2GHWA

Crystal structure of sars spike protein receptor binding domain in complex with a neutralizing antibody, 80r
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
191
structure length
191
Chain Sequence
ITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
publication title Structural basis of neutralization by a human anti-severe acute respiratory syndrome spike protein antibody, 80R.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Virus/viral protein/antibiotic
total genus 40
structure length 191
sequence length 191
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ghwA01
2AJFE 4L72B 3SCJE 3D0HE 4L3NA 4ZPWR 2GHWA 4KQZA 2GHVC 4ZPVR 3SCLE 4ZPTR 3BGFA 3SCIE 3D0IE 3D0GE 4XAKA 5DO2A 3SCKE 4QZVB 4KR0B 2DD8S 4ZS6A
chains in the Genus database with same CATH superfamily
2O3DA 4WU3A 2HVDA 1RYSA 5J2NA 3ZZUA 2ALZA 3DOKB 2GGPB 5J2MA 3TAQA 1FE4A 2V67A 2D41A 1U1MA 4J9MA 1JJCB 3FSYA 3CF5Q 1MMLA 5B0EA 1TKZA 2D3OR 3F0NA 1S0OA 2M52A 3LP2B 1IKWB 2FJVA 1Q78A 2GVZB 2G0IA 4BCAA 4G3IA 3Q2SC 4DHVA 1BE4A 3PACA 4UY8T 2KHDA 2R42A 4CTAB 4K50A 4PQUB 2ILYA 4EZ9A 3MMAB 5E41A 1S1UA 3AOBA 2R2RA 2HZCA 2BJ9A 2UXDJ 5DG7A 5LXRA 2BJ8A 7AT1B 2IDLA 4JV0A 4Y00A 4F0KA 3SQGB 3IAM9 2MKJA 1U2RA 2QLWA 2Y1IA 1S59A 1MSWD 4WZMA 1TTHB 3B6BA 1FXDA 3QAUA 4U6PA 3SCKE 1F5AA 1KSPA 3LP1A 4YEAA 2GW8A 2ZE2B 3KK3A 1O5JA 4DG1B 4DV0J 2CUYA 3N01A 5C25A 4WFNQ 4PWDB 2D74B 1KTVA 1X8DA 3LW5C 4C0HA 3TO8A 3D0HE 1LK5A 2LEBA 5DM6Q 4ZVFA 3RBDA 3MD3A 2V94A 3HJVA 1M1HA 1UKUA 1WEYA 1HNXF 2Q79A 1RT5B 2KRBA 3R5DA 3MEEA 2MZQA 4KQZA 4JB8B 2MGZA 4W90B 1B99A 2CNNB 2JZ5A 1BY9A 3JXOA 4WE1B 3EVWA 3OVAA 4ENOA 4DR1F 5H1SV 2Y8YA 2FJXA 1XK8A 4CLZA 2DBBA 4UW2A 1M90T 5CZXA 4I1TA 1YBUA 2DEJA 1S9FA 4ZDNA 1GX5A 1WI8A 3HM9A 3QSYB 1WG1A 3OFGA 5KAKA 3TVKA 3KOAA 2LLZA 4DSJA 2Y1JA 2DR8A 2BVZA 2DNLA 4P73A 4EZ6A 3MMJA 2NUHA 2YNIA 2NS1B 4TLQA 4NLUA 3UE2A 1X4HA 2CJKA 5D0HA 2GS8A 2ZKUA 1PJ6A 4I0WA 5IZHA 2FLPA 4FDFA 4USIA 1TAQA 1G1XA 4LRCA 1YJVA 3M9OB 5ETMA 2BJ1A 3K8VA 3D3BJ 3DOLB 2PO4A 2I2YA 2DH8A 4QU7A 2OPPB 2ZBPA 2F9JA 2YWHA 2CQCA 4O3QA 1R6YA 2J9CA 4LFAF 1F3VA 1YGYA 4DV3J 2HNZA 3PKYA 4QU6A 4K2JA 1SV5B 2A6MA 1T05A 3NXZA 1GXTA 3MM8A 4O0NA 1VQPS 2NZ4A 3SSRA 4LUBA 4RW9A 4K7QA 2YKNA 5AT1B 5D77A 3I32A 2WSCC 2DNHA 4B9SA 1N56A 2XNQA 3H0PA 3CXCR 1DFDA 5D0EA 1X5SA 3A8JA 3EXCX 5E3PA 3AJ1A 2MQOA 4WKRA 3BO3A 2V2VA 4MTPA 5ETNA 4XPEA 1HARA 1FD8A 1JIHA 3F56A 5F41A 2XYGB 4WYWA 3FFIA 1GMVA 2QG9B 4NL5A 3I9ZA 4C0BA 1GTHA 4Y2MA 4DCOB 2QFIA 2YNFA 2QRRA 2W8KA 1VS3A 3PW7A 3KNGA 2RT3A 1JJHA 4AQYF 4ITSA 4ZCIA 1IBKJ 4DLEA 4QIEA 2E7VA 2AJ4A 2QEXS 3QQCD 4UUXA 1NU4A 2UXCF 4ICLB 2PFFB 1GNKA 2EI5A 5DDQC 3GP9A 2AW0A 4DUYF 2MZTA 2HRTA 4QR2A 3UO0A 3OSPA 1U1RA 2F8MA 1FX2A 2XHWA 3PR4A 1AW0A 3VTIA 4B9UA 1QUVA 1JLCB 4J90A 1KLMA 1NHVA 1U47A 4DQPA 2G2ZA 5E5NA 2HGMA 4Y2CA 1XR5A 2V63A 2OSRA 4TQRA 4OI1A 1UVMA 2N7YA 1Q53A 1HQUA 3G82B 3DCAA 2ZWOA 3V2UC 4X4TA 2HW3A 4F3MA 1MN7A 3BBFA 3FEXB 2CQGA 3DRPA 3G6ES 1VQKS 1SH0A 2RUSA 3SI8A 3MDFA 1Q82T 4Q8FA 4K0KF 1FK9A 4TY8A 4Q2LA 3V4MA 1SIZA 3EDQB 1QM9A 2NCKL 3MPUB 3KYLA 2GIFA 2VPYB 2FZKB 2KHCA 2XG8A 4F2SA 3UD5A 3CGIA 3K5LA 2VU5A 2FY8A 1EJ7L 1BHNA 4NLVA 3UNGC 1S9GA 1TMJA 3RRGA 2OFGX 4ETZA 1HKAA 3N79A 1ZBTA 3THTA 2V6AA 1KQGB 2H54B 1H2TZ 1XNRF 2JNJA 1L3KA 2Z2LA 3NRBA 4RKUC 4OMFG 1IKYB 3BV8A 3D54A 4DPWA 3C6UA 2CJBA 2R2SA 2DNRA 3NWRA 4ES2A 4H4MB 4JP8A 3MAAB 4QYZK 1FTCA 5LJ5Y 2FVRA 1M5PC 5H9FK 1HMVB 4LRFA 3FCWA 3KK2B 2W2QP 2H51B 3DN9A 4HLBA 4FS2A 2VG7A 3EGZA 3TARA 3GIJA 3H2UB 1F9HA 2OEMA 2R4FA 4JI4F 3UI3A 5J1EB 1KWMA 2YY3A 2A6OA 1PC5A 1J5EJ 5I3UB 3RW7A 2D1CA 5GAHI 4DV4J 1CC8A 2OIHA 3J7YU 1H2VZ 3QATA 5IV3A 2DY1A 2R8JA 2MKSA 4N7TA 1FKAF 3VVTA 4WJBA 2QFJA 4DR3J 4ZVPB 1IM6A 1TL4A 1S10A 3FZBA 2G0CA 3IRWP 1XMQJ 1YJTA 1FTRA 1RAHB 2PI4A 2XCAA 3SQOP 1W26A 3MR2A 4X64J 1YQHA 4C8OA 4KIAA 4EBDA 5IM0B 2E9RX 3I31A 4QWDA 5HROB 1X7VA 2UUTA 3TWZA 4DZ6A 3HULA 4NMXA 3FQLA 1KDNA 2R8IA 3TUZC 4XDDA 4PAAA 2HURA 2B56A 4DR5F 3IMQJ 2CDRB 4MYTA 3CCMS 1VJQA 4J9LA 4CLYA 3OL6A 1S6QB 4ZPBA 2XWYA 2IJRA 5F8MA 4DS4A 3T1AA 4GVBB 1S99A 2MKCA 1TV6B 3T5HA 2WAQD 3GV7B 4OZ1A 4NLGA 1Q8IA 3WX8A 3EGWB 4C8KA 4OLOA 1N52B 2LA4A 3IS9A 4ZVQB 3EGVA 3KLGA 2Q6CA 2JFKA 1SH2A 2RRAA 4KH1B 5L9NA 4GKKJ 5L8RC 3IWLA 2D3O1 3MM7A 4U67Q 4A8MP 3B4DA 3L95X 4KHPJ 2NPIA 4OX9J 3CC2S 2YNGB 3QFWA 5J1PA 4ZLNA 1H74A 3HVTA 4IH7A 2XI3A 3K8WA 2AWZA 1D8ZA 3EUNA 2QZ8A 2WOMB 3Q2TC 5IQ6A 1LW0A 1S0MA 1H72C 3HF5A 2CADA 1RI7A 1WF2A 1YBAA 3CCWA 5HLFB 2IRYA 3DLKB 4ED5A 5K8NA 4ZN3A 2G2OA 1ZAVA 2I38A 1NKBA 1UVIA 3VHQA 2RILA 3HD1A 2V2ZA 2WSEC 3K58A 1KOHA 3CCQS 4ZN1A 3EPIA 5IV4A 3AY0A 4HTJA 3OT9A 1R0AA 1TFWA 2NSBA 3G8SA 1KVKA 1BWEA 4G1PA 5FDLB 1A7GE 5I3PA 3HK2A 4QYZJ 5SUHA 5H9FJ 2CQ3A 1X5TA 2AX1A 3WHIA 3PNIA 3JQMA 1R8BA 4DV5J 2FD2A 1YRUA 4LF1A 2RD5C 1N36F 4X62J 1S0VA 3BKFA 3OLAA 2BRKA 1S4EA 3NEKA 2KXHA 1ROFA 2GAGC 4OHVA 3MHYA 2P9CA 1HPZB 1VMBA 2YWWA 2ZM6J 3RAQA 4A47A 2GMLA 4FYXB 4JI6J 1YZ6A 5ETVA 2OPRA 1VLYA 1N8RT 1NJWA 2FVCA 4ZIWA 5JUMA 1VRTA 1NK7A 3MCMA 2CRLA 2VBXA 1HIYA 3V6JA 3K7RA 3K89A 1APSA 4DL5A 1P9YA 5EN1A 2Q66A 2W2OP 2VFVA 1BWVA 3KLHA 3VAGA 4NX9A 3RAMA 1TL1B 4K4YA 2EKNA 2W9CA 5LMUJ 5C24B 1X9MA 3CNQP 4PYAA 4K4SA 1DURA 4FNIA 1MU2A 1RTJB 3UD3P 3HHLA 4USKA 2CG4A 4YS2A 3CMQA 4ED1A 4U7UD 1GQEA 4K4ZA 2C2ZB 4OYMA 3HVAA 4NYZA 1CJKB 3BN4A 2ZEJA 2G2YA 3DLBA 5D6GA 4K4XA 5C2CA 1SKRA 5KFGA 1QAYA 3IRXB 3M2RB 3NGSA 1AYEA 2IRXA 2ZD1B 5L46A 1BQXA 2YPZA 3D66A 4PXDA 3OTDA 2XYHB 3P5BP 4M5KA 1FDDA 3CCES 4ECTA 1N34F 3TAMA 2OMOA 3GFZA 3EVOA 3B4MA 4RUCA 2VQEF 3DRXA 2BJDA 1B64A 1RJJA 2CZVC 1G2EA 2G1HA 5M2PA 1KP6A 1EX8A 1O8BA 3JSMA 4DQRA 2DO4A 2F4VJ 4NEZA 4C8LA 4G1QB 2AP6A 2CG8A 4TKTA 2JSXA 1MLAA 3CJQA 2DHXA 1VYAA 1G6BA 4E8UA 3UR0A 2QA4G 4M5DA 2W25A 2Y0SD 3T1HJ 4X4NA 1KTQA 3UNYA 1S6UA 3P49B 5EX3A 3IG1B 1KFDA 5K9FA 1JLAB 2NXUA 3QT8A 4DV6J 2LQ9A 1TU0B 3PX0A 3KLVA 4OYXA 2ZKTA 4BWMA 1Q86T 3CIZA 1Q5YA 4PRFA 4NLDA 3GZ7A 4QWAA 3BDPA 3R1LA 4M5HA 2OD6A 3H7HB 2KKHA 4GKJF 3KHLA 1R6VA 1OQ3A 1LFPA 2MKKA 1U2FA 1FJCA 5M2RA 5ETRA 3TR5A 3CW2C 1WD6A 4O0IA 2ZBRA 2R7XA 2ZBQA 3EYZA 3M8QB 4I7FA 4MKVA 1T8EA 2KRRA 3MECB 3EZOA 2ZH4A 4P52A 4B3MJ 2LQ8A 3CD5A 1QTNB 1Z2ZA 2BBEA 1JQGA 4OV6A 1X5OA 5J2PB 3PIOQ 1U1KA 4RNHA 2VQFF 2DT9A 2MQNA 2XY6A 4ECVA 2FZCB 4DWIA 1HI1A 2RQKA 2I5JA 3D1OA 4NMLA 4PG8A 1EP4A 4P75A 1U8WA 1JWWA 4LSLB 2Z57B 4ECSA 4OX8A 2WZ1A 2DNQA 4XIUA 3R5BA 5D4LA 1GMWA 4F26A 4IDKA 3GFHA 1Z2LA 3BYRA 2HHWA 1S1XB 2ADBA 4O44B 2AMCB 3LAMA 1NB2A 3D9BA 3HT0A 5GMEA 2XLIA 1L3UA 1UWBA 1SJQA 4GO7X 2JC1A 4DN9A 1M1KT 1RAEB 2FY1A 5F9LA 3M8YA 1VQ6S 5IWAF 4UQGA 5L38A 1FWKA 2MKIA 1S6PB 4Q0BB 1J2VA 4CIOA 5DRKA 3O5TB 2WTFA 2JWNA 3PHEA 2HEKA 3TI0A 1S7IA 1O6XA 1RE1B 1MW7A 1NK9A 3CCUS 2ZH2A 2NYHA 4QR1A 4PPDA 4M5MA 1VQ5S 1RXOB 1ZZFA 1F5CA 3PFOA 1QSYA 3H5XA 2VKZG 3UN5A 4HACA 4WKYA 5AXNA 3ZC4A 5DQGA 1VBKA 1KC8T 4P2SA 4RW8B 1DLOA 3K59A 2L48A 1IKVA 5F8NA 3CD7A 4KV8B 4J37A 2DR5A 3JSYA 4NA2A 2RF2A 2HNDB 5I4MA 1H38A 4LR8A 1F2HA 3O2IA 4DLGA 1VI7A 2O1PA 4OI0A 1UPMB 4CNYA 3PW5A 4FF4A 2FHJD 3WX4A 3JSRA 4F3OA 1RBOB 3C46A 3I5CA 4C98A 5CCMA 4ZVSB 2F1FA 1MMDA 1R8AA 3BSOA 3NOCA 1C0TB 3R5GA 4P72A 4CQ1A 4PG5A 8AT1B 4BC9A 3MOZA 4ES1A 2Z56B 4KC5A 2IM3A 3CCSS 4A4JA 2HLTA 1UEKA 3IWXA 5J2NB 3HI9A 4E0DA 4RR5A 5J2MB 1FVQA 4PXCA 4WYLA 3KLEB 2CVEA 1SJ3P 3NGKA 2KT5A 1KQKA 1VC5A 2DNMA 4OHWA 5LJ3Y 3HKZD 2ASYA 2O66A 4Q7AA 2AKWB 3QPIA 1HNIA 1TKZB 3MCNA 3EVMA 3Q22A 2RQMA 3D6FB 2RDIA 2KYZA 5HJXA 1U1LA 3QJPA 3GIIA 3R97A 2F5GA 5DG9A 5F0UA 1WG4A 2MQLA 4LF6F 2QLBB 2IM1A 3PHTA 3PZPA 2VF3A 1S1UB 5AXMA 4RWWA 3CDWA 2A1BA 1A6LA 2E5IA 1FESA 2VFTA 2Y3YA 2CPXA 1WC4A 3A1YG 3MZIA 1OO0B 5F3TA 4DI6A 1CPZA 5G4DA 4M5LA 4KT0C 5J1NA 5FD1A 4HTIA 2BE2A 4EEYA 4BWJA 2NQPA 3AB4B 2PEHA 3EM1A 2OH2A 1DBDA 1EKSA 4DSKA 4PXEA 2CZ4A 1VBYA 4NXNJ 3M8RA 5KFLA 4OI4A 3LP1B 2DXEA 4YN3B 2B9YA 3OHBA 2W7PA 3H2VE 2FYXA 1N0VC 3MCSA 4X4SA 5C25B 4FXVA 5IT4A 1EIYB 1DRZA 3NGDA 2F3JA 2DR6A 2H5IB 4ECYA 1XMOF 5L39A 1RT7A 1VR6A 4DX7A 3M8WA 4I69A 1CLFA 2WB4A 5F0WA 3R3TA 1HHTP 4ZIVA 1HNWF 3IGVA 1N0UA 3EZUA 4ZHRA 3MEEB 3RB4A 1B7FA 1S5ZA 1S6OA 4TNOA 4LIRA 2MGZB 1RWWB 2GJ2A 1NJXA 3MR7A 2C3UA 2EKYA 4C9DA 2ZNZA 5KT2A 1FNMA 4V19X 4L72B 5BJRA 2L08A 3MMAA 3KG1A 2R7TA 2G0JA 1OYEA 1D9FA 3PXGa 1QAJA 2HVZA 3S8SA 5I3QA 4ZCLA 1MWQA 3GFXA 1QSSA 3BGFA 3V81A 3TZXA 2PE8A 2PMHA 2YNIB 4UTGA 2M0GB 3S6EA 3ZTRA 4A46A 2CNLB 1K8AT 1NCLA 3CCVS 3IP0A 2EC2A 4PQAA 3SSSA 4B9NA 4F4AA 4ECQA 4JI5F 3MMCA 1JXVA 4OZ2A 4DF8A 4R5PA 4OZ0A 3GJSB 2VDHA 1L3VA 2L9NA 2DXFA 4EYHB 1VOMA 1RYRA 1T7PA 2E1MC 1NDKA 5GADI 2HNZB 3R2DJ 3A3OB 1NLKL 2GHVC 2E44A 4AT1B 3BYPA 5DM7Q 4DV1J 4YR2A 1T05B 2QLFB 2BX6A 1VHFA 3DLHA 1RQ0A 1URRA 1ZETA 4QPXA 3FRZA 1AUDA 3CCZA 2LFVA 3HKWA 3MM8B 3V5RA 1FFWB 4CH0S 3GILA 2CJ9A 4RW9B 1NK0A 2YKNB 3AD7C 4Z7CA 4M94A 3MPDA 2GHPA 3H42A 4BHQA 1XBWA 3QT6A 3N4WA 3DFEA 4B9LA 3TQEA 1WDTA 2GCFA 2GVDA 2DCUB 2K1RA 2XMJA 3D5MA 1U02A 1JKHA 1U26A 3FFIB 4DR2F 5GAGU 1LNQA 2LYVA 5B0CA 3VQSA 1IQTA 3W65A 1PAEX 1UMJA 4HT7A 2YNFB 3I56S 3HXMA 2LXIA 3IFEA 1TMMA 3H5YA 3M6XA 4U96A 4YUDA 1A9NB 3PV8A 2DJWA 2ZH7A 2HSEB 1HA1A 3FSIA 2FTRA 2H5EA 3LF0A 1WG5A 4DZDA 2F65A 2HHTA 2JFDA 3TVZA 2V2QA 3N5BA 4I56A 1U1NA 2E66A 1UEVA 2DEIA 4DQQA 3L09A 2V69A 1WUUA 4RNFA 5K8PA 1KQSR 3VGUA 1NPKA 3I9V9 1MWYA 2C2OB 4ZS6A 2A2CA 3CJKA 2IBOA 3OPKA 2C3YA 3E2EA 1KLMB 3GMGA 3TW0A 9RUBA 4LFCJ 1SH3A 2VJUA 2PI5A 4LF5F 1PCAA 4MIWA 1WKKA 1HQUB 2QTWA 4J91A 3DDKA 3D1QA 3MEGA 2DGXA 2YQ3A 4WP8A 2OHDA 1REVA 3GIMA 3DRPB 4M5NA 1K0TA 3IAS9 1FK9B 4TY8B 3KHHA 3LGNA 1RHQB 4EBEA 1WEZA 1DTTA 1HWIA 2V8GA 5CAAA 1TKDA 2YVSA 4WXOA 3BDEA 1XMBA 1JXLA 2NYIA 1IR0A 4O3PA 1S9GB 1EB0A 3D7SB 1RT4A 2XS2A 2HBZB 1NMEB 4F8RA 3B8HA 2E5HA 4NLXA 1U1QA 4JI1J 3JQJA 2XMUA 5AJ3F 5EGYA 3CCLS 1M5VC 3G9CA 3C6UB 2R7QA 3ZTSA 1AXQA 3R9LA 5MLCV 1TELA 2BA9A 2IYGA 1RDRA 3PW2A 3MUMP 1Y5NB 1TL7A 1AT1B 2C2RA 1GFWB 5F8LA 2VA2A 1G4CA 3KUEA 5CYMA 2VG7B 3C19A 4Y2KA 3MPWA 2JDJA 4K59A 4O4RA 2E29A 3EICA 3P8BB 3HCXA 4KTQA 3OUYA 3PYGA 4NRUA 3SCIE 2HWIA 3ULHA 4URSA 1IKXA 4HI2A 1X4CA 2EW9A 1R3NA 2B5JA 2J9EA 4L73A 5EX0A 4TY9A 5CZVA 4A8WA 2IM2A 5GAEI 5HMXA 5KFYA 1MMNA 3VZHA 2C42A 4CO3A 2YKMA 1DHMA 2U2FA 1FT8A 3K57A 2ACMA 4ANDA 3TEHB 2DB1A 3BSNA 1P9QC 2CAJA 3FGVA 1GH8A 3V6DA 1K0VA 2MSSA 3LGHA 4OZ5A 3D67A 1HQ2A 1RADB 3UFCX 3J80U 1AFIA 2OMLA 1Y11A 5KT4A 4F4KA 4UY85 3MEKA 1N33J 4RNNA 2E7WA 1TUVA 2ZUGA 4OFZA 3SYZA 1SQGA 3QIPA 4IO1A 4RW7A 3ENVA 2W9BA 4DFPA 4M95A 1QTMA 5SZTA 4O3SA 1NDLA 3AH6A 3GCWP 2GV1A 3WQPA 4P7TA 1YRTA 3W2WA 1HMVA 3O3LA 2KI2A 2K7KA 5IT0A 2J8AA 5KFPA 3BGUA 1U6FA 2UXDF 3PDNA 3M9MB 1NH8A 2KVIA 1T9WA 3BSCA 3OFFA 2R2UA 3M1VA 4L3KA 2HFNA 2FQQB 2KXFA 2EBGA 4JOUA 1VQNS 5KTQA 1ZZNA 3PVXA 5BYSA 1ELOA 5KG2A 4DL6A 4M1KA 3OXGA 5AE2A 1JJ2R 3RB0A 3KLGB 4RUAA 4JYAF 1Q7LB 2HHSA 3G2XA 2AJ1A 4O3OA 3MTJA 4XO0A 4PXBA 2HQCA 2Z4PA 3FSXA 3OTEA 3MM7B 3R8YA 2CVIA 4USVA 5KFUA 2JLFA 3BN7A 3GIRA 3UCZP 2CIMA 4DSIA 4JUZA 4OHZA 4ZP6A 5E3AA 2MZRA 3HVTB 5HMYA 1HD1A 1C0UA 4Q43A 3ONQA 1IWAA 4ZLLA 3V4IA 2Y0BB 2MQQA 2V9KA 1LW0B 4YDXA 2LU1A 2A3JA 4ELTA 4EU0A 3EXYA 5IM0A 1WHWA 4RUBA 4KY3A 3QLHA 2VZ9A 4F7VA 3MFHA 4XDCA 4JI2J 3PW4A 5KFDA 4X4VA 4FF3A 1YI2S 4FNHA 3T9ZA 2CQHA 1K73T 3PJ9A 2FGCA 1VCTA 4QR0A 3C15A 2E9ZA 2YWFA 5KFSA 3W64A 3W62A 3T5JA 3PTWA 2HS4A 3U27A 1R0AB 2ZHAA 1F1BB 4X4QA 5LMNF 4QYRA 2IPOB 3FDSA 1NXIA 3CO9A 1HWJA 1RSCA 2B6AA 1XERA 4DN0A 2VA3A 1S12A 2LQBA 1OIAA 2PSZA 1PYSB 3DDIA 5I42A 1IBMJ 2FHKA 1RWOB 2LXUA 2FUG9 1X4FA 4DOZA 3SIPB 2E7XA 2JLEA 1VLOA 4WFAQ 2ASDA 2NSCA 3QRRA 1U6BA 2RHQB 1DJ0A 2YX4A 3FZ2A 2OPRB 1HLWA 2C2NA 3UDVA 4DSEA 1VRTB 2EBEA 4K4UA 2DY9A 3CD0A 3I5BA 3J81Y 4QOTA 2VONA 1M5OC 3GFYA 3TA2A 4UOHA 4ELUA 2Z2MA 2KG0A 2BXJA 2A0FB 3KLHB 4A8SA 4H4OA 1S76D 5D4OA 3HX9A 2W9CB 4OI2A 3JTNA 5KFEA 3BGOP 3TEGA 3TYTA 1VRUA 2YNHA 1MU2B 2GMHA 2HQFA 3HHLB 2G1DA 3ZNJ1 2J0SD 1HQEA 4G6VB 3X1LB 3P45B 1VRQC 2M4MA 3PY8A 3KJVA 1SQFA 2W4CA 3MM9B 2JOQA 4LMZA 2NUUG 1RWNB 5IOLA 3NNCA 5RUBA 3J80Y 3DU6A 2LU2A 3I0SA 5ETTA 1WWHA 4HH1A 2CJAA 3WDOA 3TAMB 4DEZA 3SV3A 1IBKF 3SBMA 1XIQA 4ERDA 3BQ0A 5E7OB 2XLJA 1RKIA 2BQRA 4DU8A 4OHXA 4ECZA 1ZYQA 3P3DA 3TZWA 3AJDA 1S57A 3JSMB 4J9UE 3OJUA 2WHOA 4FF2A 1M5SA 4EI2A 1N5QA 4I2QA 2AZ1A 3T1YF 3M4XA 4M5DB 1RWVB 3NG8A 1TL1A 3L7OA 3D6HB 2R8GA 3OXFA 1VQLS 5C42A 4GC7A 2M5YA 4I6YA 1UPPA 3CJ5A 4ZMMA 1AZSA 3DLEA 1RHJB 4Q2MA 4USTA 2VFUA 4KB7A 2W4PA 3CSKA 1Y0HA 3ISNC 2DGVA 3W66A 1VJWA 4N47A 4PR6A 3H59A 4L6V3 1RZMA 2UUBJ 2C3OA 4I7FB 3RR8A 2YKPA 1PC4A 4X4UA 5A8RA 3A3NB 2CWKA 1SL1A 1VBXA 3D0GE 2VV5A 2YH0A 2CYYA 3M8SA 2HZAA 2R7OA 5DGAA 1EQMA 4DUZJ 2QA1A 4ED7A 4UZCA 3J7YI 4LREA 1H7WA 1NBEB 1IBLJ 2I5JB 4J9NA 2VKRA 3ET6A 1WEXA 1EP4B 2RKIA 2ASJA 2AD9A 1LWCA 3GONA 5DGBA 3PW0A 1JLQA 4UUWA 4IDKB 2R7RA 3G87A 5L1LA 2XMMA 1WHVA 2W9AA 1RWXB 4WZQA 1ZM9A 1IXKA 1S1WA 3LOUA 3IG1A 2MYFA 2HQ3A 1UWBB 3G86A 1WHYA 3FQKA 4FPRA 1D0EA 2AF6A 1J5EF 2ZVSA 2JC0A 2C28A 4DV4F 2V50A 1T9YA 3VALA 4RW4A 2XO6A 2FHJA 1E6VB 3W63A 1S79A 3QNWB 3AD9C 3KFWX 2QX0A 2HHQA 2HAIA 2EG2A 5LOQA 2LQ5A 4FVCA 4DR3F 2OEKA 1N54B 4OZLA 2FB0A 3WZ0A 1XMQF 3SCLE 2KT2A 4IRCA 3CJ3A 4HACB 2HIQA 5LT5A 5DQHA 1RP5A 1DLOB 4BC7A 2EFQA 4WCEQ 3BS9A 1IKVB 3R5CA 4QWCA 3VAHA 3MMBA 2RF2B 4NCGA 2PA8D 1TFYA 2F8EX 2MY7A 4DR5J 3KUHA 3DYAA 3DGPA 4MK7A 2XO7A 3R7BB 2J8SA 2DR9A 1FRJA 1PG5B 4KPCA 4JI7J 1CS4A 3HMJG 5EWFA 4H4KA 2IVFB 2RJZA 1RT2A 1DQAA 2IAJA 2FLOA 2OEJA 3DGVA 1AB8A 4Y6IA 1YG0A 1BQMA 4YP3A 1S1VA 3H4DA 5KG0A 5D3GA 2CQ0A 4PYDA 4N41A 1NSKL 3ZZTA 5CQGA 3HHLC 7FD1A 2IHR1 9ATCB 4Z7YA 2R7WA 1KONA 1FJGJ 4O23A 4ED3A 1K1QA 1KBRA 3E3XA 2R7UA 2CQBA 4GKKF 2IC3A 1RT6A 4YOEA 3TANA 3ZZOA 2X1BA 3VR1A 1SXLA 1U1OA 2OPQA 4ZVUB 3NS6A 2RDDA 1HNIB 3DDNA 3RBXA 2VBYA 3D28A 5A8WA 4KHPF 2RAQA 4OX9F 1WJ9A 2AEMA 4C8ZA 1N4LA 5CHCB 1GAOA 4ZJQA 1T02A 2QIFA 1KVJA 1JLBA 3H40A 3K5MA 1BQNA 1H7XA 2E1PA 3KLIA 1AFJA 2ZZNA 2YWGA 1KD1T 3R6GB 1VK8A 2JEIA 2ATLA 3FCVA 3OXLA 4CCHA 2BE9B 4L75A 3BH6B 4ZVOB 4USWA 1REGX 2BE2B 2LECA 1LFWA 4RO0A 1T03A 4DXLA 2DRDA 4IYQA 4NYOA 3FUYA 3FKBA 1QE1B 4FP9A 1TK8A 2XTJP 3PYDA 2G4BA 2P8IA 3H98A 4ILRA 3JAMU 3X3UA 2GA7A 2AYGA 6AT1B 1V6HA 2BR0A 3AOAA 4DUTA 5A76A 2W2PP 4U8VA 5HK4A 1OWXA 2R2TA 1HFEL 2K06A 4X62F 1RT7B 2B43A 2WBRA 3M6VA 1AROP 4AFFA 1VQYA 4OZ3A 3KLEA 1YJUA 4RLEA 1PIEA 4ZHRB 3A13A 4CWBA 3M6WA 1FVSA 2ZM6F 4ECUA 4XTTA 1YSJA 2Y8WA 1VK3A 2WVBA 3G71S 3ELHA 3WIVA 1ZTTA 5DLFA 1HBOB 2MQ8A 1Y10A 1UJ4A 1QUPA 2KVQE 2CQDA 5FLXU 1TL3A 1OS5A 2VC0A 2KXNB 2CA9A 3G6XA 1L5UA 3BR8A 1L3SA 1TKXA 1C4CA 3C6TA 3ZZYA 5LMUF 2EG1A 1WDDA 1SJRA 2JH3A 4OI6A 1M5KC 3Q8SB 1UWAA 1SKUB 3AHPA 3V81B 5KOXA 1JK9B 3UVJA 1WC5A 2IJFA 4FXWA 1LOUA 4DPOA 2DVIA 1JLEA 4F0HA 2DPIA 3I4HX 2B9WA 4NWBA 3CD6S 3BEGB 2FC9A 5HVHA 2GX8A 4DV2J 3QJLA 2VG5A 2O5DA 2YKQA 3MMCB 5T14A 4R5PB 4P2XA 3C16A 2UVRA 2Y9HA 1B7YB 3BBBA 1N48A 3CMAS 2D9PA 2O01C 3FBCA 2HVEA 3R5JB 3E8OA 3QO9A 3UW1A 4C8MA 5ETPA 2UXBF 1VQSA 4WP3A 4GRSA 5ETOA 5E0OA 1NDCA 4WWSA 4NEYA 3JS9A 2F4VF 4TVAB 3TX8A 1S7HA 5KFZA 1IUJA 2VJVA 2FVSA 4V19J 4A48A 2MJNA 4F3QA 3T1HF 3R2CJ 2GVDB 1KN6A 2B4VA 2K1RB 1UFLA 4NRTA 5F3ZA 1F2GA 4Y3CA 2C3PA 1JKHB 2NXNA 3KDNA 5D78A 1EAYC 2J9DE 4LF2A 2E1RA 3J7AN 1YBTA 1V3SA 2XB2D 2ZOFA 1F5BA 4J9SA 2W1BA 2ZJQQ 1NZ8A 4B02A 2DGUA 4J9RA 3RW6A 4CT8A 2BACA 2HQGA 2V8HA 1TK5A 2MY8A 3UQSA 4N5SA 4B3MF 3GPAA 3QBCA 1HR0F 3NNAA 1FERA 2DGWA 2AU0A 3CJKB 1Q8LA 3K5NA 1NK6A 4CH1A 4LF8J 4MFBA 2LCWA 4G65A 2NREA 4LF7F 1Z4UA 2OGUA 1WC1A 1LXJA 3T3FA 1TKTA 3GJQB 4WFYA 3MEGB 5T7LA 5DZ7A 2MTLA 2XSFA 1REVB 5D4NA 3OVBA 2FJEB 1RAFB 1YDLA 3TZYA 4DV7J 3PKMA 4EO6A 2X1FA 1CJUA 2ROEA 1NAQA 4DQIA 3TJ8A 3QWUA 1PGZA 1T3NA 2R9LA 2LEPA 1D09B 2E5JA 4OYBA 4QWBA 3N6LA 5K8OA 3C3LA 3T5LA 4U7UK 1IWGA 1DTTB 3NY0A 3BO2A 2F40A 2DCLA 5LSOA 2K2PA 1DTQA 2HRYA 5KFXA 1SKSA 1RA7A 3DKDA 1RT4B 2RQCA 4DFMA 1Y5IB 2EC0A 2CQIA 2P6TA 1SPBP 4NZ7A 2J9DA 1YJRA 1WACA 5HMZA 3LP0A 1X5PA 4KGZB 4YHHF 2WVCA 2N3OA 1HWLA 1VQOS 2E9TA 3H8YA 2JJ4D 3LUYA 2XBPA 5HBMA 3M30A 4K5SA 1TL7B 1B70B 5FLXY 2LA6A 2DK2A 1J27A 3CDUA 2DD8S 5CYMB 3ILLA 3MURP 1T0TV 2QLJB 2GJIA 2XYPB 1UVLA 3TNVA 3OUYB 2XZDB 4EBCA 3ENAA 4ID5A 2H4YB 1IKXB 5C7PA 2BOPA 1HHSA 3OQ2A 2N4CA 2B5JB 2EFOA 4AD6A 3A4TA 4JV2A 2W01A 2H4WB 5DETA 2QL9B 2VFRA 3K5OA 4L74A 2QT7A 2SXLA 3IC1A 4ER8A 4FS1A 2YKMB 1XC9A 4DFKA 3KHRA 2GQ2A 4DDFA 3PIPQ 2FC8A 3KHGA 4IQXA 1Y3KA 2FPHX 2X7IA 3W3SA 3V6DB 1Q95G 3RBZA 2NR0A 2K3KA 3U1LA 2YXLA 3QT7A 4F25A 1T95A 4CYUA 1FX4A 2CJQA 1R31A 3FK4A 4HH0A 3DRRA 1GEHA 4A8FA 4DR6J 4OYZA 5HO4A 2VPWB 3FBEA 5KFNA 3ETMA 3QIPB 1F9FA 5KFWA 5FJ4A 3THVA 4RW7B 2Z30B 2RB7A 4B3OB 2W9BB 5ETLA 4OYWA 2QV6A 4R25A 1NK5A 4LF6J 1KKHA 2ZUAA 3D4JA 1U7LA 2XMAA 3C14A 3N6NA 1FRMA 3W2WB 3ISND 5KFTA 4UF4A 2EK1A 3C2PA 2VPZB 3R7NB 1PBUA 2ZH3A 3O1LA 3ENQA 3MGJA 3M1VB 3KK1A 3GYNA 3GLJA 2OUGA 1X0FA 4H54A 1LXNA 1JXEA 3U1NA 4KKOA 1KEKA 3KMSA 3H5UA 4HDHA 3ZZZA 2IMWP 1ZAWA 2LDYA 2W24A 3DRSA 3IR7B 5DDOC 1F3FA 3P4UB 4DCJB 2OAUA 2DPJA 3I0RA 2W4DA 1D9DA 1YIJS 1H6KX 2J0XA 4HHJA 2E1CA 1VIXA 3IR5B 4DPUA 2HHXA 2V2KA 1UAWA 5B0BA 1C0UB 1AUSL 3V4IB 1ZM2A 2GO9A 4F50A 3BR9A 2DO0A 4BDPA 3CDBA 2CQ4A 3QLHB 4X65J 5F8JA 3BM7A 4I2PA 4KGKA 4J5OA 4OLPA 2BJEA 1R8HA 1NRKA 5KFIA 2RS8A 2CPDA 4RW6A 1EZZB 3C15B 4DSFA 2J6SA 1HD0A 2YX1A 4I6WA 1I94F 3M32A 2BKOA 1UJ6A 4MT1A 1K9MT 3IBCB 3POTA 1FRHA 2B6AB 2CQ2A 4CLSA 4QZVB 5E33A 5I42B 3AQPA 5AE3A 1QJHA 3MR5A 3BH7B 5THWA 2DIVA 3W5XA 2J7KA 4YR0A 3ZXWA 2IA0A 3FMWA 4LT6A 2BEFA 1U0SA 4CO4A 1X9SA 1T9TA 3FBFA 2AT1B 3ILIA 1NJZA 5L1KA 5CCLA 2CJXB 2HQIA 2J7WA 2ZOMA 2C22A 3M9NB 4PKDB 1IN0A 2OFHX 1SIWB 1FFSB 2CKWA 1P27B 3H20A 2QSFA 4N76A 1TK0A 4I64A 3JB9k 2G13A 5GAGI 5B0GA 4LSZB 2QLXA 1U09A 1CQNA 2EXUA 4HYKA 3RBEA 2ZJPQ 4H4OB 5D0RA 3KJFB 4DV1F 4F2RA 5HVFA 3HHLD 2UUAJ 4ZP7A 5KT6A 2DNZA 3DMJA 2Q1LA 5KFAA 2KFYA 2EFVA 1RTZA 5HAOA 1VRUB 2YNHB 2POKA 2HFVA 1HYSA 3D6TB 1HQEB 3H4BA 3D68A 4ZVHA 3KJVB 4B3RF 2XMTA 2C3MA 3ZZRA 2MKHA 2RNEA 3W1YC 3S01A 4DR2J 1DAXA 1N6QB 4R8UA 2HBRB 4LVNP 3EPGA 2B8QA 1QY7A 3FC9A 2GHWA 5KG7A 2IA6A 3BKUA 1S0NA 5DDRC 3I0SB 3AODA 4CM0A 3THPA 2VOPA 3Q8YA 2J7UA 1P1TA 1SJFA 3P5TL 5D0GA 1LV5A 4QIVA 2YPYA 2ZH8A 2M70A 1HBNA 4QPTA 1GTEA 3DXSX 4DL2A 3FNNA 5A0YA 2ZBIA 4B3TJ 4OYAA 4X66F 1YLXA 4MK8A 5KFJA 5KFRA 2LMIA 3L7PA 1U6ZA 1RHRB 3IBFB 3B82A 3AD8C 1RTIB 1PILA 4I2QB 4ED4A 4IFYA 4LF5J 2CWXA 1N5TA 1YHQS 4Y2AA 2RSQA 4LQ3A 2KZMA 2FHMA 2AGPA 2D7SA 2ZNYA 3PJWA 5C42B 4ZVGA 3CWJA 2UUCJ 2YWKA 3W5YA 1AZSB 1RACB 3DLEB 4IG0A 1RTDA 2OD4A 2V5HG 4DFJA 4F4WA 1FFGB 1OSDA 2HVIA 4KAIA 5IS2A 4KSEB 4ZPVR 2EFGA 2HQDA 2M2BA 3MM9A 1OYDA 2PIIA 4LBPA 4F04B 4ED6A 2QYCA 3TVYA 1G7CB 1FKPA 3CE8A 5A8RB 3OTOJ 2B0GA 3OTBA 1P1LA 1T11A 3NMRA 2XWXA 1KHVA 1H0HB 4WPAA 1P6TA 3PEHA 4Q5VA 5ETSA 3FEYB 3M2VA 4CH7A 3OR1A 2K8GA 1HNVA 1X4DA 3FBBA 3W9IA 4JI1F 1FXRA 3ENWA 4ILMA 1WI6A 3DHWC 1GMWD 3TAPA 2E5LF 1WSVA 1GK8A 3KLFA 3ET6B 4NLRA 4LFBJ 5K20B 2RKIB 3K5PA 4WK1A 1FDNA 1LWCB 2ROPA 4KFBA 5LM7E 5AE1A 4NASA 3SV4A 1JLQB 3MCOA 2EPIA 1PKUA 3QYYA 5CD4H 2AJ0A 2FZGB 4I68A 1VISA 3LPYA 1JX4A 4KHMA 3LWLA 2QA4S 1M1GA 4ZKAA 1S1WB 3J7A1 2RH3A 3Q23A 3VF0B 2UVWA 4DS5A 3OL8A 1VDHA 4OYIA 4FYWB 2R7VA 2V4QA 2B9EA 5KG4A 4TYBA 4AL7A 3BQ1A 2DISA 4LF4F 5A8KA 3D1HA 3T19A 5KFOA 3M2UA 3TUIC 4CDIA 4RW4B 3CJTA 3GYXB 5B0DA 3AB2B 4QW8A 3G6YA 3T5KA 1HWKA 4LIWA 3MR3A 4B3SJ 2AJFE 1WOOA 1RHMB 3D2WA 2P6SA 2JVRA 2DNOA 1UTAA 3W2VA 1SC3B 1RCXB 2BYCA 2N4DA 4IR9A 2IM0A 4WF9Q 4IUFA 3SEOA 1KOOA 3J7ZT 3JYTA 2F63A 1N33F 4Z37A 4ZVRB 2LP4A 3GYGA 4OYOA 4AE5A 1Q5VA 4OV1A 2V4RA 1V5IB 3MMBB 3EX7B 4NCGB 2GAHC 5GAEU 3CVKA 2MSTA 1U2CA 3TJ9A 2BJ3A 4YY3J 3UPFA 2I9SA 2Y1RI 3DYAB 3DGPB 3IBWA 2CPHA 2HPUA 1CULA 4LRDA 2H9ZA 1TAUA 2HS0A 4OX6A 1C1BA 1CS4B 1BUXA 3G96A 2V9WA 1RT2B 2IAJB 3Q8PB 4LRAA 4DQSA 1IQZA 5HANA 1BQMB 3PX4A 1S1VB 4QBUA 5D3GB 5KT7A 4NI2A 3C66A 4JYAJ 4KJIA 2HHVA 2AJQA 2RRNA 2R3VA 2BW2A 4ZPCA 1X9WA 3BPSP 2QL7B 1ZM3A 5E3QA 1F0XA 2VFSA 1E6VA 2IC3B 1RT6B 3GG0A 1EARA 5M2UA 2OPQB 2KH9A 1HNZJ 1ZM4A 1SJ4P 1R8CA 4JV5J 2RUGA 3ILJA 5B0AA 5A8WB 2NZCA 3CT9A 1FKOA 1NH7A 1UW4A 1DQ9A 1HHQA 4DR7F 1TVRA 1NB7A 1KHWA 2XZWA 1JLBB 3QGPA 1BQNB 2Z2ZA 1V9OA 1FE0A 5CYJA 3KLIB 1C2PA 4QIFA 4JI2F 3UCUP 1W25A 1WTFA 2CXEA 4LR7A 2YKAA 1CJVA 2IVYA 2OTJS 1I3OB 2BQ3A 1WKJA 3NBPA 1VHIA 4ZA1A 4O4GA 1RT1A 5HATA 5IT9U 3L3CA 4F02A 1T03B 2OI2A 4MYUA 1HWUA 2VDIA 5LMNJ 4EUVA 2I8EA 2FHOB 3H90A 3BJYA 2A2DA 2VICA 2XY5A 5E3CA 4KGVB 5LXYA 1S72S 1N32J 4C11A 3PCOB 3SSQA 1MROA 4M63A 1RBLA 1M5HA 1FJEB 3OW2R 4ZVTB 3MXHP 1IBMF 1EKRA 1RAJA 1HL6A 1TP7A 3OFHA 3HVRA 3KWMA 1U49A 3OVSA 4J9VA 3M6UA 3NL0A 2XNRA 4QQBA 1U24A 2V0NA 4ETXA 2QO3A 2L9DA 2HFUA 1VQMS 4JI3J 1IJEB 3BREA 1RB0A 3ZNUA 4K4VA 1HI8A 3MM6A 1OSCA 4RJVA 4TU8A 4ZLPA 2I6WA 4B9MA 3H25A 3L4BC 3KKFA 3HFKA 3MD1A 4ZK7M 2N82B 2XS7A 4LF9J 2EVZA 4JBCA 1D1UA 2LVWA 3FJ2A 2AV5A 2PD1A 5KT5A 4DR4F 3WBZA 1JLGA 3CJ8A 4I67A 1ZTWA 1TL3B 1FNXH 1B0VA 3P96A 2CNOB 4LSNA 4XAKA 3ZO7A 4EK2A 4JI0J 4PG4A 3K17A 1TKXB 4PUOA 1NDPA 3C6TB 5ETKA 4WIIA 1WORA 2V4JB 3CEDA 1RT3A 4F0MA 2B51A 3PX6A 5K8MA 1KNZA 1R0CB 3EE3A 3U02A 1QE1A 2HHPA 1WC3A 3JQKA 3UVJB 1UL3A 4GC6A 2DHAA 4A8YA 2HG4A 1T9XA 2YWEA 2BDPA 1JLEB 2XM3A 2DH7A 3BGRA 1N5YA 3DRYA 2UVUA 2ZITA 3NAHA 2VG5B 3ZFVA 1R8PA 1NK4A 1WELA 3I6PA 5LL6d 4WU2A 4B9VA 2J6TA 5K14A 2MPUA 4P71A 2HVHA 3UDEA 2XC9A 2KZZA 2FJWA 4ECWA 3C16B 2XEXA 1GXUA 1R7IA 4HHHA 2OP5A 2B3TB 1S97A 4WBFA 1V3RA 3M8PA 1SJ1A 2UVVA 4UOGA 2MJUA 3PYEA 4N77A 3QO9B 4WXWA 1NUEA 1X4EA 3EWGA 2D69A 4DPYA 4K5RA 3FMBA 1HBOA 1YZ7A 3T1YJ 2PC6A 3GU0A 1RLCL 5KG1A 2JX2A 4CT9A 3P6YC 2NXJA 4R0EA 5BR8F 2ZBCA 5HQLA 2F7VA 1RU2A 2ZH9A 3NCPA 2DNPA 4QIWD 4ID8A 3QRPA 2AYEA 1S4FA 3CJRA 4OIXA 1UCNA 3N28A 1UFWA 4H4KC 2HWHA 2J0QD 3OL7A 3HT3A 1IR2A 1ZH5A 2QJ3A 1CVJA 2HGLA 3W7BA 3DLGA 3RGIA 4GO5X 3K0JA 3RTVA 2X1AA 3DLJA 1RKJA 5GVQA 2DITA 4ZLJA 2YH1A 3GSIA 4UOCA 4NZ6A 2VIHA 1H73A 4QW9A 2UU9F 3O44A 3EDRB 4FYYB 3W5ZA 3ITHB 3RG6A 3A12A 3VV2B 3QRQA 4CZCA 3KDOA 1VQ8S 2UUBF 4USUA 2XS5A 4GMKA 1RWUA 2GQCA 5KFVA 4C3LA 3GE9A 4JI8J 1RU1A 3DC2A 4EWTA 1HBUA 4NLOA 3NOGA 1UVKA 2DRAA 2XLKA 4CO0A 2LEAA 1KRPA 4UQTA 4DUZF 4P9SA 4MFBB 3AOCA 1NKEA 3W9HA 4L3NA 4NYPA 1WSRA 1IBLF 5IT9Y 1FRLA 1TKTB 1NZAA 1PJ7A 1LWFA 5T7LB 5KFFA 1FI4A 1FO1A 4K8RA 3OFEA 8RUCA 3MR6A 1CJUB 2CPYA 3RR7A 3BSAA 2FGOA 3E01A 2PMWA 4YR3A 1PO6A 2HFZA 4RBTA 4W4MA 1UW9A 1QVGR 3EZ5A 3HLUA 2HHHJ 2J76E 3IO1A 4LBHA 1RHUB 1NKCA 3JSBA 1DTQB 3OD2A 2D3ZA 2OELA 2LQJA 1DZ5A 5DS7A 1TUWA 1YWXA 3R1HA 2MLXA 4NLPA 4ZP8A 5EWGA 2EEYA 2QSWA 3LP0B 1YITS 1FRIA 3RZAA 3IN5A 4IOBA 4YB1P 5CD4A 5HBMB 2I0XA 6FD1A 1U0HA 3M30B 3C8YA 2WW4A 4LR9A 1OQ6A 2VOOA 3DXBA 1RTHA 1IJFB 2P2CB 1VQ4S 2GJFA 4ED0A 5ADZA 1BC6A 5EUHA 3CJSA 2ZJRQ 2BKNA 2JLGA 2OJ3A 4ID5B 1WC6A 3DNCA 3US5A 5HP1A 1X60A 1NSAA 2KB2A 5HQ8A 3U1MA 3KXDA 1UP1A 1UETA 2MB0B 4FBUA 4W92B 1Y5LB 2H65B 4PABA 4FYDA 2AZ3A 3RU0A 4NXMJ 4JI7F 2BW7A 2M3DA 4LRBA 2NXEA 4AL5A 1T94A 5F9NA 1T9VA 4DPTA 1FDBA 4CYUB 3DI6A 4KR0B 3DRRB 2BMBA 2FLNA 1FJGF 1C1CA 4KO0A 3Q0AA 2HMIA 4IO9Q 2B7CB 2KT3A 5D15A 4ED2A 2BOAA 2WVEA 4FYVB 4X84A 1XNQJ 1XN9A 3C14B 2QMXA 3RRKA 1X31C 4RUHA 4MJKA 4YDDB 4Y34A 1MNEA 4E98A 1SKWA 3L7UA 3JTOA 4OJHA 3VQTA 4UZBA 1XR6A 2VASA 4MK9A 3KK1B 4F4YA 1B4SA 1S1TA 1QLNA 2HNYA 4O3RA 4RWXA 3UN2A 2QMUB 4KKOB 4CI0B 4IG3A 3RJMB 2Z2YB 3N9UC 2AJ2A 3DRSB 5MAOA 1P8GA 4KE5A 2VODA 4ZPDA 4TU7A 3I0RB 1EETA 1J5OA 2WONA 3DM2A 5H9EK 4KBIA 4OYPA 1NPRA 4A8QA 2IRUA 5B7WA 3HDSA 3RAXA 4MKAA 2RS2A 4FXDA 3EGNA 1ZPWX 1FHTA 4P2MA 1D9AA 2XMWA 3B54A 4N8NA 3TRGA 4XPCA 1RCOB 2GO8A 3I55S 3QIDA 1LEOA 1JNZB 1ZPVA 1ZS6A 4I2PB 3AXKA 3KNAA 3LH2S 4B3OA 4RW6B 5B0FA 3M8ZA 1M0SA 3WIUA 4U7CA 3QMQA 5BYRA 3H5SA 2MMYA 4C6AA 1IM4A 1H3DA 4V1Ak 2DGQA 3M32B 2ZHBA 2UP1A 3AT1B 3POTB 3MOJB 2PGCA 3VGVA 3LAKA 2XGPA 2HAFA 2ZOGA 4R0JA 2DR7A 1E6YA 5JVHQ 2A18A 1O0PA 1YVFA 1FA0A 4FKYA 4G1IA 1Q0NA 3T6JA 4CP5A 4HVZA 1U45A 2Z8QA 1W2IA 1PYTA 5KFBA 1OPIA 4DV0F 2HRUA 1ZOTA 3NCRA 3K2YA 3BGLA 4NCBA 1OMSA 4CO2A 4FPIA 3GG1A 1R27B 1S77D 4DV2F 3GTYX 2VBZA 5HI7A 2CPIA 2XULA 1HNXJ 2OKQA 2IYIA 1ZA2B 1MWZA 5JVGQ 1OPZA 3Q8RB 3WC2A 4LVOP 1SBRA 3I87A 5F8GA 1SCJB 4DMZA 4Z2XA 3OR2A 1WTBA 2UXBJ 2XSJA 4BLGA 3ICLA 4DBQA 5CYQA 1WF1A 1SUQA 3AQOA 1NNDA 2CZ9A 4DR1J 3DMJB 5L1IA 1LWEA 2AHOB 1YX2A 3NMAA 4U9RA 5G0RA 2GMJA 4HT5A 5HVGA 1HYSB 3OLBA 2N3LA 1OJ4A 2X1GA 2DNNA 4DL3A 1URNA 4TYAA 2QA2A 1W2BR 2DH9A 4R8UB 2GQQA 5ITHA 3QZ8A 4ZP9A 3MEDA 3NCQA 2B8PA 4IFVA 2OO4A 4USMA 1S9EA 3VCDA 3VAIA 5J2QA 3PR5B 2Z0GA 2AYMA 2BQUA 3JTPA 2LKZA 1HBNB 2KL8A 4LJMA 2V68A 5A0YB 3LANA 4ZJLA 4CLTA 4PG6A 3CC7S 1FEHA 1NM2A 5F8IA 2COLA 5H9EJ 1HR0J 4EO8A 2EFPA 2M8HA 4OJGA 3GV5B 4OQJA 1KLNA 3I82A 2ZH6A 4LFAJ 3FVYA 3VAFA 3WC0A 1Y7PA 4RL1A 3G6VA 2RU3A 4CLUA 1SC6A 2VG6A 2ADCA 3HHEA 3SDEA 4LF7J 4IFYB 3QZ7A 3G8TA 4DV3F 4LF8F 4IH5A 1QAXA 4AYBD 4ILLA 3N6MA 1Z1ZA 2MHEA 1EHWA 5C2GA 1K1SA 3AAWB 3ADAC 4IG0B 1RTDB 1Q8BA 1CG2A 2C2EA 4F67A 2QYGA 4DV7F 2E1AA 3AA9A 1LWXA 3MPYA 3LGMA 4NA3A 4OJ3A 3PO4A 2W2MP 2W7OA 2GFFA 2ABYA 5GMDA 4B08A 5HSPA 4IH6A 2XMVA 4UOFA 3CDEA 1RGVA 2ALYB 3FEZA 3PM9A 1N6QA 2WK4A 1FKPB 3TX0A 1YTYA 3PRDA 4B9TA 1X4GA 2APOA 3CB4A 2MQPA 4D3GA 2ASLA 2RQ4A 4AQYJ 5JJBA 3M05A 2ZZTA 4DU7A 2IIHA 2BV3A 2AYBA 3M2VB 4XK8C 2AX0A 3HSGA 2N7CA 1Q79A 3OR1B 1HNVB 4YHHJ 4YB7A 2UXCJ 1PSDA 2AGOA 2HLUA 3A8KA 4DUYJ 2QN6B 4J9KA 3SXLA 3KLFB 4WK3A 1H98A 2OPSA 4KFBB 3NGRA 1QAIA 3SCJE 1ACMB 1CJTA 3ILOA 3R5AA 3CIMA 4PCQA 3PFEA 3QGGA 2BM0A 1RTIA 3CJ2A 2JRSA 4N56A 4ECXA 2XI2A 2BANA 1X0PA 3MM5A 2CQ1A 5EWEA 2DNGA 1SB6A 3AFGA 2BRLA 3A8IA 4K0KJ 1GXLA 4ZCKA 4MH8A 5A8KB 2C2KB 3DOMA 1JB0C 4DCPB 2R8HA 1RWKB 4P10A 3M2UB 1NK8A 4MIBA 3TQ1A 3IWNC 4QWEA 2FIUA 4RU2A 3QAEA 1XR7A 2X3GA 4P2FA 2QMWA 5GMKa 4D3HA 2HIYA 3I5AA 5IXUA 3OSNA 2XZTB 3CMES 1JLFA 4IQMA 2V8PA 2ILZA 4HR2A 4KGXB 3W2VB 4B17A 1SVDA 4WFXA 1XNRJ 4WTYA 4DR6F 4RBUA 3JYTB 3SFGA 2ZDOA 2KU7A 1LW2A 3IM8A 4NLWA 3T41A 1FXLA 1YJ7A 3TZZA 3UDCA 4ZPAA 2HZVA 1N5SA 3H2LA 4P74A 1TQLA 4HHUA 1RISA 2UV8A 2L41A 4DL4A 5KFKA 3PYFA 2KFNA 2Q6BA 1CULB 2AEFA 3V6KA 4P6QA 2ERRA 5KG3A 4CM2A 4NCAA 3CUNA 3V6HA 4JI4J 1HBMA 1C1BB 3VZIA 4WTOB 1RUSA 3TP2A 2H1YA 2DNYA 1CQMA 3UR3C 1NJIT 1RK8A 3MTKA 3E51A 3A8EA 1Y4ZB 4FZVA 1WNEA 5L1JA 4EFAC 4NI2B 1FWPA 4KHRA 1TL5A 4ED8A 2I1RA 4CO5A 5HL7Q 1XQIA 4USJC 3CTRA 1BXNA 2H3EB 3BB5A 2UUWA 4USHA 3KK3B 2JVOA 3ZTQA 1NHUA 3G4SS 5AXKA 3NAIA 2VC1A 4IOAQ 1WOPA 1VQ7S 5CXTA 2WB1D 4DX6A 2RHSB 3BKTA 2HKEA 1Q7YT 4IKAA 1SC1B 2MKYA 3DLLQ 3DOKA 3GSDA 2GGPA 3CDAA 1FKOB 1N5VA 4X64F 1FDAA 2QGFB 1TVRB 1F9EB 1OY8A 3RB6A 3UN3A 3NGUA 4TN2A 4HEA9 4X65F 3LP2A 1IKWA 2CPFA 2GVZA 1X4BA 5KG6A 5GAHU 1YJWS 1CJVB 2ROGA 4OZJA 1WHXA 4C48A 1MN9A 4CTAA 3NBPB 4PQUA 5A2QU 4O4GB 1RT1B 3AXMA 1I94J 3Q86A 1JJ4A 1F60B 2XQCA 2ZWPA 3GR1A 4URQU 2JEGA 3O8WA 2GC8A 4HDGA 1YRXA 2XCPA 3SQGA 4OJ1A 4CNZA 3CJ0A 2HBQB 4C11B 5KFHA 1MROB 1FRXA 1R89A 1QSLA 1WC0A 1RABB 1YJ9S 5CABA 4FF1A 4OZNA 3CC4S 4IRDA 3NP5A 3PRVA 2ZE2A 1SL2A 4DG1A 1RAGB 5KT3A 2KO1A 4PWDA 3MM6B 3IR6B 1Y3JA 3HZGA 4AXIA 1LQ9A 4W98A 2DHSA 1TUGB 4ECRA 3GV8B 3TUPA 1ICEB 3LALA 2PT0A 3R6LB 5IFMA 2AIRB 2HS3A 4ALZA 2B7BB 3BQ2A 5DDPC 1FD2A 1RT5A 1BMQB 1YKWA 1JLGB 3CJ4A 6FDRA 4LSNB 4QIGA 1NO8A 2VBWA 4RZRA 1KFSA 1SL0A 4WE1A 4PUOB 4FVMA 2Q43A 2IBKA 4CLPA 1RT3B 3HD2A 4C4WA 2UUAF 1RAIB 2J6UA 2DGTA 4KGMA 1PJ5A 1DY3A 1D8YA 2M9KA 3HVWA 2E5GA 4NZ0A 4B3RJ 2HFOA 1C4AA 3RYLA 2PDAA 3MI7X 2KFZA 1SQEA 2NLWA 1VC0A 3PEJA 2DRBA 3Q8QB 3BGRB 1N5YB 2R8KA 1IVZA 1N36J 1UEUA 2RU9A 2U1AA 3ZZPA 4DV5F 4OX7A 2KG1A 2M88A 2ZHOA 2ZC3A 2H5JB 2ZH1A 5K14B 2OTLS 3HHDA 4K4TA 1S48A 2FJAB 1U8SA 4Y2IA 4F36A 3HSZA 3NLCA 3B78A 5D4PA 3M8PB 4HL9A 4X66J 2DHHA 2HFSA 2M8DB 2ZC4A 4NPOA 3KJNB 3DOLA 4KPYA 4B3TF 2MZSA 3VWSA 1F6TA 1UFKA 1VC6A 4JI6F 2BJ7A 2OPPA 2BZ2A 1V5VA 2PA3A 2J0WA 2V8DA 3NWGA 1JMTA 4PZVA 2VHGA 1VQ9S 2CDQA 1XJWB 2IMOA 4AL6A 1SV5A 4URGA 4M5IA 4QJVA 5E2QA 5CA5A 2UV8G 4NE9C 2AQ4A 3KTQA 3LO3A 2K3IA 2V4JA 4NLTA 3VAKA 2UUCF 2F9DA 4MKBA 5B09A 4MKYA 3J81j 4A8KA 2AGQA 3VGSA 3Q24A 3DLGB 5KOWA 3HSJA 2VPXB 4PG7A 4C3MA 1RLDA 8ATCB 1Q4RA 4J9PA 1QDUB 4U95A 1KR4A 1CSJA 3HJFA 3HZEA 1U48A 3ZTOA 5EDWA 4ZITA 5HJYA 3OTOF 1YJNS 2WBMA 4ES3A 1T3OA 4NOHA 1HBUB 1N34J 3Q89A 2KDOA 3DU5A 2VQEJ 2BKPA 2E5LJ 2P5VA 3RUBL 4ICLA 4RNOA 2CPJA 5A2QY 5K5MA 4Y0FA 3W60A 4ZCMA 2YTCA 2MXYA 2FDNA 4OI3A 2QC3A 1LWFB 4ZVEA 4LFBF 1V3ZA 1I6JA 2UZAA 1FJ7A 3CULA 2FLLA 1R0BG 3NKYA 3HPOA 1JLCA 1X4AA 3MPVA 3J81U 5LSLA 2LXFA 4YB6A 3LWMA 1NEEA 3E01B 2D9OA 3W9JA 4NLQA 4KRWA 2GIQA 3G82A 5DG8A 1KS2A 4J7CA 1WOSA 4ANCA 4DV6F 4LF4J 3F41A 1K47A 1N88A 3RRHA 3FCHA 5IC4B 4GKJJ 3N0VA 2HWTA 4DL0C 3O6QA 2C2DA 2MLZA 2DTJA 3Q8UA 4TQSA 3J7Z5 1FNOA 5IC6B 1H2UX 3BBCA 2DXDA 3ITHA 3TA0A 4B3SF 2ZH5A 4YB5A 4DSLA 2YQ0A 4K4WA 1U0HB 1QVFR 3A3PB 2GIRA 3FRYA 4IRKA 3GR0A 1RTHB 5BXIA 2RMLA 1RWMB 5U47A 2VQFJ 4O3NA 2DKOB 4GVLA 1IR1A 2W2NP 1VBZA 2C2MB 2PEBA 4RX6A 4HI1A 1ZAXA 1I5OB 3MWBA 1TZ0A 1IKYA 1MG7A 3R27A 3MF5A 4H4MA 5HP1B 4YY3F 3MAAA 4AXJA 1Q8KA 3GQCA 2DHGA 3M7VA 4ANEA 1OY9A 1R43A 3KK2A 4MMOA 3QGHA 2VH7A 3JAMY 1B0TA 4Y28C 5AXLA 3OJSA 2HYIB 5J1EA 2RVJA 4AUKA 3UCGA 2L3MA 1O51A 1RA6A 3W8GA 2R7SA 2BABA 1Q16B 5I3UA 5IWAJ 5BYQA 1XWLA 4DF4A 3IS9B 2VB6A 3QSIA 3DI6B 2IY5B 2B4OA 3DHXA 2KM8B 4P7VA 1PYOB 4IOCQ 1C1CB 3U7JA 4KO0B 3UDLA 2MHNA 3VGTA 2HMIB 1LK7A 1FWLA 1CEZA 1UZHA 2BE7D 1HNZF 3TOQA 4TU9A 4JV5F 2K7JA 4X4RA 4CLKA 3BO4A 2EWHA 4DR7J 1VIOA 5A6WA 5F8HA 4YQWA 1K44A 2HK3A 3SFUA 4N8OA 1U4BA 2RRBA 3TJAA 1CC7A 5D8HB 2W7AA 5HROA 2KYXA 4YFUA 4E2FB 1VFJA 4DPXA 5JXSA 3ETOA 1S1TB 2O67A 2HNYB 1SI9A 3OV7A 4PEOA 2CJYB 3MFIA 2HGNA 4IG3B 3VVUA 5CH7B 1S6QA 3W61A 1RAAB 3CCJS 1EETB 1QD1A 4C2MA 1J5OB 2WONB 4RPFA 3DM2B 3UD4P 1N32F 4GVBA 4MIAA 1TV6A 1ITPA 3MAQA 3G8QA 4M5JA 3MUVP 1ZA1B 2WW8A 2WCXA 1W7WA 1RAOA 1UZDA 3L9ZA 3GJTB 2FJDB 3AA8A 4C8YA 3MUTP 4JI3F 2XMKA 2XY7A 4TXSA 1I51B 3PJXA 1D3WA 4PWWA 2YNGA 3IGNA 5DLGA 4LBIA 3LA0A 3BPDA 4WIQA 4DR4J 4FN5A 3OHAA 2WOMA 3HHKA 4HKQA 4LF9F 2MLYA 4CLFA 1A0OB 2IFXA 5HLFA 3DLKA 3KG0A 1T9UA 1ULRA 1HW9A 1OY6A 3NS7B 4JI0F 3HFVA 2GZOA 3OL9A 1SC4B 1E6YB 2QE5A 5DJBA 3LQVA 3I96A 1NJYA 1GMUA 1GX6A 1FEEA 2ZZMA 3GWCA 3LTOA 4NLSA 5FDLA 3KJQB 4DJBA 2EK6A 4C8NA 3TA1A 1JNRB 4NXNF 2KTQA 4DX5A 2VUGA 3F73A 4X2BA 2V8VA 1HI0P 5DZ6A 2F8HA 1NPPA 2JEJA 4ZOSA 3GCXP 4BS2A 2KJVA 3W8PA 1Y9OA 2KJWA 1XMOJ 1Y00A 4L76A 2WSFC 4CRJA 3NS5A 2XGQA 5B08A 4RNMA 4CO1A 3CPWR 4K2XA 2MEWA 5T41A 3PRBA 3S7RA 1HNWJ 3HSDA 2CPZA 4S0MA 1HPZA 2KN4A 1U1PA 5LSRA 3TUJC 3OR2B 2ZDPA 1VGYA 2XSJB 5HN0A 3BF4A 5CYQB 4YMEA 1SUQB 5KFMA 5KFQA 3NGTA 2RDJA 1LWEB 2YBVA 5G0RB 3Q83A 2V34A 2HBYB 5BR8J 3KG4A 4MAKA 1UA1A 2PFDA 2FJBB 5HQMA 5C24A 4JV1A 2Z58B 3ISZA 2P9GA 3QT5A 1RWPB 3MEDB 4IFVB 1DARA 1GT8A 1RTJA 4NLYA 1NSPA 2YQ1A 1S9EB 2BUNA 2GNKA 3EMTA 1TR0A 3IXQA 2X51A 2PMZD 5J2QB 3T6BA 1CJKA 2UU9J 2ZVIA 1XTZA 4IR1A 4WFZA 4UT4A 2CNKB 2KM8C 1RBAA 4OL8A 3IRXA 3M2RA 4C97A 4JI5J 2ZD1A 4F4ZA 1BD6A 4NA1A 3PG9A 4CLLA 2J5AA 1BGXT 4JI8F 4M5GA 3AJ2A 1I1GA 4PPZA 2WVFA 2G9OA 2VG6B 3SDEB 3KMQA 2BM1A 2NXCA 2ATCB 2VL1A 3T9NA 1WKLA 2W8LA 2MZ1A 3OTCA 2FVPA 4J9QA 4LQ9A 1PAUB 4ZPTR 7FDRA 4X4OA 4G1QA 2JHEA 3VAMA 4X4PA 4CLWA 1DQ8A 1FCAA 2CQPA 2YX7A 3CCTA 4Q45A 2EFNA 3ZTPA 2QL5B 2VD3A 1JLAA 2L9WA 3MAHA 1BLUA 1PBAA 5C5JA 3IA0A 5KG5A 4I4BA 2HHHF 2IVMA 3SMZA 4ZJOA 1UJ5A 3BZQA 2OSQA 3OBIA 2H48B 4DX8H 5GADU 1NSQA 4PWUA 3R7SB 1B0PA 5EHHA 4C0OC 2HK2A 3ZZ0A 4C7QA 4J9OA 2JEFA 3PO5A 3LPEA 3M8QA 5KFCA 3S1TA 3MECA 2MZJA 5JMNA 1CBKA 5DO2A 3NNHA 2P9EA 4I6AA 2OPSB 1LKZA 1CJTB 5J2PA 1G3OA 4ZPWR 3EJMA 4FKXA 3CCRS 2BANB 3MM5B 3HFZB 1L3TA 3I4PA 3QWPA 4LFCF 1EQ0A 4C3KA 1Q1KA 3UWTA 2XHCA 4LSLA 1UVJA 3GB0A 2DIUA 3SZ2A 3IM9A 4WP9A 2DGSA 1S1XA 4FBTA 4O44A 3DOMB 2X3DA 3D3CJ 4NXMF 4ELVA 4DL7A 3HO1A 2MQMA 4Y65A 5E3RA 3D0IE 5L9XA 2C1EB 3QJJA 2RIJA 1Q81T 2DGOA 2CPEA 2F4FA 2YKOA 3HP6A 3QFHA 1KQFB 1JLFB 5ETQA 3GIKA 1S6PA 4Q0BA 4A8OA 1RHKB 4TLRA 2ZFHA 3Q8VA 5AJ3J 3F44A 5FIIA 2IDEA 2DYAA 2DNKA 1LW2B 2ACYA 4WFBQ 3HHNB 1FRKA 4M8LA 2M7SA 2B4UA 4EMDA 1XNQF 2B4PA 1B3TA 3GJRB 4U8YA 2WRMA 1XEZA 2PN6A 2MDAA 3RB3A 4RW8A 1AA1B 4OHYA 5A6PA 3CO0P 4RBVA 4BBYA 4Q8EA 2IJNA 2B9XA 4KV8A 1HW8A 1HBMB 1UA0A 4F4XA 2Q3PA 1KVIA 3D6MB 2HNDA 3VAJA 4Q44A 4KYZA 2AEJA 4KH0B 1WF0A 1YK9A 5DQIA 4EYIB 1U25A 3QGIA 2WVDA 2OLWA 5HMWA 4RU9A 1FF2A 4EGLA 2JL9A 2CFXA 2HHUA 2D3UA 1IBCB 2LDIA 5IQQA 1S49A 2RE1A 4ATNA 4QCLA 1NHKL 2A10A 1UVNA 1C0TA 3KUGA 4A8XA 2Y1LB 2NPFA 2FVQA 3N5FA
chains in the Genus database with same CATH topology
3GV5B 3C2PA 2GCFA 4OQJA 1KLNA 2O3DA 3I82A 2VPZB 4WU3A 2DCUB 2ZH6A 2K1RA 3FVYA 2ZH3A 3O1LA 3VAFA 3WC0A 1Y7PA 2XMJA 3D5MA 3G6VA 2RU3A 1RYSA 1JKHA 1SC6A 2VG6A 3ZZUA 3HHEA 3ENQA 1U26A 3MGJA 3SDEA 5J2NA 3FFIB 4IFYB 3DOKB 2ALZA 2GGPB 3M1VB 3KK1A 5J2MA 3TAQA 3GYNA 4DR2F 1FE4A 5GAGU 2LYVA 3QZ7A 2D41A 3G8TA 4DV3F 5B0CA 1U1MA 3VQSA 4LF8F 1IQTA 1X0FA 4J9MA 4H54A 1UMJA 1LXNA 4IH5A 1JXEA 1QAXA 3FSYA 4HT7A 3CF5Q 1MMLA 2YNFB 4AYBD 3I56S 2LXIA 3HXMA 3N6MA 4ILLA 3U1NA 3IFEA 3H5YA 3M6XA 1Z1ZA 5B0EA 1TKZA 4KKOA 2MHEA 4YUDA 1KEKA 3KMSA 3PV8A 3H5UA 2D3OR 2DJWA 2ZH7A 2M52A 3LP2B 1IKWB 1S0OA 2FJVA 1HA1A 4HDHA 3FSIA 1Q78A 2FTRA 3ZZZA 2H5EA 1K1SA 4BCAA 4G3IA 3LF0A 1WG5A 3AAWB 2IMWP 1ZAWA 4IG0B 2LDYA 2W24A 1RTDB 3DRSA 3IR7B 3Q2SC 4DHVA 5DDOC 1Q8BA 1CG2A 2OAUA 2C2EA 2DPJA 4F67A 3I0RA 3PACA 2W4DA 4DV7F 2KHDA 1D9DA 4UY8T 2HHTA 4CTAB 2E1AA 2JFDA 3TVZA 1YIJS 4K50A 4PQUB 3AA9A 1H6KX 2J0XA 3MPYA 3N5BA 4HHJA 4I56A 1U1NA 2ILYA 3LGMA 4NA3A 2E66A 4EZ9A 2E1CA 4OJ3A 3PO4A 2W7OA 3MMAB 2GFFA 2ABYA 5E41A 1S1UA 1VIXA 3IR5B 4B08A 1UEVA 2HHXA 2V2KA 2R2RA 2HZCA 4DQQA 4IH6A 5DG7A 3L09A 5LXRA 1UAWA 4RNFA 5K8PA 1KQSR 2XMVA 5B0BA 4JV0A 3I9V9 1MWYA 4Y00A 3CDEA 1RGVA 3SQGB 4ZS6A 2A2CA 3CJKA 1C0UB 2IBOA 3FEZA 3OPKA 2C3YA 3PM9A 1KLMB 3IAM9 3E2EA 3GMGA 1N6QA 2WK4A 3TW0A 1FKPB 3V4IB 1ZM2A 2MKJA 1U2RA 1SH3A 2QLWA 2GO9A 4F50A 3BR9A 2Y1IA 2DO0A 1YTYA 3PRDA 2PI5A 4B9TA 4BDPA 1X4GA 2APOA 4LF5F 1MSWD 4WZMA 1FXDA 3CDBA 2CQ4A 3CB4A 3QLHB 4MIWA 2MQPA 3QAUA 4D3GA 4U6PA 1HQUB 2ASLA 2RQ4A 5JJBA 5F8JA 3M05A 2BV3A 2AYBA 3BM7A 4I2PA 3M2VB 3SCKE 4KGKA 4XK8C 2AX0A 4J5OA 1F5AA 3DDKA 2N7CA 3D1QA 3MEGA 4OLPA 1Q79A 3OR1B 1HNVB 2BJEA 2DGXA 2YQ3A 4YB7A 1KSPA 1REVA 3GIMA 1R8HA 3DRPB 1NRKA 3LP1A 5KFIA 2RS8A 4YEAA 2CPDA 1PSDA 4RW6A 2GW8A 3IAS9 1K0TA 2AGOA 2ZE2B 3KK3A 1O5JA 1FK9B 2HLUA 4DG1B 4DSFA 2J6SA 4TY8B 1HD0A 3N01A 4J9KA 2YX1A 3SXLA 3KHHA 3KLFB 3LGNA 4WK3A 5C25A 4WFNQ 4I6WA 4PWDB 1H98A 1KTVA 2D74B 4EBEA 1X8DA 3LW5C 1I94F 3M32A 2OPSA 4C0HA 4KFBB 1QAIA 3SCJE 1UJ6A 3TO8A 3D0HE 1K9MT 3POTA 3R5AA 1LK5A 2LEBA 1WEZA 5DM6Q 1DTTA 1FRHA 3CIMA 4ZVFA 4PCQA 1HWIA 2B6AB 2V8GA 3PFEA 3QGGA 3RBDA 2BM0A 2CQ2A 1RTIA 3CJ2A 1TKDA 3MD3A 2YVSA 2V94A 2JRSA 4N56A 4ECXA 4WXOA 3BDEA 1XMBA 2XI2A 2BANA 1UKUA 1WEYA 1HNXF 1X0PA 2Q79A 3MM5A 4QZVB 1RT5B 2NYIA 5E33A 3AQPA 1IR0A 2CQ1A 5I42B 5EWEA 5AE3A 4O3PA 2DNGA 2KRBA 1S9GB 3R5DA 1RT4A 1QJHA 3MEEA 2XS2A 2MZQA 3MR5A 4F8RA 3B8HA 5THWA 2DIVA 2E5HA 4KQZA 4NLXA 1U1QA 1SB6A 2BRLA 2MGZA 2J7KA 2XMUA 4YR0A 4W90B 5AJ3F 5EGYA 2IA0A 3FMWA 4LT6A 2JZ5A 4CO4A 1BY9A 3CCLS 1M5VC 4WE1B 1GXLA 4ZCKA 1X9SA 4MH8A 5A8KB 3G9CA 3C6UB 1NJZA 2R7QA 5L1KA 3DOMA 5CCLA 1JB0C 2R8HA 2HQIA 3OVAA 1AXQA 3M2UB 2J7WA 4DR1F 5MLCV 2BA9A 2ZOMA 2IYGA 1NK8A 5H1SV 1RDRA 4MIBA 3TQ1A 3IWNC 3PW2A 3MUMP 4QWEA 2C22A 3M9NB 2FIUA 1Y5NB 2FJXA 4PKDB 4RU2A 1IN0A 2OFHX 3QAEA 1SIWB 2C2RA 1XR7A 1XK8A 2CKWA 2DBBA 2X3GA 5F8LA 2VA2A 1P27B 4UW2A 2QMWA 5CZXA 1M90T 5GMKa 4D3HA 3I5AA 4I1TA 5CYMA 2VG7B 4Y2KA 5IXUA 3H20A 3MPWA 3OSNA 2JDJA 2QSFA 4N76A 4K59A 3CMES 1JLFA 4O4RA 2E29A 4IQMA 4ZDNA 1S9FA 1TK0A 1GX5A 1WI8A 4I64A 3JB9k 3HM9A 4KTQA 3OUYA 2G13A 2ILZA 5GAGI 4NRUA 3W2VB 1WG1A 5B0GA 3SCIE 2HWIA 3OFGA 3ULHA 5KAKA 4URSA 3TVKA 3KOAA 1IKXA 2QLXA 4B17A 1U09A 1CQNA 4HI2A 1X4CA 4WFXA 2EW9A 4HYKA 2LLZA 3RBEA 4DSJA 2ZJPQ 4WTYA 2Y1JA 2DR8A 1R3NA 4DR6F 2BVZA 4RBUA 2DNLA 3JYTB 2B5JA 4H4OB 3SFGA 4EZ6A 2J9EA 2ZDOA 2NUHA 3MMJA 5EX0A 2KU7A 1LW2A 2NS1B 2YNIA 4NLWA 4TLQA 4NLUA 3UE2A 4DV1F 4F2RA 4TY9A 5CZVA 1X4HA 4A8WA 2CJKA 3HHLD 2IM2A 1FXLA 5GAEI 3UDCA 5HMXA 5KFYA 4ZP7A 2ZKUA 4ZPAA 5KT6A 2DNZA 1MMNA 3DMJA 2Q1LA 5KFAA 1FJCA 4I0WA 2KFYA 3VZHA 2EFVA 2C42A 1N5SA 4CO3A 5IZHA 1VRUB 2YNHB 2FLPA 2YKMA 3H2LA 4USIA 1DHMA 2POKA 1TAQA 1G1XA 1TQLA 2U2FA 1YJVA 1FT8A 1RISA 3K57A 3M9OB 2UV8A 2L41A 1HYSA 3K8VA 4DL4A 5KFKA 3DOLB 2KFNA 2DB1A 2PO4A 2Q6BA 2I2YA 1HQEB 1P9QC 3H4BA 3BSNA 2DH8A 4QU7A 3V6KA 3FGVA 4P6QA 4ZVHA 3V6DA 1GH8A 2ERRA 1K0VA 2MSSA 5KG3A 2OPPB 3KJVB 4B3RF 4NCAA 2F9JA 4OZ5A 2YWHA 3CUNA 2XMTA 2C3MA 3ZZRA 3V6HA 1HBMA 2MKHA 1C1BB 2CQCA 3VZIA 2RNEA 4O3QA 1R6YA 3TP2A 2J9CA 3S01A 2DNYA 1DAXA 1CQMA 3UFCX 4R8UA 1RK8A 3UR3C 1NJIT 1N6QB 4LFAF 1AFIA 1YGYA 2OMLA 3MTKA 3E51A 4LVNP 5KT4A 3EPGA 4F4KA 1QY7A 3A8EA 1Y4ZB 2HNZA 3PKYA 4UY85 3MEKA 4QU6A 2GHWA 4FZVA 4RNNA 5KG7A 2IA6A 2E7WA 1S0NA 1WNEA 1SV5B 5DDRC 3I0SB 5L1JA 4EFAC 4KHRA 1T05A 1TL5A 1TUVA 2ZUGA 4OFZA 3SYZA 4ED8A 1GXTA 3QIPA 3THPA 2I1RA 2VOPA 3MM8A 4IO1A 4RW7A 4CO5A 2J7UA 3ENVA 5HL7Q 1P1TA 1SJFA 2W9BA 3P5TL 4USJC 1VQPS 2NZ4A 3CTRA 3SSRA 1LV5A 4LUBA 4QIVA 4RW9A 4DFPA 4M95A 2ZH8A 2M70A 2YKNA 3BB5A 2UUWA 1QTMA 4USHA 5SZTA 1HBNA 5D77A 3KK3B 2JVOA 4QPTA 1GTEA 3I32A 4O3SA 1NHUA 3DXSX 5AXKA 2WSCC 2DNHA 3FNNA 3NAIA 3AH6A 3G4SS 5A0YA 4DL2A 2GV1A 4B9SA 1N56A 2ZBIA 2XNQA 3CXCR 2VC1A 4P7TA 1YRTA 4X66F 1DFDA 4MK8A 4IOAQ 3W2WA 5KFJA 5KFRA 1HMVA 2LMIA 3L7PA 1U6ZA 1X5SA 3O3LA 2KI2A 2K7KA 3EXCX 1VQ7S 5E3PA 5CXTA 3AJ1A 2WB1D 5IT0A 2J8AA 3B82A 5KFPA 2MQOA 4WKRA 3BGUA 1U6FA 2UXDF 3PDNA 3BO3A 4MTPA 1Q7YT 3M9MB 4XPEA 1NH8A 1HARA 2KVIA 1RTIB 4IKAA 1FD8A 1PILA 1JIHA 3F56A 4I2QB 5F41A 4WYWA 3BSCA 3FFIA 3OFFA 2R2UA 4IFYA 3DOKA 3GSDA 2GGPA 3M1VA 1N5TA 3DLLQ 3CDAA 1FKOB 4NL5A 2HFNA 3I9ZA 1YHQS 4Y2AA 1N5VA 4X64F 2RSQA 4C0BA 1FDAA 1GTHA 1TVRB 2KXFA 4LQ3A 4Y2MA 2EBGA 2KZMA 4JOUA 2FHMA 1VQNS 5KTQA 1ZZNA 3PVXA 5BYSA 2YNFA 2AGPA 3RB6A 2QRRA 2D7SA 2W8KA 1VS3A 1ELOA 2ZNYA 3PW7A 3KNGA 3PJWA 5KG2A 2RT3A 1JJHA 4DL6A 4TN2A 4HEA9 4X65F 3LP2A 1IKWA 4ITSA 4ZVGA 4ZCIA 3CWJA 5C42B 4AQYF 4M1KA 2CPFA 2YWKA 3OXGA 5AE2A 1JJ2R 3RB0A 1X4BA 5KG6A 3KLGB 5GAHU 4RUAA 1YJWS 3DLEB 4JYAF 1Q7LB 4IG0A 2ROGA 4DLEA 4OZJA 2OD4A 4QIEA 1RTDA 2AJ4A 2QEXS 1WHXA 2V5HG 4DFJA 2HHSA 2AJ1A 4UUXA 1NU4A 4F4WA 4O3OA 3MTJA 4XO0A 4PXBA 3NBPB 4CTAA 4ICLB 2UXCF 4PQUA 2PFFB 2Z4PA 3FSXA 1GNKA 1OSDA 4O4GB 3OTEA 2EI5A 1RT1B 3MM7B 5DDQC 2CVIA 2AW0A 4DUYF 2HVIA 5KFUA 4KAIA 1F60B 5IS2A 1JJ4A 4KSEB 2JLFA 2EFGA 4ZPVR 3BN7A 2MZTA 3UCZP 4QR2A 2CIMA 4DSIA 3GR1A 4URQU 4JUZA 4OHZA 2JEGA 4K0KF 2M2BA 3O8WA 3OSPA 4ZP6A 3MM9A 2GC8A 1U1RA 2F8MA 2PIIA 2XHWA 4HDGA 3PR4A 1AW0A 5E3AA 3VTIA 4ED6A 1YRXA 2MZRA 3HVTB 2XCPA 5HMYA 4B9UA 3SQGA 1HD1A 1QUVA 1JLCB 1C0UA 4Q43A 3ONQA 2QYCA 1KLMA 4OJ1A 1NHVA 4CNZA 1U47A 4DQPA 3TVYA 1G7CB 3CJ0A 1FKPA 5E5NA 3V4IA 2HGMA 3CE8A 4C11B 5A8RB 2MQQA 5KFHA 4Y2CA 2V9KA 1MROB 1LW0B 1FRXA 1XR5A 2B0GA 3OTBA 4YDXA 2LU1A 2OSRA 1P1LA 1R89A 2A3JA 4ELTA 4EU0A 1QSLA 3EXYA 3NMRA 4TQRA 4OI1A 5IM0A 1WHWA 2XWXA 1UVMA 3QLHA 2N7YA 2VZ9A 1KHVA 1YJ9S 1Q53A 4FF1A 1H0HB 1HQUA 1P6TA 3PEHA 4Q5VA 3DCAA 4OZNA 4XDCA 3V2UC 3FEYB 4X4TA 3MFHA 3PW4A 5KFDA 4X4VA 3M2VA 2HW3A 4F3MA 4CH7A 4FF3A 3OR1A 2K8GA 1YI2S 1HNVA 1X4DA 4FNHA 3T9ZA 3CC4S 3FEXB 4IRDA 3NP5A 2CQHA 2CQGA 3DRPA 3G6ES 1K73T 1VQKS 4JI1F 2FGCA 1SH0A 1FXRA 3SI8A 2ZE2A 3MDFA 3ENWA 4QR0A 1Q82T 1FK9A 1SL2A 1WI6A 4DG1A 4Q8FA 2E9ZA 4ILMA 3DHWC 2YWFA 3TAPA 4TY8A 2E5LF 5KFSA 4Q2LA 3V4MA 1SIZA 3KLFA 5KT3A 2KO1A 4NLRA 4PWDA 3T5JA 3MM6B 3IR6B 2HS4A 2RKIB 1Y3JA 3HZGA 3K5PA 1QM9A 4WK1A 3U27A 1R0AB 2ZHAA 1FDNA 1LWCB 3KYLA 2ROPA 2VPYB 4AXIA 1LQ9A 4KFBA 4X4QA 5AE1A 2KHCA 2XG8A 4F2SA 2DHSA 5LMNF 3SV4A 4QYRA 4ECRA 1JLQB 3CGIA 3GV8B 3FDSA 3K5LA 2EPIA 3CO9A 1HWJA 3LALA 2PT0A 2B6AA 1XERA 5IFMA 4DN0A 2VA3A 2HS3A 2LQBA 3QYYA 4ALZA 5CD4H 2B7BB 3BQ2A 1OIAA 5DDPC 2AJ0A 2PSZA 4I68A 3LPYA 1FD2A 1JX4A 1RT5A 5I42A 4KHMA 4NLVA 3LWLA 2FHKA 2QA4S 3UNGC 4ZKAA 1S9GA 1S1WB 1JLGB 3CJ4A 3J7A1 2LXUA 3RRGA 2FUG9 2OFGX 2RH3A 4ETZA 3N79A 1ZBTA 3THTA 1X4FA 6FDRA 3Q23A 4LSNB 1KQGB 3VF0B 4DOZA 4QIGA 1H2TZ 1XNRF 2UVWA 4DS5A 3OL8A 1L3KA 1NO8A 2R7VA 2V4QA 2VBWA 5KG4A 4RZRA 2E7XA 2Z2LA 1KFSA 2JLEA 3NRBA 1SL0A 4TYBA 4WE1A 3BQ1A 2DISA 4AL7A 4PUOB 4LF4F 5A8KA 4RKUC 4OMFG 1IKYB 4FVMA 3D54A 3C6UA 2Q43A 4WFAQ 3D1HA 2ASDA 1RT3B 2CJBA 2R2SA 2IBKA 2NSCA 3T19A 5KFOA 4C4WA 2DNRA 2UUAF 3M2UA 3TUIC 4RW4B 4ES2A 2J6UA 4H4MB 3GYXB 2DGTA 5B0DA 3AB2B 4KGMA 4QW8A 1U6BA 1FTCA 3G6YA 5LJ5Y 2FVRA 1M5PC 3T5KA 1D8YA 1DJ0A 1HWKA 2M9KA 3HVWA 2E5GA 2YX4A 4NZ0A 1HMVB 3FZ2A 2HFOA 2OPRB 1C4AA 4LIWA 3MR3A 3KK2B 3DN9A 3RYLA 2PDAA 3MI7X 4HLBA 2KFZA 1SQEA 2AJFE 4FS2A 2NLWA 1VC0A 3PEJA 2VG7A 3D2WA 4DSEA 1VRTB 2EBEA 3EGZA 3TARA 4K4UA 2P6SA 2DRBA 3CD0A 2JVRA 3GIJA 3H2UB 2DNOA 3I5BA 3J81Y 4QOTA 2VONA 3Q8QB 1M5OC 2R4FA 3BGRB 4JI4F 3GFYA 3UI3A 1N5YB 5J1EB 3TA2A 2YY3A 2R8KA 3W2VA 2BYCA 1UEUA 4ELUA 2N4DA 2RU9A 4IR9A 2U1AA 3ZZPA 4DV5F 2IM0A 2Z2MA 4OX7A 2KG0A 4IUFA 4WF9Q 2KG1A 2M88A 3SEOA 2ZHOA 2ZC3A 2BXJA 1KOOA 3J7ZT 1PC5A 3KLHB 3JYTA 4A8SA 4H4OA 2ZH1A 1N33F 5I3UB 1S76D 4Z37A 5K14B 3RW7A 5D4OA 4AE5A 3HX9