4PUOB

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and nevirapine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
425
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 121
structure length 412
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4puoB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4puoB03
5KFPA 1C2PA 4ZMMA 4ECZA 3PW7A 4QWCA 3PW5A 4YMEA 3NKYA 4JV0A 1LWEA 2WB4A 1RA6A 5J2NB 5KFNA 2VA2A 4IFVB 5C25A 1RTJA 3IN5A 3CJ5A 2JEFA 3BSAA 5HROA 4FS2A 4ID5A 2WK4A 3TAMB 1EETA 2IC3A 3UQSA 5F8GA 3OLBA 2R8HA 4K4VA 1QAJA 4IFVA 3BR9A 2R8IA 3PW4A 4R8UA 2OPSA 4I2QA 1LWEB 4ID5B 2J6TA 5J2MB 2UUWA 1RTDB 2W9CA 1RTJB 4WXOA 2W7OA 3DLEA 4H4OA 4MK8A 5L1LA 3RB6A 2D3UA 1DTQA 1RYSA 4ECUA 4TY8B 3DI6A 3MFHA 3MF5A 3JSMA 3CDWA 1C0UA 4WXWA 4NLWA 4I7FA 4MKBA 1QE1A 4Y3CA 1FKPB 1LW2B 3JYTB 4ZP9A 3IS9A 4K4YA 1RTIB 1S1VB 5J2PB 2WRMA 3GIJA 5KFJA 1D0EA 3GILA 3MR6A 1JXLA 2BRLA 4WE1A 2FVSA 3CO9A 3CJ2A 1EP4B 1C0TB 3DLKA 1OS5A 1W25A 5DQGA 2FJXA 2IM2A 5HBMB 4DL6A 1LW2A 4Q8FA 4Y34A 1HQUB 3QLHB 4ED8A 3I5BA 1C0TA 1TV6A 2YNGB 1N6QA 2FVRA 2XC9A 4IOBA 3DMJA 4M94A 3CJ0A 5KG3A 1VRTB 3PVXA 2IJFA 3QIDA 4O4GB 1S9GA 3ITHA 5KFEA 4KKOA 2FLPA 1JLAA 2YKNB 2YNFB 3I0SB 1T05B 4RW6B 4YR2A 3LP2A 3MEEB 3BQ1A 3RBEA 4IG3A 2AX1A 4QWAA 1RTHB 2IM1A 1TL1A 4JUZA 5EWEA 3CJ3A 1HPZA 4RW7A 4RW6A 2BE2A 1RT3A 1RT1A 3QGIA 2C2RA 3PR5B 4KKOB 5KFAA 3OL6A 4LQ3A 1S1WA 1TKZA 4ZP6A 2ASJA 3DRRB 4F4WA 2I5JB 5L9XA 4KFBA 1RTHA 3BGRA 3H4BA 2YNGA 4XPCA 4G1QB 4MIBA 4RW7B 4DEZA 4KFBB 3HKWA 1S6PB 1RA7A 2OPRB 1TL3B 5F8LA 2ZD1B 4LSNB 3KLGA 3DOLB 4NRTA 2C2DA 3PW0A 1S6PA 4K4WA 3KMSA 3NBPB 1MMLA 3IG1A 3C6UA 4R5PB 2VG7A 1HQUA 3QLHA 2J6SA 4O44B 2HWHA 3IGNA 3DRRA 1IKXB 4TY9A 2CJQA 4IKAA 4TYBA 2W7PA 5F8IA 5J2MA 4EYIB 2IJNA 3DOKA 4QWEA 3CWJA 3H5YA 1TKTA 4IR9A 3C6UB 4R5PA 3BREA 3BSOA 5C42B 2OH2A 2O5DA 4IG3B 2IAJA 1RT2A 3KLIB 3DDKA 4WYLA 5L1KA 4J9RA 3OSNA 3T5HA 1RYRA 1KLMB 3DYAA 5L1JA 2UVWA 2HNYB 1T3NA 4NLQA 4KSEB 3DI6B 4QW9A 5JUMA 4KV8A 3D5MA 5KT4A 2R2RA 2B43A 3DMJB 3PJWA 4KO0A 4QWDA 3QIPA 3IS9B 1SH2A 4HYKA 1CSJA 3VQSA 1Z4UA 4PQUB 1SV5A 3HVWA 1S1UA 3DM2A 1C1BB 2VG5B 2W9BA 1EP4A 5KFUA 5FDLA 4PWDB 3DOKB 3OLAA 3BJYA 5F9NA 5KFFA 4Q8EA 1YVFA 5DGAA 3QIPB 3H40A 1UWBB 4KB7A 3I0RB 4O4RA 1S97A 1RT2B 4RNHA 4QW8A 1R0AA 4RW9B 1FK9A 1S1UB 2RKIA 2HWIA 3UPFA 3IG1B 4IDKB 2UVVA 3NGDA 2AGQA 3LP1B 4KO0B 4HKQA 4IRKA 1TKXA 1IKXA 2ALZA 4DG1A 3C6TA 3KJVA 3FRZA 4RW4A 3M8QA 1HMVA 5DG7A 4I2PA 3LAMA 3DM2B 1LWCA 3E01A 3NL0A 3TAMA 2BQRA 1D1UA 1JLBB 4RW8A 2E9RX 4EBDA 4ECSA 4LSLA 3UDLA 4ED3A 2RF2A 4ECRA 4MH8A 4O3NA 1WNEA 3LP0A 3M8PB 4YQWA 2AU0A 2B5JA 3SFGA 5F9LA 4OL8A 1RAJA 5F8MA 4QPXA 5DLGA 2BQUA 5DQIA 3RB4A 2ZD1A 1RT3B 4LSNA 3KLGB 3KLEA 3QZ7A 4WZQA 2AWZA 4TN2A 1NNDA 3MEDA 3JSMB 4TQSA 1BQMA 2ATLA 2AGPA 2JLEA 3CDUA 2B6AA 1HNIA 3Q8PB 5KG4A 1IKWA 3ISND 4NLVA 2XI2A 2V4RA 1RTDA 5KG6A 3KHLA 3KHRA 4K4XA 1KLMA 3DYAB 1LWFA 3KK2B 1MU2B 2OPQA 4B3OA 1HNIB 3T5KA 2WOMB 4ZHRB 4ZP7A 5KG5A 4NYZA 4LSLB 4IFYA 3Q8SB 1S10A 5HLFB 3GV8B 1IKWB 1C1CB 4Q43A 3NBPA 1S49A 2IM0A 5EWFA 2E9TA 3HVTA 1TKTB 4NLSA 2R8KA 4NLGA 4NLOA 3BQ2A 4MFBB 5KG2A 3LAKA 2B6AB 5KFIA 1C1CA 1REVA 4QWBA 4ECQA 1JLQA 2VG6B 5D3GA 1IM4A 4TQRA 1TV6B 1C0UB 4ZPCA 2W8KA 4RW8B 1FK9B 2RKIB 3QYYA 3V81A 4KHRA 3MECB 4DL3A 1RT7A 3DRPB 5C24A 5F8HA 1K1SA 3TVKA 4K4ZA 4ZVEA 3V81B 5HLFA 5KFOA 4Q44A 1HYSA 2W9AA 3C6TB 3KJVB 2W8LA 3QO9A 2C22A 4JV1A 4ECTA 3KK1A 1R0AB 3H4DA 3MEDB 5T14A 2VA3A 3LP2B 3MEEA 5CYQB 1N5YB 4KHMA 4RW9A 2OPRA 1HPZB 1S0OA 1TKXB 1C1BA 1MU2A 2OPQB 2VG5A 3M8PA 2OPPA 5J2PA 1RDRA 3PR4A 5CYMB 1GX5A 4IDKA 3GV7B 4NLXA 5KFWA 1SH0A 5KT7A 1T05A 2FVPA 4ED1A 3RB0A 2WONA 5KG7A 3V4IB 1LWCB 3BGRB 3PJXA 2OPPB 5EWGA 1I6JA 4J9QA 4ECWA 4K50A 4NCGB 2BANB 1ZTWA 1JLBA 1JKHB 1HQEB 2YNHA 3CDEA 3FQLA 5DLFA 2AQ4A 2XGQA 2V9WA 3KLFB 1U09A 5KFDA 5I3UB 4R8UB 3QZ8A 3LP0B 4ED7A 4GC7A 2IC3B 3HHKA 3FFIB 1QAIA 4O3PA 2ILZA 3CIZA 3KLFA 3NAIA 5DGBA 3KK3B 2XCAA 4Y2AA 4TYAA 5KT2A 5KT6A 1K1QA 5J2NA 1LW0B 3I5CA 5KFLA 2R2SA 5KFRA 4DL5A 3SI8A 4IR1A 1TL3A 2RF2B 4TXSA 4X2BA 3QGHA 3OHAA 4URSA 3V6DA 3DLGB 4NRUA 3Q8QB 4ED0A 2IAJB 3V6KA 4K4TA 1JIHA 2R2UA 3N6MA 4LQ9A 2UVRA 2WCXA 2HNZB 2XWYA 4J9LA 2F8EX 1TVRA 3ISNC 5J2QA 3MR5A 1HARA 2OPSB 4I2QB 4RUCA 3DLEB 4H4OB 3NMAA 1TP7A 1UWBA 1ZTTA 1SH3A 3UR0A 5F8NA 4IG0B 4Q0BA 1S1TA 1S6QB 1VRUA 2D7SA 3LANA 5C42A 1S4FA 2E9ZA 3FSIA 3V4IA 3QO9B 4WFXA 2ILYA 3MR2A 2JEIA 1NHVA 1JLGB 1SUQA 2YKNA 5KFQA 3T19A 2HNYA 4NCGA 4IH5A 2V0NA 2R8GA 2ASLA 2JC0A 3M9NB 5KT5A 3HVTB 3HVAA 4RNNA 3I5AA 2IM3A 2DPJA 4J9OA 1HYSB 2C28A 2BE2B 3M9MB 1HNVB 1BQNA 1N56A 4ZPBA 4MFBA 4ZVHA 1J5OB 1T03A 4FBTA 3DOLA 2ZE2B 4IQXA 4RW4B 1S1WB 1N5YA 3GV5B 3DRSB 1S9EA 3M9OB 4H4MA 3N6NA 4M95A 4RNFA 3MFIA 1JLFA 4R0EA 3RAQA 4GC6A 5I42A 2GIQA 3E01B 1RT4A 2XGPA 2AGOA 4G1QA 4K4SA 4I2PB 1JLCA 1S9EB 1JLEB 4U6PA 3TQ1A 4FS1A 3E51A 4IH6A 5JXSA 1DTQB 4ECXA 5EUHA 4JV2A 1GX6A 5KFZA 1TKZB 4EEYA 2JEGA 3LP1A 3KK3A 1VRTA 3RBDA 2BR0A 2FVQA 1BQNB 1XR5A 3EPGA 5FDLB 4PWDA 2AX0A 5DQHA 3PW2A 1S48A 4RNMA 5KFMA 1JLCB 2J6UA 3H98A 1BQMB 2I5JA 5I3UA 1S6QA 1VRUB 3GIMA 3OL9A 4RUAA 4EO6A 2IA6A 1JKHA 1HQEA 3N6LA 5F8JA 4ICLA 3OL7A 3DLKB 4IH7A 3DRSA 2W9CB 4EBCA 5C25B 1SUQB 2HNDB 1N4LA 3IRXB 4O3QA 1SV5B 2I1RA 3RB3A 1QE1B 3KLEB 4YP3A 4MK9A 3DLGA 1S9GB 4ECYA 2XCPA 2D3ZA 1IKVA 1S1TB 2HNDA 1XR7A 2CKWA 3OL8A 2EC0A 4H54A 1JLGA 4ED2A 5KFBA 3ICLA 4MK7A 3H59A 1FKPA 4EBEA 1TVRB 3QGGA 4NLPA 4F50A 3GIIA 3H5UA 3SFUA 1N6QB 4PQUA 4TLRA 4Q0BB 3V6JA 3GQCA 2C2EA 4KAIA 4PUOB 5KFKA 2WTFA 1REVB 1IKYB 4DG1B 2HMIA 3V6DB 4O4GA 4RNOA 3BSCA 4KV8B 3BQ0A 4F4XA 4EYHB 4PUOA 4K4UA 3H2LA 2HNZA 4U7CA 5KFSA 4URGA 5KFCA 3G6XA 4O3RA 5HBMA 4MIAA 1IKYA 2JEJA 1JLFB 4NLTA 3CVKA 4O3OA 3EZUA 5L1IA 1HMVB 1QUVA 5KFYA 5DG8A 1DTTA 2W9BB 1T03B 2ASDA 3OSPA 3I0RA 3G6VA 1N48A 5CYQA 3KLVA 1JX4A 2GIRA 4DL2A 4O44A 3D28A 3FDSA 2BQ3A 5EDWA 4YR3A 4IRDA 5KG0A 2DPIA 1DTTB 1TQLA 2GC8A 5KFVA 3KK2A 5J1EB 2FLLA 3GIKA 4XO0A 3ITHB 4WZMA 4ZPAA 4J9KA 4J9SA 4ECVA 3MECA 3KMQA 4RZRA 1NHUA 3OHBA 5K14A 2WHOA 3FQKA 4XPEA 3G86A 2QV6A 4J9NA 4Q45A 3G6YA 4F4YA 3MEGA 2B5JB 4WFZA 1RT6A 3KLHB 1KHVA 4URQU 3KHHA 1DLOA 5HP1B 5C5JA 5DG9A 3T5LA 1RTIA 1S1VA 3KLIA 2FLNA 2IBKA 5KFTA 5HP1A 2IMWP 5CYMA 3IRXA 4TY8A 1KHWA 1ZETA 2FJWA 3EPIA 4B3OB 3H5SA 3V6HA 3BSNA 4ICLB 4NLYA 2YNIA 3LALA 5KFHA 4O3SA 1S0NA 1RT5A 3MEGB 4G3IA 2RDJA 4NLDA 4YR0A 4IRCA 3KHGA 4IG0A 2YKMB 2XI3A 4KBIA 4FBUA 1DLOB 2BRKA 4WE1B 5J1EA 5KFXA 4WYWA 5KG1A 2RDIA 2ZE2A 4NZ0A 3T1AA 5J2QB 1IKVB 1T94A 3NAHA 1LWFB 4ZVFA 5KFGA 1RT5B 1S9FA 4Y2CA 4RU9A 2WONB 3JYTA 1EETB 1RT1B 4ZP8A 3H5XA 2VG6A 5D3GB 1HNVA 2YKMA 5K14B 2D41A 4IFYB 1JLAB 3T5JA 3PHEA 3CJ4A 2R2TA 2YNIB 2UUTA 4ZPDA 2HAIA 2YNFA 3I0SA 3KLHA 2FVCA 4ZVGA 4EO8A 1XR6A 4J9MA 1J5OA 1S1XB 5KT3A 2UVUA 2HMIB 4MKAA 2R8JA 1TL1B 3GYNA 3KK1B 4NLRA 3FFIA 3KNAA 4I7FB 4H4MB 1FKOB 2FJVA 4F4ZA 1JLEA 3RAXA 3MR3A 1JLQB 5HROB 3IGVA 1RT4B 2WOMA 4ZHRA 4KE5A 1LW0A 3PZPA 1S0MA 2JC1A 3Q8RB 2YNHB 3KOAA 3MTKA 1S1XA 4DL7A 1RT7B 3DRPA 2BANA 5C24B 4WFYA 3M8QB 2VG7B 2V4QA 1RT6B 1FKOA 4DL4A 4J9PA 2ZKUA 4ED6A 5I42B 2QE5A 4NLUA
chains in the Genus database with same CATH superfamily
2KRBA 1YJ7A 3CO0P 3DHWC 2AIRB 1C2PA 3EVOA 2H4WB 2VFRA 3M1VA 3R2CJ 3MM7B 2NPIA 4ED4A 4ECZA 3OFFA 1KS2A 4JV0A 1ZA2B 1YJTA 1RA6A 3TO8A 2YPZA 1UJ4A 5C25A 5CA5A 2HLUA 2JEFA 4LF5F 3LGMA 4V19J 3ZTRA 5HROA 1UTAA 1NH7A 2M52A 4DLEA 3TAMB 1QDUB 1VQOS 4I4BA 2OKQA 3SMZA 2P5VA 2I2YA 4I2QA 3NP5A 4ETZA 3I31A 4DU8A 1VISA 1XMBA 5ETRA 4M5IA 1T9YA 2FQQB 4Y28C 3RAMA 1RTDB 2VFTA 3TOQA 5K8NA 4WXOA 2ZM6J 2ZUAA 1CJUB 2LYVA 1SKUB 2XSJA 2I9SA 4WIIA 5E33A 1VI7A 4ZLNA 1U02A 2XB2D 4CLLA 2LFVA 2E7WA 3CDWA 3MM9B 4U8VA 4ATNA 4OZ1A 2QEXS 3P49B 2OJ3A 4DZ6A 1YBTA 4LRDA 1SJFA 1LW2B 3JYTB 4ZP9A 3TX8A 4K4YA 4A8MP 1RTIB 1S1VB 5J2PB 3J80Y 5KFJA 3Q0AA 1D0EA 1GMUA 4K7QA 3OV7A 3GILA 1JXLA 2XO7A 1KSPA 2OTLS 2BRLA 4WE1A 3CO9A 1W2IA 3CJ2A 4CLPA 2OMOA 1J5EF 3ZO7A 3GJQB 1F9FA 2BJ1A 2IM2A 2UXCJ 3TJAA 2GW8A 2B4OA 2IVFB 1S77D 2XC9A 2FVRA 4WKYA 1KNZA 5IV4A 2E5LJ 4M94A 3M32B 3GMGA 5ETQA 1NJZA 1D9DA 2CPEA 3EJMA 4WP3A 1WOSA 1U1RA 4DFJA 2RB7A 1U0SA 2FLPA 2YVSA 4YOEA 3H7HB 4Q7AA 3I0SB 5B0EA 2E1MC 1ZAVA 4JI1J 1TUVA 2R7XA 4NASA 1QSSA 4QWAA 1RTHB 1M90T 1IJEB 1RZMA 1X7VA 1VS3A 3CJ3A 2VQEJ 2FB0A 2XMKA 2VPZB 2YTCA 1LK5A 3HSZA 3K5LA 1RT1A 3QGIA 2YKPA 2C2RA 1M1HA 2V94A 3M30A 5KFAA 5M2PA 3OL6A 1S1WA 2Y1JA 3FNNA 4LBPA 4USJC 2WSFC 4ZP6A 2ASJA 4EZ9A 3DRRB 5ETPA 2VOOA 2ZH4A 3KYLA 3ZC4A 3BGRA 5ETVA 1P1TA 2YY3A 2YNGA 2AJ1A 3M30B 1HHQA 3O8WA 5CHCB 4HR2A 4MIBA 2UXBJ 1H7XA 4RBTA 1RSCA 5ETKA 4DEZA 1RU1A 4ALZA 3U7JA 5J1PA 2KYZA 2LU2A 1RA7A 4ZLJA 4P75A 1NDKA 1ZM9A 2DNNA 3D66A 5F8LA 4X62F 1UA1A 4NRTA 2UU9F 3PW0A 3C15B 4K4WA 3KMSA 5HL7Q 4WJBA 3K5NA 2DGWA 1N0UA 1RHUB 3IG1A 3FJ2A 3DC2A 4JI5F 2MKYA 2VG7A 3QLHA 3EDRB 4JI8F 3OUYB 3HHLD 3IGNA 3GYGA 2N4DA 4TY9A 5C7PA 3A4TA 5GMKa 4CIOA 5MAOA 2B51A 4TYBA 3RYLA 2W7PA 1ZM4A 4JI3F 3HO1A 2CVIA 5IC6B 4LRCA 4ANDA 4QWEA 2DNZA 1Q8KA 3H5YA 3QPIA 2A18A 3C6UB 2HQIA 5C42B 2QMXA 2DR6A 3MMAB 4AL6A 3DDKA 4F7VA 1DARA 3P45B 2DJWA 3K57A 3KTQA 1NB2A 1FDBA 3BGOP 1Y10A 2LQ9A 3MMJA 4LUBA 1KN6A 1VMBA 1N33F 4J91A 1L3SA 4KSEB 2UUBF 1LXJA 4X4PA 2ZNZA 4DX8H 4KV8A 5KT4A 4Q2LA 1NKCA 2BM0A 4UT4A 1YKWA 2CJKA 4LIRA 1JK9B 3T3FA 4LBIA 1CSJA 4DX6A 4PQUB 2XY6A 4LF7F 3J7AN 3DM2A 1PSDA 2DNLA 2NLWA 1NM2A 1XBWA 3IAM9 3O1LA 4LT6A 4NOHA 3S6EA 5H9FJ 4DCOB 5FDLA 4PWDB 1AUDA 3OLAA 3HX9A 3PV8A 3BKUA 1ZH5A 3I87A 2MY7A 2HFNA 3NCRA 1WD6A 5AXLA 4DV4F 2B9XA 2G0IA 4W92B 1FHTA 2KDOA 4M5MA 3PACA 1FK9A 1SL2A 2HWIA 4F36A 1U6FA 3CPWR 1RWWB 1CJVA 3QRPA 3M6VA 2RVJA 1WOPA 2ZBQA 3R5CA 4B9MA 2UUCJ 1SKSA 4DR2F 2DRBA 2F8MA 4C0OC 2AYBA 4GKKJ 2ALZA 3FRZA 4FXDA 1HWJA 3AQPA 4PXCA 2BJ7A 4RW4A 4A8KA 1UVNA 1CJKA 4L6V3 4DZDA 3MM5B 1PJ6A 2C3UA 1LQ9A 1NXIA 1Y5LB 1D9FA 4DX7A 1S12A 5IWAJ 3E01A 3CJTA 3NCPA 1EB0A 2BQRA 2AJ2A 2ZHBA 4PQAA 4HHUA 2E9RX 3MXHP 4KR0B 4C2MA 2RF2A 1X4CA 4ZVRB 4ECRA 3LP0A 1RHJB 4YQWA 3BM7A 4A47A 1NJXA 2B5JA 3SFGA 1Q4RA 4GO7X 3P5BP 1RAJA 1YRUA 2AYGA 2BQUA 1UL3A 3KLEA 4A46A 4WZQA 4DFKA 4OZJA 4DV5F 1NNDA 3ILJA 3MEDA 3JSMB 2G2YA 5K20B 4DUYJ 1BQMA 2ATLA 4B3TJ 3FZ2A 5D78A 2AGPA 2JDJA 1EHWA 3Q8PB 3EX7B 3MMBA 4C8LA 3ISND 5A76A 2COLA 2XI2A 1XNRJ 4CTAB 4K4XA 1V6HA 3CCWA 1HQ2A 2OPQA 1BXNA 4PWWA 2FDNA 4ZHRB 1FDAA 1GFWB 5B0BA 2KFYA 2FJEB 2UV8G 1FRJA 4NYZA 2W4CA 2KVIA 3MR7A 4LSLB 4IFYA 3PCOB 3V4MA 2D9OA 1IKWB 2Y0BB 1C1CB 2C3YA 1N0VC 5EWFA 3HMJG 3MPWA 1X9MA 2J7KA 3NLCA 1FXRA 1KWMA 2BVZA 2W2OP 3R5DA 4OHZA 1KFSA 2A6OA 4N77A 3K0JA 1RK8A 3PRDA 4MFBB 5KG2A 5K8PA 5KFIA 2B6AB 3H2VE 2ZJQQ 4YS2A 5LT5A 2DITA 1LV5A 5D3GA 3IBWA 1IM4A 3BYRA 3LGHA 4KGZB 1TV6B 3PM9A 2RKIB 2QN6B 3QYYA 3V81A 3JQMA 4EUVA 5A0YB 1ZOTA 3BZQA 1RWOB 4DL3A 4B9UA 2IDLA 4LVOP 4GKKF 1Q78A 1CULB 2J0XA 3VHQA 5IXUA 2L41A 4K4ZA 2HEKA 3V81B 5HLFA 5KFOA 3C14B 4BDPA 2HPUA 4OX8A 2PMWA 2BM1A 2DEIA 2HBYB 2V2KA 5T14A 3MPVA 3OXGA 3G9CA 4M5NA 3LP2B 3MEEA 5B0FA 4ELTA 2EFGA 2JX2A 3W9HA 5CYQB 5D0EA 3UDVA 5CD4A 4X64J 4E0DA 4FYDA 3PYGA 3IAS9 1B0PA 1OQ6A 2Y9HA 2R7TA 1RDRA 1VGYA 4K0KJ 5CYMB 3OVSA 5M2UA 5KFWA 1SH0A 3B4MA 1UFKA 3D6TB 5U47A 5KT7A 2RJZA 2PA3A 3PX6A 3RB0A 9RUBA 1ACMB 5EWGA 3DKDA 3R6GB 3KUHA 4DV2J 4ECWA 2ZWOA 3IBCB 4K50A 3P5TL 3Q23A 2XTJP 4U9RA 5A6PA 5FJ4A 2EKNA 3RJMB 5EHHA 2E44A 2V9WA 2YNHA 2GJFA 3QZ8A 1FNMA 5I3UB 4R8UB 3Q22A 3LP0B 4DV0J 4A8WA 4DR7F 1H6KX 4CT9A 2AP6A 5HMYA 4GC7A 1M5OC 3H20A 3HHKA 1QAIA 2Y0SD 1U8WA 4U7UK 1X0FA 1Q79A 2G4BA 1QJHA 3D54A 5KT2A 2Y8YA 2O66A 2W1BA 1K1QA 5KT6A 5J2NA 1FX4A 5GMEA 3CCLS 4DMZA 3W9IA 2RQ4A 1RBAA 5E41A 1HR0F 1FDNA 1TFWA 3GCXP 3TA0A 5B08A 2I0XA 4XIUA 3Q86A 1H72C 1JJ2R 4ED0A 3Q8QB 3NMRA 4OYAA 2PMZD 3BF4A 4LQ9A 2XULA 2FHJD 4JI6J 5J2QA 1EX8A 2OELA 3ENAA 1HARA 4I2QB 2DXDA 4K8RA 3DLEB 4H4OB 2DHHA 3M2UA 5HVGA 1Q7YT 1SH3A 3UR0A 4ZITA 3LWLA 3UCGA 4CH7A 2N3LA 4IG0B 1NSKL 1S1TA 2D7SA 3EGVA 1KTQA 3CF5Q 3LANA 1R27B 2L9WA 5C42A 3EYZA 1BC6A 3AD9C 3V4IA 3QO9B 3D1HA 1IXKA 3P96A 4WFXA 1VIXA 2MKCA 4DQRA 1FD2A 4BCAA 5AE1A 4TVAB 3RR7A 1L5UA 4LFAF 3L7UA 3R6LB 2DGUA 3RW6A 4C9DA 2WVCA 3G82A 2V8HA 3DLLQ 1OSDA 4AL7A 2VL1A 1CS4B 3WC0A 1HHSA 3QRQA 3I5AA 2IM3A 2RUGA 1WKKA 3VAMA 3MM7A 4USKA 4J9OA 2GJIA 4ZPVR 3OXLA 2C28A 4KGXB 3M9MB 1HNVB 2CNOB 4RBUA 1WJ9A 1LKZA 3HJFA 4ZPBA 1BWEA 2I38A 2LA4A 3SQOP 3JTPA 3KJQB 4YB6A 1J5OB 4R0JA 3W62A 3TNVA 1VQPS 3DOLA 2EWHA 4OYPA 5D4OA 4ZK7M 5GADU 1EKRA 2IYIA 3OR1B 2HZVA 4B3SF 3IRWP 5HN0A 2HG4A 3Q89A 3GV5B 4X4VA 4H4MA 3N6NA 2DGSA 4RNFA 3MFIA 1JLFA 1VQYA 4JI2J 5I42A 4TU7A 2V8VA 3H8YA 1J2VA 5GMDA 5F0UA 3AOCA 1KRPA 2J5AA 4LF4J 4G1QA 4C11A 3TQ1A 1JLEB 4JV5J 3W63A 2YWWA 2B8PA 4IH6A 2A2DA 3VR1A 3A12A 1MWYA 2HQFA 4LF1A 4JV2A 4CLZA 2AYEA 5KFZA 1TKZB 2CPZA 3TRGA 5HVHA 2CG8A 3DRXA 2UXDJ 3KK3A 2FYXA 1BQNB 2J9CA 3PW2A 5DQHA 2J6UA 4RNMA 1UP1A 3V2UC 4N56A 1NK9A 1CVJA 3H98A 4USTA 3EMTA 4QIVA 1S6QA 1VRUB 3OL9A 3GFXA 1FRHA 3N6LA 4F4KA 4IH7A 3DRSA 1RABB 2W9CB 2RMLA 5AXNA 3CCTA 5GAHU 2M8HA 1WI8A 3GSDA 4UZBA 1PAEX 1RLDA 1E6VB 1R8PA 3TARA 2KTQA 1SJQA 4UOFA 4WTOB 4WFBQ 4USUA 1QE1B 2V68A 3VAHA 3KLEB 1NK0A 2AJQA 1HNZF 4DQPA 5DDPC 1NRKA 4LF9F 3DLGA 2HK2A 4ECYA 1WG4A 1WHYA 2XMWA 1PILA 2X1AA 1I94F 2HNDA 1XR7A 2E1AA 4ANEA 3OL8A 4DQIA 1HWIA 2VPXB 4JI5J 4H54A 5AT1B 2CG4A 2OFGX 4KIAA 2HAFA 1M5SA 5B09A 3OR2B 1L3UA 3H59A 4NLPA 4FXWA 5CXTA 3GIIA 2DHAA 2CQPA 5BXIA 4Q0BB 4KAIA 4OI1A 5KFKA 5LJ5Y 1REVB 5BR8J 4O0IA 2EFPA 2HMIA 4B9LA 4O4GA 2CZVC 1KVKA 3LF0A 3AA8A 1R43A 4LF4F 2DR7A 3J80U 3AD8C 2DR8A 2BJEA 2IA0A 2WSEC 1LNQA 4KJIA 3CNQP 5HI7A 5KFSA 3KFWX 3SDEA 1FFSB 1NDLA 1PIEA 2U1AA 3G8QA 3RW7A 4URGA 3ULHA 2FGCA 1IKYA 1R8BA 2LEBA 1Q0NA 1FD8A 2JOQA 3LW5C 2HRTA 3CVKA 5L1IA 3A3PB 2X51A 5KFYA 5DG8A 1SXLA 5IM0B 2ASDA 2F9DA 4M5GA 1N48A 1Y3JA 2DY9A 1UW9A 2GIRA 4NCAA 4JI1F 4DL2A 4DWIA 1IQZA 1PG5B 4B3RF 2QX0A 4NXNJ 3CD7A 4ILRA 2DPIA 1UKUA 4K59A 1DTTB 1NDCA 5IT9Y 4G1IA 3KK2A 2FLLA 2VDHA 4FN5A 2KG1A 1U45A 1B3TA 4D3GA 3CD0A 1S99A 3ZZTA 3MUMP 1GQEA 2CZ4A 3OTBA 1U1NA 4ZPAA 1N54B 2MLZA 4ECVA 5LSRA 3RTVA 3R5GA 3VAJA 5K14A 2G1HA 4IO9Q 4BWMA 3NOGA 2ZZNA 3QQCD 1MMDA 2JSXA 4CI0B 4J9NA 3TAPA 1OWXA 2KXHA 2HURA 1KQKA 3PYFA 2IBOA 4F0HA 3KLHB 3G87A 4URQU 2AJFE 1F3FA 4C8KA 3TI0A 3BGFA 1Q86T 3K5OA 4Z37A 2KT3A 2DGOA 1RTIA 1S1VA 2PD1A 1AXQA 2QZ8A 2YXLA 3EXYA 3FCWA 3MM8B 1KVJA 5KFTA 2K1RA 1OYDA 2MZRA 2GMLA 4DOZA 2LEAA 5DO2A 1WSVA 2R7QA 1KHWA 2POKA 1RAOA 1JJCB 3LQVA 4H4KA 3JAMU 3EPIA 3DGPB 2F7VA 3VQTA 5LM7E 1SJRA 3DCAA 4DV7F 4ZIVA 1X4EA 4RR5A 5KFHA 4JI0F 3KXDA 4DV1J 1S0NA 3B78A 4U67Q 3MEGB 3MM6A 4QIGA 2NREA 2XM3A 2RDJA 3BDPA 1RISA 3KHGA 1Q53A 2XI3A 2BXJA 4FBUA 2BRKA 5KFXA 2QFIA 2IJRA 5DRKA 5KG1A 4C4WA 5J2QB 3IM8A 3NAHA 5G0RA 2Z2LA 5KFGA 4ERDA 2R3VA 1RT5B 2DCLA 2EC2A 1HI1A 3MCMA 4ZVGA 1XTZA 2WONB 2JWNA 1RT1B 1NU4A 3A13A 4RU9A 5CZXA 3GZ7A 4QR1A 5J1NA 4IFYB 3GB0A 4YDDB 3J7Z5 2GHPA 4G1PA 4OYIA 4QBUA 2IHR1 1M0SA 4ZA1A 3T5JA 1RHKB 3IXQA 3OVBA 1BY9A 3CJ4A 2YNIB 2NSCA 2UUTA 3OT9A 1U47A 4NWBA 4J9MA 1RWKB 2FVCA 2VBXA 2ZBRA 1XR6A 3A1YG 1S59A 1OSCA 2YKQA 2RE1A 2RILA 4PXBA 3ZTQA 4DPTA 3BO2A 5D0HA 2QJ3A 3W2VB 1O6XA 3KK1B 4N8NA 2WZ1A 4NLRA 2QL7B 3V5RA 3KNAA 2CFXA 2VIHA 4F4ZA 2H1YA 3MR3A 2M3DA 1WC1A 5T7LB 4OHXA 1RT4B 4ZHRA 3CC7S 3Q8RB 4DSFA 1CG2A 3BB5A 3MTKA 3AXKA 3OFEA 4WFYA 3SXLA 5DDOC 3POTB 2XMMA 3QGPA 3M8QB 4MJKA 3D2WA 1FJGF 2VG7B 1OQ3A 2OSQA 1W26A 3N79A 1FRIA 3CC2S 4LF5J 2GIFA 4WF9Q 1R0BG 2ZKUA 3CW2C 2LA6A 5I3QA 5I42B 1TL7B 4P2FA 2QE5A 4ES2A 2UU9J 2E9TA 2AYMA 5KFPA 1TMMA 2OO4A 2RQMA 1JJHA 2B8QA 2F65A 2FIUA 3NKYA 4R25A 4YMEA 2XSFA 2WB4A 2JLFA 2RRBA 3D4JA 1QY7A 3BGUA 3IN5A 2VH7A 4FS2A 1GMVA 2WK4A 1EETA 2IC3A 4QIFA 4WBFA 3UQSA 1QAJA 3BR9A 5F3TA 4LF7J 4R8UA 2XG8A 1JB0C 2B7CB 2ZC3A 3C14A 3QT5A 4LR8A 5D15A 5J2MB 5JJBA 3TAQA 2W9CA 1RTJB 2C1EB 4C48A 4PRFA 1YWXA 4DF4A 3RB6A 3FBEA 3U27A 1RYSA 5AJ3J 2O3DA 2W2QP 1U6ZA 5HVFA 4WXWA 2JHEA 2PEBA 3KNGA 1TR0A 1XIQA 2GO9A 4KGVB 3VAKA 1ZZNA 1QE1A 4DPOA 1FKPB 3W5YA 4P6QA 3OD2A 3AJ1A 3GIJA 5D6GA 1RWVB 2MKKA 3SYZA 5CZVA 4YB5A 2DNRA 2A10A 1YLXA 2QYGA 1SJ1A 3JSBA 2HIYA 5DQGA 3OR2A 2SXLA 8AT1B 4RPFA 1H7WA 3QLHB 2DNYA 1XJWB 1H2TZ 5B0GA 4B02A 4C0HA 1DQ8A 4IOBA 2EG2A 1MNEA 2XY7A 2HVIA 4GMKA 4RO0A 3ZZPA 3PFOA 4OI2A 2IJFA 5E3AA 4ED5A 4O4GB 2MKIA 3ITHA 3UNYA 2DGQA 3H25A 1T05B 3AH6A 1HI8A 4RW6B 1T02A 2DT9A 5E5NA 3R7SB 1KONA 4KRWA 3E3XA 3BQ1A 2AX1A 1IWGA 2NZCA 3AT1B 2DK2A 1YRXA 4RW6A 2NXJA 4RUHA 4QYRA 2LMIA 4LQ3A 2FGOA 1FEEA 2YBVA 3C66A 4X65J 2BOPA 1VR6A 3MD1A 3EDQB 3GPAA 2GVZA 3ELHA 2WSCC 4X4NA 1U1OA 4C8ZA 1RKIA 2MZSA 4ZOSA 2E5JA 4RW7B 4QQBA 3P3DA 4CNZA 2YWGA 3ONQA 2GVZB 3HKWA 4RL1A 3FCHA 2PMHA 1RB0A 4QZVB 3G71S 3CC4S 4Y2MA 1L3TA 1KFDA 3DOLB 1IQTA 4P71A 2MGZB 4MAKA 2HVHA 4CO2A 5AJ3F 2C3OA 4QOTA 4AQYF 4OX7A 3C6UA 4JI7F 2O01C 1NK6A 4DPXA 2OD4A 4DR3J 2LEPA 1Z2ZA 4JYAF 3NXZA 2AD9A 2VV5A 3FK4A 1U0HA 5D4LA 2G0CA 4EYIB 4DR5F 2IJNA 2VD3A 5RUBA 2J0QD 3CWJA 1Y5NB 5A8WB 2NSBA 3BREA 3D0HE 4HACB 3BSOA 3PYDA 2DRAA 1FJEB 1M1KT 4WP9A 4JYAJ 3RRGA 1RT2A 4WYLA 3CD6S 5L1KA 1HD0A 3C16A 3ENQA 2J7UA 4OX6A 1KLMB 3DYAA 3RZAA 3PIPQ 1XNQF 1O51A 3HHLB 5A8KB 3M6UA 1YSJA 4QW9A 2CQ0A 3OTDA 2DH9A 5JUMA 2HRUA 4KO0A 2K06A 5I4MA 3W1YC 1FX2A 5F3ZA 2ZH5A 1SH2A 2F4VF 3HFKA 3VQSA 2R8JA 2KU7A 4X4QA 3HVWA 1VIOA 1X5SA 3H4BA 2XZDB 2YH1A 4EI2A 3R3TA 4ZCMA 3EXCX 3HT3A 2W9BA 2DB1A 3DOKB 3ZTOA 5HMXA 2ZJRQ 4JBCA 5F9NA 3BJYA 1D8ZA 2DY1A 1DAXA 2FUG9 3QIPB 4OYOA 3H40A 5F0WA 2R7WA 5DGAA 3I0RB 3B54A 4EK2A 5HMWA 1MG7A 1YJ9S 1S97A 4HHHA 2ZUGA 3IC1A 1R0AA 3K8VA 4QW8A 3UN2A 4CLWA 4CZCA 1YI2S 1H98A 1K44A 2LXIA 2HGNA 2R7VA 2YX4A 2UVVA 4HKQA 3U1MA 1TKXA 1IKXA 1MWQA 3C6TA 1KR4A 4KQZA 4OJGA 1X9WA 5E3PA 3EUNA 1KVIA 2CXEA 1R7IA 4I2PA 4O23A 5KOWA 1G1XA 1R6YA 1LWCA 1GAOA 2E29A 2HVZA 4UUXA 3HSJA 1TFYA 1SQFA 1JLBB 2PO4A 2WVEA 1WEXA 4ECSA 1NUEA 4F3QA 4I1TA 4ED3A 4MH8A 3M8PB 5DM7Q 1N8RT 3M2RA 4DPYA 5F9LA 1S72S 1T9VA 5F8MA 1U48A 3NGUA 1U1LA 4H4KC 5DLGA 2RU3A 2J0WA 1RT3B 4NMXA 1QD1A 3VALA 4A8OA 3T9NA 4TQSA 2MJUA 2B9YA 3UI3A 4EFAC 1DZ5A 4OX9J 1IKWA 2W24A 3D6FB 3KDOA 1NDPA 5KG6A 3KHLA 3QNWB 3KK2B 4B3OA 1HBNB 3JTNA 2CNLB 3MDFA 1MMNA 3GSIA 1SI9A 3P8BB 4KHPJ 4ZLLA 2XO6A 1U4BA 1RAHB 1TK5A 3NCQA 1S10A 1O0PA 4DCPB 3NBPA 2IM0A 1R89A 3M8RA 2VF3A 1VJWA 4RLEA 3WX4A 4OYWA 4RU2A 2JJ4D 1EQ0A 1AZSB 1ZS6A 1IR2A 3MTJA 2YKAA 4JI4F 3CCQS 3CTRA 5G4DA 1VQ5S 4OYZA 4NLGA 3I32A 2EW9A 2BACA 2M88A 2GVDA 3N5FA 1V9OA 2B9EA 2HBZB 4LSZB 3FSXA 2E5HA 3MCSA 4QWBA 5DETA 4ECQA 4C7QA 1SKWA 2VONA 2VG6B 4AL5A 1G2EA 4ZPCA 1LEOA 1FK9B 1DJ0A 1Q8LA 2EBEA 2K1RB 5L9NA 4Z7CA 3PKMA 3DRPB 3VZHA 4ZLPA 4LRAA 3CE8A 1HNZJ 3VAIA 3F0NA 4BC7A 4B3RJ 2FZCB 2HLTA 2HGMA 4LFCJ 4N41A 4M8LA 1HYSA 2CQCA 4BLGA 3HVRA 1FWLA 3SQGB 5IQ6A 2C22A 2OEKA 3FEYB 3QFHA 3H4DA 4QR2A 2RU9A 1WG1A 3ETOA 4CO5A 2NXEA 1JWWA 3C2PA 3CEDA 3Q24A 1N5YB 4LFAJ 1PYSB 2OPRA 1F0XA 3NS5A 4E2FB 4Z2XA 1S0OA 1C1BA 3PR4A 2GMHA 2Y3YA 3AFGA 4A8YA 4FXVA 3GCWP 2BE7D 1N5QA 2GCFA 1T05A 3S8SA 4ED1A 1FWKA 1SBRA 3CJSA 2WONA 1KP6A 3RGIA 3V4IB 1WF2A 3BGRB 3E2EA 1SL1A 3SZ2A 4ZVUB 1VQSA 2FJAB 4F25A 2F5GA 3W5ZA 1SJ4P 1F2HA 1BE4A 1ZTWA 2V67A 3Q83A 4ZVSB 1JLBA 2CUYA 3CDEA 3FQLA 2XGQA 4JI2F 1X4DA 2UZAA 5KFDA 1HBOB 4LF8F 3ZZ0A 4LFBF 4ED7A 5D77A 2BJ9A 5CCLA 3OFHA 4DSEA 4CLYA 2HFZA 1NKEA 3HHEA 4ZKAA 3D1QA 5DGBA 2XCAA 3UO0A 4Y2AA 1KEKA 2IRUA 1S7HA 4DR6J 3RUBL 3I5CA 1OY9A 1RLCL 3PKYA 4IR1A 1C4CA 4TXSA 1HHTP 2DNMA 3NEKA 4HEA9 1AT1B 3V6KA 4N8OA 3PHTA 1Q8IA 2IAJB 2H3EB 3ENWA 4RWXA 4UF4A 1JIHA 4X66J 4K4TA 2Z30B 3N6MA 4C0BA 4DJBA 3DU6A 2DCUB 1R3NA 1X8DA 2KJWA 3CGIA 3F41A 3ISNC 2PSZA 4GO5X 1AW0A 3W2VA 2QGFB 3W65A 1VK8A 4S0MA 4Z7YA 3MAQA 1CJUA 3G8SA 3NMAA 1FCAA 4DHVA 1UWBA 1ZTTA 1GXTA 2EK1A 1IBLF 5F8NA 2YWHA 3TZYA 1K0VA 1E6YB 2CQDA 1X31C 2H5IB 2VQFJ 3NS6A 1S6QB 1VRUA 3I9ZA 1Y5IB 2MQOA 1YITS 1YGYA 4ZJOA 5T41A 4HL9A 1VLOA 1VQLS 4L72B 1KQGB 1XEZA 1NHVA 4OZNA 2YKNA 4CO1A 3WBZA 3UE2A 4LFBJ 2V0NA 1HBUB 1IWAA 2R8GA 2ASLA 1TL7A 1B0TA 2ABYA 1VQ6S 3HVTB 3HVAA 4RNNA 2CPFA 2IFXA 3L7OA 4NA2A 2E1PA 4HT5A 5LL6d 1SC1B 3BPSP 1B99A 4P2XA 2QFJA 1LFWA 1P9QC 2CPHA 1QM9A 2F8HA 4MYUA 1OY8A 4ZVHA 4MKYA 4X4UA 1T03A 3I6PA 3OTCA 3NRBA 2ZE2B 2VODA 3UWTA 3EZ5A 1SCJB 2OHDA 2WVDA 8RUCA 3I96A 2LXUA 3TA2A 1S9EA 1Y4ZB 4UOCA 2ZZMA 1Q8BA 1SC6A 4R0EA 5LXYA 1SKRA 5HK4A 2V2QA 3M4XA 1OIAA 3PNIA 4OZLA 2KB2A 1F5CA 3N4WA 1S9EB 3ZZYA 3E51A 1H0HB 2V8GA 3R7BB 5JXSA 3W5XA 7FDRA 4DV6J 4ECXA 3KUEA 5EUHA 1GX6A 4X66F 4IQMA 3CCUS 3HD1A 2Y8WA 1IM6A 3CJ8A 4UW2A 3NGTA 1KC8T 1WC5A 1XR5A 2MZ1A 2AX0A 2RHQB 2MQLA 1JLCB 5B7WA 4DU7A 4OFZA 1VQ4S 1S76D 5I3UA 2A2CA 3GIMA 1UVJA 2Z2MA 3K59A 2X3GA 5IT9U 4RUAA 4EO6A 2IA6A 3TQEA 1WOOA 4DS5A 2GMJA 8ATCB 1XN9A 4CO0A 1OJ4A 4DUTA 2HNDB 1N4LA 3IRXB 2FLOA 4NCBA 1SC3B 4CTAA 1T0TV 3PX4A 3RB3A 2PFFB 2DIUA 2M4MA 2CQ3A 4YP3A 4MK9A 1GNKA 2ZOFA 4FPRA 4OV6A 4FP9A 1Q5VA 2OIHA 1S1TB 2H51B 1FT8A 2CKWA 5HJXA 4CH0S 2XEXA 1Q81T 2UUBJ 2WB1D 2ZDOA 4YY3F 3VGUA 5ITHA 5H9EK 1XMOJ 4ZVOB 4ED2A 2O67A 1D09B 2DGXA 4MK7A 2QC3A 1ZAWA 2DTJA 3JQKA 3TUIC 4DV6F 3QGGA 3BYPA 3SDEB 2XHWA 3UFCX 1U1QA 2AMCB 4PUOB 2P9CA 2WTFA 1IKYB 3OPKA 3VWSA 4DG1B 4LR7A 2ZH7A 1JNRB 3V6DB 5M2RA 4CLSA 1FE0A 4A8SA 2HQ3A 3DDNA 3BSCA 4KV8B 3W8PA 1U2FA 3BQ0A 4EYHB 2Q79A 4PUOA 4FKXA 4K4UA 1RWUA 4F02A 2HNZA 4U7CA 4U8YA 5IOLA 5KFCA 3GWCA 2EBGA 3FC9A 1P9YA 3MM8A 3G6XA 1ELOA 2DR5A 1FERA 4BWJA 2JEJA 1GTEA 1JLFB 3UD5A 2MGZA 2C3MA 4NLTA 4O3OA 4HT7A 2RS2A 1HMVB 3ZZZA 4CLKA 4LF8J 1DTTA 1ZA1B 4WFAQ 4DUYF 2W9BB 1F5BA 3G6VA 5K9FA 5CYQA 1F9EB 2B7BB 2FHOB 2PE8A 5GAHI 3OW2R 4I6YA 3FDSA 2QL9B 1VBYA 1GT8A 4YR3A 5DS7A 1TZ0A 2ACYA 4FZVA 4ZVQB 3MEKA 1RADB 1TQLA 2V4JA 4DL0C 1RHRB 2ZH2A 1EJ7L 4L76A 1KQSR 3HDSA 1HIYA 4XO0A 4WZMA 2W2MP 5G0RB 4YHHF 1HI0P 3K58A 1PGZA 3K8WA 1S6UA 3MECA 4RZRA 1UMJA 4PZVA 1IBMJ 5L38A 1HBMA 3D67A 3HHLA 1K8AT 1RAIB 1RCOB 4I6WA 2WHOA 5LJ3Y 3FQKA 4I0WA 5CD4H 4XPEA 4F4AA 4CLTA 1UJ5A 3IR7B 3G6YA 5CABA 3W3SA 2GQQA 2XNQA 2RQCA 1QLNA 2B5JB 2IRYA 1RT6A 2EVZA 3R2DJ 3GJSB 4NX9A 1DLOA 3LH2S 5DG9A 3T5LA 1X4AA 1ULRA 2GZOA 2IBKA 4B3MF 2IMWP 2CRLA 4WU2A 2DNPA 3S1TA 3TW0A 2VICA 3IRXA 4TY8A 1HWLA 2V8DA 4ZS6A 4I68A 1U1MA 3MD3A 4P74A 3VCDA 3MI7X 2E7XA 4ELVA 1HWKA 1HA1A 2A1BA 4ICLB 3BSNA 4NLYA 1G4CA 1T3OA 3RBXA 1NEEA 4O3SA 3CJKA 2FHKA 1AROP 3HHDA 3NS7B 1RT5A 3HFVA 4X84A 5IZHA 2VJVA 2CDRB 1M5HA 2BW7A 5D0RA 3U1NA 5C2GA 2H5EA 4YR0A 4IG0A 3NY0A 2H48B 1P1LA 4KBIA 3R7NB 1N33J 2DHSA 4W98A 1YJRA 4CQ1A 1N36F 4LVNP 4WYWA 4F0KA 2ROPA 3T1AA 2JH3A 3T6JA 1TKDA 4ZVFA 3FZBA 5E3CA 1FTCA 5B0DA 1T8EA 4Y2CA 3DN9A 3DXBA 2L9NA 1EETB 2UV8A 3MMCB 4OIXA 5D3GB 2IVMA 3L9ZA 4PCQA 4ZP8A 3ZZUA 3AD7C 2D41A 1JLAB 3QAEA 3TX0A 1D3WA 2W2PP 1IBMF 3R1HA 3PHEA 3LOUA 3AB4B 4N7TA 1TMJA 2YNFA 1MROB 1PJ7A 1AZSA 3JTOA 3M1VB 2A0FB 1FRMA 1J5OA 1GK8A 4MTPA 1NJYA 3AJDA 1TL5A 2DHGA 4MKAA 1EKSA 3AA9A 1TL1B 3GYNA 2VUGA 4ZVPB 4H4MB 3RAXA 3MUVP 3EZOA 2MHNA 2MQQA 5HROB 3IGVA 1UFLA 3HI9A 1U25A 3MAAB 4ZDNA 3F73A 1LW0A 4DR3F 1M5KC 1WHXA 1S1XA 4DL7A 3A8KA 3DRPA 1B0VA 2BANA 3ZZOA 2J8AA 3MAAA 3QWUA 5H1SV 1F5AA 3BO4A 3C8YA 3N01A 4NE9C 1FKOA 5DJBA 3SEOA 1YHQS 4J9PA 3CDAA 3C3LA 4G65A 5E7OB 4ED6A 2X1FA 4NLUA 4P7VA 1UVKA 2MKSA 4RUCA 3J7YU 4BS2A 1BWVA 2MLXA 3X3UA 1FJGJ 3ET6B 3CD5A 4USVA 4ZMMA 4B9TA 3PW7A 3PW5A 2K3KA 5K5MA 4AQYJ 3VZIA 3D7SB 3A8EA 3FMBA 6FDRA 1T9UA 2VBYA 4Q2MA 3M05A 3DDIA 1RTJA 2ZC4A 1P6TA 3CJ5A 5BYSA 3BSAA 4DSIA 4CYUA 2Q1LA 4ID5A 3AODA 4K5RA 3KWMA 2AJ0A 3VF0B 2R8HA 3IA0A 3OLBA 1M5PC 4M5LA 1E6VA 2J7WA 3PW4A 3ZFVA 4X65F 1AYEA 1RWXB 4W4MA 1LWEB 1FFWB 2MQ8A 5GAGU 4ID5B 2QSFA 1G6BA 1SIZA 4PXEA 3NGRA 5E2QA 3BDEA 3K7RA 3OTEA 2MZJA 4MK8A 3DGPA 2W7OA 5L1LA 2D3UA 3M32A 3RRKA 1DTQA 3G96A 4OI0A 2HYIB 4TY8B 3DI6A 1J5EJ 3MF5A 3JSMA 2GAGC 1FDDA 1RAGB 2RRAA 3BKFA 1X4BA 4NLWA 2HFUA 4MKBA 2XBPA 4NZ6A 4Y3CA 1FRKA 4EZ6A 3I9V9 1PKUA 3IS9A 4M5KA 3L3CA 3W61A 4USHA 2KZZA 3MR6A 4GKJF 2QYCA 4TNOA 1CEZA 1IR1A 1EP4B 1C0TB 3DLKA 1W25A 1QAYA 2AKWB 3R5BA 5B0AA 3WZ0A 2FJXA 5EGYA 1UVLA 5H9FK 2ZWPA 3N5BA 5HBMB 2MTLA 4P10A 4DL6A 2XYGB 3H2UB 1C0TA 1TV6A 2YNGB 1TELA 2A6MA 3IR5B 2XQCA 3DMJA 3QT6A 3NNAA 1VRTB 3PVXA 3EGNA 1RAEB 3QIDA 3U02A 1S9GA 1H74A 2CNKB 4HVZA 1JLAA 2YKNB 2ZZTA 4FVMA 3WIUA 2M7SA 4YR2A 3QJJA 1NSPA 1UEUA 2HKEA 2IM1A 4JUZA 2B56A 2V2VA 1GXUA 1HPZA 4RW7A 1RT3A 5GAGI 3PR5B 4KKOB 2KT2A 4J90A 4CO4A 4DR1J 4P9SA 5A8RA 4F4WA 5L9XA 1JNZB 4KFBA 3JAMY 4XPCA 1UZDA 2XS7A 2KM8C 4G1QB 2OMLA 4TKTA 3GFZA 4I67A 2DNQA 3HF5A 2HHSA 4KFBB 3HP6A 1NHKL 1BHNA 3MPUB 4JI6F 4K2XA 1TL3B 3J7YI 4AD6A 2QIFA 2ZD1B 4LSNB 3KLGA 4LRBA 4UY8T 4JI4J 1U26A 2LDIA 3MUTP 1PYOB 3NBPB 3NNHA 2CJYB 3G2XA 3W66A 2D3O1 2YWKA 4DFPA 1P8GA 2QT7A 2EI5A 2IPOB 3OTOF 1V5IB 2C3PA 1MWZA 2B4UA 2QLWA 5D0GA 1HQUA 2AV5A 4USIA 3JB9k 4N76A 2HWHA 3UCUP 1UAWA 5MLCV 3DRRA 2I8EA 3VVTA 1IKXB 1RACB 1OY6A 4IKAA 1Z2LA 4Y0FA 1NK4A 1Q82T 5J2MA 1Y0HA 1YX2A 2KT5A 3M8ZA 7AT1B 4MKVA 1WKLA 3W2WA 1BGXT 4DSLA 1Z1ZA 4R5PA 1RGVA 2OH2A 1RCXB 4OMFG 1VC6A 4IG3B 4I6AA 1H38A 1RYRA 4OX9F 3T5HA 2BX6A 4DR4F 3SSQA 1FVQA 3OFGA 2HNYB 1T3NA 1KBRA 4NLQA 2X1GA 1B7FA 3DI6B 2BKNA 2DH8A 3IBFB 4M5JA 3KKFA 4DV3F 2NXCA 3D5MA 2R2RA 4DV4J 2KHDA 3QIPA 3IS9B 3GTYX 3K2YA 4B17A 1LK7A 2IDEA 4DQSA 1XMOF 1QVGR 2RNEA 1RUSA 1VYAA 2DNHA 1R8CA 1C1BB 4LF6J 1EP4A 2ZHOA 1F9HA 4IO1A 1IBKJ 1M1GA 5KFFA 3J81U 1YVFA 3G8TA 4KB7A 1RWPB 2HVDA 4ES3A 1RP5A 4F8RA 3HSDA 2QA1A 4RW9B 4OYMA 1S1UB 2ROEA 3W64A 3B8HA 3UPFA 3TUZC 2J0SD 4Y2IA 4NA3A 3QJPA 3CJQA 1U24A 3H90A 3NGDA 2AGQA 3LP1B 2R9LA 1NKBA 3KG1A 2DHXA 2LKZA 4NI2B 5BYRA 4DG1A 1YDLA 3KJVA 4DV3J 2HHVA 2HBQB 3GONA 3OR1A 4HI1A 2XY5A 1HMVA 3FGVA 4EMDA 3LAMA 4QJVA 3DM2B 5E3QA 3M6XA 3NL0A 1FWPA 3TAMA 2C2KB 1OYEA 2E7VA 3P6YC 3MPYA 2VB6A 5EX3A 4AT1B 1NK5A 4EBDA 4USWA 4LSLA 1WNEA 4LFCF 1D9AA 1APSA 4OL8A 2Z56B 3PO4A 4KH1B 3RB4A 1FEHA 2GHWA 2Q43A 1CJVB 3BBFA 3TEHB 4TN2A 3MM9A 1S57A 3Q8UA 3MZIA 2HQGA 4PWUA 3CDUA 4CWBA 2B6AA 1HNIA 1KOHA 2GGPA 5KG4A 5A8WA 4C8YA 2XZTB 1RWNB 1VJQA 3EVWA 4NLVA 5A2QY 1VHFA 2BUNA 1RTDA 1RBLA 1U7LA 2QG9B 5FD1A 3TR5A 1KLMA 3DYAB 3KHRA 4F2SA 1S0VA 1HNIB 4XDDA 5JVGQ 3UN5A 4QR0A 1YJUA 2GQCA 5DZ6A 4DV5J 4UY85 3Q8SB 2FHMA 3QATA 4MT1A 1DY3A 2HZCA 1T7PA 2UXBF 5HLFB 1T11A 1HNXJ 4JP8A 2AEMA 2AEJA 4Q43A 3DU5A 2CQ1A 2ZH8A 1S49A 1OPZA 4NXNF 1T9TA 1X4HA 4OYXA 3HVTA 3GG0A 3NWGA 3PTWA 4NEYA 2F3JA 4WTYA 1VC5A 2I6WA 5HO4A 3MAHA 4EU0A 2R8KA 2ZHAA 2HS0A 1CQMA 1NJWA 3I4PA 3LAKA 2FD2A 3JQJA 2IRXA 2B4PA 4F0MA 2HHHF 1JLQA 2ALYB 2L48A 3P4UB 1FKAF 2R42A 5KOXA 2C42A 1MW7A 4TQRA 1QSYA 4RW8B 2QMUB 4KHRA 3BEGB 2EPIA 3MECB 2JNJA 1RT7A 5C24A 1RXOB 4DN0A 5F8HA 4YDXA 4N47A 2LQJA 1UPMB 3NGSA 1X4GA 2VASA 2H9ZA 4ZVEA 3G6ES 2DKOB 1WHVA 2DO0A 2LQ5A 3R97A 2HFSA 1N36J 3C6TB 2W8LA 4JV1A 4QCLA 1T95A 4ECTA 3MCNA 2HW3A 2F40A 1R0AB 3CJKB 1PC4A 1UZHA 2VA3A 4UZCA 4OJ3A 4FF1A 4W90B 1WC6A 5ETTA 4D3HA 2NQPA 2DXEA 2MPUA 2R7UA 4RW9A 1BMQB 2CVEA 3ISZA 2LVWA 1U1KA 4WKRA 3CB4A 1TKXB 2VG5A 1MU2A 3M8PA 3S01A 4CM0A 2OPPA 1GX5A 9ATCB 2CQBA 2K2PA 1VCTA 2EKYA 1PAUB 3MMCA 4P7TA 1NSQA 5KG7A 1LWCB 1BQXA 3PJXA 2OPPB 1I6JA 1MN7A 3C19A 2ATCB 4LREA 4J9QA 5AXMA 2QSWA 1TUWA 4FNIA 4EWTA 5K8MA 1D8YA 1YG0A 1PBAA 5ETSA 1X4FA 5HATA 3PEJA 1VC0A 4DV7J 1JKHB 1UW4A 2AQ4A 4OI4A 2EFQA 2K7KA 3KLFB 4IR9A 1X5PA 3FSYA 4FYYB 4I69A 2H4YB 1U1PA 1SQGA 1VOMA 1T9WA 3MGJA 1TU0B 3FBBA 5HAOA 4O3PA 1SIWB 1UEVA 3KLFA 2QL5B 3CIZA 3NAIA 3FBFA 1NZAA 3IWXA 3EM1A 4ZCIA 4TYAA 5HQMA 3TANA 1QUPA 2FY1A 1S6OA 2M5YA 1LW0B 3CCJS 3C46A 2R2SA 3SI8A 3JSYA 5IS2A 2PFDA 1TL3A 1FFGB 1JXEA 4WFNQ 4HDGA 5AE2A 2CQHA 4RWWA 3QGHA 1RU2A 2XZWA 1QSLA 3OHAA 2AEFA 2DD8S 3QSIA 4URSA 3V6DA 3QMQA 2GJ2A 1FO1A 3D6HB 2GVDB 1W7WA 2Q3PA 2N82B 1WC0A 1N34F 5IT0A 2HNZB 1URRA 1AA1B 2F8EX 3HFZB 1TVRA 2G2ZA 2KL8A 4PAAA 4UOHA 1U49A 2RAQA 1K73T 1UPPA 1TP7A 5A8KA 2FHJA 4L74A 3D1OA 4FYXB 1UVIA 3L95X 4DPUA 1R8AA 2BDPA 3DRYA 1RWMB 2WBMA 1WEYA 4RKUC 1HNWF 2QRRA 3MM6B 1S4FA 2OUGA 1P27B 4XAKA 3SQGA 1PCAA 2ILYA 1GXLA 2WW4A 1G3OA 1JLGB 4FPIA 3T19A 2HNYA 2E66A 4NCGA 4PPDA 1UJ6A 2MHEA 2CQGA 2F1FA 2JC0A 3D3BJ 4P72A 5KT5A 2KN4A 5L8RC 3M9NB 3IMQJ 1OPIA 3FEZA 3FMWA 3KDNA 3SCIE 1HYSB 4ZJLA 2BE2B 4GVLA 5C2CA 1BQNA 4PG8A 1FJCA 4FF3A 4HH0A 4OJHA 3KG0A 3M2UB 3KG4A 4BBYA 2JVOA 1YZ6A 2MEWA 2VDIA 4RW4B 1S1WB 2CIMA 1N5YA 2RH3A 4JB8B 4DSKA 4IQXA 3DRSB 1J27A 1FRLA 1WDTA 4OZ2A 4PG4A 4M95A 3M9OB 2FPHX 3RAQA 2OSRA 4A4JA 1WF0A 3E01B 2BJ8A 3M8SA 4V1Ak 4ZN3A 4I2PB 1JLCA 1SJ3P 3W8GA 3AOBA 4B3MJ 4FS1A 3WIVA 1ZPVA 2NZ4A 2GA7A 1DTQB 1UCNA 4C98A 1CPZA 4AE5A 4EEYA 2JEGA 3LP1A 3M6WA 2NR0A 3QWPA 4X4OA 1VRTA 1SC4B 4NA1A 3W60A 3ZTSA 1DQ9A 5HSPA 2FVQA 5LMUJ 2BV3A 1UWAA 3VTIA 3RBDA 2BR0A 4NXMJ 4KHPF 1S48A 2LECA 4WIQA 1BQMB 3CCZA 1NK7A 1WC4A 1JKHA 4ICLA 3K5PA 3DLKB 3QFWA 4DDFA 4OQJA 2UUAF 5C25B 1SUQB 1WG5A 2HHHJ 2M8DB 4LF2A 3NNCA 4F3OA 3RU0A 3HHLC 4M5DB 3J7ZT 1KTVA 1MSWD 2B4VA 3A3OB 4HH1A 1SV5B 2I1RA 4NPOA 1R31A 2CJBA 4OHWA 1UVMA 1F60B 1SB6A 5THWA 2MSSA 1S9GB 2OEJA 3DLHA 1A7GE 2D3ZA 3UNGC 2G0JA 5D4NA 1IN0A 2FZGB 4DXLA 3Q8VA 4YFUA 2ZEJA 4P73A 3LWMA 4ZIWA 1GMWD 1U0HB 1UFWA 2HFOA 3ILOA 1CULA 5SZTA 4CLFA 5KFBA 2XS2A 4XDCA 1A6LA 4EBEA 1TVRB 4OYBA 2Q66A 3SFUA 1N6QB 4PQUA 4DPWA 2CPXA 3GQCA 2C2EA 1N52B 4HLBA 3LPYA 3SSRA 1XMQF 4RNOA 2QLBB 1VFJA 2W4DA 3H2LA 3GJRB 2C2NA 5GVQA 4FF4A 1LWXA 7FD1A 2ZH1A 1VBKA 4MIAA 3DHXA 4LR9A 1VDHA 5CYJA 1SVDA 3EZUA 5E3RA 1QUVA 3B82A 1ZAXA 3BH7B 2VKRA 1T03B 3OSPA 3I0RA 4KGMA 3GYXB 5ETMA 4C8NA 1JX4A 1CQNA 4Y6IA 3VAFA 4IOAQ 3J81j 2XMTA 2DEJA 5CCMA 2BQ3A 1HBMB 2NYIA 3M8WA 5KG0A 5EDWA 3VV2B 4IRDA 2GS8A 3CXCR 1T9XA 2N7YA 2JLGA 2OGUA 5IV3A 3GIKA 2ZH6A 3ITHB 1NCLA 1ZM3A 2BKOA 5D4PA 3VVUA 3AAWB 3MHYA 4J9KA 1WF1A 3D0IE 4J9SA 2KJVA 1V3RA 3TZXA 2ZBIA 4X64F 4ID8A 4M5HA 1L3KA 4U96A 2LQBA 3AJ2A 5GAEI 3OHBA 4KPYA 2ZVIA 3SSSA 1YJNS 2NUHA 2WVBA 2V69A 3G86A 4Q45A 5LSOA 4DR5J 4F4YA 3MEGA 3C15A 2APOA 4YB7A 1MROA 4UUWA 2G1DA 3RBZA 3KHHA 5DM6Q 2LP4A 3WDOA 5HP1B 1HR0J 5C5JA 2ADCA 4PG7A 3TUPA 3KLIA 1B7YB 3EE3A 2VKZG 5FLXY 2FLNA 4UOGA 1U2RA 2P6SA 2BJDA 3L09A 4CH1A 1H2UX 4JI0J 5HP1A 2ROGA 3KJNB 3I4HX 2F63A 3EVMA 4CT8A 1KD1T 4QU6A 4UTGA 2X7IA 2DO4A 1SQEA 2WBRA 2FJWA 4B3OB 1HBNA 4RJVA 2B3TB 3PG9A 4WU3A 4CP5A 3AOAA 2YPYA 2YNIA 3UCZP 2J9DA 1H73A 4QYZK 2BMBA 4EO8A 2B9WA 2Y1RI 1XQIA 4NLDA 4DV2F 4IRCA 3SBMA 4DR2J 2N7CA 1Y7PA 3GR0A 2QLJB 5FIIA 4QYZJ 3O5TB 4WE1B 5J1EA 4L3NA 4CNYA 2IYGA 2WW8A 2RDIA 3OTOJ 2XLIA 2MB0B 1IKVB 1T94A 4LBHA 2MYFA 3LPEA 2OTJS 1S9FA 2GAHC 1XWLA 1S7IA 1XNRF 3JYTA 1BD6A 2YWEA 2VG6A 2JFDA 1HNVA 5I3PA 2YKMA 2VFSA 3HK2A 3IWNC 2N4CA 4B3TF 4B9SA 4LF6F 3ZZRA 4IOCQ 4PG5A 1Q16B 3PJ9A 2M0GB 4DSJA 2R2TA 2ACMA 1SL0A 4ZPDA 2HAIA 3I0SA 1FVSA 2DRDA 1S1XB 5KT3A 1Y3KA 2KHCA 2CJAA 1DURA 2GGPB 2HS3A 3BBBA 3OQ2A 3MOZA 3OXFA 3HXMA 4GVBA 3R1LA 1ZM2A 3FFIA 2ADBA 4N5SA 1FKOB 1JLEA 1LOUA 4L3KA 2DGVA 4IUFA 1JLQB 1CJTB 1DRZA 1KDNA 2V9KA 4KE5A 5LOQA 5BYQA 3PZPA 4PYAA 1YJWS 2NXUA 2ERRA 1S0MA 3KJFB 5ETNA 1BUXA 3D68A 1HWUA 1DHMA 3W9JA 1RT7B 5C24B 3GFYA 5ADZA 1DQAA 1CJTA 1UEKA 1JMTA 2F4FA 3ILLA 4CLUA 3BO3A 2V4QA 1RT6B 2AW0A 3IWLA 3GJTB 1FXDA 4E8UA 2JRSA 2DYAA 2PEHA 2YQ3A 3R9LA 1YTYA 2GQ2A 5CH7B 2BABA 2XCPA 4F2RA 2GNKA 4LMZA 4AYBD 3OJUA 5LMNF 4QWCA 4KTQA 3UVJB 1LWEA 1Y00A 5J2NB 1EZZB 2NS1B 3SCJE 2FZKB 2ZITA 5E0OA 4I56A 4IFVB 4DN9A 5KFNA 2VA2A 2J9DE 4ELUA 1VRQC 3VGSA 4F3MA 1K47A 5T7LA 2ZNYA 3MMBB 3GR1A 1NZ8A 5F8GA 4K4VA 4IFVA 2R8IA 2MQMA 1TK0A 1F1BB 2OPSA 4K2JA 2AZ3A 1X5OA 2AF6A 2BA9A 2ZJPQ 2A3JA 4JI8J 2J6TA 1YBUA 1FE4A 2IIHA 2BKPA 2UUWA 2IVYA 4CDIA 1MLAA 2OAUA 4TLQA 3O3LA 1AFIA 3DLEA 4H4OA 1G7CB 1NLKL 2YX1A 3Q2SC 3DGVA 4U95A 3N0VA 3MMAA 4ECUA 3MFHA 2RQKA 3OUYA 4E98A 2N3OA 1C0UA 1EARA 1JXVA 2R7SA 4I7FA 2MMYA 2P9GA 1EAYC 2KRRA 2VQEF 1VHIA 3CCES 1O5JA 2WRMA 3UR3C 3MURP 2QA4G 4DR7J 2MQPA 4ER8A 4MIWA 3CUNA 5IC4B 2FVSA 3FBCA 3FRYA 1RAAB 1OS5A 4C3LA 3KOAA 1MN9A 3LGNA 1W2BR 2MKJA 2Q6BA 2NXNA 2R7OA 1LW2A 5A2QU 3J7A1 4Q8FA 1OO0B 1N5VA 1HQUB 3GU0A 4OZ0A 3I5BA 4Y34A 1Q7LB 4ED8A 1N6QA 2PIIA 3TZWA 3CJ0A 3ZXWA 2AJ4A 5KG3A 1S79A 1HBUA 1DFDA 5KFEA 2HHPA 4KKOA 3DOMB 1K0TA 2K8GA 2YNFB 4JV5F 2E1RA 3LP2A 3MEEB 1RBOB 3RBEA 4ANCA 4ILMA 4OV1A 4IG3A 4ILLA 2G2OA 1WHWA 4KT0C 4A8QA 1TL1A 3JS9A 5EWEA 4X4SA 2ZM6F 2UUAJ 2C2ZB 2V50A 2LXFA 2G13A 4HHJA 3TP2A 1DBDA 2BE2A 5LMNJ 2AHOB 2OI2A 3F44A 3M2VB 1LFPA 1NH8A 2KXFA 2RS8A 2VFUA 1NK8A 2FY8A 1TKZA 3PRBA 4DR4J 2V4JB 1HW8A 2EXUA 1Y11A 3HHNB 2I5JB 4CO3A 4WK3A 2RSQA 1RTHA 1RE1B 2W25A 4WCEQ 1VK3A 3M2VA 3UN3A 5CQGA 2KH9A 3M8YA 3HLUA 2RRNA 4EGLA 1CBKA 1FESA 2LQ8A 4JI7J 3HSGA 4ZN1A 1N5TA 1S5ZA 1S6PB 1VQNS 1U2CA 2DVIA 4QIWD 4Y00A 2OPRB 1WI6A 2J76E 4HI2A 2B0GA 3CCVS 2YQ1A 2C2DA 1S6PA 4OI6A 2NPFA 3K89A 5HMZA 1R6VA 1MMLA 4NYOA 2Y1LB 2E5LF 2WAQD 4UQTA 4YEAA 4R5PB 3O2IA 6AT1B 2YH0A 2J6SA 2UP1A 1F6TA 4O44B 3QAUA 1XNQJ 2UXCF 4FKYA 1XERA 2HS4A 3PXGa 2Y1IA 4J9UE 4DR6F 4OLOA 2CJQA 3WC2A 4NMLA 5F8IA 2ASYA 3DOKA 1NB7A 1TKTA 3EWGA 1VBXA 4XTTA 2O5DA 3AY0A 2RUSA 2IAJA 3EGWB 3KLIB 1Q5YA 4J9RA 2K7JA 3PDNA 3OSNA 3ADAC 5B0CA 2D74B 5L1JA 2UVWA 1TTHB 1I94J 2HQDA 4DQQA 2HQCA 1TUGB 2VOPA 4FYVB 2VPYB 1YIJS 3TJ9A 4QWDA 2B43A 3PJWA 3DMJB 4WPAA 1IJFB 1LXNA 2FJDB 1HFEL 4P2MA 1QTNB 4WK1A 3VGTA 6FD1A 4HYKA 2XS5A 1I1GA 1E6YA 4NEZA 4F26A 1RHQB 4C8MA 1Z4UA 5LXRA 2VQFF 1SV5A 3TYTA 1S1UA 2NCKL 3M7VA 1RQ0A 2VG5B 2HGLA 1RKJA 2RDDA 2MZQA 1CLFA 1X9SA 3G82B 5KFUA 2EEYA 4Q5VA 2Z2YB 3QRRA 1F3VA 3GLJA 3NGKA 5A6WA 3CCMS 2CWXA 4DV1F 1VQ7S 4Q8EA 2XLKA 5ETOA 1UWBB 2VC1A 2FC9A 4NI2A 3Q2TC 4O4RA 1HLWA 1RT2B 3M2RB 1I5OB 4RNHA 3UDEA 2EK6A 2HZAA 4A8XA 1VQ9S 2XNRA 2RKIA 1BLUA 4F67A 2KZMA 3SCKE 4YY3J 3IG1B 2VPWB 4ZJQA 3HPOA 1FXLA 5LMUF 4J9VA 3DOMA 4IDKB 4DS4A 1KQFB 4IRKA 4KO0B 3FEXB 2YX7A 3OBIA 3HJVA 4F04B 3M8QA 2Z4PA 3PYEA 1Y9OA 4NL5A 2M70A 3R5AA 2RT3A 5DG7A 4A8FA 2D9PA 2H5JB 2CDQA 3DFEA 2VZ9A 1XK8A 1D1UA 2NYHA 4RW8A 3TVZA 3FVYA 3DLJA 4MYTA 3UDLA 1B70B 2Z58B 3A8IA 4O3NA 1YZ7A 2YWFA 2P2CB 2AU0A 3N28A 1N88A 4KY3A 4QPXA 4ZVTB 2LDYA 3AXMA 2ZD1A 4LSNA 3KLGB 3WX8A 4QPTA 5DQIA 3QZ7A 2AWZA 2Z0GA 3MWBA 4PABA 3QSYB 2D3OR 2RD5C 4OHYA 1F2GA 1NMEB 2W2NP 4YHHJ 3LO3A 3PO5A 2EFOA 2JLEA 3SV4A 1GTHA 4FNHA 4DUZF 5EX0A 4K5SA 3BPDA 3O44A 1N32J 2GV1A 2CQ4A 2DNGA 5AE3A 2KG0A 1YJVA 1V5VA 1LWFA 1MU2B 5F41A 3T5KA 2WOMB 4ZP7A 3SCLE 5KG5A 2PT0A 2DGTA 4PXDA 1SPBP 4M63A 3T41A 3W2WB 2WVFA 3GV8B 2DR9A 1X0PA 3CT9A 4U7UD 5CAAA 4BHQA 4YUDA 1TKTB 4NLSA 3D6MB 3B6BA 4X62J 2LU1A 4FDFA 1HNWJ 2GO8A 2J8SA 2IY5B 1ICEB 5EN1A 2CPJA 2OD6A 4NLOA 2XMAA 2R7RA 3BQ2A 2HRYA 1NPPA 3H0PA 4PKDB 1IVZA 1C1CA 1REVA 1ZPWX 1I51B 3IR6B 1PBUA 1C0UB 3BV8A 2W8KA 1YQHA 4RUBA 3WQPA 3MPDA 3PFEA 4IYQA 1K1SA 3TVKA 1HL6A 1X60A 2DBBA 3HT0A 4ETXA 1WKJA 3R5JB 1RTZA 4Q44A 2W9AA 3KJVB 3QO9A 4OZ5A 2HBRB 2MXYA 5IWAF 2J9EA 3KK1A 1R8HA 3MEDB 3MOJB 2CADA 3DNCA 2K3IA 3A3NB 4J5OA 5LSLA 3TEGA 2P9EA 4DI6A 3O6QA 3TWZA 3TVYA 4KHMA 1U8SA 4RX6A 1HPZB 2XYPB 2CJXB 2H65B 2QTWA 5L46A 4DUZJ 2OPQB 1V3SA 3BBCA 5ETLA 5J2PA 3ENVA 2CWKA 4LIWA 3THTA 4IDKA 3GV7B 2UUCF 4NLXA 1RHMB 1WTFA 2FVPA 3I55S 3W7BA 2W01A 1FI4A 2KFNA 3N9UC 2G9OA 2GHVC 3JXOA 4OHVA 4A48A 2CA9A 2RIJA 4RBVA 2PI4A 4PEOA 5HANA 2HIQA 4NCGB 2H54B 2MDAA 3GP9A 2BANB 3U1LA 1Q1KA 4DLGA 2HHXA 1HQEB 4WWSA 5DLFA 2XMUA 1U09A 2XYHB 2HWTA 3I82A 2ZOGA 4HACA 3THVA 1VBZA 2YKOA 2IC3B 2L3MA 2XMVA 4P52A 2V4RA 3FFIB 1RI7A 2VBZA 3BGLA 2LCWA 2ILZA 3C16B 2L9DA 3KK3B 4PYDA 5FLXU 1WACA 2XSJB 4J37A 3BKTA 4X4RA 3PX0A 1NJIT 3UW1A 1U6BA 4CRJA 2KO1A 4NYPA 5KFLA 3NOCA 1FNOA 2MLYA 5KFRA 4DX5A 2Z57B 4DL5A 3UD4P 2RF2B 4X2BA 3QT7A 1IBLJ 2FC8A 4OJ1A 2AZ1A 3R27A 2V2ZA 2HFVA 3DLGB 3NG8A 4NRUA 2MSTA 4O0NA 1S4EA 3PIOQ 2KKHA 1M5VC 1FTRA 1NPRA 2ZDPA 2R2UA 2DH7A 2UVRA 3T9ZA 2WCXA 3T6BA 2XWYA 4J9LA 5DZ7A 4ENOA 1EQMA 3HM9A 3PEHA 3MR5A 2OPSB 2OP5A 2VC0A 3IFEA 1NAQA 5IM0A 2CYYA 1K9MT 2C2MB 4KH0B 4Q0BA 2Z8QA 1PJ5A 4Y65A 4AXJA 2OFHX 2VBWA 3S7RA 1NBEB 2QMWA 3BR8A 2E9ZA 4K0KF 3FSIA 2ZVSA 3MR2A 2JEIA 1IUJA 1SUQA 2HVEA 1ITPA 3BH6B 5KFQA 2C2OB 2DIVA 2BW2A 1QTMA 4IH5A 2ZBPA 2EFVA 4M5DA 3CMQA 1KLNA 1CC7A 2MKHA 4G6VB 2DPJA 2OLWA 3US5A 1YBAA 1B64A 2MZTA 4KYZA 1GMWA 4ZCLA 3R8YA 4WP8A 4B3SJ 1ZBTA 1N56A 2HHUA 4MFBA 5SUHA 4J7CA 3CIMA 2MJNA 2CZ9A 3ZTPA 4FBTA 2QO3A 2W4PA 1A0OB 2CNNB 3HULA 4FF2A 1WEZA 1YRTA 3HD2A 3TA1A 3T1YJ 4OZ3A 1WTBA 2D69A 2KM8B 2JFKA 2ZOMA 4ZPWR 3THPA 4GC6A 2GIQA 2MQNA 2ZFHA 3E8OA 1RT4A 4MMOA 2KI2A 1ROFA 3SIPB 2XGPA 2AGOA 4K4SA 4U6PA 1C4AA 2HK3A 3GG1A 5GAEU 3SV3A 4LF9J 1HD1A 1HW9A 2M9KA 3NWRA 2DXFA 3POTA 1UA0A 4USMA 4V19X 3QJLA 4C3KA 2ZH9A 2R4FA 3TJ8A 3K17A 4ZCKA 3EPGA 5FDLB 4PWDA 4QIEA 5KFMA 2NUUG 2JVRA 3VAGA 2I5JA 3T1YF 1FNXH 1HQEA 4KPCA 5BR8F 5F8JA 3OL7A 4EBCA 3L4BC 1PO6A 4NXMF 4B9NA 4YN3B 2PI5A 2BBEA 4O3QA 4KC5A 2V34A 1AFJA 1YK9A 1RAFB 1NO8A 2PDAA 3CJRA 3TZZA 4QU7A 3EGZA 4JOUA 1OMSA 3FKBA 2EFNA 2V8PA 1IKVA 1UETA 4PR6A 3L7PA 2PGCA 2PN6A 4LRFA 3D0GE 2EC0A 2VFVA 1NPKA 2GFFA 5IQQA 2E1CA 1JLGA 1NSAA 2CAJA 2V5HG 3OVAA 4NZ7A 3MCOA 3ICLA 5GADI 4FYWB 3BN7A 4PG6A 4DV0F 1FKPA 4AXIA 1L3VA 1V3ZA 4F50A 2JL9A 2YQ0A 4XK8C 3H5UA 2E5GA 2OEMA 1IBCB 1QAXA 3LUYA 4TLRA 3V6JA 1AB8A 4C11B 2KFZA 3HZGA 2LLZA 1VLYA 2XWXA 3DLBA 2Q6CA 3A8JA 3IO1A 3ZNJ1 3MM5A 4F4XA 1ZZFA 5JVHQ 3IM9A 4HTIA 1AUSL 4DBQA 2BE9B 5BJRA 1XMQJ 4P2SA 1Q95G 2BYCA 3FUYA 3CMES 4O3RA 5HBMA 3LTOA 2UXDF 2ZH3A 4B9VA 2O1PA 1PYTA 1TK8A 3FCVA 3CCRS 3AB2B 3CDBA 1CJKB 1WDDA 1TAQA 1WC3A 2ZKTA 5JMNA 2DISA 2Z2ZA 5HJYA 3F56A 4BC9A 1TL4A 1FRXA 2CJ9A 3DXSX 2XLJA 2FTRA 3KLVA 3IP0A 4YB1P 2DNKA 4O44A 3D28A 2E5IA 2KYXA 3ILIA 1N5SA 2W7AA 1I3OB 5K8OA 3AHPA 3JSRA 3G4SS 2IMOA 5D8HB 2BOAA 1CS4A 5DDQC 2JZ5A 4FVCA 4TU9A 2GC8A 5KFVA 4DCJB 5J1EB 4DR1F 2HSEB 2ZBCA 4GRSA 3K5MA 1JJ4A 2HHWA 3T1HJ 5A0YA 3KMQA 3D3CJ 3VGVA 3RR8A 1NHUA 2V63A 3KUGA 5IFMA 2QV6A 3CCSS 3GFHA 2BJ3A 1N32F 3AQOA 1H3DA 3UD3P 3D9BA 4WFZA 3CSKA 1KHVA 1WELA 3TUJC 5A8RB 1GEHA 2CPIA 4CCHA 1IR0A 3PRVA 4HTJA 3ETMA 5IT4A 1URNA 4GVBB 2CQIA 3GIRA 2X3DA 2X1BA 2VU5A 2D1CA 2BEFA 2F9JA 1FA0A 2P8IA 2F4VJ 4ITSA 3I56S 5CYMA 1JQGA 4AFFA 4PPZA 1PC5A 3BS9A 2AT1B 4LJMA 2CPDA 5AXKA 4C6AA 1ZETA 2V6AA 3H5SA 4KGKA 1KOOA 2L08A 3H42A 3V6HA 1ZYQA 1H2VZ 1O8BA 3LALA 1WORA 2QLXA 2RHSB 4L75A 1VQMS 1IBKF 5H9EJ 4G3IA 4GKJJ 4AUKA 3RG6A 3GE9A 2YKMB 3PY8A 1WSRA 1CC8A 3HZEA 5KTQA 1DLOB 2QLFB 2GX8A 1FF2A 3UDCA 2ZE2A 4NZ0A 1RJJA 2PA8D 3BN4A 1GH8A 1LWFB 3CULA 1A9NB 1X5TA 2VHGA 4DFMA 3LA0A 4Y2KA 4X4TA 3H5XA 1WWHA 5DDRC 4JI3J 1TAUA 3QBCA 5K14B 4ZPTR 3J81Y 4B08A 2EG1A 3HCXA 4OLPA 3T1HF 2BZ2A 2M2BA 1VQ8S 3RRHA 2U2FA 4C97A 1EIYB 3KLHA 4DL4A 4HDHA 2XMJA 3ET6A 3OJSA 2CQ2A 5KAKA 2UVUA 3X1LB 2HMIB 1HKAA 3EICA 3QT8A 5HQ8A 2P6TA 4M1KA 1FJ7A 2VJUA 4I7FB 2FJVA 2FJBB 4TU8A 1HNXF 2KVQE 4I64A 4C8OA 4CYUB 4ES1A 2WOMA 4CM2A 1KKHA 2JC1A 2KXNB 2YNHB 3B4DA 1VQKS 2XHCA 4L73A 1WUUA 3Q8YA 3UVJA 2QA4S 1REGX 3HKZD 3CMAS 1XC9A 4DF8A 1B4SA 1N34J 2DNOA 2HHQA 2PC6A 5HQLA 2QA2A 3ZNUA 1HBOA 2CPYA 3WHIA 4UQGA 1QVFR 2HHTA 4C3MA 5L39A 2MY8A 4OI3A 1R0CB
chains in the Genus database with same CATH topology
2KRBA 3DHWC 1C2PA 2VFRA 3M1VA 3MM7B 2NPIA 4ECZA 3OFFA 1KS2A 4JV0A 1YJTA 1RA6A 3TO8A 1UJ4A 5C25A 5CA5A 2HLUA 2JEFA 4LF5F 3LGMA 4V19J 5HROA 4DLEA 1NH7A 2M52A 1VQOS 3TAMB 4I4BA 2OKQA 3SMZA 2P5VA 2I2YA 4I2QA 3NP5A 4ETZA 3I31A 1XMBA 5K8NA 4Y28C 3RAMA 1RTDB 2VFTA 3TOQA 4WXOA 2LYVA 2XSJA 4WIIA 2I9SA 5E33A 1VI7A 2XB2D 2E7WA 3CDWA 3MM9B 4ATNA 2QEXS 4OZ1A 3P49B 2OJ3A 1SJFA 1LW2B 3JYTB 4ZP9A 3TX8A 4K4YA 4A8MP 1RTIB 1S1VB 5J2PB 3J80Y 5KFJA 3Q0AA 1D0EA 3OV7A 3GILA 1JXLA 2XO7A 1KSPA 2OTLS 2BRLA 4WE1A 3CO9A 1W2IA 3CJ2A 2OMOA 1J5EF 1F9FA 2IM2A 2GW8A 2B4OA 2IVFB 1S77D 2XC9A 2FVRA 4WKYA 1KNZA 4M94A 3M32B 3GMGA 1NJZA 1D9DA 2CPEA 1U1RA 4DFJA 2RB7A 2FLPA 2YVSA 4YOEA 4Q7AA 5B0EA 3I0SB 2E1MC 1ZAVA 1TUVA 2R7XA 1QSSA 4QWAA 1RTHB 1M90T 1IJEB 1X7VA 1VS3A 3CJ3A 2FB0A 2XMKA 2VPZB 2YTCA 1LK5A 3K5LA 1UVNA 1RT1A 3QGIA 2YKPA 2C2RA 5M2PA 2V94A 3M30A 5KFAA 3OL6A 2Y1JA 1S1WA 3FNNA 4USJC 2WSFC 4ZP6A 4EZ9A 3DRRB 2VOOA 2ZH4A 3ZC4A 3KYLA 3BGRA 3H4BA 1P1TA 2YY3A 2YNGA 2AJ1A 3M30B 3O8WA 5CHCB 4MIBA 1H7XA 4RBTA 4DEZA 4ALZA 3U7JA 5J1PA 2KYZA 2LU2A 1RA7A 1ZM9A 2DNNA 5F8LA 4X62F 1UA1A 2UU9F 4NRTA 3PW0A 4K4WA 3KMSA 5HL7Q 4WJBA 3K5NA 2DGWA 1N0UA 3IG1A 3FJ2A 3DC2A 4JI5F 2VG7A 3QLHA 4JI8F 3OUYB 3HHLD 3IGNA 2N4DA 4TY9A 5GMKa 4CIOA 5MAOA 2B51A 4TYBA 3RYLA 2W7PA 1ZM4A 4JI3F 3HO1A 2CVIA 4QWEA 2DNZA 3H5YA 3QPIA 2A18A 3C6UB 2HQIA 5C42B 2QMXA 3MMAB 4AL6A 3DDKA 1DARA 2DJWA 3K57A 3KTQA 1KN6A 1FDBA 4LUBA 2LQ9A 3MMJA 1VMBA 1N33F 1L3SA 4KSEB 2UUBF 1LXJA 4X4PA 2ZNZA 4DX8H 4KV8A 5KT4A 4Q2LA 1NKCA 2BM0A 2CJKA 4LIRA 1JK9B 3T3FA 1CSJA 4PQUB 2XY6A 4LF7F 3DM2A 1PSDA 2DNLA 2NLWA 3IAM9 1XBWA 3O1LA 4LT6A 4NOHA 3S6EA 5H9FJ 5IM0A 5FDLA 4PWDB 1AUDA 3OLAA 3HX9A 3PV8A 1ZH5A 3I87A 2MY7A 2HFNA 3NCRA 1WD6A 5AXLA 4DV4F 2B9XA 1FHTA 4W92B 2KDOA 3PACA 1FK9A 1SL2A 2HWIA 1U6FA 3CPWR 3M6VA 2RVJA 4B9MA 3R5CA 1SKSA