4FPRA

Structure of a fungal protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
AYVCREASISGEIRYPQGTCPTKTEALNDCNKVTKGLIDFSQSHQRAWGIDMTAKVQCAPCKTTDPWDVVLCTCKITAHRYREFVPKIPYSSFSSAPGVIFRQETGLDHDPEWVVNMKARTRGCDHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a fungal protein
rcsb
source organism Leptosphaeria maculans
molecule tags Protein binding
molecule keywords Avirulence Effector AvrLm4-7
total genus 29
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2910 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fprA00
4FPRA
chains in the Genus database with same CATH superfamily
2APOA 4QPXA 4DU7A 4Y2KA 1HNWF 3CC7S 2DGQA 5AE3A 3IBFB 5AT1B 1XR7A 1HHQA 5AJ3F 4OJ3A 2NYIA 1HA1A 3UI3A 3LH2S 2DGSA 1D9DA 3TYTA 1VQYA 4NX9A 3KFWX 4OQJA 5J2MB 1IQTA 3L09A 4F36A 2JEFA 1KRPA 4JI3F 5LL6d 2YKMB 2F1FA 1YGYA 5K9FA 2M7SA 3CC2S 2MMYA 4OX7A 2LMIA 4AE5A 4OZNA 8AT1B 4RR5A 2N4DA 3ISZA 5A2QU 1B7FA 1RKIA 1IBLJ 2XEXA 1S6QB 4ZMMA 4CYUB 4C3MA 4ZPVR 4OZLA 3V6HA 3W2VA 3Q0AA 5KG3A 2M8DB 2GMLA 3AXKA 3VAGA 4CIOA 3R5BA 3T1HF 3C2PA 3GSIA 3IM8A 1NPRA 3N0VA 2CPYA 4FXWA 5GMKa 2RH3A 4QU6A 2CPXA 3Q23A 3MCNA 1JJHA 2CQHA 2XMVA 4DX7A 1HBMB 1B70B 5AXNA 3C16A 3M8SA 1CC8A 4W90B 2XMKA 3SXLA 3POTB 2FGCA 3DDIA 3JAMU 4IDKB 1UJ4A 2EG1A 3TX0A 3VVTA 2OGUA 1UWAA 3VV2B 4DQSA 2XS2A 3M1VB 3MMCA 4G65A 1R8CA 1YVFA 1N88A 4K5SA 2IDLA 4CT8A 1KP6A 2JLGA 2Y1JA 3NCPA 2JL9A 2OIHA 1UA1A 1FA0A 4NOHA 4QIEA 1VIXA 3P4UB 1ICEB 1KR4A 1W2IA 4H4OB 2C3YA 1FCAA 2CUYA 2YWWA 4LSZB 4HTJA 4USJC 3TP2A 2VHGA 4IO1A 1RYSA 4YUDA 2AW0A 2OP5A 4F7VA 4B3SF 2X7IA 3TR5A 1SUQB 4LIWA 1NSQA 2WW8A 1YZ6A 1VQ8S 4MT1A 2HIYA 1SC3B 3UD3P 4P6QA 3THPA 2AGQA 2BUNA 2M8HA 3NL0A 2DGOA 2YX1A 3EICA 4RW9B 4Z7YA 4DPXA 1YWXA 4UQTA 2FY1A 1IR2A 1H7WA 3NWRA 3ZZUA 1MMNA 3FNNA 3AD7C 5C24B 1TP7A 2WBRA 4RZRA 1DTTB 4HHHA 3M30A 3KK3A 3RB0A 2ZUGA 2R7XA 1M5KC 2KZMA 4JV2A 5F8HA 4K50A 4M5DB 1FNXH 1X60A 1JLQB 4L72B 3O8WA 3W62A 4C98A 5C7PA 2NR0A 4DR4J 3GYGA 3BH6B 1FK9A 3QZ7A 3PX6A 3CDAA 3OFHA 1VOMA 1QSLA 4PUOA 2L3MA 1U48A 1JXVA 3QT7A 3EVOA 3PRVA 2X1BA 4RJVA 3T1YJ 3C6TA 2UVVA 4KGVB 4ZDNA 5DETA 3MAHA 1U1KA 2OPRA 2I6WA 1S9GB 2XYPB 1J5EF 3MPDA 3BBFA 1CJKB 2R2RA 1HHSA 5DG8A 2XLKA 1WEYA 2D3UA 2KKHA 3K8WA 1S1TA 4ZJOA 5M2PA 3M05A 1IR1A 1UP1A 2FTRA 2POKA 4NYOA 1I3OB 2J8AA 3HVWA 3TVKA 2D3ZA 2HAFA 2OPRB 4I2QA 1IKVA 9RUBA 3KNAA 3C6UA 3C15B 1DRZA 4Y6IA 3MEGB 4L76A 2NQPA 1LWEA 1CC7A 2MZTA 2RU9A 1AB8A 5EUHA 2ZH8A 5HROA 1M1KT 3PX0A 3IAM9 5JMNA 2FJDB 2VG7B 3RU0A 2YXLA 3GV8B 5DS7A 3MM7A 4X66F 2D3OR 2Y9HA 2W4PA 2CJXB 1OYDA 5GVQA 3D68A 2VDHA 4L3KA 1HIYA 4DX8H 3SFGA 3QRRA 2AYGA 1VQMS 1YZ7A 1RHJB 1RWWB 2C2MB 2Z57B 2GQQA 4JI0F 4I64A 5C2CA 4DQRA 3CMQA 4ETZA 4UT4A 3IS9A 4JV5J 1T8EA 3EVMA 1HBUB 1YDLA 1W7WA 2HAIA 2DGWA 1REVA 2QJ3A 4ED7A 3JSYA 3PEHA 1K9MT 3WBZA 2RU3A 1H74A 4LF4J 4F0KA 1M5SA 3CO0P 2NYHA 2QN6B 3UE2A 4TVAB 1FKOA 1VQOS 5D3GA 2MSSA 1RWPB 1HBOA 5KFSA 2RUSA 4HR2A 3MOZA 1TAUA 4DV2J 2RQMA 1U49A 2MEWA 2VPZB 3HPOA 2VJVA 2GCFA 1K1SA 2PE8A 4HHUA 1FDDA 1S7HA 2W01A 4GVLA 4IH5A 5AXKA 3PW2A 4P7VA 1V5IB 2UZAA 2XLJA 1EHWA 2ZBCA 1F3VA 2CQ1A 4WIQA 4ES2A 2B4UA 2Z58B 2RS2A 3V6JA 4F8RA 4PYDA 5CCLA 3KJVB 3PIPQ 4DR2F 2ZH9A 5DM7Q 2J0SD 4JI5J 2Z2ZA 4NLOA 3QIPA 4BWJA 3CCSS 2B56A 1L3VA 1ZM2A 2NZCA 4QBUA 2CNKB 2LFVA 4ZP7A 2JVOA 4RNMA 4MIBA 3WZ0A 2W2PP 1DZ5A 3D3BJ 3KJVA 2WTFA 3RBZA 4M95A 4GKJF 1IN0A 2C3OA 2V2QA 5J1NA 4DV3F 1C4AA 5IV4A 4OMFG 2GAHC 1HI8A 1JXEA 2FJEB 1L3KA 1HD0A 1H7XA 2B3TB 3J7AN 4ZKAA 2W1BA 3KXDA 4YR0A 3MECB 4IR1A 4OI4A 1FESA 5CXTA 3N6NA 6AT1B 5F8MA 3BB5A 4EI2A 1FKAF 4KFBA 4HTIA 4RWXA 3Q24A 2BE9B 2VD3A 1S1XA 1AYEA 1PJ6A 3R97A 4J9UE 3KK2A 3QNWB 4ZVEA 2ZH6A 1KOOA 1IBMJ 5EN1A 1LK7A 1CJTB 2ZNZA 5CH7B 3OHAA 3GB0A 1ZOTA 3MCMA 4KH0B 3CT9A 3FBFA 1DAXA 4TXSA 1GX5A 5IS2A 1QAIA 2GVDB 1G4CA 4C8MA 1U1OA 3KWMA 1N36J 1EQMA 2RSQA 3PW7A 3GFYA 2VONA 4ID5B 4PPZA 2G9OA 3EPIA 2PA3A 1NJXA 3NP5A 3P96A 3RGIA 3OTOF 1WF0A 2QL7B 2W2QP 3QJLA 1W2BR 3I4PA 3ZC4A 1HQUA 1PYSB 1RUSA 1X4BA 2ZBIA 2UV8A 3BSAA 3EZOA 4URSA 3TVZA 5B0BA 2ZH3A 1GMWD 3SDEA 4NRTA 5HI7A 2MKSA 2YKNA 3VAIA 4F2RA 2F65A 5KFFA 2W7OA 1UVIA 1XERA 3DYAB 4NMXA 1E6YB 1GXLA 3QLHB 3J7YU 1NCLA 1FVSA 3RB6A 2UUAF 1UWBA 3QT6A 2Q43A 1X4GA 1NK5A 4E0DA 2U1AA 2ZBPA 1H73A 1FTRA 5IT9Y 1UVJA 2KDOA 4JBCA 4OZJA 4BBYA 4P74A 2K1RB 1GK8A 1R27B 2LXFA 2CZ9A 5B7WA 3P5TL 4ICLA 1VLOA 2GIRA 1P8GA 3TARA 4K0KF 1CS4A 4OJHA 1HARA 3C6TB 2V8VA 3D6FB 4R8UB 3QBCA 3M2RA 3CD6S 1GXTA 5JVGQ 1AUDA 4ES3A 1AW0A 4Y2AA 3CNQP 1GQEA 2Q1LA 3MAAB 1YTYA 1KSPA 5BYSA 1S0NA 2L9DA 5E3RA 3GIIA 4RBUA 1N6QA 3CIZA 1KLMA 2AYMA 4DV5F 1HD1A 4I68A 4YB6A 2RQKA 3BBBA 3BKUA 2LP4A 4WJBA 4YDDB 5GAGI 1RISA 3A1YG 2HHVA 2M2BA 2ATCB 1NKBA 2MZRA 5M2UA 2P2CB 4DJBA 3MM7B 2UUBF 3R2CJ 3FCWA 3AH6A 1NSAA 2JFKA 1RHRB 5ADZA 3X1LB 4Z37A 3KLHB 4K2JA 3FRZA 1S59A 3CJ4A 5E3PA 1GMWA 4PYAA 1RA7A 3IR7B 3Q86A 2CQBA 4EBEA 2GNKA 2J0QD 2JX2A 1PYOB 1VGYA 2MQ8A 4ZLNA 1JJ2R 1X9MA 2Z0GA 3UNGC 1QE1A 2ZOGA 3BDPA 1FRKA 1RABB 3HDSA 1C0TA 4I4BA 5GAHI 2ZZMA 1AZSA 1EKRA 2DHXA 3AJDA 2KHDA 4I6WA 2JDJA 4F0HA 1TKXA 3HM9A 1MWQA 2BE2A 4HACA 2EKYA 2D69A 2HFOA 2QZ8A 3EWGA 5F0UA 3TWZA 4AQYJ 3CXCR 4P7TA 1OIAA 3AT1B 3MWBA 4KGXB 3VAHA 3B6BA 3BQ0A 1JNZB 1KFSA 1NO8A 2BJEA 2N4CA 1FKOB 3C16B 3CJ8A 4FP9A 3S01A 4ANCA 3ZZPA 3IR5B 4DQQA 1RP5A 4LRCA 2CJKA 1QDUB 3GYXB 2YQ3A 4LF1A 3W2VB 1N33F 4ED0A 3HO1A 1NHUA 3D9BA 5KG6A 3MEEB 1X9SA 3OL9A 4Y3CA 2OKQA 2N3LA 4MJKA 3NCRA 2XCPA 4DUYF 1BD6A 4NLUA 4PAAA 1KC8T 1I94F 2LQJA 4ZVPB 4KV8A 2ROEA 3AB4B 3GCXP 1SL0A 2V63A 2ATLA 1NK9A 1UVLA 4X62J 4JYAJ 4RW7B 4F4XA 1NZAA 2HFUA 2JNJA 1R0AA 2DVIA 4F0MA 1S0OA 3PFOA 4RNFA 2QGFB 1ZZNA 4DV1J 4W98A 1KBRA 1F1BB 3M1VA 3MMCB 2YX4A 3MR2A 2WOMB 1B99A 1NLKL 2VUGA 3PRBA 3G6VA 3I6PA 3QWUA 4K4ZA 1RT2B 1KN6A 1V3ZA 4OX9F 5K8PA 1HQ2A 4OZ0A 4LF7J 4Y28C 4LF8J 5IOLA 5H9FK 4ZN3A 1U24A 3DLHA 2GQCA 3OXLA 3A3PB 4JYAF 1JWWA 1HYSB 4F02A 1RGVA 4IOAQ 3R5DA 4IKAA 1HNXJ 3PX4A 3ENAA 1OMSA 4OV1A 3GJTB 3PXGa 1FWLA 4A8KA 4Y2IA 1WORA 3SMZA 3MR6A 4QYZJ 1JLAB 2OD6A 3RBDA 3BYRA 2IM1A 4FNHA 1YJWS 1VLYA 3T3FA 4KPYA 4ECXA 3M7VA 3CJRA 3ISND 1RT4B 4DI6A 3KHHA 4A47A 4ED8A 3LPYA 3RBEA 2KT2A 2J6TA 2CQDA 4RW8B 1LW2B 4ZHRA 1WKLA 4ZP8A 1JLFA 2R8KA 1FJ7A 4RNOA 4KHMA 2F9JA 1XR6A 3OUYB 4J5OA 1JLEB 1S6OA 2LEPA 4EFAC 1U1NA 1WKJA 4BDPA 1RE1B 4UW2A 3CD5A 1WJ9A 3R7BB 2MKIA 5KG7A 4QJVA 1SQEA 2MZJA 3RAMA 3SDEB 4DMZA 3P45B 4LF5F 4KB7A 1QY7A 1D9AA 5KT2A 3KG1A 1IUJA 3NBPB 3WQPA 1CJVB 5LSOA 1NDKA 5KFKA 2KXNB 1WTBA 4LF5J 4RWWA 5ETSA 1QVFR 1KTQA 1UFWA 4L74A 1FXDA 2FLOA 2EFOA 5D4PA 4EBDA 4AL5A 2CA9A 5J1EB 1DY3A 3BS9A 2ZZNA 4WF9Q 3QFHA 4M5KA 1T0TV 3TZXA 4MFBB 4C0OC 3W5ZA 2DNNA 3HHEA 2W9CA 1UVMA 3M9OB 3TW0A 4D3GA 1RWXB 1TL1A 5FLXY 1HNVA 5CYJA 2BEFA 1WI8A 4DEZA 4ZVSB 4TQRA 4EYHB 1Q5YA 1U1LA 2ZOFA 1I6JA 5ETVA 3M2RB 1NRKA 5D0EA 1HNVB 2E1PA 3EDQB 3OTDA 1H72C 4KH1B 3BKTA 3BV8A 1TAQA 4CM2A 1U1RA 2E29A 2GHVC 2IM2A 2A2DA 4C9DA 2QG9B 3N9UC 4CTAA 5DRKA 3KLGB 3VAKA 4B9NA 2DRDA 3H20A 2V9WA 5F8IA 4MKVA 4AD6A 2OTLS 1GFWB 3IG1A 4UOCA 3VAJA 1FX4A 1AROP 4CH7A 3EJMA 4HH0A 1Z1ZA 5CYMB 4C11A 1RQ0A 5H9EK 1CJUA 2YNFA 3FCVA 3IG1B 3KJQB 1S1UA 2A6MA 1XMOJ 3IXQA 5JXSA 4OYMA 5DO2A 2E66A 3H7HB 4USKA 1WELA 2KI2A 3JXOA 2N7YA 1FO1A 3GYNA 2YNFB 4OLPA 4V19X 4JI8J 1N48A 1BUXA 4HEA9 2R8GA 4C8LA 5M2RA 1VC5A 3OR1B 2HLTA 2MQPA 4RBTA 3MM5A 2UXDJ 1S6QA 3NNHA 4JI7J 1Q8LA 2ALYB 2FPHX 2OEJA 3IRXB 3KUHA 5E5NA 4HDGA 5LMNJ 2MB0B 4B9SA 2KB2A 2C2EA 1XNRJ 1QAYA 2B8QA 2V34A 3KG0A 1DTTA 2W7AA 2YTCA 3MHYA 4DL2A 4FYWB 2HHHF 3PKYA 2HVHA 2HRTA 2EK1A 4J90A 4OI3A 2UU9J 3IWNC 3RG6A 1NDLA 3UDVA 3KHLA 2QLXA 3BM7A 3HP6A 2DPIA 1K47A 1NK4A 1QLNA 2CQCA 3FFIB 1EETA 2CVIA 1JJCB 1UPMB 4ID5A 3DRYA 4MYUA 1X9WA 2G0JA 2NLWA 3Q8VA 4IH6A 4NASA 4FYVB 4DZDA 5CZXA 1RTJA 4KR0B 3R9LA 4OL8A 2G0IA 1NUEA 1TZ0A 2HK2A 4ID8A 4MIWA 2X1AA 3G96A 1CULA 3OR2A 3X3UA 3B4MA 3BKFA 5H1SV 1C1BA 4HDHA 5HMXA 5LSLA 5CD4A 2A2CA 2GVDA 1NH7A 2CPFA 3UDLA 4CLLA 4CLYA 1T03A 4RBVA 2YQ1A 1UMJA 2ZHAA 2IBKA 4TU7A 2CFXA 3CJQA 3M6UA 4WP8A 2XMTA 1TV6A 3QGIA 4U8YA 3NMAA 3AA9A 3BPDA 3QLHA 1SL2A 3K5PA 2HHXA 4QPTA 2HQFA 2WVBA 4C0BA 3ZXWA 1FVQA 3GQCA 2HBQB 2WVCA 1SJFA 5EWEA 2RIJA 2YWGA 4CRJA 3W1YC 4J9RA 2JC0A 4O4GB 1HL6A 1YJ7A 3ITHB 1TK5A 2O01C 4MK9A 3KJNB 4RLEA 3HK2A 4J9KA 3DOMA 1TFYA 4EZ9A 2K1RA 4IFVA 4U9RA 5K8MA 7FDRA 2Y1RI 4ZJQA 2W8KA 3OTCA 3CJTA 2IYIA 5JUMA 2ZJRQ 3OW2R 5KFYA 1RCOB 2HHUA 2XY5A 2VQEJ 1RBOB 2D9PA 2JZ5A 2EKNA 4C6AA 3OQ2A 3H5SA 4PPDA 4C3KA 4BC7A 2MKCA 2FVPA 2JLEA 4WK3A 1RT7B 4NLVA 2ZJQQ 3NWGA 4IQMA 4OHZA 2YNIB 5C25B 5HLFB 1WG4A 4ZVQB 1SH0A 2DK2A 2VBWA 2VBYA 3OBIA 2L41A 1U1MA 3TVYA 2RDIA 3TX8A 4ZA1A 4YEAA 1S1WA 4A8YA 1RAIB 3ENQA 1WC3A 3BO2A 3CJKA 4C97A 2YX7A 1R8HA 1I5OB 3EYZA 5DQIA 4ECZA 1BC6A 2VFVA 3H98A 4TYAA 1UVNA 2J7UA 2I1RA 4EO6A 4QCLA 4ELTA 3W2WA 4AUKA 2ZBQA 1RT5A 2DNGA 2WONB 2GIQA 2GQ2A 3C14A 3M8QB 4MYTA 1QUPA 5DGBA 2CAJA 5HN0A 5L1IA 4NCAA 2XS5A 4A8QA 1IKXA 1D09B 3HKWA 4UY8T 1FRJA 2VICA 3W2WB 2YNHB 4L75A 4IH7A 4M1KA 4NWBA 1PJ7A 1FEHA 4UOHA 5KFUA 3NOGA 3TANA 4O44B 3KLHA 3S7RA 2OJ3A 3RB3A 5KFBA 2EXUA 3ZNJ1 1RWUA 3G86A 3OJSA 2Y1IA 1FXLA 3O5TB 1N36F 4YHHF 2OI2A 2HVIA 1SC4B 2F3JA 4ES1A 1ZM3A 1ZAWA 1Y5IB 2PEHA 1JX4A 3H4DA 1LW0B 3EMTA 1K8AT 2DT9A 3BF4A 3HHLC 4RPFA 4UQGA 1IBMF 5B0EA 1JIHA 5J2NB 1N0VC 1ROFA 2KO1A 2Z8QA 1DQ9A 2H4YB 3W65A 4RNNA 4B3MJ 1NPPA 4GO5X 3DLKA 4QIGA 3DOKB 4UF4A 2W4CA 2OPPB 1JK9B 2PO4A 3FRYA 1DJ0A 2CZVC 4OYZA 1IKYA 4MMOA 1TELA 3W5YA 4I67A 2VQEF 3GIJA 2VF3A 1Y0HA 3OLAA 5ITHA 1S76D 2EFGA 3C66A 5KFCA 3EGVA 3LANA 3UCZP 3IBWA 5I42A 3O3LA 3HSDA 4GKJJ 3CW2C 1KONA 1S1UB 2VC1A 2FC8A 5FJ4A 3FSYA 4BCAA 2BJ8A 1DBDA 2IAJA 4DSLA 3FJ2A 2O5DA 2LDIA 3NG8A 4A8MP 2I2YA 2QMXA 2OELA 1HYSA 4H4OA 5K8NA 1V5VA 3MMBB 1P9QC 1HFEL 5A8WB 2LQ9A 2MZSA 3R6GB 1CSJA 1SH3A 3OVAA 4TLQA 1H6KX 2FC9A 5D6GA 3SCJE 4EU0A 5BJRA 3HHLD 2BJ9A 2MDAA 1S9FA 1UFKA 1KLNA 4JI2J 2XZWA 1F3FA 1O8BA 2VFUA 2OPQA 1RAHB 5SUHA 2CNLB 2KTQA 4TY9A 2UXCJ 1VRTA 1EETB 3Q8YA 1T05B 1X5SA 2CDQA 5C42A 1TKTB 1KHWA 3FQKA 5JJBA 3AQPA 1VQPS 1V6HA 4QWBA 4FYXB 4B02A 1LNQA 3CC4S 2R7UA 2DR6A 2UV8G 2WVEA 4KGZB 5F8GA 1H2TZ 1N56A 2CPZA 2C28A 4GMKA 3NKYA 4F4ZA 2LQBA 2HHHJ 3NAHA 4XTTA 4O3PA 1OYEA 1WF1A 4F04B 3DFEA 1N52B 1HI1A 2V69A 4USIA 4ZHRB 5ETRA 4QOTA 5GMEA 1HW9A 2CQ3A 3NRBA 2M5YA 2LDYA 1JLCB 1U45A 1CJVA 5DGAA 2UXDF 1MROB 3OUYA 2ROPA 2K3IA 3RYLA 3KUGA 3DLLQ 2AJQA 3UPFA 3T9ZA 4C4WA 4X4VA 4O4GA 2QFIA 1FJCA 2JRSA 2V50A 4ZLJA 5L1LA 1S9EA 5HVGA 1MWYA 2BYCA 2O3DA 3N6LA 1XMOF 3HKZD 4DUYJ 1CEZA 1IKXB 2IM0A 2KRRA 4DQIA 3GU0A 4ECWA 2XMMA 3GFHA 4Y0FA 3DRPB 3FZ2A 5H9EJ 4L3NA 5IM0B 2DNRA 5DDQC 2N3OA 3UWTA 1SV5B 3A8JA 3QZ8A 2A6OA 1F9EB 1J5EJ 1EP4A 2BJDA 3D1QA 1PBAA 3V6KA 3T5KA 1OPZA 4F50A 1T9YA 1RWNB 3CPWR 3FVYA 4YDXA 2MQMA 1EX8A 2QC3A 2P6TA 2HZAA 1YG0A 1FF2A 3EX7B 1B0VA 1PGZA 2UUCF 2PGCA 4CLUA 5IT4A 2BQ3A 2MPUA 2RILA 3K59A 2XHWA 4YY3J 3D3CJ 4FF4A 2QMUB 2FDNA 3JSRA 2ZC4A 5ETLA 3EM1A 2GMJA 3UR0A 1N6QB 2HBYB 3QAUA 4AXIA 2XY7A 2DISA 4QIWD 4D3HA 4DCJB 2VODA 2NS1B 5D77A 2GFFA 1HR0F 4TKTA 5E3CA 5EWFA 1T3NA 1X4AA 3E01A 1IKYB 3MM6A 1NBEB 2DBBA 1KNZA 4G1QA 4WCEQ 1RZMA 2DCLA 4FKXA 3EE3A 1WUUA 4ZPTR 5E7OB 2ZD1B 2FHJA 4PCQA 4ATNA 2HNZB 3BPSP 1S72S 4DSJA 4IOCQ 4C48A 2HQDA 3SCIE 2RRNA 3FGVA 4DL6A 4MAKA 3DLJA 3D0GE 3W66A 4XAKA 2W9AA 2YKAA 4PWUA 1YJ9S 3GR0A 3HHLB 4WZMA 2NXCA 4I56A 1S49A 4GKKF 5E2QA 4QWEA 1YITS 4I69A 1U6ZA 4CYUA 4KSEB 6FD1A 4DWIA 2RS8A 4B3MF 4OI6A 3KTQA 1KEKA 2X1FA 1UCNA 4K8RA 2XCAA 2HNYA 1Q7LB 3A8IA 5A0YA 1ZAXA 2FQQB 3OR1A 1U1QA 2G1DA 3P8BB 3PRDA 3QO9B 4O0NA 3PZPA 3IO1A 3R7SB 1RAAB 2W2OP 5ETNA 4URGA 3J7Z5 1FDNA 4ANEA 2HHWA 4Y65A 1NJIT 5L1JA 2J7WA 2IC3B 1RTJB 1UEKA 2IRXA 2LA4A 1K44A 4ZLLA 1X4EA 1C1BB 3HSGA 5EDWA 2QLFB 1LV5A 3WIVA 2JEIA 4DS4A 2VKRA 3JS9A 2LQ8A 3UFCX 5KOWA 4CO2A 1SKRA 1XMQF 2XWYA 2OFGX 2QL9B 4NLPA 4C0HA 2XMAA 1RTIA 4O0IA 4H4MA 2BA9A 3CMAS 3SSRA 3NS6A 5D15A 1OY6A 4GC6A 4X84A 3OTOJ 6FDRA 4A8SA 1Q7YT 1CULB 3OR2B 3CWJA 3U1NA 3JSMA 2DHSA 2ERRA 1RT2A 4LF8F 2BOAA 1IBCB 2YH1A 4NCBA 1APSA 3SQGB 1VDHA 1QUVA 3D54A 4DLEA 2E1RA 4W4MA 4DR3F 4U7UD 2BDPA 4DV6F 2VPYB 2WVFA 2RKIB 4NYZA 1VJWA 1VRUA 1TK8A 1C0UA 3PY8A 3M4XA 1TQLA 3PJXA 4KE5A 3RRGA 3BREA 2HRYA 3IWLA 2R8HA 2YBVA 5D8HB 4KQZA 2AHOB 4K59A 2IA0A 2DNOA 3KUEA 1GX6A 4B3RF 1X5TA 4X62F 1IKWA 4PR6A 4DFMA 3ZTQA 3LTOA 2U2FA 1RSCA 2MKHA 4A48A 5A76A 3L4BC 1FX2A 2Y8YA 3SCLE 2LYVA 3DLBA 3MF5A 2R2UA 5DLGA 3QATA 1CJKA 3R6LB 3AXMA 2W7PA 3K7RA 4LFCF 4F4KA 4U67Q 4ED5A 2BJ1A 2NCKL 2NPFA 5IQ6A 5HLFA 1FKPA 1M0SA 1TL3B 4AFFA 4DSEA 1U47A 2B4VA 1VQ9S 1S0VA 2CJYB 1LEOA 3I9ZA 4IRDA 3JB9k 1WDTA 3VWSA 3KLGA 1MROA 2WB1D 3DU5A 2OUGA 5JVHQ 1PO6A 2JOQA 2H5JB 4PXBA 4DR3J 3RW7A 2RQ4A 3OV7A 1HNZJ 1WWHA 4WFZA 5F41A 1VR6A 2K7JA 3QSIA 5HJXA 1HWLA 3C46A 4M5HA 4CM0A 2PSZA 1FRMA 2YWFA 3M6VA 4KHRA 5D0HA 2FVQA 2WONA 3M8QA 3FC9A 5LXYA 1RYRA 3M8RA 2UUBJ 3G9CA 4QYRA 5CHCB 1REVB 3I96A 4B9TA 1RA6A 5LXRA 2DNPA 5ETOA 2QO3A 1Y3KA 2JWNA 3GR1A 3HSZA 1WC4A 1T02A 7FD1A 1H2VZ 1OSDA 2IJNA 1IM6A 2J9CA 2EC2A 5KFDA 3L3CA 1N34F 3CDBA 3I0SB 4A4JA 2B0GA 5A0YB 1IWGA 1HBMA 2LKZA 1Y5NB 1VQ5S 1B0TA 2LLZA 2XO7A 3L7UA 3K8VA 4FF1A 4J9SA 1LWFA 4LF9J 1BQXA 2ZVSA 4G1PA 3IN5A 4R5PA 2ACMA 2RUGA 4LVOP 3UCGA 2MQNA 3M2UA 1RAJA 4PQAA 1B7YB 1WEZA 2B9WA 4PG8A 5E41A 2DXDA 3QRQA 1ZYQA 2L9WA 2HPUA 2LU1A 3NEKA 3KNGA 3PCOB 3TRGA 4DUZF 2OPPA 3DKDA 3CCJS 2RHSB 1Z4UA 3ENVA 4J37A 2KG0A 3LP2B 2UUAJ 3NOCA 5T7LB 2GV1A 3DRSA 4ZPBA 4ED2A 3OTEA 3OPKA 4RW4A 3UDCA 4DSIA 5DZ7A 2QTWA 3EUNA 1HQUB 3CJ5A 5A6WA 3BO3A 3PVXA 1RU1A 1C2PA 1NKCA 2ZVIA 4KJIA 4K7QA 2GGPA 4V1Ak 3DXBA 1Q8KA 4FYDA 2XSFA 3E8OA 1B3TA 2HW3A 3GONA 1VRUB 1GEHA 4M5LA 5DG9A 1HR0J 1GMUA 4JV1A 3B78A 1VRTB 3HMJG 5SZTA 1D8YA 5U47A 2HWHA 1YX2A 2OMLA 2QT7A 2HFSA 1FK9B 2GO9A 1EB0A 1Q8IA 2MHNA 2CG8A 3CCTA 4TU8A 3QJPA 2PC6A 4CLFA 4CQ1A 1JJ4A 3BQ2A 1CJTA 2BVZA 4PXCA 1RACB 3ETMA 2B8PA 4DXLA 4RUCA 2UUCJ 3GG1A 1B4SA 4ILLA 3E3XA 1XQIA 5DJBA 5KFZA 2GVZA 2CQ4A 3MAQA 1C1CB 1RT3A 1S12A 4NLRA 4OZ3A 3PW0A 1G7CB 1RTIB 1Y10A 4Q7AA 2IDEA 3H2LA 4ZOSA 3RBXA 5KT4A 2QLWA 3N5BA 3DXSX 4CO5A 2VJUA 1S1WB 3AOAA 3H25A 3SYZA 5B09A 5A6PA 2R4FA 2A10A 2DHHA 3IMQJ 5D0GA 1H0HB 1T94A 4NEYA 3FBCA 2RDDA 1X4CA 4DL5A 2W4DA 2Z2YB 3VF0B 2XTJP 2HGLA 4EO8A 2F4FA 2VKZG 3DYAA 2XYGB 1U8SA 3ITHA 1SCJB 1NK0A 1QSSA 3OVSA 4ZCIA 1O51A 3NGKA 1FERA 2G4BA 1YK9A 3LP1B 4KYZA 4ZIWA 4X4OA 1NNDA 3NBPA 2E7WA 3I82A 1FFWB 1V9OA 3VQTA 3ZTRA 4V19J 4C8NA 3ENWA 3HHDA 1RKJA 1SKSA 2AT1B 2DNMA 4X4NA 1E6VB 2X3GA 4IRKA 4ER8A 1N34J 2P9GA 1WSVA 2HWTA 1YKWA 1JLGA 2PMHA 5F8NA 1PC5A 4F25A 1S57A 2HGMA 5D3GB 2VPXB 2CIMA 3ZZZA 4AT1B 2CRLA 2V4JA 3CTRA 1GH8A 2DNQA 2H54B 4HLBA 5KFXA 1GTEA 2IFXA 2UXCF 1PIEA 1HQEA 2I8EA 2R7QA 2NREA 1WSRA 3CCQS 2WB4A 1PCAA 2HHTA 2H48B 2EEYA 2DJWA 3E51A 3QMQA 4P2FA 2CNOB 1U25A 2DNZA 5AJ3J 4A46A 2VB6A 3KLFA 3BO4A 3G8QA 1EKSA 1YQHA 4B9UA 3AODA 2MKKA 4LF7F 1HNWJ 2XC9A 5KFWA 4KV8B 4C11B 3UVJB 1RT5B 4IUFA 1RBLA 3W5XA 3BZQA 4OHWA 2MY8A 5HVHA 2R8JA 3R8YA 8ATCB 2B5JA 4USMA 2DGUA 2XNRA 4CLWA 3M9MB 2CNNB 4DSKA 2WOMA 3DLGA 1Q95G 4EUVA 4PG6A 4Z2XA 3G6ES 4LFCJ 2ZKTA 1UJ5A 2PFFB 1F60B 5A8RB 2MSTA 5ETMA 1W26A 1Y5LB 2HQIA 2MJNA 2PFDA 3AD8C 3IR6B 1GMVA 2J9DE 2FGOA 5EX3A 2UXBF 3GJSB 4P2XA 2DB1A 3CEDA 3MMJA 3V4IB 4FXDA 5F0WA 4OJ1A 3V81B 3AA8A 4NA2A 4DS5A 5H9FJ 3CDEA 1KVJA 4LBPA 4RU9A 1NMEB 2AGPA 3VGUA 1GAOA 2E9TA 1YBUA 2Q3PA 4MH8A 3G71S 5KFQA 4DV7J 1JLAA 3VHQA 3MTKA 5G4DA 1K0TA 3O44A 3UN3A 2CDRB 4E2FB 1WHWA 4N47A 4ECQA 4OYBA 2FZKB 3CCRS 2H5EA 4QR2A 1VC6A 2E5LJ 4XPEA 2MQQA 3JYTA 2D9OA 2VG6B 3BR8A 4KBIA 1KQFB 2QSWA 3U1LA 5ETPA 3GILA 3ZFVA 2PN6A 2PT0A 3NLCA 1PAEX 4M8LA 4QW8A 3PO5A 4ED4A 2DGXA 1U4BA 3DGPB 4FYYB 1HW8A 4OJGA 2Z4PA 4OZ2A 1M5OC 1SB6A 2ZHOA 1D8ZA 4URQU 2MGZB 2DH8A 2GGPB 4FN5A 4OIXA 2LCWA 4NI2A 4WK1A 1U0SA 1R3NA 1NEEA 3MM8A 3UW1A 2ALZA 2IIHA 2AGOA 1T9XA 1UEVA 5KFPA 2ZH1A 1U2RA 3N28A 3SFUA 3FZBA 1BWEA 4Z7CA 2HKEA 1MMLA 1TUGB 1OS5A 2PEBA 1UTAA 5KTQA 5IZHA 2JEGA 4N76A 2IPOB 1TL4A 1ZM4A 2BKNA 1R8PA 4IG0A 1NHKL 1FDAA 2IBOA 2OMOA 1F2HA 2XZTB 3FMWA 4IFVB 4U8VA 4ZVUB 3TJAA 4CO3A 4DPOA 1RT6A 5L46A 3CE8A 3OL7A 1Y11A 2ASLA 1VISA 3FDSA 2C2OB 3LQVA 1KHVA 2CWXA 4JI6J 2RHQB 3DMJB 4P9SA 4GKKJ 1S1VA 3DRRA 4CI0B 2FHJD 3TO8A 1KFDA 1AA1B 4FVCA 1RTHA 1SIZA 5HL7Q 4O3NA 4NZ6A 1JLEA 2PA8D 1RI7A 2M52A 1TKZA 2G13A 2J0WA 2YY3A 4L6V3 2B6AA 3SCKE 4PQUA 3C15A 2LXUA 2BANB 4DU8A 3DDKA 4PWDA 4LR9A 3GG0A 5I4MA 3DCAA 4LR7A 4DN9A 3KK1A 1WHVA 3MUMP 1HPZA 1LFPA 4U95A 2BQUA 3EDRB 1XBWA 2ROGA 2O1PA 3AHPA 1I51B 3CIMA 3DHWC 4HYKA 4Q8EA 3D66A 5KFVA 5K14A 1ELOA 5F3ZA 2KJWA 1WOPA 2DNYA 4FVMA 1K73T 4DQPA 2BR0A 3H4BA 1PG5B 2R7WA 1SQFA 4LF6J 3RW6A 2AZ3A 1FWKA 3IGNA 3JQMA 4QWCA 2E5LF 4UOGA 3IS9B 2AP6A 4NZ7A 2SXLA 2GC8A 1FFGB 4NLDA 4OLOA 2KFYA 2VIHA 1SQGA 4NXMF 1XEZA 3GLJA 4DV7F 3MCOA 4IFYB 3H5UA 2HEKA 2FZGB 2AQ4A 2HURA 3K5MA 2CQIA 2V4JB 1XTZA 2AEMA 2IVYA 4DZ6A 4ZCKA 2EG2A 3AQOA 3NGTA 1VHFA 2HYIB 2OHDA 4F26A 2PI5A 4CLPA 1S1XB 2V68A 2PI4A 2WSFC 3G87A 2AZ1A 2V8GA 4N77A 3US5A 1WDDA 2MQLA 5DDOC 4YR3A 3PR5B 1XNRF 3ISNC 1F5AA 2E7XA 4EMDA 1F2GA 5I42B 1FNOA 1P9YA 2V8PA 2BX6A 3LAMA 4NLQA 1ZTTA 1QTNB 1U6FA 3VQSA 3GMGA 4WZQA 2ZZTA 3ZTSA 2D7SA 3AB2B 3QIPB 2QEXS 1CJUB 1WD6A 4Q0BB 3GCWP 4ZVHA 1KQKA 3U27A 2ZH4A 4A8OA 3G8SA 3M6XA 3M6WA 3THVA 4RW7A 1G2EA 1IVZA 2DXFA 4H4KC 1IJEB 3HFZB 3W63A 1RWVB 1BMQB 1P1TA 2LU2A 2VG5A 3HF5A 3NXZA 4IG3A 5KT3A 1CQMA 3MMAA 1ZA2B 4B08A 5K8OA 4ZVRB 4OFZA 2FJWA 2COLA 3MPUB 4NLTA 3R1HA 3M30B 5E33A 4LVNP 3K57A 5GAHU 4DV4F 4M5GA 4WXWA 1VYAA 4P72A 5C5JA 1H38A 1N8RT 3MR5A 4KTQA 2Q66A 3F73A 2JEJA 3MR7A 3NAIA 1FJEB 4X4PA 2E7VA 3KK2B 1O5JA 3PTWA 4OYWA 2WSEC 1D9FA 5KAKA 3QWPA 2IA6A 2XM3A 2Y0SD 2GW8A 1JQGA 2OAUA 3DRXA 4QR1A 1TUVA 2BZ2A 4GVBA 1UFLA 3HZGA 3SEOA 4DR5F 1WOSA 2HQ3A 5B0FA 4DFPA 3K89A 3J7ZT 4CLTA 1A7GE 4DX5A 5LMUJ 3HSJA 1L3SA 2QE5A 4H4MB 4ETXA 3HHKA 1MNEA 2FLLA 1PSDA 2GJIA 1YIJS 2HMIA 3RR8A 2G1HA 2FVRA 1TFWA 1F6TA 3MAAA 1T03B 3A4TA 3DOLB 1SBRA 2E5IA 3O1LA 2XQCA 3FSIA 3GJQB 2NSCA 1T9WA 3TEHB 4DHVA 2E1CA 3MZIA 1NK6A 3Q8UA 4W92B 3T6BA 3GPAA 3P3DA 4DOZA 4ZVFA 4RUHA 2L48A 4NLGA 1TU0B 2QMWA 4I2QB 3KJFB 4R0EA 2HQCA 2R2TA 2KRBA 4N7TA 3PIOQ 2V2KA 4Q8FA 1MN9A 3QGPA 5HVFA 2HFNA 5KFAA 2FVCA 5A8KA 3UD4P 2CXEA 3H40A 4EEYA 5J2MA 2CJBA 3M8ZA 2ZWPA 3M32A 1AT1B 3HD1A 2YKMA 2HHQA 2XMUA 3PG9A 4I7FA 2M9KA 3B54A 3QGHA 4KAIA 4TLRA 3D0HE 1NSKL 4HACB 4J9VA 5LOQA 3CDWA 1PAUB 2ZFHA 5GAEI 4YHHJ 3T5HA 4DN0A 4I7FB 1F9HA 4ZPDA 3UNYA 4GC7A 1SIWB 4B3OB 4DR6J 2CYYA 5GAGU 3VALA 2AKWB 4G1QB 1VFJA 3DLKB 1S6PA 4FPIA 5FDLA 4O3QA 2N82B 4XPCA 4MTPA 1HQEB 1DFDA 3D1HA 1VBKA 1SVDA 2K8GA 5MLCV 2IJFA 5HMWA 1BGXT 3NGUA 3BJYA 1M1GA 4LSNA 3VGVA 3BH7B 2YNGB 4HL9A 2YWHA 2IVMA 2XB2D 4RO0A 1QD1A 1U09A 5BXIA 1PJ5A 1NPKA 3G2XA 1RJJA 4LUBA 3NGDA 2VU5A 4MKAA 2ZKUA 1VQ7S 2OEMA 4CLKA 2C3PA 2YNGA 1NH8A 4K4UA 4DFJA 3SIPB 2VV5A 1ZS6A 1U26A 4USTA 4WXOA 5BYQA 3DN9A 4PRFA 4X64J 3MMAB 3GE9A 2FIUA 3VGTA 2AD9A 1VI7A 1VMBA 3CVKA 3FMBA 2XWXA 4TY8A 5KFTA 1KD1T 3I4HX 1VCTA 4DSFA 2I5JB 5HK4A 2H5IB 1I94J 2NXNA 4LF9F 3KLIA 3L7PA 4ZN1A 2XMJA 3G6XA 2ZEJA 1OO0B 3KLEB 4USVA 2J6SA 1V3RA 3TUZC 2I5JA 4QZVB 3C19A 1X31C 4LJMA 5GMDA 5KG4A 3MM9A 3DOKA 2EWHA 2HNYB 5B0CA 3V81A 2PDAA 1P1LA 3A3NB 3LWLA 2O66A 4DR1J 3PW4A 1T05A 2VC0A 2CQ2A 2IMWP 3WC2A 4RNHA 1WF2A 1S99A 3G8TA 2G2YA 1NU4A 2D74B 2HFVA 3TQ1A 4WU3A 3WX8A 4RW8A 3I0RA 2CJ9A 3TEGA 4WFBQ 3K5NA 4J9QA 1NJYA 1WC5A 2ASJA 2DR7A 1R6VA 1Q82T 3IAS9 3R5CA 2B43A 4JI2F 4CH1A 1N32J 2W25A 3NY0A 3BN4A 4I1TA 4CLZA 5C2GA 1F5BA 2FJXA 3CMES 1WC1A 5IWAF 1T9UA 2NSBA 2HLUA 2C2RA 4ECVA 5KT6A 2E44A 2Y8WA 1CLFA 3HCXA 4N41A 4G3IA 3A8KA 2ZH7A 2F9DA 1RAEB 2ZDPA 3UN2A 1Q0NA 4X4QA 2RDJA 4DX6A 5KG1A 2EI5A 2R2SA 2EC0A 2AJ0A 2V4QA 1MN7A 5CD4H 2HBRB 4X65F 1WC0A 1DTQB 2FY8A 4JOUA 5HO4A 3MM8B 1CS4B 4L73A 2ILYA 4ZVGA 2PMZD 4R8UA 2DY9A 1EQ0A 2HFZA 5HBMB 2W24A 2I0XA 1Y3JA 3HD2A 4QWDA 1EP4B 4ZPCA 3V2UC 1KDNA 5LMNF 4ECUA 3ZO7A 1NB2A 2R9LA 3E2EA 1JLGB 1S4EA 3LO3A 4K0KJ 2P5VA 3TA1A 2B6AB 4DL3A 2C2DA 4PQUB 5HP1A 4WYLA 1FRLA 1F0XA 2QSFA 4P10A 2HZCA 2F4VF 3R5JB 3TZWA 2DCUB 5RUBA 2KT3A 2BM1A 2H51B 3J80U 1S1VB 4P75A 3CUNA 5G0RA 4FS2A 4J9PA 1VIOA 3G6YA 2FHOB 4DV6J 2HWIA 5HROB 2QL5B 2A3JA 3DHXA 1TKZB 1UW9A 1A6LA 1H98A 2C42A 2XYHB 3E01B 3MM6B 2VDIA 1RTDB 1IM4A 2YNHA 1T9VA 2HS0A 3D1OA 4LFBF 2DIVA 1ZPWX 3H90A 3M8PB 1S9EB 5E3AA 3K58A 4DF4A 1YJNS 1VS3A 5KFRA 2ZD1A 4BS2A 5A8KB 3MFHA 1OWXA 4ECRA 3Q22A 5CQGA 3QPIA 1XMQJ 2K06A 2CG4A 3GIKA 1AFIA 3DLGB 1X8DA 1LQ9A 2OSRA 2IM3A 3KG4A 2VQFJ 1FJGJ 4LRAA 1J27A 3WC0A 5HQ8A 4MIAA 1RWMB 2C22A 1N5YB 4K4VA 3RUBL 1WC6A 3QFWA 2FJAB 4O44A 4ZPWR 4UZCA 4TY8B 4AL6A 1VQLS 5IXUA 3N4WA 1FD8A 1URNA 4K2XA 3KLIB 3UD5A 4B3TJ 3THTA 5E0OA 5KG2A 3T5JA 4UOFA 1Q79A 1OJ4A 3W8GA 4DG1A 3CCMS 2L9NA 3K5LA 1UPPA 1QM9A 2HK3A 3IGVA 2DRAA 4P52A 2KZZA 2BM0A 1P6TA 3EXCX 4JB8B 1JB0C 4ZP6A 1F5CA 1CG2A 1RAFB 2OPSB 4HVZA 5ETKA 1R0AB 2KJVA 1TMJA 4NRUA 1FHTA 4LR8A 2LQ5A 3P5BP 4MKBA 4LSNB 4Q45A 3OSPA 4JI4F 2XGQA 2IJRA 2BABA 2N7CA 4ECSA 1Z2ZA 3VTIA 3D67A 3TNVA 2BMBA 3PHEA 1CQNA 4J9MA 2DYAA 4J9LA 1Y9OA 2VG5B 3HI9A 4IG3B 5IQQA 3W7BA 4WE1B 3SBMA 4DPYA 2YPYA 4DV0J 3CDUA 2YKOA 3QSYB 2OTJS 2ASDA 2A0FB 3OFEA 3ZTPA 3DM2A 2WHOA 3ZZOA 5MAOA 3UCUP 4FNIA 1TV6B 3LALA 4M5JA 4JI5F 3FEYB 4AL7A 3HFKA 2OH2A 2EBEA 1TVRA 3GZ7A 4KGKA 4DCOB 2RKIA 5CAAA 3V4IA 2DY1A 4F3OA 3O2IA 2Y1LB 3DLEB 3HX9A 1JLQA 3W64A 2BRKA 4ZIVA 2BW2A 3DOMB 3QO9A 4YY3F 3J7YI 2Q79A 3OTBA 4I2PA 1BQNA 1HWIA 2DNLA 2BE7D 1J2VA 1TKTA 1X0PA 4Y2CA 5L8RC 3GV7B 1VJQA 4UY85 2R7VA 2W8LA 1HNXF 2W2NP 5GAEU 3FCHA 1VQ6S 4CNYA 3NNCA 2J76E 3FBBA 1PBUA 3W8PA 3NCQA 2AJ2A 2E9RX 2RF2A 5HANA 3W9HA 4ERDA 1ITPA 2V9KA 4HT5A 1X7VA 3MUVP 1N54B 1N5TA 4EK2A 2D41A 4LFAF 3CULA 2GO8A 4HI1A 3CF5Q 4JV5F 2HSEB 4F4YA 3H2UB 2RF2B 2YWKA 3CCUS 2KL8A 2CQ0A 4BLGA 4RKUC 2LECA 2OSQA 5J2QB 1C1CA 1RT3B 4DBQA 1MW7A 2DD8S 4FF3A 3CJKB 4OHXA 4JI7F 4U6PA 3QT8A 3TAPA 1QVGR 4WKRA 2BRLA 1ZPVA 2AEFA 5AE1A 3LP1A 3DOLA 4JI8F 4ELUA 1FNMA 1IKVB 3ZNUA 4HKQA 1HPZB 2B7CB 3MEGA 1RAOA 1R31A 4QIFA 1VQSA 1D0EA 1Q5VA 2EFPA 3IC1A 2QYCA 1NDPA 1HBNB 1LWCA 1T11A 3QGGA 3PEJA 1FWPA 4FXVA 3KMSA 1SV5A 2W9CB 4IO9Q 3RR7A 2J9DA 2KXFA 1F9FA 1X4HA 4KO0A 1FT8A 3GSDA 1R0BG 3VCDA 1S4FA 3Q8RB 1N33J 4C3LA 1S7IA 3PKMA 4HI2A 1Q4RA 4S0MA 1S79A 3ELHA 3LPEA 3J81Y 1U0HB 3ILIA 3M2VB 3IRWP 2XLIA 2UVWA 5KFHA 1YJVA 1XK8A 2BKPA 2E5GA 2QV6A 3VZIA 2V6AA 2KYZA 2F40A 1YJRA 1RCXB 2V2VA 2X1GA 1SJQA 3DMJA 1DHMA 1BHNA 2WVDA 4TYBA 3CCVS 1S77D 3DC2A 1N0UA 3OXFA 1RHKB 5DZ6A 4KKOA 1VHIA 4CO1A 3TUIC 4DL7A 4TNOA 1WOOA 4C2MA 4OYXA 3ULHA 4DG1B 3LP0A 3ZZYA 2AX0A 4KKOB 1DQAA 1QJHA 3UN5A 3MEEA 3MI7X 1KOHA 2GX8A 2P6SA 5CCMA 3CCLS 3T5LA 5J2PA 4JI1J 4YOEA 2KVIA 2OPSA 1N5QA 1MU2A 3NGSA 1X5OA 3T1AA 3VVUA 4DL4A 1PILA 1MG7A 2B5JB 2B4OA 5IC6B 4YB1P 2VOOA 2NZ4A 1URRA 3PR4A 4PABA 1QAJA 3HJFA 1RBAA 3ZZTA 1LKZA 4NZ0A 5CA5A 4NL5A 4TU9A 3MPWA 4LIRA 4DV5J 3SQOP 3TUPA 3QT5A 2V8DA 2LEAA 1VQKS 2Y0BB 4B17A 3L7OA 4KRWA 2CADA 4EBCA 5KFIA 1NSPA 3BGFA 2L08A 4LQ3A 2R7SA 4IRCA 1NAQA 2GJ2A 3OD2A 4LBHA 4OX8A 5A8WA 4PEOA 4F3QA 3EZ5A 3CB4A 4C8OA 3B4DA 1EAYC 4HHJA 3MEDB 3TZYA 2VFRA 4OZ5A 4Q5VA 1SH2A 5I3PA 4USUA 2KU7A 2NPIA 3BDEA 3R7NB 5DQGA 2XY6A 3FUYA 5DM6Q 2HVZA 3MTJA 2QLJB 4O3RA 1M1HA 4R0JA 5EHHA 2ADBA 2B9XA 4P2SA 4R5PB 1RXOB 1U7LA 4M63A 3UQSA 2I38A 2DO0A 5F9LA 2ZE2A 3J7A1 2UXBJ 1U6BA 5DQHA 4YP3A 2RRAA 2OO4A 3U02A 2E1AA 2IHR1 5BYRA 3G4SS 3V4MA 2UUWA 2ZE2B 2YQ0A 3I9V9 1JLFB 3JSBA 4JI3J 4QW9A 3A13A 2VASA 3F0NA 4ENOA 3F41A 1S48A 3K17A 4NI2B 3CD7A 2BBEA 1IWAA 4J91A 5CYQA 1DQ8A 3BQ1A 1E6YA 4FS1A 1SKWA 2M4MA 3CD0A 4NEZA 2DIUA 2EBGA 1SI9A 3RJMB 4NA3A 2QA4S 3RAQA 4K4TA 1GNKA 2MTLA 4RW9A 1L3UA 5L9XA 3DGPA 4RUBA 4RU2A 2WBMA 4OYOA 3W3SA 2BACA 4MK8A 4F2SA 2P8IA 4RUAA 1VK3A 2YKQA 2KFZA 2JFDA 3H42A 2AJFE 3ET6A 3H0PA 1I1GA 1FI4A 1SC6A 2JLFA 4OHVA 3UDEA 3D5MA 2DH9A 2MZ1A 3PYGA 1C0UB 2E5JA 3ZTOA 4WTOB 5KFOA 1WI6A 4EYIB 4MFBA 2GHWA 3LGMA 2GS8A 1D3WA 2F8EX 4OI0A 3VAMA 1J5OA 2MLZA 5LSRA 1E6VA 2AYEA 4GVBB 2YVSA 4PZVA 3R27A 3SV3A 3QJJA 3IWXA 1L3TA 1HWKA 2VH7A 3LUYA 3EGWB 3TJ9A 3PACA 1TMMA 1A0OB 1TL3A 3T6JA 1IJFB 4M5IA 4H4KA 5HMZA 3Q8QB 3L9ZA 2CKWA 1VBZA 1BE4A 4WYWA 2IVFB 1S5ZA 5AXMA 1O6XA 4PWDB 3GWCA 2YNIA 5C25A 1FE4A 3ZZRA 5FLXU 2RVJA 3LP0B 1TK0A 1KQGB 3NGRA 1RTHB 2ZWOA 4AQYF 4IQXA 2LXIA 1S6PB 3AY0A 3MGJA 2GMHA 5ETTA 2AU0A 4DLGA 1REGX 3WIUA 3D2WA 3MUTP 1BWVA 2YKPA 2PMWA 1G1XA 2JHEA 4E98A 2K2PA 3PJWA 3OL6A 1TKDA 4ELVA 3MCSA 3BGRB 1HBNA 1LWCB 2DR8A 2UVRA 4KHPJ 1YJUA 4FF2A 2WW4A 1X0FA 2FVSA 1EARA 2HNZA 2RQCA 3KYLA 2FJBB 1MLAA 2GJFA 1WG1A 3SI8A 1XNQJ 3OVBA 3LA0A 2XZDB 3KDNA 2EW9A 4GRSA 3OFFA 3D4JA 3NS5A 1V3SA 4GO7X 1FFSB 2EK6A 4AYBD 1SXLA 4ED3A 1PYTA 2DGVA 3LGHA 1LW0A 4ZJLA 1CBKA 1XWLA 3KKFA 4C8ZA 3HHLA 2VZ9A 3W60A 3I5BA 2V5HG 3I87A 1HWUA 1R8AA 4PG4A 4USWA 3OL8A 2FLNA 2VOPA 1SJRA 2HIQA 1LWFB 1TR0A 2CWKA 1S97A 4CLSA 3KHGA 2X51A 4Y00A 2UU9F 4DR1F 5A2QY 2BOPA 4NLXA 2BE2B 3D28A 3M2UB 1M5VC 1Q53A 1H2UX 3HVTB 5T14A 1UZHA 3OSNA 1VQNS 4CP5A 5J1PA 1K0VA 3OJUA 2HHSA 1RB0A 1HI0P 2CQGA 2IMOA 2OFHX 3V5RA 3KLFB 2QYGA 5FDLB 3TUJC 2P9EA 1HMVB 2MJUA 1FRHA 1RLDA 1MU2B 2RB7A 1U2FA 4FBTA 2M88A 3UVJA 5THWA 4DDFA 1FXRA 3DRSB 1RWOB 3DU6A 1JMTA 4LBIA 3J80Y 3R3TA 3N79A 2XGPA 3POTA 3QIDA 2YPZA 5KT5A 2AV5A 4YB7A 3BR9A 2QRRA 1DARA 5IT0A 4ECTA 1L5UA 2RE1A 3LP2A 4G6VB 5CYQB 5L39A 2GIFA 4TQSA 2HZVA 3W9JA 2GHPA 2MY7A 3DLEA 4XDDA 1YRXA 2XI2A 4NMLA 3TAMB 3T1YF 1ZAVA 1TL7B 2FD2A 2J7KA 3MPVA 5ETQA 4CWBA 1DURA 1FRIA 3D0IE 3MEDA 4ALZA 4DR7F 3JTOA 2A18A 4QR0A 1DLOA 1IXKA 4C7QA 4CDIA 4OHYA 3KLEA 3TAQA 4X4UA 2ACYA 3AOCA 4ZVOB 4U7CA 1Z2LA 2D3O1 3U1MA 4M94A 3MURP 4WFXA 3D6TB 4H54A 5I3QA 2M70A 2MLYA 3MM9B 3K5OA 5F9NA 3K0JA 2GVZB 4IYQA 2RJZA 3KDOA 2GA7A 1WNEA 1BQNB 3KK3B 3ILJA 5BR8J 3LOUA 1RT6B 3QAEA 4RX6A 1S1TB 2VPWB 4CH0S 4F67A 1BLUA 3DRRB 2B7BB 3DI6B 3Q2SC 2R42A 5L9NA 5HP1B 1HLWA 4QYZK 1WTFA 1YBTA 3ICLA 4ECYA 4J9OA 2JSXA 4UTGA 2UP1A 3GP9A 1KLMB 2IY5B 2LVWA 2CPIA 3PYFA 4N5SA 1HNIA 2DRBA 2HMIB 2DNHA 5KG0A 2KYXA 2W9BA 4IR9A 2ZH5A 1M90T 1VBXA 4DV3J 3I56S 2CPJA 2G2OA 3O6QA 1IBKJ 1LWEB 2DEJA 2MYFA 2CJAA 4ANDA 5D4OA 2QFJA 4K4YA 1VK8A 1WKKA 4ZVTB 1TL1B 3WHIA 4P73A 2F5GA 3S8SA 2CVEA 2F7VA 3GFZA 3KMQA 4ZLPA 2DPJA 2D1CA 2Z30B 4YMEA 3OT9A 2G0CA 1IR0A 2MZQA 1EZZB 5LMUF 2IYGA 4ICLB 5J1EA 2GZOA 1R8BA 5BR8F 3MXHP 1TKXB 4JI1F 1IQZA 1T3OA 3M32B 1U0HA 2MXYA 3DGVA 4I6YA 2FJVA 1QTMA 3K2YA 3DNCA 3BEGB 2VQFF 1FJGF 1N5SA 1ZBTA 3Q83A 2YH0A 2DO4A 2ZM6F 2RAQA 2ZOMA 3AD9C 3EGZA 3M8YA 1KTVA 4RL1A 4DR7J 5G0RB 4LF4F 1SJ1A 2OD4A 1QAXA 2NUUG 1YJTA 1S6UA 2I9SA 4F4AA 1N4LA 5CYMA 3LWMA 2QLBB 1NDCA 3LW5C 4NPOA 1SC1B 4ZP9A 2Q6BA 4X4SA 2DKOB 2DH7A 3BGOP 2HS3A 4J7CA 4OX9J 1UAWA 3D6HB 1R43A 4LFBJ 3VAFA 3J81j 2X3DA 5I3UB 2AX1A 1ZA1B 2BJ3A 2BJ7A 2HQGA 3R5GA 5D4NA 4QWAA 1ZETA 2JC1A 1FEEA 3PV8A 4NXNF 4HT7A 3M8WA 4Q0BA 4DV1F 1U2CA 4DF8A 3D7SB 1JNRB 1UZDA 3CJ3A 4WE1A 4NYPA 3LAKA 4UUXA 3MFIA 3EXYA 4K5RA 2VBZA 4X66J 1AXQA 3RRHA 2F4VJ 4EGLA 3L95X 1UA0A 4I0WA 4Q2LA 2H1YA 1G3OA 2VFTA 1UETA 4RW6B 5KFMA 5EWGA 3CCZA 3DDNA 3KHRA 3BN7A 5FIIA 4FKYA 3ILOA 1KVKA 2EPIA 1Q81T 2B9YA 4LMZA 2HNDB 3AFGA 3I0SA 2UVUA 1RADB 3HVRA 2W2MP 2ASYA 4WP3A 1NJZA 3J81U 3MM5B 5B0AA 3TOQA 4Y34A 4I2PB 4N8NA 4BWMA 5HQMA 2AWZA 5DDPC 3MECA 3H5YA 1U02A 4PG7A 3FEZA 1Q86T 3HULA 1U8WA 3A12A 7AT1B 2BW7A 3BGLA 1OY9A 2EVZA 2V8HA 3HT0A 4DR4F 2CJQA 2IC3A 4LT6A 3UR3C 4DCPB 4P2MA 3UO0A 5L38A 3R1LA 4NXMJ 2C3UA 1EIYB 2B51A 2VL1A 1XNQF 3FQLA 3B82A 1JKHB 1MMDA 5T41A 3IP0A 3NNAA 1NHVA 5KT7A 3PW5A 4KHPF 1C4CA 2XI3A 1WEXA 2YKNB 2HS4A 3I0RB 1N32F 3C6UB 3TI0A 1SUQA 1JLCA 2KVQE 2XBPA 1JKHA 1PKUA 4Y2MA 4CO0A 1NM2A 1LK5A 2H9ZA 4CNZA 1JXLA 5F8JA 3RTVA 1Y4ZB 3C3LA 1SKUB 1UL3A 4JP8A 1TVRB 3GV5B 2WAQD 4XIUA 2BQRA 2IRUA 2XSJA 3TJ8A 2WSCC 5KFLA 3Q8PB 3V6DB 3I5AA 4WFYA 3MPYA 5IC4B 5IWAJ 3HZEA 1IKWB 1O0PA 2P9CA 2KG1A 4DV0F 3SZ2A 1CPZA 4DV2F 3GIRA 2OPQB 3FBEA 3H8YA 3IBCB 2ZHBA 1YLXA 2AJ4A 4C8KA 4PXEA 2AEJA 2DR5A 5E3QA 4JI4J 1R0CB 3BSOA 1SL1A 4YN3B 2AYBA 1DTQA 5C42B 1LWXA 1HBUA 2ZH2A 1XMBA 4JI6F 3M9NB 1WG5A 1KKHA 4IOBA 4KIAA 2BKOA 1T95A 1MWZA 2V2ZA 1X5PA 3AAWB 4WKYA 4X64F 1YRTA 5CZVA 1J5OB 5B0GA 2HG4A 2H3EB 4OYPA 1WHYA 2M3DA 5KFEA 4ILMA 1TL5A 5B08A 4B3TF 5K5MA 2KN4A 4KT0C 2ZITA 4LFAJ 2F8HA 3M8PA 5J2PB 1IBLF 1HWJA 3MEKA 1D1UA 3BBCA 5DDRC 3C14B 3IFEA 4OZ1A 4PKDB 4QIVA 1WHXA 3I55S 2BV3A 1X4DA 2VG7A 2CPDA 4WFNQ 4ED1A 2DR9A 1KS2A 3A8EA 3T9NA 4NLWA 2BANA 3GJRB 3H2VE 5I3UA 4KGMA 1JLBA 4ZITA 3I32A 1GTHA 2C3MA 1M5HA 3FKBA 1OSCA 2M0GB 4ZS6A 5F3TA 4ZCMA 2RMLA 3VR1A 3CO9A 3EPGA 4MKYA 5AE2A 1AZSB 3ZZ0A 3MDFA 5KFJA 1U1PA 1R6YA 1Y00A 4DR6F 3BGRA 2RNEA 5K14B 1FDBA 3PDNA 3GFXA 2R7RA 3M2VA 4PWWA 4DUTA 3BYPA 4KC5A 2ILZA 3JTNA 5A8RA 3Q2TC 3CCWA 3PJ9A 3EVWA 2ZJPQ 5J2NA 1QE1B 1OQ3A 2DHGA 4F3MA 3R5AA 2PIIA 3RB4A 4WPAA 1C0TB 2R7OA 1RU2A 3CJ2A 4UZBA 4B9VA 3W61A 2IRYA 2RT3A 3EGNA 3RRKA 3PNIA 1HMVA 2E5HA 1FTCA 4IFYA 5LT5A 4B9LA 1HBOB 5IT9U 2MKYA 1RHUB 4OV6A 4CTAB 2J5AA 4NCGB 4DPUA 2OEKA 3N01A 4KPCA 4WBFA 3HVTA 2C2KB 3A3OB 2WZ1A 4JV0A 1HNZF 3P6YC 4U96A 2RRBA 2MHEA 2MQOA 2J9EA 4O4RA 3N5FA 1VC0A 1NXIA 1RHMB 4XDCA 3KLVA 2Z2MA 4K4SA 1MSWD 2C1EB 2CPHA 3MR3A 4WTYA 4LRBA 2FHMA 2QIFA 4IDKA 2IAJB 3HXMA 5GADU 1A9NB 3OFGA 1B0PA 4ED6A 2Q6CA 1FRXA 4PG5A 5F8LA 3CCES 2HVEA 4DR2J 2J6UA 1GXUA 2F8MA 4YFUA 4WP9A 1Y7PA 4O3OA 3MD1A 5T7LA 1H3DA 1BQMA 2V0NA 4DR5J 2AJ1A 3S1TA 3JQKA 3DM2B 5KFNA 4Q44A 1XJWB 1OPIA 1PC4A 3LGNA 1Q1KA 3EZUA 4M5DA 1K1QA 3T41A 3QQCD 1UEUA 5K20B 1UWBB 5HATA 4C8YA 1TL7A 4PUOB 4BHQA 2XHCA 1P27B 1ZTWA 4NLSA 3WX4A 4Q43A 1UVKA 4EZ6A 5C24A 2XO6A 2A1BA 1RAGB 2ZM6J 2JJ4D 4IG0B 3VZHA 1SPBP 1YSJA 1Q16B 1S9GA 1LOUA 3HVAA 4WWSA 3OXGA 5LM7E 3Q8SB 2HGNA 4DV4J 1LXJA 2J8SA 4OI2A 1NJWA 2HHPA 1TUWA 4LRFA 1RT7A 2MKJA 2QX0A 4OYIA 4JI0J 1RK8A 2QA2A 1NZ8A 4EWTA 4K4XA 1RT4A 2FYXA 1HNIB 2YWEA 3N6MA 2DXEA 4JUZA 2EFNA 1ZM9A 1GT8A 1ZZFA 1AFJA 3BSCA 5HAOA 1OY8A 1LW2A 2WCXA 3G82A 4U7UK 5AXLA 1OQ6A 3HT3A 1LFWA 4XK8C 4DFKA 5FD1A 1WACA 4E8UA 3SQGA 4P71A 2MGZA 5J2QA 1IBKF 2J0XA 2O67A 3NS7B 4QU7A 5KG5A 5LJ3Y 3I5CA 3QYYA 4X4TA 2C2ZB 4QQBA 1RHQB 2LEBA 2BXJA 4LF2A 2DEIA 4USHA 3TZZA 4ZCLA 2V94A 1RDRA 4CT9A 5DLFA 2KFNA 3Q89A 4ZPAA 3KOAA 1RTZA 4FPRA 1BY9A 5D78A 5LJ5Y 4YQWA 2E1MC 2NXEA 2UUTA 1SJ3P 3DRPA 2ZUAA 1AUSL 4FDFA 2EFVA 5IM0A 3GIMA 4B3OA 1XN9A 2FUG9 3F56A 2XULA 1S10A 3H59A 3ILLA 2JVRA 4OI1A 2FLPA 4LF6F 1ACMB 3JQJA 1VBYA 1FKPB 2XMWA 3ETOA 5CABA 1SJ4P 4HH1A 1S0MA 3LF0A 2V4RA 1QSYA 1CVJA 4M5MA 4UUWA 4NCGA 5HSPA 5EGYA 4N8OA 4G1IA 2G2ZA 4CZCA 4CCHA 5EX0A 3MD3A 1XIQA 2Z56B 5IV3A 1RTDA 5L1KA 1RT1B 2KT5A 5D4LA 1KVIA 4FZVA 4B3SJ 1JLBB 5IFMA 3CGIA 4AXJA 2R8IA 2E9ZA 1N5YA 2MLXA 2Y3YA 4YR2A 1T9TA 2KHCA 4WIIA 1XR5A 3SSSA 1M5PC 2DTJA 1RT1A 2NUHA 4O23A 5D0RA 2OLWA 2V67A 3F44A 3ADAC 2C2NA 2WK4A 2PD1A 3AOBA 3B8HA 2AIRB 5GADI 4X4RA 4K4WA 3PFEA 2VA3A 4A8XA 2DGTA 4WFAQ 1XC9A 2HNDA 3PHTA 5B0DA 2XS7A 3TA2A 3HLUA 4NLYA 1NB7A 3TA0A 4MK7A 4LSLB 5KFGA 4LQ9A 4KFBB 4TN2A 3S6EA 4DUZJ 4F4WA 3MMBA 1Q78A 1ZH5A 1UJ6A 3P49B 3C8YA 4ILRA 3PYDA 4RW6A 1FD2A 2ZBRA 3IA0A 3PYEA 3FFIA 4LSLA 3T1HJ 1HHTP 4A8FA 3TQEA 2FB0A 8RUCA 4OYAA 2JH3A 3IRXA 3D6MB 4B9MA 3T19A 2K3KA 2VBXA 3ONQA 4NE9C 2DNKA 2CQPA 2F63A 2KXHA 4ZK7M 3HJVA 4I6AA 1NKEA 2B4PA 3H5XA 5HJYA 1FE0A 2VG6A 2KH9A 1B64A 1HKAA 4XO0A 3W9IA 3BSNA 3FK4A 1UKUA 4A8WA 2ZDOA 3FSXA 4FBUA 4BC9A 2AF6A 2NXUA 3DI6A 3I31A 1KWMA 4NA1A 4WU2A 3RAXA 2R3VA 2H4WB 3OLBA 2HBZB 4RW4B 3JYTB 2CZ4A 4YB5A 4Q2MA 4CO4A 1ULRA 3NMRA 2XSJB 3V6DA 1KQSR 4PXDA 2NXJA 4DL0C 3SV4A 3CJ0A 1BXNA 2ZC3A 3U7JA 2KM8C 3TAMA 3PM9A 4J9NA 1BQMB 4DPWA 1YRUA 4M5NA 3WDOA 2WRMA 2FZCB 1R89A 1R7IA 4DPTA 1YHQS 3MOJB 4X2BA 2CPEA 3PO4A 1G6BA 1DLOB 2HRUA 9ATCB 2HVDA 3AJ1A 2GAGC 2RD5C 4O3SA 3VGSA 5HQLA 4KO0B 2K7KA 3JTPA 4ITSA 2XNQA 2KM8B 3JAMY 1EJ7L 2B9EA 2QA1A 3BGUA 3HFVA 3AJ2A 3IM9A 3RZAA 4N56A 2FHKA 2EFQA 2XG8A 1VQ4S 2R7TA 4YS2A 3ET6B 1NK8A 2DITA 3GTYX 1Q8BA 3R2DJ 3CJSA 1UW4A 2DHAA 2H65B 1LXNA 2ZNYA 1RWKB 5HBMA 1TTHB 3JSMB 2QA4G 1T7PA 3HHNB 5KOXA 4KY3A 1N5VA 1VRQC 1NK7A 4X65J 1YBAA 4B3RJ 2ABYA 4LREA 4LRDA 3SSQA 2ADCA 3OHBA 4R25A 3FEXB 3KK1B 5DG7A 3QRPA 2VA2A 3G82B 5HMYA 1RLCL 1W25A 2LA6A 2VFSA 4OX6A 1X4FA 4NXNJ 2AMCB 2W9BB 2Z2LA 1YI2S 3CSKA
chains in the Genus database with same CATH topology
2APOA 4QPXA 4Y2KA 1HNWF 3CC7S 2DGQA 5AE3A 1XR7A 5AJ3F 4OJ3A 2NYIA 1HA1A 3UI3A 3LH2S 2DGSA 1D9DA 3TYTA 1VQYA 4NX9A 3KFWX 4OQJA 5J2MB 1IQTA 3L09A 2JEFA 1KRPA 4JI3F 5LL6d 2YKMB 2F1FA 1YGYA 5K9FA 2M7SA 3CC2S 2MMYA 4OX7A 2LMIA 4AE5A 4OZNA 2N4DA 3ISZA 1B7FA 1RKIA 2XEXA 1S6QB 4ZMMA 4C3MA 4ZPVR 4OZLA 3V6HA 3W2VA 3Q0AA 5KG3A 2M8DB 2GMLA 4CIOA 3R5BA 3C2PA 5GMKa 3N0VA 2CPYA 4FXWA 2RH3A 4QU6A 2CPXA 3Q23A 1JJHA 2CQHA 2XMVA 3M8SA 1HBMB 5AXNA 1CC8A 4W90B 2XMKA 3SXLA 3POTB 2FGCA 4IDKB 1UJ4A 2EG1A 4DQSA 2XS2A 3M1VB 3MMCA 4CT8A 1R8CA 1YVFA 1N88A 4K5SA 2JLGA 2Y1JA 3NCPA 2JL9A 2OIHA 1UA1A 1FA0A 4NOHA 4QIEA 1VIXA 5IWAF 4H4OB 1KR4A 1W2IA 2XLJA 2C3YA 1FCAA 4USJC 2QA4S 3VAFA 4HTJA 1TK8A 3TP2A 1RYSA 4IO1A 4B3SF 4YUDA 2AW0A 2OP5A 3TR5A 1SUQB 4LIWA 2WW8A 1VQ8S 3UD3P 4P6QA 3THPA 2AGQA 2BUNA 2M8HA 3NL0A 2DGOA 2YX1A 4RW9B 1YWXA 4UQTA 2FY1A 1H7WA 3ZZUA 1MMNA 3FNNA 5C24B 1TP7A 2WBRA 4RZRA 1DTTB 3M30A 3KK3A 3RB0A 2ZUGA 2R7XA 1M5KC 2KZMA 4JV2A 5F8HA 4K50A 4M5DB 1FNXH 1JLQB 4L72B 3O8WA 4C98A 2NR0A 1FK9A 3QZ7A 3PX6A 3CDAA 3OFHA 1VOMA 1QSLA 4PUOA 2L3MA 1U48A 2X1BA 2UVVA 3C6TA 5DETA 4ZDNA 3MAHA 1U1KA 2OPRA 1S9GB 1J5EF 2R2RA 1HHSA 5DG8A 2XLKA 1WEYA 2D3UA 2KKHA 3K8WA 1S1TA 5M2PA 3M05A 1UP1A 2FTRA 2POKA 4NYOA 2J8AA 3HVWA 3TVKA 2D3ZA 4I2QA 2OPRB 1CEZA 1IKVA 3KNAA 3C6UA 1DRZA 4Y6IA 3MEGB 2NQPA 1LWEA 1CC7A 2MZTA 2RU9A 5EUHA 2ZH8A 5HROA 1M1KT 3PX0A 3IAM9 2FJDB 2VG7B 3RU0A 3GV8B 5DS7A 3MM7A 4X66F 2D3OR 2W4PA 5GVQA 4DX8H 3SFGA 2AYGA 1VQMS 4JI0F 2GQQA 4I64A 4DQRA 4ETZA 3IS9A 1T8EA 1HBUB 2HAIA 2DGWA 1REVA 4ED7A 3JSYA 3PEHA 1K9MT 3WBZA 2RU3A 1M5SA 3UE2A 1FKOA 1VQOS 5D3GA 2MSSA 1HBOA 5KFSA 1TAUA 3MOZA 2RQMA 1U49A 2VPZB 3HPOA 2GCFA 1K1SA 2PE8A 5AXKA 1FDDA 1S7HA 4IH5A 3PW2A 1HNZF 4P7VA 2UZAA 2KG0A 4Q0BB 2ZBCA 2E9TA 2CQ1A 4F8RA 4ES2A 2B4UA 2RS2A 3V6JA 4DR2F 5CCLA 3KJVB 3PIPQ 2ZH9A 5DM7Q 2J0SD 4NLOA 3QIPA 4BWJA 3CCSS 2B56A 1L3VA 1ZM2A 2VOPA 4QBUA 4ZP7A 2JVOA 4RNMA 4MIBA 3WZ0A 1DZ5A 3KJVA 4M95A 2WTFA 4GKJF 1IN0A 2C3OA 5J1NA 4DV3F 1C4AA 4OMFG 1HI8A 1JXEA 2FJEB 1L3KA 1HD0A 1H7XA 2B3TB 4ZKAA 4YR0A 3MECB 4IR1A 4OI4A 1FESA 5CXTA 3N6NA 5F8MA 3BB5A 1FKAF 4KFBA 4HTIA 4RWXA 3Q24A 2VD3A 1S1XA 2ZH6A 3KK2A 4ZVEA 5EN1A 1KOOA 1LK7A 2ZNZA 5CH7B 3OHAA 3GB0A 1ZOTA 4TXSA 5IS2A 3CT9A 1DAXA 1GX5A 1QAIA 4C8MA 1U1OA 3KWMA 2VONA 2RSQA 3PW7A 3GFYA 4ID5B 4PPZA 2G9OA 3EPIA 2PA3A 1NJXA 3NP5A 3P96A 3OTOF 1WF0A 3QJLA 1W2BR 3I4PA 3ZC4A 2UV8A 1HQUA 1X4BA 2ZBIA 3TVZA 3BSAA 4URSA 5B0BA 2ZH3A 3SDEA 4NRTA 5HI7A 2MKSA 2YKNA 3VAIA 4F2RA 5KFFA 2W7OA 1UVIA 1XERA 3DYAB 1E6YB 1GXLA 3QLHB 3J7YU 1FVSA 3RB6A 2UUAF 1UWBA 2Q43A 1X4GA 4E0DA 2U1AA 1FTRA 5IT9Y 1UVJA 2KDOA 4JBCA 4OZJA 4BBYA 2K1RB 1R27B 2LXFA 5B7WA 3P5TL 4ICLA 2GIRA 1P8GA 3TARA 4K0KF 4OJHA 1HARA 3C6TB 2V8VA 4R8UB 3M2RA 3CD6S 1GXTA 5JVGQ 1AUDA 4ES3A 1AW0A 4Y2AA 1GQEA 2Q1LA 1YTYA 1KSPA 5BYSA 1S0NA 2L9DA 5E3RA 3GIIA 4RBUA 1N6QA 3CIZA 1KLMA 2AYMA 4DV5F 1HD1A 4I68A 4YB6A 2RQKA 4WJBA 4YDDB 5GAGI 1RISA 3A1YG 2HHVA 2M2BA 1NKBA 2MZRA 5M2UA 4DJBA 3MM7B 2UUBF 3AH6A 2JFKA 5ADZA 3X1LB 4Z37A 3KLHB 3FRZA 3CJ4A 5E3PA 1RA7A 3IR7B 2CQBA 4EBEA 2GNKA 2J0QD 2JX2A 1VGYA 1JJ2R 1X9MA 2Z0GA 3UNGC 1QE1A 2ZOGA 3BDPA 1FRKA 5GAHI 3HDSA 1C0TA 4I4BA 2ZZMA 2DHXA 4I6WA 2KHDA 4QU7A 2JDJA 3HM9A 1TKXA 4FXDA 2BE2A 5F0UA 2EKYA 2QZ8A 2HFOA 3CXCR 4P7TA 1OIAA 3MWBA 3VAHA 3BQ0A 1JNZB 1NO8A 2BJEA 2N4CA 1FKOB 4FP9A 3S01A 3ZZPA 3IR5B 4DQQA 1RP5A 2CJKA 3W2VB 3GYXB 2YQ3A 1N33F 4ED0A 3HO1A 1NHUA 1X9SA 5KG6A 3MEEB 3OL9A 4Y3CA 2OKQA 2N3LA 4MJKA 3NCRA 2XCPA 4DUYF 1BD6A 4NLUA 1I94F 2LQJA 4KV8A 2ROEA 3AB4B 1SL0A 1NK9A 2ATLA 4RW7B 4F4XA 1NZAA 1R0AA 2DVIA 1S0OA 3PFOA 4RNFA 1ZZNA 2V4QA 3M1VA 3MMCB 2YX4A 3MR2A 2WOMB 2VUGA 3PRBA 3G6VA 3I6PA 3QWUA 4K4ZA 1RT2B 1KN6A 1V3ZA 4OX9F 5K8PA 4OZ0A 4Y28C 3DLHA 1U24A 2GQCA 3OXLA 1JWWA 1HYSB 4F02A 1RGVA 4IOAQ 3R5DA 4IKAA 3PX4A 4OV1A 3PXGa 4A8KA 4Y2IA 3SMZA 3MR6A 4QYZJ 1JLAB 2OD6A 3RBDA 1YJWS 2IM1A 4FNHA 1VLYA 3T3FA 4KPYA 4ECXA 3ISND 3KHHA 1RT4B 4ED8A 3RBEA 4A47A 3LPYA 2KT2A 2J6TA 2CQDA 4RW8B 1LW2B 4ZHRA 4ZP8A 1JLFA 2R8KA 1FJ7A 4RNOA 4KHMA 2F9JA 1XR6A 3OUYB 4J5OA 1JLEB 1S6OA 2LEPA 4EFAC 1U1NA 4BDPA 4UW2A 3CD5A 2MKIA 5KG7A 4QJVA 1SQEA 2MZJA 3RAMA 3SDEB 4DMZA 4LF5F 4KB7A 1QY7A 1D9AA 5KT2A 3KG1A 1IUJA 3NBPB 5LSOA 5KFKA 2KXNB 1WTBA 4RWWA 1QVFR 1KTQA 1UFWA 1FXDA 2EFOA 2FLOA 5D4PA 4EBDA 4AL5A 5J1EB 3BS9A 2ZZNA 4WF9Q 4MFBB 4C0OC 2DNNA 3HHEA 2W9CA 1UVMA 3M9OB 3TW0A 4D3GA 1TL1A 5FLXY 1HNVA 5CYJA 4DEZA 1WI8A 4EYHB 4TQRA 1U1LA 2ZOFA 1I6JA 3M2RB 1NRKA 1HNVB 3OTDA 1TAQA 2E29A 2GHVC 2IM2A 2A2DA 4C9DA 3N9UC 4CTAA 3KLGB 5DRKA 3VAKA 4B9NA 3H20A 2V9WA 5F8IA 2OTLS 3IG1A 4UOCA 3VAJA 1AROP 4CH7A 4HH0A 1Z1ZA 5CYMB 1RQ0A 2YNFA 3IG1B 1S1UA 3IXQA 5JXSA 5DO2A 2E66A 1WELA 2KI2A 2N7YA 1FO1A 3GYNA 2YNFB 4OLPA 4V19X 1N48A 4HEA9 2R8GA 5M2RA 1VC5A 3OR1B 2HLTA 2MQPA 4RBTA 3MM5A 1S6QA 3NNHA 1Q8LA 2FPHX 3IRXB 5E5NA 4B9SA 4HDGA 2MB0B 2KB2A 2C2EA 1QAYA 3KG0A 1DTTA 2W7AA 2YTCA 3MHYA 4DL2A 2HHHF 2HVHA 3PKYA 4OI3A 2EK1A 3IWNC 3KHLA 2QLXA 3BM7A 3HP6A 2DPIA 1NK4A 1QLNA 2CQCA 3FFIB 1EETA 2CVIA 4MYUA 4ID5A 3DRYA 1X9WA 2NLWA 4IH6A 5CZXA 1RTJA 4KR0B 4OL8A 4ID8A 1TZ0A 2X1AA 3G96A 4MIWA 4DFKA 1KC8T 3OR2A 3X3UA 3JSMB 3B4MA 4C8LA 5H1SV 1C1BA 4HDHA 5HMXA 5LSLA 2A2CA 3UDLA 1NH7A 2CPFA 1T03A 4RBVA 1UMJA 2ZHAA 2IBKA 4TU7A 2CFXA 3NMAA 3M6UA 2XMTA 1TV6A 3QGIA 3AA9A 1SL2A 3QLHA 3K5PA 2HHXA 4QPTA 4C0BA 3GQCA 1FVQA 1SJFA 5EWEA 2RIJA 2YWGA 4J9RA 3TQ1A 2JC0A 4O4GB 1HL6A 3ITHB 1TK5A 2O01C 4MK9A 4RLEA 3HK2A 4J9KA 3DOMA 1TFYA 4EZ9A 2K1RA 4IFVA 4U9RA 5K8MA 7FDRA 2Y1RI 2W8KA 3OTCA 2IYIA 5JUMA 2ZJRQ 3OW2R 5KFYA 2HHUA 2XY5A 2D9PA 2JZ5A 3OQ2A 3H5SA 4PPDA 4C3KA 4BC7A 2MKCA 2FVPA 2JLEA 4WK3A 1RT7B 4NLVA 2ZJQQ 3NWGA 4IQMA 4OHZA 2YNIB 5C25B 5HLFB 1WG4A 1SH0A 2DK2A 2VBWA 2VBYA 3OBIA 2L41A 1U1MA 3TVYA 2RDIA 3TX8A 4ZA1A 4YEAA 1S1WA 4A8YA 3ENQA 3BO2A 3CJKA 4C97A 2YX7A 1R8HA 3EYZA 5DQIA 4ECZA 1BC6A 2VFVA 3H98A 4TYAA 1UVNA 2J7UA 2I1RA 4EO6A 4QCLA 3W2WA 4AUKA 1RT5A 2DNGA 2WONB 2GIQA 2GQ2A 3M8QB 4MYTA 5DGBA 1QUPA 5L1IA 4NCAA 5HN0A 2XS5A 4A8QA 1IKXA 3HKWA 4UY8T 1FRJA 3W2WB 2YNHB 4IH7A 4M1KA 4NWBA 1FEHA 5KFUA 3TANA 4O44B 3KLHA 3S7RA 3RB3A 5KFBA 1RWUA 3G86A 3OJSA 2Y1IA 1FXLA 3O5TB 1N36F 4YHHF 2HVIA 2F3JA 4ES1A 1ZM3A 1ZAWA 1Y5IB 2PEHA 1JX4A 3H4DA 1LW0B 1K8AT 2DT9A 3BF4A 3HHLC 4UQGA 1IBMF 5B0EA 1JIHA 5J2NB 1N0VC 1ROFA 2KO1A 2Z8QA 1DQ9A 4RNNA 4GO5X 3DLKA 4QIGA 3DOKB 2W4CA 2OPPB 1JK9B 2PO4A 3FRYA 1DJ0A 2CZVC 1IKYA 4MMOA 4I67A 2VQEF 3GIJA 1Y0HA 3OLAA 5ITHA 1S76D 2EFGA 3C66A 5KFCA 3LANA 3UCZP 5I42A 3IBWA 3O3LA 1KONA 1S1UB 2VC1A 2FC8A 5FJ4A 3FSYA 4BCAA 1DBDA 2IAJA 4DSLA 3FJ2A 2O5DA 2LDIA 3NG8A 4A8MP 2QMXA 1HYSA 4H4OA 5K8NA 3MMBB 1P9QC 1HFEL 5A8WB 2LQ9A 2MZSA 1CSJA 1SH3A 3OVAA 4TLQA 1H6KX 2FC9A 5D6GA 3SCJE 4EU0A 5BJRA 3HHLD 1S9FA 2MDAA 1KLNA 2XZWA 1O8BA 2VFUA 2OPQA 5SUHA 2KTQA 4TY9A 1VRTA 1EETB 1T05B 1X5SA 2CDQA 5C42A 1TKTB 1KHWA 3FQKA 5JJBA 3AQPA 1VQPS 1V6HA 4QWBA 3CC4S 4B02A 2R7UA 2UV8G 5F8GA 1N56A 1H2TZ 2CPZA 2C28A 4GMKA 3NKYA 4F4ZA 2LQBA 3NAHA 4O3PA 1WF1A 3DFEA 1N52B 1HI1A 4USIA 4ZHRB 4QOTA 1HW9A 2CQ3A 3NRBA 2M5YA 2LDYA 1JLCB 1U45A 5DGAA 2UXDF 1MROB 3OUYA 2ROPA 2K3IA 3RYLA 3DLLQ 2AJQA 3UPFA 3T9ZA 4C4WA 4X4VA 4O4GA 1FJCA 2JRSA 5L1LA 1S9EA 1MWYA 2BYCA 2O3DA 3N6LA 1XMOF 3HKZD 1IKXB 2IM0A 2KRRA 4DQIA 4ECWA 2XMMA 3GFHA 4Y0FA 3DRPB 3FZ2A 5H9EJ 4L3NA 5IM0B 2DNRA 5DDQC 2N3OA 3UWTA 1SV5B 3QZ8A 1EP4A 2BJDA 3D1QA 3V6KA 3T5KA 1OPZA 4F50A 3CPWR 3FVYA 4YDXA 2MQMA 3EX7B 1VQ4S 2P6TA 2UUCF 1YG0A 1FF2A 1B0VA 1PGZA 2PGCA 5IT4A 2BQ3A 2MPUA 2RILA 3K59A 2XHWA 4FF4A 3JSRA 2FDNA 2ZC4A 2GMJA 3UR0A 1N6QB 3QAUA 4ERDA 4AXIA 2XY7A 2DISA 4QIWD 4D3HA 2VODA 2NS1B 5D77A 2GFFA 1HR0F 4TKTA 5E3CA 5EWFA 1T3NA 1X4AA 3E01A 1IKYB 3MM6A 2DBBA 1KNZA 4G1QA 4WCEQ 2DCLA 4ZPTR 5E7OB 2ZD1B 2FHJA 4PCQA 4ATNA 2HNZB 1S72S 4DSJA 4IOCQ 3SCIE 2RRNA 3FGVA 4DL6A 4MAKA 3DLJA 3D0GE 4XAKA 2W9AA 2YKAA 4PWUA 1YJ9S 3GR0A 3HHLB 4WZMA 4I56A 1S49A 4GKKF 5E2QA 4QWEA 1YITS 4I69A 1U6ZA 6FD1A 4KSEB 4DWIA 2RS8A 4B3MF 4OI6A 3KTQA 1KEKA 2X1FA 2XCAA 2HNYA 1Q7LB 5A0YA 1ZAXA 3OR1A 1U1QA 2G1DA 3PRDA 3QO9B 3PZPA 3IO1A 3J7Z5 4URGA 1FDNA 2HHWA 4Y65A 1NJIT 5L1JA 2J7WA 2IC3B 1RTJB 2IRXA 2LA4A 1X4EA 1C1BB 5EDWA 2JEIA 1LV5A 4DS4A 2VKRA 3UFCX 5KOWA 4CO2A 1SKRA 1XMQF 2XWYA 2OFGX 4NLPA 4C0HA 1RTIA 4O0IA 4H4MA 2BA9A 3CMAS 3SSRA 3NS6A 4GC6A 4X84A 6FDRA 4A8SA 1Q7YT 3OR2B 3JSMA 3CWJA 3U1NA 2DHSA 2ERRA 1RT2A 4LF8F 2YH1A 4NCBA 1APSA 3SQGB 3D54A 1QUVA 4DLEA 2E1RA 4DR3F 2BDPA 4DV6F 2VPYB 2RKIB 4NYZA 1VJWA 1VRUA 1C0UA 3PY8A 3M4XA 1TQLA 3PJXA 4KE5A 3RRGA 3BREA 2HRYA 3IWLA 2R8HA 5D8HB 4KQZA 4K59A 2IA0A 2DNOA 1GX6A 4B3RF 1X5TA 4X62F 1IKWA 4PR6A 4DFMA 2U2FA 2MKHA 4A48A 3SCLE 2LYVA 3DLBA 3MF5A 2R2UA 5DLGA 2W7PA 4LFCF 3K7RA 4ED5A 4F4KA 4U67Q 2NPFA 5IQ6A 5HLFA 1FKPA 1M0SA </