4M5NA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'HMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5nA00
1RAOA 1TMMA 3HSZA 3HSJA 3MCOA 3ILIA 5ETTA 5ETLA 2QX0A 5ETRA 1IM6A 5ETKA 3HSGA 3HSDA 3KUGA 1HQ2A 4M5LA 1HKAA 3ILLA 3MCMA 5ETQA 4AD6A 1RU1A 4M5HA 4PZVA 3KUEA 2BMBA 1TMJA 1DY3A 4CYUA 5ETVA 1RB0A 2F63A 3HT0A 3ILOA 3MCNA 1F9HA 1G4CA 4CWBA 1Q0NA 1EX8A 5ETPA 1RU2A 1RTZA 4CYUB 4M5GA 1EQMA 4M5IA 2F65A 3ILJA 5ETOA 3UDEA 4M5JA 4M5KA 4M5NA 4F7VA 1CBKA 3KUHA 2CG8A 3QBCA 3HCXA 3IP0A 1KBRA 4CRJA 3HD1A 1EQ0A 3UDVA 3UD5A 5ETNA 5ETMA 4M5MA 3HD2A 5ETSA
chains in the Genus database with same CATH superfamily
4CO3A 4DR3F 3NCPA 4USVA 4YB5A 3PNIA 1CS4B 3DRXA 2CNNB 3QIDA 2LU1A 3A8KA 3PYFA 2ZDPA 5CA5A 3VAKA 2CDRB 4DR4J 2Q3PA 3I56S 3TWZA 1ICEB 3BQ1A 1NBEB 3MOJB 2FGCA 3VV2B 2UUCF 1U6BA 3RW6A 3IFEA 4J9PA 1NH7A 2O1PA 1XC9A 3M8YA 4M5IA 4K8RA 4M5DA 4NMXA 2MHEA 2EG1A 4WP8A 4O23A 2ZBQA 2OSRA 1AT1B 3M1VA 3TOQA 2H48B 2KXFA 5KFNA 2J8SA 5LT5A 3M05A 3P96A 2D69A 2OH2A 4PWWA 4I56A 2QYCA 2CA9A 2LXFA 3BYRA 1HQEB 4DI6A 4F0MA 2OI2A 4O4GA 2IBOA 2FQQB 5T41A 3M8PA 1MN7A 1IKVA 3A13A 2OFGX 1YJTA 3W61A 3JAMY 3TVYA 2OPPA 3HVAA 2DNMA 3W2VA 2BJ3A 1IKXB 3Q8UA 1O0PA 5KG1A 2M4MA 4DV5J 3B4DA 2M8DB 4LF4F 4LMZA 1YJ7A 2RD5C 5IC4B 3CJRA 2VDIA 1CJKB 4IFVB 3Q8RB 1HI8A 2A1BA 5KFWA 2CPYA 1RAGB 3FJ2A 3Q8VA 1Q53A 1T11A 4UY85 3MEKA 4K2JA 1LEOA 4ZCMA 1O51A 2AIRB 5HP1A 1RAFB 2HVHA 1ZETA 1XR5A 4F4AA 5E7OB 1JMTA 2R8IA 1N0UA 1R0CB 1MU2B 4U8YA 4XTTA 4NMLA 2ZH5A 4CYUB 3BPSP 1CJUA 3SV3A 2EWHA 2ZDOA 4DOZA 2GHWA 3TARA 3OFHA 2DNPA 4CLPA 3S1TA 2ZWOA 4C7QA 1FRJA 2PO4A 1WACA 5J2QA 3FEYB 4I2PA 5L9NA 2FHMA 1WJ9A 1K1SA 1HHSA 3TZZA 1Q7YT 1M5SA 3C6UA 4CQ1A 3CO9A 2V2KA 4F36A 4CRJA 1VOMA 4URQU 4KV8B 4QR2A 2ZJQQ 1ZM4A 2UUTA 4LRBA 3KK2B 1FX2A 2DGUA 3RR7A 2NXUA 2MXYA 5CABA 3RRGA 4DV0J 2BKOA 4H4OB 2GAGC 2VFTA 2YX7A 3RBDA 1UVMA 2AZ3A 2XB2D 1I1GA 4I1TA 2P9EA 2YTCA 2RVJA 2V2QA 2KKHA 3O2IA 1SJQA 2MKYA 2VG7B 2KRRA 4R5PA 3OL6A 1EETA 1URNA 3G87A 4K4WA 4ES1A 3WQPA 2W25A 2GVZB 4JI7F 3FQKA 1LWEB 2XMVA 5AE2A 4IUFA 1TL4A 3RAXA 3TZWA 2FGOA 3IBWA 2MSTA 1Q95G 1EQMA 2H9ZA 2MB0B 1GAOA 2K3IA 2R7SA 4C8ZA 2MZ1A 2F4VF 3PW0A 3ONQA 2N82B 2ZZTA 3A3NB 5CXTA 2AEMA 2A0FB 4A8WA 3SCLE 2HGNA 1F3FA 2AW0A 3QRPA 3M2VB 1RACB 3K5NA 1HL6A 3OTOJ 1NJWA 1RWWB 2PC6A 1QDUB 3Q24A 4DPOA 2V4JB 2L48A 2IJNA 4J91A 2V6AA 3QAUA 4A8SA 3O1LA 4EBDA 5KOWA 1CULB 3D6FB 4MYTA 1XERA 2H5IB 2OUGA 3JYTB 3A8JA 1Y00A 3D0HE 3AHPA 2OPSA 4ZVOB 3VAJA 2E1CA 4PG5A 4OX8A 4FYWB 2GIRA 4ANEA 3QMQA 4DXLA 1JLEA 2FJVA 1RHKB 3A3PB 4LFAJ 3K17A 4MFBA 2UVUA 2ZITA 3NLCA 4KTQA 1M5HA 2WB4A 3TZXA 1FXDA 3NNCA 5ETOA 2MEWA 4WTYA 4QIEA 4YN3B 4BC9A 1W26A 2RE1A 2PA3A 3BN4A 4NLOA 3GQCA 3JSMB 1F60B 3OT9A 2CQHA 3OR1B 3U27A 2G0IA 2YKQA 1WC3A 5F0UA 1GQEA 2V4RA 3ENWA 4WFBQ 3D1OA 4YR2A 4TY8B 2RUGA 5HVHA 5IM0B 1HWKA 1IKWB 1LFWA 4GC6A 3BGFA 4AL5A 4FF1A 3BF4A 1UZHA 5HL7Q 3V6DA 2V4QA 2BUNA 2YKMA 5AXLA 4DUZJ 3R97A 3LP2B 5K20B 3CSKA 5LMNJ 4E0DA 4S0MA 3HVTA 4I6YA 3ZXWA 1JK9B 2QL7B 2V69A 1FD2A 3W9JA 2GCFA 5HANA 1EKRA 1R6YA 4IG0B 2B7BB 3D28A 2RILA 2B4PA 2WVCA 4ZIVA 3N79A 4NLGA 1X9SA 5F3TA 4Q44A 3W9HA 1G3OA 2NXJA 5HVFA 2AHOB 4XK8C 2WBMA 1VYAA 4C6AA 3LPYA 1D3WA 5A8KA 3AD7C 3I5CA 1XMQF 4HKQA 2CQBA 2F3JA 4O3QA 3DMJA 3GV5B 4DPXA 4M63A 3QFHA 5AJ3F 5GAEU 1G4CA 2XLJA 2YKNB 1XN9A 1HR0F 2EI5A 3HSGA 1RTJA 1SIZA 1LNQA 4RW6A 2VG6B 3LOUA 2BJ1A 4OYWA 3LA0A 5DQGA 3JS9A 3KLEA 1HFEL 4X2BA 4ED5A 1AROP 2AYEA 4RU2A 1U25A 2PT0A 2E7WA 2D9OA 3HVWA 4NLYA 3UE2A 3KHRA 3L7OA 1JJCB 4LF4J 1TL7B 4DR6F 2HBYB 2M2BA 2VHGA 1VRUB 1MROA 2F9JA 5JXSA 2MY8A 5BYRA 2YX4A 2JZ5A 3CNQP 1S1UB 1RTZA 4M95A 1ZOTA 4KKOA 4Q0BA 1C1BA 4IRKA 3E8OA 1DFDA 2Y1RI 1LW0B 1TMMA 1TK0A 4DFKA 2DT9A 3W8PA 1TUGB 4BWJA 4GRSA 3SDEB 4G1IA 1XQIA 3T1HF 1NZ8A 1S1XB 2JEJA 4M8LA 4HI2A 3TAMA 1BQNA 2OPQA 2Y1IA 3MWBA 4X66F 3T19A 2W2NP 2V34A 2VQFJ 3JB9k 2HFSA 2MSSA 4OX7A 1ELOA 2WZ1A 5J1NA 4F3QA 1Z2LA 4B9UA 2LEBA 2LU2A 3RU0A 4ZVRB 1SH0A 4ZPWR 1UMJA 1HARA 4ZPAA 2PMHA 3F73A 1FERA 4NX9A 1HD1A 2AD9A 1UPMB 1PJ5A 3EE3A 3M9NB 3KLIA 3D67A 1SQGA 4K4XA 3MOZA 3KHHA 2XO7A 4FXVA 1HNVB 4E8UA 2HNYB 3P45B 3JQJA 3I4HX 5CYMB 1NNDA 4ILMA 4BC7A 5C24A 2B4OA 4RWWA 4JI7J 1DBDA 3I4PA 5SUHA 1NPPA 2YNGA 4I6AA 2Z30B 3DKDA 1TVRB 2WSEC 3EZUA 1T9YA 4LUBA 4ES2A 4IO1A 1RUSA 2YX1A 3NY0A 3M9OB 4PXEA 3LPEA 2KM8B 1SUQA 3IS9B 3QO9A 5FLXY 4PUOA 5DLFA 1YKWA 2G0CA 5L1JA 3NOGA 3VVTA 2KFYA 4JI4F 3CD7A 7FDRA 2OTJS 4EK2A 1RB0A 1KC8T 1FTCA 2O3DA 2HEKA 3M32B 4OL8A 3OR2B 3KYLA 2L9WA 3AJDA 2CG4A 2VFVA 3BGOP 1QLNA 2JOQA 4FS2A 4OJGA 1U6FA 4B3SF 4DFMA 2UVRA 4UY8T 4B3OB 3I32A 1J2VA 4OZ3A 2HPUA 4EMDA 2FHKA 4J9VA 5HSPA 1Y7PA 3MMJA 2P9CA 4EBCA 2KN4A 3EXCX 2FZGB 2RRAA 1RT4A 3PX6A 1UJ6A 4K4VA 1P1TA 2AV5A 2V9KA 3KLFB 1Y5IB 1JLBA 4GVBA 1L3KA 1S57A 2MKIA 1WC1A 2E66A 1LWFB 3GJSB 1KLNA 2FVPA 3WC2A 2NUUG 3PYGA 4M5GA 2WW4A 9RUBA 4F4XA 5GMDA 2IA6A 1RAAB 1S1VB 5K5MA 2KT2A 2J8AA 2VPXB 4MTPA 4DN9A 5KFAA 1DJ0A 2QYGA 4I2QB 1LV5A 4KB7A 4EZ9A 4M94A 4FYXB 1FWPA 3DLBA 1HQUA 4LSLB 1PCAA 1X4DA 1S5ZA 2WOMB 4DPYA 2VASA 3KHLA 2X3GA 1WSRA 3V6HA 2VU5A 2DNLA 4XAKA 3DFEA 3V5RA 1CQNA 3DN9A 2EPIA 5EGYA 3VF0B 1R0AB 1WC4A 1TKTA 4IDKA 1S9EA 3BBBA 1F9EB 1KFSA 1QVFR 4H4KC 2GMHA 3EPGA 2IBKA 1TKXB 4UZCA 3HFKA 1WHWA 1RTDA 1KDNA 2GHPA 1P8GA 1U24A 2D3O1 5EX0A 2RJZA 2XTJP 1WC6A 2EBEA 2B8QA 2QRRA 3ZFVA 1KEKA 5DG7A 1P9YA 1QAJA 1VISA 4TYBA 3R7SB 3GYGA 3DRRA 2CG8A 3RG6A 1JLGA 2VBZA 2X1BA 4PKDB 1OSDA 1B7YB 2UUWA 3TUIC 5I42A 4ER8A 4FN5A 2W9BB 3G6XA 1S0OA 2KT5A 4OZ2A 4RUBA 1CJTB 1G6BA 4RNMA 3A8EA 1JLAB 3RBEA 1NHVA 5J2NA 4PWUA 1YDLA 2DGWA 3DOMB 4J9UE 3G82B 4Q8EA 3AD8C 3TA2A 3OJSA 5D78A 3RRKA 1M5VC 5AJ3J 1V9OA 3C16B 5L8RC 1RK8A 4KGXB 3CMES 1NKEA 2AQ4A 3SCIE 3D0GE 3D2WA 1Q16B 2JFDA 2DNGA 4ICLB 2KYZA 2WB1D 2Y3YA 1WG4A 4ZPDA 3UI3A 2DIVA 4LRAA 2FD2A 2J9DA 2V8PA 3QFWA 2BRLA 3MFHA 3B82A 1X5TA 1H98A 3RBXA 1D8YA 3GR1A 1KR4A 2Q6CA 2J0SD 1VIXA 5BYQA 3SFGA 3OLAA 1U2RA 4MH8A 2V8DA 4I7FB 3V81B 3HD1A 4KGKA 3W64A 2B8PA 3BBFA 4HI1A 3ZTSA 2QMUB 1VFJA 1YBUA 4KE5A 4DR6J 3DYAB 1UZDA 1UL3A 1UPPA 5DM7Q 3IGNA 1VQ5S 3H8YA 3NNHA 1DQ9A 2MLZA 2DNOA 1IQTA 4J9RA 4MMOA 4NLWA 2AJQA 1YJUA 4JI3F 1WEXA 3DOLA 3NXZA 3L95X 1XJWB 4GO7X 3RB3A 3T1HJ 1NHKL 4WXWA 3H2VE 4PG6A 2W9AA 2B9EA 3PO4A 2YWGA 2XMWA 1SXLA 1F9HA 4P75A 4AXJA 3OUYB 5F41A 3NGRA 4LFCJ 1X7VA 3G8SA 4UZBA 4X66J 3ET6B 1S6QA 3EJMA 5BR8F 4ATNA 3MEDA 2RKIB 2YNFB 1TV6B 4IFYB 4OLOA 1FKOB 5KT6A 3S01A 2XY7A 5A8WB 3UFCX 1SJ1A 2HRUA 4PAAA 4NYZA 2X1FA 2YPZA 3I0SB 1J5OB 2FC9A 4NA1A 4CLKA 5CAAA 3MFIA 4ZP9A 2KHDA 3NGKA 4ID5A 3HO1A 1Y11A 2HLUA 3PIPQ 4FS1A 2A10A 2CQPA 4GO5X 2RDDA 5KFUA 3N5FA 4RLEA 1OO0B 4L6V3 5A2QU 1MN9A 3MMBB 4LREA 3Q8SB 4UOCA 3IRXB 1S1TA 2L9NA 3MMCA 5KG4A 1CJVA 4KJIA 3RB0A 4OI0A 3PTWA 4ES3A 2FY8A 3UD5A 2KU7A 3M9MB 4RW9A 2XNQA 4FVMA 4NYPA 4G6VB 1X4FA 3GFZA 4KRWA 1TR0A 4X4VA 3GLJA 5CQGA 2J9DE 3FCHA 1FTRA 3MM9A 1RT6A 5LM7E 2KVIA 1L3TA 4DV4F 1XBWA 2GQ2A 2WBRA 4X4RA 2M5YA 1T03A 3R1LA 1B64A 1D09B 2XC9A 3V4MA 4LJMA 2J6TA 4K4ZA 3D1QA 3TVZA 4WK3A 1ZS6A 4Q45A 2CNOB 4YOEA 3KUEA 3OXLA 4A8FA 3DRPA 4LF5J 2ZH6A 1DHMA 4MJKA 2W9CB 3M6VA 4RUCA 2DRAA 4DUTA 2Z56B 1XNQF 5ETSA 3I9V9 3KK3A 5H1SV 3ENVA 4HHUA 1NKCA 1MMDA 1NK9A 5IV3A 4MKBA 4NLTA 2EK6A 2MPUA 2MY7A 2ZH2A 4NLVA 1N5YB 3NCQA 2GMJA 3MPDA 1TL1B 4PR6A 4CLSA 1CC8A 2LQBA 2UU9F 2YWEA 1QAIA 1SL1A 2HFVA 4ECRA 5T7LB 1UFLA 2RHQB 3KDOA 3CJKB 1F5AA 4U7UK 4QWAA 1VMBA 1U1OA 4V19X 4K59A 7FD1A 3LWLA 4DV6F 1NZAA 3MM7B 2DNKA 2MTLA 4AE5A 1Q1KA 2OLWA 1R8CA 1S6PB 2FZCB 3TUJC 3ZTPA 2E9RX 4FF3A 2C2OB 3T5HA 5B0EA 3OXFA 4DJBA 2CJ9A 4ECSA 5I3UB 3FBCA 5KTQA 3IWXA 4C3LA 1N6QA 3U02A 1K44A 3B4MA 2FHJA 3MPUB 2BANA 3HP6A 4WFNQ 2YNHB 2JWNA 2VDHA 3LGMA 3NCRA 1KFDA 2KO1A 1XNRF 2M3DA 2BBEA 2EK1A 1RI7A 1VK8A 1REGX 2CVEA 1GX5A 1WOPA 1R7IA 1U47A 1YZ6A 5GMKa 2DXFA 2J6SA 3SQOP 4M5NA 5G4DA 4J9MA 1C4CA 1QSLA 3IN5A 2BQ3A 2VONA 3CCRS 1I3OB 4DQQA 3BKTA 2XSJA 2FB0A 3UDLA 4P2XA 1TMJA 4DV7F 4HH0A 1BGXT 1BMQB 2P6TA 1Q79A 4DQRA 3D6MB 4NXNJ 5FDLB 4DZ6A 4KO0B 4QR0A 5K8MA 1Q8BA 2M8HA 2XMMA 1LWCB 4J90A 1FDDA 2HNDA 3QBCA 1R0BG 3EGVA 1RAOA 2DNZA 4PWDB 2MLXA 2VBWA 3TI0A 4MK8A 3BDPA 3PYDA 2HHUA 4DFJA 5B0CA 1WOOA 5HBMB 3N6MA 4KR0B 3UR3C 3CPWR 1X9WA 4B9MA 2DH8A 1PGZA 3ZZRA 4BDPA 4HTIA 2V8GA 2I5JB 4DSFA 3BSCA 2J0WA 4KQZA 5JUMA 4N5SA 5G0RB 1TTHB 2K2PA 1YRXA 2D3OR 1GH8A 5GAGI 4RX6A 2XCAA 2K1RA 5KFTA 2FHOB 1TZ0A 3D0IE 5U47A 3RB6A 5B0DA 2BE2B 2LCWA 4L74A 4MT1A 2GFFA 5HQMA 4TYAA 4O44A 1C2PA 3BJYA 4QR1A 1RT3A 1YVFA 3K5PA 2VV5A 4FZVA 3SMZA 5KFPA 5DDQC 5K14B 3TAQA 1C0TA 5L1LA 4DUYF 2LQ5A 3BQ0A 1S77D 1NK7A 2XZDB 2RNEA 1TUVA 3GIRA 5L9XA 2QLXA 1RYSA 4OX9F 3CMAS 1N36F 4NEYA 3GSDA 5D6GA 4ZHRB 2P2CB 3RRHA 1P9QC 4RUAA 4QBUA 1DTQA 2E5LF 5IT9U 2AEFA 1L3VA 2QG9B 4DPUA 1S79A 1U0SA 4JI8F 2CKWA 2RSQA 2JRSA 3PACA 3GIIA 3SQGA 3QLHB 1SKRA 5B7WA 4OLPA 2NYHA 1N32F 4C8YA 2RAQA 3W2WB 3DLGB 5HAOA 3JTOA 3QIPA 4GKJF 2MLYA 3CCSS 1N48A 4CDIA 1HYSB 1PILA 4R8UB 4KGMA 5DDPC 3DXSX 3PFEA 4P6QA 1RA7A 3H5SA 1SJ3P 2C2KB 3WC0A 4HT5A 2PFFB 3Q2TC 8ATCB 3U1LA 2V94A 2CQ3A 3OV7A 3H4DA 1VLOA 3LF0A 1S0VA 3O5TB 2B6AA 3FSXA 3PM9A 1NDPA 2VH7A 1F5CA 3P4UB 4Y2AA 2R7RA 1SKWA 4DSLA 2EBGA 2RB7A 1KWMA 3J7AN 2HFNA 2DXEA 1L5UA 3H90A 3R2DJ 4NEZA 2AJ4A 3O8WA 4NI2A 2IYIA 3W7BA 4M5DB 3CGIA 1GTHA 3Q22A 3TQEA 1FDAA 1N5VA 4HEA9 4U96A 2C42A 3M1VB 3Q86A 2DCUB 4KHPF 2SXLA 4RL1A 1AZSA 5F8NA 2DH9A 3CXCR 2YWHA 4CLZA 4DX6A 3FBEA 2VL1A 1H2UX 2X1GA 4O4GB 5A8RA 2ABYA 1RTIA 3MM6A 2FLOA 2VC0A 1BXNA 3KG4A 2IMWP 1IKVB 4BBYA 1F1BB 2HFUA 1AFIA 3PW7A 4DCPB 2OPPB 3W2VB 2OJ3A 3RUBL 3P3DA 1HHQA 3ZZUA 1XNQJ 4QYZK 2AEJA 5DQHA 4X64J 1FFGB 4PXCA 2FJDB 3QPIA 4CTAB 4C8OA 4F67A 2Z4PA 2KFNA 1MMNA 3NS6A 1T9TA 5GADU 1WTFA 3FRZA 5HP1B 1QAXA 1Y9OA 2V67A 4X4PA 2MQQA 1K0TA 1TFWA 2UU9J 2RMLA 1KONA 2JEIA 2QA2A 4QWBA 1X9MA 3L09A 3ELHA 3T3FA 3I6PA 2VZ9A 1CJUB 3LAKA 3ILIA 4OQJA 1KVIA 5J2QB 4I2PB 2AGOA 4DV6J 1MSWD 1URRA 5ETPA 5IOLA 4LBHA 4E98A 4EEYA 1YGYA 3C6UB 1S0MA 1Y5LB 3KG1A 2ZBPA 3ZTRA 3HHEA 4ZVSB 2D9PA 2ASLA 3BSOA 2W4DA 4BLGA 2XGQA 2FLNA 1NPRA 3K5LA 4DV3F 1IVZA 4DSKA 3HZEA 2DYAA 4F3OA 4JI6F 1TL3A 3TAPA 5L1KA 2IRYA 3OVSA 4R5PB 1NH8A 5CCLA 1XNRJ 4C8MA 1DTTA 3FBFA 4IRCA 4WPAA 1EETB 1Z2ZA 1FX4A 3EMTA 1VRQC 2ZM6F 5SZTA 4EI2A 4YFUA 4NE9C 4ZJOA 3NRBA 3NGSA 5D0GA 4LF1A 2ILZA 4ZA1A 2CVIA 3CB4A 1MNEA 1J5EJ 4NASA 2HMIA 4DV7J 3QT8A 1N54B 2IJRA 2AYGA 4IOAQ 2FJAB 4MYUA 1VLYA 5KAKA 4ZN1A 2HZCA 4LSNA 2DVIA 4ECQA 2M9KA 4LRDA 1KQFB 4WBFA 2JX2A 2J7KA 4B3MF 4DL4A 1GFWB 3AOCA 4PG4A 3AJ2A 4X62F 1VQLS 2FIUA 1M1GA 3BGRA 1EKSA 2MQMA 1FDNA 2LP4A 2V50A 4B3RF 3G82A 2MZQA 1TAQA 2DH7A 2JHEA 1NUEA 4UQGA 3C46A 3L7UA 1K47A 4PXDA 2N3LA 3I0RA 4EZ6A 2OPSB 4AUKA 2Q79A 2GVDA 4JI5J 1WF2A 2I8EA 2Y0SD 1YTYA 3JQKA 3GG0A 1Q5YA 2HURA 5KG6A 1NO8A 1JLEB 4ED6A 4ZPCA 3BB5A 1Q8IA 4OYXA 3EZ5A 4MFBB 4X4NA 3CW2C 1RAJA 4NA2A 3R5JB 3AB2B 2RQKA 3HKZD 4ECWA 5J1PA 2IFXA 2UZAA 1UVJA 2J6UA 4CM0A 4ETZA 2QN6B 1M5PC 1SPBP 5GAEI 3NOCA 2WSCC 5L38A 2XGPA 3GCXP 2BYCA 2XS7A 3MDFA 4B08A 2QSWA 4USTA 4NWBA 2RF2A 2DHHA 1Y3JA 2CQCA 4LR9A 2QLJB 3BR8A 3MZIA 1RAIB 1RT5A 3HSDA 3MXHP 2NS1B 4LVOP 4OX9J 2MGZA 1FXRA 4YB7A 3UW1A 5IT4A 2CYYA 3V6DB 1JLQA 2MZJA 2YKMB 3QT6A 4JI8J 2HVDA 4GKKF 4WIQA 4Y65A 2G2OA 1Y4ZB 2RQMA 3VAGA 3FCVA 2AU0A 3HVTB 1XIQA 2R2TA 2GZOA 3PCOB 3BREA 4QQBA 3KWMA 4LF8J 2HG4A 4CH7A 2LVWA 2W8KA 4DU8A 3QWUA 2XWXA 4ZP6A 2HYIB 1WHXA 1FT8A 3CIZA 2I6WA 3H25A 1QUVA 5HI7A 3NS7B 4K2XA 1R8HA 3D9BA 4PPDA 1LKZA 1YLXA 2HHPA 2MMYA 1NK6A 2GGPA 1UEVA 4ED8A 1YITS 2D41A 5A8KB 1N34F 4WF9Q 4C0OC 1ACMB 1H74A 4ZCLA 1Z4UA 2DGXA 3BEGB 1NJXA 1U2FA 1WWHA 3CJ3A 3IGVA 3MAAA 2PEBA 3G4SS 1WI8A 3TW0A 5HN0A 1RP5A 2CNLB 4K4TA 3DMJB 2RS2A 3N4WA 4HDGA 3AH6A 3QZ7A 1AYEA 2VD3A 1VJWA 3UO0A 2Y9HA 4F3MA 2KH9A 2KXNB 3DC2A 2I0XA 2HQDA 2OP5A 1NU4A 3UVJA 5F3ZA 2N4DA 5E3CA 1M5OC 1RTJB 4NZ7A 4RBUA 3G8QA 4RW6B 3TNVA 2FHJD 3D3BJ 4OHVA 3ZZPA 4B3TF 4DR1F 1HNXF 4IKAA 3KLEB 1DLOA 3IR7B 2FC8A 3UPFA 2M88A 3Q89A 3K8VA 4ZVHA 2CAJA 2QTWA 3IRWP 4TKTA 1NPKA 3MEEA 3UNYA 4DR7J 3OHBA 1HPZA 1NAQA 4WYWA 4KPYA 2QC3A 2XY5A 3RYLA 2CJKA 1K8AT 1MROB 2PMWA 1OY9A 3BBCA 4DR5J 2EFQA 2HQ3A 1RWPB 3D3CJ 4R25A 2NPIA 3EICA 4KKOB 4Q0BB 1C1BB 2IJFA 4IO9Q 2HGMA 5F9NA 2ALZA 1IBMJ 4ZPVR 4EFAC 2WONA 2GA7A 1RYRA 3I96A 4HT7A 4ZVFA 5MLCV 2K8GA 1U7LA 1VHIA 2LXUA 4CH1A 2DRBA 4OZJA 1UAWA 1PBUA 2ZOMA 3LQVA 2EC2A 1YBAA 4F2SA 4DQSA 2XG8A 3TAMB 1BQNB 2KRBA 4CO1A 2FY1A 5CHCB 2OPQB 3ISZA 1KSPA 3OFFA 4A8XA 3EWGA 2BJDA 1KTVA 4QWCA 4OX6A 1JJHA 2DGSA 1WKKA 4DL7A 4KH1B 2G2YA 3OFEA 5DETA 1WF0A 5GAHU 2FVRA 3TJ9A 2PDAA 4MKVA 3FUYA 2JJ4D 3J80Y 3CJ2A 2W7AA 2BKPA 3RAQA 4YR0A 3DOKA 2KM8C 3KLIB 4MIAA 3CD5A 3U1NA 3EGWB 3TA1A 4DV3J 3PYEA 3LGHA 1U1RA 1CSJA 3MM8A 4B9TA 4DV0F 4W90B 3A1YG 4F02A 1UWBA 3DDKA 2UXDF 4IH5A 2POKA 5DM6Q 5KG3A 2JEFA 1PBAA 1YWXA 3DLKA 3CE8A 5CCMA 1SJRA 1S72S 5C24B 4KC5A 2XBPA 2MYFA 4P2FA 4DR2J 1FNMA 1APSA 1G1XA 1YX2A 3HZGA 1RCXB 3R1HA 1U8WA 2YNGB 2BVZA 2CPHA 2DGOA 2J0XA 2LA6A 2VFUA 3V4IA 3QSYB 1ZBTA 2E5GA 2HFZA 1GT8A 1SUQB 2B0GA 1U8SA 1B7FA 3QO9B 3VCDA 4PUOB 1VK3A 5C5JA 2GX8A 2K7JA 4UUWA 1SH2A 1H72C 1QE1A 4RBVA 5EWGA 2IA0A 3NWRA 3RR8A 3Q8QB 2XS2A 3LH2S 2M7SA 4I6WA 1HHTP 4B3MJ 3AA8A 2EFOA 4X62J 1OS5A 3CJ4A 4MKAA 4PYAA 2NUHA 4Y0FA 1A6LA 1Q8KA 2R42A 3DU5A 2YKPA 4L3KA 1BQMA 2J9EA 1RTHA 4LBPA 4QWEA 3MUMP 5EWFA 4ECVA 2Q43A 2IHR1 3BPDA 2BJ7A 3VQTA 3KUGA 2IM3A 4ZOSA 3M6XA 1PC5A 3WHIA 1RT4B 5E41A 2E1PA 2JLGA 2ZKUA 3C3LA 3GE9A 4TNOA 4Y34A 1XWLA 1FVSA 1JLBB 2AYMA 4GVBB 3BKFA 1HBNA 2BM1A 6AT1B 4DQPA 3G8TA 3H5UA 4O3NA 3RW7A 1H7WA 2BE2A 4LFAF 2C3MA 4JUZA 2D74B 2ROEA 3GV8B 2CQ4A 3CDAA 1VBZA 3GP9A 2ASDA 3AAWB 2XMTA 3VHQA 5D15A 2GMLA 4LF2A 4ZPTR 3BGUA 1I5OB 2E5IA 1Y0HA 2IAJA 3ITHA 2YBVA 3VAHA 1B0VA 2DY9A 4WZMA 2LA4A 2XLIA 3OQ2A 1IKYA 1S9GA 1IXKA 3VAIA 1JNRB 1ROFA 4LF7F 2HBQB 1S7HA 3NGUA 4X4TA 1TKTB 4IDKB 1O5JA 2QV6A 1S9EB 5IC6B 2L41A 3VGVA 2CZ4A 2V8VA 4U7CA 1IUJA 4GKKJ 5A76A 1RTDB 2KI2A 5HJYA 5I4MA 1Q82T 3GYNA 3PRDA 3IXQA 1KRPA 4V19J 2ZOGA 4M5KA 1DQ8A 1TKZA 4UT4A 5LMNF 3DRRB 5KG0A 2N4CA 2ZH8A 3TANA 4DL0C 1RBAA 2YQ0A 2ZH9A 5A0YB 3NAHA 4R8UA 5E5NA 3UDEA 5I42B 4ZCKA 2VA2A 2BRKA 3GJQB 1XTZA 2A2DA 4J9QA 3GPAA 2R7TA 1N34J 1VQMS 2GV1A 5J2NB 1Q0NA 3M8ZA 1NMEB 2FDNA 1VQYA 3SCKE 2OELA 2DY1A 4DV2F 5CH7B 1PSDA 2R7VA 3PR5B 2BX6A 2BW2A 3SYZA 4LFBJ 4F50A 4KSEB 4KT0C 2Z58B 2LMIA 1L3SA 2HRYA 4ZLPA 3OL7A 2E7XA 2KG0A 1KOOA 3MR7A 4P52A 5D0EA 4W92B 1SB6A 1GXLA 4DX8H 3DNCA 3W60A 4B3TJ 1PO6A 4DR1J 1HNXJ 4ZP8A 3BS9A 1CC7A 3RTVA 4NZ0A 3K0JA 1FE4A 1X0FA 2Z0GA 1S12A 4B9VA 2UV8G 1CPZA 1E6VA 2B7CB 3P5TL 1ZAWA 2H5EA 3BH7B 1CLFA 2BJEA 2ZC3A 3VQSA 2VKRA 3C15A 4CO0A 5F8HA 1PG5B 4OZ1A 1D0EA 1YQHA 9ATCB 3PJ9A 2R7OA 4YR3A 3N6LA 4LQ9A 1N5TA 4WJBA 2IVFB 3D4JA 1OQ3A 1FJEB 1UETA 4CTAA 2CPZA 4U95A 3ZO7A 1H38A 1FESA 1KD1T 3W5XA 5IWAF 4YQWA 1HWIA 2XI2A 3DOLB 2GS8A 1V3ZA 2ZEJA 4KH0B 4LR7A 3OHAA 4OYBA 1B0PA 3MTJA 2B43A 2BE7D 1X4CA 5ITHA 1HI1A 4K7QA 3GZ7A 1YHQS 1TP7A 3ICLA 4DS5A 3M6UA 4WFXA 4N56A 1S6QB 1UA1A 3MEDB 1SC4B 3DGVA 2VKZG 3AXKA 4ZKAA 2VQFF 2PMZD 4I67A 4ECZA 3U1MA 4ID5B 5KFBA 3BM7A 4P10A 2V9WA 4RBTA 1M0SA 1C4AA 2F4FA 4UW2A 2RS8A 2G2ZA 2UXDJ 4DCJB 1S1TB 3MMCB 1T05A 2DNNA 1CJVB 4K4YA 5HROA 1RA6A 4G65A 2N7CA 3IR5B 2CPDA 2MHNA 3HD2A 3MR3A 2HHVA 4DF4A 3DGPA 4JV2A 4RW9B 2ZD1A 4Y00A 2V63A 3CVKA 4WFAQ 1OYDA 3OL8A 1FKPA 1PKUA 2ZHOA 1HBMA 4H4MA 3MM9B 1RT6B 4WKRA 5THWA 2R2RA 5AXMA 2BZ2A 1T03B 1A9NB 1C1CA 3LP1A 1EZZB 1KOHA 4C2MA 4ECTA 1YI2S 3PEHA 3NS5A 4NLUA 5KFMA 1MWYA 2B3TB 4X65J 4ED1A 3C8YA 1QM9A 3IAM9 3B8HA 2LECA 3M8QB 2YXLA 3GTYX 1FE0A 4PYDA 3DRPB 3PKMA 4ZLNA 1NK4A 2FJEB 1PAEX 4DSIA 3KK3B 1NHUA 3L4BC 2HIYA 1YBTA 3QT7A 2G1HA 2VUGA 4OV1A 2Q66A 4C8KA 2KVQE 3W8GA 4DQIA 4F4WA 3T1AA 2WK4A 4B9LA 4XPCA 2CQIA 3GMGA 4X4SA 4QPXA 1WDTA 2R9LA 2NSCA 1HBOA 3HULA 1Q5VA 2JC1A 1MG7A 1R43A 3EPIA 3AOAA 1R89A 2YKOA 1AUSL 4UTGA 1W25A 2OO4A 5CZVA 5AXKA 1RT7A 4P74A 4FYDA 3VGTA 3V2UC 2HHQA 2OMOA 3GSIA 2CQ2A 3F41A 3OSNA 5KFDA 4Y2CA 4FF2A 1UP1A 1YJ9S 3O6QA 3M8RA 1XK8A 4Q2LA 2ROPA 2NSBA 1T8EA 2R8HA 2XY6A 1PYSB 3GB0A 4CCHA 1EJ7L 5T14A 2UXCF 1N6QB 4DSJA 2ZKTA 2HQIA 1NM2A 4LF7J 4TVAB 4A8MP 2BANB 2Z2LA 4HDHA 3D7SB 1T9XA 5DGAA 4A8KA 1YZ7A 4FPIA 1LFPA 4HR2A 1NK0A 4C9DA 2YQ1A 5LSRA 3UD4P 1N88A 2Z57B 1YJNS 1UVLA 3ULHA 2GHVC 2XSJB 2DNHA 4QW9A 1VC5A 2K06A 2P5VA 4DL5A 1CVJA 2OGUA 2B5JA 1FNOA 2UV8A 4ECXA 3D5MA 1YK9A 1RHUB 1NDKA 3CJ5A 1R31A 2MKJA 3UCGA 2C2EA 2HVIA 1U1PA 2FTRA 4OZLA 2AZ1A 4NLQA 5B0FA 4PG7A 1TK8A 3UDVA 2RQCA 2HNDB 1NXIA 5DLGA 2FJWA 5EHHA 2I9SA 1U02A 3NMAA 2UUAF 1FJ7A 5DDOC 1CBKA 4DV2J 5LXYA 1KNZA 2IM0A 3GJRB 3HHKA 3LTOA 3QT5A 1TUWA 1VQSA 2R8KA 3ENQA 3KOAA 1HWJA 4F8RA 4NPOA 4DLEA 5IQQA 2UXBF 2K1RB 2ZH1A 4NLXA 4K0KJ 2XYGB 1I51B 2RHSB 2R7WA 1GTEA 2RRBA 2JVRA 2LYVA 4FKYA 2CJXB 1NRKA 2VFRA 3CCZA 3SEOA 1UVNA 3AT1B 4CH0S 2DR7A 4JOUA 4O44B 4XO0A 2V8HA 3HPOA 4JI0J 2ZHBA 1X60A 1RT3B 2QEXS 1WKLA 2DITA 2IIHA 2W8LA 4NLDA 1EHWA 1G7CB 1D1UA 2H51B 4PCQA 1C0TB 2B9XA 3RGIA 3EDQB 3JTNA 2JSXA 4URSA 5HMYA 3HSZA 1HLWA 2CJYB 3TZYA 2IC3A 4LVNP 1RU1A 2Z2YB 3GIMA 2E5HA 2J7UA 2P8IA 4RKUC 3FFIA 5IWAJ 1RT1A 3FC9A 3NG8A 4FXWA 3SIPB 2V0NA 4JV1A 4QJVA 5J1EA 1IBLF 3K5MA 1DTQB 4Y6IA 3EDRB 1RZMA 2FJBB 2E29A 3KHGA 1N5QA 3KG0A 3SQGB 1MWZA 2QIFA 2RH3A 1N33J 3FNNA 4NYOA 4MK9A 4OHXA 1VQ7S 2DR8A 1O8BA 4LFCF 2CFXA 1ZM9A 3THTA 3QATA 3T9NA 5ETVA 3N6NA 1GMWD 3QIPB 4EYHB 1FEHA 3MAHA 2X51A 2CPFA 2CQGA 3EVOA 4FF4A 1WUUA 3JSBA 3MF5A 3X3UA 1WHYA 2KHCA 1R8AA 5HATA 5GADI 1JQGA 2MKHA 5IV4A 3CJTA 2MQNA 3DLEA 5A6PA 3T5KA 1K73T 2MJUA 2LEPA 4RO0A 2B6AB 2FVQA 2DEIA 2V2ZA 1HNIA 5E2QA 3QJJA 3MAQA 1UW9A 3R5DA 4R0EA 2HQFA 4QWDA 3VALA 1SJFA 5KFHA 4NI2B 2ZE2A 5ADZA 3US5A 5LL6d 1F9FA 1IBCB 3R5AA 5AE1A 1KLMA 1P27B 1AZSB 5CYQA 2ROGA 4DEZA 2WTFA 2N3OA 5KG7A 2QX0A 3BH6B 1ZAVA 5C2CA 3MCMA 3IWLA 2MQLA 1T3NA 2XHCA 4DPWA 3HT0A 2R2UA 2HBZB 1REVA 5A8RB 1RTIB 2ZUGA 3MM6B 2UVVA 2AKWB 1RCOB 3Q23A 2VF3A 4QIWD 4ZJLA 5KFCA 1FHTA 1DAXA 3TVKA 4IG3A 2OD6A 3U7JA 3BO3A 1S59A 5HQ8A 1U1MA 3I5BA 1QSSA 4OYPA 1TKDA 4U9RA 2QA1A 3UQSA 4NXMF 4FKXA 4HVZA 5DZ7A 4LF5F 3LANA 1KQSR 3MR6A 4WE1A 4WU2A 5D4LA 1RWMB 4OHYA 1ZH5A 5K8PA 2COLA 4F25A 1HA1A 1NKBA 3OBIA 1JB0C 1U45A 1CQMA 4CP5A 3DHXA 1FJGJ 1T9WA 5C25A 5C2GA 1U0HA 2Y1JA 3QGGA 3IG1A 2H3EB 4MIBA 1AUDA 3JQMA 1LXJA 2ZBRA 3AY0A 3HXMA 4YDXA 4ENOA 5D3GA 2AX1A 2NLWA 3ZNJ1 2HHSA 4O3PA 2J9CA 2D7SA 4PPZA 4LF9J 5M2PA 3KNGA 4CLLA 4TLQA 5C7PA 3UR0A 4LIWA 2J5AA 3FKBA 2UXCJ 4PXBA 2NYIA 2ZH4A 1UKUA 2Q6BA 3LUYA 1TL3B 4QZVB 3CCES 4CWBA 3MEGA 1DTTB 3C19A 5EX3A 4DX7A 1SV5A 3TRGA 2Z8QA 1ZYQA 4ELUA 3AODA 3NBPA 4FXDA 3FCWA 1UJ5A 5B08A 3OW2R 2QE5A 2DISA 4D3HA 2ZZNA 2HRTA 3H0PA 1NLKL 3PXGa 3CCMS 3K5OA 4PQUA 5FD1A 2HMIB 3D66A 2AGPA 4P71A 2KT3A 4ZS6A 5JVGQ 1EP4A 2FPHX 2JH3A 1KQGB 3PZPA 3IWNC 2QA4G 2XLKA 3MECA 1HWUA 3CUNA 3MGJA 4FP9A 4NXNF 2EXUA 4LSNB 2WHOA 5A0YA 5KFRA 1HMVA 2DR5A 4Q8FA 3R5GA 1DRZA 3T6JA 1XR7A 1GXUA 4CT8A 3E01A 3T41A 4YEAA 3ZZYA 5LOQA 3OLBA 1F2HA 4XIUA 2C2MB 4IR9A 4OV6A 3BGRB 4RW8A 3N5BA 4LRCA 3MURP 3K2YA 1VRTB 4ZVGA 5B0BA 2CZ9A 5DG9A 2UUAJ 2P6SA 3WDOA 4DCOB 4RWXA 1BLUA 2IVMA 3H2UB 5DS7A 2ASYA 3HDSA 3I0RB 5F8LA 3PX4A 2DR9A 4QIGA 1UEUA 2IDLA 2GVDB 4IH7A 1SCJB 3DLHA 2PI5A 3G2XA 2YY3A 2UXBJ 5DG8A 5BXIA 4NLSA 4KY3A 2G0JA 3HI9A 2M52A 2WRMA 1X5OA 2LLZA 1DQAA 5GAGU 1WI6A 3IM8A 1PAUB 3ILLA 3CCTA 4QIVA 3GIJA 2QMXA 3G6VA 3A8IA 2A3JA 3JSYA 2VBYA 2ZJRQ 4USMA 2C3YA 1T95A 1JJ2R 5IT0A 2HHHJ 4P2SA 3TX8A 1VQ6S 4U7UD 3OXGA 2CRLA 2RF2B 4N8OA 2RDIA 4UOHA 3M8WA 3PG9A 2PGCA 3BZQA 2OIHA 2NQPA 1VC6A 3P49B 1X4HA 4ED2A 1HQ2A 3QGPA 2NCKL 1RT5B 2AJ1A 5DDRC 1YJRA 1F2GA 5HO4A 2MGZB 1X4BA 3HX9A 5KFSA 3IAS9 4HHJA 1IBLJ 2EC0A 1JLQB 3MPWA 2HK2A 2W2PP 4YHHJ 2DB1A 3BYPA 4RW4A 1MMLA 4MKYA 4I68A 5DQIA 1N4LA 4A48A 1SL2A 2BQUA 4NCGA 4USJC 4OZ0A 2GO8A 1S76D 1SQEA 3QAEA 3VGSA 2FVSA 1V5IB 6FD1A 5A2QY 2Z2MA 4WCEQ 1YIJS 2VA3A 2B56A 3NNAA 4QYZJ 4EBEA 1N52B 5D4NA 3JAMU 4ZK7M 3D6HB 1QD1A 3KK1A 2A6OA 1PYTA 1RWXB 2H54B 3TEGA 2KYXA 2IM1A 2GGPB 4JYAF 1A7GE 2ATLA 3CEDA 1VQKS 1RABB 1KVJA 2GJIA 3UN2A 1U1QA 5AT1B 5DRKA 4TXSA 3MAAB 3KLHA 1M5KC 1U4BA 1DZ5A 3CWJA 3OPKA 3DDNA 5LMUF 1T02A 3IBFB 3OSPA 1BE4A 4DBQA 3TUPA 4IQXA 1Q7LB 5C42A 5GAHI 4IRDA 3UVJB 3E3XA 2R2SA 3BO4A 3EX7B 4DFPA 1JLCA 4QIFA 2O5DA 4FBUA 4OHZA 1DLOB 4TU7A 3MI7X 2MQPA 4WKYA 2XHWA 1DURA 2AX0A 1LK5A 3FSYA 4CIOA 2G13A 4ZLJA 3R8YA 3MEEB 4NXMJ 4F26A 3M8QA 1R6VA 4EUVA 4AQYF 1HPZB 4Y2IA 2M70A 1JLFA 4NCAA 1RKIA 4AXIA 3PHTA 2QL9B 3UN5A 3OTEA 4BS2A 1OJ4A 3M6WA 4X64F 4LBIA 1S97A 3FBBA 4J5OA 2HNZA 4N7TA 2WONB 3UCUP 3ZTOA 3CT9A 4F0HA 2BXJA 3D1HA 4P73A 1ZA1B 3FQLA 1MLAA 3LW5C 3K8WA 1SC3B 3GV7B 6FDRA 4ECUA 5HLFA 1T9UA 5A6WA 2O01C 4F2RA 3MPVA 2FVCA 4H4KA 2Z2ZA 1LW2A 1R8PA 4CT9A 4JV0A 1RKJA 3T6BA 2E44A 1SC1B 2HQCA 3R7NB 5J2MA 3D68A 1UTAA 5HMXA 5ETTA 1VC0A 2G4BA 1WF1A 3DI6A 3DOKB 3ILJA 3MM8B 5EN1A 4CZCA 3HHLA 2OPRA 1UWBB 1Q78A 4B9NA 3I9ZA 1U1KA 2W2MP 3DLKB 3HJFA 1QAYA 1IWGA 2J76E 3R3TA 1RWKB 1IN0A 4M5MA 4W4MA 2F8HA 2LEAA 1BY9A 2IYGA 3K58A 3V4IB 2NZ4A 4CI0B 4XDCA 1SBRA 2PIIA 3GCWP 4C8LA 5D0HA 1ZAXA 4A47A 2VG5A 3Q83A 2H1YA 2O66A 1J5EF 2C3OA 3MCSA 1OIAA 5AE3A 2E5JA 1QE1B 3GFHA 5IS2A 2EW9A 1KQKA 5LJ3Y 4ED3A 1RT2A 1U26A 1HWLA 3GJTB 4RZRA 3BGLA 1IBKF 3T1YF 2YWKA 3BV8A 3AQOA 5I3PA 1OY6A 4DMZA 1EQ0A 1BQMB 1NDCA 2W4PA 1RTHB 5KFIA 2VPZB 3VGUA 2KFZA 2I2YA 2O67A 4ITSA 1X5PA 3HM9A 1I94J 5BJRA 2QO3A 4M5JA 2KB2A 3HLUA 3X1LB 2XYHB 5KFJA 3FDSA 4Q43A 1RHQB 3CDUA 2YNIA 1RAHB 2UUBF 1HBNB 4JI5F 2XZTB 2QLBB 1AA1B 2VQEF 2R7XA 2VB6A 3D54A 1K1QA 1NSKL 4DR3J 3I87A 2ZH3A 2YVSA 1FRMA 2WAQD 4C11A 2FJXA 2IVYA 2GQCA 3ZZZA 3SXLA 2CNKB 5DJBA 3HT3A 2UUCJ 4NCBA 2XS5A 2HVZA 1QY7A 3HMJG 3H40A 2D1CA 2KDOA 1NK5A 1N8RT 2HW3A 3LP0A 2IMOA 2A2CA 3KFWX 4ZPBA 2IAJB 3ITHB 4KFBA 1VJQA 1IKYB 1S9GB 3R6GB 5IT9Y 4OYZA 2F1FA 2W4CA 3TJ8A 3RBZA 3O3LA 1IM4A 2JEGA 2CJQA 3IR6B 5E3RA 3L9ZA 3KLGA 2AGQA 4LQ3A 1MWQA 1VBYA 4NZ6A 1RDRA 1SKSA 2OAUA 1JKHA 4U6PA 4FYVB 4DG1B 5KFYA 2ZVIA 4YY3F 5DZ6A 2OD4A 2FUG9 3CULA 3G96A 3DDIA 3M2UA 2QZ8A 3H20A 4W98A 4CNYA 3DHWC 3P6YC 1TKZB 1S0NA 2BJ9A 2J0QD 1T94A 1RGVA 3LO3A 2OSQA 2HHWA 3CCUS 4F4YA 4LF8F 4DHVA 3CCLS 1CEZA 4WFYA 3ZZTA 3K59A 3OVBA 2ZNYA 4JYAJ 1GMVA 2ZFHA 4Y3CA 5KT2A 2RUSA 4EWTA 2D3UA 1Y10A 1N5SA 3IO1A 3I5AA 1KHVA 3K89A 2YQ3A 2BQRA 5LMUJ 3MMAA 1NJIT 4U8VA 3QRQA 1YRUA 3TR5A 2LQJA 4ANDA 2GW8A 2MQ8A 3EYZA 3ADAC 5ETQA 3EGNA 1OPIA 1B70B 1B99A 4RPFA 2NR0A 2HKEA 4B9SA 2DO4A 2LQ9A 3KJQB 3THVA 2HWTA 1VIOA 2C2DA 3MM5A 1S1WA 2EFGA 1HKAA 4LSZB 1RWOB 4URGA 2GO9A 3KTQA 1E6VB 1FK9A 1M1KT 4OJ1A 2KXHA 3C15B 4AQYJ 3B78A 2QLFB 5KT4A 1KN6A 1ITPA 1ZPWX 2F63A 4DR7F 4ZVTB 4Z37A 1T7PA 3PX0A 4Q7AA 3C6TA 4DR5F 4JBCA 1HBUB 4DL3A 3FZ2A 1VGYA 4OYMA 1IBMF 2NREA 4ILLA 4ZVPB 3I82A 4L76A 4I64A 2F4VJ 1E6YA 4N77A 1SIWB 4J9LA 1H6KX 2WCXA 4M5LA 4UF4A 2NXNA 3PDNA 3L7PA 5E3QA 4OI1A 4FYYB 5FLXU 3NEKA 3GWCA 3AOBA 1VBKA 3V6KA 4HHHA 2CPIA 3H4BA 4WP3A 4CO4A 4ZCIA 3CMQA 5LXRA 4KHRA 5HK4A 3TO8A 3J7YU 1V6HA 5D4PA 2HAFA 3CC4S 3C14A 1FJCA 2E1AA 2QGFB 2BR0A 3T5LA 1C0UA 2B4VA 1XMBA 2AP6A 3NWGA 4RW7A 2AJ2A 4QCLA 4C98A 1T05B 3SBMA 5HROB 1VI7A 3MUVP 1VQNS 4CM2A 3CJ0A 4DZDA 3LGNA 3DGPB 3IMQJ 4B02A 2ZD1B 1FKAF 3J81j 3VZIA 2GIQA 5RUBA 2VODA 2C1EB 3CDWA 1FKPB 4M1KA 4L72B 4DR2F 3NKYA 1HBMB 4H4MB 3MCOA 4HACA 1Y5NB 3DRSA 1GK8A 1GNKA 1ZA2B 2XM3A 4C97A 4DF8A 2NXEA 1C1CB 3LP1B 4MK7A 2B9YA 3DM2A 4WWSA 4HH1A 2PEHA 4TQRA 3KJVA 3M30A 4RUHA 2ZNZA 2K7KA 1T0TV 2E9TA 5IQ6A 3BN7A 4JP8A 2HIQA 3PIOQ 3PY8A 2B51A 1IBKJ 4TQSA 3T1YJ 5ETRA 2JLEA 2CWKA 3W5YA 2C3UA 4OYAA 3CD0A 5L39A 1UVIA 1VRTA 4WZQA 2DTJA 5KFVA 1NSPA 2VPWB 4KGVB 5ETKA 1SVDA 2CZVC 3NL0A 5DGBA 1WDDA 2H4YB 3RZAA 5AXNA 3PV8A 2DHGA 4WTOB 1HBOB 5H9EJ 1NSAA 2UUBJ 1TL5A 2DGQA 3MR2A 3POTA 2Y8YA 3HHLC 2YKAA 2VQEJ 1WTBA 3Q8YA 1RT7B 2ACYA 1RLCL 4X4OA 4KHMA 1CS4A 1XMQJ 4OI3A 1AB8A 5IFMA 1UA0A 2X3DA 5JVHQ 4I69A 3R9LA 1Q4RA 4FNIA 4A46A 3H7HB 3W3SA 1UW4A 4Q5VA 1HR0J 1DARA 5D4OA 1R27B 3OTDA 5ETNA 5KFZA 5HMZA 3T5JA 5D8HB 3K57A 3H5XA 2E1MC 3UNGC 3EZOA 3OVAA 2W2OP 2OTLS 1TU0B 1LK7A 3R5BA 1HQEA 3HHNB 4YY3J 4PRFA 3QGHA 3UDCA 2H65B 2GIFA 1VQ9S 4DL2A 2EFVA 3QSIA 1VQ8S 4KAIA 2PD1A 1M90T 3KUHA 4J9NA 5EUHA 2B5JB 4F4ZA 1W2BR 1IKXA 1V5VA 3UN3A 3A12A 3SSQA 5E3AA 4GC7A 1F5BA 2CQ0A 2VBXA 2CXEA 4C0BA 4C3KA 2HZVA 1CJKA 1U6ZA 4IFVA 2XMJA 1OY8A 4C3MA 3FMBA 3BSNA 3D6TB 4C48A 4I0WA 4ELVA 3MHYA 2KJWA 2IRUA 5CYJA 3AQPA 4N8NA 3JTPA 4P9SA 4ZITA 2JNJA 2X1AA 4I4BA 3PO5A 1U2CA 4EO6A 3H42A 2BOPA 3QRRA 2BV3A 1YJVA 1N56A 1MU2A 4XPEA 2DCLA 2ZH7A 1WD6A 4CYUA 2HS4A 2M0GB 5M2UA 3C2PA 1X4GA 3H5YA 2A18A 4LFBF 1WOSA 3WX4A 2VJVA 2L3MA 3CCJS 3HK2A 1S99A 3KXDA 3HHLD 1OMSA 1VCTA 2PSZA 5HQLA 3KJFB 1XR6A 1JXEA 4KV8A 2XI3A 3J7A1 5CZXA 3KK2A 5IXUA 2CDQA 5F9LA 3BSAA 3EGZA 4H4OA 3FMWA 2HSEB 2L08A 1TFYA 1GEHA 4QU7A 1RBLA 2VG7A 1FI4A 2PFDA 2I38A 3OTBA 2AF6A 2VC1A 1MW7A 4F4KA 2IC3B 2GVZA 4KGZB 3PW5A 1LWEA 3FFIB 3FEZA 1RT1B 1WEYA 1FF2A 7AT1B 4USIA 3MD3A 3CJSA 2RT3A 5J1EB 3FEXB 2RQ4A 1PJ7A 4OI6A 2OEJA 2DGTA 3R5CA 1KBRA 4JI4J 1S49A 1J27A 4E2FB 4TY9A 1BWEA 4TN2A 2PI4A 2DXDA 3J81Y 5LSOA 1VDHA 3M2VA 4Y28C 4O4RA 4B3SJ 1HI0P 4JI1F 1SL0A 4ZVQB 2ZC4A 5KFGA 2V4JA 1BWVA 2XYPB 5KFXA 4DV1F 2OKQA 4NA3A 5J2PB 2HFOA 4Z7CA 3DLEB 3NGTA 2ZVSA 1CULA 4OI2A 3CD6S 3SFUA 2XO6A 4K4SA 3JYTA 1UVKA 3BO2A 3TP2A 2XNRA 4C0HA 1HNIB 4O3RA 4AYBD 5KFLA 1JX4A 3TA0A 1IR1A 4QW8A 2BOAA 2XULA 2WW8A 2W7PA 2N7YA 2QMWA 3W65A 3AFGA 2OFHX 3HF5A 2ZE2B 4ZP7A 5E3PA 3CCVS 3GR0A 4WU3A 3HVRA 4FNHA 2G9OA 3IC1A 2YWFA 2XCPA 1KLMB 5CYQB 1YSJA 2AMCB 1HW8A 5KG5A 2W7OA 4N47A 2U2FA 4AL6A 2CPXA 1U1LA 2E1RA 3TYTA 4CLYA 2DNYA 1REVB 3I31A 2CJBA 4G1QB 2JLFA 1FRXA 4ETXA 2WVFA 3C66A 1D9FA 3JSMA 1TQLA 4IG3B 4X65F 2F8MA 3OR1A 2NXCA 3OD2A 2LXIA 4TY8A 2DEJA 1TELA 2ZOFA 1FRIA 3NMRA 3THPA 5KFQA 1EARA 5IM0A 2W2QP 1IKWA 3ZTQA 3PR4A 2F5GA 1FNXH 3PEJA 4WE1B 3CO0P 2GNKA 2V2VA 4H54A 4ED4A 5FIIA 3NAIA 1HNZF 2VICA 2BA9A 2R7QA 3CJQA 3LP2A 3EM1A 2W01A 2DD8S 4WXOA 3KKFA 3TJAA 4C4WA 1OQ6A 3KMQA 3OTCA 2Y0BB 1FRLA 5C25B 1ZTTA 1U0HB 1G2EA 1X4AA 3IG1B 4IG0A 3PVXA 2F40A 4UOGA 4UOFA 1WKJA 5F8IA 3SI8A 3CCWA 3CDEA 2ERRA 1KS2A 1QTNB 2U1AA 1N0VC 5D3GB 2GJ2A 5E0OA 2W24A 5F8JA 2DNRA 1RWUA 1RU2A 2RDJA 4ZVEA 4Z2XA 5BYSA 2QT7A 1B3TA 3P5BP 4UUXA 5L1IA 3M2RB 1AW0A 1SJ4P 3QJLA 2HK3A 3Q0AA 3F44A 4DWIA 1FWLA 3SCJE 3ENAA 3PRVA 2YKNA 4LRFA 4EGLA 3MEGB 1K0VA 2OMLA 3GFYA 2KL8A 1SV5B 4P2MA 2VG6A 5KFFA 2C2RA 1OWXA 4HYKA 3NBPB 1AXQA 2XMAA 4DX5A 4DG1A 3HJVA 1B0TA 2NPFA 3E51A 1BHNA 2HBRB 1QSYA 1Q8LA 5H9EK 4PQUB 2BABA 5H9FJ 4CLTA 1SI9A 1ZM2A 1EP4B 1TL7A 3W9IA 5D77A 2DR6A 3MECB 2HAIA 3NGDA 1VRUA 4PQAA 2R4FA 1S1UA 4JI3J 2C28A 5F8GA 1HMVB 2XQCA 3MPYA 4G3IA 4K5RA 2V5HG 1RHJB 3E01B 1LW0A 3ZNUA 2YH1A 2DKOB 4ED0A 1TAUA 4RW8B 4QPTA 1F6TA 1X0PA 3SDEA 1S4FA 5GMEA 2BMBA 1HW9A 1S1XA 4OYIA 5MAOA 1RSCA 2ZWPA 5E33A 3W5ZA 4F7VA 1GMUA 5BR8J 2LKZA 4AT1B 3TQ1A 1QJHA 2IY5B 3W63A 1W7WA 3W66A 1F0XA 4DS4A 3HHDA 4YB6A 5K9FA 4DL6A 2DBBA 2A6MA 4NLPA 5KOXA 2DHSA 2DIUA 2QSFA 2DHXA 1Z1ZA 3MTKA 4NRUA 1Q86T 5ETLA 3P8BB 2WVEA 1S10A 1IQZA 4OIXA 1V3RA 4K0KF 1ZZFA 2QA4S 2FLPA 4RR5A 1RQ0A 4O0IA 1FEEA 2LDYA 3BR9A 3GYXB 2CQ1A 1S4EA 5JMNA 3H2LA 1RISA 4FVCA 4JI0F 2PE8A 2VIHA 1VS3A 3N01A 1WNEA 1HNVA 2HNYA 3GG1A 3AD9C 2BKNA 5CYMA 4J9KA 1AFJA 5HVGA 4X4QA 2FZKB 4YS2A 3QYYA 4LIRA 3SV4A 3VTIA 5EWEA 1FVQA 2RU9A 1S6UA 1RLDA 1M1HA 4DV4J 1TVRA 3IP0A 1Y3KA 1HBUA 1XMOF 3DRYA 3AJ1A 1X8DA 2WVDA 1HNWF 3IS9A 4RW4B 3MR5A 4LF6F 5GVQA 5B0GA 3M8PB 2IM2A 4KPCA 4NCGB 2UP1A 1ZTWA 2W1BA 2HWHA 3DCAA 2LQ8A 2DJWA 4O3OA 1N33F 5CD4H 5KFEA 2KTQA 3M32A 3SSSA 3OR2A 3OL9A 4RU9A 4X84A 4QOTA 3RAMA 2XEXA 4JI1J 3HCXA 1FA0A 3LAMA 3S7RA 1YJWS 1BUXA 3PHEA 2RU3A 4DV1J 4B3OA 3ZC4A 2CADA 2WVBA 3W1YC 3KK1B 4A8QA 2F9DA 4AL7A 3VR1A 3EXYA 2DGVA 3KMSA 1R3NA 1UFKA 4ZVUB 5KT5A 2EEYA 1H73A 4YDDB 3J7Z5 4CLWA 3KLHB 2ADBA 3EVMA 2DK2A 2P9GA 4F04B 1GXTA 3KLFA 1P6TA 4K50A 1RHRB 1WELA 4EO8A 2XMKA 2H5JB 1BC6A 3MD1A 4L3NA 2ILYA 4L75A 5KG2A 1LWFA 3CCQS 4A8YA 1VQPS 1Q81T 2YWWA 4DSEA 5C42B 3BKUA 2D3ZA 4P72A 5CD4A 4R0JA 3VAFA 1S1VA 1JLCB 4MAKA 4OFZA 2OEKA 4K4UA 4KBIA 3FRYA 4I2QA 4KYZA 2ZUAA 3ZZ0A 5D0RA 4LSLA 2DHAA 1VQOS 4KIAA 2VOPA 1EAYC 2WOMA 2EKYA 2ACMA 3G86A 2OHDA 2BE9B 1S9FA 5K8NA 1PC4A 3JSRA 1GX6A 4ID8A 5LSLA 1R0AA 1JLFB 4NOHA 4OYOA 3S8SA 1X4EA 2EVZA 2XMUA 1WC5A 3QGIA 1TKXA 1JWWA 2XZWA 1HNZJ 3R2CJ 2C2NA 1LXNA 4B17A 2HNZB 1UEKA 3Q8PB 2ZHAA 5JJBA 2V68A 3R7BB 1IM6A 1FXLA 4Z7YA 5HLFB 1JIHA 1FJGF 3E2EA 4ALZA 1SC6A 1A0OB 2XSFA 3N9UC 3N28A 2B9WA 3GU0A 3PW4A 1VBXA 1UCNA 2MQOA 1CG2A 2W9BA 4IQMA 1LW2B 2Y8WA 1WSVA 2F7VA 3WX8A 3QQCD 3LALA 1WORA 3A4TA 4ZIWA 3VAMA 1CJTA 3DLJA 1JLAA 3BQ2A 2YPYA 2QFJA 2ZBIA 5J2MB 1IWAA 3PW2A 3FK4A 3DOMA 3TX0A 4LF9F 1H2TZ 1UFWA 3DI6B 1RAEB 4JV5F 2IPOB 4OMFG 1IJEB 5B09A 3C16A 3GIKA 4JI2F 4ICLA 4BHQA 3HHLB 2OPRB 5KFKA 3S6EA 2DPJA 4P7TA 4Q2MA 2VOOA 4PZVA 4QU6A 2IDEA 2VJUA 1BQXA 2YH0A 2JFKA 4ZJQA 5B0AA 4USHA 4TLRA 3IBCB 1VHFA 2BACA 3HSJA 4A8OA 2VFSA 4EU0A 3ETMA 1U48A 3RJMB 2VPYB 3PKYA 4I7FA 3M4XA 3LWMA 3PFOA 3V81A 3FVYA 4OHWA 4DLGA 1R8BA 5EDWA 2C2ZB 2BM0A 2BDPA 3DU6A 2MZTA 2VG5B 4QYRA 4DUYJ 1ZPVA 1RWNB 3DYAA 1RXOB 2QJ3A 4TU8A 3HFZB 4ZN3A 3G9CA 4RNFA 2GQQA 1RJJA 5M2RA 1RT2B 1HIYA 1I6JA 3FZBA 3CIMA 3G6YA 1N36J 1FO1A 3V6JA 1OSCA 3JXOA 3SZ2A 3O44A 2E5LJ 4ZMMA 3OJUA 1RE1B 1L3UA 4ILRA 2EG2A 4AD6A 3H98A 1EIYB 4M5HA 4IOCQ 3OUYA 3AXMA 3GONA 2JC0A 2EFPA 4BWMA 1N32J 3ET6A 1S48A 1UJ4A 4AFFA 2RKIA 2YNFA 1TV6A 4IFYA 4P7VA 4GKJJ 1WG5A 3R27A 4J37A 1D9AA 1NDLA 1FKOA 5A8WA 3ZZOA 5L46A 2GC8A 2YNIB 3HFVA 3I0SA 1J5OA 2DRDA 2CIMA 1WG1A 4RJVA 3WZ0A 3FSIA 4NL5A 4USWA 1YG0A 2R3VA 4C11B 1H3DA 1U49A 3IM9A 2GAHC 4JB8B 4G1PA 2R8JA 1H0HB 1RBOB 4LR8A 1RHMB 4DN0A 2HWIA 3MMBA 3IRXA 5H9FK 2JDJA 4DR4F 1TK5A 1RWVB 2CPJA 3LP0B 2CJAA 2QLWA 2ZJPQ 2HHHF 4U67Q 4KFBB 3PJWA 2X7IA 4RNNA 2APOA 4KHPJ 4UQTA 4Y2MA 3AB4B 4WYLA 3KLGB 1VQ4S 3Q2SC 1XMOJ 1K9MT 3CJ8A 1HNWJ 1ZM3A 3WBZA 1NSQA 4LF6J 2MKKA 4ZLLA 1JKHB 4FPRA 2HHXA 1P1LA 4YHHF 4PEOA 5K8OA 3DLLQ 3M2UB 4LT6A 2G1DA 5ETMA 1IR0A 4HTJA 2AJFE 3ETOA 2WSFC 3KDNA 2H4WB 3MUTP 2C3PA 2W9CA 1QUPA 4CO5A 4DV5F 2B4UA 3WIVA 2BEFA 2AWZA 4DPTA 2CWXA 3IA0A 3L3CA 1QVGR 1SH3A 1SQFA 1W2IA 3CC7S 1N5YA 4FBTA 3M8SA 3TUZC 4OJ3A 5J2PA 2QL5B 4IH6A 4WIIA 3QZ8A 1TL1A 1ULRA 4RNHA 3HKWA 1H2VZ 4BCAA 5HMWA 4J9SA 2KG1A 4USKA 4J7CA 5KFOA 3NP5A 4MIWA 1V3SA 2ASJA 3FGVA 3MMAB 2R7UA 3PRBA 5T7LA 4C8NA 1U1NA 4X4UA 8RUCA 4O3SA 2HHTA 3J7YI 3CJKA 3GFXA 3CDBA 2FYXA 4OZ5A 1NEEA 5DO2A 3MM7A 2RIJA 3CTRA 1S6PA 3MM5B 3J81U 1EB0A 3GILA 1S1WB 1NJYA 3H59A 1NK8A 3B54A 2DPIA 2LDIA 3ISNC 5LJ5Y 4G1QA 4ANCA 4Y2KA 4JI6J 5I3UA 4L73A 1FK9B 2L9DA 3A3OB 1U09A 2GJFA 3K7RA 3SSRA 1O6XA 1JJ4A 4DU7A 2YNHA 1NB7A 4NLRA 1WC0A 1NJZA 8AT1B 3J80U 2ZM6J 1KVKA 1FFSB 2HS0A 4GVLA 5I3QA 4RNOA 2ADCA 3QJPA 4ED7A 2AYBA 1FWKA 3C6TB 1WHVA 2LFVA 4WP9A 3PJXA 1FDBA 2CPEA 1B4SA 3G6ES 2ATCB 2J7WA 2Q1LA 1LWXA 2PN6A 2MKSA 1KP6A 2BW7A 1E6YB 1FCAA 2MZSA 3W62A 1SKUB 4N41A 3F56A 1LOUA 5FDLA 4K5SA 3QNWB 4KO0A 3BDEA 2UVWA 2QFIA 4CLFA 4IYQA 4HL9A 4CLUA 4EYIB 1VR6A 3AA9A 2C22A 2ALYB 1IR2A 1LWCA 3EUNA 1D8ZA 1JXVA 4YB1P 2IRXA 2F8EX 3OTOF 4PABA 5IZHA 1JNZB 4OI4A 3DXBA 2MJNA 4V1Ak 4FDFA 2KZZA 2HZAA 4B3RJ 4PWDA 3C14B 1FRHA 4ERDA 1NB2A 2KJVA 4PG8A 3I55S 1FRKA 1GMWA 1BD6A 1C0UB 2HVEA 2HQGA 3J7ZT 2ZZMA 1PYOB 5HBMA 4JV5J 1DY3A 2FLLA 2NZCA 3G71S 4RW7B 4JI2J 2CQDA 1OPZA 1JXLA 3M2RA 2E9ZA 1X31C 3KNAA 2I5JA 3UWTA 1T9VA 1OYEA 2EFNA 2Y1LB 2HGLA 3OFGA 2AJ0A 2I1RA 3T9ZA 5G0RA 2OEMA 1UWAA 3KLVA 4HLBA 1IJFB 4J9OA 2F65A 1XEZA 1NCLA 2K3KA 1D9DA 2MDAA 2PA8D 4CNZA 2DO0A 1QTMA 2XWYA 3VWSA 4YUDA 3TEHB 2E7VA 1S6OA 2JL9A 4HACB 3CF5Q 1RADB 3DRSB 3N0VA 2BJ8A 2CUYA 4IR1A 2KZMA 1ZZNA 3UD3P 4ZDNA 1KTQA 4A4JA 4F0KA 3DM2B 3WIUA 2RRNA 5K14A 1HQUB 3KJVB 1H7XA 1PJ6A 3M30B 4DDFA 3ISND 4ECYA 5F0WA 4NRTA 3M7VA 3QWPA 1YRTA 2MKCA 4N76A 2EKNA 2HS3A 3R6LB 5F8MA 1FD8A 2JVOA 2ZBCA 3MCNA 3F0NA 1LQ9A 4YMEA 2HLTA 3EVWA 1KHWA 4ZHRA 1X5SA 1F3VA 4IOBA 1FFWB 4WFZA 3B6BA 1S7IA 5FJ4A 4DUZF 4GMKA 4XDDA 3QLHA 4OJHA 4USUA 5HJXA 4CO2A 4OZNA 1EX8A 2MZRA 1HD0A 1I94F 3W2WA 3DLGA 3UCZP 3RB4A 3KJNB 4YP3A 4WK1A 1WEZA 2AT1B 4TU9A 2DNQA 1JLGB 1T3OA 3POTB 1HYSA 5KT7A 3ILOA 4ELTA 5KT3A 4D3GA 3VZHA 1PIEA 3VVUA 1KKHA 4O0NA 2R8GA 3CC2S
chains in the Genus database with same CATH topology
1RAOA 1TMMA 3HSZA 3HSJA 3MCOA 3ILIA 5ETTA 5ETLA 2QX0A 5ETRA 1IM6A 5ETKA 3HSGA 3HSDA 3KUGA 1HQ2A 4M5LA 1HKAA 3ILLA 3MCMA 5ETQA 4AD6A 1RU1A 4M5HA 4PZVA 3KUEA 2BMBA 1TMJA 1DY3A 4CYUA 5ETVA 1RB0A 2F63A 3HT0A 3ILOA 3MCNA 1F9HA 1G4CA 4CWBA 1Q0NA 1EX8A 5ETPA 1RU2A 1RTZA 4CYUB 4M5GA 1EQMA 4M5IA 2F65A 3ILJA 5ETOA 3UDEA 4M5JA 4M5KA 4M5NA 4F7VA 1CBKA 3KUHA 2CG8A 3QBCA 3HCXA 3IP0A 1KBRA 4CRJA 3HD1A 1EQ0A 3UDVA 3UD5A 5ETNA 5ETMA 4M5MA 3HD2A 5ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RAO A;  1TMM A;  3HSZ A;  3HSJ A;  3MCO A;  3ILI A;  5ETT A;  5ETL A;  2QX0 A;  5ETR A;  1IM6 A;  5ETK A;  3HSG A;  3HSD A;  3KUG A;  1HQ2 A;  4M5L A;  1HKA A;  3ILL A;  3MCM A;  5ETQ A;  4AD6 A;  1RU1 A;  4M5H A;  4PZV A;  3KUE A;  2BMB A;  1TMJ A;  1DY3 A;  4CYU A;  5ETV A;  1RB0 A;  2F63 A;  3HT0 A;  3ILO A;  3MCN A;  1F9H A;  1G4C A;  4CWB A;  1Q0N A;  1EX8 A;  5ETP A;  1RU2 A;  1RTZ A;  4CYU B;  4M5G A;  1EQM A;  4M5I A;  2F65 A;  3ILJ A;  5ETO A;  3UDE A;  4M5J A;  4M5K A;  4M5N A;  4F7V A;  1CBK A;  3KUH A;  2CG8 A;  3QBC A;  3HCX A;  3IP0 A;  1KBR A;  4CRJ A;  3HD1 A;  1EQ0 A;  3UDV A;  3UD5 A;  5ETN A;  5ETM A;  4M5M A;  3HD2 A;  5ETS A; 
#chains in the Genus database with same CATH topology
 4CO3 A;  4DR3 F;  3NCP A;  4USV A;  4YB5 A;  3PNI A;  1CS4 B;  3DRX A;  2CNN B;  3QID A;  2LU1 A;  3A8K A;  3PYF A;  2ZDP A;  5CA5 A;  3VAK A;  2CDR B;  4DR4 J;  2Q3P A;  3I56 S;  3TWZ A;  1ICE B;  3BQ1 A;  1NBE B;  3MOJ B;  2FGC A;  3VV2 B;  2UUC F;  1U6B A;  3RW6 A;  3IFE A;  4J9P A;  1NH7 A;  2O1P A;  1XC9 A;  3M8Y A;  4M5I A;  4K8R A;  4M5D A;  4NMX A;  2MHE A;  2EG1 A;  4WP8 A;  4O23 A;  2ZBQ A;  2OSR A;  1AT1 B;  3M1V A;  3TOQ A;  2H48 B;  2KXF A;  5KFN A;  2J8S A;  5LT5 A;  3M05 A;  3P96 A;  2D69 A;  2OH2 A;  4PWW A;  4I56 A;  2QYC A;  2CA9 A;  2LXF A;  3BYR A;  1HQE B;  4DI6 A;  4F0M A;  2OI2 A;  4O4G A;  2IBO A;  2FQQ B;  5T41 A;  3M8P A;  1MN7 A;  1IKV A;  3A13 A;  2OFG X;  1YJT A;  3W61 A;  3JAM Y;  3TVY A;  2OPP A;  3HVA A;  2DNM A;  3W2V A;  2BJ3 A;  1IKX B;  3Q8U A;  1O0P A;  5KG1 A;  2M4M A;  4DV5 J;  3B4D A;  2M8D B;  4LF4 F;  4LMZ A;  1YJ7 A;  2RD5 C;  5IC4 B;  3CJR A;  2VDI A;  1CJK B;  4IFV B;  3Q8R B;  1HI8 A;  2A1B A;  5KFW A;  2CPY A;  1RAG B;  3FJ2 A;  3Q8V A;  1Q53 A;  1T11 A;  4UY8 5;  3MEK A;  4K2J A;  1LEO A;  4ZCM A;  1O51 A;  2AIR B;  5HP1 A;  1RAF B;  2HVH A;  1ZET A;  1XR5 A;  4F4A A;  5E7O B;  1JMT A;  2R8I A;  1N0U A;  1R0C B;  1MU2 B;  4U8Y A;  4XTT A;  4NML A;  2ZH5 A;  4CYU B;  3BPS P;  1CJU A;  3SV3 A;  2EWH A;  2ZDO A;  4DOZ A;  2GHW A;  3TAR A;  3OFH A;  2DNP A;  4CLP A;  3S1T A;  2ZWO A;  4C7Q A;  1FRJ A;  2PO4 A;  1WAC A;  5J2Q A;  3FEY B;  4I2P A;  5L9N A;  2FHM A;  1WJ9 A;  1K1S A;  1HHS A;  3TZZ A;  1Q7Y T;  1M5S A;  3C6U A;  4CQ1 A;  3CO9 A;  2V2K A;  4F36 A;  4CRJ A;  1VOM A;  4URQ U;  4KV8 B;  4QR2 A;  2ZJQ Q;  1ZM4 A;  2UUT A;  4LRB A;  3KK2 B;  1FX2 A;  2DGU A;  3RR7 A;  2NXU A;  2MXY A;  5CAB A;  3RRG A;  4DV0 J;  2BKO A;  4H4O B;  2GAG C;  2VFT A;  2YX7 A;  3RBD A;  1UVM A;  2AZ3 A;  2XB2 D;  1I1G A;  4I1T A;  2P9E A;  2YTC A;  2RVJ A;  2V2Q A;  2KKH A;  3O2I A;  1SJQ A;  2MKY A;  2VG7 B;  2KRR A;  4R5P A;  3OL6 A;  1EET A;  1URN A;  3G87 A;  4K4W A;  4ES1 A;  3WQP A;  2W25 A;  2GVZ B;  4JI7 F;  3FQK A;  1LWE B;  2XMV A;  5AE2 A;  4IUF A;  1TL4 A;  3RAX A;  3TZW A;  2FGO A;  3IBW A;  2MST A;  1Q95 G;  1EQM A;  2H9Z A;  2MB0 B;  1GAO A;  2K3I A;  2R7S A;  4C8Z A;  2MZ1 A;  2F4V F;  3PW0 A;  3ONQ A;  2N82 B;  2ZZT A;  3A3N B;  5CXT A;  2AEM A;  2A0F B;  4A8W A;  3SCL E;  2HGN A;  1F3F A;  2AW0 A;  3QRP A;  3M2V B;  1RAC B;  3K5N A;  1HL6 A;  3OTO J;  1NJW A;  1RWW B;  2PC6 A;  1QDU B;  3Q24 A;  4DPO A;  2V4J B;  2L48 A;  2IJN A;  4J91 A;  2V6A A;  3QAU A;  4A8S A;  3O1L A;  4EBD A;  5KOW A;  1CUL B;  3D6F B;  4MYT A;  1XER A;  2H5I B;  2OUG A;  3JYT B;  3A8J A;  1Y00 A;  3D0H E;  3AHP A;  2OPS A;  4ZVO B;  3VAJ A;  2E1C A;  4PG5 A;  4OX8 A;  4FYW B;  2GIR A;  4ANE A;  3QMQ A;  4DXL A;  1JLE A;  2FJV A;  1RHK B;  3A3P B;  4LFA J;  3K17 A;  4MFB A;  2UVU A;  2ZIT A;  3NLC A;  4KTQ A;  1M5H A;  2WB4 A;  3TZX A;  1FXD A;  3NNC A;  5ETO A;  2MEW A;  4WTY A;  4QIE A;  4YN3 B;  4BC9 A;  1W26 A;  2RE1 A;  2PA3 A;  3BN4 A;  4NLO A;  3GQC A;  3JSM B;  1F60 B;  3OT9 A;  2CQH A;  3OR1 B;  3U27 A;  2G0I A;  2YKQ A;  1WC3 A;  5F0U A;  1GQE A;  2V4R A;  3ENW A;  4WFB Q;  3D1O A;  4YR2 A;  4TY8 B;  2RUG A;  5HVH A;  5IM0 B;  1HWK A;  1IKW B;  1LFW A;  4GC6 A;  3BGF A;  4AL5 A;  4FF1 A;  3BF4 A;  1UZH A;  5HL7 Q;  3V6D A;  2V4Q A;  2BUN A;  2YKM A;  5AXL A;  4DUZ J;  3R97 A;  3LP2 B;  5K20 B;  3CSK A;  5LMN J;  4E0D A;  4S0M A;  3HVT A;  4I6Y A;  3ZXW A;  1JK9 B;  2QL7 B;  2V69 A;  1FD2 A;  3W9J A;  2GCF A;  5HAN A;  1EKR A;  1R6Y A;  4IG0 B;  2B7B B;  3D28 A;  2RIL A;  2B4P A;  2WVC A;  4ZIV A;  3N79 A;  4NLG A;  1X9S A;  5F3T A;  4Q44 A;  3W9H A;  1G3O A;  2NXJ A;  5HVF A;  2AHO B;  4XK8 C;  2WBM A;  1VYA A;  4C6A A;  3LPY A;  1D3W A;  5A8K A;  3AD7 C;  3I5C A;  1XMQ F;  4HKQ A;  2CQB A;  2F3J A;  4O3Q A;  3DMJ A;  3GV5 B;  4DPX A;  4M63 A;  3QFH A;  5AJ3 F;  5GAE U;  1G4C A;  2XLJ A;  2YKN B;  1XN9 A;  1HR0 F;  2EI5 A;  3HSG A;  1RTJ A;  1SIZ A;  1LNQ A;  4RW6 A;  2VG6 B;  3LOU A;  2BJ1 A;  4OYW A;  3LA0 A;  5DQG A;  3JS9 A;  3KLE A;  1HFE L;  4X2B A;  4ED5 A;  1ARO P;  2AYE A;  4RU2 A;  1U25 A;  2PT0 A;  2E7W A;  2D9O A;  3HVW A;  4NLY A;  3UE2 A;  3KHR A;  3L7O A;  1JJC B;  4LF4 J;  1TL7 B;  4DR6 F;  2HBY B;  2M2B A;  2VHG A;  1VRU B;  1MRO A;  2F9J A;  5JXS A;  2MY8 A;  5BYR A;  2YX4 A;  2JZ5 A;  3CNQ P;  1S1U B;  1RTZ A;  4M95 A;  1ZOT A;  4KKO A;  4Q0B A;  1C1B A;  4IRK A;  3E8O A;  1DFD A;  2Y1R I;  1LW0 B;  1TMM A;  1TK0 A;  4DFK A;  2DT9 A;  3W8P A;  1TUG B;  4BWJ A;  4GRS A;  3SDE B;  4G1I A;  1XQI A;  3T1H F;  1NZ8 A;  1S1X B;  2JEJ A;  4M8L A;  4HI2 A;  3TAM A;  1BQN A;  2OPQ A;  2Y1I A;  3MWB A;  4X66 F;  3T19 A;  2W2N P;  2V34 A;  2VQF J;  3JB9 k;  2HFS A;  2MSS A;  4OX7 A;  1ELO A;  2WZ1 A;  5J1N A;  4F3Q A;  1Z2L A;  4B9U A;  2LEB A;  2LU2 A;  3RU0 A;  4ZVR B;  1SH0 A;  4ZPW R;  1UMJ A;  1HAR A;  4ZPA A;  2PMH A;  3F73 A;  1FER A;  4NX9 A;  1HD1 A;  2AD9 A;  1UPM B;  1PJ5 A;  3EE3 A;  3M9N B;  3KLI A;  3D67 A;  1SQG A;  4K4X A;  3MOZ A;  3KHH A;  2XO7 A;  4FXV A;  1HNV B;  4E8U A;  2HNY B;  3P45 B;  3JQJ A;  3I4H X;  5CYM B;  1NND A;  4ILM A;  4BC7 A;  5C24 A;  2B4O A;  4RWW A;  4JI7 J;  1DBD A;  3I4P A;  5SUH A;  1NPP A;  2YNG A;  4I6A A;  2Z30 B;  3DKD A;  1TVR B;  2WSE C;  3EZU A;  1T9Y A;  4LUB A;  4ES2 A;  4IO1 A;  1RUS A;  2YX1 A;  3NY0 A;  3M9O B;  4PXE A;  3LPE A;  2KM8 B;  1SUQ A;  3IS9 B;  3QO9 A;  5FLX Y;  4PUO A;  5DLF A;  1YKW A;  2G0C A;  5L1J A;  3NOG A;  3VVT A;  2KFY A;  4JI4 F;  3CD7 A;  7FDR A;  2OTJ S;  4EK2 A;  1RB0 A;  1KC8 T;  1FTC A;  2O3D A;  2HEK A;  3M32 B;  4OL8 A;  3OR2 B;  3KYL A;  2L9W A;  3AJD A;  2CG4 A;  2VFV A;  3BGO P;  1QLN A;  2JOQ A;  4FS2 A;  4OJG A;  1U6F A;  4B3S F;  4DFM A;  2UVR A;  4UY8 T;  4B3O B;  3I32 A;  1J2V A;  4OZ3 A;  2HPU A;  4EMD A;  2FHK A;  4J9V A;  5HSP A;  1Y7P A;  3MMJ A;  2P9C A;  4EBC A;  2KN4 A;  3EXC X;  2FZG B;  2RRA A;  1RT4 A;  3PX6 A;  1UJ6 A;  4K4V A;  1P1T A;  2AV5 A;  2V9K A;  3KLF B;  1Y5I B;  1JLB A;  4GVB A;  1L3K A;  1S57 A;  2MKI A;  1WC1 A;  2E66 A;  1LWF B;  3GJS B;  1KLN A;  2FVP A;  3WC2 A;  2NUU G;  3PYG A;  4M5G A;  2WW4 A;  9RUB A;  4F4X A;  5GMD A;  2IA6 A;  1RAA B;  1S1V B;  5K5M A;  2KT2 A;  2J8A A;  2VPX B;  4MTP A;  4DN9 A;  5KFA A;  1DJ0 A;  2QYG A;  4I2Q B;  1LV5 A;  4KB7 A;  4EZ9 A;  4M94 A;  4FYX B;  1FWP A;  3DLB A;  1HQU A;  4LSL B;  1PCA A;  1X4D A;  1S5Z A;  2WOM B;  4DPY A;  2VAS A;  3KHL A;  2X3G A;  1WSR A;  3V6H A;  2VU5 A;  2DNL A;  4XAK A;  3DFE A;  3V5R A;  1CQN A;  3DN9 A;  2EPI A;  5EGY A;  3VF0 B;  1R0A B;  1WC4 A;  1TKT A;  4IDK A;  1S9E A;  3BBB A;  1F9E B;  1KFS A;  1QVF R;  4H4K C;  2GMH A;  3EPG A;  2IBK A;  1TKX B;  4UZC A;  3HFK A;  1WHW A;  1RTD A;  1KDN A;  2GHP A;  1P8G A;  1U24 A;  2D3O 1;  5EX0 A;  2RJZ A;  2XTJ P;  1WC6 A;  2EBE A;  2B8Q A;  2QRR A;  3ZFV A;  1KEK A;  5DG7 A;  1P9Y A;  1QAJ A;  1VIS A;  4TYB A;  3R7S B;  3GYG A;  3DRR A;  2CG8 A;  3RG6 A;  1JLG A;  2VBZ A;  2X1B A;  4PKD B;  1OSD A;  1B7Y B;  2UUW A;  3TUI C;  5I42 A;  4ER8 A;  4FN5 A;  2W9B B;  3G6X A;  1S0O A;  2KT5 A;  4OZ2 A;  4RUB A;  1CJT B;  1G6B A;  4RNM A;  3A8E A;  1JLA B;  3RBE A;  1NHV A;  5J2N A;  4PWU A;  1YDL A;  2DGW A;  3DOM B;  4J9U E;  3G82 B;  4Q8E A;  3AD8 C;  3TA2 A;  3OJS A;  5D78 A;  3RRK A;  1M5V C;  5AJ3 J;  1V9O A;  3C16 B;  5L8R C;  1RK8 A;  4KGX B;  3CME S;  1NKE A;  2AQ4 A;  3SCI E;  3D0G E;  3D2W A;  1Q16 B;  2JFD A;  2DNG A;  4ICL B;  2KYZ A;  2WB1 D;  2Y3Y A;  1WG4 A;  4ZPD A;  3UI3 A;  2DIV A;  4LRA A;  2FD2 A;  2J9D A;  2V8P A;  3QFW A;  2BRL A;  3MFH A;  3B82 A;  1X5T A;  1H98 A;  3RBX A;  1D8Y A;  3GR1 A;  1KR4 A;  2Q6C A;  2J0S D;  1VIX A;  5BYQ A;  3SFG A;  3OLA A;  1U2R A;  4MH8 A;  2V8D A;  4I7F B;  3V81 B;  3HD1 A;  4KGK A;  3W64 A;  2B8P A;  3BBF A;  4HI1 A;  3ZTS A;  2QMU B;  1VFJ A;  1YBU A;  4KE5 A;  4DR6 J;  3DYA B;  1UZD A;  1UL3 A;  1UPP A;  5DM7 Q;  3IGN A;  1VQ5 S;  3H8Y A;  3NNH A;  1DQ9 A;  2MLZ A;  2DNO A;  1IQT A;  4J9R A;  4MMO A;  4NLW A;  2AJQ A;  1YJU A;  4JI3 F;  1WEX A;  3DOL A;  3NXZ A;  3L95 X;  1XJW B;  4GO7 X;  3RB3 A;  3T1H J;  1NHK L;  4WXW A;  3H2V E;  4PG6 A;  2W9A A;  2B9E A;  3PO4 A;  2YWG A;  2XMW A;  1SXL A;  1F9H A;  4P75 A;  4AXJ A;  3OUY B;  5F41 A;  3NGR A;  4LFC J;  1X7V A;  3G8S A;  4UZB A;  4X66 J;  3ET6 B;  1S6Q A;  3EJM A;  5BR8 F;  4ATN A;  3MED A;  2RKI B;  2YNF B;  1TV6 B;  4IFY B;  4OLO A;  1FKO B;  5KT6 A;  3S01 A;  2XY7 A;  5A8W B;  3UFC X;  1SJ1 A;  2HRU A;  4PAA A;  4NYZ A;  2X1F A;  2YPZ A;  3I0S B;  1J5O B;  2FC9 A;  4NA1 A;  4CLK A;  5CAA A;  3MFI A;  4ZP9 A;  2KHD A;  3NGK A;  4ID5 A;  3HO1 A;  1Y11 A;  2HLU A;  3PIP Q;  4FS1 A;  2A10 A;  2CQP A;  4GO5 X;  2RDD A;  5KFU A;  3N5F A;  4RLE A;  1OO0 B;  4L6V 3;  5A2Q U;  1MN9 A;  3MMB B;  4LRE A;  3Q8S B;  4UOC A;  3IRX B;  1S1T A;  2L9N A;  3MMC A;  5KG4 A;  1CJV A;  4KJI A;  3RB0 A;  4OI0 A;  3PTW A;  4ES3 A;  2FY8 A;  3UD5 A;  2KU7 A;  3M9M B;  4RW9 A;  2XNQ A;  4FVM A;  4NYP A;  4G6V B;  1X4F A;  3GFZ A;  4KRW A;  1TR0 A;  4X4V A;  3GLJ A;  5CQG A;  2J9D E;  3FCH A;  1FTR A;  3MM9 A;  1RT6 A;  5LM7 E;  2KVI A;  1L3T A;  4DV4 F;  1XBW A;  2GQ2 A;  2WBR A;  4X4R A;  2M5Y A;  1T03 A;  3R1L A;  1B64 A;  1D09 B;  2XC9 A;  3V4M A;  4LJM A;  2J6T A;  4K4Z A;  3D1Q A;  3TVZ A;  4WK3 A;  1ZS6 A;  4Q45 A;  2CNO B;  4YOE A;  3KUE A;  3OXL A;  4A8F A;  3DRP A;  4LF5 J;  2ZH6 A;  1DHM A;  4MJK A;  2W9C B;  3M6V A;  4RUC A;  2DRA A;  4DUT A;  2Z56 B;  1XNQ F;  5ETS A;  3I9V 9;  3KK3 A;  5H1S V;  3ENV A;  4HHU A;  1NKC A;  1MMD A;  1NK9 A;  5IV3 A;  4MKB A;  4NLT A;  2EK6 A;  2MPU A;  2MY7 A;  2ZH2 A;  4NLV A;  1N5Y B;  3NCQ A;  2GMJ A;  3MPD A;  1TL1 B;  4PR6 A;  4CLS A;  1CC8 A;  2LQB A;  2UU9 F;  2YWE A;  1QAI A;  1SL1 A;  2HFV A;  4ECR A;  5T7L B;  1UFL A;  2RHQ B;  3KDO A;  3CJK B;  1F5A A;  4U7U K;  4QWA A;  1VMB A;  1U1O A;  4V19 X;  4K59 A;  7FD1 A;  3LWL A;  4DV6 F;  1NZA A;  3MM7 B;  2DNK A;  2MTL A;  4AE5 A;  1Q1K A;  2OLW A;  1R8C A;  1S6P B;  2FZC B;  3TUJ C;  3ZTP A;  2E9R X;  4FF3 A;  2C2O B;  3T5H A;  5B0E A;  3OXF A;  4DJB A;  2CJ9 A;  4ECS A;  5I3U B;  3FBC A;  5KTQ A;  3IWX A;  4C3L A;  1N6Q A;  3U02 A;  1K44 A;  3B4M A;  2FHJ A;  3MPU B;  2BAN A;  3HP6 A;  4WFN Q;  2YNH B;  2JWN A;  2VDH A;  3LGM A;  3NCR A;  1KFD A;  2KO1 A;  1XNR F;  2M3D A;  2BBE A;  2EK1 A;  1RI7 A;  1VK8 A;  1REG X;  2CVE A;  1GX5 A;  1WOP A;  1R7I A;  1U47 A;  1YZ6 A;  5GMK a;  2DXF A;  2J6S A;  3SQO P;  4M5N A;  5G4D A;  4J9M A;  1C4C A;  1QSL A;  3IN5 A;  2BQ3 A;  2VON A;  3CCR S;  1I3O B;  4DQQ A;  3BKT A;  2XSJ A;  2FB0 A;  3UDL A;  4P2X A;  1TMJ A;  4DV7 F;  4HH0 A;  1BGX T;  1BMQ B;  2P6T A;  1Q79 A;  4DQR A;  3D6M B;  4NXN J;  5FDL B;  4DZ6 A;  4KO0 B;  4QR0 A;  5K8M A;  1Q8B A;  2M8H A;  2XMM A;  1LWC B;  4J90 A;  1FDD A;  2HND A;  3QBC A;  1R0B G;  3EGV A;  1RAO A;  2DNZ A;  4PWD B;  2MLX A;  2VBW A;  3TI0 A;  4MK8 A;  3BDP A;  3PYD A;  2HHU A;  4DFJ A;  5B0C A;  1WOO A;  5HBM B;  3N6M A;  4KR0 B;  3UR3 C;  3CPW R;  1X9W A;  4B9M A;  2DH8 A;  1PGZ A;  3ZZR A;  4BDP A;  4HTI A;  2V8G A;  2I5J B;  4DSF A;  3BSC A;  2J0W A;  4KQZ A;  5JUM A;  4N5S A;  5G0R B;  1TTH B;  2K2P A;  1YRX A;  2D3O R;  1GH8 A;  5GAG I;  4RX6 A;  2XCA A;  2K1R A;  5KFT A;  2FHO B;  1TZ0 A;  3D0I E;  5U47 A;  3RB6 A;  5B0D A;  2BE2 B;  2LCW A;  4L74 A;  4MT1 A;  2GFF A;  5HQM A;  4TYA A;  4O44 A;  1C2P A;  3BJY A;  4QR1 A;  1RT3 A;  1YVF A;  3K5P A;  2VV5 A;  4FZV A;  3SMZ A;  5KFP A;  5DDQ C;  5K14 B;  3TAQ A;  1C0T A;  5L1L A;  4DUY F;  2LQ5 A;  3BQ0 A;  1S77 D;  1NK7 A;  2XZD B;  2RNE A;  1TUV A;  3GIR A;  5L9X A;  2QLX A;  1RYS A;  4OX9 F;  3CMA S;  1N36 F;  4NEY A;  3GSD A;  5D6G A;  4ZHR B;  2P2C B;  3RRH A;  1P9Q C;  4RUA A;  4QBU A;  1DTQ A;  2E5L F;  5IT9 U;  2AEF A;  1L3V A;  2QG9 B;  4DPU A;  1S79 A;  1U0S A;  4JI8 F;  2CKW A;  2RSQ A;  2JRS A;  3PAC A;  3GII A;  3SQG A;  3QLH B;  1SKR A;  5B7W A;  4OLP A;  2NYH A;  1N32 F;  4C8Y A;  2RAQ A;  3W2W B;  3DLG B;  5HAO A;  3JTO A;  3QIP A;  4GKJ F;  2MLY A;  3CCS S;  1N48 A;  4CDI A;  1HYS B;  1PIL A;  4R8U B;  4KGM A;  5DDP C;  3DXS X;  3PFE A;  4P6Q A;  1RA7 A;  3H5S A;  1SJ3 P;  2C2K B;  3WC0 A;  4HT5 A;  2PFF B;  3Q2T C;  8ATC B;  3U1L A;  2V94 A;  2CQ3 A;  3OV7 A;  3H4D A;  1VLO A;  3LF0 A;  1S0V A;  3O5T B;  2B6A A;  3FSX A;  3PM9 A;  1NDP A;  2VH7 A;  1F5C A;  3P4U B;  4Y2A A;  2R7R A;  1SKW A;  4DSL A;  2EBG A;  2RB7 A;  1KWM A;  3J7A N;  2HFN A;  2DXE A;  1L5U A;  3H90 A;  3R2D J;  4NEZ A;  2AJ4 A;  3O8W A;  4NI2 A;  2IYI A;  3W7B A;  4M5D B;  3CGI A;  1GTH A;  3Q22 A;  3TQE A;  1FDA A;  1N5V A;  4HEA 9;  4U96 A;  2C42 A;  3M1V B;  3Q86 A;  2DCU B;  4KHP F;  2SXL A;  4RL1 A;  1AZS A;  5F8N A;  2DH9 A;  3CXC R;  2YWH A;  4CLZ A;  4DX6 A;  3FBE A;  2VL1 A;  1H2U X;  2X1G A;  4O4G B;  5A8R A;  2ABY A;  1RTI A;  3MM6 A;  2FLO A;  2VC0 A;  1BXN A;  3KG4 A;  2IMW P;  1IKV B;  4BBY A;  1F1B B;  2HFU A;  1AFI A;  3PW7 A;  4DCP B;  2OPP B;  3W2V B;  2OJ3 A;  3RUB L;  3P3D A;  1HHQ A;  3ZZU A;  1XNQ J;  4QYZ K;  2AEJ A;  5DQH A;  4X64 J;  1FFG B;  4PXC A;  2FJD B;  3QPI A;  4CTA B;  4C8O A;  4F67 A;  2Z4P A;  2KFN A;  1MMN A;  3NS6 A;  1T9T A;  5GAD U;  1WTF A;  3FRZ A;  5HP1 B;  1QAX A;  1Y9O A;  2V67 A;  4X4P A;  2MQQ A;  1K0T A;  1TFW A;  2UU9 J;  2RML A;  1KON A;  2JEI A;  2QA2 A;  4QWB A;  1X9M A;  3L09 A;  3ELH A;  3T3F A;  3I6P A;  2VZ9 A;  1CJU B;  3LAK A;  3ILI A;  4OQJ A;  1KVI A;  5J2Q B;  4I2P B;  2AGO A;  4DV6 J;  1MSW D;  1URR A;  5ETP A;  5IOL A;  4LBH A;  4E98 A;  4EEY A;  1YGY A;  3C6U B;  1S0M A;  1Y5L B;  3KG1 A;  2ZBP A;  3ZTR A;  3HHE A;  4ZVS B;  2D9P A;  2ASL A;  3BSO A;  2W4D A;  4BLG A;  2XGQ A;  2FLN A;  1NPR A;  3K5L A;  4DV3 F;  1IVZ A;  4DSK A;  3HZE A;  2DYA A;  4F3O A;  4JI6 F;  1TL3 A;  3TAP A;  5L1K A;  2IRY A;  3OVS A;  4R5P B;  1NH8 A;  5CCL A;  1XNR J;  4C8M A;  1DTT A;  3FBF A;  4IRC A;  4WPA A;  1EET B;  1Z2Z A;  1FX4 A;  3EMT A;  1VRQ C;  2ZM6 F;  5SZT A;  4EI2 A;  4YFU A;  4NE9 C;  4ZJO A;  3NRB A;  3NGS A;  5D0G A;  4LF1 A;  2ILZ A;  4ZA1 A;  2CVI A;  3CB4 A;  1MNE A;  1J5E J;  4NAS A;  2HMI A;  4DV7 J;  3QT8 A;  1N54 B;  2IJR A;  2AYG A;  4IOA Q;  2FJA B;  4MYU A;  1VLY A;  5KAK A;  4ZN1 A;  2HZC A;  4LSN A;  2DVI A;  4ECQ A;  2M9K A;  4LRD A;  1KQF B;  4WBF A;  2JX2 A;  2J7K A;  4B3M F;  4DL4 A;  1GFW B;  3AOC A;  4PG4 A;  3AJ2 A;  4X62 F;  1VQL S;  2FIU A;  1M1G A;  3BGR A;  1EKS A;  2MQM A;  1FDN A;  2LP4 A;  2V50 A;  4B3R F;  3G82 A;  2MZQ A;  1TAQ A;  2DH7 A;  2JHE A;  1NUE A;  4UQG A;  3C46 A;  3L7U A;  1K47 A;  4PXD A;  2N3L A;  3I0R A;  4EZ6 A;  2OPS B;  4AUK A;  2Q79 A;  2GVD A;  4JI5 J;  1WF2 A;  2I8E A;  2Y0S D;  1YTY A;  3JQK A;  3GG0 A;  1Q5Y A;  2HUR A;  5KG6 A;  1NO8 A;  1JLE B;  4ED6 A;  4ZPC A;  3BB5 A;  1Q8I A;  4OYX A;  3EZ5 A;  4MFB B;  4X4N A;  3CW2 C;  1RAJ A;  4NA2 A;  3R5J B;  3AB2 B;  2RQK A;  3HKZ D;  4ECW A;  5J1P A;  2IFX A;  2UZA A;  1UVJ A;  2J6U A;  4CM0 A;  4ETZ A;  2QN6 B;  1M5P C;  1SPB P;  5GAE I;  3NOC A;  2WSC C;  5L38 A;  2XGP A;  3GCX P;  2BYC A;  2XS7 A;  3MDF A;  4B08 A;  2QSW A;  4UST A;  4NWB A;  2RF2 A;  2DHH A;  1Y3J A;  2CQC A;  4LR9 A;  2QLJ B;  3BR8 A;  3MZI A;  1RAI B;  1RT5 A;  3HSD A;  3MXH P;  2NS1 B;  4LVO P;  4OX9 J;  2MGZ A;  1FXR A;  4YB7 A;  3UW1 A;  5IT4 A;  2CYY A;  3V6D B;  1JLQ A;  2MZJ A;  2YKM B;  3QT6 A;  4JI8 J;  2HVD A;  4GKK F;  4WIQ A;  4Y65 A;  2G2O A;  1Y4Z B;  2RQM A;  3VAG A;  3FCV A;  2AU0 A;  3HVT B;  1XIQ A;  2R2T A;  2GZO A;  3PCO B;  3BRE A;  4QQB A;  3KWM A;  4LF8 J;  2HG4 A;  4CH7 A;  2LVW A;  2W8K A;  4DU8 A;  3QWU A;  2XWX A;  4ZP6 A;  2HYI B;  1WHX A;  1FT8 A;  3CIZ A;  2I6W A;  3H25 A;  1QUV A;  5HI7 A;  3NS7 B;  4K2X A;  1R8H A;  3D9B A;  4PPD A;  1LKZ A;  1YLX A;  2HHP A;  2MMY A;  1NK6 A;  2GGP A;  1UEV A;  4ED8 A;  1YIT S;  2D41 A;  5A8K B;  1N34 F;  4WF9 Q;  4C0O C;  1ACM B;  1H74 A;  4ZCL A;  1Z4U A;  2DGX A;  3BEG B;  1NJX A;  1U2F A;  1WWH A;  3CJ3 A;  3IGV A;  3MAA A;  2PEB A;  3G4S S;  1WI8 A;  3TW0 A;  5HN0 A;  1RP5 A;  2CNL B;  4K4T A;  3DMJ B;  2RS2 A;  3N4W A;  4HDG A;  3AH6 A;  3QZ7 A;  1AYE A;  2VD3 A;  1VJW A;  3UO0 A;  2Y9H A;  4F3M A;  2KH9 A;  2KXN B;  3DC2 A;  2I0X A;  2HQD A;  2OP5 A;  1NU4 A;  3UVJ A;  5F3Z A;  2N4D A;  5E3C A;  1M5O C;  1RTJ B;  4NZ7 A;  4RBU A;  3G8Q A;  4RW6 B;  3TNV A;  2FHJ D;  3D3B J;  4OHV A;  3ZZP A;  4B3T F;  4DR1 F;  1HNX F;  4IKA A;  3KLE B;  1DLO A;  3IR7 B;  2FC8 A;  3UPF A;  2M88 A;  3Q89 A;  3K8V A;  4ZVH A;  2CAJ A;  2QTW A;  3IRW P;  4TKT A;  1NPK A;  3MEE A;  3UNY A;  4DR7 J;  3OHB A;  1HPZ A;  1NAQ A;  4WYW A;  4KPY A;  2QC3 A;  2XY5 A;  3RYL A;  2CJK A;  1K8A T;  1MRO B;  2PMW A;  1OY9 A;  3BBC A;  4DR5 J;  2EFQ A;  2HQ3 A;  1RWP B;  3D3C J;  4R25 A;  2NPI A;  3EIC A;  4KKO B;  4Q0B B;  1C1B B;  2IJF A;  4IO9 Q;  2HGM A;  5F9N A;  2ALZ A;  1IBM J;  4ZPV R;  4EFA C;  2WON A;  2GA7 A;  1RYR A;  3I96 A;  4HT7 A;  4ZVF A;  5MLC V;  2K8G A;  1U7L A;  1VHI A;  2LXU A;  4CH1 A;  2DRB A;  4OZJ A;  1UAW A;  1PBU A;  2ZOM A;  3LQV A;  2EC2 A;  1YBA A;  4F2S A;  4DQS A;  2XG8 A;  3TAM B;  1BQN B;  2KRB A;  4CO1 A;  2FY1 A;  5CHC B;  2OPQ B;  3ISZ A;  1KSP A;  3OFF A;  4A8X A;  3EWG A;  2BJD A;  1KTV A;  4QWC A;  4OX6 A;  1JJH A;  2DGS A;  1WKK A;  4DL7 A;  4KH1 B;  2G2Y A;  3OFE A;  5DET A;  1WF0 A;  5GAH U;  2FVR A;  3TJ9 A;  2PDA A;  4MKV A;  3FUY A;  2JJ4 D;  3J80 Y;  3CJ2 A;  2W7A A;  2BKP A;  3RAQ A;  4YR0 A;  3DOK A;  2KM8 C;  3KLI B;  4MIA A;  3CD5 A;  3U1N A;  3EGW B;  3TA1 A;  4DV3 J;  3PYE A;  3LGH A;  1U1R A;  1CSJ A;  3MM8 A;  4B9T A;  4DV0 F;  4W90 B;  3A1Y G;  4F02 A;  1UWB A;  3DDK A;  2UXD F;  4IH5 A;  2POK A;  5DM6 Q;  5KG3 A;  2JEF A;  1PBA A;  1YWX A;  3DLK A;  3CE8 A;  5CCM A;  1SJR A;  1S72 S;  5C24 B;  4KC5 A;  2XBP A;  2MYF A;  4P2F A;  4DR2 J;  1FNM A;  1APS A;  1G1X A;  1YX2 A;  3HZG A;  1RCX B;  3R1H A;  1U8W A;  2YNG B;  2BVZ A;  2CPH A;  2DGO A;  2J0X A;  2LA6 A;  2VFU A;  3V4I A;  3QSY B;  1ZBT A;  2E5G A;  2HFZ A;  1GT8 A;  1SUQ B;  2B0G A;  1U8S A;  1B7F A;  3QO9 B;  3VCD A;  4PUO B;  1VK3 A;  5C5J A;  2GX8 A;  2K7J A;  4UUW A;  1SH2 A;  1H72 C;  1QE1 A;  4RBV A;  5EWG A;  2IA0 A;  3NWR A;  3RR8 A;  3Q8Q B;  2XS2 A;  3LH2 S;  2M7S A;  4I6W A;  1HHT P;  4B3M J;  3AA8 A;  2EFO A;  4X62 J;  1OS5 A;  3CJ4 A;  4MKA A;  4PYA A;  2NUH A;  4Y0F A;  1A6L A;  1Q8K A;  2R42 A;  3DU5 A;  2YKP A;  4L3K A;  1BQM A;  2J9E A;  1RTH A;  4LBP A;  4QWE A;  3MUM P;  5EWF A;  4ECV A;  2Q43 A;  2IHR 1;  3BPD A;  2BJ7 A;  3VQT A;  3KUG A;  2IM3 A;  4ZOS A;  3M6X A;  1PC5 A;  3WHI A;  1RT4 B;  5E41 A;  2E1P A;  2JLG A;  2ZKU A;  3C3L A;  3GE9 A;  4TNO A;  4Y34 A;  1XWL A;  1FVS A;  1JLB B;  2AYM A;  4GVB B;  3BKF A;  1HBN A;  2BM1 A;  6AT1 B;  4DQP A;  3G8T A;  3H5U A;  4O3N A;  3RW7 A;  1H7W A;  2BE2 A;  4LFA F;  2C3M A;  4JUZ A;  2D74 B;  2ROE A;  3GV8 B;  2CQ4 A;  3CDA A;  1VBZ A;  3GP9 A;  2ASD A;  3AAW B;  2XMT A;  3VHQ A;  5D15 A;  2GML A;  4LF2 A;  4ZPT R;  3BGU A;  1I5O B;  2E5I A;  1Y0H A;  2IAJ A;  3ITH A;  2YBV A;  3VAH A;  1B0V A;  2DY9 A;  4WZM A;  2LA4 A;  2XLI A;  3OQ2 A;  1IKY A;  1S9G A;  1IXK A;  3VAI A;  1JNR B;  1ROF A;  4LF7 F;  2HBQ B;  1S7H A;  3NGU A;  4X4T A;  1TKT B;  4IDK B;  1O5J A;  2QV6 A;  1S9E B;  5IC6 B;  2L41 A;  3VGV A;  2CZ4 A;  2V8V A;  4U7C A;  1IUJ A;  4GKK J;  5A76 A;  1RTD B;  2KI2 A;  5HJY A;  5I4M A;  1Q82 T;  3GYN A;  3PRD A;  3IXQ A;  1KRP A;  4V19 J;  2ZOG A;  4M5K A;  1DQ8 A;  1TKZ A;  4UT4 A;  5LMN F;  3DRR B;  5KG0 A;  2N4C A;  2ZH8 A;  3TAN A;  4DL0 C;  1RBA A;  2YQ0 A;  2ZH9 A;  5A0Y B;  3NAH A;  4R8U A;  5E5N A;  3UDE A;  5I42 B;  4ZCK A;  2VA2 A;  2BRK A;  3GJQ B;  1XTZ A;  2A2D A;  4J9Q A;  3GPA A;  2R7T A;  1N34 J;  1VQM S;  2GV1 A;  5J2N B;  1Q0N A;  3M8Z A;  1NME B;  2FDN A;  1VQY A;  3SCK E;  2OEL A;  2DY1 A;  4DV2 F;  5CH7 B;  1PSD A;  2R7V A;  3PR5 B;  2BX6 A;  2BW2 A;  3SYZ A;  4LFB J;  4F50 A;  4KSE B;  4KT0 C;  2Z58 B;  2LMI A;  1L3S A;  2HRY A;  4ZLP A;  3OL7 A;  2E7X A;  2KG0 A;  1KOO A;  3MR7 A;  4P52 A;  5D0E A;  4W92 B;  1SB6 A;  1GXL A;  4DX8 H;  3DNC A;  3W60 A;  4B3T J;  1PO6 A;  4DR1 J;  1HNX J;  4ZP8 A;  3BS9 A;  1CC7 A;  3RTV A;  4NZ0 A;  3K0J A;  1FE4 A;  1X0F A;  2Z0G A;  1S12 A;  4B9V A;  2UV8 G;  1CPZ A;  1E6V A;  2B7C B;  3P5T L;  1ZAW A;  2H5E A;  3BH7 B;  1CLF A;  2BJE A;  2ZC3 A;  3VQS A;  2VKR A;  3C15 A;  4CO0 A;  5F8H A;  1PG5 B;  4OZ1 A;  1D0E A;  1YQH A;  9ATC B;  3PJ9 A;  2R7O A;  4YR3 A;  3N6L A;  4LQ9 A;  1N5T A;  4WJB A;  2IVF B;  3D4J A;  1OQ3 A;  1FJE B;  1UET A;  4CTA A;  2CPZ A;  4U95 A;  3ZO7 A;  1H38 A;  1FES A;  1KD1 T;  3W5X A;  5IWA F;  4YQW A;  1HWI A;  2XI2 A;  3DOL B;  2GS8 A;  1V3Z A;  2ZEJ A;  4KH0 B;  4LR7 A;  3OHA A;  4OYB A;  1B0P A;  3MTJ A;  2B43 A;  2BE7 D;  1X4C A;  5ITH A;  1HI1 A;  4K7Q A;  3GZ7 A;  1YHQ S;  1TP7 A;  3ICL A;  4DS5 A;  3M6U A;  4WFX A;  4N56 A;  1S6Q B;  1UA1 A;  3MED B;  1SC4 B;  3DGV A;  2VKZ G;  3AXK A;  4ZKA A;  2VQF F;  2PMZ D;  4I67 A;  4ECZ A;  3U1M A;  4ID5 B;  5KFB A;  3BM7 A;  4P10 A;  2V9W A;  4RBT A;  1M0S A;  1C4A A;  2F4F A;  4UW2 A;  2RS8 A;  2G2Z A;  2UXD J;  4DCJ B;  1S1T B;  3MMC B;  1T05 A;  2DNN A;  1CJV B;  4K4Y A;  5HRO A;  1RA6 A;  4G65 A;  2N7C A;  3IR5 B;  2CPD A;  2MHN A;  3HD2 A;  3MR3 A;  2HHV A;  4DF4 A;  3DGP A;  4JV2 A;  4RW9 B;  2ZD1 A;  4Y00 A;  2V63 A;  3CVK A;  4WFA Q;  1OYD A;  3OL8 A;  1FKP A;  1PKU A;  2ZHO A;  1HBM A;  4H4M A;  3MM9 B;  1RT6 B;  4WKR A;  5THW A;  2R2R A;  5AXM A;  2BZ2 A;  1T03 B;  1A9N B;  1C1C A;  3LP1 A;  1EZZ B;  1KOH A;  4C2M A;  4ECT A;  1YI2 S;  3PEH A;  3NS5 A;  4NLU A;  5KFM A;  1MWY A;  2B3T B;  4X65 J;  4ED1 A;  3C8Y A;  1QM9 A;  3IAM 9;  3B8H A;  2LEC A;  3M8Q B;  2YXL A;  3GTY X;  1FE0 A;  4PYD A;  3DRP B;  3PKM A;  4ZLN A;  1NK4 A;  2FJE B;  1PAE X;  4DSI A;  3KK3 B;  1NHU A;  3L4B C;  2HIY A;  1YBT A;  3QT7 A;  2G1H A;  2VUG A;  4OV1 A;  2Q66 A;  4C8K A;  2KVQ E;  3W8G A;  4DQI A;  4F4W A;  3T1A A;  2WK4 A;  4B9L A;  4XPC A;  2CQI A;  3GMG A;  4X4S A;  4QPX A;  1WDT A;  2R9L A;  2NSC A;  1HBO A;  3HUL A;  1Q5V A;  2JC1 A;  1MG7 A;  1R43 A;  3EPI A;  3AOA A;  1R89 A;  2YKO A;  1AUS L;  4UTG A;  1W25 A;  2OO4 A;  5CZV A;  5AXK A;  1RT7 A;  4P74 A;  4FYD A;  3VGT A;  3V2U C;  2HHQ A;  2OMO A;  3GSI A;  2CQ2 A;  3F41 A;  3OSN A;  5KFD A;  4Y2C A;  4FF2 A;  1UP1 A;  1YJ9 S;  3O6Q A;  3M8R A;  1XK8 A;  4Q2L A;  2ROP A;  2NSB A;  1T8E A;  2R8H A;  2XY6 A;  1PYS B;  3GB0 A;  4CCH A;  1EJ7 L;  5T14 A;  2UXC F;  1N6Q B;  4DSJ A;  2ZKT A;  2HQI A;  1NM2 A;  4LF7 J;  4TVA B;  4A8M P;  2BAN B;  2Z2L A;  4HDH A;  3D7S B;  1T9X A;  5DGA A;  4A8K A;  1YZ7 A;  4FPI A;  1LFP A;  4HR2 A;  1NK0 A;  4C9D A;  2YQ1 A;  5LSR A;  3UD4 P;  1N88 A;  2Z57 B;  1YJN S;  1UVL A;  3ULH A;  2GHV C;  2XSJ B;  2DNH A;  4QW9 A;  1VC5 A;  2K06 A;  2P5V A;  4DL5 A;  1CVJ A;  2OGU A;  2B5J A;  1FNO A;  2UV8 A;  4ECX A;  3D5M A;  1YK9 A;  1RHU B;  1NDK A;  3CJ5 A;  1R31 A;  2MKJ A;  3UCG A;  2C2E A;  2HVI A;  1U1P A;  2FTR A;  4OZL A;  2AZ1 A;  4NLQ A;  5B0F A;  4PG7 A;  1TK8 A;  3UDV A;  2RQC A;  2HND B;  1NXI A;  5DLG A;  2FJW A;  5EHH A;  2I9S A;  1U02 A;  3NMA A;  2UUA F;  1FJ7 A;  5DDO C;  1CBK A;  4DV2 J;  5LXY A;  1KNZ A;  2IM0 A;  3GJR B;  3HHK A;  3LTO A;  3QT5 A;  1TUW A;  1VQS A;  2R8K A;  3ENQ A;  3KOA A;  1HWJ A;  4F8R A;  4NPO A;  4DLE A;  5IQQ A;  2UXB F;  2K1R B;  2ZH1 A;  4NLX A;  4K0K J;  2XYG B;  1I51 B;  2RHS B;  2R7W A;  1GTE A;  2RRB A;  2JVR A;  2LYV A;  4FKY A;  2CJX B;  1NRK A;  2VFR A;  3CCZ A;  3SEO A;  1UVN A;  3AT1 B;  4CH0 S;  2DR7 A;  4JOU A;  4O44 B;  4XO0 A;  2V8H A;  3HPO A;  4JI0 J;  2ZHB A;  1X60 A;  1RT3 B;  2QEX S;  1WKL A;  2DIT A;  2IIH A;  2W8L A;  4NLD A;  1EHW A;  1G7C B;  1D1U A;  2H51 B;  4PCQ A;  1C0T B;  2B9X A;  3RGI A;  3EDQ B;  3JTN A;  2JSX A;  4URS A;  5HMY A;  3HSZ A;  1HLW A;  2CJY B;  3TZY A;  2IC3 A;  4LVN P;  1RU1 A;  2Z2Y B;  3GIM A;  2E5H A;  2J7U A;  2P8I A;  4RKU C;  3FFI A;  5IWA J;  1RT1 A;  3FC9 A;  3NG8 A;  4FXW A;  3SIP B;  2V0N A;  4JV1 A;  4QJV A;  5J1E A;  1IBL F;  3K5M A;  1DTQ B;  4Y6I A;  3EDR B;  1RZM A;  2FJB B;  2E29 A;  3KHG A;  1N5Q A;  3KG0 A;  3SQG B;  1MWZ A;  2QIF A;  2RH3 A;  1N33 J;  3FNN A;  4NYO A;  4MK9 A;  4OHX A;  1VQ7 S;  2DR8 A;  1O8B A;  4LFC F;  2CFX A;  1ZM9 A;  3THT A;  3QAT A;  3T9N A;  5ETV A;  3N6N A;  1GMW D;  3QIP B;  4EYH B;  1FEH A;  3MAH A;  2X51 A;  2CPF A;  2CQG A;  3EVO A;  4FF4 A;  1WUU A;  3JSB A;  3MF5 A;  3X3U A;  1WHY A;  2KHC A;  1R8A A;  5HAT A;  5GAD I;  1JQG A;  2MKH A;  5IV4 A;  3CJT A;  2MQN A;  3DLE A;  5A6P A;  3T5K A;  1K73 T;  2MJU A;  2LEP A;  4RO0 A;  2B6A B;  2FVQ A;  2DEI A;  2V2Z A;  1HNI A;  5E2Q A;  3QJJ A;  3MAQ A;  1UW9 A;  3R5D A;  4R0E A;  2HQF A;  4QWD A;  3VAL A;  1SJF A;  5KFH A;  4NI2 B;  2ZE2 A;  5ADZ A;  3US5 A;  5LL6 d;  1F9F A;  1IBC B;  3R5A A;  5AE1 A;  1KLM A;  1P27 B;  1AZS B;  5CYQ A;  2ROG A;  4DEZ A;  2WTF A;  2N3O A;  5KG7 A;  2QX0 A;  3BH6 B;  1ZAV A;  5C2C A;  3MCM A;  3IWL A;  2MQL A;  1T3N A;  2XHC A;  4DPW A;  3HT0 A;  2R2U A;  2HBZ B;  1REV A;  5A8R B;  1RTI B;  2ZUG A;  3MM6 B;  2UVV A;  2AKW B;  1RCO B;  3Q23 A;  2VF3 A;  4QIW D;  4ZJL A;  5KFC A;  1FHT A;  1DAX A;  3TVK A;  4IG3 A;  2OD6 A;  3U7J A;  3BO3 A;  1S59 A;  5HQ8 A;  1U1M A;  3I5B A;  1QSS A;  4OYP A;  1TKD A;  4U9R A;  2QA1 A;  3UQS A;  4NXM F;  4FKX A;  4HVZ A;  5DZ7 A;  4LF5 F;  3LAN A;  1KQS R;  3MR6 A;  4WE1 A;  4WU2 A;  5D4L A;  1RWM B;  4OHY A;  1ZH5 A;  5K8P A;  2COL A;  4F25 A;  1HA1 A;  1NKB A;  3OBI A;  1JB0 C;  1U45 A;  1CQM A;  4CP5 A;  3DHX A;  1FJG J;  1T9W A;  5C25 A;  5C2G A;  1U0H A;  2Y1J A;  3QGG A;  3IG1 A;  2H3E B;  4MIB A;  1AUD A;  3JQM A;  1LXJ A;  2ZBR A;  3AY0 A;  3HXM A;  4YDX A;  4ENO A;  5D3G A;  2AX1 A;  2NLW A;  3ZNJ 1;  2HHS A;  4O3P A;  2J9C A;  2D7S A;  4PPZ A;  4LF9 J;  5M2P A;  3KNG A;  4CLL A;  4TLQ A;  5C7P A;  3UR0 A;  4LIW A;  2J5A A;  3FKB A;  2UXC J;  4PXB A;  2NYI A;  2ZH4 A;  1UKU A;  2Q6B A;  3LUY A;  1TL3 B;  4QZV B;  3CCE S;  4CWB A;  3MEG A;  1DTT B;  3C19 A;  5EX3 A;  4DX7 A;  1SV5 A;  3TRG A;  2Z8Q A;  1ZYQ A;  4ELU A;  3AOD A;  3NBP A;  4FXD A;  3FCW A;  1UJ5 A;  5B08 A;  3OW2 R;  2QE5 A;  2DIS A;  4D3H A;  2ZZN A;  2HRT A;  3H0P A;  1NLK L;  3PXG a;  3CCM S;  3K5O A;  4PQU A;  5FD1 A;  2HMI B;  3D66 A;  2AGP A;  4P71 A;  2KT3 A;  4ZS6 A;  5JVG Q;  1EP4 A;  2FPH X;  2JH3 A;  1KQG B;  3PZP A;  3IWN C;  2QA4 G;  2XLK A;  3MEC A;  1HWU A;  3CUN A;  3MGJ A;  4FP9 A;  4NXN F;  2EXU A;  4LSN B;  2WHO A;  5A0Y A;  5KFR A;  1HMV A;  2DR5 A;  4Q8F A;  3R5G A;  1DRZ A;  3T6J A;  1XR7 A;  1GXU A;  4CT8 A;  3E01 A;  3T41 A;  4YEA A;  3ZZY A;  5LOQ A;  3OLB A;  1F2H A;  4XIU A;  2C2M B;  4IR9 A;  4OV6 A;  3BGR B;  4RW8 A;  3N5B A;  4LRC A;  3MUR P;  3K2Y A;  1VRT B;  4ZVG A;  5B0B A;  2CZ9 A;  5DG9 A;  2UUA J;  2P6S A;  3WDO A;  4DCO B;  4RWX A;  1BLU A;  2IVM A;  3H2U B;  5DS7 A;  2ASY A;  3HDS A;  3I0R B;  5F8L A;  3PX4 A;  2DR9 A;  4QIG A;  1UEU A;  2IDL A;  2GVD B;  4IH7 A;  1SCJ B;  3DLH A;  2PI5 A;  3G2X A;  2YY3 A;  2UXB J;  5DG8 A;  5BXI A;  4NLS A;  4KY3 A;  2G0J A;  3HI9 A;  2M52 A;  2WRM A;  1X5O A;  2LLZ A;  1DQA A;  5GAG U;  1WI6 A;  3IM8 A;  1PAU B;  3ILL A;  3CCT A;  4QIV A;  3GIJ A;  2QMX A;  3G6V A;  3A8I A;  2A3J A;  3JSY A;  2VBY A;  2ZJR Q;  4USM A;  2C3Y A;  1T95 A;  1JJ2 R;  5IT0 A;  2HHH J;  4P2S A;  3TX8 A;  1VQ6 S;  4U7U D;  3OXG A;  2CRL A;  2RF2 B;  4N8O A;  2RDI A;  4UOH A;  3M8W A;  3PG9 A;  2PGC A;  3BZQ A;  2OIH A;  2NQP A;  1VC6 A;  3P49 B;  1X4H A;  4ED2 A;  1HQ2 A;  3QGP A;  2NCK L;  1RT5 B;  2AJ1 A;  5DDR C;  1YJR A;  1F2G A;  5HO4 A;  2MGZ B;  1X4B A;  3HX9 A;  5KFS A;  3IAS 9;  4HHJ A;  1IBL J;  2EC0 A;  1JLQ B;  3MPW A;  2HK2 A;  2W2P P;  4YHH J;  2DB1 A;  3BYP A;  4RW4 A;  1MML A;  4MKY A;  4I68 A;  5DQI A;  1N4L A;  4A48 A;  1SL2 A;  2BQU A;  4NCG A;  4USJ C;  4OZ0 A;  2GO8 A;  1S76 D;  1SQE A;  3QAE A;  3VGS A;  2FVS A;  1V5I B;  6FD1 A;  5A2Q Y;  2Z2M A;  4WCE Q;  1YIJ S;  2VA3 A;  2B56 A;  3NNA A;  4QYZ J;  4EBE A;  1N52 B;  5D4N A;  3JAM U;  4ZK7 M;  3D6H B;  1QD1 A;  3KK1 A;  2A6O A;  1PYT A;  1RWX B;  2H54 B;  3TEG A;  2KYX A;  2IM1 A;  2GGP B;  4JYA F;  1A7G E;  2ATL A;  3CED A;  1VQK S;  1RAB B;  1KVJ A;  2GJI A;  3UN2 A;  1U1Q A;  5AT1 B;  5DRK A;  4TXS A;  3MAA B;  3KLH A;  1M5K C;  1U4B A;  1DZ5 A;  3CWJ A;  3OPK A;  3DDN A;  5LMU F;  1T02 A;  3IBF B;  3OSP A;  1BE4 A;  4DBQ A;  3TUP A;  4IQX A;  1Q7L B;  5C42 A;  5GAH I;  4IRD A;  3UVJ B;  3E3X A;  2R2S A;  3BO4 A;  3EX7 B;  4DFP A;  1JLC A;  4QIF A;  2O5D A;  4FBU A;  4OHZ A;  1DLO B;  4TU7 A;  3MI7 X;  2MQP A;  4WKY A;  2XHW A;  1DUR A;  2AX0 A;  1LK5 A;  3FSY A;  4CIO A;  2G13 A;  4ZLJ A;  3R8Y A;  3MEE B;  4NXM J;  4F26 A;  3M8Q A;  1R6V A;  4EUV A;  4AQY F;  1HPZ B;  4Y2I A;  2M70 A;  1JLF A;  4NCA A;  1RKI A;  4AXI A;  3PHT A;  2QL9 B;  3UN5 A;  3OTE A;  4BS2 A;  1OJ4 A;  3M6W A;  4X64 F;  4LBI A;  1S97 A;  3FBB A;  4J5O A;  2HNZ A;  4N7T A;  2WON B;  3UCU P;  3ZTO A;  3CT9 A;  4F0H A;  2BXJ A;  3D1H A;  4P73 A;  1ZA1 B;  3FQL A;  1MLA A;  3LW5 C;  3K8W A;  1SC3 B;  3GV7 B;  6FDR A;  4ECU A;  5HLF A;  1T9U A;  5A6W A;  2O01 C;  4F2R A;  3MPV A;  2FVC A;  4H4K A;  2Z2Z A;  1LW2 A;  1R8P A;  4CT9 A;  4JV0 A;  1RKJ A;  3T6B A;  2E44 A;  1SC1 B;  2HQC A;  3R7N B;  5J2M A;  3D68 A;  1UTA A;  5HMX A;  5ETT A;  1VC0 A;  2G4B A;  1WF1 A;  3DI6 A;  3DOK B;  3ILJ A;  3MM8 B;  5EN1 A;  4CZC A;  3HHL A;  2OPR A;  1UWB B;  1Q78 A;  4B9N A;  3I9Z A;  1U1K A;  2W2M P;  3DLK B;  3HJF A;  1QAY A;  1IWG A;  2J76 E;  3R3T A;  1RWK B;  1IN0 A;  4M5M A;  4W4M A;  2F8H A;  2LEA A;  1BY9 A;  2IYG A;  3K58 A;  3V4I B;  2NZ4 A;  4CI0 B;  4XDC A;  1SBR A;  2PII A;  3GCW P;  4C8L A;  5D0H A;  1ZAX A;  4A47 A;  2VG5 A;  3Q83 A;  2H1Y A;  2O66 A;  1J5E F;  2C3O A;  3MCS A;  1OIA A;  5AE3 A;  2E5J A;  1QE1 B;  3GFH A;  5IS2 A;  2EW9 A;  1KQK A;  5LJ3 Y;  4ED3 A;  1RT2 A;  1U26 A;  1HWL A;  3GJT B;  4RZR A;  3BGL A;  1IBK F;  3T1Y F;  2YWK A;  3BV8 A;  3AQO A;  5I3P A;  1OY6 A;  4DMZ A;  1EQ0 A;  1BQM B;  1NDC A;  2W4P A;  1RTH B;  5KFI A;  2VPZ B;  3VGU A;  2KFZ A;  2I2Y A;  2O67 A;  4ITS A;  1X5P A;  3HM9 A;  1I94 J;  5BJR A;  2QO3 A;  4M5J A;  2KB2 A;  3HLU A;  3X1L B;  2XYH B;  5KFJ A;  3FDS A;  4Q43 A;  1RHQ B;  3CDU A;  2YNI A;  1RAH B;  2UUB F;  1HBN B;  4JI5 F;  2XZT B;  2QLB B;  1AA1 B;  2VQE F;  2R7X A;  2VB6 A;  3D54 A;  1K1Q A;  1NSK L;  4DR3 J;  3I87 A;  2ZH3 A;  2YVS A;  1FRM A;  2WAQ D;  4C11 A;  2FJX A;  2IVY A;  2GQC A;  3ZZZ A;  3SXL A;  2CNK B;  5DJB A;  3HT3 A;  2UUC J;  4NCB A;  2XS5 A;  2HVZ A;  1QY7 A;  3HMJ G;  3H40 A;  2D1C A;  2KDO A;  1NK5 A;  1N8R T;  2HW3 A;  3LP0 A;  2IMO A;  2A2C A;  3KFW X;  4ZPB A;  2IAJ B;  3ITH B;  4KFB A;  1VJQ A;  1IKY B;  1S9G B;  3R6G B;  5IT9 Y;  4OYZ A;  2F1F A;  2W4C A;  3TJ8 A;  3RBZ A;  3O3L A;  1IM4 A;  2JEG A;  2CJQ A;  3IR6 B;  5E3R A;  3L9Z A;  3KLG A;  2AGQ A;  4LQ3 A;  1MWQ A;  1VBY A;  4NZ6 A;  1RDR A;  1SKS A;  2OAU A;  1JKH A;  4U6P A;  4FYV B;  4DG1 B;  5KFY A;  2ZVI A;  4YY3 F;  5DZ6 A;  2OD4 A;  2FUG 9;  3CUL A;  3G96 A;  3DDI A;  3M2U A;  2QZ8 A;  3H20 A;  4W98 A;  4CNY A;  3DHW C;  3P6Y C;  1TKZ B;  1S0N A;  2BJ9 A;  2J0Q D;  1T94 A;  1RGV A;  3LO3 A;  2OSQ A;  2HHW A;  3CCU S;  4F4Y A;  4LF8 F;  4DHV A;  3CCL S;  1CEZ A;  4WFY A;  3ZZT A;  3K59 A;  3OVB A;  2ZNY A;  4JYA J;  1GMV A;  2ZFH A;  4Y3C A;  5KT2 A;  2RUS A;  4EWT A;  2D3U A;  1Y10 A;  1N5S A;  3IO1 A;  3I5A A;  1KHV A;  3K89 A;  2YQ3 A;  2BQR A;  5LMU J;  3MMA A;  1NJI T;  4U8V A;  3QRQ A;  1YRU A;  3TR5 A;  2LQJ A;  4AND A;  2GW8 A;  2MQ8 A;  3EYZ A;  3ADA C;  5ETQ A;  3EGN A;  1OPI A;  1B70 B;  1B99 A;  4RPF A;  2NR0 A;  2HKE A;  4B9S A;  2DO4 A;  2LQ9 A;  3KJQ B;  3THV A;  2HWT A;  1VIO A;  2C2D A;  3MM5 A;  1S1W A;  2EFG A;  1HKA A;  4LSZ B;  1RWO B;  4URG A;  2GO9 A;  3KTQ A;  1E6V B;  1FK9 A;  1M1K T;  4OJ1 A;  2KXH A;  3C15 B;  4AQY J;  3B78 A;  2QLF B;  5KT4 A;  1KN6 A;  1ITP A;  1ZPW X;  2F63 A;  4DR7 F;  4ZVT B;  4Z37 A;  1T7P A;  3PX0 A;  4Q7A A;  3C6T A;  4DR5 F;  4JBC A;  1HBU B;  4DL3 A;  3FZ2 A;  1VGY A;  4OYM A;  1IBM F;  2NRE A;  4ILL A;  4ZVP B;  3I82 A;  4L76 A;  4I64 A;  2F4V J;  1E6Y A;  4N77 A;  1SIW B;  4J9L A;  1H6K X;  2WCX A;  4M5L A;  4UF4 A;  2NXN A;  3PDN A;  3L7P A;  5E3Q A;  4OI1 A;  4FYY B;  5FLX U;  3NEK A;  3GWC A;  3AOB A;  1VBK A;  3V6K A;  4HHH A;  2CPI A;  3H4B A;  4WP3 A;  4CO4 A;  4ZCI A;  3CMQ A;  5LXR A;  4KHR A;  5HK4 A;  3TO8 A;  3J7Y U;  1V6H A;  5D4P A;  2HAF A;  3CC4 S;  3C14 A;  1FJC A;  2E1A A;  2QGF B;  2BR0 A;  3T5L A;  1C0U A;  2B4V A;  1XMB A;  2AP6 A;  3NWG A;  4RW7 A;  2AJ2 A;  4QCL A;  4C98 A;  1T05 B;  3SBM A;  5HRO B;  1VI7 A;  3MUV P;  1VQN S;  4CM2 A;  3CJ0 A;  4DZD A;  3LGN A;  3DGP B;  3IMQ J;  4B02 A;  2ZD1 B;  1FKA F;  3J81 j;  3VZI A;  2GIQ A;  5RUB A;  2VOD A;  2C1E B;  3CDW A;  1FKP B;  4M1K A;  4L72 B;  4DR2 F;  3NKY A;  1HBM B;  4H4M B;  3MCO A;  4HAC A;  1Y5N B;  3DRS A;  1GK8 A;  1GNK A;  1ZA2 B;  2XM3 A;  4C97 A;  4DF8 A;  2NXE A;  1C1C B;  3LP1 B;  4MK7 A;  2B9Y A;  3DM2 A;  4WWS A;  4HH1 A;  2PEH A;  4TQR A;  3KJV A;  3M30 A;  4RUH A;  2ZNZ A;  2K7K A;  1T0T V;  2E9T A;  5IQ6 A;  3BN7 A;  4JP8 A;  2HIQ A;  3PIO Q;  3PY8 A;  2B51 A;  1IBK J;  4TQS A;  3T1Y J;  5ETR A;  2JLE A;  2CWK A;  3W5Y A;  2C3U A;  4OYA A;  3CD0 A;  5L39 A;  1UVI A;  1VRT A;  4WZQ A;  2DTJ A;  5KFV A;  1NSP A;  2VPW B;  4KGV B;  5ETK A;  1SVD A;  2CZV C;  3NL0 A;  5DGB A;  1WDD A;  2H4Y B;  3RZA A;  5AXN A;  3PV8 A;  2DHG A;  4WTO B;  1HBO B;  5H9E J;  1NSA A;  2UUB J;  1TL5 A;  2DGQ A;  3MR2 A;  3POT A;  2Y8Y A;  3HHL C;  2YKA A;  2VQE J;  1WTB A;  3Q8Y A;  1RT7 B;  2ACY A;  1RLC L;  4X4O A;  4KHM A;  1CS4 A;  1XMQ J;  4OI3 A;  1AB8 A;  5IFM A;  1UA0 A;  2X3D A;  5JVH Q;  4I69 A;  3R9L A;  1Q4R A;  4FNI A;  4A46 A;  3H7H B;  3W3S A;  1UW4 A;  4Q5V A;  1HR0 J;  1DAR A;  5D4O A;  1R27 B;  3OTD A;  5ETN A;  5KFZ A;  5HMZ A;  3T5J A;  5D8H B;  3K57 A;  3H5X A;  2E1M C;  3UNG C;  3EZO A;  3OVA A;  2W2O P;  2OTL S;  1TU0 B;  1LK7 A;  3R5B A;  1HQE A;  3HHN B;  4YY3 J;  4PRF A;  3QGH A;  3UDC A;  2H65 B;  2GIF A;  1VQ9 S;  4DL2 A;  2EFV A;  3QSI A;  1VQ8 S;  4KAI A;  2PD1 A;  1M90 T;  3KUH A;  4J9N A;  5EUH A;  2B5J B;  4F4Z A;  1W2B R;  1IKX A;  1V5V A;  3UN3 A;  3A12 A;  3SSQ A;  5E3A A;  4GC7 A;  1F5B A;  2CQ0 A;  2VBX A;  2CXE A;  4C0B A;  4C3K A;  2HZV A;  1CJK A;  1U6Z A;  4IFV A;  2XMJ A;  1OY8 A;  4C3M A;  3FMB A;  3BSN A;  3D6T B;  4C48 A;  4I0W A;  4ELV A;  3MHY A;  2KJW A;  2IRU A;  5CYJ A;  3AQP A;  4N8N A;  3JTP A;  4P9S A;  4ZIT A;  2JNJ A;  2X1A A;  4I4B A;  3PO5 A;  1U2C A;  4EO6 A;  3H42 A;  2BOP A;  3QRR A;  2BV3 A;  1YJV A;  1N56 A;  1MU2 A;  4XPE A;  2DCL A;  2ZH7 A;  1WD6 A;  4CYU A;  2HS4 A;  2M0G B;  5M2U A;  3C2P A;  1X4G A;  3H5Y A;  2A18 A;  4LFB F;  1WOS A;  3WX4 A;  2VJV A;  2L3M A;  3CCJ S;  3HK2 A;  1S99 A;  3KXD A;  3HHL D;  1OMS A;  1VCT A;  2PSZ A;  5HQL A;  3KJF B;  1XR6 A;  1JXE A;  4KV8 A;  2XI3 A;  3J7A 1;  5CZX A;  3KK2 A;  5IXU A;  2CDQ A;  5F9L A;  3BSA A;  3EGZ A;  4H4O A;  3FMW A;  2HSE B;  2L08 A;  1TFY A;  1GEH A;  4QU7 A;  1RBL A;  2VG7 A;  1FI4 A;  2PFD A;  2I38 A;  3OTB A;  2AF6 A;  2VC1 A;  1MW7 A;  4F4K A;  2IC3 B;  2GVZ A;  4KGZ B;  3PW5 A;  1LWE A;  3FFI B;  3FEZ A;  1RT1 B;  1WEY A;  1FF2 A;  7AT1 B;  4USI A;  3MD3 A;  3CJS A;  2RT3 A;  5J1E B;  3FEX B;  2RQ4 A;  1PJ7 A;  4OI6 A;  2OEJ A;  2DGT A;  3R5C A;  1KBR A;  4JI4 J;  1S49 A;  1J27 A;  4E2F B;  4TY9 A;  1BWE A;  4TN2 A;  2PI4 A;  2DXD A;  3J81 Y;  5LSO A;  1VDH A;  3M2V A;  4Y28 C;  4O4R A;  4B3S J;  1HI0 P;  4JI1 F;  1SL0 A;  4ZVQ B;  2ZC4 A;  5KFG A;  2V4J A;  1BWV A;  2XYP B;  5KFX A;  4DV1 F;  2OKQ A;  4NA3 A;  5J2P B;  2HFO A;  4Z7C A;  3DLE B;  3NGT A;  2ZVS A;  1CUL A;  4OI2 A;  3CD6 S;  3SFU A;  2XO6 A;  4K4S A;  3JYT A;  1UVK A;  3BO2 A;  3TP2 A;  2XNR A;  4C0H A;  1HNI B;  4O3R A;  4AYB D;  5KFL A;  1JX4 A;  3TA0 A;  1IR1 A;  4QW8 A;  2BOA A;  2XUL A;  2WW8 A;  2W7P A;  2N7Y A;  2QMW A;  3W65 A;  3AFG A;  2OFH X;  3HF5 A;  2ZE2 B;  4ZP7 A;  5E3P A;  3CCV S;  3GR0 A;  4WU3 A;  3HVR A;  4FNH A;  2G9O A;  3IC1 A;  2YWF A;  2XCP A;  1KLM B;  5CYQ B;  1YSJ A;  2AMC B;  1HW8 A;  5KG5 A;  2W7O A;  4N47 A;  2U2F A;  4AL6 A;  2CPX A;  1U1L A;  2E1R A;  3TYT A;  4CLY A;  2DNY A;  1REV B;  3I31 A;  2CJB A;  4G1Q B;  2JLF A;  1FRX A;  4ETX A;  2WVF A;  3C66 A;  1D9F A;  3JSM A;  1TQL A;  4IG3 B;  4X65 F;  2F8M A;  3OR1 A;  2NXC A;  3OD2 A;  2LXI A;  4TY8 A;  2DEJ A;  1TEL A;  2ZOF A;  1FRI A;  3NMR A;  3THP A;  5KFQ A;  1EAR A;  5IM0 A;  2W2Q P;  1IKW A;  3ZTQ A;  3PR4 A;  2F5G A;  1FNX H;  3PEJ A;  4WE1 B;  3CO0 P;  2GNK A;  2V2V A;  4H54 A;  4ED4 A;  5FII A;  3NAI A;  1HNZ F;  2VIC A;  2BA9 A;  2R7Q A;  3CJQ A;  3LP2 A;  3EM1 A;  2W01 A;  2DD8 S;  4WXO A;  3KKF A;  3TJA A;  4C4W A;  1OQ6 A;  3KMQ A;  3OTC A;  2Y0B B;  1FRL A;  5C25 B;  1ZTT A;  1U0H B;  1G2E A;  1X4A A;  3IG1 B;  4IG0 A;  3PVX A;  2F40 A;  4UOG A;  4UOF A;  1WKJ A;  5F8I A;  3SI8 A;  3CCW A;  3CDE A;  2ERR A;  1KS2 A;  1QTN B;  2U1A A;  1N0V C;  5D3G B;  2GJ2 A;  5E0O A;  2W24 A;  5F8J A;  2DNR A;  1RWU A;  1RU2 A;  2RDJ A;  4ZVE A;  4Z2X A;  5BYS A;  2QT7 A;  1B3T A;  3P5B P;  4UUX A;  5L1I A;  3M2R B;  1AW0 A;  1SJ4 P;  3QJL A;  2HK3 A;  3Q0A A;  3F44 A;  4DWI A;  1FWL A;  3SCJ E;  3ENA A;  3PRV A;  2YKN A;  4LRF A;  4EGL A;  3MEG B;  1K0V A;  2OML A;  3GFY A;  2KL8 A;  1SV5 B;  4P2M A;  2VG6 A;  5KFF A;  2C2R A;  1OWX A;  4HYK A;  3NBP B;  1AXQ A;  2XMA A;  4DX5 A;  4DG1 A;  3HJV A;  1B0T A;  2NPF A;  3E51 A;  1BHN A;  2HBR B;  1QSY A;  1Q8L A;  5H9E K;  4PQU B;  2BAB A;  5H9F J;  4CLT A;  1SI9 A;  1ZM2 A;  1EP4 B;  1TL7 A;  3W9I A;  5D77 A;  2DR6 A;  3MEC B;  2HAI A;  3NGD A;  1VRU A;  4PQA A;  2R4F A;  1S1U A;  4JI3 J;  2C28 A;  5F8G A;  1HMV B;  2XQC A;  3MPY A;  4G3I A;  4K5R A;  2V5H G;  1RHJ B;  3E01 B;  1LW0 A;  3ZNU A;  2YH1 A;  2DKO B;  4ED0 A;  1TAU A;  4RW8 B;  4QPT A;  1F6T A;  1X0P A;  3SDE A;  1S4F A;  5GME A;  2BMB A;  1HW9 A;  1S1X A;  4OYI A;  5MAO A;  1RSC A;  2ZWP A;  5E33 A;  3W5Z A;  4F7V A;  1GMU A;  5BR8 J;  2LKZ A;  4AT1 B;  3TQ1 A;  1QJH A;  2IY5 B;  3W63 A;  1W7W A;  3W66 A;  1F0X A;  4DS4 A;  3HHD A;  4YB6 A;  5K9F A;  4DL6 A;  2DBB A;  2A6M A;  4NLP A;  5KOX A;  2DHS A;  2DIU A;  2QSF A;  2DHX A;  1Z1Z A;  3MTK A;  4NRU A;  1Q86 T;  5ETL A;  3P8B B;  2WVE A;  1S10 A;  1IQZ A;  4OIX A;  1V3R A;  4K0K F;  1ZZF A;  2QA4 S;  2FLP A;  4RR5 A;  1RQ0 A;  4O0I A;  1FEE A;  2LDY A;  3BR9 A;  3GYX B;  2CQ1 A;  1S4E A;  5JMN A;  3H2L A;  1RIS A;  4FVC A;  4JI0 F;  2PE8 A;  2VIH A;  1VS3 A;  3N01 A;  1WNE A;  1HNV A;  2HNY A;  3GG1 A;  3AD9 C;  2BKN A;  5CYM A;  4J9K A;  1AFJ A;  5HVG A;  4X4Q A;  2FZK B;  4YS2 A;  3QYY A;  4LIR A;  3SV4 A;  3VTI A;  5EWE A;  1FVQ A;  2RU9 A;  1S6U A;  1RLD A;  1M1H A;  4DV4 J;  1TVR A;  3IP0 A;  1Y3K A;  1HBU A;  1XMO F;  3DRY A;  3AJ1 A;  1X8D A;  2WVD A;  1HNW F;  3IS9 A;  4RW4 B;  3MR5 A;  4LF6 F;  5GVQ A;  5B0G A;  3M8P B;  2IM2 A;  4KPC A;  4NCG B;  2UP1 A;  1ZTW A;  2W1B A;  2HWH A;  3DCA A;  2LQ8 A;  2DJW A;  4O3O A;  1N33 F;  5CD4 H;  5KFE A;  2KTQ A;  3M32 A;  3SSS A;  3OR2 A;  3OL9 A;  4RU9 A;  4X84 A;  4QOT A;  3RAM A;  2XEX A;  4JI1 J;  3HCX A;  1FA0 A;  3LAM A;  3S7R A;  1YJW S;  1BUX A;  3PHE A;  2RU3 A;  4DV1 J;  4B3O A;  3ZC4 A;  2CAD A;  2WVB A;  3W1Y C;  3KK1 B;  4A8Q A;  2F9D A;  4AL7 A;  3VR1 A;  3EXY A;  2DGV A;  3KMS A;  1R3N A;  1UFK A;  4ZVU B;  5KT5 A;  2EEY A;  1H73 A;  4YDD B;  3J7Z 5;  4CLW A;  3KLH B;  2ADB A;  3EVM A;  2DK2 A;  2P9G A;  4F04 B;  1GXT A;  3KLF A;  1P6T A;  4K50 A;  1RHR B;  1WEL A;  4EO8 A;  2XMK A;  2H5J B;  1BC6 A;  3MD1 A;  4L3N A;  2ILY A;  4L75 A;  5KG2 A;  1LWF A;  3CCQ S;  4A8Y A;  1VQP S;  1Q81 T;  2YWW A;  4DSE A;  5C42 B;  3BKU A;  2D3Z A;  4P72 A;  5CD4 A;  4R0J A;  3VAF A;  1S1V A;  1JLC B;  4MAK A;  4OFZ A;  2OEK A;  4K4U A;  4KBI A;  3FRY A;  4I2Q A;  4KYZ A;  2ZUA A;  3ZZ0 A;  5D0R A;  4LSL A;  2DHA A;  1VQO S;  4KIA A;  2VOP A;  1EAY C;  2WOM A;  2EKY A;  2ACM A;  3G86 A;  2OHD A;  2BE9 B;  1S9F A;  5K8N A;  1PC4 A;  3JSR A;  1GX6 A;  4ID8 A;  5LSL A;  1R0A A;  1JLF B;  4NOH A;  4OYO A;  3S8S A;  1X4E A;  2EVZ A;  2XMU A;  1WC5 A;  3QGI A;  1TKX A;  1JWW A;  2XZW A;  1HNZ J;  3R2C J;  2C2N A;  1LXN A;  4B17 A;  2HNZ B;  1UEK A;  3Q8P B;  2ZHA A;  5JJB A;  2V68 A;  3R7B B;  1IM6 A;  1FXL A;  4Z7Y A;  5HLF B;  1JIH A;  1FJG F;  3E2E A;  4ALZ A;  1SC6 A;  1A0O B;  2XSF A;  3N9U C;  3N28 A;  2B9W A;  3GU0 A;  3PW4 A;  1VBX A;  1UCN A;  2MQO A;  1CG2 A;  2W9B A;  4IQM A;  1LW2 B;  2Y8W A;  1WSV A;  2F7V A;  3WX8 A;  3QQC D;  3LAL A;  1WOR A;  3A4T A;  4ZIW A;  3VAM A;  1CJT A;  3DLJ A;  1JLA A;  3BQ2 A;  2YPY A;  2QFJ A;  2ZBI A;  5J2M B;  1IWA A;  3PW2 A;  3FK4 A;  3DOM A;  3TX0 A;  4LF9 F;  1H2T Z;  1UFW A;  3DI6 B;  1RAE B;  4JV5 F;  2IPO B;  4OMF G;  1IJE B;  5B09 A;  3C16 A;  3GIK A;  4JI2 F;  4ICL A;  4BHQ A;  3HHL B;  2OPR B;  5KFK A;  3S6E A;  2DPJ A;  4P7T A;  4Q2M A;  2VOO A;  4PZV A;  4QU6 A;  2IDE A;  2VJU A;  1BQX A;  2YH0 A;  2JFK A;  4ZJQ A;  5B0A A;  4USH A;  4TLR A;  3IBC B;  1VHF A;  2BAC A;  3HSJ A;  4A8O A;  2VFS A;  4EU0 A;  3ETM A;  1U48 A;  3RJM B;  2VPY B;  3PKY A;  4I7F A;  3M4X A;  3LWM A;  3PFO A;  3V81 A;  3FVY A;  4OHW A;  4DLG A;  1R8B A;  5EDW A;  2C2Z B;  2BM0 A;  2BDP A;  3DU6 A;  2MZT A;  2VG5 B;  4QYR A;  4DUY J;  1ZPV A;  1RWN B;  3DYA A;  1RXO B;  2QJ3 A;  4TU8 A;  3HFZ B;  4ZN3 A;  3G9C A;  4RNF A;  2GQQ A;  1RJJ A;  5M2R A;  1RT2 B;  1HIY A;  1I6J A;  3FZB A;  3CIM A;  3G6Y A;  1N36 J;  1FO1 A;  3V6J A;  1OSC A;  3JXO A;  3SZ2 A;  3O44 A;  2E5L J;  4ZMM A;  3OJU A;  1RE1 B;  1L3U A;  4ILR A;  2EG2 A;  4AD6 A;  3H98 A;  1EIY B;  4M5H A;  4IOC Q;  3OUY A;  3AXM A;  3GON A;  2JC0 A;  2EFP A;  4BWM A;  1N32 J;  3ET6 A;  1S48 A;  1UJ4 A;  4AFF A;  2RKI A;  2YNF A;  1TV6 A;  4IFY A;  4P7V A;  4GKJ J;  1WG5 A;  3R27 A;  4J37 A;  1D9A A;  1NDL A;  1FKO A;  5A8W A;  3ZZO A;  5L46 A;  2GC8 A;  2YNI B;  3HFV A;  3I0S A;  1J5O A;  2DRD A;  2CIM A;  1WG1 A;  4RJV A;  3WZ0 A;  3FSI A;  4NL5 A;  4USW A;  1YG0 A;  2R3V A;  4C11 B;  1H3D A;  1U49 A;  3IM9 A;  2GAH C;  4JB8 B;  4G1P A;  2R8J A;  1H0H B;  1RBO B;  4LR8 A;  1RHM B;  4DN0 A;  2HWI A;  3MMB A;  3IRX A;  5H9F K;  2JDJ A;  4DR4 F;  1TK5 A;  1RWV B;  2CPJ A;  3LP0 B;  2CJA A;  2QLW A;  2ZJP Q;  2HHH F;  4U67 Q;  4KFB B;  3PJW A;  2X7I A;  4RNN A;  2APO A;  4KHP J;  4UQT A;  4Y2M A;  3AB4 B;  4WYL A;  3KLG B;  1VQ4 S;  3Q2S C;  1XMO J;  1K9M T;  3CJ8 A;  1HNW J;  1ZM3 A;  3WBZ A;  1NSQ A;  4LF6 J;  2MKK A;  4ZLL A;  1JKH B;  4FPR A;  2HHX A;  1P1L A;  4YHH F;  4PEO A;  5K8O A;  3DLL Q;  3M2U B;  4LT6 A;  2G1D A;  5ETM A;  1IR0 A;  4HTJ A;  2AJF E;  3ETO A;  2WSF C;  3KDN A;  2H4W B;  3MUT P;  2C3P A;  2W9C A;  1QUP A;  4CO5 A;  4DV5 F;  2B4U A;  3WIV A;  2BEF A;  2AWZ A;  4DPT A;  2CWX A;  3IA0 A;  3L3C A;  1QVG R;  1SH3 A;  1SQF A;  1W2I A;  3CC7 S;  1N5Y A;  4FBT A;  3M8S A;  3TUZ C;  4OJ3 A;  5J2P A;  2QL5 B;  4IH6 A;  4WII A;  3QZ8 A;  1TL1 A;  1ULR A;  4RNH A;  3HKW A;  1H2V Z;  4BCA A;  5HMW A;  4J9S A;  2KG1 A;  4USK A;  4J7C A;  5KFO A;  3NP5 A;  4MIW A;  1V3S A;  2ASJ A;  3FGV A;  3MMA B;  2R7U A;  3PRB A;  5T7L A;  4C8N A;  1U1N A;  4X4U A;  8RUC A;  4O3S A;  2HHT A;  3J7Y I;  3CJK A;  3GFX A;  3CDB A;  2FYX A;  4OZ5 A;  1NEE A;  5DO2 A;  3MM7 A;  2RIJ A;  3CTR A;  1S6P A;  3MM5 B;  3J81 U;  1EB0 A;  3GIL A;  1S1W B;  1NJY A;  3H59 A;  1NK8 A;  3B54 A;  2DPI A;  2LDI A;  3ISN C;  5LJ5 Y;  4G1Q A;  4ANC A;  4Y2K A;  4JI6 J;  5I3U A;  4L73 A;  1FK9 B;  2L9D A;  3A3O B;  1U09 A;  2GJF A;  3K7R A;  3SSR A;  1O6X A;  1JJ4 A;  4DU7 A;  2YNH A;  1NB7 A;  4NLR A;  1WC0 A;  1NJZ A;  8AT1 B;  3J80 U;  2ZM6 J;  1KVK A;  1FFS B;  2HS0 A;  4GVL A;  5I3Q A;  4RNO A;  2ADC A;  3QJP A;  4ED7 A;  2AYB A;  1FWK A;  3C6T B;  1WHV A;  2LFV A;  4WP9 A;  3PJX A;  1FDB A;  2CPE A;  1B4S A;  3G6E S;  2ATC B;  2J7W A;  2Q1L A;  1LWX A;  2PN6 A;  2MKS A;  1KP6 A;  2BW7 A;  1E6Y B;  1FCA A;  2MZS A;  3W62 A;  1SKU B;  4N41 A;  3F56 A;  1LOU A;  5FDL A;  4K5S A;  3QNW B;  4KO0 A;  3BDE A;  2UVW A;  2QFI A;  4CLF A;  4IYQ A;  4HL9 A;  4CLU A;  4EYI B;  1VR6 A;  3AA9 A;  2C22 A;  2ALY B;  1IR2 A;  1LWC A;  3EUN A;  1D8Z A;  1JXV A;  4YB1 P;  2IRX A;  2F8E X;  3OTO F;  4PAB A;  5IZH A;  1JNZ B;  4OI4 A;  3DXB A;  2MJN A;  4V1A k;  4FDF A;  2KZZ A;  2HZA A;  4B3R J;  4PWD A;  3C14 B;  1FRH A;  4ERD A;  1NB2 A;  2KJV A;  4PG8 A;  3I55 S;  1FRK A;  1GMW A;  1BD6 A;  1C0U B;  2HVE A;  2HQG A;  3J7Z T;  2ZZM A;  1PYO B;  5HBM A;  4JV5 J;  1DY3 A;  2FLL A;  2NZC A;  3G71 S;  4RW7 B;  4JI2 J;  2CQD A;  1OPZ A;  1JXL A;  3M2R A;  2E9Z A;  1X31 C;  3KNA A;  2I5J A;  3UWT A;  1T9V A;  1OYE A;  2EFN A;  2Y1L B;  2HGL A;  3OFG A;  2AJ0 A;  2I1R A;  3T9Z A;  5G0R A;  2OEM A;  1UWA A;  3KLV A;  4HLB A;  1IJF B;  4J9O A;  2F65 A;  1XEZ A;  1NCL A;  2K3K A;  1D9D A;  2MDA A;  2PA8 D;  4CNZ A;  2DO0 A;  1QTM A;  2XWY A;  3VWS A;  4YUD A;  3TEH B;  2E7V A;  1S6O A;  2JL9 A;  4HAC B;  3CF5 Q;  1RAD B;  3DRS B;  3N0V A;  2BJ8 A;  2CUY A;  4IR1 A;  2KZM A;  1ZZN A;  3UD3 P;  4ZDN A;  1KTQ A;  4A4J A;  4F0K A;  3DM2 B;  3WIU A;  2RRN A;  5K14 A;  1HQU B;  3KJV B;  1H7X A;  1PJ6 A;  3M30 B;  4DDF A;  3ISN D;  4ECY A;  5F0W A;  4NRT A;  3M7V A;  3QWP A;  1YRT A;  2MKC A;  4N76 A;  2EKN A;  2HS3 A;  3R6L B;  5F8M A;  1FD8 A;  2JVO A;  2ZBC A;  3MCN A;  3F0N A;  1LQ9 A;  4YME A;  2HLT A;  3EVW A;  1KHW A;  4ZHR A;  1X5S A;  1F3V A;  4IOB A;  1FFW B;  4WFZ A;  3B6B A;  1S7I A;  5FJ4 A;  4DUZ F;  4GMK A;  4XDD A;  3QLH A;  4OJH A;  4USU A;  5HJX A;  4CO2 A;  4OZN A;  1EX8 A;  2MZR A;  1HD0 A;  1I94 F;  3W2W A;  3DLG A;  3UCZ P;  3RB4 A;  3KJN B;  4YP3 A;  4WK1 A;  1WEZ A;  2AT1 B;  4TU9 A;  2DNQ A;  1JLG B;  1T3O A;  3POT B;  1HYS A;  5KT7 A;  3ILO A;  4ELT A;  5KT3 A;  4D3G A;  3VZH A;  1PIE A;  3VVU A;  1KKH A;  4O0N A;  2R8G A;  3CC2 S; 
#chains in the Genus database with same CATH homology
 1RAO A;  1TMM A;  3HSZ A;  3HSJ A;  3MCO A;  3ILI A;  5ETT A;  5ETL A;  2QX0 A;  5ETR A;  1IM6 A;  5ETK A;  3HSG A;  3HSD A;  3KUG A;  1HQ2 A;  4M5L A;  1HKA A;  3ILL A;  3MCM A;  5ETQ A;  4AD6 A;  1RU1 A;  4M5H A;  4PZV A;  3KUE A;  2BMB A;  1TMJ A;  1DY3 A;  4CYU A;  5ETV A;  1RB0 A;  2F63 A;  3HT0 A;  3ILO A;  3MCN A;  1F9H A;  1G4C A;  4CWB A;  1Q0N A;  1EX8 A;  5ETP A;  1RU2 A;  1RTZ A;  4CYU B;  4M5G A;  1EQM A;  4M5I A;  2F65 A;  3ILJ A;  5ETO A;  3UDE A;  4M5J A;  4M5K A;  4M5N A;  4F7V A;  1CBK A;  3KUH A;  2CG8 A;  3QBC A;  3HCX A;  3IP0 A;  1KBR A;  4CRJ A;  3HD1 A;  1EQ0 A;  3UDV A;  3UD5 A;  5ETN A;  5ETM A;  4M5M A;  3HD2 A;  5ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...