4FPRA

Structure of a fungal protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
AYVCREASISGEIRYPQGTCPTKTEALNDCNKVTKGLIDFSQSHQRAWGIDMTAKVQCAPCKTTDPWDVVLCTCKITAHRYREFVPKIPYSSFSSAPGVIFRQETGLDHDPEWVVNMKARTRGCDHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avirulence Effector AvrLm4-7
publication title Structure of a fungal protein
rcsb
source organism Leptosphaeria maculans
molecule tags Protein binding
total genus 29
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2910 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fprA00
4FPRA
chains in the Genus database with same CATH superfamily
4LF7F 2QEXS 5H9EK 3QATA 3R7BB 2FVCA 4DR7J 2VF3A 3SEOA 3PO5A 1HKAA 2DNNA 3F41A 4F25A 3FQLA 4JOUA 4GKJF 3M6UA 1IWGA 2ZJRQ 1Z2LA 5GAGU 5DZ6A 1H3DA 2ZVIA 1NXIA 1WJ9A 1LFPA 2UP1A 4F7VA 4QW9A 4YN3B 3AJ2A 2Q66A 1XQIA 2KT5A 1N4LA 4EYHB 5L9NA 4DV5J 2LXFA 2L9WA 1WHXA 2GVDB 4DBQA 3RB3A 3DLGA 1R7IA 3NMAA 3ZTPA 3IG1B 2QO3A 4KGKA 5C5JA 3FSIA 2EK6A 4LIWA 2DITA 2DXEA 3CD5A 3LAMA 1VYAA 1X4AA 1XNRF 2Z58B 3SQOP 1VC5A 3J7YU 4P10A 5KT6A 5GAHU 3H7HB 3KUHA 3QLHB 2ASYA 1WWHA 3GE9A 1UVMA 2EW9A 4B9LA 4IR9A 5C25A 3DMJB 2O01C 2AYMA 1RT4A 1ZH5A 3CXCR 3PKMA 1PBAA 2VFSA 3QT7A 3MM8A 2JOQA 1OPIA 5HJYA 3D66A 2LEAA 4MKYA 1FNMA 2DR5A 1UTAA 2J0QD 1KP6A 2MZRA 1NH7A 1RTHA 2R2UA 2KT2A 1Y5NB 2VKRA 2HQ3A 5CAAA 2ROEA 4LF6F 3O6QA 3M9NB 5DG9A 5B0GA 2A0FB 1YSJA 1T0TV 2ALYB 3H42A 2ZD1A 5F8GA 2B8PA 5CXTA 1RT6A 1VQ4S 5HMWA 2RKIB 3P5BP 2F8MA 3DU5A 3M8PB 5IT9Y 2J7UA 2KJWA 3HVTB 2CA9A 5JVGQ 3TX8A 4KHMA 1AFIA 3BO2A 1R8HA 4NZ0A 3VR1A 1FKOB 3N01A 2B9XA 4CNYA 3ELHA 2BE2B 2YKAA 4C8OA 4CLSA 3OVBA 3MECB 2D9OA 5K14A 2PO4A 4DCPB 1M1GA 5IS2A 3IWXA 1KEKA 2CPHA 3ZTQA 3RRHA 2CQBA 2NUHA 1RKJA 5C2GA 1D3WA 1RAEB 2D1CA 2YX4A 4C8MA 2ABYA 2LDYA 3RGIA 2B6AB 1RHKB 1E6VB 1BE4A 3BN7A 3N0VA 5CYMA 1WC0A 2AW0A 4NOHA 3TA0A 4C8LA 2C22A 2ZDPA 2VG6B 2FHJD 3PYGA 2KI2A 4YUDA 5DDPC 5ETKA 4CLWA 5I42B 4N8NA 3RAMA 2QA4G 4MKVA 4LFAJ 4ECWA 2AJFE 3MEGA 2K7KA 3N79A 3AB2B 2HVIA 4LSZB 2XGQA 3QBCA 3KMSA 2OPRB 3UCUP 5HROB 3DRPA 3MPVA 3BPSP 1AXQA 1HQUA 2WVFA 2G0IA 3EXCX 5I3PA 3WX8A 3LWMA 3PIPQ 4ELUA 2BKPA 4YB5A 2G2YA 4U96A 3NMRA 2Z8QA 2VBYA 1VQMS 4ZVGA 1FD8A 2DPIA 3K17A 2FGCA 2JZ5A 2BR0A 5A0YB 5H9EJ 5HQ8A 4DL5A 1SH2A 2QSWA 3CJTA 4WP8A 3DOKB 3IN5A 1N34F 1LXNA 4DR4F 4FS2A 1DTQB 5G0RA 2V68A 1S97A 3CE8A 3D4JA 2IM3A 3KLHA 1RBOB 2XEXA 1T9UA 1VJQA 1WG4A 3LGHA 3ZXWA 2KL8A 2WCXA 5B0BA 3GP9A 3R3TA 4CO2A 3MM6B 4YDXA 2OD4A 1EP4B 1IKYA 3VTIA 1WNEA 1NPKA 1G2EA 4LF4F 3BBCA 3PEJA 3GIJA 4A8KA 3P3DA 3KG1A 2LCWA 3KXDA 5D4NA 4X4PA 5F9LA 2E1AA 1HA1A 1HBUA 3AA8A 1SKRA 2YNFA 2BJ9A 4HH0A 2UV8G 2C2KB 2CZ4A 4KY3A 3DGPB 4XDCA 1RABB 3CC4S 3D3BJ 2W7PA 1JJ4A 5DLFA 2IBKA 3RTVA 4GKKF 2MQPA 3W5XA 1HHSA 5J2QB 2CQ3A 4HLBA 3P45B 1HR0F 5LMUF 4DMZA 3VAIA 2HBYB 1HWKA 1RT3A 2N4CA 1UFWA 1WDDA 3IA0A 5SUHA 4ER8A 2HFUA 5E3AA 4U67Q 2BJDA 3MR6A 1TK5A 2DO0A 1Y3JA 4I4BA 2ZFHA 2IDLA 2CPIA 1RU1A 2B5JA 2HK2A 2OGUA 2CKWA 2EC2A 2KXNB 2BOAA 1L3UA 2YPYA 4LMZA 2H5EA 2V69A 4W92B 5E41A 1NM2A 4C98A 1S57A 3HLUA 2DGVA 1VISA 2SXLA 3PM9A 3VV2B 3CSKA 4LF6J 1UWAA 2UU9F 4X4UA 3C2PA 4Z7CA 4DR3J 1NK7A 1AT1B 2QX0A 4JI0F 4CLTA 3DCAA 1TK8A 4YEAA 1OWXA 3NGSA 3I0RA 3UDVA 2KU7A 4ENOA 1NK5A 1SB6A 3MD3A 5KFLA 1I5OB 3KLFA 4N47A 1JLAB 1KLMA 3BR8A 1RAOA 3TANA 2RAQA 4A8OA 4ED3A 5CYQA 4RZRA 1LEOA 4LQ3A 2MTLA 1PIEA 4P74A 2ROGA 4J5OA 2XTJP 2E5HA 1S1WA 3J7Z5 5KOWA 2F4VJ 5IQ6A 5DS7A 1OYDA 1UFKA 5FIIA 4A46A 3SDEA 1NSQA 3PO4A 4CLZA 1EARA 2WSCC 2MZSA 3M6XA 4WK1A 4P7TA 2Y8YA 1X9SA 2QSFA 2GHVC 2B7CB 3IFEA 3WDOA 1VQLS 3SQGB 5J2NB 1U2CA 1FA0A 2M9KA 2KXHA 2DIUA 1S9EA 2KVQE 4A47A 3BDEA 2AX0A 4G1QB 1HHQA 2GQCA 4WFAQ 2DXDA 3DYAB 1C1CB 4OJ3A 4ZJOA 4WJBA 3T3FA 3I4HX 1WTBA 2OD6A 3MOZA 4CLUA 3QFHA 3IRXB 1RT1B 2GGPB 3IR6B 1D8ZA 2LEPA 3FBBA 2CWXA 2AEJA 3AQOA 2LQ5A 1OIAA 1KVJA 4E2FB 5ETMA 5IFMA 4C8NA 2WB4A 1RWNB 2P9EA 3MMCB 2ZBIA 1XMQJ 1CQNA 3TOQA 5DDOC 1DY3A 2VC1A 2YNGB 5KT5A 3LF0A 3MR7A 5K5MA 4NCAA 4CH7A 4ZCLA 3MAQA 5ETTA 1J5EF 3FSYA 2FJWA 2FJBB 3HT0A 4ZVPB 2D7SA 3PKYA 5KFDA 1HMVB 3R7NB 4X64F 1HWLA 5HSPA 1KDNA 3N6NA 3F0NA 2R8JA 3O1LA 3S8SA 2MKKA 3L7OA 4M94A 2FD2A 1XERA 3DI6B 4IRDA 4CYUB 1L3TA 4CLKA 1UJ5A 1Q8KA 1LQ9A 5AXNA 1E6YA 3FC9A 5A2QY 2EK1A 2WSFC 5IV3A 2UXBF 3T5HA 5FLXU 1FNOA 2R7SA 1WHWA 1SIWB 3GJQB 1CJUA 3TJ8A 3O8WA 4S0MA 1T8EA 3R5CA 3BZQA 3I6PA 3SIPB 5B7WA 3OFFA 3JAMU 3FMBA 1KD1T 3CVKA 1N32J 1RAIB 4URGA 3QJJA 5D4LA 1ZZFA 3RBEA 4A48A 2E9TA 1VC0A 1NLKL 4KFBB 4USUA 4YFUA 2M52A 1PO6A 4TU9A 3PACA 3A13A 1F1BB 2K2PA 4UOCA 2IBOA 2AJQA 4HACA 3JSMB 1IKWA 3E8OA 2XULA 1LW0B 4CO0A 2HQCA 3POTA 5GADI 2E44A 4O44B 2GMLA 4OX9J 1RP5A 2NXCA 4A8MP 4WFYA 1U1PA 3GR1A 2I2YA 1S1XB 1YIJS 3B78A 4LQ9A 3H2UB 4BC7A 4CO4A 4URQU 3GB0A 4DV6J 3VWSA 4F4AA 4DL7A 4KSEB 1X9MA 5DGAA 1HWIA 3BBFA 4NCGA 5IC4B 3C8YA 4KH0B 5AE1A 3KUGA 2C42A 3I82A 5CHCB 3THTA 3TZXA 3HHKA 4IOAQ 2FJDB 1HBNB 3BJYA 4GC6A 2B8QA 4ERDA 4X65J 3GTYX 1EETA 2JLEA 4I69A 2ZM6F 1VCTA 3CIMA 2B4PA 3BREA 4KO0B 2ACYA 1ZA2B 2AP6A 2N82B 2RDDA 1FO1A 4KGVB 1MLAA 2KHDA 5DJBA 3S7RA 5DDQC 3ILJA 3D67A 4NRTA 1S0NA 5DQGA 3RBDA 3RRGA 3QT8A 4ATNA 5KFTA 2GQ2A 2J6UA 2KFNA 3T1AA 3OHBA 4P75A 1RGVA 1N54B 3MPDA 2UUAF 2DGOA 1KHVA 1FDBA 4PKDB 1T94A 1NJYA 2HSEB 2EBGA 2ATCB 2VPWB 3W7BA 4DV0J 2HS0A 1C1BB 5A6WA 4PWWA 3HVRA 4LF8F 4J9KA 1IR0A 4OYIA 4MFBB 2JNJA 5B0EA 3GLJA 4OV6A 4JI2F 2IVYA 1TUGB 1QLNA 3I55S 3I31A 1FWLA 5D78A 2HGLA 3HSGA 2V8DA 1GTEA 1RHUB 2DNPA 5A8KA 1FRHA 3QIPB 3H90A 4I7FB 2WOMA 1YRUA 3WQPA 3BEGB 3TX0A 1UWBA 2HRYA 1YZ6A 1X5OA 4NI2B 1V3RA 4BS2A 1FRMA 4A8FA 4YR2A 5IM0B 4WP9A 3KKFA 4M8LA 1RUSA 1EHWA 1W2IA 3FEZA 3Q0AA 1ROFA 2XYPB 4ED6A 2QJ3A 3Q8PB 8RUCA 4KE5A 4L75A 2M8DB 4IQXA 3W8PA 4QR1A 1O0PA 1KNZA 4OHVA 1JKHA 2VFTA 3PFOA 4CT8A 3PW7A 1IBLF 1QSSA 3CD6S 4RBTA 6FDRA 2RD5C 3GG1A 3CCWA 4JV2A 4ZP8A 5FDLB 1F2GA 2HVEA 2YNIA 3CW2C 5K20B 3HT3A 3V4IA 3ET6B 2W8KA 1BUXA 4ED1A 3UN5A 1YBAA 1RXOB 2BUNA 4AQYF 4Y28C 4ECXA 1F3FA 2M7SA 3QWUA 3MWBA 4UZBA 3OTCA 2LXUA 2H5IB 2CRLA 2NSCA 2GVZA 2R3VA 2UXCF 1UEUA 1SJFA 1KSPA 2K3KA 2OPQA 2X7IA 4HT7A 4DR1J 1IKXA 1S9GB 3F73A 2BKOA 5EHHA 2N7CA 1JLBA 4BDPA 1GMVA 4WPAA 2HFNA 2RQ4A 4OX7A 3KK3A 1EAYC 2VPZB 2H9ZA 2K8GA 4CO3A 3LANA 2IM2A 3H8YA 2V50A 4N76A 2DNQA 2PA8D 1BXNA 2G13A 3G6XA 2KG0A 3FFIA 3QZ8A 1NAQA 1URRA 4ILRA 1N52B 4LRCA 2R7QA 3D5MA 3NKYA 1BMQB 4IG0B 5DQHA 2GCFA 3VAFA 4QZVB 3QSIA 4JP8A 1TKTB 1RWVB 4OZNA 3C6TA 4OL8A 1UVJA 2FVRA 3D2WA 1CQMA 1ZETA 2R9LA 3KNGA 2HVDA 2CJKA 2UXDJ 1OY8A 1RLCL 2HMIB 5KFHA 3BQ2A 1LWEB 3OFGA 1FWPA 1ZTWA 3OTOF 4DQSA 1ZAXA 4H4MA 3LO3A 2VG5A 1MU2A 3DU6A 3R8YA 5HLFB 2A2CA 5AJ3J 1Y4ZB 3CT9A 3BM7A 4RLEA 3TA2A 2ZEJA 3EICA 3MPUB 4D3GA 3H5YA 2HVZA 5LT5A 2ZH7A 3DRYA 3CDWA 3IGNA 3J81Y 2ZOMA 4F0HA 1TZ0A 5D0GA 4DUYF 2VQEF 2CPEA 2RDJA 2JWNA 2FLLA 3T9ZA 3JSRA 3OR1B 4C8YA 2NYHA 3VGSA 1WD6A 3C16B 3A8JA 4BCAA 1X7VA 1HARA 3HX9A 2I6WA 3FBCA 1TU0B 2CQGA 2YH1A 3VQSA 5KFYA 2F5GA 4OMFG 2KG1A 2CJXB 3H5SA 4PG7A 3HHEA 4HEA9 4PG4A 3KDNA 1DJ0A 4JI1J 4ED4A 2XSFA 2AX1A 2P2CB 4DF8A 3CO0P 1P8GA 3IBWA 2EI5A 2AMCB 2RDIA 3N5BA 4HDHA 1VRQC 2Y0BB 2VPYB 1FE4A 2W2OP 1EKRA 4LF5J 1SV5B 3EGWB 3GILA 3V2UC 3JTOA 5D6GA 1NSPA 1F9HA 2ZZTA 3X1LB 4ZPDA 1WOPA 1WACA 1OPZA 4HHJA 1HL6A 2RKIA 4I1TA 2WTFA 2JH3A 4N8OA 2KXFA 2XY6A 1HNXJ 4L72B 2E1CA 5IT4A 1UZDA 1FK9A 3R5JB 1TUWA 3CCVS 4EFAC 1KFSA 3G8QA 1FKOA 4DCJB 4NLOA 1Z2ZA 5HANA 1Q4RA 3AOBA 4PAAA 5KG4A 1OY6A 3RJMB 3IAS9 4Q5VA 1QTNB 3MM7B 1U48A 1PILA 1DURA 4DS4A 1HBMA 1J5OA 1UA0A 4YB7A 3RAXA 2ZUGA 3CWJA 1MROA 1W7WA 1O8BA 1U25A 4RBUA 2C2EA 2LDIA 4K8RA 1EQ0A 1UEKA 3MR3A 2IYIA 3C19A 1TL1A 2HHHJ 5HQMA 2ZKTA 4UY8T 2Y9HA 3R2DJ 1FVSA 2AWZA 2CPJA 3TARA 3K5OA 3GJSB 4ECYA 1SQGA 2HURA 1IBMF 4UUWA 2GIRA 2FIUA 3ULHA 5L1JA 4KHRA 4NXNJ 3UCZP 4RNMA 2YWKA 2OPRA 5HROA 1JLGA 3NRBA 1GFWB 3NGDA 2HEKA 3MHYA 3QSYB 4DL3A 3FQKA 3AT1B 3A8EA 2DR8A 2BYCA 3NNCA 4B9SA 2Q3PA 3I4PA 3I56S 1M0SA 2HRTA 2MHEA 3M6WA 2FYXA 4UW2A 5E3CA 1LW2B 2NZ4A 2GIFA 3O2IA 1NK0A 4YP3A 5A0YA 3CJ2A 3JQKA 1VGYA 2D3ZA 2HNZA 1HNVB 2YKQA 4B3TF 1ZPVA 2AZ3A 3DOKA 3HVWA 3H5XA 1RAJA 1YJ9S 2G2OA 1DTQA 2DHGA 4JV5J 4WCEQ 3PW5A 1RLDA 2G1DA 2VA3A 5CD4A 2XS7A 3C6UA 3LP2A 3D54A 3GMGA 3GIKA 5T7LA 2NSBA 4PG6A 2P6SA 4NYPA 2ZC3A 4USTA 1H0HB 4ZVQB 4DN0A 3DLGB 2J0XA 2VICA 3MM6A 2CADA 4NLGA 4ES3A 4DSJA 5KFGA 3BSNA 4J9OA 1EP4A 3D0GE 5HL7Q 2IM1A 4PXEA 4X4QA 1G1XA 2QE5A 2IIHA 1UW9A 2BQ3A 1C4AA 4HI2A 3N4WA 4UQTA 1VBXA 1JXEA 5D0HA 5C25B 4NEZA 5RUBA 1RT4B 5ADZA 1N6QA 2R42A 4X4NA 3OXGA 1WF1A 3MM8B 3HDSA 5I3UB 3Q2TC 1LK7A 3Q8VA 3ETOA 4PUOA 4OZJA 3PY8A 2HFZA 4F4KA 1RTHB 3FVYA 3WC0A 4PPZA 3MZIA 7AT1B 1IUJA 1WHVA 2CNKB 1SKSA 2YQ1A 4P2SA 1U7LA 1TK0A 3HKWA 2VQFJ 2ZD1B 2JLGA 2J76E 1RT6B 1SQEA 4TXSA 3KNAA 4Y2KA 4OI6A 3QPIA 3UW1A 1T05A 4O4RA 3T1HF 3B4DA 3JQJA 1M5KC 1AROP 3JSYA 2Q6BA 1JQGA 2B51A 3AH6A 1S79A 2AGOA 2UVWA 2DD8S 2OH2A 1V5VA 4GRSA 1ACMB 5ETVA 5LSLA 2JHEA 1UKUA 4DG1A 2HBZB 1WI8A 3IBFB 3HP6A 2LQBA 2W9BA 3R6LB 2PEBA 3DM2A 2QMXA 1REVA 4F4ZA 4K59A 3RAQA 3AQPA 3KYLA 3N28A 3O3LA 1YG0A 3PRDA 1SL1A 2BA9A 3DN9A 4PYAA 2AHOB 2HNDA 2ZZMA 1N5YA 4G1IA 1PJ7A 5KFSA 2X3DA 1Y10A 2XMVA 1MW7A 3VVUA 5F3TA 5A8RA 4NRUA 4R8UA 1FTRA 2K3IA 1SJ4P 2V8HA 5BYQA 5F8HA 2E7XA 2YKNA 4NXMJ 3ZO7A 3HFZB 4J7CA 1TL7B 3MEGB 3I9V9 3V6DA 2FLOA 3SCKE 3SQGA 2NXUA 5A2QU 3BQ1A 2CQ1A 3AJ1A 2DEIA 2K7JA 1PYTA 1N88A 1QSYA 1ZM2A 4ZPBA 1FRKA 1HNIA 3F56A 3IS9B 2BRKA 2OLWA 2HAFA 4LFBJ 1SJRA 3IRXA 2FDNA 2QA2A 2GGPA 2XGPA 1S6PB 2WVEA 3Q8UA 1DFDA 4DUZJ 2MZTA 5F8NA 2Q1LA 1RAFB 2PE8A 1A6LA 1XMOF 1RWMB 2WRMA 2ZBCA 3OT9A 2HFSA 3CULA 5G0RB 2HBQB 1UFLA 3KLHB 2EKNA 3TJAA 3CCZA 4C11A 1VIXA 1U49A 2DO4A 1NB7A 3HF5A 1LNQA 2MSTA 3FBEA 3OSPA 2OELA 9RUBA 4DQPA 3A8IA 1IKYB 2UUCF 2W7OA 3FMWA 1W2BR 4DL2A 2XMKA 1WI6A 4YR0A 1X4FA 1B99A 4DV7J 3A3OB 2XQCA 5KTQA 1HBUB 2YNFB 2R7TA 3MUVP 1S1UA 1OS5A 2QYCA 3HHDA 1VI7A 4ZN3A 2C3UA 2F8EX 2DCLA 3KJNB 3EPGA 1S99A 3ISND 4E8UA 3GCWP 2QFIA 4ZPAA 1Y7PA 5BJRA 3QJPA 3B54A 4OJHA 3UPFA 1RAAB 1KQKA 4LF9F 1RT3B 3DC2A 2IJFA 1D9DA 4ZLJA 5KFWA 1H38A 1LWFA 3MDFA 4WYLA 1BWEA 2B5JB 2LU2A 4OI1A 4ANCA 1VR6A 4M5KA 4MIAA 5ETNA 4JI6F 3J7AN 2DH9A 1EZZB 2B56A 5KFFA 3HPOA 4J9UE 1JNZB 1HWJA 4U9RA 2MZQA 2BE9B 3BB5A 3OTBA 2FLNA 1PGZA 3EDQB 4DX6A 1YHQS 3OLAA 1S0MA 1Q8LA 5GMEA 2C1EB 2GQQA 3I0RB 4URSA 4AYBD 1H7WA 1YJTA 2BM0A 1KLMB 1N8RT 4QR0A 2KJVA 5CYQB 1DLOA 1QSLA 2NPFA 4DEZA 2CNOB 2JVOA 4KJIA 3KWMA 1HBNA 4RBVA 2V2ZA 1WHYA 2CUYA 2RHQB 1S1WB 5BXIA 2BQUA 2O1PA 2ZZNA 2RU3A 1URNA 3OHAA 3FNNA 5ETLA 1FX4A 1TVRA 5AT1B 1NJWA 1FT8A 3U27A 3SDEB 4IFVA 2HHPA 2AQ4A 3DLBA 2J6SA 3KLIA 3UN2A 5DDRC 3GYNA 1YKWA 1FERA 3M4XA 3Q86A 2Y0SD 1F5BA 3NS7B 4ZN1A 2AV5A 2E1PA 2GC8A 1SI9A 2U1AA 2XYHB 5T41A 1S9EB 4EZ6A 4EO6A 5EWGA 2V94A 4HDGA 4A8WA 2KH9A 3G8TA 3UR0A 1UPPA 3ENWA 4EI2A 3PV8A 2DNLA 5KFEA 2HHTA 4FP9A 3UCGA 1X60A 4ZMMA 2YKMB 2HWIA 1AFJA 2F40A 2AYGA 4RW7A 5KFVA 1MN9A 4Y00A 4ZVEA 5HQLA 4FYXB 4J9PA 3ZNJ1 4JI4F 4TU7A 3MMAA 3QJLA 2MQMA 3ZZYA 4UF4A 5KG0A 5K9FA 1U6ZA 1YRXA 2XWXA 4USIA 4WFBQ 5AXKA 2PEHA 1XMOJ 3UD3P 5GMDA 1IJFB 4EWTA 3KLVA 3EM1A 4O3SA 1SUQA 5HMZA 2DHSA 4KHPJ 3T1YJ 2DCUB 4B08A 1QY7A 1N5TA 1M5PC 3QIPA 1QUPA 3KHRA 1KONA 5HBMB 2RSQA 3HHNB 3HI9A 1FDDA 3NNAA 5JMNA 5IM0A 1FEEA 3MMJA 2AKWB 2BRLA 1TQLA 2V2KA 3SI8A 2BEFA 3KTQA 3F44A 3VQTA 3VAMA 2JC0A 3W9HA 3I32A 1U4BA 4M5MA 1WEYA 3JTPA 1HNWJ 4KR0B 3BS9A 4B02A 2AJ0A 2ATLA 1CJUB 3NXZA 2HFVA 3A3PB 4IRKA 2IFXA 2LA4A 5FDLA 3FK4A 2BBEA 2DRDA 4I2PA 3KJFB 1VQYA 4P6QA 4L74A 1K9MT 1PC4A 4JYAF 3UQSA 2W2MP 4K4VA 1T9YA 1B7FA 4ZJLA 1NK6A 4LIRA 4MMOA 1WKJA 3J80Y 1Y5LB 4HACB 1RU2A 1IKWB 1NDLA 1GT8A 4AUKA 3NOCA 1V5IB 4TYAA 3GJRB 2VASA 2V4QA 3BR9A 2E1MC 3FDSA 2ILYA 3HCXA 1S9GA 4DL0C 1PAUB 4TU8A 5B0AA 3KHLA 2AIRB 1ZM4A 4FNIA 2W25A 2WONA 4ID5A 1JXLA 3S1TA 4YHHJ 2EG1A 4NCGB 1NKEA 4K4UA 2ERRA 2AEFA 1NK8A 2ZJQQ 3LALA 3L7UA 1XWLA 3GU0A 2RRNA 3CJ4A 3SCLE 5J1PA 3AODA 2PFFB 2M2BA 1L3SA 4WFNQ 4NLVA 5EWFA 2G2ZA 3GPAA 1KOOA 1NJIT 1T11A 4DR7F 1U2RA 2M4MA 2CNLB 2YWEA 4RWWA 3V6KA 1JLFA 1NHVA 3SSQA 2HHXA 3GR0A 3W64A 4IG0A 1K73T 3EXYA 2GIQA 4C4WA 1X5SA 3FJ2A 2EXUA 3ZZUA 1K0TA 2P9GA 3HHLA 4P52A 4DL6A 4DV5F 4FS1A 3OL9A 1R3NA 2HMIA 1LWEA 2HQDA 2KKHA 1FFGB 4RW6A 1F2HA 4EBEA 2UVUA 3SCJE 4L73A 2ZH6A 4KGZB 3TUJC 4QPXA 1I1GA 5J1EB 4IH5A 3PVXA 3RBXA 4BWMA 4USVA 1HI1A 4DQIA 1CLFA 2B4VA 2GJIA 3IM8A 3TA1A 4F4YA 2VH7A 2OEMA 2GMHA 5F8IA 2FY1A 2F1FA 3R2CJ 3I5CA 5GAEU 3TZYA 3OV7A 3JYTA 3TAMB 2FLPA 2JFKA 4AL5A 2KM8B 4H4OA 4U7CA 4RUHA 3BDPA 2CVIA 2ZE2A 1K44A 2D74B 4DPYA 1ZYQA 3SSRA 3P5TL 5G4DA 4V19X 1H2TZ 1IBKJ 5CYJA 1XTZA 3CIZA 3DLLQ 3KK1B 5E0OA 1WG5A 3RR7A 2HHWA 3Q8QB 5GMKa 4DX8H 4KYZA 2WOMB 3DRRA 1N36J 1H2UX 4RX6A 1UWBB 4RL1A 1ZAVA 4TQRA 4DZDA 2BW7A 4Q44A 1TFYA 2DEJA 3CEDA 5KFOA 1SV5A 1VQ8S 5A8WA 4JI8J 1DAXA 2L08A 2DNZA 1RTJA 1JKHB 4OZ1A 3IBCB 1D9AA 1S1VA 1SL2A 1Q82T 1K47A 1UVKA 4X4VA 2HZAA 2IAJB 3OXFA 2YNIB 1U47A 3IO1A 2DNGA 3Q24A 2DXFA 4OHZA 3Q89A 5HMYA 1LFWA 2NZCA 2XG8A 1SJQA 1FJ7A 2W4DA 3G8SA 1H98A 3K5NA 1JIHA 4WP3A 2IPOB 2ASDA 4KQZA 1PSDA 3CJ0A 4HKQA 1O6XA 2GVZB 1VRUB 4HL9A 1Q53A 2OTJS 1MN7A 5KG1A 4JYAJ 5U47A 4LRDA 2G4BA 2OPQB 4WU2A 2JC1A 1GMWA 4KBIA 3RU0A 4FF2A 2H54B 1VK8A 2OI2A 1YJUA 3GFHA 3FEYB 1RWPB 4LBIA 1SC4B 2MLZA 4LFAF 1ZAWA 4ECUA 2ZVSA 1JLBB 4ZVHA 4FXDA 3BGFA 4WXOA 2K1RA 5HK4A 3M30A 4CLYA 4ED8A 2XMTA 3QGPA 3BO4A 2I38A 4KPCA 1RDRA 4X66J 1M5SA 1HW8A 5DG8A 4TNOA 1VQNS 3FFIB 2O67A 1T7PA 1S0OA 2YWWA 1JJ2R 2GNKA 3ISZA 2XY7A 4Q8EA 4QIWD 4O4GA 3BYRA 2ZH2A 3TVZA 2DH8A 4ED0A 1RZMA 1QVGR 2IA0A 4UUXA 1LW2A 1Y5IB 3OBIA 2ZH3A 2GJFA 3DLJA 1S9FA 3DGVA 3C6TB 1FX2A 5J2PB 1R27B 2NCKL 5C42A 3KLEA 3MUTP 2UVRA 3ZZTA 1HNVA 2B9WA 4J9LA 3G2XA 3QYYA 4H4MB 4EO8A 3MEEA 2ZHBA 4PYDA 2B4OA 2VG5B 2KZMA 1MU2B 3DLKA 2IYGA 1CBKA 1IQTA 2Y3YA 1HFEL 1NJXA 3K5LA 1AYEA 4DV4J 3D6TB 3MAAA 2PMWA 4LRFA 5KT2A 4C6AA 4YR3A 1RKIA 2HS4A 3IP0A 4CCHA 2HW3A 2V9WA 2DISA 2RQMA 2JX2A 4A8SA 1MMDA 3M9OB 2LLZA 5KFJA 1PJ5A 3RG6A 2XSJA 1WEZA 3PFEA 3AAWB 3UD4P 1GTHA 2PC6A 1XN9A 3TUZC 4AL7A 2X51A 4X62J 4LREA 3KJVB 3M8QA 3QWPA 4RW4A 1TELA 4J9VA 3TEGA 5ETRA 2RH3A 1QAJA 1S0VA 5I3UA 3D9BA 2JSXA 3CO9A 5KFKA 6FD1A 1R43A 1CVJA 4Y0FA 1QAXA 2A6OA 2HGMA 3NEKA 2WHOA 2X1GA 3MI7X 1M1HA 1S4FA 4M5LA 3A4TA 3IWLA 5KFZA 2MYFA 3DRXA 4DR3F 3HD1A 3UR3C 4OHXA 2F4FA 1NU4A 4FBTA 4NLWA 1FESA 1U8WA 4JI3J 1JB0C 2MQNA 2W4PA 3M8ZA 2MXYA 1QVFR 1AUSL 2OPPA 2UZAA 4NYZA 1JLCA 1FK9B 1RTIB 2HWHA 3R9LA 1WDTA 2PDAA 2ZC4A 1S6OA 3HKZD 3RZAA 3VF0B 1LKZA 3M8RA 2BJ8A 2F4VF 1S1TA 1H2VZ 4ANDA 4DSIA 4K4TA 1HBMB 3TRGA 1J5OB 1UP1A 3MXHP 2JJ4D 1B0VA 2E9ZA 2D3UA 2XLJA 1Q8IA 4HHHA 3NBPA 1MROB 4PWDA 4RWXA 4EBCA 5GADU 1UJ6A 4NA1A 4NLDA 4ED5A 3PW2A 3SSSA 2CFXA 1NB2A 2ZWPA 5DLGA 1RADB 2DTJA 4FKXA 5E2QA 1T9VA 2X3GA 1TL1B 3PG9A 1RB0A 2NXEA 4ZP6A 4ES2A 4JI5J 2B9EA 3V4MA 1Q95G 3AD8C 1TL7A 1VBKA 2OKQA 4P9SA 2XM3A 3BPDA 1JLGB 1BC6A 4XO0A 3IS9A 4G65A 2HAIA 1TL3B 1AA1B 2POKA 2AD9A 5KG7A 3M2RA 1S48A 4R0EA 4Q45A 4I0WA 3CDAA 1WF2A 4GC7A 1S6PA 4WTYA 2DNKA 2WVBA 1XMQF 4GMKA 2GS8A 3AJDA 2RS2A 2CWKA 3NWGA 5GAEI 4OHYA 4LRAA 3OLBA 2HNZB 1X4BA 2C2MB 1KC8T 3LPEA 4ZPTR 1FRIA 4OLPA 4LFCJ 3MTKA 3C6UB 3HZEA 3LP2B 1HQEB 5T7LB 4IG3B 4PXDA 1P1LA 1WKKA 2BVZA 3UDLA 5KG6A 2YWHA 3UVJA 1NHKL 1N33J 4CNZA 3NWRA 2V2QA 4JI7J 4LSLA 4MJKA 3SMZA 3UFCX 1F9EB 4LJMA 3W63A 3B6BA 4P2MA 4ITSA 2RT3A 4HTIA 5L46A 3ILLA 4XDDA 4DSFA 4D3HA 1R0CB 3MR2A 2ZBPA 1M5VC 4ZDNA 1N6QB 1DTTA 1U0HA 1PYOB 4OZ3A 1N32F 1LV5A 4PUOB 2CZ9A 2E5LJ 5LJ3Y 5HP1B 3MD1A 1V3ZA 1S5ZA 2D3O1 2R2RA 3D7SB 3PJ9A 1OYEA 2F9DA 4OYPA 1Q16B 4MYTA 2MKYA 2ZKUA 4PQUA 4ZIWA 2QYGA 4OX9F 5MAOA 2DHAA 1FD2A 2MQLA 2J9EA 3KLGA 1HHTP 4B9VA 4C2MA 3B4MA 4ILLA 1R8PA 2OPSB 4DV6F 1T05B 4BHQA 4V1Ak 1D1UA 4XPCA 2NYIA 2EFQA 4HTJA 3DRSA 2ALZA 4EBDA 4WKRA 4DR5J 4KGXB 4Q0BA 3G86A 3MR5A 2IM0A 1YK9A 1OSDA 4DQRA 4J91A 4NLXA 4DSLA 4X65F 1M1KT 3VAJA 4DG1B 4N5SA 2L9NA 5H9FK 2RF2A 2W9BB 3DM2B 3PW4A 4WXWA 5KFXA 3TYTA 1REVB 1NJZA 3QT6A 4WIQA 1DQ9A 4GVBA 2W4CA 1YJNS 2JRSA 1S77D 3VGVA 2W24A 2QT7A 4CLFA 2K06A 3UNYA 4DN9A 3AY0A 4DFMA 1F3VA 2HNDB 4QR2A 1N5YB 4W98A 4B3OA 2PMZD 2HHVA 2ZDOA 2NREA 5A8RB 5L1KA 2EKYA 1I94J 4C3MA 4R8UB 4DU8A 3CC7S 3ZTSA 3NGKA 1KVKA 2JEIA 2YKNB 4Q8FA 1FRLA 3MUMP 1HYSA 1U0SA 3H0PA 1TKZA 3V6DB 4OI4A 5KT7A 1RWXB 2QIFA 5ETOA 4B3SJ 4M95A 1K8AT 1SIZA 1RCOB 3NGUA 4F0MA 2BX6A 3C46A 5BR8J 1HNIB 4C3KA 1WC5A 3UE2A 2Y8WA 1AUDA 3DNCA 4WYWA 4DV0F 3MURP 1NPRA 2OFHX 3N6MA 4Q2LA 5B08A 1T9XA 4K5SA 1NBEB 2YKMA 4USHA 4Y65A 3VAGA 2E66A 4V19J 1SC3B 2KO1A 3BGRA 4ICLB 2NXJA 3EGNA 5E5NA 2GAHC 5SZTA 4ECZA 2CQDA 2F65A 5E3QA 1AW0A 3SFGA 5F41A 3QRRA 4CIOA 3V6JA 4ZVRB 2DGSA 4F26A 4DLGA 2D9PA 4B3RJ 4E98A 5DGBA 2AT1B 1K1QA 3K0JA 2QFJA 1M5OC 4RO0A 1WUUA 1VRTA 3TR5A 4C11B 4Z7YA 2MEWA 3CMQA 1CEZA 3U1MA 4RNOA 1C2PA 4LBPA 4WWSA 2VJVA 1CG2A 4IOBA 3D68A 2VFVA 3FCHA 4DR2J 5EWEA 4JV0A 1SH3A 2E5GA 2X1AA 2JEGA 5HBMA 2FJEB 5HATA 3BGOP 1R0AA 3PDNA 4PWUA 5AXMA 3VHQA 1S1UB 4DV3J 5DRKA 2QTWA 1JXVA 2A2DA 1YLXA 4QBUA 1QJHA 1MMLA 2MMYA 1FCAA 4QW8A 2L41A 3MPWA 2KVIA 3E01A 2HPUA 4M5JA 3L95X 2LKZA 4FNHA 5DM6Q 3DKDA 1VIOA 1CC7A 2D69A 1KN6A 3EZUA 5FLXY 3GFXA 3J81j 3IR7B 3U7JA 2OTLS 1LWFB 1BD6A 2XB2D 2BMBA 2XLKA 4XIUA 4DL4A 3JAMY 3HJVA 3ILIA 3HJFA 3G96A 4OLOA 3GONA 3NS6A 4DR1F 1N0VC 3GCXP 6AT1B 4DV2J 3Q23A 1U1MA 2J7KA 4CQ1A 3R5DA 4C48A 3DLHA 1SBRA 2YQ3A 4ZITA 2HBRB 1RBLA 3B8HA 2EFGA 1SJ3P 2RILA 4KV8A 2XCPA 5KG3A 3E3XA 1V3SA 2XZWA 2Y1JA 2CQ0A 5K8OA 1NDPA 2CJYB 3SBMA 1M5HA 3L4BC 2W9CA 3DOMA 1DLOB 3NG8A 1FDNA 4YQWA 4K2XA 5F9NA 2MGZB 1HNZJ 2W9AA 5IV4A 4MK9A 1U45A 3CB4A 5H9FJ 2HQFA 2JFDA 1YBUA 7FD1A 1VHFA 1QAIA 2CQCA 2V63A 2C2OB 5HI7A 2XZTB 1Q5VA 1RHMB 4I64A 3TP2A 2LU1A 3SV3A 1S7HA 1TVRB 5C24A 2HNYA 3PX6A 4PEOA 2UVVA 4IFVB 4C0BA 2UXDF 4TVAB 5L1LA 3KLIB 3ENVA 2BANA 1NDKA 1SPBP 3MF5A 5LMNJ 3QO9A 1S6QA 1QTMA 1OQ3A 2JDJA 1FKPA 1FE0A 2ZBRA 2DYAA 3S01A 3CDEA 3BKTA 4QIEA 4F04B 5AJ3F 1T3NA 1TMJA 9ATCB 5KFAA 4DPXA 2BV3A 4CDIA 1UZHA 2FUG9 2IRUA 5LXRA 5D3GA 1UEVA 2NLWA 2GJ2A 1N56A 2F8HA 2ZNZA 3WC2A 3C14A 4B9TA 2MHNA 1X8DA 2XNRA 1CPZA 4IH7A 3LAKA 1R6VA 5J1EA 2PT0A 1CJVB 3IMQJ 4RW7B 4EZ9A 2QLXA 3JXOA 1WTFA 1H6KX 1XMBA 3HHLC 3IGVA 2AGPA 4ILMA 2VOOA 2E9RX 2MSSA 1R8BA 1LWCA 3GG0A 1NKBA 4ZHRB 3DLEA 3MMAB 1BGXT 3NNHA 3TAMA 1A9NB 4OYOA 4USWA 5IOLA 4JI1F 2FHKA 1UAWA 3IRWP 2KDOA 3FGVA 2RRBA 5KFUA 4ID8A 4TY9A 4TYBA 1J2VA 1ZZNA 4PXCA 1SUQB 3W62A 4R5PA 3KK1A 2FB0A 4ZP9A 2G1HA 4LF5F 1JJHA 2UUWA 1R6YA 1SQFA 3RW6A 2EWHA 3D1HA 2FC9A 3OL7A 1NRKA 1REGX 1RSCA 4YOEA 1IKVA 2C3MA 3TAPA 4KT0C 3NOGA 4DR6F 1YGYA 1P9YA 2R7UA 2IHR1 2XZDB 5CD4H 4NWBA 3M8SA 4M1KA 1HNXF 2F7VA 4O3RA 1F6TA 3W9JA 3HSJA 3MPYA 1TV6B 3MOJB 2ZBQA 5EX3A 1NK9A 2WBMA 2DK2A 4IFYA 2NUUG 2WVCA 2UUBJ 1EKSA 1OO0B 3PX4A 3JSBA 2IAJA 5CCLA 4WE1A 2OMOA 1A0OB 2XHCA 2DR7A 4I2PB 1R89A 1FKAF 4N77A 3T5KA 2DH7A 4F3OA 2MJNA 4OQJA 4XTTA 1IM6A 4I2QA 2XWYA 3UN3A 2R8KA 1RA6A 1VRUA 2HHHF 3MTJA 4O3PA 2FY8A 4FXVA 3GIMA 2V4JA 4IR1A 2VBZA 2I0XA 4DFPA 4ZCIA 1C4CA 2D3OR 2ADBA 4NMLA 5EUHA 2A6MA 2BM1A 3C15B 4X84A 4K50A 4DWIA 2YXLA 2WONB 4ID5B 5KFCA 4NCBA 3TZWA 4NXNF 1WC4A 4I6WA 4RU9A 3TWZA 4HH1A 2CG4A 3NAIA 3BSAA 5KT4A 2RJZA 3A1YG 2HQGA 2QLJB 4FPIA 2EBEA 2XLIA 1FXDA 2LEBA 2HHUA 2OFGX 5DZ7A 2XY5A 3UDCA 3CC2S 2DR9A 2H4YB 1X4HA 1Z1ZA 3FRZA 1G3OA 4RW9A 1RT2A 4QU7A 2CQ4A 2C2RA 2M8HA 1MNEA 4LR8A 3R7SB 3W9IA 1BWVA 1Y11A 2GFFA 1NK4A 2F9JA 1JLFB 2HZCA 2WVDA 1XEZA 5D8HB 4J9NA 2W2PP 4JV5F 3RB6A 4BBYA 5AE2A 4MTPA 3OTDA 2JEFA 2XI3A 3HHLB 5J2PA 4DZ6A 2DGTA 5FJ4A 4LT6A 1R8AA 4QIVA 4RW6B 5IT9U 3HK2A 1VQOS 4H4KC 3GQCA 3OR2A 5JXSA 2DRBA 1XNQJ 1VJWA 1GNKA 3SCIE 2IDEA 4IO9Q 4OYZA 1HIYA 2Z30B 1X5TA 2GA7A 4TLRA 4ZLPA 4WBFA 3PHEA 3V5RA 3M2UB 1IQZA 1DBDA 3D0IE 1RYRA 1KKHA 3JYTB 2I9SA 2GHPA 4ECSA 3OJSA 2CIMA 4H4OB 4LSNA 3DXSX 2ZE2B 2FTRA 2XCAA 3OQ2A 1H7XA 3KJVA 4OZ2A 4NLPA 2PIIA 4ECVA 4DXLA 2Z0GA 1DRZA 3QGHA 3EGZA 3MM9B 4UOHA 4O0NA 4AE5A 3QRQA 1VHIA 2PN6A 1VQ6S 4O3QA 2MKIA 2FGOA 2VQFF 3DRRB 2YWFA 2HYIB 4YY3J 4B9MA 1W25A 4NLQA 4NZ6A 3BO3A 1VQPS 1YQHA 2X1FA 3J7A1 3LP0B 3L7PA 4KH1B 3AD7C 2HRUA 4FYYB 4ELTA 1OMSA 5A8WB 2QA4S 1B7YB 1JK9B 4DSEA 3KHGA 1RTJB 2RHSB 1FNXH 1FEHA 3T6JA 4PRFA 4DR6J 2YKOA 3HXMA 3RB4A 1B70B 3NGTA 1S1VB 2D41A 1X0FA 2DNOA 4ZK7M 1YDLA 3M8YA 3GSDA 1PBUA 4P2XA 3CTRA 2DBBA 1RTIA 1UW4A 3M2VA 1MSWD 3FZBA 5B0FA 2VL1A 1B4SA 2CDQA 2Q79A 3GJTB 1RHJB 4MT1A 4B3MJ 4O23A 2GX8A 2AJ4A 4FDFA 2CJBA 1FJGF 4W4MA 3G6ES 5HVHA 3CGIA 3CCUS 5JJBA 1C0TA 4LF7J 2GO8A 1D09B 2VV5A 3R6GB 4USKA 3RB0A 2Z2MA 1GXTA 3D6FB 4GKJJ 2C2DA 5M2RA 2P8IA 1JLQB 1TKXA 1WF0A 4NXMF 3LQVA 4R25A 4I67A 2MY8A 4J9MA 5CH7B 2WAQD 2NR0A 1QE1A 1VS3A 4KC5A 2K1RB 5FD1A 2QC3A 1X0PA 3M30B 4LBHA 2ROPA 1RBAA 1YX2A 4LFBF 4X4SA 3DFEA 1XNRJ 5JVHQ 3L09A 4JUZA 5AE3A 4NLUA 3ZZ0A 5BYSA 2ADCA 1K1SA 2LMIA 4ZVSB 2IVMA 1Q7LB 1TL3A 3W5YA 4RKUC 4DUZF 1Q0NA 5IWAF 1P6TA 4DPTA 2CQPA 3EDRB 4GVLA 4O4GB 1HQ2A 5J1NA 2VBXA 1VMBA 3TZZA 2BJ1A 4F67A 2YY3A 2MB0B 1U2FA 5CZVA 4F02A 5C42B 1R31A 3KLEB 1XC9A 1F5CA 3ZTRA 3G82A 4OX6A 5KFBA 1FHTA 1RT5A 4Z37A 4DLEA 4DJBA 4C0OC 3MEEB 3LH2S 3KOAA 3DLKB 3X3UA 1HQEA 1IR1A 4PABA 1JWWA 2YKPA 5I3QA 4IG3A 2Z4PA 1T02A 2KB2A 3MAAB 1TUVA 3OVSA 3D1OA 2ZNYA 5IQQA 4KPYA 4DV7F 3UNGC 3FCVA 2FJXA 4OYBA 2UUTA 4Y2IA 2HHSA 2AEMA 2H1YA 2XSJB 5T14A 2Y1RI 4CWBA 3WX4A 4HYKA 2OAUA 1WORA 4K4XA 5DETA 3M8QB 3PR4A 4RW4B 1U1OA 4CO5A 1RTDB 3W2WA 1N48A 2VZ9A 3CPWR 1NZAA 1RAHB 3FSXA 1CSJA 3OTEA 3VALA 5KOXA 2IJNA 2I8EA 2HVHA 3N9UC 5HP1A 1OJ4A 4ECTA 2EFPA 4B17A 3DDIA 1RWUA 1VBZA 4EU0A 3OL6A 3VVTA 2BE7D 4Y2CA 5GAGI 3PRVA 3M9MB 1CJTA 5E3PA 2HIQA 2VJUA 1KR4A 4Q2MA 1O5JA 2J8SA 4LF1A 4QWDA 2YX7A 2C3OA 2OPSA 2OPPB 4X2BA 1JLCB 4KKOA 3MCNA 2DIVA 3MFHA 4L76A 1JJCB 3CCTA 2DGXA 1RT7A 4O3OA 4JB8B 4O3NA 2J9CA 3W1YC 2B3TB 2Z57B 3J7YI 1GK8A 1UMJA 2DNMA 5GAHI 1S1TB 3PXGa 4OYMA 1X4CA 1P9QC 1S6UA 4RJVA 2XS2A 3NCPA 3N6LA 1TL4A 2PD1A 4AL6A 3NBPB 4PWDB 1FVQA 2OHDA 1FJGJ 3TW0A 5LSOA 5K8NA 4DPUA 1VC6A 1N34J 2A10A 4DR4J 3PW0A 1MG7A 3L9ZA 2MLXA 4OYAA 2AF6A 2OSRA 2I5JA 5CQGA 3PZPA 1OQ6A 4MK8A 4DV1F 4AD6A 4C0HA 2FHJA 2C2ZB 3MMBA 1VQ9S 2XMAA 3NP5A 4ZVTB 2MQQA 3TUIC 4RW8A 5CCMA 4F36A 2W2NP 4PG5A 4IDKA 4QJVA 3BH7B 5H1SV 3VGTA 4LF4J 4K0KF 1QD1A 3P49B 1IVZA 2KN4A 2AGQA 2V9KA 2CXEA 2CPFA 4C8KA 4FYWB 3H4DA 3BGUA 3TVYA 1APSA 2IC3A 4QIGA 1X9WA 3T41A 2CPDA 4ZPCA 1O51A 3M2RB 3HMJG 4NZ7A 2XYGB 3AOCA 1RI7A 5LL6d 3AOAA 3KK2B 3EMTA 3EZOA 3ZZOA 3L3CA 5HVFA 4GKKJ 1EB0A 1WKLA 3KUEA 2FPHX 1JLEA 4ICLA 1UVNA 5EGYA 1PKUA 2IMWP 5IWAJ 3OUYA 2VKZG 3I0SA 3LUYA 1HR0J 5LMUJ 2W01A 4DCOB 2L3MA 4OYXA 4TY8A 3CJ3A 3WHIA 2DY9A 3FBFA 2FZCB 2BZ2A 1N0UA 1WEXA 2BABA 4KHPF 3T1YF 3G71S 3ETMA 5HVGA 3IXQA 4QCLA 2DPJA 5D77A 3CCRS 2MKJA 3W65A 4FPRA 3UVJB 2V8PA 4QQBA 1HBOA 2VG7A 2UU9J 4LSLB 4MK7A 1HW9A 5L1IA 3A3NB 2KRRA 5JUMA 4JI0J 2YWGA 2XBPA 3ZC4A 5B09A 3RW7A 3BKFA 2QL9B 1HNWF 2FVPA 2E5IA 1ZA1B 3JTNA 3PYDA 3K8WA 4UOGA 1DTTB 5HN0A 3TJ9A 1U0HB 4QOTA 5J2MB 1U1LA 2ASLA 3GV8B 4DQQA 2RQKA 4LVOP 1B3TA 1T03A 2OSQA 4DHVA 3M05A 1EJ7L 2RNEA 2Q6CA 1GEHA 3BH6B 4ED2A 3CUNA 1WELA 2XC9A 4FF4A 4A8QA 1XJWB 1AZSA 3HHLD 4PQUB 3GYGA 3T6BA 4Q43A 3PCOB 5D0EA 1C0UA 4FXWA 2B4UA 2QN6B 1OSCA 3WIUA 5E3RA 1AB8A 3KLGB 3ISNC 1YJRA 2OP5A 2MJUA 2LECA 4FN5A 4I6YA 2XMMA 4UZCA 1RYSA 2DHHA 3ZZZA 2YNHA 4YHHF 4L3NA 2C28A 1L5UA 2C3YA 2R7OA 4HT5A 1KTVA 1SJ1A 3DRSB 3DOLA 1RWKB 4Q0BB 1BQMA 2J5AA 3LP1A 2RUGA 4QWAA 4YB1P 3MGJA 1FJEB 1U1NA 2IRXA 1VLOA 1UJ4A 1U6FA 4OFZA 2MZ1A 1HPZA 4BLGA 4CTAA 2LXIA 3TVKA 3CCQS 2HK3A 3R1HA 2RF2B 5E33A 3IR5B 2MGZA 4EEYA 1XBWA 4IUFA 2ZJPQ 4C9DA 4GVBB 3QAEA 1FWKA 2ZH8A 3E2EA 3OJUA 4ED7A 2COLA 4DFKA 4P7VA 3AD9C 4ECQA 1CS4A 5ITHA 5AXLA 4CLPA 4B3OB 3H20A 1SKUB 2FC8A 1VBYA 2DNHA 3DDNA 4YMEA 1J5EJ 5LOQA 2MY7A 3OVAA 5THWA 3PNIA 2WZ1A 1ZM3A 2AJ2A 1HYSB 2DNRA 1TKZB 2A1BA 3HZGA 3GV7B 4X64J 4GO7X 4DV1J 4F3MA 2LVWA 2W1BA 3T9NA 1KVIA 1F9FA 2ACMA 3FUYA 3V81A 1L3VA 3TQEA 2V34A 3KHHA 4N56A 1NHUA 4OYWA 4K0KJ 4U7UD 3PEHA 2CZVC 5KG5A 1VK3A 5L39A 1CJVA 3AA9A 3IC1A 2FHMA 2UXBJ 2HG4A 3CJKB 2HGNA 2VU5A 1CJKA 3BGRB 2EVZA 4WZQA 3H2VE 2QG9B 4OI0A 1YZ7A 2DT9A 4ZHRA 3O5TB 1IBKF 3MM5A 3W2VA 2RE1A 2M5YA 1HLWA 4BWJA 1YI2S 1D9FA 2FZGB 4MYUA 2E29A 5M2UA 1VRTB 2J7WA 2R2SA 1GMWD 4WU3A 4M63A 1ZBTA 2EFOA 3Q22A 1ZOTA 2O3DA 1YITS 1U02A 4C97A 5DO2A 1N36F 3M32A 4NA3A 5KT3A 3AXMA 4ELVA 3W8GA 1RAGB 2VPXB 1HD1A 2C2NA 2CQ2A 4AXIA 1SKWA 1BQNB 1IWAA 4NEYA 3TNVA 4Y2AA 3A12A 2MLYA 2EG2A 4JI8F 3B82A 3U1LA 4IYQA 1R0AB 2V0NA 2N3OA 3S6EA 3FRYA 2PGCA 1KQFB 1V9OA 1L3KA 4KAIA 4OZ0A 3PX0A 2BKNA 1VFJA 2M70A 2MKSA 3KFWX 4NX9A 2RMLA 5HMXA 3HO1A 5K8PA 3E01B 4DS5A 4LR9A 1TV6A 2BDPA 1B64A 3HFVA 3IM9A 3OSNA 2YBVA 2CPXA 4CO1A 3HVAA 2Y1LB 3H5UA 3CJSA 2B7BB 5IC6B 2ZM6J 2KT3A 3TI0A 3GYXB 1NZ8A 1FXRA 2M88A 4Y2MA 1HWUA 3HM9A 2KYZA 4JV1A 5IXUA 1NSKL 4OI2A 1Q78A 4BC9A 3I9ZA 1EX8A 3HD2A 1KRPA 4KRWA 4UOFA 2XO7A 1RQ0A 1Q86T 3NGRA 3K57A 2GV1A 4F0KA 3K5PA 2QL5B 4KV8B 2GVDA 3Q8SB 2ZHOA 2HHQA 3C15A 4K4YA 3IG1A 2JLFA 4RU2A 1PJ6A 3J81U 1Q79A 4QIFA 4HVZA 4WFZA 4I6AA 2GW8A 1U1QA 2XS5A 2OO4A 2V8VA 2E1RA 2W9CB 1NO8A 2UUAJ 2W8LA 3DOMB 1JX4A 4X66F 4WIIA 3EE3A 3D28A 1NCLA 3PTWA 5L9XA 4K2JA 2R8GA 3CJQA 3QLHA 3TEHB 4ZLNA 2CVEA 2RRAA 2CPYA 3DMJA 4P2FA 2NS1B 1V6HA 4M5IA 1Q7YT 4LF8J 5L8RC 1IM4A 1RHQB 2BACA 3FCWA 4ZCKA 5C24B 2HNYB 3NY0A 3NCRA 1NKCA 4PR6A 4KGMA 1SCJB 1I51B 2W2QP 3VAHA 3VZIA 4M5HA 2CG8A 2GO9A 3R5BA 4JI2J 3EVMA 2BANB 4I68A 3H40A 3M1VB 2HLTA 2LQ8A 1KOHA 3CCES 3QO9B 1CULB 4WTOB 1S6QB 2KRBA 2V2VA 1FKPB 2FVQA 4CLLA 2F63A 2IVFB 1RA7A 4TN2A 3CF5Q 1HI0P 3G4SS 4DF4A 4DV4F 2GZOA 4PG8A 2DY1A 4IKAA 1X4DA 2HKEA 5D3GB 2HIYA 4ANEA 2WK4A 5EX0A 1P1TA 1Y3KA 1UPMB 3C14B 2R8IA 3LOUA 3M8PA 3RR8A 3EVOA 1BQXA 2CQHA 2QLWA 3OFEA 5CABA 3HVTA 3VAKA 5D4PA 1FJCA 3R27A 2Z2ZA 3ZNUA 5EN1A 4P71A 1IBLJ 4ZKAA 2FQQB 4UTGA 2VONA 1UVLA 4XAKA 3H59A 4X62F 1S49A 4RUCA 2V4RA 1Q5YA 1PC5A 3M2UA 2BE2A 1LWCB 1GQEA 3MECA 4IH6A 3DLEB 2R4FA 3BF4A 1VLYA 2RUSA 1UVIA 3OL8A 3MEDB 4AQYJ 1EIYB 3PHTA 3GV5B 2L9DA 2EFNA 1RISA 3T5LA 3MCSA 1B0TA 4LUBA 1NSAA 2OMLA 3MM9A 1YRTA 1G6BA 2B6AA 4DPOA 4R5PB 2UXCJ 1E6VA 2RIJA 2QZ8A 4MKAA 5F0UA 4F2RA 2VG6A 2FZKB 2KYXA 2WBRA 1VQ5S 2J0SD 2VUGA 3AB4B 1YJ7A 1IKVB 5I42A 4JI3F 5C2CA 3CD7A 1RJJA 2P5VA 3LP0A 4ES1A 3G87A 1UCNA 2DGWA 4Z2XA 4G3IA 4O0IA 3H25A 3BYPA 4ZJQA 4HI1A 2OUGA 4IFYB 2E7WA 3N5FA 1T9WA 1R0BG 2OJ3A 3ZTOA 5MLCV 3P4UB 3ITHB 3UDEA 3ZZPA 4NMXA 3Q8RB 2BOPA 1WOSA 4WE1B 2N7YA 3W61A 4C3LA 4M5DB 4K4WA 1SC1B 2QA1A 2QGFB 3IWNC 4FVCA 2VOPA 4ETZA 4CM2A 4IRCA 4HHUA 3LPYA 4FYDA 3W60A 2RVJA 3R5GA 4E0DA 3CNQP 4I2QB 1BY9A 1SH0A 4LF2A 2EFVA 4F4XA 1YJWS 2JVRA 1YVFA 4MH8A 2EEYA 3JS9A 2M0GB 4OZ5A 3CJ5A 4JI5F 2PI4A 3GWCA 2V4JB 3UI3A 2MQ8A 3VGUA 1XR6A 3CMAS 2CJAA 2VHGA 1JLQA 3OTOJ 2EC0A 3LA0A 3I5BA 5E7OB 5KFIA 3UO0A 4IOCQ 2L48A 1ZM9A 2VFRA 4Y34A 3D6MB 4DPWA 5DG7A 1A7GE 3D3CJ 3ZZRA 4C7QA 4FF3A 5L38A 3ICLA 1QM9A 4FBUA 1VQKS 3PR5B 2BQRA 1TTHB 1QAYA 4ZVOB 4ZPVR 2A18A 3DGPA 4DUYJ 5KG2A 2VQEJ 4RW9B 2BJ3A 1RT2B 3T19A 2XI2A 4WKYA 2O66A 1YWXA 3PJWA 2PMHA 2B9YA 1RCXB 3BV8A 3CDUA 2BJEA 4H4KA 5KFPA 1X5PA 5J2QA 4F3QA 1T95A 3GZ7A 4ZPWR 5D4OA 4FKYA 4LFCF 1CC8A 2NXNA 3DXBA 2QV6A 3H98A 2IY5B 1RWOB 1QUVA 1ITPA 4CRJA 4B9NA 1RHRB 1TR0A 2ZHAA 3WBZA 2JEJA 2JL9A 1N33F 2NPIA 2KFYA 1B0PA 3CDBA 4JI7F 3RYLA 3EZ5A 4HR2A 2CDRB 2AJ1A 3OR2B 1XIQA 4NLYA 5GVQA 3P8BB 1KWMA 4L3KA 3HULA 2QL7B 3RBZA 3W66A 4AFFA 1FF2A 1KS2A 2R7XA 1Y9OA 1GXLA 1X4GA 1FDAA 2IA6A 1FI4A 3TAQA 5LJ5Y 5A6PA 4TKTA 1JLAA 2ZUAA 3LGNA 1F60B 4MIBA 5K14B 5KFNA 2MDAA 2WSEC 4NPOA 3QAUA 4NLSA 3BBBA 4B9UA 3Q8YA 4LSNB 3K89A 3R5AA 2PFDA 1ULRA 2LP4A 3AXKA 5IT0A 2ZH9A 2E5LF 3FKBA 1NUEA 1J27A 4ETXA 3C3LA 1SL0A 2AZ1A 1KBRA 3J7ZT 1LK5A 1RTDA 4EK2A 4ZLLA 1DHMA 4P73A 1PAEX 4LVNP 1R8CA 2XMUA 1FFWB 2R7RA 5KFRA 5CYMB 2Z2LA 3PRBA 1U6BA 4OZLA 4USJC 1KLNA 4P72A 1YBTA 3H4BA 3LGMA 2J8AA 2RS8A 5J2NA 2J6TA 2APOA 2KZZA 3NL0A 2N3LA 3AFGA 5ETPA 4QWEA 3K8VA 3DRPB 1HQUB 4G1QA 1G4CA 2ILZA 1BLUA 4DR5F 1I6JA 3DYAA 1C1CA 4K7QA 1WC3A 2YTCA 1IBMJ 1S4EA 4K4SA 4UT4A 5LXYA 4ZVUB 2CNNB 4QU6A 2HWTA 2GAGC 1RT1A 1GAOA 2Z56B 3M2VB 4DX5A 4U95A 4DX7A 3EJMA 3VZHA 2QLBB 1TAUA 4U8YA 1MWQA 4J9QA 2ZOFA 4RUBA 4EMDA 2DKOB 1UETA 1C0TB 3MMCA 3CCMS 1G7CB 2YNGA 4KTQA 2A3JA 3V6HA 2WW4A 1HD0A 1I94F 4B3TJ 4DUTA 4A8YA 2CQIA 1DARA 1TKXB 2P9CA 4CT9A 1VDHA 4WZMA 2OEKA 3EX7B 1HMVA 4F2SA 4MKBA 2G9OA 2BXJA 4UY85 4B3SF 3GFZA 2V67A 2VA2A 1U1RA 1QE1B 1UL3A 4PCQA 2DR6A 2XMJA 4RR5A 3HFKA 5BR8F 2VC0A 3Q2SC 3EGVA 1RACB 4OI3A 1DQAA 3DI6A 4N41A 4M5NA 5EDWA 4CYUA 3QMQA 3NAHA 4FF1A 1TFWA 4Q7AA 4Y3CA 3CJRA 2MKHA 3EUNA 4J90A 1MMNA 2CPZA 2H51B 1QDUB 4Y6IA 3ADAC 1SVDA 4OJGA 4EGLA 4B3RF 3KK2A 3OFHA 3DDKA 2R7WA 1H73A 2R7VA 4KFBA 4OHWA 4J9SA 3G82B 1TP7A 2E7VA 1YJVA 3U02A 3RRKA 3T5JA 1RT5B 4U6PA 3M6VA 3GIIA 2ZH1A 3JSMA 1UA1A 4F50A 2FJVA 2W7AA 1LW0A 2LQJA 3FZ2A 3I96A 4AXJA 4O44A 4DR2F 3PYFA 5BYRA 2J9DA 2DB1A 1S1XA 1GH8A 4X4TA 1S72S 2MZJA 5ETSA 3KLFB 4DV3F 1TL5A 2HLUA 2V5HG 3UD5A 3KMQA 1IBCB 2LFVA 4WK3A 2XMWA 3T1HJ 1F0XA 2HFOA 4OIXA 1GXUA 4OJ1A 3DHXA 1DQ8A 2F3JA 2YPZA 3SZ2A 3W2WB 1ICEB 1RTZA 1SXLA 3OW2R 5J2MA 1Z4UA 1VQSA 4KO0A 1PYSB 3RUBL 3G6YA 5F0WA 2MKCA 3E51A 5F8MA 2J0WA 1IR2A 3WZ0A 3KG4A 4JBCA 2AYEA 4DV2F 2M3DA 2HZVA 4RNNA 3G9CA 1NDCA 4ALZA 1VOMA 4PPDA 4NASA 3BQ0A 3EWGA 4RPFA 1CJTB 4N7TA 2ZH4A 1K0VA 3M7VA 4LR7A 1KTQA 4A4JA 4NLRA 3K2YA 2Q43A 3KJQB 4ZCMA 3SV4A 4WF9Q 4QWCA 3TUPA 4CI0B 3PYEA 4KKOB 1RT7B 3PIOQ 2LA6A 1HNZF 4G1PA 1IJEB 4F8RA 1H74A 4NA2A 2G0JA 3JB9k 2MPUA 3CMES 1FFSB 1C1BA 2QMUB 3ENAA 3QGGA 4ZOSA 2LQ9A 3OPKA 1ZPWX 3FEXB 2RQCA 1Y0HA 4MFBA 1TMMA 2EPIA 2MQOA 4NLTA 4USMA 1U1KA 4M5GA 2CAJA 1OY9A 1Q81T 2V6AA 2LYVA 1WSRA 5LMNF 4CM0A 2KTQA 5KAKA 2I5JB 2YX1A 2O5DA 1WG1A 3H2LA 2ZITA 4QYZK 3WIVA 4I7FA 3MMBB 5ETQA 4XK8C 4AT1B 4ZIVA 1Y00A 1GX5A 4QWBA 2KM8C 4NI2A 4RW8B 2XO6A 4UQGA 4IDKB 3MCMA 2VIHA 1U24A 1IN0A 4YB6A 4RNFA 2UUCJ 1FRXA 1E6YB 4DOZA 3EYZA 3NCQA 1Q8BA 1S12A 4OX8A 2IC3B 2P6TA 2IMOA 4ZA1A 3BSCA 2YH0A 4L6V3 3O44A 2VD3A 1VQ7S 4RUAA 4IO1A 4F4WA 4R0JA 3ET6A 4J9RA 1WSVA 2I1RA 3CJKA 1YTYA 1JLEB 4U8VA 4EYIB 4ECRA 3J80U 3OUYB 4EUVA 3I0SB 4DSKA 4X4OA 5I4MA 5DQIA 2PSZA 4LF9J 2KHCA 4TY8B 4X4RA 2DNYA 3D0HE 1T9TA 2QLFB 2HQIA 1KQSR 3POTB 1D8YA 3BN4A 1FTCA 4FYVB 2BW2A 5CZXA 1KQGB 2FHOB 1P27B 4JI6J 7FDRA 8ATCB 1RE1B 4DI6A 3JQMA 1HBOB 1PG5B 2VG7B 2XNQA 4LRBA 1S7IA 4FVMA 4GO5X 1WOOA 4MIWA 1BQNA 2ZH5A 4IQMA 5D15A 3OXLA 5HAOA 5M2PA 2IRYA 4WFXA 4CZCA 3QQCD 3D1QA 3K5MA 2UUBF 3M8WA 5IZHA 4NYOA 3QIDA 4A8XA 1EETB 3R97A 2GHWA 3LWLA 4W90B 3NLCA 3QRPA 4U7UK 4G6VB 1M90T 1T03B 3DHWC 1NMEB 2OEJA 3W3SA 4ZS6A 3ILOA 4FZVA 1S76D 2Y1IA 5B0CA 2Z2YB 4J37A 2H65B 1TKTA 2X1BA 1D0EA 1AZSB 2VFUA 3THPA 3G6VA 2VODA 1H72C 3Q83A 1C0UB 3D6HB 1T3OA 4CH1A 3QGIA 1S59A 4KIAA 3QT5A 5HJXA 1S10A 5F8JA 2DVIA 5B0DA 3IAM9 2KFZA 3CD0A 3I87A 3BGLA 2YNHB 3HSDA 2FVSA 5HLFA 1RK8A 1GX6A 3SYZA 1FXLA 2C3PA 3DOLB 1TKDA 3ENQA 1BQMB 2HS3A 3LP1B 3MAHA 3QNWB 2IJRA 5LSRA 2DRAA 3LTOA 3KDOA 2B43A 3EVWA 1WC1A 1HPZB 2RU9A 4CTAB 1F5AA 2YQ0A 4DU7A 3US5A 1NNDA 3CJ8A 2XHWA 3OR1A 2WB1D 4DDFA 3MCOA 2U2FA 1LOUA 3C16A 2DJWA 2NQPA 4PXBA 3CCSS 1LXJA 1ZTTA 4NE9C 3R1LA 2UV8A 3ZFVA 4K4ZA 4TQSA 3P6YC 2PA3A 4JI4J 3CCLS 2G0CA 2YVSA 1JNRB 3QFWA 2VBWA 1CS4B 3NS5A 5K8MA 1BHNA 2CJQA 3PJXA 4YDDB 3SXLA 5A8KB 4ZVFA 1U26A 3EPIA 4KB7A 8AT1B 3M1VA 4QYRA 4RNHA 4TLQA 4QYZJ 1U8SA 3ONQA 2H3EB 3VCDA 1CULA 4MAKA 1X4EA 1NH8A 1GMUA 2BJ7A 4QPTA 2FJAB 5A76A 2DHXA 3TO8A 1XNQF 1TAQA 1XK8A 2AYBA 4CP5A 3THVA 3V81B 1IXKA 1I3OB 3P96A 2AU0A 3MFIA 2J9DE 2VB6A 1DZ5A 3SFUA 5KFQA 5DM7Q 3OD2A 2N4DA 4I56A 4NL5A 3V4IB 2V8GA 2PI5A 1N5QA 1KFDA 1CJKB 5CA5A 2R2TA 1X31C 2E5JA 3K7RA 1WC6A 3AHPA 2ASJA 5F3ZA 3KG0A 3W5ZA 1XR5A 2CJ9A 3GFYA 4PZVA 3MM7A 1MWYA 3MM5B 3W2VB 3MEKA 4C8ZA 1FRJA 5LM7E 2ZWOA 3MEDA 2R8HA 2DGQA 2VDIA 1IKXB 1EQMA 3BSOA 1HI8A 3QZ7A 2RB7A 2B0GA 5F8LA 4YY3F 1LWXA 3GIRA 3M32B 1N5SA 1RWWB 4CH0S 4YS2A 1XR7A 3UWTA 1JMTA 1PCAA 3LW5C 1SC6A 4XPEA 3A8KA 2GMJA 2OIHA 1ELOA 2CYYA 3KK3B 4OV1A 2H5JB 3U1NA 3TQ1A 3CCJS 3K59A 4DFJA 1Q1KA 2VDHA 1U09A 2WW8A 1MWZA 2DGUA 2QRRA 2H4WB 2ZOGA 4H54A 5C7PA 5D0RA 3K58A 1KHWA 1N5VA 2QMWA 3C66A 3I5AA 3BKUA 4B3MF 5HO4A 2H48B 5KFMA 1NEEA 1ZS6A 4K5RA 4PQAA 3ITHA 1NPPA 3HSZA 3GSIA 1W26A 4ZP7A 4M5DA
chains in the Genus database with same CATH topology
4LF7F 4ZHRA 3O5TB 4OZJA 2QEXS 1S77D 2W24A 2QT7A 3PY8A 1IBKF 2FVCA 2HFZA 3MM5A 3W2VA 2RE1A 2M5YA 4F4KA 4DN9A 3AY0A 4BWJA 1YI2S 1RTHB 4DFMA 1D9FA 2HNDB 3FVYA 4MYUA 3SEOA 3WC0A 4PPZA 4QR2A 1N5YB 3PO5A 2E29A 3MZIA 4B3OA 5M2UA 1VRTB 2PMZD 1IUJA 1WHVA 2J7WA 2DNNA 3F41A 4F25A 2R2SA 3FQLA 4WU3A 4M63A 4JOUA 1ZBTA 2HHVA 2EFOA 3Q22A 1ZOTA 2O3DA 2ZDOA 1YITS 1SKSA 4GKJF 3M6UA 4C97A 2ZJRQ 5DO2A 2NREA 1Z2LA 5A8RB 4P2SA 5GAGU 1N36F 1H3DA 1U7LA 5L1KA 2EKYA 3M32A 4NA3A 1TK0A 4C3MA 4R8UB 1LFPA 3HKWA 5KT3A 2UP1A 4ELVA 4QW9A 3AJ2A 3CC7S 2KT5A 1N4LA 2Q66A 3NGKA 2VPXB 4EYHB 5L9NA 2ZD1B 2JLGA 2JEIA 2YKNB 1HD1A 2LXFA 4AXIA 2CQ2A 4Q8FA 1FRLA 3MUMP 1SKWA 1HYSA 2J76E 2L9WA 1BQNB 1TKZA 1RT6B 1SQEA 1WHXA 3V6DB 4OI4A 4DBQA 4TXSA 3RB3A 3DLGA 5KT7A 3TNVA 1R7IA 2QIFA 4Y2AA 4M95A 3KNAA 1K8AT 1SIZA 3NMAA 2EG2A 3IG1B 4JI8F 4Y2KA 3B82A 4OI6A 3U1LA 2QO3A 3QPIA 4IYQA 4KGKA 3UW1A 5C5JA 3FSIA 1T05A 1R0AB 2V0NA 2EK6A 4LIWA 2N3OA 2DITA 3S6EA 3FRYA 2PGCA 4O4RA 1KQFB 3C46A 1V9OA 3CD5A 3LAMA 1HNIB 1L3KA 1X4AA 3B4DA 4C3KA 3T1HF 1M5KC 4KAIA 3UE2A 1XNRF 1AROP 4OZ0A 3JSYA 1AUDA 2Q6BA 1VC5A 3DNCA 3PX0A 3J7YU 2B51A 5KT6A 1VFJA 3AH6A 4WYWA 2M70A 5GAHU 2MKSA 3KFWX 4NX9A 2RMLA 4DV0F 1S79A 3MURP 2AGOA 5HMXA 3HO1A 2OFHX 3N6MA 2UVWA 2DD8S 4Q2LA 2OH2A 5K8PA 3E01B 5B08A 4DS5A 5LSLA 3QLHB 2ASYA 2JHEA 1TV6A 1WWHA 3GE9A 4K5SA 1UVMA 2BDPA 2YKMA 1B64A 2EW9A 4B9LA 1UKUA 4USHA 4IR9A 4DG1A 5C25A 4Y65A 3DMJB 3OSNA 3VAGA 2CPXA 2E66A 4CO1A 2O01C 1WI8A 2AYMA 3HVAA 4V19J 1RT4A 3HP6A 3H5UA 2KO1A 1ZH5A 2LQBA 3CXCR 2W9BA 3PKMA 2B7BB 3BGRA 2VFSA 3DM2A 2QMXA 4ICLB 3EGNA 5E5NA 1REVA 3MM8A 5SZTA 4ECZA 2JOQA 2CQDA 5E3QA 4F4ZA 1AW0A 3SFGA 1OPIA 2KT3A 4K59A 5F41A 4CIOA 3V6JA 3RAQA 2LEAA 3AQPA 2DGSA 3KYLA 3TI0A 4MKYA 4F26A 4DLGA 1FNMA 2DR5A 2J0QD 2D9PA 3GYXB 3N28A 3O3LA 1YG0A 3PRDA 1SL1A 2BA9A 3DN9A 4E98A 5DGBA 2MZRA 1NH7A 1K1QA 3K0JA 2QFJA 1RTHA 2R2UA 1M5OC 2KT2A 2HNDA 1Y5NB 2ZZMA 2VKRA 1N5YA 1FXRA 1VRTA 4G1IA 2HQ3A 5KFSA 2M88A 2ROEA 4Y2MA 1HWUA 3TR5A 4LF6F 3O6QA 4C11B 2KYZA 3HM9A 2XMVA 3M9NB 4JV1A 1MW7A 5IXUA 5DG9A 5F3TA 5A8RA 1CEZA 4OI2A 1Q78A 4NRUA 5B0GA 3U1MA 4RNOA 1C2PA 4BC9A 3I9ZA 4R8UA 1YSJA 1FTRA 1KRPA 2K3IA 4KRWA 1SJ4P 2V8HA 1CG2A 5BYQA 2XO7A 4IOBA 5F8HA 1RQ0A 2ZD1A 2E7XA 2YKNA 1Q86T 5F8GA 3K57A 5CXTA 2GV1A 2VFVA 3FCHA 3K5PA 3MEGB 1RT6A 1VQ4S 3I9V9 4KV8B 5HMWA 2RKIB 3V6DA 2FLOA 3SCKE 5EWEA 3SQGA 3Q8SB 2ZHOA 4JV0A 2F8MA 3DU5A 2NXUA 3BQ1A 1SH3A 2HHQA 2E5GA 2X1AA 2CQ1A 4K4YA 3IG1A 2JEGA 2JLFA 3M8PB 4RU2A 3AJ1A 5IT9Y 1Q79A 5HBMA 2FJEB 4QIFA 1R0AA 2K7JA 4HVZA 4WFZA 2J7UA 2GW8A 1N88A 4I6AA 2KJWA 1U1QA 2XS5A 2OO4A 3PDNA 4PWUA 3HVTB 1QSYA 2V8VA 1ZM2A 2E1RA 4ZPBA 5AXMA 1FRKA 2W9CB 5JVGQ 1NO8A 1HNIA 3F56A 1S1UB 3IS9B 3TX8A 2BRKA 2OLWA 2W8LA 5DRKA 1JX4A 4KHMA 1AFIA 4X66F 3BO2A 4WIIA 2A2DA 3D28A 4QBUA 1QJHA 1SJRA 1MMLA 1R8HA 2MMYA 4NZ0A 5L9XA 1FCAA 4QW8A 3VR1A 2L41A 3MPWA 2KVIA 1FKOB 3E01A 3N01A 2B9XA 2R8GA 2HPUA 4CNYA 3QLHA 3L95X 3IRXA 2BE2B 2FDNA 2LKZA 2CVEA 2YKAA 2QA2A 2CPYA 4FNHA 5DM6Q 2RRAA 1VIOA 4C8OA 3OVBA 2GGPA 3MECB 3DMJA 2XGPA 1CC7A 1S6PB 2D9OA 5K14A 2NS1B 1V6HA 2PO4A 1Q7YT 1KN6A 3EZUA 5L8RC 5FLXY 1IM4A 1DFDA 5IS2A 2BACA 2MZTA 3IWXA 3GFXA 4ZCKA 5C24B 2HNYB 5F8NA 1KEKA 2CPHA 2Q1LA 3IR7B 3NCRA 1NKCA 3RRHA 2PE8A 2CQBA 3U7JA 4PR6A 2OTLS 2NUHA 1A6LA 1LWFB 4KGMA 1XMOF 1RKJA 1BD6A 2WRMA 3VAHA 3VZIA 2XB2D 2ZBCA 1D3WA 2XLKA 3CULA 2D1CA 2GO9A 4XIUA 3R5BA 4DL4A 3JAMY 5G0RB 2YX4A 2BANB 4I68A 3H40A 3HJFA 3M1VB 1UFLA 4C8MA 2HLTA 2ABYA 2LDYA 1KOHA 4OLOA 3KLHB 3G96A 2B6AB 3NS6A 3CCES 4DR1F 1N0VC 1E6VB 3CCZA 3BN7A 3N0VA 5CYMA 3QO9B 2AW0A 3Q23A 4NOHA 1S6QB 3TA0A 1U1MA 2J7KA 4C11A 4CQ1A 2KRBA 4C8LA 1VIXA 2C22A 1FKPB 2ZDPA 2VG6B 1U49A 2FHJD 2DO4A 2FVQA 2KI2A 3R5DA 4YUDA 5DDPC 1NB7A 2IVFB 3DLHA 1RA7A 1SBRA 4TN2A 3HF5A 3CF5Q 1HI0P 2YQ3A 5I42B 3G4SS 2MSTA 4N8NA 4DF4A 3RAMA 4DV4F 3OSPA 2QA4G 4PG8A 4DQPA 4IKAA 1IKYB 4ECWA 1X4DA 2AJFE 3B8HA 2EFGA 3MEGA 1SJ3P 2UUCF 2W7OA 2RILA 5D3GB 4KV8A 3FMWA 2XCPA 2K7KA 3N79A 1W2BR 5KG3A 2WK4A 5EX0A 4DL2A 2XMKA 1P1TA 1V3SA 1Y3KA 2XZWA 3E3XA 2Y1JA 3AB2B 2CQ0A 2HVIA 2R8IA 1WI6A 3LOUA 2XGQA 4YR0A 3KMSA 2OPRB 3M8PA 5K8OA 5HROB 3UCUP 1X4FA 3RR8A 3DRPA 3MPVA 1BQXA 2CQHA 1AXQA 1HQUA 5KTQA 2QLWA 1HBUB 3OFEA 3HVTA 1M5HA 3VAKA 2YNFB 5D4PA 2R7TA 2W9CA 3MUVP 1FJCA 1S1UA 3R27A 1OS5A 3DOMA 1DLOB 3EXCX 2QYCA 5I3PA 5EN1A 3NG8A 1FDNA 3LWMA 3HHDA 3PIPQ 4YQWA 4ELUA 4K2XA 5F9NA 1VI7A 4YB5A 2C3UA 2F8EX 4ZKAA 2MGZB 2W9AA 2DCLA 1UVLA 2VONA 3EPGA 4XAKA 1S99A 4MK9A 1U45A 3H59A 4X62F 1S49A 3CB4A 3NMRA 5H9FJ 4RUCA 2Z8QA 2VBYA 3ISND 2JFDA 4E8UA 2V4RA 1VQMS 1PC5A 7FD1A 3M2UA 4ZPAA 4ZVGA 2BE2A 1FD8A 1Y7PA 1VHFA 5BJRA 1QAIA 1LWCB 1GQEA 2CQCA 3MECA 4IH6A 2DPIA 2FGCA 2JZ5A 3DLEB 2R4FA 3BF4A 5HI7A 2BR0A 4I64A 3QJPA 3TP2A 4OJHA 2LU1A 1VLYA 3UPFA 3SV3A 5A0YB 1S7HA 1UVIA 5H9EJ 1KQKA 4LF9F 1RT3B 3DC2A 5HQ8A 2IJFA 1D9DA 4DL5A 3OL8A 1TVRB 5C24A 2HNYA 5KFWA 3PX6A 3MEDB 1H38A 1SH2A 2QSWA 3GV5B 2L9DA 1LWFA 2EFNA 3DOKB 2UVVA 1RISA 3IN5A 4IFVB 3T5LA 3MDFA 1N34F 1LXNA 4C0BA 2UXDF 4DR4F 4WYLA 3MCSA 4FS2A 1DTQB 1BWEA 5L1LA 3KLIB 2B5JB 3ENVA 2LU2A 5G0RA 4OI1A 1S97A 1B0TA 4LUBA 2BANA 2OMLA 3CE8A 2IM3A 3KLHA 3MM9A 4MIAA 1YRTA 1G6BA 2B6AA 4DPOA 4R5PB 2XEXA 1E6VA 4JI6F 3MF5A 1WG4A 2RIJA 3QO9A 2QZ8A 4MKAA 1S6QA 2DH9A 5F0UA 2WCXA 5B0BA 1QTMA 1OQ3A 2B56A 2JDJA 1FKPA 4F2RA 5KFFA 2VG6A 3HPOA 3R3TA 2KYXA 4CO2A 1JNZB 1HWJA 3MM6B 1FE0A 2WBRA 4U9RA 1VQ5S 2J0SD 2MZQA 2VUGA 3AB4B 1IKVB 5I42A 3S01A 3BB5A 3CDEA 4QIEA 3OTBA 5AJ3F 1PGZA 4YDXA 2FLNA 4JI3F 3CD7A 1T3NA 2OD4A 5KFAA 1EP4B 2BV3A 1YHQS 3OLAA 1RJJA 2P5VA 1S0MA 1IKYA 3VTIA 1WNEA 2FUG9 2IRUA 5LXRA 1G2EA 1Q8LA 4LF4F 5D3GA 1UEVA 3LP0A 2NLWA 2GJ2A 4ES1A 3PEJA 3GIJA 4A8KA 1N56A 2GQQA 3I0RB 4URSA 2F8HA 3P3DA 2ZNZA 3KG1A 3WC2A 4AYBD 2DGWA 4B9TA 2LCWA 2MHNA 1H7WA 1X8DA 4Z2XA 4G3IA 2XNRA 1CPZA 5D4NA 4X4PA 1YJTA 4IH7A 3LAKA 2BM0A 4O0IA 5J1EA 3H25A 5F9LA 1KLMB 2E1AA 1HA1A 1HBUA 2PT0A 3AA8A 1SKRA 2YNFA 1N8RT 4HI1A 4QR0A 4IFYB 4HH0A 2KJVA 4RW7B 4EZ9A 5CYQB 2UV8G 2QLXA 1DLOA 2E7WA 3N5FA 1QSLA 2CZ4A 2OJ3A 5MLCV 4XDCA 1WTFA 2NPFA 3CC4S 1H6KX 4DEZA 1XMBA 3HHLC 3IGVA 3ITHB 3ZZPA 2W7PA 1JJ4A 5DLFA 3Q8RB 2AGPA 2BOPA 2JVOA 2IBKA 4KJIA 4WE1B 4ED8A 2N7YA 4C3LA 3RTVA 3KWMA 1HBNA 2VOOA 4ILMA 4RBVA 4GKKF 2E9RX 1WHYA 2MSSA 2MQPA 1R8BA 1LWCA 3GG0A 1NKBA 4M5DB 1S1WB 4ZHRB 1HHSA 3DLEA 3MMAB 5J2QB 1BGXT 3NNHA 3TAMA 4K4WA 1A9NB 2CQ3A 2BQUA 2QA1A 4HLBA 2O1PA 1HR0F 3IWNC 4FVCA 5LMUF 4DMZA 2ZZNA 3VAIA 2VOPA 2RU3A 4ETZA 1URNA 3OHAA 1HWKA 1RT3A 2N4CA 3FNNA 4JI1F 4IRCA 1UFWA 2FHKA 1TVRA 3IA0A 1UAWA 3LPYA 5SUHA 4FYDA 2RVJA 3IRWP 5E3AA 1NJWA 4U67Q 2BJDA 3MR6A 1TK5A 1FT8A 2DO0A 4E0DA 3U27A 3SDEB 4I2QB 1Y3JA 2KDOA 3FGVA 4IFVA 4I4BA 1BY9A 1SH0A 2ZFHA 2HHPA 2RRBA 2AQ4A 2EFVA 5KFUA 4ID8A 4TY9A 4F4XA 2CPIA 4TYBA 1YJWS 3DLBA 1J2VA 2J6SA 3KLIA 1ZZNA 2B5JA 2JVRA 1YVFA 2CKWA 4MH8A 4PXCA 1SUQB 5DDRC 2KXNB 3GYNA 1L3UA 4LMZA 2M0GB 2H5EA 4R5PA 4W92B 1FERA 3M4XA 5E41A 3KK1A 2FB0A 4OZ5A 3CJ5A 2Y0SD 4JI5F 1F5BA 2PI4A 3GWCA 4ZP9A 2V4JB 3UI3A 2AV5A 4C98A 4LF5F 3HLUA 1JJHA 1XR6A 2DGVA 2UUWA 3CMAS 2GC8A 1R6YA 2SXLA 3PM9A 1SI9A 3CSKA 3RW6A 2EWHA 3D1HA 2U1AA 2CJAA 2FC9A 3OL7A 2UU9F 4X4UA 5T41A 1JLQA 2EC0A 1NRKA 3C2PA 1S9EB 4YOEA 4EZ6A 1IKVA 2C3MA 3I5BA 4EO6A 3TAPA 5EWGA 4KT0C 5E7OB 2V94A 4HDGA 4A8WA 4DR6F 5KFIA 2KH9A 1YGYA 1NK7A 3G8TA 4IOCQ 2R7UA 2IHR1 4JI0F 5CD4H 2L48A 1ZM9A 2VFRA 3DCAA 2HVHA 1TK8A 4YEAA 1OWXA 4NWBA 3UR0A 4Y34A 3I0RA 3M8SA 2KU7A 4M1KA 1HNXF 2F7VA 3ENWA 4O3RA 3PV8A 2DNLA 5KFEA 1NK5A 1SB6A 2HHTA 4FP9A 3MD3A 5KFLA 5DG7A 1A7GE 3UCGA 3MPYA 3KLFA 4ZMMA 1TV6B 3ZZRA 3MOJB 4N47A 1JLAB 1KLMA 2YKMB 3BR8A 4C7QA 4FF3A 2HWIA 5L38A 1AFJA 2F40A 5EX3A 1NK9A 2WBMA 3ICLA 1QM9A 3TANA 2AYGA 3PR5B 1VQKS 4A8OA 4FBUA 2DK2A 2BQRA 4IFYA 4RW7A 4ED3A 5CYQA 1QAYA 2NUUG 5KFVA 4RZRA 4ZPVR 2A18A 3DGPA 1OO0B 4Y00A 3PX4A 4ZVEA 4LQ3A 5KG2A 3JSBA 4RW9B 1RT2B 3T19A 2XI2A 4WKYA 2IAJA 2O66A 1YWXA 3PJWA 5CCLA 2PMHA 2B9YA 4WE1A 4J9PA 2ROGA 4J5OA 4JI4F 4TU7A 2OMOA 2E5HA 2DR7A 4I2PB 1S1WA 3CDUA 3J7Z5 1R89A 2BJEA 4H4KA 4N77A 5KFPA 1FKAF 3MMAA 5KOWA 1X5PA 2MQMA 5J2QA 3T5KA 3QJLA 2DH7A 4F3QA 3ZZYA 1T95A 3GZ7A 4F3OA 5IQ6A 2MJNA 5DS7A 5KG0A 5K9FA 4OQJA 5FIIA 1U6ZA 1YRXA 4A46A 4ZPWR 2XWXA 5D4OA 3SDEA 4LFCF 4I2QA 4USIA 4WFBQ 3PO4A 5AXKA 2WSCC 1CC8A 2MZSA 2PEHA 2XWYA 3UD3P 3M6XA 4WK1A 1IJFB 2R8KA 1RA6A 4P7TA 1VRUA 3DXBA 4EWTA 3KLVA 2HHHF 1X9SA 3MTJA 2QSFA 2QV6A 2GHVC 3H98A 4O3SA 1SUQA 4O3PA 2B7CB 5HMZA 2DHSA 1QUVA 2DCUB 4B9NA 3IFEA 4FXVA 4B08A 1TR0A 2ZHAA 3GIMA 1QY7A 2V4JA 4IR1A 1N5TA 2VBZA 3WBZA 2I0XA 4DFPA 1M5PC 2JEJA 3WDOA 1VQLS 2JL9A 1C4CA 4ZCIA 2D3OR 3QIPA 2ADBA 1N33F 4NMLA 3SQGB 5J2NB 2NPIA 1FA0A 2M9KA 1QUPA 5EUHA 2BM1A 2KFYA 4X84A 1B0PA 2KXHA 2DIUA 3CDBA 4K50A 4JI7F 3RYLA 3KHRA 1S9EA 3EZ5