5CD4A

The type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
199
structure length
199
Chain Sequence
b'MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasE
publication title Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/rna
total genus 26
structure length 199
sequence length 199
chains with identical sequence M
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 5cd4A01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5cd4A02
3QRQA 2Y9HA 4U7UD 3QRPA 2Y8YA 4DZDA 1WJ9A 5H9EK 2Y8WA 5CD4A 4QYZK 3QRRA 5H9FK
chains in the Genus database with same CATH superfamily
2CYYA 4CO5A 2HNDA 6FD1A 4P72A 2KYXA 3MEEA 2JRSA 3M2RB 2VPZB 2MHNA 4PQAA 3HSZA 2BYCA 1PBUA 4DSEA 4E8UA 3OTOF 5B0CA 3DC2A 3QO9B 2DYAA 1F2GA 4DZDA 1KD1T 4MH8A 3N9UC 4PXDA 1Q95G 3KMSA 4U6PA 1RHKB 3PO4A 2Y8YA 4J9UE 4DPOA 2AYMA 3VGUA 3JYTB 3KDOA 2MYFA 4LSLB 4JI0F 3UNYA 1DTQA 1RT6A 1CJKA 2CQ3A 3A3NB 2J6SA 4USKA 4ZVSB 4H4MB 5ETOA 4WE1B 5AE3A 4U7CA 1YJNS 1TUVA 1UJ5A 3A3PB 1SL1A 4C8LA 4DQPA 4M5LA 5IOLA 3G8QA 1O8BA 3BV8A 5KFPA 5E5NA 2XMUA 4LR9A 4EMDA 3KLGB 3OLAA 4CCHA 2ZH7A 4P2FA 3OL9A 2XMAA 2CQ2A 4ECXA 1RWWB 4C3LA 5H9FJ 1IKYB 4O3SA 3R9LA 3P5TL 2AQ4A 3QT8A 1FXRA 1DQ8A 4ZJLA 3B78A 2VQFJ 1L3KA 3ET6B 3KJQB 3UDVA 4JBCA 2K06A 1OY9A 3RBZA 2LMIA 4JI5J 1T9TA 3EPIA 2AW0A 3ZZPA 2VPXB 3W8PA 1GFWB 2QIFA 3FSXA 4ZP9A 1X4BA 3AB4B 3IBWA 3SEOA 1U4BA 1EJ7L 2V8PA 2G2YA 2HS0A 2Y8WA 5KFHA 1ZTWA 4LBPA 2CFXA 2UP1A 3NGDA 3M6VA 4KQZA 1X9MA 4ZMMA 2UU9F 2DEJA 2KHDA 3VQTA 2ZNZA 1VI7A 4KAIA 4F3MA 4QIVA 2KXHA 3RR7A 1C1BB 2IRUA 2VONA 2G1DA 3ILIA 2U2FA 3GQCA 5EX3A 4WF9Q 1E6VB 4F36A 3UR0A 4RW4A 1WF0A 4DV2J 4CWBA 1SIZA 3PYEA 3QWPA 3ISZA 3AODA 1U2RA 3SIPB 5B7WA 2OD4A 4PRFA 5KFLA 4ZVFA 4AYBD 1NKEA 4GC6A 2XQCA 3C15B 2OEMA 4PYDA 4L72B 3AD9C 1DQ9A 3QIPA 5CHCB 2CDQA 5A2QU 5LMUJ 3A12A 1LWXA 4A8SA 4CO2A 4ZCLA 4ZHRB 4USHA 4EI2A 2HWIA 4ED1A 3HHNB 1TVRB 1WF1A 4KFBA 4OHWA 2XMWA 4DR3F 5ETQA 4J9QA 2R9LA 1UWBA 1SJ1A 4C0HA 4BC9A 2ZBCA 3DN9A 4RUBA 3B54A 1VBYA 2W2NP 2HPUA 4F4XA 3DOKA 4DV4J 3ISND 2BKPA 1T05B 3G6VA 2W2QP 3IRXA 2A6MA 4FYDA 1RA7A 2LEPA 1EETB 3RAQA 5GAHI 1JLAB 4URQU 2YNGB 1RWNB 1LW2A 4Y2IA 1OMSA 5DG9A 2DHGA 3G96A 2RJZA 1JLCB 4OQJA 3QQCD 2VFRA 4IFVB 2NSCA 1DFDA 1RB0A 4QYRA 5CAAA 1FFWB 2OTJS 3EVWA 2QSWA 1BWEA 1JXEA 3HO1A 1X60A 1S5ZA 1N6QB 4B9NA 4F4ZA 2OMLA 2VPWB 1K9MT 3JAMU 3BQ0A 3MM6A 4DQQA 3DGVA 3FBFA 4OL8A 1N5YA 4G6VB 1FESA 2OSRA 2JEIA 4MKVA 5F3ZA 1JJ4A 4DR5F 2ATLA 1YSJA 3EZ5A 2AGOA 1BQNA 2IRYA 3V5RA 3LP0A 2POKA 1JLGB 4J9LA 1N5SA 1F1BB 1VGYA 3HHEA 2M70A 2F7VA 1R7IA 1HI8A 1N32F 2XLIA 3C66A 2BM0A 3G6ES 2PMZD 2DISA 3M8YA 2BOPA 2NCKL 3GV5B 1IXKA 4PQUA 4FKXA 5J2PA 2PI4A 2BMBA 2GGPA 1U8WA 4K8RA 4DFKA 4ANDA 1ZM2A 2BE2B 2LEAA 3W2VB 1U09A 1Q0NA 3W2WA 2DCLA 2XZTB 3TVYA 1OSCA 3N5FA 3TJ8A 2UV8G 2QMXA 2ZWPA 5BR8F 2IVFB 1FKOB 3FQKA 1AROP 5HQLA 1VDHA 4B02A 3HMJG 3P96A 1UPMB 4FXWA 1NDLA 2VOOA 1QUVA 4JI2F 4JV1A 2QLJB 4PYAA 2Y1JA 4JI1F 3MCNA 1S1XB 1SL2A 1HBNA 2V6AA 1WI6A 3KLIA 4PWDB 4O0IA 1SJ4P 1SV5B 4GVBB 3CJ4A 4U8VA 5DM6Q 3MMAB 3CCZA 2DTJA 5IZHA 2XB2D 1A6LA 4B9SA 3H20A 1JMTA 4DEZA 5GVQA 4TN2A 3VV2B 1S9FA 1YK9A 3JSMB 4RJVA 4C8ZA 4N56A 2W7AA 1Y3JA 4M5NA 3PO5A 4ETXA 1RHRB 3MCOA 4ECYA 5ETPA 4IR1A 1GX5A 2R42A 5HK4A 4CLWA 2DKOB 1QTNB 4WFXA 1FWPA 4Y0FA 1FJ7A 1QY7A 5EGYA 1T11A 2ZH5A 2W7PA 3KK3B 3CJ3A 3QLHB 4XDDA 3M8QB 4ECUA 1R0AA 1FDAA 4B9LA 5D4LA 4DX8H 4KJIA 3MPDA 3M1VB 1IUJA 3GV8B 3NP5A 4NWBA 2WRMA 8ATCB 3CDAA 2R2UA 3HT0A 1KDNA 3K89A 2I5JB 4KPYA 1VQ6S 4DL2A 2ZJRQ 4KGMA 2F3JA 5B0EA 1RTHB 5B0FA 3MM5A 2E5LJ 4DR7F 3BSOA 3NNAA 3AD8C 4WFBQ 3N0VA 1TL3B 2VB6A 3VAHA 4OHYA 5J2QA 4RKUC 4J91A 4QCLA 3D9BA 1HHTP 1B7FA 4V19J 4QJVA 5M2RA 2DB1A 4FNIA 5L1LA 3K8VA 2YWGA 2R7XA 4YB6A 2FHMA 2C2DA 3R7NB 4LSNA 1SQFA 3T1YJ 2OP5A 5JVGQ 4F4KA 2GMHA 4ES3A 3TP2A 1F3FA 2EKNA 3C2PA 3UN3A 3TQ1A 1VQ7S 3R5GA 4QWDA 4MK7A 3I9V9 5C25B 5ETRA 2CDRB 2FC8A 4DU7A 4B3TJ 5AXNA 2VIHA 1YTYA 3BH6B 4DZ6A 1NSKL 2A0FB 5KFUA 4W4MA 1LW0A 4F4YA 4M1KA 1I94F 2IM1A 3S1TA 1P27B 3VTIA 4AXJA 3DRPA 4PEOA 4DSIA 1B64A 1LOUA 1UPPA 5B0AA 2VFSA 3HULA 1HWJA 2DNMA 2YH0A 2ZKUA 2N7YA 3JQJA 1D8YA 1DRZA 1R8CA 5L8RC 3T5KA 4KBIA 3UD3P 1FDBA 1XR6A 4DJBA 1S1TB 2RNEA 4DL5A 1BQMA 2GQ2A 3DLKA 2DXEA 5KFZA 2ZZMA 1FTRA 4CT9A 3LGHA 2EFPA 4Q2MA 3J7AN 4C8NA 5HROB 2V69A 2CRLA 3BB5A 4FYWB 4WBFA 1NKCA 3DU6A 4DR4J 1SKWA 2G0JA 2ZVSA 2D3UA 4QYZJ 3NY0A 1TR0A 3HKWA 5KT2A 1UTAA 1OY6A 1AB8A 3Q8QB 5KFXA 2K2PA 4CH0S 1PYSB 2AZ3A 3THTA 1HI0P 2W25A 1QE1A 2F4VJ 1NPPA 3EE3A 2KFYA 1RT4B 1SL0A 3J7YU 5KFCA 5B09A 3H90A 3BDEA 1CULA 3DRRB 4Q44A 4EYHB 2FGOA 1Q78A 3IG1B 1YJUA 3H98A 2CPEA 4QR1A 1Y4ZB 2XTJP 3BR8A 1FJGJ 5I3UA 4DFJA 1XMOF 3H4DA 3Q22A 2ZC3A 4CH1A 3BGRB 3CJ8A 2LLZA 4Q7AA 4PABA 4EFAC 3DOLB 1TK8A 1URRA 1S1UB 4LRCA 3GFXA 3QATA 1RU1A 3TR5A 2UXCF 2AV5A 2OO4A 3OJSA 1K0VA 3UD5A 1XNQJ 3WIUA 5FJ4A 2KFZA 2HBRB 4WP9A 3SDEA 3P4UB 1HW9A 1EP4A 1VQSA 2FHKA 5HVHA 2V67A 4HH0A 1WSVA 4R5PA 1RLCL 3SFUA 3LOUA 3QZ7A 2OIHA 2XSJA 1CJVA 4ZK7M 3TZZA 2AJQA 2AJ4A 3M4XA 2V5HG 3E2EA 4I56A 2NXEA 3S6EA 2L08A 2IYGA 1C0UB 1OIAA 3EMTA 2IYIA 3QAEA 2R2RA 4MFBA 4K4WA 3L95X 4YS2A 3SSQA 3MM9B 4LRDA 2B9EA 1DLOA 1NJWA 3JXOA 4FF1A 4FF3A 2YWFA 1FEEA 3DNCA 4ZPVR 1QAXA 1CLFA 2PDAA 2ROGA 5HP1B 4NLPA 2CQIA 3THVA 4ZLJA 2KT2A 4F0HA 3PR4A 2DNZA 3EXCX 3CJSA 3D3CJ 1Q4RA 3D0IE 3MFIA 5IC6B 4X2BA 2RUSA 5BYRA 1X4AA 4CT8A 1VK8A 1IKWA 1HNXF 3MR2A 1H2VZ 4K4XA 4WTYA 4BC7A 3VAIA 1B0TA 2BZ2A 1RTDB 4RL1A 3NGRA 3FFIB 1J5EJ 2DBBA 3VAJA 3KJVA 2C2NA 2BE9B 2DPIA 2C3MA 3NXZA 2YKNA 2W9BB 1DZ5A 2XYGB 3TI0A 1R8BA 4IG0B 4WKYA 1FRIA 2H5JB 5KFNA 1DURA 4JI8F 2HG4A 2V2VA 4USIA 2LECA 4B17A 2OH2A 3F73A 2DR8A 2GVDA 2VH7A 2RF2A 4UZBA 4HHUA 2Z8QA 2Y0SD 2I0XA 2CQPA 1RHJB 2V4JA 1JLFB 1FRXA 5J1PA 4YMEA 3VGTA 2B5JB 4ED4A 4CTAA 3ENQA 1QSLA 5KG6A 4RW7A 5I3PA 4DG1B 3TO8A 3T5HA 2NREA 5KOWA 4HLBA 3R6GB 2AX0A 2KI2A 2EBEA 2MEWA 3IP0A 2VC0A 2C3UA 2C2KB 4PAAA 5HVGA 3KK2B 3L9ZA 1QSYA 1QLNA 2Z2YB 4M5JA 3H2LA 3VVUA 2M5YA 2OPQB 1JLBB 3TUJC 2OGUA 2HLTA 4V1Ak 4DLEA 5IC4B 1S1VB 2BJ7A 3BO4A 3NMRA 2J7KA 5D3GA 1TKZB 1I1GA 4M5GA 4FYVB 2OSQA 4KY3A 1RE1B 1O51A 4C7QA 3EGZA 4ID5A 3W9HA 4ECZA 4RX6A 1SH2A 4A48A 2YH1A 1SH3A 3NL0A 1WORA 3IS9A 4DUZJ 5LOQA 2EFVA 4M63A 1VQ5S 3E01B 2YQ3A 4HKQA 4OI3A 3LA0A 3M2RA 2OPPB 4UF4A 1TKXB 1HYSB 2PEHA 3N28A 3QO9A 2HHHJ 2RHQB 3CD6S 3KLEB 4PG5A 1N54B 1HQEB 1U49A 5DO2A 4I69A 1BUXA 2X51A 2HRTA 4F3OA 3JYTA 4RW9A 3T9ZA 2E1AA 1X7VA 4O4RA 2L9DA 2OI2A 4WE1A 2GIRA 3OT9A 4L74A 3T5JA 2N7CA 5KFQA 2B51A 1R8AA 2CZVC 3MPWA 4CO1A 5D0GA 3AXKA 5D4PA 3BBFA 3DMJB 1R89A 1UCNA 4RNHA 5DDPC 1NJXA 2YX4A 4EZ9A 4JP8A 4DV5J 4H4OA 4ES1A 3R2DJ 2QYCA 3SQGB 3KLGA 1SC1B 4WWSA 1OJ4A 2MJUA 4X65J 4TNOA 3MOZA 4K4YA 2CWXA 1H38A 1N8RT 4N8OA 1IKYA 1ELOA 4W90B 2HQGA 1F2HA 5D15A 3EGNA 3G6YA 2EK6A 3TA1A 1KHWA 5F9NA 1U1OA 1ZM9A 4RW8B 2DIVA 2HZAA 4JI5F 2E9ZA 4H4KA 2B9YA 5A6WA 4I2PA 4P9SA 1WDTA 1KNZA 4LRBA 4DFPA 2V4RA 2HFZA 3CD0A 4DFMA 3PJWA 1FVSA 4TQSA 2JLGA 3CPWR 3L7OA 2V50A 5DDRC 4C2MA 4DL4A 3OW2R 3PJXA 4JV2A 2FJDB 3I55S 1O5JA 2BKOA 2I8EA 2FJEB 3CF5Q 5SUHA 1H72C 3R5BA 3GIRA 1Y5LB 2QO3A 1IN0A 3J7A1 1NNDA 1RISA 4F4AA 4NYZA 1BLUA 1C1BA 1ICEB 4FYYB 1KVKA 2ZUGA 4X84A 4DV2F 5AXMA 3DLGA 1H0HB 5LJ5Y 4G3IA 1HARA 2OHDA 2LQBA 1GXTA 3KLFB 5A8WA 2MKCA 4WKRA 4FP9A 2UUAF 4L6V3 3OL6A 4FPIA 1CQNA 3C15A 3CUNA 3PXGa 5LMUF 1RYSA 1VQKS 1NK8A 3TA2A 1VC6A 2E5HA 2E44A 2HURA 2HMIB 4ZPAA 3BSCA 4B9MA 2HAFA 3WHIA 1CJTA 2LEBA 4ZLLA 4J9KA 1R6YA 4OZ5A 3GSIA 3I0SA 1FD2A 1KLMB 1TVRA 3W64A 2AMCB 5HAOA 3PY8A 1WNEA 4Q0BB 5KG1A 4ECWA 3Q86A 2LYVA 1PG5B 5F8HA 4DV4F 4P71A 3FUYA 1YJ7A 2D41A 1F0XA 4K4SA 2XWYA 1V9OA 4NLWA 3D1OA 4IH7A 3UD4P 2FJAB 1FWKA 1RT3B 3WDOA 4R8UB 3M05A 1F60B 3A1YG 2OLWA 1XNRJ 1JLAA 2QLXA 4C9DA 1IM4A 4DR6F 1Y0HA 2YNGA 3GB0A 1CC7A 1MWYA 4RBVA 3O5TB 3W9IA 2GJ2A 4TLRA 3BH7B 5CYMA 3RG6A 4PG7A 1SKUB 2C22A 1EIYB 2LCWA 1NCLA 4C4WA 1ZZNA 1B70B 3GR1A 4FBUA 4I6WA 3J80Y 3UW1A 3C16A 5IT9Y 4PXEA 4LFAJ 3V81A 2O5DA 3M6WA 3C6TB 1YX2A 3HD1A 2JC0A 4KPCA 4ZCKA 1JXLA 2D69A 1ZAWA 4CO4A 3LO3A 2CPHA 2DPJA 3ZTQA 1VQPS 4LFBF 1HPZB 2K8GA 2WSEC 3VCDA 2X3DA 4DPXA 4DCPB 3NOGA 4NCGB 1XR7A 4AUKA 4LF2A 4OHVA 2OPSA 1JLGA 2R7RA 4CNZA 1GT8A 2QT7A 2FLLA 1TL4A 3PM9A 4LF8F 2J9EA 3AOBA 1YJRA 5IFMA 3MEDB 3CCVS 4DV6F 3FCHA 3MURP 2V9WA 4C48A 3QPIA 1S6PB 1TUWA 2AJ0A 2DT9A 2C3OA 3PHTA 1VIOA 3K7RA 3M2UA 4RU9A 1AUSL 5F9LA 2VKRA 4HI2A 1RGVA 3EX7B 2IA6A 2RT3A 2IHR1 1TL7B 3T3FA 4WYLA 4JUZA 4KB7A 4BLGA 5DS7A 1TMMA 5JUMA 4A8MP 2F40A 4ED5A 3OPKA 2NXCA 4P52A 3FRZA 1FKOA 2QFIA 1XMQJ 4NLTA 1R3NA 3H0PA 1S1XA 4V19X 2DR6A 3BYRA 4PWDA 4CLTA 4GVBA 3KJNB 3IM8A 4HACB 3KLHA 4ZP7A 2MSSA 2QJ3A 2BJ1A 1ROFA 4P7VA 3CGIA 4ZJOA 3QJJA 1VQMS 1CPZA 3FMWA 5AJ3J 3O2IA 3JSMA 3MMBA 2LA6A 3SCIE 5B0DA 1LWCB 3KXDA 2MY8A 4F8RA 1H74A 1KOOA 1UEKA 4NMXA 1KOHA 2KL8A 3PHEA 2MKHA 4WPAA 3PW0A 5HN0A 3BN7A 3ISNC 4NLSA 3CTRA 3MUVP 5J2NA 4K50A 4E98A 4Y34A 4X64J 1IBCB 2UUCJ 5KFKA 2YPZA 4I0WA 2RS8A 2C2EA 2XNRA 3OSNA 2L9WA 2HWHA 3IRWP 2V2QA 5JMNA 2DNGA 5LXRA 1UA1A 2YX1A 1YRTA 4M5DB 4ZN1A 2W9AA 4LUBA 4OMFG 3LALA 1S1WB 1U6FA 3DGPB 4L3NA 4USUA 1IWGA 1IKXB 4UOGA 1NK9A 3AQOA 1IBLJ 4OYXA 1B4SA 2WZ1A 3CVKA 5HBMB 3QBCA 5F8GA 4HR2A 1MROB 3BBCA 3WIVA 3RTVA 1FE0A 3L3CA 4YDXA 1G1XA 5DGAA 4LIRA 4NX9A 4OZJA 2GQCA 3G4SS 3N79A 4P2MA 3ZZRA 2HHVA 2BM1A 3TUIC 2C3PA 2OJ3A 1RDRA 4OV6A 5LSOA 1RTIB 4FXVA 1X0FA 1F3VA 1SXLA 5KT7A 3PTWA 1TELA 5KG4A 3QFWA 1CJUA 4Z37A 4DF8A 2J76E 1YJVA 4DR2J 1ZETA 2VJUA 2FTRA 1WHVA 1Q5YA 1U26A 4WFAQ 2ZVIA 4O3PA 1L3UA 1HNZJ 4B3TF 1RK8A 1VQYA 1CVJA 5C25A 1NRKA 2RE1A 3BO3A 3AJ2A 3KMQA 4Y28C 1QSSA 3NKYA 2H9ZA 3MTJA 4WJBA 3MM8B 2YBVA 3Q8PB 3PX4A 1U2CA 3IC1A 2CG4A 3N01A 1D9FA 4WU3A 1U0HB 2NXJA 2FDNA 3DYAA 1MMNA 2C2OB 1URNA 3R5AA 5A8KB 2F8HA 4H54A 3CD5A 3ONQA 3M8SA 3TOQA 2LXUA 1OQ3A 2YNIB 2A1BA 4Y2AA 1NDPA 5GMEA 1W25A 3NNHA 5LMNF 4C8KA 1FWLA 2FVSA 1S1TA 3SV3A 1N5VA 1PILA 3FNNA 2VQEF 4JI6J 3KNGA 1WC5A 4AL7A 4RUHA 3D68A 2VV5A 3B8HA 3Q8YA 4ERDA 2GHPA 4DR4F 3R7SB 3PRBA 3Q2SC 4QBUA 2MKIA 4JV5J 1Q1KA 1EAYC 4WTOB 2CAJA 4FDFA 1UVKA 1UVIA 2BABA 3SZ2A 4CRJA 4J9VA 1RT5B 1MMLA 4RUAA 2YKOA 4W92B 2DXFA 4J37A 2Y1IA 3MCSA 4DL0C 1RT4A 3T9NA 2YWHA 1KFSA 2AF6A 2ZITA 1WG5A 2RUGA 4WFYA 4O23A 4Y00A 2OFGX 1VRQC 4MTPA 1WUUA 3UN5A 4NA1A 2I1RA 3LPYA 5C2GA 2Y1LB 1RWKB 4K59A 3BREA 3PRVA 4TU7A 4HH1A 1X31C 3OL8A 3HFKA 2SXLA 5KFFA 3D0HE 4CYUA 5J2MB 3M2VB 2J0SD 2DGQA 5K8MA 1TL1B 2ZBPA 3S7RA 1HL6A 3GCWP 4QWEA 1ZBTA 3TVZA 2YKPA 3QNWB 1YBUA 4KE5A 2E1RA 2WBRA 1KQFB 5AT1B 3M9MB 5CZVA 4NRUA 4ILMA 1T9YA 4JYAF 1XNQF 1EARA 2XMTA 4YB7A 3AOCA 2ZH3A 3T19A 5GAEI 4X4VA 1FJCA 4DR1J 2R8JA 3NS5A 3QGIA 5H1SV 4M5MA 2HFVA 4JI3J 2RRBA 4CLSA 7FDRA 3NOCA 1YHQS 2WONA 3U7JA 4I6AA 1GH8A 3BN4A 5E3RA 4WXOA 1OPZA 1HQUA 5GADI 1X4FA 4Z7YA 4GRSA 5HJYA 2J7UA 1KQGB 4ICLB 2IM0A 1C0UA 1JKHB 1RT7B 2MLZA 2F8EX 2FVPA 2CQCA 4DF4A 1EX8A 4ZOSA 3MM9A 1X0PA 4NCBA 2JWNA 2W4PA 2ZH9A 4N8NA 3P3DA 5C24A 3A4TA 1TP7A 4N76A 1NUEA 1A9NB 3D4JA 2UZAA 3JB9k 4FF2A 1CSJA 2OUGA 3T41A 4IG3A 1KS2A 3D6FB 1T03B 3IGVA 1GMWD 2QGFB 4WIIA 2MQ8A 2KO1A 3AOAA 1UKUA 2RDJA 4HEA9 3VAGA 1XC9A 1F9FA 1TUGB 3G71S 3M8RA 1VQLS 3KUEA 3IWXA 3JQMA 2K3IA 2NPIA 3SSRA 3OV7A 5JXSA 2J0WA 3N5BA 1G7CB 2E7XA 1L3SA 2BQUA 3FFIA 1S9EA 3H7HB 1FO1A 4IH6A 1S6UA 2E7WA 1UJ6A 2OEKA 4EEYA 4CDIA 4K7QA 3CCQS 3HJVA 1UEVA 2FHJD 2KB2A 5B0GA 2ASYA 1U48A 2DRAA 4KGKA 3DLLQ 2J9CA 5KT3A 1N34J 4DQSA 2IM2A 2HYIB 4DWIA 1NBEB 3Q89A 1JLFA 2DRDA 1KLNA 3MEKA 2I9SA 1BE4A 2B5JA 1QVFR 3FDSA 2VFTA 2R2SA 1D9AA 2HQFA 5L38A 4ZVGA 7FD1A 4X62J 1SJFA 4K0KF 5DQGA 5KTQA 4YB5A 4MT1A 4NOHA 2M7SA 4O44B 1MSWD 2CJQA 4F04B 2NXNA 4RNMA 4DV7J 3DI6A 3MAAB 5E3PA 4PUOA 3KK2A 1HNIB 1PKUA 2ZD1B 4BCAA 3HSGA 1F6TA 1JX4A 1VRTB 2ZHOA 1RJJA 3C8YA 1GMWA 4O3RA 2VG5B 1PC4A 1RADB 2AGQA 1WD6A 4OI6A 2AYGA 3CC7S 1H7WA 2OPQA 1JLBA 5K14B 1FD8A 1HW8A 3PYGA 4ZPTR 2DGWA 5IM0B 3MEGB 3DDIA 2Y9HA 3K5LA 1V5VA 3SV4A 3FEXB 3PW5A 3I0RB 1TKZA 1RWXB 2KRRA 4XPCA 2W24A 1S0NA 3QGGA 2MQOA 3MR3A 3ZC4A 2XS2A 1XR5A 1SC6A 4GKJJ 3RRGA 4K5SA 2DNLA 1BWVA 3T5LA 2CJBA 3N4WA 3DCAA 3EXYA 2WTFA 2CJAA 1X4GA 3W1YC 2FYXA 1SH0A 4ZPWR 3F56A 4OI4A 4BS2A 2OPPA 2FZKB 1REGX 3H40A 2GX8A 2XO7A 2FHJA 4X4QA 2HHHF 1ZTTA 1HYSA 2UVUA 2N4DA 2HBZB 4ID8A 4DSLA 2DNKA 4A8YA 1HFEL 2XMJA 4IO1A 3J7ZT 1NZ8A 3RR8A 3J81U 3PNIA 4KH1B 4GKKJ 1RCXB 1HQEA 1APSA 4FS2A 1QUPA 1HBOA 3PV8A 2ZFHA 2XNQA 5F8LA 2XY5A 3UCGA 1XIQA 2VBWA 2RU3A 3FZ2A 1SQEA 1S6QB 4YB1P 2GO9A 2XULA 2UUBJ 1F9EB 2IAJB 1CS4B 2YX7A 2DNYA 3CMAS 4KHRA 3I9ZA 4X4RA 4Y2MA 1GTEA 2QX0A 1LK5A 3HLUA 3FRYA 3ZTPA 4DV5F 1VCTA 4LSZB 4ED2A 3SYZA 3HZEA 5EWEA 3DMJA 5HMWA 2A6OA 4YR3A 2CZ9A 2KU7A 2AP6A 2WK4A 3NEKA 2ZBIA 5IT4A 4RPFA 1VQ4S 4OZLA 3QIDA 2CG8A 4LFCF 1RU2A 2IJFA 3H59A 4X66J 1S99A 2RD5C 4CO3A 5A0YB 1AFIA 1FI4A 1KC8T 1IQTA 1NH7A 2P8IA 4DBQA 4B3MJ 1RI7A 2M3DA 1JJCB 4K2JA 2H65B 1HLWA 4QIEA 3WX8A 1S4EA 2H4YB 5G0RB 1YIJS 2KG0A 2GVZB 4BBYA 3BSAA 3I56S 2HFSA 4ITSA 4U8YA 4DSKA 1TL5A 3GTYX 4ZN3A 2HQDA 4AXIA 2UXDJ 3H5UA 1N52B 3FEZA 3LGMA 2LVWA 2VDHA 1Q53A 1SUQB 3MM7A 2HNYB 2G0IA 2B7CB 3HJFA 4DCJB 3GJQB 2HHUA 2JOQA 4WP3A 3CMQA 4B3SJ 1ZPVA 3D1HA 1RAGB 2Q6BA 1DY3A 1X8DA 1AYEA 3DM2B 2BV3A 3KLVA 3V6HA 2JVOA 3US5A 2K1RA 1UW9A 2M52A 2HFNA 2FJBB 2NYIA 2MQMA 4AQYF 4DN9A 4ZA1A 3CIZA 1I5OB 5ETMA 4DV0F 4PG8A 3NWRA 1VMBA 4M94A 5E33A 2IJNA 2HBYB 4CIOA 4N47A 1PYTA 2E1PA 2XCAA 2VG6B 2R8HA 4QPXA 2P5VA 4L73A 2MQQA 1J5OB 3G6XA 5HJXA 2FHOB 2YWEA 1M5OC 2PMWA 1QVGR 2OPRB 1NZAA 1RWPB 3JTPA 1S12A 2GHVC 3GJTB 2DCUB 1ACMB 2HMIA 1JLQB 3J81Y 4H4KC 1OS5A 3AH6A 1CJKB 4JI0J 3A13A 1QM9A 1WKJA 2XHWA 1H2TZ 2JHEA 3G87A 3DLJA 3FC9A 3PIOQ 2BKNA 2V68A 5SZTA 4C0BA 4Q0BA 4CO0A 2Z56B 3ETOA 3E3XA 1Z1ZA 4KKOB 5CD4A 1T94A 1UW4A 4JB8B 2DNHA 1UP1A 1N36J 1AT1B 1R8HA 1Y3KA 3C6UA 1BC6A 1RT3A 4R8UA 3R1LA 4UQGA 1UVNA 1FF2A 3Q8RB 1H2UX 1IJEB 2E29A 2WSFC 3SXLA 1RT1B 3CMES 2XMMA 3PCOB 2DNOA 2DNRA 2YVSA 3B4DA 3GONA 3TAMB 2ZH4A 1FX2A 2WHOA 2YNHA 2KM8B 3QT5A 3NAIA 4F2RA 3C6TA 4ENOA 4N5SA 1S9GB 3CC4S 2BJ3A 2FGCA 3WX4A 4RZRA 3C14B 3OD2A 1BY9A 1VC5A 3W66A 1U25A 3QGHA 2DGVA 4OZNA 4LF9F 1PJ6A 1XK8A 2MGZB 5IQ6A 3GJSB 4RBUA 3BGUA 4KIAA 1HWKA 3DRSA 1MU2B 2ZH1A 3QFHA 1MWQA 2BVZA 3T1HJ 1FK9A 2JDJA 2EG2A 1HHSA 4Z2XA 2UU9J 3NGTA 4PXBA 4F0KA 5GAGI 5IT0A 1WJ9A 4DS4A 3ZZOA 3HDSA 3CIMA 2VD3A 2PSZA 1JLEB 1XJWB 3OXLA 3L7PA 1VYAA 1FX4A 1S6PA 3HVTB 2DGOA 1YBAA 1SC4B 5LT5A 4P2XA 1U1LA 2OEJA 4M8LA 2RRAA 3PVXA 1N5TA 5KG0A 2ZHBA 1TL7A 2W7OA 3R2CJ 1RAOA 4QWCA 1C2PA 1KBRA 3MI7X 3QIPB 3CE8A 3EZOA 4OYOA 3DKDA 2OFHX 4LF1A 5FDLA 2EKYA 1XMQF 4DUYF 4PG6A 2NPFA 4PR6A 2GJIA 2RDDA 2UUTA 5MAOA 2VBZA 1P9YA 1REVA 4B08A 4KFBB 3ITHA 5J1EB 1UWBB 4IQMA 3BM7A 5A76A 4KHPF 3IAM9 4DR3J 5CH7B 2FZGB 2DY1A 5KOXA 3AA9A 2D1CA 4M95A 1R31A 5KFBA 1I3OB 3DOKB 3RBEA 2CPIA 2XSFA 3QZ8A 2P9GA 2ZBQA 3IRXB 3NBPA 5KFOA 1YRUA 2B9WA 2CIMA 1YVFA 2HS4A 4RU2A 3OQ2A 1KSPA 1KHVA 3GYGA 4ETZA 3VF0B 2NR0A 2CNNB 2WVDA 4QIFA 1T3NA 1HWUA 2HK3A 2XWXA 3DRXA 1LWCA 4CM2A 3DLEB 4HYKA 1U8SA 5KAKA 2IMOA 4NYOA 5IQQA 1VISA 2Z30B 1KTQA 3RRKA 2PFDA 2UUCF 5DDQC 2HQIA 3BEGB 2VC1A 5DQIA 4C8OA 2HBQB 1KRPA 2VG7A 3HHLD 3HVWA 3CJRA 4DV1J 1ZAVA 3TWZA 3NRBA 3SCKE 3H5YA 3MM6B 1O0PA 3K17A 2GNKA 1N5YB 4EU0A 3B4MA 4JI4J 2OKQA 3OR1B 2HVZA 3DU5A 2QN6B 1BQNB 2VKZG 1GMUA 4TY8B 3ZZ0A 3R6LB 1B99A 4DR5J 4L76A 3TARA 4QR0A 1S76D 2QTWA 3PKMA 4ECVA 1OO0B 2B4VA 3OR2A 1N32J 3LTOA 2HHQA 4AL6A 1HMVB 2XY6A 7AT1B 3QSYB 2DEIA 1HIYA 5J2PB 4ECSA 1F9HA 1RTJB 3RAXA 1FEHA 3CJ0A 4C6AA 4LF7J 4TXSA 1T8EA 3D54A 2JEGA 2M9KA 1V3RA 3W2WB 3RU0A 4IH5A 3K0JA 3BPSP 3CJ2A 4F0MA 3V6KA 1HNWJ 2KJVA 1R27B 3EVOA 1RQ0A 1HNZF 2ZOFA 2HSEB 2WCXA 1NJYA 4DLGA 4LF4F 1NHKL 2V8GA 2DR5A 1MW7A 1HBMA 2K7KA 2B4PA 4WZQA 4JI2J 1HBNB 4X4SA 4MKAA 4JI1J 2FVCA 3KLIB 2XI3A 4ANEA 1VJWA 3HHLA 3OJUA 4NASA 2FLNA 4Q8EA 3PZPA 4NLOA 3TAQA 2FUG9 2I2YA 4JV0A 2KTQA 2R3VA 2ZEJA 1RUSA 4BWJA 5DJBA 3AT1B 4KTQA 4DSJA 4A46A 4OYPA 2J6UA 1FJEB 3AAWB 3K57A 4U95A 2W01A 1HNVB 4Q5VA 4O3QA 3QSIA 4DX5A 5IV3A 2XBPA 1OQ6A 1VBKA 2IIHA 4JI6F 2W1BA 4X4OA 4OX7A 2Z58B 4Q45A 4B9UA 1HR0F 1NJIT 4NPOA 2F1FA 1Q82T 1R0AB 1AFJA 1X4EA 3NLCA 3HP6A 2CJYB 2VHGA 3CCTA 4ZVRB 4EBCA 4F7VA 4JV5F 4Y3CA 3J81j 3QRPA 4FS1A 2X1GA 2NSBA 3RRHA 2OTLS 2YWWA 1M5HA 1QAYA 2BOAA 3O8WA 4OX9J 4TKTA 1GTHA 1VLOA 2XC9A 3MM5B 1RT5A 3K59A 3PFOA 3BGLA 4MJKA 4AT1B 3QWUA 2HNZA 1LFWA 5FD1A 3HPOA 1SKRA 4N7TA 3HKZD 1NSQA 3S8SA 2XLKA 1NMEB 4W98A 1YKWA 2HAIA 4A4JA 1RTZA 4OLPA 4EO8A 1TAUA 3CJQA 5HATA 3TYTA 3I5BA 5CYQB 2X7IA 1FT8A 5K8PA 2PT0A 1KQSR 2XM3A 2MZRA 1QD1A 4AE5A 3HI9A 1T9XA 2MLXA 4WFZA 2C2RA 1TL1A 5DLFA 2VA3A 3A8JA 3TVKA 4G1IA 1YG0A 2Z57B 4JOUA 4YUDA 1TFWA 4IRKA 2ALYB 3DDKA 4RNFA 4ED8A 4XIUA 1FKAF 3DHXA 4HL9A 1M5PC 4OHZA 3DRYA 3PR5B 3H4BA 2Z2LA 4TYBA 5ETLA 3RB3A 3W61A 2R7QA 4DMZA 2H51B 2RH3A 4DR1F 4F4WA 1I94J 3DRPB 3BS9A 3JQKA 4DPYA 3R7BB 3CB4A 2IVYA 5D0HA 2IA0A 1MN7A 1TMJA 5IXUA 5E41A 1VHFA 1JWWA 2MMYA 3LP1A 1U1QA 2HHTA 3I87A 3OFHA 2E66A 2RDIA 2GAGC 4O3OA 2GZOA 2IC3B 1JKHA 1RT7A 2QZ8A 2HVHA 1OYDA 2RHSB 3CO0P 2XS7A 2DJWA 5F3TA 2GHWA 1WEXA 2UV8A 3UVJB 5EUHA 3VWSA 1H73A 1EKRA 1C0TB 2B3TB 4XTTA 2YY3A 1H3DA 5KFDA 2N3LA 4XAKA 4JI7F 1XEZA 4CQ1A 2BQ3A 1S97A 5CD4H 5HLFB 1T03A 3MECB 3W65A 3L7UA 1DJ0A 4ES2A 2B6AA 3ILJA 2Z2ZA 1RABB 3GJRB 2W9CB 2VF3A 2N82B 5KFYA 1D9DA 2CQBA 3Q8UA 2JC1A 4OYWA 3TUZC 4YY3F 2W2PP 2KT5A 3RB4A 3MR6A 1N48A 1RLDA 3I4PA 2KXFA 5ETNA 4MIBA 3W8GA 2RILA 1OSDA 5DETA 3GU0A 1C4CA 2MKSA 1NM2A 2QL5B 4XDCA 3HHDA 4WU2A 4TY9A 2HVEA 2CKWA 5D4NA 5I3UB 3OHAA 2IM3A 4FPRA 3I4HX 4DI6A 5IWAJ 4PXCA 2RKIA 5AXLA 1HBUA 3I5CA 1K8AT 2MHEA 4NI2B 4NXNF 3WZ0A 3FZBA 3CDEA 1PAEX 1WSRA 4X62F 2RQ4A 4C3KA 1VRUA 1WHYA 3TW0A 2ROPA 2PC6A 3ULHA 2XGQA 2MTLA 2BANA 4Q43A 3MMJA 3LQVA 3W3SA 1PBAA 9RUBA 4DV7F 4O44A 1TV6A 3KHGA 5CA5A 5GAHU 2UXCJ 2LU2A 3D7SB 1GXLA 4YOEA 1E6YA 4O4GA 2ATCB 2ZD1A 1WWHA 5DZ7A 2VODA 1IBMF 1VRTA 3BKTA 3BF4A 4R5PB 1PSDA 4HDGA 4QQBA 2XSJB 1CJVB 1FERA 4KO0A 1LWFB 1TAQA 2W4DA 1NDKA 3CT9A 5F8JA 3AJDA 1GK8A 2F5GA 3D66A 2EK1A 1RT2B 2XY7A 5A8RA 1ZYQA 3I0RA 1RHUB 1N0VC 4NCAA 4GKJF 2FC9A 2GAHC 1YGYA 4GMKA 1P1TA 1G4CA 4ZVOB 2H5EA 3VZIA 2BUNA 3HSJA 2DH8A 1BXNA 3KG4A 2MZJA 3ZZTA 3CJKA 3UFCX 4DQIA 2IVMA 4I2QB 1U1NA 4F26A 4IFYA 3ZXWA 2DITA 4GKKF 2E5IA 5HQ8A 3HVAA 4Q8FA 2RQKA 1IJFB 2EG1A 2MKKA 5ETVA 1P9QC 3X1LB 3LUYA 1IKWB 2CJXB 4QZVB 3SBMA 3IO1A 4CH7A 1TTHB 3CCUS 4UOFA 2CPZA 1SIWB 3FQLA 3TJ9A 1PO6A 2IAJA 2WBMA 4EBDA 1GEHA 2YKNB 4EWTA 1H6KX 3DLBA 5B08A 1MWZA 5K5MA 3V4IA 2F9JA 2RF2B 4YHHJ 2QA4S 1MNEA 2O67A 3CCES 4C98A 4F50A 4WCEQ 3BDPA 2V4JB 1T9UA 5G4DA 1C1CA 2CJ9A 4CTAB 3G8SA 2Z4PA 3KTQA 4RW7B 1B3TA 3KFWX 4Y65A 4EBEA 2CZ4A 2IY5B 1Y7PA 4B3MF 4NZ7A 2Q43A 1LQ9A 1NDCA 2QA2A 4ED3A 2CQ1A 2DHAA 6FDRA 3TZXA 3TEHB 2ZKTA 2EWHA 3D6MB 5C5JA 1G2EA 3EM1A 3AD7C 1S77D 1T95A 2GMLA 3MPUB 5D8HB 1PCAA 5G0RA 2XGPA 4M5IA 2DGSA 4U96A 2WW8A 1WKKA 2KHCA 2KRBA 3G8TA 4O0NA 4DPTA 2XHCA 1H7XA 1ZOTA 5L9XA 1NPRA 3TEGA 1M5VC 4DV3F 4J90A 1KEKA 2ZM6J 5DZ6A 2B7BB 3T6JA 6AT1B 5F8IA 1NXIA 1NEEA 4ED7A 2HIYA 2ZOGA 3MMCA 2B0GA 4DCOB 5DG7A 3ENVA 2QMUB 2WB1D 2QLFB 3IS9B 3U1NA 4PWWA 1AXQA 3MAHA 1W2BR 3CW2C 1ZM4A 4X4UA 2YNFA 1R0CB 1FNOA 1ZM3A 2V9KA 2HEKA 2B9XA 3D28A 4OJHA 2VG6A 3KG1A 3LW5C 1J5OA 4HT7A 1NHUA 3RYLA 2COLA 2Z2MA 5ETTA 2OPRA 5T7LB 1KTVA 3IXQA 1JLQA 4BDPA 3NCQA 4ELVA 4RW9B 3ICLA 4YQWA 1A7GE 3AQPA 3OUYA 1FCAA 2WOMB 1IKVA 3E8OA 2H5IB 2W8KA 5EDWA 2CADA 3ZO7A 1YQHA 1N33F 4P73A 5K8NA 3IR6B 1CC8A 4MKBA 3V6DB 3LPEA 2RVJA 1AZSA 2YKMB 4KKOA 2C2ZB 1N36F 3BGFA 2FLPA 2BDPA 4J5OA 1V3ZA 3N6MA 3UDLA 1NK7A 1UL3A 3GIKA 2XMKA 4H4OB 3MXHP 5E7OB 3PX0A 2CNLB 2H4WB 4Q2LA 2B56A 1ZAXA 2KJWA 3GE9A 4J9RA 1PJ5A 5CABA 2P6SA 4CP5A 3GFYA 2LQ9A 2R7VA 1RT1A 1FRJA 3OL7A 2X1AA 2JJ4D 5D0RA 2HZCA 3GIMA 2RSQA 2ROEA 4RNOA 1WTBA 4I2PB 3TAMA 1U47A 3MF5A 2Y1RI 4N77A 5FIIA 1VBXA 2OMOA 1VJQA 1I6JA 3WC0A 1TU0B 2ZH2A 1S9GA 1G6BA 2GV1A 4FVCA 4G1PA 5A6PA 2C28A 3RAMA 3C14A 3K5NA 2ILYA 2QV6A 3PEJA 1NSAA 1VBZA 2C3YA 4LSLA 5CQGA 1EZZB 3N6NA 1L5UA 4B3RJ 1T9VA 1U6ZA 1AUDA 2MGZA 3H42A 3A8KA 3T1HF 4NA2A 2ILZA 3PIPQ 1MU2A 1RHQB 4H4MA 2JL9A 2XYPB 1RAEB 2F8MA 1RA6A 2O66A 2CUYA 2VBYA 1FKPB 2FPHX 3AFGA 2QLBB 2FZCB 1B0VA 4D3GA 3DLGB 5D77A 2M8DB 4RWXA 5M2UA 4IOAQ 3BYPA 1JLEA 4IQXA 5KT6A 3KUGA 5A8WB 5EX0A 2BJEA 2GS8A 2DHSA 3HVTA 2VZ9A 1L3VA 4OZ2A 5KG5A 5KFSA 2I6WA 3J80U 3Q8SB 5IT9U 4BHQA 3F41A 2YTCA 2N4CA 1WC3A 2UUAJ 3R5JB 4IDKB 2F65A 2VQFF 5F8MA 2QA4G 3C46A 1RHMB 3W62A 1FRLA 3ET6A 1CJTB 2WVCA 2DD8S 3QJPA 1RBAA 3I0SB 3K5MA 1S57A 1PJ7A 2W2MP 1RWMB 1RAHB 2H3EB 1Q8LA 1JQGA 5K8OA 3VQSA 5J1EA 3TX8A 3KK1B 3MR5A 3PRDA 2MZTA 4MIAA 3H8YA 5CCLA 3HD2A 1YI2S 3ZNUA 5HMYA 2PMHA 4URSA 2EEYA 2BW7A 2NYHA 4DU8A 3TNVA 3MPYA 1EQ0A 4DUTA 1DBDA 4YEAA 3RW7A 3IR5B 2R7WA 4OZ0A 2ZZTA 3M6UA 3DHWC 1W7WA 2B8QA 2MLYA 4LBIA 4K5RA 3Q83A 1Y5IB 3U02A 4DR6J 3JSYA 5CYMB 1SI9A 3IBFB 2ZE2B 2QE5A 4I7FB 3NNCA 2DRBA 1E6VA 3DLEA 1S48A 5JJBA 3C16B 1RWVB 3PYDA 2CQ0A 4K4ZA 3J7YI 3V81B 3UR3C 8AT1B 1UZHA 2GQQA 4M5KA 4LQ9A 4DV1F 1WC4A 2VFVA 3GG1A 3IFEA 5I42B 2DR9A 2F4FA 4A8KA 4JI4F 1HD0A 2Y3YA 1VOMA 3GYXB 3LANA 3CXCR 2KG1A 3MUTP 2PFFB 3OR1A 4ZHRA 2QMWA 4R25A 4LFBJ 4OJ3A 4P74A 3LGNA 1RAAB 4RLEA 3DXSX 5KG3A 4ELUA 4C97A 4TY8A 2OPSB 5HMZA 4A8OA 2CNKB 3GFHA 1GAOA 3FGVA 4KGXB 3HF5A 5LSLA 3UQSA 4LF8J 4OV1A 4OZ1A 1RWOB 1T05A 3KKFA 3IWLA 1HMVA 3AY0A 5KFGA 4DV6J 3M2UB 4LF7F 1EETA 2G4BA 1RTJA 1U1MA 3GR0A 3R97A 1ZZFA 3V6JA 3MCMA 1U1KA 2YWKA 1JLCA 4OLOA 1HNWF 3OTCA 4IFVA 2VFUA 3SI8A 1Q7YT 2KDOA 4MAKA 2MZ1A 1FHTA 4ZLPA 3OXFA 2J9DE 3UCUP 2HIQA 1KVJA 3GV7B 1N6QA 2X3GA 3GFZA 4ZJQA 2CQ4A 3AA8A 1YDLA 5HSPA 5A2QY 2YPYA 1LV5A 3PW7A 3SFGA 3HX9A 3TAPA 1DTTB 4ZVTB 3VGSA 1FRHA 4YFUA 3KLHB 1DARA 4I6YA 3G2XA 4EK2A 3W5YA 2CQHA 1KP6A 4TU9A 1A0OB 1WF2A 3MMBB 3QMQA 2QG9B 3FBBA 4ZDNA 4NEYA 5DQHA 3R5CA 1S10A 1K44A 4K4TA 1M5KC 2Q66A 1HNVA 4J9NA 3Q23A 4MYTA 2IFXA 1FFGB 2AZ1A 2HHWA 1I51B 2D7SA 3NWGA 1G3OA 5J2NB 1VIXA 4B3OB 2QA1A 1NPKA 4J9SA 4IYQA 1R6VA 3M8PB 2AX1A 1X5SA 4DL6A 1FFSB 1WC1A 2HW3A 2BE2A 3W2VA 5F0UA 3AB2B 3BSNA 4IR9A 4RBTA 3I32A 2CVEA 1XERA 1S0MA 3UWTA 1UMJA 2EFGA 4OI0A 2AJ1A 3OTEA 4UUWA 3JAMY 4ZIVA 4OX9F 4QU7A 4DS5A 4UOCA 2MQNA 4LMZA 2JH3A 2XYHB 5E2QA 1VR6A 3VAKA 1CBKA 4LF5J 1UEUA 2ZH6A 5B0BA 4PG4A 3D6TB 3HHLC 3Q0AA 3ZNJ1 1IR2A 1SV5A 3MMAA 3CDUA 1Z4UA 1XQIA 2NXUA 4G1QB 1HHQA 2AEFA 1X5TA 1RAFB 5EHHA 5K9FA 5D78A 5CYQA 2YXLA 2EW9A 1RYRA 1Y9OA 4NRTA 3M9NB 2ASLA 1K1SA 2H1YA 1YBTA 1AW0A 1CJUB 2XEXA 2IBOA 3TZYA 3F44A 3K58A 3LAMA 2XS5A 3CJTA 1VFJA 2W2OP 2HHPA 3HZGA 3KK3A 3QLHA 1T0TV 3M8QA 3UI3A 1W2IA 4OYBA 1JJHA 5LXYA 1UVJA 3KYLA 1OPIA 2D3O1 1K1QA 3M1VA 4QIGA 9ATCB 4XO0A 5KFIA 2W4CA 5BXIA 2EFOA 1IWAA 3K2YA 1Q8KA 4NYPA 4QU6A 3DYAB 2I5JA 4R0EA 4U9RA 1KVIA 2M0GB 4ECQA 2E5LF 2DO0A 4C11B 2ACYA 4IKAA 3RGIA 2LQ5A 3Q2TC 1RTHA 2GIFA 1BQXA 2QL7B 4NLQA 4CNYA 2MXYA 2ASDA 4LRFA 4WP8A 1TL3A 5LMNJ 2IC3A 1QDUB 3HFZB 3PYFA 4L3KA 3HM9A 2LKZA 3D1QA 5E3AA 3QYYA 4LRAA 3NGSA 2HGNA 4LF6J 3P5BP 3M32B 1Q16B 3UVJA 2HZVA 1NSPA 3MAQA 2VQEJ 1C0TA 1C4AA 3T1YF 2E1MC 4ECRA 1WTFA 3KDNA 1D09B 2YQ1A 3P6YC 1MN9A 5HLFA 2LDYA 3I31A 3MECA 3EYZA 2FLOA 3LAKA 1XN9A 5KFVA 4NLVA 5D6GA 1YJWS 4DXLA 3GMGA 3RB0A 1RZMA 3QT6A 2HLUA 3C19A 4GC7A 2LDIA 2W9CA 4YR0A 3CSKA 4Y2KA 5DM7Q 2DNPA 1TKTB 1WC6A 2ZUAA 2DNQA 1LWEB 4R0JA 2AEJA 3CJ5A 5L39A 2DNNA 3EUNA 4UOHA 2AJFE 5I4MA 1RSCA 4PCQA 4MK9A 4QW8A 2JSXA 2QEXS 4CZCA 1T3OA 2HFOA 1WEZA 4OJGA 2EFNA 1FRKA 5M2PA 4CYUB 2HRYA 1RBOB 3PW2A 1IR0A 4ED6A 1KONA 5IWAF 2L41A 1V5IB 2HFUA 3OHBA 2VICA 2LXFA 4NI2A 1BD6A 4J9PA 2JVRA 5KT5A 3NG8A 3G82B 1GQEA 3T6BA 2K3KA 2L9NA 2AGPA 2ACMA 5HROA 4DN0A 4JYAJ 3FBEA 4LR8A 2J8SA 2A18A 3OXGA 1UAWA 1U2FA 2XZWA 1S7IA 2M88A 3CCJS 1FNMA 3RW6A 1YJ9S 5LSRA 3O3LA 2WONB 2F4VF 1LFPA 1LWFA 2HQ3A 2J8AA 2E5JA 1HQUB 1Q79A 4A47A 2BEFA 1RT2A 2CPXA 4OI2A 1N56A 4RNNA 1S49A 2J5AA 1WEYA 1Q8IA 3D0GE 4KH0B 3DRRA 4WIQA 1EB0A 4PZVA 5C24B 4CI0B 3HCXA 3IG1A 1FJGF 1RBLA 2D9OA 1JXVA 4LQ3A 2FB0A 3K8WA 4E2FB 4I2QA 4PWUA 4QPTA 4NLXA 1FDNA 4IG3B 2JLFA 3N6LA 3BGRA 2Z0GA 2VU5A 3DOLA 1S1UA 5GMKa 4FF4A 4ZITA 4I67A 2DR7A 3I6PA 3W5XA 3ZTOA 3LP2B 1J2VA 2UVVA 5C42B 4ZP8A 1X4HA 3PKYA 3HK2A 1FE4A 2DH7A 3FBCA 4I68A 4KSEB 1S9EB 4QOTA 2XCPA 4M5HA 5CYJA 2XLJA 1L3TA 1IBKJ 2R7UA 5U47A 4WK1A 3Q24A 2LP4A 3R8YA 1B7YB 4DPUA 5L1JA 3W9JA 1X9WA 1NH8A 2HWTA 4YHHF 3ILLA 1NK5A 2V8HA 3C3LA 4AD6A 3PACA 3A8IA 2BACA 1GX6A 2C2MB 2EBGA 3NAHA 4P2SA 2G0CA 2VPYB 5KG7A 2MQLA 4FZVA 1QJHA 2VUGA 4HTJA 4GVLA 1WKLA 1RKIA 5HP1A 3T1AA 1NO8A 4K0KJ 4CLPA 2HVIA 1HA1A 3DI6B 2PO4A 4PUOB 5KT4A 3K5OA 1TK5A 2KFNA 3BKFA 2KT3A 1T02A 1ITPA 4EGLA 4NXMJ 2KVIA 3MHYA 3O1LA 3V4MA 2D74B 2QFJA 4OI1A 2L48A 3KOAA 2ZM6F 2R4FA 4DQRA 3HSDA 1Z2ZA 4K4UA 2B4UA 1J5EF 4NLGA 1RTDA 3H5XA 2MY7A 3NS6A 3QT7A 3AJ1A 3GG0A 3DFEA 5DDOC 4KGVB 2BXJA 2WW4A 3W63A 2W9BA 3GLJA 1HQ2A 4IG0A 3FCVA 1M0SA 2LQJA 4J9MA 5F0WA 3QJLA 4QWBA 1KFDA 2WVEA 3KNAA 2EI5A 1S4FA 2AKWB 3M30B 3ELHA 3SSSA 2FY1A 3KUHA 1WI8A 2GO8A 2JX2A 4CLZA 3TRGA 2QYGA 2R7SA 3RBDA 4ILLA 3M7VA 2V0NA 4OX6A 4DG1A 4CLLA 2V63A 5ETKA 5E0OA 3S01A 5T7LA 4DX7A 1HBOB 1WOPA 3TX0A 2BJ9A 2BRKA 2A2CA 4KV8B 2WOMA 3U27A 1NB7A 3VGVA 3TJAA 3ILOA 3GYNA 3BZQA 3V6DA 2YKMA 1S1VA 2DHHA 1GXUA 3PG9A 1HWIA 1YRXA 4IRDA 3GCXP 4I64A 1NB2A 3UPFA 5KFTA 2CPJA 2N3OA 2LXIA 3TZWA 2Q1LA 1DAXA 3KJFB 1KQKA 1S79A 2AD9A 4DUZF 3GIJA 4NL5A 4E0DA 2ZJPQ 4LFCJ 4AL5A 2PIIA 4X4TA 2IMWP 3UDCA 3NS7B 3SMZA 2GW8A 2M8HA 3IBCB 1PGZA 1D3WA 1R43A 3E01A 3DOMB 2V94A 1TKXA 3GIIA 2U1AA 4DL3A 1KR4A 3EGWB 2JFKA 3LH2S 4WYWA 3KLEA 1SB6A 2BA9A 2PE8A 4EO6A 2ADBA 2NLWA 1RXOB 3KHRA 2NQPA 3MFHA 2HHXA 3WBZA 1RWUA 3UDEA 4B3RF 2B43A 4ZKAA 2DH9A 2CPDA 1LXJA 3POTB 1NKBA 3MM7B 5ITHA 2WSCC 3O6QA 4P7TA 1WG4A 2FVRA 2P9EA 3WQPA 4LIWA 3CD7A 4MK8A 4IRCA 2YKAA 2CQDA 1OWXA 3MGJA 2WAQD 2KYZA 3PEHA 2K1RB 1FKPA 1X4DA 1ZPWX 3OBIA 2PD1A 3WC2A 3OVBA 2CQGA 2B4OA 3EICA 4IOCQ 1WHXA 2KXNB 4AQYJ 4X65F 5RUBA 3SQGA 4WZMA 4FBTA 4J7CA 3THPA 4DV0J 2EPIA 5H9EK 5HANA 4NZ0A 1ZH5A 4TYAA 2ZJQQ 1WHWA 1U1PA 2VOPA 1M1GA 3UNGC 4PKDB 2R8GA 3JSBA 4LR7A 4IDKA 4LREA 1JJ2R 2EC0A 4RW6B 1BMQB 4RW8A 1WDDA 8RUCA 1P1LA 2V8DA 3CCSS 4GO7X 2E7VA 2Q79A 4LVNP 3F0NA 3TANA 2G9OA 2KM8C 2GC8A 3I96A 1IM6A 3BR9A 3EWGA 4DX6A 5KG2A 3KK1A 2LQ8A 3D2WA 2GJFA 2AEMA 3M9OB 1S0OA 3IR7B 1RAIB 2UXBJ 3ZZUA 4DPWA 3C6UB 2RMLA 1X5PA 3OFEA 2VA2A 2HRUA 2ABYA 4QR2A 1F5BA 1WELA 2HNDB 2ZBRA 5GAEU 1TK0A 4TU8A 4NZ6A 2RU9A 3FJ2A 1DHMA 2BQRA 2ZE2A 1N0UA 3B82A 3MEEB 4I7FA 5KFRA 2VDIA 3FCWA 5HMXA 4PPZA 2G2OA 2YQ0A 3KLFA 3BO2A 2YNHB 2EFQA 4QWAA 2W8LA 1YITS 3U1LA 1NK6A 2GIQA 2CPYA 5GADU 3OTOJ 1U6BA 2GFFA 1BGXT 3CCLS 3RB6A 1NU4A 1YZ6A 5EWGA 5I42A 2VJVA 4EZ6A 4D3HA 1DTQB 1RT6B 1X4CA 3R27A 4FVMA 5DLGA 4C0OC 3DRSB 5H9FK 4LF9J 1Y5NB 4TVAB 2AIRB 5BYSA 2PA8D 1KLMA 3L4BC 1FK9B 1MG7A 1OY8A 5FLXU 2DY9A 3BPDA 2RAQA 3KWMA 2AJ2A 5I3QA 2CPFA 4U7UK 3I82A 5D0EA 4C3MA 3TA0A 4ZVPB 3MD1A 4MMOA 1U45A 1XNRF 4C8MA 2PN6A 1N4LA 3HFVA 2JEFA 4BWMA 3VALA 1V3SA 2XG8A 1UVLA 3D5MA 2QSFA 1M5SA 4MKYA 4UTGA 2FY8A 3VZHA 1SVDA 5FDLB 4LFAF 4ZVQB 3L09A 4ALZA 4U67Q 5L1IA 1FNXH 2ZWOA 1REVB 2J7WA 1D1UA 4DUYJ 3VAFA 1K73T 1HD1A 3ITHB 4NLUA 5CZXA 3EZUA 1DTTA 4GO5X 3ZFVA 1NJZA 4KHPJ 4LJMA 3AHPA 3LWLA 1WC0A 1HPZA 4ZCMA 3NBPB 1F5CA 2HHSA 4P75A 3RZAA 1J27A 5L9NA 2NS1B 1M1KT 4NCGA 4UQTA 4HDHA 4TLQA 4F02A 1W26A 4NEZA 4QIWD 2MDAA 2DGUA 2DHXA 2L3MA 1S0VA 3JTOA 2I38A 4QW9A 2NZ4A 2JZ5A 2MKYA 4OX8A 4KR0B 1AA1B 4RW4B 3EDRB 3MEDA 1PAUB 4UY8T 3SCLE 2BR0A 2IPOB 2HKEA 3H2VE 4ZVUB 3FMBA 4B3OA 1NHVA 3IGNA 1U1RA 3EGVA 3M8PA 1WOSA 2VG7B 2EC2A 4ZPCA 1UFLA 3FVYA 2VL1A 4KHMA 3LWMA 2V34A 3IA0A 4OYAA 2C42A 2K7JA 3D67A 1UFWA 4ECTA 3IM9A 4F25A 4HT5A 5KFAA 3JSRA 1Q8BA 3PX6A 4LBHA 4UT4A 4ZLNA 2O01C 4HVZA 5THWA 4HI1A 4LF5F 4UY85 4USMA 2A3JA 3BKUA 4DDFA 3SQOP 3ZTSA 3MR7A 3ENWA 1R8PA 4FXDA 3FK4A 3W60A 1T7PA 3OVAA 1EQMA 3OR2B 5FLXY 4EUVA 1VQ9S 2RRNA 4HACA 3P49B 4FNHA 2IDEA 3O44A 2JLEA 1XMBA 2MQPA 5AJ3F 3MOJB 5AXKA 4G1QA 3OFFA 2BE7D 1M90T 1GMVA 1LW2B 3OFGA 2UVWA 3VAMA 4OYMA 1VQ8S 5CXTA 1U02A 4NLYA 2XMVA 1HWLA 2H48B 3MPVA 2JFDA 3NCRA 2FJVA 1T9WA 3OVSA 1FTCA 4X64F 2KN4A 1SQGA 2BW2A 4A8FA 1HBMB 4LF4J 3R3TA 3RBXA 1LK7A 2XO6A 2CNOB 1LXNA 1MLAA 5AE2A 5E3CA 2AYBA 2DGTA 2ALZA 1VLYA 3HHLB 4L75A 2D3OR 4ZPDA 2ZH8A 2LU1A 4M5DA 1NK0A 1N88A 4DOZA 3LP0B 4C11A 1S1WA 3HT3A 3SCJE 4YN3B 3DGPA 1IBLF 1SC3B 4B9VA 2WB4A 2ASJA 1IKXA 1M1HA 2DGXA 2IBKA 4DSFA 5GMDA 3H25A 3GWCA 4KRWA 4LF6F 5HBMA 1MROA 1S7HA 2DVIA 4PQUB 2F9DA 1SPBP 4FN5A 4YR2A 5KFMA 3M32A 2GGPB 4OIXA 1RKJA 2KZMA 1HR0J 1B0PA 3W7BA 4RWWA 1RTIA 2GMJA 2ZOMA 4DL7A 1UETA 1Y10A 5T14A 4DR2F 3OSPA 5BJRA 1ZS6A 3GILA 2ERRA 1X5OA 4KYZA 3PDNA 1YJTA 2BJDA 3GSDA 1WOOA 3IAS9 5BR8J 4CM0A 5IV4A 1Q86T 4NE9C 2H54B 2AHOB 1HI1A 5EWFA 2ZDPA 2NUHA 2AU0A 2RIJA 2ADCA 4N41A 3KG0A 3MM8A 4X4PA 2HNZB 1TKTA 3CCWA 3CNQP 1LWEA 4NLRA 1ULRA 3M6XA 1S72S 2PEBA 1U0HA 1N5QA 2X1BA 1LKZA 2MKJA 2OAUA 2RQCA 5A8KA 1VHIA 5KFWA 4OZ3A 1D0EA 1FRMA 1YWXA 3GP9A 3OTBA 2YNIA 3FSYA 2HVDA 5JVHQ 4HHHA 1WG1A 1FXLA 4ED0A 4ER8A 3CDBA 4F3QA 4XK8C 4YP3A 1IR1A 3QGPA 3X3UA 3LF0A 2LFVA 3FSIA 2DK2A 1LEOA 1TQLA 2R7TA 1R0BG 2KZZA 4ANCA 2FD2A 2OELA 1UWAA 2KVQE 5KFJA 1BHNA 3EDQB 4I4BA 3G82A 1CEZA 3BBBA 5LM7E 4EYIB 3M8ZA 4HHJA 4J9OA 2QLWA 2IDLA 3I5AA 4OYZA 2BJ8A 1QAJA 2MJNA 3MZIA 1UFKA 2F63A 3GZ7A 5F41A 2BRLA 4G65A 2J6TA 4A8XA 1Z2LA 2J0XA 2R2TA 5KFEA 4WK3A 3LP1B 4ZPBA 3A8EA 1EKSA 4PPDA 1PYOB 1FXDA 2EXUA 4I1TA 2DXDA 2FJWA 1NK4A 1Q7LB 4DR7J 5C7PA 2AYEA 4P6QA 5J2QB 5DGBA 4FKYA 2FQQB 3VVTA 1F5AA 4K2XA 4LVOP 1SJRA 3P8BB 3CULA 2D3ZA 5J2MA 3B6BA 3EJMA 1FDDA 3M2VA 4LSNB 2X1FA 3KHLA 4ZS6A 1UVMA 1K0TA 3IN5A 2R8KA 1PIEA 4F2SA 1PC5A 3IWNC 2NUUG 2JNJA 4JI7J 4UUXA 4OFZA 2UUWA 5K20B 3V2UC 3RJMB 4IO9Q 1D8ZA 1FVQA 5GAGU 2HGLA 3H5SA 2B6AB 5D4OA 1UZDA 4F67A 2J0QD 2RQMA 1Q5VA 1LW0B 3DXBA 3LP2A 2DIUA 4DHVA 2RS2A 2D9PA 2M4MA 3H2UB 5C42A 1FA0A 2A10A 4JI3F 2Q3PA 2OD6A 4YY3J 1YLXA 4CLFA 1IBKF 2UVRA 3ENAA 1P6TA 3HXMA 1TZ0A 2RB7A 3ZZYA 4QYZK 4P10A 4CLUA 2MPUA 4ICLA 2RKIB 3FKBA 1HBUB 1XWLA 1S6OA 5L1KA 1BQMB 2HQCA 4ILRA 4USTA 1H98A 3DLKB 5E3QA 3TUPA 3ZZZA 2VBXA 1RP5A 4NXNJ 1VRUB 4URGA 2APOA 1VQNS 3UO0A 3EPGA 2BANB 4Y2CA 4A8WA 2V2KA 5IS2A 2KH9A 2ZC4A 1TV6B 3MTKA 3W5ZA 3NGKA 2ZHAA 2BBEA 1E6YB 3IMQJ 4MYUA 2V2ZA 2R8IA 4O4GB 4Z7CA 4U7UD 3NMAA 4NXMF 3UE2A 4LT6A 4KO0B 1IBMJ 1QE1B 5HI7A 3MD3A 1QAIA 1MMDA 2HS3A 2LA4A 3CCRS 2QL9B 3Q8VA 4RO0A 5A8RB 4X4NA 2MB0B 1DQAA 1CULB 4KC5A 4AFFA 1XTZA 3CEDA 1VQOS 3QRQA 2KKHA 4OYIA 2PA3A 4RR5A 5DRKA 1SKSA 3CJKB 1V6HA 3BJYA 4S0MA 2B8PA 2P2CB 4UW2A 3D3BJ 1N34F 2IJRA 2AWZA 2FIUA 3PFEA 1VK3A 1XMOJ 4TQRA 1EHWA 3M30A 5HVFA 4IFYB 1LNQA 4ZVEA 1SCJB 5LJ3Y 2YKQA 5F8NA 3P45B 5EN1A 1P8GA 1HKAA 4KGZB 4ELTA 3R1HA 4CLKA 3QRRA 2P9CA 2PGCA 3MDFA 1KN6A 2AT1B 2O1PA 2FJXA 3M8WA 3CO9A 4KV8A 4ZVHA 3UCZP 1IQZA 3SDEB 3OLBA 4UZCA 4B9TA 5L46A 3MAAA 1U7LA 3PJ9A 1EP4B 4MIWA 5LL6d 1HNIA 2P6TA 3KHHA 3NCPA 2XZDB 3ADAC 2VG5A 2J9DA 3R5DA 2C1EB 5J1NA 3MWBA 3J7Z5 5K14A 1Y11A 3PW4A 3OTDA 3HHKA 3V4IB 2R7OA 1KKHA 1ZA2B 5BYQA 5IM0A 3MEGA 1K47A 1GNKA 4MFBB 1UJ4A 2G13A 2E5GA 3ETMA 3BQ1A 1DLOB 2WVBA 1C1CB 4USJC 4OJ1A 5CCMA 4IUFA 3NGUA 3VR1A 2PI5A 3E51A 3FEYB 2CWKA 2IRXA 3DOMA 1O6XA 4WXWA 4NMLA 4K4VA 4Y6IA 1ZA1B 1Y00A 2HK2A 2CA9A 4OHXA 4RUCA 3CC2S 3HVRA 2EVZA 3EVMA 2QRRA 4IOBA 3CWJA 3MUMP 4XPEA 2O3DA 5MLCV 2CXEA 3A3OB 4ZCIA 2BX6A 4ZP6A 3QAUA 2CVIA 2QC3A 3JS9A 4NA3A 2ZDOA 3POTA 3JTNA 1HNXJ 2UUBF 1U24A 5ETSA 1RCOB 1S6QA 4WFNQ 4DV3J 1CG2A 3KJVB 1VC0A 2E9TA 2ZNYA 4FYXB 1Q81T 1CS4A 4A8QA 1SJ3P 3MMCB 1JB0C 4CLYA 2Q6CA 5AE1A 4KT0C 1VS3A 3DLHA 2A2DA 3RUBL 2DO4A 2GVDB 4JI8J 2G2ZA 2MZQA 3K5PA 3VHQA 2NZCA 3BGOP 4O3NA 2YNFB 2MSTA 2Y0BB 1JNRB 3DDNA 3G86A 1RACB 4USVA 3U1MA 4X66F 2V8VA 3UN2A 3G9CA 2E1CA 2JEJA 2V4QA 1OYEA 1JIHA 5A0YA 4ATNA 3CCMS 1YZ7A 5HO4A 1RAJA 1UA0A 1QTMA 1U0SA 4RW6A 3ZTRA 1KWMA 3BQ2A 3GPAA 1SBRA 3OUYB 1XBWA 1IKVB 2HGMA 3AXMA 5C2CA 5DG8A 3CDWA 1TKDA 2M2BA 4YDDB 5HL7Q 2VASA 4ZIWA 2GVZA 5HQMA 2GCFA 4C8YA 2UXDF 2XI2A 5H9EJ 1AZSB 1N33J 2WVFA 2UXBF 3D6HB 2E9RX 1X9SA 1NLKL 1NAQA 4NLDA 5D3GB 1SUQA 1WACA 3TQEA 1CQMA 1IVZA 2HNYA 1JNZB 1JK9B 4B3SF 2FVQA 1SJQA 5T41A 2CJKA 4USWA 2G1HA 4HTIA 2ZZNA 1S59A 2MZSA 5ADZA 4ID5B 1TFYA 3DM2A 2GA7A
chains in the Genus database with same CATH topology
3QRQA 2Y9HA 4U7UD 3QRPA 2Y8YA 4DZDA 1WJ9A 5H9EK 2Y8WA 5CD4A 4QYZK 3QRRA 5H9FK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRQ A;  2Y9H A;  4U7U D;  3QRP A;  2Y8Y A;  4DZD A;  1WJ9 A;  5H9E K;  2Y8W A;  5CD4 A;  4QYZ K;  3QRR A;  5H9F K; 
#chains in the Genus database with same CATH topology
 2CYY A;  4CO5 A;  2HND A;  6FD1 A;  4P72 A;  2KYX A;  3MEE A;  2JRS A;  3M2R B;  2VPZ B;  2MHN A;  4PQA A;  3HSZ A;  2BYC A;  1PBU A;  4DSE A;  4E8U A;  3OTO F;  5B0C A;  3DC2 A;  3QO9 B;  2DYA A;  1F2G A;  4DZD A;  1KD1 T;  4MH8 A;  3N9U C;  4PXD A;  1Q95 G;  3KMS A;  4U6P A;  1RHK B;  3PO4 A;  2Y8Y A;  4J9U E;  4DPO A;  2AYM A;  3VGU A;  3JYT B;  3KDO A;  2MYF A;  4LSL B;  4JI0 F;  3UNY A;  1DTQ A;  1RT6 A;  1CJK A;  2CQ3 A;  3A3N B;  2J6S A;  4USK A;  4ZVS B;  4H4M B;  5ETO A;  4WE1 B;  5AE3 A;  4U7C A;  1YJN S;  1TUV A;  1UJ5 A;  3A3P B;  1SL1 A;  4C8L A;  4DQP A;  4M5L A;  5IOL A;  3G8Q A;  1O8B A;  3BV8 A;  5KFP A;  5E5N A;  2XMU A;  4LR9 A;  4EMD A;  3KLG B;  3OLA A;  4CCH A;  2ZH7 A;  4P2F A;  3OL9 A;  2XMA A;  2CQ2 A;  4ECX A;  1RWW B;  4C3L A;  5H9F J;  1IKY B;  4O3S A;  3R9L A;  3P5T L;  2AQ4 A;  3QT8 A;  1FXR A;  1DQ8 A;  4ZJL A;  3B78 A;  2VQF J;  1L3K A;  3ET6 B;  3KJQ B;  3UDV A;  4JBC A;  2K06 A;  1OY9 A;  3RBZ A;  2LMI A;  4JI5 J;  1T9T A;  3EPI A;  2AW0 A;  3ZZP A;  2VPX B;  3W8P A;  1GFW B;  2QIF A;  3FSX A;  4ZP9 A;  1X4B A;  3AB4 B;  3IBW A;  3SEO A;  1U4B A;  1EJ7 L;  2V8P A;  2G2Y A;  2HS0 A;  2Y8W A;  5KFH A;  1ZTW A;  4LBP A;  2CFX A;  2UP1 A;  3NGD A;  3M6V A;  4KQZ A;  1X9M A;  4ZMM A;  2UU9 F;  2DEJ A;  2KHD A;  3VQT A;  2ZNZ A;  1VI7 A;  4KAI A;  4F3M A;  4QIV A;  2KXH A;  3RR7 A;  1C1B B;  2IRU A;  2VON A;  2G1D A;  3ILI A;  2U2F A;  3GQC A;  5EX3 A;  4WF9 Q;  1E6V B;  4F36 A;  3UR0 A;  4RW4 A;  1WF0 A;  4DV2 J;  4CWB A;  1SIZ A;  3PYE A;  3QWP A;  3ISZ A;  3AOD A;  1U2R A;  3SIP B;  5B7W A;  2OD4 A;  4PRF A;  5KFL A;  4ZVF A;  4AYB D;  1NKE A;  4GC6 A;  2XQC A;  3C15 B;  2OEM A;  4PYD A;  4L72 B;  3AD9 C;  1DQ9 A;  3QIP A;  5CHC B;  2CDQ A;  5A2Q U;  5LMU J;  3A12 A;  1LWX A;  4A8S A;  4CO2 A;  4ZCL A;  4ZHR B;  4USH A;  4EI2 A;  2HWI A;  4ED1 A;  3HHN B;  1TVR B;  1WF1 A;  4KFB A;  4OHW A;  2XMW A;  4DR3 F;  5ETQ A;  4J9Q A;  2R9L A;  1UWB A;  1SJ1 A;  4C0H A;  4BC9 A;  2ZBC A;  3DN9 A;  4RUB A;  3B54 A;  1VBY A;  2W2N P;  2HPU A;  4F4X A;  3DOK A;  4DV4 J;  3ISN D;  2BKP A;  1T05 B;  3G6V A;  2W2Q P;  3IRX A;  2A6M A;  4FYD A;  1RA7 A;  2LEP A;  1EET B;  3RAQ A;  5GAH I;  1JLA B;  4URQ U;  2YNG B;  1RWN B;  1LW2 A;  4Y2I A;  1OMS A;  5DG9 A;  2DHG A;  3G96 A;  2RJZ A;  1JLC B;  4OQJ A;  3QQC D;  2VFR A;  4IFV B;  2NSC A;  1DFD A;  1RB0 A;  4QYR A;  5CAA A;  1FFW B;  2OTJ S;  3EVW A;  2QSW A;  1BWE A;  1JXE A;  3HO1 A;  1X60 A;  1S5Z A;  1N6Q B;  4B9N A;  4F4Z A;  2OML A;  2VPW B;  1K9M T;  3JAM U;  3BQ0 A;  3MM6 A;  4DQQ A;  3DGV A;  3FBF A;  4OL8 A;  1N5Y A;  4G6V B;  1FES A;  2OSR A;  2JEI A;  4MKV A;  5F3Z A;  1JJ4 A;  4DR5 F;  2ATL A;  1YSJ A;  3EZ5 A;  2AGO A;  1BQN A;  2IRY A;  3V5R A;  3LP0 A;  2POK A;  1JLG B;  4J9L A;  1N5S A;  1F1B B;  1VGY A;  3HHE A;  2M70 A;  2F7V A;  1R7I A;  1HI8 A;  1N32 F;  2XLI A;  3C66 A;  2BM0 A;  3G6E S;  2PMZ D;  2DIS A;  3M8Y A;  2BOP A;  2NCK L;  3GV5 B;  1IXK A;  4PQU A;  4FKX A;  5J2P A;  2PI4 A;  2BMB A;  2GGP A;  1U8W A;  4K8R A;  4DFK A;  4AND A;  1ZM2 A;  2BE2 B;  2LEA A;  3W2V B;  1U09 A;  1Q0N A;  3W2W A;  2DCL A;  2XZT B;  3TVY A;  1OSC A;  3N5F A;  3TJ8 A;  2UV8 G;  2QMX A;  2ZWP A;  5BR8 F;  2IVF B;  1FKO B;  3FQK A;  1ARO P;  5HQL A;  1VDH A;  4B02 A;  3HMJ G;  3P96 A;  1UPM B;  4FXW A;  1NDL A;  2VOO A;  1QUV A;  4JI2 F;  4JV1 A;  2QLJ B;  4PYA A;  2Y1J A;  4JI1 F;  3MCN A;  1S1X B;  1SL2 A;  1HBN A;  2V6A A;  1WI6 A;  3KLI A;  4PWD B;  4O0I A;  1SJ4 P;  1SV5 B;  4GVB B;  3CJ4 A;  4U8V A;  5DM6 Q;  3MMA B;  3CCZ A;  2DTJ A;  5IZH A;  2XB2 D;  1A6L A;  4B9S A;  3H20 A;  1JMT A;  4DEZ A;  5GVQ A;  4TN2 A;  3VV2 B;  1S9F A;  1YK9 A;  3JSM B;  4RJV A;  4C8Z A;  4N56 A;  2W7A A;  1Y3J A;  4M5N A;  3PO5 A;  4ETX A;  1RHR B;  3MCO A;  4ECY A;  5ETP A;  4IR1 A;  1GX5 A;  2R42 A;  5HK4 A;  4CLW A;  2DKO B;  1QTN B;  4WFX A;  1FWP A;  4Y0F A;  1FJ7 A;  1QY7 A;  5EGY A;  1T11 A;  2ZH5 A;  2W7P A;  3KK3 B;  3CJ3 A;  3QLH B;  4XDD A;  3M8Q B;  4ECU A;  1R0A A;  1FDA A;  4B9L A;  5D4L A;  4DX8 H;  4KJI A;  3MPD A;  3M1V B;  1IUJ A;  3GV8 B;  3NP5 A;  4NWB A;  2WRM A;  8ATC B;  3CDA A;  2R2U A;  3HT0 A;  1KDN A;  3K89 A;  2I5J B;  4KPY A;  1VQ6 S;  4DL2 A;  2ZJR Q;  4KGM A;  2F3J A;  5B0E A;  1RTH B;  5B0F A;  3MM5 A;  2E5L J;  4DR7 F;  3BSO A;  3NNA A;  3AD8 C;  4WFB Q;  3N0V A;  1TL3 B;  2VB6 A;  3VAH A;  4OHY A;  5J2Q A;  4RKU C;  4J91 A;  4QCL A;  3D9B A;  1HHT P;  1B7F A;  4V19 J;  4QJV A;  5M2R A;  2DB1 A;  4FNI A;  5L1L A;  3K8V A;  2YWG A;  2R7X A;  4YB6 A;  2FHM A;  2C2D A;  3R7N B;  4LSN A;  1SQF A;  3T1Y J;  2OP5 A;  5JVG Q;  4F4K A;  2GMH A;  4ES3 A;  3TP2 A;  1F3F A;  2EKN A;  3C2P A;  3UN3 A;  3TQ1 A;  1VQ7 S;  3R5G A;  4QWD A;  4MK7 A;  3I9V 9;  5C25 B;  5ETR A;  2CDR B;  2FC8 A;  4DU7 A;  4B3T J;  5AXN A;  2VIH A;  1YTY A;  3BH6 B;  4DZ6 A;  1NSK L;  2A0F B;  5KFU A;  4W4M A;  1LW0 A;  4F4Y A;  4M1K A;  1I94 F;  2IM1 A;  3S1T A;  1P27 B;  3VTI A;  4AXJ A;  3DRP A;  4PEO A;  4DSI A;  1B64 A;  1LOU A;  1UPP A;  5B0A A;  2VFS A;  3HUL A;  1HWJ A;  2DNM A;  2YH0 A;  2ZKU A;  2N7Y A;  3JQJ A;  1D8Y A;  1DRZ A;  1R8C A;  5L8R C;  3T5K A;  4KBI A;  3UD3 P;  1FDB A;  1XR6 A;  4DJB A;  1S1T B;  2RNE A;  4DL5 A;  1BQM A;  2GQ2 A;  3DLK A;  2DXE A;  5KFZ A;  2ZZM A;  1FTR A;  4CT9 A;  3LGH A;  2EFP A;  4Q2M A;  3J7A N;  4C8N A;  5HRO B;  2V69 A;  2CRL A;  3BB5 A;  4FYW B;  4WBF A;  1NKC A;  3DU6 A;  4DR4 J;  1SKW A;  2G0J A;  2ZVS A;  2D3U A;  4QYZ J;  3NY0 A;  1TR0 A;  3HKW A;  5KT2 A;  1UTA A;  1OY6 A;  1AB8 A;  3Q8Q B;  5KFX A;  2K2P A;  4CH0 S;  1PYS B;  2AZ3 A;  3THT A;  1HI0 P;  2W25 A;  1QE1 A;  2F4V J;  1NPP A;  3EE3 A;  2KFY A;  1RT4 B;  1SL0 A;  3J7Y U;  5KFC A;  5B09 A;  3H90 A;  3BDE A;  1CUL A;  3DRR B;  4Q44 A;  4EYH B;  2FGO A;  1Q78 A;  3IG1 B;  1YJU A;  3H98 A;  2CPE A;  4QR1 A;  1Y4Z B;  2XTJ P;  3BR8 A;  1FJG J;  5I3U A;  4DFJ A;  1XMO F;  3H4D A;  3Q22 A;  2ZC3 A;  4CH1 A;  3BGR B;  3CJ8 A;  2LLZ A;  4Q7A A;  4PAB A;  4EFA C;  3DOL B;  1TK8 A;  1URR A;  1S1U B;  4LRC A;  3GFX A;  3QAT A;  1RU1 A;  3TR5 A;  2UXC F;  2AV5 A;  2OO4 A;  3OJS A;  1K0V A;  3UD5 A;  1XNQ J;  3WIU A;  5FJ4 A;  2KFZ A;  2HBR B;  4WP9 A;  3SDE A;  3P4U B;  1HW9 A;  1EP4 A;  1VQS A;  2FHK A;  5HVH A;  2V67 A;  4HH0 A;  1WSV A;  4R5P A;  1RLC L;  3SFU A;  3LOU A;  3QZ7 A;  2OIH A;  2XSJ A;  1CJV A;  4ZK7 M;  3TZZ A;  2AJQ A;  2AJ4 A;  3M4X A;  2V5H G;  3E2E A;  4I56 A;  2NXE A;  3S6E A;  2L08 A;  2IYG A;  1C0U B;  1OIA A;  3EMT A;  2IYI A;  3QAE A;  2R2R A;  4MFB A;  4K4W A;  3L95 X;  4YS2 A;  3SSQ A;  3MM9 B;  4LRD A;  2B9E A;  1DLO A;  1NJW A;  3JXO A;  4FF1 A;  4FF3 A;  2YWF A;  1FEE A;  3DNC A;  4ZPV R;  1QAX A;  1CLF A;  2PDA A;  2ROG A;  5HP1 B;  4NLP A;  2CQI A;  3THV A;  4ZLJ A;  2KT2 A;  4F0H A;  3PR4 A;  2DNZ A;  3EXC X;  3CJS A;  3D3C J;  1Q4R A;  3D0I E;  3MFI A;  5IC6 B;  4X2B A;  2RUS A;  5BYR A;  1X4A A;  4CT8 A;  1VK8 A;  1IKW A;  1HNX F;  3MR2 A;  1H2V Z;  4K4X A;  4WTY A;  4BC7 A;  3VAI A;  1B0T A;  2BZ2 A;  1RTD B;  4RL1 A;  3NGR A;  3FFI B;  1J5E J;  2DBB A;  3VAJ A;  3KJV A;  2C2N A;  2BE9 B;  2DPI A;  2C3M A;  3NXZ A;  2YKN A;  2W9B B;  1DZ5 A;  2XYG B;  3TI0 A;  1R8B A;  4IG0 B;  4WKY A;  1FRI A;  2H5J B;  5KFN A;  1DUR A;  4JI8 F;  2HG4 A;  2V2V A;  4USI A;  2LEC A;  4B17 A;  2OH2 A;  3F73 A;  2DR8 A;  2GVD A;  2VH7 A;  2RF2 A;  4UZB A;  4HHU A;  2Z8Q A;  2Y0S D;  2I0X A;  2CQP A;  1RHJ B;  2V4J A;  1JLF B;  1FRX A;  5J1P A;  4YME A;  3VGT A;  2B5J B;  4ED4 A;  4CTA A;  3ENQ A;  1QSL A;  5KG6 A;  4RW7 A;  5I3P A;  4DG1 B;  3TO8 A;  3T5H A;  2NRE A;  5KOW A;  4HLB A;  3R6G B;  2AX0 A;  2KI2 A;  2EBE A;  2MEW A;  3IP0 A;  2VC0 A;  2C3U A;  2C2K B;  4PAA A;  5HVG A;  3KK2 B;  3L9Z A;  1QSY A;  1QLN A;  2Z2Y B;  4M5J A;  3H2L A;  3VVU A;  2M5Y A;  2OPQ B;  1JLB B;  3TUJ C;  2OGU A;  2HLT A;  4V1A k;  4DLE A;  5IC4 B;  1S1V B;  2BJ7 A;  3BO4 A;  3NMR A;  2J7K A;  5D3G A;  1TKZ B;  1I1G A;  4M5G A;  4FYV B;  2OSQ A;  4KY3 A;  1RE1 B;  1O51 A;  4C7Q A;  3EGZ A;  4ID5 A;  3W9H A;  4ECZ A;  4RX6 A;  1SH2 A;  4A48 A;  2YH1 A;  1SH3 A;  3NL0 A;  1WOR A;  3IS9 A;  4DUZ J;  5LOQ A;  2EFV A;  4M63 A;  1VQ5 S;  3E01 B;  2YQ3 A;  4HKQ A;  4OI3 A;  3LA0 A;  3M2R A;  2OPP B;  4UF4 A;  1TKX B;  1HYS B;  2PEH A;  3N28 A;  3QO9 A;  2HHH J;  2RHQ B;  3CD6 S;  3KLE B;  4PG5 A;  1N54 B;  1HQE B;  1U49 A;  5DO2 A;  4I69 A;  1BUX A;  2X51 A;  2HRT A;  4F3O A;  3JYT A;  4RW9 A;  3T9Z A;  2E1A A;  1X7V A;  4O4R A;  2L9D A;  2OI2 A;  4WE1 A;  2GIR A;  3OT9 A;  4L74 A;  3T5J A;  2N7C A;  5KFQ A;  2B51 A;  1R8A A;  2CZV C;  3MPW A;  4CO1 A;  5D0G A;  3AXK A;  5D4P A;  3BBF A;  3DMJ B;  1R89 A;  1UCN A;  4RNH A;  5DDP C;  1NJX A;  2YX4 A;  4EZ9 A;  4JP8 A;  4DV5 J;  4H4O A;  4ES1 A;  3R2D J;  2QYC A;  3SQG B;  3KLG A;  1SC1 B;  4WWS A;  1OJ4 A;  2MJU A;  4X65 J;  4TNO A;  3MOZ A;  4K4Y A;  2CWX A;  1H38 A;  1N8R T;  4N8O A;  1IKY A;  1ELO A;  4W90 B;  2HQG A;  1F2H A;  5D15 A;  3EGN A;  3G6Y A;  2EK6 A;  3TA1 A;  1KHW A;  5F9N A;  1U1O A;  1ZM9 A;  4RW8 B;  2DIV A;  2HZA A;  4JI5 F;  2E9Z A;  4H4K A;  2B9Y A;  5A6W A;  4I2P A;  4P9S A;  1WDT A;  1KNZ A;  4LRB A;  4DFP A;  2V4R A;  2HFZ A;  3CD0 A;  4DFM A;  3PJW A;  1FVS A;  4TQS A;  2JLG A;  3CPW R;  3L7O A;  2V50 A;  5DDR C;  4C2M A;  4DL4 A;  3OW2 R;  3PJX A;  4JV2 A;  2FJD B;  3I55 S;  1O5J A;  2BKO A;  2I8E A;  2FJE B;  3CF5 Q;  5SUH A;  1H72 C;  3R5B A;  3GIR A;  1Y5L B;  2QO3 A;  1IN0 A;  3J7A 1;  1NND A;  1RIS A;  4F4A A;  4NYZ A;  1BLU A;  1C1B A;  1ICE B;  4FYY B;  1KVK A;  2ZUG A;  4X84 A;  4DV2 F;  5AXM A;  3DLG A;  1H0H B;  5LJ5 Y;  4G3I A;  1HAR A;  2OHD A;  2LQB A;  1GXT A;  3KLF B;  5A8W A;  2MKC A;  4WKR A;  4FP9 A;  2UUA F;  4L6V 3;  3OL6 A;  4FPI A;  1CQN A;  3C15 A;  3CUN A;  3PXG a;  5LMU F;  1RYS A;  1VQK S;  1NK8 A;  3TA2 A;  1VC6 A;  2E5H A;  2E44 A;  2HUR A;  2HMI B;  4ZPA A;  3BSC A;  4B9M A;  2HAF A;  3WHI A;  1CJT A;  2LEB A;  4ZLL A;  4J9K A;  1R6Y A;  4OZ5 A;  3GSI A;  3I0S A;  1FD2 A;  1KLM B;  1TVR A;  3W64 A;  2AMC B;  5HAO A;  3PY8 A;  1WNE A;  4Q0B B;  5KG1 A;  4ECW A;  3Q86 A;  2LYV A;  1PG5 B;  5F8H A;  4DV4 F;  4P71 A;  3FUY A;  1YJ7 A;  2D41 A;  1F0X A;  4K4S A;  2XWY A;  1V9O A;  4NLW A;  3D1O A;  4IH7 A;  3UD4 P;  2FJA B;  1FWK A;  1RT3 B;  3WDO A;  4R8U B;  3M05 A;  1F60 B;  3A1Y G;  2OLW A;  1XNR J;  1JLA A;  2QLX A;  4C9D A;  1IM4 A;  4DR6 F;  1Y0H A;  2YNG A;  3GB0 A;  1CC7 A;  1MWY A;  4RBV A;  3O5T B;  3W9I A;  2GJ2 A;  4TLR A;  3BH7 B;  5CYM A;  3RG6 A;  4PG7 A;  1SKU B;  2C22 A;  1EIY B;  2LCW A;  1NCL A;  4C4W A;  1ZZN A;  1B70 B;  3GR1 A;  4FBU A;  4I6W A;  3J80 Y;  3UW1 A;  3C16 A;  5IT9 Y;  4PXE A;  4LFA J;  3V81 A;  2O5D A;  3M6W A;  3C6T B;  1YX2 A;  3HD1 A;  2JC0 A;  4KPC A;  4ZCK A;  1JXL A;  2D69 A;  1ZAW A;  4CO4 A;  3LO3 A;  2CPH A;  2DPJ A;  3ZTQ A;  1VQP S;  4LFB F;  1HPZ B;  2K8G A;  2WSE C;  3VCD A;  2X3D A;  4DPX A;  4DCP B;  3NOG A;  4NCG B;  1XR7 A;  4AUK A;  4LF2 A;  4OHV A;  2OPS A;  1JLG A;  2R7R A;  4CNZ A;  1GT8 A;  2QT7 A;  2FLL A;  1TL4 A;  3PM9 A;  4LF8 F;  2J9E A;  3AOB A;  1YJR A;  5IFM A;  3MED B;  3CCV S;  4DV6 F;  3FCH A;  3MUR P;  2V9W A;  4C48 A;  3QPI A;  1S6P B;  1TUW A;  2AJ0 A;  2DT9 A;  2C3O A;  3PHT A;  1VIO A;  3K7R A;  3M2U A;  4RU9 A;  1AUS L;  5F9L A;  2VKR A;  4HI2 A;  1RGV A;  3EX7 B;  2IA6 A;  2RT3 A;  2IHR 1;  1TL7 B;  3T3F A;  4WYL A;  4JUZ A;  4KB7 A;  4BLG A;  5DS7 A;  1TMM A;  5JUM A;  4A8M P;  2F40 A;  4ED5 A;  3OPK A;  2NXC A;  4P52 A;  3FRZ A;  1FKO A;  2QFI A;  1XMQ J;  4NLT A;  1R3N A;  3H0P A;  1S1X A;  4V19 X;  2DR6 A;  3BYR A;  4PWD A;  4CLT A;  4GVB A;  3KJN B;  3IM8 A;  4HAC B;  3KLH A;  4ZP7 A;  2MSS A;  2QJ3 A;  2BJ1 A;  1ROF A;  4P7V A;  3CGI A;  4ZJO A;  3QJJ A;  1VQM S;  1CPZ A;  3FMW A;  5AJ3 J;  3O2I A;  3JSM A;  3MMB A;  2LA6 A;  3SCI E;  5B0D A;  1LWC B;  3KXD A;  2MY8 A;  4F8R A;  1H74 A;  1KOO A;  1UEK A;  4NMX A;  1KOH A;  2KL8 A;  3PHE A;  2MKH A;  4WPA A;  3PW0 A;  5HN0 A;  3BN7 A;  3ISN C;  4NLS A;  3CTR A;  3MUV P;  5J2N A;  4K50 A;  4E98 A;  4Y34 A;  4X64 J;  1IBC B;  2UUC J;  5KFK A;  2YPZ A;  4I0W A;  2RS8 A;  2C2E A;  2XNR A;  3OSN A;  2L9W A;  2HWH A;  3IRW P;  2V2Q A;  5JMN A;  2DNG A;  5LXR A;  1UA1 A;  2YX1 A;  1YRT A;  4M5D B;  4ZN1 A;  2W9A A;  4LUB A;  4OMF G;  3LAL A;  1S1W B;  1U6F A;  3DGP B;  4L3N A;  4USU A;  1IWG A;  1IKX B;  4UOG A;  1NK9 A;  3AQO A;  1IBL J;  4OYX A;  1B4S A;  2WZ1 A;  3CVK A;  5HBM B;  3QBC A;  5F8G A;  4HR2 A;  1MRO B;  3BBC A;  3WIV A;  3RTV A;  1FE0 A;  3L3C A;  4YDX A;  1G1X A;  5DGA A;  4LIR A;  4NX9 A;  4OZJ A;  2GQC A;  3G4S S;  3N79 A;  4P2M A;  3ZZR A;  2HHV A;  2BM1 A;  3TUI C;  2C3P A;  2OJ3 A;  1RDR A;  4OV6 A;  5LSO A;  1RTI B;  4FXV A;  1X0F A;  1F3V A;  1SXL A;  5KT7 A;  3PTW A;  1TEL A;  5KG4 A;  3QFW A;  1CJU A;  4Z37 A;  4DF8 A;  2J76 E;  1YJV A;  4DR2 J;  1ZET A;  2VJU A;  2FTR A;  1WHV A;  1Q5Y A;  1U26 A;  4WFA Q;  2ZVI A;  4O3P A;  1L3U A;  1HNZ J;  4B3T F;  1RK8 A;  1VQY A;  1CVJ A;  5C25 A;  1NRK A;  2RE1 A;  3BO3 A;  3AJ2 A;  3KMQ A;  4Y28 C;  1QSS A;  3NKY A;  2H9Z A;  3MTJ A;  4WJB A;  3MM8 B;  2YBV A;  3Q8P B;  3PX4 A;  1U2C A;  3IC1 A;  2CG4 A;  3N01 A;  1D9F A;  4WU3 A;  1U0H B;  2NXJ A;  2FDN A;  3DYA A;  1MMN A;  2C2O B;  1URN A;  3R5A A;  5A8K B;  2F8H A;  4H54 A;  3CD5 A;  3ONQ A;  3M8S A;  3TOQ A;  2LXU A;  1OQ3 A;  2YNI B;  2A1B A;  4Y2A A;  1NDP A;  5GME A;  1W25 A;  3NNH A;  5LMN F;  4C8K A;  1FWL A;  2FVS A;  1S1T A;  3SV3 A;  1N5V A;  1PIL A;  3FNN A;  2VQE F;  4JI6 J;  3KNG A;  1WC5 A;  4AL7 A;  4RUH A;  3D68 A;  2VV5 A;  3B8H A;  3Q8Y A;  4ERD A;  2GHP A;  4DR4 F;  3R7S B;  3PRB A;  3Q2S C;  4QBU A;  2MKI A;  4JV5 J;  1Q1K A;  1EAY C;  4WTO B;  2CAJ A;  4FDF A;  1UVK A;  1UVI A;  2BAB A;  3SZ2 A;  4CRJ A;  4J9V A;  1RT5 B;  1MML A;  4RUA A;  2YKO A;  4W92 B;  2DXF A;  4J37 A;  2Y1I A;  3MCS A;  4DL0 C;  1RT4 A;  3T9N A;  2YWH A;  1KFS A;  2AF6 A;  2ZIT A;  1WG5 A;  2RUG A;  4WFY A;  4O23 A;  4Y00 A;  2OFG X;  1VRQ C;  4MTP A;  1WUU A;  3UN5 A;  4NA1 A;  2I1R A;  3LPY A;  5C2G A;  2Y1L B;  1RWK B;  4K59 A;  3BRE A;  3PRV A;  4TU7 A;  4HH1 A;  1X31 C;  3OL8 A;  3HFK A;  2SXL A;  5KFF A;  3D0H E;  4CYU A;  5J2M B;  3M2V B;  2J0S D;  2DGQ A;  5K8M A;  1TL1 B;  2ZBP A;  3S7R A;  1HL6 A;  3GCW P;  4QWE A;  1ZBT A;  3TVZ A;  2YKP A;  3QNW B;  1YBU A;  4KE5 A;  2E1R A;  2WBR A;  1KQF B;  5AT1 B;  3M9M B;  5CZV A;  4NRU A;  4ILM A;  1T9Y A;  4JYA F;  1XNQ F;  1EAR A;  2XMT A;  4YB7 A;  3AOC A;  2ZH3 A;  3T19 A;  5GAE I;  4X4V A;  1FJC A;  4DR1 J;  2R8J A;  3NS5 A;  3QGI A;  5H1S V;  4M5M A;  2HFV A;  4JI3 J;  2RRB A;  4CLS A;  7FDR A;  3NOC A;  1YHQ S;  2WON A;  3U7J A;  4I6A A;  1GH8 A;  3BN4 A;  5E3R A;  4WXO A;  1OPZ A;  1HQU A;  5GAD I;  1X4F A;  4Z7Y A;  4GRS A;  5HJY A;  2J7U A;  1KQG B;  4ICL B;  2IM0 A;  1C0U A;  1JKH B;  1RT7 B;  2MLZ A;  2F8E X;  2FVP A;  2CQC A;  4DF4 A;  1EX8 A;  4ZOS A;  3MM9 A;  1X0P A;  4NCB A;  2JWN A;  2W4P A;  2ZH9 A;  4N8N A;  3P3D A;  5C24 A;  3A4T A;  1TP7 A;  4N76 A;  1NUE A;  1A9N B;  3D4J A;  2UZA A;  3JB9 k;  4FF2 A;  1CSJ A;  2OUG A;  3T41 A;  4IG3 A;  1KS2 A;  3D6F B;  1T03 B;  3IGV A;  1GMW D;  2QGF B;  4WII A;  2MQ8 A;  2KO1 A;  3AOA A;  1UKU A;  2RDJ A;  4HEA 9;  3VAG A;  1XC9 A;  1F9F A;  1TUG B;  3G71 S;  3M8R A;  1VQL S;  3KUE A;  3IWX A;  3JQM A;  2K3I A;  2NPI A;  3SSR A;  3OV7 A;  5JXS A;  2J0W A;  3N5B A;  1G7C B;  2E7X A;  1L3S A;  2BQU A;  3FFI A;  1S9E A;  3H7H B;  1FO1 A;  4IH6 A;  1S6U A;  2E7W A;  1UJ6 A;  2OEK A;  4EEY A;  4CDI A;  4K7Q A;  3CCQ S;  3HJV A;  1UEV A;  2FHJ D;  2KB2 A;  5B0G A;  2ASY A;  1U48 A;  2DRA A;  4KGK A;  3DLL Q;  2J9C A;  5KT3 A;  1N34 J;  4DQS A;  2IM2 A;  2HYI B;  4DWI A;  1NBE B;  3Q89 A;  1JLF A;  2DRD A;  1KLN A;  3MEK A;  2I9S A;  1BE4 A;  2B5J A;  1QVF R;  3FDS A;  2VFT A;  2R2S A;  1D9A A;  2HQF A;  5L38 A;  4ZVG A;  7FD1 A;  4X62 J;  1SJF A;  4K0K F;  5DQG A;  5KTQ A;  4YB5 A;  4MT1 A;  4NOH A;  2M7S A;  4O44 B;  1MSW D;  2CJQ A;  4F04 B;  2NXN A;  4RNM A;  4DV7 J;  3DI6 A;  3MAA B;  5E3P A;  4PUO A;  3KK2 A;  1HNI B;  1PKU A;  2ZD1 B;  4BCA A;  3HSG A;  1F6T A;  1JX4 A;  1VRT B;  2ZHO A;  1RJJ A;  3C8Y A;  1GMW A;  4O3R A;  2VG5 B;  1PC4 A;  1RAD B;  2AGQ A;  1WD6 A;  4OI6 A;  2AYG A;  3CC7 S;  1H7W A;  2OPQ A;  1JLB A;  5K14 B;  1FD8 A;  1HW8 A;  3PYG A;  4ZPT R;  2DGW A;  5IM0 B;  3MEG B;  3DDI A;  2Y9H A;  3K5L A;  1V5V A;  3SV4 A;  3FEX B;  3PW5 A;  3I0R B;  1TKZ A;  1RWX B;  2KRR A;  4XPC A;  2W24 A;  1S0N A;  3QGG A;  2MQO A;  3MR3 A;  3ZC4 A;  2XS2 A;  1XR5 A;  1SC6 A;  4GKJ J;  3RRG A;  4K5S A;  2DNL A;  1BWV A;  3T5L A;  2CJB A;  3N4W A;  3DCA A;  3EXY A;  2WTF A;  2CJA A;  1X4G A;  3W1Y C;  2FYX A;  1SH0 A;  4ZPW R;  3F56 A;  4OI4 A;  4BS2 A;  2OPP A;  2FZK B;  1REG X;  3H40 A;  2GX8 A;  2XO7 A;  2FHJ A;  4X4Q A;  2HHH F;  1ZTT A;  1HYS A;  2UVU A;  2N4D A;  2HBZ B;  4ID8 A;  4DSL A;  2DNK A;  4A8Y A;  1HFE L;  2XMJ A;  4IO1 A;  3J7Z T;  1NZ8 A;  3RR8 A;  3J81 U;  3PNI A;  4KH1 B;  4GKK J;  1RCX B;  1HQE A;  1APS A;  4FS2 A;  1QUP A;  1HBO A;  3PV8 A;  2ZFH A;  2XNQ A;  5F8L A;  2XY5 A;  3UCG A;  1XIQ A;  2VBW A;  2RU3 A;  3FZ2 A;  1SQE A;  1S6Q B;  4YB1 P;  2GO9 A;  2XUL A;  2UUB J;  1F9E B;  2IAJ B;  1CS4 B;  2YX7 A;  2DNY A;  3CMA S;  4KHR A;  3I9Z A;  4X4R A;  4Y2M A;  1GTE A;  2QX0 A;  1LK5 A;  3HLU A;  3FRY A;  3ZTP A;  4DV5 F;  1VCT A;  4LSZ B;  4ED2 A;  3SYZ A;  3HZE A;  5EWE A;  3DMJ A;  5HMW A;  2A6O A;  4YR3 A;  2CZ9 A;  2KU7 A;  2AP6 A;  2WK4 A;  3NEK A;  2ZBI A;  5IT4 A;  4RPF A;  1VQ4 S;  4OZL A;  3QID A;  2CG8 A;  4LFC F;  1RU2 A;  2IJF A;  3H59 A;  4X66 J;  1S99 A;  2RD5 C;  4CO3 A;  5A0Y B;  1AFI A;  1FI4 A;  1KC8 T;  1IQT A;  1NH7 A;  2P8I A;  4DBQ A;  4B3M J;  1RI7 A;  2M3D A;  1JJC B;  4K2J A;  2H65 B;  1HLW A;  4QIE A;  3WX8 A;  1S4E A;  2H4Y B;  5G0R B;  1YIJ S;  2KG0 A;  2GVZ B;  4BBY A;  3BSA A;  3I56 S;  2HFS A;  4ITS A;  4U8Y A;  4DSK A;  1TL5 A;  3GTY X;  4ZN3 A;  2HQD A;  4AXI A;  2UXD J;  3H5U A;  1N52 B;  3FEZ A;  3LGM A;  2LVW A;  2VDH A;  1Q53 A;  1SUQ B;  3MM7 A;  2HNY B;  2G0I A;  2B7C B;  3HJF A;  4DCJ B;  3GJQ B;  2HHU A;  2JOQ A;  4WP3 A;  3CMQ A;  4B3S J;  1ZPV A;  3D1H A;  1RAG B;  2Q6B A;  1DY3 A;  1X8D A;  1AYE A;  3DM2 B;  2BV3 A;  3KLV A;  3V6H A;  2JVO A;  3US5 A;  2K1R A;  1UW9 A;  2M52 A;  2HFN A;  2FJB B;  2NYI A;  2MQM A;  4AQY F;  4DN9 A;  4ZA1 A;  3CIZ A;  1I5O B;  5ETM A;  4DV0 F;  4PG8 A;  3NWR A;  1VMB A;  4M94 A;  5E33 A;  2IJN A;  2HBY B;  4CIO A;  4N47 A;  1PYT A;  2E1P A;  2XCA A;  2VG6 B;  2R8H A;  4QPX A;  2P5V A;  4L73 A;  2MQQ A;  1J5O B;  3G6X A;  5HJX A;  2FHO B;  2YWE A;  1M5O C;  2PMW A;  1QVG R;  2OPR B;  1NZA A;  1RWP B;  3JTP A;  1S12 A;  2GHV C;  3GJT B;  2DCU B;  1ACM B;  2HMI A;  1JLQ B;  3J81 Y;  4H4K C;  1OS5 A;  3AH6 A;  1CJK B;  4JI0 J;  3A13 A;  1QM9 A;  1WKJ A;  2XHW A;  1H2T Z;  2JHE A;  3G87 A;  3DLJ A;  3FC9 A;  3PIO Q;  2BKN A;  2V68 A;  5SZT A;  4C0B A;  4Q0B A;  4CO0 A;  2Z56 B;  3ETO A;  3E3X A;  1Z1Z A;  4KKO B;  5CD4 A;  1T94 A;  1UW4 A;  4JB8 B;  2DNH A;  1UP1 A;  1N36 J;  1AT1 B;  1R8H A;  1Y3K A;  3C6U A;  1BC6 A;  1RT3 A;  4R8U A;  3R1L A;  4UQG A;  1UVN A;  1FF2 A;  3Q8R B;  1H2U X;  1IJE B;  2E29 A;  2WSF C;  3SXL A;  1RT1 B;  3CME S;  2XMM A;  3PCO B;  2DNO A;  2DNR A;  2YVS A;  3B4D A;  3GON A;  3TAM B;  2ZH4 A;  1FX2 A;  2WHO A;  2YNH A;  2KM8 B;  3QT5 A;  3NAI A;  4F2R A;  3C6T A;  4ENO A;  4N5S A;  1S9G B;  3CC4 S;  2BJ3 A;  2FGC A;  3WX4 A;  4RZR A;  3C14 B;  3OD2 A;  1BY9 A;  1VC5 A;  3W66 A;  1U25 A;  3QGH A;  2DGV A;  4OZN A;  4LF9 F;  1PJ6 A;  1XK8 A;  2MGZ B;  5IQ6 A;  3GJS B;  4RBU A;  3BGU A;  4KIA A;  1HWK A;  3DRS A;  1MU2 B;  2ZH1 A;  3QFH A;  1MWQ A;  2BVZ A;  3T1H J;  1FK9 A;  2JDJ A;  2EG2 A;  1HHS A;  4Z2X A;  2UU9 J;  3NGT A;  4PXB A;  4F0K A;  5GAG I;  5IT0 A;  1WJ9 A;  4DS4 A;  3ZZO A;  3HDS A;  3CIM A;  2VD3 A;  2PSZ A;  1JLE B;  1XJW B;  3OXL A;  3L7P A;  1VYA A;  1FX4 A;  1S6P A;  3HVT B;  2DGO A;  1YBA A;  1SC4 B;  5LT5 A;  4P2X A;  1U1L A;  2OEJ A;  4M8L A;  2RRA A;  3PVX A;  1N5T A;  5KG0 A;  2ZHB A;  1TL7 A;  2W7O A;  3R2C J;  1RAO A;  4QWC A;  1C2P A;  1KBR A;  3MI7 X;  3QIP B;  3CE8 A;  3EZO A;  4OYO A;  3DKD A;  2OFH X;  4LF1 A;  5FDL A;  2EKY A;  1XMQ F;  4DUY F;  4PG6 A;  2NPF A;  4PR6 A;  2GJI A;  2RDD A;  2UUT A;  5MAO A;  2VBZ A;  1P9Y A;  1REV A;  4B08 A;  4KFB B;  3ITH A;  5J1E B;  1UWB B;  4IQM A;  3BM7 A;  5A76 A;  4KHP F;  3IAM 9;  4DR3 J;  5CH7 B;  2FZG B;  2DY1 A;  5KOX A;  3AA9 A;  2D1C A;  4M95 A;  1R31 A;  5KFB A;  1I3O B;  3DOK B;  3RBE A;  2CPI A;  2XSF A;  3QZ8 A;  2P9G A;  2ZBQ A;  3IRX B;  3NBP A;  5KFO A;  1YRU A;  2B9W A;  2CIM A;  1YVF A;  2HS4 A;  4RU2 A;  3OQ2 A;  1KSP A;  1KHV A;  3GYG A;  4ETZ A;  3VF0 B;  2NR0 A;  2CNN B;  2WVD A;  4QIF A;  1T3N A;  1HWU A;  2HK3 A;  2XWX A;  3DRX A;  1LWC A;  4CM2 A;  3DLE B;  4HYK A;  1U8S A;  5KAK A;  2IMO A;  4NYO A;  5IQQ A;  1VIS A;  2Z30 B;  1KTQ A;  3RRK A;  2PFD A;  2UUC F;  5DDQ C;  2HQI A;  3BEG B;  2VC1 A;  5DQI A;  4C8O A;  2HBQ B;  1KRP A;  2VG7 A;  3HHL D;  3HVW A;  3CJR A;  4DV1 J;  1ZAV A;  3TWZ A;  3NRB A;  3SCK E;  3H5Y A;  3MM6 B;  1O0P A;  3K17 A;  2GNK A;  1N5Y B;  4EU0 A;  3B4M A;  4JI4 J;  2OKQ A;  3OR1 B;  2HVZ A;  3DU5 A;  2QN6 B;  1BQN B;  2VKZ G;  1GMU A;  4TY8 B;  3ZZ0 A;  3R6L B;  1B99 A;  4DR5 J;  4L76 A;  3TAR A;  4QR0 A;  1S76 D;  2QTW A;  3PKM A;  4ECV A;  1OO0 B;  2B4V A;  3OR2 A;  1N32 J;  3LTO A;  2HHQ A;  4AL6 A;  1HMV B;  2XY6 A;  7AT1 B;  3QSY B;  2DEI A;  1HIY A;  5J2P B;  4ECS A;  1F9H A;  1RTJ B;  3RAX A;  1FEH A;  3CJ0 A;  4C6A A;  4LF7 J;  4TXS A;  1T8E A;  3D54 A;  2JEG A;  2M9K A;  1V3R A;  3W2W B;  3RU0 A;  4IH5 A;  3K0J A;  3BPS P;  3CJ2 A;  4F0M A;  3V6K A;  1HNW J;  2KJV A;  1R27 B;  3EVO A;  1RQ0 A;  1HNZ F;  2ZOF A;  2HSE B;  2WCX A;  1NJY A;  4DLG A;  4LF4 F;  1NHK L;  2V8G A;  2DR5 A;  1MW7 A;  1HBM A;  2K7K A;  2B4P A;  4WZQ A;  4JI2 J;  1HBN B;  4X4S A;  4MKA A;  4JI1 J;  2FVC A;  3KLI B;  2XI3 A;  4ANE A;  1VJW A;  3HHL A;  3OJU A;  4NAS A;  2FLN A;  4Q8E A;  3PZP A;  4NLO A;  3TAQ A;  2FUG 9;  2I2Y A;  4JV0 A;  2KTQ A;  2R3V A;  2ZEJ A;  1RUS A;  4BWJ A;  5DJB A;  3AT1 B;  4KTQ A;  4DSJ A;  4A46 A;  4OYP A;  2J6U A;  1FJE B;  3AAW B;  3K57 A;  4U95 A;  2W01 A;  1HNV B;  4Q5V A;  4O3Q A;  3QSI A;  4DX5 A;  5IV3 A;  2XBP A;  1OQ6 A;  1VBK A;  2IIH A;  4JI6 F;  2W1B A;  4X4O A;  4OX7 A;  2Z58 B;  4Q45 A;  4B9U A;  1HR0 F;  1NJI T;  4NPO A;  2F1F A;  1Q82 T;  1R0A B;  1AFJ A;  1X4E A;  3NLC A;  3HP6 A;  2CJY B;  2VHG A;  3CCT A;  4ZVR B;  4EBC A;  4F7V A;  4JV5 F;  4Y3C A;  3J81 j;  3QRP A;  4FS1 A;  2X1G A;  2NSB A;  3RRH A;  2OTL S;  2YWW A;  1M5H A;  1QAY A;  2BOA A;  3O8W A;  4OX9 J;  4TKT A;  1GTH A;  1VLO A;  2XC9 A;  3MM5 B;  1RT5 A;  3K59 A;  3PFO A;  3BGL A;  4MJK A;  4AT1 B;  3QWU A;  2HNZ A;  1LFW A;  5FD1 A;  3HPO A;  1SKR A;  4N7T A;  3HKZ D;  1NSQ A;  3S8S A;  2XLK A;  1NME B;  4W98 A;  1YKW A;  2HAI A;  4A4J A;  1RTZ A;  4OLP A;  4EO8 A;  1TAU A;  3CJQ A;  5HAT A;  3TYT A;  3I5B A;  5CYQ B;  2X7I A;  1FT8 A;  5K8P A;  2PT0 A;  1KQS R;  2XM3 A;  2MZR A;  1QD1 A;  4AE5 A;  3HI9 A;  1T9X A;  2MLX A;  4WFZ A;  2C2R A;  1TL1 A;  5DLF A;  2VA3 A;  3A8J A;  3TVK A;  4G1I A;  1YG0 A;  2Z57 B;  4JOU A;  4YUD A;  1TFW A;  4IRK A;  2ALY B;  3DDK A;  4RNF A;  4ED8 A;  4XIU A;  1FKA F;  3DHX A;  4HL9 A;  1M5P C;  4OHZ A;  3DRY A;  3PR5 B;  3H4B A;  2Z2L A;  4TYB A;  5ETL A;  3RB3 A;  3W61 A;  2R7Q A;  4DMZ A;  2H51 B;  2RH3 A;  4DR1 F;  4F4W A;  1I94 J;  3DRP B;  3BS9 A;  3JQK A;  4DPY A;  3R7B B;  3CB4 A;  2IVY A;  5D0H A;  2IA0 A;  1MN7 A;  1TMJ A;  5IXU A;  5E41 A;  1VHF A;  1JWW A;  2MMY A;  3LP1 A;  1U1Q A;  2HHT A;  3I87 A;  3OFH A;  2E66 A;  2RDI A;  2GAG C;  4O3O A;  2GZO A;  2IC3 B;  1JKH A;  1RT7 A;  2QZ8 A;  2HVH A;  1OYD A;  2RHS B;  3CO0 P;  2XS7 A;  2DJW A;  5F3T A;  2GHW A;  1WEX A;  2UV8 A;  3UVJ B;  5EUH A;  3VWS A;  1H73 A;  1EKR A;  1C0T B;  2B3T B;  4XTT A;  2YY3 A;  1H3D A;  5KFD A;  2N3L A;  4XAK A;  4JI7 F;  1XEZ A;  4CQ1 A;  2BQ3 A;  1S97 A;  5CD4 H;  5HLF B;  1T03 A;  3MEC B;  3W65 A;  3L7U A;  1DJ0 A;  4ES2 A;  2B6A A;  3ILJ A;  2Z2Z A;  1RAB B;  3GJR B;  2W9C B;  2VF3 A;  2N82 B;  5KFY A;  1D9D A;  2CQB A;  3Q8U A;  2JC1 A;  4OYW A;  3TUZ C;  4YY3 F;  2W2P P;  2KT5 A;  3RB4 A;  3MR6 A;  1N48 A;  1RLD A;  3I4P A;  2KXF A;  5ETN A;  4MIB A;  3W8G A;  2RIL A;  1OSD A;  5DET A;  3GU0 A;  1C4C A;  2MKS A;  1NM2 A;  2QL5 B;  4XDC A;  3HHD A;  4WU2 A;  4TY9 A;  2HVE A;  2CKW A;  5D4N A;  5I3U B;  3OHA A;  2IM3 A;  4FPR A;  3I4H X;  4DI6 A;  5IWA J;  4PXC A;  2RKI A;  5AXL A;  1HBU A;  3I5C A;  1K8A T;  2MHE A;  4NI2 B;  4NXN F;  3WZ0 A;  3FZB A;  3CDE A;  1PAE X;  1WSR A;  4X62 F;  2RQ4 A;  4C3K A;  1VRU A;  1WHY A;  3TW0 A;  2ROP A;  2PC6 A;  3ULH A;  2XGQ A;  2MTL A;  2BAN A;  4Q43 A;  3MMJ A;  3LQV A;  3W3S A;  1PBA A;  9RUB A;  4DV7 F;  4O44 A;  1TV6 A;  3KHG A;  5CA5 A;  5GAH U;  2UXC J;  2LU2 A;  3D7S B;  1GXL A;  4YOE A;  1E6Y A;  4O4G A;  2ATC B;  2ZD1 A;  1WWH A;  5DZ7 A;  2VOD A;  1IBM F;  1VRT A;  3BKT A;  3BF4 A;  4R5P B;  1PSD A;  4HDG A;  4QQB A;  2XSJ B;  1CJV B;  1FER A;  4KO0 A;  1LWF B;  1TAQ A;  2W4D A;  1NDK A;  3CT9 A;  5F8J A;  3AJD A;  1GK8 A;  2F5G A;  3D66 A;  2EK1 A;  1RT2 B;  2XY7 A;  5A8R A;  1ZYQ A;  3I0R A;  1RHU B;  1N0V C;  4NCA A;  4GKJ F;  2FC9 A;  2GAH C;  1YGY A;  4GMK A;  1P1T A;  1G4C A;  4ZVO B;  2H5E A;  3VZI A;  2BUN A;  3HSJ A;  2DH8 A;  1BXN A;  3KG4 A;  2MZJ A;  3ZZT A;  3CJK A;  3UFC X;  4DQI A;  2IVM A;  4I2Q B;  1U1N A;  4F26 A;  4IFY A;  3ZXW A;  2DIT A;  4GKK F;  2E5I A;  5HQ8 A;  3HVA A;  4Q8F A;  2RQK A;  1IJF B;  2EG1 A;  2MKK A;  5ETV A;  1P9Q C;  3X1L B;  3LUY A;  1IKW B;  2CJX B;  4QZV B;  3SBM A;  3IO1 A;  4CH7 A;  1TTH B;  3CCU S;  4UOF A;  2CPZ A;  1SIW B;  3FQL A;  3TJ9 A;  1PO6 A;  2IAJ A;  2WBM A;  4EBD A;  1GEH A;  2YKN B;  4EWT A;  1H6K X;  3DLB A;  5B08 A;  1MWZ A;  5K5M A;  3V4I A;  2F9J A;  2RF2 B;  4YHH J;  2QA4 S;  1MNE A;  2O67 A;  3CCE S;  4C98 A;  4F50 A;  4WCE Q;  3BDP A;  2V4J B;  1T9U A;  5G4D A;  1C1C A;  2CJ9 A;  4CTA B;  3G8S A;  2Z4P A;  3KTQ A;  4RW7 B;  1B3T A;  3KFW X;  4Y65 A;  4EBE A;  2CZ4 A;  2IY5 B;  1Y7P A;  4B3M F;  4NZ7 A;  2Q43 A;  1LQ9 A;  1NDC A;  2QA2 A;  4ED3 A;  2CQ1 A;  2DHA A;  6FDR A;  3TZX A;  3TEH B;  2ZKT A;  2EWH A;  3D6M B;  5C5J A;  1G2E A;  3EM1 A;  3AD7 C;  1S77 D;  1T95 A;  2GML A;  3MPU B;  5D8H B;  1PCA A;  5G0R A;  2XGP A;  4M5I A;  2DGS A;  4U96 A;  2WW8 A;  1WKK A;  2KHC A;  2KRB A;  3G8T A;  4O0N A;  4DPT A;  2XHC A;  1H7X A;  1ZOT A;  5L9X A;  1NPR A;  3TEG A;  1M5V C;  4DV3 F;  4J90 A;  1KEK A;  2ZM6 J;  5DZ6 A;  2B7B B;  3T6J A;  6AT1 B;  5F8I A;  1NXI A;  1NEE A;  4ED7 A;  2HIY A;  2ZOG A;  3MMC A;  2B0G A;  4DCO B;  5DG7 A;  3ENV A;  2QMU B;  2WB1 D;  2QLF B;  3IS9 B;  3U1N A;  4PWW A;  1AXQ A;  3MAH A;  1W2B R;  3CW2 C;  1ZM4 A;  4X4U A;  2YNF A;  1R0C B;  1FNO A;  1ZM3 A;  2V9K A;  2HEK A;  2B9X A;  3D28 A;  4OJH A;  2VG6 A;  3KG1 A;  3LW5 C;  1J5O A;  4HT7 A;  1NHU A;  3RYL A;  2COL A;  2Z2M A;  5ETT A;  2OPR A;  5T7L B;  1KTV A;  3IXQ A;  1JLQ A;  4BDP A;  3NCQ A;  4ELV A;  4RW9 B;  3ICL A;  4YQW A;  1A7G E;  3AQP A;  3OUY A;  1FCA A;  2WOM B;  1IKV A;  3E8O A;  2H5I B;  2W8K A;  5EDW A;  2CAD A;  3ZO7 A;  1YQH A;  1N33 F;  4P73 A;  5K8N A;  3IR6 B;  1CC8 A;  4MKB A;  3V6D B;  3LPE A;  2RVJ A;  1AZS A;  2YKM B;  4KKO A;  2C2Z B;  1N36 F;  3BGF A;  2FLP A;  2BDP A;  4J5O A;  1V3Z A;  3N6M A;  3UDL A;  1NK7 A;  1UL3 A;  3GIK A;  2XMK A;  4H4O B;  3MXH P;  5E7O B;  3PX0 A;  2CNL B;  2H4W B;  4Q2L A;  2B56 A;  1ZAX A;  2KJW A;  3GE9 A;  4J9R A;  1PJ5 A;  5CAB A;  2P6S A;  4CP5 A;  3GFY A;  2LQ9 A;  2R7V A;  1RT1 A;  1FRJ A;  3OL7 A;  2X1A A;  2JJ4 D;  5D0R A;  2HZC A;  3GIM A;  2RSQ A;  2ROE A;  4RNO A;  1WTB A;  4I2P B;  3TAM A;  1U47 A;  3MF5 A;  2Y1R I;  4N77 A;  5FII A;  1VBX A;  2OMO A;  1VJQ A;  1I6J A;  3WC0 A;  1TU0 B;  2ZH2 A;  1S9G A;  1G6B A;  2GV1 A;  4FVC A;  4G1P A;  5A6P A;  2C28 A;  3RAM A;  3C14 A;  3K5N A;  2ILY A;  2QV6 A;  3PEJ A;  1NSA A;  1VBZ A;  2C3Y A;  4LSL A;  5CQG A;  1EZZ B;  3N6N A;  1L5U A;  4B3R J;  1T9V A;  1U6Z A;  1AUD A;  2MGZ A;  3H42 A;  3A8K A;  3T1H F;  4NA2 A;  2ILZ A;  3PIP Q;  1MU2 A;  1RHQ B;  4H4M A;  2JL9 A;  2XYP B;  1RAE B;  2F8M A;  1RA6 A;  2O66 A;  2CUY A;  2VBY A;  1FKP B;  2FPH X;  3AFG A;  2QLB B;  2FZC B;  1B0V A;  4D3G A;  3DLG B;  5D77 A;  2M8D B;  4RWX A;  5M2U A;  4IOA Q;  3BYP A;  1JLE A;  4IQX A;  5KT6 A;  3KUG A;  5A8W B;  5EX0 A;  2BJE A;  2GS8 A;  2DHS A;  3HVT A;  2VZ9 A;  1L3V A;  4OZ2 A;  5KG5 A;  5KFS A;  2I6W A;  3J80 U;  3Q8S B;  5IT9 U;  4BHQ A;  3F41 A;  2YTC A;  2N4C A;  1WC3 A;  2UUA J;  3R5J B;  4IDK B;  2F65 A;  2VQF F;  5F8M A;  2QA4 G;  3C46 A;  1RHM B;  3W62 A;  1FRL A;  3ET6 A;  1CJT B;  2WVC A;  2DD8 S;  3QJP A;  1RBA A;  3I0S B;  3K5M A;  1S57 A;  1PJ7 A;  2W2M P;  1RWM B;  1RAH B;  2H3E B;  1Q8L A;  1JQG A;  5K8O A;  3VQS A;  5J1E A;  3TX8 A;  3KK1 B;  3MR5 A;  3PRD A;  2MZT A;  4MIA A;  3H8Y A;  5CCL A;  3HD2 A;  1YI2 S;  3ZNU A;  5HMY A;  2PMH A;  4URS A;  2EEY A;  2BW7 A;  2NYH A;  4DU8 A;  3TNV A;  3MPY A;  1EQ0 A;  4DUT A;  1DBD A;  4YEA A;  3RW7 A;  3IR5 B;  2R7W A;  4OZ0 A;  2ZZT A;  3M6U A;  3DHW C;  1W7W A;  2B8Q A;  2MLY A;  4LBI A;  4K5R A;  3Q83 A;  1Y5I B;  3U02 A;  4DR6 J;  3JSY A;  5CYM B;  1SI9 A;  3IBF B;  2ZE2 B;  2QE5 A;  4I7F B;  3NNC A;  2DRB A;  1E6V A;  3DLE A;  1S48 A;  5JJB A;  3C16 B;  1RWV B;  3PYD A;  2CQ0 A;  4K4Z A;  3J7Y I;  3V81 B;  3UR3 C;  8AT1 B;  1UZH A;  2GQQ A;  4M5K A;  4LQ9 A;  4DV1 F;  1WC4 A;  2VFV A;  3GG1 A;  3IFE A;  5I42 B;  2DR9 A;  2F4F A;  4A8K A;  4JI4 F;  1HD0 A;  2Y3Y A;  1VOM A;  3GYX B;  3LAN A;  3CXC R;  2KG1 A;  3MUT P;  2PFF B;  3OR1 A;  4ZHR A;  2QMW A;  4R25 A;  4LFB J;  4OJ3 A;  4P74 A;  3LGN A;  1RAA B;  4RLE A;  3DXS X;  5KG3 A;  4ELU A;  4C97 A;  4TY8 A;  2OPS B;  5HMZ A;  4A8O A;  2CNK B;  3GFH A;  1GAO A;  3FGV A;  4KGX B;  3HF5 A;  5LSL A;  3UQS A;  4LF8 J;  4OV1 A;  4OZ1 A;  1RWO B;  1T05 A;  3KKF A;  3IWL A;  1HMV A;  3AY0 A;  5KFG A;  4DV6 J;  3M2U B;  4LF7 F;  1EET A;  2G4B A;  1RTJ A;  1U1M A;  3GR0 A;  3R97 A;  1ZZF A;  3V6J A;  3MCM A;  1U1K A;  2YWK A;  1JLC A;  4OLO A;  1HNW F;  3OTC A;  4IFV A;  2VFU A;  3SI8 A;  1Q7Y T;  2KDO A;  4MAK A;  2MZ1 A;  1FHT A;  4ZLP A;  3OXF A;  2J9D E;  3UCU P;  2HIQ A;  1KVJ A;  3GV7 B;  1N6Q A;  2X3G A;  3GFZ A;  4ZJQ A;  2CQ4 A;  3AA8 A;  1YDL A;  5HSP A;  5A2Q Y;  2YPY A;  1LV5 A;  3PW7 A;  3SFG A;  3HX9 A;  3TAP A;  1DTT B;  4ZVT B;  3VGS A;  1FRH A;  4YFU A;  3KLH B;  1DAR A;  4I6Y A;  3G2X A;  4EK2 A;  3W5Y A;  2CQH A;  1KP6 A;  4TU9 A;  1A0O B;  1WF2 A;  3MMB B;  3QMQ A;  2QG9 B;  3FBB A;  4ZDN A;  4NEY A;  5DQH A;  3R5C A;  1S10 A;  1K44 A;  4K4T A;  1M5K C;  2Q66 A;  1HNV A;  4J9N A;  3Q23 A;  4MYT A;  2IFX A;  1FFG B;  2AZ1 A;  2HHW A;  1I51 B;  2D7S A;  3NWG A;  1G3O A;  5J2N B;  1VIX A;  4B3O B;  2QA1 A;  1NPK A;  4J9S A;  4IYQ A;  1R6V A;  3M8P B;  2AX1 A;  1X5S A;  4DL6 A;  1FFS B;  1WC1 A;  2HW3 A;  2BE2 A;  3W2V A;  5F0U A;  3AB2 B;  3BSN A;  4IR9 A;  4RBT A;  3I32 A;  2CVE A;  1XER A;  1S0M A;  3UWT A;  1UMJ A;  2EFG A;  4OI0 A;  2AJ1 A;  3OTE A;  4UUW A;  3JAM Y;  4ZIV A;  4OX9 F;  4QU7 A;  4DS5 A;  4UOC A;  2MQN A;  4LMZ A;  2JH3 A;  2XYH B;  5E2Q A;  1VR6 A;  3VAK A;  1CBK A;  4LF5 J;  1UEU A;  2ZH6 A;  5B0B A;  4PG4 A;  3D6T B;  3HHL C;  3Q0A A;  3ZNJ 1;  1IR2 A;  1SV5 A;  3MMA A;  3CDU A;  1Z4U A;  1XQI A;  2NXU A;  4G1Q B;  1HHQ A;  2AEF A;  1X5T A;  1RAF B;  5EHH A;  5K9F A;  5D78 A;  5CYQ A;  2YXL A;  2EW9 A;  1RYR A;  1Y9O A;  4NRT A;  3M9N B;  2ASL A;  1K1S A;  2H1Y A;  1YBT A;  1AW0 A;  1CJU B;  2XEX A;  2IBO A;  3TZY A;  3F44 A;  3K58 A;  3LAM A;  2XS5 A;  3CJT A;  1VFJ A;  2W2O P;  2HHP A;  3HZG A;  3KK3 A;  3QLH A;  1T0T V;  3M8Q A;  3UI3 A;  1W2I A;  4OYB A;  1JJH A;  5LXY A;  1UVJ A;  3KYL A;  1OPI A;  2D3O 1;  1K1Q A;  3M1V A;  4QIG A;  9ATC B;  4XO0 A;  5KFI A;  2W4C A;  5BXI A;  2EFO A;  1IWA A;  3K2Y A;  1Q8K A;  4NYP A;  4QU6 A;  3DYA B;  2I5J A;  4R0E A;  4U9R A;  1KVI A;  2M0G B;  4ECQ A;  2E5L F;  2DO0 A;  4C11 B;  2ACY A;  4IKA A;  3RGI A;  2LQ5 A;  3Q2T C;  1RTH A;  2GIF A;  1BQX A;  2QL7 B;  4NLQ A;  4CNY A;  2MXY A;  2ASD A;  4LRF A;  4WP8 A;  1TL3 A;  5LMN J;  2IC3 A;  1QDU B;  3HFZ B;  3PYF A;  4L3K A;  3HM9 A;  2LKZ A;  3D1Q A;  5E3A A;  3QYY A;  4LRA A;  3NGS A;  2HGN A;  4LF6 J;  3P5B P;  3M32 B;  1Q16 B;  3UVJ A;  2HZV A;  1NSP A;  3MAQ A;  2VQE J;  1C0T A;  1C4A A;  3T1Y F;  2E1M C;  4ECR A;  1WTF A;  3KDN A;  1D09 B;  2YQ1 A;  3P6Y C;  1MN9 A;  5HLF A;  2LDY A;  3I31 A;  3MEC A;  3EYZ A;  2FLO A;  3LAK A;  1XN9 A;  5KFV A;  4NLV A;  5D6G A;  1YJW S;  4DXL A;  3GMG A;  3RB0 A;  1RZM A;  3QT6 A;  2HLU A;  3C19 A;  4GC7 A;  2LDI A;  2W9C A;  4YR0 A;  3CSK A;  4Y2K A;  5DM7 Q;  2DNP A;  1TKT B;  1WC6 A;  2ZUA A;  2DNQ A;  1LWE B;  4R0J A;  2AEJ A;  3CJ5 A;  5L39 A;  2DNN A;  3EUN A;  4UOH A;  2AJF E;  5I4M A;  1RSC A;  4PCQ A;  4MK9 A;  4QW8 A;  2JSX A;  2QEX S;  4CZC A;  1T3O A;  2HFO A;  1WEZ A;  4OJG A;  2EFN A;  1FRK A;  5M2P A;  4CYU B;  2HRY A;  1RBO B;  3PW2 A;  1IR0 A;  4ED6 A;  1KON A;  5IWA F;  2L41 A;  1V5I B;  2HFU A;  3OHB A;  2VIC A;  2LXF A;  4NI2 A;  1BD6 A;  4J9P A;  2JVR A;  5KT5 A;  3NG8 A;  3G82 B;  1GQE A;  3T6B A;  2K3K A;  2L9N A;  2AGP A;  2ACM A;  5HRO A;  4DN0 A;  4JYA J;  3FBE A;  4LR8 A;  2J8S A;  2A18 A;  3OXG A;  1UAW A;  1U2F A;  2XZW A;  1S7I A;  2M88 A;  3CCJ S;  1FNM A;  3RW6 A;  1YJ9 S;  5LSR A;  3O3L A;  2WON B;  2F4V F;  1LFP A;  1LWF A;  2HQ3 A;  2J8A A;  2E5J A;  1HQU B;  1Q79 A;  4A47 A;  2BEF A;  1RT2 A;  2CPX A;  4OI2 A;  1N56 A;  4RNN A;  1S49 A;  2J5A A;  1WEY A;  1Q8I A;  3D0G E;  4KH0 B;  3DRR A;  4WIQ A;  1EB0 A;  4PZV A;  5C24 B;  4CI0 B;  3HCX A;  3IG1 A;  1FJG F;  1RBL A;  2D9O A;  1JXV A;  4LQ3 A;  2FB0 A;  3K8W A;  4E2F B;  4I2Q A;  4PWU A;  4QPT A;  4NLX A;  1FDN A;  4IG3 B;  2JLF A;  3N6L A;  3BGR A;  2Z0G A;  2VU5 A;  3DOL A;  1S1U A;  5GMK a;  4FF4 A;  4ZIT A;  4I67 A;  2DR7 A;  3I6P A;  3W5X A;  3ZTO A;  3LP2 B;  1J2V A;  2UVV A;  5C42 B;  4ZP8 A;  1X4H A;  3PKY A;  3HK2 A;  1FE4 A;  2DH7 A;  3FBC A;  4I68 A;  4KSE B;  1S9E B;  4QOT A;  2XCP A;  4M5H A;  5CYJ A;  2XLJ A;  1L3T A;  1IBK J;  2R7U A;  5U47 A;  4WK1 A;  3Q24 A;  2LP4 A;  3R8Y A;  1B7Y B;  4DPU A;  5L1J A;  3W9J A;  1X9W A;  1NH8 A;  2HWT A;  4YHH F;  3ILL A;  1NK5 A;  2V8H A;  3C3L A;  4AD6 A;  3PAC A;  3A8I A;  2BAC A;  1GX6 A;  2C2M B;  2EBG A;  3NAH A;  4P2S A;  2G0C A;  2VPY B;  5KG7 A;  2MQL A;  4FZV A;  1QJH A;  2VUG A;  4HTJ A;  4GVL A;  1WKL A;  1RKI A;  5HP1 A;  3T1A A;  1NO8 A;  4K0K J;  4CLP A;  2HVI A;  1HA1 A;  3DI6 B;  2PO4 A;  4PUO B;  5KT4 A;  3K5O A;  1TK5 A;  2KFN A;  3BKF A;  2KT3 A;  1T02 A;  1ITP A;  4EGL A;  4NXM J;  2KVI A;  3MHY A;  3O1L A;  3V4M A;  2D74 B;  2QFJ A;  4OI1 A;  2L48 A;  3KOA A;  2ZM6 F;  2R4F A;  4DQR A;  3HSD A;  1Z2Z A;  4K4U A;  2B4U A;  1J5E F;  4NLG A;  1RTD A;  3H5X A;  2MY7 A;  3NS6 A;  3QT7 A;  3AJ1 A;  3GG0 A;  3DFE A;  5DDO C;  4KGV B;  2BXJ A;  2WW4 A;  3W63 A;  2W9B A;  3GLJ A;  1HQ2 A;  4IG0 A;  3FCV A;  1M0S A;  2LQJ A;  4J9M A;  5F0W A;  3QJL A;  4QWB A;  1KFD A;  2WVE A;  3KNA A;  2EI5 A;  1S4F A;  2AKW B;  3M30 B;  3ELH A;  3SSS A;  2FY1 A;  3KUH A;  1WI8 A;  2GO8 A;  2JX2 A;  4CLZ A;  3TRG A;  2QYG A;  2R7S A;  3RBD A;  4ILL A;  3M7V A;  2V0N A;  4OX6 A;  4DG1 A;  4CLL A;  2V63 A;  5ETK A;  5E0O A;  3S01 A;  5T7L A;  4DX7 A;  1HBO B;  1WOP A;  3TX0 A;  2BJ9 A;  2BRK A;  2A2C A;  4KV8 B;  2WOM A;  3U27 A;  1NB7 A;  3VGV A;  3TJA A;  3ILO A;  3GYN A;  3BZQ A;  3V6D A;  2YKM A;  1S1V A;  2DHH A;  1GXU A;  3PG9 A;  1HWI A;  1YRX A;  4IRD A;  3GCX P;  4I64 A;  1NB2 A;  3UPF A;  5KFT A;  2CPJ A;  2N3O A;  2LXI A;  3TZW A;  2Q1L A;  1DAX A;  3KJF B;  1KQK A;  1S79 A;  2AD9 A;  4DUZ F;  3GIJ A;  4NL5 A;  4E0D A;  2ZJP Q;  4LFC J;  4AL5 A;  2PII A;  4X4T A;  2IMW P;  3UDC A;  3NS7 B;  3SMZ A;  2GW8 A;  2M8H A;  3IBC B;  1PGZ A;  1D3W A;  1R43 A;  3E01 A;  3DOM B;  2V94 A;  1TKX A;  3GII A;  2U1A A;  4DL3 A;  1KR4 A;  3EGW B;  2JFK A;  3LH2 S;  4WYW A;  3KLE A;  1SB6 A;  2BA9 A;  2PE8 A;  4EO6 A;  2ADB A;  2NLW A;  1RXO B;  3KHR A;  2NQP A;  3MFH A;  2HHX A;  3WBZ A;  1RWU A;  3UDE A;  4B3R F;  2B43 A;  4ZKA A;  2DH9 A;  2CPD A;  1LXJ A;  3POT B;  1NKB A;  3MM7 B;  5ITH A;  2WSC C;  3O6Q A;  4P7T A;  1WG4 A;  2FVR A;  2P9E A;  3WQP A;  4LIW A;  3CD7 A;  4MK8 A;  4IRC A;  2YKA A;  2CQD A;  1OWX A;  3MGJ A;  2WAQ D;  2KYZ A;  3PEH A;  2K1R B;  1FKP A;  1X4D A;  1ZPW X;  3OBI A;  2PD1 A;  3WC2 A;  3OVB A;  2CQG A;  2B4O A;  3EIC A;  4IOC Q;  1WHX A;  2KXN B;  4AQY J;  4X65 F;  5RUB A;  3SQG A;  4WZM A;  4FBT A;  4J7C A;  3THP A;  4DV0 J;  2EPI A;  5H9E K;  5HAN A;  4NZ0 A;  1ZH5 A;  4TYA A;  2ZJQ Q;  1WHW A;  1U1P A;  2VOP A;  1M1G A;  3UNG C;  4PKD B;  2R8G A;  3JSB A;  4LR7 A;  4IDK A;  4LRE A;  1JJ2 R;  2EC0 A;  4RW6 B;  1BMQ B;  4RW8 A;  1WDD A;  8RUC A;  1P1L A;  2V8D A;  3CCS S;  4GO7 X;  2E7V A;  2Q79 A;  4LVN P;  3F0N A;  3TAN A;  2G9O A;  2KM8 C;  2GC8 A;  3I96 A;  1IM6 A;  3BR9 A;  3EWG A;  4DX6 A;  5KG2 A;  3KK1 A;  2LQ8 A;  3D2W A;  2GJF A;  2AEM A;  3M9O B;  1S0O A;  3IR7 B;  1RAI B;  2UXB J;  3ZZU A;  4DPW A;  3C6U B;  2RML A;  1X5P A;  3OFE A;  2VA2 A;  2HRU A;  2ABY A;  4QR2 A;  1F5B A;  1WEL A;  2HND B;  2ZBR A;  5GAE U;  1TK0 A;  4TU8 A;  4NZ6 A;  2RU9 A;  3FJ2 A;  1DHM A;  2BQR A;  2ZE2 A;  1N0U A;  3B82 A;  3MEE B;  4I7F A;  5KFR A;  2VDI A;  3FCW A;  5HMX A;  4PPZ A;  2G2O A;  2YQ0 A;  3KLF A;  3BO2 A;  2YNH B;  2EFQ A;  4QWA A;  2W8L A;  1YIT S;  3U1L A;  1NK6 A;  2GIQ A;  2CPY A;  5GAD U;  3OTO J;  1U6B A;  2GFF A;  1BGX T;  3CCL S;  3RB6 A;  1NU4 A;  1YZ6 A;  5EWG A;  5I42 A;  2VJV A;  4EZ6 A;  4D3H A;  1DTQ B;  1RT6 B;  1X4C A;  3R27 A;  4FVM A;  5DLG A;  4C0O C;  3DRS B;  5H9F K;  4LF9 J;  1Y5N B;  4TVA B;  2AIR B;  5BYS A;  2PA8 D;  1KLM A;  3L4B C;  1FK9 B;  1MG7 A;  1OY8 A;  5FLX U;  2DY9 A;  3BPD A;  2RAQ A;  3KWM A;  2AJ2 A;  5I3Q A;  2CPF A;  4U7U K;  3I82 A;  5D0E A;  4C3M A;  3TA0 A;  4ZVP B;  3MD1 A;  4MMO A;  1U45 A;  1XNR F;  4C8M A;  2PN6 A;  1N4L A;  3HFV A;  2JEF A;  4BWM A;  3VAL A;  1V3S A;  2XG8 A;  1UVL A;  3D5M A;  2QSF A;  1M5S A;  4MKY A;  4UTG A;  2FY8 A;  3VZH A;  1SVD A;  5FDL B;  4LFA F;  4ZVQ B;  3L09 A;  4ALZ A;  4U67 Q;  5L1I A;  1FNX H;  2ZWO A;  1REV B;  2J7W A;  1D1U A;  4DUY J;  3VAF A;  1K73 T;  1HD1 A;  3ITH B;  4NLU A;  5CZX A;  3EZU A;  1DTT A;  4GO5 X;  3ZFV A;  1NJZ A;  4KHP J;  4LJM A;  3AHP A;  3LWL A;  1WC0 A;  1HPZ A;  4ZCM A;  3NBP B;  1F5C A;  2HHS A;  4P75 A;  3RZA A;  1J27 A;  5L9N A;  2NS1 B;  1M1K T;  4NCG A;  4UQT A;  4HDH A;  4TLQ A;  4F02 A;  1W26 A;  4NEZ A;  4QIW D;  2MDA A;  2DGU A;  2DHX A;  2L3M A;  1S0V A;  3JTO A;  2I38 A;  4QW9 A;  2NZ4 A;  2JZ5 A;  2MKY A;  4OX8 A;  4KR0 B;  1AA1 B;  4RW4 B;  3EDR B;  3MED A;  1PAU B;  4UY8 T;  3SCL E;  2BR0 A;  2IPO B;  2HKE A;  3H2V E;  4ZVU B;  3FMB A;  4B3O A;  1NHV A;  3IGN A;  1U1R A;  3EGV A;  3M8P A;  1WOS A;  2VG7 B;  2EC2 A;  4ZPC A;  1UFL A;  3FVY A;  2VL1 A;  4KHM A;  3LWM A;  2V34 A;  3IA0 A;  4OYA A;  2C42 A;  2K7J A;  3D67 A;  1UFW A;  4ECT A;  3IM9 A;  4F25 A;  4HT5 A;  5KFA A;  3JSR A;  1Q8B A;  3PX6 A;  4LBH A;  4UT4 A;  4ZLN A;  2O01 C;  4HVZ A;  5THW A;  4HI1 A;  4LF5 F;  4UY8 5;  4USM A;  2A3J A;  3BKU A;  4DDF A;  3SQO P;  3ZTS A;  3MR7 A;  3ENW A;  1R8P A;  4FXD A;  3FK4 A;  3W60 A;  1T7P A;  3OVA A;  1EQM A;  3OR2 B;  5FLX Y;  4EUV A;  1VQ9 S;  2RRN A;  4HAC A;  3P49 B;  4FNH A;  2IDE A;  3O44 A;  2JLE A;  1XMB A;  2MQP A;  5AJ3 F;  3MOJ B;  5AXK A;  4G1Q A;  3OFF A;  2BE7 D;  1M90 T;  1GMV A;  1LW2 B;  3OFG A;  2UVW A;  3VAM A;  4OYM A;  1VQ8 S;  5CXT A;  1U02 A;  4NLY A;  2XMV A;  1HWL A;  2H48 B;  3MPV A;  2JFD A;  3NCR A;  2FJV A;  1T9W A;  3OVS A;  1FTC A;  4X64 F;  2KN4 A;  1SQG A;  2BW2 A;  4A8F A;  1HBM B;  4LF4 J;  3R3T A;  3RBX A;  1LK7 A;  2XO6 A;  2CNO B;  1LXN A;  1MLA A;  5AE2 A;  5E3C A;  2AYB A;  2DGT A;  2ALZ A;  1VLY A;  3HHL B;  4L75 A;  2D3O R;  4ZPD A;  2ZH8 A;  2LU1 A;  4M5D A;  1NK0 A;  1N88 A;  4DOZ A;  3LP0 B;  4C11 A;  1S1W A;  3HT3 A;  3SCJ E;  4YN3 B;  3DGP A;  1IBL F;  1SC3 B;  4B9V A;  2WB4 A;  2ASJ A;  1IKX A;  1M1H A;  2DGX A;  2IBK A;  4DSF A;  5GMD A;  3H25 A;  3GWC A;  4KRW A;  4LF6 F;  5HBM A;  1MRO A;  1S7H A;  2DVI A;  4PQU B;  2F9D A;  1SPB P;  4FN5 A;  4YR2 A;  5KFM A;  3M32 A;  2GGP B;  4OIX A;  1RKJ A;  2KZM A;  1HR0 J;  1B0P A;  3W7B A;  4RWW A;  1RTI A;  2GMJ A;  2ZOM A;  4DL7 A;  1UET A;  1Y10 A;  5T14 A;  4DR2 F;  3OSP A;  5BJR A;  1ZS6 A;  3GIL A;  2ERR A;  1X5O A;  4KYZ A;  3PDN A;  1YJT A;  2BJD A;  3GSD A;  1WOO A;  3IAS 9;  5BR8 J;  4CM0 A;  5IV4 A;  1Q86 T;  4NE9 C;  2H54 B;  2AHO B;  1HI1 A;  5EWF A;  2ZDP A;  2NUH A;  2AU0 A;  2RIJ A;  2ADC A;  4N41 A;  3KG0 A;  3MM8 A;  4X4P A;  2HNZ B;  1TKT A;  3CCW A;  3CNQ P;  1LWE A;  4NLR A;  1ULR A;  3M6X A;  1S72 S;  2PEB A;  1U0H A;  1N5Q A;  2X1B A;  1LKZ A;  2MKJ A;  2OAU A;  2RQC A;  5A8K A;  1VHI A;  5KFW A;  4OZ3 A;  1D0E A;  1FRM A;  1YWX A;  3GP9 A;  3OTB A;  2YNI A;  3FSY A;  2HVD A;  5JVH Q;  4HHH A;  1WG1 A;  1FXL A;  4ED0 A;  4ER8 A;  3CDB A;  4F3Q A;  4XK8 C;  4YP3 A;  1IR1 A;  3QGP A;  3X3U A;  3LF0 A;  2LFV A;  3FSI A;  2DK2 A;  1LEO A;  1TQL A;  2R7T A;  1R0B G;  2KZZ A;  4ANC A;  2FD2 A;  2OEL A;  1UWA A;  2KVQ E;  5KFJ A;  1BHN A;  3EDQ B;  4I4B A;  3G82 A;  1CEZ A;  3BBB A;  5LM7 E;  4EYI B;  3M8Z A;  4HHJ A;  4J9O A;  2QLW A;  2IDL A;  3I5A A;  4OYZ A;  2BJ8 A;  1QAJ A;  2MJN A;  3MZI A;  1UFK A;  2F63 A;  3GZ7 A;  5F41 A;  2BRL A;  4G65 A;  2J6T A;  4A8X A;  1Z2L A;  2J0X A;  2R2T A;  5KFE A;  4WK3 A;  3LP1 B;  4ZPB A;  3A8E A;  1EKS A;  4PPD A;  1PYO B;  1FXD A;  2EXU A;  4I1T A;  2DXD A;  2FJW A;  1NK4 A;  1Q7L B;  4DR7 J;  5C7P A;  2AYE A;  4P6Q A;  5J2Q B;  5DGB A;  4FKY A;  2FQQ B;  3VVT A;  1F5A A;  4K2X A;  4LVO P;  1SJR A;  3P8B B;  3CUL A;  2D3Z A;  5J2M A;  3B6B A;  3EJM A;  1FDD A;  3M2V A;  4LSN B;  2X1F A;  3KHL A;  4ZS6 A;  1UVM A;  1K0T A;  3IN5 A;  2R8K A;  1PIE A;  4F2S A;  1PC5 A;  3IWN C;  2NUU G;  2JNJ A;  4JI7 J;  4UUX A;  4OFZ A;  2UUW A;  5K20 B;  3V2U C;  3RJM B;  4IO9 Q;  1D8Z A;  1FVQ A;  5GAG U;  2HGL A;  3H5S A;  2B6A B;  5D4O A;  1UZD A;  4F67 A;  2J0Q D;  2RQM A;  1Q5V A;  1LW0 B;  3DXB A;  3LP2 A;  2DIU A;  4DHV A;  2RS2 A;  2D9P A;  2M4M A;  3H2U B;  5C42 A;  1FA0 A;  2A10 A;  4JI3 F;  2Q3P A;  2OD6 A;  4YY3 J;  1YLX A;  4CLF A;  1IBK F;  2UVR A;  3ENA A;  1P6T A;  3HXM A;  1TZ0 A;  2RB7 A;  3ZZY A;  4QYZ K;  4P10 A;  4CLU A;  2MPU A;  4ICL A;  2RKI B;  3FKB A;  1HBU B;  1XWL A;  1S6O A;  5L1K A;  1BQM B;  2HQC A;  4ILR A;  4UST A;  1H98 A;  3DLK B;  5E3Q A;  3TUP A;  3ZZZ A;  2VBX A;  1RP5 A;  4NXN J;  1VRU B;  4URG A;  2APO A;  1VQN S;  3UO0 A;  3EPG A;  2BAN B;  4Y2C A;  4A8W A;  2V2K A;  5IS2 A;  2KH9 A;  2ZC4 A;  1TV6 B;  3MTK A;  3W5Z A;  3NGK A;  2ZHA A;  2BBE A;  1E6Y B;  3IMQ J;  4MYU A;  2V2Z A;  2R8I A;  4O4G B;  4Z7C A;  4U7U D;  3NMA A;  4NXM F;  3UE2 A;  4LT6 A;  4KO0 B;  1IBM J;  1QE1 B;  5HI7 A;  3MD3 A;  1QAI A;  1MMD A;  2HS3 A;  2LA4 A;  3CCR S;  2QL9 B;  3Q8V A;  4RO0 A;  5A8R B;  4X4N A;  2MB0 B;  1DQA A;  1CUL B;  4KC5 A;  4AFF A;  1XTZ A;  3CED A;  1VQO S;  3QRQ A;  2KKH A;  4OYI A;  2PA3 A;  4RR5 A;  5DRK A;  1SKS A;  3CJK B;  1V6H A;  3BJY A;  4S0M A;  2B8P A;  2P2C B;  4UW2 A;  3D3B J;  1N34 F;  2IJR A;  2AWZ A;  2FIU A;  3PFE A;  1VK3 A;  1XMO J;  4TQR A;  1EHW A;  3M30 A;  5HVF A;  4IFY B;  1LNQ A;  4ZVE A;  1SCJ B;  5LJ3 Y;  2YKQ A;  5F8N A;  3P45 B;  5EN1 A;  1P8G A;  1HKA A;  4KGZ B;  4ELT A;  3R1H A;  4CLK A;  3QRR A;  2P9C A;  2PGC A;  3MDF A;  1KN6 A;  2AT1 B;  2O1P A;  2FJX A;  3M8W A;  3CO9 A;  4KV8 A;  4ZVH A;  3UCZ P;  1IQZ A;  3SDE B;  3OLB A;  4UZC A;  4B9T A;  5L46 A;  3MAA A;  1U7L A;  3PJ9 A;  1EP4 B;  4MIW A;  5LL6 d;  1HNI A;  2P6T A;  3KHH A;  3NCP A;  2XZD B;  3ADA C;  2VG5 A;  2J9D A;  3R5D A;  2C1E B;  5J1N A;  3MWB A;  3J7Z 5;  5K14 A;  1Y11 A;  3PW4 A;  3OTD A;  3HHK A;  3V4I B;  2R7O A;  1KKH A;  1ZA2 B;  5BYQ A;  5IM0 A;  3MEG A;  1K47 A;  1GNK A;  4MFB B;  1UJ4 A;  2G13 A;  2E5G A;  3ETM A;  3BQ1 A;  1DLO B;  2WVB A;  1C1C B;  4USJ C;  4OJ1 A;  5CCM A;  4IUF A;  3NGU A;  3VR1 A;  2PI5 A;  3E51 A;  3FEY B;  2CWK A;  2IRX A;  3DOM A;  1O6X A;  4WXW A;  4NML A;  4K4V A;  4Y6I A;  1ZA1 B;  1Y00 A;  2HK2 A;  2CA9 A;  4OHX A;  4RUC A;  3CC2 S;  3HVR A;  2EVZ A;  3EVM A;  2QRR A;  4IOB A;  3CWJ A;  3MUM P;  4XPE A;  2O3D A;  5MLC V;  2CXE A;  3A3O B;  4ZCI A;  2BX6 A;  4ZP6 A;  3QAU A;  2CVI A;  2QC3 A;  3JS9 A;  4NA3 A;  2ZDO A;  3POT A;  3JTN A;  1HNX J;  2UUB F;  1U24 A;  5ETS A;  1RCO B;  1S6Q A;  4WFN Q;  4DV3 J;  1CG2 A;  3KJV B;  1VC0 A;  2E9T A;  2ZNY A;  4FYX B;  1Q81 T;  1CS4 A;  4A8Q A;  1SJ3 P;  3MMC B;  1JB0 C;  4CLY A;  2Q6C A;  5AE1 A;  4KT0 C;  1VS3 A;  3DLH A;  2A2D A;  3RUB L;  2DO4 A;  2GVD B;  4JI8 J;  2G2Z A;  2MZQ A;  3K5P A;  3VHQ A;  2NZC A;  3BGO P;  4O3N A;  2YNF B;  2MST A;  2Y0B B;  1JNR B;  3DDN A;  3G86 A;  1RAC B;  4USV A;  3U1M A;  4X66 F;  2V8V A;  3UN2 A;  3G9C A;  2E1C A;  2JEJ A;  2V4Q A;  1OYE A;  1JIH A;  5A0Y A;  4ATN A;  3CCM S;  1YZ7 A;  5HO4 A;  1RAJ A;  1UA0 A;  1QTM A;  1U0S A;  4RW6 A;  3ZTR A;  1KWM A;  3BQ2 A;  3GPA A;  1SBR A;  3OUY B;  1XBW A;  1IKV B;  2HGM A;  3AXM A;  5C2C A;  5DG8 A;  3CDW A;  1TKD A;  2M2B A;  4YDD B;  5HL7 Q;  2VAS A;  4ZIW A;  2GVZ A;  5HQM A;  2GCF A;  4C8Y A;  2UXD F;  2XI2 A;  5H9E J;  1AZS B;  1N33 J;  2WVF A;  2UXB F;  3D6H B;  2E9R X;  1X9S A;  1NLK L;  1NAQ A;  4NLD A;  5D3G B;  1SUQ A;  1WAC A;  3TQE A;  1CQM A;  1IVZ A;  2HNY A;  1JNZ B;  1JK9 B;  4B3S F;  2FVQ A;  1SJQ A;  5T41 A;  2CJK A;  4USW A;  2G1H A;  4HTI A;  2ZZN A;  1S59 A;  2MZS A;  5ADZ A;  4ID5 B;  1TFY A;  3DM2 A;  2GA7 A; 
#chains in the Genus database with same CATH homology
 3QRQ A;  2Y9H A;  4U7U D;  3QRP A;  2Y8Y A;  4DZD A;  1WJ9 A;  5H9E K;  2Y8W A;  5CD4 A;  4QYZ K;  3QRR A;  5H9F K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...