5CD4A

The type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
199
structure length
199
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasE
publication title Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/rna
total genus 26
structure length 199
sequence length 199
chains with identical sequence M
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 5cd4A01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5cd4A02
2Y8WA 4DZDA 2Y9HA 4QYZK 5H9EK 3QRQA 3QRRA 5CD4A 4U7UD 5H9FK 2Y8YA 3QRPA 1WJ9A
chains in the Genus database with same CATH superfamily
1RT6A 1TL3A 2VV5A 2FLPA 1T05A 3KNGA 1S9EB 3MM7B 3CF5Q 2ZOMA 2YX7A 5B7WA 2E29A 4A8KA 2XYHB 5DDQC 4DUTA 4KY3A 2GIFA 3EGWB 2CPFA 4AD6A 2DHSA 1JLCB 3PJXA 3LA0A 3I96A 1PG5B 2MJUA 3CCRS 5DLFA 1LOUA 4DQSA 1TKXA 2DEIA 4PRFA 3U7JA 1N88A 2HQCA 2PGCA 3BYPA 2CQ2A 4OZ3A 5B0AA 4CLWA 1GXTA 3FRYA 1H3DA 4DPTA 4NLRA 4CTAA 3MEGA 3QIPB 3MEEB 2EW9A 3BB5A 1TUWA 1X4HA 1VK3A 3V6JA 3D2WA 3DLLQ 1WI8A 2K7KA 1VISA 2VUGA 1M5HA 4DV2J 4KYZA 4P74A 2J8AA 4ECSA 2AYMA 1VCTA 3GG0A 4QWDA 4K7QA 4DHVA 4YHHF 2P2CB 2Z0GA 2F1FA 4CNYA 3ZZRA 5L38A 1L3KA 3KJVA 1ZA1B 3QO9A 4QPXA 1NAQA 4URSA 1I3OB 2ZH3A 2OMOA 5KG1A 5F8LA 1UFWA 3O8WA 5F8JA 4DL4A 5GVQA 4YFUA 4F7VA 5F8IA 1S9EA 3MM7A 3DGVA 1CS4B 3MR5A 4B9LA 2ALYB 1TK8A 3HDSA 3GU0A 2DCUB 1MSWD 1UW4A 4DPXA 4ILRA 5KFOA 4K4XA 3LOUA 2A3JA 4LQ3A 4P2FA 5E41A 3GIKA 1JLCA 1O5JA 4PABA 3HK2A 2QE5A 3BPDA 5LMNF 4LF6J 4CLTA 5B09A 4DL5A 5CYMB 3DM2B 3QMQA 4C8NA 4DQIA 2F63A 4BWMA 1SJFA 4KO0B 3LGMA 3UFCX 2EVZA 2C2MB 4IRDA 5LSLA 2MKYA 1ZM2A 2E1CA 1NM2A 2WVBA 1X0FA 2GMHA 3BSNA 5CD4H 3QIPA 2C2KB 2XGQA 1IWGA 4DJBA 2HNZA 4HACA 1O6XA 4NRTA 2PMZD 4OX6A 3UDCA 4OHWA 3VHQA 2ZBRA 2D74B 2V94A 2UXDF 2XBPA 3FBEA 2B9YA 2MZSA 3M2VB 1FK9B 2BM1A 5F8MA 4WFAQ 3J81j 3Q8PB 2J6TA 1R0BG 4TQSA 4MMOA 2WVEA 2DGOA 3QFHA 4NLUA 2YPYA 1FWPA 3AHPA 1H7WA 2AV5A 4DX8H 5AJ3F 2UUCF 2XMMA 3Q8SB 1V5IB 4K0KJ 4DS5A 2OAUA 2PFDA 4LBPA 3X3UA 1NDPA 1FXRA 1UAWA 1L3TA 3CCMS 3NWGA 3NKYA 2E5GA 3UDLA 2BEFA 3J7AN 4X64J 3I9V9 6FD1A 5BYSA 3PM9A 1UJ4A 4Y34A 3LGNA 3EM1A 2L48A 4FBTA 2V5HG 4DR4F 1A9NB 3SSQA 2P9CA 4DUZJ 3T5JA 1VQ4S 2W7AA 3G6ES 1HNZF 4LFCJ 1UWBB 2APOA 4LJMA 5CYMA 1BHNA 3DM2A 3K5LA 1MU2B 4PXBA 2BX6A 2E5JA 1SUQB 2NYHA 4KO0A 1TKZA 2HWIA 4OYIA 3R27A 2FZKB 3N5BA 3T9ZA 1IR1A 3H5UA 1U1OA 3HD1A 2EK1A 7AT1B 4X62J 3J7ZT 5LXYA 4HH1A 4QCLA 4WKRA 4K8RA 4J9RA 4QW8A 1JK9B 4H4MA 5ETMA 5IQ6A 1Y7PA 2XI2A 2DT9A 5B0CA 4ZCKA 2J9CA 1URNA 5KFDA 3PJ9A 2VONA 4USMA 1U2RA 2B8PA 3AB4B 2R7QA 1FK9A 2OTLS 2QSFA 5HMWA 1FRMA 4GVBB 4TU7A 3ENQA 3TVZA 5CH7B 4TXSA 1L3VA 5AXNA 4L72B 4AQYF 4ZPBA 4ZPDA 2NXUA 3BREA 4OHXA 1JB0C 4WFYA 2UUAJ 4AT1B 3FNNA 1N6QB 5GAGU 4KB7A 3NAHA 2QA4G 4R8UA 2H3EB 1JLFB 5DG9A 1SJ4P 3CW2C 2FVSA 2W9AA 4OYBA 3BO4A 3M2UB 1PC5A 2B43A 4NA1A 2CADA 3GYXB 4F25A 3BGUA 2RHSB 4RL1A 4OYXA 3EYZA 4N7TA 2KHDA 2M3DA 5BJRA 2HNDB 3Q89A 3FC9A 2KJWA 4JI5J 1VOMA 2Z56B 1KKHA 5U47A 2F8EX 3DOLB 2GVDB 2ALZA 1SUQA 3BF4A 1J5EJ 4WTOB 2VG7A 4YB6A 5AXLA 5BR8J 1OO0B 3UWTA 2XMUA 5JVHQ 3M8YA 3OPKA 2CQHA 3MM5B 5T41A 4O3PA 3OFEA 3K58A 1QVFR 5EDWA 4B08A 3KTQA 2HYIB 1CJVB 2WSEC 4M94A 2E5LJ 2KH9A 2CNOB 2HK2A 1DTQB 5KFMA 5EHHA 2AGOA 4ICLB 3SYZA 3IFEA 1FJEB 3CC7S 1S1XB 3B54A 4FNHA 4TY8A 1HMVB 2H5EA 2F4FA 2NZCA 2EG1A 4GVBA 2GHWA 4UT4A 3G82B 3NS6A 3NL0A 3FCVA 3ENWA 1U0HB 5D0HA 2R7UA 4J9VA 5A8RA 4RNNA 3MM9A 3FZ2A 4JI8J 2GIRA 3VGTA 2ZH1A 1KNZA 4N8OA 5DO2A 1WC6A 1U09A 3I55S 4LSLB 4K5RA 4C6AA 3T6JA 8ATCB 2OEKA 2HKEA 4CO3A 3BGOP 3R5CA 4Z37A 2IVYA 4TLQA 1H98A 2QLJB 3UN2A 5CYQA 3KJQB 1A7GE 3MR6A 3Q8VA 1VQ9S 3M2UA 1DTTB 1SV5A 2IMWP 2JEIA 2PIIA 4A8YA 3SEOA 2G2OA 4H4OB 1TKTB 4C3LA 2XZDB 4DV7F 1I51B 1S9GB 2KRRA 5D4PA 4K50A 2DRBA 1YG0A 3G9CA 4OI1A 3DOLA 1IKYB 1PAEX 4GO5X 3JTNA 1FDNA 2YY3A 4X2BA 2EFQA 2Y8YA 1S1WB 4JV0A 2JLEA 4HH0A 1EKRA 4JI4J 4LFAF 1EB0A 3T9NA 3MCMA 2KYZA 2XS5A 4DCJB 2B7CB 1MW7A 3MM5A 3RW6A 1CJVA 4EGLA 3C66A 1Z2ZA 2LXFA 1DTQA 2QMWA 1PYTA 5IT9Y 4N77A 2N4DA 2E9ZA 5C2CA 1VK8A 4KGXB 1S1XA 1HMVA 2R2TA 2H5IB 3JS9A 4DWIA 1YRUA 4YY3F 1ZBTA 2CZ9A 2MYFA 3C6TA 3LO3A 1U0HA 4IYQA 5KT6A 4DG1A 1RHMB 3LAKA 3RR7A 2IRXA 3IC1A 1KVJA 2VL1A 3P5BP 1N34J 2RKIB 1WF0A 2NSCA 4LSLA 3TX0A 1Y4ZB 3DDNA 4ETZA 1PCAA 2ZJPQ 2J7KA 1RACB 3T1HF 2BJ3A 1D0EA 4BLGA 1LWCB 1DTTA 1SBRA 3ILJA 3PACA 2DGUA 3PW7A 1IKVB 4H4OA 2GC8A 3AOCA 4WIIA 4W98A 4J9LA 2IC3B 3K5NA 4ZVUB 2BJ8A 4PWWA 4Y2KA 4O4RA 1IKYA 2C22A 3F73A 1VQ8S 5I3UB 3AQPA 2COLA 1ZYQA 3M9MB 1YBUA 1S1WA 2Q6BA 4P6QA 1XNQF 3KMQA 5KFEA 1KQSR 3NCQA 2G1DA 3KFWX 4OLPA 2WBRA 4C0HA 2ZM6F 1VIXA 2J0XA 4FYVB 4Q44A 2MKSA 1HPZA 2BABA 2OP5A 2B4UA 2IM0A 3CCES 4F3MA 3AY0A 1UETA 3KK2B 4TLRA 1C4CA 1CJTB 4DPUA 4I68A 4FXWA 5KG3A 2V69A 3G87A 4OZ5A 2KI2A 3G71S 1UTAA 4P7TA 4ED5A 3DU5A 4ZCMA 2EFVA 4WIQA 3HSZA 1K73T 4KQZA 3WX4A 2ZOGA 1J5OB 3DLBA 4NCAA 5KFAA 2MGZB 2AQ4A 2VODA 5AXKA 4ZCLA 3CTRA 3H98A 5D0RA 2HVIA 1BQMB 3UR3C 5HLFB 4DX6A 4IH5A 4ED0A 3HHLD 4CO5A 3BPSP 3H7HB 1RWMB 1U2CA 4GKKF 3D1HA 4WXOA 1M90T 1LWCA 2VPZB 4PYAA 4E0DA 4OX9F 3JAMY 1RWOB 3VAJA 4HLBA 2NUUG 3BGFA 2BQUA 2P9EA 2ZH9A 2F8MA 3NGSA 3HI9A 2IC3A 2C3PA 3M05A 3R7BB 1VRQC 3NGUA 3KLVA 2RDJA 3VAKA 3M8QB 2QL9B 3OUYA 1FVQA 2HWTA 1F9EB 5I3UA 1X31C 2ZITA 2XEXA 2VOPA 3BQ0A 4JOUA 1TMMA 1EHWA 2DEJA 1HARA 3RUBL 2XI3A 4DPWA 3C2PA 5KFRA 2E1MC 2AIRB 1NEEA 2NXJA 2UXCJ 5K8OA 4EO8A 1HQEB 3HHLA 3FEZA 3MEDB 2XLKA 5IWAF 1YI2S 4RKUC 2BUNA 1NKBA 2NCKL 1KP6A 4EZ9A 5KG5A 3CNQP 1HWJA 5CA5A 1CJTA 2UUBF 1FI4A 3MZIA 3B4DA 2V68A 4QR1A 2YKPA 4F2SA 4A8OA 3I5BA 2CXEA 4WU3A 4Z2XA 2RNEA 5JMNA 4CI0B 2MMYA 1K1QA 3N5FA 4ZVEA 2BQRA 1CJKB 3HCXA 1S4EA 1NDCA 4DL3A 4XAKA 3P8BB 1U8SA 4DR6J 3I0RB 3W63A 1BQMA 4DR2J 5ETKA 5HLFA 1RZMA 2MLXA 4LF5F 1S6PB 2AF6A 4FPIA 2ZD1B 3CJSA 1VBYA 3QRRA 1JWWA 4F50A 5D8HB 3MCOA 1Q5VA 3K5OA 2V50A 5A8KB 1H38A 1RT4B 3JTOA 2PD1A 3TEGA 1NHKL 4ZDNA 3FGVA 2C3YA 1RT5A 1QTMA 2AZ3A 3VQSA 2P5VA 5F3TA 3V6DA 3KLHB 2M52A 2CQ4A 3MR3A 3JQMA 4JV1A 2IA6A 3RB0A 3TQEA 1N36J 2JVOA 1S6UA 1TL1B 1QAJA 1OY8A 2BJ9A 4DF4A 5JUMA 1DY3A 4YUDA 1HQEA 4LQ9A 3R1HA 1EX8A 3MEDA 5C5JA 2G4BA 3SSRA 3FKBA 5L39A 2VD3A 5IM0A 1FKOA 2CZ4A 1IKXA 2L08A 3MDFA 3DHWC 1OQ6A 2M5YA 3DOKA 3KYLA 2MY7A 4KC5A 5K5MA 1DBDA 2UVVA 2VFSA 1WSVA 3GR1A 2HIYA 4X84A 2I1RA 3DLJA 1MWYA 3S7RA 4NLDA 2HFZA 5K9FA 2W2MP 4X4OA 5IS2A 3M8WA 2CZVC 2B4VA 4FZVA 4KKOB 2DXEA 4PEOA 3QFWA 1LW0A 4I6WA 5A6PA 2ROEA 2F9JA 3THPA 3GWCA 2ZD1A 3L7OA 2MZ1A 4M5DA 3MM8B 3H5SA 2AJ0A 2HAIA 2HG4A 5KT7A 2E1RA 3QZ7A 3R8YA 3QJLA 4UY8T 2V4QA 1B70B 1FD2A 3EDQB 4NYPA 3NP5A 2CDQA 4OJ1A 1RT4A 4PUOB 4LF9F 4ES3A 3LTOA 1DZ5A 2CPEA 2HK3A 3FEYB 3KLEB 1KN6A 3P4UB 4Y2MA 2YNIA 5LL6d 2MLZA 4CH7A 2ZHBA 4TY9A 3OL8A 3DGPB 4MJKA 3ZTPA 5KG0A 2C3MA 3ETMA 1VGYA 4ZVTB 3CCUS 3NGKA 4BC9A 1TL1A 2MQQA 1SQGA 3RW7A 1RWXB 2AYGA 5LOQA 1D8ZA 4CO2A 3H20A 1FDAA 2P9GA 1YBAA 1Z1ZA 5DZ7A 4NE9C 2DNOA 1LXJA 1SJRA 3GJQB 4ZVRB 2OPPB 4NPOA 1ZS6A 3H5XA 1XMOF 4OYOA 2OKQA 3V6KA 3QT8A 2EC2A 2RD5C 4DFKA 1D09B 4F04B 4ZPVR 3PRVA 3CSKA 3A8JA 3TO8A 3ISZA 2CQBA 3K0JA 3HSGA 2NXNA 2RMLA 5HBMA 4ECYA 2VQEF 2H51B 3IG1B 2K7JA 3UCGA 3QT6A 2PI5A 1REVB 1SH2A 4ZLNA 2IFXA 3MMBB 1RADB 1SKSA 1P6TA 2WOMB 3KWMA 3W8PA 2LXIA 1SB6A 4JI1F 1UP1A 2WW4A 1S1UA 4OZNA 2D1CA 3R2CJ 4LRAA 2PN6A 4FP9A 3J81Y 1RTZA 4IRKA 2KG0A 1CLFA 5LT5A 4PR6A 5C42A 4ZVGA 4IFVA 2FTRA 2QMUB 3D4JA 3U1MA 1HBUB 4PUOA 2G0IA 3P3DA 5D4NA 4HT5A 3T5HA 3KLEA 4NA3A 2HVEA 5JJBA 5D0EA 2W2OP 3UVJA 2DPJA 4YHHJ 3P96A 4A46A 5DDPC 3DGPA 2W4DA 3DKDA 1MG7A 4IO1A 4DV5F 1B3TA 2C2DA 1MN9A 3B8HA 2FJEB 4A47A 4YDXA 1C4AA 2J0SD 1CSJA 4O3SA 4RU2A 4B3TF 3VAMA 2O5DA 4PYDA 3MPUB 3OVAA 1PAUB 3K8VA 5IC6B 5HQLA 2RDDA 2OMLA 3AD9C 4JI2F 3KHHA 4OI6A 1Q8BA 2QA1A 6FDRA 4NXMJ 1HLWA 1QJHA 5T14A 2FHOB 3DMJB 2DH9A 3BSOA 4Q2MA 4QZVB 3VR1A 1Y9OA 5EWGA 2ZWPA 1DQ9A 3V81B 3VCDA 4DV3J 4PG7A 1U48A 2OFGX 5LMNJ 5GMKa 1Q4RA 1SIWB 2RS2A 1NSAA 2N7CA 1K0VA 2WTFA 1WKKA 1XBWA 2KL8A 2WB4A 2NUHA 1YVFA 4NLXA 1RDRA 1J27A 2BACA 1TTHB 1REVA 3MMCA 4DSFA 4ECRA 4Q5VA 5GAEU 4IOAQ 4C8YA 5CCLA 2DNMA 4LMZA 1AT1B 1RCXB 4G1QA 1S77D 1N52B 1Q16B 1WORA 5KT4A 3WC2A 4M5MA 2YQ0A 1IKWA 3J7Z5 1T3NA 1KQKA 2UXDJ 4DR1J 4IO9Q 5HN0A 1HBUA 3OTBA 5J2MB 1V6HA 4ED8A 1CPZA 3M32A 1F60B 1SC1B 2ZC4A 1H73A 2CJQA 4MYTA 1NK0A 4I0WA 2MZTA 4OFZA 5A8WB 1C2PA 1XWLA 3LWMA 3Q2SC 5KFTA 1RCOB 1NK7A 5LJ5Y 1VJWA 2KG1A 3LF0A 2WCXA 1DURA 4FXDA 2ZE2B 4DX5A 4OJGA 1EKSA 5AJ3J 1RHKB 2K3KA 3IAS9 2UUCJ 1Y5IB 1SI9A 1XJWB 3CJ8A 1RK8A 2YX1A 4ZKAA 2YKOA 2PFFB 2HW3A 2BJ7A 2F5GA 3CJ5A 1GQEA 1WG5A 2XHCA 3CMQA 1WKLA 2D69A 4WF9Q 1T94A 2DISA 1SH0A 3GPAA 1N5VA 1RAIB 2E44A 1FF2A 4DZ6A 3QGPA 4X4UA 3IO1A 4KIAA 1FE0A 3DMJA 3JSRA 1AFJA 4DR4J 1O51A 3H25A 4K4ZA 3I32A 4LSZB 2HS3A 3V81A 2MDAA 3MTJA 3DLGB 1TUVA 1HNZJ 2M8DB 3K8WA 4MIAA 1FKPB 2ASDA 3OJUA 3H2LA 5F8HA 4K4WA 4GKJF 1SKWA 1NHUA 1VQKS 1EARA 2DBBA 3RG6A 2KRBA 2E9TA 4RUHA 2DR6A 1C1BA 2WAQD 4J90A 4O44B 2DHGA 2AEMA 3CDEA 4I64A 1DARA 2DIVA 1FDDA 1R89A 4GRSA 1K1SA 5KFYA 1GEHA 4RW4B 2XMVA 2KJVA 3KJNB 3WZ0A 3CCQS 4R5PB 2AJ4A 4PQUB 4OZ0A 2KVQE 1VR6A 3MECB 2MKIA 2DVIA 2BKPA 2AJFE 5J2MA 2MHEA 5BYRA 5J1NA 4U7UD 2RILA 3SQGB 4ZVPB 3FVYA 2ZVIA 3CPWR 4RW6B 3OR2B 2LU2A 2CPHA 2RS8A 4TKTA 2ROGA 1S4FA 4JP8A 5A8WA 5SZTA 3VVTA 4UUXA 4RR5A 2ZC3A 4KR0B 5B0GA 1K44A 1VQ7S 3RYLA 2OPQB 2YKAA 5D3GA 1XR5A 1NBEB 1JLQA 3OQ2A 4QIGA 4YEAA 1AXQA 1I1GA 4GO7X 2ZNZA 1WHYA 1VQNS 3QSIA 2DNNA 1HBOB 1P9YA 4C7QA 3A8EA 3SI8A 4IQXA 2HFSA 2CKWA 3O5TB 3DCAA 2HGNA 5GADI 1YJUA 5CXTA 2HGLA 1CULB 1N0VC 1JXVA 4PCQA 4NWBA 4DL0C 2R7VA 1XMBA 5M2RA 4DV6J 1FKPA 3QAUA 3P6YC 2RQMA 3N4WA 2VKZG 4YP3A 1S0VA 1XN9A 2DCLA 3KHLA 2FQQB 1N8RT 4O44A 2PSZA 2FVCA 2DGTA 3ONQA 4LRBA 5L1JA 3DXBA 4PG6A 1RAEB 1FRKA 1V3RA 2JNJA 2VFUA 4B3MF 4LIWA 2ZBIA 3ENAA 1F3VA 2K8GA 4B3RF 3IBWA 5IT0A 1UVIA 1WUUA 1T9YA 2K3IA 2X1FA 5F8GA 4R5PA 2XCAA 3BM7A 3QJJA 2Z4PA 3MECA 4DI6A 2BE9B 3M9NB 1Q81T 2IHR1 3SQGA 4HKQA 4WTYA 3MWBA 2DNLA 2QA4S 4DLEA 3TAQA 3OR2A 1J2VA 2JRSA 1R0AB 1WC4A 1GH8A 3E8OA 2ZBQA 4G65A 3R5DA 4YDDB 1R43A 1F5AA 2ZZNA 1URRA 3E2EA 4DCOB 1JLAB 4USHA 2OHDA 2UUAF 1FX2A 2XQCA 2HHXA 2FY1A 2OPRA 1F3FA 4YOEA 3HVTA 1NKEA 4ZJOA 1VRTB 1UZHA 1FTCA 1N5TA 3WDOA 3QGIA 1S10A 3MR2A 1HBOA 1EQMA 1IXKA 5B0EA 9RUBA 4NL5A 2B0GA 3KLFB 5HVFA 2DR5A 2CQ1A 2ZUGA 2AT1B 3MD3A 5E3AA 3UW1A 4NEYA 2HVDA 5L1IA 2W9BA 2CFXA 2G9OA 4USIA 3E3XA 2ZBPA 1Y3KA 1TP7A 1QD1A 3GMGA 3N28A 4UTGA 2Q79A 2YNFA 5IV4A 2ZZTA 4JI5F 2VPXB 5SUHA 4DV7J 1HQUB 2YKMA 3QQCD 2N3LA 5IOLA 4OV6A 1HWKA 1CJUA 1J5EF 3GCWP 5BXIA 3N6NA 2N4CA 3PYDA 2M2BA 1KSPA 3MTKA 5BR8F 3AJ1A 2W9CB 3M30A 2FVRA 4ZCIA 4Q8FA 4GMKA 3NS5A 2L9WA 4O0IA 4JV5J 1JLGB 3GG1A 4RNMA 1CVJA 2OELA 1YZ7A 2K06A 4RJVA 4CZCA 2E9RX 2M88A 5GMDA 4YR0A 1N32J 5DQIA 4ZPAA 2HHTA 5J1PA 3OL9A 4LF2A 3KUEA 5HMYA 3TA2A 3QLHB 1FFGB 4Y2IA 2H5JB 4IQMA 3F41A 3VAIA 4RLEA 4YY3J 4NXNF 1JLAA 4Q8EA 3JQJA 2O1PA 1QSLA 4AFFA 2ZH7A 2R8JA 3W9JA 3CDWA 2K2PA 4HHHA 3VGUA 4F8RA 4EYIB 2ZJRQ 4ZS6A 4A8WA 1T95A 3DDKA 1O0PA 2P6TA 4WK1A 3H4BA 2XNRA 1CQNA 1FA0A 1BWVA 1UVJA 3DYAB 3CD0A 8AT1B 1T0TV 1SIZA 2D9OA 4FKXA 1G1XA 3PXGa 1VHIA 3DLHA 2R8HA 2YKNB 1BQXA 1IM4A 1HHQA 3PO4A 3SBMA 1YITS 3CCJS 4BS2A 4FYXB 4ELVA 3D66A 3BGRB 3MOJB 4USVA 3EZUA 2AW0A 1C0UB 1Q7LB 3IWXA 2JEFA 4RW7B 3RB4A 4B9MA 3O6QA 3DHXA 1BXNA 4JI4F 2B9XA 2AWZA 2W9CA 4U9RA 4LT6A 2CRLA 1D9FA 5HATA 1NUEA 1B64A 2Y0BB 2ZM6J 2JHEA 2FHJD 1NK5A 2H9ZA 1QVGR 4JI7F 4CO0A 2CG4A 3BGLA 2XZTB 1HWLA 3Q24A 3QLHA 1XMQF 4ILLA 1UJ6A 3CIZA 3IMQJ 1L5UA 1Y11A 1LXNA 1VQSA 4DDFA 1RLDA 5EWFA 1OYDA 2J7WA 2DPIA 5DQGA 1GXUA 2V4JB 1PILA 4ATNA 2BDPA 4NLWA 4CO4A 2XSJB 4L74A 3K5MA 3BJYA 3PZPA 1YRXA 5L1KA 1WI6A 3AJ2A 4ZOSA 2DGXA 2QO3A 3IWLA 1CBKA 3R3TA 1OY6A 1Q8KA 4IR9A 2MQPA 4OX9J 3ZC4A 4UOHA 2HQDA 1X4EA 2FHJA 3SXLA 1FXLA 3MMAB 1GXLA 1AZSB 4NLPA 1U4BA 3QJPA 1C0UA 1QE1B 2PI4A 2CNKB 3GJSB 5HAOA 1RA7A 1QAIA 3HKZD 2EFOA 2F9DA 2RH3A 3IR6B 5CZXA 3FFIB 4PWDB 2VBYA 4I6AA 3P5TL 1H0HB 4X4PA 1T03A 3DI6A 3SV4A 5MAOA 1LFPA 5DS7A 4RNHA 1XR6A 2BV3A 3T1YF 4J5OA 1NPRA 2UUBJ 3CJ0A 1EETB 4HHUA 3ITHB 1Y3JA 1YIJS 1RWNB 5ETOA 5GMEA 4OQJA 5E2QA 1JX4A 5HMXA 4BDPA 3I5CA 4RX6A 3ILIA 2W2PP 1TQLA 2QYGA 3NMAA 3PVXA 2A10A 2CG8A 4KGZB 4FDFA 3DRPB 4ZPWR 3THTA 3NCPA 5HP1A 3TX8A 5IFMA 3K59A 1KD1T 4RW8A 1Z2LA 5BYQA 2XSJA 2IBKA 3OJSA 4NCGA 3VALA 1TR0A 3EDRB 2Z58B 3CIMA 1T9XA 3ZZTA 1QUPA 2E5HA 1WSRA 1AFIA 2HVHA 3A1YG 1NSKL 1NU4A 4QR2A 1H72C 4C9DA 2J0QD 2H65B 2HFOA 1N33F 4UY85 3PG9A 3MMAA 1VQPS 1HFEL 1AZSA 3HFZB 4AL6A 1E6YB 5HANA 4KPCA 1NSPA 2V34A 2VPYB 1QE1A 2XMTA 3GYNA 1RE1B 1ZM3A 3QWUA 3UI3A 3AD8C 5ETQA 3FFIA 4PWDA 1VS3A 4NZ7A 5KG6A 3NXZA 4J9NA 4XTTA 2LA4A 2UXCF 2V63A 5KFBA 4NLVA 3O3LA 2XYPB 3PFEA 4DS4A 1M5OC 1S0NA 2PMHA 4NLOA 3PJWA 3N79A 3ZTOA 4FXVA 2I0XA 2GGPA 1DHMA 1FJGJ 1WHVA 1LFWA 3DOMA 4U7UK 5FLXY 1RYRA 3MPWA 3ITHA 5KFIA 1OQ3A 1WELA 1H6KX 4AL5A 4OV1A 4CDIA 2MKJA 3H5YA 1MNEA 1I94J 2B6AB 4RW9B 4KV8B 4C11B 5F41A 3NS7B 3DRPA 3V2UC 2JDJA 4DR6F 2IY5B 3JSYA 1JNRB 5KT2A 2X7IA 4DR2F 2DNKA 4O4GA 4OHYA 1V5VA 4QYRA 5C24A 4NASA 2PEBA 3VZHA 2GMJA 2FJWA 1QDUB 2E7VA 2V8PA 3KKFA 2YWKA 3CGIA 2NREA 2Y3YA 2RB7A 1MWZA 2C28A 3OV7A 4UOCA 4ID5A 1W2BR 2HEKA 1AB8A 4B3OB 2UV8A 4LF9J 4ERDA 4HDGA 1RAHB 4B17A 1NRKA 2BR0A 2FD2A 1FCAA 1S7IA 1KHWA 1P1TA 3W2VA 4P7VA 5KT3A 3CMAS 1SL2A 2LVWA 1XEZA 2QLXA 3ZZUA 2XS2A 1BMQB 3HT0A 2EEYA 3TAMA 1RT6B 1TL3B 3HSDA 1RXOB 2ZEJA 4Y2AA 1UEKA 4C97A 2XSFA 1X60A 4IDKB 1FKAF 3TEHB 4LREA 5HI7A 1M1GA 1RTIB 3R5GA 2GNKA 4F02A 2FJDB 4JI3F 1XMOJ 1I6JA 3AXMA 2BZ2A 3MAHA 1U47A 2B6AA 1KS2A 1SQEA 4C11A 1TKXB 3HHLC 1NK9A 1FHTA 3SQOP 3L7PA 3CCLS 3DLKB 4DFJA 5F9NA 1UEVA 3D9BA 3IGVA 4A8QA 3KDNA 1HNXF 2FIUA 3MEGB 4FNIA 1I5OB 5KTQA 2EI5A 2PT0A 3AA8A 4ZP6A 2RQ4A 5AE1A 4DR5F 5GAHU 3RZAA 4K2XA 3EVWA 3Q83A 2D3O1 1JJ4A 2LQJA 4CCHA 4X4TA 3W66A 2KKHA 1VMBA 1F1BB 3KOAA 1RAAB 4LR7A 4RPFA 1E6VB 4DLGA 3X1LB 4G3IA 4RBTA 4ZHRA 4YB7A 1GTHA 5A2QU 4QYZJ 1UVKA 3GJTB 2XZWA 2AP6A 3JSMB 1RGVA 2BOAA 5DG8A 2AMCB 1K47A 4KE5A 4B3TJ 2HPUA 2J76E 4FKYA 1SQFA 2QYCA 3TNVA 3DNCA 3AOAA 4AXJA 3MPDA 3H42A 2W7OA 2MZQA 1AUDA 4JI2J 5KFKA 3OXFA 1RP5A 1ZZFA 1MROB 4CLZA 2DHHA 3GSDA 4IDKA 1RTIA 1YJRA 1LWEA 2C2NA 4MIWA 2MJNA 2CYYA 4OX7A 1JLEB 5THWA 3P45B 2B56A 2W7PA 4I2QA 4MK8A 1X5PA 1K9MT 5AXMA 1N54B 3HSJA 4FS2A 1A0OB 2GZOA 1OY9A 2AYEA 3CWJA 2D3OR 4O3RA 3C6UB 1MMLA 3DLKA 1GK8A 3SCJE 4U67Q 4OJ3A 2FGCA 1YKWA 1S76D 1M0SA 1RT1B 9ATCB 3IWNC 1NSQA 5GAEI 4DL2A 3ZZOA 3POTA 2HNZB 1JJHA 2IIHA 4HACB 2NXCA 2KYXA 2ZWOA 3QNWB 3BKUA 4DPYA 3C16A 2OGUA 2HMIA 3M6UA 5K14B 3PEJA 4EO6A 1X4FA 3BN7A 5HK4A 1OPZA 3HMJG 1XIQA 3D1OA 3JYTA 3HPOA 1F6TA 4JBCA 4MFBA 4F4AA 2HGMA 5FJ4A 4ZLLA 1RWWB 2BYCA 4U7CA 1E6VA 3GFYA 5LJ3Y 1RSCA 4BC7A 1LV5A 3CD6S 2R3VA 2EBGA 2AD9A 3DN9A 2ILYA 5F9LA 2Y8WA 1PJ6A 2Z57B 4LBHA 4B9NA 3TUJC 4CWBA 4CM0A 3JSMA 5I42B 2F4VF 1SC3B 1UVLA 5D6GA 4O3QA 3I6PA 2QN6B 2Y1JA 3EICA 5KOXA 4LSNB 4HR2A 1HR0F 1HKAA 2XY7A 2HNYB 2RRNA 5HL7Q 1APSA 4WP8A 3D6MB 4LFBF 4NXMF 4NLSA 1GT8A 1RKIA 2H48B 1RBLA 1MROA 2VDIA 3KLIA 2FB0A 3TWZA 1FTRA 1FJCA 2LQ8A 2HFVA 3MFHA 4DV3F 3IAM9 1WF1A 1JLEA 3ZTRA 2A2CA 3J80Y 1SJ1A 3M6VA 3OXGA 2NQPA 1R6VA 5D4LA 1GNKA 2W4CA 4GKJJ 2W01A 3C6UA 1RT2A 4WPAA 2V8HA 2JEJA 3N01A 2RF2B 2LXUA 1LW2A 4F26A 1TKZB 3HKWA 3I4HX 5E3PA 1YRTA 2RIJA 1U49A 1UMJA 1RT1A 3D28A 1N0UA 1RAOA 2MSTA 2VA3A 1UZDA 1ZETA 3SV3A 2FHKA 3CC4S 2R8KA 5CHCB 3QBCA 1KOOA 3TUZC 4H4MB 2MB0B 2MKHA 2CQDA 1F5BA 3J7A1 4ANDA 4DR1F 5K14A 3WIVA 2HFNA 4QIFA 1NNDA 1G3OA 3HF5A 3OLAA 2DY1A 3ZNUA 2CUYA 3EX7B 1EJ7L 3TZXA 2EPIA 1KC8T 5DGBA 4QBUA 1R8CA 3IGNA 2VIHA 2EBEA 3BSAA 1U2FA 4QPTA 3KK3B 2PO4A 2B4PA 4A4JA 4DPOA 4RWWA 3C3LA 3AOBA 4R8UB 3W7BA 4UUWA 3TAPA 1RBOB 5I42A 4BCAA 1TU0B 2NPIA 3NG8A 4K5SA 1YZ6A 2OIHA 1HNIA 4LSNA 4WBFA 2ROPA 2HNYA 3LW5C 4K4UA 4FF2A 2JFDA 1G7CB 3EGVA 3R5AA 3SDEA 2Y1LB 2CWXA 2OUGA 5HVGA 2W8LA 4DV4F 2J6SA 4I4BA 1IBCB 3GV7B 3MEKA 2B5JA 4PPZA 4ZA1A 4U6PA 2UXBF 2IAJA 4FF1A 1X4GA 2SXLA 1HBNB 1R8AA 5DQHA 5ADZA 1NB2A 5FIIA 3PRDA 2RF2A 3P49B 1W26A 2VG7B 3BR8A 3I0SA 3FRZA 3R6LB 3NNHA 3GTYX 1WC0A 3OXLA 4B3MJ 4UF4A 2RAQA 5IV3A 1F5CA 2Q6CA 2RQCA 4WKYA 1KVKA 4B3RJ 3CDBA 2C1EB 2JJ4D 3PR4A 4F4YA 2YWEA 4Y6IA 3GV8B 1NJXA 3AAWB 3KK1A 1JJCB 3S8SA 1WEYA 3CT9A 2ZH8A 3D1QA 3FEXB 4TY8B 1HIYA 3H90A 2DYAA 2JZ5A 4TVAB 4IFYB 3SMZA 2QLFB 3BQ1A 2DH8A 4HDHA 5A8RB 2DD8S 4OZ2A 3KK3A 3MM9B 2N3OA 3QZ8A 5DM7Q 3FCWA 1MMDA 3B6BA 2VBWA 2QG9B 2GAHC 3I4PA 1ACMB 4DSIA 5KFGA 2ZH2A 2LDYA 2G13A 1FNXH 2VG5B 4ZLPA 5CYQB 1NK8A 1SV5B 4F0KA 2B9WA 4P2SA 5KFLA 4DQRA 1WOOA 4ZK7M 4ALZA 2FLLA 4ETXA 4DV6F 2VFRA 3OSPA 3TZWA 2FGOA 5KAKA 2HHUA 2CPZA 4DQQA 1HBNA 3H8YA 1RA6A 1S9FA 2YWWA 4MAKA 2YWGA 4C8KA 2DRDA 1SVDA 4QWAA 4XPCA 2FPHX 2XY5A 2KZMA 1RLCL 1WHXA 5J2QA 2FJXA 2BE2A 2DNRA 4DXLA 2N82B 2BJDA 5DM6Q 2KXHA 3W2WA 1S6QA 2BXJA 2GQCA 2RRBA 3BDEA 3QGHA 4N56A 4K59A 3VV2B 3CULA 2LQBA 1QAXA 1YDLA 2VF3A 1VC5A 2A18A 5IT9U 2RUSA 3LP0B 2VB6A 1P8GA 2FZCB 1UFKA 2QMXA 2DNYA 4YB1P 3VAGA 3H2UB 3BBBA 1XNRJ 4NMXA 4IFYA 1WEZA 3GIRA 3R7NB 3C6TB 2KT2A 2PA3A 4OYMA 2YWHA 4DG1B 1NCLA 2X1GA 3VVUA 4DV1F 4NXNJ 2JX2A 2QL7B 1V3SA 4TU9A 3V4IA 4RWXA 4PQAA 4A8XA 4F3QA 3BBFA 2KU7A 2HZCA 4DV0F 2HHQA 5ETLA 1JXEA 3ZZZA 2VG5A 1U1QA 4K4TA 1SC6A 3PX0A 2ZJQQ 4DSLA 3UD4P 1YJWS 2QL5B 1M5SA 3GV5B 1W25A 1NZ8A 2GCFA 4G1PA 1IJFB 5L46A 3TA1A 3B4MA 1ITPA 2MKKA 3MPVA 1KRPA 1NHVA 4L3KA 6AT1B 3HZGA 3UDVA 2HQ3A 5D78A 1S57A 4B9SA 2R8IA 5HSPA 4QIVA 2GA7A 4HEA9 5M2UA 4N76A 4EZ6A 2HWHA 2DY9A 2E7XA 3CJRA 4HL9A 5ETRA 3PIPQ 3C14A 1VRUA 2O3DA 2VKRA 2B9EA 2FC8A 2J9EA 2WBMA 1JJ2R 4X65F 3OVBA 3ZZPA 3RAMA 4KH1B 1GMUA 1FERA 5E3CA 5E5NA 2YNHB 4JV5F 5IC4B 2BQ3A 1HPZB 3LH2S 2Q1LA 1FFSB 3VAFA 5J2PA 1NXIA 2FVPA 2JL9A 1BQNA 3KDOA 1N32F 4WFXA 3TUPA 4ECWA 2GHVC 4JI7J 1XC9A 4ES2A 3LP0A 5B0FA 3DRYA 4P71A 2D41A 1T9UA 1Q78A 3QAEA 1M5PC 3H4DA 1XMQJ 4FYYB 5LSRA 1UPMB 2RE1A 4JYAJ 2LP4A 2VFTA 4IG0A 3M1VB 1HHTP 5CYJA 2MSSA 2I9SA 3A13A 3EE3A 3OFGA 4EEYA 2PEHA 3PDNA 2MQOA 3R7SB 4IOCQ 3PW5A 3UN3A 2B4OA 2YQ1A 3R5BA 1K0TA 2YWFA 3JB9k 2YVSA 3ENVA 3RBDA 5D0GA 5F0UA 4AYBD 4BHQA 1HI1A 2JSXA 4IG3A 4JI0J 3JAMU 1PIEA 2C3UA 3FUYA 3R1LA 2JH3A 4M5GA 2VC0A 1Y5LB 4ZLJA 2RRAA 2V2ZA 3N6LA 5KFCA 4Y65A 3VTIA 5KFQA 1F9HA 4CH0S 5HQ8A 3OUYB 4Y2CA 1R31A 3HHDA 4EBCA 3BYRA 1YJNS 4NCBA 3EVMA 5K8MA 4B9VA 1TKDA 2MZJA 4EWTA 2VC1A 2ZUAA 3HHKA 4WP3A 1ZAXA 5LM7E 2EFGA 4RUCA 2QX0A 1SCJB 2HLUA 1RU1A 3UD5A 1DLOA 1ZM9A 1TUGB 2YNHA 3QYYA 8RUCA 2JLGA 3HHLB 1HWIA 3Q8UA 1YJVA 4CYUB 3G6XA 3T1YJ 1WACA 4NLYA 5MLCV 1H2VZ 3OVSA 1B7YB 4I6YA 3G8QA 3MOZA 3EXYA 1RB0A 1FRJA 3IR7B 2MPUA 2HSEB 2V6AA 5ITHA 3UNYA 2VA2A 3OTEA 1UPPA 3UN5A 3ISNC 4KGVB 3M1VA 3MCSA 2CVIA 4CLSA 5EWEA 4PWUA 3FDSA 2EWHA 3D0IE 2C3OA 3IS9A 4J9MA 4IKAA 4L73A 1TVRA 2M4MA 4PG5A 4ECXA 3HFVA 3FMBA 2Y9HA 2IPOB 2VU5A 1FWLA 2OD4A 4KPYA 2U2FA 2OLWA 1IWAA 4UZCA 3AD7C 1N33J 5H9FJ 3T6BA 3M6XA 3R2DJ 2M8HA 2GHPA 2IJNA 3TARA 1RT5B 1S99A 2GQ2A 2PA8D 3V6DB 1IQTA 1GAOA 2OPSA 5KFZA 1SJQA 2DNZA 5KOWA 2CQGA 3JXOA 4ZP7A 1JXLA 2ACYA 1RYSA 4I2PA 3G2XA 2LA6A 4CYUA 2R7TA 3PW2A 5IM0B 1FKOB 1NDLA 1GMWD 1U24A 3HFKA 2VQFF 1IKXB 1RJJA 2BA9A 2WSCC 4MT1A 1VQ5S 3DOKB 3CJ4A 3A8KA 2X1AA 1R0CB 2WB1D 1NLKL 2HBRB 2A1BA 2CAJA 1X4BA 2AX1A 1LW0B 5F3ZA 4WFNQ 1U6ZA 1Q7YT 2RJZA 2IRYA 4I69A 3LWLA 4ZIWA 4M5DB 1HNWJ 4QJVA 1ZZNA 4LVNP 3EGNA 3J7YU 2QT7A 1RHJB 2CVEA 3CJ2A 4F3OA 1FO1A 1PBAA 5HJXA 1WC1A 2MQLA 4NX9A 4ECVA 3GCXP 1GMWA 4QWCA 4CLLA 1CQMA 2HS0A 1JKHB 3A4TA 3PW4A 3VGSA 2G2YA 2YNIB 4F0HA 4W90B 3G8SA 5G4DA 3W62A 1TL4A 3M9OB 2DH7A 4F36A 3TZYA 2NSBA 5T7LB 4FYDA 3V5RA 3C19A 2FLNA 1REGX 2M7SA 2GO9A 2JOQA 4DBQA 2YH1A 2XWXA 4HYKA 1DAXA 3G6VA 1FJGF 4LF1A 1TFWA 2YBVA 3W65A 5ETNA 2MTLA 2JLFA 4NYOA 4CP5A 4JI3J 1C1CB 2GJFA 1Q8LA 2VBXA 2CQIA 2RVJA 3GIJA 5F0WA 1I94F 4M5IA 3MUTP 2VG6B 5HBMB 2YXLA 4ELTA 5IZHA 3HX9A 1WC3A 3O1LA 1KLMA 5A2QY 5EX0A 3NBPB 2NLWA 3L7UA 1VQMS 3R6GB 1HNXJ 4KTQA 2GX8A 4ED4A 1T11A 1S1UB 4EFAC 2IDEA 2KFZA 3R9LA 1FX4A 4EMDA 4P75A 4W92B 5C42B 3J81U 4IFVB 1EZZB 1GTEA 4KFBB 3C46A 1U1LA 4DR5J 2GQQA 5GAHI 2ZHAA 2MHNA 5EGYA 4WK3A 2XG8A 1F2HA 4RBUA 2DNPA 1VYAA 3DDIA 1JKHA 3BO3A 4A8SA 3MF5A 1TZ0A 1WD6A 3UVJB 4HI2A 1RU2A 3TVYA 4CQ1A 3KHGA 2VICA 1OPIA 5L9XA 2W24A 3AQOA 5KT5A 5ETVA 4GC7A 3T41A 1FNOA 3QRQA 1LK7A 2EK6A 1X9WA 5T7LA 3UNGC 3M8RA 4EUVA 2OFHX 2DNQA 5LMUF 2ZNYA 1FEEA 4FVMA 2VZ9A 3PYEA 3BH6B 4LF4F 3OTOJ 2ZKTA 1TAQA 3HVAA 1HI0P 1BLUA 4KHMA 5FDLB 2YNGB 3MEEA 5IQQA 4ECUA 3K7RA 2GIQA 4M5HA 2KN4A 4V19X 4DQPA 5HJYA 4DN9A 4RNOA 3HVWA 2XGPA 2GVZB 3K57A 1C1CA 3U27A 2CJ9A 2B7BB 1IBMF 2CPDA 2DGQA 3PX4A 2VG6A 1TELA 2HLTA 5CD4A 5KG7A 1S5ZA 3PW0A 2KT5A 2XMAA 5D15A 4ZMMA 4X4VA 2BW7A 4A8MP 4JI6F 4B3SF 1T7PA 2J6UA 4H4KA 1M5KC 2EFNA 3MMCB 4Z7CA 3NBPA 2ASYA 2QIFA 2CPYA 2IM3A 1IBLF 4E98A 5EN1A 4G1QB 1FESA 2XO7A 3QWPA 3LP2B 4WJBA 5DRKA 2F65A 1IKWB 4OLOA 3AT1B 4MKYA 1T9WA 4NRUA 2QJ3A 1KWMA 4KFBA 1CS4A 2KM8C 3MGJA 5L9NA 3M32B 2Z2MA 1Q0NA 2BE7D 3CO0P 5CQGA 4L76A 1FVSA 4CLYA 4IUFA 1U1NA 3A8IA 3KXDA 3ZO7A 1VHFA 3HULA 4YS2A 4X66J 1NPKA 4P52A 4F67A 2CNNB 4ED7A 4Q43A 2ASJA 4I56A 3FQKA 2MQMA 2F4VJ 2XMWA 4K4YA 1YK9A 1X4DA 3D3BJ 2WHOA 2KHCA 1SXLA 1FXDA 3A12A 2J9DE 1HR0J 2DNHA 1Q53A 4M8LA 4LFBJ 1YTYA 3D0HE 3BDPA 3WHIA 5FDLA 2YNGA 2OJ3A 1AROP 3OL6A 3MM6B 2GVZA 5FD1A 2YQ3A 2Y1RI 3VWSA 1RHQB 3CCVS 4P2MA 1XERA 4D3GA 3M2VA 1WKJA 1NJWA 1Q5YA 1H74A 4TN2A 2G0JA 5DJBA 1C1BB 1VBKA 2V2VA 1WJ9A 1KLNA 4ITSA 1BUXA 2XWYA 2E1PA 3GFZA 4PKDB 1WWHA 3U1LA 3EGZA 2HHHF 4X4NA 4FVCA 3TRGA 4USKA 3LP2A 1IR2A 3GZ7A 2XCPA 2HQIA 2R2RA 1BC6A 1VBXA 3ULHA 3D0GE 3FK4A 2NXEA 1BE4A 4KAIA 2JFKA 2Z30B 5GADU 4QU7A 1QUVA 2I8EA 2DXDA 4G1IA 3TANA 2YKQA 4HHJA 4KJIA 2DO0A 5KFNA 2E5IA 1UWBA 4OX8A 3DRSB 2DGSA 1VDHA 2ZVSA 2DR8A 2ZHOA 5D3GB 2ZDOA 4OI0A 1JLQB 1MU2A 1FFWB 3W5XA 5KFPA 1X9MA 1SC4B 3W5ZA 3NOGA 3UQSA 3Q2TC 2ZDPA 5E33A 3W8GA 2IRUA 1QTNB 3LGHA 4LR8A 3W5YA 4XIUA 1JNZB 3PYFA 4YR2A 2KXFA 2AJ2A 5JXSA 4CM2A 3GP9A 3MHYA 3N6MA 3FZBA 3NY0A 1RABB 4KT0C 2GW8A 2JC0A 3OBIA 1LNQA 3MM6A 4DV4J 4OIXA 3TYTA 4EK2A 3GONA 4KGKA 2KVIA 2KXNB 3MUVP 1IQZA 4FS1A 2UXBJ 3N0VA 4EBEA 2QLWA 4FN5A 3EUNA 2XO6A 2HBQB 3VQTA 1U02A 3KUGA 3FMWA 1N6QA 4KSEB 3CD5A 2VOOA 3ILOA 3RB3A 1LKZA 1RAFB 1JLFA 1NDKA 2QFIA 2UU9J 3WX8A 3EJMA 4NMLA 2FLOA 2RUGA 4X4RA 3SIPB 2V8DA 1L3UA 4C8ZA 1WC5A 3NGTA 2IJRA 5J2NB 2FJBB 5KFXA 3BN4A 4RU9A 4PG4A 2C2RA 3FBBA 2QA2A 2BVZA 2HNDA 2CJBA 2R9LA 4DF8A 3T19A 2FJVA 2J5AA 3DRSA 2R7WA 4MTPA 2OPRB 1MLAA 3IM8A 5GAGI 4E8UA 3HJFA 2HRUA 3HVTB 2GVDA 3CD7A 2DGVA 1FJ7A 2J8SA 3KHRA 4DR3F 4DU8A 5KG4A 1RISA 5A76A 2R7RA 2CDRB 3W9HA 1BGXT 3FBFA 1H2TZ 5KFWA 1ZPVA 5KFUA 2W9BB 1SJ3P 1S0MA 4MK9A 2AEFA 4X4SA 4Y28C 3CC2S 4ICLA 1OS5A 2YNFB 2QFJA 4Z7YA 4KHPF 3AFGA 4AUKA 4QYZK 2HS4A 2YKMB 4TNOA 1YHQS 2G0CA 3G82A 1CJUB 1EQ0A 3K89A 4C3KA 1VQ6S 3M30B 3FJ2A 1PO6A 4GC6A 5H9EJ 1PJ7A 4DSJA 3Q8YA 4CRJA 2V0NA 1S48A 2PE8A 1RT3B 1HNVB 5DETA 2NS1B 3D68A 5AE2A 5J2NA 1HI8A 2HRTA 1UA1A 3BZQA 2ADBA 5B08A 3HT3A 1TKTA 1VQYA 4WCEQ 4DR7F 1RQ0A 4DV1J 3BH7B 1ZM4A 1S9GA 1U45A 2WRMA 3D5MA 4WP9A 3TI0A 2W2NP 1NH7A 4NLQA 4DV0J 4O0NA 3ISND 3R5JB 4F4KA 1Q1KA 4ED1A 4DUYF 5KFVA 1KTQA 4J9PA 2BOPA 4ILMA 2OD6A 4CLFA 1H7XA 3ZNJ1 1MMNA 3PFOA 3B82A 3H2VE 3LALA 2QEXS 1WG4A 2IBOA 4Q2LA 1CG2A 3RGIA 2V9WA 4FYWB 2KDOA 2HBZB 4LRCA 4R0JA 2RT3A 1HA1A 4QU6A 4O3OA 2PMWA 2F3JA 1UFLA 2K1RB 4J9KA 2GAGC 2Q66A 1F9FA 3HXMA 3MAAB 4LF8J 2CQCA 2X3DA 1TAUA 3EZOA 3CUNA 2RKIA 3NGDA 2CJKA 3D6FB 4X65J 3E51A 2W1BA 1R7IA 1RT3A 3W60A 1HNVA 3BS9A 3G4SS 2HHPA 3AJDA 3MI7X 4J37A 2LYVA 3NNAA 3HD2A 3FBCA 4OI2A 1R8PA 1M5VC 1JLBB 1XNRF 2OO4A 5E3RA 1IKVA 2BRKA 2XMKA 3DU6A 1P9QC 2CNLB 2MY8A 4MKBA 2CJXB 2DR9A 4L3NA 3CE8A 1NMEB 1XTZA 2LEAA 2V67A 4HI1A 3ADAC 4XK8C 4AL7A 3NWRA 1HW9A 4HTJA 4N47A 2HFUA 2R42A 3QIDA 4XO0A 3MR7A 1KFDA 1SPBP 2ZFHA 4C98A 3D6TB 2LDIA 3FQLA 1QSSA 3PYGA 5HQMA 3GFHA 1B7FA 3KK2A 3OW2R 1IM6A 3DRXA 1IVZA 2DB1A 1NH8A 3I87A 2IVMA 3M8ZA 4DSEA 2O01C 2AJ1A 3HZEA 4KRWA 3RAXA 1S97A 1NJIT 1GX5A 4YN3B 1X8DA 2K1RA 4LF7F 4AE5A 2LQ5A 1J5OA 3MAAA 2HHWA 2CJAA 2MGZA 1SL1A 2UVUA 3CJKB 3DRRB 4B9UA 1T03B 3RJMB 3DI6B 1FE4A 1GX6A 5E7OB 4QIEA 2GO8A 2VFVA 2DJWA 4CT9A 2CA9A 4XPEA 4EYHB 4ANEA 4JB8B 3OTCA 4C8LA 3GJRB 4UOGA 2YH0A 4P72A 3Q23A 5K8PA 2XYGB 2QRRA 2ATCB 3MCNA 2Q43A 2QLBB 1JLBA 5KFSA 1HQ2A 4QWEA 2Z2YB 2CIMA 3OSNA 3TUIC 3UE2A 5KG2A 4JYAF 5H1SV 3S6EA 3ETOA 2IDLA 5HVHA 2CQ3A 3BBCA 3M8QA 3SCLE 1FWKA 5HP1B 4ZVHA 1PBUA 3AB2B 3WC0A 4RW8B 4CLKA 1YX2A 3PV8A 4NCGB 2XNQA 4NLTA 3CCSS 3F0NA 1YBTA 3PHEA 3T1AA 4ZIVA 4ED3A 2OI2A 1RHUB 3Q8RB 4JI0F 2H1YA 4LVOP 2CPIA 2XY6A 2XB2D 2BW2A 1G4CA 1RTHB 2AHOB 4DOZA 1KDNA 1RWPB 3NAIA 2KB2A 1RUSA 5CAAA 3F56A 3H0PA 2DHXA 3FSYA 3W3SA 4N41A 2KT3A 1K8AT 3CJQA 3CJKA 3I56S 1CJKA 4CLUA 3DRRA 2FVQA 2L9NA 5C7PA 4URGA 1ICEB 1R6YA 1LQ9A 3A3OB 1NJYA 4RUAA 1UWAA 2LCWA 3OHAA 3I0RA 4IOBA 3KLGB 2HIQA 3O2IA 3EZ5A 2UV8G 1S6PA 5E3QA 1P27B 2IVFB 2GGPB 4ECQA 3DOMB 3QPIA 1B99A 3EMTA 3ZXWA 2VQFJ 4ZP9A 1RT7B 2POKA 2P8IA 3THVA 1UJ5A 5FLXU 3BQ2A 5A8KA 4NI2B 1ROFA 2X51A 1UVMA 1ZA2B 3KJFB 1LWFB 1N5YB 4F2RA 4J91A 4ZVQB 4U8YA 2MXYA 3CDUA 1IN0A 2HZVA 3KLHA 3M2RB 1G6BA 2KM8B 3ZFVA 4O4GB 5C24B 1HD0A 2AX0A 1UEUA 1Y10A 4DL7A 3M6WA 3EVOA 1EIYB 4UQTA 4C8MA 3NGRA 1KVIA 3IRWP 3S1TA 2J0WA 1UVNA 2NPFA 2H4WB 4KHRA 3J7YI 4DFMA 4TQRA 1DJ0A 2AJQA 2Z2ZA 1C0TB 3F44A 4ID5B 3M4XA 3TP2A 3GSIA 3PKMA 2ZKUA 3PRBA 1RTHA 1IBKF 2CQPA 2MQNA 2O67A 2WK4A 5DG7A 4ED2A 4ZPCA 2GJIA 3SCKE 1S12A 3MFIA 5KFJA 3W2VB 2LFVA 2LLZA 1T9VA 2W25A 2E1AA 3KLGA 3TAMB 4CH1A 2KO1A 4KKOA 4IRCA 3MURP 3ZZYA 1ZH5A 2R7OA 2VJUA 3MPYA 1LWXA 1R8BA 3OFFA 2N7YA 4WU2A 3L95X 4WYLA 3FSIA 3MM8A 2V2KA 5AE3A 1RT7A 4USTA 2QGFB 3JQKA 1Z4UA 1M1HA 3Q22A 1HD1A 4NI2A 3LANA 2G2ZA 4DSKA 4OI4A 1EP4B 2F7VA 3ZZ0A 1LWFA 1N5YA 4QIWD 3IXQA 3HHNB 1X5TA 2EFPA 2QSWA 1KHVA 4A48A 3CEDA 4U95A 3M2RA 2D9PA 3RU0A 2LEPA 4DU7A 3OFHA 4F4WA 5KFFA 3D54A 2ADCA 4M1KA 3CB4A 1HNWF 4LUBA 3VZIA 1WDTA 5K20B 3UR0A 2JEGA 3G96A 2E7WA 1C0TA 4G6VB 4LBIA 2RHQB 4J9UE 1U25A 1ZOTA 3PR5B 2FUG9 3PEHA 3HVRA 3BKFA 4KGMA 2OPPA 2AZ1A 1VQOS 2DTJA 4OZJA 4BBYA 4YMEA 1HHSA 2ATLA 4ZHRB 1X9SA 3PKYA 3W61A 2ASLA 1S6OA 2RSQA 1IR0A 3D3CJ 2XULA 4ZN3A 1S0OA 4PXDA 5LMUJ 3IG1A 2R2UA 3U1NA 1U1KA 2IA0A 2FC9A 1TV6B 3MMBA 2MLYA 4ZN1A 3Q8QB 1CC8A 2WOMA 4LF4J 1UW9A 4N5SA 2JWNA 2EKYA 3TW0A 2CPXA 2OTJS 4PPDA 4C48A 5LXRA 4B9TA 1LWEB 3E01B 4K2JA 3CMES 4QOTA 1S79A 1VC6A 4DV2F 2RDIA 4NZ0A 3PO5A 4I2QB 1EP4A 1IBMJ 1S59A 3VAHA 4E2FB 1GFWB 3RTVA 1RHRB 3W64A 1X5OA 2YX4A 4M5NA 1Y0HA 4ANCA 1RKJA 2DO4A 5I3QA 4JI6J 4B3SJ 2HQFA 2BANB 2XM3A 1FRIA 2UVRA 3L09A 2NYIA 2HURA 3NNCA 2WONB 3GB0A 2Z2LA 4LR9A 1Y5NB 1IBLJ 3POTB 4Q45A 5DDRC 2FDNA 2E66A 5HO4A 1HYSB 3C16B 2HMIB 4OHVA 1OMSA 4USWA 3OD2A 3BKTA 2I2YA 3JYTB 5ETTA 2KFYA 3ILLA 1KR4A 1FRXA 3G6YA 4MFBB 2KZZA 2QC3A 2XHWA 3TVKA 4WZMA 3D6HB 2JC1A 4LF6F 2WVCA 1SKRA 1IUJA 1DFDA 3IM9A 3GQCA 1TL5A 2JVRA 3UDEA 3CXCR 4RO0A 4WFZA 1D1UA 3DFEA 3SZ2A 1TV6A 1ZTWA 2C2ZB 2BKOA 2XC9A 1VIOA 3OTOF 5H9FK 1OSDA 4K4SA 3AXKA 3WQPA 4OZLA 3KLIB 3SFUA 2GMLA 4OYPA 5IT4A 2MQ8A 3NMRA 2BJ1A 2UP1A 2DGWA 3IRXB 3E01A 4IH6A 3RBXA 1VC0A 1PJ5A 5G0RB 4KBIA 1WHWA 1ZAVA 4DX7A 1KTVA 4WWSA 3J80U 4ECZA 1FEHA 4Q7AA 2XTJP 1RT2B 3MUMP 5CZVA 4ZPTR 1YQHA 2L3MA 1LW2B 1U6FA 4AQYJ 5DGAA 2BANA 2BJEA 4TU8A 3GFXA 3K2YA 2ZE2A 3PY8A 1KFSA 4OL8A 1FD8A 2HHHJ 2WONA 4KH0B 4QWBA 3CO9A 4I1TA 4K0KF 3KMSA 5CCMA 1DQ8A 3OR1B 1XQIA 1HYSA 2PDAA 3PIOQ 4M95A 2IM1A 2VPWB 1SH3A 1RTDB 1QAYA 2OSRA 3CJ3A 4XDDA 2R7SA 2Z8QA 1OSCA 4X64F 3KG4A 1AYEA 4M63A 4OZ1A 3V4MA 2L9DA 2IMOA 1SL0A 4DUZF 4NZ6A 2V2QA 3MXHP 2UVWA 2P6SA 2M0GB 4LFCF 4J9OA 3DLGA 1PKUA 3LAMA 1RWVB 4X66F 3QATA 2IJFA 3D7SB 3BR9A 4IR1A 4C0BA 4WE1B 2GV1A 1T3OA 4UZBA 2MEWA 3LQVA 1U6BA 1HNIB 3GIIA 2WW8A 1OWXA 3ICLA 3UO0A 4X62F 2ABYA 2BRLA 4U96A 4RW4A 4M5LA 3TOQA 4NYZA 3SDEB 2Y0SD 1LK5A 1MWQA 4R0EA 4EBDA 4DZDA 3IRXA 4PQUA 2M9KA 1W2IA 1A6LA 2EG2A 3H40A 5G0RA 3CCZA 3CVKA 4HT7A 4Q0BB 3IN5A 4YR3A 2B5JB 5F8NA 2IAJB 1UKUA 3MAQA 3G86A 4RW6A 2J7UA 3V6HA 3PNIA 3I0SB 3UPFA 3I9ZA 2ZZMA 2OPQA 4OYAA 3DXSX 3HP6A 1RI7A 1YWXA 3LUYA 4R25A 4OI3A 1FRLA 3EPGA 1KQGB 5D77A 1NK4A 4PAAA 1VQLS 1X0PA 3OR1A 2GJ2A 3IR5B 1ZPWX 1N5QA 3I5AA 1RTDA 3KK1B 4ZVOB 4I7FB 4QW9A 1ELOA 1WF2A 4H4KC 3TA0A 2DR7A 4FF4A 2AYBA 2R2SA 1YJTA 3MMJA 1RAGB 3K5PA 4HTIA 2OSQA 2YPZA 1U1MA 4S0MA 1CULA 3M8PB 4CO1A 4Y3CA 3SCIE 1PSDA 3PCOB 3QGGA 4IH7A 2Y1IA 4ZVSB 1D3WA 2VBZA 1AA1B 2EC0A 3OHBA 1CC7A 4MK7A 4WE1A 2U1AA 4YB5A 1Y00A 4LFAJ 1WEXA 4DR3J 1O8BA 3IBFB 2ZH6A 4M5JA 2YTCA 3DC2A 2ZH4A 4AXIA 7FDRA 2B8QA 3ELHA 2E5LF 4FF3A 2UUTA 1NJZA 1DQAA 1UL3A 1B0PA 1NPPA 5RUBA 2AGPA 5AT1B 3W1YC 1FRHA 4P73A 4Q0BA 4DMZA 1UCNA 1L3SA 1Q79A 4KHPJ 1ULRA 1FDBA 2ZOFA 3KUHA 3TJ9A 1R0AA 3EPIA 1S1TB 4XDCA 4JI8F 3QT7A 3T5KA 3RRHA 1F2GA 2B51A 4OMFG 5J2QB 4RBVA 2NZ4A 4ES1A 3W9IA 2ZH5A 2BE2B 2UU9F 1VRTA 2DIUA 3W2WB 1WOSA 3UCZP 2R4FA 1S6QB 2H54B 4MYUA 2LECA 3US5A 3T1HJ 1T02A 3KLFA 4I7FA 2DK2A 1W7WA 4PXEA 1V3ZA 2O66A 3CDAA 3PTWA 1U8WA 1QY7A 1ZAWA 3G8TA 4WFBQ 3Q0AA 3M8PA 4F0MA 3QRPA 4DR7J 2Q3PA 1HQUA 2KFNA 3V4IB 2EKNA 2R7XA 4OYZA 4LRDA 3DLEB 1F0XA 1X7VA 3C8YA 3CJTA 1OIAA 1XNQJ 2J9DA 2X1BA 2OEMA 2C2EA 1U26A 4FBUA 1CEZA 4DUYJ 2RU3A 4C0OC 3D67A 3RR8A 4P9SA 1P1LA 1JLGA 1JMTA 1PYSB 3CCWA 4UQGA 4CT8A 1N5SA 1LEOA 2D7SA 5CABA 1RTJB 1VBZA 4QQBA 3UD3P 1HL6A 3TR5A 2ILZA 2WSFC 3HJVA 2MKCA 3IBCB 1S1TA 4RNFA 3N9UC 3HM9A 2GFFA 5LSOA 1YJ7A 3C14B 4CLPA 2W8KA 4V19J 1VRUB 1N34F 4L6V3 5HROB 5D4OA 2LQ9A 3R97A 1R27B 3RRGA 5B0BA 1FT8A 3NOCA 4GVLA 5J2PB 5DLGA 1OYEA 3OTDA 2XS7A 5EUHA 4Y00A 1KEKA 3I31A 3OLBA 3WBZA 1WNEA 1BQNB 2RU9A 2WVFA 3ZTQA 4GKKJ 4O3NA 3DYAA 2QTWA 1YLXA 4BWJA 3HHEA 2XMJA 3PHTA 2DITA 1WOPA 2C42A 1VLOA 2OEJA 2XLIA 2YKNA 3IP0A 4UOFA 2V8VA 1U1PA 2DNGA 4USJC 3M8SA 3T3FA 4TYAA 1X4AA 3NRBA 3KG0A 4IG0B 3BGRA 3ET6B 1T9TA 1QM9A 1Q8IA 1TMJA 1U7LA 4RW7A 4C4WA 3DLEA 3EWGA 2DRAA 4DEZA 4MKAA 3AA9A 3M7VA 4C3MA 2V9KA 1S1VB 2H4YB 4ECTA 4IG3B 3JSBA 1EAYC 2IM2A 4JV2A 3WIUA 1XR7A 4U8VA 5ETSA 5IWAJ 3LP1B 1KOHA 2F40A 1JIHA 4LRFA 1YJ9S 1RTJA 2HHVA 1N56A 1D8YA 4OJHA 4F4XA 3NLCA 2KTQA 4A8FA 2BMBA 3NEKA 2OH2A 2A6MA 1NB7A 1R8HA 3GLJA 1BD6A 5HMZA 1KBRA 1AUSL 4LF7J 2PC6A 4LF8F 4J9QA 1PC4A 3SFGA 4ZJQA 4NLGA 4I67A 4Y0FA 5HROA 4OHZA 3RB6A 2R8GA 2HBYB 2V4JA 4H54A 3TZZA 3A3NB 1DLOB 4ZP8A 3KG1A 2UUWA 1TK0A 2BKNA 1VFJA 4LF5J 1RBAA 5E0OA 2VH7A 1JQGA 1B0TA 2CWKA 2DXFA 2UZAA 4DCPB 1HWUA 2VDHA 1IJEB 4TYBA 4W4MA 5J1EB 4QR0A 1Q86T 5A0YB 4ZVFA 2G1HA 4MIBA 2D3UA 2FJAB 5L8RC 5I3PA 3HO1A 3VF0B 4DN0A 4MH8A 2I6WA 1N4LA 2AKWB 3QSYB 4CIOA 3ET6A 3H59A 3K17A 3O44A 4RUBA 1T8EA 3RBZA 4ELUA 5DZ6A 2C2OB 1N48A 1RAJA 3IS9B 1S72S 1TVRB 2BBEA 2A0FB 1HBMB 1V9OA 2AU0A 2V8GA 3RRKA 1S49A 1S1VA 3SSSA 1VLYA 2W4PA 4ER8A 5JVGQ 4ZJLA 1ZTTA 2WZ1A 4L75A 2GS8A 3LP1A 5DDOC 3UCUP 1EETA 3TJAA 1QLNA 4C8OA 4OYWA 1UA0A 3C15B 3GR0A 2MZRA 2OPSB 3GE9A 5B0DA 4F4ZA 3IA0A 1VJQA 5C25B 2VASA 2QZ8A 4ZITA 2HVZA 4WXWA 2VJVA 2DHAA 4MKVA 1H2UX 2QV6A 1TL7B 1U1RA 3OT9A 4D3HA 4I2PB 4DL6A 4PZVA 2FHMA 2HAFA 1S7HA 3LPEA 3GILA 3NCRA 4ID8A 2W2QP 3CCTA 2F8HA 2V4RA 4FPRA 1XK8A 2VHGA 2I38A 3GYGA 1WG1A 5K8NA 1YSJA 2D3ZA 1RWKB 3AH6A 4EU0A 4PXCA 4UW2A 1AW0A 3RBEA 2FZGB 5J1EA 3HLUA 3TQ1A 2L41A 2I5JB 4K4VA 5A0YA 1D9DA 2CQ0A 2RQKA 1KONA 4ENOA 3OL7A 1B4SA 1D9AA 1E6YA 1KQFB 3MD1A 1R3NA 1BY9A 5H9EK 2HHSA 3LPYA 3QT5A 1TFYA 1OJ4A 1QSYA 4ED6A 2HQGA 4O23A 1G2EA 4NA2A 3EXCX 5EX3A 4RZRA 5L1LA 1TK5A 1N36F 4WZQA 1Q82T 1X4CA 3KNAA 1HBMA 2DKOB 1WTBA 2AGQA 3RAQA 2BM0A 4NEZA 2CPJA 4N8NA 3TJ8A 2A2DA 4URQU 1T05B 1NK6A 4P10A 1NO8A 3JTPA 1WDDA 1MN7A 3A3PB 2LMIA 3FSXA 2XLJA 5ETPA 2A6OA 2AEJA 2WVDA 1IBKJ 7FD1A 2B3TB 3B78A 4JUZA 4DFPA 3C15A 4M5KA 2LEBA 3ZTSA 1BWEA 1U0SA 1NKCA 1HW8A 3BEGB 1NZAA 5IXUA 1PYOB 4P2XA 4RW9A 1FNMA 4KV8A 5C25A 3BSCA 1YGYA 4EI2A 3PX6A 2VQEJ 1X5SA 2X3GA 4USUA 1TL7A 3Q86A 4LIRA 4V1Ak 4B02A 4CTAB 2ERRA 3I82A 5C2GA 4WYWA 3GIMA 3BV8A 5A6WA 4JI1J 4CNZA 1DRZA 2IYIA 4X4QA 4C2MA 3FCHA 2EXUA 3U02A 2NR0A 2I5JA 5I4MA 3VGVA 3L4BC 2IYGA 2M70A 3L3CA 4B3OA 1PGZA 4YQWA 2CJYB 5M2PA 2HRYA 1WTFA 2LU1A 3T5LA 2LKZA 4NOHA 1M1KT 2HZAA 3BO2A 1B0VA 3KJVB 4J9SA 3QO9B 2ZBCA 1KLMB 4J7CA 4DV5J 1GMVA 4HVZA 1SKUB 3S01A 3AODA 1RWUA 2FY8A 4PG8A 2ACMA 2FYXA 3L9ZA 5KFHA 1VI7A 1Q95G
chains in the Genus database with same CATH topology
2Y8WA 4DZDA 2Y9HA 4QYZK 5H9EK 3QRQA 3QRRA 5CD4A 4U7UD 5H9FK 2Y8YA 3QRPA 1WJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8W A;  4DZD A;  2Y9H A;  4QYZ K;  5H9E K;  3QRQ A;  3QRR A;  5CD4 A;  4U7U D;  5H9F K;  2Y8Y A;  3QRP A;  1WJ9 A; 
#chains in the Genus database with same CATH topology
 1RT6 A;  1TL3 A;  2VV5 A;  2FLP A;  1T05 A;  3KNG A;  1S9E B;  3MM7 B;  3CF5 Q;  2ZOM A;  2YX7 A;  5B7W A;  2E29 A;  4A8K A;  2XYH B;  5DDQ C;  4DUT A;  4KY3 A;  2GIF A;  3EGW B;  2CPF A;  4AD6 A;  2DHS A;  1JLC B;  3PJX A;  3LA0 A;  3I96 A;  1PG5 B;  2MJU A;  3CCR S;  5DLF A;  1LOU A;  4DQS A;  1TKX A;  2DEI A;  4PRF A;  3U7J A;  1N88 A;  2HQC A;  2PGC A;  3BYP A;  2CQ2 A;  4OZ3 A;  5B0A A;  4CLW A;  1GXT A;  3FRY A;  1H3D A;  4DPT A;  4NLR A;  4CTA A;  3MEG A;  3QIP B;  3MEE B;  2EW9 A;  3BB5 A;  1TUW A;  1X4H A;  1VK3 A;  3V6J A;  3D2W A;  3DLL Q;  1WI8 A;  2K7K A;  1VIS A;  2VUG A;  1M5H A;  4DV2 J;  4KYZ A;  4P74 A;  2J8A A;  4ECS A;  2AYM A;  1VCT A;  3GG0 A;  4QWD A;  4K7Q A;  4DHV A;  4YHH F;  2P2C B;  2Z0G A;  2F1F A;  4CNY A;  3ZZR A;  5L38 A;  1L3K A;  3KJV A;  1ZA1 B;  3QO9 A;  4QPX A;  1NAQ A;  4URS A;  1I3O B;  2ZH3 A;  2OMO A;  5KG1 A;  5F8L A;  1UFW A;  3O8W A;  5F8J A;  4DL4 A;  5GVQ A;  4YFU A;  4F7V A;  5F8I A;  1S9E A;  3MM7 A;  3DGV A;  1CS4 B;  3MR5 A;  4B9L A;  2ALY B;  1TK8 A;  3HDS A;  3GU0 A;  2DCU B;  1MSW D;  1UW4 A;  4DPX A;  4ILR A;  5KFO A;  4K4X A;  3LOU A;  2A3J A;  4LQ3 A;  4P2F A;  5E41 A;  3GIK A;  1JLC A;  1O5J A;  4PAB A;  3HK2 A;  2QE5 A;  3BPD A;  5LMN F;  4LF6 J;  4CLT A;  5B09 A;  4DL5 A;  5CYM B;  3DM2 B;  3QMQ A;  4C8N A;  4DQI A;  2F63 A;  4BWM A;  1SJF A;  4KO0 B;  3LGM A;  3UFC X;  2EVZ A;  2C2M B;  4IRD A;  5LSL A;  2MKY A;  1ZM2 A;  2E1C A;  1NM2 A;  2WVB A;  1X0F A;  2GMH A;  3BSN A;  5CD4 H;  3QIP A;  2C2K B;  2XGQ A;  1IWG A;  4DJB A;  2HNZ A;  4HAC A;  1O6X A;  4NRT A;  2PMZ D;  4OX6 A;  3UDC A;  4OHW A;  3VHQ A;  2ZBR A;  2D74 B;  2V94 A;  2UXD F;  2XBP A;  3FBE A;  2B9Y A;  2MZS A;  3M2V B;  1FK9 B;  2BM1 A;  5F8M A;  4WFA Q;  3J81 j;  3Q8P B;  2J6T A;  1R0B G;  4TQS A;  4MMO A;  2WVE A;  2DGO A;  3QFH A;  4NLU A;  2YPY A;  1FWP A;  3AHP A;  1H7W A;  2AV5 A;  4DX8 H;  5AJ3 F;  2UUC F;  2XMM A;  3Q8S B;  1V5I B;  4K0K J;  4DS5 A;  2OAU A;  2PFD A;  4LBP A;  3X3U A;  1NDP A;  1FXR A;  1UAW A;  1L3T A;  3CCM S;  3NWG A;  3NKY A;  2E5G A;  3UDL A;  2BEF A;  3J7A N;  4X64 J;  3I9V 9;  6FD1 A;  5BYS A;  3PM9 A;  1UJ4 A;  4Y34 A;  3LGN A;  3EM1 A;  2L48 A;  4FBT A;  2V5H G;  4DR4 F;  1A9N B;  3SSQ A;  2P9C A;  4DUZ J;  3T5J A;  1VQ4 S;  2W7A A;  3G6E S;  1HNZ F;  4LFC J;  1UWB B;  2APO A;  4LJM A;  5CYM A;  1BHN A;  3DM2 A;  3K5L A;  1MU2 B;  4PXB A;  2BX6 A;  2E5J A;  1SUQ B;  2NYH A;  4KO0 A;  1TKZ A;  2HWI A;  4OYI A;  3R27 A;  2FZK B;  3N5B A;  3T9Z A;  1IR1 A;  3H5U A;  1U1O A;  3HD1 A;  2EK1 A;  7AT1 B;  4X62 J;  3J7Z T;  5LXY A;  4HH1 A;  4QCL A;  4WKR A;  4K8R A;  4J9R A;  4QW8 A;  1JK9 B;  4H4M A;  5ETM A;  5IQ6 A;  1Y7P A;  2XI2 A;  2DT9 A;  5B0C A;  4ZCK A;  2J9C A;  1URN A;  5KFD A;  3PJ9 A;  2VON A;  4USM A;  1U2R A;  2B8P A;  3AB4 B;  2R7Q A;  1FK9 A;  2OTL S;  2QSF A;  5HMW A;  1FRM A;  4GVB B;  4TU7 A;  3ENQ A;  3TVZ A;  5CH7 B;  4TXS A;  1L3V A;  5AXN A;  4L72 B;  4AQY F;  4ZPB A;  4ZPD A;  2NXU A;  3BRE A;  4OHX A;  1JB0 C;  4WFY A;  2UUA J;  4AT1 B;  3FNN A;  1N6Q B;  5GAG U;  4KB7 A;  3NAH A;  2QA4 G;  4R8U A;  2H3E B;  1JLF B;  5DG9 A;  1SJ4 P;  3CW2 C;  2FVS A;  2W9A A;  4OYB A;  3BO4 A;  3M2U B;  1PC5 A;  2B43 A;  4NA1 A;  2CAD A;  3GYX B;  4F25 A;  3BGU A;  2RHS B;  4RL1 A;  4OYX A;  3EYZ A;  4N7T A;  2KHD A;  2M3D A;  5BJR A;  2HND B;  3Q89 A;  3FC9 A;  2KJW A;  4JI5 J;  1VOM A;  2Z56 B;  1KKH A;  5U47 A;  2F8E X;  3DOL B;  2GVD B;  2ALZ A;  1SUQ A;  3BF4 A;  1J5E J;  4WTO B;  2VG7 A;  4YB6 A;  5AXL A;  5BR8 J;  1OO0 B;  3UWT A;  2XMU A;  5JVH Q;  3M8Y A;  3OPK A;  2CQH A;  3MM5 B;  5T41 A;  4O3P A;  3OFE A;  3K58 A;  1QVF R;  5EDW A;  4B08 A;  3KTQ A;  2HYI B;  1CJV B;  2WSE C;  4M94 A;  2E5L J;  2KH9 A;  2CNO B;  2HK2 A;  1DTQ B;  5KFM A;  5EHH A;  2AGO A;  4ICL B;  3SYZ A;  3IFE A;  1FJE B;  3CC7 S;  1S1X B;  3B54 A;  4FNH A;  4TY8 A;  1HMV B;  2H5E A;  2F4F A;  2NZC A;  2EG1 A;  4GVB A;  2GHW A;  4UT4 A;  3G82 B;  3NS6 A;  3NL0 A;  3FCV A;  3ENW A;  1U0H B;  5D0H A;  2R7U A;  4J9V A;  5A8R A;  4RNN A;  3MM9 A;  3FZ2 A;  4JI8 J;  2GIR A;  3VGT A;  2ZH1 A;  1KNZ A;  4N8O A;  5DO2 A;  1WC6 A;  1U09 A;  3I55 S;  4LSL B;  4K5R A;  4C6A A;  3T6J A;  8ATC B;  2OEK A;  2HKE A;  4CO3 A;  3BGO P;  3R5C A;  4Z37 A;  2IVY A;  4TLQ A;  1H98 A;  2QLJ B;  3UN2 A;  5CYQ A;  3KJQ B;  1A7G E;  3MR6 A;  3Q8V A;  1VQ9 S;  3M2U A;  1DTT B;  1SV5 A;  2IMW P;  2JEI A;  2PII A;  4A8Y A;  3SEO A;  2G2O A;  4H4O B;  1TKT B;  4C3L A;  2XZD B;  4DV7 F;  1I51 B;  1S9G B;  2KRR A;  5D4P A;  4K50 A;  2DRB A;  1YG0 A;  3G9C A;  4OI1 A;  3DOL A;  1IKY B;  1PAE X;  4GO5 X;  3JTN A;  1FDN A;  2YY3 A;  4X2B A;  2EFQ A;  2Y8Y A;  1S1W B;  4JV0 A;  2JLE A;  4HH0 A;  1EKR A;  4JI4 J;  4LFA F;  1EB0 A;  3T9N A;  3MCM A;  2KYZ A;  2XS5 A;  4DCJ B;  2B7C B;  1MW7 A;  3MM5 A;  3RW6 A;  1CJV A;  4EGL A;  3C66 A;  1Z2Z A;  2LXF A;  1DTQ A;  2QMW A;  1PYT A;  5IT9 Y;  4N77 A;  2N4D A;  2E9Z A;  5C2C A;  1VK8 A;  4KGX B;  1S1X A;  1HMV A;  2R2T A;  2H5I B;  3JS9 A;  4DWI A;  1YRU A;  4YY3 F;  1ZBT A;  2CZ9 A;  2MYF A;  3C6T A;  3LO3 A;  1U0H A;  4IYQ A;  5KT6 A;  4DG1 A;  1RHM B;  3LAK A;  3RR7 A;  2IRX A;  3IC1 A;  1KVJ A;  2VL1 A;  3P5B P;  1N34 J;  2RKI B;  1WF0 A;  2NSC A;  4LSL A;  3TX0 A;  1Y4Z B;  3DDN A;  4ETZ A;  1PCA A;  2ZJP Q;  2J7K A;  1RAC B;  3T1H F;  2BJ3 A;  1D0E A;  4BLG A;  1LWC B;  1DTT A;  1SBR A;  3ILJ A;  3PAC A;  2DGU A;  3PW7 A;  1IKV B;  4H4O A;  2GC8 A;  3AOC A;  4WII A;  4W98 A;  4J9L A;  2IC3 B;  3K5N A;  4ZVU B;  2BJ8 A;  4PWW A;  4Y2K A;  4O4R A;  1IKY A;  2C22 A;  3F73 A;  1VQ8 S;  5I3U B;  3AQP A;  2COL A;  1ZYQ A;  3M9M B;  1YBU A;  1S1W A;  2Q6B A;  4P6Q A;  1XNQ F;  3KMQ A;  5KFE A;  1KQS R;  3NCQ A;  2G1D A;  3KFW X;  4OLP A;  2WBR A;  4C0H A;  2ZM6 F;  1VIX A;  2J0X A;  4FYV B;  4Q44 A;  2MKS A;  1HPZ A;  2BAB A;  2OP5 A;  2B4U A;  2IM0 A;  3CCE S;  4F3M A;  3AY0 A;  1UET A;  3KK2 B;  4TLR A;  1C4C A;  1CJT B;  4DPU A;  4I68 A;  4FXW A;  5KG3 A;  2V69 A;  3G87 A;  4OZ5 A;  2KI2 A;  3G71 S;  1UTA A;  4P7T A;  4ED5 A;  3DU5 A;  4ZCM A;  2EFV A;  4WIQ A;  3HSZ A;  1K73 T;  4KQZ A;  3WX4 A;  2ZOG A;  1J5O B;  3DLB A;  4NCA A;  5KFA A;  2MGZ B;  2AQ4 A;  2VOD A;  5AXK A;  4ZCL A;  3CTR A;  3H98 A;  5D0R A;  2HVI A;  1BQM B;  3UR3 C;  5HLF B;  4DX6 A;  4IH5 A;  4ED0 A;  3HHL D;  4CO5 A;  3BPS P;  3H7H B;  1RWM B;  1U2C A;  4GKK F;  3D1H A;  4WXO A;  1M90 T;  1LWC A;  2VPZ B;  4PYA A;  4E0D A;  4OX9 F;  3JAM Y;  1RWO B;  3VAJ A;  4HLB A;  2NUU G;  3BGF A;  2BQU A;  2P9E A;  2ZH9 A;  2F8M A;  3NGS A;  3HI9 A;  2IC3 A;  2C3P A;  3M05 A;  3R7B B;  1VRQ C;  3NGU A;  3KLV A;  2RDJ A;  3VAK A;  3M8Q B;  2QL9 B;  3OUY A;  1FVQ A;  2HWT A;  1F9E B;  5I3U A;  1X31 C;  2ZIT A;  2XEX A;  2VOP A;  3BQ0 A;  4JOU A;  1TMM A;  1EHW A;  2DEJ A;  1HAR A;  3RUB L;  2XI3 A;  4DPW A;  3C2P A;  5KFR A;  2E1M C;  2AIR B;  1NEE A;  2NXJ A;  2UXC J;  5K8O A;  4EO8 A;  1HQE B;  3HHL A;  3FEZ A;  3MED B;  2XLK A;  5IWA F;  1YI2 S;  4RKU C;  2BUN A;  1NKB A;  2NCK L;  1KP6 A;  4EZ9 A;  5KG5 A;  3CNQ P;  1HWJ A;  5CA5 A;  1CJT A;  2UUB F;  1FI4 A;  3MZI A;  3B4D A;  2V68 A;  4QR1 A;  2YKP A;  4F2S A;  4A8O A;  3I5B A;  2CXE A;  4WU3 A;  4Z2X A;  2RNE A;  5JMN A;  4CI0 B;  2MMY A;  1K1Q A;  3N5F A;  4ZVE A;  2BQR A;  1CJK B;  3HCX A;  1S4E A;  1NDC A;  4DL3 A;  4XAK A;  3P8B B;  1U8S A;  4DR6 J;  3I0R B;  3W63 A;  1BQM A;  4DR2 J;  5ETK A;  5HLF A;  1RZM A;  2MLX A;  4LF5 F;  1S6P B;  2AF6 A;  4FPI A;  2ZD1 B;  3CJS A;  1VBY A;  3QRR A;  1JWW A;  4F50 A;  5D8H B;  3MCO A;  1Q5V A;  3K5O A;  2V50 A;  5A8K B;  1H38 A;  1RT4 B;  3JTO A;  2PD1 A;  3TEG A;  1NHK L;  4ZDN A;  3FGV A;  2C3Y A;  1RT5 A;  1QTM A;  2AZ3 A;  3VQS A;  2P5V A;  5F3T A;  3V6D A;  3KLH B;  2M52 A;  2CQ4 A;  3MR3 A;  3JQM A;  4JV1 A;  2IA6 A;  3RB0 A;  3TQE A;  1N36 J;  2JVO A;  1S6U A;  1TL1 B;  1QAJ A;  1OY8 A;  2BJ9 A;  4DF4 A;  5JUM A;  1DY3 A;  4YUD A;  1HQE A;  4LQ9 A;  3R1H A;  1EX8 A;  3MED A;  5C5J A;  2G4B A;  3SSR A;  3FKB A;  5L39 A;  2VD3 A;  5IM0 A;  1FKO A;  2CZ4 A;  1IKX A;  2L08 A;  3MDF A;  3DHW C;  1OQ6 A;  2M5Y A;  3DOK A;  3KYL A;  2MY7 A;  4KC5 A;  5K5M A;  1DBD A;  2UVV A;  2VFS A;  1WSV A;  3GR1 A;  2HIY A;  4X84 A;  2I1R A;  3DLJ A;  1MWY A;  3S7R A;  4NLD A;  2HFZ A;  5K9F A;  2W2M P;  4X4O A;  5IS2 A;  3M8W A;  2CZV C;  2B4V A;  4FZV A;  4KKO B;  2DXE A;  4PEO A;  3QFW A;  1LW0 A;  4I6W A;  5A6P A;  2ROE A;  2F9J A;  3THP A;  3GWC A;  2ZD1 A;  3L7O A;  2MZ1 A;  4M5D A;  3MM8 B;  3H5S A;  2AJ0 A;  2HAI A;  2HG4 A;  5KT7 A;  2E1R A;  3QZ7 A;  3R8Y A;  3QJL A;  4UY8 T;  2V4Q A;  1B70 B;  1FD2 A;  3EDQ B;  4NYP A;  3NP5 A;  2CDQ A;  4OJ1 A;  1RT4 A;  4PUO B;  4LF9 F;  4ES3 A;  3LTO A;  1DZ5 A;  2CPE A;  2HK3 A;  3FEY B;  3KLE B;  1KN6 A;  3P4U B;  4Y2M A;  2YNI A;  5LL6 d;  2MLZ A;  4CH7 A;  2ZHB A;  4TY9 A;  3OL8 A;  3DGP B;  4MJK A;  3ZTP A;  5KG0 A;  2C3M A;  3ETM A;  1VGY A;  4ZVT B;  3CCU S;  3NGK A;  4BC9 A;  1TL1 A;  2MQQ A;  1SQG A;  3RW7 A;  1RWX B;  2AYG A;  5LOQ A;  1D8Z A;  4CO2 A;  3H20 A;  1FDA A;  2P9G A;  1YBA A;  1Z1Z A;  5DZ7 A;  4NE9 C;  2DNO A;  1LXJ A;  1SJR A;  3GJQ B;  4ZVR B;  2OPP B;  4NPO A;  1ZS6 A;  3H5X A;  1XMO F;  4OYO A;  2OKQ A;  3V6K A;  3QT8 A;  2EC2 A;  2RD5 C;  4DFK A;  1D09 B;  4F04 B;  4ZPV R;  3PRV A;  3CSK A;  3A8J A;  3TO8 A;  3ISZ A;  2CQB A;  3K0J A;  3HSG A;  2NXN A;  2RML A;  5HBM A;  4ECY A;  2VQE F;  2H51 B;  3IG1 B;  2K7J A;  3UCG A;  3QT6 A;  2PI5 A;  1REV B;  1SH2 A;  4ZLN A;  2IFX A;  3MMB B;  1RAD B;  1SKS A;  1P6T A;  2WOM B;  3KWM A;  3W8P A;  2LXI A;  1SB6 A;  4JI1 F;  1UP1 A;  2WW4 A;  1S1U A;  4OZN A;  2D1C A;  3R2C J;  4LRA A;  2PN6 A;  4FP9 A;  3J81 Y;  1RTZ A;  4IRK A;  2KG0 A;  1CLF A;  5LT5 A;  4PR6 A;  5C42 A;  4ZVG A;  4IFV A;  2FTR A;  2QMU B;  3D4J A;  3U1M A;  1HBU B;  4PUO A;  2G0I A;  3P3D A;  5D4N A;  4HT5 A;  3T5H A;  3KLE A;  4NA3 A;  2HVE A;  5JJB A;  5D0E A;  2W2O P;  3UVJ A;  2DPJ A;  4YHH J;  3P96 A;  4A46 A;  5DDP C;  3DGP A;  2W4D A;  3DKD A;  1MG7 A;  4IO1 A;  4DV5 F;  1B3T A;  2C2D A;  1MN9 A;  3B8H A;  2FJE B;  4A47 A;  4YDX A;  1C4A A;  2J0S D;  1CSJ A;  4O3S A;  4RU2 A;  4B3T F;  3VAM A;  2O5D A;  4PYD A;  3MPU B;  3OVA A;  1PAU B;  3K8V A;  5IC6 B;  5HQL A;  2RDD A;  2OML A;  3AD9 C;  4JI2 F;  3KHH A;  4OI6 A;  1Q8B A;  2QA1 A;  6FDR A;  4NXM J;  1HLW A;  1QJH A;  5T14 A;  2FHO B;  3DMJ B;  2DH9 A;  3BSO A;  4Q2M A;  4QZV B;  3VR1 A;  1Y9O A;  5EWG A;  2ZWP A;  1DQ9 A;  3V81 B;  3VCD A;  4DV3 J;  4PG7 A;  1U48 A;  2OFG X;  5LMN J;  5GMK a;  1Q4R A;  1SIW B;  2RS2 A;  1NSA A;  2N7C A;  1K0V A;  2WTF A;  1WKK A;  1XBW A;  2KL8 A;  2WB4 A;  2NUH A;  1YVF A;  4NLX A;  1RDR A;  1J27 A;  2BAC A;  1TTH B;  1REV A;  3MMC A;  4DSF A;  4ECR A;  4Q5V A;  5GAE U;  4IOA Q;  4C8Y A;  5CCL A;  2DNM A;  4LMZ A;  1AT1 B;  1RCX B;  4G1Q A;  1S77 D;  1N52 B;  1Q16 B;  1WOR A;  5KT4 A;  3WC2 A;  4M5M A;  2YQ0 A;  1IKW A;  3J7Z 5;  1T3N A;  1KQK A;  2UXD J;  4DR1 J;  4IO9 Q;  5HN0 A;  1HBU A;  3OTB A;  5J2M B;  1V6H A;  4ED8 A;  1CPZ A;  3M32 A;  1F60 B;  1SC1 B;  2ZC4 A;  1H73 A;  2CJQ A;  4MYT A;  1NK0 A;  4I0W A;  2MZT A;  4OFZ A;  5A8W B;  1C2P A;  1XWL A;  3LWM A;  3Q2S C;  5KFT A;  1RCO B;  1NK7 A;  5LJ5 Y;  1VJW A;  2KG1 A;  3LF0 A;  2WCX A;  1DUR A;  4FXD A;  2ZE2 B;  4DX5 A;  4OJG A;  1EKS A;  5AJ3 J;  1RHK B;  2K3K A;  3IAS 9;  2UUC J;  1Y5I B;  1SI9 A;  1XJW B;  3CJ8 A;  1RK8 A;  2YX1 A;  4ZKA A;  2YKO A;  2PFF B;  2HW3 A;  2BJ7 A;  2F5G A;  3CJ5 A;  1GQE A;  1WG5 A;  2XHC A;  3CMQ A;  1WKL A;  2D69 A;  4WF9 Q;  1T94 A;  2DIS A;  1SH0 A;  3GPA A;  1N5V A;  1RAI B;  2E44 A;  1FF2 A;  4DZ6 A;  3QGP A;  4X4U A;  3IO1 A;  4KIA A;  1FE0 A;  3DMJ A;  3JSR A;  1AFJ A;  4DR4 J;  1O51 A;  3H25 A;  4K4Z A;  3I32 A;  4LSZ B;  2HS3 A;  3V81 A;  2MDA A;  3MTJ A;  3DLG B;  1TUV A;  1HNZ J;  2M8D B;  3K8W A;  4MIA A;  1FKP B;  2ASD A;  3OJU A;  3H2L A;  5F8H A;  4K4W A;  4GKJ F;  1SKW A;  1NHU A;  1VQK S;  1EAR A;  2DBB A;  3RG6 A;  2KRB A;  2E9T A;  4RUH A;  2DR6 A;  1C1B A;  2WAQ D;  4J90 A;  4O44 B;  2DHG A;  2AEM A;  3CDE A;  4I64 A;  1DAR A;  2DIV A;  1FDD A;  1R89 A;  4GRS A;  1K1S A;  5KFY A;  1GEH A;  4RW4 B;  2XMV A;  2KJV A;  3KJN B;  3WZ0 A;  3CCQ S;  4R5P B;  2AJ4 A;  4PQU B;  4OZ0 A;  2KVQ E;  1VR6 A;  3MEC B;  2MKI A;  2DVI A;  2BKP A;  2AJF E;  5J2M A;  2MHE A;  5BYR A;  5J1N A;  4U7U D;  2RIL A;  3SQG B;  4ZVP B;  3FVY A;  2ZVI A;  3CPW R;  4RW6 B;  3OR2 B;  2LU2 A;  2CPH A;  2RS8 A;  4TKT A;  2ROG A;  1S4F A;  4JP8 A;  5A8W A;  5SZT A;  3VVT A;  4UUX A;  4RR5 A;  2ZC3 A;  4KR0 B;  5B0G A;  1K44 A;  1VQ7 S;  3RYL A;  2OPQ B;  2YKA A;  5D3G A;  1XR5 A;  1NBE B;  1JLQ A;  3OQ2 A;  4QIG A;  4YEA A;  1AXQ A;  1I1G A;  4GO7 X;  2ZNZ A;  1WHY A;  1VQN S;  3QSI A;  2DNN A;  1HBO B;  1P9Y A;  4C7Q A;  3A8E A;  3SI8 A;  4IQX A;  2HFS A;  2CKW A;  3O5T B;  3DCA A;  2HGN A;  5GAD I;  1YJU A;  5CXT A;  2HGL A;  1CUL B;  1N0V C;  1JXV A;  4PCQ A;  4NWB A;  4DL0 C;  2R7V A;  1XMB A;  5M2R A;  4DV6 J;  1FKP A;  3QAU A;  3P6Y C;  2RQM A;  3N4W A;  2VKZ G;  4YP3 A;  1S0V A;  1XN9 A;  2DCL A;  3KHL A;  2FQQ B;  1N8R T;  4O44 A;  2PSZ A;  2FVC A;  2DGT A;  3ONQ A;  4LRB A;  5L1J A;  3DXB A;  4PG6 A;  1RAE B;  1FRK A;  1V3R A;  2JNJ A;  2VFU A;  4B3M F;  4LIW A;  2ZBI A;  3ENA A;  1F3V A;  2K8G A;  4B3R F;  3IBW A;  5IT0 A;  1UVI A;  1WUU A;  1T9Y A;  2K3I A;  2X1F A;  5F8G A;  4R5P A;  2XCA A;  3BM7 A;  3QJJ A;  2Z4P A;  3MEC A;  4DI6 A;  2BE9 B;  3M9N B;  1Q81 T;  2IHR 1;  3SQG A;  4HKQ A;  4WTY A;  3MWB A;  2DNL A;  2QA4 S;  4DLE A;  3TAQ A;  3OR2 A;  1J2V A;  2JRS A;  1R0A B;  1WC4 A;  1GH8 A;  3E8O A;  2ZBQ A;  4G65 A;  3R5D A;  4YDD B;  1R43 A;  1F5A A;  2ZZN A;  1URR A;  3E2E A;  4DCO B;  1JLA B;  4USH A;  2OHD A;  2UUA F;  1FX2 A;  2XQC A;  2HHX A;  2FY1 A;  2OPR A;  1F3F A;  4YOE A;  3HVT A;  1NKE A;  4ZJO A;  1VRT B;  1UZH A;  1FTC A;  1N5T A;  3WDO A;  3QGI A;  1S10 A;  3MR2 A;  1HBO A;  1EQM A;  1IXK A;  5B0E A;  9RUB A;  4NL5 A;  2B0G A;  3KLF B;  5HVF A;  2DR5 A;  2CQ1 A;  2ZUG A;  2AT1 B;  3MD3 A;  5E3A A;  3UW1 A;  4NEY A;  2HVD A;  5L1I A;  2W9B A;  2CFX A;  2G9O A;  4USI A;  3E3X A;  2ZBP A;  1Y3K A;  1TP7 A;  1QD1 A;  3GMG A;  3N28 A;  4UTG A;  2Q79 A;  2YNF A;  5IV4 A;  2ZZT A;  4JI5 F;  2VPX B;  5SUH A;  4DV7 J;  1HQU B;  2YKM A;  3QQC D;  2N3L A;  5IOL A;  4OV6 A;  1HWK A;  1CJU A;  1J5E F;  3GCW P;  5BXI A;  3N6N A;  2N4C A;  3PYD A;  2M2B A;  1KSP A;  3MTK A;  5BR8 F;  3AJ1 A;  2W9C B;  3M30 A;  2FVR A;  4ZCI A;  4Q8F A;  4GMK A;  3NS5 A;  2L9W A;  4O0I A;  4JV5 J;  1JLG B;  3GG1 A;  4RNM A;  1CVJ A;  2OEL A;  1YZ7 A;  2K06 A;  4RJV A;  4CZC A;  2E9R X;  2M88 A;  5GMD A;  4YR0 A;  1N32 J;  5DQI A;  4ZPA A;  2HHT A;  5J1P A;  3OL9 A;  4LF2 A;  3KUE A;  5HMY A;  3TA2 A;  3QLH B;  1FFG B;  4Y2I A;  2H5J B;  4IQM A;  3F41 A;  3VAI A;  4RLE A;  4YY3 J;  4NXN F;  1JLA A;  4Q8E A;  3JQJ A;  2O1P A;  1QSL A;  4AFF A;  2ZH7 A;  2R8J A;  3W9J A;  3CDW A;  2K2P A;  4HHH A;  3VGU A;  4F8R A;  4EYI B;  2ZJR Q;  4ZS6 A;  4A8W A;  1T95 A;  3DDK A;  1O0P A;  2P6T A;  4WK1 A;  3H4B A;  2XNR A;  1CQN A;  1FA0 A;  1BWV A;  1UVJ A;  3DYA B;  3CD0 A;  8AT1 B;  1T0T V;  1SIZ A;  2D9O A;  4FKX A;  1G1X A;  3PXG a;  1VHI A;  3DLH A;  2R8H A;  2YKN B;  1BQX A;  1IM4 A;  1HHQ A;  3PO4 A;  3SBM A;  1YIT S;  3CCJ S;  4BS2 A;  4FYX B;  4ELV A;  3D66 A;  3BGR B;  3MOJ B;  4USV A;  3EZU A;  2AW0 A;  1C0U B;  1Q7L B;  3IWX A;  2JEF A;  4RW7 B;  3RB4 A;  4B9M A;  3O6Q A;  3DHX A;  1BXN A;  4JI4 F;  2B9X A;  2AWZ A;  2W9C A;  4U9R A;  4LT6 A;  2CRL A;  1D9F A;  5HAT A;  1NUE A;  1B64 A;  2Y0B B;  2ZM6 J;  2JHE A;  2FHJ D;  1NK5 A;  2H9Z A;  1QVG R;  4JI7 F;  4CO0 A;  2CG4 A;  3BGL A;  2XZT B;  1HWL A;  3Q24 A;  3QLH A;  1XMQ F;  4ILL A;  1UJ6 A;  3CIZ A;  3IMQ J;  1L5U A;  1Y11 A;  1LXN A;  1VQS A;  4DDF A;  1RLD A;  5EWF A;  1OYD A;  2J7W A;  2DPI A;  5DQG A;  1GXU A;  2V4J B;  1PIL A;  4ATN A;  2BDP A;  4NLW A;  4CO4 A;  2XSJ B;  4L74 A;  3K5M A;  3BJY A;  3PZP A;  1YRX A;  5L1K A;  1WI6 A;  3AJ2 A;  4ZOS A;  2DGX A;  2QO3 A;  3IWL A;  1CBK A;  3R3T A;  1OY6 A;  1Q8K A;  4IR9 A;  2MQP A;  4OX9 J;  3ZC4 A;  4UOH A;  2HQD A;  1X4E A;  2FHJ A;  3SXL A;  1FXL A;  3MMA B;  1GXL A;  1AZS B;  4NLP A;  1U4B A;  3QJP A;  1C0U A;  1QE1 B;  2PI4 A;  2CNK B;  3GJS B;  5HAO A;  1RA7 A;  1QAI A;  3HKZ D;  2EFO A;  2F9D A;  2RH3 A;  3IR6 B;  5CZX A;  3FFI B;  4PWD B;  2VBY A;  4I6A A;  3P5T L;  1H0H B;  4X4P A;  1T03 A;  3DI6 A;  3SV4 A;  5MAO A;  1LFP A;  5DS7 A;  4RNH A;  1XR6 A;  2BV3 A;  3T1Y F;  4J5O A;  1NPR A;  2UUB J;  3CJ0 A;  1EET B;  4HHU A;  3ITH B;  1Y3J A;  1YIJ S;  1RWN B;  5ETO A;  5GME A;  4OQJ A;  5E2Q A;  1JX4 A;  5HMX A;  4BDP A;  3I5C A;  4RX6 A;  3ILI A;  2W2P P;  1TQL A;  2QYG A;  3NMA A;  3PVX A;  2A10 A;  2CG8 A;  4KGZ B;  4FDF A;  3DRP B;  4ZPW R;  3THT A;  3NCP A;  5HP1 A;  3TX8 A;  5IFM A;  3K59 A;  1KD1 T;  4RW8 A;  1Z2L A;  5BYQ A;  2XSJ A;  2IBK A;  3OJS A;  4NCG A;  3VAL A;  1TR0 A;  3EDR B;  2Z58 B;  3CIM A;  1T9X A;  3ZZT A;  1QUP A;  2E5H A;  1WSR A;  1AFI A;  2HVH A;  3A1Y G;  1NSK L;  1NU4 A;  4QR2 A;  1H72 C;  4C9D A;  2J0Q D;  2H65 B;  2HFO A;  1N33 F;  4UY8 5;  3PG9 A;  3MMA A;  1VQP S;  1HFE L;  1AZS A;  3HFZ B;  4AL6 A;  1E6Y B;  5HAN A;  4KPC A;  1NSP A;  2V34 A;  2VPY B;  1QE1 A;  2XMT A;  3GYN A;  1RE1 B;  1ZM3 A;  3QWU A;  3UI3 A;  3AD8 C;  5ETQ A;  3FFI A;  4PWD A;  1VS3 A;  4NZ7 A;  5KG6 A;  3NXZ A;  4J9N A;  4XTT A;  2LA4 A;  2UXC F;  2V63 A;  5KFB A;  4NLV A;  3O3L A;  2XYP B;  3PFE A;  4DS4 A;  1M5O C;  1S0N A;  2PMH A;  4NLO A;  3PJW A;  3N79 A;  3ZTO A;  4FXV A;  2I0X A;  2GGP A;  1DHM A;  1FJG J;  1WHV A;  1LFW A;  3DOM A;  4U7U K;  5FLX Y;  1RYR A;  3MPW A;  3ITH A;  5KFI A;  1OQ3 A;  1WEL A;  1H6K X;  4AL5 A;  4OV1 A;  4CDI A;  2MKJ A;  3H5Y A;  1MNE A;  1I94 J;  2B6A B;  4RW9 B;  4KV8 B;  4C11 B;  5F41 A;  3NS7 B;  3DRP A;  3V2U C;  2JDJ A;  4DR6 F;  2IY5 B;  3JSY A;  1JNR B;  5KT2 A;  2X7I A;  4DR2 F;  2DNK A;  4O4G A;  4OHY A;  1V5V A;  4QYR A;  5C24 A;  4NAS A;  2PEB A;  3VZH A;  2GMJ A;  2FJW A;  1QDU B;  2E7V A;  2V8P A;  3KKF A;  2YWK A;  3CGI A;  2NRE A;  2Y3Y A;  2RB7 A;  1MWZ A;  2C28 A;  3OV7 A;  4UOC A;  4ID5 A;  1W2B R;  2HEK A;  1AB8 A;  4B3O B;  2UV8 A;  4LF9 J;  4ERD A;  4HDG A;  1RAH B;  4B17 A;  1NRK A;  2BR0 A;  2FD2 A;  1FCA A;  1S7I A;  1KHW A;  1P1T A;  3W2V A;  4P7V A;  5KT3 A;  3CMA S;  1SL2 A;  2LVW A;  1XEZ A;  2QLX A;  3ZZU A;  2XS2 A;  1BMQ B;  3HT0 A;  2EEY A;  3TAM A;  1RT6 B;  1TL3 B;  3HSD A;  1RXO B;  2ZEJ A;  4Y2A A;  1UEK A;  4C97 A;  2XSF A;  1X60 A;  4IDK B;  1FKA F;  3TEH B;  4LRE A;  5HI7 A;  1M1G A;  1RTI B;  3R5G A;  2GNK A;  4F02 A;  2FJD B;  4JI3 F;  1XMO J;  1I6J A;  3AXM A;  2BZ2 A;  3MAH A;  1U47 A;  2B6A A;  1KS2 A;  1SQE A;  4C11 A;  1TKX B;  3HHL C;  1NK9 A;  1FHT A;  3SQO P;  3L7P A;  3CCL S;  3DLK B;  4DFJ A;  5F9N A;  1UEV A;  3D9B A;  3IGV A;  4A8Q A;  3KDN A;  1HNX F;  2FIU A;  3MEG B;  4FNI A;  1I5O B;  5KTQ A;  2EI5 A;  2PT0 A;  3AA8 A;  4ZP6 A;  2RQ4 A;  5AE1 A;  4DR5 F;  5GAH U;  3RZA A;  4K2X A;  3EVW A;  3Q83 A;  2D3O 1;  1JJ4 A;  2LQJ A;  4CCH A;  4X4T A;  3W66 A;  2KKH A;  1VMB A;  1F1B B;  3KOA A;  1RAA B;  4LR7 A;  4RPF A;  1E6V B;  4DLG A;  3X1L B;  4G3I A;  4RBT A;  4ZHR A;  4YB7 A;  1GTH A;  5A2Q U;  4QYZ J;  1UVK A;  3GJT B;  2XZW A;  2AP6 A;  3JSM B;  1RGV A;  2BOA A;  5DG8 A;  2AMC B;  1K47 A;  4KE5 A;  4B3T J;  2HPU A;  2J76 E;  4FKY A;  1SQF A;  2QYC A;  3TNV A;  3DNC A;  3AOA A;  4AXJ A;  3MPD A;  3H42 A;  2W7O A;  2MZQ A;  1AUD A;  4JI2 J;  5KFK A;  3OXF A;  1RP5 A;  1ZZF A;  1MRO B;  4CLZ A;  2DHH A;  3GSD A;  4IDK A;  1RTI A;  1YJR A;  1LWE A;  2C2N A;  4MIW A;  2MJN A;  2CYY A;  4OX7 A;  1JLE B;  5THW A;  3P45 B;  2B56 A;  2W7P A;  4I2Q A;  4MK8 A;  1X5P A;  1K9M T;  5AXM A;  1N54 B;  3HSJ A;  4FS2 A;  1A0O B;  2GZO A;  1OY9 A;  2AYE A;  3CWJ A;  2D3O R;  4O3R A;  3C6U B;  1MML A;  3DLK A;  1GK8 A;  3SCJ E;  4U67 Q;  4OJ3 A;  2FGC A;  1YKW A;  1S76 D;  1M0S A;  1RT1 B;  9ATC B;  3IWN C;  1NSQ A;  5GAE I;  4DL2 A;  3ZZO A;  3POT A;  2HNZ B;  1JJH A;  2IIH A;  4HAC B;  2NXC A;  2KYX A;  2ZWO A;  3QNW B;  3BKU A;  4DPY A;  3C16 A;  2OGU A;  2HMI A;  3M6U A;  5K14 B;  3PEJ A;  4EO6 A;  1X4F A;  3BN7 A;  5HK4 A;  1OPZ A;  3HMJ G;  1XIQ A;  3D1O A;  3JYT A;  3HPO A;  1F6T A;  4JBC A;  4MFB A;  4F4A A;  2HGM A;  5FJ4 A;  4ZLL A;  1RWW B;  2BYC A;  4U7C A;  1E6V A;  3GFY A;  5LJ3 Y;  1RSC A;  4BC7 A;  1LV5 A;  3CD6 S;  2R3V A;  2EBG A;  2AD9 A;  3DN9 A;  2ILY A;  5F9L A;  2Y8W A;  1PJ6 A;  2Z57 B;  4LBH A;  4B9N A;  3TUJ C;  4CWB A;  4CM0 A;  3JSM A;  5I42 B;  2F4V F;  1SC3 B;  1UVL A;  5D6G A;  4O3Q A;  3I6P A;  2QN6 B;  2Y1J A;  3EIC A;  5KOX A;  4LSN B;  4HR2 A;  1HR0 F;  1HKA A;  2XY7 A;  2HNY B;  2RRN A;  5HL7 Q;  1APS A;  4WP8 A;  3D6M B;  4LFB F;  4NXM F;  4NLS A;  1GT8 A;  1RKI A;  2H48 B;  1RBL A;  1MRO A;  2VDI A;  3KLI A;  2FB0 A;  3TWZ A;  1FTR A;  1FJC A;  2LQ8 A;  2HFV A;  3MFH A;  4DV3 F;  3IAM 9;  1WF1 A;  1JLE A;  3ZTR A;  2A2C A;  3J80 Y;  1SJ1 A;  3M6V A;  3OXG A;  2NQP A;  1R6V A;  5D4L A;  1GNK A;  2W4C A;  4GKJ J;  2W01 A;  3C6U A;  1RT2 A;  4WPA A;  2V8H A;  2JEJ A;  3N01 A;  2RF2 B;  2LXU A;  1LW2 A;  4F26 A;  1TKZ B;  3HKW A;  3I4H X;  5E3P A;  1YRT A;  2RIJ A;  1U49 A;  1UMJ A;  1RT1 A;  3D28 A;  1N0U A;  1RAO A;  2MST A;  2VA3 A;  1UZD A;  1ZET A;  3SV3 A;  2FHK A;  3CC4 S;  2R8K A;  5CHC B;  3QBC A;  1KOO A;  3TUZ C;  4H4M B;  2MB0 B;  2MKH A;  2CQD A;  1F5B A;  3J7A 1;  4AND A;  4DR1 F;  5K14 A;  3WIV A;  2HFN A;  4QIF A;  1NND A;  1G3O A;  3HF5 A;  3OLA A;  2DY1 A;  3ZNU A;  2CUY A;  3EX7 B;  1EJ7 L;  3TZX A;  2EPI A;  1KC8 T;  5DGB A;  4QBU A;  1R8C A;  3IGN A;  2VIH A;  2EBE A;  3BSA A;  1U2F A;  4QPT A;  3KK3 B;  2PO4 A;  2B4P A;  4A4J A;  4DPO A;  4RWW A;  3C3L A;  3AOB A;  4R8U B;  3W7B A;  4UUW A;  3TAP A;  1RBO B;  5I42 A;  4BCA A;  1TU0 B;  2NPI A;  3NG8 A;  4K5S A;  1YZ6 A;  2OIH A;  1HNI A;  4LSN A;  4WBF A;  2ROP A;  2HNY A;  3LW5 C;  4K4U A;  4FF2 A;  2JFD A;  1G7C B;  3EGV A;  3R5A A;  3SDE A;  2Y1L B;  2CWX A;  2OUG A;  5HVG A;  2W8L A;  4DV4 F;  2J6S A;  4I4B A;  1IBC B;  3GV7 B;  3MEK A;  2B5J A;  4PPZ A;  4ZA1 A;  4U6P A;  2UXB F;  2IAJ A;  4FF1 A;  1X4G A;  2SXL A;  1HBN B;  1R8A A;  5DQH A;  5ADZ A;  1NB2 A;  5FII A;  3PRD A;  2RF2 A;  3P49 B;  1W26 A;  2VG7 B;  3BR8 A;  3I0S A;  3FRZ A;  3R6L B;  3NNH A;  3GTY X;  1WC0 A;  3OXL A;  4B3M J;  4UF4 A;  2RAQ A;  5IV3 A;  1F5C A;  2Q6C A;  2RQC A;  4WKY A;  1KVK A;  4B3R J;  3CDB A;  2C1E B;  2JJ4 D;  3PR4 A;  4F4Y A;  2YWE A;  4Y6I A;  3GV8 B;  1NJX A;  3AAW B;  3KK1 A;  1JJC B;  3S8S A;  1WEY A;  3CT9 A;  2ZH8 A;  3D1Q A;  3FEX B;  4TY8 B;  1HIY A;  3H90 A;  2DYA A;  2JZ5 A;  4TVA B;  4IFY B;  3SMZ A;  2QLF B;  3BQ1 A;  2DH8 A;  4HDH A;  5A8R B;  2DD8 S;  4OZ2 A;  3KK3 A;  3MM9 B;  2N3O A;  3QZ8 A;  5DM7 Q;  3FCW A;  1MMD A;  3B6B A;  2VBW A;  2QG9 B;  2GAH C;  3I4P A;  1ACM B;  4DSI A;  5KFG A;  2ZH2 A;  2LDY A;  2G13 A;  1FNX H;  2VG5 B;  4ZLP A;  5CYQ B;  1NK8 A;  1SV5 B;  4F0K A;  2B9W A;  4P2S A;  5KFL A;  4DQR A;  1WOO A;  4ZK7 M;  4ALZ A;  2FLL A;  4ETX A;  4DV6 F;  2VFR A;  3OSP A;  3TZW A;  2FGO A;  5KAK A;  2HHU A;  2CPZ A;  4DQQ A;  1HBN A;  3H8Y A;  1RA6 A;  1S9F A;  2YWW A;  4MAK A;  2YWG A;  4C8K A;  2DRD A;  1SVD A;  4QWA A;  4XPC A;  2FPH X;  2XY5 A;  2KZM A;  1RLC L;  1WHX A;  5J2Q A;  2FJX A;  2BE2 A;  2DNR A;  4DXL A;  2N82 B;  2BJD A;  5DM6 Q;  2KXH A;  3W2W A;  1S6Q A;  2BXJ A;  2GQC A;  2RRB A;  3BDE A;  3QGH A;  4N56 A;  4K59 A;  3VV2 B;  3CUL A;  2LQB A;  1QAX A;  1YDL A;  2VF3 A;  1VC5 A;  2A18 A;  5IT9 U;  2RUS A;  3LP0 B;  2VB6 A;  1P8G A;  2FZC B;  1UFK A;  2QMX A;  2DNY A;  4YB1 P;  3VAG A;  3H2U B;  3BBB A;  1XNR J;  4NMX A;  4IFY A;  1WEZ A;  3GIR A;  3R7N B;  3C6T B;  2KT2 A;  2PA3 A;  4OYM A;  2YWH A;  4DG1 B;  1NCL A;  2X1G A;  3VVU A;  4DV1 F;  4NXN J;  2JX2 A;  2QL7 B;  1V3S A;  4TU9 A;  3V4I A;  4RWX A;  4PQA A;  4A8X A;  4F3Q A;  3BBF A;  2KU7 A;  2HZC A;  4DV0 F;  2HHQ A;  5ETL A;  1JXE A;  3ZZZ A;  2VG5 A;  1U1Q A;  4K4T A;  1SC6 A;  3PX0 A;  2ZJQ Q;  4DSL A;  3UD4 P;  1YJW S;  2QL5 B;  1M5S A;  3GV5 B;  1W25 A;  1NZ8 A;  2GCF A;  4G1P A;  1IJF B;  5L46 A;  3TA1 A;  3B4M A;  1ITP A;  2MKK A;  3MPV A;  1KRP A;  1NHV A;  4L3K A;  6AT1 B;  3HZG A;  3UDV A;  2HQ3 A;  5D78 A;  1S57 A;  4B9S A;  2R8I A;  5HSP A;  4QIV A;  2GA7 A;  4HEA 9;  5M2U A;  4N76 A;  4EZ6 A;  2HWH A;  2DY9 A;  2E7X A;  3CJR A;  4HL9 A;  5ETR A;  3PIP Q;  3C14 A;  1VRU A;  2O3D A;  2VKR A;  2B9E A;  2FC8 A;  2J9E A;  2WBM A;  1JJ2 R;  4X65 F;  3OVB A;  3ZZP A;  3RAM A;  4KH1 B;  1GMU A;  1FER A;  5E3C A;  5E5N A;  2YNH B;  4JV5 F;  5IC4 B;  2BQ3 A;  1HPZ B;  3LH2 S;  2Q1L A;  1FFS B;  3VAF A;  5J2P A;  1NXI A;  2FVP A;  2JL9 A;  1BQN A;  3KDO A;  1N32 F;  4WFX A;  3TUP A;  4ECW A;  2GHV C;  4JI7 J;  1XC9 A;  4ES2 A;  3LP0 A;  5B0F A;  3DRY A;  4P71 A;  2D41 A;  1T9U A;  1Q78 A;  3QAE A;  1M5P C;  3H4D A;  1XMQ J;  4FYY B;  5LSR A;  1UPM B;  2RE1 A;  4JYA J;  2LP4 A;  2VFT A;  4IG0 A;  3M1V B;  1HHT P;  5CYJ A;  2MSS A;  2I9S A;  3A13 A;  3EE3 A;  3OFG A;  4EEY A;  2PEH A;  3PDN A;  2MQO A;  3R7S B;  4IOC Q;  3PW5 A;  3UN3 A;  2B4O A;  2YQ1 A;  3R5B A;  1K0T A;  2YWF A;  3JB9 k;  2YVS A;  3ENV A;  3RBD A;  5D0G A;  5F0U A;  4AYB D;  4BHQ A;  1HI1 A;  2JSX A;  4IG3 A;  4JI0 J;  3JAM U;  1PIE A;  2C3U A;  3FUY A;  3R1L A;  2JH3 A;  4M5G A;  2VC0 A;  1Y5L B;  4ZLJ A;  2RRA A;  2V2Z A;  3N6L A;  5KFC A;  4Y65 A;  3VTI A;  5KFQ A;  1F9H A;  4CH0 S;  5HQ8 A;  3OUY B;  4Y2C A;  1R31 A;  3HHD A;  4EBC A;  3BYR A;  1YJN S;  4NCB A;  3EVM A;  5K8M A;  4B9V A;  1TKD A;  2MZJ A;  4EWT A;  2VC1 A;  2ZUA A;  3HHK A;  4WP3 A;  1ZAX A;  5LM7 E;  2EFG A;  4RUC A;  2QX0 A;  1SCJ B;  2HLU A;  1RU1 A;  3UD5 A;  1DLO A;  1ZM9 A;  1TUG B;  2YNH A;  3QYY A;  8RUC A;  2JLG A;  3HHL B;  1HWI A;  3Q8U A;  1YJV A;  4CYU B;  3G6X A;  3T1Y J;  1WAC A;  4NLY A;  5MLC V;  1H2V Z;  3OVS A;  1B7Y B;  4I6Y A;  3G8Q A;  3MOZ A;  3EXY A;  1RB0 A;  1FRJ A;  3IR7 B;  2MPU A;  2HSE B;  2V6A A;  5ITH A;  3UNY A;  2VA2 A;  3OTE A;  1UPP A;  3UN5 A;  3ISN C;  4KGV B;  3M1V A;  3MCS A;  2CVI A;  4CLS A;  5EWE A;  4PWU A;  3FDS A;  2EWH A;  3D0I E;  2C3O A;  3IS9 A;  4J9M A;  4IKA A;  4L73 A;  1TVR A;  2M4M A;  4PG5 A;  4ECX A;  3HFV A;  3FMB A;  2Y9H A;  2IPO B;  2VU5 A;  1FWL A;  2OD4 A;  4KPY A;  2U2F A;  2OLW A;  1IWA A;  4UZC A;  3AD7 C;  1N33 J;  5H9F J;  3T6B A;  3M6X A;  3R2D J;  2M8H A;  2GHP A;  2IJN A;  3TAR A;  1RT5 B;  1S99 A;  2GQ2 A;  2PA8 D;  3V6D B;  1IQT A;  1GAO A;  2OPS A;  5KFZ A;  1SJQ A;  2DNZ A;  5KOW A;  2CQG A;  3JXO A;  4ZP7 A;  1JXL A;  2ACY A;  1RYS A;  4I2P A;  3G2X A;  2LA6 A;  4CYU A;  2R7T A;  3PW2 A;  5IM0 B;  1FKO B;  1NDL A;  1GMW D;  1U24 A;  3HFK A;  2VQF F;  1IKX B;  1RJJ A;  2BA9 A;  2WSC C;  4MT1 A;  1VQ5 S;  3DOK B;  3CJ4 A;  3A8K A;  2X1A A;  1R0C B;  2WB1 D;  1NLK L;  2HBR B;  2A1B A;  2CAJ A;  1X4B A;  2AX1 A;  1LW0 B;  5F3Z A;  4WFN Q;  1U6Z A;  1Q7Y T;  2RJZ A;  2IRY A;  4I69 A;  3LWL A;  4ZIW A;  4M5D B;  1HNW J;  4QJV A;  1ZZN A;  4LVN P;  3EGN A;  3J7Y U;  2QT7 A;  1RHJ B;  2CVE A;  3CJ2 A;  4F3O A;  1FO1 A;  1PBA A;  5HJX A;  1WC1 A;  2MQL A;  4NX9 A;  4ECV A;  3GCX P;  1GMW A;  4QWC A;  4CLL A;  1CQM A;  2HS0 A;  1JKH B;  3A4T A;  3PW4 A;  3VGS A;  2G2Y A;  2YNI B;  4F0H A;  4W90 B;  3G8S A;  5G4D A;  3W62 A;  1TL4 A;  3M9O B;  2DH7 A;  4F36 A;  3TZY A;  2NSB A;  5T7L B;  4FYD A;  3V5R A;  3C19 A;  2FLN A;  1REG X;  2M7S A;  2GO9 A;  2JOQ A;  4DBQ A;  2YH1 A;  2XWX A;  4HYK A;  1DAX A;  3G6V A;  1FJG F;  4LF1 A;  1TFW A;  2YBV A;  3W65 A;  5ETN A;  2MTL A;  2JLF A;  4NYO A;  4CP5 A;  4JI3 J;  1C1C B;  2GJF A;  1Q8L A;  2VBX A;  2CQI A;  2RVJ A;  3GIJ A;  5F0W A;  1I94 F;  4M5I A;  3MUT P;  2VG6 B;  5HBM B;  2YXL A;  4ELT A;  5IZH A;  3HX9 A;  1WC3 A;  3O1L A;  1KLM A;  5A2Q Y;  5EX0 A;  3NBP B;  2NLW A;  3L7U A;  1VQM S;  3R6G B;  1HNX J;  4KTQ A;  2GX8 A;  4ED4 A;  1T11 A;  1S1U B;  4EFA C;  2IDE A;  2KFZ A;  3R9L A;  1FX4 A;  4EMD A;  4P75 A;  4W92 B;  5C42 B;  3J81 U;  4IFV B;  1EZZ B;  1GTE A;  4KFB B;  3C46 A;  1U1L A;  4DR5 J;  2GQQ A;  5GAH I;  2ZHA A;  2MHN A;  5EGY A;  4WK3 A;  2XG8 A;  1F2H A;  4RBU A;  2DNP A;  1VYA A;  3DDI A;  1JKH A;  3BO3 A;  4A8S A;  3MF5 A;  1TZ0 A;  1WD6 A;  3UVJ B;  4HI2 A;  1RU2 A;  3TVY A;  4CQ1 A;  3KHG A;  2VIC A;  1OPI A;  5L9X A;  2W24 A;  3AQO A;  5KT5 A;  5ETV A;  4GC7 A;  3T41 A;  1FNO A;  3QRQ A;  1LK7 A;  2EK6 A;  1X9W A;  5T7L A;  3UNG C;  3M8R A;  4EUV A;  2OFH X;  2DNQ A;  5LMU F;  2ZNY A;  1FEE A;  4FVM A;  2VZ9 A;  3PYE A;  3BH6 B;  4LF4 F;  3OTO J;  2ZKT A;  1TAQ A;  3HVA A;  1HI0 P;  1BLU A;  4KHM A;  5FDL B;  2YNG B;  3MEE A;  5IQQ A;  4ECU A;  3K7R A;  2GIQ A;  4M5H A;  2KN4 A;  4V19 X;  4DQP A;  5HJY A;  4DN9 A;  4RNO A;  3HVW A;  2XGP A;  2GVZ B;  3K57 A;  1C1C A;  3U27 A;  2CJ9 A;  2B7B B;  1IBM F;  2CPD A;  2DGQ A;  3PX4 A;  2VG6 A;  1TEL A;  2HLT A;  5CD4 A;  5KG7 A;  1S5Z A;  3PW0 A;  2KT5 A;  2XMA A;  5D15 A;  4ZMM A;  4X4V A;  2BW7 A;  4A8M P;  4JI6 F;  4B3S F;  1T7P A;  2J6U A;  4H4K A;  1M5K C;  2EFN A;  3MMC B;  4Z7C A;  3NBP A;  2ASY A;  2QIF A;  2CPY A;  2IM3 A;  1IBL F;  4E98 A;  5EN1 A;  4G1Q B;  1FES A;  2XO7 A;  3QWP A;  3LP2 B;  4WJB A;  5DRK A;  2F65 A;  1IKW B;  4OLO A;  3AT1 B;  4MKY A;  1T9W A;  4NRU A;  2QJ3 A;  1KWM A;  4KFB A;  1CS4 A;  2KM8 C;  3MGJ A;  5L9N A;  3M32 B;  2Z2M A;  1Q0N A;  2BE7 D;  3CO0 P;  5CQG A;  4L76 A;  1FVS A;  4CLY A;  4IUF A;  1U1N A;  3A8I A;  3KXD A;  3ZO7 A;  1VHF A;  3HUL A;  4YS2 A;  4X66 J;  1NPK A;  4P52 A;  4F67 A;  2CNN B;  4ED7 A;  4Q43 A;  2ASJ A;  4I56 A;  3FQK A;  2MQM A;  2F4V J;  2XMW A;  4K4Y A;  1YK9 A;  1X4D A;  3D3B J;  2WHO A;  2KHC A;  1SXL A;  1FXD A;  3A12 A;  2J9D E;  1HR0 J;  2DNH A;  1Q53 A;  4M8L A;  4LFB J;  1YTY A;  3D0H E;  3BDP A;  3WHI A;  5FDL A;  2YNG A;  2OJ3 A;  1ARO P;  3OL6 A;  3MM6 B;  2GVZ A;  5FD1 A;  2YQ3 A;  2Y1R I;  3VWS A;  1RHQ B;  3CCV S;  4P2M A;  1XER A;  4D3G A;  3M2V A;  1WKJ A;  1NJW A;  1Q5Y A;  1H74 A;  4TN2 A;  2G0J A;  5DJB A;  1C1B B;  1VBK A;  2V2V A;  1WJ9 A;  1KLN A;  4ITS A;  1BUX A;  2XWY A;  2E1P A;  3GFZ A;  4PKD B;  1WWH A;  3U1L A;  3EGZ A;  2HHH F;  4X4N A;  4FVC A;  3TRG A;  4USK A;  3LP2 A;  1IR2 A;  3GZ7 A;  2XCP A;  2HQI A;  2R2R A;  1BC6 A;  1VBX A;  3ULH A;  3D0G E;  3FK4 A;  2NXE A;  1BE4 A;  4KAI A;  2JFK A;  2Z30 B;  5GAD U;  4QU7 A;  1QUV A;  2I8E A;  2DXD A;  4G1I A;  3TAN A;  2YKQ A;  4HHJ A;  4KJI A;  2DO0 A;  5KFN A;  2E5I A;  1UWB A;  4OX8 A;  3DRS B;  2DGS A;  1VDH A;  2ZVS A;  2DR8 A;  2ZHO A;  5D3G B;  2ZDO A;  4OI0 A;  1JLQ B;  1MU2 A;  1FFW B;  3W5X A;  5KFP A;  1X9M A;  1SC4 B;  3W5Z A;  3NOG A;  3UQS A;  3Q2T C;  2ZDP A;  5E33 A;  3W8G A;  2IRU A;  1QTN B;  3LGH A;  4LR8 A;  3W5Y A;  4XIU A;  1JNZ B;  3PYF A;  4YR2 A;  2KXF A;  2AJ2 A;  5JXS A;  4CM2 A;  3GP9 A;  3MHY A;  3N6M A;  3FZB A;  3NY0 A;  1RAB B;  4KT0 C;  2GW8 A;  2JC0 A;  3OBI A;  1LNQ A;  3MM6 A;  4DV4 J;  4OIX A;  3TYT A;  4EK2 A;  3GON A;  4KGK A;  2KVI A;  2KXN B;  3MUV P;  1IQZ A;  4FS1 A;  2UXB J;  3N0V A;  4EBE A;  2QLW A;  4FN5 A;  3EUN A;  2XO6 A;  2HBQ B;  3VQT A;  1U02 A;  3KUG A;  3FMW A;  1N6Q A;  4KSE B;  3CD5 A;  2VOO A;  3ILO A;  3RB3 A;  1LKZ A;  1RAF B;  1JLF A;  1NDK A;  2QFI A;  2UU9 J;  3WX8 A;  3EJM A;  4NML A;  2FLO A;  2RUG A;  4X4R A;  3SIP B;  2V8D A;  1L3U A;  4C8Z A;  1WC5 A;  3NGT A;  2IJR A;  5J2N B;  2FJB B;  5KFX A;  3BN4 A;  4RU9 A;  4PG4 A;  2C2R A;  3FBB A;  2QA2 A;  2BVZ A;  2HND A;  2CJB A;  2R9L A;  4DF8 A;  3T19 A;  2FJV A;  2J5A A;  3DRS A;  2R7W A;  4MTP A;  2OPR B;  1MLA A;  3IM8 A;  5GAG I;  4E8U A;  3HJF A;  2HRU A;  3HVT B;  2GVD A;  3CD7 A;  2DGV A;  1FJ7 A;  2J8S A;  3KHR A;  4DR3 F;  4DU8 A;  5KG4 A;  1RIS A;  5A76 A;  2R7R A;  2CDR B;  3W9H A;  1BGX T;  3FBF A;  1H2T Z;  5KFW A;  1ZPV A;  5KFU A;  2W9B B;  1SJ3 P;  1S0M A;  4MK9 A;  2AEF A;  4X4S A;  4Y28 C;  3CC2 S;  4ICL A;  1OS5 A;  2YNF B;  2QFJ A;  4Z7Y A;  4KHP F;  3AFG A;  4AUK A;  4QYZ K;  2HS4 A;  2YKM B;  4TNO A;  1YHQ S;  2G0C A;  3G82 A;  1CJU B;  1EQ0 A;  3K89 A;  4C3K A;  1VQ6 S;  3M30 B;  3FJ2 A;  1PO6 A;  4GC6 A;  5H9E J;  1PJ7 A;  4DSJ A;  3Q8Y A;  4CRJ A;  2V0N A;  1S48 A;  2PE8 A;  1RT3 B;  1HNV B;  5DET A;  2NS1 B;  3D68 A;  5AE2 A;  5J2N A;  1HI8 A;  2HRT A;  1UA1 A;  3BZQ A;  2ADB A;  5B08 A;  3HT3 A;  1TKT A;  1VQY A;  4WCE Q;  4DR7 F;  1RQ0 A;  4DV1 J;  3BH7 B;  1ZM4 A;  1S9G A;  1U45 A;  2WRM A;  3D5M A;  4WP9 A;  3TI0 A;  2W2N P;  1NH7 A;  4NLQ A;  4DV0 J;  4O0N A;  3ISN D;  3R5J B;  4F4K A;  1Q1K A;  4ED1 A;  4DUY F;  5KFV A;  1KTQ A;  4J9P A;  2BOP A;  4ILM A;  2OD6 A;  4CLF A;  1H7X A;  3ZNJ 1;  1MMN A;  3PFO A;  3B82 A;  3H2V E;  3LAL A;  2QEX S;  1WG4 A;  2IBO A;  4Q2L A;  1CG2 A;  3RGI A;  2V9W A;  4FYW B;  2KDO A;  2HBZ B;  4LRC A;  4R0J A;  2RT3 A;  1HA1 A;  4QU6 A;  4O3O A;  2PMW A;  2F3J A;  1UFL A;  2K1R B;  4J9K A;  2GAG C;  2Q66 A;  1F9F A;  3HXM A;  3MAA B;  4LF8 J;  2CQC A;  2X3D A;  1TAU A;  3EZO A;  3CUN A;  2RKI A;  3NGD A;  2CJK A;  3D6F B;  4X65 J;  3E51 A;  2W1B A;  1R7I A;  1RT3 A;  3W60 A;  1HNV A;  3BS9 A;  3G4S S;  2HHP A;  3AJD A;  3MI7 X;  4J37 A;  2LYV A;  3NNA A;  3HD2 A;  3FBC A;  4OI2 A;  1R8P A;  1M5V C;  1JLB B;  1XNR F;  2OO4 A;  5E3R A;  1IKV A;  2BRK A;  2XMK A;  3DU6 A;  1P9Q C;  2CNL B;  2MY8 A;  4MKB A;  2CJX B;  2DR9 A;  4L3N A;  3CE8 A;  1NME B;  1XTZ A;  2LEA A;  2V67 A;  4HI1 A;  3ADA C;  4XK8 C;  4AL7 A;  3NWR A;  1HW9 A;  4HTJ A;  4N47 A;  2HFU A;  2R42 A;  3QID A;  4XO0 A;  3MR7 A;  1KFD A;  1SPB P;  2ZFH A;  4C98 A;  3D6T B;  2LDI A;  3FQL A;  1QSS A;  3PYG A;  5HQM A;  3GFH A;  1B7F A;  3KK2 A;  3OW2 R;  1IM6 A;  3DRX A;  1IVZ A;  2DB1 A;  1NH8 A;  3I87 A;  2IVM A;  3M8Z A;  4DSE A;  2O01 C;  2AJ1 A;  3HZE A;  4KRW A;  3RAX A;  1S97 A;  1NJI T;  1GX5 A;  4YN3 B;  1X8D A;  2K1R A;  4LF7 F;  4AE5 A;  2LQ5 A;  1J5O A;  3MAA A;  2HHW A;  2CJA A;  2MGZ A;  1SL1 A;  2UVU A;  3CJK B;  3DRR B;  4B9U A;  1T03 B;  3RJM B;  3DI6 B;  1FE4 A;  1GX6 A;  5E7O B;  4QIE A;  2GO8 A;  2VFV A;  2DJW A;  4CT9 A;  2CA9 A;  4XPE A;  4EYH B;  4ANE A;  4JB8 B;  3OTC A;  4C8L A;  3GJR B;  4UOG A;  2YH0 A;  4P72 A;  3Q23 A;  5K8P A;  2XYG B;  2QRR A;  2ATC B;  3MCN A;  2Q43 A;  2QLB B;  1JLB A;  5KFS A;  1HQ2 A;  4QWE A;  2Z2Y B;  2CIM A;  3OSN A;  3TUI C;  3UE2 A;  5KG2 A;  4JYA F;  5H1S V;  3S6E A;  3ETO A;  2IDL A;  5HVH A;  2CQ3 A;  3BBC A;  3M8Q A;  3SCL E;  1FWK A;  5HP1 B;  4ZVH A;  1PBU A;  3AB2 B;  3WC0 A;  4RW8 B;  4CLK A;  1YX2 A;  3PV8 A;  4NCG B;  2XNQ A;  4NLT A;  3CCS S;  3F0N A;  1YBT A;  3PHE A;  3T1A A;  4ZIV A;  4ED3 A;  2OI2 A;  1RHU B;  3Q8R B;  4JI0 F;  2H1Y A;  4LVO P;  2CPI A;  2XY6 A;  2XB2 D;  2BW2 A;  1G4C A;  1RTH B;  2AHO B;  4DOZ A;  1KDN A;  1RWP B;  3NAI A;  2KB2 A;  1RUS A;  5CAA A;  3F56 A;  3H0P A;  2DHX A;  3FSY A;  3W3S A;  4N41 A;  2KT3 A;  1K8A T;  3CJQ A;  3CJK A;  3I56 S;  1CJK A;  4CLU A;  3DRR A;  2FVQ A;  2L9N A;  5C7P A;  4URG A;  1ICE B;  1R6Y A;  1LQ9 A;  3A3O B;  1NJY A;  4RUA A;  1UWA A;  2LCW A;  3OHA A;  3I0R A;  4IOB A;  3KLG B;  2HIQ A;  3O2I A;  3EZ5 A;  2UV8 G;  1S6P A;  5E3Q A;  1P27 B;  2IVF B;  2GGP B;  4ECQ A;  3DOM B;  3QPI A;  1B99 A;  3EMT A;  3ZXW A;  2VQF J;  4ZP9 A;  1RT7 B;  2POK A;  2P8I A;  3THV A;  1UJ5 A;  5FLX U;  3BQ2 A;  5A8K A;  4NI2 B;  1ROF A;  2X51 A;  1UVM A;  1ZA2 B;  3KJF B;  1LWF B;  1N5Y B;  4F2R A;  4J91 A;  4ZVQ B;  4U8Y A;  2MXY A;  3CDU A;  1IN0 A;  2HZV A;  3KLH A;  3M2R B;  1G6B A;  2KM8 B;  3ZFV A;  4O4G B;  5C24 B;  1HD0 A;  2AX0 A;  1UEU A;  1Y10 A;  4DL7 A;  3M6W A;  3EVO A;  1EIY B;  4UQT A;  4C8M A;  3NGR A;  1KVI A;  3IRW P;  3S1T A;  2J0W A;  1UVN A;  2NPF A;  2H4W B;  4KHR A;  3J7Y I;  4DFM A;  4TQR A;  1DJ0 A;  2AJQ A;  2Z2Z A;  1C0T B;  3F44 A;  4ID5 B;  3M4X A;  3TP2 A;  3GSI A;  3PKM A;  2ZKU A;  3PRB A;  1RTH A;  1IBK F;  2CQP A;  2MQN A;  2O67 A;  2WK4 A;  5DG7 A;  4ED2 A;  4ZPC A;  2GJI A;  3SCK E;  1S12 A;  3MFI A;  5KFJ A;  3W2V B;  2LFV A;  2LLZ A;  1T9V A;  2W25 A;  2E1A A;  3KLG A;  3TAM B;  4CH1 A;  2KO1 A;  4KKO A;  4IRC A;  3MUR P;  3ZZY A;  1ZH5 A;  2R7O A;  2VJU A;  3MPY A;  1LWX A;  1R8B A;  3OFF A;  2N7Y A;  4WU2 A;  3L95 X;  4WYL A;  3FSI A;  3MM8 A;  2V2K A;  5AE3 A;  1RT7 A;  4UST A;  2QGF B;  3JQK A;  1Z4U A;  1M1H A;  3Q22 A;  1HD1 A;  4NI2 A;  3LAN A;  2G2Z A;  4DSK A;  4OI4 A;  1EP4 B;  2F7V A;  3ZZ0 A;  1LWF A;  1N5Y A;  4QIW D;  3IXQ A;  3HHN B;  1X5T A;  2EFP A;  2QSW A;  1KHV A;  4A48 A;  3CED A;  4U95 A;  3M2R A;  2D9P A;  3RU0 A;  2LEP A;  4DU7 A;  3OFH A;  4F4W A;  5KFF A;  3D54 A;  2ADC A;  4M1K A;  3CB4 A;  1HNW F;  4LUB A;  3VZI A;  1WDT A;  5K20 B;  3UR0 A;  2JEG A;  3G96 A;  2E7W A;  1C0T A;  4G6V B;  4LBI A;  2RHQ B;  4J9U E;  1U25 A;  1ZOT A;  3PR5 B;  2FUG 9;  3PEH A;  3HVR A;  3BKF A;  4KGM A;  2OPP A;  2AZ1 A;  1VQO S;  2DTJ A;  4OZJ A;  4BBY A;  4YME A;  1HHS A;  2ATL A;  4ZHR B;  1X9S A;  3PKY A;  3W61 A;  2ASL A;  1S6O A;  2RSQ A;  1IR0 A;  3D3C J;  2XUL A;  4ZN3 A;  1S0O A;  4PXD A;  5LMU J;  3IG1 A;  2R2U A;  3U1N A;  1U1K A;  2IA0 A;  2FC9 A;  1TV6 B;  3MMB A;  2MLY A;  4ZN1 A;  3Q8Q B;  1CC8 A;  2WOM A;  4LF4 J;  1UW9 A;  4N5S A;  2JWN A;  2EKY A;  3TW0 A;  2CPX A;  2OTJ S;  4PPD A;  4C48 A;  5LXR A;  4B9T A;  1LWE B;  3E01 B;  4K2J A;  3CME S;  4QOT A;  1S79 A;  1VC6 A;  4DV2 F;  2RDI A;  4NZ0 A;  3PO5 A;  4I2Q B;  1EP4 A;  1IBM J;  1S59 A;  3VAH A;  4E2F B;  1GFW B;  3RTV A;  1RHR B;  3W64 A;  1X5O A;  2YX4 A;  4M5N A;  1Y0H A;  4ANC A;  1RKJ A;  2DO4 A;  5I3Q A;  4JI6 J;  4B3S J;  2HQF A;  2BAN B;  2XM3 A;  1FRI A;  2UVR A;  3L09 A;  2NYI A;  2HUR A;  3NNC A;  2WON B;  3GB0 A;  2Z2L A;  4LR9 A;  1Y5N B;  1IBL J;  3POT B;  4Q45 A;  5DDR C;  2FDN A;  2E66 A;  5HO4 A;  1HYS B;  3C16 B;  2HMI B;  4OHV A;  1OMS A;  4USW A;  3OD2 A;  3BKT A;  2I2Y A;  3JYT B;  5ETT A;  2KFY A;  3ILL A;  1KR4 A;  1FRX A;  3G6Y A;  4MFB B;  2KZZ A;  2QC3 A;  2XHW A;  3TVK A;  4WZM A;  3D6H B;  2JC1 A;  4LF6 F;  2WVC A;  1SKR A;  1IUJ A;  1DFD A;  3IM9 A;  3GQC A;  1TL5 A;  2JVR A;  3UDE A;  3CXC R;  4RO0 A;  4WFZ A;  1D1U A;  3DFE A;  3SZ2 A;  1TV6 A;  1ZTW A;  2C2Z B;  2BKO A;  2XC9 A;  1VIO A;  3OTO F;  5H9F K;  1OSD A;  4K4S A;  3AXK A;  3WQP A;  4OZL A;  3KLI B;  3SFU A;  2GML A;  4OYP A;  5IT4 A;  2MQ8 A;  3NMR A;  2BJ1 A;  2UP1 A;  2DGW A;  3IRX B;  3E01 A;  4IH6 A;  3RBX A;  1VC0 A;  1PJ5 A;  5G0R B;  4KBI A;  1WHW A;  1ZAV A;  4DX7 A;  1KTV A;  4WWS A;  3J80 U;  4ECZ A;  1FEH A;  4Q7A A;  2XTJ P;  1RT2 B;  3MUM P;  5CZV A;  4ZPT R;  1YQH A;  2L3M A;  1LW2 B;  1U6F A;  4AQY J;  5DGA A;  2BAN A;  2BJE A;  4TU8 A;  3GFX A;  3K2Y A;  2ZE2 A;  3PY8 A;  1KFS A;  4OL8 A;  1FD8 A;  2HHH J;  2WON A;  4KH0 B;  4QWB A;  3CO9 A;  4I1T A;  4K0K F;  3KMS A;  5CCM A;  1DQ8 A;  3OR1 B;  1XQI A;  1HYS A;  2PDA A;  3PIO Q;  4M95 A;  2IM1 A;  2VPW B;  1SH3 A;  1RTD B;  1QAY A;  2OSR A;  3CJ3 A;  4XDD A;  2R7S A;  2Z8Q A;  1OSC A;  4X64 F;  3KG4 A;  1AYE A;  4M63 A;  4OZ1 A;  3V4M A;  2L9D A;  2IMO A;  1SL0 A;  4DUZ F;  4NZ6 A;  2V2Q A;  3MXH P;  2UVW A;  2P6S A;  2M0G B;  4LFC F;  4J9O A;  3DLG A;  1PKU A;  3LAM A;  1RWV B;  4X66 F;  3QAT A;  2IJF A;  3D7S B;  3BR9 A;  4IR1 A;  4C0B A;  4WE1 B;  2GV1 A;  1T3O A;  4UZB A;  2MEW A;  3LQV A;  1U6B A;  1HNI B;  3GII A;  2WW8 A;  1OWX A;  3ICL A;  3UO0 A;  4X62 F;  2ABY A;  2BRL A;  4U96 A;  4RW4 A;  4M5L A;  3TOQ A;  4NYZ A;  3SDE B;  2Y0S D;  1LK5 A;  1MWQ A;  4R0E A;  4EBD A;  4DZD A;  3IRX A;  4PQU A;  2M9K A;  1W2I A;  1A6L A;  2EG2 A;  3H40 A;  5G0R A;  3CCZ A;  3CVK A;  4HT7 A;  4Q0B B;  3IN5 A;  4YR3 A;  2B5J B;  5F8N A;  2IAJ B;  1UKU A;  3MAQ A;  3G86 A;  4RW6 A;  2J7U A;  3V6H A;  3PNI A;  3I0S B;  3UPF A;  3I9Z A;  2ZZM A;  2OPQ A;  4OYA A;  3DXS X;  3HP6 A;  1RI7 A;  1YWX A;  3LUY A;  4R25 A;  4OI3 A;  1FRL A;  3EPG A;  1KQG B;  5D77 A;  1NK4 A;  4PAA A;  1VQL S;  1X0P A;  3OR1 A;  2GJ2 A;  3IR5 B;  1ZPW X;  1N5Q A;  3I5A A;  1RTD A;  3KK1 B;  4ZVO B;  4I7F B;  4QW9 A;  1ELO A;  1WF2 A;  4H4K C;  3TA0 A;  2DR7 A;  4FF4 A;  2AYB A;  2R2S A;  1YJT A;  3MMJ A;  1RAG B;  3K5P A;  4HTI A;  2OSQ A;  2YPZ A;  1U1M A;  4S0M A;  1CUL A;  3M8P B;  4CO1 A;  4Y3C A;  3SCI E;  1PSD A;  3PCO B;  3QGG A;  4IH7 A;  2Y1I A;  4ZVS B;  1D3W A;  2VBZ A;  1AA1 B;  2EC0 A;  3OHB A;  1CC7 A;  4MK7 A;  4WE1 A;  2U1A A;  4YB5 A;  1Y00 A;  4LFA J;  1WEX A;  4DR3 J;  1O8B A;  3IBF B;  2ZH6 A;  4M5J A;  2YTC A;  3DC2 A;  2ZH4 A;  4AXI A;  7FDR A;  2B8Q A;  3ELH A;  2E5L F;  4FF3 A;  2UUT A;  1NJZ A;  1DQA A;  1UL3 A;  1B0P A;  1NPP A;  5RUB A;  2AGP A;  5AT1 B;  3W1Y C;  1FRH A;  4P73 A;  4Q0B A;  4DMZ A;  1UCN A;  1L3S A;  1Q79 A;  4KHP J;  1ULR A;  1FDB A;  2ZOF A;  3KUH A;  3TJ9 A;  1R0A A;  3EPI A;  1S1T B;  4XDC A;  4JI8 F;  3QT7 A;  3T5K A;  3RRH A;  1F2G A;  2B51 A;  4OMF G;  5J2Q B;  4RBV A;  2NZ4 A;  4ES1 A;  3W9I A;  2ZH5 A;  2BE2 B;  2UU9 F;  1VRT A;  2DIU A;  3W2W B;  1WOS A;  3UCZ P;  2R4F A;  1S6Q B;  2H54 B;  4MYU A;  2LEC A;  3US5 A;  3T1H J;  1T02 A;  3KLF A;  4I7F A;  2DK2 A;  1W7W A;  4PXE A;  1V3Z A;  2O66 A;  3CDA A;  3PTW A;  1U8W A;  1QY7 A;  1ZAW A;  3G8T A;  4WFB Q;  3Q0A A;  3M8P A;  4F0M A;  3QRP A;  4DR7 J;  2Q3P A;  1HQU A;  2KFN A;  3V4I B;  2EKN A;  2R7X A;  4OYZ A;  4LRD A;  3DLE B;  1F0X A;  1X7V A;  3C8Y A;  3CJT A;  1OIA A;  1XNQ J;  2J9D A;  2X1B A;  2OEM A;  2C2E A;  1U26 A;  4FBU A;  1CEZ A;  4DUY J;  2RU3 A;  4C0O C;  3D67 A;  3RR8 A;  4P9S A;  1P1L A;  1JLG A;  1JMT A;  1PYS B;  3CCW A;  4UQG A;  4CT8 A;  1N5S A;  1LEO A;  2D7S A;  5CAB A;  1RTJ B;  1VBZ A;  4QQB A;  3UD3 P;  1HL6 A;  3TR5 A;  2ILZ A;  2WSF C;  3HJV A;  2MKC A;  3IBC B;  1S1T A;  4RNF A;  3N9U C;  3HM9 A;  2GFF A;  5LSO A;  1YJ7 A;  3C14 B;  4CLP A;  2W8K A;  4V19 J;  1VRU B;  1N34 F;  4L6V 3;  5HRO B;  5D4O A;  2LQ9 A;  3R97 A;  1R27 B;  3RRG A;  5B0B A;  1FT8 A;  3NOC A;  4GVL A;  5J2P B;  5DLG A;  1OYE A;  3OTD A;  2XS7 A;  5EUH A;  4Y00 A;  1KEK A;  3I31 A;  3OLB A;  3WBZ A;  1WNE A;  1BQN B;  2RU9 A;  2WVF A;  3ZTQ A;  4GKK J;  4O3N A;  3DYA A;  2QTW A;  1YLX A;  4BWJ A;  3HHE A;  2XMJ A;  3PHT A;  2DIT A;  1WOP A;  2C42 A;  1VLO A;  2OEJ A;  2XLI A;  2YKN A;  3IP0 A;  4UOF A;  2V8V A;  1U1P A;  2DNG A;  4USJ C;  3M8S A;  3T3F A;  4TYA A;  1X4A A;  3NRB A;  3KG0 A;  4IG0 B;  3BGR A;  3ET6 B;  1T9T A;  1QM9 A;  1Q8I A;  1TMJ A;  1U7L A;  4RW7 A;  4C4W A;  3DLE A;  3EWG A;  2DRA A;  4DEZ A;  4MKA A;  3AA9 A;  3M7V A;  4C3M A;  2V9K A;  1S1V B;  2H4Y B;  4ECT A;  4IG3 B;  3JSB A;  1EAY C;  2IM2 A;  4JV2 A;  3WIU A;  1XR7 A;  4U8V A;  5ETS A;  5IWA J;  3LP1 B;  1KOH A;  2F40 A;  1JIH A;  4LRF A;  1YJ9 S;  1RTJ A;  2HHV A;  1N56 A;  1D8Y A;  4OJH A;  4F4X A;  3NLC A;  2KTQ A;  4A8F A;  2BMB A;  3NEK A;  2OH2 A;  2A6M A;  1NB7 A;  1R8H A;  3GLJ A;  1BD6 A;  5HMZ A;  1KBR A;  1AUS L;  4LF7 J;  2PC6 A;  4LF8 F;  4J9Q A;  1PC4 A;  3SFG A;  4ZJQ A;  4NLG A;  4I67 A;  4Y0F A;  5HRO A;  4OHZ A;  3RB6 A;  2R8G A;  2HBY B;  2V4J A;  4H54 A;  3TZZ A;  3A3N B;  1DLO B;  4ZP8 A;  3KG1 A;  2UUW A;  1TK0 A;  2BKN A;  1VFJ A;  4LF5 J;  1RBA A;  5E0O A;  2VH7 A;  1JQG A;  1B0T A;  2CWK A;  2DXF A;  2UZA A;  4DCP B;  1HWU A;  2VDH A;  1IJE B;  4TYB A;  4W4M A;  5J1E B;  4QR0 A;  1Q86 T;  5A0Y B;  4ZVF A;  2G1H A;  4MIB A;  2D3U A;  2FJA B;  5L8R C;  5I3P A;  3HO1 A;  3VF0 B;  4DN0 A;  4MH8 A;  2I6W A;  1N4L A;  2AKW B;  3QSY B;  4CIO A;  3ET6 A;  3H59 A;  3K17 A;  3O44 A;  4RUB A;  1T8E A;  3RBZ A;  4ELU A;  5DZ6 A;  2C2O B;  1N48 A;  1RAJ A;  3IS9 B;  1S72 S;  1TVR B;  2BBE A;  2A0F B;  1HBM B;  1V9O A;  2AU0 A;  2V8G A;  3RRK A;  1S49 A;  1S1V A;  3SSS A;  1VLY A;  2W4P A;  4ER8 A;  5JVG Q;  4ZJL A;  1ZTT A;  2WZ1 A;  4L75 A;  2GS8 A;  3LP1 A;  5DDO C;  3UCU P;  1EET A;  3TJA A;  1QLN A;  4C8O A;  4OYW A;  1UA0 A;  3C15 B;  3GR0 A;  2MZR A;  2OPS B;  3GE9 A;  5B0D A;  4F4Z A;  3IA0 A;  1VJQ A;  5C25 B;  2VAS A;  2QZ8 A;  4ZIT A;  2HVZ A;  4WXW A;  2VJV A;  2DHA A;  4MKV A;  1H2U X;  2QV6 A;  1TL7 B;  1U1R A;  3OT9 A;  4D3H A;  4I2P B;  4DL6 A;  4PZV A;  2FHM A;  2HAF A;  1S7H A;  3LPE A;  3GIL A;  3NCR A;  4ID8 A;  2W2Q P;  3CCT A;  2F8H A;  2V4R A;  4FPR A;  1XK8 A;  2VHG A;  2I38 A;  3GYG A;  1WG1 A;  5K8N A;  1YSJ A;  2D3Z A;  1RWK B;  3AH6 A;  4EU0 A;  4PXC A;  4UW2 A;  1AW0 A;  3RBE A;  2FZG B;  5J1E A;  3HLU A;  3TQ1 A;  2L41 A;  2I5J B;  4K4V A;  5A0Y A;  1D9D A;  2CQ0 A;  2RQK A;  1KON A;  4ENO A;  3OL7 A;  1B4S A;  1D9A A;  1E6Y A;  1KQF B;  3MD1 A;  1R3N A;  1BY9 A;  5H9E K;  2HHS A;  3LPY A;  3QT5 A;  1TFY A;  1OJ4 A;  1QSY A;  4ED6 A;  2HQG A;  4O23 A;  1G2E A;  4NA2 A;  3EXC X;  5EX3 A;  4RZR A;  5L1L A;  1TK5 A;  1N36 F;  4WZQ A;  1Q82 T;  1X4C A;  3KNA A;  1HBM A;  2DKO B;  1WTB A;  2AGQ A;  3RAQ A;  2BM0 A;  4NEZ A;  2CPJ A;  4N8N A;  3TJ8 A;  2A2D A;  4URQ U;  1T05 B;  1NK6 A;  4P10 A;  1NO8 A;  3JTP A;  1WDD A;  1MN7 A;  3A3P B;  2LMI A;  3FSX A;  2XLJ A;  5ETP A;  2A6O A;  2AEJ A;  2WVD A;  1IBK J;  7FD1 A;  2B3T B;  3B78 A;  4JUZ A;  4DFP A;  3C15 A;  4M5K A;  2LEB A;  3ZTS A;  1BWE A;  1U0S A;  1NKC A;  1HW8 A;  3BEG B;  1NZA A;  5IXU A;  1PYO B;  4P2X A;  4RW9 A;  1FNM A;  4KV8 A;  5C25 A;  3BSC A;  1YGY A;  4EI2 A;  3PX6 A;  2VQE J;  1X5S A;  2X3G A;  4USU A;  1TL7 A;  3Q86 A;  4LIR A;  4V1A k;  4B02 A;  4CTA B;  2ERR A;  3I82 A;  5C2G A;  4WYW A;  3GIM A;  3BV8 A;  5A6W A;  4JI1 J;  4CNZ A;  1DRZ A;  2IYI A;  4X4Q A;  4C2M A;  3FCH A;  2EXU A;  3U02 A;  2NR0 A;  2I5J A;  5I4M A;  3VGV A;  3L4B C;  2IYG A;  2M70 A;  3L3C A;  4B3O A;  1PGZ A;  4YQW A;  2CJY B;  5M2P A;  2HRY A;  1WTF A;  2LU1 A;  3T5L A;  2LKZ A;  4NOH A;  1M1K T;  2HZA A;  3BO2 A;  1B0V A;  3KJV B;  4J9S A;  3QO9 B;  2ZBC A;  1KLM B;  4J7C A;  4DV5 J;  1GMV A;  4HVZ A;  1SKU B;  3S01 A;  3AOD A;  1RWU A;  2FY8 A;  4PG8 A;  2ACM A;  2FYX A;  3L9Z A;  5KFH A;  1VI7 A;  1Q95 G; 
#chains in the Genus database with same CATH homology
 2Y8W A;  4DZD A;  2Y9H A;  4QYZ K;  5H9E K;  3QRQ A;  3QRR A;  5CD4 A;  4U7U D;  5H9F K;  2Y8Y A;  3QRP A;  1WJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...