2GHWA

Crystal structure of sars spike protein receptor binding domain in complex with a neutralizing antibody, 80r
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
191
structure length
191
Chain Sequence
ITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/viral protein/antibiotic
molecule keywords Spike glycoprotein
publication title Structural basis of neutralization by a human anti-severe acute respiratory syndrome spike protein antibody, 80R.
pubmed doi rcsb
source organism Sars coronavirus
total genus 40
structure length 191
sequence length 191
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ghwA01
2AJFE 4L72B 2DD8S 4L3NA 3D0GE 2GHWA 5DO2A 3SCIE 2GHVC 4KR0B 3SCJE 4ZPTR 4KQZA 3SCKE 3SCLE 3BGFA 4ZPWR 4ZPVR 4ZS6A 4QZVB 3D0HE 3D0IE 4XAKA
chains in the Genus database with same CATH superfamily
1DAXA 3VAKA 1BQNB 4FYWB 3D28A 2P6TA 2BJEA 4MIWA 1TUWA 3R6GB 3BH7B 3NCQA 1X9SA 2AYEA 4DSIA 3DGPA 2DHGA 3W5ZA 2VZ9A 4B3TJ 3MHYA 1Q8BA 1VK8A 1T3NA 1XNRJ 3HVRA 3M8PB 4RW6B 2FLPA 4JI4J 1NH8A 5KG7A 1RAAB 2CQGA 3R8YA 1R8HA 1FJEB 3DGVA 1JLAB 2WK4A 5BR8F 3KLGB 1N0UA 1Q8LA 3UE2A 3NMRA 2EBGA 1HNIB 2IMWP 2M70A 4IG0B 4JP8A 4HDHA 4ANCA 3CO0P 3UI3A 1WF0A 3UNYA 4QWEA 4P52A 1C1BA 4RUHA 1S12A 4ZPBA 5L1IA 3K5OA 5KT4A 4WFAQ 4J9KA 1YRUA 4MKYA 3V6JA 3ITHB 4KGVB 4RLEA 4ELUA 3CC2S 3ZZZA 1H74A 1T05A 2B51A 1OIAA 1O5JA 3TAPA 3RAXA 2VF3A 4ZJQA 2EWHA 2FJAB 2H48B 3UWTA 2H3EB 3MM7B 4CLFA 1B0PA 3H5XA 2QIFA 3MEDB 1HWKA 5HATA 1VIXA 3MM8B 1UP1A 4HTJA 1Q81T 1WKLA 4QR0A 5L1JA 5I4MA 1SQGA 2JEIA 2LKZA 1KFSA 1NMEB 1TV6A 3DGPB 3D6MB 4MMOA 1C0UA 4RW9A 4UW2A 1T9YA 2V2VA 1RXOB 3Q8UA 1H0HB 4TU8A 1UAWA 1K44A 3QRQA 2EFGA 3RBDA 3WDOA 1JLEB 3PJXA 3JAMY 2CQDA 3S6EA 1Y5LB 2X3DA 4U7CA 3TEGA 3DRYA 3N5BA 1ZYQA 3IAM9 1GXUA 1Y9OA 2PT0A 2AYBA 2Y8YA 3SV3A 2FY8A 1HBMA 5KFVA 1U6FA 1IVZA 3KHRA 1BHNA 2QMXA 4BC9A 2K06A 2R7OA 4EK2A 1WC5A 3NXZA 4IRKA 3BKTA 2ZD1A 1C1BB 1U1KA 2AF6A 2CJXB 1FD2A 3W1YC 3PACA 3OR2A 4YDXA 4EI2A 1TL1A 1RBLA 4X4QA 1T05B 1URRA 2C3OA 4U67Q 4M5LA 4C8YA 3MF5A 1N33F 2A2DA 4UT4A 1N6QA 1X9WA 5LSRA 3Q22A 2BV3A 4DR6J 1YJRA 1VYAA 4HH0A 2CVIA 4KY3A 1RYSA 2AJ2A 3KUGA 3HMJG 1D8YA 4CTAA 3GIMA 3VZIA 3M2UA 3H2UB 2GW8A 5KFDA 5K5MA 5IT0A 1TV6B 5GAEU 4F3OA 1OPIA 1C0UB 4RW9B 1R31A 3MCOA 1VBXA 4OX9F 3PR5B 4B9VA 1VC6A 2HG4A 4M5DA 3PO5A 5GADU 1X0FA 2EW9A 2QYGA 3TR5A 1U26A 2MQLA 2NQPA 2R7QA 4WWSA 4ILLA 1HBMB 4LQ9A 1RLCL 3BGLA 3QAEA 1S6PA 2KZZA 3HO1A 1CVJA 3LWMA 2AD9A 2WTFA 4LRFA 1H72C 4DV1J 2ZD1B 4RO0A 1QE1A 2VA3A 1HNVA 2Y1JA 3BQ0A 1WUUA 3OR2B 2DR6A 3KDNA 4NCGA 2KB2A 1TL1B 3LP1A 4MFBA 5DZ7A 2AGPA 4NLPA 2RNEA 1UWAA 1F6TA 4ZP9A 3FSXA 3MEKA 3KUHA 2HZAA 2GV1A 2GHPA 4DLGA 3K5LA 2AZ3A 2H5EA 2P9CA 4CTAB 3M2UB 3OJSA 3T1YF 4NLGA 2BM1A 4B3SF 2DY9A 4DR2F 4OI6A 3CCRS 3I9V9 4RBTA 4NLYA 2AJ4A 1TUVA 2JLFA 1SKUB 4LRBA 2JOQA 2FPHX 2FGCA 1H2TZ 2NXJA 2F8EX 2XS2A 1FX4A 5C25A 3R7NB 4GKKJ 1PCAA 2PFDA 1FRXA 1WORA 5THWA 1C1CA 1FXLA 1C2PA 4LQ3A 2V8DA 3AJ1A 4M5DB 4F4ZA 3QIDA 4F3MA 2XMJA 3R7SB 4CDIA 4PWWA 5GMEA 3M6WA 3J7ZT 1U1PA 5AT1B 2KXHA 4NPOA 4QIVA 5KT3A 3GIKA 3DDKA 4ZVQB 4LRDA 3AB4B 4MKBA 1S6PB 3GV5B 4DU7A 3M9MB 3GONA 1QE1B 1HNVB 3L7OA 3D7SB 4NWBA 5DDOC 5CABA 3NAHA 2HZCA 4NCGB 5T7LA 5EWGA 3LP1B 5KOWA 3IFEA 4ID8A 3TZXA 1BQMA 2CQ1A 2BKPA 3MMAA 5F8IA 2V4RA 4LF4J 5HVHA 1DHMA 1M5PC 1HHTP 4KO0A 1U8WA 1ZETA 2DGWA 2CNOB 4F2RA 4RNMA 1KR4A 1VBZA 4IKAA 3VGUA 4DQQA 1T7PA 2IYGA 4NYPA 3R5CA 4EEYA 3ILIA 2V34A 3IO1A 4FF4A 2QRRA 3NGDA 2DISA 4XTTA 4JUZA 5JJBA 2YBVA 4QYZK 2VDHA 5C25B 1SH3A 4ECSA 1PO6A 3FQLA 2MKIA 1L3VA 3HCXA 2ZKUA 3OPKA 4H4MA 3NNAA 4MTPA 1U0SA 1C1CB 2HHUA 4IO9Q 4DL2A 1N4LA 4DV6J 4FNIA 1X31C 1H73A 5LSOA 1NPKA 5KFCA 2HQIA 2C22A 1K47A 3RRGA 3VAIA 3NP5A 5IT9Y 1PSDA 1JLBA 1X5PA 2J6UA 1U0HA 4DDFA 1UVMA 4WP9A 4WYLA 4ZVSB 2C3PA 2JJ4D 3H25A 2VONA 4BLGA 1GTEA 2YWGA 4ZLJA 2UXBF 4USTA 1L3TA 2F4VJ 1VCTA 3CMQA 1MU2A 3SFUA 1KQGB 2PI5A 5T7LB 4Y00A 3KHLA 1BQMB 1QUVA 3MMAB 3IBFB 4DPTA 3VWSA 2N7YA 4JV0A 2O67A 3BO2A 4KO0B 1MWQA 2O66A 2GX8A 4TLQA 5LXYA 2F40A 5C7PA 1UZHA 1F0XA 1REVA 2OHDA 3O44A 5IZHA 1RADB 2IC3A 1VQ8S 1TK0A 4L3KA 2N4DA 1YBTA 1N33J 4F3QA 4AE5A 2XBPA 1RTDA 4NLDA 3CMES 3A8EA 5DDPC 4H4MB 4KGXB 1Y0HA 4O3QA 3RB4A 1X5OA 3GV8B 3B54A 3FCWA 5KOXA 3G6YA 5B0DA 3I55S 4DL0C 4IQXA 3AOBA 4YY3F 1JLBB 3CCSS 3FKBA 1U0HB 5L8RC 4B08A 5E3RA 3KLFA 1RI7A 2HQDA 3DRRA 2D3O1 1XQIA 2FUG9 5ETLA 3O1LA 1MG7A 1MU2B 2BMBA 2NSCA 3DCAA 2HQ3A 4ZMMA 4GC7A 1SUQA 2B4OA 3LTOA 3MOJB 2DNPA 3LGHA 2ZZNA 3RJMB 4LR9A 4PQUA 1G1XA 3CNQP 2CKWA 2JFKA 1OQ6A 1Y3KA 1EJ7L 4LFCJ 3SZ2A 4DV5J 3G2XA 3DMJA 5AXLA 1RWMB 2HQFA 3TA1A 1ZTWA 1HHSA 4U6PA 1REVB 4I4BA 1N5QA 4LSLA 2EK6A 4JV5J 3HJVA 1GX5A 3PEHA 4PPZA 2IC3B 1B3TA 4QYZJ 1WI6A 4IR1A 2XZTB 3AD9C 4OHWA 3A8JA 1P27B 4B3RF 1OYEA 1U1QA 4NZ6A 2J9DA 3FZ2A 5IM0A 4B3SJ 4DR7J 2QO3A 3W7BA 5DM7Q 4EYIB 1U2RA 3OL7A 2LQ5A 1EZZB 5HLFA 3EDRB 2UVVA 2XMMA 4PPDA 4DFKA 3A8KA 3FMBA 3PIOQ 2ZBRA 3KLFB 5IXUA 3DRRB 4EYHB 3VGTA 1DTQA 3C66A 3QT7A 1VDHA 4HEA9 1MWZA 2GJFA 2BKOA 2BOPA 3DLLQ 4CO2A 3MCNA 5IT9U 3EVOA 2O1PA 3G71S 2VIHA 1SUQB 3QSIA 2JSXA 2W2MP 4V1Ak 2KFYA 1X4EA 4PQUB 1B0VA 3W62A 1FXDA 3TRGA 3RBXA 2M0GB 3VF0B 1K73T 4PQAA 2W25A 1RDRA 2M52A 1Q8KA 4Q5VA 3Q83A 4OHZA 3E2EA 2HRUA 1SC6A 4ETZA 4LSLB 3U1LA 2ILZA 2DNYA 1GMWA 3GB0A 2LCWA 3HULA 3KNAA 3HVAA 3BR8A 2AJFE 4ZIWA 3CO9A 2MQ8A 3B8HA 4CWBA 5F8MA 3FZBA 4OHVA 2C3UA 3W66A 3BZQA 2CQBA 4YS2A 1AUDA 5IM0B 1TTHB 3LH2S 2G13A 1S97A 3DYAA 4ED1A 2DHXA 3PXGa 2X1BA 1PIEA 5K8NA 2QA1A 4LF8F 5HLFB 3R5AA 4LF9F 2X3GA 3CVKA 3NGRA 1R6VA 2EC2A 3QSYB 3MTJA 1NSPA 5L39A 3UD4P 2L3MA 1S76D 1DTTA 2VJVA 1DTQB 5CYQA 3HHLC 1MMDA 2N4CA 2FC9A 1RJJA 1Q4RA 4K4ZA 5DM6Q 1TKZA 1WHWA 3IBCB 2QFJA 4X4VA 1NJIT 3BGUA 5IFMA 3HHLB 1JJHA 3N01A 4F4AA 2QA4S 3FUYA 3A12A 4UF4A 3ZZTA 3LQVA 1YJUA 3BQ1A 3K57A 2UXBJ 4ECUA 4ED7A 3JTNA 4MKVA 3GE9A 2MKJA 4Y2KA 3OFEA 4H4KA 3T5HA 1W7WA 4NOHA 2Q6BA 2X1GA 3Q86A 1OY8A 4WU3A 5HMYA 3TYTA 2YY3A 1AZSA 3R1HA 1FRMA 1RKIA 4MK8A 3OVSA 2HFSA 4ZVGA 1FRJA 3MR7A 2XWXA 3BN4A 2DNQA 2V4QA 3IRXA 3DYAB 1PYSB 3QT6A 4DSJA 2LEPA 2V63A 5DS7A 3G4SS 2JWNA 1YI2S 1WHXA 3TJ9A 1RWWB 1KN6A 5CYQB 3KJQB 2J6SA 2MQQA 1TKZB 3RRKA 3KYLA 4PAAA 2HAFA 2K8GA 1ZM2A 2PO4A 4NA1A 2XGPA 4LUBA 2MHEA 4ZVUB 2Y0BB 1NJYA 1S57A 2HGLA 3CIZA 5HMZA 2OGUA 4R5PA 3CJ3A 3WIVA 1PKUA 3LUYA 1V5VA 1OYDA 1PC5A 4J9RA 3HSGA 4X66J 3ET6A 4C8ZA 4JI5F 4PZVA 2HFVA 1YGYA 2J9EA 3Q0AA 1TL4A 2CIMA 3CCJS 1XN9A 2E66A 2YKOA 1NXIA 3FQKA 2BQRA 4QYRA 3HKWA 2NUUG 2C2EA 1YJ7A 3ISZA 1OPZA 1NK7A 4OZNA 5AJ3F 2KVQE 2AJQA 1ELOA 2HWTA 3OL8A 2F63A 2UVWA 1T8EA 1SL0A 2EG1A 1AZSB 4C0HA 3S7RA 3CULA 3L95X 4U7UD 3UCUP 2M8HA 4A8FA 2BDPA 2PA3A 3FCVA 4PXBA 2HGMA 1JNRB 4WIIA 4V19J 5L1KA 4NRUA 1CJVA 2VV5A 3MR6A 4ECWA 2CQHA 3M6XA 4JV1A 1SJQA 2OSRA 4XAKA 3RBZA 3UQSA 4RX6A 1MN7A 3L9ZA 8ATCB 2UZAA 1M5HA 4YR3A 4YR0A 4YHHF 4WXOA 1HR0J 3WHIA 4Z7CA 3D4JA 2CPFA 3P8BB 2FJWA 1NJXA 2EI5A 4C3KA 3WQPA 2YKQA 2VHGA 1HIYA 2AW0A 3TX8A 3CIMA 3NL0A 5ETPA 2MGZA 4I6WA 4C4WA 2M7SA 1MSWD 2HQCA 4R5PB 2AGQA 2WHOA 4AL6A 4EGLA 4JI7F 3ET6B 3DKDA 2H4YB 5KG3A 3H2VE 2YH1A 1M5VC 1NZ8A 4MH8A 3VV2B 5F41A 2W2PP 4W92B 1SIWB 2ZH7A 1FA0A 2ZVSA 1OMSA 3O5TB 1RAFB 4RNFA 2DO0A 1I5OB 4LRAA 4EZ6A 1RISA 2W9CA 1IWAA 2QV6A 1WOPA 2JVOA 1N48A 1JXVA 5FJ4A 1RACB 4KTQA 1SVDA 3NGKA 3R27A 3Q2SC 5F9NA 5DLGA 2YH0A 1HI8A 1CJVB 4DUYJ 3CCZA 1SC4B 1ZOTA 4DOZA 3FMWA 3LALA 5K9FA 4CH0S 3HX9A 4OI2A 3HFVA 5IWAF 3M2VA 4C2MA 2Y1LB 4M1KA 1NDKA 4P2MA 2AU0A 2FVQA 2Z56B 2IM0A 4P73A 2IHR1 2AYMA 2YNIA 2KU7A 5ITHA 4J91A 3GYGA 4EMDA 4O3SA 1VQ5S 3F0NA 4DX6A 1WKJA 1P6TA 3UO0A 2H4WB 4LF8J 4FYDA 4CLPA 2LP4A 1R6YA 3UVJA 2Q3PA 1VRQC 4LVNP 3JXOA 2V2KA 2XCAA 2B4VA 2ZBIA 4FVCA 1DZ5A 2ATCB 1WJ9A 2F8MA 3EPIA 4NXNF 2MZTA 5ETTA 4PXCA 4DU8A 2BYCA 3EGZA 1CPZA 3ZZUA 3IR7B 1RLDA 4ZLPA 4USIA 4FXVA 1UETA 2ZDOA 2J8AA 1C4CA 4GO5X 4KT0C 2KHDA 3Q8SB 4G6VB 2XG8A 4QIEA 4ECQA 5B7WA 4NXMF 4QU7A 2GAHC 3JSMA 4DPOA 2IJRA 4FPIA 3GJTB 2W9CB 3LGNA 1FJGF 1AXQA 2CZVC 3K58A 1RQ0A 2VU5A 3M8QA 6FDRA 4O23A 3ETOA 4LIRA 2Z30B 2BJ1A 2XNRA 4J9VA 1R3NA 3ZTRA 2O3DA 1SJFA 2R8IA 1RU1A 2FD2A 2XYGB 4J7CA 2HQGA 4L76A 1FD8A 3RG6A 2DNMA 3VQTA 3LAMA 5F8HA 3M2VB 4CCHA 3H8YA 4QWAA 3WIUA 1RTJA 2BW7A 1T11A 5HI7A 3EXYA 7AT1B 2YNIB 4M5IA 4ZLLA 4ZVPB 2E5LJ 3D9BA 1UEUA 4WYWA 5IT4A 5HMWA 1KONA 1HHQA 2B0GA 1Q1KA 1CEZA 1X4FA 3BBFA 2RU9A 2GC8A 2KXFA 1XIQA 4UZBA 1S9GA 1TR0A 5J2MA 2V8PA 1JLQA 4YN3B 3FJ2A 2JLEA 2DNKA 2VKRA 2R7XA 3UVJB 2HGNA 3SYZA 1RAGB 1WG1A 3H5SA 2ILYA 2VUGA 1Q53A 1VQ4S 4ZDNA 3T41A 2FTRA 3M8YA 1Q7YT 2EFPA 4WP3A 5E2QA 4QBUA 4B02A 1X9MA 1WKKA 4IFYA 2DHAA 5DLFA 2MZJA 4ZVEA 2YWEA 4OJ1A 2IM2A 5KFMA 4G1IA 3J7A1 2KJWA 1YJVA 4MK7A 1R43A 3RZAA 2WOMA 1VJQA 3A8IA 1RKJA 3JSMB 4TY8A 2ZH9A 4LBIA 2V9KA 5KT7A 1H7XA 4KQZA 4JI5J 1Y4ZB 1OO0B 3M8QB 3K8VA 1T94A 3PRDA 2CG8A 1VR6A 3IG1A 4CNYA 3UD3P 1XEZA 2ZWPA 4LR7A 2QLWA 1RT3A 3G82A 2GQQA 2EXUA 3KLIA 1N5YA 5CD4A 3MI7X 3GIIA 1OWXA 1GK8A 5KG5A 3ELHA 4F0HA 2BA9A 2FQQB 2MZQA 2RS8A 1FKOA 1S9GB 3D3CJ 4HLBA 5J2MB 2XLIA 1QDUB 2RE1A 1H3DA 1C4AA 4YHHJ 3BJYA 5KG6A 4OZ3A 4HT5A 3PRBA 2G4BA 4CLSA 4OV6A 4NRTA 4LRCA 4IFYB 3LW5C 3IRWP 2YKNA 2XZDB 4DV3J 2XMKA 1LEOA 2XY6A 2CPJA 3CD6S 1FWKA 4WFNQ 3R97A 3FFIA 5AE1A 4KC5A 5KFPA 2IJFA 3PW2A 1RU2A 3EPGA 4TY8B 4NLRA 5M2RA 3RB3A 2UV8G 5GAHI 2CPXA 1I51B 4LR8A 2CJBA 1WC6A 1YJNS 3NAIA 3IG1B 4DX8H 5A2QU 2KFNA 1JIHA 2XC9A 1S9EB 2LEBA 5B09A 2V50A 4PR6A 5FLXU 3HT3A 2VQFJ 3OTCA 2FYXA 1RT3B 3MPWA 3G82B 4C8MA 3KLIB 1N5YB 5FIIA 3HHKA 3EICA 3GP9A 2AJ0A 1HD1A 3QMQA 3D1OA 1RBAA 4OIXA 4JI3F 4Q2MA 2WRMA 1XNQF 4TVAB 4CT8A 3ZTOA 3U7JA 3C46A 1FKOB 4OYIA 2R7RA 1BY9A 2E1RA 5HJYA 4NLTA 3HHDA 1Q79A 4ECYA 2YNHA 5ETNA 4ECVA 4UOCA 4TYBA 2XHWA 1UW9A 1KHWA 1MROA 2HFZA 3OFHA 3BDPA 1FCAA 2F3JA 3EZOA 2IVMA 2ADCA 3A3NB 3GFZA 1SL2A 4WXWA 4RNOA 2YKNB 3UCZP 3C3LA 5LMNF 1RSCA 2HVEA 4R0EA 4NL5A 3O6QA 1NKCA 3FFIB 1NPRA 2KRRA 2YKPA 1EAYC 2E44A 8AT1B 5GAGU 2G1HA 4QWCA 2EEYA 4ZCMA 2LDYA 1RWXB 1FRHA 3JTPA 2BUNA 2W4CA 3G96A 1RP5A 1VQYA 5F8NA 1RWVB 1SC3B 3NOCA 3TAQA 5DG7A 2UUCF 1CJUA 1L5UA 2UXDJ 4NXMJ 2LVWA 2NUHA 1CJTA 2CAJA 1S72S 4YB1P 3IAS9 3KJVA 4N8OA 1N32F 1FJGJ 3BB5A 1K1QA 3TUIC 3HJFA 1TKXA 2Y3YA 2H65B 5J1NA 3W61A 2LLZA 2XYPB 4M5KA 1TAUA 2FHMA 2IM1A 3ONQA 2ROGA 1YTYA 4CRJA 5KFTA 3DXSX 3ZTSA 2YNHB 1KFDA 5ETSA 4NEYA 1MROB 2RRNA 3DHWC 4RWWA 1WTFA 5LM7E 3GQCA 4IRDA 3MWBA 1EETA 3W9HA 2HAIA 1RAOA 4ZKAA 3HLUA 2IAJA 2DPJA 1X4AA 2X7IA 3HFKA 5HO4A 3RRHA 5KT6A 4OJHA 1WG4A 5L9NA 2XS7A 3TX0A 2OLWA 4I1TA 4OX6A 4ZN3A 4E2FB 2V8GA 1NZAA 4NCAA 4W4MA 5E3CA 4RUAA 1PAUB 1R8CA 2D3ZA 4OZ5A 1CULA 4OFZA 2XNQA 3LANA 3MPDA 2UUAJ 3IBWA 4ZPAA 3TUJC 1U8SA 4LBHA 1LFPA 2VICA 3D2WA 2BKNA 3KHGA 1UPPA 1M1HA 5J2QA 3PFEA 4ZHRA 1CJUB 1UA1A 1CJTB 3M1VA 5LSLA 1TK5A 2VFTA 1J5OB 3QPIA 4HT7A 3KJVB 2BABA 2XMWA 3EGNA 1OJ4A 1ZAXA 1AUSL 2AGOA 4A8WA 1TKXB 2G2YA 3NEKA 2UXCF 3ENAA 4KH0B 4A8MP 2CPDA 3D3BJ 2JRSA 3AOAA 1HQEA 1S1WA 1FDAA 5KFZA 2IBKA 1HNWF 4XDCA 4G1QA 2EVZA 3L3CA 3P96A 5K8PA 1DURA 4PYDA 1Q16B 1YDLA 1EETB 4ZOSA 1GH8A 1JQGA 4FF2A 4F2SA 2A2CA 3PG9A 3D0GE 1T3OA 2IAJB 5DQHA 4UQTA 4IO1A 4PEOA 3ZNUA 2WSFC 1WSRA 2B56A 4C8NA 2RS2A 5D0GA 1PBAA 1YITS 2FVPA 3TVZA 1FWLA 4DCJB 4JI2F 2WVEA 2R7WA 3FBBA 1M0SA 4Q8EA 4C97A 2GMLA 1CULB 3EJMA 1X60A 1Q5VA 3NY0A 3B4DA 3T6BA 5J2QB 3POTB 2W8LA 4U96A 4ZHRB 4LF5F 2NPIA 3MMCA 4DQIA 1HBNB 2COLA 3OXLA 3M1VB 3BO3A 4GC6A 4R25A 4DQSA 4KHMA 1HI0P 2W2OP 4N56A 5H9EK 3MEGA 2DJWA 5AE2A 1CC8A 4KSEB 4P2SA 3NRBA 5ADZA 3R5BA 5IV3A 1HWIA 4I2PA 4AQYF 3QGPA 2BQ3A 2K3IA 2F65A 1HQEB 1S1WB 3ZNJ1 3OSNA 2CPHA 3CJ2A 1LW0A 1KSPA 5LXRA 2M5YA 1IXKA 4G1QB 3MR5A 5JVGQ 1DLOA 5KAKA 3UCGA 2HWIA 4TQRA 2RHSB 2CQ4A 1XNQJ 5L46A 1OY6A 1WF2A 4FNHA 2CPEA 1IR1A 3VR1A 2V9WA 2B8QA 4DBQA 4Q2LA 3PW4A 4RNHA 3OBIA 1N36F 1S5ZA 5AE3A 1KWMA 3DM2A 5D0HA 3V6HA 3AXMA 1YBAA 1JX4A 5SZTA 2CJAA 4P75A 2QT7A 3W8PA 2UUBJ 1OS5A 4MT1A 1T9WA 4EFAC 1WHVA 4WFXA 1LOUA 3CF5Q 4F4XA 4QIFA 5CYMB 5LMNJ 3WC2A 4JI4F 1B64A 2C2KB 3MMCB 1O8BA 2MY8A 1HNZJ 3QGGA 2DNZA 3ZO7A 3QZ7A 4NA2A 3N4WA 1FEEA 1B4SA 3MR2A 2MZRA 2IIHA 3G9CA 4OX8A 4TKTA 4KGMA 2FY1A 4I2PB 2F4FA 2EPIA 5RUBA 2Z0GA 1VQPS 1GX6A 2B4PA 1NHUA 1RT4A 4HHUA 4HACA 4ENOA 1S99A 3ETMA 1HNXJ 1LW0B 1P9YA 4S0MA 1JLGA 1KS2A 5HANA 1EARA 2BE2A 4J90A 5A0YA 3KOAA 1DLOB 2B7BB 3L09A 2VBZA 3PCOB 1UFKA 2EBEA 1UJ4A 2CVEA 2PN6A 1LNQA 3T1HJ 3HSJA 2HKEA 4XPCA 2IMOA 3AAWB 3DI6A 1GQEA 4RW4B 2J7KA 5EUHA 3UPFA 1QM9A 2ZFHA 2MQPA 3CC4S 2RDDA 5GMDA 2DNGA 2W7OA 3Q8PB 6FD1A 3DM2B 1PJ5A 4URQU 4K2XA 3ZZOA 3DDNA 4UOHA 2CNNB 1URNA 4ERDA 1O51A 2PFFB 3JSYA 3THVA 1NJZA 2MDAA 2DR8A 2NXNA 2YWHA 1ICEB 4R8UA 2KT2A 3GJSB 4DL7A 1WWHA 3GG1A 3S1TA 3K2YA 3CD0A 4CZCA 3LP2B 2EK1A 4RW7A 2I9SA 1U1OA 5H9EJ 2UP1A 4NLUA 4DV7F 3N6LA 2K3KA 1YJ9S 5EWEA 3HT0A 4Y28C 3CJ0A 3NG8A 4IG3B 2FGOA 2OKQA 2KZMA 2GVZA 2BJDA 2HVIA 4C6AA 1YVFA 3DFEA 1RT4B 1S1UA 4HACB 3PRVA 1T0TV 4KHPF 4L6V3 3H4BA 4B9SA 1RAHB 2BE2B 5A0YB 3UFCX 1YQHA 4MIAA 4DUZF 3FNNA 3D6FB 3K89A 4OYPA 1B7FA 3QT5A 2B4UA 3TZYA 3KMQA 1ZPVA 2DO4A 3DI6B 2M9KA 2XZWA 4IDKA 1PJ6A 2APOA 2Z57B 1Z2LA 2YPYA 3HFZB 1YLXA 4AL5A 3NNHA 1NPPA 2QSWA 1S6UA 2RAQA 2XS5A 1KLMA 4TN2A 2BACA 4NA3A 4J9QA 2D74B 3I5BA 1TU0B 1J5EJ 4X4OA 3I82A 3OTOJ 4R8UB 3Q8RB 2W4DA 2MB0B 2VA2A 5I42A 3M05A 3F56A 2RQKA 1K1SA 3NCRA 1KBRA 4CYUA 3GILA 3G87A 4RW7B 4JI2J 4ZS6A 3JTOA 2J6TA 1YZ7A 2KT5A 1LKZA 4PWDA 5CH7B 3IGNA 2HZVA 3G86A 4DN0A 2YNGA 1IBCB 3SFGA 1M5SA 3VGVA 2VL1A 2GVZB 1J27A 1RWPB 4L74A 2M88A 4QIGA 1DRZA 2BM0A 4ETXA 3LPEA 3R5GA 3RB6A 2F5GA 3PW5A 4LF5J 4ILMA 2DH7A 3EE3A 1S1UB 2DGUA 4QPTA 4GKJJ 5HSPA 2Y9HA 2CWXA 1Q0NA 3HD1A 4RZRA 2J7WA 3KLGA 4A8QA 2JZ5A 3BGFA 1A6LA 5KFHA 3ZXWA 3W9JA 3QNWB 3CCES 3OHBA 3GMGA 2DY1A 2HSEB 4AQYJ 1UL3A 3QJLA 2OEJA 5D15A 2ZH6A 3KKFA 1FFWB 4OYWA 1Q82T 4XK8C 1I6JA 3KK1A 3MEEA 2QL9B 1F60B 2EKNA 1UWBA 2DXDA 2BJ9A 1KLMB 4CO1A 2ZE2A 2O01C 2XI2A 1R7IA 4DR1J 2XYHB 1IM6A 3MM7A 3EVWA 1RTHA 5B0BA 3CDUA 5E41A 1GMUA 3BF4A 2PMZD 2BW2A 4TU9A 5KFWA 1FFSB 5DZ6A 1N36J 5I42B 2IM3A 4U8VA 4IUFA 3MMBA 4CYUB 4I67A 2E5JA 4PWDB 1PG5B 3ENWA 2UU9F 3MUTP 3CDWA 4MAKA 2YNGB 5B08A 4K5RA 1D9DA 1VI7A 5GAHU 4I2QA 4P2XA 2F1FA 2VFSA 3GYXB 3KG0A 1JLEA 2QLBB 3PEJA 1S4EA 2D3UA 3EDQB 3AQOA 3OFFA 2ERRA 1NDLA 1RTIA 1UEKA 4PRFA 1X4GA 1APSA 3J7Z5 4GVLA 4LF4F 3CJ5A 3PYEA 4A48A 4ED3A 1MW7A 2OD4A 2X51A 4OI1A 1ZTTA 2R7UA 2GMHA 5C42A 2WCXA 3CGIA 1YRTA 3EGWB 2CG4A 1RUSA 2C3MA 3RB0A 4OZ1A 4FF3A 2CJYB 3D1QA 3OVBA 3CMAS 3KK1B 3MEEB 2KM8C 1WC1A 3ILLA 3LAKA 5HP1A 1UWBB 1WDDA 3M32A 1D9AA 4CH1A 2WSEC 4QIWD 1F2GA 2W9AA 1B70B 4J9UE 5H9FK 2BZ2A 3I6PA 1T95A 2ZE2B 3QWUA 3QO9A 1T03A 2CYYA 1VRTA 2DIVA 1RTHB 5D77A 3UW1A 1FXRA 1X4BA 1AFJA 2R42A 2RVJA 4ES1A 4OYZA 4DV6F 3T19A 1Z2ZA 4OI4A 3WX4A 1RT7A 3MMBB 2V94A 2YKMA 3M30A 3BYPA 1AT1B 3FGVA 1EQMA 2P8IA 1RT2A 1TVRA 1X8DA 1SJRA 4LMZA 3FDSA 4OZLA 2R9LA 4PUOA 5B0FA 4I2QB 2XLJA 1VQNS 2MXYA 1UW4A 3RAMA 1M1KT 1UJ6A 4KR0B 2QJ3A 2F4VF 2PSZA 3E01A 3W64A 2XULA 1CQNA 1KP6A 2XMAA 3D0HE 1BE4A 4DV7J 2IVYA 1RTIB 3MTKA 2ZH5A 1CG2A 1T9VA 3DNCA 1PC4A 1G2EA 4QPXA 3TWZA 1YG0A 3W60A 5C42B 3C19A 3HDSA 1HI1A 4NLXA 3I4PA 4BHQA 1WSVA 4KHPJ 2H51B 1IWGA 3CCUS 1FNMA 1U1LA 3JS9A 2LMIA 4UUWA 1MN9A 2XGQA 1FHTA 5HP1B 1HARA 2DEJA 1YZ6A 3M32B 4U8YA 4DUZJ 4ANEA 2E29A 4ED0A 2A10A 1S59A 3QO9B 1A9NB 1T03B 4FBTA 1VRTB 1V9OA 3M4XA 2DGQA 1KD1T 1NK9A 2DYAA 2Z58B 2J9CA 3DRXA 2N3OA 3K17A 2DR7A 2K2PA 2RMLA 1RT7B 3DOMA 3DLJA 1NM2A 2OIHA 2OH2A 1AFIA 1QJHA 3BSAA 2YKMB 3M30B 3NMAA 1RT2B 1TVRB 3OR1A 2R2TA 4L3NA 2B5JA 4PUOB 2JX2A 2VASA 1JK9B 1Q95G 1KC8T 1T02A 2PMHA 1U1MA 1R0BG 3IGVA 5FD1A 5F0UA 4CP5A 2RDJA 3E01B 2WZ1A 5FDLA 3H90A 5I3UA 1TKTA 2N82B 2MTLA 1VRUA 4WE1A 3J7AN 2WW4A 3FEZA 5F3TA 3J81j 1KHVA 4LSNA 2VFRA 2BOAA 4DZDA 1HWJA 1VLOA 4WF9Q 4LFCF 2YPZA 3BH6B 3OL6A 4DV5F 2VG5A 4GRSA 3T5LA 1V6HA 4LFBJ 2JC0A 3K5MA 3M9OB 2XSJA 2VPXB 3AA8A 4NCBA 4JV5F 3KLVA 1ACMB 3AJ2A 2ALZA 2W01A 4M5HA 5H9FJ 3ISND 4A8XA 4NE9C 3M9NB 3CB4A 4RWXA 1Q5YA 3TP2A 2DXEA 2DPIA 3LA0A 2CQ0A 2DGOA 3HPOA 2BRKA 2R7SA 4OMFG 1UEVA 3JSBA 2RKIA 1NB2A 1K9MT 3I56S 2R2SA 5DO2A 4DR7F 4CIOA 3VAGA 3DOMB 4FVMA 4K8RA 2W7PA 3MAHA 1KQKA 4CO0A 4HDGA 3HF5A 4DS4A 3CC7S 3OR1B 5I3PA 4CLWA 5AXNA 3CJQA 4ECTA 2B5JB 1YBUA 2R3VA 4TQSA 3TA2A 4XDDA 4U7UK 1N5TA 2GHVC 1U47A 4RBVA 3G6VA 2VG7A 3AB2B 1I94J 5KFIA 2VODA 2HVDA 4XPEA 1WC4A 2AT1B 4ELVA 4DL4A 2PI4A 3EZ5A 4N7TA 3DLGA 5FDLB 3MGJA 2AEJA 5I3UB 5C2CA 1TKTB 2QFIA 1NHKL 1LW2A 1VRUB 2YQ0A 4WE1B 3F41A 4LSNB 1M90T 3HD2A 2ZHOA 1NRKA 2XI3A 5BYRA 4A47A 2UU9J 5AXMA 4MIBA 3HZEA 4WFBQ 3M8RA 1HBUA 3NWRA 3WC0A 4Z7YA 2VG5B 3PKYA 4NMLA 4J9PA 1IQTA 3MPVA 2FVRA 3IMQJ 1YSJA 3ILJA 5A8RA 1XMOJ 2HRTA 2XSJB 3CD7A 1CC7A 3CDBA 2P9GA 3P49B 2C2RA 2Q6CA 1BWEA 4OZ0A 3W5YA 4M5JA 4P71A 4N77A 2OP5A 1FDBA 1LFWA 5LL6d 3J81Y 4KB7A 2GS8A 1OSDA 4DR4J 3SDEA 4NLOA 2R7VA 2RKIB 1L3UA 4MKAA 2K7KA 4QWDA 4FXDA 1XERA 1BC6A 4K0KJ 2OMOA 4X84A 3IR5B 1NU4A 1SQEA 5KFRA 3BPDA 4P2FA 3HHEA 4H54A 3B6BA 2BE7D 4UUXA 1TP7A 3TJAA 2GQCA 3V5RA 3ENVA 4IH7A 1Y7PA 1SJ4P 2DH9A 1RHQB 1ZA1B 2ZOGA 1QAJA 4OJGA 4P10A 1UCNA 2G2OA 2VG7B 4ER8A 4EWTA 1X4CA 3DLGB 4R0JA 4AT1B 2OPRA 5HJXA 1LW2B 5M2PA 2FJXA 3ZZPA 2RT3A 3T9ZA 1UKUA 3LGMA 5KFLA 2HYIB 2E1MC 2CNLB 2DRDA 2GFFA 4IOCQ 1HBUB 3Q89A 3GCWP 2B9EA 3H59A 3G8TA 1GFWB 4CLKA 2Y1RI 4F7VA 3HK2A 2YQ1A 5A8RB 2BQUA 3U1MA 4DCOB 4JI0F 1HFEL 2QSFA 1UZDA 3N28A 2D9PA 5ETOA 1P1TA 4ECRA 1RHUB 1WEYA 5CHCB 1WACA 3SCLE 1VC5A 2CRLA 3TA0A 4RKUC 3K8WA 2HVHA 3SDEB 3MM9A 1D3WA 3SSQA 2KT3A 1N56A 4KE5A 1W25A 2J7UA 2XM3A 3ZZRA 2ZEJA 1T9TA 2CXEA 2MHNA 2ZBQA 3BEGB 2YX4A 2JNJA 4C8KA 4K4SA 5IC4B 4ZPCA 3FCHA 4C8OA 2ZC3A 3CCTA 2AX1A 1VS3A 3OTDA 4K4WA 5IOLA 3DLHA 5ETVA 3CE8A 1W2IA 1UPMB 4Y0FA 3KHHA 2J0SD 2HEKA 2GMJA 1FK9A 2MKCA 2ABYA 3LF0A 1VQ6S 2VBYA 2AHOB 3QGIA 4OL8A 4ES3A 3AOCA 2FC8A 2V0NA 2OPRB 2DNOA 3FEYB 3GYNA 4C7QA 5CQGA 2E5HA 4RU2A 3N79A 1P9QC 3CJ4A 4KRWA 1S49A 5JXSA 2KL8A 4X66F 4DV2J 3HSDA 2QEXS 4FP9A 1TMMA 3R7BB 2E7WA 1IBLJ 3W5XA 3TZZA 3T3FA 5CYJA 4DV0F 4LFAF 4NZ0A 1Y5IB 2RRAA 4O3PA 5KFNA 5B0EA 1YJTA 3FEXB 4DL5A 2LXUA 2KTQA 3K0JA 1VIOA 2V6AA 3KFWX 5EWFA 2BE9B 2D3OR 2B9YA 2P5VA 4EZ9A 2HBZB 2PA8D 3MM9B 5F8LA 1U1NA 3KUEA 3ZZ0A 3NLCA 1JJ4A 2XCPA 3Q23A 4JOUA 2PGCA 3BQ2A 2HBRB 5CD4H 2C1EB 4CNZA 4Y2MA 4Y2AA 4DSKA 5HBMA 1WEXA 4DEZA 1F9EB 2Q66A 1ZS6A 3DHXA 3J81U 1AW0A 2Y1IA 4ES2A 2MQMA 1X4HA 4X4PA 3LWLA 4I7FA 1YJWS 3TQ1A 1OSCA 2CFXA 5DGAA 1H38A 1HR0F 2AJ1A 3W2WA 2AP6A 2H1YA 3C8YA 3PR4A 5HROA 1FK9B 2VD3A 2HBQB 1LQ9A 2HMIA 1P1LA 3IS9A 2BEFA 2H9ZA 3FSYA 3QT8A 5LMUF 4ZIVA 2W4PA 3GJQB 3L7PA 2DR9A 5DRKA 4USMA 1M5KC 3NBPA 2VDIA 2HHPA 4X65F 2ATLA 3DN9A 1X5SA 3I87A 4ZVTB 2Z2LA 3IN5A 2BX6A 2IRXA 4P7VA 4NI2A 3N0VA 3F44A 3FK4A 3S01A 3CJKA 2KVIA 4PWUA 3U27A 5GAGI 1HW9A 4U9RA 2DGTA 3HHLA 5KFBA 4MJKA 1BWVA 3SXLA 4O3RA 2EFQA 2QC3A 1IKVA 3AT1B 1FKPA 4FKYA 3D67A 4C11A 1SPBP 2HIQA 2C3YA 2DBBA 5F9LA 2ZOMA 5G0RA 4IOAQ 4C0OC 3D54A 2MLXA 2FLLA 2GJ2A 2ZOFA 1JLCA 5HBMB 4HH1A 3PW7A 2ASLA 5BYSA 1RTZA 4DUYF 1U4BA 1HKAA 2I8EA 2HLUA 2UUTA 3GSDA 4WK1A 4J9SA 4KJIA 1OY9A 2MKSA 2VC1A 2AQ4A 4JB8B 1S6QA 3CDEA 4I7FB 2MY7A 4DR5F 3W2WB 1X0PA 5HROB 2ZHAA 2CADA 4WBFA 1NH7A 2HMIB 2CQPA 4UY8T 3IS9B 1R8AA 3AFGA 1GMVA 4YB5A 4DWIA 2HVZA 4RU9A 2ZUGA 1ZBTA 4OLOA 2NREA 1T9UA 3SI8A 4YQWA 3BGRA 3NBPB 1S10A 2Q43A 3C15A 1NUEA 2AEMA 2YQ3A 2ZM6J 4YP3A 2JEGA 4USUA 2XO7A 3OT9A 4FS1A 2LQJA 1YWXA 1ULRA 3MECA 4HTIA 2XWYA 4NI2B 1NK0A 1NK6A 2HK2A 3PYFA 3CJKB 4AYBD 1D0EA 1G4CA 1LWFB 4AUKA 1TQLA 1F5CA 4J9LA 3CCVS 5HQLA 4RW8B 4WK3A 4FPRA 1IKVB 1WOSA 1FKPB 2YX7A 4C11B 5D0EA 3IM9A 3FSIA 4NZ7A 2R7TA 1ZPWX 5KFAA 5G0RB 4JI0J 4JI6J 3KXDA 1ZM3A 1NLKL 1JLCB 2HHWA 1SKSA 1WELA 3QBCA 1UVKA 4M5NA 1S6OA 3FVYA 1E6VA 5GMKa 5F8JA 4O4GA 1NB7A 4WZMA 1U02A 1S6QB 1DJ0A 1GEHA 2C2NA 3VGSA 3QWPA 2HURA 4QCLA 3Q2TC 4ZCIA 3AH6A 4YOEA 5A8KA 4LBPA 2E5LF 2WB1D 3JQJA 1M1GA 4F4WA 4N41A 2BVZA 5B0CA 2XHCA 2I6WA 4CLLA 2DGSA 4RR5A 3R5DA 2C2OB 1KRPA 3MXHP 3UN3A 3SQOP 4UTGA 2I0XA 5KFKA 9RUBA 1QAYA 1EKSA 3HSZA 3BGRB 2DXFA 3H5YA 3C6TA 3C15B 5SUHA 2M8DB 4ELTA 2G0JA 1SBRA 4PG7A 1WG5A 4YFUA 3MECB 3NGTA 5JMNA 1Y5NB 3TARA 5A6PA 5G4DA 2EFOA 2FVSA 2W24A 3QYYA 4OYXA 5ETRA 3GG0A 3R1LA 2DIUA 4B9LA 3CW2C 1IN0A 3D1HA 7FD1A 2OJ3A 2Z2YB 1TELA 4O3NA 1ZA2B 1N52B 1M5OC 1NEEA 4MYTA 1RABB 4X4NA 1QVFR 5E0OA 1U6ZA 2HS4A 2ASJA 2ZH4A 3OUYA 4CLUA 1FVQA 4LFAJ 4OHXA 3GFYA 4DV0J 3NNCA 3B78A 1XR7A 1E6VB 3C16A 4O4GB 2FZKB 4EO6A 4JYAJ 1RA7A 4DL3A 2W9BA 3D6TB 1UA0A 4X62J 3IR6B 4J9MA 4NEZA 3DRPA 5A8KB 5BXIA 3IP0A 4WTOB 2SXLA 3PZPA 5J1PA 1KTQA 3BDEA 3PKMA 1EIYB 2I2YA 2MSSA 4PKDB 1KVIA 2ZZTA 3CUNA 1D1UA 1SI9A 2GZOA 3O3LA 8RUCA 4IH6A 4FDFA 2BJ7A 4CM2A 3PFOA 3AA9A 2XY7A 1BLUA 1SKRA 4PG4A 3DOKA 3BYRA 1JB0C 3C6TB 3SV4A 2V2QA 1CLFA 1UMJA 1L3KA 2PDAA 4I64A 1U7LA 4NLWA 3BSOA 2R2UA 4DV3F 1JKHA 5LMUJ 1FRKA 4FZVA 4ZK7M 2ZNZA 4RUCA 2J9DE 2ZDPA 1RWUA 1Y11A 5B0GA 1DBDA 3TW0A 3OLAA 4KV8A 1FNXH 3QAUA 3P4UB 4X65J 1FKAF 1GAOA 3GZ7A 3IWLA 3BBCA 5A76A 3OUYB 2PE8A 2BBEA 2IA6A 4A8YA 3ILOA 4DF4A 3VHQA 2KHCA 3C16B 1R8PA 3FBFA 5HVGA 1MMNA 2VQFF 3Q24A 2ZH8A 2D7SA 2ROEA 1U25A 2W9BB 2VPZB 2MLZA 4Y2CA 2RQCA 1B99A 2ZJQQ 1BXNA 3DRPB 4LF1A 1SC1B 2GO9A 4ZP6A 4Q43A 5CZXA 2OEMA 2KXNB 2H54B 4ZVFA 5KFXA 2DNRA 4ED6A 4L75A 4QZVB 4BWMA 2RD5C 3CT9A 1HWUA 2NR0A 2PEBA 2FZGB 2P9EA 4O0IA 5L9XA 2JEJA 3QQCD 1FJCA 3M6VA 3MDFA 2QA4G 4DR5J 3DOKB 4QJVA 3GSIA 1ZZNA 3HHLD 3CWJA 3VTIA 3C14A 3CJSA 5DGBA 3T5JA 2DEIA 3M2RA 1KQFB 3RAQA 1VBYA 1JKHB 3CEDA 3GLJA 2CQ3A 2ACYA 3DRSA 3BM7A 3OTBA 1GMWD 4KV8B 5KG2A 1N6QB 3M7VA 3DC2A 1XBWA 2KRBA 4H4OA 2G2ZA 4QR1A 3LPYA 3MAQA 3ENQA 4DMZA 4YUDA 2GNKA 3UN5A 1N34J 4DSLA 5A2QY 2UXDF 1KTVA 4Q45A 1SH2A 2R8JA 2J76E 3ZTPA 4Z37A 1I3OB 5FLXY 1WHYA 3D5MA 5LJ3Y 5D6GA 4PG5A 4DV4F 2RUSA 3ULHA 1RWNB 1VQKS 3DLKA 2FHJA 3KG1A 2AV5A 2JC1A 5D3GA 2LXFA 4ZJLA 4DFPA 2ZVIA 4WP8A 4DZ6A 3H40A 1VQLS 1PYOB 5HQ8A 1EB0A 3AJDA 1P8GA 2NCKL 3JAMU 3FRZA 3OJUA 3C14B 2CJ9A 3M2RB 1CSJA 3C6UA 2HIYA 1Y3JA 1I1GA 5BR8J 3BSCA 4DSFA 4MFBB 1IR0A 4PYAA 2IRUA 1LXNA 3D6HB 3I5AA 4WIQA 3DRSB 1PBUA 1RHKB 3V81A 4ED2A 2DNNA 4HVZA 1S1TA 2Z2MA 2JDJA 1RBOB 1UTAA 5KFOA 1RT6A 4H4OB 5LJ5Y 3R9LA 1QLNA 4ZVRB 2UUAF 4JI8F 2LEAA 3I0RA 2B8PA 2GA7A 5IQQA 3QJPA 4TLRA 2GJIA 4N5SA 2HHSA 1WOOA 4KGKA 2RIJA 3EYZA 4CLTA 2ZKTA 2AYGA 3LOUA 2B43A 4PXDA 3DLKB 4I6YA 2GQ2A 1CS4A 2W7AA 3IC1A 1S9EA 5D3GB 4JI1F 3ICLA 3B82A 1FI4A 2RJZA 2YXLA 2M3DA 1IKYA 5KT2A 4FYYB 4DS5A 1MMLA 3OV7A 4U95A 1S0VA 4TY9A 7FDRA 1V5IB 3EGVA 2UV8A 3PM9A 1LWEA 3UD5A 4KBIA 4JV2A 3SCIE 4X4RA 3BBBA 3MFHA 4ED8A 2VOPA 1VQSA 4CO3A 3C6UB 3I4HX 4HL9A 2ASDA 3IA0A 2VG6A 2JFDA 2GVDA 4K59A 2WSCC 5EGYA 1N5SA 2V69A 3SCJE 2IYIA 1R89A 1O0PA 4NLQA 4CM0A 1D09B 3V81B 2UUWA 4OYMA 1S1TB 4P72A 3FBEA 4IRCA 1F1BB 2CQCA 3AY0A 3KK2A 3TEHB 1KVJA 1RT6B 2FB0A 3AODA 2HHVA 5KFGA 1S9FA 2V2ZA 3WZ0A 1U1RA 1WI8A 3I0RB 1DY3A 1QAIA 3FRYA 2FJVA 4YR2A 2E9TA 3PO4A 1KLNA 4LSZB 4M5MA 2KG1A 5BJRA 2IJNA 1CS4B 2QLXA 1U49A 5F0WA 5DG9A 4B9MA 2LA6A 3MCSA 1IKYB 2VBWA 4K7QA 4M95A 2KFZA 2KG0A 2MPUA 2JEFA 2HFOA 1VOMA 4C3MA 4W90B 5T41A 1FT8A 2J0QD 4ED5A 1LWEB 4C8LA 2ZBPA 3QRPA 3SSRA 4FF1A 2UVRA 1OQ3A 2PMWA 2IVFB 1UJ5A 4EO8A 4DX5A 4OX9J 2U1AA 4QWBA 2QG9B 1S48A 2VG6B 5K14A 2GVDB 4URGA 5CAAA 1XR6A 2E5GA 4FYVB 1JLFA 2DNHA 1IKXA 2KJVA 1HQ2A 2QYCA 1IM4A 2ZHBA 4DI6A 4DCPB 1KQSR 4WKRA 3TI0A 3KK2B 3M8WA 2UUBF 1UVLA 1SL1A 1RAJA 2WW8A 1FRIA 4RUBA 3MFIA 1X4DA 3R2DJ 4LF2A 1HNZF 1S1VA 1RHRB 1HL6A 5KG4A 4UOFA 1RTDB 1C0TA 1YX2A 4DSEA 2D1CA 1NK8A 1NNDA 2V8VA 2DITA 3T1YJ 4B9NA 4NASA 2VFVA 3TVYA 4DR2J 4TU7A 3HKZD 2ZBCA 3NKYA 3EUNA 1HA1A 2XLKA 1H6KX 1HLWA 2ALYB 1HNXF 1J5OA 1N0VC 3BREA 1LXJA 4DV4J 2CNKB 1RGVA 2JVRA 4ZVHA 2YTCA 2OO4A 4X4TA 2DB1A 3EZUA 2MEWA 1HQUA 1NHVA 3T1HF 4LF6F 3VAFA 3WX8A 2YVSA 4YDDB 4X2BA 2P6SA 5K14B 4XIUA 3KLHA 3KK3A 3CXCR 3K7RA 2DCUB 2AWZA 1WTBA 5J2PA 4HHHA 1JLFB 4EBEA 1IKXB 1UVNA 2A18A 2VFUA 2CQ2A 2G0CA 4LT6A 1F9HA 3EM1A 1U09A 2RU3A 3RYLA 4DPWA 3E3XA 3DMJB 1U2CA 2NS1B 4DL6A 3GFXA 1N5VA 3JB9k 1ZM4A 1VGYA 2D69A 5DDQC 4B9TA 2FHJD 2NSBA 2Y8WA 1V3ZA 1S1VB 1KOOA 1XR5A 3AXKA 1RT5A 2MYFA 3BR9A 1FX2A 1V3SA 1C0TB 1HWLA 4WPAA 1LV5A 3MPYA 3A4TA 4RBUA 5D4LA 3TAMA 4JI8J 2XSFA 3POTA 4USWA 2HNDA 2HFNA 2OEKA 4DFMA 3V4MA 4KYZA 1FNOA 3QIPA 4OYOA 2LYVA 3P6YC 1F5AA 1HBNA 1ZAVA 5E7OB 2OTJS 4F67A 2WB4A 5C5JA 3ZTQA 4K4VA 1VQ9S 3CSKA 2MJNA 3MURP 2POKA 1IBMF 4ILRA 1TL7A 1VMBA 3GR1A 3P5TL 1HQUB 1IUJA 1S0OA 2QLJB 2EC0A 4OLPA 1H2UX 4Q0BA 2Q79A 1QSLA 4BBYA 4JI1J 2VQEF 4MK9A 2HRYA 1NKBA 3KLHB 3KK3B 2V4JA 3PW0A 1RWKB 5J2PB 2DRBA 4DPYA 2ZH3A 2R8KA 4O4RA 1JJCB 1SJ3P 5HN0A 3JYTA 2HFUA 1WDTA 2ZJPQ 5EDWA 2GIQA 2OI2A 2Z8QA 1VHFA 2CJQA 2EFNA 3W9IA 1XMQF 1J5EF 4AXJA 3MR3A 4A46A 3OTOF 1FWPA 2DGXA 2DD8S 2BANA 2DHHA 2YWFA 2AEFA 4NMXA 4N47A 4BS2A 5IS2A 1DARA 2QTWA 2E1PA 1RT5B 2K1RA 2B9WA 3PJ9A 5AXKA 3D66A 3J7YI 4N76A 4Y65A 3A13A 3CJRA 1MLAA 2RILA 3KJNB 3TAMB 5EX3A 5GVQA 1WF1A 4NLVA 3A3PB 3HVTA 5CYMA 2XB2D 2L48A 2HNDB 4OYBA 2KO1A 3I32A 4M63A 3QIPB 4USVA 5D8HB 4GKJF 3FBCA 3QJJA 3GFHA 2DHSA 1AYEA 3OFGA 3DU5A 5C24A 5D4NA 4MYUA 2IFXA 4I69A 1A7GE 1DTTB 1TL7B 3AHPA 4Q0BB 3VVUA 4X4SA 4O3OA 2EFVA 2B7CB 3AQPA 3QATA 2V4JB 1CQMA 2L08A 3AD7C 2YX1A 4YY3J 4ECXA 1FTRA 1S4FA 4IOBA 1PGZA 3UDLA 4H4KC 3NS6A 2H5IB 3RGIA 4ZA1A 4F4KA 3HZGA 3JYTB 1LWXA 3O8WA 4DR1F 2DRAA 1NKEA 2DKOB 3X3UA 3UDEA 3TJ8A 2E5IA 4FN5A 4RW4A 4DLEA 4J5OA 3QFWA 1QAXA 3N6NA 4CI0B 2ZJRQ 2NXUA 2EG2A 1FE0A 4DN9A 4YB6A 5MAOA 2BANB 4HHJA 3JQMA 1LK5A 4ZPDA 2K1RB 4FYXB 4GMKA 4EBDA 4KAIA 1GTHA 2LQ9A 3PTWA 2QL7B 4IH5A 5M2UA 3HVTB 3IWXA 1BD6A 1W26A 1Q8IA 3ZC4A 2AKWB 3THTA 3IRXB 4QR2A 1TK8A 5F8GA 2LU1A 2L9DA 2CPZA 2HPUA 1BUXA 1VFJA 4LF7F 1TAQA 3LP2A 2E7XA 3A3OB 5C24B 5KFSA 1X5TA 4X4UA 2B9XA 4B3RJ 2WVDA 2ZUAA 3PHEA 2BR0A 1VHIA 5D0RA 4ZPWR 1K0VA 3WBZA 4IG3A 2FJDB 3QGHA 4F36A 3UR3C 2HHXA 5LT5A 2QGFB 2NYIA 1XC9A 2CPYA 1KEKA 3PVXA 4TYAA 2QA2A 5ETQA 2R4FA 4OHYA 4C3LA 1WNEA 4DXLA 1YIJS 1KOHA 3DLBA 3HVWA 4LF6J 4C9DA 2CZ4A 2VBXA 3S8SA 3RBEA 5HAOA 5E33A 3A1YG 4FS2A 4KPYA 2YWKA 1JXEA 2OSQA 2WBMA 4XO0A 1XJWB 2NZCA 4ICLA 2PIIA 2Y0SD 2I38A 4WU2A 3GPAA 1NSAA 2F9DA 2W8KA 5D4OA 1VBKA 1RHJB 1FO1A 1GXTA 1UVJA 2FIUA 4ZN1A 4DHVA 2QX0A 2DCLA 4LVOP 3TUZC 2RSQA 1Q86T 4WFZA 4ANDA 3PIPQ 4QOTA 4L73A 5A8WA 2H5JB 2LXIA 3K5PA 2CA9A 2DR5A 3P45B 1R0AA 4DPXA 3OQ2A 3N9UC 2CPIA 5DETA 3H5UA 3I0SA 2MKKA 6AT1B 4EUVA 3OW2R 1JJ2R 2LECA 1FVSA 9ATCB 2MGZB 4KIAA 4LF9J 2XTJP 2KDOA 3QLHA 4E8UA 4PG8A 1PYTA 3TZWA 2L9WA 1IBMJ 1NSKL 4F02A 4RJVA 1KKHA 2IPOB 2J0XA 3R2CJ 2E9ZA 3M8SA 2VQEJ 2G9OA 1U6BA 4A8SA 1IBKF 2E7VA 4NYZA 2QL5B 3TUPA 2VPWB 3OD2A 4ICLB 2OELA 2ZZMA 2GAGC 3ADAC 1Y00A 3VAMA 4RL1A 4RNNA 5KTQA 4P7TA 3K5NA 2RQMA 3OXGA 4WKYA 3NS5A 2QN6B 3CJTA 5KFFA 1XMQJ 1ROFA 3CPWR 2DNLA 2MZSA 1VLYA 5HVFA 2OPQA 2XMUA 4WTYA 4D3HA 2HHQA 2BJ3A 1RAEB 3CD5A 1T9XA 4K50A 3H2LA 5A8WB 2UVUA 4F0KA 1RZMA 1XMBA 3LP0A 1AROP 3UN2A 1XTZA 2KYXA 4AL7A 2FLOA 1R0AB 3W63A 4Y3CA 4ZP8A 5CXTA 3I0SB 4CH7A 1NK4A 2Z2ZA 2FHOB 4LFBF 4B3OA 4ZCKA 1F3VA 4HYKA 1KDNA 1RK8A 1XWLA 3QLHB 2IY5B 2VH7A 1NJWA 3VAJA 4CT9A 1VQMS 1D8ZA 2P2CB 1VC0A 1SCJB 2LDIA 3VALA 2G1DA 1SXLA 1AA1B 2Q1LA 5K8MA 5HQMA 5IV4A 3H42A 2MJUA 2OPPA 3THPA 3MPUB 4Y34A 1VK3A 4F8RA 1FE4A 2CDRB 3RTVA 3H0PA 3UNGC 1QSYA 1HYSA 4O0NA 2J5AA 2MQOA 4OJ3A 2WAQD 1FESA 1BGXT 2OPQB 2FJBB 4K5SA 1I94F 2PD1A 4Z2XA 3MAAA 1DFDA 2C42A 5HL7Q 2HHHF 5AJ3J 4PG6A 4QQBA 2RF2A 4HR2A 4KHRA 3LP0B 1O6XA 1RTJB 3RR7A 2D41A 2GIRA 2XQCA 5CCLA 2YNFA 1CJKA 3Q8VA 1RT1A 2GGPA 3D68A 3Q8YA 3V2UC 3SBMA 5T14A 2WVFA 4B3OB 2GHWA 3TANA 2GIFA 3VAHA 2V68A 3EMTA 4A4JA 2OFGX 1XMOF 1JLQB 1B0TA 2AIRB 1TL3A 5A6WA 1RE1B 4LF7J 4B3MF 3Q8QB 4M5GA 4ECZA 4J37A 4DR4F 1TL5A 2I1RA 4IQMA 2WVBA 1S77D 1NBEB 4AD6A 1QVGR 4K0KF 2OPPB 3NOGA 3NWGA 2WOMB 4ED4A 1F5BA 1R0CB 3FC9A 5D78A 4EBCA 4JI7J 1HYSB 4I6AA 3E8OA 5BYQA 4OI0A 3VQSA 2B6AA 3PDNA 1Y10A 2KM8B 3I96A 4BCAA 4DPUA 1V3RA 2KI2A 3MAAB 3HM9A 1NO8A 1LK7A 2CDQA 2YKAA 2DH8A 3KTQA 1QUPA 3ZZYA 2CUYA 4OI3A 2RF2B 4LJMA 4A8OA 1B7YB 5KFJA 4EU0A 1IKWA 5J2NA 1N54B 2C2MB 4F26A 2YNFB 3R6LB 1CJKB 3UDCA 4C98A 1RT1B 2FJEB 2GGPB 2X1FA 4L72B 3KNGA 3RR8A 2F9JA 1S7IA 4UZCA 1RHMB 4DR3F 2U2FA 1WEZA 1EP4A 1TL3B 3SCKE 5IWAJ 2V5HG 2RDIA 2ZH2A 1HD0A 4YMEA 3DDIA 4LREA 2K7JA 3MMJA 1TUGB 2KH9A 2X1AA 5CCMA 4M94A 2HS0A 2OTLS 3BS9A 3US5A 3V6KA 5IC6B 2LFVA 3OHAA 2WVCA 4QU6A 3SIPB 1DQ9A 4KH1B 3B4MA 2J8SA 3I5CA 2ROPA 4DF8A 2RHQB 1FDNA 4KKOA 3CCLS 3SQGA 1NK5A 2R8HA 4K4XA 3KWMA 2GO8A 2WBRA 3TOQA 2PEHA 3IM8A 2VOOA 1E6YA 1QD1A 3L4BC 4NX9A 3MOZA 4GO7X 4YEAA 4NXNJ 2B6AB 3KLEA 3HI9A 1NDPA 3HP6A 2HNZA 3I9ZA 4RPFA 3VVTA 1IBKJ 1SJ1A 4Y2IA 1YRXA 3NCPA 4WZQA 1NDCA 1IJEB 2A1BA 3H7HB 5KFQA 2CQIA 3DOLA 3V4IA 4DX7A 2E1AA 2QLFB 5E3AA 2OMLA 3KDOA 4E0DA 4F0MA 3W3SA 5C2GA 1U2FA 4AXIA 4IR9A 1IKWB 5J2NB 5B0AA 2L9NA 2MMYA 5LOQA 1U48A 3OL9A 4J9NA 5CA5A 2RB7A 4Q8FA 4WCEQ 4DV2F 3VCDA 5JUMA 2VPYB 3IWNC 4M8LA 1R27B 1IJFB 2FLNA 4WJBA 4TXSA 1IBLF 1S79A 1EP4B 3GIJA 4FKXA 4ATNA 2IA0A 3GJRB 3GWCA 1U45A 2KKHA 3R3TA 1S7HA 2JLGA 1S0NA 4DFJA 2JHEA 4G3IA 2ZNYA 2ASYA 3BSNA 4B17A 1YKWA 4KKOB 1SQFA 2OD6A 3SQGB 3KJFB 3L7UA 4OQJA 5GAEI 4WFYA 2C2ZB 2HLTA 1E6YB 2A6OA 3RW7A 2LQ8A 2FDNA 1FEHA 2W1BA 3KLEB 2VJUA 4BC7A 2HNZB 2MKYA 5GADI 3R5JB 5J1EA 2LU2A 2DK2A 3RUBL 2CZ9A 4OX7A 1EQ0A 2DT9A 4ZITA 3DOLB 3V4IB 2FZCB 3BV8A 3GU0A 3MCMA 1UFLA 3KG4A 1BMQB 1RA6A 4ZP7A 2MLYA 1H7WA 2HWHA 4F25A 3PHTA 1GNKA 2N3LA 2VC0A 4KFBA 3IXQA 4USKA 2RQ4A 3CDAA 3P3DA 4FXWA 1WD6A 3J7YU 5HK4A 2E9RX 2RH3A 3G8SA 2M4MA 2HHHJ 2IBOA 3T5KA 2DVIA 3PY8A 3RU0A 3EWGA 3GIRA 3TVKA 2W2NP 4OZJA 3MD1A 4K4YA 3VZHA 3PX0A 2G0IA 3TQEA 2C28A 3X1LB 3F73A 2PC6A 5EN1A 5DQGA 3UR0A 1SV5A 2AZ1A 4AFFA 3GV7B 3HXMA 3UDVA 1MNEA 3BGOP 4ZPTR 4I68A 4CO4A 2F8HA 1X7VA 2NYHA 4KGZB 3DU6A 4J9OA 3GCXP 4UQGA 3H4DA 4B3MJ 2MZ1A 5IQ6A 3CCWA 5EX0A 5U47A 3C2PA 2HBYB 2Z4PA 2OFHX 2MSTA 3AD8C 1FFGB 4YB7A 2NPFA 2KYZA 5J1EB 1RCXB 1TMJA 4USJC 3LO3A 4C0BA 3PX4A 1NAQA 4DQRA 1MWYA 2YWWA 1FERA 1PJ7A 5DJBA 3BKUA 4OZ2A 4ALZA 4UOGA 2A3JA 3W8GA 4DG1A 4QW9A 4KFBB 2ZM6F 3CTRA 1KVKA 4E98A 2W2QP 3GR0A 4GVBA 3T6JA 4F50A 4X64F 3SMZA 1LWCA 2VKZG 4UY85 2ZH1A 4PCQA 1RWOB 4CLYA 2A6MA 4USHA 4ID5A 3W65A 4JI3J 4DUTA 2XO6A 1YHQS 3G6XA 1YK9A 3K59A 1L3SA 1GT8A 1SV5B 5KG0A 1ZZFA 4DR3J 3NS7B 1VISA 2BJ8A 4JI6F 1TZ0A 1RYRA 3TO8A 1QTMA 5DDRC 3JSRA 2V67A 4I56A 1AB8A 3EX7B 1ZM9A 1H2VZ 3PV8A 1KNZA 2MKHA 4O44A 1G3OA 2F7VA 3MM6A 4B3TF 1XNRF 2NZ4A 1WC3A 2HNYA 1FTCA 1HBOA 3P5BP 1BQXA 4W98A 1EX8A 2B3TB 2LQBA 3G6ES 1ITPA 1PILA 5EHHA 2AX0A 3KMSA 3CJ8A 1DQAA 2LA4A 3PYGA 5K20B 1RCOB 3MEGB 3OVAA 4DG1B 4P6QA 1R8BA 1UVIA 1Z4UA 5DQIA 4B9UA 4NYOA 5E3QA 3E51A 3OXFA 1ZAWA 4IFVA 4K2JA 3H98A 2BRLA 4HKQA 4F4YA 3N5FA 2UUCJ 2L41A 1K8AT 1JWWA 3MZIA 4GVBB 5DG8A 1HPZA 2I5JA 5KFYA 1N88A 1LWCB 1PAEX 3W2VA 3PNIA 3GTYX 3J80Y 2RRBA 1N32J 3I31A 4F04B 2GCFA 2JH3A 5H1SV 5L1LA 2FVCA 5KFEA 4DJBA 4CO5A 4ID5B 5D4PA 2M2BA 3DLEA 4G1PA 5MLCV 4HI1A 3N6MA 2KN4A 2NXEA 5K8OA 4PABA 4ZVOB 1F9FA 4FBUA 3PYDA 2E1CA 5KFUA 2WONA 4G65A 3NGUA 4LIWA 5E3PA 3V6DA 2CWKA 1H98A 4JYAF 1FJ7A 1VQOS 2R8GA 1IQZA 3HHNB 4ZJOA 5KG1A 2OPSA 4URSA 2R2RA 2D9OA 4I0WA 3BN7A 4X62F 4Q7AA 4O44B 3MM6B 2HK3A 5JVHQ 1VQ7S 4ITSA 2HNYB 2ACMA 4P74A 1HBOB 1QY7A 1A0OB 1RB0A 4BDPA 2CJKA 3M6UA 3EXCX 2HS3A 5HMXA 3BKFA 2J0WA 3QZ8A 5KT5A 2MQNA 5ETMA 3MUVP 1SKWA 3EVMA 2C2DA 1Z1ZA 3MM5A 2QMUB 1UFWA 1IR2A 2ZITA 3SEOA 4IFVB 3PJWA 3OTEA 3JQKA 1HPZB 3MUMP 2I5JB 5E5NA 3W2VB 1HMVA 1JLGB 1S0MA 1NCLA 4DQPA 2IRYA 1K0TA 2O5DA 2A0FB 4OV1A 1TFWA 1JMTA 2UXCJ 4Q44A 3DLEB 2HW3A 2VB6A 4DR6F 5L38A 1TFYA 1JXLA 1U24A 1Q7LB 2DGVA 2WONB 2XY5A 1LWFA 3V6DB 4ZCLA 1HNWJ 2RUGA 3T1AA 2AMCB 3RW6A 2DTJA 2OPSB 4RW8A 1GXLA 3U02A 2HHTA 3H20A 1S1XA 2NXCA 4ZLNA 2BXJA 1DQ8A 1SH0A 3CCQS 4N8NA 2XEXA 3D0IE 1D9FA 4D3GA 3O2IA 1N8RT 2QZ8A 4TNOA 3G8QA 1JNZB 5ETKA 1F2HA 1BQNA 1Q78A 3ZFVA 3MD3A 2OAUA 2EKYA 5I3QA 3MM5B 4Y6IA 3U1NA 4IYQA 1G6BA 2QMWA 1QSSA 3BPSP 3NGSA 3T9NA 3SSSA 3M8PA 1J2VA 4RW6A 3BO4A 4DV1F 1JLAA 2OUGA 1REGX 1HMVB 3QFHA 1CBKA 4JBCA 1WC0A 4K4TA 1F3FA 1TKDA 2QE5A 4KPCA 1EKRA 4HI2A 4K4UA 1HNIA 2FHKA 4IG0A 1FRLA 1XK8A 3PX6A 1FF2A 1SIZA 3OLBA 1QTNB 4PXEA 1G7CB 2ZC4A 2IDEA 4IDKB 4X64J 3J80U 1RAIB 3ITHA 3DXBA 4CQ1A 2V8HA 4CLZA 1N34F 4A8KA 3ISNC 3OSPA 1SB6A 2ADBA 3TNVA 4BWJA 1W2BR 3CCMS 4P9SA 1S1XB 2NLWA 2ZWOA 2JL9A 4QW8A 2XMVA 4OYAA 5CZVA 4V19X 1NSQA 4GKKF 2XMTA 4NLSA 3M8ZA 3MEDA 2IDLA 2N7CA 1FDDA 1VJWA 3MM8A 4C48A 3QRRA 1EHWA 4ZPVR 1HW8A 1ZH5A 5F3ZA
chains in the Genus database with same CATH topology
2RILA 2GQCA 1T94A 3TAMB 5EX3A 1DAXA 3V5RA 3PRDA 5GVQA 3ENVA 3VAKA 1BQNB 1WF1A 3IG1A 4IH7A 3D28A 1Y7PA 4NLVA 2P6TA 1SJ4P 2BJEA 3HVTA 4CNYA 5CYMA 3UD3P 2XB2D 1XEZA 4MIWA 2L48A 3NCQA 2HNDB 2DH9A 1X9SA 2AYEA 4DSIA 2KO1A 3DGPA 2DHGA 2QLWA 3I32A 4M63A 3QIPB 2ZOGA 2VZ9A 1QAJA 1RT3A 3MHYA 1Q8BA 1VK8A 4OJGA 1T3NA 5D8HB 4GKJF 2GQQA 3KLIA 2VG7B 1N5YA 3MI7X 3GIIA 1OWXA 3QJJA 3HVRA 3M8PB 3GFHA 4RW6B 2FLPA 1NH8A 2DHSA 5KG7A 4EWTA 3OFGA 3DU5A 5C24A 2CQGA 5D4NA 4MYUA 5KG5A 1R8HA 1X4CA 1FJEB 2IFXA 2BA9A 4I69A 1A7GE 1JLAB 3DLGB 1DTTB 2WK4A 4R0JA 3AHPA 2OPRA 1LW2B 5M2PA 2FJXA 5BR8F 3ZZPA 2RT3A 3T9ZA 2MZQA 3KLGB 1N0UA 1Q8LA 4Q0BB 2RS8A 3UE2A 4X4SA 1UKUA 3LGMA 5KFLA 4O3OA 1FKOA 2HYIB 2EFVA 2E1MC 2B7CB 1S9GB 3AQPA 3NMRA 4HLBA 2EBGA 5J2MB 2XLIA 1HNIB 2V4JB 2GFFA 1CQMA 2IMWP 2M70A 4IG0B 4IOCQ 1HBUB 2RE1A 2L08A 4HDHA 3H59A 2YX1A 4ECXA 3G8TA 1H3DA 1FTRA 1S4FA 2Y1RI 1C4AA 3UI3A 3BJYA 5KG6A 1WF0A 4IOBA 4QWEA 1PGZA 3HK2A 3UDLA 4H4KC 5A8RB 2BQUA 1C1BA 3NS6A 3U1MA 4RUHA 4JI0F 4ZPBA 4ZA1A 5L1IA 4F4KA 4HT5A 3PRBA 3HZGA 3K5OA 1HFEL 3JYTB 2G4BA 5KT4A 4WFAQ 4J9KA 1YRUA 4NRTA 4MKYA 2QSFA 3N28A 3V6JA 3ITHB 3O8WA 4RLEA 4ELUA 4IFYB 2D9PA 3CC2S 3ZZZA 4DR1F 1P1TA 2DRAA 3LW5C 1T05A 1NKEA 4ECRA 2B51A 1OIAA 1O5JA 3X3UA 3TAPA 3RAXA 1WEYA 5CHCB 2E5IA 1WACA 3SCLE 1VC5A 2CRLA 3TA0A 2EWHA 4FN5A 3IRWP 2YKNA 4RW4A 2FJAB 4DLEA 4J5OA 2XMKA 3UWTA 1QAXA 3N6NA 4RKUC 4CI0B 3K8WA 2ZJRQ 2HVHA 3SDEB 2NXUA 2EG2A 1FE0A 3MM7B 3MM9A 1D3WA 4YB6A 2CPJA 3SSQA 1B0PA 4DN9A 2XY6A 3CD6S 2KT3A 5MAOA 4WFNQ 2BANB 1N56A 4KE5A 3FFIA 5AE1A 1W25A 4KC5A 4HHJA 2IJFA 5KFPA 3PW2A 3EPGA 4TY8B 2J7UA 3H5XA 2QIFA 3MEDB 4NLRA 1LK5A 4ZPDA 5M2RA 3RB3A 1HWKA 3ZZRA 2UV8G 2K1RB 5GAHI 2MHNA 1VIXA 2CPXA 4GMKA 3BEGB 2YX4A 3MM8B 1UP1A 4C8KA 4HTJA 4K4SA 1Q81T 4ZPCA 4QR0A 4EBDA 5L1JA 3FCHA 2CJBA 4KAIA 5I4MA 4C8OA 1GTHA 2LQ9A 2ZC3A 2JEIA 3CCTA 4IH5A 2LKZA 2AX1A 1VS3A 1YJNS 3OTDA 3NAIA 3IG1B 4DX8H 5M2UA 4K4WA 1KFSA 3HVTB 3IWXA 2KFNA 1BD6A 3DLHA 1JIHA 1Q8IA 3ZC4A 2XC9A 1TV6A 3THTA 1S9EB 2LEBA 3CE8A 1W2IA 3IRXB 5B09A 4QR2A 4PR6A 1TK8A 3HT3A 3OTCA 5F8GA 2LU1A 4Y0FA 4MMOA 3KHHA 1RT3B 2L9DA 3MPWA 1C0UA 4RW9A 2J0SD 4UW2A 2GMJA 2CPZA 2HPUA 4C8MA 1FK9A 2MKCA 1VFJA 3KLIB 1N5YB 5FIIA 3HHKA 1H0HB 2ABYA 4TU8A 4LF7F 1TAQA 3LP2A 1UAWA 3LF0A 2E7XA 5C24B 2VBYA 1VQ6S 2AJ0A 5KFSA 2EFGA 1HD1A 3RBDA 3WDOA 1JLEB 3QGIA 1X5TA 3PJXA 4X4UA 3JAMY 2B9XA 2CQDA 3S6EA 3QMQA 4OL8A 3D1OA 4ES3A 1Y5LB 4U7CA 2FC8A 4OIXA 3PHEA 4NCAA 2BR0A 2V0NA 4ZPWR 2OPRB 2DNOA 3FEYB 1K0VA 3WBZA 3DRYA 4JI3F 4IG3A 4Q2MA 3GYNA 3N5BA 5CQGA 2FJDB 4C7QA 2WRMA 1XNQF 3QGHA 4CT8A 1ZYQA 3UR3C 2E5HA 3IAM9 4RU2A 3N79A 1GXUA 1Y9OA 1P9QC 2PT0A 3CJ4A 4KRWA 5LT5A 3U7JA 2AYBA 1FKOB 2NYIA 3C46A 1XC9A 2R7RA 2CPYA 1S49A 3SV3A 1BY9A 2E1RA 1HBMA 5KFVA 1KEKA 1U6FA 4NLTA 3HHDA 5JXSA 3PVXA 1Q79A 4TYAA 2QA2A 4ECYA 3KHRA 2YNHA 4X66F 2R4FA 4OHYA 4ECVA 2QMXA 4C3LA 4UOCA 4TYBA 4BC9A 2R7OA 2XHWA 4IRKA 1KHWA 1MROA 1WNEA 2QEXS 2HFZA 3OFHA 3BDPA 2ZD1A 4FP9A 1C1BB 1U1KA 2E7WA 1FCAA 2AF6A 2F3JA 1FD2A 3T3FA 1YIJS 3PACA 5CYJA 4DV0F 1KOHA 2IVMA 3DLBA 4LFAF 4NZ0A 1Y5IB 3OR2A 2RRAA 4O3PA 5KFNA 4YDXA 3HVWA 1TL1A 5B0EA 4X4QA 4C9DA 2CZ4A 1YJTA 1T05B 1URRA 2VBXA 3S8SA 2C3OA 3FEXB 3RBEA 5E33A 4U67Q 2ADCA 4DL5A 3A1YG 2LXUA 4FS2A 2YWKA 4KPYA 3GFZA 1SL2A 4C8YA 3MF5A 2KTQA 4WXWA 4RNOA 2YKNB 1VIOA 3K0JA 1JXEA 3KFWX 5EWFA 1N33F 3UCZP 2OSQA 3C3LA 2WBMA 2A2DA 4XO0A 2B9YA 5LMNF 2D3OR 1N6QA 1X9WA 2P5VA 5LSRA 4EZ9A 3Q22A 2PA8D 2BV3A 3MM9B 4ICLA 5F8LA 1U1NA 4R0EA 3ZZ0A 4NL5A 3NLCA 3O6QA 2PIIA 1NKCA 1YJRA 3FFIB 4HH0A 2CVIA 1JJ4A 2XCPA 3Q23A 1RYSA 2KRRA 2YKPA 3HMJG 4JOUA 2PGCA 2Y0SD 2I38A 4WU2A 2E44A 3BQ2A 1D8YA 4CTAA 3GIMA 3VZIA 2F9DA 3M2UA 5GAGU 4CNZA 5CD4H 2W8KA 4Y2MA 4Y2AA 5D4OA 4QWCA 4ZCMA 5HBMA 4DSKA 1WEXA 2LDYA 4DEZA 1FO1A 2Q66A 1FRHA 3H2UB 3JTPA 1GXTA 2GW8A 1UVJA 2BUNA 2FIUA 2W4CA 4DHVA 3DHXA 3G96A 1RP5A 5KFDA 1VQYA 5K5MA 2DCLA 1AW0A 2Y1IA 4LVOP 4ES2A 5F8NA 5IT0A 2MQMA 3TUZC 1X4HA 4X4PA 1TV6B 3LWLA 4I7FA 1YJWS 5GAEU 3TQ1A 4F3OA 2RSQA 1OSCA 2CFXA 5DG7A 5DGAA 3TAQA 1Q86T 1OPIA 2AJ1A 1H38A 1HR0F 2UUCF 1L5UA 4WFZA 1C0UB 4RW9B 3W2WA 1R31A 2AP6A 3C8YA 3PR4A 5HROA 1FK9B 2LVWA 3PIPQ 4QOTA 2NUHA 2VD3A 5A8WA 1S72S 2LXIA 1VBXA 4YB1P 3IAS9 3K5PA 4OX9F 3KJVA 3PR5B 1LQ9A 2HMIA 4B9VA 4N8OA 1N32F 1P1LA 3BB5A 1VC6A 2DR5A 3IS9A 2HG4A 1K1QA 1R0AA 4M5DA 3PO5A 3TUIC 5GADU 1X0FA 3HJFA 2H9ZA 3OQ2A 2EW9A 1TKXA 3TR5A 3N9UC 2CPIA 3FSYA 5J1NA 1U26A 2MQLA 2NQPA 2R7QA 5DETA 2LLZA 5LMUF 3H5UA 3I0SA 2W4PA 2MKKA 1TAUA 2FHMA 3L7PA 2IM1A 2DR9A 4ILLA 3ONQA 2ROGA 1HBMB 4LQ9A 5DRKA 4EUVA 1YTYA 3OW2R 5KFTA 3DXSX 1JJ2R 2YNHB 3BGLA 3QAEA 2LECA 1FVSA 1KFDA 1S6PA 1M5KC 2KZZA 3NBPA 3HO1A 2MGZB 2HHPA 4X65F 4KIAA 1CVJA 3LWMA 2ATLA 3DN9A 1X5SA 3I87A 3IN5A 2Z2LA 2AD9A 2WTFA 1MROB 2RRNA 2KDOA 3DHWC 1WTFA 3QLHA 4RWWA 4E8UA 4PG8A 2ZD1B 1QE1A 3GQCA 4IRDA 2VA3A 2IRXA 1HNVA 4P7VA 2L9WA 2Y1JA 3N0VA 3F44A 3S01A 3MWBA 1EETA 3BQ0A 3CJKA 3OR2B 2KVIA 2HAIA 4PWUA 4NCGA 2KB2A 4F02A 3U27A 4ZKAA 5GAGI 1TL1B 3LP1A 3HLUA 4MFBA 1HW9A 2IAJA 2DPJA 2J0XA 4U9RA 2DGTA 1X4AA 2E9ZA 3HHLA 5KFBA 3M8SA 2G9OA 4MJKA 1U6BA 3HFKA 4A8SA 3SXLA 5HO4A 1IBKF 2EFQA 4O3RA 2AGPA 4NLPA 4NYZA 3RRHA 5KT6A 2RNEA 1IKVA 2VPWB 4OJHA 1FKPA 4ICLB 4ZP9A 1WG4A 5L9NA 3FSXA 4C11A 2ZZMA 2XS7A 2OLWA 3MEKA 1Y00A 2HIQA 2C3YA 2DBBA 4I1TA 3VAMA 5F9LA 2GV1A 4OX6A 2ZOMA 5G0RA 2GHPA 4DLGA 4IOAQ 4C0OC 3K5LA 2V8GA 1NZAA 2H5EA 2P9CA 2GJ2A 3D54A 4CTAB 2ZOFA 3M2UB 4RNNA 1JLCA 3OJSA 3T1YF 4NLGA 5E3CA 4RUAA 2BM1A 1R8CA 5HBMB 4B3SF 2D3ZA 4HH1A 5KTQA 4P7TA 5BYSA 4OZ5A 3PW7A 2ASLA 4DUYF 3K5NA 2RQMA 3OXGA 4WKYA 4DR2F 4OFZA 3NS5A 2XNQA 4OI6A 3CCRS 3LANA 5KFFA 1U4BA 3I9V9 4RBTA 2I8EA 3IBWA 4ZPAA 3TUJC 2HLUA 4NLYA 1U8SA 1ROFA 1LFPA 3CPWR 2AJ4A 2UUTA 3GSDA 4WK1A 3D2WA 2DNLA 4J9SA 2JLFA 1TUVA 4KJIA 2MKSA 2MZSA 1VLYA 2VC1A 3KHGA 1S6QA 2OPQA 2AQ4A 3CDEA 2XMUA 2JOQA 4WTYA 4D3HA 2FPHX 4I7FB 2HHQA 2FGCA 1H2TZ 5J2QA 2F8EX 3PFEA 2XS2A 4ZHRA 2MY7A 5C25A 4DR5F 1UA1A 3CD5A 3W2WB 1X0PA 5HROB 2ZHAA 4K50A 3M1VA 1FRXA 3H2LA 5A8WB 5THWA 5LSLA 1TK5A 2UVUA 2VFTA 1C1CA 1J5OB 3QPIA 4HT7A 3KJVB 1NH7A 2HMIB 1FXLA 2BABA 1XMBA 2XMWA 2CQPA 1C2PA 3EGNA 3LP0A 1AROP 4LQ3A 1ZAXA 4UY8T 2V8DA 3IS9B 1XTZA 2KYXA 1R8AA 2FLOA 3AJ1A 4AL7A 1R0AB 4M5DB 4F4ZA 2AGOA 3QIDA 4F3MA 4A8WA 4YB5A 2XMJA 1TKXB 4DWIA 2UXCF 2HVZA 3M6WA 4A8MP 4Y3CA 4ZP8A 4RU9A 3J7ZT 1U1PA 2ZUGA 2KXHA 5CXTA 3I0SB 1ZBTA 4NPOA 4CH7A 4QIVA 5KT3A 1NK4A 3GIKA 4OLOA 2NREA 2CPDA 2FHOB 4LFBF 3DDKA 4B3OA 2JRSA 4ZCKA 1HQEA 3SI8A 4YQWA 3BGRA 3AB4B 4MKBA 1S6PB 3GV5B 3NBPB 1S1WA 2Q43A 3M9MB 1S10A 2YQ3A 4HYKA 1FDAA 4YP3A 2JEGA 1RK8A 1XWLA 2XO7A 4FS1A 5KFZA 2IBKA 2LQJA 3QLHB 1HNWF 1YWXA 2VH7A 1NJWA 1ULRA 3MECA 3VAJA 4XDCA 1QE1B 4G1QA 4HTIA 2EVZA 3L3CA 1HNVB 2XWYA 3P96A 3L7OA 4CT9A 5K8PA 1DURA 1NK0A 1VQMS 1NK6A 1Q16B 1D8ZA 1EETB 4ZOSA 3CJKB 4NWBA 1VC0A 1GH8A 5DDOC 2LDIA 3VALA 4AYBD 4FF2A 1D0EA 2G1DA 4F2SA 1LWFB 2A2CA 2HZCA 3NAHA 4NCGB 5T7LA 5EWGA 1SXLA 4AUKA 1TQLA 3LP1B 5KOWA 3D0GE 1F5CA 3IFEA 1T3OA 2IAJB 4ID8A 2Q1LA 5K8MA 1BQMA 2CQ1A 5DQHA 4UQTA 4J9LA 3MMAA 5F8IA 3CCVS 4IO1A 2V4RA 4RW8B 2MJUA 4WK3A 1DHMA 4FPRA 1M5PC 1HHTP 1IKVB 4KO0A 1ZETA 2OPPA 1FKPB 2WSFC 3THPA 2YX7A 4C11B 2B56A 4C8NA 2RS2A 2DGWA 4F2RA 4Y34A 4RNMA 1KR4A 3FSIA 1VBZA 4IKAA 1YITS 4NZ7A 2R7TA 1ZPWX 2FVPA 3TVZA 5KFAA 4DQQA 5G0RB 1T7PA 1VK3A 4F8RA 1FE4A 2IYGA 1ZM3A 3RTVA 1JLCB 4JI2F 2HHWA 2R7WA 1SKSA 3UNGC 1WELA 4NYPA 1QSYA 3R5CA 1M0SA 4Q8EA 4EEYA 1UVKA 4C97A 1HYSA 1S6OA 2GMLA 3FVYA 2J5AA 2MQOA 1E6VA 3IO1A 5GMKa 4FF4A 2QRRA 4OJ3A 2WAQD 5F8JA 3NGDA 2DISA 4O4GA 4JUZA 1NB7A 1FESA 5JJBA 4WZMA 1BGXT 1S6QB 2OPQB 1DJ0A 2FJBB 4K5SA 3B4DA 3T6BA 1I94F 5J2QB 3POTB 3QWPA 2W8LA 4ZHRB 2PD1A 5C25B 1SH3A 4Z2XA 4LF5F 4ECSA 1DFDA 2NPIA 3MMCA 1PO6A 3Q2TC 2C42A 4QCLA 3FQLA 4ZCIA 3AH6A 1HBNB 2MKIA 2COLA 1L3VA 2ZKUA 3OXLA 4DQIA 3M1VB 4YOEA 5A8KA 5HL7Q 3OPKA 3BO3A 4GC6A 4H4MA 3NNAA 2HHHF 4MTPA 2E5LF 1C1CB 4R25A 4IO9Q 2HHUA 2WB1D 4PG6A 4DL2A 1N4LA 4DQSA 4KHMA 4QQBA 2RF2A 4F4WA 4KHRA 4FNIA 4N41A 3LP0B 2BVZA 5B0CA 1RTJB 5LSOA 1HI0P 3RR7A 2D41A 2GIRA 5KFCA 4N56A 3MEGA 5CCLA 2DJWA 2HQIA 2C22A 5AE2A 1CC8A 2YNFA 4KSEB 4P2SA 3RRGA 3NRBA 2DGSA 3R5DA 3R5BA 5ADZA 3VAIA 1RT1A 2GGPA 1HWIA 3NP5A 1KRPA 3MXHP 4I2PA 4AQYF 5IT9Y 3QGPA 2BQ3A 1PSDA 2K3IA 1JLBA 1X5PA 3V2UC 5T14A 4DDFA 2J6UA 4B3OB 2I0XA 5KFKA 1HQEB 2GHWA 3TANA 1UVMA 1QAYA 3BGRB 3VAHA 4WYLA 3H5YA 4A4JA 2OFGX 1XMOF 1JLQB 2JJ4D 2C3PA 1S1WB 3C6TA 5SUHA 2M8DB 4ELTA 1B0TA 3OSNA 2CPHA 1TL3A 3H25A 2VONA 3CJ2A 5A6WA 1LW0A 1GTEA 1SBRA 2YWGA 4PG7A 1WG5A 1KSPA 5LXRA 2M5YA 1IXKA 4YFUA 3MECB 4G1QB 1Y5NB