2GHWA

Crystal structure of sars spike protein receptor binding domain in complex with a neutralizing antibody, 80r
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
191
structure length
191
Chain Sequence
ITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of neutralization by a human anti-severe acute respiratory syndrome spike protein antibody, 80R.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Virus/viral protein/antibiotic
molecule keywords Spike glycoprotein
total genus 40
structure length 191
sequence length 191
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ghwA01
2DD8S 3SCLE 3D0HE 3SCKE 5DO2A 4L3NA 4L72B 4ZS6A 3SCIE 2GHVC 3BGFA 2AJFE 3D0GE 3D0IE 4QZVB 2GHWA 4KQZA 3SCJE 4ZPWR 4KR0B 4ZPVR 4XAKA 4ZPTR
chains in the Genus database with same CATH superfamily
2YWWA 5IM0A 2OTLS 2YWFA 3KK1A 3ENAA 4OYMA 2OH2A 3RR7A 5HQ8A 3I5CA 2PGCA 4JV2A 3NBPB 2JVRA 3PY8A 1WELA 3AT1B 4ZPDA 4DSFA 1H2VZ 1X5TA 1AZSB 1SL2A 1HR0F 2NXNA 2VG6A 2P6SA 3NGUA 2P9EA 4IH7A 2A18A 2V50A 4TU9A 4RL1A 1SUQA 4O44A 3EXYA 4LSLB 3JTPA 3VVUA 3TUZC 2GFFA 3MMAA 1R8PA 3N6NA 4LREA 4ECSA 4OYAA 3M9MB 3VAKA 1DQAA 4C4WA 1VHIA 4ZK7M 3HM9A 4BWMA 2FDNA 4NLQA 2ZHAA 3PX4A 1JXEA 1YZ7A 2O67A 2CQ1A 2OSQA 4WCEQ 3RTVA 4C0OC 4Z7CA 5F0WA 3VR1A 2DR9A 1XWLA 2ACMA 2I5JA 3CWJA 4M5KA 2E44A 4ZP7A 5MLCV 4OX7A 2WVFA 1CC8A 3VGSA 1SH3A 3MR3A 3CJ5A 3LP0A 3PVXA 5FJ4A 4FN5A 2OPPB 1Z2LA 3CDAA 3FJ2A 4Q2LA 2AD9A 2UUCF 2BACA 2FJDB 4YMEA 4P73A 1VQNS 4LBIA 3PFEA 1S1XA 1WF0A 2OPQA 5KAKA 3KLGB 3G8SA 1WG1A 4LQ3A 4J9RA 3D6FB 2BV3A 2DXFA 2P2CB 2Y1LB 4FPIA 4DXLA 3KMQA 3G82A 4QZVB 4RW6A 1OPIA 3SSRA 5MAOA 1RT5A 3WIUA 5JJBA 4J9UE 2BW7A 3LP2B 3GJSB 4DV3F 4HACB 1JLQA 2CQPA 2G2OA 3OR2A 4IH6A 1S59A 1U09A 5JXSA 2DR5A 2RE1A 2AT1B 3P5TL 4OJ1A 1QUPA 2UUAJ 1JLGA 1P27B 2VG5B 4LFBJ 3BO4A 1L3VA 5H9FK 1MN7A 3IBCB 4NLXA 3OFGA 2O66A 1KQSR 3R7NB 6FD1A 3GIKA 1FEEA 3CJKB 3W2VA 3PX0A 4KH1B 3ZZUA 3KG1A 4MIAA 2HKEA 4P71A 1GNKA 3AJ1A 3GP9A 3N6LA 5LT5A 5BXIA 2F5GA 1NK8A 2V2QA 4OJGA 3UDEA 5J2NB 1NK5A 4QBUA 3US5A 1U2CA 4UQTA 1NJZA 2XY5A 1FJGJ 1O6XA 1VYAA 5J1NA 1X4DA 4TXSA 5SUHA 2CNNB 4F0KA 3VAFA 3R2CJ 1HFEL 4BDPA 2XLJA 1TL4A 1QSLA 4HDHA 2IHR1 3VTIA 5D4OA 1KBRA 2AJ1A 2DNGA 4P6QA 2FUG9 4ECWA 2VU5A 1PAUB 3AH6A 1CS4B 4M5MA 3R8YA 2XHCA 4F0HA 2DRAA 4N47A 4PXBA 4F2RA 3VAHA 3CJTA 3M8QA 1Q16B 4R25A 4FYXB 1DTQA 3LP1B 5AJ3F 5F8MA 1J5OB 3MD1A 2IAJB 2ZUAA 3QMQA 4NOHA 1NK0A 2ABYA 4IRKA 4CO1A 2NQPA 2XCPA 1X4EA 3MPUB 1SCJB 2ASYA 2E5IA 2VFTA 4PXDA 1VHFA 2ZC3A 3ILLA 1SXLA 1FNXH 2ROGA 2VG6B 1FA0A 2GMHA 4IO1A 4DPOA 2MPUA 3BS9A 5JMNA 4DSIA 4H4MB 1XR6A 2AYEA 2DJWA 3R97A 4DX7A 3MPWA 4J9KA 4K4SA 1M5KC 1LWXA 3THPA 3W64A 2BBEA 1HWKA 3GLJA 3T1AA 3DNCA 2KZZA 1SKRA 3Q2SC 2VFVA 3EGZA 3LTOA 2PSZA 1ITPA 3VQTA 4JYAF 1S0VA 3C14A 1CS4A 1RACB 1PBUA 2BANA 1H2TZ 3P8BB 2VH7A 1KR4A 4CO3A 1UAWA 3WC0A 2B5JB 4U9RA 4CQ1A 4DV4F 3CCZA 3EE3A 4DZ6A 4UZBA 1JLCA 1Z4UA 1KHWA 5IQ6A 1V6HA 2NCKL 1BC6A 3DDKA 1CPZA 1BQMB 2HFVA 2AEMA 5KG4A 4X4VA 1IQZA 1MROA 2WVDA 4KHRA 3WDOA 3NMRA 2KT3A 1QD1A 4O4GA 2XMWA 4FNIA 3BBFA 2CQDA 5DG8A 1N36F 3MEEB 1C2PA 1Q4RA 2QLJB 4IYQA 4RNNA 5A8RA 2W7OA 1QAIA 3BKFA 1MMNA 1XNQF 2C22A 1RWWB 2QL5B 3CXCR 1CJUA 2F3JA 4L6V3 4JI5J 2WONB 1CJKA 2C3PA 3GG1A 3CUNA 2O01C 4OYIA 5K20B 1U02A 3D54A 3AHPA 4KYZA 3MM8B 2B3TB 2VBYA 3FSYA 3C8YA 4CYUB 4K4WA 2J6SA 4ZLJA 1VRUA 4QR0A 2XB2D 8RUCA 1YRTA 2ZJQQ 1TR0A 1YIJS 4HI2A 4MAKA 3TP2A 3UCZP 5D0HA 3CC4S 1LW0A 4DCJB 2V2VA 1D1UA 2C2DA 2NXUA 2K1RA 4R8UB 3ETOA 4EEYA 2RIJA 2PN6A 2Y0SD 5B7WA 5B0GA 4X64F 1S0MA 3AODA 1HARA 1LW0B 1VIOA 5ITHA 1WACA 3MXHP 1JLCB 2VL1A 3RRGA 4YDDB 4DF8A 3DYAA 2DGTA 1N5TA 1KOHA 1NAQA 1NH8A 1QUVA 1UETA 2A2DA 2D3ZA 4G1PA 5F0UA 5HMXA 5M2UA 3BYPA 4ZMMA 2HNZB 5EWFA 4QWAA 2LDIA 2E1PA 5BR8F 4M94A 4DX8H 2W25A 4AQYJ 2IM1A 1GX6A 4P2FA 1WWHA 2NPIA 1FFWB 1ACMB 4ZCLA 2KKHA 1S7HA 2WVCA 3HSDA 2HPUA 3KKFA 3M6WA 3I56S 5C24A 3T5KA 1WI6A 4PRFA 3BSOA 3EGWB 1UMJA 3R5GA 3JSYA 1P6TA 1QE1A 2O5DA 3M30B 4ANEA 1TUVA 3Q8QB 2R7WA 4ZP9A 4B3OB 4YHHJ 1Q8IA 3Q89A 2EFGA 2J9CA 2XSFA 2QV6A 3DMJB 3I9ZA 3M2RA 4I7FA 1T0TV 1VGYA 2M4MA 4I1TA 3TJAA 1TV6B 4DDFA 4Q45A 3D6TB 2K2PA 4OYOA 3HT0A 2ALYB 1TFYA 3HK2A 2WB4A 3AJ2A 3O1LA 1RWKB 3K5OA 2EXUA 4P74A 3OXLA 3OL7A 4LRCA 1VISA 1V3RA 4GKJF 4DR6J 4A48A 1QTNB 1XQIA 2XMTA 4ZVTB 5DM7Q 1TP7A 5DG9A 1S6PA 1ZPVA 3CCJS 3I82A 3ZZPA 1FJEB 1MNEA 4ELTA 1XERA 4V19X 3BR8A 1WTBA 2EKYA 1N5SA 3RZAA 3WIVA 3NAHA 1VQLS 1U8SA 4LFAJ 3DN9A 3PM9A 4TLRA 1RISA 5KTQA 4GVLA 3AAWB 3OLAA 1SJ3P 4LF8J 4AFFA 1RT1A 3DC2A 2YVSA 1PJ6A 3KG4A 4LSNA 5KOXA 4U8YA 3J7YI 4HT5A 4DV3J 3N4WA 4LSLA 1S10A 1V3ZA 2DVIA 4LF6F 4ZVUB 5L39A 4K50A 2OMOA 3THVA 2B4OA 4M5DA 4ZDNA 3T19A 3SZ2A 2HHQA 3AOBA 3MM5A 4RUAA 4DV1F 1KN6A 2E7VA 4B3TJ 1YLXA 1IKVA 3GE9A 4KGZB 3OTOF 3HSZA 1HBMB 4ZA1A 2R7VA 1HWUA 2J5AA 4HHJA 5KG7A 2I8EA 1Y4ZB 4X2BA 2BOAA 2LCWA 2FLPA 1RT7B 3Q24A 1M0SA 2OPSB 5K9FA 3Q2TC 2W7AA 1RT5B 4FYWB 5B0CA 1CJVB 2HVHA 5CYQA 4A47A 4Z7YA 4RUCA 4YOEA 2BE2A 2ZD1A 4F3MA 1FKPB 2QTWA 4HH0A 5L46A 3H5UA 1HPZA 1RBOB 4YR2A 1YKWA 3DRSA 1FD2A 3Q83A 1GXUA 4OMFG 5D0RA 3CC7S 3MPVA 4UY85 4CNYA 2MKSA 3GZ7A 1JLAB 1K47A 3ZTOA 3KHLA 4EYHB 2JX2A 2BW2A 3IS9A 1UEKA 4FZVA 4J91A 1IBKJ 3KG0A 3O6QA 3HD2A 4Y0FA 4JI0F 4ANCA 4NYOA 5CD4H 4ED0A 2HBQB 2QE5A 2B4VA 3FFIA 2QZ8A 3DLKB 5HSPA 4ZVEA 4DS4A 5E5NA 4DUYF 2CPHA 4PCQA 1SKUB 4WTYA 5KFXA 1S49A 4CT8A 3M6UA 1R31A 3LP2A 3OFFA 3JSMA 1DRZA 1CEZA 2YPZA 4ETXA 3RR8A 5B0BA 2CPYA 4WU2A 1RT6B 2CDRB 1T11A 4PQAA 3G6XA 5M2PA 3RBEA 5E3QA 1U0HA 2E5LJ 4AL5A 4MK9A 5DRKA 2B4PA 2LP4A 3IP0A 5KFZA 1FKAF 1Y10A 2VBXA 1OSDA 3R5DA 2YKAA 4YY3J 1R0AA 4R5PB 2M70A 2QYCA 1NNDA 1Q95G 4G6VB 4ZPTR 1YVFA 4E2FB 3MOZA 4G3IA 4WXOA 9ATCB 1HMVA 2CNKB 1RWXB 1S97A 3W61A 2WZ1A 4YB1P 1SIWB 4OV1A 1EX8A 1WORA 1IVZA 5J1PA 4KC5A 3NNAA 1ZM9A 3A8JA 2WAQD 3A3OB 2HBRB 2VOOA 1U25A 4NI2B 1M1GA 1IWAA 5KFDA 4QWBA 2EG1A 3CJ3A 2HGNA 3FCHA 3R7BB 4TQRA 4MMOA 2QSWA 2DH8A 1U1RA 1L3KA 2AJFE 3T1YF 3DLGA 4DV0F 4KSEB 4E0DA 1YJ9S 2UUCJ 2DO4A 4YB5A 1ZM2A 4K0KF 4M5GA 1NXIA 3QRRA 4E98A 2RH3A 2WVEA 4AT1B 3KLHB 2FY8A 1UFLA 4Q2MA 2YH1A 4NCAA 5SZTA 2BJ9A 2WRMA 2DNYA 3AOCA 1N5VA 4UT4A 4DL6A 5D4LA 4CTAB 4B9MA 1YGYA 3KHRA 4PG8A 3M9OB 4USUA 5DETA 2QSFA 4RU9A 2H9ZA 3H0PA 3IBWA 1IN0A 4UZCA 5K14A 8AT1B 3V4IB 5HLFB 1VQMS 4KV8A 3K5PA 1B99A 2BR0A 4O3SA 2ALZA 1LWEB 1IBLJ 3FZBA 4A4JA 1IKYA 2PA8D 1TUWA 2FQQB 3GPAA 3QPIA 3BSCA 1HNZF 1RWPB 4FF2A 1T05B 2E9RX 4XO0A 1HBUA 2X3GA 3AJDA 4QQBA 3SSSA 3I4PA 4TLQA 2VDHA 2KYZA 1FNMA 2XI2A 2MKJA 2VC0A 2DH9A 3BKUA 3TA0A 2IRXA 4OJ3A 1TL1B 5EWEA 2VB6A 3W7BA 3TI0A 3D2WA 3IR7B 3FGVA 4P10A 3WHIA 5CYQB 4Y2CA 3MEGB 1BD6A 1FXRA 2QMWA 3JS9A 1MMDA 3IO1A 3LGHA 4AL7A 2HFUA 4NLDA 5HK4A 3C6TB 2JOQA 3X3UA 2QJ3A 1VRUB 4YS2A 5F9NA 3EX7B 4ED2A 2VHGA 5J2MB 1FWLA 3AXKA 2D1CA 3FC9A 2FC9A 3MHYA 3QIPA 4NRTA 1M1HA 4MYTA 5T7LB 1HBMA 1M5VC 1VQ4S 4F4AA 2MLZA 3EZ5A 3MOJB 3KYLA 1RAHB 3K2YA 3WX8A 1UFWA 2OD4A 2P9CA 1U2FA 3SV4A 2GJ2A 1KOOA 2BMBA 4QYZK 2W1BA 3FCWA 1EZZB 2QIFA 3B54A 5I3QA 1RQ0A 1S6QB 3OSNA 2HQIA 3A4TA 4GVBB 2G0IA 5C2CA 1AFIA 1X5SA 1Q82T 4C98A 4X4UA 3VQSA 2HQDA 2OPQB 2V0NA 2W2PP 3E3XA 4DFPA 1RKJA 4QPXA 4Q43A 1N6QB 1GX5A 2JFDA 4QIGA 3HCXA 3ILIA 4LRAA 2CZ4A 3QYYA 4KR0B 4KH0B 3BGOP 2MY7A 2L3MA 1S6OA 3N6MA 1PC5A 1WOSA 3G9CA 1UP1A 3GCXP 3ILOA 1C4CA 6FDRA 1TKTB 4I6AA 2YKNA 4PQUB 4WE1A 3UNYA 1NDPA 2HWHA 2RILA 2GAGC 1S1VA 1FNOA 2WCXA 3A1YG 4JI8F 2XO6A 3I0RB 4DUTA 5AE3A 2ZBIA 3QNWB 2HBYB 2DT9A 1YJ7A 2KG0A 3PHTA 3ZNJ1 5HQMA 3H5YA 2ZH8A 4IFVA 1LNQA 2LFVA 3D1QA 3H42A 2E1AA 4OL8A 4KY3A 4RW7A 4ZN1A 2AWZA 5KFTA 3TNVA 2ZH2A 3DMJA 5F41A 5GAGU 2VIHA 1URNA 1MLAA 3DLEB 1NLKL 4LRDA 3OSPA 3CVKA 3TRGA 3J81Y 1HBOA 1NSAA 2GIFA 5CCLA 1OY8A 3ET6A 5IOLA 2VODA 1ICEB 3OXFA 2IAJA 3CMQA 2P9GA 3D3BJ 3AD9C 3MCMA 3FCVA 5C42A 3H4DA 4B08A 5DZ7A 1RWVB 1GXLA 3CCMS 1IBMJ 1VS3A 2DTJA 4KIAA 1BY9A 5AJ3J 4E8UA 2X1AA 2ZDOA 4EWTA 3QIDA 1OY9A 4L3KA 9RUBA 3MAQA 5AT1B 3GV5B 4DL2A 5IS2A 2DBBA 1UA1A 3W5YA 1F2GA 4J9VA 2J7UA 3C19A 4ELVA 4RR5A 1ZZFA 3MUMP 3SI8A 3MWBA 1W2IA 2C2EA 4PG4A 1R27B 4CI0B 4X65J 3HHDA 2ZZNA 4PKDB 2XMVA 3NAIA 4X4SA 5I3UA 4QIFA 5KFHA 2CFXA 1Y5NB 4A8SA 4DL4A 3HMJG 1IJFB 2FVCA 2LU1A 3QGGA 3QLHA 2FHJA 4L74A 3QZ7A 2G1DA 2EKNA 2EFPA 4QW8A 1AROP 5AE1A 2XO7A 3KJNB 4F4ZA 4CYUA 5F9LA 3NRBA 4B3MJ 1WC1A 4S0MA 5IT9Y 3D7SB 2R2RA 4TNOA 2HURA 1EJ7L 4C11B 2GV1A 3W2WB 4DV4J 1D8YA 4NZ7A 5HLFA 4NLVA 1NK6A 2W24A 4O3RA 1G3OA 1N5QA 1HHSA 1Y3JA 4LF2A 2PIIA 1RWUA 1K8AT 1SKSA 2NLWA 5F8HA 2UXCF 1VRTB 2O3DA 2QA4G 5CZXA 4JV0A 2UUBJ 5DM6Q 4YUDA 2Y9HA 3TJ9A 6AT1B 2HHVA 3HX9A 3OR1A 1YITS 1IKWB 3M1VA 5DJBA 1BQMA 1RHUB 1EP4A 1NSPA 4ID8A 4MIWA 3QO9A 1S6UA 3CEDA 4KBIA 4LSNB 2KT2A 1QAJA 1YBAA 3TVZA 1N34F 4IRDA 1XN9A 2AYMA 4DR2F 2HHXA 2A1BA 2GCFA 3NS5A 2HG4A 2F8EX 1F9EB 5A6PA 2KDOA 3AQOA 4DMZA 1WEZA 5KFEA 4B3RF 3FFIB 2CXEA 2IPOB 4LF4J 1S6PB 2EG2A 2I5JB 1KKHA 2OSRA 3TARA 2DGUA 3ZXWA 2DHAA 1T9YA 4HHUA 2EC2A 5LMNJ 4I6YA 2VPXB 2VUGA 4CLPA 2H5IB 3L4BC 1FX2A 1QSYA 2CAJA 1HW8A 1XMOJ 4DV6J 3PDNA 1MU2A 2PEHA 4WYLA 1Q8BA 1KVIA 3RAQA 2UXDJ 3NCPA 4A8XA 1PBAA 2PC6A 2V8PA 3CIZA 3GU0A 3LGMA 4KE5A 2VQEF 3CB4A 4NA2A 2VD3A 3SQGA 2APOA 3HP6A 2FVRA 1T9XA 5KT6A 1FVQA 3GR1A 8ATCB 3H59A 3RAXA 2UVUA 2D69A 4RNMA 1UVIA 3A13A 3OW2R 1RU1A 5KFAA 3AA8A 3MMBB 3CJKA 3M6VA 3EVMA 1SQGA 3H7HB 4K4YA 4RWXA 4W98A 4RBVA 2WVBA 3VZIA 3AOAA 3R6GB 1SV5B 4KGMA 3KK2B 2JEIA 2XNRA 2H54B 3DU6A 2EI5A 3IS9B 1CLFA 1LK5A 2IC3B 4BHQA 3F41A 5ETOA 1JLBA 3D28A 4ZS6A 4ZLPA 1U0SA 4UQGA 2XLIA 2MZJA 5DZ6A 1SC3B 5HBMB 5DG7A 2IJNA 2VQEJ 3BO3A 4KGVB 4HVZA 2GJFA 2W2MP 4ECQA 3NEKA 3UO0A 4DL0C 1I1GA 4B9SA 2NYHA 4KO0A 1NHVA 2OEJA 3NWGA 2BE2B 2ZD1B 3PXGa 2VV5A 1F5BA 2MTLA 2QRRA 3BH7B 1EAYC 3DCAA 3OTCA 1FE0A 2F4VJ 2YKOA 2DYAA 1A0OB 1S1XB 3HLUA 3W9IA 1NHUA 5LSRA 3UN5A 2DXEA 1KVJA 2I38A 1SIZA 3CJSA 3OD2A 1YK9A 4PG6A 4J90A 1KRPA 4NRUA 3KUHA 2RQMA 1U6FA 3SSQA 1DZ5A 2M0GB 4LQ9A 3DM2A 3T1HJ 2HHUA 1YSJA 4NX9A 4JI0J 2CWXA 2D3UA 3LO3A 4FF3A 2MZSA 1YJRA 2RF2B 3DRRA 1XIQA 2R8GA 1UEVA 3RB6A 3R27A 3PKMA 4ZVQB 4ZPCA 4WFNQ 4J9PA 2DR7A 3MCSA 4NMLA 2E5JA 4OHZA 3G6ES 3ADAC 1VBYA 3EM1A 2OFHX 2X1BA 4WP9A 4XDDA 3MAHA 3MECA 3B78A 3FNNA 5K8NA 1U47A 2U1AA 2YNIA 1BHNA 1CG2A 3LH2S 1NHKL 2MQQA 2AU0A 1HQUA 2HHSA 4TQSA 2BRLA 5ETKA 5F8LA 5B08A 4TU7A 2NPFA 5LXRA 4Q8FA 4ZVSB 4FF4A 1P1LA 4DQPA 3ZNUA 5LJ5Y 3A3PB 3D68A 5I4MA 2H5JB 3B4MA 4AUKA 1U8WA 5BJRA 1FDDA 3EDQB 2Y0BB 1WF1A 1S9EA 1YWXA 2CJAA 2HWIA 5CABA 4RUHA 2AGOA 1VBZA 3UDVA 4GKKJ 4RW4B 5RUBA 2CUYA 5CQGA 1AW0A 2ROEA 2HFOA 3C6TA 1VRQC 2JVOA 1R0AB 2XZTB 2XY7A 2VA2A 2EPIA 4FXVA 4MKAA 5E0OA 1NPKA 3KK3A 3MMAB 2FVSA 3C6UA 2N4DA 1FX4A 3OR1B 2GHPA 4X4PA 4ECVA 2MKCA 1MWZA 2Z0GA 3OXGA 3VV2B 3DLHA 2DRBA 3PX6A 1WNEA 3M8ZA 1UTAA 4TKTA 3LGNA 1RWNB 2R7OA 5JUMA 4IO9Q 2LXIA 1WC6A 4OIXA 3TO8A 2KXFA 4F8RA 1HD1A 4DUYJ 1YJWS 2VC1A 3MCOA 2I0XA 1U6ZA 2M88A 3BV8A 4URQU 5KFMA 4A8OA 2ZOFA 4Y2IA 3DLKA 4F25A 1NB2A 1PC4A 5LL6d 1HQEA 3NGTA 4ZPBA 4ZHRB 5L9NA 1HW9A 2DIUA 4ZVGA 4WKRA 2J9EA 5G4DA 1FJ7A 3U27A 2ATCB 1VLYA 3QJLA 3GV8B 7AT1B 1WKJA 3I31A 4CLTA 1GEHA 3R2DJ 2WTFA 2RQCA 3VGVA 2CZ9A 4FYYB 4FKYA 4QOTA 1ZH5A 2R7TA 1MG7A 3BGRB 3MAAB 3HI9A 3TR5A 5T41A 1N5YA 4F4KA 1TL7B 1RTDA 3BN7A 2V4QA 4IOAQ 2W9CA 5B0FA 5F8IA 1UL3A 5D3GB 1X7VA 4K5RA 1GTHA 2PT0A 4I2QB 2HGMA 4DCPB 2E9ZA 2OPSA 4N76A 3LANA 2KN4A 2YXLA 1U49A 4C8OA 2PFDA 3O8WA 3GYGA 1V9OA 4M5IA 1DLOA 1T03B 2LYVA 5F8JA 3S01A 4K4VA 3U1MA 3KLVA 3P96A 4ZPAA 1XEZA 4U96A 2HFNA 2KYXA 4FXWA 1Q7YT 1NDLA 1RAJA 5HQLA 1P9YA 2F40A 3D0GE 3ZC4A 1KHVA 4CH7A 5IV4A 4JI3J 1EP4B 3ENVA 3Q86A 1FRKA 2EVZA 3O2IA 1P1TA 1S79A 2PMHA 2CQGA 2YKMA 1SJ1A 3M2UB 4KFBB 4NLTA 4C48A 1NH7A 3DGPA 2EC0A 1YRUA 5ETVA 3UD5A 3KLGA 3E01A 2C42A 3W9HA 5HMZA 2W4CA 4CLFA 4ELUA 4DV2F 3HKWA 2BANB 2V8VA 3FUYA 2VPYB 2B8QA 2OAUA 2VBWA 2FYXA 3H4BA 4P2MA 5CD4A 1HMVB 3E2EA 2VG7B 3FEZA 4BS2A 4EO8A 3PEJA 4QU6A 2VJUA 1RT3B 2XYHB 4DZDA 4OX9J 2W4DA 2MEWA 4LRFA 1FXLA 1F0XA 4C3LA 1FDBA 2WK4A 4P75A 1NJXA 2RDIA 1NJWA 2R8JA 3CDBA 2IVFB 4P7VA 4WKYA 4DL3A 5D8HB 1VQ5S 1R8CA 3MFIA 5LSLA 5DDRC 4DLEA 2DO0A 3FZ2A 3QT5A 5H1SV 3OL8A 2ZH9A 4B3OA 4FS2A 2ADBA 2LQ9A 4G1IA 4ZVPB 3T6JA 2QN6B 1Q7LB 1WSVA 4GO7X 2RU9A 1H2UX 5D0GA 5GAHI 2DHHA 1K1QA 3RW6A 4P2XA 5ETMA 5KFUA 1UJ5A 1U45A 3QQCD 2RMLA 1FK9B 1RJJA 2CQIA 5DDPC 3QWUA 5KFOA 3CCWA 2RUGA 2YPYA 1FRLA 4UOHA 1N32F 2PDAA 1KQGB 2LECA 1QSSA 4OYPA 5KFNA 1JX4A 4OJHA 4IRCA 2NZ4A 3V5RA 3HKZD 3HHEA 3JSBA 2VF3A 2GGPB 3MR7A 2CVIA 2GVDB 4JUZA 1C0UA 3PO5A 3IN5A 1H72C 3CNQP 1EB0A 1T9UA 1WTFA 3P3DA 4OX8A 1REGX 1HNXJ 3HHLB 3CJ0A 4HHHA 3VCDA 1FKOB 2HK3A 5ETLA 1RT7A 4F3QA 2OJ3A 4F3OA 3Q8VA 4ETZA 4GKKF 3IR5B 2DNQA 2VG5A 1CULB 1WHYA 2RSQA 4WE1B 2BKPA 2A3JA 3FSIA 2B9WA 1GT8A 2BQRA 2DCLA 4DEZA 2G2YA 1R6YA 1Z2ZA 1N54B 3OFEA 1B7YB 1YJNS 4QIWD 1IXKA 2AZ3A 2DGQA 2DEJA 2DGVA 2H1YA 4TY9A 4AL6A 1UPPA 1RB0A 2N4CA 3GWCA 2KI2A 3Q8RB 2F4VF 1FO1A 1VQSA 3C46A 3TZYA 1VFJA 3JXOA 3V2UC 1U1MA 2C3OA 2ZWPA 4RU2A 4FBUA 1S9GA 5C25A 2NXEA 3ISZA 2R2TA 2DHGA 3QT7A 4WU3A 4PWWA 4ZP8A 1WEYA 4DV6F 2DEIA 1WC5A 1QLNA 1RBAA 2HLTA 2XWYA 1L3UA 3GONA 1LWCA 2YWKA 1C1CB 3FBEA 1SL0A 4PEOA 1RAGB 1RSCA 2B4UA 2DCUB 3CTRA 3GFHA 4M1KA 3GIMA 4H4KC 4MKBA 2R7RA 1N34J 5KOWA 2KM8B 4MYUA 2ZBQA 2CJYB 2F65A 1LOUA 2DHXA 2W4PA 1C1CA 1HBNA 3BN4A 3G4SS 4NXNF 3J81U 3FBBA 3QT8A 3H8YA 3DFEA 5DGBA 2HNYA 3NLCA 3TYTA 3HZGA 4CLYA 5EX0A 4JI2F 1ZZNA 4IR1A 4U95A 1NZAA 2Z56B 1M1KT 3M2RB 4I7FB 2CKWA 2UZAA 5HJYA 2UXBF 4CLUA 1FDAA 2HVIA 3M2UA 1ULRA 3M9NB 1OYDA 1HNWJ 2MQNA 1QE1B 4HDGA 2GO8A 5CXTA 3A8KA 1HNIB 2DPIA 2NUUG 2HZVA 2JHEA 1J27A 1FRXA 2MJNA 4NLUA 4DQQA 3RBDA 5LMUF 3SFUA 3TW0A 1PGZA 4NXNJ 3D9BA 3JAMU 3UQSA 4ZVOB 1Q53A 3DM2B 1T94A 1X5OA 2ZFHA 5AXKA 2MQPA 2V4RA 1QM9A 1RKIA 2PMWA 4N8NA 2YKPA 4C11A 3CD0A 2A2CA 2ZH5A 3V6DA 4DSJA 1LEOA 3CULA 1CJUB 1VC5A 1LXJA 1SC4B 3JQMA 3HO1A 3MEGA 3CCRS 1N4LA 1NSKL 4Z2XA 2R8IA 2CG8A 4B3MF 3LPEA 1B4SA 1E6VB 3GCWP 3NXZA 3TANA 3GV7B 1FF2A 1O0PA 1X4FA 5F3TA 3J81j 2HMIA 3RB3A 5KFWA 1DHMA 5KG5A 2QLXA 5DQGA 3OVSA 4MK8A 3J7YU 2DGOA 4IG3A 4NLPA 4NYZA 3FRZA 1GAOA 1F2HA 3ZTPA 3H90A 1HYSA 1FFSB 1S0OA 3MM9A 2VPZB 2IMWP 4OI0A 3C14B 4F04B 2ZNZA 3W1YC 1NO8A 4LVOP 3W5ZA 5E41A 1YTYA 3VAMA 2E5HA 2J0WA 4WFYA 1HLWA 3OL6A 4DFKA 4U7UD 2ZC4A 3NS6A 3J7Z5 4DR5F 5JVGQ 3IGVA 4UOCA 2ZHOA 3ZZTA 1IKVB 4RBUA 4W4MA 1R8HA 1NRKA 3C15B 1FDNA 4H4MA 4OZLA 4ANDA 5ETSA 1IWGA 3J80U 1K44A 4ES1A 3UI3A 2UP1A 3NNCA 1R43A 4WJBA 2Q3PA 4ENOA 3MEKA 2XC9A 2B51A 2J7WA 3EGNA 3T41A 2PEBA 4EK2A 3V6DB 2FD2A 1KSPA 2RRAA 1K9MT 5A0YB 3D66A 5A8KB 4PXEA 3DOKB 5KG0A 4JI1J 3MM6A 2HRTA 3EICA 3I0RA 4FNHA 3GIIA 2MZ1A 2YX4A 1TVRB 3K59A 1HBNB 5H9FJ 4YR0A 2KO1A 4ECYA 2FGOA 2OPRB 1Q81T 2HQ3A 3OFHA 3QGHA 4MKVA 2M3DA 4IOBA 4NE9C 2LXFA 3MM6B 4DS5A 2GQCA 1VC6A 4ZCKA 1TAUA 2BKNA 2V8GA 3M32B 3QFWA 2ZH6A 2KVQE 3CDUA 4P7TA 3UNGC 2QFJA 2UV8G 4LF5F 4ERDA 2M9KA 3QO9B 4HLBA 1FVSA 2RKIB 5KFQA 3JQKA 2AYGA 2DNRA 3BDPA 2IMOA 4J5OA 2XY6A 1JB0C 3LAKA 4DHVA 1XC9A 1AB8A 1SC1B 4J9SA 1RCXB 1YI2S 3MECB 1FJCA 1OJ4A 3VAIA 3X1LB 2J0SD 3JSMB 1PKUA 1J5OA 5IQQA 3M30A 4RW4A 4FS1A 3MMJA 5L1LA 4LUBA 2D3OR 4OYZA 4DR5J 1QTMA 2DNNA 1C1BA 3UFCX 3NBPA 4DPUA 2AJ2A 1QY7A 3KNAA 2CA9A 3I55S 3FDSA 1OS5A 4R0EA 3FRYA 1E6YA 4ID5B 2E9TA 2MGZB 3LW5C 1XNRJ 5A8WA 4GC7A 4C8KA 1EQ0A 1R3NA 1TKZA 3UR3C 4EGLA 4J37A 1EKRA 1X4AA 3M8PA 4LVNP 2Z58B 4X4QA 1M90T 1UVNA 1NKBA 1OY6A 2HFZA 2DHSA 2A0FB 2HMIB 4PYDA 1N36J 3RRHA 1Y7PA 2XZDB 4LIRA 1WD6A 3G82B 5KFVA 4CLSA 1AA1B 3DXBA 2LMIA 4RUBA 4F67A 3GILA 3K0JA 1KVKA 4HEA9 3OUYA 3U02A 5F8NA 4A8YA 1H73A 4RBTA 5HN0A 3BPSP 4CLZA 3W2VB 2IDLA 1RK8A 3I87A 4NCGA 4ES2A 4D3HA 2R8HA 2LA4A 1HIYA 1R0BG 2FZCB 2LQJA 2OPPA 1FT8A 3QWPA 4CWBA 3RYLA 3MR6A 4LFCF 4FP9A 4MH8A 4G65A 4NLYA 4BC9A 3KJVA 4PWDB 1X8DA 4C2MA 2J6UA 5IZHA 4NLRA 4USJC 4RKUC 2IDEA 2BDPA 2KJVA 3HHLA 1HNVA 3OUYB 4MK7A 1HNWF 1X31C 4ZKAA 3OHAA 3OJSA 3DOLA 2E7WA 3KMSA 2B9YA 2GGPA 2ZOMA 4UUXA 4CO4A 1KQKA 1SUQB 2HEKA 4O44B 1NB7A 4DLGA 3QFHA 2G0JA 2CZVC 3DLJA 1UCNA 2V2KA 2DH7A 3ZO7A 4BBYA 4F36A 2J0XA 5KFBA 4TY8A 2WSCC 1DJ0A 1OPZA 2V5HG 2PO4A 2CNOB 5IC6B 3UDCA 2DK2A 3LWLA 4F4YA 4KHPF 3HPOA 5DGAA 2IM0A 2W7PA 3M2VA 2HNDA 3O5TB 3PTWA 2R2UA 4WFXA 4N77A 5HP1A 2CDQA 2IYGA 3SQGB 1HI8A 4V19J 4DG1B 2GHVC 3OVBA 2RQKA 1CQNA 1SI9A 2BJ7A 2VFRA 3H2VE 3QATA 1VR6A 3N01A 3PRBA 4PZVA 4WK1A 3R1LA 2NR0A 1HKAA 3HVWA 2HGLA 3DOLB 1RZMA 4OZ2A 4G1QA 1VOMA 4KT0C 1YG0A 5CYMA 2ASLA 1JLFB 1AFJA 2R7UA 1HNVB 2QLFB 1IM6A 1D0EA 4FBTA 3BF4A 3FKBA 1RT3A 3PRVA 1PILA 4UOFA 4NASA 4WXWA 4DL7A 1YBUA 1K73T 3CCTA 1HNZJ 3H25A 5K8MA 3QAUA 4OLPA 4OHVA 5KT4A 3HJVA 4GKJJ 4CRJA 1FERA 1TK8A 4PQUA 3HHLC 1VQKS 1I94F 3LUYA 2D74B 2Z2MA 4K7QA 2BJ1A 4QR2A 3LWMA 3R3TA 1FI4A 1T3OA 3N79A 4JV5F 1REVB 4L73A 4WWSA 1YDLA 2B7CB 2CQ4A 2MKKA 1JLAA 1R8BA 3MEDB 2O1PA 1VQPS 3M1VB 3CD6S 4KFBA 1IKXB 3D67A 4OZJA 3SDEB 2LLZA 1TL1A 4O4GB 1GH8A 1RAFB 4BWJA 5FD1A 1S0NA 2EWHA 3BBBA 4I4BA 4A8MP 4BC7A 2UUWA 3EXCX 2Q6CA 3G8QA 4DR7J 1FRHA 4DPXA 1T05A 1IBLF 1ROFA 2MHEA 3GMGA 2EFNA 4JV1A 2HS0A 2E66A 1A6LA 3AFGA 4RNHA 3EPGA 1S76D 4OYXA 3KLFB 4I56A 1U1NA 5E3PA 1OMSA 2VBZA 1B0PA 4AXIA 2PMZD 5L9XA 5CAAA 3L7PA 1RE1B 4CH0S 3MR5A 5E3CA 3JTNA 1VJQA 2XYPB 3I96A 3M6XA 2ZNYA 4FF1A 1Q79A 2C2OB 3SXLA 5KT3A 2Z2LA 1BE4A 4DR3J 4ER8A 1LKZA 1WG4A 3MD3A 2YNHA 3KFWX 5FLXU 1KNZA 1E6VA 2AX0A 3D6MB 4LBHA 3B6BA 5E3RA 2GQ2A 4HL9A 3IMQJ 4ZVRB 1P8GA 2MLXA 1BWVA 3SIPB 2VOPA 3R6LB 4M8LA 3LOUA 1HWJA 3MPYA 5GMKa 1YJVA 4IG0B 4ZN3A 1ZETA 4TVAB 1EARA 2QLBB 2HZAA 3GFZA 4Y34A 4DPTA 3T5HA 4CDIA 2NREA 2F1FA 2J9DE 4A8FA 5DQIA 4ZCMA 3OQ2A 1BQNB 1HHQA 4Q44A 4JI7F 4D3GA 2ZVIA 3A8EA 3FMWA 1HNIA 1VCTA 3Q8PB 1SJRA 4DL5A 1BLUA 4NZ6A 2HIYA 2QFIA 3IWXA 2DY1A 1QAXA 4OHXA 2LU2A 4QYRA 1D3WA 1ZM3A 2WHOA 2XMJA 4G1QB 3JYTA 4M95A 2BE9B 2F9DA 3N28A 3W62A 2BEFA 1I5OB 1DY3A 2NZCA 1SVDA 2KFZA 2CJQA 2YNGB 4X62F 2KFNA 3M8SA 3HF5A 2QL7B 1VRTA 1U26A 5KT2A 5BR8J 3H5SA 4UUWA 1BQXA 3RGIA 4M5HA 5D6GA 1RAIB 5KG2A 4RJVA 4EBEA 4LF4F 4ZIVA 1TKTA 4KJIA 3QRPA 1G2EA 3AB2B 2JJ4D 3DDNA 2V34A 2KVIA 1WUUA 4C9DA 1RT4B 2LKZA 3ISNC 4YP3A 5H9EJ 4AQYF 3MTJA 1FEHA 1VI7A 3PW2A 3R5BA 1EQMA 3MZIA 2KTQA 4PWUA 4OI6A 4MTPA 2UXBJ 2CJ9A 3PO4A 3QLHB 5ETTA 2YWHA 3MURP 3Q0AA 4MFBB 4B3SF 1TU0B 2VKRA 1FCAA 1VQ7S 4DN9A 5LMNF 1OO0B 4IDKA 1TTHB 3BQ2A 3IRWP 2K1RB 4RO0A 4R8UA 1LK7A 4YEAA 4MFBA 1DTTA 2UUBF 2MY8A 2X7IA 2BQ3A 3K89A 3BEGB 3M8PB 4PR6A 1N88A 2B0GA 1SH0A 4ITSA 4USTA 3FBFA 3P5BP 2EW9A 4CLWA 5EDWA 3QSYB 1VQOS 1U48A 2KJWA 4I2PB 4EO6A 3KK2A 3BSAA 2CJBA 4OI2A 5T7LA 4KV8B 4Q5VA 3CCES 1X9MA 2DR8A 3KLIB 2XWXA 3SCKE 1JLQB 4PG5A 4WK3A 3ZZRA 4DQIA 1UA0A 2XYGB 2VQFF 2EK6A 1UEUA 2JRSA 2KRRA 4EZ9A 1NPPA 1ZS6A 5L38A 5H9EK 4RW6B 2FVQA 4DV0J 4YY3F 1KLMB 2OFGX 2VZ9A 2R8KA 2M52A 5IT0A 3LPYA 5HANA 4JI3F 2XGPA 1FFGB 3FEYB 2AJQA 3JYTB 5CHCB 3TOQA 2RKIA 4ZLLA 4C6AA 5J2QB 2I1RA 4O23A 5IWAF 4QPTA 1S9EB 1GFWB 2B5JA 1UVMA 4FYVB 3K5MA 5LM7E 1E6YB 1LFWA 4ID5A 2X3DA 3OVAA 1AUDA 3AXMA 5D78A 3C16A 3DRYA 2C2RA 2L9WA 4CM0A 1RGVA 4N5SA 5ETQA 3GIRA 3LA0A 3MMBA 4NPOA 1L3TA 1PYOB 1Y5LB 5EX3A 4C7QA 3O3LA 1SQFA 1DQ8A 1JLEA 5A0YA 4GRSA 2CYYA 1Y11A 4JBCA 2GNKA 2OKQA 2DIVA 3NGDA 3HHNB 3Q8UA 3TEHB 4GVBA 5L1JA 2DNMA 1U0HB 4DR1J 3QAEA 1XMBA 4DI6A 2GVZA 4OHWA 3O44A 3CCVS 4DR3F 2Z8QA 3HULA 1AZSA 2G2ZA 5KFPA 5FDLB 4YQWA 2HHHJ 2JEJA 4NI2A 4K2XA 3ENWA 3RBZA 2E1MC 3F44A 4Y00A 5J2PA 2DRDA 3TZWA 3PRDA 2MDAA 1JQGA 1M5HA 2LA6A 1R89A 4JV5J 3G2XA 1RT2B 3KJVB 4AE5A 1U1PA 2ZM6F 3KLEA 1SQEA 2OELA 3P4UB 4PPZA 1F9HA 1T7PA 3NP5A 1GQEA 1RA6A 3SFGA 2HRYA 4DSKA 4I0WA 4LF9F 3QSIA 5L8RC 2FGCA 1GTEA 3BGFA 3DGPB 4X66J 4LMZA 3TUPA 3SBMA 1TZ0A 1OQ6A 1N0UA 4FVMA 3F73A 3R7SB 3ZTRA 3TZZA 2AMCB 2UVVA 2OEMA 2CQ0A 3MAAA 4RX6A 3EGVA 4LBPA 4ILLA 1N0VC 4LF6J 2BOPA 1UWBA 4KKOB 2CPIA 2DGXA 4PYAA 1Q0NA 3EZUA 1FHTA 2D9OA 3IG1B 3HVTA 4KTQA 4O3PA 2AX1A 1H98A 5K14B 1R0CB 4J9OA 3V4IA 1B70B 1WHXA 4WFZA 2ROPA 1RT2A 1YHQS 2N7CA 2WONA 2EK1A 4XPCA 4F0MA 4Y3CA 1H74A 3HFVA 4RW9B 3SYZA 2ZWOA 4USMA 1VK3A 3OL9A 4PAAA 5DS7A 2CJKA 2VFSA 2W9AA 3A3NB 4O3OA 4A8KA 1S99A 2XS5A 2CPDA 2C1EB 4P9SA 4DFMA 2WSEC 1SJQA 2MSSA 3SDEA 1I94J 1I51B 1UWAA 3QZ8A 2KU7A 2NSBA 3MUVP 3KHGA 3DLGB 4ECUA 3CCLS 4LF5J 3PFOA 2AGQA 1BUXA 4ED7A 4ZPWR 4OYBA 3UW1A 2XMMA 1TKXA 2M8HA 5THWA 1NK7A 2V4JB 3N0VA 2XSJA 1L3SA 1M5PC 3V81A 1O51A 4B9NA 4ILMA 3PJXA 1IR1A 4M63A 2VG7A 2YX7A 3PJ9A 4DQRA 1XNRF 2MJUA 1HQEB 1H0HB 1R6VA 2MXYA 1UZHA 4CLLA 3L95X 2DGSA 1TVRA 1WOPA 2IVMA 2R4FA 1B7FA 1TMMA 5AXMA 1VDHA 3JB9k 3UWTA 2HAIA 4CLKA 1IBMF 1NDCA 3KJFB 3KTQA 3A12A 2V8HA 4LFCJ 4URGA 1HBOB 2QT7A 1RAAB 3PKYA 4HH1A 5ETNA 2BJEA 5C2GA 2FIUA 2Q43A 5KG1A 3PJWA 1YBTA 3T9NA 4DU7A 4QWEA 1S77D 2ZUGA 2GHWA 3IM9A 2RQ4A 2YH0A 3CO0P 2QL9B 4JI2J 3HHLD 2ATLA 3NCQA 1RLDA 4CO5A 2HS3A 3CT9A 2L9DA 5KFIA 3HT3A 1SBRA 4B9VA 1UJ6A 3FBCA 4C3KA 2JC0A 1VJWA 1X4CA 5A2QU 1N52B 3PZPA 1OYEA 4M5NA 2YNFA 3SCLE 3D1OA 4KAIA 2Z2ZA 1T03A 4EFAC 2KXHA 1X9WA 1XR7A 3LAMA 3H40A 1CVJA 4PWDA 1RHMB 3AQPA 5KFGA 1SJFA 2OUGA 4KRWA 1HYSB 1X4BA 3PNIA 1GXTA 3ILJA 3HXMA 4ED1A 3BBCA 3G96A 1O8BA 2A6MA 1FTRA 4WBFA 2CPJA 2RJZA 3OTBA 3MM7B 4L76A 2PD1A 1MMLA 5AXNA 3WBZA 2LEAA 1NK4A 2DISA 2AP6A 3CDEA 3UDLA 3UCGA 4DPWA 3IC1A 3CMAS 2CJXB 4OZNA 1WKLA 3THTA 2ZVSA 4LR9A 1FJGF 1EHWA 2BA9A 3TA2A 4W90B 1JLBB 1T9TA 1ZAWA 2ILZA 4EBCA 4PG7A 5KT5A 2XQCA 1S1TA 3W8GA 1BGXT 2D7SA 2R2SA 3KLIA 5LSOA 3VAGA 4DV5F 1JLGB 3GSIA 4H4OA 2DNZA 4RNFA 2J8SA 4LRBA 2F63A 3FQLA 3N5FA 1J5EF 1S1TB 3IFEA 4ZLNA 5DO2A 3HVTB 3K8VA 1WSRA 5KFRA 2LDYA 3PW5A 4M5LA 3CO9A 4DJBA 2ZJPQ 2Z2YB 2UUAF 3DDIA 3C3LA 1VLOA 4PXCA 1RAEB 2AW0A 2XMUA 3OTDA 1UZDA 3VHQA 3D0IE 4UTGA 2J0QD 3BO2A 1K0TA 3MM7A 1FRIA 1FRMA 3T5JA 1RBLA 1OIAA 1MU2B 3S7RA 4Q7AA 4DG1A 2KT5A 1IQTA 4IH5A 4XIUA 3L7OA 2ZM6J 1J2VA 1RA7A 3CC2S 2XHWA 4X66F 4W92B 1REVA 3M2VB 2G1HA 2KHDA 1PG5B 5HO4A 1H6KX 1FWKA 4ZVHA 1RWOB 2M7SA 2D3O1 2HZCA 2AJ0A 3RBXA 2EFQA 1ZAVA 1SC6A 4Y2KA 2GO9A 2RHQB 1Y9OA 3RRKA 3PG9A 3RU0A 2V6AA 4B02A 3PIPQ 2HHHF 2MZQA 3EDRB 3OTOJ 4F4WA 2MB0B 1YJTA 3KDNA 3D4JA 4DR1F 1VC0A 1KWMA 3I9V9 4OZ5A 5GAEI 4ZJOA 5HATA 4DN0A 4DSEA 2AEFA 2ZHBA 1EETB 1RABB 2OMLA 5I42B 1C4AA 3D3CJ 2JWNA 2KXNB 5GMDA 3GSDA 1T9WA 2ASJA 1L5UA 1RHRB 1NBEB 3WX4A 2BYCA 3K5LA 2FLLA 1YJUA 1ZOTA 2DITA 5HMYA 4QW9A 1IJEB 3TZXA 2MHNA 3ISND 3EMTA 1S48A 4KPCA 3WC2A 2KG1A 4HYKA 5KFFA 5D77A 1NK9A 3IWNC 1S1WB 1NPRA 3LQVA 4WZMA 3BR9A 3POTB 2BXJA 3CJRA 1K0VA 3GFYA 3ELHA 3EVWA 5JVHQ 1HR0J 2Y1JA 4OZ0A 4JI5F 3C16B 5F8GA 5IM0B 3L3CA 2ZBCA 3W2WA 4AYBD 5K8PA 4F50A 4DR6F 2MZRA 2JL9A 5ETPA 2RDJA 4K4XA 1JXLA 1MWYA 2ZH3A 5J2QA 2CQCA 4DFJA 2Y8WA 5HJXA 1TELA 2RRBA 3MF5A 2V68A 4TU8A 5HMWA 3RW7A 3M8RA 1HPZB 4USHA 1RTDB 5J2NA 2ZZMA 2YX1A 1ZYQA 1IBCB 2N82B 2EEYA 4B3SJ 3DU5A 3C15A 2MLYA 3IA0A 4K8RA 3HSGA 4F02A 4H54A 5FIIA 1DTQB 2IC3A 1Q5YA 3KDOA 3LP1A 2B9EA 1U1QA 4O0NA 1NDKA 5J1EB 2V63A 2WOMA 1WJ9A 3M7VA 3NS7B 2E1RA 5CH7B 3S8SA 4C8LA 5IT9U 1XMQJ 1KD1T 5LMUJ 1T9VA 1U7LA 1LQ9A 1WG5A 2QG9B 1DFDA 4CTAA 4C0HA 1DQ9A 1D8ZA 2GIRA 4NA1A 2HWTA 1S1WA 3KXDA 4K2JA 2HVDA 4Y65A 1LXNA 5EUHA 3U7JA 3W66A 1N33F 1NEEA 1HNXF 4OFZA 2WSFC 2PFFB 1LWFA 1H7WA 2DB1A 4JI6F 1JLFA 4XPEA 2GMLA 1EIYB 2FLNA 3GG0A 2MQMA 4ALZA 4NYPA 4C3MA 1TL3B 1NSQA 4C97A 3H2LA 2L41A 3KK3B 3UE2A 1V5IB 5I42A 1U4BA 2GZOA 3QBCA 3CJ4A 4LT6A 5D4NA 3NKYA 4RLEA 2RT3A 2FJAB 3A8IA 2Y1IA 4YB6A 1T8EA 1VIXA 1LFPA 4K4TA 1JJ2R 4U7UK 5A8WB 5HVGA 1RDRA 4X4OA 3DOMA 3K5NA 1GMWA 1X5PA 4DOZA 4IR9A 1P9QC 2K8GA 2EFOA 5HI7A 2YWGA 3VWSA 5C42B 1HA1A 4B9LA 3SV3A 2R3VA 4YR3A 4R5PA 3HJFA 1KDNA 4JP8A 3V4MA 1KEKA 2C3MA 3MM5B 1N48A 1IR2A 5I3PA 4K4ZA 3GTYX 2XNQA 4WTOB 3ENQA 1ZA2B 3ICLA 5HVFA 5DQHA 3QJJA 3TUJC 3VAJA 3FK4A 1N6QA 1G6BA 5C7PA 2X1FA 4Q8EA 5B0AA 2M2BA 5LJ3Y 3MMCA 1KLMA 4ILRA 1T02A 2CPEA 2G13A 1T3NA 1EETA 2COLA 1RAOA 1UFKA 3MTKA 3SCJE 2KH9A 2IM2A 2V69A 3GJQB 4DV7F 4WIQA 1HI0P 2UV8A 2HNDB 2HSEB 3M8QB 2H4YB 3NCRA 5K8OA 2K7JA 3LP0B 4C8NA 3R9LA 2I9SA 4Y6IA 1CSJA 3OT9A 2ZH1A 4HKQA 3OJUA 1XK8A 5LOQA 2Y3YA 5HL7Q 2FTRA 3J7A1 4NL5A 4HT7A 1ZTWA 1HQ2A 1OQ3A 1VMBA 1HWIA 2HVEA 2XSJB 3SEOA 4DU8A 2YKQA 4J9NA 1XJWB 3UD3P 5D3GA 1HHTP 2B8PA 5E2QA 2HVZA 5EN1A 2OD6A 3TQ1A 4URSA 3G71S 4I68A 4NEZA 4DWIA 1FTCA 3KWMA 1RYSA 4BCAA 5I3UB 3PR4A 2K3KA 2VPWB 1TFWA 2FJWA 1N32J 2YNHB 3T1YJ 3EWGA 1LWFB 4YHHF 2ADCA 1LW2A 2IIHA 3NG8A 5GAGI 4JYAJ 1DAXA 4NZ0A 3HFKA 4CNZA 2GS8A 2CQBA 2ZH7A 2J6TA 4WZQA 2E5GA 4ZP6A 2AHOB 2R7QA 4QR1A 4H4KA 2A10A 1MW7A 2YTCA 4OI1A 2UVRA 5GAEU 1GMUA 2HLUA 2A6OA 2QA2A 2IY5B 2XI3A 1ZTTA 1JJCB 2ACYA 3E8OA 3BJYA 2C2ZB 2EBEA 3CPWR 3DRPB 5J1EA 1NCLA 2LQ5A 3EPIA 4B3TF 3Q22A 1OWXA 3GIJA 3PHEA 4ZJLA 4C8MA 4PPDA 1TAQA 5HVHA 1DTTB 4KKOA 2VDIA 3FMBA 4QU7A 5B0EA 4IFYB 1S4EA 2JLEA 3BB5A 3DLEA 3ONQA 4AXJA 3T5LA 3W63A 1ZPWX 1Y5IB 3NGRA 1KONA 3KLHA 1IUJA 2P5VA 3MDFA 5L1KA 1LV5A 3VF0B 1ZAXA 2ZDPA 1FXDA 3H20A 2W2OP 5DLGA 3BDEA 2F8MA 1U1LA 2XBPA 3R5AA 4B17A 1F9FA 3MEDA 3RUBL 2PI4A 1F60B 1S7IA 2GC8A 3CD7A 5D4PA 2XMKA 4A46A 4DPYA 4C0BA 2IFXA 2KRBA 2RRNA 3BM7A 4UW2A 3TX0A 4O3QA 1RT4A 2NUHA 4LSZB 1J5EJ 4X4NA 4NXMJ 3GYXB 4UF4A 3AY0A 3SQOP 2OPRA 2RB7A 2VKZG 3LALA 2XULA 2F4FA 4X84A 4DV2J 5KG6A 2H65B 2JLFA 4WP8A 3M8WA 3IM8A 4ICLB 3TUIC 2HRUA 4NCBA 4LFBF 1PCAA 1RWMB 2KB2A 2NXJA 3B82A 1JK9B 3JTOA 5A8RB 4I6WA 2XS7A 4DBQA 3WQPA 1F3FA 1TL5A 2IVYA 2YNIB 3PYDA 3PW0A 2HYIB 2FJEB 1SJ4P 1TL3A 2YKMB 4N8OA 3AA9A 1PYSB 1I3OB 3T3FA 2RVJA 2WBRA 3CCQS 1RP5A 4ZIWA 2PA3A 5AE2A 1QVFR 5F3ZA 2FHMA 1HL6A 1C0TA 1H7XA 3IR6B 1UW9A 1AUSL 5GAHU 3CGIA 2OP5A 1UPMB 1U1KA 2POKA 1D9DA 1FWPA 2FB0A 4OV6A 3UVJB 3VGUA 4DCOB 5EHHA 4U6PA 5GADI 2KFYA 5K5MA 4ED8A 1VQ6S 1U24A 2HNZA 2QMUB 2MKYA 3CJ8A 5U47A 4MKYA 1RXOB 1HWLA 2HQFA 2UU9J 1JXVA 4IG0A 2YBVA 4KHPJ 2OIHA 1DARA 1TKXB 1FD8A 3ITHB 3BYRA 4QYZJ 4L75A 4B9UA 2D9PA 3HHKA 2IA6A 2BQUA 3AB4B 3ZTSA 1SB6A 2XS2A 1X4HA 3CD5A 3CIMA 3EJMA 2W9BB 2DR6A 2K7KA 2WW4A 2YQ1A 2HHWA 2RNEA 1SL1A 2OHDA 1SKWA 2Z4PA 5DLFA 2BE7D 3QJPA 2RDDA 3J80Y 2P8IA 3RAMA 4LFAF 2L48A 3HVRA 2W2QP 4OI3A 1SV5A 1Z1ZA 2BM1A 2MKHA 2G4BA 3T9ZA 2B56A 4JI1F 2F9JA 3NOGA 2IBOA 4JB8B 5GMEA 4WFAQ 3ZZZA 4H4OB 1CJKB 2BUNA 2GA7A 2YQ0A 3KNGA 1FRJA 4IOCQ 3OR2B 2CADA 1GMVA 4IG3B 2DGWA 2DNKA 4IQXA 1RUSA 2NSCA 2NYIA 2DKOB 3ZZ0A 5G0RA 5A76A 2JDJA 4QWCA 4P2SA 3OV7A 2OO4A 1PIEA 2P6TA 1UW4A 5CYMB 1VQYA 3D6HB 4EUVA 4ZJQA 2JEGA 2HFSA 1TK5A 4USVA 4X65F 2WW8A 1H38A 4ES3A 5M2RA 1M5SA 3QT6A 2QMXA 2BJ8A 1X9SA 2UXDF 2Q1LA 2RHSB 2V9WA 3U1LA 2KM8C 3BZQA 4X4RA 5KFCA 4QCLA 5IFMA 2IRUA 4I64A 1X0PA 2JLGA 1KTVA 2YKNB 4N7TA 1MN9A 2AJ4A 3UPFA 2J8AA 2Q79A 3MCNA 3W9JA 4F26A 2GMJA 1UVKA 4KGXB 4QIEA 2B9XA 2ZE2A 2RU3A 3NY0A 3FVYA 2QA1A 3E01B 1TK0A 2ZOGA 2E1CA 2EBGA 4B3RJ 1VBKA 4NLOA 2CQ3A 2MQOA 4WF9Q 4TYAA 1QJHA 4LR8A 3CJQA 2JEFA 4LIWA 5CCMA 2C2KB 2Z57B 2IJRA 1WC0A 3ULHA 4LF9J 3TVYA 3PW4A 2W8LA 3PYFA 1VQ9S 1X4GA 4WIIA 3V6KA 5HP1B 4XTTA 2RD5C 3I4HX 2B6AB 3L09A 4WYWA 3TVKA 4WFBQ 5C24B 1APSA 4FYDA 4MT1A 4P52A 1WHVA 2GJIA 3UN3A 4OX6A 1CJTB 4FVCA 3PR5B 4EYIB 4DSLA 3PACA 5AXLA 3MI7X 4K4UA 3QGIA 3F0NA 5ETRA 3G6YA 4NLSA 3TAPA 4J9LA 1TQLA 2LEBA 2OLWA 3IRXB 3NMAA 2XCAA 1XNQJ 2IRYA 3G8TA 1G7CB 4EZ6A 1VBXA 3VGTA 1FKPA 2QC3A 1S12A 4OX9F 3BGRA 4NMXA 5DDQC 4CT9A 4EI2A 3JAMY 1N5YB 1B3TA 3QGPA 4ED5A 1QDUB 2H4WB 3IXQA 2CNLB 1UVLA 3UD4P 5G0RB 1Q86T 2MQLA 4EBDA 2BRKA 2QO3A 1VQ8S 2VA3A 1RTHB 3MGJA 3BQ0A 4TYBA 2JNJA 3WZ0A 1WI8A 2V67A 4C8YA 2CG4A 3I0SB 4KHMA 4PUOB 2PE8A 4GO5X 4K59A 5E7OB 2DD8S 3KK1B 1RTJA 2WB1D 4A8QA 2FHKA 3DGVA 3QRQA 1JWWA 5DDOC 4HACA 4OLOA 1N8RT 3DYAB 3RJMB 2XLKA 2L9NA 2JZ5A 5HAOA 4DX6A 4KPYA 3CCSS 1LW2B 2LVWA 2HW3A 2OTJS 3RG6A 3CJ2A 1TMJA 5KFSA 2C2MB 3Q23A 1G4CA 1C0UB 1Y00A 2DNPA 2CRLA 3N9UC 3HFZB 2FJBB 3DLLQ 1HI1A 3MMCB 2W9BA 1KP6A 1MWQA 1VK8A 1XR5A 4RW7B 3S1TA 1Q8KA 2GAHC 3TQEA 2BABA 3LF0A 4DUZJ 4U67Q 3H2UB 1PJ7A 3V6JA 3PEHA 4ZCIA 3CW2C 3MR2A 1B0VA 1IKYB 3GR0A 4USKA 2EFVA 1FK9A 3PIOQ 1RYRA 4YB7A 4ECRA 2UXCJ 4USIA 4CCHA 2ZJRQ 2BVZA 2E29A 2CIMA 2QYGA 2YWEA 3NGSA 3DOMB 4R0JA 2YNFB 3TJ8A 4BLGA 2B6AA 2BJDA 5GVQA 3R1HA 1RTIB 1PAEX 3GYNA 3IBFB 3UN2A 2FPHX 3OHBA 4NLGA 2B7BB 2J7KA 4Y2AA 3T1HF 1NJIT 3FQKA 4ED4A 2YNGA 2ZKUA 4WPAA 3I5AA 4P72A 4F4XA 3PV8A 3BREA 2ZH4A 1DURA 4MIBA 1IKWA 5KFYA 2G0CA 4CZCA 1W2BR 2JSXA 4YDXA 5BYQA 4HTIA 2FJVA 5B0DA 3MUTP 2FJXA 3CDWA 4LF7F 4DR4J 4YFUA 2AQ4A 2Z30B 3UCUP 2UU9F 3IWLA 1UVJA 3CE8A 2QGFB 4V1Ak 3FSXA 1RTIA 4JI8J 2FC8A 2GQQA 3GJTB 2F8HA 2V2ZA 3I32A 1NU4A 3EZOA 2RS2A 2ASDA 2AIRB 1Q78A 4DF4A 4F2SA 2FHJD 3QIPB 1NM2A 1FESA 1PYTA 2FLOA 3KUGA 3V81B 4DV5J 3IG1A 3ZZYA 5D0EA 1YRXA 3KHHA 1V5VA 4TY8B 2CWKA 2R7SA 3ZTQA 1D9FA 2AKWB 1B64A 4RWWA 2VFUA 1S72S 2KL8A 3FEXB 4TN2A 2ZITA 1HQUB 3TX8A 2Q6BA 1R7IA 2PI5A 3J7AN 4CO0A 3C66A 1RT6A 2K3IA 3L7UA 1JNZB 3K17A 1S1UB 3DI6B 3K7RA 1WC4A 1RCOB 2VONA 2HQCA 2GX8A 3D1HA 4XAKA 3CCUS 2JH3A 1OSCA 5E33A 3ZZOA 1LWEA 3C2PA 1A7GE 4JI7J 1RTZA 2X51A 3MM8A 2H48B 1I6JA 2CQHA 2MYFA 4O0IA 2B43A 5A6WA 2W8KA 2WOMB 3EUNA 3I5BA 1CULA 3F56A 4OYWA 1A9NB 1JJHA 3I0SA 3PYGA 4PUOA 2I6WA 2DNOA 2R42A 2YY3A 5J2PB 5T14A 4I67A 2BZ2A 2V9KA 5EWGA 4LF8F 2HBZB 2V8DA 3IAM9 1S1UA 3DI6A 3DLBA 3MEEA 3DRSB 3R5CA 3TWZA 4O3NA 1Q5VA 1WF2A 4EMDA 4JI4F 1Q8LA 1MROB 1YX2A 5HROA 1T95A 2BJ3A 3ZFVA 4ZITA 3BQ1A 5HBMA 3IRXA 3DHXA 5KFJA 4U7CA 2BM0A 2Y1RI 2DXDA 2V94A 3OTEA 4AD6A 1V3SA 4RW8A 1XMQF 4K0KJ 4XK8C 1WDTA 1BWEA 1TKZB 4O4RA 1WEXA 1RTJB 1UJ4A 1X60A 3G86A 7FD1A 1S4FA 2J76E 3U1NA 4DV7J 2OGUA 4Q0BB 2HK2A 2FHOB 3BGLA 2ZBPA 5IWAJ 4NXMF 2ZBRA 2ZZTA 3OPKA 1C0TB 4LR7A 2QX0A 4IQMA 4USWA 4B9TA 1K1SA 4N56A 2CPZA 4JI4J 4KGKA 5CYJA 4J9MA 2LEPA 2E5LF 2GVZB 1KFDA 4QIVA 3W5XA 3V6HA 2DNHA 3NNHA 1TV6A 2RS8A 1Y3KA 3C6UB 3BPDA 3PYEA 3TA1A 2H5EA 3CF5Q 4GMKA 4OZ1A 4ECZA 1RT1B 5D15A 2HNYB 5BYRA 1N56A 2MQ8A 3Q8SB 4ICLA 3P45B 4ECXA 3KOAA 3H5XA 3RB0A 4CM2A 2AYBA 3AD7C 2R7XA 1CJTA 2MSTA 1IR0A 3M05A 5GADU 2W01A 1Q1KA 2AZ1A 1G1XA 1BQNA 3BKTA 1S9FA 2GIQA 4YN3B 1S57A 2RUSA 4HTJA 4CO2A 5L1IA 4RPFA 3P49B 2IBKA 3M8YA 1RHJB 4NEYA 1M5OC 5IV3A 1F6TA 3GFXA 3H98A 4XDCA 1F5AA 2LQBA 1KQFB 4ED3A 1GK8A 2M5YA 3GB0A 2VASA 1H3DA 2DNLA 3DHWC 4K5SA 2GVDA 3SMZA 3W60A 2I2YA 2HHPA 4IDKB 2C3UA 3S6EA 4PABA 5FLXY 4IFYA 2UUTA 3DKDA 4U8VA 3NL0A 2CPXA 4NA3A 2XG8A 3IGNA 2RF2A 2FZGB 4ZPVR 3VVTA 4JI6J 1AT1B 1W26A 3DRPA 2N3LA 1U1OA 4X4TA 4OZ3A 1BXNA 4FDFA 3EVOA 2DY9A 1GMWD 4Q0BA 2OEKA 2AV5A 5CZVA 3UR0A 1ZA1B 1ELOA 1WHWA 2MGZA 1JJ4A 4HR2A 2C3YA 1DLOB 3D0HE 4I2PA 3RB4A 2IM3A 1B0TA 3TEGA 3G87A 3AD8C 1EKSA 2GW8A 4RW8B 2X1GA 2N7YA 4M5JA 1C1BB 2FZKB 1R8AA 3JQJA 4UOGA 2VJVA 1WOOA 4I2QA 4DX5A 2VICA 3K8WA 2CQ2A 3JSRA 1TUGB 3MFHA 3GJRB 1JMTA 4M5DB 4MJKA 4IUFA 4F7VA 1KTQA 5HROB 4DR7F 4KO0B 1RI7A 2XGQA 3OLBA 3D5MA 3B4DA 1QAYA 3R5JB 4NLWA 2XM3A 5E3AA 2W9CB 2ZKTA 2NXCA 1JKHA 2LXUA 4UY8T 1N33J 2CVEA 1CC7A 3L9ZA 1KC8T 3KJQB 4J9QA 5A2QY 3ITHA 3HDSA 2M8DB 2JC1A 2ZEJA 3BGUA 2YQ3A 4LJMA 1W7WA 3M32A 1S5ZA 3HVAA 1NKEA 2XZWA 1YZ6A 2VQFJ 1RLCL 1JIHA 2NS1B 3MPDA 1AXQA 3KUEA 1URRA 1RADB 1UKUA 3DRXA 1DBDA 3UVJA 1CBKA 3POTA 3Q8YA 4L3NA 1NUEA 2UVWA 4KB7A 5A8KA 3SCIE 2N3OA 3ETMA 3G6VA 2KZMA 2C2NA 3NGKA 3ET6B 2WBMA 5FDLA 5IC4B 3VALA 1RHKB 2HQGA 3N5BA 4J7CA 3TAMB 2CPFA 2G9OA 2C28A 1PO6A 5KG3A 5KT7A 1RU2A 1NZ8A 4N41A 3TAQA 2MZTA 1D9AA 4EU0A 1F3VA 1NJYA 1F5CA 4ZOSA 2HAFA 3IAS9 4NWBA 3K57A 3PCOB 4Y2MA 4Y28C 1S6QA 4ATNA 2HIQA 3TAMA 1SPBP 4QJVA 3BSNA 2JFKA 2RAQA 2F7VA 3BH6B 4HI1A 4IFVB 2ZE2B 1SH2A 1JLEB 1NMEB 3M4XA 4I69A 1ZBTA 1PJ5A 1F1BB 2W2NP 4RNOA 1KS2A 3P6YC 4Z37A 4A8WA 1S1VB 4CH1A 3T6BA 5CA5A 3PW7A 2ERRA 2IA0A 2BX6A 5KFKA 4OHYA 1KFSA 2AGPA 3GQCA 4LF1A 3EYZA 5J2MA 1IBKF 4WP3A 3KLFA 1AYEA 1D09B 1XBWA 1BMQB 2U2FA 3DOKA 3MM9B 4FPRA 2DPJA 2V4JA 1LWCB 1ZM4A 5IT4A 4GC6A 5EGYA 1PSDA 4ED6A 1UWBB 2SXLA 2XMAA 4LF7J 4DR4F 1S9GB 5C25B 4DV1J 1JKHB 4JOUA 1MSWD 4DQSA 1X0FA 1TL7A 1U2RA 2K06A 1IKXA 5ADZA 3HZEA 4KQZA 2OI2A 4RZRA 4QWDA 3CMES 1HBUB 2XTJP 2D41A 4X64J 1TKDA 4IKAA 1CJVA 1IM4A 4RW9A 4FXDA 2XEXA 1Y0HA 3DRRB 5BYSA 1WC3A 2KHCA 4ECTA 1NKCA 5B09A 3E51A 4C8ZA 4ZHRA 1HD0A 3KLEB 1FE4A 4DR2J 1QVGR 2HHTA 2L08A 5IXUA 1CQMA 3J7ZT 4CP5A 3DXSX 7FDRA 2AF6A 3NOCA 1U6BA 1XTZA 2IJFA 2E7XA 4NCGB 4L72B 1RHQB 1FKOA 3I6PA 3VZHA 1RTHA 2AEJA 2QLWA 2QA4S 2LQ8A 2R9LA 3W8PA 2FVPA 3HD1A 2J9DA 4X62J 5C5JA 4DUZF 2FY1A 1W25A 1O5JA 3HSJA 2Y8YA 1WDDA 2H51B 2ILYA 2Q66A 4OQJA 4CIOA 1WKKA 2HS4A 5KFLA 1XMOF 4FKXA 1KLNA 3W3SA 2H3EB 3NWRA 2BKOA 5LXYA 2IYIA 4ZVFA 3W65A 3K58A 1JNRB 2MMYA 3B8HA 2MKIA 2QEXS 3OBIA 3CSKA 4OI4A 1YQHA
chains in the Genus database with same CATH topology
5IM0A 2OTLS 2YWFA 3KK1A 2OH2A 3RR7A 5HQ8A 3I5CA 2PGCA 4JV2A 3NBPB 2JVRA 3PY8A 1WELA 4ZPDA 1H2VZ 1X5TA 1SL2A 1HR0F 2VG6A 2P6SA 2P9EA 4IH7A 2A18A 4TU9A 1SUQA 4O44A 3EXYA 4LSLB 3JTPA 3TUZC 4F4ZA 2GFFA 3MMAA 1R8PA 3N6NA 4ECSA 3M9MB 3VAKA 1DQAA 4ZK7M 3HM9A 4BWMA 2FDNA 4NLQA 2ZHAA 3PX4A 1JXEA 3RTVA 2O67A 2CQ1A 2OSQA 4C0OC 5F0WA 3VR1A 2DR9A 1XWLA 2I5JA 3CWJA 2E44A 4ZP7A 5MLCV 4OX7A 3PVXA 1CC8A 3MR3A 1SH3A 3CJ5A 3LP0A 5FJ4A 4FN5A 2OPPB 1Z2LA 3CDAA 3FJ2A 4Q2LA 2AD9A 2UUCF 2BACA 2FJDB 4YMEA 1VQNS 3PFEA 1S1XA 1WF0A 2OPQA 5KAKA 3KLGB 3G8SA 1WG1A 4LQ3A 4J9RA 2BV3A 3KMQA 4QZVB 4RW6A 1OPIA 3SSRA 5MAOA 1RT5A 5JJBA 3LP2B 4DV3F 1JLQA 2CQPA 3OR2A 4IH6A 1U09A 5JXSA 2DR5A 2RE1A 3P5TL 4OJ1A 1QUPA 1JLGA 1P27B 2VG5B 3BO4A 1L3VA 4NLXA 3OFGA 2O66A 1KQSR 6FD1A 3GIKA 1FEEA 3CJKB 3W2VA 3PX0A 3ZZUA 3KG1A 4MIAA 1GNKA 3AJ1A 3N6LA 1NK8A 5LT5A 4OJGA 5J2NB 1NK5A 4QBUA 3US5A 4UQTA 1NJZA 2XY5A 5J1NA 1X4DA 4TXSA 5SUHA 3VAFA 1HFEL 4BDPA 2XLJA 1TL4A 1QSLA 4HDHA 2IHR1 3VTIA 5D4OA 2AJ1A 2DNGA 4P6QA 2FUG9 4ECWA 3AH6A 2DRAA 4N47A 4PXBA 4F2RA 3VAHA 3M8QA 1Q16B 4R25A 5AJ3F 1DTQA 3LP1B 5F8MA 1J5OB 3MD1A 2IAJB 3QMQA 4NOHA 1NK0A 2ABYA 4IRKA 4CO1A 2NQPA 2XCPA 1X4EA 2E5IA 2ASYA 2VFTA 4PXDA 1VHFA 2ZC3A 1SXLA 2ROGA 2VG6B 1FA0A 2GMHA 4IO1A 4DPOA 2MPUA 3BS9A 4DSIA 4H4MB 1XR6A 2AYEA 2DJWA 4J9KA 4K4SA 3MPWA 1M5KC 3THPA 2BBEA 1HWKA 3T1AA 3DNCA 2KZZA 1SKRA 3Q2SC 2VFVA 3EGZA 2PSZA 3VQTA 4JYAF 1S0VA 4CO3A 3S8SA 2BANA 4J9OA 1H2TZ 1SKSA 2VH7A 1KR4A 4CQ1A 1UAWA 3WC0A 2B5JB 4U9RA 4DV4F 3CCZA 1JLCA 1Z4UA 1KHWA 5IQ6A 1V6HA 1BC6A 3DDKA 1CPZA 1BQMB 5KG4A 4X4VA 1IQZA 1MROA 4KHRA 3NMRA 3WDOA 2KT3A 4O4GA 2XMWA 4FNIA 5DG8A 2CQDA 1N36F 3MEEB 1C2PA 1Q4RA 4IYQA 4RNNA 2W7OA 5A8RA 1QAIA 1XNQF 1MMNA 2C22A 3CXCR 2F3JA 4L6V3 2WONB 2C3PA 3GG1A 3CUNA 2O01C 3D54A 3AHPA 3MM8B 2B3TB 2VBYA 3FSYA 3C8YA 4K4WA 2J6SA 1VRUA 4QR0A 2XB2D 1YRTA 2ZJQQ 1TR0A 1YIJS 4HI2A 4MAKA 3TP2A 3UCZP 3CC4S 1LW0A 1D1UA 2C2DA 2NXUA 2K1RA 4R8UB 3ETOA 4EEYA 2RIJA 2PN6A 2Y0SD 5B7WA 5B0GA 4X64F 1S0MA 5ITHA 1HARA 1LW0B 1VIOA 1WACA 3MXHP 1JLCB 2VL1A 3RRGA 4YDDB 4DF8A 3DYAA 2DGTA 1N5TA 1KOHA 1NAQA 1NH8A 1QUVA 1UETA 2A2DA 2D3ZA 4G1PA 5F0UA 5HMXA 5M2UA 4ZMMA 5EWFA 2HNZB 4QWAA 2LDIA 5BR8F 4M94A 4DX8H 2W25A 2IM1A 1GX6A 1WWHA 2NPIA 4ZCLA 2KKHA 1S7HA 3M6WA 3T5KA 2HPUA 3KKFA 3I56S 5C24A 4PRFA 1WI6A 3BSOA 3EGWB 1UMJA 3JSYA 1P6TA 1QE1A 2O5DA 3M30B 3Q8QB 1TUVA 2R7WA 4B3OB 4ZP9A 1Q8IA 2EFGA 2XSFA 2J9CA 2QV6A 3DMJB 3I9ZA 3M2RA 4I7FA 1VGYA 2M4MA 4DDFA 4I1TA 4Q45A 1TV6B 2K2PA 1TFYA 3HK2A 2WB4A 3AJ2A 3O1LA 3K5OA 3OL7A 3OXLA 1V3RA 4GKJF 4A48A 2XMTA 5DM7Q 1TP7A 5DG9A 1S6PA 1ZPVA 3CCJS 3I82A 3ZZPA 1FJEB 1MNEA 4ELTA 1XERA 4V19X 3BR8A 1WTBA 2EKYA 1N5SA 3RZAA 3NAHA 1VQLS 1U8SA 3DN9A 3PM9A 4TLRA 1RISA 5KTQA 3AAWB 3OLAA 1SJ3P 4AFFA 1RT1A 3DC2A 2YVSA 3KG4A 4LSNA 5KOXA 3J7YI 4HT5A 3N4WA 4LSLA 1S10A 1V3ZA 2DVIA 4LF6F 4K50A 5L39A 2OMOA 3THVA 2B4OA 4M5DA 4ZDNA 3T19A 3SZ2A 2HHQA 3MM5A 4RUAA 4DV1F 1KN6A 1IKVA 3GE9A 3OTOF 1HBMB 4ZA1A 2R7VA 1HWUA 2J5AA 4HHJA 5KG7A 2I8EA 1Y4ZB 4X2BA 2LCWA 2FLPA 1RT7B 3Q24A 1M0SA 2OPSB 5K9FA 3Q2TC 2W7AA 1RT5B 5B0CA 2HVHA 5CYQA 4A47A 4RUCA 4YOEA 2BE2A 2ZD1A 4F3MA 1FKPB 4HH0A 3H5UA 1HPZA 2UXBF 4YR2A 3DRSA 1FD2A 3CC7S 1GXUA 4OMFG 4UY85 3MPVA 4CNYA 2MKSA 3GZ7A 1JLAB 3KHLA 4EYHB 2JX2A 2BW2A 3IS9A 4FZVA 3KG0A 3O6QA 4Y0FA 4JI0F 4NYOA 5CD4H 4ED0A 2QE5A 2B4VA 3FFIA 2QZ8A 3DLKB 4DS4A 4ZVEA 5E5NA 4DUYF 2CPHA 4PCQA 5KFXA 4WTYA 1S49A 4CT8A 3M6UA 1R31A 3LP2A 3OFFA 3JSMA 1DRZA 1CEZA 4ETXA 3RR8A 5B0BA 2CPYA 4WU2A 1RT6B 4PQAA 3G6XA 5M2PA 3RBEA 5E3QA 4AL5A 4MK9A 5DRKA 2B4PA 5KFZA 1FKAF 2VBXA 3R5DA 1OSDA 2YKAA 1R0AA 4R5PB 2M70A 2QYCA 1NNDA 4G6VB 4ZPTR 1YVFA 4G3IA 3MOZA 4WXOA 1S97A 1HMVA 4YB1P 1SIWB 4OV1A 5J1PA 4KC5A 3NNAA 1ZM9A 2WAQD 2VOOA 1U25A 5KFDA 4QWBA 2EG1A 3CJ3A 2HGNA 3FCHA 4TQRA 4MMOA 2QSWA 2DH8A 1U1RA 1L3KA 2AJFE 3T1YF 3DLGA 4KSEB 4E0DA 1YJ9S 2DO4A 4YB5A 1ZM2A 4K0KF 4E98A 2RH3A 3KLHB 4NCAA 1UFLA 4Q2MA 2YH1A 5SZTA 2WRMA 2DNYA 1N5VA 4DL6A 5D4LA 4CTAB 4B9MA 1YGYA 3KHRA 4PG8A 3M9OB 5DETA 2QSFA 4RU9A 2H9ZA 3IBWA 1VQMS 1IN0A 5K14A 3V4IB 5HLFB 4C4WA 4KV8A 3K5PA 2BR0A 4O3SA 2ALZA 1LWEB 3FZBA 4A4JA 1IKYA 2PA8D 3QPIA 3BSCA 1HNZF 4FF2A 1T05B 2E9RX 4XO0A 1HBUA 2X3GA 4QQBA 3SSSA 3I4PA 4TLQA 1FNXH 2KYZA 1FNMA 2XI2A 2MKJA 2VC0A 2DH9A 3TA0A 5EWEA 2IRXA 4OJ3A 1TL1B 2VB6A 3W7BA 3TI0A 3D2WA 3IR7B 3FGVA 5CYQB 4Y2CA 3MEGB 1BD6A 1FXRA 2QMWA 1MMDA 3IO1A 4AL7A 4NLDA 3X3UA 3C6TB 2JOQA 4ED2A 5F9NA 1VRUB 3EX7B 5J2MB 4NRTA 2D1CA 3MHYA 2FC9A 3QIPA 3RB6A 2BDPA 4MYTA 5T7LB 1HBMA 1M5VC 1VQ4S 3MOJB 3EZ5A 3KYLA 3K2YA 3SV4A 2P9CA 1UFWA 2OD4A 1U2FA 2GJ2A 1KOOA 5I3QA 2QIFA 1RQ0A 1S6QB 3OSNA 2HQIA 1AFIA 1X5SA 1Q82T 4C98A 4X4UA 3VQSA 4DFPA 2OPQB 2V0NA 3E3XA 1RKJA 1N6QB 4QPXA 4Q43A 1GX5A 2JFDA 4QIGA 2CZ4A 3QYYA 4KR0B 2MY7A 2L3MA 1S6OA 3N6MA 1PC5A 3G9CA 1UP1A 1C4CA 6FDRA 1TKTB 4I6AA 2YKNA 4WE1A 3Q22A 4DSFA 2HWHA 2WCXA 2RILA 3A1YG 1FNOA 1S1VA 4JI8F 3I0RB 5AE3A 2ZBIA 2DT9A 2KG0A 3H5YA 2ZH8A 4IFVA 3D1QA 2E1AA 4OL8A 4RW7A 2ZH2A 2AWZA 5KFTA 3TNVA 3DMJA 5F41A 5GAGU 1URNA 3DLEB 3OSPA 3CVKA 3TRGA 3J81Y 1HBOA 5CCLA 3OXFA 2IAJA 2P9GA 5C42A 3H4DA 4B08A 3CCMS 1GXLA 1VS3A 2DTJA 4KIAA 1BY9A 4E8UA 2X1AA 2ZDOA 4EWTA 3QIDA 3MAQA 3GV5B 4DL2A 5IS2A 2DBBA 1UA1A 1F2GA 2J7UA 4ELVA 2C2EA 1ZZFA 3MUMP 3SI8A 3MWBA 1W2IA 2ZZNA 4PG4A 1R27B 4CI0B 3HHDA 4PKDB 2XMVA 3NAIA 4X4SA 5I3UA 4QIFA 5KFHA 2CFXA 1Y5NB 4A8SA 4DL4A 3HMJG 1IJFB 2FVCA 2LU1A 3QGGA 3QLHA 2FHJA 3QZ7A 2G1DA 2EFPA 4QW8A 1AROP 5AE1A 2XO7A 5F9LA 3NRBA 5IT9Y 2R2RA 4TNOA 4C11B 2GV1A 3W2WB 1D8YA 4NZ7A 5HLFA 4NLVA 1NK6A 2W24A 4O3RA 1G3OA 1N5QA 1HHSA 1Y3JA 2PIIA 1RWUA 1K8AT 2NLWA 5F8HA 2UXCF 1VRTB 2O3DA 2QA4G 5CZXA 4JV0A 5DM6Q 4YUDA 2HHVA 3HX9A 3OR1A 1YITS 1IKWB 3M1VA 5DJBA 1BQMA 1EP4A 4ID8A 4MIWA 3QO9A 1S6UA 3CEDA 4KBIA 4LSNB 2KT2A 1QAJA 1YBAA 3TVZA 1N34F 4IRDA 1XN9A 2AYMA 4DR2F 2HHXA 2A1BA 2GCFA 3NS5A 2HG4A 2F8EX 5A6PA 2KDOA 3AQOA 4DMZA 1WEZA 5KFEA 4B3RF 3FFIB 1S6PB 2EG2A 2I5JB 2OSRA 3TARA 2DGUA 2DHAA 4I6YA 2VPXB 2VUGA 1QSYA 1HW8A 3PDNA 1MU2A 2PEHA 4WYLA 1Q8BA 1KVIA 3RAQA 3NCPA 4A8XA 2PC6A 4KE5A 3CIZA 3LGMA 2VQEF 3CB4A 4NA2A 2VD3A 3SQGA 2APOA 3HP6A 2FVRA 5KT6A 2UVUA 1FVQA 3GR1A 3RAXA 3H59A 1UVIA 4RNMA 3OW2R 5KFAA 3AA8A 3MMBB 3CJKA 3M6VA 4K4YA 4RWXA 4RBVA 3VZIA 1SV5B 4KGMA 3KK2B 2JEIA 2XNRA 3DU6A 2EI5A 3IS9B 1CLFA 1LK5A 2IC3B 4BHQA 3F41A 1JLBA 3D28A 4ZS6A 4ZLPA 4UQGA 2XLIA 5DG7A 2MZJA 5HBMB 2IJNA 3BO3A 4HVZA 4B9SA 4ECQA 4DL0C 1I1GA 4KO0A 1NHVA 3NWGA 3PXGa 2BE2B 2ZD1B 2VV5A 1F5BA 2QRRA 3OTCA 3DCAA 1FE0A 2YKOA 1S1XB 3HLUA 1NHUA 5LSRA 1KVJA 2I38A 1SIZA 4PG6A 1KRPA 4NRUA 2RQMA 1U6FA 3SSQA 1DZ5A 2M0GB 4LQ9A 3DM2A 2HHUA 1YSJA 4NX9A 2D3UA 3LO3A 4FF3A 2MZSA 1YJRA 2RF2B 3DRRA 2R8GA 3PKMA 1UEVA 3R27A 4ZPCA 4WFNQ 4J9PA 3MCSA 4NMLA 2E5JA 4OHZA 3G6ES 1VBYA 2OFHX 2X1BA 4XDDA 3MAHA 3MECA 3B78A 3FNNA 5K8NA 1U47A 2U1AA 2YNIA 1CG2A 3LH2S 2MQQA 2AU0A 2HHSA 1HQUA 4TQSA 2BRLA 4TU7A 5F8LA 5B08A 2NPFA 5LXRA 4Q8FA 4FF4A 1P1LA 4DQPA 5LJ5Y 5I4MA 3B4MA 4AUKA 5BJRA 1FDDA 1WF1A 1S9EA 1YWXA 2CJAA 2HWIA 4RUHA 2AGOA 1VBZA 4RW4B 5CQGA 1AW0A 2ROEA 2HFOA 3C6TA 2JVOA 1R0AB 2XY7A 2VA2A 2EPIA 4FXVA 4MKAA 5E0OA 3KK3A 3MMAB 2FVSA 3C6UA 2N4DA 3OR1B 2GHPA 4X4PA 4ECVA 2MKCA 1MWZA 2Z0GA 3OXGA 3DLHA 1WNEA 2DRBA 3PX6A 4TKTA 3LGNA 2R7OA 5JUMA 4IO9Q 2LXIA 3TO8A 4OIXA 2KXFA 4F8RA 1HD1A 1YJWS 2VC1A 4URQU 2I0XA 1U6ZA 2M88A 5KFMA 4A8OA 2ZOFA 4Y2IA 3DLKA 4F25A 5L9NA 1PC4A 5LL6d 1HQEA 4ZPBA 4ZHRB 1HW9A 2DIUA 4ZVGA 4WKRA 2J9EA 5G4DA 1FJ7A 3U27A 1VLYA 3QJLA 3GV8B 3I31A 2WTFA 2RQCA 4QOTA 1ZH5A 2R7TA 3BGRB 1N5YA 3HI9A 3TR5A 5T41A 4F4KA 1RTDA 3BN7A 2V4QA 4IOAQ 2W9CA 5B0FA 5F8IA 1UL3A 5D3GB 1X7VA 4K5RA 1GTHA 2PT0A 4I2QB 2HGMA 2E9ZA 2OPSA 4N76A 3LANA 2KN4A 1U49A 4C8OA 3O8WA 1V9OA 1DLOA 1T03B 2LYVA 5F8JA 3S01A 4K4VA 3U1MA 3KLVA 3P96A 4ZPAA 1XEZA 2HFNA 2KYXA 4FXWA 1Q7YT 1RAJA 2F40A 3D0GE 3ZC4A 1KHVA 4CH7A 1EP4B 3ENVA 1FRKA 2EVZA 3O2IA 1P1TA 1S79A 2PMHA 2CQGA 2YKMA 1SJ1A 3M2UB 4KFBB 4NLTA 2EC0A 1NH7A 3DGPA 1YRUA 3KLGA 3E01A 2C42A 5HMZA 2W4CA 4ELUA 4DV2F 3HKWA 2BANB 2V8VA 2VPYB 2OAUA 2VBWA 1HMVB 3E2EA 2VG7B 3FEZA 4BS2A 4EO8A 3PEJA 4QU6A 1RT3B 2W4DA 1FXLA 1F0XA 4C3LA 1FDBA 2WK4A 2RDIA 1NJWA 2R8JA 3CDBA 2IVFB 4P7VA 4WKYA 4DL3A 5D8HB 1VQ5S 1R8CA 3MFIA 5LSLA 5DDRC 4DLEA 2DO0A 3FZ2A 5H1SV 3OL8A 2ZH9A 4B3OA 4FS2A 2LQ9A 4G1IA 3T6JA 1Q7LB 4GO7X 2RU9A 1H2UX 5GAHI 1K1QA 3RW6A 1U45A 5KFUA 1UJ5A 2RMLA 1FK9B 1RJJA 2CQIA 5DDPC 3QWUA 5KFOA 3CCWA 2RUGA 1FRLA 1N32F 2PDAA 1KQGB 2LECA 1QSSA 5KFNA 1JX4A 4OJHA 4IRCA 2NZ4A 3V5RA 3HKZD 3HHEA 3JSBA 2GGPB 4JUZA 2CVIA 3PO5A 1C0UA 3IN5A 3P3DA 1WTFA 4OX8A