5CD4A

The type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
199
structure length
199
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/rna
molecule keywords CRISPR system Cascade subunit CasE
total genus 26
structure length 199
sequence length 199
chains with identical sequence M
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 5cd4A01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5cd4A02
3QRPA 2Y9HA 4QYZK 3QRQA 1WJ9A 4DZDA 5H9FK 5H9EK 3QRRA 5CD4A 2Y8YA 4U7UD 2Y8WA
chains in the Genus database with same CATH superfamily
3R5BA 1C0TB 1VHFA 5D4NA 4DFMA 1MG7A 1S10A 1D9FA 2EVZA 4O0NA 3UD5A 3C2PA 3OJUA 4W98A 3I0SB 4DXLA 2EW9A 4ETZA 1IBCB 2L41A 4KKOA 1M90T 2CPHA 2KI2A 4DI6A 4MMOA 3GJSB 2BM0A 1KKHA 2IVYA 2KT2A 4FYYB 5F3TA 2VH7A 5KG3A 1KQSR 4DR3J 1H98A 1QSYA 1Q81T 1AZSA 3R3TA 4MKVA 2KM8C 2G2YA 1XC9A 1JK9B 1SIWB 1RE1B 2LU1A 2GQ2A 2Q79A 2QTWA 3AD9C 1WC0A 2IIHA 4HTIA 1RAAB 2JC1A 4B02A 2OH2A 1EP4B 4ECRA 2VDHA 1T3OA 1YRUA 1WC1A 3A13A 2KYXA 3J7AN 3VVUA 4WKRA 3ZZYA 1KBRA 1HBUA 2PO4A 2CVIA 2B8PA 3CJ2A 3ZZZA 4FKYA 4DLEA 2G1DA 4IH5A 5FDLA 2AYGA 3M2VA 1ELOA 1N56A 1TFWA 2OHDA 3Q8YA 3MPDA 3QZ7A 3KFWX 4GMKA 5F41A 3OTDA 1GFWB 1GMWA 4B17A 3G8TA 2AU0A 1JLCA 4O3QA 2EC0A 3N0VA 1U7LA 2JLEA 4J9LA 2IM0A 3GU0A 1WUUA 3W8GA 4DUZF 1URRA 2HSEB 4DL5A 4B9VA 4DSJA 2C2MB 3R8YA 2ZHOA 2Y0BB 2FTRA 1VIOA 2VFTA 2C2DA 2AX1A 3KHRA 3V2UC 3FCHA 1MWYA 3G8QA 3D0IE 4RW8B 3PFEA 1RBOB 3PYFA 4KSEB 1ZAWA 4OHWA 4ZPVR 1OY6A 2KT3A 3W5YA 2MKKA 3A8KA 5KG0A 5HQ8A 1F9FA 3R2CJ 4M5DA 1FVQA 1T03A 4ILMA 4PAAA 3CO9A 4OQJA 3ENWA 2DNMA 5L8RC 4I64A 2WSCC 5KG1A 4F4AA 2CZ4A 2QGFB 3ENQA 1IBMJ 4O3RA 4H4OA 4FS2A 4OYIA 4EZ9A 4IDKA 1FTRA 1U2RA 2E5IA 4J37A 2WCXA 2E29A 1FEEA 1GMVA 1WF2A 4DQIA 3MCNA 1YDLA 2ZKTA 2QYCA 2U1AA 5F8MA 2CQDA 3VZHA 4K4UA 2GVDB 1Q5VA 1V6HA 2KVIA 3K8WA 1SIZA 2RS2A 3L7PA 1F2HA 1Z1ZA 5K5MA 2GHWA 1C1CB 2F9DA 3KK2B 1VRUB 1F9HA 5J2MA 5HP1A 5D78A 2JLGA 5I42A 4ZPDA 1LXNA 3ZZPA 2X7IA 2OPQA 3V81B 1WOOA 4NCBA 2FJDB 4HDHA 2VA3A 2NSCA 2ZNZA 4FDFA 4C2MA 1VRTB 1NNDA 3MMBA 4DG1B 3MEDA 3WBZA 3GMGA 2MQ8A 3HLUA 3Q83A 2J0WA 2QL9B 2V4JB 2DHGA 3BN7A 4NCGB 4YB5A 5A8WA 4LR8A 4G1PA 5CYQA 3T9NA 3BO3A 1RABB 3MCSA 4RUHA 1CEZA 3G4SS 4I2QA 2ASJA 5HBMA 1DFDA 5K20B 2UP1A 3GFXA 5C2CA 2CQBA 2RHSB 3W2WB 4DN0A 5AXNA 1VDHA 1YJUA 3C6UB 5IQQA 1WACA 3RJMB 3VZIA 2CDRB 1RWUA 3M7VA 2XZDB 4PCQA 2UVWA 5E3QA 2X1FA 2OSRA 2I2YA 3TRGA 3PW5A 3RZAA 1WC4A 4OV6A 2CPYA 3CEDA 3MUVP 2AHOB 4W4MA 1RT4A 1YHQS 4KTQA 4IFVA 3PRDA 3FJ2A 2QMWA 1WKJA 3W64A 3LF0A 2AEJA 2M88A 4NLOA 3NCQA 2CPEA 1HYSA 1RTIA 2RF2B 4U8VA 4OZ3A 4ECZA 3HHLC 2RRBA 4DR5F 1VIXA 1LFWA 2LQ8A 4OHYA 2N7YA 1HBUB 3PW0A 1UA0A 3UN2A 1NO8A 4MFBB 3TZYA 1K1SA 5KG5A 2NUHA 4IO1A 4ECTA 4JI2J 3EPGA 4V19X 2OD6A 3GB0A 2BW2A 4AQYJ 2P2CB 3HPOA 5L1JA 5J1EB 2F1FA 3AHPA 2CQ0A 4I56A 3PR5B 2EFQA 1WHYA 2CJQA 2FUG9 2R4FA 3GLJA 5DQIA 4CIOA 3Q0AA 4DUTA 4DFKA 1RYRA 1S0OA 3GV5B 1JJ2R 4HDGA 4WZQA 1HI1A 1DTQB 4NMXA 3D6TB 4OYPA 1KOOA 4Z7YA 1S99A 2HQ3A 5L9XA 5BXIA 2ZH2A 2C3OA 1BQNA 1L3UA 2I1RA 2ZWPA 3LP2B 3N6MA 4JI7J 1MSWD 3B78A 5KT4A 3EX7B 2MGZB 3BKUA 4FS1A 4B9NA 2ROEA 1OY8A 4C3KA 1FJ7A 3TJ9A 4DV5J 1NXIA 3AOAA 3OT9A 3RBEA 1XK8A 4OI0A 3AY0A 4IG0A 4C8OA 4B9LA 3ELHA 3UCZP 2HYIB 2DISA 3M8WA 1S5ZA 1KFDA 3BV8A 2F3JA 1BQXA 1CJUA 3T6BA 3EZ5A 4WP3A 4JOUA 4F3QA 4OZ2A 2GNKA 1UZHA 3KNGA 5AE2A 1IM4A 4RW9A 3EXCX 4DV4J 4NPOA 3CXCR 2CZ9A 4C8NA 2MSTA 3FC9A 2CQHA 2A3JA 5K14B 3MM8A 3MFIA 4J9MA 3FZ2A 3DGPB 2K7JA 4LQ9A 5I42B 5AJ3F 1K0TA 4OJ1A 2J9DE 3OTBA 2A0FB 3FK4A 3HF5A 3C15B 5KFYA 3W8PA 4XIUA 3VTIA 1RWMB 5M2UA 4YOEA 3UN5A 2DHXA 4ERDA 1H74A 2VF3A 3C14B 3FEZA 2GAHC 1S6UA 2JOQA 4W90B 3WDOA 4OYOA 4I1TA 3V6KA 3R1LA 2V8VA 3FMWA 4X4QA 1SJFA 4A8FA 4LF9F 4GKKF 1HMVA 3QRQA 1QY7A 4WXWA 1FK9B 4G1QB 3D6FB 4WFZA 4N41A 1LKZA 2IPOB 1VLOA 3IR5B 5F0WA 4X65J 5MLCV 1SVDA 4Y3CA 3MD3A 1AT1B 1S9GA 5KOXA 3OUYA 1AW0A 2XMKA 4CDIA 1BHNA 5HP1B 3DRPA 4P71A 1RP5A 4O3NA 4DV4F 1KTQA 3ZNJ1 1S12A 5A2QY 2YKAA 2UUAF 3NGTA 3Q22A 4PG8A 1N5YB 3BGFA 1W2BR 1QD1A 3ZZUA 3EJMA 1VK8A 2KVQE 2ZJRQ 4N7TA 2GJ2A 2E9RX 1RT7A 3GG1A 3KNAA 1M1GA 3CDEA 4DPOA 1KC8T 1CSJA 3KG1A 3P6YC 3BR8A 5E5NA 5KFIA 3UCUP 4PQUA 1YIJS 1E6VB 3ISNC 3D0HE 4PR6A 4X66J 3AT1B 1VC0A 2XI3A 4P2SA 4ZN3A 3B54A 3NS5A 3V6JA 3PX6A 2VV5A 4USWA 4DR1F 2K2PA 1JLBB 3EYZA 4PRFA 1XMBA 1O8BA 2NS1B 5AXLA 4B9UA 2H54B 2HQGA 2MLYA 3EDQB 4XAKA 1PSDA 3BQ2A 1FD8A 3HFZB 3H40A 1VCTA 4J7CA 2C42A 2HBYB 2JJ4D 1S0MA 1HBOB 1KQGB 2Q43A 3LALA 1TUVA 4O4RA 1U1LA 1PIEA 1AUSL 1GMWD 2ERRA 2W9BA 4NLUA 4DR6J 2QMXA 2MY8A 3FRZA 3ETOA 1YBTA 3CTRA 1SJ1A 5ETSA 3RG6A 4RW7A 3CPWR 4AL6A 4AYBD 2VOOA 3KXDA 3GG0A 4LFAF 2BKPA 4ZVQB 1S6PB 1P27B 3B6BA 4EUVA 1RT6B 2UV8G 3W2WA 3DYAB 5M2PA 1REVA 3GILA 1NJIT 2X1BA 4Q8FA 1OPZA 4PWWA 5J1NA 4WU3A 3O2IA 1JIHA 2W2PP 3FQLA 5RUBA 4ED7A 4USJC 2LA6A 1P1LA 5A6WA 5C5JA 3G6YA 4I4BA 2EG1A 2VUGA 5GMEA 2EFGA 1KN6A 3BH7B 3CD7A 2PN6A 4OFZA 4XDCA 3G9CA 4WFBQ 1EB0A 2W1BA 1GXLA 1TMJA 5HVFA 5E33A 1Q16B 3OHAA 3HT0A 2KFYA 3N6LA 2C22A 4NLDA 4OYZA 3NP5A 4DQSA 2MQQA 2LECA 3JYTB 2QA4G 3PY8A 1RWNB 4U6PA 1JNZB 3E8OA 4KH0B 2FLOA 4N77A 4NOHA 3BH6B 2DGXA 1PC4A 3SQGB 1HKAA 4CYUB 5LMUJ 4FF1A 4O3OA 5B0BA 3C6TA 2XB2D 4B9MA 2HRUA 5GVQA 2CQPA 4HH0A 4KC5A 1PO6A 1C1CA 4Q2MA 4OLOA 1F5CA 3MURP 4DR2J 4NXNJ 1DURA 3UD4P 4WK3A 3OSNA 1A0OB 1S6QA 4LBHA 4ZLLA 3QIPB 2GAGC 3SEOA 3RW6A 1SV5A 2JZ5A 4C7QA 4NA2A 6FD1A 1VOMA 1S49A 2HFZA 2XHWA 3FBBA 3MEDB 4KBIA 5KFQA 2MSSA 1E6YA 3ILIA 4XDDA 6AT1B 4LVOP 2EXUA 2WVBA 4KPCA 3BSCA 5A8WB 2W9CB 2CQ2A 5EGYA 1JWWA 2R2TA 4JI0J 1NSQA 5D0GA 4DV1F 3CC4S 2HNYB 3HFVA 1F5BA 3HVTB 3R7BB 4PG4A 4USIA 3C15A 4YB6A 3S1TA 3S6EA 2FZKB 4YN3B 4JYAJ 2XGPA 3D6HB 4UZCA 5KG7A 2DR9A 1SJQA 2E5GA 2BMBA 4WFAQ 4F36A 3JB9k 2B5JB 4JV2A 1MROB 3KJVB 1R89A 2B43A 3P45B 3TA0A 4HR2A 4JUZA 3W1YC 4NA1A 4RW8A 4DS5A 2NR0A 2XLIA 1LWFA 5GAEI 4HT7A 1M5KC 5C42B 1JLQB 2R7UA 1S7IA 5B0EA 3PVXA 2AT1B 2J7KA 3UCGA 5D0EA 2M7SA 2BANB 5AT1B 3CVKA 5K14A 2I5JA 2ZJQQ 1QAIA 1VQ7S 3AAWB 2BOAA 4U8YA 2HFOA 4Y2MA 3RAMA 2ZZMA 4LMZA 3HX9A 4URSA 2J9EA 4MFBA 3ZZRA 2OTJS 1KQFB 2XO6A 2NXJA 3PEHA 2R8GA 4V19J 3NNAA 4DUYF 2QLXA 4Q8EA 4WU2A 5KOWA 1IJFB 2UXDF 1Q82T 5FLXY 2D3ZA 3PDNA 1HHQA 4WFXA 4YEAA 2HIQA 3Q8RB 4KFBA 2ADCA 4PQUB 2GIFA 4H54A 1DTQA 3KMQA 3HFKA 2W8KA 1C4AA 5B0FA 3O44A 1DLOA 4WWSA 4F7VA 1TVRB 3A3OB 1BQNB 3D3CJ 1UPPA 2B4UA 4LUBA 4R8UB 2GMJA 2DB1A 2JFDA 2WK4A 2HHHJ 2CIMA 4CH1A 4ED2A 4RNMA 1YI2S 2R7SA 4HACA 1RHJB 4A8YA 2A2DA 2ZHAA 2ZVSA 4LFBJ 3KK3A 4A48A 2IAJB 1TL7B 5BJRA 3KUHA 3UFCX 2D9PA 1UEVA 4WIIA 3G82B 2HVZA 2YNHA 5CYMA 4E8UA 3VAFA 3Q89A 4A8XA 1Y00A 3LPYA 2DGWA 3PYGA 5KFMA 5KT5A 4A8KA 3A3PB 5FIIA 3THTA 1U4BA 4M8LA 1AXQA 1S6PA 1VQYA 1X4GA 1XWLA 3DI6A 4FF4A 4YUDA 3HMJG 4JI8J 2BRKA 4RU9A 1CBKA 1JNRB 3DKDA 3Q2SC 4HI1A 1U6BA 5LL6d 1XNRF 3HHLD 1ZA2B 1DQ8A 3C46A 2LQBA 4IFYA 1GTHA 1T9UA 2Z56B 1FKPB 2U2FA 1IUJA 4DUYJ 4P9SA 3EE3A 3RBDA 5CQGA 4M5LA 1BMQB 1MWQA 2DKOB 2JHEA 1TL1B 2OKQA 3DMJB 3G86A 3OFEA 3TR5A 2WTFA 1X9MA 3SI8A 1DRZA 4DQPA 1UVJA 4OJHA 4QW9A 2KM8B 1FNMA 1FE0A 2XMTA 3OVAA 2BE2A 3CDWA 4ZVRB 1S4EA 2ZD1B 4KPYA 1Q7LB 2VC0A 4NRTA 3OSPA 3JQJA 1DBDA 1TK8A 1A6LA 1D3WA 1AA1B 4XO0A 2AEFA 5F0UA 5K8PA 4EZ6A 4ELVA 2ZUGA 1BY9A 4LSLA 1Q8KA 2E44A 2HGMA 4QU6A 1R8PA 1HNVA 1JKHB 3HHLA 1VYAA 5KFKA 1MW7A 2DHSA 3H2UB 4KHRA 3JSMA 2AJ0A 2W25A 4LF5F 3CDBA 4M5DB 3ZZTA 2XS7A 2UUAJ 4C98A 2OAUA 4CT9A 3M2UA 1O51A 3M8ZA 1RTHB 3ETMA 3PJWA 4NLYA 3BB5A 1HBMB 1KHVA 3KLGB 1JJCB 1TL5A 2MKJA 2YPYA 2YQ0A 5KFVA 5CZVA 1IKVA 2OTLS 2UVVA 3PIOQ 2JDJA 2PE8A 2DNQA 2QA4S 4DV6F 1KONA 1MROA 2LFVA 4NYZA 4ZS6A 1HBOA 2Y1RI 3GCXP 4I0WA 2ZBPA 3SFGA 5GAGU 2QEXS 5LM7E 4F8RA 3DRSA 1EAYC 3MOZA 2M70A 3TAQA 4CLFA 4CM2A 4JV5F 1F0XA 2NQPA 3BBBA 1ITPA 2BVZA 3VVTA 3IG1A 5A2QU 3OL8A 2F63A 3OXLA 2JX2A 2VQEF 1TUWA 1I3OB 1FKOA 1RAEB 1RDRA 4F3OA 2DGTA 4NZ7A 3KOAA 3D7SB 3HZGA 1U0SA 2M52A 4J9SA 2W7OA 2E7WA 4DL6A 2E7XA 4I7FB 3DLEA 4ZLNA 2FVSA 2RHQB 1RHRB 3M6UA 4WXOA 1MMNA 1RI7A 1QSSA 3QRPA 3SQOP 1ZAXA 2G0CA 2O5DA 3G87A 3IGVA 3ZO7A 4AD6A 3PACA 3S8SA 1ZH5A 5IT9U 4ZPTR 3D1QA 1HD0A 1OO0B 4NA3A 3UDCA 2HHPA 2GO9A 3DLGA 4IFVB 4DZDA 1FWLA 4QW8A 2KFNA 3MM7A 1OIAA 4QPTA 1DZ5A 1FRJA 3K57A 3FSXA 1NKBA 2B9YA 5D0RA 4ZPAA 2A6MA 4Q44A 3M2RA 1UA1A 1KLNA 1IKWB 4FNHA 2LDYA 4PG5A 2AJ4A 3W62A 4OHVA 1KD1T 2A1BA 2AP6A 2RKIA 3W66A 3LGMA 1UAWA 5EWEA 1YTYA 1O6XA 2EI5A 1CLFA 1KLMB 4YB1P 1NDLA 3TJAA 1GT8A 3V4MA 2FHKA 1S72S 3M30A 1R8CA 1NKEA 3MMAB 2UUCJ 1CJKB 3TAMA 2OJ3A 3J7YI 4YP3A 5MAOA 1PYTA 1FRLA 1QE1A 2EFVA 4DV7F 4B3SF 1HYSB 3MEGB 5DQGA 4GO7X 1F1BB 2IM3A 2M3DA 5SUHA 2IDEA 1S77D 3FDSA 5I3UA 3WIUA 4X84A 5DDPC 3DM2B 2N4DA 1N0VC 4RW4A 4OHXA 3G71S 3NWGA 1EARA 1N8RT 3PO5A 2DO4A 3QJJA 1N36J 1XMQF 2BX6A 4IOAQ 3D0GE 2FJWA 3NAHA 5DG9A 3IRXA 2DR6A 2DGVA 2MQMA 1UFKA 1M5VC 3PW4A 4DPYA 1U49A 4DV7J 1NHUA 4RNNA 3MR6A 4Q0BB 1UZDA 3JSBA 1XTZA 1YJ9S 4ALZA 4ZP9A 2I9SA 2P9EA 5D6GA 2DRBA 2F5GA 3ET6A 3CCVS 3LP2A 1SBRA 3L7UA 3KLFB 4NLSA 5I3PA 1WI6A 2ZH9A 4U96A 1N54B 4LFCF 2IMWP 1DAXA 2GJFA 2V8PA 4P72A 1BGXT 3OR1A 5SZTA 4DX7A 2XWXA 3LOUA 3R7NB 3SQGA 4IH6A 1IBLJ 4F0KA 1XNRJ 3OFGA 2DGUA 1RYSA 4QYZK 1RCOB 5H9FK 3Q8PB 4NLGA 3SBMA 4N8NA 3VWSA 5L1IA 4ICLB 4YB7A 5DQHA 2VOPA 3H98A 4NZ0A 2BE7D 4KGXB 1U09A 5E41A 4ECQA 1SH2A 4IDKB 3IGNA 4QWEA 2XSJB 7FDRA 3OV7A 4B3SJ 5B0GA 4OZJA 1WOSA 2GQQA 3O6QA 3K58A 4ZITA 2HK2A 2ZC4A 3MD1A 2ZE2B 2R8KA 4PKDB 4A4JA 1JLEB 4P2MA 1QLNA 3F0NA 2B51A 2ATCB 3MM5B 1YJVA 3KK2A 1X0FA 3MTJA 2MPUA 3GONA 1EQMA 1HFEL 2W2QP 2Z2MA 2QFJA 2FZGB 4FF3A 2E9TA 2KRBA 3H2LA 3IM8A 1Q8BA 2V4QA 3D54A 1S76D 5A8RA 3IBCB 3QT5A 4TLRA 2DH9A 2FHOB 4MAKA 3TQEA 3QT7A 5I4MA 3VAKA 4HHUA 2F4FA 1C2PA 4PPDA 1XJWB 5KFEA 2KT5A 4IO9Q 1GQEA 3IO1A 4ATNA 1Y9OA 3CMQA 3ZZ0A 1HNXJ 1CG2A 2ATLA 3BN4A 1CJVB 1B0PA 2VJUA 4EYHB 1FA0A 2W7AA 5C25B 3I56S 2IC3A 2L08A 4BBYA 1NK8A 2QC3A 3IG1B 4RX6A 2BDPA 1G7CB 1RAFB 2Q6CA 5EUHA 3JAMY 2MZ1A 2J0SD 3HD1A 1RAIB 1NDCA 1VGYA 4B3OA 3W63A 2ZNYA 4CLPA 3T41A 3DRPB 3O8WA 2IA0A 5AJ3J 2DPIA 2GGPB 2VBYA 2KHCA 1M0SA 2WSEC 5G4DA 3BYPA 2X1GA 1CJKA 2RNEA 2CPJA 1FE4A 5B0AA 3TOQA 3PFOA 2R7WA 4CLSA 2UXCF 1TL1A 3NS6A 3IA0A 4NLRA 3HK2A 4ZVFA 4JI5J 3RR7A 1Y0HA 1WNEA 5IT0A 4NLWA 3THPA 3J80Y 2NYHA 4YS2A 4P74A 1M5SA 5M2RA 4C6AA 2R3VA 3AD7C 3QAEA 4Q5VA 2UU9J 2WVFA 2F4VJ 4R5PB 5ETQA 3KHLA 3HSGA 3QFHA 2J6UA 2YH0A 3CJQA 3HM9A 3TANA 1N34F 4WE1A 4MIBA 3L09A 3G2XA 2HRYA 2F40A 4DPTA 9ATCB 1IKYA 1LV5A 1NB7A 2CQ1A 2D3O1 1QAXA 1UVNA 3IS9A 2J7UA 3BGUA 3CDAA 3NRBA 3OPKA 1R3NA 2LA4A 4C8KA 4ECWA 1TV6B 5T41A 1S1UA 1SB6A 5JUMA 2VU5A 3OLAA 2OEJA 3ZTSA 4DR4F 4QYRA 1TKXB 1U2CA 3FFIA 4QPXA 3HVTA 2QT7A 5IC6B 5AE3A 3JS9A 3VF0B 4ZIVA 1N34J 2Y8WA 4A8QA 4GO5X 3CO0P 4CO5A 3G6VA 2B6AB 4OI3A 1TTHB 1VJQA 5HQLA 3F73A 2IRYA 2BKOA 1JLFB 4PXEA 2Y1IA 4NLQA 4DR3F 1TKZA 1KFSA 3P49B 5IQ6A 2RAQA 4KV8B 1IWAA 3MEKA 2FGOA 3W61A 4CQ1A 3QSYB 4JI5F 2BA9A 2B9XA 1FRKA 1CS4A 1X5PA 1Q8LA 1TL4A 2D3UA 3W9IA 2IVFB 1Q95G 5GAEU 3MR5A 2WB4A 2RJZA 4L75A 2R9LA 1Q79A 3KDNA 4FN5A 4PYAA 2GHVC 2QA2A 1KS2A 4EYIB 3FQKA 2J6SA 4DL7A 4CO1A 3QBCA 4RO0A 2HHVA 2M9KA 5L38A 2V9WA 2E5JA 2VODA 2AKWB 3TARA 5LMNF 4OYAA 1Q78A 3PKYA 3PZPA 3V6HA 2HHQA 1Q5YA 3KK1B 1S59A 1SH0A 2HGLA 2MTLA 4RJVA 3ITHA 4OI1A 3DOLB 5HMYA 2CQCA 2UXBF 2CA9A 2H48B 1HHSA 3NKYA 4UZBA 4QYZJ 1YWXA 3NOGA 5LSOA 1TAUA 1N6QB 2N3OA 3T5KA 4G1IA 2V0NA 3T9ZA 2QA1A 5C2GA 2DNNA 1IBKF 1SJRA 3FUYA 4J9KA 2QRRA 4BC7A 4TU8A 4K50A 4EI2A 2YWWA 4YR0A 4RKUC 2VFVA 1YSJA 4R8UA 5T14A 2NREA 4WPAA 2FD2A 1AROP 2V67A 3ZTQA 1FRHA 3V6DA 4X2BA 5D4LA 4CO0A 2EK6A 2A6OA 1RADB 2GIQA 2V8HA 4QWCA 4USMA 4DMZA 3A3NB 3OVSA 1N5TA 1R6YA 2ZOMA 3I0RA 2DRAA 1JQGA 2BANA 2E1AA 3QZ8A 2EFNA 3CC2S 1AYEA 5CAAA 3MPYA 4Y6IA 2IHR1 1RAGB 2RQCA 1M1KT 2R7QA 3KLHB 3WC0A 4JI6J 4R0JA 1ZA1B 1WEXA 2PMZD 3SYZA 3GYNA 2WVDA 4NXMJ 1NSAA 4Q7AA 4Q45A 4OYMA 1JLQA 1HBNB 3EDRB 3MAAA 3CF5Q 3T1HJ 1ZPWX 3TA2A 2O3DA 1DQAA 3OTCA 5HAOA 4F4XA 1K0VA 4YY3F 3QWPA 5HK4A 3LA0A 1KHWA 3MM6A 1CJTB 1LXJA 3BYRA 3DDNA 2C2ZB 4K0KJ 2ZFHA 4N76A 4K4SA 2R7TA 3IS9B 5B0CA 4ENOA 5EWGA 4PWDB 5HI7A 3RR8A 4DCPB 1X31C 2MLZA 5E0OA 2MQOA 1S1UB 2IJNA 1VQKS 4RWXA 3IRXB 1UVIA 2R8JA 3QJPA 1HW8A 3TJ8A 1LQ9A 3U7JA 4DV3F 2CG8A 4QWAA 2GA7A 2VBXA 4CNZA 2R42A 3RBXA 2OELA 1N33J 2FJBB 3EVWA 3ET6B 2MJNA 3U1NA 5C24B 4GKKJ 2DNRA 2RILA 4YFUA 4KHMA 5IV3A 1N5SA 2WAQD 3I87A 3OFHA 5LSRA 4DSLA 1UVLA 4NYPA 4PZVA 1VQ6S 3OL9A 1U45A 3KHHA 3PW2A 4AT1B 1T03B 3KTQA 2UV8A 1WJ9A 4DBQA 5BYSA 1R0BG 3DNCA 1C4CA 1RCXB 3M6WA 1WTBA 1X9SA 3OVBA 2HHXA 5EX0A 1Y11A 3C19A 1WWHA 3CUNA 1DARA 1FKAF 2PT0A 3I4HX 1JLGA 3DLKA 3PX4A 1AUDA 4DSKA 4KT0C 1FRMA 2XYGB 5DO2A 2JRSA 4WJBA 3MR7A 4UTGA 5LOQA 1T94A 2OMLA 3IFEA 1H6KX 5D77A 3LUYA 1QE1B 1S1XA 2QSFA 1RBLA 5A0YB 3C6TB 1J5OA 4OL8A 4M5HA 1RT2A 2R7XA 3CJ8A 1S0NA 2CWXA 1U6FA 1RLDA 3CJ0A 5GAGI 2WW4A 1ZYQA 4BS2A 1M5PC 4J9NA 1RK8A 3C66A 2HURA 4L72B 2B0GA 2LEBA 1IBLF 2UVUA 3TUPA 2AYMA 2IYGA 3DRRB 2D9OA 3DDIA 3GIJA 3MECA 5GAHU 4LQ3A 5IT9Y 2XULA 2E5LJ 1RT3A 1M1HA 3J81U 1V5IB 2KL8A 3FBFA 5DRKA 3BSOA 1KRPA 1UL3A 4QJVA 2DNGA 1P8GA 2YNFA 4WYLA 4LR7A 2V69A 1I94F 1N33F 4LRCA 4F50A 5J2PB 3I55S 3CW2C 2OI2A 1MWZA 1R0AA 2PMWA 3GIRA 1RJJA 1IN0A 3DLEB 3NY0A 3OXGA 3PM9A 3LAKA 3T6JA 3VR1A 2HFSA 4C4WA 3ITHB 2DXDA 4CLKA 4ZIWA 9RUBA 4ZCMA 1YQHA 2V68A 3I4PA 5IWAJ 1KWMA 2IMOA 2PI4A 3R9LA 1NEEA 4I6YA 3DRXA 4NEYA 1Y5IB 4ZN1A 4RNOA 1SH3A 5HMWA 2F4VF 4OZNA 2C28A 2KZZA 4QZVB 2JEFA 3QNWB 3BM7A 2KN4A 5KT7A 3T5HA 1FJCA 2J0QD 3CNQP 2VFSA 1X4AA 1TK0A 5BYRA 1W2IA 3A8IA 4H4MA 2J0XA 3CDUA 1CJTA 1ZOTA 4Y34A 1U25A 1FNOA 3LW5C 2LEPA 4NE9C 2PD1A 2NYIA 1CC8A 2H9ZA 4LSNA 4I6WA 4E0DA 2Y9HA 4X66F 3RRHA 3K5LA 3M1VA 4NWBA 2B7CB 3TAPA 2ZZNA 1RKIA 2QX0A 4I2QB 2VG7B 3ILOA 3N28A 4X4NA 4M94A 3M30B 1FTCA 1FD2A 3GQCA 2DY9A 1VC5A 2ZM6J 3ZTPA 5IXUA 3M8QA 3QGPA 1GX5A 1EX8A 5KG6A 3DOKB 4CWBA 4GC7A 2RQKA 4I7FA 1WOPA 2DIVA 3RUBL 4CLLA 2PEBA 4WYWA 4B3RJ 1IQZA 3ISZA 2EFPA 4DL4A 5JMNA 4X64F 4ZJOA 2L3MA 4K2XA 5HVGA 3UR0A 1CULA 5KAKA 4TQRA 2GC8A 2RQ4A 4C9DA 1RWWB 4JB8B 1JXLA 3QFWA 1RHUB 5ETRA 3LWMA 3E01A 4YMEA 2IC3B 4HH1A 3BJYA 5DDQC 1TK5A 3TYTA 4CCHA 3CGIA 3VAMA 1FESA 1Z2LA 2ZHBA 3C8YA 4UOFA 1PYOB 2WRMA 1U02A 3B8HA 3CWJA 3MPUB 3G8SA 5IWAF 4ZCIA 4MK9A 3KLHA 1VQOS 1L5UA 4N8OA 4ZPWR 3J80U 3ULHA 2YKPA 4LJMA 3M32A 3CCJS 4PUOA 2DJWA 2BJ8A 2XLJA 2V63A 4ED0A 2W4DA 1R8HA 2BXJA 3CCMS 1PKUA 4F26A 4QU7A 4O44B 4MJKA 3MM7B 4FP9A 3TAMB 4CLUA 4DLGA 3FCVA 2V94A 1IBMF 3HHKA 4MTPA 4ANDA 3MM6B 2AD9A 4AXJA 2BV3A 3GFZA 2C2KB 4LSZB 3R2DJ 1RHMB 2OPSA 1S0VA 2CUYA 2DNOA 3D66A 3KYLA 4F67A 3R5AA 2IJRA 3MMCA 3BGOP 1I51B 2LEAA 4P10A 4Y2AA 4DV2J 2YNGB 2FGCA 5HLFA 4C0BA 3HCXA 1KLMA 1HQUA 3CE8A 3LO3A 5IV4A 1H2TZ 2XY5A 1VLYA 1SQGA 4K5RA 1O5JA 3TWZA 1G2EA 3HKWA 3PYEA 4AXIA 1U1PA 2DEIA 5KFFA 1WG1A 3K5PA 3EPIA 1VBZA 3JAMU 2HQIA 2EEYA 3BGRB 4NLTA 2XO7A 1S1XB 3ADAC 3VALA 1TKXA 1LWCB 3FFIB 4OI2A 4OYWA 1S4FA 4RWWA 4AE5A 4GKJF 1UVKA 2MLXA 2FC9A 3UDVA 3WQPA 3KG0A 3MI7X 4F0HA 4CO4A 1VBYA 1HHTP 4NZ6A 1S1VA 3K7RA 2GX8A 1GMUA 2E5HA 5HATA 1TUGB 2VL1A 4TNOA 1Y4ZB 2HNZA 2ZBCA 2H1YA 2Z0GA 3BSNA 4ZPBA 2XMJA 5DM6Q 4I6AA 1YRXA 3R5DA 4FYVB 2F8HA 4L3NA 4DV6J 1AB8A 1RSCA 4B3OB 4K0KF 1PGZA 1LW2B 4WZMA 5ETTA 1RAHB 2KU7A 2V2VA 1RKJA 4LF4F 3I5BA 2XSFA 2UXDJ 3MHYA 4O4GB 4U7UK 4JI3F 2VPZB 1GNKA 3I96A 1VS3A 4HI2A 1H3DA 4ECUA 3TX8A 5G0RA 3OUYB 3TQ1A 3E3XA 2XNQA 1ZM9A 4PYDA 2HZAA 2QL7B 2NXNA 2Z2LA 3ISND 4EO6A 5LXRA 2EK1A 1RACB 3MMJA 3CJ5A 3AD8C 4MT1A 4IR1A 1FK9A 4G1QA 1LWXA 1ACMB 1Y10A 2QLFB 5FJ4A 1BUXA 2EKYA 2DEJA 1I5OB 1N32F 3JTOA 4LSNB 4FYDA 1UWAA 1WEZA 2CFXA 2ZITA 3KLIA 5C25A 2CVEA 2B9WA 2OFHX 4LRBA 4ZLPA 1S48A 2RS8A 1VBKA 2YNIA 2PDAA 3L9ZA 3RU0A 4DV0F 3BEGB 3GCWP 5DLFA 2UUBF 1UVMA 1X4BA 3CULA 1QAJA 1B0TA 1R8AA 4RNHA 3I0RB 4Q2LA 4OHZA 3NMAA 5DETA 1JLAB 2VDIA 4Y2KA 1KTVA 2MKYA 1MN9A 2MEWA 4YY3J 3T5LA 5ADZA 3C3LA 1GH8A 4ZP6A 4CTAA 4O0IA 1B7YB 3I31A 2ZBIA 2BACA 1TELA 2CYYA 1RQ0A 2BJ9A 1JLFA 4QIFA 4WCEQ 1FHTA 3FNNA 3BO4A 4UQGA 2CJBA 2IRXA 3A8JA 3KK3B 3OBIA 2UVRA 3D9BA 2XQCA 2MDAA 1KR4A 1WD6A 2W2NP 1TL7A 3DU6A 3HSZA 3IAS9 4LFAJ 4CH7A 4UT4A 4WE1B 2CNNB 2YKOA 1F9EB 2IRUA 3I0SA 2YNHB 5E3CA 3SDEA 2HHHF 2LU2A 5L1KA 2QO3A 3VGUA 3VV2B 2WB1D 4UOCA 5KFOA 3DHXA 2CPZA 1X4FA 2ZDPA 3D4JA 4PWDA 4RLEA 4Y65A 4QWBA 1A9NB 1XERA 4PG6A 3CD6S 1S79A 4ITSA 2G4BA 2HEKA 3CD0A 1RT3B 3AOBA 3MR3A 4JI4J 3DFEA 3EGZA 2AMCB 4RW7B 2W8LA 2UUWA 1FDNA 3R1HA 2CWKA 1RWOB 2FJEB 3PEJA 3CCSS 2HAFA 3ILJA 3KDOA 3N9UC 4H4KA 4DCOB 4K4XA 4M5MA 1X60A 2MYFA 3NEKA 2LP4A 2YKNA 2RIJA 1JB0C 3I5AA 4NI2B 2N82B 2KG1A 1SKWA 2E5LF 4F4ZA 5EDWA 2BQRA 4IOCQ 3HSJA 1IQTA 4LBPA 1NJWA 4TY8B 3LPEA 3KJFB 4LIRA 1B70B 2BZ2A 1HNIB 1CVJA 5ITHA 3MAQA 1NK4A 1TMMA 4OYXA 3U27A 2W9CA 2QMUB 3LQVA 3PHTA 2AIRB 2F9JA 2MHNA 1U8WA 3IR6B 2DVIA 1GEHA 2PFFB 4TYAA 2BUNA 3HDSA 4M95A 3M9OB 1JLGB 3DLKB 5H9EK 3R5CA 4LF8F 2DK2A 2YWHA 3CJ3A 5KFLA 2H5EA 3TA1A 2I38A 4HHHA 5DLGA 1ZZNA 2RU9A 3I32A 1RT5B 4RNFA 2V2KA 5LXYA 2R2RA 1UFWA 3FMBA 5BR8F 1VQMS 3CJTA 2XI2A 2DXFA 2HNYA 1WC5A 4L74A 4ZP7A 5HMXA 5GADI 5ETMA 2GVZB 1FF2A 3UD3P 3MUTP 2AEMA 4LF6F 4LRAA 2DNYA 5IT4A 1ULRA 1RZMA 2OPPB 3DXSX 2CJXB 4CLTA 1HMVB 2PGCA 3MCMA 1FDDA 4EBEA 3U1LA 4ZVGA 4DX5A 1FJGJ 1KVKA 5CD4H 2VASA 3OR2B 4ZPCA 1R7IA 2J9CA 1HBMA 3KLGA 3LAMA 1YITS 4Z2XA 2VICA 2NZCA 4DDFA 3K5MA 1OQ6A 2M2BA 5ETPA 5J1PA 4XPEA 2HWHA 4NXNF 1R6VA 2OEKA 1GTEA 1WKKA 2CRLA 3GR0A 2RDJA 5LT5A 5L1LA 2PI5A 4YQWA 4HHJA 3GJRB 3DOLA 3IAM9 2KJWA 1WHWA 3NOCA 1DHMA 2AW0A 1B4SA 2H3EB 3JSYA 4RBVA 2R2SA 4QIEA 4ES1A 4CTAB 1SPBP 5CCLA 1RBAA 2G2OA 5BYQA 4B3MF 3AB2B 2NZ4A 5EHHA 1UETA 3HHEA 1KDNA 2UUTA 4DEZA 4ZVHA 3LWLA 2HWTA 2ILZA 1UW9A 1CQNA 2MHEA 1VK3A 3MUMP 5HN0A 2AX0A 2EPIA 4BHQA 3MPVA 3M9NB 3AH6A 2JEIA 1SL1A 3BS9A 4QIGA 1NK6A 1BWEA 2LQ9A 5K8NA 3NBPA 4KO0B 3RB4A 4IFYB 4ZVPB 4C0OC 2VJVA 1Q8IA 3N79A 1U47A 4LF8J 4DR6F 2VPYB 3K2YA 1B3TA 1XMOJ 5HQMA 1URNA 1FDBA 4U9RA 2CAJA 2PC6A 3PO4A 4FBTA 3W5ZA 2V2QA 5BR8J 2AJ2A 2QLWA 2FY1A 2WVCA 3MDFA 3TVZA 3IWLA 3EMTA 2IA6A 3DLLQ 4S0MA 2HPUA 1X7VA 2MZTA 2W4CA 3D28A 3QT8A 1HPZA 4F2RA 4BCAA 5KFWA 3W9JA 2HVHA 2ZD1A 2CJYB 1BQMB 2GJIA 2L48A 3DI6B 4M1KA 3AXMA 3BGRA 2DRDA 2G2ZA 4UOHA 2W2OP 1HWIA 1UJ4A 1LFPA 3KUGA 5U47A 1WG5A 2MKSA 2FJAB 4WFYA 5KT2A 4FXVA 1T8EA 1IKYB 3QGHA 1F5AA 4IKAA 3SSRA 1HWJA 1T9WA 3HHLB 4NRUA 2PIIA 1FX4A 1K44A 3E01B 4LR9A 3RGIA 2MGZA 1N5VA 1R0CB 2GQCA 4I2PB 4J9RA 1VHIA 3T1YJ 1HNZF 1HNWJ 4KAIA 3ZZOA 4R0EA 2GHPA 4E98A 3MR2A 3PCOB 3RAQA 2HQFA 1N36F 4Y0FA 1YJ7A 2DTJA 4OX9F 1DTTB 2E1PA 5CYMB 4JI6F 4ECVA 2DO0A 1OPIA 1A7GE 1JLCB 2A10A 1MLAA 3AQOA 3IXQA 3SCLE 5HVHA 4WTYA 4CM0A 1WTFA 2RSQA 3CCES 3PJ9A 1D1UA 5D8HB 5ETOA 1LW2A 3BSAA 3IRWP 4DR5J 3DRYA 4LRFA 1IKVB 2H4WB 3CJSA 2D1CA 1FFGB 2BJEA 4IG0B 2HS3A 3CCQS 2RRNA 2CDQA 1EHWA 4CP5A 4KV8A 3QO9B 5DJBA 1HNWF 3EUNA 1N0UA 5HJXA 1MU2A 1BD6A 1HARA 2M4MA 3L4BC 2M5YA 2OPPA 3EICA 4JBCA 3DRSB 1FKPA 1HNVB 3QIPA 2H5IB 3L95X 3QSIA 4LRDA 2DGSA 4LVNP 5J2NB 1GXTA 1RAOA 5JVHQ 1NK0A 2ZH7A 3GP9A 3M8RA 2YNGA 3BQ0A 1RT1A 4JI8F 1V3ZA 1RTJA 4F3MA 1B99A 5FLXU 2HZVA 2QG9B 2QN6B 2I0XA 4A47A 1WEYA 3DLJA 3FZBA 1FWPA 3EM1A 3MM9A 2AV5A 4ECSA 1RTHA 1X4CA 3H42A 4CO3A 2CADA 3KLIB 5KFJA 1WELA 3PR4A 3KJQB 1K9MT 1NSPA 3O1LA 3RB6A 3W2VB 4MH8A 1FWKA 1NJYA 1QSLA 2ZH4A 2XZWA 1X4EA 4G65A 4UUWA 1JLAA 4C48A 3MAHA 2AZ3A 3MZIA 1JKHA 1NBEB 4MIWA 1CULB 3DLGB 1LWFB 1IKXB 4WP8A 3BF4A 2HK3A 3TEHB 4DJBA 4NCGA 4RBUA 1WHXA 2ZC3A 4ED4A 3LGHA 2MQPA 3JSMB 1UEUA 5L39A 2WOMA 5K8MA 4EEYA 3TI0A 3CMAS 3AJ1A 1HLWA 4TN2A 5K8OA 5D3GB 1O0PA 4FVMA 2N4CA 2BBEA 3BGLA 4Y28C 3D1OA 3DXBA 4GVBB 1LWEB 1AFJA 2K3IA 3CJKA 4EWTA 2HVDA 3FKBA 1VQ9S 2Z2YB 1RLCL 2Z8QA 4OLPA 1T02A 1Y5NB 3ZXWA 1HR0F 1YZ6A 4C3MA 2EWHA 4K4VA 1EIYB 2OD4A 4P7TA 1QDUB 4FBUA 4QR2A 2VBZA 3UPFA 2D41A 2IYIA 4IRDA 1HBNA 1UWBB 3FRYA 4BDPA 4N5SA 1DLOB 1WSVA 2KRRA 2XTJP 5CD4A 1C1BA 1LOUA 1P9YA 2G0JA 4K4ZA 4DQQA 2DHAA 3NBPB 1PC5A 4KO0A 4GKJJ 1HWUA 2POKA 3UDEA 2RD5C 5HJYA 2B7BB 3FGVA 4HKQA 4TY9A 4F0MA 4B9TA 4NI2A 5KG2A 1JJ4A 2E1MC 3BO2A 4ZKAA 3LP0A 3W60A 1HR0J 2YBVA 3US5A 3PX0A 1IJEB 2Q66A 1R43A 2J7WA 3MWBA 5FDLB 2FDNA 4KYZA 1L3TA 3HT3A 2H4YB 3SV3A 1OYEA 1AZSB 2OMOA 1HQEA 1IR0A 1HNIA 1YLXA 2F8MA 2W01A 4KKOB 4ZP8A 4ELTA 2DYAA 4IRKA 1H2VZ 4AQYF 3GWCA 2KH9A 2QSWA 2D7SA 1REVB 1NH7A 1EETA 2FHMA 3AFGA 3WX4A 2MB0B 4P7VA 5AXMA 5KFCA 2IJFA 4J9PA 4GVLA 1NPRA 4A8OA 4X4VA 1H38A 1SQFA 2KXHA 5GMKa 2BW7A 2LXFA 3JYTA 4NLVA 4CLZA 3I5CA 2JVRA 4KGZB 3U1MA 4AUKA 2NPIA 4DX8H 2MQLA 5KFHA 5B08A 4KY3A 1WF0A 3G96A 1U2FA 4PPZA 4ILRA 2ZH8A 2KHDA 4DSFA 5EN1A 5LJ3Y 1U6ZA 3LTOA 2HHWA 4QCLA 4C8MA 1UKUA 1C0TA 4JI0F 2K1RB 3SDEB 1PJ6A 1UPMB 4UW2A 5KFDA 2DBBA 1S9EA 4USTA 2IBOA 4ZVOB 4HTJA 4CYUA 1HQ2A 3U02A 3KJNB 1QTMA 4QWDA 2ZOGA 3KLFA 2KJVA 3AA8A 1ZZFA 3LGNA 4HYKA 5FD1A 2AYBA 4DPWA 5ETLA 2WW8A 2NXCA 2XC9A 2DR7A 1K47A 5J2MB 2PFDA 4EGLA 4JI1J 2MKIA 4A8WA 3KUEA 1BC6A 3HHNB 2C3YA 2HMIB 3V81A 1SC6A 3BBFA 3B82A 1DQ9A 3VGTA 1VQLS 2C3PA 2RQMA 5IOLA 4XTTA 5HROA 4LF6J 4DF4A 4QIWD 3JTNA 2WOMB 4DR2F 1N4LA 1XQIA 3FEXB 3O3LA 2EFOA 5D3GA 2XLKA 1T9YA 2M8HA 3QGIA 1Q86T 3K5NA 5T7LA 2X3DA 4MKAA 2Z4PA 2CXEA 2O01C 3CCTA 2ZE2A 3UNYA 5LMUF 4LFCJ 4J90A 1RWKB 2C3MA 3HI9A 1MMLA 3JTPA 3DLHA 2ACYA 2Z2ZA 4C8YA 3OFFA 5C7PA 2K7KA 5KFAA 2FLPA 2ILYA 4O4GA 4LF4J 3O5TB 3NNCA 3CSKA 2XZTB 2MQNA 3S01A 2COLA 2HNDA 3DOMB 2HQCA 2YKMB 4M5NA 1IWGA 3QATA 5F9NA 4HEA9 2ZKUA 1Y5LB 2BE9B 1BWVA 2OP5A 3DCAA 5KFXA 3V5RA 2BJ1A 1VFJA 2VC1A 1G4CA 1UJ5A 4CLYA 1HNZJ 3P5TL 1RU2A 5B7WA 2E7VA 2KO1A 1D09B 2HBQB 3PRBA 1YJRA 2KKHA 5J2QA 5ETVA 4YHHF 3GR1A 1F6TA 3ICLA 4I68A 1CJVA 5HL7Q 3GSDA 3UO0A 1T9XA 4KE5A 2GGPA 4DFPA 4JYAF 3IP0A 4LF7J 3Q8SB 3PG9A 2YX7A 2HMIA 1H7WA 3K5OA 1SQEA 2ABYA 3OQ2A 4NLXA 4CH0S 1RWVB 4XPCA 4DV0J 2UUBJ 2DNHA 4MK8A 1FRXA 5F8JA 5IM0B 3RRKA 2RUGA 3IWNC 1B7FA 1OJ4A 2ACMA 1NK5A 1RGVA 3F56A 4PG7A 1XMQJ 1EETB 4X65F 1UWBA 2OEMA 1NM2A 2OFGX 3HSDA 4LT6A 4ETXA 4MKYA 2FLNA 2M8DB 2B6AA 2G0IA 3OL6A 4ELUA 1U1QA 2YKNB 2KB2A 4RPFA 5DDOC 2X3GA 4C8ZA 2BQ3A 1JXEA 4K4TA 3M8PA 2XY6A 2C1EB 3GIIA 1VR6A 1M5OC 3P3DA 1WG4A 1L3VA 2BJ7A 4DHVA 2NXEA 3PIPQ 1JXVA 3PKMA 4B3TJ 3IC1A 2VQFF 2IAJA 3POTA 4RL1A 3GJQB 2QJ3A 1HWLA 1TU0B 5F9LA 5DGBA 3GIMA 2KXFA 3WX8A 2JC0A 2I8EA 1T3NA 3GZ7A 4LF5J 4Y2CA 2Y8YA 2QV6A 4J91A 3EWGA 3THVA 3R6GB 3HJVA 4A8MP 3ENAA 4TU7A 1OY9A 4LFBF 4FPIA 4J5OA 4OJGA 3K0JA 3H59A 4Y00A 1NDKA 2DCLA 1YVFA 3TNVA 1SJ4P 2PA3A 2QIFA 4LREA 1U1OA 3HXMA 5I3QA 3WZ0A 3UNGC 1VQ4S 2FLLA 2E1RA 1HPZB 2BJDA 1FERA 3OTEA 1RTIB 2RF2A 1N32J 1PAUB 5HO4A 4K8RA 1R27B 2FC8A 4ED1A 1PJ5A 4DV2F 2DR5A 2HQDA 1FX2A 1J5EJ 3E2EA 1NCLA 2Y0SD 1ZPVA 2V5HG 1PILA 3RB0A 4ZK7M 5DG7A 3LH2S 2R8IA 3NG8A 4LSLB 3WC2A 1QAYA 4A46A 1ZTTA 4WKYA 2VA2A 3ZFVA 4PXCA 3ZC4A 2HAIA 3OL7A 2MZQA 3CCRS 3J7YU 3HKZD 1ZBTA 3QQCD 4KHPF 2HLUA 1S6OA 5THWA 2DNKA 1IXKA 3CT9A 1PG5B 1XR7A 2F7VA 1DTTA 3CCZA 1U48A 2XMWA 4M63A 2DCUB 3MM8B 5ETKA 4CZCA 3GV8B 2CPDA 5IS2A 2VB6A 1CC7A 4DL3A 2XM3A 1GX6A 3MEEB 2AGOA 1QVFR 2FPHX 3Q8QB 5LSLA 3T1AA 4B3TF 3X3UA 3MECB 2B3TB 5F8GA 4ZVUB 1PAEX 1QVGR 3R7SB 5KG4A 2G1HA 3MXHP 2VD3A 2HNZB 2H51B 3GJTB 3QO9A 4U67Q 2D3OR 2XWYA 2ZVIA 2WSFC 3I6PA 2QE5A 1RB0A 2WZ1A 4IQXA 4TKTA 2RRAA 4FZVA 3NGDA 1VQNS 3H4BA 1IBKJ 4JI4F 2C2NA 4OX6A 4K4WA 3OR2A 4N56A 4IUFA 4M5KA 3UVJA 1VMBA 3E51A 2BM1A 5KFZA 3QYYA 2GO8A 2CPFA 1S1WA 2C3UA 2ALZA 4ED5A 1YGYA 3DOMA 3OHBA 3AJDA 2GCFA 1NPKA 1XR6A 2DGOA 1X8DA 4CI0B 4KB7A 1J27A 3RRGA 3C14A 3F41A 1X4HA 1YX2A 1X5TA 2V34A 3OTOF 4TU9A 2F65A 3UI3A 1OYDA 5DZ7A 1TR0A 3P8BB 3KLEA 3NAIA 4DR1J 1OSCA 1HI8A 4EO8A 4C97A 4B08A 1RT4B 2JEJA 3CIMA 2UXBJ 1G3OA 2HGNA 3ZTRA 2AQ4A 1VQ8S 1R8BA 3TUIC 3TUZC 3Q24A 4X4OA 4DR7F 2L9NA 3GYXB 4NLPA 4JV1A 4I2PA 4WP9A 5LMNJ 3VHQA 2SXLA 2H5JB 1HIYA 2VG6B 5LJ5Y 4KGKA 3CCUS 4DSEA 1WI8A 2EBGA 2HHSA 4OZLA 3B4MA 3QGGA 4B3MJ 1NB2A 5KT6A 1D8YA 2UU9F 2R7OA 2ZOFA 3WHIA 1XBWA 2HFVA 2RKIB 2R7RA 1N5YA 1B0VA 1SCJB 2AZ1A 2CQ4A 5DS7A 1XIQA 3IMQJ 1ZS6A 4NMLA 1YJNS 4FF2A 1RT6A 1CQMA 3QWUA 2ZWOA 1JX4A 1SUQB 1TKTB 2OO4A 2ASDA 5C24A 5HMZA 2QFIA 2HS0A 2Q6BA 4MYTA 3UWTA 4R5PA 1RA7A 1S57A 3LP1A 4J9OA 1FDAA 1OS5A 1U24A 4ZA1A 5E3AA 2JSXA 3IBWA 5DGAA 1EKRA 1EP4A 2VQFJ 2ZJPQ 2FHJD 2GFFA 1RTZA 1WORA 2A2CA 2YX1A 2LYVA 3RTVA 3MOJB 2HHUA 2AGQA 2XG8A 4FXWA 3DRRA 1S1TB 4TVAB 1H0HB 3N6NA 1FXLA 4JI3J 1SV5B 4IRCA 2HLTA 1L3KA 4O44A 3H4DA 3R27A 5HSPA 2HS4A 1E6YB 4OZ0A 2HZCA 1SKRA 1BE4A 3DHWC 1ZM4A 4QIVA 1ZTWA 4JI7F 1XMOF 1GAOA 2UZAA 3DN9A 4ZHRB 4DUZJ 3IBFB 4DZ6A 7FD1A 4DX6A 3RYLA 2V8GA 3VQSA 4L6V3 1SXLA 1WC3A 3VAJA 1T0TV 3RW7A 3DC2A 3TZWA 2VKRA 3BPSP 3DGPA 4IQMA 1CPZA 1FI4A 2RH3A 4RR5A 1WHVA 5IZHA 4K7QA 3KLVA 1SKUB 3SCIE 5DZ6A 2LQ5A 3PW7A 2NSBA 2YKMA 2F8EX 3GSIA 4HL9A 5E7OB 4YR3A 4X4TA 4DV1J 1RUSA 2ALYB 1DJ0A 4FVCA 5C42A 4JI1F 2XYHB 1SC3B 3HZEA 4EK2A 4F2SA 1VISA 1TQLA 4GVBA 3J7ZT 2K1RA 2IM1A 2DNLA 4PWUA 1V3SA 4CLWA 2ZZTA 2YH1A 2MY7A 2DY1A 3H0PA 2MKHA 1S1VB 1YK9A 4FXDA 3AQPA 3CCLS 8AT1B 2VZ9A 1FNXH 2J9DA 1NMEB 5F8HA 1VRUA 3BQ1A 1RT2B 3IR7B 2FY8A 2CZVC 3AA9A 2E1CA 2K06A 4CO2A 2RT3A 1NJZA 3HO1A 1JLEA 1FJEB 3MFHA 1QUVA 2B4PA 4D3HA 5AE1A 4LF9J 4PABA 2GVZA 3M05A 3VCDA 1IVZA 2BOPA 4LF2A 3C16B 4ZCKA 1FO1A 1VJWA 3OD2A 2XSJA 2V4RA 4IOBA 4OI4A 2BQUA 2B4VA 4H4MB 1ZM2A 3FCWA 2LXUA 1KEKA 5EX3A 3FBCA 1NHKL 3NGRA 3QLHA 2Z57B 1TVRA 3P4UB 1VC6A 2CPIA 2G13A 2DHHA 1KVIA 4PXDA 1NU4A 3LP0B 5CABA 3D1HA 4CNYA 5A8KB 3Q23A 2P8IA 1LK5A 3QAUA 1E6VA 1R0AB 4ZVTB 5KFGA 2HVIA 2HVEA 3J7Z5 4HACB 4F4WA 4WFNQ 5L9NA 4CRJA 1JMTA 3UDLA 3PXGa 3BR9A 1HI0P 1HQEB 4LF7F 5B09A 1Q0NA 4NL5A 2V6AA 5GAHI 4X4UA 1UMJA 5CZXA 2Q3PA 4RW6A 2VQEJ 2MZSA 2CPXA 2DH7A 3CJKB 5DG8A 3PYDA 3PNIA 4JP8A 5F3ZA 4TQSA 2ZH6A 3SCKE 1U8SA 2C2RA 3EZOA 3MAAB 4ID5A 2CJ9A 2L9WA 1KNZA 4DCJB 2YTCA 5CYJA 1NRKA 1T7PA 2YX4A 3R6LB 3T5JA 1NZ8A 1V9OA 1WF1A 2ZBQA 5KFSA 4X4PA 2W9BB 4AL5A 2IDLA 5GMDA 4FYWB 4M5JA 4A8SA 2HHTA 1YKWA 4ZMMA 4IH7A 1X9WA 3ZTOA 1LWEA 4DU7A 2MZJA 2FQQB 4OIXA 2VG7A 3A12A 2HRTA 3FVYA 1FFSB 3HVAA 4WIQA 2CJKA 2XCPA 2XBPA 3DYAA 3G6ES 5J1EA 3Q2TC 2FVCA 4ECXA 4H4KC 5EWFA 4LIWA 1WDTA 1S7HA 4Z37A 3VAGA 3M8SA 4B3RF 1QTNB 2DITA 2KFZA 1JJHA 2O1PA 4TLQA 2XNRA 1FXDA 4ZHRA 2GZOA 3M9MB 2EC2A 4DF8A 1EQ0A 1XR5A 4QOTA 1N48A 2OLWA 3M32B 3NGKA 1GK8A 3BDPA 4RBTA 4KH1B 1Q4RA 2Z58B 2ROGA 2JVOA 4JV0A 2VHGA 1TL3A 1T05A 3CC7S 4QR1A 5I3UB 1B64A 1OWXA 2IY5B 3IWXA 4WBFA 2RMLA 2DNZA 4ED3A 1VQPS 4OX9J 2QYGA 3DLBA 1FEHA 3OJSA 1H7XA 1UFLA 1YJTA 4KGVB 3DMJA 3H5YA 1TV6A 3UN3A 3GE9A 3T1YF 3KG4A 2V2ZA 1SI9A 1TP7A 1HNXF 1Q53A 1YBUA 3TVYA 5DM7Q 1ZETA 3KMSA 3R97A 5D4OA 5GADU 2RDDA 4C11A 2W7PA 1K8AT 4L76A 2V9KA 2WONA 2CQGA 1NHVA 1X4DA 2KDOA 4K2JA 1BLUA 1H73A 1VQSA 2DXEA 4PEOA 4RW9B 4C0HA 3OW2R 2UXCJ 2RUSA 4X4RA 5CHCB 4Z7CA 1HA1A 2XEXA 3BREA 3M2UB 2WBRA 4ZOSA 3S7RA 4MK7A 1LWCA 4AFFA 1QM9A 2BE2B 5CH7B 1PCAA 2QLBB 1WC6A 2CQ3A 3GIKA 1NPPA 2OPSB 2B8QA 5G0RB 3K17A 1YBAA 4AL7A 1TKDA 4ZDNA 1L3SA 1ROFA 3JQMA 4ZVEA 2K8GA 1H72C 4DN9A 1K73T 2Y3YA 2IBKA 3D68A 3H2VE 4W92B 3PJXA 3V4IA 2GW8A 1HQUB 5KT3A 2ZH3A 3AXKA 1R31A 3KKFA 3H8YA 2GIRA 2MJUA 2AJQA 2FIUA 4ICLA 2M0GB 3P96A 3AJ2A 2AGPA 2JEGA 1UCNA 2V4JA 5A76A 3LANA 1S9FA 3KLEB 4UY85 3ZNUA 2MKCA 3H90A 1SL2A 2LQJA 4MIAA 4USVA 3A8EA 5J2PA 3MM9B 2NCKL 3DU5A 5KFUA 2X1AA 3CIZA 1NH8A 2XMMA 4L73A 4X4SA 1NLKL 1NK9A 5T7LB 2B56A 1D9AA 1LW0B 1RU1A 1TAQA 3VQTA 4UY8T 3MM5A 4PXBA 3NXZA 2NPFA 3TX0A 1SJ3P 2LMIA 2YWKA 4QBUA 4Q43A 1F3VA 1UTAA 2CJAA 4UOGA 2B4OA 1F3FA 4M5GA 5A8RB 1KVJA 3CJ4A 1N5QA 3V6DB 1NKCA 1NJXA 3VGSA 2HNDB 4JI2F 3M8YA 2DIUA 4J9QA 2VG5B 1OMSA 3AB4B 2YWEA 4F4YA 1W7WA 1KQKA 1FKOB 1NK7A 2FJXA 3C6UA 2EBEA 2IVMA 4OYBA 2BR0A 1G1XA 2W24A 4D3GA 1KSPA 2EG2A 2BEFA 4IG3B 4RZRA 2OIHA 3D6MB 3HHDA 5L46A 4ECYA 3TO8A 1FJGF 4DV5F 1U0HB 3I9ZA 1IM6A 1NUEA 3M6VA 4QR0A 4RUBA 2CQIA 1BXNA 1RHQB 3CB4A 1X5OA 2IM2A 3FEYB 3N01A 2XMVA 2AWZA 2YXLA 3W7BA 3W9HA 2GVDA 4LBIA 3UVJB 3HVWA 3SIPB 2YWGA 2YNIB 1S1TA 1GXUA 1NZAA 4NASA 4RW6B 2A18A 4ANEA 2I6WA 1SL0A 2VIHA 2ZDOA 4EFAC 3H5XA 3QRRA 4ER8A 1HW9A 2OUGA 3SSQA 2KZMA 8ATCB 4UF4A 3J81j 1EKSA 1FFWB 2NLWA 4BWJA 3RAXA 1ICEB 4RU2A 1H2UX 4FYXB 1TL3B 1ZM3A 1T11A 3DDKA 4P75A 1NAQA 1VRTA 2J8SA 3ENVA 3MMBB 5KFRA 2APOA 4DG1A 2GMHA 2AF6A 3G82A 3MPWA 3N5BA 4KQZA 2CNKB 2QL5B 3BPDA 4O23A 4DS4A 2VKZG 2YQ1A 4DWIA 2WHOA 2V8DA 2AJ1A 2DT9A 2ZH5A 3M2RB 2DGQA 1VRQC 3H20A 2VONA 3B4DA 3VAIA 1RTDA 2CNLB 1RHKB 3G6XA 1PBAA 2PEHA 3NGSA 2D69A 5E2QA 4C11B 4DOZA 3A4TA 4NCAA 3NNHA 5JJBA 2Y1LB 4MYUA 1I1GA 3SCJE 5IM0A 3W3SA 2HKEA 3MEGA 1XEZA 3D3BJ 3R5GA 4WTOB 2LCWA 1BQMA 4NXMF 1MN7A 4Q0BA 2PMHA 1OQ3A 3OXFA 4ID5B 2HFNA 2YQ3A 1PBUA 3EGVA 4G6VB 3DM2A 4RW4B 4DU8A 2P5VA 4DL0C 3SV4A 1T9TA 3EXYA 5H9EJ 3N4WA 1T05B 3M8PB 4ZVSB 4U95A 2Z30B 2ZUAA 4BLGA 3Q86A 1UEKA 2WBMA 1SUQA 1TKTA 1WKLA 1T9VA 2BRLA 3SSSA 5CA5A 4K59A 4ED8A 3PV8A 1D0EA 4GC6A 3POTB 2ZH1A 1CJUB 1OSDA 7AT1B 3H7HB 2AJFE 2FZCB 3GPAA 3H25A 1J5OB 4USHA 2KG0A 4KJIA 1UJ6A 5CCMA 2JLFA 2LLZA 1RA6A 4TYBA 2G9OA 3EVMA 3EZUA 3AODA 4J9UE 2OGUA 3DGVA 1HL6A 3JXOA 2VPXB 3CMES 4C8LA 2WVEA 4PQAA 4F02A 3R5JB 2MZRA 3M4XA 2XY7A 1PYSB 2JFKA 4HT5A 1S9EB 3GFHA 4TY8A 3SXLA 1C0UB 3QT6A 2ASLA 5A0YA 3TVKA 3GFYA 3FSIA 1D8ZA 1YRTA 2ZEJA 4O3PA 3HVRA 4P2FA 3NMRA 4DR7J 3NS7B 5A6PA 4YR2A 2IFXA 3KK1A 4NEZA 3UQSA 3OR1B 1TZ0A 5F8LA 1Q7YT 3K8VA 4ES3A 2ZBRA 4I69A 3V4IB 4IR9A 3J7A1 2HBZB 3M2VB 3PTWA 4NX9A 1N6QA 4FNIA 4BC9A 4YDDB 2DR8A 2R7VA 2VG5A 1FCAA 1V3RA 3P5BP 5HROB 4P6QA 1UW4A 2W2MP 2YNFB 4BWMA 4USKA 2NXUA 2RDIA 3FBEA 4KRWA 3UR3C 5JVGQ 4X64J 3MTKA 5CXTA 2PSZA 1K1QA 5KTQA 1KOHA 2LDIA 2X51A 3EGWB 3SFUA 5AXKA 4DL2A 2VBWA 2I5JB 1PJ7A 3GTYX 1Y3JA 2B9EA 2P6TA 2R2UA 2UUCF 1LW0A 2ASYA 2H65B 1JLBA 1I94J 4XK8C 3ONQA 3TP2A 4RUCA 3KHGA 2HW3A 2YKQA 4UUXA 1RT7B 4ZJQA 1RAJA 4KHPJ 3IN5A 3M6XA 4ZLJA 4DQRA 1NSKL 3D5MA 4K5SA 4OMFG 1Q1KA 3CJRA 1S1WB 4DR4J 2VFUA 1XN9A 3EGNA 5HANA 4N47A 5H9FJ 3GYGA 3SZ2A 1AFIA 3M1VB 3K89A 4Y2IA 1F60B 2XYPB 3ILLA 4IG3A 3CCWA 1HWKA 1DY3A 2RVJA 4OZ5A 2XCAA 4KR0B 2HWIA 2RE1A 3F44A 1U0HA 3H5UA 4M5IA 4DFJA 1RTDB 1W26A 1VQ5S 2FVQA 3QJLA 3NWRA 3HULA 2YWFA 2ADBA 3T3FA 3W5XA 1XNQF 3DOKA 3TW0A 1RISA 1S9GB 2HG4A 1QUPA 5K9FA 2FHJA 2XHCA 2XMUA 4CT8A 1RWXB 2LXIA 2XS2A 3NGUA 1C1BB 5E3RA 3JSRA 2PA8D 4WK1A 4EMDA 2WONB 2EKNA 3L7OA 4OZ1A 4USUA 4OX7A 1APSA 1T95A 2V50A 1LEOA 3Q8UA 5D4PA 3HJFA 1IR2A 2P9CA 4JV5J 2OPRA 4KGMA 3MMAA 3CD5A 1QJHA 1YZ7A 2JNJA 4LF1A 1KP6A 2QZ8A 1UP1A 5IFMA 5KFNA 3N5FA 1MU2B 5F8NA 1SC4B 3BKTA 3H5SA 6FDRA 3BDEA 5KFPA 1X5SA 2VG6A 3IM9A 4OX8A 3OTOJ 2E66A 1N88A 2YVSA 1LNQA 4HLBA 1REGX 4FPRA 5JXSA 4ED6A 4EBCA 2FJVA 4PUOB 3T19A 2OSQA 1SKSA 2QLJB 4K4YA 2ZM6F 1S6QB 5E3PA 2N7CA 4ID8A 4OJ3A 3I9V9 4ZCLA 2C2OB 3EVOA 3NCPA 4H4OB 3A1YG 3QMQA 3RBZA 1N52B 3TZZA 1D9DA 3HP6A 1XNQJ 1G6BA 2P9GA 1YJWS 4F04B 4URGA 4WF9Q 1LK7A 3BKFA 3LP1B 3WIVA 1RXOB 1U1MA 2VFRA 4E2FB 2XGQA 4R25A 2BABA 3AOCA 2YPZA 4F25A 8RUCA 3MMCB 1W25A 4X62J 2XS5A 4ILLA 1CS4B 5D0HA 5HLFB 1TKZB 1F2GA 2HIYA 4KIAA 4YHHJ 2C2EA 4URQU 3OLBA 2AYEA 3VGVA 1P1TA 4OI6A 5DDRC 2CG4A 1IKXA 2Q1LA 1P9QC 1M5HA 3NCRA 2J5AA 2GV1A 1Y3KA 2B5JA 4P52A 1U1RA 1WDDA 1FXRA 1V5VA 3D67A 4NYOA 3NL0A 4ZJLA 1ZAVA 4V1Ak 3K59A 1RTJB 1TFYA 2JH3A 4YDXA 3FSYA 2Y1JA 4F4KA 1IR1A 3GV7B 4DPUA 4U7UD 2HBRB 2NUUG 4DPXA 2ROPA 2YY3A 1YG0A 2D74B 4TXSA 4J9VA 3MGJA 2L9DA 3I82A 1MMDA 1Z2ZA 3JQKA 1EZZB 3W2VA 4EBDA 1RT5A 1U1KA 3BBCA 3MEEA 2J8AA 5IC4B 4G3IA 1FVSA 3W65A 1I6JA 3UW1A 4U7CA 3QIDA 5F8IA 4I67A 3HD2A 3NLCA 3TUJC 2OPQB 1X0PA 3BZQA 4IYQA 3D2WA 1J2VA 1RWPB 5ETNA 2FVPA 1Z4UA 5J2NA 4X62F 1NDPA 1WSRA 2VPWB 4GRSA 3X1LB 2DH8A 4DSIA 3Q8VA 5B0DA 1U1NA 1RT1B 3C16A 2O67A 3KWMA 3T1HF 4O3SA 2LKZA 2RB7A 5CYQB 4ANCA 3PRVA 5H1SV 2XMAA 2MXYA 1C0UA 2GS8A 1FRIA 4L3KA 1FT8A 2KTQA 2JL9A 2FYXA 2R8HA 2RU3A 3QLHB 4FKXA 1EJ7L 3TZXA 2E9ZA 2W9AA 1Y7PA 4QQBA 4OV1A 3MCOA 4ES2A 3TEGA 3VAHA 4KFBB 2DPJA 3RB3A 2K3KA 3QPIA 3J81Y 2CKWA 4RUAA 3M8QB 2N3LA 5KFTA 2BYCA 2DD8S 2LVWA 1P6TA 5J2QB 1SC1B 2J76E 4B9SA 3MF5A 2P6SA 2OPRB 2KXNB 1MNEA 2JWNA 2CNOB 4P2XA 1J5EF 2W4PA 2KYZA 2MMYA 1S97A 2DNPA 5D15A 2HFUA 3KJVA 1HD1A 1VI7A 2BKNA 2O66A 3SMZA 4HVZA 5A8KA 2BJ3A 1U26A 3PHEA 2J6TA 5HBMB 4C3LA 4EU0A 1IKWA 3L3CA 4MKBA 1VBXA 2FB0A 2FVRA 5KFBA 4DV3J 4UQTA 4P73A 2GMLA 3UE2A
chains in the Genus database with same CATH topology
3QRPA 2Y9HA 4QYZK 3QRQA 1WJ9A 4DZDA 5H9FK 5H9EK 3QRRA 5CD4A 2Y8YA 4U7UD 2Y8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRP A;  2Y9H A;  4QYZ K;  3QRQ A;  1WJ9 A;  4DZD A;  5H9F K;  5H9E K;  3QRR A;  5CD4 A;  2Y8Y A;  4U7U D;  2Y8W A; 
#chains in the Genus database with same CATH topology
 3R5B A;  1C0T B;  1VHF A;  5D4N A;  4DFM A;  1MG7 A;  1S10 A;  1D9F A;  2EVZ A;  4O0N A;  3UD5 A;  3C2P A;  3OJU A;  4W98 A;  3I0S B;  4DXL A;  2EW9 A;  4ETZ A;  1IBC B;  2L41 A;  4KKO A;  1M90 T;  2CPH A;  2KI2 A;  4DI6 A;  4MMO A;  3GJS B;  2BM0 A;  1KKH A;  2IVY A;  2KT2 A;  4FYY B;  5F3T A;  2VH7 A;  5KG3 A;  1KQS R;  4DR3 J;  1H98 A;  1QSY A;  1Q81 T;  1AZS A;  3R3T A;  4MKV A;  2KM8 C;  2G2Y A;  1XC9 A;  1JK9 B;  1SIW B;  1RE1 B;  2LU1 A;  2GQ2 A;  2Q79 A;  2QTW A;  3AD9 C;  1WC0 A;  2IIH A;  4HTI A;  1RAA B;  2JC1 A;  4B02 A;  2OH2 A;  1EP4 B;  4ECR A;  2VDH A;  1T3O A;  1YRU A;  1WC1 A;  3A13 A;  2KYX A;  3J7A N;  3VVU A;  4WKR A;  3ZZY A;  1KBR A;  1HBU A;  2PO4 A;  2CVI A;  2B8P A;  3CJ2 A;  3ZZZ A;  4FKY A;  4DLE A;  2G1D A;  4IH5 A;  5FDL A;  2AYG A;  3M2V A;  1ELO A;  1N56 A;  1TFW A;  2OHD A;  3Q8Y A;  3MPD A;  3QZ7 A;  3KFW X;  4GMK A;  5F41 A;  3OTD A;  1GFW B;  1GMW A;  4B17 A;  3G8T A;  2AU0 A;  1JLC A;  4O3Q A;  2EC0 A;  3N0V A;  1U7L A;  2JLE A;  4J9L A;  2IM0 A;  3GU0 A;  1WUU A;  3W8G A;  4DUZ F;  1URR A;  2HSE B;  4DL5 A;  4B9V A;  4DSJ A;  2C2M B;  3R8Y A;  2ZHO A;  2Y0B B;  2FTR A;  1VIO A;  2VFT A;  2C2D A;  2AX1 A;  3KHR A;  3V2U C;  3FCH A;  1MWY A;  3G8Q A;  3D0I E;  4RW8 B;  3PFE A;  1RBO B;  3PYF A;  4KSE B;  1ZAW A;  4OHW A;  4ZPV R;  1OY6 A;  2KT3 A;  3W5Y A;  2MKK A;  3A8K A;  5KG0 A;  5HQ8 A;  1F9F A;  3R2C J;  4M5D A;  1FVQ A;  1T03 A;  4ILM A;  4PAA A;  3CO9 A;  4OQJ A;  3ENW A;  2DNM A;  5L8R C;  4I64 A;  2WSC C;  5KG1 A;  4F4A A;  2CZ4 A;  2QGF B;  3ENQ A;  1IBM J;  4O3R A;  4H4O A;  4FS2 A;  4OYI A;  4EZ9 A;  4IDK A;  1FTR A;  1U2R A;  2E5I A;  4J37 A;  2WCX A;  2E29 A;  1FEE A;  1GMV A;  1WF2 A;  4DQI A;  3MCN A;  1YDL A;  2ZKT A;  2QYC A;  2U1A A;  5F8M A;  2CQD A;  3VZH A;  4K4U A;  2GVD B;  1Q5V A;  1V6H A;  2KVI A;  3K8W A;  1SIZ A;  2RS2 A;  3L7P A;  1F2H A;  1Z1Z A;  5K5M A;  2GHW A;  1C1C B;  2F9D A;  3KK2 B;  1VRU B;  1F9H A;  5J2M A;  5HP1 A;  5D78 A;  2JLG A;  5I42 A;  4ZPD A;  1LXN A;  3ZZP A;  2X7I A;  2OPQ A;  3V81 B;  1WOO A;  4NCB A;  2FJD B;  4HDH A;  2VA3 A;  2NSC A;  2ZNZ A;  4FDF A;  4C2M A;  1VRT B;  1NND A;  3MMB A;  4DG1 B;  3MED A;  3WBZ A;  3GMG A;  2MQ8 A;  3HLU A;  3Q83 A;  2J0W A;  2QL9 B;  2V4J B;  2DHG A;  3BN7 A;  4NCG B;  4YB5 A;  5A8W A;  4LR8 A;  4G1P A;  5CYQ A;  3T9N A;  3BO3 A;  1RAB B;  3MCS A;  4RUH A;  1CEZ A;  3G4S S;  4I2Q A;  2ASJ A;  5HBM A;  1DFD A;  5K20 B;  2UP1 A;  3GFX A;  5C2C A;  2CQB A;  2RHS B;  3W2W B;  4DN0 A;  5AXN A;  1VDH A;  1YJU A;  3C6U B;  5IQQ A;  1WAC A;  3RJM B;  3VZI A;  2CDR B;  1RWU A;  3M7V A;  2XZD B;  4PCQ A;  2UVW A;  5E3Q A;  2X1F A;  2OSR A;  2I2Y A;  3TRG A;  3PW5 A;  3RZA A;  1WC4 A;  4OV6 A;  2CPY A;  3CED A;  3MUV P;  2AHO B;  4W4M A;  1RT4 A;  1YHQ S;  4KTQ A;  4IFV A;  3PRD A;  3FJ2 A;  2QMW A;  1WKJ A;  3W64 A;  3LF0 A;  2AEJ A;  2M88 A;  4NLO A;  3NCQ A;  2CPE A;  1HYS A;  1RTI A;  2RF2 B;  4U8V A;  4OZ3 A;  4ECZ A;  3HHL C;  2RRB A;  4DR5 F;  1VIX A;  1LFW A;  2LQ8 A;  4OHY A;  2N7Y A;  1HBU B;  3PW0 A;  1UA0 A;  3UN2 A;  1NO8 A;  4MFB B;  3TZY A;  1K1S A;  5KG5 A;  2NUH A;  4IO1 A;  4ECT A;  4JI2 J;  3EPG A;  4V19 X;  2OD6 A;  3GB0 A;  2BW2 A;  4AQY J;  2P2C B;  3HPO A;  5L1J A;  5J1E B;  2F1F A;  3AHP A;  2CQ0 A;  4I56 A;  3PR5 B;  2EFQ A;  1WHY A;  2CJQ A;  2FUG 9;  2R4F A;  3GLJ A;  5DQI A;  4CIO A;  3Q0A A;  4DUT A;  4DFK A;  1RYR A;  1S0O A;  3GV5 B;  1JJ2 R;  4HDG A;  4WZQ A;  1HI1 A;  1DTQ B;  4NMX A;  3D6T B;  4OYP A;  1KOO A;  4Z7Y A;  1S99 A;  2HQ3 A;  5L9X A;  5BXI A;  2ZH2 A;  2C3O A;  1BQN A;  1L3U A;  2I1R A;  2ZWP A;  3LP2 B;  3N6M A;  4JI7 J;  1MSW D;  3B78 A;  5KT4 A;  3EX7 B;  2MGZ B;  3BKU A;  4FS1 A;  4B9N A;  2ROE A;  1OY8 A;  4C3K A;  1FJ7 A;  3TJ9 A;  4DV5 J;  1NXI A;  3AOA A;  3OT9 A;  3RBE A;  1XK8 A;  4OI0 A;  3AY0 A;  4IG0 A;  4C8O A;  4B9L A;  3ELH A;  3UCZ P;  2HYI B;  2DIS A;  3M8W A;  1S5Z A;  1KFD A;  3BV8 A;  2F3J A;  1BQX A;  1CJU A;  3T6B A;  3EZ5 A;  4WP3 A;  4JOU A;  4F3Q A;  4OZ2 A;  2GNK A;  1UZH A;  3KNG A;  5AE2 A;  1IM4 A;  4RW9 A;  3EXC X;  4DV4 J;  4NPO A;  3CXC R;  2CZ9 A;  4C8N A;  2MST A;  3FC9 A;  2CQH A;  2A3J A;  5K14 B;  3MM8 A;  3MFI A;  4J9M A;  3FZ2 A;  3DGP B;  2K7J A;  4LQ9 A;  5I42 B;  5AJ3 F;  1K0T A;  4OJ1 A;  2J9D E;  3OTB A;  2A0F B;  3FK4 A;  3HF5 A;  3C15 B;  5KFY A;  3W8P A;  4XIU A;  3VTI A;  1RWM B;  5M2U A;  4YOE A;  3UN5 A;  2DHX A;  4ERD A;  1H74 A;  2VF3 A;  3C14 B;  3FEZ A;  2GAH C;  1S6U A;  2JOQ A;  4W90 B;  3WDO A;  4OYO A;  4I1T A;  3V6K A;  3R1L A;  2V8V A;  3FMW A;  4X4Q A;  1SJF A;  4A8F A;  4LF9 F;  4GKK F;  1HMV A;  3QRQ A;  1QY7 A;  4WXW A;  1FK9 B;  4G1Q B;  3D6F B;  4WFZ A;  4N41 A;  1LKZ A;  2IPO B;  1VLO A;  3IR5 B;  5F0W A;  4X65 J;  5MLC V;  1SVD A;  4Y3C A;  3MD3 A;  1AT1 B;  1S9G A;  5KOX A;  3OUY A;  1AW0 A;  2XMK A;  4CDI A;  1BHN A;  5HP1 B;  3DRP A;  4P71 A;  1RP5 A;  4O3N A;  4DV4 F;  1KTQ A;  3ZNJ 1;  1S12 A;  5A2Q Y;  2YKA A;  2UUA F;  3NGT A;  3Q22 A;  4PG8 A;  1N5Y B;  3BGF A;  1W2B R;  1QD1 A;  3ZZU A;  3EJM A;  1VK8 A;  2KVQ E;  2ZJR Q;  4N7T A;  2GJ2 A;  2E9R X;  1RT7 A;  3GG1 A;  3KNA A;  1M1G A;  3CDE A;  4DPO A;  1KC8 T;  1CSJ A;  3KG1 A;  3P6Y C;  3BR8 A;  5E5N A;  5KFI A;  3UCU P;  4PQU A;  1YIJ S;  1E6V B;  3ISN C;  3D0H E;  4PR6 A;  4X66 J;  3AT1 B;  1VC0 A;  2XI3 A;  4P2S A;  4ZN3 A;  3B54 A;  3NS5 A;  3V6J A;  3PX6 A;  2VV5 A;  4USW A;  4DR1 F;  2K2P A;  1JLB B;  3EYZ A;  4PRF A;  1XMB A;  1O8B A;  2NS1 B;  5AXL A;  4B9U A;  2H54 B;  2HQG A;  2MLY A;  3EDQ B;  4XAK A;  1PSD A;  3BQ2 A;  1FD8 A;  3HFZ B;  3H40 A;  1VCT A;  4J7C A;  2C42 A;  2HBY B;  2JJ4 D;  1S0M A;  1HBO B;  1KQG B;  2Q43 A;  3LAL A;  1TUV A;  4O4R A;  1U1L A;  1PIE A;  1AUS L;  1GMW D;  2ERR A;  2W9B A;  4NLU A;  4DR6 J;  2QMX A;  2MY8 A;  3FRZ A;  3ETO A;  1YBT A;  3CTR A;  1SJ1 A;  5ETS A;  3RG6 A;  4RW7 A;  3CPW R;  4AL6 A;  4AYB D;  2VOO A;  3KXD A;  3GG0 A;  4LFA F;  2BKP A;  4ZVQ B;  1S6P B;  1P27 B;  3B6B A;  4EUV A;  1RT6 B;  2UV8 G;  3W2W A;  3DYA B;  5M2P A;  1REV A;  3GIL A;  1NJI T;  2X1B A;  4Q8F A;  1OPZ A;  4PWW A;  5J1N A;  4WU3 A;  3O2I A;  1JIH A;  2W2P P;  3FQL A;  5RUB A;  4ED7 A;  4USJ C;  2LA6 A;  1P1L A;  5A6W A;  5C5J A;  3G6Y A;  4I4B A;  2EG1 A;  2VUG A;  5GME A;  2EFG A;  1KN6 A;  3BH7 B;  3CD7 A;  2PN6 A;  4OFZ A;  4XDC A;  3G9C A;  4WFB Q;  1EB0 A;  2W1B A;  1GXL A;  1TMJ A;  5HVF A;  5E33 A;  1Q16 B;  3OHA A;  3HT0 A;  2KFY A;  3N6L A;  2C22 A;  4NLD A;  4OYZ A;  3NP5 A;  4DQS A;  2MQQ A;  2LEC A;  3JYT B;  2QA4 G;  3PY8 A;  1RWN B;  4U6P A;  1JNZ B;  3E8O A;  4KH0 B;  2FLO A;  4N77 A;  4NOH A;  3BH6 B;  2DGX A;  1PC4 A;  3SQG B;  1HKA A;  4CYU B;  5LMU J;  4FF1 A;  4O3O A;  5B0B A;  3C6T A;  2XB2 D;  4B9M A;  2HRU A;  5GVQ A;  2CQP A;  4HH0 A;  4KC5 A;  1PO6 A;  1C1C A;  4Q2M A;  4OLO A;  1F5C A;  3MUR P;  4DR2 J;  4NXN J;  1DUR A;  3UD4 P;  4WK3 A;  3OSN A;  1A0O B;  1S6Q A;  4LBH A;  4ZLL A;  3QIP B;  2GAG C;  3SEO A;  3RW6 A;  1SV5 A;  2JZ5 A;  4C7Q A;  4NA2 A;  6FD1 A;  1VOM A;  1S49 A;  2HFZ A;  2XHW A;  3FBB A;  3MED B;  4KBI A;  5KFQ A;  2MSS A;  1E6Y A;  3ILI A;  4XDD A;  6AT1 B;  4LVO P;  2EXU A;  2WVB A;  4KPC A;  3BSC A;  5A8W B;  2W9C B;  2CQ2 A;  5EGY A;  1JWW A;  2R2T A;  4JI0 J;  1NSQ A;  5D0G A;  4DV1 F;  3CC4 S;  2HNY B;  3HFV A;  1F5B A;  3HVT B;  3R7B B;  4PG4 A;  4USI A;  3C15 A;  4YB6 A;  3S1T A;  3S6E A;  2FZK B;  4YN3 B;  4JYA J;  2XGP A;  3D6H B;  4UZC A;  5KG7 A;  2DR9 A;  1SJQ A;  2E5G A;  2BMB A;  4WFA Q;  4F36 A;  3JB9 k;  2B5J B;  4JV2 A;  1MRO B;  3KJV B;  1R89 A;  2B43 A;  3P45 B;  3TA0 A;  4HR2 A;  4JUZ A;  3W1Y C;  4NA1 A;  4RW8 A;  4DS5 A;  2NR0 A;  2XLI A;  1LWF A;  5GAE I;  4HT7 A;  1M5K C;  5C42 B;  1JLQ B;  2R7U A;  1S7I A;  5B0E A;  3PVX A;  2AT1 B;  2J7K A;  3UCG A;  5D0E A;  2M7S A;  2BAN B;  5AT1 B;  3CVK A;  5K14 A;  2I5J A;  2ZJQ Q;  1QAI A;  1VQ7 S;  3AAW B;  2BOA A;  4U8Y A;  2HFO A;  4Y2M A;  3RAM A;  2ZZM A;  4LMZ A;  3HX9 A;  4URS A;  2J9E A;  4MFB A;  3ZZR A;  2OTJ S;  1KQF B;  2XO6 A;  2NXJ A;  3PEH A;  2R8G A;  4V19 J;  3NNA A;  4DUY F;  2QLX A;  4Q8E A;  4WU2 A;  5KOW A;  1IJF B;  2UXD F;  1Q82 T;  5FLX Y;  2D3Z A;  3PDN A;  1HHQ A;  4WFX A;  4YEA A;  2HIQ A;  3Q8R B;  4KFB A;  2ADC A;  4PQU B;  2GIF A;  4H54 A;  1DTQ A;  3KMQ A;  3HFK A;  2W8K A;  1C4A A;  5B0F A;  3O44 A;  1DLO A;  4WWS A;  4F7V A;  1TVR B;  3A3O B;  1BQN B;  3D3C J;  1UPP A;  2B4U A;  4LUB A;  4R8U B;  2GMJ A;  2DB1 A;  2JFD A;  2WK4 A;  2HHH J;  2CIM A;  4CH1 A;  4ED2 A;  4RNM A;  1YI2 S;  2R7S A;  4HAC A;  1RHJ B;  4A8Y A;  2A2D A;  2ZHA A;  2ZVS A;  4LFB J;  3KK3 A;  4A48 A;  2IAJ B;  1TL7 B;  5BJR A;  3KUH A;  3UFC X;  2D9P A;  1UEV A;  4WII A;  3G82 B;  2HVZ A;  2YNH A;  5CYM A;  4E8U A;  3VAF A;  3Q89 A;  4A8X A;  1Y00 A;  3LPY A;  2DGW A;  3PYG A;  5KFM A;  5KT5 A;  4A8K A;  3A3P B;  5FII A;  3THT A;  1U4B A;  4M8L A;  1AXQ A;  1S6P A;  1VQY A;  1X4G A;  1XWL A;  3DI6 A;  4FF4 A;  4YUD A;  3HMJ G;  4JI8 J;  2BRK A;  4RU9 A;  1CBK A;  1JNR B;  3DKD A;  3Q2S C;  4HI1 A;  1U6B A;  5LL6 d;  1XNR F;  3HHL D;  1ZA2 B;  1DQ8 A;  3C46 A;  2LQB A;  4IFY A;  1GTH A;  1T9U A;  2Z56 B;  1FKP B;  2U2F A;  1IUJ A;  4DUY J;  4P9S A;  3EE3 A;  3RBD A;  5CQG A;  4M5L A;  1BMQ B;  1MWQ A;  2DKO B;  2JHE A;  1TL1 B;  2OKQ A;  3DMJ B;  3G86 A;  3OFE A;  3TR5 A;  2WTF A;  1X9M A;  3SI8 A;  1DRZ A;  4DQP A;  1UVJ A;  4OJH A;  4QW9 A;  2KM8 B;  1FNM A;  1FE0 A;  2XMT A;  3OVA A;  2BE2 A;  3CDW A;  4ZVR B;  1S4E A;  2ZD1 B;  4KPY A;  1Q7L B;  2VC0 A;  4NRT A;  3OSP A;  3JQJ A;  1DBD A;  1TK8 A;  1A6L A;  1D3W A;  1AA1 B;  4XO0 A;  2AEF A;  5F0U A;  5K8P A;  4EZ6 A;  4ELV A;  2ZUG A;  1BY9 A;  4LSL A;  1Q8K A;  2E44 A;  2HGM A;  4QU6 A;  1R8P A;  1HNV A;  1JKH B;  3HHL A;  1VYA A;  5KFK A;  1MW7 A;  2DHS A;  3H2U B;  4KHR A;  3JSM A;  2AJ0 A;  2W25 A;  4LF5 F;  3CDB A;  4M5D B;  3ZZT A;  2XS7 A;  2UUA J;  4C98 A;  2OAU A;  4CT9 A;  3M2U A;  1O51 A;  3M8Z A;  1RTH B;  3ETM A;  3PJW A;  4NLY A;  3BB5 A;  1HBM B;  1KHV A;  3KLG B;  1JJC B;  1TL5 A;  2MKJ A;  2YPY A;  2YQ0 A;  5KFV A;  5CZV A;  1IKV A;  2OTL S;  2UVV A;  3PIO Q;  2JDJ A;  2PE8 A;  2DNQ A;  2QA4 S;  4DV6 F;  1KON A;  1MRO A;  2LFV A;  4NYZ A;  4ZS6 A;  1HBO A;  2Y1R I;  3GCX P;  4I0W A;  2ZBP A;  3SFG A;  5GAG U;  2QEX S;  5LM7 E;  4F8R A;  3DRS A;  1EAY C;  3MOZ A;  2M70 A;  3TAQ A;  4CLF A;  4CM2 A;  4JV5 F;  1F0X A;  2NQP A;  3BBB A;  1ITP A;  2BVZ A;  3VVT A;  3IG1 A;  5A2Q U;  3OL8 A;  2F63 A;  3OXL A;  2JX2 A;  2VQE F;  1TUW A;  1I3O B;  1FKO A;  1RAE B;  1RDR A;  4F3O A;  2DGT A;  4NZ7 A;  3KOA A;  3D7S B;  3HZG A;  1U0S A;  2M52 A;  4J9S A;  2W7O A;  2E7W A;  4DL6 A;  2E7X A;  4I7F B;  3DLE A;  4ZLN A;  2FVS A;  2RHQ B;  1RHR B;  3M6U A;  4WXO A;  1MMN A;  1RI7 A;  1QSS A;  3QRP A;  3SQO P;  1ZAX A;  2G0C A;  2O5D A;  3G87 A;  3IGV A;  3ZO7 A;  4AD6 A;  3PAC A;  3S8S A;  1ZH5 A;  5IT9 U;  4ZPT R;  3D1Q A;  1HD0 A;  1OO0 B;  4NA3 A;  3UDC A;  2HHP A;  2GO9 A;  3DLG A;  4IFV B;  4DZD A;  1FWL A;  4QW8 A;  2KFN A;  3MM7 A;  1OIA A;  4QPT A;  1DZ5 A;  1FRJ A;  3K57 A;  3FSX A;  1NKB A;  2B9Y A;  5D0R A;  4ZPA A;  2A6M A;  4Q44 A;  3M2R A;  1UA1 A;  1KLN A;  1IKW B;  4FNH A;  2LDY A;  4PG5 A;  2AJ4 A;  3W62 A;  4OHV A;  1KD1 T;  2A1B A;  2AP6 A;  2RKI A;  3W66 A;  3LGM A;  1UAW A;  5EWE A;  1YTY A;  1O6X A;  2EI5 A;  1CLF A;  1KLM B;  4YB1 P;  1NDL A;  3TJA A;  1GT8 A;  3V4M A;  2FHK A;  1S72 S;  3M30 A;  1R8C A;  1NKE A;  3MMA B;  2UUC J;  1CJK B;  3TAM A;  2OJ3 A;  3J7Y I;  4YP3 A;  5MAO A;  1PYT A;  1FRL A;  1QE1 A;  2EFV A;  4DV7 F;  4B3S F;  1HYS B;  3MEG B;  5DQG A;  4GO7 X;  1F1B B;  2IM3 A;  2M3D A;  5SUH A;  2IDE A;  1S77 D;  3FDS A;  5I3U A;  3WIU A;  4X84 A;  5DDP C;  3DM2 B;  2N4D A;  1N0V C;  4RW4 A;  4OHX A;  3G71 S;  3NWG A;  1EAR A;  1N8R T;  3PO5 A;  2DO4 A;  3QJJ A;  1N36 J;  1XMQ F;  2BX6 A;  4IOA Q;  3D0G E;  2FJW A;  3NAH A;  5DG9 A;  3IRX A;  2DR6 A;  2DGV A;  2MQM A;  1UFK A;  1M5V C;  3PW4 A;  4DPY A;  1U49 A;  4DV7 J;  1NHU A;  4RNN A;  3MR6 A;  4Q0B B;  1UZD A;  3JSB A;  1XTZ A;  1YJ9 S;  4ALZ A;  4ZP9 A;  2I9S A;  2P9E A;  5D6G A;  2DRB A;  2F5G A;  3ET6 A;  3CCV S;  3LP2 A;  1SBR A;  3L7U A;  3KLF B;  4NLS A;  5I3P A;  1WI6 A;  2ZH9 A;  4U96 A;  1N54 B;  4LFC F;  2IMW P;  1DAX A;  2GJF A;  2V8P A;  4P72 A;  1BGX T;  3OR1 A;  5SZT A;  4DX7 A;  2XWX A;  3LOU A;  3R7N B;  3SQG A;  4IH6 A;  1IBL J;  4F0K A;  1XNR J;  3OFG A;  2DGU A;  1RYS A;  4QYZ K;  1RCO B;  5H9F K;  3Q8P B;  4NLG A;  3SBM A;  4N8N A;  3VWS A;  5L1I A;  4ICL B;  4YB7 A;  5DQH A;  2VOP A;  3H98 A;  4NZ0 A;  2BE7 D;  4KGX B;  1U09 A;  5E41 A;  4ECQ A;  1SH2 A;  4IDK B;  3IGN A;  4QWE A;  2XSJ B;  7FDR A;  3OV7 A;  4B3S J;  5B0G A;  4OZJ A;  1WOS A;  2GQQ A;  3O6Q A;  3K58 A;  4ZIT A;  2HK2 A;  2ZC4 A;  3MD1 A;  2ZE2 B;  2R8K A;  4PKD B;  4A4J A;  1JLE B;  4P2M A;  1QLN A;  3F0N A;  2B51 A;  2ATC B;  3MM5 B;  1YJV A;  3KK2 A;  1X0F A;  3MTJ A;  2MPU A;  3GON A;  1EQM A;  1HFE L;  2W2Q P;  2Z2M A;  2QFJ A;  2FZG B;  4FF3 A;  2E9T A;  2KRB A;  3H2L A;  3IM8 A;  1Q8B A;  2V4Q A;  3D54 A;  1S76 D;  5A8R A;  3IBC B;  3QT5 A;  4TLR A;  2DH9 A;  2FHO B;  4MAK A;  3TQE A;  3QT7 A;  5I4M A;  3VAK A;  4HHU A;  2F4F A;  1C2P A;  4PPD A;  1XJW B;  5KFE A;  2KT5 A;  4IO9 Q;  1GQE A;  3IO1 A;  4ATN A;  1Y9O A;  3CMQ A;  3ZZ0 A;  1HNX J;  1CG2 A;  2ATL A;  3BN4 A;  1CJV B;  1B0P A;  2VJU A;  4EYH B;  1FA0 A;  2W7A A;  5C25 B;  3I56 S;  2IC3 A;  2L08 A;  4BBY A;  1NK8 A;  2QC3 A;  3IG1 B;  4RX6 A;  2BDP A;  1G7C B;  1RAF B;  2Q6C A;  5EUH A;  3JAM Y;  2MZ1 A;  2J0S D;  3HD1 A;  1RAI B;  1NDC A;  1VGY A;  4B3O A;  3W63 A;  2ZNY A;  4CLP A;  3T41 A;  3DRP B;  3O8W A;  2IA0 A;  5AJ3 J;  2DPI A;  2GGP B;  2VBY A;  2KHC A;  1M0S A;  2WSE C;  5G4D A;  3BYP A;  2X1G A;  1CJK A;  2RNE A;  2CPJ A;  1FE4 A;  5B0A A;  3TOQ A;  3PFO A;  2R7W A;  4CLS A;  2UXC F;  1TL1 A;  3NS6 A;  3IA0 A;  4NLR A;  3HK2 A;  4ZVF A;  4JI5 J;  3RR7 A;  1Y0H A;  1WNE A;  5IT0 A;  4NLW A;  3THP A;  3J80 Y;  2NYH A;  4YS2 A;  4P74 A;  1M5S A;  5M2R A;  4C6A A;  2R3V A;  3AD7 C;  3QAE A;  4Q5V A;  2UU9 J;  2WVF A;  2F4V J;  4R5P B;  5ETQ A;  3KHL A;  3HSG A;  3QFH A;  2J6U A;  2YH0 A;  3CJQ A;  3HM9 A;  3TAN A;  1N34 F;  4WE1 A;  4MIB A;  3L09 A;  3G2X A;  2HRY A;  2F40 A;  4DPT A;  9ATC B;  1IKY A;  1LV5 A;  1NB7 A;  2CQ1 A;  2D3O 1;  1QAX A;  1UVN A;  3IS9 A;  2J7U A;  3BGU A;  3CDA A;  3NRB A;  3OPK A;  1R3N A;  2LA4 A;  4C8K A;  4ECW A;  1TV6 B;  5T41 A;  1S1U A;  1SB6 A;  5JUM A;  2VU5 A;  3OLA A;  2OEJ A;  3ZTS A;  4DR4 F;  4QYR A;  1TKX B;  1U2C A;  3FFI A;  4QPX A;  3HVT A;  2QT7 A;  5IC6 B;  5AE3 A;  3JS9 A;  3VF0 B;  4ZIV A;  1N34 J;  2Y8W A;  4A8Q A;  4GO5 X;  3CO0 P;  4CO5 A;  3G6V A;  2B6A B;  4OI3 A;  1TTH B;  1VJQ A;  5HQL A;  3F73 A;  2IRY A;  2BKO A;  1JLF B;  4PXE A;  2Y1I A;  4NLQ A;  4DR3 F;  1TKZ A;  1KFS A;  3P49 B;  5IQ6 A;  2RAQ A;  4KV8 B;  1IWA A;  3MEK A;  2FGO A;  3W61 A;  4CQ1 A;  3QSY B;  4JI5 F;  2BA9 A;  2B9X A;  1FRK A;  1CS4 A;  1X5P A;  1Q8L A;  1TL4 A;  2D3U A;  3W9I A;  2IVF B;  1Q95 G;  5GAE U;  3MR5 A;  2WB4 A;  2RJZ A;  4L75 A;  2R9L A;  1Q79 A;  3KDN A;  4FN5 A;  4PYA A;  2GHV C;  2QA2 A;  1KS2 A;  4EYI B;  3FQK A;  2J6S A;  4DL7 A;  4CO1 A;  3QBC A;  4RO0 A;  2HHV A;  2M9K A;  5L38 A;  2V9W A;  2E5J A;  2VOD A;  2AKW B;  3TAR A;  5LMN F;  4OYA A;  1Q78 A;  3PKY A;  3PZP A;  3V6H A;  2HHQ A;  1Q5Y A;  3KK1 B;  1S59 A;  1SH0 A;  2HGL A;  2MTL A;  4RJV A;  3ITH A;  4OI1 A;  3DOL B;  5HMY A;  2CQC A;  2UXB F;  2CA9 A;  2H48 B;  1HHS A;  3NKY A;  4UZB A;  4QYZ J;  1YWX A;  3NOG A;  5LSO A;  1TAU A;  1N6Q B;  2N3O A;  3T5K A;  4G1I A;  2V0N A;  3T9Z A;  2QA1 A;  5C2G A;  2DNN A;  1IBK F;  1SJR A;  3FUY A;  4J9K A;  2QRR A;  4BC7 A;  4TU8 A;  4K50 A;  4EI2 A;  2YWW A;  4YR0 A;  4RKU C;  2VFV A;  1YSJ A;  4R8U A;  5T14 A;  2NRE A;  4WPA A;  2FD2 A;  1ARO P;  2V67 A;  3ZTQ A;  1FRH A;  3V6D A;  4X2B A;  5D4L A;  4CO0 A;  2EK6 A;  2A6O A;  1RAD B;  2GIQ A;  2V8H A;  4QWC A;  4USM A;  4DMZ A;  3A3N B;  3OVS A;  1N5T A;  1R6Y A;  2ZOM A;  3I0R A;  2DRA A;  1JQG A;  2BAN A;  2E1A A;  3QZ8 A;  2EFN A;  3CC2 S;  1AYE A;  5CAA A;  3MPY A;  4Y6I A;  2IHR 1;  1RAG B;  2RQC A;  1M1K T;  2R7Q A;  3KLH B;  3WC0 A;  4JI6 J;  4R0J A;  1ZA1 B;  1WEX A;  2PMZ D;  3SYZ A;  3GYN A;  2WVD A;  4NXM J;  1NSA A;  4Q7A A;  4Q45 A;  4OYM A;  1JLQ A;  1HBN B;  3EDR B;  3MAA A;  3CF5 Q;  3T1H J;  1ZPW X;  3TA2 A;  2O3D A;  1DQA A;  3OTC A;  5HAO A;  4F4X A;  1K0V A;  4YY3 F;  3QWP A;  5HK4 A;  3LA0 A;  1KHW A;  3MM6 A;  1CJT B;  1LXJ A;  3BYR A;  3DDN A;  2C2Z B;  4K0K J;  2ZFH A;  4N76 A;  4K4S A;  2R7T A;  3IS9 B;  5B0C A;  4ENO A;  5EWG A;  4PWD B;  5HI7 A;  3RR8 A;  4DCP B;  1X31 C;  2MLZ A;  5E0O A;  2MQO A;  1S1U B;  2IJN A;  1VQK S;  4RWX A;  3IRX B;  1UVI A;  2R8J A;  3QJP A;  1HW8 A;  3TJ8 A;  1LQ9 A;  3U7J A;  4DV3 F;  2CG8 A;  4QWA A;  2GA7 A;  2VBX A;  4CNZ A;  2R42 A;  3RBX A;  2OEL A;  1N33 J;  2FJB B;  3EVW A;  3ET6 B;  2MJN A;  3U1N A;  5C24 B;  4GKK J;  2DNR A;  2RIL A;  4YFU A;  4KHM A;  5IV3 A;  1N5S A;  2WAQ D;  3I87 A;  3OFH A;  5LSR A;  4DSL A;  1UVL A;  4NYP A;  4PZV A;  1VQ6 S;  3OL9 A;  1U45 A;  3KHH A;  3PW2 A;  4AT1 B;  1T03 B;  3KTQ A;  2UV8 A;  1WJ9 A;  4DBQ A;  5BYS A;  1R0B G;  3DNC A;  1C4C A;  1RCX B;  3M6W A;  1WTB A;  1X9S A;  3OVB A;  2HHX A;  5EX0 A;  1Y11 A;  3C19 A;  1WWH A;  3CUN A;  1DAR A;  1FKA F;  2PT0 A;  3I4H X;  1JLG A;  3DLK A;  3PX4 A;  1AUD A;  4DSK A;  4KT0 C;  1FRM A;  2XYG B;  5DO2 A;  2JRS A;  4WJB A;  3MR7 A;  4UTG A;  5LOQ A;  1T94 A;  2OML A;  3IFE A;  1H6K X;  5D77 A;  3LUY A;  1QE1 B;  1S1X A;  2QSF A;  1RBL A;  5A0Y B;  3C6T B;  1J5O A;  4OL8 A;  4M5H A;  1RT2 A;  2R7X A;  3CJ8 A;  1S0N A;  2CWX A;  1U6F A;  1RLD A;  3CJ0 A;  5GAG I;  2WW4 A;  1ZYQ A;  4BS2 A;  1M5P C;  4J9N A;  1RK8 A;  3C66 A;  2HUR A;  4L72 B;  2B0G A;  2LEB A;  1IBL F;  2UVU A;  3TUP A;  2AYM A;  2IYG A;  3DRR B;  2D9O A;  3DDI A;  3GIJ A;  3MEC A;  5GAH U;  4LQ3 A;  5IT9 Y;  2XUL A;  2E5L J;  1RT3 A;  1M1H A;  3J81 U;  1V5I B;  2KL8 A;  3FBF A;  5DRK A;  3BSO A;  1KRP A;  1UL3 A;  4QJV A;  2DNG A;  1P8G A;  2YNF A;  4WYL A;  4LR7 A;  2V69 A;  1I94 F;  1N33 F;  4LRC A;  4F50 A;  5J2P B;  3I55 S;  3CW2 C;  2OI2 A;  1MWZ A;  1R0A A;  2PMW A;  3GIR A;  1RJJ A;  1IN0 A;  3DLE B;  3NY0 A;  3OXG A;  3PM9 A;  3LAK A;  3T6J A;  3VR1 A;  2HFS A;  4C4W A;  3ITH B;  2DXD A;  4CLK A;  4ZIW A;  9RUB A;  4ZCM A;  1YQH A;  2V68 A;  3I4P A;  5IWA J;  1KWM A;  2IMO A;  2PI4 A;  3R9L A;  1NEE A;  4I6Y A;  3DRX A;  4NEY A;  1Y5I B;  4ZN1 A;  4RNO A;  1SH3 A;  5HMW A;  2F4V F;  4OZN A;  2C28 A;  2KZZ A;  4QZV B;  2JEF A;  3QNW B;  3BM7 A;  2KN4 A;  5KT7 A;  3T5H A;  1FJC A;  2J0Q D;  3CNQ P;  2VFS A;  1X4A A;  1TK0 A;  5BYR A;  1W2I A;  3A8I A;  4H4M A;  2J0X A;  3CDU A;  1CJT A;  1ZOT A;  4Y34 A;  1U25 A;  1FNO A;  3LW5 C;  2LEP A;  4NE9 C;  2PD1 A;  2NYI A;  1CC8 A;  2H9Z A;  4LSN A;  4I6W A;  4E0D A;  2Y9H A;  4X66 F;  3RRH A;  3K5L A;  3M1V A;  4NWB A;  2B7C B;  3TAP A;  2ZZN A;  1RKI A;  2QX0 A;  4I2Q B;  2VG7 B;  3ILO A;  3N28 A;  4X4N A;  4M94 A;  3M30 B;  1FTC A;  1FD2 A;  3GQC A;  2DY9 A;  1VC5 A;  2ZM6 J;  3ZTP A;  5IXU A;  3M8Q A;  3QGP A;  1GX5 A;  1EX8 A;  5KG6 A;  3DOK B;  4CWB A;  4GC7 A;  2RQK A;  4I7F A;  1WOP A;  2DIV A;  3RUB L;  4CLL A;  2PEB A;  4WYW A;  4B3R J;  1IQZ A;  3ISZ A;  2EFP A;  4DL4 A;  5JMN A;  4X64 F;  4ZJO A;  2L3M A;  4K2X A;  5HVG A;  3UR0 A;  1CUL A;  5KAK A;  4TQR A;  2GC8 A;  2RQ4 A;  4C9D A;  1RWW B;  4JB8 B;  1JXL A;  3QFW A;  1RHU B;  5ETR A;  3LWM A;  3E01 A;  4YME A;  2IC3 B;  4HH1 A;  3BJY A;  5DDQ C;  1TK5 A;  3TYT A;  4CCH A;  3CGI A;  3VAM A;  1FES A;  1Z2L A;  2ZHB A;  3C8Y A;  4UOF A;  1PYO B;  2WRM A;  1U02 A;  3B8H A;  3CWJ A;  3MPU B;  3G8S A;  5IWA F;  4ZCI A;  4MK9 A;  3KLH A;  1VQO S;  1L5U A;  4N8O A;  4ZPW R;  3J80 U;  3ULH A;  2YKP A;  4LJM A;  3M32 A;  3CCJ S;  4PUO A;  2DJW A;  2BJ8 A;  2XLJ A;  2V63 A;  4ED0 A;  2W4D A;  1R8H A;  2BXJ A;  3CCM S;  1PKU A;  4F26 A;  4QU7 A;  4O44 B;  4MJK A;  3MM7 B;  4FP9 A;  3TAM B;  4CLU A;  4DLG A;  3FCV A;  2V94 A;  1IBM F;  3HHK A;  4MTP A;  4AND A;  3MM6 B;  2AD9 A;  4AXJ A;  2BV3 A;  3GFZ A;  2C2K B;  4LSZ B;  3R2D J;  1RHM B;  2OPS A;  1S0V A;  2CUY A;  2DNO A;  3D66 A;  3KYL A;  4F67 A;  3R5A A;  2IJR A;  3MMC A;  3BGO P;  1I51 B;  2LEA A;  4P10 A;  4Y2A A;  4DV2 J;  2YNG B;  2FGC A;  5HLF A;  4C0B A;  3HCX A;  1KLM A;  1HQU A;  3CE8 A;  3LO3 A;  5IV4 A;  1H2T Z;  2XY5 A;  1VLY A;  1SQG A;  4K5R A;  1O5J A;  3TWZ A;  1G2E A;  3HKW A;  3PYE A;  4AXI A;  1U1P A;  2DEI A;  5KFF A;  1WG1 A;  3K5P A;  3EPI A;  1VBZ A;  3JAM U;  2HQI A;  2EEY A;  3BGR B;  4NLT A;  2XO7 A;  1S1X B;  3ADA C;  3VAL A;  1TKX A;  1LWC B;  3FFI B;  4OI2 A;  4OYW A;  1S4F A;  4RWW A;  4AE5 A;  4GKJ F;  1UVK A;  2MLX A;  2FC9 A;  3UDV A;  3WQP A;  3KG0 A;  3MI7 X;  4F0H A;  4CO4 A;  1VBY A;  1HHT P;  4NZ6 A;  1S1V A;  3K7R A;  2GX8 A;  1GMU A;  2E5H A;  5HAT A;  1TUG B;  2VL1 A;  4TNO A;  1Y4Z B;  2HNZ A;  2ZBC A;  2H1Y A;  2Z0G A;  3BSN A;  4ZPB A;  2XMJ A;  5DM6 Q;  4I6A A;  1YRX A;  3R5D A;  4FYV B;  2F8H A;  4L3N A;  4DV6 J;  1AB8 A;  1RSC A;  4B3O B;  4K0K F;  1PGZ A;  1LW2 B;  4WZM A;  5ETT A;  1RAH B;  2KU7 A;  2V2V A;  1RKJ A;  4LF4 F;  3I5B A;  2XSF A;  2UXD J;  3MHY A;  4O4G B;  4U7U K;  4JI3 F;  2VPZ B;  1GNK A;  3I96 A;  1VS3 A;  4HI2 A;  1H3D A;  4ECU A;  3TX8 A;  5G0R A;  3OUY B;  3TQ1 A;  3E3X A;  2XNQ A;  1ZM9 A;  4PYD A;  2HZA A;  2QL7 B;  2NXN A;  2Z2L A;  3ISN D;  4EO6 A;  5LXR A;  2EK1 A;  1RAC B;  3MMJ A;  3CJ5 A;  3AD8 C;  4MT1 A;  4IR1 A;  1FK9 A;  4G1Q A;  1LWX A;  1ACM B;  1Y10 A;  2QLF B;  5FJ4 A;  1BUX A;  2EKY A;  2DEJ A;  1I5O B;  1N32 F;  3JTO A;  4LSN B;  4FYD A;  1UWA A;  1WEZ A;  2CFX A;  2ZIT A;  3KLI A;  5C25 A;  2CVE A;  2B9W A;  2OFH X;  4LRB A;  4ZLP A;  1S48 A;  2RS8 A;  1VBK A;  2YNI A;  2PDA A;  3L9Z A;  3RU0 A;  4DV0 F;  3BEG B;  3GCW P;  5DLF A;  2UUB F;  1UVM A;  1X4B A;  3CUL A;  1QAJ A;  1B0T A;  1R8A A;  4RNH A;  3I0R B;  4Q2L A;  4OHZ A;  3NMA A;  5DET A;  1JLA B;  2VDI A;  4Y2K A;  1KTV A;  2MKY A;  1MN9 A;  2MEW A;  4YY3 J;  3T5L A;  5ADZ A;  3C3L A;  1GH8 A;  4ZP6 A;  4CTA A;  4O0I A;  1B7Y B;  3I31 A;  2ZBI A;  2BAC A;  1TEL A;  2CYY A;  1RQ0 A;  2BJ9 A;  1JLF A;  4QIF A;  4WCE Q;  1FHT A;  3FNN A;  3BO4 A;  4UQG A;  2CJB A;  2IRX A;  3A8J A;  3KK3 B;  3OBI A;  2UVR A;  3D9B A;  2XQC A;  2MDA A;  1KR4 A;  1WD6 A;  2W2N P;  1TL7 A;  3DU6 A;  3HSZ A;  3IAS 9;  4LFA J;  4CH7 A;  4UT4 A;  4WE1 B;  2CNN B;  2YKO A;  1F9E B;  2IRU A;  3I0S A;  2YNH B;  5E3C A;  3SDE A;  2HHH F;  2LU2 A;  5L1K A;  2QO3 A;  3VGU A;  3VV2 B;  2WB1 D;  4UOC A;  5KFO A;  3DHX A;  2CPZ A;  1X4F A;  2ZDP A;  3D4J A;  4PWD A;  4RLE A;  4Y65 A;  4QWB A;  1A9N B;  1XER A;  4PG6 A;  3CD6 S;  1S79 A;  4ITS A;  2G4B A;  2HEK A;  3CD0 A;  1RT3 B;  3AOB A;  3MR3 A;  4JI4 J;  3DFE A;  3EGZ A;  2AMC B;  4RW7 B;  2W8L A;  2UUW A;  1FDN A;  3R1H A;  2CWK A;  1RWO B;  2FJE B;  3PEJ A;  3CCS S;  2HAF A;  3ILJ A;  3KDO A;  3N9U C;  4H4K A;  4DCO B;  4K4X A;  4M5M A;  1X60 A;  2MYF A;  3NEK A;  2LP4 A;  2YKN A;  2RIJ A;  1JB0 C;  3I5A A;  4NI2 B;  2N82 B;  2KG1 A;  1SKW A;  2E5L F;  4F4Z A;  5EDW A;  2BQR A;  4IOC Q;  3HSJ A;  1IQT A;  4LBP A;  1NJW A;  4TY8 B;  3LPE A;  3KJF B;  4LIR A;  1B70 B;  2BZ2 A;  1HNI B;  1CVJ A;  5ITH A;  3MAQ A;  1NK4 A;  1TMM A;  4OYX A;  3U27 A;  2W9C A;  2QMU B;  3LQV A;  3PHT A;  2AIR B;  2F9J A;  2MHN A;  1U8W A;  3IR6 B;  2DVI A;  1GEH A;  2PFF B;  4TYA A;  2BUN A;  3HDS A;  4M95 A;  3M9O B;  1JLG B;  3DLK B;  5H9E K;  3R5C A;  4LF8 F;  2DK2 A;  2YWH A;  3CJ3 A;  5KFL A;  2H5E A;  3TA1 A;  2I38 A;  4HHH A;  5DLG A;  1ZZN A;  2RU9 A;  3I32 A;  1RT5 B;  4RNF A;  2V2K A;  5LXY A;  2R2R A;  1UFW A;  3FMB A;  5BR8 F;  1VQM S;  3CJT A;  2XI2 A;  2DXF A;  2HNY A;  1WC5 A;  4L74 A;  4ZP7 A;  5HMX A;  5GAD I;  5ETM A;  2GVZ B;  1FF2 A;  3UD3 P;  3MUT P;  2AEM A;  4LF6 F;  4LRA A;  2DNY A;  5IT4 A;  1ULR A;  1RZM A;  2OPP B;  3DXS X;  2CJX B;  4CLT A;  1HMV B;  2PGC A;  3MCM A;  1FDD A;  4EBE A;  3U1L A;  4ZVG A;  4DX5 A;  1FJG J;  1KVK A;  5CD4 H;  2VAS A;  3OR2 B;  4ZPC A;  1R7I A;  2J9C A;  1HBM A;  3KLG A;  3LAM A;  1YIT S;  4Z2X A;  2VIC A;  2NZC A;  4DDF A;  3K5M A;  1OQ6 A;  2M2B A;  5ETP A;  5J1P A;  4XPE A;  2HWH A;  4NXN F;  1R6V A;  2OEK A;  1GTE A;  1WKK A;  2CRL A;  3GR0 A;  2RDJ A;  5LT5 A;  5L1L A;  2PI5 A;  4YQW A;  4HHJ A;  3GJR B;  3DOL A;  3IAM 9;  2KJW A;  1WHW A;  3NOC A;  1DHM A;  2AW0 A;  1B4S A;  2H3E B;  3JSY A;  4RBV A;  2R2S A;  4QIE A;  4ES1 A;  4CTA B;  1SPB P;  5CCL A;  1RBA A;  2G2O A;  5BYQ A;  4B3M F;  3AB2 B;  2NZ4 A;  5EHH A;  1UET A;  3HHE A;  1KDN A;  2UUT A;  4DEZ A;  4ZVH A;  3LWL A;  2HWT A;  2ILZ A;  1UW9 A;  1CQN A;  2MHE A;  1VK3 A;  3MUM P;  5HN0 A;  2AX0 A;  2EPI A;  4BHQ A;  3MPV A;  3M9N B;  3AH6 A;  2JEI A;  1SL1 A;  3BS9 A;  4QIG A;  1NK6 A;  1BWE A;  2LQ9 A;  5K8N A;  3NBP A;  4KO0 B;  3RB4 A;  4IFY B;  4ZVP B;  4C0O C;  2VJV A;  1Q8I A;  3N79 A;  1U47 A;  4LF8 J;  4DR6 F;  2VPY B;  3K2Y A;  1B3T A;  1XMO J;  5HQM A;  1URN A;  1FDB A;  4U9R A;  2CAJ A;  2PC6 A;  3PO4 A;  4FBT A;  3W5Z A;  2V2Q A;  5BR8 J;  2AJ2 A;  2QLW A;  2FY1 A;  2WVC A;  3MDF A;  3TVZ A;  3IWL A;  3EMT A;  2IA6 A;  3DLL Q;  4S0M A;  2HPU A;  1X7V A;  2MZT A;  2W4C A;  3D28 A;  3QT8 A;  1HPZ A;  4F2R A;  4BCA A;  5KFW A;  3W9J A;  2HVH A;  2ZD1 A;  2CJY B;  1BQM B;  2GJI A;  2L48 A;  3DI6 B;  4M1K A;  3AXM A;  3BGR A;  2DRD A;  2G2Z A;  4UOH A;  2W2O P;  1HWI A;  1UJ4 A;  1LFP A;  3KUG A;  5U47 A;  1WG5 A;  2MKS A;  2FJA B;  4WFY A;  5KT2 A;  4FXV A;  1T8E A;  1IKY B;  3QGH A;  1F5A A;  4IKA A;  3SSR A;  1HWJ A;  1T9W A;  3HHL B;  4NRU A;  2PII A;  1FX4 A;  1K44 A;  3E01 B;  4LR9 A;  3RGI A;  2MGZ A;  1N5V A;  1R0C B;  2GQC A;  4I2P B;  4J9R A;  1VHI A;  3T1Y J;  1HNZ F;  1HNW J;  4KAI A;  3ZZO A;  4R0E A;  2GHP A;  4E98 A;  3MR2 A;  3PCO B;  3RAQ A;  2HQF A;  1N36 F;  4Y0F A;  1YJ7 A;  2DTJ A;  4OX9 F;  1DTT B;  2E1P A;  5CYM B;  4JI6 F;  4ECV A;  2DO0 A;  1OPI A;  1A7G E;  1JLC B;  2A10 A;  1MLA A;  3AQO A;  3IXQ A;  3SCL E;  5HVH A;  4WTY A;  4CM0 A;  1WTF A;  2RSQ A;  3CCE S;  3PJ9 A;  1D1U A;  5D8H B;  5ETO A;  1LW2 A;  3BSA A;  3IRW P;  4DR5 J;  3DRY A;  4LRF A;  1IKV B;  2H4W B;  3CJS A;  2D1C A;  1FFG B;  2BJE A;  4IG0 B;  2HS3 A;  3CCQ S;  2RRN A;  2CDQ A;  1EHW A;  4CP5 A;  4KV8 A;  3QO9 B;  5DJB A;  1HNW F;  3EUN A;  1N0U A;  5HJX A;  1MU2 A;  1BD6 A;  1HAR A;  2M4M A;  3L4B C;  2M5Y A;  2OPP A;  3EIC A;  4JBC A;  3DRS B;  1FKP A;  1HNV B;  3QIP A;  2H5I B;  3L95 X;  3QSI A;  4LRD A;  2DGS A;  4LVN P;  5J2N B;  1GXT A;  1RAO A;  5JVH Q;  1NK0 A;  2ZH7 A;  3GP9 A;  3M8R A;  2YNG A;  3BQ0 A;  1RT1 A;  4JI8 F;  1V3Z A;  1RTJ A;  4F3M A;  1B99 A;  5FLX U;  2HZV A;  2QG9 B;  2QN6 B;  2I0X A;  4A47 A;  1WEY A;  3DLJ A;  3FZB A;  1FWP A;  3EM1 A;  3MM9 A;  2AV5 A;  4ECS A;  1RTH A;  1X4C A;  3H42 A;  4CO3 A;  2CAD A;  3KLI B;  5KFJ A;  1WEL A;  3PR4 A;  3KJQ B;  1K9M T;  1NSP A;  3O1L A;  3RB6 A;  3W2V B;  4MH8 A;  1FWK A;  1NJY A;  1QSL A;  2ZH4 A;  2XZW A;  1X4E A;  4G65 A;  4UUW A;  1JLA A;  4C48 A;  3MAH A;  2AZ3 A;  3MZI A;  1JKH A;  1NBE B;  4MIW A;  1CUL B;  3DLG B;  1LWF B;  1IKX B;  4WP8 A;  3BF4 A;  2HK3 A;  3TEH B;  4DJB A;  4NCG A;  4RBU A;  1WHX A;  2ZC3 A;  4ED4 A;  3LGH A;  2MQP A;  3JSM B;  1UEU A;  5L39 A;  2WOM A;  5K8M A;  4EEY A;  3TI0 A;  3CMA S;  3AJ1 A;  1HLW A;  4TN2 A;  5K8O A;  5D3G B;  1O0P A;  4FVM A;  2N4C A;  2BBE A;  3BGL A;  4Y28 C;  3D1O A;  3DXB A;  4GVB B;  1LWE B;  1AFJ A;  2K3I A;  3CJK A;  4EWT A;  2HVD A;  3FKB A;  1VQ9 S;  2Z2Y B;  1RLC L;  2Z8Q A;  4OLP A;  1T02 A;  1Y5N B;  3ZXW A;  1HR0 F;  1YZ6 A;  4C3M A;  2EWH A;  4K4V A;  1EIY B;  2OD4 A;  4P7T A;  1QDU B;  4FBU A;  4QR2 A;  2VBZ A;  3UPF A;  2D41 A;  2IYI A;  4IRD A;  1HBN A;  1UWB B;  3FRY A;  4BDP A;  4N5S A;  1DLO B;  1WSV A;  2KRR A;  2XTJ P;  5CD4 A;  1C1B A;  1LOU A;  1P9Y A;  2G0J A;  4K4Z A;  4DQQ A;  2DHA A;  3NBP B;  1PC5 A;  4KO0 A;  4GKJ J;  1HWU A;  2POK A;  3UDE A;  2RD5 C;  5HJY A;  2B7B B;  3FGV A;  4HKQ A;  4TY9 A;  4F0M A;  4B9T A;  4NI2 A;  5KG2 A;  1JJ4 A;  2E1M C;  3BO2 A;  4ZKA A;  3LP0 A;  3W60 A;  1HR0 J;  2YBV A;  3US5 A;  3PX0 A;  1IJE B;  2Q66 A;  1R43 A;  2J7W A;  3MWB A;  5FDL B;  2FDN A;  4KYZ A;  1L3T A;  3HT3 A;  2H4Y B;  3SV3 A;  1OYE A;  1AZS B;  2OMO A;  1HQE A;  1IR0 A;  1HNI A;  1YLX A;  2F8M A;  2W01 A;  4KKO B;  4ZP8 A;  4ELT A;  2DYA A;  4IRK A;  1H2V Z;  4AQY F;  3GWC A;  2KH9 A;  2QSW A;  2D7S A;  1REV B;  1NH7 A;  1EET A;  2FHM A;  3AFG A;  3WX4 A;  2MB0 B;  4P7V A;  5AXM A;  5KFC A;  2IJF A;  4J9P A;  4GVL A;  1NPR A;  4A8O A;  4X4V A;  1H38 A;  1SQF A;  2KXH A;  5GMK a;  2BW7 A;  2LXF A;  3JYT A;  4NLV A;  4CLZ A;  3I5C A;  2JVR A;  4KGZ B;  3U1M A;  4AUK A;  2NPI A;  4DX8 H;  2MQL A;  5KFH A;  5B08 A;  4KY3 A;  1WF0 A;  3G96 A;  1U2F A;  4PPZ A;  4ILR A;  2ZH8 A;  2KHD A;  4DSF A;  5EN1 A;  5LJ3 Y;  1U6Z A;  3LTO A;  2HHW A;  4QCL A;  4C8M A;  1UKU A;  1C0T A;  4JI0 F;  2K1R B;  3SDE B;  1PJ6 A;  1UPM B;  4UW2 A;  5KFD A;  2DBB A;  1S9E A;  4UST A;  2IBO A;  4ZVO B;  4HTJ A;  4CYU A;  1HQ2 A;  3U02 A;  3KJN B;  1QTM A;  4QWD A;  2ZOG A;  3KLF A;  2KJV A;  3AA8 A;  1ZZF A;  3LGN A;  4HYK A;  5FD1 A;  2AYB A;  4DPW A;  5ETL A;  2WW8 A;  2NXC A;  2XC9 A;  2DR7 A;  1K47 A;  5J2M B;  2PFD A;  4EGL A;  4JI1 J;  2MKI A;  4A8W A;  3KUE A;  1BC6 A;  3HHN B;  2C3Y A;  2HMI B;  3V81 A;  1SC6 A;  3BBF A;  3B82 A;  1DQ9 A;  3VGT A;  1VQL S;  2C3P A;  2RQM A;  5IOL A;  4XTT A;  5HRO A;  4LF6 J;  4DF4 A;  4QIW D;  3JTN A;  2WOM B;  4DR2 F;  1N4L A;  1XQI A;  3FEX B;  3O3L A;  2EFO A;  5D3G A;  2XLK A;  1T9Y A;  2M8H A;  3QGI A;  1Q86 T;  3K5N A;  5T7L A;  2X3D A;  4MKA A;  2Z4P A;  2CXE A;  2O01 C;  3CCT A;  2ZE2 A;  3UNY A;  5LMU F;  4LFC J;  4J90 A;  1RWK B;  2C3M A;  3HI9 A;  1MML A;  3JTP A;  3DLH A;  2ACY A;  2Z2Z A;  4C8Y A;  3OFF A;  5C7P A;  2K7K A;  5KFA A;  2FLP A;  2ILY A;  4O4G A;  4LF4 J;  3O5T B;  3NNC A;  3CSK A;  2XZT B;  2MQN A;  3S01 A;  2COL A;  2HND A;  3DOM B;  2HQC A;  2YKM B;  4M5N A;  1IWG A;  3QAT A;  5F9N A;  4HEA 9;  2ZKU A;  1Y5L B;  2BE9 B;  1BWV A;  2OP5 A;  3DCA A;  5KFX A;  3V5R A;  2BJ1 A;  1VFJ A;  2VC1 A;  1G4C A;  1UJ5 A;  4CLY A;  1HNZ J;  3P5T L;  1RU2 A;  5B7W A;  2E7V A;  2KO1 A;  1D09 B;  2HBQ B;  3PRB A;  1YJR A;  2KKH A;  5J2Q A;  5ETV A;  4YHH F;  3GR1 A;  1F6T A;  3ICL A;  4I68 A;  1CJV A;  5HL7 Q;  3GSD A;  3UO0 A;  1T9X A;  4KE5 A;  2GGP A;  4DFP A;  4JYA F;  3IP0 A;  4LF7 J;  3Q8S B;  3PG9 A;  2YX7 A;  2HMI A;  1H7W A;  3K5O A;  1SQE A;  2ABY A;  3OQ2 A;  4NLX A;  4CH0 S;  1RWV B;  4XPC A;  4DV0 J;  2UUB J;  2DNH A;  4MK8 A;  1FRX A;  5F8J A;  5IM0 B;  3RRK A;  2RUG A;  3IWN C;  1B7F A;  1OJ4 A;  2ACM A;  1NK5 A;  1RGV A;  3F56 A;  4PG7 A;  1XMQ J;  1EET B;  4X65 F;  1UWB A;  2OEM A;  1NM2 A;  2OFG X;  3HSD A;  4LT6 A;  4ETX A;  4MKY A;  2FLN A;  2M8D B;  2B6A A;  2G0I A;  3OL6 A;  4ELU A;  1U1Q A;  2YKN B;  2KB2 A;  4RPF A;  5DDO C;  2X3G A;  4C8Z A;  2BQ3 A;  1JXE A;  4K4T A;  3M8P A;  2XY6 A;  2C1E B;  3GII A;  1VR6 A;  1M5O C;  3P3D A;  1WG4 A;  1L3V A;  2BJ7 A;  4DHV A;  2NXE A;  3PIP Q;  1JXV A;  3PKM A;  4B3T J;  3IC1 A;  2VQF F;  2IAJ A;  3POT A;  4RL1 A;  3GJQ B;  2QJ3 A;  1HWL A;  1TU0 B;  5F9L A;  5DGB A;  3GIM A;  2KXF A;  3WX8 A;  2JC0 A;  2I8E A;  1T3N A;  3GZ7 A;  4LF5 J;  4Y2C A;  2Y8Y A;  2QV6 A;  4J91 A;  3EWG A;  3THV A;  3R6G B;  3HJV A;  4A8M P;  3ENA A;  4TU7 A;  1OY9 A;  4LFB F;  4FPI A;  4J5O A;  4OJG A;  3K0J A;  3H59 A;  4Y00 A;  1NDK A;  2DCL A;  1YVF A;  3TNV A;  1SJ4 P;  2PA3 A;  2QIF A;  4LRE A;  1U1O A;  3HXM A;  5I3Q A;  3WZ0 A;  3UNG C;  1VQ4 S;  2FLL A;  2E1R A;  1HPZ B;  2BJD A;  1FER A;  3OTE A;  1RTI B;  2RF2 A;  1N32 J;  1PAU B;  5HO4 A;  4K8R A;  1R27 B;  2FC8 A;  4ED1 A;  1PJ5 A;  4DV2 F;  2DR5 A;  2HQD A;  1FX2 A;  1J5E J;  3E2E A;  1NCL A;  2Y0S D;  1ZPV A;  2V5H G;  1PIL A;  3RB0 A;  4ZK7 M;  5DG7 A;  3LH2 S;  2R8I A;  3NG8 A;  4LSL B;  3WC2 A;  1QAY A;  4A46 A;  1ZTT A;  4WKY A;  2VA2 A;  3ZFV A;  4PXC A;  3ZC4 A;  2HAI A;  3OL7 A;  2MZQ A;  3CCR S;  3J7Y U;  3HKZ D;  1ZBT A;  3QQC D;  4KHP F;  2HLU A;  1S6O A;  5THW A;  2DNK A;  1IXK A;  3CT9 A;  1PG5 B;  1XR7 A;  2F7V A;  1DTT A;  3CCZ A;  1U48 A;  2XMW A;  4M63 A;  2DCU B;  3MM8 B;  5ETK A;  4CZC A;  3GV8 B;  2CPD A;  5IS2 A;  2VB6 A;  1CC7 A;  4DL3 A;  2XM3 A;  1GX6 A;  3MEE B;  2AGO A;  1QVF R;  2FPH X;  3Q8Q B;  5LSL A;  3T1A A;  4B3T F;  3X3U A;  3MEC B;  2B3T B;  5F8G A;  4ZVU B;  1PAE X;  1QVG R;  3R7S B;  5KG4 A;  2G1H A;  3MXH P;  2VD3 A;  2HNZ B;  2H51 B;  3GJT B;  3QO9 A;  4U67 Q;  2D3O R;  2XWY A;  2ZVI A;  2WSF C;  3I6P A;  2QE5 A;  1RB0 A;  2WZ1 A;  4IQX A;  4TKT A;  2RRA A;  4FZV A;  3NGD A;  1VQN S;  3H4B A;  1IBK J;  4JI4 F;  2C2N A;  4OX6 A;  4K4W A;  3OR2 A;  4N56 A;  4IUF A;  4M5K A;  3UVJ A;  1VMB A;  3E51 A;  2BM1 A;  5KFZ A;  3QYY A;  2GO8 A;  2CPF A;  1S1W A;  2C3U A;  2ALZ A;  4ED5 A;  1YGY A;  3DOM A;  3OHB A;  3AJD A;  2GCF A;  1NPK A;  1XR6 A;  2DGO A;  1X8D A;  4CI0 B;  4KB7 A;  1J27 A;  3RRG A;  3C14 A;  3F41 A;  1X4H A;  1YX2 A;  1X5T A;  2V34 A;  3OTO F;  4TU9 A;  2F65 A;  3UI3 A;  1OYD A;  5DZ7 A;  1TR0 A;  3P8B B;  3KLE A;  3NAI A;  4DR1 J;  1OSC A;  1HI8 A;  4EO8 A;  4C97 A;  4B08 A;  1RT4 B;  2JEJ A;  3CIM A;  2UXB J;  1G3O A;  2HGN A;  3ZTR A;  2AQ4 A;  1VQ8 S;  1R8B A;  3TUI C;  3TUZ C;  3Q24 A;  4X4O A;  4DR7 F;  2L9N A;  3GYX B;  4NLP A;  4JV1 A;  4I2P A;  4WP9 A;  5LMN J;  3VHQ A;  2SXL A;  2H5J B;  1HIY A;  2VG6 B;  5LJ5 Y;  4KGK A;  3CCU S;  4DSE A;  1WI8 A;  2EBG A;  2HHS A;  4OZL A;  3B4M A;  3QGG A;  4B3M J;  1NB2 A;  5KT6 A;  1D8Y A;  2UU9 F;  2R7O A;  2ZOF A;  3WHI A;  1XBW A;  2HFV A;  2RKI B;  2R7R A;  1N5Y A;  1B0V A;  1SCJ B;  2AZ1 A;  2CQ4 A;  5DS7 A;  1XIQ A;  3IMQ J;  1ZS6 A;  4NML A;  1YJN S;  4FF2 A;  1RT6 A;  1CQM A;  3QWU A;  2ZWO A;  1JX4 A;  1SUQ B;  1TKT B;  2OO4 A;  2ASD A;  5C24 A;  5HMZ A;  2QFI A;  2HS0 A;  2Q6B A;  4MYT A;  3UWT A;  4R5P A;  1RA7 A;  1S57 A;  3LP1 A;  4J9O A;  1FDA A;  1OS5 A;  1U24 A;  4ZA1 A;  5E3A A;  2JSX A;  3IBW A;  5DGA A;  1EKR A;  1EP4 A;  2VQF J;  2ZJP Q;  2FHJ D;  2GFF A;  1RTZ A;  1WOR A;  2A2C A;  2YX1 A;  2LYV A;  3RTV A;  3MOJ B;  2HHU A;  2AGQ A;  2XG8 A;  4FXW A;  3DRR A;  1S1T B;  4TVA B;  1H0H B;  3N6N A;  1FXL A;  4JI3 J;  1SV5 B;  4IRC A;  2HLT A;  1L3K A;  4O44 A;  3H4D A;  3R27 A;  5HSP A;  2HS4 A;  1E6Y B;  4OZ0 A;  2HZC A;  1SKR A;  1BE4 A;  3DHW C;  1ZM4 A;  4QIV A;  1ZTW A;  4JI7 F;  1XMO F;  1GAO A;  2UZA A;  3DN9 A;  4ZHR B;  4DUZ J;  3IBF B;  4DZ6 A;  7FD1 A;  4DX6 A;  3RYL A;  2V8G A;  3VQS A;  4L6V 3;  1SXL A;  1WC3 A;  3VAJ A;  1T0T V;  3RW7 A;  3DC2 A;  3TZW A;  2VKR A;  3BPS P;  3DGP A;  4IQM A;  1CPZ A;  1FI4 A;  2RH3 A;  4RR5 A;  1WHV A;  5IZH A;  4K7Q A;  3KLV A;  1SKU B;  3SCI E;  5DZ6 A;  2LQ5 A;  3PW7 A;  2NSB A;  2YKM A;  2F8E X;  3GSI A;  4HL9 A;  5E7O B;  4YR3 A;  4X4T A;  4DV1 J;  1RUS A;  2ALY B;  1DJ0 A;  4FVC A;  5C42 A;  4JI1 F;  2XYH B;  1SC3 B;  3HZE A;  4EK2 A;  4F2S A;  1VIS A;  1TQL A;  4GVB A;  3J7Z T;  2K1R A;  2IM1 A;  2DNL A;  4PWU A;  1V3S A;  4CLW A;  2ZZT A;  2YH1 A;  2MY7 A;  2DY1 A;  3H0P A;  2MKH A;  1S1V B;  1YK9 A;  4FXD A;  3AQP A;  3CCL S;  8AT1 B;  2VZ9 A;  1FNX H;  2J9D A;  1NME B;  5F8H A;  1VRU A;  3BQ1 A;  1RT2 B;  3IR7 B;  2FY8 A;  2CZV C;  3AA9 A;  2E1C A;  2K06 A;  4CO2 A;  2RT3 A;  1NJZ A;  3HO1 A;  1JLE A;  1FJE B;  3MFH A;  1QUV A;  2B4P A;  4D3H A;  5AE1 A;  4LF9 J;  4PAB A;  2GVZ A;  3M05 A;  3VCD A;  1IVZ A;  2BOP A;  4LF2 A;  3C16 B;  4ZCK A;  1FO1 A;  1VJW A;  3OD2 A;  2XSJ A;  2V4R A;  4IOB A;  4OI4 A;  2BQU A;  2B4V A;  4H4M B;  1ZM2 A;  3FCW A;  2LXU A;  1KEK A;  5EX3 A;  3FBC A;  1NHK L;  3NGR A;  3QLH A;  2Z57 B;  1TVR A;  3P4U B;  1VC6 A;  2CPI A;  2G13 A;  2DHH A;  1KVI A;  4PXD A;  1NU4 A;  3LP0 B;  5CAB A;  3D1H A;  4CNY A;  5A8K B;  3Q23 A;  2P8I A;  1LK5 A;  3QAU A;  1E6V A;  1R0A B;  4ZVT B;  5KFG A;  2HVI A;  2HVE A;  3J7Z 5;  4HAC B;  4F4W A;  4WFN Q;  5L9N A;  4CRJ A;  1JMT A;  3UDL A;  3PXG a;  3BR9 A;  1HI0 P;  1HQE B;  4LF7 F;  5B09 A;  1Q0N A;  4NL5 A;  2V6A A;  5GAH I;  4X4U A;  1UMJ A;  5CZX A;  2Q3P A;  4RW6 A;  2VQE J;  2MZS A;  2CPX A;  2DH7 A;  3CJK B;  5DG8 A;  3PYD A;  3PNI A;  4JP8 A;  5F3Z A;  4TQS A;  2ZH6 A;  3SCK E;  1U8S A;  2C2R A;  3EZO A;  3MAA B;  4ID5 A;  2CJ9 A;  2L9W A;  1KNZ A;  4DCJ B;  2YTC A;  5CYJ A;  1NRK A;  1T7P A;  2YX4 A;  3R6L B;  3T5J A;  1NZ8 A;  1V9O A;  1WF1 A;  2ZBQ A;  5KFS A;  4X4P A;  2W9B B;  4AL5 A;  2IDL A;  5GMD A;  4FYW B;  4M5J A;  4A8S A;  2HHT A;  1YKW A;  4ZMM A;  4IH7 A;  1X9W A;  3ZTO A;  1LWE A;  4DU7 A;  2MZJ A;  2FQQ B;  4OIX A;  2VG7 A;  3A12 A;  2HRT A;  3FVY A;  1FFS B;  3HVA A;  4WIQ A;  2CJK A;  2XCP A;  2XBP A;  3DYA A;  3G6E S;  5J1E A;  3Q2T C;  2FVC A;  4ECX A;  4H4K C;  5EWF A;  4LIW A;  1WDT A;  1S7H A;  4Z37 A;  3VAG A;  3M8S A;  4B3R F;  1QTN B;  2DIT A;  2KFZ A;  1JJH A;  2O1P A;  4TLQ A;  2XNR A;  1FXD A;  4ZHR A;  2GZO A;  3M9M B;  2EC2 A;  4DF8 A;  1EQ0 A;  1XR5 A;  4QOT A;  1N48 A;  2OLW A;  3M32 B;  3NGK A;  1GK8 A;  3BDP A;  4RBT A;  4KH1 B;  1Q4R A;  2Z58 B;  2ROG A;  2JVO A;  4JV0 A;  2VHG A;  1TL3 A;  1T05 A;  3CC7 S;  4QR1 A;  5I3U B;  1B64 A;  1OWX A;  2IY5 B;  3IWX A;  4WBF A;  2RML A;  2DNZ A;  4ED3 A;  1VQP S;  4OX9 J;  2QYG A;  3DLB A;  1FEH A;  3OJS A;  1H7X A;  1UFL A;  1YJT A;  4KGV B;  3DMJ A;  3H5Y A;  1TV6 A;  3UN3 A;  3GE9 A;  3T1Y F;  3KG4 A;  2V2Z A;  1SI9 A;  1TP7 A;  1HNX F;  1Q53 A;  1YBU A;  3TVY A;  5DM7 Q;  1ZET A;  3KMS A;  3R97 A;  5D4O A;  5GAD U;  2RDD A;  4C11 A;  2W7P A;  1K8A T;  4L76 A;  2V9K A;  2WON A;  2CQG A;  1NHV A;  1X4D A;  2KDO A;  4K2J A;  1BLU A;  1H73 A;  1VQS A;  2DXE A;  4PEO A;  4RW9 B;  4C0H A;  3OW2 R;  2UXC J;  2RUS A;  4X4R A;  5CHC B;  4Z7C A;  1HA1 A;  2XEX A;  3BRE A;  3M2U B;  2WBR A;  4ZOS A;  3S7R A;  4MK7 A;  1LWC A;  4AFF A;  1QM9 A;  2BE2 B;  5CH7 B;  1PCA A;  2QLB B;  1WC6 A;  2CQ3 A;  3GIK A;  1NPP A;  2OPS B;  2B8Q A;  5G0R B;  3K17 A;  1YBA A;  4AL7 A;  1TKD A;  4ZDN A;  1L3S A;  1ROF A;  3JQM A;  4ZVE A;  2K8G A;  1H72 C;  4DN9 A;  1K73 T;  2Y3Y A;  2IBK A;  3D68 A;  3H2V E;  4W92 B;  3PJX A;  3V4I A;  2GW8 A;  1HQU B;  5KT3 A;  2ZH3 A;  3AXK A;  1R31 A;  3KKF A;  3H8Y A;  2GIR A;  2MJU A;  2AJQ A;  2FIU A;  4ICL A;  2M0G B;  3P96 A;  3AJ2 A;  2AGP A;  2JEG A;  1UCN A;  2V4J A;  5A76 A;  3LAN A;  1S9F A;  3KLE B;  4UY8 5;  3ZNU A;  2MKC A;  3H90 A;  1SL2 A;  2LQJ A;  4MIA A;  4USV A;  3A8E A;  5J2P A;  3MM9 B;  2NCK L;  3DU5 A;  5KFU A;  2X1A A;  3CIZ A;  1NH8 A;  2XMM A;  4L73 A;  4X4S A;  1NLK L;  1NK9 A;  5T7L B;  2B56 A;  1D9A A;  1LW0 B;  1RU1 A;  1TAQ A;  3VQT A;  4UY8 T;  3MM5 A;  4PXB A;  3NXZ A;  2NPF A;  3TX0 A;  1SJ3 P;  2LMI A;  2YWK A;  4QBU A;  4Q43 A;  1F3V A;  1UTA A;  2CJA A;  4UOG A;  2B4O A;  1F3F A;  4M5G A;  5A8R B;  1KVJ A;  3CJ4 A;  1N5Q A;  3V6D B;  1NKC A;  1NJX A;  3VGS A;  2HND B;  4JI2 F;  3M8Y A;  2DIU A;  4J9Q A;  2VG5 B;  1OMS A;  3AB4 B;  2YWE A;  4F4Y A;  1W7W A;  1KQK A;  1FKO B;  1NK7 A;  2FJX A;  3C6U A;  2EBE A;  2IVM A;  4OYB A;  2BR0 A;  1G1X A;  2W24 A;  4D3G A;  1KSP A;  2EG2 A;  2BEF A;  4IG3 B;  4RZR A;  2OIH A;  3D6M B;  3HHD A;  5L46 A;  4ECY A;  3TO8 A;  1FJG F;  4DV5 F;  1U0H B;  3I9Z A;  1IM6 A;  1NUE A;  3M6V A;  4QR0 A;  4RUB A;  2CQI A;  1BXN A;  1RHQ B;  3CB4 A;  1X5O A;  2IM2 A;  3FEY B;  3N01 A;  2XMV A;  2AWZ A;  2YXL A;  3W7B A;  3W9H A;  2GVD A;  4LBI A;  3UVJ B;  3HVW A;  3SIP B;  2YWG A;  2YNI B;  1S1T A;  1GXU A;  1NZA A;  4NAS A;  4RW6 B;  2A18 A;  4ANE A;  2I6W A;  1SL0 A;  2VIH A;  2ZDO A;  4EFA C;  3H5X A;  3QRR A;  4ER8 A;  1HW9 A;  2OUG A;  3SSQ A;  2KZM A;  8ATC B;  4UF4 A;  3J81 j;  1EKS A;  1FFW B;  2NLW A;  4BWJ A;  3RAX A;  1ICE B;  4RU2 A;  1H2U X;  4FYX B;  1TL3 B;  1ZM3 A;  1T11 A;  3DDK A;  4P75 A;  1NAQ A;  1VRT A;  2J8S A;  3ENV A;  3MMB B;  5KFR A;  2APO A;  4DG1 A;  2GMH A;  2AF6 A;  3G82 A;  3MPW A;  3N5B A;  4KQZ A;  2CNK B;  2QL5 B;  3BPD A;  4O23 A;  4DS4 A;  2VKZ G;  2YQ1 A;  4DWI A;  2WHO A;  2V8D A;  2AJ1 A;  2DT9 A;  2ZH5 A;  3M2R B;  2DGQ A;  1VRQ C;  3H20 A;  2VON A;  3B4D A;  3VAI A;  1RTD A;  2CNL B;  1RHK B;  3G6X A;  1PBA A;  2PEH A;  3NGS A;  2D69 A;  5E2Q A;  4C11 B;  4DOZ A;  3A4T A;  4NCA A;  3NNH A;  5JJB A;  2Y1L B;  4MYU A;  1I1G A;  3SCJ E;  5IM0 A;  3W3S A;  2HKE A;  3MEG A;  1XEZ A;  3D3B J;  3R5G A;  4WTO B;  2LCW A;  1BQM A;  4NXM F;  1MN7 A;  4Q0B A;  2PMH A;  1OQ3 A;  3OXF A;  4ID5 B;  2HFN A;  2YQ3 A;  1PBU A;  3EGV A;  4G6V B;  3DM2 A;  4RW4 B;  4DU8 A;  2P5V A;  4DL0 C;  3SV4 A;  1T9T A;  3EXY A;  5H9E J;  3N4W A;  1T05 B;  3M8P B;  4ZVS B;  4U95 A;  2Z30 B;  2ZUA A;  4BLG A;  3Q86 A;  1UEK A;  2WBM A;  1SUQ A;  1TKT A;  1WKL A;  1T9V A;  2BRL A;  3SSS A;  5CA5 A;  4K59 A;  4ED8 A;  3PV8 A;  1D0E A;  4GC6 A;  3POT B;  2ZH1 A;  1CJU B;  1OSD A;  7AT1 B;  3H7H B;  2AJF E;  2FZC B;  3GPA A;  3H25 A;  1J5O B;  4USH A;  2KG0 A;  4KJI A;  1UJ6 A;  5CCM A;  2JLF A;  2LLZ A;  1RA6 A;  4TYB A;  2G9O A;  3EVM A;  3EZU A;  3AOD A;  4J9U E;  2OGU A;  3DGV A;  1HL6 A;  3JXO A;  2VPX B;  3CME S;  4C8L A;  2WVE A;  4PQA A;  4F02 A;  3R5J B;  2MZR A;  3M4X A;  2XY7 A;  1PYS B;  2JFK A;  4HT5 A;  1S9E B;  3GFH A;  4TY8 A;  3SXL A;  1C0U B;  3QT6 A;  2ASL A;  5A0Y A;  3TVK A;  3GFY A;  3FSI A;  1D8Z A;  1YRT A;  2ZEJ A;  4O3P A;  3HVR A;  4P2F A;  3NMR A;  4DR7 J;  3NS7 B;  5A6P A;  4YR2 A;  2IFX A;  3KK1 A;  4NEZ A;  3UQS A;  3OR1 B;  1TZ0 A;  5F8L A;  1Q7Y T;  3K8V A;  4ES3 A;  2ZBR A;  4I69 A;  3V4I B;  4IR9 A;  3J7A 1;  2HBZ B;  3M2V B;  3PTW A;  4NX9 A;  1N6Q A;  4FNI A;  4BC9 A;  4YDD B;  2DR8 A;  2R7V A;  2VG5 A;  1FCA A;  1V3R A;  3P5B P;  5HRO B;  4P6Q A;  1UW4 A;  2W2M P;  2YNF B;  4BWM A;  4USK A;  2NXU A;  2RDI A;  3FBE A;  4KRW A;  3UR3 C;  5JVG Q;  4X64 J;  3MTK A;  5CXT A;  2PSZ A;  1K1Q A;  5KTQ A;  1KOH A;  2LDI A;  2X51 A;  3EGW B;  3SFU A;  5AXK A;  4DL2 A;  2VBW A;  2I5J B;  1PJ7 A;  3GTY X;  1Y3J A;  2B9E A;  2P6T A;  2R2U A;  2UUC F;  1LW0 A;  2ASY A;  2H65 B;  1JLB A;  1I94 J;  4XK8 C;  3ONQ A;  3TP2 A;  4RUC A;  3KHG A;  2HW3 A;  2YKQ A;  4UUX A;  1RT7 B;  4ZJQ A;  1RAJ A;  4KHP J;  3IN5 A;  3M6X A;  4ZLJ A;  4DQR A;  1NSK L;  3D5M A;  4K5S A;  4OMF G;  1Q1K A;  3CJR A;  1S1W B;  4DR4 J;  2VFU A;  1XN9 A;  3EGN A;  5HAN A;  4N47 A;  5H9F J;  3GYG A;  3SZ2 A;  1AFI A;  3M1V B;  3K89 A;  4Y2I A;  1F60 B;  2XYP B;  3ILL A;  4IG3 A;  3CCW A;  1HWK A;  1DY3 A;  2RVJ A;  4OZ5 A;  2XCA A;  4KR0 B;  2HWI A;  2RE1 A;  3F44 A;  1U0H A;  3H5U A;  4M5I A;  4DFJ A;  1RTD B;  1W26 A;  1VQ5 S;  2FVQ A;  3QJL A;  3NWR A;  3HUL A;  2YWF A;  2ADB A;  3T3F A;  3W5X A;  1XNQ F;  3DOK A;  3TW0 A;  1RIS A;  1S9G B;  2HG4 A;  1QUP A;  5K9F A;  2FHJ A;  2XHC A;  2XMU A;  4CT8 A;  1RWX B;  2LXI A;  2XS2 A;  3NGU A;  1C1B B;  5E3R A;  3JSR A;  2PA8 D;  4WK1 A;  4EMD A;  2WON B;  2EKN A;  3L7O A;  4OZ1 A;  4USU A;  4OX7 A;  1APS A;  1T95 A;  2V50 A;  1LEO A;  3Q8U A;  5D4P A;  3HJF A;  1IR2 A;  2P9C A;  4JV5 J;  2OPR A;  4KGM A;  3MMA A;  3CD5 A;  1QJH A;  1YZ7 A;  2JNJ A;  4LF1 A;  1KP6 A;  2QZ8 A;  1UP1 A;  5IFM A;  5KFN A;  3N5F A;  1MU2 B;  5F8N A;  1SC4 B;  3BKT A;  3H5S A;  6FDR A;  3BDE A;  5KFP A;  1X5S A;  2VG6 A;  3IM9 A;  4OX8 A;  3OTO J;  2E66 A;  1N88 A;  2YVS A;  1LNQ A;  4HLB A;  1REG X;  4FPR A;  5JXS A;  4ED6 A;  4EBC A;  2FJV A;  4PUO B;  3T19 A;  2OSQ A;  1SKS A;  2QLJ B;  4K4Y A;  2ZM6 F;  1S6Q B;  5E3P A;  2N7C A;  4ID8 A;  4OJ3 A;  3I9V 9;  4ZCL A;  2C2O B;  3EVO A;  3NCP A;  4H4O B;  3A1Y G;  3QMQ A;  3RBZ A;  1N52 B;  3TZZ A;  1D9D A;  3HP6 A;  1XNQ J;  1G6B A;  2P9G A;  1YJW S;  4F04 B;  4URG A;  4WF9 Q;  1LK7 A;  3BKF A;  3LP1 B;  3WIV A;  1RXO B;  1U1M A;  2VFR A;  4E2F B;  2XGQ A;  4R25 A;  2BAB A;  3AOC A;  2YPZ A;  4F25 A;  8RUC A;  3MMC B;  1W25 A;  4X62 J;  2XS5 A;  4ILL A;  1CS4 B;  5D0H A;  5HLF B;  1TKZ B;  1F2G A;  2HIY A;  4KIA A;  4YHH J;  2C2E A;  4URQ U;  3OLB A;  2AYE A;  3VGV A;  1P1T A;  4OI6 A;  5DDR C;  2CG4 A;  1IKX A;  2Q1L A;  1P9Q C;  1M5H A;  3NCR A;  2J5A A;  2GV1 A;  1Y3K A;  2B5J A;  4P52 A;  1U1R A;  1WDD A;  1FXR A;  1V5V A;  3D67 A;  4NYO A;  3NL0 A;  4ZJL A;  1ZAV A;  4V1A k;  3K59 A;  1RTJ B;  1TFY A;  2JH3 A;  4YDX A;  3FSY A;  2Y1J A;  4F4K A;  1IR1 A;  3GV7 B;  4DPU A;  4U7U D;  2HBR B;  2NUU G;  4DPX A;  2ROP A;  2YY3 A;  1YG0 A;  2D74 B;  4TXS A;  4J9V A;  3MGJ A;  2L9D A;  3I82 A;  1MMD A;  1Z2Z A;  3JQK A;  1EZZ B;  3W2V A;  4EBD A;  1RT5 A;  1U1K A;  3BBC A;  3MEE A;  2J8A A;  5IC4 B;  4G3I A;  1FVS A;  3W65 A;  1I6J A;  3UW1 A;  4U7C A;  3QID A;  5F8I A;  4I67 A;  3HD2 A;  3NLC A;  3TUJ C;  2OPQ B;  1X0P A;  3BZQ A;  4IYQ A;  3D2W A;  1J2V A;  1RWP B;  5ETN A;  2FVP A;  1Z4U A;  5J2N A;  4X62 F;  1NDP A;  1WSR A;  2VPW B;  4GRS A;  3X1L B;  2DH8 A;  4DSI A;  3Q8V A;  5B0D A;  1U1N A;  1RT1 B;  3C16 A;  2O67 A;  3KWM A;  3T1H F;  4O3S A;  2LKZ A;  2RB7 A;  5CYQ B;  4ANC A;  3PRV A;  5H1S V;  2XMA A;  2MXY A;  1C0U A;  2GS8 A;  1FRI A;  4L3K A;  1FT8 A;  2KTQ A;  2JL9 A;  2FYX A;  2R8H A;  2RU3 A;  3QLH B;  4FKX A;  1EJ7 L;  3TZX A;  2E9Z A;  2W9A A;  1Y7P A;  4QQB A;  4OV1 A;  3MCO A;  4ES2 A;  3TEG A;  3VAH A;  4KFB B;  2DPJ A;  3RB3 A;  2K3K A;  3QPI A;  3J81 Y;  2CKW A;  4RUA A;  3M8Q B;  2N3L A;  5KFT A;  2BYC A;  2DD8 S;  2LVW A;  1P6T A;  5J2Q B;  1SC1 B;  2J76 E;  4B9S A;  3MF5 A;  2P6S A;  2OPR B;  2KXN B;  1MNE A;  2JWN A;  2CNO B;  4P2X A;  1J5E F;  2W4P A;  2KYZ A;  2MMY A;  1S97 A;  2DNP A;  5D15 A;  2HFU A;  3KJV A;  1HD1 A;  1VI7 A;  2BKN A;  2O66 A;  3SMZ A;  4HVZ A;  5A8K A;  2BJ3 A;  1U26 A;  3PHE A;  2J6T A;  5HBM B;  4C3L A;  4EU0 A;  1IKW A;  3L3C A;  4MKB A;  1VBX A;  2FB0 A;  2FVR A;  5KFB A;  4DV3 J;  4UQT A;  4P73 A;  2GML A;  3UE2 A; 
#chains in the Genus database with same CATH homology
 3QRP A;  2Y9H A;  4QYZ K;  3QRQ A;  1WJ9 A;  4DZD A;  5H9F K;  5H9E K;  3QRR A;  5CD4 A;  2Y8Y A;  4U7U D;  2Y8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...