4PUOB

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
425
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
total genus 121
structure length 412
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB03
4QW9A 1C1BA 1VRUA 3KLIB 3KLIA 4KFBA 4DEZA 1W25A 3BSNA 5F8NA 1MMLA 5HP1B 3CDEA 2R2TA 2IA6A 2FLNA 3PHEA 1J5OB 3I0RA 3I0RB 5CYQB 1T05A 2ASJA 1RT4A 4I7FB 5K14A 5K14B 3T5LA 4WYWA 1RT7A 3FDSA 2EC0A 1TV6A 1TV6B 4NLSA 5KG3A 5KFPA 3M9MB 2RDIA 1SH2A 4NCGA 2HWIA 3DYAA 3H4BA 4R8UB 1TKTB 2OPPB 3QYYA 2BANA 3DRRB 3DRRA 1S4FA 2AWZA 3SFGA 4MK9A 3TQ1A 4Q8EA 3T5KA 3T5HA 2QV6A 2HNDB 4JV1A 1JIHA 4ZVEA 1XR6A 2HAIA 5KFJA 3V6KA 1OS5A 5C25A 3BJYA 1EETA 1LW2B 3V4IB 4ZP8A 3H59A 2E9ZA 3KK2B 4IR1A 3RB3A 4WZMA 1S9GA 3HHKA 3NL0A 2JLEA 2WONB 5DLFA 4Y2AA 2ILZA 4J9NA 3NGDA 3H4DA 5EWEA 4YP3A 2R8HA 5KG4A 5KT7A 5KT5A 2J6UA 2HNYB 4RNOA 1N56A 3IRXA 3IRXB 2OPQB 4RU9A 4M94A 3UPFA 1MU2B 5KFKA 4QWAA 1TKZA 1TKZB 2FVCA 3KLHB 3OL7A 3H40A 4NLVA 4EYIB 3BQ0A 4Q0BB 3M8QB 4ED1A 4TYAA 3H5UA 3QO9A 1RTJA 3QO9B 4MK7A 3RB4A 3MR2A 4ED3A 1RTIA 3ITHB 3ITHA 4NLYA 4Q8FA 4IQXA 1S97A 5KFOA 3MEDA 3MEEA 3CVKA 3GV8B 4ECSA 3LP0B 4Y34A 4ZPBA 4GC6A 1RDRA 4IOBA 2W9BA 3V6JA 1C0TB 3FQLA 1DTTB 3BGRA 2V4RA 2BRLA 2DPIA 1IKYA 1IKYB 1I6JA 1HARA 4KO0B 3T1AA 1CSJA 3KHLA 2YKMB 1HNVB 2FVRA 2ALZA 2XGQA 2FVPA 3DRSA 3KK1B 5I42B 2HNZA 2HNZB 3T19A 5DGBA 1LW0A 5KT2A 1FK9A 1FK9B 5JXSA 1RT5A 4WE1B 1S9EA 2FLPA 1WNEA 2ASLA 2O5DA 3CJ5A 3D28A 3PVXA 4K4UA 2WCXA 3OSPA 1LWEB 2R2RA 5DQIA 3QZ7A 3DLGA 4IFVB 3KLVA 2FJWA 4JUZA 4DL6A 2OH2A 4MFBB 2WOMA 4WZQA 2YKNB 2R8KA 5KFFA 2UUTA 4EEYA 3PW2A 2FJXA 4RW7B 1HNIA 2W8KA 4Y2CA 3Q8RB 3DLKB 1JLAB 3OHAA 3OSNA 4J9KA 1IM4A 3RAXA 4R0EA 2B6AB 2JEGA 5C24B 2W8LA 4IG0A 3JYTB 5DG8A 4ZPDA 3QGGA 2C2RA 4H54A 2C2DA 3FFIB 5J2QA 4WFZA 4O3RA 2YNIB 3NAIA 4F4WA 5KFAA 4LSNB 2AX1A 1DTQA 3IG1A 2BE2A 4IH6A 4O3PA 2WHOA 1S49A 4QWEA 3DM2A 3DM2B 1T03A 1LWFA 5F9LA 5L1KA 1JXLA 2BRKA 3JSMA 3I5AA 3N6NA 1VRTB 2ILYA 3OL6A 5J2MA 5J2MB 2IM0A 5I3UA 3IS9A 1JLFA 3IS9B 3V81B 5KFMA 1JLQA 1JLQB 5D3GB 4MKBA 3TVKA 2W9CB 1TL3B 2IM3A 1REVA 1REVB 2VG7B 3HVTA 2VG7A 4QPXA 1QE1A 1QE1B 4F4XA 4IG3A 4IG3B 4RW6B 3G86A 5J2NB 4RNNA 4Q44A 2R2SA 3ICLA 4O3SA 4IRDA 3MEGB 3NAHA 4K50A 3QIPB 1D1UA 4ECXA 5HP1A 3GIJA 4IDKB 4ZVGA 5FDLB 1TL1A 1TL1B 3KK3B 3DOKA 3DOKB 2XGPA 3QGIA 3PZPA 5KFTA 3KJVB 1J5OA 5CYQA 2UVVA 4NLPA 4ZPCA 5DQHA 4I7FA 3V6DA 3V6DB 3IGVA 1S0OA 3UDLA 1JKHB 4DL2A 5KFYA 4R8UA 5L1IA 2IMWP 1TKTA 2OPPA 3MFHA 4ED8A 3M9OB 4WXWA 4ECRA 1BQMB 4ID5B 3KMSA 2HNDA 2XI3A 2ZKUA 3H2LA 4QWBA 1RTHB 4RW9B 1KHWA 3H5SA 4H4MB 3HVAA 2VG6B 1LW2A 2VG5B 2VG5A 3V4IA 1S48A 4I2QB 4PUOB 2WK4A 3OLBA 2VA2A 4IRCA 2AGQA 3KK2A 4J9RA 1DLOB 5F8GA 1FKPB 4WFXA 5KT3A 2XWYA 3HKWA 1IKWA 1IKWB 3MF5A 4TLRA 1XR5A 3Q8PB 2WONA 4M95A 4F50A 4ECYA 3RBEA 1RT2B 3N6LA 3QLHA 3QLHB 2FLLA 2ASDA 4RW8B 2HNYA 1JLBB 2OPQA 3GV5B 2ZE2A 2ZE2B 2IAJB 3GIMA 1S1VB 1MU2A 1TKXA 1TKXB 4NLWA 4KB7A 4YR2A 4FS2A 1K1SA 2IM1A 3KLHA 5KT4A 5HROB 2HWHA 1UWBB 3MR5A 3M9NB 1ZETA 1S9FA 3BR9A 3PW7A 3CJ3A 4Q0BA 3ISNC 3M8QA 1BQNB 4ICLB 4ICLA 3TAMB 4R5PB 2DPJA 4ED6A 1C2PA 1RT6B 2B43A 2GIQA 3KHHA 2BR0A 4HYKA 2IC3B 3CO9A 3LP1B 4G3IA 3LP0A 1QAJA 4ED2A 5T14A 1TP7A 4TYBA 4WFYA 1C0UA 1C0UB 2JC0A 5KFXA 1C0TA 4TXSA 5F8HA 3MR3A 4IH7A 4NRUA 3KLGB 2W9AA 1DTTA 4F4YA 2AGOA 3DMJB 4ZVFA 3G6YA 4MIBA 4ZP9A 4KO0A 2YKMA 1NHVA 1HNVA 3IN5A 1S6QA 1EP4B 1S6QB 3DRPB 5L9XA 4NZ0A 3KK1A 5I42A 2I5JA 2I5JB 5JUMA 1S6PB 5KFLA 4Q45A 3E01B 1RT1A 1RT1B 1U09A 4K4YA 5KFIA 4WE1A 4WXOA 5KFCA 4O44B 1N5YB 5F8IA 1LWEA 2VA3A 2E9TA 3OL8A 5F8MA 3RBDA 4IFVA 4YMEA 1SV5B 3OHBA 1S1XB 4X2BA 3ISND 4MFBA 3NMAA 3PW5A 2YKNA 3MTKA 2WB4A 2C2EA 2BQ3A 4RW7A 4JV2A 3GQCA 3DLKA 1JLAA 2JEJA 1S0MA 5KG6A 3LAKA 4URQU 2B6AA 4ZHRB 5C24A 1SUQB 3CDWA 4J9LA 3JYTA 1QUVA 3N6MA 4KAIA 4DG1B 1LWCA 1LWCB 3G6VA 1JLGB 1HPZB 3BSOA 4KBIA 4KKOB 1IKVB 1HMVB 1HMVA 3DLEB 3FFIA 3LP2B 2YNIA 3LP2A 4FBTA 4XPEA 1KHVA 2BQUA 4ZP7A 3CJ4A 2JEIA 5DG7A 4URGA 4LSNA 5KFVA 5J1EB 4ZMMA 4LQ3A 2YNFB 4QW8A 2D3UA 2GIRA 5KFUA 3EPGA 1S1TB 4LQ9A 1FKOB 1KLMB 4QWCA 4K4XA 4EBEA 2IJFA 4KHMA 4GC7A 2IM2A 1VRTA 5EUHA 5EDWA 3V81A 2F8EX 3D5MA 3KLEB 5D3GA 5KG7A 4IKAA 4K4TA 1TL3A 2AU0A 4PWDB 4PQUB 5CYMB 3LANA 2BQRA 3V6HA 1T3NA 3H5YA 4RW6A 4XPCA 1HYSB 1HYSA 5KFHA 1NNDA 5J2NA 4JV0A 2RF2A 2RF2B 3GYNA 4NRTA 5KFBA 4ZPAA 1JLCB 3MEGA 4IFYA 4IFYB 2D41A 3T5JA 3QIPA 3NBPA 3NBPB 4TY8B 5KG2A 4IDKA 4KE5A 5EWFA 5FDLA 4MKAA 1HQUA 1HQUB 3KK3A 1S1WB 2OPRB 2OPRA 4B3OB 5DGAA 3KJVA 2OPSB 4H4OA 4H4OB 1D0EA 4URSA 4NLXA 4J9SA 3E51A 2AGPA 2FVQA 1S1UA 1S1UB 4J9OA 1RTDB 3RB0A 1T94A 4ECTA 2WTFA 1JKHA 3DOLB 5F9NA 4RNMA 4J9QA 4O3OA 2YNGB 2B5JB 5HBMB 4G1QA 4G1QB 2R2UA 3EZUA 3I5CA 4ZP6A 5KFGA 3VQSA 2XCAA 4O4GB 1BQMA 4ID5A 4NYZA 4Y3CA 2FJVA 1C1BB 1VRUB 2JC1A 4KFBB 5F8LA 4RUCA 1RYRA 5J2PA 5J2PB 1RTHA 4EBDA 4ED7A 3OLAA 4RW9A 2XC9A 4ECWA 4O3NA 5KG1A 4K4VA 4H4MA 5KFRA 3Q8SB 2VG6A 1N6QA 1N6QB 5KG5A 4I2QA 1T05B 4PUOA 4KHRA 1RT4B 1C1CA 1C1CB 1DLOA 1FKPA 3DI6A 3DI6B 5DQGA 1RT3A 1RT3B 4I2PB 4I2PA 1RT7B 2FVSA 4ZVHA 2XCPA 4J9MA 2D3ZA 4RUAA 1K1QA 3CWJA 3H5XA 4NCGB 4NLTA 4MK8A 3DYAB 3C6UA 3C6UB 1RT2A 2RDJA 5KG0A 2BANB 5KFWA 4RW8A 4NLRA 1JLBA 1GX5A 4KSEB 5L1LA 4MH8A 5C42A 5C42B 2IAJA 4TQRA 1S1VA 4RZRA 3GIIA 5C25B 2AX0A 5HROA 5KT6A 1UWBA 4YR3A 1EETB 4YR0A 2CJQA 1IKXA 1IKXB 1RAJA 1BQNA 3TAMA 4R5PA 3FRZA 3HVWA 2W7OA 1RT6A 4F4ZA 3FSIA 1S9GB 4U6PA 3BQ1A 2UVRA 3KOAA 2CKWA 4RNFA 2IC3A 3PJXA 2XI2A 2UVWA 3LP1A 3IGNA 3C6TA 3C6TB 2C28A 4K4ZA 1RA7A 4EBCA 1ZTWA 3KLFA 3KLFB 2R8GA 3KNAA 2RKIA 2RKIB 3KHGA 4K4SA 3KLGA 3DMJA 3LAMA 3M8PB 3M8PA 2GC8A 4O3QA 2HMIA 2HMIB 4EO8A 4K4WA 2J6SA 2E9RX 1EP4A 4NLOA 3I0SA 3DRPA 3I0SB 3PR5B 2V0NA 3CDUA 4MIAA 1RTJB 4KV8B 4KV8A 2UVUA 1S6PA 4IH5A 3E01A 1RTIB 3G6XA 2QE5A 3LALA 4NLGA 2V9WA 4DL4A 5HLFA 4O44A 3MEDB 3MEEB 5HLFB 1N5YA 1XR7A 4TN2A 3PW0A 1S10A 3CIZA 1SV5A 2W9BB 1S1XA 3QGHA 4WYLA 4NLUA 3PJWA 4DL5A 5KFQA 1QAIA 3BGRB 1NHUA 3QZ8A 3GIKA 4ED0A 3H98A 4NLDA 4ECZA 5KFDA 4ZHRA 5KFEA 2I1RA 3BSCA 1SUQA 3DRSB 4LSLB 4LSLA 4RW4B 4RW4A 2UUWA 3Q8QB 4DL7A 2IBKA 1N4LA 1LW0B 4O4RA 4DG1A 4OL8A 2IJNA 1RT5B 4TY9A 1JLGA 1HPZA 1S9EB 5EWGA 4EO6A 4YQWA 4Q43A 3GV7B 4KKOA 2R8IA 1IKVA 3DLEA 2J6TA 3KMQA 5KFSA 4EYHB 1GX6A 3BSAA 5L1JA 3DLGB 1Z4UA 2W9CA 4ECVA 1S0NA 5J1EA 2WOMB 4TQSA 1TQLA 2YNFA 1SH3A 1S1TA 1RA6A 1FKOA 1KLMA 2ZD1A 2ZD1B 1TVRA 1TVRB 1HNIB 4QWDA 3BQ2A 3PW4A 1RYSA 3FQKA 2V4QA 3KLEA 3MECA 3MECB 2YNHA 2YNHB 4IG0B 1ZTTA 4PWDA 4PQUA 5CYMA 4HKQA 4J9PA 3RB6A 3EPIA 4NLQA 5KFZA 3PR4A 3OL9A 3UR0A 4ECUA 3SI8A 1HQEA 1HQEB 5DLGA 2R8JA 4IRKA 4FBUA 3NKYA 5J2QB 1JLCA 3CJ2A 3KHRA 3RAQA 3CJ0A 4IR9A 3GILA 4TY8A 3DDKA 5F8JA 1DTQB 3IG1B 2BE2B 1JLEA 1JLEB 3I5BA 3UQSA 1S1WA 4XO0A 4B3OA 1SH0A 1YVFA 5DG9A 1T03B 1LWFB 3BREA 4FS1A 3JSMB 2OPSA 2C22A 5I3UB 1JLFB 2W7PA 2ATLA 4ECQA 5C5JA 2WRMA 4RNHA 4DL3A 1RTDA 3HVTB 2D7SA 3MR6A 2AQ4A 3DOLA 4U7CA 3MFIA 1R0AA 1R0AB 3QIDA 2JEFA 5KFNA 2YNGA 2B5JA 5HBMA 1JX4A 1N48A 3SFUA 4O4GA
chains in the Genus database with same CATH superfamily
5ADZA 1RHUB 3VF0B 2CJYB 2J9DA 3S1TA 3VAHA 4DV4J 4NMLA 1ZA2B 1WC0A 3HP6A 4X64F 3T5LA 1GQEA 3N5BA 4P72A 2HFOA 3K5OA 1U1QA 1RHRB 3R1HA 1Q82T 2R3VA 2K3IA 2W2NP 8RUCA 3V4IB 3AOAA 1NK0A 2WSCC 1S9GA 2HQFA 4DR4J 5K8OA 1WUUA 5KT5A 4RNOA 1KR4A 1TU0B 1N36J 2JLFA 2FHMA 5AXMA 3QO9B 3CCWA 4P10A 1F9HA 4B3RF 5AXLA 3EM1A 2YXLA 2VKRA 4Z2XA 1IKYB 1KEKA 4QJVA 1UPPA 2Z0GA 3KK1B 3HULA 4QCLA 3J81U 2KFYA 1RT5A 5DQIA 2MYFA 3ENAA 5BYQA 4ILLA 2W8KA 2K7JA 2HVHA 1KP6A 4GMKA 1CQNA 3TRGA 2C2DA 5L39A 3SDEA 3SCKE 2HRTA 2N3LA 2ABYA 2OGUA 3B82A 2IRUA 4F7VA 3N6NA 2GHWA 2W9CB 1REVA 2F40A 3FMBA 3L3CA 4PXCA 3TR5A 1QTNB 1MN7A 3TZWA 2RMLA 2XNQA 1SL1A 5SZTA 5KFTA 4LF4J 1KDNA 3D54A 2R42A 4DL2A 3H90A 1T11A 1FI4A 3KDOA 3N01A 4PZVA 5EX0A 2VG5A 2XWXA 1S48A 3CDBA 4WK1A 5CD4A 1TKXB 4BC7A 2YX4A 5JVHQ 3TI0A 4Q0BA 1VK8A 4R5PB 2B43A 1OY9A 2DGUA 4ED2A 1TP7A 4I68A 3SZ2A 4WFYA 4E0DA 2JC0A 4TXSA 3FSXA 1CULB 1HI1A 3HZEA 1RLDA 4DMZA 3W2WA 2R7RA 3DRPB 4NZ0A 3QRRA 4CIOA 2MQOA 4K4YA 4WXOA 4HL9A 3KDNA 1NB2A 1XMOJ 3UD4P 2C2EA 1CJVA 2KU7A 2JEJA 3OV7A 4EMDA 2WBMA 2G2ZA 3L9ZA 4J9LA 1N32F 2BJ1A 2CA9A 2G4BA 4FBTA 3MOJB 1ZAVA 2FY8A 5LXRA 2B4UA 3IR7B 4LF6F 5CYMB 3NG8A 5J2NA 4JV0A 1N88A 3ZZYA 2MQPA 2WW4A 4LBPA 3KK3A 1VCTA 1D0EA 1X31C 2R7SA 2EBEA 3DOLB 1FWPA 2YNGB 3HZGA 3FEYB 1RAOA 5J2PA 1Q53A 3OLAA 3M2VB 4HI1A 3I87A 2HVDA 2LA4A 5CCLA 2D3ZA 4DZDA 3C6UA 2R7QA 2C2NA 4Y2MA 1JLBA 5C42B 3BEGB 4RZRA 3ZTPA 4KGZB 1UWBA 2QIFA 4DSFA 4RUHA 2FIUA 2FUG9 3TUJC 3BN4A 2MJUA 2E29A 2FZGB 2WVBA 4WP3A 3F73A 4DR5F 4TLQA 1YBAA 3LAMA 2FGOA 4OYPA 4DL0C 3IBCB 1VC5A 1RTJB 1WACA 4J91A 3E01A 3UD3P 2DRAA 2V8DA 1FDAA 1FXDA 3HSJA 2DEIA 3PW0A 3CIZA 2RVJA 2VFUA 3SQOP 4ECZA 4DG1A 1U26A 1X4GA 2GIFA 1UFKA 3CJKA 3BSAA 3D0GE 4ECVA 1Q1KA 1A7GE 1RYSA 1TVRA 2GMHA 2AHOB 2NQPA 4CNZA 1ZTTA 2J0XA 3SI8A 3DKDA 2DH9A 1FTRA 2L3MA 4OV1A 1FWKA 2NYHA 2JEFA 2RRAA 4DEZA 1W25A 4FVCA 5HP1B 5LM7E 3CJ8A 3MHYA 2A1BA 1ITPA 3BBBA 5A0YA 3KG0A 4CYUB 4OX9J 1TV6B 4N56A 3OXGA 4UOFA 2HK2A 1H2UX 1FVQA 3AB4B 1P9QC 4JI2J 1XR6A 2QYGA 3MPYA 1R7IA 4ZP8A 2E9ZA 2NXJA 1WG4A 3RB3A 1R3NA 3DLHA 3G6ES 2Y1IA 2G9OA 4YB6A 2BV3A 1U2RA 1N56A 1B0PA 3KLHB 5D77A 4LR9A 4M5NA 3M8QB 1P9YA 4DFKA 1RTIA 4ILRA 3MEDA 4LR8A 4Q7AA 2E5HA 2BOAA 1V5VA 2X3DA 3R2DJ 3Q8UA 2Y8WA 4MYUA 4KO0B 4LRAA 4IOAQ 5CD4H 5KT2A 1L3SA 2UU9J 2O67A 1QTMA 3GB0A 2IVYA 1PYSB 5MAOA 2WOMA 1D9DA 1CJKA 1HWJA 1HNIA 2F9DA 3DGPA 2VHGA 4ZPVR 2AJFE 2F1FA 2W8LA 1NPPA 2W24A 4A4JA 2CXEA 4ZPDA 4LRCA 3CD6S 3FCVA 2HHHF 4AE5A 2DCLA 3EZ5A 2ILYA 3K7RA 1FDBA 3HHLC 1KKHA 4IG3B 2YWHA 3ZTSA 5HQLA 3IO1A 2E44A 1J5OA 3I82A 3HPOA 1HL6A 4ZLNA 3QRPA 1P1TA 4O0IA 3D66A 1ZM3A 4N77A 1HBUA 2MLZA 2O1PA 2CAJA 1IKWB 1EZZB 3MF5A 4TLRA 2J9EA 3E3XA 4ECYA 1RT2B 1U4BA 3W60A 3N6LA 3QLHA 1WF1A 2H54B 3JAMU 5JMNA 4NLWA 1HHTP 2DH7A 2N7YA 4YR2A 1WWHA 1XEZA 1HKAA 1ZPVA 4AQYJ 5BYRA 3M30A 1GTEA 3MPDA 1U6BA 1KWMA 3FZ2A 3OXFA 1SI9A 4B3SJ 3P5TL 1T9YA 5F8HA 2UXBF 3M32A 2YKMA 2QLXA 5IT0A 2I5JB 4Q45A 3TVZA 1Y10A 2HAFA 2DR8A 3D1OA 4D3HA 4IQMA 1M5PC 2G13A 2NPIA 3OHBA 3N4WA 3HMJG 3C16A 2WB4A 2LXFA 1K0VA 1HBOA 1RWMB 3P5BP 3PEHA 4CWBA 4U8YA 5LMNF 4U7UD 5KFUA 1S1TB 1KLMB 1WSVA 5DDQC 4W98A 1UW9A 4X4SA 1WC6A 4ALZA 3MEGA 4Q2LA 3A8IA 2YPYA 4H4OB 2DNRA 2CQ1A 2VH7A 4ZJQA 1S1UB 4YHHF 3HHNB 2WTFA 3GCWP 3ILJA 3NP5A 1YITS 1RTHA 4PRFA 3KUEA 1OY6A 4ECWA 3R9LA 1Q81T 3Q8SB 2VG6A 1N6QB 6FD1A 2LDYA 5A6PA 4F25A 3CSKA 4DR6F 4H4KC 2G0IA 1PYOB 4ZDNA 3K59A 1VQ8S 1PGZA 3KFWX 3PJXA 2ZBCA 4DX8H 3C6TB 4K4ZA 3M1VB 1XJWB 4EBCA 2PFFB 1ZTWA 2OKQA 3DMJA 2GC8A 1CBKA 3TA2A 4O3QA 3HX9A 4QR1A 1QVGR 1RWKB 4J90A 2J9CA 2D74B 2B7CB 2XZDB 3MUMP 3GIKA 2A6MA 1NRKA 1X8DA 1M5VC 4NXMJ 3GSIA 3SIPB 3O44A 2H48B 1LKZA 4I0WA 2L9WA 1CC7A 2EFVA 5ETVA 2IJRA 2HK3A 1FNXH 4IG0B 4HKQA 2CWKA 4NLQA 2QSFA 1H6KX 4FBUA 2AYBA 2G2OA 3CJ2A 3GFYA 2HHPA 3DDKA 1NDKA 4FS1A 3BREA 3TVYA 3JSMB 2OPSA 4DN9A 1PJ7A 3VHQA 5I3UB 3C66A 1N34J 1FRKA 1MSWD 3MMAA 3VV2B 2DB1A 2LP4A 4QW9A 2EEYA 1Y5IB 4FYYB 1D9AA 1RP5A 2UXCF 4JI1J 3HLUA 1TAUA 4R8UB 1TKTB 2XLJA 2VDHA 2J7WA 3FCHA 2QV6A 4XIUA 1U47A 1QSLA 1UP1A 2HAIA 4LF2A 3V6KA 2GVZA 1LW2B 3TO8A 1UA0A 4WZMA 2M9KA 2UZAA 2M70A 2WONB 3PV8A 4I67A 3H4DA 5EWEA 2AEMA 2J6UA 2EC2A 4PWUA 4NLVA 5D15A 5GADI 1OPZA 1RCOB 4ECSA 1EX8A 3WC0A 3KUGA 4P74A 1GXLA 3BGRA 1KSPA 2DPIA 4LF7J 3A8JA 8AT1B 3H8YA 2VONA 4PABA 2J7UA 3ZZUA 2C3YA 2DHXA 1U02A 1HNWF 3X3UA 2H51B 3DLKB 2AEFA 1IM4A 3UVJB 5C24B 5HMWA 2BBEA 1APSA 4H54A 4FYXB 4O3RA 3SSSA 3HFVA 3ET6A 1PILA 1BXNA 5F3TA 4DV3J 3J81j 3PW5A 5D3GB 4A8YA 1TL3B 2IM3A 3T9NA 1PG5B 1QE1B 4ZVPB 1XMQF 1U1NA 3GYGA 2DXEA 4O3SA 2HFUA 2M7SA 4DQIA 2CPYA 3C19A 3EE3A 2GHVC 1ZAWA 4ZLJA 3UDLA 4GVLA 3KWMA 2OPPA 5KOWA 2PC6A 3M9OB 4ECRA 3JSBA 2ZKUA 1IBMJ 2Y1RI 5G0RB 1LK5A 4NZ7A 3KK2A 5F8GA 2GJFA 3CF5Q 3QQCD 4PEOA 3GIMA 2AF6A 2IDEA 2U2FA 2VQFJ 3MR5A 3A13A 5B0EA 3RTVA 1NKCA 1Q16B 2C2OB 2CNNB 4KRWA 2KZZA 2HQDA 3G8QA 3LP1B 1Y3KA 1ULRA 5T14A 2N7CA 3MR3A 4P7VA 3QNWB 4NRUA 1S6QB 2HW3A 2YTCA 5I42A 2RU9A 2QLJB 3K0JA 1U6FA 1R31A 3QT6A 2OI2A 4RKUC 5F8MA 5HQMA 1SV5B 5H9FK 3Q23A 4FNIA 3MTKA 3ULHA 4RW7A 1RAHB 7FDRA 3KJFB 2V9KA 1HPZB 1NLKL 2YNIA 1F9EB 4RJVA 1FNOA 2QA2A 4CH1A 4LT6A 1PJ6A 3EPGA 3NEKA 2GGPB 3SV3A 2ADBA 4J37A 2IM2A 1VRTA 1TL5A 3TYTA 3D5MA 3GJRB 3IR5B 4XPCA 1HYSB 1NNDA 3B78A 3QIPA 3NBPB 4KE5A 3KJVA 3UNYA 1SL0A 2GVDB 1DJ0A 4URSA 4PXBA 3EGZA 1HR0F 2FDNA 3AT1B 5F9NA 2VBZA 2B5JB 3AA8A 4Y3CA 4X4OA 2B9XA 4KFBB 1X5PA 2X7IA 2MQ8A 4KHRA 1C1CA 1OMSA 3RZAA 3MM5A 2UUCF 2ZZMA 1UVMA 2Q6BA 5L1LA 2IAJA 1R43A 2AX0A 3G82A 4M5GA 2VU5A 3PY8A 3MD3A 1GMVA 3DDIA 2CQHA 1BWEA 3EWGA 2MQQA 1J2VA 3QBCA 2L9DA 2HWTA 1NZ8A 1T9XA 3ILIA 2RKIB 3K57A 2CJKA 3VAMA 4KV8A 1E6YA 1SCJB 6FDRA 2QE5A 2V9WA 4DL4A 1XR7A 1TK0A 2ZBRA 1HHSA 1HI8A 1X5TA 3EX7B 4A8SA 4DL5A 4DSLA 1TTHB 4DPXA 1UEUA 4XTTA 1OQ6A 2EFQA 2IJNA 4N5SA 2VUGA 4AD6A 1R6YA 3GCXP 3SSRA 1C4CA 2XBPA 4F4KA 4DN0A 4CT8A 2ZD1B 4C7QA 5I3PA 3BKTA 1URNA 1HQEA 3NKYA 1N33F 1DTQB 4U7UK 1T03B 2NSCA 5LMUJ 3IC1A 2WRMA 3MR6A 2XZWA 2LDIA 2XLIA 3U7JA 4YFUA 5F8NA 3HJFA 2NUHA 4LFAF 3CDEA 4EZ9A 4CCHA 4GRSA 5LJ3Y 2ASJA 2OELA 1RT4A 4F04B 1ICEB 1RT7A 5KG3A 2Z8QA 2EKNA 3P4UB 4Q8EA 4B9VA 1SJ4P 4JV1A 3CD5A 3TX8A 5C25A 2X1FA 3TEGA 2DGSA 1S57A 1LV5A 2DIUA 2ZWPA 2WBRA 1FJ7A 2HVZA 2U1AA 3LO3A 1MU2B 3BQ0A 3AJ2A 4X66J 2IYGA 1U2CA 1VR6A 1ZM9A 3HCXA 3ZNJ1 3JTPA 3ZZ0A 2NUUG 4IOBA 1GH8A 2Y9HA 1GT8A 1VQ5S 3T1AA 2CZVC 1KNZA 2PD1A 3MCOA 4CH7A 2MEWA 4YEAA 1NJIT 3O8WA 2Z2LA 4DLGA 3MM7A 1N0UA 4ZA1A 3UDVA 1HBMB 3DDNA 1YZ6A 3EGNA 4CLPA 3SDEB 1NBEB 2RQKA 2Y8YA 3QSYB 2OJ3A 1TZ0A 3FSYA 4QWEA 5J2MA 3ZFVA 4WJBA 1REVB 3HVTA 5BJRA 3R5GA 3W5ZA 3G86A 2R2SA 1FERA 4K50A 2L41A 2A0FB 2B7BB 4ILMA 3CGIA 1PO6A 3P49B 2FJDB 2D69A 4DV0F 2HBYB 1Q0NA 3MFHA 4ED8A 3BDPA 4CO5A 1URRA 3H2LA 2NZCA 2VG5B 3MUVP 2MKSA 4ZVRB 4DR4F 1FJCA 1M5OC 3UE2A 3Q8PB 2WW8A 2V8HA 5H9FJ 2HQ3A 1N36F 2HNYA 2M52A 1OO0B 1KFDA 1VJQA 3KG1A 4HVZA 1ZETA 2H4WB 4KQZA 3P8BB 4DQRA 4G1IA 3VVUA 4ZKAA 3KLGB 3CJSA 1NHVA 3W2WB 2IY5B 1FEEA 4K5SA 4CO2A 2AYEA 1RT1A 4Y6IA 3O3LA 4ZJLA 4X2BA 1FF2A 2DVIA 1DRZA 3CUNA 1JLAA 1NK6A 1FE0A 1YGYA 3G6VA 3T1YF 1LWCA 5ITHA 2DRDA 3AB2B 3LP2A 2CQ2A 2RUGA 2V2KA 1DQAA 2BM1A 3DOMA 4JI0J 1RWXB 1RWPB 1H38A 2LVWA 4K4TA 3EJMA 3PYEA 2AU0A 2M3DA 3LANA 5KFHA 3B4DA 4ZVUB 3MMBA 4DR2J 5KFBA 2V5HG 3IMQJ 5ETOA 3F0NA 5KG2A 4LF4F 5DO2A 4OLOA 1B0TA 4MKYA 4KH0B 5IM0A 5DDOC 3IR6B 5HBMB 4ID5A 2FJVA 4RUCA 2HHWA 5J2PB 4QU6A 3K5LA 4H4MA 4U96A 4X84A 1GK8A 3DI6A 4MAKA 2CPIA 2RDJA 3C6UB 2EK6A 3EZOA 1H3DA 5EX3A 3WX4A 3DLBA 3CPWR 2ZJPQ 1BQNA 3HI9A 1RT6A 4HHJA 2PI4A 5IT9U 1OY8A 3CCMS 1RTZA 2NR0A 3OTOF 3VR1A 2XS2A 2V2ZA 4HTJA 4QU7A 2XY5A 3TAQA 4LIWA 1F5CA 2AJ0A 4C11A 3ADAC 2EPIA 2RSQA 1FDNA 2W9BB 4LRDA 2I9SA 4KT0C 1M5KC 4JBCA 5KFDA 3S8SA 4F26A 3BSCA 4RW4A 4LSLA 5A2QU 4O4RA 2R8IA 4EO6A 1IKVA 3R8YA 7FD1A 2VKZG 1S0NA 3CE8A 2I0XA 4QWDA 1TVRB 2J9DE 2FZKB 2HSEB 1S72S 3QJLA 2HLUA 3O2IA 2OD4A 3PEJA 4TY8A 5F8JA 2EVZA 2R7TA 3CCJS 3IG1B 2E7VA 2KM8B 3AH6A 1S4EA 2AQ4A 3ZZRA 2VC1A 4F36A 2KFZA 4PPDA 1T05A 4A8KA 1FXLA 1LXNA 3UN5A 4Z7CA 5IQQA 2VFSA 3H2VE 2HNDB 1FFGB 4DBQA 3SYZA 1EETA 1RU1A 3GYXB 3JSYA 2KG1A 2MKCA 5DLFA 2ILZA 4P2MA 2BXJA 4I56A 1DAXA 2MKYA 1X4HA 3TEHB 1TKZA 3MWBA 4ER8A 4LIRA 3GONA 2AYMA 3MEEA 5FD1A 2QT7A 4KHPJ 3HT0A 5D0HA 1C0TB 5B0AA 2ERRA 2DD8S 2KXNB 3MR7A 1HNVB 1VOMA 4NEZA 5IT9Y 3OFFA 4EWTA 1FK9A 5JXSA 4OI2A 2VD3A 3LW5C 4IFVB 1NJXA 4ZN1A 1CJUB 4Y2CA 3DU5A 2GA7A 4UOHA 3IFEA 2XS5A 1F60B 2WHOA 2V4JB 5IQ6A 2B8PA 3AODA 3V81B 1V3SA 1JLQA 4LREA 5HSPA 3HHLA 3CEDA 4JV5J 2PGCA 4UZBA 2NXEA 3PX4A 4RWXA 4ECXA 3DFEA 1KVKA 4OX9F 4GVBB 2YVSA 5DQHA 3FC9A 1K73T 4JI2F 1OIAA 4JI8J 4BBYA 1H73A 2Q43A 3BN7A 1G6BA 4I2QB 1HBUB 2CZ9A 2XMVA 2X1GA 3LWLA 1KS2A 5EGYA 3QLHB 1SJRA 2Z4PA 4TKTA 3OJSA 3HFKA 3UW1A 4YS2A 4P73A 5HROB 4CO3A 2DHGA 2BKNA 2AJQA 2WVCA 2E5LJ 2PIIA 2GV1A 5HMXA 1WSRA 2AGOA 2D9PA 5ETSA 2GO9A 1EP4B 2XMTA 2BJ7A 2MSTA 4CH0S 4OJGA 4JI7J 1UJ5A 4O44B 1N5YB 4C8OA 2VA3A 2H1YA 9RUBA 4C8KA 3NMAA 1UTAA 4NEYA 3NWGA 2IMOA 1EJ7L 3IWXA 3EDRB 4ZHRB 2E5IA 1NJWA 2COLA 1KC8T 1JLGB 2IVMA 4XPEA 1KHVA 3V2UC 4URGA 4LSNA 5GAHU 3WQPA 3I32A 4LQ9A 4C8YA 1LEOA 4PWDB 2DRBA 3V6HA 3OJUA 4RW6A 1JJCB 4IFYA 5EWFA 2KT2A 4PYDA 2C3MA 3QMQA 1XERA 4V1Ak 3K5PA 4N76A 4DDFA 3GE9A 5E33A 1NSQA 1D3WA 1JKHA 5ETMA 2XCAA 2RE1A 1ZYQA 2BEFA 4P2SA 1N5QA 2CNOB 5KFRA 1DLOA 4CO1A 4I2PA 5LSRA 4NCGB 4JI4F 3IAS9 4AQYF 4H4KA 1Q7YT 4DXLA 1XNQJ 4YR0A 2YWGA 1VQSA 3OTEA 3FRZA 1WC1A 2H5IB 3EUNA 4B3SF 3TZXA 1OPIA 1NEEA 3QJJA 5E5NA 4G65A 2WZ1A 3D6FB 4M5DA 4C8LA 2KKHA 4P9SA 4ZITA 2DHSA 5DDRC 1VI7A 3OFEA 3QGHA 2ZFHA 4DCOB 2CIMA 1SUQA 2Z56B 1VC6A 2RAQA 3W65A 3DLEA 3PO4A 1U48A 1EKRA 3DLGB 1Z4UA 2BUNA 1M1GA 4TQSA 2DH8A 3VGVA 4FXVA 5HMYA 1NXIA 3N9UC 2LCWA 4DF8A 4L3KA 2HS4A 3DRXA 2O01C 2ZH8A 4DF4A 3TAPA 2ZVIA 1R8AA 4B3OA 1ROFA 3RRGA 2WAQD 4DL3A 3MMAB 4LSZB 3C14A 3ETOA 1N48A 2J0QD 2HRYA 2FC9A 3JTOA 1VQOS 2DR9A 2IA6A 2HFZA 1GAOA 4QZVB 4EUVA 2WB1D 2B9YA 4ANCA 1S4FA 2QYCA 3FBCA 2EBGA 1VIOA 4CLKA 3BJYA 3VGSA 3ENVA 1VBZA 4CLUA 3PCOB 2CG8A 1YJUA 3IBFB 2CJXB 3IRXA 1PIEA 3OL7A 5HATA 2KZMA 1IJEB 3PM9A 3BBCA 4F0HA 2E1AA 4MK7A 1HHQA 4WP9A 3ITHA 3M8SA 2LU2A 3AD9C 5RUBA 3V6JA 3EGVA 4QIEA 1DTTB 2V8VA 2XHCA 1B7FA 4NXMF 3GIRA 3Q8VA 2J0SD 5K5MA 1OSDA 1X4FA 2IBOA 2FQQB 4WKYA 1NSAA 1NDCA 4L74A 5ETNA 3MAQA 2IRXA 4C97A 4QIVA 1RUSA 5E3CA 2KRBA 3DU6A 3JYTB 1TELA 1O51A 2DHHA 2CPHA 4HH0A 4F8RA 1R89A 5A8KA 1NM2A 5F9LA 1RGVA 3H0PA 1X4BA 3IS9A 1JLFA 2OTLS 2X1BA 4MKBA 4FYWB 2QZ8A 1UETA 5A8RB 1T8EA 5L46A 1NSKL 2F7VA 4JI1F 2IYIA 2YKAA 1M1HA 4I7FA 3V6DA 3B54A 4I4BA 1G7CB 3VAKA 4DOZA 1WI6A 4J9VA 1TFWA 1ZZFA 2WK4A 4PUOB 4MJKA 5F3ZA 4J9RA 3BO2A 2AKWB 4ITSA 1IR1A 2PMZD 3PNIA 2DT9A 5H9EJ 3M9NB 3GWCA 2XS7A 3TAMB 2PA8D 4DFPA 2P8IA 2LQBA 2F65A 1V3RA 3K58A 2JRSA 4LF7F 3H25A 4J5OA 3R5AA 4ZCKA 5JUMA 1S6PB 1TUWA 1U09A 3BKUA 4WE1A 5HAOA 3MTJA 3FRYA 1BC6A 1S1XB 2FHJD 5HK4A 5IC4B 5KG6A 1RJJA 1YJVA 1U0HA 4KBIA 3DHXA 2YBVA 3ELHA 2JEIA 3C15A 2QTWA 1FKOB 4K4XA 4KHMA 3TX0A 2HPUA 1AW0A 2Y3YA 2C2MB 4NRTA 1S99A 1JLCB 3DXSX 2A6OA 3BGLA 4O0NA 4DQPA 3HFZB 2LEPA 1YBUA 1G2EA 3E51A 4WU3A 4DX7A 4AXJA 4B3TJ 1IBMF 4G1QA 2HGMA 1BQMA 1GMUA 2KO1A 2HHTA 1NKBA 1C1CB 1FKPA 4PR6A 4USVA 5HI7A 1CEZA 5CABA 2BJDA 3VGTA 4OI0A 4NLRA 2VQFF 3EYZA 2K06A 3MCSA 2DHAA 3EGWB 5KT6A 2B8QA 2AP6A 3S7RA 2ADCA 3A8KA 3L7PA 1SJFA 1ZPWX 2V50A 2CKWA 1GXUA 3RR7A 1Y5NB 4WCEQ 3I55S 4WF9Q 3CD0A 3SQGB 2J6SA 4NLOA 3PR5B 2V0NA 4KV8B 1E6YB 3CC2S 4RBTA 2CPZA 3PJWA 1RWWB 1S12A 3H98A 3GU0A 1HWKA 1FJGJ 1IWGA 4DL7A 5GAGU 3U1MA 4KGKA 4NA1A 2PSZA 2JH3A 3TARA 1UL3A 2KVQE 3BQ2A 1RCXB 2DO0A 2MPUA 3KLEA 2DXDA 1UZDA 3OR2A 3PRVA 4USHA 1HQEB 1VHIA 2R8JA 4IRKA 4CLWA 1RU2A 1YLXA 2MB0B 1YKWA 3MGJA 3PIOQ 1RTDA 1SC1B 2NLWA 2LU1A 5L9NA 3SBMA 2P9EA 1C1BA 3KLIA 3ZC4A 2VOPA 1QSYA 3HDSA 4WIIA 1UW4A 4TVAB 5CYQB 3TZYA 1WORA 3GPAA 2KH9A 4FPIA 4PYAA 2BANA 3PXGa 1NU4A 4ZVEA 1X9MA 2YWFA 2B4OA 4UOCA 1VRQC 5DZ7A 3QT5A 4JYAJ 4Y2AA 4J9NA 1MMDA 1XBWA 3C46A 4M94A 3IWNC 2HS3A 5KFKA 1HD0A 2FVCA 3MCMA 5LSLA 1RB0A 4P7TA 1XN9A 4F2RA 2IRYA 5LT5A 3CVKA 2X1AA 2NXUA 4DUYJ 3TNVA 5D78A 2L9NA 3R6GB 2UUBJ 3MM9A 5AE1A 5IS2A 1RWNB 3OR1A 3W62A 1EIYB 5KOXA 2JFKA 3UD5A 1LWEB 2LMIA 4DJBA 4MFBB 1S77D 4LUBA 2KJVA 4PCQA 1NCLA 3QFWA 2C2RA 2KB2A 3FFIB 3ZZPA 5KFAA 4NI2B 1NKEA 2EG1A 1YRUA 1BLUA 5LMUF 2BE2A 2BA9A 1FFWB 3LPEA 3OL6A 5J2MB 3US5A 1Z2ZA 3TVKA 2VG7A 1VK3A 4CLLA 4IDKB 3O5TB 4ELVA 2OAUA 4DQSA 4DZ6A 2IMWP 1Q8BA 2XI3A 1MROA 2LQJA 4RW9B 3MUTP 1U8SA 3V4IA 4UUWA 5KT3A 1LXJA 2CNKB 3MURP 2HHUA 4DSIA 4X66F 2UV8A 1K1SA 4UQGA 3T6BA 2ZOMA 3U1LA 2L48A 2ZH5A 4UUXA 2BACA 1NK8A 4LBHA 4JI5J 2A2CA 3NS7B 4ZVFA 1SQEA 5L9XA 3LWMA 3KK1A 3FBFA 2PFDA 5KFLA 2VPWB 1RT1B 4XDCA 2VASA 1Y11A 1CS4A 3LOUA 2BQ3A 1IR0A 2PDAA 1BMQB 3D0IE 1EB0A 4YUDA 1RISA 2CPXA 3PRBA 5D0RA 4YB1P 1LWCB 1PKUA 2KI2A 1HMVA 2QJ3A 3LP2B 1SJ3P 5E3PA 2L08A 4ZMMA 5EUHA 4OHYA 4UOGA 5KG7A 3MMBB 4OX7A 3QT8A 1S9FA 4MKAA 2OPRA 1NDLA 2KYXA 4WK3A 2VB6A 4P2XA 3W9HA 3E8OA 3A3OB 2CQBA 4O3OA 4B08A 2R2UA 3GZ7A 5F8LA 2JC1A 4EGLA 2QRRA 2XC9A 4A8WA 1UJ4A 1N5SA 3DI6B 1HW8A 1NK9A 2CUYA 4MK8A 3DYAB 3NOCA 3GG0A 5KFWA 4DV0J 3BGFA 4CTAA 3AJDA 1ZA1B 3J7ZT 3IWLA 4YR3A 1U2FA 1SBRA 4ETXA 1U25A 4R5PA 3LQVA 3MCNA 2RH3A 1U45A 1Q78A 2OSRA 4ERDA 2HIQA 2MQLA 3LH2S 4CLZA 5ETQA 2C28A 3TUPA 2Z58B 3KLFA 3KNAA 2ZH3A 2MKIA 2ZUAA 1CULA 1FVSA 3VTIA 4IUFA 3DRPA 5T41A 4HACB 3GMGA 2DIVA 1WOSA 2UVUA 1Y7PA 3BGOP 1MMNA 2DNZA 4C11B 4OZ2A 3ZZTA 1NSPA 3FJ2A 3NGTA 4ED0A 3QZ8A 3H42A 4HI2A 3DRSB 4RW4B 4LSLB 2UUWA 3M2RA 3W7BA 1BHNA 4JI0F 1BUXA 4DR2F 9ATCB 5CYMA 2ATCB 2VFTA 1QUPA 1FX2A 1DQ8A 3RG6A 4QIWD 3T1YJ 2WSEC 2RRBA 2W4DA 4FPRA 3W5XA 2XLKA 1LWFB 4K0KJ 2C22A 2MLXA 2W7PA 5C5JA 4N47A 3DOLA 4DV2F 2YNGA 1F5AA 4FKYA 3NS6A 4OMFG 4USTA 4EI2A 3NGSA 2FLNA 3FMWA 3M2VA 3FEZA 3BDEA 5J1NA 2VODA 3QAUA 1JIHA 4OFZA 4N8NA 2GHPA 2XMJA 3PKMA 3BS9A 5HQ8A 3D0HE 2KN4A 3B8HA 4JI3J 2LYVA 2ZDOA 5HVGA 2OPQB 3THTA 1S7HA 3EVWA 5FLXY 1TKZB 1H7XA 3UFCX 1PSDA 1RTJA 3TP2A 3J7YU 1D8ZA 1YRXA 2QFIA 4Y34A 4HHHA 3RW7A 1HARA 4LVOP 2I2YA 2DNYA 3OTOJ 4GKKJ 5DGBA 1FK9B 3PDNA 1V9OA 2O5DA 2AJ4A 5L8RC 3WIVA 2NZ4A 4F67A 3RAXA 5DETA 2B6AB 2Z2ZA 4ANEA 2HQGA 1F6TA 5A8WB 1M1KT 4ATNA 2KM8C 4IO1A 3QFHA 4IH6A 1KLNA 2PN6A 1WEZA 4ZCIA 3R7SB 1JLQB 4QPXA 2OEJA 2AJ1A 3CNQP 2J76E 5HP1A 4ZVGA 4CYUA 3G71S 1RBAA 3Q2TC 5KFYA 2GS8A 3JB9k 4WXWA 4FKXA 4X62F 1D8YA 3UO0A 2YX1A 3OLBA 4PXEA 4IRCA 3HSDA 2OP5A 1XR5A 3GSDA 2PEHA 2ZE2A 3CD7A 1IBLJ 1IWAA 3KLHA 1RBOB 2CDQA 3M8QA 4C2MA 2FLOA 5HANA 3V5RA 3HSZA 3KHHA 4KHPF 4HYKA 4OYZA 5GAEU 4IH7A 4KO0A 3IN5A 3W1YC 2WVDA 1NB7A 2QX0A 2BW2A 4BLGA 3DLJA 4U8VA 1KOHA 1JJHA 5D4LA 2DNLA 3J80Y 2JWNA 4I1TA 3LAKA 4URQU 2A18A 4P2FA 1QLNA 4KAIA 2RS2A 3JSRA 2R7WA 4PG5A 3M6XA 2MGZB 2MLYA 3MM6B 3CJ4A 2FZCB 1WHVA 1AZSB 2IJFA 1T9UA 5C7PA 3NY0A 4OZLA 4JV5F 2ZH9A 4IKAA 1NAQA 2OSQA 1YRTA 4ZPAA 4USJC 4IFYB 2FY1A 2EFGA 2BW7A 3UN2A 4OI6A 1RWOB 1FHTA 4JI8F 1FXRA 1KONA 4ZP6A 3VQSA 3G87A 3G8TA 1WJ9A 4O4GB 1VRUB 1WTFA 3AD7C 5KG1A 4K4VA 2JVOA 5KG5A 1U1LA 2CVIA 5E3RA 4I2PB 1EKSA 1ZM2A 1O8BA 4RPFA 1RT2A 3R5DA 2J8SA 1VQYA 3CXCR 3VCDA 1DHMA 3SSQA 1H7WA 2E5LF 1TK8A 2CPDA 1CJTB 2DNPA 3DXBA 2RQCA 3G9CA 2EWHA 3A4TA 4JI7F 4M5DB 3BYPA 1AXQA 3G6XA 1L3TA 2F4VJ 2VIHA 2YH1A 1YJWS 3L09A 2RQ4A 2ZC3A 2JHEA 1YJNS 3M8YA 4HLBA 1LW0B 1S9EB 2AJ2A 4DLEA 2CFXA 3PYDA 1SH3A 1S1TA 5U47A 1KLMA 2V4QA 2BM0A 5CXTA 5GMEA 2RIJA 5J2QB 4NXNJ 3M6UA 1IM6A 3T1HJ 1SH0A 3JQKA 1RKIA 2LXUA 2DO4A 4ZVTB 4ZIWA 4DI6A 3PHEA 4M63A 4ES2A 5A6WA 2QO3A 5K14A 2HZVA 4OIXA 4WTYA 4HDGA 2JL9A 3H4BA 1QAYA 4YY3J 3IP0A 3RBXA 1G1XA 1XNQF 5KFJA 2XTJP 3H59A 3WZ0A 2B9EA 3PX0A 4F0MA 2CJBA 2BE9B 1NMEB 2QGFB 2XSJB 1Y00A 2XMKA 3IRXB 3M1VA 4JI4J 4U95A 4CM2A 3UPFA 1WDTA 3RU0A 1F0XA 4K7QA 4TYAA 3RB4A 2GZOA 4ED3A 5HJYA 3ITHB 3TQEA 4IQXA 5KFOA 2VL1A 2M0GB 4EFAC 3KNGA 3LP0B 4RU2A 4ZPBA 4RO0A 1RQ0A 5GMKa 2FVRA 2MKHA 2ASLA 3CJ5A 3D28A 2WCXA 2V67A 2ROGA 2UUTA 1H98A 2I8EA 2OMLA 4IG0A 4LRBA 1R0CB 5DG8A 1HFEL 4OZ0A 4Q5VA 1SPBP 1VQMS 2RD5C 3AXKA 3DM2A 1W2BR 3JSMA 5I3UA 3IS9B 1P1LA 1T9VA 2GJIA 2JFDA 1A6LA 2BX6A 2PT0A 1PBUA 5FDLB 2RHQB 2XGPA 3E2EA 3QGIA 3AA9A 4NLPA 2NXNA 3V6DB 3CB4A 4R8UA 1TKTA 2ZH1A 3IXQA 3HHLD 4USIA 4XDDA 4OHWA 2R4FA 3R3TA 2VOOA 1LW2A 4LVNP 2XWYA 5M2PA 2WONA 4F50A 2MZSA 3TJ8A 4RW8B 1WC5A 4CNYA 1S1VB 1RSCA 3QT7A 3MPVA 4DPOA 3BR9A 3ISNC 2KL8A 3NXZA 5CQGA 2GIQA 1RAIB 1U1PA 4LMZA 5M2UA 2F4FA 4F4YA 1CPZA 4E2FB 2ZM6J 2HQIA 5KFIA 4U9RA 1X9SA 3D6MB 2CDRB 4BHQA 1RHQB 1QM9A 3DLKA 1AFIA 3UVJA 5C24A 5D4PA 3OPKA 1U0HB 1F9FA 4KKOB 1H74A 2K1RB 5CZVA 2RILA 3C15B 4W90B 4K2XA 3T41A 5IWAJ 5D3GA 4TNOA 3ZZOA 2UXDJ 1TL3A 4BS2A 2RF2A 5AJ3J 3I31A 1WG1A 3BR8A 3ISZA 3R6LB 4LFCF 4UW2A 1JQGA 1M0SA 2V2VA 3KJNB 2BJ9A 4J9QA 4G1QB 3I5CA 1RYRA 2AW0A 4CLYA 1UVJA 1VBKA 3SMZA 5D0GA 2Y0SD 1UCNA 3H5XA 1X0FA 4NLTA 1JMTA 3TANA 2MQNA 2P5VA 1N8RT 1NH8A 3GTYX 5B0BA 1OSCA 1RAJA 3OVBA 3QWUA 2XZTB 4F4ZA 4RUBA 3MAAB 1T9TA 3KOAA 5D8HB 1X7VA 3LP1A 2CQPA 1JXEA 3ENQA 4DUZJ 2YKOA 4K4SA 4EO8A 1S0VA 2DNQA 3N0VA 3PG9A 3MMCB 2HEKA 2YWWA 4ELTA 2NPFA 1SV5A 1Y3JA 2HBQB 2M8HA 1QAIA 5KAKA 2HS0A 2ROPA 3Q8QB 2ZWOA 1HPZA 2KG0A 2GMJA 4R25A 1GX6A 4WPAA 3PW4A 2GGPA 4LF8F 1Y9OA 2HZCA 1PAUB 4NX9A 2XNRA 2GQ2A 2C2ZB 1FRJA 4P71A 3RAQA 1LQ9A 1YJ7A 4NPOA 1L5UA 4AYBD 5BXIA 2W01A 5T7LB 2GVDA 1WEYA 1WTBA 4B3TF 2XEXA 4RNHA 3ZTQA 2HKEA 3MFIA 5KFNA 2B5JA 4B02A 3KLIB 2MMYA 4KFBA 4L75A 2HLTA 2HBRB 1IQZA 2V8PA 1RAFB 1A0OB 3BH7B 4I6YA 4NLSA 5KFPA 4YB5A 2HHVA 2DY9A 2ZOGA 2MJNA 3QYYA 3DC2A 4W4MA 1F5BA 2AWZA 4X4VA 3LGHA 1K8AT 3M8ZA 3P45B 1FWLA 1V3ZA 1QSSA 5L38A 3RUBL 2AZ3A 5ETKA 2ZZNA 3IA0A 4WBFA 1K9MT 1LOUA 4OQJA 1F2HA 1XIQA 1BY9A 3POTB 3D9BA 2VDIA 4ED1A 5CYJA 2RDDA 1AUDA 4FVMA 4YN3B 3GV8B 1FKAF 1WKLA 2RQMA 4AXIA 1FJGF 1AYEA 1I6JA 1CSJA 1WKJA 4DX6A 3OR1B 3PO5A 2ZZTA 2ZVSA 3KLVA 5SUHA 1GNKA 2YKNB 4LFBJ 2NREA 1E6VB 3OHAA 3NWRA 3CMES 3QGGA 2R7UA 2JOQA 1P27B 2KHDA 1HBNB 4F4WA 2POKA 3NNCA 2AX1A 1DTQA 2YKQA 1T03A 1NJYA 1S6OA 3R1LA 1UA1A 2VG7B 3NCRA 4DS4A 4LBIA 2GX8A 2DNOA 1HI0P 2MXYA 2CYYA 4X4NA 1J27A 2QA1A 5BYSA 3GIJA 2UV8G 3G8SA 3EVOA 3DOKA 3BM7A 4KC5A 1JXVA 3KMSA 1MROB 2HIYA 1KHWA 3HVAA 1FEHA 4JYAF 4CRJA 1I94J 4WFXA 4USWA 4M95A 3LPYA 2DNNA 2FD2A 4UY8T 1MU2A 2KT5A 3BPDA 4FS2A 4NE9C 3MPUB 3MM8B 4FF4A 3PRDA 2R7XA 4DUYF 2K7KA 2IC3B 3S01A 2VZ9A 2UUBF 2BDPA 4WP8A 3W2VA 2DITA 1F3FA 4B3MJ 4HDHA 2BABA 4UF4A 1WD6A 3RAMA 3GLJA 2C42A 1FD8A 2E1PA 2I38A 1REGX 4OHXA 1CS4B 5IV3A 3GQCA 2YPZA 1HBMA 1D9FA 4C8MA 2R7VA 3LF0A 3BSOA 2RS8A 4DSJA 2DR5A 1HMVB 4FYVB 1FA0A 3W5YA 5J1EB 3EVMA 2YNFB 1WC4A 1NPKA 1CVJA 3IRWP 3R2CJ 4PQUB 1T3NA 3ONQA 1R6VA 5ETLA 3RJMB 4ANDA 1S1WB 2OPRB 3NNHA 3Q22A 2CWXA 2H65B 1RLCL 5IZHA 1N54B 3D6HB 3AXMA 5G4DA 3THPA 3ENWA 2QSWA 2EFNA 5DQGA 1RT3A 2XYHB 2FVSA 1VJWA 4CTAB 4TQRA 1UFLA 3JTNA 4OI3A 2LECA 4ZCLA 1S9GB 4JI5F 1B3TA 2K8GA 1O0PA 3IGNA 2ZJQQ 1BGXT 1RA7A 1U1KA 4DR7J 3KLFB 3QATA 3KHGA 3KLGA 3M8PA 2HMIA 4RR5A 2Q79A 4X65F 3BO3A 3BF4A 4ZK7M 4TN2A 2NXCA 4DR3J 4DV6J 3CC7S 4YB7A 4Y0FA 2YQ1A 4EK2A 3M2RB 1RT5B 1F3VA 2DEJA 4EYHB 1WC3A 2V94A 1J5EF 3J81Y 1UMJA 1GMWA 4RL1A 3U1NA 1B99A 1JB0C 3MECA 2OEMA 4BC9A 1ZH5A 2N4DA 5KFZA 3PR4A 5J1PA 1U24A 1VLYA 4K2JA 3CJ0A 3B4MA 1JLEA 3SCJE 4I69A 2EI5A 1AT1B 1T3OA 4Y2KA 5HBMA 4C3KA 3RRHA 2R2TA 1FRLA 3I0RA 1WG5A 3TUZC 4X4PA 3OTDA 2CQGA 3VAFA 4RBVA 3HD1A 1WF0A 4FN5A 2HWIA 5E0OA 4WFBQ 3SFGA 3OTCA 4J9UE 3T5KA 3VGUA 2B4VA 1PBAA 2OEKA 1R27B 1T02A 2V69A 2X51A 2QLWA 2O66A 1VQNS 3NL0A 2OTJS 2JLEA 4NYPA 1VIXA 1HLWA 3NGDA 1LFPA 5KG4A 2QMWA 4DV7J 4RU9A 4TU8A 2A10A 3FUYA 4Q0BB 1X4EA 1I51B 2D3OR 3CW2C 3BYRA 2VPZB 1QD1A 4GC6A 3PHTA 2W9BA 3MPWA 2MZ1A 1FD2A 4C48A 2H4YB 2OO4A 1JJ2R 4U67Q 2ALZA 2W4PA 2MZQA 3T19A 4LF5J 2MHNA 2A2DA 2XYGB 5GAHI 1Q4RA 1T95A 4LF9J 4OZJA 1MG7A 2JVRA 4WZQA 2R8KA 4EEYA 3PW2A 4GKJJ 1CJVB 3FGVA 2R7OA 3KG4A 1R8PA 5IOLA 5EN1A 4NCAA 3NAIA 4K0KF 3C3LA 3IG1A 4FZVA 1S6UA 4ETZA 4F4XA 1X4AA 2P6SA 1AB8A 5J2NB 5B7WA 1QY7A 3KYLA 3BO4A 1V6HA 2ATLA 1TL1A 3KK3B 3PZPA 4DV1J 4N41A 1N5VA 4DFJA 1P6TA 2YKPA 4CZCA 1W2IA 2ZHAA 1FX4A 1PYTA 2FJBB 4ZLPA 3LTOA 1FCAA 1X60A 2D1CA 2KHCA 2HNDA 2D9OA 4DV2J 5B0CA 1KOOA 2B4PA 4DV5J 4P6QA 3UNGC 3HF5A 3KKFA 2ZBPA 4JI3F 1JWWA 3HKWA 4UZCA 1JLBB 1RHJB 4MYTA 3T9ZA 3GV5B 2ZE2B 2CJAA 1RXOB 4M5MA 2IM1A 1UWBB 2MY8A 5B0DA 3CJ3A 5HVHA 2DPJA 2CPEA 2W1BA 5IC6B 4KPCA 2P6TA 1MWQA 4OYIA 2KDOA 1C0TA 4MIBA 4GKKF 1HNVA 3WHIA 1SIWB 1SKWA 1KD1T 3E01B 5KFCA 3V4MA 5F8IA 2ZHOA 4IFVA 3A8EA 3IAM9 1CJUA 2E7XA 3GR1A 2H5JB 4JV2A 2ZH7A 4B9UA 1QUVA 3UDEA 4DG1B 4FXWA 1KRPA 2Q66A 2ASYA 3FBBA 4K8RA 3CJKB 4QW8A 2QA4S 4QWCA 2V4JA 2E1RA 2OD6A 3RBZA 3V81A 2BKPA 2PMHA 4Z7YA 2HVEA 2DNHA 2H3EB 3GYNA 2AEJA 1BQXA 1UVKA 4KGXB 5ETRA 4GVBA 2LXIA 2AGPA 4NLXA 2FVQA 2DNKA 2QL5B 1K47A 3D67A 3JQJA 4MTPA 4EBDA 2QMXA 3EICA 3TJAA 2SXLA 3OVAA 4I2QA 1PCAA 2VJUA 5A0YB 2JDJA 1B64A 2IDLA 3RB6A 3KJQB 2Y0BB 1IBLF 5DRKA 4ZPTR 4KSEB 3OFHA 5B0GA 2DJWA 5HROA 4X62J 2K2PA 3TUIC 4C8NA 4HHUA 1VMBA 2W7OA 2UVRA 4FF2A 3PFEA 3EMTA 1S5ZA 2FHJA 3VAGA 3ETMA 1UEVA 5KTQA 2E5GA 2OIHA 2J7KA 1G4CA 4ZVQB 3W61A 3M4XA 1EP4A 5CCMA 1SL2A 2JJ4D 3CCUS 2A3JA 1RTIB 4NLGA 4O44A 3MEDB 3JS9A 1IQTA 1N5YA 3D3CJ 2DGTA 4GO7X 4JP8A 4NLUA 1NHUA 3K8WA 2CQIA 5C2GA 2JLGA 4ZHRA 5KFEA 4M1KA 2IBKA 5EWGA 1JLGA 4YQWA 2V63A 2J6TA 4ZVSB 2CQCA 1MWZA 2WOMB 2F8HA 2BOPA 2DR6A 1RA6A 1CJKB 1UJ6A 3AY0A 1HNIB 2IA0A 3DGPB 2OFHX 2MZRA 2ZITA 4J9PA 4PWDA 2XMAA 4ECUA 4BWMA 3GILA 4USKA 1YVFA 2LQ9A 2M2BA 5AE2A 4ELUA 2D7SA 3TA1A 5DS7A 3PFOA 2CVEA 3LGNA 2XY6A 4LR7A 1J5OB 1V5IB 1VS3A 1U0SA 5K14B 1UVIA 3X1LB 3GR0A 3M9MB 4JI6J 4NCGA 4KIAA 3DRRA 3UCGA 2B9WA 2AZ1A 2DGOA 3WX8A 3OW2R 3DCAA 1NO8A 1WHYA 2BKOA 2OLWA 2LEAA 3BZQA 2P9CA 4DU7A 1DQ9A 1YBTA 3T6JA 1TL7A 2WVEA 1NK5A 3UR3C 5B0FA 3QJPA 4QWAA 3FK4A 2ZBIA 2P2CB 3VQTA 3RYLA 4DHVA 3M30B 2F4VF 2MKKA 3N79A 3JAMY 5C2CA 1BWVA 3NLCA 3G2XA 2V34A 4IYQA 4P75A 1SJQA 1KTVA 2BRLA 3Q83A 3NRBA 3VVTA 4NYOA 3M32B 2YKMB 4L76A 5CAAA 2FVPA 2ZDPA 3WC2A 3BV8A 3OTBA 3VALA 3QGPA 2ACYA 3D4JA 1XTZA 2FLPA 1VYAA 3OSPA 3ZTRA 4ZCMA 3DLGA 4BWJA 4JUZA 4WKRA 3C16B 5E41A 4OI1A 2KVIA 1QVFR 3Q8RB 1HBOB 4XAKA 4CI0B 5H9EK 2JEGA 4R0EA 4NXNF 1XQIA 4YDDB 3T1HF 4BDPA 2N82B 3D1HA 3GG1A 1S49A 1VC0A 3DM2B 3I5AA 2IM0A 1W26A 1SIZA 4X4TA 1QAXA 2GCFA 4Q44A 2UP1A 3MEGB 1M5HA 3NAHA 3OBIA 4PG4A 1AUSL 1YX2A 1TUVA 1R0BG 2GAGC 2BYCA 5DM6Q 3UCUP 4YY3F 2N4CA 3IGVA 1S0OA 3K17A 4FP9A 5L1IA 1VBXA 2ZNYA 1RTHB 4RWWA 1IXKA 1HNXJ 1EAYC 4ZOSA 2VG6B 2XY7A 4QYZK 1RE1B 1Q8IA 1FT8A 2CRLA 5D0EA 3RBEA 1TKDA 3PJ9A 4KTQA 1U6ZA 1HWUA 1VBYA 2AT1B 4KB7A 4BCAA 2VPXB 2CQ4A 2HWHA 3WBZA 1N5TA 5DZ6A 4M5JA 2HHQA 2QLBB 3GFZA 5MLCV 1NPRA 1LWXA 2W9AA 1DTTA 2RU3A 3DMJB 5GAGI 1SB6A 4YOEA 3L7UA 1IVZA 3K2YA 3W63A 4ID8A 1OWXA 4L72B 4S0MA 1S0MA 1OYEA 3JYTA 1WOPA 1DZ5A 1HIYA 2KT3A 1Q7LB 2YQ0A 3K8VA 4TU9A 5FIIA 4C3MA 1I3OB 1TMJA 2BQUA 4KJIA 2DGWA 3RR8A 1VQLS 3TA0A 3I9V9 1YI2S 1HQ2A 2RF2B 5A8RA 2LFVA 5K20B 2D41A 3T5JA 3BGUA 3HM9A 2MZTA 1ZZNA 2FYXA 1HQUA 3L95X 1UVNA 1AFJA 2OPSB 2XHWA 3HKZD 4RNMA 2JSXA 4KR0B 2MSSA 4PUOA 3ZNUA 2XCPA 3ILOA 4LRFA 3CJRA 2C3PA 5KG0A 1YZ7A 5F0WA 4MH8A 1XK8A 4Q2MA 2GVZB 5LSOA 3HO1A 3TAMA 3HVWA 3CTRA 1KN6A 3DGVA 4RNFA 4OLPA 2NCKL 4M5LA 2R8GA 3J7Z5 1TMMA 1O6XA 2Z2MA 2ZM6F 2E9RX 3I0SA 1YIJS 1PC4A 3CDUA 2GO8A 1KFSA 1S6PA 2F9JA 3GJSB 3LALA 2B51A 5HLFA 3NCPA 1S10A 1S1XA 3JXOA 2M88A 3BGRB 2WVFA 1HNZJ 1DARA 3MZIA 3GV7B 4QPTA 2ACMA 5IWAF 2W2OP 3SCLE 2UXDF 1FKOA 3LGMA 1BE4A 3NOGA 4CT9A 1A9NB 3RRKA 5AJ3F 1YWXA 3OL9A 4Y28C 3TWZA 3ZXWA 5DLGA 1JLCA 3KHRA 4IR9A 4WFAQ 1LNQA 4PQAA 3ET6B 5DG9A 2Q3PA 2MY7A 2RNEA 3KUHA 1WEXA 1B0VA 1WOOA 4ECQA 3FCWA 1XNRF 1R0AA 1GTHA 3JQMA 4DCPB 2UUAJ 2EC0A 2CADA 2K3KA 4TU7A 4LFCJ 2OPPB 3TW0A 3TQ1A 2BJEA 1VQ4S 3GFHA 2F63A 1DFDA 4M5KA 2CPFA 3M05A 3KK2B 1QDUB 2QC3A 2MKJA 3HHKA 1WDDA 1QJHA 4DUZF 3UCZP 3ZZZA 4QIGA 2R8HA 3AHPA 1F1BB 3SQGA 3FKBA 3NGUA 1FJEB 4C3LA 1SC3B 1SC4B 2AD9A 1ZAXA 4OHVA 4DFMA 1VLOA 8ATCB 5LXYA 3FQLA 1SC6A 4Y00A 1PC5A 5I42B 2HNZA 5JJBA 1KQSR 4K4UA 5CH7B 2R2RA 2CG4A 2W7AA 4DPYA 2ZH4A 2IIHA 4RW7B 1G3OA 2E7WA 4OV6A 1VQKS 2EXUA 5H1SV 2VJVA 4QYRA 4F3MA 3LUYA 5B08A 1FO1A 3DRYA 2XG8A 1L3VA 1KQFB 4WFZA 2YNIB 3M2UA 2XB2D 4O3PA 4A46A 4QYZJ 1JXLA 2BRKA 1VRTB 2KFNA 4LF8J 4L73A 2CQ3A 3QIPB 4B9LA 1IUJA 3DOKB 4C6AA 3KJVB 5CYQA 3OUYA 4DSKA 5BR8J 3AQOA 4OI4A 4QR0A 5DM7Q 2E5JA 1OJ4A 2PMWA 3D7SB 4QWBA 4F3OA 2YWKA 1TK5A 1H72C 3MD1A 4HT7A 3FEXB 3SV4A 4A8XA 4WWSA 3IM8A 3MM5B 1UPMB 2LQ8A 2V68A 4EZ6A 2IAJB 3IBWA 3G82B 1UEKA 4ICLA 4PXDA 2O3DA 5LL6d 1FE4A 1HWLA 4G3IA 2Z57B 3CCES 4WU2A 2VV5A 3W2VB 1C0UA 4PAAA 1IBKJ 4DR1J 4E98A 4USMA 2DBBA 5IV4A 1YJTA 4KPYA 4M5IA 3MMJA 1X4DA 5GADU 3HHDA 4LFBF 1LWEA 2LA6A 1EARA 3FNNA 3RBDA 4YMEA 4MFBA 5AT1B 4HR2A 4CP5A 4V19J 3HSGA 5ETTA 1L3KA 2XQCA 3CDWA 3WDOA 2G0JA 4USUA 3N6MA 2VQEF 3FFIA 4NI2A 2OFGX 4LQ3A 2D3UA 2GIRA 1YK9A 1K44A 1IR2A 4GC7A 1TL4A 5EDWA 2F8EX 1JNRB 4UTGA 1EQ0A 2QL9B 4A8OA 3D6TB 4CLTA 5HMZA 4AUKA 2DGXA 4B9SA 4DV4F 4IDKA 2OHDA 2IPOB 2LLZA 3KTQA 1MW7A 4QIFA 2GQCA 4J9SA 1ACMB 4ECTA 4EU0A 2XO6A 3DNCA 5F41A 4RW9A 1I94F 2D3O1 3SXLA 1RT4B 1RT3B 1RT7B 1TAQA 2C3UA 4MMOA 3CT9A 4X64J 4OJHA 1GX5A 2NSBA 5C25B 1S76D 3J7YI 2DISA 1IKXA 1NUEA 3FSIA 3AQPA 2RJZA 2XULA 4B3MF 1K0TA 3HHEA 1L3UA 3D2WA 3K5NA 2F8MA 2AIRB 4OX6A 3M8PB 1SKRA 2HMIB 4K4WA 4F02A 3UWTA 4ED4A 4NZ6A 3DN9A 3W66A 4ES1A 4NCBA 4Z37A 5E3QA 4B3RJ 3MEKA 3QSIA 1IJFB 2IFXA 1YJRA 3UDCA 3DHWC 3Q24A 2XO7A 3I56S 4Q43A 3MM7B 2G1HA 1RHKB 2FTRA 5JVGQ 4UT4A 2ZBQA 3MECB 2YNHA 4CM0A 1RABB 4Y2IA 2PO4A 3UQSA 1JLEB 4X4RA 4YDXA 3HVTB 2X3GA 5HL7Q 4F2SA 5B09A 2FC8A 4OX8A 1NJZA 3EDQB 2DXFA 3I0RB 2H5EA 5IFMA 4FDFA 4HT5A 3I96A 4O23A 2DR7A 4AL6A 2VFVA 3DYAA 2Z30B 3CCVS 3ZTOA 1PJ5A 3T5HA 4ZS6A 1ZM4A 4NOHA 1FTCA 3K5MA 4RX6A 3S6EA 4DR7F 5GAEI 3A12A 5KT7A 2HNYB 1Q95G 1I5OB 1RADB 2CQ0A 2DTJA 3QWPA 5AXNA 1SKUB 1N52B 4HACA 3H5UA 3QO9A 2RRNA 2GQQA 1ZOTA 4DR3F 1S97A 4DV6F 1XMOF 4IO9Q 2QMUB 1IKYA 3KHLA 2M5YA 3DRSA 1RAGB 5E7OB 1B70B 1WNEA 4X65J 4L6V3 5ETPA 4QBUA 3AFGA 5LJ5Y 4FNHA 5KFFA 2FJXA 4DPTA 2KJWA 1SQFA 1JLAB 3VAJA 4J9KA 2J0WA 3A1YG 4OHZA 1N32J 2W4CA 4A8FA 1Q5VA 3MAHA 3N28A 3GFXA 1LWFA 3DOMB 5L1KA 1J5EJ 2W9CA 3W3SA 3D68A 2J5AA 3OXLA 4LF6J 4OJ1A 1YJ9S 1MWYA 1XMBA 1H2VZ 4IRDA 4NASA 1TL1B 3P3DA 4C0OC 4ED5A 2DGQA 4ZPCA 2PE8A 3CIMA 5IM0B 1AA1B 2LEBA 4RBUA 4KH1B 4OYMA 2CPJA 3EXYA 2MTLA 4ID5B 1RAEB 3CCSS 2GMLA 2VICA 3HD2A 2HHXA 4H4MB 5I3QA 4MKVA 2VA2A 1X0PA 3R97A 2AGQA 5FLXU 2VBXA 1BD6A 5K8PA 4DV7F 2FJAB 4I6AA 4B9MA 2OPQA 3R27A 2FB0A 1TKXA 5AXKA 2HBZB 4MT1A 5A76A 1BQNB 3GP9A 1VISA 4Y65A 1RT6B 4C98A 3N5FA 2BE7D 5EHHA 2HG4A 4M5HA 2R9LA 3CO9A 3W9JA 4K5RA 1YHQS 3RGIA 2GFFA 3G6YA 1KVJA 1HA1A 3CMAS 4LF5F 4A48A 2BMBA 4DR5J 3MOZA 4LF9F 1KTQA 3AOBA 2E9TA 4PKDB 4GKJF 5F0UA 1O5JA 1KBRA 2HURA 2APOA 4N7TA 3QAEA 1RHMB 2B6AA 1NZAA 3MDFA 1IKVB 2VC0A 5A8WA 1SVDA 5DG7A 5KFVA 1EHWA 1EQMA 4CQ1A 5A2QY 3CDAA 4EBEA 4WTOB 2EK1A 1RZMA 4FYDA 1RAAB 2YY3A 2FJEB 3CULA 4DV1F 1Z1ZA 5K8NA 4TY8B 5E3AA 3L7OA 3CCRS 1JJ4A 3QRQA 1IBCB 1WHWA 3RB0A 3M6WA 4RLEA 5KFGA 2JX2A 3BH6B 4DV5F 5GMDA 3J7AN 3R7NB 3R5CA 1T05B 1RK8A 4ZVHA 2YX7A 4RUAA 1K1QA 3GJTB 2HFVA 3CMQA 5C42A 2KRRA 1EETB 2CJQA 3W64A 3PIPQ 1FRHA 2WSFC 3RW6A 1UWAA 3I6PA 4A8QA 4ZVOB 1M90T 2UU9F 1SKSA 3J80U 2QLFB 3MEEB 3CO0P 4OZNA 2EFOA 1NHKL 5KFQA 4DWIA 3F56A 3CCQS 2QA4G 2I1RA 1B7YB 4DSEA 2W2QP 4OJ3A 1UAWA 3CCZA 5KFSA 2MGZA 3MM6A 1AZSA 3TOQA 2PI5A 3EPIA 2G2YA 2EW9A 1H2TZ 5M2RA 4NL5A 1C4AA 2ZH2A 1U1OA 4C0BA 2ZKTA 2HHHJ 2CZ4A 2BJ3A 3I5BA 3OT9A 4XO0A 2QFJA 2KTQA 2HGLA 1Z2LA 3HHLB 3QIDA 1GMWD 4O4GA 1VRUA 3BSNA 2HHSA 1DURA 3KXDA 2HFNA 2DNMA 3FDSA 1TV6A 4ZLLA 1SH2A 4FXDA 1X5OA 3DRRB 2Q1LA 2W2MP 4MK9A 2E1CA 3NMRA 5I4MA 1U7LA 3Q0AA 3Q8YA 2IHR1 4IR1A 3OQ2A 2ZOFA 1CJTA 1TL7B 2ZC4A 4G1PA 3F41A 3H40A 2QEXS 3MR2A 4I64A 4NLYA 1VFJA 5FJ4A 2HVIA 3WIUA 1CLFA 1WKKA 4FF3A 3VAIA 1D09B 1LK7A 4N8OA 4DPWA 4M8LA 2UXBJ 4V19X 1LW0A 1ELOA 4LJMA 2YQ3A 5E2QA 1S9EA 5DJBA 3PVXA 3QZ7A 4PG6A 2OH2A 4DL6A 2KXHA 2B0GA 3G4SS 1ZBTA 5LOQA 2RHSB 4ENOA 3OSNA 2XYPB 2CNLB 4HH1A 2ZHBA 5J2QA 3Q86A 1RACB 3HJVA 1JK9B 3AD8C 4LSNB 1JNZB 1MN9A 5LMNJ 4PWWA 1RWVB 2OMOA 3C2PA 4IG3A 4RW6B 4MIWA 3P6YC 4RNNA 3D3BJ 2NYIA 4P52A 1D1UA 2Q6CA 1U49A 1S79A 2VBWA 4CLFA 2UVVA 3U02A 4JI6F 3PKYA 1JKHB 3NNAA 2MZJA 5GVQA 1VQ9S 3MXHP 1I1GA 4ES3A 3LA0A 4KGVB 4YHHJ 2VFRA 1VHFA 3H5SA 3GJQB 4HTIA 3CJQA 4AT1B 2BVZA 1DLOB 1TFYA 1Y0HA 1IKWA 4NWBA 2XSJA 2IVFB 2FLLA 2ASDA 1XC9A 2XMWA 4DR6J 3B6BA 3D1QA 1Y5LB 1KQGB 2EFPA 3PW7A 4ED6A 1C2PA 1T9WA 1FNMA 1RWUA 2BR0A 3LP0A 1QAJA 3DLLQ 2W2PP 4TYBA 4UY85 4XK8C 4OYXA 4F0KA 4ZP9A 4D3GA 1DBDA 2I5JA 3I9ZA 5DDPC 1HW9A 3VZIA 3OL8A 2DGVA 4E8UA 3I4HX 1T0TV 2C2KB 1H0HB 1SUQB 4DQQA 2DY1A 3DLEB 3O1LA 4KGMA 4NMXA 4ZP7A 3A3NB 3BPSP 2KYZA 3PYGA 1N34F 1TUGB 1UFWA 1Q79A 2AV5A 1NDPA 2DNGA 3Q2SC 1ZS6A 2H9ZA 2BQRA 3G96A 1RKJA 3H5YA 3W9IA 3QPIA 5HJXA 1NH7A 5FDLA 1HQUB 5HN0A 4B3OB 5DGAA 2KXFA 4H4OA 3Q89A 4PG7A 1S1UA 1TR0A 2ZEJA 4J9OA 5IXUA 1FRXA 2J8AA 3EZUA 3C14B 1HNXF 4NYZA 3OFGA 4ED7A 2JZ5A 3I4PA 1N6QA 3P96A 3PTWA 4A8MP 2AYGA 1FRMA 1Y4ZB 2UXCJ 4RW8A 3UI3A 1FDDA 1S1VA 4DCJB 3O6QA 2GW8A 3J7A1 1RBLA 5CHCB 2QN6B 2CQDA 4U6PA 3BQ1A 4WFNQ 3C6TA 2B3TB 4W92B 4B9TA 4F3QA 2HQCA 4QOTA 4KY3A 2FGCA 3I0SB 2ROEA 1X4CA 4IH5A 3PX6A 1N0VC 5HLFB 4OYBA 2ZNZA 2M8DB 4OYOA 1GXTA 4JB8B 4AFFA 4DUTA 4NLDA 5CZXA 2G0CA 3L4BC 3NCQA 4OL8A 4TY9A 2ZH6A 4ZJOA 4KKOA 3KMQA 2K1RA 1DY3A 4DV3F 4FF1A 1TQLA 1Q5YA 1HNWJ 3AAWB 3FQKA 4C4WA 2YH0A 3R5JB 1S7IA 2MDAA 1LFWA 1WI8A 2RB7A 3THVA 3C8YA 5A8KB 3HT3A 3H7HB 1Q8LA 4UQTA 3SCIE 1GFWB 1YTYA 3A3PB 1JLFB 2C1EB 5HVFA 1R8HA 2Y1LB 1R0AB 3AJ1A 4DS5A 1JX4A 1XMQJ 3FBEA 2PA3A 1MMLA 2NS1B 2M4MA 3PYFA 1P8GA 1UZHA 4DX5A 4K59A 1VQPS 4LF1A 4I7FB 1MNEA 4QQBA 4WYWA 1VGYA 4GO5X 2RDIA 1YG0A 4G6VB 3HXMA 1U1MA 5K8MA 1OS5A 3EXCX 2ZUGA 2VPYB 4X4UA 3BKFA 1CC8A 3MAAA 3OVSA 3R5BA 1R8BA 4DPUA 4YP3A 3M8WA 2I6WA 3VWSA 4KYZA 4EYIB 2N3OA 3W8GA 1T7PA 4NA3A 3MMCA 4PPZA 4Q8FA 1XWLA 1UKUA 1CG2A 1RDRA 2HGNA 4CO0A 2QL7B 1HNZF 1OYDA 3R7BB 2V4RA 4X4QA 2XGQA 2HNZB 3AOCA 4WE1B 3HK2A 1U1RA 2E1MC 4OYAA 5D6GA 3PACA 2FJWA 2HYIB 2P9GA 2EKYA 1SJ1A 4NA2A 3CJTA 3M6VA 2LQ5A 2W25A 1R8CA 2MQMA 3TZZA 3M2UB 4QR2A 3H20A 1VQ7S 3NGKA 2RT3A 2F3JA 5T7LA 4L3NA 5KFMA 1F2GA 5K9FA 1QE1A 4WIQA 1NK7A 1HWIA 1GEHA 3IM9A 3ICLA 2UUAF 1RI7A 3K89A 4B9NA 4ZIVA 2V6AA 2DCUB 3OUYB 2AMCB 1YSJA 2V8GA 2V2QA 1U8WA 4CDIA 5D4OA 1KVIA 1HR0J 1XNRJ 4J7CA 1BQMB 3CCLS 1X9WA 1MLAA 5G0RA 1YQHA 2VBYA 1X5SA 3UN3A 2FPHX 1FKPB 1IN0A 2OUGA 4AL7A 1OQ3A 1UVLA 2DK2A 2BZ2A 4OYWA 4A47A 2UUCJ 1M5SA 4CO4A 4DU8A 3POTA 5KT4A 4ZPWR 2DKOB 4B17A 2Z2YB 2CJ9A 4ICLB 1NK4A 3OD2A 1KQKA 2G1DA 1FESA 4R0JA 2BJ8A 2FHOB 7AT1B 3MI7X 1SXLA 2E66A 1C0UB 5KFXA 5HO4A 5D4NA 1S6QA 3NGRA 2PEBA 2JNJA 5AE3A 3SEOA 3CCTA 3ISND 4ZN3A 1Q86T 4C8ZA 2YKNA 1AROP 2HFSA 1E6VA 4OZ3A 3M7VA 4C0HA 4OZ1A 2F5GA 1HBNA 2XM3A 1FFSB 2FHKA 3VZHA 5CA5A 3KLEB 1HD1A 1HYSA 3OR2B 1S59A 6AT1B 2EG2A 3NBPA 2HRUA 3HVRA 4PG8A 2VF3A 5BR8F 1FRIA 1N33J 2GJ2A 3T3FA 1YDLA 3TJ9A 1RTDB 1T94A 2C3OA 2Y1JA 3U27A 1WF2A 1C1BB 3BB5A 4CLSA 4O3NA 4IOCQ 4LFAJ 2XMUA 4J9MA 1CQMA 2QG9B 3CWJA 2BANB 2RUSA 1WELA 3GIIA 4JOUA 1Q8KA 1IKXB 5THWA 4AL5A 4HEA9 3MM8A 3ILLA 4F4AA 2ALYB 1WHXA 2IC3A 2UVWA 2XI2A 1IBKF 4DR1F 2GAHC 1SQGA 2RKIA 2XMMA 1VQ6S 3H2UB 4C9DA 4MIAA 3NS5A 2GNKA 2XSFA 3F44A 1PAEX 3W8PA 4WYLA 2HZAA 3MM9B 1W7WA 3ZO7A 5IT4A 1N4LA 3FVYA 3BBFA 2DYAA 3M8RA 3CC4S 5L1JA 5J1EA 2B56A 2YNFA 2ZD1A 2YNHB 4PQUA 1VDHA 2ZJRQ 3UR0A 1B4SA 2VQEJ 2BE2B 1S1WA 2MHEA 4OZ5A 2YWEA 3FZBA 4I6WA 4U7CA 2LKZA 3SFUA
chains in the Genus database with same CATH topology
2DO4A 5ADZA 2VC1A 3CMES 3VF0B 2KFZA 2J9DA 3S1TA 3VAHA 3PHEA 4PPDA 4M63A 4NMLA 4ES2A 1T05A 5A6WA 4A8KA 1FXLA 2QO3A 3HP6A 4X64F 5K14A 1LXNA 1GQEA 4OIXA 3N5BA 3T5LA 2EC0A 4WTYA 2HFOA 3K5OA 2K3KA 4TU7A 1U1QA 4HDGA 2JL9A 3H4BA 1QAYA 5IQQA 2OPPB 3TW0A 2VFSA 3TQ1A 2BJEA 3R1HA 1Q82T 1VQ4S 3GFHA 3H2VE 1G1XA 2HNDB 1XNQF 4DBQA 2K3IA 5KFJA 3SYZA 1DFDA 2CPFA 1EETA 3M05A 3V4IB 3H59A 3GYXB 3WZ0A 3KK2B 1NK0A 3PX0A 2MKJA 2WSCC 1S9GA 3HHKA 3JSYA 2KG1A 2MKCA 5DLFA 2CJBA 1QJHA 2ILZA 4DUZF 3UCZP 2XSJB 5K8OA 3ZZZA 1Y00A 4QIGA 2R8HA 3AHPA 5KT5A 2XMKA 2BXJA 1KR4A 4I56A 3IRXB 3M1VA 4RNOA 1DAXA 3UPFA 1X4HA 1TKZA 3MWBA 3RU0A 3SQGA 2JLFA 1F0XA 4LIRA 2FHMA 4TYAA 5AXMA 1FJEB 1KLNA 4C3LA 3QO9B 3CCWA 3RB4A 4B3RF 4ED3A 5AXLA 3ITHB 2AYMA 4IQXA 2AD9A 5KFOA 1ZAXA 3MEEA 2VL1A 2M0GB 5FD1A 4EFAC 3KNGA 3LP0B 4OHVA 4DFMA 4RU2A 2QT7A 4ZPBA 2VKRA 1C0TB 1RQ0A 5B0AA 5GMKa 4Z2XA 5LXYA 3FQLA 2ERRA 1SC6A 2DD8S 2KXNB 1IKYB 4Y00A 1HNVB 2FVRA 1KEKA 4QJVA 1PC5A 1VOMA 2MKHA 2Z0GA 3KK1B 4QCLA 5IT9Y 3OFFA 5I42B 2HNZA 4EWTA 1FK9A 5JXSA 2KFYA 1RT5A 4OI2A 2VD3A 2ASLA 3CJ5A 3D28A 5JJBA 1KQSR 4K4UA 2WCXA 3LW5C 5CH7B 2R2RA 2CG4A 5DQIA 2W7AA 4IFVB 2MYFA 2ZH4A 1NJXA 2ROGA 5BYQA 4ILLA 2UUTA 1H98A 2I8EA 4RW7B 1G3OA 2E7WA 4Y2CA 2K7JA 2W8KA 1VQKS 2HVHA 5H1SV 2OMLA 4QYRA 4F3MA 3LUYA 5B08A 1FO1A 4GMKA 3DRYA 4IG0A 2XG8A 1L3VA 5DG8A 1KQFB 3DU5A 1CQNA 3TRGA 2C2DA 5L39A 3SDEA 4WFZA 1HFEL 2YNIB 2GA7A 4OZ0A 3M2UA 2XB2D 3SCKE 4Q5VA 1VQMS 3IFEA 2N3LA 2RD5C 2XS5A 1F60B 4O3PA 2WHOA 4A46A 4QYZJ 3DM2A 1W2BR 2V4JB 2ABYA 5IQ6A 3B82A 2IRUA 1JXLA 2BRKA 3JSMA 3N6NA 1VRTB 2KFNA 5I3UA 3IS9B 3V81B 1P1LA 1V3SA 1JLQA 2GJIA 2GHWA 2W9CB 2JFDA 1REVA 1A6LA 3HHLA 2F40A 3FMBA 3L3CA 3CEDA 2PGCA 4PXCA 3TR5A 2CQ3A 3PX4A 2RMLA 2PT0A 4RWXA 3QIPB 4ECXA 2XNQA 1SL1A 1IUJA 4B9LA 5SZTA 5FDLB 2XGPA 3DFEA 3E2EA 3DOKB 3QGIA 5KFTA 3KJV