4PUOB

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
425
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 121
structure length 412
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB03
3H98A 4LQ3A 4QPXA 4NLOA 1RT5B 4KE5A 5DG7A 4IR1A 1DTQB 2VG7B 1C1BA 2UVWA 1JLGB 2ZE2A 5F8MA 4EO8A 4KO0A 4Q8EA 4O3PA 1C2PA 2AWZA 4MKAA 5KFDA 2FVSA 1ZTWA 2C2DA 1S6PA 3TQ1A 4Q43A 2QE5A 1FKPA 5DG8A 2C22A 1IKYB 4LSLA 1RT2B 1RT6B 4K4WA 3H5SA 3ISND 1C0UA 1JLEA 4TY8A 2RF2B 5F8LA 3PR4A 5DQGA 2V9WA 5CYQA 3BSAA 3T5KA 4H4MA 4RNOA 3Q8QB 4NLPA 3KK1B 3ICLA 2AX1A 3IN5A 2VG6B 3DLKA 2W7OA 3PVXA 2RDJA 1IKVB 3C6UA 1ZTTA 4KB7A 4TYAA 5KFNA 4YP3A 3TAMA 2JC1A 1TVRA 4O44A 3EZUA 4ZVFA 4DEZA 3OL7A 3V6HA 4IRDA 1KHWA 4IG3A 1EETA 3GIIA 1N4LA 4Y34A 4RW8A 2IM0A 4DL3A 3KLHA 1LWCA 3KK2B 1REVA 5DGBA 5K14B 1S1XB 3Q8SB 4FS1A 4K4SA 2FVPA 3M9MB 2EC0A 2YNFA 1S4FA 5KT7A 5L1LA 5J2PB 4QWDA 4FBTA 3KHRA 2WHOA 2OPPA 1HYSB 1HARA 3HVAA 3KLIB 2B6AB 2HNYB 2JLEA 1RT4A 1TL3A 4XPCA 1D0EA 4K50A 1SUQB 1J5OB 5KFLA 3TVKA 4RNFA 1DTTB 4G1QB 2ILYA 1BQNA 2RKIA 5KFGA 3BQ0A 2D3ZA 5KG4A 3KLEA 4TXSA 5KG5A 1RTDA 3BSCA 2C28A 3FFIB 4O3OA 4WFYA 4FBUA 2AGPA 3EPGA 2YNIA 4WYWA 3MECA 2R2RA 1XR7A 3I0RA 4R0EA 4ZPCA 3SI8A 4K4TA 5EWFA 2IBKA 2VA3A 2AQ4A 2F8EX 1JIHA 3T5LA 5HROA 5KG3A 3GIKA 3CDEA 3GIJA 3PW4A 3LP2A 4M95A 2R8HA 2OPSB 2JEJA 4NLXA 4ZVEA 1HQEB 3M8PA 3LAKA 2BRLA 4QWBA 3BREA 1VRUA 5C25A 1JXLA 3DM2B 1LW2B 4MK9A 2HNZA 5HP1A 3D5MA 2AX0A 5KG7A 5KFJA 4ED7A 5C42B 4HKQA 2IMWP 4KSEB 4NLYA 4IQXA 3MTKA 5FDLA 4MH8A 4MK8A 3DOLB 4I2QA 3BQ1A 4O3RA 2HNDB 3SFGA 2YKNA 4QWEA 3MEEB 3IS9A 1JKHA 3BGRA 5HLFB 3LP0B 3QGHA 1DLOA 3IRXA 2R2UA 1Z4UA 3KHLA 4TN2A 5KFCA 4RUAA 1RT3A 4J9SA 4ECYA 1RT1B 4ID5B 3JSMB 3KLGA 3KHHA 2O5DA 2BQRA 1TQLA 2ZKUA 2E9RX 1T3NA 3JYTA 1W25A 1LWEB 1U09A 4J9MA 2W8KA 3DRRB 3MEGA 2XC9A 1FK9B 3NKYA 4H54A 4JV1A 4ED0A 4EEYA 2ASDA 4DG1A 4EBDA 3LP1B 2BE2A 2W7PA 2FLNA 3QO9A 2UUTA 3PR5B 1MU2B 4PUOB 4ED6A 1JLBA 4YR2A 4XO0A 4WXWA 1N5YA 2I5JA 4J9NA 1HNIA 4ZHRB 1MMLA 1NHUA 3QIPA 5KG0A 1C1BB 3T1AA 5C5JA 1QE1A 3CJ2A 1SH0A 2YNGB 4M94A 3CVKA 3N6MA 3E01A 4O4GB 1IKWB 3Q8RB 4IFYA 3KNAA 4TQSA 5C24A 2XCPA 1S6PB 4F4ZA 3OLBA 4RW4A 5D3GB 2R8GA 3QIDA 4ZVHA 1FKPB 3OHAA 2GIRA 4LSLB 1N6QA 3CIZA 3MR5A 2I1RA 2HAIA 3H5UA 3QGGA 1C0UB 4TY8B 5I3UB 5CYMB 3H5XA 5CYQB 4URSA 4H4MB 1JLAA 2OH2A 1S6QA 2WOMB 3V4IA 1R0AB 1HMVA 3FQLA 2HWIA 3V6KA 1C0TA 3T19A 3IGVA 3SFUA 4Y2AA 3DMJA 3UQSA 3TAMB 1RA7A 1RTJA 3QZ8A 1TVRB 5DGAA 4R5PB 3V6DA 1TKXA 4EBCA 1TV6B 4YR3A 1SV5A 4NCGA 1EETB 3ITHB 4KBIA 2B5JB 4RW8B 2XWYA 3DRSA 3KLHB 4B3OA 1LWCB 5F8IA 5KFYA 4DL5A 1JLCA 2IM1A 5KFQA 4KV8A 1S1WB 2YNHA 5J2QA 5KFIA 2IJNA 4NLVA 2JEGA 3MR6A 3I5BA 4ZPBA 1S10A 4K4VA 3CWJA 1TL3B 3NBPA 4IG0A 3GQCA 4OL8A 3KLFB 3FSIA 1LWFB 4RNNA 1BQNB 2RKIB 4NRUA 2OPQA 3OL8A 4J9OA 1RTDB 4WYLA 2VG5A 1RTIA 1GX6A 5F8GA 5T14A 3G6VA 3C6TA 3MECB 4KAIA 4Y2CA 2W9AA 4RW6A 2JEIA 3IG1A 5HBMA 3NAHA 5KFPA 2JEFA 5HROB 1EP4A 3QLHB 1TKZB 4NYZA 3KK3A 4MIBA 1NNDA 2ZD1A 3D28A 4WFZA 3H40A 4DL7A 4RW9A 3M8PB 4LSNB 5J2NA 1S9GA 3M9OB 1VRUB 3DOKB 1BQMA 3NGDA 1RTHB 2IM2A 5HP1B 4Q44A 4RUCA 3M9NB 4DL4A 4ICLA 5J1EA 2JC0A 1T05B 4J9QA 3RAXA 1S1VB 1KLMB 4IDKB 4K4XA 4I2QB 3DYAA 3PW0A 2YKNB 4R8UB 4I2PA 1JLQB 4I7FA 1JKHB 2IC3B 5DG9A 1DTQA 3IRXB 2VG7A 4WE1A 3QGIA 1ZETA 2UVRA 3HVTA 1LW0B 2XI2A 2CKWA 4RW7A 1RT3B 1JLFB 5KG1A 2YKMB 3UR0A 2V4RA 4H4OB 2XI3A 2B43A 5KT5A 1S9FA 1T94A 3GILA 3V81A 5KT4A 3JYTB 3I0SA 3BR9A 3OLAA 2ALZA 5EWEA 4RNHA 4ECXA 3KHGA 4IR9A 1RT2A 4Q0BB 4EYIB 4DG1B 3DI6B 3KMSA 2BE2B 3GV7B 3QO9B 2UVUA 3E51A 1JX4A 3KK1A 1QUVA 1N5YB 5F9NA 1HNIB 3VQSA 3RB3A 4WZMA 4IFVA 1IKVA 3QIPB 4MIAA 5KFTA 2WONA 1QE1B 4ZP6A 5DQIA 4URQU 1FKOB 4IRCA 1T03A 4GC7A 3OL6A 2D7SA 1RAJA 5EWGA 2W9BA 4F4YA 4IFYB 3OSNA 4KKOA 4GC6A 4RNMA 5C24B 4IRKA 2D41A 3M8QA 2D3UA 4MFBB 2HMIA 3NL0A 4PWDB 5KFXA 3MEDA 5J2MA 1S1UA 3KK2A 1N6QB 4ZPDA 5KFKA 1TL1A 2RDIA 5K14A 1S1XA 5KFVA 2J6UA 4F4WA 1HQUA 4TQRA 3LALA 5J2PA 3DLGA 1S6QB 4WZQA 1S0MA 4ED3A 3V4IB 1HMVB 2HNYA 2OPRB 4MKBA 4URGA 3HVWA 1S97A 5I42B 3IGNA 4PQUB 2BQ3A 1SUQA 1TKTB 1J5OA 1S0OA 3CJ4A 1DTTA 4G1QA 3PW7A 1SH2A 3RBDA 3V6DB 1TKXB 1S9EA 3CDWA 1N48A 4O3QA 5KFOA 3KOAA 3FFIA 2ZE2B 1S1TA 4KO0B 3H4DA 5L1JA 1HNVA 2W8LA 3CDUA 3DRSB 2QV6A 2DPIA 2R8KA 2FJXA 1JLCB 5J2QB 4NLRA 2IAJA 3KJVA 2DPJA 2BQUA 2OPSA 5KFSA 3GIMA 1HQEA 5F8HA 2AGOA 1JLEB 2IJFA 4IG0B 3NBPB 4ZMMA 4J9KA 3DM2A 3MR3A 5L1KA 3DLKB 1CSJA 2WB4A 1N56A 1S48A 4ECTA 5C42A 3C6UB 4NLQA 2R8JA 1RTIB 2UUWA 2ASJA 2GC8A 3C6TB 3G6XA 2ILZA 2HNDA 4Q8FA 3NAIA 4O44B 4JV2A 3BSNA 1HPZA 4IG3B 1NHVA 4ECZA 4HYKA 3LAMA 3RBEA 3GYNA 4YQWA 1REVB 1OS5A 3BQ2A 4RW9B 3RAQA 1IKXA 2BANA 5J2NB 1S9GB 3I5AA 1LWEA 2YNFB 5EUHA 1FK9A 2OPPB 1VRTA 2WTFA 4DL6A 4WXOA 1I6JA 4ECUA 3MR2A 4ICLB 4Q45A 3RB4A 1RT4B 5F8NA 4LQ9A 1QAJA 1MU2A 4PUOA 2XGPA 3GV8B 3DYAB 4TY9A 1KHVA 4I2PB 4I7FB 4ZHRA 3MFIA 3KLEB 3PJXA 4WE1B 4KFBA 4U6PA 4Y3CA 2VA2A 3KLVA 3G6YA 3HVTB 5L1IA 1UWBA 3CJ3A 2ATLA 4RW7B 3NMAA 2YNIB 2YNGA 4QWCA 3I0RB 2R8IA 3V6JA 4O4GA 2E9TA 1IKWA 3V81B 2E9ZA 5KG2A 4NLSA 3I0SB 4TLRA 3BSOA 5D3GA 2FJWA 4ECRA 1RT7A 3LP2B 2FVCA 1XR6A 5DLFA 4J9LA 2W9CA 4ZP9A 4NLWA 3DLEA 1C1CA 5I3UA 5CYMA 5DLGA 5KFHA 5C25B 1IM4A 3PZPA 2C2EA 5L9XA 1SH3A 2WOMA 2BRKA 4YMEA 1R0AA 2HNZB 2V4QA 2FLPA 4IFVB 1K1SA 2V0NA 4QWAA 3UDLA 2FLLA 4O4RA 2WONB 3DRPA 5FDLB 3OSPA 1T03B 2W9BB 4R5PA 1RT5A 3BGRB 3IS9B 1TV6A 1DLOB 4KKOB 3N6NA 1JLGA 3ITHA 3M8QB 2B5JA 2HMIB 5F8JA 5KFBA 4ZVGA 3MEDB 4IH7A 4KHMA 5J2MB 1S1UB 3KLGB 3PJWA 4EO6A 4ECWA 1TL1B 4NLGA 1RA6A 1S1WA 4F4XA 4F50A 3G86A 5KT2A 1HQUB 3MEGB 3DLGB 3N6LA 3PW2A 3PW5A 1RYRA 5F9LA 4DL2A 3H59A 1IKYA 3DDKA 5KT6A 1RT6A 1XR5A 2RF2A 2CJQA 4KHRA 2WCXA 2R2TA 3KLFA 3H2LA 1LWFA 1JLBB 3UPFA 5JUMA 2I5JB 2VG6A 2FVQA 4X2BA 1S9EB 4K4UA 3T5HA 4IOBA 1WNEA 1S1TB 1HNVB 5KG6A 5JXSA 2HWHA 3T5JA 3E01B 1GX5A 4ZPAA 1RDRA 5KFEA 2ASLA 4ZP7A 2IAJB 3OL9A 4NRTA 3KJVB 3QLHA 4RW4B 3CJ5A 3FQKA 4K4ZA 1TKZA 3FDSA 4ZP8A 3GV5B 2FJVA 2XCAA 3EPIA 3KMQA 4WFXA 4IH6A 4LSNA 4NLUA 4ECSA 2BR0A 2C2RA 3DOKA 1JLAB 1K1QA 1RTHA 1HYSA 2AGQA 3RB0A 3KLIA 2B6AA 1C0TB 1T05A 4EBEA 3LANA 3DMJB 1S1VA 2FVRA 4JUZA 1KLMA 4IDKA 4YR0A 5KFMA 4U7CA 1RTJB 1TP7A 4R8UA 1JLQA 2IC3A 5KFZA 1HPZB 1D1UA 3PHEA 4NLDA 1SV5B 3H4BA 2IA6A 4NCGB 1S49A 4PQUA 1LW0A 4RZRA 1JLFA 2YKMA 5EDWA 4B3OB 3CJ0A 4H4OA 3QZ7A 3OHBA 1RYSA 4KV8B 5KFRA 1YVFA 1IKXB 2BANB 2YNHB 2R2SA 2GIQA 3RB6A 2WK4A 3QYYA 3I5CA 4J9PA 3HKWA 1VRTB 3ISNC 3FRZA 4Q0BA 3DI6A 4O3NA 4K4YA 4EYHB 4ED8A 4JV0A 4QW8A 5KFFA 1LW2A 4FS2A 2OPQB 3HHKA 1S0NA 2WRMA 4KFBB 2VG5B 3MF5A 1UWBB 5KT3A 1FKOA 3DOLA 4J9RA 2AU0A 2UVVA 3Q8PB 3MEEA 3BJYA 5HLFA 3LP0A 4RW6B 1QAIA 3IG1B 5HBMB 5KFWA 4MFBA 1EP4B 4ED2A 2J6SA 1RT7B 4PWDA 3H5YA 3MFHA 1RT1A 4ID5A 3KK3B 3JSMA 2ZD1B 2J6TA 4O3SA 2W9CB 3DLEB 1C1CB 4IH5A 4NLTA 2IM3A 4NZ0A 4ED1A 3DRRA 1BQMB 5DQHA 5KFAA 4ECVA 4QW9A 4ECQA 4IKAA 2OPRA 4RU9A 2XGQA 3LP1A 5J1EB 4G3IA 4MK7A 5KFUA 5I42A 3CO9A 4XPEA 3DRPB 1TKTA 4TYBA
chains in the Genus database with same CATH superfamily
3IMQJ 1WACA 1QSYA 2YPYA 1EX8A 1NK0A 3BM7A 1WKJA 2QE5A 1GXLA 4TY8A 5CYQA 2ZVSA 1FJGF 1ZTTA 1A7GE 1TVRA 3MGJA 1N4LA 2NXUA 2L9NA 1YJTA 3K5LA 2F65A 5KT7A 2CYYA 3DGPB 1JXEA 2JLEA 4P2MA 5LMUJ 1LK5A 1K9MT 2RRBA 3EXYA 1AW0A 1XR7A 1ACMB 2PN6A 1XJWB 2JEJA 2ZHBA 5C25A 1WWHA 3K8WA 5HVHA 4KSEB 4IQXA 4DV1J 3MEEB 4F8RA 2VDHA 1Z4UA 1FRJA 4WP9A 2BQRA 3GWCA 9ATCB 3UVJB 1LQ9A 3MPVA 2HVZA 1YBUA 1UVKA 2YNGB 5L8RC 2NZCA 1FKPB 3MPYA 4CH7A 1WHWA 1L5UA 5IT9U 1RTJA 3QZ8A 2ZH7A 3V6DA 4B3SJ 3JSYA 4NCGA 1T9YA 1QVGR 2ZBCA 4OZ0A 5J2QA 1RWMB 4LREA 2XMKA 1D8YA 4OL8A 1BQNB 1Q5VA 2VHGA 2OUGA 5HATA 3AOCA 5F8GA 1U4BA 2KFYA 2W9AA 1H72C 2OMLA 1WHVA 3JQJA 3A8EA 3T41A 1AFIA 1VRUB 1N0UA 4F26A 3V4MA 1WSRA 4KH0B 1VQ5S 2JC0A 3SDEA 2DR5A 4ZIWA 1NK6A 2VV5A 2DY9A 3HSGA 1RT3B 1B7YB 5KT4A 5IOLA 4OYWA 4KTQA 4RNHA 3KHGA 5EX0A 3CB4A 2QSWA 1JX4A 4IFVA 4DLGA 2E1AA 1RAJA 2XULA 4NXNJ 3T1HF 1S7HA 5K14A 2MYFA 2CJBA 3QRQA 5J2PA 4ED3A 3K57A 3JS9A 4FVMA 2KM8C 3IBWA 2V9KA 1J5OA 1QVFR 3RBDA 2FPHX 1R43A 2EG2A 2QT7A 2G9OA 4ZN1A 4HDHA 4M5DB 1L3KA 3M1VB 1JK9B 3DC2A 1QAYA 3RRKA 3EICA 1UWAA 3P49B 2FD2A 1CSJA 2GS8A 2JL9A 1B70B 3ET6A 3BQ2A 1FFWB 2UP1A 1VRTA 1Q8IA 2IY5B 3MR2A 3CT9A 4PUOA 4ATNA 2XGPA 5BYQA 3WX8A 1Y7PA 1YSJA 4ELVA 3CCJS 1QUPA 2G1DA 2IRXA 5I3UA 5CYMA 3SQOP 2D69A 2UUBJ 4OHXA 2L3MA 1R0AA 4QWAA 3OSPA 3KJQB 5T7LA 2QA1A 1RWPB 2B5JA 2HMIB 4RUHA 3PO5A 2GAHC 3CDAA 5E3RA 4ALZA 2BM1A 1CS4B 5E3QA 4NMXA 4EFAC 5F9LA 3RUBL 5AT1B 3C15B 1SJQA 1XNQJ 3OBIA 3UPFA 3UN2A 3DNCA 1WNEA 3J7AN 2OD6A 3AHPA 5IQQA 3FDSA 4ECSA 2C2RA 4WFAQ 1K1QA 3HM9A 4YR0A 2DY1A 5KFMA 4KPYA 5DETA 1NJYA 3H4BA 1OSCA 3M7VA 3QRPA 1Q8BA 4OYZA 4H4OA 1YZ7A 1PBAA 4A8KA 5G0RA 1N33J 2LU2A 3CJKA 5CH7B 2CVEA 3JAMY 2AU0A 2CUYA 2X7IA 2R7WA 3DU6A 1U2FA 1U45A 1NKEA 5LXRA 2CG8A 1BQMB 4OZJA 3IR7B 2J7WA 3AT1B 4PWUA 3THTA 4X64J 4C0OC 5DG7A 3ZZYA 3K58A 4KO0A 4Y6IA 2AWZA 3KKFA 2FVSA 5IWAJ 1VQNS 1KP6A 3QATA 1RT2B 3DDNA 2W1BA 5HI7A 1PSDA 4NLPA 4GO5X 3PVXA 1FNXH 4B08A 4YB7A 1X5OA 5D0HA 2V8HA 3MAQA 2F1FA 3EWGA 1S4FA 4QWDA 4FBTA 1Q4RA 3TVKA 1DTTB 2ILYA 1UFLA 4I6YA 2YNIA 5E41A 2R2RA 4R0EA 2LQJA 2XMUA 3Q2SC 1GQEA 4RL1A 4X65J 3ZZ0A 4B3MF 3QPIA 3MPWA 5HP1A 1Q78A 3BH7B 4BC9A 3KHLA 3JSMB 2W4CA 1TQLA 1RBOB 1VQ4S 2ZM6F 4H54A 3PRVA 3LP1B 2QLJB 4Q2LA 1JLBA 4JYAJ 4XO0A 4JOUA 4B9TA 1R8AA 2DR8A 3ENWA 3W3SA 4B02A 5LOQA 2G4BA 4PG6A 3UW1A 4P2SA 1MROB 4AE5A 1XMQF 3B54A 4GVBA 3O1LA 1RKIA 1Y11A 4Y0FA 1IBMJ 3UI3A 2MQPA 1TKXA 2YWGA 1EHWA 1OIAA 2J9DE 2XWYA 1IBKF 5I3PA 1JLCA 3UFCX 3EUNA 1RU2A 1Z2ZA 4FN5A 4P75A 5LMNF 2HHWA 2BM0A 2DH8A 2CQ0A 2DCLA 4LIWA 1RTDB 3HKZD 5T14A 3G6VA 5HBMA 4KHPF 1URRA 4CT8A 1CJTA 2LXUA 1FRLA 3M8PB 4L6V3 5AXMA 3QFWA 4QR0A 3NGDA 1RTHB 3M9NB 1IR2A 4PXDA 1QAXA 2KDOA 3CJQA 1BC6A 2KB2A 2YKNB 2HQCA 4WTOB 3M2RB 4RW7A 3ONQA 2NXNA 3G9CA 3OLAA 2ALZA 1I94F 1Y10A 1NK9A 3E51A 2DCUB 4UQGA 3A8KA 4QBUA 2ZZTA 2HG4A 2CQBA 4IFYB 5C24B 2D41A 2D3UA 2V8VA 3MUTP 4PR6A 4OHVA 4Q2MA 2MTLA 2VBZA 4WK1A 3EYZA 2CPIA 2CPYA 3ETMA 3TW0A 4UTGA 1U0HB 3IGNA 2E7WA 3CJ4A 4G1QA 1X4EA 3CDWA 2VZ9A 2NS1B 5L1JA 4MTPA 1HNVA 2VQEF 3S6EA 2DPIA 2XTJP 3IO1A 3M6UA 4TKTA 2MJUA 3J80U 4JI5F 3ZTOA 1NJIT 4ZMMA 4J9KA 1U25A 3US5A 4ZOSA 3VZHA 1RADB 2DEJA 4AT1B 3Q22A 3I5AA 4QYZJ 2FHKA 3CW2C 3IM8A 3ZZUA 2LXIA 1CC7A 4WE1B 3G6YA 1YRUA 2HHPA 3BN7A 2E9TA 3GFYA 4ES1A 5CCLA 5DLFA 2H5JB 2BJ8A 2ZKTA 3MWBA 3M6XA 1FJGJ 5DLGA 5C25B 2GIFA 3T6BA 1M1HA 4UY85 2A10A 3HHLC 4OLOA 2I2YA 2OIHA 3MM7A 3PJWA 1WC6A 2AYGA 1RHRB 3PW2A 3U27A 4RR5A 4LBPA 1H7XA 3WIUA 1C4AA 2HQGA 2ZC3A 2ZITA 2IRUA 3G87A 4LSNA 1Y5NB 3DOKA 2EXUA 3JSRA 4U7CA 1RTJB 4DV5F 1WDDA 4NCGB 2V5HG 2YKMA 5LXYA 2IYGA 1HIYA 3FCHA 2VBWA 3EE3A 4NCAA 1LW2A 3HHKA 3MM9A 2E5IA 1UWBB 1HA1A 4GMKA 5KT3A 1KQFB 1M5KC 1ELOA 4NXMF 5HLFA 2BMBA 4JV5F 4LT6A 4IOCQ 1RT1A 2E7XA 3Q8UA 4A8MP 5KFAA 1NZAA 4G6VB 3KXDA 3SDEB 2DT9A 2A1BA 3VAKA 1C1BA 3RR7A 4CO3A 3M2UB 3SCJE 2OP5A 2QGFB 1V3SA 2HBQB 2HWTA 1JLEA 5IXUA 5MLCV 4HT7A 4NWBA 5HMYA 2JC1A 3W1YC 2J0XA 5K14B 3CDBA 3MEKA 5J2PB 2VF3A 5BR8F 1HYSB 3QJPA 1U0SA 1KSPA 1J5OB 4F04B 3TZZA 5LJ3Y 4OQJA 1T9TA 1MSWD 3H25A 5HROA 4I64A 5IS2A 3P4UB 2LMIA 1D9FA 3OTDA 4NA1A 1MN9A 3P45B 3DXSX 1Q7LB 1SQEA 2AX0A 1FEEA 3T1HJ 4ZVSB 5SUHA 3ZNUA 3QGHA 2M7SA 4GKKF 4ECYA 3BO2A 3KLGA 4DG1A 4PUOB 3AFGA 2XZDB 1N34F 3CJSA 1GMWA 2BA9A 2GO9A 3NS7B 4NL5A 3OLBA 5E3CA 2M70A 3M30A 5H9EJ 4A47A 3MR5A 3H5UA 5I3UB 5CYMB 3MHYA 1YTYA 1S6QA 3V4IA 1R0AB 1SBRA 3HF5A 4P74A 1IJEB 2H54B 5T7LB 4DZ6A 2B5JB 1X5PA 4JB8B 1DURA 1M0SA 1WI8A 2PO4A 1VHIA 3IBFB 3FBEA 1QSLA 3FSIA 2CQIA 2ZJPQ 2POKA 4PCQA 4OI2A 3GFHA 1RAFB 2UXCF 3R1HA 2HHUA 4EK2A 1RWVB 4DV2J 5DDOC 3F44A 4OZNA 4OI6A 4OI3A 3AA9A 2HAFA 2FJAB 4H4OB 2HURA 3RTVA 1S9FA 1WC4A 1R7IA 2V50A 3I0SA 4C2MA 3D1HA 1NJZA 2E29A 3CJKB 1IKVA 3CCLS 2DR9A 4Y65A 4FNHA 3HSJA 5T41A 3DFEA 3MEDA 4L76A 1ICEB 3W9IA 2F8MA 2J8SA 2IBOA 4UUXA 5I4MA 1S0OA 2DNMA 2Y9HA 1RHKB 2XMJA 1P27B 5FLXU 4KO0B 2RQ4A 2QV6A 1Y0HA 3S7RA 3KJVA 4YS2A 2YKAA 7FDRA 2HVEA 3CCES 5THWA 3L4BC 2I8EA 3O6QA 2WBRA 5BJRA 3IA0A 1NHVA 1HHTP 2AYMA 3D68A 1W2IA 4TVAB 2B4PA 2WTFA 3RB4A 4F4KA 4FVCA 2OMOA 4CH0S 4X4NA 1CG2A 2YNIB 2GCFA 2HQFA 3QBCA 1D09B 1Y3KA 5KFHA 1MWZA 3KUEA 4Y00A 1YWXA 3MCSA 2V0NA 1PO6A 3POTA 1PYOB 2GZOA 4KHMA 5J2MB 4ECWA 4V19X 1FRHA 1FERA 2LQ9A 2RF2A 2WCXA 3KLFA 1CVJA 1JLBB 4L75A 2P9EA 5KG6A 4ZPAA 3J81Y 1SL2A 5ETPA 3IP0A 4C8MA 1LKZA 4Z2XA 1K8AT 2CFXA 3MDFA 4M5HA 3PHEA 2RSQA 3HLUA 2FHJD 1YITS 2BANB 3H2VE 2G0CA 3PFEA 4J9PA 4P7TA 3TRGA 1S0NA 4X84A 2YXLA 4LF6F 3ZZZA 2QMUB 3Q8PB 5HBMB 3CEDA 4PWDA 4ID5A 1S6UA 2W9CB 2GAGC 2YTCA 1TAQA 1N36F 4PG7A 4RU9A 1KQKA 5GAGI 1KHWA 2DBBA 3OTCA 2HBZB 1IBKJ 1Q81T 1Q0NA 4JI6F 1DBDA 2OO4A 1M5VC 1DFDA 5LMNJ 2C2DA 2CXEA 2MKHA 4LF5F 1RI7A 3C8YA 4OFZA 3HD2A 4KHPJ 3NRBA 1RWOB 3ELHA 3MM5B 2C3UA 4V19J 2U1AA 1CJKA 2D9PA 4NI2A 1SL1A 3I32A 2YNFA 1FWKA 3KLIB 1VBXA 2F5GA 4EGLA 2VBXA 2L9WA 2Z2YB 4RNFA 4MIWA 4G1QB 2RKIA 5KG4A 4CLLA 3SI8A 3AXKA 1VQSA 3LP2A 1RLDA 1CJUA 4O0IA 3AA8A 4ED7A 3R5DA 1TL4A 1JKHA 3HHLD 5A76A 3VVUA 4J9MA 1FXDA 4NA3A 4ED0A 3CCVS 3PR5B 4HEA9 3QIPA 3PY8A 4DFJA 1QE1A 4JI5J 4CWBA 4TQSA 3OR2B 2F4VF 3OXFA 1X4BA 3I4PA 4A8WA 1NB2A 2XYPB 3FQLA 1XK8A 2PD1A 1WDTA 2F3JA 3GU0A 3DRSA 3MM7B 1T9VA 4UOGA 2UUCF 1T02A 1F1BB 4ZCLA 3BGFA 2NUUG 2L9DA 3SIPB 3MECB 3RW6A 4LJMA 3I9V9 3NAHA 4DQRA 3LUYA 3HJFA 1NLKL 4LSNB 2M5YA 3DOKB 4K8RA 4J9QA 2PDAA 1I51B 4EUVA 3QGIA 2VPXB 4WWSA 2XI2A 2YKMB 5KT5A 3GILA 4FP9A 3BR9A 1IWAA 2A2DA 4ECXA 2K8GA 3SCLE 1RLCL 6AT1B 2AEFA 2G0IA 1QUVA 2ROEA 2CJKA 1FTRA 1NCLA 5KFTA 1SJ1A 2BE7D 1BE4A 1L3SA 3OSNA 2XO6A 4GC6A 3M8QA 1PBUA 2FY8A 2LLZA 3OVSA 3DLGA 1NBEB 4DV5J 1HMVB 3BEGB 4C0HA 1SIWB 5DDQC 2IIHA 3C14A 3B6BA 3MCOA 2ZBPA 1PJ6A 2ZH6A 1JLEB 5GAGU 2XBPA 3NBPB 1G4CA 2KU7A 4NXMJ 4JV5J 5IV3A 5HANA 3LGNA 3G6XA 2HNDA 4I56A 3K89A 1HPZA 2CNOB 2CVIA 2XMAA 2A6MA 3GJQB 4RU2A 2EI5A 4PG8A 3W5ZA 1HBNB 1FHTA 1AROP 2MQMA 1FRIA 3TJ8A 5K8NA 4I7FB 3ENAA 4KFBA 4Y3CA 3CJRA 2EWHA 1QLNA 4NA2A 2FJWA 2PI5A 1IM4A 1RWXB 2RHSB 2BRKA 2OGUA 3X1LB 4XAKA 4PG5A 1G3OA 1HBMB 2CZ4A 3D0IE 3UCUP 4JI1J 2CA9A 1DY3A 2N7YA 1TV6A 1JLGA 1HD0A 3KLGB 1X0PA 4N47A 1RB0A 4F4XA 1HQUB 3DRXA 2XS5A 4GKJF 1XR5A 4UQTA 4DPOA 2VG6A 3N01A 4OZ1A 1S1TB 8ATCB 3UNYA 2FZGB 5KFEA 1VQPS 3M30B 5K9FA 2VPWB 2KT2A 8AT1B 4ES3A 2DRDA 4YB1P 2F4FA 3H8YA 2NXCA 4GKKJ 4X4VA 4WPAA 1PAUB 3UDEA 3I82A 1JLQA 4R8UA 1B0VA 2CADA 2J0WA 2OAUA 1S49A 4UT4A 2JLGA 1Y4ZB 1JB0C 3D6TB 3MMBA 1YQHA 5KOXA 1X4FA 3W62A 2VB6A 4USTA 1U7LA 1GXTA 4M5KA 1N34J 3GG1A 3EZ5A 2Y8YA 3SEOA 3Q89A 1FKAF 2YWKA 1REGX 2M3DA 2Q6BA 5KFWA 5HQ8A 4Z37A 2BW7A 5D6GA 2YH1A 3DLEB 1C1CB 2HQDA 3TX0A 1FVQA 3DRRA 5D77A 3MAAB 4ECVA 2ZHOA 4HHUA 1X31C 3W61A 3K2YA 3D7SB 1FVSA 4EO8A 1KDNA 1C2PA 1FWLA 3SQGA 4FYWB 2NXEA 1ZTWA 3GJSB 4LSLA 1HWIA 3RYLA 4OHZA 4R25A 1UVJA 4G1IA 2COLA 3ICLA 2EFGA 3IN5A 2W7OA 1IKVB 2HQ3A 2B4UA 1UEKA 2UXCJ 1OJ4A 4ZK7M 2KRBA 3LO3A 3W2VB 4DPWA 2VOOA 4PPZA 1BD6A 3M9MB 1S7IA 5FIIA 4CI0B 3GCWP 2DTJA 1TL3A 2ABYA 2FYXA 3V2UC 4FBUA 2DKOB 1X4CA 3QSIA 1G6BA 1B99A 3FCVA 5A6PA 1PC5A 3FMWA 3NOCA 3CNQP 1SQGA 5KG7A 3HD1A 4HKQA 3ISZA 4MH8A 4DQIA 3LP0B 3P3DA 2VD3A 4OI1A 1SJ3P 4CNZA 4E0DA 4OYMA 3N0VA 3ENVA 2ASDA 5A2QY 5A0YB 4DF4A 1HNIA 1MMLA 1X5TA 1ZYQA 3LPYA 1VYAA 4C11A 2FIUA 1JMTA 3MMCA 3Q8RB 2GX8A 2WB1D 2N3LA 3G4SS 4URSA 1JLAA 3O44A 4D3HA 3SFUA 1RTZA 3POTB 1GH8A 3BF4A 4KBIA 3TAQA 1NO8A 5F8IA 3KLHB 2KYZA 1LWCB 4ZVRB 3FKBA 4FYVB 4F25A 4MKYA 2RVJA 1JJ2R 1IBCB 2DNQA 4I68A 1VGYA 1U48A 3KLFB 2DRAA 3GFXA 3WZ0A 2AD9A 1F9EB 3FK4A 3AOAA 2DHGA 3C6TA 3EZOA 3AQOA 5HN0A 4AUKA 2B8QA 1U1KA 2O67A 1EP4A 4C8KA 2DNPA 2ZDPA 1WTFA 3T1YF 4RW9A 2KVQE 1KQGB 3OR1B 1LWXA 4C8LA 4ICLA 1BLUA 4CLUA 3PO4A 4I2PA 1NK4A 1HWJA 4LFAJ 2DGSA 3A3OB 1F5CA 2OSQA 2JFDA 3OQ2A 5EWEA 4U8YA 1IBLJ 3WC0A 1F6TA 1N5YB 3VQSA 2XB2D 2WONA 1SC1B 2F63A 4ZP6A 4GC7A 5EWGA 2EBGA 2LU1A 3HSDA 4PWDB 2A2CA 3VAGA 1TL1A 1NAQA 3AB4B 5J1PA 2AZ3A 4FXVA 2BQ3A 4ZCIA 1TU0B 1ZPVA 4HACA 2EK1A 1IJFB 2W8LA 2MGZB 2J7UA 4QIVA 3U7JA 1JWWA 1YJWS 1YDLA 3CJTA 3CC7S 1S77D 4LF6J 3B82A 2GC8A 4YHHF 4ECZA 4M5GA 1CJKB 2QTWA 2Y0BB 2YNFB 3BS9A 3D1QA 2V63A 4QR2A 3WX4A 3J7ZT 3EX7B 2KKHA 3A4TA 1VDHA 1R0BG 5L1IA 3Q8YA 5K5MA 1KKHA 2R8IA 4O4GA 2DYAA 4F02A 2BEFA 3CMQA 1WTBA 3LP2B 3A8JA 4LF5J 2DGXA 2KZZA 1K0TA 2W9BB 3MM8B 5B0FA 2KG1A 4M5IA 2BBEA 3W8PA 2RU3A 4FKYA 2P9GA 3HSZA 1R3NA 2MQNA 3KG1A 2IHR1 1EAYC 1HNXJ 3EGVA 3FQKA 4ZP8A 1J5EF 2RDDA 3TEHB 1XNRJ 3TO8A 2V8GA 1S1VA 3R9LA 3OFHA 4E2FB 2IA6A 5EDWA 3UR3C 3QZ7A 3PKYA 3RB6A 1CC8A 3WIVA 2M8DB 4Q0BA 4EYHB 5K8MA 5KFFA 4OV1A 2ZOFA 3HP6A 2Z57B 2J0QD 2JJ4D 3GYGA 2QC3A 3U02A 1RT7B 4QYZK 2Z58B 1SXLA 4NZ0A 4LRAA 4KGMA 2OPRA 4MK7A 4C3KA 1Q95G 2CQDA 4FPRA 3NGKA 2UUCJ 2UVWA 1DZ5A 5M2PA 2EC2A 5KFDA 1OYDA 3MPUB 1JXVA 1RT6B 4J5OA 1O51A 2MQOA 1NPKA 3TAMA 4DEZA 5BYSA 2CPDA 2RUSA 5LSOA 4OYIA 2EC0A 3Q8VA 2GMHA 2B6AB 1RT4A 3BGUA 2ZVIA 2OHDA 3K5MA 3KLEA 4TXSA 2AP6A 3FRYA 2AGPA 3EPGA 1NEEA 3LWMA 1CBKA 3EVMA 1HI0P 5ETQA 2NSBA 1JXLA 3NMRA 4CIOA 1B0TA 2KHCA 4LRDA 1TK8A 2HNDB 3BGRA 2MLZA 2DR7A 1QTNB 4DV1F 3PG9A 3TJAA 2OKQA 2HFSA 2W8KA 2PT0A 2XC9A 1JJ4A 1EZZB 3ZTSA 4X66F 4ED6A 2V8DA 3TUJC 5KG0A 2R7OA 4CO1A 3DHWC 1S6PB 4NZ6A 4ZLLA 1T95A 3H0PA 2Z2MA 3CIZA 5B0DA 1W2BR 3QGGA 3R27A 4CLKA 1VQ6S 4CO5A 2GA7A 3U1MA 1I1GA 1C0TA 2C2NA 2IJRA 1VQYA 1H0HB 1XMOJ 4EBCA 1TV6B 1JJCB 2HGNA 3OXGA 2BJ1A 4B3SF 4USKA 4KV8A 1F5BA 4U7UD 1SJRA 3I5BA 3KDNA 2APOA 2FHJA 2HVDA 4PABA 3NCPA 1NKCA 4OZ2A 2OFGX 1S6OA 4DX6A 2ZOMA 3G8QA 5AXLA 4K4XA 2RRAA 4QR1A 3NXZA 1JLQB 4R8UB 3HVTA 2G2YA 5KG1A 2CPFA 2V4RA 3DU5A 2PSZA 2DH7A 3RZAA 5FLXY 1UFWA 3GJRB 4AXJA 1TL5A 3GV7B 3QO9B 2V6AA 3HMJG 1K73T 3FBCA 1WF2A 2Q66A 1SC3B 3L9ZA 5GADI 1SVDA 3DLHA 3NL0A 2WW8A 5KFXA 4YY3F 1N6QB 2MZJA 5KFKA 3PRBA 1H3DA 3PDNA 1FD2A 3KOAA 3H4DA 2B9WA 2EFOA 1CULA 4QIEA 1FDAA 1M5HA 3SQGB 3DOMA 3MURP 5KFSA 1HQEA 3OD2A 2N4DA 1QSSA 5F0UA 2HLUA 1U2CA 4ZPVR 1RTIB 1M5PC 1APSA 3CCZA 1WC0A 3I9ZA 4ELTA 1YJRA 3MR7A 1IKXA 1LWEA 1GMUA 3HHLA 2B4OA 3HULA 3MM6B 2GGPB 4DL0C 4IO1A 3CJ3A 1PAEX 4QWCA 1IKWA 3BSOA 3RU0A 3HX9A 5IZHA 1NJWA 4I4BA 5GVQA 2AYBA 3QJLA 2JH3A 4HT5A 3TA2A 1RBLA 4QJVA 3BKUA 5IM0B 1RYRA 1IKYA 5ETNA 1S5ZA 1SJFA 3T5HA 3AQPA 4IOBA 1XNQF 4C11B 1GMVA 3MMCB 2AJQA 2FQQB 3CE8A 1JLAB 3AXMA 3D6FB 3MUMP 3N5BA 1D1UA 1XERA 5GAHI 1QDUB 4EU0A 2L08A 5LSRA 4C8NA 2AEMA 3OHBA 5KFRA 3QYYA 2FB0A 3ISNC 4WTYA 1VJWA 4DQPA 1BY9A 4HHJA 2GW8A 2RB7A 4MFBA 1EP4B 1U49A 2J6SA 1Q53A 3OUYA 3MFHA 1D9AA 2DO0A 2ZNYA 1DHMA 4ED1A 1MG7A 1B4SA 2XYHB 1X9WA 3UD3P 1UMJA 4OX9J 2QA2A 4TU9A 4DR4F 4B17A 4K2XA 4MKAA 4HDGA 2LDYA 4Q43A 3B8HA 2CQ4A 3F73A 4M5LA 3Q8QB 1FWPA 3M32A 5EX3A 2MQQA 2CRLA 1D9DA 3DCAA 1B64A 4RW8A 1WC1A 5I3QA 2QX0A 3CD6S 4DR7F 1U6BA 5L1LA 2OPPA 2XHCA 1VQOS 3M4XA 1DJ0A 2QFIA 3MMAA 3TUPA 5GADU 2IBKA 2Q3PA 2VA3A 3GYXB 1R6YA 3PACA 4M95A 1CQNA 2EVZA 2E5LF 1NXIA 4PQAA 4I2QA 4O3RA 2V68A 4DWIA 3HHNB 3TAPA 4RUAA 1WHXA 1RHJB 3JYTA 2M88A 3M2VA 1V9OA 3L7PA 3VGSA 3NKYA 3BGOP 5RUBA 4EEYA 2I0XA 3P5TL 5HVFA 3Q23A 2I5JA 2GMJA 3IBCB 3FNNA 4JYAF 3E01A 4O4GB 4B9NA 1SCJB 3OHAA 1L3TA 3BKTA 2I1RA 1C0UB 2BOAA 1NDKA 4KGVB 4LF9J 1HHSA 2DGOA 1ZZFA 5ETLA 1WORA 2OEJA 1IBMF 2F7VA 1EQ0A 2PI4A 2MDAA 4WIIA 1U8WA 3H20A 4NLVA 1WOOA 2O01C 1S99A 2BKOA 4J9OA 2CDQA 1X4AA 5ETKA 3HVRA 2ZD1A 4WFZA 3N5FA 3M9OB 1S9GA 2FJEB 3MD3A 4AL7A 5F3ZA 1WJ9A 1S1VB 2RH3A 4YOEA 2DNHA 1JJHA 2UUAJ 3BDEA 4M5JA 1FF2A 4P72A 3LOUA 4Q0BB 2VJVA 2H5EA 2AEJA 2DB1A 1RSCA 5GAHU 3CF5Q 4CRJA 1J5EJ 3HZGA 3HT0A 3LGHA 1FFSB 3UD4P 4C8OA 3SCIE 3EVWA 2R7TA 5GMEA 2OPRB 5A8RA 2ERRA 1U24A 4DFMA 1SUQA 4L73A 1S9EA 1WI6A 2BUNA 3QRRA 3CDUA 4F3OA 5A8KA 2FC9A 4JBCA 4DSLA 1RK8A 2AZ1A 2QYGA 5A8WA 1ZOTA 3Q24A 1SKRA 2OELA 3SYZA 3MR3A 1WF0A 1XEZA 1S48A 4DN0A 5C42A 4ECTA 3OV7A 2ASJA 2HGMA 1FDDA 4IYQA 2IDEA 3GYNA 1ZS6A 4J7CA 2VIHA 5J2NB 2VFUA 3FEZA 2Y3YA 4WXOA 4H4KA 1RT4B 1MU2A 1D3WA 3D66A 3KLEB 2ZEJA 3PJXA 2HZAA 2JZ5A 4NLSA 2FVCA 4X4TA 5H9FJ 3A12A 2HFNA 4ZP9A 3GTYX 1RUSA 2X1BA 2XY5A 4LF2A 2KFNA 2FDNA 2BX6A 2P2CB 2YPZA 1HNZF 2N82B 3O2IA 4IUFA 1T03B 1WUUA 3BGRB 2OTJS 3PYEA 5F8JA 5E33A 1RQ0A 1S1WA 4OYBA 2ZUGA 1RAOA 2R2TA 3H2LA 5B08A 5B0GA 3HT3A 5JXSA 5AE2A 3FMBA 4TU7A 2XCAA 2GVDA 2WZ1A 3L7OA 4WFXA 2R42A 4OJGA 1C0TB 2IVFB 3BN4A 4X4PA 1OWXA 1TUGB 1Y9OA 3W2WA 4PPDA 4KV8B 2E5GA 3GE9A 4X66J 9RUBA 3NG8A 3TQEA 1EJ7L 3DOLA 4MYTA 1NMEB 2K1RA 4C8ZA 4NLTA 2IM3A 2KG0A 4G3IA 2EFVA 4TN2A 3TA0A 3BB5A 1AUSL 1RT5B 2MKYA 2LXFA 5F8MA 4NEYA 1KRPA 2E5HA 3TQ1A 1E6YA 4HI2A 1VC0A 1WOPA 2Y1JA 4ZDNA 4ZKAA 4CH1A 3T5KA 2NZ4A 1H73A 1N5VA 4WIQA 1VS3A 1I3OB 3NGSA 4DX5A 3V6HA 4PEOA 2ZC4A 4IG3A 4GRSA 2MPUA 4DL3A 1PC4A 3MTJA 3LTOA 1FJEB 2AJ0A 3C16B 3DGVA 3KHRA 1M1GA 1LEOA 4OJ1A 1VLOA 5KFLA 2KXNB 3BQ0A 2D3ZA 4WFYA 1B7FA 1NSQA 2DK2A 1CULB 2XLJA 4PYDA 3FGVA 4ZVEA 1HQEB 4KGXB 2BRLA 3PJ9A 3NS5A 3CTRA 2DNKA 1WG4A 4QWEA 1P9YA 4YY3J 4OV6A 4PAAA 3IRXA 4QOTA 5KFCA 1YZ6A 4QZVB 1A0OB 1TK0A 1LWEB 1U09A 3AH6A 5IC6B 2FLNA 4RLEA 1H6KX 1VI7A 2XHWA 2LEAA 1W7WA 1IKWB 5D0RA 4I6WA 1UVLA 2R8GA 2QLFB 1MMDA 1DQ9A 3C46A 2P6SA 2UU9F 4H4MB 4JI0F 4F36A 3T19A 4Y2AA 4QU7A 1VQLS 3QWUA 2R4FA 1EETB 4DL5A 3S01A 2QJ3A 1ZM3A 4BCAA 3MI7X 4IG0A 2OPQA 3T3FA 1U1RA 4DSKA 5HVGA 3PYDA 1YLXA 4LFBJ 4Y2CA 2QA4G 2ZH5A 2EK6A 4DV6F 2XY7A 4CLWA 1TELA 4K59A 5J1EA 3DYAA 4DV2F 2KFZA 1BWEA 1T94A 3V81A 1LNQA 3CIMA 3BPDA 2BE2B 1UW4A 3UDVA 3KK1A 4OZ3A 5E2QA 4X4UA 2VASA 1VBZA 4USIA 4KKOA 4RNMA 4MFBB 2HHHJ 4D3GA 2YX7A 2PIIA 4PXCA 1JNRB 4B9LA 3M8WA 2XLKA 2V2ZA 2CWKA 4ZITA 2R8KA 3I6PA 2QRRA 1YHQS 4Y2MA 4RPFA 3GIMA 2MZ1A 2ZNZA 1S0VA 2CJYB 2WB4A 3M32B 4NLQA 4A8XA 2RE1A 3V5RA 2VU5A 2ILZA 3F56A 5DDPC 4JV2A 4WKRA 3G82A 3R5GA 4RBUA 4FKXA 4C8YA 1HLWA 4DCJB 2CJ9A 2OPPB 3O8WA 1VOMA 3ILIA 3P6YC 1QAJA 4DR4J 1VISA 4FXDA 2WAQD 2KT5A 4FYYB 2ZH8A 1LOUA 2XNRA 5ETTA 5IFMA 4W4MA 5E3AA 5HMZA 3DN9A 4LR8A 4NLWA 1NH7A 2BKPA 5B0AA 1EIYB 2V2KA 4O4RA 4DR7J 1SKUB 2IPOB 4ED4A 1S1UB 2DNRA 2Y1RI 2QL7B 3OTOF 2JVOA 3JTPA 4WU2A 5G4DA 4ES2A 2CZVC 3Q83A 5JUMA 2I5JB 2QMWA 1ZM2A 3SZ2A 4N76A 1VBKA 5K20B 3E01B 1WEZA 2ZHAA 1RE1B 2IAJB 2E5LJ 2PA3A 2FJVA 3FCWA 4PYAA 1ZAXA 4DR3F 3DGPA 4CTAA 2AGQA 3TI0A 3J7Z5 2G0JA 3ZC4A 3ZO7A 2XY6A 2RQKA 3CCTA 4BWMA 2HS0A 1SJ4P 2H51B 2M8HA 1SKWA 3HI9A 2XWXA 4C9DA 4U9RA 3MEEA 3VCDA 2VBYA 2MKSA 2ZD1B 2J6TA 3PV8A 3GLJA 2XS7A 1GK8A 3UVJA 3R5CA 4ID8A 3DRPB 4TYBA 1U02A 1OY9A 4NOHA 3TZYA 2JLFA 2J76E 2HHQA 2CNLB 3BBBA 2BE9B 1FKPA 5DG8A 2ZH4A 2C22A 1G1XA 1RU1A 4ETXA 4EMDA 2V9WA 2RD5C 1H38A 2AX1A 2MHNA 1RAGB 4MJKA 1OYEA 5KTQA 4O44A 3W9HA 3MD1A 3VWSA 4ANCA 4Y34A 4C97A 4MAKA 5DGBA 3EJMA 4K4SA 2H3EB 5AJ3F 5HQLA 5A8RB 1SUQB 3ZZRA 1BQNA 3VVTA 2PE8A 2OI2A 5HO4A 4PRFA 4WYWA 5A8KB 1YBTA 3AB2B 1HW8A 2IMOA 4DR6J 3N79A 5KG3A 2LA4A 2V4JB 4UOFA 4CQ1A 1VRUA 2F8HA 5C42B 1H98A 3MTKA 3BQ1A 2P8IA 4ZPWR 1DLOA 5BYRA 1RT3A 1RISA 1CJVB 4DS4A 1W25A 5DO2A 4EBDA 4NZ7A 1MU2B 3UD5A 3R1LA 2HIQA 4ZLPA 2K7JA 2EKYA 1UKUA 3KJFB 2PC6A 1FDBA 1KTQA 2MLYA 1NM2A 3CJ2A 3VAHA 2AV5A 5D0EA 3X3UA 1YI2S 4ZPTR 2A6OA 4RW4A 4U7UK 4TY8B 3H5XA 5CYQB 1ITPA 1HHQA 2LA6A 4CNYA 4MYUA 1KFDA 1RWUA 1RABB 3SXLA 1TVRB 4B3TF 4B3RF 2BABA 4DR5J 4M5DA 4X4OA 2CQ2A 2AJ2A 1UJ6A 1S1WB 2W4PA 1HI8A 2GHVC 1TUVA 1FRXA 5E0OA 4P2XA 2DNYA 1Q8KA 2QZ8A 4PZVA 4GVLA 5KFPA 3CCQS 2MEWA 1RHMB 3G71S 3H40A 1HNZJ 5HJYA 1P1LA 2BW2A 3CXCR 2HFUA 4I6AA 1U1LA 1YBAA 2Q43A 2BACA 4JI7F 2RHQB 3EGNA 3W2WB 1T3OA 1T9XA 1TAUA 1N54B 4DPUA 2P9CA 2Y8WA 1FCAA 1CLFA 3UNGC 3OL6A 3VV2B 1RAIB 2HMIA 3MXHP 5KFVA 1PJ7A 1NK8A 2KJVA 1S0MA 1FFGB 3CSKA 3V6DB 2AMCB 3IWXA 4HH0A 3FZBA 1TKDA 4AD6A 5J2QB 2KXHA 3BDPA 1E6YB 2V34A 2ZJRQ 1Q82T 2OPSA 3WDOA 5F8HA 2C3PA 2AJ4A 2HRTA 5E5NA 2GQQA 2EPIA 2UUWA 2ZUAA 3BSNA 2K7KA 3K8VA 4IG3B 4RX6A 5HSPA 5L38A 4YQWA 4ZA1A 2Z8QA 2YQ1A 5LSLA 1F0XA 4LQ9A 1CPZA 1VIOA 4I0WA 2BYCA 1FO1A 4U6PA 5DZ7A 1EQMA 2NLWA 3NMAA 4USUA 4PWWA 3V6JA 4FF1A 2E9ZA 2YH0A 2M2BA 1AXQA 1VLYA 3PZPA 2WOMA 4IFVB 2FLLA 2KN4A 2MXYA 1LV5A 3MOZA 3W5YA 2PGCA 4JI1F 4ZVGA 2MSTA 1YKWA 1KS2A 3WC2A 4DL2A 3C66A 2CJQA 4X2BA 4LF1A 4KGKA 1F5AA 3MUVP 4DDFA 4R0JA 1RDRA 4NRTA 1TKZA 2LECA 1SPBP 4L3NA 1NRKA 4CM2A 3FEXB 2FVRA 2NUHA 1FX2A 2DHAA 1KTVA 3NWGA 5KFZA 1P8GA 3ET6B 4RZRA 4CCHA 4P10A 2YKPA 3EDRB 1FXRA 1VRTB 4K4YA 3SSRA 2OPQB 3I96A 4F7VA 2BDPA 2DNZA 2UU9J 2CDRB 3JSMA 4JI0J 2DJWA 2VUGA 3LP1A 5J1EB 4W92B 4M94A 5KFBA 1TKTA 4LR7A 4XTTA 4QPXA 4IR1A 2RIJA 1OQ3A 3MCMA 4UZBA 3O3LA 2E44A 1QM9A 3K5OA 3HO1A 3KK1B 1MROA 1NSPA 4DV6J 3QWPA 5D15A 4LF4F 2HFOA 4F0KA 2C2OB 4QQBA 2R7XA 3LW5C 2WHOA 3I87A 1IUJA 3R5BA 5D4LA 5KFGA 1FRKA 1RTDA 3OW2R 4F4AA 2ADCA 4ZPCA 3JTOA 1JIHA 5LJ5Y 2KYXA 1Q5YA 5HMXA 1VQ7S 3Q86A 2DIUA 5IC4B 3M8PA 1ZBTA 2DGQA 3BREA 5G0RB 2RMLA 1RCXB 5MAOA 2BOPA 4NE9C 4JI8F 1NK5A 1SL0A 1AT1B 1KEKA 2YKNA 1HWKA 1GFWB 3VALA 1S4EA 3CO0P 4NYPA 1R8HA 3TA1A 3G82B 5CD4A 5DM7Q 1T3NA 2PFDA 1M5SA 2MY8A 3Q0AA 4DSJA 2HZVA 3D54A 4YR2A 2VC0A 4J9NA 3IWLA 5DRKA 2H48B 2MZQA 4L3KA 4IFYA 3M8RA 5C24A 5D4OA 2LVWA 3D2WA 3IR6B 3JQKA 3CCUS 2R7QA 2XSJA 1ROFA 2R9LA 2QYCA 2GQCA 2RS8A 1U47A 5SZTA 2W2OP 5DS7A 3M8YA 1AUDA 3ZZTA 4B3OA 3TVYA 3R7SB 3U1NA 4Y2KA 4K4VA 1UAWA 2R3VA 4PXBA 4DV0J 4RNNA 3LPEA 2YY3A 4PKDB 5HQMA 3IWNC 5JMNA 1G2EA 1WELA 1H2UX 5IV4A 1F9HA 1HI1A 4DL7A 4G65A 4ZVQB 4CTAB 5HP1B 4Q44A 3JQMA 2LQ8A 5DG9A 4WE1A 3OTOJ 4KH1B 1BXNA 3ILJA 3L95X 3FSXA 4LFAF 4EYIB 2EKNA 2HSEB 3ZTRA 2DH9A 1P9QC 2JVRA 1IBLF 2C1EB 3NCQA 2D3O1 4EZ6A 4B9VA 3N4WA 4K2JA 1S59A 4DR3J 1YGYA 1SC6A 1S1XA 3GCXP 1AB8A 1V3ZA 3A3PB 4GVBB 1Q1KA 4DFPA 3QAUA 5GMKa 3T9NA 2ZH1A 1NK7A 1R31A 2CPZA 2MZSA 3FVYA 5L46A 1TKXB 2HRYA 2V2QA 3BO3A 1JLCB 3M05A 2HS4A 1PKUA 4P52A 3NCRA 1NDCA 4M63A 2X51A 3K59A 2IJFA 2ROPA 3DM2A 4XDCA 1EKSA 4O44B 4MKVA 2QEXS 4F3MA 3LAMA 1CJTB 1SB6A 2KO1A 3GB0A 1NUEA 4JI4F 2LEBA 2FC8A 3GJTB 4ECUA 4Q45A 1BHNA 2VA2A 2H65B 1DQAA 1UWBA 2ATLA 4RW7B 3R7BB 1R27B 4ZLNA 1VQ9S 2B8PA 1Q7YT 3L3CA 1K47A 2C2EA 1TMMA 1F60B 1K1SA 3R5AA 1F2HA 1DLOB 2AW0A 4BBYA 3BBFA 5KAKA 3M2UA 5AJ3J 4EO6A 3ADAC 1HFEL 2DNGA 4DUZJ 2N7CA 2B4VA 3H59A 2B0GA 2DHSA 4KHRA 2O3DA 2QL5B 1HNVB 1GX5A 2GFFA 3TZXA 1FT8A 1RJJA 4RW4B 1RGVA 1HNXF 4U96A 1HYSA 1KR4A 5JJBA 2RU9A 1KFSA 1AA1B 4EBEA 1VHFA 1XNRF 3LWLA 1KLMA 4UW2A 3I31A 3H7HB 4NMLA 1JLFA 3ZZOA 5IT9Y 2G13A 4OJ3A 1NB7A 3FRZA 4KT0C 3LA0A 4F3QA 4TU8A 4O3NA 1EARA 4JV0A 3VAJA 1MN7A 5D0GA 3BJYA 2PMWA 5E3PA 3UO0A 2Y1IA 3MAHA 1T8EA 2AHOB 4IH5A 1KVIA 3KG0A 4YB6A 4B3TJ 3NS6A 4B3RJ 4C6AA 4NCBA 4TNOA 4NLOA 3BZQA 2ZOGA 1FE0A 2WBMA 5H9FK 1IQZA 4NEZA 4K4WA 3PR4A 4RNOA 3W65A 1VQKS 4CLYA 1O8BA 3VF0B 2W2MP 2KVIA 3A13A 4DUYF 1UA0A 1X4GA 3T6JA 3IC1A 4F2RA 2AJFE 4JI7J 3IAS9 4RKUC 2YX4A 3BSCA 2BKNA 4O3OA 3AJDA 4K4TA 2YX1A 2HS3A 2F8EX 4A4JA 2OPSB 3B4DA 1NZ8A 1UZHA 1LW2B 3MM9B 1MWYA 5HLFB 4F0HA 4USHA 1RT1B 4UF4A 3DDIA 3BO4A 4CLTA 3OT9A 3PNIA 1C1BB 3TUZC 2C3MA 1FTCA 1OMSA 2BXJA 3CVKA 3N6MA 1VRQC 5GAEI 2DXDA 2FGOA 2E1RA 2NYIA 4QPTA 2HPUA 4A8FA 4P6QA 3GSDA 2WOMB 2W24A 5J1NA 3GR0A 3IGVA 3UQSA 1RA7A 4ANDA 3AD8C 1XMOF 2I6WA 1UVNA 2ZZNA 2YNHA 3QT7A 2YWFA 3MR6A 3MPDA 4ZPBA 4NRUA 3OL8A 1GX6A 1OO0B 3OFGA 1VBYA 5LL6d 3IG1A 5HROB 2KTQA 1HR0J 1TKZB 3G8TA 1U1OA 3KK3A 1NNDA 1K0VA 2E1MC 2IM2A 3OFEA 3OTEA 4CM0A 4DL4A 3TP2A 4KYZA 3ULHA 4C48A 3UR0A 2NR0A 2K3KA 4DV4F 4W98A 2B9XA 3CCMS 4DG1B 2BJ9A 3BR8A 1YIJS 2DO4A 2CPXA 2G2ZA 4CZCA 1X5SA 2PEBA 3D0HE 4S0MA 5J2MA 2CJXB 4F4WA 1S6QB 3V4IB 2HNYA 1PIEA 1TKTB 1B3TA 3O5TB 3PW7A 4DFKA 4LFCF 5LT5A 2MKKA 2ZH9A 4DI6A 4OZLA 2DPJA 2BQUA 3OXLA 4Z7YA 3GONA 4Q8FA 1W26A 2DR6A 1DQ8A 2ZH3A 3A1YG 4DV7J 5A2QU 2DHXA 5DJBA 3GG0A 3RAQA 2BANA 4TLQA 5U47A 3MOJB 4DL6A 1I6JA 4OX7A 3RBXA 2JHEA 1N88A 5AXKA 3GV8B 4TY9A 4LF8F 3PYFA 3MFIA 3G2XA 3LQVA 3KLVA 2HBYB 5C2CA 1SC4B 3I0SB 1PGZA 3NLCA 3J7A1 2W9CA 3KWMA 8RUCA 1AZSA 3UN5A 2ACMA 2DXFA 1UJ5A 1U1PA 1TTHB 2CNKB 1H2VZ 4LF4J 4JI2J 2RNEA 4R5PA 1VIXA 4USJC 3MEDB 4IH7A 2R7RA 1RA6A 1V5VA 4X4QA 3DDKA 1MWQA 1X7VA 5H1SV 4P71A 2DNNA 2VPYB 2D74B 1HWUA 3MM5A 4DJBA 3OL9A 3KJVB 4DQSA 2XSJB 4JI8J 1N0VC 5CAAA 2LQ5A 1FRMA 3KLIA 2W2PP 3LANA 4DX8H 2N3OA 4IDKA 1IQTA 2J8AA 1MLAA 5GAEU 4NLDA 2GHWA 3RRGA 4B3OB 2WSEC 4AQYF 3I5CA 4WCEQ 4QW8A 4J9RA 4LRFA 3QAEA 2OLWA 4L72B 2LYVA 4YB5A 1T11A 2XGQA 3NWRA 5I42A 2EG1A 3CO9A 5KFQA 3L7UA 3KNGA 1QY7A 1U6ZA 2ZE2A 7AT1B 4OX9F 4C98A 3OR2A 2LQBA 4ZVTB 5ETVA 2RF2B 5KFNA 3DXBA 3K17A 3KDOA 4IRDA 1XN9A 3D0GE 3WBZA 1S1XB 1HKAA 4FS1A 1XC9A 3R97A 1JQGA 3NP5A 1TFWA 2XLIA 2C28A 2AIRB 2K2PA 4ILLA 3MECA 3Q2TC 3PW4A 3DLLQ 2ZWPA 3P5BP 3G96A 2R8HA 4NLXA 3LAKA 4K0KF 3DM2B 3FC9A 3J80Y 2QLXA 1N32F 3VAMA 3R6LB 4MK8A 3QFHA 4RBVA 2J9EA 2VPZB 2HVIA 4ID5B 3PIPQ 2O5DA 3VAFA 1XTZA 4DSIA 4JV1A 2WVCA 2W7PA 1KD1T 2WW4A 4C3LA 1NPPA 1NHUA 2MLXA 1KNZA 5FJ4A 3KNAA 2DRBA 1O5JA 2IVMA 3QQCD 2CQ1A 3JTNA 3DLBA 1HWLA 1HMVA 2MY7A 2B7BB 1KOOA 3I56S 3TNVA 4LF9F 3CUNA 4ZCKA 4JI4J 4LBIA 2GV1A 1KLNA 4NI2B 1X0FA 3SSQA 3NBPA 3GQCA 1ZA2B 2FLOA 2RKIB 1R8PA 3DRYA 3K5PA 1FD8A 5FD1A 4N41A 2XO7A 2ATCB 2BJ7A 1IN0A 1CJUB 4HHHA 1HBNA 1X9MA 1KLMB 3HFVA 3QJJA 2YWWA 1Y00A 4I7FA 1JKHB 1DTQA 2VG7A 4WKYA 1UZDA 1JLFB 2XI3A 2ZFHA 3EGWB 2UUAF 2AJ1A 2E7VA 4IR9A 3S1TA 2DGVA 2DXEA 3QIPB 1OY6A 1QE1B 1HBMA 4IRKA 4DMZA 1WG1A 3KK2A 4A48A 2RDIA 1HQUA 3TUIC 1HBOA 4TQRA 3LALA 2XNQA 5K8OA 4NASA 4KIAA 5HJXA 4URGA 2JDJA 2CPEA 4LR9A 4FF4A 2FTRA 4OX8A 1S1TA 4CT9A 5KOWA 3DRSB 4DCPB 3D3CJ 4LVOP 1YRTA 5L1KA 1S79A 4I69A 4I1TA 4YUDA 3EGZA 1DARA 1MW7A 2LP4A 7FD1A 3W66A 1F3VA 3HFKA 1WEYA 5F8NA 1RWKB 2RS2A 4ZHRA 3AJ1A 1WEXA 1LXNA 3PX6A 2DNOA 2ZBRA 2FJBB 4UZCA 3DLEA 1C1CA 3CC2S 3MAAA 1UEVA 5GMDA 2FLPA 1U1MA 4JI3F 1WKKA 4F67A 5DZ6A 1X8DA 4DUYJ 2IDLA 5A6WA 3M8QB 2RILA 3KJNB 2WVDA 2YQ3A 3QT5A 2GJ2A 3DLGB 3F0NA 2P6TA 3TYTA 1WHYA 2HZCA 2XMVA 2HWHA 4NX9A 3CMAS 1VK3A 2M4MA 1TR0A 3C14B 3W2VA 4O23A 2GHPA 2AT1B 3KMQA 2PEHA 1U8SA 4IH6A 2CZ9A 3K0JA 2KT3A 5ETOA 4OHYA 2H4WB 4ZS6A 2KI2A 1HPZB 5IQ6A 1LW0A 1U2RA 1DAXA 3IXQA 1UP1A 2Z2LA 2YNHB 4G1PA 2CG4A 3B4MA 2MKCA 1HBUA 2WRMA 3CCWA 4QCLA 4KFBB 2IVYA 4WFBQ 5EGYA 1FKOA 3WHIA 3LP0A 3IG1B 4RBTA 2VQFF 3KK3B 1LFWA 2VKZG 2KRRA 2OEMA 3HZEA 5JVGQ 2X1GA 4LF7F 2FZKB 5A0YA 5DDRC 4LQ3A 3TR5A 4KE5A 4DSFA 1JLGB 2L48A 5HK4A 4L74A 4FYDA 4UOCA 3GSIA 2ZZMA 3SBMA 2RAQA 4FDFA 2VG6B 2VFTA 1JNZB 3VTIA 4TYAA 4H4KC 2NPFA 4ZVFA 1IVZA 1WKLA 2CWXA 3KLHA 1LWCA 4XK8C 2JX2A 2Q6CA 3AJ2A 3HVAA 1HARA 2RRNA 4DHVA 2H5IB 2HNYB 4KC5A 4XPCA 1X4DA 1P1TA 5LM7E 4DV4J 3NY0A 1K44A 1MNEA 3GIRA 3MMBB 2AQ4A 4B3MJ 2FHMA 2EBEA 4EI2A 1H7WA 1R0CB 2VFVA 2HNZA 3OR1A 4MK9A 2UXDF 2QG9B 3SFGA 4AFFA 3IS9A 4OJHA 2V2VA 2R2UA 3AD7C 2F40A 3HCXA 2ZM6J 2VH7A 3FJ2A 4J9SA 1PYSB 4BHQA 3DRRB 2QL9B 3VHQA 3QT6A 4LFCJ 2O66A 3MMJA 3ZTQA 2KL8A 2YQ0A 2B9EA 1N5YA 1M1KT 2PMZD 3W7BA 1N5TA 3T1AA 1R89A 1YJVA 4DBQA 2KZMA 5DM6Q 4KPCA 1WF1A 5H9EK 2DGUA 4F4ZA 2I9SA 4A46A 3HXMA 2D9OA 1M5OC 2GIRA 4LSLB 1XMQJ 2WVFA 1AZSB 2V94A 3RAMA 2DNLA 1LXJA 1RCOB 4KY3A 3CJ8A 4R5PB 1F3FA 1FE4A 2Q1LA 1GNKA 5F3TA 3SV4A 2Q79A 4P73A 2MGZA 3W5XA 3ILOA 4QIFA 2YWHA 3P8BB 5KFIA 3DHXA 1KVJA 1YJ7A 4HLBA 3RG6A 2JEGA 3PX4A 1RWWB 4LF8J 1TL3B 1E6VA 1GT8A 4DPTA 2XSFA 4P9SA 2DITA 2VC1A 2D3OR 4KAIA 4ZVPB 4OYAA 3U1LA 1N5SA 2C2MB 1HQ2A 1F2GA 1NSAA 4NYZA 4LFBF 4MIBA 3OJUA 3D28A 4M5NA 4HL9A 3W8GA 4DR2F 3L09A 5C7PA 3D6HB 1LK7A 4DN9A 4IDKB 3THVA 3PIOQ 4LMZA 1ZAVA 3PW0A 3EDQB 2E1CA 1VQMS 2CKWA 1I94J 3H90A 2JWNA 2ZH2A 3KMSA 2W2QP 2MQLA 2UVUA 3SCKE 4GO7X 3ETOA 4Y28C 1HNIB 5ITHA 3RB3A 1RXOB 2V67A 3AAWB 2W9BA 4F4YA 3MM8A 2DVIA 3AOBA 2HK3A 2N4CA 4ZN3A 1URNA 2HHHF 2VONA 2BV3A 1S97A 2DGTA 4B9SA 5I42B 2VQEJ 2IA0A 1N48A 5KFOA 1A9NB 3FFIA 2ZE2B 2LFVA 4AQYJ 1UPPA 2HVHA 1V6HA 2CQ3A 2D1CA 3ZNJ1 4A8SA 4WFNQ 4C7QA 1UA1A 3C6TB 4DU8A 4DR1F 2MSSA 4HYKA 2C3YA 1U26A 1KVKA 3HJVA 4RW9B 2QO3A 4KGZB 2CPHA 2VDIA 1VFJA 1UEUA 3E3XA 1BQXA 3VGUA 5M2UA 4ICLB 1ZM4A 4CLSA 5HL7Q 4WP8A 4I2PB 2RQMA 1TMJA 2CPJA 3GZ7A 5KG2A 4Q5VA 2B56A 1RT7A 1XR6A 2KM8B 1D8ZA 3B78A 1Z2LA 1RWNB 1OQ6A 2AYEA 3R7NB 3UDLA 4V1Ak 2WONB 4YFUA 2XS2A 1OY8A 4NLGA 1TL1B 1Q16B 4F50A 2HHTA 3N6LA 3PW5A 6FD1A 3EXCX 1OPIA 1RT6A 3P96A 2CQGA 1OSDA 4K4UA 2E66A 1G7CB 4I67A 4HACB 2LEPA 1Q8LA 3CCRS 2XM3A 3K5NA 3GPAA 1HD1A 3D1OA 2ZDOA 4K0KJ 3EPIA 1N32J 4M8LA 1NDPA 1NJXA 3FZ2A 1IR0A 4DX7A 4ERDA 2B6AA 4AYBD 3CPWR 2FJDB 1VJQA 3D3BJ 2VICA 4B9MA 4QYRA 3CD0A 1RYSA 3RR8A 4YDXA 2CIMA 3PEJA 3RW7A 4FS2A 4HTIA 1WC3A 4LRBA 4DOZA 3CGIA 3E2EA 1C4CA 3H5YA 4O3SA 4ZIVA 4ENOA 2Y0SD 3QGPA 1YRXA 4QW9A 2HFVA 2XMMA 4PQUA 3PXGa 4YDDB 3H98A 1XBWA 1DTQB 2VG7B 1FNOA 4Q8EA 3TVZA 3C2PA 2AF6A 2DGWA 1XWLA 2GJFA 1S6PA 2G2OA 2LDIA 4J9VA 1U6FA 3H5SA 5F8LA 5DQGA 3DLJA 2QIFA 3DLKA 1Y5LB 4YP3A 2H4YB 2NYHA 3OL7A 1FXLA 3GIIA 2WVEA 5BR8J 2FY1A 3KK2B 2M9KA 3RGIA 1ZAWA 3Q8SB 1HBOB 4DSEA 3D4JA 1WC5A 2VL1A 2AKWB 1D0EA 4HVZA 1KONA 4CLFA 3I0RA 1N5QA 4J37A 1A6LA 3T5LA 3CDEA 5BXIA 1VCTA 2XEXA 4DR6F 3R2CJ 3D5MA 2NCKL 2HGLA 2IMWP 3BYPA 4NLYA 1S12A 3BPSP 4U67Q 2U2FA 4WK3A 3KHHA 2KJWA 2ZKUA 2VKRA 3MEGA 2H9ZA 1KBRA 2K3IA 3J81j 4LIRA 3QO9A 2UUTA 4M1KA 3JSBA 4ZHRB 4DPXA 1KN6A 1V5IB 5C5JA 4CO2A 1TZ0A 4X62F 1FI4A 4HTJA 3QIDA 1GXUA 4ZVHA 5AE1A 1N6QA 2RJZA 2EFNA 4ETZA 3NNHA 2HWIA 2QFJA 3HDSA 3TAMB 3TEGA 3IRWP 4A8YA 4YEAA 4YR3A 1SV5A 4J90A 2IYIA 1RBAA 4DR5F 2VODA 2MQ8A 1S10A 3CWJA 4HH1A 1TUWA 1CEZA 1RTIA 1WSVA 4ZVUB 5CZVA 4RW6A 2KH9A 1UVMA 2QLWA 3FBBA 3JXOA 3RBZA 2UXBF 4JI3J 2H1YA 4E8UA 4UUWA 2WSFC 2QSFA 4ZVOB 4RUCA 1T9WA 3KTQA 5CD4H 4EWTA 3MM6A 2GGPA 2OD4A 1LW0B 5EN1A 3TX8A 2ZJQQ 2DIVA 4N77A 2MB0B 1R8CA 1XMBA 2JSXA 3IAM9 5F9NA 1HBUB 2QLBB 2RUGA 1NU4A 3IM9A 1FKOB 4IRCA 2D7SA 3QNWB 1B0PA 5B0CA 3AODA 3TANA 5IM0A 3PEHA 3C3LA 2UV8A 4MKBA 3TJ9A 3HVWA 4FZVA 4O3QA 4USVA 2EW9A 3PX0A 4CO0A 4NLRA 5F41A 2DEIA 1YK9A 4RWWA 1XQIA 3CC4S 1Q86T 3M6VA 4AL6A 4ITSA 2VQFJ 3NAIA 2OSRA 4OYPA 1NDLA 2F9JA 3F41A 2XG8A 2IFXA 4LF7J 4IQMA 1FK9A 2X1AA 2X1FA 3NNAA 3HHEA 3PCOB 4OYOA 3BH6B 4DQQA 1KHVA 3PM9A 1YJNS 1ZM9A 1NSKL 4DLEA 4WU3A 3HVTB 2ACYA 2EFPA 2R7UA 2UV8G 4F0MA 3GR1A 5D3GA 3PYGA 3RRHA 1H74A 1PG5B 4YMEA 2HNZB 4LVNP 2B9YA 4E98A 1NKBA 2HHSA 1IWGA 3IS9B 5L9NA 3N6NA 3ITHA 1HL6A 2GMLA 1PJ5A 3ZZPA 2BJEA 5KT2A 2DISA 4MT1A 1UETA 2ADBA 5B7WA 2GNKA 1LWFA 2FVQA 4K7QA 3PKMA 4ED5A 1IM6A 2M52A 3J7YI 3DOMB 2ASLA 4ZP7A 3A3NB 1J27A 3QLHA 4DV3F 2YWEA 3GV5B 4NLUA 5IT4A 4OLPA 2UXDJ 3UCGA 4ELUA 1TK5A 1T05A 2C2KB 4FF3A 3HHDA 2IC3A 2Z2ZA 1VR6A 1X9SA 2MKIA 2JRSA 1IKXB 2GIQA 5CZXA 2ZBIA 4RO0A 3DI6A 1PILA 1E6VB 4XIUA 3HHLB 4ED8A 5EHHA 5HMWA 2NPIA 3MF5A 4YN3B 1QAIA 2M0GB 3MZIA 2W7AA 3KUGA 1N36J 1LFPA 1ZA1B 4ZJOA 2BJDA 2NSCA 1FX4A 3SSSA 5L39A 1VC6A 4JI6J 1HNWF 4XPEA 2X3DA 1PYTA 4N5SA 4OI0A 3NGTA 1YJUA 4ER8A 4LUBA 4LSZB 1VK8A 3BV8A 3QT8A 2GJIA 3IFEA 1IKYB 2Z4PA 3ISND 1C0UA 2BVZA 3JAMU 2BJ3A 3BSAA 3BGLA 4C0BA 3HFZB 2KHDA 2RDJA 1O0PA 3C6UA 4P7VA 1RACB 3GFZA 4FNIA 3D6MB 1UW9A 2OFHX 2HHXA 1RZMA 4DR2J 1REVA 2RT3A 3LH2S 4CDIA 2XYGB 1RAAB 2FVPA 2CJAA 1TL7A 4K5RA 2QA4S 5M2RA 5KG5A 3FFIB 2MKJA 3M8SA 3R2DJ 5EWFA 4LBHA 1BMQB 2BZ2A 4ZLJA 2VOPA 1FJCA 3GIKA 2J0SD 4J91A 2CQPA 1X60A 2UZAA 2LKZA 5CHCB 3R8YA 2FZCB 1VQ8S 5FDLA 2PA8D 1NHKL 2EEYA 1BWVA 4CO4A 3OUYB 3OPKA 1FNMA 5AXNA 2F9DA 2LCWA 2PFFB 3KUHA 5E7OB 2GQ2A 4CYUA 1IXKA 3I55S 3W64A 2F4VJ 1BGXT 4BWJA 2I38A 4ANEA 2HAIA 2GVZA 2C2ZB 4DR1J 3V6KA 1HW9A 3PHTA 3DMJA 2GO8A 2HIYA 2FGCA 5DGAA 4RW8B 2NXJA 5KFYA 2IM1A 1M90T 2FHOB 3QMQA 5D8HB 4HR2A 2VFSA 3BYRA 4OI4A 3MMAB 2B7CB 1FEHA 4WYLA 2VG5A 1WOSA 3VGTA 4DV0F 3K7RA 4RJVA 5B09A 4HI1A 2JEFA 1L3UA 1UFKA 3KFWX 5J2NA 3NOGA 1BUXA 3PFOA 2HRUA 3J7YU 1WG5A 3RAXA 2ROGA 4I2QB 1Y5IB 1QD1A 2FUG9 4XDDA 1J2VA 2UVRA 2C3OA 3EVOA 1UCNA 3PTWA 2HFZA 5LMUF 2HQIA 1UPMB 3JYTB 3M2VB 3LF0A 1EKRA 6FDRA 4DZDA 2WVBA 4PG4A 4WZMA 3VQTA 4ILMA 4N8NA 4MIAA 2OEKA 4KR0B 3G8SA 1FA0A 1GAOA 1T03A 1R6VA 3G6ES 1H2TZ 1OPZA 3OTBA 4ZPDA 1KQSR 1R8BA 2HHVA 1N8RT 3NEKA 1NH8A 4DUTA 4PQUB 4U95A 4UY8T 4DXLA 5CYJA 2OTLS 4OZ5A 2XMTA 3MCNA 3ZFVA 2AGOA 3W63A 4N8OA 3DLKB 1N56A 2W25A 1DRZA 2R8JA 5AE3A 1S57A 1OS5A 4J9UE 1S9GB 4CP5A 1GEHA 5ADZA 2E5JA 3FEYB 4DF8A 4A8OA 2P5VA 2W2NP 2YNGA 4BDPA 3I0RB 1ZH5A 3H2UB 3DKDA 5IT0A 2V4QA 3UE2A 2R7SA 2CQHA 1XIQA 4AL5A 1RT5A 4IO9Q 4DS5A 1VMBA 4WP3A 4KRWA 4GKJJ 3FBFA 3MEGB 2J9CA 4WBFA 3KYLA 1EB0A 4DUZF 2R7VA 3A8IA 4PXEA 1S9EB 2CAJA 4QIGA 3OVAA 1N52B 2RQCA 2MMYA 2J5AA 3ENQA 4Q7AA 1GTHA 2B51A 5A8WB 3SMZA 4NXNF 3N9UC 2BR0A 3C16A 4CLPA 4FF2A 3RB0A 1FDNA 3UCZP 4JUZA 2J7KA 1PCAA 1KC8T 1SV5B 3CCSS 3CJ0A 2MJNA 1KWMA 1ZZNA 2QN6B 3KG4A 3HKWA 2DD8S 4A8QA 2SXLA 3M6WA 4ZJQA 4RUBA 3BBCA 4X62J 3FUYA 5HAOA 4FXWA 3RJMB 4RW6B 3UN3A 4ED2A 1QTMA 3R6GB 2IRYA 3OJSA 5DQHA 4IKAA 1UTAA 5KFUA 2DHHA 2YBVA 4USMA 5ETSA 4O3PA 3M1VA 1RAEB 2HEKA 3H42A 5ETMA 4U8VA 4H4MA 4Z7CA 3TARA 4KB7A 4ZCMA 2UUBF 3NGRA 3UDCA 3EZUA 2CNNB 2UXBJ 2CQCA 2Z56B 4P2FA 1EETA 1RAHB 2IM0A 3I4HX 2GVDB 4FPIA 5B0EA 4EZ9A 2J9DA 2XMWA 4K50A 5K8PA 3HPOA 3NGUA 1T0TV 2WSCC 2ALYB 4Y2IA 2ASYA 5CQGA 3GIJA 3CD7A 2HLTA 3OVBA 5CA5A 4QWBA 5D4PA 1S72S 2V8PA 2E1PA 5KFJA 3VR1A 3DOLB 2W4DA 2QMXA 4FYXB 1U1QA 3EMTA 2E9RX 2K1RB 1YX2A 4DCOB 5JVHQ 1CS4A 1FK9B 4ZJLA 3C15A 3THPA 2BE2A 4NYOA 3PRDA 4JP8A 4WXWA 3VGVA 1T9UA 3W60A 1N33F 2YKOA 1SH0A 1YG0A 2JNJA 4OYXA 3GP9A 1VC5A 2XCPA 4OHWA 3IR5B 1P6TA 5D3GB 4DPYA 2Z30B 2OH2A 2VJUA 5CXTA 3JB9k 2ZWOA 2HYIB 3ITHB 1QJHA 4X64F 3FSYA 2K06A 2IJNA 2PMHA 1UL3A 1T7PA 5IWAF 1Z1ZA 3EM1A 1SQFA 1UJ4A 1LWFB 3UWTA 2G1HA 3TWZA 1Q79A 1YJ9S 3T1YJ 2JEIA 4C4WA 3QLHB 3T9ZA 3CMES 3OFFA 3HK2A 1HR0F 1BQMA 2V69A 4X4SA 5F0WA 1T05B 2W01A 2XQCA 1GTEA 1S76D 2IC3B 3IRXB 1IR1A 3W9JA 1ZETA 4WJBA 1CQMA 2B43A 3R3TA 1RT2A 3DI6B 4M5MA 4X65F 1ZPWX 4K5SA 1RHQB 4KJIA 3TZWA 4LRCA 3ILLA 5DQIA 4URQU 4DV3J 1TFYA 2O1PA 1ULRA 1S1UA 2J6UA 2ZBQA 2MZTA 3AD9C 2YVSA 3D9BA 3N28A 4WZQA 1V3RA 1DTTA 1SH2A 2JFKA 4BC7A 2HW3A 2FJXA 2MHEA 2IAJA 3M8ZA 4KQZA 2NQPA 3C19A 4IOAQ 4IG0B 3S8SA 3VAIA 4CLZA 4YHHJ 1RKJA 3C6UB 2HK2A 1L3VA 3E8OA 2VFRA 2X3GA 3RBEA 1SI9A 1UVIA 3NNCA 1REVB 2XZWA 1HNWJ 5EUHA 4DV7F 4F2SA 1TL7B 3GMGA 2A18A 2JOQA 1SIZA 4QU6A 4O0NA 5B0BA 2HKEA 2Z0GA 1O6XA 3DYAB 4UOHA 4MMOA 4RWXA 2OJ3A 3V81B 4C3MA 3ZTPA 4TLRA 4ECRA 4W90B 1Y3JA 2L41A 4J9LA 4BS2A 2YKQA 5L9XA 1SH3A 5D4NA 4OX6A 3DRPA 5FDLB 4KKOB 1RP5A 4JI2F 3WQPA 1SKSA 3G86A 4NPOA 4AXIA 4X4RA 1GMWD 4DU7A 5KT6A 2A0FB 3VZIA 4CYUB 4N56A 1WD6A 2EFQA 1F9FA 4B9UA 2KXFA 1AFJA 3QSYB 1U1NA 1RHUB 1FESA 2A3JA 3T5JA 2B3TB 4K4ZA 3CJ5A 4BLGA 2C42A 2GVZB 4ILRA 1NPRA 1RTHA 3CD5A 3CULA 3DMJB 4OIXA 1TP7A 3BKFA 5CABA 1X4HA 3M2RA 3R5JB 2XZTB 2NREA 1YVFA 2R2SA 2WK4A 2V4JA 3AY0A 5D78A 3J81U 1I5OB 5CCMA 3D67A 4WF9Q 2VG5B 3LGMA 2UVVA 1MMNA 2HBRB 4N7TA 4QIWD 5ETRA 2MZRA 5C2GA 1KOHA 1CJVA 4USWA 1FJ7A 3SV3A 3ZXWA 3TOQA 4OMFG 2Y1LB 4ECQA 1AYEA 1U0HA
chains in the Genus database with same CATH topology
3K2YA 5DDRC 4LQ3A 3TR5A 1WACA 1FVSA 1QSYA 4KE5A 4NOHA 4DSFA 1JLGB 4EO8A 2L48A 1C2PA 1NK0A 2JLFA 3SQGA 3BM7A 2J76E 1ZTWA 2HHQA 2QE5A 2ZH4A 1FKPA 5DG8A 2C22A 4FYDA 4UOCA 4LSLA 1HWIA 3RYLA 1G1XA 1GXLA 2ZZMA 4OHZA 4TY8A 4ETXA 4R25A 2V9WA 2RD5C 1UVJA 4G1IA 5CYQA 2COLA 1H38A 3ICLA 2AX1A 2EFGA 3IN5A 2VG6B 2ZVSA 2W7OA 2MHNA 2VFTA 1IKVB 1JNZB 1FJGF 1ZTTA 3VTIA 4TYAA 2HQ3A 4H4KC 2NPFA 1A7GE 2B4UA 4MJKA 5KTQA 1TVRA 4O44A 4ZVFA 3MGJA 3MD1A 3VWSA 4ZK7M 2KRBA 1N4LA 4Y34A 2NXUA 3LO3A 3W2VB 2L9NA 1YJTA 2VOOA 3KLHA 1LWCA 4C97A 4MAKA 4PPZA 1BD6A 5DGBA 4XK8C 3K5LA 4K4SA 3M9MB 2JX2A 5KT7A 2CYYA 2Q6CA 3AJ2A 5FIIA 1JXEA 3HVAA 5AJ3F 1HARA 2RRNA 4CI0B 4DHVA 2HNYB 2JLEA 2DTJA 5A8RB 4KC5A 1TL3A 4XPCA 1X4DA 1SUQB 1P1TA 3ZZRA 1BQNA 1LK5A 2ABYA 2PE8A 3V2UC 1K9MT 2RRBA 1MNEA 3EXYA 4FBUA 5HO4A 4PRFA 4WYWA 1AW0A 5A8KB 1XR7A 3AB2B 1HW8A 1X4CA 2IMOA 3MMBB 2AQ4A 2PN6A 1G6BA 3N79A 5KG3A 2FHMA 2LA4A 5A6PA 1PC5A 2V4JB 2EBEA 2JEJA 2ZHBA 4CQ1A 3FMWA 1VRUA 5C25A 2F8HA 1H7WA 2VFVA 2HNZA 3OR1A 4MK9A 1WWHA 5KG7A 3ISZA 5C42B 4HKQA 1H98A 3K8WA 4KSEB 2UXDF 4IQXA 3MTKA 3BQ1A 4MH8A 4ZPWR 4DQIA 3SFGA 4AFFA 3MEEB 3IS9A 4OJHA 3LP0B 4F8RA 1DLOA 2R2UA 1Z4UA 2F40A 1FRJA 5BYRA 3P3DA 2VD3A 4OI1A 1RT3A 1RISA 4J9SA 2VH7A 3FJ2A 4DS4A 1SJ3P 4CNZA 4BHQA 2BQRA 3GWCA 4E0DA 1W25A 3DRRB 3N0VA 5DO2A 3ENVA 2ASDA 4EBDA 5A2QY 4NZ7A 1LQ9A 2O66A 3MMJA 5A0YB 4DF4A 1MU2B 3R1LA 2HIQA 1N5YA 3MPVA 4ZLPA 1HNIA 2HVZA 1M1KT 2PMZD 2K7JA 1MMLA 1X5TA 2EKYA 1ZYQA 3LPYA 3W7BA 1N5TA 3T1AA 1R89A 1UKUA 1YJVA 4DBQA 2KZMA 1UVKA 2PC6A 1FDBA 1KTQA 3CJ2A 4C11A 2FIUA 5DM6Q 3VAHA 2YNGB 1JMTA 1WF1A 2AV5A 3MMCA 3Q8RB 3X3UA 1YI2S 2GX8A 2DGUA 5L8RC 4ZPTR 4F4ZA 2WB1D 2N3LA 4RW4A 2I9SA 4A46A 3HXMA 1FKPB 3MPYA 2D9OA 1M5OC 2GIRA 4LSLB 4U7UK 4CH7A 4TY8B 3H5XA 2V94A 5CYQB 3RAMA 3G4SS 4URSA 2DNLA 1JLAA 1LXJA 2LA6A 4CNYA 3O44A