4FPRA

Structure of a fungal protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
AYVCREASISGEIRYPQGTCPTKTEALNDCNKVTKGLIDFSQSHQRAWGIDMTAKVQCAPCKTTDPWDVVLCTCKITAHRYREFVPKIPYSSFSSAPGVIFRQETGLDHDPEWVVNMKARTRGCDHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Avirulence Effector AvrLm4-7
publication title Structure of a fungal protein
rcsb
source organism Leptosphaeria maculans
total genus 29
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2910 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fprA00
4FPRA
chains in the Genus database with same CATH superfamily
3V6DB 1YX2A 4TY8A 4ZCKA 3MAAA 4DLGA 1S1UA 4UOFA 1SIWB 3MM9A 3D3CJ 3JAMU 4TVAB 1N6QB 2C2ZB 2BOPA 5DDQC 3V6KA 2VJVA 1D09B 2B7BB 4JI5F 5DGAA 2VIHA 1OYEA 3M9NB 1RDRA 4HHUA 4F8RA 1T7PA 2O67A 4GRSA 2FB0A 1SC4B 5KFUA 5D3GA 2GV1A 2FLNA 4PWDB 1FXLA 3BEGB 3TR5A 1WACA 2ACYA 3UDEA 4JI1F 4UTGA 2Y0BB 5IZHA 3DLLQ 2HIQA 2JVOA 4A8QA 4KHRA 2OTLS 3ELHA 3UNGC 3HJVA 4GVBA 1DQAA 3MEGB 4RL1A 4ED7A 1N56A 2KRRA 4V19J 2E5LF 4K5RA 4OX6A 4X2BA 5AXMA 4WZQA 1B0VA 4P74A 3VAKA 3GIMA 3E01A 1SUQB 5CYQA 1DTTB 3CDBA 2HGMA 1FTCA 5IQ6A 1FNOA 3SV4A 5DM6Q 3T5KA 2CQGA 2AEJA 1FDDA 3LO3A 3IP0A 3QYYA 5IT9Y 1EKRA 1GTHA 1KQKA 4CLTA 1HHQA 3TQEA 1RABB 2QLFB 4PQAA 1VQ7S 4WKRA 4YR3A 3LTOA 4HT7A 7AT1B 4DFJA 4K0KF 5ETKA 4QIGA 5HLFB 1YRXA 3P8BB 4RW8B 3BREA 2B7CB 2E5GA 3V6DA 4W90B 2FLPA 4B9NA 3FZBA 3KG1A 3Q8RB 2X1FA 1Y9OA 7FD1A 4Q0BA 1HHTP 4ECYA 3I56S 3K5NA 2ZH3A 1S7HA 1SI9A 2KYXA 5DRKA 2NUHA 2AYBA 4L76A 1HD0A 1S9EB 1RAGB 2QLBB 3DXSX 3MM6A 5HP1B 3G6VA 2CQPA 4J9UE 4ILLA 1K1QA 2LU2A 4LIWA 3UD3P 2GZOA 4PWDA 3NCQA 2GO8A 1B0PA 4FP9A 5LSRA 1FRIA 3Q8VA 3FBBA 4IH7A 1VRTA 4DR4F 5U47A 3RRHA 5B0DA 1UFWA 2JC1A 5DO2A 1X8DA 4PXEA 3B4DA 1FKPB 5F0WA 2AJ2A 1IBCB 1HMVA 4ENOA 2VQEJ 1OS5A 2CQ4A 1VFJA 2IM0A 3G2XA 2EFGA 4N8NA 2B4UA 2KFYA 2LXIA 3NOCA 3TUJC 4RBUA 2KFNA 2XMUA 5CZVA 2FHMA 1R0BG 4RU9A 2KZZA 2V4QA 2XLJA 2HNYA 1O51A 2RRAA 1XN9A 5JJBA 3OFFA 5J2NA 1T9WA 2ZKUA 2AMCB 9ATCB 2JLEA 2P8IA 2UXDJ 3FFIB 2R7OA 1ZAWA 2XTJP 4QIWD 2J8AA 4N77A 2HHQA 3CDUA 3K17A 2B8QA 5B0FA 3W66A 3S8SA 3QZ7A 3BSCA 2Z0GA 5KAKA 5KG0A 3FQKA 1UZHA 1SQEA 2EFOA 3CJ5A 1GK8A 2LP4A 2XMJA 2V8PA 4F50A 2XMVA 3NOGA 1WSVA 3MCMA 5HMYA 1UEKA 4LSNA 3RRGA 4WXWA 1HYSB 2AW0A 1HWKA 4ZLPA 4C0OC 2RDDA 1ZPWX 3I31A 3RB6A 5MAOA 2M9KA 1VS3A 2OUGA 4DUTA 1LNQA 1Q8LA 2XY5A 4DPOA 3IMQJ 2NSBA 2QE5A 4CLZA 3CC4S 4JP8A 3JQJA 2CQHA 2DNKA 3T41A 2XZWA 3GYXB 1MSWD 1JLFB 1KHVA 4NMXA 2CFXA 2GQQA 3WIUA 1FXDA 1RWKB 1RQ0A 4I0WA 1DJ0A 2NQPA 2DGXA 2JOQA 1U4BA 4ID5B 3MMAA 2VBYA 4A8XA 4DXLA 2W4PA 3HKZD 1RWNB 2W9AA 1B4SA 2XZTB 2J5AA 3VGVA 4Z7YA 2E66A 3RZAA 2VHGA 3TP2A 1JJCB 3DLEB 4CM2A 3CIMA 2J7UA 3IR7B 5HANA 1W7WA 4UUWA 3B8HA 3D66A 3R2CJ 4YB5A 1IBKF 4YEAA 1KVIA 4NLSA 1HI1A 1DQ9A 4P2MA 1JLGA 2UVUA 1H7WA 5LSOA 4DV6F 4KT0C 2IRXA 2DISA 4A8SA 1B3TA 3U1MA 4A8MP 1LEOA 3HFKA 5EWEA 4ANCA 1OQ6A 2DIVA 2G2OA 2CQ0A 4E2FB 2DNYA 1IR2A 1X5TA 2IVMA 4X66J 2G13A 3BGRB 1CPZA 4ANDA 2GMLA 1IWAA 3ISZA 4HACA 1M5HA 1NO8A 4LF8F 1J2VA 3ZZYA 1UVJA 5C7PA 3JSRA 3OVBA 2GA7A 4HEA9 2AGOA 4DL7A 3CPWR 4QR0A 2J6UA 4G1PA 1K73T 4JI2F 4X62J 4C6AA 4RZRA 2VPYB 4UF4A 2NXUA 3PYGA 4AL6A 4DSEA 3JSYA 1NK7A 1OYDA 1RT2A 2R7TA 2VFUA 5HO4A 3AOCA 2GAGC 3KJFB 1PCAA 3M8PA 4ZOSA 2ZJRQ 4JI4F 2IMOA 2LQ8A 3DMJB 3U7JA 1NZ8A 4LR7A 3KKFA 4LF9J 4WFBQ 2E44A 1RWXB 4DPWA 1G6BA 4G1IA 2DH8A 2M8DB 1CG2A 2QA4G 1HW8A 2VOOA 5KFGA 3WIVA 3J81U 3SV3A 1N8RT 2VBWA 1WKJA 2MKKA 4KY3A 4ID5A 3CCSS 4QU6A 3TANA 3QLHB 2HS3A 3M30A 3UN3A 2VICA 3M8YA 3D4JA 5GADU 4PG8A 2E5HA 3NY0A 5D0RA 5BYQA 4RJVA 3TJ9A 1NMEB 2MQ8A 2IA6A 3PACA 2UXCJ 4FYYB 4LRAA 3TVYA 2OMOA 1T3OA 5LMUJ 1MWZA 4LSZB 1IN0A 2Q6BA 3AXKA 5AE3A 4L75A 4AXIA 4A8YA 5GAEI 1N33F 4K4XA 2Y0SD 4EO8A 3NS5A 3R7SB 3M6VA 3GTYX 3CD6S 1DZ5A 4NYOA 4L72B 1IKVB 5AJ3J 3CMQA 4HH1A 5EWFA 4JV5J 1RT6B 2Z30B 2VV5A 3EJMA 3BQ2A 2R7VA 5KFLA 1BGXT 3HSJA 1VLYA 5D8HB 1HQUB 3ZNJ1 2VD3A 4DN0A 4RPFA 2X3GA 1KC8T 2JWNA 1I5OB 4KO0B 4MK8A 4JI7F 4O3QA 1N0UA 5D4LA 2YH1A 3CB4A 3GQCA 1LWCB 1WD6A 2L41A 2C2EA 5ETOA 1RAAB 1KLNA 1Q79A 3NCRA 5IM0A 2ZE2B 4TXSA 4NZ0A 3PFOA 2KU7A 4YHHF 5KG1A 3HX9A 5IT0A 3PDNA 2CJAA 3FBFA 3KDNA 3PNIA 1WI8A 3IG1A 3T6JA 3RJMB 2BACA 2V8VA 2GGPA 1FJGF 1R6YA 2B8PA 5ETNA 1UVNA 1LOUA 4U7UD 4UOGA 5KFRA 3R5GA 1UKUA 3P5TL 4CH7A 3CD7A 3OXFA 3JAMY 4BBYA 1PC5A 2CWXA 3CDEA 3I9V9 4J9LA 1H6KX 2CUYA 4EFAC 3C15B 4C98A 1S5ZA 1VIOA 1MN7A 4DLEA 1U6ZA 4FNHA 1WHYA 2XMTA 2MLYA 4IFYA 2XG8A 1XQIA 3CIZA 3NAIA 4M5IA 4KPYA 3HP6A 3BQ0A 3GSIA 3W2VA 5L8RC 1EB0A 1K8AT 2RS8A 3UI3A 2FGOA 3OD2A 4USKA 4LRBA 4QCLA 3DCAA 1Z2ZA 1SH3A 1DFDA 2W8LA 4QW8A 1U49A 2MKIA 4F7VA 4O23A 3D28A 1WG1A 1Z2LA 1NKBA 1QAIA 3J80Y 3O6QA 3QZ8A 4FVCA 4IG3B 2Q43A 2IRYA 2CPEA 3QWUA 5D4PA 3OVAA 3B82A 4K4TA 2AD9A 3MEDB 1K44A 1FESA 2UU9F 3V81B 2KZMA 3HT0A 3RR7A 4ZVUB 1WTBA 2DXDA 3MR2A 3C8YA 4DR2J 3EWGA 2DNZA 4EGLA 4DDFA 3G82A 1A7GE 4ED5A 2ZBRA 4J9RA 2XBPA 2KG0A 4M1KA 4M5DA 1SKUB 1VQ9S 1HNIA 1MWYA 2DNQA 2CJQA 4H4OA 1IWGA 4IOAQ 2N4CA 5M2RA 1GMVA 2Q1LA 3TQ1A 4ZA1A 2IDLA 5AXNA 2QSFA 4XDCA 3GJQB 2LQJA 4QJVA 3RAQA 5DLGA 1SB6A 2HVZA 1LFWA 2I5JB 3FC9A 2HQFA 2J9EA 4EBDA 1S9GA 1U02A 2B9XA 2B6AB 4B3RF 4KHMA 5KG4A 2C3UA 4LIRA 9RUBA 1R89A 4U8YA 1F9FA 1MW7A 2FLOA 1Q1KA 2FTRA 4RBTA 1AYEA 2DKOB 3R1HA 4LJMA 3VCDA 1JLAB 4HKQA 3THVA 2Y8YA 4AT1B 2QYGA 3QATA 4MAKA 3D54A 5KFVA 1MG7A 1TK5A 4OZ0A 2YPZA 1AUDA 1N5SA 4USTA 1RHRB 3ULHA 4LF5F 1PJ5A 2FJAB 4TKTA 2HVHA 4L6V3 2VA2A 2PA8D 2R8GA 3BB5A 4NRUA 2XSJA 1T05A 5K8MA 3A13A 4RKUC 5KFKA 4J9OA 1FKOA 2COLA 4X84A 4AQYF 2M5YA 2GJFA 4FXDA 3IS9A 2VG5A 1E6YA 1RT1B 3F41A 3VWSA 2KJWA 4OZ3A 4X65F 1U0HA 2YWHA 4XO0A 4KH1B 4DR3J 2EXUA 4ELVA 1C1BB 3SBMA 3PRVA 3ZZOA 3HDSA 1H2TZ 2B4VA 1U7LA 2GW8A 1IXKA 5FLXU 3TEHB 4EI2A 4I6YA 2UVRA 3D68A 3S01A 2IA0A 2BJ7A 3ILOA 5H1SV 1Q82T 5LSLA 2PA3A 4JI3J 1CC8A 2ZH8A 3AD7C 2EFVA 1X4BA 1Q78A 1ZS6A 4X4PA 4ELTA 3FK4A 2AJQA 2ZM6J 1VK3A 4EU0A 1NZAA 2KXHA 2GC8A 1H3DA 2YQ1A 4DR6F 2IRUA 4HDGA 3GYGA 2M7SA 3T1HJ 4FVMA 3JXOA 5IWAF 2ZBIA 2XMAA 2XMMA 2EFQA 3MM8B 2HS0A 4WFZA 1N34F 2DR5A 4M5MA 3HSDA 4ED0A 1D8ZA 2J0SD 2HS4A 5A8KA 4YN3B 3J7AN 4F04B 4X4TA 3PEJA 5A8RB 2B51A 2MHNA 4GKKF 2OPPB 3RG6A 3V4IA 2W9BB 2HHPA 4DSFA 3EZOA 1JMTA 3C14B 3T1YJ 1U2RA 1IBLJ 1R8BA 2CPIA 4LRDA 2RMLA 2JEIA 4ETXA 4ZP8A 5D0GA 3UQSA 2ALYB 1RTIB 1WI6A 4PAAA 3ZFVA 3RB4A 4LSLB 1J5EJ 1RU2A 1FD8A 3R3TA 4NCGB 3I87A 3ISND 5ETPA 2OD4A 3ZTOA 4ZVGA 2WVBA 1C1BA 2C3MA 3H8YA 2RDIA 3NRBA 5T14A 1RAIB 1GTEA 3K59A 1U1LA 4RWWA 2OSQA 2D9PA 1TQLA 2JLFA 2OEMA 3GU0A 3NS6A 3GG0A 3HHEA 4EEYA 1VDHA 2WTFA 3SSSA 4CO1A 4EWTA 2MKHA 2ZHBA 4ECRA 1UVMA 2ADBA 2U2FA 4FN5A 4P73A 4J9PA 3CJ3A 3US5A 5D4OA 1TKDA 2G0IA 1GMWD 1SVDA 1KTQA 1VQ6S 2V2QA 1RTJB 5I42A 2ZDOA 2GS8A 2RDJA 3RB0A 2KXNB 1RUSA 3EVOA 3GYNA 4P2XA 3NLCA 4CRJA 2HFVA 3LF0A 1GQEA 4CYUB 5HQMA 3RGIA 2C1EB 1WDTA 4OHVA 4DV7F 3PKYA 5L1IA 2Y1LB 1TL4A 3R5JB 2IVYA 2ZEJA 4OYWA 1C0TB 5EX3A 3VTIA 3AD9C 1U1NA 3OTOJ 4ZPWR 1PBAA 2WVDA 4ER8A 1VBYA 4MKBA 5A8RA 2ALZA 3LWMA 3CCRS 2W9BA 1UTAA 2DY9A 2HEKA 3H0PA 3WDOA 5L39A 1UVLA 3P49B 2HFZA 1M5OC 4MT1A 1NJIT 1LV5A 4IG0A 1TMMA 2RVJA 4L3NA 4PG4A 3W5XA 4IO1A 2E7VA 1Y10A 2HZAA 4FKXA 2R8KA 2DTJA 3DKDA 2OH2A 5JVHQ 2VDHA 4LF7J 4DFKA 2E1RA 3OTBA 1REGX 4U67Q 2HRTA 3P96A 2DHHA 2HIYA 2D74B 3HHKA 3GP9A 4F0KA 1H73A 2LQBA 1YZ7A 1RZMA 4LF2A 1QJHA 4RW9B 2R7UA 4IOCQ 1IKYB 4X4NA 4ES2A 3CCQS 3TVKA 5CCLA 1RI7A 3K8VA 4ITSA 1U1OA 3PG9A 2V34A 5J2MA 2WAQD 2F65A 4PUOA 3NGSA 1GNKA 3H2VE 3MGJA 1ZH5A 1FXRA 2R42A 5KFHA 1QTMA 1TU0B 3NNHA 4ATNA 2PMHA 3MZIA 1NJWA 3W9JA 1XMOJ 3ISNC 4CLUA 2RHSB 1HBUB 2BMBA 2YWFA 4ZMMA 1UVKA 4JI1J 1TKTA 3PW4A 2J9DE 1UAWA 1QY7A 2VL1A 1Y0HA 1ITPA 2DO0A 2ASLA 1U1RA 1WJ9A 2V4JA 1F3FA 4PQUB 2IM1A 5HBMB 1FE4A 1F9HA 3DLBA 1OY8A 2XQCA 2GJ2A 4G6VB 1RGVA 1LQ9A 5KFYA 4X4OA 2RQCA 4NRTA 1TAUA 4PEOA 3T19A 2HFOA 3M9MB 4N41A 2M0GB 2KL8A 3CD5A 2WW4A 5B09A 3UCUP 5I4MA 5F8JA 3DRRB 5C25B 1XK8A 5DG7A 2H9ZA 2WBMA 1YBTA 1S0OA 2GNKA 3R5AA 2UUCJ 1AXQA 1HWIA 1U8SA 5KFTA 3KK1B 4J9VA 5IQQA 3CSKA 2EI5A 2YWGA 3KJVB 4A8OA 1TELA 1RLDA 3M2UB 4M5JA 4OLPA 2J0XA 5EX0A 4IUFA 2VUGA 2HBRB 1RTDA 5J2PB 2RU9A 4BCAA 2UZAA 1CS4A 3FQLA 2VQEF 4K0KJ 4IQMA 3CDAA 3HD2A 3F56A 2OPQB 2PEBA 2BE2B 4FYDA 1X9SA 4DF4A 3U27A 2MQNA 3EZ5A 3CNQP 2DGWA 3HK2A 3TUPA 3ETMA 3A3NB 2DHGA 2HWHA 1TFWA 3DGPA 3W1YC 5KG3A 2X51A 4NA1A 1ZTWA 2NR0A 1MU2B 5C2CA 5E3PA 2G4BA 1N4LA 5CHCB 3G96A 2C3YA 3ZZUA 4NL5A 2UXDF 4WK1A 5LL6d 1RT5A 1LKZA 1NHVA 2HNDB 2KH9A 4WBFA 1S48A 1HL6A 1WOPA 4B9UA 4JI8F 2MTLA 1CQNA 2BA9A 4Z2XA 3ETOA 4R5PB 3KJNB 1D0EA 5A2QU 1VC5A 3Q8YA 1CJTB 4WIQA 3W2WA 4PG5A 3OTEA 2MZQA 4N76A 1T9UA 1RHKB 2PFFB 3TZWA 4NXMJ 2JJ4D 1KR4A 3M1VB 1SJRA 2RF2A 5BJRA 3J7ZT 4ZDNA 2YKNB 3FCVA 2ZHAA 2HVDA 3CJKB 1KNZA 3NWGA 1TVRB 2AKWB 2KM8C 5CAAA 3DYAB 3IWXA 3IBWA 2QIFA 1BQMA 1X5SA 4K50A 2MSSA 3GIJA 1P8GA 5J2PA 3BBCA 2NXCA 4C48A 3G4SS 1EAYC 1S6PB 3BGOP 3Q8PB 2OFHX 8AT1B 3QJLA 2BE2A 4CM0A 3A8JA 3EXYA 4GO7X 1IM4A 1TKXA 1SJ3P 4OL8A 3PCOB 2HHHF 5DQHA 1I1GA 2ILYA 2N3OA 2XCAA 1NSAA 1RWWB 1FNMA 3M8QA 3F0NA 4WK3A 3SFGA 3OLAA 3TZYA 1F60B 2ZVSA 1ZA2B 4ZKAA 1R8AA 1L3KA 2LDYA 3HULA 4DX7A 2O66A 3C19A 1S6OA 5HROA 1VLOA 4I6AA 3C66A 1WSRA 2HNDA 4YMEA 2YY3A 1RTHB 4LQ3A 1R0CB 3JQMA 5L9NA 1NPKA 1IJEB 1ZM4A 2FHOB 2IY5B 2UXBJ 2DGUA 4J37A 4LFBJ 1WC6A 3EGNA 3MR7A 4DV5F 4NCAA 1FVSA 2EG1A 2PO4A 2PI5A 4IDKB 4KGMA 2J6SA 5I3PA 3DRSA 3POTB 2CQ2A 2M88A 1TKZA 2JHEA 5G0RA 5KG7A 4ZLJA 1FEHA 2XMWA 1RP5A 3ENVA 2X1AA 2VDIA 2VPXB 2YKNA 4ZHRB 4X62F 3KLEB 2KO1A 1HR0J 3CJKA 4F2SA 1TVRA 2YNIA 2CNLB 5FLXY 4OYOA 5DG8A 3TJAA 2CWKA 3LUYA 2YQ3A 1PJ6A 5EHHA 1R6VA 1X4EA 1NK0A 1RAEB 2CKWA 5B0AA 1NDPA 3D6FB 4PG6A 2DBBA 4LF9F 1S6PA 4QYZJ 4QWAA 2ROGA 2K2PA 4LBPA 4QOTA 4ZVRB 3G6ES 1KWMA 4G1QB 3KYLA 2JFKA 4P9SA 1S0NA 2JLGA 1N32J 1GT8A 2CNKB 1IM6A 3D6MB 5KFIA 3ZXWA 2YNFB 2MZJA 2UXCF 3IR5B 1NEEA 2KRBA 1KFDA 1M1HA 1VMBA 3M2VB 2GAHC 1VRUA 1GMWA 5LMUF 2EK1A 4C0BA 1OPZA 3A8EA 1BQNA 4Y2AA 4JI2J 4C97A 1JLBA 3EPGA 4HVZA 2I38A 1U48A 4E8UA 5KG5A 1QUPA 5E0OA 5CYMB 2W25A 1F3VA 1FRXA 5AJ3F 3L3CA 4V1Ak 1SJQA 5CCMA 4JV5F 4LVNP 5KOXA 3H7HB 5A8WA 2RQ4A 3C6UA 3AJDA 2R8HA 1C4AA 5HVGA 3JTPA 1SKWA 3LAKA 3C46A 2YNHB 4CNZA 1YJVA 4C4WA 4IDKA 5KFOA 4J9QA 4EZ6A 4JI0J 2CQIA 5I3UA 1BHNA 4W92B 1HQEA 1D9FA 5B7WA 1FE0A 1S99A 4LFAF 2FZCB 4ZHRA 3TZXA 4I64A 3HCXA 1JKHB 2XYGB 4W98A 1HWJA 3TEGA 5JVGQ 2UUWA 1KRPA 4B02A 3AA8A 8RUCA 3TYTA 4OZ2A 3D3BJ 4L74A 4P6QA 2FVRA 4DR5J 4DSJA 2AIRB 4RR5A 2OO4A 3Q22A 2HRYA 2W8KA 1Y3JA 4CO3A 4KTQA 2BJDA 2YKPA 2PFDA 3VF0B 3AOBA 3S1TA 2F8EX 3ENWA 4G1QA 3QAEA 4I67A 4K4ZA 1IKXB 3WZ0A 2W9CB 3LQVA 3DFEA 5H9EJ 1XR7A 3BO2A 3H5YA 4QW9A 2PI4A 1Y5LB 4W4MA 3HHLD 4A8KA 1RWUA 1KKHA 2YNFA 3EVMA 3PKMA 2A0FB 3G87A 2W7OA 1HNVA 3OJUA 4I7FA 1YWXA 3ITHB 3G6YA 3O44A 5JMNA 4NLDA 4DUZJ 3P45B 3KMSA 4RW4A 3VALA 1KHWA 2CJ9A 4CT8A 2W01A 2ZVIA 3UD5A 4IOBA 2QL9B 2JEJA 1KVJA 4URSA 3VVTA 4Y2KA 2IIHA 1N5YB 5HK4A 3LP1A 2YWEA 1M1GA 5CYMA 4PRFA 1LW0B 3KLGB 3MAQA 1ROFA 3D7SB 4I2PA 1DHMA 5FDLB 1S12A 3V6HA 4YHHJ 3EDRB 4AE5A 2FJEB 1FEEA 4MIAA 4GO5X 4DS5A 5D4NA 1FVQA 1KLMB 2MKSA 4F36A 3PJ9A 5BR8J 3SSQA 3JSMA 5KG2A 5D78A 1S1TA 4DSKA 1VGYA 2F40A 1URNA 4X4RA 2AV5A 5F41A 2W7AA 1S49A 3IFEA 4Y00A 1S10A 3FEYB 3J7YU 3QGIA 3SQGA 1S1XB 1PYTA 3UR3C 2ZH1A 2DHXA 3R6LB 4QIVA 2BQRA 1HWLA 1NH8A 1WTFA 4DR2F 4RU2A 4C0HA 1FRMA 2BM0A 3PXGa 1P9YA 3NWRA 5KT6A 3AHPA 2C42A 3TOQA 3EUNA 1U47A 2W9CA 5F8LA 4O44B 1VQ8S 2BV3A 2FJXA 2AU0A 3ICLA 1NBEB 4HI1A 3M7VA 2B3TB 4CP5A 5A0YA 2Y3YA 2HRUA 1RT3B 1HLWA 1IUJA 3PRBA 1HI0P 1R43A 1TV6B 2QYCA 1BD6A 4I4BA 3X1LB 1HWUA 1RXOB 1S1VB 2XEXA 1CJUB 3H25A 3I0SA 4ECVA 3N5FA 1SH2A 2PDAA 3BH7B 3W5ZA 1XNQJ 2BW2A 4YR2A 2WRMA 1VBXA 5E3AA 3GV7B 2IAJB 3GE9A 1J5OA 2RKIA 4ZVFA 1LW0A 3JYTB 3R7NB 3HHLC 2WZ1A 3PY8A 3OXGA 5FDLA 1U09A 4UY8T 2VF3A 2OFGX 1JB0C 4KIAA 3CE8A 4EUVA 4KFBB 4NLYA 3H90A 4HT5A 4R25A 4C3KA 2A6OA 1EP4B 4N5SA 2OEJA 4DV1J 1SKSA 4ECQA 3MEEB 2IMWP 1LWFB 1KS2A 2QV6A 3LP0B 2K1RB 3ZZPA 2RUSA 1NLKL 3G86A 4ZCIA 1T11A 2QN6B 1X4CA 5KFJA 3BO3A 1MMNA 2BVZA 3FKBA 3DOLB 4CH1A 4KPCA 1A9NB 2Z58B 1F5CA 3MMCB 2EVZA 1FKAF 1VRQC 5J1PA 3G6XA 1UVIA 2HHSA 1UWBA 2RJZA 4CO2A 2MKJA 3FRYA 4AL5A 3AQOA 4DR3F 1S79A 4URGA 5HSPA 2ZD1B 4FBUA 1TUGB 2MY8A 3TJ8A 1DTQA 4UY85 1NU4A 5LMNJ 1ZA1B 1ZYQA 1R3NA 1T9TA 5DM7Q 1RT3A 4CLYA 2HYIB 2QFIA 3D6TB 2KHCA 3DI6A 2MZ1A 3I82A 1GX6A 2OTJS 2P9EA 4JI3F 3OFHA 3ZC4A 1FFWB 2IDEA 3QGPA 3N6MA 2UV8G 2G2ZA 3GIIA 5K9FA 2ZM6F 1JLCB 4YB1P 3BGLA 2MQMA 1KVKA 5KFQA 1SC6A 1KFSA 5LT5A 5A6PA 3OPKA 3L7PA 2D3UA 2XHCA 5DDPC 1WKLA 2LCWA 4EYHB 3T1HF 2DPIA 2R2RA 2JFDA 1UEUA 3KG4A 3O8WA 1QAYA 3W8PA 2HPUA 3PRDA 2H5EA 2DGOA 3C6TB 5DQGA 3DOKA 1H7XA 1F1BB 2G9OA 3BDEA 4FS2A 1N54B 5K5MA 1U26A 4Y34A 1ULRA 2ZWOA 3HKWA 4GKJJ 1QLNA 2LA6A 1L5UA 1H74A 4AD6A 3T1YF 1VQLS 1Q8IA 2ZC3A 1IBLF 4OZLA 5F8IA 2M2BA 1G1XA 2ZH2A 3KDOA 2V9WA 4USWA 2B4OA 4DU7A 3VR1A 4IO9Q 1J5EF 1TL1B 2XZDB 2V8HA 3KG0A 3B6BA 1REVA 1R0AB 5GAGI 3C2PA 2K3KA 4I69A 5HJXA 4CIOA 3TAMB 3QJPA 5EUHA 2MYFA 1HPZB 1IBMJ 3QMQA 2JH3A 5E3QA 4TY8B 4ZVOB 4OHWA 3MAAB 1S1UB 2UUTA 3HVTA 3NG8A 4MIBA 1JLEA 3MM9B 3MUVP 3B4MA 3IM8A 1J27A 4DZ6A 4DV0J 3DOMA 4ECXA 1W2BR 4LRCA 3JSBA 3MOZA 2BQ3A 1UJ6A 2AJ1A 1NHKL 5EN1A 1TR0A 1X0FA 3W64A 3IWNC 1NKEA 4K4UA 2KT3A 5D3GB 5KFXA 2OP5A 1SV5A 5E5NA 5T7LA 2QC3A 1I51B 4B08A 3DLKA 3VAJA 3DN9A 2BANA 3RUBL 3MD1A 1TZ0A 3QT7A 4QIFA 1G4CA 3T5HA 2MB0B 1ACMB 4GVBB 4IRKA 5GMEA 3R9LA 2YX1A 2BR0A 1QAXA 4WTYA 2CQCA 3BKTA 4DSIA 1VQSA 3E01B 4NLUA 5L1LA 1FNXH 1WKKA 4N56A 4OJGA 1PAUB 4RX6A 1AB8A 3AODA 3D6HB 5HQLA 4DQPA 4FBTA 5F8GA 3NMRA 1QVFR 3U1NA 2BRKA 2BJ3A 4F0MA 3OV7A 1IR1A 4DFMA 5BXIA 3CXCR 2RH3A 4HH0A 4PPZA 1LWEA 3EM1A 3TZZA 4ZP6A 1WG5A 2IPOB 4PYAA 4LF7F 3BN4A 2Q6CA 4FF3A 4HDHA 3CT9A 3R5BA 3PYFA 3DLGA 2ZOMA 2XHWA 4DJBA 1HPZA 3OL9A 3KJQB 1RYRA 1ZZFA 2VKZG 5MLCV 4QWBA 4DV7J 1V5IB 4UQGA 2R7WA 4TY9A 4B9MA 3CJ4A 1RT7A 4Q0BB 4CNYA 3C3LA 1CULA 3HLUA 2V69A 4WKYA 2P6SA 4JUZA 3UDLA 2O01C 3Q0AA 1QTNB 3MM6B 2DNMA 3UCGA 4ZVTB 2DITA 2FY8A 4OI3A 3EPIA 1XMOF 2VU5A 2FJWA 1Q8BA 1RK8A 4GC6A 3I55S 1U1QA 1JJHA 3QRQA 4LBIA 3RRKA 2CADA 2WK4A 1VRTB 2K8GA 4USHA 2NZ4A 1LFPA 5HMWA 2OMLA 4J91A 2Y9HA 4RUBA 5T41A 5M2PA 2OPSA 2QG9B 3K2YA 1HMVB 3O2IA 2GVZB 2Q3PA 3VV2B 1FJ7A 3H5SA 2EPIA 2OD6A 1A0OB 4I56A 3MM5B 1IQZA 5KFNA 1RU1A 2DIUA 4MFBA 2DGTA 4NLWA 1S57A 2OHDA 3IC1A 1C1CA 2ZJPQ 2FZGB 1RBAA 2MZRA 3RW7A 1GMUA 2UUCF 1S1WA 2YXLA 4C8KA 3EGZA 3VAIA 2HNYB 5J2NB 1PYOB 1NSQA 4OI6A 4OHXA 2VONA 5KFWA 3UN5A 3QFHA 2H4YB 4F4WA 5C24A 2LXFA 4TNOA 3MR3A 4O3NA 3SCIE 1P9QC 3BF4A 1B64A 3MMJA 4DI6A 1RWVB 2YNGA 3PZPA 4R8UB 4K2XA 5A6WA 1BQXA 2MGZA 2A2DA 1I94J 2CVIA 3I5BA 3PEHA 4DZDA 4LSNB 4B3MJ 1D8YA 3JQKA 3NNCA 1FO1A 1T94A 1Q0NA 2BKNA 5B0EA 1SXLA 4ICLB 4F26A 3MUMP 3W65A 3W60A 4NI2A 4P72A 1OY9A 2RB7A 4Z7CA 2ZZNA 2FJDB 4RO0A 1TL7A 3M6UA 1S9FA 3PYDA 1RTZA 5CA5A 2FVQA 3QWPA 3W3SA 3G8QA 4J5OA 3DNCA 3OUYA 3IBFB 2QL5B 2GVZA 5KFCA 1VYAA 5KFSA 4EZ9A 1FT8A 3MM5A 3GV5B 2O1PA 4CO0A 4NXMF 2MHEA 2XGPA 3MMAB 1VQYA 2EC0A 2V4RA 2NXEA 5C42A 2MY7A 4BC7A 2CQ1A 1Y11A 2JEGA 2WSEC 2DD8S 1RB0A 1U25A 4M63A 4UOCA 2XS2A 3H40A 1ZM2A 3H20A 3DU5A 2F1FA 5AE1A 4Y2MA 3RBZA 1T03A 1JLGB 4JI8J 4IFVA 1RKJA 2VOPA 5GAEU 1U1PA 3LW5C 3R97A 3AD8C 3EXCX 4YR0A 4R8UA 2HQCA 1RCXB 2DK2A 5G4DA 2J7WA 1NPPA 3S7RA 3BJYA 2V5HG 2YBVA 1D9DA 4HACB 4LF4J 3RBXA 3TA2A 3IRWP 4DV4J 1RHQB 4OYPA 2W2QP 5L38A 2I9SA 4TYBA 1D3WA 5ETSA 2P9CA 2BE7D 4ICLA 5RUBA 1SBRA 3GLJA 3FZ2A 4DCJB 3IO1A 5F3ZA 2L9DA 3L9ZA 1CLFA 2YH0A 3MPUB 1SQGA 1RT2B 2E1PA 1KDNA 3NP5A 3M8PB 2CG4A 1ZBTA 2UXBF 3NNAA 2EW9A 3EMTA 3VGUA 4LFBF 2RQMA 2FPHX 1B70B 2BOAA 5IT9U 3ILLA 1WELA 3UE2A 4J9SA 2OGUA 5LXYA 5HL7Q 1R8PA 1N5QA 2WOMA 3UO0A 3P3DA 2HHHJ 2E7XA 2F63A 4RW7A 4YQWA 1NAQA 1XERA 1FA0A 3A8KA 4MKYA 3M30B 1B99A 4MIWA 2AYEA 5K8OA 3GILA 4DPXA 3CCWA 3LGHA 4OZ5A 1HR0F 3UR0A 3QSYB 3CEDA 3OT9A 1RJJA 4NYPA 2AGPA 3ET6A 3OL6A 4ZPDA 2F9DA 3CCVS 2ROPA 3GFHA 3HZEA 4QYRA 5ETQA 1D1UA 1OSCA 4MKVA 2BKOA 3HM9A 2KXFA 6AT1B 1VBZA 2CPYA 3BDPA 4PYDA 2VA3A 2KJVA 4B3OA 1TFYA 2LDIA 4LUBA 1N32F 1WEXA 2UVWA 3OJSA 3OR1B 1IKWA 1MROB 4ILRA 3HZGA 5ETLA 4DV5J 2AYGA 4GC7A 1M5VC 4BHQA 3TA1A 3N79A 4A8FA 1FCAA 4QR2A 1OO0B 3L7OA 3Q89A 3MXHP 1T9VA 4KV8A 3I4PA 1RKIA 2Z2LA 2V68A 2NPIA 2QMWA 2ADCA 1ICEB 4PZVA 3UPFA 1RHMB 1SQFA 5ETMA 2B0GA 1CJKB 1X4FA 4FYXB 5F8MA 4U6PA 5KT4A 1AT1B 5JXSA 1SCJB 4RW6B 1PAEX 5IM0B 3WBZA 2M70A 1GFWB 4USVA 2QA4S 3BKFA 2Z2ZA 3IGVA 3M05A 3QIDA 3SFUA 1KD1T 4UT4A 2FGCA 3IG1B 5AXKA 2Q79A 4OYXA 4JI0F 4DQIA 2GGPB 2R4FA 3KLIB 4QWEA 3QT6A 4WXOA 1ZAXA 4NEZA 1XNRJ 3OSNA 4KAIA 3PJXA 2XS5A 3W5YA 2WONB 3M2RA 2ILZA 1UL3A 4P2SA 3GMGA 6FDRA 3RB3A 1HNWF 4U96A 4DL4A 3I0RA 4PKDB 2DVIA 4WE1A 4AFFA 1K47A 1WOSA 1TL3A 2JRSA 3CWJA 2F9JA 1H0HB 4DR5F 5SUHA 2CG8A 1CSJA 4ILMA 1HBNA 2D7SA 4KBIA 1E6VA 1PG5B 5FIIA 1YJRA 3AJ2A 4ZPBA 4IFYB 4M5NA 4NLRA 2VBXA 2HURA 1TUVA 3MPVA 1KONA 3NGRA 3W2VB 2VODA 4ED3A 3R5DA 3N6LA 3OR1A 3D1QA 1MROA 1U2FA 1S6UA 1JK9B 1SJFA 4OYZA 1JLQA 4Y3CA 3R8YA 3QT5A 2HHUA 5DLFA 2LVWA 1U1KA 2M8HA 4LRFA 4DMZA 4XK8C 1PYSB 4DUZF 2Y1JA 4LFAJ 5GAHI 2OSRA 3UVJB 3EDQB 2GX8A 1CJKA 4HTIA 1WEYA 4AUKA 1F6TA 2IM3A 3O3LA 1DLOA 5IC6B 3BPSP 3KTQA 2BE9B 3EICA 3MECA 3LALA 2ZITA 3BV8A 3R2DJ 2C2RA 4RW6A 2QRRA 1T9XA 3FSIA 4ZPCA 2KG1A 1LK7A 2I0XA 4ZP7A 3G82B 4ZVSB 1RA7A 3UCZP 3DM2A 4IH6A 5JUMA 1JXEA 4TYAA 2VFVA 3QFWA 3PX6A 3T3FA 4M5DB 3KLIA 1SC1B 1NDLA 1HNIB 4K2JA 4K59A 4LF6F 4DCOB 5BR8F 2D1CA 4H4OB 2BEFA 3NGUA 2WONA 3PX0A 1X7VA 5H9FJ 3BM7A 1NJZA 1XIQA 4ANEA 1HBOA 4NYZA 3GFZA 2XWXA 4M5LA 3BSOA 2PMZD 2F4VJ 1RAFB 3B54A 4KKOA 5L1JA 2XSFA 1NB7A 1S9GB 1WC5A 2XY7A 4XAKA 4DX6A 3HD1A 4MKAA 2A1BA 3H5XA 1HQ2A 2QMUB 3BH6B 3JTOA 2MJNA 1YZ6A 3GSDA 4B3SJ 4WP3A 5F3TA 4FKYA 2KYZA 1DBDA 4NPOA 2DNGA 2WHOA 4ED6A 3KHGA 4H54A 3UWTA 2HHXA 1RT4A 1CEZA 2CIMA 4P2FA 3IGNA 2DHAA 2JNJA 3N5BA 1WHXA 2YKOA 1UWAA 3AT1B 4EO6A 3MOJB 3A3PB 1FK9B 3VZHA 5HVHA 2VJUA 3AJ1A 2EFPA 2V2VA 2XSJB 1T05B 2A2CA 2CDRB 3FDSA 3UVJA 4IQXA 5AXLA 3OTDA 1FKOB 2H54B 5L1KA 3N01A 2FQQB 1NJYA 1XNQF 1Q8KA 2QA1A 3G9CA 2GIFA 5KT5A 2AEMA 3IS9B 2VG5B 4PXCA 4F4ZA 4PABA 3MURP 1E6YB 4C7QA 2V94A 1U0HB 2D41A 1TTHB 3MCNA 1XBWA 5AE2A 2IJNA 2KHDA 2RUGA 4ZIWA 1CQMA 5K14B 1JNRB 1VR6A 1U45A 2EC2A 4CO4A 1PGZA 1GXTA 2MMYA 3HHDA 3IXQA 2BJ1A 1YBUA 1YDLA 4M5GA 4FYWB 4ZP9A 4DV1F 3DLJA 3PHTA 1R7IA 2RSQA 2K06A 3L95X 2B5JA 2FC8A 5DS7A 2CQBA 4DL0C 3WQPA 3KLFA 5CYJA 1RWOB 4C11B 1S0MA 1JNZB 5DQIA 3K89A 2DYAA 2HSEB 1IQTA 4KHPF 2E9RX 3Q2SC 2UP1A 3T1AA 2VKRA 2DNOA 2KI2A 3CJRA 4NCBA 4ZIVA 2LKZA 3IR6B 2PEHA 2DPJA 4DG1A 2BKPA 3BBFA 3D0GE 1YJ7A 2YX4A 5LMNF 1M0SA 2OAUA 5CZXA 1IVZA 3DLHA 4MYTA 2UUAF 4X4QA 3CO9A 4IR1A 5A8KB 2DCLA 4FS1A 2O3DA 3RBEA 1FK9A 3SI8A 1JX4A 3V4IB 1EQ0A 1S72S 1UPMB 1M1KT 1H98A 2C2NA 2VFTA 2C2KB 4P10A 1X5PA 1EKSA 3TX0A 1N88A 2XY6A 1RBLA 4JV1A 2NXJA 2GMHA 3DC2A 1QVGR 2MKYA 4OJHA 3HFVA 2KKHA 1SH0A 4NWBA 5KTQA 1DQ8A 5K14A 1BMQB 2PD1A 2VPWB 4NOHA 2NXNA 2OJ3A 1V5VA 3FRZA 2JL9A 4NLQA 4DV2J 2DY1A 2KN4A 1K9MT 5J1NA 4GKJF 2ZC4A 1MMDA 2RD5C 4OQJA 3KHLA 3PV8A 5E41A 4BLGA 1MWQA 4R0EA 2HZCA 2EEYA 4OI0A 3G71S 3WHIA 1ZETA 1Y7PA 4KH0B 4DUYJ 4ZPTR 4X4SA 4Y2IA 4C11A 4CTAB 2X1BA 4C3MA 4USMA 1DY3A 1WEZA 2J8SA 1G3OA 1RHUB 2V9KA 4ECWA 4DU8A 3ZZ0A 2LEBA 2LECA 1WF0A 5I42B 3DRYA 3KXDA 1IBMF 2MQPA 3MDFA 4ECUA 2XO7A 1NSKL 1BWEA 4CLKA 3J80U 4LT6A 1K0VA 1S6QA 3LAMA 3K0JA 4Q8EA 4DV0F 2D3ZA 1X9MA 4OZJA 1YK9A 1NKCA 2QJ3A 3T9ZA 4DN9A 3G8TA 1YHQS 3IRXA 4Y28C 2GMJA 3VGTA 1F5AA 5KFEA 1YGYA 4C8LA 2DCUB 4IG0B 4DBQA 1CJVB 2E1MC 2C2DA 1MLAA 4KYZA 3CDWA 3Q23A 3V2UC 3GIRA 2CPDA 2XLIA 1FD2A 1JIHA 2XWYA 2DRAA 1T95A 1X4HA 1WWHA 5J1EA 1HBMB 1WF1A 1FX4A 3LGNA 4HTJA 3MCOA 1AZSA 2AYMA 3IM9A 2EKYA 1PC4A 2HWTA 3HT3A 2ZH5A 4FNIA 1OPIA 3UDCA 1OQ3A 4O3OA 4YP3A 2GFFA 4I6WA 4DV3J 1N6QA 4YFUA 3HMJG 4K4WA 3T6BA 1QSLA 2BABA 5J2MB 2RHQB 2JEFA 4PUOB 3HVWA 2M3DA 4LVOP 1NH7A 5D0HA 2QLJB 4CTAA 2ZOFA 2PN6A 1UCNA 2D9OA 5DETA 3ADAC 2DNHA 2MDAA 4ZN1A 1TKTB 3M4XA 3CVKA 2BJEA 1TMJA 1YJNS 3D1HA 4NXNJ 3MEGA 4JOUA 1ZM3A 2ZH6A 2V4JB 2C28A 1Q4RA 3M8RA 2OELA 1NK8A 1SUQA 3CJTA 2CPZA 2F8MA 3CCLS 5LOQA 3AQPA 4ECZA 1DTTA 2C3OA 5DDOC 5C5JA 1YI2S 2E9TA 2LLZA 4OYBA 1OMSA 2VB6A 2D3OR 3TX8A 3J81j 3IAS9 2VZ9A 3PM9A 1HFEL 2AWZA 1CJVA 2K7JA 2F4FA 3QQCD 2B43A 4OI4A 3QBCA 3J81Y 3DU6A 1N48A 3FSXA 5HMXA 4YY3J 2L48A 2M52A 1T8EA 2Z2MA 5KFFA 4DL6A 2HLUA 2HKEA 1HBMA 4O4RA 3QSIA 3OLBA 2NSCA 3P6YC 1RTDB 1PBUA 4N8OA 3GFYA 3IBCB 4ZVEA 1CS4B 5HLFA 4L73A 4QU7A 2Z4PA 4RW8A 1Q7LB 2LA4A 4M94A 2WB1D 3HSGA 1YJUA 4OYIA 1WC3A 2DHSA 3M9OB 3E51A 4FXVA 3AAWB 3UFCX 3TARA 2X7IA 2BBEA 2A6MA 4ZPVR 1X31C 2BM1A 1O6XA 3DGPB 1S9EA 1XMQJ 2P6TA 3NS7B 1FRHA 5HP1A 1H2VZ 2I1RA 3D9BA 2W7PA 4OYAA 4ETZA 4CDIA 2HVEA 3TI0A 3KWMA 1RT5B 1FDNA 3WC0A 1EJ7L 5IC4B 2RT3A 4DPUA 2X1GA 3DRPB 3DDKA 2XB2D 3SEOA 2G1DA 1FKPA 3RU0A 1I3OB 4KR0B 3LP2B 3AB4B 2HVIA 4F0HA 5LJ3Y 1YRTA 2ZZTA 1UFLA 1VC0A 4P7TA 2PGCA 3W2WB 2RQKA 1X4DA 2ZOGA 2WVFA 2CYYA 4J9KA 2DNLA 4FYVB 2K3IA 2C2MB 1I94F 2CDQA 2BX6A 3GG1A 4UUXA 4B3MF 2H5JB 2WB4A 5CD4H 5DG9A 2RF2B 1H72C 4RUAA 1YKWA 1P1TA 1SKRA 4DWIA 3MTKA 3QIPB 3FCWA 1KOHA 1VCTA 2DGSA 5L9XA 4RNNA 4ES3A 3FEZA 4CT9A 4IKAA 3FFIA 5EWGA 2QLWA 1BQMB 1QDUB 3K5OA 1FWPA 2FVSA 2H5IB 1FRLA 3RAMA 4BWMA 4CLFA 2QX0A 4TLRA 5B0GA 1AFJA 1F2HA 3KOAA 3MMBB 5CH7B 4QR1A 1GH8A 3GJRB 1SL0A 5KFDA 3THTA 4JI6J 4DPYA 4A46A 2Y8WA 1TKXB 1N36J 2V8GA 3K5MA 1FDAA 1FFSB 1BE4A 4C8OA 3M8QB 4ALZA 3THPA 1FWLA 4RNMA 3LOUA 3Q8SB 1HYSA 5CABA 1RWMB 2Q66A 5F9LA 1R27B 3BKUA 1Y5NB 4B9VA 1FERA 5HROB 1VC6A 1OJ4A 1YBAA 1HARA 2VQFF 2QT7A 3VHQA 2LQ5A 2MQLA 3DRPA 1UJ4A 5L46A 2BUNA 2EWHA 1C4CA 1CC7A 1JLFA 1HIYA 4YDXA 4RWXA 2ZDPA 3LP2A 2MZTA 2H65B 3UD4P 2OIHA 3OSPA 1XR5A 4NE9C 4U8VA 4E0DA 3MPYA 1VI7A 2HQDA 3LWLA 1XMBA 3DRSB 3VQTA 2MKCA 4LF4F 3G8SA 1TL5A 3NEKA 3M8SA 4OX9J 1TKZB 5J2QB 1MN9A 4DV4F 1SPBP 5G0RB 3CJ0A 4URQU 4XTTA 4QBUA 1NCLA 3ILJA 3QIPA 3CCUS 1GEHA 1APSA 3P5BP 1W25A 1X0PA 3DLEA 2FHKA 2W24A 4M95A 3QGHA 3ZZZA 2YNIB 3MR5A 3J7A1 2HHVA 1KQFB 2YKQA 1NK6A 2D3O1 4P7VA 4Q45A 4K8RA 4DR1J 4LBHA 2DR9A 1PILA 2H1YA 4OV1A 3MMBA 5D6GA 4CQ1A 4QZVB 3FMWA 2E9ZA 4DQRA 4M5HA 1KN6A 1FX2A 2CA9A 4WFYA 3BGRA 2J9CA 4ECSA 2ZBPA 1WC0A 5M2UA 3M6WA 1B0TA 2UUBJ 2AF6A 3FBCA 4YS2A 2QA2A 2IC3B 3EZUA 5SZTA 3J7Z5 1EARA 4L3KA 4D3GA 1WDDA 1VRUB 4FF2A 2QSWA 2RIJA 4FF1A 4DEZA 1NUEA 1BQNB 3C16B 5DZ6A 3H4BA 3L09A 4CLWA 1JLBB 2LEPA 4UW2A 3VQSA 3NMAA 1Q95G 4FZVA 2DXFA 4K7QA 1R8HA 4CI0B 3CJ2A 3DMJA 2KFZA 3T5JA 1BY9A 4F25A 4MH8A 2DNPA 2DNRA 4ZVHA 2ASDA 4G3IA 3GCXP 5A8WB 2N7CA 3C6UB 2CZ9A 4F4XA 3GONA 2E29A 3I5AA 4F67A 1DARA 4RUHA 3CC2S 2JDJA 1V3SA 3W63A 3QLHA 5I3UB 2P2CB 4ZCMA 1V3RA 1HQEB 5J2QA 1D9AA 3AXMA 4ED1A 3E3XA 2VPZB 3PR4A 1IJFB 2PSZA 2R7XA 1NSPA 5ADZA 4ZVQB 1NPRA 4RNFA 1F0XA 5CXTA 2CJBA 2E7WA 4KJIA 4K4SA 3R1LA 4N7TA 2I8EA 4DL3A 3K58A 5KT3A 1LXNA 5GMDA 3AY0A 3TWZA 2HAIA 1IKVA 4V19X 2CZVC 2J9DA 1RT6A 2HAFA 1P27B 4OX8A 1KBRA 2R8JA 1Q86T 3T9NA 5D15A 1XNRF 3WC2A 2AJ0A 1HQUA 3OR2B 1Z1ZA 2J0WA 4OJ1A 4LF1A 1R31A 2QZ8A 4KGVB 1HNVB 4OHZA 2L08A 4I7FB 3UW1A 2IC3A 3CJQA 3GJTB 4KO0A 2YVSA 2FHJD 1YLXA 4RBVA 4QPXA 4FDFA 4ID8A 2L9WA 2B56A 3VAFA 3FVYA 4NLXA 3NGDA 4DFPA 3HF5A 2HBQB 4P75A 3C16A 1T9YA 4RW4B 1LWCA 3N6NA 5E7OB 1FJEB 4WTOB 2DR7A 3BQ1A 5E33A 1KQGB 2KM8B 1N52B 5K20B 5ITHA 1U1MA 2ZJQQ 3LP1B 4WZMA 2ZE2A 1XEZA 2HHTA 2WVEA 4R0JA 1GAOA 1PKUA 4F4KA 3BBBA 3N4WA 5KG6A 4Q7AA 3T5LA 3KFWX 4I2PB 4FPRA 3VVUA 2YPYA 3FUYA 1HNZJ 1VQKS 1ZTTA 3Q8UA 2WW8A 1RHJB 4A48A 5GADI 2AJFE 2GHWA 1RISA 2J0QD 4CLSA 1W26A 3SYZA 3JSMB 1WNEA 2HGNA 4WYLA 1S1TB 4WFAQ 2POKA 2N82B 3PYEA 1HNWJ 1EZZB 1UA1A 3OW2R 3R5CA 5B0CA 3BYRA 4HI2A 4NA3A 4B17A 2N7YA 4IRDA 2X3DA 2PE8A 3SQGB 3C15A 1I6JA 3R7BB 4WU2A 3TVZA 4MYUA 2UV8A 5B08A 3BS9A 1AFIA 1WF2A 4O3SA 2RNEA 4KB7A 4QYZK 1F9EB 2FJVA 3SCJE 4LMZA 2HFNA 4QWCA 4C8NA 4PG7A 2AX1A 1YQHA 4OFZA 5I3QA 4ELUA 5KFPA 2AQ4A 2AEFA 1YJWS 4TQRA 3PR5B 3RW6A 5A0YB 3QRPA 2ASJA 3OR2A 1BUXA 5DJBA 3AFGA 4X4UA 1VQOS 2DJWA 2OEKA 1URRA 2MLXA 3EGVA 3OFEA 4LFCJ 2R7QA 4IG3A 2E5IA 2F4VF 1O5JA 2BQUA 4IYQA 2EBGA 1GX5A 3I0SB 3MEDA 2LXUA 3D0IE 3V81A 3R27A 2W2PP 5F8HA 1UETA 4B3SF 2IFXA 1F5BA 3FGVA 2V2ZA 4B9SA 4JYAJ 2P5VA 3NGKA 1MMLA 1J5OB 3L7UA 4N47A 2RKIB 3KNGA 3KHRA 2RAQA 3F44A 5F0UA 4ZJOA 5IT4A 1H2UX 4USIA 3NAHA 1ZM9A 3RAXA 1M90T 1Q7YT 1SJ1A 4OLOA 1SJ4P 2G2YA 3H59A 2IJRA 4LF6J 1WG4A 4PPDA 4WU3A 1RWPB 5HMZA 4G65A 4DX5A 1VJWA 4U7CA 2B9EA 3TAQA 4Z37A 5A76A 1M5KC 1RACB 2ZWPA 1PO6A 1AROP 2I5JA 5LJ5Y 1S77D 4JB8B 2M4MA 3HFZB 3PW0A 1T02A 4B3TF 1QSSA 1CVJA 2B6AA 4K4VA 3DDIA 4RNOA 1ELOA 2VFRA 2OLWA 1UW4A 4ED4A 4X64F 3W61A 3QJJA 4CCHA 3N9UC 1N5VA 4KGZB 2XGQA 1AA1B 1HI8A 2FC9A 4NA2A 1UWBB 3MUTP 3TAPA 5GAGU 1JLAA 2ACMA 3OQ2A 3MAHA 3WX4A 2CJXB 3ZTRA 3HHNB 4MTPA 1NNDA 2GVDB 5H9EK 2GHVC 2NLWA 1DTQB 2BJ9A 2CQDA 2VG7B 5D77A 1YJ9S 3D2WA 3VGSA 3HXMA 2KT2A 3IA0A 4DPTA 3MFIA 3CGIA 2BDPA 3SMZA 3DI6B 4TN2A 4F02A 2W4CA 2VASA 4A4JA 1H38A 2B4PA 1NRKA 4DR7J 1JQGA 4ES1A 4O0IA 2DB1A 2OKQA 3WX8A 3K8WA 2APOA 1RT1A 3RTVA 3O5TB 4XDDA 1BC6A 4NLGA 2E1CA 1RCOB 2NCKL 2B9WA 2CVEA 2B9YA 1QM9A 1V9OA 1Q81T 2L9NA 1EETB 4OJ3A 1GXLA 3DOKB 2O5DA 4ZITA 1RYSA 3LANA 5KFAA 2NYIA 2A10A 1Q53A 3ZTSA 3KLHB 1RAHB 3PW7A 1AUSL 5FJ4A 4F4YA 4TLQA 2E1AA 2J7KA 2VH7A 3TW0A 1YRUA 3NL0A 2YX7A 2GIQA 4F3QA 1FI4A 1SL2A 1SL1A 5KT2A 3SQOP 5E2QA 3HJFA 1HD1A 4KHPJ 1REVB 3HVAA 2FVCA 2MLZA 1VIXA 4NASA 2GHPA 3GZ7A 3MM8A 2MPUA 1C2PA 4FF4A 1FF2A 2GVDA 4DV2F 4LR9A 3M8ZA 3BR8A 3ZNUA 1RSCA 4DF8A 2VG7A 1HNXJ 2A3JA 3F73A 3HVTB 5KFMA 2CXEA 1JLEB 2G1HA 5HI7A 1XTZA 2UUAJ 3DOMB 2ZUGA 2ATLA 2OPPA 5IV3A 2Z2YB 5A2QY 1MNEA 5CQGA 4DUYF 2R3VA 3C14A 2QMXA 4PXDA 2FDNA 3CUNA 3OL8A 4GVLA 4ED8A 2BYCA 3EYZA 1VBKA 1SV5B 5T7LB 2HZVA 4QIEA 3DLKB 2KB2A 1RTIA 2BANB 2H48B 4LSLA 2XNQA 2DH7A 4EYIB 3Q86A 1YG0A 4NCGA 4Q43A 2WVCA 3KK2B 2FIUA 1P1LA 2QEXS 3SCKE 1FHTA 3TNVA 2W2MP 4DL5A 1EETA 4NZ7A 2R2UA 5KFZA 3FSYA 3OTCA 2HQIA 4PR6A 4Y65A 1OSDA 3KLHA 2EKNA 2FUG9 4XIUA 2IM2A 2HK3A 4Q8FA 2H4WB 4C8MA 1FRJA 3SCLE 5ETTA 4JI5J 4LQ9A 3ONQA 1YVFA 1V3ZA 2RILA 5KT7A 1SIZA 2V2KA 2CPJA 3I6PA 1LWEB 1RTJA 3IWLA 2MQOA 1U24A 1YTYA 4HR2A 2CQ3A 2HK2A 3DLGB 3GR1A 4CYUA 2DNNA 1B7YB 4WFXA 2CPXA 4CH0S 2E5LJ 3H98A 1C0TA 3QO9B 3DRXA 4DV3F 3HHLB 3OVSA 3CJ8A 2ZUAA 4UQTA 1NK4A 1RT7B 2ZH4A 2FHJA 1Q5VA 1CULB 2JSXA 4A8WA 1VQ5S 2GQ2A 3MTJA 3CMAS 2MZSA 4D3HA 1M5PC 2AZ3A 1BWVA 4HHJA 3UN2A 1KQSR 2DEIA 3MM7B 2LQ9A 3KNAA 3ENQA 2NZCA 1UFKA 4F3OA 2H3EB 2ZKTA 2XI3A 3QNWB 3ZZTA 4Q2LA 1NK9A 1UMJA 4NXNF 2XS7A 2DGVA 3BSNA 3HSZA 4KRWA 3KK2A 2OPSB 1ZAVA 4ZK7M 3GV8B 1KP6A 5B0BA 3S6EA 4RW9A 3V6JA 1IKYA 3W9IA 2C3PA 3GFXA 2V6AA 3SIPB 1RBOB 4MFBB 1FTRA 3GJSB 4U95A 1C1CB 5DGBA 2CZ4A 1F2GA 1ZZNA 2L3MA 3FJ2A 1T3NA 2FJBB 4KC5A 2RS2A 3CMES 4YY3F 1S1WB 1S76D 4H4KC 1NDKA 4DOZA 4Q5VA 3A12A 1S7IA 3FEXB 1HBUA 3MEKA 1VQ4S 1WUUA 1C0UB 3VAMA 1JJ2R 1S0VA 3OHAA 3OXLA 3MWBA 4DR4J 2XULA 5C24B 4WP8A 4PQUA 2V50A 5HBMA 2FY1A 2ZHOA 2XNRA 2HQGA 1U6BA 1V6HA 4EK2A 2HLTA 4BC9A 2VFSA 1RLCL 2N3LA 3QO9A 2YNGB 4WF9Q 5D0EA 1RAJA 3HHLA 4KGXB 2AT1B 1XWLA 1U0SA 3KK3B 2MGZB 5K8PA 1XMQF 3CO0P 4NLVA 4DQSA 2LMIA 5DDRC 2AP6A 3EGWB 3DRRA 5C25A 2LYVA 4OX7A 4ERDA 2ZZMA 4BWJA 3MM7A 2D69A 2ZBCA 3SDEB 3PX4A 4NLOA 1NXIA 3KK1A 3HO1A 2YKAA 2R2TA 4NI2B 3W7BA 3KJVA 2CAJA 3M2UA 3Q83A 4UZBA 1K0TA 4HHHA 1TL7B 2BRLA 1G2EA 5E3RA 2OPQA 3OUYB 2ERRA 2CNOB 4A47A 4ZJLA 1VISA 2IYGA 2IJFA 3Q2TC 5KOWA 2XYHB 1TK0A 1RADB 3TRGA 5HAOA 1MU2A 5C42B 3KUGA 3DXBA 1UW9A 2FLLA 2CJYB 3M6XA 4TU9A 2W2NP 3GCWP 4NLPA 6FD1A 5HJYA 3GB0A 1C0UA 2ZNYA 5C2GA 1OY6A 3VAHA 3PHEA 4OIXA 3CW2C 3PIOQ 4M5KA 3I9ZA 4B9LA 1T03B 4OZNA 3W8GA 4ZCLA 4IFVB 4R5PA 4EBEA 1JWWA 4JI6F 2PIIA 1CJTA 1R8CA 1N36F 4OV6A 2Z56B 2VBZA 2QTWA 4X66F 2LFVA 2YKMB 3MR6A 5GVQA 3KK3A 3KLVA 3PIPQ 2VG6B 5F8NA 4NEYA 1QE1B 2FZKB 3M1VA 2V63A 5IS2A 2C22A 1CBKA 2VC0A 5HVFA 4HYKA 3PTWA 2I2YA 4OYMA 2NPFA 1RAOA 1XR6A 3SDEA 2PC6A 2KVQE 1TUWA 4GMKA 3DYAA 3BGFA 1BLUA 3K7RA 3W9HA 4OHYA 4FPIA 4DX8H 2XI2A 3OFGA 3GIKA 4CZCA 2AJ4A 1IBKJ 4WPAA 1Y5IB 3HVRA 1DRZA 3BO4A 4EMDA 1PJ7A 5EGYA 4O4GB 2MXYA 5IXUA 4IRCA 3BR9A 2XM3A 2YQ0A 4BS2A 2F3JA 4DV6J 1NDCA 4YUDA 3P4UB 2CJKA 2J6TA 1LK5A 3CCTA 4OI1A 2WOMB 3MPWA 4UOHA 4PWWA 2WSFC 4OX9F 1Y4ZB 4RW7B 4WFNQ 2EK6A 3U1LA 2RU3A 4J90A 3BPDA 2CNNB 4LF8J 2XC9A 5E3CA 4C9DA 3MPDA 3Q8QB 2XO6A 4F2RA 3ET6B 1DURA 4P52A 1EIYB 1RTHA 1UJ5A 3A8IA 4YB7A 4AL7A 1NB2A 2HW3A 3AOAA 3H2LA 4YB6A 4DR1F 4I2QB 3PVXA 2VQFJ 2R7SA 1Y3KA 4MJKA 1WHVA 4FXWA 3H42A 3ZO7A 4JI4J 4AXJA 3QPIA 2K7KA 1TK8A 4B3OB 2QL7B 3RYLA 2YKMA 2WCXA 1IKWB 2U1AA 1SC3B 4C2MA 4OI2A 1FWKA 2VG6A 1HKAA 3POTA 1QE1A 2UUBF 4HL9A 2EBEA 2QLXA 4Y6IA 4YOEA 1QAJA 1NHUA 1AW0A 4KV8B 1L3SA 4J7CA 2R9LA 4MMOA 2W2OP 3KLEA 3ZTQA 3X3UA 4LREA 3GR0A 1VQPS 1KOOA 2JZ5A 1Q5YA 4H4KA 2BJ8A 4TU7A 5GAHU 1X5OA 2E5JA 2BW7A 4M8LA 4E98A 1LXJA 5GMKa 1YITS 1X4GA 4CWBA 4ZPAA 1Z4UA 3A3OB 3SZ2A 3FNNA 1N33J 4ZLNA 1VOMA 2FVPA 5ETRA 1HW9A 4O4GA 4ZJQA 3CF5Q 2G0CA 5HATA 2KVIA 3MHYA 2DT9A 3CD0A 2AHOB 5KFBA 3PO4A 2XMKA 4QWDA 2NREA 3IAM9 4Y0FA 5FD1A 1U8WA 3ZZRA 3VZIA 5BYSA 2F5GA 3CJSA 3M2RB 4K5SA 4USUA 3N28A 1FRKA 3I0RB 4OMFG 1O0PA 3M2VA 4WE1B 3ENAA 1BXNA 3A1YG 3BGUA 2JC0A 1XC9A 4JI7J 1TL3B 2CPHA 4EBCA 4Q44A 2MQQA 1UZDA 5ETVA 1WC1A 2VC1A 1LWXA 1HBNB 4I2QA 3NKYA 1UEVA 3BN7A 1WOOA 1E6VB 3K57A 2HFSA 2R2SA 2MSTA 4DQQA 2MJUA 4PWUA 2AX0A 3KMQA 2QO3A 4XPEA 2YNHA 2BXJA 3M32B 3DGVA 3ZTPA 2EG2A 2ZH9A 3LA0A 2JVRA 1JLQB 1FJGJ 3AA9A 3FCHA 4UZCA 1U2CA 1KTVA 2QFJA 4JV2A 4WJBA 4F3MA 1S97A 4S0MA 3BZQA 1JKHA 2IVFB 3JB9k 3CCMS 3V5RA 3FMBA 1VQMS 3NBPB 2V8DA 1TAQA 3ILIA 3N0VA 1FJCA 1DLOB 3CTRA 2GJIA 4KQZA 3FBEA 1NM2A 2ZFHA 3MECB 2NS1B 3CC7S 1NK5A 1QSYA 1PSDA 3EE3A 4AYBD 4J9NA 3UNYA 1IKXA 2Y1RI 1HNZF 1LW2B 3DM2B 3Q24A 4DL2A 1IR0A 3I32A 2HBZB 4J9MA 2ASYA 2OI2A 3RR8A 3V4MA 3B78A 4C8YA 3PJWA 7FDRA 3I5CA 3OBIA 2DXEA 1WHWA 3QRRA 2OPRB 3OHBA 3D1OA 4ZLLA 3MCSA 3ITHA 4QPTA 2HMIB 1JXLA 1L3TA 1HBOB 3MF5A 3M8WA 3MI7X 3KHHA 1GXUA 2XYPB 3I4HX 3E8OA 4KKOB 5THWA 4U9RA 2FYXA 1L3VA 1WORA 1N5YA 4WP9A 2UU9J 2Y1IA 2HNZB 2LU1A 4CO5A 2ABYA 3GWCA 4DS4A 4RLEA 3AB2B 5DZ7A 3KLGA 3DDNA 2Z57B 4JBCA 3GPAA 2NYHA 1RE1B 2RE1A 4MK7A 5IOLA 3M32A 5IFMA 2DRBA 3LGMA 1KLMA 1RT4B 3W62A 1VHFA 4Q2MA 3CULA 2ZH7A 4YDDB 4LFCF 2P9GA 3PW5A 2QGFB 3O1LA 1M5SA 4NZ6A 2DEJA 2R7RA 4DCPB 3JS9A 2Z8QA 4ED2A 3NBPA 2LEAA 3TUIC 2IBOA 1S1XA 3LPEA 4RNHA 2WSCC 4B9TA 1WC4A 4F4AA 5LXRA 4B3RJ 4NMLA 4JYAF 2WBRA 3PO5A 5AT1B 8ATCB 2A18A 2GIRA 4PXBA 3PFEA 5F9NA 2HHWA 2XCPA 1LW2A 1YIJS 4WWSA 2DGQA 4O44A 3DHXA 2CRLA 2ZNZA 1UPPA 1QUVA 2OPRA 2ROEA 3UDVA 5K8NA 4LF5J 1G7CB 1TV6A 3HPOA 2HMIA 2B5JB 2AZ1A 1S1VA 1DAXA 3QGGA 3KLFB 2RRBA 3NCPA 4WIIA 4DHVA 1CJUA 1S4EA 4BDPA 4AQYJ 1EQMA 3H4DA 2KT5A 2CPFA 1N0VC 4C3LA 2IAJA 2HNZA 1EHWA 3LH2S 2KTQA 1S59A 4H4MB 2HGLA 3JYTA 4X65J 3KUHA 4CLPA 4DG1B 1OWXA 3TA0A 2C2OB 2R8IA 4NX9A 2DR8A 3CCZA 4USJC 2XLKA 4KE5A 2HQ3A 3MD3A 3I96A 3EVWA 2HWIA 2IBKA 4KFBA 2AGQA 4ZS6A 1EX8A 4DSLA 4OZ1A 1EP4A 3E2EA 2EFNA 2SXLA 3CCJS 3MEEA 1LWFA 4WYWA 1X4AA 3J7YI 3LP0A 2K1RA 3SSRA 1HA1A 4I1TA 4DR7F 4WCEQ 4NLTA 3EX7B 1TP7A 2PMWA 4IH5A 3LPYA 1S4FA 2F8HA 1HHSA 2JX2A 4B3TJ 4TQSA 1JXVA 5HQ8A 5BYRA 3DOLA 1Y00A 3BYPA 4JV0A 1ZPVA 2YWWA 4HLBA 3D0HE 3MMCA 2HG4A 4X64J 2HFUA 1X9WA 1B7FA 4DR6J 1NJXA 1RA6A 1W2IA 4U7UK 2DO4A 2ZD1A 3AH6A 3L4BC 3QAUA 2H51B 4MK9A 2I6WA 5IWAJ 4O0NA 1YJTA 4LR8A 3D5MA 2MEWA 3DHWC 3A4TA 1KSPA 2GO9A 4I68A 1N34J 2DRDA 2GCFA 2PT0A 5CD4A 3RBDA 1X60A 4KGKA 5H9FK 4C8ZA 5IV4A 1K1SA 1PIEA 4GKKJ 3H5UA 2IHR1 4ZVPB 1N5TA 4P71A 1ZOTA 1JLCA 1T0TV 2ATCB 2RRNA 2F7VA 1KEKA 2HBYB 4RUCA 1XJWB 2ZBQA 3MFHA 3K5PA 2YWKA 2V67A 2BZ2A 4H4MA 2J76E 3PW2A 3D67A 2W1BA 4IR9A 1VHIA 4K4YA 3HI9A 4QQBA 5HN0A 3C6TA 1VJQA 3U02A 1HNXF 1U6FA 1S6QB 3OTOF 5CYQB 4O3PA 1VK8A 3H2UB 4TU8A 1VQNS 5EDWA 3KUEA 2G0JA 2KDOA 3K5LA 3NXZA 4XPCA 4Y2CA 1FDBA 4CLLA 2DH9A 2W4DA 4PCQA 3IRXB 3CCES 5LM7E 3TUZC 1UP1A 3R6GB 4ZN3A 1UA0A 2UVVA 4ECTA 4X4VA 3OL7A 2FD2A 1Q16B 1FFGB 3NGTA 2N4DA 4KSEB 3SXLA 1A6LA 3IN5A 2YTCA 1TL1A 2GQCA 1QD1A 2DR6A 1R0AA 1YSJA 2NUUG 1P6TA 3JTNA 3BSAA 3QT8A 5J1EB 3TO8A 2IYIA 1JJ4A 1L3UA 1OIAA 2V0NA 1AZSB 3TAMA 3VAGA 1O8BA 4O3RA
chains in the Genus database with same CATH topology
2QMWA 4OLOA 2ADCA 1SJ4P 1HL6A 3V6DB 4B9UA 4TY8A 3H59A 4JI8F 3UPFA 1WG4A 4PPDA 4ZCKA 4WU3A 4DLGA 1S1UA 2B0GA 1CQNA 5HMZA 2BA9A 1SIWB 1X4FA 3MM9A 4Z2XA 1VJWA 3ETOA 4R5PB 5F8MA 4U6PA 5KT4A 1N6QB 1D0EA 4U7CA 3TAQA 1VC5A 4Z37A 2BOPA 5JXSA 1M5KC 5DDQC 3V6KA 1PO6A 1AROP 2I5JA 3W2WA 4RW6B 5LJ5Y 1S77D 2M4MA 2B7BB 3PW0A 1T02A 4PG5A 4B3TF 4JI5F 1QSSA 3OTEA 3WBZA 5IM0B 5DGAA 2B6AA 2M70A 2MZQA 1CVJA 4K4VA 3M9NB 1RDRA 1ELOA 2VFRA 2OLWA 4RNOA 4N76A 1UW4A 4F8RA 1T7PA 2QA4S 2PFFB 2O67A 4X64F 2FB0A 3IGVA 3M05A 3QIDA 2JJ4D 3SFUA 5KFUA 5D3GA 1KR4A 3QJJA 1KD1T 3M1VB 2GV1A 2FLNA 4CCHA 4PWDB 3BEGB 1FXLA 3TR5A 2FGCA 3N9UC 1N5VA 1WACA 3IG1B 1SJRA 2XGQA 2ACYA 5AXKA 1HI8A 2RF2A 2Q79A 2FC9A 4JI0F 4NA2A 4DQIA 4JI1F 1UWBB 5IZHA 5BJRA 3J7ZT 3MUTP 2GGPB 3TAPA 3DLLQ 5GAGU 1JLAA 2R4FA 3KLIB 4QWEA 2HIQA 3OQ2A 4WXOA 2JVOA 3MAHA 4A8QA 4ZDNA 3WX4A 1ZAXA 2YKNB 4KHRA 2OTLS 2ZHAA 3HHNB 4MTPA 3OSNA 4KAIA 3PJXA 2XS5A 3UNGC 1NNDA 2GHVC 3CJKB 1KNZA 2WONB 3M2RA 2NLWA 3NWGA 2ILZA 1DQAA 1TVRB 1UL3A 4P2SA 1DTQB 3GMGA 2CQDA 6FDRA 3MEGB 3RB3A 2KM8C 2VG7B 1HNWF 4DL4A 3DYAB 4ED7A 3I0RA 5D77A 4PKDB 3IWXA 3IBWA 1N56A 2KRRA 2QIFA 2DVIA 4V19J 2E5LF 1BQMA 1X5SA 4K5RA 4OX6A 4WE1A 2MSSA 3D2WA 1YJ9S 4K50A 3HXMA 4AFFA 2KT2A 4X2BA 3IA0A 3GIJA 1P8GA 5AXMA 5J2PA 4WZQA 1B0VA 3MFIA 3VAKA 3GIMA 3E01A 1SUQB 5CYQA 3CGIA 2BDPA 1TL3A 3SMZA 2JRSA 3CWJA 3DI6B 3G4SS 2F9JA 1H0HB 4DR5F 1S6PB 3Q8PB 1DTTB 3CDBA 5SUHA 2OFHX 3QJLA 1CSJA 2BE2A 2HGMA 4TN2A 4ILMA 4F02A 1HBNA 1FTCA 2D7SA 2W4CA 2VASA 4KBIA 3EXYA 5IQ6A 1FNOA 4GO7X 1E6VA 1IM4A 1TKXA 5DM6Q 3SV4A 1SJ3P 4A4JA 1H38A 2B4PA 1NRKA 3T5KA 5FIIA 2CQGA 4ES1A 4OL8A 4O0IA 2HHHF 1FDDA 3LO3A 5DQHA 1I1GA 1YJRA 3AJ2A 4ZPBA 3QYYA 2DB1A 2ILYA 4IFYB 5IT9Y 2N3OA 2XCAA 2OKQA 1GTHA 1KQKA 3K8WA 2APOA 4NLRA 2VBXA 1TUVA 1FNMA 3MPVA 3M8QA 1KONA 1RT1A 4WK3A 3SFGA 3W2VB 3OLAA 2VODA 4ED3A 3R5DA 3N6LA 3OR1A 3D1QA 1F60B 1MROA 2ZVSA 3RTVA 1U2FA 4ZKAA 1S6UA 3O5TB 4XDDA 4PQAA 1VQ7S 4WKRA 1R8AA 1JK9B 1L3KA 2LDYA 1SJFA 1JLQA 4Y3CA 1BC6A 4NLGA 2E1CA 4YR3A 2B9WA 2CVEA 2B9YA 4HT7A 1QM9A 2HHUA 4DFJA 2O66A 4K0KF 5DLFA 1S6OA 2LVWA 4QIGA 1V9OA 5HROA 1Q81T 2L9NA 1EETB 4I6AA 4OJ3A 3C66A 5HLFB 1YRXA 1GXLA 2M8HA 1U1KA 2HNDA 4DMZA 4YMEA 2YY3A 1RTHB 3DOKB 4LQ3A 4XK8C 4RW8B 2O5DA 3BREA 2B7CB 1RYSA 4DUZF 2E5GA 3LANA 5KFAA 2Y1JA 2NYIA 3V6DA 4W90B 2FLPA 2A10A 1Q53A 5GAHI 2OSRA 3KLHB 4B9NA 2GX8A 5L9NA 3PW7A 1IJEB 1ZM4A 3FZBA 4HTIA 5FJ4A 3KG1A 3Q8RB 1WEYA 4AUKA 2FHOB 2X1FA 1Y9OA 7FD1A 4F4YA 2IM3A 4TLQA 3O3LA 1HHTP 4Q0BA 4ECYA 1DLOA 2DGUA 2E1AA 4J37A 3I56S 3KTQA 2J7KA 2VH7A 3MECA 3LALA 3K5NA 2ZITA 2ZH3A 1S7HA 1SI9A 2KYXA 3EGNA 5DRKA 3TW0A 2NUHA 2C2RA 4RW6A 2AYBA 2QRRA 3FSIA 4DV5F 1HD0A 1YRUA 3NL0A 2YX7A 1S9EB 4NCAA 4ZPCA 1FVSA 2GIQA 2EG1A 3DXSX 4F3QA 2KG1A 2PO4A 2PI5A 3MM6A 1SL1A 1SL2A 5KT2A 4IDKB 4KGMA 5HP1B 3G6VA 2CQPA 1LK7A 2J6SA 5I3PA 5E2QA 4ILLA 3DRSA 2I0XA 1K1QA 4ZP7A 3HJFA 2LU2A 2CQ2A 3POTB 1RA7A 4LIWA 1HD1A 3UCZP 3DM2A 3UD3P 1REVB 2M88A 4IH6A 4PWDA 3NCQA 5JUMA 1JXEA 4TYAA 2GO8A 1TKZA 3HVAA 2FVCA 2JHEA 2VFVA 1B0PA 5G0RA 5KG7A 1FEHA 2XMWA 4FP9A 3PX6A 1RP5A 1VIXA 5LSRA 3T3FA 4M5DB 1FRIA 3ENVA 3KLIA 2X1AA 4IH7A 1VRTA 2VPXB 1HNIB 4LF6F 2YKNA 4K59A 4ZHRB 4X62F 4DR4F 5U47A 2GHPA 2D1CA 3GZ7A 5BR8F 3MM8A 2MPUA 3RRHA 4H4OB 1C2PA 5B0DA 4FF4A 1FF2A 1UFWA 3KLEB 2KO1A 4DV2F 2JC1A 5DO2A 3CJKA 2WONA 4F2SA 1X8DA 3BR8A 4PXEA 1TVRA 2YNIA 3PX0A 3B4DA 5FLXY 1FKPB 1X7VA 4DF8A 2VG7A 3BM7A 5H9FJ 5F0WA 5DG8A 2A3JA 3F73A 3HVTB 5KFMA 1HMVA 1JLEB 1NJZA 3LUYA 5HI7A 1XTZA 1OS5A 1HBOA 2YQ3A 4NYZA 3GFZA 2CQ4A 5EHHA 1VFJA 2XWXA 1X4EA 2ZUGA 1NK0A 2ATLA 2CKWA 3BSOA 5B0AA 2OPPA 2PMZD 4PG6A 2IM0A 2DBBA 4KKOA 5A2QY 4LF9F 1S6PA 1MNEA 5L1JA 2XSFA 2EFGA 5CQGA 1NB7A 4N8NA 4QWAA 1S9GB 2B4UA 2ROGA 2KFYA 4DUYF 4QYZJ 2XY7A 2LXIA 2K2PA 2QMXA 4PXDA 4QOTA 4XAKA 2FDNA 3CUNA 4MKAA 3G6ES 2A1BA 3H5XA 3OL8A 4G1QB 3KYLA 2JFKA 3TUJC 4RBUA 4ED8A 3JTOA 2BYCA 2KFNA 1S0NA 2XMUA 5CZVA 3EYZA 2MJNA 3GSDA 2FHMA 1SV5B 5T7LB 2JLGA 4QIEA 4RU9A 3DLKB 2KZZA 5F3TA 2KB2A 1RTIA 2BANB 1GT8A 2V4QA 2KYZA 2XLJA 2HNYA 1DBDA 1O51A 4LSLA 2XNQA 4NPOA 2DNGA 2RRAA 2DH7A 4EYIB 2WHOA 1XN9A 1YG0A 3OFFA 5JJBA 4ED6A 5KFIA 5J2NA 4NCGA 2ZKUA 2YNFB 4Q43A 3KHGA 4H54A 3UWTA 2MZJA 3KK2B 2UXCF 2FIUA 3IR5B 2HHXA 1NEEA 1P1LA 1RT4A 2KRBA 2QEXS 1CEZA 3SCKE 2CIMA 2JLEA 3FFIB 1KFDA 3IGNA 1FHTA 2R7OA 2DHAA 1VMBA 3M2VB 1ZAWA 4QIWD 1VRUA 3TNVA 5LMUF 2EK1A 3N5BA 4C0BA 2J8AA 4N77A 1OPZA 3A8EA 1WHXA 2YKOA 1BQNA 4Y2AA 3CDUA 2HHQA 4DL5A 1EETA 4EO6A 4NZ7A 5B0FA 2R2UA 3MOJB 1FK9B 5KFZA 3VZHA 3S8SA 3QZ7A 3AJ1A 3FSYA 4C97A 2EFPA 3OTCA 2XSJB 3BSCA 1T05B 2A2CA 2HQIA 1JLBA 2Z0GA 5KAKA 3EPGA 4PR6A 4HVZA 2I38A 5KG0A 3FDSA 1U48A 3FQKA 4Y65A 4E8UA 1OSDA 3KLHA 4IQXA 5KG5A 5AXLA 1SQEA 2EFOA 3CJ5A 3OTDA 1QUPA 1FKOB 2FUG9 4XIUA 5L1KA 2IM2A 3N01A 5E0OA 4Q8FA 5CYMB 2W25A 2XMJA 1NJYA 1XNQF 2QA1A 1FRXA 4C8MA 3G9CA 1FRJA 5AJ3F 5KT5A 3L3CA 1SJQA 3SCLE 5CCMA 4F50A 3IS9B 4JV5F 2XMVA 2VG5B 4LVNP 4PXCA 5KOXA 4F4ZA 4LQ9A 3ONQA 5A8WA 2RQ4A 3C6UA 3MURP 2R8HA 1E6YB 5HMYA 1C4AA 4LSNA 3JTPA 4C7QA 1SKWA 3LAKA 3C46A 2V94A 1YVFA 2YNHB 1V3ZA 4CNZA 3RRGA 4WXWA 1YJVA 2AW0A 2D41A 4IDKA 1HYSB 4C4WA 2RILA 5KFOA 5KT7A 1XBWA 5AE2A 1HWKA 2IJNA 2KHDA 4J9QA 2RUGA 1CQMA 4EZ6A 1SIZA 2V2KA 5K14B 4ZLPA 2CPJA 2CQIA 1JNRB 4C0OC 5I3UA 3I6PA 1LWEB 1ZPWX 3I31A 4W92B 1RTJA 3RB6A 3IWLA 1HQEA 2MQOA 5MAOA 1U45A 1U24A 2M9KA 1YTYA 1VS3A 1D9FA 4CO4A 2CQ3A 5B7WA 1FE0A 3DLGB 1Q8LA 2XY5A 1GXTA 1S99A 3GR1A 2MMYA 1PGZA 2DNNA 4DPOA 4WFXA 4LFAF 3HHDA 3IXQA 4ZHRA 2CPXA 4I64A 2NSBA 4CH0S 2QE5A 3CC4S 1JKHB 3H98A 4ZP9A 2CQHA 1C0TA 1HWJA 2DNKA 2XZWA 3QO9B 3DRXA 4DV1F 3DLJA 5JVGQ 3GYXB 4DV3F 1MSWD 3HHLB 1JLFB 1R7IA 2UUWA 1KHVA 3OVSA 2RSQA 1KRPA 4B02A 3AA8A 3TYTA 3L95X 2CFXA 4UQTA 1NK4A 4P6QA 1RT7B 2B5JA 2FC8A 2GQQA 2FVRA 2UXDF 1FXDA 5DS7A 2ZH4A 2CQBA 1RQ0A 4I0WA 2FHJA 4DL0C 3KLFA 4DSJA 2JSXA 4A8WA 2OO4A 3Q22A 1VQ5S 1DJ0A 5CYJA 2HRYA 2NQPA 2GQ2A 3MTJA 4C11B 1S0MA 2W8KA 3CMAS 1Y3JA 4CO3A 4KTQA 1JNZB 5DQIA 2BJDA 2YKPA 3VF0B 1IQTA 4KHPF 2MZSA 4D3HA 2DGXA 1M5PC 3S1TA 2JOQA 1U4BA 4ID5B 2E9RX 4HHJA 1KQSR 3Q2SC 2UP1A 3MMAA 2F8EX 3ENWA 4G1QA 3QAEA 2VBYA 3MM7B 2LQ9A 2VKRA 3T1AA 4I67A 4K4ZA 3KNAA 1IKXB 3WZ0A 4A8XA 3ENQA 2W9CB 3LQVA 2DNOA 2KI2A 4NCBA 3DFEA 5H9EJ 2W4PA 2LKZA 1XR7A 2PEHA 3HKZD 3IR6B 2DPJA 4F3OA 2ZKTA 3BO2A 3H5YA 2W9AA 2XI3A 4DG1A 2J5AA 3ZZTA 4Q2LA 4QW9A 2E66A 3D0GE 1NK9A 1UMJA 4NXNF 3RZAA 2YX4A 2PI4A 1Y5LB 2XS7A 5LMNF 3HHLD 2DGVA 3BSNA 1RWUA 1M0SA 2YNFA 4A8KA 4KRWA 2OAUA 3TP2A 3PKMA 3DLEB 5CZXA 3CIMA 2J7UA 2W7OA 3KK2A 1HNVA 3IR7B 3OJUA 4MYTA 4I7FA 3DLHA 4UUWA 3B8HA 2UUAF 2OPSB 3CO9A 1YWXA 4YB5A 3ITHB 4X4QA 1IBKF 1ZAVA 4YEAA 1KVIA 4NLSA 1HI1A 3G6YA 4IR1A 5A8KB 1DQ9A 4ZK7M 3O44A 3GV8B 2DCLA 4NLDA 1JLGA 4FS1A 2UVUA 3KMSA 5B0BA 1H7WA 3S6EA 2O3DA 4RW4A 4RW9A 3RBEA 1FK9A 3VALA 3V6JA 1KHWA 3SI8A 1IKYA 2CJ9A 4CT8A 3V4IB 1JX4A 2C3PA 5LSOA 4DV6F 4IOBA 3GFXA 4KT0C 1S72S 2JEJA 2IRXA 1M1KT 2DISA 1KVJA 1H98A 4A8SA 4URSA 4Y2KA 2VFTA 3U1MA 4A8MP 1N5YB 3HFKA 4MFBB 5EWEA 1FTRA 1X5PA 3LP1A 1N88A 2YWEA 1OQ6A 2XY6A 1C1CB 5DGBA 5CYMA 2CZ4A 2DIVA 4JV1A 2CQ0A 1F2GA 1ZZNA 2GMHA 2DNYA 2L3MA 1X5TA 2IVMA 2G13A 3DC2A 3FJ2A 3BGRB 4PRFA 1T3NA 1LW0B 2FJBB 4KC5A 3KLGB 2RS2A 3CMES 1CPZA 3MAQA 1QVGR 4YY3F 1S1WB 2GMLA 1ROFA 1S76D 4I2PA 1DHMA 4H4KC 5FDLB 3ISZA 1M5HA 4DOZA 4Q5VA 1NO8A 3V6HA 4LF8F 4OJHA 1J2VA 4AE5A 2FJEB 3FEXB 1HBUA 1FEEA 3MEKA 3ZZYA 1UVJA 2KKHA 1SH0A 4NWBA 1VQ4S 1C0UB 3JSRA 5KTQA 1DQ8A 2GA7A 4GO5X 4MIAA 4HEA9 4DS5A 2AGOA 5K14A 4DL7A 3CPWR 4QR0A 5D4NA 1FVQA 1KLMB 2MKSA 3VAMA 2PD1A 1JJ2R 2J6UA 4G1PA 1K73T 2VPWB 1S0VA 3OHAA 3OXLA 4JI2F 4NOHA 3MWBA 2XULA 5C24B 2OJ3A 4RZRA 3FRZA 2JL9A 2VPYB 3SSQA 4NLQA 3JSMA 5KG2A 5D78A 2NXUA 4PQUA 5HBMA 2FY1A 2KN4A 1K9MT 1S1TA 4AL6A 4DSEA 4DSKA 3JSYA 2ZHOA 1NK7A 2XNRA 1RT2A 5J1NA 1VGYA 2R7TA 2F40A 1URNA 2VFUA 4GKJF 5HO4A 4X4RA 1U6BA 2ZC4A 1V6HA 1MMDA 2RD5C 2AV5A 4OQJA 2HLTA 4BC9A 2VFSA 5F41A 2N3LA 2W7AA 1S49A 3M8PA 2YNGB 3QO9A 3IFEA 3KHLA 4WF9Q 4ZOSA 4Y00A 5E41A 2ZJRQ 3PV8A 1RAJA 3HHLA 4R0EA 4JI4F 2IMOA 1S10A 3FEYB 1XWLA 3J7YU 3QGIA 3DMJB 3SQGA 3U7JA 1S1XB 3KK3B 2HZCA 3KKFA 4OI0A 4WFBQ 3UR3C 3G71S 2ZH1A 2E44A 2MGZB 5K8PA 1ZETA 1Y7PA 1XMQF 2DHXA 4QIVA 2BQRA 1HWLA 4ZPTR 1G6BA 4G1IA 1NH8A 1WTFA 4X4SA 4DR2F 4NLVA 2DH8A 4Y2IA 1CG2A 4C0HA 4C11A 2QA4G 4DQSA 4RU2A 2M8DB 1FRMA 2LMIA 2BM0A 4CTAB 1HW8A 5DDRC 2VOOA 2AP6A 2X1BA 5KFGA 3EGWB 3PXGa 3DRRA 4C3MA 5C25A 3SV3A 2LYVA 1N8RT 1WEZA 2VBWA 5KT6A 2MKKA 1G3OA 3AHPA 4ID5A 3CCSS 4QU6A 2C42A 4OX7A 3TOQA 3TANA 2ZZMA 4ERDA 2V9KA 4BWJA 3EUNA 3MM7A 3QLHB 4ECWA 2HS3A 2ZBCA 3M30A 3SDEB 3ZZ0A 2LEBA 2LECA 3PX4A 1U47A 2W9CA 4NLOA 1WF0A 5I42B 5F8LA 3KK1A 4O44B 3HO1A 3DRYA 1VQ8S 2YKAA 5GADU 2R2TA 2BV3A 3W7BA 2E5HA 4PG8A 3KJVA 1IBMF