4FPRA

Structure of a fungal protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
b'AYVCREASISGEIRYPQGTCPTKTEALNDCNKVTKGLIDFSQSHQRAWGIDMTAKVQCAPCKTTDPWDVVLCTCKITAHRYREFVPKIPYSSFSSAPGVIFRQETGLDHDPEWVVNMKARTRGCDHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avirulence Effector AvrLm4-7
publication title Structure of a fungal protein
rcsb
source organism Leptosphaeria maculans
molecule tags Protein binding
total genus 29
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2910 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fprA00
4FPRA
chains in the Genus database with same CATH superfamily
2XMMA 3MUTP 3VR1A 2AHOB 5FDLA 1BC6A 3D0GE 2WZ1A 1VJQA 1PAEX 1NEEA 2V4QA 5D0GA 3R5BA 3KJFB 4WKRA 4CO0A 2AZ3A 1OJ4A 4ECXA 4MKVA 1NK4A 1T94A 2B5JA 3LWLA 3PFEA 2O66A 1SKSA 2CIMA 4KBIA 5KFNA 1U8SA 1JKHB 2ACYA 1T03A 1AA1B 3J7YI 1WDTA 1NM2A 1E6YA 2AYGA 5DDRC 1IQTA 1F3FA 4N8NA 2OPSB 2XMTA 3D6FB 2AP6A 1LXNA 2P8IA 1TKTB 1CJKB 3H90A 2FB0A 2M4MA 2YWEA 1RHJB 2W2MP 3HF5A 1IJEB 5CXTA 2HQCA 1HBUA 2XMVA 1ZM4A 2I0XA 3AJDA 3FQKA 3MPUB 2C3OA 5M2PA 4RJVA 5HLFB 4O4GA 1CS4B 5JXSA 4OHWA 3N79A 2CPZA 4WCEQ 3EUNA 3NKYA 4PPDA 2E9ZA 3E01A 3TJ9A 3D2WA 3VV2B 4I6AA 1WKJA 4JI4F 2RUGA 3M32B 3M2UA 4BWJA 3ZO7A 2DO4A 1XK8A 4IOBA 3SFUA 3UNGC 5HJYA 3D67A 3M4XA 1WORA 2BANB 2MZQA 4MFBA 2ALYB 2R8IA 2E5HA 1Q78A 1ZAXA 4F3MA 3FRZA 1T9YA 2CQIA 3MFHA 3ZZPA 5KFVA 2Y8WA 2EFVA 3FEYB 5EX3A 1LWEB 4NEYA 2QFIA 3QGIA 4CTAA 2FGCA 1NPPA 5DO2A 3MR6A 4DV2J 3AJ2A 2VQFF 3R1LA 7FD1A 4NLOA 4KYZA 3FNNA 2E5LF 3PNIA 3A8KA 2QSWA 4ZVOB 4IUFA 3NMAA 1UWBA 3MD1A 4LREA 2NYHA 2OPPB 4EUVA 2Z57B 3T19A 3R97A 1N32J 3AT1B 4G1PA 2ZBIA 4DBQA 1M90T 3LGHA 4Q44A 3VVUA 2V2KA 4ZHRA 2B56A 2RHQB 4ZPBA 2NPFA 4M5HA 1SC4B 3CJ2A 3OSPA 1FWKA 1CJTA 2CNOB 2CQ3A 1X4FA 4BBYA 1S9EA 2VFRA 5A8WB 1S0NA 2RDDA 3HP6A 3DRPB 1XBWA 1NKEA 4DHVA 2RRBA 1D1UA 1C0TA 2VBXA 1RI7A 3R9LA 1UWAA 4HLBA 2XWYA 4F26A 4RR5A 1W7WA 3TW0A 2AIRB 4C4WA 5I42A 1KC8T 5KFCA 1XEZA 1KQFB 4ZIVA 2BKOA 2XSJB 2FZCB 1Y11A 2G9OA 4J9VA 1YBUA 1X60A 5D3GA 4CLZA 4PWUA 1XMQJ 1NK8A 4F4WA 1S1VA 1HQUB 2LQ5A 1N5SA 4WXOA 3TQEA 2C2DA 1PO6A 4LQ9A 4AT1B 4DLGA 5EWEA 3MTKA 2PMWA 1HKAA 1B4SA 1B0PA 1U49A 1V9OA 2WB1D 3J7AN 4CZCA 4ZDNA 2DGUA 2RQKA 5HSPA 2FZKB 2FHJA 3OLAA 3S1TA 2I1RA 3NS5A 2HHPA 3NLCA 1Y9OA 4HDHA 3T6BA 2NSBA 2V0NA 3VF0B 5CYQA 4KKOB 1MSWD 2E5GA 3MAAA 4CQ1A 1NHKL 3H2VE 4N47A 2E5JA 2J0SD 2HMIA 2V34A 3KLIB 3HHEA 4RWXA 5F41A 1FRLA 4K0KF 4WWSA 3TUPA 2EPIA 2OUGA 3M2VA 2YWWA 1K44A 3MXHP 3T5KA 4IRKA 2RU3A 1BE4A 2GX8A 2YNIB 4Y2MA 2E7WA 2LQ8A 2VFVA 4JI0J 3LQVA 5L1JA 5LMNF 4N41A 4DCJB 3PRBA 4USHA 1SIWB 3M6WA 4USKA 2HZAA 1RAAB 1Q86T 5K8OA 3W62A 2KM8B 2MSTA 4GVBA 5E0OA 3I55S 3PV8A 4MYTA 1S10A 3U27A 5LXRA 5F8MA 3QJPA 4Y00A 4DI6A 2DRDA 3QSIA 1HWUA 2X1GA 2XO6A 1RWOB 2UZAA 1RBOB 4ZVGA 5KTQA 2QJ3A 4NXNJ 2B4UA 3EGWB 1R8AA 3H20A 3EPIA 5K5MA 3MCOA 1S4FA 2MQNA 2V4RA 1URNA 4CP5A 4DV5J 4IRCA 2WVFA 3MZIA 1LOUA 5B0DA 4M5KA 3PX0A 1R0AB 2RDJA 1N56A 2XCPA 5I3UA 5KFOA 3PXGa 1RWKB 2JHEA 2BJ9A 4U9RA 1TL3B 2BW2A 4O3PA 4DV7F 3TZWA 3QLHB 1H7XA 5L39A 3UCZP 3QPIA 1RP5A 2LKZA 2XZTB 2D9PA 1S9GB 2QL9B 4ZVUB 2SXLA 3GJSB 1CSJA 1WOOA 5A8RA 3HX9A 4ID8A 3ZTSA 3GFYA 3FSYA 3IXQA 4LF4J 3LGMA 2MLYA 3WBZA 1HBMA 4QWCA 2EW9A 4DR3J 4IQXA 2Z4PA 3K5LA 1XMOF 1QE1A 1C1CB 2QLJB 2Y1IA 4TVAB 4AL7A 4BLGA 4LMZA 3DFEA 4Q45A 2J5AA 1OQ3A 3JYTB 2QEXS 2CPDA 2IC3A 1F6TA 4UF4A 1YI2S 2WB4A 2FJEB 2V2QA 3PX4A 1SH0A 2AJ0A 3NG8A 3OD2A 1YZ6A 2GHVC 2XY7A 4J9OA 1H73A 2DISA 3QATA 1YLXA 1R6VA 2CQHA 1QSSA 4C3KA 2FC8A 3MEEB 1HQEB 4URGA 2EG2A 2QLBB 2NZCA 1SC1B 2MLZA 3P8BB 4LFAF 1NNDA 3MEKA 4ES2A 4PYAA 4J9SA 4URQU 2Q6CA 2XO7A 2OP5A 1DTQB 2DJWA 4NOHA 3GIMA 1HNVB 5E5NA 3M9OB 5IWAJ 5L1KA 2V8VA 4JI8F 2X1FA 3SSRA 1PYSB 1HHTP 3C3LA 1ELOA 3B8HA 3CCLS 3U1MA 4ZCLA 1CJVB 3L95X 5I4MA 2LVWA 3QRQA 2DY1A 4PAAA 5HP1A 4Q43A 2CQ2A 1X4BA 5JJBA 2R3VA 2ZJPQ 2Z2YB 2OI2A 3FFIA 2XTJP 1FCAA 1QTNB 3X3UA 2H5JB 5BYRA 2N7YA 4CO1A 3CJKA 1N5QA 2CNLB 2CG8A 2Z2ZA 4F4KA 4CLWA 3EGVA 1UEKA 1N36J 4ZN1A 1FRXA 1RHUB 3HSDA 1IKWA 2OO4A 3FVYA 2IA6A 1RT4A 1FK9A 5L8RC 2DKOB 2RS8A 5J1EB 1FXRA 3C16A 1FRHA 2RNEA 4OMFG 4ZVPB 1U45A 1S1UB 3GQCA 4UY8T 3BM7A 3V6DB 3R8YA 4P2MA 1KNZA 1GMUA 5K8PA 4NASA 4FYXB 4ZPAA 4C0HA 4L3NA 2ZZNA 4JBCA 2KFYA 3KTQA 3MR3A 3PJXA 4B08A 4DMZA 4JI6J 4F7VA 3HVTA 1HNWF 3R2CJ 3B4MA 2W4CA 4IFYA 3ZNUA 2LDIA 1RWUA 2XI2A 3G8QA 2PO4A 5KFUA 3R5CA 3P4UB 3RB4A 3UO0A 4IG3B 2HRTA 3R5AA 4JI7J 1JJCB 3J7YU 3VAMA 2VA2A 2E9RX 3M9NB 2F3JA 2HLUA 2AGPA 1HD0A 2HRYA 3DNCA 1F5AA 4LR8A 4N77A 2Y0BB 1YKWA 5D77A 3NEKA 2VQEF 2F8HA 4F04B 3TVYA 4LF9J 4ENOA 3FSXA 3I9V9 5A2QY 2XLJA 2C3YA 1L3TA 1JLCA 4LF7J 4EI2A 3VAGA 1VQPS 2JEJA 2BE7D 5KT3A 1U1QA 3NXZA 4DEZA 2QN6B 3CVKA 4F4ZA 1XR6A 1VBYA 2R7OA 1FESA 1OPZA 1DTTA 4WKYA 4KV8A 5AXLA 5A76A 2HW3A 5DLFA 1QAJA 3GCXP 1Y7PA 3JB9k 2FHJD 2DR9A 4NMXA 3DCAA 1RKIA 4K4XA 4I7FA 2BE9B 1VQ4S 3OFGA 1HWJA 1BXNA 2GMHA 1QLNA 3P5BP 1Q82T 4OZNA 1O5JA 5HJXA 2XGPA 2UV8A 1SKWA 5HK4A 2RVJA 5KFPA 1HIYA 1J5OA 3PJ9A 1D8YA 2MTLA 2GIQA 2ZEJA 3TRGA 4F67A 2WW4A 3IAM9 5CQGA 2UXDJ 4ZP6A 5KFDA 5K9FA 1WOSA 4ID5A 5EWFA 3CULA 2B8PA 3HLUA 1VC5A 2R7TA 1P6TA 2JJ4D 1RWVB 4LVNP 3CPWR 2VFSA 1HA1A 5A2QU 2PC6A 2FVQA 4QPTA 1N5YB 2PN6A 2HQGA 2HGNA 3D28A 3DLGA 1DFDA 3JQKA 3PEJA 1FXLA 2AD9A 4OYPA 1TKZA 2F9JA 2IRXA 1UJ4A 1WSVA 2ZH5A 2FJVA 3GTYX 1AYEA 3KLEA 4CH7A 4YEAA 3SSSA 1JJ2R 3H25A 3CCRS 3Q2TC 3KJVB 3PVXA 4M94A 3VGSA 1P1TA 1RT7B 4ICLA 4Q5VA 2MZ1A 4EMDA 2UU9J 1VRQC 4KHPJ 1VRTA 3PW0A 3OVBA 6FD1A 3N0VA 5CD4A 4RNFA 2W2OP 4KGXB 3FSIA 5B08A 1QD1A 3ZZOA 3WC2A 2RE1A 1ZTWA 2UUCF 1N4LA 4PYDA 2VPZB 5ETPA 4FNHA 4HI1A 3O5TB 3FKBA 1N32F 2UUBF 1GK8A 4PXDA 5KG5A 1IKVB 2WVBA 2WSFC 5EUHA 1V3ZA 4U6PA 4J9RA 1YWXA 4UOFA 3R6GB 5B0CA 1EP4B 1TL5A 4E8UA 3GR1A 2AGQA 1XJWB 4TY8A 2DIUA 2RDIA 2B51A 2WW8A 3AHPA 3BB5A 3OQ2A 3BBCA 1RWMB 5KFSA 4B3OA 4P2SA 1BUXA 1RJJA 1H6KX 3IBFB 5KFHA 3TEHB 1U48A 1JLAA 2R2SA 2Z8QA 1UW4A 3H4BA 2ZHAA 4X4TA 1HPZA 2HSEB 1PGZA 1U25A 1KOOA 3DRSA 4LF6F 3PHEA 1JLGB 4PQUB 1NSPA 2EK1A 1FX4A 4I69A 2YH0A 4QCLA 4LF2A 5KG6A 1VMBA 2CG4A 9ATCB 5M2UA 1G4CA 1HNXJ 2QC3A 4DPTA 3DOLB 4MK7A 2R4FA 5GAHI 4O3RA 5AT1B 2A6MA 4EYHB 4ECUA 5E3AA 2EEYA 5IQ6A 1R8CA 3OL8A 5CYMA 2VG6B 1FT8A 2G0JA 4S0MA 4P74A 4UOHA 1X0FA 2MKSA 4ELUA 5LMUJ 2L9WA 4B9SA 3N6LA 2AJ1A 1K8AT 1OPIA 5L9XA 4KHMA 2VIHA 4JP8A 2WRMA 1NH7A 2FLNA 1OIAA 5KFMA 2V8PA 5HBMB 4NI2B 3Q24A 1XTZA 2J8AA 3DM2B 3GFHA 2UXCJ 4WTOB 2ASLA 3VZIA 2EBEA 2FHOB 1B0VA 3ZC4A 4ALZA 2C1EB 1FX2A 1ZBTA 1RWNB 3MM5B 4JI3F 1M5VC 3KK1B 1LWXA 2DNOA 2RIJA 4JYAF 3PG9A 4GC7A 1K9MT 2CJQA 1JKHA 2FVRA 3M8YA 4EFAC 3C15B 1RT6B 1VYAA 4ED8A 5IV4A 4FVCA 2OPSA 3CNQP 4FVMA 5KG7A 4PZVA 1TKTA 1CJKA 4B3SF 3OSNA 2D3UA 2RUSA 2I9SA 1MROB 1UPMB 3V6KA 1WTFA 3WDOA 1XNQF 1T0TV 1NB2A 4AXIA 1DURA 4NA3A 5HLFA 1CS4A 1NSKL 2DT9A 2ATCB 4OYIA 3CD5A 2HPUA 4DS4A 2DGOA 4DFPA 1S59A 2XMKA 3M32A 3J7Z5 1RHKB 4OLOA 2XS7A 1HW8A 3ISND 4AUKA 3MECB 3ZTRA 2BANA 1IBLJ 2QA4G 2VU5A 3H2UB 4MKYA 4WIQA 3PHTA 3QO9B 1I6JA 4H4KC 1UZDA 1VQKS 1UETA 4F0MA 4C8MA 3KHRA 3BV8A 1B70B 3BGOP 1LWEA 2PFFB 4GO5X 4IDKB 2D7SA 3QGPA 2Q79A 3G6VA 4C8ZA 4DV5F 1X8DA 2BW7A 1GNKA 2LCWA 5CABA 4DX6A 1WI8A 2UXBF 3LOUA 4NLGA 1IQZA 1IBCB 4OYAA 3N9UC 2B4PA 3ENQA 3M6XA 4A46A 2LA4A 2FHMA 2OPPA 2HK3A 3H59A 3IFEA 2MY7A 3UR0A 2GIRA 3KG1A 1SJ1A 2HS0A 2DD8S 2VFUA 3EZ5A 3KHHA 1GX5A 4HT7A 4PWWA 4ETXA 1A9NB 4J7CA 3QT6A 2YX4A 1NPKA 4JUZA 2BRLA 2B9XA 2YWHA 1KWMA 5AXKA 3I82A 2RF2B 3FC9A 3UE2A 1H74A 3BO3A 5A8WA 3ZFVA 4AE5A 4HVZA 1NK6A 3M2RB 2R2TA 3DRPA 1TMJA 2ZWPA 1K0TA 3EGZA 2L9DA 3OTOF 5ADZA 3S8SA 4X4VA 3WHIA 4OX8A 2K1RA 1EHWA 4FXVA 4QWEA 2BVZA 4ELVA 3VTIA 3NNAA 2MLXA 2XQCA 2B9WA 4ES3A 5LL6d 2G4BA 1WF0A 4EU0A 1HNZJ 3TANA 2XBPA 4ZK7M 2VODA 2W8LA 2VPWB 3EDRB 3VAJA 1FWLA 4DN9A 2XSJA 1VQLS 3MMJA 2G2YA 2IYIA 2LU1A 3NNCA 4X4NA 2DPJA 1U2FA 1HQUA 4W90B 2DYAA 4C2MA 1N88A 3TA2A 2BOPA 3OUYB 1XR7A 3CDBA 4K2JA 1OYDA 2JWNA 2DRBA 3M8ZA 3KK3B 2Q6BA 3TEGA 1PAUB 3QT7A 2J8SA 2RILA 1OY6A 2IJRA 3OW2R 4KTQA 1FKOB 2HQDA 5SZTA 1N36F 4FNIA 2BM1A 4ZP9A 3U7JA 2R8KA 3IS9B 1S99A 1SL1A 3LP2B 1UVMA 4BDPA 4ZCMA 4J5OA 2I5JA 4KKOA 3BH7B 4UZBA 1EQMA 3A8JA 3N28A 1H72C 1VQ7S 4G3IA 1IR2A 2H65B 1YJ9S 1RAFB 1WEZA 3C19A 4XPEA 3KLIA 2KXHA 4NZ6A 2BKPA 1HMVB 3HI9A 5B09A 4Y2CA 1M0SA 3BREA 1WHXA 3EWGA 3TUIC 4ZVRB 5C5JA 2YNIA 2VHGA 4QJVA 4WFYA 4JI6F 1CG2A 1GXTA 3AA8A 1FJEB 2HNYB 1T05B 2H4YB 2ILYA 3NGRA 3DLEB 5J2NB 2JEIA 1FJ7A 2B4OA 3POTB 2VDHA 2CNNB 3FZ2A 1RA6A 2DGSA 3Q8RB 4IYQA 3NGTA 4DR6J 4LFBF 1EIYB 2OTJS 4F0HA 2E9TA 2BQRA 3FRYA 1A6LA 3JTOA 4FBTA 2YVSA 2YKQA 3CJSA 3HHLD 5KFZA 2EVZA 1RE1B 1GEHA 3CCVS 3BEGB 2BMBA 3OTCA 1Q1KA 3UWTA 2UUAF 4ANDA 2HFNA 4HYKA 4M1KA 2R7XA 4LF7F 1QVFR 2RT3A 2PEHA 2YBVA 1LNQA 3QQCD 4QR2A 1RLDA 1U6FA 1OQ6A 3PW5A 1U2CA 5DS7A 2JEGA 4E0DA 4M5MA 3MAQA 2AYMA 4DUYJ 1R0AA 1CC8A 5A0YB 3HJFA 4OZJA 3WX4A 5KFRA 1TL3A 2HFOA 3FCWA 3QLHA 5JVHQ 2Y1JA 3BGUA 4KH1B 4PABA 1S9GA 4DSIA 1SIZA 4DCOB 3CIZA 1NJIT 1YJTA 3TOQA 4AFFA 1GQEA 4DV0F 4WU2A 2UXDF 4MIWA 4DQSA 4ZPTR 4M5NA 3PCOB 4P52A 1C1CA 1Y0HA 3EVOA 3TX8A 4WFZA 2RU9A 4DZ6A 2BEFA 1U1NA 4DV1J 3JYTA 2AU0A 1C2PA 3KMQA 2PMZD 2Y8YA 2KI2A 4Z37A 2V69A 3CIMA 4F4YA 2AYEA 2FVPA 2YH1A 3MEEA 4X62J 1HQEA 5L46A 3DGPB 4DX7A 1YJUA 2Z58B 2F40A 1NKCA 2XULA 3IO1A 5IM0B 3OR1A 2XYPB 3TO8A 1D9DA 3RRHA 2VUGA 3ILLA 5IV3A 3HD1A 3UCUP 1HNVA 1QUVA 2EK6A 2JC0A 3O1LA 2VPXB 3W66A 3KLFB 2MQ8A 1CJVA 1Q8KA 4DV6F 5AJ3J 2MQMA 2ZBCA 4F8RA 2F65A 2LEBA 3RBXA 3SCKE 3MM8B 3SV4A 1RA7A 2PGCA 1RYSA 2J6SA 3KDNA 2ROEA 2Q43A 1NBEB 2O01C 3W1YC 2JVOA 2IM1A 4ZVFA 1S0OA 1PJ7A 3MM7B 2VOPA 1PG5B 4OYOA 2YY3A 3CXCR 4UUXA 1DRZA 3OBIA 3Q2SC 4ATNA 3HXMA 1WDDA 4YB7A 3CCES 2HFVA 3CCMS 2B8QA 2FJAB 2UVWA 1HI8A 1KHVA 2DGTA 5KT6A 5EDWA 3HM9A 1R43A 5J1EA 5GAHU 2VBWA 3D1HA 1C4CA 5D0EA 1S1UA 4B3TF 2DCUB 3T5HA 4CO2A 1KFSA 1D9FA 5KFEA 3V6DA 1TAQA 2KT5A 2VPYB 4U7CA 1LW0B 3GP9A 2P6TA 2R7QA 4HHHA 4Z2XA 4IH7A 2ERRA 4RNHA 1ZS6A 2XHCA 3MMBB 4RBTA 1MU2A 1Q8IA 4TNOA 3KWMA 1VQNS 5ITHA 4GKKF 3NCPA 3EE3A 4OV6A 3HKZD 4IOAQ 3MWBA 4NLQA 1CULB 4IG3A 4H4MB 4DG1B 2CJAA 4E2FB 4X4QA 5HQMA 1FKPB 2EC2A 4DQIA 2H5EA 2XMAA 2ZOMA 1T9VA 1EB0A 2MPUA 3SFGA 1I3OB 1TKDA 1B0TA 4PWDB 2YKPA 3RYLA 5LMUF 4P73A 4Y34A 3MDFA 4LVOP 3ITHB 3P5TL 4AL5A 1QM9A 2HNZB 1R3NA 2ZBQA 3KKFA 5CCLA 3HSJA 4DL6A 1RADB 1KR4A 1UEUA 4XPCA 3D6HB 1UA1A 2V8DA 4Q7AA 3IR6B 4O3OA 4DN0A 3RB0A 3CCQS 3UI3A 3QJLA 4LUBA 1WJ9A 4HEA9 2OMOA 3UCGA 1XNRF 1UMJA 1KHWA 4MK8A 4J9UE 2V94A 1XR5A 1YBAA 2H1YA 1PJ5A 4YHHJ 3F0NA 2VG7B 2C2MB 3JSBA 4JV2A 2MDAA 3OR2B 2C42A 2P2CB 3ONQA 2Z30B 4ED3A 2YX7A 1S5ZA 2VDIA 3I96A 5U47A 2J6UA 3TX0A 2IAJB 4DV3F 2DHHA 3HVWA 3H8YA 1NO8A 1RABB 1R0CB 4ZPWR 3OT9A 2VJUA 4ILLA 2CJKA 4H54A 5K20B 1RXOB 3AOCA 3EDQB 5IXUA 2VBZA 1Y10A 3KLGB 3IM9A 3UDEA 1RISA 1IBLF 2HGLA 1X5SA 3BSAA 3QGGA 5H9EK 1KQSR 3GE9A 4E98A 1VQ9S 5HVHA 1S76D 2NS1B 3EX7B 3KJVA 1E6VB 1UFLA 4KC5A 1RT7A 1OWXA 1O0PA 2LU2A 2D74B 1FRKA 2ZDPA 2HQIA 2QIFA 2YKAA 4JI4J 1S12A 1VC6A 3HD2A 3BYRA 5KFIA 1U0SA 3ZZ0A 5F8JA 3BR8A 2M8HA 1IJFB 4NLSA 3K58A 2HQ3A 1U1LA 2V68A 5F8HA 1H2TZ 4F02A 5KOWA 3I5BA 2A0FB 5LSRA 3CJ8A 3W3SA 1IKVA 1YTYA 5DDOC 2VQFJ 1S7HA 5IC6B 2AZ1A 3G87A 1TVRB 1EP4A 4DV4F 3ZNJ1 4GMKA 1FFGB 3T5JA 3MR5A 1VQ6S 2VICA 2HBYB 3MMCB 3FQLA 4QW9A 3Q86A 3DRYA 1IUJA 4TXSA 2GO8A 3T1YF 1M1KT 4OZ0A 1W26A 4YUDA 2YXLA 4C8OA 1C1BB 2IFXA 4DPWA 1ZAWA 2I38A 3CJ4A 3D66A 4ZP8A 1JLGA 2EFGA 3A1YG 4PQUA 3QAUA 2ZKUA 1WUUA 4USUA 2IY5B 3QGHA 5HVFA 5JMNA 4W92B 2ZNZA 3JSRA 4ES1A 2CQPA 4DL5A 3DOLA 2E1CA 1KS2A 4OZ2A 1RU2A 3IG1B 3IR5B 4C48A 4LRAA 3I0RB 2NXCA 4WFNQ 3FBEA 4ZP7A 4WP8A 2HKEA 2KJVA 2YTCA 2P9CA 1P1LA 3BKTA 5ETVA 3G9CA 1LXJA 1RBAA 1EKSA 2B6AB 4A8MP 2ASDA 3NWRA 4NI2A 3NAHA 2QG9B 1IBMJ 3DM2A 1VDHA 2C28A 3A3NB 2W8KA 1N5TA 3RJMB 3MM5A 1S7IA 3KK1A 2IA0A 4HH0A 2CQ4A 1N5VA 2KB2A 1TK0A 3UNYA 3C15A 1YG0A 1RT6A 1UPPA 4RO0A 2FTRA 3DHXA 2MGZB 2AV5A 3C66A 3T6JA 1UJ6A 5DQGA 4DUZF 1OYEA 2BJ8A 4MIAA 3D68A 5SUHA 1MROA 1WF2A 4WJBA 2L41A 1EQ0A 3K57A 4M95A 1CJUB 4K4UA 2ZZMA 3VAHA 4DR6F 3Q8YA 1XWLA 2CA9A 3NRBA 1U8WA 4K0KJ 1KVJA 5DZ7A 4NPOA 3MECA 3GU0A 1J2VA 3QO9A 4HL9A 3L4BC 4TLRA 3UN2A 2DVIA 2QTWA 4KPYA 3R2DJ 3D9BA 5LMNJ 3VVTA 1S9FA 1RCXB 4L6V3 4PRFA 1X9SA 3UDVA 3ZZUA 1FTCA 4RKUC 4IDKA 2AEJA 5KT5A 1T9XA 3GJQB 1HYSB 4I1TA 3MM6B 4DR2F 4DR4F 2XI3A 3N5FA 3IA0A 3ILOA 4DUYF 4TLQA 4RNNA 5G0RB 5HMXA 4ZIWA 4OX7A 1S1XB 2RKIB 4X65J 2XNRA 2YWFA 2GQ2A 2GHPA 3QMQA 3BKUA 4QU7A 3QWPA 3ULHA 8RUCA 1H3DA 3CDWA 3RRGA 2AX1A 2XMWA 2GGPB 3PX6A 4OYZA 1YX2A 1UFWA 3H4DA 4NXMF 2RF2A 1FE4A 2V4JB 4DV1F 2DNLA 2B4VA 2WAQD 3AOAA 2OEJA 3I9ZA 3M2RA 3LPEA 4DV7J 2R7UA 2MJNA 3I0SB 1HNIB 1NH8A 1F2HA 1HI1A 4RNMA 3W7BA 5FJ4A 4CLYA 2CPEA 5DG8A 1XQIA 2P9EA 1U1MA 2BQUA 4R25A 2DPIA 5KG3A 2H54B 3CO9A 3SMZA 4RW6B 3ILIA 1RUSA 3K5NA 3MURP 1YBTA 4JI5F 1Q7YT 2KXFA 5AJ3F 2COLA 3GR0A 4NLXA 1VLYA 3V6HA 1O51A 2HK2A 2MZJA 1YSJA 3DRXA 2HFSA 1VC0A 3OUYA 1HBNB 4BWMA 1RWPB 2AMCB 3KK3A 3BR9A 1IR1A 1T9WA 4KGMA 3TAMB 4UT4A 1FKOA 3FUYA 1GTHA 5E33A 4JI8J 2R8GA 2HHVA 1IM6A 3LP2A 5CA5A 1RTHB 4J9QA 3SBMA 2C2KB 1GH8A 4NLRA 4JV5F 2ZH1A 2K2PA 1UEVA 3G82B 3DRRB 1DQ9A 4O3QA 1VK3A 3I4PA 5HATA 3P49B 2WONB 4FDFA 4L74A 1YJWS 2GQCA 5IT9Y 1XERA 1HMVA 4BCAA 3G6YA 4IOCQ 1T95A 4P10A 4LSZB 5BJRA 7AT1B 4RUHA 4C0OC 1Y3KA 4O3NA 1W25A 2HNYA 4RUAA 4N7TA 1VS3A 1JLFB 3LAMA 2M3DA 3DLEA 5J2NA 3H0PA 4KRWA 2GHWA 3CCZA 2HFZA 3POTA 4K8RA 3C6TB 4P9SA 2ZD1B 4GC6A 2K7KA 1Q95G 2BXJA 1F3VA 3BS9A 3SIPB 1JNRB 1NK7A 2JFDA 3CC2S 3JTNA 1TAUA 1FFSB 2Y1LB 1S4EA 4ZPCA 3CJRA 5J2MB 2P6SA 4WYWA 4FYVB 3NGUA 4CM0A 3WZ0A 1Q0NA 3RAMA 1W2BR 2R8HA 1BWVA 2AQ4A 5F0WA 2BJDA 2Z2LA 1RZMA 4R0JA 1WC6A 1F9FA 4ZVQB 5IT9U 2L48A 1U6ZA 5E3QA 5A0YA 2VQEJ 3W8GA 2BJ3A 4JB8B 2GO9A 3VGUA 1QAXA 2GC8A 1C0UB 4QWAA 1KVKA 4YHHF 1N6QB 2JL9A 4O3SA 4YMEA 3VQSA 5CD4H 2HHXA 4Y28C 3CDUA 3FDSA 4OHVA 2EC0A 1SQFA 1BQNB 2IRYA 4RW7B 2XY6A 3KNGA 2QFJA 1VQ5S 2POKA 4MAKA 1LW2B 2MKJA 5EN1A 1SKRA 1YJNS 1ROFA 1RAHB 1UL3A 4ECWA 2PSZA 4KFBA 1I94F 4FF2A 4P7TA 4O23A 1KN6A 2ZH6A 2EFNA 4CT8A 1GFWB 1WELA 3DGPA 3G4SS 5CZXA 4NWBA 1LV5A 2JZ5A 1XMBA 5IM0A 3L09A 1P8GA 4KGVB 1R8PA 2VB6A 2ZC3A 2NQPA 3DMJB 5B0GA 1UZHA 2HVHA 2Y0SD 1VISA 3A13A 3AJ1A 2RB7A 3W9JA 3ZTQA 3GFZA 5AXNA 2WBMA 3KLFA 3UD4P 3ZZZA 2XWXA 3MEGB 2F7VA 4HHUA 2FDNA 1OSCA 1RAJA 2VZ9A 3MM8A 3GYGA 1RQ0A 4B9NA 3CWJA 3HT0A 4A8QA 4WP9A 1HHQA 3GG1A 1G1XA 3MM7A 2OELA 4ELTA 2HZCA 1Z2LA 4DS5A 2WK4A 5DM7Q 3GZ7A 4Z7YA 4ECZA 1NZAA 5KG4A 2AJFE 2AX0A 3EYZA 3GJRB 2QLXA 2JDJA 4TQRA 3MPDA 4DR5F 1H0HB 2OPRA 1V3SA 1WHVA 4H4KA 2NPIA 4F4AA 2UUCJ 4C0BA 1LW0A 4IKAA 3E3XA 1U09A 3PRDA 2UUBJ 2I8EA 4O0NA 3MMBA 2NR0A 1REVB 4B9UA 1SXLA 4UTGA 2CAJA 3B82A 2Z0GA 1BGXT 1WC4A 1UTAA 3EVMA 4LF1A 4QW8A 3K59A 3LWMA 2B3TB 3SZ2A 2DH9A 3PRVA 3W5XA 1FNOA 1CULA 4PG4A 4ZMMA 4H4MA 1RCOB 1A7GE 1TV6B 2X3GA 4DG1A 4DSJA 1FKPA 4YS2A 3W9IA 2DK2A 2QA1A 4LJMA 2HVEA 2AGOA 4I4BA 1Y5LB 4NX9A 2ZVIA 3BGFA 4LF6J 4PWDA 3K7RA 3BBFA 4USMA 3BDEA 1FTRA 3PY8A 3TJ8A 1Q5VA 2YNHB 2MSSA 3T9ZA 3UDCA 3ITHA 3K8WA 3JXOA 4M5JA 4WXWA 1RWWB 3OTDA 2HNZA 4UQGA 1RT3B 4DR7F 1FXDA 1M5OC 1T9TA 1IBMF 1WG4A 5ETMA 1JXEA 4DL2A 2KT2A 2BE2B 2DCLA 2VKRA 4O44B 1QTMA 4IQMA 3OJSA 3MOZA 2ZHBA 3KLHB 1L5UA 2F5GA 2DXFA 3ETMA 2XG8A 4CO4A 3LF0A 1SKUB 3T41A 3HHNB 3TI0A 4FP9A 4LRFA 4DDFA 5C24B 2CZVC 1AXQA 2JLFA 4DL7A 5DRKA 2VG7A 3AD8C 3GMGA 5D15A 3F73A 4RL1A 1TELA 1EETB 2IAJA 1RBLA 2DNNA 5ETQA 4JI3J 1FKAF 3HSGA 3HT3A 2D9OA 4USWA 1X0PA 3SQGB 3UD3P 4JYAJ 2L3MA 3R7SB 2B7BB 3PR4A 3M05A 4ZITA 3TP2A 2CWKA 3KLGA 2GAGC 1RGVA 1Y5IB 2J7KA 5BYQA 2YQ3A 3BH6B 4X4UA 2CPHA 1A0OB 2ZH9A 5DM6Q 3GPAA 4B3SJ 2KT3A 1QSLA 3FCVA 4J90A 2KZMA 3GFXA 1XNQJ 2PFDA 3LALA 1BD6A 3CCWA 1E6VA 1HWLA 1SQGA 1U26A 2W2NP 1MMDA 4BS2A 2NXUA 1NJXA 2QGFB 1BQMB 1Y00A 1YK9A 1FVQA 3HVRA 1TZ0A 2PA8D 2F8MA 2E7XA 4ANEA 5KT4A 2WTFA 2J0XA 4LSNB 2UVUA 4X65F 1WF1A 4KH0B 3CMQA 2YNGA 5IT4A 4YDDB 3L9ZA 2N7CA 4CDIA 2N4DA 2RQMA 3HHLC 3HFKA 2FJDB 2HVDA 5ETSA 3AXKA 4FS1A 1NDKA 2C3MA 2GJIA 3W61A 1TVRA 1WC0A 3KJNB 4J37A 4EZ6A 1AT1B 1GXLA 1MWYA 3U1NA 1VRUB 2UXBJ 4YDXA 3D1OA 4GKJF 3QZ8A 2CPYA 2DHGA 2KFZA 2RRNA 4OJ3A 2W9CB 3H40A 3UVJB 3MMCA 2RS2A 3N4WA 3KUEA 5A8KB 2IC3B 4ZLPA 2ZBRA 3HZGA 3IRWP 3DOMB 3N6MA 3HCXA 3G8SA 4OFZA 3TYTA 1RU1A 1C1BA 4FPRA 4JI1F 4PXCA 2QZ8A 2XGQA 2DITA 2O67A 4L73A 1R6YA 4USJC 5AXMA 1UA0A 4QIVA 4DXLA 4PPZA 1ZA2B 4M5IA 2FC9A 2DGXA 4XK8C 4NMLA 4X64F 4ZLNA 2DXEA 2ZH2A 5GMDA 3OTOJ 1GX6A 1BY9A 2CUYA 3I87A 3IG1A 4I0WA 3FZBA 1SH2A 3AY0A 1F9EB 1KTVA 3I0RA 3R6LB 3K0JA 4LRBA 5K14B 2DR7A 4P2FA 2J0QD 3BGRB 2CPFA 4IR9A 2H3EB 2AW0A 4M8LA 1U1RA 2R42A 2JLGA 4DSLA 1B99A 2B6AA 3HK2A 5H1SV 1X31C 3TQ1A 3CJ3A 2HRUA 2VBYA 4WE1B 4N76A 1JK9B 3CB4A 1OY9A 1VOMA 2W2PP 5IFMA 3D7SB 4KPCA 3NAIA 1NSQA 4F4XA 2KRRA 4MK9A 1WC1A 1JQGA 4WF9Q 4Y3CA 4KHRA 2CZ9A 1D8ZA 4JI2F 1PIEA 4NYPA 2MGZA 2EFQA 4OLPA 3MFIA 3FBCA 3H5YA 1WNEA 4FXDA 4CI0B 2VL1A 3AFGA 3NGKA 1JB0C 4H4OB 1M1HA 5MAOA 3OTEA 4TU9A 2X1AA 3P96A 1CJUA 1TR0A 2DH7A 4M5DB 3HSZA 4QPXA 4EEYA 4IFYB 4NLUA 4Y2IA 4WZQA 4V19X 4ZCIA 2ZE2B 4N5SA 1N54B 1RAEB 2CYYA 3NCQA 1Q79A 2A6OA 4ZN3A 1YZ7A 5D4NA 2QMXA 3E51A 2FY8A 2KXNB 4EO8A 3LP1B 3MM9B 2DNMA 2FUG9 3IMQJ 4P6QA 4DCPB 3H98A 5B0AA 3EZOA 5KFXA 3G71S 2MB0B 4GRSA 1URRA 1AZSB 2G0IA 3L3CA 3M8QB 2CQBA 3K5OA 1U0HB 2EXUA 4OI6A 4LFBJ 1HYSA 4WFXA 3D5MA 3MM6A 3PYFA 4U7UK 4J9MA 2XC9A 1CQMA 1XIQA 2FVSA 2PI4A 2RQ4A 1C4AA 2DNYA 5G0RA 2H4WB 1PCAA 2WHOA 4M5GA 3FMBA 2UUAJ 2RKIA 3DC2A 4X66F 3DDKA 4OJGA 2CJYB 5BR8F 3GSDA 3I4HX 4HT5A 4CCHA 1BLUA 2UV8G 5C7PA 2KL8A 2OSQA 2VKZG 2GGPA 2MEWA 4Y65A 2R2RA 2GVDB 4I6YA 1H98A 3T3FA 2FLOA 2V4JA 1NMEB 4HACB 4B3RF 4F2RA 1P9QC 4C98A 1AUSL 4AD6A 4V19J 2CQ1A 1CEZA 4LIWA 4C11B 1VHFA 1DAXA 4RNOA 4LSLB 3GWCA 4IH5A 3HHKA 4CLUA 3I0SA 1RSCA 2Y3YA 1HNIA 5EWGA 3BDPA 1ZH5A 3X1LB 4G1QB 4DV0J 3RG6A 2LA6A 1MWQA 1I51B 1RLCL 4WIIA 5KG1A 1KLMB 2GJ2A 1RTZA 4RU9A 4YP3A 2DO0A 4RW6A 4Q8EA 2B7CB 2MZSA 2KZZA 3B54A 5CCMA 1NB7A 5DZ6A 1IM4A 2G1DA 1UW9A 1S6UA 4MT1A 4ER8A 1AB8A 1N33F 2LQBA 1MW7A 3BGLA 5C25B 5G4DA 1TUWA 5DDQC 3S7RA 1N34F 1X4AA 1HBNA 1NRKA 4P72A 1WWHA 4L3KA 3ZTOA 2WVDA 1RTIB 3WQPA 2ZZTA 3TAMA 4I64A 1R8HA 2GCFA 3RTVA 3IWLA 3ISZA 2PI5A 3DLLQ 3TAPA 1UP1A 2KVQE 2FGOA 2IJFA 3G86A 3V81B 5GVQA 1RTHA 4DV6J 2OPQA 3UN5A 1TFYA 4LIRA 1NHVA 3BSCA 2XEXA 1S57A 2F4VF 3G82A 3DRRA 1YQHA 3LGNA 1Q8BA 3EXCX 1SV5B 3HKWA 3MHYA 2VOOA 3PYDA 4CM2A 2W01A 4TY8B 3VGVA 1LWFB 2UVVA 3D6MB 2WONA 3PM9A 1OY8A 1UCNA 3K17A 3TZZA 3LTOA 2D41A 1MLAA 5I3PA 3IWXA 4AL6A 1BQXA 1FD2A 2KHDA 1U47A 2V8HA 2XNQA 2MYFA 3V4MA 5IC4B 1FDDA 3M30B 3MMAB 5DGBA 3PJWA 5DJBA 3R3TA 1JLFA 3D0HE 1HWKA 4B3TJ 1ZOTA 1WG5A 3C6TA 1QJHA 3HFVA 2EKNA 3A12A 3UW1A 3RRKA 2ZD1A 2GVZB 4CO5A 1Y3JA 3HDSA 3HHLB 1M5PC 3V2UC 1T11A 4IFVB 3QYYA 5AE2A 1WC5A 1FERA 5D78A 5J2MA 4ZKAA 4P2XA 3AXMA 4KAIA 1B3TA 2CJXB 2GJFA 3ADAC 2BABA 4GKKJ 1FWPA 3RBEA 1FI4A 3I32A 4OIXA 2NCKL 5D6GA 5GADI 4DFJA 3F44A 3M6VA 4C8NA 2IM3A 4RUCA 2R7VA 3KUGA 2HAFA 4R0EA 5DG7A 4KQZA 2Z56B 4A8XA 4OZ5A 1V3RA 1QAIA 3BKFA 4OJ1A 2VH7A 3DXBA 3UR3C 3W63A 2HS3A 4OQJA 3J7A1 3T1AA 2QT7A 4MKBA 1WI6A 3I5CA 5L1IA 2IBKA 2FPHX 3UQSA 1V5VA 1KONA 3HMJG 5L1LA 4I67A 1R8BA 2YPZA 5H9FJ 3CCSS 3W9HA 4AXJA 1IKYB 1C0UA 2V50A 1NJYA 1N6QA 3I56S 3TARA 5B7WA 1B7FA 2VG5B 3HJVA 1G7CB 1SC6A 2KVIA 3JSMB 4B17A 3CUNA 4OI2A 1BQNA 4RW7A 2CXEA 5J1PA 3M8RA 1LW2A 3BPDA 1BMQB 1X5OA 2U1AA 3O8WA 2FHKA 4OI1A 3TZYA 1XNRJ 1S97A 4CLSA 3F41A 1RTDB 4C8KA 2OKQA 3KOAA 3KDOA 2I2YA 4NEZA 2DHXA 2W7AA 2ADBA 3K5PA 3BJYA 2WOMB 3OL6A 2OD6A 4ED4A 3D0IE 4DV3J 2CRLA 5HI7A 5AE1A 1LK7A 1ULRA 3DMJA 4OZ3A 4WFAQ 1U4BA 5HVGA 3LO3A 4O0IA 4X84A 4R8UB 3TVKA 1NZ8A 2D1CA 3MEGA 3QAEA 1I1GA 4ILMA 2RQCA 2E7VA 1FVSA 2DR8A 3PACA 2Y9HA 1Q16B 2CPXA 4F2SA 3AQPA 3W8PA 2CQCA 1REGX 2OFGX 4ZOSA 2W9AA 3KLVA 4Q2MA 2HBZB 2LDYA 2KU7A 3CD7A 5FLXY 4LF5F 5RUBA 4L76A 3CCUS 3DXSX 2IRUA 1MNEA 4QWBA 3SYZA 1WHYA 3AD9C 5KT2A 2HHSA 1SQEA 4PG7A 2HZVA 4KY3A 4Q0BB 5CYJA 1Q81T 2IM0A 1FNMA 2IMWP 3AA9A 5KFGA 3A8EA 3VAIA 2V63A 4ZLLA 2RHSB 2F9DA 3QT8A 2VC1A 4HKQA 1QY7A 3OVSA 2CDQA 4PR6A 4BC9A 3SCJE 2MY8A 3J81j 3NNHA 3RBDA 1NU4A 3QWUA 1REVA 3W2VB 1VI7A 1U6BA 3MTJA 4OJHA 2JVRA 3RR7A 3IGNA 4XDCA 4NCAA 2HS4A 4ITSA 4DL0C 3BZQA 4C3LA 3G8TA 3PIPQ 1K47A 2QX0A 2K1RB 1TUGB 4DV4J 4Y2AA 4UOGA 1NK5A 1X4DA 4CIOA 2VJVA 1X4EA 2C2OB 3NY0A 3Q8SB 2QA2A 1S0VA 3PKYA 4A47A 2GIFA 2HHHF 4OX9F 4LF8J 1RT1B 1TV6A 4UOCA 3QRRA 3DOKB 2F1FA 4YR2A 1APSA 3T1YJ 4B02A 5E3PA 4XIUA 1S77D 1KLNA 4J9KA 3J7ZT 4ZVSB 4U96A 1KVIA 2AJQA 3M8SA 3JTPA 4K5RA 3THVA 5FLXU 2DTJA 4RLEA 1Q53A 1Y5NB 3ZZRA 2PDAA 2YNHA 1FRMA 2C2NA 4WZMA 1RAIB 4X4SA 5L9NA 4IR1A 2DBBA 1NJWA 1ZETA 1RT3A 4GVLA 4B9MA 1PC4A 2IDEA 2XZWA 4ECTA 4D3GA 1GAOA 2BE2A 3V5RA 2EFOA 2Y1RI 3FCHA 4O44A 3MCMA 1N48A 4IG0B 2DHSA 4DFMA 2I5JB 3KLHA 2R9LA 4W98A 2PT0A 2D69A 1X5TA 5DQIA 4B3MF 2MQPA 2DR5A 5C24A 3NP5A 2FD2A 2BOAA 1JX4A 1G6BA 4HTIA 5THWA 3GV8B 2JRSA 4PCQA 1SJ3P 3PFOA 3CW2C 1FHTA 1EETA 1CPZA 4XO0A 2YWGA 3GYNA 4MKAA 4DLEA 3SQGA 1BHNA 1IKXB 1ZPWX 2BM0A 3LA0A 1TP7A 4RW9B 3MPWA 4NLWA 2BYCA 4P71A 2H51B 3RU0A 5ETOA 1D9AA 3B78A 4I2PB 1WG1A 4F0KA 2IVMA 3GONA 3DN9A 3VHQA 2CADA 3V4IB 1FA0A 2D3O1 4L75A 3I6PA 4DUZJ 4CNYA 5C42B 1W2IA 4BHQA 2KYXA 5ETRA 2PIIA 1TU0B 4IH6A 4ED1A 3UN3A 1VFJA 1CQNA 4ERDA 2QL7B 2X1BA 3CC7S 1BQMA 3K8VA 3M8WA 3H5XA 4NYOA 2LQJA 2M88A 2QA4S 4ECVA 1ZM9A 2V9KA 1GTEA 1Q4RA 1VIOA 1SC3B 3K2YA 2ZH8A 4RX6A 2ALZA 3Q89A 4WPAA 4I56A 4J9PA 4QR1A 4LSNA 1DHMA 4X4OA 3AODA 5D0HA 3EICA 2FYXA 3PIOQ 2Z2MA 2YQ0A 1IVZA 4CH1A 4HH1A 1YVFA 2ASYA 5KT7A 2H48B 2P5VA 1VCTA 2CQGA 1U1PA 1AROP 4ZJQA 2DNHA 1JXLA 2FJWA 1UAWA 1UVLA 2DGQA 4DR2J 4F36A 4DR4J 2RSQA 2LEAA 2V67A 3OXGA 5JUMA 3E8OA 2BZ2A 2AT1B 3DDIA 4C97A 1VRUA 3M7VA 2XB2D 2G13A 4UY85 5IOLA 2W9CA 4K4YA 1R31A 1IBKF 2XHWA 3O2IA 1FJGJ 3UVJA 2VFTA 2FIUA 2VF3A 5J1NA 5A8KA 1U02A 4DZDA 3PDNA 1KFDA 2V6AA 3DOMA 2MKYA 3PW7A 4ECQA 4F50A 1HARA 2NZ4A 2HNDB 3ENAA 2MKCA 2C2EA 4NXMJ 1RT5B 4CWBA 3FGVA 2N82B 4URSA 1LWCB 4OL8A 4OI3A 4QOTA 1G2EA 3OR1B 1T9UA 4WBFA 1SJRA 2WVCA 3UPFA 2EBGA 3GIRA 4U7UD 4K4VA 1KP6A 1R89A 4U8VA 2JEFA 4DPOA 2XCAA 4RW8B 2AJ4A 4CLKA 2CPJA 4YB5A 4X4RA 4ZJOA 2ADCA 5K14A 1WD6A 3BGRA 1DTQA 2RJZA 1UJ5A 4NRTA 2YKNB 3HPOA 2MQOA 2W7OA 2C3PA 3SV3A 1WKKA 4NL5A 2NXJA 1FFWB 1F1BB 4JI5J 1OS5A 3JQMA 3JQJA 3WIVA 1CLFA 3MR7A 4OV1A 2DNGA 1RT2B 4WE1A 1N0UA 3IAS9 3G96A 4IO9Q 1DY3A 5LM7E 4A8WA 1AFIA 3W64A 2GW8A 1FNXH 5HANA 4GO7X 3GYXB 4EK2A 3MEDB 4NCGB 2W1BA 2BRKA 3P3DA 4YY3F 5GADU 3MOJB 5E2QA 1FEEA 4FF3A 3GJTB 4JV0A 2BACA 2CQ0A 4FKYA 4QBUA 1RACB 1T7PA 4H4OA 3CSKA 1WEXA 4MTPA 1MU2B 1HR0F 5DGAA 1S6QB 4ZA1A 4JV5J 4NE9C 1YJVA 4DR1J 2ZVSA 4FKXA 4M5DA 4UQTA 3HZEA 4B9VA 3D1QA 2ZE2A 2RMLA 3Q8VA 1RKJA 1WHWA 1TTHB 4ECRA 4PXBA 2DXDA 1TQLA 1TL7B 3C8YA 4NLPA 2A18A 1YHQS 2JX2A 2HBRB 3LP1A 3MM9A 1JWWA 2HIQA 3D3BJ 3NWGA 2HHWA 3BO4A 3JAMY 1AZSA 3H42A 1DLOB 3M8QA 2Q1LA 3ILJA 2PA3A 3W60A 1U0HA 2HURA 1SJQA 4QIGA 1ZM3A 1TFWA 1HWIA 3TUZC 1FRIA 3OHAA 2NXNA 1EARA 4RW4B 4X2BA 4IO1A 1OO0B 3H5UA 2MHNA 5EHHA 2BQ3A 2EWHA 2WCXA 4FF1A 3ICLA 1S79A 5D4OA 4XAKA 2M9KA 1FEHA 3PO5A 1LFPA 1UVNA 4I6WA 3HULA 3K5MA 3KG0A 4ETZA 2HIYA 2P9GA 1IXKA 2M7SA 2HVIA 2O1PA 3MPYA 2GVDA 1SJ4P 4PKDB 1PBAA 5CZVA 4HACA 5KAKA 3ET6B 3CO0P 2ASJA 2HQFA 3MD3A 2A2DA 2OGUA 4HHJA 1FD8A 4C11A 2AJ2A 3GILA 3RR8A 4DSKA 4PXEA 4LSLA 2QLFB 4KO0B 4F25A 3JAMU 5FD1A 2DR6A 2A2CA 1JLBB 4C7QA 2BJ7A 3LAKA 3T5LA 2GMJA 2FVCA 4G1QA 3D54A 1T8EA 1FE0A 1PBUA 4K4TA 1KLMA 3GIKA 1UFKA 1VBXA 3EM1A 3FK4A 4EGLA 2CZ4A 2I6WA 2XYGB 3TA0A 2EG1A 3V6JA 3H5SA 3QRPA 2D3ZA 3O44A 1I94J 1JMTA 1N5YA 3A4TA 4DV2F 1U1OA 3AD7C 1YGYA 5C25A 1MG7A 3J80Y 1QVGR 3Q8UA 2IVFB 3RB3A 2JOQA 3OFFA 1H2UX 1L3VA 2NUHA 3DGVA 1CC7A 4NYZA 4NA2A 3L7UA 3TVZA 4NLTA 3AH6A 1RTIA 5H9EJ 3G6ES 3C14B 1HL6A 3MR2A 1KKHA 4I2QB 1NDLA 3B4DA 3M9MB 2X51A 4DOZA 5C2CA 4ANCA 4DWIA 3V81A 3DLKB 1S1TB 1P9YA 1H38A 3DDNA 5GAEI 3Q0AA 1Q5YA 2HGMA 3QZ7A 4OYWA 1S6OA 2ATLA 2XMJA 1SV5A 3IR7B 3BO2A 5DLGA 3CD6S 4KGZB 2MQQA 3ZXWA 1L3SA 3PW2A 1LWFA 2W9BB 2ZH7A 3QIPB 3EXYA 5D8HB 5CH7B 2ZM6J 1ICEB 2IYGA 1RTJB 2NXEA 2KFNA 3AAWB 3MCNA 2YKMB 4YB1P 3W65A 1OSDA 2RD5C 1DBDA 1T3OA 1DQAA 5IQQA 2KTQA 2J9DA 2K3IA 5F8GA 3RW6A 1S1WB 3M30A 3C2PA 2HBQB 3IRXB 3MMAA 1NCLA 4B9LA 2U2FA 3J80U 4DR5J 4CT9A 3OFEA 1KRPA 1WACA 4LF8F 2GVZA 1X7VA 1PJ6A 3ENWA 3Q22A 5AE3A 1WKLA 1MWZA 1L3KA 3HHLA 1M5HA 4NZ0A 1JXVA 4LBHA 2IM2A 2KG0A 4IFVA 2KH9A 4FZVA 1XMQF 2CKWA 1B64A 2OD4A 3LW5C 1DQ8A 2EI5A 5DG9A 2J7UA 3US5A 5H9FK 1HW9A 2OH2A 1OMSA 1M5SA 2HYIB 4PEOA 4J91A 2XMUA 3OL7A 3CTRA 5FIIA 2GA7A 1GXUA 3H7HB 3VGTA 4YOEA 3OTBA 4MJKA 4YB6A 2E1AA 3H2LA 5KFBA 3R5JB 1TUVA 2VG6A 1JLQB 3J81Y 3RZAA 1LEOA 1RAGB 1KQGB 1LKZA 1TKXB 1IR0A 3Q8PB 4DPXA 4C6AA 2C2RA 4PUOB 3TUJC 4WFBQ 1K1QA 3A3PB 1X4GA 1IKYA 4QIFA 5KG0A 2GV1A 4DR7J 2G0CA 4YN3B 4V1Ak 3SEOA 5HBMA 2VG5A 1F9HA 5T7LB 3JSMA 4M63A 5IS2A 4AYBD 4DSFA 4FYWB 1DZ5A 5KFFA 2ZWOA 2LFVA 5B0EA 2KRBA 4KB7A 2OLWA 2ZNYA 3W2WB 1RWXB 3EGNA 4G1IA 2HWIA 3SDEB 1NK9A 5B0BA 4JI0F 7FDRA 3Q83A 4LR9A 4OYMA 5KFWA 3QFWA 3NOGA 2ZOGA 3R7NB 1ZZNA 5HMZA 4JOUA 1RTDA 4ZS6A 3VQTA 1YIJS 3S01A 1G3OA 2APOA 3GSIA 4DX8H 2WOMA 5F3TA 4QIEA 2JFKA 2WSCC 3SSQA 3T1HJ 2UP1A 2CDRB 5J2PB 1KQKA 2DEIA 3GIJA 1SPBP 3HO1A 3M8PB 2X3DA 2YPYA 2L08A 4QU6A 2UUTA 3J81U 4A8KA 4CLPA 4OZ1A 2IHR1 3DU5A 1EZZB 2HFUA 3NS7B 4NXNF 4R8UA 3TJAA 3THPA 2OTLS 3M1VB 2ZFHA 3AOBA 3OXFA 5L38A 1YRUA 5T14A 1WC3A 2E1RA 3RB6A 2N3LA 1X4HA 1HHSA 3RAXA 2A3JA 4RUBA 1HBOB 3IGVA 4DU7A 2ZC4A 5KFYA 2NUUG 3LUYA 3DYAB 4QYZJ 2ZH4A 3D4JA 2DRAA 5HMWA 4WK1A 1R27B 2QYGA 4CYUB 5F0UA 3PYGA 2GAHC 5ETKA 3PW4A 4NLDA 4LF4F 1NUEA 4JV1A 1ITPA 3D3CJ 2MZTA 4DR3F 3TZXA 4Q0BA 1Z2ZA 1FJGF 1TL1B 5HROB 2AKWB 3ENVA 3CF5Q 2IMOA 1TK5A 2N4CA 4CLLA 1N52B 3LP0B 3NS6A 2BA9A 1NSAA 5DQHA 4DPYA 3W2VA 1JJ4A 5J2QB 1CVJA 4USTA 2IBOA 5MLCV 3KHLA 2CNKB 3TR5A 2OEKA 4PG5A 1GMVA 4GKJJ 1YJRA 5KFLA 1QSYA 1RHMB 1VGYA 5KFTA 1XC9A 4I68A 1ZM2A 5IWAF 2D3OR 2ZITA 1RT1A 2R7RA 3DOKA 4YQWA 3UFCX 2ZH3A 3MI7X 1WEYA 2E5IA 1MMNA 1SUQB 4OYBA 3DHWC 3RAQA 4J9NA 2YNFB 1L3UA 3AB4B 1AUDA 4JI1J 2BR0A 2XLKA 3R5GA 5E3CA 1LK5A 1N8RT 2YQ1A 1TMMA 4K59A 4LFCJ 5LJ5Y 5D4LA 2FJBB 4X64J 3SI8A 1VQMS 3QT5A 8ATCB 4KT0C 1SVDA 1R0BG 3GLJA 1UKUA 2E66A 5LSLA 1VBKA 5HL7Q 2L9NA 4IG0A 4LT6A 5LOQA 3CJTA 2J76E 3C46A 5D4PA 1R7IA 5CHCB 3U02A 2OJ3A 1JLEB 3IBCB 5GMKa 3IS9A 2JH3A 1K1SA 1Z4UA 2BBEA 2DB1A 1S6PB 1SBRA 1S72S 1X5PA 2ROGA 4RBUA 4TQSA 4DR1F 4Q2LA 2J9DE 1EAYC 1IKXA 4DQQA 2MKKA 4RW9A 2CJ9A 4I2PA 1NAQA 3SQOP 2X7IA 4JI2J 2PD1A 3KK2B 2AWZA 4R5PB 3NBPB 5LJ3Y 4JI7F 3V4IA 3KFWX 4RPFA 5KOXA 3KG4A 3WX8A 1ACMB 2KN4A 5C42A 3ZZYA 4OI4A 3F56A 3PYEA 5ETNA 2FY1A 1T05A 4K4SA 4LF9F 2A1BA 1H2VZ 3TWZA 4A8SA 3PEHA 1X4CA 4KIAA 5LSOA 1SI9A 2NREA 3FMWA 3DI6B 4WK3A 1Z1ZA 2F8EX 3CJ0A 2DNPA 2IJNA 1RYRA 1U24A 4DF4A 2O3DA 2RRAA 1M5KC 2LXUA 3C6UB 1FDAA 2FLPA 2CQDA 4EO6A 3G6XA 4RU2A 2DGVA 1MMLA 4ED6A 3Q23A 4DSEA 2VV5A 2NLWA 1FO1A 5FDLB 1VQ8S 2E1PA 3B6BA 1J27A 2FQQB 1NDPA 3ELHA 4B9TA 2HWTA 5KG2A 2KYZA 3L7OA 4OZLA 3SCLE 3QFHA 3OV7A 2HAIA 4FF4A 3FEZA 1Q8LA 2G2OA 4D3HA 1YJ7A 1F0XA 1ZA1B 1K0VA 5KFAA 3GG0A 1PC5A 2ZDOA 2LLZA 2ZKTA 1NHUA 4ZPDA 3W5YA 2ACMA 1O6XA 2Q66A 4ZPVR 5DDPC 2LP4A 2B5JB 1HLWA 4YR3A 4U8YA 2K8GA 2VC0A 3WIUA 3DKDA 4EZ9A 2OSRA 3IBWA 1EX8A 4P7VA 2XYHB 4X66J 3VZHA 5BR8J 1T03B 5GMEA 2M2BA 1E6YB 2RAQA 3GB0A 4RWWA 4KFBB 3MPVA 4OYXA 4FXWA 1LFWA 1VQYA 2HNDA 4LBIA 1Q7LB 4LRDA 1NKBA 2HHUA 1V6HA 2G1HA 1RT5A 1PKUA 5GAEU 3RBZA 1LWCA 4C8LA 1HBUB 5A6PA 2YWKA 4B3RJ 1T02A 2GFFA 2DH8A 4O4GB 2A10A 2ZJRQ 1MN9A 5C2GA 5HMYA 3QJJA 4DQPA 3E01B 3QBCA 1FDNA 4N8OA 2UU9F 4RW8A 4KHPF 4FS2A 4G6VB 3M2UB 2B43A 1RB0A 3FBBA 2BDPA 1RHQB 2MHEA 4MFBB 5GAGI 3HHDA 3UDLA 4NZ7A 3EMTA 1B7YB 4K50A 1PSDA 4UZCA 4WYLA 2MXYA 2YKNA 1YRXA 4NA1A 3A3OB 4C3MA 5KFJA 5E3RA 4CTAB 5B0FA 2V2VA 2J9CA 3VALA 3BN7A 4CLFA 1N33J 1RT2A 3NOCA 2KDOA 4KGKA 4LBPA 2KJWA 3R1HA 1N34J 3DLJA 4CLTA 4EWTA 5D0RA 2E44A 3EJMA 2EKYA 4OHYA 2ZM6F 1NPRA 1UWBB 5I3QA 2OPRB 4DFKA 3MEDA 1ZYQA 3ISNC 8AT1B 4NCGA 3I31A 4ED7A 2JLEA 3HFZB 1PYTA 2BV3A 4TKTA 5HAOA 3BYPA 1X9MA 3DU6A 3W5ZA 2CFXA 4FN5A 1S6QA 2HLTA 4ZHRB 2J6TA 2F4VJ 4M5LA 1CJTB 2M70A 3BPSP 5M2RA 1FDBA 2JSXA 3O3LA 1S9EB 3CE8A 3EVWA 2XS5A 1HFEL 5HQLA 1HNXF 1U7LA 3BQ1A 3ZZTA 4OHZA 1C0TB 1DJ0A 4L72B 1TL7A 3R7BB 1S49A 2AF6A 4C8YA 3UD5A 4CRJA 4QIWD 1T3NA 3PR5B 3TAQA 4DQRA 3TA1A 3GV7B 5K8NA 4CH0S 2QYCA 1RK8A 3O6QA 3CDEA 4FBUA 2LMIA 3SXLA 5I42B 1QUPA 4AQYJ 1DLOA 3I5AA 4TYBA 5LT5A 1YRTA 1VIXA 2WSEC 1RHRB 2PEBA 2C3UA 4UUWA 5IZHA 2XLIA 2V9WA 4W4MA 4RW4A 2UXCF 5D3GB 2PMHA 3LH2S 2DHAA 2J7WA 2DNKA 2DIVA 4F3OA 1H7WA 2V5HG 5F3ZA 1J5EJ 1S1VB 4DU8A 2QRRA 3BBBA 4J9LA 3OJUA 1UVJA 3VAFA 1FF2A 1K73T 2VONA 2IDLA 4K2XA 3CCTA 5CAAA 3RGIA 3CJ5A 2W2QP 2NYIA 3R27A 4PQAA 4HTJA 5CYQB 3MAAB 2B0GA 3ET6A 3ETOA 3BQ0A 3VAKA 1NLKL 2HMIB 4EYIB 1BWEA 2BUNA 2LXIA 4KO0A 1P27B 1M1GA 1JLBA 3MAHA 3OR2A 1IWGA 3M2VB 4FYYB 1MN7A 3BSOA 1NK0A 3T1HF 3AQOA 2CWXA 3P6YC 1FJCA 5T41A 3KNAA 2GS8A 3G2XA 1SH3A 2KHCA 4TU7A 1AFJA 2XY5A 3SCIE 1ZAVA 2C22A 1CBKA 3BQ2A 4GVBB 3PO4A 3VCDA 1ZPVA 2CPIA 3U1LA 2BJEA 2KG1A 1I5OB 2R7SA 1GMWA 1DARA 1HI0P 3N01A 5DETA 3IN5A 4HR2A 2DY9A 2M52A 2R7WA 3C14A 5HQ8A 4TYAA 1HQ2A 4RZRA 3EPGA 2H5IB 2YNGB 4I2QA 1VK8A 2DGWA 4ED5A 3ZTPA 2B9EA 2JC1A 2LQ9A 2ZOFA 3DLKA 1S1TA 6FDRA 4KE5A 3JS9A 3N5BA 2W24A 1WTBA 3PKMA 4OHXA 4C9DA 2E5LJ 2CJBA 4O4RA 4Y2KA 5I3UB 2J9EA 2W9BA 3CC4S 3M6UA 3QIPA 2GZOA 3MUVP 1RTJA 3E2EA 4X4PA 1IWAA 5E41A 1SL0A 1WSRA 2YKMA 1PYOB 5HO4A 4WTYA 2QV6A 3KUHA 2MJUA 1F2GA 4OX6A 1SCJB 4LF5J 5A8RB 3CJQA 2BJ1A 1S1WA 4ZVTB 3IRXA 3KMSA 5F9LA 2OIHA 1HBMB 5A6WA 4DJBA 1QE1B 4K4WA 4QQBA 4PG8A 4ILRA 3IP0A 1HNZF 1RDRA 4A4JA 1EKRA 4ZLJA 4U95A 2E1MC 1U2RA 4DF8A 4P75A 2XS2A 4CO3A 1F60B 2IIHA 4TN2A 1WOPA 1S0MA 4XTTA 2GMLA 3CT9A 3OFHA 2K06A 2DNRA 2ZJQQ 1FRJA 9RUBA 1PILA 2LECA 4LFCF 2W7PA 3NGSA 4Q8FA 5KFKA 2HHHJ 4OX9J 3CEDA 4Z7CA 4OI0A 1RAOA 4ECSA 2OHDA 1SL2A 1JLQA 3FBFA 4A48A 5HP1B 4DX5A 2O5DA 4HI2A 4IRDA 2V8GA 2NSCA 2W25A 1VQSA 3FFIB 1V5IB 1GT8A 4WU3A 1TKXA 2Q3PA 3WC0A 1KSPA 2EFPA 2QLWA 1KEKA 1XN9A 4PUOA 2AEMA 3AB2B 4QZVB 4EBEA 3CJKB 5EGYA 2QO3A 3CMES 1EJ7L 5T7LA 2G2ZA 3N6NA 5BXIA 6AT1B 2CVIA 1SB6A 3BN4A 1SJFA 4DPUA 1IKWB 2XM3A 2W4PA 3W2WA 1VLOA 1RT4B 1FK9B 3VWSA 3SDEA 2FZGB 1JIHA 3C16B 1VR6A 1VJWA 2LEPA 4FPIA 2HVZA 3A8IA 4XDDA 4B3MJ 2IPOB 2MQLA 2HG4A 3MF5A 2IVYA 3THTA 4NLVA 3OHBA 4LQ3A 4PG6A 1N0VC 2LXFA 4EBDA 4LR7A 4NRUA 1ZTTA 5LXYA 2AEFA 5J2PA 3CD0A 5BYSA 2QL5B 3M8PA 5ETTA 4ZVHA 3HVTB 2M8DB 4QYRA 2HHQA 3TNVA 4QYZK 1VQOS 2N3OA 3KYLA 4MIBA 3CMAS 3M1VA 4A8OA 3OVAA 2DNZA 2J0WA 3NCRA 2FLLA 5F8NA 2YX1A 2QSFA 4DUTA 4ED0A 3LANA 1QDUB 4YFUA 3CGIA 2ILZA 4BC7A 1NJZA 1JJHA 1HBOA 4ECYA 1HD1A 5F8IA 3DYAA 5E7OB 2YKOA 2WVEA 1JLCB 4NCBA 4CNZA 4CYUA 1X9WA 1JNZB 3GV5B 2JNJA 4DL3A 3OXLA 2ZHOA 4KJIA 1DTTB 4KV8B 5IT0A 3GIIA 3OL9A 2QMUB 4TY9A 1S1XA 1TL1A 5ETLA 5HROA 4I7FB 5GAGU 2PE8A 2OFHX 2VA3A 3KHGA 2ROPA 4Y6IA 3P45B 2RH3A 3LP0A 2C2ZB 4K5SA 5J2QA 3KXDA 3QNWB 5F8LA 3MUMP 3QSYB 1D3WA 4KSEB 4X62F 4QR0A 1J5OB 4N56A 1Y4ZB 3PZPA 4HDGA 2HWHA 5JVGQ 2AYBA 3BSNA 4ED2A 2E29A 4F3QA 1D09B 2HHTA 4ID5B 1XMOJ 3HVAA 1NDCA 1IBKJ 3T9NA 3PTWA 3Q8QB 2MMYA 2B9YA 3CCJS 2V2ZA 2QE5A 2MZRA 3K89A 2DNQA 5K8MA 2FJXA 1SUQA 3IC1A 3DLGB 2YNFA 3IM8A 3JSYA 1TKZB 3BF4A 2R8JA 2MKHA 1KTQA 3GCWP 3MCSA 4K7QA 4DL4A 5F9NA 1F5BA 3IWNC 4LFAJ 2M5YA 1S48A 3KLEB 3LPYA 1GMWD 3RW7A 2R2UA 4G65A 4MMOA 4MYUA 2KO1A 2ZUGA 2VD3A 4ICLB 2H9ZA 2WBRA 4RBVA 1VRTB 3FJ2A 1VBZA 1UVIA 4UW2A 2OPQB 3RUBL 4KR0B 4A8FA 1KBRA 3OPKA 4EBCA 2LYVA 3NMRA 2OMLA 3KJQB 1YDLA 1YITS 2KKHA 1O8BA 3R5DA 1JLEA 3S6EA 4ZJLA 2KM8C 3FEXB 2DEJA 3NGDA 4LRCA 1U1KA 1LQ9A 1S6PA 2M0GB 3DLHA 4ZVEA 4U67Q 1AW0A 5EX0A 1KOHA 5HN0A 1ZZFA 2OEMA 3EZUA 1VHIA 3CDAA 1D0EA 2K7JA 2OAUA 4USVA 4A8YA 4NLYA 2GQQA 4B3OB 2VASA 2ZBPA 4Y0FA 4YY3J 2F63A 3KK2A 2XZDB 4R5PA 3NBPA 2W4DA 4FYDA 2UUWA 2QMWA 3QIDA 3D6TB 3NL0A 1JLAB 1KD1T 1TL4A 2BX6A 3MGJA 1TK8A 3DLBA 2MKIA 1HPZB 4MH8A 2K3KA 1HR0J 4ZCKA 2ZUAA 3DRSB 2UVRA 4AQYF 3L7PA 2GNKA 4TU8A 1HNWJ 4USIA 2ABYA 4YR0A 5KFQA 3DI6A 1QAYA 1UVKA 1KDNA 2XSFA 4WP3A 3OLBA 4QWDA 2BKNA 2F4FA 2HEKA 3C6UA 1J5EF 1F5CA 4K4ZA 1IN0A 2CVEA 5CYMB 1NXIA
chains in the Genus database with same CATH topology
2XMMA 3QLHA 3MUTP 3VR1A 2OD4A 3HZGA 5FDLA 3IRWP 5JVHQ 1BC6A 3D0GE 2Y1JA 3LW5C 3BGUA 3N6MA 1DQ8A 2EI5A 1S9GA 3G8SA 4OFZA 5DG9A 4DSIA 1SIZA 3TYTA 2J7UA 3US5A 3CIZA 1NJIT 1YJTA 1C1BA 1HW9A 1NEEA 2V4QA 4FPRA 2OH2A 3TOQA 4JI1F 3R5BA 4PXCA 2QZ8A 2XGQA 4AFFA 2DITA 1M5SA 2O67A 2HYIB 1GQEA 4WKRA 4DV0F 1R6YA 4WU2A 2UXDF 4MIWA 4USJC 4DQSA 4ZPTR 2XMUA 5AXMA 1UA0A 4QIVA 3OL7A 3CTRA 1C1CA 4CO0A 1Y0HA 4PPZA 5FIIA 2GA7A 4WFZA 3TX8A 2RU9A 4ECXA 1U1NA 1GXUA 2DGXA 2FC9A 1T94A 1NK4A 4XK8C 2B5JA 3LWLA 4YOEA 4NMLA 3OTBA 4MJKA 4YB6A 2E1AA 3H2LA 5KFBA 4X64F 3PFEA 3JYTA 2AU0A 2O66A 1C2PA 1SKSA 2CIMA 1TUVA 2VG6A 3KMQA 1JLQB 2PMZD 3J81Y 2ZH2A 3RZAA 1GX6A 4KBIA 1BY9A 5KFNA 1KQGB 1U8SA 1LKZA 2KI2A 1JKHB 3I87A 3IG1A 4Z37A 2ACYA 1TKXB 1T03A 4I0WA 1IR0A 3FZBA 1SH2A 3Q8PB 3J7YI 3AY0A 3CIMA 3I0RA 1KTVA 2AYEA 4F4YA 2C2RA 3K0JA 2FVPA 4PUOB 1E6YA 5K14B 3TUJC 4WFBQ 2YH1A 2AYGA 2DR7A 1K1QA 3MEEA 1HQEA 5DDRC 1X4GA 1IKYA 1YJUA 4QIFA 1IQTA 2J0QD 5KG0A 2GV1A 3BGRB 2CPFA 4IR9A 4N8NA 2OPSB 2F40A 2G0CA 1NKCA 2XULA 3IO1A 2AW0A 2XMTA 5IM0B 3OR1A 2AP6A 3SEOA 5HBMA 3TO8A 1LXNA 2VG5A 4M8LA 5T7LB 1D9DA 3RRHA 2VUGA 1TKTB 3JSMA 4M63A 5IS2A 4AYBD 1U1RA 4DSFA 2JLGA 4DSLA 2FB0A 2M4MA 2YWEA 3UCUP 5KFFA 1DZ5A 3HF5A 1HNVA 1IJEB 2B6AA 5CXTA 1QUVA 1HBUA 5B0EA 2XMVA 2KRBA 4KB7A 2OLWA 2ZNYA 2EK6A 3W2WB 2JC0A 1ZM4A 3HK2A 3EGNA 2I0XA 5H1SV 3O1LA 4G1IA 3FQKA 2C3OA 2HWIA 3TQ1A 2VPXB 3SDEB 5M2PA 3CJ3A 2HRUA 5HLFB 2VBYA 1NK9A 4O4GA 4WE1B 5B0BA 5JXSA 4OHWA 4JI0F 7FDRA 3N79A 2CPZA 4WCEQ 3EUNA 3NKYA 4PPDA 3KLFB 2E9ZA 4N76A 4DV6F 1JK9B 3CB4A 3E01A 1VOMA 2MQMA 2ZBCA 5KFWA 5IFMA 3D2WA 4I6AA 3NAIA 2ZOGA 1ZZNA 4F8RA 2LEBA 5HMZA 4F4XA 2KRRA 4JOUA 4JI4F 2RUGA 3SCKE 3M32B 1RTDA 3M2UA 4ZS6A 4MK9A 4BWJA 2DO4A 1XK8A 4IOBA 3MM8B 3SFUA 3SV4A 3UNGC 3VQTA 1RA7A 4WF9Q 2PGCA 4Y3CA 1YIJS 1RYSA 3M4XA 2J6SA 2BANB 2ROEA 2MZQA 2Q43A 4KHRA 4MFBA 3S01A 1G3OA 1D8ZA 2APOA 2O01C 2R8IA 2E5HA 4JI2F 4NYPA 1Q78A 1ZAXA 4DX8H 2MGZA 2EFQA 2WOMA 2JVOA 5F3TA 2IM1A 4QIEA 4ZVFA 1S0OA 3MM7B 2VOPA 2JFKA 2WSCC 3SSQA 2UP1A 4OLPA 3MFIA 4F3MA 3FRZA 2YY3A 3H5YA 5J2PB 2CQIA 1KQKA 3MFHA 3CXCR 1WNEA 3ZZPA 4FXDA 3GIJA 4UUXA 1DRZA 4CI0B 3HO1A 2VL1A 3M8PB 3OBIA 3Q2SC 5KFVA 4ATNA 3NGKA 2EFVA 1JB0C 3FEYB 4H4OB 5EX3A 2L08A 5MAOA 3HXMA 4QU6A 3OTEA 1LWEB 4YB7A 2UUTA 4TU9A 3CCES 2X1AA 3CCMS 3P96A 4A8KA 3QGIA 4CTAA 4OZ1A 2FGCA 2IHR1 2FJAB 2UVWA 1TR0A 2DH7A 1HI8A 1KHVA 3DU5A 5DO2A 3MR6A 2DGTA 3AJ2A 4M5DB 5KT6A 5EDWA 3HM9A 1R43A 2VQFF 4QPXA 5J1EA 5GAHU 3R1LA 7FD1A 4EEYA 2VBWA 3D1HA 4NLOA 4NXNF 4R8UA 3FNNA 4IFYB 4NLUA 3THPA 2OTLS 4Y2IA 3M1VB 2ZFHA 1C4CA 2E5LF 1S1UA 4B3TF 2DCUB 3PNIA 4V19X 4WZQA 3OXFA 3T5HA 4ZCIA 2ZE2B 5L38A 2QSWA 1YRUA 4CO2A 1KFSA 5T14A 4N5SA 1D9FA 5KFEA 1N54B 2E1RA 3V6DA 1TAQA 2KT5A 2VPYB 4U7CA 3RB6A 1LW0B 4IUFA 3NMAA 2P6TA 2N3LA 2R7QA 1UWBA 1X4HA 2CYYA 3MD1A 3NCQA 4Z2XA 1HHSA 4IH7A 3RAXA 2ERRA 1Q79A 2A3JA 4RNHA 3MMBB 5D4NA 2OPPB 2QMXA 4EUVA 1HBOB 3E51A 4RBTA 3T19A 3IGVA 4EO8A 2KXNB 3LP1B 3MM9B 2DNMA 2FUG9 2ZC4A 5KFYA 2NUUG 4P6QA 1MU2A 3H98A 4G1PA 3LUYA 5B0AA 1Q8IA 3DYAB 2ZBIA 4TNOA 3KWMA 1VQNS 4DBQA 5KFXA 5ITHA 3G71S 4QYZJ 4GKKF 3NCPA 2ZH4A 1M90T 2MB0B 1URRA 2DRAA 5HMWA 4WK1A 3L3CA 1R27B 4Q44A 5F0UA 2V2KA 3M8QB 4ZHRA 3HKZD 2B56A 2CQBA 3MWBA 4IOAQ 4NLQA 4ZPBA 2NPFA 3K5OA 3PW4A 4NLDA 4OI6A 4LF4F 1HYSA 4WFXA 4JV1A 3D5MA 3MM6A 3CJ2A 3OSPA 2MZTA 4U7UK 4DR3F 4IG3A 4H4MB 2CQ3A 4J9MA 1X4FA 4BBYA 4Q0BA 1S9EA 2XC9A 2VFRA 5A8WB 1Z2ZA 4DG1B 1CQMA 1S0NA 2CJAA 4X4QA 1FJGF 2FVSA 1TL1B 1FKPB 2PI4A 2RQ4A 1C4AA 5HROB 3ENVA 3HP6A 4DQIA 3DRPB 3CF5Q 1XBWA 2IMOA 2DNYA 1TK5A 1NKEA 5G0RA 4DHVA 2N4CA 2RRBA 2WHOA 2H5EA 2ZOMA 1D1UA 3FMBA 1C0TA 1N52B 2VBXA 2RKIA 3DC2A 3LP0B 3NS6A 2MPUA 2BA9A 3SFGA 5DQHA 4X66F 3DDKA 1TKDA 1RI7A 1B0TA 4OJGA 4PWDB 2YKPA 3RYLA 3W2VA 5BR8F 4HLBA 2XWYA 3GSDA 4F26A 3I4HX 5LMUF 5J2QB 1JJ4A 1CVJA 4Y34A 2IBOA 3TW0A 4HT5A 4CCHA 3MDFA 4LVOP 4C4WA 1BLUA 2UV8G 3ITHB 3P5TL 4AL5A 5MLCV 3KHLA 1QM9A 3TR5A 5I42A 2HNZB 1KC8T 5KFCA 1R3NA 4PG5A 2OSQA 1XEZA 1KQFB 3KKFA 2VKZG 2GGPA 1YJRA 5KFLA 5CCLA 4Y65A 4DL6A 1QSYA 1VGYA 2R2RA 1KR4A 4I6YA 5KFTA 1H98A 3T3FA 2XSJB 2FLOA 4I68A 1XC9A 1UEUA 4XPCA 1UA1A 2V4JA 2V8DA 4Q7AA 1ZM2A 3IR6B 2G9OA 5IWAF 2D3OR 4B3RF 2ZITA 4F2RA 1RT1A 5D3GA 1P9QC 4C98A 2R7RA 3DOKA 4YQWA 3UFCX 2ZH3A 4PWUA 4O3OA 1NK8A 4DN0A 3MI7X 4V19J 2CQ1A 4F4WA 1CEZA 1WEYA 4LIWA 4C11B 1S1VA 3RB0A 1HQUB 2LQ5A 3CCQS 1VHFA 3UI3A 1DAXA 4RNOA 1N5SA 4WXOA 3QJLA 4LUBA 2E5IA 1MMNA 4HEA9 2C2DA 1PO6A 1SUQB 2OMOA 3GWCA 4LSLB 4LQ9A 3UCGA 4IH5A 3DHWC 3HHKA 4DLGA 3I0SA 3RAQA 4J9NA 2YNFB 1L3UA 1XNRF 5EWEA 1UMJA 3AB4B 1HNIA 1AUDA 1KHWA 3MTKA 5EWGA 4MK8A 3BDPA 2V94A 1XR5A 1YBAA 1ZH5A 3X1LB 4G1QB 2BR0A 1B0PA 1U49A 1V9OA 2WB1D 2VG7B 2LA6A 3JSBA 2XLKA 4WIIA 4CZCA 5E3CA 4JV2A 4ZDNA 1LK5A 2DGUA 2MDAA 2RQKA 3OR2B 5KG1A 1N8RT 2C42A 1KLMB 3ONQA 4ED3A 2YX7A 2GJ2A 4K59A 5LJ5Y 2FHJA 4RU9A 3I96A 5D4LA 5U47A 4YP3A 3OLAA 2FJBB 3S1TA 2J6UA 2DO0A 2I1RA 3NS5A 2HHPA 2IAJB 3NLCA 4RW6A 4DV3F 3SI8A 4Q8EA 1VQMS 1Y9OA 4HDHA 3HVWA 2B7CB 2MZSA 3T6BA 2KZZA 2NSBA 2V0NA 3H8YA 4KT0C 5CCMA 1NO8A 3VF0B 1NB7A 4ZPWR 5CYQA 4KKOB 1MSWD 1IM4A 2E5GA 2G1DA 4ILLA 1UKUA 2CJKA 2E66A 1S6UA 5LSLA 4H54A 4CQ1A 5HL7Q 2L9NA 3H2VE 4IG0A 1N33F 4LT6A 4N47A 2LQBA 5IXUA 1MW7A 3BGLA 5C25B 2E5JA 2VBZA 2J0SD 5G4DA 2HMIA 3KLGB 3KLIB 5DDQC 3S7RA 1N34F 3HHEA 4RWXA 5F41A 2J76E 3C46A 1FRLA 5D4PA 4K0KF 1RISA 1X4AA 1IBLF 2HGLA 1HBNA 1R7IA 2EPIA 5CHCB 3U02A 2OJ3A 1JLEB 1NRKA 3M2VA 1X5SA 5GMKa 3BSAA 1WWHA 3MXHP 3T5KA 3IS9A 4IRKA 2RU3A 2JH3A 3QGGA 1KQSR 1RTIB 1K1SA 3GE9A 4E98A 1Z4UA 2BBEA 2GX8A 2YNIB 2DB1A 4Y2MA 3TAMA 1S6PB 4I64A 1R8HA 1VQ9S 2GCFA 2E7WA 3RTVA 3IWLA 1S76D 2NS1B 3EX7B 1SBRA 1S72S 3ISZA 2PI5A 3DLLQ 3KJVA 1E6VB 1UFLA 1X5PA 2VFVA 2ROGA 3TAPA 1UP1A 4RBUA 4KC5A 3LQVA 5L1JA 2FGOA 2IJFA 3G86A 3V81B 5LMNF 5GVQA 4TQSA 1RTHA 1RT7A 2OPQA 4DR1F 1OWXA 1O0PA 1TFYA 4Q2LA 2LU2A 2D74B 2J9DE 4LIRA 4N41A 1NHVA 1FRKA 3BSCA 2XEXA 2HQIA 1IKXA 2ZDPA 2QIFA 2YKAA 4DQQA 1VC6A 2F4VF 3DRRA 1YQHA 3LGNA 1Q8BA 3PRBA 3EXCX 4USHA 2MKKA 1SV5B 4RW9A 1SIWB 3M6WA 2CJ9A 5KFIA 3HKWA 1Q86T 5K8OA 3ZZ0A 3MHYA 2VOOA 2KM8B 4I2PA 1NAQA 2MSTA 5F8JA 3BR8A 2M8HA 4TY8B 2PD1A 1LWFB 1IJFB 4NLSA 2UVVA 5E0OA 3KK2B 2AWZA 4R5PB 3NBPB 3K58A 5LJ3Y 2WONA 3PM9A 2HQ3A 3I55S 3PV8A 1U1LA 4JI7F 4MYTA 3V4IA 3KFWX 5F8HA 1S10A 1H2TZ 3U27A 5KOXA 2D41A 5LXRA 5I3PA 5F8MA 3KG4A 4Y00A 3QJPA 2KN4A 3IWXA 5C42A 3ZZYA 4F02A 4OI4A 4AL6A 3F56A 1BQXA 5KOWA 3I5BA 1HWUA 2FY1A 1T05A 5LSRA 3W3SA 1FD2A 1IKVA 4K4SA 2KHDA 1U47A 2V8HA 1YTYA 2X1GA 2XNQA 2MYFA 5DDOC 4LF9F 2A1BA 3V4MA 1FDDA 2UZAA 3M30B 4ZVGA 1H2VZ 5KTQA 3MMAB 5DGBA 3PJWA 5DJBA 1S7HA 3R3TA 4A8SA 2B4UA 3PEHA 1JLFA 3EGWB 1X4CA 1TVRB 1R8AA 4KIAA 3D0HE 1SI9A 5LSOA 2NREA 3FMWA 3DI6B 3H20A 1EP4A 1HWKA 4WK3A 3EPIA 5K5MA 1Z1ZA 2F8EX 1ZOTA 3CJ0A 1WG5A 4DV4F 3C6TA 4GMKA 1QJHA 1S4FA 3T5JA 2MQNA 3UW1A 2V4RA 3RRKA 2ZD1A 1URNA 4IRCA 2DNPA 1Y3JA 4CO5A 3HDSA 2IJNA 1RYRA 3MZIA 1U24A 1LOUA 5B0DA 3MR5A 4DF4A 2O3DA 3PX0A 1VQ6S 2RRAA 1R0AB 2RDJA 1M5KC 1N56A 2XCPA 2LXUA 3C6UB 1FDAA 5I3UA 3MMCB 2FLPA 3FQLA 4QW9A 2CQDA 3HHLB 4EO6A 1M5PC 3V2UC 5KFOA 3PXGa 4RU2A 2JHEA 3DRYA 4IFVB 3QYYA 2DGVA 4U9RA 1IUJA 5AE2A 3G6XA 1TL3B 2BW2A 5D78A 1FERA 4O3PA 4TXSA 1MMLA 4ED6A 5J2MA 2GO8A 4ZKAA 4DV7F 3Q23A 3T1YF 3QLHB 4DSEA 1H7XA 2VV5A 2NLWA 1FO1A 5FDLB 1M1KT 4KAIA 1VQ8S 5L39A 3UCZP 3QPIA 1RP5A 4OZ0A 4B9TA 2LKZA 2BABA 2HWTA 4YUDA 5KG2A 3RBEA 2D9PA 2KYZA 3L7OA 4OZLA 3SCLE 3OV7A 1S9GB 2HAIA 4C8OA 4FF4A 3FEZA 3I32A 1Q8LA 2SXLA 4OIXA 4D3HA 1CSJA 1C1BB 2IFXA 5A8RA 3HX9A 1ZAWA 1F0XA 5D6GA 2I38A 3CJ4A 4ID8A 4ZP8A 1JLGA 5GADI 3GFYA 1K0VA 3FSYA 2EFGA 3IXQA 3A1YG 4PQUA 4DFJA 3QAUA 3F44A 3GG0A 3M6VA 5KFAA 1PC5A 4C8NA 3LGMA 2ZDOA 2ZKUA 2IM3A 4RUCA 2R7VA 3WBZA 1HBMA 2LLZA 2EW9A 2ZKTA 1NHUA 2Z4PA 4ZPDA 3QGHA 4QWCA 4IQXA 3K5LA 1XMOF 1QE1A 1C1CB 4R0EA 5DG7A 2Q66A 4KQZA 2Y1IA 4ZPVR 4W92B 2ZNZA 3JSRA 5DDPC 4AL7A 4ES1A 2CQPA 4LMZA 4A8XA 2B5JB 3DFEA 4Q45A 4OZ5A 4YR3A 1V3RA 2J5AA 2K8GA 4DL5A 1OQ3A 2VC0A 3DOLA 3JYTB 1QAIA 2QEXS 2CPDA 4OJ1A 2IC3A 2VH7A 1YI2S 3DXBA 3UR3C 2E1CA 2WB4A 2OSRA 3IBWA 4EZ9A 1KS2A 2FJEB 2HS3A 4OQJA 3PX4A 1SH0A 3T1AA 2AJ0A 3J7A1 3NG8A 2QT7A 4MKBA 4P7VA 1WI6A 3I5CA 5L1IA 2IBKA 3IG1B 2GHVC 2FPHX 4J9OA 2XY7A 2DISA 3IR5B 3VZHA 1T03B 3UQSA 1KONA 2CQHA 3HMJG 1QSSA 4C3KA 5L1LA 4I67A 3I0RB 2M2BA 1R8BA 5H9FJ 3CCSS 1E6YB 4WFNQ 2FC8A 3MEEB 1HQEB 4ZP7A 3GB0A 4RWWA 4AXJA 4KFBB 4URGA 2EG2A 3MPVA 4FXWA 1IKYB 1C0UA 2KJVA 1LFWA 1NJYA 1VQYA 4LFAF 2HNDA 1N6QA 2YTCA 3I56S 2P9CA 3TARA 1Q7LB 1P1LA 1NNDA 3MEKA 4ES2A 5B7WA 1NKBA 1B7FA 2VG5B 2HHUA 1V6HA 4J9SA 1G7CB 1LXJA 1RT5A 1SC6A 2KVIA 4URQU 3JSMB 3G9CA 4B17A 2Q6CA 3CUNA 5GAEU 2XO7A 2OP5A 1DTQB 2DJWA 4OI2A 4NOHA 1BQNA 3GIMA 4RW7A 1HNVB 5E5NA 2B6AB