1CVJA

X-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
169
structure length
169
Chain Sequence
ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of polyadenylate RNA by the poly(A)-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
molecule keywords 5'-R(*AP*AP*AP*AP*AP*AP*AP*AP*AP*AP*A)-3'
total genus 36
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1999-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cvjA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cvjA01
2F3JA 3CPWR 1UFWA 4YUDA 2L41A 1G2EA 3K0JA 3MDFA 2MZ1A 3NS5A 2KG0A 1FJ7A 3IWNC 2RUGA 1WELA 3CD6S 1KOHA 1VQ6S 2MPUA 2CPFA 2LXUA 2LKZA 5GMKa 3Q2SC 2DH8A 2RT3A 1FXLA 2M88A 1K8AT 1WG4A 1URNA 3MUVP 2G1DA 3CF5Q 3H2UB 5IM0A 2DNYA 1U1OA 1OIAA 4TU8A 5DETA 1HD0A 2HZCA 2DHAA 1U1MA 2RU3A 2DNZA 2FC8A 3CC2S 2YWKA 2CPDA 5D77A 3UCZP 2KVIA 3SMZA 1VQNS 1H2TZ 2X1BA 2DNGA 3SDEB 2B0GA 2J0SD 2MQMA 2L9WA 3EGZA 4Z2XA 1X5SA 2ZJPQ 1WG5A 2CPXA 3PIOQ 4WFNQ 3CCLS 2MJNA 1L3KA 1M5OC 1S72S 2JX2A 2UP1A 2MZTA 2XS7A 1WHYA 2OTLS 2K8GA 4ED5A 3VAIA 1NJIT 2OSRA 3CCRS 1CVJA 1VQKS 4C7QA 1U1LA 3VAJA 3NNCA 5LXRA 2G4BA 2CQHA 2CQIA 2LCWA 2MZSA 5CYJA 1WG1A 2MGZA 1X4DA 3US5A 2M4MA 2EK1A 4IUFA 1FO1A 2MQQA 1M90T 1OWXA 3CCUS 2MQOA 1Q7YT 3DLLQ 1O0PA 1DRZA 5GADU 1R8HA 1QVGR 3BO3A 2MKJA 4LJMA 3D2WA 3P6YC 2CQ0A 3VAMA 4W90B 4WCEQ 2MGZB 1U1KA 3SXLA 2MMYA 2XNRA 2AYMA 2XB2D 5DDRC 1VQ7S 1ZZNA 2U2FA 3HHNB 2GHPA 2J0QD 1UP1A 2HVZA 3THTA 1VQOS 1K9MT 2L08A 1WF2A 3U1LA 3HI9A 4WF9Q 3VAKA 2DB1A 4V19X 1KD1T 1HL6A 1U6FA 2BOPA 5DM7Q 4YOEA 1SJFA 4WFBQ 2XS2A 3VF0B 4W92B 1WI6A 4LMZA 2KRRA 3OW2R 2I2YA 2DNPA 2CPJA 2RRBA 3RW7A 3SDEA 1YI2S 2DH9A 2DHXA 2LA4A 4TLQA 2RQCA 1WF0A 2X1FA 2V94A 2MB0B 3B4MA 4YB1P 3CTRA 5EN1A 2CQ2A 5IQQA 5LJ5Y 2M8HA 2DNRA 3S8SA 2RRAA 2LA6A 2DGVA 3U1MA 5DDOC 2LXIA 3MXHP 3VAGA 2MZQA 3CMES 2N3LA 5LSLA 2E5JA 1Q81T 2FC9A 1RK8A 2MKIA 2JVOA 1N88A 5H1SV 2MQPA 2E5HA 2MKCA 2J76E 2MQLA 1KOOA 1WF1A 4PKDB 5GAGU 3VAFA 2LECA 1X0FA 2MY7A 2CQCA 2KM8B 2KT5A 3Q2TC 1VBZA 3G96A 1VQPS 2ZJQQ 2XS5A 3J7YU 1JJHA 2CPZA 2CQDA 3S6EA 4Y00A 2DNHA 2VONA 1WHWA 5BJRA 2EVZA 1WEXA 1WTBA 5D78A 4CIOA 1VC0A 5HL7Q 1QM9A 4QU6A 1SXLA 2LMIA 4FXVA 2FHOB 3NNHA 3THPA 2KFYA 3MUMP 3I55S 2N82B 1X4EA 2CPIA 2XNQA 2JRSA 3UD3P 2ERRA 1S79A 1U6BA 2OTJS 1A9NB 3VAHA 3UCUP 1FHTA 3CMAS 4IO9Q 1X5TA 4ZKAA 4WIIA 2DISA 3CXCR 1YJNS 4TU9A 2DGTA 1JJ2R 3L3CA 3NNAA 3MURP 1Q86T 5DDQC 2X1GA 3N9UC 4J5OA 3EGNA 1H2UX 4WKRA 4FXWA 1UAWA 3CULA 1VC6A 4F02A 5CA5A 2KU7A 3G4SS 2DK2A 2KHCA 1RKJA 1N52B 3J7ZT 4A8XA 2LEAA 2CPEA 3BEGB 5FJ4A 2PE8A 4C0OC 1X5PA 2CQGA 1VQ8S 2DGUA 1YITS 1ZZFA 1VQ4S 2WBRA 2PEHA 5LXYA 4CH0S 4QQBA 2MYFA 2M8DB 2E44A 2KXFA 1P1TA 2YTCA 5JVHQ 1DBDA 2DGQA 4F26A 1U1PA 2XSFA 2D3OR 3S7RA 5GAHU 3LQVA 1FNXH 5DM6Q 4P6QA 2O3DA 1NU4A 5IM0B 1X4FA 4CH1A 4BS2A 1YTYA 2KI2A 2HGLA 2DH7A 1PGZA 2RS8A 1YHQS 3ZZYA 1KQSR 3G71S 3RW6A 3MD1A 2D9PA 2D9OA 1YJ9S 3JB9k 2HGNA 2AYEA 1H2VZ 2OIHA 4OZ0A 2KXNB 2QEXS 2CQ1A 2DGWA 3EX7B 1SJRA 3PIPQ 3UD4P 2CPHA 2RVJA 5ITHA 4UY8T 2MKHA 2FPHX 3CCMS 2DIUA 2ADCA 1YJWS 1WWHA 1JJ4A 2MHNA 2MJUA 3NS6A 4ERDA 1DHMA 2DITA 2QA4S 3VALA 2CJKA 2AYBA 3TYTA 2DNMA 3FEYB 1KC8T 3G9CA 2ADBA 3ULHA 3CCVS 1OPIA 2F9DA 2CQ3A 1QVFR 1X4AA 4OZ1A 2N3OA 3BO2A 2DNNA 2E5GA 3MI7X 1DZ5A 1H6KX 2BZ2A 1WHVA 3G8SA 2DO4A 1R8PA 3CCES 2E5IA 2OSQA 2A3JA 4F25A 5LJ3Y 3R1LA 1HD1A 3BO4A 4LIRA 2U1AA 5HO4A 2MKKA 3BS9A 2AYGA 2OJ3A 3G6ES 2CQPA 1ZH5A 2DIVA 3LPYA 2HGMA 2CPYA 3B4DA 2NLWA 2YKAA 3I56S 2DNKA 2MSSA 3P49B 4M5DB 2SXLA 1UW4A 1WI8A 1P27B 3CCSS 1PO6A 3CC7S 2DGSA 5GAEU 2VOOA 3IRWP 4Y0FA 2KH9A 2KXHA 2X1AA 1K73T 3G8TA 1VC5A 3CCQS 1SJQA 1Q82T 1FJEB 5IFMA 2KM8C 2MKSA 1FT8A 1WEYA 4EGLA 3CUNA 1BY9A 1M5KC 2DNOA 3R27A 1X4BA 4QPTA 2Q79A 2K3KA 4U67Q 3UWTA 2DHGA 1VQ5S 2VOPA 4C4WA 1X4HA 2J8AA 2RNEA 2KG1A 2DNLA 1B7FA 3ZZZA 2YH1A 1U1RA 2MZRA 2JWNA 4QU7A 2DGXA 5JVGQ 2KRBA 1N54B 1YIJS 3TO8A 1AUDA 1WEZA 1X4CA 1F9FA 5MLCV 1D9AA 3R1HA 1M5VC 2ZJRQ 1U2FA 2LQ5A 1VQMS 3UE2A 1W2BR 3V4MA 2RQ4A 4IOCQ 1VBXA 3MD3A 2HYIB 2DGOA 2QFJA 2G0CA 2MXYA 1X5OA 5CXTA 3MUTP 1U1NA 1N8RT 2CQ4A 2AD9A 3CC4S 2M9KA 2MQNA 2RS2A 3CCJS 5DDPC 2I38A 2DO0A 2LEBA 1X4GA 2EK6A 2VODA 4WFAQ 2F9JA 3TP2A 2M2BA 2M70A 1WHXA 3FEXB 1IQTA 4UQTA 4RU2A 1U1QA 2M52A 2MY8A 1A7GE 2MZJA 3P3DA 1VQLS 1NO8A 4PR6A 1YWXA 5LSOA 2JVRA 1SJ3P 2GO9A 1M5PC 1D8ZA 2LYVA 1VBYA 4TU7A 2M0GB 3P5TL 1FJCA 3DXBA 2KYXA 2YH0A 1JMTA 2M7SA 4CQ1A 2N7CA 2FY1A 4IOAQ 2KN4A 2DHSA 2MSTA 1XN9A 2DNQA 1VQ9S 3NMRA 3S01A 5GVQA 2NZ4A 1M1KT 3UCGA 1OO0B 1SJ4P 3H2VE 2CQBA 1HA1A 3MOJB 4PRFA
chains in the Genus database with same CATH superfamily
4WK3A 3X1LB 3N79A 1IBCB 2Y1RI 2NCKL 2P5VA 4USUA 4P2XA 1Q5YA 3JSBA 5D0RA 3W66A 3PW4A 4YUDA 3GIMA 2R7OA 2XO7A 1G4CA 3ZZUA 2B9XA 1KTVA 4B9TA 4KGKA 2IAJA 1RHKB 1G2EA 3MDFA 3TJ8A 2XC9A 4ECYA 2RHSB 1RU2A 4S0MA 5DZ7A 1MMNA 3NS5A 3OLBA 4JB8B 3MMAA 3HULA 3NAIA 4RUCA 1Q8LA 4WYLA 3IWNC 4GKJF 1RAAB 1DY3A 1HBNA 4FN5A 1NKEA 1NDKA 2VBXA 1MWZA 4ED0A 1WELA 3TZWA 4CZCA 2F8HA 2JEGA 3LANA 1T05A 3QGGA 4WE1A 1WKLA 2CPFA 2LXUA 2QSFA 3PM9A 2GMJA 4PG7A 4JI8F 3JAMU 3GV8B 4ZLPA 4CNYA 4K0KJ 2VJUA 4ECZA 2JOQA 1E6YA 2RT3A 4NYOA 4TXSA 1H98A 1UWAA 1SKRA 1FKPB 1WG4A 1NPPA 5KG5A 4DV7J 2GJIA 4J9VA 1K8AT 1K0TA 1OS5A 4RPFA 2GJFA 3BN7A 2H65B 3LO3A 2BA9A 8RUCA 2V2KA 1WC1A 4M5JA 1RTDB 4F2SA 4DCOB 1OIAA 2WSCC 4PXDA 4R25A 4TU8A 5DETA 2HZCA 4DV2J 3BR8A 5L1IA 2DHAA 5FD1A 2AJ0A 2P8IA 4OQJA 5AXKA 5K8NA 1HQEB 5EHHA 3BDPA 1S9GB 2BM0A 2J7WA 4X4VA 4URGA 3AOCA 3DYAB 2FC8A 1ACMB 2RDIA 5H9EJ 4HH1A 4LRCA 3C14A 4NEYA 4NZ0A 4RW8A 3MR6A 2M3DA 1N5YB 3MTKA 2UUAF 5D77A 3V81B 1H2TZ 1MN9A 2DNGA 4W4MA 2Z2LA 3HLUA 1WC0A 5CZVA 1CJKA 1T9TA 2R2UA 4KO0B 2HRUA 3HHEA 1X5SA 4YY3F 1VLYA 2ZJPQ 3WDOA 5FLXY 4OYOA 5IV3A 4F3MA 2HZAA 2PSZA 2YWEA 4G65A 3ILJA 3OXGA 1EB0A 4MK7A 1YBUA 2VFSA 3T5LA 2MZTA 3M30B 4KGVB 4HR2A 1LXNA 2UP1A 2DJWA 2C2NA 3TEHB 4JV1A 8AT1B 1HNWJ 1LWFA 3MM5A 2BKNA 2R2SA 2OSRA 2HQIA 2Z30B 3C19A 3CCRS 4J9OA 1VQKS 2HURA 2UXCF 1D3WA 1U6ZA 2WW8A 3MEDA 4FYVB 3VGSA 1CLFA 1VS3A 2YKNA 2HFVA 2CA9A 1IR1A 3EXCX 3PYFA 2IYIA 1RT1B 4ZN3A 2G1HA 1WG1A 2VKRA 3AB2B 6FD1A 3GZ7A 1FO1A 1T9WA 1M90T 2LU1A 3L7PA 1LW2A 4L74A 2C2MB 4DMZA 1UEUA 5J2QB 3LP0A 5A76A 1UFLA 3DLLQ 1JLEA 3U27A 4ETXA 1O0PA 2GS8A 1HWJA 5J1EA 2FDNA 2P9GA 2QMXA 3MOZA 2V6AA 5KFPA 3HO1A 1T05B 3CIMA 3M2RB 2HNDA 4ZLNA 5GADU 2HFZA 1R8HA 1ZM4A 2A6OA 1DRZA 2GHVC 1A6LA 4C0HA 1ZM9A 4NA3A 1ZTWA 1D1UA 4R0JA 2CQ0A 2BXJA 4W90B 2Q6BA 1KVIA 4DPOA 2V8PA 4OI1A 1UPPA 3FZBA 2VFTA 2LDIA 3GB0A 2C2KB 3QQCD 4BC7A 5HP1B 1FEEA 1HWKA 3FCHA 4PWWA 2J6TA 2J6UA 1TKXB 3C46A 1QDUB 3CO0P 5D3GA 3EZOA 1XNQF 1FRKA 2U2FA 4Y6IA 4CNZA 3Q24A 1Y3JA 1UP1A 2HVZA 1XEZA 3KJVB 3H5SA 2Y8WA 4KHPF 1N33J 1ZM3A 1RWPB 3HI9A 4WF9Q 3C6UB 4DCJB 3KK1B 4O3QA 2G9OA 3OJUA 3L9ZA 3J81U 1QAYA 2DB1A 3DYAA 4NLDA 3TA0A 1I94F 2J9DE 4ECVA 1KD1T 4V19X 1CQMA 1U6FA 4USMA 2HHPA 5B0DA 2DD8S 3HFKA 2BOPA 3BGRB 1CQNA 2DY1A 3QMQA 4LFAF 4M5HA 2P6SA 4UZCA 2B5JB 1HI1A 4OJ3A 2XS2A 3SQGB 1LW0A 1Y5LB 3QFWA 5AE1A 2J9EA 4LMZA 5GAHI 2R2RA 3OW2R 4ELUA 1YRXA 2DNPA 2QIFA 2BANB 2IA0A 4WFYA 3RW7A 2OPRA 3O6QA 3PHTA 3UDLA 1RCXB 3QATA 3SV3A 2AZ3A 4YP3A 4NLGA 1WF0A 4X62F 1EP4B 2V94A 2JFKA 4GMKA 4K2JA 4QW8A 1PIEA 4XAKA 3C16A 3KG0A 3PR4A 2XCAA 4J9SA 4JI7J 2IVYA 3B4MA 5B0BA 4YB1P 1F6TA 5IQ6A 5IQQA 5LJ5Y 3BPSP 1ZBTA 2B43A 3PW5A 3R7SB 3QBCA 2DNRA 4UT4A 2FLNA 1CJKB 2BUNA 2DGVA 2NXJA 3KUHA 3U1MA 3ZTRA 4KBIA 3Q8UA 4DX5A 2VBZA 4YQWA 2RQMA 2HIYA 3ZZPA 1EIYB 4HHUA 5F8JA 3MXHP 1QUVA 4LRFA 5B08A 3CMES 5D0HA 5AXNA 3DRSB 1SH0A 2EW9A 2NXCA 3CMQA 4H4MB 2DRAA 3LUYA 4KHPJ 1NPRA 1N33F 1Q81T 2C2ZB 2FC9A 3BBBA 5FDLA 2OHDA 4ED4A 2C22A 4LF7F 4XPCA 2HG4A 4LQ3A 4GKKF 4CLKA 3OL7A 1VK8A 5IC4B 3K57A 5H1SV 4DSJA 4WZQA 3RR7A 2DR6A 4LR8A 3OR1B 1WF1A 2APOA 4MYUA 3EDQB 1I5OB 2PD1A 1ZPWX 2IDEA 4X4UA 3SIPB 3W2WA 1X0FA 2LECA 2MY7A 1J5OA 2CQCA 3U02A 3D3CJ 2KM8B 4ZCIA 4RW8B 3EZUA 4ECXA 1U49A 3OTOF 1VBZA 2NSCA 2ZJQQ 5D4PA 4QIFA 5F8HA 2D3UA 2YNIA 1WJ9A 3ZZRA 3Q8PB 1RHRB 4ZOSA 2R8KA 4X66J 3DU6A 2EFPA 3R3TA 3MM7A 2V8DA 2RUSA 2DNHA 2W9CB 3T9NA 3MM5B 2AQ4A 1WKKA 4QWCA 3HJFA 4NPOA 3CNQP 4U9RA 4YY3J 1IN0A 1IR0A 1TL4A 2ZWOA 3TVZA 2B7BB 1HHTP 4K50A 1JB0C 3K17A 1BHNA 1NSQA 1PBAA 4KJIA 2EC0A 2D1CA 5HL7Q 5I3QA 1QM9A 3BKTA 4Y2IA 3N6LA 5ADZA 5KFEA 2W9BA 2QLJB 2QLBB 1FEHA 1K1QA 2BRKA 3R5CA 2ZVSA 4FXVA 5A6PA 2E1CA 1S9FA 2UUCJ 4DWIA 3NNHA 1OYEA 5T7LB 2YKMA 5HVGA 3MUMP 2KFYA 2WW4A 3DMJB 2XMAA 2WTFA 2AJQA 1DTTB 2FJWA 4EWTA 1VOMA 1TL1B 2VFUA 5A8WB 1T3NA 4MAKA 4Y34A 4GC6A 1QE1B 1JLBB 1LFPA 2GA7A 1C1BA 1PG5B 2HFUA 2LQ9A 3DXSX 1WOPA 1L3SA 3QSYB 5F8IA 3HP6A 5K8MA 3UCUP 2UVUA 2JEIA 1Y11A 4N8OA 4KGMA 2I6WA 4PUOA 1GNKA 2VV5A 1X5TA 4EYIB 5L9NA 1V3ZA 3CXCR 1BQMA 2RSQA 4ITSA 3BGRA 4K4TA 4RWXA 3W64A 4QR1A 3R5BA 2WONA 3D9BA 4ZP8A 3NNAA 1FF2A 2NXNA 1RBLA 2YPZA 5KFXA 3GSIA 4J9UE 2BQRA 1REGX 4DBQA 4IFVB 5DGBA 3N9UC 2B4VA 1SV5B 1HMVA 2FJBB 3D1HA 3OTOJ 5HP1A 4JI4J 2VH7A 3EGNA 1TKTB 2UUTA 1YBTA 1B99A 5J1NA 4B9NA 4BLGA 3DLEA 2QMUB 3EMTA 5KG1A 4C6AA 5KG7A 1RYRA 2ACMA 5HATA 4NLPA 4KQZA 1CJUB 3NL0A 5IWAJ 3L7OA 1FDAA 4G1IA 1S48A 1TUWA 4HHJA 3BEGB 1FWLA 1YSJA 3JTNA 3D6FB 1HBOB 5I4MA 1VIXA 4IKAA 4B3TF 4QCLA 3BREA 4F36A 5LMUF 1RT7A 3AJ2A 3AOAA 5L1LA 3OVSA 4FF1A 5D15A 4FP9A 1FXRA 1RT3B 2G2OA 1YITS 1TK8A 2F65A 4TY9A 3PW0A 1TMJA 2F7VA 1U45A 2R7UA 1X9SA 2XG8A 3G82B 3T3FA 4YMEA 1CJVB 3B6BA 3PX0A 4QQBA 3K58A 4P10A 3T1HJ 4F2RA 1TP7A 2DT9A 3PDNA 5EX3A 2KXFA 4IG3B 1P1TA 1UZDA 3D66A 4KPCA 2Y1IA 1DTQA 1DBDA 1UVLA 5EUHA 1TFWA 3W63A 2DVIA 5AT1B 1SIWB 5I42A 2IRXA 3OT9A 4P7VA 1FNXH 1U25A 1SL1A 2Q1LA 3MAAA 2HLTA 2NPFA 4O3SA 4GO5X 1Q8IA 2KI2A 1LK7A 4EEYA 5I3UB 4DPUA 1PGZA 2RS8A 2C1EB 2ZD1B 3ZZYA 3PO4A 2JLFA 4JI7F 5G0RB 5KT7A 5CD4A 2D9PA 2MTLA 3C15B 3DOMA 5KFIA 3TJ9A 4J90A 4KRWA 3GP9A 4YN3B 1YJ9S 1YG0A 4ZIWA 2NPIA 3LGMA 1H2VZ 1CJTB 1HWIA 1SQGA 3EDRB 2OIHA 4FYXB 4WIQA 3WZ0A 2QEXS 2CQ1A 4MKBA 3OVAA 2ZH1A 3MR5A 4PAAA 3PIPQ 1N34J 2CPHA 5ITHA 4ILLA 2DPIA 1GX6A 1JLBA 1JLCB 3M1VA 3WC0A 3NP5A 3TJAA 2G2YA 4N8NA 1F2HA 2AEMA 4NLWA 4RO0A 4OMFG 2ADCA 2H9ZA 3LP2B 1JJ4A 2DR5A 2ACYA 3CDBA 2FVCA 4ERDA 2YWWA 5D4LA 4C2MA 1DHMA 2DITA 3TUZC 2PT0A 2XI2A 1U0SA 2CJKA 2FJEB 2WVFA 3FEYB 3HHDA 4C8NA 4LR7A 2LU2A 4I2PA 4DN9A 3G9CA 5KFGA 2V4RA 5E7OB 1ZS6A 2JSXA 4P72A 4TY8A 5M2RA 3HPOA 2ZBIA 4QYRA 5DLFA 2QO3A 3IAM9 4J9MA 4E98A 4DFJA 2PO4A 5DO2A 4J9NA 3TANA 2N3OA 1HI8A 4LFAJ 3DOKB 3SCLE 3VR1A 2DNNA 2E5GA 2V4JA 5GMEA 3BKUA 1DZ5A 2K7KA 4E0DA 2M5YA 5FLXU 4DUZJ 3MMBA 3TVKA 3G87A 4ZCLA 3G8SA 1MG7A 4K59A 1S1WB 4MJKA 4NWBA 4Q0BB 1U8SA 1RLCL 2A3JA 1SV5A 1EQMA 2IM3A 2CZ9A 4F25A 3R1LA 1HD1A 2HQGA 5DGAA 2F40A 4RW4B 5E3RA 3T6BA 3KNGA 2MKKA 1SL0A 2OJ3A 2DIVA 1EETB 4LSZB 4R8UA 3NXZA 1N5SA 1BMQB 2NLWA 4MIBA 4H4KA 3BGUA 1UEKA 1LKZA 3MWBA 4K4SA 2BKPA 2O67A 1UWBB 2RQKA 1I6JA 1UW4A 3KLEB 3RB6A 3DLKB 4AYBD 5B7WA 1IBKF 2VOOA 4RW7A 1Z4UA 4CLWA 2KXHA 1X7VA 2QV6A 4UOHA 4X4TA 3E2EA 1F1BB 4O4RA 3G8TA 2Y1LB 2HNDB 3Q8VA 1VC5A 1AZSA 2LP4A 2YWHA 4QIEA 5J2PB 3CJ5A 2FZGB 3D3BJ 2AGPA 2KM8C 1RTHA 2DY9A 4L6V3 3QRQA 1SJ1A 3VV2B 2HFSA 3TUJC 2PFFB 3IGNA 1SKUB 1BY9A 4E8UA 3KLFA 2QN6B 4BDPA 3QPIA 4OYZA 4P2SA 2Q79A 4FBTA 2K3KA 3PHEA 4OHYA 1V3RA 4DUTA 2JZ5A 2DHGA 1O6XA 5L9XA 1J27A 2EKNA 1N0UA 4J91A 1UTAA 4HACA 2FJVA 4QW9A 2KG1A 1MN7A 1W26A 4FZVA 3ZZZA 5D8HB 3PNIA 1WC4A 1LWCA 2EC2A 1RA7A 3FJ2A 3ZO7A 1C0UB 5JVGQ 3RAXA 3C6UA 3R5GA 2HFNA 1FD8A 2I1RA 3D6MB 2DR9A 1QSSA 4JYAJ 3FRYA 2VASA 1BWEA 4B3OA 3L09A 3PJWA 1H7XA 4HT5A 1NHUA 3FFIB 1J5OB 2CJ9A 4LF2A 1RADB 5KOWA 1M5HA 4RW6A 4ZLJA 4Z37A 1M5VC 3PG9A 2ZOGA 3OV7A 2YKQA 2XSJA 1W2BR 4WFZA 3JYTA 4DUZF 1R3NA 2RQ4A 2XMWA 1R27B 2AJ1A 3MD3A 4F4AA 1N5TA 1RWMB 2DGOA 1JIHA 5KFLA 1KR4A 1JLFA 1X8DA 1IBLF 3KLGB 2HAIA 4RWWA 1U1NA 3VGTA 1N6QA 2HMIA 1N8RT 2MLXA 2CQ4A 4NCAA 3CC4S 4ZJQA 4P52A 2LEBA 4M5LA 1GXTA 2DO0A 2HHWA 1T02A 4ZA1A 5A8KB 1LWEB 2JHEA 4OZ5A 5IV4A 1UKUA 4HYKA 2HHHF 2E1MC 4GKJJ 2ZZNA 4PYAA 2G2ZA 1VQLS 4DR4F 3NBPB 4USWA 4FS1A 3CJ0A 3LWLA 2V5HG 1SH3A 1WC6A 4ANCA 4LF9J 1DQ8A 2Q3PA 1YWXA 2ZC4A 3QO9A 1S0VA 5LSOA 1RT4A 1D8ZA 2QMWA 1RABB 2D74B 2HNYB 3AD7C 4IH7A 4IH5A 2M0GB 2ILYA 1RTHB 4X64F 4NXNJ 4C3MA 2V8VA 2HHXA 2QT7A 2YH0A 2BRLA 1U0HA 2HS4A 2ILZA 1R6YA 1JMTA 3CJKB 4DZDA 3GFZA 3UDVA 3TA1A 4WK1A 2N7CA 2H54B 2FY1A 1NPKA 1JKHA 2WHOA 2BE2A 2RILA 2ZZMA 2VQEF 2LXFA 4DFMA 2DNQA 3S01A 3E3XA 1MMLA 5GVQA 5T14A 1LV5A 2YNIB 3A13A 1M1KT 1JNZB 2AEJA 3K59A 1OO0B 1R0CB 2E7VA 2P2CB 2N4DA 2B51A 2CQBA 2CJAA 3MM6A 5BR8J 2WSEC 3MOJB 2BJ8A 4RNNA 3MPDA 2UXDJ 2PEBA 1QD1A 5HQ8A 4Y2MA 3GTYX 4NYPA 1APSA 1R8BA 1V9OA 1VRUA 3ISND 3RB4A 1S1UA 4N5SA 3Q8SB 3AD9C 2P9EA 3M8QA 4KH1B 5F8NA 2ZHOA 4DDFA 2UUBF 4Q43A 3KK3B 1UJ4A 1JX4A 5EWGA 2HRYA 4I64A 4NLOA 3GYGA 2RUGA 3Q8RB 3OUYA 3QRRA 1HWUA 3DRSA 1RHJB 4KKOA 4RBVA 3PEHA 4XIUA 2XLKA 2HHVA 1RAHB 1RHMB 2MKYA 2FD2A 3GG1A 3N01A 3N4WA 4FKYA 1KOHA 3HF5A 1NAQA 3KG4A 3KHGA 1S9EB 2ZH2A 2NQPA 3C14B 1FVQA 1LWCB 4CO2A 3I9ZA 2DPJA 1S57A 2X7IA 5GMKa 1LQ9A 2DYAA 2YKMB 4QIWD 3RAMA 2ATCB 4ECWA 3J7AN 1HQEA 2YY3A 3MM8A 1HR0F 4ANDA 2Z2YB 5H9EK 1S0OA 4PQAA 3IG1B 3J80Y 1EAYC 4LFBJ 1RAFB 3H2UB 3M2VB 1E6VB 3VZIA 2VQFF 4DV3J 2IM0A 5HQMA 1IKVA 1HNXF 1TKTA 2EFQA 2CWKA 1TL7A 2VPXB 1BQNB 1U24A 2F4FA 2WOMA 1FESA 2E1AA 2I0XA 3A4TA 1U1MA 2RD5C 3AAWB 4WU3A 2ZDOA 2XY6A 2W2PP 2KKHA 4TN2A 1REVA 3CC2S 3SZ2A 1VBKA 1MROA 2YWKA 4WJBA 2R7SA 3O1LA 2KVIA 5AE2A 1KHWA 3UCZP 1NM2A 1P8GA 2QFIA 3SBMA 5E0OA 3SDEB 3UQSA 7FDRA 3PVXA 1H38A 3NBPA 2QLFB 5HI7A 4MIWA 3EGZA 4Z2XA 5KFFA 2A6MA 2HAFA 5HBMB 2VG6B 4ED2A 3W3SA 2CPXA 1CJTA 5KFZA 1NNDA 4HH0A 2NREA 2MJNA 4QWDA 2NR0A 1Q79A 2CJXB 1U4BA 4ZN1A 1NHVA 4HTIA 4RUAA 1ZA1B 2XS7A 4RNOA 2VG7B 3QRPA 2W1BA 4WYWA 4XPEA 4NRUA 3M8ZA 5ETSA 3V5RA 3MFIA 3W9IA 1O51A 3MM6B 1I51B 3UVJB 4NOHA 4CWBA 2XQCA 1XMQJ 3PV8A 4DS4A 5CAAA 3NGTA 2VKZG 1FA0A 3WQPA 2CADA 3VAJA 2E66A 2NS1B 4AD6A 3NNCA 2CQHA 2CQIA 4U8VA 3W61A 1F9EB 5CYJA 1Q0NA 1PJ5A 1AROP 2A2CA 3QLHA 4GVLA 4J7CA 3W2VB 4DJBA 1X4DA 1R89A 3US5A 4CTAB 1R0AB 4OZJA 4IUFA 2AJ2A 1NDPA 2NYIA 4MYTA 4RW6B 4F0MA 1HR0J 2XGQA 2HBYB 2WONB 1IKYB 3QIDA 4P71A 3DLJA 2MQOA 3CJKA 3QYYA 3CCUS 4EZ6A 2KB2A 4FVCA 3OTEA 4IQMA 3BYPA 2FJXA 4O3NA 3CJ8A 3ET6A 5DQHA 4F0KA 2EXUA 1XR5A 2XMMA 5ETMA 1S6OA 3ENVA 4JUZA 2FHKA 4OJGA 3D2WA 1MLAA 1MNEA 1Q8KA 3V4IB 3OR2A 2X3GA 1F5AA 1V6HA 3QT6A 4OLOA 6AT1B 3VAMA 1GQEA 3LP1B 3H4DA 2W7AA 2A18A 1JLCA 4NX9A 2HSEB 1OY8A 5I3UA 1KLNA 4ECSA 1GT8A 2XB2D 1PAEX 2ZITA 1VQ7S 1BC6A 3HVTA 4FVMA 3T6JA 1K44A 5L46A 5K9FA 3HHNB 2RB7A 3EPGA 4B9LA 2GHPA 4WZMA 4N41A 3ENAA 3THTA 1VQOS 1KN6A 4IDKB 5DLGA 3NWRA 1YJ7A 1FXDA 2L08A 3U1LA 3RBDA 1TVRA 1UVMA 3CWJA 3GJQB 2QRRA 4USJC 3CVKA 3PX4A 3IR6B 3VAKA 2BV3A 3GMGA 1WOSA 2RU9A 3HKWA 2IJRA 4DS5A 1S1TB 1NMEB 4PCQA 1X9WA 1RQ0A 4X4PA 3VVUA 4YOEA 4ZVFA 4WFBQ 2HVHA 5ETRA 5BYSA 4H4MA 1EP4A 1WI6A 2VZ9A 3DOMB 4YR2A 1N34F 4ILMA 2KRRA 2GZOA 4WTYA 3SEOA 2I2YA 1DQAA 5E3PA 3SDEA 2N4CA 4HACB 3BM7A 2LA4A 2EFVA 5A8RA 2ATLA 2UXDF 4QWBA 2WB1D 4P74A 3SQGA 2MB0B 2BE7D 1QTNB 4CDIA 1T95A 1S10A 3W60A 1XBWA 3D6TB 2XMKA 3A8KA 4V19J 4CM2A 3OVBA 1T03B 5F0UA 5KT4A 2YQ0A 4LIWA 1NK4A 2CG8A 2V34A 3HXMA 2R8GA 3AA9A 2ZNYA 2PMHA 3OPKA 2ZBPA 1RXOB 4MKAA 5HMYA 1S9EA 3HCXA 1PYTA 1MWYA 4HTJA 3VAGA 5E41A 4K4YA 2HWHA 5DZ6A 2PMWA 3RTVA 2CFXA 2ZOFA 1JLGB 1RDRA 3FCWA 3PYDA 3HZGA 4OHVA 4RW7B 5B0FA 5LSLA 3JSYA 3SYZA 4IFYB 4DSKA 2GMLA 1R31A 4ZVEA 4CLZA 1IWAA 2VDIA 5CYQA 4ZS6A 4OL8A 4FPIA 3J7Z5 1N88A 2YKPA 3WIUA 2BANA 5KTQA 3H5UA 3N6MA 2MKCA 2MQLA 3DRPB 4JI2J 1X31C 2F5GA 3I96A 4PKDB 2BX6A 4AUKA 5KG0A 1KP6A 2ZEJA 2V68A 4A8WA 2ASLA 4MFBB 1QAJA 4RUHA 3HD2A 4TYAA 3KJQB 3SSSA 2DXEA 5G4DA 2KT5A 3H5XA 3H90A 4NEZA 4I7FB 1Q1KA 3Q2TC 4LVOP 5IOLA 1VQPS 2UVWA 2BE9B 3RB3A 2IC3A 4IQXA 2CPZA 3D1OA 4DCPB 4PUOB 5B0AA 3QSIA 4B3MJ 2ZDPA 1KEKA 2I9SA 4A8YA 2VONA 1BWVA 2IYGA 4C8LA 5HBMA 1C1BB 4ZVQB 2KFZA 2V0NA 4U8YA 1WEXA 2FTRA 3R6GB 1KDNA 5A8WA 1KLMB 2ZFHA 5HROA 5CQGA 2OUGA 2O01C 1VC0A 4QU6A 3J80U 1SXLA 3F0NA 2LMIA 1S1XB 2JC0A 2FGCA 2FZKB 4ER8A 2OLWA 3DRXA 4PABA 4ES2A 1HWLA 1PKUA 4QPXA 4CO0A 2CVEA 4U6PA 5CD4H 4UOGA 1KVKA 2EBGA 2C3UA 2VC0A 3NOGA 4UOCA 3UD3P 3SCJE 3AJ1A 3TQ1A 1DURA 2HHQA 2IY5B 4OHZA 1HBNB 4Q8EA 3VAHA 5E5NA 2UUAJ 1PAUB 4RLEA 1RSCA 2OEJA 3R7BB 4O0IA 3TUPA 1GK8A 1XR6A 3HFZB 1KRPA 3CMAS 2AV5A 2A0FB 3PR5B 4C8YA 2AF6A 4WIIA 2UV8G 3W5XA 1YJNS 4JI5J 4TU9A 2Z0GA 3I5CA 1Y4ZB 1RZMA 2JNJA 3PFOA 2KVQE 4KKOB 4O3PA 4NYZA 3TZYA 1Q86T 1Y00A 1A0OB 3QIPA 5DDQC 5GMDA 5EWFA 4H4OB 4J5OA 4DV4J 1L3VA 3FFIA 4OYIA 2L48A 2C3OA 2P6TA 2W4DA 4WKRA 1RWKB 1FCAA 4UUXA 5K14B 1TAUA 1S6QB 4B3RF 1UAWA 1VC6A 2KU7A 2BBEA 4ZVHA 1NK6A 2HK2A 2DK2A 4G3IA 2XTJP 4PWDB 3RRGA 1T11A 4M94A 1RTJA 3PRVA 4X64J 1GMUA 1PJ6A 4DU7A 4G6VB 4ETZA 1N5YA 1QSLA 2LEAA 2XBPA 3IM8A 3ITHA 1S6UA 5B0EA 4B3SJ 3TNVA 3K5OA 4C0OC 1IQZA 1X5PA 4MKVA 4RZRA 2EFNA 3LA0A 2VD3A 5KFRA 3PXGa 2NUHA 4USHA 3Q83A 2J9DA 4WU2A 4YHHF 4DSEA 2VG5B 1KONA 3MEGB 1ZZFA 4N77A 1FKOB 1TKXA 2QA1A 2AW0A 1FWPA 3AB4B 1VQ4S 3BR9A 4OJHA 1EARA 1NSKL 3CJRA 2QGFB 2ZH3A 2M8DB 4DLEA 1NJZA 3UNYA 3N5BA 2E44A 1XMQF 5ETVA 4DU8A 2XZDB 5DQIA 1CULB 2CDRB 4NLRA 4QWEA 2HHTA 2MEWA 4LF4F 3DC2A 1YJUA 2XSFA 2D3OR 4OI6A 2EFGA 3CCWA 3MF5A 4DR5F 2OEKA 2LLZA 3AOBA 1NDLA 2GVDA 4OHXA 1BQXA 3OXLA 5DM6Q 1N36F 1AFJA 5J1EB 3R6LB 5E33A 1NU4A 3M2VA 1S4FA 1SCJB 2HS0A 2ZVIA 5CYMB 4ZLLA 4CH1A 1JKHB 2XYPB 2DXFA 3O5TB 3M1VB 1J5EF 2JEJA 4BS2A 5EDWA 1EKSA 1NBEB 4DV0J 2B3TB 3G71S 1NSPA 2RF2A 1GXLA 2YNHB 1I3OB 1RJJA 2I8EA 4I1TA 4KV8B 7FD1A 2PI5A 2HQFA 3DU5A 2W4CA 2HGNA 3DLHA 2AYEA 1HNVB 3M8PB 3CCZA 2Y8YA 4ELVA 3ITHB 1WSRA 2XCPA 2KXNB 3BB5A 3NGRA 4MMOA 3GFXA 1FWKA 2EI5A 1FFGB 2QYCA 4U96A 4KGXB 4DZ6A 3HM9A 1VRTA 3M8QB 4M5KA 3PY8A 2MKHA 2WZ1A 3ELHA 1OY6A 4DL3A 1KQFB 4JOUA 1CS4A 1BQNA 4IH6A 5K14A 2FPHX 4DHVA 5J2MA 1NK8A 1PYSB 2PC6A 3R5AA 4DR1J 1WWHA 2POKA 1EZZB 2G0IA 3QGIA 3ZNJ1 1TELA 3QIPB 1WACA 2MJUA 1H72C 2F63A 3LGNA 2AYBA 3TYTA 2DNMA 4HLBA 2D7SA 4ZCKA 4DL7A 3MCOA 1VJQA 3IWLA 1FJGF 2KZMA 1BE4A 4UTGA 3WX4A 3CJ4A 5F41A 3GONA 5F3ZA 3I0RA 4KR0B 2CQ3A 4OZ1A 3BO2A 2XO6A 3TX0A 2FVQA 3MI7X 5LM7E 1FX4A 2VG5A 3A8EA 4PEOA 2Q43A 3PEJA 3H20A 4OI3A 1R8AA 1VISA 1U2CA 5ETPA 3UDEA 5B0CA 2ZH5A 4UZBA 4DPYA 4FXDA 2DO4A 3EJMA 3KG1A 1FK9A 4OX7A 4LFCJ 1S77D 2JEFA 4AL5A 2BW7A 1MWQA 2ZE2B 3UN5A 3UO0A 1VR6A 4OYAA 3RG6A 3AODA 3M32B 2CQPA 3HHKA 2KT2A 2I5JA 1Z2ZA 2WVBA 3LPYA 2HGMA 2ROEA 4OZ3A 3I56S 1D0EA 5LSRA 3TZZA 2AU0A 3DDIA 3P49B 1XNQJ 2JJ4D 4FNHA 1S7HA 2SXLA 3E8OA 1W25A 5DRKA 1N0VC 3ZFVA 3GV5B 1J5EJ 3LTOA 2XZWA 3NGSA 3MMBB 1N32F 5GAEU 3I9V9 3IRWP 2VPWB 5BR8F 3HHLB 2X1AA 3DLGB 3FC9A 1Q78A 3P96A 3P45B 4F3QA 4DL2A 3LGHA 4WKYA 3ZXWA 4LF6F 4ICLB 1S49A 4J37A 1J2VA 2EFOA 3MMCA 3PW7A 2GMHA 1SJQA 4M5DA 1V5VA 3GIRA 5J2NA 4PZVA 5HK4A 2AT1B 4WBFA 1WEYA 1B0TA 1C1CB 2GVDB 1S9GA 2RF2B 3H8YA 3QAUA 1PILA 1RGVA 1YRTA 1IWGA 3I0SA 3R27A 2EG1A 3JSMA 2W9AA 2Q66A 2EWHA 1EJ7L 1JNRB 3UWTA 1C4CA 1D09B 4TLRA 2K1RB 3M2UA 3I32A 1VQ5S 3RR8A 2WCXA 5C7PA 3NCPA 3P4UB 2FUG9 4R8UB 3RYLA 1SVDA 4QYZJ 2OPRB 3W5ZA 1Y5NB 4P75A 4CI0B 4DV1J 3JTPA 1LWEA 3VTIA 2MZRA 4LBPA 1RWOB 2QL7B 3M8PA 4W98A 2ZUAA 1JLQA 3KNAA 3T5JA 2XY7A 5C2CA 3OLAA 3BKFA 4K2XA 4B9SA 1FJGJ 1IVZA 1EKRA 1AUDA 2CG4A 2R2TA 1WKJA 4NLTA 1JWWA 3FBEA 3NWGA 4FYDA 1ZAVA 3QZ7A 3ISZA 4RBTA 3H59A 3OJSA 1YZ6A 3TOQA 1FE4A 1R0BG 3MMAB 4H54A 2L9DA 2R7RA 3R1HA 1FKOA 3NEKA 2NYHA 3OFHA 3VGUA 1U2FA 3PZPA 4N76A 2VICA 2XMVA 2Y0BB 3ZTQA 3DLEB 2ABYA 4A8KA 3K0JA 4YFUA 2HKEA 3H98A 1UVIA 2B6AA 2V67A 5A8KA 4F7VA 4IOCQ 3TAPA 1JLAA 4C3LA 4OX9J 5JJBA 4DV6F 4DLGA 1M5SA 5D0GA 3DN9A 3DRRA 1RT2B 2OFHX 3MECB 4DX7A 3BBFA 3JQJA 3NRBA 4C8KA 1UFKA 2AD9A 2RS2A 1XWLA 4YR3A 2IM1A 3BQ1A 1X4GA 4OI0A 2V2QA 2OMLA 1QE1A 2LQJA 2M2BA 4C48A 1ELOA 1WHXA 4JYAF 2D69A 1F2GA 3CJ2A 2R4FA 2UUWA 4RU2A 2UUBJ 1HARA 4P73A 3W65A 2M52A 2MY8A 2MZJA 3MHYA 3OXFA 4OHWA 5KT6A 4O3RA 4DXLA 2ZC3A 1GFWB 4DUYF 4C8ZA 4M95A 3A1YG 4FDFA 1SJ3P 1M5PC 1Z2LA 2LYVA 1CEZA 2PIIA 1PYOB 4AL7A 4TVAB 4I4BA 2CWXA 1K1SA 1EHWA 4USTA 4EMDA 4ECUA 4FF4A 3QGPA 5L8RC 5J2QA 2M7SA 4ZVUB 4DQSA 3T1HF 3UR3C 1HFEL 5I3PA 3BN4A 4X4SA 2DHSA 4LFBF 2E9TA 2MSTA 2J6SA 2COLA 4I2QB 4KHRA 4GC7A 1VQ9S 3NMRA 2DCUB 1RAIB 4NZ6A 5KFUA 2V8HA 3D1QA 1WD6A 1SC3B 4U95A 2YKNB 3UCGA 3D5MA 4C0BA 3NGDA 4M5MA 3L7UA 5CHCB 4B08A 3DGPB 2RKIA 2FYXA 4ZDNA 5A8RB 3CT9A 4DQQA 5KG4A 3IA0A 3H2VE 1HA1A 3GJSB 1ICEB 1WORA 1YGYA 3O3LA 2LQBA 4P2MA 4PRFA 5MAOA 1ZAXA 2Z2ZA 5GADI 3CPWR 1UFWA 3GV7B 1NXIA 4O0NA 4ECRA 5BYRA 1HNWF 4KFBB 4C8OA 1ZAWA 5ETNA 1GMVA 4BWJA 5HQLA 5LOQA 4NZ7A 3SQOP 3F41A 2V63A 5JMNA 3JSMB 4KIAA 2NXUA 3DDKA 3TVYA 1FJ7A 2OPPA 4BC9A 4NCGA 4K4UA 2PA8D 3ILLA 1Z1ZA 4KYZA 4H4KC 4HL9A 4LSNB 9RUBA 1I1GA 3NLCA 1TKDA 1XC9A 1VQ6S 4B3TJ 2HIQA 3NAHA 1RT5A 5CYQB 5HN0A 3OSPA 5SUHA 1GTEA 5B09A 5L39A 2LKZA 2VBYA 4C8MA 3T1AA 3NOCA 3Q2SC 3DRRB 1Y3KA 2Z57B 2ZD1A 2WVCA 2Q6CA 1URNA 2HWIA 4DUYJ 4TKTA 2G1DA 4NLXA 3F56A 3TAQA 2XMTA 1S1WA 1TKZA 2B4PA 4OZNA 1HHQA 3TAMB 3HVAA 3VZHA 4KAIA 3QZ8A 5H9FK 2DNYA 1U1OA 1N5VA 3EVWA 4XO0A 1XTZA 1HD0A 1R8CA 3BGLA 3BSNA 2W7PA 3EPIA 1NJWA 4WP3A 1FRMA 1R7IA 2BJ9A 2RU3A 4KY3A 5ETOA 3C16B 2CPDA 1JXLA 1OSCA 4M8LA 2R7TA 2HBRB 4I2PB 2KL8A 2GO8A 4I67A 3M8RA 4O3OA 4DQPA 5C5JA 1PJ7A 2MQMA 2J0SD 3H40A 3H5YA 1Q16B 4OI4A 1TAQA 1YJRA 3BGFA 4Q8FA 4ED3A 3PIOQ 3MEGA 5F9NA 2ZHAA 4KC5A 1IKVB 3CCLS 2YXLA 1L3KA 4DV5F 1TV6A 3QT8A 1M5OC 2XGPA 2ZZTA 3KTQA 4C11B 4JI6J 3FCVA 2GV1A 2JX2A 2LFVA 3GR0A 4KHMA 5HVFA 1WHYA 2PGCA 1TR0A 4ED7A 2GVZB 1IUJA 3UW1A 1T0TV 3EICA 2W9BB 4U7UD 4U7CA 1CVJA 1OMSA 3IBWA 4O44A 4OYBA 3IWXA 5A0YA 2QL5B 4BHQA 1RWXB 1VHFA 1N48A 1Q8BA 1IKWB 3LAKA 1U1LA 2OPSA 4EFAC 2UUCF 2G4BA 3W62A 2LCWA 2MZSA 2FHMA 2HBZB 2R8HA 2W25A 4NI2B 4DL5A 2MGZA 3RBXA 3GFYA 2EK1A 3GQCA 2O5DA 1KSPA 5C24A 2PI4A 2KZZA 4JI8J 5BXIA 3KLEA 3MCSA 3KUGA 2D3O1 3HVTB 3FGVA 4K0KF 2RMLA 1Q7YT 5HAOA 3KHRA 4O4GB 1OJ4A 4KFBA 2QSWA 5HSPA 1HW9A 3TA2A 2XYHB 1RTJB 2IPOB 1C0UA 4YB7A 1QVGR 5KFWA 3FKBA 4NL5A 1UZHA 1RT6B 2MKJA 4LJMA 5E2QA 3BO3A 2K06A 1E6YB 3ENWA 3RJMB 3D7SB 1S6PA 3RZAA 2V69A 3D6HB 2BQ3A 2HLUA 4ZVGA 5CYMA 4WCEQ 2E7WA 3ZTPA 3Q0AA 1U1KA 3SXLA 1RTDA 1FKAF 1HLWA 1TV6B 4NMXA 1IJFB 4RL1A 4YS2A 3J81Y 3CW2C 3W9JA 2ZH7A 2C2DA 1L5UA 1ZZNA 3H7HB 5FIIA 2V9KA 1KKHA 2CDQA 1CSJA 3KLFB 3LALA 3M6XA 3LWMA 2W9CA 4CTAA 4YDDB 1IJEB 4DR2J 2BR0A 2J0QD 1UVKA 2J0WA 2WAQD 1K9MT 1Q7LB 1SUQA 2B4OA 1HNIA 1WF2A 2XZTB 2X51A 3MPUB 4P2FA 2R9LA 1HKAA 2WSFC 1TUGB 2VU5A 2J7KA 3FUYA 1S59A 4ILRA 3G6VA 3O8WA 5IT9Y 3MEEA 4IRCA 2KHDA 2B7CB 3IRXB 2QL9B 5KFOA 2C3MA 4DX6A 1GTHA 4U7UK 4DV5J 1SJFA 4LF9F 4MK8A 3EWGA 3HHLC 1VLOA 3FQLA 3K8VA 2CNOB 3I0SB 4K8RA 4QIVA 4V1Ak 4W92B 1ROFA 3CDEA 4LF5F 3HDSA 5HMZA 2BJDA 1BUXA 4UF4A 4ED8A 4X4RA 3OL8A 1JLGA 1YI2S 2Z2MA 1UA1A 1Q5VA 3DRPA 4BWMA 2W8KA 2HVDA 2KT3A 1FRXA 4I56A 2X1FA 4KV8A 1RWVB 3CDUA 4ANEA 5CCLA 1FD2A 1XMOJ 3KXDA 4IDKA 3C2PA 1WOOA 1GAOA 2OP5A 3TZXA 1FE0A 3GG0A 5I42B 5EN1A 4NCGB 4NXMF 1H74A 3KUEA 4OX9F 2M8HA 2XLJA 2EBEA 2IC3B 4IFYA 2OPSB 2LA6A 1DLOA 1FRJA 2VPZB 3AXMA 3MAAB 5DDOC 2ZE2A 2H51B 3I31A 2UXCJ 2Y0SD 2HEKA 2B56A 1YX2A 2E29A 3KJVA 3O44A 4J9QA 4QWAA 4ZMMA 3SSQA 4P9SA 2CUYA 1YQHA 2I5JB 3M8YA 1ZETA 1IKXB 3CO9A 5E3QA 2E5JA 3GJRB 1H73A 2WBMA 2VB6A 4K7QA 6FDRA 1QSYA 4NRTA 2VBWA 4IG3A 3LH2S 3E51A 3MGJA 4JI1F 2JVOA 5KFVA 1TL5A 4DL0C 3HJVA 3G82A 3Q86A 1N32J 2A2DA 1HBMB 3IM9A 3Q23A 2J76E 1KOOA 3UNGC 4DEZA 1M1GA 3KDNA 3IG1A 4F0HA 1AFIA 1B4SA 1CJUA 3QT7A 2O66A 4PG4A 3LF0A 4JI0F 5GAGU 5RUBA 3M2RA 1MU2B 1DQ9A 3D68A 3BPDA 3DCAA 2HS3A 4X65F 2R42A 5H9FJ 5HMWA 3R5JB 3W8PA 3G96A 3LP0B 3J7YU 1JJHA 5A6WA 1VRUB 4OV1A 3AXKA 1B70B 2GHWA 5HVHA 3J7YI 2H5EA 5AJ3J 4EI2A 3MMJA 5L38A 4Y00A 1WHWA 1SH2A 4Z7YA 5K8PA 2QG9B 1IBMJ 2HPUA 1IM6A 2EVZA 3BQ2A 2J8SA 1WTBA 3IS9A 2OAUA 3WC2A 1S99A 2IRYA 2OMOA 2UZAA 3FSXA 3FNNA 2OI2A 3MEDB 5KFNA 2IBOA 4CIOA 3UD5A 4ECQA 3NCRA 2B9YA 3KOAA 4NLYA 2B9EA 3IC1A 2ROPA 2VG6A 4RNFA 1AW0A 3OFFA 2DXDA 2FHOB 2JH3A 1XQIA 2BEFA 3P5BP 1NCLA 2VL1A 3MECA 3Q8YA 3THPA 4DR3F 5K5MA 3DLBA 4X4QA 1T94A 2N82B 3GWCA 1DFDA 2YQ3A 4ZP9A 3A12A 2RKIB 1X4EA 2W24A 4HDHA 1GMWA 1WUUA 3IR5B 4ZVTB 1JLAB 1VFJA 3Q8QB 4DFPA 2HHHJ 1TL3A 3G6YA 4A4JA 2H48B 2JRSA 1OPZA 4DV1F 2AEFA 1KVJA 1UW9A 1RWWB 2OTJS 2YWGA 2CRLA 2MDAA 3MR3A 3O2IA 4Q2MA 1AXQA 2WK4A 4PG5A 2DRBA 2UVVA 2ZBQA 1HQUB 3MM8B 4JV2A 1S6PB 4QZVB 2Z58B 4DSFA 4IO9Q 2CVIA 4DV6J 3L95X 1FTCA 1OSDA 2AGQA 4YB5A 4ZKAA 3TARA 2DISA 1IR2A 1E6VA 2RJZA 1B0PA 1SPBP 3I82A 3N5FA 4LUBA 2DGTA 5B0GA 4LF8F 2FVSA 4AL6A 2HK3A 2GCFA 4KSEB 4UUWA 5CH7B 3ZZ0A 4Q7AA 1DARA 3A3PB 3L3CA 4NLSA 2ASDA 2XMUA 4KPYA 4HI1A 1M1HA 3M9MB 1DLOB 2R7WA 3MM7B 1G7CB 3T5KA 1FI4A 4L75A 3FEZA 1UVNA 4DI6A 3VQTA 1ZM2A 1NZAA 1S1VB 1U02A 3NMAA 2RHQB 3FRZA 2IA6A 3UI3A 3F73A 3CULA 5CA5A 3QJPA 4F02A 4B3OB 4B3MF 3BYRA 3TAMA 4NLQA 2UV8A 1RKJA 3ENQA 3FDSA 2DEIA 2XWYA 3FBCA 4A8XA 3J7ZT 4F4WA 1HW8A 1CPZA 3GFHA 1RWNB 1TQLA 4GVBB 4B9MA 1WNEA 4K4ZA 5FJ4A 2DHHA 3AH6A 4RKUC 4X65J 4ZVRB 2BJ3A 3OSNA 1CC8A 1KQKA 3OUYB 3BF4A 4HKQA 2QLWA 2CQGA 4ZP6A 2B6AB 2YNHA 1VQ8S 2VDHA 3G86A 3QNWB 5C25B 4RNMA 2E9ZA 3JTOA 4DF8A 2C2OB 3D0IE 1Q4RA 3NY0A 1S12A 4RJVA 2PEHA 1D8YA 2PN6A 3P8BB 4L3NA 3NCQA 5LXYA 4LR9A 2MYFA 2F4VJ 2F8MA 2Y3YA 5DG9A 4B3RJ 1QAXA 3J81j 1MU2A 1FNOA 2YTCA 4USIA 5JVHQ 3GILA 1JLFB 3TEGA 4PXBA 1LWXA 1RA6A 3AQPA 4ZPBA 2ZH9A 5CZXA 1T9VA 1VIOA 3V6KA 2KDOA 2XHWA 3S7RA 5GAHU 3K5LA 1HI0P 1IM4A 1O8BA 1MW7A 2H1YA 4P6QA 1OY9A 2ZM6J 1YZ7A 2F8EX 2XMJA 1U2RA 4WE1B 4RR5A 3LP1A 1AZSB 5KAKA 3HT0A 4IRDA 5IT4A 1YTYA 1T9XA 2HGLA 3KWMA 1T3OA 2VA2A 4KGZB 1YHQS 4ZCMA 3SSRA 4EU0A 2UU9F 2HW3A 2FLOA 1DAXA 3EGWB 3IR7B 4ZPWR 2OD6A 2C42A 2J9CA 3RBZA 3RBEA 3RW6A 4LVNP 2AX1A 2BABA 3R97A 4ZK7M 4DR4J 1KQGB 1HBOA 2AIRB 2UXBF 4OZ0A 3V81A 3ZZTA 4LF8J 1LOUA 4ZHRB 1XERA 1SJRA 4QJVA 1KS2A 3NGUA 4DR7J 2RVJA 5D6GA 4UY8T 4L76A 5KFDA 5KFQA 1B7YB 2CKWA 1EX8A 2CZVC 3KMQA 2GNKA 2PA3A 2NSBA 4K5SA 1YJWS 1FRHA 4Y2KA 3VHQA 2MHNA 3V6DA 1D9FA 2V9WA 2VIHA 4LF1A 3VALA 4B9VA 4MK9A 1KC8T 5J2PA 2XY5A 2ASYA 1C2PA 1GMWD 2P9CA 3CSKA 3PTWA 4O44B 2C3YA 3I87A 5A0YB 5D3GB 1XR7A 2ADBA 3ZTSA 3ULHA 3JYTB 3CCVS 3T41A 4OX6A 5KFHA 4EZ9A 1IBLJ 1FK9B 4F4XA 2F9DA 2JL9A 4DG1A 4OV6A 2WVDA 1YJVA 1X4AA 3Q22A 3J7A1 3JXOA 3LOUA 1QTMA 2QX0A 3EXYA 5KT2A 5L1KA 3K5MA 3LAMA 4DN0A 2CNKB 3TRGA 4ZPCA 1WHVA 1UEVA 2AX0A 2VC1A 5KFCA 5IT9U 1R8PA 1RT7B 2VUGA 2FY8A 1UPMB 3PRBA 3CCES 5HLFB 1TL1A 4Y2CA 3C8YA 3BO4A 2G0JA 3M4XA 1RT4B 2RRNA 5HO4A 2CYYA 3BS9A 3KK2B 1QLNA 3G6ES 2R8JA 1ZH5A 3HSJA 1HYSA 3PACA 2CPYA 3AT1B 2YKAA 1LW0B 2ZBRA 3M6UA 3G6XA 5HROB 1RT1A 4IOBA 2DNKA 2MSSA 2GIRA 1TL3B 1FX2A 3B8HA 4M5DB 2BE2B 3HMJG 3BBCA 2UXBJ 4QBUA 3OL9A 1WI8A 1LW2B 2K1RA 2NZCA 3HFVA 3M2UB 4MIAA 3CCSS 2HQDA 1JQGA 2YPYA 4A8SA 1PO6A 2DGSA 2XSJB 1FFSB 1U0HB 1WDTA 2CJQA 3I0RB 3CC7S 4F8RA 4M5GA 1YK9A 2B8QA 2R7VA 2FJAB 3CD7A 2PDAA 1Y0HA 1NJYA 3OHAA 1Q82T 2IFXA 1FJEB 1JLQB 1RLDA 1RYSA 1PCAA 4I69A 5IFMA 5KOXA 4RW9B 2RDJA 4EGLA 3AHPA 3N6NA 3CUNA 3V2UC 4JI1J 2GFFA 2DNOA 3UPFA 1X4BA 4QPTA 1DTQB 1RISA 2V4JB 1AUSL 4ZP7A 4AT1B 5EX0A 2OPQB 4EO6A 4PQUA 2VOPA 1IXKA 2CAJA 1IKWA 3OFGA 3I6PA 3PJ9A 4XDDA 4IO1A 3HX9A 2DNLA 5A2QY 1B0VA 1B7FA 2YH1A 2C2RA 3CJSA 4JP8A 1PBUA 5LT5A 2QE5A 1G3OA 2ALYB 4L73A 5KG3A 1W7WA 8ATCB 1HBMA 1N54B 3BSOA 1ZTTA 1B3TA 4A8MP 3TWZA 5G0RA 1VDHA 3DLGA 3F44A 1JLEB 1NKCA 1LXJA 3EGVA 4TQRA 1WEZA 4KB7A 1X4CA 4LRAA 5K20B 1F3VA 1P9QC 5MLCV 1GH8A 1RT2A 3H0PA 4OLPA 2WRMA 3MR2A 4DR2F 2WOMB 2LQ5A 4JI5F 3AA8A 1PC5A 3BZQA 3UE2A 3IN5A 4TY8B 4WFXA 3IP0A 3LP2A 3SCIE 4DV3F 4LSLB 2AGOA 1VBXA 2ZKUA 1VQYA 1YVFA 3V6JA 4NMLA 3MZIA 2QFJA 4FBUA 1REVB 2JDJA 2GQ2A 2MXYA 5CXTA 1FRIA 1C0TB 2FLLA 1NH7A 4FYWB 1IKYA 4FF2A 5HJXA 4I0WA 1IKXA 1NEEA 4AFFA 2MQNA 2E5LF 4JBCA 4DOZA 3CCJS 4KTQA 2R7QA 2EK6A 1XMOF 3POTB 4WFAQ 4R5PB 2VODA 4FYYB 2AHOB 2F1FA 4EO8A 2FZCB 1RKIA 5ETKA 1UWBA 1IQTA 1U1QA 3U1NA 4LF5J 3CD5A 2QC3A 3BV8A 3UFCX 5DJBA 3PW2A 1X0PA 4OYPA 1VCTA 4ZJLA 4DG1B 5JUMA 2IBKA 4P7TA 3H4BA 1HNZF 1NDCA 2IAJB 4DPWA 3W2VA 2UU9J 4OYWA 1W2IA 3FSIA 4EBEA 1NB7A 4JI3J 2JVRA 4RW4A 4XDCA 4ZVPB 3H25A 3HSZA 3RGIA 5EGYA 5EWEA 3DXBA 4C98A 1FJCA 2ZWPA 3JAMY 4I6WA 4RNHA 3NKYA 2YNGB 4M63A 5KFAA 2CJYB 3D28A 1VRQC 3GLJA 2KN4A 4ID5A 4IOAQ 4ZPDA 3SFGA 1XN9A 4DL4A 4QIGA 2DTJA 4LF4J 2MHEA 2R8IA 3D0GE 4IR1A 1OQ6A 4NLVA 3I4HX 1KBRA 1F0XA 1SJ4P 2E1PA 2L9NA 2FGOA 1C0TA 3MPYA 1XNRF 4WPAA 4EUVA 3CDWA 3D67A 4ZPAA 2F3JA 5IWAF 3HKZD 2GIQA 5AJ3F 4C3KA 1F9HA 2QTWA 2L41A 2UVRA 3EM1A 3TI0A 4R5PA 1Y10A 2J0XA 3KLVA 2KFNA 2FQQB 2MZ1A 1H3DA 3MPVA 3CB4A 3DOKA 4DPXA 4E2FB 2KG0A 4JI0J 3T5HA 2OPQA 2OD4A 3GYNA 4WXOA 7AT1B 4C9DA 4PQUB 2RAQA 1LK5A 2H3EB 2G13A 2H4WB 3V4IA 2LDYA 3T1YJ 2OFGX 3OTCA 1R6VA 1DTTA 4G1QA 5KFKA 1QJHA 4Y2AA 4A8OA 3CD6S 4LRBA 1C4AA 1VJWA 3KLIB 5F3TA 4BBYA 9ATCB 1HPZB 3QO9B 4MT1A 5C42A 2MPUA 5IZHA 5KT3A 4DSLA 3AQOA 3MFHA 1HIYA 3KK2A 1HYSB 3EVOA 5SZTA 2DH8A 1T9UA 3DLKA 2M88A 1YDLA 3WHIA 1FXLA 5J1PA 3MUVP 3K7RA 3D4JA 5KG2A 3CF5Q 2YVSA 5IM0A 3ETMA 1IBKJ 3CEDA 3QLHB 4LBIA 1N5QA 2V50A 1BQMB 2WB4A 1BD6A 5HANA 4M5NA 4B17A 2W7OA 3M8WA 1U48A 5CABA 3IGVA 1VI7A 2AP6A 3C6TA 1UA0A 3E01B 3WIVA 1FVSA 2DNZA 1JJCB 5IC6B 1DJ0A 2ZH8A 1RT5B 2XULA 4DV7F 5KT5A 3M32A 4F3OA 4GVBA 1SIZA 4A46A 3RU0A 1TVRB 3PRDA 1RAJA 3SMZA 3ADAC 4C11A 3JQMA 2X1BA 4DR6F 3OHBA 4CCHA 3PX6A 5KFTA 2B0GA 3DMJA 3HHLA 4QR0A 2VF3A 4FPRA 2L9WA 3PKYA 3L4BC 3MCNA 1S1VA 1WG5A 3SCKE 3R9LA 4WFNQ 4EBCA 4LT6A 5HMXA 2JC1A 1F60B 1S72S 1FDNA 4CO5A 2OELA 5U47A 2WVEA 4LF6J 2BACA 2OTLS 1BGXT 2K8GA 1HQ2A 2HNZA 2LEPA 3A8IA 3GJTB 3K89A 5E3AA 3VAIA 1NJIT 4F67A 2MLZA 1YBAA 2RIJA 1Y5IB 1N36J 3R2DJ 2GC8A 1P9YA 1RT6A 2NUUG 5BYQA 4C7QA 2VHGA 1U47A 4USVA 3KLHB 3S1TA 4IYQA 5LXRA 2DBBA 4LSLA 4N47A 4IG0B 4K4WA 1VQNS 3NS7B 4EYHB 4F4KA 1RBAA 2M4MA 4YEAA 1FDBA 2QJ3A 5F8MA 2MQQA 1OWXA 3KK3A 3QWPA 3E01A 2HMIB 2YNFB 2GAGC 3CJTA 3NGKA 1UL3A 4KT0C 2ZOMA 4M5IA 4O23A 4OZLA 2BJ7A 2CZ4A 5ETTA 4FS2A 2IJFA 2OKQA 3M9NB 2FLPA 1S76D 3N0VA 2E7XA 3DFEA 1HHSA 2KYZA 1RWUA 2XHCA 2ALZA 2GX8A 1UMJA 4Y65A 3FQKA 3MTJA 3U7JA 3HSDA 2HFOA 3P6YC 3ONQA 2B8PA 4AQYF 3W8GA 2FHJA 1RB0A 3M05A 1HPZA 2Z8QA 2RE1A 2MGZB 1TMMA 2BYCA 2MMYA 3OFEA 2AYMA 2XNRA 3DDNA 1BLUA 3A3OB 3AFGA 3QFHA 5DDRC 2JFDA 3B78A 1YJTA 3EZ5A 1FRLA 3WX8A 5L1JA 1T03A 1UETA 2L3MA 2HRTA 3D0HE 3MR7A 1V5IB 4Y28C 3K8WA 2GW8A 1QY7A 4LBHA 1EQ0A 3W1YC 2HNYA 4XK8C 1F5BA 5D4OA 4AE5A 2ZH4A 1VQSA 2A10A 1CJVA 4CYUA 1RAOA 3KLHA 2B5JA 1X9MA 4DR7F 2Z4PA 1RP5A 2VQEJ 1TUVA 2IMOA 2K3IA 4PXEA 2HVEA 3HSGA 3FBBA 1HL6A 4DPTA 2DEJA 3MAQA 2HHSA 4KH0B 3UN2A 1LNQA 1TL7B 2YX4A 5AXLA 4WP8A 5DM7Q 2MLYA 1LFWA 2H5IB 3KKFA 2ZNZA 3QGHA 2CXEA 4HEA9 4HT7A 4Z7CA 4IRKA 3VF0B 2GIFA 1SL2A 2HZVA 3HVWA 1S1XA 3KHLA 2V2ZA 1P1LA 1RTIB 1RUSA 2CPJA 2RRBA 1QAIA 3CD0A 2DH9A 2DHXA 2HBQB 4I6AA 4TLQA 4WWSA 4XTTA 5KFBA 4MH8A 3FMBA 3HVRA 5HLFA 1RACB 4DSIA 4K4VA 4DR5J 1UCNA 1VMBA 3ILOA 2W01A 2V2VA 2DCLA 3CTRA 2CQ2A 1KNZA 4TYBA 3BH6B 3M7VA 3S8SA 2XLIA 1C1CA 2RRAA 4NA1A 1RHQB 1ZPVA 1F3FA 3BSAA 1KLMA 2J5AA 2K2PA 3IXQA 3PCOB 3DM2B 3VQSA 2V4QA 2AKWB 3DKDA 1BXNA 3CGIA 3K5PA 4ID8A 2LXIA 4CO3A 1RAGB 3BSCA 4EK2A 3DI6B 1H0HB 2MZQA 1KHVA 2AJ4A 4BCAA 1EETA 5IXUA 4LRDA 2C28A 2N3LA 3OR1A 3Q89A 4KE5A 3VGVA 3RAQA 2ZKTA 2CIMA 4DQIA 4AQYJ 4LQ9A 3TUIC 4TNOA 4B3SF 2R7XA 1RK8A 1YLXA 2HQ3A 2OO4A 3ZTOA 1CC7A 2MKIA 3JSRA 1XJWB 4Q44A 2MQPA 4GRSA 2E5HA 5T7LA 4YHHJ 4ATNA 4A8QA 1HBUB 1UVJA 3VAFA 3T9ZA 4CLUA 1MROB 1MSWD 1FTRA 3ILIA 3HK2A 1SQFA 2HWTA 2XS5A 3R7NB 4CYUB 3UR0A 2CQDA 2C3PA 4QR2A 1GEHA 3S6EA 2RDDA 2W2OP 2IIHA 4L72B 4DL6A 3M6WA 3RRHA 2DRDA 4K5RA 5BJRA 1WC5A 4ZPVR 3GIIA 1NK7A 1NSAA 5D78A 2QA2A 3PYGA 2BMBA 3GIJA 3T1YF 3OBIA 1JXEA 3KJNB 3W2WB 4PPZA 2QZ8A 3THVA 4X2BA 4D3GA 2FHJD 2YX7A 2XM3A 3CIZA 1RE1B 2DKOB 1D9DA 1U8WA 4MKYA 1GXUA 5AE3A 1NK9A 3I55S 3QT5A 4Y3CA 4HDGA 4OZ2A 4URQU 4WP9A 2W8LA 2CPIA 2XNQA 3CE8A 3H42A 2XEXA 3UDCA 2NZ4A 3IMQJ 1HMVB 3PKMA 2ERRA 1S79A 1UJ6A 2YX1A 2OEMA 4AXJA 1U6BA 3K2YA 4B02A 1A9NB 2YNFA 1FKPA 4I6YA 4DV2F 5D0EA 2VFRA 2YWFA 3OR2B 5AXMA 1T9YA 3AD8C 1FHTA 1V3SA 1NRKA 4ZVSB 3DM2A 1TU0B 1HNVA 2H4YB 4NA2A 2KO1A 4CLYA 4CLLA 4ZIVA 5M2UA 5F8LA 3PO5A 3HT3A 1JJ2R 3C3LA 1S0MA 1S0NA 5LL6d 2E5LJ 2HVIA 4G1QB 4PWUA 2GAHC 3OTDA 2CNLB 5KFMA 5DQGA 3MURP 1ZYQA 2W4PA 1SQEA 1VYAA 2AMCB 2X1GA 3BDEA 4NI2A 4CLTA 4DR3J 3RB0A 5ETLA 3PYEA 3CCTA 1H2UX 4R0EA 3GE9A 2W2MP 2YQ1A 1KFDA 4FXWA 3TR5A 5DS7A 1TFYA 4HI2A 1Q95G 4AXIA 3G4SS 5LMNJ 2KHCA 4NE9C 1NLKL 1RT3A 1HBUA 4ID5B 4X4OA 2GVZA 1KFSA 1N52B 4RX6A 4FNIA 2YBVA 3A8JA 3M9OB 4X4NA 1SC1B 2CPEA 2IMWP 2R3VA 4OJ1A 2BM1A 2PE8A 5IS2A 1T8EA 1M0SA 4NLUA 2NXEA 4UW2A 1S1UB 3A3NB 3OD2A 3M30A 3GIKA 1URRA 4CT9A 4HHHA 2ZHBA 1G6BA 4QOTA 4WXWA 4IR9A 1VRTB 2DGUA 3VVTA 4OYXA 4CT8A 4C97A 1S1TA 2WBRA 5E3CA 4J9KA 2BOAA 2IRUA 4CH0S 5J2MB 5DG8A 3GCWP 2N7YA 1N4LA 4QYZK 4ZPTR 2BQUA 3I4PA 4F50A 4CLSA 5GAEI 3ZC4A 1AA1B 3MMCB 4CLPA 4WTOB 5K8OA 1XK8A 5LMUJ 2DGQA 1SUQB 4F26A 1U1PA 4GO7X 1T7PA 2KJWA 3R2CJ 4DF4A 5THWA 3LQVA 2AJFE 5KFSA 4NXNF 3V6DB 3MEKA 2OGUA 4CRJA 4O4GA 2HNZB 2O3DA 2BDPA 1S7IA 5IM0B 3MCMA 4DX8H 1X4FA 2BKOA 4D3HA 3FSYA 5C42B 3IRXA 4M1KA 1Y9OA 4CH7A 3KDOA 4X66F 4Q5VA 2E9RX 2E1RA 2DH7A 1NZ8A 1YKWA 4LREA 1KQSR 1LEOA 2EG2A 4ELTA 4IG0A 2OH2A 3MD1A 2ROGA 4NCBA 5JXSA 1P6TA 3HZEA 2D9OA 2W2NP 4OIXA 1UJ5A 4EBDA 3JB9k 2F4VF 2Y1JA 1XNRJ 1ZA2B 1SKSA 2D41A 1VHIA 1TK5A 4CLFA 4L3KA 4USKA 2PMZD 2DGWA 3RUBL 3EX7B 4F4YA 2FB0A 4RBUA 3UD4P 2GQQA 2BW2A 4ED5A 1SC6A 1FERA 2MQ8A 3W7BA 1I94J 4FF3A 4NXMJ 4I2QA 3ZZOA 3MPWA 3M8SA 1HNIB 3ETOA 3FZ2A 3RRKA 2VPYB 4G1PA 2DIUA 3CCMS 3ICLA 3WBZA 4UY85 5M2PA 4UQGA 2X3DA 3NS6A 2KTQA 2VQFJ 1VK3A 2QA4S 1RTZA 3LPEA 3UN3A 1HNXJ 4PWDA 2HHUA 2KJVA 2IDLA 2DR8A 3SFUA 1NKBA 2FVRA 3KYLA 1K0VA 1OPIA 3W9HA 2ZH6A 3KMSA 3DOLB 4Q0BA 2DR7A 2VG7A 3IO1A 3W5YA 4A48A 1QVFR 4JV5J 5FDLB 3KLIA 1B64A 1MMDA 4J9RA 3FVYA 3CDAA 1TTHB 2QA4G 1L3UA 3OTBA 3PFEA 1R0AA 1OYDA 3PJXA 4ALZA 3IAS9 4CP5A 1H6KX 1NH8A 3FMWA 4N56A 1GX5A 2BZ2A 3AY0A 3MM9B 4NASA 5KG6A 1RHUB 3DNCA 4ZHRA 2AWZA 2A1BA 1QUPA 1VGYA 1FDDA 2E5IA 1FNMA 2OSQA 2FIUA 3BH7B 4OI2A 5LJ3Y 4LF7J 1CG2A 3M6VA 4CM0A 2BJ1A 3IBCB 3IBFB 2IVMA 4LIRA 3UVJA 1NK5A 1RAEB 1ITPA 2U1AA 3GYXB 2AYGA 1U7LA 5IT0A 3G8QA 2GGPB 3B82A 3C6TB 3KJFB 2LVWA 5KFYA 5HJYA 3QJJA 1Q53A 3B4DA 4YB6A 1WC3A 4LSNA 3X3UA 4PG6A 3GPAA 1CULA 1IBMF 1PSDA 2D3ZA 3CJQA 3DHXA 1H7WA 4FKXA 1SC4B 4B9UA 3EVMA 1Y7PA 4ED1A 2YKOA 1P27B 4PYDA 2XYGB 4PPDA 2EEYA 4MTPA 2H5JB 4YDXA 4Q2LA 2Y9HA 4Y0FA 2KH9A 1TKZB 3KHHA 4URSA 2QYGA 3SV4A 1AT1B 1U09A 3AJDA 3DGPA 3G2XA 3JS9A 2VJVA 1K73T 3ET6B 3I5BA 4J9LA 3CCQS 2VA3A 5ETQA 5CCMA 2MKSA 3I5AA 1JK9B 2GQCA 3R5DA 1FT8A 2LQ8A 3OL6A 4A8FA 4ES1A 3DRYA 3HD1A 4JI4F 1WTFA 3IFEA 3T19A 4DR1F 1SKWA 1M5KC 3DGVA 4YR0A 4U67Q 3QWUA 3K5NA 4N7TA 2O1PA 2OPPB 4RU9A 3MAHA 1SBRA 2CNNB 1S6QA 2VFVA 3QAEA 1KWMA 1X4HA 4OYMA 3BGOP 4C4WA 1RI7A 1WSVA 3IS9B 5F0WA 4JV5F 5F9LA 4F4ZA 2J8AA 2RNEA 4ES3A 3B54A 4KO0A 4IFVA 3H2LA 3POTA 1OQ3A 2IM2A 4JI6F 1U1RA 1HNZJ 1AYEA 1LWFB 3CJ3A 2JWNA 3EUNA 3BQ0A 2FJDB 4JI2F 2DGXA 5LMNF 1NK0A 4QU7A 4JI3F 1NUEA 2J7UA 1PC4A 2KRBA 1YIJS 1R43A 3TO8A 1K47A 2K7JA 3HHLD 1SI9A 5KFJA 4J9PA 4PXCA 1F9FA 3FBFA 3R8YA 4RUBA 4LFCF 4DFKA 4HVZA 1D9AA 3GR1A 2AZ1A 5C24B 4X62J 1KTQA 3BJYA 2ZJRQ 2JLGA 1N6QB 1F5CA 1ULRA 4RW9A 3C66A 3EYZA 1VQMS 1NHKL 3V4MA 2CJBA 2IJNA 3V6HA 2Z56B 2FVPA 2PFDA 2GJ2A 3EE3A 2RQCA 5GAGI 4ICLA 2HYIB 4ZJOA 1O5JA 2ZBCA 2G0CA 4DR6J 2B4UA 1X5OA 2JLEA 2XWXA 4I68A 1RTIA 2EPIA 3ZNUA 1S5ZA 3MUTP 1G1XA 4ENOA 1FFWB 1HQUA 1CBKA 2GGPA 2M9KA 3GSDA 3FK4A 3N28A 1YRUA 2I38A 3TX8A 1XMBA 5DDPC 2QLXA 3JQKA 3GU0A 1L3TA 4JV0A 2F9JA 3GCXP 1X60A 1NJXA 4DV0F 3TP2A 2M70A 2ZUGA 4OFZA 4DQRA 1S4EA 2BJEA 2HQCA 3FEXB 4UQTA 3VWSA 3ISNC 3VCDA 3QJLA 3MM9A 3KFWX 1RCOB 2IVFB 1A7GE 3P3DA 1S97A 4GKKJ 5A2QU 4K4XA 1NO8A 4PR6A 4ECTA 4TQSA 3DI6A 2GO9A 4CO1A 3KLGA 1VBYA 4TU7A 3NG8A 4Q45A 4I7FA 3P5TL 1RBOB 2KYXA 4X84A 4CQ1A 4A47A 4PG8A 3C15A 1ZOTA 2BVZA 2EKYA 4F04B 3OQ2A 5C2GA 1TK0A 2RH3A 2C2EA 1AB8A 5C25A 3TQEA 1CS4B 2W2QP 2ASJA 5J2NB 1WDDA 4UOFA 1U26A 3TW0A 1JXVA 5D4NA 3KK1A 4DV4F 4ED6A 1NB2A 2V8GA 3DHWC 5DG7A 1XIQA 3SI8A 3DOLA 1TZ0A 3D54A 1N56A 2IHR1 4H4OA 2YNGA 3MEEB 1RU1A 4MFBA 4OX8A 5T41A 4CO4A 1SB6A 3LW5C 4ZVOB 5F8GA 2ZM6F 4ZITA 2B9WA 2XI3A
chains in the Genus database with same CATH topology
4WK3A 3X1LB 3N79A 2Y1RI 2P5VA 3PW4A 3JSBA 4YUDA 3GIMA 2R7OA 2XO7A 3ZZUA 4B9TA 2B9XA 1KTVA 4X4NA 4KGKA 2IAJA 1G2EA 3MDFA 4ECYA 2XC9A 1MMNA 3NS5A 3OLBA 4RUCA 3MMAA 3IWNC 3NAIA 1Q8LA 4WYLA 4GKJF 1HBNA 4FN5A 1NKEA 2VBXA 1MWZA 4ED0A 1WELA 4CZCA 2F8HA 2JEGA 3LANA 1T05A 3QGGA 4WE1A 3PM9A 2CPFA 2LXUA 2QSFA 4PG7A 2GMJA 4JI8F 3GV8B 2ZH8A 4ZLPA 4CNYA 4ECZA 2JOQA 1E6YA 2RT3A 4NYOA 4TXSA 1H98A 1SKRA 1K8AT 1FKPB 1WG4A 5KG5A 1K0TA 2GJIA 1OS5A 3BN7A 3LO3A 2BA9A 4F2SA 2V2KA 1RTDB 1OIAA 2WSCC 4PXDA 4R25A 4TU8A 5DETA 2HZCA 3BR8A 5L1IA 2DHAA 5FD1A 2AJ0A 4OQJA 5K8NA 5AXKA 1HQEB 5EHHA 3BDPA 1S9GB 2BM0A 2J7WA 4X4VA 4URGA 3DYAB 2FC8A 2RDIA 5H9EJ 4HH1A 4NZ0A 4RW8A 3MR6A 2M3DA 1N5YB 3MTKA 2UUAF 5D77A 3V81B 1H2TZ 2DNGA 2Z2LA 3HLUA 5CZVA 2R2UA 4KO0B 2HRUA 3HHEA 1X5SA 4YY3F 1VLYA 2ZJPQ 3WDOA 5FLXY 4F3MA 2PSZA 2YWEA 3OXGA 4MK7A 2VFSA 3T5LA 2MZTA 3M30B 2UP1A 1LXNA 2DJWA 4JV1A 1LWFA 3MM5A 2R2SA 2OSRA 2HQIA 3CCRS 4J9OA 1VQKS 2UXCF 1D3WA 1U6ZA 2WW8A 3MEDA 1CLFA 1VS3A 2YKNA 3EXCX 2IYIA 1RT1B 1WG1A 2VKRA 3AB2B 6FD1A 3GZ7A 1FO1A 1M90T 2LU1A 3L7PA 1LW2A 4DMZA 1UEUA 5J2QB 3LP0A 1UFLA 3DLLQ 1JLEA 3U27A 4ETXA 1O0PA 5J1EA 1HWJA 2FDNA 2P9GA 2QMXA 3MOZA 5KFPA 3HO1A 1T05B 3CIMA 3M2RB 2HNDA 1DRZA 5GADU 2HFZA 1R8HA 1ZM4A 2GHVC 1A6LA 4C0HA 1ZM9A 4NA3A 1ZTWA 1D1UA 4R0JA 2CQ0A 2BXJA 4W90B 2Q6BA 1KVIA 4DPOA 4OI1A 3FZBA 2VFTA 2LDIA 3GB0A 5HP1B 4BC7A 1FEEA 1HWKA 3FCHA 2J6UA 2J6TA 1TKXB 3C46A 5D3GA 1XNQF 1FRKA 2U2FA 4Y6IA 4CNZA 3Q24A 1Y3JA 1UP1A 2HVZA 1XEZA 3KJVB 3H5SA 4KHPF 1ZM3A 3HI9A 4WF9Q 3C6UB 3KK1B 4O3QA 2G9OA 3OJUA 1QAYA 2DB1A 3DYAA 4NLDA 3TA0A 1I94F 2J9DE 4ECVA 1KD1T 4V19X 1CQMA 1U6FA 2HHPA 5B0DA 2DD8S 3HFKA 2BOPA 3BGRB 1CQNA 3QMQA 4LFAF 2P6SA 2B5JB 1HI1A 4OJ3A 2XS2A 3SQGB 1LW0A 1Y5LB 5AE1A 2J9EA 4LMZA 5GAHI 2R2RA 3OW2R 4ELUA 1YRXA 2DNPA 2QIFA 2BANB 2IA0A 4WFYA 3RW7A 2OPRA 3O6QA 3UDLA 3SV3A 4YP3A 4NLGA 1WF0A 4X62F 1EP4B 2V94A 2JFKA 4GMKA 4QW8A 3PR4A 4J9SA 4XAKA 3KG0A 2XCAA 2IVYA 3B4MA 4YB1P 5IQ6A 5IQQA 5LJ5Y 1ZBTA 2B43A 3PW5A 2DNRA 2FLNA 2BUNA 2DGVA 3U1MA 4KBIA 2VBZA 4YQWA 2RQMA 3ZZPA 5F8JA 3MXHP 1QUVA 3CMES 5B08A 5AXNA 3DRSB 1SH0A 2EW9A 4H4MB 2DRAA 3LUYA 1N33F 1Q81T 2FC9A 5FDLA 2C22A 4LF7F 4XPCA 2HG4A 4LQ3A 4GKKF 3K57A 3OL7A 1VK8A 4DSJA 4WZQA 5H1SV 3RR7A 3OR1B 1WF1A 2APOA 4MYUA 2PD1A 1ZPWX 4X4UA 3W2WA 1X0FA 2LECA 2MY7A 1J5OA 2CQCA 3U02A 2KM8B 4ZCIA 4RW8B 3EZUA 4ECXA 1U49A 3OTOF 1VBZA 2NSCA 2ZJQQ 5D4PA 4QIFA 5F8HA 2D3UA 2YNIA 3ZZRA 3Q8PB 2R8KA 4ZOSA 3DU6A 2EFPA 3R3TA 3MM7A 2V8DA 2DNHA 2W9CB 3T9NA 3MM5B 2AQ4A 4QWCA 3HJFA 4NPOA 4U9RA 1IN0A 1IR0A 1TL4A 1HHTP 3TVZA 2B7BB 4K50A 1JB0C 4KJIA 2EC0A 2D1CA 5HL7Q 5I3QA 1QM9A 4Y2IA 3N6LA 5ADZA 5KFEA 2W9BA 1FEHA 1K1QA 2BRKA 3R5CA 2ZVSA 4FXVA 5A6PA 2E1CA 1S9FA 3NNHA 4DWIA 2WTFA 5T7LB 2YKMA 3MUMP 2KFYA 3DMJB 2AJQA 1DTTB 2FJWA 4EWTA 1VOMA 1TL1B 2VFUA 5A8WB 1T3NA 4MAKA 4Y34A 4GC6A 1QE1B 1JLBB 1LFPA 2GA7A 1C1BA 1L3SA 3DXSX 2LQ9A 5F8IA 3HP6A 5K8MA 3UCUP 2UVUA 2JEIA 4N8OA 4KGMA 4PUOA 1GNKA 2VV5A 1X5TA 4EYIB 5L9NA 1V3ZA 3CXCR 1BQMA 2RSQA 4ITSA 3BGRA 4K4TA 4RWXA 4QR1A 3R5BA 2WONA 4ZP8A 3NNAA 1FF2A 5KFXA 2BQRA 4DBQA 5DGBA 4IFVB 3N9UC 2B4VA 1SV5B 1HMVA 2FJBB 3D1HA 5HP1A 2VH7A 3EGNA 1TKTB 2UUTA 5J1NA 4B9NA 3DLEA 5KG1A 5KG7A 1RYRA 4NLPA 4KQZA 3NL0A 3L7OA 1FDAA 4G1IA 1S48A 4HHJA 3BEGB 1YSJA 3JTNA 1HBOB 5I4MA 1VIXA 4IKAA 4QCLA 3BREA 5LMUF 1RT7A 3AJ2A 5L1LA 3OVSA 4FF1A 4FP9A 1FXRA 1RT3B 1YITS 1TK8A 4TY9A 3PW0A 2F7VA 1U45A 2R7UA 1X9SA 2XG8A 3T3FA 4YMEA 3PX0A 4QQBA 3K58A 1TP7A 2DT9A 3PDNA 5EX3A 2KXFA 4IG3B 1P1TA 2Y1IA 1DTQA 1DBDA 1UVLA 5EUHA 1TFWA 2DVIA 1SIWB 5I42A 2IRXA 4P7VA 1FNXH 1U25A 1SL1A 2Q1LA 2HLTA 2NPFA 4O3SA 4GO5X 1Q8IA 2KI2A 1LK7A 4EEYA 5I3UB 1PGZA 2RS8A 2ZD1B 3ZZYA 3PO4A 2JLFA 4JI7F 5G0RB 5KT7A 2D9PA 3DOMA 5KFIA 4KRWA 1YJ9S 1YG0A 2NPIA 3LGMA 1H2VZ 1HWIA 2OIHA 3WZ0A 2QEXS 2CQ1A 4MKBA 3OVAA 2ZH1A 3MR5A 3PIPQ 2CPHA 5ITHA 2DPIA 1GX6A 1JLBA 1JLCB 3M1VA 3WC0A 3NP5A 4N8NA 4NLWA 2ADCA 4OMFG 1JJ4A 2H9ZA 3LP2B 2DR5A 2ACYA 3CDBA 2FVCA 4ERDA 5D4LA 4C2MA 1DHMA 2DITA 3TUZC 2PT0A 2XI2A 2CJKA 2FJEB 3HHDA 3FEYB 4C8NA 4DN9A 3G9CA 2LU2A 4I2PA 5KFGA 2V4RA 5E7OB 2JSXA 5M2RA 5DLFA 4TY8A 4ILLA 3HPOA 2ZBIA 4QYRA 2QO3A 3IAM9 4J9MA 4E98A 4DFJA 2PO4A 5DO2A 4J9NA 3TANA 2N3OA 1HI8A 4FYDA 3DOKB 3SCLE 3VR1A 2DNNA 2E5GA 2V4JA 4E0DA 1DZ5A 2K7KA 2M5YA 3MMBA 3TVKA 4ZCLA 3G8SA 4K59A 1S1WB 4MJKA 4NWBA 4Q0BB 1U8SA 2A3JA 4F25A 1SV5A 2IM3A 3R1LA 1HD1A 5DGAA 2F40A 4RW4B 5E3RA 3T6BA 3KNGA 2MKKA 1SL0A 2OJ3A 2DIVA 1EETB 4R8UA 1N5SA 2NLWA 4MIBA 4K4SA 4H4KA 3BGUA 1LKZA 3MWBA 2O67A 1UWBB 2RQKA 1I6JA 1UW4A 3KLEB 3RB6A 3DLKB 4AYBD 5B7WA 1IBKF 2VOOA 4RW7A 1Z4UA 2KXHA 1X7VA 2QV6A 4X4TA 3E2EA 4O4RA