2HNDB

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
422
structure length
394
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 113
structure length 394
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB03
3KLFB 2VA2A 5C5JA 4MK8A 2VG7B 3T5KA 1NNDA 1J5OB 2E9RX 3FFIA 1JKHA 1S1UA 1LWCB 5KFTA 2GIQA 5HBMA 1RTIB 1NHVA 5KFEA 2XGPA 2W7OA 3BJYA 4NLGA 4IFYA 5D3GB 3MR5A 2YNIA 5KFDA 4J9SA 1LW0A 1S1WA 1R0AA 2IC3B 4WFZA 5DGBA 3KLEB 5DG9A 2ZE2A 4ED6A 2FVSA 4IG3A 1RT2A 1IKXB 3BR9A 4O44A 3EZUA 4NRUA 4WYLA 3TAMA 1C2PA 3T5HA 3TQ1A 3DI6A 3T5JA 2V4QA 1RYRA 3GV5B 3KLGB 4H54A 4ICLB 2IAJB 3GV7B 4M94A 2AGPA 1T05A 1MMLA 2FVQA 2R2RA 3BREA 5F8HA 1GX6A 1S97A 5CYMA 4R8UB 1TKXB 1TKZB 4H4MA 4F4ZA 3QZ8A 3KJVB 3N6LA 5KFRA 2VG5A 1IKWA 1HNVA 1JLAA 4ZHRB 3H59A 4KBIA 3NL0A 2W7PA 1HYSA 2GIRA 4TY8A 4TQSA 2UUTA 3ITHB 1BQMA 1SUQB 2IJNA 3OL7A 1RT1B 5C25A 3C6UB 3MFIA 5J2NB 3E01A 2R8KA 1JLCA 2WHOA 5HLFA 2ILZA 3CJ0A 3NAHA 2JLEA 5C42A 2RKIB 3KK2B 3I0SB 1S6PB 2HNYA 4URQU 3OHAA 3DLEB 3LP0A 4O4GB 5KG5A 4NCGB 1JLEA 2GC8A 5KFVA 1HQEB 4R0EA 2BE2A 3KK1B 2D3ZA 1DTQA 2W8LA 4JV0A 5KT5A 1RT4B 4K4XA 2B5JA 4LQ3A 4H4OB 1HQUB 2I5JB 2D41A 4IDKB 1VRUA 2WONB 5FDLA 3M9OB 3JSMB 4F4WA 4EYHB 4LSNA 4KHRA 4TXSA 4K4WA 4IR9A 1N5YB 3KLFA 3Q8PB 2UVRA 2VG7A 2OPRB 3I5BA 4JUZA 1J5OA 5KG0A 4RW9A 1TL3B 1S0NA 1LWCA 5KG6A 1RTIA 3DRSB 2FJVA 2J6UA 4DL7A 3M8QB 3IG1B 1RT3B 4ZPDA 2YKNB 1T03B 4PWDB 3N6NA 2IC3A 4NLDA 5KFIA 4QW9A 5KT7A 3DOLB 3KLEA 4ECSA 3CDWA 5KFXA 3CDUA 3DRRB 1RDRA 4KKOB 1IKXA 1HPZB 1NHUA 1C0UB 3FQLA 4O3OA 5J2QB 4WXWA 5KG4A 4I7FB 2CKWA 1QUVA 1JLBB 3BGRA 4J9KA 3PR5B 4EO6A 3KHGA 3KLGA 4WYWA 4ICLA 3M9MB 2IAJA 5HROB 4ZP6A 3IRXB 4ED3A 4R8UA 1TKXA 1TKZA 5KG2A 1RT6B 3PJXA 4YR0A 1C1BB 4IG0B 3KJVA 1LW2B 3DOKB 3PR4A 4ED7A 4ZP9A 4IRKA 4QWCA 1ZTTA 4B3OB 4ZHRA 2I1RA 4J9RA 3MR2A 2XCAA 1T3NA 2F8EX 2JEJA 2AQ4A 4KO0B 4TLRA 3ITHA 1HNIB 1VRTB 3GILA 3RB4A 5F8IA 3H40A 1SUQA 1RT1A 3C6UA 4ZMMA 5J2NA 3TVKA 4RUAA 3BQ1A 1LWFB 4NLWA 4ZVGA 4I2QB 2FLLA 2RKIA 3KK2A 4KFBB 2IM2A 1S9GB 3I0SA 1S6PA 5T14A 2WRMA 4K4YA 3H5XA 3DLEA 4O4GA 4NCGA 4ECVA 3PW4A 1HQEA 3KK1A 5KT4A 3M8PB 3RBDA 1RT4A 4ZPAA 4H4OA 2CJQA 4IDKA 4NLUA 2WONA 4K4SA 3JSMA 2BANB 2YNFB 4URGA 3Q8RB 3PVXA 1N5YA 4IH5A 3M9NB 2OPRA 5KT3A 4TN2A 1TL3A 5EWFA 1C0TA 4J9MA 2XI3A 4IH6A 5K14B 5F8LA 4ECWA 2R8GA 2AX1A 3DRSA 5KFUA 4WZQA 5F8JA 3LAMA 4DG1B 4KE5A 3M8QA 3IG1A 5F8GA 1RT3A 2YKNA 1IKYB 2DPIA 3Q8QB 2HNZB 1RA6A 1W25A 3QGGA 3GYNA 4O3SA 3DOLA 4NLRA 1S0MA 3GIJA 5L1JA 4X2BA 3DRRA 2V4RA 4J9OA 1RTHB 3CVKA 5I3UB 4RNFA 3PW7A 4J9PA 2J6SA 4KKOA 2UUWA 5DQHA 1C0UA 4Y3CA 3MR3A 5J2QA 4O3QA 5JUMA 4I7FA 3MEGA 4KV8B 4RW4B 1S0OA 1D1UA 3IRXA 5EWGA 5L1LA 4NYZA 4XPEA 2XWYA 1C1CA 1RA7A 1RT6A 1EP4B 1C1BA 2ZD1B 4IG0A 1LW2A 1JLFA 3V6DB 2AX0A 3DOKA 3N6MA 5JXSA 3MF5A 3KHLA 2UVUA 5KFNA 2B6AB 2QV6A 3FSIA 4YR3A 2V9WA 1Z4UA 1FK9A 1RT7A 1SV5B 4KO0A 2HWIA 1HNIA 1VRTA 1S9FA 4FS1A 2BR0A 1RTDB 1ZTWA 5F9LA 3PZPA 1LWFA 4I2QA 4RW7B 1QE1B 1BQNB 3EPGA 4JV1A 4DL5A 4KFBA 5J2MB 3CDEA 1S9GA 3QGIA 3OL6A 3CJ3A 4EBCA 4IRDA 5J2PB 2C2RA 3T1AA 4MKAA 3I0RB 4WZMA 4YMEA 5HP1B 5KFKA 1LWEB 4EBEA 3H5UA 2ALZA 2WTFA 3MECA 3QGHA 2W8KA 1ZETA 4K4VA 5EUHA 2BANA 3T19A 3CIZA 4YR2A 1HMVB 3G86A 2C2EA 4NLOA 1KLMB 2ILYA 5K14A 1XR7A 2HWHA 2FVRA 5F8MA 1TVRB 2R2SA 2FVCA 4DEZA 3LP1B 2IA6A 1IKYA 1S9EA 3DMJA 2HNZA 1S6QB 2IJFA 3DLGB 1D0EA 4J9LA 2IBKA 5EWEA 3OSNA 1JLQB 1RTHA 5I3UA 5L9XA 5KFFA 4DL6A 4J9QA 4Y34A 5KFPA 4Q8EA 1I6JA 3V6KA 4KV8A 4RW4A 4RNMA 4ZPCA 3BQ2A 3T5LA 1TP7A 4MKBA 3GIMA 3QIPB 2UVWA 1FKPB 3DLKB 4DL2A 3MR6A 4IOBA 3RB3A 5D3GA 3LANA 1EP4A 4MIBA 4O3PA 2ZD1A 4MFBB 3SFUA 1TV6B 1JXLA 3H2LA 4IRCA 1S1XB 1DLOB 2B6AA 4R5PB 2BRLA 4QPXA 4IH7A 4RNHA 3LP2B 4NLSA 1S48A 4RW6B 2E9TA 2YNHB 3GIIA 3C6TB 4Q8FA 3EPIA 5KFAA 1DTTB 3GQCA 2J6TA 4XPCA 1RTDA 4Q43A 3D28A 2OPSB 4RW7A 1QE1A 1BQNA 1S1TB 5J2MA 4ZP8A 1IKVB 4Q44A 3V6HA 3I0RA 2IM3A 5J1EB 1RAJA 2R8HA 5HP1A 1LWEA 4HKQA 3HVTB 4QWEA 2RDIA 2O5DA 2OPPB 5CYQB 3FDSA 1RTJB 1EETB 1HMVA 3MEEB 1S4FA 5KFLA 2JC1A 4IKAA 3KLIB 1KHVA 1S10A 1TL1B 3JYTB 4WE1B 1WNEA 3OSPA 3KMQA 4O3NA 1XR5A 3PJWA 2HNDB 2XC9A 1FKOB 1TVRA 2YKMB 2ASDA 3UQSA 3LP1A 4TYAA 4DL4A 4ED8A 1S6QA 2C22A 3V6JA 4NLPA 3DLGA 4IFYB 4RZRA 4ZVFA 1S1VB 1HQUA 1LW0B 2I5JA 5KT6A 3PW2A 2C2DA 2AGOA 2WB4A 3NGDA 2ATLA 5KT2A 3QLHB 4K50A 3CO9A 4MK7A 2W9BB 4IQXA 3V4IB 1N48A 1U09A 3BSCA 3D5MA 3QIPA 1FKPA 3DLKA 5DG7A 4MFBA 3CWJA 4ZPBA 1TV6A 1T03A 4PWDA 4IFVB 4KB7A 2ASJA 5CYMB 1S1XA 1DLOA 4R5PA 5KFWA 4QWDA 3QYYA 4U7CA 1RYSA 5F9NA 4RW6A 2R2UA 3Q8SB 2YNHA 3C6TA 4ID5B 4Q0BB 5KFSA 1DTTA 1HPZA 1JLAB 4KHMA 2B43A 3BSAA 1JLBA 2OPSA 1S1TA 1REVB 5HROA 3DM2B 1IKVA 3H4BA 3IS9B 2VG6B 2BRKA 4EO8A 5J1EA 3NBPB 4RW8B 2WCXA 3PHEA 3SFGA 4ECTA 2HNYB 2W9CB 3ISND 3HVTA 4I2PB 3H4DA 4B3OA 4NLYA 4QW8A 5CYQA 2YNGB 4G1QB 1RTJA 1DTQB 2FJXA 4EBDA 2BQ3A 1EETA 3MEEA 2V0NA 4K4UA 1HARA 2BQRA 1UWBB 4FS2A 4XO0A 1TL1A 3JYTA 4WE1A 4MIAA 1SH0A 3HHKA 3RB6A 2HNDA 3RAXA 1FKOA 2YKMA 4O3RA 4RW9B 1N56A 3KNAA 5KFOA 3G6YA 2FLPA 3MTKA 5DG8A 2QE5A 1S1VA 3M8PA 1IM4A 2AWZA 4ED1A 3H98A 5EDWA 5C24B 1QAIA 3KHRA 3QO9B 2YNFA 4URSA 3QLHA 5KFZA 2W9BA 2JC0A 3UDLA 3H5SA 3MEDB 5DLGA 4TY9A 3V4IA 5KG1A 4ECZA 4WXOA 2RDJA 3CJ2A 3E51A 5KG7A 4Y2AA 2HMIB 5KFMA 3BGRB 4DG1A 4NRTA 1MU2B 4TYBA 1QAJA 4IFVA 2JEGA 3OL8A 3I5AA 3ICLA 3GV8B 1K1SA 1T94A 3QIDA 4PUOB 1GX5A 5KFBA 1JX4A 3V81B 4RU9A 3ISNC 4HYKA 4ID5A 4Q0BA 4O4RA 4ZVHA 5KFQA 3RAQA 4GC7A 2XI2A 3KOAA 4PQUB 3DDKA 2BQUA 2R8IA 1REVA 2FJWA 4K4TA 3DM2A 1YVFA 2WK4A 3KLHB 3IS9A 1KHWA 4F4XA 2VG6A 1XR6A 4NLXA 4TQRA 3NBPA 2VA3A 3V6DA 4RW8A 3NAIA 4RNNA 2EC0A 4OL8A 4KAIA 2W9CA 4I2PA 2D7SA 2WOMB 1OS5A 3DYAB 4U6PA 2XCPA 3OLAA 4YQWA 2YNGA 4G1QA 2IM0A 1SV5A 5I42B 4NZ0A 5KG3A 3BSNA 2OH2A 4QWBA 5KFGA 1UWBA 2AGQA 4MK9A 3KK3B 1N6QB 2D3UA 3DRPB 3G6VA 4NLVA 4ECQA 3KLVA 3NMAA 1TKTB 1C0TB 5J2PA 4K4ZA 2OPQB 4NLTA 4YP3A 3BSOA 4ZP7A 3GIKA 2AU0A 3QZ7A 4Y2CA 4EEYA 4J9NA 4JV2A 4KSEB 3SI8A 4LSLB 1JLGB 5C24A 1CSJA 4ECYA 5DGAA 3QO9A 4ECRA 1S49A 3FQKA 4ZVEA 4LQ9A 1KLMA 3MEDA 2R2TA 1RT5B 2ASLA 3LAKA 2JEFA 2RF2B 3NKYA 2HMIA 1SH2A 3MEGB 4F4YA 2JEIA 1MU2A 3FFIB 1JKHB 1S1UB 3LALA 5HBMB 5KFJA 3VQSA 3H5YA 1C1CB 5KFYA 4GC6A 5L1IA 4PUOA 2YNIB 3V81A 1JLFB 4RUCA 3PW0A 1S1WB 1R0AB 4ED2A 1JLQA 3OLBA 2ZE2B 4RNOA 4FBTA 4DL3A 4MH8A 1FK9B 1RT7B 4PQUA 2XGQA 4IG3B 1RT2B 3RBEA 4O44B 3MFHA 4EYIB 4ECUA 3TAMB 3KLHA 1N4LA 1JIHA 2IM1A 3I5CA 3IGNA 3KHHA 3DI6B 4WFXA 3PW5A 4Q45A 4F50A 1T05B 1K1QA 3IGVA 4IR1A 3KMSA 2WOMA 3DYAA 4H4MB 2W9AA 3LP2A 3HVAA 5I42A 1TQLA 3UPFA 4M95A 2VG5B 1IKWB 3HVWA 4QWAA 1HNVB 3FRZA 3KK3A 3MECB 4ED0A 2FLNA 2C28A 3IN5A 1N6QA 2FVPA 3BQ0A 2DPJA 1HYSB 3DRPA 2IMWP 4TY8B 1BQMB 3RB0A 5KFHA 1SH3A 5F8NA 5DQIA 5C25B 1TKTA 3E01B 1JLCB 2ZKUA 5HLFB 4NLQA 3G6XA 2OPQA 5C42B 2E9ZA 2HAIA 3UR0A 5KFCA 4FBUA 5L1KA 3LP0B 1S9EB 3DMJB 4WFYA 5DLFA 1JLEB 4LSLA 1JLGA 4ECXA 2OPPA 2BE2B 5DQGA 2UVVA 2B5JB 3OL9A 3KLIA 5FDLB 1VRUB 3CJ5A 4G3IA 3CJ4A 1RT5A 3OHBA 4LSNB 2R8JA 3HKWA 2RF2A
chains in the Genus database with same CATH superfamily
4B3SF 3AHPA 1LQ9A 3DDNA 2OSRA 1I94J 4X62J 2YXLA 2KTQA 5A8KB 2PN6A 2RAQA 1TKZB 3OFEA 2YWFA 2HFVA 3LH2S 1L3UA 4KT0C 4NXNJ 3PEJA 1R8HA 5HLFA 3SQGA 3QWUA 3ULHA 4P10A 1RT4B 1X7VA 4I69A 1CC8A 4FP9A 3GJRB 4K59A 2Y3YA 2DGWA 5KG6A 1LFWA 5GMEA 2UXCF 1S77D 2VFRA 2HAFA 5BXIA 4A8WA 1KQGB 4I7FB 2N3OA 2XMWA 1F5AA 2MLZA 3PR4A 4J91A 2ZJRQ 1T3NA 3OVBA 1R8BA 2CRLA 2L9NA 5H9EK 4KFBB 3D6FB 3M1VA 4KH0B 4O4GA 3VAFA 1HQEA 3PJ9A 2ZITA 1NPKA 3CCUS 2BANB 4IH5A 2R8GA 3MZIA 1WHWA 1RA6A 2V4RA 1Y9OA 3TUPA 5ETLA 4PXCA 1NJIT 1O51A 3K8VA 1BLUA 5KFNA 2BMBA 4R25A 3FSIA 1S72S 3J7Z5 2HVIA 2N4DA 1N54B 1KN6A 1NDKA 4I2QA 3GIRA 3NS7B 3EPGA 1VQMS 4HDGA 3HFKA 4JYAJ 3FMWA 2D74B 4LFCJ 4K4VA 4YR2A 1XIQA 1RLDA 1TL5A 2CJYB 5BYSA 2HHQA 2EK1A 2KI2A 4L76A 3OSNA 3PIPQ 4OZ0A 2HHUA 3IFEA 4UZCA 3TWZA 1S48A 3O8WA 3C6TB 3AJDA 1RTDA 2Z4PA 2QSWA 2RQKA 9ATCB 3S6EA 1U1OA 2D1CA 3BGUA 3WIVA 3BDPA 4WE1B 4TLQA 3GTYX 2HNDB 1WC3A 3CCMS 2E5LF 3DKDA 1OPIA 3CO9A 2W9BB 1N48A 1OYDA 2FJDB 4C2MA 2V5HG 2AIRB 4EZ9A 1AT1B 1JLAB 4Q2LA 3Q23A 2DCLA 2U1AA 3IS9B 2HIQA 2VPWB 2WCXA 4U9RA 3H4DA 2X1GA 5F0WA 4K4UA 4CNZA 2MZ1A 3JQMA 4L75A 1N56A 3G6YA 3RRGA 1X4FA 2Q79A 2AWZA 2I2YA 2YNFA 1WC4A 2ZM6F 2CZ9A 4DSEA 2PIIA 1QAJA 4IFVA 2MPUA 2R7SA 3OL8A 2Q43A 3NCRA 4Q0BA 4DR7F 2FY1A 3DDKA 1VBXA 4LF7J 2ZZTA 4EUVA 2XYGB 5D0HA 1SL1A 2OEKA 4U7UK 3IR5B 3W5YA 4N56A 1ZPVA 2BABA 4K4ZA 1B99A 2Z58B 1RI7A 3E8OA 2HIYA 1S7HA 3OPKA 3MWBA 4ILRA 3OTOJ 3VGUA 1G7CB 4DV0J 3C66A 4ED2A 2ZHBA 1S7IA 3IAM9 1NSQA 1H2UX 2B51A 3M2RA 2ZDPA 2W01A 2E1RA 4DU8A 3KLHA 3I5CA 1WKJA 3W2VA 3T1HJ 3ONQA 4IR1A 1YKWA 1VLYA 4DFMA 3MXHP 1X4EA 3IR6B 3EGWB 4F67A 4Y2KA 5HLFB 4NLQA 2F65A 3SQGB 3BZQA 2DT9A 2PMHA 2DY9A 2AW0A 1FESA 3OL9A 3KLIA 1RT5A 3HKWA 2DK2A 4BDPA 1S1UA 2FLOA 2W7OA 3BJYA 2YNIA 1R0AA 3CCQS 2EBGA 1YZ6A 1HL6A 2ZE2A 1ICEB 1F3FA 4PCQA 2NPFA 4DV3F 4ANDA 4YS2A 1RISA 2FGOA 3P3DA 5CYMA 2KJVA 3CXCR 1IKWA 2B4OA 4N76A 2KRRA 4AD6A 4BHQA 3R7BB 3MUTP 3OHAA 3M1VB 5KG5A 4O4GB 4X4NA 4A8KA 1HQEB 2WBMA 2W8LA 3MM5A 2MZQA 1LK5A 5K8MA 4USWA 3A1YG 4IR9A 2FJVA 3JS9A 4PWDB 3TJAA 4LF5J 2BOAA 4EO6A 4WYWA 2BKPA 1SC4B 3OTCA 4DV1F 2R9LA 1UTAA 1YJRA 1R8AA 1X4BA 4CO4A 1QSYA 2WZ1A 1ZZNA 2FLLA 1TELA 4I2QB 3RJMB 3QPIA 1S6PA 4L3NA 3Q86A 1TL7A 4OX9F 5L8RC 3EVWA 3W9IA 5L39A 3I4HX 5EWFA 5F8GA 3BYRA 3TX8A 3QJPA 4V19J 3T1YJ 3MR3A 2MQLA 2OGUA 1YJNS 5EWGA 5HSPA 1N0VC 4PR6A 3MURP 1J27A 3B6BA 1BE4A 3F44A 2VH7A 4LRBA 1RTDB 4OZ2A 3V2UC 3HD1A 3QGIA 1VQKS 3MTJA 3MUMP 4B17A 2B9WA 2UUBF 2JX2A 2LEAA 4UW2A 4W92B 2DH7A 1R0CB 2X1BA 4YHHJ 2H5IB 2O67A 3BKUA 1S9EA 4DZDA 2IJFA 4E0DA 1SQGA 2IBKA 2RQ4A 1KVKA 1RWXB 1O5JA 2UVWA 1H98A 3MR6A 3Q2SC 2RUGA 4M5IA 1FD8A 1GTEA 4MT1A 3GQCA 1MW7A 1KEKA 4X65J 4NZ6A 3EZOA 5HP1A 5E33A 2B8PA 2CWXA 1FNOA 1TK5A 1FWKA 4DR4J 3F56A 1R7IA 2U2FA 1UJ5A 4RR5A 5MAOA 3V6JA 4RL1A 4B02A 3DRXA 3SDEA 4QZVB 2CNKB 1G6BA 1MLAA 3K5NA 2POKA 2VUGA 1U09A 1CJTA 4KHPJ 4DR1J 5DG7A 4CQ1A 4IFVB 2Z2LA 2EG1A 4Q0BB 3AAWB 1VQ7S 1VLOA 3SIPB 2CVEA 2BRKA 4EO8A 1U24A 4PRFA 3ISND 4E98A 3D9BA 3IO1A 2FY8A 1YRUA 2CDRB 1S1VA 2M7SA 1WEXA 2RVJA 1KRPA 3ENVA 4B9NA 4ECZA 4HDHA 4Y2AA 1N5SA 4NCAA 4DG1A 3LUYA 4EU0A 2JEGA 4FNHA 4CLYA 1FNXH 3PXGa 2H5EA 2KYXA 3CCRS 1JXVA 4HTJA 4OHYA 3M2RB 2FJWA 1HNWF 3NOGA 3KLHB 2C2ZB 3W2VB 4UT4A 3MCOA 2MKYA 2OH2A 5KG3A 2R4FA 2OSQA 1TR0A 2DR6A 4KYZA 3A8KA 1RLCL 4DF8A 5CH7B 1E6VA 4OHXA 2LLZA 2RS2A 1BC6A 3D2WA 3ILIA 1S49A 1GXLA 1RT5B 3IAS9 1YLXA 2MZJA 4F4YA 3JSBA 1S1UB 3LALA 1ULRA 5C7PA 2YNIB 1YTYA 1R0AB 4M5MA 3H8YA 5E3PA 2ZE2B 4FBTA 2I0XA 2XGQA 1J5EF 4N5SA 4B3RJ 2HS0A 4DN9A 3G8TA 4DV6J 1APSA 3HZGA 4HH0A 3DU6A 3EE3A 2A1BA 1N34F 1F9FA 5EGYA 1NPRA 4QWAA 1IKWB 4AXJA 2ZC3A 4CP5A 2FLNA 3QFWA 2FVPA 2QG9B 4M5HA 1WTBA 4LF8J 3SV3A 4DUZF 1RU2A 1VK3A 3NNAA 4ECXA 1KFSA 3MM5B 1MN9A 3AOCA 1QVGR 3ILJA 1R3NA 1OQ3A 5DM6Q 2X3GA 3CJ8A 4Z7CA 1NNDA 1XMQJ 3FFIA 5KFTA 1NHVA 2MTLA 3AQOA 3US5A 2G2OA 4J9SA 3J80Y 3C8YA 4QR2A 1U49A 4LJMA 2WW8A 1D8YA 1PYTA 2XSJA 5B0DA 2AEJA 4ZCMA 1FJEB 1TAUA 2BZ2A 4WP9A 4Z7YA 2NREA 1LNQA 3BKFA 4Y65A 4X4PA 1HNXF 4LIWA 3NAHA 1S6PB 1ZPWX 2V63A 2BE2A 2FYXA 3D54A 3L7UA 2D41A 4DR5J 1XNRJ 4ZN1A 3CDAA 3OXLA 4DV4F 3FCVA 5E5NA 3FCHA 4EFAC 4B9TA 2CPEA 3W1YC 1X4AA 3K5OA 5KFXA 1NHUA 1SJ1A 5E2QA 3R97A 1QUVA 3UDCA 4J9KA 2XY6A 3DFEA 2KT3A 3TANA 3R5CA 2PFDA 2BA9A 4RUAA 3HULA 2FHOB 2NSBA 3I0SA 5T14A 3SSQA 4NCGA 4H4OA 3MM8A 4S0MA 4RBTA 1X5OA 4HLBA 5A0YA 1Q5VA 1JJHA 1VC0A 3LAMA 4F3QA 2R7QA 4XIUA 1P1TA 4C48A 2CJXB 2F1FA 3RG6A 2XNQA 1IQZA 2COLA 2J6SA 4LFAF 4QU7A 4HI2A 1JJCB 3VTIA 1PJ7A 2HZVA 2KT5A 3G82A 4IG0A 4F4KA 5K8OA 2OMOA 2V8PA 1S57A 1Z4UA 1Q5YA 1RSCA 4ZCKA 4DCOB 3AJ2A 3LQVA 1S9GA 2VKZG 4IRDA 3W60A 2DNOA 3T9NA 3MCMA 3BN7A 5HP1B 1SC6A 4M5KA 5ETKA 3MECA 2CPZA 1VISA 1HBOA 1S99A 3J7YI 3HK2A 3HLUA 3BO4A 1D0EA 2C3PA 3SDEB 5EWEA 1JLQB 4CDIA 4Y34A 1KVJA 3ZNUA 5AT1B 3ISZA 2IFXA 3S01A 4NEYA 1FRXA 3SV4A 4QPXA 4IH7A 4LBPA 3J80U 2DHHA 1DQ8A 1Q16B 2DNKA 1UWAA 2SXLA 2EBEA 5IWAF 2XNRA 5ETPA 2IYGA 3NRBA 4F0HA 3IM9A 3C46A 2XZDB 1S1VB 1HQUA 4IQXA 3D5MA 4DU7A 4Z37A 3H2VE 4HHHA 2XMKA 4BLGA 3MPDA 4RW6A 1U6BA 2HQIA 2JZ5A 1YI2S 3BSAA 1K9MT 4C0HA 2ATCB 5KAKA 4OYAA 2BJEA 3NNCA 2R7UA 4HACA 3FEYB 4B3OA 3M8ZA 4EBDA 2QMXA 2DRDA 2V8VA 4USTA 1S4EA 2DNQA 4DSKA 3QGPA 1IM4A 2G0CA 1ZAWA 1QAIA 3B4DA 4TY9A 2HBYB 3HHEA 4KGKA 4ZN3A 4HYKA 2W4PA 4GC7A 3EZ5A 4CH1A 3EGVA 2ZOFA 3AA9A 2CQ3A 3NBPA 4OL8A 3FMBA 4OI1A 3NXZA 1X4GA 2M0GB 2MHNA 2R3VA 3RAMA 3H0PA 1VQNS 2O3DA 3VQTA 3G9CA 3CC2S 4NLTA 5T41A 4WK3A 4OYBA 4UOHA 1NMEB 3QO9A 1U0HA 2R2TA 2HGLA 4RU2A 3NKYA 1PILA 2VODA 3FFIB 2M8HA 2L08A 3Q2TC 4G1PA 3GG1A 1XK8A 2IM1A 1CQNA 2XSJB 1L3KA 1KD1T 3DYAA 5I42A 5DZ7A 4USMA 4ED0A 4IOAQ 1HLWA 3R2DJ 2UUAJ 2F4VF 3AH6A 2HGMA 4K0KF 4QCLA 3UR0A 4M5LA 4N7TA 5F3TA 1Q81T 2BE2B 4CO3A 1KOHA 2KT2A 1ZM3A 4BC9A 2RF2A 5C5JA 4DN0A 3FZ2A 5KFEA 1X8DA 4IFYA 4TNOA 5B0EA 2BV3A 3TRGA 4FDFA 3D68A 3FNNA 2CPJA 2GQQA 1RWKB 2EW9A 1N32F 2QLXA 4QBUA 3T6JA 2PGCA 3GV7B 1S97A 4RWXA 2BJ8A 5E3AA 4F4ZA 2IHR1 4YUDA 1AYEA 2PD1A 2VG5A 1O8BA 2GIRA 1WSVA 3OL7A 2MQOA 5C42A 4NE9C 3I0SB 4NCGB 4LQ3A 2D3ZA 3AOBA 2B5JA 4H4OB 2VL1A 1VRUA 3M9OB 4LSNA 3MM8B 4WP3A 1I94F 2N3LA 4X62F 4RW9A 2J6UA 3MI7X 4A4JA 4ELUA 2DY1A 2HRUA 2GGPA 3RGIA 4O3OA 3HI9A 2GNKA 2LU1A 1B0PA 2R7TA 1WKLA 4IG0B 3KJVA 2C2NA 3DLBA 4NXNF 2VDHA 1KDNA 5G0RA 3RB4A 1U8SA 4ZVGA 3AB2B 1S9GB 5AE2A 3MMAA 4EZ6A 3SBMA 5J1NA 5K8NA 1N5YA 1HBOB 4P2MA 1SKWA 2XI3A 2DBBA 4ECWA 4WZQA 2AX1A 2O01C 1Q53A 1TAQA 1RK8A 3QRPA 4LVNP 1XMOJ 3VZIA 3LWMA 3NG8A 5L1LA 1FRJA 2ROPA 1WDDA 2MGZA 4KTQA 4C8NA 4KO0A 1IJEB 1TZ0A 3KUEA 1ZTWA 2RHQB 4OFZA 1JJ4A 3ZFVA 2C2RA 4MKAA 1F1BB 4WU2A 2ASYA 1ZETA 4OLPA 4F3MA 2C2EA 2J5AA 4FF3A 2IRUA 5ETQA 3LGNA 2GA7A 5GAEI 4TVAB 2AJ2A 2XY5A 3CCWA 3BQ2A 4ZOSA 4ANCA 3UWTA 4I56A 3K89A 2E44A 2C3UA 4RW6B 2A6OA 2HRTA 3VCDA 3MM7A 4M5NA 4A8QA 1BQNA 4JYAF 1N5QA 3I9ZA 3V6HA 4LFCF 4OI2A 1LWEA 3KG4A 3FDSA 2Y8YA 3SCLE 2GMHA 2BXJA 3OVAA 2VZ9A 4M8LA 1KHVA 3KMQA 1YWXA 3PCOB 3UQSA 2V2ZA 1RB0A 3H2UB 4AUKA 2NR0A 4P6QA 3GPAA 2E7VA 5L9NA 1A9NB 5KT2A 3H90A 3QIPA 1G2EA 1FKPA 5E3RA 4MFBA 1TL4A 3PY8A 5AE3A 2AJFE 4QWDA 4R5PA 3VGSA 2DGQA 4U7CA 4K2XA 2H54B 2CQ2A 2VPXB 3D6TB 5LT5A 1UFWA 1SL2A 1WC1A 3OJUA 2VBZA 3NBPB 3FGVA 2CDQA 2FHJA 1NZ8A 2HBZB 4UOGA 1CG2A 1TL1A 1VHFA 3HHKA 3BO3A 1U02A 2DHXA 1SKRA 3HZEA 2QE5A 1V6HA 3M2UA 3QO9B 2JC0A 1U0HB 2W2OP 2KO1A 1TUGB 2VV5A 4YN3B 4NRTA 1KLNA 5L46A 2DNPA 1T94A 1FE4A 1JX4A 1VOMA 3DHWC 3ISNC 4QIVA 2DIVA 2KN4A 2WK4A 2CPXA 3C16B 5BR8J 4RW8A 3KJQB 2FC8A 3DYAB 3ZZOA 2YNGA 1SV5A 5I42B 1JNRB 3O2IA 2OHDA 2AGQA 2R7VA 3G6VA 2FJBB 2VKRA 2ZHAA 1C0TB 3QZ7A 3PDNA 3MPYA 3GYGA 2ASLA 4X4UA 2RF2B 3UNYA 1FVQA 3MM9B 3ZTRA 3D7SB 2PI4A 2R7RA 3VVTA 5FLXY 4LF7F 4U96A 4J9VA 3TZZA 5HANA 4RNOA 4MH8A 3AODA 4NI2A 2IRYA 3GFHA 2FJEB 4USHA 2ZH1A 2A2CA 5K8PA 2LECA 2WOMA 4ZIWA 2KB2A 1VCTA 1XWLA 2VG5B 3DLJA 2EFPA 2UUCJ 4CLUA 5C42B 1FDDA 3W66A 3OTOF 2MKSA 1O0PA 2B5JB 4ER8A 1VRUB 1OY8A 1EIYB 2DGUA 4LSNB 4DV0F 2VA2A 2JFKA 2WVFA 2K7JA 2GIQA 1P1LA 3T1HF 2DNHA 2GGPB 4TU8A 4IG3A 1RAHB 3KJVB 2N7YA 2AJ0A 3NL0A 4MKYA 5G0RB 2UUTA 1YJVA 4A8MP 2R8KA 1PJ6A 2HNYA 3X3UA 3HKZD 1CJUA 2H4YB 4ZA1A 1N5YB 2ZJQQ 4JI4J 5CZVA 2Y1LB 2CUYA 3EGNA 1LWXA 3LF0A 4B9SA 2LXUA 4N47A 3B78A 5ETSA 2QYGA 3CCSS 3HFVA 4UY8T 3U1NA 2Q3PA 3RZAA 1NUEA 1VS3A 3UE2A 5JJBA 2MGZB 1AXQA 5HQLA 4KO0B 3GILA 1SUQA 2XMVA 3SSSA 1LV5A 2L9DA 4K4YA 2VHGA 1NSPA 4X64J 3VAHA 1CVJA 1PCAA 4OI3A 1W2BR 1U4BA 2IDLA 4LF5F 4BC7A 2HQGA 3K7RA 3DRYA 1VBKA 2F7VA 2KH9A 2VFSA 3MEGA 1V3RA 2RRNA 1C1CA 2AKWB 1LW2A 5FLXU 1FO1A 4GO7X 3HSGA 4B3MJ 3NCPA 2H4WB 4DZ6A 3MM7B 1BQNB 2EKNA 1VJQA 4OYXA 3T1AA 2BJDA 2RILA 1LWEB 1HBMA 3THVA 4D3GA 3T19A 2QA1A 4NLOA 4PG7A 1AB8A 4LRFA 5LXRA 3V4MA 1GT8A 4DL6A 4M5JA 1HWUA 2CJAA 2EI5A 3QIPB 1FKPB 4MFBB 2ACYA 1JXLA 4R5PB 1RHKB 4Y00A 1PAEX 3HJFA 2VJVA 1HR0J 3TUIC 3VAMA 3SMZA 4CZCA 1I1GA 4LR8A 4YHHF 1GMVA 2HHTA 5BYRA 2QLJB 4EGLA 1TL1B 1WC6A 1KC8T 3IBFB 1IM6A 2NXEA 2AEMA 3LP1A 3JSYA 1S6QA 3OQ2A 3EX7B 2YWWA 4OZJA 3M2UB 3QJJA 2J8AA 1XTZA 3BSCA 3KUGA 2NSCA 1TV6A 5DO2A 2M8DB 2J0QD 3IBCB 4X65F 2H3EB 3EDQB 5KFSA 1HPZA 1NJXA 4ERDA 4KHMA 2QL5B 5D78A 3TUJC 4RW8B 2V8DA 2E7XA 4DR4F 3QQCD 2YNGB 4LR7A 1RTJA 2L48A 3J7YU 1RZMA 2C42A 3EGZA 1B0TA 1IBKJ 4WWSA 2AV5A 3M8PA 4KHPF 4DR1F 4PAAA 1I5OB 5KFMA 3A3OB 2KG0A 5EHHA 3SXLA 2BQUA 4NI2B 2ERRA 2FC9A 2B8QA 4F4XA 2OELA 3PX0A 2L9WA 3CE8A 2HRYA 2WOMB 1RWWB 4YQWA 1WHYA 1UWBA 2MSSA 4DWIA 4NYOA 3MGJA 2WSCC 1XNQJ 2VF3A 1CJVA 3D67A 2ZOGA 3GJTB 3C2PA 1NKBA 1OWXA 4AL5A 3NLCA 2AD9A 4IG3B 3IGNA 1TFYA 4OJ1A 3I6PA 3LGHA 4LF9J 1TQLA 2IVMA 2JH3A 4MTPA 2IMWP 3R1HA 4WFAQ 2KZZA 1D9FA 4PG4A 3DMJB 5DLFA 1FVSA 1CJUB 3CJ5A 3J7A1 4F4AA 3K8WA 1U8WA 3NGRA 5HBMA 4GMKA 2Z2MA 2H48B 5KFDA 3GFXA 4B3RF 4DV6F 5H9FJ 3NMRA 4NRUA 3TAMA 4ZIVA 1FRHA 4FYXB 4DQSA 4M94A 4CLLA 3FUYA 2W7PA 4LF8F 1NH8A 1SUQB 2MKHA 1NSKL 2N4CA 1X9MA 4DSFA 3R8YA 2XMJA 4ITSA 2EG2A 5HQ8A 1XMQF 1HW9A 3THTA 2HLTA 3DDIA 1LWCA 3W7BA 4NL5A 4F36A 2VPZB 4YDDB 3KLEA 1LXNA 2G4BA 5KG2A 1LW2B 2DHGA 2C2OB 2QMUB 2WSFC 1GXUA 3GCWP 2XCAA 4TLRA 1X5SA 1QUPA 3HVRA 1S6OA 2UZAA 3BV8A 1NDCA 1HQ2A 4DR5F 1XNRF 2Y1IA 1DQAA 1FDBA 1P9YA 2HQCA 3J81Y 3JSMA 2V4JA 4B9MA 3TEGA 4DDFA 6AT1B 3AFGA 2YWKA 3M9NB 3GP9A 4TN2A 3PKMA 3QT5A 4IH6A 4KE5A 1QY7A 4A8XA 4O3SA 3GIJA 2J7UA 3LGMA 4ZVOB 3R5BA 4ETXA 4ZCLA 4DPWA 1PGZA 3CGIA 2HZAA 2VFUA 5JXSA 3V6DB 1JLFA 2W2QP 5LL6d 4HR2A 2F5GA 3OUYA 2QX0A 3A8EA 3CDEA 3O1LA 2LA6A 3UN5A 1HI1A 3QGHA 1EARA 2OIHA 2KFYA 2ILYA 4CRJA 2FVRA 1DURA 3QMQA 3B4MA 4H4KC 3LP1B 3MMCA 1IKYA 1VGYA 1S6QB 4FKYA 2QLBB 5I3UA 1GMUA 1ZAXA 1SXLA 4CO1A 5D3GA 4MIBA 1TV6B 3H2LA 1WC5A 3OXGA 3GIIA 4Q8FA 4DLEA 4Q43A 5J2MA 4Q44A 4KJIA 2GQ2A 1R89A 3CD0A 4F2RA 1RTJB 5KFLA 4LRCA 2JC1A 3VGTA 5DRKA 4HTIA 3I82A 2ZBRA 4RZRA 4N77A 1VHIA 3PW2A 2Q66A 2YWGA 2ZZNA 5F9NA 4OZ5A 2V68A 2OUGA 1UJ4A 2E5JA 4YY3J 4CO0A 2OPSA 2X3DA 2XS5A 1QD1A 1XN9A 2DXEA 5CCLA 2BJ3A 2GHVC 1UWBB 4FS2A 3W2WB 4ES2A 3RAXA 3MTKA 5AJ3J 1CJVB 5GAEU 3J81U 3I31A 3QLHA 3UDLA 4QQBA 2PC6A 2GJFA 5LSRA 4CT9A 5LJ3Y 1WDTA 1SPBP 3P5BP 4BWMA 1U1PA 4O4RA 1M90T 2W24A 2VG6A 3M6VA 2ROGA 3HT0A 5CYJA 3CCJS 4GO5X 3FVYA 2UXDJ 1VQ6S 1KONA 3WX4A 4NWBA 2HS3A 4YP3A 3BSOA 3GIKA 1FRIA 4EEYA 5DGAA 1KLMA 1FFGB 4OI0A 4KPCA 1CULB 3ZZPA 1U26A 2QGFB 5HBMB 5KFJA 1FJ7A 1NJZA 1QJHA 4OZ3A 3RBEA 3TAMB 2JVOA 3HXMA 2JLFA 1F9HA 3O6QA 4JI6J 1SJ4P 2Y1JA 2YPZA 2KG1A 3DRPA 3CD5A 4LREA 4I6AA 5B0AA 2F8HA 5HATA 3OBIA 4K8RA 1H2TZ 5DQGA 4WCEQ 4CLFA 3PX4A 2R8JA 2M5YA 2DHAA 3HF5A 1LWCB 4PG8A 2RUSA 3KLEB 3UD4P 1YDLA 3T9ZA 4IYQA 4O44A 1EB0A 3T5JA 3RU0A 2ROEA 1MMLA 2J9EA 3K5MA 1FWLA 2E5HA 2QMWA 2UUAF 4CIOA 1AFJA 1DY3A 3CCVS 3FZBA 1HYSA 2CIMA 5C25A 1N36J 2OFHX 3E01A 1L3SA 3CJTA 1U2RA 2MQMA 1YJ9S 4R0EA 2WBRA 5FDLA 1V9OA 2OEJA 3JSMB 2V4JB 4TXSA 3PV8A 4OI4A 4ZK7M 3G8SA 1UFLA 3KLFA 4QR1A 5LJ5Y 2IC3A 2Z57B 1TFWA 8ATCB 4QW9A 2UV8G 5C2GA 2DNMA 1U6ZA 1Q78A 3BGRA 2P9CA 3KHGA 5HROB 3AOAA 3QAUA 4ED7A 4HHJA 4ZHRA 3BQ1A 3OUYB 3KK2A 2E1PA 2WRMA 3BM7A 4FZVA 3D0HE 2DNNA 1TK0A 4DX5A 3OR2A 1H38A 2EVZA 4QYRA 5DDPC 3DRSA 3MMCB 1KTQA 3DNCA 1IKYB 3WHIA 4BS2A 1S0MA 3LTOA 4YOEA 5I3UB 5HO4A 4QYZK 3GCXP 1IQTA 4WTOB 2LQ9A 1NEEA 4UTGA 4XPEA 3TZWA 1FK9A 3EWGA 2V9KA 4FS1A 5F9LA 2HQ3A 3GSIA 3DN9A 4PABA 3BB5A 1HI0P 3TI0A 5J2MB 3W62A 4H4KA 5D0GA 3S1TA 2CAJA 1QAYA 2QO3A 1WWHA 2B4UA 1RP5A 1XMOF 3LOUA 3L09A 1JQGA 1PYSB 4J9LA 1PC4A 2LDIA 4FYDA 2H5JB 4QU6A 1EP4A 3OTEA 3MHYA 3EPIA 1NSAA 1Y4ZB 2OPSB 1WF0A 3I0RA 2LQJA 2E66A 1CJKA 2OPPB 1S4FA 1NK4A 3N5BA 1UVKA 1NO8A 1OJ4A 3PJWA 2P5VA 2R7WA 4AFFA 3DLGA 1LW0B 3R27A 3NGDA 5CD4A 3QLHB 3CWJA 1JNZB 2LXIA 3QYYA 1RYSA 1X60A 2VOOA 2ADCA 2R2UA 2IJRA 2DXDA 2QJ3A 5HVGA 4OZ1A 4WKYA 3SQOP 2VG6B 3HX9A 3TOQA 1UW9A 2JSXA 1EETA 1Q7YT 4P9SA 2Q6BA 3J7ZT 3JYTA 1U7LA 1SH0A 3N4WA 4ZCIA 5KFOA 2FLPA 5D8HB 2B7BB 4AYBD 4IUFA 3KHRA 1VR6A 4BWJA 4MIWA 4OHZA 1TMMA 1IBMJ 2G9OA 3CJ2A 1NKCA 4C4WA 3PFEA 1KQSR 1G3OA 1HFEL 5HVFA 3LWLA 1M0SA 3G4SS 2F9DA 1QLNA 3SCIE 2C3OA 2IVFB 4CH0S 2FHMA 4I67A 4OJHA 1FX4A 4PYAA 3DRPB 3CMAS 1B4SA 1V3ZA 2P9GA 5IV3A 3GJSB 3M8SA 3AT1B 3R7NB 4JV2A 3WDOA 1CSJA 1WSRA 1Y3JA 3CC7S 3M4XA 1IBLJ 4PEOA 4PUOA 1NDLA 4A47A 4DPOA 2K8GA 1FT8A 3I87A 5BR8F 1RKIA 4DL3A 2EPIA 4O44B 2LMIA 1JIHA 1RWUA 1QSSA 1U48A 1FD2A 1K1QA 3NGTA 2M52A 3O44A 2LYVA 3KK3A 1FJGJ 1HYSB 2KM8B 5C25B 1TKTA 3E01B 3G6XA 2VJUA 2E9ZA 4U7UD 5HAOA 1WG1A 1F5BA 3CNQP 3A13A 2BE7D 4RWWA 5FDLB 3OHBA 3KLFB 1KVIA 1H2VZ 2CPIA 4FVCA 3M05A 2IC3B 2H65B 1LXJA 1Q82T 1UPPA 1EZZB 3T5HA 5JVHQ 3M8RA 3ZO7A 2RU9A 4DJBA 2PA8D 4ED4A 4OYOA 2MKCA 5GMDA 2UUCF 4C9DA 3N6LA 1RWNB 2A6MA 4ZHRB 5CABA 4O23A 3MFIA 2DEJA 2ILZA 3KK2B 1T95A 1YRXA 3FBCA 3IP0A 2DGOA 4F4WA 1ZM9A 2HWTA 3VALA 3OR2B 1BXNA 2XB2D 2GMJA 3DRSB 1TKDA 4NLDA 3CDWA 3G8QA 3CCTA 4DR3J 2EC2A 4WXWA 1X4CA 1JLBB 2IAJA 4ALZA 4ED3A 3PJXA 4I68A 2NYHA 2HHVA 4OYMA 2KJWA 5LSLA 3C6UA 2RKIA 5CD4H 2YBVA 3PRVA 4JI4F 4DOZA 3AJ1A 3PTWA 4C3LA 3TVZA 2FHJD 4Q5VA 1KQKA 5D77A 4OV6A 2DIUA 1AROP 5F8LA 3H20A 1LFPA 3SCKE 1M5PC 3GYNA 3AD9C 1PC5A 4FXVA 3DRRA 3P49B 1H72C 3QAEA 4J9PA 3ZZTA 2CXEA 1WI8A 3FRYA 1RA7A 1EP4B 3DOKA 3MF5A 3OJSA 1HHQA 2BR0A 1RAOA 4EBCA 1N52B 4X64F 3I0RB 4XDCA 2HFNA 4M5DB 4NEZA 1CJKB 4P75A 3L7OA 2W25A 2EWHA 4ZVQB 2RRAA 5K14A 1XR7A 1KP6A 1BQXA 2PDAA 2GO8A 3DLGB 3OXFA 2HQFA 4W98A 3OFFA 5A2QU 4BCAA 3QFHA 2BDPA 2K06A 4B3MF 3UVJA 4USUA 2PSZA 2P2CB 1OSCA 2J6TA 4CM0A 3W64A 1ZYQA 4QOTA 2P6SA 1RAJA 3RW7A 2RDIA 1EETB 4RO0A 1CQMA 1S10A 3GONA 3JYTB 5IOLA 1SIZA 3PYGA 3W65A 1T9XA 1REGX 2F4FA 2I5JA 2XY7A 2HVDA 2QC3A 1VI7A 3M32A 2HHHJ 1YGYA 1T03A 1KBRA 3LO3A 1HR0F 2KHDA 4P73A 4DL0C 3TJ8A 5BYQA 2B43A 4E2FB 2GMLA 2C2MB 1ZS6A 2J9CA 3BH7B 5J1EA 1NLKL 2J9DA 3R1LA 3QATA 3MD1A 4O3RA 3P5TL 4ED1A 4F3OA 3H98A 5EDWA 3E51A 3TX0A 4ZITA 2YY3A 2QLFB 3NEKA 3GV8B 4PUOB 2QLWA 3HSDA 3N0VA 4LVOP 1JXEA 2VBWA 4KRWA 5HL7Q 4TQRA 3NAIA 4KY3A 4I2PA 2PO4A 4NZ0A 1IBKF 4YB5A 2IDEA 2X1FA 3KK3B 1M1HA 3H42A 2V2QA 2VASA 1TKTB 5J2PA 2WVCA 5AXKA 1K47A 5IT9Y 4UOCA 5DM7Q 3T3FA 5D0EA 1RXOB 3MEDA 3SZ2A 1UVJA 1S76D 2LDYA 3QWPA 1SH2A 1IVZA 2XQCA 3H5YA 3CF5Q 3N9UC 4PQUA 1ROFA 4X4SA 1HBUA 1X4DA 3GLJA 3PW5A 3EVOA 2Z2YB 2G0JA 2NCKL 4F02A 3FSXA 5B09A 3QNWB 4EWTA 3LP2A 5DJBA 1R6YA 1G1XA 1XNQF 2PE8A 5DQIA 3AQPA 2HAIA 5H9EJ 2V6AA 2DGVA 2NUUG 3W5ZA 5IC4B 1MWYA 2E5GA 3BSNA 5L1JA 3UCUP 1NU4A 2OP5A 3R5GA 4P2FA 3VGVA 1MSWD 3PX6A 5GVQA 2MQNA 4OMFG 1A7GE 5EX0A 4WYLA 1F60B 4LF9F 2IAJB 2KXNB 3QZ8A 3TARA 4LF4J 5KFRA 3H59A 1R8PA 4DPUA 1ITPA 4FNIA 3C6UB 1ELOA 2RKIB 2LU2A 3BF4A 5DDRC 3LP0A 2GC8A 1DTQA 3BGLA 1DHMA 3W9HA 3UCGA 1TUVA 3IC1A 2G2ZA 3VAJA 4DSJA 2IBOA 3WC2A 1RHMB 3LW5C 3BPDA 1SJQA 3KUHA 2ALYB 3PRBA 3CDUA 3DRRB 3AXMA 1IKXA 5KG4A 2YKAA 1EQ0A 5F41A 3PR5B 3KLGA 3M9MB 4JI1J 5GADI 4DS4A 2NLWA 4K5SA 3DOKB 2LFVA 4NZ7A 1FCAA 4QWCA 2AQ4A 1NB7A 4MJKA 3QT8A 1KKHA 5HMZA 2GS8A 3IMQJ 1N5TA 2IM2A 5JMNA 3JTOA 3P96A 1X0FA 1PG5B 4CI0B 3ILLA 3NS6A 2YNFB 5A8WA 4MKVA 3OW2R 5K14B 5KFUA 2HLUA 5EN1A 3Q24A 4KR0B 1JWWA 5IT9U 3QGGA 3K2YA 1L3TA 3CVKA 1XJWB 2C2KB 1C0UA 4O3QA 1WHXA 4UQGA 1KNZA 4NYZA 3Q0AA 3TZYA 4C98A 1U25A 1WKKA 3N6MA 2BUNA 3UVJB 8AT1B 4GKKJ 3OR1A 1NK5A 1RT7A 1HNIA 3K5PA 3PEHA 2XS2A 1YIJS 4J37A 1HIYA 3SYZA 4C0OC 2RU3A 5F8MA 1LEOA 2IA6A 4OV1A 3OD2A 4A46A 3M32B 1RTZA 4PWWA 4ZPCA 1QM9A 4O3PA 4X4OA 2ZD1A 4OYIA 3TO8A 4DX7A 2E9TA 4CO2A 3D28A 2AYEA 5I4MA 4ZP8A 3FEZA 5J1EB 2R8HA 4HKQA 3G2XA 1F6TA 4L3KA 2MDAA 3KLIB 3MOZA 1VQ9S 4ZVPB 2IY5B 1DQ9A 4AQYJ 2BM1A 2CQCA 4DR2J 1YQHA 5ETTA 3QT7A 3KWMA 1FFSB 1Q8KA 4KQZA 4OQJA 4LF6J 4ZJQA 1UVNA 4BBYA 2YVSA 4USJC 3C19A 5CYMB 1XMBA 1S1XA 1DLOA 5CAAA 1YJWS 3LPEA 4I2PB 2HW3A 1RAGB 1FJCA 1E6YA 2B9XA 1AW0A 4UF4A 3HHDA 2V50A 1URNA 3IWXA 5A6WA 3KDNA 3BGOP 1SKUB 3KJNB 1H0HB 1AZSA 1FRLA 2PEHA 3MEDB 3KYLA 4DUYJ 2HHXA 5KG7A 1VDHA 3E3XA 3H25A 4ATNA 4YY3F 3I5AA 1GX5A 4RU9A 4A8YA 2VICA 4LFBJ 4N8OA 4PQUB 3HHNB 3DM2A 3MD3A 1HBUB 2VA3A 1NHKL 2EC0A 3HHLC 1OS5A 2WSEC 1TL7B 4CM2A 4DPTA 2EFVA 2A0FB 2IM0A 2F8MA 5SZTA 4I6YA 5AJ3F 1SB6A 4HT7A 4YB6A 2MKJA 3FBBA 5ETVA 5C24A 1RWVB 4ECRA 4ZVEA 3LAKA 4OX8A 4DCPB 4HEA9 1YG0A 9RUBA 2F3JA 1F0XA 3TAQA 2JFDA 3UN2A 1EHWA 2MYFA 4ZVTB 2Z8QA 4EYIB 1K0TA 3QT6A 2UXDF 1ZH5A 5LMNJ 1W7WA 2CQ1A 2QZ8A 3SCJE 4LT6A 5GMKa 2E1CA 2ZH6A 3IGVA 2VBYA 2CQGA 1UEVA 1T11A 4YFUA 3ETOA 4AXIA 3G96A 4USIA 2CQBA 1P9QC 3ENWA 3LP0B 1S9EB 2MZTA 2UU9J 4F7VA 1VBYA 3ELHA 3U1LA 2YTCA 1IWAA 5LMUJ 3CJ4A 1U45A 3GSDA 1RWOB 2YQ3A 2DCUB 2MJUA 3MMBA 1V5IB 4HVZA 2PA3A 1IKXB 4Y6IA 3TW0A 4YEAA 4JI6F 1D8ZA 3KLGB 1OQ6A 3CMQA 1NB2A 2IMOA 5LXYA 2MSTA 1JLAA 5HJYA 1T9VA 3GB0A 2BX6A 2XBPA 2DNYA 4ZPTR 2DNGA 2D69A 2DGSA 1AFIA 1YJTA 3JSRA 4PXBA 4JI0J 4JI8J 2HFUA 2XSFA 1B64A 5A8WB 3BBFA 1CJTB 1KTVA 1RAIB 1D3WA 4ZPDA 4ECSA 2WVDA 1V3SA 2LQ8A 1C0UB 1TK8A 3EICA 3U7JA 4R8UA 2PT0A 2HS4A 2L41A 2DEIA 1VQ8S 1N36F 4IRKA 2JEJA 3OR1B 4LF2A 4DV5J 2HFSA 1FE0A 2WVEA 1HNIB 1RT1A 4NXMJ 3M2VA 3ZTQA 1X5TA 2JVRA 3W8GA 1WI6A 3DXSX 3J81j 2ZBPA 4ZS6A 3I4PA 1NAQA 2VDIA 4URGA 2W1BA 1KR4A 2OPRA 1TL3A 3M30A 1CEZA 1HW8A 4DG1B 1MNEA 4C97A 1F3VA 2DO0A 5D6GA 3U27A 1W25A 3EXYA 1YHQS 4FYVB 4M63A 2MHEA 4ANEA 4WF9Q 1C1BA 2ZD1B 2CFXA 3KHLA 2YWHA 2ZWOA 1AUDA 2QV6A 5U47A 6FDRA 2CQIA 2ZZMA 2HVZA 2WAQD 1UEKA 3PM9A 3OL6A 3WQPA 3GG0A 4MMOA 1SVDA 1D09B 1KQFB 1EKRA 1E6VB 1SL0A 2D3O1 3A4TA 1YITS 4OJGA 4DEZA 2R2SA 2LKZA 2Y8WA 5AXLA 4J9QA 4Q8EA 3V6KA 4RW4A 1SQFA 4M1KA 2GV1A 3SFUA 2VQEJ 2KYZA 1S1XB 1DLOB 2O66A 4C7QA 3POTA 2KDOA 2BW2A 2CNLB 3FSYA 2V67A 2W4CA 4X4RA 1HD0A 1E6YB 1T8EA 4OHVA 4TYAA 3UCZP 2DVIA 2MEWA 1AZSB 2QEXS 4ZPBA 4PWDA 5IT4A 1EKSA 5A76A 3Q8SB 5D4OA 4C8ZA 1YZ7A 1ZBTA 8RUCA 1VQLS 1Q4RA 1WHVA 3DM2B 4G6VB 3SFGA 1F2GA 4ELTA 2MZRA 2MY7A 1RABB 2V0NA 1HARA 1NCLA 2VC0A 3I9V9 2LA4A 2FPHX 1GTHA 1N5VA 5C24B 1Y5NB 2QSFA 2NUHA 5DLGA 5KG1A 4ZDNA 3NOCA 3A8IA 1RADB 3ICLA 3GFZA 4DFJA 3HHLA 4GVLA 5IT0A 5CHCB 2ZH7A 1WUUA 4EK2A 1UFKA 4Z2XA 3MAHA 1XR6A 4C8MA 2OTJS 4D3HA 1EJ7L 2W9CA 2GCFA 1I51B 4U6PA 4G1QA 5KFGA 1NK0A 1BD6A 2WW4A 5D4PA 3CJKA 5A0YB 2Q6CA 4ZP7A 3JTNA 1IBMF 3CCZA 3SI8A 1PIEA 2BKOA 1T02A 3GU0A 4JP8A 2JEFA 3HJVA 1RKJA 2DRAA 1MU2A 5FJ4A 3MMBB 3G82B 3PW0A 2NPIA 2RE1A 4WKRA 2V8HA 1T9TA 2IPOB 2AJ4A 4JI5J 1NM2A 1Y7PA 1XC9A 3HVWA 3MECB 1N6QA 5KFHA 1SH3A 3CDBA 1FEHA 5IFMA 2G1HA 2ZH8A 1IBLF 2DISA 3C15A 1LOUA 4USKA 2BJ9A 2CYYA 3MMJA 1GFWB 5DG9A 1P6TA 4YDXA 3OFGA 4OHWA 4DPXA 3H7HB 5B0GA 3MPVA 4DPYA 1HWJA 5F0UA 3BBBA 1FJGF 4R8UB 1VQSA 2LQBA 2XHCA 1GK8A 2XMAA 1IWGA 1RT1B 3M2VB 3MUVP 2V8GA 2ZH9A 3PFOA 2XLKA 3TA1A 3VAKA 5ETRA 4P2XA 5I3PA 4JV0A 1PYOB 1RU1A 1HQUB 2K7KA 4FXDA 1S0VA 4EYHB 4KHRA 2UVRA 2OPRB 1J5OA 3PYEA 1TL3B 4FYWB 3M30B 1RTIA 3ZXWA 4IO1A 3O3LA 4XDDA 4LIRA 1T7PA 2QFIA 3N6NA 3AY0A 1RDRA 3CULA 2J0WA 1NK8A 4A8OA 4ZLPA 1C1BB 2B0GA 4HACB 2RDDA 2BW7A 1ZTTA 4B3OB 4P7TA 4P2SA 1Q8BA 1HHSA 3ITHA 2BEFA 5KTQA 1M5SA 4HHUA 3H40A 1UVLA 3TVKA 5B0BA 3LA0A 4MAKA 2OD4A 2ABYA 3FEXB 2FIUA 2FD2A 3RBDA 2MXYA 4IDKA 4LR9A 4NLUA 4K4SA 1NZAA 5M2PA 3PYFA 2DNRA 2XM3A 2V2KA 2Z30B 4DR3F 2DPIA 3DOLA 1PKUA 4NLRA 4CTAA 1F2HA 4RNFA 1FNMA 5J2QA 5JUMA 4RW4B 2QYCA 1D1UA 2XWYA 2B56A 3T5KA 2E9RX 2D3OR 1Q0NA 4DQIA 2GVDA 2V9WA 2AT1B 2JRSA 3BS9A 3POTB 3K59A 3JQJA 4FN5A 4YMEA 1PAUB 3RUBL 3G86A 1WOOA 3BGFA 2CQPA 2HWHA 2B7CB 2JWNA 4ES1A 2K1RA 1QAXA 3CD6S 1UVIA 3NNHA 1Q8IA 1ZOTA 1ZM2A 3TAPA 5L9XA 5LM7E 4LSZB 2E1AA 3LPYA 5GADU 1DZ5A 4IRCA 5A6PA 2B6AA 3TA2A 3ET6A 2R7OA 1ACMB 3C3LA 1FEEA 1IR1A 4RW7A 4EMDA 1UVMA 2IM3A 2XS7A 5CZXA 1PJ5A 2ACMA 1UZDA 3ZTOA 2KXFA 1RCOB 1HMVA 1Y00A 4DUTA 1WNEA 3I32A 3OSPA 2J7WA 4WU3A 5ETMA 4IFYB 2DJWA 5T7LA 3FJ2A 2XHWA 2EK6A 2YQ0A 2RB7A 3M8WA 5HJXA 2KFZA 2Y0BB 2FDNA 3VVUA 4UZBA 1X4HA 3NP5A 1DTTA 2KZMA 3HHLB 3G71S 4OZLA 3T41A 4FVMA 4ECTA 2W9CB 1UL3A 2MJNA 3W8PA 4G1QB 4KGMA 2BQRA 3VWSA 2GJ2A 2FJAB 1FXRA 2M3DA 2YKMA 3CJKB 4RW9B 2HHHF 1SKSA 3AXKA 3QRQA 3W3SA 4URSA 1BY9A 3VV2B 3V4IA 3J7AN 5ADZA 4NOHA 2E1MC 2ZC4A 5E7OB 2M88A 4I4BA 1MU2B 4TYBA 2OO4A 4V1Ak 1K1SA 4X66J 5KFBA 4FF2A 4C3KA 1GMWA 2XI2A 3DCAA 1OIAA 4NLXA 5IS2A 1WC0A 2FGCA 4ES3A 4RNNA 4USVA 2D7SA 2MMYA 3IA0A 3MMAB 2XCPA 4LUBA 2I8EA 1N6QB 4ETZA 3KLVA 1H7WA 4OX7A 1T9UA 3QRRA 1VQYA 2AU0A 4N41A 2AMCB 2ADBA 2G1DA 3IBWA 3N5FA 3C15B 3FQKA 4P74A 3R5AA 2DR5A 2J8SA 3FBFA 2P6TA 3ZTSA 3P6YC 4C8KA 1UCNA 4DF4A 3RR8A 1RACB 3V81A 4RUCA 3UNGC 2LP4A 1JLQA 3ZTPA 1HA1A 1OO0B 2R42A 4P52A 4NASA 1NPPA 3MOJB 3WIUA 3UD3P 2G2YA 2VOPA 2B4VA 3I56S 3G6ES 4RLEA 3HPOA 3BQ0A 3A3PB 5HK4A 3KXDA 1Y3KA 4FBUA 5HN0A 4LSLA 4WK1A 2GFFA 2J76E 1J5OB 3TP2A 1RTIB 2GW8A 2RQCA 2OI2A 5KOXA 1RJJA 1U6FA 4F26A 4WFZA 5GAGU 5LOQA 5DGBA 4X4QA 4ZJLA 2W2PP 3BBCA 1VIXA 2ZUAA 3GV5B 3W5XA 2R2RA 2XYPB 3BEGB 4I64A 3B54A 3FC9A 4XTTA 1HNVA 2R7XA 4TY8A 3ITHB 1H74A 1MN7A 3OV7A 3CJ0A 5M2RA 2HGNA 1UP1A 4U67Q 3T1YF 2MLYA 1BGXT 4Y28C 4IDKB 2VQFJ 1Z2ZA 1T3OA 2G13A 3SSRA 3Q8PB 1RHUB 5M2UA 4JUZA 1GEHA 2DGXA 3GWCA 2NXUA 4C6AA 3T6BA 3DOLB 4CTAB 1QTMA 3TZXA 5J2QB 4LF4F 4ICLA 1U1MA 3HP6A 2EXUA 1TKXA 1RAAB 3V5RA 4JI3J 4CO5A 2GVDB 4ZP9A 2I1RA 2XZWA 5FD1A 1N88A 4L72B 2ZNZA 2XLIA 2YQ1A 3KK1A 5KT4A 3K17A 1MWQA 4CWBA 2YH0A 4YB7A 1Y10A 1URRA 4J9MA 3KTQA 5F8JA 3M8QA 1RT3A 3FCWA 2K1RB 2CJBA 4ILMA 3P45B 4AL6A 4JI1F 4DV2J 1B3TA 2I6WA 1S0OA 3IRXA 4FYYB 2DD8S 1Z2LA 2EEYA 1FTRA 1PSDA 2QN6B 2B6AB 2YWEA 1SV5B 3ET6B 5A8RA 2OTLS 3CJRA 4DS5A 4RW7B 4JV1A 5IQQA 4IO9Q 4DL5A 1RAEB 3ZZZA 5EX3A 2MZSA 2DTJA 4GKJJ 4DR6J 1HBNA 3H5UA 1O6XA 2WTFA 4W90B 2AZ3A 1HMVB 1HHTP 1VC5A 2BVZA 2XULA 4HI1A 1NJWA 5T7LB 2I38A 5KFFA 3M6WA 4ZVSB 4WBFA 4RNMA 3VR1A 4GKKF 1Q7LB 2HFZA 2CJ9A 2AHOB 1QVFR 2M70A 2BRLA 3TJ9A 1U1KA 1DTTB 2OKQA 4B3TJ 3HSJA 2VONA 2DR9A 2A18A 2O5DA 4RBUA 4G1IA 2CQDA 1ZM4A 3Q89A 4L74A 1TVRA 2YKMB 4RUBA 2JNJA 2C22A 4ZVFA 2C2DA 2NXNA 3GZ7A 3V4IB 3M8YA 3DLLQ 3DLKA 1UEUA 1Y11A 2HZCA 5KFWA 2M4MA 5AE1A 2GAGC 1DRZA 1K73T 2HK3A 2BJ7A 2HEKA 2P8IA 1FXDA 1GXTA 1OPZA 2D9OA 3PHEA 1XQIA 2HNYB 3HVTA 4AQYF 5CYQA 3MEEA 2I9SA 3UO0A 4DR2F 3W61A 4LF6F 3MPUB 1NH7A 2ZHOA 1HNZJ 1LK7A 2ZBCA 1RWPB 2GQCA 3EYZA 1K0VA 3Q8YA 4XAKA 4JV5J 4I0WA 3CB4A 2YX7A 2B4PA 3V81B 4RUHA 1SCJB 2DNZA 4ID5A 3CD7A 3RAQA 3OVSA 1YBAA 1L5UA 1ZA2B 1FRMA 4J7CA 1JK9B 2NXCA 2KM8C 3PHTA 1T9YA 2OEMA 2D3UA 1PBUA 4ECQA 3NMAA 3ENAA 4ENOA 3MM6A 4JI7J 2G0IA 3MR7A 4DUYF 1A6LA 4LSLB 1UAWA 3D1OA 2HVEA 1OMSA 3HT3A 2LCWA 3MEGB 3KKFA 5ETNA 4LFBF 1C1CB 2AYBA 2FHKA 4QIFA 1G4CA 4RBVA 5L38A 1U47A 3EDRB 1X0PA 2DR7A 3KHHA 4WFXA 4F50A 3TUZC 1VQ5S 2IIHA 3KMSA 1CS4A 3Q22A 1CC7A 1HBMB 1HNVB 2VFVA 3FRZA 2CZVC 4TY8B 5G4DA 2ZKUA 4O0NA 4UOFA 1WF1A 4KC5A 3N01A 3WX8A 4CLWA 1F9EB 1N33J 1I3OB 3KNGA 3D1QA 3PKYA 4CH7A 4CLPA 5B0FA 2HBRB 1S1WA 5LMNF 2JLGA 3BKTA 2YKPA 1MMNA 3EXCX 3DI6A 1RYRA 4ICLB 4X4TA 2AGPA 1OY6A 3O5TB 1TKXB 4H4MA 2B9EA 1SJFA 1FDNA 4C8LA 4I1TA 3KJFB 2IJNA 2RD5C 2UU9F 5LMUF 1R0BG 3PO4A 2QT7A 3KK1B 2Y1RI 4K4XA 3DGPA 3UD5A 3D6MB 4K4WA 2UP1A 7AT1B 1WJ9A 3B8HA 2VG7A 2JJ4D 1L3VA 4DL7A 3M8QB 5DETA 1RT3B 1U0SA 4JI2J 1NRKA 3DHXA 4ILLA 2UXBJ 1HWKA 3ZZYA 2BE9B 1HPZB 3FKBA 3UN3A 4PYDA 3IRXB 4YR0A 2KU7A 2WVBA 2JHEA 4LBHA 4J9RA 2F8EX 5A8RB 2HKEA 4J9UE 4ZMMA 2JL9A 3C16A 1SC1B 2APOA 2QA4G 4NLWA 4JI0F 3NS5A 5IC6B 4JI8F 1UA0A 4ECVA 1UA1A 1HBNB 3M8PB 1UPMB 3PVXA 3Q8RB 1C0TA 1VQOS 3IG1A 2YKNA 1U2CA 2VU5A 4QIWD 1ZAVA 1XEZA 4X84A 1NJYA 3DC2A 4WPAA 4DV7J 3MM9A 1FX2A 2A3JA 4DV5F 4K5RA 1GQEA 2AEFA 4NXMF 2ZH5A 1TU0B 1S9FA 2W2NP 1DFDA 4OJ3A 1CBKA 2H51B 4F8RA 3DGVA 4WJBA 3CIZA 2MB0B 3ENQA 3IWLA 1TVRB 4PKDB 3I55S 4QIEA 4DHVA 5IM0A 1RTHA 4KPYA 1W26A 1I6JA 3C14A 1RWMB 1TP7A 3DLKB 4DL2A 5RUBA 2IVYA 3AD8C 3RTVA 4NLSA 1VQPS 2DGTA 5KFAA 4XPCA 3JB9k 2XLJA 2BM0A 2ZUGA 2FTRA 3HVTB 5CYQB 2J0XA 3MEEB 2VFTA 4WIQA 2RS8A 2XC9A 4CYUA 2F63A 3N79A 5B08A 2BYCA 3HSZA 4K50A 3B82A 1RBLA 1HD1A 1BMQB 2VQEF 3Q8UA 1U1LA 3JTPA 1R27B 1YBUA 2H9ZA 4ID5B 1H7XA 1IKVA 3H4BA 2F40A 1KOOA 3AB4B 1Q86T 1FKOA 4U8VA 3KNAA 3MM6B 4DQRA 4UUXA 4KH1B 3OTDA 1IBCB 1RE1B 1B70B 3RRHA 5IXUA 2B3TB 3KDOA 1NKEA 4KGZB 4ZVHA 3KOAA 2BBEA 4I6WA 2CQ4A 5IV4A 1REVA 2R8IA 1YVFA 2DR8A 1R8CA 2KXHA 4OYZA 3AA8A 1CS4B 4K7QA 1IUJA 3OTBA 2PMZD 1YX2A 4MK9A 1M1GA 3L95X 1UETA 1RCXB 2C3MA 4E8UA 1S6UA 3UDEA 1EAYC 2XMTA 4KSEB 2GHWA 2OMLA 4C8YA 4LQ9A 1MMDA 3D66A 3DXBA 3CIMA 4WIIA 3F0NA 1VYAA 1BHNA 4PG5A 1JLFB 1S1WB 4B3SJ 3DI6B 2C1EB 1S59A 1WG4A 1YJUA 3IWNC 4RJVA 4C11A 4H4MB 4O0IA 2W9AA 3HVAA 2O1PA 2QRRA 1QTNB 2DPJA 4LRAA 2M2BA 3L4BC 3ZZ0A 4LRDA 2EFOA 2LEBA 4B9UA 4DSIA 5L1KA 4RX6A 2JOQA 2KHCA 1JLGA 5E3QA 4NMLA 3DGPB 2PMWA 5K9FA 3I96A 4W4MA 2VG7B 3IXQA 4V19X 2XGPA 3EM1A 1YJ7A 5D3GB 4F0MA 3MR5A 4JI5F 3PIOQ 2UXCJ 2OAUA 2FVSA 3BR9A 1C2PA 1WTFA 4EI2A 2D9PA 4H54A 1GX6A 5IQ6A 3RYLA 2VBXA 3PACA 4NCBA 1X9WA 2JLEA 2AJ1A 2Y9HA 3NY0A 5KT5A 2OJ3A 1JB0C 2XWXA 4OX6A 5K5MA 3DU5A 3BDEA 1SI9A 2Q1LA 1S0NA 1SJRA 5GAHI 2K3IA 3IG1B 2YKNB 3EMTA 4MYTA 5KFIA 2BACA 4RKUC 4DQQA 2V94A 4DXLA 2W4DA 4QPTA 5LSOA 5E3CA 3FQLA 1IN0A 2MQ8A 1SC3B 2V34A 5HI7A 4PWUA 3GFYA 4PXEA 3U1MA 5F8IA 2CPYA 3BPSP 5MLCV 4KGVB 1N0UA 3BYPA 3PW4A 1RUSA 2EFQA 2WONA 4PPDA 5H9FK 2ZDOA 2ZFHA 4TU9A 3DLHA 3ILOA 4LBIA 1WOSA 3K58A 4B9VA 3MCNA 4A8SA 1P27B 5IM0B 1RTHB 3PW7A 3G87A 3CSKA 4Y3CA 3C14B 4HH1A 2ZH4A 1U1NA 1RT6A 2AX0A 3M7VA 3HM9A 5D0RA 2H1YA 4OYWA 2GAHC 1LWFA 4P72A 3HHLD 4AE5A 2RMLA 2ZBIA 4QJVA 2VB6A 2P9EA 4HL9A 2W8KA 1U2FA 1R43A 1KLMB 1GAOA 2KKHA 3K57A 3TQEA 2XEXA 5DDOC 4CYUB 1P8GA 3DMJA 4OYPA 1S79A 2LQ5A 2DXFA 1TUWA 3RBXA 4ZLNA 1UZHA 1M5HA 5CA5A 2KFNA 2NQPA 1B7YB 4JB8B 3Q83A 5KFPA 2E5LJ 4KV8A 4MKBA 3GIMA 1FXLA 4ZJOA 4IOBA 2CADA 5B7WA 2F9JA 1YSJA 1WORA 2DH8A 3KG1A 3S7RA 3VAGA 1IKVB 5HVHA 3RRKA 1YK9A 1HWLA 1Q8LA 3PRDA 4IKAA 3RR7A 1XR5A 1U1QA 1FKOB 4DL4A 3HMJG 2XO7A 5KT6A 4Y0FA 3VF0B 1QSLA 1GNKA 3W63A 2ZM6J 4KB7A 5ETOA 2MY8A 3WZ0A 1NK7A 4B08A 3D4JA 1RHRB 1S5ZA 1REVB 4DR7J 3JAMY 1LKZA 4NLYA 4QW8A 2J9DE 2X7IA 5A2QY 1WELA 4MIAA 1Y0HA 1TMJA 1SQEA 5DZ6A 2ZBQA 1FI4A 3QSIA 4DBQA 2RDJA 3BGRB 1XBWA 3JQKA 1RAFB 3W9JA 3A3NB 3CJQA 2DHSA 2N82B 4WTYA 2V69A 4K4TA 3V6DA 2EKYA 3QSYB 1XERA 4KAIA 1VC6A 4C11B 3OLAA 2GZOA 3BH6B 3JXOA 4NLVA 4U95A 3CT9A 1FTCA 2IRXA 4M5GA 2KVIA 1X31C 4FPRA 1JLGB 1HWIA 1M1KT 5D15A 1VK8A 4X66F 5C2CA 2M9KA 4UY85 4OIXA 5KFYA 4GC6A 3P8BB 2GO9A 2HQDA 2RH3A 3SEOA 2OLWA 1FK9B 2DNLA 3ADAC 4DFKA 4ZPVR 3BR8A 2FZGB 1KWMA 3A8JA 3Q8VA 4JBCA 4C8OA 4DV3J 1CLFA 1RHQB 3N28A 1F5CA 1BWEA 2BJ1A 3RB0A 5F8NA 4CLZA 2OPQA 2MQPA 1VFJA 3CO0P 3A12A 5IZHA 1VJWA 2UVVA 1RBAA 5HMXA 4ZVRB 4MK8A 7FD1A 1PO6A 1JKHA 3EVMA 5I3QA 1Y5LB 4C3MA 2QA4S 1A0OB 2GVZA 3R3TA 4F0KA 3R2CJ 3P4UB 1RT2A 2J7KA 3TQ1A 3EZUA 4PZVA 3TA0A 2AJQA 1Q1KA 3BREA 1NK9A 2PI5A 3R7SB 4DSLA 4QYZJ 3D0GE 3VAIA 4DV1J 1Q95G 4HT5A 2HHPA 1UJ6A 2WHOA 3JAMU 2ZH3A 5KFVA 3DOMA 2HFOA 2CJKA 2WONB 3CJSA 3W2WA 5KG0A 2DKOB 4OX9J 4DMZA 1ZA1B 2W7AA 2WB1D 4UQTA 1EQMA 3L3CA 3L7PA 3D3BJ 4KGXB 5KT7A 2FQQB 2GHPA 2DH9A 2CPDA 1MWZA 2RSQA 4C0BA 4NPOA 4OLOA 2CKWA 3MAQA 4ZP6A 5B0CA 5H1SV 1RT6B 2HG4A 4FKXA 5E41A 2EFNA 4A8FA 4ZVUB 3MR2A 3IR7B 4MYUA 1JJ2R 4F2SA 1FA0A 5J2NA 1LWFB 4F04B 2AP6A 4ZKAA 3H5XA 2VQFF 3DLEA 4Q2MA 3U02A 2RIJA 1IR2A 4GVBA 3QJLA 5KT3A 1H73A 3GE9A 2C3YA 2UUBJ 3HCXA 3Q8QB 3CPWR 2DO4A 4X2BA 4J9OA 2FZKB 3FBEA 4WP8A 4KKOA 4FF1A 1CULA 5DDQC 4LF1A 4OI6A 4JI3F 3MAAA 4KV8B 3NGSA 2HPUA 2QL9B 1BUXA 2UVUA 1FDAA 4YR3A 1FHTA 1VRTA 3PZPA 4QR0A 1WF2A 1AA1B 1RQ0A 3TVYA 4NYPA 5F3ZA 1GMWD 1PBAA 5KFKA 1C4CA 2ZH2A 2HVHA 4K2JA 2ZVSA 3HDSA 2XG8A 2FVCA 1JMTA 4DV2F 2HNZA 1KSPA 3CC4S 3GYXB 3RW6A 3LANA 3EUNA 2W2MP 4R0JA 1B0VA 4NA2A 2E5IA 4Y2IA 3NWRA 4GKJF 5JVGQ 4DR6F 2X51A 1W2IA 1QE1A 4DLGA 2X1AA 2AYGA 1WG5A 4QWEA 3CCLS 7FDRA 2YKQA 1H3DA 2KL8A 2VC1A 4CCHA 4F25A 4O3NA 2ASDA 4ED8A 4NLPA 1UW4A 5E0OA 3ZC4A 2E29A 4MK7A 4PPZA 2ZOMA 1IXKA 4CNYA 3NCQA 1TTHB 4ED5A 1MG7A 4DFPA 2ASJA 3X1LB 1K44A 2YNHA 2VIHA 4B3TF 3M6XA 1SIWB 1S1TA 5HROA 1MROA 2CQHA 3GJQB 1HNWJ 1DJ0A 2BQ3A 2FJXA 4XO0A 5CCMA 2VD3A 4LMZA 2CZ4A 3RB6A 2XTJP 5DG8A 2CNNB 1IR0A 2CA9A 3D3CJ 4DQPA 1R6VA 5AXMA 1HKAA 2LXFA 4WXOA 3EJMA 2A2DA 3HO1A 1VIOA 5CXTA 1X9SA 3MPWA 5D4LA 1OY9A 2EFGA 1CPZA 5KFQA 3WBZA 1N8RT 1KHWA 2AF6A 3ETMA 3UR3C 2CWKA 1J5EJ 1RHJB 6FD1A 1N34J 4ELVA 2CQ0A 2K3KA 1HNZF 1D9DA 2QA2A 2OPQB 3R5JB 4OZNA 3BO2A 4J9NA 1UKUA 4ECYA 2A10A 4JV5F 1FFWB 4DUZJ 1M5KC 2VPYB 3UW1A 2HMIA 2JEIA 1SJ3P 1JKHB 1DBDA 5HMYA 1FF2A 5L1IA 3K0JA 4FPIA 2GVZB 3UDVA 5DS7A 1HI8A 2IYIA 3AD7C 4NA3A 4NA1A 1RT2B 1Y5IB 1N4LA 4NMXA 2NZ4A 1X5PA 4Q45A 4IOCQ 5J1PA 3S8SA 2CG8A 2QTWA 1VQ4S 2RT3A 3PYDA 3UPFA 4P71A 3IN5A 4JI7F 1J2VA 2ZKTA 2XYHB 2ZJPQ 1HNXJ 2HBQB 2XMMA 2OPPA 4IQMA 3PNIA 3DOMB 2XO6A 4N8NA 3F41A 1BWVA 1KS2A 2DRBA 1T9WA 1FRKA 4NLGA 3IM8A 1RGVA 1LW0A 4CLSA 4DV4J 4ED6A 1ZZFA 3R6LB 2K2PA 1R31A 2V4QA 1T05A 2NS1B 2FVQA 3NGUA 5F8HA 3GR0A 2GX8A 1Z1ZA 3PG9A 4KBIA 3PO5A 2ZVIA 4TQSA 1BQMA 5K20B 5J2NB 1JLCA 5AXNA 1N33F 3QBCA 2HHSA 1YBTA 4URQU 3DLEB 3D0IE 1JLEA 1K8AT 4KIAA 1NXIA 3WC0A 2I5JB 4GVBB 3HFZB 2RRBA 3CW2C 3I5BA 2LEPA 2RQMA 1RBOB 1UMJA 1T03B 4ZLLA 3L9ZA 5A8KA 3ZNJ1 3R9LA 4KKOB 3MCSA 2OFGX 3ZZRA 3KFWX 3MAAB 2QIFA 2FB0A 2XMUA 4LFAJ 1TKZA 1EX8A 2E7WA 1IJFB 1VRTB 4FXWA 1WACA 2OD6A 4WFBQ 2NZCA 2CNOB 3CUNA 4CLTA 3R5DA 2GJIA 4AL7A 1RT4A 2DB1A 4ZPAA 2CJQA 1WOPA 3NWGA 2YX1A 3MDFA 4JI2F 1H6KX 2UXBF 2CG4A 1OYEA 3VZHA 2HNZB 2YX4A 2UUWA 5DQHA 4I7FA 4TU7A 1FKAF 2J0SD 3RBZA 2HHWA 3FK4A 2NYIA 2PFFB 5CQGA 2HYIB 2HWIA 4NX9A 2Z2ZA 4DX6A 4AT1B 3TYTA 4WFNQ 4YB1P 4A48A 1QE1B 4KFBA 3NGKA 1WEZA 3CJ3A 5J2PB 4RPFA 4B9LA 4WZMA 1KFDA 1YRTA 2L3MA 4EBEA 4PQAA 2ALZA 1VMBA 5EUHA 2BANA 4ZPWR 3KG0A 5IWAJ 1V5VA 1B7FA 1NK6A 2JDJA 5GAHU 4DV7F 5GAGI 3OFHA 3D1HA 2QFJA 3D6HB 3T5LA 1WD6A 1U1RA 4PG6A 4CLKA 4ZLJA 3RB3A 2HURA 3VHQA 4RNHA 3LP2B 2YNHB 4ID8A 2FZCB 2Z0GA 1S1TB 2YH1A 1MROB 3E2EA 1C4AA 1OSDA 4P7VA 4QIGA 3HD2A 1FERA 2AGOA 2WB4A 4TKTA 2BOPA 2ATLA 2MLXA 3IRWP 1WEYA 5FIIA 4G65A 3K5LA 3UI3A 2ZWPA 2IA0A 2ZEJA 2MKIA 1Q79A 2CVIA 2NXJA 3MEKA 4CT8A 3C6TA 4XK8C 3CTRA 2KRBA 1JLBA 3THPA 4Y2MA 3GR1A 4Q7AA 1DTQB 2CPHA 1NDPA 2RNEA 2YKOA 3TEHB 4WE1A 2BKNA 2HNDA 5D4NA 3CEDA 5BJRA 1DAXA 4DI6A 2MQQA 2ZNYA 5THWA 4UUWA 5KFZA 4DCJB 2W9BA 3TNVA 3H5SA 2HMIB 2GIFA 3ZZUA 4PXDA 3QIDA 5HQMA 2HSEB 2XZTB 4DX8H 3F73A 2KVQE 1SBRA 4L6V3 3IS9A 1D9AA 3R6GB 2HK2A 1DARA 1S12A 2PEBA 1AUSL 2DITA 2AZ1A 4QWBA 1VRQC 1NBEB 4L73A 3GMGA 2Z56B 4X4VA 1GH8A 2RHSB 2YPYA 2AYMA 2F4VJ 4Y2CA 4M5DA 1M5OC 3BN4A 4K0KJ 2QL7B 3UFCX 3CCES 4U8YA 4FF4A 2N7CA 2MKKA 4J90A 5ITHA 2FUG9 5HMWA 3VQSA 2Y0SD 3M6UA 1VBZA 1FWPA 1T0TV 3CMES 3OLBA 5SUHA 3OT9A 1M5VC 1RT7B 4ECUA 3MFHA 3TR5A 1T05B 2CPFA 2V2VA 1N32J 4J5OA 4M95A 2DYAA 2C28A 2B9YA 1BQMB 1JLCB 2UV8A 5KFCA 4JOUA 4GRSA 4WFYA 5KOWA 1JLEB 1QDUB 4G3IA 2RJZA 2LVWA
chains in the Genus database with same CATH topology
3D1QA 2VA2A 3PKYA 2JFKA 2NUUG 4B3SF 1MWYA 2E5GA 4CH7A 2K7JA 3BSNA 5L1JA 2GIQA 3AHPA 3UCUP 5B0FA 1LQ9A 1NU4A 3DDNA 2OSRA 2OP5A 1S1WA 2KTQA 1P1LA 3PX6A 3T1HF 1MSWD 2DNHA 2GGPB 5A8KB 4TU8A 2JLGA 5GVQA 5LMNF 2MQNA 4OMFG 1A7GE 2YKPA 4IG3A 5EX0A 1MMNA 2PN6A 3EXCX 4WYLA 1F60B 4LF9F 3DI6A 1RYRA 4ICLB 4X4TA 2IAJB 2AGPA 3O5TB 2KXNB 1TKXB 1TKZB 4H4MA 3OFEA 2YWFA 3QZ8A 3KJVB 3TARA 2N7YA 3LH2S 5KFRA 1SJFA 1FDNA 1L3UA 3H59A 2AJ0A 4C8LA 4I1TA 3NL0A 4MKYA 1R8PA 5G0RB 2UUTA 1YJVA 4A8MP 4KT0C 2IJNA 4FNIA 2RD5C 2UU9F 3C6UB 3PEJA 1R8HA 2R8KA 1ELOA 5HLFA 2RKIB 5LMUF 2HNYA 2LU2A 3BF4A 3SQGA 5DDRC 3LP0A 3QWUA 3ULHA 2GC8A 3PO4A 2QT7A 3X3UA 3KK1B 2Y1RI 4K4XA 1DTQA 3BGLA 1RT4B 3HKZD 3DGPA 1DHMA 1X7VA 4ZA1A 3UCGA 4K4WA 4I69A 1TUVA 1N5YB 2UP1A 3B8HA 2VG7A 1CC8A 3IC1A 2ZJQQ 4FP9A 3VAJA 4K59A 2DGWA 5KG6A 4DSJA 2JJ4D 2IBOA 1LFWA 3WC2A 3LW5C 1L3VA 4DL7A 3M8QB 5CZVA 2VFRA 1RT3B 5DETA 1S77D 2UXCF 1SJQA 4A8WA 3EGNA 1NRKA 3LF0A 3DHXA 4B9SA 2LXUA 4ILLA 4N47A 3PRBA 3CDUA 3DRRB 1HWKA 3B78A 3ZZYA 1IKXA 1HPZB 1KQGB 5KG4A 2YKAA 4I7FB 2N3OA 2XMWA 5F41A 3PR5B 3CCSS 3KLGA 3M9MB 3IRXB 5GADI 4UY8T 4DS4A 3U1NA 4YR0A 1F5AA 2KU7A 2NLWA 2Q3PA 3DOKB 4K5SA 3PR4A 2JHEA 3RZAA 1VS3A 4NZ7A 1FCAA 3UE2A 4QWCA 2ZJRQ 4J9RA 5JJBA 2MGZB 1T3NA 1AXQA 1R8BA 2F8EX 2AQ4A 3OVBA 5A8RB 4KO0B 1NB7A 3GILA 2CRLA 4MJKA 1SUQA 2XMVA 2L9NA 2JL9A 3SSSA 2APOA 4ZMMA 5HMZA 2QA4G 4NLWA 2L9DA 1LV5A 1N5TA 4KFBB 2IM2A 4JI0F 3NS5A 4JI8F 4K4YA 3M1VA 1UA0A 3VAFA 4O4GA 4ECVA 3JTOA 1UA1A 3P96A 1HQEA 1HBNB 1X0FA 3M8PB 2ZITA 4CI0B 3CCUS 3NS6A 2BANB 2YNFB 3Q8RB 3VAHA 3PVXA 4IH5A 1CVJA 5A8WA 4OI3A 1W2BR 1C0TA 1VQOS 2R8GA 3OW2R 5K14B 5KFUA 2HLUA 3MZIA 5EN1A 1U4BA 1WHWA 3IG1A 3Q24A 2YKNA 4LF5F 4KR0B 4BC7A 1JWWA 4QIWD 1RA6A 3K7RA 3QGGA 1ZAVA 1XEZA 3DRYA 3K2YA 4X84A 2V4RA 1L3TA 3CVKA 1Y9OA 2F7VA 2KH9A 1NJYA 1C0UA 3DC2A 4O3QA 4PXCA 1WHXA 2VFSA