3NGSA

Structure of leishmania nucleoside diphosphate kinase b with ordered nucleotide-binding loop
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFPALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDSVESAEREIAFWFKADEIASWTSHSVSQIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Molecular adaptability of nucleoside diphosphate kinase b from trypanosomatid parasites: stability, oligomerization and structural determinants of nucleotide binding.
pubmed doi rcsb
source organism Leishmania major
total genus 43
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2010-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3ngsA00
1HHQA 1EHWA 2HVDA 4ANCA 3FC9A 3Q86A 3NGSA 1NSQA 3ETMA 2BX6A 1W7WA 1F3FA 1UCNA 4UOGA 3EVWA 5CABA 3EMTA 3NGTA 3VVTA 5BXIA 1PKUA 3VGSA 4DUTA 3FBCA 3FBEA 3PJ9A 1HIYA 2CWKA 1MN9A 3G2XA 3EJMA 3ENAA 3EM1A 3BBBA 3PRVA 4O0NA 3ZTSA 4KPCA 4EK2A 5CAAA 3EICA 3ELHA 1HLWA 1NCLA 1NPKA 4F4AA 3VGTA 4UOFA 1XQIA 3Q8UA 2DXDA 3FBFA 2DXEA 1PAEX 1K44A 3VGUA 1LWXA 4CP5A 3EVMA 3B6BA 3GP9A 4C6AA 1NSPA 1U8WA 3FCWA 4DZ6A 3DDIA 4S0MA 1XIQA 1NB2A 3DKDA 3GPAA 1B99A 2HURA 4UOHA 3FBBA 5C7PA 1BE4A 3Q83A 3Q89A 3ZTPA 1NLKL 3Q8VA 3B54A 3WX8A 1NHKL 1S57A 3FCVA 2ZUAA 2AZ1A 3EVOA 4F36A 3BH7B 3EE3A 3BH6B 1NDKA 1NSKL 1WKLA 2DXFA 2HVEA 1MN7A 1BHNA 1ZS6A 4FKXA 3ZTQA 3BBCA 1S5ZA 4WBFA 3FKBA 3ZTOA 2VU5A 1NUEA 1LEOA 4ANEA 4W98A 4HR2A 1NDCA 2B8QA 2DY9A 1NDLA 3MPDA 5IOLA 1B4SA 4ENOA 1F6TA 2B8PA 4DI6A 3JS9A 1BUXA 1WKKA 2AZ3A 3VVUA 2DYAA 3NGRA 3VGVA 1KDNA 4FKYA 3NGUA 2NCKL 3BBFA 3Q8YA 3R9LA 1VYAA 3ZTRA 1NDPA 4ANDA 1WKJA 2BEFA 1S59A 1JXVA 3L7UA
chains in the Genus database with same CATH superfamily
2V0NA 3R2DJ 1HYSA 5GAGI 3J7AN 1AA1B 3T9ZA 1WSVA 4PQUB 4X62F 3PJ9A 3VAGA 5J2PA 4KHPF 2DCUB 5KT3A 4O3OA 2J6TA 3S7RA 2MZRA 4B9UA 4ES1A 4ES2A 1BD6A 4H4MB 2AJFE 3GIIA 2BQUA 3V4MA 2DH7A 4CT8A 4MH8A 1ELOA 3LP0B 1AZSB 2V9WA 3ADAC 3AOCA 1IBLJ 1RWXB 3GB0A 3AXMA 1S10A 4DV3J 1U2CA 1SKWA 2I5JB 1ZOTA 2AYEA 3RTVA 3EVOA 4RW7A 4EI2A 5FD1A 3M4XA 4XTTA 1UEKA 3K5NA 3QPIA 4MKYA 2E7XA 3GJSB 4OHVA 3RU0A 2KT3A 1NPRA 2ALYB 3N4WA 1C4AA 2FLNA 1WWHA 4B9TA 4U7UK 3BJYA 1FCAA 5IQ6A 2O1PA 1WG4A 2MQPA 4EBCA 1FRJA 3G71S 5KG4A 2XQCA 3GFZA 1KDNA 4CLTA 3ISNC 2P9GA 4OI1A 3LP1A 3QT8A 3CC4S 2W2MP 1RUSA 3PVXA 1GMWD 3ZO7A 4JV2A 4LF6J 2MLZA 3VVTA 2BE2B 3DM2B 4RX6A 3HD2A 4USJC 3DRPA 3I4HX 4OZ2A 3V4IB 2RD5C 4ELTA 1FDAA 4OJ3A 4CTAB 3OHBA 4KGVB 4ZVUB 4NX9A 3OR1A 2ZD1A 2MHEA 2ROEA 1N33F 3F0NA 2OPSB 4OYMA 1SKRA 2DR6A 2R7QA 4U8YA 4DR1J 1SJRA 5E2QA 4LSZB 3TJ9A 2MGZB 1WI6A 3VCDA 4FKXA 1XN9A 3K57A 3TX8A 4PEOA 5IZHA 1OY6A 2BUNA 1EQMA 4OJ1A 3GCXP 2J6UA 1RB0A 3MEEB 4DL5A 3D6TB 2OSRA 3NMRA 2EEYA 4JV1A 4A8SA 2C2MB 2PGCA 2E7WA 2I38A 3T5LA 2ZOMA 1HI1A 3DOMB 4L72B 3VAHA 4ID5A 4YMEA 1VBZA 1WACA 1NCLA 1HD0A 2H9ZA 3SXLA 5J2PB 2R8JA 4Z2XA 3NOGA 4KHRA 3GG0A 2D3OR 2HFNA 1HHTP 3IWLA 1MMNA 2J7UA 1QE1A 5KG3A 4S0MA 1R8PA 3N01A 4OI6A 3FK4A 3K17A 1LNQA 1S1VA 1HPZA 1OJ4A 2NPFA 3UO0A 5HMZA 1SC6A 2WW8A 4LIRA 3M30A 3I32A 3FQLA 1VQLS 5KFNA 2BW2A 2BRKA 5A6PA 4RNOA 3M8WA 5A0YA 2OHDA 1Y5IB 1WELA 3R1HA 3PZPA 2K2PA 2ZOFA 4PUOA 3I5BA 4DV1F 2OKQA 4Q2MA 5EDWA 3L7UA 3J7A1 2IAJA 5EHHA 3KUHA 3OXLA 4X66F 3MM6A 5I3UA 2W7AA 3BQ2A 4DCPB 3TQEA 4XPCA 2HGMA 4B02A 3D6FB 2BJ8A 4O0IA 4B17A 1U09A 3FCHA 3NEKA 2R7TA 1IUJA 3DRPB 1X4AA 3VGUA 2ZH9A 3OFEA 1KQKA 5D0GA 4OZLA 4JP8A 3GLJA 4ES3A 1LXJA 1UJ4A 2MPUA 3OR1B 2HFOA 3CE8A 1BLUA 1IBLF 4I64A 2FJXA 4LF7F 3K7RA 1L5UA 1GTHA 4DV3F 5MLCV 2NXNA 1Z4UA 4IUFA 3CJ3A 5DQGA 4A8QA 4LBPA 1P27B 2KRBA 1GQEA 4NLDA 2VONA 4DQQA 4CO4A 3QJLA 2EWHA 2QL7B 4ZLNA 4TKTA 1AYEA 2CAJA 4OV6A 1PYSB 2CQIA 1KTVA 2B9XA 2DR8A 5DO2A 4LRBA 1SKSA 2L41A 3BYRA 1TKDA 3CDBA 4LF6F 1VIOA 2NQPA 3L9ZA 4KB7A 1VBXA 3MR5A 2CPEA 3AH6A 3C66A 3H8YA 2RDDA 4JI6J 4K0KF 4OI4A 2GQCA 1Q79A 3SQOP 2IIHA 1AUSL 4K4TA 4ID5B 5KG6A 3UR0A 3LF0A 2DR9A 1N5TA 2ASYA 1BC6A 2KFYA 1FJEB 2C2OB 4B3TJ 3G96A 2PO4A 4JI7J 1FKOA 2OGUA 1CBKA 2OFGX 3AT1B 1QE1B 1YJRA 2IMWP 3HSZA 2Z2MA 2O5DA 3VF0B 3ET6A 4WIQA 2B9EA 4DR1F 2N3LA 4G6VB 5C24B 4WTYA 5F3TA 2HFVA 2HQ3A 1TKZA 4RR5A 1IQTA 2I1RA 3GFHA 4P71A 5K8OA 3HM9A 5D77A 4DR5F 4OHYA 1C2PA 3M30B 2OPRA 2RVJA 1V3RA 1YJVA 5K9FA 2HZVA 3QLHA 1X8DA 1FWKA 1WEXA 1B7FA 4C4WA 3CD6S 3O3LA 5L1JA 3ZZYA 4LIWA 4PUOB 1A0OB 1U0HA 4LF5J 1Y5NB 4QIWD 5D0RA 1ZYQA 1YRXA 2V34A 2HQIA 1B3TA 3FBEA 1OWXA 2IM0A 3CF5Q 1S0VA 3PYEA 2JDJA 2DR5A 1RT2A 1PJ6A 3IWXA 4N7TA 5I3UB 4FYYB 4U95A 1D9FA 2ZJQQ 4F26A 3OTOF 3DXSX 3CMAS 4IYQA 1ZZFA 1T9UA 4LQ3A 1T94A 4EZ9A 1NJZA 2ZHBA 2V5HG 4L74A 4ECQA 4DWIA 2UVVA 4KRWA 4C8KA 2QEXS 2RQCA 1R43A 4R8UB 1W26A 2JFKA 3MPYA 4J9NA 1S6QA 1FK9A 2DGTA 5IC6B 5HN0A 2BJ7A 1YJ9S 3OSPA 3UCZP 4DR4J 4A8MP 2KFNA 1ICEB 3SSQA 3QZ8A 3J7YU 3E2EA 2DHHA 1SL1A 3NGUA 1VI7A 4H4KA 4ZJLA 2YQ1A 2RS2A 4NLUA 4FZVA 2R7RA 1X4EA 1DHMA 2FPHX 4K59A 2F7VA 2WVFA 3NL0A 1IBKF 3P6YC 5CYMA 1NK9A 3CDEA 3SFUA 3MM8A 4ILMA 2AWZA 5CAAA 3AJ1A 2EG2A 3EICA 4G1PA 2OUGA 3U1NA 5HROA 3G8TA 4USMA 5GAGU 3TW0A 2GMJA 1WC4A 4DN0A 1EZZB 5AE2A 5EWGA 5DETA 4MK9A 4LFBF 1T02A 2HVHA 3D1OA 3BGRB 4X64F 1YRUA 2CQGA 2VKZG 4QW8A 3GE9A 2NSCA 2K7KA 1RWPB 1IKVA 3CDUA 2H3EB 3FEZA 2C28A 3FBBA 4G1IA 2JEGA 1FKOB 1VQ4S 4M8LA 3WIUA 4RUAA 3QAEA 2DB1A 5KFQA 2B5JA 1RSCA 4WFNQ 3ET6B 2KL8A 3M8QA 1Q7YT 5M2RA 4JYAF 1AXQA 1N36F 3JQJA 1TKZB 4Q7AA 2LKZA 1EETB 4M5NA 4P10A 2J0WA 4LR7A 5KFUA 5SZTA 2Z57B 4IR9A 3H20A 1Y3JA 4KSEB 4ANDA 4RU2A 2OPRB 1JXVA 1DFDA 2H5IB 4KJIA 1W7WA 2U2FA 3QIDA 3PCOB 4ECRA 2L9NA 1FE0A 3C14A 4RKUC 4OYXA 4NPOA 1U0HB 2NZCA 2FC9A 5F8JA 3N5BA 2XGQA 4M5GA 2XULA 1DQAA 1RT2B 1CJKA 2OFHX 3DLEA 2V68A 1Y00A 1M5SA 1K1QA 4IFYB 5IT9Y 3DLBA 1Y5LB 1I94J 2ZH6A 2XMKA 1FWLA 3A8KA 1UJ5A 3DGPA 3BGFA 4K4WA 2DNKA 2CQ4A 2HNZA 3MAAB 1S6UA 1FK9B 1PILA 3A12A 3MZIA 2UVRA 1R6YA 2FQQB 3UCUP 3MDFA 4HDGA 1ZETA 1UA1A 4DR6F 2KKHA 2FHKA 4HYKA 2R8IA 2CPDA 3R9LA 2G2ZA 3V6KA 3T5KA 4RZRA 3ZC4A 2CRLA 3BV8A 1KBRA 1HHQA 2KHCA 3TVYA 3GYGA 3KMSA 4LF5F 1CEZA 3JYTA 4PYAA 2BBEA 2DGXA 4PWDA 5CYMB 5ETRA 1XQIA 2ZNYA 2DNZA 3MM8B 4ICLA 2FVRA 4DF4A 3G8SA 2NUHA 3OVAA 2CADA 1UEVA 1U25A 2DIVA 1GMVA 2JVRA 3HHEA 4ZPAA 3HHLB 2PFFB 2XLIA 5E33A 1IKVB 2ZUAA 5HP1A 3KLHA 2DXFA 3R5JB 2FLPA 3E8OA 4NCGA 5F8HA 4P52A 2J9EA 5F9LA 1S49A 2CQPA 1IR2A 4MKBA 3J81j 2HZCA 2GAGC 3BSCA 4P72A 1SJFA 2DNHA 4NLGA 3J81U 4ZMMA 2B5JB 3TA0A 1CG2A 1FRIA 1H7WA 3M8QB 3I96A 5B7WA 2GGPB 4J9UE 3VAIA 2DJWA 5B0BA 4R0EA 1RTJA 4P6QA 4MK7A 4I7FB 2HBQB 1MWZA 2RRAA 3BDPA 4ETZA 3TUJC 3FC9A 1T8EA 2KN4A 2BOAA 3LGHA 1BXNA 4IR1A 5DQHA 1LW2A 3NGDA 2RSQA 5EWEA 3PJXA 4RWWA 3C14B 2JLEA 2YXLA 4F4WA 2P9CA 2AU0A 1XIQA 1CJKB 1AB8A 3GZ7A 2D69A 1RWOB 4L3NA 5T7LB 2XI3A 3PW2A 2FC8A 2PC6A 2MSSA 2RDJA 3J7Z5 4ILLA 1VQ9S 4KPYA 1P6TA 1S5ZA 2KVQE 3IMQJ 4WFBQ 1SH0A 4I69A 2RQ4A 3KHRA 4K4YA 3JQKA 2HNZB 3KFWX 5LL6d 3PFOA 3H2LA 3IR6B 3TUIC 3CJ0A 2UZAA 3BBFA 2HQDA 3CIMA 4JI4J 4EYIB 4NXMJ 5ETOA 1UFKA 5HANA 4CI0B 2KG1A 1U48A 5AT1B 1REVA 3K5LA 2HG4A 5L38A 1FESA 3B4MA 1S4FA 2JNJA 1HR0J 1OYDA 2HWTA 4FPRA 1RHJB 4PWDB 3J80Y 2R4FA 4C8LA 5K8NA 2IYIA 4DFPA 2LEBA 5LSRA 4CZCA 1Y7PA 4USKA 2OO4A 1Q5YA 2EVZA 2UVWA 5ADZA 4EBEA 3ITHB 1XNRJ 3OVSA 1YG0A 1BHNA 2QV6A 1RP5A 3ZTQA 2W2QP 2YPZA 1HBMA 1XTZA 4X4TA 2YVSA 5HP1B 3UVJB 2HRTA 3LAMA 3AJDA 5F8GA 2HHPA 4LBIA 4ZOSA 4ECSA 1UVLA 3R5DA 4C3LA 3WC0A 2H5JB 4HT7A 4ILRA 2A0FB 2M8DB 3QIPB 3MPWA 2HGNA 3QT7A 4AL7A 4DSJA 2ADCA 4IRCA 5BR8J 2BZ2A 4KIAA 4P74A 3R5CA 4M5HA 2BDPA 1RTJB 4MIAA 3NGTA 4ZJQA 3BQ0A 4DFJA 3EXYA 4F4KA 4OYAA 1RLDA 4PXCA 3FZ2A 2ZHAA 2W8LA 1KHVA 5DQIA 2RHQB 2MKIA 5IWAJ 4LF4J 2B6AA 1FF2A 4B3OA 1VISA 2XS5A 2XHCA 5LSLA 3KHGA 1LFWA 2HHTA 3KHLA 2YQ0A 1W25A 5HJXA 3UI3A 4TLRA 3LH2S 4WU2A 3D66A 4ZCKA 4C48A 3TP2A 1S0MA 1YQHA 1UVJA 1SCJB 3VALA 4IDKB 4IFVA 1B0PA 1FJGJ 1V6HA 2FVCA 3QSYB 1TUWA 2PI4A 4NMLA 5LMNF 3OL7A 1HNXJ 2J8SA 4OZ5A 4BS2A 3HZGA 4JI8J 4FYDA 2RKIB 3CCWA 2C3MA 4QPXA 3CNQP 1NM2A 3SDEA 2V67A 1GFWB 1OO0B 4PG4A 3M8RA 2M2BA 1WEZA 3SCKE 2W9AA 3E01B 4QIVA 4PRFA 3T41A 2C3YA 1JNZB 2DNGA 1WDDA 4OZNA 1MU2B 3IGNA 2EKYA 1REVB 3HK2A 2W9CA 1FVQA 1VQKS 1FNXH 2ZVIA 2AV5A 3BKUA 2XGPA 3HHDA 4EEYA 3CPWR 2WBMA 1RT3A 1S76D 4JB8B 2FZCB 3MEKA 4QR2A 3Q8QB 4DV0F 1NLKL 2AJ0A 4P9SA 3H4BA 4QOTA 2CVIA 1MG7A 3MD1A 1N5YA 3OLAA 3THVA 3WZ0A 2KTQA 4AYBD 3CGIA 5F0WA 3IG1B 2V2ZA 2E1MC 3GJRB 1U24A 4HDHA 4CLYA 1JWWA 1KD1T 1B4SA 2MDAA 4Z7CA 1YBAA 4UZBA 3M32A 4J9PA 2BQRA 2V50A 2DR7A 2XBPA 3QAUA 2ILZA 2QL5B 3KXDA 3D5MA 1DAXA 3T9NA 4JI4F 3PACA 2HWIA 5KT2A 5SUHA 3T1YJ 2PA3A 1R3NA 5DG7A 5CYJA 3M2UB 4OZ0A 3HKZD 2QMWA 3EZOA 3CSKA 1F5BA 3CDAA 4CO3A 3D28A 2FTRA 2RT3A 3OXFA 1S9FA 2VFUA 2EFQA 3W5ZA 2WVDA 2B6AB 2KG0A 4B3OB 3F56A 2WCXA 5HMXA 2MKYA 1J5OA 3BH6B 1BWEA 3JB9k 1XNRF 1FT8A 2N7CA 3B78A 3RAXA 2HS4A 4ELUA 4MYTA 4IFVB 3TR5A 5CCLA 5HAOA 3CMES 3KNAA 1X9MA 4AQYJ 3QSIA 2LDIA 4DL2A 4ZVFA 1Y4ZB 3K5OA 1BQXA 3D68A 2Y8WA 2R7WA 3BSOA 3QGGA 4ZDNA 5IXUA 2ASJA 2VG6A 3W2VA 2YWGA 3TAPA 5BR8F 1S1UB 1SC1B 4NYZA 2JC1A 2E1PA 1RTZA 2Z0GA 2JLFA 3IAM9 5D6GA 3G86A 4DSFA 3PO5A 4JI5F 3DC2A 2KZMA 1TQLA 2W9CB 4IO1A 2BJDA 4KFBB 4NYOA 2W2PP 4CH1A 2E5LJ 5IWAF 2DY1A 1IKYB 1FJ7A 3UDCA 3RG6A 2HLTA 5J1EB 3EDRB 1XNQF 3VAJA 4KO0A 1GMWA 4KR0B 1QTNB 3UDVA 1DQ8A 1SIZA 2X7IA 4GVBA 2VOOA 1REGX 4RL1A 5L46A 3CIZA 3W1YC 4IQXA 4B3RJ 1RT4A 4YDXA 1QY7A 2AJ1A 4USHA 1DTTB 1DURA 3MPDA 1FX2A 1FEHA 1KQSR 1HNXF 2G2OA 1GAOA 1ZM4A 2O67A 5B09A 1KFDA 2COLA 3M32B 1KHWA 2MZ1A 4AT1B 4ANCA 4X84A 2KM8C 5KOWA 2MY8A 4F3MA 3EMTA 1N56A 1SJ3P 2JC0A 2CZVC 2Y1RI 1WC0A 4PCQA 2R42A 3H7HB 1IKWA 2DPJA 2VZ9A 3HULA 1X5SA 1NJYA 5GMEA 5AXLA 4ZLLA 2BANA 3FCWA 1LKZA 1WHXA 4ED0A 4K4SA 3MMJA 5F3ZA 4JI1J 2MYFA 5H9FJ 1PYTA 4PAAA 3TEHB 2ZBIA 3BH7B 3EE3A 5CZXA 5DLGA 3K59A 1I1GA 4G65A 2C2ZB 2C3OA 1M5PC 4WP9A 1UETA 1KLMA 2XWYA 2MZJA 3W9IA 2NXUA 2GHPA 2UV8G 2OMLA 2XY7A 3T19A 2LLZA 3AODA 3GYXB 1PC5A 3PFEA 2GZOA 1VYAA 3SYZA 4LF2A 3AJ2A 3R6GB 4RUCA 3IS9A 1PKUA 4DLGA 3KYLA 3MCOA 1D3WA 4OYBA 2AT1B 2I9SA 3W2VB 2HKEA 2WOMB 3VGTA 1O5JA 1NK5A 1ZH5A 5AJ3J 4DN9A 1VHIA 2EK1A 2XMTA 2ATCB 3V5RA 5IM0A 3FSXA 2GHWA 2FUG9 4CLFA 4WP3A 1HW9A 1GX5A 5B08A 2EFNA 1B99A 1PJ5A 2HQGA 4LFCF 2DRBA 4EZ6A 1JLFA 3M8YA 1ULRA 2D9PA 5J2NB 2X3DA 1N6QA 2DNYA 3MM7B 3C46A 5J1NA 1XMOJ 1MN7A 1KWMA 3SI8A 4ZVEA 3GG1A 4ZCMA 1DTQA 5ITHA 1S0OA 4UT4A 3FFIA 4ZIVA 4L73A 3G4SS 4GVBB 2RU3A 4ED6A 1LK5A 1F6TA 2B8PA 3OTEA 4TU8A 3P96A 1I5OB 5KFGA 1AT1B 3RB4A 3F41A 4CO1A 3O2IA 5C2GA 3DRSA 2ZC3A 3PTWA 2XS2A 1TK8A 2GMHA 4DL4A 1RT7A 3N9UC 4NA2A 1KRPA 5E3RA 1VHFA 4KH1B 4FNIA 5A8RA 2HFSA 4F4ZA 4TU9A 1JJCB 2BJ3A 5FIIA 3MCMA 3UN2A 4ECWA 4ZVTB 2HSEB 1IKWB 4IOBA 1QAJA 1OMSA 3FEXB 1CULA 2E5LF 5GMDA 2VFRA 2KO1A 2BANB 2QA1A 3RBXA 2ABYA 2CVEA 3D3CJ 4ATNA 2XSFA 3DU5A 4M5IA 2UUAF 2AGQA 3HLUA 3A1YG 2GVDB 5DJBA 4YDDB 3BPSP 2OEKA 2P2CB 1KLMB 1Q81T 4HL9A 2CJQA 1Q0NA 1RKJA 1FHTA 1UL3A 1YK9A 3DLJA 2WAQD 1GEHA 2ASLA 4CNYA 4FS1A 4A8YA 2G0CA 2R2TA 3EVWA 4NLSA 2HBRB 4A8KA 3DDNA 3G2XA 3KDNA 2P5VA 2Z56B 2UXBJ 3KLIB 3IS9B 1O51A 4NLOA 1S77D 3DLGA 5JVGQ 1TP7A 1UTAA 3FMWA 3AHPA 5U47A 2Y9HA 2EPIA 2EBEA 4ZLPA 1U6FA 1TL7B 3KLFB 1QAIA 4OI3A 2V4JA 2HMIA 1VK3A 1SKUB 5KFKA 2KXNB 3MEDA 1LWEA 3J81Y 1XC9A 2W8KA 3T6BA 2FJAB 1JLAB 3L09A 4N77A 1HKAA 1YSJA 1KFSA 4JI1F 2ZBPA 2PA8D 1RJJA 3F73A 4ELVA 3LALA 1JLFB 3SFGA 1YLXA 3P45B 2QRRA 3Q8RB 4PKDB 4O44A 1N6QB 4DV7J 2NZ4A 4YP3A 1D9DA 2KFZA 1RQ0A 4PWWA 3CB4A 2IM1A 1TKTA 1DTQB 1NKCA 3FFIB 2B4PA 2AYMA 2ZDPA 3EDQB 3MOJB 3M2RB 4URQU 2YX4A 2XZWA 4DBQA 2Z2LA 2F3JA 4RBUA 3A8EA 1D0EA 1F1BB 3H98A 1MROB 1YJUA 2J8AA 4K4ZA 1Y0HA 2MQ8A 3DRSB 3KLGB 2OELA 3EZUA 2V8VA 3A8IA 1RT7B 4F4AA 3IGVA 4YR3A 1KR4A 3BQ1A 2VC1A 1N5VA 2DNQA 5AE1A 5A8RB 2MJNA 4WFXA 3DI6B 1M0SA 2EW9A 2PT0A 3NWRA 2XWXA 3RW7A 3HHNB 1VLYA 5HVGA 4OV1A 4M63A 5FDLA 1CULB 3HHLD 5ETKA 3JTOA 2BE9B 1J27A 3PG9A 3WIVA 1LWFA 2QZ8A 3FKBA 2M4MA 2Q43A 3HI9A 3R1LA 1XMOF 5KFSA 3R27A 3G87A 1R0CB 5CXTA 3OSNA 1JLCA 3BSNA 2DVIA 3GSDA 3AOAA 1RT6A 4WWSA 2QLFB 3H59A 1UMJA 1IR1A 3TVKA 3IWNC 5T14A 1F60B 3MEGB 2CJXB 1FO1A 2FJEB 4DV2F 2X1BA 3NLCA 2ZOGA 3DHWC 3TOQA 3OL8A 4YFUA 4F3QA 1RAEB 2CWXA 2YNGA 2OTJS 4CH0S 1KLNA 4LRAA 1GTEA 2HS0A 1TV6A 3BN4A 4U7CA 2HGLA 3PV8A 2VKRA 4XDDA 1HNZF 5D0EA 3UD5A 2V4JB 2HMIB 2WVEA 3CO0P 2KRRA 3DCAA 3DXBA 1Y3KA 4DR2J 4TYAA 3MR6A 3CD0A 1FRKA 4N41A 1R0AA 2VU5A 2HHHJ 5J2MB 5B0FA 4NOHA 3TZYA 4O44B 3QRPA 2FHJD 2POKA 5DGBA 2A6MA 4KV8A 1V3ZA 3QFWA 4I2QB 1CJTB 4BWJA 4USWA 4JI3F 3W5YA 2L08A 2BX6A 5GADI 2WBRA 5RUBA 1HL6A 1R7IA 2UXBF 4R0JA 2J9DA 2W24A 2CFXA 2CQ2A 2ZM6J 3AOBA 1FXLA 4RW8A 2IMOA 3DOKB 4OHZA 3IP0A 2OMOA 3PDNA 1WNEA 2CQ1A 4F67A 3Q8VA 2MKCA 2R8KA 2KT5A 5DZ7A 3IRXA 5KFDA 5FDLB 2NYHA 4NLPA 3PYDA 4DV7F 1LWFB 4N56A 5DRKA 4ED3A 5HI7A 3HVTA 4DL6A 4CNZA 4CLUA 5G0RA 2GVZB 1JLCB 4Q0BA 1T11A 2UUCJ 3ILOA 2XCAA 4FPIA 1R27B 2BM0A 4NASA 2QE5A 3KG4A 4LRFA 2KI2A 3CJKA 3K5PA 4TYBA 4Y6IA 1VQYA 3N28A 3AQOA 2RAQA 3AQPA 1E6VB 2XLJA 4LRCA 4ECTA 1FEEA 4M94A 4ZP6A 5D15A 5D3GB 2X1AA 3LUYA 1HI0P 1SQEA 1ACMB 2ZH3A 4DPOA 2DHAA 3BZQA 2BMBA 3K2YA 3DDIA 5IS2A 2WRMA 1X5TA 1N32J 2YNGB 1EB0A 2F63A 5LOQA 3PO4A 1RGVA 3Q89A 4CWBA 4GKJJ 1YJWS 2IBKA 1RA6A 2IVFB 2CNOB 1JXEA 4WCEQ 1KC8T 4K7QA 2N7YA 5CH7B 1FXRA 2PN6A 3PX4A 1S6PA 1Q1KA 3QGPA 3NKYA 3BEGB 3CT9A 2DT9A 4J9VA 4NLQA 1NHUA 2XCPA 5EX3A 3NGKA 1ZM3A 3TUZC 3UCGA 4ZPTR 2X3GA 3BGLA 3R5BA 1BQMA 2HVDA 2IDEA 2VQFF 4WP8A 2VG5B 2BOPA 3AY0A 2G2YA 2OPQA 4M1KA 3EJMA 4ZHRB 3C6UA 3VAFA 2Z2YB 4HH0A 2DTJA 1UJ6A 3P4UB 4RNNA 3X1LB 2QLJB 5KTQA 4IKAA 2NXCA 3THPA 2MEWA 1W2IA 4J90A 4RW8B 1ZPVA 1LOUA 1Y11A 2K06A 1RWNB 2WSEC 2XLKA 2R7XA 3P3DA 2GQQA 3NCRA 1KSPA 2DGQA 4KQZA 2GJIA 4Y00A 4DR2F 3IRXB 4P2FA 3X3UA 1LEOA 3LP2A 4RW4A 5HLFA 2GW8A 1FNMA 1UVKA 4WZQA 1T9TA 4C0OC 2DNOA 2RH3A 1G2EA 2EK6A 3HVTB 4LRDA 2W01A 2FYXA 1SC4B 3PW0A 5G0RB 3MGJA 3WC2A 2Z8QA 4WF9Q 4Q0BB 5BYQA 3MECA 2LA6A 1SVDA 4KYZA 4O3RA 2UXDF 3KLEA 3O1LA 4BDPA 3CJKB 5DDOC 3MWBA 1NRKA 3OUYA 3CD7A 2LEAA 2RUSA 1EKSA 4M95A 3MCNA 3KK3A 1U1LA 4F4YA 4ZPDA 3WQPA 1NK7A 1ROFA 4MFBB 2LXFA 2LXUA 4ZLJA 2HVZA 1JLQA 1S99A 4USIA 5KT7A 4U6PA 5I42A 2EFPA 4ED4A 3H42A 2YKPA 3M6XA 4R5PA 2MQQA 2ZNZA 3IBWA 4J9SA 3HJFA 3FDSA 3T1HF 1OQ6A 5GVQA 1P9QC 1H72C 2OTLS 1RE1B 2M8HA 5JJBA 3CD5A 1IWAA 3KDOA 3U1MA 3Q2TC 2EFVA 2JH3A 3RJMB 3KKFA 1H2VZ 1LK7A 2JEJA 2DGUA 2Y8YA 5K5MA 4KH0B 1MNEA 2R8HA 4M5LA 1LWCA 3N5FA 3SCLE 5A76A 1BQMB 4J9OA 2I5JA 4KHMA 2Y1IA 2KJWA 3OFFA 3W5XA 4A8OA 1RYSA 4EO6A 3C6UB 5K8PA 4IQMA 4X2BA 4BHQA 3MAQA 1I6JA 4HH1A 3PIPQ 2MZQA 1PC4A 2NXJA 5E7OB 1M5OC 2VQEF 1CS4B 3MAHA 1PG5B 5KT4A 3AD8C 5D4OA 2DGWA 5HBMB 1HARA 2BE2A 1NUEA 3GCWP 3W63A 4HR2A 3I55S 3CCSS 4JV0A 1EP4A 5C25A 1N5QA 3VV2B 2ZKUA 4XO0A 2DEIA 3RAQA 1A6LA 2FJBB 4I4BA 5ETQA 2VV5A 4WE1A 4GVLA 4WFZA 3W65A 4GC7A 4O0NA 3SQGB 3D6MB 3MECB 2GAHC 4QZVB 5IFMA 3KLEB 3R7BB 5IQQA 5D4LA 4DUYF 1RWMB 4NEYA 3GQCA 2ZDOA 1RYRA 4NZ0A 3KK3B 4MAKA 1UP1A 5THWA 1UVMA 3DLHA 2HIQA 4QIFA 1X0FA 2W9BA 5HQ8A 3KK1B 4C9DA 2HYIB 1NJWA 1T9YA 2RU9A 1RTHB 3AXKA 2XY6A 1IJEB 3GFYA 4WBFA 2JL9A 3QQCD 3VR1A 4LSLA 4KY3A 3DOMA 5LJ5Y 1WOSA 3IXQA 2QMXA 3KUGA 1F9HA 3OBIA 3R97A 3DRRA 2C2EA 1VC6A 2VJVA 2JEFA 4YEAA 1VS3A 1YBUA 3UNGC 3RB3A 4B3SF 2GC8A 1T7PA 3BR8A 3JSMA 3PEHA 4A47A 1HI8A 5CABA 1Q5VA 2UUBJ 4PXBA 2JRSA 4F3OA 1LWCB 3ELHA 1NPKA 3OJSA 1UKUA 1N34F 5GADU 1S12A 2GA7A 2D3ZA 4ZKAA 4ZVSB 3SBMA 4NLRA 1YZ7A 2G0IA 2FD2A 3W7BA 3ZTPA 4F02A 3MM5B 5F8IA 2AIRB 4EWTA 4C97A 4PG5A 2B51A 2CJBA 4MKAA 3SV3A 4DL0C 1HMVA 4NE9C 3RW6A 4C8YA 4Z37A 4K4VA 1U1NA 2HRUA 4OX9F 4KKOA 3MR7A 3EUNA 2YBVA 5IOLA 2DEJA 1VQ8S 4LFAJ 1EP4B 3EGNA 2HS3A 3EGWB 5C25B 1P1TA 5BYRA 4CQ1A 3EPIA 1RBAA 4CM0A 2UV8A 1PCAA 4WE1B 2MQMA 2QX0A 4X4PA 4X4UA 1K8AT 4FNHA 2JFDA 1OS5A 2HQCA 3ZZTA 1WOPA 1FERA 1CJVA 2DXDA 4HKQA 2M52A 4EGLA 2IFXA 3O5TB 1LW0B 1XJWB 2EKNA 3PKMA 3OTCA 2SXLA 1F2GA 3DN9A 4OFZA 3GPAA 4CLKA 1RLCL 4RBTA 1EKRA 1TL1B 3LANA 8RUCA 3H0PA 3PHEA 2W9BB 4DR3J 2PIIA 1VJWA 4A8WA 4X4VA 4WFYA 4RNFA 1CSJA 3TYTA 1PBUA 4DPWA 3FZBA 4V19J 3VAMA 3CW2C 3IFEA 4LSLB 4RW9A 2ZE2B 3SZ2A 1HQEB 5BJRA 1L3VA 5FJ4A 2MB0B 3QT6A 4DSKA 1D8YA 3RR8A 2DGSA 3DRRB 1WKJA 3ENWA 4ZP8A 2BVZA 4F0KA 5KFVA 2MKKA 2PSZA 5ETNA 5I3PA 3DRYA 4FP9A 3JSMB 1RAHB 4I68A 2F4VJ 2L48A 3HFVA 1IWGA 4DX6A 3TANA 5C24A 2G9OA 5ETMA 1N88A 2FJWA 2DNPA 3GIRA 1RAIB 3E3XA 2B3TB 3NCPA 3CC7S 5F8NA 5KG2A 1H6KX 3CCTA 1CC7A 1TUVA 2AZ1A 3TAQA 3MM9B 4HT5A 4YB6A 2AX1A 1KVIA 1N54B 4X65J 2LFVA 2EC0A 2HWHA 3D0IE 1HMVB 4CLZA 3D1HA 3HDSA 3MFHA 4KKOB 3D7SB 3TVZA 2X1GA 4GKKJ 1HWUA 2EBGA 3NS7B 4F0HA 3H5YA 4B08A 4JV5J 1V3SA 1MMLA 4DLEA 1S0NA 4PG8A 4R8UA 3LO3A 4Q43A 2BXJA 1JJ2R 1UVNA 1EX8A 1WORA 3DFEA 3CCES 3K89A 1YBTA 2ZJPQ 1TL5A 2ROGA 3WDOA 3BPDA 2AP6A 4TY8A 3I4PA 3GU0A 1CJVB 1OPZA 3ICLA 1VK8A 4E98A 5KFLA 4FS2A 3UQSA 2CQDA 2QGFB 3RAMA 2VPWB 1YVFA 1TUGB 1XMQJ 5KFOA 5M2UA 1XK8A 2H65B 2QFIA 1SQGA 3D9BA 4GMKA 4P2MA 3CCZA 4Y2AA 8AT1B 3OR2A 1FDNA 4PG7A 1NEEA 4MJKA 4D3GA 3V6HA 3SEOA 3NOCA 2Y1JA 5CZVA 3HPOA 2QLBB 4TU7A 4IRKA 1HW8A 2E5IA 4CO5A 4Y65A 1X4CA 4G1QA 5GAHI 2FVQA 4RW9B 3UFCX 4WK1A 3BGRA 4PWUA 4LFAF 3D3BJ 1QVGR 2QA4G 3OTBA 2XEXA 3CJ5A 3O44A 3IR5B 5KG7A 5KFPA 2NPIA 3UDEA 5K8MA 2GMLA 3DHXA 4ZN1A 3TWZA 2CQCA 2HBYB 1S97A 1SI9A 1T3OA 2CUYA 3PM9A 4FYXB 2GHVC 3QMQA 1S48A 3HXMA 2W2OP 5D78A 4ALZA 1EETA 3I87A 5JUMA 1X4BA 1CVJA 2D3UA 4UZCA 3FSIA 1GXLA 1D09B 4DV4J 2IM2A 5HMYA 5DGAA 1NZAA 1SBRA 1GK8A 4B9LA 2QFJA 1G3OA 4TY9A 4P2XA 3M2VB 3SMZA 3N79A 2P9EA 4X4SA 1YX2A 2DGVA 2B8QA 4WFAQ 1QM9A 4MT1A 4ZVQB 2QC3A 2HAFA 3SV4A 2DK2A 1FKAF 1YIJS 2G1HA 1R8AA 4LSNA 2ZBCA 3VZHA 3W61A 2RF2A 4F25A 3K8VA 3L3CA 1RHMB 3UNYA 2H4WB 3GMGA 2K1RA 5BXIA 4IFYA 2JHEA 4ZVOB 5HSPA 3QGHA 3QO9B 1SJQA 1ZTWA 1C0UA 1OY9A 2OP5A 2CDQA 2DXEA 2VA3A 2Q79A 5EGYA 1ZA2B 3MAAA 1T3NA 3H2VE 2QTWA 4USUA 2DNRA 3C6TA 3I31A 3ISZA 1J5EJ 2YNHB 4TY8B 4K2JA 4ECXA 3OD2A 2AYBA 4XAKA 1PO6A 3NRBA 3EZ5A 3W9JA 5A8KA 3RRHA 3JQMA 2ZC4A 3KWMA 9ATCB 2A3JA 2LXIA 4W98A 4ZPVR 4DQIA 2BV3A 4YB1P 2FVSA 2JSXA 1GT8A 2MZTA 4H4OA 1H73A 3ENVA 4N8NA 3OR2B 3NBPA 4Q44A 3IRWP 2B7CB 3POTA 4QIGA 1JLGA 3E51A 2R7SA 2GJFA 2MSTA 3FSYA 4G1QB 3ETMA 1Z1ZA 4DPUA 2ACYA 3HHLA 4UOGA 1HNWJ 2HW3A 1SJ4P 5H1SV 3LW5C 2GX8A 2CWKA 2JX2A 3BBBA 3HCXA 3IAS9 2Y0BB 8ATCB 3S1TA 2IJRA 1WC1A 3W9HA 2CNKB 4JI0J 1JXLA 2ERRA 4P75A 1K44A 1LWXA 1RBLA 2IHR1 2N4DA 5ETPA 3BS9A 1VR6A 1IJFB 3KJNB 2Z30B 3L7PA 4E8UA 2WONA 4Q45A 2GGPA 2XG8A 4I7FA 3H5UA 1F9FA 3VWSA 2P6SA 2XYHB 2CJAA 3ZZPA 3B8HA 2RNEA 2RS8A 3G6VA 4LREA 2CZ4A 3MCSA 5EUHA 2HK2A 5JVHQ 2WB1D 5I3QA 4AXJA 2H1YA 1VFJA 1URNA 1VQ6S 1T03B 1VQ5S 1IQZA 1QLNA 4DV6J 2L3MA 3I56S 4JI6F 2MLXA 4LSNB 4DS5A 2RF2B 3P5TL 1NSQA 2XB2D 1B0TA 1H2TZ 4NA1A 5T7LA 4O3SA 4AL5A 4EK2A 4B3TF 4E2FB 3CMQA 2K1RB 4JI7F 4A4JA 4X62J 3I6PA 2XSJB 4ZP7A 7FD1A 1XMBA 3GILA 3CCUS 1C0UB 2FHJA 3MR3A 3TA1A 2FDNA 3M8PB 3PW5A 1NSPA 3I0RB 3JAMU 5ETVA 1V5VA 2GJ2A 2C3UA 2JVOA 1VDHA 2VH7A 4YY3J 3TQ1A 4V1Ak 1Q95G 2L9DA 3C6TB 3OFGA 3HFKA 1U1OA 2IRYA 3MMBA 1ZZNA 2APOA 2KVIA 3TAMA 4DV4F 1YI2S 2VASA 1RACB 1PGZA 3K58A 2QYGA 1I51B 5A8KB 4MMOA 3HT3A 3SIPB 3GIJA 4WKRA 4NWBA 3VGVA 2CQ0A 1IN0A 2HRYA 4EUVA 6AT1B 4H4OB 3FUYA 4RBVA 1HBNA 3R5AA 3NBPB 2YKNA 4YQWA 2BA9A 3N0VA 1Q86T 3POTB 3M8ZA 1JLGB 4YS2A 4WYWA 2CQBA 1RK8A 3ITHA 1DBDA 1TVRA 1JX4A 3S01A 1PAEX 3UVJA 4FXWA 2V2VA 2VBWA 1IM4A 3DMJA 2AHOB 2KXHA 3S8SA 2LDYA 2PMZD 2R3VA 5H9EK 3LA0A 1J5EF 4PR6A 2C2DA 4JBCA 4DR4F 3QIPA 2CPXA 1J2VA 1Q53A 2WONB 4GO7X 3DLKA 1RZMA 1HNVB 3ZTOA 1N33J 2ROPA 3TO8A 3OL9A 4RUHA 4DU8A 2DHXA 2G0JA 2VC0A 1X4GA 3QRQA 4D3HA 2G4BA 1SH2A 2MKJA 2B7BB 1IKXA 1TMMA 1S59A 4KGXB 1U6ZA 1NH7A 1TR0A 3UPFA 4YHHJ 5DS7A 5H9EJ 3FBCA 1RCXB 3NNAA 1HNIB 2EC2A 5T41A 2B43A 2LECA 2FLLA 4IDKA 3IA0A 1GNKA 4DG1A 4URSA 3GP9A 4JI0F 3HFZB 1WF2A 1U8WA 4OLPA 1T9XA 4LBHA 2JJ4D 3KNGA 1Q7LB 1NB2A 4TQRA 3F44A 4LR8A 1VIXA 1U7LA 1X7VA 1S1TB 2RKIA 3CTRA 4I56A 2HVEA 2J5AA 3E01A 3MMBB 3RBZA 1ZM9A 4PPDA 3TAMB 3FMBA 1MU2A 2YNIB 5K14A 2MQNA 3NS5A 4U67Q 3CVKA 1HWJA 1Q4RA 1TU0B 2FHMA 4DZDA 3HVWA 4RJVA 2MHNA 2IA0A 2NXEA 2HPUA 1AFIA 1WTFA 1HBNB 3MHYA 2YKNB 1TMJA 2E5HA 5GAHU 4OX8A 4DV1J 1QSLA 1RXOB 1NB7A 2ZWOA 5L1LA 2M0GB 2NUUG 1KQGB 4QU6A 4X66J 3P8BB 3Q8UA 1WI8A 3M9NB 4U8VA 4ZVHA 4FBUA 3RGIA 5HO4A 3DOLA 3W60A 1I94F 2AJ2A 2EXUA 3B6BA 4QCLA 1TVRB 2CKWA 5KFBA 3IG1A 2A6OA 4Z7YA 4F2SA 4ED7A 3PXGa 4RUBA 4Y28C 1E6YB 3QNWB 1U26A 2DO0A 1UPMB 4C8ZA 1WEYA 2E7VA 2FVPA 1JK9B 3DMJB 2HNDB 5KFHA 1FI4A 4YY3F 7AT1B 5KFJA 4EMDA 5DDPC 1OSCA 1RTDB 1UW4A 3DLKB 1RKIA 5E5NA 4LF7J 3M2UA 1OSDA 2WVCA 3G6ES 5A2QU 1YWXA 4DMZA 4O3QA 1Q8BA 1UWAA 1NK0A 1NMEB 3J80U 2A18A 1JLBB 1V9OA 4JOUA 1IKXB 2HEKA 4B3MJ 1C1BA 1LV5A 4HVZA 3QATA 2KJVA 4M5MA 2UU9J 1N52B 2DNNA 1UZHA 1M1KT 3ETOA 1H98A 3QWUA 2U1AA 2CIMA 4K0KJ 2M70A 4DG1B 2WW4A 1U1KA 2WHOA 2AQ4A 2IDLA 3S6EA 1CC8A 6FDRA 6FD1A 3BB5A 3RBDA 2DHGA 3PRBA 3CCRS 4DUZJ 3W64A 2HHSA 4OJGA 4KE5A 2VG7A 1S1UA 4GRSA 2GQ2A 1WTBA 3PR5B 3IM9A 1VQMS 5KFEA 1M1GA 4NZ7A 3C3LA 5K14B 5M2PA 1VOMA 4KFBA 4MIWA 4U96A 4DR5J 4OZJA 1IKYA 4DQPA 1Y10A 3Q86A 5CQGA 5DDQC 5J1EA 2GCFA 2HHVA 5A6WA 2ZH2A 2LCWA 3I9V9 2MQLA 1QTMA 1X60A 1RDRA 3UR3C 4YHHF 2ZH8A 4BC7A 4QWAA 3RB6A 4LJMA 1QAXA 1RADB 2E5JA 3O8WA 1CQNA 2MLYA 2V8HA 4CIOA 2KYZA 4ZVRB 1HYSB 4J9KA 1DTTA 2RQMA 3DOLB 2CYYA 2OD6A 4IG0A 3QYYA 2HURA 1EAYC 3MPUB 3UDLA 3MOZA 3OTOJ 3CDWA 4Q8FA 1K0TA 4EO8A 4PXEA 2AX0A 1NDKA 4Y2MA 1K1SA 5KFFA 2Y0SD 3I5AA 3I0SA 3ZFVA 5E3CA 4NXMF 2ZEJA 2VJUA 1K0VA 1ZAVA 2YX7A 2K3KA 2AJ4A 4KTQA 1L3KA 3V6DA 3GV8B 1CQMA 3SSSA 2KDOA 4RW7B 1XERA 4UTGA 2LQ9A 4NMXA 2HFZA 1RHKB 2E44A 1HR0F 2KXFA 3OTDA 2VBXA 2MTLA 2CPHA 3TZWA 5ETLA 1AFJA 2WVBA 1C1BB 4B9SA 2E9TA 1IBKJ 2AJQA 4CLSA 1WC5A 1VQNS 1T9WA 3LP1B 2PI5A 3OW2R 1IM6A 2XI2A 4A48A 4C6AA 2DBBA 2OEJA 3ISND 1FE4A 3CWJA 1QAYA 2GIRA 3R3TA 1RU1A 2YKMA 4LFBJ 4R25A 2BKOA 4ED5A 4X64J 3C8YA 3CJ2A 2YWWA 1NU4A 1NKEA 5ETSA 2E1RA 3L95X 4ED8A 3HVRA 3KLVA 5E41A 1OPIA 1VMBA 2DCLA 3PYFA 3Q8PB 2YKQA 5ETTA 1OQ3A 3C16A 3C15A 3UN3A 4CT9A 4IOCQ 2LQJA 1SJ1A 4XIUA 5GMKa 2WOMA 2ZD1B 4C11A 2A1BA 2BKNA 2VG7B 3DDKA 2RB7A 4LQ9A 1DRZA 2QA2A 3HMJG 4JYAJ 1JB0C 1N36J 4OLOA 3FJ2A 2FY8A 1TK5A 1X5PA 3VHQA 3LAKA 3V81A 3ZZUA 3BKFA 3HD1A 4LF4F 4RPFA 2HHUA 5J2NA 3UN5A 4B3MF 3MM7A 2AEJA 4NYPA 1PYOB 4DPTA 2UU9F 2BRLA 2XNQA 2LQ5A 3BF4A 5L9XA 1F0XA 4A46A 3CCMS 4OYZA 1FJGF 1RT5A 3ZZOA 3L7OA 3D67A 2C2RA 4QYZK 4IG0B 3PJWA 4P7TA 5H9FK 1X4HA 4RWXA 5AXKA 5KOXA 3PYGA 3JSRA 4DUZF 4JI8F 2ZZNA 5KFWA 1RBOB 5KFIA 2KU7A 1FFSB 2B0GA 3I0SB 5AE3A 3PKYA 3BO2A 2UUTA 3M7VA 4UUWA 4FKYA 3D0GE 1S1VB 1HPZB 2ADBA 2YWHA 2OEMA 5LXYA 4J9QA 2Q1LA 2OLWA 5J1PA 2ZH1A 3V6DB 1QUVA 4DR6J 3Q0AA 4ECZA 4ID8A 1ZBTA 2O3DA 4UF4A 2V63A 3ENAA 4QYZJ 1MWYA 2R2RA 2W7PA 1TL3A 5A0YB 2PFDA 1FTCA 3FBFA 5K20B 1JIHA 4BC9A 4O4GA 5KT6A 4MK8A 1WJ9A 2GVDA 2LU1A 2PEHA 1QVFR 3PHTA 2IAJB 3V6JA 4Y2IA 1D8ZA 2R7OA 1FD2A 4QIEA 3CCJS 3LGMA 3MM6B 1KP6A 1H7XA 4DSIA 2VD3A 2YPYA 1O8BA 2YKMB 3CJSA 1RTIA 2OI2A 1U2RA 2QA4S 1YZ6A 2EFGA 2G1DA 3KHHA 3KTQA 2F9JA 4UUXA 1RHQB 3GJQB 2A2CA 1ZA1B 3KLIA 3C16B 3C15B 3D2WA 3MXHP 1HWKA 1N4LA 4UOCA 3CJTA 4YN3B 1BUXA 3PNIA 3HO1A 4C11B 3T1YF 3RB0A 2IVMA 4ER8A 2NREA 2CQ3A 1TL7A 3KLFA 2AEMA 2BEFA 2BQ3A 2KHDA 5IT0A 1FA0A 3N6LA 2QT7A 2FLOA 5LJ3Y 1JLAA 1EQ0A 2DD8S 5J2QA 4WIIA 1RWWB 3V81B 3Q2SC 2W2NP 1R89A 3A3PB 2KZZA 1MLAA 3LOUA 1LXNA 4CH7A 3K0JA 4PXDA 3FRZA 4CRJA 2E9RX 5B0AA 2KM8B 5E0OA 2R9LA 2ZFHA 3IBFB 5KFAA 4UOHA 1RAJA 3M2RA 4USVA 5CA5A 1TK0A 1FDDA 2VIHA 2ZHOA 3I82A 2XMJA 3W8PA 1RT5B 1WKLA 3FRYA 1H0HB 3CJRA 4H4KC 4WYLA 4HTJA 4AQYF 3DLLQ 4ED2A 5EWFA 4P73A 2CPFA 1MROA 3DRXA 1FWPA 3NAHA 3KLGA 4J5OA 3EGZA 5KFRA 3H40A 3Q23A 4CLWA 4DI6A 4DQRA 3TJ8A 1FTRA 2IM3A 5MAOA 2XHWA 3ILIA 3DI6A 1EIYB 3ULHA 4OZ3A 2X51A 3MURP 2EFOA 3BN7A 3JAMY 3HHLC 4XK8C 3KMQA 2NSBA 1G7CB 2ZH4A 2HQFA 4WXOA 2D7SA 4DXLA 4XPEA 1APSA 1UPPA 1NAQA 1BQNA 4DX8H 1KS2A 3AB4B 2XMAA 1SL2A 3OVBA 3QLHB 1N48A 3A4TA 2E9ZA 1TL3B 4IOAQ 4DPYA 4P2SA 3KG0A 4MKVA 4O4GB 4RO0A 4B9MA 3MR2A 3OV7A 2IPOB 3MUMP 3MI7X 2VHGA 1RT1A 2KYXA 4L76A 2ZKTA 3JSYA 3OJUA 4L75A 4B3RF 4YOEA 3TI0A 3GWCA 4RNHA 3EYZA 1RI7A 3MEGA 4OYPA 2EG1A 1WOOA 1NBEB 2Q6BA 1C0TA 1RTIB 2AW0A 2XS7A 1NDLA 4Q8EA 4Y34A 3T5JA 2JEIA 1MW7A 3AD7C 1URRA 4BWMA 1TZ0A 1VBYA 2V2KA 4WJBA 3QT5A 2WSCC 2O66A 1VGYA 1FKPA 3KOAA 1JJHA 1U49A 1FFGB 2AEFA 3H5XA 1WF1A 3ZTRA 1VQPS 1KKHA 2P8IA 4HHUA 3G8QA 1S6QB 5BYSA 3U02A 3OHAA 1N8RT 1S9EA 4ECYA 1N0UA 4PYDA 3ZZRA 3QFHA 1NZ8A 3B82A 5J2QB 3CULA 5L9NA 5J2MA 4KGZB 1HWLA 3US5A 3PX0A 3DKDA 3DYAA 3FQKA 4I2QA 1CJTA 1K47A 4ZP9A 4PPZA 5HROB 4W90B 2OIHA 2FHOB 1B0VA 4IRDA 4ERDA 5I4MA 1RWVB 5GAEI 2MKHA 3CJQA 2V9KA 2UXCJ 3D6HB 1BMQB 1HQUA 1QUPA 1AW0A 1ZTTA 4W92B 4F04B 4K5RA 1LQ9A 4DL7A 2HHQA 5LMNJ 2CQHA 1PSDA 3DOKA 3NGSA 4ETXA 4F8RA 2N82B 1UCNA 4C98A 1SPBP 3HX9A 3PR4A 5AJ3F 5AXNA 4J9MA 4OI0A 3B4DA 1SUQA 1GX6A 2GFFA 4L3KA 1BQNB 5D4NA 2Z58B 1IBMJ 2C42A 3ILJA 2E5GA 5HQMA 2DO4A 2Y3YA 4C0BA 5F41A 4WXWA 2D41A 2GVZA 2VPZB 5DDRC 2DRDA 4UW2A 1RT1B 4Y3CA 1UFWA 1X9SA 4DV0J 1JMTA 1YGYA 2IRUA 5F8MA 1E6VA 2XZDB 4IO9Q 1U02A 1B64A 3DLEB 3HVAA 2DY9A 3CJ4A 1WKKA 4Y2KA 5D3GA 1C0TB 3ZZZA 5CYQA 3IO1A 1QD1A 2QIFA 1SC3B 2CG8A 3R2CJ 3MUVP 1HFEL 3DGPB 1FKPB 4LF8J 1F3FA 4C8MA 1C4CA 2ASDA 1RA7A 9RUBA 2BW7A 2LYVA 1S9EB 3R6LB 2M3DA 4DX5A 3OPKA 1FX4A 1D9AA 2VDHA 2W7OA 4OYOA 4ZITA 2MQOA 2H5EA 3HSGA 5A2QY 2PMHA 4CDIA 2YWEA 3AD9C 4USTA 3EWGA 3JYTB 4EFAC 3TUPA 3KUEA 1XWLA 3DYAB 4HACA 4ICLB 1GXTA 2G13A 3UW1A 2VG5A 4EBDA 2FJDB 2UUWA 2DKOB 1Q8KA 5JMNA 2BKPA 5LSOA 3W8GA 4ZHRA 4NLXA 5CD4H 3CCVS 7FDRA 4NXNJ 4DFMA 3ZNJ1 3K8WA 2DHSA 2R2SA 4BBYA 5HATA 4FF2A 1HQUB 2O01C 2D74B 3KLHB 1WHVA 3I5CA 3NP5A 5LXRA 4NCGB 4QR1A 2OD4A 2J0SD 1Q8IA 3QJPA 5EN1A 3OL6A 2F5GA 3VQSA 3QZ7A 1XR5A 2XMVA 1YKWA 3H2UB 3T5HA 1S7IA 4F7VA 5F0UA 3GTYX 1HLWA 1FD8A 2BYCA 4K2XA 1YHQS 4B9VA 3WHIA 1SUQB 3EVMA 3Q24A 3TZZA 4ZPWR 4P7VA 2OPPA 2IJNA 1Z2ZA 4JI5J 3A8JA 2C3PA 2LQ8A 5B0EA 3ZZ0A 3W66A 1X9WA 1LW2B 2F9DA 4B9NA 3HHKA 5FLXU 1XNQJ 1S1WA 1H38A 3RBEA 2Z4PA 3KG1A 5AXMA 2R2UA 4OIXA 5HMWA 5D4PA 3TA2A 3NWGA 2CA9A 3T3FA 1CJUA 1TFYA 1BWVA 2XO6A 4LMZA 2UXCF 3D4JA 1HQ2A 2V8DA 4J9LA 4K5SA 2MMYA 5HVFA 2IBOA 5IT4A 4MFBA 2B56A 4DV5J 5CYQB 2HAIA 3TX0A 4NRUA 3TEGA 4XDCA 2IC3A 4N47A 2QN6B 3OFHA 2CJKA 3DGVA 1HIYA 2V8GA 2XO7A 3IR7B 2F4FA 2R7UA 5A8WA 2GV1A 2FGCA 1FFWB 2XM3A 3PY8A 1QDUB 2AMCB 4NCBA 4WZMA 4KT0C 2YNFA 1M1HA 1TAUA 1JQGA 3GR1A 2R7VA 2ZH7A 4F50A 3RR7A 3M8SA 2V8PA 1IBMF 1HWIA 3K5MA 1YTYA 3QJJA 1RWKB 3NS6A 1NXIA 2CG4A 2VB6A 1LFPA 3HSJA 3U27A 3Q83A 2VDIA 2MJUA 1R8BA 3M6WA 2CJ9A 1B70B 1Y9OA 3IC1A 2LA4A 3LPEA 3WBZA 1X4DA 4FVCA 5F8LA 2Q3PA 3CCQS 3JTNA 4HACB 1NDCA 3AAWB 2HNYA 4ZIWA 3OT9A 1SIWB 3NCQA 4CYUA 3FGVA 3W3SA 4YB5A 5KG1A 4KBIA 3NNHA 2W1BA 2W4CA 1V5IB 1TL4A 4ZVPB 5DLFA 1U1PA 4DOZA 1HBMB 4FVMA 4I6AA 2CNNB 3ENQA 3HF5A 2RE1A 2YKAA 4LF8F 2DRAA 1QSYA 4ZJOA 2YQ3A 1CS4A 4M5KA 1T9VA 5HBMA 4I6YA 3KJVA 1IXKA 2VFTA 3T6JA 3R8YA 3ONQA 2ZBRA 4F0MA 5B0GA 1RAGB 2OPPB 2HHHF 3BO4A 2VA2A 1U4BA 2BABA 2LEPA 4LF1A 3D1QA 1NPPA 1F5AA 4F4XA 1PJ7A 4AUKA 3A3OB 3BBCA 4LFCJ 4NLWA 4GC6A 1NJIT 3RRKA 1S1WB 3SQGA 2M5YA 1R8CA 1TTHB 1NO8A 1HBOA 5KFYA 1O6XA 5KFCA 3Q8YA 2WZ1A 3GSIA 4NI2A 1X0PA 4HI2A 1ZAWA 1CJUB 1NDPA 4NXNF 3VTIA 4N5SA 2A10A 5E3PA 4C0HA 1VC0A 4QWBA 1S72S 1O0PA 3BKTA 1NJXA 1UFLA 3ZNUA 3RRGA 2B9YA 3BYPA 5G4DA 2ZM6F 1F2HA 3KK1A 1IVZA 4DS4A 3GR0A 3ZXWA 2IC3B 4QR0A 1RTHA 3OLBA 1VRUA 2FZGB 4M5DA 4HTIA 3FVYA 3TNVA 5A8WB 4CP5A 4I0WA 4CLLA 3SDEB 4RW6A 4C7QA 2YNFB 1U6BA 4LT6A 2OSQA 2RRBA 2F1FA 4LUBA 2IY5B 1DLOA 1VQSA 2D1CA 4DSEA 3DNCA 2N4CA 3VAKA 2NYIA 2J9CA 4OZ1A 3PRDA 5D0HA 1M90T 3SCIE 4FXVA 4U9RA 3G6XA 1NH8A 2UUCF 4FF1A 4TVAB 5KG0A 2W4DA 1RT3B 2P6TA 2BJ9A 1FJCA 2UUAJ 2RDIA 2E66A 2HNYB 4W4MA 1HHSA 1XR6A 4CYUB 5GAEU 4RU9A 4QYRA 1N5YB 5KFTA 2NS1B 4DV5F 4FXDA 2XY5A 1RAAB 3MM5A 3U1LA 4QQBA 3EM1A 1RABB 4KPCA 4HLBA 2VICA 1N32F 4IG3A 1C1CA 2YWKA 2J7KA 2DPIA 4GKJF 4JI2J 1K9MT 3QBCA 1WUUA 2V6AA 2GO8A 2VOPA 4ZS6A 4V19X 2DH8A 3KJVB 4FF3A 2AYGA 2VPYB 1S57A 2QG9B 3MF5A 4DDFA 2J7WA 3IM8A 4K4XA 2EI5A 1VRQC 3A3NB 4O3PA 4C2MA 4NZ6A 3PW4A 2ALZA 2GIQA 4E0DA 4PZVA 3LGNA 4EU0A 2M88A 2FJVA 1H3DA 1HBOB 1J5OB 2UVUA 1LW0A 3UE2A 4J7CA 4NI2B 4FN5A 4OX7A 4WKYA 1TL1A 1FVSA 3LWMA 1CLFA 4NL5A 4NLVA 1GMUA 1NK6A 3M9MB 4U7UD 2BJEA 4OQJA 4UQTA 4PQAA 1ITPA 1VRUB 1OIAA 1YJNS 3KJFB 4M5DB 2Q66A 4C3MA 2VG6B 3WX4A 2HLUA 5KT5A 2ZITA 1R8HA 2ZE2A 1RHUB 1DY3A 5HK4A 1MSWD 1HQEA 4RW6B 1EJ7L 3B54A 2H51B 4N76A 1KOOA 1L3UA 3TRGA 4ZN3A 4J9RA 3W62A 1DLOB 1CPZA 3JSBA 4DX7A 2ATLA 1S7HA 3J7ZT 4WTOB 3EX7B 2XMMA 5DG8A 1ZPWX 2DISA 2MKSA 1KVKA 2ZZMA 2Y1LB 2JZ5A 4KO0B 3D0HE 1DZ5A 2QL9B 1U1MA 2ZH5A 1RCOB 4M5JA 3SCJE 4LF9J 1KN6A 3FEYB 1RT4B 3TZXA 4OI2A 3PRVA 2E1AA 1VJQA 2GNKA 2BE7D 3MM9A 4UOFA 2MY7A 4NEZA 4TLQA 3VQTA 4DV2J 1FNOA 5LT5A 1TFWA 3W2WA 4IG3B 1KEKA 1KVJA 1C1CB 4CCHA 1U8SA 3OQ2A 2FIUA 4EYHB 2QYCA 1UW9A 3GV5B 1X31C 5C2CA 4K50A 1HNZJ 5KAKA 1S4EA 1NNDA 2YKOA 2BR0A 3CC2S 1FRLA 1PIEA 3V2UC 1B7YB 1L3SA 1A9NB 2J0XA 4I67A 4RNMA 4ENOA 2NR0A 4A8FA 1U2FA 2AZ3A 1F3VA 1M5VC 2XYGB 1WDTA 1FXDA 5B0CA 2HZAA 1ZM2A 1X4FA 3HJVA 1G6BA 2AKWB 1MN9A 3ZTSA 2IJFA 1SQFA 4JI3J 4DEZA 2DIUA 4HI1A 3LPYA 4ZVGA 3EGVA 1Q8LA 2YWFA 1D1UA 2F40A 2BACA 2B4OA 1G1XA 2HFUA 1QJHA 2VF3A 3G9CA 4DZ6A 4DL3A 4JI2F 4AXIA 5IV4A 4O3NA 2A2DA 1Q16B 2DNLA 5B0DA 1H2UX 3D54A 2WTFA 1U45A 5CHCB 1UAWA 1H74A 3H90A 5IM0B 5LM7E 4YR0A 1JNRB 1SV5A 2N3OA 4OJHA 3QRRA 2VPXB 5DG9A 3LTOA 3JS9A 3LWLA 2ZUGA 4CO0A 4CM2A 4N8OA 4NLYA 3HT0A 3NXZA 2C2KB 5L1KA 1T05A 1S1XA 2PDAA 2HBZB 4BLGA 2HHXA 1Z2LA 2XC9A 4FYVB 1YITS 4OX6A 4C8NA 2XTJP 3TARA 1FDBA 4ITSA 2FZKB 3R5GA 2GO9A 3HP6A 4DPXA 4UY85 3NNCA 3M6VA 4KGMA 4FF4A 3HSDA 3M2VA 1AROP 2V4RA 1SXLA 2B9WA 1FRMA 3NY0A 4QJVA 3BM7A 1Q78A 3W2WB 4Y2CA 1S6OA 2OAUA 1XBWA 2RILA 1BY9A 3CEDA 3KJQB 1M5KC 2VFSA 2YH0A 3PW7A 1NSKL 3H25A 2FY1A 3HKWA 5DM7Q 3JXOA 4ANEA 1A7GE 2CPIA 3QO9A 2KH9A 3N6MA 1RU2A 1XR7A 2UUBF 4WPAA 1HBUA 3GJTB 3G6YA 4LVOP 1TELA 3SSRA 3MMCA 3AB2B 4OL8A 3GIMA 2ILYA 4FDFA 3THTA 2YNHA 4LF9F 1KTQA 1RAFB 4OMFG 3MFIA 2RQKA 3M1VA 3GV7B 5EX0A 1R31A 3H4DA 5LMUJ 2VQFJ 1RISA 2QLWA 4IH6A 4DR7J 3IN5A 4KC5A 2PEBA 1UZDA 4QW9A 3GONA 1WD6A 2CXEA 4ZPCA 1FRHA 4X4RA 4C8OA 2HHWA 5KFMA 2ZJRQ 1TKXA 3C19A 5C7PA 1BE4A 1WSRA 5HQLA 4LVNP 2E1CA 1S9GA 2FB0A 3O6QA 2K7JA 2LMIA 2CPZA 4DU7A 4NCAA 1NKBA 3DLGB 3GYNA 2OH2A 1PAUB 2M9KA 2RIJA 2I0XA 2QJ3A 3MEDB 4DHVA 1LWEB 2NLWA 3JTPA 3MTKA 5L8RC 4O23A 1VBKA 2QLXA 1NK8A 1SV5B 1G4CA 2LU2A 4OHXA 3R7NB 3BDEA 2BJ1A 4RLEA 2MZSA 2AD9A 4K4UA 4X4NA 3CO9A 1EHWA 3BGUA 3GFXA 1T05B 1P8GA 4TQSA 1S1XB 1N5SA 2HK3A 2VODA 1TKTB 2V94A 2KB2A 5KFXA 2UXDJ 1SH3A 5FLXY 4GO5X 2GIFA 4MYUA 2X1FA 2RHSB 4DR3F 2WSFC 1WC6A 4HHJA 3VZIA 1I3OB 1MMDA 1T03A 4QPTA 4DFKA 1F9EB 5L1IA 2ZVSA 1U1QA 1RAOA 4WK3A 1JLEA 1KNZA 2RUGA 1OY8A 1T95A 2RJZA 1DJ0A 5C42A 2I2YA 3CCLS 2IVYA 3HZEA 2IA6A 5HVHA 1VRTA 3RYLA 3T1HJ 1P1LA 4ZCIA 2XSJA 2J9DE 4AE5A 2K8GA 3M8PA 1M5HA 1Q82T 2F4VF 3I0RA 4ECUA 4PABA 5DZ6A 1HBUB 2D3O1 3BSAA 3Q8SB 3MMCB 4H54A 4UQGA 2K3IA 4KAIA 1KONA 3IBCB 4FYWB 2LVWA 2ZWPA 1YRTA 3M1VB 1U1RA 1RT6B 2J76E 3Q22A 4IH5A 1WHYA 2LP4A 4TXSA 3NAIA 3RZAA 2F65A 3AA8A 5E3AA 2J6SA 4I1TA 4X65F 3WX8A 5KG5A 1TKXB 5HJYA 4F36A 1R0BG 1JKHA 3CXCR 4URGA 1S9GB 4F2RA 1SL0A 3AFGA 2F8EX 2PE8A 1VCTA 1F5CA 2XYPB 4GKKF 3FNNA 2RMLA 1K73T 1TV6B 4JV5F 1WG1A 2VQEJ 3NG8A 1UA0A 2AGOA 3NMAA 1T0TV 1FRXA 2C2NA 5DM6Q 2YX1A 4JUZA 4PG6A 1NSAA 3OXGA 4QWEA 1KQFB 4G3IA 1R0AB 2XMUA 1HD1A 4J37A 4DF8A 4ED1A 3I9ZA 3BREA 4C3KA 1YDLA 4I2PA 2VFVA 3UD4P 1YJ7A 2V69A 1IR0A 4KV8B 3G82A 2Z2ZA 2YY3A 2AF6A 1HNVA 1KOHA 5LMUF 2BM1A 4DR7F 1P9YA 3U7JA 5KFZA 4X4OA 4DQSA 1XMQF 3A13A 4L6V3 3T1AA 3BO3A 4YB7A 3P5BP 4DUYJ 2VBZA 1JJ4A 4MTPA 2CZ9A 2HIYA 3P49B 4A8XA 4QU7A 4TNOA 4ZCLA 1UEUA 4IH7A 1ZS6A 4WU3A 4DSLA 3MMAA 5CCMA 3MUTP 2DH9A 1S79A 1HNIA 3M05A 1HA1A 1DQ9A 4DCOB 1JLEB 4NA3A 2V2QA 1UWBA 4J91A 5C42B 4DCJB 2CJYB 1UVIA 4ZPBA 1VRTB 3MPVA 3KK2A 3LQVA 2JLGA 4KHPJ 4HEA9 4HHHA 4DUTA 2AGPA 1N0VC 4CO2A 2JOQA 4K8RA 1S1TA 4OHWA 4QBUA 4B3SJ 2B4UA 2DNMA 2JWNA 4NLTA 1RHRB 5F9NA 2FGOA 2YNIA 4CLPA 1VQ7S 4X4QA 1N34J 5CD4A 4ZA1A 5HL7Q 1NK4A 1IBCB 3RUBL 3QWPA 4I6WA 1NHKL 1MWQA 2I8EA 2I6WA 1WHWA 4TN2A 3MTJA 2LQBA 2QSWA 1JKHB 2WB4A 2KT2A 1WC3A 3CJ8A 3M9OB 2XMWA 3VVUA 5IT9U 3NGRA 3CUNA 2NCKL 4OX9J 2W4PA 4PQUA 4NRTA 3TJAA 4MIBA 4OYWA 4Y0FA 1E6YA 3N6NA 1ZAXA 1WG5A 1S6PB 3ILLA 1U0SA 2Q6CA 2HNDA 5L39A 3AA9A 3L4BC 4YR2A 4H4MA 2ZBQA 2OJ3A 4I2PB 3R7SB 3H5SA 5E3QA 3LP0A 1GXUA 1AZSA 3PIOQ 1VC5A 2D9OA 2F8HA 4QWDA 1RTDA 4AL6A 3EPGA 1TAQA 3G82B 2ACMA 2PD1A 2UP1A 2CPYA 2QSFA 3C2PA 4AFFA 2OPQB 1RWUA 2B4VA 1EARA 5IC4B 2F8MA 1OYEA 2RRNA 2MXYA 2PMWA 1NHVA 2C22A 1JLBA 2XNRA 1AUDA 2HVIA 5D8HB 1R6VA 2V4QA 3QGIA 4ECVA 2YTCA 3UD3P 3MMAB 4KGKA 2DYAA 2ZZTA 1HNWF 2R8GA 2QO3A 3UWTA 1QSSA 1L3TA 2DGOA 4Q5VA 3DM2A 1UWBB 1VLOA 1YJTA 3VGSA 2H48B 3KK2B 4UY8T 2H4YB 2DITA 3LP2B 4RW4B 3V4IA 1U47A 4DJBA 5HLFB 2IRXA 4ZK7M 4YUDA 2CNLB 3DU6A 2L9WA 1X5OA 4FBTA 1WF0A 4CTAA 4O4RA 2VUGA 1W2BR 2VBYA 1DARA 3MD3A 2H54B 4BCAA 2XZTB 4QWCA 2OPSA 4Q2LA 2GS8A 3M6UA 2CPJA 4AD6A 2WK4A 2MGZA 2C1EB 2E29A 3OUYB 2W25A 2VL1A 3FCVA 5JXSA 3J7YI 1VQOS 2M7SA 3BGOP 2IYGA 2YH1A 5IV3A 1SB6A 2J0QD 3GIKA 1BGXT 3MEEA 1PBAA 1GH8A 4DV6F 5C5JA 1JLQB 4OYIA 3EXCX 5I42B 2CDRB 4LR9A 3PX6A 4R5PB 3BR9A 3PEJA 2QMUB 1XEZA
chains in the Genus database with same CATH topology
1HHQA 1EHWA 2HVDA 4ANCA 3FC9A 3Q86A 3NGSA 1NSQA 3ETMA 2BX6A 1W7WA 1F3FA 1UCNA 4UOGA 3EVWA 5CABA 3EMTA 3NGTA 3VVTA 5BXIA 1PKUA 3VGSA 4DUTA 3FBCA 3FBEA 3PJ9A 1HIYA 2CWKA 1MN9A 3G2XA 3EJMA 3ENAA 3EM1A 3BBBA 3PRVA 4O0NA 3ZTSA 4KPCA 4EK2A 5CAAA 3EICA 3ELHA 1HLWA 1NCLA 1NPKA 4F4AA 3VGTA 4UOFA 1XQIA 3Q8UA 2DXDA 3FBFA 2DXEA 1PAEX 1K44A 3VGUA 1LWXA 4CP5A 3EVMA 3B6BA 3GP9A 4C6AA 1NSPA 1U8WA 3FCWA 4DZ6A 3DDIA 4S0MA 1XIQA 1NB2A 3DKDA 3GPAA 1B99A 2HURA 4UOHA 3FBBA 5C7PA 1BE4A 3Q83A 3Q89A 3ZTPA 1NLKL 3Q8VA 3B54A 3WX8A 1NHKL 1S57A 3FCVA 2ZUAA 2AZ1A 3EVOA 4F36A 3BH7B 3EE3A 3BH6B 1NDKA 1NSKL 1WKLA 2DXFA 2HVEA 1MN7A 1BHNA 1ZS6A 4FKXA 3ZTQA 3BBCA 1S5ZA 4WBFA 3FKBA 3ZTOA 2VU5A 1NUEA 1LEOA 4ANEA 4W98A 4HR2A 1NDCA 2B8QA 2DY9A 1NDLA 3MPDA 5IOLA 1B4SA 4ENOA 1F6TA 2B8PA 4DI6A 3JS9A 1BUXA 1WKKA 2AZ3A 3VVUA 2DYAA 3NGRA 3VGVA 1KDNA 4FKYA 3NGUA 2NCKL 3BBFA 3Q8YA 3R9LA 1VYAA 3ZTRA 1NDPA 4ANDA 1WKJA 2BEFA 1S59A 1JXVA 3L7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HHQ A;  1EHW A;  2HVD A;  4ANC A;  3FC9 A;  3Q86 A;  3NGS A;  1NSQ A;  3ETM A;  2BX6 A;  1W7W A;  1F3F A;  1UCN A;  4UOG A;  3EVW A;  5CAB A;  3EMT A;  3NGT A;  3VVT A;  5BXI A;  1PKU A;  3VGS A;  4DUT A;  3FBC A;  3FBE A;  3PJ9 A;  1HIY A;  2CWK A;  1MN9 A;  3G2X A;  3EJM A;  3ENA A;  3EM1 A;  3BBB A;  3PRV A;  4O0N A;  3ZTS A;  4KPC A;  4EK2 A;  5CAA A;  3EIC A;  3ELH A;  1HLW A;  1NCL A;  1NPK A;  4F4A A;  3VGT A;  4UOF A;  1XQI A;  3Q8U A;  2DXD A;  3FBF A;  2DXE A;  1PAE X;  1K44 A;  3VGU A;  1LWX A;  4CP5 A;  3EVM A;  3B6B A;  3GP9 A;  4C6A A;  1NSP A;  1U8W A;  3FCW A;  4DZ6 A;  3DDI A;  4S0M A;  1XIQ A;  1NB2 A;  3DKD A;  3GPA A;  1B99 A;  2HUR A;  4UOH A;  3FBB A;  5C7P A;  1BE4 A;  3Q83 A;  3Q89 A;  3ZTP A;  1NLK L;  3Q8V A;  3B54 A;  3WX8 A;  1NHK L;  1S57 A;  3FCV A;  2ZUA A;  2AZ1 A;  3EVO A;  4F36 A;  3BH7 B;  3EE3 A;  3BH6 B;  1NDK A;  1NSK L;  1WKL A;  2DXF A;  2HVE A;  1MN7 A;  1BHN A;  1ZS6 A;  4FKX A;  3ZTQ A;  3BBC A;  1S5Z A;  4WBF A;  3FKB A;  3ZTO A;  2VU5 A;  1NUE A;  1LEO A;  4ANE A;  4W98 A;  4HR2 A;  1NDC A;  2B8Q A;  2DY9 A;  1NDL A;  3MPD A;  5IOL A;  1B4S A;  4ENO A;  1F6T A;  2B8P A;  4DI6 A;  3JS9 A;  1BUX A;  1WKK A;  2AZ3 A;  3VVU A;  2DYA A;  3NGR A;  3VGV A;  1KDN A;  4FKY A;  3NGU A;  2NCK L;  3BBF A;  3Q8Y A;  3R9L A;  1VYA A;  3ZTR A;  1NDP A;  4AND A;  1WKJ A;  2BEF A;  1S59 A;  1JXV A;  3L7U A; 
#chains in the Genus database with same CATH topology
 2V0N A;  3R2D J;  1HYS A;  5GAG I;  3J7A N;  1AA1 B;  3T9Z A;  1WSV A;  4PQU B;  4X62 F;  3PJ9 A;  3VAG A;  5J2P A;  4KHP F;  2DCU B;  5KT3 A;  4O3O A;  2J6T A;  3S7R A;  2MZR A;  4B9U A;  4ES1 A;  4ES2 A;  1BD6 A;  4H4M B;  2AJF E;  3GII A;  2BQU A;  3V4M A;  2DH7 A;  4CT8 A;  4MH8 A;  1ELO A;  3LP0 B;  1AZS B;  2V9W A;  3ADA C;  3AOC A;  1IBL J;  1RWX B;  3GB0 A;  3AXM A;  1S10 A;  4DV3 J;  1U2C A;  1SKW A;  2I5J B;  1ZOT A;  2AYE A;  3RTV A;  3EVO A;  4RW7 A;  4EI2 A;  5FD1 A;  3M4X A;  4XTT A;  1UEK A;  3K5N A;  3QPI A;  4MKY A;  2E7X A;  3GJS B;  4OHV A;  3RU0 A;  2KT3 A;  1NPR A;  2ALY B;  3N4W A;  1C4A A;  2FLN A;  1WWH A;  4B9T A;  4U7U K;  3BJY A;  1FCA A;  5IQ6 A;  2O1P A;  1WG4 A;  2MQP A;  4EBC A;  1FRJ A;  3G71 S;  5KG4 A;  2XQC A;  3GFZ A;  1KDN A;  4CLT A;  3ISN C;  2P9G A;  4OI1 A;  3LP1 A;  3QT8 A;  3CC4 S;  2W2M P;  1RUS A;  3PVX A;  1GMW D;  3ZO7 A;  4JV2 A;  4LF6 J;  2MLZ A;  3VVT A;  2BE2 B;  3DM2 B;  4RX6 A;  3HD2 A;  4USJ C;  3DRP A;  3I4H X;  4OZ2 A;  3V4I B;  2RD5 C;  4ELT A;  1FDA A;  4OJ3 A;  4CTA B;  3OHB A;  4KGV B;  4ZVU B;  4NX9 A;  3OR1 A;  2ZD1 A;  2MHE A;  2ROE A;  1N33 F;  3F0N A;  2OPS B;  4OYM A;  1SKR A;  2DR6 A;  2R7Q A;  4U8Y A;  4DR1 J;  1SJR A;  5E2Q A;  4LSZ B;  3TJ9 A;  2MGZ B;  1WI6 A;  3VCD A;  4FKX A;  1XN9 A;  3K57 A;  3TX8 A;  4PEO A;  5IZH A;  1OY6 A;  2BUN A;  1EQM A;  4OJ1 A;  3GCX P;  2J6U A;  1RB0 A;  3MEE B;  4DL5 A;  3D6T B;  2OSR A;  3NMR A;  2EEY A;  4JV1 A;  4A8S A;  2C2M B;  2PGC A;  2E7W A;  2I38 A;  3T5L A;  2ZOM A;  1HI1 A;  3DOM B;  4L72 B;  3VAH A;  4ID5 A;  4YME A;  1VBZ A;  1WAC A;  1NCL A;  1HD0 A;  2H9Z A;  3SXL A;  5J2P B;  2R8J A;  4Z2X A;  3NOG A;  4KHR A;  3GG0 A;  2D3O R;  2HFN A;  1HHT P;  3IWL A;  1MMN A;  2J7U A;  1QE1 A;  5KG3 A;  4S0M A;  1R8P A;  3N01 A;  4OI6 A;  3FK4 A;  3K17 A;  1LNQ A;  1S1V A;  1HPZ A;  1OJ4 A;  2NPF A;  3UO0 A;  5HMZ A;  1SC6 A;  2WW8 A;  4LIR A;  3M30 A;  3I32 A;  3FQL A;  1VQL S;  5KFN A;  2BW2 A;  2BRK A;  5A6P A;  4RNO A;  3M8W A;  5A0Y A;  2OHD A;  1Y5I B;  1WEL A;  3R1H A;  3PZP A;  2K2P A;  2ZOF A;  4PUO A;  3I5B A;  4DV1 F;  2OKQ A;  4Q2M A;  5EDW A;  3L7U A;  3J7A 1;  2IAJ A;  5EHH A;  3KUH A;  3OXL A;  4X66 F;  3MM6 A;  5I3U A;  2W7A A;  3BQ2 A;  4DCP B;  3TQE A;  4XPC A;  2HGM A;  4B02 A;  3D6F B;  2BJ8 A;  4O0I A;  4B17 A;  1U09 A;  3FCH A;  3NEK A;  2R7T A;  1IUJ A;  3DRP B;  1X4A A;  3VGU A;  2ZH9 A;  3OFE A;  1KQK A;  5D0G A;  4OZL A;  4JP8 A;  3GLJ A;  4ES3 A;  1LXJ A;  1UJ4 A;  2MPU A;  3OR1 B;  2HFO A;  3CE8 A;  1BLU A;  1IBL F;  4I64 A;  2FJX A;  4LF7 F;  3K7R A;  1L5U A;  1GTH A;  4DV3 F;  5MLC V;  2NXN A;  1Z4U A;  4IUF A;  3CJ3 A;  5DQG A;  4A8Q A;  4LBP A;  1P27 B;  2KRB A;  1GQE A;  4NLD A;  2VON A;  4DQQ A;  4CO4 A;  3QJL A;  2EWH A;  2QL7 B;  4ZLN A;  4TKT A;  1AYE A;  2CAJ A;  4OV6 A;  1PYS B;  2CQI A;  1KTV A;  2B9X A;  2DR8 A;  5DO2 A;  4LRB A;  1SKS A;  2L41 A;  3BYR A;  1TKD A;  3CDB A;  4LF6 F;  1VIO A;  2NQP A;  3L9Z A;  4KB7 A;  1VBX A;  3MR5 A;  2CPE A;  3AH6 A;  3C66 A;  3H8Y A;  2RDD A;  4JI6 J;  4K0K F;  4OI4 A;  2GQC A;  1Q79 A;  3SQO P;  2IIH A;  1AUS L;  4K4T A;  4ID5 B;  5KG6 A;  3UR0 A;  3LF0 A;  2DR9 A;  1N5T A;  2ASY A;  1BC6 A;  2KFY A;  1FJE B;  2C2O B;  4B3T J;  3G96 A;  2PO4 A;  4JI7 J;  1FKO A;  2OGU A;  1CBK A;  2OFG X;  3AT1 B;  1QE1 B;  1YJR A;  2IMW P;  3HSZ A;  2Z2M A;  2O5D A;  3VF0 B;  3ET6 A;  4WIQ A;  2B9E A;  4DR1 F;  2N3L A;  4G6V B;  5C24 B;  4WTY A;  5F3T A;  2HFV A;  2HQ3 A;  1TKZ A;  4RR5 A;  1IQT A;  2I1R A;  3GFH A;  4P71 A;  5K8O A;  3HM9 A;  5D77 A;  4DR5 F;  4OHY A;  1C2P A;  3M30 B;  2OPR A;  2RVJ A;  1V3R A;  1YJV A;  5K9F A;  2HZV A;  3QLH A;  1X8D A;  1FWK A;  1WEX A;  1B7F A;  4C4W A;  3CD6 S;  3O3L A;  5L1J A;  3ZZY A;  4LIW A;  4PUO B;  1A0O B;  1U0H A;  4LF5 J;  1Y5N B;  4QIW D;  5D0R A;  1ZYQ A;  1YRX A;  2V34 A;  2HQI A;  1B3T A;  3FBE A;  1OWX A;  2IM0 A;  3CF5 Q;  1S0V A;  3PYE A;  2JDJ A;  2DR5 A;  1RT2 A;  1PJ6 A;  3IWX A;  4N7T A;  5I3U B;  4FYY B;  4U95 A;  1D9F A;  2ZJQ Q;  4F26 A;  3OTO F;  3DXS X;  3CMA S;  4IYQ A;  1ZZF A;  1T9U A;  4LQ3 A;  1T94 A;  4EZ9 A;  1NJZ A;  2ZHB A;  2V5H G;  4L74 A;  4ECQ A;  4DWI A;  2UVV A;  4KRW A;  4C8K A;  2QEX S;  2RQC A;  1R43 A;  4R8U B;  1W26 A;  2JFK A;  3MPY A;  4J9N A;  1S6Q A;  1FK9 A;  2DGT A;  5IC6 B;  5HN0 A;  2BJ7 A;  1YJ9 S;  3OSP A;  3UCZ P;  4DR4 J;  4A8M P;  2KFN A;  1ICE B;  3SSQ A;  3QZ8 A;  3J7Y U;  3E2E A;  2DHH A;  1SL1 A;  3NGU A;  1VI7 A;  4H4K A;  4ZJL A;  2YQ1 A;  2RS2 A;  4NLU A;  4FZV A;  2R7R A;  1X4E A;  1DHM A;  2FPH X;  4K59 A;  2F7V A;  2WVF A;  3NL0 A;  1IBK F;  3P6Y C;  5CYM A;  1NK9 A;  3CDE A;  3SFU A;  3MM8 A;  4ILM A;  2AWZ A;  5CAA A;  3AJ1 A;  2EG2 A;  3EIC A;  4G1P A;  2OUG A;  3U1N A;  5HRO A;  3G8T A;  4USM A;  5GAG U;  3TW0 A;  2GMJ A;  1WC4 A;  4DN0 A;  1EZZ B;  5AE2 A;  5EWG A;  5DET A;  4MK9 A;  4LFB F;  1T02 A;  2HVH A;  3D1O A;  3BGR B;  4X64 F;  1YRU A;  2CQG A;  2VKZ G;  4QW8 A;  3GE9 A;  2NSC A;  2K7K A;  1RWP B;  1IKV A;  3CDU A;  2H3E B;  3FEZ A;  2C28 A;  3FBB A;  4G1I A;  2JEG A;  1FKO B;  1VQ4 S;  4M8L A;  3WIU A;  4RUA A;  3QAE A;  2DB1 A;  5KFQ A;  2B5J A;  1RSC A;  4WFN Q;  3ET6 B;  2KL8 A;  3M8Q A;  1Q7Y T;  5M2R A;  4JYA F;  1AXQ A;  1N36 F;  3JQJ A;  1TKZ B;  4Q7A A;  2LKZ A;  1EET B;  4M5N A;  4P10 A;  2J0W A;  4LR7 A;  5KFU A;  5SZT A;  2Z57 B;  4IR9 A;  3H20 A;  1Y3J A;  4KSE B;  4AND A;  4RU2 A;  2OPR B;  1JXV A;  1DFD A;  2H5I B;  4KJI A;  1W7W A;  2U2F A;  3QID A;  3PCO B;  4ECR A;  2L9N A;  1FE0 A;  3C14 A;  4RKU C;  4OYX A;  4NPO A;  1U0H B;  2NZC A;  2FC9 A;  5F8J A;  3N5B A;  2XGQ A;  4M5G A;  2XUL A;  1DQA A;  1RT2 B;  1CJK A;  2OFH X;  3DLE A;  2V68 A;  1Y00 A;  1M5S A;  1K1Q A;  4IFY B;  5IT9 Y;  3DLB A;  1Y5L B;  1I94 J;  2ZH6 A;  2XMK A;  1FWL A;  3A8K A;  1UJ5 A;  3DGP A;  3BGF A;  4K4W A;  2DNK A;  2CQ4 A;  2HNZ A;  3MAA B;  1S6U A;  1FK9 B;  1PIL A;  3A12 A;  3MZI A;  2UVR A;  1R6Y A;  2FQQ B;  3UCU P;  3MDF A;  4HDG A;  1ZET A;  1UA1 A;  4DR6 F;  2KKH A;  2FHK A;  4HYK A;  2R8I A;  2CPD A;  3R9L A;  2G2Z A;  3V6K A;  3T5K A;  4RZR A;  3ZC4 A;  2CRL A;  3BV8 A;  1KBR A;  1HHQ A;  2KHC A;  3TVY A;  3GYG A;  3KMS A;  4LF5 F;  1CEZ A;  3JYT A;  4PYA A;  2BBE A;  2DGX A;  4PWD A;  5CYM B;  5ETR A;  1XQI A;  2ZNY A;  2DNZ A;  3MM8 B;  4ICL A;  2FVR A;  4DF4 A;  3G8S A;  2NUH A;  3OVA A;  2CAD A;  1UEV A;  1U25 A;  2DIV A;  1GMV A;  2JVR A;  3HHE A;  4ZPA A;  3HHL B;  2PFF B;  2XLI A;  5E33 A;  1IKV B;  2ZUA A;  5HP1 A;  3KLH A;  2DXF A;  3R5J B;  2FLP A;  3E8O A;  4NCG A;  5F8H A;  4P52 A;  2J9E A;  5F9L A;  1S49 A;  2CQP A;  1IR2 A;  4MKB A;  3J81 j;  2HZC A;  2GAG C;  3BSC A;  4P72 A;  1SJF A;  2DNH A;  4NLG A;  3J81 U;  4ZMM A;  2B5J B;  3TA0 A;  1CG2 A;  1FRI A;  1H7W A;  3M8Q B;  3I96 A;  5B7W A;  2GGP B;  4J9U E;  3VAI A;  2DJW A;  5B0B A;  4R0E A;  1RTJ A;  4P6Q A;  4MK7 A;  4I7F B;  2HBQ B;  1MWZ A;  2RRA A;  3BDP A;  4ETZ A;  3TUJ C;  3FC9 A;  1T8E A;  2KN4 A;  2BOA A;  3LGH A;  1BXN A;  4IR1 A;  5DQH A;  1LW2 A;  3NGD A;  2RSQ A;  5EWE A;  3PJX A;  4RWW A;  3C14 B;  2JLE A;  2YXL A;  4F4W A;  2P9C A;  2AU0 A;  1XIQ A;  1CJK B;  1AB8 A;  3GZ7 A;  2D69 A;  1RWO B;  4L3N A;  5T7L B;  2XI3 A;  3PW2 A;  2FC8 A;  2PC6 A;  2MSS A;  2RDJ A;  3J7Z 5;  4ILL A;  1VQ9 S;  4KPY A;  1P6T A;  1S5Z A;  2KVQ E;  3IMQ J;  4WFB Q;  1SH0 A;  4I69 A;  2RQ4 A;  3KHR A;  4K4Y A;  3JQK A;  2HNZ B;  3KFW X;  5LL6 d;  3PFO A;  3H2L A;  3IR6 B;  3TUI C;  3CJ0 A;  2UZA A;  3BBF A;  2HQD A;  3CIM A;  4JI4 J;  4EYI B;  4NXM J;  5ETO A;  1UFK A;  5HAN A;  4CI0 B;  2KG1 A;  1U48 A;  5AT1 B;  1REV A;  3K5L A;  2HG4 A;  5L38 A;  1FES A;  3B4M A;  1S4F A;  2JNJ A;  1HR0 J;  1OYD A;  2HWT A;  4FPR A;  1RHJ B;  4PWD B;  3J80 Y;  2R4F A;  4C8L A;  5K8N A;  2IYI A;  4DFP A;  2LEB A;  5LSR A;  4CZC A;  1Y7P A;  4USK A;  2OO4 A;  1Q5Y A;  2EVZ A;  2UVW A;  5ADZ A;  4EBE A;  3ITH B;  1XNR J;  3OVS A;  1YG0 A;  1BHN A;  2QV6 A;  1RP5 A;  3ZTQ A;  2W2Q P;  2YPZ A;  1HBM A;  1XTZ A;  4X4T A;  2YVS A;  5HP1 B;  3UVJ B;  2HRT A;  3LAM A;  3AJD A;  5F8G A;  2HHP A;  4LBI A;  4ZOS A;  4ECS A;  1UVL A;  3R5D A;  4C3L A;  3WC0 A;  2H5J B;  4HT7 A;  4ILR A;  2A0F B;  2M8D B;  3QIP B;  3MPW A;  2HGN A;  3QT7 A;  4AL7 A;  4DSJ A;  2ADC A;  4IRC A;  5BR8 J;  2BZ2 A;  4KIA A;  4P74 A;  3R5C A;  4M5H A;  2BDP A;  1RTJ B;  4MIA A;  3NGT A;  4ZJQ A;  3BQ0 A;  4DFJ A;  3EXY A;  4F4K A;  4OYA A;  1RLD A;  4PXC A;  3FZ2 A;  2ZHA A;  2W8L A;  1KHV A;  5DQI A;  2RHQ B;  2MKI A;  5IWA J;  4LF4 J;  2B6A A;  1FF2 A;  4B3O A;  1VIS A;  2XS5 A;  2XHC A;  5LSL A;  3KHG A;  1LFW A;  2HHT A;  3KHL A;  2YQ0 A;  1W25 A;  5HJX A;  3UI3 A;  4TLR A;  3LH2 S;  4WU2 A;  3D66 A;  4ZCK A;  4C48 A;  3TP2 A;  1S0M A;  1YQH A;  1UVJ A;  1SCJ B;  3VAL A;  4IDK B;  4IFV A;  1B0P A;  1FJG J;  1V6H A;  2FVC A;  3QSY B;  1TUW A;  2PI4 A;  4NML A;  5LMN F;  3OL7 A;  1HNX J;  2J8S A;  4OZ5 A;  4BS2 A;  3HZG A;  4JI8 J;  4FYD A;  2RKI B;  3CCW A;  2C3M A;  4QPX A;  3CNQ P;  1NM2 A;  3SDE A;  2V67 A;  1GFW B;  1OO0 B;  4PG4 A;  3M8R A;  2M2B A;  1WEZ A;  3SCK E;  2W9A A;  3E01 B;  4QIV A;  4PRF A;  3T41 A;  2C3Y A;  1JNZ B;  2DNG A;  1WDD A;  4OZN A;  1MU2 B;  3IGN A;  2EKY A;  1REV B;  3HK2 A;  2W9C A;  1FVQ A;  1VQK S;  1FNX H;  2ZVI A;  2AV5 A;  3BKU A;  2XGP A;  3HHD A;  4EEY A;  3CPW R;  2WBM A;  1RT3 A;  1S76 D;  4JB8 B;  2FZC B;  3MEK A;  4QR2 A;  3Q8Q B;  4DV0 F;  1NLK L;  2AJ0 A;  4P9S A;  3H4B A;  4QOT A;  2CVI A;  1MG7 A;  3MD1 A;  1N5Y A;  3OLA A;  3THV A;  3WZ0 A;  2KTQ A;  4AYB D;  3CGI A;  5F0W A;  3IG1 B;  2V2Z A;  2E1M C;  3GJR B;  1U24 A;  4HDH A;  4CLY A;  1JWW A;  1KD1 T;  1B4S A;  2MDA A;  4Z7C A;  1YBA A;  4UZB A;  3M32 A;  4J9P A;  2BQR A;  2V50 A;  2DR7 A;  2XBP A;  3QAU A;  2ILZ A;  2QL5 B;  3KXD A;  3D5M A;  1DAX A;  3T9N A;  4JI4 F;  3PAC A;  2HWI A;  5KT2 A;  5SUH A;  3T1Y J;  2PA3 A;  1R3N A;  5DG7 A;  5CYJ A;  3M2U B;  4OZ0 A;  3HKZ D;  2QMW A;  3EZO A;  3CSK A;  1F5B A;  3CDA A;  4CO3 A;  3D28 A;  2FTR A;  2RT3 A;  3OXF A;  1S9F A;  2VFU A;  2EFQ A;  3W5Z A;  2WVD A;  2B6A B;  2KG0 A;  4B3O B;  3F56 A;  2WCX A;  5HMX A;  2MKY A;  1J5O A;  3BH6 B;  1BWE A;  3JB9 k;  1XNR F;  1FT8 A;  2N7C A;  3B78 A;  3RAX A;  2HS4 A;  4ELU A;  4MYT A;  4IFV B;  3TR5 A;  5CCL A;  5HAO A;  3CME S;  3KNA A;  1X9M A;  4AQY J;  3QSI A;  2LDI A;  4DL2 A;  4ZVF A;  1Y4Z B;  3K5O A;  1BQX A;  3D68 A;  2Y8W A;  2R7W A;  3BSO A;  3QGG A;  4ZDN A;  5IXU A;  2ASJ A;  2VG6 A;  3W2V A;  2YWG A;  3TAP A;  5BR8 F;  1S1U B;  1SC1 B;  4NYZ A;  2JC1 A;  2E1P A;  1RTZ A;  2Z0G A;  2JLF A;  3IAM 9;  5D6G A;  3G86 A;  4DSF A;  3PO5 A;  4JI5 F;  3DC2 A;  2KZM A;  1TQL A;  2W9C B;  4IO1 A;  2BJD A;  4KFB B;  4NYO A;  2W2P P;  4CH1 A;  2E5L J;  5IWA F;  2DY1 A;  1IKY B;  1FJ7 A;  3UDC A;  3RG6 A;  2HLT A;  5J1E B;  3EDR B;  1XNQ F;  3VAJ A;  4KO0 A;  1GMW A;  4KR0 B;  1QTN B;  3UDV A;  1DQ8 A;  1SIZ A;  2X7I A;  4GVB A;  2VOO A;  1REG X;  4RL1 A;  5L46 A;  3CIZ A;  3W1Y C;  4IQX A;  4B3R J;  1RT4 A;  4YDX A;  1QY7 A;  2AJ1 A;  4USH A;  1DTT B;  1DUR A;  3MPD A;  1FX2 A;  1FEH A;  1KQS R;  1HNX F;  2G2O A;  1GAO A;  1ZM4 A;  2O67 A;  5B09 A;  1KFD A;  2COL A;  3M32 B;  1KHW A;  2MZ1 A;  4AT1 B;  4ANC A;  4X84 A;  2KM8 C;  5KOW A;  2MY8 A;  4F3M A;  3EMT A;  1N56 A;  1SJ3 P;  2JC0 A;  2CZV C;  2Y1R I;  1WC0 A;  4PCQ A;  2R42 A;  3H7H B;  1IKW A;  2DPJ A;  2VZ9 A;  3HUL A;  1X5S A;  1NJY A;  5GME A;  5AXL A;  4ZLL A;  2BAN A;  3FCW A;  1LKZ A;  1WHX A;  4ED0 A;  4K4S A;  3MMJ A;  5F3Z A;  4JI1 J;  2MYF A;  5H9F J;  1PYT A;  4PAA A;  3TEH B;  2ZBI A;  3BH7 B;  3EE3 A;  5CZX A;  5DLG A;  3K59 A;  1I1G A;  4G65 A;  2C2Z B;  2C3O A;  1M5P C;  4WP9 A;  1UET A;  1KLM A;  2XWY A;  2MZJ A;  3W9I A;  2NXU A;  2GHP A;  2UV8 G;  2OML A;  2XY7 A;  3T19 A;  2LLZ A;  3AOD A;  3GYX B;  1PC5 A;  3PFE A;  2GZO A;  1VYA A;  3SYZ A;  4LF2 A;  3AJ2 A;  3R6G B;  4RUC A;  3IS9 A;  1PKU A;  4DLG A;  3KYL A;  3MCO A;  1D3W A;  4OYB A;  2AT1 B;  2I9S A;  3W2V B;  2HKE A;  2WOM B;  3VGT A;  1O5J A;  1NK5 A;  1ZH5 A;  5AJ3 J;  4DN9 A;  1VHI A;  2EK1 A;  2XMT A;  2ATC B;  3V5R A;  5IM0 A;  3FSX A;  2GHW A;  2FUG 9;  4CLF A;  4WP3 A;  1HW9 A;  1GX5 A;  5B08 A;  2EFN A;  1B99 A;  1PJ5 A;  2HQG A;  4LFC F;  2DRB A;  4EZ6 A;  1JLF A;  3M8Y A;  1ULR A;  2D9P A;  5J2N B;  2X3D A;  1N6Q A;  2DNY A;  3MM7 B;  3C46 A;  5J1N A;  1XMO J;  1MN7 A;  1KWM A;  3SI8 A;  4ZVE A;  3GG1 A;  4ZCM A;  1DTQ A;  5ITH A;  1S0O A;  4UT4 A;  3FFI A;  4ZIV A;  4L73 A;  3G4S S;  4GVB B;  2RU3 A;  4ED6 A;  1LK5 A;  1F6T A;  2B8P A;  3OTE A;  4TU8 A;  3P96 A;  1I5O B;  5KFG A;  1AT1 B;  3RB4 A;  3F41 A;  4CO1 A;  3O2I A;  5C2G A;  3DRS A;  2ZC3 A;  3PTW A;  2XS2 A;  1TK8 A;  2GMH A;  4DL4 A;  1RT7 A;  3N9U C;  4NA2 A;  1KRP A;  5E3R A;  1VHF A;  4KH1 B;  4FNI A;  5A8R A;  2HFS A;  4F4Z A;  4TU9 A;  1JJC B;  2BJ3 A;  5FII A;  3MCM A;  3UN2 A;  4ECW A;  4ZVT B;  2HSE B;  1IKW B;  4IOB A;  1QAJ A;  1OMS A;  3FEX B;  1CUL A;  2E5L F;  5GMD A;  2VFR A;  2KO1 A;  2BAN B;  2QA1 A;  3RBX A;  2ABY A;  2CVE A;  3D3C J;  4ATN A;  2XSF A;  3DU5 A;  4M5I A;  2UUA F;  2AGQ A;  3HLU A;  3A1Y G;  2GVD B;  5DJB A;  4YDD B;  3BPS P;  2OEK A;  2P2C B;  1KLM B;  1Q81 T;  4HL9 A;  2CJQ A;  1Q0N A;  1RKJ A;  1FHT A;  1UL3 A;  1YK9 A;  3DLJ A;  2WAQ D;  1GEH A;  2ASL A;  4CNY A;  4FS1 A;  4A8Y A;  2G0C A;  2R2T A;  3EVW A;  4NLS A;  2HBR B;  4A8K A;  3DDN A;  3G2X A;  3KDN A;  2P5V A;  2Z56 B;  2UXB J;  3KLI B;  3IS9 B;  1O51 A;  4NLO A;  1S77 D;  3DLG A;  5JVG Q;  1TP7 A;  1UTA A;  3FMW A;  3AHP A;  5U47 A;  2Y9H A;  2EPI A;  2EBE A;  4ZLP A;  1U6F A;  1TL7 B;  3KLF B;  1QAI A;  4OI3 A;  2V4J A;  2HMI A;  1VK3 A;  1SKU B;  5KFK A;  2KXN B;  3MED A;  1LWE A;  3J81 Y;  1XC9 A;  2W8K A;  3T6B A;  2FJA B;  1JLA B;  3L09 A;  4N77 A;  1HKA A;  1YSJ A;  1KFS A;  4JI1 F;  2ZBP A;  2PA8 D;  1RJJ A;  3F73 A;  4ELV A;  3LAL A;  1JLF B;  3SFG A;  1YLX A;  3P45 B;  2QRR A;  3Q8R B;  4PKD B;  4O44 A;  1N6Q B;  4DV7 J;  2NZ4 A;  4YP3 A;  1D9D A;  2KFZ A;  1RQ0 A;  4PWW A;  3CB4 A;  2IM1 A;  1TKT A;  1DTQ B;  1NKC A;  3FFI B;  2B4P A;  2AYM A;  2ZDP A;  3EDQ B;  3MOJ B;  3M2R B;  4URQ U;  2YX4 A;  2XZW A;  4DBQ A;  2Z2L A;  2F3J A;  4RBU A;  3A8E A;  1D0E A;  1F1B B;  3H98 A;  1MRO B;  1YJU A;  2J8A A;  4K4Z A;  1Y0H A;  2MQ8 A;  3DRS B;  3KLG B;  2OEL A;  3EZU A;  2V8V A;  3A8I A;  1RT7 B;  4F4A A;  3IGV A;  4YR3 A;  1KR4 A;  3BQ1 A;  2VC1 A;  1N5V A;  2DNQ A;  5AE1 A;  5A8R B;  2MJN A;  4WFX A;  3DI6 B;  1M0S A;  2EW9 A;  2PT0 A;  3NWR A;  2XWX A;  3RW7 A;  3HHN B;  1VLY A;  5HVG A;  4OV1 A;  4M63 A;  5FDL A;  1CUL B;  3HHL D;  5ETK A;  3JTO A;  2BE9 B;  1J27 A;  3PG9 A;  3WIV A;  1LWF A;  2QZ8 A;  3FKB A;  2M4M A;  2Q43 A;  3HI9 A;  3R1L A;  1XMO F;  5KFS A;  3R27 A;  3G87 A;  1R0C B;  5CXT A;  3OSN A;  1JLC A;  3BSN A;  2DVI A;  3GSD A;  3AOA A;  1RT6 A;  4WWS A;  2QLF B;  3H59 A;  1UMJ A;  1IR1 A;  3TVK A;  3IWN C;  5T14 A;  1F60 B;  3MEG B;  2CJX B;  1FO1 A;  2FJE B;  4DV2 F;  2X1B A;  3NLC A;  2ZOG A;  3DHW C;  3TOQ A;  3OL8 A;  4YFU A;  4F3Q A;  1RAE B;  2CWX A;  2YNG A;  2OTJ S;  4CH0 S;  1KLN A;  4LRA A;  1GTE A;  2HS0 A;  1TV6 A;  3BN4 A;  4U7C A;  2HGL A;  3PV8 A;  2VKR A;  4XDD A;  1HNZ F;  5D0E A;  3UD5 A;  2V4J B;  2HMI B;  2WVE A;  3CO0 P;  2KRR A;  3DCA A;  3DXB A;  1Y3K A;  4DR2 J;  4TYA A;  3MR6 A;  3CD0 A;  1FRK A;  4N41 A;  1R0A A;  2VU5 A;  2HHH J;  5J2M B;  5B0F A;  4NOH A;  3TZY A;  4O44 B;  3QRP A;  2FHJ D;  2POK A;  5DGB A;  2A6M A;  4KV8 A;  1V3Z A;  3QFW A;  4I2Q B;  1CJT B;  4BWJ A;  4USW A;  4JI3 F;  3W5Y A;  2L08 A;  2BX6 A;  5GAD I;  2WBR A;  5RUB A;  1HL6 A;  1R7I A;  2UXB F;  4R0J A;  2J9D A;  2W24 A;  2CFX A;  2CQ2 A;  2ZM6 J;  3AOB A;  1FXL A;  4RW8 A;  2IMO A;  3DOK B;  4OHZ A;  3IP0 A;  2OMO A;  3PDN A;  1WNE A;  2CQ1 A;  4F67 A;  3Q8V A;  2MKC A;  2R8K A;  2KT5 A;  5DZ7 A;  3IRX A;  5KFD A;  5FDL B;  2NYH A;  4NLP A;  3PYD A;  4DV7 F;  1LWF B;  4N56 A;  5DRK A;  4ED3 A;  5HI7 A;  3HVT A;  4DL6 A;  4CNZ A;  4CLU A;  5G0R A;  2GVZ B;  1JLC B;  4Q0B A;  1T11 A;  2UUC J;  3ILO A;  2XCA A;  4FPI A;  1R27 B;  2BM0 A;  4NAS A;  2QE5 A;  3KG4 A;  4LRF A;  2KI2 A;  3CJK A;  3K5P A;  4TYB A;  4Y6I A;  1VQY A;  3N28 A;  3AQO A;  2RAQ A;  3AQP A;  1E6V B;  2XLJ A;  4LRC A;  4ECT A;  1FEE A;  4M94 A;  4ZP6 A;  5D15 A;  5D3G B;  2X1A A;  3LUY A;  1HI0 P;  1SQE A;  1ACM B;  2ZH3 A;  4DPO A;  2DHA A;  3BZQ A;  2BMB A;  3K2Y A;  3DDI A;  5IS2 A;  2WRM A;  1X5T A;  1N32 J;  2YNG B;  1EB0 A;  2F63 A;  5LOQ A;  3PO4 A;  1RGV A;  3Q89 A;  4CWB A;  4GKJ J;  1YJW S;  2IBK A;  1RA6 A;  2IVF B;  2CNO B;  1JXE A;  4WCE Q;  1KC8 T;  4K7Q A;  2N7Y A;  5CH7 B;  1FXR A;  2PN6 A;  3PX4 A;  1S6P A;  1Q1K A;  3QGP A;  3NKY A;  3BEG B;  3CT9 A;  2DT9 A;  4J9V A;  4NLQ A;  1NHU A;  2XCP A;  5EX3 A;  3NGK A;  1ZM3 A;  3TUZ C;  3UCG A;  4ZPT R;  2X3G A;  3BGL A;  3R5B A;  1BQM A;  2HVD A;  2IDE A;  2VQF F;  4WP8 A;  2VG5 B;  2BOP A;  3AY0 A;  2G2Y A;  2OPQ A;  4M1K A;  3EJM A;  4ZHR B;  3C6U A;  3VAF A;  2Z2Y B;  4HH0 A;  2DTJ A;  1UJ6 A;  3P4U B;  4RNN A;  3X1L B;  2QLJ B;  5KTQ A;  4IKA A;  2NXC A;  3THP A;  2MEW A;  1W2I A;  4J90 A;  4RW8 B;  1ZPV A;  1LOU A;  1Y11 A;  2K06 A;  1RWN B;  2WSE C;  2XLK A;  2R7X A;  3P3D A;  2GQQ A;  3NCR A;  1KSP A;  2DGQ A;  4KQZ A;  2GJI A;  4Y00 A;  4DR2 F;  3IRX B;  4P2F A;  3X3U A;  1LEO A;  3LP2 A;  4RW4 A;  5HLF A;  2GW8 A;  1FNM A;  1UVK A;  4WZQ A;  1T9T A;  4C0O C;  2DNO A;  2RH3 A;  1G2E A;  2EK6 A;  3HVT B;  4LRD A;  2W01 A;  2FYX A;  1SC4 B;  3PW0 A;  5G0R B;  3MGJ A;  3WC2 A;  2Z8Q A;  4WF9 Q;  4Q0B B;  5BYQ A;  3MEC A;  2LA6 A;  1SVD A;  4KYZ A;  4O3R A;  2UXD F;  3KLE A;  3O1L A;  4BDP A;  3CJK B;  5DDO C;  3MWB A;  1NRK A;  3OUY A;  3CD7 A;  2LEA A;  2RUS A;  1EKS A;  4M95 A;  3MCN A;  3KK3 A;  1U1L A;  4F4Y A;  4ZPD A;  3WQP A;  1NK7 A;  1ROF A;  4MFB B;  2LXF A;  2LXU A;  4ZLJ A;  2HVZ A;  1JLQ A;  1S99 A;  4USI A;  5KT7 A;  4U6P A;  5I42 A;  2EFP A;  4ED4 A;  3H42 A;  2YKP A;  3M6X A;  4R5P A;  2MQQ A;  2ZNZ A;  3IBW A;  4J9S A;  3HJF A;  3FDS A;  3T1H F;  1OQ6 A;  5GVQ A;  1P9Q C;  1H72 C;  2OTL S;  1RE1 B;  2M8H A;  5JJB A;  3CD5 A;  1IWA A;  3KDO A;  3U1M A;  3Q2T C;  2EFV A;  2JH3 A;  3RJM B;  3KKF A;  1H2V Z;  1LK7 A;  2JEJ A;  2DGU A;  2Y8Y A;  5K5M A;  4KH0 B;  1MNE A;  2R8H A;  4M5L A;  1LWC A;  3N5F A;  3SCL E;  5A76 A;  1BQM B;  4J9O A;  2I5J A;  4KHM A;  2Y1I A;  2KJW A;  3OFF A;  3W5X A;  4A8O A;  1RYS A;  4EO6 A;  3C6U B;  5K8P A;  4IQM A;  4X2B A;  4BHQ A;  3MAQ A;  1I6J A;  4HH1 A;  3PIP Q;  2MZQ A;  1PC4 A;  2NXJ A;  5E7O B;  1M5O C;  2VQE F;  1CS4 B;  3MAH A;  1PG5 B;  5KT4 A;  3AD8 C;  5D4O A;  2DGW A;  5HBM B;  1HAR A;  2BE2 A;  1NUE A;  3GCW P;  3W63 A;  4HR2 A;  3I55 S;  3CCS S;  4JV0 A;  1EP4 A;  5C25 A;  1N5Q A;  3VV2 B;  2ZKU A;  4XO0 A;  2DEI A;  3RAQ A;  1A6L A;  2FJB B;  4I4B A;  5ETQ A;  2VV5 A;  4WE1 A;  4GVL A;  4WFZ A;  3W65 A;  4GC7 A;  4O0N A;  3SQG B;  3D6M B;  3MEC B;  2GAH C;  4QZV B;  5IFM A;  3KLE B;  3R7B B;  5IQQ A;  5D4L A;  4DUY F;  1RWM B;  4NEY A;  3GQC A;  2ZDO A;  1RYR A;  4NZ0 A;  3KK3 B;  4MAK A;  1UP1 A;  5THW A;  1UVM A;  3DLH A;  2HIQ A;  4QIF A;  1X0F A;  2W9B A;  5HQ8 A;  3KK1 B;  4C9D A;  2HYI B;  1NJW A;  1T9Y A;  2RU9 A;  1RTH B;  3AXK A;  2XY6 A;  1IJE B;  3GFY A;  4WBF A;  2JL9 A;  3QQC D;  3VR1 A;  4LSL A;  4KY3 A;  3DOM A;  5LJ5 Y;  1WOS A;  3IXQ A;  2QMX A;  3KUG A;  1F9H A;  3OBI A;  3R97 A;  3DRR A;  2C2E A;  1VC6 A;  2VJV A;  2JEF A;  4YEA A;  1VS3 A;  1YBU A;  3UNG C;  3RB3 A;  4B3S F;  2GC8 A;  1T7P A;  3BR8 A;  3JSM A;  3PEH A;  4A47 A;  1HI8 A;  5CAB A;  1Q5V A;  2UUB J;  4PXB A;  2JRS A;  4F3O A;  1LWC B;  3ELH A;  1NPK A;  3OJS A;  1UKU A;  1N34 F;  5GAD U;  1S12 A;  2GA7 A;  2D3Z A;  4ZKA A;  4ZVS B;  3SBM A;  4NLR A;  1YZ7 A;  2G0I A;  2FD2 A;  3W7B A;  3ZTP A;  4F02 A;  3MM5 B;  5F8I A;  2AIR B;  4EWT A;  4C97 A;  4PG5 A;  2B51 A;  2CJB A;  4MKA A;  3SV3 A;  4DL0 C;  1HMV A;  4NE9 C;  3RW6 A;  4C8Y A;  4Z37 A;  4K4V A;  1U1N A;  2HRU A;  4OX9 F;  4KKO A;  3MR7 A;  3EUN A;  2YBV A;  5IOL A;  2DEJ A;  1VQ8 S;  4LFA J;  1EP4 B;  3EGN A;  2HS3 A;  3EGW B;  5C25 B;  1P1T A;  5BYR A;  4CQ1 A;  3EPI A;  1RBA A;  4CM0 A;  2UV8 A;  1PCA A;  4WE1 B;  2MQM A;  2QX0 A;  4X4P A;  4X4U A;  1K8A T;  4FNH A;  2JFD A;  1OS5 A;  2HQC A;  3ZZT A;  1WOP A;  1FER A;  1CJV A;  2DXD A;  4HKQ A;  2M52 A;  4EGL A;  2IFX A;  3O5T B;  1LW0 B;  1XJW B;  2EKN A;  3PKM A;  3OTC A;  2SXL A;  1F2G A;  3DN9 A;  4OFZ A;  3GPA A;  4CLK A;  1RLC L;  4RBT A;  1EKR A;  1TL1 B;  3LAN A;  8RUC A;  3H0P A;  3PHE A;  2W9B B;  4DR3 J;  2PII A;  1VJW A;  4A8W A;  4X4V A;  4WFY A;  4RNF A;  1CSJ A;  3TYT A;  1PBU A;  4DPW A;  3FZB A;  4V19 J;  3VAM A;  3CW2 C;  3IFE A;  4LSL B;  4RW9 A;  2ZE2 B;  3SZ2 A;  1HQE B;  5BJR A;  1L3V A;  5FJ4 A;  2MB0 B;  3QT6 A;  4DSK A;  1D8Y A;  3RR8 A;  2DGS A;  3DRR B;  1WKJ A;  3ENW A;  4ZP8 A;  2BVZ A;  4F0K A;  5KFV A;  2MKK A;  2PSZ A;  5ETN A;  5I3P A;  3DRY A;  4FP9 A;  3JSM B;  1RAH B;  4I68 A;  2F4V J;  2L48 A;  3HFV A;  1IWG A;  4DX6 A;  3TAN A;  5C24 A;  2G9O A;  5ETM A;  1N88 A;  2FJW A;  2DNP A;  3GIR A;  1RAI B;  3E3X A;  2B3T B;  3NCP A;  3CC7 S;  5F8N A;  5KG2 A;  1H6K X;  3CCT A;  1CC7 A;  1TUV A;  2AZ1 A;  3TAQ A;  3MM9 B;  4HT5 A;  4YB6 A;  2AX1 A;  1KVI A;  1N54 B;  4X65 J;  2LFV A;  2EC0 A;  2HWH A;  3D0I E;  1HMV B;  4CLZ A;  3D1H A;  3HDS A;  3MFH A;  4KKO B;  3D7S B;  3TVZ A;  2X1G A;  4GKK J;  1HWU A;  2EBG A;  3NS7 B;  4F0H A;  3H5Y A;  4B08 A;  4JV5 J;  1V3S A;  1MML A;  4DLE A;  1S0N A;  4PG8 A;  4R8U A;  3LO3 A;  4Q43 A;  2BXJ A;  1JJ2 R;  1UVN A;  1EX8 A;  1WOR A;  3DFE A;  3CCE S;  3K89 A;  1YBT A;  2ZJP Q;  1TL5 A;  2ROG A;  3WDO A;  3BPD A;  2AP6 A;  4TY8 A;  3I4P A;  3GU0 A;  1CJV B;  1OPZ A;  3ICL A;  1VK8 A;  4E98 A;  5KFL A;  4FS2 A;  3UQS A;  2CQD A;  2QGF B;  3RAM A;  2VPW B;  1YVF A;  1TUG B;  1XMQ J;  5KFO A;  5M2U A;  1XK8 A;  2H65 B;  2QFI A;  1SQG A;  3D9B A;  4GMK A;  4P2M A;  3CCZ A;  4Y2A A;  8AT1 B;  3OR2 A;  1FDN A;  4PG7 A;  1NEE A;  4MJK A;  4D3G A;  3V6H A;  3SEO A;  3NOC A;  2Y1J A;  5CZV A;  3HPO A;  2QLB B;  4TU7 A;  4IRK A;  1HW8 A;  2E5I A;  4CO5 A;  4Y65 A;  1X4C A;  4G1Q A;  5GAH I;  2FVQ A;  4RW9 B;  3UFC X;  4WK1 A;  3BGR A;  4PWU A;  4LFA F;  3D3B J;  1QVG R;  2QA4 G;  3OTB A;  2XEX A;  3CJ5 A;  3O44 A;  3IR5 B;  5KG7 A;  5KFP A;  2NPI A;  3UDE A;  5K8M A;  2GML A;  3DHX A;  4ZN1 A;  3TWZ A;  2CQC A;  2HBY B;  1S97 A;  1SI9 A;  1T3O A;  2CUY A;  3PM9 A;  4FYX B;  2GHV C;  3QMQ A;  1S48 A;  3HXM A;  2W2O P;  5D78 A;  4ALZ A;  1EET A;  3I87 A;  5JUM A;  1X4B A;  1CVJ A;  2D3U A;  4UZC A;  3FSI A;  1GXL A;  1D09 B;  4DV4 J;  2IM2 A;  5HMY A;  5DGA A;  1NZA A;  1SBR A;  1GK8 A;  4B9L A;  2QFJ A;  1G3O A;  4TY9 A;  4P2X A;  3M2V B;  3SMZ A;  3N79 A;  2P9E A;  4X4S A;  1YX2 A;  2DGV A;  2B8Q A;  4WFA Q;  1QM9 A;  4MT1 A;  4ZVQ B;  2QC3 A;  2HAF A;  3SV4 A;  2DK2 A;  1FKA F;  1YIJ S;  2G1H A;  1R8A A;  4LSN A;  2ZBC A;  3VZH A;  3W61 A;  2RF2 A;  4F25 A;  3K8V A;  3L3C A;  1RHM B;  3UNY A;  2H4W B;  3GMG A;  2K1R A;  5BXI A;  4IFY A;  2JHE A;  4ZVO B;  5HSP A;  3QGH A;  3QO9 B;  1SJQ A;  1ZTW A;  1C0U A;  1OY9 A;  2OP5 A;  2CDQ A;  2DXE A;  2VA3 A;  2Q79 A;  5EGY A;  1ZA2 B;  3MAA A;  1T3N A;  3H2V E;  2QTW A;  4USU A;  2DNR A;  3C6T A;  3I31 A;  3ISZ A;  1J5E J;  2YNH B;  4TY8 B;  4K2J A;  4ECX A;  3OD2 A;  2AYB A;  4XAK A;  1PO6 A;  3NRB A;  3EZ5 A;  3W9J A;  5A8K A;  3RRH A;  3JQM A;  2ZC4 A;  3KWM A;  9ATC B;  2A3J A;  2LXI A;  4W98 A;  4ZPV R;  4DQI A;  2BV3 A;  4YB1 P;  2FVS A;  2JSX A;  1GT8 A;  2MZT A;  4H4O A;  1H73 A;  3ENV A;  4N8N A;  3OR2 B;  3NBP A;  4Q44 A;  3IRW P;  2B7C B;  3POT A;  4QIG A;  1JLG A;  3E51 A;  2R7S A;  2GJF A;  2MST A;  3FSY A;  4G1Q B;  3ETM A;  1Z1Z A;  4DPU A;  2ACY A;  3HHL A;  4UOG A;  1HNW J;  2HW3 A;  1SJ4 P;  5H1S V;  3LW5 C;  2GX8 A;  2CWK A;  2JX2 A;  3BBB A;  3HCX A;  3IAS 9;  2Y0B B;  8ATC B;  3S1T A;  2IJR A;  1WC1 A;  3W9H A;  2CNK B;  4JI0 J;  1JXL A;  2ERR A;  4P75 A;  1K44 A;  1LWX A;  1RBL A;  2IHR 1;  2N4D A;  5ETP A;  3BS9 A;  1VR6 A;  1IJF B;  3KJN B;  2Z30 B;  3L7P A;  4E8U A;  2WON A;  4Q45 A;  2GGP A;  2XG8 A;  4I7F A;  3H5U A;  1F9F A;  3VWS A;  2P6S A;  2XYH B;  2CJA A;  3ZZP A;  3B8H A;  2RNE A;  2RS8 A;  3G6V A;  4LRE A;  2CZ4 A;  3MCS A;  5EUH A;  2HK2 A;  5JVH Q;  2WB1 D;  5I3Q A;  4AXJ A;  2H1Y A;  1VFJ A;  1URN A;  1VQ6 S;  1T03 B;  1VQ5 S;  1IQZ A;  1QLN A;  4DV6 J;  2L3M A;  3I56 S;  4JI6 F;  2MLX A;  4LSN B;  4DS5 A;  2RF2 B;  3P5T L;  1NSQ A;  2XB2 D;  1B0T A;  1H2T Z;  4NA1 A;  5T7L A;  4O3S A;  4AL5 A;  4EK2 A;  4B3T F;  4E2F B;  3CMQ A;  2K1R B;  4JI7 F;  4A4J A;  4X62 J;  3I6P A;  2XSJ B;  4ZP7 A;  7FD1 A;  1XMB A;  3GIL A;  3CCU S;  1C0U B;  2FHJ A;  3MR3 A;  3TA1 A;  2FDN A;  3M8P B;  3PW5 A;  1NSP A;  3I0R B;  3JAM U;  5ETV A;  1V5V A;  2GJ2 A;  2C3U A;  2JVO A;  1VDH A;  2VH7 A;  4YY3 J;  3TQ1 A;  4V1A k;  1Q95 G;  2L9D A;  3C6T B;  3OFG A;  3HFK A;  1U1O A;  2IRY A;  3MMB A;  1ZZN A;  2APO A;  2KVI A;  3TAM A;  4DV4 F;  1YI2 S;  2VAS A;  1RAC B;  1PGZ A;  3K58 A;  2QYG A;  1I51 B;  5A8K B;  4MMO A;  3HT3 A;  3SIP B;  3GIJ A;  4WKR A;  4NWB A;  3VGV A;  2CQ0 A;  1IN0 A;  2HRY A;  4EUV A;  6AT1 B;  4H4O B;  3FUY A;  4RBV A;  1HBN A;  3R5A A;  3NBP B;  2YKN A;  4YQW A;  2BA9 A;  3N0V A;  1Q86 T;  3POT B;  3M8Z A;  1JLG B;  4YS2 A;  4WYW A;  2CQB A;  1RK8 A;  3ITH A;  1DBD A;  1TVR A;  1JX4 A;  3S01 A;  1PAE X;  3UVJ A;  4FXW A;  2V2V A;  2VBW A;  1IM4 A;  3DMJ A;  2AHO B;  2KXH A;  3S8S A;  2LDY A;  2PMZ D;  2R3V A;  5H9E K;  3LA0 A;  1J5E F;  4PR6 A;  2C2D A;  4JBC A;  4DR4 F;  3QIP A;  2CPX A;  1J2V A;  1Q53 A;  2WON B;  4GO7 X;  3DLK A;  1RZM A;  1HNV B;  3ZTO A;  1N33 J;  2ROP A;  3TO8 A;  3OL9 A;  4RUH A;  4DU8 A;  2DHX A;  2G0J A;  2VC0 A;  1X4G A;  3QRQ A;  4D3H A;  2G4B A;  1SH2 A;  2MKJ A;  2B7B B;  1IKX A;  1TMM A;  1S59 A;  4KGX B;  1U6Z A;  1NH7 A;  1TR0 A;  3UPF A;  4YHH J;  5DS7 A;  5H9E J;  3FBC A;  1RCX B;  3NNA A;  1HNI B;  2EC2 A;  5T41 A;  2B43 A;  2LEC A;  2FLL A;  4IDK A;  3IA0 A;  1GNK A;  4DG1 A;  4URS A;  3GP9 A;  4JI0 F;  3HFZ B;  1WF2 A;  1U8W A;  4OLP A;  1T9X A;  4LBH A;  2JJ4 D;  3KNG A;  1Q7L B;  1NB2 A;  4TQR A;  3F44 A;  4LR8 A;  1VIX A;  1U7L A;  1X7V A;  1S1T B;  2RKI A;  3CTR A;  4I56 A;  2HVE A;  2J5A A;  3E01 A;  3MMB B;  3RBZ A;  1ZM9 A;  4PPD A;  3TAM B;  3FMB A;  1MU2 A;  2YNI B;  5K14 A;  2MQN A;  3NS5 A;  4U67 Q;  3CVK A;  1HWJ A;  1Q4R A;  1TU0 B;  2FHM A;  4DZD A;  3HVW A;  4RJV A;  2MHN A;  2IA0 A;  2NXE A;  2HPU A;  1AFI A;  1WTF A;  1HBN B;  3MHY A;  2YKN B;  1TMJ A;  2E5H A;  5GAH U;  4OX8 A;  4DV1 J;  1QSL A;  1RXO B;  1NB7 A;  2ZWO A;  5L1L A;  2M0G B;  2NUU G;  1KQG B;  4QU6 A;  4X66 J;  3P8B B;  3Q8U A;  1WI8 A;  3M9N B;  4U8V A;  4ZVH A;  4FBU A;  3RGI A;  5HO4 A;  3DOL A;  3W60 A;  1I94 F;  2AJ2 A;  2EXU A;  3B6B A;  4QCL A;  1TVR B;  2CKW A;  5KFB A;  3IG1 A;  2A6O A;  4Z7Y A;  4F2S A;  4ED7 A;  3PXG a;  4RUB A;  4Y28 C;  1E6Y B;  3QNW B;  1U26 A;  2DO0 A;  1UPM B;  4C8Z A;  1WEY A;  2E7V A;  2FVP A;  1JK9 B;  3DMJ B;  2HND B;  5KFH A;  1FI4 A;  4YY3 F;  7AT1 B;  5KFJ A;  4EMD A;  5DDP C;  1OSC A;  1RTD B;  1UW4 A;  3DLK B;  1RKI A;  5E5N A;  4LF7 J;  3M2U A;  1OSD A;  2WVC A;  3G6E S;  5A2Q U;  1YWX A;  4DMZ A;  4O3Q A;  1Q8B A;  1UWA A;  1NK0 A;  1NME B;  3J80 U;  2A18 A;  1JLB B;  1V9O A;  4JOU A;  1IKX B;  2HEK A;  4B3M J;  1C1B A;  1LV5 A;  4HVZ A;  3QAT A;  2KJV A;  4M5M A;  2UU9 J;  1N52 B;  2DNN A;  1UZH A;  1M1K T;  3ETO A;  1H98 A;  3QWU A;  2U1A A;  2CIM A;  4K0K J;  2M70 A;  4DG1 B;  2WW4 A;  1U1K A;  2WHO A;  2AQ4 A;  2IDL A;  3S6E A;  1CC8 A;  6FDR A;  6FD1 A;  3BB5 A;  3RBD A;  2DHG A;  3PRB A;  3CCR S;  4DUZ J;  3W64 A;  2HHS A;  4OJG A;  4KE5 A;  2VG7 A;  1S1U A;  4GRS A;  2GQ2 A;  1WTB A;  3PR5 B;  3IM9 A;  1VQM S;  5KFE A;  1M1G A;  4NZ7 A;  3C3L A;  5K14 B;  5M2P A;  1VOM A;  4KFB A;  4MIW A;  4U96 A;  4DR5 J;  4OZJ A;  1IKY A;  4DQP A;  1Y10 A;  3Q86 A;  5CQG A;  5DDQ C;  5J1E A;  2GCF A;  2HHV A;  5A6W A;  2ZH2 A;  2LCW A;  3I9V 9;  2MQL A;  1QTM A;  1X60 A;  1RDR A;  3UR3 C;  4YHH F;  2ZH8 A;  4BC7 A;  4QWA A;  3RB6 A;  4LJM A;  1QAX A;  1RAD B;  2E5J A;  3O8W A;  1CQN A;  2MLY A;  2V8H A;  4CIO A;  2KYZ A;  4ZVR B;  1HYS B;  4J9K A;  1DTT A;  2RQM A;  3DOL B;  2CYY A;  2OD6 A;  4IG0 A;  3QYY A;  2HUR A;  1EAY C;  3MPU B;  3UDL A;  3MOZ A;  3OTO J;  3CDW A;  4Q8F A;  1K0T A;  4EO8 A;  4PXE A;  2AX0 A;  1NDK A;  4Y2M A;  1K1S A;  5KFF A;  2Y0S D;  3I5A A;  3I0S A;  3ZFV A;  5E3C A;  4NXM F;  2ZEJ A;  2VJU A;  1K0V A;  1ZAV A;  2YX7 A;  2K3K A;  2AJ4 A;  4KTQ A;  1L3K A;  3V6D A;  3GV8 B;  1CQM A;  3SSS A;  2KDO A;  4RW7 B;  1XER A;  4UTG A;  2LQ9 A;  4NMX A;  2HFZ A;  1RHK B;  2E44 A;  1HR0 F;  2KXF A;  3OTD A;  2VBX A;  2MTL A;  2CPH A;  3TZW A;  5ETL A;  1AFJ A;  2WVB A;  1C1B B;  4B9S A;  2E9T A;  1IBK J;  2AJQ A;  4CLS A;  1WC5 A;  1VQN S;  1T9W A;  3LP1 B;  2PI5 A;  3OW2 R;  1IM6 A;  2XI2 A;  4A48 A;  4C6A A;  2DBB A;  2OEJ A;  3ISN D;  1FE4 A;  3CWJ A;  1QAY A;  2GIR A;  3R3T A;  1RU1 A;  2YKM A;  4LFB J;  4R25 A;  2BKO A;  4ED5 A;  4X64 J;  3C8Y A;  3CJ2 A;  2YWW A;  1NU4 A;  1NKE A;  5ETS A;  2E1R A;  3L95 X;  4ED8 A;  3HVR A;  3KLV A;  5E41 A;  1OPI A;  1VMB A;  2DCL A;  3PYF A;  3Q8P B;  2YKQ A;  5ETT A;  1OQ3 A;  3C16 A;  3C15 A;  3UN3 A;  4CT9 A;  4IOC Q;  2LQJ A;  1SJ1 A;  4XIU A;  5GMK a;  2WOM A;  2ZD1 B;  4C11 A;  2A1B A;  2BKN A;  2VG7 B;  3DDK A;  2RB7 A;  4LQ9 A;  1DRZ A;  2QA2 A;  3HMJ G;  4JYA J;  1JB0 C;  1N36 J;  4OLO A;  3FJ2 A;  2FY8 A;  1TK5 A;  1X5P A;  3VHQ A;  3LAK A;  3V81 A;  3ZZU A;  3BKF A;  3HD1 A;  4LF4 F;  4RPF A;  2HHU A;  5J2N A;  3UN5 A;  4B3M F;  3MM7 A;  2AEJ A;  4NYP A;  1PYO B;  4DPT A;  2UU9 F;  2BRL A;  2XNQ A;  2LQ5 A;  3BF4 A;  5L9X A;  1F0X A;  4A46 A;  3CCM S;  4OYZ A;  1FJG F;  1RT5 A;  3ZZO A;  3L7O A;  3D67 A;  2C2R A;  4QYZ K;  4IG0 B;  3PJW A;  4P7T A;  5H9F K;  1X4H A;  4RWX A;  5AXK A;  5KOX A;  3PYG A;  3JSR A;  4DUZ F;  4JI8 F;  2ZZN A;  5KFW A;  1RBO B;  5KFI A;  2KU7 A;  1FFS B;  2B0G A;  3I0S B;  5AE3 A;  3PKY A;  3BO2 A;  2UUT A;  3M7V A;  4UUW A;  4FKY A;  3D0G E;  1S1V B;  1HPZ B;  2ADB A;  2YWH A;  2OEM A;  5LXY A;  4J9Q A;  2Q1L A;  2OLW A;  5J1P A;  2ZH1 A;  3V6D B;  1QUV A;  4DR6 J;  3Q0A A;  4ECZ A;  4ID8 A;  1ZBT A;  2O3D A;  4UF4 A;  2V63 A;  3ENA A;  4QYZ J;  1MWY A;  2R2R A;  2W7P A;  1TL3 A;  5A0Y B;  2PFD A;  1FTC A;  3FBF A;  5K20 B;  1JIH A;  4BC9 A;  4O4G A;  5KT6 A;  4MK8 A;  1WJ9 A;  2GVD A;  2LU1 A;  2PEH A;  1QVF R;  3PHT A;  2IAJ B;  3V6J A;  4Y2I A;  1D8Z A;  2R7O A;  1FD2 A;  4QIE A;  3CCJ S;  3LGM A;  3MM6 B;  1KP6 A;  1H7X A;  4DSI A;  2VD3 A;  2YPY A;  1O8B A;  2YKM B;  3CJS A;  1RTI A;  2OI2 A;  1U2R A;  2QA4 S;  1YZ6 A;  2EFG A;  2G1D A;  3KHH A;  3KTQ A;  2F9J A;  4UUX A;  1RHQ B;  3GJQ B;  2A2C A;  1ZA1 B;  3KLI A;  3C16 B;  3C15 B;  3D2W A;  3MXH P;  1HWK A;  1N4L A;  4UOC A;  3CJT A;  4YN3 B;  1BUX A;  3PNI A;  3HO1 A;  4C11 B;  3T1Y F;  3RB0 A;  2IVM A;  4ER8 A;  2NRE A;  2CQ3 A;  1TL7 A;  3KLF A;  2AEM A;  2BEF A;  2BQ3 A;  2KHD A;  5IT0 A;  1FA0 A;  3N6L A;  2QT7 A;  2FLO A;  5LJ3 Y;  1JLA A;  1EQ0 A;  2DD8 S;  5J2Q A;  4WII A;  1RWW B;  3V81 B;  3Q2S C;  2W2N P;  1R89 A;  3A3P B;  2KZZ A;  1MLA A;  3LOU A;  1LXN A;  4CH7 A;  3K0J A;  4PXD A;  3FRZ A;  4CRJ A;  2E9R X;  5B0A A;  2KM8 B;  5E0O A;  2R9L A;  2ZFH A;  3IBF B;  5KFA A;  4UOH A;  1RAJ A;  3M2R A;  4USV A;  5CA5 A;  1TK0 A;  1FDD A;  2VIH A;  2ZHO A;  3I82 A;  2XMJ A;  3W8P A;  1RT5 B;  1WKL A;  3FRY A;  1H0H B;  3CJR A;  4H4K C;  4WYL A;  4HTJ A;  4AQY F;  3DLL Q;  4ED2 A;  5EWF A;  4P73 A;  2CPF A;  1MRO A;  3DRX A;  1FWP A;  3NAH A;  3KLG A;  4J5O A;  3EGZ A;  5KFR A;  3H40 A;  3Q23 A;  4CLW A;  4DI6 A;  4DQR A;  3TJ8 A;  1FTR A;  2IM3 A;  5MAO A;  2XHW A;  3ILI A;  3DI6 A;  1EIY B;  3ULH A;  4OZ3 A;  2X51 A;  3MUR P;  2EFO A;  3BN7 A;  3JAM Y;  3HHL C;  4XK8 C;  3KMQ A;  2NSB A;  1G7C B;  2ZH4 A;  2HQF A;  4WXO A;  2D7S A;  4DXL A;  4XPE A;  1APS A;  1UPP A;  1NAQ A;  1BQN A;  4DX8 H;  1KS2 A;  3AB4 B;  2XMA A;  1SL2 A;  3OVB A;  3QLH B;  1N48 A;  3A4T A;  2E9Z A;  1TL3 B;  4IOA Q;  4DPY A;  4P2S A;  3KG0 A;  4MKV A;  4O4G B;  4RO0 A;  4B9M A;  3MR2 A;  3OV7 A;  2IPO B;  3MUM P;  3MI7 X;  2VHG A;  1RT1 A;  2KYX A;  4L76 A;  2ZKT A;  3JSY A;  3OJU A;  4L75 A;  4B3R F;  4YOE A;  3TI0 A;  3GWC A;  4RNH A;  3EYZ A;  1RI7 A;  3MEG A;  4OYP A;  2EG1 A;  1WOO A;  1NBE B;  2Q6B A;  1C0T A;  1RTI B;  2AW0 A;  2XS7 A;  1NDL A;  4Q8E A;  4Y34 A;  3T5J A;  2JEI A;  1MW7 A;  3AD7 C;  1URR A;  4BWM A;  1TZ0 A;  1VBY A;  2V2K A;  4WJB A;  3QT5 A;  2WSC C;  2O66 A;  1VGY A;  1FKP A;  3KOA A;  1JJH A;  1U49 A;  1FFG B;  2AEF A;  3H5X A;  1WF1 A;  3ZTR A;  1VQP S;  1KKH A;  2P8I A;  4HHU A;  3G8Q A;  1S6Q B;  5BYS A;  3U02 A;  3OHA A;  1N8R T;  1S9E A;  4ECY A;  1N0U A;  4PYD A;  3ZZR A;  3QFH A;  1NZ8 A;  3B82 A;  5J2Q B;  3CUL A;  5L9N A;  5J2M A;  4KGZ B;  1HWL A;  3US5 A;  3PX0 A;  3DKD A;  3DYA A;  3FQK A;  4I2Q A;  1CJT A;  1K47 A;  4ZP9 A;  4PPZ A;  5HRO B;  4W90 B;  2OIH A;  2FHO B;  1B0V A;  4IRD A;  4ERD A;  5I4M A;  1RWV B;  5GAE I;  2MKH A;  3CJQ A;  2V9K A;  2UXC J;  3D6H B;  1BMQ B;  1HQU A;  1QUP A;  1AW0 A;  1ZTT A;  4W92 B;  4F04 B;  4K5R A;  1LQ9 A;  4DL7 A;  2HHQ A;  5LMN J;  2CQH A;  1PSD A;  3DOK A;  3NGS A;  4ETX A;  4F8R A;  2N82 B;  1UCN A;  4C98 A;  1SPB P;  3HX9 A;  3PR4 A;  5AJ3 F;  5AXN A;  4J9M A;  4OI0 A;  3B4D A;  1SUQ A;  1GX6 A;  2GFF A;  4L3K A;  1BQN B;  5D4N A;  2Z58 B;  1IBM J;  2C42 A;  3ILJ A;  2E5G A;  5HQM A;  2DO4 A;  2Y3Y A;  4C0B A;  5F41 A;  4WXW A;  2D41 A;  2GVZ A;  2VPZ B;  5DDR C;  2DRD A;  4UW2 A;  1RT1 B;  4Y3C A;  1UFW A;  1X9S A;  4DV0 J;  1JMT A;  1YGY A;  2IRU A;  5F8M A;  1E6V A;  2XZD B;  4IO9 Q;  1U02 A;  1B64 A;  3DLE B;  3HVA A;  2DY9 A;  3CJ4 A;  1WKK A;  4Y2K A;  5D3G A;  1C0T B;  3ZZZ A;  5CYQ A;  3IO1 A;  1QD1 A;  2QIF A;  1SC3 B;  2CG8 A;  3R2C J;  3MUV P;  1HFE L;  3DGP B;  1FKP B;  4LF8 J;  1F3F A;  4C8M A;  1C4C A;  2ASD A;  1RA7 A;  9RUB A;  2BW7 A;  2LYV A;  1S9E B;  3R6L B;  2M3D A;  4DX5 A;  3OPK A;  1FX4 A;  1D9A A;  2VDH A;  2W7O A;  4OYO A;  4ZIT A;  2MQO A;  2H5E A;  3HSG A;  5A2Q Y;  2PMH A;  4CDI A;  2YWE A;  3AD9 C;  4UST A;  3EWG A;  3JYT B;  4EFA C;  3TUP A;  3KUE A;  1XWL A;  3DYA B;  4HAC A;  4ICL B;  1GXT A;  2G13 A;  3UW1 A;  2VG5 A;  4EBD A;  2FJD B;  2UUW A;  2DKO B;  1Q8K A;  5JMN A;  2BKP A;  5LSO A;  3W8G A;  4ZHR A;  4NLX A;  5CD4 H;  3CCV S;  7FDR A;  4NXN J;  4DFM A;  3ZNJ 1;  3K8W A;  2DHS A;  2R2S A;  4BBY A;  5HAT A;  4FF2 A;  1HQU B;  2O01 C;  2D74 B;  3KLH B;  1WHV A;  3I5C A;  3NP5 A;  5LXR A;  4NCG B;  4QR1 A;  2OD4 A;  2J0S D;  1Q8I A;  3QJP A;  5EN1 A;  3OL6 A;  2F5G A;  3VQS A;  3QZ7 A;  1XR5 A;  2XMV A;  1YKW A;  3H2U B;  3T5H A;  1S7I A;  4F7V A;  5F0U A;  3GTY X;  1HLW A;  1FD8 A;  2BYC A;  4K2X A;  1YHQ S;  4B9V A;  3WHI A;  1SUQ B;  3EVM A;  3Q24 A;  3TZZ A;  4ZPW R;  4P7V A;  2OPP A;  2IJN A;  1Z2Z A;  4JI5 J;  3A8J A;  2C3P A;  2LQ8 A;  5B0E A;  3ZZ0 A;  3W66 A;  1X9W A;  1LW2 B;  2F9D A;  4B9N A;  3HHK A;  5FLX U;  1XNQ J;  1S1W A;  1H38 A;  3RBE A;  2Z4P A;  3KG1 A;  5AXM A;  2R2U A;  4OIX A;  5HMW A;  5D4P A;  3TA2 A;  3NWG A;  2CA9 A;  3T3F A;  1CJU A;  1TFY A;  1BWV A;  2XO6 A;  4LMZ A;  2UXC F;  3D4J A;  1HQ2 A;  2V8D A;  4J9L A;  4K5S A;  2MMY A;  5HVF A;  2IBO A;  5IT4 A;  4MFB A;  2B56 A;  4DV5 J;  5CYQ B;  2HAI A;  3TX0 A;  4NRU A;  3TEG A;  4XDC A;  2IC3 A;  4N47 A;  2QN6 B;  3OFH A;  2CJK A;  3DGV A;  1HIY A;  2V8G A;  2XO7 A;  3IR7 B;  2F4F A;  2R7U A;  5A8W A;  2GV1 A;  2FGC A;  1FFW B;  2XM3 A;  3PY8 A;  1QDU B;  2AMC B;  4NCB A;  4WZM A;  4KT0 C;  2YNF A;  1M1H A;  1TAU A;  1JQG A;  3GR1 A;  2R7V A;  2ZH7 A;  4F50 A;  3RR7 A;  3M8S A;  2V8P A;  1IBM F;  1HWI A;  3K5M A;  1YTY A;  3QJJ A;  1RWK B;  3NS6 A;  1NXI A;  2CG4 A;  2VB6 A;  1LFP A;  3HSJ A;  3U27 A;  3Q83 A;  2VDI A;  2MJU A;  1R8B A;  3M6W A;  2CJ9 A;  1B70 B;  1Y9O A;  3IC1 A;  2LA4 A;  3LPE A;  3WBZ A;  1X4D A;  4FVC A;  5F8L A;  2Q3P A;  3CCQ S;  3JTN A;  4HAC B;  1NDC A;  3AAW B;  2HNY A;  4ZIW A;  3OT9 A;  1SIW B;  3NCQ A;  4CYU A;  3FGV A;  3W3S A;  4YB5 A;  5KG1 A;  4KBI A;  3NNH A;  2W1B A;  2W4C A;  1V5I B;  1TL4 A;  4ZVP B;  5DLF A;  1U1P A;  4DOZ A;  1HBM B;  4FVM A;  4I6A A;  2CNN B;  3ENQ A;  3HF5 A;  2RE1 A;  2YKA A;  4LF8 F;  2DRA A;  1QSY A;  4ZJO A;  2YQ3 A;  1CS4 A;  4M5K A;  1T9V A;  5HBM A;  4I6Y A;  3KJV A;  1IXK A;  2VFT A;  3T6J A;  3R8Y A;  3ONQ A;  2ZBR A;  4F0M A;  5B0G A;  1RAG B;  2OPP B;  2HHH F;  3BO4 A;  2VA2 A;  1U4B A;  2BAB A;  2LEP A;  4LF1 A;  3D1Q A;  1NPP A;  1F5A A;  4F4X A;  1PJ7 A;  4AUK A;  3A3O B;  3BBC A;  4LFC J;  4NLW A;  4GC6 A;  1NJI T;  3RRK A;  1S1W B;  3SQG A;  2M5Y A;  1R8C A;  1TTH B;  1NO8 A;  1HBO A;  5KFY A;  1O6X A;  5KFC A;  3Q8Y A;  2WZ1 A;  3GSI A;  4NI2 A;  1X0P A;  4HI2 A;  1ZAW A;  1CJU B;  1NDP A;  4NXN F;  3VTI A;  4N5S A;  2A10 A;  5E3P A;  4C0H A;  1VC0 A;  4QWB A;  1S72 S;  1O0P A;  3BKT A;  1NJX A;  1UFL A;  3ZNU A;  3RRG A;  2B9Y A;  3BYP A;  5G4D A;  2ZM6 F;  1F2H A;  3KK1 A;  1IVZ A;  4DS4 A;  3GR0 A;  3ZXW A;  2IC3 B;  4QR0 A;  1RTH A;  3OLB A;  1VRU A;  2FZG B;  4M5D A;  4HTI A;  3FVY A;  3TNV A;  5A8W B;  4CP5 A;  4I0W A;  4CLL A;  3SDE B;  4RW6 A;  4C7Q A;  2YNF B;  1U6B A;  4LT6 A;  2OSQ A;  2RRB A;  2F1F A;  4LUB A;  2IY5 B;  1DLO A;  1VQS A;  2D1C A;  4DSE A;  3DNC A;  2N4C A;  3VAK A;  2NYI A;  2J9C A;  4OZ1 A;  3PRD A;  5D0H A;  1M90 T;  3SCI E;  4FXV A;  4U9R A;  3G6X A;  1NH8 A;  2UUC F;  4FF1 A;  4TVA B;  5KG0 A;  2W4D A;  1RT3 B;  2P6T A;  2BJ9 A;  1FJC A;  2UUA J;  2RDI A;  2E66 A;  2HNY B;  4W4M A;  1HHS A;  1XR6 A;  4CYU B;  5GAE U;  4RU9 A;  4QYR A;  1N5Y B;  5KFT A;  2NS1 B;  4DV5 F;  4FXD A;  2XY5 A;  1RAA B;  3MM5 A;  3U1L A;  4QQB A;  3EM1 A;  1RAB B;  4KPC A;  4HLB A;  2VIC A;  1N32 F;  4IG3 A;  1C1C A;  2YWK A;  2J7K A;  2DPI A;  4GKJ F;  4JI2 J;  1K9M T;  3QBC A;  1WUU A;  2V6A A;  2GO8 A;  2VOP A;  4ZS6 A;  4V19 X;  2DH8 A;  3KJV B;  4FF3 A;  2AYG A;  2VPY B;  1S57 A;  2QG9 B;  3MF5 A;  4DDF A;  2J7W A;  3IM8 A;  4K4X A;  2EI5 A;  1VRQ C;  3A3N B;  4O3P A;  4C2M A;  4NZ6 A;  3PW4 A;  2ALZ A;  2GIQ A;  4E0D A;  4PZV A;  3LGN A;  4EU0 A;  2M88 A;  2FJV A;  1H3D A;  1HBO B;  1J5O B;  2UVU A;  1LW0 A;  3UE2 A;  4J7C A;  4NI2 B;  4FN5 A;  4OX7 A;  4WKY A;  1TL1 A;  1FVS A;  3LWM A;  1CLF A;  4NL5 A;  4NLV A;  1GMU A;  1NK6 A;  3M9M B;  4U7U D;  2BJE A;  4OQJ A;  4UQT A;  4PQA A;  1ITP A;  1VRU B;  1OIA A;  1YJN S;  3KJF B;  4M5D B;  2Q66 A;  4C3M A;  2VG6 B;  3WX4 A;  2HLU A;  5KT5 A;  2ZIT A;  1R8H A;  2ZE2 A;  1RHU B;  1DY3 A;  5HK4 A;  1MSW D;  1HQE A;  4RW6 B;  1EJ7 L;  3B54 A;  2H51 B;  4N76 A;  1KOO A;  1L3U A;  3TRG A;  4ZN3 A;  4J9R A;  3W62 A;  1DLO B;  1CPZ A;  3JSB A;  4DX7 A;  2ATL A;  1S7H A;  3J7Z T;  4WTO B;  3EX7 B;  2XMM A;  5DG8 A;  1ZPW X;  2DIS A;  2MKS A;  1KVK A;  2ZZM A;  2Y1L B;  2JZ5 A;  4KO0 B;  3D0H E;  1DZ5 A;  2QL9 B;  1U1M A;  2ZH5 A;  1RCO B;  4M5J A;  3SCJ E;  4LF9 J;  1KN6 A;  3FEY B;  1RT4 B;  3TZX A;  4OI2 A;  3PRV A;  2E1A A;  1VJQ A;  2GNK A;  2BE7 D;  3MM9 A;  4UOF A;  2MY7 A;  4NEZ A;  4TLQ A;  3VQT A;  4DV2 J;  1FNO A;  5LT5 A;  1TFW A;  3W2W A;  4IG3 B;  1KEK A;  1KVJ A;  1C1C B;  4CCH A;  1U8S A;  3OQ2 A;  2FIU A;  4EYH B;  2QYC A;  1UW9 A;  3GV5 B;  1X31 C;  5C2C A;  4K50 A;  1HNZ J;  5KAK A;  1S4E A;  1NND A;  2YKO A;  2BR0 A;  3CC2 S;  1FRL A;  1PIE A;  3V2U C;  1B7Y B;  1L3S A;  1A9N B;  2J0X A;  4I67 A;  4RNM A;  4ENO A;  2NR0 A;  4A8F A;  1U2F A;  2AZ3 A;  1F3V A;  1M5V C;  2XYG B;  1WDT A;  1FXD A;  5B0C A;  2HZA A;  1ZM2 A;  1X4F A;  3HJV A;  1G6B A;  2AKW B;  1MN9 A;  3ZTS A;  2IJF A;  1SQF A;  4JI3 J;  4DEZ A;  2DIU A;  4HI1 A;  3LPY A;  4ZVG A;  3EGV A;  1Q8L A;  2YWF A;  1D1U A;  2F40 A;  2BAC A;  2B4O A;  1G1X A;  2HFU A;  1QJH A;  2VF3 A;  3G9C A;  4DZ6 A;  4DL3 A;  4JI2 F;  4AXI A;  5IV4 A;  4O3N A;  2A2D A;  1Q16 B;  2DNL A;  5B0D A;  1H2U X;  3D54 A;  2WTF A;  1U45 A;  5CHC B;  1UAW A;  1H74 A;  3H90 A;  5IM0 B;  5LM7 E;  4YR0 A;  1JNR B;  1SV5 A;  2N3O A;  4OJH A;  3QRR A;  2VPX B;  5DG9 A;  3LTO A;  3JS9 A;  3LWL A;  2ZUG A;  4CO0 A;  4CM2 A;  4N8O A;  4NLY A;  3HT0 A;  3NXZ A;  2C2K B;  5L1K A;  1T05 A;  1S1X A;  2PDA A;  2HBZ B;  4BLG A;  2HHX A;  1Z2L A;  2XC9 A;  4FYV B;  1YIT S;  4OX6 A;  4C8N A;  2XTJ P;  3TAR A;  1FDB A;  4ITS A;  2FZK B;  3R5G A;  2GO9 A;  3HP6 A;  4DPX A;  4UY8 5;  3NNC A;  3M6V A;  4KGM A;  4FF4 A;  3HSD A;  3M2V A;  1ARO P;  2V4R A;  1SXL A;  2B9W A;  1FRM A;  3NY0 A;  4QJV A;  3BM7 A;  1Q78 A;  3W2W B;  4Y2C A;  1S6O A;  2OAU A;  1XBW A;  2RIL A;  1BY9 A;  3CED A;  3KJQ B;  1M5K C;  2VFS A;  2YH0 A;  3PW7 A;  1NSK L;  3H25 A;  2FY1 A;  3HKW A;  5DM7 Q;  3JXO A;  4ANE A;  1A7G E;  2CPI A;  3QO9 A;  2KH9 A;  3N6M A;  1RU2 A;  1XR7 A;  2UUB F;  4WPA A;  1HBU A;  3GJT B;  3G6Y A;  4LVO P;  1TEL A;  3SSR A;  3MMC A;  3AB2 B;  4OL8 A;  3GIM A;  2ILY A;  4FDF A;  3THT A;  2YNH A;  4LF9 F;  1KTQ A;  1RAF B;  4OMF G;  3MFI A;  2RQK A;  3M1V A;  3GV7 B;  5EX0 A;  1R31 A;  3H4D A;  5LMU J;  2VQF J;  1RIS A;  2QLW A;  4IH6 A;  4DR7 J;  3IN5 A;  4KC5 A;  2PEB A;  1UZD A;  4QW9 A;  3GON A;  1WD6 A;  2CXE A;  4ZPC A;  1FRH A;  4X4R A;  4C8O A;  2HHW A;  5KFM A;  2ZJR Q;  1TKX A;  3C19 A;  5C7P A;  1BE4 A;  1WSR A;  5HQL A;  4LVN P;  2E1C A;  1S9G A;  2FB0 A;  3O6Q A;  2K7J A;  2LMI A;  2CPZ A;  4DU7 A;  4NCA A;  1NKB A;  3DLG B;  3GYN A;  2OH2 A;  1PAU B;  2M9K A;  2RIJ A;  2I0X A;  2QJ3 A;  3MED B;  4DHV A;  1LWE B;  2NLW A;  3JTP A;  3MTK A;  5L8R C;  4O23 A;  1VBK A;  2QLX A;  1NK8 A;  1SV5 B;  1G4C A;  2LU2 A;  4OHX A;  3R7N B;  3BDE A;  2BJ1 A;  4RLE A;  2MZS A;  2AD9 A;  4K4U A;  4X4N A;  3CO9 A;  1EHW A;  3BGU A;  3GFX A;  1T05 B;  1P8G A;  4TQS A;  1S1X B;  1N5S A;  2HK3 A;  2VOD A;  1TKT B;  2V94 A;  2KB2 A;  5KFX A;  2UXD J;  1SH3 A;  5FLX Y;  4GO5 X;  2GIF A;  4MYU A;  2X1F A;  2RHS B;  4DR3 F;  2WSF C;  1WC6 A;  4HHJ A;  3VZI A;  1I3O B;  1MMD A;  1T03 A;  4QPT A;  4DFK A;  1F9E B;  5L1I A;  2ZVS A;  1U1Q A;  1RAO A;  4WK3 A;  1JLE A;  1KNZ A;  2RUG A;  1OY8 A;  1T95 A;  2RJZ A;  1DJ0 A;  5C42 A;  2I2Y A;  3CCL S;  2IVY A;  3HZE A;  2IA6 A;  5HVH A;  1VRT A;  3RYL A;  3T1H J;  1P1L A;  4ZCI A;  2XSJ A;  2J9D E;  4AE5 A;  2K8G A;  3M8P A;  1M5H A;  1Q82 T;  2F4V F;  3I0R A;  4ECU A;  4PAB A;  5DZ6 A;  1HBU B;  2D3O 1;  3BSA A;  3Q8S B;  3MMC B;  4H54 A;  4UQG A;  2K3I A;  4KAI A;  1KON A;  3IBC B;  4FYW B;  2LVW A;  2ZWP A;  1YRT A;  3M1V B;  1U1R A;  1RT6 B;  2J76 E;  3Q22 A;  4IH5 A;  1WHY A;  2LP4 A;  4TXS A;  3NAI A;  3RZA A;  2F65 A;  3AA8 A;  5E3A A;  2J6S A;  4I1T A;  4X65 F;  3WX8 A;  5KG5 A;  1TKX B;  5HJY A;  4F36 A;  1R0B G;  1JKH A;  3CXC R;  4URG A;  1S9G B;  4F2R A;  1SL0 A;  3AFG A;  2F8E X;  2PE8 A;  1VCT A;  1F5C A;  2XYP B;  4GKK F;  3FNN A;  2RML A;  1K73 T;  1TV6 B;  4JV5 F;  1WG1 A;  2VQE J;  3NG8 A;  1UA0 A;  2AGO A;  3NMA A;  1T0T V;  1FRX A;  2C2N A;  5DM6 Q;  2YX1 A;  4JUZ A;  4PG6 A;  1NSA A;  3OXG A;  4QWE A;  1KQF B;  4G3I A;  1R0A B;  2XMU A;  1HD1 A;  4J37 A;  4DF8 A;  4ED1 A;  3I9Z A;  3BRE A;  4C3K A;  1YDL A;  4I2P A;  2VFV A;  3UD4 P;  1YJ7 A;  2V69 A;  1IR0 A;  4KV8 B;  3G82 A;  2Z2Z A;  2YY3 A;  2AF6 A;  1HNV A;  1KOH A;  5LMU F;  2BM1 A;  4DR7 F;  1P9Y A;  3U7J A;  5KFZ A;  4X4O A;  4DQS A;  1XMQ F;  3A13 A;  4L6V 3;  3T1A A;  3BO3 A;  4YB7 A;  3P5B P;  4DUY J;  2VBZ A;  1JJ4 A;  4MTP A;  2CZ9 A;  2HIY A;  3P49 B;  4A8X A;  4QU7 A;  4TNO A;  4ZCL A;  1UEU A;  4IH7 A;  1ZS6 A;  4WU3 A;  4DSL A;  3MMA A;  5CCM A;  3MUT P;  2DH9 A;  1S79 A;  1HNI A;  3M05 A;  1HA1 A;  1DQ9 A;  4DCO B;  1JLE B;  4NA3 A;  2V2Q A;  1UWB A;  4J91 A;  5C42 B;  4DCJ B;  2CJY B;  1UVI A;  4ZPB A;  1VRT B;  3MPV A;  3KK2 A;  3LQV A;  2JLG A;  4KHP J;  4HEA 9;  4HHH A;  4DUT A;  2AGP A;  1N0V C;  4CO2 A;  2JOQ A;  4K8R A;  1S1T A;  4OHW A;  4QBU A;  4B3S J;  2B4U A;  2DNM A;  2JWN A;  4NLT A;  1RHR B;  5F9N A;  2FGO A;  2YNI A;  4CLP A;  1VQ7 S;  4X4Q A;  1N34 J;  5CD4 A;  4ZA1 A;  5HL7 Q;  1NK4 A;  1IBC B;  3RUB L;  3QWP A;  4I6W A;  1NHK L;  1MWQ A;  2I8E A;  2I6W A;  1WHW A;  4TN2 A;  3MTJ A;  2LQB A;  2QSW A;  1JKH B;  2WB4 A;  2KT2 A;  1WC3 A;  3CJ8 A;  3M9O B;  2XMW A;  3VVU A;  5IT9 U;  3NGR A;  3CUN A;  2NCK L;  4OX9 J;  2W4P A;  4PQU A;  4NRT A;  3TJA A;  4MIB A;  4OYW A;  4Y0F A;  1E6Y A;  3N6N A;  1ZAX A;  1WG5 A;  1S6P B;  3ILL A;  1U0S A;  2Q6C A;  2HND A;  5L39 A;  3AA9 A;  3L4B C;  4YR2 A;  4H4M A;  2ZBQ A;  2OJ3 A;  4I2P B;  3R7S B;  3H5S A;  5E3Q A;  3LP0 A;  1GXU A;  1AZS A;  3PIO Q;  1VC5 A;  2D9O A;  2F8H A;  4QWD A;  1RTD A;  4AL6 A;  3EPG A;  1TAQ A;  3G82 B;  2ACM A;  2PD1 A;  2UP1 A;  2CPY A;  2QSF A;  3C2P A;  4AFF A;  2OPQ B;  1RWU A;  2B4V A;  1EAR A;  5IC4 B;  2F8M A;  1OYE A;  2RRN A;  2MXY A;  2PMW A;  1NHV A;  2C22 A;  1JLB A;  2XNR A;  1AUD A;  2HVI A;  5D8H B;  1R6V A;  2V4Q A;  3QGI A;  4ECV A;  2YTC A;  3UD3 P;  3MMA B;  4KGK A;  2DYA A;  2ZZT A;  1HNW F;  2R8G A;  2QO3 A;  3UWT A;  1QSS A;  1L3T A;  2DGO A;  4Q5V A;  3DM2 A;  1UWB B;  1VLO A;  1YJT A;  3VGS A;  2H48 B;  3KK2 B;  4UY8 T;  2H4Y B;  2DIT A;  3LP2 B;  4RW4 B;  3V4I A;  1U47 A;  4DJB A;  5HLF B;  2IRX A;  4ZK7 M;  4YUD A;  2CNL B;  3DU6 A;  2L9W A;  1X5O A;  4FBT A;  1WF0 A;  4CTA A;  4O4R A;  2VUG A;  1W2B R;  2VBY A;  1DAR A;  3MD3 A;  2H54 B;  4BCA A;  2XZT B;  4QWC A;  2OPS A;  4Q2L A;  2GS8 A;  3M6U A;  2CPJ A;  4AD6 A;  2WK4 A;  2MGZ A;  2C1E B;  2E29 A;  3OUY B;  2W25 A;  2VL1 A;  3FCV A;  5JXS A;  3J7Y I;  1VQO S;  2M7S A;  3BGO P;  2IYG A;  2YH1 A;  5IV3 A;  1SB6 A;  2J0Q D;  3GIK A;  1BGX T;  3MEE A;  1PBA A;  1GH8 A;  4DV6 F;  5C5J A;  1JLQ B;  4OYI A;  3EXC X;  5I42 B;  2CDR B;  4LR9 A;  3PX6 A;  4R5P B;  3BR9 A;  3PEJ A;  2QMU B;  1XEZ A; 
#chains in the Genus database with same CATH homology
 1HHQ A;  1EHW A;  2HVD A;  4ANC A;  3FC9 A;  3Q86 A;  3NGS A;  1NSQ A;  3ETM A;  2BX6 A;  1W7W A;  1F3F A;  1UCN A;  4UOG A;  3EVW A;  5CAB A;  3EMT A;  3NGT A;  3VVT A;  5BXI A;  1PKU A;  3VGS A;  4DUT A;  3FBC A;  3FBE A;  3PJ9 A;  1HIY A;  2CWK A;  1MN9 A;  3G2X A;  3EJM A;  3ENA A;  3EM1 A;  3BBB A;  3PRV A;  4O0N A;  3ZTS A;  4KPC A;  4EK2 A;  5CAA A;  3EIC A;  3ELH A;  1HLW A;  1NCL A;  1NPK A;  4F4A A;  3VGT A;  4UOF A;  1XQI A;  3Q8U A;  2DXD A;  3FBF A;  2DXE A;  1PAE X;  1K44 A;  3VGU A;  1LWX A;  4CP5 A;  3EVM A;  3B6B A;  3GP9 A;  4C6A A;  1NSP A;  1U8W A;  3FCW A;  4DZ6 A;  3DDI A;  4S0M A;  1XIQ A;  1NB2 A;  3DKD A;  3GPA A;  1B99 A;  2HUR A;  4UOH A;  3FBB A;  5C7P A;  1BE4 A;  3Q83 A;  3Q89 A;  3ZTP A;  1NLK L;  3Q8V A;  3B54 A;  3WX8 A;  1NHK L;  1S57 A;  3FCV A;  2ZUA A;  2AZ1 A;  3EVO A;  4F36 A;  3BH7 B;  3EE3 A;  3BH6 B;  1NDK A;  1NSK L;  1WKL A;  2DXF A;  2HVE A;  1MN7 A;  1BHN A;  1ZS6 A;  4FKX A;  3ZTQ A;  3BBC A;  1S5Z A;  4WBF A;  3FKB A;  3ZTO A;  2VU5 A;  1NUE A;  1LEO A;  4ANE A;  4W98 A;  4HR2 A;  1NDC A;  2B8Q A;  2DY9 A;  1NDL A;  3MPD A;  5IOL A;  1B4S A;  4ENO A;  1F6T A;  2B8P A;  4DI6 A;  3JS9 A;  1BUX A;  1WKK A;  2AZ3 A;  3VVU A;  2DYA A;  3NGR A;  3VGV A;  1KDN A;  4FKY A;  3NGU A;  2NCK L;  3BBF A;  3Q8Y A;  3R9L A;  1VYA A;  3ZTR A;  1NDP A;  4AND A;  1WKJ A;  2BEF A;  1S59 A;  1JXV A;  3L7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...