2GHWA

Crystal structure of sars spike protein receptor binding domain in complex with a neutralizing antibody, 80r
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
191
structure length
191
Chain Sequence
ITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
publication title Structural basis of neutralization by a human anti-severe acute respiratory syndrome spike protein antibody, 80R.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Virus/viral protein/antibiotic
total genus 40
structure length 191
sequence length 191
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ghwA01
5DO2A 4L3NA 4ZS6A 4ZPWR 3SCKE 2DD8S 2GHVC 2AJFE 4ZPVR 4KR0B 2GHWA 4QZVB 3SCJE 4L72B 4KQZA 4XAKA 3SCIE 3SCLE 4ZPTR 3D0HE 3D0IE 3BGFA 3D0GE
chains in the Genus database with same CATH superfamily
4I69A 3IO1A 2FVPA 4ILLA 3SXLA 5DZ7A 5GAEU 1DY3A 2C2NA 2DO0A 3ZTRA 2UUBF 2NQPA 1IKVA 2B56A 2IRUA 2ZE2A 4UUWA 4DDFA 4PKDB 3H98A 4CYUA 1H73A 2QT7A 4IH7A 4ZVQB 2QMXA 1WOOA 2IA0A 2PEHA 3OL8A 2UV8A 4ED8A 3JQJA 2I8EA 4DLEA 1GXUA 1S9GB 1S1UA 3ILJA 1XMBA 1B0PA 2MHEA 3H42A 2FJDB 1U2CA 3GP9A 3JTOA 4OYXA 1UJ6A 3P8BB 2XS7A 5J1EA 2E44A 1CJKA 3W63A 2CQ3A 1I94F 2MJNA 5KFCA 3BPSP 2F65A 2Z30B 4MJKA 2FUG9 4IFVA 2HHUA 2MKSA 3RAXA 2R7RA 3D6MB 2AYBA 3LPEA 3K59A 5ETOA 2KN4A 1NSQA 2NYHA 2ROPA 4OX6A 3HVWA 1JQGA 5KOXA 2OP5A 1Q86T 1Y0HA 5CYMB 4KGVB 3K5NA 4URSA 5I3UA 3CVKA 4WKYA 3QGGA 1YQHA 3LUYA 4DL7A 4B3MJ 4F0HA 5CYJA 2YNGB 2Y8WA 2GQ2A 2DNPA 3PFOA 3W65A 4TKTA 2AGPA 4ANCA 4UW2A 5DG7A 1PSDA 5L8RC 2W24A 1UKUA 4U96A 3J7Z5 3BGFA 1JB0C 1EP4B 5IM0B 4FKXA 4DR7J 5HN0A 5E0OA 2BQRA 3B78A 1O5JA 1XIQA 1RTHB 2GAGC 5L1LA 3ILOA 1ZAXA 3CW2C 2V2KA 2MHNA 4BC9A 2NYIA 4ZLLA 4FZVA 1H3DA 3FEYB 2XS5A 2D7SA 2D9PA 4RWXA 2ZD1B 4J91A 1SIWB 4EK2A 2ZOGA 2KM8C 3CJRA 4V19J 3AOCA 3JQMA 3CNQP 3FVYA 4KH1B 4P10A 1NPKA 4DBQA 4HDGA 2QA2A 2DNNA 4KQZA 1T3NA 4JB8B 2XO7A 3QBCA 4OIXA 3S7RA 4JYAF 1FHTA 3W9IA 2IAJA 1DRZA 3KHGA 3UDLA 3VGUA 1U6FA 4CM2A 3L4BC 1HMVB 3P45B 4ECYA 4WBFA 3G8SA 4ZHRB 1RWWB 4UY8T 1PJ6A 3VAKA 3BYRA 2PC6A 3NWRA 4DU7A 3CIZA 4QPTA 2MGZA 3MTKA 2ALYB 2LA4A 4J9SA 4RU2A 2W2NP 3BEGB 5L9XA 3TQEA 5IC6B 2Q6CA 1RAEB 3ILIA 4XTTA 1ZBTA 1RDRA 3CO9A 2W4DA 2CPFA 4P2FA 1AZSA 3W8PA 3EZUA 3WQPA 2ZBIA 4J9OA 1Y5NB 3OQ2A 3TVYA 1RZMA 4DL3A 1Z1ZA 2QYGA 1R0CB 1NJXA 1VHIA 3MR2A 1JXLA 1DAXA 4RW8B 4YR0A 3P49B 1RT5B 2VKRA 1MWQA 2FYXA 1T9TA 2RD5C 3W1YC 1UFWA 4KB7A 4OZLA 4LF4F 3M8WA 1I3OB 1QDUB 1FA0A 2E9TA 2MKHA 2EFGA 4HHUA 3Q86A 4PAAA 2LXUA 2VFRA 1A6LA 2KYXA 3AA9A 4F4WA 3UW1A 2XLJA 4B08A 1A9NB 2QG9B 2V4QA 5LMNJ 1FD2A 2P8IA 4WXWA 4YFUA 2PMHA 2CWKA 7AT1B 3EICA 4CO0A 4P52A 2DTJA 5KT3A 2VOPA 2VJVA 1HBNB 5CYQB 1NU4A 2HVZA 4ATNA 1YRUA 4CM0A 2F3JA 2HNZA 4GVLA 1FX4A 2XZWA 3GYNA 4USIA 3BGRA 2DHXA 3KLGA 3QGPA 4RBUA 4QPXA 3UDVA 3T1HF 2QTWA 2HHWA 2GC8A 3R97A 5B0EA 3JTNA 1FRXA 4P7VA 4OI1A 2RSQA 3D2WA 1YITS 1X4DA 3UVJA 4DF4A 4OYIA 4R5PA 2ERRA 4D3GA 5KFXA 1Q0NA 3THVA 4IFYA 4ZPAA 1GNKA 1YJ9S 2AQ4A 1RWMB 3QT5A 1ICEB 2HQFA 2BVZA 1S4EA 1H38A 3E01A 2W2OP 1SBRA 4TU7A 3H59A 3GFYA 3SDEA 2XMMA 4CO4A 2V4JA 3GJQB 5I42A 2J8AA 2VA3A 1G2EA 1XTZA 4PABA 2HLUA 4M5DA 2R8JA 4OQJA 2HHSA 3UNGC 3T5HA 2H5IB 3ZC4A 3R2CJ 3SYZA 2ZC3A 4LF8J 1WHYA 3QAEA 2NZCA 4B17A 4ZN1A 2GV1A 4ED3A 4TYBA 4L72B 4KY3A 4EZ6A 3U27A 4Q8FA 3DU6A 2D74B 1HQEA 2HWHA 2VQFJ 1JKHA 3PO5A 3WZ0A 4F67A 4TY9A 2WONA 3BM7A 4L75A 3R8YA 3GJTB 3WX4A 4DPXA 4C2MA 2VQEF 4DL0C 1JNZB 2BKPA 2NXCA 2GFFA 2N82B 1QSSA 2YPYA 1K1QA 3KK1B 1RWXB 2RRAA 1S1WB 2YWKA 3CJSA 3MPUB 1XMQJ 3NGTA 4NE9C 3UWTA 4Z37A 2RDJA 3MAAA 1TKXA 4JI7F 2QLBB 3BGLA 2R8GA 2RHQB 5LSRA 4B9SA 3IWNC 3JYTA 3V4IB 1RADB 1TK8A 4GKJJ 4Y0FA 3CJKA 5ETMA 2DGQA 3SMZA 2XTJP 5CA5A 1NB7A 1UCNA 2W01A 3I87A 4XPCA 3I56S 3QPIA 4RZRA 1VK3A 3IRWP 5F8GA 3IAS9 3M2UA 1AW0A 2JSXA 2B6AB 4KGXB 3QAUA 4LF2A 3HK2A 3FKBA 1MROB 3Q23A 1T9UA 2B4PA 1CC7A 3IG1B 1VRTA 3MMBA 2ZDPA 1HBUA 1SKRA 5B0DA 4ECVA 3HHNB 1HNIB 2RAQA 1PBUA 3PRBA 2UV8G 3W60A 4X4UA 4WXOA 2CKWA 1VS3A 1B3TA 3Q2TC 2DNQA 4Y2CA 2ZZMA 3CJ4A 2OEMA 4OHZA 7FD1A 2NR0A 4FYXB 4R8UB 3AQOA 4NLSA 4JV5J 2OPSB 4RNNA 2IVFB 1Q8IA 2BJ7A 5DETA 3OV7A 2HBYB 4EGLA 2G0JA 3D9BA 4WFBQ 2C2KB 4OYPA 2OPQB 3POTB 4ERDA 4DUTA 1M90T 1NEEA 2JEIA 3ONQA 1RAGB 4YR3A 4QYZJ 2MXYA 4ZVHA 3CJTA 2ZHBA 1U1QA 3ENAA 5B7WA 5JUMA 1C0UA 5SZTA 2UUAJ 4K4WA 1URRA 1LEOA 2BR0A 1H7WA 5KFHA 1BQMB 3SBMA 2ZH3A 2BQUA 4F4KA 1N33J 4RW6B 4RW9B 3TYTA 2C2ZB 4DV7F 1RXOB 4HR2A 1MNEA 3ZZRA 3RB3A 3MTJA 4X65F 5ETTA 4L3NA 5D4OA 1HD1A 1KDNA 2GMHA 3NNCA 4IDKA 1GK8A 1IBLJ 2HZVA 4X4PA 3BN7A 2A6OA 5ADZA 1X4GA 5HAOA 2X1FA 1O51A 1MG7A 2CAJA 1T3OA 3OPKA 1FKOB 4U8YA 2R9LA 4J9MA 4JI0J 1SB6A 2GMJA 1KSPA 2GJ2A 1N6QB 2ACYA 4NLQA 3MXHP 2IBOA 3BO2A 5J1NA 1HWKA 2XM3A 1QE1A 2G0CA 4CIOA 1BGXT 3O1LA 2YNGA 2Y1JA 5FJ4A 3GU0A 4KAIA 3VZIA 1YLXA 1TELA 2XLIA 2A1BA 1EP4A 3FDSA 1FVSA 5HMWA 8AT1B 1FX2A 4A48A 1CVJA 3GSDA 4MTPA 4EEYA 1DTQB 5HI7A 4A8MP 3MZIA 1WG1A 3GILA 2BW2A 2D1CA 5GAGI 2HNDA 5KFOA 1T9XA 4M5JA 5A6WA 5L1JA 5B0AA 3G2XA 3GFXA 4CLYA 5IWAJ 1KFDA 1S7HA 1FDDA 1APSA 1R8CA 4G6VB 1NK6A 3C6UB 4UZBA 1TR0A 1UMJA 3DHXA 3BKFA 4F02A 1VYAA 3LH2S 3RRKA 1FRIA 2RQKA 2NSCA 1RACB 1CQNA 1WHWA 5IT9Y 5KFTA 1FEEA 1NSPA 5LOQA 4IRDA 3CCES 2A18A 2ROEA 5HMXA 4LSNA 3S01A 1DQ9A 3M9NB 3AFGA 4DUZJ 4WU2A 4PXDA 1FTRA 1KEKA 3M4XA 3UR3C 2QV6A 2QLXA 4USVA 3GG0A 1C4AA 4PZVA 2IA6A 4LMZA 4J9RA 2CYYA 2YKOA 2AT1B 3MM8A 5B0CA 2ADBA 5LXYA 2HBZB 2B7BB 1K8AT 2IJRA 1U6ZA 1W25A 2BQ3A 2DR8A 4O0IA 3PHEA 3BR9A 2E1PA 3VV2B 3GIMA 3R5AA 5FIIA 5IC4B 2CXEA 3BQ0A 5F8LA 2MQLA 4DPUA 1HL6A 4RW8A 1BHNA 2G2ZA 4NZ6A 4M5HA 4DFJA 2R7XA 1RT2B 1TFYA 3KK3A 4RPFA 2KXHA 5ETLA 4OI0A 3UQSA 1RB0A 4ZVFA 5T7LA 3T5JA 3I32A 2D3OR 2X3DA 5E2QA 1WEZA 3ZZ0A 2WTFA 4L73A 5RUBA 2EK1A 4K2JA 1FF2A 1FDAA 1IBCB 4KT0C 4B9UA 1Y10A 4LFAJ 1C0TA 3SCLE 2YNFA 4YB7A 3TJ9A 1HNXJ 3Q8QB 3EGNA 4ED1A 3Q8VA 1NJWA 1HBNA 2M9KA 5CYQA 3HDSA 4OZNA 3V6JA 3KLEB 3J7YI 3CJ8A 1WSRA 2K7JA 1B7YB 3OSNA 1KOHA 2Q3PA 3R27A 4HACB 2ATLA 5HQLA 5CHCB 3ZNUA 4B3SJ 4P74A 1IWGA 1NRKA 3IR7B 2AF6A 1NMEB 1QSYA 2K8GA 5C2GA 2H51B 2V34A 2OKQA 4ANEA 5CD4H 2V2ZA 3EWGA 4RKUC 1SQFA 5K14B 4USKA 3NLCA 2P9CA 2KRRA 1GH8A 3RRHA 2MSSA 3WDOA 5A8RB 4X84A 2ZVIA 2KFZA 3W9HA 4ES2A 1NAQA 3LP2B 4USMA 2FDNA 2AZ3A 4LFBJ 1JLQB 1IWAA 3GV8B 1YBTA 2YH1A 1WELA 4O4GB 3LA0A 2XSJB 1JLEA 3PYDA 1RABB 3IBFB 1K0VA 4FYDA 1IVZA 3TEGA 2BKNA 4YMEA 2CDRB 3EPGA 1N5YB 3GTYX 2GVZB 1CJTB 3M30A 2J9DA 1PCAA 1A0OB 1RE1B 3ISNC 1VIXA 3V81B 4ZJQA 4K4UA 2BE2B 4M63A 3KK1A 2N7CA 1S1WA 2F63A 3IGVA 1XWLA 2J9EA 5B08A 3BKTA 1R31A 1S1XB 2BJ9A 3BS9A 2JWNA 2JHEA 1OYDA 2DPIA 4E8UA 3UI3A 2UXBJ 2Z57B 5DDPC 1SJ1A 1RT6A 3BSOA 3V4IA 4G1QB 2B51A 4TQSA 1M5OC 3BH7B 2JEJA 1U0HB 1LW2A 5KG0A 2NS1B 2EC0A 3O44A 3SQGB 4C9DA 1Y3JA 2HGMA 5AT1B 2VDIA 4MKYA 1HPZA 1X8DA 4YP3A 4CH1A 4J7CA 2VICA 1D3WA 1UPMB 1UVLA 1HLWA 1S1TB 1S6PB 4O23A 4X4SA 2P6TA 4LRFA 4IRCA 5BR8J 3KLHB 5KFGA 4KHRA 4KFBA 1HYSA 4NI2B 1S6QB 2DNOA 2AW0A 2MKIA 4ALZA 2SXLA 3Q8UA 4N76A 1L3KA 4YY3J 3DRYA 3AJ1A 3T5KA 1WC5A 3K17A 3PKMA 4ZN3A 3PXGa 2R2RA 4F04B 3HZGA 2HFUA 2UU9J 4AXJA 4LBIA 4DOZA 1AUDA 3GYGA 3CD6S 3K89A 3POTA 4MAKA 1SC4B 4PXBA 2M8DB 1DQAA 1IBMJ 3GIJA 3CMAS 2HWIA 3M2RA 2PN6A 2DR7A 1LWFB 2MZSA 3D68A 3IGNA 3IFEA 3THTA 2XMAA 2QFIA 1BQMA 1UA1A 4W90B 4LIRA 2DNMA 1RT4A 1VBKA 2O67A 3H2VE 1E6YA 5GAHI 4ZVSB 4K4ZA 2H48B 2H4WB 5THWA 1XR5A 3HKZD 2VL1A 2ZH2A 4LFCJ 3AQPA 4OX7A 2F9JA 2BM1A 1RHKB 4ECSA 4Q45A 3I0RB 2ZITA 3CCQS 2HURA 2RH3A 3LGHA 1GMUA 3JAMU 2H5EA 1YJRA 4ECZA 2W4PA 1C1BA 1JLBB 1QJHA 4CLFA 3HVTB 1N52B 4EZ9A 5DQIA 2QA1A 4ELUA 1D0EA 1RT1B 2YTCA 5LSOA 1RU2A 3V5RA 2CQBA 4DL5A 4DI6A 2X51A 2V6AA 1J27A 1N6QA 1MMNA 4JP8A 1Q8LA 2CPDA 1Y9OA 4NLVA 2OEJA 1EHWA 4DN9A 5HLFB 3TX0A 4DR6J 3TAMB 4ZJOA 1MLAA 2HIQA 4QJVA 1WF1A 1C1CB 1TZ0A 2ZH5A 3THPA 3PNIA 2U2FA 2VONA 2AJ1A 1IM6A 2JDJA 2E5JA 1ZOTA 5DO2A 1S97A 1NKCA 5K8MA 2J0SD 1SL1A 4ZP8A 2L9DA 3A8IA 1RWOB 3IXQA 4ZK7M 4I2QB 4C0OC 2LEBA 4DCJB 4OJ3A 1N8RT 2VG6A 1PBAA 1P6TA 1JIHA 4LQ9A 4ZIVA 3ZO7A 2JOQA 4AXIA 4CZCA 1X31C 3CCWA 4E0DA 2YX4A 3NS6A 2YWEA 2PFDA 5HL7Q 3ELHA 5IS2A 4FS2A 3I5BA 1GTHA 1LXJA 3PJ9A 4A46A 4JI3F 1SKSA 4TVAB 1Q7YT 4FF1A 2LQJA 1VRUB 1HBOA 2DBBA 4I2PB 1HNVA 4MT1A 2KG0A 2DCUB 2FZGB 1H2VZ 7FDRA 5HMZA 2OLWA 3KTQA 2HHHF 4JOUA 1VRQC 2FHOB 5D0HA 2DRDA 4F4AA 1RHMB 1FJGJ 1UJ4A 2AHOB 4OJ1A 2L3MA 4C8OA 1HQUB 2ZKUA 3D67A 4ZP7A 4ID5B 1VQ4S 3NOCA 1KP6A 4CLPA 4OI2A 4NMXA 1DTTB 4MMOA 4F4ZA 1S4FA 3MEEA 3TQ1A 2UXCJ 4RO0A 2YKMB 2B9WA 1RISA 1YKWA 2BE9B 2FGCA 5ITHA 1IR0A 5A8KB 1UW9A 2PA8D 4KJIA 2WRMA 1Q7LB 4EO8A 4P7TA 1UVJA 4CP5A 5LMNF 1Y3KA 3NNAA 1RT2A 1AYEA 5HVGA 2ZM6F 2RQ4A 2CJXB 4ETZA 4U7UK 3LO3A 4PRFA 4DCOB 5G0RB 1TL1B 3DLHA 2C1EB 4DV6J 4F25A 4O3QA 2JX2A 2ZBCA 2XI3A 2OTJS 3FQKA 3I5AA 3G8QA 2AP6A 2CZ4A 3LW5C 5A0YB 3HCXA 4WZQA 2Y1IA 2YH0A 1VBYA 1PO6A 2WVDA 4NCGB 4WFYA 4ID8A 4NCAA 4OYOA 2VASA 4DQIA 4PQUB 3HT3A 5AXKA 4NYOA 4WFXA 1NZ8A 3PRDA 4PWWA 4HACA 4NPOA 4ZVTB 3IAM9 3UPFA 3Q8SB 5GAGU 3DOLA 3AD9C 3BSNA 3C16B 4QWAA 2C2RA 5BYQA 2RUGA 4ZOSA 4C11A 2AJQA 4KHPJ 1N5TA 3CCRS 2ASDA 5K9FA 1CJUA 3MF5A 1HA1A 4QYZK 3VWSA 1GX5A 4ZCIA 1RTJB 5K14A 4LF8F 4NLYA 3IM8A 2GX8A 2K3KA 2ZJRQ 4HH1A 5KOWA 3J81j 3DI6A 1ROFA 1XMOJ 2HK3A 4ICLB 5LSLA 3S6EA 4QR0A 1ZAVA 2I5JB 2V9KA 2WB4A 1FE4A 3HJFA 1VBZA 1FWKA 4OYZA 1JLQA 4A8OA 4KC5A 4Z7CA 3NBPB 2R2SA 1N32J 4CI0B 3QIDA 4AL5A 4QWCA 2EVZA 4ANDA 4LR9A 1XMQF 2VF3A 1KONA 2Z0GA 2YWHA 2DT9A 3DRRB 2C28A 1P9YA 3ENWA 1CJTA 2UUCF 2WVEA 2R7QA 1O8BA 4DV0J 4J9QA 3NGKA 2V2VA 1SJ4P 3V81A 2J5AA 3RTVA 4RNFA 1QAIA 2F8EX 1CJVA 3CC4S 1JJ2R 2KH9A 4TLRA 2H54B 4HTIA 2EEYA 3QRPA 1S0OA 1JWWA 3QGIA 1RHQB 4QIWD 3K7RA 5DG8A 4G1QA 5LM7E 2UVRA 1Y5LB 1U4BA 5A2QU 2MZJA 3QIPB 3RB0A 1TL7B 4FKYA 2YNHB 5ETSA 1U1LA 2EBEA 3UDEA 4IR1A 2Z2ZA 1GAOA 1RT3B 2K1RA 1D09B 1R6YA 2BMBA 1X4HA 4OI6A 3G8TA 2CNOB 3KHLA 1S1TA 2R7SA 4ZJLA 2ZC4A 2C22A 3J7YU 2B8PA 1FFWB 4GKKJ 1SH3A 3LWLA 3FFIA 1J5OB 4I6YA 2COLA 3QRQA 3RYLA 4WTOB 1NB2A 1NK7A 4J9PA 4CNYA 4NI2A 1JXVA 1UZHA 4LR7A 3PTWA 2DHHA 4PUOB 2VU5A 1NK5A 3PEJA 2IM3A 2XCAA 1NPPA 3DC2A 1VHFA 4NMLA 1WTBA 3MUMP 5KTQA 3QWUA 4PG8A 3Q83A 4RNHA 1EETB 3D6FB 2GS8A 1FNMA 1FRMA 4CQ1A 3MR7A 2J0XA 3OTEA 1YJTA 1XNQJ 1QUVA 2QIFA 2IDEA 2J8SA 2UUAF 3CMQA 1SXLA 2XULA 3CCVS 4I56A 3TZXA 1N33F 1FXDA 4AUKA 3PO4A 5FDLA 1EQ0A 3TJAA 5E41A 2VV5A 3KLFA 3MURP 1N88A 1NJIT 4IKAA 2DCLA 5F3TA 3BBCA 2FC8A 3OR2A 1TMJA 5L1IA 1U1MA 2P2CB 3RBZA 3ENQA 2HAFA 2WAQD 2VBZA 1YWXA 2APOA 5ETPA 2ZH1A 2KT2A 2YWWA 4JI0F 1ZM2A 1M1HA 4ZMMA 1PGZA 5EUHA 1LQ9A 2CJAA 1JLFA 3KG4A 1FRLA 3I0RA 1U7LA 2DB1A 2AJFE 1BLUA 3CJQA 4KBIA 5AJ3F 1JLBA 1UTAA 1ELOA 3BB5A 4NYPA 2OMOA 2B0GA 2QLJB 2BJ1A 3O6QA 1EIYB 1RT1A 2ZOMA 3EJMA 1KN6A 1G6BA 2MQQA 1YVFA 1VFJA 4I68A 1R27B 4CO5A 5L1KA 1HR0J 2HHVA 9ATCB 1VISA 3AAWB 2J0QD 4IYQA 2IYGA 1VGYA 3FEXB 2DH7A 2OGUA 2UXDJ 1LWEA 1Q8BA 3KMSA 5HBMB 2QA4S 4USHA 2F4VJ 1N36J 2XHCA 2DXFA 4ECRA 4F2SA 1UW4A 1GQEA 5KG1A 2F40A 1BQNA 2HK2A 2JEGA 1FJCA 2H1YA 4QU6A 1IKVB 1FESA 5IWAF 2R7OA 3A3NB 3KMQA 2MY7A 2ZE2B 3JSMA 2PT0A 4K4SA 3W66A 4CYUB 3IP0A 3G86A 4JBCA 4BWJA 3CDBA 2VG5A 1U6BA 5F0UA 2QC3A 4LVNP 3UE2A 4CNZA 1S1UB 2DXEA 4P2SA 2X3GA 1TVRA 1GFWB 2HS3A 4UTGA 3CXCR 3TUZC 3OTOJ 4IQMA 3LP1B 1CJKB 1RTDA 4DUZF 4I2PA 3AB4B 1KTQA 3MEDA 3PIOQ 3BQ1A 1NSAA 3TWZA 3PX0A 4IFVB 1H98A 4DUYJ 3W9JA 1TK0A 4OZJA 2E5GA 2HS0A 4M8LA 1R43A 2RKIA 4UOGA 2HEKA 4QIEA 5KFVA 3OXGA 2M8HA 3IBWA 4H54A 5K8OA 2FD2A 1AXQA 2F5GA 2R7TA 2ZH8A 5IQQA 2K7KA 2YQ0A 1SKUB 1U09A 1IKWA 1DTTA 2HQDA 2IVMA 3TEHB 4C8KA 2AX1A 3CSKA 1PYOB 3ITHA 2YKMA 4GO7X 5D8HB 3CIMA 3QFWA 3CDAA 1HHTP 2WVCA 5LMUJ 1EQMA 1CEZA 4Q0BB 2V4RA 2QLFB 5HSPA 2CA9A 4LRDA 1T02A 4F26A 4DSFA 1S99A 3RAMA 3Q89A 1X4AA 1KNZA 2QL5B 1RGVA 1KHVA 5KFEA 2CJBA 2XB2D 3OHBA 3CDWA 1TUGB 2V8GA 1HNXF 4PWUA 5IXUA 3SI8A 5D4NA 2CPYA 4FPRA 2IMWP 5G0RA 3PW4A 5ETVA 3G6VA 2U1AA 2XMKA 2L9NA 1QY7A 3EVMA 4DV2F 4OYAA 1N5SA 4C8NA 2J9DE 4LBHA 5ETKA 3M8QA 4NRUA 1PKUA 2L48A 1VQLS 2ILZA 4AFFA 4OJHA 2UVUA 2YX7A 3PEHA 5KG4A 3G9CA 4QCLA 1VC0A 2LQ5A 3PACA 4TYAA 2I2YA 3ZXWA 4B3SF 1RUSA 2PA3A 1JXEA 1U1RA 4F0MA 5CCLA 1LOUA 4PPZA 2IAJB 4ZPTR 4WYLA 2ZKTA 2RU3A 2FGOA 1TV6B 2YWFA 1EAYC 1JJCB 3DRSB 3FK4A 5KFJA 4HKQA 1VK8A 1ZM3A 3A1YG 2MGZB 3NOGA 2V0NA 3T19A 2OAUA 3OUYB 4UOHA 4WP9A 5LL6d 1RTJA 2EW9A 3OL7A 1U1PA 4DSIA 2UP1A 4B9VA 1VQPS 4FF2A 1Y5IB 3VVTA 2GHVC 1HI0P 5FD1A 3H5SA 1S76D 4QZVB 5K8NA 5MAOA 2IM1A 2KHCA 4WFNQ 5KG2A 1QTNB 2J7KA 4Y00A 3RB6A 4FF3A 5CCMA 1WG4A 4DQPA 5A6PA 3DXBA 4HI1A 4A8WA 1ITPA 3T1AA 8RUCA 4JV1A 2E9ZA 4MIAA 3NBPA 5KFMA 3NWGA 1V9OA 2E29A 1S12A 4LREA 3I4PA 5CD4A 1HNWJ 3CCJS 1WUUA 3OVAA 2PI5A 3UNYA 1Y11A 4C0BA 4DR5J 4KE5A 2E5HA 1TL5A 5EWFA 4LUBA 3DRRA 5JJBA 4U8VA 1VLYA 2PIIA 1ZM4A 3KNGA 1RCXB 2ZZTA 1PAEX 1X9SA 4DSLA 1NKBA 3M1VB 2QEXS 2CPZA 2AGQA 2HNZB 3P5BP 2VOOA 4H4KC 1FVQA 3MM6A 3H7HB 4I0WA 4JI4J 3TZYA 3BGRB 3KLGB 3J7A1 3JQKA 2MKCA 3F0NA 3PG9A 2AJ2A 3QJJA 3HMJG 1KVJA 2R8HA 4IH5A 1R7IA 3UVJB 4LJMA 2CIMA 1FD8A 5KFQA 1VC6A 4BWMA 2RDDA 3DLEA 4IFYB 2NXJA 5KG6A 1RT3A 5GADU 4Y28C 4QBUA 3FJ2A 1YX2A 2HW3A 2HRYA 4V1Ak 4PQAA 4X62J 4B3TJ 4HYKA 2I1RA 3E01B 5E3QA 2HYIB 3SDEB 2XQCA 1ZYQA 4LF6J 4LF7J 2BYCA 3HJVA 2V4JB 3A8KA 3TR5A 2VC0A 3ENVA 5IT9U 4ECTA 3NXZA 2FZCB 4M5DB 4QU7A 2XYHB 2GHWA 1EKSA 4B3RF 1IUJA 2CQ2A 2UU9F 1GXTA 3VQSA 3C3LA 4Q2MA 4RR5A 3NRBA 4LF9J 3MPYA 1N56A 1UZDA 3GR0A 4J9UE 4J37A 2VBYA 3GFHA 2QL9B 2H65B 1F2GA 4BBYA 1P27B 1HQEB 2YQ3A 5KG3A 1JKHB 2IM0A 4KHMA 5J1PA 2WONB 3BZQA 2W7OA 4X4TA 2CJKA 1NBEB 1LNQA 3VZHA 1SUQA 1UEUA 4N56A 1WTFA 1G1XA 1Q4RA 3I82A 4MYTA 1Q8KA 3U1NA 1FXLA 3DOKB 2X1BA 1Q5VA 1V5IB 1HI8A 3QLHB 1MSWD 3UR0A 2WOMB 3AOBA 2FQQB 2YNIA 1SQGA 4X66J 4TXSA 3C2PA 4KKOA 2XY5A 3TUJC 3DM2A 3BGUA 3MAAB 2N3OA 2JRSA 4KH0B 1FDNA 4YN3B 2PMWA 3DXSX 4YQWA 4LFCF 3SEOA 4I6AA 3JYTB 1UWBB 3OBIA 1UVIA 3CJKB 3QZ7A 5DM7Q 4ELTA 4ZPDA 1GTEA 2EKNA 1D8ZA 2HNYA 4H4MA 1UJ5A 3M2UB 3N01A 3BQ2A 4P9SA 5F8JA 4MH8A 2MTLA 2Y0BB 1M0SA 2OSQA 5K5MA 2VA2A 1HBUB 1KVKA 4DR6F 3AHPA 1F9FA 2M52A 2R7VA 4OLPA 1PYSB 4P2XA 5DQHA 1N34F 3F44A 4DL6A 3N6MA 4C4WA 4DFPA 4AQYJ 2XMWA 1T05A 1R0AA 2ASJA 4N41A 5F0WA 1Y00A 2Z58B 3G6YA 4A4JA 2VC1A 2XZTB 2YVSA 2JFDA 2QN6B 2MLZA 3IWXA 3HHDA 3VAGA 3LQVA 3GV7B 3Q8YA 2BX6A 3EVOA 1EKRA 2RT3A 2NZ4A 4S0MA 2V68A 4YHHF 5C25B 3AY0A 4WCEQ 2XWYA 3F56A 3GFZA 3GONA 2BUNA 3UD5A 2PO4A 3A8EA 2EPIA 3SSQA 1IR1A 3I9V9 4OJGA 3ILLA 2PI4A 2V5HG 4RU9A 2CPEA 1WG5A 3R3TA 5JVHQ 1OMSA 3VTIA 3SV3A 2JLFA 3MPWA 4I4BA 1C0UB 3GQCA 5EWEA 4IG0A 2F8HA 3Q22A 3KJVA 4JYAJ 3QT8A 1EJ7L 2BA9A 4F0KA 2GJIA 1FJGF 1LFWA 2O66A 4DX7A 2IJFA 3LP1A 2A2DA 4QIGA 3HSGA 2LEAA 4C98A 3I5CA 3DRPA 1T03A 2OPPB 3EVWA 2QX0A 2HZAA 2AEFA 1LW0A 5LT5A 5E5NA 1OPIA 3L7PA 5KFDA 4IDKB 3OXLA 2UUWA 1VCTA 2YKPA 2UXCF 2DGWA 3R5GA 2AU0A 2ZNYA 2VUGA 3D4JA 2KFYA 2XY7A 3RUBL 4ED6A 1S0VA 1T94A 2CUYA 3CMES 1TTHB 2EFOA 1YGYA 2Y3YA 2XMTA 3SSSA 4A8XA 4CH7A 2WW8A 5DDRC 1QE1B 5LXRA 4JI2J 3FBFA 2XCPA 5HQ8A 5HVHA 1VQOS 2YKAA 4Q2LA 4RL1A 3GYXB 2W7PA 2H5JB 4PG6A 4GC7A 2HHQA 4Q0BA 4WFZA 3AXKA 1T0TV 1D1UA 4HT5A 3MEGA 4DV6F 1R8BA 4OZ2A 1ZM9A 2KKHA 1ZZFA 2Q6BA 2AGOA 2HRUA 5D0RA 2DRBA 1T11A 5EN1A 1REVB 3T1YJ 4PG7A 3I9ZA 2J6TA 3TW0A 5F8MA 2MLYA 4U6PA 3K8VA 3HP6A 3NGRA 2DHAA 2WCXA 2HNDB 1D9AA 5KT7A 2R42A 3FSIA 3R2DJ 1IBKF 1VQ8S 4F8RA 3V6KA 1X4FA 2FPHX 1KR4A 5KFUA 2RB7A 2BJ8A 2POKA 3PJXA 2OH2A 1IN0A 4MYUA 2M5YA 1E6VB 2AJ4A 2HWTA 4RBTA 4LSNB 4O3OA 1FDBA 4KHPF 3G96A 1JLGA 3FBBA 2RILA 1X7VA 2ZBQA 2IRXA 5H1SV 2J6UA 3KWMA 2Q79A 1TV6A 2AYGA 2KI2A 1WC0A 3DRSA 3HSDA 2ZEJA 3QO9A 3ZFVA 3NNHA 3EMTA 2LXIA 4ZCKA 1XMOF 4ZP6A 4OMFG 2KB2A 1PYTA 2A6MA 3SV4A 3MM8B 2DGVA 2Z2LA 3C6TB 3OUYA 1S72S 4FVCA 4IG3A 3T6JA 1PC4A 3UFCX 3MUVP 2LYVA 4LSLA 2AX0A 1EB0A 2C3UA 2DITA 1N32F 1T9VA 5F8NA 2Y0SD 3I0SA 2XGQA 2X1GA 4DV3F 1RAAB 3EXCX 3MM9A 4Q43A 5CZXA 3KNAA 3KK3B 2WB1D 2VQEJ 1M5SA 5CXTA 5F41A 4OX9F 2G2OA 4DV0F 2HBRB 5KFNA 3HSZA 5T7LB 3MUTP 3G71S 1Q81T 3MAHA 3KFWX 3J80U 4NLGA 2DVIA 1J5EF 3HO1A 3VAHA 2QL7B 3UD3P 1C0TB 2YNFB 3FUYA 2AYEA 1HQ2A 3GIRA 3RAQA 3C15A 1SVDA 4Y3CA 4JI6J 1SCJB 5ETQA 2KZMA 5BJRA 4FS1A 2MQ8A 3DMJA 4DX6A 3O8WA 3M1VA 2F9DA 1TMMA 1TKTA 2W2MP 3BSAA 1OPZA 3SCIE 2EK6A 3M32B 1KKHA 1Q16B 1FFSB 1WEXA 1H0HB 2EFPA 4JV2A 1TP7A 3A13A 1REGX 2IVYA 3WHIA 4U7CA 2F1FA 3H5XA 2VKZG 4GKKF 3PW0A 2HVHA 3E51A 1FNOA 5IV3A 4USUA 2I9SA 4QW9A 3V6HA 2MQMA 1K44A 4C6AA 1RLCL 3GR1A 1NHVA 1ZA2B 1RYRA 4IUFA 4ZITA 1SC3B 3R1LA 1K47A 3CCTA 3R7BB 3PM9A 4LBPA 3X1LB 1J2VA 2HQ3A 1FXRA 2RHSB 1BE4A 4RW4A 2XSFA 5HJXA 4DV1J 3N5FA 3OT9A 4UQTA 4UOFA 1MMLA 2KT5A 2EFQA 2OFGX 5EX0A 1DLOB 1S9EB 5J2MB 2HFZA 1JLEB 4DR2F 3HHKA 2BJDA 3NAIA 2MPUA 1WC1A 2X1AA 2DNLA 2CQGA 2DNYA 4QWDA 3J81Y 1TAQA 3M30B 4LF5F 2XYPB 1VDHA 3G6ES 2B8QA 1T9YA 5KFZA 4DV5F 5DS7A 3DOKA 2XMVA 3NMAA 4NL5A 2GIRA 3QLHA 4DL4A 1IR2A 4CT9A 2B4VA 2WOMA 2A3JA 4DV7J 3LTOA 5KFYA 3KUGA 3HX9A 4FYYB 1MWZA 4X65J 2J0WA 4NEYA 4PEOA 4XK8C 1RT6B 1X0PA 2RF2B 4F7VA 1UWBA 1YJNS 4WP8A 3VGVA 3NS5A 2VZ9A 1ZAWA 4NASA 1LW2B 3IRXA 4WYWA 2OI2A 3OJUA 3LP0A 1HWLA 3R7NB 3OVBA 1SC1B 1R3NA 5CH7B 4NXMF 5B0BA 3R6LB 3IN5A 1RT7B 1HPZB 4R25A 5IFMA 3HHLB 2JL9A 2BW7A 3PX6A 4K5RA 4Q5VA 1NKEA 3UCUP 3R5BA 4DZDA 1HR0F 2FJVA 3P3DA 1KQSR 3JS9A 4EBEA 3BO4A 4KFBB 5DZ6A 1HYSB 5C42A 2UXDF 1FWLA 1BWEA 2MEWA 3RBEA 3NAHA 2F4VF 2XHWA 4A8QA 1KWMA 4NOHA 3A3PB 3CEDA 2BJ3A 1RA6A 3HFVA 3RZAA 4CTAA 4OHWA 3PV8A 3MI7X 4U9RA 4MK8A 4EBCA 1H2UX 3V6DB 2ZDOA 1QAYA 2OD6A 3QYYA 4LVOP 2B9YA 1FFGB 1VJQA 5C25A 2PDAA 4I7FB 5ETNA 2HMIA 2M2BA 3OFGA 4EUVA 3K57A 4ITSA 3GE9A 4OHXA 2CQ4A 3M2RB 3OTOF 3TJ8A 4FYWB 4KGZB 4O4RA 1UFKA 1F0XA 3MCSA 4USTA 3MM5A 3LAMA 5E33A 1Z2LA 4MK7A 3FCHA 2K3IA 4C0HA 2CNKB 3PIPQ 2WVFA 3PKYA 1HHSA 1RT4B 1AB8A 4X4RA 2H3EB 1E6YB 4M5MA 2GGPA 3ZZPA 1ZH5A 4DG1B 2ZBPA 3C14A 1OO0B 1WHXA 2LEPA 3MMCA 2XG8A 3LPYA 4A8FA 2BRLA 4ER8A 3ICLA 1VC5A 3DLGA 5IT0A 2QZ8A 2X7IA 5KFBA 3E2EA 2LQ9A 3O5TB 2OPPA 2V8PA 2FJWA 4KIAA 1XR6A 5F9NA 3WC2A 1C1BB 1H7XA 1HW8A 3J7ZT 1U02A 1NK4A 2FHKA 3BSCA 2B7CB 3DKDA 5AE2A 2QO3A 3NGSA 5LMUF 2AEJA 2FIUA 1I1GA 4M5LA 4ZVOB 3GCWP 2GMLA 2GO8A 2R7UA 3T5LA 4TY8B 1RYSA 2VPXB 4Y34A 1XJWB 2N3LA 2XMUA 1TL3A 5HK4A 4JUZA 1F60B 4CRJA 4L74A 2BABA 2ACMA 2RVJA 4DWIA 2LFVA 4DFKA 1XR7A 1JJ4A 1BUXA 1FRHA 4GO5X 3MECA 3OL9A 2W2PP 4EMDA 1FKAF 4ZPVR 4C8ZA 2CPXA 1Y7PA 4YDDB 4EFAC 4F50A 4Q8EA 1REVA 2WHOA 1UA0A 2VG6B 1U25A 4RUHA 3EGWB 4KYZA 4ILRA 1WNEA 3CO0P 3CF5Q 2KU7A 3E8OA 1KLMA 3ZTQA 1UETA 1VQYA 1CLFA 1SJ3P 2M70A 3MGJA 1HBOB 4DFMA 1HNVB 3IS9A 5JVGQ 2HG4A 2V50A 4RLEA 4K2XA 2OHDA 1E6VA 5DGAA 3BREA 3D1QA 3WBZA 2JVRA 3P5TL 2V8VA 2GO9A 2DGXA 4P2MA 1NCLA 2GJFA 1EX8A 3D3CJ 2MB0B 1FJ7A 4QOTA 1S57A 1RSCA 1KBRA 5DJBA 4ECWA 4IOBA 3L09A 1ZETA 1U1KA 1X4EA 3MEEB 1SKWA 2RU9A 3CULA 3LF0A 3C6TA 5F8IA 3JTPA 4URQU 4K0KF 2J76E 1SH0A 5C24A 1IXKA 5K20B 1RBOB 4KPYA 5KFFA 3FSXA 4LIWA 1U47A 2LA6A 2M0GB 5A8WA 2G9OA 4E98A 3ZTSA 5DDOC 3W5ZA 3EGZA 3TP2A 3TVZA 1HKAA 3EUNA 1HNZF 2AIRB 2AD9A 4IRKA 2DXDA 4DR5F 4WFAQ 2E1CA 3TANA 2QLWA 4CLUA 3UN3A 1SV5A 2GVDB 1L3TA 5AXLA 3DLBA 4URGA 1Q1KA 5F3ZA 2VBWA 1YRXA 3QNWB 4DSEA 4WF9Q 1LWXA 1KQKA 1WHVA 4N7TA 4DPTA 1W2IA 1FKPB 1FJEB 3MOZA 3HPOA 3EZ5A 3T9ZA 3U7JA 2JEFA 1RJJA 4OHVA 5KFSA 5DLFA 3DRXA 4N8OA 1KC8T 5BXIA 5D77A 5I4MA 4RW7B 3K58A 4C97A 2CWXA 3M32A 4C3KA 2RS2A 4JV0A 3OXFA 3UN5A 3T3FA 2WSEC 4KO0B 3G6XA 4X62F 3TA1A 3DOLB 2HRTA 4DR4F 2FJXA 3ET6B 4NLRA 3CT9A 2V63A 4PXEA 4LF7F 1WD6A 2NXUA 5J2QA 2G0IA 4DV4J 3PW5A 4C11B 2OJ3A 2PGCA 2CPIA 3BJYA 4HLBA 1UVNA 2ASYA 1CJUB 2CJ9A 2C2MB 1P8GA 1NM2A 2OPRB 2E66A 1I51B 1NXIA 3FRYA 4K59A 1L3UA 1S48A 3JXOA 4PYAA 3SCKE 4LF9F 1LXNA 3DI6B 4NCBA 3KK2A 4DX5A 3E3XA 2V67A 1IM4A 1NPRA 3I4HX 3BKUA 1P1LA 1S79A 4J9KA 3B54A 4Y2MA 1WEYA 2FJBB 1VBXA 3L7UA 2XS2A 3R1HA 4N5SA 3DCAA 3SZ2A 3J7AN 3IMQJ 2MSTA 4B3OA 4EYHB 1DLOA 1X9WA 1S9EA 3A8JA 5J2MA 4NXNF 1RK8A 3PW2A 1RTIA 2HFOA 4ZPWR 2FJAB 3M2VB 4X2BA 2RRBA 4FP9A 4X66F 2HVDA 2KDOA 3CUNA 2EWHA 2JC0A 4KRWA 2FZKB 2VH7A 2MZTA 2KXFA 2WSFC 1S0NA 1VIOA 2OTLS 1RAFB 2XC9A 1CJVB 2AJ0A 4EI2A 4FXDA 3NMRA 2D69A 3RU0A 3MWBA 4BLGA 1S6UA 4DQSA 3H5YA 1URNA 3T41A 1XERA 3TARA 2RF2A 5HQMA 3T6BA 3QSIA 4MK9A 4ZLPA 3D0IE 1WI8A 1VQNS 2FB0A 3D6HB 1VJWA 2HLTA 2K1RB 1RT7A 4NLPA 3HHLA 2IFXA 1NK0A 1N48A 3RB4A 1IKYB 4AQYF 4K8RA 4NZ0A 2YXLA 3FFIB 5KFLA 2BM0A 4QWBA 1EZZB 3TAQA 4UOCA 2ASLA 1YBUA 1X5SA 5A2QY 5JMNA 2W4CA 1DFDA 1WDTA 2HGNA 2R8KA 1S6OA 1AROP 4CLLA 1U26A 2R8IA 1NZAA 1RTZA 3K8WA 1VQKS 3V6DA 3VAIA 3GJRB 2VDHA 2BOPA 1TUWA 3M8PB 4ED4A 4LR8A 3W2WA 2GQQA 3MD3A 2V8DA 4I7FA 3MHYA 2EG1A 3CC2S 3H0PA 1YRTA 3CB4A 3O2IA 4JI3J 2C42A 1YK9A 2Z56B 1L5UA 4ZVEA 3SCJE 1Z2ZA 5FDLB 3PFEA 3ZZYA 2IPOB 1G4CA 3KLFB 4DSKA 3VGSA 3DU5A 1AA1B 3WC0A 3AJ2A 2RJZA 2HHHJ 2Q66A 3FQLA 3S8SA 3OTDA 3OR2B 3TA2A 4UZCA 2XGPA 1HBMB 4XAKA 1OY9A 4QQBA 3TUIC 3PZPA 1BY9A 1JJHA 4DG1A 3CE8A 2IIHA 3S1TA 4WZMA 4LQ3A 1H74A 1LKZA 3HD2A 1G7CB 5D4PA 4XO0A 3TA0A 2LP4A 1N4LA 4C7QA 2E5LJ 4CLKA 3ZTOA 1GX6A 4CO3A 1K9MT 1JLFB 4KV8B 1H72C 1NDKA 3M8SA 1KTVA 3ULHA 3KLIA 4JI2F 4B3MF 1LK5A 4XPEA 2IJNA 5K8PA 4GVBA 3MR3A 1FRJA 4A47A 3W61A 2KJWA 3U1LA 1VI7A 4B9NA 3EGVA 4WE1A 4TY8A 1WWHA 2LQ8A 3MDFA 2R4FA 5C7PA 2DH8A 1FK9B 4DR7F 4F36A 3NG8A 3HHLD 2ZM6J 2HZCA 3R5DA 1LWEB 2ZVSA 3FMBA 3T1YF 1BMQB 2PE8A 4DPOA 5DGBA 2IDLA 2PD1A 3W2VA 4X64J 4TN2A 2BBEA 2ADCA 3SIPB 4OZ1A 4G3IA 3GMGA 1BQNB 5D3GA 3ZZOA 1S1VA 4OYWA 4DXLA 3DYAB 3AXMA 1OIAA 3JSMB 2YKNB 1X5OA 4CLTA 2DYAA 4TNOA 3TUPA 2VG5B 4IOCQ 3AB2B 4LRBA 1TFWA 3D0GE 2W9CA 1TVRB 2HIYA 3M05A 3C66A 2ROGA 3QATA 1D8YA 5SUHA 1RTDB 3MEDB 3NCPA 4OYBA 3WX8A 3HM9A 2C3PA 4PCQA 2JNJA 2GW8A 2RKIB 5EHHA 1UPPA 4L3KA 2EXUA 1R0BG 3CCZA 1NLKL 3KDOA 4GRSA 3M6XA 2DR6A 1I5OB 2MKYA 1IKWB 4DSJA 3RG6A 3DLKA 2NCKL 2JH3A 3PYGA 4JI1J 5J2PB 1D9DA 2HSEB 4F2RA 2VPYB 1RWNB 3ITHB 1U1OA 4M95A 2O3DA 3OFFA 2MDAA 4GMKA 4DR1J 3M6VA 4RUCA 2W9AA 1KVIA 2HFVA 3TO8A 1JLAB 5IOLA 5B0GA 1M5PC 1EARA 2P6SA 4Z2XA 2F7VA 2KZZA 2W7AA 4NX9A 4YEAA 1LWCA 1WOPA 4E2FB 3FCWA 3VAJA 3DGPA 2UUCJ 4DU8A 2NPIA 1GT8A 4CLSA 5H9EJ 2GVDA 4JI6F 3C8YA 4TU8A 2IY5B 4UQGA 3ZZUA 1HWUA 4MKAA 3OFHA 5B09A 1XBWA 2KHDA 1NH8A 2DH9A 3M8QB 1FKPA 5L39A 2M88A 1U48A 2ZHAA 3VF0B 2CPJA 1PC5A 4QW8A 1U2FA 3HKWA 5L38A 3RGIA 4RW7A 2DIUA 4WIIA 1LK7A 2E7XA 1BXNA 1N5VA 2JVOA 5A76A 2HQIA 2VHGA 5DQGA 4KO0A 5GMKa 3N28A 3ET6A 2O5DA 3FBEA 2ZWPA 2FVCA 1M5VC 1MW7A 2DRAA 4RJVA 2DHGA 3N9UC 3NKYA 3ISZA 5L46A 1RKIA 1MU2A 2ZH6A 3EYZA 2OPRA 4ELVA 4DV1F 3CDUA 4BCAA 2Z2MA 3D7SB 1CBKA 1AT1B 2XY6A 2B43A 4BS2A 2C3OA 4I6WA 2IYIA 2G1DA 2BACA 1YJUA 2VQFF 5BYRA 1X4BA 1ZZNA 1PIEA 3PYEA 4C8LA 4PG5A 4R0EA 2E9RX 1S5ZA 1QSLA 1WKJA 1S9GA 3CDEA 1TQLA 2YBVA 4YOEA 4DN0A 4AL7A 1XNRJ 1DZ5A 1XK8A 4ECQA 1F6TA 2LDYA 4KSEB 3M2VA 2DR5A 4IQXA 4ZIWA 4YR2A 4OL8A 2D9OA 1OSDA 4FDFA 3LAKA 3KDNA 3M9MB 1WORA 3H8YA 4HI2A 4GKJF 1NHUA 2CQ1A 2YQ1A 2MKKA 2HVEA 2CDQA 2JLGA 2JC1A 3MM6B 4FBTA 2MYFA 1NSKL 3ZZTA 2KM8B 2HFNA 2V9WA 2KRBA 3VR1A 2B5JB 1VQSA 5ETRA 3PHTA 2DNHA 1MMDA 2QMUB 4MKBA 2F4FA 5CYMA 1XN9A 5AJ3J 1RHRB 3DLEB 1DURA 5HVFA 1VQMS 2E1RA 3DNCA 1YJWS 2ZFHA 3MEKA 1SJQA 2DHSA 2DISA 4O3PA 3HF5A 1KQGB 2M3DA 5FLXY 8ATCB 1IKYA 2LU2A 2FJEB 4I1TA 2DGSA 4MIBA 3TI0A 5IM0A 4F3MA 3QMQA 2C2OB 2DPJA 2QRRA 2DO4A 4EWTA 4WK1A 2B9EA 4IOAQ 3M6UA 4JV5F 1RTHA 3K0JA 4RUBA 1NK9A 2OIHA 2PSZA 5KFIA 3PJWA 3PCOB 2BOAA 1JX4A 2ZD1A 4ZPBA 1R8AA 3JSBA 4HTJA 4OLOA 1WDDA 1K73T 1B70B 2QSFA 4K4XA 1KOOA 4Y2AA 2VJUA 2CQPA 1S10A 4ZDNA 3M8PA 3OTCA 1SUQB 3A3OB 4QR2A 1F9HA 4DMZA 2XO6A 4K5SA 2P9GA 1JLCB 1O6XA 1SPBP 2YNIB 1ZS6A 4KKOB 3DM2B 4O3NA 5CAAA 3KXDA 4DL2A 4EBDA 1HMVA 2HHTA 4NLOA 2C3YA 3D3BJ 1AFJA 2ZZNA 1FERA 4M1KA 4ZHRA 3MFIA 1SL0A 2MMYA 1X4CA 1XQIA 1JK9B 2NLWA 2HNYB 1HBMA 2G1HA 3DDKA 4H4MB 2LCWA 1S0MA 2VG7B 2NUUG 4H4KA 1IBLF 1NNDA 4DCPB 4NRTA 1XC9A 2FLLA 2W1BA 5DLGA 1N0UA 2AYMA 3MPDA 1NJYA 3CWJA 2WZ1A 3GLJA 4O3SA 1JNRB 2GIQA 3HZEA 1RAHB 2BEFA 4NA1A 2YWGA 4P72A 1RT5A 2W25A 4KV8A 6FDRA 3Q2SC 3CD7A 3JSRA 3HSJA 1F1BB 1QAJA 3BH6B 1FTCA 3SFUA 3VALA 3CPWR 4PPDA 3QJLA 2WBMA 1T05B 1R0AB 1A7GE 2OD4A 1QAXA 3LGMA 2YPZA 2ABYA 5MLCV 3RW6A 2M4MA 1FK9A 2I0XA 5IQ6A 5KFWA 3IR5B 3A12A 4O44B 4AD6A 4CLZA 2K2PA 1RBAA 2GNKA 5KFRA 4DV2J 1B99A 3TOQA 2GA7A 3NY0A 3DYAA 3ETMA 2CQ0A 1GMWA 3OSPA 3M9OB 3K5LA 1SI9A 2YKNA 3QJPA 1D9FA 2OMLA 4AL6A 1IJFB 4IG0B 3AT1B 2ZUGA 3M8ZA 3BYPA 4GC6A 4HEA9 3KJVB 2WBRA 1YDLA 4IR9A 1HFEL 2VODA 3ETOA 4DZ6A 1LFPA 1Q95G 4H4OB 5KFPA 1F5BA 4J90A 4DQQA 1CULB 2KL8A 2L9WA 2G13A 3SQOP 1P9QC 3FBCA 3ZNJ1 3B4MA 3IM9A 4L76A 3LOUA 3J81U 3DRPB 4YB1P 4RNMA 1T03B 2BJEA 3VAMA 1LW0B 1WC4A 2IMOA 2L08A 1M5KC 1HW9A 2NSBA 5AE1A 2YY3A 4OI3A 3PDNA 1V3SA 3US5A 2N4CA 4HHHA 2RQCA 2QE5A 1N5QA 2GAHC 4LT6A 1IKXB 4IO9Q 1C4CA 5J2PA 2HFSA 2M7SA 5GAHU 5JXSA 2OEKA 1UEVA 3GIKA 2BDPA 4OX8A 3HXMA 2D3O1 1WJ9A 3FRZA 2MZRA 1JLAA 2FC9A 1UFLA 2ZUAA 2LDIA 3MEGB 4KGMA 4X4OA 2QJ3A 4U67Q 2NXNA 1Q78A 3GZ7A 4B9TA 2R7WA 3EM1A 1AFIA 1ZPVA 4LFAF 2XNRA 2OSRA 1H2TZ 4FVMA 2KFNA 2IHR1 1VMBA 1DBDA 3H20A 3PR5B 3OD2A 3R6GB 3HLUA 1HD0A 2ATCB 3I96A 2HBQB 1PAUB 4JI5J 4NLTA 3CCMS 4OZ5A 4HHJA 1OY8A 2JLEA 1DQ8A 3MMJA 1PJ7A 4PWDB 1OYEA 2CQCA 5M2PA 3BR8A 2B6AA 2C2DA 5KT4A 1X60A 4M5KA 1MROA 4ES3A 4HL9A 4BDPA 4X4QA 3HVAA 5M2UA 3IG1A 2XYGB 3BV8A 2AV5A 3OW2R 4XDDA 4DV4F 1GMWD 1HNIA 1QUPA 3PYFA 4CH0S 4DR3J 1ZTWA 1JLGB 1TU0B 3H4DA 2FLPA 4C8YA 2W8LA 3QO9B 1C2PA 1B64A 2I6WA 5KT5A 1T7PA 4O3RA 4NZ7A 2JFKA 3EE3A 4R8UA 3RW7A 2CJQA 1YG0A 4B3RJ 3MR6A 2OPSA 2CPHA 3T9NA 2LQBA 4X4VA 2PFFB 4IG3B 2CQHA 2EFNA 1FWPA 5BYSA 4LFBF 2OPQA 2WSCC 3KUEA 4LSLB 2Z2YB 1HARA 2AKWB 3MPVA 2EFVA 1IJEB 2HQGA 3I0SB 1UVKA 2CNLB 4FPIA 1H6KX 4JI8J 3KG0A 3MM9B 3LGNA 2FVQA 2NPFA 2E1MC 2C2EA 1BC6A 1NDPA 2E7WA 2KXNB 1GXLA 3L9ZA 2VFTA 2FTRA 1G3OA 2W9BB 4Z7YA 1HWJA 4LRCA 4RW6A 1FI4A 2IM2A 4RW9A 3OLBA 1SIZA 4YB5A 1WKLA 5EGYA 3LWMA 4CDIA 3O3LA 4OHYA 2UXBF 5DDQC 3C15B 3CJ5A 4ZVUB 1OQ3A 1VQ6S 3DMJB 5GVQA 4B02A 3M6WA 2UUTA 4M5IA 1TKTB 2XMJA 3RR8A 5AXNA 4ZVPB 5HROB 3N0VA 1K0TA 1FKOA 2DGOA 3NP5A 3DFEA 4AYBD 3J80Y 2B5JA 5HO4A 1O0PA 4WIQA 3HULA 3I55S 3BDEA 4O0NA 1HIYA 2C3MA 2BXJA 5GMDA 4J9LA 4L6V3 2RDIA 2NREA 5BR8F 2VPWB 2QSWA 3Q8RB 3QQCD 1N34J 3NL0A 4RNOA 2EC2A 3H5UA 1YI2S 2KO1A 2W8KA 2BE7D 3KKFA 3AA8A 4PYDA 3G82B 2HAIA 3FMWA 2E5IA 3U1MA 4YY3F 1HHQA 4OFZA 2DY9A 4ETXA 1Q53A 2J6SA 2QFJA 2BRKA 3WIVA 4C48A 1L3SA 1IQZA 1WF0A 4ZP9A 4RW4B 3KYLA 2XBPA 1DTQA 4YHHJ 3H4BA 1QVFR 3EDQB 3R5JB 2UUBJ 2DD8S 3D1OA 1YTYA 1IBMF 6FD1A 2EBGA 1W7WA 2G4BA 3C6UA 2VD3A 3CCSS 3EPIA 1PG5B 2E1AA 1Q79A 3AD7C 4ZKAA 5EWGA 4YUDA 2VFUA 5H9FJ 4AE5A 3DOMB 1JLCA 3WIUA 3RR7A 5DG9A 3G4SS 1RU1A 4ILMA 4OV6A 4Y6IA 1U45A 1UEKA 1NO8A 3MCOA 2G2YA 1I94J 3F41A 3N4WA 4P71A 1BQXA 1CS4B 4U95A 2BV3A 3VHQA 3DDIA 1S77D 2V69A 1NDCA 2Q43A 3V4MA 1F3VA 4WWSA 2E5LF 3H25A 3DLJA 2F8MA 1UVMA 1CG2A 4NA2A 3IRXB 1U0SA 4KGKA 2RUSA 3LP0B 2DGUA 1VLOA 2VG7A 4PR6A 1X5PA 3LANA 1RHJB 6AT1B 3HHEA 1TKDA 3ZTPA 5H9EK 1YZ7A 1OQ6A 3ZZZA 3X3UA 1B7FA 2A10A 2CZVC 1B0TA 3EXYA 5C42B 5IT4A 2VFVA 3M8YA 4LF1A 4ZPCA 1V6HA 4X64F 1RKJA 3MMAB 1U8WA 1RCOB 4CTAB 3CCUS 2ZJQQ 4D3HA 1Q5YA 4DJBA 2FLOA 5D78A 5GADI 1S9FA 3TX8A 2KJVA 3L7OA 4ED7A 4O44A 3CJ0A 5E3CA 2IBKA 3KLEA 4N47A 2HMIB 3AODA 4YS2A 1M5HA 5KG7A 2D3ZA 1IBKJ 3HFZB 1CSJA 1YJ7A 4P75A 3NGDA 3HHLC 2VFSA 3GWCA 3FZBA 5CZVA 5HATA 3KHHA 1VQ9S 3A4TA 5F9LA 4MFBB 3TZWA 1R89A 4CCHA 1CQMA 3MM5B 4UT4A 1SC6A 2BZ2A 4C3LA 3R5CA 4RWWA 3D5MA 3OL6A 4WK3A 1SQEA 4FNHA 3VAFA 1PILA 2DEIA 3D1HA 2QMWA 5GMEA 3KLVA 3IR6B 4H4OA 2GGPB 2V94A 3OFEA 1CULA 2OFHX 3C14B 4CT8A 3MMCB 4ED0A 2PMZD 3B8HA 1WF2A 3GSIA 1S49A 5KAKA 3DLGB 1SJRA 3GIIA 3K5PA 1W2BR 1RWKB 4M94A 5A8RA 1YJVA 2A2CA 5KFKA 2HPUA 3K5MA 4JI1F 1TKZB 4J9VA 2MZQA 3EX7B 4ECXA 3LP2A 3DHWC 4C8MA 1CC8A 2J7UA 5HJYA 2MKJA 1YBAA 3TZZA 4DR1F 4K4YA 4HT7A 4NYZA 4O4GA 3VCDA 2XSJA 2RNEA 3FGVA 2CQIA 1U8SA 1IKXA 4NLUA 1TK5A 2AMCB 4ZCMA 3UCZP 4DV3J 1NHKL 2CQDA 1TL3B 2FY1A 4LF4J 1N5YA 5M2RA 2HHXA 2GVZA 3GV5B 4OX9J 1RBLA 4CWBA 9RUBA 1KLNA 3MECB 2BE2A 3OTBA 2GHPA 3BBBA 4XIUA 3PX4A 1J5EJ 1S1XA 4I64A 1N54B 2MY8A 1QTMA 4ED2A 3V2UC 2WW4A 1FEHA 3MM7B 1WC6A 1VR6A 2QA4G 2OO4A 1U0HA 3N6NA 3AJDA 2RRNA 3SQGA 3N79A 1RP5A 2K06A 1KLMB 3HD1A 5E3RA 4PWDA 5HP1B 1I6JA 3T1HJ 2KVQE 1MWYA 4USJC 4K50A 1T95A 3IS9B 1S6PA 1WACA 1RA7A 3VQTA 4ED5A 4A8KA 1WI6A 5GAEI 4N8NA 3VVUA 3KLHA 4YDXA 1S6QA 2ILYA 4U7UD 4C3MA 2CZ9A 2CADA 1OS5A 3NEKA 3K5OA 1QM9A 3B4DA 1KQFB 5KT6A 2E7VA 1ZTTA 1ZA1B 1RWVB 2P9EA 1Y4ZB 1KFSA 2Y8YA 2DNRA 3FEZA 2KG1A 1OY6A 1F9EB 3SFGA 4FXVA 1NDLA 1FCAA 3W5YA 2EKYA 5C24B 4QR1A 2W2QP 1U49A 1RWUA 2FVSA 3P6YC 2XI2A 4F3OA 5A8WB 4DR2J 2VB6A 2RIJA 5G4DA 3RRGA 1NUEA 5DRKA 2XEXA 2ZBRA 3M7VA 1XNRF 1R8HA 2B4UA 3H40A 1F3FA 1LV5A 1U1NA 1LWFA 2DJWA 3UCGA 4TLQA 4LF5J 4KR0B 3MAQA 1K1SA 4BHQA 4HVZA 4UUXA 1SV5B 3R7SB 3GPAA 5J2NB 3H2LA 4DV5J 3OR1B 2XNQA 3D28A 2W9BA 3W5XA 4B9LA 2BANB 3TRGA 4CO2A 1RQ0A 3QT6A 3FZ2A 1WSVA 1KD1T 3MOJB 4JI7J 1X0FA 3GCXP 2LMIA 3Q24A 2NUHA 3BO3A 4DF8A 3DN9A 2FHMA 3BF4A 4R0JA 1SJFA 3U02A 1F2HA 4NXMJ 4MIWA 3HVTA 3UO0A 2R2UA 1PJ5A 2DY1A 2H4YB 5I3QA 3HVRA 3D0HE 5HROA 1UL3A 4ZVRB 5LJ3Y 5I3PA 2BKOA 2V2QA 5HLFA 2HKEA 1NH7A 2MLXA 3HI9A 5J2QB 3TAMA 1S59A 2DEJA 2IC3B 4IO1A 3Q0AA 2L41A 1C1CA 2XWXA 4NA3A 4FBUA 2YKQA 4G1PA 2GZOA 2KT3A 2MJUA 4OZ0A 4G1IA 2Y9HA 3G82A 2A0FB 5D15A 3P96A 4CLWA 3CGIA 3KK2B 1IQTA 4I2QA 5EDWA 3R9LA 1X9MA 4KTQA 2UZAA 3OVSA 4CO1A 3F73A 2B3TB 2ZH7A 1KRPA 5T14A 1DJ0A 1DARA 3HT0A 2D41A 3ADAC 2LECA 5HANA 2B9XA 1XNQF 3I31A 4B3OB 5C2CA 4DLGA 2FLNA 3GG1A 4OV1A 2Y1LB 1UP1A 3QZ8A 2FHJA 3KHRA 3QSYB 1RTIB 4Q44A 2CRLA 1M1GA 5J1EB 3FCVA 2R3VA 1DHMA 1VRUA 3CC7S 2NXEA 2AEMA 2DR9A 4NLWA 3C19A 4K4TA 1UWAA 4WJBA 3NCRA 3DOMA 4TU9A 2GCFA 4P73A 2ZJPQ 2QGFB 2R2TA 4ZA1A 1HQUA 3KJNB 1XEZA 1CS4A 4ID5A 3CD0A 2FVRA 3GB0A 4X4NA 2OUGA 2CJYB 4LRAA 2HQCA 1R8PA 4MKVA 5I3UB 2DIVA 2ZWOA 3TNVA 5U47A 1W26A 1HI1A 3KG1A 2GIFA 2O1PA 3L95X 1FE0A 2EI5A 3DGVA 3B6BA 5A8KA 3UDCA 4M5NA 1WKKA 4ZLJA 2UVWA 3CCLS 3BBFA 4N77A 4DHVA 4Y65A 4Q7AA 3W64A 2CNNB 1M1KT 1OSCA 2CFXA 4TQRA 3NGUA 5D0GA 2IRYA 4QWEA 4I67A 4F3QA 1GEHA 3OLAA 1N36F 1S7IA 3RJMB 1TL1A 5EX3A 3UD4P 3MMAA 4J5OA 2HVIA 3HFKA 2ZH9A 2MQOA 3PY8A 1T9WA 1TAUA 3EZOA 4FN5A 4Y2KA 2V8HA 4NLXA 3PR4A 3MCNA 1RAJA 1ZPWX 2OELA 1RAIB 5A0YA 3H2UB 3W2WB 1AUSL 2J7WA 2VBXA 4NCGA 2ZH4A 1JMTA 3AD8C 4ZLNA 1WC3A 1CPZA 4PQUA 4J9NA 4A8SA 1FRKA 3JSYA 2CG4A 4LSZB 5IZHA 2EG2A 4NWBA 1F5AA 3FNNA 2B4OA 3NS7B 4MFBA 4XDCA 4A8YA 5KFAA 4WTYA 4RBVA 2FHJD 4Y2IA 3C16A 5T41A 3DLLQ 4DUYF 3PRVA 2RE1A 3MR5A 3CTRA 2CG8A 2RS8A 4DPWA 4ES1A 3FC9A 3AOAA 4P6QA 4WKRA 4WPAA 3BDPA 1SH2A 1F5CA 3C46A 4EYIB 1WOSA 1AZSB 2UVVA 2LVWA 2JJ4D 1VOMA 4RUAA 4ICLA 2KVIA 2I5JA 1VQ7S 5D6GA 1RLDA 2DNGA 2Z8QA 3PVXA 2LKZA 5L9NA 3W62A 1TKZA 4UY85 2DNKA 3B82A 4K0KJ 1V3ZA 1U2RA 3KLIB 2ZHOA 4KPCA 3OJSA 3CJ3A 4OZ3A 1FT8A 4GVBB 1RI7A 3PW7A 2N4DA 3DDNA 3P4UB 5E3AA 3QFHA 2J9CA 4WE1B 1NJZA 2XLKA 3KJFB 4PXCA 2DK2A 1N0VC 1HNZJ 3MD1A 5E3PA 2HS4A 1OJ4A 2CVEA 4RX6A 4FF4A 4ENOA 2YX1A 2MQNA 3JB9k 1YIJS 2PEBA 4DS5A 3N6LA 2DNZA 1YHQS 3MFHA 3NCQA 2LXFA 3W2VB 3OHAA 1QD1A 4QIVA 3JAMY 1TL4A 4F4YA 4W98A 5D3GB 1X5TA 4ZVGA 3QWPA 2QYCA 1S1VB 2ALZA 4JI5F 5FLXU 2P5VA 1MN9A 4HH0A 4IH6A 1HWIA 3MM7A 3KJQB 2XZDB 3CD5A 5B0FA 4OI4A 3QIPA 1TL7A 2YNHA 4R5PB 3CJ2A 4UF4A 2W9CB 3I6PA 2VPZB 4YB6A 1B4SA 4DR3F 5HP1A 1BWVA 1GMVA 3RBDA 2RQMA 4NEZA 1KS2A 1TUVA 3D66A 4DR4J 5IV4A 2JZ5A 1V3RA 5I42B 3TVKA 2DGTA 1J5OA 3IA0A 3LALA 3KOAA 4DEZA 1L3VA 2H9ZA 4AT1B 4ECUA 2GQCA 2Z4PA 4DX8H 1P1TA 4PUOA 1V5VA 1FO1A 2RMLA 1QLNA 2D3UA 3K2YA 4FNIA 4WU3A 3ISND 4DPYA 1YSJA 4NLDA 4K7QA 1RWPB 3BPDA 3DLKB 5H9FK 3TAPA 4EU0A 3D54A 1KHWA 1EETA 4B9MA 3Q8PB 1B0VA 4W4MA 4JI8F 1UAWA 2O01C 5D4LA 3IWLA 2KYZA 1T8EA 2ZNZA 5F8HA 4NXNJ 3IBCB 4PG4A 3QRRA 2VIHA 3MCMA 2AWZA 5KG5A 5DM6Q 4M5GA 2WK4A 5C5JA 4FYVB 1HNWF 4ZS6A 1TKXB 1LWCB 2FY8A 2Q1LA 1Q82T 2MQPA 3QGHA 3DGPB 4DQRA 4EO6A 3VGTA 4DS4A 2HHPA 5J2NA 2CVIA 3OR1A 5AXMA 4ZCLA 2BANA 1Z4UA 3G87A 4BC7A 4F4XA 2LU1A 3W3SA 3KUHA 1MN7A 5CABA 4QIFA 4JI4F 3SSRA 4QYRA 4V19X 2HGLA 3AH6A 5HMYA 3L3CA 3GJSB 2AZ1A 2MZ1A 3EDRB 3UN2A 4OYMA 1OWXA 5E7OB 3D6TB 1VRTB 1ACMB 3BN4A 1RHUB 3MMBB 5KT2A 4HDHA 2LLZA 4USWA 3N5BA 2Y1RI 3FSYA 3W8GA 3W7BA 1FNXH 5CQGA 1NK8A 2ZOFA 2N7YA 1U24A 3M8RA 4G65A 3IC1A 1BD6A 1SL2A 4B3TF 2WVBA 4LF6F 1VQ5S 4K4VA 2KTQA 2IC3A 4FXWA 5LJ5Y 3RBXA 4WP3A 1RAOA 1R6VA 5AE3A 2DKOB 3BGOP 2I38A 1ULRA 5HBMA 4W92B 3H90A 1MU2B 5D0EA 1YZ6A 3QT7A 1QVGR
chains in the Genus database with same CATH topology
1UWBA 2L08A 3IO1A 4I69A 1YJNS 2FVPA 1HW9A 2NSBA 1M5KC 4ILLA 2OTJS 3SXLA 3FQKA 5GAEU 3NS5A 5AE1A 2YY3A 4OI3A 2VZ9A 3PDNA 1ZAWA 3I5AA 2DO0A 2UUBF 2NQPA 1V3SA 1LW2B 3IRXA 4WYWA 3US5A 3G8QA 1IKVA 2N4CA 2AP6A 3OJUA 2B56A 2CZ4A 3LP0A 1HWLA 2IRUA 2ZE2A 3OVBA 1R3NA 3LW5C 5CH7B 5A0YB 2RQCA 4UUWA 4WZQA 4DDFA 2QE5A 4NXMF 4PKDB 2Y1IA 3H98A 5B0BA 2YH0A 1N5QA 1VBYA 1PO6A 3IN5A 4LT6A 4NCGB 1RT7B 4WFYA 4ID8A 4NCAA 2QT7A 1IKXB 1HPZB 4IH7A 2VASA 4R25A 3HHLB 5IFMA 4IO9Q 2JL9A 2QMXA 4DQIA 1C4CA 5J2PA 4PQUB 2IA0A 2PEHA 3PX6A 4K5RA 3OL8A 4Q5VA 3HT3A 1NKEA 3UCUP 2UV8A 2M7SA 4ED8A 5GAHU 5AXKA 5JXSA 2I8EA 3R5BA 4NYOA 4WFXA 4DLEA 1HR0F 1GXUA 1UEVA 1S9GB 3PRDA 3GIKA 1S1UA 2FJVA 3P3DA 1XMBA 1B0PA 2MHEA 4NPOA 3IAM9 2FJDB 3UPFA 1KQSR 2BDPA 4OX8A 3HXMA 3FRZA 3Q8SB 5GAGU 3DOLA 4EBEA 2MZRA 3JTOA 3BO4A 3BSNA 1UJ6A 4KFBB 1JLAA 5C42A 1HYSB 2XS7A 2FC9A 5J1EA 4QWAA 1UFLA 2UXDF 2E44A 2C2RA 1BWEA 5BYQA 2LDIA 2CQ3A 1I94F 2RUGA 2MJNA 3MEGB 5KFCA 3RBEA 4KGMA 4X4OA 3NAHA 2F4VF 4ZOSA 4U67Q 2XHWA 4C11A 1Q78A 3GZ7A 2AJQA 4MJKA 4B9TA 2FUG9 2R7WA 1N5TA 4A8QA 4IFVA 1AFIA 3CCRS 1ZPVA 2ASDA 5K9FA 4LFAF 2HHUA 4NOHA 2XNRA 2MKSA 3MF5A 3CEDA 2OSRA 1HA1A 3RAXA 3VWSA 1H2TZ 2R7RA 4FVMA 2KFNA 1RA6A 3RZAA 4CTAA 1GX5A 4ZCIA 2IHR1 4OHWA 1VMBA 1RTJB 3PV8A 1DBDA 5K14A 2AYBA 4LF8F 3H20A 3PR5B 4NLYA 3MI7X 4U9RA 4MK8A 2GX8A 2K3KA 4EBCA 3HLUA 2ZJRQ 4HH1A 1HD0A 1H2UX 3I96A 5KOWA 3K59A 3V6DB 2ZDOA 3DI6A 1ROFA 1QAYA 2OD6A 2KN4A 3QYYA 4LVOP 4ICLB 2ROPA 5LSLA 3S6EA 2B9YA 4QR0A 1ZAVA 2I5JB 2VOOA 4NLTA 2V9KA 2WB4A 3CCMS 4OZ5A 4HHJA 5C25A 1FE4A 2JLEA 1DQ8A 2PDAA 3MMJA 4OX6A 3HJFA 4I7FB 4PWDB 2CQCA 1VBZA 2M2BA 3HVWA 2HMIA 3OFGA 5KOXA 5M2PA 3BR8A 4EUVA 2B6AA 2C2DA 5KT4A 2OP5A 3K57A 1JLQA 1Q86T 4A8OA 1Y0HA 5CYMB 1MROA 4ES3A 3K5NA 4ITSA 3GE9A 4URSA 4KC5A 5I3UA 4OHXA 4HL9A 4BDPA 3CVKA 4WKYA 3QGGA 1YQHA 3LUYA 4X4QA 4DL7A 3HVAA 3NBPB 3IG1A 5M2UA 2R2SA 5CYJA 2YNGB 2CQ4A 3M2RB 3OTOF 2GQ2A 2DNPA 4CI0B 3QIDA 4AL5A 3PFOA 4QWCA 2EVZA 2AV5A 4O4RA 4TKTA 3OW2R 2AGPA 4XDDA 1F0XA 4DV4F 1XMQF 1HNIA 1QUPA 4UW2A 5DG7A 3MCSA 4CH0S 3MM5A 1KONA 1PSDA 5L8RC 2W24A 2Z0GA 1UKUA 3LAMA 1ZTWA 5E33A 1JLGB 1Z2LA 4MK7A 3J7Z5 3FCHA 2K3IA 4C0HA 2YWHA 3PIPQ 3BGFA 1JB0C 2DT9A 3PKYA 1EP4B 1HHSA 5IM0B 3DRRB 2C28A 3H4DA 3ENWA 2FLPA 1RT4B 2UUCF 4C8YA 2W8LA 2R7QA 5HN0A 1O8BA 5E0OA 3NL0A 2BQRA 4J9QA 3B78A 3NGKA 1O5JA 4X4RA 1SJ4P 3V81A 2J5AA 3RTVA 4RNFA 1QAIA 3QO9B 1C2PA 1E6YB 1B64A 2F8EX 5KT5A 1RTHB 2GGPA 3ZZPA 1ZH5A 4DG1B 3CC4S 1T7PA 1JJ2R 1OO0B 1WHXA 2LEPA 5L1LA 2KH9A 4O3RA 4NZ7A 3MMCA 1ZAXA 4TLRA 2XG8A 2JFKA 2V2KA 3LPYA 4R8UA 4A8FA 3RW7A 2MHNA 4BC9A 2BRLA 2NYIA 4FZVA 1H3DA 3FEYB 2XS5A 2CJQA 1YG0A 3ICLA 2D7SA 2D9PA 4HTIA 1VC5A 3MR6A 2OPSA 3DLGA 5IT0A 4RWXA 2QZ8A 2CPHA 3T9NA 2ZD1B 1SIWB 2LQBA 4X4VA 5KFBA 2PFFB 3E2EA 2LQ9A 4IG3B 3O5TB 2CQHA 2EFNA 2OPPA 5BYSA 1S0OA 1JWWA 2FJWA 4KIAA 1XR6A 4LFBF 3QGIA 2ZOGA 2KM8C 4QIWD 2OPQA 3K7RA 5DG8A 2WSCC 5F9NA 3WC2A 4G1QA 4V19J 4LSLB 1C1BB 1H7XA 1HW8A 2UVRA 1Y5LB 1U4BA 1HARA 2MZJA 3J7ZT 3QIPB 3RB0A 1NK4A 3MPVA 2EFVA 2YNHB 2FHKA 3BSCA 1IJEB 2B7CB 3FVYA 1U1LA 3I0SB 2EBEA 5AE2A 2QO3A 4IR1A 4DBQA 5LMUF 4HDGA 2QA2A 2FIUA 2DNNA 1UVKA 4KQZA 1GAOA 1H6KX 1I1GA 3KG0A 1T3NA 1RT3B 2XO7A 2K1RA 3MM9B 2GMLA 2GO8A 3LGNA 2R7UA 1R6YA 4OIXA 3S7RA 3T5LA 4TY8B 1RYSA 2VPXB 4JYAF 1FHTA 2FVQA 4Y34A 2N3LA 1X4HA 2XMUA 4OI6A 2NPFA 1TL3A 3G8TA 2E1MC 2C2EA 3KHLA 1BC6A 4JUZA 2IAJA 1S1TA 1F60B 2R7SA 1DRZA 2E7WA 2KXNB 2BABA 3KHGA 1GXLA 2ZC4A 2RVJA 2C22A 4DWIA 3J7YU 3UDLA 1U6FA 2VFTA 1SH3A 3LWLA 2FTRA 1G3OA 2W9BB 3FFIA 4DFKA 1J5OB 4I6YA 1HMVB 1XR7A 2COLA 1JJ4A 4ECYA 1FRHA 3G8SA 4GO5X 1HWJA 3MECA 4RW6A 3OL9A 3RYLA 4ZHRB 2IM2A 4RW9A 1NK7A 4J9PA 4CNYA 3OLBA 4UY8T 1FKAF 1SIZA 4YB5A 3VAKA 2PC6A 5EGYA 3LWMA 3CIZA 4QPTA 4ZPVR 2MGZA 2CPXA 3O3LA 4C8ZA 4PUOB 4OHYA 1NK5A 3PEJA 2UXBF 3MTKA 2LA4A 2IM3A 2XCAA 1Y7PA 5DDQC 4J9SA 4RU2A 3CJ5A 4YDDB 4EFAC 3BEGB 5L9XA 4F50A 4Q8EA 1OQ3A 1REVA 2WHOA 2Q6CA 3DC2A 1VHFA 1VQ6S 1UA0A 2VG6B 1U25A 3DMJB 4NMLA 4RUHA 5GVQA 4B02A 3M6WA 2UUTA 1ZBTA 1WTBA 1RDRA 3CO9A 3MUMP 3EGWB 2W4DA 5KTQA 1TKTB 2CPFA 3QWUA 4PG8A 2XMJA 4RNHA 1EETB 1FNMA 3EZUA 1FRMA 2ZBIA 1Y5NB 4J9OA 3RR8A 4ILRA 1WNEA 3CF5Q 2KU7A 3OQ2A 3TVYA 4DL3A 1Z1ZA 1NJXA 4CQ1A 5AXNA 3MR2A 5HROB 1DAXA 4RW8B 1JXLA 3N0VA 1K0TA 2J0XA 1FKOA 2DGOA 3NP5A 3DFEA 3OTEA 4AYBD 4YR0A 1YJTA 3P49B 3J80Y 1RT5B 2B5JA 1QUVA 1KLMA 2QIFA 2VKRA 3E8OA 5HO4A 1UETA 1O0PA 2UUAF 1VQYA 2RD5C 3I55S 3BDEA 1UFWA 1SXLA 4KB7A 4OZLA 4LF4F 1CLFA 1SJ3P 2M70A 2XULA 2C3MA 2BXJA 3MGJA 1HBOB 4J9LA 4DFMA 1FA0A 1HNVB 3CCVS 2E9TA 4L6V3 2RDIA 2MKHA 4I56A 2NREA 2EFGA 3IS9A 5BR8F 2VPWB 5JVGQ 2HG4A 1N33F 2QSWA 3Q8RB 1FXDA 4AUKA 2LXUA 4RLEA 2VFRA 1A6LA 5FDLA 4K2XA 2KYXA 4RNOA 3PO4A 3AA9A 4F4WA 3H5UA 1E6VA 3UW1A 2XLJA 1YI2S 5DGAA 2KO1A 4B08A 2W8KA 3BREA 5E41A 2VV5A 1A9NB 3D1QA 3KLFA 3WBZA 2JVRA 3MURP 2V4QA 3KKFA 1N88A 1NJIT 4IKAA 3AA8A 3P5TL 1FD2A 2DCLA 2V8VA 5F3TA 4WXWA 4YFUA 2GO9A 2HAIA 2PMHA 3FMWA 2FC8A 2DGXA 4CO0A 2E5IA 3U1MA 3OR2A 4YY3F 2DTJA 5KT3A 2VOPA 4OFZA 2MB0B 4ETXA 1FJ7A 5L1IA 1Q53A 4QOTA 1U1MA 1HBNB 2J6SA 5CYQB 2QFJA 2BRKA 1NU4A 3ENQA 2WAQD 1L3SA 5DJBA 1IQZA 4ECWA 2HVZA 4ATNA 1WF0A 2VBZA 4IOBA 4ZP9A 4RW4B 3KYLA 1YRUA 1YWXA 3L09A 1ZETA 2APOA 1X4EA 2F3JA 2HNZA 2XBPA 2ZH1A 1U1KA 3MEEB 1SKWA 1DTQA 2KT2A 2RU9A 3CULA 3LF0A 1XNRF 2XZWA 4JI0F 1ZM2A 3GYNA 3H4BA 1QVFR 4USIA 3C6TA 3BGRA 2DHXA 5F8IA 3JTPA 4ZMMA 1PGZA 3KLGA 4URQU 5EUHA 1LQ9A 3QGPA 2CJAA 4K0KF 1JLFA 3KG4A 1FRLA 4RBUA 2J76E 1SH0A 2DD8S 1U7LA 3I0RA 4QPXA 2DB1A 2AJFE 5C24A 3D1OA 3T1HF 1BLUA 1IXKA 1YTYA 4KPYA 2HHWA 2GC8A 5KFFA 3FSXA 1IBMF 4KBIA 6FD1A 4LIWA 5B0EA 5AJ3F 2EBGA 1U47A 3JTNA 1JLBA 1FRXA 2LA6A 2M0GB 5A8WA 1QVGR 1ELOA 4P7VA 3BB5A 4OI1A 2G4BA 3C6UA 4NYPA 2RSQA 3D2WA 2OMOA 2B0GA 2G9OA 3O6QA 1YITS 2VD3A 1X4DA 1RT1A 2ZOMA 1KN6A 1G6BA 3CCSS 4DF4A 3EPIA 4E98A 4R5PA 2ERRA 2MQQA 5DDOC 4D3GA 2E1AA 5KFXA 3THVA 3EGZA 3TP2A 3TVZA 1Q79A 1YVFA 1VFJA 3EUNA 4I68A 4IFYA 4ZPAA 1HNZF 2AD9A 1GNKA 1R27B 4CO5A 5L1KA 2HHVA 4ZKAA 1YJ9S 5EWGA 4IRKA 2AQ4A 4YUDA 3AAWB 2VFUA 2J0QD 4DR5F 4WFAQ 2BVZA 5H9FJ 4AE5A 2E1CA 3TANA 4IYQA 2QLWA 2IYGA 1H38A 1JLCA 3E01A 1SBRA 4TU7A 1VGYA 3H59A 3RR7A 1SV5A 3FEXB 5DG9A 3G4SS 3GFYA 3SDEA 2DH7A 2XMMA 1L3TA 4ILMA 5AXLA 4CO4A 3DLBA 4Y6IA 1LWEA 1U45A 1NO8A 2V4JA 5I42A 1Q8BA 2J8AA 3KMSA 2VA3A 3F41A 3N4WA 1BQXA 5HBMB 4URGA 2QA4S 4USHA 1G2EA 1XTZA 2BV3A 1Q1KA 5F3ZA 2HLUA 2VBWA 4M5DA 4ECRA 2R8JA 1YRXA 4OQJA 4DSEA 4F2SA 1UW4A 1GQEA 4WF9Q 1KQKA 1WHVA 1S77D 5KG1A 2HHSA 2Q43A 3UNGC 1W2IA 3T5HA 3ZC4A 1FKPB 2F40A 3V4MA 1BQNA 2E5LF 3H25A 3DLJA 2F8MA 1UVMA 3SYZA 1CG2A 4NA2A 1FJEB 2JEGA 3IRXB 2ZC3A 1FJCA 4QU6A 1IKVB 3MOZA 1FESA 5IWAF 2R7OA 4KGKA 3HPOA 3KMQA 1WHYA 2MY7A 3LP0B 2ZE2B 3QAEA 4B17A 3JSMA 3EZ5A 2PT0A 3T9ZA 2DGUA 2GV1A 4K4SA 4ED3A 3U7JA 2JEFA 2VG7A 1RJJA 4OHVA 4TYBA 5KFSA 4PR6A 1X5PA 5DLFA 4L72B 4EZ6A 3DRXA 3U27A 3LANA 4Q8FA 4N8OA 1KC8T 5D77A 3DU6A 5I4MA 4RW7B 2D74B 3HHEA 3G86A 1HQEA 4JBCA 3K58A 4BWJA 2HWHA 3CDBA 2VG5A 4C97A 1JKHA 3PO5A 1TKDA 1U6BA 3M32A 5F0UA 3WZ0A 4C3KA 4F67A 4LVNP 3UE2A 2RS2A 4TY9A 4JV0A 3OXFA 4CNZA 2WONA 3T3FA 1S1UB 3BM7A 4P2SA 2X3GA 1OQ6A 1TVRA 3WX4A 2WSEC 4C2MA 4KO0B 2VQEF 3ZZZA 4DL0C 2HS3A 1JNZB 3G6XA 3X3UA 4X62F 1B7FA 2GFFA 2N82B 1QSSA 3TA1A 3DOLB 2A10A 3CXCR 3TUZC 2CZVC 4DR4F 2FJXA 1B0TA 1K1QA 4NLRA 3KK1B 3CT9A 4PXEA 3EXYA 5C42B 4IQMA 4LF7F 3LP1B 2RRAA 1WD6A 1S1WB 2NXUA 2YWKA 5IT4A 5J2QA 1RTDA 4DUZF 3PW5A 4I2PA 3AB4B 1KTQA 3MEDA 2VFVA 3PIOQ 3BQ1A 3UWTA 4C11B 4ZPCA 4Z37A 2OJ3A 1V6HA 2RDJA 2PGCA 2CPIA 4X64F 3BJYA 3PX0A 4HLBA 4IFVB 1H98A 1RKJA 2ASYA 1UVNA 1TKXA 2CJ9A 1TK0A 4OZJA 3MMAB 4JI7F 3BGLA 2R8GA 1P8GA 4CTAB 5LSRA 2OPRB 2E66A 3FRYA 4B9SA 4K59A 2E5GA 2HS0A 4M8LA 1L3UA 1R43A 2RKIA 3IWNC 3JYTA 3CCUS 1S48A 2ZJQQ 3V4IB 4D3HA 1TK8A 3SCKE 4Y0FA 1LXNA 4LF9F 3CJKA 4QIEA 2FLOA 4DJBA 2DGQA 3DI6B 3SMZA 4NCBA 5D78A 5KFVA 5CA5A 1NB7A 3KK2A 3OXGA 2M8HA 5GADI 1S9FA 3IBWA 3I87A 2KJVA 3L7OA 3TX8A 4H54A 4O44A 5K8OA 3E3XA 4ED7A 4XPCA 1IM4A 2FD2A 3I4HX 3I56S 3CJ0A 1AXQA 3QPIA 2R7TA 2ZH8A 5E3CA 5IQQA 2K7KA 1U09A 1P1LA 2IBKA 4RZRA 1VK3A 3IRWP 1IKWA 4N47A 5F8GA 3KLEA 3IAS9 3M2UA 1DTTA 2HMIB 1AW0A 1M5HA 2JSXA 1S79A 5KG7A 2B6AB 4J9KA 4Y2MA 2D3ZA 1WEYA 2FJBB 3QAUA 2IVMA 1VBXA 2XS2A 3HK2A 3R1HA 1MROB 4N5SA 3DCAA 3Q23A 3SZ2A 1CSJA 2B4PA 4C8KA 2AX1A 3CSKA 3NGDA 1CC7A 3HHLC 2MSTA 4B3OA 3IG1B 3ITHA 1VRTA 4EYHB 2VFSA 2YKMA 1DLOA 3GWCA 3FZBA 4GO7X 1X9WA 3MMBA 1S9EA 5J2MA 5CZVA 3KHHA 5D8HB 2ZDPA 1HBUA 3CIMA 1VQ9S 1SKRA 4NXNF 5B0DA 1RK8A 3CDAA 4ECVA 5F9LA 3HHNB 3PW2A 4MFBB 1RTIA 2HFOA 1HHTP 1HNIB 1R89