5CD4A

The type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
199
structure length
199
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords CRISPR system Cascade subunit CasE
publication title Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 199
sequence length 199
chains with identical sequence M
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 5cd4A01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5cd4A02
2Y8WA 3QRRA 2Y9HA 5H9FK 4QYZK 1WJ9A 5CD4A 3QRQA 4U7UD 5H9EK 3QRPA 2Y8YA 4DZDA
chains in the Genus database with same CATH superfamily
5KTQA 5FD1A 2ZE2B 2HHVA 2JJ4D 2XSFA 3B4MA 2JC1A 4K8RA 3NXZA 3BQ1A 4CCHA 2IC3A 1HIYA 2UUWA 3I0RA 1HNVB 4KAIA 2BKOA 4C3MA 4DUYF 2VFSA 2XSJB 2QT7A 1GX6A 1RTIB 4X4RA 3MD3A 1Z4UA 4USVA 3B78A 4U7CA 5LM7E 3I0SB 3ZTSA 2KJVA 3US5A 3CCUS 4IG3B 1NB2A 5K8NA 3P49B 1EQMA 2PEBA 2CPHA 3KHGA 3FK4A 2DGTA 1H3DA 1YK9A 1S6PA 1TVRA 3GFZA 2KN4A 4NLTA 1VC0A 2C3PA 4ZJOA 3IWNC 2FJDB 2ZBRA 1RLDA 2OPQB 1G4CA 4CO1A 1HR0F 3M6VA 2DR6A 1TZ0A 1IKVB 2CDQA 2FVQA 3CNQP 2GHWA 3M8QA 4IRDA 4MK9A 1R8BA 3Q2TC 3CDBA 3KYLA 4YUDA 2QV6A 2XM3A 5JMNA 5CA5A 3C8YA 5D4PA 5I3PA 4OYXA 5J2NA 2YKQA 1HMVA 3OTBA 2IJRA 1SIZA 5HP1B 3D28A 2ZOGA 2QYGA 1X4BA 2ZJQQ 2F3JA 3FKBA 1UVKA 5C2CA 5RUBA 4X66F 3N4WA 3ZZ0A 3LPEA 3G82A 2QG9B 2FDNA 1REVB 2ZZNA 4F50A 4RLEA 9RUBA 4DDFA 3CCJS 4DV6J 5HMWA 4B17A 1DHMA 3CD7A 1OQ6A 4FKYA 1LW0B 4YY3F 2XO6A 2AYEA 1R6YA 3UN5A 3FZ2A 4E98A 3CW2C 4FBUA 2BOAA 1E6YB 1T0TV 2GMJA 1TUWA 3CJTA 1FK9B 2YTCA 4QW9A 2RQMA 2GO9A 2UP1A 2YWFA 1RSCA 2BW7A 2DHHA 3BGFA 1BY9A 3NMRA 4RW8A 3RBZA 2FUG9 3MEDB 2DNYA 3JYTB 1U4BA 3LP1B 2AKWB 3E8OA 2XWYA 4WTYA 1FJGF 3BR8A 1RT1B 2WHOA 2GO8A 1SIWB 2A10A 4KC5A 4ICLB 1M5VC 4J9MA 3AJ1A 3ZO7A 1UP1A 2HPUA 1MWYA 3B4DA 5C2GA 1WHYA 3N9UC 4USMA 3H2VE 4OFZA 4ZP7A 2VQFF 1JLBA 1S4FA 5AXMA 4EO6A 3FJ2A 2EFNA 1N6QB 2J9DE 2ROPA 2ZBCA 3MTJA 4TQRA 1KTVA 4LF6F 2HFSA 2C2NA 3ELHA 2UUBF 4QWBA 2V8VA 4NA1A 3OBIA 1LWXA 3DHWC 3VGTA 1NH7A 1H2UX 3QRRA 4R5PA 2HWTA 1BQNB 3MMAB 4MYTA 1W7WA 2AZ1A 5ETMA 4P52A 4JI8F 4X4SA 3IM8A 4OJGA 1HFEL 2F1FA 5K14B 5DETA 3CCMS 1F5BA 1TL4A 2NYIA 3DRXA 1UKUA 1FKPB 2DNGA 1F9EB 4JI2J 5L1JA 1RI7A 5EWEA 3F41A 2H51B 3BM7A 1U8SA 1N56A 3GV8B 2MKCA 2G0IA 2MQPA 3CCTA 2V2VA 2RRNA 3TZWA 1RT7B 3MR7A 3HKWA 1XR6A 3D4JA 2V8HA 1FT8A 5D0EA 2MZJA 3SZ2A 4RU9A 1XN9A 1ZOTA 1HBNA 2OKQA 2YX4A 3M1VB 3GE9A 1N54B 3GMGA 3DC2A 1D1UA 2GX8A 3LO3A 1GMWD 1IVZA 4F0KA 3VAJA 1QE1B 2VH7A 1B70B 3R97A 1RAFB 2KKHA 1ULRA 3M6UA 4ZCMA 4K4TA 2Z8QA 5KFEA 3PO4A 3MCMA 1PC4A 3C3LA 1RYSA 3Q86A 2AJ0A 4LF5J 3H20A 3W3SA 2Z2YB 2VBXA 1YRTA 4LR9A 5F41A 1DZ5A 5DZ7A 1CLFA 1Y9OA 5DS7A 3GIMA 3SDEB 4U67Q 4X62F 5DO2A 2JNJA 1ZS6A 1Y00A 3M30A 5F8IA 1K1QA 1YJVA 1JLFB 1V5VA 2VODA 2OO4A 3W2WA 3CMAS 2F7VA 1U1OA 1R43A 3D2WA 1VRUB 3FMWA 4DCOB 3Q8SB 1NKBA 3I6PA 3H5YA 5AXKA 4J9VA 4B08A 4DFMA 3QAEA 4ECWA 1K47A 2PMHA 3DM2B 3HSZA 4ZVGA 1ZM9A 2XO7A 4WU3A 2XYHB 3C46A 2P5VA 1WTFA 4Y2CA 1GXLA 4CYUB 1S1WB 3R27A 2Z57B 1TKZA 3PW2A 4EZ9A 1RGVA 1HNIA 3I31A 4L76A 2MY7A 3QATA 2PDAA 1RAJA 3JTOA 4PCQA 3EUNA 2VA3A 3ZZYA 3NRBA 4USHA 4A8KA 3C15A 4GKJF 4ZCLA 1UWBB 4ZHRB 2OPRA 4X64J 4QIFA 1S59A 2ZHOA 2IM0A 1SVDA 1TFWA 2KFNA 5J1EB 1WEXA 4R0JA 3KLHA 1RABB 1LOUA 3FQLA 1WF1A 2IC3B 3NOCA 2R8JA 2MQLA 3GFHA 3RRGA 3ITHA 4BC9A 4NCAA 4JYAJ 2V4QA 4NXMF 3FGVA 2GCFA 1HBUA 1R3NA 2JHEA 5D77A 1WF0A 3W65A 2RQKA 3WIVA 1U45A 2K3KA 2ALYB 1RWXB 3W61A 2QLBB 1KKHA 4IFVB 4IG0B 4OZ5A 1RA7A 1TVRB 3RR7A 2DCUB 2M2BA 2KI2A 1BWVA 3QO9A 3RB6A 3V4IA 3W62A 3PW4A 1FWKA 3VGSA 5DGAA 2LA4A 1VRTA 1K0TA 4C97A 4NZ0A 5HJXA 5KOXA 3T19A 2A0FB 2JFKA 1S1XB 4FXDA 2HQGA 3VCDA 1JQGA 1WG4A 3M8QB 1WORA 2EPIA 1FD8A 2DNOA 2DNPA 5F8JA 4PXDA 2HMIB 1J5EF 1L3UA 4ZIVA 1MMNA 3MXHP 4LSLA 2HK3A 2CJKA 3I4PA 5GMEA 4LQ3A 1HI0P 2V5HG 1HR0J 1Q53A 2DH8A 3QJPA 1RAGB 4HH1A 2Y1JA 1H73A 2PA8D 1HWLA 2AIRB 4DX6A 2I1RA 1XR5A 3G82B 4F8RA 4PG4A 4OHXA 5JJBA 3R1LA 1H7XA 4I64A 5KFTA 3BJYA 4MFBB 1MMDA 3BH6B 4NLWA 3QT6A 3WHIA 3BGRA 4DLGA 4Q2LA 2VG5B 3H8YA 1YKWA 2XMVA 4TKTA 1RTDA 3P8BB 4RW7A 2RSQA 3PO5A 2OEKA 1TV6A 1ZM2A 5DJBA 1URNA 4X66J 4WPAA 2RDIA 4UUWA 1RADB 3CGIA 1IR0A 3T1YJ 4KJIA 2JX2A 2OFHX 4P2SA 2UXBF 3CIMA 2FHKA 1S77D 3CF5Q 4X2BA 1S6OA 1N5TA 1TK8A 3LWMA 5D4LA 5CAAA 3L95X 3UDCA 1VISA 5LJ5Y 3U1NA 3JQJA 1J27A 1WEZA 5K9FA 3PFOA 1EB0A 1SL1A 1EETA 1UVIA 2XTJP 2B0GA 1U1PA 5FLXY 3RR8A 2RUSA 3DLJA 4A8FA 2M70A 2NLWA 1JLCA 1UVJA 5F8GA 4H4OB 2RIJA 4O3PA 4P9SA 3NGKA 3HHLA 1T05A 3HD1A 4PPDA 3Q0AA 1C0TA 4QPXA 2JLFA 1VQKS 3KK2A 3JS9A 1PAEX 1WI6A 2MEWA 4R5PB 1S1UA 2IIHA 4C11A 3IRXA 4O4RA 4ZPDA 1H6KX 2VQFJ 2E5HA 2YNHB 2V0NA 3VAGA 2GS8A 1Q79A 1OY6A 3I5AA 3OLAA 3TUPA 2QL7B 1WWHA 2GVZB 4OX6A 2OP5A 3SI8A 2UUBJ 1YLXA 1AUDA 4DUZJ 5K5MA 1VBZA 4C0HA 4RW4A 4O0IA 3M8PA 1TFYA 4QU7A 3PEHA 2FLPA 2NXCA 4HI1A 2CFXA 3DGVA 3DRRA 1YI2S 1U47A 4YDXA 1HBNB 2IJNA 2Y1LB 1S9GA 2BKPA 1VQNS 1T9YA 1FCAA 3OFGA 5EGYA 1HI8A 3MEGA 4KGXB 4M63A 2HQ3A 1N34J 2P6TA 3TJAA 4XTTA 4CLYA 3PX6A 1BMQB 3TZYA 2J9DA 1Q8IA 3OUYB 4P75A 4DUTA 3GJRB 1PGZA 1LWCB 3HP6A 3TUZC 4NCGA 3EM1A 3KK3A 3W8PA 3M2UA 4EMDA 1FEHA 2FGOA 3B82A 1UFKA 3JQKA 3CJ3A 2QN6B 3PDNA 4K4ZA 3AXKA 3T5LA 2VD3A 4ZCIA 1FKAF 3SXLA 4IR9A 1IKYA 2JLGA 1BQXA 1HQUB 1KVJA 3PYGA 2E9TA 2YQ0A 4TY8A 2ZWPA 1QAIA 2RKIA 1QY7A 3K5OA 4P71A 4YS2A 5F3ZA 4TLQA 1PYOB 4RZRA 2CNOB 4DL7A 3U27A 1ITPA 1X5OA 3RRKA 4B3OB 4TLRA 3ETMA 3B6BA 2PD1A 1WKLA 4TYAA 3HVRA 3VGVA 1JLGA 2UUTA 4GKKF 2V6AA 2BJ3A 4JB8B 3HI9A 4ILMA 2RUGA 1S7HA 5IZHA 4LF7F 2I2YA 3AAWB 4LIRA 2YKOA 1GX5A 3H5SA 3UFCX 2K3IA 3C15B 3KWMA 1VQLS 2JEGA 2V94A 1NK0A 2IM3A 2J0QD 5DQIA 4M5HA 4DX7A 5J2MA 3BKFA 3LGHA 5HANA 5ETSA 1C1CA 1U1KA 1DQ8A 5HVGA 3KUHA 3KLHB 2XY5A 4LFAJ 2N3LA 4XAKA 3PJXA 1GMVA 5KT4A 4Z2XA 3CD5A 1NK6A 4TYBA 5KFQA 3A8KA 3IS9B 3A3OB 2GMLA 3K5PA 2KZZA 2Y0BB 3CIZA 4KGMA 3R5CA 4MKVA 5ETNA 2DO4A 1RAIB 4LJMA 5JVGQ 3L7PA 1PIEA 2LMIA 2XZTB 1U48A 4CNYA 4A8QA 3GONA 2ASYA 4LIWA 3R1HA 4AL6A 2AD9A 4FYVB 2XNRA 2QMWA 2F8MA 3E51A 1H7WA 4I68A 2LEBA 3G2XA 2W7PA 3IG1B 3BPSP 3V6DA 4A8XA 1N36F 2V2ZA 3GQCA 1VRTB 3PHEA 4OIXA 2VKZG 2W4CA 2B4OA 2J0XA 1XERA 2ZZTA 4U6PA 4O23A 1HQEB 4U96A 4CLTA 4ZKAA 1N32J 2IYGA 1OY9A 1S99A 4TU7A 4WXWA 1FRXA 4RNOA 4C7QA 2ILYA 1TP7A 3DLBA 3SV3A 2GQ2A 5C7PA 3ENWA 5HVHA 2CKWA 2QL9B 3PXGa 1Q16B 2P9EA 2OEJA 1X9SA 4FBTA 2PO4A 2LQ9A 5E3RA 2ACYA 2P8IA 4J9RA 2ZKUA 3V5RA 2FHJD 4GC7A 4DEZA 2JC0A 4YB5A 2MHEA 2R2TA 1FFWB 2YKNA 4IRCA 1YWXA 1BD6A 2YVSA 4DPUA 3QMQA 3CB4A 1LWFB 2OAUA 3CJ2A 3CDUA 4R0EA 4X4UA 2G2YA 1GEHA 4K50A 2DNZA 1VHFA 3OR2A 4J37A 3UI3A 2VDHA 4NLXA 4YHHF 3HZEA 4IR1A 3ILOA 4X4VA 1TV6B 2CDRB 1Q7LB 3KNAA 2NPIA 1KDNA 3SSQA 5L38A 2JDJA 2AGOA 1D9AA 4DR7F 2ACMA 2ZJPQ 2UUCJ 2E1PA 3P45B 4A47A 2ZH2A 5K8OA 2VL1A 2PN6A 2K2PA 3D5MA 4OJ3A 1CJTA 2H48B 1D8ZA 3KHHA 4DV4F 2G9OA 1HYSA 4JI4F 5B0FA 2MZRA 4MJKA 2CXEA 2M7SA 1FI4A 2U1AA 1RU2A 5E3AA 1VLOA 4ZVUB 4Q7AA 1U49A 3OTOJ 2R42A 4DSIA 3GJSB 4ALZA 4RUHA 4O3QA 4ZVPB 4GVBB 2BOPA 1M5SA 3NNAA 4JI5F 4P7TA 3I87A 1Y4ZB 4QPTA 3T3FA 1OIAA 4FPIA 1SB6A 1VQ4S 5HO4A 1FTRA 4HI2A 2AW0A 3CMES 3ZTRA 4L73A 2MKKA 3M32A 3KK2B 4L3NA 4OYOA 2XMAA 1RXOB 4AUKA 3IRXB 1XNQJ 4PWWA 4CLFA 1NNDA 3DFEA 2X7IA 1R89A 2HHXA 1SKRA 1MMLA 3NS7B 5CXTA 2G2OA 2HQDA 1G7CB 1RHUB 4WFNQ 4RW4B 1P9QC 3MD1A 3M8ZA 4FVCA 2AYBA 4DR4J 2V34A 4M95A 3HSGA 2E1AA 1E6VB 3HHDA 2VQEF 2FVRA 3DRRB 3VV2B 2K8GA 3W64A 3EX7B 3W9JA 4KE5A 1TKXA 2XYPB 1M1GA 1RTHA 5I42A 4KHPJ 5HLFB 1K44A 3HX9A 4CLZA 1WF2A 3CJKB 4CLLA 3CJQA 3TA1A 3KHLA 4F3MA 2Q79A 3L4BC 2EFPA 3RBEA 2W2QP 5KFJA 3UD3P 5A8RB 2YPZA 2E5GA 3N5BA 5D4OA 2VPWB 3CCVS 1X8DA 2ZKTA 5CYQA 3OVBA 5D8HB 2ASDA 1HNZF 1I94F 4KBIA 2ZITA 3BYRA 2E7XA 5A8KB 2IBKA 4HLBA 3KK3B 5KFMA 2Z2MA 3FBCA 6FD1A 3M2UB 5F8LA 2B3TB 1QAXA 4OZ2A 2HBZB 2RRBA 2AP6A 1FRMA 1T7PA 3E01B 1K9MT 1FDDA 4K4WA 3PCOB 1NSAA 1YIJS 2E7VA 5KG6A 2Z58B 3BDEA 4LF4J 2VOPA 1U0SA 1Y5NB 4DQSA 1S72S 3U1MA 4EU0A 1T11A 2N7YA 2D3OR 4RW6A 3SSSA 3JAMY 1LW2A 5H9EK 2H5EA 4DL5A 4KFBB 4F4YA 4MYUA 2QSWA 2HHSA 1V3SA 3O1LA 3QWPA 3DYAA 1H72C 4NLSA 4C2MA 1TK0A 4FDFA 2J6SA 2AX1A 4RBVA 4DJBA 4TY9A 3KLIB 1RT5A 1OMSA 3THVA 3UVJB 2MZ1A 1VIXA 3F56A 3OR1B 4C8ZA 2IFXA 3Q89A 5CH7B 4JV5F 3MMBA 1VIOA 4B3MF 3FVYA 4HEA9 4Z37A 3KG1A 4FXWA 2FLOA 3KUEA 4J9UE 2N4DA 1RT2B 1L3SA 4CQ1A 1C1CB 1XK8A 1X4AA 3RW6A 1I51B 3K5MA 3V81B 4EWTA 2XG8A 4J90A 4X84A 1VLYA 1S0NA 3C6UA 3PW5A 5CD4H 3JAMU 2XI2A 3RAMA 4NCBA 3SV4A 1WHVA 5ETRA 1HD1A 4PABA 2LEPA 3C6TA 4G6VB 3MUVP 1HKAA 1S6QB 2OHDA 3MR6A 1HNWF 2XGPA 4CLPA 5A2QY 2B56A 4HKQA 3M8WA 3ZNUA 2HHHF 1NXIA 2FY1A 2V4JA 3MZIA 3UD5A 4DZDA 3KLFA 4QJVA 4H4KA 5KFUA 1JLEA 1GAOA 1HARA 1S97A 3GLJA 3D68A 3TP2A 1Q78A 1JJ2R 4CH7A 3N6LA 1FJEB 2FHOB 1R0AA 1SC3B 8AT1B 1WD6A 1XMOF 3UR3C 2NZ4A 4K4SA 3RGIA 1Q95G 3IBWA 3FBFA 4QIVA 2R8IA 2C22A 2JRSA 2Y3YA 3HZGA 1XIQA 1YJRA 1YJ7A 4DR1F 4X4QA 2XY6A 3TO8A 5JVHQ 2R4FA 2EG1A 1OPIA 2MYFA 4ZCKA 4DX8H 3J7ZT 4NLVA 5AE3A 4V1Ak 1RTJB 2FLNA 5LT5A 5D3GA 1TKTA 4M5LA 3MM5A 5A2QU 4LVNP 4ZVSB 5C42A 1KSPA 3QWUA 3Q8YA 3A3NB 5J2PA 4FNHA 2GJFA 1YRUA 3IAM9 1VMBA 3GYGA 3CC2S 4UZCA 3CCLS 2FD2A 1AFJA 1FFGB 1XNRJ 1ZAWA 2OUGA 3OFEA 2LQBA 3OR2B 5A8WA 1SH2A 2UXDJ 1U0HB 1OSDA 4I7FA 1YJNS 4ID5A 3HVTA 3OXLA 4ZITA 2HNDA 1ZPWX 1G1XA 1H38A 2X1BA 4CTAB 4HTIA 2YNFA 5HBMA 4JBCA 3PACA 3PY8A 2VB6A 1U1QA 1T94A 3FRZA 1N4LA 1BGXT 3K5LA 1RAAB 2J7KA 3AD7C 4C0OC 2PSZA 4OZ3A 2E1MC 1CJTB 1UZDA 2FQQB 3DU6A 5ADZA 4HACB 4KYZA 2FJVA 2NR0A 1HYSB 3FUYA 4CO3A 4DV1F 3G71S 3FCHA 1GMWA 4PYAA 4C8NA 4ZLJA 3BGLA 2OTLS 1MW7A 2KL8A 4DR7J 4J91A 2BR0A 3M2RA 5J1NA 1SKUB 2MZSA 4Q45A 4XDDA 4UQGA 3A13A 4ZS6A 3RUBL 4PXCA 1EKSA 4K7QA 3E2EA 2DRDA 4PWUA 4DV4J 1IBMF 2A2CA 5H9FK 2RB7A 4NI2A 3SCLE 3I9V9 3M32B 1OWXA 5DG8A 5GAGI 2GQCA 5E3QA 3LGMA 1KHWA 4W98A 1KD1T 5HL7Q 3MUMP 3CDAA 1NPPA 4WFAQ 4FNIA 3UN3A 1F5CA 4NASA 2IVFB 5LMNF 1UTAA 3GTYX 3MUTP 1S0VA 4JI5J 3ILIA 2WVFA 2DRAA 4YQWA 1EIYB 3AB4B 4I2PB 4QR0A 3WBZA 4WFZA 4URSA 2D9OA 3HFKA 4ED0A 1AXQA 5KT6A 1SJ1A 2GC8A 1NK7A 1UZHA 3NY0A 1SUQB 3RJMB 5A76A 1QJHA 2O66A 3IO1A 3W2VB 4CZCA 3KJVB 4DL0C 5I42B 5GAEI 1AW0A 4NLPA 1T9TA 1AA1B 1H2TZ 4USJC 3MEKA 1TMMA 3MM6B 1VQ9S 3PTWA 2HVDA 1AROP 2CQ1A 3UPFA 3M2VA 2DHXA 1M5KC 2BYCA 1RISA 4DCPB 2MZQA 2KM8B 2OMOA 3FZBA 2BM0A 2ASLA 2MPUA 1GXUA 2W01A 1HHQA 3BSNA 3QFHA 1WOPA 1XQIA 2B9WA 1QUPA 2I5JA 3I96A 2XGQA 2ZH1A 4RUAA 1T8EA 1PBUA 3ZZRA 2V8GA 2ZC4A 3R6LB 4AXIA 3TARA 5D6GA 1HBOA 2RT3A 2YNGA 4NLUA 1S57A 3RZAA 3IWLA 4LMZA 2L08A 3ET6A 1SH3A 1HHTP 4DV3F 2HEKA 3DLKB 3CC4S 4X65F 4DV7F 4RW6B 1T9WA 2VASA 1HNZJ 1R7IA 1LW2B 3BF4A 2RVJA 5D0RA 3KXDA 4G1QA 3P3DA 5E41A 3DOKA 3DYAB 3EGZA 1JLQA 3PVXA 3OLBA 4KR0B 3PG9A 2OJ3A 3EGVA 1XMQF 3M8RA 1KHVA 4EI2A 5KG0A 1CSJA 2K7JA 1RT5B 2ZEJA 1FJ7A 1VJWA 1P9YA 3QJJA 1FESA 3MMBB 4B3SF 3JSMB 2BE2A 4RKUC 4F4ZA 3EVWA 4XPCA 4KGKA 4ILLA 2CPEA 1RT6A 2LVWA 1DTTA 2ZD1B 2RHQB 2NXUA 1NPRA 3D0GE 5D15A 4EEYA 2XY7A 1LK5A 4G1PA 4LRBA 2R8HA 4JV1A 4PXEA 2P9CA 4DS4A 1KFDA 1KLMB 1SJQA 1HPZA 1VCTA 4KKOA 3CD0A 3TJ9A 1CJUA 3C6UB 3GFXA 3EWGA 4RNMA 4D3HA 4OQJA 4QYZK 3C6TB 4I6AA 3W5XA 2YH0A 4LRAA 2RF2A 1JX4A 4J9PA 2Z0GA 2D1CA 4UY8T 2LYVA 4ZK7M 5BR8F 1O8BA 2V4JB 3UNGC 2CRLA 3CXCR 2BMBA 3MPVA 4HDHA 2RNEA 1JLEB 5HMXA 5LXYA 1KQFB 4ZVEA 3VGUA 3GIRA 2I0XA 2DH9A 2L3MA 3CO0P 4J9LA 2P9GA 4I6YA 3S01A 3HHNB 1R0AB 1W2BR 4LBHA 2QMUB 3BGUA 2ZUAA 4NMXA 1HNWJ 2DKOB 4U9RA 1B3TA 4ZLLA 4DPXA 4HL9A 4H54A 3D7SB 1KWMA 3HPOA 4I4BA 4YR0A 3A8IA 3MAQA 1YTYA 4LUBA 3DDIA 3LP0B 4B9TA 4EBCA 4V19J 5D3GB 1TKTB 1Y11A 2E1RA 6AT1B 2MLYA 2KRBA 2ATLA 2FJAB 1Y5LB 1F9HA 4LFCJ 4DR1J 3M7VA 4NA2A 2YBVA 2HAIA 2W8LA 2OFGX 2E5LJ 4ZPTR 4Q0BA 1JNZB 1L3VA 4ZVQB 1JWWA 2CYYA 4ZN3A 3CJ0A 2NQPA 4QIEA 3IGNA 4K0KJ 4ZPVR 5F8HA 3OSNA 3HVTB 4PUOB 4FVMA 3WZ0A 2HNDB 1UA0A 2IVMA 2LDIA 2ZE2A 4XDCA 2YNFB 4OYMA 1FFSB 2FPHX 2HFNA 4QQBA 2OMLA 1EX8A 2J9EA 3R6GB 1WELA 1D9DA 1KQKA 4IFYA 2WSEC 1HNVA 3PIOQ 3TWZA 5ETOA 1C1BB 3T5HA 1XEZA 1V5IB 1JJ4A 4ED3A 1RTIA 3ZZUA 3W1YC 2OTJS 1WKKA 3AFGA 1D3WA 2J0WA 4ZP9A 3NS6A 1S1VA 4IG3A 5KFOA 1DQ9A 4DR2J 2VPZB 5IT4A 2DGOA 2CPIA 3ILLA 3JTPA 4ZJQA 2DTJA 4QWDA 4OZJA 2Z30B 3UD4P 2OPQA 1SKWA 3BREA 3CCZA 5LSOA 4HH0A 3CO9A 3I32A 3M6WA 3Q22A 3UE2A 2YKMA 2RDJA 2YPYA 4DPOA 1IKWA 3T1HF 1KOOA 2X1AA 1F60B 1FX4A 4UOFA 1G2EA 4DQIA 4NMLA 1EARA 3FFIB 2OPSA 5K20B 3W5YA 1IWGA 5HN0A 4I2QB 1NDCA 2B6AB 5G0RB 3RW7A 3BSAA 3FNNA 1N5QA 3DXSX 5L9NA 2AGQA 4C8MA 2WSCC 3RU0A 5KFLA 2HLTA 1RA6A 2MKSA 3AQPA 2ZM6J 2DPJA 1REVA 2Y1RI 1FRHA 1QAJA 2VIHA 1OY8A 2ZH8A 2ABYA 3PX0A 4OX9J 1VQ8S 4DR5F 1P6TA 2J76E 2RU3A 4JUZA 3PYFA 1LW0A 5LMNJ 4N8NA 3FQKA 1E6YA 4DR6J 1RKIA 1FK9A 4QYRA 2RQCA 2PE8A 4YFUA 3HDSA 3ADAC 3IRWP 2X1GA 2BRKA 1W26A 2IM1A 1NKCA 4F3OA 2HLUA 4F25A 4OV1A 5IV3A 1AZSB 3LP1A 4FF4A 2VFVA 3R3TA 1SKSA 3Q24A 3PRDA 1S1TB 1IBLF 5C25B 4DG1B 2DY1A 4ICLA 5SZTA 2ZNYA 3ET6B 3W9IA 2RQ4A 2MDAA 1JMTA 3O3LA 2CQ2A 3L09A 3ZNJ1 4QR1A 3D0IE 4DSEA 4CM0A 4WE1B 1M0SA 1GT8A 4G1QB 3IR7B 5IC4B 1N0UA 1JLQB 5I4MA 1IBCB 1JKHB 2HKEA 3AJ2A 3MM9A 1N6QA 4IQXA 3I56S 3NGTA 3K57A 3C14A 2R8KA 1YGYA 4PQAA 5CYMB 2L41A 2IBOA 2WBMA 4OX8A 2XMMA 4DWIA 1EHWA 3A1YG 4X65J 2CZ4A 2FY8A 3UN2A 3KLVA 3D3BJ 1UJ5A 2CNLB 1BQNA 1N8RT 4ES3A 4HYKA 1YBUA 1NU4A 2J9CA 1YSJA 5K14A 4ZVOB 2PEHA 4C6AA 3ENVA 5IXUA 3LTOA 1FKPA 2J7UA 3IP0A 4USTA 5AJ3J 2J0SD 3Q8PB 2M3DA 2BE9B 1MROA 4P73A 3BN4A 2DNHA 1R6VA 1RT7A 2H3EB 5IM0B 1HD0A 4ED4A 3P4UB 1CJUB 1VBKA 3MEEA 4P2FA 2FHJA 3WC0A 1S9EB 1UFWA 3M1VA 2ZDOA 1WC5A 1Y5IB 4YR3A 2L9DA 1NBEB 1QE1A 2K1RA 2RF2B 5KFAA 3PV8A 3LOUA 2Z4PA 5B0AA 2B43A 1P8GA 3L3CA 1U1NA 5LMUF 3IBCB 5CYJA 1XWLA 2UV8G 3CT9A 2L9WA 2AJ1A 3MWBA 2CZ9A 3I9ZA 2FZCB 3KHRA 2KHCA 3Q8UA 4USIA 3N0VA 2F63A 4FYXB 1N5YB 2V4RA 3SDEA 3KLEB 4ZVFA 4DX5A 1YHQS 1HLWA 2QL5B 2QRRA 4CLWA 1GTHA 5BR8J 3PZPA 1KOHA 1JLFA 1NPKA 3G6XA 2UXCF 3J7Z5 3VZIA 2VG7A 2PMZD 4YOEA 3CJSA 3GG0A 2Z2LA 2RD5C 1G6BA 1PJ6A 2ZBQA 5HJYA 5FDLB 5KG4A 3DMJB 5BYSA 2LXIA 4KT0C 1NK5A 3R5BA 2IRXA 4YDDB 4LSNA 2CJBA 2IPOB 5J2QB 2Q66A 2V63A 3J81Y 1RWKB 2IRUA 3S7RA 4LFBF 2J7WA 4CYUA 1S1WA 3HULA 5L1LA 3DHXA 2BANB 4XK8C 2HRYA 4Q0BB 2ALZA 1D0EA 2W2MP 2UU9F 5ETKA 3J7AN 1Q8BA 4XPEA 2LQJA 3VWSA 1PYSB 2EXUA 1UWBA 3TAMB 4ZHRA 5DG7A 1ZPVA 1VI7A 3MAAB 5J1EA 2WOMB 4DR3F 1N5VA 1CBKA 1PAUB 4IFYB 4U8YA 1FXLA 1KR4A 4RNFA 2XMUA 3HHLC 2BXJA 4OHZA 1ELOA 2HK2A 1IJFB 1GTEA 5HQLA 3TYTA 5L46A 1X4HA 1OPZA 1WOSA 1OS5A 1S1VB 3J81U 2C3OA 2IM2A 2GQQA 2CAJA 3OTEA 1ZA2B 1RU1A 4B9SA 2XB2D 3VAHA 2LA6A 4YB1P 4NWBA 2XEXA 4IFVA 3H4BA 4IG0A 3FSYA 4RNNA 4MIBA 3RTVA 3TVKA 3SIPB 4CO4A 2V67A 1VYAA 4AXJA 5GMKa 2IY5B 3OXGA 1D09B 4L3KA 2HG4A 1NAQA 1BQMA 1S1XA 4PG8A 2MGZB 3QJLA 2XS5A 4DN9A 4B9NA 2E5IA 2AZ3A 5BJRA 3OHBA 2B9EA 2YKMB 4J9QA 1IKWB 3MCNA 5KT3A 2XMJA 3UWTA 2AEMA 2HMIA 4DPTA 4NLYA 1TL3A 4N77A 2QSFA 2OPSB 2O5DA 1FDAA 4JI0J 3WC2A 4J9SA 4PYDA 2KHDA 2QE5A 4M5IA 3P96A 2Z56B 2DNRA 1KN6A 1HNXF 2DK2A 2KT2A 1U2RA 1BXNA 2EFGA 1VBXA 5CHCB 3DI6B 2YWWA 1CVJA 4EFAC 5KFCA 4MFBA 3KLGA 2PIIA 3D67A 1ZH5A 1F2HA 3R7SB 2VG5A 3B8HA 1MWQA 4ANEA 1HWKA 4ZDNA 1NHKL 3CMQA 1NCLA 3EMTA 3TJ8A 5HQMA 2C1EB 3EDRB 1T3NA 2LQ8A 2I38A 1SQFA 1RYRA 1JXVA 1RBLA 3QZ7A 1R0BG 4DR5J 1FERA 2C2ZB 1WDTA 1NK9A 3NMAA 3M4XA 3O2IA 3MPWA 2B9XA 1B0TA 3FSXA 2DB1A 1RDRA 3VF0B 4ANDA 2KXFA 3O6QA 2EG2A 1NJZA 2VBZA 4C8OA 3K2YA 2EBEA 1R0CB 4E2FB 3H5UA 1KTQA 4BS2A 4JI6F 2AV5A 1HW9A 2EW9A 3QNWB 3NNCA 1U2CA 3GR1A 4AFFA 5E3PA 1QM9A 1M5OC 4M5KA 4USUA 3PW7A 1WKJA 3EVMA 2AJFE 1KRPA 4M5MA 3CSKA 1WDDA 2MY8A 1NB7A 4H4OA 1PCAA 3CCRS 2W24A 3MM9B 2BX6A 5DDOC 3D66A 2RS2A 3UO0A 1X5PA 1UETA 3C14B 4RO0A 3PW0A 1HL6A 2W9AA 2HIQA 1FDNA 4KSEB 4OI2A 2BEFA 1ZBTA 1WG5A 1EKRA 2GGPB 3P6YC 4LT6A 1NJXA 3R7NB 5T41A 4WP3A 1NZ8A 1X4DA 3GV7B 3HF5A 3HFVA 4N56A 3D1QA 3MDFA 3O5TB 2COLA 1MWZA 1UPPA 2YNHA 2W8KA 3QT7A 1ZTTA 2B7CB 4ECYA 2W4PA 2GVZA 3T9NA 4NXNF 1MROB 3LQVA 1WHWA 1QDUB 3J7YI 4A8YA 2WZ1A 3MEEB 4U7UK 3Q8VA 2KG1A 3OL9A 2FVCA 2C3YA 2WW4A 3JSYA 1UCNA 3POTA 4KHMA 4UY85 2K1RB 3GWCA 4A8MP 2DXEA 2C2KB 4C9DA 3FEXB 2UUAF 3AOAA 1XC9A 4PEOA 2W9BA 2MXYA 3QGHA 4K4XA 4LR8A 1U1MA 2MMYA 3NWGA 1U6BA 1NUEA 1YJWS 3OUYA 3DGPB 2ZBIA 1LWCA 2DGUA 3LP2B 1REGX 1BC6A 1JLAB 2ZOFA 4LSZB 4X4OA 3GJTB 3CCWA 5A0YA 1MLAA 3OL8A 1X4GA 3TOQA 5BXIA 2VG7B 4JI3F 4FXVA 1W25A 2VDIA 3NAIA 1HQUA 3CDEA 2EK6A 2RJZA 4CH1A 4DFKA 1UEVA 3HHLD 2CJAA 2WSFC 4LSNB 3AJDA 1DJ0A 2CPDA 1BWEA 2F40A 4RWWA 4B3OA 2XBPA 1ZAVA 4BC7A 4TQSA 2UXCJ 4OI0A 4OI1A 2M0GB 1RWVB 3AHPA 3VVUA 2JWNA 4IQMA 2DGWA 3IR5B 5JXSA 3DDKA 3W66A 2KB2A 2ZH5A 1EP4A 2BJ7A 2G13A 2HS0A 5B08A 1IKXA 1JJHA 2DNQA 2QA4S 3ZTQA 2WONB 4NLDA 1JK9B 1RBOB 1N33J 4Y2MA 2CJQA 1DRZA 3OQ2A 4PWDB 1L3KA 3KK1A 2HS4A 3BBBA 3R8YA 1Q1KA 2NS1B 3IS9A 4F2SA 2CQPA 4OV6A 2KYXA 3MAHA 1VFJA 4OJHA 4ZMMA 4NYOA 8RUCA 1EAYC 2HYIB 1OO0B 4M5DB 4BDPA 2E9RX 1MN9A 1IUJA 5KFDA 3DRSB 5L8RC 5A6PA 2VBYA 1PSDA 3BKUA 1CJVA 4IUFA 2HRTA 1AYEA 2BUNA 4DUYJ 3JTNA 1S49A 3IG1A 2WAQD 3IMQJ 4ES1A 3CJ8A 1M1HA 2AEJA 2EWHA 3NGRA 4BBYA 1BQMB 1D9FA 4CIOA 1G3OA 2R7VA 1IR1A 1HQEA 1MU2B 2MQMA 3LAKA 4QU6A 5J1PA 2DR5A 1TL3B 5U47A 2XWXA 2HZVA 2FVSA 4OL8A 1RHJB 2KO1A 4K4YA 3DRPB 3PM9A 1KQSR 1LV5A 1FRLA 3IXQA 2XMKA 2M5YA 4N76A 2XLJA 2KM8C 4O3NA 3AD9C 4Y2IA 2XMWA 3KLGB 1LWFA 2PFDA 1L3TA 4CWBA 2XULA 2GMHA 2A3JA 4HTJA 3TI0A 3PRVA 3F44A 5HSPA 4DV6F 5DDRC 5DQGA 1FRIA 1NDKA 4FN5A 2WVBA 1HNXJ 2FHMA 2Q1LA 2CA9A 3NEKA 3EZ5A 2FJXA 2FC9A 3OW2R 4DSKA 1Y7PA 2BBEA 3CCQS 5KFWA 5M2UA 1GNKA 4TN2A 1S4EA 3DDNA 3U02A 2LP4A 3PR5B 2HFOA 4YY3J 1RWMB 5IQQA 2GA7A 3A3PB 4KGZB 2EI5A 4URGA 4O3RA 2GIQA 3QGPA 4KO0A 4H4MA 3FCWA 4EBEA 2YKPA 3JQMA 4DZ6A 4CO5A 1VQ7S 2ZH6A 1QUVA 3N6NA 2AWZA 4K59A 1YZ6A 3AODA 3Q8QB 2RH3A 4GVBA 2CVEA 2GW8A 1FJGJ 3DLEA 1RK8A 1NZAA 2MKJA 5GMDA 3KJFB 3HFZB 4C48A 1OYDA 2HVZA 3ZC4A 4QWAA 1FXRA 1DARA 2W4DA 3ISNC 2LDYA 3R9LA 4LRCA 4XO0A 2B5JB 2HFZA 2W2OP 3PEJA 1LFPA 1WACA 2HBRB 2MHNA 3N28A 5KFYA 2QGFB 4OI4A 3AT1B 2W25A 3I5BA 4LF2A 3K8VA 3HSJA 1QSSA 5KAKA 1YDLA 5HROB 3OSPA 4DCJB 2OEMA 3HHKA 4RBTA 2DT9A 2HNZB 3EGNA 1H98A 2CPXA 4LF6J 5DDQC 4H4KC 4JI2F 5GADU 2W2PP 2HSEB 1NK4A 2DD8S 1RLCL 5T7LB 2GIFA 4ED2A 4X4NA 3RBDA 1E6VA 1WHXA 5BYRA 4ELUA 4DQRA 2CIMA 5FLXU 4NLGA 4JI8J 2KH9A 5HLFA 3POTB 5EHHA 3CJKA 3T9ZA 1F1BB 4N41A 4CRJA 3TA2A 1TK5A 3TNVA 2CWXA 5A8RA 3QSYB 4DMZA 3PYEA 2W9BB 3NKYA 2YWEA 2PFFB 1RQ0A 4TXSA 1Z1ZA 3VTIA 4Y34A 2HZCA 1U6ZA 5LXRA 4LF5F 2HS3A 3NAHA 2EBGA 5A8KA 1DY3A 4LF1A 4KRWA 2KVIA 3JSBA 3DLLQ 3BQ0A 4WP9A 3KKFA 2AX0A 1SJ4P 1EJ7L 3L7OA 2UUAJ 4Q5VA 2AHOB 5A0YB 3H90A 1RT3A 4B02A 3E01A 3CJ5A 1OSCA 4NEZA 1LWEB 4N47A 2R2SA 1HWUA 1M90T 3TX0A 2M8HA 2C3MA 4ILRA 2R7RA 4B9MA 2AJ4A 4DS5A 5GADI 4KFBA 3ONQA 3T6BA 3VQSA 1QTMA 3DLHA 3QLHB 1WC1A 1S7IA 2HHPA 1X0PA 1RWUA 4X62J 3G8QA 3JB9k 5ETLA 2E5JA 1T3OA 1TL5A 2AYMA 2R2UA 2V69A 3MOZA 4B3TF 1YBAA 3KLIA 1Q82T 2R7UA 2HFVA 1F2GA 3UVJA 2HQIA 5KT5A 3RAXA 5B7WA 3G4SS 1PG5B 2AU0A 3OR1A 4WZMA 1ZETA 4JI3J 2KG0A 4FS1A 4ZPWR 4DF8A 4WU2A 1N48A 1QAYA 3GYNA 1EP4B 2Y8YA 2HVIA 1R8PA 4WYWA 1IKXB 1XBWA 4FKXA 4OHWA 5F8NA 4WKYA 4OYIA 1RT2A 5CABA 3LWLA 1UMJA 3Q2SC 4R8UA 3TUIC 4X64F 3PKMA 1B64A 2CPJA 4AT1B 3V81A 2CJYB 3KK1B 1CPZA 1S10A 3VZHA 1OYEA 4CO0A 4HHUA 4WBFA 1N52B 2HIYA 1S6QA 4GKJJ 5F0UA 1UEKA 3HMJG 2BJEA 4DI6A 1MN7A 4CLKA 4NLQA 3ZTOA 3R5DA 2W7OA 4USKA 1CJVB 1K1SA 4M94A 1KBRA 1Y10A 2XS7A 3OXFA 1U2FA 2W9CA 3RG6A 4NYPA 4KB7A 4NXMJ 3TAPA 3DOLB 1VJQA 5KFPA 3ZZTA 5IC6B 2JSXA 4IO1A 3R2DJ 3OVSA 1RBAA 2B4UA 2AEFA 4QCLA 5L1IA 3ZZZA 1NLKL 3BGOP 2B51A 2JL9A 4J9NA 2AYGA 1CULB 4AL7A 1KVKA 3H98A 1IQZA 5FIIA 4DV0F 3LAMA 3F73A 2DVIA 4MK8A 2VA2A 3TQEA 3UW1A 1VBYA 4Y65A 1R8CA 1RTJA 2HVEA 2QIFA 4M8LA 3PYDA 2BQ3A 3AOCA 5L9XA 4Q43A 3FRYA 5EUHA 2A18A 2E66A 4PXBA 4PG6A 5SUHA 1ICEB 3CDWA 3OPKA 4JI1F 3VHQA 2EEYA 1UPMB 3LF0A 2I9SA 1NKEA 1NH8A 4N5SA 2QA2A 2IA0A 2HURA 1J5EJ 4A8SA 2UVVA 1DBDA 4ZP6A 1B99A 2YWGA 3BO3A 3SBMA 2MZTA 3A8EA 3ZZOA 1CC8A 3IN5A 2XS2A 1SC6A 2MKIA 3SFUA 2OPPA 2ZJRQ 1U0HA 4F26A 1LKZA 3T5KA 1MSWD 3W7BA 2RRAA 4UQTA 1NSPA 2KFYA 3PRBA 4CTAA 3ISND 4F67A 2ZZMA 4QR2A 3MMJA 2GVDA 2PT0A 3NLCA 4RUBA 4C8KA 3SQOP 5THWA 4QYZJ 3MCOA 4KH1B 2XZDB 3T1YF 4J7CA 3AA8A 3G8SA 2V50A 2BACA 3U1LA 4FYYB 2A6OA 3ILJA 4OX7A 2D3ZA 3D6MB 5KG5A 4BHQA 4HACA 1TTHB 4KO0B 5IS2A 1J2VA 3C16A 3WX4A 1FKOB 4H4MB 4UT4A 2E1CA 3G86A 4AQYF 2CZVC 2HW3A 4A8WA 3QGGA 3ZXWA 1M5PC 2RMLA 3MPUB 4FYWB 4F3QA 2RDDA 2VOOA 3ZZPA 3BBCA 2DHAA 2G0CA 2UXBJ 5D0GA 2DJWA 4C98A 1N88A 4ECTA 5DG9A 3DLEB 1B7FA 3WDOA 1TKDA 3KOAA 4Z7YA 2VPYB 2CQ0A 1HW8A 1BLUA 5IOLA 1VK8A 2N82B 2QZ8A 2BQRA 2HGLA 5F9NA 5ETVA 1UWAA 2AJ2A 2HHQA 1B4SA 4ZP8A 1SV5A 4WFXA 4RW9A 1NJIT 1FNOA 1CC7A 3Q83A 4OYZA 1TUVA 3IFEA 2W2NP 4O3OA 1UVMA 4B9UA 4F7VA 3TEHB 1U02A 3MFIA 2H5JB 4QIWD 4TU8A 4DFPA 2XHWA 1YZ7A 3CVKA 2DGXA 2VFTA 2WRMA 3KJQB 3W60A 4I2PA 3EPGA 5AT1B 2RILA 3TAQA 1FRJA 4KY3A 3NCPA 3TVZA 3EDQB 4OJ1A 2V9KA 1FD2A 2GJIA 4MH8A 1SUQA 4DUZF 3W2VA 4WF9Q 4DOZA 3KJVA 3GP9A 4YMEA 1BUXA 3VAIA 1HBMA 3GILA 1NDPA 2E44A 2BJDA 3CULA 2EK1A 1HWJA 3MM6A 5D4NA 1O5JA 4JV0A 3JSRA 2ZFHA 4EZ6A 3M6XA 3H25A 2DGSA 1FEEA 3H42A 5B0BA 1N34F 4IH5A 1RP5A 1RWOB 4XIUA 4FZVA 2FIUA 1QVFR 3DN9A 3ZTPA 5C24B 2VHGA 5LSLA 2WBRA 1VQMS 4PQUB 2Y9HA 1FHTA 4F02A 1QLNA 4U8VA 1JXLA 2VU5A 4Q2MA 1TUGB 3X1LB 1RT3B 4DV5F 3PNIA 2EFVA 2CQHA 1NSKL 3T41A 4HDGA 4J9OA 1BE4A 4ECZA 2PA3A 3DLKA 2YNIB 2YX7A 1BHNA 1QVGR 4G65A 2ZH9A 2VPXB 3WQPA 4QOTA 1EQ0A 4EGLA 1M5HA 2QJ3A 2NYHA 4ANCA 4DL2A 4I1TA 1XJWB 3MM8B 2NXNA 1VQ5S 4F36A 3H5XA 1FNXH 4WK1A 1I3OB 1VQSA 3NS5A 4WTOB 2CQGA 6FDRA 3JSMA 5B0EA 5F9LA 1RKJA 4LRFA 2JEJA 2ZD1A 4PKDB 1UVNA 2CQ3A 1DLOB 2ROGA 1XMBA 4V19X 4UOGA 1TL1B 2IRYA 2QO3A 2ATCB 2ZVSA 5KOWA 4Y0FA 4NYZA 2C2EA 4B3TJ 4R8UB 4WZQA 4QW8A 4CH0S 1KLMA 4GKKJ 2KXHA 1RB0A 4O44B 1TAUA 4LFAF 4LF7J 5F3TA 5KT7A 3D6TB 1MNEA 2HHUA 3IWXA 1F6TA 4IH7A 4ID8A 1UAWA 1B0VA 1SL2A 2CQCA 5GAHU 5HK4A 3TVYA 4K4VA 4KHRA 1Y0HA 3G9CA 5KFZA 4DN0A 2WTFA 5MAOA 2V2KA 2XLIA 3D1OA 1WG1A 3EYZA 1NDLA 2W9CB 1GFWB 5KFVA 4G1IA 3HVWA 4E0DA 3I0RB 2MSTA 3BSCA 3LPYA 2Y8WA 3W8GA 1TL7A 2XYGB 2YWHA 4ATNA 2VBWA 2HBQB 3LA0A 4DSLA 4YP3A 3EZOA 3HT0A 1UFLA 2BA9A 2A1BA 5DGBA 3GJQB 4NLOA 5KG1A 1O6XA 4AYBD 3DLGA 1VS3A 1N32F 2F9DA 1HHSA 3KDNA 3K17A 1V9OA 1IJEB 1N36J 1S6PB 1T03A 2CNKB 3LP0A 1VC5A 4TNOA 2F4VF 2KTQA 1CG2A 1RHMB 3AH6A 2F5GA 1SQGA 4K5RA 3OFFA 1WTBA 2IVYA 3ISZA 3G96A 2MLZA 1IN0A 4GC6A 5E0OA 3LANA 3G87A 2FB0A 1AT1B 3HCXA 5HMYA 4GO7X 4DV0J 5GAHI 2AGPA 3BR9A 2CG4A 2B8QA 4DSJA 2OPPB 3IBFB 5GAGU 5IT9Y 2YY3A 4HHHA 2CJ9A 5J2NB 4PUOA 1HMVB 3CUNA 4JI1J 2BW2A 3M9NB 5D78A 2NUHA 4UZBA 1NMEB 2GVDB 4ZLNA 3QAUA 2YXLA 9ATCB 4F4XA 1NK8A 3UR0A 4IOBA 4ZLPA 1V3RA 4DPYA 1C1BA 4IOCQ 2UUCF 3FBBA 2ADCA 2BM1A 3MECA 4AE5A 3F0NA 4YHHJ 3IM9A 3B54A 3IAS9 5E2QA 1UL3A 3C16B 2NCKL 4PR6A 4PAAA 5GAEU 5JUMA 1TELA 2IYIA 1F3FA 4F4AA 2OELA 4RW8B 4E8UA 1URRA 3OTOF 1CQNA 3SQGA 4X4PA 5IT9U 4UUXA 1WEYA 2L48A 5EN1A 4OI6A 4BLGA 4JI4J 2KVQE 3NG8A 1UJ4A 4OYAA 2EFQA 2GFFA 4WWSA 4AQYJ 1SV5B 3E3XA 4DV2F 2KYZA 4RW9B 3FFIA 5CZXA 2XHCA 4LBIA 2R3VA 3DU5A 5IWAF 4I2QA 1UVLA 2B6AA 2AJQA 5G0RA 4LR7A 2ZNZA 3J7A1 1CJKA 4ED7A 1XNQF 1RHQB 2PC6A 1SJ3P 1JLBB 2MTLA 1GQEA 4FPRA 2MQQA 3BB5A 3K0JA 1HI1A 3KTQA 2VFRA 2JVOA 3HT3A 3SEOA 2OGUA 3GSDA 4O3SA 4DR4F 4WCEQ 2DHSA 1KNZA 1DQAA 2EKNA 1HBMB 3HJVA 3RYLA 4KHPF 1IM4A 5DLFA 4HR2A 3I5CA 2DCLA 4DL3A 4NEYA 1V6HA 3ENQA 2UVUA 3EICA 3Q8RB 4NZ6A 1JB0C 2Q6CA 2VQEJ 2EVZA 3A8JA 2HVHA 1AZSA 4P72A 5EWGA 1T9UA 3HLUA 5MLCV 3J80Y 2B4PA 1S1TA 1NJWA 2N7CA 3G6YA 3TZXA 5C25A 4DG1A 1VGYA 5KFBA 1PYTA 1DAXA 2E29A 4DBQA 2FJEB 4LF8F 2POKA 1I94J 4WE1A 4M5JA 4LF4F 1V3ZA 3T1AA 1ZA1B 3VR1A 3KJNB 2R7WA 2QTWA 1JKHA 4Y00A 4L72B 1XTZA 1FE0A 1NSQA 3BEGB 2MJNA 2RS8A 4DV5J 5CYMA 3R5AA 1DFDA 4TU9A 3M30B 4CI0B 3AY0A 3LH2S 5AE1A 1QTNB 1I6JA 2X51A 3W2WB 2D41A 2VJUA 4CM2A 2QEXS 1VQYA 2OSRA 2BJ8A 2DIVA 3CEDA 3UQSA 4JP8A 4ECQA 1ZZNA 4L6V3 4U95A 3K58A 3J80U 5GVQA 1X5TA 2MB0B 1YJUA 3X3UA 2C2MB 2A2DA 3FEZA 2HZAA 4ECRA 2VG6A 5DQHA 4BWJA 3N5FA 5K8MA 1VC6A 5A6WA 4NL5A 5IM0A 1SCJB 1XR7A 2H4YB 4HVZA 3UDEA 2RE1A 4WK3A 3I4HX 4JV5J 4F2RA 2YQ3A 2UZAA 2BE7D 1TKZB 1S9EA 4B3MJ 4ITSA 5KFIA 3SCIE 1HNIB 2HQCA 3MMCA 4M1KA 2OIHA 2ZHBA 3NL0A 2R7OA 4QIGA 2MQOA 2E7WA 1YITS 2J8AA 4OYPA 5B0GA 1S6UA 2FTRA 1K8AT 1WOOA 1WC4A 3EPIA 2OPRB 2D3O1 3KFWX 2GNKA 3THTA 1CEZA 2HHTA 2WB1D 1ROFA 2ZH7A 1HWIA 4L74A 2FJBB 3ITHB 3J81j 3UCZP 1TL7B 3AXMA 1N5YA 1SJFA 2NSBA 2ERRA 3KLEA 4F04B 1HBUB 3EJMA 1SJRA 3W63A 1F0XA 3HK2A 2HHHJ 1KP6A 3MR5A 1X4EA 2JEIA 3DLGB 1C0UA 2QLWA 2IMWP 2H54B 1Q8LA 4KIAA 5FDLA 2DGVA 3DMJA 2ZOMA 5DM7Q 1P27B 1T03B 4OI3A 1NEEA 5AXLA 4MKBA 3QO9B 4O0NA 3V4IB 5J2QA 1XMOJ 2DNNA 3LALA 5E33A 1KEKA 3BBFA 3BQ2A 1K73T 3LGNA 1U09A 2FC8A 4P74A 1OJ4A 3FCVA 3OT9A 2BANA 4TVAB 2VC0A 1P1TA 1X9MA 3MFHA 4ECVA 5KFGA 3OTDA 3W9HA 4NA3A 2F4VJ 4LSLB 3UNYA 2QA4G 1XNRF 4D3GA 2J8SA 2LXUA 1ZYQA 1FVQA 1LFWA 4DL4A 3TAMA 2UXDF 2KZMA 4A4JA 3MAAA 1OQ3A 3TQ1A 2HAFA 4WYLA 3IC1A 2WOMA 3D0HE 4A8OA 4CT9A 5EX3A 3GB0A 1X4CA 3OJUA 3M9OB 4ZJLA 3BGRB 3M9MB 2G1DA 2DEJA 3MECB 2APOA 2U2FA 4DFJA 1VQOS 1RTDB 2BV3A 4CLUA 2XNQA 4RW7B 3TANA 2JOQA 2D74B 2O1PA 2F9JA 1Y3JA 1U26A 4PG7A 3HJFA 4NZ7A 2KT3A 1Q0NA 2WVDA 3QT5A 3SQGB 2JVRA 1Y3KA 1UEUA 1VQPS 2MGZA 2G2ZA 2PI5A 4C4WA 4B9VA 2NUUG 3ULHA 4DV1J 2UVRA 3VVTA 3NP5A 2DNMA 3QBCA 1FJCA 4EK2A 3BH7B 3GFYA 4ED1A 3NCRA 4LQ9A 4G3IA 1YRXA 3PIPQ 2XCAA 1Q5VA 5KG7A 1RJJA 1MG7A 3C19A 4WIIA 5E5NA 3R7BB 3H59A 2JLEA 2N4CA 5I3QA 1EETB 5DRKA 2R9LA 1CJKB 4URQU 1AFIA 3SSRA 4MAKA 1IBMJ 1JLCB 2A6MA 2B7BB 3HHLB 3DI6A 1YG0A 1C4CA 1T05B 5ETQA 4DV2J 1C0TB 2CPYA 1S79A 3AD8C 5HAOA 2HWIA 4I69A 1VK3A 3I55S 1RHKB 3NGDA 1R8AA 2GHPA 1IWAA 2NXJA 2L9NA 4S0MA 5IWAJ 2GIRA 2OH2A 1S1UB 4ZN1A 3CJ4A 2VC1A 3CCSS 4P6QA 1Z2LA 3N79A 4C11B 5B09A 3H7HB 3QQCD 5HVFA 1FVSA 2KXNB 2QFJA 2H9ZA 1RAOA 3V2UC 2Y1IA 1X7VA 1U6FA 4AD6A 1YQHA 4QZVB 2V2QA 3M8PB 4DL6A 3R5JB 2OSQA 4AL5A 2DBBA 4OYWA 2DXFA 4LF9F 2IDLA 3WX8A 4GVLA 3CCES 1ZTWA 3BN7A 1S9GB 5KFHA 4KPYA 1T95A 3DNCA 1Q5YA 5HMZA 3MEGB 4RJVA 1PBAA 1S76D 3PFEA 2MKHA 1O0PA 2BQUA 4JI7F 3RB3A 2FLLA 1Q86T 2CQBA 3D9BA 1IXKA 2MKYA 5CD4A 4Q44A 1QSLA 2GJ2A 1GMUA 1X4FA 3PJ9A 3EE3A 3LUYA 4BCAA 2DYAA 1SPBP 1WC3A 4NCGB 1ZM4A 4QBUA 3GCWP 3Q23A 1RWPB 2QFIA 3HHEA 3MGJA 3FC9A 4LF8J 4DV3J 4IKAA 3QPIA 2GGPA 4DV7J 2C28A 3BZQA 3GZ7A 4OLOA 2KDOA 3MM7A 2IJFA 2DH7A 2R7XA 4IOAQ 2ZWOA 5IT0A 1IKYB 4A46A 2VJVA 1XMQJ 4UW2A 3C2PA 4QWEA 4TY8B 1JNRB 2RKIB 2VG6B 2YKAA 2CNNB 3UDLA 3R5GA 5T14A 2CJXB 2JFDA 2OD6A 1F5AA 2V8PA 3RB4A 1RAHB 2J6UA 4B3SJ 3K8WA 1JLGB 3A4TA 1QSYA 1FWPA 2BJ1A 4FYDA 1U25A 3NBPA 3MMCB 5B0CA 2NREA 5HQ8A 1W2IA 1FE4A 4RNHA 5LL6d 4DU7A 1GK8A 4YB7A 2KFZA 2K7KA 5CCMA 5L1KA 1WNEA 5IV4A 1H2VZ 4M5NA 2KJWA 2D69A 4NX9A 4UOCA 4ELVA 5J2MB 1FX2A 3G8TA 2ADBA 2DRBA 2WK4A 4KGVB 4DQQA 3DGPA 3DKDA 3UDVA 4PG5A 5C5JA 1KFSA 3LP2A 2CWKA 4GMKA 2HRUA 2YWKA 3RBXA 1JLAA 2G0JA 4L75A 4RX6A 3PJWA 2AT1B 2MJUA 3FMBA 3K7RA 2Q43A 3ENAA 1P1LA 4PPZA 1R27B 1GXTA 2NSCA 4ZVRB 1C0UB 2MLXA 4WP8A 2HWHA 1NHVA 1JJCB 4OZLA 1SI9A 4NE9C 3TA0A 1H0HB 1FRKA 3BV8A 4Y3CA 3OTCA 4RUCA 2HNYA 3HM9A 7FDRA 3V6DB 1C4AA 3GG1A 3W5ZA 5E3CA 2O01C 4C0BA 3DCAA 2NZCA 2LU2A 3KUGA 3O8WA 1LEOA 2MQNA 4I67A 5IQ6A 1U24A 3EVOA 3GIKA 4O4GA 2NPFA 4LFCF 4MK7A 3OVAA 2DITA 2E5LF 1I5OB 3SCKE 2ROEA 3PX4A 3VAMA 4OZNA 2ZDPA 2R2RA 4GRSA 2IHR1 2PGCA 4K0KF 4OYBA 3OV7A 1B0PA 2BKNA 2WONA 1SXLA 2XC9A 2XCPA 4KH0B 3DXBA 3IA0A 4I56A 4OZ1A 5D0HA 4PWDA 2FZGB 2YKNB 2BABA 4BWMA 5ETPA 5IFMA 2ZH3A 3V4MA 1UW9A 4B9LA 2X1FA 4ZPAA 2J5AA 2HFUA 3OFHA 2Y0SD 4M5DA 4EUVA 2ILZA 3MTKA 4CNZA 4KTQA 3DRSA 2MSSA 4DR2F 2DNKA 2DIUA 3V6KA 3D6FB 5LSRA 2LLZA 3BSOA 1WJ9A 2VKRA 5BYQA 3S6EA 2D3UA 3I82A 3HD2A 4ZPBA 2C3UA 4Q8EA 2ZC3A 1QD1A 2AMCB 2KT5A 3TZZA 4OHYA 1MU2A 2UV8A 4ZIWA 4WXOA 2MQ8A 1YJTA 4OMFG 1KLNA 2LXFA 2QLXA 1ZZFA 4C8YA 4P2MA 5ETTA 2IMOA 3WIUA 2M88A 2YQ1A 2DR7A 3BPDA 4PRFA 1CQMA 1M1KT 4ZA1A 2IA6A 2N3OA 5KG2A 2HBYB 3DRPA 4ZPCA 5FJ4A 3GSIA 3SFGA 7AT1B 2P2CB 3NGSA 3GR0A 2W1BA 2QMXA 2QX0A 3T1HJ 2DR8A 1VRQC 3P5TL 3QGIA 5K8PA 4UF4A 1KS2A 5M2RA 2ZM6F 2LFVA 1RHRB 4P10A 2VV5A 1VHIA 3C66A 4OX9F 3D3CJ 4ES2A 2XMTA 2W7AA 1A9NB 4NLRA 4I0WA 5EWFA 4DLEA 2Z2ZA 1RCOB 1R31A 2VZ9A 4HT5A 4DR6F 3M8SA 2DGQA 1U7LA 2V68A 1N5SA 2QLJB 1PJ7A 1PO6A 3FBEA 1B7YB 2B4VA 2ZUGA 4YB6A 1IBKF 3H4DA 4UTGA 2PI4A 1TKXB 2B8PA 2PMWA 3BO4A 3N01A 2OD4A 1IQTA 1RTHB 1S0MA 4USWA 4JV2A 5KFFA 1S12A 3J7YU 1ZAXA 2ZHAA 2JH3A 3PKYA 5L39A 4DPWA 2NXEA 5CCLA 5B0DA 2FYXA 4KPCA 2F4FA 3MF5A 1A6LA 2C2DA 3BO2A 1WC0A 2DR9A 3EZUA 3GV5B 2B9YA 1C2PA 4CT8A 4ZVHA 4CDIA 5CYQB 5G4DA 4LF9J 2P6SA 4RWXA 2Q6BA 4MTPA 4MMOA 2VICA 3HSDA 2LEAA 3QT8A 1IBLJ 3DOMA 2CG8A 4LBPA 3D54A 2M4MA 4N8OA 4R25A 5M2PA 1SC4B 4M5GA 4JI7J 3GU0A 2B5JA 1R8HA 2EC2A 2D9PA 5KFNA 3MPDA 1UA1A 2R7SA 3MM7B 2DNLA 3MCSA 1WC6A 4DHVA 2GHVC 4MT1A 5HROA 1LQ9A 4OLPA 2GZOA 1IR2A 1SL0A 2HNZA 1SBRA 1RT4A 3OL6A 4WJBA 5AJ3F 1AUSL 5T7LA 1S48A 1RZMA 3QSIA 3LW5C 1J5OA 2F65A 2XQCA 2XLKA 3TEGA 4ETZA 3OL7A 8ATCB 1FWLA 3SMZA 3UCUP 3K59A 3NBPB 4ED6A 2EKYA 4KV8A 1DURA 3CJRA 3OHAA 3K89A 3SCJE 1UJ6A 2BDPA 2IAJA 2ZVIA 2SXLA 3D1HA 5F8MA 4F0MA 1CS4A 1NRKA 4MKAA 4NPOA 4A48A 1JIHA 2X3DA 2D7SA 3D6HB 2HGNA 1X31C 4Y2AA 5EX0A 1NO8A 3P5BP 4IYQA 1U8WA 2RAQA 5KFXA 2XZWA 3MPYA 3AQOA 3GPAA 1RWWB 3V6HA 1VOMA 2V9WA 2GAGC 5LMUJ 3JXOA 1LWEA 5I3UA 1T9XA 4WIQA 1VQ6S 4B3RF 2V8DA 5KFSA 4CO2A 1DTQA 3KLFB 3H2LA 3MHYA 2VUGA 4W4MA 4Y28C 2HNYB 3CTRA 3QLHA 3QRQA 2FGCA 1RTZA 3QIPA 7FD1A 4O4GB 3QRPA 2Q3PA 2F8HA 3S1TA 3QYYA 1L5UA 3EXYA 3R2CJ 1Q81T 2M8DB 2EFOA 1SH0A 3T6JA 4ECUA 4J9KA 3FDSA 5DM6Q 3KG0A 3QFWA 1O51A 3TX8A 1TMJA 5DLGA 3MM5B 3H40A 4Y6IA 4LFBJ 5C42B 5KT2A 1A7GE 2BZ2A 3VAFA 1WSRA 4ENOA 5J2PB 1YX2A 3N6MA 3NCQA 2UU9J 4IDKA 3KMSA 3RRHA 3TW0A 3FSIA 1YJ9S 4ED5A 2YX1A 3NGUA 4ERDA 1TR0A 3KNGA 3U7JA 1IM6A 2KU7A 5A8WB 4I6WA 2RHSB 5LOQA 1LXJA 4I7FB 3GIJA 4ID5B 4LREA 2AQ4A 4MIAA 4DR3J 4ZVTB 2CADA 5HBMB 2C2RA 1S9FA 3HVAA 1FDBA 5CZVA 3ZFVA 3DOLA 2LCWA 1LXNA 3MR3A 4EYIB 2XSJA 3MOJB 3IR6B 3OD2A 5EDWA 3NWRA 1KQGB 2O67A 3KG4A 2VF3A 4FF1A 4DQPA 3I0SA 4Y2KA 2UVWA 1U1LA 5H9EJ 1F3VA 4MIWA 1T02A 4EO8A 1CULA 1X60A 2QLFB 4DXLA 2CQDA 4C3KA 2F8EX 2I8EA 3EXCX 3M2RB 4KQZA 5ITHA 2JEFA 1PILA 3QZ8A 4HHJA 3PHTA 3KMQA 1TAQA 4JI0F 3BS9A 1SC1B 2H65B 1T9VA 4K2XA 5DDPC 2HHWA 3NNHA 1IKVA 4F0HA 3M8YA 3GIIA 4RR5A 3DRYA 1YBTA 4JOUA 1WI8A 2G1HA 4NI2B 5KFKA 3BKTA 3CD6S 1KONA 1LK7A 1GH8A 4IRKA 1VDHA 2QC3A 2ZBPA 1APSA 2X3GA 2RU9A 4NRTA 4Z7CA 4YR2A 3H2UB 2DPIA 3CWJA 4ED8A 2H5IB 2IDEA 5HP1A 3IGVA 3VAKA 2GAHC 1F9FA 4ETXA 2CQ4A 3BYPA 2CQIA 4LRDA 2XI3A 4IO9Q 1Q4RA 3HXMA 4RBUA 2WB4A 2O3DA 1S0OA 5HATA 4GO5X 3FEYB 3GCXP 3G6ES 1FKOA 5AXNA 3QIDA 4WKRA 3M2VB 1FXDA 4OHVA 4PZVA 2LU1A 1WUUA 3ETOA 4P7VA 4C8LA 4ECSA 3S8SA 4ECXA 1IBKJ 4X4TA 3MEDA 3JYTA 3L9ZA 1PC5A 2C42A 5AE2A 2R7QA 3DOMB 2I5JB 1RT1A 4CLSA 3TR5A 4DU8A 1HQ2A 1N0VC 1A0OB 2BRLA 4JI6J 1HBOB 2YNGB 1RAEB 4N7TA 5F0WA 4Q8FA 3RAQA 2JZ5A 2M52A 4WFYA 5CQGA 2ZH4A 3T5JA 1NM2A 4FF3A 1SQEA 3G6VA 1U1RA 2H4WB 3OJSA 1ACMB 1RCXB 4YN3B 3DOKB 3ICLA 3BDPA 3THPA 2EC0A 2VONA 4K4UA 2G4BA 1RT4B 3VQTA 4FP9A 2WVEA 2DHGA 3O44A 4ER8A 1FF2A 3TUJC 1FA0A 4LVOP 1LNQA 1RUSA 2GV1A 5KFRA 1J5OB 1ZM3A 4NRUA 2FZKB 2DXDA 1Q7YT 2BJ9A 3PR4A 3HO1A 2BE2B 3CPWR 4KV8B 3MMAA 1RT6B 1DTTB 1YVFA 2DEIA 4EBDA 4FS2A 2J6TA 1H74A 2CPFA 2IAJB 3L7UA 4QWCA 4NXNJ 4FF2A 4F4WA 3H0PA 1CS4B 5KG3A 4DSFA 2BVZA 3AOBA 4RPFA 4C3LA 3TRGA 4UOHA 1NJYA 3M05A 2AF6A 1I1GA 2R8GA 3NOGA 1HPZB 2C2OB 4KKOB 5DZ6A 3AB2B 2ASJA 4RL1A 4U7UD 5C24A 3MR2A 4J5OA 1HA1A 2DISA 2QYCA 4PQUA 1K0VA 2OI2A 1RWNB 3CC7S 1D8YA 2VFUA 1KC8T 1PJ5A 4CP5A 2CPZA 3VALA 5I3UB 3KDOA 2WVCA 1RACB 5HI7A 2YNIA 2K06A 1Q8KA 3AA9A 1NHUA 1DTQB 3MURP 2LKZA 1KVIA 4ELTA 2FVPA 1TQLA 2WCXA 1FO1A 5E7OB 4HT7A 5H9FJ 2LECA 3MM8A 2WW8A 3CE8A 4ZOSA 3QIPB 2KRRA 2OLWA 1S5ZA 4P2XA 3MI7X 4K2JA 4F4KA 3A12A 2YH1A 4B3RJ 2M9KA 2H1YA 2HGMA 2QA1A 1FTCA 2DO0A 2CVIA 1PKUA 1VRUA 3GYXB 3EGWB 1DLOA 1AB8A 3UCGA 1TU0B 1TL1A 3HKZD 4YEAA 4NOHA 1FNMA 4IH6A 4RU2A 3DM2A 2DY9A 4K5SA 1X9WA 3SYZA 3RB0A 4OZ0A 1RE1B 4EYHB 4WFBQ 1JXEA 4W92B 2E9ZA 1N33F 2CUYA 4O44A 1X5SA 1Z2ZA 5H1SV 4IDKB 5LJ3Y 1X0FA 3K5NA 4JYAF 1UW4A 2FJWA 2HQFA 4DF4A 2LQ5A 1WSVA 4W90B 2I6WA 3V6JA 2R7TA 1EZZB 1VR6A 4MKYA
chains in the Genus database with same CATH topology
2Y8WA 3QRRA 2Y9HA 5H9FK 4QYZK 1WJ9A 5CD4A 3QRQA 4U7UD 5H9EK 3QRPA 2Y8YA 4DZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8W A;  3QRR A;  2Y9H A;  5H9F K;  4QYZ K;  1WJ9 A;  5CD4 A;  3QRQ A;  4U7U D;  5H9E K;  3QRP A;  2Y8Y A;  4DZD A; 
#chains in the Genus database with same CATH topology
 5KTQ A;  5FD1 A;  2ZE2 B;  2HHV A;  2JJ4 D;  2XSF A;  3B4M A;  2JC1 A;  4K8R A;  3NXZ A;  3BQ1 A;  4CCH A;  2IC3 A;  1HIY A;  2UUW A;  3I0R A;  1HNV B;  4KAI A;  2BKO A;  4C3M A;  4DUY F;  2VFS A;  2XSJ B;  2QT7 A;  1GX6 A;  1RTI B;  4X4R A;  3MD3 A;  1Z4U A;  4USV A;  3B78 A;  4U7C A;  5LM7 E;  3I0S B;  3ZTS A;  2KJV A;  3US5 A;  3CCU S;  4IG3 B;  1NB2 A;  5K8N A;  3P49 B;  1EQM A;  2PEB A;  2CPH A;  3KHG A;  3FK4 A;  2DGT A;  1H3D A;  1YK9 A;  1S6P A;  1TVR A;  3GFZ A;  2KN4 A;  4NLT A;  1VC0 A;  2C3P A;  4ZJO A;  3IWN C;  2FJD B;  2ZBR A;  1RLD A;  2OPQ B;  1G4C A;  4CO1 A;  1HR0 F;  3M6V A;  2DR6 A;  1TZ0 A;  1IKV B;  2CDQ A;  2FVQ A;  3CNQ P;  2GHW A;  3M8Q A;  4IRD A;  4MK9 A;  1R8B A;  3Q2T C;  3CDB A;  3KYL A;  4YUD A;  2QV6 A;  2XM3 A;  5JMN A;  5CA5 A;  3C8Y A;  5D4P A;  5I3P A;  4OYX A;  5J2N A;  2YKQ A;  1HMV A;  3OTB A;  2IJR A;  1SIZ A;  5HP1 B;  3D28 A;  2ZOG A;  2QYG A;  1X4B A;  2ZJQ Q;  2F3J A;  3FKB A;  1UVK A;  5C2C A;  5RUB A;  4X66 F;  3N4W A;  3ZZ0 A;  3LPE A;  3G82 A;  2QG9 B;  2FDN A;  1REV B;  2ZZN A;  4F50 A;  4RLE A;  9RUB A;  4DDF A;  3CCJ S;  4DV6 J;  5HMW A;  4B17 A;  1DHM A;  3CD7 A;  1OQ6 A;  4FKY A;  1LW0 B;  4YY3 F;  2XO6 A;  2AYE A;  1R6Y A;  3UN5 A;  3FZ2 A;  4E98 A;  3CW2 C;  4FBU A;  2BOA A;  1E6Y B;  1T0T V;  2GMJ A;  1TUW A;  3CJT A;  1FK9 B;  2YTC A;  4QW9 A;  2RQM A;  2GO9 A;  2UP1 A;  2YWF A;  1RSC A;  2BW7 A;  2DHH A;  3BGF A;  1BY9 A;  3NMR A;  4RW8 A;  3RBZ A;  2FUG 9;  3MED B;  2DNY A;  3JYT B;  1U4B A;  3LP1 B;  2AKW B;  3E8O A;  2XWY A;  4WTY A;  1FJG F;  3BR8 A;  1RT1 B;  2WHO A;  2GO8 A;  1SIW B;  2A10 A;  4KC5 A;  4ICL B;  1M5V C;  4J9M A;  3AJ1 A;  3ZO7 A;  1UP1 A;  2HPU A;  1MWY A;  3B4D A;  5C2G A;  1WHY A;  3N9U C;  4USM A;  3H2V E;  4OFZ A;  4ZP7 A;  2VQF F;  1JLB A;  1S4F A;  5AXM A;  4EO6 A;  3FJ2 A;  2EFN A;  1N6Q B;  2J9D E;  2ROP A;  2ZBC A;  3MTJ A;  4TQR A;  1KTV A;  4LF6 F;  2HFS A;  2C2N A;  3ELH A;  2UUB F;  4QWB A;  2V8V A;  4NA1 A;  3OBI A;  1LWX A;  3DHW C;  3VGT A;  1NH7 A;  1H2U X;  3QRR A;  4R5P A;  2HWT A;  1BQN B;  3MMA B;  4MYT A;  1W7W A;  2AZ1 A;  5ETM A;  4P52 A;  4JI8 F;  4X4S A;  3IM8 A;  4OJG A;  1HFE L;  2F1F A;  5K14 B;  5DET A;  3CCM S;  1F5B A;  1TL4 A;  2NYI A;  3DRX A;  1UKU A;  1FKP B;  2DNG A;  1F9E B;  4JI2 J;  5L1J A;  1RI7 A;  5EWE A;  3F41 A;  2H51 B;  3BM7 A;  1U8S A;  1N56 A;  3GV8 B;  2MKC A;  2G0I A;  2MQP A;  3CCT A;  2V2V A;  2RRN A;  3TZW A;  1RT7 B;  3MR7 A;  3HKW A;  1XR6 A;  3D4J A;  2V8H A;  1FT8 A;  5D0E A;  2MZJ A;  3SZ2 A;  4RU9 A;  1XN9 A;  1ZOT A;  1HBN A;  2OKQ A;  2YX4 A;  3M1V B;  3GE9 A;  1N54 B;  3GMG A;  3DC2 A;  1D1U A;  2GX8 A;  3LO3 A;  1GMW D;  1IVZ A;  4F0K A;  3VAJ A;  1QE1 B;  2VH7 A;  1B70 B;  3R97 A;  1RAF B;  2KKH A;  1ULR A;  3M6U A;  4ZCM A;  4K4T A;  2Z8Q A;  5KFE A;  3PO4 A;  3MCM A;  1PC4 A;  3C3L A;  1RYS A;  3Q86 A;  2AJ0 A;  4LF5 J;  3H20 A;  3W3S A;  2Z2Y B;  2VBX A;  1YRT A;  4LR9 A;  5F41 A;  1DZ5 A;  5DZ7 A;  1CLF A;  1Y9O A;  5DS7 A;  3GIM A;  3SDE B;  4U67 Q;  4X62 F;  5DO2 A;  2JNJ A;  1ZS6 A;  1Y00 A;  3M30 A;  5F8I A;  1K1Q A;  1YJV A;  1JLF B;  1V5V A;  2VOD A;  2OO4 A;  3W2W A;  3CMA S;  2F7V A;  1U1O A;  1R43 A;  3D2W A;  1VRU B;  3FMW A;  4DCO B;  3Q8S B;  1NKB A;  3I6P A;  3H5Y A;  5AXK A;  4J9V A;  4B08 A;  4DFM A;  3QAE A;  4ECW A;  1K47 A;  2PMH A;  3DM2 B;  3HSZ A;  4ZVG A;  1ZM9 A;  2XO7 A;  4WU3 A;  2XYH B;  3C46 A;  2P5V A;  1WTF A;  4Y2C A;  1GXL A;  4CYU B;  1S1W B;  3R27 A;  2Z57 B;  1TKZ A;  3PW2 A;  4EZ9 A;  1RGV A;  1HNI A;  3I31 A;  4L76 A;  2MY7 A;  3QAT A;  2PDA A;  1RAJ A;  3JTO A;  4PCQ A;  3EUN A;  2VA3 A;  3ZZY A;  3NRB A;  4USH A;  4A8K A;  3C15 A;  4GKJ F;  4ZCL A;  1UWB B;  4ZHR B;  2OPR A;  4X64 J;  4QIF A;  1S59 A;  2ZHO A;  2IM0 A;  1SVD A;  1TFW A;  2KFN A;  5J1E B;  1WEX A;  4R0J A;  3KLH A;  1RAB B;  1LOU A;  3FQL A;  1WF1 A;  2IC3 B;  3NOC A;  2R8J A;  2MQL A;  3GFH A;  3RRG A;  3ITH A;  4BC9 A;  4NCA A;  4JYA J;  2V4Q A;  4NXM F;  3FGV A;  2GCF A;  1HBU A;  1R3N A;  2JHE A;  5D77 A;  1WF0 A;  3W65 A;  2RQK A;  3WIV A;  1U45 A;  2K3K A;  2ALY B;  1RWX B;  3W61 A;  2QLB B;  1KKH A;  4IFV B;  4IG0 B;  4OZ5 A;  1RA7 A;  1TVR B;  3RR7 A;  2DCU B;  2M2B A;  2KI2 A;  1BWV A;  3QO9 A;  3RB6 A;  3V4I A;  3W62 A;  3PW4 A;  1FWK A;  3VGS A;  5DGA A;  2LA4 A;  1VRT A;  1K0T A;  4C97 A;  4NZ0 A;  5HJX A;  5KOX A;  3T19 A;  2A0F B;  2JFK A;  1S1X B;  4FXD A;  2HQG A;  3VCD A;  1JQG A;  1WG4 A;  3M8Q B;  1WOR A;  2EPI A;  1FD8 A;  2DNO A;  2DNP A;  5F8J A;  4PXD A;  2HMI B;  1J5E F;  1L3U A;  4ZIV A;  1MMN A;  3MXH P;  4LSL A;  2HK3 A;  2CJK A;  3I4P A;  5GME A;  4LQ3 A;  1HI0 P;  2V5H G;  1HR0 J;  1Q53 A;  2DH8 A;  3QJP A;  1RAG B;  4HH1 A;  2Y1J A;  1H73 A;  2PA8 D;  1HWL A;  2AIR B;  4DX6 A;  2I1R A;  1XR5 A;  3G82 B;  4F8R A;  4PG4 A;  4OHX A;  5JJB A;  3R1L A;  1H7X A;  4I64 A;  5KFT A;  3BJY A;  4MFB B;  1MMD A;  3BH6 B;  4NLW A;  3QT6 A;  3WHI A;  3BGR A;  4DLG A;  4Q2L A;  2VG5 B;  3H8Y A;  1YKW A;  2XMV A;  4TKT A;  1RTD A;  3P8B B;  4RW7 A;  2RSQ A;  3PO5 A;  2OEK A;  1TV6 A;  1ZM2 A;  5DJB A;  1URN A;  4X66 J;  4WPA A;  2RDI A;  4UUW A;  1RAD B;  3CGI A;  1IR0 A;  3T1Y J;  4KJI A;  2JX2 A;  2OFH X;  4P2S A;  2UXB F;  3CIM A;  2FHK A;  1S77 D;  3CF5 Q;  4X2B A;  1S6O A;  1N5T A;  1TK8 A;  3LWM A;  5D4L A;  5CAA A;  3L95 X;  3UDC A;  1VIS A;  5LJ5 Y;  3U1N A;  3JQJ A;  1J27 A;  1WEZ A;  5K9F A;  3PFO A;  1EB0 A;  1SL1 A;  1EET A;  1UVI A;  2XTJ P;  2B0G A;  1U1P A;  5FLX Y;  3RR8 A;  2RUS A;  3DLJ A;  4A8F A;  2M70 A;  2NLW A;  1JLC A;  1UVJ A;  5F8G A;  4H4O B;  2RIJ A;  4O3P A;  4P9S A;  3NGK A;  3HHL A;  1T05 A;  3HD1 A;  4PPD A;  3Q0A A;  1C0T A;  4QPX A;  2JLF A;  1VQK S;  3KK2 A;  3JS9 A;  1PAE X;  1WI6 A;  2MEW A;  4R5P B;  1S1U A;  2IIH A;  4C11 A;  3IRX A;  4O4R A;  4ZPD A;  1H6K X;  2VQF J;  2E5H A;  2YNH B;  2V0N A;  3VAG A;  2GS8 A;  1Q79 A;  1OY6 A;  3I5A A;  3OLA A;  3TUP A;  2QL7 B;  1WWH A;  2GVZ B;  4OX6 A;  2OP5 A;  3SI8 A;  2UUB J;  1YLX A;  1AUD A;  4DUZ J;  5K5M A;  1VBZ A;  4C0H A;  4RW4 A;  4O0I A;  3M8P A;  1TFY A;  4QU7 A;  3PEH A;  2FLP A;  2NXC A;  4HI1 A;  2CFX A;  3DGV A;  3DRR A;  1YI2 S;  1U47 A;  4YDX A;  1HBN B;  2IJN A;  2Y1L B;  1S9G A;  2BKP A;  1VQN S;  1T9Y A;  1FCA A;  3OFG A;  5EGY A;  1HI8 A;  3MEG A;  4KGX B;  4M63 A;  2HQ3 A;  1N34 J;  2P6T A;  3TJA A;  4XTT A;  4CLY A;  3PX6 A;  1BMQ B;  3TZY A;  2J9D A;  1Q8I A;  3OUY B;  4P75 A;  4DUT A;  3GJR B;  1PGZ A;  1LWC B;  3HP6 A;  3TUZ C;  4NCG A;  3EM1 A;  3KK3 A;  3W8P A;  3M2U A;  4EMD A;  1FEH A;  2FGO A;  3B82 A;  1UFK A;  3JQK A;  3CJ3 A;  2QN6 B;  3PDN A;  4K4Z A;  3AXK A;  3T5L A;  2VD3 A;  4ZCI A;  1FKA F;  3SXL A;  4IR9 A;  1IKY A;  2JLG A;  1BQX A;  1HQU B;  1KVJ A;  3PYG A;  2E9T A;  2YQ0 A;  4TY8 A;  2ZWP A;  1QAI A;  2RKI A;  1QY7 A;  3K5O A;  4P71 A;  4YS2 A;  5F3Z A;  4TLQ A;  1PYO B;  4RZR A;  2CNO B;  4DL7 A;  3U27 A;  1ITP A;  1X5O A;  3RRK A;  4B3O B;  4TLR A;  3ETM A;  3B6B A;  2PD1 A;  1WKL A;  4TYA A;  3HVR A;  3VGV A;  1JLG A;  2UUT A;  4GKK F;  2V6A A;  2BJ3 A;  4JB8 B;  3HI9 A;  4ILM A;  2RUG A;  1S7H A;  5IZH A;  4LF7 F;  2I2Y A;  3AAW B;  4LIR A;  2YKO A;  1GX5 A;  3H5S A;  3UFC X;  2K3I A;  3C15 B;  3KWM A;  1VQL S;  2JEG A;  2V94 A;  1NK0 A;  2IM3 A;  2J0Q D;  5DQI A;  4M5H A;  4DX7 A;  5J2M A;  3BKF A;  3LGH A;  5HAN A;  5ETS A;  1C1C A;  1U1K A;  1DQ8 A;  5HVG A;  3KUH A;  3KLH B;  2XY5 A;  4LFA J;  2N3L A;  4XAK A;  3PJX A;  1GMV A;  5KT4 A;  4Z2X A;  3CD5 A;  1NK6 A;  4TYB A;  5KFQ A;  3A8K A;  3IS9 B;  3A3O B;  2GML A;  3K5P A;  2KZZ A;  2Y0B B;  3CIZ A;  4KGM A;  3R5C A;  4MKV A;  5ETN A;  2DO4 A;  1RAI B;  4LJM A;  5JVG Q;  3L7P A;  1PIE A;  2LMI A;  2XZT B;  1U48 A;  4CNY A;  4A8Q A;  3GON A;  2ASY A;  4LIW A;  3R1H A;  4AL6 A;  2AD9 A;  4FYV B;  2XNR A;  2QMW A;  2F8M A;  3E51 A;  1H7W A;  4I68 A;  2LEB A;  3G2X A;  2W7P A;  3IG1 B;  3BPS P;  3V6D A;  4A8X A;  1N36 F;  2V2Z A;  3GQC A;  1VRT B;  3PHE A;  4OIX A;  2VKZ G;  2W4C A;  2B4O A;  2J0X A;  1XER A;  2ZZT A;  4U6P A;  4O23 A;  1HQE B;  4U96 A;  4CLT A;  4ZKA A;  1N32 J;  2IYG A;  1OY9 A;  1S99 A;  4TU7 A;  4WXW A;  1FRX A;  4RNO A;  4C7Q A;  2ILY A;  1TP7 A;  3DLB A;  3SV3 A;  2GQ2 A;  5C7P A;  3ENW A;  5HVH A;  2CKW A;  2QL9 B;  3PXG a;  1Q16 B;  2P9E A;  2OEJ A;  1X9S A;  4FBT A;  2PO4 A;  2LQ9 A;  5E3R A;  2ACY A;  2P8I A;  4J9R A;  2ZKU A;  3V5R A;  2FHJ D;  4GC7 A;  4DEZ A;  2JC0 A;  4YB5 A;  2MHE A;  2R2T A;  1FFW B;  2YKN A;  4IRC A;  1YWX A;  1BD6 A;  2YVS A;  4DPU A;  3QMQ A;  3CB4 A;  1LWF B;  2OAU A;  3CJ2 A;  3CDU A;  4R0E A;  4X4U A;  2G2Y A;  1GEH A;  4K50 A;  2DNZ A;  1VHF A;  3OR2 A;  4J37 A;  3UI3 A;  2VDH A;  4NLX A;  4YHH F;  3HZE A;  4IR1 A;  3ILO A;  4X4V A;  1TV6 B;  2CDR B;  1Q7L B;  3KNA A;  2NPI A;  1KDN A;  3SSQ A;  5L38 A;  2JDJ A;  2AGO A;  1D9A A;  4DR7 F;  2ACM A;  2ZJP Q;  2UUC J;  2E1P A;  3P45 B;  4A47 A;  2ZH2 A;  5K8O A;  2VL1 A;  2PN6 A;  2K2P A;  3D5M A;  4OJ3 A;  1CJT A;  2H48 B;  1D8Z A;  3KHH A;  4DV4 F;  2G9O A;  1HYS A;  4JI4 F;  5B0F A;  2MZR A;  4MJK A;  2CXE A;  2M7S A;  1FI4 A;  2U1A A;  1RU2 A;  5E3A A;  1VLO A;  4ZVU B;  4Q7A A;  1U49 A;  3OTO J;  2R42 A;  4DSI A;  3GJS B;  4ALZ A;  4RUH A;  4O3Q A;  4ZVP B;  4GVB B;  2BOP A;  1M5S A;  3NNA A;  4JI5 F;  4P7T A;  3I87 A;  1Y4Z B;  4QPT A;  3T3F A;  1OIA A;  4FPI A;  1SB6 A;  1VQ4 S;  5HO4 A;  1FTR A;  4HI2 A;  2AW0 A;  3CME S;  3ZTR A;  4L73 A;  2MKK A;  3M32 A;  3KK2 B;  4L3N A;  4OYO A;  2XMA A;  1RXO B;  4AUK A;  3IRX B;  1XNQ J;  4PWW A;  4CLF A;  1NND A;  3DFE A;  2X7I A;  1R89 A;  2HHX A;  1SKR A;  1MML A;  3NS7 B;  5CXT A;  2G2O A;  2HQD A;  1G7C B;  1RHU B;  4WFN Q;  4RW4 B;  1P9Q C;  3MD1 A;  3M8Z A;  4FVC A;  2AYB A;  4DR4 J;  2V34 A;  4M95 A;  3HSG A;  2E1A A;  1E6V B;  3HHD A;  2VQE F;  2FVR A;  3DRR B;  3VV2 B;  2K8G A;  3W64 A;  3EX7 B;  3W9J A;  4KE5 A;  1TKX A;  2XYP B;  1M1G A;  1RTH A;  5I42 A;  4KHP J;  5HLF B;  1K44 A;  3HX9 A;  4CLZ A;  1WF2 A;  3CJK B;  4CLL A;  3CJQ A;  3TA1 A;  3KHL A;  4F3M A;  2Q79 A;  3L4B C;  2EFP A;  3RBE A;  2W2Q P;  5KFJ A;  3UD3 P;  5A8R B;  2YPZ A;  2E5G A;  3N5B A;  5D4O A;  2VPW B;  3CCV S;  1X8D A;  2ZKT A;  5CYQ A;  3OVB A;  5D8H B;  2ASD A;  1HNZ F;  1I94 F;  4KBI A;  2ZIT A;  3BYR A;  2E7X A;  5A8K B;  2IBK A;  4HLB A;  3KK3 B;  5KFM A;  2Z2M A;  3FBC A;  6FD1 A;  3M2U B;  5F8L A;  2B3T B;  1QAX A;  4OZ2 A;  2HBZ B;  2RRB A;  2AP6 A;  1FRM A;  1T7P A;  3E01 B;  1K9M T;  1FDD A;  4K4W A;  3PCO B;  1NSA A;  1YIJ S;  2E7V A;  5KG6 A;  2Z58 B;  3BDE A;  4LF4 J;  2VOP A;  1U0S A;  1Y5N B;  4DQS A;  1S72 S;  3U1M A;  4EU0 A;  1T11 A;  2N7Y A;  2D3O R;  4RW6 A;  3SSS A;  3JAM Y;  1LW2 A;  5H9E K;  2H5E A;  4DL5 A;  4KFB B;  4F4Y A;  4MYU A;  2QSW A;  2HHS A;  1V3S A;  3O1L A;  3QWP A;  3DYA A;  1H72 C;  4NLS A;  4C2M A;  1TK0 A;  4FDF A;  2J6S A;  2AX1 A;  4RBV A;  4DJB A;  4TY9 A;  3KLI B;  1RT5 A;  1OMS A;  3THV A;  3UVJ B;  2MZ1 A;  1VIX A;  3F56 A;  3OR1 B;  4C8Z A;  2IFX A;  3Q89 A;  5CH7 B;  4JV5 F;  3MMB A;  1VIO A;  4B3M F;  3FVY A;  4HEA 9;  4Z37 A;  3KG1 A;  4FXW A;  2FLO A;  3KUE A;  4J9U E;  2N4D A;  1RT2 B;  1L3S A;  4CQ1 A;  1C1C B;  1XK8 A;  1X4A A;  3RW6 A;  1I51 B;  3K5M A;  3V81 B;  4EWT A;  2XG8 A;  4J90 A;  4X84 A;  1VLY A;  1S0N A;  3C6U A;  3PW5 A;  5CD4 H;  3JAM U;  2XI2 A;  3RAM A;  4NCB A;  3SV4 A;  1WHV A;  5ETR A;  1HD1 A;  4PAB A;  2LEP A;  3C6T A;  4G6V B;  3MUV P;  1HKA A;  1S6Q B;  2OHD A;  3MR6 A;  1HNW F;  2XGP A;  4CLP A;  5A2Q Y;  2B56 A;  4HKQ A;  3M8W A;  3ZNU A;  2HHH F;  1NXI A;  2FY1 A;  2V4J A;  3MZI A;  3UD5 A;  4DZD A;  3KLF A;  4QJV A;  4H4K A;  5KFU A;  1JLE A;  1GAO A;  1HAR A;  1S97 A;  3GLJ A;  3D68 A;  3TP2 A;  1Q78 A;  1JJ2 R;  4CH7 A;  3N6L A;  1FJE B;  2FHO B;  1R0A A;  1SC3 B;  8AT1 B;  1WD6 A;  1XMO F;  3UR3 C;  2NZ4 A;  4K4S A;  3RGI A;  1Q95 G;  3IBW A;  3FBF A;  4QIV A;  2R8I A;  2C22 A;  2JRS A;  2Y3Y A;  3HZG A;  1XIQ A;  1YJR A;  1YJ7 A;  4DR1 F;  4X4Q A;  2XY6 A;  3TO8 A;  5JVH Q;  2R4F A;  2EG1 A;  1OPI A;  2MYF A;  4ZCK A;  4DX8 H;  3J7Z T;  4NLV A;  5AE3 A;  4V1A k;  1RTJ B;  2FLN A;  5LT5 A;  5D3G A;  1TKT A;  4M5L A;  3MM5 A;  5A2Q U;  4LVN P;  4ZVS B;  5C42 A;  1KSP A;  3QWU A;  3Q8Y A;  3A3N B;  5J2P A;  4FNH A;  2GJF A;  1YRU A;  3IAM 9;  1VMB A;  3GYG A;  3CC2 S;  4UZC A;  3CCL S;  2FD2 A;  1AFJ A;  1FFG B;  1XNR J;  1ZAW A;  2OUG A;  3OFE A;  2LQB A;  3OR2 B;  5A8W A;  1SH2 A;  2UXD J;  1U0H B;  1OSD A;  4I7F A;  1YJN S;  4ID5 A;  3HVT A;  3OXL A;  4ZIT A;  2HND A;  1ZPW X;  1G1X A;  1H38 A;  2X1B A;  4CTA B;  4HTI A;  2YNF A;  5HBM A;  4JBC A;  3PAC A;  3PY8 A;  2VB6 A;  1U1Q A;  1T94 A;  3FRZ A;  1N4L A;  1BGX T;  3K5L A;  1RAA B;  2J7K A;  3AD7 C;  4C0O C;  2PSZ A;  4OZ3 A;  2E1M C;  1CJT B;  1UZD A;  2FQQ B;  3DU6 A;  5ADZ A;  4HAC B;  4KYZ A;  2FJV A;  2NR0 A;  1HYS B;  3FUY A;  4CO3 A;  4DV1 F;  3G71 S;  3FCH A;  1GMW A;  4PYA A;  4C8N A;  4ZLJ A;  3BGL A;  2OTL S;  1MW7 A;  2KL8 A;  4DR7 J;  4J91 A;  2BR0 A;  3M2R A;  5J1N A;  1SKU B;  2MZS A;  4Q45 A;  4XDD A;  4UQG A;  3A13 A;  4ZS6 A;  3RUB L;  4PXC A;  1EKS A;  4K7Q A;  3E2E A;  2DRD A;  4PWU A;  4DV4 J;  1IBM F;  2A2C A;  5H9F K;  2RB7 A;  4NI2 A;  3SCL E;  3I9V 9;  3M32 B;  1OWX A;  5DG8 A;  5GAG I;  2GQC A;  5E3Q A;  3LGM A;  1KHW A;  4W98 A;  1KD1 T;  5HL7 Q;  3MUM P;  3CDA A;  1NPP A;  4WFA Q;  4FNI A;  3UN3 A;  1F5C A;  4NAS A;  2IVF B;  5LMN F;  1UTA A;  3GTY X;  3MUT P;  1S0V A;  4JI5 J;  3ILI A;  2WVF A;  2DRA A;  4YQW A;  1EIY B;  3AB4 B;  4I2P B;  4QR0 A;  3WBZ A;  4WFZ A;  4URS A;  2D9O A;  3HFK A;  4ED0 A;  1AXQ A;  5KT6 A;  1SJ1 A;  2GC8 A;  1NK7 A;  1UZH A;  3NY0 A;  1SUQ B;  3RJM B;  5A76 A;  1QJH A;  2O66 A;  3IO1 A;  3W2V B;  4CZC A;  3KJV B;  4DL0 C;  5I42 B;  5GAE I;  1AW0 A;  4NLP A;  1T9T A;  1AA1 B;  1H2T Z;  4USJ C;  3MEK A;  1TMM A;  3MM6 B;  1VQ9 S;  3PTW A;  2HVD A;  1ARO P;  2CQ1 A;  3UPF A;  3M2V A;  2DHX A;  1M5K C;  2BYC A;  1RIS A;  4DCP B;  2MZQ A;  2KM8 B;  2OMO A;  3FZB A;  2BM0 A;  2ASL A;  2MPU A;  1GXU A;  2W01 A;  1HHQ A;  3BSN A;  3QFH A;  1WOP A;  1XQI A;  2B9W A;  1QUP A;  2I5J A;  3I96 A;  2XGQ A;  2ZH1 A;  4RUA A;  1T8E A;  1PBU A;  3ZZR A;  2V8G A;  2ZC4 A;  3R6L B;  4AXI A;  3TAR A;  5D6G A;  1HBO A;  2RT3 A;  2YNG A;  4NLU A;  1S57 A;  3RZA A;  3IWL A;  4LMZ A;  2L08 A;  3ET6 A;  1SH3 A;  1HHT P;  4DV3 F;  2HEK A;  3DLK B;  3CC4 S;  4X65 F;  4DV7 F;  4RW6 B;  1T9W A;  2VAS A;  1HNZ J;  1R7I A;  1LW2 B;  3BF4 A;  2RVJ A;  5D0R A;  3KXD A;  4G1Q A;  3P3D A;  5E41 A;  3DOK A;  3DYA B;  3EGZ A;  1JLQ A;  3PVX A;  3OLB A;  4KR0 B;  3PG9 A;  2OJ3 A;  3EGV A;  1XMQ F;  3M8R A;  1KHV A;  4EI2 A;  5KG0 A;  1CSJ A;  2K7J A;  1RT5 B;  2ZEJ A;  1FJ7 A;  1VJW A;  1P9Y A;  3QJJ A;  1FES A;  3MMB B;  4B3S F;  3JSM B;  2BE2 A;  4RKU C;  4F4Z A;  3EVW A;  4XPC A;  4KGK A;  4ILL A;  2CPE A;  1RT6 A;  2LVW A;  1DTT A;  2ZD1 B;  2RHQ B;  2NXU A;  1NPR A;  3D0G E;  5D15 A;  4EEY A;  2XY7 A;  1LK5 A;  4G1P A;  4LRB A;  2R8H A;  4JV1 A;  4PXE A;  2P9C A;  4DS4 A;  1KFD A;  1KLM B;  1SJQ A;  1HPZ A;  1VCT A;  4KKO A;  3CD0 A;  3TJ9 A;  1CJU A;  3C6U B;  3GFX A;  3EWG A;  4RNM A;  4D3H A;  4OQJ A;  4QYZ K;  3C6T B;  4I6A A;  3W5X A;  2YH0 A;  4LRA A;  2RF2 A;  1JX4 A;  4J9P A;  2Z0G A;  2D1C A;  4UY8 T;  2LYV A;  4ZK7 M;  5BR8 F;  1O8B A;  2V4J B;  3UNG C;  2CRL A;  3CXC R;  2BMB A;  3MPV A;  4HDH A;  2RNE A;  1JLE B;  5HMX A;  5LXY A;  1KQF B;  4ZVE A;  3VGU A;  3GIR A;  2I0X A;  2DH9 A;  2L3M A;  3CO0 P;  4J9L A;  2P9G A;  4I6Y A;  3S01 A;  3HHN B;  1R0A B;  1W2B R;  4LBH A;  2QMU B;  3BGU A;  2ZUA A;  4NMX A;  1HNW J;  2DKO B;  4U9R A;  1B3T A;  4ZLL A;  4DPX A;  4HL9 A;  4H54 A;  3D7S B;  1KWM A;  3HPO A;  4I4B A;  4YR0 A;  3A8I A;  3MAQ A;  1YTY A;  4LUB A;  3DDI A;  3LP0 B;  4B9T A;  4EBC A;  4V19 J;  5D3G B;  1TKT B;  1Y11 A;  2E1R A;  6AT1 B;  2MLY A;  2KRB A;  2ATL A;  2FJA B;  1Y5L B;  1F9H A;  4LFC J;  4DR1 J;  3M7V A;  4NA2 A;  2YBV A;  2HAI A;  2W8L A;  2OFG X;  2E5L J;  4ZPT R;  4Q0B A;  1JNZ B;  1L3V A;  4ZVQ B;  1JWW A;  2CYY A;  4ZN3 A;  3CJ0 A;  2NQP A;  4QIE A;  3IGN A;  4K0K J;  4ZPV R;  5F8H A;  3OSN A;  3HVT B;  4PUO B;  4FVM A;  3WZ0 A;  2HND B;  1UA0 A;  2IVM A;  2LDI A;  2ZE2 A;  4XDC A;  2YNF B;  4OYM A;  1FFS B;  2FPH X;  2HFN A;  4QQB A;  2OML A;  1EX8 A;  2J9E A;  3R6G B;  1WEL A;  1D9D A;  1KQK A;  4IFY A;  2WSE C;  1HNV A;  3PIO Q;  3TWZ A;  5ETO A;  1C1B B;  3T5H A;  1XEZ A;  1V5I B;  1JJ4 A;  4ED3 A;  1RTI A;  3ZZU A;  3W1Y C;  2OTJ S;  1WKK A;  3AFG A;  1D3W A;  2J0W A;  4ZP9 A;  3NS6 A;  1S1V A;  4IG3 A;  5KFO A;  1DQ9 A;  4DR2 J;  2VPZ B;  5IT4 A;  2DGO A;  2CPI A;  3ILL A;  3JTP A;  4ZJQ A;  2DTJ A;  4QWD A;  4OZJ A;  2Z30 B;  3UD4 P;  2OPQ A;  1SKW A;  3BRE A;  3CCZ A;  5LSO A;  4HH0 A;  3CO9 A;  3I32 A;  3M6W A;  3Q22 A;  3UE2 A;  2YKM A;  2RDJ A;  2YPY A;  4DPO A;  1IKW A;  3T1H F;  1KOO A;  2X1A A;  1F60 B;  1FX4 A;  4UOF A;  1G2E A;  4DQI A;  4NML A;  1EAR A;  3FFI B;  2OPS A;  5K20 B;  3W5Y A;  1IWG A;  5HN0 A;  4I2Q B;  1NDC A;  2B6A B;  5G0R B;  3RW7 A;  3BSA A;  3FNN A;  1N5Q A;  3DXS X;  5L9N A;  2AGQ A;  4C8M A;  2WSC C;  3RU0 A;  5KFL A;  2HLT A;  1RA6 A;  2MKS A;  3AQP A;  2ZM6 J;  2DPJ A;  1REV A;  2Y1R I;  1FRH A;  1QAJ A;  2VIH A;  1OY8 A;  2ZH8 A;  2ABY A;  3PX0 A;  4OX9 J;  1VQ8 S;  4DR5 F;  1P6T A;  2J76 E;  2RU3 A;  4JUZ A;  3PYF A;  1LW0 A;  5LMN J;  4N8N A;  3FQK A;  1E6Y A;  4DR6 J;  1RKI A;  1FK9 A;  4QYR A;  2RQC A;  2PE8 A;  4YFU A;  3HDS A;  3ADA C;  3IRW P;  2X1G A;  2BRK A;  1W26 A;  2IM1 A;  1NKC A;  4F3O A;  2HLU A;  4F25 A;  4OV1 A;  5IV3 A;  1AZS B;  3LP1 A;  4FF4 A;  2VFV A;  3R3T A;  1SKS A;  3Q24 A;  3PRD A;  1S1T B;  1IBL F;  5C25 B;  4DG1 B;  2DY1 A;  4ICL A;  5SZT A;  2ZNY A;  3ET6 B;  3W9I A;  2RQ4 A;  2MDA A;  1JMT A;  3O3L A;  2CQ2 A;  3L09 A;  3ZNJ 1;  4QR1 A;  3D0I E;  4DSE A;  4CM0 A;  4WE1 B;  1M0S A;  1GT8 A;  4G1Q B;  3IR7 B;  5IC4 B;  1N0U A;  1JLQ B;  5I4M A;  1IBC B;  1JKH B;  2HKE A;  3AJ2 A;  3MM9 A;  1N6Q A;  4IQX A;  3I56 S;  3NGT A;  3K57 A;  3C14 A;  2R8K A;  1YGY A;  4PQA A;  5CYM B;  2L41 A;  2IBO A;  2WBM A;  4OX8 A;  2XMM A;  4DWI A;  1EHW A;  3A1Y G;  4X65 J;  2CZ4 A;  2FY8 A;  3UN2 A;  3KLV A;  3D3B J;  1UJ5 A;  2CNL B;  1BQN A;  1N8R T;  4ES3 A;  4HYK A;  1YBU A;  1NU4 A;  2J9C A;  1YSJ A;  5K14 A;  4ZVO B;  2PEH A;  4C6A A;  3ENV A;  5IXU A;  3LTO A;  1FKP A;  2J7U A;  3IP0 A;  4UST A;  5AJ3 J;  2J0S D;  3Q8P B;  2M3D A;  2BE9 B;  1MRO A;  4P73 A;  3BN4 A;  2DNH A;  1R6V A;  1RT7 A;  2H3E B;  5IM0 B;  1HD0 A;  4ED4 A;  3P4U B;  1CJU B;  1VBK A;  3MEE A;  4P2F A;  2FHJ A;  3WC0 A;  1S9E B;  1UFW A;  3M1V A;  2ZDO A;  1WC5 A;  1Y5I B;  4YR3 A;  2L9D A;  1NBE B;  1QE1 A;  2K1R A;  2RF2 B;  5KFA A;  3PV8 A;  3LOU A;  2Z4P A;  5B0A A;  2B43 A;  1P8G A;  3L3C A;  1U1N A;  5LMU F;  3IBC B;  5CYJ A;  1XWL A;  2UV8 G;  3CT9 A;  2L9W A;  2AJ1 A;  3MWB A;  2CZ9 A;  3I9Z A;  2FZC B;  3KHR A;  2KHC A;  3Q8U A;  4USI A;  3N0V A;  2F63 A;  4FYX B;  1N5Y B;  2V4R A;  3SDE A;  3KLE B;  4ZVF A;  4DX5 A;  1YHQ S;  1HLW A;  2QL5 B;  2QRR A;  4CLW A;  1GTH A;  5BR8 J;  3PZP A;  1KOH A;  1JLF A;  1NPK A;  3G6X A;  2UXC F;  3J7Z 5;  3VZI A;  2VG7 A;  2PMZ D;  4YOE A;  3CJS A;  3GG0 A;  2Z2L A;  2RD5 C;  1G6B A;  1PJ6 A;  2ZBQ A;  5HJY A;  5FDL B;  5KG4 A;  3DMJ B;  5BYS A;  2LXI A;  4KT0 C;  1NK5 A;  3R5B A;  2IRX A;  4YDD B;  4LSN A;  2CJB A;  2IPO B;  5J2Q B;  2Q66 A;  2V63 A;  3J81 Y;  1RWK B;  2IRU A;  3S7R A;  4LFB F;  2J7W A;  4CYU A;  1S1W A;  3HUL A;  5L1L A;  3DHX A;  2BAN B;  4XK8 C;  2HRY A;  4Q0B B;  2ALZ A;  1D0E A;  2W2M P;  2UU9 F;  5ETK A;  3J7A N;  1Q8B A;  4XPE A;  2LQJ A;  3VWS A;  1PYS B;  2EXU A;  1UWB A;  3TAM B;  4ZHR A;  5DG7 A;  1ZPV A;  1VI7 A;  3MAA B;  5J1E A;  2WOM B;  4DR3 F;  1N5V A;  1CBK A;  1PAU B;  4IFY B;  4U8Y A;  1FXL A;  1KR4 A;  4RNF A;  2XMU A;  3HHL C;  2BXJ A;  4OHZ A;  1ELO A;  2HK2 A;  1IJF B;  1GTE A;  5HQL A;  3TYT A;  5L46 A;  1X4H A;  1OPZ A;  1WOS A;  1OS5 A;  1S1V B;  3J81 U;  2C3O A;  2IM2 A;  2GQQ A;  2CAJ A;  3OTE A;  1ZA2 B;  1RU1 A;  4B9S A;  2XB2 D;  3VAH A;  2LA6 A;  4YB1 P;  4NWB A;  2XEX A;  4IFV A;  3H4B A;  4IG0 A;  3FSY A;  4RNN A;  4MIB A;  3RTV A;  3TVK A;  3SIP B;  4CO4 A;  2V67 A;  1VYA A;  4AXJ A;  5GMK a;  2IY5 B;  3OXG A;  1D09 B;  4L3K A;  2HG4 A;  1NAQ A;  1BQM A;  1S1X A;  4PG8 A;  2MGZ B;  3QJL A;  2XS5 A;  4DN9 A;  4B9N A;  2E5I A;  2AZ3 A;  5BJR A;  3OHB A;  2B9E A;  2YKM B;  4J9Q A;  1IKW B;  3MCN A;  5KT3 A;  2XMJ A;  3UWT A;  2AEM A;  2HMI A;  4DPT A;  4NLY A;  1TL3 A;  4N77 A;  2QSF A;  2OPS B;  2O5D A;  1FDA A;  4JI0 J;  3WC2 A;  4J9S A;  4PYD A;  2KHD A;  2QE5 A;  4M5I A;  3P96 A;  2Z56 B;  2DNR A;  1KN6 A;  1HNX F;  2DK2 A;  2KT2 A;  1U2R A;  1BXN A;  2EFG A;  1VBX A;  5CHC B;  3DI6 B;  2YWW A;  1CVJ A;  4EFA C;  5KFC A;  4MFB A;  3KLG A;  2PII A;  3D67 A;  1ZH5 A;  1F2H A;  3R7S B;  2VG5 A;  3B8H A;  1MWQ A;  4ANE A;  1HWK A;  4ZDN A;  1NHK L;  3CMQ A;  1NCL A;  3EMT A;  3TJ8 A;  5HQM A;  2C1E B;  3EDR B;  1T3N A;  2LQ8 A;  2I38 A;  1SQF A;  1RYR A;  1JXV A;  1RBL A;  3QZ7 A;  1R0B G;  4DR5 J;  1FER A;  2C2Z B;  1WDT A;  1NK9 A;  3NMA A;  3M4X A;  3O2I A;  3MPW A;  2B9X A;  1B0T A;  3FSX A;  2DB1 A;  1RDR A;  3VF0 B;  4AND A;  2KXF A;  3O6Q A;  2EG2 A;  1NJZ A;  2VBZ A;  4C8O A;  3K2Y A;  2EBE A;  1R0C B;  4E2F B;  3H5U A;  1KTQ A;  4BS2 A;  4JI6 F;  2AV5 A;  1HW9 A;  2EW9 A;  3QNW B;  3NNC A;  1U2C A;  3GR1 A;  4AFF A;  5E3P A;  1QM9 A;  1M5O C;  4M5K A;  4USU A;  3PW7 A;  1WKJ A;  3EVM A;  2AJF E;  1KRP A;  4M5M A;  3CSK A;  1WDD A;  2MY8 A;  1NB7 A;  4H4O A;  1PCA A;  3CCR S;  2W24 A;  3MM9 B;  2BX6 A;  5DDO C;  3D66 A;  2RS2 A;  3UO0 A;  1X5P A;  1UET A;  3C14 B;  4RO0 A;  3PW0 A;  1HL6 A;  2W9A A;  2HIQ A;  1FDN A;  4KSE B;  4OI2 A;  2BEF A;  1ZBT A;  1WG5 A;  1EKR A;  2GGP B;  3P6Y C;  4LT6 A;  1NJX A;  3R7N B;  5T41 A;  4WP3 A;  1NZ8 A;  1X4D A;  3GV7 B;  3HF5 A;  3HFV A;  4N56 A;  3D1Q A;  3MDF A;  3O5T B;  2COL A;  1MWZ A;  1UPP A;  2YNH A;  2W8K A;  3QT7 A;  1ZTT A;  2B7C B;  4ECY A;  2W4P A;  2GVZ A;  3T9N A;  4NXN F;  1MRO B;  3LQV A;  1WHW A;  1QDU B;  3J7Y I;  4A8Y A;  2WZ1 A;  3MEE B;  4U7U K;  3Q8V A;  2KG1 A;  3OL9 A;  2FVC A;  2C3Y A;  2WW4 A;  3JSY A;  1UCN A;  3POT A;  4KHM A;  4UY8 5;  2K1R B;  3GWC A;  4A8M P;  2DXE A;  2C2K B;  4C9D A;  3FEX B;  2UUA F;  3AOA A;  1XC9 A;  4PEO A;  2W9B A;  2MXY A;  3QGH A;  4K4X A;  4LR8 A;  1U1M A;  2MMY A;  3NWG A;  1U6B A;  1NUE A;  1YJW S;  3OUY A;  3DGP B;  2ZBI A;  1LWC A;  2DGU A;  3LP2 B;  1REG X;  1BC6 A;  1JLA B;  2ZOF A;  4LSZ B;  4X4O A;  3GJT B;  3CCW A;  5A0Y A;  1MLA A;  3OL8 A;  1X4G A;  3TOQ A;  5BXI A;  2VG7 B;  4JI3 F;  4FXV A;  1W25 A;  2VDI A;  3NAI A;  1HQU A;  3CDE A;  2EK6 A;  2RJZ A;  4CH1 A;  4DFK A;  1UEV A;  3HHL D;  2CJA A;  2WSF C;  4LSN B;  3AJD A;  1DJ0 A;  2CPD A;  1BWE A;  2F40 A;  4RWW A;  4B3O A;  2XBP A;  1ZAV A;  4BC7 A;  4TQS A;  2UXC J;  4OI0 A;  4OI1 A;  2M0G B;  1RWV B;  3AHP A;  3VVU A;  2JWN A;  4IQM A;  2DGW A;  3IR5 B;  5JXS A;  3DDK A;  3W66 A;  2KB2 A;  2ZH5 A;  1EP4 A;  2BJ7 A;  2G13 A;  2HS0 A;  5B08 A;  1IKX A;  1JJH A;  2DNQ A;  2QA4 S;  3ZTQ A;  2WON B;  4NLD A;  1JK9 B;  1RBO B;  1N33 J;  4Y2M A;  2CJQ A;  1DRZ A;  3OQ2 A;  4PWD B;  1L3K A;  3KK1 A;  2HS4 A;  3BBB A;  3R8Y A;  1Q1K A;  2NS1 B;  3IS9 A;  4F2S A;  2CQP A;  4OV6 A;  2KYX A;  3MAH A;  1VFJ A;  4OJH A;  4ZMM A;  4NYO A;  8RUC A;  1EAY C;  2HYI B;  1OO0 B;  4M5D B;  4BDP A;  2E9R X;  1MN9 A;  1IUJ A;  5KFD A;  3DRS B;  5L8R C;  5A6P A;  2VBY A;  1PSD A;  3BKU A;  1CJV A;  4IUF A;  2HRT A;  1AYE A;  2BUN A;  4DUY J;  3JTN A;  1S49 A;  3IG1 A;  2WAQ D;  3IMQ J;  4ES1 A;  3CJ8 A;  1M1H A;  2AEJ A;  2EWH A;  3NGR A;  4BBY A;  1BQM B;  1D9F A;  4CIO A;  1G3O A;  2R7V A;  1IR1 A;  1HQE A;  1MU2 B;  2MQM A;  3LAK A;  4QU6 A;  5J1P A;  2DR5 A;  1TL3 B;  5U47 A;  2XWX A;  2HZV A;  2FVS A;  4OL8 A;  1RHJ B;  2KO1 A;  4K4Y A;  3DRP B;  3PM9 A;  1KQS R;  1LV5 A;  1FRL A;  3IXQ A;  2XMK A;  2M5Y A;  4N76 A;  2XLJ A;  2KM8 C;  4O3N A;  3AD9 C;  4Y2I A;  2XMW A;  3KLG B;  1LWF A;  2PFD A;  1L3T A;  4CWB A;  2XUL A;  2GMH A;  2A3J A;  4HTJ A;  3TI0 A;  3PRV A;  3F44 A;  5HSP A;  4DV6 F;  5DDR C;  5DQG A;  1FRI A;  1NDK A;  4FN5 A;  2WVB A;  1HNX J;  2FHM A;  2Q1L A;  2CA9 A;  3NEK A;  3EZ5 A;  2FJX A;  2FC9 A;  3OW2 R;  4DSK A;  1Y7P A;  2BBE A;  3CCQ S;  5KFW A;  5M2U A;  1GNK A;  4TN2 A;  1S4E A;  3DDN A;  3U02 A;  2LP4 A;  3PR5 B;  2HFO A;  4YY3 J;  1RWM B;  5IQQ A;  2GA7 A;  3A3P B;  4KGZ B;  2EI5 A;  4URG A;  4O3R A;  2GIQ A;  3QGP A;  4KO0 A;  4H4M A;  3FCW A;  4EBE A;  2YKP A;  3JQM A;  4DZ6 A;  4CO5 A;  1VQ7 S;  2ZH6 A;  1QUV A;  3N6N A;  2AWZ A;  4K59 A;  1YZ6 A;  3AOD A;  3Q8Q B;  2RH3 A;  4GVB A;  2CVE A;  2GW8 A;  1FJG J;  3DLE A;  1RK8 A;  1NZA A;  2MKJ A;  5GMD A;  3KJF B;  3HFZ B;  4C48 A;  1OYD A;  2HVZ A;  3ZC4 A;  4QWA A;  1FXR A;  1DAR A;  2W4D A;  3ISN C;  2LDY A;  3R9L A;  4LRC A;  4XO0 A;  2B5J B;  2HFZ A;  2W2O P;  3PEJ A;  1LFP A;  1WAC A;  2HBR B;  2MHN A;  3N28 A;  5KFY A;  2QGF B;  4OI4 A;  3AT1 B;  2W25 A;  3I5B A;  4LF2 A;  3K8V A;  3HSJ A;  1QSS A;  5KAK A;  1YDL A;  5HRO B;  3OSP A;  4DCJ B;  2OEM A;  3HHK A;  4RBT A;  2DT9 A;  2HNZ B;  3EGN A;  1H98 A;  2CPX A;  4LF6 J;  5DDQ C;  4H4K C;  4JI2 F;  5GAD U;  2W2P P;  2HSE B;  1NK4 A;  2DD8 S;  1RLC L;  5T7L B;  2GIF A;  4ED2 A;  4X4N A;  3RBD A;  1E6V A;  1WHX A;  5BYR A;  4ELU A;  4DQR A;  2CIM A;  5FLX U;  4NLG A;  4JI8 J;  2KH9 A;  5HLF A;  3POT B;  5EHH A;  3CJK A;  3T9Z A;  1F1B B;  4N41 A;  4CRJ A;  3TA2 A;  1TK5 A;  3TNV A;  2CWX A;  5A8R A;  3QSY B;  4DMZ A;  3PYE A;  2W9B B;  3NKY A;  2YWE A;  2PFF B;  1RQ0 A;  4TXS A;  1Z1Z A;  3VTI A;  4Y34 A;  2HZC A;  1U6Z A;  5LXR A;  4LF5 F;  2HS3 A;  3NAH A;  2EBG A;  5A8K A;  1DY3 A;  4LF1 A;  4KRW A;  2KVI A;  3JSB A;  3DLL Q;  3BQ0 A;  4WP9 A;  3KKF A;  2AX0 A;  1SJ4 P;  1EJ7 L;  3L7O A;  2UUA J;  4Q5V A;  2AHO B;  5A0Y B;  3H90 A;  1RT3 A;  4B02 A;  3E01 A;  3CJ5 A;  1OSC A;  4NEZ A;  1LWE B;  4N47 A;  2R2S A;  1HWU A;  1M90 T;  3TX0 A;  2M8H A;  2C3M A;  4ILR A;  2R7R A;  4B9M A;  2AJ4 A;  4DS5 A;  5GAD I;  4KFB A;  3ONQ A;  3T6B A;  3VQS A;  1QTM A;  3DLH A;  3QLH B;  1WC1 A;  1S7I A;  2HHP A;  1X0P A;  1RWU A;  4X62 J;  3G8Q A;  3JB9 k;  5ETL A;  2E5J A;  1T3O A;  1TL5 A;  2AYM A;  2R2U A;  2V69 A;  3MOZ A;  4B3T F;  1YBA A;  3KLI A;  1Q82 T;  2R7U A;  2HFV A;  1F2G A;  3UVJ A;  2HQI A;  5KT5 A;  3RAX A;  5B7W A;  3G4S S;  1PG5 B;  2AU0 A;  3OR1 A;  4WZM A;  1ZET A;  4JI3 J;  2KG0 A;  4FS1 A;  4ZPW R;  4DF8 A;  4WU2 A;  1N48 A;  1QAY A;  3GYN A;  1EP4 B;  2Y8Y A;  2HVI A;  1R8P A;  4WYW A;  1IKX B;  1XBW A;  4FKX A;  4OHW A;  5F8N A;  4WKY A;  4OYI A;  1RT2 A;  5CAB A;  3LWL A;  1UMJ A;  3Q2S C;  4R8U A;  3TUI C;  4X64 F;  3PKM A;  1B64 A;  2CPJ A;  4AT1 B;  3V81 A;  2CJY B;  3KK1 B;  1CPZ A;  1S10 A;  3VZH A;  1OYE A;  4CO0 A;  4HHU A;  4WBF A;  1N52 B;  2HIY A;  1S6Q A;  4GKJ J;  5F0U A;  1UEK A;  3HMJ G;  2BJE A;  4DI6 A;  1MN7 A;  4CLK A;  4NLQ A;  3ZTO A;  3R5D A;  2W7O A;  4USK A;  1CJV B;  1K1S A;  4M94 A;  1KBR A;  1Y10 A;  2XS7 A;  3OXF A;  1U2F A;  2W9C A;  3RG6 A;  4NYP A;  4KB7 A;  4NXM J;  3TAP A;  3DOL B;  1VJQ A;  5KFP A;  3ZZT A;  5IC6 B;  2JSX A;  4IO1 A;  3R2D J;  3OVS A;  1RBA A;  2B4U A;  2AEF A;  4QCL A;  5L1I A;  3ZZZ A;  1NLK L;  3BGO P;  2B51 A;  2JL9 A;  4J9N A;  2AYG A;  1CUL B;  4AL7 A;  1KVK A;  3H98 A;  1IQZ A;  5FII A;  4DV0 F;  3LAM A;  3F73 A;  2DVI A;  4MK8 A;  2VA2 A;  3TQE A;  3UW1 A;  1VBY A;  4Y65 A;  1R8C A;  1RTJ A;  2HVE A;  2QIF A;  4M8L A;  3PYD A;  2BQ3 A;  3AOC A;  5L9X A;  4Q43 A;  3FRY A;  5EUH A;  2A18 A;  2E66 A;  4PXB A;  4PG6 A;  5SUH A;  1ICE B;  3CDW A;  3OPK A;  4JI1 F;  3VHQ A;  2EEY A;  1UPM B;  3LF0 A;  2I9S A;  1NKE A;  1NH8 A;  4N5S A;  2QA2 A;  2IA0 A;  2HUR A;  1J5E J;  4A8S A;  2UVV A;  1DBD A;  4ZP6 A;  1B99 A;  2YWG A;  3BO3 A;  3SBM A;  2MZT A;  3A8E A;  3ZZO A;  1CC8 A;  3IN5 A;  2XS2 A;  1SC6 A;  2MKI A;  3SFU A;  2OPP A;  2ZJR Q;  1U0H A;  4F26 A;  1LKZ A;  3T5K A;  1MSW D;  3W7B A;  2RRA A;  4UQT A;  1NSP A;  2KFY A;  3PRB A;  4CTA A;  3ISN D;  4F67 A;  2ZZM A;  4QR2 A;  3MMJ A;  2GVD A;  2PT0 A;  3NLC A;  4RUB A;  4C8K A;  3SQO P;  5THW A;  4QYZ J;  3MCO A;  4KH1 B;  2XZD B;  3T1Y F;  4J7C A;  3AA8 A;  3G8S A;  2V50 A;  2BAC A;  3U1L A;  4FYY B;  2A6O A;  3ILJ A;  4OX7 A;  2D3Z A;  3D6M B;  5KG5 A;  4BHQ A;  4HAC A;  1TTH B;  4KO0 B;  5IS2 A;  1J2V A;  3C16 A;  3WX4 A;  1FKO B;  4H4M B;  4UT4 A;  2E1C A;  3G86 A;  4AQY F;  2CZV C;  2HW3 A;  4A8W A;  3QGG A;  3ZXW A;  1M5P C;  2RML A;  3MPU B;  4FYW B;  4F3Q A;  2RDD A;  2VOO A;  3ZZP A;  3BBC A;  2DHA A;  2G0C A;  2UXB J;  5D0G A;  2DJW A;  4C98 A;  1N88 A;  4ECT A;  5DG9 A;  3DLE B;  1B7F A;  3WDO A;  1TKD A;  3KOA A;  4Z7Y A;  2VPY B;  2CQ0 A;  1HW8 A;  1BLU A;  5IOL A;  1VK8 A;  2N82 B;  2QZ8 A;  2BQR A;  2HGL A;  5F9N A;  5ETV A;  1UWA A;  2AJ2 A;  2HHQ A;  1B4S A;  4ZP8 A;  1SV5 A;  4WFX A;  4RW9 A;  1NJI T;  1FNO A;  1CC7 A;  3Q83 A;  4OYZ A;  1TUV A;  3IFE A;  2W2N P;  4O3O A;  1UVM A;  4B9U A;  4F7V A;  3TEH B;  1U02 A;  3MFI A;  2H5J B;  4QIW D;  4TU8 A;  4DFP A;  2XHW A;  1YZ7 A;  3CVK A;  2DGX A;  2VFT A;  2WRM A;  3KJQ B;  3W60 A;  4I2P A;  3EPG A;  5AT1 B;  2RIL A;  3TAQ A;  1FRJ A;  4KY3 A;  3NCP A;  3TVZ A;  3EDQ B;  4OJ1 A;  2V9K A;  1FD2 A;  2GJI A;  4MH8 A;  1SUQ A;  4DUZ F;  3W2V A;  4WF9 Q;  4DOZ A;  3KJV A;  3GP9 A;  4YME A;  1BUX A;  3VAI A;  1HBM A;  3GIL A;  1NDP A;  2E44 A;  2BJD A;  3CUL A;  2EK1 A;  1HWJ A;  3MM6 A;  5D4N A;  1O5J A;  4JV0 A;  3JSR A;  2ZFH A;  4EZ6 A;  3M6X A;  3H25 A;  2DGS A;  1FEE A;  3H42 A;  5B0B A;  1N34 F;  4IH5 A;  1RP5 A;  1RWO B;  4XIU A;  4FZV A;  2FIU A;  1QVF R;  3DN9 A;  3ZTP A;  5C24 B;  2VHG A;  5LSL A;  2WBR A;  1VQM S;  4PQU B;  2Y9H A;  1FHT A;  4F02 A;  1QLN A;  4U8V A;  1JXL A;  2VU5 A;  4Q2M A;  1TUG B;  3X1L B;  1RT3 B;  4DV5 F;  3PNI A;  2EFV A;  2CQH A;  1NSK L;  3T41 A;  4HDG A;  4J9O A;  1BE4 A;  4ECZ A;  2PA3 A;  3DLK A;  2YNI B;  2YX7 A;  1BHN A;  1QVG R;  4G65 A;  2ZH9 A;  2VPX B;  3WQP A;  4QOT A;  1EQ0 A;  4EGL A;  1M5H A;  2QJ3 A;  2NYH A;  4ANC A;  4DL2 A;  4I1T A;  1XJW B;  3MM8 B;  2NXN A;  1VQ5 S;  4F36 A;  3H5X A;  1FNX H;  4WK1 A;  1I3O B;  1VQS A;  3NS5 A;  4WTO B;  2CQG A;  6FDR A;  3JSM A;  5B0E A;  5F9L A;  1RKJ A;  4LRF A;  2JEJ A;  2ZD1 A;  4PKD B;  1UVN A;  2CQ3 A;  1DLO B;  2ROG A;  1XMB A;  4V19 X;  4UOG A;  1TL1 B;  2IRY A;  2QO3 A;  2ATC B;  2ZVS A;  5KOW A;  4Y0F A;  4NYZ A;  2C2E A;  4B3T J;  4R8U B;  4WZQ A;  4QW8 A;  4CH0 S;  1KLM A;  4GKK J;  2KXH A;  1RB0 A;  4O44 B;  1TAU A;  4LFA F;  4LF7 J;  5F3T A;  5KT7 A;  3D6T B;  1MNE A;  2HHU A;  3IWX A;  1F6T A;  4IH7 A;  4ID8 A;  1UAW A;  1B0V A;  1SL2 A;  2CQC A;  5GAH U;  5HK4 A;  3TVY A;  4K4V A;  4KHR A;  1Y0H A;  3G9C A;  5KFZ A;  4DN0 A;  2WTF A;  5MAO A;  2V2K A;  2XLI A;  3D1O A;  1WG1 A;  3EYZ A;  1NDL A;  2W9C B;  1GFW B;  5KFV A;  4G1I A;  3HVW A;  4E0D A;  3I0R B;  2MST A;  3BSC A;  3LPY A;  2Y8W A;  3W8G A;  1TL7 A;  2XYG B;  2YWH A;  4ATN A;  2VBW A;  2HBQ B;  3LA0 A;  4DSL A;  4YP3 A;  3EZO A;  3HT0 A;  1UFL A;  2BA9 A;  2A1B A;  5DGB A;  3GJQ B;  4NLO A;  5KG1 A;  1O6X A;  4AYB D;  3DLG A;  1VS3 A;  1N32 F;  2F9D A;  1HHS A;  3KDN A;  3K17 A;  1V9O A;  1IJE B;  1N36 J;  1S6P B;  1T03 A;  2CNK B;  3LP0 A;  1VC5 A;  4TNO A;  2F4V F;  2KTQ A;  1CG2 A;  1RHM B;  3AH6 A;  2F5G A;  1SQG A;  4K5R A;  3OFF A;  1WTB A;  2IVY A;  3ISZ A;  3G96 A;  2MLZ A;  1IN0 A;  4GC6 A;  5E0O A;  3LAN A;  3G87 A;  2FB0 A;  1AT1 B;  3HCX A;  5HMY A;  4GO7 X;  4DV0 J;  5GAH I;  2AGP A;  3BR9 A;  2CG4 A;  2B8Q A;  4DSJ A;  2OPP B;  3IBF B;  5GAG U;  5IT9 Y;  2YY3 A;  4HHH A;  2CJ9 A;  5J2N B;  4PUO A;  1HMV B;  3CUN A;  4JI1 J;  2BW2 A;  3M9N B;  5D78 A;  2NUH A;  4UZB A;  1NME B;  2GVD B;  4ZLN A;  3QAU A;  2YXL A;  9ATC B;  4F4X A;  1NK8 A;  3UR0 A;  4IOB A;  4ZLP A;  1V3R A;  4DPY A;  1C1B A;  4IOC Q;  2UUC F;  3FBB A;  2ADC A;  2BM1 A;  3MEC A;  4AE5 A;  3F0N A;  4YHH J;  3IM9 A;  3B54 A;  3IAS 9;  5E2Q A;  1UL3 A;  3C16 B;  2NCK L;  4PR6 A;  4PAA A;  5GAE U;  5JUM A;  1TEL A;  2IYI A;  1F3F A;  4F4A A;  2OEL A;  4RW8 B;  4E8U A;  1URR A;  3OTO F;  1CQN A;  3SQG A;  4X4P A;  5IT9 U;  4UUX A;  1WEY A;  2L48 A;  5EN1 A;  4OI6 A;  4BLG A;  4JI4 J;  2KVQ E;  3NG8 A;  1UJ4 A;  4OYA A;  2EFQ A;  2GFF A;  4WWS A;  4AQY J;  1SV5 B;  3E3X A;  4DV2 F;  2KYZ A;  4RW9 B;  3FFI A;  5CZX A;  2XHC A;  4LBI A;  2R3V A;  3DU5 A;  5IWA F;  4I2Q A;  1UVL A;  2B6A A;  2AJQ A;  5G0R A;  4LR7 A;  2ZNZ A;  3J7A 1;  1CJK A;  4ED7 A;  1XNQ F;  1RHQ B;  2PC6 A;  1SJ3 P;  1JLB B;  2MTL A;  1GQE A;  4FPR A;  2MQQ A;  3BB5 A;  3K0J A;  1HI1 A;  3KTQ A;  2VFR A;  2JVO A;  3HT3 A;  3SEO A;  2OGU A;  3GSD A;  4O3S A;  4DR4 F;  4WCE Q;  2DHS A;  1KNZ A;  1DQA A;  2EKN A;  1HBM B;  3HJV A;  3RYL A;  4KHP F;  1IM4 A;  5DLF A;  4HR2 A;  3I5C A;  2DCL A;  4DL3 A;  4NEY A;  1V6H A;  3ENQ A;  2UVU A;  3EIC A;  3Q8R B;  4NZ6 A;  1JB0 C;  2Q6C A;  2VQE J;  2EVZ A;  3A8J A;  2HVH A;  1AZS A;  4P72 A;  5EWG A;  1T9U A;  3HLU A;  5MLC V;  3J80 Y;  2B4P A;  1S1T A;  1NJW A;  2N7C A;  3G6Y A;  3TZX A;  5C25 A;  4DG1 A;  1VGY A;  5KFB A;  1PYT A;  1DAX A;  2E29 A;  4DBQ A;  2FJE B;  4LF8 F;  2POK A;  1I94 J;  4WE1 A;  4M5J A;  4LF4 F;  1V3Z A;  3T1A A;  1ZA1 B;  3VR1 A;  3KJN B;  2R7W A;  2QTW A;  1JKH A;  4Y00 A;  4L72 B;  1XTZ A;  1FE0 A;  1NSQ A;  3BEG B;  2MJN A;  2RS8 A;  4DV5 J;  5CYM A;  3R5A A;  1DFD A;  4TU9 A;  3M30 B;  4CI0 B;  3AY0 A;  3LH2 S;  5AE1 A;  1QTN B;  1I6J A;  2X51 A;  3W2W B;  2D41 A;  2VJU A;  4CM2 A;  2QEX S;  1VQY A;  2OSR A;  2BJ8 A;  2DIV A;  3CED A;  3UQS A;  4JP8 A;  4ECQ A;  1ZZN A;  4L6V 3;  4U95 A;  3K58 A;  3J80 U;  5GVQ A;  1X5T A;  2MB0 B;  1YJU A;  3X3U A;  2C2M B;  2A2D A;  3FEZ A;  2HZA A;  4ECR A;  2VG6 A;  5DQH A;  4BWJ A;  3N5F A;  5K8M A;  1VC6 A;  5A6W A;  4NL5 A;  5IM0 A;  1SCJ B;  1XR7 A;  2H4Y B;  4HVZ A;  3UDE A;  2RE1 A;  4WK3 A;  3I4H X;  4JV5 J;  4F2R A;  2YQ3 A;  2UZA A;  2BE7 D;  1TKZ B;  1S9E A;  4B3M J;  4ITS A;  5KFI A;  3SCI E;  1HNI B;  2HQC A;  3MMC A;  4M1K A;  2OIH A;  2ZHB A;  3NL0 A;  2R7O A;  4QIG A;  2MQO A;  2E7W A;  1YIT S;  2J8A A;  4OYP A;  5B0G A;  1S6U A;  2FTR A;  1K8A T;  1WOO A;  1WC4 A;  3EPI A;  2OPR B;  2D3O 1;  3KFW X;  2GNK A;  3THT A;  1CEZ A;  2HHT A;  2WB1 D;  1ROF A;  2ZH7 A;  1HWI A;  4L74 A;  2FJB B;  3ITH B;  3J81 j;  3UCZ P;  1TL7 B;  3AXM A;  1N5Y A;  1SJF A;  2NSB A;  2ERR A;  3KLE A;  4F04 B;  1HBU B;  3EJM A;  1SJR A;  3W63 A;  1F0X A;  3HK2 A;  2HHH J;  1KP6 A;  3MR5 A;  1X4E A;  2JEI A;  3DLG B;  1C0U A;  2QLW A;  2IMW P;  2H54 B;  1Q8L A;  4KIA A;  5FDL A;  2DGV A;  3DMJ A;  2ZOM A;  5DM7 Q;  1P27 B;  1T03 B;  4OI3 A;  1NEE A;  5AXL A;  4MKB A;  3QO9 B;  4O0N A;  3V4I B;  5J2Q A;  1XMO J;  2DNN A;  3LAL A;  5E33 A;  1KEK A;  3BBF A;  3BQ2 A;  1K73 T;  3LGN A;  1U09 A;  2FC8 A;  4P74 A;  1OJ4 A;  3FCV A;  3OT9 A;  2BAN A;  4TVA B;  2VC0 A;  1P1T A;  1X9M A;  3MFH A;  4ECV A;  5KFG A;  3OTD A;  3W9H A;  4NA3 A;  2F4V J;  4LSL B;  3UNY A;  2QA4 G;  1XNR F;  4D3G A;  2J8S A;  2LXU A;  1ZYQ A;  1FVQ A;  1LFW A;  4DL4 A;  3TAM A;  2UXD F;  2KZM A;  4A4J A;  3MAA A;  1OQ3 A;  3TQ1 A;  2HAF A;  4WYL A;  3IC1 A;  2WOM A;  3D0H E;  4A8O A;  4CT9 A;  5EX3 A;  3GB0 A;  1X4C A;  3OJU A;  3M9O B;  4ZJL A;  3BGR B;  3M9M B;  2G1D A;  2DEJ A;  3MEC B;  2APO A;  2U2F A;  4DFJ A;  1VQO S;  1RTD B;  2BV3 A;  4CLU A;  2XNQ A;  4RW7 B;  3TAN A;  2JOQ A;  2D74 B;  2O1P A;  2F9J A;  1Y3J A;  1U26 A;  4PG7 A;  3HJF A;  4NZ7 A;  2KT3 A;  1Q0N A;  2WVD A;  3QT5 A;  3SQG B;  2JVR A;  1Y3K A;  1UEU A;  1VQP S;  2MGZ A;  2G2Z A;  2PI5 A;  4C4W A;  4B9V A;  2NUU G;  3ULH A;  4DV1 J;  2UVR A;  3VVT A;  3NP5 A;  2DNM A;  3QBC A;  1FJC A;  4EK2 A;  3BH7 B;  3GFY A;  4ED1 A;  3NCR A;  4LQ9 A;  4G3I A;  1YRX A;  3PIP Q;  2XCA A;  1Q5V A;  5KG7 A;  1RJJ A;  1MG7 A;  3C19 A;  4WII A;  5E5N A;  3R7B B;  3H59 A;  2JLE A;  2N4C A;  5I3Q A;  1EET B;  5DRK A;  2R9L A;  1CJK B;  4URQ U;  1AFI A;  3SSR A;  4MAK A;  1IBM J;  1JLC B;  2A6M A;  2B7B B;  3HHL B;  3DI6 A;  1YG0 A;  1C4C A;  1T05 B;  5ETQ A;  4DV2 J;  1C0T B;  2CPY A;  1S79 A;  3AD8 C;  5HAO A;  2HWI A;  4I69 A;  1VK3 A;  3I55 S;  1RHK B;  3NGD A;  1R8A A;  2GHP A;  1IWA A;  2NXJ A;  2L9N A;  4S0M A;  5IWA J;  2GIR A;  2OH2 A;  1S1U B;  4ZN1 A;  3CJ4 A;  2VC1 A;  3CCS S;  4P6Q A;  1Z2L A;  3N79 A;  4C11 B;  5B09 A;  3H7H B;  3QQC D;  5HVF A;  1FVS A;  2KXN B;  2QFJ A;  2H9Z A;  1RAO A;  3V2U C;  2Y1I A;  1X7V A;  1U6F A;  4AD6 A;  1YQH A;  4QZV B;  2V2Q A;  3M8P B;  4DL6 A;  3R5J B;  2OSQ A;  4AL5 A;  2DBB A;  4OYW A;  2DXF A;  4LF9 F;  2IDL A;  3WX8 A;  4GVL A;  3CCE S;  1ZTW A;  3BN7 A;  1S9G B;  5KFH A;  4KPY A;  1T95 A;  3DNC A;  1Q5Y A;  5HMZ A;  3MEG B;  4RJV A;  1PBA A;  1S76 D;  3PFE A;  2MKH A;  1O0P A;  2BQU A;  4JI7 F;  3RB3 A;  2FLL A;  1Q86 T;  2CQB A;  3D9B A;  1IXK A;  2MKY A;  5CD4 A;  4Q44 A;  1QSL A;  2GJ2 A;  1GMU A;  1X4F A;  3PJ9 A;  3EE3 A;  3LUY A;  4BCA A;  2DYA A;  1SPB P;  1WC3 A;  4NCG B;  1ZM4 A;  4QBU A;  3GCW P;  3Q23 A;  1RWP B;  2QFI A;  3HHE A;  3MGJ A;  3FC9 A;  4LF8 J;  4DV3 J;  4IKA A;  3QPI A;  2GGP A;  4DV7 J;  2C28 A;  3BZQ A;  3GZ7 A;  4OLO A;  2KDO A;  3MM7 A;  2IJF A;  2DH7 A;  2R7X A;  4IOA Q;  2ZWO A;  5IT0 A;  1IKY B;  4A46 A;  2VJV A;  1XMQ J;  4UW2 A;  3C2P A;  4QWE A;  4TY8 B;  1JNR B;  2RKI B;  2VG6 B;  2YKA A;  2CNN B;  3UDL A;  3R5G A;  5T14 A;  2CJX B;  2JFD A;  2OD6 A;  1F5A A;  2V8P A;  3RB4 A;  1RAH B;  2J6U A;  4B3S J;  3K8W A;  1JLG B;  3A4T A;  1QSY A;  1FWP A;  2BJ1 A;  4FYD A;  1U25 A;  3NBP A;  3MMC B;  5B0C A;  2NRE A;  5HQ8 A;  1W2I A;  1FE4 A;  4RNH A;  5LL6 d;  4DU7 A;  1GK8 A;  4YB7 A;  2KFZ A;  2K7K A;  5CCM A;  5L1K A;  1WNE A;  5IV4 A;  1H2V Z;  4M5N A;  2KJW A;  2D69 A;  4NX9 A;  4UOC A;  4ELV A;  5J2M B;  1FX2 A;  3G8T A;  2ADB A;  2DRB A;  2WK4 A;  4KGV B;  4DQQ A;  3DGP A;  3DKD A;  3UDV A;  4PG5 A;  5C5J A;  1KFS A;  3LP2 A;  2CWK A;  4GMK A;  2HRU A;  2YWK A;  3RBX A;  1JLA A;  2G0J A;  4L75 A;  4RX6 A;  3PJW A;  2AT1 B;  2MJU A;  3FMB A;  3K7R A;  2Q43 A;  3ENA A;  1P1L A;  4PPZ A;  1R27 B;  1GXT A;  2NSC A;  4ZVR B;  1C0U B;  2MLX A;  4WP8 A;  2HWH A;  1NHV A;  1JJC B;  4OZL A;  1SI9 A;  4NE9 C;  3TA0 A;  1H0H B;  1FRK A;  3BV8 A;  4Y3C A;  3OTC A;  4RUC A;  2HNY A;  3HM9 A;  7FDR A;  3V6D B;  1C4A A;  3GG1 A;  3W5Z A;  5E3C A;  2O01 C;  4C0B A;  3DCA A;  2NZC A;  2LU2 A;  3KUG A;  3O8W A;  1LEO A;  2MQN A;  4I67 A;  5IQ6 A;  1U24 A;  3EVO A;  3GIK A;  4O4G A;  2NPF A;  4LFC F;  4MK7 A;  3OVA A;  2DIT A;  2E5L F;  1I5O B;  3SCK E;  2ROE A;  3PX4 A;  3VAM A;  4OZN A;  2ZDP A;  2R2R A;  4GRS A;  2IHR 1;  2PGC A;  4K0K F;  4OYB A;  3OV7 A;  1B0P A;  2BKN A;  2WON A;  1SXL A;  2XC9 A;  2XCP A;  4KH0 B;  3DXB A;  3IA0 A;  4I56 A;  4OZ1 A;  5D0H A;  4PWD A;  2FZG B;  2YKN B;  2BAB A;  4BWM A;  5ETP A;  5IFM A;  2ZH3 A;  3V4M A;  1UW9 A;  4B9L A;  2X1F A;  4ZPA A;  2J5A A;  2HFU A;  3OFH A;  2Y0S D;  4M5D A;  4EUV A;  2ILZ A;  3MTK A;  4CNZ A;  4KTQ A;  3DRS A;  2MSS A;  4DR2 F;  2DNK A;  2DIU A;  3V6K A;  3D6F B;  5LSR A;  2LLZ A;  3BSO A;  1WJ9 A;  2VKR A;  5BYQ A;  3S6E A;  2D3U A;  3I82 A;  3HD2 A;  4ZPB A;  2C3U A;  4Q8E A;  2ZC3 A;  1QD1 A;  2AMC B;  2KT5 A;  3TZZ A;  4OHY A;  1MU2 A;  2UV8 A;  4ZIW A;  4WXO A;  2MQ8 A;  1YJT A;  4OMF G;  1KLN A;  2LXF A;  2QLX A;  1ZZF A;  4C8Y A;  4P2M A;  5ETT A;  2IMO A;  3WIU A;  2M88 A;  2YQ1 A;  2DR7 A;  3BPD A;  4PRF A;  1CQM A;  1M1K T;  4ZA1 A;  2IA6 A;  2N3O A;  5KG2 A;  2HBY B;  3DRP A;  4ZPC A;  5FJ4 A;  3GSI A;  3SFG A;  7AT1 B;  2P2C B;  3NGS A;  3GR0 A;  2W1B A;  2QMX A;  2QX0 A;  3T1H J;  2DR8 A;  1VRQ C;  3P5T L;  3QGI A;  5K8P A;  4UF4 A;  1KS2 A;  5M2R A;  2ZM6 F;  2LFV A;  1RHR B;  4P10 A;  2VV5 A;  1VHI A;  3C66 A;  4OX9 F;  3D3C J;  4ES2 A;  2XMT A;  2W7A A;  1A9N B;  4NLR A;  4I0W A;  5EWF A;  4DLE A;  2Z2Z A;  1RCO B;  1R31 A;  2VZ9 A;  4HT5 A;  4DR6 F;  3M8S A;  2DGQ A;  1U7L A;  2V68 A;  1N5S A;  2QLJ B;  1PJ7 A;  1PO6 A;  3FBE A;  1B7Y B;  2B4V A;  2ZUG A;  4YB6 A;  1IBK F;  3H4D A;  4UTG A;  2PI4 A;  1TKX B;  2B8P A;  2PMW A;  3BO4 A;  3N01 A;  2OD4 A;  1IQT A;  1RTH B;  1S0M A;  4USW A;  4JV2 A;  5KFF A;  1S12 A;  3J7Y U;  1ZAX A;  2ZHA A;  2JH3 A;  3PKY A;  5L39 A;  4DPW A;  2NXE A;  5CCL A;  5B0D A;  2FYX A;  4KPC A;  2F4F A;  3MF5 A;  1A6L A;  2C2D A;  3BO2 A;  1WC0 A;  2DR9 A;  3EZU A;  3GV5 B;  2B9Y A;  1C2P A;  4CT8 A;  4ZVH A;  4CDI A;  5CYQ B;  5G4D A;  4LF9 J;  2P6S A;  4RWX A;  2Q6B A;  4MTP A;  4MMO A;  2VIC A;  3HSD A;  2LEA A;  3QT8 A;  1IBL J;  3DOM A;  2CG8 A;  4LBP A;  3D54 A;  2M4M A;  4N8O A;  4R25 A;  5M2P A;  1SC4 B;  4M5G A;  4JI7 J;  3GU0 A;  2B5J A;  1R8H A;  2EC2 A;  2D9P A;  5KFN A;  3MPD A;  1UA1 A;  2R7S A;  3MM7 B;  2DNL A;  3MCS A;  1WC6 A;  4DHV A;  2GHV C;  4MT1 A;  5HRO A;  1LQ9 A;  4OLP A;  2GZO A;  1IR2 A;  1SL0 A;  2HNZ A;  1SBR A;  1RT4 A;  3OL6 A;  4WJB A;  5AJ3 F;  1AUS L;  5T7L A;  1S48 A;  1RZM A;  3QSI A;  3LW5 C;  1J5O A;  2F65 A;  2XQC A;  2XLK A;  3TEG A;  4ETZ A;  3OL7 A;  8ATC B;  1FWL A;  3SMZ A;  3UCU P;  3K59 A;  3NBP B;  4ED6 A;  2EKY A;  4KV8 A;  1DUR A;  3CJR A;  3OHA A;  3K89 A;  3SCJ E;  1UJ6 A;  2BDP A;  2IAJ A;  2ZVI A;  2SXL A;  3D1H A;  5F8M A;  4F0M A;  1CS4 A;  1NRK A;  4MKA A;  4NPO A;  4A48 A;  1JIH A;  2X3D A;  2D7S A;  3D6H B;  2HGN A;  1X31 C;  4Y2A A;  5EX0 A;  1NO8 A;  3P5B P;  4IYQ A;  1U8W A;  2RAQ A;  5KFX A;  2XZW A;  3MPY A;  3AQO A;  3GPA A;  1RWW B;  3V6H A;  1VOM A;  2V9W A;  2GAG C;  5LMU J;  3JXO A;  1LWE A;  5I3U A;  1T9X A;  4WIQ A;  1VQ6 S;  4B3R F;  2V8D A;  5KFS A;  4CO2 A;  1DTQ A;  3KLF B;  3H2L A;  3MHY A;  2VUG A;  4W4M A;  4Y28 C;  2HNY B;  3CTR A;  3QLH A;  3QRQ A;  2FGC A;  1RTZ A;  3QIP A;  7FD1 A;  4O4G B;  3QRP A;  2Q3P A;  2F8H A;  3S1T A;  3QYY A;  1L5U A;  3EXY A;  3R2C J;  1Q81 T;  2M8D B;  2EFO A;  1SH0 A;  3T6J A;  4ECU A;  4J9K A;  3FDS A;  5DM6 Q;  3KG0 A;  3QFW A;  1O51 A;  3TX8 A;  1TMJ A;  5DLG A;  3MM5 B;  3H40 A;  4Y6I A;  4LFB J;  5C42 B;  5KT2 A;  1A7G E;  2BZ2 A;  3VAF A;  1WSR A;  4ENO A;  5J2P B;  1YX2 A;  3N6M A;  3NCQ A;  2UU9 J;  4IDK A;  3KMS A;  3RRH A;  3TW0 A;  3FSI A;  1YJ9 S;  4ED5 A;  2YX1 A;  3NGU A;  4ERD A;  1TR0 A;  3KNG A;  3U7J A;  1IM6 A;  2KU7 A;  5A8W B;  4I6W A;  2RHS B;  5LOQ A;  1LXJ A;  4I7F B;  3GIJ A;  4ID5 B;  4LRE A;  2AQ4 A;  4MIA A;  4DR3 J;  4ZVT B;  2CAD A;  5HBM B;  2C2R A;  1S9F A;  3HVA A;  1FDB A;  5CZV A;  3ZFV A;  3DOL A;  2LCW A;  1LXN A;  3MR3 A;  4EYI B;  2XSJ A;  3MOJ B;  3IR6 B;  3OD2 A;  5EDW A;  3NWR A;  1KQG B;  2O67 A;  3KG4 A;  2VF3 A;  4FF1 A;  4DQP A;  3I0S A;  4Y2K A;  2UVW A;  1U1L A;  5H9E J;  1F3V A;  4MIW A;  1T02 A;  4EO8 A;  1CUL A;  1X60 A;  2QLF B;  4DXL A;  2CQD A;  4C3K A;  2F8E X;  2I8E A;  3EXC X;  3M2R B;  4KQZ A;  5ITH A;  2JEF A;  1PIL A;  3QZ8 A;  4HHJ A;  3PHT A;  3KMQ A;  1TAQ A;  4JI0 F;  3BS9 A;  1SC1 B;  2H65 B;  1T9V A;  4K2X A;  5DDP C;  2HHW A;  3NNH A;  1IKV A;  4F0H A;  3M8Y A;  3GII A;  4RR5 A;  3DRY A;  1YBT A;  4JOU A;  1WI8 A;  2G1H A;  4NI2 B;  5KFK A;  3BKT A;  3CD6 S;  1KON A;  1LK7 A;  1GH8 A;  4IRK A;  1VDH A;  2QC3 A;  2ZBP A;  1APS A;  2X3G A;  2RU9 A;  4NRT A;  4Z7C A;  4YR2 A;  3H2U B;  2DPI A;  3CWJ A;  4ED8 A;  2H5I B;  2IDE A;  5HP1 A;  3IGV A;  3VAK A;  2GAH C;  1F9F A;  4ETX A;  2CQ4 A;  3BYP A;  2CQI A;  4LRD A;  2XI3 A;  4IO9 Q;  1Q4R A;  3HXM A;  4RBU A;  2WB4 A;  2O3D A;  1S0O A;  5HAT A;  4GO5 X;  3FEY B;  3GCX P;  3G6E S;  1FKO A;  5AXN A;  3QID A;  4WKR A;  3M2V B;  1FXD A;  4OHV A;  4PZV A;  2LU1 A;  1WUU A;  3ETO A;  4P7V A;  4C8L A;  4ECS A;  3S8S A;  4ECX A;  1IBK J;  4X4T A;  3MED A;  3JYT A;  3L9Z A;  1PC5 A;  2C42 A;  5AE2 A;  2R7Q A;  3DOM B;  2I5J B;  1RT1 A;  4CLS A;  3TR5 A;  4DU8 A;  1HQ2 A;  1N0V C;  1A0O B;  2BRL A;  4JI6 J;  1HBO B;  2YNG B;  1RAE B;  4N7T A;  5F0W A;  4Q8F A;  3RAQ A;  2JZ5 A;  2M52 A;  4WFY A;  5CQG A;  2ZH4 A;  3T5J A;  1NM2 A;  4FF3 A;  1SQE A;  3G6V A;  1U1R A;  2H4W B;  3OJS A;  1ACM B;  1RCX B;  4YN3 B;  3DOK B;  3ICL A;  3BDP A;  3THP A;  2EC0 A;  2VON A;  4K4U A;  2G4B A;  1RT4 B;  3VQT A;  4FP9 A;  2WVE A;  2DHG A;  3O44 A;  4ER8 A;  1FF2 A;  3TUJ C;  1FA0 A;  4LVO P;  1LNQ A;  1RUS A;  2GV1 A;  5KFR A;  1J5O B;  1ZM3 A;  4NRU A;  2FZK B;  2DXD A;  1Q7Y T;  2BJ9 A;  3PR4 A;  3HO1 A;  2BE2 B;  3CPW R;  4KV8 B;  3MMA A;  1RT6 B;  1DTT B;  1YVF A;  2DEI A;  4EBD A;  4FS2 A;  2J6T A;  1H74 A;  2CPF A;  2IAJ B;  3L7U A;  4QWC A;  4NXN J;  4FF2 A;  4F4W A;  3H0P A;  1CS4 B;  5KG3 A;  4DSF A;  2BVZ A;  3AOB A;  4RPF A;  4C3L A;  3TRG A;  4UOH A;  1NJY A;  3M05 A;  2AF6 A;  1I1G A;  2R8G A;  3NOG A;  1HPZ B;  2C2O B;  4KKO B;  5DZ6 A;  3AB2 B;  2ASJ A;  4RL1 A;  4U7U D;  5C24 A;  3MR2 A;  4J5O A;  1HA1 A;  2DIS A;  2QYC A;  4PQU A;  1K0V A;  2OI2 A;  1RWN B;  3CC7 S;  1D8Y A;  2VFU A;  1KC8 T;  1PJ5 A;  4CP5 A;  2CPZ A;  3VAL A;  5I3U B;  3KDO A;  2WVC A;  1RAC B;  5HI7 A;  2YNI A;  2K06 A;  1Q8K A;  3AA9 A;  1NHU A;  1DTQ B;  3MUR P;  2LKZ A;  1KVI A;  4ELT A;  2FVP A;  1TQL A;  2WCX A;  1FO1 A;  5E7O B;  4HT7 A;  5H9F J;  2LEC A;  3MM8 A;  2WW8 A;  3CE8 A;  4ZOS A;  3QIP B;  2KRR A;  2OLW A;  1S5Z A;  4P2X A;  3MI7 X;  4K2J A;  4F4K A;  3A12 A;  2YH1 A;  4B3R J;  2M9K A;  2H1Y A;  2HGM A;  2QA1 A;  1FTC A;  2DO0 A;  2CVI A;  1PKU A;  1VRU A;  3GYX B;  3EGW B;  1DLO A;  1AB8 A;  3UCG A;  1TU0 B;  1TL1 A;  3HKZ D;  4YEA A;  4NOH A;  1FNM A;  4IH6 A;  4RU2 A;  3DM2 A;  2DY9 A;  4K5S A;  1X9W A;  3SYZ A;  3RB0 A;  4OZ0 A;  1RE1 B;  4EYH B;  4WFB Q;  1JXE A;  4W92 B;  2E9Z A;  1N33 F;  2CUY A;  4O44 A;  1X5S A;  1Z2Z A;  5H1S V;  4IDK B;  5LJ3 Y;  1X0F A;  3K5N A;  4JYA F;  1UW4 A;  2FJW A;  2HQF A;  4DF4 A;  2LQ5 A;  1WSV A;  4W90 B;  2I6W A;  3V6J A;  2R7T A;  1EZZ B;  1VR6 A;  4MKY A; 
#chains in the Genus database with same CATH homology
 2Y8W A;  3QRR A;  2Y9H A;  5H9F K;  4QYZ K;  1WJ9 A;  5CD4 A;  3QRQ A;  4U7U D;  5H9E K;  3QRP A;  2Y8Y A;  4DZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...