3TA1A

A. fulgidus glnk3, mgadp complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
110
Chain Sequence
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLQFRGVEVDLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of disruption of the Amt-GlnK complex by P(II)-mediated sensing of 2-oxoglutarate.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-3)
total genus 21
structure length 110
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ta1A00
3N5BA 3NCRA 1H3DA 4RLEA 4CNYA 2O66A 3O8WA 1OSCA 2NS1B 2GX8A 2XG8A 2EG1A 4WK1A 2XULA 4OZLA 3MHYA 5D4PA 1J2VA 2XZWA 2Z0GA 1V3RA 2GW8A 2V5HG 5D4NA 2XBPA 2NUHA 4D3GA 1KR4A 1QY7A 2ZFHA 4C3KA 4Y65A 3X3UA 4CO4A 2J9CA 3AA8A 4RWXA 3AH6A 4RX6A 1NAQA 3HLUA 3TA1A 4USHA 5D4LA 1PILA 3L7PA 4OZJA 4AFFA 4CO0A 4IYQA 2J9DE 4YB7A 1O51A 1XK8A 4R25A 2O67A 5DS7A 4RWWA 1UKUA 4ZK7M 4CO5A 3GSDA 3BZQA 3T9ZA 3LF0A 4CO1A 4USIA 3M05A 1NH8A 4USJC 1V3SA 3NCPA 3AA9A 2EG2A 2J9DA 4C3LA 1UFLA 3DFEA 5DRKA 2CZ4A 3AHPA 4CNZA 1Q1KA 2RD5C 1VHFA 4NYPA 4C3MA 4CO2A 1GNKA 3TA2A 3TA0A 3NCQA 4WK3A 2PIIA 2VD3A 2GNKA 4E98A 2ZOMA 1NH7A 1HWUA 4YB5A 2J9EA 3OPKA 4Y6IA 2JJ4D 1V9OA 4OZNA 4CO3A 4NYOA 3O5TB 1V6HA 3CE8A 1NZAA 1O5JA 5L9NA 1UL3A 2NUUG 2DCLA 2E66A 5D4OA 1P1LA 1UMJA 4D3HA 4YB6A 1VFJA
chains in the Genus database with same CATH superfamily
2B4UA 2YVSA 4ZCIA 3CJRA 1U02A 1HI8A 3BPDA 3JSMA 2HRUA 1MSWD 4NA3A 1VRUB 2V6AA 1T05B 2P6SA 3MEEB 4V1Ak 4U7UK 4DR1J 5F41A 1R8HA 3I5AA 2DGTA 1XERA 3PYEA 3CVKA 4Q44A 4FBTA 4GKKF 1TL3A 2YQ3A 3I31A 3QRQA 1LW2B 1N0VC 2HFSA 2JFDA 4QQBA 2VQEF 2K06A 1KLMB 2MQQA 2VPXB 1IKWA 1JIHA 2KYZA 3B8HA 4DCJB 3K5NA 2R8KA 1S99A 1HBUA 1N32F 4HVZA 2IIHA 1CQNA 1IKXB 4LSZB 5DJBA 5B0AA 3L7OA 1VQPS 1UVMA 4WE1B 4CTAB 1HPZA 1NSQA 1T03A 1Z1ZA 2ZFHA 1P6TA 4M5MA 4UQTA 4HL9A 5D8HB 3IS9A 3AD8C 4JI1F 1RCOB 2E29A 3AA8A 1S49A 5L1KA 2PO4A 4B02A 4O3QA 4OQJA 5KFWA 3BR9A 4K4TA 1LOUA 1NAQA 5B0EA 1U1NA 3C46A 1K0VA 3CJKB 2ZBRA 3N6LA 3C15A 4MIWA 3TA1A 4B9VA 1VGYA 1HNVA 3C16A 4USHA 1PILA 1F0XA 2V8HA 4ZJLA 5CYJA 1S9EA 2GFFA 3K5OA 3FJ2A 1E6VB 4B3MJ 3HHEA 4OX9F 4K0KF 4JV0A 1FTCA 3M9MB 2M3DA 4LRFA 2R42A 3CXCR 1U6BA 2BKPA 2OPPB 3UDVA 1HQUA 5L9XA 2FLOA 2QFJA 2BJEA 3GYNA 3ZNUA 4MFBA 2ZDOA 3OHBA 1JNZB 3WC0A 4EO8A 2V0NA 1AFJA 5KFUA 4HYKA 4DR5J 3KG0A 2LECA 3DDKA 1RT3A 4MYTA 1YITS 1R8AA 1QSYA 2FY1A 2X7IA 1RYRA 4OHYA 2VDHA 4CH1A 4ICLB 3EJMA 4O44A 5KFQA 2XMAA 1UEUA 2SXLA 3I9ZA 4N56A 1RJJA 4ZPTR 3BYRA 3UVJB 4YY3J 3VAKA 1GK8A 4M8LA 5HVHA 5LOQA 1NH8A 3I4PA 4USJC 5HP1B 3MM5B 2VODA 1N6QB 4R0EA 4G3IA 4N8OA 2YNGB 2WVBA 1IBMF 4DV6J 4OYAA 3MR6A 2D69A 3TQ1A 3OFHA 2R7VA 1JQGA 4EK2A 4MKAA 1EETB 1YVFA 2P2CB 1Y00A 4U9RA 4ZIWA 3PACA 4B3OB 1RT2A 3UFCX 3I55S 2HHXA 3IS9B 3PYFA 3D0HE 1ZPVA 1YZ6A 2NPIA 3HDSA 1GMUA 1TVRA 1LV5A 2I9SA 4LBPA 5ADZA 2CZ9A 7FDRA 2QFIA 4LIRA 1M5OC 1JB0C 1T3NA 1A9NB 1S5ZA 3CWJA 3U1NA 3UI3A 2ASYA 3FEZA 2IM1A 1RBOB 4A8FA 1CJTA 2KT3A 1C0TA 2QG9B 4DV7J 3W9IA 3LAKA 3HSDA 4FYXB 3O2IA 3ENQA 2MQOA 2WVCA 5J2PB 2AIRB 2X1BA 3GV8B 2MZQA 3MF5A 5AXMA 3BBCA 3TX0A 1KRPA 1GX6A 3HO1A 1G4CA 2CNOB 4RPFA 1JLCB 1JLBA 3DDIA 1VS3A 3QGHA 5L38A 2CPYA 5B08A 2GZOA 1HW9A 1WC1A 2L9NA 5B0FA 3MURP 1CJVA 2HFZA 1T9WA 2V50A 3CT9A 3H5YA 2IVYA 4ED2A 1VQKS 4RUBA 1EB0A 3MMJA 3HJFA 2HQIA 4I0WA 3KLEA 3QGPA 2ZWPA 1YK9A 2CJBA 2CQCA 2YKMA 1T3OA 2FHMA 2OP5A 5IT0A 1HWLA 5I3PA 3GILA 5JUMA 5AE1A 4P2XA 3UWTA 3DLBA 2HHVA 4CZCA 2O3DA 4N5SA 3TOQA 2IYGA 2HSEB 2HHUA 4N8NA 2N3OA 1UP1A 2IDLA 2OPPA 3SXLA 5F9NA 1HBMB 2V9WA 1CC8A 3JSYA 4ZVEA 4PKDB 3GV5B 4KTQA 1LNQA 2G2ZA 3BH7B 2VFTA 3DOLB 1RB0A 1GH8A 4PR6A 1ACMB 4ZP8A 1RLCL 1OQ3A 4QJVA 1WKLA 2HIQA 2ZD1B 5GMEA 4BLGA 4IUFA 5GAEU 2KXFA 3MHYA 2ZKUA 3BKUA 4CLUA 2R2UA 1QAIA 1TFWA 2DR7A 2CVEA 2FUG9 2HQCA 3MM7B 3LP0A 5H9EK 1RA7A 1FE0A 2R7RA 2DPIA 4UOFA 4JOUA 3KHGA 1SKSA 4YEAA 3HVWA 4DMZA 1QE1B 2K3IA 1UJ5A 1QUPA 3LA0A 4LVOP 2ZH1A 3IBFB 1AB8A 2B4PA 5ETLA 1IKXA 1M1KT 2LXIA 2DGXA 4IO9Q 4W90B 3SEOA 1GT8A 3BBBA 5C2GA 2FGOA 4DS5A 1BQXA 4RU9A 1WC6A 4IH5A 1GQEA 1M1HA 2C2EA 1HARA 4ZVQB 3RBXA 2VKZG 3I82A 1K0TA 1NXIA 1Y3KA 3KLGB 3D1OA 2RB7A 4NZ7A 4OYIA 2UV8G 3PW4A 3TVYA 4CI0B 4AL7A 2LVWA 4QR0A 3RRHA 4DFPA 2BE9B 1ZBTA 2JX2A 4ZDNA 1K9MT 2LQ9A 1RTJB 5DS7A 4O3SA 4ED3A 1XNRF 3HFKA 2MB0B 2WVFA 4IRCA 1U1QA 1VLYA 3Q8YA 3PYGA 4JI0J 2B8PA 3CD0A 3LGHA 3MUVP 4LSLA 1FRMA 3R5GA 3UN3A 3SIPB 3ZZOA 2FJBB 2RAQA 3BDEA 1S4EA 4O0NA 3RJMB 3TJ9A 1WNEA 1WKKA 4P52A 2CNNB 3GPAA 3BZQA 4KB7A 1S7HA 3GMGA 3T5KA 2C2RA 1GMWA 4X4RA 3H4DA 2XLKA 2Z56B 4IQXA 4NCGA 1AYEA 2QSWA 1TR0A 4F0MA 2ILZA 2ZNYA 1S1WB 4WP3A 3W61A 2B51A 1RTHA 1R31A 1VLOA 2W2OP 1UFLA 1GX5A 3ONQA 4NRTA 3PYDA 4O23A 5KFVA 3G6XA 1AUSL 3CNQP 4Q2MA 5GAGI 4ILRA 3ILOA 3QYYA 1GFWB 2GAGC 1GNKA 4GO7X 2DITA 4OI6A 3QRPA 4DV3F 2UXCJ 4EBDA 1WDTA 1Y10A 2QN6B 1T11A 2Q6BA 3TA2A 3K5LA 4DV5J 2G0JA 2DXFA 3NG8A 2WTFA 4L72B 4C8LA 2YTCA 1RE1B 3JSBA 5KFSA 2ADBA 4K5SA 1XMQJ 1UVLA 2B6AB 2F7VA 1VDHA 4DCOB 1RTDA 2W2PP 3GWCA 2XLJA 3D68A 3MDFA 4DX5A 2WONA 2GQCA 2UUBF 2BRKA 2RDDA 3MEGA 4NZ0A 5HVFA 1TUWA 3NWRA 1KWMA 1TMMA 2FVSA 2C28A 1KOOA 1IBLF 3KKFA 4K2XA 1C4CA 2QRRA 3SSSA 3KLEB 2YX1A 4XDCA 1YRTA 2G1DA 3E01B 2XLIA 2CQ4A 1L3TA 1YJRA 3RG6A 3M8SA 1YDLA 3NS7B 2RU9A 4ZOSA 2HLUA 4NPOA 2E44A 5E3PA 1F5CA 1PCAA 4IG3A 1Q8LA 1U8SA 4P2SA 3DGPA 1S79A 2IJFA 4X4VA 3EE3A 1R0AB 4LF7F 2DNRA 2B8QA 1S1XB 2BV3A 3H2UB 5KG2A 2HBRB 2DJWA 2JEJA 3DRPA 3I0SB 1TP7A 8AT1B 5FLXY 2XMMA 3BKFA 3VVUA 4YQWA 3H2VE 2PC6A 2R8JA 2ZE2A 3CF5Q 4B3SJ 1Y0HA 4HT7A 1VBZA 2QLXA 4XIUA 3GE9A 4J9VA 1N52B 4WPAA 1UFWA 3JAMU 4DL6A 3U7JA 5EWFA 1VRTB 4Q0BB 1TL7B 1VYAA 4PQAA 4C9DA 2BABA 1H74A 3J7AN 2EWHA 2HLTA 3OVSA 1REVB 3NKYA 3KNAA 4J5OA 3KJVA 5LSOA 3HJVA 2VA2A 3VR1A 1BY9A 3ZNJ1 5CZXA 3MAQA 4C0HA 1N6QA 2UVVA 4UT4A 2EG1A 4M5KA 3GIJA 5BR8F 1S4FA 1RAAB 1KKHA 4FNHA 3NMRA 1FJCA 3T1HJ 4A48A 3VAFA 4W4MA 2DO0A 4DR4J 2Z2LA 3T9NA 2VQFF 3HHNB 1R3NA 2EFPA 3GTYX 3MPVA 4HH0A 3SZ2A 5ETOA 1QY7A 1EQMA 1Q78A 2RE1A 4WXOA 1FE4A 4Y65A 5KFEA 4OZ3A 2X3DA 2DNPA 3DLGA 4Z7CA 4ZJQA 1SI9A 4YUDA 2EC0A 1OMSA 3VCDA 3CULA 3FEXB 3K7RA 1B0VA 1X8DA 1LWEB 4U8VA 5DGAA 2KXHA 1H2UX 2A2DA 4U95A 1KHVA 2E7VA 4CO0A 5F0WA 3TO8A 3GIKA 2DHHA 4H54A 1YHQS 3RR8A 3MOZA 3K0JA 1TKZB 1NU4A 3LGMA 3OQ2A 2FVRA 2CPIA 4WXWA 1M5VC 4JYAF 5HN0A 3J7YI 2BJ1A 1U25A 3OJSA 5F3ZA 4RWWA 2MMYA 3EMTA 5M2RA 6FDRA 3THPA 4IG0A 5LMUF 3BM7A 2ASJA 3QMQA 1K1QA 3UQSA 3MM6B 2XC9A 2OTLS 3V4IB 4JI8J 1UWBB 4LF9F 3GIMA 2CQDA 3P49B 3ZZRA 2D3UA 3LF0A 4CO1A 1SQGA 2GQQA 4GKKJ 4N7TA 3MCMA 3DRPB 3I0SA 3I32A 4C4WA 2YWFA 4LR8A 4MK8A 4QIEA 3DC2A 3ZTQA 3GJTB 2A1BA 4NA2A 4B3RJ 5M2UA 2JL9A 2UU9F 4FBUA 4JI5F 2DK2A 1CJKB 4J90A 4PUOA 2OO4A 4P74A 1FKOB 1NDKA 4JI2J 1U09A 1VQYA 3GU0A 6FD1A 1VJQA 3C8YA 3UO0A 2MKSA 4KSEB 1RAHB 3DLLQ 1SIZA 3M8QA 3KXDA 3TW0A 5HATA 3PG9A 1C1BB 2W7AA 2YBVA 4I4BA 3PX0A 3IWNC 4X84A 2R7UA 5J1NA 3A3NB 2GNKA 5A8RB 2X51A 3QLHB 4TXSA 3SI8A 2RRNA 3EDRB 1Y5IB 4OJ3A 1HNXJ 4UOCA 3HSJA 3LGNA 1RWOB 1RT6B 3S8SA 4X64J 1PG5B 5GAHU 2KKHA 3D6TB 3CPWR 4EZ6A 3EVMA 2G1HA 3PEJA 4ZN3A 3TI0A 4HDGA 2GIQA 3PCOB 4K5RA 4DLEA 1K8AT 3I5CA 1Y5NB 4KV8A 4UOGA 4X62J 2R2RA 3VTIA 3DMJB 3NRBA 3IC1A 2DHAA 2EKYA 4Y00A 3HFZB 2IJRA 2RVJA 3DOLA 4AXJA 2KM8B 2AJ2A 8ATCB 2HS4A 3K58A 1JLEA 2JRSA 4JB8B 4RU2A 4WBFA 1DQ8A 3DU5A 5CYQB 5L8RC 5DETA 3QJPA 2APOA 2D3O1 2G0IA 2RUSA 2CPJA 3I5BA 3CMAS 5JVHQ 4NLOA 2WB1D 5D4OA 2F8MA 3BH6B 4A8SA 3D0GE 5CQGA 4CLFA 4DPTA 4DUYJ 1ZM3A 1HBOA 3JB9k 1H2TZ 2QLFB 1RTIB 3IXQA 4DSEA 5BYSA 1R7IA 4AXIA 4HTJA 4DR3F 1CBKA 4OV6A 4F4ZA 2BANB 2NXUA 5KG0A 3J7A1 2CPFA 4NLUA 2HNDA 5K8MA 3TVKA 2VG6B 3DLEB 1F6TA 1DLOB 4NWBA 3UR3C 5KG4A 5F3TA 2C22A 2Q1LA 4NEZA 3FEYB 3SDEB 3O3LA 1GXLA 1W26A 1PJ7A 2RS2A 2DRBA 4LF4F 2ALZA 3HX9A 3KLGA 3PX6A 4DR6F 1F60B 1FXDA 1TU0B 3G82B 1N0UA 2P9CA 4K4YA 4I7FB 2ZH8A 3OD2A 1TL1B 1SC3B 1Y11A 3KHLA 3G82A 1CJTB 4PUOB 4A8XA 1IKVB 1R0BG 1S1TB 2Q3PA 3DOMB 1WHXA 1X5SA 1IJFB 1NK6A 1Y4ZB 4FPRA 4LF5J 4NLTA 1WG1A 5GADU 1FJEB 2V63A 4XPEA 4RUHA 1QTMA 4ES3A 2ZHOA 3GZ7A 2KT5A 1WF0A 2HGLA 4WJBA 3FZBA 4NE9C 1URNA 1JXEA 3OTOF 3H7HB 2VONA 4M5IA 2DGOA 4PYAA 5IV3A 1OS5A 1D9AA 4F0HA 4X65J 2RDIA 1A7GE 2AX1A 2QLWA 3QT8A 4I2PA 4ZP6A 3W2VB 4ANCA 1NHUA 2ZH9A 3IR5B 3GG0A 2O67A 1U7LA 3UDLA 4DX8H 4DWIA 4EMDA 5HBMA 1P1TA 1EP4A 1FERA 4TVAB 3MAHA 4CQ1A 3TARA 2MTLA 2VUGA 4WYWA 2GVDA 4TKTA 1HNWF 2R7TA 4FYDA 1YBTA 3PR5B 1KC8T 3CMES 3PXGa 1ITPA 5D15A 2ZBCA 3ZZUA 3L3CA 1VBYA 1SL2A 4K50A 2EBGA 3KDNA 4AUKA 2A6OA 3DKDA 1BE4A 1TV6B 3HHLA 2J8SA 2BJ9A 2V8VA 4ZVOB 3RB0A 2CPHA 2OMLA 4M63A 4U7CA 1KNZA 1RT6A 2H3EB 2MQNA 2O01C 1XMOF 3CIMA 2N3LA 2GVZB 2RD5C 3D7SB 1S1VB 1MMDA 2E1MC 2YKMB 2C2ZB 4I6AA 3LTOA 3QLHA 4NEYA 4NYPA 5HLFA 1LW0B 5C7PA 1S9GA 3ADAC 2AYBA 1QSSA 4LF9J 4MIAA 2XZTB 1XR7A 2MY8A 2OD4A 1M5KC 1OJ4A 3NEKA 5LMUJ 4ERDA 4DG1A 3GFHA 3PO5A 2KZZA 1QD1A 3R5BA 5D0EA 1RHRB 5HQMA 4DF8A 1U1LA 4DN9A 1Q86T 4JYAJ 4HLBA 2JH3A 1EJ7L 1JLFA 2CKWA 2CWKA 3C6TA 1OY9A 3CDAA 3PO4A 1TTHB 1N34F 1IKWB 2JJ4D 5HJXA 4C8KA 3U1LA 3FMWA 3A8KA 4RR5A 3K5MA 2Q79A 4CO3A 4BWMA 2LMIA 5I4MA 2XYHB 4NXNF 4OYMA 4CLTA 2C42A 4LQ9A 2E1RA 3LPEA 2OFGX 4X65F 2AWZA 2RSQA 2Y1JA 2IVMA 2G13A 3Q23A 3CE8A 1X4GA 4ENOA 1U1KA 4JI3F 2WB4A 1LW0A 1HA1A 2LCWA 3UCUP 3SDEA 1UL3A 3IAM9 5L46A 2LP4A 3I56S 1VQOS 5ETVA 2E5IA 4XK8C 3QJLA 2VG6A 4HHJA 2HNYA 3DM2A 2BANA 2M7SA 2CJ9A 5GADI 4MKVA 2GVZA 3N5BA 1JJ2R 4ZLJA 1H3DA 1NB2A 1RWUA 4ZVHA 2R7OA 4FF2A 2AJQA 2KVQE 2A6MA 1XN9A 1MMNA 2FTRA 2W2MP 3C66A 3KG1A 3RYLA 4DL7A 3QZ7A 3NGTA 3TUZC 2X1AA 4GKJJ 4HHHA 2R8GA 2N4CA 2NS1B 4LF4J 4F3OA 3K8VA 1NKBA 2QZ8A 4PG5A 4PYDA 2J5AA 4DZDA 4M5NA 3LP1A 3UN2A 3HVRA 4PQUA 2K1RA 1WJ9A 2AJ0A 2ROGA 2RT3A 4LRCA 4P2MA 3T6BA 3FFIB 1TKTB 4RW7B 3CJ4A 4QW9A 1E6VA 1LXNA 2V5HG 4DR3J 4RBTA 4LFAF 4QWDA 4RZRA 1O0PA 4QOTA 4LSNB 2XY6A 3DDNA 3VALA 2YX4A 3FCVA 1K73T 1I6JA 2CQ0A 3T3FA 1SBRA 5ETQA 3T41A 3CCLS 4M95A 3VAHA 1JMTA 1AROP 1LK7A 1SH0A 2OHDA 4IFYB 4KYZA 4TN2A 1WHVA 1S1UB 4KKOA 3MFHA 3FDSA 2QYGA 3MOJB 2RHQB 4JP8A 2AX0A 2JOQA 2V2VA 3GJRB 5D0HA 4DSKA 3NBPA 1UA1A 3QNWB 4DJBA 4AFFA 3M6VA 2KFZA 4URQU 2HHPA 2YNHB 4IO1A 5K14A 2CJKA 5J2MB 2AZ3A 2RILA 2C3PA 5D77A 1U2RA 2ZEJA 3A13A 4X62F 1QVGR 1JXLA 2BJ8A 1W2IA 3BN7A 2D74B 1FKOA 2FB0A 4NYZA 5CYMA 3IRWP 4YS2A 1TQLA 4OI0A 3DYAA 2DNZA 4K2JA 2MDAA 5M2PA 1IR2A 4K4ZA 5HMWA 1JLGA 2GGPB 4PEOA 4Q5VA 3FVYA 2UXCF 1IKYB 4EUVA 1QE1A 3EYZA 3L09A 3TQEA 1ZTTA 5D6GA 4GC7A 1ZS6A 3NCPA 1RTIA 1WG4A 5KT5A 3KJQB 3MM7A 2NSCA 2V34A 1AT1B 2M5YA 2MSTA 3G2XA 4RBVA 1ZZFA 2O1PA 3FMBA 1N5TA 5DRKA 2H5IB 4JI2F 3R9LA 4ZCMA 3RR7A 4JI7J 1B99A 2J6SA 1JKHB 3HHLD 1U6FA 1MROA 4Z2XA 5C25A 3UD3P 5LT5A 3QQCD 3UDEA 4ZIVA 2ZBIA 3KK1B 1KQSR 2H5JB 4W92B 3NNCA 2PD1A 3K89A 1F3VA 1FDNA 1RT7B 1FK9B 2E1PA 2FHKA 3NS6A 3M32B 2MZSA 4KQZA 4M5GA 2XWYA 3ZZZA 4CH0S 3OUYB 2WSCC 4DR1F 1GXTA 4ALZA 4OYPA 4E98A 2IMWP 4OZ1A 3M8RA 3Q2TC 3CEDA 2VFRA 4F3QA 2CQGA 2K1RB 2ZBPA 3TP2A 4IRKA 5DDRC 1IQTA 1K1SA 3R3TA 4B9NA 2XO7A 1C0UB 2HIYA 5KFXA 1HHQA 2KVIA 3QT5A 3C6UB 1HWJA 3HF5A 2PMZD 4X4QA 1I1GA 2Y1IA 2HK2A 5FIIA 4K4SA 1CPZA 3M30A 3O5TB 3BB5A 2AEJA 4OX9J 3QFHA 2KJVA 2WSFC 1R8PA 3F41A 5IQ6A 4LF6F 1FCAA 3JSRA 3O6QA 4WFNQ 3CSKA 5A8RA 2HWTA 2CJXB 3PJWA 1YBUA 2CQBA 5F9LA 4Y0FA 3MUMP 3CCSS 1O5JA 1W7WA 2LYVA 3R5JB 3OSNA 4DR2J 4DV1J 5IXUA 2G4BA 1P1LA 2QA2A 1LWCA 4OYXA 5J2NB 2IAJA 2V67A 4FN5A 2Y1LB 3B4MA 4KE5A 2KT2A 3R7NB 2FIUA 3R5DA 1L3KA 5A76A 4CLPA 3DRRA 5C42A 5IS2A 1FJGF 2W2NP 2NCKL 2OPSA 3T1HF 1MG7A 1SIWB 4TY8B 1YJ7A 4C2MA 3LOUA 2W9BA 4DFKA 2C2OB 1OSCA 2OPQB 4NLPA 4QIWD 1NK9A 2XHCA 5F8HA 1FD8A 4NMLA 4USWA 2X1GA 4F0KA 4RNFA 4J9RA 1BQNB 1FRJA 2ADCA 3HD2A 1HYSB 4WK1A 4C8MA 5DDPC 5HL7Q 1WSVA 3JTOA 3SFGA 1N36J 1YBAA 5ETTA 1PIEA 2PFDA 4RO0A 2F63A 3AD7C 2FZGB 4ZVSB 4DUYF 2UZAA 1V3RA 2Q6CA 2GW8A 3H5SA 3R5AA 4I1TA 2UXBF 5D4NA 1XR5A 2QIFA 2NUHA 2IBOA 3AQPA 2PSZA 2ZOGA 3PRDA 4OZ0A 3U02A 7AT1B 3HXMA 3THVA 1RK8A 2DGVA 4GVBB 2R2SA 2HQGA 1CS4A 4PWDB 3FFIA 4P7TA 3CDEA 1BMQB 1X4AA 2EFGA 5F8NA 2WONB 4J9LA 2R4FA 2G9OA 3LW5C 3RBEA 2Z4PA 4WFXA 1SJ1A 3CDUA 1UEVA 2XM3A 1X9MA 1HWIA 4MFBB 4FXWA 2AW0A 3IG1A 2HNZA 2N4DA 2QLJB 2XI2A 1HQEB 4S0MA 4ZHRB 4OFZA 2BYCA 2DNYA 3J80Y 1FX4A 2W25A 4ZJOA 2QL9B 4V19X 1JJHA 1FRIA 2BVZA 3HULA 4RW6B 2ROEA 2NXCA 3I4HX 4P72A 1N36F 5KFDA 1N33J 2LXUA 2UUBJ 3N79A 4MAKA 2QO3A 4ETXA 5HBMB 2PFFB 4I68A 2R2TA 3M6XA 5HVGA 4N77A 3UCGA 1JX4A 1X5OA 4NLWA 5E3CA 2E9TA 2MEWA 3JYTB 2FVQA 4JI3J 3NMAA 2P5VA 2PA8D 3W2VA 3W5XA 3WBZA 4ANEA 3QRRA 4RNHA 3DOKA 1R27B 2B9XA 1RU1A 3OL6A 3AD9C 4DV5F 4FKYA 3M8PA 4DV3J 1TL7A 3Q86A 3QGIA 3DFEA 3WDOA 1WG5A 1N5SA 1WF1A 3AHPA 3H5UA 3BJYA 3SV3A 4DSIA 1IKYA 2HVEA 3D3CJ 2DNGA 4I56A 4CO2A 3DOMA 5C42B 3NGDA 3E51A 1T7PA 1NK0A 4FF3A 4ZPCA 2HGNA 3SSRA 3W3SA 4L6V3 2PIIA 5LSRA 3MGJA 3MM9A 3V5RA 4GO5X 1TUVA 5LMNJ 4F4WA 1TKDA 1PGZA 4X4UA 4OHVA 2HVIA 1ZPWX 3G86A 2CJAA 4CLZA 5IWAF 2ZZMA 5GAGU 5AE2A 2V2QA 2OKQA 3KFWX 5F8MA 4QIGA 1PAUB 2M52A 1HFEL 3MPYA 4Y2CA 5B09A 3CD6S 2RMLA 2EXUA 2MKHA 3HHDA 3T5LA 3M30B 5KT3A 1NJIT 1LWFB 2VG7A 1W25A 2MLXA 4RUAA 3VGSA 1MN7A 2KDOA 3VGUA 3J7ZT 1HNZJ 3G87A 2KG0A 2WSEC 3ICLA 2DT9A 4N41A 3PRVA 3IG1B 1RKIA 5DZ6A 4O4GA 4R0JA 3U1MA 4C0BA 3IR7B 1MU2B 3V81A 5I3UA 1RTDB 4DDFA 4NLGA 2VFSA 1AZSB 1PYTA 2XYGB 3ZZPA 4PXDA 5L9NA 1T9UA 2HGMA 4HEA9 1MLAA 4OLOA 2C2KB 4A47A 5GMKa 2NQPA 1Y3JA 3BKTA 4RL1A 2AGQA 1KP6A 3TJ8A 2GJ2A 2YWHA 3ENWA 3SQGB 3CC2S 5FDLA 4JI7F 3IO1A 2MPUA 1DQAA 2CG8A 2RF2A 3OR1B 4P75A 3OW2R 4ED0A 1N32J 1HNVB 4FF4A 1TL5A 2I1RA 2YKNB 4DL2A 4LRBA 3W5ZA 2HZAA 3EICA 3BGRA 1X9SA 3FK4A 2XMTA 4PXCA 4KHPJ 1LKZA 3BPSP 4I2PB 1RAJA 2KN4A 2D41A 1U6ZA 2GMHA 1U2CA 2P6TA 3NGRA 3K57A 1XC9A 1DBDA 1S7IA 2H51B 3EDQB 1N88A 5E5NA 3EGZA 1ULRA 3ZZYA 4DV2F 1Q4RA 4O3NA 4OJGA 5H9FJ 4J9UE 1ZAVA 2GQ2A 4PXEA 2CIMA 3R7BB 5JJBA 4R5PA 3GIIA 2MHNA 2YNIA 4NLVA 2Z2YB 5DDOC 5CZVA 1FJ7A 2B5JA 3HKZD 4ILMA 2GHWA 2HFNA 1C1BA 2JVRA 1FFSB 1HWKA 2HS0A 3AJDA 3SCLE 3CDWA 3VQTA 4AD6A 2J6TA 2F4VF 3S01A 1CJKA 1BWEA 1HD1A 2RH3A 4F4AA 3NAHA 3AH6A 2JC1A 2AHOB 4GMKA 1XQIA 3PJ9A 2MQPA 1TKXA 2HQFA 2ZC3A 2VBZA 4USKA 4PPDA 1P9QC 2QTWA 1NM2A 1XR6A 2K3KA 2F8EX 5KT2A 4F4YA 1FNXH 2J6UA 1DLOA 5LL6d 1ZTWA 1RT1A 2F3JA 5DDQC 3RBDA 1RDRA 3AOCA 1KHWA 3FBEA 4NLDA 1L3VA 2HEKA 2FDNA 2ZH6A 1SB6A 4DR4F 4EEYA 3OLBA 1H98A 3RTVA 2YKNA 3W66A 1JLQB 2ZD1A 2YWEA 4IFVA 2PI4A 4KPYA 3ITHA 2E5JA 3CCVS 2POKA 2EFOA 1NPKA 3PW5A 1B4SA 2WBRA 3HT0A 1HBMA 5AJ3F 4IR1A 3EGNA 3KG4A 2Y8YA 2F4VJ 4DQQA 5F0UA 4QR1A 4PAAA 2C2MB 3ZTPA 4CT8A 1P9YA 2CQ1A 2W4DA 3HMJG 4J9PA 2FHOB 4PQUB 2JVOA 4ZHRA 4YDXA 3L4BC 2GC8A 4P73A 1X60A 4M94A 2D3ZA 2PEHA 3CB4A 4I2QA 1WKJA 4A8OA 4ZLNA 1CULB 3NXZA 1NJXA 4QU6A 1ZH5A 1FT8A 2VG7B 5U47A 3NP5A 4KGXB 3AFGA 3ENAA 1OYEA 3D6HB 2FPHX 2MQ8A 5CCLA 2QA1A 2IMOA 2KFNA 5F8JA 2HBYB 3OXFA 3MCOA 4ATNA 3GB0A 2WAQD 4NOHA 4ED5A 4NXNJ 2RS8A 2RRAA 4BC7A 2Y1RI 5HI7A 4TNOA 1XWLA 5GVQA 4B17A 3PR4A 1RWPB 5I42A 1LWXA 1PBUA 2QLBB 3BSCA 1IR1A 1VIOA 3LANA 3CC4S 3ZO7A 1B7FA 2UUWA 2BKOA 1U0HA 2GMLA 1FDBA 5AE3A 1RBLA 2KRBA 2V2ZA 1T9VA 1VRTA 3CCZA 2VPYB 3UPFA 3PFEA 2Y9HA 3EGWB 3H59A 1FEEA 1U0HB 2I8EA 1EKRA 1XMQF 1W2BR 1S1TA 1F2HA 2HZCA 2PEBA 4QR2A 3HK2A 1P8GA 1RHQB 1WEZA 4KC5A 4A8QA 1HI0P 4ZPWR 3OXLA 2VB6A 5KAKA 4IH7A 2MXYA 1RKJA 1U4BA 1RT2B 5A8KA 3GSIA 3I6PA 3JSMB 2VICA 2CPEA 2NSBA 3MMBA 2DIUA 3D9BA 2ZDPA 2AD9A 1VQNS 3DGVA 2QE5A 3EPIA 4K7QA 3DGPB 3CUNA 4TY9A 1YTYA 4ED6A 2DO4A 1DJ0A 3CCWA 2L9DA 3CGIA 4RLEA 5KOXA 5JMNA 1DTTB 3Q8QB 1EIYB 1D9FA 3T5JA 2XY7A 5KFIA 2YQ0A 4NLRA 2ZH7A 2VV5A 3M2VA 1SPBP 3W9HA 2ATCB 2L3MA 3GFXA 5LXYA 4DLGA 1C0UA 1LQ9A 2HK3A 1C2PA 4BHQA 5IV4A 3HPOA 1RT3B 4EGLA 3IFEA 2EVZA 2BE7D 2LQ8A 4P9SA 1GEHA 5KFGA 1Q82T 5EX3A 2D9OA 5SUHA 2YWKA 4F25A 4EBEA 4K4UA 3ZZTA 4C7QA 3MEDB 4DL3A 3FQLA 4X66F 4EZ9A 2A18A 1RAFB 3DN9A 2HW3A 3C15B 3D67A 3AAWB 1S1WA 4AQYJ 3OJUA 2RQMA 1S9EB 3PTWA 3KLHB 4QBUA 2L08A 1O6XA 9ATCB 2ACYA 1U47A 2RRBA 5KFKA 2ZZTA 4KJIA 2DR6A 2OEMA 5EUHA 3ZTSA 2IA0A 4RNNA 1VQ6S 3KK2B 2XSJA 1DARA 4O4RA 5LJ3Y 3GR1A 2GIRA 1OIAA 2OLWA 4UZCA 2IBKA 3BREA 3N6MA 4YB7A 4DUTA 3QFWA 4U8YA 4EFAC 4O3RA 4FF1A 3GCXP 1S77D 4WE1A 1N5QA 4EYHB 4GVLA 1X4CA 3H20A 4CT9A 1T03B 2W7PA 1KLMA 3R1HA 4EI2A 2UUCF 1ZM4A 4OX6A 1BXNA 4KAIA 2ZHAA 4DXLA 3L9ZA 1Q8BA 1YJTA 1FEHA 2MQLA 2ZM6F 1F5BA 1JLAB 1T9TA 2CAJA 3HVTB 2VKRA 1NDLA 2AF6A 5BXIA 3M7VA 4ETZA 4IRDA 4YHHJ 2VHGA 1TKXB 4H4MB 2DEIA 4USIA 4USMA 5D3GA 3CCUS 4OV1A 4CYUB 2KL8A 4KPCA 2XNRA 4CCHA 2OH2A 5IT9U 4TQRA 2W9AA 3Q89A 4QZVB 5J1EA 4IOAQ 2GHVC 2IAJB 2E5GA 2XCPA 3Q8RB 4DS4A 2HFUA 1HBNA 4Q7AA 3X1LB 4X4TA 3VV2B 3TZXA 1R6VA 4RNMA 3FBCA 5A8WB 1SJFA 4KGVB 1QTNB 1N4LA 2R7XA 1YX2A 3QO9A 1KQGB 3MI7X 3MM6A 4ID5B 4R8UB 3MUTP 3MD3A 1VK3A 2FC8A 3NCQA 3ET6B 2PT0A 2LEBA 3M8YA 3G96A 1I94F 2UVRA 5H1SV 3D2WA 1VISA 2Y3YA 3KHHA 2IM2A 4YB1P 2NYHA 5ETNA 1NLKL 3OTCA 1SVDA 4DL4A 1TKTA 4B9TA 4OLPA 1NK4A 3NNHA 5CA5A 2VFUA 3JTNA 2ILYA 4N76A 3OR1A 2CPXA 3A12A 4HACB 3B82A 1HNIA 3CO9A 3I96A 4OHWA 3VQSA 4DV1F 4DR2F 4ILLA 1AW0A 1D09B 3A3OB 4U6PA 1HW8A 1RP5A 3MTJA 1DURA 4H4KC 3G6ES 5AXKA 2R8HA 4BS2A 2M8DB 3N0VA 4ELVA 1URRA 1NK7A 3D5MA 3MECA 4FYWB 1WF2A 5EWEA 4JV1A 3GR0A 3QO9B 3HSGA 4NCAA 4ZCLA 4CM2A 4USTA 3GV7B 3MPUB 2QL5B 3ISND 1S48A 1VR6A 1FTRA 2DHGA 2LXFA 3GONA 4X66J 2ASDA 2FJXA 3LPYA 1Q7YT 5A8WA 4DV2J 3NCRA 3VAMA 2AU0A 4JI5J 4NXMJ 4QW8A 2CRLA 3JQMA 4HHUA 1TK0A 3DI6B 3MM9B 4NZ6A 4CNYA 4H4MA 3Q0AA 2IPOB 5CYMB 3RRGA 4I7FA 2FJVA 3NOCA 1WI6A 3IA0A 3DYAB 4KHPF 4LFBF 1RI7A 5SZTA 3QWPA 4NXMF 2H5EA 1VC6A 1S97A 1YLXA 2KU7A 1WD6A 5E3QA 2MHEA 3LWLA 2OAUA 3W63A 1WTFA 2ASLA 4DQSA 1B7YB 3PKYA 1J5OB 1VQ8S 4ZLLA 3BV8A 4D3GA 2GCFA 1NHKL 4MJKA 3HT3A 1KR4A 1QDUB 2C3YA 3R97A 2QC3A 4IFYA 3KOAA 2WOMB 3POTB 3MWBA 4L3KA 3P4UB 4MT1A 2KO1A 1RUSA 2W4CA 4CO4A 2FGCA 4IG3B 2XYPB 4ECZA 1EETA 7FD1A 5B7WA 4KFBB 2HURA 1S6PB 4J9NA 4TYAA 4DR7J 5FD1A 4C11B 3GLJA 4ZP7A 3D1HA 4ES2A 3UW1A 1RACB 2FYXA 2J8AA 2YWWA 4IYQA 3MMCB 2NXJA 4DFJA 4WP8A 2DNMA 1TV6A 3HHLB 3WQPA 4DI6A 2GIFA 2HNZB 2WBMA 2IHR1 4JI4F 2UV8A 1S12A 2DBBA 4ZLPA 1RT4B 4EWTA 3VAJA 2FVPA 4LRDA 4DPYA 3PRBA 4DPWA 4A8MP 2JFKA 1JXVA 2E5LF 1EHWA 2D7SA 2PMHA 4OI3A 5KFYA 5LSLA 5DG7A 4DPXA 3CDBA 1Y9OA 1FWLA 3CJTA 2W2QP 1PO6A 2HNYB 3DM2B 2GJFA 3P3DA 1RHKB 3VGVA 1K44A 2EFVA 1S6QA 1TK8A 2JNJA 1WOSA 2ZHBA 3E3XA 4CNZA 2CZ4A 1Q1KA 3P8BB 1WC3A 4NI2A 3CJ2A 3AB2B 4X4OA 2MGZA 1UPMB 2DY9A 1PBAA 4WFAQ 2JLGA 2EK1A 2M4MA 2JDJA 5LM7E 5KFMA 2EFNA 1REVA 3POTA 3QSIA 4YHHF 2CQHA 2DNKA 2F5GA 3D54A 2O5DA 2ZE2B 2ZVIA 4GKJF 2VD3A 2ZM6J 3FKBA 2OPSB 3QPIA 1UJ6A 4RJVA 1N5YB 2MKIA 3K8WA 4ECTA 2VBWA 4PRFA 3LP2A 2DNHA 3FSYA 1M1GA 4TLQA 1WSRA 1UEKA 2NYIA 3RAMA 3G8SA 1DTQB 2IJNA 3HVAA 1RXOB 4YB5A 1SQEA 1LEOA 3ILJA 4B3OA 1XTZA 3WIVA 4HTIA 3IP0A 3K17A 2OI2A 2ABYA 2Y0SD 5IT9Y 1RWVB 3R2DJ 3H42A 1APSA 4WKYA 4FPIA 4MYUA 1I5OB 4ECVA 1X7VA 3J80U 4AQYF 1RA6A 1X4EA 1UFKA 3HSZA 5IQQA 4ED4A 1OO0B 1FKAF 2PE8A 2OIHA 2FJAB 4WTOB 2F40A 1LWEA 2GMJA 4OYZA 3ZC4A 4WF9Q 3KLIA 2V8PA 4ICLA 1B3TA 2BW2A 4D3HA 4IKAA 4KIAA 2UXBJ 2AV5A 2QV6A 1CULA 2AEMA 4YB6A 5C24B 2DGWA 5F8IA 4F4XA 4WFBQ 4LFCJ 3R1LA 1X31C 3R2CJ 5F8LA 5HK4A 2XHWA 4HACA 5HQ8A 3MAAB 4LFAJ 4U7UD 2KI2A 5FDLB 3TEHB 4A4JA 2FLPA 2ZVSA 2O66A 3QJJA 4DPOA 4RW4A 5CHCB 4P7VA 3W2WA 1S6OA 3OTBA 1FKPB 2EW9A 4ELTA 3J81Y 4ECWA 1VC5A 4LQ3A 3C16B 2EFQA 5MLCV 3BR8A 3KUGA 5K9FA 4LBIA 2GA7A 4DOZA 1YG0A 2EKNA 3B78A 4Q45A 5L1IA 2BM1A 3NGSA 3OR2B 2XNQA 1IBKF 2ZH2A 3K5PA 3HZEA 3EVWA 4ER8A 3N4WA 1LWFA 2V9KA 4IH6A 2QMUB 2C3OA 3BGOP 1KTQA 4DHVA 1KLNA 2CWXA 1RTJA 1KS2A 2C2NA 2IDEA 4TY8A 1S57A 2JC0A 5EHHA 2JEFA 4MKYA 3FCHA 3PW0A 2J76E 2YQ1A 4P2FA 1KVKA 1NEEA 1H72C 2KJWA 4CYUA 5L1LA 2HWHA 1HNWJ 1PSDA 3SV4A 1TL1A 1BQMB 1I51B 3HFVA 1XNRJ 1DTQA 1SV5B 3BBFA 2AJ1A 4EO6A 1FHTA 2FQQB 2KRRA 3LP2B 5GAHI 4UUWA 3V6DA 3CIZA 5ETKA 1LK5A 3DLEA 2BQUA 1SKRA 2M9KA 2ZJQQ 5K8OA 2DH9A 2C2DA 2M0GB 1PYSB 2FLNA 1EAYC 5L39A 1N48A 1FF2A 2E1AA 3NBPB 5IWAJ 5A0YA 3BQ2A 4IDKB 2UUAJ 2JZ5A 4LF5F 3AT1B 1OYDA 5CXTA 1Z2ZA 2B6AA 2DPJA 2RF2B 2HWIA 1EKSA 2EG2A 2J9DA 4OI2A 4QIVA 3SQGA 4C3LA 4FXDA 1YSJA 4ZCKA 4BC9A 4B3TJ 3BN4A 3PDNA 1XMOJ 3OL9A 4RW7A 3D4JA 1UVJA 2AZ1A 2C3MA 1VRQC 3W5YA 1XIQA 4QWEA 4UY8T 4TQSA 2ZJRQ 1SH3A 3KTQA 1HIYA 1UVKA 3N6NA 2RKIB 4ANDA 3DMJA 3BSNA 1KVJA 2BMBA 3BGFA 4G1QB 3ZZ0A 4NCGB 2BQ3A 2VU5A 4LREA 2BUNA 1JKHA 1RAGB 1RU2A 4YN3B 3WIUA 1F1BB 1HQUB 3MMAB 1UCNA 3OTDA 1HI1A 2VH7A 3BF4A 4LFCF 2DY1A 3LAMA 1M90T 1RTZA 2K7KA 5E3AA 2WVEA 5ETSA 2LQJA 2MJNA 2Z2MA 1ICEB 3OPKA 5EN1A 3IBCB 5JXSA 3PIPQ 5K20B 2ZITA 3RW7A 4DSLA 3N01A 2K2PA 2VIHA 4DV0F 1GTEA 3DCAA 2V4JB 2CNLB 4H4OB 3G6YA 2DGSA 3W7BA 1FRKA 5ETMA 3I87A 2QMXA 3P5BP 4RBUA 5B0GA 4KGMA 1PJ6A 3VGTA 5KFTA 9RUBA 2B7CB 3A3PB 4P10A 5J1EB 3TUPA 2VG5B 1C0TB 4TU9A 1HPZB 3OHAA 1RT5A 3CD5A 4OJ1A 2N7CA 2ZUGA 3L7UA 1CEZA 4OI1A 2LA4A 4LT6A 5ETPA 1YKWA 1IM6A 2WHOA 1TVRB 2FC9A 5LXRA 4J9OA 4CRJA 1HQ2A 2NXEA 3DRSA 4IG0B 3NAIA 1UW4A 5EX0A 1TELA 2E7WA 1QAJA 4B9UA 1SL1A 2PI5A 3V4IA 3HP6A 4FKXA 1B0PA 2GS8A 1F2GA 1NMEB 1IR0A 3UR0A 3KYLA 1U24A 3A8IA 2XSJB 1NUEA 3PZPA 5KG6A 4DR6J 2OGUA 3DI6A 5AT1B 2BR0A 3R6LB 1DAXA 1GMWD 2VPZB 2FHJD 4AT1B 5KFOA 3DRXA 5EDWA 1RISA 4Y2AA 1X4FA 1U1RA 4X4NA 3BS9A 3DXSX 4DL0C 4MK7A 5DM7Q 4PCQA 2BKNA 2PMWA 1ELOA 1H7XA 3IM8A 4XAKA 5BJRA 1NKEA 1GAOA 3CC7S 2QGFB 3KDOA 3LP1B 4ECUA 2D1CA 3GYXB 2VC0A 2CPZA 4KO0B 1Q7LB 5E7OB 5HQLA 3PM9A 4JI4J 1RT4A 3CCJS 2CQPA 1TUGB 4C3KA 3HM9A 2YKAA 4G1QA 3X3UA 3RB6A 1HR0F 4LRAA 4MIBA 4WIQA 2GO9A 2RKIA 1NDCA 4RWXA 4FYVB 4JI8F 2UU9J 1S0NA 4DV4F 2OSRA 3RRKA 2QEXS 2HVDA 1VCTA 3ZTRA 4CLKA 3D6MB 4MTPA 4QYRA 3G8QA 4YMEA 3G6VA 3BQ0A 5KFFA 4DR5F 3RB4A 1TAQA 3C3LA 4LF6J 1FNMA 4JI1J 1RQ0A 3N9UC 2Z2ZA 1N34J 4J9QA 3CJQA 1KQFB 3TWZA 4KGKA 3JQKA 4GVBA 5ITHA 3SCKE 4DL5A 4F2RA 1G2EA 4G65A 2UVUA 3UN5A 1HL6A 1TL4A 4EYIB 2AYGA 1HYSA 4JUZA 3EXCX 3ENVA 1LFWA 4LVNP 1FVQA 1UJ4A 1A0OB 3OFFA 1SUQB 1K47A 4Q0BA 4X2BA 4OZ2A 2HKEA 2VPWB 3TZWA 5G4DA 2DHXA 1Q16B 4CTAA 4AL5A 3H8YA 4LFBJ 1FNOA 1NDPA 3MPWA 3QWUA 1J5OA 1SC4B 1YZ7A 2EEYA 4QWBA 2W9BB 4IR9A 1B0TA 1Q5YA 2I0XA 1G3OA 2VG5A 4ZN1A 4RW9B 3QAEA 4PG4A 3TEGA 4RW8B 2KFYA 2ZH4A 3V6KA 2FJWA 1HHSA 5BR8J 1OWXA 4Z37A 3IBWA 3OFEA 5I42B 2E1CA 3D1QA 4QYZJ 1IN0A 3OT9A 3D0IE 3PFOA 1KTVA 4NI2B 1VBXA 2G0CA 2E9RX 3TA0A 2M8HA 3RAXA 4WK3A 5DM6Q 2HHHF 5KFLA 3WX8A 1MW7A 3VVTA 2R8IA 5KG1A 5H9EJ 3CCQS 1F3FA 2XTJP 2XGQA 3D3BJ 3CD7A 4Q8FA 1U0SA 3PJXA 4Y34A 3AXKA 5CH7B 3LP0B 4I69A 1J27A 3KK2A 1DY3A 3KK3B 1SCJB 2NZCA 1U1MA 1UA0A 4E0DA 2CNKB 4UOHA 1B70B 1RZMA 2X3GA 1DQ9A 4USUA 2PA3A 4DEZA 4DSFA 4G1PA 2HHTA 1VQLS 4A46A 3DNCA 4NYOA 5HANA 2P8IA 2BJ3A 3TAPA 4C8ZA 3P45B 3MCNA 1TZ0A 2IYIA 1Q81T 2HMIA 2KZMA 3A1YG 2MKCA 3M2RA 4Y3CA 4LF8J 2PN6A 2QX0A 3NWGA 1EQ0A 1VQ5S 2HMIB 3KLVA 1NKCA 3E8OA 2W9CA 4DSJA 4HDHA 4DV0J 4O4GB 1RHUB 5I3UB 2V94A 6AT1B 4F7VA 1VOMA 2IC3B 3CMQA 3EVOA 5KG7A 5KFBA 2YKOA 1U26A 3DU6A 2W8LA 2G2YA 4F26A 3KK1A 3P96A 4KV8B 5C5JA 2VJVA 1VQMS 2CJQA 4DU8A 1VFJA 4Y2MA 3QGGA 3SQOP 3JAMY 5KT7A 1S76D 2GO8A 2ZJPQ 3OL7A 4V19J 5A0YB 4G6VB 3Q24A 3BSAA 1FDAA 3MTKA 1A6LA 3MR2A 3SSQA 3BQ1A 4UF4A 4K4VA 2BACA 2N82B 1KDNA 3QIDA 1YJ9S 2D9PA 2J7KA 1QSLA 2IA6A 4F4KA 1WHWA 5L1JA 1WC0A 1H0HB 2LLZA 2MJUA 1SH2A 2ACMA 2B4OA 2NREA 4LF1A 2NXNA 1AXQA 2L48A 5D4PA 3T19A 1EZZB 4PWWA 1YJNS 1CVJA 1IJEB 1SV5A 4B3TF 1SC1B 1VMBA 2Z0GA 4ZPBA 3T1AA 2KXNB 4WP9A 2UUCJ 3HVTA 2AT1B 4NA1A 1S59A 2Z57B 5K14B 2BJ7A 2GJIA 3B54A 3EXYA 4F50A 1VK8A 5E33A 5J2QA 2XMUA 2AKWB 2YNIB 1YI2S 3IR6B 1D0EA 1G7CB 3TJAA 3M8ZA 4DX6A 3ZFVA 2EC2A 1XEZA 2IFXA 3OR2A 4LMZA 1WUUA 2HBQB 3FC9A 5IM0A 4U67Q 3Q8SB 2R9LA 2JLFA 1QAYA 4AL6A 2IRYA 4JI0F 3EUNA 4UW2A 2HYIB 2JEIA 2CQIA 5DGBA 2PGCA 2XCAA 1YGYA 2HAFA 2YNGA 4P71A 2J9DE 4NX9A 2L41A 1N8RT 3HCXA 4NLSA 3BGRB 3HI9A 4ZVGA 3FGVA 4DUZF 1F5AA 4KHRA 4M1KA 4X64F 5HP1A 4RW4B 3BO3A 1TFYA 2H54B 1HNIB 2CG4A 4H4KA 1KQKA 3UVJA 4KHMA 3T5HA 3MEDA 3RAQA 4KH0B 1OY6A 3M2RB 3MAAA 3Q83A 4O44B 4TU7A 1C1CA 1UKUA 1RWMB 1T95A 2J0WA 4B9LA 3MXHP 3BEGB 3K2YA 3E2EA 1IXKA 5CD4A 1PJ5A 1QM9A 2DHSA 2DKOB 3MM8B 4PZVA 5KFCA 4RUCA 1ZZNA 4OL8A 2A0FB 2A2CA 2QL7B 4LBHA 2JSXA 2R7SA 3Q8PB 4LIWA 3IWLA 2MKYA 3KLIB 2YNFA 3NGUA 4WIIA 4BCAA 5BYQA 3GFYA 4FS1A 1V3SA 2DXDA 2CUYA 1F9HA 4F8RA 3W62A 5CAAA 2MZTA 4W98A 3VAIA 4JBCA 4CLLA 4R8UA 3H40A 2DNQA 4PWDA 3A8EA 2LEPA 3ETMA 2HRYA 3L95X 4C11A 1WHYA 5HMXA 4X4SA 2XQCA 3OL8A 2XO6A 2P9EA 1E6YB 1WC5A 3KJFB 4BWJA 3CJKA 3I0RB 3S1TA 1NCLA 3RU0A 2KYXA 2HVHA 3D66A 4OJHA 3M9NB 3UE2A 1JLBB 1JLCA 2DH8A 3G71S 4RKUC 2LQ5A 2M2BA 5D78A 4EU0A 1V3ZA 2UUAF 3I9V9 4WKRA 5D3GB 1BHNA 1JNRB 2HG4A 4DX7A 3A4TA 4UY85 2UXDF 2BZ2A 3GCWP 1WEYA 3B6BA 2E9ZA 4Y6IA 2ZH3A 1L3UA 3KUEA 2DNOA 1V9OA 2FY8A 2FZCB 3DRSB 2MLYA 3HKWA 2QSFA 3LQVA 3PHEA 3QIPA 2BBEA 4QWAA 3TAMB 4QCLA 1RT5B 4NLQA 1NB7A 4PG7A 1H38A 3BO2A 4ZVRB 1JLFB 2RIJA 1R0AA 3J81U 5DLGA 3DRRB 3ULHA 4DV4J 2ZUAA 2YKQA 4K8RA 3ZXWA 3OSPA 1S9FA 2FJEB 1FWKA 2L9WA 2FHJA 3R5CA 1QLNA 2B5JB 1Q95G 3DLKA 2Q43A 4I6YA 4ZKAA 2VBXA 1E6YA 5HROB 1NRKA 2LDYA 2OFHX 1HKAA 1S1VA 5KT4A 2EI5A 3KLFA 2HAIA 1S6QB 3G4SS 3K59A 2B3TB 1SKUB 2B9YA 5T7LB 1S9GB 5K8PA 5KG5A 4ECRA 4RW6A 3CJ5A 1NJZA 4HT5A 5GMDA 4MH8A 4L73A 5A6PA 5D0GA 1L5UA 1CG2A 1IBKJ 1HBOB 3OFGA 2HVZA 1MN9A 1N56A 5BYRA 5KFAA 1SJ3P 4L74A 1HQEA 3O8WA 4KT0C 3SCJE 3TUIC 1Z2LA 4FYYB 4C8YA 2RDJA 3CJ8A 1IBCB 2W1BA 3TVZA 5AJ3J 2VASA 1C1CB 2XG8A 1IM4A 1D3WA 3Q8UA 5DLFA 2XULA 3KMQA 4L3NA 1XNQJ 1GMVA 1V5IB 2AP6A 3AODA 3P6YC 2B4VA 4B3SF 4CWBA 2J0SD 2XMKA 1IBMJ 1WACA 2XBPA 3QBCA 1U1PA 2BDPA 1X5TA 5J1PA 3OVBA 1FK9A 1UWAA 5G0RA 3FRYA 1KFDA 4USVA 1YRUA 1VQ4S 1D9DA 2I2YA 2J9CA 4BDPA 1T8EA 3HZGA 1ZOTA 2ALYB 1Y7PA 2YPYA 3M8WA 3TRGA 3AQOA 4RX6A 1X4HA 1NBEB 4DF4A 2BRLA 2N7YA 4ID5A 2J0QD 3PW2A 1HBUB 5HJYA 1MNEA 4CLSA 1V5VA 4OYBA 2GV1A 1JLGB 2GGPA 3DHWC 1RCXB 2CADA 4NLXA 3M8QB 2YWGA 1DRZA 2VDIA 1S0VA 1O51A 1CLFA 1HMVA 3AJ2A 2B9WA 5HO4A 2LQBA 1JJ4A 3WC2A 1RAIB 4QYZK 1S72S 1OY8A 3DLHA 4FS2A 3DLJA 1S6UA 1TL3B 2VJUA 3U27A 1T94A 4G1IA 3R8YA 4IQMA 4ZK7M 1XNQF 3T1YJ 2KHDA 3TX8A 1NK8A 4Z7YA 1HNXF 2VOOA 5E2QA 1BC6A 2HNDB 3V81B 5RUBA 2HHWA 2B9EA 2LDIA 3GJQB 1L3SA 1IVZA 3PEHA 3LUYA 3HHLC 1VQ7S 1FFWB 1R89A 2UUTA 3AA9A 2XMVA 3MECB 4KY3A 4C48A 4DCPB 4YR0A 1X4BA 1YQHA 4ZVUB 5THWA 3C6UA 2XY5A 1AUDA 1FRHA 2RHSB 2Z58B 4GRSA 2DB1A 4OX8A 3PVXA 2UP1A 5B0BA 4M5HA 4B3RF 5KG3A 1M5HA 3FCWA 3VF0B 3V6HA 3LWMA 2DISA 3R6GB 4YR2A 4C98A 2CA9A 3O44A 4CIOA 4ES1A 5JVGQ 2AGOA 4EBCA 2HHHJ 3F73A 2Y8WA 2M88A 3GJSB 3W2WB 2BE2A 2XWXA 2AQ4A 3KMSA 2ZOMA 1NPRA 1NH7A 1HWUA 1RT7A 2OEJA 4DUZJ 3ITHB 2W01A 1ZM9A 1AZSA 2QJ3A 2WCXA 1JLQA 4Y28C 4OZNA 1D8ZA 1RHJB 2KH9A 1QVFR 1IUJA 2HQ3A 2BXJA 5C24A 3OTOJ 3IN5A 3VWSA 3H5XA 5AXLA 1SKWA 2KHCA 3C14B 1CQMA 2JHEA 3TZZA 4FVMA 4PG6A 2F4FA 4M5DA 1UVNA 2Y0BB 4L76A 4UQGA 2KG1A 5GAEI 3VAGA 4NRUA 3SCIE 1HD0A 3EZ5A 4B3MF 5LMNF 3IGVA 4ED7A 2XB2D 3CO0P 3PKMA 4WYLA 3V6JA 2ZH5A 5MAOA 4DR7F 1RAOA 2DR5A 5T7LA 1H7WA 1PC4A 2YKPA 3M1VA 2RQCA 4A8KA 3V6DB 1U45A 2QYCA 2E66A 3MCSA 4XTTA 5KFRA 3VZIA 3MR5A 1WEXA 5J2PA 1RWWB 2VFVA 1SC6A 1X5PA 4J9SA 4M5LA 1KBRA 2B56A 2YX7A 2LU2A 3CCES 2W24A 3IM9A 2YPZA 1SL0A 2XS2A 3NL0A 4RW8A 3OBIA 3M4XA 1X9WA 4JV5J 3W60A 3WZ0A 3H4BA 1SJQA 2NPFA 2UVWA 1ZYQA 1RABB 3KNGA 4ZMMA 1JWWA 1X0PA 1SUQA 4WTYA 8RUCA 2VOPA 4OYOA 2M70A 2U1AA 2VQEJ 3A8JA 2ZC4A 2GX8A 1BD6A 3TZYA 1JJCB 3DRYA 3JTPA 1PKUA 4OZLA 3THTA 4PG8A 4TU8A 4J37A 4NCBA 4DG1B 2DR9A 2DEJA 5KOWA 4AE5A 5T41A 1LWCB 1TKZA 2HHSA 4PABA 2MSSA 1ZA2B 2CFXA 1Q5VA 1BUXA 3JS9A 5HLFB 4I67A 2KB2A 1UZDA 3OTEA 1FDDA 3MM5A 3KWMA 1KSPA 2B0GA 1DHMA 3EZOA 1BGXT 3FRZA 3MMAA 4JV2A 1BLUA 2D3OR 1N33F 4LF7J 1T9XA 4OMFG 1GXUA 1WC4A 2J7UA 4WCEQ 4DFMA 3KHRA 1VHIA 4OZJA 4C97A 5F8GA 3DLGB 1VBKA 3MFIA 3SYZA 1F9FA 2BM0A 3MEKA 5IC6B 1RYSA 3Q22A 2V8DA 3HD1A 1U1OA 4WU3A 4TLRA 1FESA 1FXRA 3IMQJ 2AEFA 4R25A 4C0OC 1CS4B 2NR0A 1Q8IA 2DYAA 5IT4A 1IBLJ 1PC5A 4YP3A 2WW4A 4ZS6A 5DQIA 4ZPVR 3F0NA 1FA0A 2BQRA 4ZPDA 4WZMA 4OZ5A 1YRXA 4NMXA 4CO5A 1DTTA 3SMZA 1NSAA 1N54B 3GSDA 3TYTA 1M5SA 3ILIA 4B9MA 2IY5B 2CXEA 1KN6A 2NZ4A 1RSCA 1UETA 2BW7A 2H48B 2ZBQA 3IAS9 4KFBA 4ED1A 3UDCA 2F8HA 5KTQA 4KRWA 1VJWA 3M05A 2VC1A 3BGLA 4DBQA 2FLLA 4YOEA 3ZTOA 4JV5F 1SQFA 3DXBA 1H2VZ 4RNOA 4HKQA 3TUJC 4P6QA 1SXLA 5KFHA 1REGX 1ROFA 2C1EB 1VHFA 1IWAA 4K59A 2E5HA 2U2FA 3QIPB 2LKZA 2ZZNA 1N5YA 3G9CA 3BO4A 2VL1A 5HSPA 4YY3F 5A2QY 4DQPA 4WWSA 1D1UA 1N5VA 2XS5A 2MLZA 3LO3A 4DN0A 2MKJA 2V8GA 1Y5LB 2IM3A 3H2LA 1WTBA 2MQMA 3DOKB 5A6WA 3JYTA 1FJGJ 4Y2KA 1PYOB 3J7Z5 2XEXA 5J2NA 1U8WA 4UTGA 2YNHA 3GP9A 3UD4P 1WI8A 2MZ1A 1X0FA 2V4JA 2J9EA 2QA4G 4QIFA 2H1YA 1WORA 3NGKA 1Q0NA 2VF3A 4J9KA 5E41A 1NO8A 4KGZB 2MYFA 5IZHA 4LUBA 1X4DA 2DH7A 2WRMA 2DIVA 1RWNB 1FXLA 1RHMB 2YXLA 1SJ4P 2FD2A 4I2QB 1C4AA 4LR9A 4FP9A 4HI2A 4LSNA 2HRTA 1NJWA 1HR0J 1NZAA 2K7JA 2OPRA 2RQ4A 2HZVA 3ILLA 2F9DA 3MM8A 4PWUA 1S10A 2DCLA 2EPIA 2ZNZA 3RB3A 4F2SA 2I6WA 2MZRA 4IOCQ 3OUYA 1RTHB 1EP4B 2F65A 1JK9B 4NL5A 3GIRA 5I3QA 3JXOA 4QU7A 4GC6A 1OPIA 1MMLA 2RU3A 1MWYA 3R27A 5DZ7A 2YY3A 3M32A 3QT7A 4IOBA 1FO1A 4ECQA 1UTAA 3TNVA 2QT7A 3QSYB 1XMBA 4IDKA 1M0SA 2I5JA 4LJMA 4CLYA 2CPDA 3FBFA 3H0PA 3KK3A 3BDPA 2AYEA 3ET6A 2AGPA 1MROB 3MPDA 1T9YA 4DQIA 4YFUA 1WELA 2F9JA 2WVDA 1I3OB 2HBZB 1FRXA 3EGVA 2DRDA 4ECXA 3RGIA 3C2PA 4FDFA 4YR3A 1B64A 1ZA1B 3LALA 3T1YF 2X1FA 5ETRA 2R7WA 1NZ8A 4CDIA 3RW6A 4LSLB 1CJVB 3J7YU 5DO2A 3KLFB 1HBNB 4QPXA 2HFVA 1OSDA 2FJDB 1NSKL 4UZBA 1KVIA 1RLDA 3VHQA 4CH7A 1PAEX 2IRXA 2FVCA 3ISZA 5K5MA 4ZITA 3PIOQ 3ELHA 2XMJA 3H90A 4CP5A 1U48A 2ZKTA 4Q2LA 5DQHA 2V69A 3IWXA 2HHQA 3B4DA 3CCRS 3UD5A 4KR0B 1YIJS 4HI1A 4RW9A 2WZ1A 4KBIA 1YJWS 2A10A 2RUGA 3HLUA 3IRXA 2CQ3A 3HHKA 4X4PA 1ZAWA 2YH0A 3MD1A 2BA9A 5EWGA 4K4XA 2ERRA 3CCMS 2MY7A 3L7PA 1IWGA 2A3JA 2BX6A 4ZP9A 3M8PB 2BJDA 4CM0A 2JWNA 1Q8KA 2YH1A 3C14A 1XK8A 2PDAA 2Z8QA 1UPPA 1UWBA 1WWHA 4I64A 4ITSA 4PPZA 5IC4B 2VQFJ 3AXMA 5G0RB 5HAOA 3OLAA 1I94J 2DGUA 2C3UA 1M5PC 4F67A 2DXEA 4L75A 3AOAA 4ID8A 3W65A 1IQZA 1U2FA 2I5JB 3NLCA 4ZVPB 2DVIA 4ECYA 4ZPAA 1RAEB 4ELUA 1VQSA 4OIXA 1KD1T 3T9ZA 2H4WB 3F44A 1YJUA 2CZVC 3S7RA 5KFPA 3D6FB 3VZHA 1FKPA 3GQCA 2Z30B 3CJ0A 4FNIA 1VQ9S 3N28A 4Q43A 2ROPA 4XPCA 2B43A 2AYMA 1TK5A 3W1YC 2BOPA 3EX7B 2OPRB 2OUGA 2RQKA 4J9MA 2ZOFA 1D8YA 1MU2A 4O0IA 2RJZA 5HMYA 3W8PA 5HMZA 4A8YA 1NSPA 2K8GA 4ED8A 4FVCA 2OJ3A 3PX4A 3M9OB 3M2VB 1VC0A 3JQJA 4MMOA 1FI4A 2GVDB 1S0MA 2Q66A 1NK5A 1RWKB 1QAXA 1Z4UA 3FNNA 2MZJA 3LH2S 1H73A 1RGVA 3G8TA 1UAWA 5DG8A 1MWQA 1NNDA 3TANA 2WW8A 1R43A 1BWVA 4OI4A 2R3VA 1XBWA 3C19A 2H4YB 4LR7A 4DZ6A 2VBYA 4F36A 2CVIA 3QT6A 4WU2A 3EWGA 5B0DA 1HHTP 4NLYA 1XJWB 3AJ1A 1FFGB 2LEAA 2WOMA 4ZVFA 4YDDB 1KONA 3MMBB 1DZ5A 1AFIA 5E0OA 2OEKA 1BQNA 3NS5A 5A8KB 3RZAA 2VZ9A 4XO0A 4B08A 1HMVB 1R8BA 1TMJA 4AYBD 2ZWOA 2F1FA 3DHXA 3F56A 1CJUA 4HR2A 3V2UC 3N5FA 3H25A 3S6EA 1HLWA 2V4RA 3PV8A 3M6UA 1EX8A 3AB4B 1V6HA 1ZAXA 3EM1A 4U96A 3RBZA 3FSXA 5J2QB 3UCZP 1VI7A 5D0RA 1HNZF 3OVAA 3C6TB 3CJSA 3T6JA 4C6AA 5IFMA 4ZA1A 1S1UA 3FBBA 1UZHA 3ISNC 4KKOB 2E7XA 3MEEA 5C2CA 4K4WA 3EZUA 4J7CA 5KT6A 5T14A 4ZVTB 2VA3A 2BEFA 3BYPA 2UXDJ 4OHZA 1NHVA 1R6YA 2MGZB 4QPTA 2WK4A 4JI6F 2DCUB 2AMCB 3BGUA 3M2UA 1J5EJ 5DQGA 5B0CA 3OXGA 4H4OA 4O3PA 1T02A 4URGA 1FVSA 2GHPA 4M5DB 4UUXA 4Y2IA 5CCMA 5EGYA 3FSIA 2OTJS 4OYWA 2QA4S 4DQRA 3Q2SC 2I38A 4DU7A 2R7QA 2W7OA 1J5EF 3PY8A 2KM8C 1R0CB 2YNFB 3H98A 1ZM2A 3IGNA 4DPUA 2XI3A 3UNGC 4JI6J 1U49A 2XS7A 1J2VA 2XZWA 2COLA 2H9ZA 3GFZA 4QWCA 1G6BA 1T0TV 3FZ2A 2XMWA 3PNIA 4HH1A 2FZKB 3MMCA 1QJHA 5CYQA 2OMOA 1S0OA 3CCTA 3CW2C 3W9JA 4E2FB 2DD8S 5CABA 3J81j 1JLEB 4J91A 3BSOA 4N47A 2MKKA 1VIXA 3R7SB 4O3OA 1O8BA 1FRLA 1S6PA 1RBAA 4FZVA 3V4MA 3P5TL 5LJ5Y 2DTJA 1G1XA 3NY0A 1OPZA 1KEKA 1TAUA 2NLWA 4Q8EA 5D4LA 3MR7A 2IVFB 3DLKB 5HROA 4F02A 4NASA 2V68A 2IM0A 2B7BB 1F9EB 2GAHC 3AOBA 3M6WA 3D28A 4CLWA 1YWXA 3KJVB 4MKBA 2DNNA 3QATA 4E8UA 2AJ4A 2H65B 4OHXA 2OPQA 5A2QU 3QZ8A 2DR8A 1LXJA 2HFOA 5K8NA 3W64A 1KFSA 1GTHA 2QMWA 2XSFA 4F04B 3TAMA 2V4QA 5H9FK 4WFYA 2OD6A 4I6WA 3GG1A 2ATLA 2J0XA 1CJUB 5AXNA 2OSQA 1FWPA 2RNEA 5IOLA 2W8KA 3SFUA 1BQMA 1IKVA 3IRXB 3TAQA 1VRUA 1S1XA 1LW2A 1WOPA 3AY0A 1UW9A 2XZDB 5E3RA 1ZETA 1T05A 2V2KA 3M1VB 1CC7A 3KJNB 3WHIA 5KFJA 2HS3A 2G2OA 1JLAA 2P9GA 5J2MA 2CYYA 4DV6F 4R5PB 2LFVA 4PXBA 3I0RA 2KTQA 1NPPA 2AJFE 2CJYB 3E01A 3CTRA 4A8WA 4C3MA 2W4PA 4BBYA 1YJVA 2EK6A 2CDQA 1H6KX 1P27B 2J7WA 3MZIA 3PHTA 4M5JA 1Q53A 3US5A 2XGPA 4TYBA 3TR5A 3O1LA 4K0KJ 3Q8VA 3MEGB 4OX7A 2E5LJ 1WOOA 3WX4A 5FLXU 4MK9A 1Q79A 5KFNA 4KH1B 2EBEA 2LA6A 2OELA 4LF8F 2DNLA 4F3MA 4URSA 1EARA 2IRUA 4WZQA 1RADB 4B9SA 1AA1B 4ECSA 1R8CA 3KLHA 2IC3A 3RUBL 3PW7A 1OQ6A 4C8NA 2W9CB 4FXVA 2BE2B 1CSJA 3FQKA 1KOHA 4XDDA 3CJ3A 2CDRB 3GYGA 5C25B 5DG9A 4DV7F 3EPGA 5FJ4A 4LF2A 1UVIA 4IFVB 2JLEA 1LFPA 3NOGA 1NJYA 1DFDA 3QAUA 2LU1A 2HPUA 1MWZA 5KFZA 1FD2A 4KO0A 2DRAA 3SBMA 3KUHA 2DGQA 2BOAA 1RWXB 2NUUG 4WFZA 3OV7A 5IM0B 4C8OA 3W8GA 1UMJA 2JEGA 3UNYA 1RT1B 1WDDA 3NNAA 2CQ2A 3FUYA 5CD4H 1FX2A 2HQDA 3MR3A 3M2UB 1SJRA 3ETOA 1QUVA
chains in the Genus database with same CATH topology
2B4UA 2YVSA 4ZCIA 1HI8A 3JSMA 2HRUA 1MSWD 4NA3A 1VRUB 1T05B 2P6SA 3MEEB 4U7UK 5F41A 1R8HA 3I5AA 2DGTA 1XERA 4FBTA 3CVKA 4Q44A 4GKKF 1TL3A 2YQ3A 3I31A 1LW2B 1N0VC 4QQBA 2JFDA 2VQEF 1KLMB 2MQQA 2VPXB 1IKWA 1JIHA 2KYZA 3B8HA 3K5NA 2R8KA 1N32F 1S99A 1HBUA 4HVZA 1CQNA 1IKXB 5DJBA 5B0AA 3L7OA 1VQPS 1UVMA 4WE1B 4CTAB 1HPZA 1T03A 1Z1ZA 2ZFHA 1P6TA 4UQTA 4HL9A 5D8HB 3IS9A 4JI1F 2E29A 3AA8A 5L1KA 1S49A 2PO4A 4B02A 4O3QA 4OQJA 5KFWA 3BR9A 4K4TA 1LOUA 1NAQA 5B0EA 1U1NA 3C46A 1K0VA 3CJKB 3TA1A 3N6LA 4B9VA 4MIWA 1VGYA 1HNVA 4USHA 5CYJA 1PILA 1F0XA 2V8HA 1S9EA 2GFFA 3K5OA 3FJ2A 1E6VB 3HHEA 4OX9F 4JV0A 1FTCA 3M9MB 2M3DA 3CXCR 1U6BA 2OPPB 1HQUA 5L9XA 2FLOA 2QFJA 2BJEA 3GYNA 4MFBA 2ZDOA 3OHBA 1JNZB 3WC0A 4EO8A 2V0NA 1AFJA 5KFUA 4HYKA 3KG0A 2LECA 3DDKA 1RT3A 4MYTA 1YITS 1R8AA 1QSYA 2FY1A 1RYRA 4OHYA 4CH1A 4ICLB 4O44A 5KFQA 1UEUA 2SXLA 3I9ZA 4N56A 1RJJA 4ZPTR 3VAKA 4M8LA 1NH8A 3I4PA 4USJC 5HP1B 3MM5B 2VODA 1N6QB 4R0EA 4G3IA 4N8OA 2YNGB 1IBMF 3MR6A 3TQ1A 3OFHA 2R7VA 4MKAA 1EETB 1YVFA 4U9RA 1Y00A 3PACA 4B3OB 1RT2A 3UFCX 3I55S 2HHXA 3IS9B 3D0HE 1ZPVA 2NPIA 3HDSA 1LV5A 1TVRA 2I9SA 5ADZA 7FDRA 1M5OC 4LIRA 1JB0C 1T3NA 1A9NB 3CWJA 3U1NA 3UI3A 2ASYA 3FEZA 2IM1A 4A8FA 2KT3A 1C0TA 3LAKA 3O2IA 3ENQA 2MQOA 5J2PB 2X1BA 3GV8B 2MZQA 3MF5A 5AXMA 1KRPA 1GX6A 3HO1A 1JLCB 1JLBA 4PRFA 1VS3A 3QGHA 5L38A 2CPYA 5B08A 3MURP 1HW9A 2L9NA 3H5YA 5B0FA 2HFZA 3CT9A 4ED2A 2IVYA 1VQKS 3MMJA 3HJFA 2HQIA 4I0WA 3KLEA 3QGPA 2CJBA 2CQCA 2YKMA 1T3OA 2FHMA 2OP5A 5IT0A 1HWLA 5I3PA 3GILA 5JUMA 5AE1A 3UWTA 3DLBA 2HHVA 4CZCA 2O3DA 4N5SA 3TOQA 2IYGA 2HHUA 4N8NA 2N3OA 1UP1A 2OPPA 3SXLA 5F9NA 1HBMB 2V9WA 1CC8A 3JSYA 4ZVEA 4PKDB 3GV5B 4KTQA 1GH8A 3DOLB 2VFTA 4PR6A 4ZP8A 1OQ3A 4QJVA 2HIQA 2ZD1B 4IUFA 5GAEU 2KXFA 3MHYA 2ZKUA 2R2UA 1QAIA 1TFWA 2DR7A 2CVEA 2FUG9 3MM7B 3LP0A 2DPIA 1RA7A 1FE0A 2R7RA 4JOUA 3KHGA 1SKSA 4YEAA 3HVWA 4DMZA 1QE1B 2K3IA 1UJ5A 1QUPA 2ZH1A 4LVOP 2B4PA 1IKXA 1M1KT 2LXIA 2DGXA 4IO9Q 4W90B 3SEOA 1GT8A 2FGOA 4DS5A 1BQXA 4RU9A 4IH5A 1GQEA 2C2EA 1HARA 2VKZG 3I82A 1K0TA 1Y3KA 3KLGB 3D1OA 2RB7A 4NZ7A 2UV8G 3PW4A 3TVYA 4CI0B 4AL7A 2LVWA 4QR0A 3RRHA 4DFPA 1K9MT 1ZBTA 2JX2A 4ZDNA 4O3SA 2LQ9A 1RTJB 5DS7A 4ED3A 1XNRF 3HFKA 2MB0B 4IRCA 1U1QA 1VLYA 3CD0A 3MUVP 4LSLA 1FRMA 3ZZOA 2FJBB 3BDEA 1WNEA 3BZQA 4KB7A 1S7HA 3GMGA 3T5KA 2C2RA 4X4RA 3H4DA 2XLKA 4IQXA 4NCGA 2QSWA 1TR0A 2ILZA 2ZNYA 1S1WB 1TFYA 2B51A 1RTHA 1R31A 3ONQA 4NRTA 1UFLA 1GX5A 4O23A 5KFVA 3G6XA 4Q2MA 5GAGI 4ILRA 3QYYA 4GO7X 1GNKA 2DITA 4OI6A 4DV3F 4EBDA 3TA2A 2Q6BA 3K5LA 2WTFA 3NG8A 4L72B 4C8LA 2YTCA 3JSBA 2ADBA 5KFSA 4K5SA 1UVLA 2B6AB 2F7VA 1RTDA 3GWCA 2XLJA 3MDFA 2WONA 2GQCA 2UUBF 2BRKA 3MEGA 4NZ0A 2FVSA 2C28A 1KOOA 1IBLF 3KKFA 4K2XA 1C4CA 2QRRA 3SSSA 3KLEB 2YX1A 4XDCA 1YRTA 2G1DA 3E01B 2XLIA 2CQ4A 1L3TA 1YJRA 3BSNA 3M8SA 5E3PA 1ZH5A 2RU9A 4ZOSA 2HLUA 4NPOA 2E44A 1F5CA 4IG3A 1Q8LA 1U8SA 4P2SA 3DGPA 1S79A 2IJFA 4X4VA 1R0AB 4LF7F 2DNRA 1S1XB 2BV3A 3H2UB 5KG2A 2DJWA 2JEJA 3DRPA 3I0SB 1TP7A 5FLXY 2XMMA 4YQWA 3H2VE 2PC6A 2R8JA 2ZE2A 3CF5Q 1Y0HA 4HT7A 1VBZA 2QLXA 4XIUA 3GE9A 1N52B 1UFWA 4DL6A 3U7JA 5EWFA 1VRTB 4Q0BB 4PQAA 4C9DA 2BABA 2EWHA 2HLTA 3OVSA 1REVB 3NKYA 3KNAA 4J5OA 3KJVA 5LSOA 2VA2A 3VR1A 1BY9A 3MAQA 5CZXA 1N6QA 4C0HA 2UVVA 2EG1A 3GIJA 5BR8F 1S4FA 4FNHA 3NMRA 1FJCA 4A48A 3VAFA 2DO0A 2Z2LA 3T9NA 2VQFF 3HHNB 1R3NA 2EFPA 3MPVA 4HH0A 3SZ2A 1QY7A 1Q78A 2RE1A 4WXOA 5KFEA 1FE4A 4Y65A 2DNPA 3DLGA 1SI9A 4YUDA 3CULA 3VCDA 3FEXB 3K7RA 1B0VA 1X8DA 1LWEB 5DGAA 2KXHA 1H2UX 2A2DA 1KHVA 4CO0A 5F0WA 3TO8A 3GIKA 4H54A 1YHQS 3RR8A 3MOZA 3K0JA 1TKZB 1NU4A 3LGMA 3OQ2A 2FVRA 2CPIA 4WXWA 1M5VC 4JYAF 5HN0A 3J7YI 1U25A 3OJSA 5F3ZA 4RWWA 2MMYA 5M2RA 6FDRA 3THPA 4IG0A 5LMUF 3BM7A 2ASJA 3QMQA 1K1QA 3UQSA 3MM6B 2XC9A 2OTLS 3V4IB 1UWBB 4LF9F 3GIMA 2CQDA 3P49B 3ZZRA 2D3UA 3LF0A 4CO1A 2GQQA 3DRPB 3I0SA 3I32A 4C4WA 2YWFA 4MK8A 4QIEA 3DC2A 4NA2A 2A1BA 5M2UA 2JL9A 4FBUA 4JI5F 2DK2A 4PUOA 2OO4A 1FKOB 1U09A 1VQYA 6FD1A 3C8YA 2MKSA 4KSEB 3DLLQ 1SIZA 3M8QA 3TW0A 1C1BB 2W7AA 4I4BA 3PX0A 3IWNC 4X84A 2R7UA 5J1NA 2GNKA 5A8RB 2X51A 3QLHB 4TXSA 3SI8A 2RRNA 1Y5IB 4OJ3A 4UOCA 3LGNA 3S8SA 1RT6B 5GAHU 2KKHA 3CPWR 4EZ6A 3TI0A 3PEJA 4HDGA 2GIQA 4K5RA 4DLEA 1K8AT 3I5CA 1Y5NB 4KV8A 2R2RA 3VTIA 3DMJB 3NRBA 3IC1A 2DHAA 2EKYA 4Y00A 2RVJA 3DOLA 4AXJA 2KM8B 2HS4A 3K58A 1JLEA 2JRSA 4RU2A 1DQ8A 3DU5A 5CYQB 5L8RC 5DETA 3QJPA 2APOA 2CPJA 3I5BA 3CMAS 5JVHQ 4NLOA 2WB1D 5D4OA 2F8MA 4A8SA 3D0GE 5CQGA 1ZM3A 1HBOA 3JB9k 1H2TZ 1RTIB 3IXQA 4DSEA 5BYSA 1R7IA 4AXIA 4HTJA 4DR3F 3J7A1 4F4ZA 2BANB 2NXUA 5KG0A 2CPFA 4NLUA 2HNDA 5K8MA 3TVKA 2VG6B 3DLEB 4NWBA 1DLOB 3UR3C 5KG4A 5F3TA 2C22A 2Q1LA 3FEYB 3SDEB 3O3LA 1GXLA 2RS2A 2DRBA 4LF4F 2ALZA 3HX9A 3KLGA 3PX6A 4DR6F 1F60B 1FXDA 1N0UA 2P9CA 4I7FB 2ZH8A 1TL1B 3KHLA 4PUOB 4A8XA 1IKVB 1S1TB 2Q3PA 1WHXA 1X5SA 1IJFB 1NK6A 1Y4ZB 4FPRA 4NLTA 1WG1A 5GADU 1FJEB 4XPEA 4RUHA 1QTMA 4ES3A 2ZHOA 3GZ7A 2KT5A 1WF0A 2HGLA 4WJBA 3FZBA 1JXEA 3OTOF 2VONA 2DGOA 1OS5A 1D9AA 2RDIA 2QLWA 1A7GE 2AX1A 4I2PA 4ZP6A 3W2VB 2ZH9A 1NHUA 3IR5B 3GG0A 2O67A 1U7LA 3UDLA 4DX8H 4DWIA 5HBMA 1P1TA 1EP4A 1FERA 3TARA 3MAHA 4CQ1A 1HNWF 2VUGA 4WYWA 4TKTA 2R7TA 4FYDA 3PR5B 3CMES 1KC8T 3PXGa 2ZBCA 3ZZUA 3L3CA 1VBYA 1SL2A 4K50A 2EBGA 4AUKA 1TV6B 3HHLA 2V8VA 3RB0A 2CPHA 2OMLA 4M63A 4U7CA 1KNZA 1RT6A 2MQNA 2O01C 1XMOF 3CIMA 2N3LA 2RD5C 1S1VB 1MMDA 2E1MC 2YKMB 4I6AA 4NYPA 3QLHA 5HLFA 1LW0B 1S9GA 2AYBA 1QSSA 4MIAA 1XR7A 2MY8A 2OD4A 1M5KC 4ERDA 4DG1A 3GFHA 3PO5A 2KZZA 3R5BA 1U1LA 4DF8A 4DN9A 1Q86T 4HLBA 2JH3A 1JLFA 2CKWA 3C6TA 3PO4A 3CDAA 1N34F 1IKWB 2JJ4D 4C8KA 3U1LA 3FMWA 3K5MA 2Q79A 4CO3A 4BWMA 2LMIA 5I4MA 4NXNF 2C42A 4LQ9A 2E1RA 4X65F 2OFGX 2AWZA 2RSQA 2Y1JA 2IVMA 2G13A 3Q23A 3CE8A 1X4GA 1U1KA 4JI3F 2WB4A 1LW0A 1HA1A 2LCWA 3UCUP 3SDEA 1UL3A 3IAM9 1VQOS 3I56S 2E5IA 4XK8C 3QJLA 2VG6A 4HHJA 2HNYA 3DM2A 2M7SA 2BANA 2CJ9A 5GADI 1JJ2R 3N5BA 1H3DA 1RWUA 4ZVHA 2R7OA 4FF2A 2AJQA 1XN9A 1MMNA 2FTRA 3C66A 3RYLA 3KG1A 4DL7A 3QZ7A 3TUZC 2X1AA 2R8GA 2N4CA 2NS1B 4F3OA 3K8VA 1NKBA 2QZ8A 4PG5A 2J5AA 3LP1A 3HVRA 4PQUA 2K1RA 2AJ0A 2ROGA 2RT3A 3T6BA 3FFIB 1TKTB 4RW7B 3CJ4A 4QW9A 1E6VA 1LXNA 2V5HG 4LFAF 4RBTA 4QWDA 4RZRA 1O0PA 4QOTA 4LSNB 2XY6A 3DDNA 3VALA 2YX4A 1K73T 1I6JA 2CQ0A 3T3FA 1SBRA 3CCLS 4M95A 3VAHA 1JMTA 1AROP 1LK7A 1SH0A 4IFYB 4TN2A 3MFHA 1WHVA 1S1UB 4KKOA 3FDSA 3MOJB 2AX0A 2JOQA 4DSKA 3NBPA 1UA1A 4DJBA 4AFFA 3M6VA 2KFZA 4URQU 2HHPA 2YNHB 4IO1A 5K14A 2CJKA 5J2MB 2RILA 2C3PA 5D77A 1U2RA 4X62F 1QVGR 1JXLA 5CYMA 1W2IA 3BN7A 2D74B 1FKOA 2FB0A 4NYZA 3IRWP 1TQLA 4OI0A 3DYAA 2DNZA 2MDAA 5M2PA 4K4ZA 5HMWA 1JLGA 2GGPB 4Q5VA 3FVYA 2UXCF 1IKYB 4EUVA 1QE1A 3EYZA 3L09A 1ZTTA 5D6GA 4GC7A 3NCPA 1RTIA 1WG4A 5KT5A 3MM7A 2NSCA 2M5YA 2MSTA 5DRKA 4JI2F 4RBVA 1ZZFA 2O1PA 3FMBA 1N5TA 4ZCMA 3RR7A 2J6SA 1JKHB 3HHLD 1U6FA 1MROA 3UD3P 5C25A 5LT5A 3KK1B 4W92B 3NNCA 2ZBIA 1KQSR 2PD1A 1FDNA 1RT7B 1FK9B 2FHKA 4CH0S 3NS6A 3M32B 2MZSA 4KQZA 3ZZZA 2XWYA 3OUYB 4DR1F 2WSCC 2IMWP 1GXTA 4ALZA 4E98A 4OZ1A 3M8RA 3Q2TC 3CEDA 2VFRA 4F3QA 2CQGA 2K1RB 3TP2A 4IRKA 5DDRC 1IQTA 1K1SA 3R3TA 4B9NA 2XO7A 1C0UB 4X4QA 5KFXA 2KVIA 2PMZD 2Y1IA 3C6UB 1HWJA 3HF5A 1I1GA 5FIIA 4K4SA 1CPZA 3M30A 3O5TB 3BB5A 2KJVA 2WSFC 1R8PA 3F41A 5IQ6A 4LF6F 1FCAA 3JSRA 3O6QA 4WFNQ 3CSKA 5A8RA 2HWTA 5F9LA 3PJWA 2CQBA 4Y0FA 3MUMP 3CCSS 1O5JA 2LYVA 3OSNA 5IXUA 2G4BA 2QA2A 1P1LA 1LWCA 5J2NB 2IAJA 4FN5A 3B4MA 4KE5A 2KT2A 2FIUA 3R5DA 1L3KA 3DRRA 5C42A 5IS2A 1FJGF 2OPSA 3T1HF 1SIWB 4TY8B 4C2MA 3LOUA 2W9BA 4DFKA 1OSCA 2OPQB 4NLPA 4QIWD 1NK9A 4K0KF 5F8HA 1FD8A 4NMLA 1CVJA 2X1GA 4RNFA 2ADCA 1HYSB 1BQNB 1FRJA 4WK1A 4C8MA 5DDPC 5HL7Q 3JTOA 3SFGA 1YBAA 4DUYF 2UZAA 1V3RA 2Q6CA 2GW8A 3H5SA 3R5AA 4I1TA 2UXBF 5D4NA 1XR5A 2QIFA 2NUHA 2IBOA 3AQPA 2PSZA 2ZOGA 3PRDA 4OZ0A 3U02A 3HXMA 3THVA 1RK8A 2DGVA 2R2SA 4PWDB 3FFIA 4P7TA 3CDEA 1X4AA 2EFGA 5F8NA 2WONB 4J9LA 2R4FA 2G9OA 3LW5C 3RBEA 2Z4PA 4WFXA 1SJ1A 3CDUA 1UEVA 1X9MA 1HWIA </