5CD4A

The type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
199
structure length
199
Chain Sequence
MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cascade subunit CasE
publication title Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/rna
total genus 26
structure length 199
sequence length 199
chains with identical sequence M
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 5cd4A01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 5cd4A02
1WJ9A 4DZDA 2Y8YA 5H9EK 3QRQA 4QYZK 4U7UD 5CD4A 5H9FK 3QRPA 2Y8WA 3QRRA 2Y9HA
chains in the Genus database with same CATH superfamily
6AT1B 3NRBA 3TO8A 2D7SA 2VG7A 2RT3A 4J9VA 3D6HB 4J9RA 4JI5F 4JI0F 1LWEA 2FJVA 5A8KB 1RTIB 3DRSA 2XY5A 1B99A 1RWOB 1KKHA 2WK4A 2DNLA 1DQAA 4RW9B 2HMIA 4F3MA 3ZTRA 4IG3A 1RWXB 3FSYA 3K8WA 3EICA 1Q81T 2KG0A 5EDWA 2OPQA 1LWCA 2VBXA 1RYSA 3BQ2A 4KT0C 2JRSA 2D9PA 3R5GA 4O0NA 3K2YA 2VG6B 3O2IA 4YY3F 2DITA 3LTOA 3R2DJ 2PGCA 2DPIA 4AFFA 3OHBA 2KZZA 1T02A 1KQSR 3R7BB 1VQYA 3OVSA 1A0OB 3AOCA 4KGVB 1X5OA 3V6DB 4Y3CA 2FQQB 4UTGA 3CJ5A 3UWTA 3A12A 2Q6BA 2VJVA 3MAQA 4PXDA 2HNZB 1HD1A 1H6KX 1ZA1B 1K1SA 2V2ZA 1NDCA 1TKTB 2CJQA 4C3KA 2VA2A 5L38A 1NKCA 4JOUA 1KNZA 4NCGA 3H25A 4TU9A 3QRPA 1NB2A 2VIHA 4O3OA 4M5LA 3LW5C 3OTBA 1G1XA 4LF5J 4YR3A 1SBRA 3E8OA 3CSKA 2WVCA 3DRRB 1N5YA 3IFEA 2RJZA 2WTFA 2WOMA 4YDXA 4LF6J 4LF2A 4ID8A 2J8SA 3UW1A 1PCAA 4ERDA 3AA9A 3JB9k 3NXZA 2KU7A 4OX9F 4NMXA 5DG9A 1Q4RA 1NMEB 3DHWC 3WHIA 1R8HA 1RWPB 1RT6A 4C8YA 1K9MT 2VC0A 1RQ0A 5C24B 2FY1A 3G8QA 3KLGA 4ED7A 2R7RA 4YDDB 2AJ0A 1WJ9A 1SB6A 4CDIA 3SZ2A 2LXFA 3UDCA 2CUYA 1U25A 3MOZA 4PABA 4B08A 4UW2A 4DL2A 4B3SJ 2BW7A 4OYZA 1S4EA 4LF4F 2F8EX 2FLLA 5IM0A 5A2QU 3DXBA 4U9RA 2UUCJ 2CQPA 3UDEA 2BEFA 5HJYA 1S5ZA 5D77A 3PVXA 2CPDA 2C2DA 2D69A 2WBRA 1X5SA 3W62A 1IUJA 1KHWA 4Z2XA 2B3TB 2LXIA 3IGVA 3M8PA 1Y10A 2BW2A 3IWLA 4MMOA 3LPEA 3FDSA 1UA1A 3M2RA 3KLFB 1U6BA 3MECB 4B02A 3N6MA 4ZLPA 3B78A 4DEZA 5E3AA 2QZ8A 2AKWB 5J1EA 4DUZJ 3M2UB 3CD6S 1KEKA 1RKIA 2H1YA 2V68A 1HBOB 2FVRA 2BM0A 2L9NA 2ZBIA 2CQDA 2W2MP 4FS2A 5IOLA 5HMXA 2C1EB 2FLNA 4WIQA 3UE2A 3HFVA 2W25A 4ECZA 3MEDA 2HNYA 4Y0FA 3V6KA 3IP0A 4DBQA 1U1KA 1FO1A 2YNHA 3DM2A 3ENVA 2XWXA 2R2RA 2V8DA 2MZSA 3MPVA 4RW6B 1D9AA 1J5OB 1RHMB 2XSJA 3BH7B 3BKUA 2RQMA 1MN7A 3BGRB 4CLWA 3MM9B 2EK1A 1RZMA 2YNGA 4XPCA 2DR8A 3EXCX 2V69A 3GONA 2ZJQQ 3AD7C 3TRGA 4J90A 4DR2F 2A2CA 5A8KA 1RTIA 2KDOA 3VVUA 1U1NA 3I56S 5K8OA 3PKYA 3ISZA 4QU7A 2NS1B 3VGSA 4WXWA 2RHQB 5EWFA 2CFXA 1WDDA 2UXCF 3C2PA 2E1RA 2EG2A 2XC9A 3EJMA 4JI3F 1HYSB 1SIWB 1N8RT 1T9XA 3C6UB 2VG6A 4PG7A 1N6QB 3DC2A 5JVGQ 1ZPWX 3AA8A 4C9DA 1KHVA 4NLRA 2QSFA 3G6ES 2M8HA 2R4FA 4X4QA 2KT5A 3V6DA 1S1XB 1WHWA 1JLGB 1FVQA 2NQPA 4I64A 2MMYA 1FKPA 1M5OC 1PAEX 3CCRS 2O1PA 4K5RA 2HNZA 1RKJA 1N33J 3O5TB 1FRIA 3P49B 1TKTA 3MEGB 4DU8A 5ADZA 2G4BA 3QBCA 3BJYA 4X4PA 1AT1B 1UVLA 5KFHA 3BM7A 2R3VA 1NAQA 2GW8A 2HEKA 2RNEA 4M8LA 2H3EB 3DLHA 3DRRA 2YKAA 4OYMA 5IT9U 3MR7A 3D0GE 3J81Y 4LFBJ 3AQPA 2QC3A 3UD5A 1X4FA 5K14B 1SH3A 3LGNA 2VODA 2VH7A 3J7AN 2JLGA 4NLDA 1R0BG 3GILA 2AZ3A 3JSBA 2ZBPA 5C24A 1REGX 3UCZP 1EP4B 4KH1B 1HPZA 3CCQS 3M8QB 5MAOA 3PR5B 1T3NA 1S0VA 2LU2A 3FBEA 4KIAA 2ZJRQ 3WX8A 3QLHB 2CAJA 3C8YA 1ELOA 1KOHA 3CO0P 4ZP7A 4AQYF 2AV5A 1HNWJ 4QWDA 4CI0B 2AW0A 2M88A 1WC1A 4EYIB 1JJHA 1LNQA 2DO0A 1HI8A 1W2BR 4ECYA 2O3DA 1OIAA 5RUBA 3Q8QB 3GCXP 2HGLA 3WC2A 2BBEA 3US5A 1S57A 3PW0A 2KI2A 2KO1A 2HK3A 4ZP9A 2KM8B 4BHQA 4Q8FA 1RT4B 2QN6B 4R5PB 5THWA 5GMEA 1WTFA 4KY3A 3P96A 1VQ5S 1DZ5A 4USHA 4FN5A 3GJRB 4A8WA 4BC7A 2G0IA 3KLFA 3UI3A 2XS7A 4PZVA 4A8QA 3GSDA 3KUGA 2YPYA 2GMLA 4Y2IA 3D6TB 1Y5NB 3DOMB 3RG6A 4WKYA 1UL3A 4CCHA 3K5MA 4DSLA 3M2UA 1SQFA 5JMNA 3D28A 3NNAA 1HBOA 3K0JA 5DGAA 3UFCX 3EPIA 3RW6A 3HI9A 4L6V3 1KONA 1T9UA 3MMCB 1YIJS 4TLRA 3D66A 1I6JA 1IWAA 1QD1A 2DNOA 1JB0C 4I2PB 2J7KA 3T6JA 1SXLA 3KMSA 2Y1LB 1K0TA 2PMHA 1XNQJ 1FVSA 5HL7Q 3OJUA 2XMTA 4LR8A 2W8LA 4RW6A 5KFIA 1X60A 3B82A 5E3QA 2C42A 2AGQA 4A8SA 1VQ6S 3BGRA 3MM9A 4I67A 4X66J 3D67A 2ZM6F 4FVMA 5BJRA 4HKQA 4FS1A 3M30B 2IFXA 9ATCB 2W8KA 2DVIA 4LF9J 1IWGA 2JC1A 2V50A 4E0DA 5LMUF 3LAKA 2W2QP 1UA0A 5CD4H 4PPDA 4LF8J 3Q8YA 4L3KA 1VQ7S 9RUBA 4F8RA 4AUKA 3TAMB 3LA0A 3LWLA 1KTVA 3JXOA 1LV5A 4PQAA 3FSIA 3TYTA 2JEFA 1RDRA 3P45B 2WONB 1P9YA 2X1FA 1WOOA 1HYSA 1N5VA 4PCQA 3C6UA 1CULB 2MTLA 4NE9C 4QIWD 1PBAA 4Q2LA 1N6QA 3OL7A 2RILA 1MN9A 1NK0A 3ENQA 1CQNA 4QWEA 1F2HA 1S1XA 1JLGA 3H42A 4P75A 3VQTA 3I5CA 2N4DA 1JQGA 1FI4A 2POKA 4XK8C 1GK8A 3SMZA 1MU2B 2FJXA 3VGVA 1G4CA 1KVKA 2CNLB 4FNIA 3BQ0A 3MUVP 2M2BA 1R8BA 3MEGA 1MMDA 3K58A 2JOQA 4ZVQB 2AD9A 4CO5A 4DQSA 2X7IA 1TQLA 4LR9A 2ATLA 4UOCA 2R7SA 3BDPA 2R7VA 2LA4A 3AXKA 5BYSA 1YWXA 3M8YA 5J2NA 5I3QA 3FSXA 2FJBB 5DG7A 1EX8A 5K14A 2CJAA 4V1Ak 5J1PA 3J7ZT 1B0TA 2CVIA 3PRBA 4FPIA 5BYRA 2EFVA 8RUCA 3O3LA 4KBIA 3CNQP 1VC6A 1EP4A 3I0RB 3M8QA 4I7FA 5D4OA 2ZZTA 4H4KA 4NPOA 2HRYA 3AD8C 2JC0A 3SCKE 3QLHA 2DR7A 4DV7J 1UMJA 2IBOA 4HEA9 3CJTA 2UVRA 2G1HA 4DF8A 3BH6B 2DIVA 1Q79A 2C2OB 1U2FA 3VZIA 1O51A 2B7CB 2UV8A 4P2MA 4HH0A 1BGXT 3OUYB 3HXMA 1Z2ZA 3VAIA 2J8AA 3MM7B 1YRXA 3JSYA 3VAHA 3N9UC 4H4KC 3DLEB 4OI0A 4C8OA 5IQQA 4V19J 2BKPA 4A8MP 2O5DA 2W2PP 2OTLS 2ZH8A 3TAPA 2R7UA 3OW2R 5D4LA 5HI7A 3CDWA 1RT4A 2IA6A 2KL8A 4CLZA 2VBWA 1UETA 2HHHF 3H2LA 1IR0A 1VJQA 4DQIA 2A6MA 2I2YA 4V19X 2BRLA 3F44A 2NUHA 1F0XA 3DOMA 3EZ5A 4JV2A 5LSLA 2XI3A 3J81j 2ROPA 3CE8A 2FTRA 2IAJB 2ACYA 1FNMA 3KG4A 2KM8C 4ANCA 3AB4B 3D6MB 1N5SA 3MMCA 4TXSA 3A3OB 3Q8SB 4DL7A 4EGLA 3FEYB 4I2PA 3N5BA 4IOAQ 3FCVA 3NBPB 3MCNA 4P10A 3ZO7A 2J7WA 3PIPQ 3CDEA 2RE1A 1IM6A 5LMNF 2CQIA 1WORA 5C25B 4LRFA 2C3PA 1RAEB 2WRMA 2QG9B 2XGPA 3OR1B 2QLBB 1H74A 4K50A 1PYTA 1OPZA 3S7RA 3PXGa 1EQ0A 3GIIA 2MQMA 4MTPA 3EGWB 1X4AA 4F4YA 1N0VC 3PYEA 4K4XA 3QWUA 2DGVA 3SCLE 2R7XA 1NK8A 2MPUA 2ZOGA 4ED8A 4IYQA 4QBUA 3H20A 3HHLD 1WD6A 2KFNA 3MF5A 4UT4A 3Q8PB 2M5YA 1RACB 3V2UC 3GE9A 3D1QA 2XLJA 1L3VA 2F5GA 1SCJB 3TAMA 1Y3JA 1N52B 2LQJA 3TJ8A 2E5HA 1XQIA 1VRUB 4ZDNA 3QQCD 4FNHA 3KK1B 3QJLA 2PMZD 2WONA 1TL7B 4QYZK 1KBRA 2RF2B 4ZCKA 3W9JA 2XG8A 2KFYA 3QRQA 1CULA 3BYPA 1Q8IA 2CNNB 5IC4B 1OYDA 4ED2A 4DFKA 5FD1A 4NMLA 1X0FA 4KPYA 4ED0A 4DPUA 1U02A 1EQMA 5F8LA 2LVWA 2FHOB 2NREA 2P9CA 1UJ4A 3IR7B 3LWMA 2HWIA 2KT2A 1MU2A 3T6BA 2DEJA 1OY8A 5BYQA 2EPIA 2CJ9A 2GCFA 2MJUA 2VPXB 2IRXA 5HQ8A 2B4OA 4KHPJ 3OXLA 1U1LA 1P1LA 2MLXA 3AOBA 3D5MA 1FXRA 5LXRA 2HVIA 1P27B 1XR7A 2JLEA 3BV8A 1SC1B 4U7UK 1Q7LB 2B8QA 1QUPA 4OYAA 4Z7YA 3SSRA 2VF3A 4B9NA 1VOMA 2XQCA 4DPXA 4Y2CA 3RW7A 1VRTB 1FJEB 4LF5F 4CQ1A 5EGYA 3I0RA 3M4XA 4DL6A 4LF6F 3MMAA 4F67A 1O0PA 1REVB 4ER8A 4FXVA 3VGTA 1DLOB 4QIGA 5KT2A 1IKXB 1HHTP 3VZHA 3TAQA 3OUYA 4NLGA 3MM7A 4ZVRB 3AY0A 3U1NA 3TA2A 4QR2A 3BO2A 3DLEA 4UUWA 4CO0A 5DGBA 4ECTA 5CCMA 2GZOA 3MPWA 4B3SF 3H5YA 5AE2A 3CIMA 4MKVA 2XM3A 1HFEL 3CT9A 3MPUB 1HA1A 2GQCA 2PA3A 5LJ3Y 3OPKA 3ZFVA 2ZBQA 2UUCF 1L3UA 4NLUA 1TU0B 5HP1B 1OYEA 2KT3A 2FHKA 4L74A 4RUBA 4OX8A 3DRXA 2IBKA 3D0IE 2DR5A 1LW2B 3PKMA 3CULA 2AEFA 3BN7A 2ZVSA 2IAJA 2EEYA 2FYXA 2UUBJ 1MWYA 2RQKA 1NDLA 2QIFA 3I6PA 1QSLA 2EW9A 1Y4ZB 3M8ZA 3G9CA 1UW9A 2KVIA 2ZNZA 5KT5A 4YMEA 1MG7A 2NZCA 1FNOA 1LW0B 3NBPA 4DUZF 2HS4A 4JI7J 4NA3A 3HHDA 3EUNA 2ZWPA 1RWKB 2CYYA 4HHUA 1U1RA 4LQ3A 5C25A 5FLXU 3HSGA 3BSOA 2DRBA 2O01C 3OR1A 2VBYA 4RR5A 1WI8A 3BB5A 2GO9A 2QL7B 3DMJB 2C3MA 2VDIA 1MWZA 1A9NB 2FIUA 4P6QA 2AGOA 2IVMA 5DDQC 1TL5A 3FBBA 4QW9A 4RU2A 4DJBA 3AJ1A 2L48A 3ILOA 2OH2A 4K5SA 3HVAA 1VK3A 2X3DA 1X4DA 5GAGI 2O66A 1M1KT 3CCVS 1U49A 2E1CA 4U8VA 4FF3A 1VRUA 1MROB 2GHPA 3H5SA 2XMWA 3KK1A 4HDHA 1TL7A 3D6FB 2RF2A 1IQZA 2FUG9 2F9DA 1ACMB 5I3UA 4OYWA 5LOQA 2WZ1A 3I87A 2BANB 3QAUA 2ZH6A 4Y00A 3ZZPA 1TUVA 1WELA 2DTJA 2ZUGA 4TQSA 3I5AA 4CO3A 3GIJA 1F9EB 5CYMB 2MLYA 4CLUA 4NCBA 5ETTA 2GQ2A 5IV3A 2XZWA 4TVAB 1WI6A 3W63A 2ZZMA 1QUVA 2MYFA 1HMVB 1GXLA 3EVMA 3DLBA 5H9FJ 4OZJA 3B6BA 4OQJA 3CB4A 1N33F 1O8BA 1RLCL 1YLXA 5K5MA 4HH1A 4X4OA 1PSDA 3PTWA 3R5DA 4OZNA 3FBFA 3SDEB 2ATCB 1NK4A 3DU6A 1VRTA 2RMLA 4O4GB 3FFIB 3LP1B 2OJ3A 4DPYA 2L3MA 2HQDA 4ZP6A 4LFBF 3SFUA 4HVZA 4F0KA 2GQQA 1F9FA 4DSIA 1REVA 1JMTA 3KUEA 3U27A 3HT3A 2W1BA 2RQ4A 4UF4A 1Q78A 1WEYA 1BE4A 1YJ7A 1DLOA 1JXLA 5EHHA 3QT8A 3E01B 5ETPA 1IKXA 5HQLA 2GJFA 1WC6A 1SVDA 3P3DA 2BE7D 2Y3YA 4DDFA 1BQNB 3BPSP 4X64J 4YHHJ 1F6TA 3HHKA 1ZBTA 3IMQJ 1HNWF 3M9MB 2DNNA 1X9SA 3K5LA 2Z57B 2DGQA 4WK3A 3UR3C 3KJVB 3PJXA 2QLWA 5HP1A 3TVZA 1FRXA 4G65A 2UXBJ 3CMAS 1FT8A 2QLXA 2MQPA 4YEAA 2VASA 2HSEB 1KC8T 2FVQA 1D8ZA 1LW2A 4AE5A 2VFRA 5EWGA 2XZDB 3HMJG 1IKWB 1R0AB 1YJVA 3SI8A 3DDIA 2HGMA 3DDKA 4D3GA 5B08A 3B4MA 1NHVA 2BZ2A 2ZH3A 1TZ0A 2BM1A 2E1AA 1S48A 3QGIA 4BWJA 1YI2S 1S76D 1LW0A 3C66A 4FKXA 1U1QA 3UD4P 4W98A 1HWJA 4EBDA 3A1YG 2B43A 1QE1B 2LXUA 2MZ1A 5CH7B 3PX4A 1P1TA 3GIKA 2VQEJ 2LQ8A 1IBMJ 5FDLA 1NBEB 3WZ0A 2F40A 1XNQF 5H1SV 1UJ5A 4EZ9A 4QIEA 3DOKB 3KLIB 3PW2A 1RTDB 4NZ7A 1HLWA 4I6AA 3U1LA 3A8EA 4X66F 2HHTA 2UP1A 5M2PA 1Y0HA 2ZITA 3J7YI 2HZCA 4DSKA 4LF9F 1X5PA 3KOAA 2KRRA 4LF7J 1MROA 2HBZB 2GO8A 5HANA 2QFJA 1XNRJ 3Q8UA 4LF8F 3PV8A 2DR9A 3LGHA 1PJ7A 2HVHA 3EMTA 4FZVA 3LQVA 3GU0A 3M8RA 2JEIA 1PIEA 4RUHA 5D0EA 4PWWA 2BANA 5E0OA 2HK2A 1AB8A 3HF5A 4G1PA 1ZOTA 3FUYA 2XGQA 3N01A 3SSQA 3FMWA 3W9IA 2RB7A 1APSA 1OWXA 4FYVB 4A47A 4ES1A 2FGOA 4WJBA 2V4QA 2GIQA 5CYMA 3GJSB 3NGTA 1OQ6A 1KR4A 1RYRA 2HHXA 1DBDA 4F02A 1H73A 3RZAA 2CNOB 3DGVA 1HMVA 5AXNA 1RADB 3H5UA 2CDQA 3TR5A 3JTOA 4XDDA 4DV0J 3MCSA 4PWDB 1B0PA 1NO8A 4KB7A 4N8OA 3EVWA 3SDEA 1ZA2B 4N5SA 4NA2A 2E5IA 4LFCJ 5KOXA 3MI7X 2Z4PA 4F7VA 1JLQB 4O4GA 3FFIA 2YNIB 3LP1A 3AFGA 1FDAA 2Z30B 4P72A 1C1BB 2H65B 3KKFA 2AU0A 5KT4A 1U24A 3ILIA 2VA3A 5F8JA 2XMKA 2QMUB 5GAEI 2AF6A 1X9WA 2YX1A 4A48A 2B9XA 5KG1A 3E01A 1P8GA 4OJ1A 2IRUA 3HM9A 4ANDA 1F3FA 2HPUA 4FPRA 2ASJA 1RCOB 4I2QB 4CZCA 2OPSB 4RNHA 4KGKA 2XHCA 1BQNA 4KC5A 4OFZA 4DV7F 1VC5A 1HIYA 4DXLA 3F0NA 4ETZA 2AQ4A 1KQKA 2HFUA 5CAAA 2MY7A 3SFGA 3JTPA 3M9NB 3FBCA 3RBXA 3KJVA 2YWWA 4C3MA 3RR8A 2P9GA 5KFUA 4OI6A 3DDNA 3TARA 3FZ2A 3JS9A 5KFGA 1XMBA 2F8MA 4U6PA 2R2UA 2ASYA 4ZCIA 2EG1A 4LRDA 3W7BA 4GVBA 4OHZA 4A46A 1IKWA 1R0AA 4A8OA 2AEMA 1LOUA 3OLAA 4MK7A 5K8NA 1UFKA 1Z2LA 4HT7A 3UNYA 1IR1A 2B9WA 4EEYA 1SL2A 1DFDA 1FDNA 3S1TA 4PG8A 1UVKA 2N7CA 1BHNA 3TW0A 2GJ2A 1QE1A 2DT9A 2ZZNA 3H2UB 3KJQB 2MY8A 2A3JA 2DNKA 2EK6A 4FVCA 2IY5B 1FEHA 1YZ6A 2APOA 5EWEA 4C8LA 2COLA 4J7CA 4WF9Q 1UEVA 1RI7A 4OI2A 2DHHA 4PUOB 3SCIE 1B64A 1E6YB 3DOKA 3KLIA 1VLYA 1H38A 1GMUA 5DETA 2NXJA 4LT6A 2VU5A 3B8HA 4G1QA 2FVSA 4NXNJ 1RT2B 4JI2J 4F36A 4C8NA 1QAXA 4ZVTB 1M5KC 1XR5A 4ECRA 3DOLB 3TWZA 2V2QA 2M0GB 3UO0A 3AAWB 2OD6A 3IBWA 2HYIB 4I56A 4QYZJ 4WTYA 1UEUA 3UQSA 2EKYA 2FVCA 1I1GA 2YVSA 4I6YA 3OLBA 3T1HJ 3H4BA 4JI8J 3KUHA 2EWHA 1VBZA 4NLWA 5DLGA 2BJEA 1ZTTA 2BE2B 3TX8A 2H5JB 2Q43A 2LEBA 2V2VA 4RW8A 5K9FA 4ES3A 2W7OA 3JQKA 1OY6A 5C2CA 2QA4G 2ZD1B 2XNRA 2HIYA 4RZRA 3BEGB 5L46A 2RU3A 3QJJA 3GQCA 2CNKB 2AIRB 3BPDA 4Y6IA 2E9TA 4YOEA 3CUNA 1VDHA 1H98A 2CJBA 4PWDA 2PIIA 4B3TJ 4DCPB 2N3LA 2FLPA 4HTIA 4KHPF 2JLFA 4DR1J 1NNDA 4RBUA 1KQFB 2ZUAA 1JLQA 1S99A 4P7VA 2YNIA 1KVIA 4DV2J 2QLJB 2DXFA 1TTHB 4YFUA 1C1BA 1BUXA 2WSFC 5L1KA 3I4PA 3M6UA 2DJWA 4ZITA 3P6YC 1H3DA 3AJDA 2B9EA 3HFKA 4WBFA 2ROEA 3AXMA 3M05A 5L1IA 2HHUA 2VG5B 4I2QA 2OPSA 2G0JA 1CVJA 5C2GA 3KNAA 1UW4A 4TQRA 4EI2A 2DNPA 4JB8B 4R0EA 5HLFB 1YBUA 3MAAA 2C28A 1MWQA 3NOCA 1XTZA 4DU7A 5D0HA 5B0GA 1BMQB 2C3UA 5KT7A 3H59A 1G3OA 2HGNA 2QLFB 3MPYA 2GAGC 3W64A 4K4TA 1H2VZ 2OFHX 2RU9A 3Q8VA 2D41A 3GFXA 3UVJB 3FQLA 1RHJB 4ZPBA 2Z58B 1K44A 3FRZA 4OV1A 4ZHRB 1YJNS 5KFJA 4LFAJ 5B0AA 3VAFA 3BO3A 2FHMA 2DNMA 1FD2A 5A8WB 1LFPA 4HHHA 2ZNYA 4K0KJ 3P4UB 4DFMA 3QATA 4NLXA 3NGSA 3PM9A 2HBYB 1FWPA 4I4BA 4WZQA 1W25A 1NK9A 3H4DA 2V94A 2VKZG 2KHDA 2Y1RI 1NKBA 1WF0A 4LMZA 4UZCA 2UUBF 2HS0A 5DG8A 1NSQA 5ETMA 2Y9HA 1RXOB 2AJFE 4WFZA 2CQGA 3ZTOA 1B0VA 1I5OB 5ETQA 1NJWA 2V4JB 4J9LA 2IVFB 3QPIA 4JI7F 1GTEA 3HD1A 3CJ0A 2Y1JA 2RQCA 1TAQA 4CNYA 1TKZB 5ETNA 3GV5B 5EN1A 5D0RA 3WBZA 3ZTPA 1E6YA 4QZVB 2QJ3A 1P6TA 1HW8A 1C4AA 3KG0A 3W1YC 4NLQA 2NYIA 3H2VE 3HZGA 3W9HA 2ALZA 5HVGA 1RT2A 3FCHA 5JVHQ 1HI0P 3ZC4A 2W24A 4YN3B 1U0SA 4YB5A 2BABA 4IG0B 3DOLA 3WX4A 4DV4J 3W3SA 3IBFB 5HK4A 3ZTQA 4IQXA 3CF5Q 1U1PA 4QOTA 3QFWA 1OMSA 2CQ3A 2KVQE 4EU0A 4ED1A 3OTOJ 4AL6A 2RUSA 1Q8LA 4OZ2A 3ZZ0A 5CYJA 2FJAB 2WHOA 4DSJA 2XNQA 2BE2A 1KLNA 3TP2A 2FVPA 3NAHA 2I0XA 1T7PA 1SKWA 3JYTB 3GP9A 2ZD1A 2N3OA 3KHHA 1ROFA 1HI1A 1M5VC 4NCAA 3ICLA 3PFOA 5KG4A 4NRUA 3TEGA 3W2VB 3THVA 2EKNA 4Y2MA 2CQHA 4KV8B 2JH3A 2ERRA 2GVZB 3W61A 3LH2S 4ELTA 4CLLA 1FRKA 3HSZA 4JUZA 2CQ0A 4W90B 4QPTA 5DLFA 1UKUA 4RBVA 2HRTA 4KFBA 2R8GA 2HQIA 4DV3J 2IC3B 3IAM9 2GA7A 4C0BA 5F41A 1UTAA 2CPYA 3G96A 1VQ8S 2E5LJ 4IO9Q 3D9BA 4DN9A 4C7QA 1VBXA 3KTQA 4HR2A 1G6BA 3QFHA 1PYOB 2DCLA 4HHJA 4C8ZA 5HQMA 2OD4A 4HT5A 2DHGA 4O3QA 2VG5A 3DLKB 4LRCA 2OHDA 3L95X 5HLFA 1QAJA 3TZWA 2B4UA 1M90T 1FRHA 1IQTA 2PI5A 5DM7Q 4NLVA 4I0WA 4P2SA 5KG5A 1PYSB 2GMJA 4X64F 1RHRB 4YHHF 4J9SA 3A8KA 1NJZA 5AE3A 3UVJA 2ZHOA 2B6AB 3IR6B 2W2OP 2OI2A 4ZHRA 3K5OA 1S79A 3ULHA 5KFNA 4HDGA 2PDAA 3HHNB 3ZNJ1 5A8WA 3DRPB 1XEZA 3R5BA 4WCEQ 2ZH5A 5E2QA 5BXIA 5ETKA 2UXBF 1WKLA 4DWIA 4OYPA 1WC3A 3OHAA 1SKUB 1UPPA 4DN0A 2DXDA 2Q6CA 3U1MA 2OKQA 4JV5J 2LYVA 3N28A 1TAUA 5KFAA 1A6LA 1IKVB 5T7LB 3ISND 4DS5A 4L3NA 4O44B 1YQHA 4CYUB 3D54A 4HL9A 2HFZA 5KOWA 1S4FA 5HVHA 1D09B 4TYBA 3FVYA 2MZJA 2V4JA 3NY0A 4ITSA 2J9EA 1XK8A 5HJXA 1AYEA 1EAYC 5AE1A 3C19A 1TKZA 1HBUB 1FDDA 1TMMA 1V3ZA 1Q5YA 1U8WA 5F8NA 4USWA 5KFEA 3TZZA 2VQEF 2Z56B 1IBMF 2W7PA 3ELHA 1EETA 4X4TA 1R27B 1X4BA 4YQWA 4C6AA 2GNKA 2BJ3A 1KS2A 3HULA 2VUGA 4B9SA 3HVTB 2MGZB 3GV8B 4I6WA 4IG0A 1TFYA 4ZPWR 2QV6A 1Q8BA 5EUHA 1M5PC 4MYTA 4UQTA 2JZ5A 3T19A 4RX6A 3BKFA 4LF7F 3H90A 3N4WA 1FCAA 1VQKS 1XNRF 1V3SA 1WG1A 4DZ6A 4KQZA 1RWNB 3IR5B 2XY6A 2R8JA 1TUWA 2AMCB 4F04B 2DPJA 1YJUA 2PSZA 1I3OB 1NRKA 2FZGB 4QIFA 3JYTA 3MEEB 4ZVFA 4ZA1A 1VR6A 3MM5B 2I38A 1RAGB 3VV2B 1UAWA 3BN4A 4ES2A 3W2VA 5HBMB 5FJ4A 1R8PA 3FK4A 1Y5LB 4KV8A 3HK2A 3KYLA 2EFGA 1C0UB 1RISA 3NCRA 1U47A 1TK8A 3EGNA 1MLAA 2B8PA 1UFWA 4XTTA 1WTBA 3AODA 4FYDA 1RT5B 1M5SA 3A8JA 4N76A 1ZPVA 4DV0F 7FDRA 3CCUS 4TY8B 4H54A 1NK6A 2JEGA 3EGZA 2VPZB 2YBVA 4ZMMA 2IC3A 1JLFB 4LFCF 1NSPA 2HZVA 3Q23A 1JXEA 1NDPA 2JVRA 2PT0A 1IR2A 4K59A 4U8YA 2C2RA 1T95A 3CJ2A 1HL6A 3NLCA 2VFTA 1R31A 3DLKA 1DURA 1T9WA 4RUAA 1CQMA 3G4SS 1N56A 4TLQA 1MSWD 4R25A 1RTHB 4QR0A 3NOGA 4LSNA 2MLZA 3UCGA 1QSSA 5KFQA 5B7WA 2AJ4A 3D3BJ 1TKDA 3POTB 4YS2A 1YBAA 7AT1B 3NGRA 4U95A 4DF4A 3SQOP 2DNYA 5KFCA 3PNIA 2B6AA 1F5AA 3MTJA 1YSJA 3G82B 1H7XA 4F4AA 1VS3A 5D15A 2OPPB 4DPWA 3DRPA 4YR2A 3EPGA 3LGMA 3QSIA 2IM1A 3HHLB 2FJEB 4ZPCA 4F2RA 1XMOJ 1T9VA 2DR6A 1HNIB 2MKIA 2Y0SD 1S97A 3BYRA 2DNRA 1EJ7L 2VJUA 2L08A 4BC9A 1IKVA 2E7VA 3T41A 2K7KA 1HQ2A 4ZIWA 4DZDA 2VBZA 1KDNA 4O44A 4CYUA 4FP9A 3QSYB 4J37A 1DTQB 2LDIA 4DCJB 1KD1T 3QGHA 4DOZA 2YWGA 3TZXA 2W9BB 3HKWA 3MCOA 1SQEA 1VQOS 4RNFA 2J9DE 1RT3B 1HBUA 2QT7A 3HP6A 5GADU 1RU1A 3TX0A 5HATA 2PC6A 3T5KA 2GVDB 5KG3A 1SUQB 3LP2A 2C3YA 1Y3KA 1RTJB 5KAKA 1UPMB 2LCWA 4MIBA 3HVTA 1GT8A 2J76E 4ZVGA 4DR6J 4I68A 3N6NA 4OHWA 3N0VA 3RRHA 5G0RB 1WDTA 5HMYA 3PJWA 4NXNF 4JI2F 3MGJA 4ZJLA 2HBQB 4P2XA 2VC1A 3RBZA 1FHTA 3LANA 2HAIA 2K1RB 2IRYA 2MKKA 1L3KA 1UVMA 1RWWB 3IC1A 3CDUA 2C2MB 2RIJA 2BOAA 2K06A 3R27A 2HRUA 2J6TA 3D7SB 3F73A 3M2VB 1QSYA 4OI3A 3R3TA 3BKTA 3T1HF 2Z8QA 3PW5A 4PXEA 4JI8F 4DSFA 2F9JA 3AB2B 3MEEA 3MM5A 1T11A 2OEKA 4PG5A 3G6XA 4ECSA 2IMOA 2MHNA 5HBMA 3LOUA 5IT4A 8ATCB 2R9LA 4WP3A 1FRJA 1C0UA 3KK3B 4RW9A 3D3CJ 1YG0A 2DISA 3THPA 5M2RA 1R3NA 1WEZA 3R5AA 1QTMA 3CC7S 2V34A 2YKMB 1YZ7A 4IRDA 3H5XA 3W5ZA 1RT5A 4ILLA 1U6ZA 2PEBA 3OR2B 1X4CA 5C5JA 4TY8A 4B3TF 1X31C 2MZTA 1JLFA 2DK2A 2MQQA 1CJUB 1UWBB 5KG2A 3Q89A 4DR1F 2QTWA 2PI4A 5KFRA 4ED6A 1GFWB 2ZFHA 1LWXA 4LQ9A 3ZZZA 1MW7A 4DV2F 5SZTA 4DX7A 2LMIA 2N82B 1F1BB 3QMQA 3VVTA 2JEJA 4BBYA 2HVZA 3HSDA 2EFOA 2DNHA 5H9FK 4FF1A 2Y1IA 1RTHA 1K8AT 1LK5A 1L3TA 3OV7A 3N79A 3CPWR 2W4PA 3GCWP 4F3OA 3F41A 1S1WB 3BF4A 4NI2B 2MKYA 3RJMB 3POTA 2YWKA 1S72S 3DHXA 4U7CA 3BGFA 3I9ZA 2VHGA 4XPEA 5F8GA 3EYZA 2IM2A 3PG9A 3G82A 2YH0A 4PRFA 2Q1LA 2QA2A 1EARA 2VFUA 2OPPA 4USVA 3CEDA 4OX6A 1I51B 2J0XA 4TU8A 1FTCA 3W5YA 1S9FA 2G2OA 4DR5J 2EFQA 4EO8A 1WSRA 4UOHA 4LFAF 3ET6B 5K8PA 1HNZJ 3IS9B 1FJGJ 3VQSA 3MZIA 4K0KF 2DD8S 3CCWA 4NLPA 4ECUA 2H48B 1S77D 4J9UE 1DTQA 4YB6A 4N77A 2F8HA 2OEJA 2W9BA 3MR6A 3KXDA 1F60B 1ZH5A 4W4MA 1SPBP 3BSNA 2M9KA 2HLUA 3GPAA 1YJWS 1RT3A 4PXCA 2BJ8A 2F1FA 4B9MA 2ZOMA 4ZIVA 3MECA 2I1RA 5D78A 1C0TB 3V81B 2ZE2B 3RUBL 1SUQA 4I69A 1ULRA 2NPFA 1RCXB 3U7JA 1VRQC 1RTJA 4NLOA 3MAHA 3T5HA 2RRAA 2Z0GA 4NA1A 4F4WA 5I3PA 4A8XA 1NB7A 1S59A 3WIUA 3FCWA 4X65J 1XC9A 5DDPC 2M4MA 1R8CA 3G2XA 2BOPA 1GXUA 4J5OA 1PBUA 1D0EA 4PKDB 1RUSA 3SV4A 3JSMB 3CIZA 5G0RA 2J9CA 2VOOA 4DR7J 2RVJA 3OTEA 1VBKA 3UNGC 3UPFA 2K1RA 4DV4F 4AL7A 1J5OA 5H9EJ 2D3ZA 3JSRA 4USUA 4IKAA 2AYMA 3K17A 6FD1A 3V4IB 5KFOA 2CG4A 4B3OB 5IT9Y 4CO1A 4J9NA 1NDKA 3VR1A 2H4YB 5C7PA 3OTOF 1JKHB 2F4FA 3TI0A 4JP8A 1S6UA 4A8KA 4DLEA 1R8AA 2WSEC 2HHWA 2BKNA 3DGPB 3IO1A 2Z2MA 4U96A 1RAHB 3OQ2A 2R8KA 3BBBA 5KFPA 4A8FA 3KK3A 3QYYA 4IUFA 4CLKA 4AXJA 2YKMA 2CQCA 4M5GA 2VFVA 1D1UA 4WXOA 1UVIA 2JFDA 1F2GA 3J7Z5 3OR2A 4RJVA 2GIFA 4J9OA 1S0NA 1IBLJ 1FRMA 4DHVA 2CDRB 3H8YA 1CJUA 1UWBA 5CD4A 5D4PA 4Q7AA 3MMJA 5HVFA 1GAOA 3M1VB 3NMRA 2Q66A 1WUUA 4WTOB 1RAAB 2XHWA 3UN2A 5KFKA 2DRDA 2MZRA 3TUJC 2WBMA 4NYPA 2BVZA 3OVAA 3MR5A 4R8UB 5A0YB 4DV3F 2NZ4A 1OO0B 3PYFA 1PGZA 2UVUA 2E5LF 2F63A 4M5MA 2DYAA 4ZVOB 2WW4A 2LP4A 2V0NA 2IVYA 4ED3A 3A4TA 3OTCA 3RRKA 1S1WA 1RGVA 4NI2A 1KRPA 4NLYA 1RE1B 5JUMA 1BQMB 1RJJA 2NR0A 3CXCR 2OPQB 5F0WA 2J0QD 4MKAA 2ZC3A 3PR4A 3MURP 2XCAA 1JLAB 5KTQA 1QAIA 1OPIA 2MXYA 3H98A 4ILMA 1PG5B 5GAHU 3KHLA 3NAIA 2V63A 1WC5A 3TANA 4WP9A 5KFBA 3IGNA 4EO6A 2XI2A 2DGTA 1RK8A 1TR0A 4CO4A 1FF2A 4B3RJ 4NLSA 4OZ1A 3NNHA 2YWFA 3ET6A 2BKOA 1FKAF 3Q83A 3PFEA 4HLBA 5KFYA 4K4VA 1ZS6A 3ILLA 4NEYA 3EXYA 3CD0A 1L5UA 2BA9A 3PYDA 4OJGA 4QJVA 2G2YA 3RB6A 1HWKA 4GKJJ 1NPKA 2NXEA 3W2WB 4JV5F 1TL1B 4RPFA 4RBTA 4R5PA 2KYZA 2CVEA 4KKOB 3K89A 3QIPB 1V5IB 2IM3A 1Y7PA 5F8HA 1C0TA 4AT1B 3Q8RB 3V81A 2NXNA 1VYAA 2XBPA 2ZE2A 1HHSA 3K59A 1FXDA 2CWXA 4F25A 3C15B 1S9EB 4Y65A 4BLGA 4UY8T 2JSXA 2JWNA 2SXLA 4KJIA 1UP1A 4X62J 1XWLA 1AUDA 2GC8A 3HHEA 1FEEA 4WP8A 3QT5A 3PX6A 4QWAA 2KHCA 2E7XA 2D74B 3HFZB 2RDJA 2H51B 3JSMA 1F9HA 1JLCB 3W5XA 1U2CA 2YX4A 1J27A 4RL1A 5ETLA 2AYGA 4JI1J 1C4CA 1SH0A 2ZVIA 1T3OA 3CGIA 4E2FB 2KB2A 3EM1A 3RYLA 3V4IA 4B3OA 2D1CA 3UDLA 2VPWB 1TVRB 4F26A 3MM8B 3QAEA 1CC8A 2YQ1A 3UDVA 2MKSA 1O6XA 3JQMA 2CJYB 4WE1B 5JXSA 4ALZA 1FFSB 3M30A 1DTTB 3DLGB 5M2UA 2V8PA 3DGPA 3PO4A 3WIVA 2R2TA 4FF2A 1VI7A 2ADBA 4CLYA 4C97A 1OQ3A 2AHOB 4HTJA 3DKDA 4WFNQ 3MM6B 2VL1A 3JQJA 2DO4A 1VISA 1NHKL 3IAS9 2A0FB 5L1JA 3T9NA 4OX7A 2LU1A 3ZZYA 1F3VA 4ZPTR 4A8YA 5CABA 1TKXB 5L8RC 4OLOA 1DQ8A 2V4RA 1FX2A 3OXGA 3M1VA 5J2MB 3C46A 2EC0A 3V6JA 2FDNA 3OT9A 5F0UA 3C6TB 2JJ4D 1LWFB 3OXFA 1Q0NA 4R8UA 5A0YA 4IH5A 4WYWA 3D1HA 3ISNC 4RUCA 2H54B 4MK8A 4ED4A 4KH0B 2AGPA 2DCUB 3M8WA 3HLUA 1B3TA 4AD6A 2MEWA 2I8EA 2J5AA 3CD7A 4OHVA 3OSNA 1URRA 3DI6B 1RAFB 2CG8A 3NNCA 3OD2A 2XLKA 2CRLA 1BQMA 2DH7A 3R7NB 1V3RA 3OSPA 4DCOB 1RT7B 2HHSA 1JLAA 1U4BA 4GMKA 5KG0A 1QLNA 4QWCA 1IJEB 2KG1A 3FZBA 5A6PA 1NCLA 1Y5IB 1U26A 1NSAA 4KGXB 2NPIA 3K7RA 1UEKA 2OMOA 4O3NA 5AXKA 4Q43A 1J5EJ 4ZVUB 4QR1A 1AROP 5IFMA 1X0PA 1FKPB 4ED5A 3IWXA 3I31A 4ID5B 4X4SA 2V2KA 2KN4A 1S12A 1RBOB 3QO9B 1FWLA 2MJNA 2KXNB 2D3O1 2R42A 2GX8A 5B0DA 4DFPA 3OBIA 3MEKA 2QMXA 2FD2A 1YJRA 3AH6A 1TMJA 1WF1A 1XMOF 4W92B 4USMA 3W2WA 2VZ9A 1TL1A 2CZ4A 5U47A 2DGSA 2CPHA 2HFNA 4N47A 4DV5J 3CJRA 5KFTA 2V8VA 1L3SA 3GJQB 4OHXA 1VGYA 2WAQD 4KKOA 4MJKA 2I6WA 5L39A 2ALYB 1YVFA 3QIPA 1IXKA 3GIMA 3QJPA 2LQ5A 3MCMA 1HR0J 1HPZB 2E1PA 3KJNB 5DQHA 4ZCMA 3C15A 1S9EA 5GMKa 3BQ1A 3RBDA 1HWUA 4FXDA 2AYEA 2DKOB 2U2FA 2W4DA 1WG4A 2YKNB 3LF0A 4ETXA 1JLCA 1NHUA 4CLFA 1EHWA 3TVKA 3Q22A 2R7OA 2LEPA 4OYOA 2XS5A 1LKZA 4JI6J 1QVFR 3AD9C 1BD6A 4HI1A 3DXSX 4ELVA 4DR6F 2YKQA 1GXTA 2IJNA 2J6SA 1Q16B 3BBFA 2VV5A 1S9GB 4B3MJ 1WACA 3HT0A 1KWMA 1TVRA 2QMWA 3MM8A 2RRNA 1FNXH 2DHAA 4OMFG 1H2TZ 4WE1A 5F8IA 3SQGB 1DTTA 3DLGA 3CW2C 4KSEB 5CZXA 4J9MA 4EFAC 2V8HA 1XERA 4YB1P 1RBLA 4ZLLA 1U09A 3MM6A 4LR7A 1TK0A 3MHYA 4MYUA 3J81U 4IOCQ 2WVBA 4O3PA 1VMBA 1WC0A 2OLWA 2P6SA 3I96A 4XDCA 3ITHB 1K47A 3NG8A 4KPCA 1N36J 1VQNS 2HW3A 4QW8A 3O6QA 1U45A 4NZ6A 3PIOQ 4IFYB 3VTIA 1TKXA 4JYAJ 5AJ3J 3RAQA 5IWAJ 3Q24A 2WW8A 4FF4A 2RSQA 3V5RA 1VQPS 3PEHA 5J2MA 1XMQJ 1FK9B 2ZH9A 3LAMA 1KN6A 3LO3A 1SJFA 4P7TA 3T1YJ 3C6TA 1LWFA 3TJAA 2WCXA 3PHTA 2F4VJ 4K4WA 1TL4A 3FEXB 3GG1A 1T9TA 2CA9A 1NLKL 3IWNC 4F50A 2ZKTA 3BBCA 2L9DA 4KGZB 3KNGA 5MLCV 5L9XA 1HBNB 5KFDA 4KHRA 2ZBRA 4Y2AA 2R7QA 4CH0S 3TVYA 3DI6A 1FE4A 2HHPA 2HHQA 3R6LB 4EYHB 5DQGA 2DGOA 4OLPA 5DDOC 4NX9A 4CLTA 1CS4B 1RHKB 1RT7A 4Q8EA 1DRZA 1J2VA 1HQEB 2XY7A 2D9OA 3R6GB 4IH7A 2Z2ZA 2A18A 5B0FA 2N7YA 5FLXY 1RA6A 2M7SA 3BSAA 5E3CA 3B54A 4D3HA 3G8SA 4PR6A 4Q2MA 4LIWA 1M1HA 1PO6A 3GB0A 3SYZA 4RWWA 4EK2A 4Q45A 4QU6A 2GFFA 4RNMA 4OYBA 1VQ9S 4ID5A 1VK8A 5LJ5Y 2BJ1A 2P5VA 5ETOA 3QO9A 4MIAA 3TUIC 2DNQA 5A8RB 2Y8YA 4PYDA 4MH8A 4ZPVR 5LSOA 1Z1ZA 3W60A 1R6YA 4DMZA 4WU3A 4DR5F 4N56A 2E5GA 4KR0B 3RB4A 2GHWA 5E41A 3ENWA 3VAGA 1HNZF 1UCNA 1FJGF 5J2NB 1VC0A 3T3FA 4OZ0A 3TOQA 2X1AA 2R2SA 3KLVA 4CT8A 2AT1B 4TKTA 3MPDA 5D3GB 3K8VA 3OTDA 3ETMA 3MFHA 1B70B 3VHQA 4I7FB 2D3UA 4ZKAA 4DL3A 1IN0A 2BUNA 1F5CA 1ICEB 5DJBA 3PRVA 3RU0A 2W01A 4DR4J 2XMUA 3TUPA 2YKNA 2XMVA 1MMLA 3OFGA 2ASDA 2PA8D 1E6VB 2XSFA 3CO9A 2ZH1A 3MD3A 4OZLA 4N7TA 2HLTA 2U1AA 2JX2A 2BJ9A 4X65F 2GS8A 1WOPA 1M1GA 5T14A 3NL0A 3MMBB 1WHYA 1FRLA 2ROGA 1RAOA 3OFHA 4DPOA 1S9GA 2XYPB 2E9ZA 4GO7X 4DR7F 3NCQA 2Z2YB 3DMJA 4ZCLA 4L72B 5F9LA 1NSKL 3FNNA 3IRWP 3MFIA 4ZPDA 3SQGA 4LBIA 1SJ1A 1SJ3P 2W4CA 2IMWP 3Q86A 4GKKJ 3AHPA 2GJIA 3PZPA 1U8SA 3SSSA 4C98A 5ETVA 2RD5C 2FJWA 3Q2SC 4BDPA 2Z2LA 2YPZA 4IDKB 2MHEA 3L4BC 4DL5A 1UWAA 2EVZA 2O67A 3AJ2A 2W9AA 2CPEA 1KOOA 4BWMA 3ITHA 8AT1B 5LT5A 2OSRA 1Q82T 4KRWA 4CNZA 3CTRA 4IFYA 1NK7A 4DUYJ 4ZLJA 2AZ1A 4M63A 4DV1J 2X51A 2YTCA 4JI4J 4X4NA 2PEHA 1FK9A 3GWCA 3LPYA 1EB0A 4ZK7M 1HW9A 1RWUA 2NCKL 2YKOA 3D4JA 4OHYA 2E66A 4UOGA 1U1OA 2IYIA 4QPXA 1IBLF 3X3UA 1SL0A 4E8UA 3Q2TC 2OO4A 2DGWA 1N5TA 3HPOA 1SL1A 3WQPA 1HBNA 4USKA 3R97A 2B4VA 3NEKA 1A7GE 2OSQA 2R7TA 4JV0A 1HARA 2KJVA 2QE5A 5KFWA 2DHXA 1IVZA 3LALA 2OMLA 5HMZA 1W2IA 4PXBA 3HCXA 1CS4A 4YUDA 1HQEA 5D6GA 3CJ8A 1JNRB 3M32B 3SBMA 4F0HA 5HROB 1CEZA 2HG4A 4J9PA 3PW4A 1PKUA 5IC6B 2DIUA 3PX0A 2OGUA 3IM8A 1VJWA 1N88A 4K2JA 4N41A 1LK7A 4P71A 1R43A 3KFWX 2BJ7A 4CTAB 1R6VA 1SI9A 3NS5A 5FIIA 4J9KA 3KMQA 3D1OA 5A8RA 1JX4A 3NCPA 3FQKA 3C16B 3W8GA 1XN9A 3L7PA 4B3RF 3EZOA 1CJTB 1FTRA 2ZH4A 2MQOA 2NYHA 3ENAA 1UZDA 2Y8WA 1YGYA 2VPYB 3MXHP 4NXMJ 4CIOA 1WOSA 3NP5A 3PW7A 3FMBA 2AJQA 4GKJF 1HWIA 4M5NA 3KLHB 5D3GA 3BREA 4H4MB 1N32J 2HBRB 3MMAB 1TL3B 2VDHA 4TNOA 3AT1B 5KFSA 1H0HB 3GFYA 4KE5A 2GIRA 1ZAVA 3HZEA 4NRTA 1FFWB 2VD3A 3C3LA 2PN6A 4MIWA 2QYCA 3NS7B 4M95A 4Y2KA 1YJ9S 2EC2A 2CKWA 3DLJA 2CQ2A 3M8SA 2W2NP 4MK9A 4DQPA 1E6VA 4LF1A 2NLWA 5LL6d 2PFDA 2F3JA 4K2XA 4YB7A 4X62F 2HNDB 4QYRA 1WWHA 1URNA 3FEZA 1T8EA 2CPXA 5E5NA 1NH8A 3MMBA 3MR2A 3NWGA 3EZUA 2JDJA 4JI1F 2HURA 5ETSA 5GVQA 2BXJA 3T9ZA 1IBKJ 1EKRA 5DDRC 1QY7A 3H7HB 1UVNA 1RTDA 1OSDA 3GG0A 3A3NB 1WC4A 3BR8A 3KLEB 3FRYA 3CJSA 1D8YA 2QEXS 3L7OA 2CWKA 1UJ6A 3PDNA 3IBCB 4LVNP 2G2ZA 4IDKA 4P9SA 2UUAJ 4WKRA 1AZSB 4OZ3A 2G9OA 1GX6A 1VCTA 4YP3A 3PEJA 2DH8A 2JHEA 3KJFB 2RKIB 1N54B 4DV6J 2CZ9A 4OJ3A 1TP7A 5HAOA 5J1NA 1ZZNA 4P2FA 3V4MA 5IZHA 4IO1A 3KDOA 2UVVA 4G1IA 4USTA 2PD1A 2NXCA 2WVEA 3M9OB 1SH2A 4M5KA 2YWEA 2E1MC 1FJCA 2J7UA 1ZTWA 4EWTA 2EFPA 2PMWA 4J91A 2QL5B 1HQUB 1KP6A 2CQ1A 1SC6A 3GSIA 2UU9J 3BO4A 3L3CA 2YXLA 3CVKA 1Z4UA 4TYAA 2FPHX 1CPZA 1FE0A 4CO2A 2HQFA 2DY1A 4M5JA 2B56A 2ACMA 1GMWA 3R1HA 5I3UB 1SKSA 2QRRA 1KFDA 3N6LA 2LEAA 3M32A 5HROA 3PCOB 2R8HA 2GMHA 1U6FA 2XULA 3I55S 1PC5A 1YK9A 4PWUA 3W66A 1V5VA 4X2BA 4ECWA 2PFFB 4CTAA 2RHSB 2IJRA 3NGUA 1NH7A 1JK9B 2KH9A 4RNNA 1W26A 4B9TA 1M5HA 1HNXJ 3HJVA 5D0GA 3QIDA 4DFJA 5KFXA 3EX7B 1WKKA 2MKHA 3I9V9 1J5EF 3C16A 1WKJA 1SC4B 5CXTA 2BR0A 2ABYA 2W9CB 1CJTA 3QGGA 5EX0A 1NJXA 2MSTA 3ILJA 3O8WA 1ZYQA 1NM2A 3PACA 2I5JB 5IT0A 2YWHA 3FC9A 2MSSA 4UOFA 3UN5A 2HHVA 3CCLS 2IYGA 2ZDOA 2J0SD 1V9OA 2QA4S 5G4DA 3M6XA 5DZ7A 5KG7A 3KLHA 3GLJA 2H9ZA 4H4MA 3E3XA 2EFNA 1KSPA 1TL3A 1LXNA 3RAMA 4LREA 4DV5F 3ZNUA 2FHJA 2FZCB 4XAKA 2BQUA 4UQGA 1O5JA 4PG4A 4RLEA 1D3WA 4RWXA 1HR0F 2K8GA 4ZVPB 1FFGB 2ZDPA 3R8YA 2HNDA 3RRGA 2DNZA 4C0OC 1YKWA 3MDFA 1R7IA 4GC6A 2VOPA 4FXWA 3R9LA 2IM0A 5IV4A 1BC6A 3KK2B 5F3ZA 2B5JB 4JI6F 3G86A 1RWVB 1H2UX 1SKRA 3BGOP 3HD2A 4A4JA 4PUOA 2ASLA 3CDAA 4P74A 1GTHA 1VIOA 5AXLA 2OELA 3KHRA 1NU4A 4B3MF 4L75A 3KLEA 4LBPA 1G7CB 3M6WA 1QM9A 1IM4A 4N8NA 2UUWA 1H7WA 2UUTA 4ECQA 4G6VB 3P8BB 5E3RA 3HO1A 4DL0C 1AZSA 4M1KA 4C4WA 1I94J 1VQSA 3UN3A 2XWYA 3DCAA 1YRTA 2RKIA 2E5JA 2Q79A 2ZJPQ 1P9QC 1PJ5A 1N34J 2RDIA 1ITPA 1NEEA 3SXLA 2HS3A 2IA0A 5JJBA 4XIUA 5H9EK 5B0BA 1ZAWA 3D68A 4NLTA 1ZM4A 2XTJP 1IKYB 3BGLA 2QA1A 5FDLB 1N36F 2DY9A 3ZZOA 2HQGA 4JYAF 1S6QB 2CJXB 1TFWA 5AJ3F 3KG1A 4OYXA 5IWAF 2GV1A 2G0CA 4RW7B 1XMQF 1HQUA 2BDPA 3BZQA 1CJKB 4O0IA 2VB6A 3T1YF 2R7WA 4NZ0A 3SV3A 4Z37A 1HD0A 2BX6A 4LBHA 4O3SA 2F4VF 3DNCA 3S8SA 2DH9A 1SJ4P 1U0HB 2MZQA 1DY3A 2FB0A 1S1UB 1S0MA 1JJ2R 3LP0B 3D2WA 4C0HA 1Y00A 3DLLQ 4KHMA 5LM7E 4ANEA 3EWGA 4WK1A 5LXYA 4Q0BB 2DB1A 2FZKB 4C48A 3BGUA 2XCPA 2LLZA 3BS9A 3MOJB 1Q95G 5CA5A 4K8RA 4EMDA 2VQFJ 4MKBA 4CT9A 4K4ZA 4IOBA 2XMAA 2C2EA 4IRKA 3QWPA 1RU2A 1RAIB 4Q44A 3PJ9A 3E2EA 2B0GA 4URGA 3QZ8A 3TA1A 3RGIA 3I4HX 1Y11A 3TJ9A 3VALA 1JWWA 5D8HB 2W9CA 1RAJA 5HMWA 3MR3A 3F56A 2W7AA 5CYQB 2KXFA 4QQBA 3ZZRA 4IRCA 1B7FA 2X3GA 2I5JA 3GTYX 2P2CB 3W65A 3I5BA 3S6EA 1S49A 5GAGU 3MUMP 1X7VA 2VFSA 2LQBA 4NOHA 1GH8A 4LSLB 3ZZTA 3SEOA 5DRKA 3OL6A 3GR1A 3HVRA 4OYIA 4ILRA 1X4HA 2AEJA 1AA1B 2ZH7A 2AWZA 4NASA 1T94A 5K8MA 3A13A 4RW4B 3A3PB 3G6VA 1VQMS 3TQEA 3CCMS 3KDNA 1Q86T 1W7WA 4USIA 2A10A 4PG6A 1LFWA 4MT1A 1S6OA 4CP5A 3ETOA 3T5LA 2E7WA 1SC3B 3VAKA 1WF2A 3JAMY 3KHGA 4DR4F 3TUZC 1KTQA 3NWRA 4RU9A 1SQGA 4F3QA 5IQ6A 4KO0B 2NUUG 2OPRB 2WVDA 2KZMA 2KXHA 3B4DA 1ZETA 4ZS6A 3KK2A 4LRAA 3CCTA 1Q7YT 5B0EA 4LRBA 4LIRA 3J80Y 1YDLA 2B5JA 2B4PA 2C3OA 2RRBA 3MD1A 1KVJA 2E44A 4MKYA 3L9ZA 2KKHA 4B9UA 3CCZA 1OSCA 1QVGR 3CCJS 2XLIA 1FESA 2YY3A 2XMMA 4GVBB 3PRDA 1NPRA 1YITS 2DEIA 4DPTA 4ZN1A 2UV8G 3P5TL 1AFIA 5BR8J 1WSVA 4OL8A 3GFHA 2F65A 4GKKF 1QDUB 4L76A 5J2PB 1DHMA 4TY9A 2BRKA 4EUVA 1TV6B 2HVEA 2HAFA 1C1CB 1GX5A 2X1GA 2P6TA 4CWBA 3CDBA 3PO5A 4CH7A 4K4SA 1YBTA 3MUTP 2RDDA 3OFEA 1IKYA 5KFMA 2V9KA 1IBCB 1D9FA 2IIHA 2LQ9A 4CH1A 4DR3J 4NWBA 2DBBA 2ILYA 1VQ4S 4IR9A 1KFSA 3IM9A 4DUYF 2UXDJ 4M5HA 1S6QA 2EI5A 4DV1F 2VONA 5DM6Q 4JI4F 4RW7A 1N5QA 3K57A 1T03B 2BJDA 2XB2D 2N4CA 1R0CB 1CJKA 4IH6A 4CLPA 1NJYA 1T05B 2F7VA 1RSCA 3T5JA 4G1QB 5DQIA 2C22A 4DUTA 2RAQA 3CJKB 2G13A 3GYGA 2ZWOA 3QZ7A 4BCAA 1U0HA 4ICLB 3X1LB 1ZZFA 1S10A 3O44A 2C2NA 2GVZA 4ZVEA 1S1UA 2I9SA 3LP0A 5DS7A 1Q5VA 4URSA 2WSCC 4Q0BA 2HWHA 4DSEA 5EX3A 1X5TA 4F0MA 2HWTA 3CJQA 4X4RA 4Y28C 1PILA 3TQ1A 1WEXA 3NKYA 1OS5A 2MKCA 3R2CJ 1PC4A 3HX9A 4JI5J 3CWJA 4X4VA 2ZKUA 4JI0J 1SV5B 4IFVB 3AQOA 1EIYB 2VKRA 3PYGA 4FBTA 1CSJA 2DHSA 4RW8B 4FKYA 3CC4S 4LJMA 4X84A 3VCDA 2EXUA 4K4YA 5E33A 2LDYA 4QIVA 2OTJS 3H40A 2KJWA 3J7A1 1NK5A 1SJQA 2IHR1 2M52A 4CRJA 3KWMA 5CYQA 1S0OA 4PEOA 4DLGA 1SIZA 1VHIA 1QJHA 1YX2A 4YY3J 3GYXB 1CG2A 1JXVA 5GADI 3GJTB 4DG1B 4ECVA 3J7YU 4WYLA 2OIHA 3QGPA 4LSLA 2MKJA 4NEZA 5B0CA 4LVOP 3GZ7A 1BY9A 2DRAA 3QT6A 1KLMB 4K4UA 4WFBQ 2YNFB 2H4WB 4ZVSB 4HACB 2NSBA 2PE8A 3U02A 1N48A 1HKAA 4NXMF 2DGUA 3OL9A 4YR0A 4FYYB 1FWKA 4DS4A 4RW4A 4F2SA 4GVLA 1WNEA 3JTNA 1N32F 2HQCA 2UVWA 5AT1B 1X4GA 3ZTSA 2DGXA 4MFBB 3QNWB 1ZM9A 1GQEA 2CPJA 5T7LA 1N0UA 4ZLNA 3RAXA 1X9MA 3MAAB 4O3RA 2EBGA 5F8MA 1WHVA 4OX9J 4KO0A 4M94A 2OPRA 4PQUB 5CHCB 1DAXA 1DJ0A 3WC0A 1M0SA 3QT7A 4HI2A 2YQ0A 3TNVA 3T1AA 2ILZA 5A76A 2K3KA 2KFZA 3EDRB 4JBCA 4L73A 2ZC4A 5CCLA 3UCUP 3RBEA 2K3IA 1MNEA 3VWSA 2H5EA 2GGPB 3RB0A 1FERA 4DQQA 3P5BP 4DQRA 4LF4J 2V6AA 2G1DA 3CJ3A 1BXNA 4TU7A 1IBKF 5HN0A 3UR0A 4GO5X 3RB3A 3BSCA 2MGZA 4DI6A 3OVBA 2MDAA 3NMAA 2BMBA 1ZM3A 5J2PA 5GAEU 2JVOA 1GNKA 4KTQA 1CLFA 1LQ9A 2R8IA 2UUAF 1TV6A 3OFFA 1C1CA 2YX7A 3Q0AA 4AYBD 3G87A 2P9EA 1FDBA 4AXIA 1VBYA 1CJVB 2HIQA 3R1LA 3DRYA 2B9YA 1S1VB 4ELUA 4DV6F 3VGUA 1UVJA 3WDOA 4FYWB 1Q53A 1VFJA 4OI1A 3CCSS 3MWBA 4Y34A 1DARA 3CJ4A 1T03A 3EDQB 3K5PA 2CJKA 2RS8A 1T05A 4F4ZA 1UZHA 1XBWA 2CQBA 3CJKA 2JFKA 2QFIA 4NL5A 2FLOA 3FKBA 4ICLA 2C2KB 4WU2A 1AFJA 4F4XA 4P73A 2OFGX 2UU9F 2PO4A 1TUGB 2CADA 3D0HE 1BLUA 5F9NA 2CXEA 2B7BB 1U7LA 2HQ3A 2ZEJA 1LXJA 5A6WA 1WG5A 2JNJA 4WFAQ 5A2QY 4LSZB 2XS2A 2MQ8A 1NPPA 2XZTB 4C11B 4DR2J 2MQLA 3HDSA 1SV5A 4IFVA 4C8KA 2UZAA 1N4LA 5E7OB 2HVDA 1ZAXA 3EE3A 4M5DB 1HBMB 2M70A 2LA6A 4B9VA 1B4SA 1DQ9A 2ADCA 4AL5A 4PPZA 4WFXA 2BQ3A 3L7UA 1U1MA 5I4MA 1R89A 2V67A 2UXCJ 2KRBA 2KYXA 4JI3J 1JNZB 1NKEA 1K1QA 1HNXF 2L9WA 1JJ4A 4FBUA 4DL4A 4M5IA 4DG1A 1XR6A 4C2MA 1VIXA 2LECA 2YH1A 1HNVB 2Y0BB 1KQGB 1KLMA 4H4OB 4KFBB 2YNFA 2C2ZB 4HACA 4ZJOA 5SUHA 4X4UA 2QO3A 4IQMA 4ATNA 5IS2A 3FJ2A 3NGKA 4NYZA 2J9DA 3I32A 3HHLA 4S0MA 4WFYA 3ZXWA 1HNIA 1NJIT 2ZH2A 3V6HA 7FD1A 2A1BA 2IJFA 1EZZB 5KT6A 1XIQA 4MFBA 1NXIA 1NUEA 2AYBA 2KTQA 4F4KA 4EZ6A 1RABB 2Q3PA 4IR1A 3IN5A 1VHFA 2AX0A 4B9LA 4PQUA 3BR9A 4MAKA 1EKSA 2XMJA 3I0SB 3RTVA 2FY8A 2AJ1A 3HVWA 3HHLC 1PJ6A 5D4NA 3OJSA 5J2QB 2AJ2A 4U67Q 4QWBA 2EBEA 3GR0A 2FGCA 1HWLA 2XEXA 2IDEA 4ZN3A 1U48A 4PAAA 2XYHB 4U7UD 3SCJE 3DYAB 4CLSA 2GGPA 1CBKA 3L09A 4AQYJ 1OJ4A 2OEMA 2GVDA 3IRXB 4UZBA 1FKOB 4CM2A 3GIRA 1S6PB 3VAJA 4RO0A 5KFVA 5CQGA 4EBEA 3VAMA 4WZMA 3TA0A 3S01A 2MB0B 2XO7A 4PYAA 4CM0A 4XO0A 1JLEB 1FD8A 5HO4A 4OV6A 3BDEA 5KG6A 2CQ4A 3VF0B 2OUGA 5HSPA 4ZP8A 3N5FA 2BV3A 2NSCA 2HFOA 2DXEA 1I94F 5L9NA 2X1BA 2WB1D 1RT1B 1QAYA 3HKZD 1CJVA 4HYKA 4URQU 1AW0A 2V9WA 5K20B 1S1VA 4JV1A 3E51A 3R5CA 3MTKA 1N34F 4R0JA 1RBAA 3M2VA 2QSWA 4Q5VA 1TELA 4WWSA 2HFSA 5GMDA 2GHVC 4GRSA 5C42B 1EETB 4C8MA 3H0PA 3GV7B 1BWVA 1PAUB 3DFEA 2QYGA 3O1LA 5IXUA 2FC8A 5F3TA 4ENOA 2BE9B 4O23A 1SJRA 5L1LA 3PHEA 2YKPA 2AP6A 5I42B 1UFLA 5GAHI 2J0WA 4EBCA 1JLBB 1K0VA 4WIIA 3UD3P 2J6UA 3W8PA 3QRRA 3C14B 5E3PA 2D3OR 4J9QA 2ZM6J 4OZ5A 4GC7A 3CCES 3CMQA 3GFZA 2CPZA 3M6VA 1JIHA 3IXQA 2QGFB 5KT3A 4C11A 5LMUJ 3IG1B 3TEHB 2OAUA 1RP5A 4FDFA 1S1TB 2K2PA 4M5DA 2RS2A 1HBMA 2VG7B 2AX1A 1RLDA 3ONQA 2VQFF 5KFZA 2B51A 1ZM2A 3JAMU 1LWEB 3G8TA 3EGVA 4B17A 3DRSB 2CPIA 4NYOA 1MMNA 4P52A 3LUYA 1C2PA 1IJFB 3R5JB 4USJC 4ZJQA 2HMIB 1FA0A 4I1TA 1GEHA 4IG3B 3HSJA 4OIXA 3J80U 2QX0A 3TZYA 2ZHBA 3CMES 4KGMA 2WB4A 1RHQB 2JL9A 1GMVA 1LWCB 1HNVA 2VICA 4DX8H 4RKUC 3HJFA 2V8GA 4H4OA 3IA0A 2FJDB 2CZVC 4UUXA 1RTZA 1FJ7A 1U2RA 2ZOFA 5B09A 1NZAA 3GMGA 2ZBCA 2E9RX 1HHQA 3AOAA 4UY85 2K7JA 2IPOB 5LSRA 1X4EA 1OY9A 4DX5A 4ZVHA 1AXQA 5CZVA 4OI4A 5ETRA 3IS9A 1K73T 4WPAA 4NCGB 1TK5A 1D9DA 1BQXA 1YTYA 4LSNB 2A2DA 1BWEA 1F5BA 1S7HA 3EVOA 3I0SA 3I82A 1N5YB 2WOMB 4DX6A 1YRUA 5J2QA 2M8DB 1Y9OA 2BACA 3K5NA 3G6YA 1FXLA 2GAHC 3CC2S 4G3IA 5ITHA 3DYAA 4ZPAA 4BS2A 1RT6B 4ZOSA 2NXUA 2OP5A 5T41A 3KLGB 3IRXA 1FKOA 1RWMB 4K7QA 1S6PA 1YHQS 2CIMA 1YJTA 4QCLA 1CC7A 3NS6A 5AXMA 1LEOA 1WHXA 2IDLA 2RH3A 2FC9A 2LFVA 5KFLA 2QL9B 2XO6A 1JLEA 2RUGA 4ECXA 1GMWD 1T0TV 1RB0A 1NZ8A 4KYZA 5IM0B 5BR8F 2P8IA 2HHHJ 1S7IA 1VQLS 1RT1A 4Z7CA 5DZ6A 3CD5A 4LUBA 1FX4A 6FDRA 1G2EA 3M7VA 3M8PB 2HFVA 3THTA 4FYXB 2A6OA 3GYNA 4O4RA 1JKHA 2E29A 3M2RB 2HKEA 3R7SB 2L41A 4C3LA 2H5IB 2M3DA 1VLOA 5C42A 4DR3F 1QTNB 4TN2A 2DNGA 1XJWB 3LP2B 5J1EB 2UXDF 2BYCA 1Q1KA 2V5HG 2LKZA 3DU5A 1RA7A 3SIPB 5LMNJ 2MQNA 1T9YA 5KFFA 1V6HA 5I42A 3MEDB 2HNYB 3ZZUA 2HZAA 1JLBA 3G71S 4E98A 1RHUB 4OJHA 2CPFA 2YNHB 4RNOA 3C14A 3DM2B 3ADAC 1H72C 2BQRA 3FGVA 3DN9A 3A8IA 1Q8KA 4KAIA 2ZHAA 2XYGB 2XSJB 1AUSL 2YQ3A 1JJCB 1B7YB 5DO2A 2FHJD 3IG1A 3PY8A 3OL8A 1X8DA 2YNGB 2WVFA 1S1TA 3NGDA 3RR7A
chains in the Genus database with same CATH topology
1WJ9A 4DZDA 2Y8YA 5H9EK 3QRQA 4QYZK 4U7UD 5CD4A 5H9FK 3QRPA 2Y8WA 3QRRA 2Y9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ9 A;  4DZD A;  2Y8Y A;  5H9E K;  3QRQ A;  4QYZ K;  4U7U D;  5CD4 A;  5H9F K;  3QRP A;  2Y8W A;  3QRR A;  2Y9H A; 
#chains in the Genus database with same CATH topology
 6AT1 B;  3NRB A;  3TO8 A;  2D7S A;  2VG7 A;  2RT3 A;  4J9V A;  3D6H B;  4J9R A;  4JI5 F;  4JI0 F;  1LWE A;  2FJV A;  5A8K B;  1RTI B;  3DRS A;  2XY5 A;  1B99 A;  1RWO B;  1KKH A;  2WK4 A;  2DNL A;  1DQA A;  4RW9 B;  2HMI A;  4F3M A;  3ZTR A;  4IG3 A;  1RWX B;  3FSY A;  3K8W A;  3EIC A;  1Q81 T;  2KG0 A;  5EDW A;  2OPQ A;  1LWC A;  2VBX A;  1RYS A;  3BQ2 A;  4KT0 C;  2JRS A;  2D9P A;  3R5G A;  4O0N A;  3K2Y A;  2VG6 B;  3O2I A;  4YY3 F;  2DIT A;  3LTO A;  3R2D J;  2PGC A;  2DPI A;  4AFF A;  3OHB A;  2KZZ A;  1T02 A;  1KQS R;  3R7B B;  1VQY A;  3OVS A;  1A0O B;  3AOC A;  4KGV B;  1X5O A;  3V6D B;  4Y3C A;  2FQQ B;  4UTG A;  3CJ5 A;  3UWT A;  3A12 A;  2Q6B A;  2VJV A;  3MAQ A;  4PXD A;  2HNZ B;  1HD1 A;  1H6K X;  1ZA1 B;  1K1S A;  2V2Z A;  1NDC A;  1TKT B;  2CJQ A;  4C3K A;  2VA2 A;  5L38 A;  1NKC A;  4JOU A;  1KNZ A;  4NCG A;  3H25 A;  4TU9 A;  3QRP A;  1NB2 A;  2VIH A;  4O3O A;  4M5L A;  3LW5 C;  3OTB A;  1G1X A;  4LF5 J;  4YR3 A;  1SBR A;  3E8O A;  3CSK A;  2WVC A;  3DRR B;  1N5Y A;  3IFE A;  2RJZ A;  2WTF A;  2WOM A;  4YDX A;  4LF6 J;  4LF2 A;  4ID8 A;  2J8S A;  3UW1 A;  1PCA A;  4ERD A;  3AA9 A;  3JB9 k;  3NXZ A;  2KU7 A;  4OX9 F;  4NMX A;  5DG9 A;  1Q4R A;  1NME B;  3DHW C;  3WHI A;  1R8H A;  1RWP B;  1RT6 A;  4C8Y A;  1K9M T;  2VC0 A;  1RQ0 A;  5C24 B;  2FY1 A;  3G8Q A;  3KLG A;  4ED7 A;  2R7R A;  4YDD B;  2AJ0 A;  1WJ9 A;  1SB6 A;  4CDI A;  3SZ2 A;  2LXF A;  3UDC A;  2CUY A;  1U25 A;  3MOZ A;  4PAB A;  4B08 A;  4UW2 A;  4DL2 A;  4B3S J;  2BW7 A;  4OYZ A;  1S4E A;  4LF4 F;  2F8E X;  2FLL A;  5IM0 A;  5A2Q U;  3DXB A;  4U9R A;  2UUC J;  2CQP A;  3UDE A;  2BEF A;  5HJY A;  1S5Z A;  5D77 A;  3PVX A;  2CPD A;  2C2D A;  2D69 A;  2WBR A;  1X5S A;  3W62 A;  1IUJ A;  1KHW A;  4Z2X A;  2B3T B;  2LXI A;  3IGV A;  3M8P A;  1Y10 A;  2BW2 A;  3IWL A;  4MMO A;  3LPE A;  3FDS A;  1UA1 A;  3M2R A;  3KLF B;  1U6B A;  3MEC B;  4B02 A;  3N6M A;  4ZLP A;  3B78 A;  4DEZ A;  5E3A A;  2QZ8 A;  2AKW B;  5J1E A;  4DUZ J;  3M2U B;  3CD6 S;  1KEK A;  1RKI A;  2H1Y A;  2V68 A;  1HBO B;  2FVR A;  2BM0 A;  2L9N A;  2ZBI A;  2CQD A;  2W2M P;  4FS2 A;  5IOL A;  5HMX A;  2C1E B;  2FLN A;  4WIQ A;  3UE2 A;  3HFV A;  2W25 A;  4ECZ A;  3MED A;  2HNY A;  4Y0F A;  3V6K A;  3IP0 A;  4DBQ A;  1U1K A;  1FO1 A;  2YNH A;  3DM2 A;  3ENV A;  2XWX A;  2R2R A;  2V8D A;  2MZS A;  3MPV A;  4RW6 B;  1D9A A;  1J5O B;  1RHM B;  2XSJ A;  3BH7 B;  3BKU A;  2RQM A;  1MN7 A;  3BGR B;  4CLW A;  3MM9 B;  2EK1 A;  1RZM A;  2YNG A;  4XPC A;  2DR8 A;  3EXC X;  2V69 A;  3GON A;  2ZJQ Q;  3AD7 C;  3TRG A;  4J90 A;  4DR2 F;  2A2C A;  5A8K A;  1RTI A;  2KDO A;  3VVU A;  1U1N A;  3I56 S;  5K8O A;  3PKY A;  3ISZ A;  4QU7 A;  2NS1 B;  3VGS A;  4WXW A;  2RHQ B;  5EWF A;  2CFX A;  1WDD A;  2UXC F;  3C2P A;  2E1R A;  2EG2 A;  2XC9 A;  3EJM A;  4JI3 F;  1HYS B;  1SIW B;  1N8R T;  1T9X A;  3C6U B;  2VG6 A;  4PG7 A;  1N6Q B;  3DC2 A;  5JVG Q;  1ZPW X;  3AA8 A;  4C9D A;  1KHV A;  4NLR A;  2QSF A;  3G6E S;  2M8H A;  2R4F A;  4X4Q A;  2KT5 A;  3V6D A;  1S1X B;  1WHW A;  1JLG B;  1FVQ A;  2NQP A;  4I64 A;  2MMY A;  1FKP A;  1M5O C;  1PAE X;  3CCR S;  2O1P A;  4K5R A;  2HNZ A;  1RKJ A;  1N33 J;  3O5T B;  1FRI A;  3P49 B;  1TKT A;  3MEG B;  4DU8 A;  5ADZ A;  2G4B A;  3QBC A;  3BJY A;  4X4P A;  1AT1 B;  1UVL A;  5KFH A;  3BM7 A;  2R3V A;  1NAQ A;  2GW8 A;  2HEK A;  2RNE A;  4M8L A;  2H3E B;  3DLH A;  3DRR A;  2YKA A;  4OYM A;  5IT9 U;  3MR7 A;  3D0G E;  3J81 Y;  4LFB J;  3AQP A;  2QC3 A;  3UD5 A;  1X4F A;  5K14 B;  1SH3 A;  3LGN A;  2VOD A;  2VH7 A;  3J7A N;  2JLG A;  4NLD A;  1R0B G;  3GIL A;  2AZ3 A;  3JSB A;  2ZBP A;  5C24 A;  1REG X;  3UCZ P;  1EP4 B;  4KH1 B;  1HPZ A;  3CCQ S;  3M8Q B;  5MAO A;  3PR5 B;  1T3N A;  1S0V A;  2LU2 A;  3FBE A;  4KIA A;  2ZJR Q;  3WX8 A;  3QLH B;  2CAJ A;  3C8Y A;  1ELO A;  1KOH A;  3CO0 P;  4ZP7 A;  4AQY F;  2AV5 A;  1HNW J;  4QWD A;  4CI0 B;  2AW0 A;  2M88 A;  1WC1 A;  4EYI B;  1JJH A;  1LNQ A;  2DO0 A;  1HI8 A;  1W2B R;  4ECY A;  2O3D A;  1OIA A;  5RUB A;  3Q8Q B;  3GCX P;  2HGL A;  3WC2 A;  2BBE A;  3US5 A;  1S57 A;  3PW0 A;  2KI2 A;  2KO1 A;  2HK3 A;  4ZP9 A;  2KM8 B;  4BHQ A;  4Q8F A;  1RT4 B;  2QN6 B;  4R5P B;  5THW A;  5GME A;  1WTF A;  4KY3 A;  3P96 A;  1VQ5 S;  1DZ5 A;  4USH A;  4FN5 A;  3GJR B;  4A8W A;  4BC7 A;  2G0I A;  3KLF A;  3UI3 A;  2XS7 A;  4PZV A;  4A8Q A;  3GSD A;  3KUG A;  2YPY A;  2GML A;  4Y2I A;  3D6T B;  1Y5N B;  3DOM B;  3RG6 A;  4WKY A;  1UL3 A;  4CCH A;  3K5M A;  4DSL A;  3M2U A;  1SQF A;  5JMN A;  3D28 A;  3NNA A;  1HBO A;  3K0J A;  5DGA A;  3UFC X;  3EPI A;  3RW6 A;  3HI9 A;  4L6V 3;  1KON A;  1T9U A;  3MMC B;  1YIJ S;  4TLR A;  3D66 A;  1I6J A;  1IWA A;  1QD1 A;  2DNO A;  1JB0 C;  4I2P B;  2J7K A;  3T6J A;  1SXL A;  3KMS A;  2Y1L B;  1K0T A;  2PMH A;  1XNQ J;  1FVS A;  5HL7 Q;  3OJU A;  2XMT A;  4LR8 A;  2W8L A;  4RW6 A;  5KFI A;  1X60 A;  3B82 A;  5E3Q A;  2C42 A;  2AGQ A;  4A8S A;  1VQ6 S;  3BGR A;  3MM9 A;  4I67 A;  4X66 J;  3D67 A;  2ZM6 F;  4FVM A;  5BJR A;  4HKQ A;  4FS1 A;  3M30 B;  2IFX A;  9ATC B;  2W8K A;  2DVI A;  4LF9 J;  1IWG A;  2JC1 A;  2V50 A;  4E0D A;  5LMU F;  3LAK A;  2W2Q P;  1UA0 A;  5CD4 H;  4PPD A;  4LF8 J;  3Q8Y A;  4L3K A;  1VQ7 S;  9RUB A;  4F8R A;  4AUK A;  3TAM B;  3LA0 A;  3LWL A;  1KTV A;  3JXO A;  1LV5 A;  4PQA A;  3FSI A;  3TYT A;  2JEF A;  1RDR A;  3P45 B;  2WON B;  1P9Y A;  2X1F A;  1WOO A;  1HYS A;  1N5V A;  4PCQ A;  3C6U A;  1CUL B;  2MTL A;  4NE9 C;  4QIW D;  1PBA A;  4Q2L A;  1N6Q A;  3OL7 A;  2RIL A;  1MN9 A;  1NK0 A;  3ENQ A;  1CQN A;  4QWE A;  1F2H A;  1S1X A;  1JLG A;  3H42 A;  4P75 A;  3VQT A;  3I5C A;  2N4D A;  1JQG A;  1FI4 A;  2POK A;  4XK8 C;  1GK8 A;  3SMZ A;  1MU2 B;  2FJX A;  3VGV A;  1G4C A;  1KVK A;  2CNL B;  4FNI A;  3BQ0 A;  3MUV P;  2M2B A;  1R8B A;  3MEG A;  1MMD A;  3K58 A;  2JOQ A;  4ZVQ B;  2AD9 A;  4CO5 A;  4DQS A;  2X7I A;  1TQL A;  4LR9 A;  2ATL A;  4UOC A;  2R7S A;  3BDP A;  2R7V A;  2LA4 A;  3AXK A;  5BYS A;  1YWX A;  3M8Y A;  5J2N A;  5I3Q A;  3FSX A;  2FJB B;  5DG7 A;  1EX8 A;  5K14 A;  2CJA A;  4V1A k;  5J1P A;  3J7Z T;  1B0T A;  2CVI A;  3PRB A;  4FPI A;  5BYR A;  2EFV A;  8RUC A;  3O3L A;  4KBI A;  3CNQ P;  1VC6 A;  1EP4 A;  3I0R B;  3M8Q A;  4I7F A;  5D4O A;  2ZZT A;  4H4K A;  4NPO A;  2HRY A;  3AD8 C;  2JC0 A;  3SCK E;  3QLH A;  2DR7 A;  4DV7 J;  1UMJ A;  2IBO A;  4HEA 9;  3CJT A;  2UVR A;  2G1H A;  4DF8 A;  3BH6 B;  2DIV A;  1Q79 A;  2C2O B;  1U2F A;  3VZI A;  1O51 A;  2B7C B;  2UV8 A;  4P2M A;  4HH0 A;  1BGX T;  3OUY B;  3HXM A;  1Z2Z A;  3VAI A;  2J8A A;  3MM7 B;  1YRX A;  3JSY A;  3VAH A;  3N9U C;  4H4K C;  3DLE B;  4OI0 A;  4C8O A;  5IQQ A;  4V19 J;  2BKP A;  4A8M P;  2O5D A;  2W2P P;  2OTL S;  2ZH8 A;  3TAP A;  2R7U A;  3OW2 R;  5D4L A;  5HI7 A;  3CDW A;  1RT4 A;  2IA6 A;  2KL8 A;  4CLZ A;  2VBW A;  1UET A;  2HHH F;  3H2L A;  1IR0 A;  1VJQ A;  4DQI A;  2A6M A;  2I2Y A;  4V19 X;  2BRL A;  3F44 A;  2NUH A;  1F0X A;  3DOM A;  3EZ5 A;  4JV2 A;  5LSL A;  2XI3 A;  3J81 j;  2ROP A;  3CE8 A;  2FTR A;  2IAJ B;  2ACY A;  1FNM A;  3KG4 A;  2KM8 C;  4ANC A;  3AB4 B;  3D6M B;  1N5S A;  3MMC A;  4TXS A;  3A3O B;  3Q8S B;  4DL7 A;  4EGL A;  3FEY B;  4I2P A;  3N5B A;  4IOA Q;  3FCV A;  3NBP B;  3MCN A;  4P10 A;  3ZO7 A;  2J7W A;  3PIP Q;  3CDE A;  2RE1 A;  1IM6 A;  5LMN F;  2CQI A;  1WOR A;  5C25 B;  4LRF A;  2C3P A;  1RAE B;  2WRM A;  2QG9 B;  2XGP A;  3OR1 B;  2QLB B;  1H74 A;  4K50 A;  1PYT A;  1OPZ A;  3S7R A;  3PXG a;  1EQ0 A;  3GII A;  2MQM A;  4MTP A;  3EGW B;  1X4A A;  4F4Y A;  1N0V C;  3PYE A;  4K4X A;  3QWU A;  2DGV A;  3SCL E;  2R7X A;  1NK8 A;  2MPU A;  2ZOG A;  4ED8 A;  4IYQ A;  4QBU A;  3H20 A;  3HHL D;  1WD6 A;  2KFN A;  3MF5 A;  4UT4 A;  3Q8P B;  2M5Y A;  1RAC B;  3V2U C;  3GE9 A;  3D1Q A;  2XLJ A;  1L3V A;  2F5G A;  1SCJ B;  3TAM A;  1Y3J A;  1N52 B;  2LQJ A;  3TJ8 A;  2E5H A;  1XQI A;  1VRU B;  4ZDN A;  3QQC D;  4FNH A;  3KK1 B;  3QJL A;  2PMZ D;  2WON A;  1TL7 B;  4QYZ K;  1KBR A;  2RF2 B;  4ZCK A;  3W9J A;  2XG8 A;  2KFY A;  3QRQ A;  1CUL A;  3BYP A;  1Q8I A;  2CNN B;  5IC4 B;  1OYD A;  4ED2 A;  4DFK A;  5FD1 A;  4NML A;  1X0F A;  4KPY A;  4ED0 A;  4DPU A;  1U02 A;  1EQM A;  5F8L A;  2LVW A;  2FHO B;  2NRE A;  2P9C A;  1UJ4 A;  3IR7 B;  3LWM A;  2HWI A;  2KT2 A;  1MU2 A;  3T6B A;  2DEJ A;  1OY8 A;  5BYQ A;  2EPI A;  2CJ9 A;  2GCF A;  2MJU A;  2VPX B;  2IRX A;  5HQ8 A;  2B4O A;  4KHP J;  3OXL A;  1U1L A;  1P1L A;  2MLX A;  3AOB A;  3D5M A;  1FXR A;  5LXR A;  2HVI A;  1P27 B;  1XR7 A;  2JLE A;  3BV8 A;  1SC1 B;  4U7U K;  1Q7L B;  2B8Q A;  1QUP A;  4OYA A;  4Z7Y A;  3SSR A;  2VF3 A;  4B9N A;  1VOM A;  2XQC A;  4DPX A;  4Y2C A;  3RW7 A;  1VRT B;  1FJE B;  4LF5 F;  4CQ1 A;  5EGY A;  3I0R A;  3M4X A;  4DL6 A;  4LF6 F;  3MMA A;  4F67 A;  1O0P A;  1REV B;  4ER8 A;  4FXV A;  3VGT A;  1DLO B;  4QIG A;  5KT2 A;  1IKX B;  1HHT P;  3VZH A;  3TAQ A;  3OUY A;  4NLG A;  3MM7 A;  4ZVR B;  3AY0 A;  3U1N A;  3TA2 A;  4QR2 A;  3BO2 A;  3DLE A;  4UUW A;  4CO0 A;  5DGB A;  4ECT A;  5CCM A;  2GZO A;  3MPW A;  4B3S F;  3H5Y A;  5AE2 A;  3CIM A;  4MKV A;  2XM3 A;  1HFE L;  3CT9 A;  3MPU B;  1HA1 A;  2GQC A;  2PA3 A;  5LJ3 Y;  3OPK A;  3ZFV A;  2ZBQ A;  2UUC F;  1L3U A;  4NLU A;  1TU0 B;  5HP1 B;  1OYE A;  2KT3 A;  2FHK A;  4L74 A;  4RUB A;  4OX8 A;  3DRX A;  2IBK A;  3D0I E;  2DR5 A;  1LW2 B;  3PKM A;  3CUL A;  2AEF A;  3BN7 A;  2ZVS A;  2IAJ A;  2EEY A;  2FYX A;  2UUB J;  1MWY A;  2RQK A;  1NDL A;  2QIF A;  3I6P A;  1QSL A;  2EW9 A;  1Y4Z B;  3M8Z A;  3G9C A;  1UW9 A;  2KVI A;  2ZNZ A;  5KT5 A;  4YME A;  1MG7 A;  2NZC A;  1FNO A;  1LW0 B;  3NBP A;  4DUZ F;  2HS4 A;  4JI7 J;  4NA3 A;  3HHD A;  3EUN A;  2ZWP A;  1RWK B;  2CYY A;  4HHU A;  1U1R A;  4LQ3 A;  5C25 A;  5FLX U;  3HSG A;  3BSO A;  2DRB A;  2O01 C;  3OR1 A;  2VBY A;  4RR5 A;  1WI8 A;  3BB5 A;  2GO9 A;  2QL7 B;  3DMJ B;  2C3M A;  2VDI A;  1MWZ A;  1A9N B;  2FIU A;  4P6Q A;  2AGO A;  2IVM A;  5DDQ C;  1TL5 A;  3FBB A;  4QW9 A;  4RU2 A;  4DJB A;  3AJ1 A;  2L48 A;  3ILO A;  2OH2 A;  4K5S A;  3HVA A;  1VK3 A;  2X3D A;  1X4D A;  5GAG I;  2O66 A;  1M1K T;  3CCV S;  1U49 A;  2E1C A;  4U8V A;  4FF3 A;  1VRU A;  1MRO B;  2GHP A;  3H5S A;  2XMW A;  3KK1 A;  4HDH A;  1TL7 A;  3D6F B;  2RF2 A;  1IQZ A;  2FUG 9;  2F9D A;  1ACM B;  5I3U A;  4OYW A;  5LOQ A;  2WZ1 A;  3I87 A;  2BAN B;  3QAU A;  2ZH6 A;  4Y00 A;  3ZZP A;  1TUV A;  1WEL A;  2DTJ A;  2ZUG A;  4TQS A;  3I5A A;  4CO3 A;  3GIJ A;  1F9E B;  5CYM B;  2MLY A;  4CLU A;  4NCB A;  5ETT A;  2GQ2 A;  5IV3 A;  2XZW A;  4TVA B;  1WI6 A;  3W63 A;  2ZZM A;  1QUV A;  2MYF A;  1HMV B;  1GXL A;  3EVM A;  3DLB A;  5H9F J;  4OZJ A;  3B6B A;  4OQJ A;  3CB4 A;  1N33 F;  1O8B A;  1RLC L;  1YLX A;  5K5M A;  4HH1 A;  4X4O A;  1PSD A;  3PTW A;  3R5D A;  4OZN A;  3FBF A;  3SDE B;  2ATC B;  1NK4 A;  3DU6 A;  1VRT A;  2RML A;  4O4G B;  3FFI B;  3LP1 B;  2OJ3 A;  4DPY A;  2L3M A;  2HQD A;  4ZP6 A;  4LFB F;  3SFU A;  4HVZ A;  4F0K A;  2GQQ A;  1F9F A;  4DSI A;  1REV A;  1JMT A;  3KUE A;  3U27 A;  3HT3 A;  2W1B A;  2RQ4 A;  4UF4 A;  1Q78 A;  1WEY A;  1BE4 A;  1YJ7 A;  1DLO A;  1JXL A;  5EHH A;  3QT8 A;  3E01 B;  5ETP A;  1IKX A;  5HQL A;  2GJF A;  1WC6 A;  1SVD A;  3P3D A;  2BE7 D;  2Y3Y A;  4DDF A;  1BQN B;  3BPS P;  4X64 J;  4YHH J;  1F6T A;  3HHK A;  1ZBT A;  3IMQ J;  1HNW F;  3M9M B;  2DNN A;  1X9S A;  3K5L A;  2Z57 B;  2DGQ A;  4WK3 A;  3UR3 C;  3KJV B;  3PJX A;  2QLW A;  5HP1 A;  3TVZ A;  1FRX A;  4G65 A;  2UXB J;  3CMA S;  1FT8 A;  2QLX A;  2MQP A;  4YEA A;  2VAS A;  2HSE B;  1KC8 T;  2FVQ A;  1D8Z A;  1LW2 A;  4AE5 A;  2VFR A;  5EWG A;  2XZD B;  3HMJ G;  1IKW B;  1R0A B;  1YJV A;  3SI8 A;  3DDI A;  2HGM A;  3DDK A;  4D3G A;  5B08 A;  3B4M A;  1NHV A;  2BZ2 A;  2ZH3 A;  1TZ0 A;  2BM1 A;  2E1A A;  1S48 A;  3QGI A;  4BWJ A;  1YI2 S;  1S76 D;  1LW0 A;  3C66 A;  4FKX A;  1U1Q A;  3UD4 P;  4W98 A;  1HWJ A;  4EBD A;  3A1Y G;  2B43 A;  1QE1 B;  2LXU A;  2MZ1 A;  5CH7 B;  3PX4 A;  1P1T A;  3GIK A;  2VQE J;  2LQ8 A;  1IBM J;  5FDL A;  1NBE B;  3WZ0 A;  2F40 A;  1XNQ F;  5H1S V;  1UJ5 A;  4EZ9 A;  4QIE A;  3DOK B;  3KLI B;  3PW2 A;  1RTD B;  4NZ7 A;  1HLW A;  4I6A A;  3U1L A;  3A8E A;  4X66 F;  2HHT A;  2UP1 A;  5M2P A;  1Y0H A;  2ZIT A;  3J7Y I;  2HZC A;  4DSK A;  4LF9 F;  1X5P A;  3KOA A;  2KRR A;  4LF7 J;  1MRO A;  2HBZ B;  2GO8 A;  5HAN A;  2QFJ A;  1XNR J;  3Q8U A;  4LF8 F;  3PV8 A;  2DR9 A;  3LGH A;  1PJ7 A;  2HVH A;  3EMT A;  4FZV A;  3LQV A;  3GU0 A;  3M8R A;  2JEI A;  1PIE A;  4RUH A;  5D0E A;  4PWW A;  2BAN A;  5E0O A;  2HK2 A;  1AB8 A;  3HF5 A;  4G1P A;  1ZOT A;  3FUY A;  2XGQ A;  3N01 A;  3SSQ A;  3FMW A;  3W9I A;  2RB7 A;  1APS A;  1OWX A;  4FYV B;  4A47 A;  4ES1 A;  2FGO A;  4WJB A;  2V4Q A;  2GIQ A;  5CYM A;  3GJS B;  3NGT A;  1OQ6 A;  1KR4 A;  1RYR A;  2HHX A;  1DBD A;  4F02 A;  1H73 A;  3RZA A;  2CNO B;  3DGV A;  1HMV A;  5AXN A;  1RAD B;  3H5U A;  2CDQ A;  3TR5 A;  3JTO A;  4XDD A;  4DV0 J;  3MCS A;  4PWD B;  1B0P A;  1NO8 A;  4KB7 A;  4N8O A;  3EVW A;  3SDE A;  1ZA2 B;  4N5S A;  4NA2 A;  2E5I A;  4LFC J;  5KOX A;  3MI7 X;  2Z4P A;  4F7V A;  1JLQ B;  4O4G A;  3FFI A;  2YNI B;  3LP1 A;  3AFG A;  1FDA A;  2Z30 B;  4P72 A;  1C1B B;  2H65 B;  3KKF A;  2AU0 A;  5KT4 A;  1U24 A;  3ILI A;  2VA3 A;  5F8J A;  2XMK A;  2QMU B;  5GAE I;  2AF6 A;  1X9W A;  2YX1 A;  4A48 A;  2B9X A;  5KG1 A;  3E01 A;  1P8G A;  4OJ1 A;  2IRU A;  3HM9 A;  4AND A;  1F3F A;  2HPU A;  4FPR A;  2ASJ A;  1RCO B;  4I2Q B;  4CZC A;  2OPS B;  4RNH A;  4KGK A;  2XHC A;  1BQN A;  4KC5 A;  4OFZ A;  4DV7 F;  1VC5 A;  1HIY A;  4DXL A;  3F0N A;  4ETZ A;  2AQ4 A;  1KQK A;  2HFU A;  5CAA A;  2MY7 A;  3SFG A;  3JTP A;  3M9N B;  3FBC A;  3RBX A;  3KJV A;  2YWW A;  4C3M A;  3RR8 A;  2P9G A;  5KFU A;  4OI6 A;  3DDN A;  3TAR A;  3FZ2 A;  3JS9 A;  5KFG A;  1XMB A;  2F8M A;  4U6P A;  2R2U A;  2ASY A;  4ZCI A;  2EG1 A;  4LRD A;  3W7B A;  4GVB A;  4OHZ A;  4A46 A;  1IKW A;  1R0A A;  4A8O A;  2AEM A;  1LOU A;  3OLA A;  4MK7 A;  5K8N A;  1UFK A;  1Z2L A;  4HT7 A;  3UNY A;  1IR1 A;  2B9W A;  4EEY A;  1SL2 A;  1DFD A;  1FDN A;  3S1T A;  4PG8 A;  1UVK A;  2N7C A;  1BHN A;  3TW0 A;  2GJ2 A;  1QE1 A;  2DT9 A;  2ZZN A;  3H2U B;  3KJQ B;  2MY8 A;  2A3J A;  2DNK A;  2EK6 A;  4FVC A;  2IY5 B;  1FEH A;  1YZ6 A;  2APO A;  5EWE A;  4C8L A;  2COL A;  4J7C A;  4WF9 Q;  1UEV A;  1RI7 A;  4OI2 A;  2DHH A;  4PUO B;  3SCI E;  1B64 A;  1E6Y B;  3DOK A;  3KLI A;  1VLY A;  1H38 A;  1GMU A;  5DET A;  2NXJ A;  4LT6 A;  2VU5 A;  3B8H A;  4G1Q A;  2FVS A;  4NXN J;  1RT2 B;  4JI2 J;  4F36 A;  4C8N A;  1QAX A;  4ZVT B;  1M5K C;  1XR5 A;  4ECR A;  3DOL B;  3TWZ A;  2V2Q A;  2M0G B;  3UO0 A;  3AAW B;  2OD6 A;  3IBW A;  2HYI B;  4I56 A;  4QYZ J;  4WTY A;  1UEU A;  3UQS A;  2EKY A;  2FVC A;  1I1G A;  2YVS A;  4I6Y A;  3OLB A;  3T1H J;  3H4B A;  4JI8 J;  3KUH A;  2EWH A;  1VBZ A;  4NLW A;  5DLG A;  2BJE A;  1ZTT A;  2BE2 B;  3TX8 A;  2H5J B;  2Q43 A;  2LEB A;  2V2V A;  4RW8 A;  5K9F A;  4ES3 A;  2W7O A;  3JQK A;  1OY6 A;  5C2C A;  2QA4 G;  2ZD1 B;  2XNR A;  2HIY A;  4RZR A;  3BEG B;  5L46 A;  2RU3 A;  3QJJ A;  3GQC A;  2CNK B;  2AIR B;  3BPD A;  4Y6I A;  2E9T A;  4YOE A;  3CUN A;  1VDH A;  1H98 A;  2CJB A;  4PWD A;  2PII A;  4B3T J;  4DCP B;  2N3L A;  2FLP A;  4HTI A;  4KHP F;  2JLF A;  4DR1 J;  1NND A;  4RBU A;  1KQF B;  2ZUA A;  1JLQ A;  1S99 A;  4P7V A;  2YNI A;  1KVI A;  4DV2 J;  2QLJ B;  2DXF A;  1TTH B;  4YFU A;  1C1B A;  1BUX A;  2WSF C;  5L1K A;  3I4P A;  3M6U A;  2DJW A;  4ZIT A;  3P6Y C;  1H3D A;  3AJD A;  2B9E A;  3HFK A;  4WBF A;  2ROE A;  3AXM A;  3M05 A;  5L1I A;  2HHU A;  2VG5 B;  4I2Q A;  2OPS A;  2G0J A;  1CVJ A;  5C2G A;  3KNA A;  1UW4 A;  4TQR A;  4EI2 A;  2DNP A;  4JB8 B;  4R0E A;  5HLF B;  1YBU A;  3MAA A;  2C28 A;  1MWQ A;  3NOC A;  1XTZ A;  4DU7 A;  5D0H A;  5B0G A;  1BMQ B;  2C3U A;  5KT7 A;  3H59 A;  1G3O A;  2HGN A;  2QLF B;  3MPY A;  2GAG C;  3W64 A;  4K4T A;  1H2V Z;  2OFH X;  2RU9 A;  3Q8V A;  2D41 A;  3GFX A;  3UVJ B;  3FQL A;  1RHJ B;  4ZPB A;  2Z58 B;  1K44 A;  3FRZ A;  4OV1 A;  4ZHR B;  1YJN S;  5KFJ A;  4LFA J;  5B0A A;  3VAF A;  3BO3 A;  2FHM A;  2DNM A;  1FD2 A;  5A8W B;  1LFP A;  4HHH A;  2ZNY A;  4K0K J;  3P4U B;  4DFM A;  3QAT A;  4NLX A;  3NGS A;  3PM9 A;  2HBY B;  1FWP A;  4I4B A;  4WZQ A;  1W25 A;  1NK9 A;  3H4D A;  2V94 A;  2VKZ G;  2KHD A;  2Y1R I;  1NKB A;  1WF0 A;  4LMZ A;  4UZC A;  2UUB F;  2HS0 A;  5DG8 A;  1NSQ A;  5ETM A;  2Y9H A;  1RXO B;  2AJF E;  4WFZ A;  2CQG A;  3ZTO A;  1B0V A;  1I5O B;  5ETQ A;  1NJW A;  2V4J B;  4J9L A;  2IVF B;  3QPI A;  4JI7 F;  1GTE A;  3HD1 A;  3CJ0 A;  2Y1J A;  2RQC A;  1TAQ A;  4CNY A;  1TKZ B;  5ETN A;  3GV5 B;  5EN1 A;  5D0R A;  3WBZ A;  3ZTP A;  1E6Y A;  4QZV B;  2QJ3 A;  1P6T A;  1HW8 A;  1C4A A;  3KG0 A;  3W1Y C;  4NLQ A;  2NYI A;  3H2V E;  3HZG A;  3W9H A;  2ALZ A;  5HVG A;  1RT2 A;  3FCH A;  5JVH Q;  1HI0 P;  3ZC4 A;  2W24 A;  4YN3 B;  1U0S A;  4YB5 A;  2BAB A;  4IG0 B;  3DOL A;  3WX4 A;  4DV4 J;  3W3S A;  3IBF B;  5HK4 A;  3ZTQ A;  4IQX A;  3CF5 Q;  1U1P A;  4QOT A;  3QFW A;  1OMS A;  2CQ3 A;  2KVQ E;  4EU0 A;  4ED1 A;  3OTO J;  4AL6 A;  2RUS A;  1Q8L A;  4OZ2 A;  3ZZ0 A;  5CYJ A;  2FJA B;  2WHO A;  4DSJ A;  2XNQ A;  2BE2 A;  1KLN A;  3TP2 A;  2FVP A;  3NAH A;  2I0X A;  1T7P A;  1SKW A;  3JYT B;  3GP9 A;  2ZD1 A;  2N3O A;  3KHH A;  1ROF A;  1HI1 A;  1M5V C;  4NCA A;  3ICL A;  3PFO A;  5KG4 A;  4NRU A;  3TEG A;  3W2V B;  3THV A;  2EKN A;  4Y2M A;  2CQH A;  4KV8 B;  2JH3 A;  2ERR A;  2GVZ B;  3W61 A;  3LH2 S;  4ELT A;  4CLL A;  1FRK A;  3HSZ A;  4JUZ A;  2CQ0 A;  4W90 B;  4QPT A;  5DLF A;  1UKU A;  4RBV A;  2HRT A;  4KFB A;  2R8G A;  2HQI A;  4DV3 J;  2IC3 B;  3IAM 9;  2GA7 A;  4C0B A;  5F41 A;  1UTA A;  2CPY A;  3G96 A;  1VQ8 S;  2E5L J;  4IO9 Q;  3D9B A;  4DN9 A;  4C7Q A;  1VBX A;  3KTQ A;  4HR2 A;  1G6B A;  3QFH A;  1PYO B;  2DCL A;  4HHJ A;  4C8Z A;  5HQM A;  2OD4 A;  4HT5 A;  2DHG A;  4O3Q A;  2VG5 A;  3DLK B;  4LRC A;  2OHD A;  3L95 X;  5HLF A;  1QAJ A;  3TZW A;  2B4U A;  1M90 T;  1FRH A;  1IQT A;  2PI5 A;  5DM7 Q;  4NLV A;  4I0W A;  4P2S A;  5KG5 A;  1PYS B;  2GMJ A;  4X64 F;  1RHR B;  4YHH F;  4J9S A;  3A8K A;  1NJZ A;  5AE3 A;  3UVJ A;  2ZHO A;  2B6A B;  3IR6 B;  2W2O P;  2OI2 A;  4ZHR A;  3K5O A;  1S79 A;  3ULH A;  5KFN A;  4HDG A;  2PDA A;  3HHN B;  3ZNJ 1;  5A8W A;  3DRP B;  1XEZ A;  3R5B A;  4WCE Q;  2ZH5 A;  5E2Q A;  5BXI A;  5ETK A;  2UXB F;  1WKL A;  4DWI A;  4OYP A;  1WC3 A;  3OHA A;  1SKU B;  1UPP A;  4DN0 A;  2DXD A;  2Q6C A;  3U1M A;  2OKQ A;  4JV5 J;  2LYV A;  3N28 A;  1TAU A;  5KFA A;  1A6L A;  1IKV B;  5T7L B;  3ISN D;  4DS5 A;  4L3N A;  4O44 B;  1YQH A;  4CYU B;  3D54 A;  4HL9 A;  2HFZ A;  5KOW A;  1S4F A;  5HVH A;  1D09 B;  4TYB A;  3FVY A;  2MZJ A;  2V4J A;  3NY0 A;  4ITS A;  2J9E A;  1XK8 A;  5HJX A;  1AYE A;  1EAY C;  5AE1 A;  3C19 A;  1TKZ A;  1HBU B;  1FDD A;  1TMM A;  1V3Z A;  1Q5Y A;  1U8W A;  5F8N A;  4USW A;  5KFE A;  3TZZ A;  2VQE F;  2Z56 B;  1IBM F;  2W7P A;  3ELH A;  1EET A;  4X4T A;  1R27 B;  1X4B A;  4YQW A;  4C6A A;  2GNK A;  2BJ3 A;  1KS2 A;  3HUL A;  2VUG A;  4B9S A;  3HVT B;  2MGZ B;  3GV8 B;  4I6W A;  4IG0 A;  1TFY A;  4ZPW R;  2QV6 A;  1Q8B A;  5EUH A;  1M5P C;  4MYT A;  4UQT A;  2JZ5 A;  3T19 A;  4RX6 A;  3BKF A;  4LF7 F;  3H90 A;  3N4W A;  1FCA A;  1VQK S;  1XNR F;  1V3S A;  1WG1 A;  4DZ6 A;  4KQZ A;  1RWN B;  3IR5 B;  2XY6 A;  2R8J A;  1TUW A;  2AMC B;  4F04 B;  2DPJ A;  1YJU A;  2PSZ A;  1I3O B;  1NRK A;  2FZG B;  4QIF A;  3JYT A;  3MEE B;  4ZVF A;  4ZA1 A;  1VR6 A;  3MM5 B;  2I38 A;  1RAG B;  3VV2 B;  1UAW A;  3BN4 A;  4ES2 A;  3W2V A;  5HBM B;  5FJ4 A;  1R8P A;  3FK4 A;  1Y5L B;  4KV8 A;  3HK2 A;  3KYL A;  2EFG A;  1C0U B;  1RIS A;  3NCR A;  1U47 A;  1TK8 A;  3EGN A;  1MLA A;  2B8P A;  1UFW A;  4XTT A;  1WTB A;  3AOD A;  4FYD A;  1RT5 B;  1M5S A;  3A8J A;  4N76 A;  1ZPV A;  4DV0 F;  7FDR A;  3CCU S;  4TY8 B;  4H54 A;  1NK6 A;  2JEG A;  3EGZ A;  2VPZ B;  2YBV A;  4ZMM A;  2IC3 A;  1JLF B;  4LFC F;  1NSP A;  2HZV A;  3Q23 A;  1JXE A;  1NDP A;  2JVR A;  2PT0 A;  1IR2 A;  4K59 A;  4U8Y A;  2C2R A;  1T95 A;  3CJ2 A;  1HL6 A;  3NLC A;  2VFT A;  1R31 A;  3DLK A;  1DUR A;  1T9W A;  4RUA A;  1CQM A;  3G4S S;  1N56 A;  4TLQ A;  1MSW D;  4R25 A;  1RTH B;  4QR0 A;  3NOG A;  4LSN A;  2MLZ A;  3UCG A;  1QSS A;  5KFQ A;  5B7W A;  2AJ4 A;  3D3B J;  1TKD A;  3POT B;  4YS2 A;  1YBA A;  7AT1 B;  3NGR A;  4U95 A;  4DF4 A;  3SQO P;  2DNY A;  5KFC A;  3PNI A;  2B6A A;  1F5A A;  3MTJ A;  1YSJ A;  3G82 B;  1H7X A;  4F4A A;  1VS3 A;  5D15 A;  2OPP B;  4DPW A;  3DRP A;  4YR2 A;  3EPG A;  3LGM A;  3QSI A;  2IM1 A;  3HHL B;  2FJE B;  4ZPC A;  4F2R A;  1XMO J;  1T9V A;  2DR6 A;  1HNI B;  2MKI A;  2Y0S D;  1S97 A;  3BYR A;  2DNR A;  1EJ7 L;  2VJU A;  2L08 A;  4BC9 A;  1IKV A;  2E7V A;  3T41 A;  2K7K A;  1HQ2 A;  4ZIW A;  4DZD A;  2VBZ A;  1KDN A;  4O44 A;  4CYU A;  4FP9 A;  3QSY B;  4J37 A;  1DTQ B;  2LDI A;  4DCJ B;  1KD1 T;  3QGH A;  4DOZ A;  2YWG A;  3TZX A;  2W9B B;  3HKW A;  3MCO A;  1SQE A;  1VQO S;  4RNF A;  2J9D E;  1RT3 B;  1HBU A;  2QT7 A;  3HP6 A;  5GAD U;  1RU1 A;  3TX0 A;  5HAT A;  2PC6 A;  3T5K A;  2GVD B;  5KG3 A;  1SUQ B;  3LP2 A;  2C3Y A;  1Y3K A;  1RTJ B;  5KAK A;  1UPM B;  2LCW A;  4MIB A;  3HVT A;  1GT8 A;  2J76 E;  4ZVG A;  4DR6 J;  4I68 A;  3N6N A;  4OHW A;  3N0V A;  3RRH A;  5G0R B;  1WDT A;  5HMY A;  3PJW A;  4NXN F;  4JI2 F;  3MGJ A;  4ZJL A;  2HBQ B;  4P2X A;  2VC1 A;  3RBZ A;  1FHT A;  3LAN A;  2HAI A;  2K1R B;  2IRY A;  2MKK A;  1L3K A;  1UVM A;  1RWW B;  3IC1 A;  3CDU A;  2C2M B;  2RIJ A;  2BOA A;  2K06 A;  3R27 A;  2HRU A;  2J6T A;  3D7S B;  3F73 A;  3M2V B;  1QSY A;  4OI3 A;  3R3T A;  3BKT A;  3T1H F;  2Z8Q A;  3PW5 A;  4PXE A;  4JI8 F;  4DSF A;  2F9J A;  3AB2 B;  3MEE A;  3MM5 A;  1T11 A;  2OEK A;  4PG5 A;  3G6X A;  4ECS A;  2IMO A;  2MHN A;  5HBM A;  3LOU A;  5IT4 A;  8ATC B;  2R9L A;  4WP3 A;  1FRJ A;  1C0U A;  3KK3 B;  4RW9 A;  3D3C J;  1YG0 A;  2DIS A;  3THP A;  5M2R A;  1R3N A;  1WEZ A;  3R5A A;  1QTM A;  3CC7 S;  2V34 A;  2YKM B;  1YZ7 A;  4IRD A;  3H5X A;  3W5Z A;  1RT5 A;  4ILL A;  1U6Z A;  2PEB A;  3OR2 B;  1X4C A;  5C5J A;  4TY8 A;  4B3T F;  1X31 C;  2MZT A;  1JLF A;  2DK2 A;  2MQQ A;  1CJU B;  1UWB B;  5KG2 A;  3Q89 A;  4DR1 F;  2QTW A;  2PI4 A;  5KFR A;  4ED6 A;  1GFW B;  2ZFH A;  1LWX A;  4LQ9 A;  3ZZZ A;  1MW7 A;  4DV2 F;  5SZT A;  4DX7 A;  2LMI A;  2N82 B;  1F1B B;  3QMQ A;  3VVT A;  2JEJ A;  4BBY A;  2HVZ A;  3HSD A;  2EFO A;  2DNH A;  5H9F K;  4FF1 A;  2Y1I A;  1RTH A;  1K8A T;  1LK5 A;  1L3T A;  3OV7 A;  3N79 A;  3CPW R;  2W4P A;  3GCW P;  4F3O A;  3F41 A;  1S1W B;  3BF4 A;  4NI2 B;  2MKY A;  3RJM B;  3POT A;  2YWK A;  1S72 S;  3DHX A;  4U7C A;  3BGF A;  3I9Z A;  2VHG A;  4XPE A;  5F8G A;  3EYZ A;  2IM2 A;  3PG9 A;  3G82 A;  2YH0 A;  4PRF A;  2Q1L A;  2QA2 A;  1EAR A;  2VFU A;  2OPP A;  4USV A;  3CED A;  4OX6 A;  1I51 B;  2J0X A;  4TU8 A;  1FTC A;  3W5Y A;  1S9F A;  2G2O A;  4DR5 J;  2EFQ A;  4EO8 A;  1WSR A;  4UOH A;  4LFA F;  3ET6 B;  5K8P A;  1HNZ J;  3IS9 B;  1FJG J;  3VQS A;  3MZI A;  4K0K F;  2DD8 S;  3CCW A;  4NLP A;  4ECU A;  2H48 B;  1S77 D;  4J9U E;  1DTQ A;  4YB6 A;  4N77 A;  2F8H A;  2OEJ A;  2W9B A;  3MR6 A;  3KXD A;  1F60 B;  1ZH5 A;  4W4M A;  1SPB P;  3BSN A;  2M9K A;  2HLU A;  3GPA A;  1YJW S;  1RT3 A;  4PXC A;  2BJ8 A;  2F1F A;  4B9M A;  2ZOM A;  4ZIV A;  3MEC A;  2I1R A;  5D78 A;  1C0T B;  3V81 B;  2ZE2 B;  3RUB L;  1SUQ A;  4I69 A;  1ULR A;  2NPF A;  1RCX B;  3U7J A;  1VRQ C;  1RTJ A;  4NLO A;  3MAH A;  3T5H A;  2RRA A;  2Z0G A;  4NA1 A;  4F4W A;  5I3P A;  4A8X A;  1NB7 A;  1S59 A;  3WIU A;  3FCW A;  4X65 J;  1XC9 A;  5DDP C;  2M4M A;  1R8C A;  3G2X A;  2BOP A;  1GXU A;  4J5O A;  1PBU A;  1D0E A;  4PKD B;  1RUS A;  3SV4 A;  3JSM B;  3CIZ A;  5G0R A;  2J9C A;  2VOO A;  4DR7 J;  2RVJ A;  3OTE A;  1VBK A;  3UNG C;  3UPF A;  2K1R A;  4DV4 F;  4AL7 A;  1J5O A;  5H9E J;  2D3Z A;  3JSR A;  4USU A;  4IKA A;  2AYM A;  3K17 A;  6FD1 A;  3V4I B;  5KFO A;  2CG4 A;  4B3O B;  5IT9 Y;  4CO1 A;  4J9N A;  1NDK A;  3VR1 A;  2H4Y B;  5C7P A;  3OTO F;  1JKH B;  2F4F A;  3TI0 A;  4JP8 A;  1S6U A;  4A8K A;  4DLE A;  1R8A A;  2WSE C;  2HHW A;  2BKN A;  3DGP B;  3IO1 A;  2Z2M A;  4U96 A;  1RAH B;  3OQ2 A;  2R8K A;  3BBB A;  5KFP A;  4A8F A;  3KK3 A;  3QYY A;  4IUF A;  4CLK A;  4AXJ A;  2YKM A;  2CQC A;  4M5G A;  2VFV A;  1D1U A;  4WXO A;  1UVI A;  2JFD A;  1F2G A;  3J7Z 5;  3OR2 A;  4RJV A;  2GIF A;  4J9O A;  1S0N A;  1IBL J;  1FRM A;  4DHV A;  2CDR B;  3H8Y A;  1CJU A;  1UWB A;  5CD4 A;  5D4P A;  4Q7A A;  3MMJ A;  5HVF A;  1GAO A;  3M1V B;  3NMR A;  2Q66 A;  1WUU A;  4WTO B;  1RAA B;  2XHW A;  3UN2 A;  5KFK A;  2DRD A;  2MZR A;  3TUJ C;  2WBM A;  4NYP A;  2BVZ A;  3OVA A;  3MR5 A;  4R8U B;  5A0Y B;  4DV3 F;  2NZ4 A;  1OO0 B;  3PYF A;  1PGZ A;  2UVU A;  2E5L F;  2F63 A;  4M5M A;  2DYA A;  4ZVO B;  2WW4 A;  2LP4 A;  2V0N A;  2IVY A;  4ED3 A;  3A4T A;  3OTC A;  3RRK A;  1S1W A;  1RGV A;  4NI2 A;  1KRP A;  4NLY A;  1RE1 B;  5JUM A;  1BQM B;  1RJJ A;  2NR0 A;  3CXC R;  2OPQ B;  5F0W A;  2J0Q D;  4MKA A;  2ZC3 A;  3PR4 A;  3MUR P;  2XCA A;  1JLA B;  5KTQ A;  1QAI A;  1OPI A;  2MXY A;  3H98 A;  4ILM A;  1PG5 B;  5GAH U;  3KHL A;  3NAI A;  2V63 A;  1WC5 A;  3TAN A;  4WP9 A;  5KFB A;  3IGN A;  4EO6 A;  2XI2 A;  2DGT A;  1RK8 A;  1TR0 A;  4CO4 A;  1FF2 A;  4B3R J;  4NLS A;  4OZ1 A;  3NNH A;  2YWF A;  3ET6 A;  2BKO A;  1FKA F;  3Q83 A;  3PFE A;  4HLB A;  5KFY A;  4K4V A;  1ZS6 A;  3ILL A;  4NEY A;  3EXY A;  3CD0 A;  1L5U A;  2BA9 A;  3PYD A;  4OJG A;  4QJV A;  2G2Y A;  3RB6 A;  1HWK A;  4GKJ J;  1NPK A;  2NXE A;  3W2W B;  4JV5 F;  1TL1 B;  4RPF A;  4RBT A;  4R5P A;  2KYZ A;  2CVE A;  4KKO B;  3K89 A;  3QIP B;  1V5I B;  2IM3 A;  1Y7P A;  5F8H A;  1C0T A;  4AT1 B;  3Q8R B;  3V81 A;  2NXN A;  1VYA A;  2XBP A;  2ZE2 A;  1HHS A;  3K59 A;  1FXD A;  2CWX A;  4F25 A;  3C15 B;  1S9E B;  4Y65 A;  4BLG A;  4UY8 T;  2JSX A;  2JWN A;  2SXL A;  4KJI A;  1UP1 A;  4X62 J;  1XWL A;  1AUD A;  2GC8 A;  3HHE A;  1FEE A;  4WP8 A;  3QT5 A;  3PX6 A;  4QWA A;  2KHC A;  2E7X A;  2D74 B;  3HFZ B;  2RDJ A;  2H51 B;  3JSM A;  1F9H A;  1JLC B;  3W5X A;  1U2C A;  2YX4 A;  1J27 A;  4RL1 A;  5ETL A;  2AYG A;  4JI1 J;  1C4C A;  1SH0 A;  2ZVI A;  1T3O A;  3CGI A;  4E2F B;  2KB2 A;  3EM1 A;  3RYL A;  3V4I A;  4B3O A;  2D1C A;  3UDL A;  2VPW B;  1TVR B;  4F26 A;  3MM8 B;  3QAE A;  1CC8 A;  2YQ1 A;  3UDV A;  2MKS A;  1O6X A;  3JQM A;  2CJY B;  4WE1 B;  5JXS A;  4ALZ A;  1FFS B;  3M30 A;  1DTT B;  3DLG B;  5M2U A;  2V8P A;  3DGP A;  3PO4 A;  3WIV A;  2R2T A;  4FF2 A;  1VI7 A;  2ADB A;  4CLY A;  4C97 A;  1OQ3 A;  2AHO B;  4HTJ A;  3DKD A;  4WFN Q;  3MM6 B;  2VL1 A;  3JQJ A;  2DO4 A;  1VIS A;  1NHK L;  3IAS 9;  2A0F B;  5L1J A;  3T9N A;  4OX7 A;  2LU1 A;  3ZZY A;  1F3V A;  4ZPT R;  4A8Y A;  5CAB A;  1TKX B;  5L8R C;  4OLO A;  1DQ8 A;  2V4R A;  1FX2 A;  3OXG A;  3M1V A;  5J2M B;  3C46 A;  2EC0 A;  3V6J A;  2FDN A;  3OT9 A;  5F0U A;  3C6T B;  2JJ4 D;  1LWF B;  3OXF A;  1Q0N A;  4R8U A;  5A0Y A;  4IH5 A;  4WYW A;  3D1H A;  3ISN C;  4RUC A;  2H54 B;  4MK8 A;  4ED4 A;  4KH0 B;  2AGP A;  2DCU B;  3M8W A;  3HLU A;  1B3T A;  4AD6 A;  2MEW A;  2I8E A;  2J5A A;  3CD7 A;  4OHV A;  3OSN A;  1URR A;  3DI6 B;  1RAF B;  2CG8 A;  3NNC A;  3OD2 A;  2XLK A;  2CRL A;  1BQM A;  2DH7 A;  3R7N B;  1V3R A;  3OSP A;  4DCO B;  1RT7 B;  2HHS A;  1JLA A;  1U4B A;  4GMK A;  5KG0 A;  1QLN A;  4QWC A;  1IJE B;  2KG1 A;  3FZB A;  5A6P A;  1NCL A;  1Y5I B;  1U26 A;  1NSA A;  4KGX B;  2NPI A;  3K7R A;  1UEK A;  2OMO A;  4O3N A;  5AXK A;  4Q43 A;  1J5E J;  4ZVU B;  4QR1 A;  1ARO P;  5IFM A;  1X0P A;  1FKP B;  4ED5 A;  3IWX A;  3I31 A;  4ID5 B;  4X4S A;  2V2K A;  2KN4 A;  1S12 A;  1RBO B;  3QO9 B;  1FWL A;  2MJN A;  2KXN B;  2D3O 1;  2R42 A;  2GX8 A;  5B0D A;  4DFP A;  3OBI A;  3MEK A;  2QMX A;  2FD2 A;  1YJR A;  3AH6 A;  1TMJ A;  1WF1 A;  1XMO F;  4W92 B;  4USM A;  3W2W A;  2VZ9 A;  1TL1 A;  2CZ4 A;  5U47 A;  2DGS A;  2CPH A;  2HFN A;  4N47 A;  4DV5 J;  3CJR A;  5KFT A;  2V8V A;  1L3S A;  3GJQ B;  4OHX A;  1VGY A;  2WAQ D;  4KKO A;  4MJK A;  2I6W A;  5L39 A;  2ALY B;  1YVF A;  3QIP A;  1IXK A;  3GIM A;  3QJP A;  2LQ5 A;  3MCM A;  1HR0 J;  1HPZ B;  2E1P A;  3KJN B;  5DQH A;  4ZCM A;  3C15 A;  1S9E A;  5GMK a;  3BQ1 A;  3RBD A;  1HWU A;  4FXD A;  2AYE A;  2DKO B;  2U2F A;  2W4D A;  1WG4 A;  2YKN B;  3LF0 A;  4ETX A;  1JLC A;  1NHU A;  4CLF A;  1EHW A;  3TVK A;  3Q22 A;  2R7O A;  2LEP A;  4OYO A;  2XS5 A;  1LKZ A;  4JI6 J;  1QVF R;  3AD9 C;  1BD6 A;  4HI1 A;  3DXS X;  4ELV A;  4DR6 F;  2YKQ A;  1GXT A;  2IJN A;  2J6S A;  1Q16 B;  3BBF A;  2VV5 A;  1S9G B;  4B3M J;  1WAC A;  3HT0 A;  1KWM A;  1TVR A;  2QMW A;  3MM8 A;  2RRN A;  1FNX H;  2DHA A;  4OMF G;  1H2T Z;  4WE1 A;  5F8I A;  3SQG B;  1DTT A;  3DLG A;  3CW2 C;  4KSE B;  5CZX A;  4J9M A;  4EFA C;  2V8H A;  1XER A;  4YB1 P;  1RBL A;  4ZLL A;  1U09 A;  3MM6 A;  4LR7 A;  1TK0 A;  3MHY A;  4MYU A;  3J81 U;  4IOC Q;  2WVB A;  4O3P A;  1VMB A;  1WC0 A;  2OLW A;  2P6S A;  3I96 A;  4XDC A;  3ITH B;  1K47 A;  3NG8 A;  4KPC A;  1N36 J;  1VQN S;  2HW3 A;  4QW8 A;  3O6Q A;  1U45 A;  4NZ6 A;  3PIO Q;  4IFY B;  3VTI A;  1TKX A;  4JYA J;  5AJ3 J;  3RAQ A;  5IWA J;  3Q24 A;  2WW8 A;  4FF4 A;  2RSQ A;  3V5R A;  1VQP S;  3PEH A;  5J2M A;  1XMQ J;  1FK9 B;  2ZH9 A;  3LAM A;  1KN6 A;  3LO3 A;  1SJF A;  4P7T A;  3T1Y J;  3C6T A;  1LWF A;  3TJA A;  2WCX A;  3PHT A;  2F4V J;  4K4W A;  1TL4 A;  3FEX B;  3GG1 A;  1T9T A;  2CA9 A;  1NLK L;  3IWN C;  4F50 A;  2ZKT A;  3BBC A;  2L9D A;  4KGZ B;  3KNG A;  5MLC V;  5L9X A;  1HBN B;  5KFD A;  4KHR A;  2ZBR A;  4Y2A A;  2R7Q A;  4CH0 S;  3TVY A;  3DI6 A;  1FE4 A;  2HHP A;  2HHQ A;  3R6L B;  4EYH B;  5DQG A;  2DGO A;  4OLP A;  5DDO C;  4NX9 A;  4CLT A;  1CS4 B;  1RHK B;  1RT7 A;  4Q8E A;  1DRZ A;  1J2V A;  1HQE B;  2XY7 A;  2D9O A;  3R6G B;  4IH7 A;  2Z2Z A;  2A18 A;  5B0F A;  2N7Y A;  5FLX Y;  1RA6 A;  2M7S A;  3BSA A;  5E3C A;  3B54 A;  4D3H A;  3G8S A;  4PR6 A;  4Q2M A;  4LIW A;  1M1H A;  1PO6 A;  3GB0 A;  3SYZ A;  4RWW A;  4EK2 A;  4Q45 A;  4QU6 A;  2GFF A;  4RNM A;  4OYB A;  1VQ9 S;  4ID5 A;  1VK8 A;  5LJ5 Y;  2BJ1 A;  2P5V A;  5ETO A;  3QO9 A;  4MIA A;  3TUI C;  2DNQ A;  5A8R B;  2Y8Y A;  4PYD A;  4MH8 A;  4ZPV R;  5LSO A;  1Z1Z A;  3W60 A;  1R6Y A;  4DMZ A;  4WU3 A;  4DR5 F;  4N56 A;  2E5G A;  4KR0 B;  3RB4 A;  2GHW A;  5E41 A;  3ENW A;  3VAG A;  1HNZ F;  1UCN A;  1FJG F;  5J2N B;  1VC0 A;  3T3F A;  4OZ0 A;  3TOQ A;  2X1A A;  2R2S A;  3KLV A;  4CT8 A;  2AT1 B;  4TKT A;  3MPD A;  5D3G B;  3K8V A;  3OTD A;  3ETM A;  3MFH A;  1B70 B;  3VHQ A;  4I7F B;  2D3U A;  4ZKA A;  4DL3 A;  1IN0 A;  2BUN A;  1F5C A;  1ICE B;  5DJB A;  3PRV A;  3RU0 A;  2W01 A;  4DR4 J;  2XMU A;  3TUP A;  2YKN A;  2XMV A;  1MML A;  3OFG A;  2ASD A;  2PA8 D;  1E6V B;  2XSF A;  3CO9 A;  2ZH1 A;  3MD3 A;  4OZL A;  4N7T A;  2HLT A;  2U1A A;  2JX2 A;  2BJ9 A;  4X65 F;  2GS8 A;  1WOP A;  1M1G A;  5T14 A;  3NL0 A;  3MMB B;  1WHY A;  1FRL A;  2ROG A;  1RAO A;  3OFH A;  4DPO A;  1S9G A;  2XYP B;  2E9Z A;  4GO7 X;  4DR7 F;  3NCQ A;  2Z2Y B;  3DMJ A;  4ZCL A;  4L72 B;  5F9L A;  1NSK L;  3FNN A;  3IRW P;  3MFI A;  4ZPD A;  3SQG A;  4LBI A;  1SJ1 A;  1SJ3 P;  2W4C A;  2IMW P;  3Q86 A;  4GKK J;  3AHP A;  2GJI A;  3PZP A;  1U8S A;  3SSS A;  4C98 A;  5ETV A;  2RD5 C;  2FJW A;  3Q2S C;  4BDP A;  2Z2L A;  2YPZ A;  4IDK B;  2MHE A;  3L4B C;  4DL5 A;  1UWA A;  2EVZ A;  2O67 A;  3AJ2 A;  2W9A A;  2CPE A;  1KOO A;  4BWM A;  3ITH A;  8AT1 B;  5LT5 A;  2OSR A;  1Q82 T;  4KRW A;  4CNZ A;  3CTR A;  4IFY A;  1NK7 A;  4DUY J;  4ZLJ A;  2AZ1 A;  4M63 A;  4DV1 J;  2X51 A;  2YTC A;  4JI4 J;  4X4N A;  2PEH A;  1FK9 A;  3GWC A;  3LPY A;  1EB0 A;  4ZK7 M;  1HW9 A;  1RWU A;  2NCK L;  2YKO A;  3D4J A;  4OHY A;  2E66 A;  4UOG A;  1U1O A;  2IYI A;  4QPX A;  1IBL F;  3X3U A;  1SL0 A;  4E8U A;  3Q2T C;  2OO4 A;  2DGW A;  1N5T A;  3HPO A;  1SL1 A;  3WQP A;  1HBN A;  4USK A;  3R97 A;  2B4V A;  3NEK A;  1A7G E;  2OSQ A;  2R7T A;  4JV0 A;  1HAR A;  2KJV A;  2QE5 A;  5KFW A;  2DHX A;  1IVZ A;  3LAL A;  2OML A;  5HMZ A;  1W2I A;  4PXB A;  3HCX A;  1CS4 A;  4YUD A;  1HQE A;  5D6G A;  3CJ8 A;  1JNR B;  3M32 B;  3SBM A;  4F0H A;  5HRO B;  1CEZ A;  2HG4 A;  4J9P A;  3PW4 A;  1PKU A;  5IC6 B;  2DIU A;  3PX0 A;  2OGU A;  3IM8 A;  1VJW A;  1N88 A;  4K2J A;  4N41 A;  1LK7 A;  4P71 A;  1R43 A;  3KFW X;  2BJ7 A;  4CTA B;  1R6V A;  1SI9 A;  3NS5 A;  5FII A;  4J9K A;  3KMQ A;  3D1O A;  5A8R A;  1JX4 A;  3NCP A;  3FQK A;  3C16 B;  3W8G A;  1XN9 A;  3L7P A;  4B3R F;  3EZO A;  1CJT B;  1FTR A;  2ZH4 A;  2MQO A;  2NYH A;  3ENA A;  1UZD A;  2Y8W A;  1YGY A;  2VPY B;  3MXH P;  4NXM J;  4CIO A;  1WOS A;  3NP5 A;  3PW7 A;  3FMB A;  2AJQ A;  4GKJ F;  1HWI A;  4M5N A;  3KLH B;  5D3G A;  3BRE A;  4H4M B;  1N32 J;  2HBR B;  3MMA B;  1TL3 B;  2VDH A;  4TNO A;  3AT1 B;  5KFS A;  1H0H B;  3GFY A;  4KE5 A;  2GIR A;  1ZAV A;  3HZE A;  4NRT A;  1FFW B;  2VD3 A;  3C3L A;  2PN6 A;  4MIW A;  2QYC A;  3NS7 B;  4M95 A;  4Y2K A;  1YJ9 S;  2EC2 A;  2CKW A;  3DLJ A;  2CQ2 A;  3M8S A;  2W2N P;  4MK9 A;  4DQP A;  1E6V A;  4LF1 A;  2NLW A;  5LL6 d;  2PFD A;  2F3J A;  4K2X A;  4YB7 A;  4X62 F;  2HND B;  4QYR A;  1WWH A;  1URN A;  3FEZ A;  1T8E A;  2CPX A;  5E5N A;  1NH8 A;  3MMB A;  3MR2 A;  3NWG A;  3EZU A;  2JDJ A;  4JI1 F;  2HUR A;  5ETS A;  5GVQ A;  2BXJ A;  3T9Z A;  1IBK J;  1EKR A;  5DDR C;  1QY7 A;  3H7H B;  1UVN A;  1RTD A;  1OSD A;  3GG0 A;  3A3N B;  1WC4 A;  3BR8 A;  3KLE B;  3FRY A;  3CJS A;  1D8Y A;  2QEX S;  3L7O A;  2CWK A;  1UJ6 A;  3PDN A;  3IBC B;  4LVN P;  2G2Z A;  4IDK A;  4P9S A;  2UUA J;  4WKR A;  1AZS B;  4OZ3 A;  2G9O A;  1GX6 A;  1VCT A;  4YP3 A;  3PEJ A;  2DH8 A;  2JHE A;  3KJF B;  2RKI B;  1N54 B;  4DV6 J;  2CZ9 A;  4OJ3 A;  1TP7 A;  5HAO A;  5J1N A;  1ZZN A;  4P2F A;  3V4M A;  5IZH A;  4IO1 A;  3KDO A;  2UVV A;  4G1I A;  4UST A;  2PD1 A;  2NXC A;  2WVE A;  3M9O B;  1SH2 A;  4M5K A;  2YWE A;  2E1M C;  1FJC A;  2J7U A;  1ZTW A;  4EWT A;  2EFP A;  2PMW A;  4J91 A;  2QL5 B;  1HQU B;  1KP6 A;  2CQ1 A;  1SC6 A;  3GSI A;  2UU9 J;  3BO4 A;  3L3C A;  2YXL A;  3CVK A;  1Z4U A;  4TYA A;  2FPH X;  1CPZ A;  1FE0 A;  4CO2 A;  2HQF A;  2DY1 A;  4M5J A;  2B56 A;  2ACM A;  1GMW A;  3R1H A;  5I3U B;  1SKS A;  2QRR A;  1KFD A;  3N6L A;  2LEA A;  3M32 A;  5HRO A;  3PCO B;  2R8H A;  2GMH A;  1U6F A;  2XUL A;  3I55 S;  1PC5 A;  1YK9 A;  4PWU A;  3W66 A;  1V5V A;  4X2B A;  4ECW A;  2PFF B;  4CTA A;  2RHS B;  2IJR A;  3NGU A;  1NH7 A;  1JK9 B;  2KH9 A;  4RNN A;  1W26 A;  4B9T A;  1M5H A;  1HNX J;  3HJV A;  5D0G A;  3QID A;  4DFJ A;  5KFX A;  3EX7 B;  1WKK A;  2MKH A;  3I9V 9;  1J5E F;  3C16 A;  1WKJ A;  1SC4 B;  5CXT A;  2BR0 A;  2ABY A;  2W9C B;  1CJT A;  3QGG A;  5EX0 A;  1NJX A;  2MST A;  3ILJ A;  3O8W A;  1ZYQ A;  1NM2 A;  3PAC A;  2I5J B;  5IT0 A;  2YWH A;  3FC9 A;  2MSS A;  4UOF A;  3UN5 A;  2HHV A;  3CCL S;  2IYG A;  2ZDO A;  2J0S D;  1V9O A;  2QA4 S;  5G4D A;  3M6X A;  5DZ7 A;  5KG7 A;  3KLH A;  3GLJ A;  2H9Z A;  4H4M A;  3E3X A;  2EFN A;  1KSP A;  1TL3 A;  1LXN A;  3RAM A;  4LRE A;  4DV5 F;  3ZNU A;  2FHJ A;  2FZC B;  4XAK A;  2BQU A;  4UQG A;  1O5J A;  4PG4 A;  4RLE A;  1D3W A;  4RWX A;  1HR0 F;  2K8G A;  4ZVP B;  1FFG B;  2ZDP A;  3R8Y A;  2HND A;  3RRG A;  2DNZ A;  4C0O C;  1YKW A;  3MDF A;  1R7I A;  4GC6 A;  2VOP A;  4FXW A;  3R9L A;  2IM0 A;  5IV4 A;  1BC6 A;  3KK2 B;  5F3Z A;  2B5J B;  4JI6 F;  3G86 A;  1RWV B;  1H2U X;  1SKR A;  3BGO P;  3HD2 A;  4A4J A;  4PUO A;  2ASL A;  3CDA A;  4P74 A;  1GTH A;  1VIO A;  5AXL A;  2OEL A;  3KHR A;  1NU4 A;  4B3M F;  4L75 A;  3KLE A;  4LBP A;  1G7C B;  3M6W A;  1QM9 A;  1IM4 A;  4N8N A;  2UUW A;  1H7W A;  2UUT A;  4ECQ A;  4G6V B;  3P8B B;  5E3R A;  3HO1 A;  4DL0 C;  1AZS A;  4M1K A;  4C4W A;  1I94 J;  1VQS A;  3UN3 A;  2XWY A;  3DCA A;  1YRT A;  2RKI A;  2E5J A;  2Q79 A;  2ZJP Q;  1P9Q C;  1PJ5 A;  1N34 J;  2RDI A;  1ITP A;  1NEE A;  3SXL A;  2HS3 A;  2IA0 A;  5JJB A;  4XIU A;  5H9E K;  5B0B A;  1ZAW A;  3D68 A;  4NLT A;  1ZM4 A;  2XTJ P;  1IKY B;  3BGL A;  2QA1 A;  5FDL B;  1N36 F;  2DY9 A;  3ZZO A;  2HQG A;  4JYA F;  1S6Q B;  2CJX B;  1TFW A;  5AJ3 F;  3KG1 A;  4OYX A;  5IWA F;  2GV1 A;  2G0C A;  4RW7 B;  1XMQ F;  1HQU A;  2BDP A;  3BZQ A;  1CJK B;  4O0I A;  2VB6 A;  3T1Y F;  2R7W A;  4NZ0 A;  3SV3 A;  4Z37 A;  1HD0 A;  2BX6 A;  4LBH A;  4O3S A;  2F4V F;  3DNC A;  3S8S A;  2DH9 A;  1SJ4 P;  1U0H B;  2MZQ A;  1DY3 A;  2FB0 A;  1S1U B;  1S0M A;  1JJ2 R;  3LP0 B;  3D2W A;  4C0H A;  1Y00 A;  3DLL Q;  4KHM A;  5LM7 E;  4ANE A;  3EWG A;  4WK1 A;  5LXY A;  4Q0B B;  2DB1 A;  2FZK B;  4C48 A;  3BGU A;  2XCP A;  2LLZ A;  3BS9 A;  3MOJ B;  1Q95 G;  5CA5 A;  4K8R A;  4EMD A;  2VQF J;  4MKB A;  4CT9 A;  4K4Z A;  4IOB A;  2XMA A;  2C2E A;  4IRK A;  3QWP A;  1RU2 A;  1RAI B;  4Q44 A;  3PJ9 A;  3E2E A;  2B0G A;  4URG A;  3QZ8 A;  3TA1 A;  3RGI A;  3I4H X;  1Y11 A;  3TJ9 A;  3VAL A;  1JWW A;  5D8H B;  2W9C A;  1RAJ A;  5HMW A;  3MR3 A;  3F56 A;  2W7A A;  5CYQ B;  2KXF A;  4QQB A;  3ZZR A;  4IRC A;  1B7F A;  2X3G A;  2I5J A;  3GTY X;  2P2C B;  3W65 A;  3I5B A;  3S6E A;  1S49 A;  5GAG U;  3MUM P;  1X7V A;  2VFS A;  2LQB A;  4NOH A;  1GH8 A;  4LSL B;  3ZZT A;  3SEO A;  5DRK A;  3OL6 A;  3GR1 A;  3HVR A;  4OYI A;  4ILR A;  1X4H A;  2AEJ A;  1AA1 B;  2ZH7 A;  2AWZ A;  4NAS A;  1T94 A;  5K8M A;  3A13 A;  4RW4 B;  3A3P B;  3G6V A;  1VQM S;  3TQE A;  3CCM S;  3KDN A;  1Q86 T;  1W7W A;  4USI A;  2A10 A;  4PG6 A;  1LFW A;  4MT1 A;  1S6O A;  4CP5 A;  3ETO A;  3T5L A;  2E7W A;  1SC3 B;  3VAK A;  1WF2 A;  3JAM Y;  3KHG A;  4DR4 F;  3TUZ C;  1KTQ A;  3NWR A;  4RU9 A;  1SQG A;  4F3Q A;  5IQ6 A;  4KO0 B;  2NUU G;  2OPR B;  2WVD A;  2KZM A;  2KXH A;  3B4D A;  1ZET A;  4ZS6 A;  3KK2 A;  4LRA A;  3CCT A;  1Q7Y T;  5B0E A;  4LRB A;  4LIR A;  3J80 Y;  1YDL A;  2B5J A;  2B4P A;  2C3O A;  2RRB A;  3MD1 A;  1KVJ A;  2E44 A;  4MKY A;  3L9Z A;  2KKH A;  4B9U A;  3CCZ A;  1OSC A;  1QVG R;  3CCJ S;  2XLI A;  1FES A;  2YY3 A;  2XMM A;  4GVB B;  3PRD A;  1NPR A;  1YIT S;  2DEI A;  4DPT A;  4ZN1 A;  2UV8 G;  3P5T L;  1AFI A;  5BR8 J;  1WSV A;  4OL8 A;  3GFH A;  2F65 A;  4GKK F;  1QDU B;  4L76 A;  5J2P B;  1DHM A;  4TY9 A;  2BRK A;  4EUV A;  1TV6 B;  2HVE A;  2HAF A;  1C1C B;  1GX5 A;  2X1G A;  2P6T A;  4CWB A;  3CDB A;  3PO5 A;  4CH7 A;  4K4S A;  1YBT A;  3MUT P;  2RDD A;  3OFE A;  1IKY A;  5KFM A;  2V9K A;  1IBC B;  1D9F A;  2IIH A;  2LQ9 A;  4CH1 A;  4DR3 J;  4NWB A;  2DBB A;  2ILY A;  1VQ4 S;  4IR9 A;  1KFS A;  3IM9 A;  4DUY F;  2UXD J;  4M5H A;  1S6Q A;  2EI5 A;  4DV1 F;  2VON A;  5DM6 Q;  4JI4 F;  4RW7 A;  1N5Q A;  3K57 A;  1T03 B;  2BJD A;  2XB2 D;  2N4C A;  1R0C B;  1CJK A;  4IH6 A;  4CLP A;  1NJY A;  1T05 B;  2F7V A;  1RSC A;  3T5J A;  4G1Q B;  5DQI A;  2C22 A;  4DUT A;  2RAQ A;  3CJK B;  2G13 A;  3GYG A;  2ZWO A;  3QZ7 A;  4BCA A;  1U0H A;  4ICL B;  3X1L B;  1ZZF A;  1S10 A;  3O44 A;  2C2N A;  2GVZ A;  4ZVE A;  1S1U A;  2I9S A;  3LP0 A;  5DS7 A;  1Q5V A;  4URS A;  2WSC C;  4Q0B A;  2HWH A;  4DSE A;  5EX3 A;  1X5T A;  4F0M A;  2HWT A;  3CJQ A;  4X4R A;  4Y28 C;  1PIL A;  3TQ1 A;  1WEX A;  3NKY A;  1OS5 A;  2MKC A;  3R2C J;  1PC4 A;  3HX9 A;  4JI5 J;  3CWJ A;  4X4V A;  2ZKU A;  4JI0 J;  1SV5 B;  4IFV B;  3AQO A;  1EIY B;  2VKR A;  3PYG A;  4FBT A;  1CSJ A;  2DHS A;  4RW8 B;  4FKY A;  3CC4 S;  4LJM A;  4X84 A;  3VCD A;  2EXU A;  4K4Y A;  5E33 A;  2LDY A;  4QIV A;  2OTJ S;  3H40 A;  2KJW A;  3J7A 1;  1NK5 A;  1SJQ A;  2IHR 1;  2M52 A;  4CRJ A;  3KWM A;  5CYQ A;  1S0O A;  4PEO A;  4DLG A;  1SIZ A;  1VHI A;  1QJH A;  1YX2 A;  4YY3 J;  3GYX B;  1CG2 A;  1JXV A;  5GAD I;  3GJT B;  4DG1 B;  4ECV A;  3J7Y U;  4WYL A;  2OIH A;  3QGP A;  4LSL A;  2MKJ A;  4NEZ A;  5B0C A;  4LVO P;  3GZ7 A;  1BY9 A;  2DRA A;  3QT6 A;  1KLM B;  4K4U A;  4WFB Q;  2YNF B;  2H4W B;  4ZVS B;  4HAC B;  2NSB A;  2PE8 A;  3U02 A;  1N48 A;  1HKA A;  4NXM F;  2DGU A;  3OL9 A;  4YR0 A;  4FYY B;  1FWK A;  4DS4 A;  4RW4 A;  4F2S A;  4GVL A;  1WNE A;  3JTN A;  1N32 F;  2HQC A;  2UVW A;  5AT1 B;  1X4G A;  3ZTS A;  2DGX A;  4MFB B;  3QNW B;  1ZM9 A;  1GQE A;  2CPJ A;  5T7L A;  1N0U A;  4ZLN A;  3RAX A;  1X9M A;  3MAA B;  4O3R A;  2EBG A;  5F8M A;  1WHV A;  4OX9 J;  4KO0 A;  4M94 A;  2OPR A;  4PQU B;  5CHC B;  1DAX A;  1DJ0 A;  3WC0 A;  1M0S A;  3QT7 A;  4HI2 A;  2YQ0 A;  3TNV A;  3T1A A;  2ILZ A;  5A76 A;  2K3K A;  2KFZ A;  3EDR B;  4JBC A;  4L73 A;  2ZC4 A;  5CCL A;  3UCU P;  3RBE A;  2K3I A;  1MNE A;  3VWS A;  2H5E A;  2GGP B;  3RB0 A;  1FER A;  4DQQ A;  3P5B P;  4DQR A;  4LF4 J;  2V6A A;  2G1D A;  3CJ3 A;  1BXN A;  4TU7 A;  1IBK F;  5HN0 A;  3UR0 A;  4GO5 X;  3RB3 A;  3BSC A;  2MGZ A;  4DI6 A;  3OVB A;  2MDA A;  3NMA A;  2BMB A;  1ZM3 A;  5J2P A;  5GAE U;  2JVO A;  1GNK A;  4KTQ A;  1CLF A;  1LQ9 A;  2R8I A;  2UUA F;  1TV6 A;  3OFF A;  1C1C A;  2YX7 A;  3Q0A A;  4AYB D;  3G87 A;  2P9E A;  1FDB A;  4AXI A;  1VBY A;  1CJV B;  2HIQ A;  3R1L A;  3DRY A;  2B9Y A;  1S1V B;  4ELU A;  4DV6 F;  3VGU A;  1UVJ A;  3WDO A;  4FYW B;  1Q53 A;  1VFJ A;  4OI1 A;  3CCS S;  3MWB A;  4Y34 A;  1DAR A;  3CJ4 A;  1T03 A;  3EDQ B;  3K5P A;  2CJK A;  2RS8 A;  1T05 A;  4F4Z A;  1UZH A;  1XBW A;  2CQB A;  3CJK A;  2JFK A;  2QFI A;  4NL5 A;  2FLO A;  3FKB A;  4ICL A;  2C2K B;  4WU2 A;  1AFJ A;  4F4X A;  4P73 A;  2OFG X;  2UU9 F;  2PO4 A;  1TUG B;  2CAD A;  3D0H E;  1BLU A;  5F9N A;  2CXE A;  2B7B B;  1U7L A;  2HQ3 A;  2ZEJ A;  1LXJ A;  5A6W A;  1WG5 A;  2JNJ A;  4WFA Q;  5A2Q Y;  4LSZ B;  2XS2 A;  2MQ8 A;  1NPP A;  2XZT B;  4C11 B;  4DR2 J;  2MQL A;  3HDS A;  1SV5 A;  4IFV A;  4C8K A;  2UZA A;  1N4L A;  5E7O B;  2HVD A;  1ZAX A;  3EE3 A;  4M5D B;  1HBM B;  2M70 A;  2LA6 A;  4B9V A;  1B4S A;  1DQ9 A;  2ADC A;  4AL5 A;  4PPZ A;  4WFX A;  2BQ3 A;  3L7U A;  1U1M A;  5I4M A;  1R89 A;  2V67 A;  2UXC J;  2KRB A;  2KYX A;  4JI3 J;  1JNZ B;  1NKE A;  1K1Q A;  1HNX F;  2L9W A;  1JJ4 A;  4FBU A;  4DL4 A;  4M5I A;  4DG1 A;  1XR6 A;  4C2M A;  1VIX A;  2LEC A;  2YH1 A;  1HNV B;  2Y0B B;  1KQG B;  1KLM A;  4H4O B;  4KFB B;  2YNF A;  2C2Z B;  4HAC A;  4ZJO A;  5SUH A;  4X4U A;  2QO3 A;  4IQM A;  4ATN A;  5IS2 A;  3FJ2 A;  3NGK A;  4NYZ A;  2J9D A;  3I32 A;  3HHL A;  4S0M A;  4WFY A;  3ZXW A;  1HNI A;  1NJI T;  2ZH2 A;  3V6H A;  7FD1 A;  2A1B A;  2IJF A;  1EZZ B;  5KT6 A;  1XIQ A;  4MFB A;  1NXI A;  1NUE A;  2AYB A;  2KTQ A;  4F4K A;  4EZ6 A;  1RAB B;  2Q3P A;  4IR1 A;  3IN5 A;  1VHF A;  2AX0 A;  4B9L A;  4PQU A;  3BR9 A;  4MAK A;  1EKS A;  2XMJ A;  3I0S B;  3RTV A;  2FY8 A;  2AJ1 A;  3HVW A;  3HHL C;  1PJ6 A;  5D4N A;  3OJS A;  5J2Q B;  2AJ2 A;  4U67 Q;  4QWB A;  2EBE A;  3GR0 A;  2FGC A;  1HWL A;  2XEX A;  2IDE A;  4ZN3 A;  1U48 A;  4PAA A;  2XYH B;  4U7U D;  3SCJ E;  3DYA B;  4CLS A;  2GGP A;  1CBK A;  3L09 A;  4AQY J;  1OJ4 A;  2OEM A;  2GVD A;  3IRX B;  4UZB A;  1FKO B;  4CM2 A;  3GIR A;  1S6P B;  3VAJ A;  4RO0 A;  5KFV A;  5CQG A;  4EBE A;  3VAM A;  4WZM A;  3TA0 A;  3S01 A;  2MB0 B;  2XO7 A;  4PYA A;  4CM0 A;  4XO0 A;  1JLE B;  1FD8 A;  5HO4 A;  4OV6 A;  3BDE A;  5KG6 A;  2CQ4 A;  3VF0 B;  2OUG A;  5HSP A;  4ZP8 A;  3N5F A;  2BV3 A;  2NSC A;  2HFO A;  2DXE A;  1I94 F;  5L9N A;  2X1B A;  2WB1 D;  1RT1 B;  1QAY A;  3HKZ D;  1CJV A;  4HYK A;  4URQ U;  1AW0 A;  2V9W A;  5K20 B;  1S1V A;  4JV1 A;  3E51 A;  3R5C A;  3MTK A;  1N34 F;  4R0J A;  1RBA A;  3M2V A;  2QSW A;  4Q5V A;  1TEL A;  4WWS A;  2HFS A;  5GMD A;  2GHV C;  4GRS A;  5C42 B;  1EET B;  4C8M A;  3H0P A;  3GV7 B;  1BWV A;  1PAU B;  3DFE A;  2QYG A;  3O1L A;  5IXU A;  2FC8 A;  5F3T A;  4ENO A;  2BE9 B;  4O23 A;  1SJR A;  5L1L A;  3PHE A;  2YKP A;  2AP6 A;  5I42 B;  1UFL A;  5GAH I;  2J0W A;  4EBC A;  1JLB B;  1K0V A;  4WII A;  3UD3 P;  2J6U A;  3W8P A;  3QRR A;  3C14 B;  5E3P A;  2D3O R;  4J9Q A;  2ZM6 J;  4OZ5 A;  4GC7 A;  3CCE S;  3CMQ A;  3GFZ A;  2CPZ A;  3M6V A;  1JIH A;  3IXQ A;  2QGF B;  5KT3 A;  4C11 A;  5LMU J;  3IG1 B;  3TEH B;  2OAU A;  1RP5 A;  4FDF A;  1S1T B;  2K2P A;  4M5D A;  2RS2 A;  1HBM A;  2VG7 B;  2AX1 A;  1RLD A;  3ONQ A;  2VQF F;  5KFZ A;  2B51 A;  1ZM2 A;  3JAM U;  1LWE B;  3G8T A;  3EGV A;  4B17 A;  3DRS B;  2CPI A;  4NYO A;  1MMN A;  4P52 A;  3LUY A;  1C2P A;  1IJF B;  3R5J B;  4USJ C;  4ZJQ A;  2HMI B;  1FA0 A;  4I1T A;  1GEH A;  4IG3 B;  3HSJ A;  4OIX A;  3J80 U;  2QX0 A;  3TZY A;  2ZHB A;  3CME S;  4KGM A;  2WB4 A;  1RHQ B;  2JL9 A;  1GMV A;  1LWC B;  1HNV A;  2VIC A;  4DX8 H;  4RKU C;  3HJF A;  2V8G A;  4H4O A;  3IA0 A;  2FJD B;  2CZV C;  4UUX A;  1RTZ A;  1FJ7 A;  1U2R A;  2ZOF A;  5B09 A;  1NZA A;  3GMG A;  2ZBC A;  2E9R X;  1HHQ A;  3AOA A;  4UY8 5;  2K7J A;  2IPO B;  5LSR A;  1X4E A;  1OY9 A;  4DX5 A;  4ZVH A;  1AXQ A;  5CZV A;  4OI4 A;  5ETR A;  3IS9 A;  1K73 T;  4WPA A;  4NCG B;  1TK5 A;  1D9D A;  1BQX A;  1YTY A;  4LSN B;  2A2D A;  1BWE A;  1F5B A;  1S7H A;  3EVO A;  3I0S A;  3I82 A;  1N5Y B;  2WOM B;  4DX6 A;  1YRU A;  5J2Q A;  2M8D B;  1Y9O A;  2BAC A;  3K5N A;  3G6Y A;  1FXL A;  2GAH C;  3CC2 S;  4G3I A;  5ITH A;  3DYA A;  4ZPA A;  4BS2 A;  1RT6 B;  4ZOS A;  2NXU A;  2OP5 A;  5T41 A;  3KLG B;  3IRX A;  1FKO A;  1RWM B;  4K7Q A;  1S6P A;  1YHQ S;  2CIM A;  1YJT A;  4QCL A;  1CC7 A;  3NS6 A;  5AXM A;  1LEO A;  1WHX A;  2IDL A;  2RH3 A;  2FC9 A;  2LFV A;  5KFL A;  2QL9 B;  2XO6 A;  1JLE A;  2RUG A;  4ECX A;  1GMW D;  1T0T V;  1RB0 A;  1NZ8 A;  4KYZ A;  5IM0 B;  5BR8 F;  2P8I A;  2HHH J;  1S7I A;  1VQL S;  1RT1 A;  4Z7C A;  5DZ6 A;  3CD5 A;  4LUB A;  1FX4 A;  6FDR A;  1G2E A;  3M7V A;  3M8P B;  2HFV A;  3THT A;  4FYX B;  2A6O A;  3GYN A;  4O4R A;  1JKH A;  2E29 A;  3M2R B;  2HKE A;  3R7S B;  2L41 A;  4C3L A;  2H5I B;  2M3D A;  1VLO A;  5C42 A;  4DR3 F;  1QTN B;  4TN2 A;  2DNG A;  1XJW B;  3LP2 B;  5J1E B;  2UXD F;  2BYC A;  1Q1K A;  2V5H G;  2LKZ A;  3DU5 A;  1RA7 A;  3SIP B;  5LMN J;  2MQN A;  1T9Y A;  5KFF A;  1V6H A;  5I42 A;  3MED B;  2HNY B;  3ZZU A;  2HZA A;  1JLB A;  3G71 S;  4E98 A;  1RHU B;  4OJH A;  2CPF A;  2YNH B;  4RNO A;  3C14 A;  3DM2 B;  3ADA C;  1H72 C;  2BQR A;  3FGV A;  3DN9 A;  3A8I A;  1Q8K A;  4KAI A;  2ZHA A;  2XYG B;  2XSJ B;  1AUS L;  2YQ3 A;  1JJC B;  1B7Y B;  5DO2 A;  2FHJ D;  3IG1 A;  3PY8 A;  3OL8 A;  1X8D A;  2YNG B;  2WVF A;  1S1T A;  3NGD A;  3RR7 A; 
#chains in the Genus database with same CATH homology
 1WJ9 A;  4DZD A;  2Y8Y A;  5H9E K;  3QRQ A;  4QYZ K;  4U7U D;  5CD4 A;  5H9F K;  3QRP A;  2Y8W A;  3QRR A;  2Y9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...