3S6EA

Crystal structure of a rna binding motif protein 39 (rbm39) from mus musculus at 0.95 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords RNA-binding protein 39
publication title Crystal structure of a RNA binding motif protein 39 (RBM39) from Mus musculus at 0.95 A resolution
rcsb
source organism Mus musculus
total genus 30
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s6eA00
1X0FA 2RS2A 4J5OA 1XN9A 3UCZP 1DRZA 2I2YA 2N7CA 2LECA 1KD1T 5CYJA 1JJ2R 1IQTA 2LMIA 1JMTA 5LJ3Y 1Q86T 3VALA 1UP1A 1O0PA 1X5TA 3S6EA 1M5KC 2DGQA 3U1MA 2KG1A 3CD6S 2X1BA 3CCQS 1X4FA 2KI2A 2M8HA 5LSOA 2F9JA 1N8RT 2X1FA 1YIJS 3R27A 4QPTA 1A7GE 1R8HA 4UY8T 1YI2S 1VBXA 2RRBA 2HVZA 2DGOA 4M5DB 1VC6A 4IOAQ 2MMYA 3LQVA 2MSTA 1SJQA 1PO6A 1CVJA 1NU4A 3I55S 2E5GA 1DHMA 1OO0B 3MUVP 5FJ4A 1P27B 3S8SA 1FHTA 1SJRA 2QFJA 2J8AA 4WIIA 3MXHP 2LXUA 2CQ3A 2CPZA 3BEGB 1VQ6S 1S79A 2CQGA 2RUGA 1YWXA 2DNMA 3CPWR 3R1LA 4CH1A 3D2WA 2MSSA 3N9UC 3CTRA 4LJMA 2DHGA 3MI7X 2MGZA 5DDQC 2L08A 4QQBA 2RVJA 1X4AA 2LA6A 4TLQA 3DXBA 2DNGA 1D8ZA 3EGNA 2KT5A 1WG1A 2KG0A 2PE8A 1D9AA 2MKHA 2DNHA 3VAMA 1X4CA 2KRRA 2RRAA 2M4MA 3MUMP 2MKSA 5CA5A 1FJ7A 1WEYA 2M8DB 2J0QD 1M5OC 2FHOB 2K3KA 2DIUA 2MKJA 3NS5A 2OSQA 3CC2S 3SMZA 5LJ5Y 2KXFA 4WCEQ 4FXVA 2L9WA 1AUDA 3HI9A 2XS7A 3NS6A 1WF1A 3SXLA 2N3OA 3PIPQ 2KH9A 1YITS 2CPEA 3J7ZT 1F9FA 1U1NA 2MZTA 2QA4S 2LKZA 2M70A 3H2UB 2YH1A 3Q2SC 2MQLA 3I56S 4C4WA 1X5SA 2KXNB 1VQNS 3CCMS 2M88A 1HA1A 2DITA 4WF9Q 2DNZA 3Q2TC 2PEHA 3SDEA 2ADCA 3UD4P 2KHCA 1U1MA 1WF2A 2KXHA 5D77A 2MGZB 3B4DA 3VAHA 5CXTA 5JVHQ 1YTYA 3VAIA 1YJ9S 5GVQA 5D78A 4A8XA 2E44A 2DHSA 2HGNA 2MQOA 3THTA 2CQPA 4QU6A 1OIAA 3R1HA 4FXWA 1VQ7S 1YJNS 2MQPA 2G4BA 1VQ4S 3G6ES 1KC8T 1U6BA 3H2VE 2MYFA 3NNCA 2ZJPQ 2DNNA 2A3JA 2XNQA 2DNYA 2AYMA 3BO4A 3UE2A 3TO8A 4V19X 2MZRA 5DM7Q 4RU2A 2D3OR 4OZ0A 2Q79A 2GO9A 1ZZNA 2AD9A 2DNLA 1U1QA 2VONA 1QVFR 1K9MT 5IFMA 3MURP 2CPHA 2ERRA 2N3LA 4W92B 5GMKa 2MY7A 2MZSA 1WG4A 4IOCQ 3CC7S 1WHYA 3FEXB 3NNHA 1WEXA 1JJHA 3SDEB 3ULHA 5GAHU 2CPDA 5GADU 2RU3A 4ED5A 2YWKA 1UW4A 1ZZFA 1X5PA 2F9DA 3THPA 3UCUP 2NZ4A 2WBRA 2G1DA 2DK2A 3OW2R 1X4DA 2CQBA 3B4MA 2M7SA 3K0JA 1WF0A 2LCWA 4QU7A 1ZH5A 5ITHA 1M5VC 3P6YC 4ZKAA 4WKRA 5MLCV 1K8AT 2CQCA 1VC0A 1H6KX 1M5PC 2JWNA 5DDRC 1VQMS 2DGTA 2DO4A 2E5JA 2KRBA 1Q7YT 2YKAA 2YH0A 1G2EA 2ZJRQ 3VAJA 2E5HA 1VQKS 2MZQA 1UAWA 4LIRA 2LXIA 4BS2A 2MZJA 2U2FA 2CQ4A 5GAGU 5DM6Q 3CCSS 2MKCA 1YHQS 3TP2A 1WELA 1WHWA 3S7RA 3MD3A 2MJUA 4CQ1A 2X1AA 2FC8A 2L41A 2LYVA 2I38A 4C7QA 2CQ2A 4WFAQ 1NJIT 1VQ8S 1FNXH 2VOOA 4CH0S 2AYEA 1RK8A 2GHPA 3RW6A 2B0GA 1RKJA 2O3DA 2CJKA 3EGZA 5DDPC 2VODA 4P6QA 2D9PA 2RNEA 4WFNQ 1N54B 1VBZA 4TU7A 1YJWS 2OIHA 2KVIA 1X4GA 1WHVA 2M9KA 1HD1A 3G4SS 2JVRA 3CCUS 3EX7B 2MHNA 2CQIA 2DNRA 2DH7A 2XS2A 3CCVS 1HD0A 2XB2D 2CQ0A 5EN1A 1WHXA 3LPYA 2LEAA 2KM8B 4U67Q 2X1GA 4YUDA 2DGSA 2KU7A 1W2BR 1WI8A 4ERDA 1M90T 2HZCA 2CPIA 1M1KT 1Q81T 1FJEB 2DGUA 1DBDA 3MDFA 3VAKA 5HL7Q 2QEXS 1X4EA 1U2FA 2JVOA 3CUNA 4C0OC 2LA4A 1KOHA 1SXLA 3J7YU 1U1PA 1FO1A 3VAFA 1QVGR 2KYXA 1X5OA 4Y0FA 1VQOS 3HHNB 3V4MA 1OWXA 2BZ2A 5HO4A 2DHXA 2NLWA 1U6FA 4LMZA 1HL6A 2J76E 3JB9k 1U1OA 2EK1A 5JVGQ 2DNKA 5LSLA 2JRSA 1JJ4A 1X4HA 2J0SD 5IM0A 1U1RA 1WG5A 2MPUA 2MQQA 4TU8A 4Z2XA 2HGMA 1VC5A 3U1LA 2MKIA 2RQ4A 3P3DA 2CPXA 2BOPA 1FT8A 2V94A 2MKKA 1WWHA 4F02A 5BJRA 1OPIA 1H2VZ 2DH8A 2MJNA 2OSRA 3UCGA 2E5IA 2XNRA 2CPYA 1U1KA 1N88A 4OZ1A 2KFYA 3BO3A 3CMAS 2M2BA 2CPFA 1A9NB 2HGLA 3CMES 3CULA 2KM8C 2MB0B 1VBYA 4PR6A 5IQQA 3UWTA 1URNA 1FXLA 3CC4S 2DNPA 2OTJS 1X4BA 3G71S 2EVZA 1L3KA 2LQ5A 1SJ3P 3G96A 2CQHA 3S01A 2DNQA 2MY8A 3IRWP 3G9CA 4F25A 4IO9Q 1FJCA 3PIOQ 2F3JA 1SJ4P 3P5TL 3G8TA 1KQSR 2OJ3A 2DGVA 3VF0B 2DIVA 2YTCA 1UFWA 3BO2A 1B7FA 1QM9A 3MD1A 2LEBA 3MOJB 3MUTP 2KN4A 2XSFA 1K73T 5LXYA 5IM0B 2RT3A 3CCJS 3NNAA 4PKDB 4UQTA 3DLLQ 2D9OA 3ZZYA 2MQNA 1BY9A 1WI6A 4Y00A 3CCLS 2MQMA 2DNOA 3VAGA 1KOOA 1VQPS 1N52B 4F26A 1H2TZ 2FC9A 4WFBQ 2MZ1A 1VQLS 2AYGA 2DO0A 2DGXA 4CIOA 5LXRA 5H1SV 2N82B 3CXCR 3L3CA 1NO8A 4W90B 1U1LA 3IWNC 2DGWA 1R8PA 4EGLA 2G0CA 1VQ9S 2DHAA 3ZZZA 3CF5Q 3G8SA 2M0GB 2UP1A 1Q82T 4YB1P 2HYIB 2RS8A 3US5A 2FY1A 4IUFA 2DB1A 1S72S 1PGZA 1VQ5S 2EK6A 2OTLS 2AYBA 2MXYA 3BS9A 1SJFA 1DZ5A 1P1TA 2DISA 3FEYB 3CCRS 4TU9A 3CCES 1H2UX 2K8GA 5GAEU 2RQCA 4PRFA 2M52A 3TYTA 3UD3P 4YOEA 2SXLA 3P49B 2ZJQQ 1WTBA 5DDOC 2JX2A 2CQ1A 2ADBA 2FPHX 2XS5A 2VOPA 2DH9A 3RW7A 2CPJA 3NMRA 1WEZA 2U1AA 2CQDA 5DETA
chains in the Genus database with same CATH superfamily
1GH8A 4M5JA 2HNYB 1JXEA 5K20B 2R2UA 2BE7D 4NLOA 2I2YA 3N5BA 4JI3F 3CGIA 1RHRB 5KT3A 1SQEA 4E2FB 1LK5A 2H4WB 3S6EA 3QQCD 4ES2A 4CH7A 4YY3F 5EX3A 1VS3A 3LH2S 1S6OA 1FWPA 4QPTA 5GADI 3DC2A 1E6VA 1PO6A 4JB8B 1X8DA 4ID5A 3GJSB 3W8PA 5IS2A 1IR2A 1DHMA 3KJFB 5D4OA 1ZM2A 1IM4A 2J8AA 2VG7A 4AL7A 1N36F 4A8FA 4USTA 2W4PA 1FKAF 1UA1A 1SJ1A 4DR6F 2R2TA 2X7IA 3K59A 4X66F 3B6BA 1U45A 2BJ9A 2WVCA 1TL1B 1NK5A 2OPQA 3MPVA 4ES3A 5KG7A 1SH3A 4PYAA 4HT7A 2VB6A 4FVMA 2DVIA 2XEXA 3GFXA 5LJ5Y 2KXFA 2PFDA 4WCEQ 3HI9A 3QZ7A 3SXLA 3CT9A 1IVZA 4JI0F 3RGIA 1HARA 4R25A 1NKCA 2IM0A 2Y0BB 3BDPA 4WF9Q 4WK3A 2WK4A 1UL3A 4RW8A 3KLHA 4CO0A 3U27A 3UN5A 3K89A 5HJYA 4UY85 3HJFA 4CDIA 4A8XA 1SKSA 2IM2A 2MQOA 4WE1A 4CT8A 1AUSL 4WIQA 2QMWA 3LGHA 3MM5A 4LF6F 3E01A 3MZIA 5F8JA 2N7YA 2MZRA 4ZVPB 2D3OR 3N6MA 4OZ0A 4DWIA 4FZVA 4RUAA 3THVA 4MKBA 1K9MT 2DR7A 4KO0A 2W4DA 2MZSA 2C2NA 1FFGB 3CDEA 1UVLA 1RT3A 4AT1B 2LXFA 2F9DA 2DK2A 2CQBA 2XG8A 5LT5A 3FBCA 1M5VC 1SIWB 4NOHA 1FE0A 2Z4PA 4URSA 4FBUA 3AHPA 1LWFA 5CCMA 1WDDA 2GO8A 4N77A 3C16A 2ZC4A 2XSJA 3BR9A 1QJHA 3DOKA 3KLFA 4MYUA 4DSLA 2QRRA 2W7PA 5IC4B 2GHPA 4L73A 1RT4A 3BKTA 2GAHC 4DPXA 1C0UA 2RDDA 4DSKA 3DM2A 3QRQA 3MECB 4URGA 4JUZA 4UW2A 4QR1A 3L4BC 3A12A 4H54A 5EN1A 4NCAA 4ZVRB 1TMMA 3PDNA 3SIPB 4E98A 2F1FA 3EM1A 1M90T 3C15A 4QIWD 1JLEB 3GB0A 4YDDB 1M1GA 1VQSA 2BE9B 2FQQB 2NSBA 3UDVA 2JVOA 1IKVA 3MM8A 4JI6F 4M5NA 4NLTA 1EP4B 2KDOA 5L8RC 1XJWB 2FVPA 5M2PA 1QTMA 5HO4A 1S6PB 3NOCA 3POTA 2YKQA 4F0KA 3R6GB 1VR6A 9ATCB 3MEDA 4X4PA 1ZA1B 3FBFA 3Q8QB 1NMEB 2OSRA 4CNYA 4ANEA 2CPYA 2OH2A 3D7SB 1W2IA 3BQ0A 4C8NA 1EETA 3CULA 4CNZA 1FXLA 2DNPA 1D9DA 5KG4A 4DR4J 2Q43A 3L09A 4YS2A 4RZRA 4F25A 4WZQA 1Z2ZA 2DGVA 2RH3A 4HI1A 1XNQJ 1NHKL 3WC2A 2KL8A 1K73T 5CABA 2VHGA 4LRAA 1TKTA 3EJMA 3R5JB 4K59A 2MQNA 1WI6A 4NLVA 2ZBQA 4LRBA 5J1NA 4K4YA 4DR7J 4DPUA 3GFYA 2N4CA 2G0CA 4Y2IA 1TL7A 3M8PA 3KJVB 2PSZA 4DHVA 3BSNA 4NX9A 4ED7A 1RUSA 4ZVQB 5E33A 3KOAA 6FD1A 1CEZA 3QO9B 2OTLS 1DZ5A 1KHVA 3NGSA 1MWYA 5D0EA 4DR3J 3WHIA 3T5JA 3MM6B 5KFFA 3TYTA 2LDYA 3OPKA 3QAUA 4OYWA 3P96A 3EDQB 3M2UA 4ZJLA 2XLKA 2VKZG 2VOPA 2DH9A 3GG0A 3RW7A 2KZZA 2VF3A 4PUOA 1Q86T 3UN2A 1YSJA 1GEHA 1NHVA 1M5KC 3FZBA 2GV1A 4X4SA 2KI2A 4DN0A 4C8KA 2M8HA 2LVWA 1IBKJ 4ZIWA 4RW6B 1XR7A 2V2ZA 2JH3A 4OIXA 3I55S 5KFIA 1V9OA 3I9V9 2O01C 1W26A 3PJWA 1CJKB 2HZAA 4QR2A 2CPZA 4NEZA 5E2QA 5D4PA 1B7YB 2L08A 1T9VA 4X4OA 1XERA 2DNGA 2KO1A 1H38A 4X4QA 3VAMA 4J9LA 3QJPA 4AXIA 2NXCA 3L9ZA 1QE1A 4FXVA 3AJ1A 3N4WA 1MW7A 1RYRA 5DZ6A 2BANB 2ASDA 4DR5J 4ECTA 4KPYA 4LFCJ 2M88A 4OHWA 1KQKA 2W25A 4AXJA 2VDHA 2B8QA 4BWJA 3UD4P 3LALA 3PEJA 5B7WA 4ES1A 4YR2A 1WF2A 4XDCA 1S76D 3VAIA 2BRLA 3KDOA 3GONA 4N47A 3M2VB 4PZVA 1RT2A 2F4FA 1RA6A 4IFYA 3MFIA 3H2VE 2MYFA 1EX8A 3AA9A 3LP1A 2W2NP 4Q8FA 5SZTA 3MMBB 4IYQA 1NDPA 3UVJA 2AYMA 4ZOSA 3OFEA 2MY7A 1WHYA 1OS5A 3M8WA 4DPTA 1BUXA 3RB3A 1T7PA 1B0TA 2JDJA 1ZZFA 4MIWA 2J0WA 1CJVA 4F4WA 3OW2R 3MCMA 4LSZB 5HROA 3J7Z5 1LFPA 2IVYA 3SQGB 4MMOA 5IT4A 2G2OA 3IWLA 4ICLB 1Q0NA 1UFKA 1BD6A 1IBLJ 4PQUB 2QLXA 3C14B 5J2MB 5BYRA 1RB0A 1RKJA 2O3DA 5A0YA 3FQLA 1N54B 1J5OB 3NGRA 1IKYB 4TU7A 1YJWS 3HT3A 5C24B 3O6QA 2M9KA 1UWBA 3ZTRA 2QYCA 3QGPA 1SPBP 3HHLA 1H74A 4ETZA 4RLEA 2AZ3A 2AJ4A 2DEJA 3PACA 1VLYA 1M1KT 2BM0A 1GFWB 1SXLA 2D41A 3J7YU 1QVGR 5EWEA 3HHNB 4ED1A 2E1AA 3T5HA 1HKAA 3ADAC 3CJSA 1U47A 4N5SA 2BQUA 4QWEA 5CYMA 5KT7A 2HNDB 5IM0A 3M9OB 1S1TA 5DG7A 5FLXU 3MPWA 2RQ4A 4ZCMA 2CPXA 2BYCA 2LU1A 4RW7A 3HFVA 2W1BA 3Q8RB 3A8JA 2WONA 2BJ3A 3SZ2A 3HO1A 3CMAS 4J9NA 4O44A 2DXFA 3CMES 4F4YA 1VBYA 3ILLA 2D1CA 2AEFA 5BXIA 3CCZA 1FWKA 2LQ5A 1RI7A 2DXEA 2W8LA 2QGFB 1KVIA 1FJCA 1Y00A 2OPPA 3WDOA 2OO4A 1FI4A 4B3TF 3MOJB 4B9TA 3P45B 2GGPB 3RBXA 4ANCA 4QPXA 1ZM9A 1FJGF 2D9OA 2LEPA 5A76A 2YXLA 4OHXA 4USJC 5IV3A 3UDLA 3DDIA 1UVIA 5LXRA 2N82B 4DSFA 3RB6A 3OLBA 4H4KC 2V67A 1DTQB 4KGXB 1OQ6A 2RS8A 3OTCA 4NE9C 3P4UB 2GMHA 2C2OB 1C4AA 2YQ1A 2AYBA 4NLGA 4K2XA 1RTIA 4FP9A 3FEYB 4ALZA 3CCES 1KEKA 2M52A 4AQYF 1JIHA 3QSIA 3Q8PB 2CQDA 4KGZB 4WBFA 1HNVA 3UCZP 1XNRF 1G6BA 1L3TA 4A8MP 1N4LA 3ILOA 1S4EA 5AE2A 4NXNF 2FZCB 1N6QB 3I4PA 2KG1A 4ENOA 2HWTA 3CD6S 5KOXA 4P2MA 3TEGA 1RTHB 3R27A 1VBKA 1UVKA 1D8YA 4RWXA 4UOFA 3J81j 1Y7PA 4OMFG 1RABB 1D1UA 3MECA 3FSIA 3MHYA 4TY9A 3IP0A 3FDSA 3Q8VA 3R6LB 3PFEA 3BEGB 3IM8A 1IBCB 1SC3B 4CTAB 4DQIA 3R1LA 4UOCA 4A8QA 5A8WB 1C1CB 5D3GA 4M5KA 2HNZA 4QQBA 3AA8A 1JLEA 3PX6A 4ZVTB 5GMDA 2F5GA 3R5BA 3T9NA 2LQBA 1XK8A 4K7QA 1EP4A 1LW2A 4OYOA 1C0TB 2N4DA 1FJ7A 3K5NA 1S6PA 3FVYA 1HQUB 3CC2S 4ZPWR 2HMIB 5BYQA 2YNGB 3E51A 3QGIA 4DR1F 3O2IA 1T8EA 3TR5A 5DLGA 4B3SF 3CEDA 2CPEA 5L1KA 1MU2B 3J7A1 1RWUA 4DFKA 3DI6B 1TMJA 4QZVB 3OR1B 3G6VA 1RQ0A 2VPXB 2DRAA 2RRNA 3OQ2A 1TFYA 2UVUA 5D78A 1PBAA 4PG6A 2HWHA 4USMA 2PDAA 4LF9J 3ZNUA 5IC6B 4TVAB 1KC8T 3GWCA 2HFUA 4PAAA 5L38A 1U49A 4XPCA 1EJ7L 2L48A 4IDKA 4JI2J 4Y28C 4X65F 2R4FA 1SL0A 3W2VB 3BREA 4XAKA 2WSEC 3TA1A 2EFOA 2E9TA 4F8RA 4NZ0A 4LR9A 4C11B 1KLNA 3KLVA 4WZMA 1MNEA 3FKBA 2E9ZA 4CI0B 3V6JA 1RWXB 1Y9OA 2X51A 3DLHA 2DGTA 2KRBA 1YGYA 2E5HA 1YRTA 2CQ4A 3T3FA 1FDAA 1FERA 1HNIA 1QD1A 5GAGU 1YHQS 1WHWA 4BHQA 2BJ7A 2NPIA 3CO9A 4Q45A 2FC8A 2LYVA 3FRYA 3E8OA 1FX2A 3WC0A 3OR2B 2CDQA 3KFWX 4UTGA 2FUG9 4CO3A 4Q5VA 2VBWA 1SB6A 3CDWA 4FKYA 1WC1A 4Z37A 2HBYB 3N01A 3FK4A 1WUUA 3D3BJ 2UUAJ 2CQ0A 3NY0A 4O0NA 4ZS6A 2X1GA 2DGSA 1WI8A 3IN5A 3NAHA 4RW6A 3N28A 2CPIA 1OYDA 1Q81T 3MDFA 1RWPB 4JBCA 3I0SB 2ZE2A 3MR3A 2HHTA 3ILIA 2Y8WA 2B3TB 2IPOB 4NL5A 5ETSA 4CM0A 1CJKA 2HRTA 1U6FA 3KHRA 3BDEA 2DNKA 3MM9B 4QYZK 1ULRA 1E6YB 1RT7B 5HMXA 2RF2B 1OJ4A 3KYLA 1NPKA 1DQAA 3FSXA 3KJQB 1FCAA 4K4TA 2FHMA 2IRYA 1JLCB 1HBMA 2ZITA 3W9HA 1RWKB 1A9NB 5F3TA 4OYMA 1HQEA 4PQAA 2EI5A 3UN3A 2HHHF 4DPOA 3CC4S 2BE2B 1N32F 1W25A 3TZXA 1SJ3P 3UR0A 4DLEA 2ZKTA 3TX8A 5FDLB 1TL4A 1X7VA 2GHWA 1AFJA 2VPYB 3Q86A 3X1LB 4A47A 4ILMA 3KDNA 2ZVSA 2QV6A 3NNAA 3DLGA 3GR0A 1YBTA 3M2VA 4NMXA 4QWDA 3BBBA 2CJAA 1R6YA 4P2FA 2HQDA 4ZHRB 1QDUB 4CM2A 5F9NA 1FTRA 4LT6A 1ZAVA 4EBCA 2JFDA 5LM7E 5KG6A 1HMVB 3MMBA 4OX9J 2FYXA 3FBEA 2HURA 2DR6A 2M0GB 2UP1A 2BJDA 2B7CB 3W65A 2V4JB 1J27A 1QSSA 4NXMF 2R7VA 4FF2A 2EK6A 2DISA 3MEGB 5E0OA 1KQGB 4IFVA 1PYSB 3LP0B 4PRFA 2ZNYA 4DV2J 3M8ZA 4WPAA 5M2RA 3SFGA 3W5ZA 3LWMA 3JQJA 2ZH2A 3SQGA 3M2RA 3F73A 4ICLA 2VIHA 5CYJA 2NQPA 2JOQA 3QPIA 3VALA 1P9QC 1GNKA 4PQUA 3CJQA 1XEZA 2GVZA 2A6OA 3C14A 3UI3A 1VK3A 3PX0A 4LSNB 5ETVA 1IKYA 3SV4A 3OUYB 1CQNA 5C2GA 4DS4A 4B3MJ 4Q0BB 1O6XA 4QIEA 1YWXA 1Y4ZB 4DDFA 4EU0A 4QCLA 2DBBA 2MGZA 1TAQA 1WC0A 3ZZRA 2OAUA 2RMLA 2GVDA 2RU9A 3TZYA 1HBOB 4IQXA 2OSQA 3QLHB 5CAAA 1JWWA 1UWAA 4Q2LA 1XIQA 1U1NA 1MWZA 1URRA 5FIIA 4IO1A 4YHHF 2KXNB 4JI5J 4Q7AA 1AZSA 2OD6A 2O5DA 2DNZA 2BKPA 2AZ1A 4NASA 4QIVA 1I94F 2PEHA 1JLFB 4J37A 3DYAB 2EG1A 5EHHA 2YWFA 3IG1B 1X9WA 5D8HB 2HIQA 2ZEJA 3DLBA 3GCWP 1Y5NB 2FGCA 2AT1B 2HGNA 2EKYA 4R8UA 2CQPA 1NM2A 5C25A 2WBMA 2YNHB 1K44A 3LAKA 2ZJPQ 2QZ8A 1SC1B 2J6TA 2A0FB 3AXMA 1Q4RA 1U2RA 1CULA 2DNLA 3OHBA 2Z30B 2XY6A 3CD5A 3FJ2A 2FHKA 4LF4F 4QW9A 2F8HA 1NSQA 4X4NA 4DL6A 1SL1A 2OMOA 1M5HA 1HHQA 4FYYB 1JJHA 2V8PA 5L1LA 5GAHU 5GADU 3VR1A 4QIFA 3UCUP 5C7PA 1DTQA 5CHCB 1NJXA 2VBZA 1AA1B 3DGVA 5D0GA 5E3QA 3CJKB 2VPWB 1CQMA 1SL2A 1M5SA 4F50A 2ZBRA 2LXIA 4C2MA 3CCSS 3MAQA 1T9YA 2J5AA 2L41A 2I38A 2R7OA 4NZ7A 4B9UA 1NKEA 5HATA 4DPYA 4V19J 1VBZA 3TEHB 2XCPA 2QC3A 3GTYX 4NCBA 2MHNA 3BGRA 3JSMA 3CJ8A 4J90A 3GP9A 4KT0C 3A1YG 3CCWA 3VQSA 1WDTA 5ETMA 1RTHA 4A4JA 5J2NB 2UU9F 5KG0A 2QEXS 3EWGA 2NXUA 2CVIA 3PYDA 1TELA 1S10A 2ZBPA 3MAHA 4A48A 3U1NA 3NCPA 3QIPB 2JRSA 2HVDA 2ZOGA 4B3RF 1XMQJ 2CZ4A 2XBPA 1DY3A 2MKIA 1TKDA 4S0MA 4F02A 3EZUA 3OTOF 1H2VZ 1C0TA 4MYTA 3NS7B 2YNIB 2B9YA 3SYZA 3RBEA 4PYDA 3HSDA 2CPFA 2IFXA 1OSDA 4U7UD 1RJJA 5KFXA 1HPZA 3HPOA 5AE1A 2UUBF 1JLGA 2P9EA 1CJUB 3NL0A 1R8AA 3MMAA 3GJTB 1B7FA 3OSNA 5K8OA 4AL6A 4CLUA 1ZA2B 1Q7LB 5D4NA 3GV5B 5I42A 1F5BA 1HYSB 2FC9A 3TI0A 5DO2A 3TA0A 3QSYB 2BA9A 2PMHA 2V69A 1AFIA 3OTEA 5DQHA 3MR5A 1Q8BA 3HKWA 4YB1P 2BRKA 4RO0A 4I56A 4QIGA 2ZFHA 3W8GA 3W2VA 1RHQB 3TOQA 5IQ6A 1S6QB 5CYQA 1H0HB 3ZZTA 4ED6A 4Y3CA 4QBUA 4L75A 4PWUA 4YDXA 2P5VA 4M1KA 4DV4J 2IDLA 2R7TA 3QAEA 2W2OP 3EICA 3CJ0A 3G82B 4C8YA 2ZDPA 4F0HA 3PYFA 1KD1T 1LOUA 1JMTA 1Y5IB 4N56A 4P7VA 8RUCA 1O0PA 2R8IA 3AB4B 2A1BA 5E3RA 2DGOA 1VC6A 1N34J 5E41A 2FGOA 4M5LA 3PRBA 5BYSA 4WFYA 3FEZA 1HNXF 4PWWA 3MM7B 1DLOA 2GMJA 5FJ4A 2AGQA 1RZMA 1S79A 3P5BP 2DNMA 2VQFJ 1VCTA 3N9UC 4M95A 3FSYA 2HRUA 3G6YA 1D8ZA 3PRDA 3JQKA 1D0EA 1U09A 5L9XA 2MKJA 1YJ7A 3BZQA 1RTZA 5HJXA 2HZVA 1RTDB 4DUZJ 2J9EA 1RT7A 1L3UA 1KLMA 3PO5A 1C2PA 2RF2A 3DGPB 2IDEA 4FF1A 2CYYA 4FYVB 4BLGA 2G1HA 1HNZF 3PV8A 2L9DA 1HA1A 1AW0A 4LRCA 2J9CA 4A8OA 4DU7A 2KXHA 5JVHQ 1YJ9S 3BQ1A 2I5JA 1XMOJ 4MKAA 1SQGA 3PM9A 1LXJA 3NNCA 4RNNA 2FTRA 4KHPF 3D1HA 4IG0B 4DQSA 2CADA 2ZNZA 1D9FA 5J1EB 2XZTB 2HFZA 3MMCA 4DCJB 3R5AA 4ED4A 3MAAA 2Z2ZA 4JI3J 4USVA 3GJQB 1HI1A 4Z7CA 3ET6A 1S0OA 4KHRA 4DL2A 2IAJB 2WVFA 3NOGA 1S0VA 2YQ3A 2V4JA 4QYZJ 3VGSA 2DR9A 2CQCA 2E5JA 4Y34A 1U26A 4ECRA 4DZDA 5L1IA 1WACA 4J9QA 3S7RA 4LUBA 2AJQA 1VQ8S 1IBMF 3T19A 2BKNA 2DEIA 3FC9A 3FZ2A 1N5TA 4H4OB 4CRJA 4I1TA 2W24A 1WKKA 2KKHA 1SUQB 4B9MA 3EX7B 3D3CJ 2XMJA 5EDWA 2CQIA 1EARA 2XB2D 4EWTA 2ZZTA 1PAEX 3ISZA 4NLRA 2ACMA 1NJZA 2HLTA 1R3NA 2QL5B 4EYHB 3QFWA 5FLXY 3CW2C 3OUYA 2GJFA 3SV3A 3MR2A 4JI0J 1A6LA 2Z57B 3MMJA 2JL9A 1VLOA 2V8GA 4I4BA 4KFBB 1U1OA 2FD2A 3SSQA 4F67A 5JVGQ 4ZA1A 4MTPA 4RW4B 5IT9U 4LR8A 3FMWA 2WHOA 3U1LA 2VV5A 1BWEA 2WB4A 4DX8H 1FT8A 4ZK7M 4Y2KA 4L76A 2IVFB 1OPIA 5B0DA 3UCGA 4LF6J 2KFYA 4LSLB 2AMCB 3C8YA 4DS5A 9RUBA 4GKKJ 3CD0A 3K8VA 4FNIA 1Q95G 4CYUA 3C6TB 4IQMA 3V4IB 1H98A 3OV7A 3KWMA 1WOSA 4IO9Q 1LKZA 3PW0A 1HWIA 3BSAA 2FVCA 3HHLD 1ZM4A 3MD1A 5AJ3F 4HLBA 3RAQA 3D68A 2W9BB 4PKDB 2C2MB 2XLIA 3X3UA 1Q5VA 4C8ZA 1HWLA 2E66A 2VFVA 2DNOA 3BR8A 2XYGB 2MZ1A 2FVSA 3ETMA 1BQMA 2CJQA 1IM6A 4J9VA 4OL8A 3GSIA 1U0SA 4OI0A 4DG1A 4IUFA 1OY6A 3CD7A 1S72S 3NMAA 2YKNB 3PXGa 3WIUA 5GAEU 1YBAA 2XY7A 4IR9A 3W5XA 4OZ5A 2XY5A 1KP6A 2JX2A 1PJ7A 2D3ZA 2R9LA 2FLOA 2JLEA 2YKMA 2AEJA 2IYIA 1OY8A 3IA0A 4NZ6A 2ROEA 1RE1B 2R7WA 3UR3C 4EUVA 3O3LA 2LECA 1JJ2R 4FXDA 1HI8A 1DTTA 1SV5A 2DGQA 4ITSA 1FRIA 4LFBJ 1F2GA 3MR6A 4W98A 5LSOA 3D1QA 4FF3A 2F9JA 1MN9A 1A7GE 2E1PA 1R7IA 4M5DB 4IOAQ 3DMJB 4OI3A 3LQVA 5T14A 1Y0HA 1O5JA 4ZDNA 2DPIA 1P27B 3Q24A 2CQ3A 1TK8A 3D2WA 3PYGA 2PN6A 4U96A 3UFCX 3DKDA 2HKEA 4UUWA 3EE3A 2W9CB 4LJMA 2RVJA 5F8HA 4WP9A 3OFFA 2V5HG 4N41A 3K5LA 2M4MA 3FRZA 4WTYA 1MSWD 3TVKA 1WEYA 4OZLA 3CSKA 5A6WA 1QAIA 3QIPA 5I4MA 2IM1A 5HBMA 2HBZB 2M70A 4ID5B 3H2UB 5KFYA 1NSKL 2XMTA 4C4WA 3HULA 2YNIA 4HI2A 2HSEB 4ZVFA 4M63A 3JTOA 3RBZA 2ATLA 1S7IA 1T0TV 2ZH8A 3RAMA 3OHAA 2C2EA 2GZOA 1YZ7A 2OPQB 1ZAWA 2NPFA 3HKZD 2G0JA 1UMJA 3QRPA 3AT1B 1XTZA 3TO8A 3UD5A 1IJFB 4C9DA 2AD9A 4ECUA 2E1CA 5DLFA 3WX8A 2IIHA 1WEXA 2XO6A 2VH7A 2RHSB 4RW8B 4O3QA 3KLHB 1OPZA 2UVRA 3PRVA 3AOCA 4I0WA 1EKSA 1ZH5A 2CNOB 2EBEA 4HYKA 3DU5A 2JWNA 2Q3PA 3OVBA 4ECYA 1PYTA 3E01B 2ZM6F 2RD5C 2OHDA 3PNIA 2XQCA 1FFSB 3D6HB 3HD1A 4KO0B 2DKOB 1IXKA 1YJRA 3LA0A 2CG4A 3HFKA 1GMVA 3R5CA 1WHVA 1RT3B 3QT7A 2DNRA 2K2PA 1TQLA 2B5JA 1MLAA 5D15A 3LPYA 1BGXT 2LEAA 3H4BA 5KFNA 3N5FA 4M5MA 1U8WA 3M6UA 4DFMA 2F4VJ 2WB1D 4NI2A 4OQJA 5HQMA 2XSJB 2XMUA 1D09B 3DOKB 3KLFB 3JB9k 5HN0A 3KJNB 2V2QA 4KC5A 1RT4B 2H4YB 4MH8A 4A8KA 1C0UB 3WIVA 4WFZA 3PHEA 5DRKA 3DM2B 4Y65A 3M6VA 3RRHA 1BXNA 1R0AA 2AKWB 2IRXA 1NNDA 2FJDB 4ATNA 3CJ2A 5KFVA 1YKWA 1ACMB 4A8SA 1TAUA 1XNQF 4RNOA 1YX2A 1FEHA 3ETOA 4NA1A 5C2CA 1NXIA 3DLEA 4DSEA 2H5IB 3C15B 4U6PA 4NLDA 2MB0B 3MM8B 4DX7A 2IA6A 1P6TA 1VIOA 2H5JB 2FJAB 2DRDA 2WTFA 4DR7F 4QWAA 3CJ5A 3QGHA 5L1JA 3AODA 4JI8F 2ZD1A 2W2PP 3POTB 1FNOA 2AX1A 6AT1B 1NUEA 4X64F 5AXLA 2QO3A 2XLJA 3J81U 2GS8A 1JK9B 1ELOA 4GRSA 3MCSA 2YNFA 2APOA 4DL3A 4O4GA 4PCQA 4USWA 2AYGA 1F1BB 3A4TA 4GO5X 3IWNC 5B09A 4V1Ak 2NSCA 3GFHA 5KTQA 2MLXA 1I6JA 3H42A 4ZCIA 5J1EA 1BC6A 3EXCX 1PGZA 1H7XA 1K0VA 2CWXA 5HMWA 3A8EA 3HXMA 4OI2A 2CJYB 3P49B 3VV2B 1KS2A 2HS4A 3MWBA 1UZHA 1FKOA 1TKTB 4QJVA 4IKAA 1S1VA 3IC1A 2W01A 3TANA 2ZBCA 5KFPA 4DUYJ 2Y1JA 2D69A 1TL7B 3M8PB 1T05B 1GX6A 1X4FA 2X1FA 5MAOA 3BN7A 3EGVA 4H4OA 3ZZPA 2MMYA 2PIIA 1TL5A 2NS1B 3R97A 5ETQA 5HVGA 2RHQB 3M32B 4I2PB 3MR7A 2PC6A 4X62J 5G0RA 1N5YA 1VRTA 1WTFA 3M2UB 5DQIA 2C22A 3VHQA 1Q1KA 3ENQA 2J9DA 1G4CA 2KT5A 4PUOB 4LFCF 2FY8A 4FYXB 1X4CA 4OHZA 4C0HA 1KBRA 3AFGA 5ETNA 2EFQA 3F56A 3R8YA 4HHHA 3NS6A 4KV8A 1TUGB 2MZTA 3QATA 1LWEB 3ENWA 3Q2SC 2ACYA 2V4RA 4ZLLA 1ZM3A 3ISNC 4X4UA 2LP4A 1KVJA 4IH5A 5KFMA 1U1MA 3VAHA 3TVZA 1VRUA 4GO7X 5HMYA 2ZH6A 4CLWA 4C8OA 2MHEA 3HDSA 2R2SA 3KNGA 2HWIA 2A3JA 3CIMA 4JV5F 2HW3A 4N7TA 4YB6A 3PR4A 2GO9A 4K4VA 2MTLA 4AQYJ 3DCAA 2W9BA 5IFMA 4IOCQ 3IRXA 4DV7J 2ZKUA 2LFVA 2AHOB 1IBLF 1XNRJ 4PXCA 4O3PA 4QR0A 4I2QA 4RL1A 4TKTA 3JSYA 4KHMA 2B9XA 1UW4A 1RDRA 1X5PA 2ZH7A 2G1DA 4QU7A 5ITHA 3K57A 4JI1J 2KFNA 1UJ5A 2YKNA 3I5BA 5HLFA 4IFYB 5DDRC 4DEZA 4IH6A 2FB0A 3TUZC 3LP1B 2V50A 3JAMU 2HAIA 2CA9A 3UVJB 3AAWB 3EMTA 2X1AA 1SBRA 4QW8A 3TA2A 2HLUA 4DCOB 2AYEA 4RW9B 1Q78A 2QTWA 1HD1A 3VWSA 1KNZA 2Q6CA 2ALYB 3EVMA 5KFOA 5HQ8A 1FDDA 1RAOA 3GMGA 1T03B 1CJVB 4M5HA 4ZVGA 1ROFA 4K4ZA 5HROB 1LNQA 4YUDA 5HK4A 3Q0AA 4DR1J 4K50A 1DBDA 3KMSA 1UJ6A 1UZDA 1KOHA 3LGMA 2UXCF 3WBZA 1YRUA 3SQOP 2V63A 1QLNA 4KTQA 1FA0A 2NLWA 1HL6A 1RCOB 4ELUA 2ZOFA 2CKWA 4BWMA 4ECQA 4NCGA 3W63A 5A0YB 5KFHA 2JC1A 4CLLA 4R5PA 3GFZA 1VHIA 1UWBB 2FVRA 3HHLB 2J7KA 2BOPA 1B70B 3LW5C 3KG4A 4NRTA 1GK8A 1DARA 1RWMB 3D66A 4KH0B 2H48B 1SIZA 2HBQB 4X65J 2OTJS 5A2QU 2MY8A 2UVWA 1TV6A 2R7RA 4MJKA 2VBXA 4KE5A 2ILYA 3HD2A 5IV4A 4CO5A 5CYMB 4L3NA 4MFBB 4CLTA 5IM0B 1UW9A 1S1TB 4ZP7A 1KR4A 4EFAC 3TUJC 1YJTA 3KKFA 3NXZA 1K47A 4UUXA 4M5GA 4P52A 2YQ0A 5C42A 3NCRA 4RW7B 3ISND 2WONB 3R5DA 4IH7A 4O44B 1TKXB 4OZ3A 3D6FB 2R7QA 4C97A 1NK7A 2O66A 1P1TA 3CCRS 3BYPA 4JYAJ 2OPPB 2RQCA 4GMKA 2GQCA 1FTCA 1HW9A 1N48A 2GHVC 5J1PA 4DX5A 4DFJA 1PBUA 3HK2A 2VJUA 2AGOA 2PT0A 4HH1A 1IQTA 3VCDA 2AP6A 2POKA 2V8VA 1HQ2A 3GJRB 1UP1A 3SFUA 1KKHA 4B3OA 1J5EF 1DURA 2QG9B 2GIQA 5B0GA 4CT9A 3OTBA 1YIJS 1K0TA 2RRBA 1NK4A 1RTIB 1S4FA 3HHEA 1H73A 2WRMA 4C3LA 2IBOA 2Y1IA 1FRHA 4LIWA 2OGUA 3Q83A 1MN7A 2LQJA 4IRDA 1QTNB 4ZP8A 2VKRA 4HDGA 2J0XA 2FHJA 2YX7A 1HNVB 4DV6J 3L7OA 4FS2A 2LA6A 4UZBA 3DXBA 2ATCB 1S1UA 1PILA 2RRAA 1MWQA 1N32J 1GQEA 4N76A 2O67A 2XI2A 1M5OC 3BBFA 5L9NA 1IQZA 3RZAA 1R0CB 2N3OA 2QMUB 1F9FA 2BJEA 2AEMA 2FLPA 2EC2A 1U8SA 2VZ9A 2ZHAA 4J9OA 1S12A 1NDCA 3T9ZA 1FRLA 3RAXA 1JB0C 3H8YA 3SDEA 5KFSA 4JI2F 2KHCA 1F2HA 4TYBA 4QWCA 4F7VA 5D3GB 3EDRB 1GX5A 3J7AN 2HNZB 4R0EA 5B0EA 2ZH4A 2BDPA 4WU2A 3H5XA 5GVQA 2QLBB 4G1QA 3OL6A 1LW2B 1YJNS 3D4JA 2B4UA 5KG1A 2DNNA 1S1XA 4C0BA 4LFAF 3BO4A 2A6MA 3LPEA 3VGUA 5DQGA 1WORA 1QVFR 1CC7A 1WG4A 2RKIA 3SCLE 1TUVA 3LWLA 2BEFA 3L7UA 1ZETA 4F3QA 4PWDA 5D4LA 3K0JA 2AV5A 4RNMA 2KB2A 5ADZA 5KFGA 4OJGA 4E0DA 2JJ4D 5F3ZA 1G2EA 4DBQA 2HFNA 2HRYA 3T1HF 3TUPA 3BPDA 4IDKB 2AIRB 4FBTA 1FNXH 2VOOA 3G6XA 2X3DA 1OMSA 2K1RA 3J80U 2OIHA 1NEEA 5I3PA 3KMQA 3I82A 3K5PA 1HD0A 1REGX 3KK2B 1T05A 4LQ3A 1JX4A 4I64A 3QGGA 2KM8B 3DU6A 2YWEA 3K8WA 2P9GA 4DFPA 5IT9Y 4FS1A 2XZWA 3GYGA 2LA4A 3I32A 1HNIB 1F9EB 3M32A 4I2PA 3V4MA 4P71A 5B0BA 1FE4A 3SCJE 1RWNB 3D54A 3DRXA 1I94J 1M0SA 4Q8EA 1X4HA 1U1RA 3DRPA 1HBUA 2MPUA 3TRGA 5JJBA 4OV1A 4IRKA 1CSJA 2JEGA 2FIUA 3R7NB 1WWHA 3NEKA 3IM9A 3M8SA 2AJFE 1GTEA 4JV2A 1BHNA 4TXSA 2B43A 5IQQA 2ZE2B 1LWEA 1LEOA 3IR7B 5JMNA 3S01A 3DLKA 2IBKA 4LF4J 2YBVA 4OX9F 4K5RA 4MKVA 5D0RA 1RBLA 1PKUA 5E7OB 2XSFA 2AGPA 2WSFC 4L72B 2J9DE 4UQTA 1CJTA 3DLLQ 4ED0A 4ZP9A 5IOLA 1S49A 1T94A 3CIZA 5J2QA 4DSJA 2MQMA 3TAPA 2NXEA 1WNEA 3IFEA 1HBMB 2DO0A 1T3NA 1QY7A 4DV2F 2L3MA 3F41A 3T1YF 1HQEB 3M05A 2Z2YB 4PEOA 2P6TA 5KG2A 3BS9A 3TJAA 2ZDOA 2VQEF 3HVWA 3H5UA 1T9XA 3AY0A 1K1SA 3H5YA 3FQKA 3KHGA 5KFZA 1X0PA 3GR1A 3DLGB 1SC4B 4ZN1A 2BQRA 1UEVA 2RS2A 3ITHA 4I6WA 4NLYA 1B4SA 3BSOA 3JSRA 4K4SA 3IO1A 3U1MA 2DXDA 4HKQA 1I1GA 1N8RT 1U0HA 3MPDA 4LRFA 4RW9A 4DLGA 1U48A 1SJQA 3IMQJ 4B3RJ 4IFVB 1WC3A 3JTPA 2QFJA 1T03A 5A8RA 2UUTA 1LWCA 5DG9A 4CH1A 1S5ZA 4IG3A 2V8DA 1QUVA 2DCUB 3EZOA 4EO8A 3M2RB 1X4AA 3HVTA 3QT6A 3Q23A 2NYIA 2W2QP 3RB4A 2OI2A 2M3DA 2KRRA 4RUCA 2MKSA 5CA5A 8ATCB 2M8DB 2J0QD 2HVIA 2GVZB 2NCKL 3HT0A 4HACA 1WKJA 3V6DA 3KLIB 1RSCA 1WF1A 4OI6A 3DRRA 3Q8SB 3G8QA 2DHHA 1FD8A 5A8KA 4DL4A 4WP8A 2ADCA 4DOZA 2HHQA 2FLNA 2ROGA 1UJ4A 1UPPA 1WD6A 2MGZB 1RT5A 3BQ2A 4HHJA 4P72A 2IJFA 2GVDB 3BM7A 4F4XA 3CDUA 1NAQA 1U6BA 3AB2B 2XO7A 4KRWA 3C46A 4DPWA 1R8CA 1RU1A 5KFKA 4HHUA 3DFEA 1J2VA 2DPJA 5BR8J 4MFBA 3HFZB 3AOAA 1TL3A 1S9EA 3L95X 3MURP 1EHWA 1AZSB 3FEXB 3NNHA 4FF4A 4ED5A 1VFJA 5DZ7A 4PPDA 2AJ0A 2WVBA 4B9VA 3CJ3A 1S59A 4XTTA 1S1WA 5CCLA 3M30B 4KPCA 2W8KA 4D3HA 1TKXA 2AJ1A 2PO4A 4R8UB 4ZN3A 3D9BA 3W9JA 4NYOA 4GVBA 5C25B 2DY9A 4ZMMA 2YKAA 3VAJA 4K0KJ 3BPSP 2U2FA 1FD2A 1HNXJ 2XTJP 3U02A 5KFCA 4J9RA 2XYPB 5H9FJ 4ED2A 1CULB 3TARA 1HFEL 5M2UA 4DV5F 2IHR1 3HSJA 2OEKA 4MT1A 5DDPC 4P6QA 2RNEA 5JUMA 2KVIA 2P6SA 3PHTA 4DZ6A 3R7BB 5HQLA 4CLYA 1XR5A 3UPFA 1UVNA 2HPUA 4H4KA 3W9IA 3C6UA 2VL1A 1XMQF 1FJEB 2VUGA 1FDNA 3JS9A 2OPRB 3TUIC 1VQOS 4P73A 2PMWA 5JXSA 4ID8A 3OT9A 4PXBA 1NK9A 4RNHA 1VI7A 1UA0A 2UXBF 2J0SD 1HBNA 4CWBA 4Z2XA 1VC5A 2V4QA 3BGRB 3JSMB 3RRKA 3EVWA 5BJRA 4GKJJ 1JKHA 4ZPTR 1RAIB 4Q44A 3HJVA 3W1YC 4USHA 2KTQA 4KHPJ 3D0GE 3GIIA 3J81Y 2K7JA 2HGLA 1CC8A 1EAYC 3UWTA 2M5YA 3A8IA 2EVZA 4Y2CA 4B08A 4NLSA 2QE5A 2DNQA 4P74A 4QWBA 2QLJB 4CZCA 2OJ3A 3PKMA 1UFWA 3ZZOA 3AOBA 1JNRB 1VQYA 1QSYA 2FJEB 2ZZNA 3HVRA 3F44A 3MCNA 3KLGA 1KWMA 1NPRA 3I31A 4ZLJA 1Q16B 3MEKA 1RLDA 4DF4A 4DV4F 5AXKA 4OI4A 3LUYA 4DR2F 3ZZZA 4KSEB 4ZVOB 3CF5Q 4NPOA 1S77D 3RB0A 3EZ5A 2QLWA 4H4MA 1IBMJ 1HPZB 3RYLA 3KK1A 1JLGB 1PG5B 3OD2A 3MMAB 2WAQD 5KFAA 2ZH3A 2CQ1A 1FEEA 4TNOA 1Z1ZA 1FK9A 5I42B 5I3UA 1H72C 1RAAB 2GA7A 3OBIA 3QNWB 4PABA 4K8RA 3H20A 2R8HA 1GTHA 2MEWA 4OJHA 2QIFA 2ZBIA 2B7BB 2VQFF 1YG0A 4HDHA 4OHVA 2NYHA 2UV8A 2HQCA 2E5GA 3M7VA 2EBGA 5CYQB 3Q22A 2GC8A 1FHTA 3NGUA 1T11A 4JI4J 2J7UA 4ER8A 2LXUA 4NYPA 3KK2A 3QMQA 2CQGA 4RPFA 2CZ9A 1WOPA 2XMAA 5HP1B 4DQQA 2KG0A 2LDIA 2DNHA 5EWFA 3TX0A 2Y1LB 4DI6A 3AJDA 2Q6BA 1WSVA 3TZWA 2JEIA 2GCFA 2VG6A 4ANDA 1AUDA 3PYEA 5IXUA 1JLAB 1NCLA 1XMOF 1YDLA 4LF7J 2YH1A 1DLOB 4RJVA 3CB4A 2ASLA 3EGWB 3UW1A 3Q2TC 3K5OA 1F9HA 3FNNA 3QZ8A 2E5LJ 1TKZA 3MPUB 3N6NA 3R1HA 3Q8YA 2BUNA 2CAJA 5KAKA 2H65B 4NLWA 1S0MA 2QYGA 4DV3J 3KXDA 1RTJA 3MTKA 4C8MA 1U4BA 1XQIA 1BQNA 3U7JA 5B08A 1KLMB 2V2VA 3NAIA 3T6BA 1SI9A 4O0IA 1U1QA 4NA2A 2W4CA 5GAHI 2GNKA 4FKXA 3LAMA 3JAMY 2H3EB 1N0VC 4J9PA 4OYBA 3B8HA 4LF8F 1X4DA 1FX4A 3IWXA 4DV0J 1GMUA 3LTOA 3T41A 2I5JB 3P6YC 4ZKAA 5T7LA 3EYZA 4KY3A 1DQ8A 4LIRA 2MZJA 2GW8A 5ETOA 2ZOMA 5KFDA 2RIJA 4BDPA 3FCWA 3V5RA 4CH0S 4ECSA 1R43A 3V6HA 1NDLA 1EIYB 3HVAA 2ZH5A 3MMCB 3GIKA 2KVQE 1T9WA 2YPZA 3D6MB 4EI2A 2B9WA 3MAAB 1GMWA 3ET6B 4WYLA 2DH7A 5J2PA 4ZLNA 2D3O1 2XWYA 3RTVA 4U67Q 4C6AA 3M4XA 2JSXA 3T1AA 3PW5A 2DGUA 1MROA 3CUNA 1N33F 3ILJA 2HHUA 1UEKA 4CO4A 4WTOB 4KGMA 4FN5A 2XMMA 3OVSA 1F0XA 2H5EA 4OZ2A 3HM9A 4C8LA 2VA3A 2OFGX 2C28A 1JJ4A 4GKKF 2LQ8A 3Q8UA 4MIAA 3SBMA 3NP5A 5A2QY 1S9FA 2RB7A 4DV1J 2DY1A 1FRJA 3KUEA 4U8YA 2E9RX 1NB2A 2XNRA 2H51B 1U1KA 1N88A 4JP8A 4JOUA 1KTQA 3CO0P 4RNFA 2V0NA 3VQTA 3KLIA 2XMKA 2VFUA 2ZH1A 1PYOB 1VK8A 2IRUA 2K06A 3P5TL 1SKRA 1B0PA 3G8TA 2YTCA 2PEBA 3BKUA 3GU0A 1JLQA 2H1YA 3ZTPA 3NCQA 4Q43A 1RHUB 3NWRA 3PTWA 2PFFB 4HH0A 2FDNA 1IKXA 2ZM6J 3OSPA 1VQ9S 3ZNJ1 4GVLA 3BGFA 1DAXA 1X31C 3NLCA 4CYUB 3DXSX 2MDAA 4UOHA 2HK2A 1H2UX 1T02A 2GAGC 2W2MP 4J7CA 2ZJQQ 4LFBF 5DDOC 2ADBA 4TY8A 2XS5A 3M30A 2UUCJ 2CPJA 1BWVA 1RBAA 3NMRA 2U1AA 4ED8A 1X0FA 1BQMB 2N7CA 2HHXA 4NLPA 1FVQA 5AXMA 1FKPA 1V3SA 3KK3B 4DG1B 1QUPA 4BCAA 4WJBA 3V81A 4URQU 3BN4A 1LW0A 1YI2S 3PY8A 4F2RA 3PVXA 2FJVA 4C48A 3M8QA 1Q8LA 1NU4A 4IR1A 4W4MA 1HWUA 4USUA 1MMNA 3BH7B 4TQRA 2YKMB 3NWGA 1S9GA 2MSSA 2QA1A 1SC6A 3CTRA 5KFJA 2DHGA 3MI7X 3W5YA 4TLQA 1NH7A 3KG1A 2OPRA 3GILA 7AT1B 1TK5A 1DTTB 1SV5B 2DRBA 4I7FA 2R42A 2UXDJ 4OYIA 2C42A 3MGJA 1KDNA 2K3KA 3DRSA 2B4OA 4JI8J 2R7XA 2ABYA 1YITS 2RE1A 2CIMA 4DUTA 4X64J 1EQ0A 3QJJA 4U7UK 3HP6A 3KHLA 3CJTA 2CJXB 1KSPA 1VQNS 2WVDA 3B78A 3W2WA 4JV0A 1KTVA 1R27B 4B9NA 2B6AB 3PO4A 1VISA 1A0OB 3B4DA 1NJYA 1SKWA 3EVOA 2R3VA 2Q66A 4O23A 4TQSA 1UEUA 4ZIVA 2MQPA 4X2BA 2VG5A 3G6ES 1ZYQA 2DNYA 1VDHA 3A3OB 3RJMB 5CD4H 1VYAA 4EEYA 5DM7Q 4OZNA 1CS4A 1V5IB 4BC9A 5HBMB 1R0BG 3D0IE 3HCXA 3O44A 2FHJD 3MFHA 2JNJA 3VVTA 3TVYA 4ZPDA 1NPPA 2CPDA 2RU3A 3KLEA 3KTQA 1ITPA 3THPA 3IAM9 2M7SA 4TLRA 2BMBA 4DX6A 4WXWA 1HNWF 2B51A 3J80Y 1K8AT 1M5PC 3NBPB 3I6PA 4FNHA 4O3OA 2AU0A 3W3SA 3QJLA 3DLJA 3I4HX 5DM6Q 3NGKA 2OPSA 5F8MA 2PD1A 3TP2A 4UT4A 4C7QA 4DSIA 2OLWA 1HR0F 2VODA 2VC1A 4UQGA 2F4VF 3E3XA 1CLFA 1JQGA 2JVRA 3TQEA 4KKOB 2DR8A 2V9KA 1WC5A 5LMNF 2QN6B 1WKLA 4ERDA 2HZCA 3JYTA 3PZPA 3HMJG 3C2PA 1PJ6A 2QSFA 1U2FA 4C0OC 1G7CB 4FPIA 2B9EA 4F4AA 4WXOA 7FDRA 4K5SA 5IWAJ 4LMZA 3I0RB 3MEEA 2AW0A 4F2SA 4NRUA 2AF6A 5LSLA 2MKYA 3M9NB 5HANA 3W7BA 3UNYA 3AQPA 4CLFA 2VICA 4WK1A 4FYWB 5HP1A 1F5CA 1TVRA 2B5JB 3CMQA 2MJNA 3DN9A 3GCXP 2HIYA 2YPYA 4X4RA 1NK8A 4JV5J 1JLAA 2X3GA 4ILRA 4NI2B 3G71S 2ZH9A 1VIXA 2YKOA 2I8EA 4F0MA 1SJ4P 3L7PA 3BO2A 1RADB 3IR6B 4L74A 1QM9A 2KN4A 1GXTA 3SCKE 5LSRA 3GPAA 1R0AB 2GIFA 4KIAA 3CCLS 2HNYA 4DU8A 2EFPA 4ZJOA 2K3IA 3HHLC 1ZPVA 2R7UA 3K58A 1NO8A 4ZITA 2DGWA 3W60A 1R8PA 2PA8D 3DLEB 1S48A 1R31A 3IBCB 3PW4A 3OFGA 4MKYA 1GXLA 2HYIB 5GAEI 3G86A 2VPZB 2XCAA 4KB7A 1SJFA 4DUYF 1KVKA 3R7SB 2ZD1B 2J8SA 2IM3A 1QAXA 4ED3A 4O3SA 2VBYA 3K5MA 2C2KB 1I51B 2CVEA 2YNFB 1WEZA 5DETA 4O4GB 3GIJA 4N8OA 4YFUA 4X62F 1NK0A 1TL1A 3M9MB 2GIRA 4LBHA 5KG5A 2UXCJ 5CD4A 4TN2A 2KJWA 4OLPA 2VU5A 4CLZA 2ZUGA 2X1BA 1RT1B 1HI0P 4JI7J 5KT5A 1KFDA 1VBXA 2HVZA 3V2UC 4Y2MA 1V3RA 4EK2A 2EPIA 5LMUF 4LF5F 5F8GA 1FKOB 4YY3J 1S1VB 2P9CA 3HF5A 5K8MA 1AT1B 4PXDA 3TJ8A 3EGNA 1WG1A 2PE8A 2HHPA 3I96A 2LU2A 2P8IA 3SMZA 5HVHA 1FXDA 2ALZA 1N36J 1C1BB 4FVCA 4DR6J 3ENAA 1LV5A 2QX0A 2JZ5A 4X66J 1PC4A 2HQIA 2RAQA 1MG7A 5G0RB 1FXRA 2KT3A 1N5YB 1VRTB 3PFOA 1R89A 2D74B 3JTNA 5AT1B 3EXYA 2E44A 1LK7A 4CO1A 4QU6A 4DV7F 3KUHA 3RR7A 2GJ2A 1XBWA 2G4BA 1VQ4S 5F0UA 2GMLA 3BKFA 4DL0C 1HHSA 2CJ9A 2BXJA 1IWAA 2C3OA 1X9SA 2RQKA 4JI1F 1FRKA 2XZDB 4KV8B 1Y3KA 3T6JA 3KG0A 2DJWA 4ZPVR 2N3LA 5EGYA 3HHKA 1WSRA 3ZTSA 2BW2A 2COLA 4C3MA 1TZ0A 2W9AA 2EC0A 2I9SA 1LQ9A 2LLZA 2ZHOA 1VRUB 1YQHA 4U95A 1J5EJ 5MLCV 4L3KA 3CWJA 2DO4A 2ZJRQ 3VZHA 4GC6A 4M94A 1OQ3A 4BS2A 3SSRA 2MKCA 3PG9A 1Y3JA 4C3KA 2ASJA 1WELA 4ZP6A 3FFIB 2GX8A 1RK8A 3OVAA 7FD1A 2F8MA 2B0GA 2CJKA 3A8KA 5SUHA 3IRXB 3BJYA 2CNKB 5EX0A 2A10A 2Z58B 2Z56B 4I2QB 5ETLA 3KHHA 2C2ZB 3KK3A 4DL7A 1WHXA 4WP3A 3ZXWA 2VC0A 1KFSA 2OP5A 1IUJA 5HLFB 3D1OA 4I6YA 5HL7Q 1X4EA 1RXOB 2NXNA 1TFWA 1FO1A 3VAFA 2KYXA 1X5OA 4Y0FA 1IR0A 1V5VA 2V9WA 2NREA 3LP2B 2CDRB 1I3OB 4ZPAA 5F8NA 2ZHBA 1WC4A 1JXLA 1JNZB 1PAUB 5C5JA 2FJBB 4JI6J 1AROP 3JXOA 2Z2MA 2E5IA 4OZ1A 3HX9A 2UUWA 1VGYA 3KJVA 4LFAJ 4YEAA 2KM8C 4J91A 2BKOA 4RU9A 1YRXA 5RUBA 4DMZA 3QO9A 2R8GA 3MM6A 5HI7A 3PW2A 2B6AA 4NCGB 2EFVA 3R3TA 4PPZA 3EUNA 4CO2A 4G1IA 4R5PB 3UDEA 3A3PB 3DDNA 1Y11A 3WZ0A 4JYAF 1ZTWA 1N52B 4LVOP 1VJWA 2DGXA 5K5MA 5A6PA 4PG7A 3CXCR 2JEJA 4W90B 1U1LA 1NZAA 3T1HJ 3G8SA 1Q82T 1SQFA 3US5A 2DB1A 4XIUA 2DD8S 3CJRA 4L6V3 4MK9A 1TV6B 3GYXB 3M8RA 5U47A 3GIRA 1RYSA 2CRLA 1V6HA 4HTJA 4MK8A 3DOLB 2C3UA 3CE8A 3OJSA 1HWJA 1BMQB 4RR5A 4A8WA 4UZCA 4D3GA 1QSLA 2I1RA 3IGVA 3O5TB 1ICEB 1RWOB 5C42B 2DT9A 1YZ6A 3NBPA 3DHWC 2C3YA 3BBCA 2OFHX 5F8IA 2G9OA 4P10A 4R0JA 3DDKA 4DV6F 2JEFA 2YY3A 3FBBA 5GMEA 3LGNA 3A13A 1R8HA 2QMXA 2B8PA 2HQ3A 5E3PA 2JLFA 1TP7A 4EBEA 2BANA 1K1QA 5F41A 3MUVP 3M8YA 4KKOA 1BQXA 1O51A 4RUBA 5ETPA 4J9UE 5DDQC 1S6UA 4EBDA 3OLAA 2F40A 3CCTA 1M1HA 3M6XA 3QYYA 4WKYA 1D9AA 2BJ8A 4IOBA 3MUMP 4B9LA 3PEHA 2ILZA 2FHOB 4B3OB 2R8JA 3NS5A 4U8VA 3I0RA 4K2JA 4RBUA 4BC7A 4KYZA 3PIPQ 5KFUA 1GT8A 4OYZA 2QT7A 1X5SA 3CCMS 4QOTA 4YB5A 3AD7C 4BBYA 1FFWB 1FNMA 4AL5A 2CXEA 3T1YJ 5DS7A 3UNGC 1RHMB 1BE4A 4LR7A 3THTA 1S1UB 2XM3A 1RHKB 2IVMA 3BGOP 3RBDA 1FF2A 4FXWA 3H59A 5K14B 2AQ4A 2HHVA 1JLBB 5H9EK 4LRDA 2VQEJ 3KUGA 4EZ9A 4DQRA 4A46A 4V19X 2ZUAA 1F3FA 4USIA 1SKUB 2VONA 5J2MA 4DR4F 2OEMA 1VMBA 1J5OA 5IT0A 2EW9A 1YK9A 5C24A 3SDEB 2WVEA 2OKQA 3V6KA 2NZ4A 1AB8A 3OXGA 3B4MA 2D3UA 2V8HA 4FYDA 3EPGA 4J9KA 4G1QB 4WKRA 3TWZA 4AD6A 1KRPA 2KHDA 1VQMS 1VQKS 1S1XB 4ZCLA 1FVSA 3G87A 5AXNA 3MTJA 2XMVA 1HW8A 2YX4A 3K2YA 1NJIT 1ZBTA 2IJRA 2E29A 2RKIB 2EFGA 2J7WA 1IJEB 1Q8KA 4DR3F 2HNDA 2WCXA 1X4GA 4U9RA 3G4SS 5DG8A 1F3VA 3M1VB 4PWDB 3H98A 3TZZA 4E8UA 3O1LA 3ZO7A 1W2BR 1RT1A 4I6AA 1H3DA 1P8GA 3PR5B 2RJZA 1IN0A 1U1PA 4NYZA 5K9FA 2IMOA 1CBKA 4FDFA 3GQCA 1Q5YA 3CDAA 2WW4A 2BZ2A 2A2CA 4XO0A 2ASYA 1RLCL 2WZ1A 1IBKF 3HHDA 4OX6A 3BSCA 3PJXA 2GGPA 2K1RB 1X9MA 2CZVC 3Q89A 4XK8C 3HZGA 3GV8B 4B9SA 1RAGB 3AQOA 3H2LA 2JFKA 3C66A 3BB5A 1N56A 2EXUA 3GE9A 2M2BA 3CVKA 8AT1B 1C1BA 5LOQA 2KZMA 3GIMA 3N6LA 4P75A 3K7RA 1X4BA 2QL9B 3G96A 3H25A 1YVFA 2BJ1A 3IRWP 4ZVSB 2DIVA 1GMWD 4YN3B 4KH1B 2PMZD 2RT3A 3DRPB 1HBUB 1HIYA 4J9MA 4DR5F 4UF4A 3K17A 4EO6A 1VQLS 4NLUA 5H1SV 3L3CA 3C19A 3KNAA 4B3TJ 4HR2A 4NEYA 1N5SA 1N6QA 2KYZA 1ZTTA 2FY1A 1NLKL 2H9ZA 5THWA 5KFWA 4DV5J 1NZ8A 3DLKB 2EWHA 1FJGJ 1OYEA 1OY9A 3EPIA 2ZVIA 3UD3P 4YOEA 2NR0A 2SXLA 1NSPA 2GJIA 2XHWA 2JC0A 3DNCA 2VA2A 1EKRA 2D7SA 4CTAA 1CJTB 3SSSA 4NWBA 3ZZ0A 5A8WA 1C1CA 3B54A 5J2QB 3W62A 1XN9A 1RAJA 1DRZA 2CJBA 2XULA 4I68A 4G1PA 2LMIA 1MMLA 5LJ3Y 3D6TB 1X5TA 3AXKA 3FFIA 1HQUA 2HMIA 2YNGA 1JJCB 4UY8T 4HT5A 2PI5A 5ETRA 1IKWB 2RDJA 5CH7B 2UXBJ 1MU2A 2XGQA 3PCOB 4ZVHA 2MQ8A 1L3VA 4ILLA 4ELTA 3DI6A 2BR0A 1V3ZA 4RUHA 2WSCC 2W7OA 1VQ6S 4NXNJ 3OR1A 1TU0B 1LXNA 3CPWR 1Q8IA 1RAEB 1PC5A 3ZTOA 2EFNA 1NH8A 3GLJA 3ITHB 4OI1A 6FDRA 4WFXA 3OJUA 2MKHA 1S7HA 4NMLA 5KFBA 4MIBA 1QAJA 2PA3A 1U0HB 3D5MA 3LP2A 2XS7A 4OJ3A 2QA4S 3LO3A 2PI4A 1VHFA 3TAQA 5A8RB 3GZ7A 1LWCB 1NRKA 2I0XA 2MLZA 4IG3B 4C11A 5BR8F 3HVTB 1YTYA 4DR2J 3BH6B 3PX4A 2DHSA 3GG1A 4B3SJ 2XHCA 2G2ZA 5EUHA 2UZAA 3QRRA 2YX1A 1REVB 2NZCA 1KONA 4HACB 3O8WA 3LOUA 3V6DB 1KHWA 4WYWA 2Q79A 4LBPA 4P9SA 1ZZNA 3DRRB 3OR2A 5A8KB 1I5OB 4DQPA 3WX4A 3RUBL 4K0KF 2AWZA 5H9FK 1TK0A 3PJ9A 3ULHA 2C1EB 1RGVA 1RT5B 2WBRA 2R2RA 1UFLA 2CNNB 1Z4UA 5HVFA 2WOMB 3ONQA 3ICLA 1H6KX 1Q7YT 2YH0A 2YWWA 3QFHA 3I0SA 4X4VA 3VVUA 1B64A 5KOWA 3MD3A 4YQWA 4Y2AA 2A18A 2CQ2A 2VFRA 3ENVA 3IBWA 1TL3B 1L3SA 3DOLA 1S9EB 2QLFB 3MM9A 2YKPA 3EGZA 1E6YA 2E1RA 1U6ZA 1YJVA 4F3MA 2F65A 4TYAA 1RT6B 2ZZMA 2Y9HA 1D3WA 3CCUS 4F36A 3BGUA 4P7TA 2NXJA 1T9TA 1S1WB 1JLCA 3WQPA 5K8NA 5KT2A 3UO0A 1ZOTA 2HFVA 1RBOB 3VZIA 4GVBB 3CJ4A 5HMZA 3QWPA 2BQ3A 1S99A 1YJUA 2Q1LA 3VAKA 4OLOA 3NGDA 4WU3A 3VTIA 2BE2A 4GKJF 4G3IA 5F8LA 2OUGA 4LF1A 2JLGA 5T41A 5I3QA 1RWWB 1YLXA 3LANA 1WJ9A 5FDLA 2L9NA 1RACB 4EYIB 1NJWA 1FWLA 2VFTA 2HGMA 3S1TA 3ZC4A 1AYEA 3GV7B 4F4ZA 4ZHRA 3ZTQA 4C98A 4KGVB 3C6UB 4YR3A 1HMVA 3MPYA 1NSAA 1URNA 5IZHA 4XPEA 2BACA 2G2YA 2V2KA 4RBVA 3MEGA 1R8BA 4QYRA 3OXFA 3PIOQ 2F3JA 3LP0A 2IC3B 2FJXA 4O3NA 2LEBA 3I5AA 4LF8J 1HBNB 1EZZB 1WC6A 3ZZYA 2HG4A 2E7WA 2BW7A 1FRMA 4Y00A 2HHHJ 3VAGA 1JKHB 2J6SA 4F26A 5K14A 3OL8A 1JLBA 3PKYA 4UOGA 1B3TA 2RDIA 3MCOA 3HZEA 2ZWPA 2H54B 1T95A 2OEJA 1U25A 2Y1RI 3H5SA 3TNVA 1UKUA 4ZLPA 2XMWA 5E3AA 4LF9F 2RUSA 1Z2LA 1VQ5S 5CZVA 3FGVA 4LSNA 1NKBA 2B4PA 4K4XA 1UETA 1WOOA 3ZFVA 4Q0BA 3OTDA 3R2CJ 2QA2A 1W7WA 2RSQA 2FLLA 4I67A 3B82A 3ELHA 3KLGB 3BYRA 1NDKA 2P2CB 4NXMJ 1UPMB 4RKUC 2J6UA 5ETTA 1PJ5A 1TR0A 1RA7A 4JI4F 1N33J 4NLXA 4ZCKA 5DGBA 2YWHA 3DRYA 2VDIA 2E7XA 2IYGA 1HBOA 4RX6A 3QLHA 4H4MB 2I6WA 5CQGA 2HFOA 3KK1B 2C2DA 4CLPA 3AJ2A 2G0IA 2HVEA 2MSTA 1B0VA 1S97A 2F63A 3IS9B 1RKIA 4OFZA 2OD4A 1SVDA 1OO0B 1B99A 3M1VA 3R9LA 4WIIA 5H9EJ 1DJ0A 1FESA 1JLFA 2AJ2A 2RUGA 3DYAA 2HHWA 2BABA 1FK9B 3IG1A 2QFIA 1BLUA 5I3UB 4P2XA 2OMLA 2B4VA 1YBUA 2VFSA 4LF7F 1ZS6A 3NRBA 2C2RA 2NUHA 2VJVA 2UUAF 3D28A 2YNHA 2FZKB 3FCVA 1R6VA 2Z8QA 2E5LF 2BBEA 2L9WA 1ZAXA 3IR5B 4O4RA 3J7ZT 3IGNA 1T9UA 4J9SA 2LKZA 1UCNA 4YB7A 3D67A 4DV3F 4ZVUB 1G1XA 4RBTA 4IRCA 3BGLA 3SI8A 3DOMB 3H0PA 2DCLA 3J7YI 2JHEA 5CXTA 2IY5B 4LF2A 4GC7A 3CJKA 5HSPA 4KBIA 5G4DA 1MMDA 5DGAA 1UVMA 1VQ7S 2EKNA 5KFTA 3ZZUA 4YHHJ 2A2DA 4MAKA 2IJNA 2VG6B 4PG5A 4DV0F 2XGPA 4OJ1A 2C3MA 1GAOA 3QBCA 4OX8A 3H4DA 3TAMB 5KG3A 2IMWP 2FZGB 1Y10A 2OELA 2W7AA 2CPHA 5KFQA 4W92B 5GMKa 3CC7S 4ECXA 1FDBA 1PCAA 1XMBA 4M8LA 3FCHA 3IAS9 2IA0A 3JQMA 4LBIA 5AE3A 1TKZB 3RR8A 2ZWOA 4OV6A 3I9ZA 5J2NA 4ZPCA 5EWGA 1XWLA 1SH2A 1RTJB 2MZQA 4F04B 3RU0A 3M6WA 5L39A 4F3OA 4ETXA 1BQNB 1LWXA 5D0HA 1CPZA 3HSGA 4CLKA 2HK3A 3TW0A 5HAOA 4AE5A 3A3NB 1TUWA 4OYXA 4WWSA 1E6VB 2HEKA 4OX7A 1UVJA 1NB7A 3T5LA 4Q2MA 1T3OA 4OYAA 1UTAA 1DQ9A 2VG7B 1NBEB 3I5CA 4LREA 4K4UA 2KU7A 5T7LB 4DV1F 3HSZA 1IKWA 1O8BA 5B0FA 2ROPA 2DYAA 5FD1A 1S57A 1OWXA 1CJUA 4O3RA 4OHYA 1PIEA 2AX0A 2EK1A 4DF8A 2CWKA 3H7HB 1VRQC 1NHUA 1WG5A 4TU8A 2UU9J 3RG6A 4B3MF 2PGCA 2MKKA 2FJWA 1HYSA 5J2PB 2UVVA 2G13A 4X4TA 3HLUA 4KGKA 1KQFB 2Z2LA 3BO3A 2XC9A 4NA3A 3BV8A 3GSDA 1MROB 3UQSA 2XYHB 4PR6A 4WE1B 4ELVA 2GFFA 1L3KA 2CQHA 3N79A 2CFXA 1RISA 3MM5B 3G9CA 4USKA 3N0VA 2RILA 2BX6A 1S6QA 3OTOJ 1KQSR 2XI3A 3IXQA 3VF0B 5KT6A 4X84A 3MUTP 1P1LA 4DCPB 3D0HE 3TQ1A 2DR5A 3VGVA 1XC9A 4JI5F 2BOAA 1BY9A 3G82A 1HNWJ 1KOOA 3OXLA 1H2TZ 5KFLA 1L5UA 2UUBJ 1REVA 4LVNP 4HTIA 2DHAA 2UUCF 4HVZA 2HHSA 1IWGA 2BVZA 3SCIE 1Q79A 2HS0A 3AD9C 2CUYA 2VD3A 4NLQA 1HR0J 4RWWA 1LWFB 2WW8A 2EG2A 4DN9A 3OL9A 1EB0A 2HQGA 3C16B 5L46A 3MM7A 1RAHB 1WTBA 4KAIA 1F5AA 1JLQB 2FPHX 3F0NA 1IR1A 2Y8YA 5LMNJ 3JSBA 4OZJA 2WOMA 5K8PA 2EEYA 4J5OA 3W61A 5KFEA 3H90A 4MK7A 1IKXB 2DTJA 1ZPWX 3CCQS 1RTDA 2CNLB 1U2CA 3IBFB 1CVJA 1IKVB 1LFWA 3R2DJ 3DGPA 1RT6A 3P8BB 1CG2A 2UXDF 5B0CA 3S8SA 1SJRA 4ECZA 3MXHP 1APSA 4TY8B 3VGTA 2RQMA 4F4KA 2QA4G 2GQQA 3NKYA 1FRXA 1QAYA 5GAGI 4KR0B 1U02A 4AFFA 1EQMA 3MEDB 1RAFB 1FKPB 2V6AA 2MLYA 2UV8G 5E3CA 2HFSA 2DIUA 3G2XA 4IG0A 5DJBA 3V81B 4OYPA 1LW0B 2Z0GA 4AYBD 4B17A 1EETB 2O1PA 2KH9A 3M8QB 3QT8A 2MQLA 3I56S 3QT5A 3AD8C 5LL6d 2DITA 4XDDA 1P9YA 1RWVB 1S9GB 2BM1A 3C3LA 5D77A 4HL9A 3FMBA 2IAJA 1VOMA 3LF0A 4U7CA 3AH6A 2YWGA 1OIAA 3NGTA 2GQ2A 4I7FB 1HNZJ 3DRSB 5CZXA 2ZC3A 2IC3A 2XNQA 3MF5A 5D6GA 1RP5A 1OSCA 3UE2A 4CCHA 4RU2A 1F6TA 2V34A 2YVSA 4CLSA 5F0WA 2ERRA 1KN6A 2Y3YA 1JXVA 4Y6IA 3W2WB 3DHXA 1VJQA 2Y0SD 4KQZA 3OL7A 1SUQA 2HBRB 2YWKA 5F9LA 2HS3A 1WF0A 2LCWA 1HHTP 2XWXA 1HLWA 3W64A 4I69A 2HQFA 1VC0A 1AXQA 2QSWA 4M5IA 2QL7B 2VG5B 4KJIA 1GXUA 1UAWA 2F7VA 2VASA 1H7WA 4AUKA 2HAFA 2MJUA 4CQ1A 1CS4B 4KFBA 4WFAQ 3NG8A 4PG8A 5LMUJ 4LF5J 1RHJB 3RW6A 2D9PA 1RU2A 4WFNQ 2KJVA 4RW4A 1Q53A 2R8KA 2E1MC 3KLEB 5IWAF 4N8NA 2XS2A 3CCVS 4YMEA 1N5QA 4K4WA 4LSLA 5KT4A 1PSDA 4ZPBA 4ZVEA 3T5KA 3QWUA 1Y5LB 1SH0A 4PXEA 3PW7A 4DXLA 2E7VA 2KT2A 3CDBA 3CNQP 4A8YA 3IS9A 5ETKA 2LQ9A 2OPSB 3C6TA 1RCXB 3FUYA 1DFDA 3V4IA 4ECWA 1F60B 2DHXA 2J76E 1QE1B 1U7LA 4PG4A 1N34F 2V68A 4EMDA 2HVHA 1C4CA 3SEOA 2MQQA 2FVQA 2K7KA 3P3DA 2V94A 3MOZA 4CP5A 4G6VB 3GYNA 3RRGA 2DH8A 2B56A 3JYTB 4B02A 1XR6A 4DL5A 1RT2B 3I87A 2CG8A 3MEEB 3DOMA 4DUZF 4YP3A 4JV1A 1NK6A 4ZJQA 2F8EX 4DJBA 5LXYA 3CCJS 4LQ9A 1S0NA 3OFHA 1TVRB 4YR0A 3W66A 1VQPS 4P2SA 4WFBQ 4G65A 4CIOA 3R5GA 4FPRA 4EGLA 4EZ6A 5AJ3J 3UDCA 3TAMA 3E2EA 5E5NA 2KFZA 1G3OA 3QIDA 2MXYA 4M5DA 3DMJA 5B0AA 1TTHB 4TU9A 2K8GA 3H40A 4HEA9 5KFRA 4Z7YA 1N5VA 1HWKA 1SCJB 1U24A 1X60A 2NUUG 2BV3A 4JI7F 2R7SA 4ECVA 3TJ9A 2C3PA 1N0UA 3BF4A 2W9CA 2QJ3A
chains in the Genus database with same CATH topology
1UEVA 3O5TB 1GH8A 2RS2A 4C8YA 3ITHA 2HNYB 1JXEA 2ZDPA 5C42B 4I6WA 2DT9A 2R2UA 4NLYA 4NLOA 3NBPA 2I2YA 3N5BA 3DHWC 4JI3F 2C3YA 3CGIA 1KD1T 5KT3A 1SQEA 1LOUA 1JMTA 1Y5IB 2OFHX 4N56A 3BSOA 4P7VA 3JSRA 4K4SA 1LK5A 5F8IA 2G9OA 1O0PA 3S6EA 4ES2A 2R8IA 3AB4B 3IO1A 3U1MA 4CH7A 4YY3F 4R0JA 5EX3A 4HKQA 2A1BA 1VS3A 3DDKA 3LH2S 4DV6F 1S6OA 1I1GA 5E3RA 1N8RT 2JEFA 2YY3A 4QPTA 3LGNA 1R8HA 5GADI 2QMXA 3DC2A 2DGOA 1VC6A 1E6VA 5E41A 2FGOA 4RW9A 4DLGA 1U48A 1SJQA 2HQ3A 1PO6A 5BYSA 3PRBA 5E3PA 4IFVB 1X8DA 2JLFA 4WFYA 1TP7A 3FEZA 4ID5A 4EBEA 3MM7B 1HNXF 2BANA 5IS2A 1DLOA 3JTPA 1DHMA 1K1QA 2GMJA 5F41A 3MUVP 5FJ4A 2AGQA 5D4OA 1ZM2A 4KKOA 2QFJA 1IM4A 2J8AA 1BQXA 1T03A 5A8RA 2VG7A 1O51A 1S79A 2UUTA 4AL7A 1N36F 4A8FA 1LWCA 5DG9A 2DNMA 2W4PA 4CH1A 1FKAF 4IG3A 2V8DA 1UA1A 1SJ1A 4DR6F 3N9UC 1QUVA 2DCUB 2R2TA 5DDQC 1S6UA 4EBDA 4EO8A 3M2RB 4X66F 3K59A 1X4AA 4M95A 3FSYA 3HVTA 3OLAA 1U45A 2F40A 3CCTA 2HRUA 3G6YA 3Q23A 3M6XA 1D8ZA 2NYIA 3RB4A 3QYYA 4WKYA 1TL1B 1NK5A 3PRDA 2OPQA 3MPVA 4ES3A 1D9AA 2M3DA 5KG7A 1SH3A 2KRRA 4IOBA 4RUCA 2MKSA 3MUMP 4B9LA 5CA5A 4HT7A 1D0EA 2VB6A 3PEHA 1U09A 2ILZA 4FVMA 2M8DB 2DVIA 2J0QD 2HVIA 2FHOB 4B3OB 2R8JA 2XEXA 2MKJA 3NS5A 5L9XA 3GFXA 3I0RA 5LJ5Y 2KXFA 3BZQA 4WCEQ 4RBUA 4BC7A 3V6DA 3HI9A 3KLIB 1RTDB 2J9EA 1RT7A 1WF1A 3QZ7A 1KLMA 3SXLA 1C2PA 5KFUA 3PIPQ 4OI6A 1L3UA 3CT9A 2RF2A 3PO5A 1GT8A 3DRRA 3Q8SB 3G8QA 2QT7A 1FD8A 4JI0F 5A8KA 4FF1A 2CYYA 4DL4A 1HNZF 3PV8A 2L9DA 1X5SA 1HARA 4R25A 3CCMS 1NKCA 2IM0A 4QOTA 3BDPA 1HA1A 1AW0A 4WF9Q 4YB5A 4WK3A 2ADCA 2WK4A 2J9CA 4A8OA 4DOZA 2HHQA 4BBYA 2FLNA 2ROGA 1UJ4A 1FNMA 1UL3A 4RW8A 3KLHA 4AL5A 1WD6A 2KXHA 2MGZB 1RT5A 3U27A 4CO0A 5DS7A 3UNGC 4UY85 5JVHQ 3HJFA 1YJ9S 3BQ2A 3BQ1A 4HHJA 4A8XA 1SKSA 2IM2A 2MQOA 2I5JA 3THTA 1S1UB 4WE1A 4MKAA 3PM9A 2IVMA 2IJFA 4CT8A 3RBDA 1FF2A 4FXWA 3BM7A 4F4XA 1LXJA 3H59A 2QMWA 3CDUA 5K14B 1JLBB 2AQ4A 2HHVA 1NAQA 3MM5A 4LF6F 1U6BA 3NNCA 3AB2B 3E01A 4RNNA 2FTRA 4KHPF 3D1HA 4EZ9A 4DQRA 2XO7A 3MZIA 4IG0B 4KRWA 4DQSA 4A46A 3C46A 5F8JA 1R8CA 5KFKA 3DFEA 4V19X 2N7YA 1J2VA 2MZRA 2D3OR 2DPJA 3N6MA 2ZNZA 4OZ0A 4DWIA 4FZVA 4RUAA 3THVA 4MKBA 4MFBA 4USIA 2VONA 5J2MA 1D9FA 5J1EB 1K9MT 2DR7A 1TL3A 4DR4F 4KO0A 1VMBA 1S9EA 3L95X 2W4DA 3MURP 2MZSA 2HFZA 3FEXB 3NNHA 3MMCA 5IT0A 1J5OA 4FF4A 3CDEA 2EW9A 5C24A 3SDEB 3R5AA 1UVLA 1RT3A 4ED5A 1VFJA 4PPDA 1HI1A 2AJ0A 2OKQA 3V6KA 2LXFA 2F9DA 1S0OA 4KHRA 2NZ4A 4B9VA 2DK2A 3CJ3A 3OXGA 2CQBA 3B4MA 2D3UA 2IAJB 1S1WA 2V8HA 2XG8A 5CCLA 3M30B 5LT5A 3EPGA 4J9KA 2W8KA 4FYDA 4D3HA 1M5VC 1S0VA 1TKXA 2YQ3A 4G1QB 1SIWB 4NOHA 2AJ1A 1FE0A 2PO4A 2V4JA 2Z4PA 4R8UB 4URSA 4WKRA 4FBUA 4QYZJ 2DR9A 1KRPA 2CQCA 4NYOA 5C25B 2KHDA 1VQMS 4ZMMA 2E5JA 3AHPA 2YKAA 1LWFA 3VAJA 1VQKS 4Y34A 1S1XB 4ZCLA 5CCMA 1FVSA 1U26A 2U2FA 4ECRA 2GO8A 4N77A 2ZC4A 1FD2A 2XSJA 3BR9A 5L1IA 1WACA 3U02A 5AXNA 5KFCA 4J9QA 3MTJA 1QJHA 1HW8A 2XMVA 2YX4A 3S7RA 4J9RA 3DOKA 3KLFA 4MYUA 5H9FJ 4ED2A 4LUBA 3K2YA 4DSLA 2AJQA 3TARA 1NJIT 1VQ8S 1ZBTA 1IBMF 1HFEL 3T19A 2QRRA 5M2UA 2W7PA 4DV5F 2IHR1 2GHPA 3FZ2A 1N5TA 1RT4A 4H4OB 2E29A 2RKIB 2EFGA 5DDPC 1C0UA 4P6QA 2RNEA 5JUMA 2J7WA 4I1TA 1IJEB 4DSKA 4DR3F 3DM2A 2HNDA 2KVIA 2WCXA 1X4GA 2W24A 4U9RA 2P6SA 3MECB 3G4SS 2KKHA 1SUQB 4B9MA 3EX7B 4URGA 5DG8A 2XMJA 5EDWA 2CQIA 3M1VB 4JUZA 4UW2A 4PWDB 1XR5A 3UPFA 1UVNA 4QR1A 3H98A 2HPUA 4H4KA 2XB2D 4EWTA 4H54A 5EN1A 3ISZA 4NCAA 4NLRA 4E8UA 3PDNA 3C6UA 4E98A 1NJZA 3O1LA 2HLTA 2VL1A 1XMQF 1R3NA 1W2BR 2F1FA 1RT1A 1M90T 4I6AA 1H3DA 4EYHB 1P8GA 4QIWD 1JLEB 1FJEB 3GB0A 4YDDB 2VUGA 1FDNA 3PR5B 2OPRB 1VQSA 2NSBA 2RJZA 3TUIC 5FLXY 2JVOA 1IKVA 3MM8A 1IN0A 4JI6F 1U1PA 4NYZA 5K9FA 3OUYA 2IMOA 4NLTA 1EP4B 2KDOA 3SV3A 3MR2A 1A6LA 3GQCA 1VQOS 5L8RC 3CDAA 2BZ2A 2A2CA 3MMJA 2JL9A 4XO0A 5M2PA 2FVPA 4I4BA 2V8GA 5JXSA 4ID8A 5HO4A 1S6PB 1QTMA 2ASYA 4KFBB 1IBKF 1U1OA 2FD2A 4PXBA 3SSQA 3HHDA 1NK9A 4F67A 4RNHA 4OX6A 3BSCA 3POTA 5JVGQ 1VI7A 2YKQA 3PJXA 4ZA1A 2GGPA 4MTPA 1UA0A 2UXBF 2K1RB 2J0SD 1X9MA 4RW4B 1HBNA 2CZVC 4XK8C 3FMWA 3HZGA 3GV8B 4Z2XA 1VC5A 2WHOA 3U1LA 3H2LA 3AQOA 4B9SA 2VV5A 2V4QA 2JFKA 3BGRB 3MEDA 4X4PA 2WB4A 3JSMB 1BWEA 3RRKA 4DX8H 1FT8A 4ZK7M 4Y2KA 3C66A 5BJRA 3Q8QB 2IVFB 3BB5A 1N56A 1JKHA 1OPIA 4ZPTR 5B0DA 2OSRA 4CNYA 4Q44A 3UCGA 4USHA 2CPYA 3GE9A 2KTQA 2KFYA 4LSLB 3D0GE 2OH2A 2M2BA 3C8YA 3GIIA 4DS5A 3J81Y 1W2IA 3CVKA 1C1BA 2K7JA 3BQ0A 4C8NA 2HGLA 2KZMA 1EETA 3CULA 1CC8A 3GIMA 4CNZA 3N6LA 3CD0A 3UWTA 2M5YA 3K8VA 4FNIA 1FXLA 3K7RA 2DNPA 1X4BA 2EVZA 1D9DA 5KG4A 4Y2CA 4B08A 3C6TB 3G96A 4NLSA 4IQMA 2Q43A 3H25A 2QE5A 2DNQA 3L09A 3V4IB 1H98A 3OV7A 1YVFA 3IRWP 4RZRA 3KWMA 4F25A 4IO9Q 1LKZA 4QWBA 3PW0A 4WZQA 1HWIA 1Z2ZA 3BSAA 2FVCA 4CZCA 2OJ3A 3PKMA 2DGVA 2DIVA 3HHLD 1UFWA 2RH3A 4HI1A 1ZM4A 3ZZOA 1JNRB 3MD1A 2PMZD 5AJ3F 4HLBA 3RAQA 1VQYA 1QSYA 3WC2A 1K73T 2FJEB 2RT3A 2ZZNA 3DRPB