1CVJA

X-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
169
structure length
169
Chain Sequence
ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*AP*AP*AP*AP*AP*AP*AP*AP*A)-3'
publication title Recognition of polyadenylate RNA by the poly(A)-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
total genus 36
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1999-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cvjA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cvjA01
1DBDA 4OZ0A 3SDEA 3UE2A 4QU6A 2MZRA 2FHOB 1A9NB 2HGMA 3TYTA 2DNMA 3MD3A 4TU8A 1QVGR 2KM8B 2MJNA 1WELA 2DH9A 3TP2A 1HL6A 3LPYA 2CPFA 2OTJS 3CULA 2I38A 2EK1A 2L41A 2G4BA 2CQ3A 2JWNA 2VOPA 2LECA 1WEYA 4LJMA 4QPTA 2QFJA 1U1MA 1CVJA 1HD1A 2YWKA 1N88A 2JVOA 5LJ5Y 1X4CA 4YUDA 3G8TA 4U67Q 1M5VC 3BO4A 3BO3A 1VQ6S 1AUDA 2JVRA 2KG1A 2KXNB 2L9WA 1YJNS 2CQBA 2MZJA 3US5A 2E5GA 3VAMA 1Q81T 1SJRA 2XS7A 3B4DA 3S6EA 1HA1A 5IM0B 5CXTA 3CCVS 3NNCA 2MGZB 3MUTP 2DNLA 2L08A 2CQ1A 2DB1A 1RK8A 5GADU 2WBRA 3MURP 2YH1A 5BJRA 4ED5A 2HVZA 2K8GA 1F9FA 4M5DB 3IWNC 3RW7A 3CCMS 2RNEA 4PKDB 5GAGU 4Y0FA 2DO0A 1X4EA 2MHNA 2MQNA 2RUGA 3CXCR 1OWXA 4A8XA 3R27A 3VAIA 2OTLS 1X4AA 3U1MA 4J5OA 2MQMA 2KU7A 1SJ3P 1FJ7A 2G0CA 1X4GA 1FT8A 2E44A 2O3DA 2DISA 2MZTA 3VAHA 1VQ4S 4OZ1A 2MYFA 4LIRA 3SXLA 1VQOS 5CA5A 2E5HA 1K8AT 5LJ3Y 1DRZA 1WHWA 1UAWA 2X1FA 1SXLA 2UP1A 2XSFA 4PR6A 2U1AA 3UD3P 1OPIA 2JRSA 1UW4A 3CCQS 1D8ZA 4WFBQ 2YKAA 2CQGA 2G1DA 2LXIA 1N54B 1FO1A 1WI6A 2M8DB 3IRWP 3PIOQ 2ZJQQ 3U1LA 2DHGA 5H1SV 3EGZA 5LSLA 1WI8A 2ADCA 3CTRA 3MUVP 4P6QA 1U2FA 2CQ2A 1M1KT 2RVJA 3VAJA 2LCWA 1WG1A 1VQ5S 3DLLQ 2M7SA 3CCES 1S79A 1PGZA 5HO4A 2DO4A 2CPYA 1VC6A 1FNXH 2MB0B 2CPXA 1NJIT 1URNA 1U1PA 5D77A 2AYEA 2ZJRQ 2DNOA 2DGVA 3G96A 3UD4P 2M8HA 2DNHA 3Q2SC 2MKSA 3CCJS 3NNAA 2KHCA 2XS5A 1S72S 3TO8A 3FEXB 5IQQA 3SMZA 1QM9A 1M5PC 2BOPA 2U2FA 2MKKA 1QVFR 1OIAA 1Q7YT 3VAFA 2HGLA 2KYXA 2KXHA 2DIVA 3MI7X 1VQPS 3HI9A 2AD9A 1U1KA 1N8RT 1JJ4A 3UCZP 1U1NA 2RRBA 1R8HA 2YTCA 1VQMS 5ITHA 2M0GB 3EGNA 2J0SD 2LMIA 5GAEU 1X4BA 1U1RA 2XNRA 1FJEB 2MKJA 2OJ3A 1P27B 2NLWA 1HD0A 2D3OR 1RKJA 1VBXA 2HYIB 2RQCA 3H2UB 3UCUP 1WEZA 3NNHA 2NZ4A 1NO8A 1WF0A 4WCEQ 2CPJA 1VBYA 3S8SA 2Q79A 3VAKA 5DM7Q 2DNRA 2OSQA 5DDRC 2LEBA 1DZ5A 2ADBA 3D2WA 2DIUA 1DHMA 1FXLA 1X0FA 1VQKS 2CPEA 3CC7S 1WEXA 1XN9A 2MXYA 2EVZA 2JX2A 2AYMA 4IOCQ 3S7RA 1Q86T 1VBZA 2MZ1A 3LQVA 5CYJA 1SJFA 4WF9Q 2VODA 5GMKa 4WKRA 3MUMP 1FJCA 2CQIA 3BEGB 4V19X 4ERDA 2M52A 2MKCA 5LXRA 1UP1A 3CMAS 3MXHP 2F9DA 1D9AA 2M9KA 2V94A 1W2BR 1KQSR 2RT3A 2FPHX 4WIIA 4C4WA 4FXVA 2KRBA 2X1GA 2MPUA 2DGWA 1U1OA 1VC5A 5DDOC 2DGQA 2CJKA 3CCUS 1VQ9S 4IUFA 2DK2A 2A3JA 3P3DA 2MQOA 1YI2S 4IO9Q 3HHNB 1JJ2R 2EK6A 2DNPA 5D78A 4TLQA 3ZZZA 2CPIA 1JMTA 2X1AA 2M88A 2MQLA 1VC0A 5IM0A 2CQCA 2MGZA 4CQ1A 3G9CA 4UQTA 1KD1T 2DNNA 2DGSA 2DNKA 2J8AA 1N52B 4TU9A 3B4MA 2J76E 4F02A 1L3KA 3SDEB 1WWHA 1ZZNA 2KM8C 1X5SA 2DGUA 2ERRA 5DDPC 1JJHA 4W92B 4CH1A 4Y00A 2N82B 2LYVA 1OO0B 2KXFA 3NS5A 4FXWA 1YJ9S 1ZH5A 2RS2A 2DNGA 3OW2R 3MOJB 3G8SA 3CC2S 5EN1A 3RW6A 1WHYA 3CUNA 2CPZA 1X4HA 5HL7Q 1IQTA 3THPA 3MDFA 4QQBA 2XS2A 3R1HA 4F25A 1VQ7S 2DHSA 3H2VE 1G2EA 4YOEA 3ULHA 1B7FA 2K3KA 2BZ2A 1WG4A 2OIHA 1PO6A 2ZJPQ 2J0QD 2MQQA 4PRFA 3MD1A 3L3CA 2CQHA 3VALA 2VONA 1U6FA 2XNQA 3R1LA 3VAGA 2D9PA 4QU7A 1WHVA 1KC8T 2KT5A 2KFYA 3S01A 4UY8T 1U1LA 2FC8A 2DGTA 1UFWA 2AYGA 2N3OA 3G6ES 2CQPA 1BY9A 1M90T 4IOAQ 1YJWS 2RRAA 1FHTA 1SJQA 1O0PA 2RQ4A 2CPDA 3EX7B 1VQLS 3VF0B 3NMRA 1A7GE 3K0JA 3I55S 3CCRS 2RU3A 2MJUA 4WFNQ 3I56S 1K9MT 1X5OA 1WF2A 3BS9A 2OSRA 4C7QA 2LEAA 4LMZA 2MY7A 4EGLA 2MSSA 4TU7A 3CMES 5FJ4A 5GAHU 3FEYB 3P6YC 2VOOA 2KRRA 1U6BA 4CH0S 1KOHA 1WHXA 1X5TA 2M4MA 2DNYA 2F9JA 4WFAQ 3N9UC 2F3JA 1H2VZ 3G4SS 5JVHQ 5MLCV 1H6KX 2DNQA 4Z2XA 2PEHA 1X4FA 3ZZYA 3CF5Q 1P1TA 2N3LA 5GVQA 4YB1P 3G71S 2SXLA 4RU2A 2XB2D 2HZCA 5DDQC 3J7ZT 1NU4A 3NS6A 3CCLS 2DITA 1VQ8S 3Q2TC 5JVGQ 2KH9A 2HGNA 1K73T 5IFMA 2B0GA 2E5IA 2MZSA 2PE8A 3V4MA 2MKIA 1WG5A 2GHPA 1WF1A 3J7YU 2M2BA 2KVIA 2LQ5A 2RS8A 3CC4S 3BO2A 1YIJS 5LXYA 2QEXS 3JB9k 2FY1A 2AYBA 2MKHA 1Q82T 2LA4A 2CQ4A 4F26A 3P5TL 2YH0A 2MSTA 5DETA 4BS2A 2CQ0A 2LXUA 1KOOA 1SJ4P 2GO9A 2I2YA 1YTYA 1M5OC 2FC9A 2KN4A 1U1QA 2KI2A 2DHAA 2D9OA 1R8PA 1H2TZ 1YHQS 1M5KC 1X5PA 4ZKAA 4C0OC 1X4DA 2MZQA 2KG0A 2MY8A 3CPWR 2LA6A 5DM6Q 3CD6S 2LKZA 4W90B 3UWTA 5LSOA 1YWXA 2DGXA 2DH7A 4CIOA 3CCSS 3DXBA 1WTBA 2M70A 1VQNS 2MMYA 2X1BA 2N7CA 1H2UX 2MQPA 1ZZFA 2DH8A 3UCGA 2CPHA 2QA4S 2E5JA 3THTA 3P49B 2CQDA 2DNZA 2DHXA 1YITS 3PIPQ 2DGOA
chains in the Genus database with same CATH superfamily
3I96A 3MF5A 2HHWA 2W8LA 2QYCA 3HO1A 5E0OA 3BDPA 4AL5A 3UR0A 4HT7A 2VF3A 1GFWB 5F3ZA 5DG7A 2DXDA 4LJMA 5HP1A 5AJ3J 4FNHA 3J80U 4WP3A 3PV8A 4YUDA 1Q0NA 3ENAA 5D4NA 1VI7A 4G3IA 3SYZA 1Q81T 4RUBA 2J7UA 2H5EA 3AOBA 3H8YA 2QRRA 4PKDB 1OWXA 3T9NA 2HNYB 2IRYA 4KFBB 5DZ6A 1JLAB 3QLHB 4G65A 3TUPA 2O3DA 4WU3A 2Y1RI 3SXLA 4CT8A 1VQOS 4ZVHA 1W25A 1K8AT 1DRZA 5HMZA 2HBZB 4LF6J 2XY5A 1OPIA 2H9ZA 1N5YB 2LXIA 1WJ9A 1KTQA 4DR5J 1KR4A 2AEFA 1I3OB 3DLLQ 1KHVA 1VS3A 4HH0A 5HMXA 3I6PA 2AYEA 4BC9A 5ETMA 1FE4A 1S72S 4FP9A 5KFAA 4J9LA 1UVIA 4KV8B 5KG5A 2ZBPA 3KUGA 4MK7A 4DCJB 4HHHA 1LWCA 1FRHA 2F8MA 1X4BA 1U1RA 4RLEA 3RG6A 2YNFB 4MFBA 4PZVA 2Y1JA 3H2UB 3LANA 1WEZA 1WKLA 2DYAA 2NZ4A 3RU0A 4PG6A 2Q79A 3SV4A 1DZ5A 4M63A 3MR2A 1DHMA 4F4ZA 3N6NA 1JK9B 4QR2A 1VQYA 3B54A 4KY3A 2EKYA 3OFHA 2W2PP 3GYNA 1T3OA 4IOCQ 1SJFA 4DFJA 4LF5J 1ZOTA 2CNOB 3JQJA 2H65B 4DV5F 3E8OA 2DCLA 1SPBP 4LFAF 1HMVB 5A8WA 4LFBF 4ZCIA 3MR3A 5KG0A 2AWZA 2X3GA 3DDNA 3OVAA 4PXBA 1IBKJ 1LW2B 2PT0A 2UUCF 2LEPA 2ZH9A 3MM8A 4TLQA 3A8EA 3PJ9A 4IFYB 3UDVA 3MMCB 5HBMA 4OI0A 3W2VB 3KK2A 3DRXA 3KLFB 2DNKA 3AXMA 4NCBA 3JSYA 3KJQB 4LBPA 1RE1B 1OY9A 3MEGB 3V6HA 5C24A 3WIVA 1PO6A 2B9EA 2ZJPQ 4DR1F 3MD1A 4W98A 2YNHB 1SC1B 1S7IA 2ZHBA 3W5ZA 1X7VA 3DC2A 2WONB 4DSEA 4C97A 4B3TF 1U8SA 2HNDA 5AE3A 4J9NA 4I67A 3FGVA 4ZP6A 4ECVA 4ECTA 3DRPA 1VRUA 4LREA 5HJXA 3DDIA 2EWHA 3A8JA 1HBUB 3RB6A 4WFNQ 1RTIA 3W2WB 4CLLA 3NGUA 2D3O1 2Q6CA 4P2MA 4ID8A 5DO2A 4ZIWA 1FRIA 3NLCA 2HHTA 1U6BA 2LQ8A 3BYPA 2VUGA 4TY8A 3N9UC 3C16A 4KHPF 5H9FK 1U48A 3CIZA 5E2QA 4R5PB 3HZEA 2BVZA 4IDKA 2QLFB 4OZJA 4FS1A 4ILMA 5AE2A 1MG7A 1DJ0A 4FZVA 2MZSA 2QO3A 2R2UA 5I4MA 5IV4A 3GP9A 2RS8A 3BO2A 4H4MB 4Q0BB 5JJBA 4YMEA 4NXNF 1QUPA 5A0YA 1P9QC 1M5OC 1UWBA 2D9OA 1XMQJ 4LSLB 3U02A 4ZKAA 3TVYA 1X4DA 3M4XA 2DGXA 4L73A 3BPDA 2YX7A 2MMYA 4DQQA 3TJAA 3MEEA 3CJ4A 4U7UD 4J9KA 2JH3A 4CO2A 1FESA 4JI7J 1EHWA 3NKYA 3DLEB 4NE9C 3LUYA 4KKOA 1HL6A 5L39A 1VFJA 1WOSA 3BGOP 2R2TA 3QAEA 3DOLA 2DCUB 4OZNA 3OQ2A 4ZPAA 2YWKA 3LGMA 5LJ5Y 2R8IA 2LQBA 4NLDA 1JLQB 5J2NB 3UI3A 2D3ZA 2B56A 2R7QA 4PWDA 4B3SJ 3BYRA 2QIFA 1ZM2A 3VAMA 3FCVA 1HWJA 3ZNJ1 2G9OA 2AGPA 1NHVA 2FHJA 2VBZA 4I68A 1H3DA 2K8GA 1QD1A 4M94A 4PUOB 4QW8A 5GAGU 4PWUA 2Y9HA 1T05A 2MHNA 2MQNA 4A8XA 4DL7A 2DY9A 3IMQJ 2V63A 2W7AA 4OYWA 3MMJA 3VAHA 2CYYA 4FBUA 5CA5A 4DQPA 1NKBA 2FJWA 3UW1A 3J7YI 2UV8G 1N36F 8ATCB 2ROGA 2XQCA 1WI6A 2DHGA 2W2MP 4QJVA 4FPIA 2CDRB 3QJLA 2CQ2A 3LAMA 3W9JA 3D28A 1NPRA 1T3NA 4EYHB 4E98A 2DGVA 1VIOA 1EARA 5L8RC 1H7XA 2BOPA 4I69A 3T5HA 3I0RB 4XDDA 1MN9A 4KHRA 3WQPA 2RRBA 3GIKA 1RT2B 4WU2A 3G82B 2DRDA 2J0SD 5T41A 3SCJE 1RT7A 2QMXA 3MOZA 2J5AA 3NNHA 3ZZPA 2BEFA 5KFKA 2R2SA 1J2VA 2CPJA 3GTYX 3S8SA 3M9MB 5E3QA 4B9TA 3GIIA 4JI1F 4ED4A 1VQKS 4DLEA 5B0FA 2NXUA 1WEXA 1T9TA 3BQ1A 2BBEA 5AXMA 2J7WA 3H5SA 1MWZA 3HVTB 3FSYA 3BREA 3GG0A 1XNQJ 1CS4B 2IYGA 3F44A 3Q8YA 2UXCJ 1RTZA 2E5LJ 2RT3A 3O8WA 2JC1A 3IM8A 3TX8A 3HSZA 5ETVA 4ETZA 4B02A 2BQUA 3HCXA 2CXEA 4PCQA 1NK7A 2DNPA 4KPCA 5KT4A 2WW4A 2W9BB 1IJFB 2YNGB 3AOCA 2ZH4A 1Y3JA 2AJFE 5J2QA 5KFWA 1QTNB 1RAIB 3ISND 2QG9B 2YWHA 3IWXA 2DNNA 2DGSA 1YJVA 2FVCA 4TU9A 3TA1A 4F02A 5M2UA 4TQRA 4ZCMA 1NSQA 3UFCX 5SUHA 4F2SA 4FXWA 1U24A 3H59A 5B09A 4NA2A 3HKZD 3MOJB 3OTDA 4DR7J 1VQ7S 1QUVA 2J6SA 1RADB 2XHCA 1WG4A 1RT5A 1NBEB 1VK3A 2CADA 3W66A 1B0PA 2IC3A 1O8BA 3T3FA 1S1XA 4G1QA 2RQKA 4RR5A 3W5XA 2RHQB 4TXSA 3KG0A 2VDIA 4GMKA 2AF6A 2DBBA 4IOAQ 4ZVEA 4DR4F 4WP8A 1O0PA 3K57A 1RHJB 1A7GE 1NK0A 3I55S 5CD4H 1KDNA 1SC3B 2I6WA 2ZE2A 3C6TA 3G6VA 1V9OA 4ETXA 4HKQA 1CBKA 2LEAA 1X9WA 3UDCA 2VB6A 3PM9A 3FVYA 1PJ5A 4JV0A 4NLUA 4ITSA 1NJWA 2VKZG 3M8ZA 1N33F 4CLZA 2ILYA 2AT1B 3PX4A 3D5MA 5K5MA 2D1CA 1HQ2A 2HZCA 3FJ2A 3J7ZT 5C25A 3C3LA 2PMWA 2ZDOA 5L1JA 2A6MA 1OJ4A 1JQGA 3NXZA 4DV2F 1K44A 2JEGA 1RLDA 5G4DA 2MKIA 1WNEA 2HBQB 2M2BA 4P2XA 4N8OA 4P72A 4Z7CA 2XYGB 2AYBA 3VZHA 1T9UA 2RH3A 3MM6A 4R0EA 5L1KA 3BBBA 2DPJA 4UUWA 2OEJA 1JLCB 1UEKA 5DM6Q 4H4OB 4F3OA 3CCSS 3NGRA 1FCAA 2OELA 3ET6B 3PX6A 5DGBA 3HD2A 2ZUGA 3WHIA 2HVEA 5DG9A 2YX1A 3UE2A 2MJNA 1FDBA 4DR3F 3R5AA 2OTJS 3CULA 1S49A 3IGVA 2I38A 2EK1A 3SBMA 1NH7A 3W64A 5CYMB 4IFVB 5K20B 2P2CB 1N88A 4OYMA 4FN5A 2BE9B 4DWIA 2KG1A 2K7JA 1SJRA 1SKWA 4NLGA 2XS7A 2KT3A 2B4VA 2MGZB 2L08A 2AJ1A 1DTQA 3M9OB 1S9FA 2GVDA 1KP6A 2Y0BB 3DLGB 4YN3B 2X51A 3R27A 1V3ZA 3MM5B 1T94A 4R8UB 3DXSX 5SZTA 1WDDA 1X4GA 1FT8A 2DISA 4DV6F 2OPSA 2BJEA 1VQ4S 5KT5A 4LIRA 2ZH3A 4CLYA 1RWPB 5EWEA 1D3WA 2EFNA 3FUYA 1NB2A 1RAEB 5IWAF 5FD1A 1VISA 3AA9A 3IRWP 3IAM9 1JIHA 4BWMA 5D3GA 1M1KT 2FVQA 2KJWA 3MMAA 2RMLA 3W9HA 2MB0B 4F4KA 1B0TA 1EZZB 4OJ3A 3SSSA 2KHCA 5DLGA 4ILRA 1G6BA 3EJMA 3DI6B 1HBMA 4K7QA 5C42A 1VCTA 2DIVA 4DFKA 3TARA 1N8RT 3IO1A 2BJ8A 3BGRB 3CT9A 1TP7A 1TL1A 3OD2A 4GVBB 4Y34A 1HWUA 2YKMB 1TUVA 3ZNUA 2CZVC 3RUBL 2WVFA 4DR6J 3FMBA 4LF9F 1C4CA 1NXIA 1S10A 2V50A 5DDRC 2HMIA 2VG6A 1X0FA 3MPWA 1NZAA 4MT1A 4ECWA 3I0SA 4NXMJ 2CRLA 2GCFA 2JEJA 4HL9A 3DYAA 4O4GA 1IN0A 5B7WA 3MXHP 2GJ2A 3QNWB 4FF1A 3OFFA 4K0KJ 2VFTA 2BE2B 3DRYA 4DCOB 2F5GA 4RW8A 5B0DA 3HSJA 3TNVA 2N4CA 3QYYA 1IBMJ 1DY3A 2YKNA 1IXKA 2M88A 3OR1B 5CABA 3DOKB 1RAOA 1DARA 1TELA 5DG8A 3AAWB 1FVSA 3SI8A 2FHJD 1B99A 4O4RA 1LV5A 3MHYA 3SV3A 3P96A 2H4WB 5DJBA 2K06A 4M8LA 2POKA 1V5VA 2J6UA 1OS5A 2F63A 1RWUA 3GYXB 1NAQA 3IN5A 1R7IA 4USWA 3RBDA 2RRNA 5HP1B 3H2VE 5ETOA 3W7BA 1RHKB 4OX9F 3AOAA 1U6FA 2PD1A 5LMUJ 3R7NB 2C3PA 1U25A 1U1LA 5B0AA 3DCAA 4JYAJ 2AYGA 4F67A 3H42A 3M2RA 5KG3A 4J9UE 3MWBA 4KGMA 3M8PA 4PXCA 4CLPA 2EI5A 3NMRA 1M0SA 2HVHA 3MPYA 1ULRA 1S97A 1NSKL 3I56S 4DQRA 1TKDA 2KKHA 1B64A 3GFHA 2ASDA 4H54A 4FF2A 5L1IA 2CVIA 3JSRA 1ZYQA 2DNYA 4I6AA 3G4SS 2DNQA 1ZTTA 4F0MA 3CF5Q 2Y3YA 5BYQA 3FBCA 4YP3A 1P8GA 3IP0A 2GZOA 2BRLA 4XK8C 1CQNA 1K73T 2FLNA 3EGVA 1LOUA 1FI4A 1L5UA 4AE5A 1HWIA 4YHHF 2K2PA 2E9TA 4NYOA 1Z4UA 3SIPB 1LWCB 4CCHA 3OXLA 4MFBB 4PPZA 2OAUA 1ZA1B 2AJ0A 2XCPA 3T1HF 4DDFA 1SQGA 4KPYA 3QQCD 1S77D 3BDEA 1BD6A 2GO8A 4EO8A 3DXBA 4LBHA 2JDJA 3S1TA 4N56A 4Q2MA 3PNIA 4Y28C 4KGKA 3RRGA 3THTA 3GWCA 1S0OA 4H4KC 2WVCA 4NASA 4OZ0A 4LF7F 3T6JA 2ZOMA 4FYWB 4YB5A 5A8WB 2P9EA 5K9FA 1T95A 4ZVOB 2L48A 1F5CA 3A3NB 4A8YA 3D1OA 1N34J 2UUAF 4DHVA 3BQ0A 5EX0A 4TNOA 3MM8B 5HAOA 2JVRA 4LT6A 2KXNB 2CQBA 1GX5A 5HBMB 3S6EA 2GJFA 1YGYA 3CCVS 4IOBA 3KK2B 3AY0A 1TMJA 2HVZA 3GZ7A 3GQCA 2GMHA 2JL9A 5EUHA 3ZZUA 3MEDA 4B9VA 5ETTA 1HNWJ 4I0WA 3QSIA 5C24B 4LRFA 1SXLA 2JHEA 2GA7A 1GTEA 2I8EA 2QTWA 2YKAA 3T1YF 1FDDA 2E29A 2G1HA 4RL1A 3EGZA 4K4UA 2HNDB 2WZ1A 3P4UB 4DUZJ 3ENQA 2IY5B 1WG1A 4EI2A 4JI3J 3HFZB 2W4DA 3CJ5A 1SKUB 4JI6F 3CCTA 1VRUB 2N7YA 4TYAA 5IQQA 2EBEA 2U2FA 1GMUA 1OPZA 1Q7YT 3N6LA 1RTIB 3GFZA 1VQPS 3OSNA 3CD5A 3D1HA 3ONQA 3OTEA 1VQMS 2RIJA 4DZ6A 2XNRA 3ENVA 4O3NA 4Q43A 1P27B 2NLWA 2C2KB 1JXVA 4G1IA 3L95X 4TY8B 5LT5A 3C16B 3I5BA 1AYEA 1NO8A 1T9YA 1Z1ZA 4X66F 4IDKB 2ZKTA 3W8GA 1S0NA 1XN9A 2ZKUA 3TQEA 3GILA 3K5LA 2LVWA 3QWUA 2VODA 1YRUA 2UU9J 5M2RA 3EVMA 5H9FJ 2F9DA 5ETNA 1OY8A 4ECQA 2R8KA 4OJHA 4EU0A 2MPUA 4NL5A 1UWBB 1FDNA 2AJQA 4HH1A 3D3CJ 2OUGA 2CJBA 3TAPA 3P3DA 4MYTA 4IO9Q 3BR8A 3HHNB 1BWEA 3T41A 5D78A 1T0TV 4YR0A 1RISA 3HHKA 3ZZTA 3MEEB 2N4DA 4UQTA 1KN6A 2OGUA 1LKZA 3B4MA 1TR0A 4ZVSB 1ZZNA 1XNRJ 4C3MA 2E1AA 5CCMA 4UY85 5DDPC 1OO0B 4GO7X 4KKOB 2HK3A 4RNOA 5F0UA 4ZITA 3SZ2A 3G8SA 2VQEJ 1HHTP 3DOLB 2FJBB 4M5LA 3CEDA 3OPKA 2DHSA 1WACA 2HBRB 3H5YA 2J0QD 1YG0A 2QZ8A 4PWDB 1FRMA 2AGQA 2NYHA 4DX8H 4URGA 2KT5A 4YB7A 2RILA 3BGFA 4K4TA 3LO3A 1T05B 4KAIA 2E7VA 3VV2B 4KC5A 1I94F 2BA9A 1BC6A 3HX9A 4KGVB 1K9MT 1KQKA 2P9CA 2R42A 4K2JA 5FJ4A 3CMES 2KZMA 1KOHA 2J9DE 3MFIA 1H2VZ 2HFUA 4KGZB 4OLPA 4NLTA 4DUTA 4ZIVA 2BACA 5F0WA 1HR0J 1BE4A 1NK6A 3QSYB 4WE1A 2V0NA 5CHCB 4L6V3 4RUCA 3V4MA 2PFDA 3J7YU 4ZCKA 3BKFA 4X62J 3LP2A 4FPRA 1EB0A 3CC4S 2RU9A 1PKUA 3JB9k 2JNJA 3DFEA 1RT7B 3I4PA 4X64F 2G2ZA 4DS5A 3PW0A 3GR1A 2R7XA 2KG0A 4LFCJ 3R6GB 4OV1A 4F0HA 2IDLA 3OL6A 2DR9A 2NYIA 1RWMB 2ROEA 1U4BA 2IVYA 4DPTA 2VQFJ 1TU0B 2DH8A 1QDUB 2EFQA 2DEIA 2CNLB 2E5JA 3QJPA 4MJKA 2BQ3A 2NSCA 2CQDA 2DNZA 2DHXA 5L9NA 1YITS 1DBDA 2HGMA 3TYTA 1Q5VA 2V4RA 2YNIA 3KHHA 4TY9A 4KH1B 4LR8A 2LECA 3FSIA 2JVOA 1DAXA 3OSPA 4ZN3A 3PHTA 1XR5A 2E5GA 3LWLA 1NH8A 5DS7A 5J2QB 1U02A 4OHVA 2CQ1A 4WZMA 4CLSA 3JS9A 3MAAA 3TI0A 4Y0FA 5M2PA 3JAMU 2UXDJ 1V5IB 1HI8A 1WDTA 4BLGA 3F73A 4Q8FA 4J5OA 2VFSA 3PJXA 3QO9A 1CLFA 1K1QA 2E5HA 4HTJA 4C8NA 1S5ZA 1FJGJ 2WAQD 3KLHA 1RT5B 5AJ3F 1FD2A 4WFBQ 4R25A 2IC3B 3I31A 1S1XB 4G1QB 3M30A 4CLWA 5E5NA 3AB2B 5KFIA 4OYZA 3MUVP 1W26A 4J9PA 5I3QA 3PEHA 3GIMA 2R7OA 3NCQA 1YLXA 4DL5A 4YS2A 1U1PA 4K4XA 2HG4A 1O6XA 4ES3A 5U47A 2V2KA 1RDRA 2AV5A 2XM3A 3IAS9 2V8HA 1HBOA 4ZN1A 3AQOA 3ILJA 4ED2A 2ZE2B 3K8WA 2C2RA 1P1LA 3C6TB 3MI7X 1KLMA 1FWKA 3MCNA 1NHKL 1RAHB 3V81A 4M5NA 4F7VA 4LF6F 3KNGA 5D0HA 4MAKA 1YJTA 5KG7A 1FEHA 2JZ5A 5IT9U 4MH8A 4DR5F 2VFVA 2DNRA 2LEBA 4OYIA 3D2WA 5C25B 1WC3A 1VRTA 3CWJA 5CZXA 4X2BA 2KYZA 2RDDA 3EVOA 4IKAA 1B70B 2MZ1A 1MU2A 2UUBJ 2KT2A 3HHLA 2YWFA 5F8MA 1NDLA 3BH6B 2DKOB 2UVWA 3OL8A 5HMWA 5LXRA 2GHVC 4L74A 2Z2YB 4OZ5A 1R8BA 1H73A 3CIMA 1MN7A 3IBWA 3MM6B 2D3UA 3QZ8A 4RUAA 4EBCA 3CGIA 4ZLJA 3H5UA 3GV8B 1RAJA 4X4VA 1OYEA 3DNCA 2B4PA 1LW0A 2KDOA 2BKPA 2DR5A 3R5JB 1IBCB 2DR7A 5IC6B 1L3KA 3DLHA 2EBGA 4LF5F 2XG8A 4TYBA 4Y00A 4N5SA 1BUXA 5LOQA 1N0VC 2RS2A 2DNGA 3QJJA 2L3MA 2JC0A 4ZPCA 2AQ4A 4YOEA 2DY1A 3AD8C 2V68A 4USUA 3OXFA 4C8KA 4TLRA 2GAHC 2MLYA 3N4WA 4ED6A 1WD6A 1DTQB 1HWKA 2GVDB 1FHTA 4ZP8A 2RQ4A 1ZAWA 3M8QA 3B6BA 3EZUA 3K0JA 3RAQA 2L9DA 4KQZA 2OPSB 2ZHOA 1RQ0A 3W8PA 1APSA 4K4SA 2GIRA 2DEJA 1XC9A 1O51A 2KVQE 2V4QA 3FBEA 4KBIA 1HNZJ 5GAHU 2VOOA 4RZRA 1IBLJ 3ZZYA 2N3LA 5D3GB 2BX6A 2FJDB 4UTGA 1F2GA 3D0GE 3MMAB 3M6UA 1AZSA 2C2ZB 2Q6BA 3NS6A 2XLKA 2CA9A 3POTA 2ZZMA 2VPXB 2R8JA 1XBWA 2CJXB 4MKAA 1HBMB 2B0GA 3EZOA 3VVTA 3LP1A 2WK4A 4FVMA 1YIJS 5LXYA 2AEJA 3HJVA 2LA4A 2CQ4A 4IR9A 3BSCA 2GFFA 1TL1B 1TKXA 3FNNA 3UPFA 2B9YA 2RQMA 1FA0A 2W7OA 3GV5B 2LDIA 4NCGA 5CAAA 5KT3A 5B0CA 2LA6A 2HMIB 3CD6S 4C8LA 2LQJA 1VQNS 1LXNA 3VCDA 3QIPA 2N7CA 5J1NA 3MPUB 3I0SB 4KSEB 1EP4A 1R0CB 4USVA 1S0VA 2DTJA 3DYAB 4O4GB 3MD3A 2HIYA 2NXJA 3HXMA 1B7YB 4K4YA 4JP8A 5DRKA 4RPFA 4PG5A 4RW8B 4K5RA 4CLTA 1XMQF 2PN6A 1AUDA 4MMOA 3HLUA 5BR8F 2L9WA 4A8QA 2YKNB 1PYOB 3US5A 4E2FB 2R7WA 1RA7A 1X9SA 2HURA 4KJIA 3TZYA 3G6XA 1T11A 2YH1A 5BJRA 3RW7A 2OD4A 1BQNA 4DUYJ 4DPUA 4HI2A 1Z2ZA 4URSA 4O23A 2F8EX 5GAGI 4JI7F 1IUJA 2XZDB 2YBVA 2QC3A 3HVRA 4OZ1A 4J9OA 4A47A 1T9WA 1D8ZA 2CQGA 3SCLE 1PIEA 2NPIA 1YJ7A 3EPGA 3U1LA 2ZJQQ 4B3SF 4RW9A 2GGPA 2HAIA 2PMZD 2W4PA 3AB4B 3BH7B 1GK8A 1ZPWX 3JAMY 3CCES 3KK1A 1KVJA 3M2RB 4BWJA 4M5JA 1NJIT 3M8PB 3G96A 3UD4P 1OQ6A 1YBAA 3IBCB 3FEXB 2ZWPA 1M5PC 3WC2A 4NLXA 3IRXA 3CMQA 4IH6A 2HLTA 1U1KA 2G2OA 7FDRA 1D0EA 3VQSA 2QL7B 3TJ9A 3MMBA 3BKUA 4O44A 1TUWA 3D1QA 3GLJA 2B7CB 3NMAA 2EKNA 2VC0A 1YJUA 2RAQA 2B51A 4NYPA 4LF8J 2V34A 3DLKA 3AT1B 3EGWB 4JI2J 3U7JA 1FKAF 3X1LB 1UEUA 4RBUA 2I1RA 4IH7A 1PSDA 2AX1A 1GMWA 3EYZA 3CMAS 3FDSA 4DF8A 1NDKA 1W2BR 4EZ6A 3KTQA 4WIIA 5LMNJ 4A8WA 2Z2LA 3VWSA 5K8NA 4AYBD 1Q8IA 4C0BA 1CJVA 2B8QA 1CULA 3GJRB 3TOQA 2R8HA 3TZXA 1N52B 1S6OA 1WWHA 1XNQF 2KM8C 4QW9A 2DGUA 3CD0A 2VPZB 2UXCF 1YJ9S 4K4ZA 3CC2S 1V3SA 5IXUA 1WHYA 2VD3A 4ECRA 1TV6A 2DVIA 3W9IA 3TX0A 5B0GA 2K3KA 4XPCA 5DLFA 3ILOA 4LFAJ 4ZVPB 4CRJA 3VALA 4NI2A 5EGYA 1N5SA 4HDHA 2P9GA 3M1VA 1P6TA 2UUCJ 3HP6A 2PC6A 4F8RA 3SSQA 4DI6A 2RRAA 3MPDA 2C3UA 2KHDA 3MEDB 3HHEA 1J5EJ 1IM6A 2YKOA 4WYWA 1SIWB 2CKWA 3CB4A 1MLAA 1VQSA 3IXQA 1KWMA 1FKPA 4DR7F 4GVLA 4X4QA 3A8KA 2MY7A 4QIFA 4EGLA 1NPPA 5KFXA 1X4FA 4ANDA 2GMLA 4M95A 4OL8A 4O3QA 5E7OB 4CM0A 4DR1J 4FXDA 1WKJA 1XQIA 3D4JA 1NSPA 1UL3A 2B9WA 3R5GA 2QLWA 2WCXA 2B43A 2KVIA 3Q8QB 4ED3A 3ADAC 3VHQA 2QEXS 5AXNA 2RKIA 1Q82T 2GAGC 4F26A 2YH0A 3PY8A 2MSTA 2XSJA 2AHOB 2IRXA 2ASJA 2JFKA 5HROA 1FTRA 3UD5A 2MY8A 3LOUA 4ES1A 2V9WA 3KLIA 3ZZOA 5KFPA 4FDFA 1Q8BA 4M1KA 4ZPBA 4UZBA 4RO0A 1Q95G 2F1FA 3UCGA 1NUEA 3JSBA 2Z4PA 3V6DA 5HVHA 3PKMA 5G0RA 1QVGR 2DH9A 2C2EA 4RWWA 4K50A 2WOMA 1RAAB 1SJ1A 4DBQA 2O66A 1HARA 1AT1B 3AODA 3IG1A 5KFMA 1HD1A 2QJ3A 4N8NA 1S48A 1RBLA 3M6WA 1VQ6S 1KONA 1RYRA 1NKEA 4WBFA 4DEZA 3QT6A 3JYTA 4ZP7A 3GJTB 3RBEA 3BN7A 3U1NA 5J1EA 3CDEA 3SQOP 1HQUA 4I1TA 1AFIA 2RNEA 2XBPA 3KYLA 4AL6A 4PQUA 3GYGA 4C9DA 2OI2A 4NMXA 1OQ3A 4LF4J 2IMOA 3NOCA 3PW2A 2IVFB 3ZTRA 4RW7A 3ZFVA 2QX0A 4NYZA 4OI1A 4NZ7A 4F3MA 4UOCA 5L38A 1WC0A 4CDIA 4FYDA 4DXLA 1NK8A 4F4XA 3RB3A 1SKRA 2FYXA 1PCAA 4PG7A 3FMWA 3FQLA 6FDRA 3O2IA 2ZNZA 2IVMA 2XS5A 1MMDA 3L7OA 2Z2MA 3PRDA 2ROPA 2KXHA 1Q8KA 1JJ4A 2YTCA 2ZWOA 1IR2A 3CJTA 2MEWA 4ED7A 4NRTA 2HHSA 5GAEU 4JI5J 1HD0A 3TQ1A 4ENOA 1S6QA 5I3UA 1R0AA 1FX4A 4Q8EA 3Q8VA 2ALYB 5H9EK 2O67A 3CC7S 4GC6A 3QRRA 4DX5A 1UVJA 2EVZA 4ZLNA 4WE1B 4DV1J 1C1BA 1GNKA 1SKSA 3LQVA 4C0HA 1RHQB 4USKA 1HHQA 3BEGB 4RNHA 2M52A 3LF0A 2MKCA 3LP2B 3TVZA 2IAJA 2ZOGA 5B0EA 1T02A 2FVRA 2XO6A 1XR6A 1RT4A 2W4CA 1NKCA 4OX7A 2CJKA 1HHSA 3C19A 4DR6F 3EE3A 1ROFA 1YSJA 3CCZA 2MQLA 3QFWA 3PO5A 3I82A 1YVFA 5IOLA 2GQCA 4JI1J 1VIXA 3FBFA 4GKJF 4DCPB 3SFUA 4I2QA 1XIQA 2YNIB 3QGIA 1QLNA 4K0KF 5ADZA 2QSWA 4ZLPA 3MDFA 3MCOA 1RTHA 3HSDA 3R5CA 3FSXA 1Y5IB 1NK5A 4HI1A 2XMUA 2UZAA 3VGSA 1G4CA 2Y8YA 3W5YA 4HACA 1IWAA 1IBMF 3DKDA 3W63A 3NP5A 1RWKB 4C8MA 3H4BA 3BSOA 3MAAB 1CEZA 3NCPA 2GC8A 3P45B 1OYDA 3C15A 1M90T 4AQYJ 3OTOJ 4ER8A 1SJQA 1VQLS 4B3OA 4QIVA 3D54A 5HATA 2HS0A 4ZVUB 5HLFA 3QO9B 3DHXA 2QLJB 4ZMMA 3G87A 5F8LA 1SIZA 3O1LA 2JJ4D 4K59A 2ZVIA 3KLHB 3CO0P 2MSSA 4YR2A 4TU7A 5D0GA 4D3GA 1HNIA 2M4MA 3PHEA 2R8GA 3CW2C 2F40A 2V69A 3H25A 2OH2A 4ZJLA 3M30B 1H6KX 5LMUF 2RD5C 3G71S 1WOPA 3CVKA 4JYAF 5DDQC 1VHIA 4CNYA 3BSNA 3NG8A 4ECXA 2GQQA 4DLGA 4QOTA 2LDYA 1HBOB 1V3RA 5A8KA 1KLMB 3M9NB 3QATA 5HVFA 4H4KA 2MKHA 4DSIA 3V81B 2E7WA 4CLKA 1SL2A 2I2YA 1NB7A 2DR8A 4B3MJ 1LNQA 1M5KC 1WUUA 1RWNB 1RTDA 2DH7A 1VRTB 3LP0A 4A8MP 1N33J 4HLBA 1MU2B 3HHLB 4EBEA 5EX3A 2O01C 1R27B 4ECYA 1HW9A 1CSJA 5BXIA 3BGUA 3QAUA 1U0SA 1LFWA 3D6MB 3M2UA 3RRKA 1UWAA 2ZBRA 4RKUC 2J7KA 2HK2A 4QIGA 3QZ7A 4DL4A 3K7RA 2CFXA 4ED1A 3R9LA 2RDIA 4OHYA 1M5SA 4YDDB 1YJNS 1QTMA 4ZVTB 1LWFA 1LW0B 3I87A 4J90A 3MUTP 3HULA 1U2RA 1Y0HA 4ED5A 2AU0A 2ZZNA 2W2OP 4OI4A 4C8YA 3MGJA 1RCXB 4ZJQA 2ZH1A 2PDAA 1S7HA 1URRA 3A3OB 1N34F 1GAOA 3BBCA 3HHLC 1FO1A 3F0NA 2M8DB 2ADCA 4I56A 1XR7A 2I9SA 1XMOF 3WX4A 1LFPA 1FNXH 3GV7B 2HS4A 4RBTA 3M8QB 3Q2SC 1LK7A 1MWYA 2FJVA 2YKPA 1D1UA 3FCWA 2OPPA 1AW0A 1H98A 2DRBA 3UCZP 4DSFA 3GG1A 4KHMA 3EGNA 4ED0A 1DTTA 1F2HA 4YR3A 2Z56B 1F0XA 5F3TA 1WSVA 3J81j 2QT7A 3P5BP 2C2MB 1VBYA 5IWAJ 2IDEA 1FKOA 2NXCA 1AZSB 1EQ0A 1G7CB 2JLEA 3I5AA 4JI3F 1UJ6A 3POTB 4PXEA 3PZPA 2WRMA 2UVVA 2OPQA 3H90A 5IS2A 1MMLA 3LP1B 2IA0A 2OO4A 1OMSA 3L7UA 4B9LA 1EAYC 3AA8A 3PVXA 1D9AA 2ZBCA 3NCRA 2KRBA 2X1GA 1TKXB 5K14A 4PABA 3DRSA 2FUG9 4DV7J 3OLBA 1N6QA 3BJYA 2WB1D 4NCGB 1YI2S 2RHSB 1TMMA 1JMTA 2OMOA 4HHUA 4P2FA 4NOHA 3QIPB 4CQ1A 1S1UA 4DN0A 3OHBA 1EJ7L 1U26A 2J8AA 1EP4B 2EG1A 2UU9F 2ERRA 4CH1A 2B9XA 4X65J 4F4AA 5D0EA 2EPIA 1I1GA 3L09A 5EN1A 1F3VA 4QIEA 3CSKA 1NCLA 3Q8PB 3BZQA 1G2EA 4F25A 1VBKA 3K8VA 4C8OA 1WHVA 4DFMA 2NR0A 2J9DA 3KHRA 2E66A 1BQNB 2Y1LB 2IIHA 3E01A 4OV6A 3NS7B 2EEYA 2WHOA 3LAKA 4OI3A 1XNRF 3MZIA 4L75A 4C11A 1LXJA 4C2MA 1JLBA 4OYOA 3OT9A 2RU3A 2RE1A 2VQEF 1SCJB 4DV0J 1S1WA 2E1PA 4U7UK 1PJ7A 1T7PA 4QCLA 1KVKA 4RW9B 2GGPB 2ZITA 1P1TA 4LF2A 1U09A 1FRKA 3KK1B 5C2GA 1RWWB 4P75A 2KH9A 2H48B 2Q66A 3EDRB 1RACB 3IRXB 4DF4A 1UZHA 1BHNA 2WW8A 1VRQC 1TVRA 2PO4A 3MAHA 2W7PA 3MMBB 4AFFA 4RBVA 3RBXA 4O44B 1C1CA 5AE1A 1H72C 2BE7D 1XEZA 1NM2A 4CH7A 1I6JA 1YHQS 4RW4A 3OTBA 2CG8A 4JI4F 5KT7A 2LKZA 5HQ8A 5LSOA 2XMMA 3BBFA 3EDQB 5FLXY 3DLKB 5IZHA 5D4PA 1GH8A 2FB0A 2LQ9A 3N01A 2J0WA 1HR0F 2X1BA 2HAFA 2BDPA 5KAKA 1ZZFA 1UVNA 3WX8A 1B4SA 1IKYA 3ZZ0A 3CNQP 1B3TA 3PIPQ 4DR2F 1WOOA 3H20A 3RAMA 4Z37A 2E7XA 2W9CA 2VJVA 5KFZA 2HS3A 5E41A 1RBAA 2JWNA 3IS9A 1CVJA 5T7LA 1X4CA 3C6UA 1CJVB 3BO4A 1CULB 4D3HA 2RDJA 5JXSA 4LFCF 4DMZA 3IGNA 2XMJA 2H5IB 3Q23A 4DPOA 3WDOA 1S6PA 2DB1A 1RK8A 3IWNC 1TL7A 2GIFA 3CCMS 2VQFF 4B9SA 2HWTA 2OTLS 4FF3A 5I42A 1C2PA 4NLOA 2HHHJ 4ALZA 1HFEL 2HHVA 4LF7J 1TV6B 1U0HA 5LJ3Y 1UAWA 4B3RF 4P10A 3CJKA 4A8KA 3CCQS 2FGOA 4LSZB 4NI2B 3M1VB 1MMNA 1U2FA 2DO4A 1L3SA 2XMTA 2MKSA 2UXDF 1L3TA 4XPEA 1R6VA 2CNKB 2VH7A 1AB8A 3MTKA 1PG5B 2KYXA 1FKPB 1AA1B 3UO0A 5J1PA 2HFOA 1ZAXA 2VFUA 3T9ZA 3DLBA 5J2MA 2MKJA 2UXBF 1EKRA 2YPYA 2HVIA 3VQTA 3UCUP 2D69A 3P8BB 1O5JA 4F4YA 3T1AA 1GTHA 1Q78A 2PI5A 4KTQA 2CAJA 2MXYA 2JX2A 2B5JA 4ED8A 1VR6A 1YBTA 4LR9A 3SQGA 5GMKa 2ZHAA 4MK8A 4ICLA 3PFEA 4V19X 2VBXA 4YY3F 2BM1A 2RKIB 1DQ8A 2ZM6F 1SVDA 1XERA 2XSJB 2J8SA 4EUVA 1CJKA 4HYKA 5HROB 5KFRA 2C2NA 2DGWA 2HHPA 3QGPA 2OP5A 2YWWA 3JQMA 1IKVA 2MQOA 1RSCA 3QT5A 2EK6A 3IC1A 3KLIB 1HYSA 2VICA 3Q8RB 3FK4A 5A6PA 4LSNA 3IFEA 1ZM4A 2GVZA 2XMKA 4X66J 2UUBF 2Z0GA 2NS1B 3V6DB 2ZBQA 1CPZA 3U27A 5G0RB 2GX8A 2WOMB 2OLWA 4U7CA 3RW6A 2CPZA 1X4HA 3THPA 3IG1B 2HKEA 4EMDA 3H7HB 2G2YA 4RWXA 1I51B 2WVDA 2OIHA 4XTTA 3GB0A 2IRUA 4M5IA 4KO0A 4A8SA 2XNQA 4C8ZA 3JYTB 1IWGA 3S01A 3SEOA 2ATCB 5J1EB 2ZD1A 5DQHA 2M5YA 4PG4A 1GQEA 3D3BJ 1HQUB 3JSMA 1ELOA 4UT4A 5GMEA 1SL0A 4PQUB 1BY9A 2AP6A 1JLFA 3PW7A 5C7PA 9RUBA 4Y65A 3CO9A 2E1RA 1XMBA 1WF2A 4RW7B 3V5RA 2QFIA 4LMZA 3ILIA 1NK4A 1TFWA 2KRRA 4CH0S 1WORA 4WFAQ 2MDAA 4FKYA 1HI0P 4OJ1A 5GAHI 2BYCA 1PYSB 1TTHB 2XLIA 2QA4G 1KFSA 1ACMB 3PFOA 5E33A 4G6VB 3CCLS 4PEOA 2LU2A 1N5TA 4DL0C 5JVGQ 3OL9A 4LRBA 1WG5A 1WF1A 3LPEA 3EMTA 2XTJP 4F50A 1EETA 1D09B 1HNZF 2GO9A 2FC9A 1IBLF 3AD7C 1S6QB 3QT8A 5I3UB 1R0AB 4XDCA 1FVQA 2QE5A 3A8IA 2MTLA 3DRRA 4CIOA 1FDAA 1VMBA 3R8YA 3B8HA 2XHWA 5HMYA 2Y8WA 1C1BB 2VC1A 3NRBA 2OPRA 3MECA 3P49B 3HZGA 3TO8A 2HLUA 2HRUA 1TL4A 2IAJB 2XLJA 1RT4B 5H9EJ 1DFDA 4CT9A 2EC2A 2VOPA 1RABB 2FZKB 4QWAA 1U1MA 4BBYA 1M5VC 1BQMA 1RHRB 1HNXJ 2FTRA 3M8SA 3RTVA 1PJ6A 5D4OA 3CJ8A 2DO0A 1X4EA 3OJUA 4JV5J 1QE1A 4I2QB 3U1MA 3PXGa 3KNAA 1FJ7A 1FRXA 3M8WA 4UOFA 2PI4A 4U8VA 2DT9A 5IC4B 2ZBIA 1RTHB 4OMFG 1MWQA 4HACB 4C48A 3IA0A 3JTPA 2HHXA 1RYSA 3C14A 1IKWA 4P6QA 2LCWA 3L4BC 3WBZA 1S79A 3MR7A 3KXDA 1M5HA 5DQIA 3C15B 1GX6A 3I32A 4EYIB 2ZJRQ 2NPFA 4DUYF 4B3OB 1TKZA 1UPMB 2G13A 2KL8A 3BF4A 5HLFB 2IM0A 3OHAA 3KHGA 2QSFA 4O3RA 3KMQA 2NCKL 4DZDA 5KG1A 4I7FA 1HLWA 1HNIB 1Y5NB 1SH3A 1N32J 3QFHA 1RLCL 3LW5C 5A76A 1R89A 1W7WA 4NRUA 3Q89A 5CQGA 2AJ2A 3J81U 2ADBA 4K8RA 1KLNA 4USTA 4ZK7M 4B9MA 1SV5A 1R8AA 1HKAA 1NEEA 5KFCA 1VBZA 4WKRA 2VKRA 3UQSA 3UVJA 4DV3J 3TUJC 1PC4A 2V67A 5A8KB 4JB8B 4HTIA 5GADI 4EEYA 3KLEA 5KOXA 1R43A 2VL1A 4C4WA 3H5XA 1U1OA 3G6YA 3C46A 2A3JA 1R31A 5CZVA 2QLBB 1JNZB 3KDNA 1RTDB 4LRDA 4URQU 1MROA 4LVOP 3LP0B 5IM0A 4LF8F 1X0PA 3MR6A 4WK3A 4JI2F 2PA3A 4IQMA 4M5DA 4DSKA 1NJYA 4ANCA 2R7UA 3FZ2A 3TWZA 3KK3A 1DQAA 3M2UB 1J5OA 1UVMA 3D0IE 1ZH5A 4YDXA 3NL0A 1REVA 1FD8A 3LA0A 5LMNF 3UN3A 3R1HA 3ULHA 5HVGA 3ZC4A 2ZH8A 4X4SA 5MAOA 2MQQA 2VONA 3D67A 3HSGA 1LWFB 2BW7A 1KC8T 3T19A 3FBBA 3M2VA 2F4FA 3TAQA 4J9RA 1CJUA 3DGPA 2HVDA 2DHHA 3K5OA 3N5BA 3EWGA 2ZDPA 4N7TA 2MJUA 3KOAA 2WBMA 4NWBA 1S1TA 2R2RA 3BS9A 2WTFA 4PWWA 1TKTA 4C7QA 3LTOA 2J9EA 3IBFB 1UVKA 1FRLA 2EFVA 2Y0SD 3OFEA 7AT1B 3E2EA 4EZ9A 4OQJA 4R0JA 4BHQA 5KFJA 3KJVA 2H51B 3H0PA 4CLUA 2JEIA 3C8YA 1ZTWA 2V8DA 1M1HA 4JV1A 3HHDA 4X4NA 2YY3A 2BV3A 1J5EF 2OPPB 4OYPA 1RXOB 5ETKA 2C28A 2PFFB 2FZGB 1HPZA 4PG8A 1RBOB 1DTTB 3EUNA 4KR0B 1NJZA 1HIYA 1GXLA 4C98A 1YTYA 1Q53A 4NA1A 1FKOB 3ITHA 3CPWR 2P5VA 3UWTA 3DRPB 2NZCA 2DRAA 1WTBA 2KTQA 2M70A 2GS8A 4ELUA 4GKKJ 4NLVA 4N77A 4I4BA 2OPQB 4ZJOA 3SDEA 1ZPVA 1A9NB 5HK4A 2DNMA 4E8UA 4TU8A 1WELA 4J7CA 3FCHA 3K59A 5K14B 2L41A 5KFBA 3DRSB 1Z2LA 2FJEB 4M5GA 1N6QB 2P6SA 2R3VA 2ZH5A 4F3QA 1YBUA 3OUYA 3CCWA 3M32A 4OIXA 5HANA 5LL6d 5F9LA 4DL6A 2WSFC 2ZH2A 5F8NA 2G0JA 2XGQA 2HWIA 2HHUA 3CJQA 5CXTA 3NNCA 1FFWB 1Y9OA 1S1UB 3VVUA 3PDNA 3RAXA 3K5NA 2HBYB 4P74A 5C2CA 2AGOA 1HI1A 5D6GA 5A0YB 3AJ2A 2ZZTA 2AMCB 2FZCB 1F6TA 2HQIA 2C3OA 2YWGA 2CWKA 5F8GA 2CIMA 3AJDA 5B08A 1E6YA 3DDKA 3DGVA 4KH0B 1UA1A 2X7IA 4KB7A 1L3VA 5D8HB 3K17A 2RVJA 1VQ5S 2LFVA 4J9SA 4W4MA 5BR8J 1Q16B 3E01B 3TUZC 3ELHA 1VYAA 2J6TA 1KHWA 3E3XA 1WKKA 4OHWA 5HN0A 2XGPA 4C11B 2LXFA 1JLBB 1QVFR 3PRVA 1ZETA 2V8VA 4UUXA 4LF4F 2L9NA 2W24A 4YB6A 1S1WB 5KFGA 5CCLA 2LMIA 4I64A 1HNVA 1RHUB 1SUQA 5DGAA 1QAXA 4KIAA 2GMJA 2BJ7A 4JI0F 5GAEI 2LP4A 3LGHA 4FBTA 1UMJA 3NGSA 1JNRB 4NLWA 3M6XA 2ZC3A 2I5JA 1I5OB 3KDOA 2E1CA 4NEYA 3R5DA 5T14A 3DM2A 3MM7A 1R8CA 3CE8A 1TVRB 3RGIA 2H3EB 3DHWC 4ES2A 2V94A 2HQDA 2IM2A 3Q8SB 3DOMA 1C1CB 2XULA 1UA0A 1LWXA 4JI5F 5KT2A 5DDOC 4RW4B 3J80Y 3J81Y 1VQ9S 4OZ3A 2IM1A 3PR4A 3OVBA 1JJ2R 1KRPA 2ZEJA 2V2QA 1CG2A 1FK9A 1T03A 2ZC4A 2CQCA 4DV1F 4Y2MA 1IKYB 5EWFA 1MSWD 1JLEA 3PX0A 3RR7A 2C3MA 3NGTA 2PMHA 2KXFA 2HRYA 1FRJA 2YQ3A 3I9V9 2W9CB 2F4VJ 4A8FA 3ZTSA 3FEZA 4TQSA 2J9CA 5J2PA 2B4UA 1RT6A 3IS9B 3KUEA 5KG6A 5T7LB 3D68A 3V2UC 3C6UB 2BZ2A 4Y2CA 1U49A 4DFPA 1Q1KA 1VOMA 4IYQA 2IJNA 2V2VA 3IR6B 3K89A 2V4JA 3VGVA 5KFLA 1S6PB 1CC7A 4NPOA 1TL7B 1GEHA 1S4EA 3PYEA 2HRTA 3L7PA 3W1YC 3UDEA 4DN9A 2UUTA 1R3NA 3G2XA 5I42B 4P9SA 3MM9A 4NZ0A 2OEKA 3V4IA 4ZS6A 3SSRA 1K0VA 1U0HB 3NY0A 4DV4F 4A8OA 3CJKB 2YWEA 4A46A 3HT0A 3P6YC 3I5CA 4UQGA 1WC1A 2F9JA 1S9GA 3GPAA 2AKWB 4C6AA 4DG1A 2PEHA 3PACA 3AXKA 2FHKA 4FYXB 4Z7YA 4Q44A 5F8JA 4KYZA 5KFNA 5HI7A 3Q0AA 3GFYA 4AQYF 3OTOF 1ICEB 1REGX 2HGNA 4USJC 5CYQA 4ID5A 1AUSL 2CJ9A 4J9VA 2VG5A 3TJ8A 1L3UA 3KFWX 4RNMA 4BS2A 1KOOA 5J2MB 3A12A 1YX2A 1U1QA 3K2YA 3RJMB 1ZS6A 2H1YA 3ZTQA 1KTVA 1V6HA 2F8HA 1YWXA 5F8IA 2O1PA 3LALA 5ETQA 1TL3A 5GMDA 1RT3A 2B5JB 4K5SA 4TVAB 2R7SA 1H2UX 1S59A 3SQGB 5L9XA 3FKBA 3QRQA 1QSYA 2K3IA 3Q22A 2VZ9A 1PAUB 4X4TA 4ICLB 4HVZA 2MZRA 3HD1A 3WZ0A 2V6AA 1KNZA 3LPYA 4JI8J 4DL2A 1CJKB 2BQRA 1Q8LA 2CG4A 1EX8A 2VASA 1TZ0A 2RF2A 4IG3A 1HWLA 1IKVB 2HQCA 4B3MF 4I2PA 1HYSB 5EDWA 4QWBA 1KKHA 3VGTA 5A8RA 4WIQA 4DSLA 2YQ0A 1HA1A 4LSNB 2GVZB 3OBIA 4MYUA 2JOQA 4RW6A 2W2NP 3W61A 1MNEA 2KU7A 1SJ3P 2XYHB 5KFDA 2Z58B 2R4FA 3NGDA 2A2DA 3K58A 4RUHA 2VA3A 4PR6A 2U1AA 4KO0B 2DXEA 4WXOA 3HJFA 3O5TB 1TK5A 4U6PA 4IQXA 5H1SV 3HM9A 2BJ1A 4P73A 3HF5A 3QGHA 2ZD1B 2XWYA 2M7SA 1IJEB 1PGZA 3JSMB 1PBAA 1SC6A 1URNA 4DU8A 1S57A 1JLFB 2HFSA 2HPUA 5HQMA 3M8YA 3X3UA 1N56A 4ZVRB 4UZCA 2D74B 4F2RA 1JKHA 2QA1A 4FVCA 1VHFA 4JUZA 2BANA 3O6QA 1U7LA 5ITHA 1IBKF 2HZVA 4B08A 2IYIA 1ZBTA 1WTFA 2CNNB 4PPDA 2OJ3A 2RQCA 2BJ3A 4KRWA 4QR0A 1WF0A 3D9BA 3V6JA 5L1LA 2YKQA 2B6AA 3EZ5A 2AJ4A 1MW7A 4LVNP 5CYJA 1HQEA 3UR3C 2IFXA 5KFYA 4AD6A 2HIQA 1UETA 1EETB 4IR1A 4WXWA 2CZ4A 2AZ1A 4FXVA 3D6HB 1QSSA 3KG1A 3BGLA 1ZM9A 1NRKA 3O44A 3SCIE 1C0UA 3ZZZA 2C2DA 3DRRB 2FJXA 2H54B 3VTIA 4WK1A 1VC0A 2K1RA 3TUIC 3WIUA 5C5JA 3G9CA 3O3LA 2KZZA 5C42B 1TK0A 3DU5A 1RT1A 2OPRB 3MECB 2IJRA 1TK8A 4MIAA 4ZPWR 1S0MA 3VGUA 2N82B 3EM1A 3T5JA 4DOZA 4AXIA 1RAFB 3CUNA 4EWTA 1ZAVA 1UPPA 2FVPA 2AZ3A 4DV7F 1BQMB 2VG6B 2IPOB 3AQPA 2PEBA 4Y3CA 1IVZA 2KFYA 3MAQA 1AROP 1RZMA 3OV7A 1XK8A 2ZFHA 2BOAA 1Y11A 1SB6A 3G6ES 1HBNA 2FLLA 4MTPA 3TZWA 1YJWS 4C3LA 1QE1B 3NWRA 4X84A 2VIHA 3PYDA 1A0OB 3C2PA 1RA6A 3CCRS 2VG7A 2EFGA 4X65F 4K2XA 4GKJJ 1GT8A 1FFGB 1NDPA 5A2QU 4N47A 2HHQA 4V19J 3KJFB 4IRKA 4USHA 1WHXA 4WFYA 4LRAA 2VDHA 2B8PA 3C14B 1IKWB 3T6BA 1FX2A 4YB1P 2AEMA 4B17A 2FDNA 2BRKA 4RX6A 3W60A 2Z2ZA 2DITA 4ZA1A 1FWLA 1VQ8S 2ZH6A 3NAHA 2P6TA 3Q2TC 3PJWA 1S9EA 1TKZB 5IFMA 3PW5A 3R6LB 1FXDA 5JMNA 4RNNA 2FLPA 1GXUA 1RWXB 4NMLA 3D0HE 3KJNB 2NQPA 4DV0F 4I7FB 3EPIA 2VBWA 5DETA 1FNOA 4DS4A 3NAIA 4PQAA 1IQZA 1KFDA 3JTOA 5K8OA 2Q1LA 3GCXP 4OYAA 1EIYB 4X4RA 4FS2A 1YDLA 2MZQA 5CD4A 3R2CJ 2APOA 2NUHA 2QA2A 3J7AN 3LH2S 4OHZA 1SV5B 5KFFA 2MQPA 2BJ9A 1T8EA 1DLOA 3UVJB 4CO1A 4QU6A 5DZ7A 1KQGB 2W1BA 3KLEB 2KM8B 1VK8A 1Y7PA 3NBPA 1JX4A 2QMWA 4WJBA 4L72B 3CDAA 5KG2A 2C2OB 2IBOA 2QMUB 1WEYA 2QFJA 3ZO7A 4DPXA 2P8IA 2BMBA 4OHXA 3OTCA 1MROB 3FQKA 2CZ9A 5IM0B 2DNLA 1PBUA 5GADU 1LWEA 4M5DB 3G8QA 3B78A 2H5JB 1C4AA 3WC0A 2BKNA 4RJVA 3KK3B 1J5OB 1N4LA 1REVB 2DPIA 2VPWB 2NUUG 3TVKA 4O0NA 3CDBA 1X31C 2GHWA 1Y4ZB 1RUSA 3KKFA 3L9ZA 3GCWP 2UP1A 5D15A 2XSFA 3THVA 5THWA 3D6TB 2G1DA 1N54B 4NCAA 3ISNC 3BPSP 1FFSB 3NGKA 2KFNA 3M2VB 4Q5VA 2R7TA 5HQLA 1WI8A 3CTRA 2GQ2A 2ALZA 1NDCA 3OJSA 4ZOSA 3RBZA 5HO4A 3HT3A 2A18A 1CJUB 1VLOA 3DGPB 3HFKA 4DX6A 3GR0A 1NJXA 3ZTOA 2DNHA 1E6VA 3DU6A 3ZTPA 2E5LF 1CQMA 4AUKA 2CWXA 1VLYA 4DV5J 1S1TB 2AD9A 1TKTB 2EG2A 2HHHF 4ZVFA 2M0GB 4DU7A 4LFBJ 1D9DA 4EBDA 1BLUA 3C66A 4M5KA 3TAMA 2I0XA 2V2ZA 3BM7A 2D3OR 1U47A 3IM9A 3PYFA 4WCEQ 4L3KA 4O3PA 5DM7Q 2OSQA 3KJVB 1RU2A 2XI2A 4CO0A 1QSLA 5KFHA 1FXLA 4MKVA 3GE9A 3AHPA 3BKTA 1Q86T 1XMOJ 3DMJA 5HSPA 1FJCA 4JBCA 2CQIA 1HPZB 4OI6A 1XTZA 4J91A 5AXKA 1G1XA 4EK2A 3KLGA 2PIIA 2V8PA 2VHGA 4OJGA 4U96A 2RSQA 3HKWA 3W3SA 2QYGA 1DQ9A 4IO1A 1U8WA 4K4WA 4EO6A 3ITHB 1U45A 4GRSA 2CVEA 2XC9A 1FE0A 1RWVB 4B3TJ 4B9NA 1Q79A 2HFZA 3CJRA 1KS2A 3HHLD 1IM4A 3BV8A 3GU0A 5IV3A 3SDEB 2DR6A 3B82A 1YZ7A 4W92B 1FWPA 2W25A 2LYVA 5FDLA 3RB4A 3OW2R 1GMVA 3K5PA 2CJQA 2MLZA 4NLRA 5KFTA 3OUYB 3M32B 1IKXA 3R5BA 4X4UA 4MIWA 1NPKA 3L3CA 4IRCA 4KHPJ 2MQ8A 4FYVB 2HNZA 4V1Ak 3EXCX 1PILA 4I6WA 4DQSA 2XZWA 2FD2A 4IG0A 3BB5A 4UY8T 2FC8A 2XO7A 2FLOA 5KFVA 3LWMA 1K47A 3A1YG 1RAGB 2M3DA 1TAQA 2CPDA 2QL9B 3EX7B 2IA6A 2BR0A 4Y2AA 3BR9A 2Z8QA 3TRGA 2OKQA 3W65A 4ZPVR 1N5VA 2ASYA 1UJ5A 4NZ6A 4NXNJ 4DJBA 3OXGA 3GONA 1DURA 4Q7AA 3HVAA 3FEYB 4L3NA 1E6YB 1X5TA 4CYUA 4F36A 2K7KA 5BYSA 4NLSA 5JVHQ 2OFHX 4CM2A 4P71A 2YQ1A 4HHJA 2O5DA 4QR1A 2JEFA 1UVLA 4GO5X 2FQQB 1PC5A 2PE8A 1NNDA 2Z30B 2EW9A 5A2QY 2Y1IA 4QYZK 4E0DA 3TA0A 3Q8UA 1LK5A 3QGGA 1UEVA 1QY7A 1YQHA 3P5TL 1HNVB 1SUQB 4OZ2A 1F60B 3FRYA 3IWLA 2DHAA 4YQWA 4OYBA 2XEXA 2XWXA 1X5PA 2YPZA 2F7VA 8RUCA 4QYRA 3H40A 4ANEA 2V9KA 2I5JB 2WVBA 1Q5YA 2PSZA 3M7VA 3FFIA 1RTJA 3Q83A 3DM2B 3MM7B 4ECZA 2LU1A 3A13A 2EFPA 1TAUA 3PRBA 3DOMB 5KFOA 4MK9A 2VBYA 2ABYA 2CQ3A 2ACMA 3G8TA 3N6MA 4U67Q 1N36J 2NXNA 3BO3A 2DJWA 2XMVA 5DQGA 1FK9B 1T03B 4Y2IA 4Q2LA 2HEKA 1S1VA 4JI4J 3RR8A 5F8HA 1F9FA 1CJTA 1JLEB 2JLGA 1H7WA 5F41A 4UOGA 2HWHA 4PAAA 8AT1B 3OR2A 2MQMA 4BDPA 4OI2A 3PTWA 3ISZA 3ICLA 1F5BA 5J2PB 2ZVSA 4DR2J 1RT6B 1KVIA 1WHWA 4CTAA 2AW0A 3N28A 2JRSA 1W2IA 5LM7E 2V4JB 3D7SB 5LSLA 1HNXF 3AD9C 1RWOB 3HMJG 1C0TA 4ZHRA 4NXMF 1ITPA 5I3PA 2CPXA 1WSRA 2EXUA 3HK2A 4O0IA 5BYRA 1F9EB 1BXNA 3CCJS 1JLGA 4JV5F 1RJJA 3MM9B 1D9FA 3V4IB 2BABA 1A6LA 1OIAA 4F4WA 1K1SA 2XI3A 5E3RA 2XY6A 3HI9A 1VJWA 1R8HA 4QZVB 3ENWA 4ZDNA 2QGFB 3OLAA 3TR5A 1UW9A 5FIIA 4LQ3A 3TA2A 1FJEB 4K4VA 2BM0A 2HQGA 1S9GB 2HYIB 4G1PA 4B9UA 4DG1B 3MCSA 1VJQA 3JQKA 4B3RJ 4ELTA 2AX0A 1HW8A 1UFKA 3BN4A 1IR1A 3PO4A 2V8GA 2AYMA 3H2LA 3D66A 3AH6A 4PYDA 5CYQB 4ID5B 2MHEA 4BC7A 4QPXA 2VG5B 1VDHA 4LR7A 1FEEA 4ZCLA 4OFZA 1QAIA 4Q45A 2COLA 4O3OA 5A6WA 1N32F 2IMWP 3EVWA 2A2CA 2DGQA 4Y2KA 1RB0A 4IUFA 2DK2A 3CJ2A 4WYLA 1RCOB 2UXBJ 1TL3B 5FLXU 1RT3B 3NOGA 2B4OA 1PYTA 5D0RA 1KD1T 4WTOB 4DR4J 2RUSA 2J76E 1T9XA 5KTQA 1X5SA 1U6ZA 4DV3F 1GMWD 2HNYA 4KFBA 1JLAA 3QLHA 2DD8S 2OMLA 3PYGA 2CDQA 3AFGA 4NX9A 4J37A 4F04B 2RF2B 4YY3J 2XS2A 1Y00A 4IG3B 2ASLA 1UKUA 1B7FA 2ZM6J 2Q3PA 5F9NA 4PRFA 4I2PB 1N5YA 2CQHA 3HPOA 4QU7A 5A8RB 1WC5A 3EXYA 2DGTA 2MKYA 4WFZA 5B0BA 2N3OA 5E3CA 4QBUA 3H4DA 4EFAC 3UNYA 4RW6B 1EKSA 4WP9A 5D4LA 4DV2J 1ZM3A 3QT7A 4KV8A 5EHHA 4NEZA 2F65A 3HVWA 1SH2A 3GJQB 1YRXA 4KE5A 4DQIA 2YNFA 3MR5A 4WKYA 4U8YA 1R0BG 5MLCV 4Z2XA 1BWVA 2WSCC 1OSCA 5KFUA 2GJIA 2SXLA 2YVSA 4RU2A 2QL5B 1X8DA 2BXJA 4P52A 4CWBA 5HJYA 5KG4A 1JKHB 4C3KA 4OX6A 4DR3J 2BANB 3RYLA 2C1EB 2HFVA 3R7SB 2ZNYA 4HDGA 2CQ0A 1AFJA 2X3DA 1HMVA 3KLVA 4ZVGA 1J27A 1ZA2B 2KN4A 2KI2A 3HDSA 4NLYA 2WB4A 5KFSA 2ZUAA 2HZAA 2NSBA 6FD1A 4HR2A 1LW2A 1SBRA 4W90B 3CJSA 3PKYA 4A48A 2B6AB 1BQXA 2FY8A 4IFYA 4DSJA 4I6YA 3MMCA 3E51A 3W2VA 1HQEB 2CPHA 5IQ6A 2C3YA 3KLFA 2IM3A 1HNWF 1F3FA 1S76D 5IT0A 3TP2A 2IJFA 4DV6J 2CPFA 4X4OA 2A10A 2R9LA 4WFXA 2Q43A 3MEGA 3V6KA 4AXJA 3Q24A 2YX4A 1NHUA 4DUZF 4XO0A 1C0UB 3CDUA 3TEHB 3PW4A 4O3SA 1S4FA 2YNHA 3I9ZA 4ILLA 2KB2A 1JXEA 2WONA 2K1RB 4JOUA 4DPWA 1RT1B 1Q7LB 4GKKF 2GIQA 3CXCR 2NREA 4ECUA 3VAIA 3I4HX 4XAKA 2NXEA 2VFRA 3JTNA 1HBUA 2E44A 2W01A 2MZTA 5E3PA 2QV6A 2MYFA 1SH0A 3GSIA 2CJYB 3W2WA 2X1FA 3QWPA 3UD3P 4N76A 1UW4A 1SQFA 3QRPA 4USIA 3M8RA 1FF2A 4FNIA 2HQFA 4LF9J 2BW2A 4UOHA 2JFDA 5ETRA 1FERA 1RGVA 2D41A 4R5PA 2WSEC 1HBNB 5K8MA 1VC6A 2VJUA 2GW8A 2DNOA 4HT5A 1U2CA 2M8HA 3NNAA 3SMZA 3R7BB 1QM9A 2VG7B 2MKKA 1TL5A 3TZZA 3VAFA 2HGLA 2FHMA 1SL1A 1U1NA 3OFGA 5RUBA 2DXFA 4H4MA 4Q0BA 1TUGB 3IR7B 4TKTA 5AT1B 4HEA9 4ZVQB 1UCNA 1VBXA 3RZAA 1RKJA 2HQ3A 2BJDA 4U95A 3R2DJ 4LSLA 3VAKA 3KUHA 4DPYA 4CO3A 5IT4A 1RI7A 6AT1B 2CPEA 2FJAB 1LQ9A 1S9EB 4MKBA 1OY6A 4WF9Q 2UUWA 2W8KA 4QIWD 5KOWA 4ERDA 1CC8A 1UP1A 3KG4A 2UVUA 3DLEA 2M9KA 1Q4RA 4OX8A 4FKXA 3N79A 1JB0C 3DN9A 3OVSA 1VC5A 3CCUS 4OX9J 2JLFA 1JLQA 3ILLA 2ACYA 5J2NA 3ETOA 2AIRB 4U9RA 2H4YB 1RKIA 1JWWA 2XMAA 1KQFB 3N5FA 5KFEA 4X4PA 3M6VA 1DLOB 3KHLA 3QIDA 4PUOA 3UN2A 2KO1A 9ATCB 1JJHA 3NBPB 3NS5A 4ZPDA 2FGCA 3KWMA 2XMWA 5HL7Q 4NA3A 5EWGA 1IQTA 2BKOA 4QQBA 4PXDA 2OD6A 1F1BB 3GMGA 3R1LA 3VAGA 3T5LA 3W62A 3QMQA 1LWEB 3SFGA 4LUBA 4NLQA 2HFNA 2XY7A 1VGYA 2MLXA 1YRTA 4YFUA 2W9AA 1S6UA 2B7BB 4DX7A 4X62F 2VU5A 3VF0B 4ZP9A 4TN2A 4YHHJ 2F4VF 3I0RA 3R97A 1X5OA 1RT2A 3G82A 1QJHA 4XIUA 2JSXA 4CP5A 4DL3A 3MFHA 3LGNA 3KMSA 4CLFA 3NEKA 3T1HJ 2F3JA 5IT9Y 3RRHA 1QAYA 1Y5LB 4BCAA 1NU4A 4WPAA 1QAJA 3F41A 2CUYA 5JUMA 1B0VA 1E6VB 4FYYB 1WC6A 4CI0B 3M05A 3HVTA 2RJZA 2GHPA 3A3PB 2XCAA 1CS4A 1YJRA 5KT6A 4Y6IA 7FD1A 3GJSB 3QBCA 2LXUA 4MKYA 3TW0A 3TAMB 1RHMB 2UUAJ 3TANA 1NLKL 4C0OC 1M1GA 3MPVA 2W9BA 2YNGA 1SI9A 3VR1A 3BSAA 2R7VA 2RB7A 3PG9A 4OLOA 4GC7A 1G3OA 3DMJB 2J0XA 4J9MA 2UV8A 5L46A 3OL7A 4AT1B 4J9QA 4FF4A 2FHOB 2KJVA 4CNZA 3KLGB 1FJGF 3Q86A 4WZQA 2E9ZA 2EFOA 2G4BA 4P7VA 3SCKE 4RNFA 1S12A 1JXLA 4QPTA 1OSDA 1X9MA 3EICA 2XZTB 5E3AA 3R3TA 3T1YJ 1KBRA 1XWLA 3CD7A 2MZJA 2OFGX 3B4DA 3FC9A 1TQLA 5KFQA 2WBRA 3MURP 4PYAA 4JI6J 4ECSA 4QWDA 2EC0A 1LEOA 2RUGA 4UW2A 1X4AA 1UFLA 5FDLB 1SQEA 2G0CA 2ATLA 1RP5A 1YKWA 4P2SA 4LQ9A 2IBKA 4JI8F 1UJ4A 2BUNA 3NWGA 1IKXB 5ETLA 1FTCA 2CJAA 2UVRA 2HNZB 1IR0A 1T9VA 4IG0B 3PIOQ 1NSAA 1KEKA 2E9RX 2A0FB 3T5KA 3PCOB 3VAJA 1H74A 2CPYA 2G0IA 5D77A 2HSEB 3QPIA 2IHR1 1N48A 3J7A1 4M5HA 4UF4A 1K0TA 4LF1A 5AXLA 4CYUB 3K5MA 2Z57B 4ELVA 1FNMA 3UNGC 4KT0C 1JLCA 1D8YA 4H4OA 2DIUA 3UN5A 4IRDA 3H98A 3S7RA 4LRCA 3J7Z5 2E1MC 3ET6A 4QWCA 3GIJA 3MUMP 2B3TB 1EQMA 4P7TA 1YK9A 1KQSR 3UDLA 2FPHX 1GXTA 1UZDA 1F9HA 2FVSA 5CYMA 1N0UA 4IFVA 4ATNA 4A4JA 4CO4A 4CO5A 4LIWA 3VZIA 4IH5A 3RB0A 3F56A 1AXQA 4JV2A 2CPIA 2QLXA 2W2QP 3G86A 4JI0J 2X1AA 4QYZJ 1R6YA 2V5HG 2MGZA 5LSRA 2ZOFA 2HW3A 2ZH7A 1P9YA 2FIUA 3FFIB 1JJCB 1RTJB 1I94J 3DLGA 2KFZA 4CZCA 3MM5A 4R8UA 2OEMA 3N0VA 3GFXA 1KSPA 3ZXWA 3HFVA 3ETMA 2D9PA 1FXRA 2A6OA 2ILZA 4ZPTR 1S1VB 3TEGA 1TFYA 1UFWA 5ETSA 4KGXB 1CJTB 2CQPA 3GIRA 1NZ8A 3BQ2A 3CDWA 4WTYA 2D7SA 3OR2B 3ZZRA 3A4TA 4YEAA 2OHDA 3DI6A 1H38A 2GV1A 1RU1A 4N41A 2C42A 3CJ0A 4WWSA 3MTJA 2OSRA 3AJ1A 4CTAB 3FZBA 4MIBA 4X64J 2YXLA 3BGRA 1S99A 1NK9A 4RU9A 1YZ6A 4GVBA 4OZLA 2YKMA 1F5AA 4F0KA 1Y10A 5GVQA 4L76A 1C0TB 4ZHRB 1H0HB 2XB2D 5K8PA 4USMA 3PR5B 2XYPB 4QWEA 3JXOA 2A1BA 4AL7A 4NLPA 1JLGB 3MEKA 2E5IA 1SC4B 4S0MA 2LQ5A 1UTAA 4M5MA 2FY1A 1PAEX 1X60A 2WVEA 2C22A 2QN6B 3D6FB 4OYXA 1SJ4P 2BE2A 1NMEB 3FRZA 2LLZA 1XJWB 3CJ3A 3PEJA 5ETPA 4LBIA 1R8PA 1H2TZ 3MCMA 4DV4J 2VV5A 3DLJA 3GSDA 1BGXT 1Y3KA 2PA8D 3IR5B 2PGCA 3OR1A 2R7RA 3DOKA 4ZLLA 1WC4A 1BMQB 5CH7B 2VPYB 2QA4S 1N5QA 2GNKA 2VA2A 2DGOA
chains in the Genus database with same CATH topology
1DBDA 4CO1A 4QU6A 3I96A 3MF5A 1KQGB 2HHWA 4DR2F 2HGMA 3TYTA 2QYCA 2W8LA 3HO1A 5E0OA 3KLEB 2KM8B 1VK8A 1Y7PA 3H20A 2V4RA 3RAMA 3NBPA 3BDPA 1JX4A 2QMWA 4Z37A 4AL5A 2E7XA 4WJBA 2YNIA 2W9CA 4L72B 3UR0A 3KHHA 4TY9A 4HT7A 3CDAA 5KG2A 5KFZA 5F3ZA 2IBOA 2HS3A 5E41A 2JWNA 2LECA 5DG7A 1WEYA 4LJMA 3FSIA 2QFJA 5HP1A 3IS9A 1CVJA 4FNHA 2JVOA 5T7LA 3PV8A 1X4CA 3C6UA 4YUDA 5D4NA 1VI7A 3BO4A 1DAXA 4G3IA 3OSPA 3SYZA 4OHXA 4D3HA 1XR5A 3OTCA 2RDJA 5JXSA 4LFCF 4DMZA 1MROB 3IGNA 2XMJA 2E5GA 1Q81T 3FQKA 3LWLA 1NH8A 5DS7A 3Q23A 5IM0B 5J2QB 2DNLA 4OHVA 4DPOA 3WDOA 1S6PA 2CQ1A 2DB1A 4WZMA 1RK8A 1LWEA 5GADU 2J7UA 2H5EA 4M5DB 3IWNC 3G8QA 3B78A 3H8YA 3CCMS 3TI0A 2QRRA 4PKDB 4Y0FA 2VQFF 1C4AA 5M2PA 3WC0A 4B9SA 1OWXA 3T9NA 2HNYB 2IRYA 3KK3B 4KFBB 1HI8A 2HWTA 3F73A 2OTLS 4Q8FA 1JLAB 3QLHB 4J5OA 2VFSA 1J5OB 3PJXA 4FF3A 5I42A 1C2PA 1N4LA 1REVB 2DPIA 2O3DA 2VPWB 2NUUG 4WU3A 2Y1RI 3TVKA 3QO9A 4NLOA 1CLFA 1K1QA 3CDBA 4ALZA 3SXLA 2GHWA 1HFEL 2HHVA 1Y4ZB 3KKFA 4CT8A 4ZVHA 2E5HA 1W25A 1VQOS 1TV6B 1K8AT 4HTJA 4C8NA 5LJ3Y 1DRZA 5HMZA 1UAWA 4B3RF 2UP1A 2XSFA 2WAQD 3KLHA 1RT5B 3THVA 2XY5A 5THWA 3CJKA 1OPIA 5AJ3F 2H9ZA 4A8KA 1N5YB 1FD2A 3CCQS 2FGOA 4WFBQ 2G1DA 4R25A 2LXIA 1N54B 2IC3B 4NCAA 3ISNC 3I31A 1S1XB 4G1QB 1KTQA 3M1VB 3NGKA 3M30A 2KFNA 3M2VB 4Q5VA 5E5NA 2R7TA 1WI8A 1KR4A 3AB2B 5KFIA 1MMNA 3CTRA 3MUVP 1U2FA 2GQ2A 4J9PA 2ALZA 5I3QA 3DLLQ 1KHVA 3OJSA 4ZOSA 1VS3A 3PEHA 4HH0A 5HO4A 2DO4A 3HT3A 3GIMA 2A18A 2R7OA 1L3SA 3NCQA 4DL5A 5HMXA 3HFKA 3I6PA 1U1PA 3GR0A 2AYEA 4K4XA 2HG4A 1NJXA 4ES3A 4BC9A 2DNHA 2XMTA 2MKSA 1FE4A 5U47A 1S72S 2V2KA 1RDRA 2AV5A 3IAS9 2UXDF 1L3TA 1E6VA 3DU6A 4XPEA 2E5LF 2V8HA 1HBOA 3AQOA 1CQMA 4AUKA 4FP9A 5KFAA 2VH7A 4ED2A 1VLYA 4J9LA 3MTKA 1UVIA 2ZE2B 3K8WA 4KV8B 5KG5A 2KYXA 1P1LA 3C6TB 2C2RA 3MI7X 1KLMA 1S1TB 2AD9A 1FKPB 1TKTB 2EG2A 2HHHF 4ZVFA 4MK7A 5J1PA 2HFOA 2M0GB 1LWCA 1ZAXA 2VFUA 1FRHA 1D9DA 4EBDA 3V81A 1BLUA 3T9ZA 2F8MA 3C66A 1X4BA 5J2MA 4RLEA 1U1RA 3DLBA 4LF6F 2MKJA 2YNFB 2UXBF 3TAMA 3KNGA 2I0XA 4MFBA 2HVIA 3BM7A 2D3OR 1U47A 4MAKA 1YJTA 3H2UB 3VQTA 3LANA 3UCUP 1WEZA 2Y1JA 5KG7A 1FEHA 2JZ5A 2NZ4A 1O5JA 4WCEQ 4MH8A 4O3PA 3RU0A 4DR5F 4F4YA 4PG6A 2Q79A 2VFVA 5DM7Q 3SV4A 2DNRA 2OSQA 3KJVB 2LEBA 2XI2A 3T1AA 1DZ5A 1GTHA 4CO0A 4M63A 3MR2A 1QSLA 5KFHA 3D2WA 1DHMA 1Q78A 1FXLA 5C25B 2PI5A 4F4ZA 3N6NA 1JK9B 4QR2A 1VQYA 4KTQA 1VRTA 2EKYA 3CWJA 3OFHA 5CZXA 3GYNA 2KYZA 2JX2A 3GE9A 3AHPA 2MXYA 4X2BA 1T3OA 2B5JA 4IOCQ 4ED8A 4IKAA 1Q86T 2MZ1A 1MU2A 3DMJA 1SJFA 2KT2A 3HHLA 3SQGA 2YWFA 4DFJA 5F8MA 5GMKa 1FJCA 2ZHAA 2UVWA 4JBCA 4MK8A 1ZOTA 3OL8A 2CQIA 4ICLA 3PFEA 4V19X 5HMWA 1HPZB 2VBXA 4YY3F 4DV5F 4OI6A 5LXRA 3E8OA 2GHVC 2DCLA 1XTZA 2BM1A 5AXKA 2RKIB 1DQ8A 4OZ5A 1G1XA 2ZM6F 1XERA 3KLGA 2PIIA 2XSJB 1R8BA 4EUVA 4LFAF 1HMVB 3CIMA 4OJGA 5A8WA 4LFBF 3IBWA 4ZCIA 2RSQA 3HKWA 3MM6B 3W3SA 4HYKA 3MR3A 5HROB 2D3UA 5KG0A 2AWZA 5KFRA 2X3GA 3QZ8A 1DQ9A 3DDNA 2DGWA 3OVAA 4RUAA 4EBCA 2HHPA 3CGIA 3QGPA 4IO1A 2OP5A 4PXBA 4K4WA 4EO6A 3ITHB 1IKVA 1LW2B 2PT0A 3H5UA 2MQOA 3GV8B 1RAJA 1U45A 2EK6A 2UUCF 2LEPA 3IC1A 3KLIB 2ZH9A 3MM8A 4X4VA 2CVEA 4TLQA 3A8EA 2XC9A 1HYSA 1FE0A 4IFYB 3DNCA 2B4PA 3MMCB 3Q8RB 5HBMA 5A6PA 1LW0A 4B9NA 1Q79A 2HFZA 2KDOA 4OI0A 1KS2A 2DR5A 3W2VB 4LSNA 3IFEA 2DR7A 1ZM4A 3KK2A 3HHLD 1IM4A 2XMKA 3DRXA 3KLFB 2DNKA 2UUBF 2Z0GA 2NS1B 1L3KA 3SDEB 3V6DB 3DLHA 2EBGA 4NCBA 3B82A 4LF5F 2XG8A 1CPZA 4TYBA 3U27A 4W92B 5G0RB 4Y00A 2W25A 4N5SA 2LYVA 5FDLA 1N0VC 3JSYA 2GX8A 2RS2A 2WOMB 3RB4A 2DNGA 3OW2R 3QJJA 2OLWA 4U7CA 3RW6A 2L3MA 2CPZA 3K5PA 2JC0A 1X4HA 2CJQA 3MEGB 3THPA 4ZPCA 4NLRA 3V6HA 3IG1B 5C24A 5KFTA 2AQ4A 3OUYB 4YOEA 4RWXA 3M32B 2OIHA 1PO6A 3GB0A 1IKXA 3R5BA 4X4UA 2IRUA 4MIWA 2ZJPQ 4DR1F 4KO0A 3MD1A 3L3CA 2YNHB 3OXFA 4A8SA 4IRCA 4C8KA 2XNQA 2HNZA 3EXCX 1PILA 4TLRA 4I6WA 4DQSA 4C8ZA 2ZHBA 2XZWA 3N4WA 2FD2A 1X7VA 3JYTB 3DC2A 2WONB 3BB5A 4IG0A 4DSEA 4C97A 4B3TF 3S01A 4UY8T 2FC8A 2XO7A 4ED6A 1U8SA 2FLOA 5KFVA 2HNDA 3SEOA 5AE3A 1WD6A 4J9NA 3LWMA 5J1EB 2ZD1A 5DQHA 1DTQB 2M5YA 4PG4A 1GQEA 4I67A 3FGVA 1HQUB 3A1YG 3JSMA 1ELOA 1HWKA 1SL0A 4ZP6A 4PQUB 1BY9A 2AP6A 1FHTA 2M3DA 4ECVA 4ECTA 4ZP8A 2RQ4A 3DRPA 1JLFA 1TAQA 2CPDA 1VRUA 3EX7B 1ZAWA 3M8QA 3EZUA 3PW7A 2IA6A 2BR0A 3K0JA 3RAQA 4Y2AA 3BR9A 2L9DA 2Z8QA 2EWHA 3TRGA 1HBUB 2OKQA 4KQZA 3RB6A 4Y65A 2OPSB 2ZHOA 3CO9A 4ZPVR 1RQ0A 2E1RA 1N5VA 1APSA 4K4SA 4WFNQ 1RTIA 2ASYA 3W2WB 2GIRA 1UJ5A 4NZ6A 1XMBA 1XC9A 1WF2A 4RW7B 3V5RA 1O51A 4DJBA 3OXGA 2Q6CA 4LMZA 2V4QA 4KBIA 4ID8A 5DO2A 1NK4A 1TFWA 1FRIA 1DURA 4Q7AA 3HVAA 5GAHU 3FEYB 3NLCA 2HHTA 2VOOA 2KRRA 1U6BA 4CH0S 4L3NA 1E6YB 1X5TA 2VUGA 4WFAQ 2K7KA 4TY8A 2MDAA 5BYSA 4RZRA 3N9UC 4NLSA 5JVHQ