 3HFKA 3LPYA 1NHVA 4UUWA 2ZJQQ 3SCLE 2QFJA 1IWGA 2QN6B 3KLFA 4M5MA 4CH1A 4USWA 1NMEB 4QW8A 3KHLA 1DURA 1U49A 4OYXA 4LIRA 2RU9A 4F50A 1NKCA 2WTFA 3OFEA 5CH7B 4USMA 2FZCB 2CG8A 1SJFA 2MSTA 2X1BA 1HI8A 2O67A 2HK2A 1NBEB 2DHXA 3DRXA 3ZO7A 5H9FJ 1YSJA 4C3LA 4Q43A 3V4IB 1I3OB 5HBMB 3NGSA 1WC6A 3OTOJ 2HBZB 5LJ5Y 3DLBA 1RU1A 2JRSA 3OV7A 1C1CB 3DRRA 1X4EA 5KT3A 3E01B 2R7RA 4FNHA 4LF6F 3FCVA 1N54B 2XY6A 4OX9J 4P7VA 4CLWA 3S01A 1T05B 4NA3A 3C14A 1LWFB 1H0HB 1S9GA 2R7XA 3I9ZA 4WXWA 4FP9A 1FDDA 1QJHA 3MPYA 3QLHB 3C15A 3PIPQ 1BXNA 3NWGA 5HANA 3TR5A 4EYHB 2HFUA 1H6KX 4DCJB 1RWNB 2R2UA 6FDRA 3OJSA 3D6MB 3ETOA 2MSSA 4RKUC 5A8KA 2EFGA 2ZH6A 2VONA 4UOFA 4PZVA 1YG0A 5J2QB 1PILA 2MHNA 3NG8A 4IG3B 4QR0A 1OJ4A 2N3OA 1MN9A 2JOQA 1OQ3A 2UUWA 1LWEB 1RGVA 1SH2A 2X7IA 5ETRA 5G4DA 4JOUA 1CG2A 5A0YB 3K5LA 2A2DA 2K1RA 4P10A 2NS1B 2OUGA 5LOQA 5K8NA 3P6YC 2V8HA 4O4RA 4XPCA 3HSZA 4LFCF 4WZQA 4NCGA 2C3UA 3DGPB 3E51A 2CQDA 2JHEA 3HZGA 4X65F 1N8RT 3OT9A 1JLAA 4D3HA 3MTJA 2GS8A 3ULHA 2LQ8A 4YHHJ 2JEJA 1HARA 2HS0A 4LRBA 4KAIA 3H5XA 3ZZOA 3QNWB 1ZM3A 2YPZA 3ENQA 4DU8A 4UQGA 3BH6B 1EX8A 4J9NA 2VFRA 3BREA 2MYFA 3V4IA 4YB7A 3H40A 4HYKA 4ED3A 1VQOS 4I2QB 4TLQA 4CLSA 1VBXA 3C2PA 4RW8B 4KFBB 2ZC3A 3HO1A 3TOQA 4ZPTR 3OTCA 3L09A 4NXMJ 4CLUA 3PV8A 4JI4F 3E01A 5BR8F 2IAJA 2UUCF 2Q79A 3HP6A 1LNQA 2XLIA 3MOJB 4Y3CA 4ALZA 2HVZA 1UFWA 1UVKA 2CIMA 1IR1A 2EC2A 2HVEA 2XULA 1O51A 3TW0A 2DNQA 3RBZA 2IVYA 3MEEB 1AROP 2BACA 2GHVC 2N3LA 4OYZA 2KG1A 1U47A 4B9NA 3KMQA 1JLEA 3MURP 2CNOB 2J76E 2LCWA 1O0PA 5KFKA 4DR2F 3KUEA 3PRVA 4DUYF 1DBDA 1HWJA 1NPPA 1F1BB 1U7LA 1CJUA 1UFKA 2ZJRQ 3X1LB 2DH9A 2GJ2A 2ZWOA 2F4VJ 2KT3A 1NK9A 2NLWA 4P6QA 5C2CA 3C19A 1DLOB 1FKPA 2G13A 2KO1A 4WFYA 1RAJA 2FLPA 1VQ8S 2DISA 2F1FA 2X1FA 3E8OA 1GXTA 5EHHA 2J6SA 3AD8C 4OZ5A 2DRDA 4NCGB 1KQKA 3NGDA 1K44A 3JSMA 5I3UB 2H65B 2J0WA 4PWWA 1MN7A 2OFGX 3KJFB 2MDAA 2FUG9 3IBWA 1UJ6A 2LXIA 3HLUA 3A13A 4H54A 4LRFA 1NJWA 1LV5A 3UD4P 5GMEA 4HH1A 3DFEA 1OY9A 1FERA 1F9FA 3QGGA 5KOXA 3QAUA 4A8SA 1IBMJ 2CNLB 2W25A 4QIVA 1QAYA 2RAQA 3FBFA 2QLXA 1RAHB 4X62J 3M30A 2R7WA 1HPZB 2ZZTA 4MT1A 3S1TA 2RE1A 5J2NA 3EXCX 3I0SB 4ZVTB 5MLCV 3K17A 3RB6A 2ZBIA 3PFEA 3ZZRA 2W7OA 1JB0C 3TJ9A 1WELA 4JI8F 2XMJA 1C0TB 1H74A 1M1GA 3RR8A 4F3OA 2M7SA 4FF1A 1URNA 3TUZC 2RVJA 3H90A 3DXBA 1JNZB 1NK4A 4DPWA 2OIHA 1MMLA 1I5OB 2FJDB 4CLYA 4A8XA 4XO0A 4KV8A 2LEAA 2QMUB 4OHWA 1HL6A 4JI6F 2FHJA 3CIZA 4CH0S 3E3XA 4ZCIA 3RBDA 3DU6A 2ZZMA 2VD3A 3NS7B 3JSRA 5HI7A 3W7BA 2YNHB 2M88A 3BN7A 1RT2B 4H4MB 1PO6A 2PEBA 4IUFA 2A2CA 2AX1A 2EVZA 1KQSR 2M8DB 3J80Y 2A1BA 2KYZA 2XSFA 3UCGA 4WFBQ 4DUZJ 1EIYB 5B0BA 2UUAJ 3N28A 2GHWA 1NRKA 1TL7B 2W2MP 1SKSA 4FPRA 4TY9A 2XO6A 4IH6A 2HSEB 3OL6A 3UCZP 2EBEA 4EO6A 4FF4A 4USIA 3W9HA 4FXVA 1M5HA 2R8IA 3FFIA 4JI7J 2EEYA 2GNKA 4NXNF 4OYPA 2QFIA 2DHSA 4TNOA 3CDWA 5KOWA 5FLXU 3VAKA 1L3UA 2H4WB 2K7KA 1QAIA 2LA4A 4WU2A 5KFBA 3DLKA 2D3OR 1NK0A 4DR7F 1PAEX 3Q8SB 1Q8KA 1S6PB 1NPRA 3BZQA 1PGZA 1SBRA 4UZCA 1H2VZ 4O3RA 2EC0A 2AT1B 3DI6A 2EK6A 2C2KB 2D3UA 2QE5A 5IV3A 5D0HA 3EGZA 1FXRA 3EICA 2R7QA 2HHTA 4XDDA 1VC0A 2MJUA 5I42A 5CYQB 4BHQA 1V3RA 2RUSA 4ES3A 5LSOA 1RKJA 1RWWB 4KV8B 3ZNJ1 1V6HA 1CJTB 4J9VA 2KH9A 2VU5A 4J9QA 2MLYA 2CG4A 2B6AB 2FJVA 1T02A 3D6FB 5GVQA 4DHVA 5CYJA 4M5HA 3Q8PB 1S1VB 2DKOB 4H4MA 4RBTA 1G6BA 4ID5A 2V0NA 4K4VA 1FRJA 2AYGA 3GIRA 1RAFB 2WSFC 4DFJA 1B0TA 5LXYA 5GMKa 4ECVA 2PFDA 3OSPA 2YNIA 4X84A 2QIFA 2GFFA 3KUGA 2DNYA 4P72A 5IM0B 3G4SS 2DGUA 1T3NA 1NK7A 1SKWA 1MMNA 3RJMB 3H2LA 4OYMA 5K8MA 3I55S 3JQJA 4AL5A 3AOBA 4LFBF 4IDKB 4USJC 2IDLA 4HT7A 4CT9A 2WSEC 3KHHA 4J9PA 4CQ1A 3L4BC 2D69A 3D4JA 3HI9A 3KWMA 3OR2B 1R0AB 3FFIB 3RRGA 2UXCF 4QWDA 4QU6A 1IBLJ 1YIJS 5IT0A 3HVTA 4Y00A 3FQKA 1LW0B 4GKJF 1R3NA 2ZUGA 2X3GA 3CIMA 4M5DB 3V4MA 3QZ8A 3BN4A 5AXKA 3MM6A 2BW7A 5L1LA 1RA6A 3OBIA 4K5SA 3KOAA 2DBBA 4USUA 3BQ0A 3MUTP 4U7UD 3MOZA 4E98A 2AQ4A 3JQMA 1SL1A 1AFIA 2W8KA 3QSIA 2LECA 3ZTSA 2KVQE 1RHQB 3DOKB 3KDOA 3H2UB 3HKZD 2KFZA 2XZWA 2VOPA 1FEHA 2ACYA 2AMCB 2Y1IA 3FNNA 3U1NA 3OXLA 2R7UA 4RW4B 4HDHA 2HQDA 2LXUA 2WHOA 1CJTA 1JLCA 4WYWA 4X4RA 3NOGA 2WONA 4B9UA 3RR7A 3W8PA 1AZSA 2WB4A 4Q8FA 3T5HA 4UZBA 2OTLS 2QEXS 2WB1D 2HHQA 1LKZA 2I5JA 3LALA 3IRWP 1CVJA 3MTKA 5D78A 4RNFA 4DLEA 4ZVOB 1S4EA 3MFHA 2B4PA 2W7PA 1DQ9A 1N33F 2QZ8A 4MJKA 1RK8A 1P1TA 2W4PA 1PAUB 3W66A 2RKIB 1VQ4S 3M2RA 4LBHA 2Y8WA 1OPZA 2BEFA 3GFXA 4L3NA 2ATLA 3ENWA 5ETPA 3KK3B 1IWAA 2M70A 2W9AA 3JS9A 3NCPA 2YQ0A 3M32A 1SQFA 3SSSA 1XNQJ 2DK2A 2DH7A 2LVWA 3AH6A 2EW9A 2QYCA 4JP8A 2IMOA 3OHBA 1YITS 1U09A 1Q8LA 3HVTB 2YX7A 1B0VA 1UETA 1XEZA 2LEPA 3MHYA 1UKUA 2B56A 4WP9A 3PACA 4AYBD 2EPIA 1AUDA 2DNMA 1Q82T 1KHVA 1X4FA 4JI3F 2RRBA 4URSA 3OVAA 1WG5A 4LJMA 4URQU 3R97A 3F41A 2FJWA 3BBFA 1H38A 1TL4A 3A8EA 3FMWA 4NX9A 3DOKA 4JBCA 4L74A 1VRTB 3C16B 1U1NA 4M5LA 1I94F 3TQ1A 1RTIB 4USVA 3IS9A 1VR6A 3R8YA 1ZYQA 1NH8A 2YKOA 5F0WA 3IWLA 1RLCL 2CPDA 5FD1A 3P3DA 1A9NB 1UVMA 2FVPA 3FRZA 5C25B 1RBAA 5DGBA 2OMLA 2PC6A 2ZH4A 3ZZ0A 1ZPVA 4ZJOA 4X66F 1HNIA 1FDBA 3GFHA 3KG1A 1E6YA 1QVFR 2CPXA 4ILMA 2RNEA 3C8YA 4MK9A 3EXYA 1DTQB 1B7YB 3I56S 1HKAA 2CPZA 4PYAA 5D0EA 4MAKA 2JVRA 4PXEA 2UXDJ 3M2RB 2AHOB 3TUJC 4ED6A 2BJEA 4M94A 1I6JA 5B08A 3RAXA 1U24A 1RCOB 5DM7Q 3MEKA 2IJRA 4URGA 2Q66A 1S12A 4DV7J 4ECZA 2V4QA 1S76D 2DNHA 3L95X 1UPPA 4ZPBA 2GIQA 3G6YA 3PW2A 3VF0B 4C9DA 3QATA 3EMTA 4UY8T 1IKWA 4F8RA 3TX8A 2KXHA 2ZH3A 3LPEA 4C8KA 4IH7A 4ZLLA 2KN4A 2JL9A 3UN5A 1KEKA 3HXMA 5KFEA 1WHYA 4GRSA 2I1RA 4MK7A 2H5JB 4A8OA 4X4UA 3KLHB 1L3KA 1FRKA 1MROA 4LF4F 2FY1A 2ROGA 3DMJB 3TVZA 4DR7J 3GG0A 3VAIA 3BQ1A 1Y00A 4OYBA 1K47A 3TA2A 4UUXA 1S59A 1C2PA 2OD4A 2H5EA 3CUNA 4TN2A 1N6QA 1P27B 3QLHA 2HFSA 2MHEA 2HBYB 1L3TA 1E6YB 4ZOSA 2ZDOA 4WFXA 2KHDA 3PCOB 2AW0A 1FVSA 2AYMA 3Q8YA 2V2QA 4JI2F 3VTIA 2YH1A 2L41A 2AYBA 2CQBA 3DN9A 4HI1A 4LR8A 4NLVA 5A8KB 2XY7A 2HLTA 4FXDA 3NGRA 3C6UA 2A18A 3PHTA 1KQGB 3MUMP 4CCHA 2W9BB 2E5LF 1HR0F 2FPHX 1UAWA 4FPIA 4RUBA 2Q1LA 1XMOJ 1U0HA 4NLPA 4AFFA 3SCJE 4DUTA 3ICLA 4PG4A 1RWVB 2VC1A 5A8WB 2DR6A 1NSQA 4HH0A 1GX5A 2CNNB 5A8RA 3MECA 2DNKA 3S7RA 3VGTA 5KFHA 3OVSA 2ASJA 4B3RJ 1ZTTA 2VKZG 1LW2B 1HNZF 4J9RA 3I0RA 2MLXA 1Q5VA 3BBCA 4OV6A 4DX5A 5IC4B 2G2OA 1TR0A 3OTEA 1FJGF 4LF2A 2CQ2A 1SH3A 5KT2A 2OTJS 2KYXA 2BJ7A 1K0TA 1MROB 2IDEA 3NMAA 2F4FA 4TVAB 3KK1B 4H4OB 2F3JA 4DQQA 1UVNA 1N32F 4KFBA 3W1YC 3GV8B 2ZOFA 4ED5A 4OI3A 4CLZA 2YNFB 3HHLA 1MU2A 3FBBA 4MMOA 1C1BB 3LOUA 1HBMB 3FSXA 1KOOA 4ZK7M 1OY8A 2YVSA 5KFWA 4OI4A 4ZCKA 1H3DA 3GJQB 2FB0A 3G86A 3PJWA 1S0MA 2QLJB 2KZZA 1X31C 1VBZA 2L9WA 3M8QA 2RD5C 3MPUB 1XQIA 3B6BA 1MWZA 4X4SA 4ERDA 5JVHQ 4P9SA 1D1UA 1RAAB 4ZP6A 3I31A 4MKYA 2MLZA 4DSFA 1SIZA 2KL8A 2OEKA 1WHXA 3GYNA 2Z2YB 3QAEA 4G1IA 2XWYA 4OZLA 1H7XA 4DPOA 4A8KA 2R7TA 1WSRA 4PG6A 4EGLA 2RQCA 3CD6S 3ENAA 5D4NA 4U7CA 2D9PA 3BO2A 3QJPA 1GT8A 3A8IA 3JSMB 1EARA 4Y34A 1NDPA 4YDXA 4CO1A 2KRBA 3M2VA 2OJ3A 1RT1B 1A6LA 4F25A 5AE1A 5B0EA 4ECTA 2IY5B 1LW2A 3GSIA 2BKOA 1BGXT 2W01A 4IOBA 2QGFB 3CW2C 2KXNB 3CB4A 1DAXA 1KONA 2UU9F 1QSLA 2B9YA 3FKBA 2CNKB 2YX1A 5EX3A 3OFGA 5F8HA 4LQ3A 5HJYA 5GAEU 3NNHA 3R5BA 2NPFA 1KD1T 4LF9F 2HMIA 2DYAA 2FYXA 1KHWA 1X9MA 2WK4A 2LQ9A 5CCLA 4Q7AA 2XGQA 3FC9A 4PUOB 1C1BA 4JV1A 4C2MA 1S49A 1KP6A 1BWVA 2DGOA 1RHKB 5IQQA 3X3UA 2BJ1A 4OI2A 2IA0A 4N47A 4DU7A 3UPFA 1KWMA 1HW9A 1YKWA 2EXUA 5EWEA 4X4OA 4DS5A 3NNCA 3IRXA 2KU7A 3FMBA 5H9EJ 3T5KA 4DQIA 1ZH5A 3J7AN 3P96A 1HFEL 3AHPA 2NXJA 4NL5A 2YWEA 4OX6A 4YOEA 3HX9A 3H98A 3JB9k 5HMYA 3WZ0A 1RT2A 3RRKA 4YP3A 4DV3J 1RT3B 2OPSA 3KNGA 4PRFA 3BPDA 1HQEB 1D8ZA 1U45A 2B9EA 5IT9Y 4DX7A 2P2CB 1UJ5A 3UW1A 1G3OA 3GR1A 1NSAA 2FHMA 1FVQA 3I87A 5F3TA 3V6DA 2AP6A 4QBUA 2DNGA 4DZDA 4G1QA 3MMBB 3NEKA 1G7CB 3JSYA 3RGIA 3H20A 5DDOC 1CEZA 3K2YA 1LOUA 2VG6B 3GYGA 4C8OA 4FS2A 2E44A 3FBCA 3QFWA 1GXUA 5KT6A 3PW7A 1S10A 4IRCA 2HNZB 2NR0A 1YK9A 4IH5A 2XGPA 4F02A 3JTNA 2IM0A 3SEOA 4UQTA 3N9UC 4WWSA 5BYSA 4UT4A 3BKTA 2C2EA 2V9WA 4XDCA 1CC7A 4LFAF 3K0JA 4QCLA 1T11A 3TJ8A 3CCRS 3HJFA 3IM8A 2AGPA 1QE1B 2R2RA 4OHXA 3Q22A 1DFDA 2GZOA 1GMWA 2W9CB 1Y7PA 1HNWF 1FKOB 5E0OA 4O3OA 2FVQA 1U2CA 2Z58B 3FK4A 3A1YG 3MF5A 4PQUB 3PFOA 4U8VA 4QPXA 4LF8F 1B0PA 2RJZA 5IT4A 2XCPA 1UA1A 4X2BA 1NCLA 4P2FA 1N5YA 2POKA 3SZ2A 2BV3A 2DXDA 3HSDA 2XQCA 4OYWA 4QW9A 1RHJB 8RUCA 3VZIA 1QTNB 2Y9HA 1DY3A 1FXLA 2RRNA 2EFVA 1YDLA 5HATA 1RT3A 5GAHI 1Q5YA 2HQFA 3MPDA 4W90B 4EEYA 1OSCA 4ECUA 3KLFB 3SIPB 1XR6A 1FWLA 7FDRA 1GTHA 4ZHRB 2RHQB 4NLQA 5IFMA 2D3ZA 2VC0A 4OLOA 5LXRA 4AL6A 2DR7A 3PX4A 2FGCA 1R0BG 5GAHU 1QTMA 4GMKA 4G1QB 3CXCR 2I0XA 2XO7A 2ZITA 1HWIA 5F8MA 3H59A 1R89A 5HVFA 2XMVA 1EP4A 3DRSB 2XYHB 2QO3A 2RMLA 2ZD1A 1KTQA 3QRPA 2BRLA 1N33J 1HR0J 2DEIA 1PC4A 2XNQA 2AZ1A 2J0XA 1JIHA 4C0HA 2MY7A 4ETZA 1VQNS 2NXUA 1XJWB 2AKWB 2R3VA 3KK2B 3M6VA 3OFFA 2QMWA 2ADCA 1GXLA 1XNQF 1IBLF 2C42A 7FD1A 1R0CB 1Q1KA 3AOAA 4GVBA 5DS7A 3TZWA 3DLGA 1GQEA 4O3QA 3POTA 4HEA9 3ZZTA 1SL0A 2JNJA 2IA6A 4FVCA 1T9XA 2WSCC 5F41A 4RUAA 3GJTB 4TU9A 1JQGA 2GO9A 2C2OB 1F9HA 1BE4A 1VYAA 3RBEA 1KOHA 1KN6A 1C4CA 4WBFA 4DV3F 3PX6A 2P9GA 5DQIA 5FDLA 1VQ5S 5F8NA 1AZSB 3W65A 3SQOP 4DSKA 2I5JB 1VQKS 4R25A 2R2SA 3UE2A 3SFGA 2P6SA 3R7NB 2DNNA 1HWKA 2M8HA 4J9LA 4NCBA 1DRZA 5A6WA 4F0KA 1Z1ZA 1KKHA 2PGCA 2AV5A 3SDEA 4X66J 4E8UA 4ZVUB 1HIYA 2E1RA 4N7TA 5T7LB 4EU0A 4JI0J 2V50A 2FZGB 3D66A 3D54A 3FEYB 3TP2A 1H73A 3UO0A 5IZHA 2DPJA 2CJBA 2CJYB 5KG6A 3V5RA 2UXDF 2ASLA 4UOGA 2PMWA 3MEDA 3CCWA 2DGQA 4QR2A 1TUGB 1TU0B 2EWHA 3PY8A 2UUBJ 4B3SJ 1MMDA 5HQLA 5M2UA 4QYRA 4KT0C 1X5SA 1RTDB 2KTQA 2DNLA 5THWA 2YKNA 2LU1A 3P49B 2DIVA 3B8HA 2X1GA 4TXSA 3EZ5A 3AJ1A 1RTIA 2EFQA 3HSGA 3D1HA 3P5BP 4X4QA 2Q6BA 3T1YF 2C1EB 1JLEB 2GJIA 3R6LB 4U8YA 1DJ0A 1CS4B 5DM6Q 2FHJD 4USTA 3HPOA 1CJUB 4WKYA 2G1DA 1L3VA 2AGOA 1NHUA 5CZVA 3PTWA 3F56A 5B0DA 3VAJA 1RWUA 2CPHA 4DV1J 1S0OA 5C24B 3EDQB 1TTHB 4NLOA 4QZVB 5J1NA 4K2JA 3W2WA 3JYTA 4OX9F 3RAMA 2VJUA 2BABA 2DD8S 3CCUS 4PXDA 4B3MF 1HD1A 4HR2A 2M5YA 2WRMA 2C22A 3KDNA 3EZUA 4EWTA 3HFVA 2MZSA 2XMTA 3I96A 4IFVB 4ZPVR 5JVGQ 3M8SA 3CCVS 1PBUA 3GB0A 1GH8A 3IR6B 4K50A 5B0CA 5E3QA 2HQCA 3DLHA 3THVA 2V8VA 1QDUB 1FDNA 4CDIA 4W92B 1WI8A 1DHMA 1R31A 1S77D 2HHSA 1RHRB 2OO4A 5KFDA 2MZQA 2FLNA 2W4DA 3TRGA 4FYXB 3CJ5A 1KVKA 1YRTA 3W9JA 1RTHA 2GVZA 2DPIA 2OLWA 4P52A 1QVGR 4GC6A 4IR9A 1Q81T 3IWXA 4PXBA 3BB5A 3ILOA 3OW2R 1RCXB 2CQ0A 4Y2AA 5GMDA 2DEJA 2YXLA 6AT1B 1RT5A 4A8YA 4FYYB 3VWSA 3G6VA 3HDSA 3BPSP 5KG2A 1WTBA 2PD1A 1VCTA 1SQEA 1KTVA 4LF7F 3MXHP 2BUNA 2O5DA 3H4DA 1RYRA 4QYZJ 4FF2A 2W7AA 4DL5A 1VK3A 1W7WA 2B7CB 3P5TL 3VQSA 1MWQA 2AWZA 2ZHOA 4C98A 1KNZA 1IQTA 4M63A 5CXTA 3HKWA 4OZ1A 3MD3A 1QY7A 1R27B 1WACA 5KTQA 4F3MA 5KG5A 2MZ1A 5HSPA 1HNWJ 2GMHA 3I9V9 2HPUA 2DCLA 2MJNA 1RSCA 4JI5J 4ZCLA 3JYTB 3PVXA 5BXIA 2J9EA 1N88A 2Z57B 3HHLD 8AT1B 4QIFA 4IRKA 5D15A 3J81Y 1SVDA 2F8EX 1FDAA 1MNEA 3WQPA 1VQLS 3R7BB 1FFSB 4IFVA 1KC8T 4HDGA 5ETQA 1JLGA 1VS3A 2AJ2A 4WP8A 5E3PA 4CO5A 5HP1A 2XMUA 3SI8A 3DNCA 3R5CA 4LSZB 5ETVA 4WKRA 1V9OA 2MB0B 5A8WA 5B7WA 1CULB 3J7YI 4FBTA 4Z7YA 4XTTA 4ED7A 2UVWA 2D1CA 1KFSA 1R8AA 9RUBA 4YY3J 3TUPA 1YLXA 4DL2A 4O44A 3OTDA 3PG9A 3KLGA 2JDJA 5BYRA 4ELTA 2CQ1A 1AT1B 2WBRA 1LWXA 2OPPB 2IJNA 3LAMA 3FVYA 1YWXA 3LP0A 5CYQA 2DGVA 2L48A 3JSBA 5KFXA 1YJWS 5HJXA 1BHNA 4NLTA 2NYHA 3E2EA 4C8MA 4PWDA 4R5PB 2HAIA 4RUHA 4DR3J 3B4DA 2W2QP 3R3TA 4C11A 2FVCA 3PRDA 1MU2B 2PEHA 3RW6A 4Z37A 1UP1A 1A7GE 2ALZA 4RU9A 3CCQS 1S1XB 2M4MA 1YJRA 4ID5B 4RPFA 4WTOB 4LF5F 4OHYA 2HFZA 3OJUA 4AT1B 1F0XA 3AODA 3ONQA 2GC8A 3W64A 4ECWA 2DR8A 3TAQA 3M6UA 3UD5A 2J5AA 2HG4A 1X4BA 4JV5J 1YI2S 3ZTRA 3F0NA 5DQGA 3AXKA 4WFNQ 4C8ZA 4MIWA 5D4LA 3CDEA 1T9UA 4KSEB 2U1AA 2V63A 2XHWA 3FZBA 1WF0A 4NWBA 4FYVB 2RQ4A 3OR2A 4DPXA 1R0AA 2ZC4A 4QIGA 2ZH9A 2CVIA 4DL4A 3UN3A 1FK9B 2FLLA 2JX2A 1LW0A 4RW9A 1JJ2R 2KVIA 3MM6B 2HZCA 2YBVA 2D41A 3CMES 1YQHA 3RB4A 2FJEB 2K2PA 4TYBA 4RWWA 1WOSA 1WOOA 3M2VB 2B8QA 4P7TA 4NLXA 1UVLA 3LP2A 2BE2B 3UQSA 3WC0A 3WDOA 4AD6A 5K20B 4XK8C 3BSOA 1RI7A 3GWCA 2ZBPA 2B5JA 2RF2A 1S5ZA 1ZA2B 4TU8A 3LP0B 1NK5A 4IRDA 3G6XA 1H2TZ 5C2GA 4LSLA 4PWDB 1FRHA 2EG2A 5HLFA 2JVOA 3Q2SC 4ZVQB 1A0OB 1HHQA 4QIWD 4C11B 2WONB 1E6VA 4B3TJ 1FTCA 5G0RB 1KSPA 5J2PB 2VPYB 1WKJA 4ER8A 2CQGA 1HW8A 1RUSA 2YNGA 1TMJA 5D4PA 3D3CJ 1LXNA 4JV0A 4RWXA 3SSRA 4NA1A 1ZETA 1IVZA 3AT1B 4I4BA 1AW0A 4KC5A 5CABA 3M8ZA 4RNNA 1RWOB 3LWMA 4ZDNA 1HI0P 5EN1A 3F73A 2HHPA 2MQ8A 5JJBA 4DR4J 1R8BA 4NYPA 3DLJA 1N52B 1FRLA 4ID8A 4M5IA 4YHHF 1DZ5A 2YKAA 1B70B 2W2PP 3IBFB 5EGYA 5ITHA 4DR1J 4DL0C 1HBOA 4WU3A 1CQNA 5KFCA 2KJWA 4DV2F 1S72S 2DRBA 2BMBA 5EX0A 2HLUA 2RIJA 3CCZA 1YBUA 3HMJG 2UVVA 2K3KA 4LSNB 1K0VA 1S1WB 5DDQC 2CQCA 1F9EB 1XIQA 2VJVA 3VV2B 2JH3A 2BE2A 2J9CA 2UV8A 4Q44A 4IO9Q 3MMAB 3EYZA 2VA2A 3CC4S 3KLEA 1LFPA 2B5JB 2RF2B 5BYQA 1BQNA 1TKZB 3BF4A 2DO0A 3NAHA 4NPOA 4YB5A 3OLAA 3Q23A 5KT4A 4GO7X 2IJFA 4F3QA 2D9OA 4OZ2A 4ES2A 4O3SA 1UWBB 1VIOA 1QE1A 1YZ6A 2RILA 3IA0A 3MM7A 4I56A 1SJQA 5J2PA 1VDHA 2UZAA 4ZVEA 3MFIA 4DL3A 1BD6A 3VGSA 1FD2A 2W9CA 4EZ9A 4KO0B 4OV1A 2QC3A 3AOCA 3OLBA 5E3AA 2HRUA 2R2TA 3FGVA 4USKA 1AYEA 5K9FA 2CPFA 2XI3A 4KBIA 2IM3A 3R1HA 1ZZFA 4MIAA 1QLNA 4L72B 3ITHB 2BJDA 3RYLA 4X65J 4HACB 1YVFA 2JFKA 1JXEA 1VQSA 2GGPB 4MKBA 1M1HA 4RO0A 2P8IA 4RNHA 5K8OA 3PO5A 5HN0A 1OO0B 2AX0A 3IAS9 5K14B 3NS6A 4FKYA 4YMEA 3UNGC 3DRPB 3CT9A 4DXLA 4E2FB 1PJ7A 2A6OA 5D3GA 1FESA 1LFWA 4JYAJ 4RNOA 4ZHRA 3RG6A 2XNRA 4QYZK 3UR0A 2UXBJ 5DDRC 4B9MA 2NUHA 2RQKA 4C8NA 1IKWB 2OKQA 4K4YA 3HT3A 1RYSA 3IAM9 3A4TA 2HS3A 5BR8J 3FUYA 1YBTA 3GR0A 4J90A 3ELHA 1MW7A 2CPEA 4X4NA 3M1VA 4FXWA 3THPA 2F8MA 5D0RA 1GK8A 2PI4A 3MMAA 3DMJA 3KLEB 2AYEA 4RW7B 2E5GA 1R43A 2VPWB 4PYDA 2PN6A 2RT3A 5T41A 1X4AA 2MKCA 4BCAA 2DB1A 4ZVRB 1R6VA 1ULRA 4HKQA 2HRTA 4ATNA 5CAAA 2MEWA 4WPAA 3QO9A 4M5KA 2MY8A 5CD4H 3EPIA 2VOOA 4I6WA 1T7PA 3LO3A 2ZEJA 4TY8A 4LQ9A 4USHA 4C0BA 2VQEF 3MM5B 1WKLA 2W24A 1FWKA 3IN5A 1N6QB 1T0TV 1VIXA 4OYOA 2HAFA 3EGNA 5B0FA 2UU9J 3K89A 3SV4A 1ZM2A 4BWMA 5HO4A 4O0IA 1N34F 2AJQA 4P2MA 2V8DA 2A10A 2AF6A 5RUBA 1RWKB 3PR5B 3HF5A 2Q3PA 1VI7A 4LBIA 5D0GA 5FDLB 4EFAC 2F4VF 2JEIA 5H9FK 1ZTWA 1I94J 2GGPA 3T1AA 4K5RA 2BE9B 4QOTA 5U47A 3CJQA 2PA8D 2GVDB 3GLJA 4B9SA 5HVGA 2VZ9A 2I9SA 3DRPA 2R7OA 2HQ3A 1TVRA 3MR2A 1JKHB 2QL9B 2PFFB 4AQYF 2HHVA 3FCHA 2CYYA 1B3TA 3MECB 4C4WA 3G82B 2HQGA 1PCAA 1Z4UA 2AU0A 3JAMY 4CLPA 1N36F 4X62F 1T9TA 1J5EJ 1QM9A 3MPWA 3D3BJ 3SDEB 4DFMA 5C42A 1VJWA 5T7LA 1Q95G 3DM2A 5GADI 4EBDA 3QBCA 4EI2A 2E9RX 3L7PA 3SBMA 3M1VB 2IVFB 1IKYB 2H3EB 1UPMB 3D28A 1FE0A 4NEYA 4H4OA 1YJUA 1TK0A 1B7FA 5GAGU 3MR6A 4DSIA 3QIPA 3CCSS 2LXFA 2ZHAA 2NPIA 5KFJA 3O2IA 4NLWA 2PE8A 4P73A 2ZH5A 2DVIA 1T05A 4R8UB 4P74A 4F2SA 2XS5A 1XMBA 1S0NA 2W1BA 3DHXA 4OYIA 4A47A 1Q53A 3JAMU 3M9MB 5L9XA 1M0SA 2CJ9A 4DCPB 1XNRF 3PXGa 5KAKA 4RU2A 1RDRA 4ZPDA 1N48A 4LR7A 4OQJA 4X64J 3NBPB 2J9DA 2P9EA 2CQIA 3NKYA 4PR6A 3M8YA 5I4MA 3J7ZT 5E41A 2QYGA 2LP4A 5EWFA 5J2QA 2YTCA 3KFWX 1T8EA 4IG3A 2B0GA 2B51A 4B3TF 2NUUG 2CFXA 2FY8A 5LMUJ 3US5A 3SQGA 3H5YA 3R7SB 4EBCA 4ZVFA 5CZXA 5DLGA 1NDCA 2R4FA 1NZ8A 5C24A 1WHVA 5K5MA 2AIRB 2HBQB 3W2WB 3ZC4A 4CNZA 2YQ1A 3NGUA 3QFHA 4OLPA 4Y6IA 4B9TA 4FNIA 3DLLQ 4CRJA 2DNOA 4ZMMA 1JLAB 4DR6J 1TKTB 4Q0BA 3PW5A 2AZ3A 2GCFA 3D67A 4B3MJ 3M8PA 4Y2CA 3V2UC 3R2DJ 2IRYA 5KFGA 1HBUB 2VG7A 1BY9A 1S7HA 1VGYA 1Y9OA 4F67A 2W8LA 3V6KA 2GQCA 2M52A 1GMVA 4X4TA 3N79A 1HMVB 3OHAA 4RW8A 3BS9A 3BSAA 4NXMF 2IHR1 1UZHA 3QIPB 1WJ9A 4ANDA 5ETSA 2YX4A 2GVZB 2E9ZA 1HYSA 1ICEB 4KB7A 4NMXA 3VR1A 3PJXA 1RAGB 3A8KA 4KHRA 1VRUB 4UW2A 4ZN1A 3GYXB 3K5OA 1P9QC 2HVIA 1QSYA 3K5PA 4WJBA 1ZM9A 2IBKA 2CWXA 1Q4RA 2COLA 2MKKA 2VODA 4YN3B 4OZ0A 5KFUA 1HNZJ 4IFYB 1H72C 5DRKA 4JI1J 3NBPA 4CNYA 4KIAA 4LF1A 1RT7A 1WTFA 1EQMA 4ZA1A 3R5JB 3QT7A 4N76A 1I1GA 1S6QB 4LFCJ 2BANB 1LWCB 1FRXA 1V5IB 3PDNA 5AT1B 2MXYA 2HIYA 3UR3C 5K8PA 2UXCJ 2O01C 2N4CA 4OZJA 2YH0A 2U2FA 1IBKJ 1J2VA 1X7VA 3AB2B 4ED4A 4RR5A 2BE7D 2KRRA 1S79A 2DT9A 4ANEA 3WIVA 4ZJQA 4LF5J 1TKTA 4OYAA 3HJVA 2Y0BB 1RBOB 1ROFA 4EMDA 3Q89A 2XSJB 3GE9A 4U9RA 1EB0A 2LFVA 5HMWA 2KDOA 1D9AA 2AEMA 2OEJA 4ZCMA 4B02A 1HMVA 1KVJA 2V68A 3M30B 1FI4A 2ASDA 2DR9A 2VFVA 3MM9A 3I0SA 1GMWD 2IPOB 3CCES 2PIIA 3EX7B 5M2PA 1O5JA 4O44B 4ZVGA 1Q7LB 1NLKL 3VZHA 3NRBA 2RS2A 3OVBA 1U2RA 1T3OA 4LUBA 2OPPA 4PQUA 2CADA 3DGVA 5KFNA 1NB7A 1JXVA 3MD1A 4GKKF 3TX0A 3KKFA 4A46A 3NL0A 1SB6A 4N56A 1VC5A 2B43A 3P4UB 1WG1A 1YJTA 3V6JA 1WC3A 3D5MA 1ACMB 4PEOA 3DDNA 3QZ7A 1PG5B 4Y2KA 4KYZA 2VQEJ 1U1RA 1BLUA 4RLEA 4ZITA 5KG1A 1S1TA 2BKPA 3BEGB 1FRIA 5KG3A 1WI6A 2QLWA 4MKAA 3UDEA 4F0MA 5HL7Q 5DG8A 5KFYA 2FIUA 3CD0A 1S99A 5C7PA 1B99A 4NZ0A 4YUDA 2ZJPQ 4ED8A 4S0MA 2ILYA 5H9EK 1NK8A 4UY85 2QG9B 3T41A 1M5KC 3DHWC 3DRSA 5F9NA 2B4VA 1K8AT 1IBMF 2CDQA 2QLFB 4F7VA 4JI7F 1WD6A 2WAQD 3GIMA 3GIJA 1OIAA 4ITSA 2GMLA 3MAHA 4MIBA 4KQZA 2XMMA 4RBVA 2HURA 2X1AA 4DL6A 2AGQA 4BS2A 1CJVA 2UVUA 3DLKB 1WSVA 3Q8RB 2Y1JA 4KGZB 3CCJS 2CQ4A 3HK2A 1S6PA 4DR5J 1R6YA 4RUCA 2Q6CA 3VVUA 1JMTA 4ELVA 1YBAA 1RTZA 3OUYA 3LP2B 1QSSA 1HA1A 2OHDA 3HHDA 2VL1A 5L1KA 3K5MA 3D1QA 4NLRA 1FCAA 3IXQA 3CWJA 5ETLA 2HWTA 5KT7A 5GADU 2CJKA 1UCNA 2Z2LA 3DRYA 4O3NA 3K58A 3TI0A 1K73T 1KLNA 4FYDA 5AE2A 2AJ1A 1D8YA 3DOLA 1NEEA 3SSQA 3GV5B 2KT5A 4C7QA 2HFNA 5LL6d 3B4MA 4PG8A 3QSYB 2MQLA 3T1HJ 8ATCB 1SUQB 2OELA 1X0PA 3CJRA 5DO2A 1NKBA 1HI1A 4ZPAA 2K7JA 1WEZA 2PT0A 2G9OA 3KG0A 4G6VB 3BKUA 4WTYA 2E1MC 2OPRB 2R8JA 1YJNS 3UD3P 4OI1A 1J27A 1VLOA 4QJVA 4N41A 1S4FA 4PQAA 1VQMS 3A3NB 3CDAA 3EWGA 2OP5A 3ISZA 4HLBA 1RP5A 2VG5A 1IXKA 1XN9A 3W9IA 1U2FA 4C0OC 1BC6A 4NRUA 1VJQA 5EUHA 2ASYA 2J8AA 5DGAA 4MKVA 4DR4F 3OTOF 1S1UA 3C6TA 3AA8A 2ZNYA 2V2KA 3Q86A 3NGKA 2Z8QA 2H54B 1CPZA 3KG4A 1D9DA 2YY3A 4NZ6A 3TZXA 3IM9A 2DHAA 5D4OA 2JLFA 5SZTA 3C14B 4DR1F 1AUSL 1YHQS 1FNXH 3M9NB 1S9GB 3U27A 4JI4J 1U6FA 4OZNA 4QIEA 2ABYA 3L9ZA 4DFPA 2V5HG 1P1LA 1EAYC 2YKNB 3QT6A 1S6UA 2VHGA 2C2RA 1N56A 4PABA 1JLFA 5D8HB 1NB2A 2OMOA 2CRLA 3W3SA 3SXLA 3O1LA 4F4AA 1CS4A 4Q45A 4RW4A 2VBXA 2VIHA 3MMCA 4MFBB 3MM7B 4UTGA 1NHKL 5DQHA 2VQFJ 3PYEA 3HD2A 4WFZA 4OX8A 5J1EA 1WWHA 1FX2A 2ZH8A 1UA0A 4WP3A 1NSKL 2WBMA 1XMOF 3DYAB 1UMJA 4FDFA 4BBYA 3DGPA 3N01A 4M5NA 4NA2A 3IFEA 2JWNA 4WXOA 3W2VB 4DR3F 1FF2A 3G6ES 4F4ZA 2ZDPA 1L5UA 3CC2S 1X8DA 2BX6A 3M2UB 3TVKA 3D0IE 3JQKA 3LGHA 5KFTA 5IT9U 2LQ5A 1AFJA 3ZZPA 4PKDB 3KNAA 4DL7A 3I82A 2VG5B 5K14A 1T94A 1FEEA 1ZAWA 1LEOA 3GV7B 1U1KA 2M2BA 4I2QA 1TKXA 1VQYA 4JV5F 2MKIA 2NYIA 4NZ7A 1HHTP 3BGOP 5CQGA 3EE3A 4MYUA 4UOHA 1TMMA 1HWUA 5D77A 2UXBF 4K4ZA 3T5JA 2JC1A 1R8PA 2ZUAA 4J9UE 4KGXB 3R9LA 3OR1B 1VRTA 3C16A 1C4AA 2JFDA 2QRRA 3HSJA 3HZEA 3M6XA 3CJ3A 3N5FA 1BQMA 3UDVA 4CO2A 4U95A 2CAJA 1XTZA 4JI0F 4NOHA 1YX2A 2C3PA 3Q83A 4ZN3A 1NDKA 3G9CA 3TZYA 2L08A 5C25A 4EK2A 3MMCB 4Y0FA 5E33A 4TY8B 3S6EA 3BSCA 4NYZA 4F4WA 3MM5A 4WF9Q 2C3YA 2EBGA 5J1EB 2XZTB 2C2NA 4ZPWR 2LQJA 1Y5IB 3QGHA 1D3WA 2OFHX 3GSDA 2E7WA 3DYAA 5A76A 2J9DE 1RT4B 3D68A 3MUVP 2ZH1A 3CDUA 4ANCA 1V3ZA 2DY9A 1N0UA 2AJFE 5FJ4A 2MKSA 1JLGB 1MWYA 2L9NA 4DJBA 4EUVA 3FDSA 1HHSA 1SC1B 2BJ8A 2JJ4D 2WVEA 3G87A 3QGIA 1TAQA 1VLYA 5HP1B 4IG0B 3RZAA 2GVDA 3ZNUA 4CI0B 3GP9A 3NGTA 1TL5A 2G0JA 2F5GA 3N6NA 4K8RA 2MZTA 2DGWA 4N8OA 3D0HE 5I3QA 1JWWA 1CULA 4DDFA 2EI5A 2LDIA 1HPZA 4NXNJ 4DV4J 1VRQC 1SC6A 2LA6A 1M5SA 2NZCA 3FSYA 3G82A 2A0FB 1CJKB 2ALYB 4FYWB 4ILRA 1S97A 4LF9J 4NLUA 2YWWA 2PI5A 4O4GA 2HFVA 3DM2B 1G2EA 1BQXA 2R42A 3AY0A 1LXJA 1XR5A 2PO4A 5B0GA 1IKYA 1TAUA 2F9DA 5F8JA 1X4CA 2XCAA 5DG7A 3FRYA 1FX4A 4WFAQ 3KLVA 3I4PA 4FBUA 1CQMA 3Q8VA 1S1XA 2YWKA 1PJ6A 3S8SA 2ZHBA 1OYEA 1U8WA 4OL8A 3WC2A 2G2ZA 3LH2S 1NJXA 1VQ6S 4I1TA 4EO8A 3BQ2A 1RU2A 4CYUA 1U1QA 5E3RA 1IR0A 2QA4G 3HVAA 3ISND 4DX8H 4DUZF 1XK8A 1TZ0A 2NXNA 4I0WA 1YRUA 4Q2MA 2V6AA 5F9LA 4KHPF 5IXUA 2V2VA 2WVFA 4FN5A 4ICLB 1RT4A 2C3MA 1SPBP 2OSQA 4G1PA 2KB2A 2OH2A 2ZZNA 4MTPA 3T1HF 1APSA 4ZP7A 1GAOA 1SI9A 2C3OA 5DDPC 3SQGB 4U7UK 1IKXA 2RS8A 3IMQJ 1KQFB 4LVOP 2W9BA 1NKEA 1GEHA 1M5OC 4RX6A 3TO8A 1VQ7S 1SJRA 4LF7J 2IRUA 2VUGA 3PYDA 2FHOB 3RUBL 5T14A 4NASA 1XMQF 2HZVA 4RW9B 4NLYA 4Y28C 2NXCA 4J9MA 1Q86T 1FKAF 3AJDA 1K1QA 1HBNB 1OY6A 2IBOA 2KXFA 2VPZB 3MCOA 2CJQA 1X60A 1RWXB 3UDCA 3BO4A 3J7A1 2AEFA 2E5HA 4I68A 1WG4A 2GQ2A 1TP7A 2VB6A 4F04B 2B3TB 1FRMA 3TQEA 3BO3A 3AQOA 4N77A 3ZFVA 4K0KF 2DNPA 2GAGC 2FLOA 1HBUA 3J7YU 1X5TA 3KJQB 4M1KA 1TKDA 1VQ9S 2GMJA 3HULA 3THTA 1G1XA 4M95A 2NSCA 1Z2LA 1F3VA 1Q79A 4LSLB 1TUVA 2N4DA 3GCWP 4TKTA 5B0AA 3LTOA 4ZLJA 2J6TA 2UUCJ 3TUIC 4E0DA 4KTQA 2B6AA 3HHLB 5G0RA 1F5CA 1RHMB 1S1VA 1KLMB 2ZE2B 3MAAA 2HGLA 4TLRA 3W8GA 4F4KA 1IJFB 1T95A 1YZ7A 2EKYA 1M5PC 1V5VA 3UWTA 2I6WA 3MCNA 1WC0A 3GQCA 3IBCB 1SIWB 2YWGA 4CH7A 4NLSA 1UZDA 3CULA 4I69A 3AD9C 5A2QY 4HT5A 1U25A 2JZ5A 2BW2A 1PYTA 1H2UX 3QWUA 4FKXA 2XLKA 2KM8C 4LFBJ 1M5VC 4RW6A 1S9EB 3W63A 3R1LA 2W2NP 3CF5Q 4FF3A 3BGLA 1LWCA 3QWPA 3RTVA 3VCDA 3HVWA 2DGTA 3L7UA 1KDNA 2A3JA 2E7VA 3W60A 5IWAF 3J7Z5 4M5DA 3EZOA 3HM9A 2XI2A 2RRAA 1N0VC 1HBNA 3H4BA 1N34J 2IC3B 4LSNA 3QYYA 1UEKA 2DO4A 4I7FA 2O66A 1EKRA 5B09A 4YFUA 4OJGA 4R0JA 4WZMA 2HBRB 3EVMA 5ADZA 2XSJA 1RABB 5H1SV 4B3OB 1BQNB 1TKZA 2KHCA 2MGZA 3EGVA 1SJ3P 3RRHA 2BRKA 2P5VA 4NEZA 3L7OA 2MQMA 1HNVB 4JUZA 2WVBA 2V69A 3T5LA 2HMIB 2NZ4A 3DOMB 1X9SA 2CKWA 1FJCA 4PUOA 4YR0A 3OFHA 3CJ2A 3H5UA 2GIRA 3MAAB 3KHGA 2JLGA 3HHNB 4KO0A 1UJ4A 5M2RA 4QWCA 1FE4A 1FD8A 1WEYA 5JXSA 1ZA1B 3BBBA 2FZKB 3I6PA 4CLLA 1WEXA 2G0CA 2RHSB 2IYGA 1JLQB 1OYDA 1VFJA 3UVJA 3HHKA 2HIQA 4DMZA 3GONA 5KFOA 1B4SA 3DDIA 2RKIA 2IYIA 3CCTA 3MZIA 3OSNA 3H0PA 1NK6A 3ITHA 1NZAA 3CPWR 1JJ4A 3KK3A 1U6BA 1WUUA 3TNVA 4WYLA 3PNIA 5HMZA 4RZRA 1S9FA 3NAIA 2RDDA 4U6PA 1S9EA 4EYIB 5IC6B 1REGX 2CZ4A 5D3GB 1H7WA 1N5VA 2IFXA 3ZZZA 1NJZA 2BQUA 5HQMA 3V6DB 2BYCA 4K7QA 1LK7A 4W4MA 4DOZA 3TWZA 5KFQA 2B4UA 3PO4A 2XBPA 7AT1B 3AB4B 4L75A 2ZOGA 4P2SA 1RTJB 5KG4A 4ENOA 2PSZA 1V3SA 4Z2XA 4DN0A 2VG6A 3K5NA 3NNAA 1X5PA 4DSEA 2DITA 5CHCB 3BV8A 2FQQB 3TAMA 2ROEA 5KFLA 2HNZA 1ITPA 3PYFA 4CO3A 1Y0HA 4LIWA 2BVZA 4J9KA 5ETNA 4YR2A 3CNQP 2MGZB 3ILLA 3MMJA 2QMXA 3CTRA 5GAGI 3PZPA 2LEBA 2XG8A 2VV5A 3K8WA 4P75A 1Y11A 3M6WA 2GX8A 3DOMA 3N6MA 4NLDA 1P8GA 2XS7A 2V8GA 2YWFA 2N7YA 3EVOA 4CZCA 3J81U 5A2QU 3OUYB 3FJ2A 3CMAS 4OJHA 5L1JA 1TQLA 2F40A 3AFGA 2CVEA 4DWIA 1UFLA 4A4JA 3PHEA 4PG7A 5IS2A 3SV3A 1FTRA 1W26A 5L9NA 2B9XA 3DOLB 3VGVA 3MDFA 3MM8A 1TL3A 2QV6A 2Z56B 3H42A 1M90T 1N5SA 2R9LA 1DQ8A 1SUQA 1ZBTA 2DIUA 3U1LA 2HKEA 1VHFA 2DY1A 2CPJA 3CO9A 3OPKA 3ZZYA 2C28A 3B54A 2QA1A 3L3CA 2VKRA 3EPGA 1TVRB 3G96A 1JKHA 2Z4PA 2R7VA 2CA9A 1T9VA 4KGVB 1OS5A 1REVB 2OPRA 4ZVSB 5CCMA 3GILA 2QA2A 1P6TA 1IM6A 3HD1A 1HQ2A 2HVDA 3A8JA 2DR5A 1CBKA 2DH8A 2LLZA 3C66A 1HQUB 4BLGA 2QJ3A 1EP4B 1F5BA 3KJVB 1I51B 3PJ9A 4XIUA 4F4XA 2V2ZA 2V8PA 4QU7A 2FTRA 1O6XA 2ZD1B 1SKUB 2EFPA 2ROPA 1RXOB 4ZIWA 2BJ3A 2XY5A 4A8QA 5L1IA 4ED1A 2J0SD 1FJGJ 3W62A 3PX0A 1JLBA 1BMQB 2CJAA 3DLEB 3C6TB 2GO8A 3GMGA 4ECQA 3BDPA 2YQ3A 1NU4A 2DNRA 3LQVA 3H7HB 3O3LA 3KK2A 2WOMA 1RAIB 3CDBA 3JTOA 3TVYA 4DV6J 2EFNA 1JNRB 1EETB 2K8GA 3GPAA 3QT5A 4R8UA 4AXJA 3R5AA 4BC9A 2G4BA 2CPYA 4DS4A 4K0KJ 4K2XA 2GV1A 2HK3A 1PBAA 2FD2A 4ZPCA 4I64A 2ZBCA 3WIUA 4KKOA 1QAXA 5DG9A 2CWKA 1WC1A 4ED0A 4EZ6A 3CJSA 2VFUA 3MPVA 1MSWD 4TQRA 4I6AA 3GJRB 2WZ1A 1U6ZA 3LF0A 4AL7A 5CD4A 3IR5B 1F60B 1TL3B 2EK1A 2HWIA 5AXNA 3HHEA 3MWBA 3EGWB 3CGIA 1UVIA 1UEVA 1Y5NB 1VOMA 2VH7A 3IGVA 2OEMA 4DF4A 2BBEA 2E5LJ 3RBXA 1R8CA 2J7KA 3Q24A 3CO0P 5C5JA 3TJAA 3BGRB 2R8KA 1IR2A 3TEGA 1NJYA 1DTTB 4DF8A 4WIIA 3W2VA 1RJJA 2HNYB 3HT0A 3NY0A 4HTIA 2HGNA 4Q0BB 3CEDA 1J5OA 3M2UA 3QT8A 4KPCA 3CC7S 1SV5B 3M8PB 2CUYA 4G3IA 3GFZA 3R6GB 3BDEA 3FCWA 1GFWB 5KFFA 2VG7B 1RWPB 2RU3A 3PKMA 3BH7B 4N8NA 5KFIA 1QAJA 1ZAXA 4DR2J 1FWPA 3Q8QB 4NLGA 1TKXB 4CP5A 3KK1A 2HQIA 2CJXB 4BDPA 4DSLA 5AXMA 5J2MB 4DLGA 2HGMA 1JLBB 2HHHJ 2Z0GA 1C1CA 1TL1A 2AJ0A 3I32A 5LMNJ 1N32J 3CD5A 3OL9A 1U1MA 3MEDB 4BWJA 4K59A 1HBMA 2Y8YA 4Q8EA 4DBQA 4YQWA 2FJBB 1VRUA 2RH3A 1NO8A 3GIIA 2CPIA 4OHZA 2QLBB 1IN0A 3AA9A 4YB6A 3GIKA 1FFWB 2Q43A 5KFRA 4AQYJ 3TA1A 3SFUA 1RTDA 4V1Ak 4WK1A 1AXQA 3P8BB 3Q0AA 4DV4F 2HFOA 2XB2D 2JLEA 2UUTA 1J5EF 1CLFA 4ECRA 4IFYA 3M8QB 3D9BA 4QWAA 1N4LA 1S0VA 2Z2ZA 2KM8B 4LVNP 1RBLA 4IOCQ 3OXFA 5L8RC 1L3SA 1SCJB 3U02A 4DV5J 4DR5F 1HNXJ 1X4GA 4CT8A 5E5NA 1S6QA 1R8HA 3J81j 2E29A 2HYIB 4ELUA 2V34A 1W25A 2K1RB 5JUMA 3VALA 2W4CA 3HFZB 1NPKA 4CO0A 4A8MP 1G4CA 2ZKTA 3QJJA 1UW9A 5FIIA 4NI2A 4YS2A 3DCAA 3BGRA 4KGKA 3IG1B 1DTTA 1S48A 3PEHA 1D0EA 2YKMA 5ETMA 1VISA 3GTYX 2HNYA 3R27A 5KG7A 3N0VA 3CCLS 1SV5A 3BGFA 3R2CJ 3DU5A 1U8SA 3AD7C 4HHJA 2YKPA 4HVZA 3VHQA 2KG0A 2C2DA 2BM1A 2HHWA 4X4VA 2X3DA 3IGNA 1Y4ZB 1SL2A 2DHGA 1MLAA 5A6PA 5J2MA 1JX4A 2QL5B 5HAOA 3LGMA 2XC9A 1SKRA 1YJVA 3MM9B 2Y3YA 1F6TA 2V67A 3NOCA 4GO5X 1ZM4A 2R8HA 4LFAJ 1PJ5A 1RT6A 2B4OA 1WNEA 4IR1A 4O4GB 4ZLNA 4BC7A 1XMQJ 3M8RA 3NCRA 4LF4J 3T1YJ 2MQNA 3IRXB 3FSIA 1RT5B 3ET6A 2YKQA 3MI7X 4ZVHA 2XHCA 3MEEA 2L9DA 3CJ0A 4L3KA 4ES1A 1X9WA 4V19X 4KHMA 1WF1A 2LU2A 4DV1F 2E5IA 2V9KA 3KLIA 4H4KC 2QTWA 1XC9A 1AA1B 2OD6A 3FEZA 2DRAA 1HQEA 1PC5A 2ZVSA 2MQQA 1YTYA 2JC0A 1FXDA 2NQPA 4HHHA 1VK8A 5KFSA 3EUNA 1Y3KA 2NSBA 3H25A 4CYUB 1DLOA 1FKPB 4UF4A 2LMIA 2OSRA 4F0HA 4LRCA 5EDWA 5AJ3F 4CO4A 3OTBA 3KTQA 4NCAA 1BUXA 4KHPJ 4LF6J 1XBWA 2KFNA 5J1PA 9ATCB 4ED2A 3IG1A 3RB0A 3R5DA 2XM3A 1NAQA 3MR3A 2CDRB 4MYTA 4ZP9A 2ZM6F 1GX6A 4P2XA 2BXJA 4C97A 4DX6A 4K4WA 4JI1F 2V94A 2BM0A 3BM7A 3O44A 1RADB 3W61A 1S6OA 2BR0A 3K7RA 3M8WA 1TV6B 2BZ2A 4QQBA 5ETKA 3D2WA 3KHRA 4DQRA 2WCXA 3BJYA 2IMWP 4I67A 2JSXA 5KFVA 2G1HA 3I5CA 2XMWA 2IM2A 3I5AA 2PA3A 2QSWA 3QGPA 4KH0B 1QUPA 2BJ9A 2CQHA 3LANA 1Y5LB 3CJ8A 1RT6B 1HD0A 3H5SA 3SMZA 4UOCA 2H9ZA 1Y10A 3WBZA 4WCEQ 3EVWA 3MR7A 4B08A 1RHUB 1OSDA 3BKFA 4DG1B 2VBWA 4PG5A 2HRYA 1VHIA 2DXEA 3MCMA 3CJKA 4DV6F 4A8FA 4GKJJ 3ADAC 3KLIB 2ZE2A 1KLMA 2E1AA 4M5GA 4IO1A 3FZ2A 1JXLA 4D3GA 2A6MA 1O8BA 2QSFA 3V6HA 4DPYA 2MMYA 4OHVA 1RQ0A 1TELA 2H48B 1S7IA 5EWGA 2MQOA 5IOLA 1UW4A 2RUGA 3TARA 1KBRA 4RBUA 3HVRA 1NSPA 3VAGA 5F8IA 4RNMA 3RAQA 4ECXA 2P6TA 1NNDA 5E2QA 2IIHA 1WOPA 4RL1A 4RW6B 3LWLA 4F2RA 2APOA 4W98A 3VQTA 2DGXA 3BYPA 2MQPA 4YR3A 2DGSA 2MPUA 1S1UB 4A48A 1XERA 1XWLA 3WX8A 3EM1A 4PAAA 5DJBA 3C3LA 3OL8A 4ZJLA 2XYPB 1TV6A 1RLDA 2KJVA 2OPQA 2WW8A 1UVJA 2ZFHA 3CMQA 1D9FA 3LUYA 4GVBB 3PKYA 2IC3A 3DI6B 2EG1A 3AQPA 3M05A 3DLGB 3T9NA 4I7FB 2W2OP 3POTB 2VASA 4YEAA 4A8WA 4DPTA 3LA0A 1JJHA 3A3OB 5F0UA 2ACMA 4B3OA 4J9SA 4B3SF 2RB7A 3MGJA 1JLFB 5I42B 4PWUA 3AAWB 5LSRA 1IKVB 1Q8IA 1U1PA 2HHHF 1C0UB 4H4KA 3EJMA 2D74B 5HLFB 1W2BR 3IR7B 3CJKB 1NH7A 4MFBA 1SH0A 3W5YA 4TYAA 1E6VB 3IC1A 5F8GA 4CLTA 3UCUP 1X0FA 2H51B 4AXIA 5KFPA 4PXCA 4CTAB 1SQGA 4V19J 4MK8A 2YWHA 2GHPA 4LT6A 1T03B 2YNGB 2J7UA 2MZRA 2PDAA 4Y2MA 4JI3J 3TYTA 4CWBA 1H98A 3P45B 3ZZUA 4RJVA 2GW8A 4JV2A 1JLQA 1EQ0A 2VF3A 3H8YA 4J5OA 4QWBA 1LK5A 2FVRA 1VQPS 4NE9C 3OL7A 2WVDA 4JI8J 2E9TA 3IWNC 2M0GB 4DV5F 1HNXF 4B9LA 3QRQA 3NMRA 1F3FA 1ZPWX 1ZAVA 1IJEB 4ZS6A 2KT2A 3DDKA 4DCOB 3G8QA 2E7XA 3VAFA 4I6YA 2BKNA 2FJXA 1IQZA 4WE1B 2ZOMA 2GIFA 4DPUA 4PPZA 1SJ4P 1HBOB 3UFCX 3MR5A 4M5JA 4C6AA 1PKUA 3O5TB 4Y65A 1HWLA 2D7SA 2B9WA 2HZAA 5LT5A 3T3FA 3UNYA 2UV8G 5HVHA 4QPTA 1LWFA 1YJ7A 2E1PA 3NP5A 2HW3A 1X5OA 2UUBF 4DQPA 1MG7A 1S1WA 2MKJA 2NXEA 2RDJA 3RB3A 2UUAF 4B3RF 3OR1A 1NUEA 1DQAA 1BWEA 3C15B 1FT8A 4J91A 3R5GA 2ZWPA 4F26A 2J7WA 2FGOA 1BQMB 1UTAA 4IKAA 3RU0A 2AD9A 4ECYA 3UN2A 1XNRJ 2V4RA 1OQ6A 2VPXB 5DETA 3TAPA 4IQXA 4JI2J 2RDIA 3PYGA 1FNOA 3HHLC 2JEGA 4KH1B 1GMUA 1UWBA 1JJCB 1LWEA 5A0YA 1UWAA 4L76A 2HS4A 4C3MA 3BR9A 4LF8J 1CC8A 1Z2ZA 3NWRA 3PM9A 3D7SB 3OXGA 3NS5A 1Q16B 4CLKA 2J8SA 4ZP8A 3ZTPA 1PIEA 2EFOA 2NCKL 2CZ9A 1T9WA 2VDHA 5KG0A 4CM2A 5DLFA 4LR9A 1WORA 2WW4A 4HACA 3JXOA 5HMXA 1U02A 3VGUA 4DR6F 4IG0A 1FNMA 1FJ7A 2RSQA 1WHWA 4AE5A 3HCXA 4GC7A 1TUWA 5AJ3J 4WE1A 1UEUA 3U1MA 2GQQA 2I8EA 3DC2A 1F2GA 4KGMA 1REVA 3H2VE 2IRXA 2E1CA 2IM1A 1CJKA 1RTHB 3NCQA 3O6QA 2VQFF 1U4BA 2IAJB 3SCKE 2CQ3A 4Q5VA 2J6UA 1HQUA 3I5BA 2ZBRA 3GFYA 3KJVA 3SYZA 1SXLA 2HWHA 2SXLA 2F7VA 3IO1A 3QPIA 4WK3A 2ZM6J 3TEHB 4O0NA 4QWEA 4F4YA 1K9MT 1KRPA 5LJ3Y 2BQ3A 2BA9A 3ISNC 5F8LA 4NMLA 4I2PA 1EHWA 1RACB 3GJSB 3DLEA 2FHKA 5IWAJ 2HVHA 4OFZA 5IQ6A 3M9OB 1TK8A 1FO1A 2GA7A 4OIXA 2BOPA 3O8WA 1F5AA 1PSDA 1YJ9S 4C48A 2XEXA 3GU0A 3LGNA 5KFAA 3QRRA 3DXSX 4O3PA 4Z7CA 5L38A 3K57A 4C8LA 2HHUA 2GJFA 4OX7A 3OQ2A 3D0GE 1OPIA 1HNIB 3BYRA 1YGYA 5L39A 1RAOA 5LMNF 4O23A 3PW4A 1U0SA 4DFKA 3C46A 3LAKA 4KKOB 3FBEA 3CCMS 2BQRA 4LREA 2UP1A 4JI5F 1N5TA 4ICLA 4DI6A 3KYLA 5I3UA 2Y0SD 1GTEA 3D6HB 2XS2A 1JK9B 1RZMA 1ZOTA 2EKNA 2ZKUA 2XYGB 3PEJA 1NDLA 3U7JA 3UI3A 3M7VA 3ZTOA 4J9OA 4JYAF 1IKXB 3CD7A 3CVKA 3T9ZA 3IP0A 5DZ7A 3BR8A 2LDYA 2K3IA 4GVLA 4OI6A 1KVIA 2OAUA 3QIDA 5HROA 1OMSA 2DJWA 3G8SA 1UL3A 1Q8BA 2DCUB 3K59A 3CJTA 4KRWA 2F65A 2P9CA 2YPYA 4Q2LA 1N36J 3PRBA 5J2NB 1RB0A 2DXFA 1CSJA 2HHXA 2XWXA 2KKHA 1J5OB 2NREA 2VFSA 2ATCB 3N6LA 4YY3F 1C0TA 2KI2A 3F44A 3KLGB 1K1SA 3GCXP 5C42B 3PIOQ 4ECSA 3KXDA 1IM4A 1FHTA 1ZZNA 3KLHA 4C8YA 4K4SA 3I4HX 4HHUA 3FEXB 2LKZA 4G65A 4R5PA 3SCIE 4CLFA 4K4UA 4I2PB 3BGUA 1TL1B 2C2ZB 2ZNZA 2CXEA 4DZ6A 5DZ6A 3TA0A 2YNHA 4DSJA 4DV0F 1KR4A 1XR7A 2H1YA 2ZVIA 5E3CA 2E66A 1B64A 3PR4A 1SC3B 2ADBA 4OJ3A 4OZ3A 1TL7A 1KS2A 4KE5A 1T9YA 3UDLA 2E5JA 3VAHA 1ZS6A 4X64F 4FS1A 3ETMA 1VC6A 1NXIA 5AXLA 2F9JA 5CYMB 5KT5A 2I2YA 3D6TB 2V4JB 3ILJA 3C6UB 3N4WA 2KFYA 3ZTQA 3RW7A 4DEZA 3QJLA 3B78A 2JEFA 2N7CA 4U67Q 3K8VA 2KZMA 1FK9A 2ERRA 1U0HB 4YB1P 3VAMA 1RISA 5HQ8A 4U96A 4NRTA 5HROB 4NI2B 1W2IA 4YDDB 2VA3A 1NJIT 1RE1B 2OI2A 1P9YA 2X51A 5A8RB 1Q7YT 4JI6J 2YKMB 2MZJA 2N82B 1NM2A 3T19A 2FVSA 3I0RB 5JMNA 2M3DA 1PYSB 3T6JA 3KJNB 1LQ9A 2F8HA 2O1PA 5HK4A 1N5QA 4IOAQ 1U1OA 3MCSA 2C2MB 1HNVA 2K06A 2VBZA 3WHIA 5GAEI 5MAOA 2DHHA 4PCQA 3VVTA 3MEGA 4L73A 2YNFA 4XAKA 2AEJA 4R0EA 3JTPA 4LRDA 4ZLPA 1HYSB 2XLJA 5ETOA 4P71A 4OMFG 3TZZA 4TU7A 2F63A 1HLWA 4B9VA 4OI0A 2H4YB 2GAHC 4DV7F 2B7BB 2WVCA 2H5IB 2XTJP 4LRAA 1F2HA 2FC9A 3ET6B 3G2XA 2YNIB 4PPDA 3UVJB 3B82A 4KR0B 4LBPA 5AE3A 1RA7A 5IM0A 2XMAA 1RWMB 4ZVPB 5LMUF 1Q0NA 4HI2A 1EKSA 5CYMA 1D09B 4IDKA 2L3MA 4ZKAA 1RT7B 2V4JA 5LSLA 4XPEA 2VFTA 2XZDB 2M9KA 1FJEB 2B8PA 1RAEB 3FQLA 2FDNA 4ILLA 2BANA 1WDDA 1QD1A 3WX4A 1SJ1A 4HL9A 2OGUA 4J7CA 3CE8A 5BJRA 3G71S 1KFDA 2MKYA 3QQCD 2RQMA 1RTJA 4LMZA 3A3PB 4DV2J 2PMZD 1TFYA 3KMSA 3ENVA 3W5ZA 1RT1A 3AJ2A 5CA5A 3TAMB 2QL7B 2I38A 1RKIA 4TQSA 2HNDA 5D6GA 4Y2IA 2Z30B 2AJ4A 4J37A 2ZBQA 1WKKA 5FLXY 1IBCB 3MAQA 1M1KT 3DKDA 1X4HA 2VDIA 6FD1A 1WF2A 1IUJA 1GNKA 1U26A 1JLCB 3LW5C 3N5BA 3G8TA 3MEGB 4K4TA 4DUYJ 2VBYA 3D1OA 2R8GA 1U48A 1PYOB 1U1LA 4NYOA 2IVMA 2BDPA 3NXZA 1X4DA 2PMHA 1VBYA 3Q2TC 1Y3JA 3CJ4A 2Y1LB 2R7SA 4GKKJ 2BOAA 4JB8B 2O3DA 1URRA 4FVMA 3QMQA 2HEKA 3J80U 2QT7A
chains in the Genus database with same CATH topology
3MM8B 4DG1A 1R7IA 4IQMA 4M8LA 3LP1B 1FA0A 5E7OB 2OPSB 1OWXA 3V81B 3M32B 2QA4S 4OJ1A 1S1TB 1IBKF 3CSKA 2DTJA 2UVRA 3MMBA 4X4PA 1YRXA 2CQPA 4B17A 3BSNA 1DARA 1VMBA 3M4XA 3T6BA 2J0QD 3TANA 2ILZA 4CIOA 5HBMA 5KFMA 2HNDB 2FJAB 2MKHA 3GG1A 3PW0A 1TK5A 4RW7A 1TFWA 3DRRB 3IS9B 1QUVA 2WOMB 2Z2MA 2OPQB 1EETA 3QO9B 1ELOA 4L6V3 4ETXA 5F3ZA 4DN9A 2ZH2A 4FZVA 5I3PA 4QR1A 3GZ7A 5KFZA 2CZVC 4K4XA 4N5SA 1FKOA 2XMKA 4HTJA 4EBEA 1IKVA 2Y1RI 5HMXA 1DTQA 5SUHA 1C0UA 2ZH7A 2LQBA 1N5YB 4DQSA 4AUKA 2DNZA 4C3KA 4MH8A 3LP1A 3NLCA 4IYQA 2LYVA 4KPYA 4CTAA 1Q78A 3V81A 1T03A 2FC8A 3HFKA 3LPYA 2ZJQQ 1NHVA 4UUWA 3SCLE 2QFJA 3KLFA 4CH1A 3KHLA 4QW8A 1DURA 1U49A 4LIRA 2RU9A 4F50A 1NKCA 2WTFA 3OFEA 5CH7B 1SJFA 2MSTA 2X1BA 1HI8A 2O67A 3DRXA 2DHXA 4Q43A 4C3LA 5H9FJ 1YSJA 3V4IB 5HBMB 5LJ5Y 3DLBA 2JRSA 3OV7A 1C1CB 3DRRA 1X4EA 5KT3A 3E01B 2R7RA 4FNHA 4LF6F 2XY6A 1N54B 4P7VA 3S01A 1T05B 4NA3A 1LWFB 1H0HB 1S9GA 2R7XA 3I9ZA 4WXWA 4FP9A 1FDDA 1QJHA 3MPYA 3QLHB 3PIPQ 3NWGA 3TR5A 4EYHB 1H6KX 2R2UA 6FDRA 3OJSA 3ETOA 2MSSA 4RKUC 5A8KA 2EFGA 2ZH6A 2VONA 3G4SS 1YG0A 5J2QB 1PILA 2MHNA 3NG8A 4IG3B 4QR0A 2N3OA 1BWEA 2JOQA 1OQ3A 2UUWA 1LWEB 1RGVA 1SH2A 5A0YB 5G4DA 3K5LA 4JOUA 1CG2A 2A2DA 2K1RA 2NS1B 5K8NA 3P6YC 2V8HA 4O4RA 4XPCA 4LFCF 4WZQA 4NCGA 2C3UA 3E51A 3HZGA 2CQDA 2JHEA 4X65F 1N8RT 1JLAA 4D3HA 3MTJA 3ULHA 2JEJA 1HARA 2HS0A 4KAIA 3H5XA 3ZZOA 1ZM3A 3ENQA 4UQGA 4J9NA 2VFRA 3BREA 2MYFA 3V4IA 4YB7A 3H40A 4HYKA 4ED3A 1VQOS 4I2QB 4TLQA 1VBXA 3C2PA 4RW8B 4KFBB 2ZC3A 3HO1A 3TOQA 4ZPTR 3OTCA 3L09A 3PV8A 4JI4F 3E01A 5BR8F 2IAJA 2UUCF 2Q79A 3HP6A 2XLIA 3MOJB 4Y3CA 4ALZA 2HVZA 1UFWA 1UVKA 2CIMA 3TW0A 2XULA 1O51A 2DNQA 2IVYA 3MEEB 1AROP 2BACA 2GHVC 2N3LA 2KG1A 1U47A 4B9NA 3KMQA 1JLEA 3MURP 2J76E 2LCWA 5KFKA 1O0PA 4DR2F 4DUYF 1DBDA 1HWJA 1U7LA 2ZJRQ 3X1LB 2DH9A 2GJ2A 2KT3A 2NLWA 4P6QA 1DLOB 1FKPA 2G13A 2KO1A