3TA1A

A. fulgidus glnk3, mgadp complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
110
Chain Sequence
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLQFRGVEVDLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-3)
publication title Mechanism of disruption of the Amt-GlnK complex by P(II)-mediated sensing of 2-oxoglutarate.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 21
structure length 110
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ta1A00
1VHFA 4WK3A 1QY7A 2EG2A 4YB7A 3MHYA 1Q1KA 2PIIA 2XZWA 2XULA 4YB5A 4C3LA 4RWWA 1O5JA 2CZ4A 3AHPA 2DCLA 3NCRA 1V9OA 4OZJA 2VD3A 1J2VA 1UMJA 2NS1B 5DRKA 1NH8A 3NCQA 4CO0A 3AA8A 2NUUG 4NYPA 5DS7A 4NYOA 2GX8A 1XK8A 4RLEA 2J9EA 4R25A 2E66A 2J9DA 4CO2A 4USIA 4AFFA 1GNKA 3LF0A 4CO5A 2V5HG 3N5BA 5D4PA 2Z0GA 1NH7A 1KR4A 1UL3A 4RWXA 1O51A 3TA2A 1V3RA 1V6HA 2O67A 3AH6A 4RX6A 4D3HA 4E98A 3X3UA 5L9NA 3HLUA 2EG1A 2GW8A 2ZFHA 1NZAA 4Y65A 1VFJA 2O66A 4USJC 2J9DE 2J9CA 3TA0A 2RD5C 4OZNA 3GSDA 4C3MA 3BZQA 4CNYA 3AA9A 2JJ4D 4USHA 1P1LA 3O8WA 3T9ZA 4IYQA 4OZLA 1PILA 5D4LA 1H3DA 3O5TB 3CE8A 3L7PA 4WK1A 4Y6IA 5D4OA 3NCPA 1UFLA 4YB6A 1V3SA 2NUHA 4CO4A 3OPKA 4D3GA 3TA1A 4C3KA 1HWUA 2XG8A 2XBPA 4CNZA 1UKUA 2GNKA 4CO1A 4CO3A 4ZK7M 1OSCA 5D4NA 1NAQA 3DFEA 3M05A 2ZOMA
chains in the Genus database with same CATH superfamily
2VH7A 4M5HA 3RB6A 3NRBA 3CJ3A 4NA2A 2AIRB 4ZVEA 5F9LA 1N0UA 2AMCB 4FXWA 2AJ1A 2DGOA 3D9BA 1S9GA 1SI9A 4ED3A 1Y10A 3OXFA 4NYOA 4HTIA 1WD6A 3I4PA 3M30B 4PWDB 2MQMA 3K59A 2VZ9A 4HTJA 5D3GB 2RILA 1Q8IA 2CQ1A 5F8NA 2QLWA 4CTAA 3M2UB 1XR5A 1Q7LB 3FZ2A 3TYTA 1TUWA 3T9NA 2JHEA 2NSCA 2J9CA 2HW3A 3IBWA 4C4WA 3CCSS 4DPWA 2W01A 2AX1A 3D54A 3QAUA 3L7OA 3LANA 1NKCA 3V6JA 5A0YA 2Y1LB 2B9XA 1HW8A 3B8HA 4ZCIA 4NLTA 4ANEA 1KWMA 3HPOA 4DF4A 3CULA 3QGHA 2ROEA 2H4YB 5KFAA 1P8GA 4OX9J 1KNZA 2ADBA 1YLXA 4M94A 2XULA 4DQRA 2M8HA 1OS5A 5LXYA 2XMUA 3PJXA 2V69A 4JI4J 2MDAA 1F60B 1CLFA 1IBCB 2NCKL 1X31C 3MFIA 4DF8A 2G1DA 2YH1A 1SJRA 5CZVA 3H2VE 1URNA 4NLVA 4O3PA 5JXSA 4F4ZA 1DLOA 5C5JA 2CFXA 5KT7A 2HVEA 2XWYA 2RDJA 5J2PB 1FX4A 1CULB 1Z1ZA 2CQ3A 4ZLJA 4YR0A 4MT1A 2Q1LA 2RMLA 5DQHA 1HBNA 1KP6A 3RJMB 2FVPA 2HHQA 1SKRA 1WC0A 2JFDA 3FKBA 3NBPA 1GEHA 2QLBB 4RBTA 5DLGA 1PJ6A 2DNMA 3K5PA 5J2MB 4B3SF 4DCJB 2DNRA 1KLMA 2FJXA 1TMMA 1Q95G 3SFUA 3I55S 4LSNA 1IUJA 2E44A 5L1LA 1LFWA 4QR1A 2A10A 3MM7A 4AXIA 2CZ9A 5DM7Q 4C0HA 3MM6B 1V9OA 2A1BA 1GK8A 2AJ0A 1N5YB 4KHPF 5B0CA 3MMBB 1VDHA 3BGRB 2HFOA 5K20B 3Q23A 2J6TA 1U8WA 5BXIA 3MAQA 3T1YJ 3S1TA 2LQ8A 4I67A 3AD8C 1Y3KA 4KKOA 4RNOA 3MEDB 2BE2A 5E3RA 4CZCA 3RB0A 1BQNB 3WX4A 2CJYB 2Q43A 4FVMA 2CXEA 3LP1B 4DX8H 3QJLA 1R27B 3L4BC 2BM1A 4F4KA 3BO3A 4CI0B 5CZXA 4A8YA 2WVBA 1A0OB 4PG6A 3AXMA 3CCVS 3UPFA 3FZBA 3GFXA 3M8RA 2W2PP 2A3JA 4DQSA 2NZ4A 2IYIA 5J2NB 1AFIA 3S6EA 1RWMB 2QA1A 3M05A 3KK1A 1PYSB 3BBBA 2PMWA 1GMWD 1VMBA 5HANA 3QGGA 3HP6A 2J6SA 2XB2D 1FD2A 2DNGA 1NK9A 1UVJA 2ZBIA 4OYPA 4ZPWR 3KK2B 3WX8A 2EK6A 4IG3B 4NLXA 2GJ2A 2NXJA 2XSJB 2ZD1A 3HT0A 4A8QA 2HFUA 2ZH3A 3IWLA 3TAMA 2I1RA 3Q8RB 1KDNA 4DPUA 3K17A 3MPWA 2ZHAA 2AV5A 1MG7A 3BDEA 5A8RB 2EKYA 1I3OB 2PI4A 4OHVA 2UUCJ 2Q3PA 4DV4F 2HLUA 3D3BJ 2F9DA 4X4SA 2LEBA 4DS5A 1YVFA 1VI7A 4O0IA 2QA4S 1P1LA 3GWCA 2DNHA 3KMSA 2LEAA 2ZVIA 2FYXA 2R8KA 4IOAQ 2IM0A 2NUHA 4I4BA 1KFSA 3I87A 2HK2A 1S4FA 4BCAA 1VQYA 1MROA 5HSPA 2IJFA 3TX8A 3LQVA 3SIPB 3MOJB 4YB7A 2P8IA 3PW4A 1B0TA 3OFHA 1R43A 3HI9A 1NUEA 1R8HA 3WQPA 2VD3A 1FO1A 5F8MA 3EUNA 2KG1A 1HQ2A 4M5NA 4CTAB 3BGOP 4FYDA 4HVZA 3I32A 4FXDA 1F6TA 4TLRA 5DQIA 5KT4A 3V81A 3H7HB 3OJUA 1YJ9S 5IOLA 4DV7J 4QPTA 1GT8A 3PHTA 1KHVA 2FHKA 4ZKAA 1L3VA 1RTZA 2VONA 4F8RA 2DGUA 3G8SA 2OPRB 2MZRA 2FJAB 3UCZP 2IM2A 3AA9A 1UJ6A 1L3UA 2HHUA 3WBZA 1RDRA 2IMOA 4ZDNA 4XTTA 2PMHA 2CVIA 3OR1B 1CJKB 2F1FA 3OPKA 4D3GA 3CMAS 2XBPA 2CRLA 2ZH8A 2W7PA 3IM8A 1ULRA 5D4NA 5GAEI 1ZM3A 3HZGA 3TW0A 5HQLA 3VF0B 2CQBA 2FVQA 3SSRA 2F9JA 4C9DA 2QYGA 4U6PA 2UP1A 4C3LA 5IWAJ 5LJ5Y 1M5VC 1P27B 3LP0A 4MAKA 1FEHA 3NCQA 4B17A 3I56S 4TY9A 1SC1B 3C46A 1IKXB 4OJ1A 4I64A 3P5BP 4I7FA 2KFNA 3ULHA 3T5LA 1MMDA 4ECQA 2E7XA 3MM8B 1TL5A 4CH7A 3R5AA 3DLKB 5LM7E 4Q2LA 1S6OA 3GR0A 3U27A 1UZDA 4HL9A 2MYFA 5THWA 4DHVA 4LJMA 5LJ3Y 2KXNB 1N34F 1X4FA 1KLMB 4M5MA 5DETA 4W90B 1CJVB 3CMQA 3SZ2A 1SKWA 3G86A 2CPEA 3MM7B 1ZZNA 4J9SA 4YEAA 5I3QA 2R42A 4Q8EA 2YKAA 1NJYA 4IFYA 2X1BA 4ZP8A 3DLBA 4JI1J 1U02A 1TVRA 1UW9A 4PXDA 2HS0A 1IQTA 2R2TA 2GGPB 3NOGA 3CJ5A 3G6VA 4HI1A 3VWSA 1UZHA 3HHLA 2HWIA 2HRYA 4XIUA 5IT4A 4HDGA 2EPIA 1RTJB 1OYEA 1S0MA 2QA2A 2CNKB 2WONB 4WJBA 3LP2A 1RLCL 1GNKA 1NK6A 4C2MA 4DUYJ 2FZKB 4C8YA 4LF6J 4OYOA 2VDIA 4ALZA 2BMBA 1V6HA 2FVSA 5J1EA 1MU2A 3UN3A 3C15B 1N8RT 5K8NA 2X3DA 4N5SA 2HNYB 4IDKB 1JLEA 1C1BA 3V6KA 4L6V3 3BH7B 4NCBA 3W5YA 2HZAA 1AZSA 2V8PA 1KLNA 4F3QA 1CJUA 3BF4A 2YKMB 2KDOA 1JLGA 4OX9F 3DU5A 5LMUF 4I2QA 2IA6A 3C14B 1KEKA 2XY5A 1RABB 4TU8A 3ZZ0A 4LFCJ 1D8YA 4JI4F 2ZD1B 2YX7A 2P9CA 1FK9A 3IA0A 1EAYC 3G6YA 3TAMB 2V8DA 5B0FA 2AQ4A 1RCXB 4DZ6A 2KM8C 4OJHA 1DURA 5ITHA 1RWWB 3FBEA 2DNZA 3QT7A 3H2UB 4DV0J 1PYOB 2DH8A 2W25A 3A3NB 3DOKB 3EM1A 2YNGB 3LGNA 4DEZA 3KJFB 4A4JA 3Q83A 1K0TA 5F0WA 1C0TB 4U96A 4CLUA 4C6AA 4RUAA 1RI7A 3ETOA 2MKIA 4LR7A 4DR6F 2GHWA 2V2KA 2HMIA 4DV1J 1CQMA 3TA1A 2O01C 3PIOQ 5C24B 4CNZA 2GIRA 3H20A 3R27A 3K0JA 4F0HA 2XMTA 1A7GE 3QATA 2ZEJA 2E9RX 2HZVA 4DL2A 1DZ5A 3DC2A 4RWWA 5DLFA 3BSCA 3GJSB 2NS1B 3W63A 2GVZA 2NXCA 2LDIA 3T1YF 3VCDA 2W4PA 4LF7J 3DXBA 3HD1A 4UUWA 4P72A 1JWWA 4IR9A 3NGSA 1AA1B 4HDHA 5I3PA 1NEEA 2HQGA 3AT1B 2G9OA 4KO0B 1LWEA 4JV5F 1TV6A 1N56A 3JSMA 5B0EA 2E9TA 4DL5A 4ETZA 2E1RA 1S4EA 1RT3A 4OIXA 4PPDA 4LVNP 4EK2A 3R6LB 3ADAC 4LIWA 4QIWD 4DWIA 2M9KA 2FLOA 3TANA 2LU1A 1WELA 4O3QA 2ASJA 3Q89A 1RWVB 3CO0P 1TELA 1RAJA 1RBAA 3DRXA 1KS2A 4FYVB 3TI0A 2B0GA 4LT6A 3W65A 4K4TA 4ZVGA 5HLFB 3MHYA 1JLQA 2WW8A 4YHHJ 3CC2S 1WF0A 3AHPA 4EYIB 1NHVA 4QWEA 1U1OA 1AT1B 2HRUA 2WOMA 4P7TA 2R7UA 1RYSA 1VQ7S 4M5IA 2LFVA 4OZ2A 3ZZRA 3CF5Q 1S10A 2UUWA 1R8AA 1Y5IB 4JB8B 4MJKA 1HNIB 2YQ1A 2HBQB 2UUCF 3D1QA 2IDLA 4B9UA 2NREA 4LF5J 1S5ZA 3LWLA 4IFYB 4JBCA 3KYLA 3BO4A 4YQWA 2HFSA 1I6JA 3P8BB 4LFAJ 1MNEA 4RW7A 1RCOB 2VPZB 3CCRS 4CLFA 3S7RA 4RBVA 1HWUA 2HGNA 1TMJA 2V68A 2ASDA 1JJ2R 4A8KA 4H4MA 3P49B 1ZZFA 3MPDA 3T19A 2FHJA 2ZH2A 1U0HA 2B4PA 2B4UA 4J9VA 4C8ZA 2DGXA 3G8TA 4O4GA 3ET6A 1WKLA 2ZH7A 4PZVA 1T8EA 1SC4B 4QPXA 4OI0A 3SDEB 1J5EJ 1GH8A 1REVA 2EW9A 3MCOA 5MAOA 2HBZB 4P75A 2DCUB 4DQIA 2BE7D 1NJIT 3IGVA 4PQAA 4R8UB 2RKIA 4NA3A 3ITHA 4HHJA 1NPPA 3FC9A 1TKXA 2ZFHA 1FERA 1HWIA 2ZH4A 4UY8T 4EFAC 4YUDA 1AZSB 4RO0A 5D0GA 3R9LA 1T7PA 1P9YA 2BJ7A 3GSDA 2XYHB 3VAJA 3SI8A 3CDEA 3ZZTA 4MK8A 4B3MJ 2DR6A 3MR6A 2MGZA 2M70A 5AXMA 1X60A 5B0BA 1VC6A 1UP1A 5K9FA 2VFUA 2ZBRA 4K2JA 2HHHJ 1RTDA 4C3KA 3TUJC 2C28A 3FBBA 1R0AB 4ZPTR 3SQGB 3VTIA 1U45A 4B9MA 2KT3A 3MMAB 1PIEA 2ZITA 1VQLS 4B3RJ 4OYWA 2KG0A 2RU3A 1RA7A 3THTA 4DJBA 4BDPA 2Q6CA 8AT1B 3MM5B 1UVLA 4ICLB 4G1PA 2GAGC 3MM9B 1L5UA 4NYPA 1GTEA 2DGWA 3T6BA 1B3TA 5A8WB 3BN4A 4WFYA 2J9DA 3THPA 3QWUA 2MLYA 1EQMA 1IKVB 2HS4A 3Q8SB 4LRDA 1L3TA 2JOQA 2QX0A 2VDHA 2E5IA 4Q8FA 1F5AA 4IH5A 3Q2SC 1HA1A 3MEEB 2XI3A 3BB5A 1HBOA 1FKPB 2HFNA 1RAIB 4F2RA 3QYYA 1HHTP 3DN9A 1WC5A 3ILIA 3FVYA 3MMCB 1JKHA 1NSKL 2CAJA 1D9AA 3M1VA 4Q5VA 4UY85 4JI1F 4M95A 3BPSP 2DGTA 3D0IE 3MEGB 3H5XA 2EXUA 1QE1A 2YWGA 1OWXA 2GVZB 3HHKA 2OH2A 4HACB 3NNCA 3PXGa 2YKNA 4A8MP 5KFIA 2C42A 5A2QY 5JMNA 2AJ2A 1RHJB 1V5VA 5KFCA 1D9FA 2RRNA 3DOLA 2XS2A 2R7VA 4WWSA 3GYXB 2HVHA 4QWCA 2QRRA 2E66A 3MPYA 2FJWA 2R2RA 3V4IA 1J27A 1NK4A 4IQXA 4PG4A 3MZIA 1HL6A 4IR1A 3RAXA 4NCAA 3PACA 5B0AA 3GSIA 1ZTTA 1C0UA 5CA5A 2ERRA 3I0RA 4WIIA 3H5SA 1RJJA 3NGTA 1DQ8A 3K5MA 1EB0A 3FRZA 4MTPA 3G6XA 5LMNJ 4I6YA 1QAIA 5KFMA 2AJ4A 4Z37A 3V6DB 5A76A 5E41A 3M8YA 1RAHB 3DGPA 4ES1A 3A8KA 4RNMA 4IFVA 1NKEA 1JNZB 2CPZA 1QTMA 3GPAA 4LFCF 3EPGA 4IOCQ 1SJQA 4EEYA 3KFWX 1RWPB 4TLQA 5GVQA 1FHTA 4CT9A 2UUBF 4DDFA 1A9NB 2P9GA 3D68A 3P5TL 1CC8A 4NLDA 1FRHA 2XNQA 4PXCA 1FD8A 3QT6A 4A8FA 2OPQA 1J2VA 3I5CA 3SCLE 3KLHB 4RBUA 1R0CB 4DV0F 4RKUC 4NZ6A 4DLGA 2EFQA 5LT5A 2W1BA 2GIQA 3TJ8A 3KDNA 1ZPVA 2JC0A 3JS9A 4K4ZA 4MMOA 3DRSA 3RRKA 1MN7A 3LTOA 1CBKA 3HHEA 2U1AA 2COLA 2AYMA 1MW7A 3QJPA 2HNDB 3I31A 3G9CA 3ICLA 2CPFA 5DGBA 4G3IA 1UFWA 3IGNA 4QBUA 1F5BA 2VG6B 2K1RB 1S1UB 3PYGA 1UJ5A 2DIUA 2V63A 1ACMB 3BGUA 5BYQA 2DISA 2DXDA 4I69A 1AROP 4DV1F 2MLZA 2ZOGA 1K9MT 4ILMA 5H9FJ 1PJ5A 1NDPA 1U0HB 2KXFA 3QIDA 4NCGA 3L7UA 5EUHA 2CJAA 5J1PA 3Q8UA 2GMHA 3M8SA 3BBFA 1VRQC 1NAQA 4B9SA 3D2WA 1REVB 3OLAA 2W9CA 1RWUA 1T3OA 3RB3A 2FY8A 2AJFE 2QIFA 2XZTB 4H4KA 2BUNA 1M1GA 2CPYA 1U6FA 4LF7F 4DV5F 2XLJA 2YNIA 1KKHA 2CPHA 2KHCA 1LK5A 2AX0A 3ZFVA 1HLWA 3FMBA 4A8XA 2BJ1A 1N88A 1S77D 3H4DA 2Q79A 3HXMA 3DLEB 3X3UA 1P9QC 2AEMA 4JI2J 4G1QB 2RQMA 4EWTA 2ASYA 2J0QD 4ZLNA 2VL1A 5KFUA 1RE1B 2B9WA 4ED5A 4ED8A 1APSA 2B7CB 5KFHA 4EUVA 1WOSA 3UCUP 4MKAA 2B56A 2M0GB 3GCXP 4LSLB 4U8VA 2FJBB 1UPPA 2YTCA 1RP5A 4YHHF 4IRCA 4NMXA 4C8KA 4PR6A 3IRWP 1IBLJ 2V2VA 3NMAA 3N9UC 3DU6A 2GMJA 2ZH5A 2OFHX 3MAAB 2D3ZA 2DTJA 2DITA 4RNNA 2F4FA 4ED2A 2RUGA 3LPYA 4ZA1A 1K8AT 4X4OA 4P7VA 3JTNA 4OHZA 4ZHRB 4X84A 3CD5A 1Q0NA 2A6MA 3PV8A 1WC3A 3M7VA 1HBOB 1VGYA 3R5GA 4OZ1A 3CVKA 1DHMA 4DG1B 2V9WA 4LF5F 4PQUB 2ZHBA 3K58A 3ZO7A 3M1VB 3CCMS 2OEJA 4L73A 2HSEB 3KHGA 1LEOA 2BKPA 3KJVA 4LFAF 1BGXT 5IS2A 3DRYA 1FT8A 4C7QA 4TXSA 1C4CA 3NL0A 5ETQA 5DZ7A 2XMKA 2K3IA 3T1AA 4KRWA 4GC7A 4LREA 2H54B 1S76D 4FPIA 2MEWA 2AZ3A 3J81Y 1BXNA 1JLBA 5KFYA 1HYSA 3J80Y 1VQNS 4LUBA 3G82A 3VVUA 1MWYA 1S1TA 4BWMA 1ZETA 3GJTB 1O6XA 3R97A 1J5EF 5E33A 3AB2B 1EHWA 4ERDA 3V4IB 2HHPA 3ILOA 5IM0B 3LAKA 3CWJA 3LO3A 1QAYA 2C2OB 5BYSA 2UU9J 2E7WA 4EBCA 4YB1P 3ZZPA 2DEIA 4K2XA 2Z0GA 4NA1A 5KT5A 4K0KJ 3CJ2A 4I2PA 1IXKA 1IBMJ 5GAGI 3GONA 4C48A 4B3MF 4KR0B 1KVKA 1HQUB 3RBXA 4NASA 1JJCB 3DGPB 4DX7A 4KAIA 3KLVA 2OTJS 3QPIA 3JQMA 4C8NA 4PXBA 4X4RA 2MHNA 3GV8B 2HHHF 3VR1A 4KGXB 2IJNA 7FDRA 1YX2A 3IXQA 2POKA 2V50A 3S8SA 1JLCA 3OSNA 3TARA 1GX6A 4B3RF 2OPQB 3UI3A 3TUPA 5HP1A 3E8OA 1VIOA 4LSZB 1YBUA 3T5JA 2E29A 3FNNA 4F3OA 4PKDB 5DQGA 2CPJA 4IOBA 4J37A 1V5IB 2G2ZA 5KFKA 1VJWA 4EI2A 3MPUB 4DPYA 3QSIA 5DS7A 4ZN1A 2XYGB 3DOMB 3C6UB 2FVRA 1NJZA 3BYPA 1WF2A 4Q44A 3QIPB 3Q24A 4V1Ak 4ZPVR 3B4MA 4WFXA 3GE9A 2XCPA 1WOOA 3AQOA 5I42A 3MDFA 1AB8A 4ID5A 1N5TA 3ETMA 3H5UA 1WORA 4M1KA 4OV1A 1XMOJ 4HEA9 3W1YC 4DN0A 1TL7A 2R2SA 3E01B 5ETPA 1IBKJ 2KKHA 4J9RA 4DR3J 4I56A 4KFBA 3I4HX 4HLBA 4ES3A 1RTHB 2FLNA 1CJTA 2ZZNA 3PHEA 1W2IA 5AE2A 1U2CA 4U7CA 2FLLA 2I5JA 2I38A 3TNVA 5IC6B 5J2QB 4ITSA 3H42A 2AGOA 2M52A 2DNKA 2PE8A 1BQXA 2XCAA 5LMNF 1FWPA 3K89A 1S1WA 4AL6A 2L48A 3RR7A 4UQGA 4CCHA 3F0NA 4F4XA 2QYCA 3O3LA 1X4GA 4LVOP 3J7YU 3SYZA 1BLUA 2KFYA 3DLLQ 3D1HA 3X1LB 4JI3J 1K73T 2HIYA 2UVWA 1RAAB 1REGX 5CYQB 3TO8A 3JSBA 1NJXA 4OV6A 2KU7A 2ROPA 2B4VA 2RSQA 2IFXA 3M2RB 3TQ1A 5AE1A 4F04B 3OHBA 2NXEA 1SJ4P 3DDNA 2W4DA 2L41A 2CJKA 3D1OA 3SBMA 2NUUG 2MKCA 2UUAF 4ZVSB 5DDRC 1XK8A 4J9NA 3B4DA 3KJVB 4K5RA 2F8MA 3EDRB 4ECTA 7FD1A 2MQLA 4MKBA 2G0IA 1NZAA 4ZVTB 5F3ZA 1YJVA 1NSPA 1OIAA 4M5GA 3TX0A 3JSRA 2Y0SD 2PA3A 2OAUA 5CCMA 1RK8A 5K14A 4I0WA 4DUZJ 2EFOA 1S1TB 2MHEA 3D5MA 3HHLC 4PUOA 2DH9A 3FBFA 4YY3J 3GIKA 5A8KA 2RRAA 2RS8A 1U0SA 4NPOA 2OEKA 2KJVA 1U4BA 3PYDA 1R8BA 1EJ7L 3I5AA 5HQ8A 1VS3A 1N32J 1U09A 3M9NB 2H9ZA 4J9PA 3PX0A 1S72S 3KLIB 3SCKE 4CYUA 3N5FA 2LEPA 3MURP 2OLWA 1HNXJ 3OL8A 5M2RA 2B9EA 2GAHC 2BOPA 1Q86T 1CSJA 3LF0A 1DTTA 4JI2F 4ED7A 3RRGA 2MQ8A 1N33J 4TYBA 3OTEA 4F2SA 4QYZJ 3DRPB 1T9UA 1W7WA 3IG1B 2ZE2A 1U26A 4IH7A 3CDAA 2C3OA 2R8HA 4LQ9A 2C3YA 2XM3A 4A46A 3UO0A 1XC9A 4K4VA 2MSTA 3QWPA 4MFBA 2VBXA 1HPZA 1ZOTA 3ZTQA 1DBDA 2JRSA 2C1EB 5B7WA 3POTB 2DH7A 2OIHA 5D4LA 3CCLS 1IBLF 4R5PB 3KHHA 2D3O1 2VFSA 3DRRA 5HL7Q 1KQKA 3KUHA 4O0NA 3CUNA 1VRUA 4ZPCA 3ZTOA 1U6BA 3RG6A 2C2EA 4F36A 4FN5A 1Q1KA 3O44A 5KFTA 1M5OC 2MKYA 3AAWB 3KG0A 1G1XA 2HGMA 1QSSA 1MWQA 1F9FA 2Z2YB 2YX4A 2DEJA 4UZCA 4PWUA 1BQMB 3GILA 1RBOB 3C66A 3JB9k 2VA3A 1M1KT 3PW2A 1LW2A 2E1MC 5HMZA 2WHOA 5KT2A 4OYXA 1RLDA 4TNOA 3T1HJ 1JMTA 4ZVOB 1TKZA 2E5LF 2DPIA 2GQCA 1T05A 2YWFA 2F4VJ 4C98A 1E6VB 2XLKA 4P52A 3QGIA 4B3TJ 2HHXA 1D09B 4ED4A 1WG1A 5HMXA 1UEKA 1FTCA 3T9ZA 3DCAA 5A6PA 5KFFA 1RT7A 2FVCA 2ZKUA 4TN2A 4WFAQ 2AYBA 5GAHU 1JLAA 4YR2A 1CS4B 2I5JB 4A48A 1SIZA 2W2QP 2ZBCA 1FRMA 1HI8A 1S1XB 4URQU 2UU9F 1CC7A 2RNEA 2WVCA 4EMDA 1PJ7A 4K0KF 1IBMF 2XWXA 4DQPA 2LYVA 2ZOFA 4CO5A 4ES2A 1HNVA 3W66A 4DV2J 3EE3A 2D3OR 2PT0A 1WKKA 5IXUA 4X62J 4J9QA 1C4AA 3MWBA 5AXLA 1YWXA 1O0PA 1F9EB 4DZDA 1KOOA 4C3MA 2WTFA 4NLGA 1RT4A 2FHOB 1QSYA 2V2ZA 4B3OA 2BABA 4ELUA 4DOZA 1IR1A 2QN6B 1IVZA 2V8HA 3PZPA 2RF2B 2VODA 1FWLA 4FVCA 1URRA 1S6UA 2N82B 3KUGA 3KUEA 1YJUA 1PYTA 2E1PA 2HS3A 2CQ2A 1R89A 1X4AA 1LFPA 3GIJA 3IN5A 3PFOA 5D77A 4WE1B 3Q0AA 3BQ1A 3DLGB 3SV3A 2W9AA 1NK0A 3TVKA 4NI2B 1X5PA 3FSXA 1Q81T 3R2DJ 3M30A 4WFNQ 1NU4A 2KRRA 5D3GA 2CG8A 5DG9A 1Y11A 1NH7A 1RQ0A 2NXUA 3AJ2A 4P2XA 1WC1A 1NNDA 4QIEA 2YNHB 4BBYA 2EK1A 1T9WA 1U1QA 2IBOA 1VC5A 4PUOB 1AFJA 5A8KB 2KB2A 2FHMA 3CPWR 4QWAA 1U6ZA 1D3WA 1OMSA 2MZSA 4CQ1A 4A8WA 2YPYA 4ETXA 2HHTA 1QDUB 5KFRA 2R8IA 4RW6B 4P71A 1XMOF 3BKTA 5E3PA 2F5GA 3F41A 4ZMMA 3US5A 1R6YA 3ZZZA 1IBKF 2DY9A 1IJFB 1YBAA 4WZQA 4CYUB 2HRTA 2WAQD 3HHDA 4DMZA 4DR3F 4ATNA 1S0NA 5F41A 3IR6B 1U49A 2FGCA 2IYGA 3E51A 4DU7A 1DTQB 3PIPQ 1NCLA 1DTTB 4XAKA 2HVZA 3PJ9A 3B54A 4RPFA 2XHWA 1NPKA 4MK7A 1PG5B 3M6UA 5BJRA 3CJ0A 2HAIA 1RZMA 1FRXA 1R6VA 4HH0A 1F5CA 2M3DA 3C3LA 1XJWB 3AH6A 5CYMB 1HPZB 2VC0A 3D6HB 1NLKL 2OMLA 4B08A 4E0DA 1CULA 2VHGA 2CA9A 2ZKTA 2LLZA 5CQGA 2IHR1 1KVJA 4QIFA 3IP0A 3QZ8A 1QUVA 2JJ4D 3UCGA 4JI3F 3PR5B 2FC9A 2V0NA 2O5DA 2MTLA 2OPSB 3QMQA 2HFVA 4X2BA 5LSOA 5J2MA 5IFMA 1WHWA 2MKJA 4C8OA 2CJBA 3N4WA 3D4JA 4DUTA 2HYIB 1HW9A 2I8EA 3BO2A 2WSEC 2HWTA 1Y5LB 4B9LA 5F3TA 2WW4A 3MM6A 2CZ4A 1D9DA 5T7LB 4DR7J 4GO5X 5FIIA 1X5TA 3PX4A 2VKRA 1N5YA 3VQSA 4TU9A 4A8OA 4Y34A 3ZZOA 3MMBA 4P2FA 3PM9A 3BGRA 2H5IB 1BUXA 3BQ2A 3KXDA 2YKPA 2QT7A 4P73A 3JQKA 3MEDA 1HMVA 1TKDA 4OJ3A 1BQNA 4DUZF 3QRQA 4USKA 3LP1A 4DCPB 2KZZA 1NM2A 3W2VB 1K1SA 3VVTA 1H2UX 3CXCR 5GADI 2VPYB 3GB0A 4BWJA 4YY3F 3UD4P 4N47A 4RNHA 3A13A 3MUVP 5M2PA 1EETA 3NS7B 1JLAB 1LQ9A 4DSJA 5KFXA 4LR8A 5J2NA 3CC7S 1N32F 4Y2AA 3CC4S 3R8YA 1AYEA 3MI7X 5KFOA 1F2HA 4NLPA 1HNXF 4DSEA 1VC0A 3KK2A 2ZJRQ 4DL3A 4DBQA 1F0XA 1Y9OA 2YWEA 4CLWA 2GX8A 2XSJA 3TAQA 2XLIA 2DR8A 3C19A 1QLNA 2FPHX 2ZH1A 3PW5A 1LW0B 1M5PC 4UT4A 1UWBA 5CHCB 3Q8VA 1TFWA 4KY3A 5A8RA 2LU2A 4OYZA 3KLFB 2M8DB 1N5SA 4AD6A 3ZC4A 3VAKA 2DHXA 2QMXA 1D8ZA 2IA0A 2EVZA 1XQIA 1RB0A 2NYHA 3MD3A 1ZAVA 3BV8A 3SQOP 2DGQA 3OUYB 3QO9B 1LNQA 4C0BA 4TYAA 1JX4A 4M5JA 5F9NA 5D8HB 3FFIA 2BVZA 4IKAA 6FD1A 3K8VA 5KG0A 4OJGA 3G96A 1G7CB 2MLXA 3SSSA 3IRXB 4OYAA 5U47A 5DJBA 2D69A 3CD7A 3MPVA 1KVIA 1TUVA 3R5DA 2IIHA 2OHDA 1V3ZA 1GXTA 2DK2A 1VQ8S 1SH3A 1VCTA 2E9ZA 1TUGB 3T1HF 3TA2A 2F4VF 5L39A 3V5RA 4DSIA 4B3TF 1WEZA 1YGYA 5DM6Q 5ETOA 3TWZA 3RYLA 3GIMA 3GJQB 2FC8A 2OPRA 3HX9A 3N6MA 4A47A 3DMJB 4TKTA 5LSLA 4CLSA 2X7IA 2WVDA 4H4KC 2QSFA 1PAEX 3HVWA 3OR1A 3EX7B 4ZVRB 5LMUJ 3H4BA 1OQ3A 1CJKA 3MECA 2C2DA 2GFFA 4WBFA 2IDEA 3ENWA 5JVHQ 4ZPAA 3MCSA 2FJDB 3CCWA 3GYGA 2NPFA 3H8YA 1SIWB 3VAIA 5CAAA 1N52B 2Y1IA 3DYAA 4QQBA 5BYRA 1U1KA 4ZLPA 2GV1A 4UF4A 3V6HA 4DV2F 3TAPA 1IKXA 1CPZA 2QV6A 5DZ6A 2CUYA 4X62F 3UW1A 3TZYA 4NLUA 2B51A 2AF6A 3PCOB 1WI8A 2PGCA 3MM8A 1SL0A 2ZJPQ 2H5JB 2C2KB 3DLKA 1MMLA 2Q66A 1ZM4A 3BSNA 1VQ4S 4K4SA 1NMEB 3DGVA 2VASA 4XK8C 4DR6J 3ZXWA 2E5JA 1CJVA 1RT2B 2PD1A 2G2YA 4LIRA 2E5HA 2JVRA 1XBWA 3PJWA 5ETNA 4CRJA 4PCQA 1F3VA 3AD9C 1MN9A 1YZ6A 4K4WA 2R4FA 3KLEA 1UKUA 2CQCA 2MZJA 3AJDA 2EC2A 3V2UC 4USUA 1VHFA 4DR5J 4WFZA 2GGPA 3C16B 4L72B 3M2VB 2DGVA 2ZZMA 2WCXA 3QFHA 4DI6A 4GVBA 2QE5A 3G8QA 3CCES 3GTYX 1RTJA 1HMVB 2KI2A 1GFWB 5KFGA 4YR3A 4F50A 2CPDA 2WONA 1R8CA 3QRPA 1G2EA 4CO2A 4LF9J 5H1SV 2NLWA 4MYUA 4JV5J 4FXVA 1VQOS 3EZOA 1GAOA 2XHCA 5HMYA 1VQ5S 3C15A 3LPEA 1EETB 4EO8A 2XY7A 2HNYA 4IDKA 4FYXB 1FKOB 3JSYA 1QJHA 2OJ3A 2Z4PA 4EZ6A 1FDNA 5L38A 1DY3A 1RUSA 2QG9B 1YRTA 3HFZB 1F9HA 1M5KC 2YKMA 4DR1J 3PX6A 1BD6A 1Y0HA 4X66F 5F0UA 3C14A 2D9OA 4RW8A 2IC3B 4CO3A 3NY0A 2KTQA 5F8LA 4O3SA 3R1HA 2H4WB 3NCRA 2ADCA 2BJ8A 4HKQA 3CJTA 3DHXA 1UWBB 3D7SB 4DFPA 2GO9A 4KTQA 5H9EK 4ID8A 2KL8A 4OI1A 1DJ0A 4ZIVA 2L9WA 1U2FA 3DOKA 4QZVB 3HFKA 2YNGA 2M5YA 1N5QA 5I3UB 3O6QA 2DR7A 4B9VA 3UVJB 5KG1A 1WNEA 1OY9A 2PSZA 1C0TA 1S9EB 1VQ6S 1FEEA 5C25B 4A8SA 4LMZA 4DPTA 3PRDA 2J7WA 2Z8QA 3GG0A 3K57A 3FFIB 4XPCA 3BBCA 1U1MA 2W9BB 4MK9A 5G0RB 2D9PA 5C24A 1H72C 2Z2LA 3PEJA 1RT1B 5C42B 2FY1A 3AOCA 4DR7F 1MLAA 3NLCA 3KKFA 1LWCB 3IO1A 2AGQA 1WHYA 3J7AN 1P1TA 2FZCB 2GMLA 3RGIA 4DXLA 2I0XA 5BR8J 1RXOB 5E3AA 3AY0A 1HI1A 1H73A 3PYFA 5IT9U 2PDAA 2W2OP 4MIBA 5SZTA 2M7SA 1WUUA 3IBFB 1SKSA 1H2TZ 1CVJA 2HFZA 1VLOA 3HVRA 4KO0A 4B9TA 4U9RA 1KOHA 2W7AA 2J7KA 3CD0A 3MECB 3TZXA 4OX7A 4C8LA 3WC2A 2R7QA 1WACA 5HO4A 2GVDB 2IVFB 2FJVA 1RADB 3GYNA 2PN6A 4M5DB 1SV5B 3MR7A 1NRKA 2HQFA 1UFKA 4YMEA 4GC6A 3DYAB 2CG4A 1RBLA 4CO1A 2ATCB 4N41A 4Y2KA 4IRDA 2QLJB 2QGFB 2IVYA 5HLFA 5KFDA 5E3CA 1S9FA 5LL6d 2XZDB 3UD5A 1NDCA 1S1VB 1DRZA 2VIHA 4F25A 2RAQA 3I9V9 1N36J 2PC6A 2BR0A 2QJ3A 2FJEB 1WEXA 2OSRA 5JUMA 3GCWP 4ZVQB 1TKTA 4R0JA 2N7CA 4N77A 4TVAB 4LBHA 1HNIA 1K47A 4BC7A 9ATCB 2CNLB 1VFJA 1T03B 2OTLS 3QGPA 2DNYA 2LQ5A 3DM2B 4EZ9A 4EYHB 2VG7B 2UZAA 4RU9A 2AW0A 3UR0A 3KLEB 1FXDA 2C22A 4NXNJ 3EICA 1YHQS 1Q7YT 3IBCB 5KFEA 2K8GA 1VK8A 4GVBB 1LWFA 3FJ2A 2IJRA 4FS2A 1TK8A 5EX0A 4NMLA 4P9SA 1VQSA 2IAJA 2OUGA 3OL6A 2CPXA 1FKAF 2K2PA 4LF8F 3SDEA 2UXDF 3HJVA 4JYAJ 1HBUB 3U1MA 3PO5A 1PBAA 4CH1A 4RZRA 4EBEA 1N6QA 2VG5A 4R8UA 1JXEA 4CP5A 4IG0B 3PY8A 3QT8A 1PKUA 1SCJB 1XNQJ 3H25A 1T9YA 2B6AB 4O3OA 5DDPC 1FRIA 3D66A 3NNAA 3BREA 1N48A 1BC6A 3FCHA 4RW8B 3MCMA 1H7WA 2YVSA 5FLXU 2DO4A 1H38A 1PC5A 1SUQA 4DL4A 3O5TB 1S6QB 3OVBA 4J5OA 1R0AA 2UUBJ 3SQGA 2XC9A 1QUPA 2L9NA 3FGVA 3FSYA 3MMAA 1KBRA 4L74A 1FDAA 2FLPA 2XQCA 2ZWPA 2MJUA 4FP9A 2HZCA 3L09A 1YJTA 4DSLA 3G6ES 1M5SA 3OR2A 2ALYB 3MM5A 4ICLA 2KYZA 2DB1A 2BJ3A 2MXYA 3MM9A 1BWVA 4G6VB 4FKYA 2CADA 3RW7A 1AUDA 2WB4A 1VBKA 5A8WA 1VQPS 3H90A 2EFPA 1XMBA 1FXRA 3FSIA 1IKVA 1QSLA 3M6WA 4IH6A 1X9WA 3KNAA 3TVYA 3PTWA 1V3RA 4J7CA 3C6TB 4N7TA 2E7VA 1IM6A 4WCEQ 2R8GA 1SL1A 3A1YG 3TRGA 1UWAA 3MEEA 3WZ0A 1SQEA 1Q5YA 2N4CA 1FI4A 1FKPA 1OPZA 4DLEA 1JIHA 1QAJA 4USVA 3MMCA 4GRSA 4DPOA 4NEZA 4JI6J 1VBXA 3IM9A 4F67A 4LRBA 4K8RA 3TEGA 3MEGA 2CQGA 1Y7PA 2APOA 2JEIA 4DR5F 2WBMA 2G1HA 3KHRA 2I2YA 2HBRB 2V4JB 4HACA 1SVDA 3DHWC 3LAMA 1YK9A 2B3TB 1X4EA 4DV5J 1XIQA 3CJSA 2BACA 1J5OB 2KT5A 2X1GA 3BR8A 4LF9F 3KLGB 3CCZA 3W2WA 4UOCA 4F4WA 1IM4A 2CDRB 3HVAA 2WK4A 4JI5J 3HCXA 1AXQA 2VOOA 2PMZD 3FK4A 3QLHB 4RX6A 3KNGA 4ANDA 4Y65A 3RUBL 4CLLA 1S79A 1WJ9A 4DX6A 2DRBA 2ZH6A 4MYTA 4ILLA 2JLEA 4ZITA 4DR1F 3BDPA 3V6DA 3PYEA 5FJ4A 2VJVA 2R2UA 2DRDA 4DV6J 4DX5A 1FA0A 2GHVC 1YI2S 5HBMA 1EP4B 3HHLD 1TR0A 2XG8A 1NK7A 1VHIA 4GKKJ 2VFTA 1OSCA 3TJAA 5KT3A 2QFIA 4PG5A 1VQKS 1TKTB 3VZIA 2CVEA 3KLHA 1E6YB 4QOTA 1QVGR 4KH0B 1ICEB 1NH8A 3NKYA 3LW5C 2OO4A 1YJNS 2YWKA 1QM9A 1F1BB 5D78A 2MJNA 1T9TA 1SQGA 4NLRA 1KR4A 4Q7AA 4U8YA 1ZBTA 4O44B 2HNDA 1U8SA 1XWLA 3NP5A 4R0EA 3CMES 2J8AA 3SSQA 3OTOJ 2DR9A 2VG6A 2K1RA 1S1UA 1D0EA 1UEVA 4ZP7A 3F44A 5HVHA 2B4OA 5EWEA 3DI6B 3ONQA 1LWFB 4WTOB 2YPZA 4S0MA 1MSWD 1FJGJ 3OQ2A 1RISA 8RUCA 2GS8A 2IAJB 2Y8WA 3CJQA 1VLYA 4OL8A 3K2YA 5CABA 3DFEA 3ZNJ1 3HD2A 2ZUGA 4LFBJ 1JB0C 5BR8F 1RWKB 3GIIA 1N6QB 3SCIE 2VG5B 2PI5A 1RWOB 4KBIA 2VUGA 4F4YA 5B08A 1UJ4A 5C2CA 3LGMA 4I68A 2JEGA 4ZN3A 2D3UA 1GMWA 9RUBA 4U7UK 5G4DA 1S57A 3Q22A 1B4SA 4M8LA 2OPPB 2RHQB 1ITPA 1S6PA 1NBEB 1S7HA 3DLEA 1WTFA 1VIXA 2KZMA 4Y2MA 3UE2A 5L9NA 3LGHA 2CPIA 5D6GA 4G1QA 4OHXA 3G2XA 1NK8A 2YNFB 2Y1JA 1SUQB 1KFDA 3M8PB 1T9VA 4J90A 3THVA 5LOQA 4K50A 2EWHA 1VR6A 2MQQA 2EEYA 1WF1A 2NXNA 3M8QA 3M8WA 3CJRA 3OVSA 2K06A 1HD1A 4LSLA 1X4DA 3CD6S 1FX2A 1BY9A 2JZ5A 3OR2B 5L46A 3MGJA 1TL1B 3CIZA 1IKWB 2HEKA 2N3LA 2DNPA 2QC3A 1C1CA 1FRLA 1GTHA 4NRUA 2YH0A 3EXYA 4PAAA 3MAAA 3K7RA 2WB1D 2PIIA 1N36F 3BS9A 5FDLB 4JV2A 4WIQA 3D28A 3P3DA 1ELOA 4RW4A 1FRJA 2BJEA 3VGVA 4ZHRA 3OFFA 2DY1A 4YFUA 2IBKA 5IT9Y 2AHOB 3HVTB 4AFFA 1KC8T 4V19X 2R7OA 2RRBA 3EMTA 4DG1A 3KJQB 4PQUA 1X5SA 4MIWA 1WDTA 3HSGA 4NE9C 1HNWJ 4XDDA 2ZBPA 1RHRB 4KPCA 1YQHA 3WHIA 4DSFA 3MD1A 3L3CA 1OJ4A 4NXNF 3A12A 4Q43A 3VAGA 2R7SA 4JP8A 3RR8A 1RTIB 4JV0A 4TQRA 3ZTPA 1S12A 4O3NA 2ZJQQ 5K8MA 1NB2A 4WK1A 4I6AA 3QRRA 5HN0A 2YX1A 3GIRA 1SC6A 1OPIA 2CQ0A 5E3QA 4ZIWA 2J5AA 4KQZA 2PEHA 3W2WB 2O3DA 4PABA 4JYAF 4MH8A 2VJUA 1Z2ZA 4KV8A 1DAXA 2XGPA 4FF4A 3KK3B 1NSQA 2AD9A 5IM0A 5DGAA 4OMFG 4QJVA 2HQIA 4KGZB 4XDCA 5M2UA 2J9EA 2R7WA 2YY3A 4F3MA 5EDWA 1I94J 2FUG9 1TL4A 1XNQF 1NZ8A 1SXLA 3EVWA 3IWNC 3QQCD 3KJNB 1NJWA 1H0HB 3LUYA 1HQUA 3TZWA 1YSJA 2FTRA 2N4DA 4NOHA 2ZBQA 3MAHA 3H0PA 3BSOA 3PKYA 1JLFA 2CNNB 1GXLA 2XSFA 4NYZA 5HBMB 5KOWA 1OQ6A 1CG2A 3BR9A 1Q8LA 2FHJD 5DG7A 1RT6B 1H3DA 1R3NA 2G4BA 3NWRA 5D4OA 1W25A 3UWTA 2HAFA 2V94A 4ZCLA 1HBMB 1KD1T 5ETSA 2RDIA 4DN9A 1SL2A 3SFGA 3TUIC 5L1KA 2FD2A 2ILZA 1VYAA 1XR6A 5KG5A 3T5KA 1O5JA 4XO0A 4UQTA 4ZPDA 2UUAJ 5HROB 4IRKA 4X4TA 4L3NA 3M32B 1Z4UA 5ETKA 3R7BB 1MWZA 2AKWB 1NB7A 4NLWA 1YJRA 2MMYA 3C6UA 3DOMA 3W5ZA 4F02A 2WVEA 2AYEA 3U1NA 3RW6A 4I1TA 3CJKB 3F73A 4LQ3A 2PFDA 3GP9A 3QIPA 4X65J 4USJC 4JI6F 5HATA 4PG7A 1XNRF 1D1UA 1FFGB 1YBTA 3EDQB 5FLXY 2XMWA 4USHA 4CM2A 2KXHA 5D0EA 3ZNUA 4RUBA 4BLGA 4OX8A 2GO8A 2BA9A 2LA6A 2BOAA 5CXTA 2H48B 4FF2A 5ETTA 3E01A 2X51A 3GMGA 3R5BA 4YB5A 5KFWA 1JQGA 2C3UA 1HWLA 2DCLA 3A3OB 1RTHA 1HNZJ 1S6PB 1S9GB 4JI5F 2BW7A 2KH9A 2SXLA 1K44A 3ZZUA 2GQQA 2H1YA 1UVKA 1XERA 2JWNA 4YDXA 4ZJLA 5J2QA 3NMRA 4FDFA 1VBZA 3MMJA 2Z58B 3M8ZA 1RA6A 2ZNZA 5KAKA 2UV8A 2XS7A 3M8QB 3L95X 5KG4A 2XS5A 4PWWA 3K5OA 4DSKA 3DDIA 5KFSA 4HHUA 5T14A 1FXLA 4DV6F 4LBIA 2YQ0A 4WYLA 4CLYA 5KG7A 1C1CB 3OSPA 1S0VA 4FBTA 4GKKF 4ECVA 1FNMA 3EWGA 4ECWA 2J8SA 2WRMA 5GAEU 4Y6IA 5CYQA 2B8PA 2DD8S 5A0YB 2ACYA 4UOFA 3H5YA 4RW4B 3R7NB 2BYCA 5HJXA 5FD1A 5CD4H 4YDDB 1R7IA 2DNQA 3M2RA 1U7LA 1L3KA 1LOUA 3CCQS 2LA4A 3OLBA 4WFBQ 4KYZA 2LXFA 2RJZA 2AZ1A 3RRHA 1B64A 2IVMA 1YJWS 2WSFC 5A2QU 2ILYA 3OTOF 1DLOB 3BGFA 2P5VA 1HR0J 2E5LJ 1R8PA 4DR4J 2DXFA 2BBEA 4J91A 3GFZA 1FJGF 3M9MB 1VBYA 3OXGA 4DS4A 3PEHA 1WSVA 2VPWB 1HBNB 4FZVA 2NR0A 2HNZA 2PFFB 1XEZA 3CDUA 2V8VA 2W2MP 3NBPB 3T6JA 1FFWB 4ECYA 5KFJA 2HPUA 3MFHA 3K8WA 5L9XA 4Y3CA 4X64J 3FQLA 4KV8B 4LFBF 4LSNB 1X4BA 2C2RA 4L76A 2FGOA 4JUZA 1QAXA 4OHWA 1TAUA 1ZYQA 4X4VA 3KLIA 2I6WA 3P6YC 4UOHA 3TZZA 1DARA 4FS1A 1Y5NB 4FYWB 1EZZB 2ZNYA 3E3XA 5DDQC 2Y3YA 4ECRA 4YS2A 4I6WA 2V5HG 2B8QA 3N5BA 4RJVA 2BV3A 1JLFB 5SUHA 4C0OC 4KJIA 2IRYA 4DQQA 4RNFA 3DRPA 4JI8J 4KKOB 3IG1A 2W7OA 4E98A 5KFLA 2ZC4A 4DU8A 4USMA 2BE2B 3NGRA 3TJ9A 2PA8D 1W26A 4OZ3A 2ZWOA 2QZ8A 1ZM9A 4J9UE 3POTA 2FIUA 2HQCA 4H4OA 2P6SA 1OY8A 4R5PA 2JX2A 2HHWA 4QWDA 4WKYA 1EX8A 2BDPA 2J7UA 3LH2S 4DR2J 1NXIA 2X1AA 3AQPA 1FNOA 1WWHA 3KK1B 5KOXA 1IR0A 1AW0A 4QR2A 4ECZA 1PAUB 2F65A 3FQKA 2EFVA 2CQHA 1SH0A 1WTBA 1BQMA 3GU0A 1BE4A 1TK0A 1HNWF 2HHVA 3GFHA 2V2QA 2DVIA 3MF5A 2DHSA 3J81j 4LR9A 4WU2A 3IS9A 1KQFB 2AEFA 4BC9A 1LXNA 1HKAA 1LK7A 2KRBA 1E6VA 4NEYA 2EI5A 4ER8A 2ZDOA 4KT0C 4E2FB 3HFVA 4NL5A 5ETVA 4N76A 1OYDA 3MTKA 3FMWA 3I9ZA 3ILJA 3OTDA 8ATCB 5ADZA 3QFWA 3LALA 2E1CA 2Z30B 2C3MA 3IFEA 3C2PA 5EGYA 2KT2A 1GX5A 3HT3A 3CTRA 1HARA 2DNLA 3CNQP 1U1PA 1VQMS 3FCVA 4ZP6A 2XTJP 1MROB 2YWWA 2HVDA 4BS2A 1NHUA 2H65B 1CS4A 2OELA 2YXLA 3RB4A 1WI6A 1S1XA 2DPJA 1TL3A 2MSSA 3RBDA 5IV3A 4GKJJ 3P45B 2GIFA 2DNOA 1I94F 2A18A 2RQKA 3TOQA 1JJ4A 4FKXA 4Z7YA 2VA2A 3QNWB 3U1LA 3V81B 4DCOB 3HULA 4WU3A 1YDLA 1OY6A 1GQEA 1IR2A 3DNCA 2EG1A 3EJMA 4KGVB 3VGUA 2J0WA 1RHKB 3TA0A 2CJQA 1T0TV 4OI2A 1WEYA 2C2ZB 2DJWA 2YKOA 3HSZA 2BANA 2GJIA 3PR4A 2ZC3A 4Q0BA 4HHHA 2X1FA 1RT5A 2RF2A 2RU9A 4DL0C 2AT1B 4OI4A 3NCPA 5KG3A 2QO3A 4QIVA 3J7YI 1PO6A 3KWMA 2QFJA 2AWZA 1F2GA 2YQ3A 2FDNA 1QY7A 1ZAWA 2EG2A 5HVGA 3CT9A 2LXIA 3LWMA 1FDDA 1VRTA 3SMZA 3W9JA 4WE1A 3J81U 3DLGA 5EWGA 3LP0B 2NYIA 4NI2A 3J80U 5KFVA 3JAMU 4QR0A 1K1QA 1XTZA 2Z2ZA 4RLEA 4I7FB 3NAHA 5H9FK 4X65F 3AD7C 4ELTA 1B99A 1YIJS 2U2FA 1UW4A 2YNHA 1DQAA 1ZA1B 4B02A 3HLUA 3KMQA 4W98A 3PVXA 4FYYB 1KSPA 2HNZB 1ZA2B 1HD0A 4QU7A 2AP6A 1S49A 3W8GA 1B0PA 4BHQA 4RW6A 3CCUS 4P2MA 2Z57B 3VALA 5KG2A 1UEUA 2UVRA 2GA7A 3HKZD 2CZVC 2EBEA 4ZVFA 4TQSA 4X4PA 1Q5VA 2HVIA 1F3FA 1TVRB 2VKZG 3D0GE 4NLOA 1HNZF 1DTQA 2ALZA 3OV7A 3N79A 2QSWA 2BJDA 4PPZA 3ISNC 4EO6A 4YP3A 5DRKA 2H51B 2KJWA 3HHLB 4L75A 5IT0A 3RTVA 3NGKA 1FVQA 4IO9Q 5A6WA 2LXUA 1G6BA 4KIAA 4OX6A 3FCWA 2CYYA 3LP2B 2UXCJ 3K5LA 5L1IA 4NRTA 3RZAA 5CYMA 1UTAA 1G3OA 5J1EB 2DBBA 2FZGB 4LF1A 1MU2B 4DV7F 4H4OB 2VBYA 3I5BA 3GR1A 1HHSA 2QMUB 4CNYA 3ENQA 1JLEB 1C1BB 4KB7A 4DV3J 4CH0S 6AT1B 2JSXA 1Q8BA 2HURA 2OPSA 2HBYB 3AFGA 4QYRA 3BN7A 3ZTRA 1CJUB 1WHVA 2CKWA 2DRAA 3HSDA 1JLGB 1Q4RA 4FBUA 3Q86A 3VGSA 4I2QB 3UN2A 2GQ2A 4ECUA 2BE9B 3UNGC 4PRFA 5L1JA 2OD4A 3EVMA 4RR5A 5T7LA 4OZJA 2BW2A 1FK9B 4KPYA 5JVGQ 4CO0A 3AA8A 3CJ8A 4KC5A 5IWAF 3IS9B 3SXLA 5KFZA 2HK3A 2BXJA 1HR0F 3FEZA 4K5SA 4ELVA 2DHGA 4RW9A 4RUHA 4DR4F 4NZ0A 5GMEA 3OFEA 2HLTA 5KT6A 3NNHA 3EZUA 5F8GA 3O2IA 4WZMA 4CM0A 3UDVA 2CDQA 1IWAA 3W2VA 2G2OA 3OT9A 1XMQJ 4RUCA 1M1HA 1XR7A 2AGPA 3T41A 4NLYA 2GZOA 3KOAA 2DGSA 4X64F 2BQUA 4OZLA 3NGDA 2WBRA 3JQJA 4P74A 5E7OB 2YBVA 1HQEA 2HMIB 3S01A 3ELHA 2F7VA 1TL3B 4KHMA 3KHLA 3HHNB 1Q16B 2XMMA 4ECXA 4NX9A 2W24A 4WKRA 4HT5A 1BHNA 4AQYJ 1Y00A 3U02A 3M4XA 4KH1B 3B6BA 3W60A 2MY7A 5GAHI 2CQDA 2E5GA 3F56A 1T3NA 2G0JA 3ISZA 4CLPA 4JI8F 2VBZA 5IZHA 2Y0BB 3ZZYA 1LW0A 1G4CA 2JEFA 4KSEB 4PG8A 4N56A 4CWBA 2BANB 2XEXA 4E8UA 1B7FA 4Q0BB 4DUYF 3DXSX 4LF6F 3KLFA 3UFCX 2UVUA 4U7UD 1RT5B 1LWEB 1TV6B 2BM0A 3JSMB 2A0FB 4P10A 1IJEB 4U95A 3A8IA 5T41A 2EBGA 2K3KA 2LP4A 4QU6A 4WP9A 1Q78A 1RT3B 2WZ1A 2L9DA 3MR5A 4DR2F 1FE0A 1IN0A 3H2LA 2CQ4A 3W64A 2LCWA 3UDCA 2NSBA 2LDYA 1VRTB 3OUYA 2IRXA 3QO9A 3GLJA 2LQ9A 3DLJA 4KGKA 1FESA 1RGVA 2W8KA 2V34A 1WSRA 2JFKA 2BRLA 3PKMA 1FWKA 3H59A 1VK3A 2FQQB 5IC4B 4O23A 1JLQB 2XZWA 4ZJOA 5KFQA 4GVLA 5IQQA 1T11A 3IRXA 2P2CB 5B09A 4C11A 2QLXA 3VQTA 4NWBA 2AEJA 2WOMB 4Q45A 2H3EB 1KRPA 2OSQA 3UDEA 4WP3A 2G13A 2ZHOA 1TQLA 4UOGA 1NSAA 1YG0A 3TR5A 1FNXH 2XMAA 1X7VA 3IWXA 1TP7A 4USTA 3IMQJ 5RUBA 3DMJA 2DXEA 1RAOA 2OEMA 1RKIA 3VGTA 3N0VA 1JK9B 4F0KA 2CJ9A 2BKNA 2OP5A 1YTYA 2CWXA 4OI3A 4YOEA 2VICA 4J9KA 4ZVHA 4X66J 1JXLA 1FJCA 5AT1B 5EWFA 3VAFA 4RW7B 4PYAA 2V4QA 2R7TA 3GQCA 3W61A 2J6UA 3R1LA 5CYJA 5CH7B 3EYZA 1YITS 4H4MB 3E2EA 3IC1A 3OVAA 4GKJF 1X0PA 3UR3C 4O4GB 3ET6B 3R6GB 2P9EA 1LWXA 1RU2A 2ZUAA 4ED0A 3Q2TC 3D0HE 1VJQA 1WG4A 3LOUA 1SH2A 2BZ2A 2KYXA 3ZTSA 2RKIB 3ITHB 5L8RC 1Q8KA 3MUMP 1TKXB 5KG6A 3H98A 5AXNA 2JLFA 1RWXB 3OJSA 2UXBJ 1VOMA 1RT2A 4WF9Q 4Z2XA 2MGZB 3EGWB 3D6MB 3O8WA 1NHKL 5LSRA 4IO1A 4Y2IA 4IYQA 3OTCA 5HVFA 2HQDA 3EGVA 3NWGA 4O4RA 1L3SA 4WTYA 3CCTA 1RTDB 2B5JA 2ZH9A 4OYMA 3JYTA 1UVMA 1ZS6A 2QL7B 4AL7A 1DFDA 6FDRA 3C16A 3M2VA 5EX3A 3HDSA 4LBPA 3CB4A 4RW9B 4AUKA 3CIMA 4Y00A 2VV5A 2D41A 3PW7A 4WYWA 4PYDA 1OSDA 1FJEB 2L3MA 1FTRA 1M5HA 3HSJA 2B9YA 1KQGB 3PW0A 2R9LA 3N28A 3VHQA 1H7XA 3ENAA 3DDKA 4IQMA 1ZAXA 3D6FB 3KG1A 2NQPA 1RAEB 2RH3A 1FKOA 4M63A 4ZVPB 1HQEB 4CLKA 2CIMA 4XPEA 5ETMA 1EARA 1JKHB 1FFSB 2GCFA 2CWKA 1TZ0A 3OFGA 2ATLA 3Q8QB 1UA1A 2EFNA 1X9MA 4M5LA 4CO4A 2IM1A 2CJXB 2IC3A 4N8OA 1QE1B 1SJFA 2YKQA 2GNKA 5KFBA 2R7RA 4CLTA 1FCAA 4QYZK 2YKNB 4ZP9A 3OXLA 2QL5B 3PG9A 2ASLA 4F26A 3OW2R 3SCJE 3TEHB 1O8BA 2UXCF 3JAMY 1YRXA 4USWA 3DOLB 1ZTWA 5GAGU 2KN4A 4ILRA 2LMIA 2DT9A 4URGA 4NLSA 3BEGB 1I5OB 5I3UA 4F4AA 2XY6A 3UVJA 2V8GA 1WC4A 2VOPA 3BPDA 2OD6A 2XO6A 1N54B 4DV3F 1C0UB 3I0RB 1S9EA 3A8EA 5DDOC 4OZNA 5AE3A 5C25A 1JNRB 2BJ9A 4P6QA 1RHQB 2QLFB 4K4UA 3KG4A 4C97A 3A3PB 3R2CJ 5CD4A 1WC6A 3I0SA 2W9BA 4OQJA 5G0RA 4Z7CA 4ZOSA 2AJQA 4DL7A 2RT3A 4IFVB 4ZS6A 2BEFA 4FPRA 5D0RA 2N3OA 4G1IA 4C11B 5C42A 1RT1A 5C7PA 4W4MA 1CEZA 3BKUA 4M5KA 5F8IA 4DL6A 2K7KA 4LF8J 1LWCA 4ANCA 2UXDJ 7AT1B 4OZ5A 2IRUA 4ED1A 4JOUA 5DO2A 5HMWA 1U2RA 1S99A 4X4UA 2HHSA 3R5CA 2MKHA 1S48A 2ABYA 5LXRA 2V6AA 3MCNA 1X4HA 1NO8A 3R7SB 3CW2C 1NPRA 3DRSB 2ZVSA 2UV8G 2JLGA 2Y9HA 3NXZA 4F7VA 2KFZA 2DR5A 1XMQF 1HI0P 4W92B 5JJBA 1Y4ZB 4MKVA 1GXUA 1EKSA 4CLZA 2F3JA 2GVDA 1NKBA 3N01A 4M5DA 1SV5A 5E2QA 3MR3A 3RBEA 3DKDA 3U7JA 4DFMA 2XMVA 1TK5A 2HIQA 2IM3A 5AXKA 1WDDA 3CE8A 2XYPB 4AQYF 4NCGB 3GFYA 4OLPA 3HKWA 1IWGA 5K5MA 2W9CB 1LXJA 4L3KA 2O1PA 4QWBA 3GZ7A 1Z2LA 1S1VA 3OL7A 1YJ7A 2UUTA 2YNIB 3A8JA 3PO4A 2QEXS 2OKQA 2GHPA 2XMJA 2D7SA 2A2DA 3PDNA 1UAWA 2VBWA 1YRUA 1TAQA 2UVVA 3IR5B 3WIUA 1BWEA 1T03A 1RKJA 1P6TA 3DM2A 1HWJA 3H40A 2MZ1A 2VG7A 3MR2A 2WVFA 1SBRA 1TU0B 2YWHA 4ZLLA 4QW9A 1Y3JA 2B5JB 3JYTB 2BKOA 1UVNA 4QCLA 2M88A 1W2BR 2P6TA 3V4MA 1VQ9S 2DHHA 2XI2A 4YB6A 2ZZTA 3CCJS 5AJ3J 4NXMJ 2RB7A 3TUZC 3JTOA 3WC0A 1M90T 2HQ3A 4AYBD 2RE1A 2M4MA 3C8YA 2VU5A 3CDWA 2V4RA 5E0OA 4HI2A 4HR2A 4AE5A 4ZPBA 2KO1A 3AXKA 1HBUA 1IKYA 1U1RA 2LVWA 2MQPA 2JNJA 4NLQA 3EVOA 3EGZA 2J76E 2JH3A 2M2BA 1WOPA 5D4PA 3B78A 1UL3A 1U1NA 2W4CA 3G71S 4IG0A 3HMJG 4OZ0A 1U25A 3UD3P 2ROGA 3HO1A 2B6AA 1RU1A 1GMUA 2LQBA 1UVIA 3IR7B 3QT5A 3HF5A 3IAM9 3TQEA 2VQEJ 4EGLA 5KFPA 5HJYA 2VQFJ 3T3FA 3MUTP 3BGLA 1S6QA 3RAQA 2ZM6J 1UFLA 1EKRA 1T9XA 3K5NA 1A6LA 2FB0A 3VV2B 4Y0FA 4OHYA 2MPUA 1LV5A 1JLBB 1HYSB 3BYRA 3CDBA 4ZK7M 3G82B 2JC1A 2ZOMA 4LF2A 3PRVA 4DFKA 4KGMA 4N8NA 3CJ4A 2CNOB 4LF4J 2V9KA 2J0XA 3HK2A 2VF3A 3M6VA 2NZCA 2OFGX 1QVFR 2BQ3A 5E5NA 3CGIA 1FVSA 1KQSR 2ACMA 3TP2A 1AUSL 4URSA 2HWHA 3AODA 1YZ7A 4J9MA 1X4CA 3C6TA 3J7ZT 3MEKA 4I2PB 1U24A 2UXBF 4U67Q 1X8DA 2C2NA 3P4UB 4HT7A 2O66A 1OO0B 4JI7J 5KTQA 1UETA 4K7QA 3I0SB 3NAIA 1B70B 1RHUB 3VZHA 1PGZA 1I1GA 4HH1A 1H2VZ 4K4YA 4B9NA 4LRCA 3BJYA 3W7BA 2AU0A 1M0SA 3L7PA 1RHMB 3D6TB 5EN1A 1JLCB 2V4JA 3I82A 5EHHA 1MMNA 5HP1B 4JI0J 3OD2A 2I9SA 3HZEA 4FF1A 2BX6A 2QA4G 4WK3A 1X0FA 3WIVA 2OI2A 1FE4A 3FRYA 3M6XA 2IPOB 3RBZA 1J5OA 3SV4A 1B7YB 1H98A 3KLGA 4G65A 3G4SS 2CQIA 5K8OA 1S7IA 1RAGB 1SC3B 4UTGA 3AOAA 2Z2MA 3QZ7A 2HGLA 2EKNA 1KN6A 1YKWA 5DG8A 3QLHA 4ED6A 1S97A 2GJFA 3R3TA 2VC1A 1HWKA 4CDIA 3P96A 2H5EA 5F8HA 3NS6A 3GV7B 2MZQA 4J9LA 1UPMB 2KVIA 4WP8A 2A6OA 3NS5A 3J7Z5 2QTWA 3R5JB 4OYIA 1NK5A 3OBIA 3G87A 3W62A 5I42B 5KFNA 4ID5B 1S0OA 5D0HA 3W8PA 5B0DA 1KHWA 2KVQE 2XNRA 1EP4A 3RU0A 5GMKa 1K0VA 1QD1A 3EXCX 2XGQA 4OFZA 3BM7A 4KHRA 4AT1B 1T95A 1TL7B 3W9IA 4K59A 4GO7X 1KTQA 2F8EX 1X5OA 1RYRA 1E6YA 1UMJA 4KFBB 2RHSB 5GMDA 1U1LA 1GMVA 4O3RA 1CJTB 3N6NA 1CQNA 2RVJA 2JVOA 1X9SA 5ETLA 3T5HA 1UA0A 5MLCV 1IQZA 4HYKA 4TY8A 3D67A 4DFJA 2DIVA 4J9OA 4O44A 4IUFA 2O67A 5F8JA 1ROFA 1RACB 2PEBA 2RIJA 3DI6A 1S1WB 1SKUB 1RAFB 3O1LA 2MQOA 4FF3A 4WPAA 3NEKA 3W3SA 1TFYA 2K7JA 2Y8YA 3LA0A 1IKYB 1UCNA 3PFEA 1EIYB 3HJFA 4B3SJ 2DYAA 2F40A 4F0MA 4QIGA 3CEDA 3FUYA 2JEJA 2LQJA 3AOBA 4FNIA 2Q6BA 2EFGA 3OTBA 3BSAA 2QMWA 3Q8PB 2D1CA 4EBDA 3NG8A 4GMKA 3Q8YA 4R25A 4UUXA 4DPXA 4LRAA 5I4MA 4AL5A 4X4QA 4KHPJ 2OPPA 2J0SD 2AYGA 2PO4A 1HFEL 2MB0B 1RWNB 2HKEA 2L08A 1B0VA 2YNFA 3M8PA 4FNHA 3OHAA 4PWDA 1XN9A 2XO7A 1VISA 3RAMA 4RL1A 5K14B 1ZPWX 3AB4B 1PCAA 3M2UA 1SJ1A 2WSCC 1S59A 1U47A 3MOZA 2KHDA 1PILA 3NGUA 5D15A 2CQPA 2MKKA 1DQ9A 3UDLA 1TL1A 3QBCA 1IKWA 2X3GA 3SEOA 2RQCA 3FEYB 2BRKA 2N7YA 5C2GA 1PSDA 5FDLA 2RS2A 2IMWP 1Q79A 3W9HA 2VPXB 1KONA 3QJJA 1FRKA 4ZVUB 3HVTA 3GJRB 3BKFA 3UQSA 3UN5A 1LKZA 4EU0A 3VAMA 3ILLA 2KM8B 3AJ1A 2MKSA 3HM9A 4D3HA 3L9ZA 2JDJA 3CO9A 2E1AA 3D3CJ 1XNRJ 3FEXB 1NDLA 2ZE2B 1JXVA 3CSKA 4MIAA 4P2SA 2RD5C 1SPBP 3A4TA 5HQMA 2BQRA 5H9EJ 2W2NP 1RTIA 4MFBB 3ENVA 5AJ3F 4OLOA 4NXMF 3TVZA 2RDDA 3FDSA 5J2PA 4DV4J 2MZTA 1R31A 2VFVA 2DHAA 3GG1A 4CT8A 4KE5A 2B43A 3DRRB 4WXOA 3I96A 4Y28C 1FDBA 1R0BG 1KTVA 1HHQA 1SB6A 3QAEA 4MKYA 2MQNA 1VRUB 3KTQA 4RU2A 3MXHP 1I51B 4K4XA 1H6KX 1T94A 1Q53A 3PNIA 3KDOA 3KK3A 3W5XA 2QL9B 3IAS9 3BH6B 4JV1A 1NDKA 1H74A 1WG5A 2DO0A 3VAHA 1JJHA 2OGUA 1ZH5A 3NOCA 5B0GA 3WDOA 3JTPA 4RWXA 4X4NA 1O51A 1QTNB 4ZJQA 2B7BB 1LW2B 2GW8A 5GADU 5HI7A 3J7A1 2MY8A 1N0VC 4PXEA 1TKZB 1PBUA 2RQ4A 3FBCA 2VQEF 1N4LA 1HIYA 3BZQA 2VQFF 1T05B 5K8PA 4UZBA 2ZM6F 2C3PA 4WXWA 4LRFA 2D74B 1RT6A 2V67A 3BQ0A 2G0CA 2R3VA 2Y1RI 1TTHB 2A2CA 4CIOA 2C2MB 1RSCA 5IV4A 4TU7A 3JXOA 4PEOA 4ZCKA 1RT7B 1HBMA 2VB6A 4UW2A 4ZCMA 5CCLA 3I6PA 4LF4F 3QSYB 5J1NA 1BMQB 2JL9A 2OMOA 2R7XA 1ZM2A 2Z56B 2R8JA 2VFRA 5HROA 3DLHA 1WHXA 1SJ3P 4TY8B 3N6LA 5HK4A 3M32A 4Y2CA 3ISND 4QW8A 5ETRA 3M9OB 2W8LA 1FJ7A 2RUSA 4H54A 4USIA 2IY5B 4Q2MA 1EQ0A 3EGNA 4JI7F 1HNVB 1FF2A 2NPIA 3EPIA 3CJKA 4AXJA 1T02A 1Q82T 4IG3A 2F63A 4C8MA 1U48A 1N33F 3EZ5A 4ENOA 2J9DE 5IQ6A 1PC4A 4YN3B 2DNNA 4OYBA 2ZDPA 3OL9A 1RT4B 4ECSA 2EC0A 4B3OB 2F8HA 4OI6A 2DKOB 4NZ7A 3GV5B 1N5VA 4JI0F 1N34J 2GC8A 3B82A 4V19J 1SQFA 1V3SA 1C2PA 1WKJA 2LKZA 2HG4A 3PRBA 3MTJA 2LECA 3UNYA 5HAOA
chains in the Genus database with same CATH topology
2VH7A 4BWMA 3UNGC 3RB6A 2IVYA 5HLFA 1ZETA 3NRBA 3CJ3A 4NA2A 4ZVEA 5F9LA 5KFDA 5E3CA 5L1JA 4PRFA 2OD4A 1S9FA 1J5EF 1N0UA 5E33A 5LL6d 3AB2B 5T7LA 4ERDA 4OZJA 4FXWA 3V4IB 2HHPA 2BW2A 1FK9B 2AJ1A 4KPYA 2DGOA 1S9GA 1S1VB 1DRZA 1SI9A 4F25A 4ED3A 5JVGQ 4CO0A 3AA8A 5IWAF 4KC5A 3I9V9 3IS9B 3OXFA 2PC6A 3SXLA 2BR0A 4NYOA 5KFZA 5IM0B 3LAKA 2FJEB 4HTIA 1WEXA 2OSRA 2BXJA 3CWJA 3LO3A 5JUMA 1QAYA 1WD6A 1HR0F 3I4PA 3M30B 5BYSA 1TKTA 4R0JA 4PWDB 2E7WA 3FEZA 4K5SA 4YB1P 3ZZPA 2MQMA 4EBCA 2N7CA 4N77A 3K59A 4K2XA 2VZ9A 4ELVA 2DHGA 4RW9A 2Z0GA 4HTJA 4NA1A 4NZ0A 4RUHA 5D3GB 4DR4F 1HNIA 5KT5A 2RILA 1Q8IA 3OFEA 3CJ2A 4I2PA 1IXKA 2HLTA 2CQ1A 4BC7A 2QLWA 5KT6A 5F8NA 5GAGI 3NNHA 3EZUA 4CTAA 3M2UB 1XR5A 4B3MF 5F8GA 3O2IA 1Q7LB 3FZ2A 3TYTA 1VFJA 4KR0B 4WZMA 1T03B 1HQUB 3T9NA 2OTLS 3QGPA 2CDQA 2DNYA 2JHEA 2LQ5A 2NSCA 3DM2B 4EZ9A 4EYHB 2J9CA 2HW3A 2VG7B 3IBWA 3W2VA 4C4WA 3CCSS 2UZAA 4RU9A 4KAIA 4RUCA 3KLVA 1XR7A 2OTJS 3QPIA 2AGPA 2AW0A 4C8NA 2AX1A 3D54A 4NLYA 3QAUA 2MHNA 4PXBA 3UR0A 4X4RA 3KLEB 1FXDA 3GV8B 2HHHF 2C22A 3VR1A 3KOAA 2DGSA 3L7OA 2IJNA 4X64F 2BQUA 4OZLA 3NGDA 3LANA 7FDRA 2WBRA 3IXQA 1YHQS 1Q7YT 5E7OB 1NKCA 5KFEA 2K8GA 2POKA 3S8SA 1JLCA 3OSNA 3V6JA 3TARA 5A0YA 1HQEA 2B9XA 2HMIB 1GX6A 1HW8A 1VK8A 3B8HA 3S01A 4B3RF 2OPQB 2F7VA 1TL3B 4KHMA 3UI3A 5HP1A 1LWFA 3E8OA 1VIOA 4ZCIA 3FJ2A 4NLTA 3T5JA 3KHLA 4FS2A 2E29A 1Q16B 3HHNB 3HPOA 2XMMA 4ECXA 3FNNA 4NX9A 2W24A 4DF4A 4WKRA 4HT5A 4F3OA 3CULA 3QGHA 4PKDB 2ROEA 5KFAA 1P8GA 5DQGA 1KNZA 1TK8A 1Y00A 2CPJA 5EX0A 4NMLA 2ADBA 1VQSA 4IOBA 4J37A 4M94A 2IAJA 2XULA 3U02A 3M4XA 4DQRA 5KFKA 3OL6A 2M8HA 2MY7A 1OS5A 5LXYA 2CPXA 2XMUA 1FKAF 5GAHI 2K2PA 1VJWA 2CQDA 2E5GA 4LF8F 3SDEA 3PJXA 2UXDF 1HBUB 3U1MA 3F56A 1T3NA 2MDAA 5DS7A 3PO5A 1F60B 1CLFA 3ISZA 4JI8F 3MFIA 4CH1A 2VBZA 5IZHA 4DF8A 4RZRA 4EBEA 2G1DA 2YH1A 1N6QA 1SJRA 5CZVA 3ZZYA 3H2VE 1LW0A 3C6UB 4NLVA 1URNA 2VG5A 2JEFA 4KSEB 4O3PA 4R8UA 4PG8A 5JXSA 4F4ZA 2FVRA 1NJZA 1DLOA 4N56A 5C5JA 1JXEA 2BANB 2XEXA 2CFXA 4E8UA 4IG0B 1WF2A 3PY8A 1B7FA 4Q0BB 4DUYF 3DXSX 4LF6F 3KLFA 5KT7A 2XWYA 3UFCX 2RDJA 4Q44A 5J2PB 2UVUA 1RT5B 1LWEB 1TV6B 2BM0A 3QIPB 3JSMB 1Z1ZA 3H25A 1IJEB 2B6AB 2CQ3A 5T41A 2EBGA 3Q24A 2K3KA 4QU6A 4ZPVR 3B4MA 4O3OA 4WFXA 3GE9A 2XCPA 4YR0A 2Q1LA 1Q78A 2RMLA 5DQHA 5DDPC 1FRIA 1RT3B 1HBNA 3NNAA 3BREA 1N48A 2FVPA 3FCHA 2HHQA 4RW8B 1BC6A 1SKRA 1H7WA 2JFDA 2L9DA 3AQOA 3MR5A 3MDFA 5I42A 2YVSA 4ID5A 1N5TA 2DO4A 1H38A 1PC5A 4DR2F 1SUQA 1FE0A 1IN0A 3NBPA 4DL4A 3H5UA 3H2LA 2CQ4A 2LCWA 3UDCA 2NSBA 3O5TB 2LDYA 4RBTA 5DLGA 1VRTB 3OUYA 1S6QB 2DNMA 3K5PA 2IRXA 3QO9A 5J2MB 4B3SF 3OVBA 4M1KA 2LQ9A 4J5OA 1R0AA 4OV1A 2DNRA 3DLJA 1KLMA 2FJXA 3SFUA 3SQGA 4KGKA 3I55S 1FESA 1RGVA 1IUJA 1QUPA 4LSNA 2XC9A 2L9NA 3FGVA 3FSYA 2W8KA 4HEA9 3MMAA 4DN0A 2E44A 2JFKA 2BRLA 2R2SA 3PKMA 5L1LA 3H59A 1VK3A 1LFWA 4QR1A 1FDAA 2A10A 3MM7A 3E01B 2FLPA 4AXIA 2MJUA 4FP9A 2KKHA 4J9RA 5DM7Q 4O23A 1JLQB 2XZWA 4C0HA 5KFQA 2HZCA 3L09A 1YJTA 4I56A 5IQQA 4DSLA 3G6ES 3MM6B 1M5SA 4KFBA 3IRXA 1V9OA 2A1BA 3I4HX 3OR2A 4HLBA 3MM5A 5B09A 4ICLA 2KYZA 4ES3A 2DB1A 1RTHB 4C11A 2QLXA 2MXYA 2FLNA 3MM9A 2AJ0A 1N5YB 4G6VB 4KHPF 2ZZNA 3RW7A 3VQTA 4NWBA 5B0CA 2WOMB 3PHEA 1W2IA 3MMBB 4Q45A 1KRPA 2OSQA 1AUDA 2WB4A 5A8WA 3BGRB 2HFOA 3Q23A 1VQPS 2J6TA 2G13A 5AE2A 2EFPA 4U7CA 1XMBA 2FLLA 1FXRA 2I5JA 2ZHOA 1TQLA 3FSIA 1IKVA 1QSLA 2I38A 3MAQA 3M6WA 3TNVA 5J2QB 1YG0A 3S1TA 3TR5A 1FNXH 4IH6A 1X9WA 3KNAA 4I67A 1Y3KA 3TVYA 4ITSA 4KKOA 1V3RA 4RNOA 1X7VA 3C6TB 3IWXA 2AGOA 3MEDB 2M52A 4WCEQ 2DNKA 1TP7A 2BE2A 5E3RA 4CZCA 2R8GA 2PE8A 1SL1A 1BQXA 3A1YG 3TRGA 2XCAA 5LMNF 3RB0A 3MEEA 3WZ0A 1BQNB 1SQEA 3WX4A 3DMJA 2N4CA 1FKPA 1OPZA 2Q43A 4DLEA 4FVMA 1RKIA 1JIHA 1S1WA 1QAJA 4AL6A 3LP1B 2L48A 3N0VA 3MMCA 3RR7A 4DX8H 3QJLA 1JK9B 4UQGA 1R27B 4CCHA 2BM1A 2CJ9A 4F4KA 4DPOA 3BO3A 2OP5A 5CZXA 4CI0B 4F4XA 4A8YA 4OI3A 1YTYA 2QYCA 4YOEA 3O3LA 1VBXA 1X4GA 4LVOP 4F67A 3J7YU 3SYZA 4J9KA 4PG6A 3CCVS 4ZVHA 3UPFA 1BLUA 2KFYA 1JXLA 3DLLQ 5EWFA 3VAFA 3D1HA 3FZBA 4RW7B 3X1LB 3GFXA 3M8RA 3MEGA 2V4QA 2R7TA 2A3JA 2CQGA 1K73T 2UVWA 3GQCA 1Y7PA 2APOA 4DQSA 2NZ4A 2JEIA 5CYQB 2J6UA 4DR5F 2WBMA 3KHRA 2I2YA 3R1LA 3TO8A 5CYJA 2IYIA 3JSBA 5J2NB 2V4JB 5CH7B 1NJXA 1AFIA 3S6EA 3EYZA 2KU7A 2QA1A 2ROPA 1YITS 3M05A 4H4MB 2B4VA 3DHWC 2RSQA 3LAMA 3KK1A 2IFXA 3E2EA 3IC1A 2B3TB 3OVAA 1VMBA 1X4EA 3QGGA 4GKJF 3HP6A 1X0PA 2J6SA 3UR3C 3M2RB 3TQ1A 2XB2D 2BACA 5AE1A 1FD2A 2DNGA 1NK9A 3OHBA 4O4GB 1SJ4P 1UVJA 1J5OB 2KT5A 2P9EA 2ZBIA 3DDNA 2X1GA 2W4DA 4ZPWR 3KK2B 2L41A 2EK6A 3D1OA 3BR8A 2CJKA 4LF9F 3KLGB 2NUUG 4ED0A 3Q2TC 4IG3B 3CCZA 2MKCA 3D0HE 2UUAF 4NLXA 5DDRC 3W2WA 2GJ2A 1XK8A 4UOCA 4F4WA 4J9NA 1IM4A 3B4DA 2XSJB 1WG4A 2ZD1A 3HVAA 3LOUA 4A8QA 2WK4A 3KJVB 4K5RA 2ZH3A 1SH2A 2BZ2A 3IWLA 3TAMA 2KYXA 2F8MA 2I1RA 3Q8RB 1AXQA 2PMZD 2VOOA 2RKIB 3QLHB 4ECTA 3ITHB 4RX6A 5L8RC 7FD1A 3MPWA 3KNGA 2ZHAA 2AV5A 3MUMP 2MQLA 4MKBA 1TKXB 3BDEA 1NZAA 4Y65A 5A8RB 2EKYA 5F3ZA 5KG6A 1YJVA 1OIAA 3H98A 5AXNA 3JSRA 2Y0SD 2PA3A 2OAUA 2JLFA 3OJSA 1S79A 5CCMA 2PI4A 1RK8A 4OHVA 2DRBA 2ZH6A 2Q3PA 4DV4F 2HLUA 4MYTA 2F9DA 5K14A 4X4SA 2LEBA 4ILLA 1VOMA 4DS5A 1YVFA 1RT2A 1VI7A 4WF9Q 4O0IA 2JLEA 4I0WA 4Z2XA 3EGWB 2MGZB 2QA4S 4DR1F 1P1LA 3O8WA 2EFOA 3GWCA 1S1TB 5LSRA 3BDPA 2DNHA 3V6DA 4IO1A 3KMSA 2LEAA 2MHEA 4Y2IA 4IYQA 5FJ4A 3D5MA 3HHLC 4PUOA 2R2UA 2DH9A 3OTCA 2R8KA 3GIKA 5A8KA 4IOAQ 1FA0A 2IM0A 2GHVC 2NUHA 3NWGA 4O4RA 2RS8A 4I4BA 4WTYA 2RRAA 5HBMA 1EP4B 3CCTA 1YI2S 1L3SA 3HHLD 1TR0A 2XG8A 4NPOA 1RTDB 2B5JA 3I87A 1KFSA 1S4FA 2ZH9A 3JYTA 4BCAA 1NK7A 1UVMA 1VQYA 2KJVA 1MROA 2VFTA 1OSCA 2IJFA 1U4BA 4AL7A 1DFDA 3TX8A 1R8BA 3LQVA 5KT3A 6FDRA 3I5AA 4YB7A 3MOJB 3PW4A 3M2VA 5HQ8A 1VS3A 4PG5A 5EX3A 3HDSA 1B0TA 3OFHA 1VQKS 1R43A 1TKTB 3VZIA 3HI9A 1U09A 3M9NB 1R8HA 2CVEA 2H9ZA 4J9PA 3PX0A 1S72S 3CB4A 3KLIB 3SCKE 4RW9B 2VD3A 1FO1A 3KLHA 5F8MA 1E6YB 3EUNA 4QOTA 1QVGR 2KG1A 3N5FA 2LEPA 1NH8A 3NKYA 3CIMA 4AUKA 3MURP 2OLWA 3LW5C 4Y00A 4CTAB 2OO4A 2VV5A 3OL8A 1YJNS 2YWKA 1QM9A 2D41A 5M2RA 4FYDA 3PW7A 5D78A 4HVZA 4WYWA 2BOPA 3I32A 2MJNA 4FXDA 1Q86T 1OSDA 1CSJA 3LF0A 1FJEB 1DTTA 2L3MA 4JI2F 4NLRA 4ED7A 4TLRA 5DQIA 1FTRA 5KT4A 3V81A 1M5HA 3RRGA 2B9YA 1KR4A 1KQGB 4Q7AA 4TYBA 3OJUA 3OTEA 3PW0A 1YJ9S 4F2SA 2R9LA 3N28A 4QPTA 1GT8A 1ZBTA 3DRPB 4QYZJ 1KHVA 4O44B 2HNDA 2FHKA 1U8SA 1XWLA 3NP5A 4R0EA 4ED1A 3IG1B 1H7XA 4ZKAA 3CMES 3DDKA 1L3VA 4IQMA 1ZAXA 2ZE2A 2J8AA 3SSQA 2DR9A 2VONA 4F8RA 1U26A 2DGUA 2VG6A 2K1RA 3KG1A 4IH7A 3G8SA 2NQPA 1S1UA 1D0EA 1UEVA 2OPRB 2RH3A 2C3OA 2MZRA 3CDAA 3F44A 4ZP7A 2FJAB 2R8HA 1FKOA 2B4OA 4M63A 4LQ9A 5EWEA 1HQEB 2C3YA 3DI6B 4A46A 2IM2A 3ONQA 3UCZP 3AA9A 1UJ6A 1XC9A 2CIMA 4K4VA 1L3UA 2HHUA 2MSTA 3WBZA 3QWPA 1LWFB 1RDRA 2VBXA 4MFBA 4XPEA 1HPZA 2IMOA 1JKHB 2GCFA 4ZDNA 1ZOTA 1TZ0A 1DBDA 2JRSA 2PMHA 1MSWD 5B7WA 2CVIA 3OFGA 3POTB 2DH7A 2ATLA 3OR1B 2OIHA 3Q8QB 5D4LA 3CCLS 3OQ2A 1RISA 1IBLF 4R5PB 3KHHA 1UA1A 2IAJB 1VLYA 2EFNA 1X9MA 2F1FA 4CO4A 2IM1A 3OPKA 4D3GA 3CMAS 2XBPA 2CRLA 2ZH8A 2VFSA 2W7PA 3DRRA 2IC3A 4OL8A 4N8OA 1QE1B 5HL7Q 2YKQA 1ULRA 2GNKA 1SJFA 3K2YA 5KFBA 1KQKA 5D4NA 5GAEI 3DFEA 1ZM3A 3HZGA 2R7RA 3TW0A 3VF0B 3CUNA 1VRUA 2CQBA 4ZPCA 2FVQA 1FCAA 3SSRA 1U6BA 2F9JA 2YKNB 4C9DA 2ZUGA 2C2EA 4FN5A 1Q1KA 3O44A 5KFTA 4U6PA 1JB0C 4ZP9A 4C3LA 3OXLA 5BR8F 1M5OC 2UP1A 5LJ5Y 3GIIA 1M5VC 1N6QB 1P27B 3SCIE 2VG5B 2ASLA 2PI5A 4F26A 3AAWB 4KBIA 3OW2R 3KG0A 3SCJE 2VUGA 1G1XA 3LP0A 4F4YA 2HGMA 1O8BA 4MAKA 1FEHA 3NCQA 5B08A 2UXCF 3JAMY 4B17A 1UJ4A 1YRXA 1QSSA 3I56S 4TY9A 3LGMA 3C46A 1F9FA 1IKXB 3DOLB 4OJ1A 4I64A 2YX4A 4I68A 1ZTWA 2JEGA 4PWUA 2D3UA 5GAGU 1BQMB 2KN4A 4I7FA 4U7UK 2KFNA 5G4DA 4ILRA 3ULHA 2LMIA 3T5LA 1MMDA 3GILA 2DT9A 3C66A 4URGA 4NLSA 3BEGB 4M8LA 3Q22A 3JB9k 4ECQA 2VA3A 2OPPB 2E7XA 1S6PA 5I3UA 2XY6A 1S7HA 3DLEA 1WTFA 1VIXA 2KZMA 1M1KT 3MM8B 1LW2A 3PW2A 2E1MC 4Y2MA 1TL5A 3UE2A 4CH7A 2CPIA 2V8GA 5HMZA 5L9NA 2VOPA 5D6GA 4G1QA 2WHOA 5KT2A 4OHXA 2OD6A 3R5AA