1CJVB

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
188
Chain Sequence
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSARQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 61
structure length 188
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjvB00
1CJTB 4OYPA 5D0HA 4CLUA 1YBUA 1TL7A 1U0HA 4OYMA 3C14A 1WC0A 5D0GA 4CM0A 4OZ3A 4P2MA 4OYXA 1CJKA 3MAAB 1CJUB 1CS4A 4CLTA 3G82B 5IV4A 4OYIA 3C16A 2GVZB 1WC5A 2GVDA 4WP3A 2W01A 1AZSB 4USWA 3UVJB 1CJTA 4USVA 1WC1A 1WC6A 4OYAA 4P2FA 1CULB 3C15B 5D15A 5IV3A 5D0RA 2WZ1A 4NI2B 3MAAA 1CJUA 4CLYA 1U0HB 3ET6B 1WC4A 1CJVA 4WP8A 4CLZA 1AZSA 4USTA 3UVJA 4CLSA 5D0EA 1CS4B 4CLPA 3R5GA 1AB8A 3C15A 4CM2A 1Y10A 1FX2A 4OYOA 4OZ2A 1TL7B 4OYWA 1Y11A 4NI2A 4CLWA 3MR7A 3C14B 3G82A 2GVZA 4OYBA 3ET6A 4WP9A 4CLKA 4P2XA 4CLFA 1CJKB 1YK9A 4CLLA 1YBTA 1WC3A 1CULA 4USUA 3C16B 2GVDB 2QV6A 1FX4A 2BW7A 4OYZA 1CJVB 4WPAA
chains in the Genus database with same CATH superfamily
2EG2A 2BQRA 1YITS 1WD6A 4P6QA 4DCOB 3EE3A 4RW9A 4DPWA 2IPOB 1SC4B 4M5DA 1TUGB 1LW2B 1WEXA 1CJKA 1U24A 2XG8A 2A18A 1TKXB 3M8PA 2KN4A 5HN0A 6FD1A 4DX5A 1FRIA 3DDNA 5CZXA 2AZ1A 4AUKA 1LV5A 2XO7A 4ZCLA 3PW4A 3K5MA 2DNPA 2PE8A 1F60B 5E3RA 1VBXA 2HHTA 1ACMB 5BYQA 1F9EB 1UWBB 2LLZA 4DPYA 5E3AA 3MWBA 3HHLD 3PIOQ 4OZNA 4DS4A 4JI2F 4WXWA 1R27B 4LRBA 3H98A 2G0CA 4MIBA 4WFYA 4WKRA 3M05A 2BXJA 3Q2TC 3UNGC 1HNIA 3DRRB 3CC7S 1MW7A 3MDFA 3QFHA 2DJWA 5CCLA 1YI2S 3I0SA 3M8WA 3PEHA 4LF7J 3WC0A 4AL7A 2I9SA 2KVIA 3GFYA 4QU7A 3Q0AA 3S7RA 4K2XA 2VPWB 3O1LA 3BQ1A 3DOLB 4TYAA 4DR7J 3CJ8A 5DJBA 2VFRA 1BLUA 1VHIA 4WPAA 1LOUA 3L9ZA 3R9LA 1I6JA 5THWA 1TKTA 2AV5A 1X8DA 2DHXA 4K50A 2DNLA 5J2PA 1VQ4S 4OL8A 2R7TA 3MD1A 4OYIA 3LUYA 2KZMA 1GTHA 3CO0P 3SDEA 2R2UA 2VFUA 4HI2A 5LM7E 1C4AA 2DKOB 2O5DA 1N36F 2BW2A 2Z4PA 1S6QB 4XAKA 5L46A 4NXNF 3TX0A 1YJ9S 5JVHQ 2XMTA 1EP4B 1HR0J 3CIZA 1HMVA 3EZ5A 4ECUA 2HKEA 5KG1A 4DF4A 1XMQF 1DBDA 4X64F 5IWAJ 2C3PA 4OV6A 4DUYF 2OH2A 2GHWA 4LIRA 2V5HG 4URGA 2PFDA 4QWEA 3OW2R 4BC9A 1RT1A 1URNA 1ZA2B 3FJ2A 5F9LA 2IHR1 4C0HA 1BD6A 2QL5B 2DY1A 1WHVA 1UPMB 5KT5A 2R2TA 1TVRB 4I6AA 4MKBA 5ETQA 1DFDA 3JSRA 1TL7A 4OX8A 3PO4A 4UQGA 1X5OA 2MQMA 5HLFB 3KOAA 2OSRA 1GFWB 2UVVA 4ZJQA 4ED5A 3SCIE 2B4PA 1H74A 1HBUA 1C1CA 1JKHA 3GQCA 2H65B 2GV1A 3CMAS 3HHLB 4ZVTB 1N52B 4J5OA 3NAHA 5FD1A 5IV3A 3BB5A 1C1BB 4OFZA 2YNFA 3CNQP 1V9OA 1YJWS 1HHQA 1RUSA 1WC4A 1RT5B 3KJNB 1HI1A 2FJVA 4PWDA 1FTCA 4LBHA 4F4WA 1XERA 5D0EA 1RDRA 1NB7A 3K5OA 3TA0A 1J5EJ 4DR1F 3DLKB 5CD4A 2HIQA 5HAOA 2B4OA 3EXYA 3UCGA 1EQMA 1S6UA 3M9OB 2ROPA 1T3OA 4EGLA 3NWRA 4ILLA 3AY0A 3MEEB 3R5AA 4DU8A 5DGBA 4HHHA 4C3MA 1A6LA 3OVSA 2KYZA 1N56A 2VKZG 1RSCA 1N5TA 2Y9HA 2KYXA 2C2RA 1X9MA 2UXCF 2WSEC 1KVIA 1WF0A 3KWMA 1F2GA 3KUEA 1LFWA 2HQDA 1FK9A 4DUZJ 4AL5A 2FHJA 5F8GA 1NJYA 1F9FA 3NWGA 1GH8A 3N9UC 2MLZA 2DXFA 2MZTA 1NPPA 1XR6A 5AT1B 2V8VA 4O3QA 2CFXA 1X7VA 1NU4A 2JVRA 3PDNA 1T7PA 2AX0A 4NLWA 1VS3A 4USMA 1XR5A 1RTJB 2GA7A 5ETPA 2J9DA 2VPYB 2BW7A 4NZ0A 3LANA 2IMOA 2JEJA 2EC0A 1YIJS 2I8EA 2GMHA 3KLVA 4NXMF 3MPVA 4LRCA 2NXUA 3I4HX 4ZIWA 5KFJA 2HK3A 2ZM6F 3PR5B 2DH8A 3V4IB 4USKA 3HT3A 2E1MC 2ZOFA 4WE1A 3HD2A 2F8MA 1UZHA 2QE5A 4CO3A 2BZ2A 4GMKA 3Q2SC 2IVYA 3ITHB 4XK8C 4U67Q 1M5PC 1EX8A 2R3VA 2RIJA 3D1OA 3AH6A 1D9FA 3HVRA 4Y2IA 3GG0A 5F8NA 5KFLA 3DFEA 2DGXA 3OXGA 4RW9B 4EUVA 5K9FA 3ZNUA 4MKVA 1HKAA 4M5DB 4K4ZA 1CJKB 4KGVB 4CLLA 3M8PB 1PJ6A 4RWWA 4OHZA 1V3RA 3FMWA 3H20A 2XO6A 3VAJA 1D9AA 5EX3A 1U48A 1O5JA 1DTTA 5M2PA 4LF4F 2OPPA 1ZZFA 2AEMA 5KFAA 3A8JA 4KKOA 1HNIB 3RR7A 4MK7A 3HZEA 1S0OA 3I0SB 1U47A 4CLYA 1DAXA 3IWLA 3OJUA 4CO1A 5LSLA 4YB7A 2V4JA 3H4BA 5F9NA 5H9FJ 5IT9U 2RVJA 2FVPA 2F4VF 4JI5F 2HQFA 1MU2A 3GFZA 3V6KA 4DPOA 2F40A 4Y3CA 4J9LA 5J2PB 2YQ1A 4A4JA 3PRBA 3R8YA 3SDEB 3K59A 3CCQS 1RT3A 4ATNA 3J7YU 4M95A 1FRXA 3KHLA 2HNZB 4I69A 2IM2A 4D3HA 1WOOA 5HO4A 4G1QB 1PSDA 1Y3KA 4DFPA 3GV7B 1RACB 1BQMA 1VCTA 3FKBA 1CPZA 2DR9A 5JXSA 4RKUC 4AYBD 4OX6A 5C7PA 4B9VA 2FHJD 2QFJA 1Z2ZA 1SB6A 1OMSA 4DZ6A 4M94A 2MPUA 1HMVB 1RZMA 1KLMA 2AYMA 3R27A 2V34A 1HQEB 2J8SA 4ES2A 4B9MA 4IOAQ 1X0PA 1FTRA 2HVZA 3NKYA 1RT1B 2GGPA 3I9V9 4F2RA 3MM5A 3MFHA 3V5RA 5RUBA 1L3VA 2RJZA 1HNZJ 1FO1A 1FKOB 3J7AN 1FKAF 4HTIA 1TL7B 2ZFHA 2H54B 1SH0A 1Q16B 2AW0A 1MROA 3I0RA 3IO1A 4IRCA 4DR5J 2GAHC 4L72B 2RRNA 1T9YA 3BH6B 3PKMA 4KO0A 3S01A 3BN4A 4TNOA 3PX0A 4Y2CA 3PFOA 1C1CB 2EK6A 4TU7A 5J1NA 1JKHB 3B6BA 1Y5NB 5KFVA 2XMKA 2NXJA 4PPZA 3VVTA 3DM2A 1RTHA 5M2UA 4OHXA 4AD6A 4QWDA 2AJ2A 2R2SA 1Y9OA 2BA9A 1WELA 2YNFB 3TARA 5I42A 2Y3YA 4X4QA 3CJ2A 2DCLA 1Y00A 3TYTA 3NGDA 3LP1A 3RB3A 3I6PA 2HRUA 4FZVA 2MLXA 5KFTA 1UW4A 5CYQB 5GADI 2GJFA 4F7VA 4NLTA 2O66A 4ZCIA 3EGZA 3FNNA 4PG7A 2UUWA 2ADCA 4Z37A 2Y8WA 2HHHJ 4Q8EA 2AGPA 4F50A 4MKYA 1KTQA 1HA1A 3UDEA 4ED2A 2VG5A 3VHQA 2VZ9A 2CJYB 5HROA 1TAUA 2HNYA 3HJFA 4LQ9A 3E01A 2NXNA 3TZZA 1QAXA 4N56A 3HP6A 4ID5A 1NRKA 2Z2ZA 2WK4A 4N5SA 1KOOA 1RHRB 4OI1A 3PW2A 2VHGA 2JWNA 3FBCA 3NMAA 3G6VA 1RAAB 4ZK7M 4Y00A 2H4YB 3CCVS 1WUUA 2R2RA 3MMJA 4DR7F 1RQ0A 2QL7B 3M8SA 3H2VE 3SCLE 1SQFA 3M9MB 4DN0A 4N7TA 4DV5F 2E7VA 2VASA 1QAYA 2G1DA 5D3GA 4WP8A 3BSOA 1QDUB 1PJ7A 1N5SA 4LSZB 1UEUA 3HSGA 1U1QA 1YWXA 3C15A 5BJRA 2XI2A 3BH7B 5GMKa 2Y1LB 4USHA 1SJFA 1FCAA 1T94A 4OIXA 2J76E 1FKPA 1F5AA 3QWUA 1GMWA 2DYAA 3FSYA 4LFCJ 4CLUA 4EYHB 1YHQS 1REVB 2CPXA 4H4OB 3M6XA 4I1TA 1NK4A 1FDBA 5LXRA 1SQEA 4CYUB 2AJ0A 4Y2AA 5BYRA 2ACMA 2ZNYA 2D3UA 2G1HA 2W01A 3H90A 1VQNS 1K0TA 4K4TA 2IJNA 1UP1A 1SC3B 3KG0A 3D1QA 3EZUA 1OY6A 2ZBIA 1VQMS 1UVNA 3GV5B 1YRXA 1HQ2A 1NKCA 4DL6A 2H9ZA 3PW7A 3ADAC 2JEGA 2BKPA 1KN6A 3GR0A 3MPDA 5FLXY 1FD2A 4ED3A 4IG3A 1T03A 4ZPAA 2NSBA 1VJQA 2ROEA 1X9WA 2XCAA 4PRFA 1VRQC 2L9NA 3IFEA 4OYBA 2BQUA 3SFUA 3BGLA 5CXTA 4EWTA 1B64A 3OL9A 1VBYA 1DTTB 4XTTA 2OPPB 4USUA 5F8IA 1U2CA 1FVQA 2J7KA 5K14A 4ED1A 2EW9A 4DX6A 3C6UB 2ALYB 2XLIA 1J5EF 2CQGA 4KKOB 4K2JA 4ZHRA 2CJKA 3MURP 4WIQA 2XQCA 2BDPA 1QY7A 3NL0A 1WTBA 1FVSA 2IVFB 3TEGA 1R0CB 3KJQB 1V5IB 1RYSA 4JI0J 2LDIA 2RMLA 4LFAJ 3RR8A 4IOBA 3DOMB 2B43A 1FXRA 1EETA 1JLBA 2IRUA 1H98A 3H59A 3JYTA 2RHSB 3ENVA 2Z30B 3RB6A 2LA6A 5C42B 2MHNA 2GIFA 3F0NA 3DMJA 2MSTA 3HF5A 5EHHA 1BQMB 2DGUA 2MKCA 2AMCB 1NSPA 2N4CA 1YKWA 4P10A 5EGYA 1VK8A 3HFVA 2XWYA 2XMAA 2H5JB 2W2NP 2MZRA 3A8KA 2LP4A 1KLMB 2IIHA 4QPTA 1I94F 3R5BA 2EPIA 5HVGA 2F7VA 2U1AA 3MM5B 4ED7A 4ECYA 1Q8LA 1U1NA 3QT8A 1CULB 3W63A 4OJGA 2DCUB 4U7UD 3FEXB 4FXWA 2HS3A 4PQUA 1MROB 1YZ6A 3W5ZA 3ILOA 3NRBA 2MKSA 4K5RA 1UVIA 2VQFJ 3HLUA 2PA8D 4KO0B 2FQQB 2WVDA 3NAIA 1GMWD 4CT8A 2VA2A 5A6WA 2ZJQQ 3IP0A 2ZBPA 1RTHB 2B8QA 3FK4A 5BR8F 4J9KA 3EVOA 5ETVA 2XNRA 1FA0A 2BACA 1WEYA 3JQMA 1HBMA 3MOJB 4F02A 3LP1B 3K58A 3RTVA 3H40A 3D68A 4FVMA 5KFBA 4HACA 3HO1A 3JSBA 2LXIA 1R8BA 4M5JA 3M9NB 2WVCA 2CQDA 4WCEQ 3M30B 4PAAA 1NM2A 1CQNA 2L9WA 3J81j 2YPYA 2HBRB 1AUSL 3QGGA 4ECRA 2CUYA 1CLFA 2VG5B 1Y3JA 3TR5A 3OTOJ 1VQKS 1CJUA 3ZZUA 4FN5A 1PYTA 2L41A 5HROB 2QZ8A 4O0NA 2HNYB 4YR2A 3C66A 1U6FA 3VV2B 5H9FK 2IM3A 1TP7A 4LF6F 4ID5B 2P2CB 1IBLF 4UZBA 2COLA 1IXKA 3P8BB 1RA7A 1X9SA 2V67A 4QW9A 4DJBA 3CJTA 4BS2A 3MECA 4FDFA 2B7BB 1U26A 4C0BA 3IXQA 1QJHA 2B9EA 4OX7A 5KT6A 5DDQC 2E44A 3JS9A 1MWYA 1X4AA 4H54A 1WHYA 3BBFA 1JJ2R 3T1YJ 3ISNC 1CS4A 3QGIA 4O3PA 5D3GB 5KFNA 3I56S 2DGTA 3VGUA 1FJGJ 5AXNA 2FGCA 4BBYA 2UUCF 1N8RT 3GJQB 3G4SS 3C15B 3CD6S 1NAQA 1YJ7A 1OO0B 3QT6A 3D0IE 3C6TB 1XBWA 3ZO7A 3JB9k 2BYCA 4MJKA 4QR2A 3G9CA 1RAGB 4M1KA 1QTMA 4I2QB 2J6SA 2XMMA 1FKPB 1YX2A 3L7PA 4WFZA 1AB8A 4AXJA 1B0TA 4ZVPB 1TUWA 2F8EX 4JI3J 2BJ7A 1NDLA 1HFEL 2FJEB 4K4VA 3MCSA 3VQSA 1D8ZA 5I3UB 5BXIA 2LQ5A 1HPZA 2LA4A 1UA1A 4A8WA 1KFDA 1NSAA 3ENAA 5DGAA 4LF8J 3KLFA 2OELA 2QX0A 1DHMA 1IWAA 4ELVA 2MQLA 4F4YA 1JLGA 2KRRA 5DQGA 3VAMA 2V2KA 4DR5F 1OYDA 3R1LA 1FESA 3DI6A 3JAMY 5IV4A 2Y0BB 4ER8A 1K9MT 1FDDA 1S0NA 4CCHA 5B7WA 4IG3B 2HQGA 2BM0A 3QO9A 2OFHX 3UN5A 4DSLA 3D3CJ 2V8HA 5IXUA 3M7VA 2WZ1A 1VHFA 2HZVA 2WVEA 3W9IA 3KTQA 5JJBA 3HM9A 4KSEB 4QWCA 4KTQA 3V6DA 2JJ4D 2R7WA 4EZ9A 5K14B 4NEZA 3NNAA 4OYOA 3TAPA 2CVIA 3QBCA 2VBXA 2AIRB 2C2ZB 4CLWA 3M1VA 1FFSB 4ZHRB 2QSFA 1OYEA 3TUPA 4O4RA 2MZSA 5GAHU 1TL1A 1X4CA 2BKNA 1OSCA 2X7IA 1T9TA 2HHHF 4YB5A 4O3RA 2UV8G 1DQ8A 1RXOB 1M1HA 2W4DA 2ZH2A 2R8GA 1S1WB 2CZ4A 2YWWA 2MQNA 2OGUA 4WU2A 2MHEA 1MG7A 1RT6B 4ZLJA 2GJIA 4OZ3A 2W25A 4LSLA 3TRGA 1MWZA 3IG1A 2JRSA 2CG4A 3EYZA 2IY5B 1EETB 1JLBB 4K4UA 3NOCA 4CIOA 4DV1J 1ZBTA 1KHVA 3H5SA 3JYTB 1NLKL 1B70B 5LJ5Y 2XSJA 1QSYA 2DNNA 3DMJB 4NCBA 3RW6A 4A46A 2YWHA 1JLEA 3PO5A 1SUQB 2QMUB 3MM8A 1NSKL 1WOSA 3MMCA 1PGZA 2RDDA 3DLBA 1I1GA 4B3MJ 2J6UA 2DHAA 4UY85 4AT1B 4F4AA 2FJBB 2XS2A 3EGNA 2VV5A 2EFQA 1JXEA 2CQIA 1VQYA 3G82A 3CUNA 4NEYA 5EWEA 4UF4A 2DH9A 3BV8A 2C2DA 3J7Z5 4XPCA 3OTDA 4LF1A 2SXLA 4F8RA 3VAHA 3D4JA 3K89A 2QRRA 2F9JA 5LMUJ 1NJIT 1DQAA 2X1FA 4L74A 3POTA 4X65J 3DRPB 3RBXA 1B99A 3QMQA 4PQUB 3GIKA 4CDIA 4WP3A 3AD9C 2M7SA 3TAMA 3G8QA 3AJDA 1R89A 4LFCF 4B3RF 3C46A 2CWXA 3FCVA 3KNAA 5D15A 3R2DJ 3W3SA 4ED0A 1IJFB 2GNKA 3OVAA 4HI1A 4WK3A 2AHOB 2M5YA 2IM0A 1XN9A 4EFAC 2Y1RI 2U2FA 4HHJA 3V6HA 3AA8A 4NA1A 1NK6A 1BE4A 2N3LA 1Q79A 3CJ4A 2ROGA 4NLQA 1EKSA 4R0JA 1VQSA 3GILA 2DGOA 1S7HA 1JWWA 1N32J 1GMVA 2YWKA 4WK1A 3ZTQA 4NOHA 2YKOA 2OD6A 5A2QY 1NDCA 1N5QA 2VG7A 2YX4A 1BWEA 1NMEB 4PXCA 3T41A 3I82A 4P72A 4ZPVR 4ZITA 4M5GA 2FZGB 2X51A 4YB6A 1HIYA 3UDVA 3OUYB 1CJUB 4Y28C 4RUCA 2PMZD 3O6QA 2KT5A 5E7OB 4C3KA 2GO8A 3TZWA 4UQTA 1RT7B 3AB4B 2ZUAA 3PKYA 2CRLA 5EN1A 4FF4A 4KBIA 4KJIA 2DGWA 1UVLA 3L95X 3MTKA 3RRHA 4TN2A 4ZVHA 1RA6A 2R7QA 1PBAA 4ETZA 2CYYA 1IUJA 4EK2A 2MY8A 2Y1IA 4JOUA 2ZITA 4CLSA 1DJ0A 1XJWB 3TA2A 2PMWA 5D4LA 5H9EJ 5KFXA 3CULA 4A8KA 2MKKA 2K1RA 3TZXA 3CGIA 3KLHA 3UQSA 5A6PA 4ZN1A 4C98A 3KHGA 3M4XA 1RBAA 3MMBB 3HI9A 5L1IA 1BY9A 8ATCB 3D6HB 1CC7A 1FNXH 1A0OB 1LWEA 1Q7YT 1V6HA 3IR5B 2GQQA 5HK4A 1D8YA 3HULA 3LAMA 2XS7A 4DL0C 1LWCA 1HNWJ 1NZAA 3KLGB 1EB0A 2A6MA 2R8KA 3D54A 4RBUA 4DG1A 1VR6A 3A8IA 3CB4A 3PM9A 1TQLA 1NNDA 3THTA 1SKWA 1OJ4A 1TKZB 2NUHA 1RAJA 2LQ9A 2ZH4A 2L3MA 1N0UA 4B9SA 4MKAA 4QYRA 2OEKA 4HKQA 1I3OB 4NMXA 1X31C 3O3LA 4NLDA 1UWAA 3QZ7A 5KFMA 4ANEA 2KM8B 5A8RA 3N79A 1HPZB 3OL8A 1FDNA 2ATLA 3TANA 4GO7X 2Q6CA 2XMVA 4I67A 3EM1A 2IBKA 4UTGA 1JLGB 3P4UB 2D7SA 5LXYA 4DV7J 1RWUA 3IC1A 5F0WA 3GIMA 4RUAA 1UVKA 3Q86A 2QO3A 2AD9A 3IAS9 1U1LA 5IC4B 3QO9B 1KTVA 1WORA 4IFVA 1Q8BA 3RU0A 2ZOMA 2M4MA 1PYOB 2NS1B 3KFWX 1SC1B 2QGFB 1XNQF 2EEYA 3FSIA 5KG2A 3V6DB 1Y7PA 4I6WA 3WDOA 4RO0A 2XEXA 1RWVB 3EZOA 1Q0NA 4F67A 1H7WA 1WDTA 2VQEF 3HT0A 4DN9A 4LFBF 2P9GA 3LWLA 1TL1B 3OTCA 5LL6d 1KWMA 4MAKA 3KLIA 1Q53A 3IM9A 3LP2A 3SFGA 2PN6A 3CSKA 2KG0A 1IBMJ 4IG0B 5EUHA 3T1AA 3QT7A 4PABA 4YDDB 1N54B 2OEJA 3EGVA 4DCPB 1GEHA 4Q2LA 2KHDA 1JJ4A 2JL9A 1EARA 1KQFB 3GFHA 4IFYB 3P96A 2W2PP 2UUAF 1GXLA 1K73T 2XWXA 2XSJB 2HVDA 3PHEA 2FLLA 1D0EA 1JLEB 1CG2A 4HR2A 2ZBQA 1M5VC 5ETMA 3FRZA 1RWPB 3MMCB 4NMLA 2WB1D 4M5MA 3DGPA 4PCQA 1P8GA 2XHWA 2PI5A 2GIQA 2FVQA 2OIHA 2ATCB 3T1YF 3UI3A 3D6TB 1W25A 2CIMA 2GQCA 2DNMA 1IM6A 2MQ8A 4O4GA 2W2QP 3GLJA 2XGPA 1FX2A 1KHWA 5E41A 2OPRA 4UY8T 3UD3P 3DHWC 3MR7A 2RUSA 3A13A 3DLEB 3POTB 4YY3J 4DSJA 4CRJA 2RT3A 4PQAA 1UFWA 3UDCA 2VIHA 1S1VA 1U0SA 3IGVA 2G2YA 1IBCB 4J7CA 5DS7A 3GFXA 1J2VA 3SSSA 2FTRA 1SJQA 2RF2A 3I5BA 1F2HA 2KL8A 1SC6A 3EXCX 3A12A 1BQNA 2V63A 1RTDA 3M8QA 2E9RX 3ETOA 3V2UC 1S0VA 3N4WA 1W2BR 2C22A 3UVJA 1I5OB 4QR1A 2FJXA 1SVDA 2EI5A 3BDEA 3V81B 4I0WA 1S6PA 3AD8C 2RU9A 2KJWA 1V5VA 3OD2A 2VJUA 2WOMB 4CO5A 2D1CA 2IVMA 2RRAA 3NG8A 5DZ6A 1KP6A 2Q79A 3DN9A 2CNLB 2ZH5A 1B3TA 3PR4A 4Q0BA 3GIIA 4KE5A 2OPQA 4RNNA 4W90B 2FY1A 1OY8A 2MKIA 1N33J 4YHHJ 3OFFA 1S1TA 1VK3A 3CW2C 2FJDB 4DSIA 3C16A 3P49B 4J9PA 4MTPA 2FHKA 3BF4A 2XGQA 3J7YI 1NK8A 2LEAA 3K8VA 1C0TA 5ADZA 3PVXA 2OI2A 1WF2A 3G6XA 1GX5A 1WEZA 3KLHB 1EIYB 2QFIA 2W8LA 3RB4A 4EBCA 4JI4J 1RI7A 2MGZA 2E5LF 2AYGA 3MAQA 5DM6Q 2B56A 1R43A 5KT2A 3O5TB 1P9YA 4JI8F 5E3QA 4B9LA 4KV8B 1LWCB 3G6ES 1WOPA 3GWCA 3ZZZA 2HHWA 4DG1B 5E3PA 4EI2A 4B3MF 2HWTA 1O6XA 4L73A 3EWGA 1LQ9A 1NHUA 3R7SB 5DLGA 1EJ7L 1K47A 3CDAA 2JZ5A 1LKZA 5I4MA 3P3DA 3IR7B 5A8WB 3GB0A 3WZ0A 2FZKB 3ZZPA 3QGHA 3LOUA 2V2ZA 4F4KA 1G6BA 5B09A 4KAIA 2R4FA 3L3CA 1RU1A 3PCOB 1UA0A 4KB7A 4YEAA 2RQCA 3BYRA 2EFNA 2VG6A 4PUOA 4I2PB 4Y34A 3M8YA 4X65F 2M3DA 1IQTA 3VZHA 2GS8A 3DU6A 2XYGB 3LGNA 4IYQA 4TY9A 4KHPJ 2W7PA 3US5A 3MHYA 2FZCB 2P5VA 3R97A 2ZD1A 2BE7D 3GYGA 5HVFA 2ZVSA 4PWWA 4FYYB 3KK2A 4OLPA 3B82A 4RR5A 1J5OA 2JOQA 3IRWP 2EK1A 2AX1A 3RUBL 2CJAA 1KR4A 4USIA 3KK3A 1ZAVA 2M2BA 4LT6A 1FRKA 4M5LA 4KIAA 5KFRA 2V6AA 5KFYA 2WSFC 4YS2A 4WTOB 2MQOA 4IQXA 2C28A 4KGZB 2QEXS 1RTIA 1RAOA 2A10A 3THPA 4QQBA 3T1HJ 1LXJA 4N77A 1HW8A 4ANDA 3VAKA 1JLAA 5HJYA 1YDLA 2V94A 3KNGA 3WQPA 4FNHA 3LP2B 4EBDA 2XLKA 5H9EK 4K4YA 3CEDA 6AT1B 2MQQA 1YJNS 3VALA 1M0SA 2RNEA 1VBKA 2KKHA 1U7LA 3LA0A 5JVGQ 2MJUA 2VB6A 2CNNB 2C3OA 4L3KA 2CNKB 2DGQA 2CJXB 4ZVEA 3U1MA 1WNEA 4ZIVA 2Q43A 3MM6A 1E6YA 2DRDA 2RS2A 3BR8A 3A4TA 2WVFA 2ZH1A 4H4KA 3F44A 2E9TA 2DNOA 1Q5VA 5FIIA 1SXLA 2VU5A 3GU0A 2DVIA 2QMWA 2F65A 4USWA 1H2UX 4JYAJ 1A9NB 5KG5A 3T19A 2VFSA 1FFGB 4Q45A 3W1YC 2FJWA 1X4HA 1YSJA 5AE1A 4JV2A 2OPRB 3CJ3A 1QAJA 1HNWF 2OMOA 2KJVA 2MDAA 2G0IA 2GW8A 1CQMA 2XM3A 2RILA 4I68A 4NYZA 2ZZNA 3W61A 1E6VB 4ZJLA 4WKYA 4NRUA 1S1VB 1L3KA 3MPUB 5FDLA 4C6AA 2HVHA 2E7WA 4U7CA 4U8YA 3BEGB 4DQIA 2N7YA 3DRYA 2OSQA 4WP9A 4CLKA 2RF2B 3CJKA 2NPIA 1H3DA 3PIPQ 2ZVIA 3A3NB 2HQIA 2D69A 3SV3A 4IDKA 2HPUA 3QLHA 3MM7A 4P74A 2W9AA 5HBMA 2C2KB 1AA1B 1Z1ZA 1RTDB 1WC0A 3MTJA 1DLOA 3M8QB 4ELUA 1JLQA 1T9UA 1HHSA 4JV0A 2CADA 1FE0A 3QZ8A 2A2CA 2HGNA 4KH1B 3UVJB 1SKRA 2H48B 2E7XA 3ETMA 5GAGU 4AQYJ 5LT5A 1P9QC 1S10A 2LECA 5A0YB 4ZPCA 5D0RA 4DEZA 1S6PB 4K0KJ 2FVSA 1F1BB 2EFGA 3FCHA 5G0RB 1T05B 2QYCA 3CWJA 1KBRA 3QNWB 4QJVA 2HQ3A 3VTIA 4CH1A 3Q89A 4RW7A 4UZCA 5A8KB 3FFIA 3GZ7A 4JV5J 1SH2A 2OKQA 2UU9J 4Q0BB 3VF0B 4KY3A 2DEIA 2OPQB 3EMTA 4ALZA 1G3OA 4J9NA 3RRKA 4DV2J 1FWKA 1S1TB 3EDRB 4F4XA 1YBAA 3NXZA 3CMQA 2D3O1 5KOXA 1U09A 1FJ7A 3C16B 4ZN3A 2W4PA 1TZ0A 4LRAA 4X4VA 2IC3A 4LVOP 1SV5A 2XZDB 4OYMA 2RS8A 2F63A 1WJ9A 2DO4A 3M2UA 1OIAA 5K8MA 2MGZB 4UT4A 4RNOA 2DY9A 1H2TZ 2DHHA 3P6YC 1NUEA 2Q3PA 3VQTA 4QU6A 1O8BA 2MQPA 4C0OC 4CT9A 5KG7A 2BX6A 3LAKA 2JNJA 4ZPTR 5J1PA 4RNFA 4DR6J 4IRDA 2DNRA 1IJEB 2ZHBA 2LCWA 4EO6A 5D78A 3QRQA 2R8JA 1VJWA 2HW3A 1HI8A 1X0FA 2PSZA 1S4EA 4DQSA 1ELOA 3G8TA 4OV1A 2W9BB 5K8NA 2A6OA 1XK8A 1NPRA 3JQJA 1S4FA 3Q8QB 4CO4A 3NLCA 2F3JA 2RUGA 4GVBA 3BREA 5HMXA 1HBOA 4ZVFA 1UJ5A 3EGWB 2M52A 3TJ8A 1T95A 3AHPA 3KDOA 5KFFA 4B9NA 3QJJA 4NX9A 3MFIA 2YKMA 5J1EA 2D9PA 4USVA 2V2VA 3TUZC 2ZD1B 4DV0F 4RW4A 1REGX 5HQLA 3EVMA 1FWPA 1NB2A 4IRKA 2LXFA 2IRXA 4OZJA 1J5OB 4GKJF 4ERDA 3S6EA 3OLAA 5F8JA 2PD1A 4KPCA 3KK3B 3UDLA 1URRA 4RNHA 4RU9A 1N4LA 1HD1A 5KFCA 4OJ1A 3BSNA 3LO3A 2AKWB 3CMES 2XNQA 2GVZA 4X62F 4LF5F 1RAHB 1VQLS 2RQKA 1WKLA 3FBEA 3H5UA 2BVZA 4ECZA 3GSDA 4K5SA 4FF3A 2MMYA 2HFUA 3ONQA 2AF6A 1S1UA 5M2RA 3VAGA 4LJMA 2F5GA 3O44A 3TA1A 5AXLA 1KNZA 1YZ7A 1RBOB 4OX9J 3M8ZA 1WG4A 2ZBRA 3NNCA 1JLAB 2FHOB 2BOAA 5HATA 5IT9Y 4QIWD 4JBCA 3P5BP 3K57A 3TQ1A 1XMOF 3DXSX 4ZCKA 3TVYA 2JFDA 2QTWA 5EWGA 3JSMA 2HLUA 3U02A 3T5KA 2D3OR 1MNEA 7AT1B 4DR4J 4YHHF 3BR9A 5CCMA 3OTBA 2CZ9A 4CLZA 3D5MA 1OWXA 5K5MA 3WC2A 2B8PA 1UZDA 1IR2A 2QT7A 2R7VA 3TX8A 2F8HA 4C2MA 3G86A 5L39A 2E1AA 3IRXA 1T9WA 3GPAA 2DH7A 4FPRA 1DTQB 1YVFA 3WIVA 2JH3A 2FGOA 4G1PA 4WFAQ 2QYGA 4GKKJ 5GAEU 2HFOA 4FVCA 1LK7A 4B3OA 1H72C 4U95A 1J27A 4IOCQ 3OR1A 4G65A 1B0VA 2V50A 3GG1A 3CF5Q 4PKDB 4PXEA 2CG8A 2H4WB 3CDWA 1SL1A 2JEFA 2VFVA 5HSPA 3ZZTA 4DSFA 3T9NA 5IC6B 4F3OA 5L1KA 5HJXA 4DR2F 4ZP9A 4JI7F 2H3EB 3LALA 5CABA 5FDLB 2QA4G 4ETXA 4JI2J 4C4WA 4CP5A 4XDDA 1IWGA 2DNGA 3DOKA 2KXHA 3HCXA 4ZOSA 4H4KC 1CJVA 4USJC 1ZM9A 3CJKB 2ZUGA 1ROFA 3OXFA 2R8HA 1AW0A 3M2RA 4FKXA 3QLHB 3EPGA 4F3QA 3MM7B 3MEGA 1AFIA 2W2OP 3A3PB 3T6BA 5HBMB 1X4GA 4DFJA 2XZTB 1U1MA 1IR0A 3MEKA 1HNVA 3ET6A 2H5EA 2H5IB 1F5CA 5LJ3Y 1U1KA 4Y65A 1BXNA 1JLQB 2WONB 4PPDA 1U6BA 3W9HA 4KHPF 2P9EA 3Q22A 3SQGA 2YBVA 1T02A 4QIVA 4DR3F 1Q81T 5F8LA 3OSPA 5K20B 3D66A 3L7UA 3PG9A 1RLCL 3HVWA 3DYAA 1FHTA 2WHOA 4N8NA 2CQ0A 3IN5A 5GAHI 2A1BA 3SV4A 2DB1A 3KLEA 3HVTA 1N36J 3IBCB 4X66F 4M63A 4RW7B 4Y2KA 3I96A 3QIPA 2XS5A 3BBBA 2C2NA 4JI6F 4BLGA 4X4PA 2JSXA 5ETRA 2V8DA 5E3CA 3KMQA 1FF2A 4C8KA 1FXDA 1JX4A 3TAQA 4NL5A 1RWNB 1WSVA 4DPXA 3AB2B 4C8YA 3NP5A 1XMQJ 4X64J 3QFWA 4DUYJ 3JTPA 3H8YA 3WBZA 2IC3B 4F26A 4OYWA 1BMQB 1SV5B 2XLJA 4ZDNA 1U1PA 2YTCA 4HT7A 2OTJS 1SPBP 5J2NA 3CCSS 3M2UB 2FY8A 1GX6A 4RWXA 2CQ3A 3FMBA 3ZTRA 3SIPB 1F3VA 3MEDA 2OP5A 1T3NA 1PILA 3LQVA 2Z2YB 5I3QA 2AP6A 2F4FA 1U0HA 1M5HA 2QIFA 4WJBA 2DNQA 2ZEJA 2AZ3A 3WX4A 3E8OA 1OQ3A 3H2UB 1ZYQA 4DS5A 2ZDPA 2EC2A 3NBPA 4X4UA 1FDAA 1OQ6A 1QUPA 2YNIA 1KFSA 4ECSA 4R8UA 1WF1A 3VWSA 4NLPA 4U7UK 3N5BA 3RYLA 1GQEA 4EEYA 1TKTB 2AGQA 3KK1A 2A2DA 4FXVA 4BWJA 4K7QA 4JYAF 3BKFA 2EBGA 3RRGA 3OL7A 2QA2A 4FP9A 4DL4A 2LU2A 4YDXA 4ECQA 1HWIA 3BQ0A 2HG4A 3HHDA 4DV4J 1SQGA 4O44A 3K8WA 3TVZA 3M32A 1R8AA 1SL0A 3M6UA 2XULA 2IYGA 1R31A 4V19J 3K5PA 2M8DB 1GXUA 4LR7A 3D28A 1LK5A 2JDJA 4DQRA 4DFMA 2YKMB 3R5DA 5J1EB 3W65A 1SKUB 1FRLA 1KSPA 3N0VA 2HHSA 4X84A 1VQ9S 3QATA 3CDUA 3PYEA 4KHRA 4RW4B 5CQGA 3ZFVA 4W98A 4P7VA 1GXTA 1S57A 2UXCJ 4B3TJ 4PG8A 2JHEA 3KG4A 4HT5A 3OR2A 3PYDA 4KQZA 4NYOA 4Q7AA 2MKHA 1VFJA 2OJ3A 2C2MB 1Q5YA 2EFOA 4QIFA 1N34J 4M5HA 1YGYA 3PHTA 4QW8A 3PEJA 1JNZB 2R7OA 5F8MA 2ZC4A 3IMQJ 4QIEA 2I0XA 2BV3A 1PO6A 1G2EA 3FDSA 2B9WA 3OPKA 5DDPC 2Z58B 5KT4A 2N82B 1S1UB 1TMMA 2KFNA 2UXBF 3MCMA 1QVGR 1HBUB 4OQJA 4LBIA 4I7FA 4S0MA 2CQ4A 1XQIA 2UXDF 1U25A 3V6JA 2L48A 3GJTB 1Q78A 4ID8A 5E0OA 4B9TA 2V9WA 4NZ6A 3HKWA 4YUDA 1S6QA 4JV5F 4PWDB 3JQKA 2V68A 3JSMB 3VVUA 1BWVA 1YRTA 3CC2S 2ZM6J 4DX8H 1EP4A 1HWLA 2AU0A 1O0PA 3JTOA 1EAYC 1OS5A 2GVDA 2CPYA 3QRRA 2QA4S 2AEFA 4TVAB 1CSJA 4NPOA 4PYAA 1WC6A 3I5AA 4OYAA 4DFKA 3ENQA 4XIUA 1EZZB 2QC3A 1KS2A 2HHVA 3GJSB 2C2EA 2OEMA 2KG1A 5MAOA 2XC9A 3M6WA 1TVRA 3CDEA 4TU9A 1HYSA 4M5IA 2LQJA 5IM0A 5HLFA 4OI2A 2LDYA 3SBMA 4CO0A 5KG0A 3A3OB 5DM7Q 1T11A 1M1KT 4LF7F 2OHDA 1Q4RA 1FWLA 3CJ0A 1FK9B 1IN0A 4WTYA 2YKQA 3PNIA 1RWKB 3EICA 3HHLA 4CNZA 4G6VB 3BSAA 4A8QA 3G6YA 1RT5A 3CJQA 5T7LA 2NXCA 4LF4J 4U96A 3F73A 1TL3A 2JX2A 4QIGA 2YWEA 1QSSA 2PI4A 3DLKA 1ZS6A 1NBEB 5HP1A 3M2RB 5HL7Q 2Z8QA 2ZH6A 3MEGB 1U45A 3AJ2A 3FEYB 5D6GA 4LBPA 4WFXA 4M5KA 5IQ6A 1HNVB 3DXBA 3ET6B 2ZWOA 2DGSA 3SXLA 2CPHA 3EJMA 2HYIB 3RJMB 2ZH7A 4CZCA 1HR0F 2F4VJ 3JTNA 2J6TA 1VBZA 4RZRA 4DX7A 4JI5J 4L76A 4B02A 2DGVA 2CPDA 1PBUA 4WE1B 1XWLA 2ZBCA 1UEKA 5IWAF 2MXYA 3DYAB 3D9BA 2CQ2A 1KQGB 4EYIB 4HYKA 4P52A 3HVTB 1QE1A 4F0KA 2WBRA 5C24A 2XYPB 2RRBA 2DIUA 3HKZD 4Q5VA 3QIPB 1EKRA 5HMYA 1SKSA 3ILIA 2UVRA 3T5HA 1RBLA 4MH8A 1UEVA 4F04B 4WFNQ 2ASJA 1ZPWX 2BJ8A 2JLGA 3NCRA 4MMOA 4XPEA 2X1GA 4CWBA 3T9ZA 5L1LA 1NO8A 1RHJB 3U1LA 3PYGA 5J2NB 2YPZA 4J90A 3H5XA 4C9DA 2V4QA 3MEDB 4FF2A 3CJSA 2IJRA 4X4SA 2J8AA 1PAUB 4TY8A 4ZP6A 5IQQA 1VQ7S 5KFWA 3W2WA 4LRFA 3V4IA 4DR4F 2UZAA 2G9OA 4OJHA 1SIWB 3G87A 2D41A 1NKEA 1ITPA 3KMSA 5A76A 1Z2LA 3ITHA 4UW2A 2PC6A 3CCLS 4WYWA 2V4JB 3UNYA 1N48A 1APSA 2I6WA 3KXDA 2NYHA 4GVLA 2CQBA 4OI6A 2G2OA 5J2MA 3EDQB 1MU2B 2VH7A 3ISND 3OJSA 4J9SA 4GKKF 3LH2S 1C2PA 3PW0A 2MZ1A 1RTZA 4X4RA 2HWIA 5GMDA 4KRWA 1RT3B 4W92B 1RJJA 1S9EA 5KT3A 4O44B 7FDRA 4DUZF 4AL6A 3M32B 4UOCA 1RLDA 2DXDA 2BMBA 4C8ZA 1IVZA 3SQOP 2UUBJ 2H51B 2Q6BA 2WVBA 5B0FA 1FNMA 1G7CB 4NLGA 1NHKL 4F4ZA 1RADB 5IOLA 2IRYA 4RUHA 1RHKB 3QRPA 2DPJA 4ZJOA 3OR2B 1HBNA 2KRBA 2GGPB 1UJ6A 3NNHA 1MLAA 5CYJA 2XMUA 5G4DA 2DISA 1S1XA 1Y4ZB 5EDWA 1GK8A 3U27A 5T14A 5KFDA 3I0RB 2QA1A 1JJHA 2J9DE 1NKBA 1M5SA 2QLXA 4DV5J 4URSA 2Q66A 2ILYA 3PX6A 1QVFR 1R6YA 3M8RA 5ETSA 4I7FB 4RW6A 4P2SA 3DM2B 2MY7A 5SUHA 2HNZA 2YX7A 4FNIA 4G1QA 1RT4A 1U6ZA 4RU2A 2YWFA 1AUDA 1RISA 5I42B 1VISA 4Z7CA 4ECTA 4NI2A 1RYRA 5HANA 4IQMA 4X4NA 1TFYA 3PACA 3BN7A 4WZMA 4OZ1A 4IR9A 1HWUA 2CPEA 2GVDB 2WRMA 4OZLA 3AQPA 4Q44A 1C4CA 1HQEA 4O3OA 1ZZNA 3MPWA 4A8XA 3LTOA 1PC5A 4CH0S 4YP3A 2LVWA 2Z56B 1H2VZ 3HSJA 1ZTTA 4RUBA 3FGVA 1FKOA 4HHUA 1HYSB 4KHMA 1JIHA 2XTJP 2CAJA 3E01B 1S77D 2CJQA 2CQPA 5IM0B 2PDAA 5C2CA 2M9KA 1S12A 5B0GA 4LF9J 3PX4A 3R6LB 2KT2A 2P6SA 2IDEA 2X1AA 2CVEA 2V8PA 4QOTA 1IQZA 2XBPA 1UVJA 2VD3A 5AJ3J 2R7RA 5KFSA 4Y6IA 2QLWA 2W4CA 3C2PA 1VC5A 4ZVGA 1N88A 5T7LB 1TL5A 1H73A 1TL3B 3BO3A 2AGOA 4TKTA 2XMWA 1L5UA 2AQ4A 4ZVQB 1Q8IA 4OYZA 5CYQA 5HP1B 3QPIA 3FVYA 4TQRA 3MF5A 1R0AA 4DV4F 2HHPA 2CDRB 2UUTA 4OYXA 1UL3A 4FBUA 2MYFA 3CXCR 3FQKA 2DRBA 1X5PA 3W62A 5CHCB 1WC5A 4OHWA 3QGPA 2CPIA 3PRVA 3ELHA 2CQCA 2YQ3A 4DMZA 3BGUA 4P2FA 3HHLC 4A47A 3T5JA 1ZH5A 2ZZMA 1P1LA 4A8SA 3ZZOA 3LWMA 3NCQA 1NK0A 1XIQA 2PFFB 4B3TF 2OLWA 1AZSA 3NCPA 4WYLA 3ULHA 3U1NA 3MPYA 1QE1B 4U6PA 1TV6A 3R3TA 8AT1B 1N34F 1HNZF 5CA5A 5C24B 3BKUA 1CBKA 2XB2D 2HBQB 5ITHA 3PJ9A 1JMTA 1RAIB 4FYWB 4WIIA 1OSDA 3BS9A 2ABYA 1RB0A 3ENWA 5B0AA 3GP9A 5IT4A 4ZA1A 1T03B 1I94J 3CC4S 3OFGA 2HNDA 4CM0A 3AOBA 5GMEA 2HVEA 2B6AA 2WAQD 4B17A 5SZTA 2LEPA 1Q8KA 2OD4A 1WC1A 3BO2A 3S1TA 4TY8B 1Q95G 5DETA 3GIRA 1M5KC 4ZLNA 1VYAA 2ZHOA 3W2WB 3O2IA 1HI0P 4CQ1A 1HW9A 2RAQA 1R8CA 1JJCB 4I6YA 2DR8A 4USTA 4YR0A 3RBEA 3HPOA 2GC8A 4WZQA 5C5JA 1REVA 1U1OA 4EBEA 1K1QA 2DIVA 4H4OA 4OZ2A 4J9UE 2LMIA 1T9VA 1UKUA 5BR8J 4CYUA 1S59A 3FSXA 2EFVA 4J9QA 5J2MB 1IKXA 1FRHA 2ADBA 1MN9A 2N7CA 4IH5A 1LWXA 4FYDA 4ED4A 1U8SA 1X4EA 2OO4A 2H1YA 5KFOA 3CT9A 2FB0A 2KXFA 4N8OA 3QJLA 1S9EB 4AXIA 2FHMA 5DG8A 4CO2A 3D6MB 4IO9Q 3FEZA 1HWKA 3M2VA 3Q8UA 2XZWA 4ZLLA 2VJVA 2B9XA 3DKDA 3MR6A 3BO4A 5KFIA 4NLUA 4WWSA 4LQ3A 5KFZA 4NWBA 3MGJA 2R8IA 3QT5A 3C6UA 4LF6J 3MZIA 1IBLJ 3J80Y 5GAGI 3SMZA 2FLPA 4PXDA 4EO8A 1HBNB 4Y2MA 2KI2A 4Z7YA 2DO0A 2BANA 2YNHA 1LWFA 2YNGA 5EX0A 1S79A 1PIEA 1S1XB 4X4TA 4YB1P 3ZXWA 4V19X 4M5NA 2ZJRQ 2DNZA 2AYEA 8RUCA 1HL6A 3PW5A 2K2PA 3LF0A 1W26A 1YJTA 3I31A 3NS7B 4HH0A 3MUMP 3AODA 4FF1A 3DOMA 1MMNA 2J7UA 1P6TA 3FBFA 2CZVC 1F9HA 3Q8VA 2DHGA 4RW6B 2EKNA 1ZTWA 1RAEB 3B4DA 1QTNB 2A3JA 2UUCJ 2J0WA 4DOZA 3W5YA 5C42A 3K5LA 3RAMA 4KR0B 1XMBA 5KFQA 1RT4B 2RSQA 3SCKE 4NASA 2HMIA 3T6JA 1HBMB 3R1HA 3FC9A 5B0BA 1ZAXA 1AYEA 4NI2B 4ED6A 5IZHA 2MZQA 2POKA 2PT0A 2V0NA 4Q43A 4DL7A 3A1YG 4UOFA 4HACB 2VDHA 1FFWB 4DSKA 1HWJA 3L4BC 1TFWA 5KFKA 3VAIA 1UW9A 1GMUA 2HWHA 4ZVOB 1PC4A 1WC3A 1CULA 3T3FA 4BHQA 3BGFA 3RBDA 1G4CA 2PEBA 1U1RA 5CYMA 3BPSP 3CD0A 1ZETA 2VDIA 2W9CA 4ZVUB 3LW5C 3MCOA 2HFVA 2G0JA 3UCZP 3UWTA 4DI6A 1WKJA 4TU8A 2O01C 2BJ3A 2Z57B 3ISZA 1U4BA 2Y1JA 3DU5A 1WHWA 3GONA 3OBIA 2XSFA 2HBYB 4DLEA 3OFHA 2YKNA 3W9JA 3D1HA 2O1PA 3MECB 3UPFA 4ECVA 3DGVA 3NY0A 4JI0F 4LFAF 3NOGA 5C25A 2L9DA 3F41A 4P73A 5DG9A 1GNKA 9ATCB 5KFEA 1KDNA 2R9LA 3R7BB 1CS4B 1MMDA 1FI4A 1F5BA 1VQ5S 4BC7A 1FXLA 1FT8A 2ZWPA 4BWMA 2ZOGA 1AROP 3IA0A 1R0AB 2XY6A 3BSCA 2JVOA 1MSWD 1FNOA 3M30A 3P45B 1VQOS 3MCNA 2B4UA 5AE3A 5GVQA 2O3DA 2DXEA 4FPIA 2UUBF 3MUTP 3MR5A 2DD8S 2BE2A 1Q1KA 5HMWA 2VKRA 4CH7A 3J7A1 3TZYA 2MEWA 3IBWA 4CLTA 4IH7A 2KU7A 1XEZA 3SEOA 4KGKA 1AZSB 3FUYA 3KG1A 1YG0A 3QIDA 5HI7A 2R7SA 1Q82T 1TV6B 2R7XA 3F56A 2JC0A 3KLFB 4FXDA 5KG3A 3ILJA 2Y0SD 2VA3A 1BGXT 2XI3A 4ECXA 2DHSA 2LYVA 1L3TA 2GX8A 2R7UA 3D0HE 3DI6B 1VRTA 2VQFF 2RH3A 3R5JB 2JLFA 1D3WA 2F1FA 2LEBA 3OVBA 2E29A 3DLLQ 1L3SA 4V1Ak 3NEKA 3J81Y 2HNDB 3N6MA 3K0JA 5U47A 3TVKA 1YK9A 2M88A 2B6AB 3KUGA 2CPFA 1VDHA 4DWIA 3TQEA 4LF2A 4PYDA 3C6TA 1V3SA 2QMXA 3BKTA 1FJEB 4DL2A 3PFEA 4I2QA 1N5VA 1C0UA 1NDPA 3OFEA 3Q8RB 4A8OA 4RNMA 1RE1B 3M1VB 2ZH9A 4C11A 5GAEI 4BDPA 1NPKA 2ZKTA 4B3RJ 2X3DA 1FD8A 2RB7A 1SJ4P 4DL3A 2K7KA 2FLOA 3VR1A 2LU1A 1PG5B 3WX8A 1PYSB 2VBWA 5I3UA 3DDKA 2ASLA 3RBZA 3OHBA 4ANCA 2C2OB 3OTOF 3ZZYA 4YMEA 4O3NA 4LSLB 4K4WA 4KFBA 4I4BA 1ZM3A 3RZAA 1IKXB 3IG1B 4E98A 5D4NA 2NREA 2I5JA 4ED8A 4LF9F 2FVCA 4A8MP 4QYZJ 4A48A 3PTWA 1JXVA 3R5CA 2WW4A 3G96A 1HHTP 2ZJPQ 5L8RC 1TELA 2I2YA 2B5JA 3HDSA 3OSNA 4RPFA 1WI8A 5MLCV 4Y0FA 4OHYA 5FJ4A 3MM8B 3M2VB 4OYPA 1XNRJ 5AJ3F 4B9UA 2EG1A 2KXNB 4LMZA 1MWQA 5D0GA 2HS0A 2RU3A 2QLFB 1UCNA 4ZMMA 2YX1A 2HFZA 3G82B 1JK9B 3CVKA 2DPIA 4PG4A 3MR2A 2VOPA 2J9CA 1VOMA 3IS9A 2NCKL 3MD3A 1FJGF 5AE2A 2BANB 1K0VA 2YNHB 1LWFB 2YNGB 5E2QA 2B51A 3QSIA 2Q1LA 4O0IA 2MKYA 2MJNA 3R2CJ 4MYUA 2ILZA 5T41A 5IFMA 3MM9A 1S1WA 2NLWA 4ZS6A 1W2IA 2EXUA 2DK2A 3KHRA 1NDKA 3HX9A 2LQ8A 4K8RA 1RT6A 3TAMB 1SJ1A 1K8AT 4NCGA 3LPEA 4MIWA 2CA9A 3PZPA 2NSCA 4JI3F 2KFZA 5B0DA 2DNYA 3DLJA 1XR7A 4L75A 2R42A 1JQGA 2K8GA 2QL9B 3FCWA 3VZIA 1PJ5A 2CPZA 2HMIB 4LF8F 3C14A 1SUQA 1S97A 5F3TA 1RKIA 3GCWP 1KKHA 3W5XA 3DC2A 1S5ZA 1W7WA 3PXGa 1RK8A 2BJ1A 1NHVA 2MB0B 4KT0C 5F41A 4LREA 4LIWA 2APOA 3ZZRA 2PA3A 2VG7B 2VFTA 1TMJA 2P6TA 4RW8A 4HDGA 3CCTA 3H2LA 1LW0A 1BQXA 2VICA 2KFYA 4IR1A 1VC6A 3N01A 2V8GA 1U49A 4ZPBA 2VBZA 2OPSA 4UUXA 1WG1A 2BM1A 3RGIA 5LMNJ 1NK7A 2LKZA 1TK8A 1QUVA 2QLBB 1AXQA 5CYMB 3DRPA 2W9CB 1DURA 4IH6A 4IKAA 3BBCA 5EWFA 1TAQA 3N6LA 2FDNA 5L9XA 3AAWB 3ZTSA 2YKNB 4NCAA 1OPIA 1AT1B 2AJFE 1JXLA 2M0GB 1R8PA 2AJ4A 2K1RB 5LSRA 1PKUA 2VOOA 2CQHA 1FEEA 1S9GA 3E3XA 1NK9A 1XNQJ 5C25B 4IO1A 2PO4A 3OT9A 4MFBA 4FBTA 3CE8A 1GAOA 3FRYA 3KJFB 3IAM9 5JMNA 1T0TV 4NA3A 4DV1F 1XTZA 2VQEJ 4LFBJ 1LWEB 5D8HB 3PJWA 2OTLS 1IKVA 3ZC4A 4AFFA 2X1BA 5HQ8A 1X4BA 5F8HA 4UOGA 4C8MA 2BBEA 4J9VA 3GSIA 3CPWR 3OUYA 2NZCA 1DQ9A 2BE2B 5ETKA 1Z4UA 2GZOA 2BR0A 2FD2A 4W4MA 1M90T 5IS2A 3HK2A 2QG9B 1RT7A 5KAKA 2GIRA 1HNXJ 4PG6A 5A8RB 5IT0A 2AJ1A 3HVAA 2UUAJ 1WSRA 2PGCA 3X3UA 5LMUF 5FLXU 4YN3B 4TLQA 3HSZA 4E2FB 2OAUA 3IWNC 2BKOA 3AOCA 1WHXA 3TI0A 3HMJG 1VRTB 2ASYA 3SSQA 1R3NA 1TU0B 3MMBA 1B4SA 4ENOA 1IR1A 4ZPWR 2E9ZA 1D9DA 4IFVB 1SIZA 3E2EA 3SCJE 4ZKAA 1KONA 5I3PA 5DLFA 2PMHA 5ETTA 4LR8A 2MTLA 3KLGA 1KQKA 2BOPA 1Y11A 2ZH8A 2YY3A 1S7IA 4DV6J 5B0EA 3SZ2A 4X2BA 1SBRA 1TKZA 1C0UB 2YXLA 2RDJA 5C2GA 1N32F 4TYBA 1FRJA 1RP5A 3OLBA 2B3TB 4C11B 1JLCA 1PAEX 2HGMA 4QWBA 1S6OA 5F0UA 3H0PA 3TWZA 1F3FA 2V9KA 2QSWA 3HHEA 2E5JA 1K1SA 3BYPA 2E1PA 4NRTA 1B7FA 4I56A 3KLIB 2YKAA 3V4MA 3SYZA 4MT1A 1YLXA 2ZDOA 4DU7A 4ZP7A 1CJTA 3HD1A 4KFBB 5DDOC 2RQMA 4HTJA 2IAJA 4URQU 2I5JB 2FYXA 3D2WA 2EWHA 3GR1A 1TL4A 2AWZA 4Z2XA 4J37A 2ALZA 3TUIC 2K3KA 2B5JB 4DHVA 6FDRA 4F25A 1VIOA 2EKYA 4CLPA 3A8EA 2NUUG 3C19A 4QCLA 4CM2A 3GJRB 3UR3C 4ITSA 3GE9A 3DGPB 4QBUA 5BYSA 1RWMB 2HRTA 4UUWA 2CDQA 3UD4P 3G8SA 4CLFA 3NGSA 2C1EB 3ICLA 3TP2A 1YTYA 3W66A 1VQPS 3VCDA 3IS9B 1TTHB 1YJUA 3PJXA 4O4GB 4O3SA 4P2MA 5ETOA 2L08A 5L38A 3MMAA 2E5GA 1KD1T 4KYZA 5CAAA 4N47A 4ELTA 2CQ1A 3MM9B 5KFUA 4C8NA 2RKIA 2A0FB 5JUMA 4KGMA 3HXMA 3CD5A 5CH7B 4IG0A 1WACA 1Y0HA 4PWUA 2V4RA 4NCGB 2DEJA 3FZBA 3K17A 4L6V3 1NJXA 2E5LJ 5ETNA 4IFYA 4C48A 3NMRA 2DR7A 4JI8J 4CI0B 2I38A 2LXUA 1BQNB 2K3IA 3CTRA 2KT3A 1WKKA 2B7CB 3C14B 4DPTA 1VQ6S 3UD5A 1SH3A 4G3IA 4C8OA 4KH0B 1WDDA 1X4FA 4DV7F 1S0MA 3IGNA 4ILRA 1RABB 2NPFA 4P7TA 3DHXA 5D0HA 2HK2A 3S8SA 4HEA9 5KFGA 4RW8B 2HGLA 5L1JA 1LW0B 1D09B 3EVWA 3OV7A 4B3SJ 3AA9A 2XHCA 3IR6B 2VBYA 3FZ2A 3CCJS 3P5TL 2E1CA 3QSYB 2HQCA 3C3LA 3HSDA 3D67A 5J2QA 2OPSB 3LP0A 2QN6B 4U8VA 2ZH3A 3DLEA 1LNQA 2D3ZA 3GTYX 3DLGA 3WHIA 2GO9A 2UV8A 3I32A 3CJRA 3DRXA 1FERA 2HS4A 3U7JA 2HZCA 4EZ6A 1MN7A 4F0HA 1YQHA 2IBOA 1EHWA 1VI7A 1DY3A 1U2FA 3AXMA 1A7GE 1V3ZA 1P27B 1Y10A 4QYZK 1LXNA 2MKJA 1C0TB 4RBVA 2WB4A 1RWXB 1X5SA 3CCWA 4P2XA 1S9GB 1IBMF 2G2ZA 2GHPA 1G1XA 2BRLA 2J0XA 4MFBB 2QV6A 1UAWA 2D9OA 4D3GA 3D0GE 2AYBA 4Q2MA 3HHKA 2OFGX 2JC1A 3K5NA 2XMJA 3CCRS 5D4OA 1VGYA 1ZOTA 3PRDA 2ZNZA 4DZDA 3DNCA 1FEHA 3V81A 2OMLA 2EFPA 4FYVB 1IKVB 3KKFA 4OI4A 3CO9A 2GJ2A 4EMDA 2WOMA 2CXEA 3HJVA 1XNRF 4NLRA 3OL6A 3E51A 1R0BG 1SCJB 1NJZA 1RWOB 3CCMS 5DRKA 5KT7A 2XYHB 4LVNP 4MK9A 1O51A 3AXKA 3W7BA 1KVKA 3GMGA 3CDBA 3TOQA 1YJRA 5ETLA 1RHQB 1CVJA 2HLTA 3TW0A 5HVHA 1GTEA 2BRKA 3JAMU 1N0VC 3TO8A 2ZZTA 3BGRA 2VG6B 2UP1A 4ICLA 4PUOB 2K7JA 1VLYA 1Q86T 4PG5A 1LFPA 3QYYA 4QWAA 4YY3F 5HQMA 2VODA 3AD7C 3QQCD 1KLNA 5DQIA 5DG7A 3BM7A 1RGVA 3VGTA 5GADU 2VL1A 2AT1B 2RD5C 5CZVA 3KK2B 2ERRA 1K44A 1MMLA 3UN3A 1I51B 2RDIA 3ZZ0A 3GYXB 3Q23A 2N4DA 3KDNA 1DRZA 4FKYA 4KV8A 4H4MA 2RQ4A 3KYLA 4HDHA 1AFJA 2DR5A 1RT2A 1NSQA 3H7HB 1RAFB 1GT8A 3RW7A 4DBQA 2M70A 5KFHA 2VUGA 4DV3J 2KHCA 4N41A 4OZ5A 1FJCA 1JLFA 5A8WA 1JLCB 1RTIB 2J0SD 4R25A 4J9OA 9RUBA 1X60A 1T8EA 3SI8A 1H7XA 2HBZB 2GCFA 1ZPVA 1YBTA 2XCPA 4KPYA 3KJVA 2ZC3A 2FUG9 2FC8A 5LMNF 1CJTB 4I2PA 4ES3A 3L09A 1XC9A 1VMBA 4OMFG 2IAJB 2W7OA 2O67A 2LQBA 4ECWA 4ZLPA 2NYIA 1N33F 4CTAA 3BGOP 3MI7X 1N5YA 3MM6B 1E6YB 3I55S 3W8GA 1VQ8S 2J5AA 2VF3A 1U02A 1UJ4A 5AXKA 3RB0A 5E33A 3B78A 3L7OA 3J80U 2CKWA 3MAAA 1QLNA 2HURA 1IKYA 2KM8C 4OHVA 4JI4F 1B7YB 1N6QA 1IBKJ 4RJVA 1R7IA 4JI1J 1NH7A 5K8OA 2BUNA 4CNYA 5DQHA 2CWKA 4PEOA 4DXLA 3Q8SB 3G71S 4MYTA 2C3UA 4QR0A 2W24A 5F3ZA 2BEFA 3MMAB 4M8LA 4L3NA 2X3GA 1RHUB 3HFZB 4J9RA 4FS1A 2Z2MA 2RKIB 1YBUA 4WU3A 4BCAA 1FRMA 3LGMA 2LFVA 3LPYA 4ES1A 1X4DA 1JNRB 4RX6A 3RAQA 2G13A 4ILMA 3IM8A 4DL5A 3NGUA 1HNXF 5D4PA 1LEOA 1NJWA 3Q24A 2KTQA 2PEHA 3QAUA 3GCXP 1BHNA 4DDFA 4IDKB 4YFUA 4R0EA 1S48A 4PR6A 1HQUA 3UR0A 1M5OC 3GYNA 5DO2A 5A2QU 3DDIA 1QAIA 4WFBQ 3CD7A 4NZ7A 5LOQA 1DLOB 3EX7B 3CCES 3UN2A 4RBTA 2ZE2A 3D6FB 4IUFA 2GMLA 5KFPA 4NLVA 2HRYA 4TQSA 2N3OA 2W1BA 1ZAWA 1PCAA 1YJVA 3CCZA 3UW1A 1IM4A 4ZP8A 3K7RA 4F2SA 2WSCC 1NEEA 1ICEB 3W2VA 2HEKA 4P9SA 4C7QA 4YQWA 2RE1A 3R6GB 3B8HA 1WG5A 1BUXA 5L9NA 2F9DA 1IKWA 3GV8B 2ZKUA 1FX4A 2CNOB 2IA6A 2HFNA 5J2QB 3LP0B 2VPXB 2E5IA 3W8PA 3KUHA 3FFIB 3B4MA 1SL2A 2UVWA 3DLGB 4DV6F 2Z0GA 4XO0A 3H5YA 3I5CA 4KC5A 2JEIA 4LUBA 4NXNJ 1E6VA 5AXMA 4OLOA 1OPZA 3AT1B 2FPHX 2Z2LA 3I87A 7FD1A 4DV0J 3WIUA 3EPIA 2FJAB 3J7ZT 1WWHA 5CD4H 3HFKA 5DZ7A 4NA2A 3I4PA 2J7WA 1KQSR 2IYIA 3QWPA 4WF9Q 3T1HF 2GAGC 4HL9A 2BQ3A 2HSEB 4GKJJ 3B54A 4WXOA 4C8LA 2K06A 4JB8B 3K2YA 2MSSA 3DCAA 4DSEA 3EUNA 3ZNJ1 3GIJA 3TJ9A 2MLYA 3KHHA 4A8YA 3R5GA 3W60A 1ZM2A 5LSOA 4X62J 4LF5J 1UVMA 1RHMB 4R5PA 2WBMA 1NK5A 1EQ0A 4K4XA 4FYXB 1VRUA 5KOWA 2VONA 2NQPA 2XY5A 5A0YA 3DRSA 4UOHA 3RAXA 4A8FA 2HHUA 1OY9A 2QJ3A 3OTEA 5E5NA 5G0RA 1T05A 2YH1A 2E66A 4N76A 3BZQA 2ACYA 1SI9A 1M1GA 2IM1A 1H0HB 5H1SV 1Y5IB 4ZVSB 1XMOJ 3NGKA 5A8KA 2YKPA 4Q8FA 4LSNA 3VGSA 1YRUA 2UVUA 3AJ1A 3H25A 4DR1J 4MK8A 4C97A 2YWGA 5KG4A 1NCLA 3VGVA 1LW2A 3JSYA 1WTFA 4GVBB 3OHAA 1TKXA 3NS5A 2DITA 3O8WA 1HBOB 3BGRB 2IJFA 1HLWA 4ICLB 4GC7A 1TR0A 1UFLA 4J9MA 1RWWB 4YOEA 2FVRA 4P71A 2D74B 3J81U 4NLYA 2NR0A 1UWBA 4YR3A 4TLRA 5KTQA 1U2RA 2DRAA 5K8PA 4ZVRB 4LRDA 3Q83A 1JB0C 4DQQA 3D3BJ 3N28A 3TEHB 4NE9C 1UETA 3DRRA 4ZCMA 2C42A 1TK5A 1BC6A 2HFSA 2QLJB 1SJ3P 1QM9A 4RL1A 1CEZA 4P75A 4H4MB 4X4OA 2FLNA 2WCXA 1QD1A 4OZ0A 2P8IA 3N6NA 1R6VA 1ZM4A 1RT2B 2MZJA 5KG6A 3DOLA 2RHQB 4DR2J 4JI7J 1RCOB 2GVZB 2P9CA 2HVIA 3UE2A 2W8KA 2BE9B 1UFKA 1ULRA 1JLFB 4AQYF 3T5LA 3NGTA 3TNVA 5D77A 1RKJA 4E0DA 2DNHA 3BJYA 2W9BA 2FC9A 3BPDA 4GRSA 4DPUA 1KVJA 1H38A 4K0KF 2I1RA 3Q8PB 4B3SF 1L3UA 3TJAA 4O23A 4JP8A 4DF8A 3KJVB 4F36A 2HAFA 4E8UA 3RG6A 1TKDA 2VC0A 4NXMJ 2UU9F 4NYPA 2XY7A 3ZTOA 2ZHAA 1CC8A 2Y8YA 3AFGA 1H6KX 4DV2F 4CTAB 2GQ2A 4DR3J 4LR9A 2HHQA 1N5YB 3QJPA 2IDLA 2BJDA 1UPPA 1DZ5A 2B9YA 2V2QA 4QPXA 3AQOA 3MR3A 4GO5X 4PXBA 1NH8A 1RCXB 2KO1A 3MAAB 1Q7LB 3IRXB 1T9XA 4C3LA 2WTFA 1IKYB 1ZA1B 4X66J 2EVZA 2YQ0A 2JFKA 4HLBA 3CJ5A 2FIUA 1UMJA 4U9RA 1N6QB 4AE5A 4JI6J 3LGHA 3SSRA 4DUTA 5DDRC 2CJBA 4B3OB 2HAIA 2B0GA 3G2XA 1S49A 3OR1B 1S76D 2B4VA 2GFFA 4DLGA 4K4SA 3D7SB 3ILLA 1X5TA 3UO0A 1KC8T 3X1LB 3PY8A 1B0PA 1WI6A 4OI3A 1Y5LB 1C1BA 1QSLA 2JLEA 1NXIA 4JUZA 2C3MA 1S99A 1S72S 4DR6F 4TXSA 3H42A 4FS2A 1SJRA 1F6TA 4NLOA 3BQ2A 3QAEA 1FE4A 3DOKB 2DTJA 4EU0A 4PZVA 2E1RA 4HVZA 3MAHA 1NZ8A 4G1IA 1CJVB 3CIMA 2G4BA 3C8YA 3I9ZA 3THVA 3ZTPA 1TK0A 4NLXA 1DARA 5HMZA 2OUGA 4F3MA 1R8HA 3PYFA 1U8WA 2C3YA 1HQUB 2BJEA 3FBBA 4WBFA 2ASDA 4RLEA 3UFCX 3MXHP 2KH9A 2ZE2B 2IMWP 2IFXA 4KGXB 3MEEA 2J9EA 2DR6A 2KVQE 3AOAA 1DTQA 3SQGB 4B08A 3FQLA 3W2VB 3MOZA 2W2MP 4QZVB 1S9FA 2GMJA 1KOHA 3M6VA 2DBBA 2E5HA 3OQ2A 3IWXA 2DNKA 2HHXA 1IKWB 1TUVA 3UCUP 3VAFA 2BJ9A 3R7NB 3W64A 3KLEB 4HH1A 3NGRA 2PIIA 4XDCA 2NZ4A 4F0MA 3TUJC 3IBFB 2BABA 3CCUS 4JV1A 2AEJA 2J0QD 1UTAA 2AJQA 1VIXA 4DV3F 3BDPA 2M8HA 1KRPA 4MIAA 4K59A 1VC0A 3MUVP 4OX9F 1RTJA 4DQPA 3HZGA 4I64A 2IA0A 2HIYA 5B08A 2WONA 4R5PB 4OI0A 3Q8YA 2V69A 1U0HB 3H4DA 2CJ9A 2KZZA 2YH0A 2GHVC 1VRUB 2NXEA 2YVSA 2UXBJ 2EBEA 1VLOA 2DT9A 2WW8A 3DRSB 2KB2A 4GC6A 3NBPB 2W7AA 3PV8A 1D1UA 3OXLA 4OJ3A 4DCJB 4ZPDA 3NS6A 2UXDJ 1KEKA 2VPZB 2YNIB 5B0CA 1RU2A 1HD0A 1P1TA 2HZAA 1HARA 2VC1A 4R8UB 2KDOA 1F0XA 3DLHA 3HHNB 3N5FA 3JXOA 4J91A 4NLSA 4LSNB 1IBKF 3KK1B 4JI1F 2CPJA
chains in the Genus database with same CATH topology
1CJTB 4OYPA 5D0HA 4CLUA 1YBUA 1TL7A 1U0HA 4OYMA 3C14A 1WC0A 5D0GA 4CM0A 4OZ3A 4P2MA 4OYXA 1CJKA 3MAAB 1CJUB 1CS4A 4CLTA 3G82B 5IV4A 4OYIA 3C16A 2GVZB 1WC5A 2GVDA 4WP3A 2W01A 1AZSB 4USWA 3UVJB 1CJTA 4USVA 1WC1A 1WC6A 4OYAA 4P2FA 1CULB 3C15B 5D15A 5IV3A 5D0RA 2WZ1A 4NI2B 3MAAA 1CJUA 4CLYA 1U0HB 3ET6B 1WC4A 1CJVA 4WP8A 4CLZA 1AZSA 4USTA 3UVJA 4CLSA 5D0EA 1CS4B 4CLPA 3R5GA 1AB8A 3C15A 4CM2A 1Y10A 1FX2A 4OYOA 4OZ2A 1TL7B 4OYWA 1Y11A 4NI2A 4CLWA 3MR7A 3C14B 3G82A 2GVZA 4OYBA 3ET6A 4WP9A 4CLKA 4P2XA 4CLFA 1CJKB 1YK9A 4CLLA 1YBTA 1WC3A 1CULA 4USUA 3C16B 2GVDB 2QV6A 1FX4A 2BW7A 4OYZA 1CJVB 4WPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJT B;  4OYP A;  5D0H A;  4CLU A;  1YBU A;  1TL7 A;  1U0H A;  4OYM A;  3C14 A;  1WC0 A;  5D0G A;  4CM0 A;  4OZ3 A;  4P2M A;  4OYX A;  1CJK A;  3MAA B;  1CJU B;  1CS4 A;  4CLT A;  3G82 B;  5IV4 A;  4OYI A;  3C16 A;  2GVZ B;  1WC5 A;  2GVD A;  4WP3 A;  2W01 A;  1AZS B;  4USW A;  3UVJ B;  1CJT A;  4USV A;  1WC1 A;  1WC6 A;  4OYA A;  4P2F A;  1CUL B;  3C15 B;  5D15 A;  5IV3 A;  5D0R A;  2WZ1 A;  4NI2 B;  3MAA A;  1CJU A;  4CLY A;  1U0H B;  3ET6 B;  1WC4 A;  1CJV A;  4WP8 A;  4CLZ A;  1AZS A;  4UST A;  3UVJ A;  4CLS A;  5D0E A;  1CS4 B;  4CLP A;  3R5G A;  1AB8 A;  3C15 A;  4CM2 A;  1Y10 A;  1FX2 A;  4OYO A;  4OZ2 A;  1TL7 B;  4OYW A;  1Y11 A;  4NI2 A;  4CLW A;  3MR7 A;  3C14 B;  3G82 A;  2GVZ A;  4OYB A;  3ET6 A;  4WP9 A;  4CLK A;  4P2X A;  4CLF A;  1CJK B;  1YK9 A;  4CLL A;  1YBT A;  1WC3 A;  1CUL A;  4USU A;  3C16 B;  2GVD B;  2QV6 A;  1FX4 A;  2BW7 A;  4OYZ A;  1CJV B;  4WPA A; 
#chains in the Genus database with same CATH topology
 2EG2 A;  2BQR A;  1YIT S;  1WD6 A;  4P6Q A;  4DCO B;  3EE3 A;  4RW9 A;  4DPW A;  2IPO B;  1SC4 B;  4M5D A;  1TUG B;  1LW2 B;  1WEX A;  1CJK A;  1U24 A;  2XG8 A;  2A18 A;  1TKX B;  3M8P A;  2KN4 A;  5HN0 A;  6FD1 A;  4DX5 A;  1FRI A;  3DDN A;  5CZX A;  2AZ1 A;  4AUK A;  1LV5 A;  2XO7 A;  4ZCL A;  3PW4 A;  3K5M A;  2DNP A;  2PE8 A;  1F60 B;  5E3R A;  1VBX A;  2HHT A;  1ACM B;  5BYQ A;  1F9E B;  1UWB B;  2LLZ A;  4DPY A;  5E3A A;  3MWB A;  3HHL D;  3PIO Q;  4OZN A;  4DS4 A;  4JI2 F;  4WXW A;  1R27 B;  4LRB A;  3H98 A;  2G0C A;  4MIB A;  4WFY A;  4WKR A;  3M05 A;  2BXJ A;  3Q2T C;  3UNG C;  1HNI A;  3DRR B;  3CC7 S;  1MW7 A;  3MDF A;  3QFH A;  2DJW A;  5CCL A;  1YI2 S;  3I0S A;  3M8W A;  3PEH A;  4LF7 J;  3WC0 A;  4AL7 A;  2I9S A;  2KVI A;  3GFY A;  4QU7 A;  3Q0A A;  3S7R A;  4K2X A;  2VPW B;  3O1L A;  3BQ1 A;  3DOL B;  4TYA A;  4DR7 J;  3CJ8 A;  5DJB A;  2VFR A;  1BLU A;  1VHI A;  4WPA A;  1LOU A;  3L9Z A;  3R9L A;  1I6J A;  5THW A;  1TKT A;  2AV5 A;  1X8D A;  2DHX A;  4K50 A;  2DNL A;  5J2P A;  1VQ4 S;  4OL8 A;  2R7T A;  3MD1 A;  4OYI A;  3LUY A;  2KZM A;  1GTH A;  3CO0 P;  3SDE A;  2R2U A;  2VFU A;  4HI2 A;  5LM7 E;  1C4A A;  2DKO B;  2O5D A;  1N36 F;  2BW2 A;  2Z4P A;  1S6Q B;  4XAK A;  5L46 A;  4NXN F;  3TX0 A;  1YJ9 S;  5JVH Q;  2XMT A;  1EP4 B;  1HR0 J;  3CIZ A;  1HMV A;  3EZ5 A;  4ECU A;  2HKE A;  5KG1 A;  4DF4 A;  1XMQ F;  1DBD A;  4X64 F;  5IWA J;  2C3P A;  4OV6 A;  4DUY F;  2OH2 A;  2GHW A;  4LIR A;  2V5H G;  4URG A;  2PFD A;  4QWE A;  3OW2 R;  4BC9 A;  1RT1 A;  1URN A;  1ZA2 B;  3FJ2 A;  5F9L A;  2IHR 1;  4C0H A;  1BD6 A;  2QL5 B;  2DY1 A;  1WHV A;  1UPM B;  5KT5 A;  2R2T A;  1TVR B;  4I6A A;  4MKB A;  5ETQ A;  1DFD A;  3JSR A;  1TL7 A;  4OX8 A;  3PO4 A;  4UQG A;  1X5O A;  2MQM A;  5HLF B;  3KOA A;  2OSR A;  1GFW B;  2UVV A;  4ZJQ A;  4ED5 A;  3SCI E;  2B4P A;  1H74 A;  1HBU A;  1C1C A;  1JKH A;  3GQC A;  2H65 B;  2GV1 A;  3CMA S;  3HHL B;  4ZVT B;  1N52 B;  4J5O A;  3NAH A;  5FD1 A;  5IV3 A;  3BB5 A;  1C1B B;  4OFZ A;  2YNF A;  3CNQ P;  1V9O A;  1YJW S;  1HHQ A;  1RUS A;  1WC4 A;  1RT5 B;  3KJN B;  1HI1 A;  2FJV A;  4PWD A;  1FTC A;  4LBH A;  4F4W A;  1XER A;  5D0E A;  1RDR A;  1NB7 A;  3K5O A;  3TA0 A;  1J5E J;  4DR1 F;  3DLK B;  5CD4 A;  2HIQ A;  5HAO A;  2B4O A;  3EXY A;  3UCG A;  1EQM A;  1S6U A;  3M9O B;  2ROP A;  1T3O A;  4EGL A;  3NWR A;  4ILL A;  3AY0 A;  3MEE B;  3R5A A;  4DU8 A;  5DGB A;  4HHH A;  4C3M A;  1A6L A;  3OVS A;  2KYZ A;  1N56 A;  2VKZ G;  1RSC A;  1N5T A;  2Y9H A;  2KYX A;  2C2R A;  1X9M A;  2UXC F;  2WSE C;  1KVI A;  1WF0 A;  3KWM A;  1F2G A;  3KUE A;  1LFW A;  2HQD A;  1FK9 A;  4DUZ J;  4AL5 A;  2FHJ A;  5F8G A;  1NJY A;  1F9F A;  3NWG A;  1GH8 A;  3N9U C;  2MLZ A;  2DXF A;  2MZT A;  1NPP A;  1XR6 A;  5AT1 B;  2V8V A;  4O3Q A;  2CFX A;  1X7V A;  1NU4 A;  2JVR A;  3PDN A;  1T7P A;  2AX0 A;  4NLW A;  1VS3 A;  4USM A;  1XR5 A;  1RTJ B;  2GA7 A;  5ETP A;  2J9D A;  2VPY B;  2BW7 A;  4NZ0 A;  3LAN A;  2IMO A;  2JEJ A;  2EC0 A;  1YIJ S;  2I8E A;  2GMH A;  3KLV A;  4NXM F;  3MPV A;  4LRC A;  2NXU A;  3I4H X;  4ZIW A;  5KFJ A;  2HK3 A;  2ZM6 F;  3PR5 B;  2DH8 A;  3V4I B;  4USK A;  3HT3 A;  2E1M C;  2ZOF A;  4WE1 A;  3HD2 A;  2F8M A;  1UZH A;  2QE5 A;  4CO3 A;  2BZ2 A;  4GMK A;  3Q2S C;  2IVY A;  3ITH B;  4XK8 C;  4U67 Q;  1M5P C;  1EX8 A;  2R3V A;  2RIJ A;  3D1O A;  3AH6 A;  1D9F A;  3HVR A;  4Y2I A;  3GG0 A;  5F8N A;  5KFL A;  3DFE A;  2DGX A;  3OXG A;  4RW9 B;  4EUV A;  5K9F A;  3ZNU A;  4MKV A;  1HKA A;  4M5D B;  4K4Z A;  1CJK B;  4KGV B;  4CLL A;  3M8P B;  1PJ6 A;  4RWW A;  4OHZ A;  1V3R A;  3FMW A;  3H20 A;  2XO6 A;  3VAJ A;  1D9A A;  5EX3 A;  1U48 A;  1O5J A;  1DTT A;  5M2P A;  4LF4 F;  2OPP A;  1ZZF A;  2AEM A;  5KFA A;  3A8J A;  4KKO A;  1HNI B;  3RR7 A;  4MK7 A;  3HZE A;  1S0O A;  3I0S B;  1U47 A;  4CLY A;  1DAX A;  3IWL A;  3OJU A;  4CO1 A;  5LSL A;  4YB7 A;  2V4J A;  3H4B A;  5F9N A;  5H9F J;  5IT9 U;  2RVJ A;  2FVP A;  2F4V F;  4JI5 F;  2HQF A;  1MU2 A;  3GFZ A;  3V6K A;  4DPO A;  2F40 A;  4Y3C A;  4J9L A;  5J2P B;  2YQ1 A;  4A4J A;  3PRB A;  3R8Y A;  3SDE B;  3K59 A;  3CCQ S;  1RT3 A;  4ATN A;  3J7Y U;  4M95 A;  1FRX A;  3KHL A;  2HNZ B;  4I69 A;  2IM2 A;  4D3H A;  1WOO A;  5HO4 A;  4G1Q B;  1PSD A;  1Y3K A;  4DFP A;  3GV7 B;  1RAC B;  1BQM A;  1VCT A;  3FKB A;  1CPZ A;  2DR9 A;  5JXS A;  4RKU C;  4AYB D;  4OX6 A;  5C7P A;  4B9V A;  2FHJ D;  2QFJ A;  1Z2Z A;  1SB6 A;  1OMS A;  4DZ6 A;  4M94 A;  2MPU A;  1HMV B;  1RZM A;  1KLM A;  2AYM A;  3R27 A;  2V34 A;  1HQE B;  2J8S A;  4ES2 A;  4B9M A;  4IOA Q;  1X0P A;  1FTR A;  2HVZ A;  3NKY A;  1RT1 B;  2GGP A;  3I9V 9;  4F2R A;  3MM5 A;  3MFH A;  3V5R A;  5RUB A;  1L3V A;  2RJZ A;  1HNZ J;  1FO1 A;  1FKO B;  3J7A N;  1FKA F;  4HTI A;  1TL7 B;  2ZFH A;  2H54 B;  1SH0 A;  1Q16 B;  2AW0 A;  1MRO A;  3I0R A;  3IO1 A;  4IRC A;  4DR5 J;  2GAH C;  4L72 B;  2RRN A;  1T9Y A;  3BH6 B;  3PKM A;  4KO0 A;  3S01 A;  3BN4 A;  4TNO A;  3PX0 A;  4Y2C A;  3PFO A;  1C1C B;  2EK6 A;  4TU7 A;  5J1N A;  1JKH B;  3B6B A;  1Y5N B;  5KFV A;  2XMK A;  2NXJ A;  4PPZ A;  3VVT A;  3DM2 A;  1RTH A;  5M2U A;  4OHX A;  4AD6 A;  4QWD A;  2AJ2 A;  2R2S A;  1Y9O A;  2BA9 A;  1WEL A;  2YNF B;  3TAR A;  5I42 A;  2Y3Y A;  4X4Q A;  3CJ2 A;  2DCL A;  1Y00 A;  3TYT A;  3NGD A;  3LP1 A;  3RB3 A;  3I6P A;  2HRU A;  4FZV A;  2MLX A;  5KFT A;  1UW4 A;  5CYQ B;  5GAD I;  2GJF A;  4F7V A;  4NLT A;  2O66 A;  4ZCI A;  3EGZ A;  3FNN A;  4PG7 A;  2UUW A;  2ADC A;  4Z37 A;  2Y8W A;  2HHH J;  4Q8E A;  2AGP A;  4F50 A;  4MKY A;  1KTQ A;  1HA1 A;  3UDE A;  4ED2 A;  2VG5 A;  3VHQ A;  2VZ9 A;  2CJY B;  5HRO A;  1TAU A;  2HNY A;  3HJF A;  4LQ9 A;  3E01 A;  2NXN A;  3TZZ A;  1QAX A;  4N56 A;  3HP6 A;  4ID5 A;  1NRK A;  2Z2Z A;  2WK4 A;  4N5S A;  1KOO A;  1RHR B;  4OI1 A;  3PW2 A;  2VHG A;  2JWN A;  3FBC A;  3NMA A;  3G6V A;  1RAA B;  4ZK7 M;  4Y00 A;  2H4Y B;  3CCV S;  1WUU A;  2R2R A;  3MMJ A;  4DR7 F;  1RQ0 A;  2QL7 B;  3M8S A;  3H2V E;  3SCL E;  1SQF A;  3M9M B;  4DN0 A;  4N7T A;  4DV5 F;  2E7V A;  2VAS A;  1QAY A;  2G1D A;  5D3G A;  4WP8 A;  3BSO A;  1QDU B;  1PJ7 A;  1N5S A;  4LSZ B;  1UEU A;  3HSG A;  1U1Q A;  1YWX A;  3C15 A;  5BJR A;  2XI2 A;  3BH7 B;  5GMK a;  2Y1L B;  4USH A;  1SJF A;  1FCA A;  1T94 A;  4OIX A;  2J76 E;  1FKP A;  1F5A A;  3QWU A;  1GMW A;  2DYA A;  3FSY A;  4LFC J;  4CLU A;  4EYH B;  1YHQ S;  1REV B;  2CPX A;  4H4O B;  3M6X A;  4I1T A;  1NK4 A;  1FDB A;  5LXR A;  1SQE A;  4CYU B;  2AJ0 A;  4Y2A A;  5BYR A;  2ACM A;  2ZNY A;  2D3U A;  2G1H A;  2W01 A;  3H90 A;  1VQN S;  1K0T A;  4K4T A;  2IJN A;  1UP1 A;  1SC3 B;  3KG0 A;  3D1Q A;  3EZU A;  1OY6 A;  2ZBI A;  1VQM S;  1UVN A;  3GV5 B;  1YRX A;  1HQ2 A;  1NKC A;  4DL6 A;  2H9Z A;  3PW7 A;  3ADA C;  2JEG A;  2BKP A;  1KN6 A;  3GR0 A;  3MPD A;  5FLX Y;  1FD2 A;  4ED3 A;  4IG3 A;  1T03 A;  4ZPA A;  2NSB A;  1VJQ A;  2ROE A;  1X9W A;  2XCA A;  4PRF A;  1VRQ C;  2L9N A;  3IFE A;  4OYB A;  2BQU A;  3SFU A;  3BGL A;  5CXT A;  4EWT A;  1B64 A;  3OL9 A;  1VBY A;  1DTT B;  4XTT A;  2OPP B;  4USU A;  5F8I A;  1U2C A;  1FVQ A;  2J7K A;  5K14 A;  4ED1 A;  2EW9 A;  4DX6 A;  3C6U B;  2ALY B;  2XLI A;  1J5E F;  2CQG A;  4KKO B;  4K2J A;  4ZHR A;  2CJK A;  3MUR P;  4WIQ A;  2XQC A;  2BDP A;  1QY7 A;  3NL0 A;  1WTB A;  1FVS A;  2IVF B;  3TEG A;  1R0C B;  3KJQ B;  1V5I B;  1RYS A;  4JI0 J;  2LDI A;  2RML A;  4LFA J;  3RR8 A;  4IOB A;  3DOM B;  2B43 A;  1FXR A;  1EET A;  1JLB A;  2IRU A;  1H98 A;  3H59 A;  3JYT A;  2RHS B;  3ENV A;  2Z30 B;  3RB6 A;  2LA6 A;  5C42 B;  2MHN A;  2GIF A;  3F0N A;  3DMJ A;  2MST A;  3HF5 A;  5EHH A;  1BQM B;  2DGU A;  2MKC A;  2AMC B;  1NSP A;  2N4C A;  1YKW A;  4P10 A;  5EGY A;  1VK8 A;  3HFV A;  2XWY A;  2XMA A;  2H5J B;  2W2N P;  2MZR A;  3A8K A;  2LP4 A;  1KLM B;  2IIH A;  4QPT A;  1I94 F;  3R5B A;  2EPI A;  5HVG A;  2F7V A;  2U1A A;  3MM5 B;  4ED7 A;  4ECY A;  1Q8L A;  1U1N A;  3QT8 A;  1CUL B;  3W63 A;  4OJG A;  2DCU B;  4U7U D;  3FEX B;  4FXW A;  2HS3 A;  4PQU A;  1MRO B;  1YZ6 A;  3W5Z A;  3ILO A;  3NRB A;  2MKS A;  4K5R A;  1UVI A;  2VQF J;  3HLU A;  2PA8 D;  4KO0 B;  2FQQ B;  2WVD A;  3NAI A;  1GMW D;  4CT8 A;  2VA2 A;  5A6W A;  2ZJQ Q;  3IP0 A;  2ZBP A;  1RTH B;  2B8Q A;  3FK4 A;  5BR8 F;  4J9K A;  3EVO A;  5ETV A;  2XNR A;  1FA0 A;  2BAC A;  1WEY A;  3JQM A;  1HBM A;  3MOJ B;  4F02 A;  3LP1 B;  3K58 A;  3RTV A;  3H40 A;  3D68 A;  4FVM A;  5KFB A;  4HAC A;  3HO1 A;  3JSB A;  2LXI A;  1R8B A;  4M5J A;  3M9N B;  2WVC A;  2CQD A;  4WCE Q;  3M30 B;  4PAA A;  1NM2 A;  1CQN A;  2L9W A;  3J81 j;  2YPY A;  2HBR B;  1AUS L;  3QGG A;  4ECR A;  2CUY A;  1CLF A;  2VG5 B;  1Y3J A;  3TR5 A;  3OTO J;  1VQK S;  1CJU A;  3ZZU A;  4FN5 A;  1PYT A;  2L41 A;  5HRO B;  2QZ8 A;  4O0N A;  2HNY B;  4YR2 A;  3C66 A;  1U6F A;  3VV2 B;  5H9F K;  2IM3 A;  1TP7 A;  4LF6 F;  4ID5 B;  2P2C B;  1IBL F;  4UZB A;  2COL A;  1IXK A;  3P8B B;  1RA7 A;  1X9S A;  2V67 A;  4QW9 A;  4DJB A;  3CJT A;  4BS2 A;  3MEC A;  4FDF A;  2B7B B;  1U26 A;  4C0B A;  3IXQ A;  1QJH A;  2B9E A;  4OX7 A;  5KT6 A;  5DDQ C;  2E44 A;  3JS9 A;  1MWY A;  1X4A A;  4H54 A;  1WHY A;  3BBF A;  1JJ2 R;  3T1Y J;  3ISN C;  1CS4 A;  3QGI A;  4O3P A;  5D3G B;  5KFN A;  3I56 S;  2DGT A;  3VGU A;  1FJG J;  5AXN A;  2FGC A;  4BBY A;  2UUC F;  1N8R T;  3GJQ B;  3G4S S;  3C15 B;  3CD6 S;  1NAQ A;  1YJ7 A;  1OO0 B;  3QT6 A;  3D0I E;  3C6T B;  1XBW A;  3ZO7 A;  3JB9 k;  2BYC A;  4MJK A;  4QR2 A;  3G9C A;  1RAG B;  4M1K A;  1QTM A;  4I2Q B;  2J6S A;  2XMM A;  1FKP B;  1YX2 A;  3L7P A;  4WFZ A;  1AB8 A;  4AXJ A;  1B0T A;  4ZVP B;  1TUW A;  2F8E X;  4JI3 J;  2BJ7 A;  1NDL A;  1HFE L;  2FJE B;  4K4V A;  3MCS A;  3VQS A;  1D8Z A;  5I3U B;  5BXI A;  2LQ5 A;  1HPZ A;  2LA4 A;  1UA1 A;  4A8W A;  1KFD A;  1NSA A;  3ENA A;  5DGA A;  4LF8 J;  3KLF A;  2OEL A;  2QX0 A;  1DHM A;  1IWA A;  4ELV A;  2MQL A;  4F4Y A;  1JLG A;  2KRR A;  5DQG A;  3VAM A;  2V2K A;  4DR5 F;  1OYD A;  3R1L A;  1FES A;  3DI6 A;  3JAM Y;  5IV4 A;  2Y0B B;  4ER8 A;  1K9M T;  1FDD A;  1S0N A;  4CCH A;  5B7W A;  4IG3 B;  2HQG A;  2BM0 A;  3QO9 A;  2OFH X;  3UN5 A;  4DSL A;  3D3C J;  2V8H A;  5IXU A;  3M7V A;  2WZ1 A;  1VHF A;  2HZV A;  2WVE A;  3W9I A;  3KTQ A;  5JJB A;  3HM9 A;  4KSE B;  4QWC A;  4KTQ A;  3V6D A;  2JJ4 D;  2R7W A;  4EZ9 A;  5K14 B;  4NEZ A;  3NNA A;  4OYO A;  3TAP A;  2CVI A;  3QBC A;  2VBX A;  2AIR B;  2C2Z B;  4CLW A;  3M1V A;  1FFS B;  4ZHR B;  2QSF A;  1OYE A;  3TUP A;  4O4R A;  2MZS A;  5GAH U;  1TL1 A;  1X4C A;  2BKN A;  1OSC A;  2X7I A;  1T9T A;  2HHH F;  4YB5 A;  4O3R A;  2UV8 G;  1DQ8 A;  1RXO B;  1M1H A;  2W4D A;  2ZH2 A;  2R8G A;  1S1W B;  2CZ4 A;  2YWW A;  2MQN A;  2OGU A;  4WU2 A;  2MHE A;  1MG7 A;  1RT6 B;  4ZLJ A;  2GJI A;  4OZ3 A;  2W25 A;  4LSL A;  3TRG A;  1MWZ A;  3IG1 A;  2JRS A;  2CG4 A;  3EYZ A;  2IY5 B;  1EET B;  1JLB B;  4K4U A;  3NOC A;  4CIO A;  4DV1 J;  1ZBT A;  1KHV A;  3H5S A;  3JYT B;  1NLK L;  1B70 B;  5LJ5 Y;  2XSJ A;  1QSY A;  2DNN A;  3DMJ B;  4NCB A;  3RW6 A;  4A46 A;  2YWH A;  1JLE A;  3PO5 A;  1SUQ B;  2QMU B;  3MM8 A;  1NSK L;  1WOS A;  3MMC A;  1PGZ A;  2RDD A;  3DLB A;  1I1G A;  4B3M J;  2J6U A;  2DHA A;  4UY8 5;  4AT1 B;  4F4A A;  2FJB B;  2XS2 A;  3EGN A;  2VV5 A;  2EFQ A;  1JXE A;  2CQI A;  1VQY A;  3G82 A;  3CUN A;  4NEY A;  5EWE A;  4UF4 A;  2DH9 A;  3BV8 A;  2C2D A;  3J7Z 5;  4XPC A;  3OTD A;  4LF1 A;  2SXL A;  4F8R A;  3VAH A;  3D4J A;  3K89 A;  2QRR A;  2F9J A;  5LMU J;  1NJI T;  1DQA A;  2X1F A;  4L74 A;  3POT A;  4X65 J;  3DRP B;  3RBX A;  1B99 A;  3QMQ A;  4PQU B;  3GIK A;  4CDI A;  4WP3 A;  3AD9 C;  2M7S A;  3TAM A;  3G8Q A;  3AJD A;  1R89 A;  4LFC F;  4B3R F;  3C46 A;  2CWX A;  3FCV A;  3KNA A;  5D15 A;  3R2D J;  3W3S A;  4ED0 A;  1IJF B;  2GNK A;  3OVA A;  4HI1 A;  4WK3 A;  2AHO B;  2M5Y A;  2IM0 A;  1XN9 A;  4EFA C;  2Y1R I;  2U2F A;  4HHJ A;  3V6H A;  3AA8 A;  4NA1 A;  1NK6 A;  1BE4 A;  2N3L A;  1Q79 A;  3CJ4 A;  2ROG A;  4NLQ A;  1EKS A;  4R0J A;  1VQS A;  3GIL A;  2DGO A;  1S7H A;  1JWW A;  1N32 J;  1GMV A;  2YWK A;  4WK1 A;  3ZTQ A;  4NOH A;  2YKO A;  2OD6 A;  5A2Q Y;  1NDC A;  1N5Q A;  2VG7 A;  2YX4 A;  1BWE A;  1NME B;  4PXC A;  3T41 A;  3I82 A;  4P72 A;  4ZPV R;  4ZIT A;  4M5G A;  2FZG B;  2X51 A;  4YB6 A;  1HIY A;  3UDV A;  3OUY B;  1CJU B;  4Y28 C;  4RUC A;  2PMZ D;  3O6Q A;  2KT5 A;  5E7O B;  4C3K A;  2GO8 A;  3TZW A;  4UQT A;  1RT7 B;  3AB4 B;  2ZUA A;  3PKY A;  2CRL A;  5EN1 A;  4FF4 A;  4KBI A;  4KJI A;  2DGW A;  1UVL A;  3L95 X;  3MTK A;  3RRH A;  4TN2 A;  4ZVH A;  1RA6 A;  2R7Q A;  1PBA A;  4ETZ A;  2CYY A;  1IUJ A;  4EK2 A;  2MY8 A;  2Y1I A;  4JOU A;  2ZIT A;  4CLS A;  1DJ0 A;  1XJW B;  3TA2 A;  2PMW A;  5D4L A;  5H9E J;  5KFX A;  3CUL A;  4A8K A;  2MKK A;  2K1R A;  3TZX A;  3CGI A;  3KLH A;  3UQS A;  5A6P A;  4ZN1 A;  4C98 A;  3KHG A;  3M4X A;  1RBA A;  3MMB B;  3HI9 A;  5L1I A;  1BY9 A;  8ATC B;  3D6H B;  1CC7 A;  1FNX H;  1A0O B;  1LWE A;  1Q7Y T;  1V6H A;  3IR5 B;  2GQQ A;  5HK4 A;  1D8Y A;  3HUL A;  3LAM A;  2XS7 A;  4DL0 C;  1LWC A;  1HNW J;  1NZA A;  3KLG B;  1EB0 A;  2A6M A;  2R8K A;  3D54 A;  4RBU A;  4DG1 A;  1VR6 A;  3A8I A;  3CB4 A;  3PM9 A;  1TQL A;  1NND A;  3THT A;  1SKW A;  1OJ4 A;  1TKZ B;  2NUH A;  1RAJ A;  2LQ9 A;  2ZH4 A;  2L3M A;  1N0U A;  4B9S A;  4MKA A;  4QYR A;  2OEK A;  4HKQ A;  1I3O B;  4NMX A;  1X31 C;  3O3L A;  4NLD A;  1UWA A;  3QZ7 A;  5KFM A;  4ANE A;  2KM8 B;  5A8R A;  3N79 A;  1HPZ B;  3OL8 A;  1FDN A;  2ATL A;  3TAN A;  4GO7 X;  2Q6C A;  2XMV A;  4I67 A;  3EM1 A;  2IBK A;  4UTG A;  1JLG B;  3P4U B;  2D7S A;  5LXY A;  4DV7 J;  1RWU A;  3IC1 A;  5F0W A;  3GIM A;  4RUA A;  1UVK A;  3Q86 A;  2QO3 A;  2AD9 A;  3IAS 9;  1U1L A;  5IC4 B;  3QO9 B;  1KTV A;  1WOR A;  4IFV A;  1Q8B A;  3RU0 A;  2ZOM A;  2M4M A;  1PYO B;  2NS1 B;  3KFW X;  1SC1 B;  2QGF B;  1XNQ F;  2EEY A;  3FSI A;  5KG2 A;  3V6D B;  1Y7P A;  4I6W A;  3WDO A;  4RO0 A;  2XEX A;  1RWV B;  3EZO A;  1Q0N A;  4F67 A;  1H7W A;  1WDT A;  2VQE F;  3HT0 A;  4DN9 A;  4LFB F;  2P9G A;  3LWL A;  1TL1 B;  3OTC A;  5LL6 d;  1KWM A;  4MAK A;  3KLI A;  1Q53 A;  3IM9 A;  3LP2 A;  3SFG A;  2PN6 A;  3CSK A;  2KG0 A;  1IBM J;  4IG0 B;  5EUH A;  3T1A A;  3QT7 A;  4PAB A;  4YDD B;  1N54 B;  2OEJ A;  3EGV A;  4DCP B;  1GEH A;  4Q2L A;  2KHD A;  1JJ4 A;  2JL9 A;  1EAR A;  1KQF B;  3GFH A;  4IFY B;  3P96 A;  2W2P P;  2UUA F;  1GXL A;  1K73 T;  2XWX A;  2XSJ B;  2HVD A;  3PHE A;  2FLL A;  1D0E A;  1JLE B;  1CG2 A;  4HR2 A;  2ZBQ A;  1M5V C;  5ETM A;  3FRZ A;  1RWP B;  3MMC B;  4NML A;  2WB1 D;  4M5M A;  3DGP A;  4PCQ A;  1P8G A;  2XHW A;  2PI5 A;  2GIQ A;  2FVQ A;  2OIH A;  2ATC B;  3T1Y F;  3UI3 A;  3D6T B;  1W25 A;  2CIM A;  2GQC A;  2DNM A;  1IM6 A;  2MQ8 A;  4O4G A;  2W2Q P;  3GLJ A;  2XGP A;  1FX2 A;  1KHW A;  5E41 A;  2OPR A;  4UY8 T;  3UD3 P;  3DHW C;  3MR7 A;  2RUS A;  3A13 A;  3DLE B;  3POT B;  4YY3 J;  4DSJ A;  4CRJ A;  2RT3 A;  4PQA A;  1UFW A;  3UDC A;  2VIH A;  1S1V A;  1U0S A;  3IGV A;  2G2Y A;  1IBC B;  4J7C A;  5DS7 A;  3GFX A;  1J2V A;  3SSS A;  2FTR A;  1SJQ A;  2RF2 A;  3I5B A;  1F2H A;  2KL8 A;  1SC6 A;  3EXC X;  3A12 A;  1BQN A;  2V63 A;  1RTD A;  3M8Q A;  2E9R X;  3ETO A;  3V2U C;  1S0V A;  3N4W A;  1W2B R;  2C22 A;  3UVJ A;  1I5O B;  4QR1 A;  2FJX A;  1SVD A;  2EI5 A;  3BDE A;  3V81 B;  4I0W A;  1S6P A;  3AD8 C;  2RU9 A;  2KJW A;  1V5V A;  3OD2 A;  2VJU A;  2WOM B;  4CO5 A;  2D1C A;  2IVM A;  2RRA A;  3NG8 A;  5DZ6 A;  1KP6 A;  2Q79 A;  3DN9 A;  2CNL B;  2ZH5 A;  1B3T A;  3PR4 A;  4Q0B A;  3GII A;  4KE5 A;  2OPQ A;  4RNN A;  4W90 B;  2FY1 A;  1OY8 A;  2MKI A;  1N33 J;  4YHH J;  3OFF A;  1S1T A;  1VK3 A;  3CW2 C;  2FJD B;  4DSI A;  3C16 A;  3P49 B;  4J9P A;  4MTP A;  2FHK A;  3BF4 A;  2XGQ A;  3J7Y I;  1NK8 A;  2LEA A;  3K8V A;  1C0T A;  5ADZ A;  3PVX A;  2OI2 A;  1WF2 A;  3G6X A;  1GX5 A;  1WEZ A;  3KLH B;  1EIY B;  2QFI A;  2W8L A;  3RB4 A;  4EBC A;  4JI4 J;  1RI7 A;  2MGZ A;  2E5L F;  2AYG A;  3MAQ A;  5DM6 Q;  2B56 A;  1R43 A;  5KT2 A;  3O5T B;  1P9Y A;  4JI8 F;  5E3Q A;  4B9L A;  4KV8 B;  1LWC B;  3G6E S;  1WOP A;  3GWC A;  3ZZZ A;  2HHW A;  4DG1 B;  5E3P A;  4EI2 A;  4B3M F;  2HWT A;  1O6X A;  4L73 A;  3EWG A;  1LQ9 A;  1NHU A;  3R7S B;  5DLG A;  1EJ7 L;  1K47 A;  3CDA A;  2JZ5 A;  1LKZ A;  5I4M A;  3P3D A;  3IR7 B;  5A8W B;  3GB0 A;  3WZ0 A;  2FZK B;  3ZZP A;  3QGH A;  3LOU A;  2V2Z A;  4F4K A;  1G6B A;  5B09 A;  4KAI A;  2R4F A;  3L3C A;  1RU1 A;  3PCO B;  1UA0 A;  4KB7 A;  4YEA A;  2RQC A;  3BYR A;  2EFN A;  2VG6 A;  4PUO A;  4I2P B;  4Y34 A;  3M8Y A;  4X65 F;  2M3D A;  1IQT A;  3VZH A;  2GS8 A;  3DU6 A;  2XYG B;  3LGN A;  4IYQ A;  4TY9 A;  4KHP J;  2W7P A;  3US5 A;  3MHY A;  2FZC B;  2P5V A;  3R97 A;  2ZD1 A;  2BE7 D;  3GYG A;  5HVF A;  2ZVS A;  4PWW A;  4FYY B;  3KK2 A;  4OLP A;  3B82 A;  4RR5 A;  1J5O A;  2JOQ A;  3IRW P;  2EK1 A;  2AX1 A;  3RUB L;  2CJA A;  1KR4 A;  4USI A;  3KK3 A;  1ZAV A;  2M2B A;  4LT6 A;  1FRK A;  4M5L A;  4KIA A;  5KFR A;  2V6A A;  5KFY A;  2WSF C;  4YS2 A;  4WTO B;  2MQO A;  4IQX A;  2C28 A;  4KGZ B;  2QEX S;  1RTI A;  1RAO A;  2A10 A;  3THP A;  4QQB A;  3T1H J;  1LXJ A;  4N77 A;  1HW8 A;  4AND A;  3VAK A;  1JLA A;  5HJY A;  1YDL A;  2V94 A;  3KNG A;  3WQP A;  4FNH A;  3LP2 B;  4EBD A;  2XLK A;  5H9E K;  4K4Y A;  3CED A;  6AT1 B;  2MQQ A;  1YJN S;  3VAL A;  1M0S A;  2RNE A;  1VBK A;  2KKH A;  1U7L A;  3LA0 A;  5JVG Q;  2MJU A;  2VB6 A;  2CNN B;  2C3O A;  4L3K A;  2CNK B;  2DGQ A;  2CJX B;  4ZVE A;  3U1M A;  1WNE A;  4ZIV A;  2Q43 A;  3MM6 A;  1E6Y A;  2DRD A;  2RS2 A;  3BR8 A;  3A4T A;  2WVF A;  2ZH1 A;  4H4K A;  3F44 A;  2E9T A;  2DNO A;  1Q5V A;  5FII A;  1SXL A;  2VU5 A;  3GU0 A;  2DVI A;  2QMW A;  2F65 A;  4USW A;  1H2U X;  4JYA J;  1A9N B;  5KG5 A;  3T19 A;  2VFS A;  1FFG B;  4Q45 A;  3W1Y C;  2FJW A;  1X4H A;  1YSJ A;  5AE1 A;  4JV2 A;  2OPR B;  3CJ3 A;  1QAJ A;  1HNW F;  2OMO A;  2KJV A;  2MDA A;  2G0I A;  2GW8 A;  1CQM A;  2XM3 A;  2RIL A;  4I68 A;  4NYZ A;  2ZZN A;  3W61 A;  1E6V B;  4ZJL A;  4WKY A;  4NRU A;  1S1V B;  1L3K A;  3MPU B;  5FDL A;  4C6A A;  2HVH A;  2E7W A;  4U7C A;  4U8Y A;  3BEG B;  4DQI A;  2N7Y A;  3DRY A;  2OSQ A;  4WP9 A;  4CLK A;  2RF2 B;  3CJK A;  2NPI A;  1H3D A;  3PIP Q;  2ZVI A;  3A3N B;  2HQI A;  2D69 A;  3SV3 A;  4IDK A;  2HPU A;  3QLH A;  3MM7 A;  4P74 A;  2W9A A;  5HBM A;  2C2K B;  1AA1 B;  1Z1Z A;  1RTD B;  1WC0 A;  3MTJ A;  1DLO A;  3M8Q B;  4ELU A;  1JLQ A;  1T9U A;  1HHS A;  4JV0 A;  2CAD A;  1FE0 A;  3QZ8 A;  2A2C A;  2HGN A;  4KH1 B;  3UVJ B;  1SKR A;  2H48 B;  2E7X A;  3ETM A;  5GAG U;  4AQY J;  5LT5 A;  1P9Q C;  1S10 A;  2LEC A;  5A0Y B;  4ZPC A;  5D0R A;  4DEZ A;  1S6P B;  4K0K J;  2FVS A;  1F1B B;  2EFG A;  3FCH A;  5G0R B;  1T05 B;  2QYC A;  3CWJ A;  1KBR A;  3QNW B;  4QJV A;  2HQ3 A;  3VTI A;  4CH1 A;  3Q89 A;  4RW7 A;  4UZC A;  5A8K B;  3FFI A;  3GZ7 A;  4JV5 J;  1SH2 A;  2OKQ A;  2UU9 J;  4Q0B B;  3VF0 B;  4KY3 A;  2DEI A;  2OPQ B;  3EMT A;  4ALZ A;  1G3O A;  4J9N A;  3RRK A;  4DV2 J;  1FWK A;  1S1T B;  3EDR B;  4F4X A;  1YBA A;  3NXZ A;  3CMQ A;  2D3O 1;  5KOX A;  1U09 A;  1FJ7 A;  3C16 B;  4ZN3 A;  2W4P A;  1TZ0 A;  4LRA A;  4X4V A;  2IC3 A;  4LVO P;  1SV5 A;  2XZD B;  4OYM A;  2RS8 A;  2F63 A;  1WJ9 A;  2DO4 A;  3M2U A;  1OIA A;  5K8M A;  2MGZ B;  4UT4 A;  4RNO A;  2DY9 A;  1H2T Z;  2DHH A;  3P6Y C;  1NUE A;  2Q3P A;  3VQT A;  4QU6 A;  1O8B A;  2MQP A;  4C0O C;  4CT9 A;  5KG7 A;  2BX6 A;  3LAK A;  2JNJ A;  4ZPT R;  5J1P A;  4RNF A;  4DR6 J;  4IRD A;  2DNR A;  1IJE B;  2ZHB A;  2LCW A;  4EO6 A;  5D78 A;  3QRQ A;  2R8J A;  1VJW A;  2HW3 A;  1HI8 A;  1X0F A;  2PSZ A;  1S4E A;  4DQS A;  1ELO A;  3G8T A;  4OV1 A;  2W9B B;  5K8N A;  2A6O A;  1XK8 A;  1NPR A;  3JQJ A;  1S4F A;  3Q8Q B;  4CO4 A;  3NLC A;  2F3J A;  2RUG A;  4GVB A;  3BRE A;  5HMX A;  1HBO A;  4ZVF A;  1UJ5 A;  3EGW B;  2M52 A;  3TJ8 A;  1T95 A;  3AHP A;  3KDO A;  5KFF A;  4B9N A;  3QJJ A;  4NX9 A;  3MFI A;  2YKM A;  5J1E A;  2D9P A;  4USV A;  2V2V A;  3TUZ C;  2ZD1 B;  4DV0 F;  4RW4 A;  1REG X;  5HQL A;  3EVM A;  1FWP A;  1NB2 A;  4IRK A;  2LXF A;  2IRX A;  4OZJ A;  1J5O B;  4GKJ F;  4ERD A;  3S6E A;  3OLA A;  5F8J A;  2PD1 A;  4KPC A;  3KK3 B;  3UDL A;  1URR A;  4RNH A;  4RU9 A;  1N4L A;  1HD1 A;  5KFC A;  4OJ1 A;  3BSN A;  3LO3 A;  2AKW B;  3CME S;  2XNQ A;  2GVZ A;  4X62 F;  4LF5 F;  1RAH B;  1VQL S;  2RQK A;  1WKL A;  3FBE A;  3H5U A;  2BVZ A;  4ECZ A;  3GSD A;  4K5S A;  4FF3 A;  2MMY A;  2HFU A;  3ONQ A;  2AF6 A;  1S1U A;  5M2R A;  3VAG A;  4LJM A;  2F5G A;  3O44 A;  3TA1 A;  5AXL A;  1KNZ A;  1YZ7 A;  1RBO B;  4OX9 J;  3M8Z A;  1WG4 A;  2ZBR A;  3NNC A;  1JLA B;  2FHO B;  2BOA A;  5HAT A;  5IT9 Y;  4QIW D;  4JBC A;  3P5B P;  3K57 A;  3TQ1 A;  1XMO F;  3DXS X;  4ZCK A;  3TVY A;  2JFD A;  2QTW A;  5EWG A;  3JSM A;  2HLU A;  3U02 A;  3T5K A;  2D3O R;  1MNE A;  7AT1 B;  4DR4 J;  4YHH F;  3BR9 A;  5CCM A;  3OTB A;  2CZ9 A;  4CLZ A;  3D5M A;  1OWX A;  5K5M A;  3WC2 A;  2B8P A;  1UZD A;  1IR2 A;  2QT7 A;  2R7V A;  3TX8 A;  2F8H A;  4C2M A;  3G86 A;  5L39 A;  2E1A A;  3IRX A;  1T9W A;  3GPA A;  2DH7 A;  4FPR A;  1DTQ B;  1YVF A;  3WIV A;  2JH3 A;  2FGO A;  4G1P A;  4WFA Q;  2QYG A;  4GKK J;  5GAE U;  2HFO A;  4FVC A;  1LK7 A;  4B3O A;  1H72 C;  4U95 A;  1J27 A;  4IOC Q;  3OR1 A;  4G65 A;  1B0V A;  2V50 A;  3GG1 A;  3CF5 Q;  4PKD B;  4PXE A;  2CG8 A;  2H4W B;  3CDW A;  1SL1 A;  2JEF A;  2VFV A;  5HSP A;  3ZZT A;  4DSF A;  3T9N A;  5IC6 B;  4F3O A;  5L1K A;  5HJX A;  4DR2 F;  4ZP9 A;  4JI7 F;  2H3E B;  3LAL A;  5CAB A;  5FDL B;  2QA4 G;  4ETX A;  4JI2 J;  4C4W A;  4CP5 A;  4XDD A;  1IWG A;  2DNG A;  3DOK A;  2KXH A;  3HCX A;  4ZOS A;  4H4K C;  1CJV A;  4USJ C;  1ZM9 A;  3CJK B;  2ZUG A;  1ROF A;  3OXF A;  2R8H A;  1AW0 A;  3M2R A;  4FKX A;  3QLH B;  3EPG A;  4F3Q A;  3MM7 B;  3MEG A;  1AFI A;  2W2O P;  3A3P B;  3T6B A;  5HBM B;  1X4G A;  4DFJ A;  2XZT B;  1U1M A;  1IR0 A;  3MEK A;  1HNV A;  3ET6 A;  2H5E A;  2H5I B;  1F5C A;  5LJ3 Y;  1U1K A;  4Y65 A;  1BXN A;  1JLQ B;  2WON B;  4PPD A;  1U6B A;  3W9H A;  4KHP F;  2P9E A;  3Q22 A;  3SQG A;  2YBV A;  1T02 A;  4QIV A;  4DR3 F;  1Q81 T;  5F8L A;  3OSP A;  5K20 B;  3D66 A;  3L7U A;  3PG9 A;  1RLC L;  3HVW A;  3DYA A;  1FHT A;  2WHO A;  4N8N A;  2CQ0 A;  3IN5 A;  5GAH I;  2A1B A;  3SV4 A;  2DB1 A;  3KLE A;  3HVT A;  1N36 J;  3IBC B;  4X66 F;  4M63 A;  4RW7 B;  4Y2K A;  3I96 A;  3QIP A;  2XS5 A;  3BBB A;  2C2N A;  4JI6 F;  4BLG A;  4X4P A;  2JSX A;  5ETR A;  2V8D A;  5E3C A;  3KMQ A;  1FF2 A;  4C8K A;  1FXD A;  1JX4 A;  3TAQ A;  4NL5 A;  1RWN B;  1WSV A;  4DPX A;  3AB2 B;  4C8Y A;  3NP5 A;  1XMQ J;  4X64 J;  3QFW A;  4DUY J;  3JTP A;  3H8Y A;  3WBZ A;  2IC3 B;  4F26 A;  4OYW A;  1BMQ B;  1SV5 B;  2XLJ A;  4ZDN A;  1U1P A;  2YTC A;  4HT7 A;  2OTJ S;  1SPB P;  5J2N A;  3CCS S;  3M2U B;  2FY8 A;  1GX6 A;  4RWX A;  2CQ3 A;  3FMB A;  3ZTR A;  3SIP B;  1F3V A;  3MED A;  2OP5 A;  1T3N A;  1PIL A;  3LQV A;  2Z2Y B;  5I3Q A;  2AP6 A;  2F4F A;  1U0H A;  1M5H A;  2QIF A;  4WJB A;  2DNQ A;  2ZEJ A;  2AZ3 A;  3WX4 A;  3E8O A;  1OQ3 A;  3H2U B;  1ZYQ A;  4DS5 A;  2ZDP A;  2EC2 A;  3NBP A;  4X4U A;  1FDA A;  1OQ6 A;  1QUP A;  2YNI A;  1KFS A;  4ECS A;  4R8U A;  1WF1 A;  3VWS A;  4NLP A;  4U7U K;  3N5B A;  3RYL A;  1GQE A;  4EEY A;  1TKT B;  2AGQ A;  3KK1 A;  2A2D A;  4FXV A;  4BWJ A;  4K7Q A;  4JYA F;  3BKF A;  2EBG A;  3RRG A;  3OL7 A;  2QA2 A;  4FP9 A;  4DL4 A;  2LU2 A;  4YDX A;  4ECQ A;  1HWI A;  3BQ0 A;  2HG4 A;  3HHD A;  4DV4 J;  1SQG A;  4O44 A;  3K8W A;  3TVZ A;  3M32 A;  1R8A A;  1SL0 A;  3M6U A;  2XUL A;  2IYG A;  1R31 A;  4V19 J;  3K5P A;  2M8D B;  1GXU A;  4LR7 A;  3D28 A;  1LK5 A;  2JDJ A;  4DQR A;  4DFM A;  2YKM B;  3R5D A;  5J1E B;  3W65 A;  1SKU B;  1FRL A;  1KSP A;  3N0V A;  2HHS A;  4X84 A;  1VQ9 S;  3QAT A;  3CDU A;  3PYE A;  4KHR A;  4RW4 B;  5CQG A;  3ZFV A;  4W98 A;  4P7V A;  1GXT A;  1S57 A;  2UXC J;  4B3T J;  4PG8 A;  2JHE A;  3KG4 A;  4HT5 A;  3OR2 A;  3PYD A;  4KQZ A;  4NYO A;  4Q7A A;  2MKH A;  1VFJ A;  2OJ3 A;  2C2M B;  1Q5Y A;  2EFO A;  4QIF A;  1N34 J;  4M5H A;  1YGY A;  3PHT A;  4QW8 A;  3PEJ A;  1JNZ B;  2R7O A;  5F8M A;  2ZC4 A;  3IMQ J;  4QIE A;  2I0X A;  2BV3 A;  1PO6 A;  1G2E A;  3FDS A;  2B9W A;  3OPK A;  5DDP C;  2Z58 B;  5KT4 A;  2N82 B;  1S1U B;  1TMM A;  2KFN A;  2UXB F;  3MCM A;  1QVG R;  1HBU B;  4OQJ A;  4LBI A;  4I7F A;  4S0M A;  2CQ4 A;  1XQI A;  2UXD F;  1U25 A;  3V6J A;  2L48 A;  3GJT B;  1Q78 A;  4ID8 A;  5E0O A;  4B9T A;  2V9W A;  4NZ6 A;  3HKW A;  4YUD A;  1S6Q A;  4JV5 F;  4PWD B;  3JQK A;  2V68 A;  3JSM B;  3VVU A;  1BWV A;  1YRT A;  3CC2 S;  2ZM6 J;  4DX8 H;  1EP4 A;  1HWL A;  2AU0 A;  1O0P A;  3JTO A;  1EAY C;  1OS5 A;  2GVD A;  2CPY A;  3QRR A;  2QA4 S;  2AEF A;  4TVA B;  1CSJ A;  4NPO A;  4PYA A;  1WC6 A;  3I5A A;  4OYA A;  4DFK A;  3ENQ A;  4XIU A;  1EZZ B;  2QC3 A;  1KS2 A;  2HHV A;  3GJS B;  2C2E A;  2OEM A;  2KG1 A;  5MAO A;  2XC9 A;  3M6W A;  1TVR A;  3CDE A;  4TU9 A;  1HYS A;  4M5I A;  2LQJ A;  5IM0 A;  5HLF A;  4OI2 A;  2LDY A;  3SBM A;  4CO0 A;  5KG0 A;  3A3O B;  5DM7 Q;  1T11 A;  1M1K T;  4LF7 F;  2OHD A;  1Q4R A;  1FWL A;  3CJ0 A;  1FK9 B;  1IN0 A;  4WTY A;  2YKQ A;  3PNI A;  1RWK B;  3EIC A;  3HHL A;  4CNZ A;  4G6V B;  3BSA A;  4A8Q A;  3G6Y A;  1RT5 A;  3CJQ A;  5T7L A;  2NXC A;  4LF4 J;  4U96 A;  3F73 A;  1TL3 A;  2JX2 A;  4QIG A;  2YWE A;  1QSS A;  2PI4 A;  3DLK A;  1ZS6 A;  1NBE B;  5HP1 A;  3M2R B;  5HL7 Q;  2Z8Q A;  2ZH6 A;  3MEG B;  1U45 A;  3AJ2 A;  3FEY B;  5D6G A;  4LBP A;  4WFX A;  4M5K A;  5IQ6 A;  1HNV B;  3DXB A;  3ET6 B;  2ZWO A;  2DGS A;  3SXL A;  2CPH A;  3EJM A;  2HYI B;  3RJM B;  2ZH7 A;  4CZC A;  1HR0 F;  2F4V J;  3JTN A;  2J6T A;  1VBZ A;  4RZR A;  4DX7 A;  4JI5 J;  4L76 A;  4B02 A;  2DGV A;  2CPD A;  1PBU A;  4WE1 B;  1XWL A;  2ZBC A;  1UEK A;  5IWA F;  2MXY A;  3DYA B;  3D9B A;  2CQ2 A;  1KQG B;  4EYI B;  4HYK A;  4P52 A;  3HVT B;  1QE1 A;  4F0K A;  2WBR A;  5C24 A;  2XYP B;  2RRB A;  2DIU A;  3HKZ D;  4Q5V A;  3QIP B;  1EKR A;  5HMY A;  1SKS A;  3ILI A;  2UVR A;  3T5H A;  1RBL A;  4MH8 A;  1UEV A;  4F04 B;  4WFN Q;  2ASJ A;  1ZPW X;  2BJ8 A;  2JLG A;  3NCR A;  4MMO A;  4XPE A;  2X1G A;  4CWB A;  3T9Z A;  5L1L A;  1NO8 A;  1RHJ B;  3U1L A;  3PYG A;  5J2N B;  2YPZ A;  4J90 A;  3H5X A;  4C9D A;  2V4Q A;  3MED B;  4FF2 A;  3CJS A;  2IJR A;  4X4S A;  2J8A A;  1PAU B;  4TY8 A;  4ZP6 A;  5IQQ A;  1VQ7 S;  5KFW A;  3W2W A;  4LRF A;  3V4I A;  4DR4 F;  2UZA A;  2G9O A;  4OJH A;  1SIW B;  3G87 A;  2D41 A;  1NKE A;  1ITP A;  3KMS A;  5A76 A;  1Z2L A;  3ITH A;  4UW2 A;  2PC6 A;  3CCL S;  4WYW A;  2V4J B;  3UNY A;  1N48 A;  1APS A;  2I6W A;  3KXD A;  2NYH A;  4GVL A;  2CQB A;  4OI6 A;  2G2O A;  5J2M A;  3EDQ B;  1MU2 B;  2VH7 A;  3ISN D;  3OJS A;  4J9S A;  4GKK F;  3LH2 S;  1C2P A;  3PW0 A;  2MZ1 A;  1RTZ A;  4X4R A;  2HWI A;  5GMD A;  4KRW A;  1RT3 B;  4W92 B;  1RJJ A;  1S9E A;  5KT3 A;  4O44 B;  7FDR A;  4DUZ F;  4AL6 A;  3M32 B;  4UOC A;  1RLD A;  2DXD A;  2BMB A;  4C8Z A;  1IVZ A;  3SQO P;  2UUB J;  2H51 B;  2Q6B A;  2WVB A;  5B0F A;  1FNM A;  1G7C B;  4NLG A;  1NHK L;  4F4Z A;  1RAD B;  5IOL A;  2IRY A;  4RUH A;  1RHK B;  3QRP A;  2DPJ A;  4ZJO A;  3OR2 B;  1HBN A;  2KRB A;  2GGP B;  1UJ6 A;  3NNH A;  1MLA A;  5CYJ A;  2XMU A;  5G4D A;  2DIS A;  1S1X A;  1Y4Z B;  5EDW A;  1GK8 A;  3U27 A;  5T14 A;  5KFD A;  3I0R B;  2QA1 A;  1JJH A;  2J9D E;  1NKB A;  1M5S A;  2QLX A;  4DV5 J;  4URS A;  2Q66 A;  2ILY A;  3PX6 A;  1QVF R;  1R6Y A;  3M8R A;  5ETS A;  4I7F B;  4RW6 A;  4P2S A;  3DM2 B;  2MY7 A;  5SUH A;  2HNZ A;  2YX7 A;  4FNI A;  4G1Q A;  1RT4 A;  1U6Z A;  4RU2 A;  2YWF A;  1AUD A;  1RIS A;  5I42 B;  1VIS A;  4Z7C A;  4ECT A;  4NI2 A;  1RYR A;  5HAN A;  4IQM A;  4X4N A;  1TFY A;  3PAC A;  3BN7 A;  4WZM A;  4OZ1 A;  4IR9 A;  1HWU A;  2CPE A;  2GVD B;  2WRM A;  4OZL A;  3AQP A;  4Q44 A;  1C4C A;  1HQE A;  4O3O A;  1ZZN A;  3MPW A;  4A8X A;  3LTO A;  1PC5 A;  4CH0 S;  4YP3 A;  2LVW A;  2Z56 B;  1H2V Z;  3HSJ A;  1ZTT A;  4RUB A;  3FGV A;  1FKO A;  4HHU A;  1HYS B;  4KHM A;  1JIH A;  2XTJ P;  2CAJ A;  3E01 B;  1S77 D;  2CJQ A;  2CQP A;  5IM0 B;  2PDA A;  5C2C A;  2M9K A;  1S12 A;  5B0G A;  4LF9 J;  3PX4 A;  3R6L B;  2KT2 A;  2P6S A;  2IDE A;  2X1A A;  2CVE A;  2V8P A;  4QOT A;  1IQZ A;  2XBP A;  1UVJ A;  2VD3 A;  5AJ3 J;  2R7R A;  5KFS A;  4Y6I A;  2QLW A;  2W4C A;  3C2P A;  1VC5 A;  4ZVG A;  1N88 A;  5T7L B;  1TL5 A;  1H73 A;  1TL3 B;  3BO3 A;  2AGO A;  4TKT A;  2XMW A;  1L5U A;  2AQ4 A;  4ZVQ B;  1Q8I A;  4OYZ A;  5CYQ A;  5HP1 B;  3QPI A;  3FVY A;  4TQR A;  3MF5 A;  1R0A A;  4DV4 F;  2HHP A;  2CDR B;  2UUT A;  4OYX A;  1UL3 A;  4FBU A;  2MYF A;  3CXC R;  3FQK A;  2DRB A;  1X5P A;  3W62 A;  5CHC B;  1WC5 A;  4OHW A;  3QGP A;  2CPI A;  3PRV A;  3ELH A;  2CQC A;  2YQ3 A;  4DMZ A;  3BGU A;  4P2F A;  3HHL C;  4A47 A;  3T5J A;  1ZH5 A;  2ZZM A;  1P1L A;  4A8S A;  3ZZO A;  3LWM A;  3NCQ A;  1NK0 A;  1XIQ A;  2PFF B;  4B3T F;  2OLW A;  1AZS A;  3NCP A;  4WYL A;  3ULH A;  3U1N A;  3MPY A;  1QE1 B;  4U6P A;  1TV6 A;  3R3T A;  8AT1 B;  1N34 F;  1HNZ F;  5CA5 A;  5C24 B;  3BKU A;  1CBK A;  2XB2 D;  2HBQ B;  5ITH A;  3PJ9 A;  1JMT A;  1RAI B;  4FYW B;  4WII A;  1OSD A;  3BS9 A;  2ABY A;  1RB0 A;  3ENW A;  5B0A A;  3GP9 A;  5IT4 A;  4ZA1 A;  1T03 B;  1I94 J;  3CC4 S;  3OFG A;  2HND A;  4CM0 A;  3AOB A;  5GME A;  2HVE A;  2B6A A;  2WAQ D;  4B17 A;  5SZT A;  2LEP A;  1Q8K A;  2OD4 A;  1WC1 A;  3BO2 A;  3S1T A;  4TY8 B;  1Q95 G;  5DET A;  3GIR A;  1M5K C;  4ZLN A;  1VYA A;  2ZHO A;  3W2W B;  3O2I A;  1HI0 P;  4CQ1 A;  1HW9 A;  2RAQ A;  1R8C A;  1JJC B;  4I6Y A;  2DR8 A;  4UST A;  4YR0 A;  3RBE A;  3HPO A;  2GC8 A;  4WZQ A;  5C5J A;  1REV A;  1U1O A;  4EBE A;  1K1Q A;  2DIV A;  4H4O A;  4OZ2 A;  4J9U E;  2LMI A;  1T9V A;  1UKU A;  5BR8 J;  4CYU A;  1S59 A;  3FSX A;  2EFV A;  4J9Q A;  5J2M B;  1IKX A;  1FRH A;  2ADB A;  1MN9 A;  2N7C A;  4IH5 A;  1LWX A;  4FYD A;  4ED4 A;  1U8S A;  1X4E A;  2OO4 A;  2H1Y A;  5KFO A;  3CT9 A;  2FB0 A;  2KXF A;  4N8O A;  3QJL A;  1S9E B;  4AXI A;  2FHM A;  5DG8 A;  4CO2 A;  3D6M B;  4IO9 Q;  3FEZ A;  1HWK A;  3M2V A;  3Q8U A;  2XZW A;  4ZLL A;  2VJV A;  2B9X A;  3DKD A;  3MR6 A;  3BO4 A;  5KFI A;  4NLU A;  4WWS A;  4LQ3 A;  5KFZ A;  4NWB A;  3MGJ A;  2R8I A;  3QT5 A;  3C6U A;  4LF6 J;  3MZI A;  1IBL J;  3J80 Y;  5GAG I;  3SMZ A;  2FLP A;  4PXD A;  4EO8 A;  1HBN B;  4Y2M A;  2KI2 A;  4Z7Y A;  2DO0 A;  2BAN A;  2YNH A;  1LWF A;  2YNG A;  5EX0 A;  1S79 A;  1PIE A;  1S1X B;  4X4T A;  4YB1 P;  3ZXW A;  4V19 X;  4M5N A;  2ZJR Q;  2DNZ A;  2AYE A;  8RUC A;  1HL6 A;  3PW5 A;  2K2P A;  3LF0 A;  1W26 A;  1YJT A;  3I31 A;  3NS7 B;  4HH0 A;  3MUM P;  3AOD A;  4FF1 A;  3DOM A;  1MMN A;  2J7U A;  1P6T A;  3FBF A;  2CZV C;  1F9H A;  3Q8V A;  2DHG A;  4RW6 B;  2EKN A;  1ZTW A;  1RAE B;  3B4D A;  1QTN B;  2A3J A;  2UUC J;  2J0W A;  4DOZ A;  3W5Y A;  5C42 A;  3K5L A;  3RAM A;  4KR0 B;  1XMB A;  5KFQ A;  1RT4 B;  2RSQ A;  3SCK E;  4NAS A;  2HMI A;  3T6J A;  1HBM B;  3R1H A;  3FC9 A;  5B0B A;  1ZAX A;  1AYE A;  4NI2 B;  4ED6 A;  5IZH A;  2MZQ A;  2POK A;  2PT0 A;  2V0N A;  4Q43 A;  4DL7 A;  3A1Y G;  4UOF A;  4HAC B;  2VDH A;  1FFW B;  4DSK A;  1HWJ A;  3L4B C;  1TFW A;  5KFK A;  3VAI A;  1UW9 A;  1GMU A;  2HWH A;  4ZVO B;  1PC4 A;  1WC3 A;  1CUL A;  3T3F A;  4BHQ A;  3BGF A;  3RBD A;  1G4C A;  2PEB A;  1U1R A;  5CYM A;  3BPS P;  3CD0 A;  1ZET A;  2VDI A;  2W9C A;  4ZVU B;  3LW5 C;  3MCO A;  2HFV A;  2G0J A;  3UCZ P;  3UWT A;  4DI6 A;  1WKJ A;  4TU8 A;  2O01 C;  2BJ3 A;  2Z57 B;  3ISZ A;  1U4B A;  2Y1J A;  3DU5 A;  1WHW A;  3GON A;  3OBI A;  2XSF A;  2HBY B;  4DLE A;  3OFH A;  2YKN A;  3W9J A;  3D1H A;  2O1P A;  3MEC B;  3UPF A;  4ECV A;  3DGV A;  3NY0 A;  4JI0 F;  4LFA F;  3NOG A;  5C25 A;  2L9D A;  3F41 A;  4P73 A;  5DG9 A;  1GNK A;  9ATC B;  5KFE A;  1KDN A;  2R9L A;  3R7B B;  1CS4 B;  1MMD A;  1FI4 A;  1F5B A;  1VQ5 S;  4BC7 A;  1FXL A;  1FT8 A;  2ZWP A;  4BWM A;  2ZOG A;  1ARO P;  3IA0 A;  1R0A B;  2XY6 A;  3BSC A;  2JVO A;  1MSW D;  1FNO A;  3M30 A;  3P45 B;  1VQO S;  3MCN A;  2B4U A;  5AE3 A;  5GVQ A;  2O3D A;  2DXE A;  4FPI A;  2UUB F;  3MUT P;  3MR5 A;  2DD8 S;  2BE2 A;  1Q1K A;  5HMW A;  2VKR A;  4CH7 A;  3J7A 1;  3TZY A;  2MEW A;  3IBW A;  4CLT A;  4IH7 A;  2KU7 A;  1XEZ A;  3SEO A;  4KGK A;  1AZS B;  3FUY A;  3KG1 A;  1YG0 A;  3QID A;  5HI7 A;  2R7S A;  1Q82 T;  1TV6 B;  2R7X A;  3F56 A;  2JC0 A;  3KLF B;  4FXD A;  5KG3 A;  3ILJ A;  2Y0S D;  2VA3 A;  1BGX T;  2XI3 A;  4ECX A;  2DHS A;  2LYV A;  1L3T A;  2GX8 A;  2R7U A;  3D0H E;  3DI6 B;  1VRT A;  2VQF F;  2RH3 A;  3R5J B;  2JLF A;  1D3W A;  2F1F A;  2LEB A;  3OVB A;  2E29 A;  3DLL Q;  1L3S A;  4V1A k;  3NEK A;  3J81 Y;  2HND B;  3N6M A;  3K0J A;  5U47 A;  3TVK A;  1YK9 A;  2M88 A;  2B6A B;  3KUG A;  2CPF A;  1VDH A;  4DWI A;  3TQE A;  4LF2 A;  4PYD A;  3C6T A;  1V3S A;  2QMX A;  3BKT A;  1FJE B;  4DL2 A;  3PFE A;  4I2Q A;  1N5V A;  1C0U A;  1NDP A;  3OFE A;  3Q8R B;  4A8O A;  4RNM A;  1RE1 B;  3M1V B;  2ZH9 A;  4C11 A;  5GAE I;  4BDP A;  1NPK A;  2ZKT A;  4B3R J;  2X3D A;  1FD8 A;  2RB7 A;  1SJ4 P;  4DL3 A;  2K7K A;  2FLO A;  3VR1 A;  2LU1 A;  1PG5 B;  3WX8 A;  1PYS B;  2VBW A;  5I3U A;  3DDK A;  2ASL A;  3RBZ A;  3OHB A;  4ANC A;  2C2O B;  3OTO F;  3ZZY A;  4YME A;  4O3N A;  4LSL B;  4K4W A;  4KFB A;  4I4B A;  1ZM3 A;  3RZA A;  1IKX B;  3IG1 B;  4E98 A;  5D4N A;  2NRE A;  2I5J A;  4ED8 A;  4LF9 F;  2FVC A;  4A8M P;  4QYZ J;  4A48 A;  3PTW A;  1JXV A;  3R5C A;  2WW4 A;  3G96 A;  1HHT P;  2ZJP Q;  5L8R C;  1TEL A;  2I2Y A;  2B5J A;  3HDS A;  3OSN A;  4RPF A;  1WI8 A;  5MLC V;  4Y0F A;  4OHY A;  5FJ4 A;  3MM8 B;  3M2V B;  4OYP A;  1XNR J;  5AJ3 F;  4B9U A;  2EG1 A;  2KXN B;  4LMZ A;  1MWQ A;  5D0G A;  2HS0 A;  2RU3 A;  2QLF B;  1UCN A;  4ZMM A;  2YX1 A;  2HFZ A;  3G82 B;  1JK9 B;  3CVK A;  2DPI A;  4PG4 A;  3MR2 A;  2VOP A;  2J9C A;  1VOM A;  3IS9 A;  2NCK L;  3MD3 A;  1FJG F;  5AE2 A;  2BAN B;  1K0V A;  2YNH B;  1LWF B;  2YNG B;  5E2Q A;  2B51 A;  3QSI A;  2Q1L A;  4O0I A;  2MKY A;  2MJN A;  3R2C J;  4MYU A;  2ILZ A;  5T41 A;  5IFM A;  3MM9 A;  1S1W A;  2NLW A;  4ZS6 A;  1W2I A;  2EXU A;  2DK2 A;  3KHR A;  1NDK A;  3HX9 A;  2LQ8 A;  4K8R A;  1RT6 A;  3TAM B;  1SJ1 A;  1K8A T;  4NCG A;  3LPE A;  4MIW A;  2CA9 A;  3PZP A;  2NSC A;  4JI3 F;  2KFZ A;  5B0D A;  2DNY A;  3DLJ A;  1XR7 A;  4L75 A;  2R42 A;  1JQG A;  2K8G A;  2QL9 B;  3FCW A;  3VZI A;  1PJ5 A;  2CPZ A;  2HMI B;  4LF8 F;  3C14 A;  1SUQ A;  1S97 A;  5F3T A;  1RKI A;  3GCW P;  1KKH A;  3W5X A;  3DC2 A;  1S5Z A;  1W7W A;  3PXG a;  1RK8 A;  2BJ1 A;  1NHV A;  2MB0 B;  4KT0 C;  5F41 A;  4LRE A;  4LIW A;  2APO A;  3ZZR A;  2PA3 A;  2VG7 B;  2VFT A;  1TMJ A;  2P6T A;  4RW8 A;  4HDG A;  3CCT A;  3H2L A;  1LW0 A;  1BQX A;  2VIC A;  2KFY A;  4IR1 A;  1VC6 A;  3N01 A;  2V8G A;  1U49 A;  4ZPB A;  2VBZ A;  2OPS A;  4UUX A;  1WG1 A;  2BM1 A;  3RGI A;  5LMN J;  1NK7 A;  2LKZ A;  1TK8 A;  1QUV A;  2QLB B;  1AXQ A;  5CYM B;  3DRP A;  2W9C B;  1DUR A;  4IH6 A;  4IKA A;  3BBC A;  5EWF A;  1TAQ A;  3N6L A;  2FDN A;  5L9X A;  3AAW B;  3ZTS A;  2YKN B;  4NCA A;  1OPI A;  1AT1 B;  2AJF E;  1JXL A;  2M0G B;  1R8P A;  2AJ4 A;  2K1R B;  5LSR A;  1PKU A;  2VOO A;  2CQH A;  1FEE A;  1S9G A;  3E3X A;  1NK9 A;  1XNQ J;  5C25 B;  4IO1 A;  2PO4 A;  3OT9 A;  4MFB A;  4FBT A;  3CE8 A;  1GAO A;  3FRY A;  3KJF B;  3IAM 9;  5JMN A;  1T0T V;  4NA3 A;  4DV1 F;  1XTZ A;  2VQE J;  4LFB J;  1LWE B;  5D8H B;  3PJW A;  2OTL S;  1IKV A;  3ZC4 A;  4AFF A;  2X1B A;  5HQ8 A;  1X4B A;  5F8H A;  4UOG A;  4C8M A;  2BBE A;  4J9V A;  3GSI A;  3CPW R;  3OUY A;  2NZC A;  1DQ9 A;  2BE2 B;  5ETK A;  1Z4U A;  2GZO A;  2BR0 A;  2FD2 A;  4W4M A;  1M90 T;  5IS2 A;  3HK2 A;  2QG9 B;  1RT7 A;  5KAK A;  2GIR A;  1HNX J;  4PG6 A;  5A8R B;  5IT0 A;  2AJ1 A;  3HVA A;  2UUA J;  1WSR A;  2PGC A;  3X3U A;  5LMU F;  5FLX U;  4YN3 B;  4TLQ A;  3HSZ A;  4E2F B;  2OAU A;  3IWN C;  2BKO A;  3AOC A;  1WHX A;  3TI0 A;  3HMJ G;  1VRT B;  2ASY A;  3SSQ A;  1R3N A;  1TU0 B;  3MMB A;  1B4S A;  4ENO A;  1IR1 A;  4ZPW R;  2E9Z A;  1D9D A;  4IFV B;  1SIZ A;  3E2E A;  3SCJ E;  4ZKA A;  1KON A;  5I3P A;  5DLF A;  2PMH A;  5ETT A;  4LR8 A;  2MTL A;  3KLG A;  1KQK A;  2BOP A;  1Y11 A;  2ZH8 A;  2YY3 A;  1S7I A;  4DV6 J;  5B0E A;  3SZ2 A;  4X2B A;  1SBR A;  1TKZ A;  1C0U B;  2YXL A;  2RDJ A;  5C2G A;  1N32 F;  4TYB A;  1FRJ A;  1RP5 A;  3OLB A;  2B3T B;  4C11 B;  1JLC A;  1PAE X;  2HGM A;  4QWB A;  1S6O A;  5F0U A;  3H0P A;  3TWZ A;  1F3F A;  2V9K A;  2QSW A;  3HHE A;  2E5J A;  1K1S A;  3BYP A;  2E1P A;  4NRT A;  1B7F A;  4I56 A;  3KLI B;  2YKA A;  3V4M A;  3SYZ A;  4MT1 A;  1YLX A;  2ZDO A;  4DU7 A;  4ZP7 A;  1CJT A;  3HD1 A;  4KFB B;  5DDO C;  2RQM A;  4HTJ A;  2IAJ A;  4URQ U;  2I5J B;  2FYX A;  3D2W A;  2EWH A;  3GR1 A;  1TL4 A;  2AWZ A;  4Z2X A;  4J37 A;  2ALZ A;  3TUI C;  2K3K A;  2B5J B;  4DHV A;  6FDR A;  4F25 A;  1VIO A;  2EKY A;  4CLP A;  3A8E A;  2NUU G;  3C19 A;  4QCL A;  4CM2 A;  3GJR B;  3UR3 C;  4ITS A;  3GE9 A;  3DGP B;  4QBU A;  5BYS A;  1RWM B;  2HRT A;  4UUW A;  2CDQ A;  3UD4 P;  3G8S A;  4CLF A;  3NGS A;  2C1E B;  3ICL A;  3TP2 A;  1YTY A;  3W66 A;  1VQP S;  3VCD A;  3IS9 B;  1TTH B;  1YJU A;  3PJX A;  4O4G B;  4O3S A;  4P2M A;  5ETO A;  2L08 A;  5L38 A;  3MMA A;  2E5G A;  1KD1 T;  4KYZ A;  5CAA A;  4N47 A;  4ELT A;  2CQ1 A;  3MM9 B;  5KFU A;  4C8N A;  2RKI A;  2A0F B;  5JUM A;  4KGM A;  3HXM A;  3CD5 A;  5CH7 B;  4IG0 A;  1WAC A;  1Y0H A;  4PWU A;  2V4R A;  4NCG B;  2DEJ A;  3FZB A;  3K17 A;  4L6V 3;  1NJX A;  2E5L J;  5ETN A;  4IFY A;  4C48 A;  3NMR A;  2DR7 A;  4JI8 J;  4CI0 B;  2I38 A;  2LXU A;  1BQN B;  2K3I A;  3CTR A;  2KT3 A;  1WKK A;  2B7C B;  3C14 B;  4DPT A;  1VQ6 S;  3UD5 A;  1SH3 A;  4G3I A;  4C8O A;  4KH0 B;  1WDD A;  1X4F A;  4DV7 F;  1S0M A;  3IGN A;  4ILR A;  1RAB B;  2NPF A;  4P7T A;  3DHX A;  5D0H A;  2HK2 A;  3S8S A;  4HEA 9;  5KFG A;  4RW8 B;  2HGL A;  5L1J A;  1LW0 B;  1D09 B;  3EVW A;  3OV7 A;  4B3S J;  3AA9 A;  2XHC A;  3IR6 B;  2VBY A;  3FZ2 A;  3CCJ S;  3P5T L;  2E1C A;  3QSY B;  2HQC A;  3C3L A;  3HSD A;  3D67 A;  5J2Q A;  2OPS B;  3LP0 A;  2QN6 B;  4U8V A;  2ZH3 A;  3DLE A;  1LNQ A;  2D3Z A;  3GTY X;  3DLG A;  3WHI A;  2GO9 A;  2UV8 A;  3I32 A;  3CJR A;  3DRX A;  1FER A;  2HS4 A;  3U7J A;  2HZC A;  4EZ6 A;  1MN7 A;  4F0H A;  1YQH A;  2IBO A;  1EHW A;  1VI7 A;  1DY3 A;  1U2F A;  3AXM A;  1A7G E;  1V3Z A;  1P27 B;  1Y10 A;  4QYZ K;  1LXN A;  2MKJ A;  1C0T B;  4RBV A;  2WB4 A;  1RWX B;  1X5S A;  3CCW A;  4P2X A;  1S9G B;  1IBM F;  2G2Z A;  2GHP A;  1G1X A;  2BRL A;  2J0X A;  4MFB B;  2QV6 A;  1UAW A;  2D9O A;  4D3G A;  3D0G E;  2AYB A;  4Q2M A;  3HHK A;  2OFG X;  2JC1 A;  3K5N A;  2XMJ A;  3CCR S;  5D4O A;  1VGY A;  1ZOT A;  3PRD A;  2ZNZ A;  4DZD A;  3DNC A;  1FEH A;  3V81 A;  2OML A;  2EFP A;  4FYV B;  1IKV B;  3KKF A;  4OI4 A;  3CO9 A;  2GJ2 A;  4EMD A;  2WOM A;  2CXE A;  3HJV A;  1XNR F;  4NLR A;  3OL6 A;  3E51 A;  1R0B G;  1SCJ B;  1NJZ A;  1RWO B;  3CCM S;  5DRK A;  5KT7 A;  2XYH B;  4LVN P;  4MK9 A;  1O51 A;  3AXK A;  3W7B A;  1KVK A;  3GMG A;  3CDB A;  3TOQ A;  1YJR A;  5ETL A;  1RHQ B;  1CVJ A;  2HLT A;  3TW0 A;  5HVH A;  1GTE A;  2BRK A;  3JAM U;  1N0V C;  3TO8 A;  2ZZT A;  3BGR A;  2VG6 B;  2UP1 A;  4ICL A;  4PUO B;  2K7J A;  1VLY A;  1Q86 T;  4PG5 A;  1LFP A;  3QYY A;  4QWA A;  4YY3 F;  5HQM A;  2VOD A;  3AD7 C;  3QQC D;  1KLN A;  5DQI A;  5DG7 A;  3BM7 A;  1RGV A;  3VGT A;  5GAD U;  2VL1 A;  2AT1 B;  2RD5 C;  5CZV A;  3KK2 B;  2ERR A;  1K44 A;  1MML A;  3UN3 A;  1I51 B;  2RDI A;  3ZZ0 A;  3GYX B;  3Q23 A;  2N4D A;  3KDN A;  1DRZ A;  4FKY A;  4KV8 A;  4H4M A;  2RQ4 A;  3KYL A;  4HDH A;  1AFJ A;  2DR5 A;  1RT2 A;  1NSQ A;  3H7H B;  1RAF B;  1GT8 A;  3RW7 A;  4DBQ A;  2M70 A;  5KFH A;  2VUG A;  4DV3 J;  2KHC A;  4N41 A;  4OZ5 A;  1FJC A;  1JLF A;  5A8W A;  1JLC B;  1RTI B;  2J0S D;  4R25 A;  4J9O A;  9RUB A;  1X60 A;  1T8E A;  3SI8 A;  1H7X A;  2HBZ B;  2GCF A;  1ZPV A;  1YBT A;  2XCP A;  4KPY A;  3KJV A;  2ZC3 A;  2FUG 9;  2FC8 A;  5LMN F;  1CJT B;  4I2P A;  4ES3 A;  3L09 A;  1XC9 A;  1VMB A;  4OMF G;  2IAJ B;  2W7O A;  2O67 A;  2LQB A;  4ECW A;  4ZLP A;  2NYI A;  1N33 F;  4CTA A;  3BGO P;  3MI7 X;  1N5Y A;  3MM6 B;  1E6Y B;  3I55 S;  3W8G A;  1VQ8 S;  2J5A A;  2VF3 A;  1U02 A;  1UJ4 A;  5AXK A;  3RB0 A;  5E33 A;  3B78 A;  3L7O A;  3J80 U;  2CKW A;  3MAA A;  1QLN A;  2HUR A;  1IKY A;  2KM8 C;  4OHV A;  4JI4 F;  1B7Y B;  1N6Q A;  1IBK J;  4RJV A;  1R7I A;  4JI1 J;  1NH7 A;  5K8O A;  2BUN A;  4CNY A;  5DQH A;  2CWK A;  4PEO A;  4DXL A;  3Q8S B;  3G71 S;  4MYT A;  2C3U A;  4QR0 A;  2W24 A;  5F3Z A;  2BEF A;  3MMA B;  4M8L A;  4L3N A;  2X3G A;  1RHU B;  3HFZ B;  4J9R A;  4FS1 A;  2Z2M A;  2RKI B;  1YBU A;  4WU3 A;  4BCA A;  1FRM A;  3LGM A;  2LFV A;  3LPY A;  4ES1 A;  1X4D A;  1JNR B;  4RX6 A;  3RAQ A;  2G13 A;  4ILM A;  3IM8 A;  4DL5 A;  3NGU A;  1HNX F;  5D4P A;  1LEO A;  1NJW A;  3Q24 A;  2KTQ A;  2PEH A;  3QAU A;  3GCX P;  1BHN A;  4DDF A;  4IDK B;  4YFU A;  4R0E A;  1S48 A;  4PR6 A;  1HQU A;  3UR0 A;  1M5O C;  3GYN A;  5DO2 A;  5A2Q U;  3DDI A;  1QAI A;  4WFB Q;  3CD7 A;  4NZ7 A;  5LOQ A;  1DLO B;  3EX7 B;  3CCE S;  3UN2 A;  4RBT A;  2ZE2 A;  3D6F B;  4IUF A;  2GML A;  5KFP A;  4NLV A;  2HRY A;  4TQS A;  2N3O A;  2W1B A;  1ZAW A;  1PCA A;  1YJV A;  3CCZ A;  3UW1 A;  1IM4 A;  4ZP8 A;  3K7R A;  4F2S A;  2WSC C;  1NEE A;  1ICE B;  3W2V A;  2HEK A;  4P9S A;  4C7Q A;  4YQW A;  2RE1 A;  3R6G B;  3B8H A;  1WG5 A;  1BUX A;  5L9N A;  2F9D A;  1IKW A;  3GV8 B;  2ZKU A;  1FX4 A;  2CNO B;  2IA6 A;  2HFN A;  5J2Q B;  3LP0 B;  2VPX B;  2E5I A;  3W8P A;  3KUH A;  3FFI B;  3B4M A;  1SL2 A;  2UVW A;  3DLG B;  4DV6 F;  2Z0G A;  4XO0 A;  3H5Y A;  3I5C A;  4KC5 A;  2JEI A;  4LUB A;  4NXN J;  1E6V A;  5AXM A;  4OLO A;  1OPZ A;  3AT1 B;  2FPH X;  2Z2L A;  3I87 A;  7FD1 A;  4DV0 J;  3WIU A;  3EPI A;  2FJA B;  3J7Z T;  1WWH A;  5CD4 H;  3HFK A;  5DZ7 A;  4NA2 A;  3I4P A;  2J7W A;  1KQS R;  2IYI A;  3QWP A;  4WF9 Q;  3T1H F;  2GAG C;  4HL9 A;  2BQ3 A;  2HSE B;  4GKJ J;  3B54 A;  4WXO A;  4C8L A;  2K06 A;  4JB8 B;  3K2Y A;  2MSS A;  3DCA A;  4DSE A;  3EUN A;  3ZNJ 1;  3GIJ A;  3TJ9 A;  2MLY A;  3KHH A;  4A8Y A;  3R5G A;  3W60 A;  1ZM2 A;  5LSO A;  4X62 J;  4LF5 J;  1UVM A;  1RHM B;  4R5P A;  2WBM A;  1NK5 A;  1EQ0 A;  4K4X A;  4FYX B;  1VRU A;  5KOW A;  2VON A;  2NQP A;  2XY5 A;  5A0Y A;  3DRS A;  4UOH A;  3RAX A;  4A8F A;  2HHU A;  1OY9 A;  2QJ3 A;  3OTE A;  5E5N A;  5G0R A;  1T05 A;  2YH1 A;  2E66 A;  4N76 A;  3BZQ A;  2ACY A;  1SI9 A;  1M1G A;  2IM1 A;  1H0H B;  5H1S V;  1Y5I B;  4ZVS B;  1XMO J;  3NGK A;  5A8K A;  2YKP A;  4Q8F A;  4LSN A;  3VGS A;  1YRU A;  2UVU A;  3AJ1 A;  3H25 A;  4DR1 J;  4MK8 A;  4C97 A;  2YWG A;  5KG4 A;  1NCL A;  3VGV A;  1LW2 A;  3JSY A;  1WTF A;  4GVB B;  3OHA A;  1TKX A;  3NS5 A;  2DIT A;  3O8W A;  1HBO B;  3BGR B;  2IJF A;  1HLW A;  4ICL B;  4GC7 A;  1TR0 A;  1UFL A;  4J9M A;  1RWW B;  4YOE A;  2FVR A;  4P71 A;  2D74 B;  3J81 U;  4NLY A;  2NR0 A;  1UWB A;  4YR3 A;  4TLR A;  5KTQ A;  1U2R A;  2DRA A;  5K8P A;  4ZVR B;  4LRD A;  3Q83 A;  1JB0 C;  4DQQ A;  3D3B J;  3N28 A;  3TEH B;  4NE9 C;  1UET A;  3DRR A;  4ZCM A;  2C42 A;  1TK5 A;  1BC6 A;  2HFS A;  2QLJ B;  1SJ3 P;  1QM9 A;  4RL1 A;  1CEZ A;  4P75 A;  4H4M B;  4X4O A;  2FLN A;  2WCX A;  1QD1 A;  4OZ0 A;  2P8I A;  3N6N A;  1R6V A;  1ZM4 A;  1RT2 B;  2MZJ A;  5KG6 A;  3DOL A;  2RHQ B;  4DR2 J;  4JI7 J;  1RCO B;  2GVZ B;  2P9C A;  2HVI A;  3UE2 A;  2W8K A;  2BE9 B;  1UFK A;  1ULR A;  1JLF B;  4AQY F;  3T5L A;  3NGT A;  3TNV A;  5D77 A;  1RKJ A;  4E0D A;  2DNH A;  3BJY A;  2W9B A;  2FC9 A;  3BPD A;  4GRS A;  4DPU A;  1KVJ A;  1H38 A;  4K0K F;  2I1R A;  3Q8P B;  4B3S F;  1L3U A;  3TJA A;  4O23 A;  4JP8 A;  4DF8 A;  3KJV B;  4F36 A;  2HAF A;  4E8U A;  3RG6 A;  1TKD A;  2VC0 A;  4NXM J;  2UU9 F;  4NYP A;  2XY7 A;  3ZTO A;  2ZHA A;  1CC8 A;  2Y8Y A;  3AFG A;  1H6K X;  4DV2 F;  4CTA B;  2GQ2 A;  4DR3 J;  4LR9 A;  2HHQ A;  1N5Y B;  3QJP A;  2IDL A;  2BJD A;  1UPP A;  1DZ5 A;  2B9Y A;  2V2Q A;  4QPX A;  3AQO A;  3MR3 A;  4GO5 X;  4PXB A;  1NH8 A;  1RCX B;  2KO1 A;  3MAA B;  1Q7L B;  3IRX B;  1T9X A;  4C3L A;  2WTF A;  1IKY B;  1ZA1 B;  4X66 J;  2EVZ A;  2YQ0 A;  2JFK A;  4HLB A;  3CJ5 A;  2FIU A;  1UMJ A;  4U9R A;  1N6Q B;  4AE5 A;  4JI6 J;  3LGH A;  3SSR A;  4DUT A;  5DDR C;  2CJB A;  4B3O B;  2HAI A;  2B0G A;  3G2X A;  1S49 A;  3OR1 B;  1S76 D;  2B4V A;  2GFF A;  4DLG A;  4K4S A;  3D7S B;  3ILL A;  1X5T A;  3UO0 A;  1KC8 T;  3X1L B;  3PY8 A;  1B0P A;  1WI6 A;  4OI3 A;  1Y5L B;  1C1B A;  1QSL A;  2JLE A;  1NXI A;  4JUZ A;  2C3M A;  1S99 A;  1S72 S;  4DR6 F;  4TXS A;  3H42 A;  4FS2 A;  1SJR A;  1F6T A;  4NLO A;  3BQ2 A;  3QAE A;  1FE4 A;  3DOK B;  2DTJ A;  4EU0 A;  4PZV A;  2E1R A;  4HVZ A;  3MAH A;  1NZ8 A;  4G1I A;  1CJV B;  3CIM A;  2G4B A;  3C8Y A;  3I9Z A;  3THV A;  3ZTP A;  1TK0 A;  4NLX A;  1DAR A;  5HMZ A;  2OUG A;  4F3M A;  1R8H A;  3PYF A;  1U8W A;  2C3Y A;  1HQU B;  2BJE A;  3FBB A;  4WBF A;  2ASD A;  4RLE A;  3UFC X;  3MXH P;  2KH9 A;  2ZE2 B;  2IMW P;  2IFX A;  4KGX B;  3MEE A;  2J9E A;  2DR6 A;  2KVQ E;  3AOA A;  1DTQ A;  3SQG B;  4B08 A;  3FQL A;  3W2V B;  3MOZ A;  2W2M P;  4QZV B;  1S9F A;  2GMJ A;  1KOH A;  3M6V A;  2DBB A;  2E5H A;  3OQ2 A;  3IWX A;  2DNK A;  2HHX A;  1IKW B;  1TUV A;  3UCU P;  3VAF A;  2BJ9 A;  3R7N B;  3W64 A;  3KLE B;  4HH1 A;  3NGR A;  2PII A;  4XDC A;  2NZ4 A;  4F0M A;  3TUJ C;  3IBF B;  2BAB A;  3CCU S;  4JV1 A;  2AEJ A;  2J0Q D;  1UTA A;  2AJQ A;  1VIX A;  4DV3 F;  3BDP A;  2M8H A;  1KRP A;  4MIA A;  4K59 A;  1VC0 A;  3MUV P;  4OX9 F;  1RTJ A;  4DQP A;  3HZG A;  4I64 A;  2IA0 A;  2HIY A;  5B08 A;  2WON A;  4R5P B;  4OI0 A;  3Q8Y A;  2V69 A;  1U0H B;  3H4D A;  2CJ9 A;  2KZZ A;  2YH0 A;  2GHV C;  1VRU B;  2NXE A;  2YVS A;  2UXB J;  2EBE A;  1VLO A;  2DT9 A;  2WW8 A;  3DRS B;  2KB2 A;  4GC6 A;  3NBP B;  2W7A A;  3PV8 A;  1D1U A;  3OXL A;  4OJ3 A;  4DCJ B;  4ZPD A;  3NS6 A;  2UXD J;  1KEK A;  2VPZ B;  2YNI B;  5B0C A;  1RU2 A;  1HD0 A;  1P1T A;  2HZA A;  1HAR A;  2VC1 A;  4R8U B;  2KDO A;  1F0X A;  3DLH A;  3HHN B;  3N5F A;  3JXO A;  4J91 A;  4NLS A;  4LSN B;  1IBK F;  3KK1 B;  4JI1 F;  2CPJ A; 
#chains in the Genus database with same CATH homology
 1CJT B;  4OYP A;  5D0H A;  4CLU A;  1YBU A;  1TL7 A;  1U0H A;  4OYM A;  3C14 A;  1WC0 A;  5D0G A;  4CM0 A;  4OZ3 A;  4P2M A;  4OYX A;  1CJK A;  3MAA B;  1CJU B;  1CS4 A;  4CLT A;  3G82 B;  5IV4 A;  4OYI A;  3C16 A;  2GVZ B;  1WC5 A;  2GVD A;  4WP3 A;  2W01 A;  1AZS B;  4USW A;  3UVJ B;  1CJT A;  4USV A;  1WC1 A;  1WC6 A;  4OYA A;  4P2F A;  1CUL B;  3C15 B;  5D15 A;  5IV3 A;  5D0R A;  2WZ1 A;  4NI2 B;  3MAA A;  1CJU A;  4CLY A;  1U0H B;  3ET6 B;  1WC4 A;  1CJV A;  4WP8 A;  4CLZ A;  1AZS A;  4UST A;  3UVJ A;  4CLS A;  5D0E A;  1CS4 B;  4CLP A;  3R5G A;  1AB8 A;  3C15 A;  4CM2 A;  1Y10 A;  1FX2 A;  4OYO A;  4OZ2 A;  1TL7 B;  4OYW A;  1Y11 A;  4NI2 A;  4CLW A;  3MR7 A;  3C14 B;  3G82 A;  2GVZ A;  4OYB A;  3ET6 A;  4WP9 A;  4CLK A;  4P2X A;  4CLF A;  1CJK B;  1YK9 A;  4CLL A;  1YBT A;  1WC3 A;  1CUL A;  4USU A;  3C16 B;  2GVD B;  2QV6 A;  1FX4 A;  2BW7 A;  4OYZ A;  1CJV B;  4WPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...