1UAWA

Solution structure of the n-terminal rna-binding domain of mouse musashi1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
CKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords mouse-musashi-1
publication title Origin of higher affinity to RNA of the N-terminal RNA-binding domain than that of the C-terminal one of a mouse neural protein, musashi1, as revealed by comparison of their structures, modes of interaction, surface electrostatic potentials, and backbone dynamics
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1uawA00
1N52B 1WWHA 3OW2R 2DNGA 5GAHU 2CQ2A 4P6QA 4UY8T 4V19X 3D2WA 3VAKA 5IM0A 2MY8A 2MZTA 2DGUA 3TYTA 2J0SD 4WFBQ 1WI6A 2DNYA 4ZKAA 3R1HA 1RK8A 1JJ2R 1H2VZ 1X4GA 2DNLA 2CPJA 2CQGA 2M8HA 3G9CA 3MDFA 1ZH5A 2RNEA 2I2YA 2KG0A 5MLCV 3NNCA 2CPEA 1WG4A 3I56S 1NO8A 2LYVA 2MJNA 1X4EA 2DHSA 3CMAS 1F9FA 4IOAQ 1VQ8S 4OZ1A 1X4BA 3P6YC 2HGNA 2MHNA 2CQ4A 5DDRC 2F9JA 3BO2A 4WIIA 3B4DA 3MUVP 4TU7A 2DNNA 1HD0A 1WF2A 5IM0B 4PRFA 2DGSA 1SJ3P 3TP2A 2MKKA 1U6BA 3VAFA 1YJ9S 2CJKA 2MGZA 2X1GA 2MKSA 2J8AA 1SJFA 1X4FA 1VBYA 3ZZZA 2B0GA 1VQ4S 1SJQA 5H1SV 1WHWA 1K8AT 3IWNC 2MQMA 1FJEB 1YJWS 1YI2S 3CULA 2LCWA 3VAHA 2E5HA 2L9WA 1Q7YT 1K9MT 4YOEA 4YB1P 2KXFA 3BO3A 4Z2XA 3THTA 2M0GB 3LPYA 4F26A 2M88A 2HZCA 3UD3P 2CPDA 3PIPQ 1YHQS 4WCEQ 1YTYA 2M2BA 2M70A 1WELA 3CCJS 1A9NB 1U1MA 3MOJB 2RS2A 5D78A 1PO6A 4ERDA 2DNPA 5LSLA 1IQTA 2DISA 3G8TA 2DGWA 1UW4A 1VQ9S 2CPIA 1DZ5A 3P5TL 2VOPA 2MSTA 4W90B 2YKAA 1K73T 2KI2A 3N9UC 3G96A 1U1KA 2D9PA 4WFNQ 1SJ4P 2CQ1A 4U67Q 2N7CA 1N88A 2D9OA 2OIHA 2OTLS 2AYBA 2MY7A 2JVOA 3US5A 1WI8A 3VAGA 2MQOA 2NZ4A 2QA4S 4YUDA 2XNQA 2DGTA 3L3CA 2RVJA 3RW6A 2YH1A 2DNHA 2XS7A 2WBRA 1U6FA 3NS5A 1VQNS 4Y00A 3J7ZT 3CPWR 3CC2S 3UCUP 2DNMA 4TU8A 2OJ3A 1WG5A 2G4BA 2DGVA 2E5GA 3K0JA 3CCVS 2DO0A 2MZSA 1U1NA 2DHGA 1DRZA 2XB2D 1B7FA 1HA1A 2M9KA 4TU9A 4CH1A 2RT3A 3CCSS 2MJUA 1UAWA 2DNQA 3MD1A 2BOPA 4WKRA 1VQKS 1AUDA 5LJ5Y 4J5OA 3S8SA 2VODA 4ED5A 2MZJA 3VAIA 2OTJS 3SDEA 2M52A 1VQ5S 1VC0A 1H6KX 5JVGQ 2KYXA 3RW7A 3DXBA 2KVIA 2KFYA 1W2BR 3FEYB 2KU7A 1PGZA 1QVFR 4IUFA 1M1KT 3CD6S 3TO8A 1X5OA 1QM9A 1U1RA 1FXLA 2KHCA 3CC7S 2CQCA 2KXNB 2V94A 2I38A 5JVHQ 3H2VE 1URNA 2RUGA 5GADU 3CCQS 1O0PA 2HGMA 1S79A 2LMIA 1VC5A 2K8GA 1G2EA 1VBXA 2U2FA 3CMES 1X0FA 2RRBA 5ITHA 2KG1A 2J76E 2OSRA 2RQ4A 2CPYA 2QFJA 2DGXA 2FC9A 3J7YU 2EK6A 2PEHA 3U1LA 1UFWA 3Q2SC 2MQNA 4F02A 1R8HA 1A7GE 1WG1A 3CCRS 2G0CA 3UE2A 2DH7A 5GAGU 1WTBA 3UCZP 2ADBA 3LQVA 2ADCA 3VALA 1OO0B 3UD4P 3SDEB 4RU2A 4QU6A 1FJCA 4LMZA 2DNOA 2Q79A 2DB1A 2SXLA 3THPA 1Q82T 1VQOS 5DDQC 2DNRA 5LXRA 2LECA 2VONA 2EVZA 2FPHX 5CXTA 2JX2A 1OWXA 3IRWP 3VAMA 2DNZA 1DBDA 1DHMA 2CPHA 1NU4A 2A3JA 4CIOA 1M5OC 1CVJA 1N8RT 1JMTA 4A8XA 1P1TA 2MZRA 3MI7X 2FC8A 2MB0B 2N3OA 1D8ZA 2MQLA 3HHNB 3EGZA 2E44A 2M7SA 2CQ0A 1P27B 2CPFA 3H2UB 5GAEU 2J0QD 1VQMS 1YIJS 4CQ1A 2DNKA 2MPUA 3PIOQ 4EGLA 1HL6A 1HD1A 1WF0A 2UP1A 5IQQA 3G71S 4W92B 1D9AA 3P3DA 2MGZB 5D77A 2X1AA 3SXLA 2LEBA 4OZ0A 5IFMA 3BS9A 2DITA 2KT5A 3JB9k 3FEXB 2FHOB 4QQBA 1M5VC 1R8PA 2KXHA 2E5JA 4M5DB 1M5KC 1U2FA 3VF0B 1FNXH 5FJ4A 2HVZA 2MZ1A 3U1MA 5GMKa 2DHAA 3DLLQ 1H2UX 5CA5A 1L3KA 2GO9A 2MXYA 2MQPA 1M5PC 1JJ4A 2ERRA 1Q81T 3P49B 5LJ3Y 1WHXA 2N82B 2KRRA 3MXHP 2ZJRQ 2MYFA 2AD9A 3BO4A 2LKZA 2RU3A 3S7RA 1SXLA 1M90T 2D3OR 1KD1T 2PE8A 2L08A 2DHXA 4C4WA 2JWNA 3MURP 2ZJPQ 1NJIT 2HYIB 2XNRA 1N54B 3G6ES 1VQPS 1QVGR 3ULHA 3CTRA 2LA4A 3CCMS 3G4SS 3B4MA 1KC8T 5EN1A 2EK1A 2AYEA 1Q86T 3VAJA 3CCUS 2DIVA 2MKIA 1WEZA 3CXCR 2M8DB 2XS2A 1X4AA 2DH8A 2OSQA 5DDOC 5HO4A 2N3LA 2X1BA 5DDPC 3UCGA 2X1FA 2F9DA 3CCLS 3SMZA 2RRAA 2CPXA 2DK2A 5LXYA 2YH0A 1FT8A 3MD3A 2AYMA 2KM8B 4WFAQ 3CUNA 1X4CA 1X4HA 2XS5A 2LA6A 1FJ7A 2DGQA 2G1DA 3CF5Q 2O3DA 1WEXA 1YJNS 3NNAA 1ZZNA 4C0OC 5BJRA 3R1LA 2MQQA 1WHVA 2CQHA 1YWXA 3G8SA 2QEXS 3UWTA 3I55S 2LXIA 2DGOA 2MKHA 3EX7B 2ZJQQ 1U1LA 1KQSR 5HL7Q 4FXVA 4F25A 3R27A 4LIRA 4IO9Q 2KRBA 5DETA 2VOOA 2DH9A 2KN4A 3S6EA 5DM7Q 2LQ5A 2K3KA 1U1OA 2LXUA 1X4DA 2E5IA 4PKDB 4UQTA 1OPIA 1KOOA 2KH9A 1VBZA 2DO4A 1OIAA 2CPZA 2MMYA 1VQ7S 1JJHA 3CC4S 1XN9A 2AYGA 1BY9A 1S72S 1H2TZ 1ZZFA 5DM6Q 2RQCA 2JRSA 2MKJA 1RKJA 1SJRA 4Y0FA 3EGNA 3NNHA 4BS2A 4C7QA 4QU7A 1X5TA 1VQ6S 2KM8C 1KOHA 1WHYA 2LEAA 1X5SA 5GVQA 3S01A 3NMRA 3BEGB 1WEYA 1U1QA 2NLWA 2MKCA 2YTCA 1UP1A 4IOCQ 2XSFA 4CH0S 1YITS 2MZQA 1VQLS 2BZ2A 2CQBA 5CYJA 2YWKA 3ZZYA 5LSOA 1FO1A 3MUMP 1X5PA 4PR6A 2CQPA 4QPTA 2U1AA 2CQ3A 2CQIA 3V4MA 3MUTP 2F3JA 4LJMA 2FY1A 2CQDA 4TLQA 1VC6A 1U1PA 2MSSA 1WF1A 3CCES 4WF9Q 2RS8A 2HGLA 2GHPA 1FHTA 2L41A 3HI9A 3Q2TC 2DIUA 2M4MA 4FXWA 2JVRA 3NS6A
chains in the Genus database with same CATH superfamily
2YNIA 5KFCA 4OZ2A 5LMUJ 4V19X 3AJ1A 3C66A 3LP2B 1NDCA 5E41A 2GIFA 2W2NP 2G13A 2EFVA 2Z56B 2RIJA 4J9OA 2WSFC 1FWKA 3RG6A 3D1QA 4DPWA 4U7UD 4ANEA 2BJ7A 4CLKA 3EXCX 4OYZA 1F9FA 2QLXA 3TW0A 3CT9A 4FVMA 1IKYA 1FEEA 3GFHA 3BKUA 3QRQA 3H4BA 2X51A 1S77D 2GQ2A 1YI2S 5J1EA 2R8GA 3KJVA 5T41A 1FX4A 2A2DA 1XTZA 3T5HA 2BM1A 4LF5J 2ZD1A 3MAHA 2HZCA 1HPZB 2PMWA 1YHQS 1M0SA 3J80Y 3KTQA 1S6PA 2HHQA 2JDJA 2RDIA 1RGVA 2ZUGA 2HFVA 4OQJA 2OPSA 1WC3A 1GXUA 4FNIA 1S12A 4O0IA 4QYZK 4B17A 2XI2A 1SUQA 2DNHA 3L9ZA 1YRXA 2A1BA 3CC2S 2WONB 2MTLA 3PYDA 5IT9U 4WE1B 4FDFA 2AJ0A 4LFBJ 2DNQA 4WKRA 2QMUB 1UFKA 1RT1A 1JKHA 2WZ1A 2M52A 1APSA 1H98A 4PG5A 1RTIB 1N33F 2DR5A 3HK2A 2V94A 2I38A 1U0HA 1OYDA 5GADU 3D6TB 3CJKB 3AXKA 2LMIA 1VC5A 3FFIA 3AJ2A 2WSEC 2YNHB 4J9KA 1HWLA 3MCNA 1IM4A 3IGNA 3OTDA 2HHHF 2XCAA 1FRXA 4TYBA 3GQCA 1WOSA 4J91A 2DNRA 4AXJA 2CXEA 3ZZOA 2HWHA 1JXLA 4ZN3A 2DKOB 2M5YA 4OFZA 4USHA 1D8ZA 4QW9A 5CHCB 1BQMB 4UUWA 2CPFA 3BM7A 4RUAA 4DQQA 4QWDA 2EFGA 3H0PA 3PYEA 4BWJA 1JLCA 3AQOA 5IOLA 1N0UA 5IFMA 3OFFA 2F7VA 2IM3A 3R97A 4G1QA 4JV5F 2HHWA 5C5JA 3IRXB 1M5KC 1B64A 2C2DA 1IVZA 1HNIA 5HK4A 3TX0A 2HS0A 4IQXA 2DTJA 2I8EA 3IWLA 4IOBA 4NWBA 3UN5A 5E0OA 3HZEA 3GR1A 4XPEA 2C3MA 2UV8G 3KK3B 2J6UA 1KC8T 3RTVA 3NXZA 4FYVB 4M5IA 3M2UB 4OZ3A 3CXCR 3TZXA 2DH8A 1JLGA 2XMTA 4DV1F 2E1MC 1REGX 4IH7A 4RBVA 5AJ3F 2CPXA 5M2PA 3TQEA 2IVMA 4DQRA 4ICLA 4ZVGA 2OPQB 1TUGB 2OAUA 3I0RA 2V67A 1WDTA 3KLEB 3RB3A 2D3O1 3HVAA 4F4KA 2ALZA 5H9EK 4QWAA 3JSYA 1LW2B 2YX1A 3V6DB 1YBTA 1UEUA 4DI6A 5CYMB 3TUPA 4O0NA 4B3OB 1XWLA 3RR8A 2YKMA 1FVQA 2IRYA 3SSQA 1RLCL 1YBAA 3EYZA 1HHSA 3GU0A 4ZPVR 2PT0A 1JLEA 2QX0A 2KH9A 4C8OA 2QLJB 3TZZA 2YNGB 4N56A 2AF6A 1BY9A 2V50A 2HVHA 1DURA 1RKJA 1SH3A 3K5NA 4QIGA 4OYBA 2N4CA 4TQRA 4CCHA 1U1QA 2Z2ZA 4M5JA 1TK0A 2BZ2A 1HHQA 3FEZA 3ZZYA 3R3TA 1XMOF 1U6ZA 4YS2A 2VG6A 2E1CA 4M5NA 5HVHA 1VRUA 4IG0B 2R4FA 4CH7A 3UN3A 2QYCA 1SKWA 2NSBA 2DIUA 1WWHA 2F8HA 4P2FA 3CJRA 2L48A 2CQ2A 3DDIA 4LUBA 2GQQA 3BSCA 4FXDA 3KG0A 2DNYA 1XNQJ 4P72A 1TVRA 1ROFA 4GMKA 3D67A 1X4GA 5HMXA 5EWGA 3P4UB 2CQGA 2NR0A 3G9CA 5HAOA 5KFJA 2KHDA 2RNEA 3VQSA 4E0DA 4KGKA 2BUNA 2NSCA 3KK1B 1H7WA 3N28A 5L1JA 1VQ8S 1SH2A 3EJMA 4K50A 2IRUA 4C8KA 1HR0F 4DV5F 1F2HA 2QN6B 3P6YC 1RT6B 2HVEA 2AX0A 4YY3J 1Z2LA 4KR0B 4LSLA 2AHOB 1K1QA 1F3FA 2GIQA 1GT8A 2IBOA 3ZTQA 3HF5A 3Q8SB 4KHPJ 5K14B 3V2UC 2WRMA 3VAHA 4YOEA 1HWUA 4JI3J 4NLRA 3LPYA 2BJ1A 1JLQA 4JI2J 4WCEQ 1WELA 4RUHA 4ZA1A 1A9NB 3FQLA 4AQYJ 1YZ7A 3BBBA 4LR7A 4RPFA 4OHXA 4Z37A 2VOPA 1RT3A 5HANA 3G96A 5F3ZA 2F4VF 4DWIA 3D66A 1Z4UA 3M4XA 5KFLA 5HATA 2ZDOA 2NZ4A 4Y2IA 3L3CA 1U6FA 3J7ZT 1CBKA 4O4GA 2W01A 4OYPA 1X60A 5LM7E 4JI8F 3DM2B 5L46A 3TOQA 2YWHA 3HVWA 5I3PA 3RW7A 2DR7A 2KU7A 1NK6A 3UDVA 5IZHA 1RI7A 1GTHA 2KHCA 3V6JA 3BSNA 2AEFA 3HPOA 2J7KA 5F0UA 3NKYA 1U26A 4ALZA 3PDNA 2KTQA 2K8GA 2X3GA 2H4YB 2I5JB 2QFJA 8RUCA 1NSQA 2JEFA 3O1LA 2BE2A 5LMUF 2RE1A 1TUVA 3Q2SC 1R7IA 1B3TA 4DSEA 1A7GE 3CCRS 4DL2A 2DH7A 4QU6A 2Y0BB 3LP0A 4C0BA 2I1RA 2IA6A 2AEJA 3L4BC 1VS3A 2DNZA 3W9HA 3KHHA 2P6TA 1MG7A 4J90A 3QSYB 1RT7B 2LQ8A 2WB4A 5D4OA 2DRAA 4OYOA 3FJ2A 3C6UA 1O8BA 1NKBA 1HBUB 4S0MA 4EGLA 1CPZA 2HZAA 5IQQA 5DZ7A 3LWMA 3QGPA 1TKZB 4OZ0A 1CULB 4CO2A 1YRTA 2LDYA 2UUWA 3W9IA 3M8PA 4HTIA 1YSJA 1WOPA 5ETRA 3W61A 3U27A 4JI7J 1XMQF 4E98A 3TRGA 4ANCA 3P49B 2KL8A 1RTJB 5IC4B 2HW3A 5F8HA 3M6VA 3Q86A 1S10A 1SXLA 1M90T 3VGSA 2XMAA 2ZJPQ 5ETPA 2HYIB 2XNRA 1OJ4A 3NBPB 7AT1B 3KUHA 1WD6A 4IYQA 1RWXB 2IAJA 2RRAA 3J7A1 2AJ2A 1I5OB 3OFGA 1KLNA 3KLIA 1FT8A 1P9QC 4LF4F 2FVPA 1UVKA 2VD3A 1VK8A 5KG0A 2LA6A 2VBWA 5KT6A 4C0OC 1NNDA 3PVXA 5KG3A 1UFLA 4YQWA 2G9OA 2MLXA 2MKHA 3T19A 1WC1A 3HVTA 4AYBD 1K0TA 1OY6A 4LRAA 4OI4A 2K3KA 2LXUA 1OY9A 4C3LA 4A8MP 3IBFB 4QYZJ 1TV6B 4DR6J 2C2ZB 4DDFA 4GVBA 1IJEB 2AYGA 4DV7J 3KK2A 4UOFA 4DX7A 3MM9A 1RBAA 1DJ0A 1KOHA 4C0HA 5GVQA 4MKYA 3MPWA 3NMRA 2LU1A 1IKWA 2NCKL 5B0GA 3AQPA 4DL0C 2OPRB 4OI6A 2YTCA 3ISND 3NMAA 4FNHA 2WVBA 1S1UB 2HBQB 4MYTA 2P9CA 3NGRA 3N0VA 3MEGA 1XNRJ 3CCES 2H5JB 1S1XA 3J81Y 3TJ8A 5HMZA 2J6TA 2YNFA 3RBEA 1AW0A 2LP4A 1QJHA 2MY8A 2WHOA 1V9OA 4ZVPB 5CZVA 2GHWA 3DLGA 2DNLA 2GIRA 3IXQA 3GYGA 2DHSA 1DTTB 3I0SA 4KHMA 4PG7A 4IG3A 3HSDA 4MJKA 1JNZB 2BKPA 3T1AA 3OSPA 4WIIA 3OJSA 4C8NA 3NWRA 1T9YA 3OLBA 3C15B 1FKAF 2DD8S 2R2UA 1U6BA 3TAPA 3T5LA 3OTBA 3SFUA 1VBYA 2KT2A 5GAHI 3TVZA 1RWWB 4RNFA 1NRKA 5L9NA 2XY7A 4DPTA 1OY8A 2OMLA 5L38A 5K8MA 1T9TA 2PN6A 4P74A 4LRDA 2H5EA 1SKRA 5LSRA 2H9ZA 3RUBL 2UUCJ 2VQEF 1Q4RA 1PYOB 1VQ9S 5E5NA 2B6AA 4L75A 1X9SA 4EO8A 2EFQA 2OFGX 2LEPA 2JNJA 5B09A 3MTKA 3GB0A 2Y1IA 2GVDA 2R7OA 3EMTA 1WI8A 4LF7J 4NRTA 1TL7A 4CO0A 3FZ2A 1HI8A 4Q7AA 2Q6BA 2DNMA 1KQKA 4OX9F 3R7NB 4QR1A 1VISA 3DDKA 3N5BA 2DO0A 1RWOB 2AIRB 2XB2D 4G6VB 1C0UA 2UUAJ 2XG8A 2VDIA 3TZWA 2VODA 2OTJS 4MKAA 4TN2A 3NOCA 4XTTA 2KYXA 1YDLA 3WIUA 4P10A 2CNLB 2W2MP 2E7XA 3CD6S 5KG4A 1U1RA 3WHIA 2XLIA 2JEGA 1ZETA 2P8IA 7FDRA 5HBMB 1F5AA 2W24A 3W63A 4MMOA 3CE8A 3W5XA 3W8GA 4A46A 2CPYA 2DGXA 3V81B 3I6PA 3BF4A 1HNVB 1WG1A 1IQZA 4JI4J 1YQHA 1FJCA 3QRPA 4C48A 2E66A 2VONA 5DG7A 2JX2A 2G2OA 2YKPA 2ZH1A 1Q53A 3OD2A 2XMMA 1BXNA 3VQTA 4KO0B 4KPYA 4PCQA 2R7UA 2W7OA 4FYWB 1P27B 1QLNA 1YIJS 2ABYA 1RHRB 3ITHA 3H2LA 1RHMB 4N7TA 5LMNF 5J2QA 1TKTA 3K89A 2UP1A 4I2PA 3SXLA 4AUKA 1YJ7A 1ICEB 3MM7B 2VIHA 2VBYA 1RSCA 4RO0A 2CVIA 3MMBA 5A8WA 2ZNYA 1GMUA 3H90A 4X66J 2LQBA 3IGVA 3KYLA 4D3HA 3GR0A 2ERRA 4JI3F 1Q81T 4JI2F 1R6YA 4FYYB 2PA3A 4Q0BB 3ILJA 4AQYF 1VIOA 2JL9A 2BACA 1GEHA 2HQIA 3JSMA 1FDDA 3H5YA 2AW0A 3DOKA 3DRXA 2MDAA 3S1TA 2HHSA 3ILOA 1CJKA 4CLYA 1U25A 1PKUA 2L9NA 5LXYA 4WP9A 2UU9F 4IFVA 1IBLJ 4OJ1A 4BBYA 1WC0A 4LBHA 3D6MB 1HKAA 2GMJA 3K59A 4B3RJ 2A2CA 3MM5B 3CUNA 3MR7A 2OMOA 3ILIA 2O3DA 4B3MJ 2FJEB 2Z2LA 1RTZA 2BR0A 1CJVB 4ZCIA 1OQ6A 1U1LA 3M30A 2FB0A 2VPYB 2KRBA 2AZ1A 1KLMB 3KG1A 2B9WA 2LQ5A 2RAQA 2BRKA 1U1OA 3VGUA 4NASA 1GMVA 4PAAA 4I68A 1N6QA 1FRHA 4DUZF 4K0KJ 1UA0A 3R2DJ 4RL1A 4F0MA 2MKJA 2HHPA 3FMWA 3NY0A 1WHYA 3FC9A 2HQGA 2J0XA 2R2SA 1OSDA 2HNYA 4PQUA 3EM1A 4IOCQ 2O5DA 1YGYA 1VQLS 2XYGB 5I42A 1HIYA 5CYJA 1FO1A 4HT7A 2CQ3A 4DX5A 2C2MB 3BPSP 5C25A 2E1AA 2UXBJ 4OHVA 2HMIA 1CG2A 2RILA 3ENAA 2Z2MA 2FHMA 1FK9A 3OW2R 3EGWB 1EP4B 4IRCA 2NXCA 1KHVA 4HH1A 3UDLA 4BWMA 2XMUA 3C14B 1BQXA 4F3MA 2AV5A 4P9SA 1RTHB 5IV3A 2W8LA 4DEZA 4KV8B 5BYRA 2V4RA 5A76A 1Y5IB 9ATCB 3GV7B 5HLFB 3BR9A 5MLCV 1ZOTA 3I56S 4ZPDA 4NZ0A 4F67A 3FZBA 2JLGA 4LVOP 3G82B 5HN0A 2F9JA 1FNOA 3ZZRA 4O23A 2FJWA 2ZBIA 5JUMA 4LRCA 3K5PA 5KFQA 4LF2A 4TLRA 4O3OA 3LWLA 2CKWA 2D41A 2OO4A 3R6GB 1UWBB 4I4BA 1IBMJ 3GE9A 2CPDA 4USTA 1MMLA 5J2MA 4U7CA 1Y7PA 2AGOA 1KFSA 2E7WA 1SC1B 4I2QB 1XIQA 2B4PA 5A8RA 1V3SA 4UZBA 2QGFB 4U8YA 1JLAB 2FLNA 2XTJP 2AYBA 2JVOA 2HS3A 2QA4S 2RVJA 4J7CA 3O2IA 3NS5A 4RW9A 3R5BA 1RQ0A 1A0OB 3QMQA 3W5ZA 2KYZA 1RU1A 1P1LA 1HI1A 2DHGA 1B7FA 2XCPA 4TU9A 1S0MA 4GKKJ 4PYAA 4I7FA 2H54B 2V6AA 4F4AA 1RAGB 4ECTA 1HNWF 2ROEA 2UZAA 2E1RA 4KRWA 2C2OB 1S1TB 3DXBA 3FEYB 3X3UA 1CC8A 4IRKA 2ZOMA 4AL7A 1PAUB 1ZM3A 2R2RA 3R7SB 4FYXB 1FXLA 2OD6A 1EARA 1FTRA 1QSYA 5HP1A 1UW9A 1F9EB 4ZVQB 2V68A 1NHUA 1UVNA 2XMVA 5GMEA 4MK8A 4RWWA 3CMES 2VV5A 2OSRA 4K5RA 1DQAA 4ZIVA 4DSFA 1RTDB 4KKOA 1UKUA 2BJ9A 2XMKA 2GGPB 2W7AA 1PJ5A 1OPZA 3VALA 2QLWA 3UD4P 3SDEB 4QIWD 1S6QA 3SV3A 4ZJLA 4ZK7M 3P5BP 5AXNA 4FF2A 2W9CA 2PDAA 2FJAB 3IFEA 1C4CA 2CPHA 3B6BA 4DSIA 1CVJA 2QC3A 3A3OB 5A0YB 3JQKA 4H4OA 3QYYA 3H59A 5KG1A 1Q8KA 1RUSA 3H5XA 1KS2A 1OSCA 5J2PB 4Q8FA 3UW1A 2Z57B 2YX4A 2XWYA 3ENQA 4AFFA 3K2YA 2HQFA 3BS9A 5D15A 4IFYB 5LL6d 2BE7D 2W2QP 1SB6A 3GJQB 3VF0B 5F3TA 3MWBA 4CYUA 4EZ9A 2MQPA 1M5PC 2WB1D 2Q3PA 2N82B 4ZJOA 2MQ8A 1RHQB 4RW8A 4FP9A 6AT1B 4DZ6A 4PG8A 4F7VA 1FESA 4F4XA 4CLFA 4W98A 3CTRA 4OHYA 3M8QB 3HSZA 3V4IB 1KBRA 2DIVA 3ZFVA 3DRRB 4C11B 5DDOC 5KG5A 2N3LA 1MU2B 4OJ3A 5DS7A 2RU9A 2X1FA 2CVEA 1HMVB 4ETXA 3F41A 3R5CA 3MF5A 1YJNS 2UUAF 5BJRA 1JLBA 2NPFA 1X0PA 2YY3A 3I55S 4F2SA 2ZH5A 4DOZA 5C42A 3E51A 5DETA 2HQDA 2ZEJA 5IV4A 5EGYA 3GPAA 4C8ZA 2DO4A 4RJVA 3CC4S 1N5YB 3W5YA 1UA1A 1DFDA 4ECQA 3CD7A 1YRUA 3EGNA 2C3OA 3LP2A 4XO0A 1ZTTA 1U09A 1RU2A 1LXNA 2YWKA 2XLJA 1V6HA 2CQPA 4QPTA 5EUHA 2YKOA 4DR5F 1N32F 2RS8A 2UUTA 3EZOA 2LVWA 3OUYA 1U45A 3FBCA 4C3KA 1CS4B 1VCTA 2H65B 2CG8A 2HVIA 1YJRA 4F0KA 1QSLA 2HK3A 3CIMA 2R7XA 1EQ0A 5T14A 2I2YA 3FKBA 2KG0A 3NNCA 2HRUA 2CPEA 4UUXA 3RBXA 2BA9A 4NRUA 1X4EA 1HPZA 4PPZA 3K17A 4TVAB 3HX9A 4M5HA 1NK4A 3NGTA 9RUBA 3B4DA 4ZP9A 4WKYA 3MUVP 2HK2A 4ILRA 1BC6A 4QIVA 1IR2A 2ZM6F 1HARA 2VBZA 1WUUA 4YMEA 1NEEA 1LKZA 3OR2B 2COLA 4KSEB 2EFPA 5IXUA 3LP1B 3MM8B 2KB2A 4NCGB 3UPFA 3UD5A 4LRFA 2PI5A 2WONA 4WE1A 2GMLA 1XQIA 2FLLA 3TARA 4DS5A 4WK3A 2MKYA 3G8TA 1T05B 3PHEA 2VA3A 4URGA 1K73T 1HW9A 1R0BG 1EKRA 4U67Q 1RTIA 4RBUA 1QAJA 3NWGA 1D3WA 1FJGJ 3UDEA 1E6YB 4EI2A 2V9WA 1Y4ZB 1V5IB 2XNQA 2DGTA 4P71A 4Y2MA 1RCOB 4LREA 3IO1A 1TKDA 3KUEA 3E8OA 2YNHA 1X31C 4TYAA 3MD1A 4KE5A 3G6XA 4B9UA 5L39A 4HT5A 1H6KX 4DPOA 3PW4A 1T8EA 3W66A 1QM9A 3NAHA 1LW0B 3CJSA 5KFDA 5F8IA 3H2VE 3TWZA 1Q8IA 1BQMA 1VBKA 3O3LA 3TANA 3NCQA 1G2EA 2RRBA 5ITHA 1U2RA 5T7LB 2RQ4A 4PWDB 2QL7B 1LXJA 5A6WA 2XYPB 1TL3B 5J2NB 1IWAA 1KONA 2POKA 2VKZG 3G2XA 1B7YB 4M5GA 3G86A 3THPA 1Q82T 1BHNA 3IRXA 3PR5B 1IUJA 3H40A 1C1CB 5KT5A 3NLCA 2VPXB 3OTEA 1C2PA 2VPWB 3MI7X 4C98A 2MQLA 1Q5YA 3HHNB 4HHJA 1RAIB 3Q89A 1VQMS 4RU9A 2MPUA 2CNNB 3JXOA 1FWLA 3TZYA 5M2UA 1NBEB 4ZLNA 2XMWA 3ZO7A 3BBFA 3KK3A 1PBAA 4DR1J 1N56A 3M2UA 4DHVA 2BQ3A 4PG6A 4PUOB 3UDCA 2PI4A 2EG2A 1SH0A 1KWMA 4M5KA 2V2KA 2WTFA 2E9TA 2MZ1A 1H2UX 5CA5A 4ECSA 4USMA 2FVSA 4OZ5A 5KFWA 2OPQA 1NM2A 5DQGA 2CA9A 1JXVA 1S4EA 5KFHA 2OD4A 4DFKA 2HSEB 4OI1A 4K7QA 1LW2A 4YB5A 4B3TJ 4P52A 5CYMA 4B3OA 3G6ES 4ECYA 5I4MA 4KIAA 2V34A 2AYEA 2XI3A 4MIAA 1WACA 2E7VA 4AT1B 2YNGA 4FBUA 3NGKA 3EZUA 2OPPB 4WU2A 1NUEA 4WFAQ 3MPVA 1PCAA 4O44B 2AQ4A 2K1RB 3W64A 4XK8C 3ONQA 3DGPB 3Q8VA 3IG1B 2HRYA 3PZPA 1FRLA 1KQSR 3RAXA 5MAOA 3R27A 4WYLA 1HQEB 1GTEA 1S59A 4CTAA 4DMZA 3BGRB 3CVKA 2E5IA 4IG0A 2VC1A 1VBZA 3RAMA 2B4VA 1MNEA 4OX6A 4X4OA 2YQ1A 2B51A 3IR6B 3EPGA 3NNHA 1DQ8A 4DV3J 4NLVA 2ZITA 5C24B 2DR6A 3CO0P 4X64F 4NX9A 1QSSA 2XSFA 1YITS 2HG4A 4EZ6A 3DC2A 1JNRB 1VQSA 3I4PA 1ZPVA 3O8WA 1J5EJ 4DFPA 1RBOB 2GNKA 3QQCD 4DXLA 1WF1A 3KK1A 1I51B 2J9DA 3QZ7A 2HGLA 5KFOA 1SL2A 1Y3KA 1RT6A 5ETQA 4C8MA 3NS6A 1N52B 2O67A 3PG9A 1CQNA 1G7CB 5KFPA 4U7UK 2DR8A 4UY8T 4NYOA 2XWXA 1FXDA 5KTQA 3DKDA 4NI2B 4MH8A 2J0SD 4CM2A 4DQSA 1O51A 4ZKAA 1TMJA 3GYXB 1RK8A 5K14A 4M95A 1G6BA 3OVSA 4CP5A 3J7Z5 1GAOA 4G1IA 5U47A 2BKOA 1NDPA 4DV0J 4CLPA 3PW7A 2RB7A 3IBWA 5IM0B 2X1GA 4RW7B 1SJFA 1RT2B 3KLGB 1MN7A 4WXWA 2C3PA 1HWKA 1AZSB 2ZNZA 2L9WA 4V19J 1K47A 2KXFA 4WXOA 3TVYA 3OXLA 3LPEA 5DRKA 3PW5A 2M88A 1UZHA 1AFIA 3QJPA 3DM2A 1AA1B 4DUYF 3QWPA 2DGWA 4OJGA 3ETOA 2CDQA 1IBKF 1KQFB 1PJ7A 4A8SA 3N9UC 2EC2A 2CQ1A 2ZZMA 3W2WA 3W65A 2C3UA 3DLJA 3DOLA 7FD1A 2V5HG 4ZVFA 4KB7A 3UCUP 1WG5A 2DGVA 1Q95G 2I5JA 4KT0C 2PFDA 2YX7A 3ENWA 1VHFA 5FLXU 2QA2A 2RT3A 2QT7A 4X62F 1GK8A 2JOQA 3BYPA 1RJJA 3DDNA 1L3SA 4URQU 3HHLD 1X7VA 3TA0A 1K0VA 3GWCA 4WBFA 4U9RA 3IAM9 3D9BA 2IYGA 2IJFA 1PILA 2HEKA 1ACMB 4IH5A 2W7PA 4KH1B 4E2FB 3KOAA 5E3PA 1RT7A 1S48A 3D6HB 5KT3A 3PJXA 1HBUA 3MGJA 5CABA 2MQNA 3TEGA 5LT5A 1TKZA 2BANB 1WTBA 4K4YA 1OO0B 1CULA 2Q79A 2RSQA 2R7VA 2VFSA 1S9GB 2VASA 4HHUA 4L3NA 2EVZA 1OWXA 3PM9A 2XGPA 2EKYA 1N5TA 1YK9A 1RTJA 1S99A 3BN7A 2DR9A 5GADI 2PD1A 2HBYB 1HD1A 4K4SA 3VCDA 1JB0C 1HNZF 3NBPA 2WCXA 2VQFJ 4IKAA 3MCOA 2NREA 2QA4G 4Q2LA 1RAAB 5J1EB 4M1KA 4UQGA 4O3SA 5ADZA 4BLGA 1N33J 5FIIA 1H0HB 4RUBA 2GAHC 3G8QA 1WHXA 2JC1A 2ZJRQ 2NYHA 4CM0A 4RW4B 2XY6A 2D3OR 2JWNA 3MURP 1NJIT 2EPIA 2JZ5A 3G4SS 1I1GA 1M5HA 2HHHJ 4ZVTB 2MKIA 2XS2A 4MAKA 3D3BJ 2UV8A 1SUQB 5HO4A 3IBCB 2R7TA 4O3RA 2VH7A 2RJZA 1TV6A 4QIFA 1R43A 3MD3A 4NXMF 4BHQA 1P8GA 4OHWA 1RWNB 4AL6A 2RDDA 1TAUA 2XSJB 2L9DA 2XS5A 5F9LA 5DG8A 4M94A 3NNAA 3BSAA 4FYDA 3VVUA 2DBBA 5D4PA 2OPRA 4FS2A 1S1UA 3CCZA 4IR9A 2ZHOA 4NOHA 4URSA 3MOZA 2YBVA 1UEVA 4JV5J 2IJNA 4XIUA 1WKKA 2RQKA 4WP3A 4L76A 1IKXB 3PX6A 5D3GA 5KFAA 4BS2A 4D3GA 3PW2A 2CJYB 4O3PA 2Y1LB 4N76A 3D4JA 2ILYA 4ELUA 4RKUC 2J7UA 4ZHRB 3V4MA 4DV1J 2E9ZA 1DTTA 1RDRA 5J1PA 5AJ3J 5ETVA 1FX2A 3I5BA 1MW7A 2KFZA 1AROP 3CB4A 3PJ9A 3PYFA 1CJUB 2EBGA 4X4UA 4KFBA 4B08A 5A8KB 5CYQB 3C15A 4DR1F 4WFBQ 3VGVA 4LF6F 4G1QB 4LFCF 1HFEL 2BDPA 1G4CA 3JTOA 2G2YA 2RD5C 3PHTA 2WBMA 3GTYX 4HKQA 4LSZB 2GVZA 2HLTA 3HHEA 2ZHBA 4OZ1A 4OZJA 2HGNA 1RHUB 3KUGA 2VG7A 4B3TF 4IO1A 2A10A 3VGTA 3UNYA 1ZTWA 1RLDA 2IM1A 4CO3A 3EICA 5E3AA 1SJQA 2R8HA 3IA0A 1FJEB 4X4VA 4YB1P 1QE1A 4ICLB 1DQ9A 4DV2J 4Z2XA 4IQMA 2A6OA 3W9JA 3QT8A 1YTYA 3PRBA 3ZTSA 5AXLA 1U48A 5LSLA 1IQTA 2NPIA 2ZE2B 4LF9F 1WC4A 4ZPCA 4YP3A 2YKMB 1UPMB 3HFVA 3U02A 3US5A 4EK2A 3DRYA 3PYGA 1GQEA 2Z2YB 5HBMA 1U7LA 2PFFB 2JFDA 1NJXA 3NCRA 3AA8A 4DPUA 4CDIA 3QO9B 3LAKA 2BOPA 1HR0J 4DV5J 3HCXA 1JXEA 2AKWB 5DG9A 3QAUA 1RWKB 3SSRA 2YWEA 1UVJA 2RKIA 2IMOA 1WDDA 5HJXA 2HVDA 2CUYA 3MMCA 4DX6A 2CQCA 3MFHA 1YZ6A 3PTWA 1M1HA 4KO0A 1RA6A 1VBXA 2FJXA 1TFYA 4OYXA 1B4SA 4HI2A 1UVLA 2ASYA 1WKLA 3CJQA 3OR1B 3ZZ0A 1S6UA 3MM7A 3R2CJ 2RRNA 2IIHA 1GXLA 5HQLA 4YB6A 1F5CA 2V8HA 2R9LA 2F4VJ 3GSIA 4LBIA 3HSJA 1N8RT 1FD2A 1VRTB 4R5PB 3EVOA 2PEBA 4YR0A 3BH7B 1WKJA 4FF1A 1Q78A 4J9PA 4Q0BA 3KLFB 3HHKA 3QSIA 2IM0A 4Q2MA 2DNKA 5JMNA 1D9AA 4OL8A 1VJWA 2X1AA 4DL7A 5AXKA 1EHWA 2V69A 5KFNA 2WAQD 1ELOA 4M5DB 1RHKB 1G1XA 2PGCA 2VJUA 4CLSA 4G3IA 3CW2C 5KFTA 2MXYA 1JLQB 3ET6B 4QBUA 8ATCB 3MM5A 3GIMA 4ZCMA 5LJ3Y 2JLFA 1RBLA 2MYFA 3R5GA 3W2VB 3JQJA 4NLPA 1CJVA 2P2CB 2V4JB 3RZAA 1Y5NB 3I9V9 3HP6A 1M5SA 4YEAA 3CD0A 2QLFB 4ED1A 5EN1A 1KLMA 1GXTA 2ATCB 2ZH2A 1JLFB 3GSDA 3ZC4A 4OMFG 1S1VB 3G87A 2H1YA 1HWJA 3M8RA 5L1LA 2HFZA 2J9EA 4J9QA 2CQHA 1YWXA 3B78A 4LQ9A 4USVA 3GYNA 5G0RB 3KLHB 4N5SA 2GW8A 2XGQA 4J9UE 5FDLA 3TJ9A 3QIPA 4ENOA 4CI0B 5DQHA 4J37A 5DM6Q 3GFXA 2BE2B 1XMQJ 5KFUA 1IR1A 4NLWA 1EP4A 5CCLA 1B99A 4PXBA 3S01A 3C14A 2NUUG 3ZZUA 4JI0F 1QY7A 4BDPA 2MKCA 2VB6A 4JI1F 4KV8A 1QUVA 4A8QA 5LSOA 3ICLA 2B8PA 3MUTP 5ETLA 3VVTA 1BQNA 4LJMA 5HMWA 1B70B 1VC6A 2ALYB 2CZ9A 2ZH3A 5HROB 4QZVB 3C6UB 1SQEA 3A8JA 3HI9A 4LF4J 2DJWA 2EG1A 3G82A 4FXWA 3CCUS 3NGUA 3OXFA 5K8NA 4PXDA 2Y1JA 1MMDA 2ACMA 2ZOFA 5D0HA 3MPDA 4I69A 2PC6A 3ISNC 3OFEA 3PX4A 2VQFF 3ILLA 2VZ9A 2VUGA 3M8PB 1H2VZ 4R0JA 1S1WA 2CPJA 2UXCJ 1UWBA 1VGYA 4K59A 2AMCB 3LW5C 3AH6A 5ETKA 1LV5A 2MHNA 4I2QA 3FVYA 4JBCA 5JXSA 1S0NA 1Q8BA 3M9NB 2EW9A 1JLAA 1FRJA 1KVIA 3MZIA 3DXSX 2GA7A 3UFCX 2O1PA 3KLIB 2HNDB 4AL5A 1L5UA 1RAOA 2CJQA 2OLWA 2B9XA 4L73A 2UVWA 2HS4A 2RHSB 4F4ZA 4WZMA 2QL9B 4LVNP 3CJ5A 1BD6A 1S1TA 3DMJB 5RUBA 3SEOA 1LWFA 3C16A 3PKYA 3T6BA 5IT9Y 4USIA 2B3TB 2OH2A 1TELA 2GS8A 3RW6A 1HNXJ 2FQQB 2XS7A 4KGVB 1PBUA 5F0WA 2P9GA 2V0NA 3MM9B 1RTDA 5J1NA 1U1NA 1HA1A 3GIIA 3CCSS 5KG6A 1IKWB 3SDEA 1LOUA 5JVGQ 3KNAA 2CFXA 2VHGA 1XK8A 4I1TA 1MWZA 3M6XA 1WSVA 3JYTB 5KFEA 2KXNB 4GO7X 5A0YA 2K06A 1H74A 1URNA 3DYAA 2CJ9A 5HJYA 4DX8H 4HACA 5J2PA 3X1LB 2GFFA 1AXQA 1UFWA 2D7SA 2VQEJ 2KT3A 3HT3A 3D6FB 2ADCA 4KY3A 3HD1A 3GJRB 1FERA 4IFYA 4A8YA 5DQIA 3DLGB 2LU2A 4LSNB 1RYSA 5BYSA 4F0HA 1CJTB 2CG4A 4ANDA 4IRDA 3R5AA 1M5OC 3I0SB 1JMTA 4A8WA 3JQMA 3PJWA 1D09B 3EGZA 1RT4B 1FVSA 2YKNA 5D0EA 5A2QU 4H4KA 1R6VA 2J0QD 4OX9J 2WW4A 3MECB 3LOUA 2QG9B 3HLUA 4QWCA 3R6LB 4JI6F 2JEIA 2BXJA 4X65F 4C11A 1TMMA 1EIYB 2KXHA 1FKOB 3BREA 1MU2A 2E5JA 1ZYQA 1UEKA 1W7WA 3I96A 1HMVA 4RUCA 4DV2F 1WOOA 3BGOP 4KTQA 2ACYA 2DT9A 3K8VA 3K5MA 3S7RA 1ZPWX 1KD1T 1TL5A 2B6AB 1N54B 4G1PA 2BBEA 2DCLA 3ULHA 4KH0B 4ZITA 1FI4A 1Y11A 4QWBA 3BGFA 4P73A 1VYAA 3M9MB 2K7JA 3QJLA 4EMDA 1TKXB 4RNHA 4NLUA 1E6VB 3OQ2A 1VIXA 1I3OB 2MQQA 1WHVA 3W7BA 1H72C 1RAJA 2HKEA 5LMNJ 2LXIA 3SV4A 2DGOA 2QTWA 3OTOJ 4ZN1A 5IQ6A 2DH9A 4ECWA 5A6PA 4UQTA 1OPIA 2CAJA 4I67A 2YWGA 1FRMA 4PEOA 2CZVC 1XN9A 2WK4A 2RQCA 3IAS9 1VFJA 1SCJB 3Q8UA 3AAWB 3DLEB 1CS4A 2B43A 4DR3F 4OJHA 1S9EB 3RBZA 2EFOA 4CH0S 4C2MA 2J9DE 4MFBA 2BW2A 3CDBA 4YR2A 4X4TA 4IH6A 4P2MA 3KG4A 2UU9J 1U0SA 4ES2A 1TKTB 2EKNA 4OI3A 2V9KA 2E9RX 2MZTA 1MROB 2YXLA 4JV1A 3ZTPA 2N4DA 4HDHA 3OR2A 4Z7YA 2PO4A 3LP1A 2IM2A 4NCGA 3PV8A 3QATA 3UI3A 2MJNA 1S7HA 4DU8A 1KNZA 4DUZJ 4RX6A 3AODA 1FTCA 3MAAB 1T9VA 2GJFA 4HI1A 2AJFE 2J5AA 5KFSA 1T05A 1NSKL 2NXJA 4B9SA 4CNZA 3JSMB 3TP2A 3MM6A 2CJKA 2OEMA 3RRGA 4ZVSB 4BC9A 3I82A 1YJTA 1WHWA 1K8AT 1YG0A 1E6YA 3QZ8A 1ZAWA 1X9WA 5D4LA 4FVCA 3JTNA 1VOMA 1N0VC 5HSPA 4F26A 4Y28C 1NK0A 1VK3A 3DOMA 1SL1A 4OHZA 2DISA 2ASDA 2B5JB 4UOCA 3KHLA 3PXGa 2PMHA 2B56A 5K20B 1LW0A 2AGPA 3C46A 2MQOA 2ZC4A 4QR0A 1N6QB 1SV5A 4FF3A 3JAMU 4L6V3 3CPWR 2OJ3A 2G4BA 5T7LA 4PWDA 5L9XA 4B3SF 2E1PA 3HHLB 1TL3A 5J2NA 4RZRA 3RU0A 1C0TA 1VQKS 5LJ5Y 4PQUB 5HVGA 3IMQJ 1VC0A 4E8UA 1LWCB 4F04B 2ILZA 4ID5B 5AE2A 2MEWA 3VHQA 1C1CA 2IVYA 1KEKA 3BDPA 4PZVA 1R8CA 2RUGA 2V2QA 4R8UB 4DR7F 4MTPA 3K58A 2WVEA 4F4WA 3AB2B 2ZVSA 3CDUA 2ZDPA 3IP0A 2BV3A 1P6TA 3H8YA 3Q24A 2G1HA 4PUOA 4EO6A 2HFUA 4WFYA 2DB1A 2SXLA 2VFVA 5KFFA 2LECA 2DVIA 3I31A 1Q8LA 2UXCF 3H25A 1EKSA 1FD8A 2AP6A 2D69A 4OYMA 1DARA 1VRQC 2N3OA 1A6LA 2E44A 3SCKE 4MIBA 2C2EA 4ED0A 5CCMA 4OYAA 1LFPA 1I6JA 4ZCKA 4QW8A 1NH8A 4Y2AA 1HQUB 4DR4F 1HNWJ 5BR8F 2VU5A 2IC3B 4AXIA 1G3OA 3HKWA 1CSJA 2P6SA 2F5GA 3DLLQ 3VWSA 3BBCA 3B82A 3AOBA 3M05A 5B0FA 4NCAA 3MXHP 5K9FA 3T3FA 3FSYA 4O44A 2UUBF 4IDKB 1BMQB 1W2IA 5IC6B 2CNKB 4Y65A 4CWBA 3IG1A 5F8JA 2FHJA 1Y0HA 4QWEA 3BB5A 3DFEA 1HQEA 1HBOB 2Y3YA 4YHHF 1X4AA 2OSQA 2XO6A 3BGRA 3EDRB 4PXCA 1BGXT 4FPIA 1HNXF 1H38A 1HBNB 4UY85 3CCTA 2DRDA 2VG5B 3NEKA 4UTGA 4I7FB 1U49A 5C24A 3UVJA 3TR5A 1UMJA 2J6SA 2XBPA 4GC7A 1IM6A 2XC9A 3TAMA 5DM7Q 1FFSB 1NZAA 1KOOA 1Q79A 3RB0A 1NMEB 3WZ0A 1BWEA 5B0AA 1WC6A 1YJVA 4KKOB 2W8KA 3I9ZA 3MR6A 4NI2A 2NQPA 1HBMB 2NLWA 4ED6A 3T41A 3ZXWA 1IKVB 3PW0A 4DLEA 2G0JA 4NZ7A 3BQ0A 2DY9A 2DRBA 2CQDA 1Q5VA 1VQYA 1U1PA 3K57A 4I6YA 1S6OA 5I3QA 1IR0A 3QT6A 2M4MA 4N47A 2OP5A 3VAKA 5IM0A 4FF4A 1LFWA 1YLXA 3UR0A 4RW7A 1RT2A 3KLGA 2VBXA 2XEXA 5THWA 4DSJA 3OHAA 4JI5F 2IJRA 4F36A 3DLKB 2HNZB 1RT5B 3MDFA 2VPZB 4TY8A 1R3NA 5F8NA 4NXNF 3SZ2A 2G0IA 2X7IA 3RRKA 2CQ4A 5DDRC 2C2NA 2D3UA 2O01C 1RWPB 1PJ6A 1HD0A 2BJ3A 1BUXA 2MGZA 3T9ZA 1NDLA 3TQ1A 3RJMB 4DR2F 4ILMA 1D9DA 3M2RB 2F65A 1XEZA 4LFAF 1AUSL 2MQMA 1LK5A 1Q7YT 2FUG9 4G65A 3MEDB 5G4DA 2WOMA 3BO3A 3ZNUA 4CLTA 2CDRB 1RCXB 4JB8B 5KG2A 1KQGB 4DR5J 1N32J 4K5SA 2P5VA 2I6WA 4OX8A 2D74B 1UW4A 1XC9A 2OHDA 1FDAA 2NS1B 3IWXA 2LQ9A 1Y9OA 1Y00A 5C42B 3OTOF 3J80U 2ZZNA 4OLOA 1JIHA 2HFOA 2OIHA 2MY7A 4IR1A 2F8MA 2HRTA 4GKJJ 2FHKA 4PQAA 3EXYA 1R8BA 2FVCA 4Y00A 3M8WA 2QV6A 4C9DA 2NXNA 4TQSA 3HVRA 2Z8QA 1FFWB 2MJUA 2BANA 4ED5A 1N36F 2W4DA 2ZM6J 2KVIA 4WTOB 1PGZA 1S9GA 4LT6A 1QDUB 3DCAA 4M5MA 1SC6A 5KOWA 6FD1A 1DAXA 2R8KA 5BXIA 1UCNA 3IM8A 2D3ZA 5AE1A 2BRLA 3DRSB 2KO1A 3OUYB 3J7AN 1C1BA 3BR8A 2BVZA 1R8HA 4NLDA 5GAGU 4Y6IA 1UPPA 3ENVA 3KMQA 5L1IA 1NHKL 4WU3A 2VICA 4NZ6A 2HBZB 2CWXA 2ROPA 3DHXA 1FNMA 2ZFHA 3FQKA 5F8LA 5HI7A 4A8XA 1P1TA 3WC0A 1FRIA 4KPCA 5L8RC 3MR3A 4RW4A 4DL6A 2ZWPA 2Z4PA 4ETZA 3NGSA 2M3DA 3P3DA 3D7SB 5AE3A 2KT5A 2X3DA 1TL1B 3AOAA 3TEHB 3RB6A 1J27A 2FZKB 1RYRA 1FNXH 2HVZA 4LQ3A 3U1NA 5K8OA 4DL3A 4USWA 1L3KA 5KFIA 3Q8PB 3PEHA 2GC8A 1IN0A 1JJ4A 1Q1KA 1D0EA 3DLHA 2HHUA 2XSJA 2AD9A 1KVKA 2LKZA 3BO4A 1HI0P 3ZNJ1 2H48B 2XM3A 3B4MA 4ZP7A 3M8YA 1TTHB 1HQ2A 3NG8A 2M8DB 2GO8A 4MT1A 2KZZA 5L1KA 3FCHA 3CCLS 1TP7A 3E3XA 2CJAA 1IKXA 1C4AA 4F50A 1X4CA 2R3VA 4ZVOB 4ED7A 4ZVRB 1QAIA 1X8DA 3BGUA 3QAEA 1NB7A 2RDJA 2Y8WA 4B02A 5B0BA 2ZBRA 5K5MA 3SQGB 4ZHRA 5JJBA 4DCPB 3JS9A 2B4OA 1KSPA 2FLOA 3BV8A 1OMSA 4N8OA 1OYEA 2OKQA 1WJ9A 4K4XA 2W9BB 1CJUA 1SJRA 5CD4H 5A8KA 5CYQA 1SQGA 4ZOSA 5DJBA 1N34F 1B0TA 3QGGA 4P7VA 1FE4A 3MR5A 1IWGA 1EQMA 4FKYA 1X5PA 4UF4A 1FFGB 1QTNB 6FDRA 2AZ3A 1LNQA 2YVSA 4RBTA 1KVJA 4JUZA 3MPYA 3FSIA 4K2JA 3SIPB 2ZKUA 5E7OB 1J2VA 1KDNA 1NHVA 2DNGA 2XHCA 3D2WA 2AX1A 3PX0A 4B9VA 4ZPWR 3U7JA 4DCJB 2VA2A 2APOA 3TAQA 2FVRA 2Q66A 2A18A 3HM9A 1R89A 4CLWA 1WG4A 3MHYA 1NAQA 3KHGA 3RBDA 1PYSB 3AA9A 4U8VA 4WPAA 4XDDA 3TX8A 4ZLJA 4NEYA 2ZE2A 2C28A 2IMWP 4ED8A 5D0RA 3VAFA 4DBQA 1FRKA 1S4FA 3ZZPA 2BW7A 2AGQA 4X64J 4K4TA 3IWNC 2LCWA 1PYTA 2GV1A 1KR4A 3BQ2A 3FRYA 4FZVA 3QO9A 1PAEX 1UZDA 1TR0A 3MOJB 5D78A 2DNPA 4PABA 3P5TL 3H4DA 4W90B 4DJBA 1Z2ZA 4NMLA 1O6XA 2RH3A 1KTQA 2BABA 3HKZD 3ADAC 2UXDF 4EWTA 4CTAB 4DV4J 2R8IA 3M2VA 2V63A 1T03B 2C22A 3K5OA 4PPDA 2MLYA 2UVRA 4LF8F 2FGCA 2MZSA 4RLEA 4HTJA 1Y5LB 1UAWA 2YQ3A 1GFWB 1NKCA 1ZAXA 3OR1A 3VAIA 1VQ5S 5DO2A 2H51B 1W2BR 5BYQA 5F9NA 5GAEI 2IPOB 1VMBA 4R0EA 1GMWA 3BSOA 1VRTA 4R5PA 3DI6A 3KNGA 1L3VA 1F6TA 3M8SA 4CO5A 2KKHA 2XMJA 4NLSA 1S79A 4X4RA 3AJDA 3KLFA 1X0FA 3MEKA 5M2RA 2V8GA 4NPOA 4Z7CA 2Y1RI 2PEHA 3HFKA 2G0CA 2W2OP 1UJ6A 4DUYJ 3HHLC 4P75A 1RABB 2PIIA 1IBKJ 4QOTA 4M5DA 5LXRA 4DPXA 1REVB 3UN2A 3VAMA 3MMAB 2HAFA 3T6JA 3DRPB 2MZRA 3ET6A 2F63A 2DHHA 1UVMA 2BX6A 2QJ3A 2V4QA 4TY9A 3AB4B 3W2VA 4QCLA 4XPCA 3W8PA 2BQRA 2V4JA 4DZDA 1HL6A 5E3QA 4EU0A 3L7OA 4X62J 4CZCA 2LEBA 2QE5A 3JB9k 1PG5B 3CO9A 1JLFA 2VFRA 1M5VC 3QFWA 4LIWA 1S1VA 1DLOB 2HQCA 5IT4A 2D1CA 1U2FA 4KHRA 5IWAF 5FJ4A 3LANA 3U1MA 1RZMA 5KT7A 3JTPA 1T9XA 1UETA 3NAIA 1VR6A 2RUSA 1PC5A 1T9UA 3CSKA 4ED2A 1U47A 3H42A 3N4WA 3W60A 2V2VA 2VC0A 4C4WA 4L72B 1ZA2B 3OL6A 2HURA 5G0RA 3KLHA 2Z30B 2DXEA 3W2WB 3CDWA 2GCFA 2AJ4A 3RRHA 3DOLB 5KAKA 1VLOA 2YKQA 5H9FJ 4GKJF 2B9EA 4Y3CA 1YKWA 4UOHA 1JX4A 4W4MA 1RE1B 4WYWA 4YFUA 2QYGA 2KM8B 4RNOA 3H98A 1SKUB 4YDDB 3CF5Q 1WEXA 1FKPB 2QLBB 2AJQA 3F56A 2XY5A 1KP6A 1NDKA 4HL9A 1XR5A 3EVMA 1B0PA 2G2ZA 4ZMMA 1HNZJ 2KN4A 5D4NA 1N5SA 3C6TB 1P9YA 5HROA 2CRLA 1S76D 1H2TZ 1ZZFA 4CNYA 1ZM9A 2IHR1 1RXOB 3MAQA 4C7QA 1K1SA 4JV2A 5IS2A 4WJBA 3KWMA 3M1VB 2MHEA 2QSFA 1UP1A 3TJAA 3QBCA 1S97A 4FS1A 5EHHA 4O3NA 4N77A 4LF5F 3CDEA 5E3RA 1NSAA 2FY1A 4TLQA 4C8YA 2MSSA 2E5LJ 4NA1A 1FHTA 3HMJG 3CJKA 4NXMJ 2K2PA 5B0DA 3TNVA 3BQ1A 3J81U 2OELA 1T11A 2DGUA 4OI0A 2ZBPA 5KOXA 3OL8A 1V5VA 2W2PP 2JEJA 5C2GA 2HNDA 2R2TA 3QLHB 1VJQA 4DG1B 1NO8A 2AEMA 3A8EA 4LFBF 1MN9A 1X4BA 3KXDA 4LR8A 2XYHB 2YQ0A 4PRFA 2DGSA 2RQMA 3DMJA 2MKKA 2ZH4A 1KFDA 2MKSA 3BKTA 3L7UA 4O4RA 2FHJD 3OL9A 3V5RA 4RR5A 3EWGA 3RAQA 4ECRA 3PKMA 4AD6A 2BOAA 3HJFA 3OV7A 4O3QA 3MR2A 3Q83A 3PIPQ 4OYIA 4KBIA 1XR7A 3QFHA 2OEKA 3QPIA 4KQZA 3A1YG 3N6MA 2RS2A 3HDSA 5EX0A 3PEJA 3LTOA 1S0OA 3E01B 2YPYA 3UNGC 2HIYA 4ITSA 2N7CA 2OFHX 3JYTA 4LF6J 4LFCJ 3J7YI 2CNOB 4MKVA 4I6AA 4MKBA 4YUDA 3FSXA 1PC4A 4TU8A 1SI9A 5D3GB 2FTRA 5HQMA 4MK7A 4ZLLA 3CCVS 1WORA 3IS9B 4QR2A 4J9LA 1SIZA 1DTQB 1TZ0A 4J5OA 3KLEA 1KTVA 4X84A 1DY3A 5HVFA 3V6DA 4HDGA 3LALA 4LSNA 2B4UA 1AYEA 1CJTA 3C19A 2CADA 2UVUA 1RT4A 5C7PA 5KT2A 4N41A 2KG1A 4NLOA 3MECA 4ZVUB 3POTB 4KFBB 2R7QA 4RWXA 5I3UB 4JV0A 3UCZP 3K8WA 3CNQP 1S7IA 4LF9J 1NKEA 4DPYA 2LXFA 4WP8A 1VQOS 1JWWA 5KFKA 1FKOA 1HLWA 3RYLA 2FPHX 1RADB 3LGMA 1NU4A 1AT1B 1UJ4A 2GVZB 2MB0B 3PCOB 3VZHA 4NA3A 2R7RA 3QGHA 3H2UB 3LA0A 2WVDA 2VG7B 2BJ8A 4DN9A 3PIOQ 2FGOA 1F2GA 4JP8A 4KJIA 1RA7A 2HBRB 2DITA 3R9LA 4NL5A 2FHOB 3GIRA 3A3PB 1WC5A 1PIEA 4JOUA 1QE1B 4WWSA 4F8RA 1TKXA 4F4YA 1RWUA 1E6VA 2IFXA 3OXGA 3Q8RB 1R0AB 3BN4A 3DGVA 3LUYA 2KRRA 3QRRA 2EWHA 4MK9A 2L08A 5H9EJ 3Q8YA 1J5OB 3VTIA 3D28A 2CZ4A 3CCMS 2F1FA 4H4MB 4C6AA 3CCWA 4DV4F 1RAFB 1IXKA 4KYZA 4B9MA 2Q6CA 5DDPC 5E2QA 5KFVA 2F40A 3HJVA 4EYIB 3SQOP 1R0CB 3KLVA 5DGAA 3GV5B 4DCOB 2AT1B 4HYKA 4QIEA 3T1YJ 1V3ZA 2K3IA 3D1HA 1N5QA 1LWXA 4RW6B 3BYRA 4BC7A 3DLEA 2IDEA 3AD9C 3M32B 1XNQF 3UWTA 1S9EA 2RF2B 1XERA 2RKIB 3K5LA 1ULRA 2ZJQQ 5HL7Q 1TK5A 2HLUA 2EC0A 3MMCB 3FNNA 2VOOA 3S6EA 1NH7A 1PSDA 3MEEB 3QT5A 5DZ6A 2BJDA 3MMJA 2MMYA 4K8RA 4J9SA 3FK4A 2ROGA 2JRSA 1AFJA 3WQPA 4YY3F 1HYSB 4B9NA 1ZAVA 3SCLE 1T7PA 3WIVA 2H5IB 4NYPA 3A13A 2B9YA 3MCSA 4DQIA 1MROA 4LR9A 4KHPF 3A3NB 4CT9A 3FGVA 1K44A 3HSGA 1LWEB 4NA2A 3G6VA 1NJZA 2HHXA 4L74A 2I9SA 3M6WA 2F3JA 4EFAC 2ZBQA 3JSBA 1T9WA 4WF9Q 5D8HB 3ETMA 4WFXA 4OV1A 3MAAA 1FEHA 3M8ZA 3FBEA 4P6QA 1S57A 1Q0NA 2DPIA 4PXEA 1WI6A 1NJYA 3R1HA 3PRDA 5ETMA 2FJBB 2AWZA 5GMDA 4K4VA 3N6NA 4HR2A 4I56A 1EETB 4UOGA 2FDNA 3QIDA 4OIXA 3RB4A 1SKSA 3OFHA 3AXMA 1UL3A 4FKXA 4U96A 1L3UA 2YNIB 2B5JA 4USKA 2DNNA 2XLKA 1QD1A 3P8BB 3GJSB 4DU7A 4JI0J 1GX5A 2B0GA 4JI1J 3KHRA 4PG4A 2QA1A 3RGIA 2HZVA 2WVCA 4ZS6A 3O6QA 1U8WA 5EWEA 3OHBA 3HHLA 3I5CA 2OGUA 3AOCA 1DZ5A 3PY8A 2GHVC 3OVAA 1NSPA 1H3DA 1LWCA 1IKYB 4ID5A 2D9PA 4WFNQ 1SJ4P 2D9OA 3CJ3A 5E3CA 3CMQA 3GG1A 3VAGA 5FDLB 1MMNA 3J81j 1S9FA 4R8UA 3QIPB 5FLXY 3KJVB 2HWTA 3HD2A 2ZD1B 1DRZA 3FCWA 2PA8D 3TI0A 2LQJA 3CJ8A 2DCUB 1TK8A 1S6PB 4C97A 2MZJA 4ECUA 1NJWA 5EWFA 1JK9B 4M5LA 1WTFA 5AT1B 3IC1A 3DU5A 2OPSB 4J9VA 4Q45A 2I0XA 1X5OA 5KT4A 1ZM4A 2DEJA 4JI7F 1BQNB 2EFNA 1CC7A 3CCQS 2E5LF 1N48A 1YVFA 2U2FA 4YR3A 4FBTA 3IR7B 3EUNA 2FC9A 2JLEA 2JSXA 1NK9A 3EDQB 4WK1A 1RT1B 1JKHB 1HQUA 2NXUA 2R42A 5KFYA 1S1WB 2IC3A 1BE4A 1DBDA 1DHMA 4CIOA 1U0HB 3AT1B 4XDCA 4IDKA 2JC0A 3FFIB 3D0IE 4FN5A 5LOQA 4PWUA 4DV6J 3QJJA 1HW8A 3R7BB 5DLFA 2DPJA 1HBOA 3PR4A 4QQBA 2P9EA 4DR6F 4QJVA 4ZPTR 4DV7F 4CLZA 3Q23A 1HBNA 4UZCA 4A48A 2VG5A 5KG7A 2W4PA 1RACB 4WFZA 1MSWD 4CT8A 2QO3A 2FLPA 2XHWA 4ZCLA 1JLCB 2VDHA 3DU6A 2KVQE 1I94J 1LWFB 3C16B 3VAJA 1WEZA 3HXMA 3CGIA 1R31A 1XNRF 4ZPBA 3GP9A 2DK2A 3VZIA 4USUA 1HNIB 2J8SA 3PO4A 4P2SA 1RWVB 3A4TA 2G1DA 4RNMA 3WDOA 1FCAA 5KFXA 2OEJA 4B9TA 3SSSA 3W1YC 3R1LA 4DSLA 3LAMA 1EJ7L 3OL7A 1HBMA 5ETSA 2B7CB 1NK5A 4FXVA 4LIRA 3KDNA 1KKHA 1IKVA 4JI6J 3GCXP 1JLGB 4X65J 3DYAB 2FIUA 1RAHB 4PKDB 3D1OA 4YN3B 4HACB 1GMWD 4CLUA 1VQ7S 2R7SA 4EBEA 1S72S 4DS4A 1U2CA 3I0RB 4Y0FA 4DL5A 2V8VA 2KM8C 4B9LA 3GZ7A 4HLBA 2LEAA 1X5SA 3KDOA 3HULA 1V3RA 4U6PA 2XO7A 3B8HA 3PFOA 2MZQA 2CQBA 3DLKA 3HO1A 2HNZA 1RT5A 4NMXA 4EYHB 3CJ0A 3N01A 4A4JA 1JLEB 5ETOA 2YKNB 1UJ5A 2UUCF 2GHPA 2A0FB 4J9NA 2CJBA 1QTMA 2JVRA 1UVIA 5KFZA 5GAHU 3V81A 2HFNA 1NLKL 1HNVA 3UO0A 1QAXA 1S49A 3GIJA 5HQ8A 3M2RA 4LF7F 4ES3A 1HHTP 1ZM2A 3MEDA 3EPIA 2VG6B 3FDSA 1FWPA 2LYVA 2F4FA 1VRUB 5CH7B 4P2XA 4YDXA 4IOAQ 1GH8A 5B7WA 3LF0A 5HMYA 4TU7A 1U24A 1WF2A 5B0EA 3R5DA 4M8LA 4Y2CA 4DN0A 3AFGA 3TUJC 2DXDA 3LH2S 4DR3J 4K4WA 2WW8A 1TVRB 1VQ4S 3IM9A 1WSRA 5H1SV 2C2KB 2FJVA 2NYIA 2CYYA 2J0WA 4OZLA 4V1Ak 3CD5A 4DF8A 3SCJE 2M2BA 2M70A 3T1YF 4KGXB 3CCJS 2FVQA 2EBEA 4JI4F 2RMLA 1F3VA 3M6UA 3FBFA 2CPIA 2IA0A 4NLGA 3D5MA 2YKAA 4LSLB 1EZZB 1JQGA 4QPXA 3Q0AA 2YWWA 2IY5B 3AD7C 1FA0A 2N7YA 2YH1A 2ASJA 1VQNS 3DRSA 3TUZC 2GMHA 4QYRA 1AUDA 3DLBA 2KJVA 4AE5A 1RT3B 3PFEA 4UW2A 4MFBB 2EXUA 2QZ8A 3T9NA 1QVFR 1M1KT 4X66F 3VV2B 5JVHQ 4ATNA 3NGDA 2NUHA 1O0PA 3WC2A 1IJFB 2IVFB 2FJDB 4JYAJ 4O4GB 3F44A 4Q5VA 3BJYA 3SI8A 2JFKA 2WSCC 3UE2A 2ADBA 3LQVA 3HT0A 1TL1A 4LMZA 1SPBP 5DDQC 1F1BB 2FYXA 3OPKA 5CXTA 1N5VA 1IBLF 4HEA9 4ED4A 2A3JA 4B3RF 3IN5A 4ZDNA 3QNWB 4NCBA 4B3MF 1VHIA 2BMBA 3QT7A 2M7SA 2A6MA 1BWVA 2LFVA 3D54A 3OT9A 4B3SJ 3MM6B 5D0GA 3KJFB 3KJQB 1D8YA 1RTHA 3LP0B 2W1BA 2ASLA 4ID8A 3KMSA 3GLJA 3EVWA 1KHWA 1CQMA 2V2ZA 4OYWA 2Y8YA 4K0KF 3EZ5A 4KGZB 3D68A 5HLFA 3V6KA 2VJVA 3DOMB 2QMXA 4DR7J 1F9HA 2RU3A 2DEIA 1RB0A 1SBRA 1EAYC 1QVGR 3SQGA 3CEDA 3JSRA 2VFTA 2IDLA 4TKTA 2GZOA 1SQFA 1SV5B 4C8LA 2L3MA 3SMZA 2UXBF 2GAGC 2AYMA 2DXFA 1YBUA 4GVLA 2W9BA 1QUPA 3CIZA 1C0TB 4ELVA 1ZZNA 1WNEA 3G8SA 4ER8A 4X4QA 1EB0A 2QMWA 1Y10A 3EX7B 1RKIA 2NZCA 4KAIA 4DR4J 2IAJB 1FE0A 1LQ9A 1T95A 5E33A 2Z58B 4J9MA 5BR8J 1OIAA 2CPZA 3DN9A 5K8PA 2FZGB 1UTAA 5SUHA 1NPPA 2PSZA 4QU7A 4EUVA 1NK7A 3C8YA 2UUBJ 4ZIWA 3RR7A 2C1EB 3BEGB 3BH6B 3KFWX 4DSKA 4ZP8A 1RAEB 4R25A 1ITPA 2B7BB 3HVTB 2FD2A 4ECVA 2U1AA 4YHHJ 1IBMF 3FBBA 4Y2KA 1TQLA 3T1HJ 4GVBB 4LF1A 3BKFA 1MWYA 2XQCA 3I87A 4H54A 3KK2B 3R8YA 2LLZA 2F8EX 1OS5A 3NL0A 1NXIA 4DV6F 4ECXA 3H20A 3BDEA 3TYTA 2GGPA 1D9FA 1Q16B 1JJ2R 2HIQA 3A8IA 2W4CA 2H3EB 2M8HA 4FPRA 3OVBA 3CDAA 3OSNA 5D6GA 3MEGB 3CMAS 4F3OA 1S1XB 1QAYA 4GKKF 2C3YA 1W26A 3BO2A 4DL4A 2YNFB 5ETNA 3H5UA 3OTCA 2XZWA 5B0CA 5KFRA 2QL5B 1SJ3P 1YJ9S 1I94F 3G6YA 1X9MA 3I5AA 4K4ZA 1X4FA 2LDIA 3ZZZA 4Y34A 1NZ8A 2MLZA 2AJ1A 1T03A 3N6LA 4F2RA 4RNNA 1SC4B 3UQSA 3CULA 2E5HA 3C2PA 3VR1A 4ZLPA 3W3SA 3THTA 2M0GB 3L95X 2ZH6A 4I0WA 4IG3B 2ATLA 3ZTOA 2W9AA 3W62A 1T3OA 4HVZA 4GC6A 4YB7A 1U1MA 3UVJB 2ZWOA 1PO6A 4ERDA 2GJIA 3E2EA 4ZPAA 2MSTA 4CO4A 4DQPA 2KI2A 3TAMB 4K4UA 1BLUA 3M8QA 1Q7LB 3V4IA 2OTLS 3CJ4A 3DRRA 3FRZA 3KKFA 2K7KA 5DGBA 4ILLA 1NCLA 4JI5J 5B08A 3A12A 4NEZA 2HAIA 3D0HE 2JJ4D 2NXEA 2HHTA 5SZTA 2IBKA 1SVDA 4NXNJ 2IYIA 4EBDA 2OI2A 3GFZA 4P7TA 4MIWA 3GMGA 3A8KA 4I64A 1GX6A 1F0XA 2KFYA 4IUFA 3HZGA 4NE9C 1R8AA 1REVA 3TO8A 4OZNA 2GVDB 4X4NA 3MMAA 3CC7S 3GILA 4DR2J 2HQ3A 2BYCA 3T5JA 3DRPA 4LFAJ 1TL7B 1R27B 3IR5B 2CWKA 2EEYA 4F3QA 3WX4A 3MPUB 1N5YA 5C2CA 3U1LA 1C0UB 4ZVEA 3ZTRA 2AU0A 2XULA 3CJTA 4EEYA 3LO3A 2DNOA 4J9RA 1DLOA 1TFWA 1XJWB 5A2QY 2DYAA 4TY8B 3HHDA 4XAKA 3KJNB 2CJXB 3DNCA 2ZOGA 5GAEU 3NRBA 3F0NA 1N4LA 3M9OB 4CQ1A 3I32A 2BKNA 2KDOA 2MGZB 1RISA 5D77A 4DLGA 1N36J 4TNOA 3PNIA 1F60B 4EBCA 3THVA 5GAGI 2WOMB 2BJEA 3UR3C 2W25A 5FD1A 1NPRA 3TVKA 3D3CJ 3SFGA 1FDBA 3GJTB 3OLAA 2Z0GA 3H5SA 5CAAA 1FKPA 3K7RA 1U02A 2PE8A 3ITHB 5J2QB 1VLYA 4WTYA 4I2PB 5F8GA 2EK1A 3GCWP 1Q86T 4ELTA 4N8NA 3C6TA 3UCGA 3MMBB 3P45B 1TUWA 5A8WB 2YH0A 3NS7B 3MM8A 2V8PA 3WBZA 3BGLA 5KFMA 2BE9B 5CD4A 1FJ7A 2DGQA 5KFGA 2JHEA 1ZBTA 1AB8A 3M1VA 4X2BA 3NP5A 4PYDA 4OLPA 4IO9Q 4DUTA 3DOKB 4A47A 1CJKB 1U4BA 3ISZA 2Y0SD 3L7PA 1JJHA 4IFVB 4PWWA 1C1BB 2R7WA 4JYAF 4I6WA 1X5TA 1ZA1B 2R8JA 1YJUA 4DFJA 3M30B 8AT1B 3PO5A 3MTJA 3P96A 2YPZA 3N5FA 2EI5A 2ZVIA 3QLHA 1L3TA 4DG1A 3EGVA 5KFBA 4Q44A 2YWFA 4HHHA 1CLFA 2L41A 1O5JA 3AY0A 1NPKA 1S0VA 2BM0A 3O44A 1Z1ZA 3NCPA 1KN6A 3ZZTA 2VKRA 2HNYB 1URRA 4USJC 1FJGF 4OI2A 1W25A 2H4WB 2Q43A 5I42B 3F73A 1ZH5A 2ZH7A 2JH3A 4NLQA 5C25B 4NYZA 3SBMA 2XZDB 2HMIB 2HWIA 4H4KC 1FK9B 2J7WA 1HWIA 3E01A 3OJUA 2FY8A 2BQUA 3T5KA 2J8AA 1N34J 1H7XA 2GQCA 1TAQA 1YJWS 3GG0A 1K9MT 5F8MA 3PRVA 4WZQA 4LBPA 5EX3A 3WX8A 1SL0A 3UD3P 2RHQB 1LK7A 3IS9A 3HFZB 2ZKTA 1VI7A 4GO5X 3QGIA 5CQGA 4ED3A 4DF4A 3AD8C 1DTQA 3Q8QB 1NB2A 3L09A 2C42A 1U1KA 1XR6A 1N88A 3JAMY 1T02A 1NK8A 2FZCB 2XZTB 2WBRA 5AXMA 2V8DA 4BCAA 3N79A 2ZC3A 1MWQA 3GFYA 2E5GA 2WVFA 3K0JA 2OPPA 3POTA 5J2MB 2M9KA 4CH1A 4C3MA 4ZVHA 5I3UA 4MYUA 4CLLA 2K1RA 3S8SA 3DGPA 1T0TV 2OUGA 5CZXA 2VL1A 5A8RB 3OBIA 2B8QA 3EE3A 1SJ1A 3T1HF 3QWUA 4OX7A 2DY1A 4RW9B 2HGMA 2ZH9A 2J76E 4DFMA 2Q1LA 2QFIA 3J7YU 2EK6A 4F02A 2QIFA 2Y9HA 3LGNA 1D1UA 4RU2A 5ETTA 3CJ2A 4LRBA 3O5TB 1FF2A 1XMOJ 3GONA 3IRWP 2UXDJ 1SIWB 3I4HX 1TU0B 1R0AA 5HP1B 2KJWA 2FC8A 1MLAA 3BZQA 2HFSA 2E29A 2ZZTA 1XMBA 1FXRA 4U95A 1Y3JA 5F41A 4K2XA 2O66A 2CQ0A 5DLGA 2ZH8A 3GV8B 1M1GA 4LF8J 4NLXA 2ZHAA 1J5OA 1WF0A 3G71S 5IT0A 3BPDA 4W92B 3Q22A 4H4MA 3TA1A 1U8SA 3C3LA 1S6QB 4A8OA 3FEXB 4M63A 1R8PA 2W9CB 3DHWC 4A8FA 2KZMA 5GMKa 2DHAA 1VDHA 2QSWA 2GO9A 3D0GE 2KFNA 4H4OB 1TL4A 3FUYA 4DV3F 1S5ZA 3MFIA 2PMZD 2J9CA 3PACA 2GJ2A 2QRRA 4RW6A 3GIKA 2IRXA 2DHXA 3M32A 4WIQA 3SCIE 2RF2A 1VQPS 1UWAA 2LA4A 3FMBA 1RHJB 1JJCB 3M2VB 1J5EF 1F5BA 2HPUA 3MEEA 1IBCB 1ZS6A 4UT4A 2X1BA 1AZSA 5EDWA 2CIMA 2F9DA 3B54A 4ECZA 3ELHA 4CYUB 1EX8A 4L3KA 1HYSA 4KGMA 1X4HA 2C2RA 4OV6A 4RW8B 4CRJA 1FDNA 4KC5A 4A8KA 1T3NA 2GX8A 2HHVA 1CEZA 2QEXS 1B0VA 2ZUAA 4HH0A 4X4PA 1LWEA 4F25A 3TA2A 3AHPA 2VF3A 1LEOA 3LGHA 4CO1A 3CWJA 5H9FK 1X4DA 3DI6B 1RP5A 1SC3B 4DV0F 5IWAJ 4GRSA 3FCVA 1GNKA 4ZJQA 3V6HA 2VFUA 3SYZA 3MCMA 1T94A 4JI8J 1VQ6S 2ZBCA 4ZP6A 2BEFA 1JLBB 1WEYA 3M7VA 4NLYA 1OQ3A 3TUIC 4X4SA 3MUMP 4PR6A 4NLTA 2UVVA 1EETA 2CQIA 1RWMB 3NOGA 4TXSA 1H73A 4Q43A 3R5JB 4ES1A 1YX2A 3H7HB 4Q8EA 1XBWA 3Q2TC 1KRPA
chains in the Genus database with same CATH topology
1FEHA 1TKTB 2YNIA 5KFCA 4P6QA 4V19X 1U45A 2DPIA 3AJ1A 3C66A 4OI3A 3LP2B 4PXEA 4C3KA 2V9KA 5E41A 2E9RX 2EFVA 2G13A 2MZTA 1WI6A 1MROB 2RIJA 2WSFC 4J9OA 1NJYA 4JV1A 2HVIA 3R1HA 3PRDA 1YJRA 2N4DA 1QSLA 2FJBB 3OR2A 4HDHA 2PO4A 3CIMA 3D1QA 2AWZA 4K4VA 2R7XA 5T14A 3LP1A 3N6NA 2IM2A 4I56A 2I2YA 1EETB 4NCGA 2KG0A 3NNCA 2HRUA 2CPEA 3UI3A 3PV8A 4UUXA 2FDNA 2BA9A 3QIDA 4NRUA 4OIXA 3RB4A 2MJNA 1X4EA 3EXCX 1HPZA 4PPZA 1SKSA 3OFHA 1F9FA 2QLXA 3TW0A 1UL3A 1S7HA 1KNZA 3HX9A 4RX6A 1L3UA 1NK4A 1FTCA 3CT9A 4HI1A 3B4DA 2AJFE 2J5AA 4ZP9A 5KFSA 4WKYA 3MUVP 1T05A 2YNIB 2B5JA 4ILRA 1BC6A 2DNNA 4QIVA 2XLKA 2ZM6F 4B9SA 4CNZA 1HARA 4FVMA 1IKYA 3JSMB 2VBZA 3TP2A 3MM6A 2CJKA 1FEEA 4YMEA 3GFHA 3RRGA 1GX5A 4BC9A 2B0GA 3I82A 1NEEA 1YJTA 3H4BA 2X51A 1WHWA 1K8AT 3KHRA 1YG0A 1S77D 1E6YA 1LKZA 1ZAWA 2GQ2A 3QZ8A 3OR2B 5J1EA 2COLA 4PG4A 1YI2S 4KSEB 1X9WA 2R8GA 5D4LA 2EFPA 2QA1A 4FVCA 5IXUA 3JTNA 3LP1B 3MM8B 1VOMA 4ZS6A 3KJVA 2KB2A 4NCGB 5T41A 3UPFA 1N0VC 3O6QA 2A2DA 1XTZA 3T5HA 2BM1A 2ZD1A 3MAHA 4F26A 4Y28C 2WONA 2PI5A 2HZCA 1NK0A 1HPZB 4WE1A 1YHQS 1VK3A 5EWEA 3DOMA 2GMLA 1M0SA 3J80Y 3OHBA 3KTQA 3HHLA 2FLLA 3TARA 4DS5A 3I5CA 4WK3A 1SL1A 1S6PA 4OHZA 2DISA 3G8TA 2HHQA 2ASDA 1T05B 1DZ5A 3PHEA 3PY8A 2B5JB 2GHVC 2VA3A 2JDJA 4URGA 3OVAA 4UOCA 1H3DA 1RGVA 2RDIA 2ZUGA 3PXGa 3KHLA 1LWCA 1K73T 1IKYB 1HW9A 4OQJA 4ID5A 2OPSA 2D9PA 4WFNQ 1SJ4P 1GXUA 4FNIA 4U67Q 1RTIA 4RBUA 2PMHA 2B56A 2D9OA 1QAJA 4O0IA 3CJ3A 5E3CA 3NWGA 1LW0A 2AGPA 4B17A 2XI2A 3GG1A 1D3WA 3VAGA 5FDLB 3C46A 2MQOA 1E6YB 1MMNA 1SUQA 1Y4ZB 2ZC4A 4QR0A 2V9WA 1S9FA 1N6QB 4R8UA 1SV5A 2XNQA 3QIPB 5FLXY 2DGTA 4FF3A 4Y2MA 2DNHA 1YRXA 3KJVB 2A1BA 3CC2S 4L6V3 3CPWR 2OJ3A 2HWTA 3IO1A 1TKDA 2ZD1B 2WONB 5T7LA 2G4BA 4WE1B 4PWDA 5L9XA 4B3SF 3E8OA 2YNHA 1DRZA 2PA8D 3TI0A 2LQJA 2AJ0A 4TYAA 3HHLB 2DCUB 2DNQA 3MD1A 1TL3A 4WKRA 5J2NA 4RZRA 3RU0A 1C0TA 1TK8A 1VQKS 5LJ5Y 1S6PB 4C97A 4KE5A 3G6XA 2MZJA 1RT1A 1JKHA 4B9UA 4PQUB 5L39A 2M52A 4HT5A 1VC0A 4ECUA 1NJWA 1H6KX 5EWFA 4DPOA 1APSA 4E8UA 1JK9B 1LWCB 1WTFA 3PW4A 1H98A 2ILZA 3DU5A 2OPSB 3IC1A 4ID5B 4PG5A 5AE2A 1T8EA 4Q45A 1RTIB 2I0XA 2DR5A 1N33F 1X5OA 1QM9A 5KT4A 1ZM4A 3HK2A 3NAHA 4JI7F 1LW0B 1C1CA 1BQNB 2IVYA 2EFNA 1KEKA 1CC7A 2V94A 2I38A 5KFDA 5F8IA 3BDPA 3H2VE 1R8CA 2RUGA 5GADU 3CCQS 4R8UB 2E5LF 1N48A 1Q8IA 4DR7F 4MTPA 3K58A 1YVFA 1BQMA 3O3LA 3CJKB 3TANA 2LMIA 3NCQA 4F4WA 1VC5A 3FFIA 1G2EA 2U2FA 4YR3A 4FBTA 2RRBA 3IR7B 1U2RA 3AJ2A 5T7LB 5ITHA 2RQ4A 4PWDB 3AB2B 2FC9A 2WSEC 3EUNA 2ZVSA 2JLEA 2YNHB 2JSXA 1LXJA 5A6WA 1HWLA 4J9KA 1NK9A 1IM4A 3CDUA 1TL3B 3IGNA 5J2NB 3OTDA 2HHHF 4WK1A 2ZDPA 1KONA 2POKA 1RT1B 2BV3A 1JKHB 1P6TA 1HQUA 2VKZG 3H8YA 3Q24A 2NXUA 4PUOA 4EO6A 4WFYA 2XCAA 5KFYA 2DB1A 1FRXA 2SXLA 3G86A 4TYBA 3THPA 3GQCA 1Q82T 1S1WB 2IC3A 2VFVA 3IRXA 5KFFA 2DNRA 4AXJA 3PR5B 2LECA 1IUJA 3H40A 3I31A 3ZZOA 2HWHA 1Q8LA 2DVIA 2UXCF 1JXLA 1DBDA 1DHMA 1C1CB 2M5YA 5KT5A 4CIOA 3NLCA 2VPXB 3OTEA 4OFZA 3H25A 1FD8A 2AP6A 1C2PA 2VPWB 3MI7X 1DARA 4USHA 2N3OA 4C98A 1D8ZA 4XDCA 4QW9A 2MQLA 5CHCB 3HHNB 1A6LA 1BQMB 4HHJA 4UUWA 2E44A 4IDKA 3SCKE 2JC0A 2CPFA 3FFIB 3BM7A 1VQMS 4MIBA 4RU9A 2C2EA 2MPUA 4ED0A 5CCMA 3D0IE 1LFPA 4FN5A 1I6JA 4RUAA 4DQQA 4QWDA 2EFGA 5M2UA 4PWUA 4BWJA 1JLCA 2XMWA 3AQOA 4ZCKA 3QJJA 1HW8A 3KK3A 5DLFA 1N0UA 4QW8A 1NH8A 5IFMA 4Y2AA 1N56A 3M2UA 1HQUB 3OFFA 4DR4F 2DPJA 1HBOA 4DHVA 2BQ3A 4PG6A 4PUOB 3PR4A 4QQBA 2F7VA 2IM3A 3UDCA 4G1QA 2PI4A 4JV5F 2EG2A 5BR8F 2HHWA 1SH0A 2IC3B 2P9EA 5C5JA 3IRXB 2V2KA 1M5KC 4DR6F 1B64A 4OL8A 4AXIA 2WTFA 1G3OA 2E9TA 3HKWA 4QJVA 1CSJA 2MZ1A 2P6SA 4ZPTR 3DLLQ 1H2UX 5CA5A 2C2DA 4DV7F 4ECSA 1HNIA 3Q23A 3VWSA 2FVSA 1HBNA 4OZ5A 3B82A 5KFWA 2OPQA 3M05A 5DQGA 5B0FA 4NCAA 4A48A 2HS0A 3MXHP 2VG5A 5K9FA 5KG7A 2DTJA 3T3FA 3FSYA 4IQXA 2W4PA 1MSWD 4WFZA 4O44A 2I8EA 4CT8A 5KFHA 4IDKB 2UUBF 2OD4A 2QO3A 3IWLA 4DFKA 1W2IA 2FLPA 2XHWA 4IOBA 4NWBA 4OI1A 4Y65A 3IG1A 4ZCLA 1LW2A 4YB5A 5E0OA 5F8JA 2FHJA 3HZEA 5CYMA 4B3OA 3G6ES 4ECYA 3GR1A 1JLCB 5I4MA 4XPEA 1Y0HA 2C3MA 3DU6A 2UV8G 3KK3B 2J6UA 4QWEA 3BB5A 1KC8T 3RTVA 1LWFB 4KIAA 3M2UB 3DFEA 1HQEA 2AYEA 3VAJA 1HBOB 1WEZA 3CXCR 3CGIA 3HXMA 4YHHF 1X4AA 1R31A 1JLGA 2DH8A 2OSQA 2XMTA 4DV1F 2XI3A 3BGRA 2E1MC 4MIAA 4IH7A 1XNRF 1WACA 4RBVA 4PXCA 1BGXT 4ZPBA 2CPXA 5AJ3F 2DK2A 5M2PA 2YNGA 4FBUA 3NGKA 3VZIA 2IVMA 1HNXF 3EZUA 4DQRA 1HNIB 4ICLA 1H38A 1HBNB 4ZVGA 2OPPB 4WU2A 2OPQB 3PO4A 4P2SA 4UY85 2OAUA 4WFAQ 3MPVA 3CCTA 3I0RA 2VG5B 2G1DA 4RNMA 4O44B 3WDOA 1FCAA 5KFXA 2K1RB 4I7FB 2AQ4A 4B9TA 4XK8C 3KLEB 3SSSA 3R1LA 3RB3A 4DSLA 1U49A 3LAMA 3HVAA 3ONQA 5C24A 2ALZA 4F4KA 3TR5A 4QWAA 3JSYA 3IG1B 3OL7A 1UMJA 1LW2B 2YX1A 3V6DB 1HBMA 1UEUA 2HRYA 2J6SA 5CYMB 3PZPA 4B3OB 1FRLA 1XWLA 2XBPA