2HNDB

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
422
structure length
394
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 113
structure length 394
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndB03
3I5AA 3ITHB 1JLAB 4QW8A 2IAJA 4ECRA 2IBKA 3M8PB 4WE1B 1JLGA 3KJVA 4QWBA 5KFCA 4NLXA 4DL2A 4K4VA 5EWGA 3E01A 3KHRA 1VRTA 3FQKA 5J2QA 2BRLA 3MEGA 4PUOA 4ED3A 3EPIA 2OPRB 3OHAA 3DRRB 5F8LA 1JIHA 3ITHA 4J9LA 3KHHA 4ECWA 3M8PA 4WE1A 4QWDA 4F4XA 2C2EA 5T14A 4JUZA 2R8JA 4O3QA 2R8KA 3PW7A 2VA2A 3DRPA 3PHEA 5C24B 4RNFA 4QWAA 5DG9A 2XCPA 1XR6A 3DRRA 2R2RA 3RB4A 2JEFA 1XR5A 2IJNA 3H4BA 5HLFB 3LP2B 5KFBA 1S9EB 1DTQB 4ED2A 5J2PA 1T05B 5EWEA 3KLGB 4J9SA 3HVTB 1RYRA 4MFBB 2XGPA 4QPXA 5HLFA 3LP2A 5DGAA 4RW4B 1RT5B 3T5HA 1S9EA 1HYSB 3QGHA 2GC8A 1KLMA 2XC9A 4MIAA 3I5CA 4ZHRB 4YR2A 4EYHB 1T05A 3GILA 3KLGA 3BSOA 2ASLA 4FBUA 3HVTA 4KE5A 4HYKA 1RT7B 4MFBA 4DG1A 2ILYA 5KFUA 5L1LA 4LSLB 1SV5B 4ZVFA 3BSNA 4RW4A 1RT5A 2VG6A 1HYSA 4IR1A 2UVWA 1MU2B 2YKNB 3CDEA 2AQ4A 1S1VB 4ZHRA 3IGVA 4MK7A 3ISNC 2IM2A 4NLSA 4TY9A 4F4WA 1MMLA 4EBCA 3TVKA 5KT4A 1RT7A 4FS2A 2HNZA 4LSLA 4IDKB 3NKYA 4NLDA 3UPFA 3FQLA 1MU2A 4KSEB 2IMWP 4IH7A 1S1VA 3PJXA 5F8JA 1ZTTA 2YNHB 3BJYA 1S1UB 3KHLA 3PR5B 2OPPB 4ZPCA 2YNFA 4WFZA 2W9BA 3BREA 4PWDB 3QIPB 3G6XA 4ZVHA 4NLGA 4NZ0A 5KFHA 1UWBB 3LP0B 3H5UA 4U6PA 4RNHA 1IKVB 3D5MA 4ECUA 3T5KA 4GC6A 4DL3A 4KV8B 1K1QA 3V6KA 2YNHA 4K4SA 1S1UA 3CDWA 2OPPA 1IKYB 5DQGA 1S0NA 4DL5A 2AX0A 3NL0A 3MR5A 3IRXB 1TQLA 1GX5A 2UUWA 3V4IB 1RTHA 3BGRB 4NLOA 1UWBA 3KNAA 1N6QA 1HQUB 2BQ3A 3HKWA 4WXWA 4JV0A 3TQ1A 1TKXA 1HMVA 1IKYA 5KFVA 1N48A 4ED1A 4WZMA 3TAMA 1HQEB 3IRXA 2IC3B 3V4IA 4RZRA 5HBMA 2UVVA 3BGRA 2RDJA 4Y2AA 2D3UA 1HQUA 3MEDB 4IFVB 2J6UA 2O5DA 3CIZA 1LW2B 1HNVB 5CYMB 1S9FA 5DQHA 4EBEA 3MTKA 4ECVA 3RBDA 1HQEA 4O3OA 2IC3A 4WYLA 1JLQB 5KFOA 1C0UB 5HROB 2QE5A 5J2NA 4M94A 4J9OA 1GX6A 1DLOB 2YNGB 3MEDA 3GYNA 4IFVA 5J1EA 4NRUA 4EEYA 1J5OB 5CYMA 4NLTA 2IM1A 3CJ0A 2WOMA 2JC0A 2FVSA 4FS1A 1JLQA 3MR3A 1JLCB 1S1WB 5HROA 5L1KA 5EDWA 1DLOA 2YNGA 4KFBB 1TP7A 4ZP7A 5KFWA 4IG3B 2FVPA 1VRUA 2W9AA 4X2BA 1JLEB 2FLLA 3DLKB 2HAIA 1JLCA 1S1WA 3DYAA 3SFGA 3T19A 4IOBA 4TYBA 3SFUA 1TVRB 5C5JA 5F8GA 4ZP8A 4NRTA 1JLEA 4NLPA 4EBDA 2BQUA 2JEIA 3MF5A 4WFYA 1REVB 4ID5A 4OL8A 4RUAA 3IN5A 1TVRA 2ZD1B 1FKPB 1FKOA 3I0SB 3IGNA 3OLBA 2YNIB 1T94A 4I7FB 3PJWA 5KG3A 4M95A 2R2SA 2UUTA 4Y2CA 3DM2B 1REVA 4Y34A 1LW0B 4TXSA 2IM0A 2B5JB 1C1CB 2ZD1A 4ECTA 2FJWA 1N56A 3KLIA 1FKPA 2IM3A 3NAIA 5L1IA 2V9WA 3ICLA 3KLVA 5FDLA 1KHWA 4ZPAA 5DQIA 4ECXA 1JX4A 1BQMB 4MIBA 3DM2A 3NMAA 2W8LA 1LW0A 1SUQA 4K4WA 2XI3A 1JLAA 5KFIA 1C1BB 4ED7A 3CJ4A 4EO6A 4PQUB 1NNDA 4RNNA 4J9QA 1BQMA 2HWIA 2C2DA 3DOLB 2QV6A 2OPRA 3KHGA 1CSJA 3PR4A 5KFSA 1C1BA 1HARA 2JC1A 4LQ9A 5JUMA 1SH2A 4PQUA 5L1JA 2R2TA 2ZKUA 4IRDA 3MFHA 4G3IA 5C24A 3DOLA 2UVRA 5KG1A 4TYAA 3G6YA 2R8HA 2DPJA 3LALA 4TQSA 4RNOA 1TKTB 1DTQA 3BQ2A 4DL4A 2AGPA 2D41A 2DPIA 3DOKB 1QE1B 1RAJA 1S97A 3IS9B 2JEGA 3PW0A 2E9ZA 3FSIA 3MR6A 2WTFA 2IA6A 1RT4B 4XPCA 2WRMA 3CJ3A 5KG6A 3H98A 4WZQA 2AGQA 5KG0A 2J6TA 2C22A 4H4OB 2AGOA 5I3UB 4YR0A 4J9NA 3DOKA 1QE1A 4MK9A 5JXSA 3PZPA 4KHRA 3IS9A 3QIDA 4KBIA 4NCGB 4O44B 2F8EX 1RT4A 4IFYB 3EZUA 1SV5A 1RT1B 1S1XB 4H4OA 4JV2A 4RW7B 3QO9B 3KK2B 3Q8QB 3DRSB 4H4MB 1LWCB 2YKNA 4B3OB 3T5LA 4MH8A 2HNYB 2WK4A 4XPEA 4NCGA 4O44A 1RA6A 4IFYA 3D28A 1S1TB 4IDKA 3OL9A 1RT1A 3KMQA 4ED6A 3DLEB 3QO9A 3KK2A 2I1RA 1HPZB 3DRSA 4H4MA 1LWCA 4B3OA 5DG8A 1TL1B 1RA7A 4NLWA 2HNYA 3PW2A 2ZE2B 4YR3A 3KK1B 1S1TA 2RDIA 4PWDA 3QIPA 3KK3B 3DLEA 2FLNA 3LP0A 1IKVA 1EETB 5KFTA 4RUCA 2E9RX 4EYIB 3PW5A 4KV8A 3H40A 2ZE2A 1S9GB 2I5JB 1N4LA 3CJ5A 5HP1B 2RKIB 4KB7A 3BR9A 4QWEA 4RW8B 4H54A 3Q8SB 2RF2B 3KK3A 3DLGB 2BQRA 4K4TA 2XGQA 1JLFB 2ASDA 2D7SA 3GV7B 3JYTB 2ALZA 1QAIA 2B43A 4RU9A 2OPSB 1FK9B 1S9GA 4RW9B 4R5PB 4ZVGA 5HP1A 2RKIA 4J9PA 5D3GB 4YQWA 5KT5A 3QZ8A 2BR0A 2RF2A 3H59A 3DLGA 1JLFA 2B6AB 4ICLB 3G86A 1IM4A 4K50A 3UDLA 3JYTA 1JXLA 4ZMMA 3CO9A 1LW2A 2OPSA 1HNVA 1FK9A 4R5PA 4RW9A 2YKMB 1W25A 3ISND 3T5JA 1S6PB 5D3GA 1ZETA 1C0TB 1C0UA 3KLFB 4ICLA 5J2MB 2V0NA 3BSCA 4O4GB 3NBPB 4R8UB 1J5OA 3RAXA 2YKMA 1S6PA 2XCAA 5F8IA 3CDUA 3KLFA 3OL8A 4KFBA 4KKOB 4O4GA 5KFZA 3NBPA 3BSAA 4IG3A 4R8UA 3H5YA 2AU0A 4IH5A 4DEZA 2FVRA 4NLQA 1IKXB 3LAKA 3DLKA 5EUHA 5DLGA 1LWFB 1RTJB 4Q44A 4HKQA 4YMEA 1T3NA 4RW6B 3CJ2A 2XI2A 3C6TB 3EPGA 4ZP6A 1I6JA 4IRCA 3V81B 1IKXA 3FRZA 5KFYA 3I0RB 1D1UA 1RTJA 2E9TA 3GV5B 3PW4A 2EC0A 5KFRA 4WXOA 5KG5A 1NHVA 4ED8A 4RW6A 4ECQA 3I0SA 2BRKA 2OPQB 1TKZB 2YNIA 3V6DB 4I7FA 1SH3A 3V81A 4KAIA 1TV6B 3QGGA 4Q0BB 3I0RA 4LQ3A 4Q8EA 2OH2A 2B5JA 3IG1B 1C1CA 1RT3B 2BANB 3GQCA 5F9NA 4O3NA 2OPQA 1TKZA 2IAJB 3V6DA 5F8HA 4ECSA 5KFNA 3KJVB 5KT7A 1BQNB 1TV6A 2J6SA 4Q0BA 3N6NA 3NGDA 3V6HA 2JEJA 4TLRA 1VRTB 1WNEA 1ZTWA 3IG1A 3FFIB 3MEGB 1R0AB 2FVQA 4ZVEA 3OL7A 2BANA 2WCXA 3C6UB 5KG7A 1BQNA 1KHVA 1S49A 4GC7A 2BE2B 4TQRA 3OL6A 3DRPB 3SI8A 3FFIA 1R0AA 3BQ1A 4NLUA 2HNDB 1S48A 1NHUA 1RTIB 3C6UA 2UVUA 2V4QA 5KT3A 5C25B 4K4XA 3PVXA 2FVCA 2BE2A 4WFXA 5KFQA 5KT6A 5K14B 1D0EA 3M9MB 3M9OB 4ECZA 4TY8B 4K4ZA 1QAJA 1RDRA 5J2PB 5KFDA 4URQU 1RYSA 5KFJA 2HNDA 1RTIA 3HHKA 4DL7A 1TKTA 2R8GA 5C25A 4TN2A 2W8KA 3DMJB 3LP1B 3QZ7A 1KLMB 3GIKA 4K4UA 5K14A 2C28A 3H2LA 4TY8A 4NLRA 4NLYA 5F8MA 5F8NA 1S0MA 5KFEA 4WYWA 1S6QB 3MECB 4DG1B 4KHMA 1EP4B 5I3UA 1RT6B 4ZPBA 3RB6A 2VG6B 1XR7A 1JLBB 3DMJA 4O3SA 3LP1A 3V6JA 2VA3A 3H5SA 5KFKA 4URSA 4IG0B 1S10A 3FDSA 1S0OA 2W9CB 4KO0B 3E51A 1S6QA 3MECA 1S1XA 2HNZB 3DI6B 1OS5A 4RW7A 3QGIA 1EP4A 4O3PA 1RT6A 4URGA 2C2RA 3MFIA 4G1QB 1JLBA 3M8QB 3OSNA 3OSPA 1TL3B 4IG0A 5KG2A 4QW9A 2FJVA 3GIMA 2W9CA 4KO0A 2JLEA 3H5XA 2W9BB 2YNFB 2VG7B 3DI6A 1K1SA 1HPZA 1DTTB 3CVKA 4G1QA 1SH0A 1TL1A 1YVFA 4I2PB 1C2PA 3M8QA 5KFAA 4IRKA 3N6MA 1TL3A 3KLEB 3M9NB 3KK1A 4EO8A 1T03B 4J9KA 4Q43A 4ECYA 4MKAA 3MEEB 2VG7A 3H4DA 2R2UA 3GIIA 1DTTA 3LAMA 5KFPA 1EETA 4I2PA 4LSNB 1RTHB 4F50A 1N6QB 4Y3CA 3KLEA 2I5JA 3RAQA 4QWCA 1T03A 3CWJA 1TKXB 3MEEA 4RW8A 1HMVB 2HWHA 2HMIB 3TAMB 2GIQA 4O3RA 3JSMB 2AWZA 4LSNA 5HBMB 1QUVA 2W7OA 1U09A 2ILZA 2ATLA 5C42B 3RB0A 4R0EA 3Q8RB 2HMIA 4IH6A 4Q45A 2B6AA 1Z4UA 3JSMA 4F4ZA 4RNMA 3OHBA 5J2NB 3DDKA 1IKWB 5C42A 5J1EB 4FBTA 1C0TA 2WOMB 4JV1A 3I5BA 3VQSA 2D3ZA 4DL6A 1LWEB 5J2MA 4XO0A 3GIJA 1JKHB 1RT2B 3KLHB 4U7CA 1IKWA 4IR9A 4F4YA 4NYZA 4Q8FA 3RBEA 1VRUB 3NAHA 5I42B 3QYYA 1HNIB 1LWEA 3OLAA 3QLHB 4KKOA 3UQSA 2VG5B 5KFLA 4IQXA 3DYAB 2WHOA 1JKHA 4I2QB 4ED0A 1RT2A 3KLHA 5EWFA 2FJXA 3RB3A 5DGBA 4ZP9A 1S4FA 5DG7A 5I42A 1HNIA 1LWFA 2XWYA 3N6LA 5F9LA 2AX1A 2WB4A 5KG4A 3QLHA 5KFGA 5KFMA 4K4YA 2VG5A 4MK8A 4O4RA 2V4RA 4ID5B 4I2QA 3G6VA 3KOAA 3C6TA 1N5YB 2CKWA 2FLPA 2GIRA 4J9MA 3Q8PB 2WONB 1FKOB 5CYQB 5KFXA 1RTDB 3KMSA 5KT2A 2W7PA 3HVAA 3BQ0A 2IJFA 3T1AA 4MKBA 5DLFA 1N5YA 5L9XA 3GV8B 4YP3A 1JLGB 3KLIB 3UR0A 2WONA 5CYQA 1RTDA 3E01B 2CJQA 4IKAA 5FDLB 3MR2A 2R8IA 4J9RA 2ASJA 5J2QB 4ZPDA 3HVWA 4NLVA 4PUOB 5KFFA 3LANA 1RT3A 1SUQB
chains in the Genus database with same CATH superfamily
1V3SA 2IAJA 3M8PB 3E01A 1F3FA 3EVWA 2QYCA 3DXSX 2GGPA 1RLCL 4KY3A 2N7YA 2OD6A 2MKYA 2M9KA 1TUGB 2JEFA 1SC3B 4F36A 2YQ1A 1X4GA 5ETVA 2M88A 4X62J 1TAQA 4RUHA 1B99A 2GC8A 4LSZB 1AROP 2XYPB 4YR2A 2RHQB 1RISA 2MY8A 1FJ7A 4QU7A 3NCPA 1UA0A 3S1TA 1S1VB 5A8KB 4JI5F 1FKAF 4X4VA 2MPUA 2U1AA 3A8KA 2K3KA 2F7VA 3QBCA 2KYZA 2FDNA 2VZ9A 3KJFB 2V94A 3KKFA 3C14A 5JVGQ 3TARA 5BR8J 1WHVA 1X31C 1X4BA 4GVBB 3D3BJ 2XY5A 2Z2YB 1MMNA 4DV0F 4RZRA 4TU9A 3BGRA 1Y3KA 2DNGA 1LW2B 3Q86A 1GTEA 4WYLA 1VQ4S 4NZ6A 3PY8A 4DFMA 2QLJB 4EEYA 1AA1B 2O66A 2R7VA 1DLOA 4ZP7A 3T6BA 4PWUA 3C15A 3SFUA 3OPKA 4CLLA 1REVB 2M7SA 3R7SB 2DNNA 1UJ4A 1FKPB 2HBZB 3RRHA 2B5JB 3BBCA 1U1QA 4UW2A 3Q89A 2V9WA 5JJBA 2CDQA 2FJEB 4ECXA 5KFIA 2VKRA 3PACA 3BH6B 4J9QA 1NSAA 4CNYA 4OI6A 5D4PA 1VJWA 4X4SA 4G3IA 5C24A 1BE4A 1CG2A 5KG1A 1BWEA 3PW0A 1RT4B 1U02A 4PPDA 3FRYA 3BBFA 2R7TA 3ZZ0A 3SQGA 4J7CA 5D77A 2Q43A 1LWCB 1QAXA 4O0NA 2QL5B 1Q1KA 5DG8A 1FT8A 5AXLA 3GR0A 2HS0A 3DLEA 4NEYA 3H40A 3P45B 4OYPA 3GV7B 4DQQA 2R7QA 6FDRA 4RW9B 3TVZA 5EGYA 3OUYA 1IM4A 4HDGA 3OFHA 2OPSA 3T5JA 4YB7A 3MPUB 2E5GA 1TAUA 2XCAA 2CQPA 3CDUA 4C11B 3W9HA 2CVEA 4ED5A 2FVRA 1S59A 3EICA 4NPOA 2EC0A 2VBXA 5J1NA 1TKZB 2HBQB 4Q0BB 4N8OA 2KDOA 5EN1A 2GJFA 2XMMA 3LF0A 3LTOA 1DARA 1ZTWA 2HAFA 3GJRB 2OUGA 4LRCA 3CD7A 1S7HA 1KHVA 1NLKL 2F4FA 2KI2A 2GCFA 1QM9A 1KD1T 2GQCA 1VK8A 2ZUGA 5GMDA 1TMMA 2CQIA 4Z37A 4ES1A 2MQQA 4K4UA 1LEOA 2EW9A 3UN2A 4FVMA 2CJBA 3CCWA 5M2UA 4GKJF 4KO0B 4O3PA 1T7PA 4FYDA 1VCTA 3HT3A 2N82B 3OSNA 3GJSB 2SXLA 3NLCA 3U1MA 1DTTB 4CLZA 5ETQA 1RSCA 4RR5A 5A8RA 4DR2F 1T03A 3UVJB 3C16A 3GWCA 1Q95G 2W7OA 1U09A 5DDOC 3G8SA 3H2VE 4C4WA 2EFOA 1EB0A 5E7OB 3PDNA 4DL0C 2QA4S 4OMFG 3TA2A 2AEMA 5KOWA 2ZM6J 3IWLA 3W62A 3GIJA 2XNRA 1NH8A 1K73T 3JQMA 4K2XA 2GAGC 2WW8A 1RCXB 2C2NA 4F7VA 1RI7A 4O4RA 3I82A 2X1AA 2AEFA 3W2WA 4TU8A 1X5TA 2HFVA 4NA3A 2CQ4A 5G0RA 2FGOA 5CCLA 4ED4A 2B56A 4A8XA 2B4UA 1KS2A 4NLVA 4N41A 4ANEA 2QLWA 2IBKA 5EWGA 4DCPB 4U8VA 1PAEX 1P9QC 1JJCB 1WEXA 3TEHB 3DRPA 2M4MA 2WZ1A 2E1RA 1QVGR 1RWMB 2ZZTA 2CNLB 4ED2A 4OI1A 2J0WA 3PO4A 5E3QA 3T5HA 4KR0B 4EYHB 1T9XA 4NXNJ 1BQXA 3GG0A 2WVCA 4WTOB 1HYSA 3CJKA 3HO1A 2B7BB 1FX2A 5KT4A 4LSLA 3QSYB 5F8JA 1ZTTA 4A4JA 4ETZA 5FJ4A 4ZPCA 2P6SA 3LP0B 3MPDA 3T5KA 1PC4A 2FYXA 4KV8B 3R9LA 2XS7A 3WIVA 4FF2A 1UWBA 1MROA 4CTAA 2KM8C 3HKWA 1HWUA 3T3FA 1N48A 4DR6J 4Z2XA 2RDJA 2F8MA 3CCQS 3T1YF 3CIZA 4USVA 4DUZF 4O3OA 1JLQB 3A4TA 3ZZOA 1NDPA 2MQNA 3MR3A 1U45A 2XWXA 2V8VA 4BWJA 3SQOP 1E6YA 1VDHA 1DAXA 4ZCKA 3GSIA 3D0IE 4RUAA 5KOXA 2HWTA 4DSJA 4JI4F 4BHQA 2J9DA 2Z2LA 3RW7A 2OP5A 4DR4J 3GPAA 3ICLA 4Y00A 2W8LA 1NCLA 1YBAA 2XI3A 3P3DA 4DPTA 1JLAA 5L46A 1U6ZA 3NOGA 4TKTA 3OT9A 4ANCA 4I69A 2PA8D 1NRKA 1C1BA 2ZDOA 1PGZA 5LSLA 2L9DA 4TYAA 2W2NP 2X3DA 4LF7J 4DR7F 3TWZA 4XIUA 5CYJA 4H4OB 1NPPA 1BY9A 2XO6A 3R7NB 2M8HA 3EZUA 3M8SA 1S1XB 1PBAA 3BGUA 3H8YA 3K7RA 2DNKA 3MDFA 1S1TB 4IDKA 3KG1A 3TUJC 3Q8YA 4YB5A 1TL1B 2BMBA 3OR2B 1H6KX 2ZH1A 3DFEA 2LA6A 5KFTA 4P9SA 1BC6A 1N4LA 1JLFB 1NAQA 2ALZA 1YSJA 2B43A 4OV6A 1XMOF 3CDAA 4YB1P 3MEKA 2RRAA 2ZHOA 3JYTA 2XLKA 3GZ7A 1FK9A 4R5PA 1S6PB 3RZAA 3U1LA 8AT1B 4UUXA 3UCGA 3BBBA 3DGVA 2M8DB 4RLEA 3LAKA 3SCJE 1LWFB 1LNQA 3Q22A 1S5ZA 5GAGI 4A8SA 2MHEA 2LMIA 5JMNA 3CCMS 5F8HA 1HR0J 2AYGA 2YQ3A 2GS8A 2FHOB 1SPBP 4UOFA 1UJ5A 1VS3A 1HBNA 2AYMA 2UVUA 5SUHA 4OZ3A 2EKYA 2IRUA 4QU6A 4TY8B 1QAJA 5KFDA 3O3LA 2DO0A 2HLUA 2X1GA 4ZPVR 4NLYA 2CJXB 4FYWB 3LW5C 3IR6B 4EGLA 4URSA 4X4PA 1GMVA 1HNZJ 4DFKA 1OS5A 2HNZB 4L3NA 2V68A 4IG0A 4QW9A 4DR3F 2G4BA 4DV5F 2OFGX 3HHEA 1C2PA 4HTJA 1TL3A 5IM0A 2MGZA 5ETNA 4AD6A 5LXYA 1EETA 4CYUA 3PFOA 3ZZZA 3AY0A 8ATCB 6AT1B 3LOUA 4N47A 1VC6A 2J76E 1FRJA 2PT0A 3NNAA 3OHBA 2VBZA 5C42A 1IM6A 1U48A 4I4BA 3CPWR 3R5CA 4OV1A 2CNOB 4I2QB 1S4FA 3MMBA 2B4VA 1FEEA 1NBEB 3NG8A 4QR2A 3TJ8A 3J80U 3BQ0A 3AXKA 5CYQA 4U96A 4DS4A 2FUG9 2KZZA 4ECRA 3K17A 2C3PA 4X84A 2EFGA 2DYAA 2G9OA 4HT5A 3EPIA 4CO4A 1XNQF 4PXCA 4FF1A 4Y65A 2YQ0A 2MSSA 2A10A 2IJNA 1SC6A 4GKKF 5J2PA 1NXIA 3KLGB 5B09A 2HK3A 2LEAA 1IUJA 2ACYA 4DSKA 2XC9A 4JI1F 3M32A 1U2RA 1WACA 4USWA 3KG4A 4RJVA 3PKYA 3PRBA 3JAMU 1VISA 3W8PA 2CPEA 4MT1A 1MMLA 3D1OA 1RT7A 1R6VA 2EK6A 2DGTA 1RAEB 3M2UA 5CZXA 3UO0A 3PR5B 4WFZA 2VOPA 3L7PA 1SKSA 4P10A 4M5DA 1HNWF 2M70A 2FC8A 1CULB 5KFVA 5HBMA 1X5SA 4FVCA 2ZJRQ 2C2OB 3MTKA 1ZAWA 2IC3A 4P2MA 4FS1A 3UDEA 1Y3JA 5HROA 4OYXA 2HBYB 1FFGB 1HBUA 3W65A 4ELTA 2B4OA 2MJUA 2QJ3A 3CCRS 2RVJA 2LDYA 2JNJA 3I55S 1VBZA 1M1KT 1VQMS 1KDNA 3D7SB 2LEPA 4C9DA 1G2EA 5ETLA 5CQGA 2Z0GA 2KYXA 1R27B 2C2DA 2JH3A 5JUMA 2XZWA 1SH2A 2GVDB 1X4EA 4CM0A 2AGPA 4X66F 1S97A 4ZA1A 4MIWA 2E9ZA 2LU2A 2ZH4A 2N3LA 2CQ1A 4FPIA 2HFUA 3X1LB 4V19J 2GHPA 2V2KA 3T5LA 1N5SA 4MTPA 1V5IB 4ZLJA 1M5OC 3QO9A 3D0HE 2ZHBA 3FEXB 4WP9A 1ZYQA 2M3DA 3D54A 1Z2LA 1WDDA 2QFJA 3PW5A 2ZE2A 3N0VA 1D3WA 4DCOB 3TA0A 1FRMA 3B82A 4ICLB 3TJ9A 3VZIA 2QSWA 4HH0A 1WUUA 1FO1A 3BN4A 1YRXA 1HHSA 4Z7YA 2H4YB 1AUDA 2ZFHA 1CPZA 5HVFA 4HKQA 4ZVRB 3CJ2A 2LQ9A 4CT8A 3C6TB 1HI8A 1LKZA 2EVZA 1D1UA 3T1HF 1RWNB 2ZC4A 3CW2C 4N8NA 1SKRA 1F2HA 2VPZB 4Q8EA 2OH2A 1U49A 3VGVA 3HZGA 2EFVA 2R7SA 3R3TA 5BYQA 1U7LA 2FZCB 2V2ZA 5LT5A 2AV5A 2BE2B 1WOPA 5IQ6A 4CH1A 3HVRA 3VGTA 2VJVA 2BJDA 5HQLA 5KT6A 4B9SA 1RYSA 2C2KB 4V1Ak 3LP1B 1KLMB 5C2GA 1UFLA 2VU5A 1XMQJ 4WYWA 4IUFA 2NXEA 5I3UA 2GO8A 1RT6B 2F4VF 2FJAB 1XR7A 3MURP 3DMJA 2LYVA 4O3SA 2DY1A 4L74A 1X9SA 1TU0B 4URGA 4RW7A 5CABA 2R7UA 2C3MA 3DLHA 2ZOGA 2RHSB 3H5XA 5RUBA 2YNFB 1IN0A 4X4RA 5LSRA 3N6MA 3PCOB 1YHQS 4QWCA 2LQBA 5LJ5Y 2ZH7A 2V8DA 1HMVB 2HWHA 2HVIA 4DV1F 3SDEB 2ATLA 3RB0A 3Q8RB 3ETOA 3M2RB 4DL6A 2QYGA 2GJ2A 2JFDA 1V3RA 3DOMB 1N34F 4IQXA 3OW2R 3KLHA 3QT6A 4B3TJ 2HIQA 2Z30B 5DDPC 4FKXA 1E6VA 1JJ4A 3L95X 2GHWA 1WJ9A 4O0IA 2YKPA 2GIRA 2DGSA 3G9CA 4WWSA 4MKBA 5DLFA 2V2VA 1X60A 3G2XA 1MW7A 1SCJB 4H4KC 1RT3A 4OX6A 3I5AA 2DHSA 4ZDNA 1SBRA 1GXLA 2ADBA 1N32F 3HHDA 4QWDA 2H54B 1Y7PA 3QFWA 3PHEA 4DN9A 2KG1A 1TELA 1NPKA 2KJVA 2J8AA 4QCLA 2Q6CA 1R0CB 4N56A 1VQ5S 3PG9A 1IQTA 4QPXA 2G13A 5HLFA 3LP2A 3UDVA 2MB0B 2X1FA 1IBLF 1UFWA 4G6VB 4CO0A 2JSXA 5KFUA 1YIJS 3L9ZA 5IV3A 2ATCB 3NKYA 2PI4A 3I56S 3N28A 5AXMA 1HNXJ 4NLGA 4YFUA 1WI6A 2XMTA 3H5UA 4U6PA 3NOCA 2LQ8A 4UZBA 4GC6A 1PBUA 2YNHA 1UW4A 3VAMA 3AOAA 3MR5A 5I3QA 1ZM3A 4KJIA 4MKVA 1YRTA 3TQ1A 2L9NA 1QVFR 4Y2AA 1HQUA 1HNVB 1S9FA 3ILOA 1FE0A 1N5VA 1X8DA 2DNPA 2G2OA 2X7IA 2F3JA 1OWXA 3DXBA 4ZITA 4G1IA 1TR0A 2YNGA 3VAFA 1SIWB 2FVPA 3AT1B 2DKOB 2ZBRA 3HLUA 3QJLA 4IQMA 2Y0SD 1SL0A 5HJYA 4PAAA 1NK5A 4OL8A 1TVRA 2IYIA 3M30A 1FKOA 1T11A 4FXDA 2GNKA 3PJWA 5D4NA 5KG3A 2J9EA 3EVOA 2HZAA 1CS4A 3U02A 1C1CB 2ZD1A 2DCLA 3QJPA 2IM3A 2OKQA 4U8YA 5DDQC 5BYSA 5IT9U 2W01A 2HIYA 1CQNA 3BDPA 2QV6A 1KNZA 3M8ZA 4QQBA 4DQPA 4IRDA 3G6YA 2XY6A 4TQSA 3BQ2A 1SQEA 2D41A 2KO1A 1NDLA 1ULRA 2C3OA 5KG0A 2CYYA 4USKA 1CQMA 1G4CA 3DOKA 3PZPA 4RL1A 2XLIA 2AHOB 3DDIA 4OI3A 1YBTA 1NSKL 2KB2A 3FBCA 1RKIA 3PEJA 1URNA 3KK3B 1NO8A 2A1BA 3VWSA 3GYXB 2RKIB 1ZA2B 4JI0F 1X5PA 2IRXA 2B6AB 1C4CA 1VQ8S 1JXLA 4ZMMA 1LW2A 3EE3A 3ISND 3BYPA 3ULHA 1WC4A 3BSCA 4ALZA 3NBPB 2BKNA 4OYOA 3H90A 4O4GA 3OTDA 1IKXB 3MCNA 2Y1IA 5A76A 2WSFC 3V81B 4DV3F 3ZZUA 2BE9B 1NHVA 1V5VA 4DJBA 3CJ8A 2MZTA 1TV6B 3I0RA 3A1YG 2B5JA 2I8EA 2BANB 1H2UX 4FYVB 2UUCF 4LF8J 2UU9J 2CVIA 3N6NA 2FJDB 5DM7Q 3KYLA 1YJWS 3CJQA 3CC2S 2WCXA 3C6UB 1D9FA 3OVAA 4I6WA 2XNQA 5LSOA 1DQ8A 4TVAB 1KQGB 2XBPA 2W8KA 3QZ7A 1NK8A 1N36F 1S6QB 3HFZB 4WJBA 2EFNA 1NH7A 1RKJA 2A3JA 3M6WA 4QWEA 1UAWA 3MECA 1OJ4A 2C2RA 4BCAA 2MLXA 4LF6J 2HHUA 1LFWA 1JXVA 2CADA 3CVKA 4G1QA 4Y2IA 3RAMA 2F5GA 3SSSA 1WHYA 4I2PA 5AT1B 1YQHA 2DNZA 3OXGA 3N4WA 2OJ3A 2N4DA 4LSNA 3VR1A 5A0YA 2PIIA 4ZIWA 3UN5A 2A2CA 5E3AA 3G82B 2GMJA 1VJQA 4L73A 4U67Q 1IKWA 4IR9A 4Q8FA 1VRUB 3NAHA 2XULA 1DQAA 1RWPB 2RD5C 1JNRB 1J5EF 4DV6J 4CLTA 5F9LA 5KG4A 3JXOA 4CQ1A 1N5YB 3PYEA 2FLPA 1RWKB 1KVJA 3JQKA 1O51A 3OQ2A 5D4OA 2HZCA 5K20B 1VQYA 4ZPDA 1DY3A 3FC9A 1GMWD 3CSKA 4RPFA 3HDSA 4NE9C 1JNZB 2BRLA 5LM7E 4EZ9A 3MM6B 5D78A 3NXZA 2R8KA 2E7VA 3FUYA 4CCHA 5LMNJ 1DTQB 1UWAA 4J9SA 4TU7A 1M5VC 2XGPA 1NB2A 1Q8BA 1DRZA 3AFGA 1T05A 3BSOA 4MFBA 5JVHQ 1U0HB 4USMA 3IBFB 3FCHA 1RXOB 3W7BA 4P2XA 3UNGC 2IIHA 2J0XA 1FDBA 3J7YU 3BJYA 1L5UA 3RG6A 2L41A 3WHIA 4ETXA 3QAUA 2BM0A 4DX8H 4ECUA 1IBKF 1K1QA 2CPXA 3NL0A 4KH0B 4DL5A 2CWXA 1VR6A 3LQVA 2UVVA 2CQHA 3MEDB 2KZMA 2YX4A 2LA4A 3TANA 1FD2A 4IFVA 2POKA 2IM1A 2VFTA 5EDWA 2KL8A 3MPWA 4X2BA 2D1CA 2DHXA 2HAIA 1D09B 2VPYB 3T19A 2XMJA 3T9ZA 2NPFA 2BQUA 4EBDA 1FXLA 3BEGB 3MM7A 4K7QA 3DM2B 1LW0B 1ZPWX 3QGPA 2ACMA 2DD8S 1QDUB 2ZH9A 1BQMB 2ZC3A 2VC0A 4CT9A 4IO1A 4PQUB 5CZVA 4RNNA 3DOLB 3R5BA 5AJ3J 3PR4A 3J80Y 3MZIA 4RNOA 3CCLS 2AJ0A 2XM3A 3CE8A 2WRMA 2OEKA 4KHRA 3D6TB 3DRSB 2ASYA 4O44A 3UCZP 2ZH8A 4MYUA 2FHMA 5AE3A 2V8PA 2CNKB 4I1TA 3GFZA 2IYGA 2FJBB 3LP0A 1EZZB 1OPZA 2CQGA 4KV8A 3JAMY 4M1KA 5HP1B 4DFJA 4JV5F 1CJTB 4LFBJ 2RH3A 4IOAQ 5KT5A 5L8RC 2A2DA 5IWAF 3MM9B 2YKMA 3OL8A 7FD1A 1U6BA 4QBUA 2HBRB 4ZP6A 4NYOA 1QLNA 3G8QA 2Z2MA 5KG5A 4ED8A 4F0MA 2E44A 3W64A 4LQ3A 2FQQB 4LF9F 3VGUA 4LREA 1MLAA 3R6LB 4NA1A 3N79A 1RZMA 4JI2F 4G1PA 4LMZA 1KLNA 4AYBD 4F8RA 4JI5J 3FJ2A 3FFIA 1WC1A 3BF4A 1SIZA 1U1NA 3M9MB 4ECZA 1RTIA 5G4DA 3KFWX 3N01A 2Y1LB 5K14A 1DHMA 4DV0J 2WB1D 4ZS6A 1SQGA 2Y1JA 2R9LA 2QT7A 2W9CB 1S1XA 3DI6B 1EP4A 4J9VA 1DJ0A 3BGOP 1ICEB 4M5IA 4LF4J 4C8MA 2VG7B 2HRTA 1TL1A 2EBEA 3KLEB 2W2MP 2MKCA 3LAMA 1RTHB 1Y0HA 2QA2A 3RUBL 3AA9A 4PZVA 1TKXB 3W61A 2VUGA 1KBRA 2IFXA 1BUXA 2PMZD 4IH6A 3T41A 4F4ZA 3I4HX 3D66A 5J1EB 1PG5B 2Q66A 1XMBA 2J7UA 1LWEB 3AXMA 1SC1B 4PG8A 1HNIB 5HVHA 4IYQA 1FRHA 4F0KA 1OO0B 1LWFA 1H0HB 3I9ZA 4ZVPB 5K8OA 3ONQA 1UTAA 4M5JA 3AHPA 1FRIA 2W7PA 3FEYB 4YP3A 2WONA 1RTDA 3HHLA 2R8IA 1WF2A 4JOUA 3R1HA 4PUOB 2AJ4A 2D69A 5C7PA 2OPRB 3DRRB 2Q6BA 2B0GA 3HFKA 2MLYA 4RNFA 2XCPA 2I0XA 1F60B 2Z56B 2VPXB 3FBEA 1JWWA 3D6MB 1S9EA 2GVZB 2CAJA 1I5OB 1RT5A 1WHWA 1AW0A 4KGZB 4NLSA 4EBCA 3HKZD 2HNZA 4OZNA 1MU2A 4M5MA 1S1UB 3BREA 3ZZTA 3PRDA 4DL3A 2AD9A 2ZH6A 5B0FA 3SCLE 4DLGA 1YZ7A 2AYEA 3JB9k 4UTGA 3WC0A 1KKHA 3DU5A 1TMJA 2AKWB 2V50A 3CF5Q 2J6UA 3D68A 1YITS 5CYMB 3QATA 4EBEA 4OHXA 1FVSA 1I51B 1Q5YA 1C0UB 1KONA 4J9OA 1J5OB 4K0KJ 3Q23A 4HR2A 4W92B 4KFBB 1JLEB 2ADCA 1S4EA 2CWKA 4TYBA 2B51A 2DT9A 2HHSA 2W7AA 3CC7S 4A47A 4AXJA 1RHUB 3OLBA 1T94A 2Q1LA 4ZPAA 4YN3B 3CCUS 3SV4A 1FE4A 4GKJJ 4ANDA 1NUEA 3CJ4A 3MOJB 3AOCA 1RHRB 4PG7A 2E1AA 2IVYA 4K5RA 2B3TB 1V6HA 3ENAA 1NJZA 4I64A 4DL4A 4P2FA 1QE1B 3D1HA 4TLQA 4Y2KA 4JYAF 1FDNA 4DR2J 2W2OP 4OX7A 1ZM4A 2COLA 3ET6B 1T9YA 4LRAA 3EWGA 1NJWA 2NUUG 4PXDA 3AD9C 2PMHA 4CO1A 2R4FA 1IJEB 1HI0P 3VF0B 3KK1B 3ZZYA 4HTIA 1D9AA 3IC1A 3O44A 2VBWA 2VFUA 2KHCA 1AZSB 1MMDA 4ZVGA 2DGXA 3POTB 2BZ2A 2LU1A 3G86A 3P4UB 3J81U 2BABA 3I96A 3TO8A 3KLFB 2CPJA 4C0BA 3H2UB 1OIAA 4P2SA 3W3SA 1KQKA 3V2UC 3UW1A 3BSAA 1F2GA 2AU0A 5ITHA 1EAYC 1FTRA 2V34A 3KDNA 1FJCA 1RTJB 2KG0A 3IO1A 1AYEA 4ER8A 2DGOA 4Z7CA 2HVZA 5D0GA 2IPOB 5HQMA 4WXOA 1OY6A 3IM9A 5CCMA 3KNGA 4WFNQ 3VVUA 2VJUA 2HS4A 5CD4A 3V6DA 3M6VA 2YH0A 3M05A 5KG7A 1NK7A 4GC7A 4TQRA 2QG9B 5H9EJ 1OYEA 3VAKA 2ALYB 4NLUA 2MQLA 2ZH5A 2GVDA 4WFXA 3M9OB 4YY3J 5IT9Y 1IR2A 2DR5A 5F8NA 3M1VB 2UXCF 5DJBA 3UI3A 5KFKA 3P8BB 3T1YJ 1S10A 3LWMA 1HD1A 1RWVB 4UOGA 1CC8A 4DUZJ 2H3EB 4ELUA 1P1LA 3GIMA 2HVHA 4N7TA 1SH0A 5KFAA 3M8QA 3L3CA 4HH1A 1U8SA 1CJUB 2MKKA 1M0SA 3GIIA 2JLFA 1HKAA 2DY9A 2EXUA 3NWGA 4CO5A 2HMIB 1LOUA 4P72A 3QMQA 1SB6A 4X4NA 2GX8A 5AXKA 1BD6A 1VBXA 3WZ0A 4JI4J 4HHJA 4HACB 3N5BA 3ZNUA 2D3ZA 2Y8WA 2X1BA 4XO0A 2PMWA 2K3IA 3JTOA 3CD5A 4MJKA 4DPUA 2DR7A 1RQ0A 3GIRA 2YX1A 5CHCB 1S0VA 5I42A 2Y8YA 2I2YA 2ZITA 3C8YA 1OQ6A 1FXRA 3C6TA 3TA1A 4DR7J 5EX3A 1KOHA 4JI7F 2D9OA 3E01B 3MR2A 1FJGF 4YUDA 1RK8A 5M2PA 4DL2A 5J2QA 1PILA 4AL7A 1X4FA 3N9UC 4C7QA 4DR1F 4I56A 1F5CA 4F4XA 2C2EA 1NK6A 2R8JA 2DNLA 2GJIA 2ZVIA 3W2VB 5DO2A 3H4BA 1KQFB 4WU3A 4EUVA 4E2FB 3QFHA 5EWEA 4Y28C 4LF5F 1WSRA 1KLMA 3A13A 3O1LA 4YB6A 2HFZA 4USIA 1XMOJ 1N0VC 2RDDA 3WX4A 2AQ4A 4LT6A 4GO7X 3D1QA 4FS2A 5CA5A 2XZTB 3ZTOA 2MZ1A 4PYAA 3C14B 3QRQA 4M63A 2YNFA 4PWDB 1HBMA 4RNHA 1IKVB 1Y10A 2CPIA 4KH1B 2OPPA 4EWTA 2H1YA 1TQLA 3BGRB 2G1HA 4OZJA 4OZ5A 2OI2A 2BQ3A 4JV0A 1HMVA 1IKYA 1UL3A 3IRXA 3V4IA 2OSRA 3GTYX 5EX0A 2KFYA 1PCAA 1SXLA 5DQHA 3G8TA 1GX6A 1DLOB 4ZJQA 3DHXA 1Q86T 1B7YB 2RQ4A 3K59A 2RIJA 4CO2A 3C15B 4C0HA 3J7A1 3NGTA 2VDIA 2VHGA 3K5MA 3DOMA 2MLZA 3TEGA 4AFFA 2RSQA 1U26A 1JK9B 1B0TA 5GAHI 3KJQB 2DIUA 2ZNYA 3OVSA 4WFYA 2DH8A 1WOOA 2ZZMA 2YNIB 3RR7A 2DR9A 8RUCA 4YDXA 1TL7B 1UVLA 3Q8UA 5L1IA 1KHWA 3DLLQ 4MIBA 4EO6A 4J5OA 2HWIA 4KHPF 1Y5IB 5KFSA 4DR3J 1K9MT 4FNHA 2V69A 1N54B 4DV5J 2NS1B 2MZQA 1RTZA 2L08A 1TL4A 3VAHA 1UVMA 1IBMF 3SQGB 1EKSA 1REGX 3IS9A 2DRDA 2CPDA 1YLXA 2QSFA 3F41A 3OL9A 1PO6A 3DLEB 3KK2A 4NLWA 3HSZA 3PW2A 2LFVA 4YHHF 2K2PA 3Q8SB 2XGQA 3OUYB 1VQSA 1FWPA 4RU9A 2OPSB 1HNZF 3SYZA 1XN9A 1OSDA 4DQSA 2GIFA 2KXFA 3CO9A 2EKNA 1HNVA 2G1DA 2V9KA 3ZC4A 2O67A 3GB0A 1WHXA 3H5YA 1XNQJ 3B78A 2J9DE 3W9IA 4Q44A 5U47A 3PTWA 4CLFA 3H7HB 2E9TA 5KFRA 4GKKJ 4RW6A 2RU9A 3MAAB 2LP4A 4DSLA 4JI1J 1C1CA 5F0WA 3MCOA 1WWHA 1H73A 5KFNA 2OFHX 4TLRA 3VAJA 3AOBA 3TR5A 3MEGB 2HG4A 5GAGU 1R0AA 1Y11A 3R5DA 4CLUA 3OFFA 4JB8B 1YJ7A 1HW9A 2YBVA 1HNWJ 3IBCB 3M8WA 2EPIA 1XIQA 1FDAA 2HEKA 3DN9A 2P8IA 3IAM9 3HHLC 1YG0A 5IT0A 3CJRA 4CLSA 3GP9A 2XB2D 3TUIC 2C3UA 4HL9A 4E98A 2CJKA 2K1RA 4OJ3A 3KJNB 4RBVA 3W8GA 5A8RB 5F0UA 2YWFA 1T03B 4Q43A 1KN6A 3H4DA 2YWEA 2WBRA 1T9VA 2MY7A 3CC4S 2GMHA 4RUBA 1JQGA 2EFQA 4K59A 2B6AA 5D0EA 1U1LA 1YX2A 5IT4A 3DU6A 3GCXP 3OTEA 4QR0A 2V63A 3TW0A 3QJJA 2CQBA 2HVDA 3DYAB 4DU8A 2RRBA 1KVIA 4QIVA 2OTJS 3AB4B 2KJWA 3D4JA 3W2WB 2DNHA 1FJEB 2VG5A 4JBCA 2B7CB 5MLCV 1JXEA 1ZM2A 5KT2A 4X66J 5HI7A 4M5NA 4OX9F 1VYAA 4MKYA 2E5LJ 3DGPA 5E41A 5KFCA 2HPUA 4X64F 1KRPA 2OSQA 4O3QA 4B02A 2J7WA 1P27B 2B9WA 2IHR1 1UETA 1VQ9S 2D9PA 2N7CA 5DZ7A 4N76A 1HYSB 3CJKB 2DTJA 4ZLPA 3TAQA 4LSLB 1GMWA 1FDDA 4RW4A 2YKNB 3V5RA 3UE2A 4MK7A 1Q7LB 3FBBA 2HW3A 4ZN1A 3ZTPA 3M8YA 3LGHA 4NCAA 2BJEA 3KHLA 4YOEA 3EGZA 2DRBA 1UWBB 1TKDA 1MROB 4A8FA 3CDWA 2L48A 1FNMA 2UUWA 3FGVA 3NNHA 5K8PA 3CCZA 1EX8A 3T1HJ 4USJC 4K8RA 3C66A 4ECVA 2LCWA 4OI4A 2LXUA 4OJHA 4LIRA 2KT2A 1E6YB 4OLOA 2N3OA 4DSEA 1VRUA 5B0EA 4ZVOB 1TK5A 3HMJG 2ZKTA 5IFMA 1ZPVA 2R2SA 3AD8C 3TVYA 2I38A 1N56A 2LXFA 1J27A 4OZ1A 4C8NA 3KLVA 1VHIA 1R7IA 2F4VJ 4Y2MA 3WBZA 2YWKA 2F63A 3NEKA 1C1BB 1UZHA 3ENVA 1AXQA 1NNDA 1GH8A 1MG7A 1RWWB 1CSJA 2FY8A 1XWLA 2E1CA 5KAKA 1KC8T 2UUAJ 2DGUA 3R5AA 4ZLNA 3LALA 4OQJA 1DTQA 4WCEQ 3MR6A 3W5YA 3EXYA 1RU1A 3D6HB 3JSYA 1U2CA 1ITPA 2RMLA 4YR0A 1RAFB 4DV1J 3QIDA 3UN3A 2XO7A 2H5IB 1U0HA 3AJ1A 1RT1A 4OZ2A 3ZO7A 3B6BA 2NXJA 4I67A 2I5JB 1YJUA 1F5AA 4RKUC 1QY7A 3JYTB 1HL6A 4DZ6A 1FK9B 1S9GA 4R5PB 1DBDA 3DDNA 3FZ2A 4J9PA 4ILRA 2BR0A 2RF2A 3K57A 3A8IA 1NJIT 2FHJD 5D3GA 4I6YA 4EMDA 2XMVA 1NKEA 3P5TL 3QRPA 3S01A 4DF8A 3PKMA 5CH7B 1F6TA 1N32J 2C1EB 5EUHA 4JP8A 4LRFA 4DPOA 3KDOA 1V3ZA 3PIPQ 4ID8A 5C2CA 4KAIA 2K7JA 1IBLJ 4XAKA 1ZBTA 4ZJLA 4B9LA 2W2PP 2RB7A 4ES2A 3GQCA 5F9NA 2J6SA 3KJVB 3O6QA 3U27A 3KUEA 1HBNB 1S49A 4B9VA 1SJQA 4A46A 3UD5A 2M0GB 3GJQB 2ZJPQ 2CPFA 4P7VA 2W24A 3CNQP 4TN2A 3PJ9A 2XSJB 3FBFA 1S0MA 4KHMA 4PCQA 4NOHA 4IG0B 1M5HA 2ZWPA 3G4SS 2EEYA 2CZ4A 1JLBA 4U7UK 1TL3B 5KG2A 5IM0B 2MGZB 2R42A 4OI2A 3QNWB 4TNOA 3QWUA 2AYBA 4OHVA 4RWXA 5IZHA 1F1BB 5C42B 3LGNA 1M5PC 3M6UA 3RU0A 1Z4UA 5J2NB 3PEHA 1QSYA 5DRKA 1RAGB 4U7CA 2EWHA 2QLFB 3M4XA 3EXCX 2GZOA 3MMBB 1TTHB 3IBWA 1JKHA 1RT2A 2PC6A 5EWFA 2FJXA 4LFCF 3J81Y 3MD3A 1H74A 3QLHA 5KFMA 3FK4A 1WELA 3G6VA 1SKWA 1B64A 5CYQB 2VQEJ 1S72S 1VC5A 4DS5A 4LVOP 5A8WB 4DN0A 2YWWA 2ZVSA 5L9XA 4B17A 4MAKA 1KQSR 2CQ0A 2QLXA 2E5JA 1JLGA 3KHRA 3OFEA 4DU7A 2UP1A 3ITHA 4J9LA 4WE1A 2O3DA 3I4PA 4CZCA 4UF4A 3H25A 1VQNS 1H2TZ 3QT8A 2A6MA 3SBMA 2RU3A 5DGAA 3NGRA 4FBUA 1YWXA 1RT7B 5B7WA 4JI0J 2NR0A 1SV5B 3CDEA 5IXUA 2PN6A 3M2UB 1MSWD 2CPYA 4DPXA 3UPFA 4IH7A 1I94F 3GCWP 3ENWA 5THWA 4M5DB 3M8RA 1VFJA 1AB8A 3IAS9 4NZ0A 3W1YC 2OGUA 1CJVB 2EI5A 3HD2A 3IM8A 1RTHA 3HP6A 2MSTA 1TKXA 2ZJQQ 3GG1A 2XG8A 2IC3B 4DV3J 2HQ3A 5D8HB 3L4BC 3SZ2A 1EQMA 4WF9Q 1HQEA 2EC2A 1KOOA 5HROB 1N88A 5J1EA 1FRLA 3GYGA 1RB0A 2UUCJ 2QGFB 2ZBIA 2BYCA 2FTRA 1NJYA 1S1WA 2CDRB 4NLPA 2OMOA 2MYFA 2XYGB 4NWBA 1Q53A 3IN5A 4FNIA 3I0SB 4I7FB 1VLOA 1RCOB 4ITSA 4S0MA 4FZVA 3B54A 2BJ1A 1N36J 2LECA 2HHWA 1FF2A 3Q83A 1DURA 2GW8A 2HKEA 2K8GA 4CP5A 2PI5A 2OPRA 2J5AA 2JC1A 2G2YA 2RJZA 4JI3F 2PGCA 4C3KA 5DS7A 2BKPA 3K89A 5DZ6A 2DPIA 3DCAA 2IA6A 5KG6A 4OI0A 4DQRA 1CBKA 2Z57B 2WAQD 3LO3A 3QO9B 2DXEA 2KT5A 5I4MA 2DBBA 2NLWA 2BA9A 1UVNA 4IFYA 1H7WA 3US5A 1U1PA 1X0FA 1Y00A 2RS2A 4M5LA 4H4MA 4B3OA 3NGUA 2E7WA 3OFGA 4QIGA 2ZE2B 3IR5B 1AT1B 4FXWA 2V5HG 2HQGA 2J7KA 4RW8B 4DV2F 4J9UE 4K4TA 2QL7B 2WVDA 4NX9A 4DR5F 4K50A 2KVQE 3AAWB 5GAEI 1C0UA 2LEBA 4C8ZA 3IRWP 4ZOSA 1J5OA 1TUVA 2R7RA 2EFPA 4USTA 4KFBA 2ZBQA 1XJWB 2ROPA 3CULA 5B08A 2YVSA 3PV8A 1T3NA 1KTQA 4PYDA 1K44A 2BDPA 5KFYA 2W25A 4EU0A 3MUVP 2BEFA 3GV5B 1CVJA 1SH3A 4NXMF 2OHDA 4DHVA 4ECSA 1HWKA 3MTJA 1RHJB 3OL7A 9RUBA 2JL9A 2V4QA 3EGNA 2QA4G 3SMZA 2FVCA 1LQ9A 2P2CB 3LA0A 1L3SA 1T95A 3HHKA 2R8GA 1WF1A 1Z2ZA 3DMJB 2PA3A 2QIFA 4DG1B 4D3GA 4RU2A 2VG6B 1MWYA 5ETKA 4OHYA 3V6JA 1KFSA 1S0OA 4W4MA 2WVEA 3VAGA 3V4MA 1YVFA 1Y5LB 4P71A 3KK1A 4EO8A 3QT7A 4NL5A 1YJTA 1YZ6A 3MM8A 5KFPA 4F50A 1G1XA 3UWTA 3TZXA 2YPYA 1QTMA 3MEEA 1R8HA 2GIQA 2AWZA 2XHWA 2ILZA 4X4UA 5T7LA 2NCKL 1B0VA 1Y5NB 1U47A 4DZDA 4Q45A 2C2MB 3JSMA 3K2YA 3OR1A 2HS3A 1N33F 3HCXA 2DJWA 3AJDA 3R7BB 3KLHB 2BXJA 4KGXB 2JX2A 1E6VB 1R0BG 4Q7AA 2VDHA 4ED0A 2CJAA 1UFKA 3LUYA 4LR7A 1EKRA 4O23A 3JTPA 3N6LA 3R5GA 2AX1A 4E0DA 2CKWA 4J9MA 3FNNA 1EARA 3KMSA 5LMUF 5HAOA 2QN6B 2WSCC 1LXNA 3VALA 2IJRA 4ZPBA 3LANA 1SUQB 5B0GA 2H48B 4QW8A 5A6PA 1R89A 2PO4A 4DOZA 5F8LA 1YTYA 3R5JB 3CXCR 2VPWB 3BKTA 3THPA 2PFDA 5HLFB 3LP2B 4PG6A 3OJUA 1NZ8A 2RQMA 1WSVA 2B9YA 2H4WB 3EJMA 4JV5J 4A8YA 3HVTA 3M1VA 2YWHA 5AJ3F 4B3RF 4ZHRA 3IGVA 2IM2A 2FLOA 2QA1A 4U95A 2PE8A 3CCES 5IWAJ 2R3VA 2YNHB 1T0TV 1B3TA 3DC2A 1CJUA 1S0NA 1RADB 1GX5A 2LKZA 2AMCB 3AQPA 1HQUB 3PYFA 1BMQB 4WZMA 4PRFA 3E3XA 2FD2A 2IY5B 3NGKA 2J0SD 1HWJA 1HBOA 4PXEA 4YS2A 4C3LA 3RBDA 3D67A 4HACA 4M94A 1VQOS 2YNGB 3OV7A 3RRGA 2JC0A 3QWPA 4NEZA 2FC9A 4JI2J 1FWKA 1Q79A 3MMAB 2DB1A 1JLCA 2E5HA 1FESA 1TVRB 3M30B 1FFWB 2R7XA 5D6GA 4HLBA 1CS4B 2ZD1B 4ZKAA 2AZ1A 4L6V3 4Y2CA 4FPRA 3M7VA 4ECTA 1GTHA 2BKOA 1QTNB 3R6GB 3TX8A 1WC0A 3P5BP 4WIQA 1UPMB 1HARA 3TI0A 3W2VA 3HPOA 4QJVA 3BO2A 1BHNA 1VQ7S 3DOKB 2J0QD 1IWGA 3SEOA 5HMZA 3PYGA 3MUTP 2J6TA 3AD7C 4J9NA 1URRA 4PQAA 4KBIA 3KWMA 3UD4P 2DNRA 4LF1A 3Q8QB 4PR6A 4NCGA 4X4TA 1RA6A 1ROFA 2I1RA 3CCTA 2HNYA 5H9FK 3ILLA 5B0CA 3VQTA 4PWDA 4QIEA 5ETMA 3OXFA 1RAOA 1WI8A 1IKVA 2E9RX 2PEBA 3BR9A 4USHA 2XQCA 3NNCA 3QZ8A 3DLGA 1Q81T 4ILMA 1NJXA 4Y0FA 5HMWA 4LF4F 2Z2ZA 1C0TB 1KP6A 3DKDA 5LL6d 3UR3C 5J2MB 1G6BA 4O4GB 2VH7A 3M2VA 1F3VA 1IR0A 2ZBCA 2AW0A 3D2WA 4KKOB 4R8UA 4C2MA 2KVIA 4WBFA 2BW7A 3PIOQ 2A18A 1I6JA 1R8PA 3I0RB 2V4JA 3VTIA 1SJ4P 2YNIA 3O5TB 4FP9A 1NSPA 4X65F 1TL7A 1UW9A 5CXTA 2OPQA 1XBWA 5KT7A 1VRTB 1WNEA 1G7CB 3IG1A 2FVQA 2MXYA 1S76D 1W2IA 1ELOA 1BQNA 2YTCA 3BQ1A 1WTBA 4K4XA 2HNDA 5D0RA 1SJ3P 5C25A 2X51A 2BJ7A 3GIKA 3WC2A 1M5SA 1K0VA 4NLRA 1N5TA 3MECB 3IR7B 1GXUA 3E51A 4F04B 3BN7A 5HVGA 4G1QB 5A2QU 3L09A 4CH0S 4I2PB 4B9TA 1OMSA 4ECYA 4MKAA 4AQYF 4C8LA 4QYZJ 4LSNB 3O8WA 3MD1A 2DGWA 3UDCA 5A0YB 3IWXA 3HK2A 2P5VA 3R8YA 1TK0A 1KVKA 2CQDA 1KEKA 5GMEA 1WC3A 2XTJP 1R31A 1IKWB 2AIRB 2WOMB 4EZ6A 4C48A 5CD4H 1WORA 5EHHA 2WHOA 4OIXA 2DHAA 3SSRA 4ZP9A 2LQJA 2XWYA 4ID5B 1QD1A 4G65A 2BJ3A 2NZCA 4DX7A 3MAAA 4JYAJ 2W1BA 4K0KF 3GV8B 4DBQA 1S6OA 2FHKA 1RAIB 5ETTA 1NZAA 2J8SA 4UQTA 3CIMA 2WVFA 2FZGB 2BE7D 3MM5A 4DX6A 3MEGA 1FERA 3OHAA 3M8PA 5H9FJ 2HHHJ 2VA2A 1SQFA 2ROEA 2HGLA 4NASA 2DNQA 1X9MA 1T05B 4MFBB 2V67A 3IP0A 2JVRA 3UCUP 2VFVA 3GE9A 4QPTA 2KRRA 2HHVA 4ZVFA 2VONA 4KIAA 2WVBA 2KRBA 4A8WA 3TVKA 2C42A 3ZNJ1 4J37A 2IMWP 4LRDA 1S1VA 1FRXA 3PJXA 1G3OA 5A8KA 3MPYA 4B3MF 2MZJA 2E1PA 2K7KA 5DQGA 3THTA 4V19X 4UOCA 4GO5X 5IS2A 1CC7A 4GVBA 4I68A 4IFVB 1CJKB 2RT3A 5DETA 4AL6A 1UJ6A 4CI0B 1B4SA 1Q5VA 1SJRA 1NKBA 3L7OA 4JI6F 3I87A 5L1KA 2DH7A 2W9AA 3DYAA 3SFGA 3MM7B 3CCVS 4OYIA 5HJXA 1MWQA 1QJHA 3MF5A 5L9NA 3MCMA 1I3OB 2YKQA 4M95A 4OYMA 4AT1B 4IO9Q 3OTOJ 1R6YA 1REVA 4Y34A 1TFWA 1FKPA 4F2RA 1JJHA 2IRYA 4CH7A 2UXCJ 1F9EB 4B9MA 3HT0A 1WDTA 7AT1B 4ENOA 1M90T 3MGJA 4ZCLA 3TP2A 2R2TA 3ZTRA 3CMAS 4U7UD 1VQKS 2UVRA 1Q0NA 3PX0A 4A48A 1RAJA 1ZOTA 3JS9A 2WTFA 4XPCA 2C22A 5ETSA 2DIVA 2DHHA 4O44B 1RT4A 3HD1A 1YK9A 4DCJB 3HF5A 4JV2A 2NYIA 2YKNA 1TFYA 3E2EA 2MJNA 3LPEA 4ED6A 1HPZB 1LWCA 1FI4A 4F26A 2W4DA 1BWVA 4YY3F 4RUCA 5F3ZA 1HA1A 1RBAA 2VFRA 4H54A 2QLBB 2D7SA 1QAIA 2PSZA 1PYSB 1X7VA 2DGVA 2OAUA 1Q8IA 1XNRF 4KGKA 1C4AA 4H4KA 1W25A 4RW9A 2YKMB 3J81j 4JI7J 2CNNB 1ZETA 1Q78A 2VASA 1FJGJ 1OSCA 2B4PA 2UXBF 5IV4A 2JHEA 3FVYA 3K5NA 2MKHA 4ZVUB 2JOQA 9ATCB 2F65A 4DR1J 3HSJA 4XK8C 5E3PA 4C11A 1RLDA 2XI2A 2F9JA 2DO4A 2ZH3A 1JMTA 4ECQA 2U2FA 4A8MP 4LF5J 2FHJA 4DUYJ 3NS7B 2NXNA 1H7XA 1TKZA 4Q0BA 1QAYA 1Q82T 3FFIB 3BPSP 1RACB 3PX6A 1RTIB 4NMLA 3PVXA 3OJSA 1GFWB 3B4DA 3FMBA 5K14B 1D0EA 4URQU 2CZVC 5HL7Q 1A9NB 2M52A 3CD0A 2Y3YA 4DFPA 5GADU 5F8MA 1FXDA 5AE2A 4QZVB 3NP5A 1ZZNA 1M1GA 3MMCB 1EP4B 3H5SA 3OTCA 1N5QA 2M5YA 4KO0A 2W9BB 2BVZA 1OPIA 4IRKA 3M9NB 4J9KA 3HSGA 1RHMB 1DTTA 4UT4A 1VC0A 1FX4A 2CXEA 2EBGA 1N6QB 4Y3CA 1NDKA 2I5JA 2DNYA 2KT3A 3D3CJ 4EI2A 3QT5A 2RNEA 4CNZA 4NI2B 1FTCA 2VD3A 3UVJA 1XEZA 2B9XA 5IC6B 1NEEA 3M6XA 2VV5A 4FBTA 4GVLA 3K0JA 3Q24A 2DHGA 1U6FA 4F3OA 3DLJA 3QYYA 4DQIA 2CPHA 1RWXB 1RWUA 2AZ3A 4PKDB 4KHPJ 4L76A 3MI7X 4XDDA 1B7FA 3CB4A 3OVBA 1VBKA 5KFBA 2Y0BB 2UUBF 4CWBA 2NQPA 3IA0A 3BKUA 4F4KA 4HI1A 2QMWA 2WONB 2YY3A 1RTDB 3HHLB 1VOMA 3GFXA 2ZWOA 2GQQA 3T1AA 3EGWB 1IJFB 1VIXA 1IBMJ 1XC9A 5FDLB 4J9RA 3TAPA 4WK3A 4DMZA 3KG0A 4PG4A 4QWBA 3KJVA 4HDHA 3FQKA 4MMOA 2LVWA 1H38A 5DG9A 2R2RA 1U0SA 2DR8A 1S9EB 2E1MC 4BWMA 4YHHJ 1RYRA 1RT5B 2UXDF 3F0NA 4LFAF 1YJ9S 2XSJA 1QSLA 2ILYA 3K5OA 4N5SA 2ZZNA 1MU2B 4BS2A 4M8LA 1YGYA 5LXRA 3FQLA 4DV7F 2DVIA 2B8PA 2XYHB 4NYPA 2HGNA 2V8HA 1OQ3A 3QIPB 5KFHA 3RR8A 4HEA9 4K4SA 4I6AA 4DV4F 1H98A 1PAUB 1R8BA 1NK9A 2JLGA 3DHWC 2HURA 1X4DA 4JI8F 3HHLD 2XEXA 1GEHA 1S7IA 1RAHB 2VQFF 4WU2A 5J2NA 2H9ZA 1A6LA 4B3SF 3E8OA 3CJ0A 2CA9A 2FVSA 3Q8VA 1JLQA 1DQ9A 5KTQA 3U1NA 2XLJA 5GVQA 2FLLA 4OLPA 3JSRA 3DLKB 4BBYA 1VK3A 1I1GA 2E29A 2NUHA 5DDRC 2VBYA 4WIIA 2ZDPA 4XDCA 5E5NA 1GNKA 2DNMA 2X3GA 3DRXA 2FY1A 5A8WA 4R0JA 2RAQA 2Z58B 5DQIA 4RWWA 4KQZA 4F4AA 3EUNA 5GAHU 3EZOA 3KHGA 4ZCIA 1Q4RA 2ZKUA 4WKYA 3AJ2A 2UV8A 5LJ3Y 1TKTB 3GLJA 1K0TA 3FSIA 3CJ3A 4WZQA 2QFIA 1IXKA 1WKJA 4FN5A 3WIUA 1SV5A 4H4OA 1KR4A 1HWLA 5HMYA 2BV3A 1LV5A 1FNXH 1RA7A 3BGLA 3B8HA 3IFEA 4E8UA 2R7WA 1S1TA 4KGMA 5E3CA 1X5OA 3OD2A 5E0OA 5BJRA 4X62F 3OR2A 3CJ5A 4KB7A 1CJVA 2QL9B 2OD4A 2XY7A 3HULA 1FEHA 4C6AA 3H59A 1VRQC 1JLFA 4B9NA 3UDLA 2KXHA 1K8AT 4Q2MA 4CLYA 1KWMA 1GT8A 3BPDA 2V0NA 4OX9J 2CJYB 1VBYA 2IA0A 1S6PA 2P9GA 5F8IA 5BR8F 4X64J 2MTLA 1ZS6A 3K5PA 2AP6A 1S12A 4NLQA 3MXHP 4IOCQ 3ZZPA 3NMRA 1S57A 2HVEA 3EPGA 2Q79A 1WTFA 1UVKA 2APOA 1WG4A 5HANA 1R43A 2YX7A 1IWAA 2W2QP 3I0SA 3V6DB 2CJ9A 4I7FA 3QGGA 1XTZA 4ZLLA 2RUGA 4O3NA 3HM9A 1OY8A 2C2ZB 4WK1A 1YI2S 1A7GE 3CDBA 2JRSA 2DRAA 3KTQA 1S48A 1NHUA 5IQQA 3PXGa 3QPIA 1AFJA 1UVJA 4DL7A 4CIOA 1T9UA 1LWXA 2E5LF 4TY8A 5KFEA 1NK4A 3LGMA 2P9EA 2RILA 4R25A 3F44A 3LPYA 3M8QB 1NK0A 3PRVA 2FJVA 4CDIA 5AXNA 3CCSS 2AT1B 1MN7A 4FF3A 1RP5A 1VGYA 1UKUA 5H9EK 1NDCA 2VL1A 2RS8A 4RW8A 3T6JA 2R7OA 4M5GA 2MEWA 3TAMB 4ILLA 3RYLA 1RU2A 1QUVA 1UZDA 2V6AA 2XMAA 2OEMA 4DWIA 3BS9A 1V9OA 3TJAA 4JV1A 1U2FA 3OTBA 3W5ZA 4OX8A 2NSBA 2XS5A 4WTYA 3RBEA 5I42B 3ZXWA 1VI7A 2BUNA 2JVOA 2A6OA 1KTVA 3CTRA 5DG7A 2WB4A 2VOOA 5KFGA 4I2QA 4CO3A 3G71S 2I6WA 4KC5A 4FF4A 2BOAA 1EQ0A 2YPZA 5KFXA 3ENQA 4DSIA 1P8GA 2VICA 3KLIB 4BC7A 2V2QA 3ZTQA 1S99A 5J2QB 2CG8A 1F5BA 5KFFA 2DK2A 2GMLA 2MQPA 4K4VA 3ADAC 2MHNA 5ETRA 1H3DA 3J7ZT 1W2BR 1RHKB 4QWAA 2CIMA 1XR5A 5K8NA 3PX4A 3QAEA 5F41A 2Y1RI 3HI9A 3O2IA 1UVIA 1X4AA 3EDQB 4Q2LA 3D6FB 2ZBPA 3KLGA 1BGXT 4DG1A 3RBXA 1IBCB 3FKBA 2VG6A 2J9CA 3NY0A 4F4WA 4TY9A 4P75A 2D3OR 1WKLA 2EG1A 5HN0A 5D4LA 1HBMB 2DR6A 2UUAF 2OPPB 2KTQA 2RQKA 2HSEB 1F9HA 3CJSA 2ERRA 1RUSA 3AODA 4C97A 2IBOA 1IKYB 2AX0A 3IRXB 3V4IB 2C3YA 1FCAA 5A6WA 3RTVA 2G2ZA 4ED1A 5A2QY 2D3UA 4B9UA 1CULA 2NPIA 3GYNA 3A8EA 4CLWA 1U1OA 1X4HA 4IG3B 3PYDA 1KSPA 5B0BA 3H20A 4PPZA 4DSFA 3BH7B 4IOBA 5C5JA 3NCRA 4LBIA 2JEIA 3EMTA 4KPCA 4AXIA 3IGNA 2AF6A 4LUBA 4PWWA 4TXSA 3IWNC 2ZHAA 2LLZA 2ZM6F 2OMLA 3FZBA 1SUQA 4K4WA 2IDEA 2M2BA 3G87A 5GADI 1AFIA 1MNEA 5L1JA 1TK8A 3KXDA 3BV8A 5LOQA 1TZ0A 3I6PA 2DPJA 3J7Z5 4N77A 4HT7A 3IS9B 2JEGA 1PJ5A 2BACA 3R2CJ 4KT0C 5JXSA 3CMES 3SXLA 3BGFA 2Z8QA 2IDLA 3KK2B 4XTTA 2WK4A 1HHQA 4L72B 1WG5A 2HQCA 2A0FB 5D0HA 1B0PA 4Y6IA 4C8OA 1O5JA 1DFDA 2MZRA 1YBUA 3HFVA 3VHQA 4ZVQB 2B9EA 4LFCJ 3SSQA 1K47A 2F40A 4NXNF 3W5XA 1SKUB 2WW4A 3MUMP 3S8SA 2HQFA 3PHTA 1MN9A 4ICLA 1PJ7A 1SJ1A 4QIWD 5IOLA 2HK2A 3BKFA 5KFZA 3MMAA 4DEZA 1VIOA 4NA2A 4YMEA 1YRUA 4RW6B 3R27A 3RGIA 4DR6F 4KPYA 1ZZFA 4F25A 3TOQA 2N4CA 1D8ZA 3C46A 4OJGA 4ERDA 2FPHX 3D9BA 4J91A 1P9YA 4NZ7A 1PC5A 2IAJB 1WC5A 2JFKA 2KU7A 1HD0A 3MR7A 1BLUA 2GQ2A 2GGPB 1R0AB 2F1FA 4M5HA 3NGSA 1I94J 2VQEF 2BE2A 3TX0A 4K4ZA 2DITA 1D8YA 7FDRA 3HXMA 5FD1A 4ELVA 4K2JA 3H2LA 2MZSA 4DR4F 2MMYA 1PIEA 3LP1A 1PSDA 3FDSA 2YXLA 2K1RB 3GMGA 1VQLS 1RT6A 4C0OC 4P74A 1PJ6A 2MKJA 3NS5A 4M5KA 1K1SA 2WBMA 1PYOB 2FGCA 5AE1A 1QSSA 3FSYA 4UZCA 2VKZG 4LF7F 4PABA 2BX6A 3P96A 4R0EA 2VC1A 3W66A 3SCKE 3SDEA 4L75A 3NWRA 1C0TA 3DLBA 5J2MA 4F4YA 3M2RA 4KKOA 2VG5B 4HI2A 4ZVSB 2JWNA 1RAAB 4WPAA 4DF4A 3ZTSA 4JI3J 1L3TA 3BB5A 3Q8PB 1O6XA 4I0WA 4OYBA 2E66A 3DGPB 2XHCA 1X4CA 2W4CA 3NS6A 4D3HA 1CLFA 1JB0C 4P6QA 4NLXA 1NB7A 1U1KA 1VRTA 1WF0A 4ECWA 2OTLS 5T14A 4JUZA 2QEXS 5C24B 1XR6A 2DCUB 3QQCD 3RB4A 4LR9A 2MQOA 2CG4A 4RW4B 1WKKA 4DV2J 4ZPTR 1RBOB 4C8KA 4KE5A 5FLXU 1HR0F 1JJ2R 2KH9A 3WX8A 3VVTA 4DR5J 2HYIB 4BLGA 1FVQA 4B08A 3KUGA 4NLDA 4KGVB 4ZN3A 4FYXB 3G6XA 4ZVHA 3RRKA 1SL2A 4C3MA 3W9JA 3BR8A 1U25A 2OELA 3UNYA 4NLOA 5E3RA 4WFAQ 2ZOFA 3GONA 2CQ2A 4RO0A 1L3VA 3RBZA 1LFPA 2IVMA 4LF2A 4NXMJ 1FA0A 2WOMA 2H51B 4PG5A 1RJJA 1TP7A 1AUSL 2EK1A 2GO9A 3A3NB 4ID5A 3MOZA 4A8QA 4FKYA 4OZ0A 1WC6A 4LVNP 1T9TA 4UUWA 3EDRB 1S79A 2IM0A 2FJWA 3AH6A 1UEUA 3P6YC 1P6TA 3DNCA 1O0PA 2KFZA 2DEJA 2H5EA 3A8JA 4QR1A 1Q16B 3TQEA 4OJ1A 4LQ9A 1HI1A 1R8CA 3MFHA 4UQGA 4Q5VA 3K5LA 3IXQA 2MDAA 2NYHA 4QYRA 3W60A 2AGQA 4MK9A 3LWLA 2G0IA 2F8EX 3TRGA 1RT1B 4F3QA 2XZDB 4F67A 1IR1A 3KMQA 1N33J 2FB0A 4ZJOA 1TUWA 5J1PA 3VGSA 2RDIA 4WP3A 1NKCA 2YKOA 4C8YA 2FLNA 3AB2B 3C3LA 2NXCA 1S9GB 1UMJA 2RF2B 3KK3A 2BQRA 3C16B 3TYTA 2ASDA 5ETPA 1UEVA 4BC9A 2RKIA 3T9NA 5D3GB 4KYZA 3P49B 1EHWA 1CJKA 5LMUJ 4USUA 1ZAVA 3BO3A 1WD6A 1IVZA 1Y4ZB 3I9V9 3NBPA 3I32A 2VODA 1KFDA 3Q2SC 4DXLA 2PFFB 3HHNB 5GAEU 4RBUA 1IKXA 3JTNA 3B4MA 3F73A 3FEZA 4DPWA 2O1PA 5G0RB 5HO4A 3V81A 4LRBA 2KHDA 3WQPA 2OIHA 3U7JA 2Y9HA 4ZPWR 5M2RA 1TV6A 2BOPA 2HHTA 4K5SA 4B3RJ 2PEHA 2BANA 3PFEA 3DRPB 3C6UA 1UEKA 5KT3A 3BM7A 3CD6S 2CUYA 5KFQA 1RDRA 2H65B 5KFJA 3C2PA 1UCNA 3Q0AA 2C28A 5E33A 4OYAA 5H1SV 3RB6A 4OZLA 1JLBB 2NXUA 1S6QA 2O01C 3I31A 1UPPA 5B0DA 2JLEA 4C98A 1HPZA 4AUKA 3EGVA 2Z4PA 4CTAB 3RAQA 3D0GE 4GRSA 2MQMA 2P6TA 2GAHC 2HQIA 4ZIVA 5K8MA 2HRUA 2FIUA 2F9DA 1XK8A 2QO3A 3VQSA 1U1RA 3G82A 4FXVA 1T02A 1IQZA 1T9WA 1JKHB 1N0UA 1RT2B 2HQDA 4NYZA 1HW8A 4CM2A 3QLHB 2H5JB 2XMUA 1L3KA 3RB3A 4CRJA 4MK8A 1HWIA 3HSDA 4KRWA 1OY9A 2AJFE 2IJFA 2PDAA 1N5YA 1JLGB 3HZEA 3UR0A 1NU4A 2DXFA 1MWZA 2CQCA 3R2DJ 4DUTA 4LBPA 3ITHB 1JLAB 1FNOA 4WE1B 1H72C 1NM2A 4ED3A 1W7WA 1FHTA 4W90B 4QIFA 3TNVA 4DX5A 3PW7A 4CLPA 3OXLA 4NCBA 3MM6A 2QMXA 3FCWA 4A8OA 3BYRA 4J90A 1Z1ZA 2V8GA 2QX0A 3W63A 1FFSB 4MIAA 3GILA 2ASLA 2KFNA 4HYKA 3C19A 3MMCA 3BSNA 4IR1A 2UVWA 5HSPA 2RRNA 2VFSA 4IDKB 2G0JA 2HFOA 5HK4A 2DNOA 1FD8A 4KSEB 2VB6A 1RHQB 2W9BA 3THVA 3D5MA 3V6KA 1J2VA 2D74B 4X4QA 3PM9A 1N6QA 1N34J 1XMQF 1HQEB 1VLYA 3R97A 1GQEA 1RWOB 3AQOA 4NI2A 3ISZA 4UOHA 1LK5A 5KFOA 4ZVTB 5I3PA 3MEDA 3VAIA 1WEYA 1D9DA 4X65J 3L7UA 1NPRA 1S1WB 1GMUA 1LK7A 2HHPA 5KFWA 2MKSA 5BXIA 3A12A 1BXNA 1RBLA 5F8GA 1R3NA 2G0CA 2DGQA 1SJFA 3FMWA 3RJMB 2UUTA 3X3UA 3RW6A 6FD1A 1O8BA 5BYRA 3NAIA 4OHZA 2ZOMA 5FDLA 1JX4A 3DM2A 1LW0A 5HATA 4ED7A 4WP8A 1BQMA 1SC4B 4B3TF 3GU0A 4PQUA 3DOLA 1HQ2A 3PNIA 2R8HA 4NMXA 4AQYJ 3EVMA 2RUSA 4ATNA 2DH9A 2JZ5A 2LXIA 4LBHA 2AGOA 4IFYB 3VV2B 3ELHA 3MPVA 1YKWA 4H4MB 4B3OB 4PEOA 4F0HA 3EM1A 2LQ5A 1ZAXA 4XPEA 5SZTA 5B0AA 1VQ6S 2BW2A 3DRSA 2VIHA 2HFNA 3QIPA 1R8AA 1EETB 3NRBA 4EYIB 4CYUB 1QUPA 3MMJA 4EFAC 2KKHA 5HP1A 1XQIA 4YQWA 1T3OA 1CJTA 1U1MA 3N5FA 1S6UA 4LR8A 4W98A 4P73A 2HZVA 2MQ8A 3RAXA 1HNXF 2CPZA 3CUNA 3MM9A 2MKIA 5IC4B 3ILIA 3AA8A 3DLKA 1YJRA 3TUZC 5DLGA 3K58A 2CRLA 4IRCA 2QZ8A 4AE5A 2YH1A 1RABB 4QOTA 1YJVA 3NGDA 4FDFA 2HHXA 2JDJA 3FSXA 4P52A 3CT9A 2KM8B 5L39A 4F02A 1A0OB 3ZFVA 3SI8A 2L9WA 1EJ7L 3UD3P 4B3MJ 5J2PB 4YEAA 1TKTA 2XMKA 2ZH2A 3M32B 2KXNB 2BBEA 2RE1A 3SV3A 3ETMA 3MWBA 2XMWA 5HMXA 3Q2TC 2AJ1A 1RE1B 2HHHF 1LXJA 3MFIA 3OSPA 1GK8A 2HRYA 1Y9OA 5MAOA 2W9CA 2CQ3A 3DI6A 3CEDA 4JI6J 2OO4A 3MM8B 1UP1A 3MEEB 4AL5A 2VG7A 5ADZA 2R2UA 2ZUAA 4LIWA 2L3MA 3BO4A 2ROGA 1N52B 5T7LB 3KLEA 4DLEA 3TUPA 4BDPA 3CWJA 1NMEB 3JSMB 5HBMB 3OR1B 1SI9A 4LJMA 1YJNS 3DRYA 4RNMA 5HQ8A 2QTWA 1VMBA 2OLWA 4L3KA 1HBUB 1HLWA 1LWEA 3OLAA 3UQSA 4DI6A 1HNIA 1NSQA 1SVDA 3CMQA 2AJ2A 4K4YA 2V4RA 3G6ES 3KOAA 2QC3A 2I9SA 3CCJS 4A8KA 2HGMA 2YWGA 3JSBA 4FYYB 2CJQA 2GV1A 2ASJA 3HVWA 2K06A 2NSCA 1RGVA 1T8EA 4KTQA 1U8WA 2HLTA 2DEIA 2QRRA 4OYZA 4PUOA 1JIHA 2CFXA 1GAOA 3KHHA 3VZHA 2E5IA 5L38A 3DRRA 2VF3A 3NCQA 1L3UA 2CZ9A 3OTOF 3J7YI 1S77D 3MCSA 3HVTB 3HJVA 1DZ5A 4HVZA 3QGHA 3SCIE 3I5CA 4ZHRB 4ES3A 2QMUB 2FZKB 1HHTP 3QRRA 5DM6Q 4GMKA 4LF8F 4OHWA 2UU9F 5L1LA 1XNRJ 3ISNC 5CAAA 2GVZA 3S6EA 3ILJA 2UXBJ 4WKRA 2HFSA 3UFCX 5K9FA 1S1UA 2ZEJA 4ZCMA 3KNAA 1XERA 4WXWA 1PKUA 1HBOB 3TAMA 2AJQA 1N8RT 1J5EJ 2O5DA 4LF6F 2QE5A 4NRUA 5CYMA 4NLTA 1F9FA 3LH2S 1JLCB 2KN4A 1WEZA 1SL1A 3GR1A 2P9CA 3OBIA 3H42A 1EIYB 3WDOA 3GJTB 4OYWA 1Q8LA 4ZP8A 4NRTA 1JLEA 3TZYA 2BJ8A 4F3MA 4YDDB 4ZK7M 1P1TA 3KLIA 5ETOA 3S7RA 3NMAA 3FCVA 2NZ4A 1UA1A 3R1LA 4DV6F 1GXTA 3VCDA 2UV8G 3TZWA 3GSDA 4WFBQ 1OYDA 4DUYF 3SIPB 1HIYA 1IBKJ 3H98A 2YKAA 5I3UB 1H2VZ 1QE1A 1VQPS 4NCGB 3IMQJ 1YDLA 2ABYA 4RW7B 4EK2A 4UY8T 4MH8A 2HNYB 1U4BA 1ZM9A 1W26A 3ET6A 1VHFA 3D28A 2JJ4D 2E7XA 1ZA1B 3BDEA 4YR3A 2B8QA 5LMNF 4HHUA 5FLXY 1NHKL 2AEJA 3EZ5A 3DLGB 3J7AN 2UUBJ 2OEJA 4PXBA 2HHQA 2XS2A 5K5MA 1X9WA 1AZSA 3M2VB 2GFFA 3POTA 3CGIA 3MHYA 2DXDA 4R8UB 4CLKA 1PYTA 2LDIA 3KLFA 1FRKA 4IG3A 4RX6A 4IH5A 5E2QA 3GFYA 2PD1A 2V4JB 3HX9A 2EG2A 3FRZA 2D3O1 1RTJA 4U9RA 3PW4A 2BRKA 4HHHA 2OPQB 1WG1A 2UXDJ 1HFEL 3JQJA 4LFAJ 3IG1B 2XSFA 3TZZA 1RT3B 3QSIA 1BQNB 2BM1A 2GHVC 3V6HA 2JEJA 4ZVEA 1M1HA 4MYTA 3OL6A 4DV7J 2Q3PA 2HNDB 1ACMB 3HJFA 5C25B 2NREA 4DDFA 2ZNZA 3A3PB 2GA7A 1APSA 3CO0P 5FIIA 4DV4J 1Q8KA 3ZZRA 4JI8J 2VA3A 4DPYA 3F56A 3QGIA 5T41A 2VQFJ 1FWLA 1M5KC 4B3SJ 4P7TA 2UZAA 3GFHA 2W4PA 5D15A 4UY85 2DISA 4OFZA 3PO5A 3H0PA 5GMKa 1F0XA 3A3OB 4O3RA 3BZQA 3EX7B 1Q7YT 2HMIA 3G96A 2BJ9A 3EYZA 3DDKA 2IVFB 3I5BA 2WSEC 4RBTA 3K8VA 4LF9J 3CJTA 5KFLA 4X4OA 5DGBA 2F8HA 3K8WA 4LFBF 1CEZA 1ZH5A 1WOSA 4QYZK 1FKOB 1B70B 1TL5A 3HVAA 3MAQA 2RQCA 5F3TA 1X0PA 4F2SA 4IKAA 3MM5B 1U24A 2IMOA 3KUHA 3MAHA
chains in the Genus database with same CATH topology
1V3SA 2E5JA 3HDSA 2IAJA 1JNZB 2GMLA 3M8PB 2MQPA 1JLGA 4K4VA 3E01A 3KHRA 2QYCA 3DXSX 2BRLA 2GGPA 3OFEA 2UP1A 2MHNA 4EZ9A 3ITHA 1H3DA 2N7YA 4J9LA 4WE1A 2O3DA 2OD6A 3MM6B 5D78A 3J7ZT 3I4PA 4CZCA 3H25A 1VQNS 2R8KA 1W2BR 2M9KA 1H2TZ 4QWAA 2CIMA 2JEFA 1XR5A 5K8NA 4CCHA 3PX4A 3QAEA 1DTQB 1X4GA 2M88A 5F41A 2Y1RI 4J9SA 4TU7A 3HI9A 3O2IA 1M5VC 1TAQA 4RUHA 2XGPA 2RU3A 5DGAA 1UVIA 1Q8BA 1DRZA 2GC8A 1AROP 1X4AA 4Q2LA 4YR2A 1T05A 3KLGA 3BSOA 1BGXT 1RISA 4FBUA 1YWXA 1RT7B 4MFBA 4DG1A 5B7WA 5JVHQ 2NR0A 2MY8A 1SV5B 1FJ7A 2VG6A 4QU7A 3FCHA 3NCPA 1UA0A 2J9CA 3CDEA 3S1TA 1S1VB 5IXUA 4F4WA 3W7BA 4TY9A 5A8KB 2PN6A 3M2UB 1MSWD 2D3OR 3UNGC 2EG1A 5HN0A 2J0XA 2CPYA 4JI5F 1FKAF 1FDBA 3UPFA 5D4LA 4X4VA 1HBMB 2MPUA 4IH7A 2U1AA 2UUAF 3J7YU 1I94F 2K3KA 2F7VA 3BJYA 2L41A 1L5UA 2KYZA 2OPPB 3ENWA 5THWA 2FDNA 4M5DB 3M8RA 2VZ9A 2KTQA 1VFJA 4ETXA 2RQKA 3QAUA 3IAS9 2V94A 3KKFA 4NZ0A 2BM0A 5JVGQ 4DX8H 4ECUA 3TARA 1IBKF 2ERRA 1WHVA 1K1QA 2CPXA 1X4BA 2IBOA 1IKYB 4C97A 3NL0A 4DL5A 2AX0A 2EI5A 3IRXB 3V4IB 1RTHA 2C3YA 3HP6A 1FCAA 2MSTA 5A6WA 2XY5A 3RTVA 1TKXA 1MMNA 2ZJQQ 3GG1A 4ED1A 3LQVA 2XG8A 2IC3B 5A2QY 4DV0F 4RZRA 4TU9A 2UVVA 3BGRA 2HQ3A 2D3UA 2CQHA 1Y3KA 3MEDB 5D8HB 2DNGA 4B9UA 1LW2B 3SZ2A 2KZMA 2NPIA 1HQEA 1GTEA 4WYLA 4WF9Q 1VQ4S 1KOOA 5HROB 2YX4A 1N88A 2LA4A 3TANA 4NZ6A 3GYNA 3PY8A 1FD2A 4IFVA 4DFMA 5J1EA 1FRLA 4EEYA 2POKA 2IM1A 2O66A 3A8EA 2R7VA 2VFTA 2QLXA 1U1OA 1X4HA 5EDWA 1DLOA 4ZP7A 2ZBIA 3T6BA 3MPWA 4IG3B 1KSPA 4PWUA 2BYCA 4X2BA 5B0BA 2FTRA 3H20A 2D1CA 2DHXA 4PPZA 1NJYA 2HAIA 4DSFA 1S1WA 2VPYB 3T19A 2XMJA 4IOBA 3SFUA 3T9ZA 5C5JA 3NCRA 2NPFA 3OPKA 2BQUA 4NLPA 4EBDA 1FXLA 2OMOA 2JEIA 2MYFA 3BEGB 4NWBA 1REVB 2M7SA 1Q53A 3MM7A 4AXIA 3IN5A 4FNIA 2DNNA 1UJ4A 1FKPB 3I0SB 2AF6A 3IGNA 4I7FB 4LUBA 3RRHA 3DM2B 4ITSA 1LW0B 4TXSA 4FZVA 2B5JB 1ZPWX 3IWNC 2ZHAA 3QGPA 1FF2A 2LECA 2HHWA 1U1QA