5CD4A

The type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
199
structure length
199
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/rna
molecule keywords CRISPR system Cascade subunit CasE
total genus 26
structure length 199
sequence length 199
chains with identical sequence M
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 5cd4A01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5cd4A02
5H9EK 5CD4A 2Y8YA 4U7UD 5H9FK 3QRRA 3QRPA 2Y9HA 4DZDA 2Y8WA 4QYZK 3QRQA 1WJ9A
chains in the Genus database with same CATH superfamily
4OHWA 1FJGF 2WB4A 1WSVA 4ZS6A 4YHHJ 1SJFA 1YJTA 1VQ9S 1PAUB 1TKXA 4OFZA 5KFRA 4DLGA 2ZZNA 2FLLA 5J1EB 1OQ6A 3FGVA 3KNGA 5E0OA 4DU8A 5KOWA 3RAXA 1VC6A 5B08A 4F8RA 2O3DA 4TU9A 4RNFA 5J2PB 1U6ZA 3OT9A 4JOUA 4RKUC 5IS2A 3H5XA 3D6MB 1DTQB 1NHKL 3MEGB 5KG1A 1DAXA 2IRXA 3BYPA 4URGA 4ZCKA 3RAQA 1UTAA 4YHHF 2HHXA 4ZITA 4CWBA 1JXEA 4GVLA 2DY1A 4F4YA 1OMSA 2XHWA 1VJWA 5D4PA 3KG0A 3LF0A 1S10A 2V68A 4DV7J 1S77D 1FE4A 3RW6A 3MM5B 2DGSA 2QYCA 4FKYA 1RTHA 4LBIA 4RUCA 1I1GA 3D68A 1IBLJ 1WHVA 4ED5A 3PW4A 4AQYJ 4I0WA 5IM0A 3PJWA 1N5YB 2HRYA 4CO1A 1JLEB 3GZ7A 4RW6A 2QA1A 3TVZA 1TKZA 2VU5A 2YX1A 4ZLPA 1L5UA 3GYXB 4B3SF 1VQ6S 2HG4A 4JI6J 2ACYA 4KE5A 4ZVFA 4AXJA 5DDOC 3GILA 4MK9A 2VJVA 2F4VF 3BO2A 2CNOB 2PSZA 2JX2A 2X1BA 2XZDB 2HFOA 2DGOA 4J5OA 2KN4A 2F9DA 3MWBA 4DPWA 4ZKAA 2ACMA 2YKPA 2ZH3A 1S72S 4NLDA 2W9BA 4QWDA 4DR1F 2RAQA 4LF5F 2DGXA 3UI3A 1RT2B 3K5OA 2DH8A 2X51A 1FJGJ 1FDBA 2GAHC 1D9FA 2HYIB 2VA3A 4NXMF 3ITHA 3PACA 1JLQA 1UKUA 3CCWA 2XLJA 2EI5A 3VALA 3V6DB 5L1JA 3JTNA 3DCAA 1Y4ZB 1XC9A 2VONA 2W8LA 2DRAA 2KO1A 5HMWA 1PYOB 1S1WA 3MCNA 4ETXA 4EBEA 2UVUA 3ITHB 2KVIA 2QLBB 2Z56B 3RR7A 4OI0A 3W61A 2WVFA 2FTRA 2B43A 4M5IA 1CVJA 1VK3A 1OY8A 1LK7A 1S1WB 5K14B 2KH9A 2R7RA 1KRPA 2DT9A 2RD5C 2IJFA 2DTJA 4IOAQ 5F8LA 1ZA2B 3DM2B 4UZBA 3W1YC 1U8SA 3QFHA 4NLQA 1RHKB 2QX0A 1PJ7A 2MJNA 3MPUB 4P6QA 5K14A 3LUYA 2DRBA 3EE3A 3Q8UA 4RR5A 5LT5A 4K4ZA 4M63A 4MTPA 1YLXA 5A0YB 3ZZYA 3MOJB 1U45A 4C11B 2HGLA 4OLPA 2C3MA 2AYBA 2MKIA 2FC9A 4WP8A 1VHFA 3GFZA 4LUBA 1DQ8A 3IGNA 5J2QB 4NI2A 3CJKB 3L4BC 1RT6A 3FEXB 4LRCA 4NLVA 4PCQA 4LRDA 5HJXA 4O4GA 4K4WA 4R8UA 2WOMB 2IY5B 1FKOB 4AL5A 2J7KA 2B4UA 1HYSA 2QFJA 3GV5B 4Q43A 4EZ6A 4OZLA 3PW7A 1TL3A 2FVCA 1SI9A 4G6VB 4I1TA 4RW8A 3EPIA 5J2QA 4B3OA 2KZZA 4JI5F 1AW0A 1VMBA 5ETOA 2E1PA 2C1EB 3VAIA 1GAOA 1W7WA 3TOQA 1WC4A 3ZZOA 1CSJA 2P8IA 5C5JA 4DDFA 1ZZFA 3JSRA 3MPWA 2PA3A 1TAUA 3AJ2A 2IM3A 5A2QY 1GH8A 1Q8BA 2DNGA 5HATA 2LQJA 2UV8A 3K5NA 2EK1A 4RW8B 3PO4A 4F2SA 3IG1A 3W66A 3IM8A 4PG4A 2CNNB 4CLKA 1SV5A 1FWPA 1ROFA 2KYXA 3JSYA 1RDRA 1M5OC 1IWAA 1RT3B 5CCLA 4Q8EA 2M9KA 2V2VA 1DTTB 3S7RA 3TYTA 3TZWA 4CO3A 4E98A 3S8SA 2F8HA 4B9MA 3MECA 4LF9J 2IM1A 3ZZPA 4K2JA 1U47A 3BN7A 1IM6A 3QGHA 1X4HA 2RS8A 4NZ0A 4J9PA 5I3UA 2ADCA 3AA8A 1H2VZ 4JI6F 1T05A 4AYBD 2QLJB 1F3FA 1NXIA 2MKKA 2BRKA 4IRCA 3K0JA 1DHMA 2IDLA 4X4SA 4OJ1A 4ELTA 4JBCA 5CXTA 3AJDA 1GNKA 2ZE2B 4R25A 2QO3A 4BS2A 3IR5B 4DL0C 4WKRA 5B0FA 3MMCB 4DCPB 2XY7A 4ZPCA 1S1UB 1E6YB 3KXDA 3QT5A 4QBUA 1JXLA 2E5LF 3DNCA 3H20A 4NMXA 4IFYB 2BJ1A 2E1AA 3UVJB 1U1MA 2Y0SD 2Y8YA 2A1BA 2MQMA 1DRZA 2E1RA 2YNIB 3DOKA 1WEYA 3Q83A 2V5HG 2C3YA 1Q79A 3G6ES 2AQ4A 4CO2A 2J6UA 3TA0A 1RT1B 2GW8A 3K57A 2HW3A 6FDRA 3HF5A 4DR3F 3W9JA 2G0IA 4CT9A 4DN9A 5J2NA 4OI3A 5E33A 5KG6A 3D1HA 2QMUB 3VZHA 3SCKE 1JKHA 2VKZG 1RWOB 4QW8A 4DR2F 2LQ8A 4ILRA 2X1AA 2ILYA 2E66A 4ENOA 1OPIA 3KUEA 3KWMA 4Y34A 4CLLA 4RO0A 4X65J 2F4VJ 1HBNA 1EIYB 2M4MA 2GJFA 1YJ7A 1WOOA 2K3IA 1IKVA 1EETA 2VG7A 3CSKA 4L3NA 3TVKA 3QQCD 1HHQA 2GX8A 4NL5A 4XDCA 4N41A 1G4CA 2BXJA 1WF1A 3AXMA 2Z57B 4QWBA 1S1VB 2E7WA 1PJ5A 3R5CA 4OJHA 4WFYA 1TVRB 5D0RA 3I4PA 3RJMB 3DDKA 3VV2B 4DPYA 3I82A 1QVFR 1L3KA 4URQU 3KLVA 2CAJA 2QIFA 3SCIE 1EETB 4ED8A 5KFUA 4YDDB 5IC4B 3SV4A 2V8DA 4NXMJ 1S49A 1S6UA 4EGLA 2KXNB 4WFXA 1SJRA 1V3ZA 5J1PA 3DLLQ 1U0HA 1N5TA 2QTWA 4NLPA 3KK1A 5G4DA 1LW2A 1I6JA 3NRBA 3SDEA 4ZPAA 3E3XA 5FLXU 3F0NA 2R7OA 2ZOGA 2HS3A 3EM1A 5F8JA 5ETRA 3GPAA 1I94J 4KGXB 1XWLA 3I5BA 1N48A 4F02A 1VC5A 1WKJA 3M6VA 4OZJA 5HK4A 5KFDA 4GVBB 3OXGA 1Z2ZA 3HHDA 3PHTA 3W2VB 3C2PA 2BMBA 5A8KB 1HR0F 4QIFA 2ZWPA 2LCWA 4KIAA 2IJNA 3HKWA 4ZVPB 2EFQA 3TEHB 1WTFA 2JDJA 5KAKA 4H4KC 3BQ2A 4GKJF 4LF4J 1WC6A 2J7WA 4JV1A 1SC1B 5KFXA 3TX8A 3LPYA 1M5PC 2CPXA 4P52A 4K4TA 1HNWJ 1FRJA 3OFGA 5HANA 2MKYA 4QR0A 2AX1A 2WW8A 2YQ3A 5DQGA 2AJQA 4KPCA 1WWHA 4MIWA 1QAJA 4X62F 4EI2A 3PCOB 4IG0A 1IKWA 3PYGA 1UPMB 3BH7B 4CM0A 1HNWF 1M5VC 3AJ1A 3NS5A 2EKYA 2G1HA 1E6VB 3ET6B 4LF4F 2BJDA 4NLTA 3NL0A 3HJVA 3BH6B 2GVDA 3GG1A 1S1XB 4ELUA 4ERDA 1FRIA 2IVMA 3KMQA 1KKHA 4A8WA 3L3CA 1H73A 3CJRA 1C4AA 2PMHA 3UR0A 3OLBA 2V2KA 1UVMA 3BS9A 4Q2MA 1X4AA 3OW2R 3BEGB 4KHMA 2I2YA 3U1NA 2DNPA 4F0KA 3CO9A 3PG9A 4KKOA 4ES2A 1YGYA 1Q8LA 4CRJA 4L75A 3MD1A 1HMVB 1T7PA 2BV3A 2HVHA 4C97A 1WG5A 4U95A 3SSSA 1MMDA 2L9NA 2CIMA 2EPIA 3CUNA 4OYOA 4USJC 2JEJA 1Q0NA 4GKKJ 4HH1A 1QUVA 4X4NA 3LP1B 4CTAB 3QIPB 1BMQB 1FK9A 1IR1A 2CPZA 4OHXA 2DEIA 3TJ9A 5IV3A 2B4PA 3H4BA 3OTOJ 1IBKJ 3HSDA 3NKYA 2GMHA 2OHDA 2WCXA 3K8WA 4CM2A 1U26A 3TAPA 1YQHA 1ZTWA 3MD3A 2LMIA 2KFNA 4WZMA 1MLAA 4HTIA 2BRLA 2LXIA 4PPZA 5HBMB 2F8EX 3PFEA 3LP1A 4MK8A 4CTAA 1J5EF 1WEZA 1JK9B 1B4SA 1KVKA 5EWEA 1EX8A 3RU0A 2ASDA 2B0GA 2RQMA 3PHEA 2HBZB 2PDAA 3LA0A 3PM9A 5AT1B 2MKCA 1M1KT 1AZSA 1HWUA 2MZSA 4M5HA 4WXWA 3LANA 4LF9F 2HHHJ 1TKZB 2NR0A 3BDEA 1RABB 1TV6A 3AA9A 4NCGA 2C22A 5J1NA 2ASJA 1VRUA 5A6WA 5CYJA 5JXSA 4CZCA 1DJ0A 2BQUA 3JAMU 3H0PA 3TARA 1GK8A 2YKNA 3GFHA 1NH8A 4OZ0A 3DLBA 1CPZA 5DDPC 3T5HA 2C2EA 2HQFA 1FO1A 3OVSA 1WDDA 2LA6A 4X4RA 1A0OB 1X4BA 1VQ8S 2DCUB 4B9NA 5F0WA 4LFBF 4DX7A 3U7JA 5F8HA 1SKSA 1S57A 3MURP 3UWTA 1SBRA 1WHYA 1T3NA 5KG4A 2V67A 4Q44A 4J9QA 2E5LJ 4B3RF 4DLEA 5KFLA 2ZDPA 4C8ZA 1VLOA 2VPYB 5GVQA 3T19A 2ZC3A 3U1MA 4DV5F 3PRVA 5B0GA 4MFBB 4GKJJ 4ZVHA 2LQ9A 1ZOTA 2UVWA 3MUVP 4ILLA 2GQ2A 3P5TL 2OKQA 4NEYA 4U96A 2FJEB 5E3AA 1XBWA 4ER8A 2G4BA 2G2OA 3OHBA 1RACB 3V6JA 1NSAA 1O0PA 5ETLA 2OUGA 1AB8A 2YKAA 3G9CA 2V2ZA 3UQSA 2W9CB 1Q95G 1RTZA 2XNQA 2KT3A 2CQPA 2C3OA 4HT7A 2RIJA 1C0TA 4RW7B 1GX6A 3J80U 3IN5A 5HLFB 2ZHBA 2DNYA 2VBXA 2VC1A 2WVBA 3M8ZA 3H5UA 2BKOA 4BBYA 3S01A 4RBUA 3FNNA 1JLEA 1OO0B 3CDWA 3PZPA 5F8NA 3BBCA 3EUNA 3BGLA 2PO4A 4F26A 3VAMA 2BM0A 1YJUA 1AT1B 4WP3A 3SQGB 4WFAQ 3C19A 1SQEA 1HBOA 4ZHRA 4M5NA 4N8NA 4EUVA 5A6PA 4OHVA 1DFDA 3M30A 2DH9A 3SQOP 5KFGA 3AXKA 3CNQP 3BPDA 3BO4A 1VRQC 3PJXA 2LA4A 4KJIA 5D8HB 1KHVA 4DBQA 5LXRA 4Z37A 5IFMA 4LSNA 4DEZA 2BKNA 5KT5A 2QSWA 4X4PA 1H2TZ 3A13A 3OBIA 4LQ9A 4DV6J 1XMOF 2UUBF 3FKBA 3CDBA 2KJWA 4FYXB 1T11A 5CCMA 3JSMA 2GFFA 1FTRA 4KAIA 2CWXA 4ALZA 1K0TA 2U2FA 1T8EA 1LV5A 3EZOA 2ZD1A 1VQSA 4Q7AA 3UN2A 3QAEA 2PT0A 2HVZA 3IBCB 2DH7A 2OEMA 3WZ0A 2MKJA 1FX4A 1RBAA 3FK4A 3R3TA 3SV3A 1I94F 4I7FB 3JSMB 4KHPF 5IQQA 1H7XA 1J5OB 2QN6B 3TW0A 3QGGA 4ZA1A 3TNVA 2ZD1B 1HL6A 3KK2B 3R7BB 3I5CA 2WONB 2UXDF 5KTQA 4BC9A 1S9FA 1J2VA 2VD3A 4X4TA 2KFZA 3S6EA 1RT5A 2AGQA 1FRKA 4ZPWR 3M6UA 3PKYA 4DFJA 1NK5A 3THPA 4KFBA 2WONA 3RAMA 3MM7A 3TZZA 3TWZA 3K17A 5HROB 5KG5A 1RT5B 3OVBA 1S1UA 3M8WA 4B9TA 2CQGA 4JI4F 1CEZA 2F3JA 1JQGA 2CPIA 4OYAA 2DGWA 4X4VA 1NJXA 4GMKA 3N6LA 4D3GA 1ZYQA 3MCMA 4M5DB 2BJ8A 4NI2B 3TQEA 3OFHA 2DR5A 4WFBQ 2H51B 4USWA 2P6SA 1PC4A 3FEZA 2QV6A 1WD6A 1F9HA 2BKPA 3H5SA 2XSFA 4D3HA 4FF3A 3HT0A 2UXBJ 1HQ2A 1FXDA 3CCZA 4LRAA 3RRHA 3BF4A 3H7HB 5D4NA 4ZMMA 1TKTA 2Y1IA 3TUPA 1Y5IB 4PAAA 2EC0A 3V6KA 5IXUA 4CH7A 4JI3J 1RAHB 1RWUA 1HW8A 3NG8A 2K3KA 4CLTA 5LM7E 2VQFF 2OI2A 3TAQA 2MYFA 3H5YA 4JI5J 1FDNA 1LW0A 3RZAA 3ZO7A 4LFBJ 2IM2A 2DGUA 4LF6F 2P9GA 2DK2A 3TZYA 4IUFA 3KG1A 3EGVA 1HKAA 4RNOA 2XY5A 4GC6A 2MKHA 2OGUA 1XNRF 2NUUG 3GR0A 2KM8B 1K8AT 4DL7A 1FDAA 3MF5A 2C2ZB 3ZZ0A 2ABYA 2Q43A 2QL5B 1MG7A 4IH5A 4PZVA 4F25A 1CQMA 3L09A 3RRKA 2HVDA 3FCHA 2XNRA 3ENVA 2IM0A 1KTVA 3Q23A 4FBUA 3NAIA 4DZDA 3ULHA 5LSOA 4FXWA 2BZ2A 4QIVA 4IQXA 4DFMA 5AXMA 2VG5A 1BLUA 2XMKA 3PIPQ 5D3GA 4WK1A 5HAOA 5DGAA 4KT0C 3KUGA 1ZZNA 4ID5A 1X0FA 1APSA 3QWPA 4RWXA 2G1DA 2B4OA 2CA9A 2LEPA 1TL7A 3QYYA 3W2WA 4DL6A 1YBUA 2EBEA 3IAM9 2FHJD 2FZCB 1HQEB 4R0JA 4TY9A 5KFIA 2VG5B 1CJKB 2YWWA 2AJFE 2BE7D 4G1IA 2RDDA 3TP2A 4ICLA 3J7A1 1RT1A 3HHLD 1WKKA 4QW9A 4ED1A 2CWKA 2V50A 4C8MA 1UJ4A 2LLZA 1MNEA 2NXUA 4CLFA 1NK9A 1G1XA 1NNDA 2YNGA 1XN9A 3LGNA 2XS2A 5GAGI 1F5BA 5CD4H 1BE4A 2HNZB 3CGIA 4K8RA 3D0HE 4TY8A 4I6WA 3EYZA 1X31C 2PE8A 3DI6A 1U0SA 1UVKA 4W4MA 2KRRA 4YB7A 4DX6A 4I56A 4F7VA 4C4WA 3D4JA 1C2PA 2HSEB 3QMQA 4AD6A 1IKXB 2FZKB 4A8OA 1E6VA 1FXLA 1JWWA 4UOCA 4TY8B 2HHHF 2B8PA 2HWHA 1SPBP 1NJYA 2VASA 2MZRA 3HVRA 1HARA 3RTVA 3NNCA 2CKWA 3I9ZA 1RWKB 4J9RA 2BVZA 3I32A 3PYFA 2EFNA 2JEIA 3A4TA 4DL2A 4DWIA 2I5JB 4CLYA 1VQNS 2WK4A 3CE8A 2KHCA 2QL7B 1WOPA 5M2PA 5MLCV 4OQJA 2COLA 3MEEB 4J91A 2XMMA 3BGOP 5GAHU 3OTOF 1IBKF 2CQ0A 2DO0A 2FC8A 2HBQB 3KJQB 2PMWA 3HHLA 4FPRA 2EFVA 3PTWA 4ZLJA 3OJUA 3OSPA 2EEYA 1RTJB 2XEXA 3MAAB 3OR1B 5KG7A 1G2EA 1I3OB 1MMNA 1T0TV 3UN3A 3OTEA 5T14A 3OJSA 4LREA 3PVXA 2CG8A 1NH7A 2OFGX 4M1KA 2H4YB 2OPQB 3V81A 3UDEA 4ECUA 1PJ6A 1W2BR 1SKRA 4B9UA 4RUBA 3RB3A 2ALZA 2AIRB 4C8NA 4LFAF 1ZPWX 1VBZA 2KHDA 2MPUA 1UWBA 3MHYA 2B51A 1Q5YA 3R5JB 4M5LA 3C15B 5C7PA 3NCPA 3QT7A 4RL1A 1S9GB 4YB5A 4H4KA 2H4WB 3CWJA 2GVZA 2WZ1A 2D3OR 1ELOA 1UCNA 3UE2A 4IG0B 1B0VA 1MROB 1P1LA 5L8RC 4CLWA 5EWFA 2B6AB 1NZ8A 2G9OA 2RHSB 3IC1A 2RUSA 4KYZA 4MKBA 5KFAA 3CXCR 3GYNA 5F9LA 2UUCF 5D78A 2R2TA 1WF2A 1S1XA 3MAHA 4WF9Q 2VBYA 3M1VB 2KYZA 4DL4A 1OY6A 2BJ3A 1S6PB 3OFFA 1U1LA 1SJ4P 4IR1A 3EICA 4X66F 3R2CJ 5KT6A 1EZZB 2APOA 3BQ1A 2R7QA 2VJUA 1GXUA 4G1QB 3OVAA 3HLUA 4OJ3A 2XO6A 1UVJA 2JLGA 1BC6A 2NLWA 2JRSA 1NEEA 2DIUA 3CJ0A 4ZPBA 5ETMA 4OI1A 3AD7C 3RW7A 3UW1A 3M2VA 4NA3A 2DHAA 4USVA 1BHNA 1V5IB 2B5JA 3DOMB 4QYRA 3T6BA 3E01A 3LGMA 3UD4P 2RDJA 3MEDA 1GMVA 1VOMA 1MWQA 4YR3A 1IR2A 4IRKA 1DLOB 3M2UB 3EGZA 1YJVA 2Y8WA 4P2XA 3BSOA 2HBYB 3EGNA 4DSEA 2OTLS 1B3TA 1FE0A 2W9CA 4KB7A 1P6TA 1U7LA 3M6WA 3GB0A 2WB1D 1VCTA 1RP5A 2W4DA 3RBZA 2IRYA 1N34F 1SH2A 1S6OA 2RH3A 4V1Ak 3Q8RB 2C28A 1GFWB 3D7SB 3QBCA 2LU1A 5K8NA 4OLOA 4DQRA 4LF8J 4O3SA 2W2PP 5C42A 4NZ6A 2CPHA 1VQ4S 3HHKA 3MM5A 3QJLA 5AE3A 4U67Q 3EVOA 3G87A 1S7HA 2IC3B 3DRSB 2IBKA 2D3O1 1CG2A 2DNKA 4ECSA 5IM0B 2YWEA 2HS4A 2WBMA 3M8SA 2IFXA 1K44A 4NLXA 3X3UA 3WX8A 1PGZA 2F9JA 2JFDA 2GQQA 3BBBA 3T1YJ 2GCFA 5AJ3F 4RW6B 4MK7A 5EDWA 3JTOA 3GIRA 4OHZA 4QU7A 3BGFA 2DHGA 4FYYB 4A46A 3J81Y 3CCLS 3FQLA 1RGVA 3M8PA 4LSNB 5IWAJ 4LVOP 5CYMA 1FCAA 3L7OA 1S7IA 2BA9A 2WRMA 3MZIA 3MR2A 3KHRA 4ECWA 3DGVA 4TN2A 3GV8B 3UCZP 3HI9A 2R7TA 2EC2A 1RT7A 3JQJA 3UD3P 2GAGC 3RBEA 2BANA 3M8PB 1BQNA 5CYMB 1DURA 4FF4A 4P74A 3IAS9 3IRWP 4FS1A 4OZ2A 3J81U 4ANCA 3LTOA 1H74A 1SJQA 4Y2AA 4DZ6A 4KV8B 3NGDA 4DSJA 2DRDA 4EBCA 2MEWA 3D0IE 3ZZTA 3IRXA 8RUCA 3QZ8A 4C7QA 1B99A 2V4RA 1A6LA 3LOUA 1Y10A 1UMJA 1EB0A 5LXYA 3PX0A 2BOPA 4EO6A 1RU2A 1SC4B 3ZTRA 4EBDA 3K5LA 4ZPDA 1MWYA 1NBEB 4ATNA 3JAMY 4O3NA 5D0HA 1F6TA 3W65A 4ZVQB 2AJ1A 2FDNA 2MLYA 4UQTA 1R0BG 4USHA 3SCJE 2AHOB 3OLAA 1EKRA 2XMTA 2ZNYA 3DM2A 4ED0A 1OPZA 3HZEA 3CCUS 2MQNA 2ZJPQ 3ISZA 2D1CA 5G0RA 4ZCMA 4DQSA 4QJVA 1YK9A 4ELVA 4ANEA 2PI4A 2J8AA 4PRFA 4QWEA 3AOCA 3G2XA 4HEA9 2NXNA 5C25A 1L3TA 1D9DA 4X4UA 1S6QA 2CPJA 3M32A 4L74A 5AXLA 2F65A 2OPPA 2VKRA 3LAMA 1K1SA 2RQKA 4TU8A 4DV2J 3M05A 1F5CA 3OXFA 2RILA 2LYVA 3K89A 1JJHA 2JFKA 4X62J 3IG1B 4O44A 3VR1A 1OQ3A 1K73T 1Q7LB 3GSDA 4O4GB 1SJ3P 1QAYA 3M2RA 4EO8A 5HMXA 3FMWA 2OMOA 1Y9OA 4U7UK 2J0XA 4WKYA 1HFEL 5KFJA 4MKYA 1LFWA 2XY6A 1MN7A 3D6FB 1N6QA 2HHSA 1VR6A 2Z30B 3EMTA 1CULA 3CJ4A 2UUCJ 2IA0A 2HIYA 2I38A 3GMGA 5A8RA 2F63A 2BE2A 3H4DA 2JNJA 5F41A 2ZE2A 2ZJRQ 2UVVA 1G7CB 2AW0A 2YWFA 4C8OA 4RNNA 2B9XA 1WC5A 3DMJA 1WSRA 3D66A 5CA5A 3PW0A 2NREA 1IM4A 3MM9A 3BKFA 4B9SA 1Q8IA 1JLCA 1HBUA 5AJ3J 2CQ4A 4DUYJ 1B7FA 1OSDA 2OIHA 2O66A 2HKEA 2AJ4A 1XJWB 5CYQB 1U1KA 3D1QA 1MW7A 4FS2A 2J9CA 4OYWA 3MM9B 1LWEB 3VHQA 3I4HX 4OI6A 3Q8QB 4KTQA 1JLCB 2GHVC 3HP6A 1U0HB 4YR0A 4PABA 2HZCA 4TLQA 3GFYA 4GO5X 4K4YA 1D8ZA 2OLWA 1RTIA 4I69A 1JKHB 5FDLA 2PEBA 3KLGA 5D0GA 4N76A 1N34J 1HQUB 3C14B 2I6WA 4ES1A 1UFWA 3QRQA 1GX5A 2XMUA 1FDDA 3NGSA 4V19X 3WDOA 4BWJA 3T6JA 3HCXA 1DBDA 1S1TA 1SQGA 2JL9A 4RW4B 3NY0A 3UCGA 4F3MA 3V4IB 2ZZMA 2WW4A 3IS9A 2ZH7A 3M8YA 2PIIA 5KT2A 3DDIA 4XPEA 3J7YI 3C46A 2ZDOA 4R5PB 1CS4B 2V69A 3GFXA 3VGSA 3DI6B 4LFAJ 3T1YF 2Y1JA 3JQMA 1K9MT 2UUAJ 2V8PA 2P9EA 3N4WA 4PR6A 2AGOA 1KD1T 4KHPJ 2BEFA 2D3ZA 4L6V3 8ATCB 2XCPA 1IKXA 5DDRC 1FJEB 4FNHA 5EN1A 5IT9Y 2EFGA 1YZ7A 2JH3A 2K1RB 2UUAF 1JLAB 4FVCA 2DYAA 1RHMB 3TR5A 2KZMA 2RNEA 1IKWB 4YB6A 2LKZA 2R7VA 2I0XA 4DV6F 2DY9A 3BR9A 3LP2B 4OX7A 3MM8B 3NWGA 1IQTA 4P73A 1SKUB 2DNQA 4OYMA 2LXFA 3B6BA 2ZJQQ 3HSZA 3K59A 1XQIA 4A47A 1FHTA 3GYGA 1MSWD 2DNZA 2FVQA 3W2VA 5EX3A 2AJ2A 2RUGA 5HL7Q 3BO3A 3MM8A 1T9UA 4ZOSA 4JI8J 3DLEA 4U6PA 3LO3A 4ID5B 5ETQA 1CJTB 2YQ0A 2CJQA 2KVQE 3AB2B 2L41A 2DPIA 1TFYA 3F73A 2HLTA 2ZH4A 1LW2B 3RBDA 2HNYB 2M88A 2OD4A 4DF4A 1WHWA 2MZQA 1JB0C 2XULA 2XO7A 3DLEB 3HD1A 4WCEQ 2PGCA 2E7XA 1V9OA 5ETKA 1RAGB 4NXNJ 1RWXB 1KFSA 2HNYA 4LF7F 4DV5J 4HDGA 3HFVA 4Z2XA 1FJ7A 1RLDA 3ZTPA 3R5DA 1RADB 2HMIA 3JYTA 1F3VA 3KDNA 4Y2KA 2VF3A 4J9MA 2O5DA 3GR1A 2X3DA 3IA0A 3OTBA 3QZ7A 2F40A 1WDTA 2R7SA 2NXJA 3EDQB 5T7LA 4NWBA 3QLHA 3JSBA 4G3IA 4J90A 3CC4S 3C66A 3T9ZA 3AH6A 1WC0A 3DLHA 3QFWA 3O44A 3CPWR 3ZZUA 1X9WA 1HNVB 3LGHA 1L3VA 3H2UB 4I2QA 1M5HA 4RUHA 1X0PA 4DQPA 3HO1A 3HFZB 3PEJA 1TV6B 1R27B 4NZ7A 1U24A 3M1VA 4NCGB 3TQ1A 3B82A 2BUNA 2HK3A 1RE1B 5GMEA 3MR5A 2M52A 1Q82T 1LWFA 1QE1A 1RSCA 4OYXA 4DHVA 2R2RA 1YZ6A 3ZZRA 4JI3F 2YNFA 3IP0A 5I4MA 2N7YA 2MQQA 1U6BA 4BCAA 5DLGA 4IFVB 3M2VB 4YY3F 3LAKA 3GWCA 3VAJA 1P8GA 1RHRB 1EHWA 1U02A 2XMWA 3H90A 1A9NB 2OAUA 3MEDB 3N5BA 5HI7A 5HQ8A 2XCAA 3E2EA 1FRHA 4WBFA 5BYSA 4H54A 2KI2A 2R3VA 4F36A 1PIEA 3E8OA 3FCWA 2GNKA 3KYLA 1QLNA 1QJHA 1EJ7L 1PG5B 2X3GA 1UL3A 2KJVA 3TUIC 3PR4A 1QM9A 5LMNF 1UW4A 4TQRA 4LIWA 5C24B 4ECRA 2ZUGA 2AD9A 3QIPA 3OD2A 4NCBA 3NOCA 3GCXP 4LRBA 3OL6A 3G6XA 4LFCF 4FF1A 1RTDB 3BKTA 3CT9A 4NX9A 4DR7J 1FI4A 1Z1ZA 2QRRA 4KR0B 4LF1A 2QC3A 1FJCA 3DRXA 2UV8G 5C24A 1RAOA 4LF5J 1LXJA 4ZP6A 4B02A 4PUOA 2P9CA 3IWNC 4LJMA 2UXDJ 2V34A 4WP9A 2B6AA 1OIAA 1SQFA 2IYGA 1NKBA 1JJ2R 2HHVA 2RMLA 2HIQA 4K4SA 4KPYA 4QCLA 2N4CA 3QGPA 4DR6J 3CJSA 4OZ3A 2DNLA 4L76A 1JXVA 3EDRB 1R8AA 4Y3CA 3BGUA 1NSQA 1TQLA 1IN0A 2AYEA 2C2KB 2FIUA 3HVWA 4MFBA 2I9SA 3K8VA 3ADAC 1VGYA 4ZHRB 5I3QA 5L9NA 4EZ9A 2AT1B 5LSRA 2LEBA 2HFVA 2HQIA 3K2YA 3M9OB 1S59A 2E1MC 3OFEA 1NJIT 3MMAA 2XLIA 4TU7A 1IBLF 2V8VA 4QYZJ 3P3DA 2EW9A 3UDLA 3Q22A 1HPZB 1N54B 4I2PB 1CQNA 1KOHA 1LNQA 1T9YA 3NGKA 3UFCX 3LP0A 5RUBA 2D9OA 1X5TA 2J76E 3A8KA 1GEHA 4U9RA 3TO8A 4Y00A 3V5RA 2HQDA 1B70B 3R5GA 2J9EA 5HLFA 4M95A 1HI1A 2CRLA 3MPYA 4OZNA 3Q0AA 1HPZA 2GC8A 4I2PA 2GO8A 3U1LA 3PR5B 2MZTA 2IBOA 3FZ2A 3QSYB 3CIMA 4E8UA 1TL5A 2QJ3A 4F3QA 4EYIB 2YH1A 2DGTA 1S0NA 5KFBA 4C9DA 2H5EA 3RUBL 2UVRA 3CCTA 1O51A 4IYQA 4I64A 4P2SA 1RCOB 2IRUA 4CYUB 7AT1B 4A8XA 3M9NB 1N5YA 4FXDA 2CUYA 3CVKA 1VIOA 1DY3A 3FFIA 2AMCB 3PIOQ 3DFEA 3I0RB 2CQ1A 3FSXA 1Q4RA 2L9WA 1DQ9A 5KFZA 3WIUA 4DXLA 1VQMS 3I87A 2XGQA 3VQSA 1JNRB 1NO8A 1U09A 3O1LA 1K47A 5HROA 3PYEA 3UNYA 4LQ3A 4R8UB 1XNQJ 1S6QB 3M32B 5GAGU 3D2WA 4C6AA 2DGQA 2QA4S 2BABA 2HRTA 2XMJA 2GIQA 2YBVA 4IQMA 4YN3B 4BC7A 5IV4A 2XI2A 1WC3A 2ROPA 3Q8PB 1Y11A 5L1LA 4B3OB 4G65A 3KLEA 2VOOA 2UUBJ 4FDFA 2L9DA 4X2BA 2GIFA 4DR1J 4F0HA 5F8GA 4IOCQ 3M2RB 1EP4B 4O4RA 3LW5C 4N77A 1RLCL 2BYCA 4C0OC 3CMES 3UPFA 4X84A 1TMJA 3DKDA 4QWCA 3M8RA 4B3TJ 1UW9A 4KGKA 4LR7A 2J0SD 2AEJA 4RPFA 3ZTQA 1TKTB 3L95X 4H4OA 4JI0F 3H42A 1BY9A 4AXIA 1U4BA 3GIJA 5I3PA 2GGPA 1D8YA 4F04B 4B9LA 1S5ZA 2DHXA 2AEFA 2PFDA 4NE9C 3L9ZA 4G1PA 4KFBB 4ZVEA 2XZWA 5HVFA 4X65F 1UAWA 1ITPA 4QQBA 3DRRB 1ULRA 1NDCA 1VQ5S 1RAFB 5L39A 5KFMA 2IA6A 5KFSA 3PX4A 2VUGA 1U1QA 1UJ6A 3MPVA 3R27A 1RA7A 3KK2A 1RWNB 1FFGB 4QWAA 3QRRA 2FGOA 2B7BB 4ZLLA 1PC5A 3DYAB 2OH2A 5CYQA 1KR4A 4Q0BA 3ZZZA 5ETNA 2MZ1A 3QAUA 3GTYX 3QNWB 2PN6A 4WYLA 3W63A 4C11A 2VICA 1XR6A 1HIYA 4IFYA 4DN0A 2ZOFA 5KFQA 1NK6A 2KG1A 4CLSA 2N82B 2O1PA 2MXYA 2CQCA 3F41A 2XSJA 2VV5A 2PC6A 2EK6A 3R6GB 4IG3A 4Q2LA 5BYRA 1RT6B 2Z2YB 3I96A 3N9UC 4DPXA 1GTEA 2G2ZA 3DXBA 5KFTA 2KFYA 1T03A 2J0QD 2Q79A 4OHYA 2MB0B 4A8KA 1MU2B 3WC2A 1FKOA 2M0GB 1NSKL 2OPPB 4TXSA 1B0PA 2CVIA 1YG0A 5JVHQ 1TKDA 2RT3A 2A10A 2C3PA 2XSJB 3DN9A 4EFAC 5KFPA 1YIJS 1X5PA 1X7VA 1N56A 3IS9B 1J27A 3BSAA 5KFHA 1T03B 3GJRB 1H6KX 2W9AA 1Z4UA 3B78A 5AXKA 3MUTP 2MSSA 4FN5A 2QE5A 2MZJA 2W1BA 2BJ9A 4CT8A 1KN6A 2M7SA 5CH7B 3CTRA 3MFIA 2OTJS 1YTYA 3W9HA 3T5LA 1JNZB 2YX7A 1AXQA 2K1RA 3D6TB 1X8DA 1X5OA 1IKYB 2UZAA 3KG4A 3DDNA 3LALA 4DCJB 3ZTSA 5KFNA 3RB4A 1S0OA 2OELA 3HSJA 3DHWC 3QIDA 1KFDA 2QEXS 4DSIA 3GIKA 4NA2A 2YKQA 1FTCA 4DL3A 2OJ3A 4QYZK 1A7GE 2HWTA 1UEVA 3T9NA 1F1BB 4F0MA 3W5XA 3TANA 3SEOA 4KH1B 2JEGA 3CW2C 3FBFA 4OX8A 5E5NA 4O3QA 1UPPA 4NOHA 1TL7B 2XS7A 4TYBA 3EX7B 2XB2D 1ZAXA 1ZM3A 3R9LA 1U1OA 1T9VA 1U49A 2VQEF 1UA0A 3ENWA 3QRPA 1U1PA 4JI2F 1OYDA 1CJTA 1FT8A 4K5SA 3FJ2A 3LQVA 1JLGA 4DOZA 1Q8KA 1R8PA 4QOTA 4KC5A 4FZVA 2P6TA 4CQ1A 2DR6A 3UVJA 2DKOB 1NPPA 4YQWA 4P75A 3WC0A 1FKPA 3MTJA 1RTJA 1UZDA 4TYAA 4ZVRB 4W90B 1W26A 2JZ5A 4DR5F 3IFEA 1RBOB 5DG8A 2A2CA 3G8TA 3BV8A 2RF2A 2QLWA 3D5MA 1SH0A 2HK2A 3TRGA 3H25A 4C3MA 3PJ9A 3SXLA 3QGIA 4RW4A 1FKPB 1FNOA 3QWUA 3JYTB 1N8RT 1TK5A 3G6VA 4YOEA 4F50A 1GXTA 2IMOA 3U27A 4R5PA 3DLKB 3Q8VA 2K2PA 4C2MA 4EK2A 1VQ7S 2CJKA 2YNGB 2MLXA 1IKVB 2VG7B 1RXOB 1FRXA 1RISA 1JIHA 2GJIA 2XTJP 5CAAA 5EWGA 1XMQJ 1VISA 1LWCA 3EWGA 5DJBA 4RBTA 4ZVOB 3SBMA 2VA2A 3K5MA 2SXLA 4M94A 4L3KA 1RWWB 4Y6IA 4B9VA 5D0EA 3NNHA 3FBBA 3HKZD 2VDIA 4RW9A 1MROA 2A2DA 4RU2A 3FRZA 1FNXH 1H3DA 4FYDA 4DX5A 2FGCA 2XM3A 4PWDA 1LWFB 3DRPB 1WG1A 2KXHA 1QDUB 2LDIA 4NXNF 1FWKA 1NLKL 3G86A 2HZVA 2XI3A 3MAAA 2DXEA 3G82A 1MWZA 3OR1A 1KQGB 2DNNA 2RRAA 1XMQF 3UCUP 3PX6A 2V4QA 3CJ3A 1U2CA 3CMQA 3MPDA 2MGZA 4Y28C 1S6PA 3JQKA 3RYLA 1XEZA 1KNZA 3TX0A 1S79A 1IVZA 2WSCC 2WBRA 1ZAWA 1KWMA 4NCAA 3VAHA 2I5JA 2K06A 3V2UC 2ZOMA 4WTOB 4ILMA 1RCXB 2FJBB 1ZS6A 1F2GA 1I51B 2MGZB 4J9NA 2B5JB 3DOMA 5E3RA 5MAOA 3C6TB 2R8IA 1YJRA 1HLWA 3E01B 5A8KA 3CJ2A 5H9FK 1KVIA 1TZ0A 4CO0A 2MMYA 3H8YA 2FLPA 4B3MF 2RQ4A 1DTQA 1SUQA 1VK8A 1FWLA 1R6YA 5ITHA 1NK0A 4Q45A 2FJWA 1HBMB 2CJXB 1RHQB 3G4SS 1HI8A 4DPUA 1YSJA 1AZSB 1OY9A 3EVMA 1TUWA 2FHJA 2RSQA 4DSKA 3IR6B 1UWAA 4BLGA 1WF0A 1XMBA 2HVEA 3SFUA 4Z7CA 2HQ3A 2VFVA 4CI0B 1HBMA 2YKMA 2KTQA 2B3TB 2WSEC 1P1TA 4OMFG 1HNVA 5C42B 1K1QA 2HFUA 3ZNJ1 3FEYB 2NPIA 3LPEA 3OTCA 4N5SA 2DBBA 5D15A 1BWVA 2GVZB 3FSYA 1VS3A 1BUXA 1FRLA 3DRSA 4MAKA 3R2DJ 1XR5A 2LXUA 5KG3A 2E5JA 2YKMB 1QD1A 4OI4A 4DUTA 4GO7X 4YB1P 5JVGQ 2R7UA 1KSPA 4DR7F 3C3LA 2CQ2A 1N33F 2XLKA 4PWUA 2HBRB 4XPCA 3NBPB 4M8LA 1PO6A 2LVWA 1HR0J 3BDPA 4NLWA 3D28A 3Q2TC 1YRTA 3Q2SC 4FP9A 5E41A 1AFJA 2GQCA 2ZFHA 3TEGA 1SC6A 4C48A 1TL4A 4QPXA 2Z2LA 2Z4PA 3HULA 4I68A 1X60A 2VODA 1JMTA 2NPFA 4IR9A 2HAIA 2Z2MA 2L48A 1GMUA 2BANB 3TA1A 3NS6A 2QA4G 3A8JA 2AGPA 4YUDA 2HNDA 3GG0A 4DUYF 3DHXA 3H40A 2J6TA 3VCDA 3IWLA 2P5VA 3MEKA 2B56A 2B9YA 4NLOA 4W98A 3J7ZT 2DB1A 4ZVGA 4P7VA 4RW7A 4P2FA 2E44A 2M8HA 2VQEJ 2A6OA 4BWMA 1NKCA 1TL1A 2V4JB 3HVAA 2XMAA 1N0VC 3PV8A 3MMBA 5J2MA 1R8BA 2KRBA 4WIQA 4JV2A 4CYUA 5B0BA 2DXDA 2N4DA 1AFIA 2W2MP 2XYHB 4ECXA 2KKHA 1JLFB 1U2RA 2HRUA 1WI8A 3CDUA 3IBFB 2L3MA 4DG1B 3Q8SB 1WI6A 4OJGA 2BW7A 3FFIB 4USKA 1IJFB 1TL1B 2V4JA 1M90T 3UNGC 3BGRB 4P7TA 4TVAB 2G0CA 2KM8C 5LJ3Y 4U8VA 1JLBA 3NLCA 1VQPS 5DGBA 3WIVA 4ZN1A 4WZQA 3ONQA 2CPFA 3EXYA 1RAAB 2HLUA 4UQGA 1VQKS 1W2IA 3ILOA 3CCSS 4I6AA 3BGRA 3UN5A 3T5JA 4YDXA 1BQNB 4USTA 2FHKA 2ZBIA 2QLXA 2C3UA 1IXKA 1RB0A 2DGVA 4YY3J 2MY8A 4OX9J 3PRDA 4FPIA 3VGUA 3HVTA 1C0UA 2UUWA 3KJNB 4CH0S 2JSXA 1WELA 2D7SA 3UD5A 3ZTOA 5B0CA 4RUAA 4X64J 3O8WA 4K7QA 3GJQB 2QYGA 3P96A 5BR8J 3GIMA 3LP0B 2EFPA 2H5JB 2W4PA 2GGPB 4JI4J 3PKMA 4OYZA 3K7RA 3MR6A 4XTTA 4ECYA 1TMMA 3T1HF 1XERA 3A8IA 2W25A 4PQAA 2QFIA 2XQCA 4UY8T 4USUA 2CJ9A 2H5IB 3ICLA 2ALYB 2DNHA 2H65B 2HZAA 3G96A 3N0VA 1NAQA 1R7IA 2KG0A 2DJWA 2V9KA 1R31A 4Y2MA 2ILZA 1X4CA 1YX2A 3I5AA 2MHEA 2V0NA 4TKTA 3RRGA 2QA2A 4P9SA 1XTZA 4UOGA 2HAFA 4P10A 1AUSL 2J8SA 2HEKA 5K20B 2QSFA 3LWLA 1Q1KA 1BD6A 4KY3A 4M5DA 2ASLA 5HP1A 3NMAA 1URRA 2X1FA 4ZLNA 5A0YA 3CC7S 4UW2A 2G2YA 1E6YA 3PDNA 1WORA 3QATA 2R9LA 3BZQA 5FD1A 4F4XA 4F4WA 1HWJA 1MU2A 3CCVS 1UZHA 5G0RB 3SI8A 3B8HA 1NK7A 4LFCJ 3FRYA 1KHWA 4DQIA 2C42A 4UTGA 5CZVA 4FXVA 1NK8A 3CIZA 2M2BA 2ROEA 1FERA 3MCOA 2HQGA 3KLGB 2CQHA 4WE1A 4AL7A 2B9EA 1XK8A 1TK8A 1Y5NB 4R0EA 4M5GA 2VIHA 4LBPA 4IO1A 2ZBQA 4RBVA 5IT4A 3HPOA 1PKUA 4HI2A 3D0GE 4OZ5A 2FQQB 4ZP7A 1QTMA 4C98A 1S97A 1CJVA 2DISA 1NRKA 2CNLB 1GXLA 2JOQA 4ANDA 3DMJB 1CS4A 2VPXB 4WU2A 3TZXA 2N3OA 5BYQA 1J5OA 1TFWA 2EG1A 1TR0A 1H0HB 2F7VA 4ID8A 3ZXWA 3MMJA 4KH0B 3M9MB 3KMSA 1G3OA 3WX4A 1I5OB 3DRRA 5KFYA 2IMWP 3WBZA 2VL1A 1TTHB 4DJBA 1JLAA 4LRFA 1QSYA 4DV0F 5EGYA 3W8GA 2BE9B 2B9WA 5IOLA 5CD4A 3JB9k 4UUXA 1CLFA 4CNYA 1T05B 5DG9A 4J7CA 1RAEB 3IXQA 4JB8B 5D3GB 3MM7B 4ED7A 1YHQS 1TK0A 1B7YB 5IZHA 4PWWA 1RZMA 1HQUA 1R0AA 1R89A 3PFOA 1T9TA 2W8KA 3J7Z5 3KK1B 1VLYA 2A18A 2VH7A 4NLUA 4LSLB 3ETOA 4MKAA 2MQPA 3BYRA 2X7IA 1SJ1A 3UO0A 1AA1B 2EWHA 4NRUA 1TAQA 5B0DA 3ENAA 5M2RA 4PXCA 2CDQA 4GVBA 4GRSA 3NNAA 1R6VA 5B0AA 3AFGA 3IMQJ 2W24A 4KGVB 4LSLA 3GCWP 2JC0A 2ZKTA 3FVYA 3VWSA 3THTA 1HI0P 1GMWD 4OIXA 1WACA 2PFFB 3N79A 4DFKA 2EKNA 3C14A 3MCSA 3KTQA 3VQTA 3NMRA 1N88A 2WSFC 4J9OA 2FVRA 3FC9A 1PBAA 2FB0A 2W7AA 5K5MA 1S1TB 5KFOA 4M5MA 2RS2A 3TI0A 2HMIB 3V4IA 2ZBPA 3LP2A 3NGTA 3WQPA 5KT3A 4F4ZA 3I0SB 3CJQA 5EUHA 5L38A 1Y00A 2DCLA 3QLHB 4Y65A 3R8YA 3OL9A 2RB7A 1X4EA 1ZBTA 4OI2A 5GAEI 1K0VA 1RK8A 2H1YA 1YKWA 3N28A 1PILA 2M3DA 5M2UA 1UFLA 2CADA 5A8WB 3KUHA 1R43A 2ZUAA 3BPSP 3W7BA 3RB6A 4F67A 3G82B 2KXFA 5DZ6A 2RQCA 3KOAA 3PRBA 4LR9A 2OFHX 3CF5Q 2FJXA 3AHPA 3KHLA 1HWLA 4Q8FA 3EXCX 2CQBA 3FCVA 2FJDB 4K5RA 1C1BA 4LR8A 3PXGa 4PXEA 4QIGA 1CC7A 3KFWX 4JV0A 2YQ1A 3HZGA 1Y5LB 3R5BA 5F3ZA 2ATLA 1JX4A 3SDEB 5EX0A 2CVEA 4OZ1A 5KOXA 3C6TA 3HT3A 2UXCJ 1S48A 2OPQA 4MH8A 2U1AA 4ZN3A 2K8GA 3SZ2A 1H98A 5A2QU 3T3FA 1F60B 1FESA 1FVQA 1U2FA 5HSPA 3PW2A 2UP1A 2LQ5A 1IBMJ 3TAMB 3QT6A 1QY7A 5K8MA 3EVWA 2ZM6J 4OX9F 5DG7A 2V63A 1GQEA 3VVTA 2R7WA 3RB0A 3G71S 1G6BA 2RKIA 1Y3KA 4I2QB 5HBMA 3FBCA 1RU1A 3DLKA 1R8HA 4E2FB 4EWTA 2JHEA 2W2NP 1S4EA 1IJEB 1T95A 2HPUA 2AU0A 1XIQA 4PG8A 2I8EA 4B08A 3IWXA 2VFUA 4NLRA 4WYWA 3R97A 1YVFA 2VG6A 2RKIB 3BJYA 2AP6A 2WHOA 4JI1J 2YNFB 1WOSA 1P27B 3OR2B 3B54A 3VAKA 2ZC4A 1HWIA 2NQPA 4PXBA 3V6HA 4NASA 1REVB 1Q5VA 3CCQS 1CC8A 1VRUB 2CZ4A 4PWDB 2ERRA 4K59A 3W9IA 2E1CA 2VZ9A 4B3RJ 2J9DA 4LIRA 9ATCB 3PW5A 3H2VE 4JV5F 1ZM9A 1N5SA 2KT5A 4J37A 2HWIA 5SUHA 2IYIA 1VQYA 3HDSA 4DV3F 2CZ9A 2EVZA 1KLMB 2CPYA 2GZOA 2HGNA 3MEEA 3UR3C 4YMEA 4NLYA 5J1EA 5HO4A 1RYSA 4O3PA 1KQFB 4I6YA 2LU2A 2ZBRA 5LOQA 4A8SA 2VFSA 2AZ1A 1FF2A 1VYAA 4DPTA 4NYZA 1BWEA 4NA1A 4BHQA 2W01A 1W25A 3N6MA 3LWMA 4A8QA 1XNRJ 3MR7A 2OD6A 3GJSB 4XIUA 1XNQF 2Q1LA 2UXCF 4DI6A 4MIBA 1FNMA 5T41A 5B09A 1P9QC 4CIOA 5JUMA 2XC9A 2BR0A 5H1SV 1RTDA 5LMUF 4ZJOA 1KTQA 5LSLA 1SIWB 2VDHA 2FY8A 4UUWA 2JC1A 4B3TF 3CULA 2QGFB 5K9FA 4A8MP 4QPTA 1KEKA 1N4LA 4PUOB 4UOHA 3MMBB 4LF8F 3H59A 1RBLA 3NOGA 2FVSA 2B4VA 2H3EB 1R8CA 5J2PA 3D3BJ 1S9GA 3BBFA 4IH6A 2E5GA 3FSIA 2ZHAA 4DSFA 2NXCA 3KJFB 1UJ5A 3KK3B 2H48B 5GMDA 4UZCA 3A1YG 1CBKA 3MXHP 2OPRA 2Z0GA 1FD2A 1RHJB 3DOLA 4P71A 4Z7YA 1RKJA 4KRWA 5THWA 1T3OA 4C3LA 1X4FA 2QLFB 2NYHA 3DXSX 3RBXA 3MMAB 1OYEA 2JVRA 1VRTB 3DGPA 2LDYA 2XZTB 1HA1A 3HX9A 1SVDA 3OTDA 2MTLA 4KO0A 4RX6A 1KONA 1LWXA 4J9LA 1NJZA 2OPRB 3GE9A 3NCRA 4KQZA 4U7CA 4DF8A 2L08A 1IWGA 1H72C 1KBRA 2RJZA 5A76A 3M30B 4A8YA 3HFKA 4JYAF 3D54A 1HNIA 3NBPA 1RT7B 4JI7J 3OPKA 1C0UB 5H9FJ 4ECTA 4JUZA 1JJCB 2CYYA 1VRTA 1HD0A 2Q3PA 1NDKA 3DGPB 4H4MA 1D09B 4KO0B 3D67A 3MFHA 3EPGA 1N33J 2GO9A 3RG6A 3I9V9 2IHR1 4HTJA 2V6AA 2XYGB 3O5TB 5DZ7A 4RJVA 1KOOA 4ZJQA 1Q16B 3J80Y 3R5AA 2ZZTA 3IM9A 3MEGA 4H4MB 2GMLA 1IR0A 4B17A 3EGWB 4Y0FA 2DXFA 5C2CA 2R2SA 4MYUA 3GONA 4IH7A 1VBKA 2VPZB 3NS7B 2GIRA 3OXLA 5DO2A 1RTHB 5FLXY 2ADBA 2VB6A 2FYXA 3KLIA 4HACA 4ZCLA 2BQ3A 1J5EJ 2PEHA 4L72B 2HFZA 2DD8S 5J2MB 2IAJB 1O5JA 1QAXA 2NZ4A 3AODA 4L73A 4ED2A 1RJJA 2FD2A 3OL8A 3MTKA 3HSGA 4DG1A 3UDVA 2Z8QA 3POTA 4A4JA 1NB7A 1SCJB 3CB4A 3KLIB 2IIHA 4HACB 5HVHA 1Y3JA 1NPRA 5B7WA 3DYAA 3HHEA 4HHHA 1JLBB 2LP4A 4NLGA 2HHUA 5HJYA 1Z2LA 4IKAA 4ZP9A 5AE1A 1NCLA 1Y7PA 2K7JA 1EP4A 1KDNA 2ZITA 4HLBA 3ZC4A 3R1HA 2FHOB 4ECVA 2W9BB 3NXZA 2KL8A 1TL3B 4DV1F 2DR7A 3SQGA 4B3SJ 3U02A 4HKQA 1IQZA 4NYPA 1D3WA 3W64A 1FFSB 2HHPA 1H38A 1JLQB 1YBTA 3V6DA 1GMWA 2XHCA 3MI7X 3HMJG 4WTYA 2E7VA 5E3QA 3GSIA 2KB2A 1QSLA 1Q53A 3EZUA 7FD1A 4ECQA 3DC2A 4OYBA 3SCLE 5LMNJ 3R7NB 4FYWB 1RAJA 2F5GA 3CJKA 3KLEB 3EZ5A 4PXDA 2G13A 1DZ5A 1FEEA 5ETSA 2DEJA 5A8RB 1N36J 1BGXT 4IO9Q 4IDKA 1LW0B 2XWXA 6AT1B 1TU0B 4CH1A 3CJ8A 3THVA 2BE2B 4LMZA 2HHQA 1KLNA 5DQIA 4DFPA 4PEOA 4AE5A 2CJYB 4H4OB 1ZTTA 5C2GA 4Q0BB 4I7FA 2NYIA 4XAKA 1KP6A 3N5FA 1EQ0A 1V3RA 2ZH5A 4MKVA 2OMLA 3J81j 1HBUB 2BJ7A 4MT1A 3BN4A 5E7OB 3HXMA 4C8LA 4F3OA 4O3RA 3AQPA 3O3LA 5ETTA 5GADI 1VI7A 1D9AA 2LEAA 2RU9A 1PYTA 5D6GA 1LQ9A 7FDRA 3QO9A 2FPHX 4DR4F 1R0AB 2VOPA 2MSTA 4RNMA 3KLHA 1NU4A 1PCAA 2BM1A 1VQLS 2J6SA 4DQQA 4K4XA 1PAEX 3D1OA 3DOKB 2VBWA 2E29A 2CQDA 3QO9B 2ZH9A 4F2RA 4LF6J 4ED3A 3SYZA 4FF2A 4DL5A 1HYSB 3PYDA 5SZTA 3CD7A 5H9EJ 1AROP 4UT4A 4X64F 1HD1A 8AT1B 2XYPB 2QZ8A 1CJKA 2ZBCA 2MDAA 1YJNS 2DHSA 2V94A 3I31A 4KGMA 2R8JA 2E9RX 4ICLB 1BXNA 2RF2B 4LF7J 3DLGB 2D41A 3R1LA 1HBNB 3RR8A 2ZH2A 1FFWB 1H2UX 2KDOA 3ETMA 1S9EA 5D77A 1UFKA 3FUYA 2NCKL 3NGUA 2HNZA 3VVUA 1DQAA 2YNIA 1KQKA 1RT4B 1N6QB 1BQXA 3CD5A 1S1VA 2BW2A 4J9UE 5FIIA 2MLZA 4RU9A 4AT1B 1U48A 2RDIA 3ILJA 3MECB 4EMDA 2D3UA 2WTFA 4ZK7M 4TQSA 3ILIA 1M5KC 1AYEA 2R7XA 1LWCB 2MQ8A 1M5SA 3NCQA 3VAGA 4WFNQ 5A8WA 2O01C 2RVJA 4WJBA 4YEAA 2DNOA 1S0MA 2R2UA 1X4DA 4S0MA 3GQCA 1U6FA 1AUDA 3O2IA 2N7CA 5H9EK 1QTNB 3DU5A 3TA2A 3P45B 4DV1J 4RNHA 5KFVA 2M5YA 2E9TA 1C1BB 5DM6Q 2YXLA 3MMCA 2RRNA 1IBMF 1WHXA 3KDOA 1EQMA 3BKUA 3D3CJ 1N5QA 2AYGA 4AFFA 1FD8A 2YVSA 2FZGB 5AXNA 4X4QA 5I42A 2VBZA 5IT9U 3SIPB 2HURA 2NUHA 2Q6CA 1X5SA 2W7OA 1WNEA 2KT2A 4HT5A 4JI0J 3KKFA 3OQ2A 4ZP8A 4FVMA 5FDLB 4YS2A 4B3MJ 2XBPA 3R7SB 3TVYA 3B4MA 2X1GA 5EHHA 3G8SA 4U7UD 3US5A 5F0UA 3GIIA 2V8HA 3TAMA 1R0CB 4NYOA 3J7AN 3BSNA 2OEKA 4LSZB 1GTHA 3MAQA 4K50A 3CC2S 2AX0A 2R4FA 1NUEA 2VPWB 3MM6A 4UY85 1Y0HA 4PG5A 3TUJC 1LKZA 4ZVTB 2GS8A 3Q24A 4M5KA 3DRPA 2ATCB 5IT0A 5HN0A 2DR8A 4DPOA 1NDLA 4FNIA 3KLFA 1TVRA 2QT7A 2ZVIA 4KSEB 2IDEA 2Z2ZA 3AD9C 3OR2A 3NWRA 3TJ8A 3MM6B 4HHUA 4ZDNA 3UDCA 4HH0A 4C0BA 1NKEA 5LL6d 4K0KF 4KGZB 5ETPA 4DR6F 2G0JA 4F4AA 4U8YA 3AAWB 1U8WA 4HDHA 3M4XA 1OWXA 3ILLA 2V9WA 1UEKA 3VTIA 2BX6A 2YTCA 2F1FA 5HMZA 4LF2A 3CCRS 3OSNA 2YY3A 4LVNP 1IBCB 3ET6A 3I56S 5FJ4A 4CLPA 1FXRA 2WVEA 3PNIA 4PKDB 2W7PA 2Q6BA 4UF4A 4K0KJ 2N3LA 5E3CA 5F8MA 1TKXB 2BQRA 4TNOA 2UU9F 4RWWA 4ES3A 4CCHA 1FK9B 4MMOA 1VJQA 3P49B 2CZVC 4PYAA 1WC1A 3KJVB 1S4FA 3FMBA 5LJ5Y 2Q66A 1NHVA 5U47A 5HVGA 4DR5J 1F2HA 4KKOB 2J0WA 1WJ9A 4RLEA 3ZNUA 1P9YA 5KG2A 2ZH6A 1PYSB 1RWMB 4OV6A 2BDPA 2HQCA 3OUYB 4CLZA 2D9PA 2HNDB 4HHJA 2PMZD 3HK2A 2W2QP 1OJ4A 4EYHB 4WK3A 3ZFVA 4YR2A 2FHMA 2E5HA 1NK4A 2RHQB 4P72A 2CQ3A 2NXEA 2AZ3A 2E9ZA 6FD1A 2DNMA 4URSA 4XK8C 3KK3A 1N0UA 3OUYA 4ZCIA 3CO0P 4FKXA 5B0EA 2FY1A 1UWBB 2DIVA 2E5IA 4FYVB 4LBHA 2NS1B 4Y2IA 1M1HA 3DOLB 2BJEA 4ZJLA 3RGIA 1N52B 2A6MA 3C16A 3O6QA 4QZVB 5IC6B 3K58A 1YI2S 2HGMA 3W8PA 3TJAA 4EEYA 3PY8A 2ZEJA 2IC3A 2FJAB 1DARA 2AV5A 3KHHA 1R3NA 2HHWA 1HNZJ 3CDAA 4QR1A 1C4CA 4W92B 1RWPB 4QIWD 4DR3J 1SXLA 1QE1B 1UETA 4C0HA 3C16B 5CHCB 2GHWA 3M7VA 3A3NB 2GV1A 1FRMA 1HHTP 1RT2A 3BR8A 5BJRA 4ECZA 4DR4J 3BQ0A 1HMVA 2JJ4D 4CO4A 3E51A 2FUG9 1RUSA 3OL7A 4DS5A 3FBEA 4PYDA 2JLEA 4J9SA 2ZKUA 1EARA 3AY0A 3DRYA 3IGVA 3HVTB 4I4BA 1NHUA 4DX8H 2ZM6F 4AUKA 4N47A 2F8MA 2Z58B 4NEZA 5CQGA 2C2RA 1ZETA 2UXBF 3NAHA 1NZAA 2DPJA 3W62A 1TP7A 5BR8F 1JLFA 1X9MA 1UVLA 1UEUA 2OSRA 2CXEA 1N32F 2XWYA 1T9XA 4QR2A 1X9SA 5DRKA 1DLOA 3M2UA 3G8QA 4ED4A 1S76D 1QUPA 1B64A 2IPOB 3VZIA 1VC0A 2IAJA 2H9ZA 2F4FA 1YBAA 2JWNA 1MN9A 4O0NA 4C3KA 2PA8D 3CCES 4GC7A 1N32J 3OV7A 4EU0A 3POTB 1LFPA 1H7WA 1F5AA 4WXOA 5ETVA 3CCMS 5E2QA 2HFSA 1YITS 2HVIA 1HBOB 2Y1LB 5KFCA 4DS4A 4PQUA 2RU3A 4DV4J 2YKNB 4OX6A 2IJRA 3KHGA 3Q8YA 1C0TB 1ICEB 4HL9A 4LT6A 1VQOS 1YDLA 2VFTA 1HNZF 1M0SA 4QU6A 1VFJA 1WUUA 1YJ9S 1VBXA 4O23A 1UP1A 2A0FB 2M8DB 1S0VA 3FQKA 1REGX 1S12A 3CCJS 5DQHA 4PQUB 2ZNZA 3MDFA 4AL6A 2PI5A 2D69A 4NRTA 4XO0A 2WOMA 3CDEA 1S99A 1ACMB 1HNIB 5L9XA 3S1TA 1VBYA 1NDPA 2BOAA 3F44A 3PEHA 5KT7A 1UA1A 2R8KA 3N6NA 2LQBA 3KNAA 3D6HB 4O44B 3T1AA 1RQ0A 2ZWOA 2DITA 3T41A 3HM9A 4HYKA 2C2DA 4YP3A 3SSRA 2UUTA 1U1NA 2RRBA 1EKSA 4DMZA 1VHIA 3Q89A 4IDKB 3GV7B 1LEOA 1SL0A 3C6UB 2W4CA 3AQOA 1NJWA 4N8OA 3L7UA 4PG6A 2D74B 1PBUA 2YPYA 1CJVB 4K4VA 1SV5B 2NSCA 2EFOA 4JI8F 1RT3A 2Y0BB 2C2OB 2VFRA 2UU9J 4I67A 3NGRA 1FA0A 4KV8A 3H2LA 1WEXA 2J7UA 2P2CB 3VGTA 3CJTA 3P8BB 3A8EA 4NMLA 5I3UB 3C6UA 2EBGA 1C1CA 3IRXB 4A8FA 4F4KA 2HHTA 4MYTA 1FX2A 4WU3A 4KHRA 1RKIA 4E0DA 3P6YC 2JLFA 4JP8A 3M8QA 3SMZA 3V4MA 4WIIA 4A48A 1T94A 1V6HA 1ZAVA 2HFNA 3SSQA 1TUGB 2AJ0A 2WVCA 3I0RA 4HR2A 2WVDA 3IO1A 3ISND 1C1CB 4IG3B 4OV1A 1NPKA 3VGVA 2FVPA 1HW9A 2CJAA 1YWXA 1N36F 4QIEA 2DR9A 3C8YA 1LWEA 2Y9HA 1PSDA 2QMWA 3M8QB 3F56A 5LMUJ 1QAIA 1VDHA 5E3PA 3VF0B 4V19J 2JEFA 2Y1RI 5JMNA 2GHPA 5F9NA 3JS9A 1T9WA 2EXUA 2K7KA 5L1KA 4ZIWA 1D0EA 2CFXA 1X4GA 4RZRA 4UOFA 5HP1B 5C25B 1LK5A 2XMVA 3BSCA 5IQ6A 1F0XA 3MOZA 3GLJA 5GMKa 4DV0J 2GMJA 1XMOJ 5DS7A 4M5JA 4DU7A 2XG8A 2OPSA 2YX4A 3T5KA 2DVIA 5J2NB 2VHGA 2LECA 2B7CB 1S9EB 4N7TA 4NLSA 1ZPVA 3ENQA 4DV7F 1URNA 3CMAS 1U25A 5GADU 3J7YU 3FZBA 4WE1B 4CNZA 3I55S 5DM7Q 2CNKB 3A3OB 5ADZA 3PO5A 1IKYA 2A3JA 4MJKA 2POKA 3W60A 2OPSB 4C8YA 1UVIA 4USMA 2ROGA 1LOUA 5CZXA 3W5ZA 4DV2F 3QJJA 4AQYF 1OS5A 2QG9B 5KT4A 3HJFA 2XGPA 4USIA 2ASYA 2R42A 1GT8A 1B0TA 2BACA 3MGJA 4CO5A 2EG2A 4KBIA 1CULB 4JI1F 1DTTA 4NPOA 4PG7A 2AWZA 1L3UA 3H98A 4OYPA 2AKWB 1TELA 4IOBA 2XS5A 4JYAJ 2ZH8A 1TUVA 4DR2J 1NSPA 2IVYA 5L1IA 4YFUA 3BREA 2OO4A 3IR7B 1RI7A 1SL2A 4O3OA 3N01A 4PPDA 2NZCA 1BQMA 3P5BP 2CQIA 1KS2A 1V5VA 4HI1A 2MJUA 2MQOA 3KLHB 1JLGB 2OP5A 2DNRA 2AYMA 3JTPA 1T02A 3W2WB 5DETA 4ED6A 4Y2CA 4JV5J 1QSSA 2M70A 2CG4A 2FLOA 4J9KA 2RE1A 3W3SA 5F3TA 1BQMB 2BBEA 4OYIA 3X1LB 1KVJA 3P4UB 4DSLA 1ZH5A 4ETZA 2YWHA 4ZVUB 2IVFB 3T1HJ 3EJMA 2OSQA 2NSBA 3LH2S 5GAHI 1KQSR 1D1UA 2CPDA 1RTIB 1HNXJ 3D9BA 4GKKF 3CEDA 1HWKA 2YWKA 3W5YA 1FVSA 2FJVA 5HQLA 3GJTB 3I0SA 1UVNA 3DLGA 5KG0A 1SH3A 3SFGA 2V2QA 1RWVB 2B8QA 3HD2A 1RHUB 1HQEA 3QT8A 4K4UA 2J9DE 2GJ2A 1OSCA 2CDRB 3ISNC 2V8GA 3I6PA 3AOBA 4JI7F 1RT4A 3IBWA 1YRUA 3CJ5A 1O6XA 3DU6A 1JJ4A 5IWAF 5T7LB 1SL1A 1Q78A 1FKAF 3ELHA 4RW9B 4WPAA 3MUMP 4OL8A 3G6YA 3JXOA 5HMYA 1YRXA 1ZA1B 3QPIA 2JVOA 5HQMA 2OEJA 3NEKA 4O0IA 1NM2A 5KFWA 2ZH1A 3R6LB 1KC8T 1MMLA 1IUJA 3VAFA 1F9FA 4HVZA 4DUZJ 1F9EB 1NB2A 1WTBA 4J9VA 2YPZA 2MY7A 4XDDA 2LFVA 5AE2A 5K8PA 1NMEB 4X4OA 1XR7A 1HHSA 2AF6A 2O67A 3NP5A 2HS0A 1L3SA 4ITSA 1SC3B 5KFKA 1M1GA 2ZHOA 1RA6A 1ZM2A 2YWGA 4DCOB 2J5AA 1KLMA 2QMXA 2AEMA 4IFVA 4K2XA 2Y3YA 4DV4F 5D4OA 5I42B 3HHLC 1U1RA 1Q7YT 4CP5A 3KJVA 3AOAA 3V81B 3B4DA 2CPEA 3HHNB 2MQLA 2ZVSA 5D4LA 1WKLA 4ZVSB 3GU0A 5JJBA 2C2MB 2QL9B 1SUQB 4JI2J 5BXIA 4TLRA 1SIZA 3DLJA 4ZPTR 4DUZF 3AD8C 2DHHA 1VIXA 3HHLB 4CLUA 3AT1B 4MIAA 5KFFA 3OHAA 3C15A 3K5PA 5DDQC 2C2NA 4N56A 2GA7A 4DV3J 5F8IA 3A12A 1RYRA 3L7PA 2I1RA 2H54B 2MKSA 3M6XA 5KFEA 3TUZC 4WWSA 1REVA 4Q5VA 4WFZA 4P2MA 5L46A 1QVGR 3QJPA 2YH0A 1SKWA 2YNHA 5GAEU 1O8BA 3WHIA 2KU7A 2VC0A 4CDIA 1Q81T 2MHNA 3CD0A 2CJBA 1FEHA 3GP9A 4X66J 3KLFB 1YJWS 3BB5A 3QSIA 2PD1A 4C8KA 2W2OP 3MR3A 1CJUB 1ZM4A 2FLNA 2WAQD 3CD6S 5DLFA 1N5VA 2YNHB 3BM7A 3Q86A 1V3SA 1SB6A 1WG4A 2DO4A 2VG6B 3A3PB 4ZIVA 5CABA 4G1QA 2VQFJ 4BDPA 2GVDB 4IRDA 3AB4B 9RUBA 2R8HA 2R8GA 5K8OA 3FDSA 1Q86T 4ZPVR 1RAIB 1HNXF 1CJUA 1EAYC 1LXNA 2YKOA 4FBTA
chains in the Genus database with same CATH topology
5H9EK 5CD4A 2Y8YA 4U7UD 5H9FK 3QRRA 3QRPA 2Y9HA 4DZDA 2Y8WA 4QYZK 3QRQA 1WJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H9E K;  5CD4 A;  2Y8Y A;  4U7U D;  5H9F K;  3QRR A;  3QRP A;  2Y9H A;  4DZD A;  2Y8W A;  4QYZ K;  3QRQ A;  1WJ9 A; 
#chains in the Genus database with same CATH topology
 4OHW A;  1FJG F;  2WB4 A;  1WSV A;  4ZS6 A;  4YHH J;  1SJF A;  1YJT A;  1VQ9 S;  1PAU B;  1TKX A;  4OFZ A;  5KFR A;  4DLG A;  2ZZN A;  2FLL A;  5J1E B;  1OQ6 A;  3FGV A;  3KNG A;  5E0O A;  4DU8 A;  5KOW A;  3RAX A;  1VC6 A;  5B08 A;  4F8R A;  2O3D A;  4TU9 A;  4RNF A;  5J2P B;  1U6Z A;  3OT9 A;  4JOU A;  4RKU C;  5IS2 A;  3H5X A;  3D6M B;  1DTQ B;  1NHK L;  3MEG B;  5KG1 A;  1DAX A;  2IRX A;  3BYP A;  4URG A;  4ZCK A;  3RAQ A;  1UTA A;  4YHH F;  2HHX A;  4ZIT A;  4CWB A;  1JXE A;  4GVL A;  2DY1 A;  4F4Y A;  1OMS A;  2XHW A;  1VJW A;  5D4P A;  3KG0 A;  3LF0 A;  1S10 A;  2V68 A;  4DV7 J;  1S77 D;  1FE4 A;  3RW6 A;  3MM5 B;  2DGS A;  2QYC A;  4FKY A;  1RTH A;  4LBI A;  4RUC A;  1I1G A;  3D68 A;  1IBL J;  1WHV A;  4ED5 A;  3PW4 A;  4AQY J;  4I0W A;  5IM0 A;  3PJW A;  1N5Y B;  2HRY A;  4CO1 A;  1JLE B;  3GZ7 A;  4RW6 A;  2QA1 A;  3TVZ A;  1TKZ A;  2VU5 A;  2YX1 A;  4ZLP A;  1L5U A;  3GYX B;  4B3S F;  1VQ6 S;  2HG4 A;  4JI6 J;  2ACY A;  4KE5 A;  4ZVF A;  4AXJ A;  5DDO C;  3GIL A;  4MK9 A;  2VJV A;  2F4V F;  3BO2 A;  2CNO B;  2PSZ A;  2JX2 A;  2X1B A;  2XZD B;  2HFO A;  2DGO A;  4J5O A;  2KN4 A;  2F9D A;  3MWB A;  4DPW A;  4ZKA A;  2ACM A;  2YKP A;  2ZH3 A;  1S72 S;  4NLD A;  2W9B A;  4QWD A;  4DR1 F;  2RAQ A;  4LF5 F;  2DGX A;  3UI3 A;  1RT2 B;  3K5O A;  2DH8 A;  2X51 A;  1FJG J;  1FDB A;  2GAH C;  1D9F A;  2HYI B;  2VA3 A;  4NXM F;  3ITH A;  3PAC A;  1JLQ A;  1UKU A;  3CCW A;  2XLJ A;  2EI5 A;  3VAL A;  3V6D B;  5L1J A;  3JTN A;  3DCA A;  1Y4Z B;  1XC9 A;  2VON A;  2W8L A;  2DRA A;  2KO1 A;  5HMW A;  1PYO B;  1S1W A;  3MCN A;  4ETX A;  4EBE A;  2UVU A;  3ITH B;  2KVI A;  2QLB B;  2Z56 B;  3RR7 A;  4OI0 A;  3W61 A;  2WVF A;  2FTR A;  2B43 A;  4M5I A;  1CVJ A;  1VK3 A;  1OY8 A;  1LK7 A;  1S1W B;  5K14 B;  2KH9 A;  2R7R A;  1KRP A;  2DT9 A;  2RD5 C;  2IJF A;  2DTJ A;  4IOA Q;  5F8L A;  1ZA2 B;  3DM2 B;  4UZB A;  3W1Y C;  1U8S A;  3QFH A;  4NLQ A;  1RHK B;  2QX0 A;  1PJ7 A;  2MJN A;  3MPU B;  4P6Q A;  5K14 A;  3LUY A;  2DRB A;  3EE3 A;  3Q8U A;  4RR5 A;  5LT5 A;  4K4Z A;  4M63 A;  4MTP A;  1YLX A;  5A0Y B;  3ZZY A;  3MOJ B;  1U45 A;  4C11 B;  2HGL A;  4OLP A;  2C3M A;  2AYB A;  2MKI A;  2FC9 A;  4WP8 A;  1VHF A;  3GFZ A;  4LUB A;  1DQ8 A;  3IGN A;  5J2Q B;  4NI2 A;  3CJK B;  3L4B C;  1RT6 A;  3FEX B;  4LRC A;  4NLV A;  4PCQ A;  4LRD A;  5HJX A;  4O4G A;  4K4W A;  4R8U A;  2WOM B;  2IY5 B;  1FKO B;  4AL5 A;  2J7K A;  2B4U A;  1HYS A;  2QFJ A;  3GV5 B;  4Q43 A;  4EZ6 A;  4OZL A;  3PW7 A;  1TL3 A;  2FVC A;  1SI9 A;  4G6V B;  4I1T A;  4RW8 A;  3EPI A;  5J2Q A;  4B3O A;  2KZZ A;  4JI5 F;  1AW0 A;  1VMB A;  5ETO A;  2E1P A;  2C1E B;  3VAI A;  1GAO A;  1W7W A;  3TOQ A;  1WC4 A;  3ZZO A;  1CSJ A;  2P8I A;  5C5J A;  4DDF A;  1ZZF A;  3JSR A;  3MPW A;  2PA3 A;  1TAU A;  3AJ2 A;  2IM3 A;  5A2Q Y;  1GH8 A;  1Q8B A;  2DNG A;  5HAT A;  2LQJ A;  2UV8 A;  3K5N A;  2EK1 A;  4RW8 B;  3PO4 A;  4F2S A;  3IG1 A;  3W66 A;  3IM8 A;  4PG4 A;  2CNN B;  4CLK A;  1SV5 A;  1FWP A;  1ROF A;  2KYX A;  3JSY A;  1RDR A;  1M5O C;  1IWA A;  1RT3 B;  5CCL A;  4Q8E A;  2M9K A;  2V2V A;  1DTT B;  3S7R A;  3TYT A;  3TZW A;  4CO3 A;  4E98 A;  3S8S A;  2F8H A;  4B9M A;  3MEC A;  4LF9 J;  2IM1 A;  3ZZP A;  4K2J A;  1U47 A;  3BN7 A;  1IM6 A;  3QGH A;  1X4H A;  2RS8 A;  4NZ0 A;  4J9P A;  5I3U A;  2ADC A;  3AA8 A;  1H2V Z;  4JI6 F;  1T05 A;  4AYB D;  2QLJ B;  1F3F A;  1NXI A;  2MKK A;  2BRK A;  4IRC A;  3K0J A;  1DHM A;  2IDL A;  4X4S A;  4OJ1 A;  4ELT A;  4JBC A;  5CXT A;  3AJD A;  1GNK A;  2ZE2 B;  4R25 A;  2QO3 A;  4BS2 A;  3IR5 B;  4DL0 C;  4WKR A;  5B0F A;  3MMC B;  4DCP B;  2XY7 A;  4ZPC A;  1S1U B;  1E6Y B;  3KXD A;  3QT5 A;  4QBU A;  1JXL A;  2E5L F;  3DNC A;  3H20 A;  4NMX A;  4IFY B;  2BJ1 A;  2E1A A;  3UVJ B;  1U1M A;  2Y0S D;  2Y8Y A;  2A1B A;  2MQM A;  1DRZ A;  2E1R A;  2YNI B;  3DOK A;  1WEY A;  3Q83 A;  2V5H G;  2C3Y A;  1Q79 A;  3G6E S;  2AQ4 A;  4CO2 A;  2J6U A;  3TA0 A;  1RT1 B;  2GW8 A;  3K57 A;  2HW3 A;  6FDR A;  3HF5 A;  4DR3 F;  3W9J A;  2G0I A;  4CT9 A;  4DN9 A;  5J2N A;  4OI3 A;  5E33 A;  5KG6 A;  3D1H A;  2QMU B;  3VZH A;  3SCK E;  1JKH A;  2VKZ G;  1RWO B;  4QW8 A;  4DR2 F;  2LQ8 A;  4ILR A;  2X1A A;  2ILY A;  2E66 A;  4ENO A;  1OPI A;  3KUE A;  3KWM A;  4Y34 A;  4CLL A;  4RO0 A;  4X65 J;  2F4V J;  1HBN A;  1EIY B;  2M4M A;  2GJF A;  1YJ7 A;  1WOO A;  2K3I A;  1IKV A;  1EET A;  2VG7 A;  3CSK A;  4L3N A;  3TVK A;  3QQC D;  1HHQ A;  2GX8 A;  4NL5 A;  4XDC A;  4N41 A;  1G4C A;  2BXJ A;  1WF1 A;  3AXM A;  2Z57 B;  4QWB A;  1S1V B;  2E7W A;  1PJ5 A;  3R5C A;  4OJH A;  4WFY A;  1TVR B;  5D0R A;  3I4P A;  3RJM B;  3DDK A;  3VV2 B;  4DPY A;  3I82 A;  1QVF R;  1L3K A;  4URQ U;  3KLV A;  2CAJ A;  2QIF A;  3SCI E;  1EET B;  4ED8 A;  5KFU A;  4YDD B;  5IC4 B;  3SV4 A;  2V8D A;  4NXM J;  1S49 A;  1S6U A;  4EGL A;  2KXN B;  4WFX A;  1SJR A;  1V3Z A;  5J1P A;  3DLL Q;  1U0H A;  1N5T A;  2QTW A;  4NLP A;  3KK1 A;  5G4D A;  1LW2 A;  1I6J A;  3NRB A;  3SDE A;  4ZPA A;  3E3X A;  5FLX U;  3F0N A;  2R7O A;  2ZOG A;  2HS3 A;  3EM1 A;  5F8J A;  5ETR A;  3GPA A;  1I94 J;  4KGX B;  1XWL A;  3I5B A;  1N48 A;  4F02 A;  1VC5 A;  1WKJ A;  3M6V A;  4OZJ A;  5HK4 A;  5KFD A;  4GVB B;  3OXG A;  1Z2Z A;  3HHD A;  3PHT A;  3W2V B;  3C2P A;  2BMB A;  5A8K B;  1HR0 F;  4QIF A;  2ZWP A;  2LCW A;  4KIA A;  2IJN A;  3HKW A;  4ZVP B;  2EFQ A;  3TEH B;  1WTF A;  2JDJ A;  5KAK A;  4H4K C;  3BQ2 A;  4GKJ F;  4LF4 J;  1WC6 A;  2J7W A;  4JV1 A;  1SC1 B;  5KFX A;  3TX8 A;  3LPY A;  1M5P C;  2CPX A;  4P52 A;  4K4T A;  1HNW J;  1FRJ A;  3OFG A;  5HAN A;  2MKY A;  4QR0 A;  2AX1 A;  2WW8 A;  2YQ3 A;  5DQG A;  2AJQ A;  4KPC A;  1WWH A;  4MIW A;  1QAJ A;  4X62 F;  4EI2 A;  3PCO B;  4IG0 A;  1IKW A;  3PYG A;  1UPM B;  3BH7 B;  4CM0 A;  1HNW F;  1M5V C;  3AJ1 A;  3NS5 A;  2EKY A;  2G1H A;  1E6V B;  3ET6 B;  4LF4 F;  2BJD A;  4NLT A;  3NL0 A;  3HJV A;  3BH6 B;  2GVD A;  3GG1 A;  1S1X B;  4ELU A;  4ERD A;  1FRI A;  2IVM A;  3KMQ A;  1KKH A;  4A8W A;  3L3C A;  1H73 A;  3CJR A;  1C4A A;  2PMH A;  3UR0 A;  3OLB A;  2V2K A;  1UVM A;  3BS9 A;  4Q2M A;  1X4A A;  3OW2 R;  3BEG B;  4KHM A;  2I2Y A;  3U1N A;  2DNP A;  4F0K A;  3CO9 A;  3PG9 A;  4KKO A;  4ES2 A;  1YGY A;  1Q8L A;  4CRJ A;  4L75 A;  3MD1 A;  1HMV B;  1T7P A;  2BV3 A;  2HVH A;  4C97 A;  1WG5 A;  4U95 A;  3SSS A;  1MMD A;  2L9N A;  2CIM A;  2EPI A;  3CUN A;  4OYO A;  4USJ C;  2JEJ A;  1Q0N A;  4GKK J;  4HH1 A;  1QUV A;  4X4N A;  3LP1 B;  4CTA B;  3QIP B;  1BMQ B;  1FK9 A;  1IR1 A;  2CPZ A;  4OHX A;  2DEI A;  3TJ9 A;  5IV3 A;  2B4P A;  3H4B A;  3OTO J;  1IBK J;  3HSD A;  3NKY A;  2GMH A;  2OHD A;  2WCX A;  3K8W A;  4CM2 A;  1U26 A;  3TAP A;  1YQH A;  1ZTW A;  3MD3 A;  2LMI A;  2KFN A;  4WZM A;  1MLA A;  4HTI A;  2BRL A;  2LXI A;  4PPZ A;  5HBM B;  2F8E X;  3PFE A;  3LP1 A;  4MK8 A;  4CTA A;  1J5E F;  1WEZ A;  1JK9 B;  1B4S A;  1KVK A;  5EWE A;  1EX8 A;  3RU0 A;  2ASD A;  2B0G A;  2RQM A;  3PHE A;  2HBZ B;  2PDA A;  3LA0 A;  3PM9 A;  5AT1 B;  2MKC A;  1M1K T;  1AZS A;  1HWU A;  2MZS A;  4M5H A;  4WXW A;  3LAN A;  4LF9 F;  2HHH J;  1TKZ B;  2NR0 A;  3BDE A;  1RAB B;  1TV6 A;  3AA9 A;  4NCG A;  2C22 A;  5J1N A;  2ASJ A;  1VRU A;  5A6W A;  5CYJ A;  5JXS A;  4CZC A;  1DJ0 A;  2BQU A;  3JAM U;  3H0P A;  3TAR A;  1GK8 A;  2YKN A;  3GFH A;  1NH8 A;  4OZ0 A;  3DLB A;  1CPZ A;  5DDP C;  3T5H A;  2C2E A;  2HQF A;  1FO1 A;  3OVS A;  1WDD A;  2LA6 A;  4X4R A;  1A0O B;  1X4B A;  1VQ8 S;  2DCU B;  4B9N A;  5F0W A;  4LFB F;  4DX7 A;  3U7J A;  5F8H A;  1SKS A;  1S57 A;  3MUR P;  3UWT A;  1SBR A;  1WHY A;  1T3N A;  5KG4 A;  2V67 A;  4Q44 A;  4J9Q A;  2E5L J;  4B3R F;  4DLE A;  5KFL A;  2ZDP A;  4C8Z A;  1VLO A;  2VPY B;  5GVQ A;  3T19 A;  2ZC3 A;  3U1M A;  4DV5 F;  3PRV A;  5B0G A;  4MFB B;  4GKJ J;  4ZVH A;  2LQ9 A;  1ZOT A;  2UVW A;  3MUV P;  4ILL A;  2GQ2 A;  3P5T L;  2OKQ A;  4NEY A;  4U96 A;  2FJE B;  5E3A A;  1XBW A;  4ER8 A;  2G4B A;  2G2O A;  3OHB A;  1RAC B;  3V6J A;  1NSA A;  1O0P A;  5ETL A;  2OUG A;  1AB8 A;  2YKA A;  3G9C A;  2V2Z A;  3UQS A;  2W9C B;  1Q95 G;  1RTZ A;  2XNQ A;  2KT3 A;  2CQP A;  2C3O A;  4HT7 A;  2RIJ A;  1C0T A;  4RW7 B;  1GX6 A;  3J80 U;  3IN5 A;  5HLF B;  2ZHB A;  2DNY A;  2VBX A;  2VC1 A;  2WVB A;  3M8Z A;  3H5U A;  2BKO A;  4BBY A;  3S01 A;  4RBU A;  3FNN A;  1JLE A;  1OO0 B;  3CDW A;  3PZP A;  5F8N A;  3BBC A;  3EUN A;  3BGL A;  2PO4 A;  4F26 A;  3VAM A;  2BM0 A;  1YJU A;  1AT1 B;  4WP3 A;  3SQG B;  4WFA Q;  3C19 A;  1SQE A;  1HBO A;  4ZHR A;  4M5N A;  4N8N A;  4EUV A;  5A6P A;  4OHV A;  1DFD A;  3M30 A;  2DH9 A;  3SQO P;  5KFG A;  3AXK A;  3CNQ P;  3BPD A;  3BO4 A;  1VRQ C;  3PJX A;  2LA4 A;  4KJI A;  5D8H B;  1KHV A;  4DBQ A;  5LXR A;  4Z37 A;  5IFM A;  4LSN A;  4DEZ A;  2BKN A;  5KT5 A;  2QSW A;  4X4P A;  1H2T Z;  3A13 A;  3OBI A;  4LQ9 A;  4DV6 J;  1XMO F;  2UUB F;  3FKB A;  3CDB A;  2KJW A;  4FYX B;  1T11 A;  5CCM A;  3JSM A;  2GFF A;  1FTR A;  4KAI A;  2CWX A;  4ALZ A;  1K0T A;  2U2F A;  1T8E A;  1LV5 A;  3EZO A;  2ZD1 A;  1VQS A;  4Q7A A;  3UN2 A;  3QAE A;  2PT0 A;  2HVZ A;  3IBC B;  2DH7 A;  2OEM A;  3WZ0 A;  2MKJ A;  1FX4 A;  1RBA A;  3FK4 A;  3R3T A;  3SV3 A;  1I94 F;  4I7F B;  3JSM B;  4KHP F;  5IQQ A;  1H7X A;  1J5O B;  2QN6 B;  3TW0 A;  3QGG A;  4ZA1 A;  3TNV A;  2ZD1 B;  1HL6 A;  3KK2 B;  3R7B B;  3I5C A;  2WON B;  2UXD F;  5KTQ A;  4BC9 A;  1S9F A;  1J2V A;  2VD3 A;  4X4T A;  2KFZ A;  3S6E A;  1RT5 A;  2AGQ A;  1FRK A;  4ZPW R;  3M6U A;  3PKY A;  4DFJ A;  1NK5 A;  3THP A;  4KFB A;  2WON A;  3RAM A;  3MM7 A;  3TZZ A;  3TWZ A;  3K17 A;  5HRO B;  5KG5 A;  1RT5 B;  3OVB A;  1S1U A;  3M8W A;  4B9T A;  2CQG A;  4JI4 F;  1CEZ A;  2F3J A;  1JQG A;  2CPI A;  4OYA A;  2DGW A;  4X4V A;  1NJX A;  4GMK A;  3N6L A;  4D3G A;  1ZYQ A;  3MCM A;  4M5D B;  2BJ8 A;  4NI2 B;  3TQE A;  3OFH A;  2DR5 A;  4WFB Q;  2H51 B;  4USW A;  2P6S A;  1PC4 A;  3FEZ A;  2QV6 A;  1WD6 A;  1F9H A;  2BKP A;  3H5S A;  2XSF A;  4D3H A;  4FF3 A;  3HT0 A;  2UXB J;  1HQ2 A;  1FXD A;  3CCZ A;  4LRA A;  3RRH A;  3BF4 A;  3H7H B;  5D4N A;  4ZMM A;  1TKT A;  2Y1I A;  3TUP A;  1Y5I B;  4PAA A;  2EC0 A;  3V6K A;  5IXU A;  4CH7 A;  4JI3 J;  1RAH B;  1RWU A;  1HW8 A;  3NG8 A;  2K3K A;  4CLT A;  5LM7 E;  2VQF F;  2OI2 A;  3TAQ A;  2MYF A;  3H5Y A;  4JI5 J;  1FDN A;  1LW0 A;  3RZA A;  3ZO7 A;  4LFB J;  2IM2 A;  2DGU A;  4LF6 F;  2P9G A;  2DK2 A;  3TZY A;  4IUF A;  3KG1 A;  3EGV A;  1HKA A;  4RNO A;  2XY5 A;  4GC6 A;  2MKH A;  2OGU A;  1XNR F;  2NUU G;  3GR0 A;  2KM8 B;  1K8A T;  4DL7 A;  1FDA A;  3MF5 A;  2C2Z B;  3ZZ0 A;  2ABY A;  2Q43 A;  2QL5 B;  1MG7 A;  4IH5 A;  4PZV A;  4F25 A;  1CQM A;  3L09 A;  3RRK A;  2HVD A;  3FCH A;  2XNR A;  3ENV A;  2IM0 A;  1KTV A;  3Q23 A;  4FBU A;  3NAI A;  4DZD A;  3ULH A;  5LSO A;  4FXW A;  2BZ2 A;  4QIV A;  4IQX A;  4DFM A;  5AXM A;  2VG5 A;  1BLU A;  2XMK A;  3PIP Q;  5D3G A;  4WK1 A;  5HAO A;  5DGA A;  4KT0 C;  3KUG A;  1ZZN A;  4ID5 A;  1X0F A;  1APS A;  3QWP A;  4RWX A;  2G1D A;  2B4O A;  2CA9 A;  2LEP A;  1TL7 A;  3QYY A;  3W2W A;  4DL6 A;  1YBU A;  2EBE A;  3IAM 9;  2FHJ D;  2FZC B;  1HQE B;  4R0J A;  4TY9 A;  5KFI A;  2VG5 B;  1CJK B;  2YWW A;  2AJF E;  2BE7 D;  4G1I A;  2RDD A;  3TP2 A;  4ICL A;  3J7A 1;  1RT1 A;  3HHL D;  1WKK A;  4QW9 A;  4ED1 A;  2CWK A;  2V50 A;  4C8M A;  1UJ4 A;  2LLZ A;  1MNE A;  2NXU A;  4CLF A;  1NK9 A;  1G1X A;  1NND A;  2YNG A;  1XN9 A;  3LGN A;  2XS2 A;  5GAG I;  1F5B A;  5CD4 H;  1BE4 A;  2HNZ B;  3CGI A;  4K8R A;  3D0H E;  4TY8 A;  4I6W A;  3EYZ A;  1X31 C;  2PE8 A;  3DI6 A;  1U0S A;  1UVK A;  4W4M A;  2KRR A;  4YB7 A;  4DX6 A;  4I56 A;  4F7V A;  4C4W A;  3D4J A;  1C2P A;  2HSE B;  3QMQ A;  4AD6 A;  1IKX B;  2FZK B;  4A8O A;  1E6V A;  1FXL A;  1JWW A;  4UOC A;  4TY8 B;  2HHH F;  2B8P A;  2HWH A;  1SPB P;  1NJY A;  2VAS A;  2MZR A;  3HVR A;  1HAR A;  3RTV A;  3NNC A;  2CKW A;  3I9Z A;  1RWK B;  4J9R A;  2BVZ A;  3I32 A;  3PYF A;  2EFN A;  2JEI A;  3A4T A;  4DL2 A;  4DWI A;  2I5J B;  4CLY A;  1VQN S;  2WK4 A;  3CE8 A;  2KHC A;  2QL7 B;  1WOP A;  5M2P A;  5MLC V;  4OQJ A;  2COL A;  3MEE B;  4J91 A;  2XMM A;  3BGO P;  5GAH U;  3OTO F;  1IBK F;  2CQ0 A;  2DO0 A;  2FC8 A;  2HBQ B;  3KJQ B;  2PMW A;  3HHL A;  4FPR A;  2EFV A;  3PTW A;  4ZLJ A;  3OJU A;  3OSP A;  2EEY A;  1RTJ B;  2XEX A;  3MAA B;  3OR1 B;  5KG7 A;  1G2E A;  1I3O B;  1MMN A;  1T0T V;  3UN3 A;  3OTE A;  5T14 A;  3OJS A;  4LRE A;  3PVX A;  2CG8 A;  1NH7 A;  2OFG X;  4M1K A;  2H4Y B;  2OPQ B;  3V81 A;  3UDE A;  4ECU A;  1PJ6 A;  1W2B R;  1SKR A;  4B9U A;  4RUB A;  3RB3 A;  2ALZ A;  2AIR B;  4C8N A;  4LFA F;  1ZPW X;  1VBZ A;  2KHD A;  2MPU A;  1UWB A;  3MHY A;  2B51 A;  1Q5Y A;  3R5J B;  4M5L A;  3C15 B;  5C7P A;  3NCP A;  3QT7 A;  4RL1 A;  1S9G B;  4YB5 A;  4H4K A;  2H4W B;  3CWJ A;  2GVZ A;  2WZ1 A;  2D3O R;  1ELO A;  1UCN A;  3UE2 A;  4IG0 B;  1B0V A;  1MRO B;  1P1L A;  5L8R C;  4CLW A;  5EWF A;  2B6A B;  1NZ8 A;  2G9O A;  2RHS B;  3IC1 A;  2RUS A;  4KYZ A;  4MKB A;  5KFA A;  3CXC R;  3GYN A;  5F9L A;  2UUC F;  5D78 A;  2R2T A;  1WF2 A;  1S1X A;  3MAH A;  4WF9 Q;  2VBY A;  3M1V B;  2KYZ A;  4DL4 A;  1OY6 A;  2BJ3 A;  1S6P B;  3OFF A;  1U1L A;  1SJ4 P;  4IR1 A;  3EIC A;  4X66 F;  3R2C J;  5KT6 A;  1EZZ B;  2APO A;  3BQ1 A;  2R7Q A;  2VJU A;  1GXU A;  4G1Q B;  3OVA A;  3HLU A;  4OJ3 A;  2XO6 A;  1UVJ A;  2JLG A;  1BC6 A;  2NLW A;  2JRS A;  1NEE A;  2DIU A;  3CJ0 A;  4ZPB A;  5ETM A;  4OI1 A;  3AD7 C;  3RW7 A;  3UW1 A;  3M2V A;  4NA3 A;  2DHA A;  4USV A;  1BHN A;  1V5I B;  2B5J A;  3DOM B;  4QYR A;  3T6B A;  3E01 A;  3LGM A;  3UD4 P;  2RDJ A;  3MED A;  1GMV A;  1VOM A;  1MWQ A;  4YR3 A;  1IR2 A;  4IRK A;  1DLO B;  3M2U B;  3EGZ A;  1YJV A;  2Y8W A;  4P2X A;  3BSO A;  2HBY B;  3EGN A;  4DSE A;  2OTL S;  1B3T A;  1FE0 A;  2W9C A;  4KB7 A;  1P6T A;  1U7L A;  3M6W A;  3GB0 A;  2WB1 D;  1VCT A;  1RP5 A;  2W4D A;  3RBZ A;  2IRY A;  1N34 F;  1SH2 A;  1S6O A;  2RH3 A;  4V1A k;  3Q8R B;  2C28 A;  1GFW B;  3D7S B;  3QBC A;  2LU1 A;  5K8N A;  4OLO A;  4DQR A;  4LF8 J;  4O3S A;  2W2P P;  5C42 A;  4NZ6 A;  2CPH A;  1VQ4 S;  3HHK A;  3MM5 A;  3QJL A;  5AE3 A;  4U67 Q;  3EVO A;  3G87 A;  1S7H A;  2IC3 B;  3DRS B;  2IBK A;  2D3O 1;  1CG2 A;  2DNK A;  4ECS A;  5IM0 B;  2YWE A;  2HS4 A;  2WBM A;  3M8S A;  2IFX A;  1K44 A;  4NLX A;  3X3U A;  3WX8 A;  1PGZ A;  2F9J A;  2JFD A;  2GQQ A;  3BBB A;  3T1Y J;  2GCF A;  5AJ3 F;  4RW6 B;  4MK7 A;  5EDW A;  3JTO A;  3GIR A;  4OHZ A;  4QU7 A;  3BGF A;  2DHG A;  4FYY B;  4A46 A;  3J81 Y;  3CCL S;  3FQL A;  1RGV A;  3M8P A;  4LSN B;  5IWA J;  4LVO P;  5CYM A;  1FCA A;  3L7O A;  1S7I A;  2BA9 A;  2WRM A;  3MZI A;  3MR2 A;  3KHR A;  4ECW A;  3DGV A;  4TN2 A;  3GV8 B;  3UCZ P;  3HI9 A;  2R7T A;  2EC2 A;  1RT7 A;  3JQJ A;  3UD3 P;  2GAG C;  3RBE A;  2BAN A;  3M8P B;  1BQN A;  5CYM B;  1DUR A;  4FF4 A;  4P74 A;  3IAS 9;  3IRW P;  4FS1 A;  4OZ2 A;  3J81 U;  4ANC A;  3LTO A;  1H74 A;  1SJQ A;  4Y2A A;  4DZ6 A;  4KV8 B;  3NGD A;  4DSJ A;  2DRD A;  4EBC A;  2MEW A;  3D0I E;  3ZZT A;  3IRX A;  8RUC A;  3QZ8 A;  4C7Q A;  1B99 A;  2V4R A;  1A6L A;  3LOU A;  1Y10 A;  1UMJ A;  1EB0 A;  5LXY A;  3PX0 A;  2BOP A;  4EO6 A;  1RU2 A;  1SC4 B;  3ZTR A;  4EBD A;  3K5L A;  4ZPD A;  1MWY A;  1NBE B;  4ATN A;  3JAM Y;  4O3N A;  5D0H A;  1F6T A;  3W65 A;  4ZVQ B;  2AJ1 A;  2FDN A;  2MLY A;  4UQT A;  1R0B G;  4USH A;  3SCJ E;  2AHO B;  3OLA A;  1EKR A;  2XMT A;  2ZNY A;  3DM2 A;  4ED0 A;  1OPZ A;  3HZE A;  3CCU S;  2MQN A;  2ZJP Q;  3ISZ A;  2D1C A;  5G0R A;  4ZCM A;  4DQS A;  4QJV A;  1YK9 A;  4ELV A;  4ANE A;  2PI4 A;  2J8A A;  4PRF A;  4QWE A;  3AOC A;  3G2X A;  4HEA 9;  2NXN A;  5C25 A;  1L3T A;  1D9D A;  4X4U A;  1S6Q A;  2CPJ A;  3M32 A;  4L74 A;  5AXL A;  2F65 A;  2OPP A;  2VKR A;  3LAM A;  1K1S A;  2RQK A;  4TU8 A;  4DV2 J;  3M05 A;  1F5C A;  3OXF A;  2RIL A;  2LYV A;  3K89 A;  1JJH A;  2JFK A;  4X62 J;  3IG1 B;  4O44 A;  3VR1 A;  1OQ3 A;  1K73 T;  1Q7L B;  3GSD A;  4O4G B;  1SJ3 P;  1QAY A;  3M2R A;  4EO8 A;  5HMX A;  3FMW A;  2OMO A;  1Y9O A;  4U7U K;  2J0X A;  4WKY A;  1HFE L;  5KFJ A;  4MKY A;  1LFW A;  2XY6 A;  1MN7 A;  3D6F B;  1N6Q A;  2HHS A;  1VR6 A;  2Z30 B;  3EMT A;  1CUL A;  3CJ4 A;  2UUC J;  2IA0 A;  2HIY A;  2I38 A;  3GMG A;  5A8R A;  2F63 A;  2BE2 A;  3H4D A;  2JNJ A;  5F41 A;  2ZE2 A;  2ZJR Q;  2UVV A;  1G7C B;  2AW0 A;  2YWF A;  4C8O A;  4RNN A;  2B9X A;  1WC5 A;  3DMJ A;  1WSR A;  3D66 A;  5CA5 A;  3PW0 A;  2NRE A;  1IM4 A;  3MM9 A;  3BKF A;  4B9S A;  1Q8I A;  1JLC A;  1HBU A;  5AJ3 J;  2CQ4 A;  4DUY J;  1B7F A;  1OSD A;  2OIH A;  2O66 A;  2HKE A;  2AJ4 A;  1XJW B;  5CYQ B;  1U1K A;  3D1Q A;  1MW7 A;  4FS2 A;  2J9C A;  4OYW A;  3MM9 B;  1LWE B;  3VHQ A;  3I4H X;  4OI6 A;  3Q8Q B;  4KTQ A;  1JLC B;  2GHV C;  3HP6 A;  1U0H B;  4YR0 A;  4PAB A;  2HZC A;  4TLQ A;  3GFY A;  4GO5 X;  4K4Y A;  1D8Z A;  2OLW A;  1RTI A;  4I69 A;  1JKH B;  5FDL A;  2PEB A;  3KLG A;  5D0G A;  4N76 A;  1N34 J;  1HQU B;  3C14 B;  2I6W A;  4ES1 A;  1UFW A;  3QRQ A;  1GX5 A;  2XMU A;  1FDD A;  3NGS A;  4V19 X;  3WDO A;  4BWJ A;  3T6J A;  3HCX A;  1DBD A;  1S1T A;  1SQG A;  2JL9 A;  4RW4 B;  3NY0 A;  3UCG A;  4F3M A;  3V4I B;  2ZZM A;  2WW4 A;  3IS9 A;  2ZH7 A;  3M8Y A;  2PII A;  5KT2 A;  3DDI A;  4XPE A;  3J7Y I;  3C46 A;  2ZDO A;  4R5P B;  1CS4 B;  2V69 A;  3GFX A;  3VGS A;  3DI6 B;  4LFA J;  3T1Y F;  2Y1J A;  3JQM A;  1K9M T;  2UUA J;  2V8P A;  2P9E A;  3N4W A;  4PR6 A;  2AGO A;  1KD1 T;  4KHP J;  2BEF A;  2D3Z A;  4L6V 3;  8ATC B;  2XCP A;  1IKX A;  5DDR C;  1FJE B;  4FNH A;  5EN1 A;  5IT9 Y;  2EFG A;  1YZ7 A;  2JH3 A;  2K1R B;  2UUA F;  1JLA B;  4FVC A;  2DYA A;  1RHM B;  3TR5 A;  2KZM A;  2RNE A;  1IKW B;  4YB6 A;  2LKZ A;  2R7V A;  2I0X A;  4DV6 F;  2DY9 A;  3BR9 A;  3LP2 B;  4OX7 A;  3MM8 B;  3NWG A;  1IQT A;  4P73 A;  1SKU B;  2DNQ A;  4OYM A;  2LXF A;  3B6B A;  2ZJQ Q;  3HSZ A;  3K59 A;  1XQI A;  4A47 A;  1FHT A;  3GYG A;  1MSW D;  2DNZ A;  2FVQ A;  3W2V A;  5EX3 A;  2AJ2 A;  2RUG A;  5HL7 Q;  3BO3 A;  3MM8 A;  1T9U A;  4ZOS A;  4JI8 J;  3DLE A;  4U6P A;  3LO3 A;  4ID5 B;  5ETQ A;  1CJT B;  2YQ0 A;  2CJQ A;  2KVQ E;  3AB2 B;  2L41 A;  2DPI A;  1TFY A;  3F73 A;  2HLT A;  2ZH4 A;  1LW2 B;  3RBD A;  2HNY B;  2M88 A;  2OD4 A;  4DF4 A;  1WHW A;  2MZQ A;  1JB0 C;  2XUL A;  2XO7 A;  3DLE B;  3HD1 A;  4WCE Q;  2PGC A;  2E7X A;  1V9O A;  5ETK A;  1RAG B;  4NXN J;  1RWX B;  1KFS A;  2HNY A;  4LF7 F;  4DV5 J;  4HDG A;  3HFV A;  4Z2X A;  1FJ7 A;  1RLD A;  3ZTP A;  3R5D A;  1RAD B;  2HMI A;  3JYT A;  1F3V A;  3KDN A;  4Y2K A;  2VF3 A;  4J9M A;  2O5D A;  3GR1 A;  2X3D A;  3IA0 A;  3OTB A;  3QZ7 A;  2F40 A;  1WDT A;  2R7S A;  2NXJ A;  3EDQ B;  5T7L A;  4NWB A;  3QLH A;  3JSB A;  4G3I A;  4J90 A;  3CC4 S;  3C66 A;  3T9Z A;  3AH6 A;  1WC0 A;  3DLH A;  3QFW A;  3O44 A;  3CPW R;  3ZZU A;  1X9W A;  1HNV B;  3LGH A;  1L3V A;  3H2U B;  4I2Q A;  1M5H A;  4RUH A;  1X0P A;  4DQP A;  3HO1 A;  3HFZ B;  3PEJ A;  1TV6 B;  1R27 B;  4NZ7 A;  1U24 A;  3M1V A;  4NCG B;  3TQ1 A;  3B82 A;  2BUN A;  2HK3 A;  1RE1 B;  5GME A;  3MR5 A;  2M52 A;  1Q82 T;  1LWF A;  1QE1 A;  1RSC A;  4OYX A;  4DHV A;  2R2R A;  1YZ6 A;  3ZZR A;  4JI3 F;  2YNF A;  3IP0 A;  5I4M A;  2N7Y A;  2MQQ A;  1U6B A;  4BCA A;  5DLG A;  4IFV B;  3M2V B;  4YY3 F;  3LAK A;  3GWC A;  3VAJ A;  1P8G A;  1RHR B;  1EHW A;  1U02 A;  2XMW A;  3H90 A;  1A9N B;  2OAU A;  3MED B;  3N5B A;  5HI7 A;  5HQ8 A;  2XCA A;  3E2E A;  1FRH A;  4WBF A;  5BYS A;  4H54 A;  2KI2 A;  2R3V A;  4F36 A;  1PIE A;  3E8O A;  3FCW A;  2GNK A;  3KYL A;  1QLN A;  1QJH A;  1EJ7 L;  1PG5 B;  2X3G A;  1UL3 A;  2KJV A;  3TUI C;  3PR4 A;  1QM9 A;  5LMN F;  1UW4 A;  4TQR A;  4LIW A;  5C24 B;  4ECR A;  2ZUG A;  2AD9 A;  3QIP A;  3OD2 A;  4NCB A;  3NOC A;  3GCX P;  4LRB A;  3OL6 A;  3G6X A;  4LFC F;  4FF1 A;  1RTD B;  3BKT A;  3CT9 A;  4NX9 A;  4DR7 J;  1FI4 A;  1Z1Z A;  2QRR A;  4KR0 B;  4LF1 A;  2QC3 A;  1FJC A;  3DRX A;  2UV8 G;  5C24 A;  1RAO A;  4LF5 J;  1LXJ A;  4ZP6 A;  4B02 A;  4PUO A;  2P9C A;  3IWN C;  4LJM A;  2UXD J;  2V34 A;  4WP9 A;  2B6A A;  1OIA A;  1SQF A;  2IYG A;  1NKB A;  1JJ2 R;  2HHV A;  2RML A;  2HIQ A;  4K4S A;  4KPY A;  4QCL A;  2N4C A;  3QGP A;  4DR6 J;  3CJS A;  4OZ3 A;  2DNL A;  4L76 A;  1JXV A;  3EDR B;  1R8A A;  4Y3C A;  3BGU A;  1NSQ A;  1TQL A;  1IN0 A;  2AYE A;  2C2K B;  2FIU A;  3HVW A;  4MFB A;  2I9S A;  3K8V A;  3ADA C;  1VGY A;  4ZHR B;  5I3Q A;  5L9N A;  4EZ9 A;  2AT1 B;  5LSR A;  2LEB A;  2HFV A;  2HQI A;  3K2Y A;  3M9O B;  1S59 A;  2E1M C;  3OFE A;  1NJI T;  3MMA A;  2XLI A;  4TU7 A;  1IBL F;  2V8V A;  4QYZ J;  3P3D A;  2EW9 A;  3UDL A;  3Q22 A;  1HPZ B;  1N54 B;  4I2P B;  1CQN A;  1KOH A;  1LNQ A;  1T9Y A;  3NGK A;  3UFC X;  3LP0 A;  5RUB A;  2D9O A;  1X5T A;  2J76 E;  3A8K A;  1GEH A;  4U9R A;  3TO8 A;  4Y00 A;  3V5R A;  2HQD A;  1B70 B;  3R5G A;  2J9E A;  5HLF A;  4M95 A;  1HI1 A;  2CRL A;  3MPY A;  4OZN A;  3Q0A A;  1HPZ A;  2GC8 A;  4I2P A;  2GO8 A;  3U1L A;  3PR5 B;  2MZT A;  2IBO A;  3FZ2 A;  3QSY B;  3CIM A;  4E8U A;  1TL5 A;  2QJ3 A;  4F3Q A;  4EYI B;  2YH1 A;  2DGT A;  1S0N A;  5KFB A;  4C9D A;  2H5E A;  3RUB L;  2UVR A;  3CCT A;  1O51 A;  4IYQ A;  4I64 A;  4P2S A;  1RCO B;  2IRU A;  4CYU B;  7AT1 B;  4A8X A;  3M9N B;  1N5Y A;  4FXD A;  2CUY A;  3CVK A;  1VIO A;  1DY3 A;  3FFI A;  2AMC B;  3PIO Q;  3DFE A;  3I0R B;  2CQ1 A;  3FSX A;  1Q4R A;  2L9W A;  1DQ9 A;  5KFZ A;  3WIU A;  4DXL A;  1VQM S;  3I87 A;  2XGQ A;  3VQS A;  1JNR B;  1NO8 A;  1U09 A;  3O1L A;  1K47 A;  5HRO A;  3PYE A;  3UNY A;  4LQ3 A;  4R8U B;  1XNQ J;  1S6Q B;  3M32 B;  5GAG U;  3D2W A;  4C6A A;  2DGQ A;  2QA4 S;  2BAB A;  2HRT A;  2XMJ A;  2GIQ A;  2YBV A;  4IQM A;  4YN3 B;  4BC7 A;  5IV4 A;  2XI2 A;  1WC3 A;  2ROP A;  3Q8P B;  1Y11 A;  5L1L A;  4B3O B;  4G65 A;  3KLE A;  2VOO A;  2UUB J;  4FDF A;  2L9D A;  4X2B A;  2GIF A;  4DR1 J;  4F0H A;  5F8G A;  4IOC Q;  3M2R B;  1EP4 B;  4O4R A;  3LW5 C;  4N77 A;  1RLC L;  2BYC A;  4C0O C;  3CME S;  3UPF A;  4X84 A;  1TMJ A;  3DKD A;  4QWC A;  3M8R A;  4B3T J;  1UW9 A;  4KGK A;  4LR7 A;  2J0S D;  2AEJ A;  4RPF A;  3ZTQ A;  1TKT B;  3L95 X;  4H4O A;  4JI0 F;  3H42 A;  1BY9 A;  4AXI A;  1U4B A;  3GIJ A;  5I3P A;  2GGP A;  1D8Y A;  4F04 B;  4B9L A;  1S5Z A;  2DHX A;  2AEF A;  2PFD A;  4NE9 C;  3L9Z A;  4G1P A;  4KFB B;  4ZVE A;  2XZW A;  5HVF A;  4X65 F;  1UAW A;  1ITP A;  4QQB A;  3DRR B;  1ULR A;  1NDC A;  1VQ5 S;  1RAF B;  5L39 A;  5KFM A;  2IA6 A;  5KFS A;  3PX4 A;  2VUG A;  1U1Q A;  1UJ6 A;  3MPV A;  3R27 A;  1RA7 A;  3KK2 A;  1RWN B;  1FFG B;  4QWA A;  3QRR A;  2FGO A;  2B7B B;  4ZLL A;  1PC5 A;  3DYA B;  2OH2 A;  5CYQ A;  1KR4 A;  4Q0B A;  3ZZZ A;  5ETN A;  2MZ1 A;  3QAU A;  3GTY X;  3QNW B;  2PN6 A;  4WYL A;  3W63 A;  4C11 A;  2VIC A;  1XR6 A;  1HIY A;  4IFY A;  4DN0 A;  2ZOF A;  5KFQ A;  1NK6 A;  2KG1 A;  4CLS A;  2N82 B;  2O1P A;  2MXY A;  2CQC A;  3F41 A;  2XSJ A;  2VV5 A;  2PC6 A;  2EK6 A;  3R6G B;  4IG3 A;  4Q2L A;  5BYR A;  1RT6 B;  2Z2Y B;  3I96 A;  3N9U C;  4DPX A;  1GTE A;  2G2Z A;  3DXB A;  5KFT A;  2KFY A;  1T03 A;  2J0Q D;  2Q79 A;  4OHY A;  2MB0 B;  4A8K A;  1MU2 B;  3WC2 A;  1FKO A;  2M0G B;  1NSK L;  2OPP B;  4TXS A;  1B0P A;  2CVI A;  1YG0 A;  5JVH Q;  1TKD A;  2RT3 A;  2A10 A;  2C3P A;  2XSJ B;  3DN9 A;  4EFA C;  5KFP A;  1YIJ S;  1X5P A;  1X7V A;  1N56 A;  3IS9 B;  1J27 A;  3BSA A;  5KFH A;  1T03 B;  3GJR B;  1H6K X;  2W9A A;  1Z4U A;  3B78 A;  5AXK A;  3MUT P;  2MSS A;  4FN5 A;  2QE5 A;  2MZJ A;  2W1B A;  2BJ9 A;  4CT8 A;  1KN6 A;  2M7S A;  5CH7 B;  3CTR A;  3MFI A;  2OTJ S;  1YTY A;  3W9H A;  3T5L A;  1JNZ B;  2YX7 A;  1AXQ A;  2K1R A;  3D6T B;  1X8D A;  1X5O A;  1IKY B;  2UZA A;  3KG4 A;  3DDN A;  3LAL A;  4DCJ B;  3ZTS A;  5KFN A;  3RB4 A;  1S0O A;  2OEL A;  3HSJ A;  3DHW C;  3QID A;  1KFD A;  2QEX S;  4DSI A;  3GIK A;  4NA2 A;  2YKQ A;  1FTC A;  4DL3 A;  2OJ3 A;  4QYZ K;  1A7G E;  2HWT A;  1UEV A;  3T9N A;  1F1B B;  4F0M A;  3W5X A;  3TAN A;  3SEO A;  4KH1 B;  2JEG A;  3CW2 C;  3FBF A;  4OX8 A;  5E5N A;  4O3Q A;  1UPP A;  4NOH A;  1TL7 B;  2XS7 A;  4TYB A;  3EX7 B;  2XB2 D;  1ZAX A;  1ZM3 A;  3R9L A;  1U1O A;  1T9V A;  1U49 A;  2VQE F;  1UA0 A;  3ENW A;  3QRP A;  1U1P A;  4JI2 F;  1OYD A;  1CJT A;  1FT8 A;  4K5S A;  3FJ2 A;  3LQV A;  1JLG A;  4DOZ A;  1Q8K A;  1R8P A;  4QOT A;  4KC5 A;  4FZV A;  2P6T A;  4CQ1 A;  2DR6 A;  3UVJ A;  2DKO B;  1NPP A;  4YQW A;  4P75 A;  3WC0 A;  1FKP A;  3MTJ A;  1RTJ A;  1UZD A;  4TYA A;  4ZVR B;  4W90 B;  1W26 A;  2JZ5 A;  4DR5 F;  3IFE A;  1RBO B;  5DG8 A;  2A2C A;  3G8T A;  3BV8 A;  2RF2 A;  2QLW A;  3D5M A;  1SH0 A;  2HK2 A;  3TRG A;  3H25 A;  4C3M A;  3PJ9 A;  3SXL A;  3QGI A;  4RW4 A;  1FKP B;  1FNO A;  3QWU A;  3JYT B;  1N8R T;  1TK5 A;  3G6V A;  4YOE A;  4F50 A;  1GXT A;  2IMO A;  3U27 A;  4R5P A;  3DLK B;  3Q8V A;  2K2P A;  4C2M A;  4EK2 A;  1VQ7 S;  2CJK A;  2YNG B;  2MLX A;  1IKV B;  2VG7 B;  1RXO B;  1FRX A;  1RIS A;  1JIH A;  2GJI A;  2XTJ P;  5CAA A;  5EWG A;  1XMQ J;  1VIS A;  1LWC A;  3EWG A;  5DJB A;  4RBT A;  4ZVO B;  3SBM A;  2VA2 A;  3K5M A;  2SXL A;  4M94 A;  4L3K A;  1RWW B;  4Y6I A;  4B9V A;  5D0E A;  3NNH A;  3FBB A;  3HKZ D;  2VDI A;  4RW9 A;  1MRO A;  2A2D A;  4RU2 A;  3FRZ A;  1FNX H;  1H3D A;  4FYD A;  4DX5 A;  2FGC A;  2XM3 A;  4PWD A;  1LWF B;  3DRP B;  1WG1 A;  2KXH A;  1QDU B;  2LDI A;  4NXN F;  1FWK A;  1NLK L;  3G86 A;  2HZV A;  2XI3 A;  3MAA A;  2DXE A;  3G82 A;  1MWZ A;  3OR1 A;  1KQG B;  2DNN A;  2RRA A;  1XMQ F;  3UCU P;  3PX6 A;  2V4Q A;  3CJ3 A;  1U2C A;  3CMQ A;  3MPD A;  2MGZ A;  4Y28 C;  1S6P A;  3JQK A;  3RYL A;  1XEZ A;  1KNZ A;  3TX0 A;  1S79 A;  1IVZ A;  2WSC C;  2WBR A;  1ZAW A;  1KWM A;  4NCA A;  3VAH A;  2I5J A;  2K06 A;  3V2U C;  2ZOM A;  4WTO B;  4ILM A;  1RCX B;  2FJB B;  1ZS6 A;  1F2G A;  1I51 B;  2MGZ B;  4J9N A;  2B5J B;  3DOM A;  5E3R A;  5MAO A;  3C6T B;  2R8I A;  1YJR A;  1HLW A;  3E01 B;  5A8K A;  3CJ2 A;  5H9F K;  1KVI A;  1TZ0 A;  4CO0 A;  2MMY A;  3H8Y A;  2FLP A;  4B3M F;  2RQ4 A;  1DTQ A;  1SUQ A;  1VK8 A;  1FWL A;  1R6Y A;  5ITH A;  1NK0 A;  4Q45 A;  2FJW A;  1HBM B;  2CJX B;  1RHQ B;  3G4S S;  1HI8 A;  4DPU A;  1YSJ A;  1AZS B;  1OY9 A;  3EVM A;  1TUW A;  2FHJ A;  2RSQ A;  4DSK A;  3IR6 B;  1UWA A;  4BLG A;  1WF0 A;  1XMB A;  2HVE A;  3SFU A;  4Z7C A;  2HQ3 A;  2VFV A;  4CI0 B;  1HBM A;  2YKM A;  2KTQ A;  2B3T B;  2WSE C;  1P1T A;  4OMF G;  1HNV A;  5C42 B;  1K1Q A;  2HFU A;  3ZNJ 1;  3FEY B;  2NPI A;  3LPE A;  3OTC A;  4N5S A;  2DBB A;  5D15 A;  1BWV A;  2GVZ B;  3FSY A;  1VS3 A;  1BUX A;  1FRL A;  3DRS A;  4MAK A;  3R2D J;  1XR5 A;  2LXU A;  5KG3 A;  2E5J A;  2YKM B;  1QD1 A;  4OI4 A;  4DUT A;  4GO7 X;  4YB1 P;  5JVG Q;  2R7U A;  1KSP A;  4DR7 F;  3C3L A;  2CQ2 A;  1N33 F;  2XLK A;  4PWU A;  2HBR B;  4XPC A;  3NBP B;  4M8L A;  1PO6 A;  2LVW A;  1HR0 J;  3BDP A;  4NLW A;  3D28 A;  3Q2T C;  1YRT A;  3Q2S C;  4FP9 A;  5E41 A;  1AFJ A;  2GQC A;  2ZFH A;  3TEG A;  1SC6 A;  4C48 A;  1TL4 A;  4QPX A;  2Z2L A;  2Z4P A;  3HUL A;  4I68 A;  1X60 A;  2VOD A;  1JMT A;  2NPF A;  4IR9 A;  2HAI A;  2Z2M A;  2L48 A;  1GMU A;  2BAN B;  3TA1 A;  3NS6 A;  2QA4 G;  3A8J A;  2AGP A;  4YUD A;  2HND A;  3GG0 A;  4DUY F;  3DHX A;  3H40 A;  2J6T A;  3VCD A;  3IWL A;  2P5V A;  3MEK A;  2B56 A;  2B9Y A;  4NLO A;  4W98 A;  3J7Z T;  2DB1 A;  4ZVG A;  4P7V A;  4RW7 A;  4P2F A;  2E44 A;  2M8H A;  2VQE J;  2A6O A;  4BWM A;  1NKC A;  1TL1 A;  2V4J B;  3HVA A;  2XMA A;  1N0V C;  3PV8 A;  3MMB A;  5J2M A;  1R8B A;  2KRB A;  4WIQ A;  4JV2 A;  4CYU A;  5B0B A;  2DXD A;  2N4D A;  1AFI A;  2W2M P;  2XYH B;  4ECX A;  2KKH A;  1JLF B;  1U2R A;  2HRU A;  1WI8 A;  3CDU A;  3IBF B;  2L3M A;  4DG1 B;  3Q8S B;  1WI6 A;  4OJG A;  2BW7 A;  3FFI B;  4USK A;  1IJF B;  1TL1 B;  2V4J A;  1M90 T;  3UNG C;  3BGR B;  4P7T A;  4TVA B;  2G0C A;  2KM8 C;  5LJ3 Y;  4U8V A;  1JLB A;  3NLC A;  1VQP S;  5DGB A;  3WIV A;  4ZN1 A;  4WZQ A;  3ONQ A;  2CPF A;  3EXY A;  1RAA B;  2HLU A;  4UQG A;  1VQK S;  1W2I A;  3ILO A;  3CCS S;  4I6A A;  3BGR A;  3UN5 A;  3T5J A;  4YDX A;  1BQN B;  4UST A;  2FHK A;  2ZBI A;  2QLX A;  2C3U A;  1IXK A;  1RB0 A;  2DGV A;  4YY3 J;  2MY8 A;  4OX9 J;  3PRD A;  4FPI A;  3VGU A;  3HVT A;  1C0U A;  2UUW A;  3KJN B;  4CH0 S;  2JSX A;  1WEL A;  2D7S A;  3UD5 A;  3ZTO A;  5B0C A;  4RUA A;  4X64 J;  3O8W A;  4K7Q A;  3GJQ B;  2QYG A;  3P96 A;  5BR8 J;  3GIM A;  3LP0 B;  2EFP A;  2H5J B;  2W4P A;  2GGP B;  4JI4 J;  3PKM A;  4OYZ A;  3K7R A;  3MR6 A;  4XTT A;  4ECY A;  1TMM A;  3T1H F;  1XER A;  3A8I A;  2W25 A;  4PQA A;  2QFI A;  2XQC A;  4UY8 T;  4USU A;  2CJ9 A;  2H5I B;  3ICL A;  2ALY B;  2DNH A;  2H65 B;  2HZA A;  3G96 A;  3N0V A;  1NAQ A;  1R7I A;  2KG0 A;  2DJW A;  2V9K A;  1R31 A;  4Y2M A;  2ILZ A;  1X4C A;  1YX2 A;  3I5A A;  2MHE A;  2V0N A;  4TKT A;  3RRG A;  2QA2 A;  4P9S A;  1XTZ A;  4UOG A;  2HAF A;  4P10 A;  1AUS L;  2J8S A;  2HEK A;  5K20 B;  2QSF A;  3LWL A;  1Q1K A;  1BD6 A;  4KY3 A;  4M5D A;  2ASL A;  5HP1 A;  3NMA A;  1URR A;  2X1F A;  4ZLN A;  5A0Y A;  3CC7 S;  4UW2 A;  2G2Y A;  1E6Y A;  3PDN A;  1WOR A;  3QAT A;  2R9L A;  3BZQ A;  5FD1 A;  4F4X A;  4F4W A;  1HWJ A;  1MU2 A;  3CCV S;  1UZH A;  5G0R B;  3SI8 A;  3B8H A;  1NK7 A;  4LFC J;  3FRY A;  1KHW A;  4DQI A;  2C42 A;  4UTG A;  5CZV A;  4FXV A;  1NK8 A;  3CIZ A;  2M2B A;  2ROE A;  1FER A;  3MCO A;  2HQG A;  3KLG B;  2CQH A;  4WE1 A;  4AL7 A;  2B9E A;  1XK8 A;  1TK8 A;  1Y5N B;  4R0E A;  4M5G A;  2VIH A;  4LBP A;  4IO1 A;  2ZBQ A;  4RBV A;  5IT4 A;  3HPO A;  1PKU A;  4HI2 A;  3D0G E;  4OZ5 A;  2FQQ B;  4ZP7 A;  1QTM A;  4C98 A;  1S97 A;  1CJV A;  2DIS A;  1NRK A;  2CNL B;  1GXL A;  2JOQ A;  4AND A;  3DMJ B;  1CS4 A;  2VPX B;  4WU2 A;  3TZX A;  2N3O A;  5BYQ A;  1J5O A;  1TFW A;  2EG1 A;  1TR0 A;  1H0H B;  2F7V A;  4ID8 A;  3ZXW A;  3MMJ A;  4KH0 B;  3M9M B;  3KMS A;  1G3O A;  3WX4 A;  1I5O B;  3DRR A;  5KFY A;  2IMW P;  3WBZ A;  2VL1 A;  1TTH B;  4DJB A;  1JLA A;  4LRF A;  1QSY A;  4DV0 F;  5EGY A;  3W8G A;  2BE9 B;  2B9W A;  5IOL A;  5CD4 A;  3JB9 k;  4UUX A;  1CLF A;  4CNY A;  1T05 B;  5DG9 A;  4J7C A;  1RAE B;  3IXQ A;  4JB8 B;  5D3G B;  3MM7 B;  4ED7 A;  1YHQ S;  1TK0 A;  1B7Y B;  5IZH A;  4PWW A;  1RZM A;  1HQU A;  1R0A A;  1R89 A;  3PFO A;  1T9T A;  2W8K A;  3J7Z 5;  3KK1 B;  1VLY A;  2A18 A;  2VH7 A;  4NLU A;  4LSL B;  3ETO A;  4MKA A;  2MQP A;  3BYR A;  2X7I A;  1SJ1 A;  3UO0 A;  1AA1 B;  2EWH A;  4NRU A;  1TAQ A;  5B0D A;  3ENA A;  5M2R A;  4PXC A;  2CDQ A;  4GVB A;  4GRS A;  3NNA A;  1R6V A;  5B0A A;  3AFG A;  3IMQ J;  2W24 A;  4KGV B;  4LSL A;  3GCW P;  2JC0 A;  2ZKT A;  3FVY A;  3VWS A;  3THT A;  1HI0 P;  1GMW D;  4OIX A;  1WAC A;  2PFF B;  3N79 A;  4DFK A;  2EKN A;  3C14 A;  3MCS A;  3KTQ A;  3VQT A;  3NMR A;  1N88 A;  2WSF C;  4J9O A;  2FVR A;  3FC9 A;  1PBA A;  2FB0 A;  2W7A A;  5K5M A;  1S1T B;  5KFO A;  4M5M A;  2RS2 A;  3TI0 A;  2HMI B;  3V4I A;  2ZBP A;  3LP2 A;  3NGT A;  3WQP A;  5KT3 A;  4F4Z A;  3I0S B;  3CJQ A;  5EUH A;  5L38 A;  1Y00 A;  2DCL A;  3QLH B;  4Y65 A;  3R8Y A;  3OL9 A;  2RB7 A;  1X4E A;  1ZBT A;  4OI2 A;  5GAE I;  1K0V A;  1RK8 A;  2H1Y A;  1YKW A;  3N28 A;  1PIL A;  2M3D A;  5M2U A;  1UFL A;  2CAD A;  5A8W B;  3KUH A;  1R43 A;  2ZUA A;  3BPS P;  3W7B A;  3RB6 A;  4F67 A;  3G82 B;  2KXF A;  5DZ6 A;  2RQC A;  3KOA A;  3PRB A;  4LR9 A;  2OFH X;  3CF5 Q;  2FJX A;  3AHP A;  3KHL A;  1HWL A;  4Q8F A;  3EXC X;  2CQB A;  3FCV A;  2FJD B;  4K5R A;  1C1B A;  4LR8 A;  3PXG a;  4PXE A;  4QIG A;  1CC7 A;  3KFW X;  4JV0 A;  2YQ1 A;  3HZG A;  1Y5L B;  3R5B A;  5F3Z A;  2ATL A;  1JX4 A;  3SDE B;  5EX0 A;  2CVE A;  4OZ1 A;  5KOX A;  3C6T A;  3HT3 A;  2UXC J;  1S48 A;  2OPQ A;  4MH8 A;  2U1A A;  4ZN3 A;  2K8G A;  3SZ2 A;  1H98 A;  5A2Q U;  3T3F A;  1F60 B;  1FES A;  1FVQ A;  1U2F A;  5HSP A;  3PW2 A;  2UP1 A;  2LQ5 A;  1IBM J;  3TAM B;  3QT6 A;  1QY7 A;  5K8M A;  3EVW A;  2ZM6 J;  4OX9 F;  5DG7 A;  2V63 A;  1GQE A;  3VVT A;  2R7W A;  3RB0 A;  3G71 S;  1G6B A;  2RKI A;  1Y3K A;  4I2Q B;  5HBM A;  3FBC A;  1RU1 A;  3DLK A;  1R8H A;  4E2F B;  4EWT A;  2JHE A;  2W2N P;  1S4E A;  1IJE B;  1T95 A;  2HPU A;  2AU0 A;  1XIQ A;  4PG8 A;  2I8E A;  4B08 A;  3IWX A;  2VFU A;  4NLR A;  4WYW A;  3R97 A;  1YVF A;  2VG6 A;  2RKI B;  3BJY A;  2AP6 A;  2WHO A;  4JI1 J;  2YNF B;  1WOS A;  1P27 B;  3OR2 B;  3B54 A;  3VAK A;  2ZC4 A;  1HWI A;  2NQP A;  4PXB A;  3V6H A;  4NAS A;  1REV B;  1Q5V A;  3CCQ S;  1CC8 A;  1VRU B;  2CZ4 A;  4PWD B;  2ERR A;  4K59 A;  3W9I A;  2E1C A;  2VZ9 A;  4B3R J;  2J9D A;  4LIR A;  9ATC B;  3PW5 A;  3H2V E;  4JV5 F;  1ZM9 A;  1N5S A;  2KT5 A;  4J37 A;  2HWI A;  5SUH A;  2IYI A;  1VQY A;  3HDS A;  4DV3 F;  2CZ9 A;  2EVZ A;  1KLM B;  2CPY A;  2GZO A;  2HGN A;  3MEE A;  3UR3 C;  4YME A;  4NLY A;  5J1E A;  5HO4 A;  1RYS A;  4O3P A;  1KQF B;  4I6Y A;  2LU2 A;  2ZBR A;  5LOQ A;  4A8S A;  2VFS A;  2AZ1 A;  1FF2 A;  1VYA A;  4DPT A;  4NYZ A;  1BWE A;  4NA1 A;  4BHQ A;  2W01 A;  1W25 A;  3N6M A;  3LWM A;  4A8Q A;  1XNR J;  3MR7 A;  2OD6 A;  3GJS B;  4XIU A;  1XNQ F;  2Q1L A;  2UXC F;  4DI6 A;  4MIB A;  1FNM A;  5T41 A;  5B09 A;  1P9Q C;  4CIO A;  5JUM A;  2XC9 A;  2BR0 A;  5H1S V;  1RTD A;  5LMU F;  4ZJO A;  1KTQ A;  5LSL A;  1SIW B;  2VDH A;  2FY8 A;  4UUW A;  2JC1 A;  4B3T F;  3CUL A;  2QGF B;  5K9F A;  4A8M P;  4QPT A;  1KEK A;  1N4L A;  4PUO B;  4UOH A;  3MMB B;  4LF8 F;  3H59 A;  1RBL A;  3NOG A;  2FVS A;  2B4V A;  2H3E B;  1R8C A;  5J2P A;  3D3B J;  1S9G A;  3BBF A;  4IH6 A;  2E5G A;  3FSI A;  2ZHA A;  4DSF A;  2NXC A;  3KJF B;  1UJ5 A;  3KK3 B;  2H48 B;  5GMD A;  4UZC A;  3A1Y G;  1CBK A;  3MXH P;  2OPR A;  2Z0G A;  1FD2 A;  1RHJ B;  3DOL A;  4P71 A;  4Z7Y A;  1RKJ A;  4KRW A;  5THW A;  1T3O A;  4C3L A;  1X4F A;  2QLF B;  2NYH A;  3DXS X;  3RBX A;  3MMA B;  1OYE A;  2JVR A;  1VRT B;  3DGP A;  2LDY A;  2XZT B;  1HA1 A;  3HX9 A;  1SVD A;  3OTD A;  2MTL A;  4KO0 A;  4RX6 A;  1KON A;  1LWX A;  4J9L A;  1NJZ A;  2OPR B;  3GE9 A;  3NCR A;  4KQZ A;  4U7C A;  4DF8 A;  2L08 A;  1IWG A;  1H72 C;  1KBR A;  2RJZ A;  5A76 A;  3M30 B;  4A8Y A;  3HFK A;  4JYA F;  3D54 A;  1HNI A;  3NBP A;  1RT7 B;  4JI7 J;  3OPK A;  1C0U B;  5H9F J;  4ECT A;  4JUZ A;  1JJC B;  2CYY A;  1VRT A;  1HD0 A;  2Q3P A;  1NDK A;  3DGP B;  4H4M A;  1D09 B;  4KO0 B;  3D67 A;  3MFH A;  3EPG A;  1N33 J;  2GO9 A;  3RG6 A;  3I9V 9;  2IHR 1;  4HTJ A;  2V6A A;  2XYG B;  3O5T B;  5DZ7 A;  4RJV A;  1KOO A;  4ZJQ A;  1Q16 B;  3J80 Y;  3R5A A;  2ZZT A;  3IM9 A;  3MEG A;  4H4M B;  2GML A;  1IR0 A;  4B17 A;  3EGW B;  4Y0F A;  2DXF A;  5C2C A;  2R2S A;  4MYU A;  3GON A;  4IH7 A;  1VBK A;  2VPZ B;  3NS7 B;  2GIR A;  3OXL A;  5DO2 A;  1RTH B;  5FLX Y;  2ADB A;  2VB6 A;  2FYX A;  3KLI A;  4HAC A;  4ZCL A;  2BQ3 A;  1J5E J;  2PEH A;  4L72 B;  2HFZ A;  2DD8 S;  5J2M B;  2IAJ B;  1O5J A;  1QAX A;  2NZ4 A;  3AOD A;  4L73 A;  4ED2 A;  1RJJ A;  2FD2 A;  3OL8 A;  3MTK A;  3HSG A;  4DG1 A;  3UDV A;  2Z8Q A;  3POT A;  4A4J A;  1NB7 A;  1SCJ B;  3CB4 A;  3KLI B;  2IIH A;  4HAC B;  5HVH A;  1Y3J A;  1NPR A;  5B7W A;  3DYA A;  3HHE A;  4HHH A;  1JLB B;  2LP4 A;  4NLG A;  2HHU A;  5HJY A;  1Z2L A;  4IKA A;  4ZP9 A;  5AE1 A;  1NCL A;  1Y7P A;  2K7J A;  1EP4 A;  1KDN A;  2ZIT A;  4HLB A;  3ZC4 A;  3R1H A;  2FHO B;  4ECV A;  2W9B B;  3NXZ A;  2KL8 A;  1TL3 B;  4DV1 F;  2DR7 A;  3SQG A;  4B3S J;  3U02 A;  4HKQ A;  1IQZ A;  4NYP A;  1D3W A;  3W64 A;  1FFS B;  2HHP A;  1H38 A;  1JLQ B;  1YBT A;  3V6D A;  1GMW A;  2XHC A;  3MI7 X;  3HMJ G;  4WTY A;  2E7V A;  5E3Q A;  3GSI A;  2KB2 A;  1QSL A;  1Q53 A;  3EZU A;  7FD1 A;  4ECQ A;  3DC2 A;  4OYB A;  3SCL E;  5LMN J;  3R7N B;  4FYW B;  1RAJ A;  2F5G A;  3CJK A;  3KLE B;  3EZ5 A;  4PXD A;  2G13 A;  1DZ5 A;  1FEE A;  5ETS A;  2DEJ A;  5A8R B;  1N36 J;  1BGX T;  4IO9 Q;  4IDK A;  1LW0 B;  2XWX A;  6AT1 B;  1TU0 B;  4CH1 A;  3CJ8 A;  3THV A;  2BE2 B;  4LMZ A;  2HHQ A;  1KLN A;  5DQI A;  4DFP A;  4PEO A;  4AE5 A;  2CJY B;  4H4O B;  1ZTT A;  5C2G A;  4Q0B B;  4I7F A;  2NYI A;  4XAK A;  1KP6 A;  3N5F A;  1EQ0 A;  1V3R A;  2ZH5 A;  4MKV A;  2OML A;  3J81 j;  1HBU B;  2BJ7 A;  4MT1 A;  3BN4 A;  5E7O B;  3HXM A;  4C8L A;  4F3O A;  4O3R A;  3AQP A;  3O3L A;  5ETT A;  5GAD I;  1VI7 A;  1D9A A;  2LEA A;  2RU9 A;  1PYT A;  5D6G A;  1LQ9 A;  7FDR A;  3QO9 A;  2FPH X;  4DR4 F;  1R0A B;  2VOP A;  2MST A;  4RNM A;  3KLH A;  1NU4 A;  1PCA A;  2BM1 A;  1VQL S;  2J6S A;  4DQQ A;  4K4X A;  1PAE X;  3D1O A;  3DOK B;  2VBW A;  2E29 A;  2CQD A;  3QO9 B;  2ZH9 A;  4F2R A;  4LF6 J;  4ED3 A;  3SYZ A;  4FF2 A;  4DL5 A;  1HYS B;  3PYD A;  5SZT A;  3CD7 A;  5H9E J;  1ARO P;  4UT4 A;  4X64 F;  1HD1 A;  8AT1 B;  2XYP B;  2QZ8 A;  1CJK A;  2ZBC A;  2MDA A;  1YJN S;  2DHS A;  2V94 A;  3I31 A;  4KGM A;  2R8J A;  2E9R X;  4ICL B;  1BXN A;  2RF2 B;  4LF7 J;  3DLG B;  2D41 A;  3R1L A;  1HBN B;  3RR8 A;  2ZH2 A;  1FFW B;  1H2U X;  2KDO A;  3ETM A;  1S9E A;  5D77 A;  1UFK A;  3FUY A;  2NCK L;  3NGU A;  2HNZ A;  3VVU A;  1DQA A;  2YNI A;  1KQK A;  1RT4 B;  1N6Q B;  1BQX A;  3CD5 A;  1S1V A;  2BW2 A;  4J9U E;  5FII A;  2MLZ A;  4RU9 A;  4AT1 B;  1U48 A;  2RDI A;  3ILJ A;  3MEC B;  4EMD A;  2D3U A;  2WTF A;  4ZK7 M;  4TQS A;  3ILI A;  1M5K C;  1AYE A;  2R7X A;  1LWC B;  2MQ8 A;  1M5S A;  3NCQ A;  3VAG A;  4WFN Q;  5A8W A;  2O01 C;  2RVJ A;  4WJB A;  4YEA A;  2DNO A;  1S0M A;  2R2U A;  1X4D A;  4S0M A;  3GQC A;  1U6F A;  1AUD A;  3O2I A;  2N7C A;  5H9E K;  1QTN B;  3DU5 A;  3TA2 A;  3P45 B;  4DV1 J;  4RNH A;  5KFV A;  2M5Y A;  2E9T A;  1C1B B;  5DM6 Q;  2YXL A;  3MMC A;  2RRN A;  1IBM F;  1WHX A;  3KDO A;  1EQM A;  3BKU A;  3D3C J;  1N5Q A;  2AYG A;  4AFF A;  1FD8 A;  2YVS A;  2FZG B;  5AXN A;  4X4Q A;  5I42 A;  2VBZ A;  5IT9 U;  3SIP B;  2HUR A;  2NUH A;  2Q6C A;  1X5S A;  2W7O A;  1WNE A;  2KT2 A;  4HT5 A;  4JI0 J;  3KKF A;  3OQ2 A;  4ZP8 A;  4FVM A;  5FDL B;  4YS2 A;  4B3M J;  2XBP A;  3R7S B;  3TVY A;  3B4M A;  2X1G A;  5EHH A;  3G8S A;  4U7U D;  3US5 A;  5F0U A;  3GII A;  2V8H A;  3TAM A;  1R0C B;  4NYO A;  3J7A N;  3BSN A;  2OEK A;  4LSZ B;  1GTH A;  3MAQ A;  4K50 A;  3CC2 S;  2AX0 A;  2R4F A;  1NUE A;  2VPW B;  3MM6 A;  4UY8 5;  1Y0H A;  4PG5 A;  3TUJ C;  1LKZ A;  4ZVT B;  2GS8 A;  3Q24 A;  4M5K A;  3DRP A;  2ATC B;  5IT0 A;  5HN0 A;  2DR8 A;  4DPO A;  1NDL A;  4FNI A;  3KLF A;  1TVR A;  2QT7 A;  2ZVI A;  4KSE B;  2IDE A;  2Z2Z A;  3AD9 C;  3OR2 A;  3NWR A;  3TJ8 A;  3MM6 B;  4HHU A;  4ZDN A;  3UDC A;  4HH0 A;  4C0B A;  1NKE A;  5LL6 d;  4K0K F;  4KGZ B;  5ETP A;  4DR6 F;  2G0J A;  4F4A A;  4U8Y A;  3AAW B;  1U8W A;  4HDH A;  3M4X A;  1OWX A;  3ILL A;  2V9W A;  1UEK A;  3VTI A;  2BX6 A;  2YTC A;  2F1F A;  5HMZ A;  4LF2 A;  3CCR S;  3OSN A;  2YY3 A;  4LVN P;  1IBC B;  3ET6 A;  3I56 S;  5FJ4 A;  4CLP A;  1FXR A;  2WVE A;  3PNI A;  4PKD B;  2W7P A;  2Q6B A;  4UF4 A;  4K0K J;  2N3L A;  5E3C A;  5F8M A;  1TKX B;  2BQR A;  4TNO A;  2UU9 F;  4RWW A;  4ES3 A;  4CCH A;  1FK9 B;  4MMO A;  1VJQ A;  3P49 B;  2CZV C;  4PYA A;  1WC1 A;  3KJV B;  1S4F A;  3FMB A;  5LJ5 Y;  2Q66 A;  1NHV A;  5U47 A;  5HVG A;  4DR5 J;  1F2H A;  4KKO B;  2J0W A;  1WJ9 A;  4RLE A;  3ZNU A;  1P9Y A;  5KG2 A;  2ZH6 A;  1PYS B;  1RWM B;  4OV6 A;  2BDP A;  2HQC A;  3OUY B;  4CLZ A;  2D9P A;  2HND B;  4HHJ A;  2PMZ D;  3HK2 A;  2W2Q P;  1OJ4 A;  4EYH B;  4WK3 A;  3ZFV A;  4YR2 A;  2FHM A;  2E5H A;  1NK4 A;  2RHQ B;  4P72 A;  2CQ3 A;  2NXE A;  2AZ3 A;  2E9Z A;  6FD1 A;  2DNM A;  4URS A;  4XK8 C;  3KK3 A;  1N0U A;  3OUY A;  4ZCI A;  3CO0 P;  4FKX A;  5B0E A;  2FY1 A;  1UWB B;  2DIV A;  2E5I A;  4FYV B;  4LBH A;  2NS1 B;  4Y2I A;  1M1H A;  3DOL B;  2BJE A;  4ZJL A;  3RGI A;  1N52 B;  2A6M A;  3C16 A;  3O6Q A;  4QZV B;  5IC6 B;  3K58 A;  1YI2 S;  2HGM A;  3W8P A;  3TJA A;  4EEY A;  3PY8 A;  2ZEJ A;  2IC3 A;  2FJA B;  1DAR A;  2AV5 A;  3KHH A;  1R3N A;  2HHW A;  1HNZ J;  3CDA A;  4QR1 A;  1C4C A;  4W92 B;  1RWP B;  4QIW D;  4DR3 J;  1SXL A;  1QE1 B;  1UET A;  4C0H A;  3C16 B;  5CHC B;  2GHW A;  3M7V A;  3A3N B;  2GV1 A;  1FRM A;  1HHT P;  1RT2 A;  3BR8 A;  5BJR A;  4ECZ A;  4DR4 J;  3BQ0 A;  1HMV A;  2JJ4 D;  4CO4 A;  3E51 A;  2FUG 9;  1RUS A;  3OL7 A;  4DS5 A;  3FBE A;  4PYD A;  2JLE A;  4J9S A;  2ZKU A;  1EAR A;  3AY0 A;  3DRY A;  3IGV A;  3HVT B;  4I4B A;  1NHU A;  4DX8 H;  2ZM6 F;  4AUK A;  4N47 A;  2F8M A;  2Z58 B;  4NEZ A;  5CQG A;  2C2R A;  1ZET A;  2UXB F;  3NAH A;  1NZA A;  2DPJ A;  3W62 A;  1TP7 A;  5BR8 F;  1JLF A;  1X9M A;  1UVL A;  1UEU A;  2OSR A;  2CXE A;  1N32 F;  2XWY A;  1T9X A;  4QR2 A;  1X9S A;  5DRK A;  1DLO A;  3M2U A;  3G8Q A;  4ED4 A;  1S76 D;  1QUP A;  1B64 A;  2IPO B;  3VZI A;  1VC0 A;  2IAJ A;  2H9Z A;  2F4F A;  1YBA A;  2JWN A;  1MN9 A;  4O0N A;  4C3K A;  2PA8 D;  3CCE S;  4GC7 A;  1N32 J;  3OV7 A;  4EU0 A;  3POT B;  1LFP A;  1H7W A;  1F5A A;  4WXO A;  5ETV A;  3CCM S;  5E2Q A;  2HFS A;  1YIT S;  2HVI A;  1HBO B;  2Y1L B;  5KFC A;  4DS4 A;  4PQU A;  2RU3 A;  4DV4 J;  2YKN B;  4OX6 A;  2IJR A;  3KHG A;  3Q8Y A;  1C0T B;  1ICE B;  4HL9 A;  4LT6 A;  1VQO S;  1YDL A;  2VFT A;  1HNZ F;  1M0S A;  4QU6 A;  1VFJ A;  1WUU A;  1YJ9 S;  1VBX A;  4O23 A;  1UP1 A;  2A0F B;  2M8D B;  1S0V A;  3FQK A;  1REG X;  1S12 A;  3CCJ S;  5DQH A;  4PQU B;  2ZNZ A;  3MDF A;  4AL6 A;  2PI5 A;  2D69 A;  4NRT A;  4XO0 A;  2WOM A;  3CDE A;  1S99 A;  1ACM B;  1HNI B;  5L9X A;  3S1T A;  1VBY A;  1NDP A;  2BOA A;  3F44 A;  3PEH A;  5KT7 A;  1UA1 A;  2R8K A;  3N6N A;  2LQB A;  3KNA A;  3D6H B;  4O44 B;  3T1A A;  1RQ0 A;  2ZWO A;  2DIT A;  3T41 A;  3HM9 A;  4HYK A;  2C2D A;  4YP3 A;  3SSR A;  2UUT A;  1U1N A;  2RRB A;  1EKS A;  4DMZ A;  1VHI A;  3Q89 A;  4IDK B;  3GV7 B;  1LEO A;  1SL0 A;  3C6U B;  2W4C A;  3AQO A;  1NJW A;  4N8O A;  3L7U A;  4PG6 A;  2D74 B;  1PBU A;  2YPY A;  1CJV B;  4K4V A;  1SV5 B;  2NSC A;  2EFO A;  4JI8 F;  1RT3 A;  2Y0B B;  2C2O B;  2VFR A;  2UU9 J;  4I67 A;  3NGR A;  1FA0 A;  4KV8 A;  3H2L A;  1WEX A;  2J7U A;  2P2C B;  3VGT A;  3CJT A;  3P8B B;  3A8E A;  4NML A;  5I3U B;  3C6U A;  2EBG A;  1C1C A;  3IRX B;  4A8F A;  4F4K A;  2HHT A;  4MYT A;  1FX2 A;  4WU3 A;  4KHR A;  1RKI A;  4E0D A;  3P6Y C;  2JLF A;  4JP8 A;  3M8Q A;  3SMZ A;  3V4M A;  4WII A;  4A48 A;  1T94 A;  1V6H A;  1ZAV A;  2HFN A;  3SSQ A;  1TUG B;  2AJ0 A;  2WVC A;  3I0R A;  4HR2 A;  2WVD A;  3IO1 A;  3ISN D;  1C1C B;  4IG3 B;  4OV1 A;  1NPK A;  3VGV A;  2FVP A;  1HW9 A;  2CJA A;  1YWX A;  1N36 F;  4QIE A;  2DR9 A;  3C8Y A;  1LWE A;  2Y9H A;  1PSD A;  2QMW A;  3M8Q B;  3F56 A;  5LMU J;  1QAI A;  1VDH A;  5E3P A;  3VF0 B;  4V19 J;  2JEF A;  2Y1R I;  5JMN A;  2GHP A;  5F9N A;  3JS9 A;  1T9W A;  2EXU A;  2K7K A;  5L1K A;  4ZIW A;  1D0E A;  2CFX A;  1X4G A;  4RZR A;  4UOF A;  5HP1 B;  5C25 B;  1LK5 A;  2XMV A;  3BSC A;  5IQ6 A;  1F0X A;  3MOZ A;  3GLJ A;  5GMK a;  4DV0 J;  2GMJ A;  1XMO J;  5DS7 A;  4M5J A;  4DU7 A;  2XG8 A;  2OPS A;  2YX4 A;  3T5K A;  2DVI A;  5J2N B;  2VHG A;  2LEC A;  2B7C B;  1S9E B;  4N7T A;  4NLS A;  1ZPV A;  3ENQ A;  4DV7 F;  1URN A;  3CMA S;  1U25 A;  5GAD U;  3J7Y U;  3FZB A;  4WE1 B;  4CNZ A;  3I55 S;  5DM7 Q;  2CNK B;  3A3O B;  5ADZ A;  3PO5 A;  1IKY A;  2A3J A;  4MJK A;  2POK A;  3W60 A;  2OPS B;  4C8Y A;  1UVI A;  4USM A;  2ROG A;  1LOU A;  5CZX A;  3W5Z A;  4DV2 F;  3QJJ A;  4AQY F;  1OS5 A;  2QG9 B;  5KT4 A;  3HJF A;  2XGP A;  4USI A;  2ASY A;  2R42 A;  1GT8 A;  1B0T A;  2BAC A;  3MGJ A;  4CO5 A;  2EG2 A;  4KBI A;  1CUL B;  4JI1 F;  1DTT A;  4NPO A;  4PG7 A;  2AWZ A;  1L3U A;  3H98 A;  4OYP A;  2AKW B;  1TEL A;  4IOB A;  2XS5 A;  4JYA J;  2ZH8 A;  1TUV A;  4DR2 J;  1NSP A;  2IVY A;  5L1I A;  4YFU A;  3BRE A;  2OO4 A;  3IR7 B;  1RI7 A;  1SL2 A;  4O3O A;  3N01 A;  4PPD A;  2NZC A;  1BQM A;  3P5B P;  2CQI A;  1KS2 A;  1V5V A;  4HI1 A;  2MJU A;  2MQO A;  3KLH B;  1JLG B;  2OP5 A;  2DNR A;  2AYM A;  3JTP A;  1T02 A;  3W2W B;  5DET A;  4ED6 A;  4Y2C A;  4JV5 J;  1QSS A;  2M70 A;  2CG4 A;  2FLO A;  4J9K A;  2RE1 A;  3W3S A;  5F3T A;  1BQM B;  2BBE A;  4OYI A;  3X1L B;  1KVJ A;  3P4U B;  4DSL A;  1ZH5 A;  4ETZ A;  2YWH A;  4ZVU B;  2IVF B;  3T1H J;  3EJM A;  2OSQ A;  2NSB A;  3LH2 S;  5GAH I;  1KQS R;  1D1U A;  2CPD A;  1RTI B;  1HNX J;  3D9B A;  4GKK F;  3CED A;  1HWK A;  2YWK A;  3W5Y A;  1FVS A;  2FJV A;  5HQL A;  3GJT B;  3I0S A;  1UVN A;  3DLG A;  5KG0 A;  1SH3 A;  3SFG A;  2V2Q A;  1RWV B;  2B8Q A;  3HD2 A;  1RHU B;  1HQE A;  3QT8 A;  4K4U A;  2J9D E;  2GJ2 A;  1OSC A;  2CDR B;  3ISN C;  2V8G A;  3I6P A;  3AOB A;  4JI7 F;  1RT4 A;  3IBW A;  1YRU A;  3CJ5 A;  1O6X A;  3DU6 A;  1JJ4 A;  5IWA F;  5T7L B;  1SL1 A;  1Q78 A;  1FKA F;  3ELH A;  4RW9 B;  4WPA A;  3MUM P;  4OL8 A;  3G6Y A;  3JXO A;  5HMY A;  1YRX A;  1ZA1 B;  3QPI A;  2JVO A;  5HQM A;  2OEJ A;  3NEK A;  4O0I A;  1NM2 A;  5KFW A;  2ZH1 A;  3R6L B;  1KC8 T;  1MML A;  1IUJ A;  3VAF A;  1F9F A;  4HVZ A;  4DUZ J;  1F9E B;  1NB2 A;  1WTB A;  4J9V A;  2YPZ A;  2MY7 A;  4XDD A;  2LFV A;  5AE2 A;  5K8P A;  1NME B;  4X4O A;  1XR7 A;  1HHS A;  2AF6 A;  2O67 A;  3NP5 A;  2HS0 A;  1L3S A;  4ITS A;  1SC3 B;  5KFK A;  1M1G A;  2ZHO A;  1RA6 A;  1ZM2 A;  2YWG A;  4DCO B;  2J5A A;  1KLM A;  2QMX A;  2AEM A;  4IFV A;  4K2X A;  2Y3Y A;  4DV4 F;  5D4O A;  5I42 B;  3HHL C;  1U1R A;  1Q7Y T;  4CP5 A;  3KJV A;  3AOA A;  3V81 B;  3B4D A;  2CPE A;  3HHN B;  2MQL A;  2ZVS A;  5D4L A;  1WKL A;  4ZVS B;  3GU0 A;  5JJB A;  2C2M B;  2QL9 B;  1SUQ B;  4JI2 J;  5BXI A;  4TLR A;  1SIZ A;  3DLJ A;  4ZPT R;  4DUZ F;  3AD8 C;  2DHH A;  1VIX A;  3HHL B;  4CLU A;  3AT1 B;  4MIA A;  5KFF A;  3OHA A;  3C15 A;  3K5P A;  5DDQ C;  2C2N A;  4N56 A;  2GA7 A;  4DV3 J;  5F8I A;  3A12 A;  1RYR A;  3L7P A;  2I1R A;  2H54 B;  2MKS A;  3M6X A;  5KFE A;  3TUZ C;  4WWS A;  1REV A;  4Q5V A;  4WFZ A;  4P2M A;  5L46 A;  1QVG R;  3QJP A;  2YH0 A;  1SKW A;  2YNH A;  5GAE U;  1O8B A;  3WHI A;  2KU7 A;  2VC0 A;  4CDI A;  1Q81 T;  2MHN A;  3CD0 A;  2CJB A;  1FEH A;  3GP9 A;  4X66 J;  3KLF B;  1YJW S;  3BB5 A;  3QSI A;  2PD1 A;  4C8K A;  2W2O P;  3MR3 A;  1CJU B;  1ZM4 A;  2FLN A;  2WAQ D;  3CD6 S;  5DLF A;  1N5V A;  2YNH B;  3BM7 A;  3Q86 A;  1V3S A;  1SB6 A;  1WG4 A;  2DO4 A;  2VG6 B;  3A3P B;  4ZIV A;  5CAB A;  4G1Q A;  2VQF J;  4BDP A;  2GVD B;  4IRD A;  3AB4 B;  9RUB A;  2R8H A;  2R8G A;  5K8O A;  3FDS A;  1Q86 T;  4ZPV R;  1RAI B;  1HNX F;  1CJU A;  1EAY C;  1LXN A;  2YKO A;  4FBT A; 
#chains in the Genus database with same CATH homology
 5H9E K;  5CD4 A;  2Y8Y A;  4U7U D;  5H9F K;  3QRR A;  3QRP A;  2Y9H A;  4DZD A;  2Y8W A;  4QYZ K;  3QRQ A;  1WJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...