1CVJA

X-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
169
structure length
169
Chain Sequence
b'ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*AP*AP*AP*AP*AP*AP*AP*AP*A)-3'
publication title Recognition of polyadenylate RNA by the poly(A)-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
total genus 36
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1999-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cvjA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cvjA01
2LECA 2XS7A 3UD4P 2DGOA 2KM8B 2XB2D 2JRSA 4UY8T 3NNAA 5GMKa 4W92B 2MKHA 2MZ1A 5FJ4A 2F9JA 3BO4A 5LSOA 1P27B 3JB9k 2VONA 1FXLA 3S01A 1X5PA 4CIOA 1RKJA 2LYVA 1YTYA 1NO8A 1YWXA 2CPJA 1Q81T 2DNQA 3ZZZA 2CPHA 2HGMA 1WF1A 2N3LA 3G9CA 3NS6A 1D8ZA 1X4CA 3CCVS 2X1FA 2AYEA 1P1TA 2DNKA 1FJ7A 1U1MA 2QA4S 1R8HA 1X4FA 1X5OA 4V19X 3N9UC 3HHNB 1B7FA 3B4MA 4BS2A 1SJ4P 5MLCV 2NZ4A 1X4DA 3TYTA 3CXCR 2DGVA 1ZZFA 1SJ3P 3NNHA 2M52A 5GAHU 2G0CA 4U67Q 1YI2S 3CC4S 4ED5A 1URNA 2LXUA 2MZSA 2N82B 2JVRA 4QPTA 4F25A 2D9OA 4PRFA 4IOAQ 3THPA 2E5JA 3VAFA 2MJUA 2CPFA 2CQIA 5GADU 5ITHA 1QVFR 2XNRA 1IQTA 3S8SA 4RU2A 1OIAA 1M1KT 1N52B 2MQNA 2J0SD 2M7SA 3FEXB 3CMES 1A9NB 1N54B 1WG5A 3BO2A 2CQ0A 4Y0FA 2DO4A 2E5IA 2MKKA 2MHNA 2CJKA 2DHAA 3G4SS 2UP1A 4CH0S 3U1MA 5GAEU 2DB1A 4YOEA 1HL6A 2DITA 2DH7A 2MKSA 1WI6A 1X4GA 4ZKAA 1FO1A 3THTA 2DNPA 2OSRA 1UAWA 1VQKS 1YJWS 3U1LA 4TLQA 2RS8A 1N8RT 1VQLS 1VQPS 2DH9A 2KRRA 5JVGQ 2YTCA 2ADBA 1K9MT 1X5SA 1U6BA 2DNZA 1U1OA 2L9WA 1M5OC 1UW4A 1SJFA 1VC5A 1HA1A 2D3OR 3LPYA 2DIVA 3CC2S 5LJ3Y 2DGSA 1M5KC 1D9AA 2MXYA 2JWNA 2DHSA 3RW7A 4TU8A 2DNYA 2ZJRQ 3CCMS 2KRBA 3CMAS 4CQ1A 1PGZA 1JJHA 2DGTA 4QU6A 3LQVA 2K8GA 2MJNA 3VALA 2OJ3A 3CULA 2HGLA 2MMYA 1SJQA 1KD1T 1O0PA 1JJ4A 2XNQA 1QM9A 2CPIA 3R1HA 2DGQA 2GHPA 3VAJA 4FXWA 1HD1A 3S6EA 2KG1A 4LMZA 4LJMA 2KVIA 3ZZYA 3NMRA 2A3JA 4OZ0A 1WTBA 5CXTA 2G4BA 2DNHA 5CA5A 3OW2R 4QU7A 1KOHA 4UQTA 1X4BA 1NU4A 2E5GA 1DZ5A 2OIHA 2CQ2A 2FC8A 3R1LA 2F3JA 2KN4A 4M5DB 3FEYB 2MQOA 2RNEA 4F02A 3MURP 4WKRA 2HGNA 3CTRA 2QFJA 2DNNA 2LKZA 2O3DA 5GAGU 3VAIA 2CQ3A 3VAHA 4WCEQ 4C7QA 2VODA 3UD3P 5DDRC 1DHMA 3MXHP 1VQ8S 3J7ZT 2I2YA 2MKCA 1SJRA 3IRWP 2KHCA 5GVQA 2DNLA 2KFYA 4LIRA 2MKIA 2X1BA 1YITS 1HD0A 2KG0A 1KC8T 2CQBA 2U2FA 2EK1A 2KXHA 5LXRA 2SXLA 2YH1A 2LA4A 2RRBA 5D78A 1Q86T 1UFWA 2M8HA 5LSLA 1VQ4S 2MSSA 2RU3A 3MOJB 2M0GB 3B4DA 2CPEA 3CCES 3UCGA 4WFBQ 2MY7A 2OTJS 2KI2A 1WHYA 1U1KA 1YJNS 1VBXA 3VAKA 3CC7S 2E5HA 1WHXA 2MQQA 5JVHQ 5H1SV 1F9FA 4PKDB 5DM6Q 5IM0A 2XS2A 3EGZA 2AYMA 2LMIA 1CVJA 1VC0A 3MUVP 4WFNQ 3CCLS 2L08A 1WEYA 1Q7YT 1WG4A 1YHQS 2M4MA 2MPUA 3SXLA 2DISA 2MSTA 2ZJQQ 2K3KA 2MZTA 1WF2A 3G8SA 1QVGR 2LQ5A 1BY9A 4CH1A 2U1AA 2G1DA 2D9PA 3CUNA 2MYFA 2QEXS 2DK2A 3S7RA 1DBDA 2B0GA 3R27A 3TO8A 3PIPQ 1NJIT 3IWNC 5LJ5Y 4PR6A 3CF5Q 3EGNA 1WF0A 4Z2XA 3NS5A 2KXNB 1H6KX 2JVOA 2RQCA 2CPXA 2RRAA 2M2BA 1K73T 3G71S 4TU7A 5HL7Q 2L41A 1VQOS 1X4EA 3CCSS 5LXYA 1JJ2R 2AYGA 2ZJPQ 2LEAA 2MQPA 3MUMP 4P6QA 2NLWA 1U6FA 2HVZA 2OTLS 5BJRA 1FT8A 1N88A 5DDPC 3MI7X 3PIOQ 2KT5A 4WIIA 2GO9A 2N7CA 4W90B 2MY8A 4J5OA 3UCZP 2MB0B 2M70A 4Y00A 3SDEA 1A7GE 2J8AA 1XN9A 5DM7Q 4YUDA 5D77A 1H2TZ 2KXFA 3DXBA 2CPYA 1UP1A 1WWHA 1L3KA 2MGZA 2M9KA 1X5TA 4WFAQ 5DETA 2LCWA 1H2VZ 2CQPA 1M90T 1FNXH 2XS5A 2YH0A 3UE2A 3I55S 3CCRS 3L3CA 3MUTP 5IM0B 3CCJS 2EK6A 2DNRA 1YIJS 2KYXA 4IO9Q 2HZCA 2PEHA 2RQ4A 2XSFA 2YKAA 1SXLA 1FJEB 1X4AA 2J76E 1ZH5A 1M5PC 1U2FA 1YJ9S 2LXIA 1OWXA 2E44A 2OSQA 3UWTA 3EX7B 1U1LA 2FY1A 3P5TL 1M5VC 3CCQS 3H2VE 4EGLA 4ERDA 4WF9Q 2KU7A 1VC6A 3Q2SC 1H2UX 2DNGA 3ULHA 2M88A 3K0JA 1S79A 2DGUA 4IUFA 3MD1A 3RW6A 3MDFA 3I56S 1WHWA 1R8PA 3P49B 2M8DB 2CQHA 2Q79A 4F26A 2V94A 1WEXA 1U1NA 3VAGA 2DH8A 2CPZA 2AD9A 3G8TA 5IQQA 3BO3A 1OPIA 3SMZA 2RS2A 2CQDA 2BOPA 2DGXA 2DHGA 1VBYA 2JX2A 2VOOA 3VF0B 4YB1P 3Q2TC 2MKJA 1OO0B 4A8XA 1VQ5S 2LA6A 2PE8A 3HI9A 2KM8C 2DO0A 2CQCA 2FHOB 3P3DA 1JMTA 2MZRA 3SDEB 1PO6A 1WI8A 4C4WA 1FHTA 1ZZNA 4C0OC 2RUGA 1KQSR 3J7YU 1U1PA 1KOOA 1WEZA 2DHXA 2MQMA 2ADCA 3US5A 2I38A 2DIUA 1X4HA 3P6YC 2X1GA 1DRZA 2MGZB 4IOCQ 3TP2A 5DDOC 1S72S 2EVZA 2YWKA 1U1RA 5CYJA 2DNOA 3MD3A 1VQ7S 2F9DA 2CQGA 5IFMA 2CQ4A 1G2EA 3V4MA 2DNMA 3UCUP 3VAMA 1VBZA 2KH9A 3D2WA 2ERRA 1VQ6S 4QQBA 3CCUS 5EN1A 2MZQA 3NNCA 3H2UB 2N3OA 1VQ9S 4FXVA 2FPHX 1U1QA 2LEBA 1WG1A 3G96A 1WELA 2CQ1A 2HYIB 1WHVA 2MZJA 5HO4A 1RK8A 2VOPA 2CPDA 2FC9A 1FJCA 5DDQC 1K8AT 1X0FA 3BS9A 1VQNS 2WBRA 1AUDA 3G6ES 2AYBA 2DGWA 2BZ2A 2J0QD 2X1AA 3DLLQ 4TU9A 2MQLA 3BEGB 3CPWR 4OZ1A 1Q82T 2RVJA 1VQMS 3CD6S 2RT3A 1W2BR
chains in the Genus database with same CATH superfamily
3ITHB 3DLJA 1HBNB 5AE1A 2ZNZA 2VFTA 5F8IA 1LWEB 2OGUA 2MKHA 1UVIA 2Y1IA 1FK9A 4DHVA 4R8UA 3NEKA 3ZZTA 1RAEB 3OFEA 4URGA 4RW6B 4OZ3A 4NCAA 1YWXA 2CPJA 2VG5B 1RJJA 5IQ6A 2DPJA 2WBMA 2OP5A 1D8ZA 3CCVS 5KFMA 3G6YA 3Q8VA 3EGVA 1F3VA 1NMEB 2CNNB 4G3IA 2KT2A 4MFBB 4DV2F 1ZZFA 2OPQB 2GCFA 4NLSA 4QPTA 1WACA 4F25A 3C3LA 3FRYA 3UN2A 1TQLA 4OJHA 1RHRB 1RKIA 4OYZA 3KDOA 2IC3A 2B9WA 4DV4F 2UXDF 2PT0A 2K3IA 1F2HA 1WG5A 1U24A 3BO2A 1X9SA 2HQ3A 3DLKA 3IWLA 5L9NA 2IRYA 1C0UB 4CH0S 3GYXB 1HL6A 4OFZA 5I42A 2OSRA 5KG0A 1VQKS 2HRYA 2E9RX 4TLQA 2GW8A 3MPYA 2YWWA 2FJEB 3MR6A 2OI2A 2XO6A 1QY7A 1SJFA 3H20A 2MXYA 1N34F 3J81Y 1QDUB 1RSCA 5T7LB 2XZWA 2XMTA 1TUWA 2A0FB 3NXZA 4KHRA 1EZZB 1KDNA 2JLFA 4P75A 3HP6A 2LQJA 3OBIA 3TAPA 2XULA 1U7LA 3VAJA 3IR6B 2V68A 5CYQB 2ZH7A 3BN7A 2C3UA 2VPWB 1KVJA 1SPBP 2UUWA 3HPOA 4WK1A 3CJKB 1LNQA 4USUA 2VPYB 4E2FB 2BKOA 2HRTA 2YKPA 1UVMA 2CQ3A 4HYKA 4C7QA 1RU2A 2QMWA 4J9PA 3IRWP 1LW0A 4MK9A 2CQBA 3HJVA 2LU1A 2X3DA 3EICA 4NLYA 4RBVA 1AZSB 2M8HA 3ELHA 4M94A 4LF4J 3H2LA 5KFRA 2XI3A 5AJ3F 1U0HB 1M5SA 4ZCMA 1UVJA 1DQ8A 5JVHQ 2HFZA 3D0HE 1E6VB 4PKDB 5DM6Q 4GC6A 4MTPA 1EKSA 2UXCJ 2BABA 4DV1J 4K0KF 3LWMA 1RDRA 1VHIA 2XG8A 1IKXA 4BDPA 4DPYA 3TI0A 3RBZA 4A8OA 3MEDB 4WBFA 2F63A 3BGRB 5L9XA 2QA1A 4LR9A 3R27A 4NXNF 2JFKA 5ETKA 2RQCA 5C2CA 1PSDA 1AYEA 4ED0A 2FIUA 3KLFA 1BQMB 1B64A 5ETNA 4LRAA 3SIPB 4KO0B 2D41A 4C8NA 2A6OA 5EDWA 4J91A 1FT8A 2HAIA 4HR2A 3UR3C 1S5ZA 4J5OA 2W9BA 2DVIA 3PFOA 3W8GA 3C6UA 1FX4A 4EEYA 4U96A 1ZTWA 3MPDA 1FVQA 5K14A 2WSEC 2HVDA 4DL6A 2OAUA 2B4VA 3FRZA 2W2QP 2V9KA 5FDLA 4B9VA 3B54A 1SL1A 1NSPA 3R5JB 3DHWC 3OL7A 1LWCA 3GSDA 4G1QB 3KXDA 1JLCA 4TLRA 2CUYA 5AXLA 3M6XA 3KHGA 3T5JA 3OTCA 4USJC 1IKVA 3GILA 1I94F 3F73A 1U1NA 2AD9A 5IC4B 1QE1A 2DD8S 4NLVA 2JX2A 1FNOA 2RDIA 2LXFA 4DCJB 2UVVA 2KM8C 1T9YA 5FIIA 4RZRA 4WP3A 4JI4F 2QMXA 4DN0A 1U47A 1UZDA 3WIVA 4GO7X 4XPEA 5IFMA 5L1LA 3B6BA 1DTQA 3QT6A 2CIMA 4AFFA 1VQ6S 2K2PA 2N3OA 1WSVA 4KQZA 1QUPA 4TYAA 4K7QA 3QT8A 2Q6CA 2CQ1A 5HO4A 1HMVB 5EGYA 3PKMA 3W2VB 5E2QA 3BS9A 4Y6IA 3R3TA 4NLDA 2CJYB 4AE5A 4X4RA 3AD7C 3H7HB 5ADZA 3X3UA 5IZHA 3KK3B 2KZMA 1MLAA 2HQDA 2JRSA 3JSYA 3H5YA 3TZWA 1FXLA 3OTEA 1BQNB 4E8UA 1UEUA 4CM0A 3PW0A 1RTHA 3JTOA 2QA4G 3CDBA 3HXMA 1XNQJ 5C25A 3OLAA 3MFHA 5H9EK 4X64J 3T5HA 1P1TA 2DNKA 3FCVA 1TZ0A 1FJ7A 4L76A 1B0TA 4ILMA 3PRVA 4I2QB 1CJTA 3H25A 1MU2B 1CJVB 3PR4A 3DM2A 1GQEA 2IVMA 1OY6A 2HFOA 1M1KT 2B9XA 2CJAA 1WC4A 2ZOMA 1S1WA 1PBUA 3W65A 2VG6A 1S6QA 4ZN3A 3G4SS 1T9UA 3MM5A 4M5DA 4QYZJ 4QYRA 1FDBA 5HP1A 1FK9B 4YB5A 4R8UB 2VJUA 3HSDA 4ECTA 3C14A 1FDAA 1SIZA 1RT7A 2IFXA 4FYYB 4DWIA 3LP2B 4Q8EA 3I82A 2H5JB 1RWPB 3CJSA 1CQMA 4LF8J 1GFWB 2DNYA 1EAYC 2R4FA 2Q66A 3RU0A 1TUGB 2QLXA 1T8EA 4DSFA 1M5HA 2G2OA 2WCXA 4DR3J 5K20B 1WDTA 1KN6A 1QM9A 2IC3B 3J81U 5F9NA 3HFZB 4IRCA 1WTBA 4JV5F 5F8HA 4WE1A 3FJ2A 5I42B 3IA0A 2KN4A 1RBAA 4CLSA 4CLUA 3CEDA 3FEYB 2MQOA 2ZH9A 3CTRA 1N34J 2G13A 4I0WA 4DFKA 4L3NA 1YRXA 2UUTA 4ZVHA 2MKIA 3HVWA 5IT4A 2F5GA 5LL6d 2WOMA 4XIUA 4LQ3A 3EZUA 4ZJLA 3QGGA 1TAUA 4LFAF 3TUZC 2HIYA 4MIWA 4O4RA 1HWIA 4CO5A 3KTQA 2ASDA 1F9FA 3AXKA 3EGZA 2R42A 2BACA 4O4GA 3VGSA 4P52A 4ZIVA 4RNHA 2BRKA 3KUEA 1JB0C 2NXCA 5EX3A 4B3MJ 2QEXS 2VG7A 2NCKL 1ZPWX 4Q44A 2RRAA 5B0AA 3K57A 4TU7A 3QO9A 5AJ3J 4EBDA 3ETMA 1OJ4A 2BJ8A 1IR0A 1LW0B 1UWBA 2QT7A 2IBOA 4DV0J 2OELA 4WIIA 5C24A 2BMBA 4NEYA 2QC3A 4Y00A 1XN9A 4K0KJ 1F9EB 3DXBA 3I9ZA 4ZK7M 3WX4A 3QJJA 2RAQA 3C16A 3T1YF 4ID5A 1SC4B 1UCNA 2RILA 2LDIA 4HLBA 4X4SA 3J7YI 4NXNJ 2B7BB 3U02A 4JI3F 4OX9F 2XSFA 1SXLA 5THWA 1IKXB 2CG4A 3SSSA 2KU7A 4O3OA 3ZZPA 3BM7A 1OSCA 2NYIA 3MDFA 4JOUA 4ZVQB 1BHNA 1U6ZA 4F26A 5E3CA 1PG5B 3KLFB 3M8QA 3SMZA 3OXFA 4RNFA 3KG4A 1XR5A 4KH1B 2PE8A 1HNIA 2JEGA 3H40A 4YEAA 3BZQA 4OX6A 5A8WA 2VC1A 2F65A 2FHOB 1J5OB 3C6UB 2VZ9A 3QBCA 4B17A 3KLHA 5L1KA 3IFEA 2ADCA 1KLMB 5K14B 1IBCB 5DDOC 2CQGA 3PY8A 5FDLB 4Q45A 1G2EA 2CWXA 4I68A 2I9SA 4XDDA 2PFDA 1RWOB 2DRBA 3VVUA 4ZA1A 1IQZA 1JLCB 1HLWA 3M8WA 3NAIA 4X4NA 3C2PA 1CPZA 3ENWA 3VR1A 2VPZB 3KLIA 1VQNS 2CVIA 2B8QA 2IJFA 4DOZA 2CRLA 1JK9B 1GX5A 4A8MP 4KGMA 2PO4A 4OI6A 1QE1B 2XI2A 3RB3A 3TAMA 2PSZA 4DR6F 4P7VA 5FJ4A 3K8VA 5KFUA 4X65F 4H54A 3LW5C 5M2RA 2VICA 2B9EA 4F36A 4L73A 2XYGB 5J2NA 5FLXY 1JLFA 2XSJA 4UF4A 4IH6A 4CH7A 1QAIA 3HZEA 1SJ4P 1DTQB 3TYTA 4F4KA 3KMQA 2M52A 1S1TA 1UA1A 3HHLD 2F8MA 1IQTA 1R8BA 3K58A 2KJWA 2J0SD 1S12A 1R0CB 3CJQA 3FDSA 4TVAB 2G2ZA 4KRWA 1HPZA 3MZIA 2DHAA 1NLKL 4WWSA 2RDDA 2DITA 4DX6A 2GIFA 1VK8A 1JKHA 5CCLA 1YJWS 1FX2A 2ASJA 2F7VA 2YX7A 4ZVSB 3DNCA 3TZXA 1X5SA 3KJVA 1KONA 3A8IA 1RTHB 1EP4A 3FZBA 5C25B 4P2SA 2BANA 3MMCB 3DGVA 2EG1A 1K47A 3UN3A 2UUBF 3NCQA 4AL7A 2MTLA 1R8CA 1S0NA 4GKKJ 5HBMA 4IR9A 1T11A 2CPIA 2GQ2A 2O5DA 2Y8YA 2KG1A 3EVOA 4LMZA 4LJMA 4DSJA 7FDRA 1S1WB 4TYBA 2J9DA 3DYAA 2VG6B 1S6QB 4UQTA 3T9NA 1F6TA 3S1TA 3MM5B 4LVNP 3I0SA 2VFVA 4M5DB 3L9ZA 5C7PA 5HP1B 4W4MA 4PZVA 3VAHA 4NOHA 2AX1A 3D28A 3C14B 4ANCA 1V3RA 3FNNA 3NWRA 1RT7B 2LA4A 3E01A 4Q43A 4XPCA 1SH0A 5D78A 1ZPVA 2BE2A 1XMQF 4ZPWR 2P9EA 3QAEA 4JI7F 1U1KA 4BWJA 2Z0GA 1K44A 4B9TA 1RAFB 3F44A 1RWKB 1SIWB 1NB7A 1T9WA 4IYQA 1PC4A 3K5NA 2LVWA 3MMAA 2NYHA 2R2RA 2B51A 2LQ5A 1L3UA 2R7XA 3TZZA 4NLRA 2KJVA 4DZDA 1XNRF 4PYDA 4Y28C 5LJ5Y 4WE1B 1RHMB 4PR6A 4YDDB 4DPUA 2GJ2A 2AYGA 2MQPA 4NLPA 2NLWA 3K5OA 3TVZA 3EXYA 4CO2A 1S49A 5KG6A 3UCZP 4CYUA 5HVGA 3BQ0A 4WU3A 4YHHF 2WOMB 3JXOA 1D0EA 3OFGA 4YUDA 1TK0A 1F2GA 1NKEA 3H4BA 4WFAQ 2G9OA 5I3QA 4I56A 1IJFB 2DEJA 1DLOB 5D6GA 5A2QU 3OUYA 3UE2A 3I55S 1U2CA 1K1SA 3CDWA 2IRXA 2EK6A 2YPYA 4IO9Q 2YKOA 3L95X 3D1OA 5KFOA 4CLWA 1RWNB 3D67A 1SV5A 1UA0A 1RBOB 2QL9B 3ENQA 4J9LA 4K8RA 1HBUA 1HNXF 4MT1A 4M5GA 4NLQA 3GIIA 7FD1A 2OUGA 4QZVB 2HLTA 1IKWA 3QO9B 2ZFHA 2KVQE 2MKJA 2HQGA 1UWBB 4CRJA 5KFSA 3D9BA 4OX9J 2ZM6F 2A1BA 4ETXA 1KQSR 5HN0A 2DIUA 2ASLA 2EVZA 3ETOA 5KFAA 2DNOA 3LALA 4ID5B 3BSOA 4KIAA 4UW2A 3PO4A 3P45B 2KH9A 5ETPA 2ERRA 4ANEA 3GYNA 1RT4A 2AJ1A 5DO2A 4FXVA 5AXMA 2VBYA 1KLNA 1U1QA 3R2DJ 4ICLA 4WXOA 4F3OA 3KDNA 5M2UA 2HYIB 3QZ7A 2ZZTA 2V50A 3M32A 2FC9A 3OL8A 1APSA 2JSXA 3PXGa 1TKZA 1S7IA 3M8QB 4GKJF 3FVYA 3GIJA 3L4BC 4KBIA 2R8HA 1FFGB 4J9NA 1HNIB 2R2UA 4C8ZA 4DLGA 4ZN1A 3BO4A 3S01A 3HSJA 5A8WB 4LBHA 3NGSA 2QSFA 2AJ4A 4YQWA 4JV2A 3KLHB 2FLPA 5A8KA 2GIRA 4KC5A 1B0PA 2GIQA 3PKYA 1PYSB 4Q8FA 1LXNA 4OZ5A 3QMQA 5KFXA 2WVFA 4MH8A 4ZPAA 1NJZA 5A76A 1JXVA 1UVKA 4LFCJ 2ZE2B 1JWWA 3NAHA 1FDNA 3SFGA 4QJVA 5FLXU 2PA8D 4YP3A 1IWAA 4CLPA 3KLIB 2W4CA 3M4XA 1JJCB 2YQ0A 2NUUG 3N4WA 2HAFA 4PABA 3PX6A 2MKSA 3TAMB 2IVYA 3Q0AA 1UW9A 1HARA 3IP0A 1D1UA 3CCZA 2RQMA 1RP5A 5DGAA 2R7QA 5GAGI 4FF2A 5J2NB 1JLFB 2XSJB 4QW9A 3NP5A 2HZAA 2KRBA 4CLFA 5F8GA 1H7WA 4DXLA 1IR2A 1GMWA 1PAUB 1D3WA 1HW8A 3EMTA 1S1TB 4X4QA 2QLBB 2BR0A 1ZM2A 2I8EA 1LFPA 3AHPA 3QSYB 3AXMA 2CA9A 1H3DA 3LO3A 4TY8A 1HPZB 2DNHA 2QJ3A 3OW2R 4QOTA 3DLGB 3ZTSA 2AGOA 1Y5IB 4P2XA 4WKRA 2LKZA 1JKHB 2O3DA 4JI6J 3C19A 2PMZD 3CJ2A 3Q8SB 3KJVB 3AT1B 2XY7A 1TMMA 3K89A 1EP4B 3AAWB 4GRSA 3HT0A 2MSSA 3QPIA 2BANB 1TUVA 5KFCA 1JNZB 2HLUA 2RSQA 5IT9Y 4XK8C 3N5FA 5HBMB 5C2GA 5KFYA 1S59A 1Q7YT 2XQCA 2B5JA 4ZS6A 4I6AA 4CLLA 4LFBJ 1V5VA 1FE4A 4CH1A 1RQ0A 3K5MA 2ZDPA 4P2MA 3CF5Q 3EGNA 3I0SB 1WOPA 1Y7PA 2E29A 3PJWA 4IH7A 1NKCA 2QG9B 5LXYA 4ED8A 2DJWA 4IH5A 1T95A 4DI6A 2L9DA 1S9GA 3NGTA 2XLJA 3AFGA 1KP6A 1AT1B 2LQ9A 4EO6A 5F41A 1WC6A 2BE2B 4USVA 2OD6A 3SSRA 4F3MA 2GQCA 3LAKA 3M1VB 1XNRJ 1KEKA 3RZAA 4OYXA 3PRBA 2GMLA 2ZITA 1TKTA 2ZZMA 2GHVC 2OSQA 3QJPA 3MMAB 3W5YA 2PI5A 2BE9B 3Q2SC 1J5EF 1OMSA 1EETA 1L3VA 1GK8A 5KTQA 1IJEB 5EHHA 4PEOA 2A6MA 4MAKA 3CDEA 1QAJA 5HLFA 1ZA2B 4IQXA 4ZLLA 4GC7A 5T41A 1VQ5S 3HFVA 1R0AB 1SVDA 3AQPA 2YPZA 9RUBA 4CYUB 4C4WA 4I67A 3SV3A 3GIKA 3Q89A 1FJGJ 3US5A 5AT1B 4F04B 2F8EX 4C3KA 4IOCQ 3FFIA 2XMMA 5DJBA 1N36J 1YJVA 1T3OA 3OUYB 4LF2A 4M5MA 4CO4A 1N32F 2HHVA 1R6YA 2B6AA 2W2PP 1VBZA 1XWLA 3DGPA 2MZQA 1RT1B 2PMHA 1DAXA 3C8YA 1HR0F 1SV5B 3GFYA 1HBUB 3ZC4A 3CIMA 1W7WA 2ZM6J 4DL7A 2E9TA 3AOBA 1R7IA 3UDVA 4O3NA 5HANA 1IKWB 1Y0HA 2BXJA 4F50A 4DBQA 3IGNA 1P9QC 1U02A 2BRLA 3GJQB 4M8LA 5KG7A 4PWDA 1CJKA 3FBEA 3I5AA 1NJXA 1SQEA 3GP9A 4LT6A 3I6PA 3G86A 3GIRA 2B7CB 1NEEA 3J7Z5 2AIRB 4C2MA 2KZZA 1HFEL 1RT4B 4CT8A 2MZSA 3D54A 3THPA 3VAFA 4OHZA 5HSPA 1REGX 4C48A 1D9FA 6AT1B 3M32B 2YNHA 1HNZF 1HNWF 2MKKA 1Q1KA 2UP1A 1TKZB 5BYSA 3QAUA 3AODA 5DRKA 5KG2A 1NK6A 4EYHB 4LF9F 2HS3A 3VQTA 5DG8A 3NGDA 3AD9C 4HDHA 2ADBA 2HMIA 2AZ1A 1U1OA 2MDAA 1PYTA 1S1VA 2D3OR 3KK2A 1JLAA 4DU8A 2JWNA 1ZAXA 2VA2A 3LQVA 4V19J 2HNYA 4X84A 1NPPA 2HGLA 3UDEA 1TVRA 2FQQB 4Y2KA 1NH7A 1JXLA 3L7OA 4C8KA 3R1HA 3PNIA 1UJ4A 3MR3A 4DR2F 2JJ4D 2A3JA 2ZBRA 1R31A 4NLUA 5DLGA 4ZCLA 4HL9A 2G4BA 3LF0A 4LF7F 4UT4A 4GMKA 3LGHA 4RWXA 5C42A 3LP1A 2HFUA 2ZHAA 2KL8A 4FXDA 1GEHA 2AT1B 3WZ0A 2QFJA 3LA0A 4LQ9A 3CDAA 4LSZB 4OYOA 2DNLA 4LIRA 2HWTA 2PMWA 1L3SA 1MWQA 2B56A 2RU3A 2C2NA 2GZOA 3G2XA 2FJVA 2EFOA 4USMA 4WFBQ 2KI2A 2HIQA 3J80Y 3A8EA 2ZH4A 5L46A 1VYAA 3PEHA 3RAQA 2XZDB 5IOLA 3OVAA 2FZCB 1SC1B 2W4DA 1IBMJ 3SXLA 1S0OA 4JB8B 2V4JA 5D0HA 4KR0B 2KTQA 3DOKA 3I5BA 5IT9U 5E7OB 3OTOJ 4ELTA 4QR0A 5KFLA 3A8KA 3CJ0A 3TQEA 5CD4A 4LF5F 2GO8A 2ZJPQ 2Z30B 3MUMP 1SH2A 5F3ZA 3TR5A 1MMNA 3F56A 1NUEA 3KUGA 3PEJA 1TKDA 1QTMA 5AXNA 2MB0B 3PW7A 1TMJA 1YJ7A 1UVLA 2G1HA 3R5GA 2ZD1A 4DFMA 3R7BB 2V4RA 4J37A 2W7OA 1DURA 1UJ6A 2C3OA 1LW2A 4U95A 2R7UA 2ZBIA 3EGWB 3L3CA 3Q8UA 3MUTP 2RF2A 3IXQA 4EI2A 4WU2A 2B43A 4DL0C 2B5JB 3SV4A 2NSCA 3EZ5A 2JNJA 3HD2A 3THVA 1VQYA 1S9EB 3VAGA 3RRHA 3G8TA 4EBCA 2BOPA 3QWUA 2DHGA 2AV5A 3MEGA 4F2RA 4GVBA 5E3PA 4I64A 5KAKA 4K50A 4FDFA 2J0XA 2JC0A 1JMTA 2OO4A 4B02A 5JJBA 4ATNA 4FNHA 4B9LA 4KGXB 2O67A 3MMBA 1N5TA 3DCAA 1JLQA 2XMWA 4FVMA 2WW8A 3K8WA 3LUYA 7AT1B 3RRKA 4QYZK 4N5SA 2EC0A 1TKTB 4ZCIA 3R8YA 2HVHA 3HSZA 4R0EA 1YQHA 2XHCA 1EETB 5J2PA 1Y00A 3ISNC 4LBIA 4ZLJA 2XZTB 5LT5A 2BKPA 3LP0A 5HLFB 4B9SA 1WKJA 2RU9A 4DV6F 5HJXA 3FBCA 4OX8A 4CM2A 2ZWPA 3NNAA 5F0WA 3K2YA 2D69A 1S4FA 2NXUA 1X5PA 5GAEI 2UU9F 4IG0A 4FYXB 1Y4ZB 1RI7A 5ETVA 1HR0J 4O0NA 2JEIA 4MKVA 4HT5A 3FFIB 1YRUA 2F4FA 1X4CA 4H4MB 2ALYB 2JZ5A 2K1RB 4ZPVR 1X5OA 3N9UC 3R5BA 5D4PA 1HQUA 2B6AB 1H74A 5HVHA 3MF5A 1NPKA 3DGPB 3CJ8A 3CC4S 2ZC4A 4AXJA 3O1LA 2NQPA 3HKZD 3HX9A 2MJUA 2CNKB 1OIAA 1D9DA 3W64A 2EWHA 1IBLJ 1A9NB 3KHRA 2CQ0A 3D3CJ 3ZZUA 1RZMA 1FO1A 3JS9A 3R5AA 2FVQA 4RUHA 2PA3A 4UZBA 3QGPA 4ED4A 1MNEA 2AWZA 3DRYA 1Q95G 2L9WA 2J6UA 1FRIA 1VC5A 1VJQA 3HLUA 5J2QA 1CJKB 4PWDB 1O6XA 2ZUAA 3IM9A 1M5KC 1VIOA 3UDCA 1A6LA 4EZ6A 1R3NA 2CDRB 3CMAS 4CLKA 2K8GA 2OJ3A 2MMYA 3TX0A 1M0SA 1XR6A 3MR2A 2IHR1 1XIQA 4A8WA 3IRXB 2YNHB 2BQRA 3FSIA 2Z8QA 2OIHA 1FXDA 1SJ1A 4DCPB 2MHEA 4ITSA 3GJTB 4O44A 2CADA 1G3OA 3J7ZT 1WNEA 2NUHA 1GH8A 3GTYX 3ADAC 4USHA 5GVQA 1VOMA 1RT3A 4ZITA 5L8RC 3OSPA 2YH1A 3DDNA 2V2QA 2D7SA 3KK2B 5CCMA 1SKWA 4OI2A 4DR2J 1KSPA 1U2RA 2VPXB 5J2MA 2ROEA 1TU0B 2CZVC 1T9VA 4LRCA 2HNYB 2UXBF 4ZPBA 1SUQA 1TVRB 1U8WA 2LMIA 3BYRA 3J81j 1KVIA 3NL0A 1WC1A 1SKSA 1NDLA 1VBKA 2DR6A 1DQAA 4KGZB 2Y0BB 3J80U 1BY9A 4ZIWA 1S1UA 2G1DA 2D9PA 3QRRA 2DK2A 1DBDA 1JQGA 3NS5A 1KTVA 5C42B 4KKOA 3E51A 3AQOA 4N7TA 4ED6A 3TEGA 5KFPA 3MCMA 1KQKA 1PYOB 2LU2A 1CLFA 2N7CA 4DSLA 2QLFB 2YWFA 2BVZA 5D3GA 1S6PA 2E7VA 1SI9A 5IT0A 1WWHA 1L3KA 2HBRB 5DETA 4K4WA 2FZGB 1FI4A 4RLEA 4TY9A 2PEHA 3HK2A 1X4AA 3HSGA 1LWFB 1FNMA 3JTPA 1U1LA 5DZ7A 1M5VC 3AD8C 4ERDA 1VC6A 2V4JB 1CBKA 3DOKB 3I56S 2Z56B 4OJGA 1OSDA 4DFPA 2X3GA 1RHJB 4P74A 2GGPA 2CQDA 1HHTP 4O3SA 1Z2ZA 3C15A 4PG4A 4DDFA 2LA6A 4J9QA 1S9FA 5HQLA 4JI0J 3GG1A 3T1HJ 1MSWD 5HMYA 2EEYA 3G82A 1MROB 2ZD1B 3QATA 2D3ZA 2W25A 2R7SA 4OYAA 2O1PA 2F9DA 4HACA 1LW2B 3O6QA 2CQ4A 1SKRA 5BYQA 3UCUP 1NXIA 3HDSA 3VAMA 5G0RA 2BA9A 2BE7D 1FRLA 3D4JA 1WG1A 3T5LA 2V2KA 3RJMB 4LREA 1R27B 1AFJA 2W9CA 1H73A 2VOPA 2CPDA 3NG8A 1FJCA 3M6WA 2V6AA 3BGLA 5GAHI 3EUNA 2BJEA 5KG4A 1I51B 3RUBL 1BC6A 4M5LA 4FYVB 2XS7A 2FDNA 3MEGB 4GVBB 2OHDA 3KLVA 4W92B 2BW7A 4LF4F 1QAYA 3OD2A 4CIOA 3HHLA 1FRXA 2LYVA 4F4XA 3ISND 2ZH5A 1G4CA 4RNOA 1JLQB 2UXCF 4DSEA 4DV1F 4F67A 3GJRB 3ZXWA 4FYWB 4RPFA 3B4MA 2FHKA 1MN7A 3WBZA 4I7FA 4NMXA 4OYMA 1SC3B 2YWHA 5A0YA 4U67Q 1FKOA 3OL9A 1PILA 5LMUJ 3ZZRA 4PRFA 4N77A 2YVSA 4B3TF 5GADU 3FK4A 4C6AA 5EWFA 2P6SA 1CJUA 2LP4A 1UTAA 4FF1A 3LP0B 2DH7A 9ATCB 1NK4A 5K8NA 1UAWA 4Q7AA 4ECQA 2R8KA 2DH9A 2RQKA 3A1YG 3PJ9A 2YTCA 1K9MT 2AJ2A 4IG0B 4TXSA 1HA1A 3CJRA 4USKA 3MAHA 3RW7A 1BMQB 4N8NA 3CCMS 1MMDA 2FJXA 3NWGA 2EI5A 1Q8BA 5A6WA 4OJ1A 3CWJA 4ECVA 3EPGA 5ETRA 2W8KA 3CMQA 2KVIA 4C8YA 4OZ0A 1S97A 2AEMA 4F4AA 3R1LA 3KLEB 2WVDA 4OYWA 1TK5A 4F02A 2Z57B 4RBUA 4NX9A 4DR5J 2CJQA 2E7WA 1SJRA 1C4AA 3R7SB 2AF6A 3D6FB 1N5YA 4IRKA 3TJ8A 3Q8PB 4K4ZA 4FF3A 4QIFA 4P9SA 2SXLA 3KNAA 5K8PA 5J2QB 5DQHA 5K8MA 2YY3A 2QIFA 4Q2LA 2D74B 2HQCA 2C2EA 1XEZA 3IBWA 3CC7S 2MQQA 3J7AN 4YFUA 3RB6A 2AGPA 2L08A 3K59A 4WTOB 3VQSA 4LSLB 1RYSA 4X4TA 3W5ZA 3DRRA 1WF2A 4K4YA 4Z2XA 4K2JA 3Q23A 1WC3A 1NPRA 4X4OA 3GIMA 2R2TA 4IO1A 3DMJA 2FZKB 4O44B 1TFYA 1KVKA 2ASYA 2LEAA 4Q0BA 1RWUA 2F1FA 3NCRA 2FJAB 1XNQF 2BEFA 2JEFA 1NK8A 4U7CA 2VUGA 1RT3B 3PM9A 1CQNA 1C4CA 2GO9A 3M30A 1DJ0A 2MY8A 3M2UA 2HHXA 1WKLA 1WDDA 2CPYA 3M2VA 4HKQA 1UP1A 4OMFG 2QMUB 2MGZA 2OPRA 1D8YA 4HT7A 3RTVA 5J2MB 1OYDA 1H98A 3QT5A 4UY85 4AL5A 3Q24A 1SUQB 1S10A 3IM8A 1YVFA 2JEJA 1FJEB 4DZ6A 1ZH5A 3RB0A 3AOAA 3CCQS 1HI8A 4Z7CA 1IXKA 3MEEA 1YRTA 4PG6A 4X66F 1S1UB 4U7UK 1T0TV 1I1GA 4CZCA 1OQ3A 3PX0A 1IM6A 3O8WA 4KKOB 3UPFA 2JL9A 2DH8A 4F2SA 2P2CB 5D4LA 1LKZA 2VU5A 4NZ7A 4L3KA 1VBYA 3BSNA 4YB1P 4PG7A 2BKNA 4DF8A 2ZWOA 4LF8F 4RKUC 3IAS9 4HVZA 4C9DA 5D3GB 4B3OA 3HD1A 3RBXA 3A3OB 2X1GA 1DRZA 4QWAA 4DR3F 4QWBA 1Q5YA 4USWA 1JLEA 2XY6A 1TP7A 3K5PA 4M5JA 5DG9A 3GFZA 4QWEA 1RGVA 1HKAA 5F8LA 4KB7A 1WSRA 4IFVB 2KM8B 3C15B 4PAAA 3UFCX 3KJFB 4KPCA 3VGUA 3GPAA 2DKOB 1T02A 3UW1A 1RCOB 3ZZZA 3G82B 3FKBA 3KNGA 4XAKA 2J7KA 2X1FA 3BB5A 1LV5A 3MWBA 1U0SA 4CNZA 4ES2A 5G0RB 2EKYA 4ED3A 4FBUA 3BDEA 4B3MF 3MPUB 4ED5A 5EWEA 4HTJA 1P1LA 3LGNA 1O5JA 3S8SA 2PC6A 4ZP8A 2W9CB 1JXEA 3UDLA 3U1MA 4DV0F 4R25A 1WI6A 2Z2ZA 4J9RA 1FRHA 4Z37A 2VQEJ 1N8RT 2DHHA 4MKAA 2NSBA 1YBAA 3HHLB 4KYZA 1NK9A 2WZ1A 4ER8A 3QYYA 3ILJA 3V6HA 4DR7J 2CXEA 4KE5A 4B3TJ 1MN9A 4R5PA 4J9UE 4JI1F 4LRBA 4KFBA 2XO7A 4U7UD 1JJHA 1FWKA 2EXUA 2MKYA 4I7FB 1MWZA 2L3MA 4EUVA 5A0YB 1FKOB 4QIGA 1TK8A 4QR1A 1PCAA 2WTFA 2LEPA 2LFVA 4JI5J 3PVXA 1IKYA 1CJUB 4DCOB 1H38A 3UVJA 1GTEA 2QFIA 4QU7A 1H72C 4DPWA 3JYTA 1CC7A 1CS4A 3M8RA 2VJVA 2R7WA 2K06A 2GV1A 4A47A 4ZVEA 3KJQB 3SCIE 2VODA 1DHMA 2QL7B 2HK3A 4F4YA 4DF4A 1TKXA 1ZAVA 2IJNA 1LXJA 1XTZA 3D3BJ 3L7PA 3U7JA 4YS2A 2NR0A 1UFWA 4USIA 3BR9A 3B4DA 3CCES 2MQ8A 4NLGA 3HZGA 4ZVGA 4USTA 4DR1J 1WUUA 1ZM4A 2R7OA 2H51B 4XO0A 2WONB 3M2RA 3ZZOA 5B09A 2YNFA 4E0DA 4MMOA 2WK4A 4QWCA 4ANDA 1WEYA 1LK5A 4B9NA 1S7HA 2VBXA 2X7IA 1EX8A 2C2DA 3SCJE 2JVOA 2CPXA 4U6PA 4YDXA 4J9VA 1N88A 2YXLA 4RW7B 1K0TA 1TV6A 1S77D 2FUG9 2XYHB 5IWAF 2OEMA 3QIDA 2M5YA 5E3RA 4ZP6A 2EBGA 4CNYA 1T03B 1HQEA 4FNIA 4RW8A 4YY3J 3BYPA 5H9FJ 2CQPA 4WTYA 1NKBA 2I0XA 4ZVRB 5ETOA 3MCSA 4LSNB 1N4LA 3FGVA 2YKAA 2DR7A 2RHQB 1YJ9S 2IYGA 2H65B 1HWKA 3B78A 1U49A 3HHLC 3EX7B 5A8RA 3M8PA 2WVCA 4ZHRA 1H2UX 3DRRB 3GYGA 2PEBA 2OPSB 2DGUA 3TARA 3TA2A 1RE1B 1N33J 1CC8A 3TAQA 1NH8A 4ED1A 5KFJA 3DMJB 2WSCC 2YNIA 2NS1B 1KHWA 4QIVA 2QL5B 4CO3A 3M8ZA 3AH6A 1C1CA 3M9NB 2RH3A 3BBBA 3MAAA 2DO0A 2GVDA 3M30B 3MCNA 5HMWA 1QSLA 1WI8A 2DCLA 1YZ7A 3SQOP 3KUHA 3J7YU 4NYZA 1SKUB 1RTZA 1WEZA 3M2VB 3G87A 4OZJA 4GKKF 2MGZB 2OPRB 3CB4A 1UJ5A 3TEHB 4X66J 4DR4J 2FLNA 3AJDA 4EK2A 3KLGA 5IV4A 3PHEA 3NNCA 5I3UA 5A6PA 5B0DA 1TL1A 3SCLE 2ZH8A 3MEEB 3NBPA 1RK8A 1X0FA 3HVTA 4MK8A 1TL7A 5E33A 4ZVOB 3M8SA 2DGWA 5E41A 4YMEA 4S0MA 2DGOA 3CDUA 4UY8T 4C98A 2BW2A 3EVWA 2OLWA 3GCWP 5KT7A 4WK3A 1Q81T 2XGQA 5EUHA 2V5HG 3DLKB 3ISZA 3ZZ0A 4B3OB 1YBUA 2H1YA 1F1BB 1SBRA 1UL3A 3GR1A 1C1BA 3QLHA 1NRKA 1FKPA 5DG7A 5F8NA 4GO5X 4OX7A 4AQYJ 4EZ9A 2FD2A 5KFDA 2JVRA 3RAXA 2Y8WA 2GX8A 4IOAQ 1IBKJ 2BDPA 1QVFR 1S57A 2I5JA 4RW6A 2EKNA 3FEXB 3Q83A 1N6QA 4Y0FA 1UZHA 4L75A 1VJWA 4YOEA 4ZKAA 2OEKA 3U27A 2DNPA 4IRDA 2VA3A 3MCOA 2COLA 3ZFVA 4DUYJ 2OFGX 2DNZA 8RUCA 5D15A 4WKYA 4ZCKA 2Y9HA 3PYEA 2BQUA 5LJ3Y 2HZVA 3FC9A 4A8SA 1YJTA 3QT7A 3DLEA 2A2DA 2HNDA 4WZQA 2XHWA 1R8AA 1HQ2A 4LVOP 1FEHA 4B9UA 2V34A 5B0GA 3D66A 2DGQA 2FVCA 4FXWA 2P9GA 3ZZYA 4NYOA 4AXIA 1XR7A 3AJ1A 3IGVA 2EFNA 3D7SB 1U09A 1NU4A 1DTTA 4PWUA 3HFKA 3BKUA 4JYAJ 3W7BA 4TN2A 4QPXA 3DLBA 3B82A 4JI1J 1KS2A 3IG1A 3NS7B 2UUAJ 4A8YA 2RKIA 2IMOA 2HG4A 1HD0A 3RGIA 2U2FA 2EK1A 2H54B 4YR2A 4DPTA 3I9V9 3UCGA 5DGBA 3LTOA 2ATCB 4R5PB 2J9EA 4H4KC 2LLZA 4RNMA 3Q8YA 3DU5A 4KFBB 2HQIA 3H4DA 1KRPA 1YJNS 4DU7A 1P8GA 2WAQD 4NEZA 4NI2A 2EBEA 2E5HA 5EWGA 2QLJB 4ETZA 2QO3A 3BQ1A 2XS2A 1RT2A 5CABA 2W9BB 4WFNQ 4WFYA 3QZ8A 1IKYB 3BH7B 5E3AA 5KT5A 1RAGB 4JV0A 3HHDA 3I32A 3DU6A 2B3TB 2KXNB 2VKZG 1CS4B 4BC7A 4NCGA 2ZBPA 1LWCB 2DXDA 1H0HB 5LOQA 2N7YA 1FF2A 1TKXB 1E6VA 5SZTA 2Q3PA 5HJYA 1IKVB 3C46A 2J8AA 3CVKA 5D77A 2XYPB 2XLKA 3I4HX 1H7XA 2EW9A 4LRFA 4UZCA 1SC6A 3CCWA 4LFCF 2C2MB 1FD2A 3DI6A 3PRDA 3M2RB 2V69A 3EDQB 2W8LA 4E98A 3CD7A 1GX6A 1U45A 4DL3A 2VQFF 1FWPA 4BWMA 5HMXA 2R7VA 4O0IA 2ACMA 5BR8J 4M63A 5IWAJ 2YNGA 1VIXA 3I0RA 3CGIA 2RHSB 5DZ6A 1OYEA 3IR7B 3VHQA 4KHPJ 4DX5A 3TRGA 1VHFA 1YK9A 3FQLA 3VGTA 5D4NA 1GXLA 2Y3YA 3I5CA 1OPZA 4PYAA 3EE3A 2CQCA 1TV6B 3H59A 4C0OC 3DRXA 4DS4A 4LRDA 4LF6J 4DL5A 4RW8B 4HHUA 4AUKA 4QR2A 4F8RA 4K5RA 1FD8A 2DR5A 2J9CA 4K2XA 3V4MA 5CD4H 2ATLA 3OPKA 3SSQA 2V8VA 1IWGA 3WC2A 5A8RB 4TKTA 1ZETA 1LOUA 4ZHRB 1SH3A 2Z2YB 4DX7A 3CO9A 2AJFE 2MZJA 1VRQC 3PDNA 1HBMA 1NHVA 4WFXA 5HATA 4JI6F 4M1KA 1CJTB 1RTDA 4OZ1A 5JUMA 2AX0A 3IS9A 2YNIB 1XC9A 2CG8A 1C1CB 3DM2B 3DHXA 1REVA 2POKA 1NJWA 3MAAB 1FKAF 2XMUA 1WC0A 2GVDB 4JI2J 1RKJA 2R7RA 3CO0P 2QA2A 3WC0A 4WFZA 1NDPA 1N5VA 3HM9A 1WF1A 2BJ7A 2V8HA 3FZ2A 4Y2IA 1OY8A 1J27A 1CSJA 3R6GB 1HMVA 3W63A 1X8DA 1Q5VA 2OMOA 1X4FA 2QRRA 3HHNB 4AL6A 5G4DA 4LBPA 3KLGB 1Y11A 4LFBF 2C22A 2AKWB 1HIYA 3EWGA 4FP9A 1F60B 5I3UB 1XQIA 1TL1B 2R9LA 4PQUA 5ITHA 2BJ3A 3NBPB 3M05A 2M7SA 3FCWA 1BD6A 4WXWA 3BKFA 4RW9A 2DB1A 2C28A 3FCHA 2H4WB 3ET6A 1RLDA 1X4GA 1NNDA 5K8OA 1G7CB 2FB0A 3NLCA 5ETMA 3V81A 4IG3A 4ZPTR 4M5HA 3MM6A 2EC2A 4UOFA 3ZTPA 1AFIA 3PFEA 5F0UA 3OSNA 1C1BB 2E7XA 2Z4PA 4FN5A 1PGZA 3DC2A 1BGXT 4QU6A 5CAAA 2BUNA 1FFWB 2G2YA 3KYLA 2R8IA 3QQCD 2I5JB 2ZBQA 1VGYA 4K4TA 1N6QB 2ZH1A 3TZYA 4OIXA 1X4BA 3LP2A 1Q78A 1RWVB 2F3JA 1X7VA 3CW2C 1N0UA 2M3DA 1U26A 2Q43A 2DNNA 5GAGU 2ILZA 4O4GB 3OV7A 3UD3P 1FJGF 1HNVA 4RUAA 4K4SA 1NHKL 2B4PA 1N36F 2VG7B 3BR8A 5L39A 4O3PA 5ETSA 2HFNA 3OT9A 1UEVA 4J90A 1MG7A 2M0GB 2ZOGA 3KFWX 3HKWA 1WD6A 2VASA 3OXLA 3DLEB 3CE8A 2HNDB 1NDKA 1V5IB 1SB6A 1RHQB 4N41A 2GQQA 1RWMB 2N4CA 4L6V3 2AYMA 4PG8A 5C24B 2H3EB 1RCXB 2GJIA 5KFEA 2DISA 2HHQA 2K3KA 2MZTA 3CCTA 3HO1A 4F0MA 2QZ8A 3C16B 3FEZA 2B0GA 1DTTB 2O01C 1RA7A 1GAOA 3P8BB 4HHHA 4ILLA 2R7TA 1G6BA 4P6QA 3IG1B 1WOSA 5LSRA 2RKIB 4OYIA 2IDEA 8ATCB 4C97A 2C2KB 4NYPA 3O5TB 3TUPA 1KHVA 5SUHA 2F4VJ 3M6VA 4RR5A 3W9JA 5B08A 3DXSX 1M90T 2ZHBA 4NI2B 2WSFC 1W26A 3W5XA 2ZH3A 1RT2B 2EFQA 3D6TB 4WZMA 2XC9A 1R0BG 1RHUB 2HKEA 2IA6A 4KGVB 3KOAA 2I1RA 2EPIA 4WF9Q 3PW5A 5GMEA 2OPPA 1UVNA 5KG5A 1S79A 2FGCA 1FXRA 2M8DB 2AU0A 2E9ZA 2CQHA 3HHKA 2Q6BA 4N8OA 4MK7A 4NCGB 4CDIA 5KT6A 3EVMA 2PGCA 3BQ2A 1TL4A 4UOGA 4NLXA 4LIWA 3GV7B 1ZZNA 1VMBA 3TUJC 2YQ3A 1X4HA 4QBUA 1B7YB 4ZPDA 2QTWA 2VQFJ 1U1RA 1DQ9A 4B3SF 2DYAA 3DI6B 4L72B 2BYCA 1XMOF 1QJHA 1B99A 2DNMA 2VBZA 1NJYA 3RRGA 2HURA 5U47A 2E1CA 4OHXA 1L5UA 4KY3A 2FPHX 1GNKA 4ELVA 2Y1JA 4YR3A 4Y2MA 2IIHA 1WHVA 2CJBA 1KNZA 1J5OA 1PJ6A 4D3GA 2YNGB 2W2MP 3I0RB 2FJWA 3CPWR 1Y3JA 2CNLB 5F8MA 1KLMA 3NGUA 1VI7A 3CD6S 3SI8A 3IBCB 1O8BA 2KFZA 3MM7A 4DFJA 1PJ7A 3UD4P 4WPAA 5GMKa 2F9JA 3KG0A 3JB9k 3T41A 4DL4A 3EPIA 4WJBA 2FYXA 2FHJD 1E6YA 5KFKA 1ZOTA 2K7KA 4PUOA 4KHMA 3HHEA 1N0VC 1U1MA 1S1XA 3IAM9 4QCLA 1IBMF 2J9DE 3D5MA 1ULRA 3CSKA 2QX0A 5CH7B 1B3TA 2DGVA 2E66A 3P4UB 1SJ3P 1AA1B 4DV3F 2IAJA 3DDIA 2HWIA 1M1HA 2D9OA 5F3TA 3OTOF 2EFGA 4AT1B 1HBMB 1WORA 4OV6A 1U25A 1DY3A 2E5IA 1RTDB 5HI7A 2OKQA 3IS9B 2ZKTA 2UUCJ 4ED2A 3THTA 1EKRA 1REVB 2XCAA 2F8HA 4EFAC 1Z2LA 4URQU 1VQPS 1YZ6A 3V5RA 2OFHX 3PACA 3OLBA 1HW9A 3DYAB 3N01A 2IPOB 3LPYA 4BHQA 4TU8A 2XTJP 3X1LB 2GS8A 4JBCA 4PXCA 2YBVA 3OFFA 3GJSB 3EXCX 2NXEA 3UR0A 1VRUA 3CULA 3PW2A 2E5LJ 3E01B 4PQUB 1YJRA 1F5CA 1PBAA 3NGKA 3CJ5A 4IDKA 4RW9B 1DZ5A 4JI8F 2FC8A 2HHPA 2ZOFA 4H4OA 5B0BA 3I31A 3ET6B 1NB2A 3MMCA 4NZ6A 4DV7J 1IN0A 4ZVPB 3QJLA 4DJBA 4KTQA 1GT8A 2DXFA 2DY1A 2KHCA 3NCPA 4DQQA 3OXGA 4C3MA 3V81B 2ZZNA 4IG3B 2KG0A 3M9OB 3GB0A 3MM6B 4MJKA 2LDYA 5IV3A 2RRBA 4CWBA 3TNVA 2C2OB 1AW0A 2CPEA 5B0EA 2HBYB 5KG3A 4EWTA 3PX4A 2OTJS 4QIWD 2YQ1A 4CP5A 4K59A 1LFWA 3QRQA 1F5AA 2HHUA 3A4TA 1CEZA 1FFSB 1Y3KA 4YB6A 4DUZF 4OZNA 2YWEA 2J6SA 4OI3A 3GE9A 4DV2J 3FMBA 3KG1A 2YKNA 3PHTA 3QWPA 3S7RA 1HWLA 3OJSA 2B4OA 1H6KX 1R6VA 3OTBA 4DV4J 2UXDJ 3GCXP 3NOGA 2L41A 3JQKA 5HK4A 2G0IA 2ZH6A 3MGJA 2DEIA 2R3VA 1HNVB 1FRJA 5BJRA 2BQ3A 5DDPC 2IA0A 3LWLA 2CFXA 1WTFA 4C8OA 2M70A 2XLIA 1Q53A 2HEKA 2KXFA 4N76A 1K0VA 2LCWA 1H2VZ 2VL1A 1L3TA 2DR9A 2XS5A 2YH0A 4KH0B 1IBLF 3KWMA 4OI1A 2DNRA 1YIJS 2KYXA 3MM8A 2NXNA 2J76E 2E44A 2ROPA 2HHHF 4RWWA 3P5TL 4EGLA 2AZ3A 2DNGA 3ULHA 2C3YA 2M88A 3JSMA 4IUFA 4C11A 3RW6A 1WHWA 3MMJA 5CZXA 2Q79A 2D1CA 2BOAA 3BO3A 2E1RA 3BPSP 3PO5A 4ZP9A 3POTA 2W7PA 3Q2TC 4CLZA 1I6JA 4ICLB 3W1YC 1DLOA 3K7RA 1RTIA 5BXIA 3HI9A 2FLOA 3OL6A 3GV8B 2MZRA 2Z2MA 2HWHA 3TOQA 1KOOA 3P5BP 1TAQA 2HHSA 4LUBA 1TL5A 3UN5A 3MD3A 1X0PA 4ZMMA 1RT5A 4WIQA 3TJ9A 1HI1A 2Z2LA 4RNNA 4NA1A 4N56A 4F0HA 3HJFA 2KDOA 3AB2B 3WDOA 2C3MA 2V67A 1ZYQA 1FRMA 2ZC3A 4V1Ak 5A8KB 2XMAA 3FQKA 5A2QY 4PXBA 2OPPB 4ES3A 4ELUA 2JC1A 2VV5A 2MEWA 3KK1A 5F8JA 4ZPCA 4ED7A 1UFKA 3G6ES 1YX2A 2DCUB 2HFVA 2BZ2A 3MECA 3E3XA 3DLLQ 3CJTA 1VDHA 3QFHA 3R97A 2CZ4A 4B3SJ 1XMOJ 1P27B 2QLWA 3TQ1A 2ROGA 4X4PA 4K5SA 3IO1A 1QTNB 1ITPA 4RW4A 3NY0A 2GNKA 4HH0A 3BREA 3JQJA 2AYEA 3GQCA 2QA4S 3T1AA 3WQPA 2DPIA 3IN5A 1B7FA 3QRPA 5MLCV 1X4DA 1URNA 2E5JA 3TVYA 2PDAA 1BLUA 3O3LA 1PIEA 3CMES 4X62F 2W1BA 2MHNA 2DY9A 3C6TA 5GAEU 2IMWP 3MM7B 4UQGA 5MAOA 4OYBA 1UKUA 3E2EA 1FE0A 3U1LA 2RS8A 1I94J 4CCHA 2HVEA 3TX8A 4OHWA 1O51A 5JVGQ 1E6YB 3JAMY 4TY8B 2UVWA 2EFVA 1M5OC 4DV3J 2ZE2A 4ZLNA 1VFJA 1UW4A 2VBWA 4J9KA 4FKXA 1HWJA 4PUOB 1P6TA 4A8FA 5HVFA 3LH2S 1D9AA 4XTTA 1S1XB 5I3PA 5LM7E 4MYUA 3RBDA 4JI4J 2J5AA 2JOQA 4Y34A 4ZOSA 4AD6A 2IAJB 1LWXA 1Y10A 5T14A 5GMDA 3NMRA 1PC5A 5KFTA 2BV3A 4Y65A 3I87A 1KOHA 3IC1A 3IR5B 4B08A 2DRDA 3QFWA 1ELOA 2NPFA 4JI0F 4FF4A 2E5GA 3V6JA 5JMNA 3T1HF 1Q8LA 1RAJA 3KMSA 2RNEA 5H9FK 1VQSA 1EHWA 5DDRC 4PXEA 2GAHC 1HHSA 4MIBA 3GV5B 4OI4A 2RJZA 3L7UA 1EARA 2HFSA 2KXHA 3VTIA 1Q86T 1VQ4S 2XCPA 3V2UC 3NOCA 1PAEX 3DLGA 1S9GB 2W2NP 5M2PA 1VRUB 4JI8J 5IM0A 3K17A 1KQFB 2JH3A 1CVJA 2V9WA 4PXDA 1MW7A 1RT6A 4PWWA 5ETQA 1YHQS 2FGOA 2MPUA 3LANA 2MSTA 1X31C 3G8SA 3HMJG 1HWUA 2WB4A 4IDKB 3CUNA 3PIPQ 3TO8A 3QNWB 3ZNJ1 4H4OB 1XMBA 3ZTQA 2JLGA 4C8MA 3Q8RB 1VQOS 2HS0A 1ZAWA 1JJ2R 2GAGC 2V8PA 2CZ9A 2PIIA 3N6LA 2Q1LA 5E5NA 2ZEJA 2O66A 2EFPA 1AUSL 5DM7Q 4OLOA 2HQFA 4DUZJ 5LMUF 2BJDA 1FNXH 5KG1A 1RABB 4HTIA 3CCRS 1N48A 6FDRA 1VK3A 4OQJA 1M5PC 1U2FA 3LAMA 2LXIA 1FRKA 1XERA 1GMVA 2YKNB 2UZAA 2E1MC 3MD1A 2RDJA 3N0VA 1YKWA 2R8GA 4QW8A 5AXKA 3UNYA 1ZS6A 2DGXA 3AJ2A 4JV5J 5I4MA 3CNQP 3M1VA 1NCLA 3GZ7A 4KT0C 2VKRA 4FKYA 1NDCA 3RYLA 3H5XA 1UPMB 1FHTA 2V2ZA 1BQXA 4O3RA 1VISA 3ILLA 2HHHJ 4Q2MA 3TP2A 3EJMA 1NSKL 3FUYA 5ETTA 1GTHA 1NSAA 1Z1ZA 3ENVA 5DS7A 3TUIC 3DRPA 3MM8B 1S6UA 4LFAJ 2H48B 1R0AA 4TNOA 3W3SA 2ZNYA 3JSMB 1UPPA 1DARA 3A3NB 4C11B 1K8AT 2FVRA 4DR5F 1HBOA 1Q82T 2RVJA 4ZLPA 2CKWA 3POTB 1XK8A 3W9IA 5KFIA 4C0BA 1RTIB 1W25A 2AP6A 1RT1A 5KFVA 3RG6A 5E3QA 4XDCA 3KJNB 5IXUA 2C1EB 2WHOA 3EYZA 2FVPA 3FBFA 2XMKA 4IKAA 5AE3A 3AOCA 3SCKE 1J2VA 2ALZA 3BV8A 1R8HA 1RT5B 4V19X 2NZ4A 1RAOA 4GVLA 4WYWA 5GAHU 2G0CA 1OS5A 4FYDA 3H8YA 2HMIB 2LXUA 4QWDA 3T1YJ 1HI0P 1ACMB 1S1VB 2QGFB 1JLAB 4EMDA 2HNZA 2PFFB 3KK1B 2K7JA 4JI3J 3MECB 2APOA 4C8LA 5KFQA 3FSYA 4FPIA 4HEA9 4UUWA 1C2PA 3SZ2A 3T6JA 3MTJA 2FHMA 3UNGC 1VQLS 1M1GA 1Q79A 2KT3A 4OZLA 1SQGA 4RW4B 4I4BA 5J1EA 3RAMA 2V4QA 3WIUA 3LP1B 2DIVA 2YWGA 2DHSA 1YDLA 2AMCB 1WJ9A 4RUCA 4X62J 4DSKA 1S76D 2GHWA 4MIAA 3V4IA 1KR4A 4C0HA 1EQMA 2CJXB 3JAMU 3VALA 2WW4A 4FS2A 1KD1T 1N5SA 4W98A 2XNQA 3R9LA 3A8JA 3SYZA 3EM1A 1HD1A 1YJUA 2IM3A 3D6MB 3BPDA 2FY8A 1S99A 3PYDA 3C6TB 1LEOA 2BJ1A 3R2CJ 4K4XA 2HGNA 2AJQA 4WCEQ 5D0RA 1VQ8S 4LF1A 2I2YA 1U48A 4I69A 4ECRA 2RIJA 4A8KA 4DR6J 2V2VA 1WOOA 3R6LB 4LR7A 3MOJB 4NA3A 2XEXA 3DFEA 4X65J 1WHYA 3TWZA 4TQSA 1RLCL 1KFDA 6FD1A 5H1SV 3OQ2A 4AYBD 3MUVP 2KFNA 3CCLS 2UV8G 5HAOA 1U8SA 4DPOA 1WG4A 2CWKA 3H42A 1QVGR 3H0PA 2J8SA 4NL5A 2GMHA 2MYFA 2ZVSA 3IWNC 5K9FA 3DOMA 1WF0A 2QN6B 4HH1A 1X9WA 1T05A 2VC0A 2CJ9A 2RF2B 3G71S 3KKFA 1HYSA 2BM1A 2HVZA 3TA1A 3D68A 1B0VA 1I3OB 4DQPA 3H5UA 3PIOQ 5IC6B 2KT5A 3UD5A 4W90B 1VLOA 4CLTA 3SDEA 4KAIA 4ID8A 4IOBA 3MHYA 4ZP7A 2M9KA 4RJVA 4ZVTB 4ES1A 4P73A 4WP8A 2VF3A 4Y2CA 2HPUA 5IM0B 4DQRA 3CD5A 3NKYA 3PYGA 3CD0A 2JFDA 4ENOA 2AEFA 2IJRA 1RT6B 4BC9A 2MLYA 2UUBJ 3MMBB 2L9NA 2DR8A 4DSIA 1GMUA 3KHHA 1RHKB 1RTJA 4DEZA 2RE1A 2VQEF 3M8YA 2XWYA 2V94A 1K1QA 2VFSA 1VLYA 5JXSA 3VF0B 2C3PA 4DR7F 1OO0B 1MWYA 1X9MA 4UOHA 2IVFB 3BGOP 4P2FA 2Y1RI 5J2PB 3PR5B 2KB2A 4ZVUB 1NK7A 2MQMA 5DQGA 3W61A 1A0OB 2I38A 3ZTRA 4FBTA 4CT9A 5L1JA 1RUSA 1IVZA 1FWLA 4JI5F 2AGQA 1S9EA 1EIYB 3CJ4A 1RISA 2V0NA 4QQBA 1XMQJ 1T9TA 2V8DA 3H2UB 1QSSA 4JI7J 3ICLA 3SEOA 5HQMA 4M5NA 3V6DA 3G96A 1WELA 2NZCA 5AE2A 3CIZA 4HI1A 2AYBA 3B8HA 4TU9A 3M9MB 1HQUB 1W2BR 1P9YA 1TR0A 5D4OA 1ZTTA 2J0WA 3GR0A 3MM9A 4F0KA 4Z7YA 1NK0A 4J9SA 4DPXA 1R89A 1MMLA 2DNQA 3C66A 3JTNA 1AXQA 4DR1F 2HGMA 3ILOA 4NPOA 3G9CA 1UFLA 4X2BA 3QGHA 1Q8IA 4YHHJ 4BS2A 2Z58B 1EQ0A 3CXCR 4DQIA 4KSEB 3DRPB 1Q16B 2J7UA 2PN6A 3LOUA 3GMGA 2IM2A 2CQIA 2XNRA 2HK2A 1N52B 1TELA 3LPEA 2GVZA 1KBRA 4ZDNA 1GXTA 3SBMA 1TL3A 4FPRA 4I2PA 2DXEA 1HBOB 1NM2A 4A4JA 3PYFA 1T7PA 3VWSA 3BGFA 4H4MA 2K1RA 3OJUA 4NLOA 1OQ6A 5KFNA 4F4WA 1HNXJ 3A3PB 3FSXA 5F9LA 3OFHA 4YY3F 2F40A 2IYIA 4P72A 2A10A 5HMZA 2CAJA 2EG2A 5CQGA 1QSYA 3CC2S 4R0JA 2DGSA 4DMZA 3W2WA 2ZJRQ 2L48A 5KFZA 2DGTA 3OVSA 1FTRA 1SJQA 1V3ZA 2QE5A 2AQ4A 1O0PA 1N33F 1UMJA 2N4DA 1JLGA 5LMNF 2GHPA 2HNZB 2ACYA 5H9EJ 3DKDA 4NLTA 1F5BA 1IM4A 4K4UA 4CLYA 3SQGA 1URRA 1QLNA 1VR6A 4DL2A 2DRAA 8AT1B 4OHVA 2W9AA 4GKJJ 2AW0A 5J1EB 4DR4F 4BCAA 1XBWA 2X51A 3TJAA 4UUXA 1Q7LB 4H4KA 3IRXA 3W66A 3G8QA 1X60A 2MY7A 1VBXA 2FJDB 2YKMA 3V4IB 4EU0A 1BUXA 5KFHA 2KYZA 1AB8A 2GA7A 3V6KA 5KT4A 3N5BA 4I1TA 3MEKA 3GG0A 1FEEA 4NZ0A 5EX0A 3DOLA 1S6PB 3RBEA 2ZJQQ 2YKQA 4OZ2A 2ZDOA 5KT2A 1NJIT 1IUJA 3VZHA 3ONQA 2M2BA 2E1PA 1K73T 2XBPA 3Q86A 3CCSS 3T5KA 5KT3A 2OTLS 1YLXA 4NE9C 3A12A 2CYYA 3HT3A 4F3QA 1KFSA 3VZIA 2GGPB 4AQYF 4P10A 2FTRA 1IBKF 2GMJA 1FESA 2MLXA 4X4VA 1U4BA 4G1PA 2HZCA 2CDQA 4U8VA 4DLEA 3UWTA 3PG9A 2R2SA 3MOZA 1TTHB 2FY1A 1F3FA 1JLBA 3N79A 3AY0A 3OHAA 4HDGA 4HACB 4TQRA 3DOMB 1R8PA 3P49B 2VDIA 4DV5F 4DUYF 3D6HB 3Q8QB 1T05B 1WEXA 2W01A 5IQQA 1OPIA 4URSA 1ICEB 1NSQA 1HYSB 2RUSA 5D0EA 4FS1A 1W2IA 4X4UA 2CVEA 2W2OP 3WHIA 2VDHA 1JNRB 2ZVIA 5CHCB 4FVCA 1NZ8A 5CYMA 3SDEB 1C0TA 3CT9A 1LWFA 2RUGA 1BE4A 3P6YC 3ENAA 5HROA 3R5DA 1S72S 4IR1A 3UQSA 3OR2A 5K5MA 3D1QA 4Y3CA 3D2WA 3CCUS 5EN1A 3OR1A 5HQ8A 3HCXA 3QSIA 2FHJA 3MFIA 1N5QA 3GLJA 1KWMA 3BH6B 4JYAF 4JP8A 1RTJB 1RXOB 5L38A 4A48A 2X1AA 1MROA 3BEGB 2UUAF 1Q4RA 4EYIB 5KFFA 4M95A 2RT3A 3JQMA 2HHTA 2XB2D 3MR7A 3MR5A 4K4VA 1FVSA 3R5CA 2AEJA 2FVSA 4NWBA 2B8PA 5E0OA 3AA8A 1YTYA 4OV1A 2VFUA 1CULA 2CPHA 2N3LA 3NS6A 1RWWB 4DG1A 1T9XA 4FZVA 4ECZA 4ALZA 1QAXA 1Z4UA 3VVTA 2QV6A 3NNHA 4RBTA 4EBEA 2N82B 3BSCA 4Y2AA 4LR8A 3V6DB 2CPFA 4RUBA 1SCJB 4PQAA 4RU2A 5B0CA 3OHBA 4OL8A 1N54B 2DT9A 1JX4A 2DO4A 4G1IA 4JV1A 2HS4A 2BJ9A 2AJ0A 1J5EJ 2A18A 3BDPA 3FBBA 4DUTA 3MM9B 4HHJA 2GC8A 1QUVA 1RA6A 3EZOA 4OJ3A 4HI2A 1EJ7L 3BBCA 3H98A 5DQIA 3RR8A 4NXMF 4O3QA 4G6VB 3VV2B 2P6TA 3DRSA 2WVBA 4CI0B 1ZM3A 3T6BA 4CQ1A 2OH2A 4B3RF 3MPWA 4KV8A 1N5YB 2MJNA 2LQBA 4F7VA 4UTGA 4ZJOA 5BR8F 3MAQA 5L1IA 1FTCA 4I6WA 1VRTA 1JJ4A 4DS5A 1XJWB 3S6EA 1N32J 2GVZB 4KHPF 2CNOB 5CXTA 1TL3B 4NMLA 4YN3B 4I2PB 4MYTA 3DLHA 2CQ2A 4A46A 2Y0SD 1YG0A 1V9OA 1SL0A 5KOXA 1NAQA 2E1AA 2ZHOA 3VAIA 4IFYA 4LF6F 1ZA1B 4CTAA 4NRTA 2KFYA 3HVRA 1YITS 2OD4A 5C5JA 4YB7A 3UO0A 3KHLA 4ECUA 5LMNJ 1S0VA 3W2WB 2VD3A 3T3FA 3QIPA 3W62A 4Q0BB 3VAKA 2HW3A 3CJ3A 3KLEA 2JHEA 1SL2A 4PCQA 2LQ8A 3GFXA 3M2UB 1JLGB 4NCBA 5KFGA 4NASA 2WB1D 2U1AA 3M6UA 2IDLA 1ROFA 2AHOB 1FA0A 3SQGB 4UOCA 4JI2F 5HL7Q 2H5EA 3OTDA 1X4EA 2NXJA 4ECXA 1HNZJ 4OYPA 1HNWJ 4DN9A 2UVUA 2IM1A 1RWXB 3ZNUA 3MI7X 2RRNA 3AB4B 2C2RA 1GXUA 1YBTA 4LSLA 4ECWA 2OMLA 3WX8A 3H5SA 5B7WA 4LF9J 3LGMA 1X5TA 1RAHB 2HSEB 2YKMB 2IM0A 1RBLA 3N6NA 1RAIB 1LQ9A 4KPYA 4BLGA 4J7CA 2RB7A 2RQ4A 3I96A 1EB0A 1V3SA 3W9HA 3DOLB 4N47A 1OWXA 4PG5A 3M7VA 4J9MA 4NLWA 5B0FA 2GFFA 3K0JA 5RUBA 4PPZA 1PJ5A 2ILYA 1YGYA 2NREA 1JLEB 3H90A 4A8QA 2RS2A 1TFWA 3IMQJ 3D1HA 3ITHA 2VOOA 1Q8KA 2HBZB 1HBNA 4LF7J 4A8XA 3ZTOA 2ZBCA 1LWEA 3GU0A 3VCDA 5DLFA 2BM0A 1I5OB 5D0GA 5IS2A 3J7A1 2IRUA 1PO6A 1T3NA 2DBBA 2VG5A 1U1PA 2DHXA 3GSIA 4DX8H 2XGPA 2D3O1 3JSBA 1VQ7S 1FCAA 2BX6A 4RX6A 3N6MA 2JDJA 2NPIA 4DV5J 4JUZA 3D0IE 3IBFB 4MFBA 1UEKA 2OPQA 1BXNA 3ZO7A 1F0XA 1VQ9S 1DFDA 2QYCA 3L09A 2UVRA 2LEBA 2KHDA 1JLBB 1OY9A 2RD5C 3AA9A 1Y5NB 4U8YA 3UI3A 1WKKA 5DDQC 1KKHA 4NRUA 2WBRA 1AUDA 2J0QD 2XM3A 1S6OA 2ZUGA 1C0UA 4P7TA 2HVIA 2LECA 1RB0A 3MPVA 4L74A 2B4UA 1PKUA 1S48A 4IQMA 2MZ1A 5LSOA 1QD1A 2VONA 4I6YA 5KOWA 3N28A 5CYMB 1NO8A 4WP9A 2VHGA 1C0TB 3P96A 4LF5J 2QSWA 4B9MA 3Q22A 5HROB 3OR2B 4CO0A 2QYGA 3VGVA 2D3UA 2P8IA 3T19A 5T7LA 3PTWA 4MKBA 1YSJA 3OR1B 2I6WA 2W24A 1YI2S 4IFVA 2FJBB 3HULA 5KFWA 5D8HB 4F4ZA 3I4PA 3PW4A 1F9HA 2KO1A 2IBKA 2MQNA 1BWEA 5CZVA 4WYLA 5CYQA 2A2CA 2GJFA 4D3HA 2WRMA 2CJKA 2OEJA 2XMVA 4EO8A 2V8GA 3CJKA 4ZVFA 4RO0A 2H4YB 1NHUA 2F4VF 2C2ZB 2KRRA 3TA0A 3JSRA 1U6BA 3UVJB 1CULB 3GWCA 4DG1B 1UETA 2P9CA 1N56A 1AZSA 3JYTB 3BKTA 1LK7A 4ECYA 3F41A 3TANA 3TVKA 1S4EA 4ILRA 1U0HA 3SFUA 2FLLA 1T94A 3DDKA 4ZJQA 1SQFA 1V6HA 1VCTA 3A13A 1CG2A 3FMWA 2VH7A 3W8PA 1D09B 3MEDA 1NBEB 5CA5A 3BGRA 1S0MA 2P5VA 3D0GE 2HBQB 4NXMJ 1HHQA 1NK5A 2KKHA 2YNFB 4QIEA 3MURP 1BQMA 2YX4A 3MTKA 2PD1A 3NGRA 1GMWD 4KJIA 3MXHP 4KO0A 2H5IB 2MKCA 4B3RJ 2X1BA 1ZM9A 4DV6J 1KC8T 2IY5B 2XWXA 3O44A 2JLEA 5LXRA 3G6VA 4NA2A 2J6TA 5LSLA 4ECSA 3DRSB 2RMLA 3GFHA 2UU9J 2VB6A 3W60A 1G1XA 4KV8B 1WHXA 2UV8A 4PPDA 1VC0A 3GONA 1VRTB 2BBEA 3U1NA 4G1QA 4J9OA 3IWXA 1NZAA 2M4MA 2ZKUA 3G6XA 1HQEB 3OVBA 5BYRA 2YX1A 1B4SA 3BGUA 3TW0A 2VFRA 2C42A 4DQSA 4RL1A 3BJYA 3E8OA 2H9ZA 3O2IA 1JIHA 2W4PA 4IFYB 3PZPA 2ABYA 4KGKA 3NRBA 1U6FA 2V63A 2B9YA 3M8PB 1VS3A 3PV8A 4CTAB 2WONA 1RACB 3HVAA 3R7NB 4M5KA 4G65A 3BN4A 1KTQA 2G0JA 1IR1A 1A7GE 1KQGB 1H2TZ 5FD1A 4Q5VA 1FDDA 4M5IA 2XMJA 3QIPB 1RYRA 4RU9A 3RB4A 1Y5LB 3CCJS 3K5LA 3ILIA 1RAAB 2J7WA 4P71A 2DTJA 3PCOB 4YR0A 2HHWA 2ZH2A 1Y9OA 3H2VE 3DN9A 5ETLA 2UUCF 4OHYA 2WVEA 4RW7A 1RADB 5KFBA 3W2VA 4OLPA 3EDRB 3F0NA 2PI4A 2CPZA 1T03A 4O23A 3KK3A 3QGIA 3BF4A 3HF5A 2HRUA 1AROP 3T9ZA 4CO1A 4MKYA 1BQNA 4LSNA 1Q0NA 3P3DA 3HVTB 1TL7B 4C3LA 2MLZA 2R8JA 1BWVA 4BBYA 2OPSA 2YWKA 5CYJA 3PJXA 2E5LF 1UWAA 3RR7A 4I2QA 3NMAA 5J1NA 4OI0A 4U9RA 1MU2A 1CJVA 1WC5A 3BSAA 2XY5A 2Y1LB 4X64F 1RU1A 1R43A 1ZBTA 2W7AA 3BBFA 2UXBJ 4DV7F 1B70B 3QLHB 1FERA 1FKPB 2VIHA 2MQLA 5J1PA 1VQMS 5GADI
chains in the Genus database with same CATH topology
3POTB 3ITHB 1Y0HA 1XK8A 3DLJA 2DGOA 3CDUA 1HBNB 5AE1A 5KFIA 2ZNZA 4UY8T 2VFTA 4C0BA 2BW2A 2BXJA 4C98A 1LWEB 5F8IA 2MKHA 1UVIA 1RTIB 1W25A 2Y1IA 1FK9A 4DHVA 2OLWA 4F50A 2AP6A 4R8UA 4DBQA 3ZZTA 3OFEA 4URGA 3IGNA 4RW6B 5KT7A 4WK3A 1P9QC 1RT1A 4NCAA 1YWXA 2CPJA 1Q81T 2XGQA 2VG5B 5KFVA 5EUHA 2BRLA 4M8LA 2V5HG 3DLKB 3ISZA 4XDCA 5E3QA 3ZZ0A 1RJJA 4B3OB 5IXUA 5KG7A 2WHOA 5IQ6A 3EYZA 2FVPA 2DPJA 2XMKA 2WBMA 4PWDA 2OP5A 4IKAA 1D8ZA 5AE3A 3CCVS 3I5AA 5KFMA 1SBRA 3SCKE 3G6YA 1UL3A 1J2VA 2ALZA 3GR1A 1NJXA 1R8HA 1RT5B 1SQEA 4V19X 1C1BA 3QLHA 1NRKA 1FKPA 5DG7A 4LT6A 3I6PA 3G86A 4GO5X 5F8NA 2NZ4A 2B7CB 4OX7A 2KT2A 1NEEA 4MFBB 4G3IA 4DV2F 1ZZFA 3J7Z5 4C2MA 2KZZA 1HFEL 4WYWA 2OPQB 2G0CA 1OS5A 1RT4B 5GAHU 4EZ9A 4FYDA 2FD2A 2GCFA 3H8YA 4CT8A 2HMIB 2LXUA 2MZSA 4NLSA 2JVRA 1WACA 3D54A 4QPTA 4F25A 3FRYA 5KFDA 1TQLA 2GX8A 3RAXA 1HI0P 4IOAQ 3THPA 4OJHA 3VAFA 2BDPA 1RKIA 4OHZA 1QVFR 1S1VB 2IC3A 3R1LA 2B9WA 4DV4F 2UXDF 1JLAB 2PT0A 2I5JA 4RW6A 2HNZA 2K3IA 1D9FA 3FEXB 3KK1B 2PFFB 2K7JA 3M32B 1WG5A 2YNHA 1U24A 1HNZF 3BO2A 1N6QA 1X9SA 4Y0FA 2HQ3A 3MECB 1HNWF 2MKKA 3DLKA 1Q1KA 2APOA 3IWLA 5L9NA 4C8LA 5KFQA 2UP1A 3FSYA 2IRYA 1C0UB 4CH0S 1TKZB 1VJWA 3GYXB 4YOEA 1HL6A 4OFZA 5I42A 5BYSA 4ZKAA 4HEA9 4UUWA 3QAUA 3U27A 2DNPA 1C2PA 4IRDA 2OSRA 2VA3A 3SZ2A 5KG0A 3T6JA 5DRKA 5KG2A 1NK6A 3MTJA 1VQKS 2FHMA 4EYHB 2HRYA 3UNGC 2E9RX 4TLQA 2GW8A 3MPYA 1VQLS 2COLA 3ZFVA 4LF9F 2HS3A 2FJEB 1Q79A 3VQTA 5DG8A 2KT3A 4OZLA 3NGDA 3MR6A 4HDHA 2ADBA 4RW4B 2OFGX 4I4BA 2DNZA 5J1EA 1U1OA 2HMIA 2MDAA 1QY7A 4WKYA 3RAMA 1SJFA 4ZCKA 2V4QA 1S1VA 2BQUA 2D3OR 3KK2A 1JLAA 3LP1B 2DIVA 2YWGA 3H20A 5LJ3Y 2MXYA 2JWNA 2DHSA 1ZAXA 4A8SA 2VA2A 1N34F 3J81Y 1YJTA 4RUCA 3DLEA 2A2DA 2HNDA 4DSKA 1S76D 4WZQA 2GHWA 4MIAA 5T7LB 2XHWA 2XZWA 3V4IA 1KR4A 4C0HA 2XMTA 3LQVA 4V19J 2HNYA 4KHRA 4X84A 1R8AA 3VALA 2HGLA 4FS2A 2JLFA 1TVRA 4LVOP 3HP6A 1KD1T 1FEHA 1N5SA 2LQJA 4Y2KA 1NH7A 3OBIA 4B9UA 3TAPA 5B0GA 2XULA 2XNQA 1JXLA 3L7OA 3SYZA 4C8KA 3R1HA 1U7LA 2DGQA 2FVCA 3PNIA 3VAJA 1UJ4A 4FXWA 3IR6B 3MR3A 1HD1A 4DR2F 2P9GA 2JJ4D 3ZZYA 1YJUA 2A3JA 1R31A 4NYOA 4NLUA 5DLGA 4AXIA 4ZCLA 2IM3A 1XR7A 3AJ1A 3IGVA 4HL9A 5CYQB 2ZH7A 3LF0A 2G4BA 4LF7F 3BN7A 2EFNA 1U09A 2C3UA 1S99A 2VPWB 1KVJA 1NU4A 1DTTA 3C6TB 4PWUA 4GMKA 2UUWA 4RWXA 3HPOA 5C42A 4WK1A 3CJKB 3LP1A 3HFKA 2VPYB 2ZHAA 4K4XA 4FXDA 2YKPA 3W7BA 2HGNA 4TN2A 3WZ0A 2QFJA 4QPXA 1UVMA 2AJQA 2CQ3A 3DLBA 4HYKA 4LQ9A 4WCEQ 4C7QA 3B82A 1KS2A 1VQ8S 3IG1A 2QMWA 4J9PA 2I2YA 3CDAA 3IRWP 1LW0A 4A8YA 2DNLA 2RKIA 4MK9A 2IMOA 4LIRA 2HG4A 1HD0A 1U48A 4I69A 2CQBA 2U2FA 4ECRA 2EK1A 2HWTA 2RIJA 2LU1A 1L3SA 4YR2A 4NLYA 4A8KA 2B56A 4RBVA 2M8HA 4M94A 2RU3A 3MOJB 4NA3A 3I9V9 2XEXA 3H2LA 5KFRA 3DFEA 2XI3A 3UCGA 2FJVA 5DGBA 4R5PB 2EFOA 4WFBQ 2J9EA 4H4KC 5AJ3F 2LLZA 4RNMA 1M5SA 3DU5A 2KI2A 1WHYA 2HIQA 2HQIA 4KFBB 3H4DA 3J80Y 1YJNS 4ZCMA 1KRPA 3A8EA 1P8GA 2ZH4A 2WAQD 2EBEA 4TQSA 2E5HA 1UVJA 1DQ8A 5EWGA 3PEHA 4ETZA 3RAQA 1KFDA 6FD1A 2HFZA 3D0HE 5H1SV 5JVHQ 1E6VB 4PKDB 5DM6Q 2QO3A 3BQ1A 2XS2A 4GC6A 3OQ2A 4MTPA 1RT2A 4AYBD 3MUVP 2KFNA 3OVAA 2W9BB 4WFNQ 3CCLS 2BABA 2UV8G 4K0KF 3LWMA 1RDRA 4WFYA 2W4DA 1U8SA 2XG8A 4DPOA 3QZ8A 1IKXA 4BDPA 1IKYB 1WG4A 3SXLA 1S0OA 5E3AA 3TI0A 5KT5A 2V4JA 4KR0B 2KTQA 4A8OA 1QVGR 4JV0A 3MEDB 3DOKA 3I5BA 3HHDA 4NL5A 2GMHA 5L9XA 3BGRB 5E7OB 2MYFA 2QA1A 2ZVSA 3R27A 3IWNC 5K9FA 3DOMA 3I32A 4ELTA 1WF0A 4NXNF 3DU6A 2B3TB 2JFKA 4HH1A 4QR0A 5KFLA 2KXNB 2RQCA 1PSDA 2VKZG 1X9WA 1T05A 3CJ0A 2VC0A 2CJ9A 2RF2B 4ED0A 3G71S 4BC7A 2FIUA 4NCGA 3KLFA 1BQMB 1B64A 3KKFA 4LF5F 1LWCB 2GO8A 1H0HB 1HYSA 2BM1A 2ZJPQ 3MUMP 4KO0B 2N7YA 2D41A 4C8NA 1SH2A 2HVZA 3TA1A 5F3ZA 1FF2A 3TR5A 1B0VA 5EDWA 4DQPA 1TKXB 3H5UA 1MMNA 1E6VA 1FT8A 3F56A 2HAIA 5SZTA 3PIOQ 2KT5A 2Q3PA 3UR3C 4W90B 4J5OA 3PEJA 2W9BA 1IKVB 1TKDA 5AXNA 1QTMA 2DVIA 3PFOA 2MB0B 3C46A 3PW7A 3SDEA 3C6UA 2J8AA 3CVKA 4EEYA 4KAIA 1UVLA 4ID8A 1ZTWA 5D77A 1FVQA 2XLKA 3I4HX 1H7XA 2ZD1A 5K14A 2WSEC 2EW9A 4IOBA 3MHYA 4ZP7A 4DFMA 1SC6A 3CCWA 2V4RA 2M9KA 4DL6A 2OAUA 4J37A 4LFCF 2W7OA 1FD2A 2B4VA 3FRZA 1DURA 4ES1A 3DI6A 1UJ6A 2C3OA 2V9KA 4Y2CA 5FDLA 1LW2A 3PRDA 2R7UA 2HPUA 4B9VA 1SL1A 2ZBIA 3EGWB 3M2RB 3L3CA 3MUTP 5IM0B 2RF2A 3IXQA 4DQRA 3DHWC 3CD5A 3NKYA 3CD0A 2W8LA 2JFDA 3OL7A 1LWCA 4WU2A 4E98A 3CD7A 1RT6B 4BC9A 3GSDA 4G1QB 1GX6A 2B43A 1JLCA 4DL0C 2B5JB 1U45A 3SV4A 3MMBB 2NSCA 4TLRA 5AXLA 3M6XA 2VQFF 4DL3A 2L9NA 3KHGA 3EZ5A 3T5JA 2DR8A 3OTCA 4BWMA 4DSIA 5HMXA 2R7VA 4O0IA 4USJC 3KHHA 1IKVA 1RTJA 4M63A 4DEZA 3THVA 3GILA 2RE1A 2VQEF 1I94F 1VQYA 2XWYA 2YNGA 1VIXA 3F73A 2V94A 3CGIA 3I0RA 1K1QA 1S9EB 1U1NA 3VAGA 2VFSA 3RRHA 2AD9A 3IR7B 3G8TA 1VLYA 5JXSA 4EBCA 2BOPA