4M5NA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
HMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5nA00
1IM6A 1KBRA 2CG8A 4M5KA 4CRJA 3HT0A 5ETNA 2F65A 4M5GA 4M5MA 5ETQA 4F7VA 3HD1A 3QBCA 1EQ0A 1HQ2A 1EQMA 3ILJA 4M5NA 1RU1A 4M5JA 3MCMA 3HSJA 1CBKA 1TMMA 3HCXA 3HSGA 5ETKA 4CWBA 5ETPA 4M5IA 2BMBA 1G4CA 1RB0A 3MCNA 1RU2A 3UDEA 3UD5A 5ETRA 2F63A 3KUHA 5ETOA 3ILLA 3KUGA 5ETSA 3ILOA 2QX0A 1DY3A 4PZVA 3HD2A 1TMJA 3MCOA 4M5LA 3HSDA 1Q0NA 3IP0A 3ILIA 5ETVA 1HKAA 4M5HA 5ETTA 5ETMA 3KUEA 4AD6A 5ETLA 1EX8A 3HSZA 4CYUB 3UDVA 1F9HA 1RAOA 1RTZA 4CYUA
chains in the Genus database with same CATH superfamily
2VC1A 3QWPA 1ZM9A 3SV4A 1LWEB 2LP4A 3V6DA 5IT9U 1U24A 3MEEB 1X4CA 4IYQA 1AZSA 3D0GE 2YKNB 3IBWA 2KFNA 5HN0A 1Q16B 3SEOA 1PIEA 2B3TB 3K5MA 1FX4A 4RW9A 3W5YA 3NLCA 2KZMA 2LDYA 1N36F 2XQCA 2AX1A 2C2DA 3BF4A 1X4GA 1FKOB 3ETOA 4K50A 1FT8A 3B82A 4G1QA 4ID5A 4PG4A 1CJTA 1AUDA 2M3DA 4I64A 4ZPWR 1RAIB 4PYDA 3PDNA 4ZP7A 3TJ9A 3QSIA 1HA1A 4O4GA 4U7UD 1JKHA 1NSAA 5K8MA 2ZC3A 2PA8D 3JQMA 1VOMA 3HDSA 4Q0BA 1DTQA 2Q6CA 2W7AA 4U8VA 2A3JA 2P5VA 3EVMA 1XR6A 3LPEA 3L7UA 2F8HA 3MPVA 2RILA 3FEYB 3BJYA 2JLEA 3CWJA 3MM5A 4KO0A 2V8HA 2ZJQQ 2KG0A 4KAIA 3MECA 4DJBA 2E1MC 3HULA 2GMHA 3KYLA 5T41A 1VC6A 2HNDB 3N6MA 2YWHA 4QIEA 3NEKA 5CAAA 2JL9A 5KFHA 3SSRA 4CH1A 4EFAC 1P6TA 2BJ8A 2FJEB 5C42B 2GJFA 1HBMA 5KT7A 4DR4F 4Y34A 1VBZA 3RAXA 3NL0A 3KG4A 3J81U 3FZBA 4MKBA 5KFRA 3DMJA 2ALYB 2YVSA 4YB5A 3BS9A 2QV6A 3W2WB 2PA3A 3RR8A 4KGKA 3TAMA 4M8LA 3RB3A 2XMVA 2BDPA 4R0JA 5IV3A 4IO9Q 2DGXA 4OJGA 1R8HA 2KJWA 2PEHA 3HT3A 1JLFB 2V9WA 2KXFA 4U95A 1O51A 4CI0B 4O0IA 4YOEA 2N82B 2CA9A 4ZVPB 4DR6J 5CYMA 4F4WA 2X1BA 3GFZA 4KSEB 1YSJA 2E1RA 2NZ4A 3KLFA 4B9MA 2QX0A 3PFOA 1R31A 2QMWA 3OTEA 3FKBA 4PXEA 1G6BA 2AD9A 2E5IA 5IT9Y 2ATLA 1SC1B 2JZ5A 2Q66A 3HHNB 4ZCMA 3HCXA 3PJ9A 5FDLA 2A10A 4LF2A 2FZGB 2XZWA 4ES1A 2OFGX 1EP4B 3GJSB 5IWAJ 2APOA 2KYXA 4CLLA 2BANA 4ZPVR 1Q8BA 4CO3A 4WTYA 2OPPA 3GIKA 1N32J 1VRTA 4TVAB 3BR9A 4NLDA 1IQZA 3NCQA 2BABA 2CPEA 1S9GA 3GSIA 5D4PA 1HQEB 1RADB 3AHPA 4RKUC 2KM8C 1AROP 3SZ2A 4CO2A 3VV2B 1QAIA 3KJFB 1KLMB 2J9DE 3AFGA 2XMJA 1KVJA 3W5XA 4DV0F 5D78A 1VQPS 1TUGB 1U1KA 4RW6B 1KTQA 2CPZA 2CQBA 2PMHA 5HMWA 5EX3A 1RU2A 1JMTA 1PGZA 1TFWA 4KJIA 3M8QA 1UVMA 2QO3A 2YKQA 4Q44A 3HX9A 3OXLA 4C11A 3PKYA 2D3ZA 1SC4B 3BPSP 5HO4A 4LF9J 3MM7A 2HVIA 4M95A 4LR7A 3TA1A 3EGZA 3PRBA 2LU1A 2ZZNA 3MR7A 3GJRB 3B8HA 3IRXB 4P72A 1X5TA 5BXIA 2KO1A 5ETSA 2OELA 1OQ3A 3J81Y 4ZN3A 3LOUA 3PKMA 4DPTA 2QFJA 2H51B 2E5GA 4LF7J 4QR2A 2ZBIA 2A6OA 2VBXA 4LVNP 2DGSA 2FD2A 2ZVSA 2ACMA 2DCUB 2CPJA 2AJ4A 4EU0A 3A8EA 2QIFA 3GIJA 3HHLA 2KVIA 1L3SA 3MPWA 1NDPA 1RAOA 2KN4A 2IJFA 3KK1A 1QSSA 4HHJA 3FZ2A 3NBPA 5LT5A 5AJ3J 4NLOA 4DQSA 2F4VJ 4DU7A 3NNHA 4BBYA 5F8LA 1ZTWA 2RRBA 1CJUB 1FHTA 2I0XA 4FYVB 2HFNA 1RWXB 3IG1A 3M30A 1LEOA 1S9EB 1NDLA 3GYNA 2R9LA 4ZLJA 1RT1A 2JC0A 4G3IA 1Y9OA 2YWWA 1REVA 3AJDA 2MQNA 4LRCA 3PYFA 3SQGA 5A8RB 2PI4A 2IYIA 1KQFB 1HYSA 1DY3A 4CO4A 2YH0A 2IYGA 1HBUA 3B4DA 1GMVA 1R8CA 4CRJA 1X4AA 5HI7A 4Z37A 4HH0A 1NCLA 5F0WA 1RTDB 4DSJA 1MWQA 3T9ZA 4LFCJ 4FS2A 1OQ6A 2LYVA 2FVQA 2PEBA 3DXSX 4GVLA 3TX8A 5J2NA 4F4YA 3V6JA 4CO1A 4DSKA 1T3NA 4NCGB 4CLSA 1TFYA 1RU1A 2QG9B 2BQ3A 2UXBF 3L7PA 2WONB 2E5HA 4HACA 3AB2B 1XEZA 2V8PA 2VL1A 3AA9A 4OMFG 2AV5A 4R8UA 5F9NA 4AUKA 3A12A 3SFUA 2XMMA 1D09B 4OI0A 3HVRA 4DL4A 4X2BA 5J2MB 2DR7A 2MZQA 3W1YC 1DURA 4M5IA 4LBIA 4ILMA 4XO0A 1HD0A 2AW0A 1VQMS 2CPDA 4DZDA 2H4WB 1RT2B 5F0UA 2CNKB 1FEEA 1UETA 2QLXA 3Q22A 1XK8A 3AXKA 2KTQA 2DGTA 3BB5A 2VBZA 1AFJA 3BO4A 3MAAA 3QNWB 1QUVA 3I0SA 4ZVTB 2XSFA 4O3QA 4CNZA 1VQNS 1N52B 2YKMA 3KK2A 3AOBA 5KFLA 1QD1A 1UEUA 3EXYA 3QYYA 3M8PA 2XNQA 1RT4B 3C66A 1PG5B 2GC8A 3DGVA 1A6LA 3LP2B 3PW5A 3MGJA 2O3DA 3BGRA 1SQGA 2DRDA 2IMOA 4QIWD 2J76E 1HW8A 2V4JA 2M70A 4JYAF 3RYLA 1TR0A 3GZ7A 4F4XA 3M2VB 4RLEA 4YFUA 1S1TA 1GEHA 4K0KF 1RYRA 5CYQB 2W1BA 2V94A 2YKPA 3PM9A 3Q2TC 1HBNA 3QT8A 3SQOP 2FHJA 3KK3A 1N48A 2K2PA 4EWTA 1BXNA 2RDIA 2VPYB 1FFWB 2VQEF 2C3OA 5IQQA 1QDUB 4O44B 5HQMA 1H74A 1MROA 1S7HA 4DCOB 4RR5A 2DHSA 4OZJA 1P9YA 1WHYA 4JOUA 5K14A 1RB0A 2FJVA 1T9WA 5K8PA 2GHVC 3E51A 3MM8B 3CE8A 1IKWA 3EJMA 3JAMY 2ZH4A 1U1OA 2DNKA 2V2QA 1CULA 5L1KA 3CC7S 4H4MA 3SBMA 3Q83A 2GVZB 4A47A 5L1IA 1OIAA 2RHQB 3N4WA 2CQGA 2I6WA 1D9AA 1FFGB 2OPRB 5F9LA 1GXLA 3UVJB 2PMZD 2Q79A 1NNDA 3AXMA 2ASYA 2C2ZB 1C0UA 3ISNC 4USVA 2DK2A 3VTIA 5K8OA 1L3UA 4E98A 4TXSA 2OTJS 1U1QA 1IVZA 3DOKA 3FK4A 1QTMA 3A8JA 4Q2LA 1U0HB 3SSSA 4C4WA 5LJ3Y 1AFIA 1LFWA 1J5EJ 4Q43A 5EN1A 4IR1A 1JX4A 2V8GA 3N01A 4B9SA 3M32A 1ELOA 3MCSA 1T9YA 2DR8A 1NK4A 2FJAB 1WKJA 3KKFA 2DRAA 2BJDA 1AZSB 3QLHA 4XK8C 2R8JA 2CQ0A 5A6WA 1WOSA 4A8WA 5HSPA 2UU9J 5I42A 3D5MA 1VLOA 3OL9A 4OQJA 4RW9B 2A1BA 1B0VA 1NUEA 5DRKA 2CQ2A 1Q81T 4MJKA 2OGUA 3MEGA 1WG5A 1S1XA 1KQGB 3M8YA 4RNHA 3CJRA 2K7KA 1DQAA 4E2FB 3RB0A 4G1QB 2CYYA 2ATCB 1CJTB 4MK7A 4C8LA 4FBUA 3QATA 4QW9A 1LNQA 5IM0B 4O4GB 1D8ZA 2HIQA 1WG1A 3M8WA 2F3JA 1JKHB 2PC6A 4ZJQA 3CVKA 1EETA 2W4DA 1GQEA 4A8XA 4PCQA 4UOHA 4Q0BB 1DTQB 4RO0A 5KFEA 4XTTA 2KKHA 2VODA 4M5MA 4ZP6A 1XNRJ 3PNIA 2CQ1A 2OSQA 2BUNA 2RU9A 4KE5A 5KT3A 3MM5B 4DBQA 5B0DA 2WTFA 3AJ2A 4KO0B 2MHNA 3K2YA 2VJUA 3H0PA 1Y0HA 1S79A 2L9DA 1VDHA 1KRPA 2VG6B 4PWDA 1FJGF 5CZVA 4I56A 3DRRA 2BVZA 1S7IA 3GFXA 4WKRA 4CYUB 4ETZA 5E0OA 4DR7F 1KQKA 3EE3A 3RUBL 3I4PA 1HL6A 2R7XA 3C8YA 1KDNA 2MKIA 4HYKA 4EZ9A 1UWAA 1HBMB 3HP6A 2AYEA 4DV4J 2QE5A 3CMES 4F36A 1DAXA 2J9CA 2PMWA 4DOZA 3BYRA 2RRAA 3J7YU 1UEKA 4M5NA 3N0VA 3M6XA 4Z7CA 1ZA2B 2ZDOA 4MYTA 5KFGA 3TAMB 5A6PA 3OTDA 2U1AA 1ZYQA 4FVMA 4GKKJ 3QGIA 3I0RA 1HI8A 2YNHA 1X5PA 3HK2A 1RWPB 4K4XA 5DLFA 2J8AA 3GCWP 4PPDA 3GB0A 4NLPA 2KT3A 5ETOA 2ZWPA 1OSDA 1T11A 3M6WA 3WDOA 1SL2A 1P27B 1HWKA 1SJFA 4N76A 5CYMB 4Q5VA 2MZJA 2P9EA 4PG6A 2E5LJ 2ZH7A 1R8PA 4L74A 4QCLA 3OL7A 1ZA1B 1PO6A 3DLLQ 1P9QC 4LMZA 2DH7A 4MT1A 2PIIA 4M1KA 2GVDB 2HURA 4DV5J 1RISA 4DL7A 1G3OA 4HEA9 4OZNA 2CFXA 1SQFA 2FY1A 1KR4A 2C2EA 3FCHA 2ZH3A 3C19A 1IWAA 1YQHA 1RSCA 3AB4B 3D6FB 5ETQA 3PVXA 1RKIA 2BANB 1DQ9A 1B0TA 3MCNA 2YH1A 2Y9HA 2OPPB 1FWPA 4XDCA 2WVDA 3VVUA 5JJBA 2H3EB 4Q8EA 1S9GB 5HJYA 4HI1A 4K2XA 3CCSS 3BR8A 3ILOA 1LK7A 1XIQA 4UUXA 2RE1A 2SXLA 3GPAA 1HNWJ 2ZNZA 2NLWA 3B4MA 2LKZA 2XWYA 5L8RC 2BOAA 4JI6J 3GJTB 2BW2A 1RYSA 4DUZJ 4FF3A 4F4AA 2RQMA 4Y6IA 4KFBA 1QAXA 4OZ3A 1LV5A 3CMAS 2HFUA 3G86A 2VDHA 4C11B 1A0OB 1W25A 2UVRA 3I55S 2HQGA 3NS7B 4ZCKA 4LF6J 3I6PA 4EK2A 3MM7B 1SCJB 3BO3A 3J7YI 2VA3A 3AAWB 5CYJA 3N5FA 4OYAA 4DR5F 1VRQC 4FDFA 2YXLA 1TK0A 3UR3C 4RJVA 4F0MA 2BQRA 5L39A 2VH7A 1M1HA 1VIOA 1IKXB 2IFXA 3V81B 4J9OA 2D7SA 1NH8A 1WACA 2H9ZA 2EEYA 2EK1A 3UDEA 4OJ1A 2XS7A 4A4JA 1HNIA 2W4PA 1UEVA 2VU5A 2KFZA 3QRPA 5KFOA 4JI2F 3CPWR 3MOZA 4CTAA 3TX0A 1YJRA 2DJWA 4XAKA 4DV3F 3CJ0A 3LQVA 1F6TA 4DHVA 1SVDA 3HHLB 3P49B 3OT9A 1H7XA 3KK1B 2GO8A 1U6FA 4F67A 3NBPB 4NLTA 4F3MA 4C2MA 4C8YA 1AW0A 2NUUG 1MWYA 4CLTA 3H5XA 3ENWA 3IFEA 3DN9A 3OTOJ 4B3SJ 5H9EJ 4QZVB 3CW2C 2W2MP 3GYGA 1VK8A 2RB7A 4AL6A 2Z2LA 3IG1B 3MUTP 2YWGA 3M30B 1FESA 4ZP9A 3HSGA 3IN5A 4DV2J 4FXDA 5DZ7A 4ETXA 2HVHA 2MHEA 2AWZA 1RT1B 2YWKA 4ZIVA 2HGNA 3J7Z5 3N6LA 1VQYA 1REVB 3UN3A 4NZ0A 4UQGA 4XPCA 2HZAA 1IBKJ 2FLPA 1SH2A 2CPYA 1HBUB 3FFIA 4DDFA 5DG8A 4ELTA 5JMNA 5AE2A 1A7GE 3H25A 4USHA 4CLUA 4GKJJ 2G2YA 3DLHA 4NXMJ 2HVDA 2MKYA 1QTNB 2X7IA 5J2NB 1Y3JA 5L46A 2GHWA 2DRBA 1VBYA 3HJVA 3KMSA 4HACB 4YB6A 4RNFA 3KXDA 4DN0A 1RT6A 1Y5NB 3CNQP 4IH7A 3BN4A 4Y65A 3SCIE 2XSJB 1FX2A 1GXTA 4K2JA 1RACB 5LSRA 1IJFB 4X65F 2E29A 4KR0B 4UQTA 1WWHA 1Q4RA 3WZ0A 4JV0A 3E01A 4J9LA 2CNOB 3T1AA 2XMTA 3F56A 4ER8A 2AGPA 2AGOA 2DH9A 3RR7A 5E3QA 1RT7B 2QGFB 1C0TB 1WC4A 4WFYA 3MAAB 1JLAA 4OFZA 3I0SB 4C98A 2NYIA 4G6VB 2W8LA 2YKMB 3MM9A 4WFXA 5KFZA 3KK2B 2J0WA 2ZH2A 2HLTA 3R8YA 2BACA 3M8PB 4AQYF 2GAGC 4ZVHA 4O0NA 4JBCA 4I68A 4O3NA 3BGRB 1T8EA 4F4KA 1U48A 1TV6B 1RAGB 1FJCA 2V4JB 1RLCL 1RBLA 2WRMA 3GG0A 4I4BA 4B3RJ 1RWOB 2DEJA 4CH0S 1FXLA 1FCAA 4I6YA 3FCWA 1ZS6A 1WI6A 3CO9A 5ADZA 2V8VA 3MM6A 1HD1A 2FHOB 4WU2A 2L3MA 4U7CA 1E6VA 3GTYX 4Q2MA 4QIGA 3T5LA 1REGX 1IBLJ 3KJQB 3KK3B 3PW7A 2ZH6A 2Y0SD 1BQNA 1S12A 3G6YA 2YKOA 1HHQA 3KNAA 2OPSB 1CJVA 4IQMA 4W4MA 1AT1B 4IOAQ 2QYCA 2IMWP 4E8UA 1Y7PA 1MROB 1UP1A 2E7VA 2BYCA 2LXUA 1C1CA 4ENOA 2QJ3A 2HWTA 4OJ3A 4P2XA 1HHTP 1YJTA 4KGMA 3KLVA 3TUJC 1FEHA 1IKWB 2Q43A 2XMAA 4OI4A 1N36J 2MYFA 4M5KA 4QR0A 4JI7J 1CULB 3UE2A 1WOOA 3US5A 3SXLA 3DLKA 1FJ7A 3W64A 5E2QA 2AYGA 2W9AA 2HVZA 3UDVA 5AE3A 1IR1A 1EHWA 1T9UA 3CCES 2QLBB 3RBEA 2BRLA 1Q8IA 4Z2XA 4F2SA 1YBTA 3O8WA 4JI4F 2MSTA 3O2IA 2FLOA 4G65A 3DLBA 2B4PA 1N34J 4OZ0A 2W4CA 2JHEA 4NMLA 4L3NA 4N5SA 1LQ9A 3WBZA 1RAFB 4I67A 3F0NA 2WSFC 4KC5A 1SKUB 2JC1A 3NOCA 3S8SA 4ICLB 5HQ8A 4NRTA 2D3UA 4DI6A 3CULA 3VQTA 1DBDA 3QLHB 2CJ9A 3MD3A 1SKSA 3MPYA 2ROGA 4W92B 4FS1A 2DNPA 4YY3F 5LSLA 4J9SA 3PEJA 4FPIA 3P8BB 1PSDA 3PR4A 1V9OA 5I42B 1D1UA 4DR4J 1UFKA 2GJ2A 3DCAA 4OX6A 1RWWB 1EB0A 2EKNA 4URGA 2YQ0A 3MEGB 1S1XB 1S0MA 5C2CA 2H54B 4DWIA 3IWNC 2KDOA 1YJ9S 3DI6B 1SH3A 2AQ4A 1YJNS 3LAKA 2VKZG 3PRVA 3CCLS 2HHUA 1NHKL 3I31A 3HVTA 3A8KA 2C2NA 3RRHA 4OI6A 2CWKA 2KZZA 4RU2A 3HT0A 1NK5A 2HYIB 5KG7A 2AP6A 3NP5A 4BCAA 1KWMA 1PAEX 2HPUA 2O5DA 4OI1A 3X1LB 4OYWA 4L73A 3D3CJ 1IN0A 2F9JA 3R27A 1EIYB 4RBTA 1ZZFA 5FJ4A 3GFHA 5A76A 1RAEB 1SQEA 2DKOB 3HKZD 3UD5A 1K0TA 4RUCA 1RK8A 3HSDA 3C6UB 1Q8LA 2J7KA 1HNZF 1JXVA 4MK8A 2N7CA 3W9HA 4PWDB 1WG4A 1BD6A 3CJ4A 4PG5A 4K4TA 3DRRB 2D74B 2FVCA 1O8BA 3OFHA 4DPWA 5CD4H 2R8HA 4KB7A 1S48A 4KGXB 1L3TA 4X64F 3UQSA 2ZHOA 3T1YF 5E5NA 2DH8A 1VC5A 4QYZK 5KFSA 3GFYA 2UXDJ 1M5PC 1Q5YA 2PDAA 2JDJA 3PW4A 2BXJA 1UVJA 3BQ1A 1HPZB 3PW2A 9ATCB 3D54A 4OL8A 4RW7B 1DZ5A 1LWCA 2ZM6J 1YJ7A 1TQLA 2CJQA 3I0RB 3KLEA 2ZE2A 1IM6A 1FNOA 4HKQA 2OAUA 2B7BB 3P4UB 2YKAA 3CC2S 4DV0J 1ZZNA 2V69A 5C24B 1HNVA 5IOLA 2GIQA 4OZLA 2ZJRQ 4CLWA 3NGSA 3GE9A 2VOOA 1I1GA 5HK4A 3FSXA 1KTVA 5AXMA 1GX5A 1SC3B 3AA8A 5KG5A 4B17A 1HNXF 5L1LA 4YHHJ 2WBRA 3CDAA 3MEDA 2QT7A 3CCWA 1NZAA 2YTCA 2EI5A 2DCLA 2QTWA 1XWLA 3OHAA 2OH2A 3FMBA 2R3VA 4EBEA 1MN7A 3AQOA 2IVYA 2IM3A 3IR7B 2M5YA 4URSA 3PW0A 1S1WA 3THPA 1NRKA 1CG2A 2VV5A 2XYPB 2LU2A 4FF4A 3OL8A 3NKYA 4A8OA 4JI1J 1R3NA 1RDRA 2IBKA 2RMLA 4QPTA 4CH7A 2FQQB 2AX0A 1RKJA 1RTJA 1F2GA 4ES3A 3P45B 5CZXA 4IG3A 4WXOA 4K7QA 5SUHA 5DO2A 4F26A 4EUVA 4OX9F 2V4QA 2OHDA 3L9ZA 3MXHP 3W2VB 3D6MB 1RXOB 4BWJA 3IGNA 1UPPA 5FD1A 5K20B 2HQDA 4IUFA 1C4AA 2R42A 2ACYA 4KFBB 2HW3A 4DS5A 3ENAA 1EKSA 1LXNA 2XCPA 8ATCB 4ELUA 1M5HA 4IR9A 2QYGA 1JXEA 3MR2A 1VI7A 1UZHA 4A8QA 4B3OB 1FKAF 4JI8F 4LR9A 5JVHQ 1NJIT 1WKLA 1PILA 1YJWS 2OPQA 2CUYA 3IGVA 4L72B 5LMNF 1TKTA 3UNYA 4AL5A 2DYAA 2Z56B 4TN2A 1VJWA 3QT6A 1S97A 1V3RA 4M5DA 2GS8A 2ZH8A 2CVIA 5HMYA 3HD1A 4HI2A 4X4OA 2LQ9A 1N0UA 5HJXA 2RH3A 1HNIB 3TUIC 3HHKA 1TKXA 1U6ZA 4F2RA 3T5HA 1FI4A 3Q24A 1S77D 4G1IA 2J7WA 1SB6A 2MKKA 4JB8B 5IQ6A 4HH1A 3KWMA 4CTAB 2UXBJ 2VG5A 2CXEA 2WSCC 1AB8A 2DD8S 1OJ4A 2ZVIA 2XBPA 3DLEB 4ZVGA 2ZFHA 2E44A 1Q95G 4O3OA 1F9HA 2HFSA 2JSXA 3UN2A 4N56A 1TAQA 1GXUA 3G96A 3BSCA 3PIPQ 2W8KA 2UUBF 2Y1RI 4ZP8A 5DLGA 4YQWA 5DDPC 3P5BP 5THWA 2H5EA 5D6GA 4C8KA 2VA2A 1O6XA 3LGMA 4OHXA 3D9BA 5LXRA 3G8QA 3I87A 3MTJA 1F2HA 2IVFB 2UUTA 3CJ2A 3EMTA 3OW2R 1VQSA 3AOCA 1LW2B 3V4IA 2FJDB 1JLGA 2CJYB 4DCJB 1R89A 1IQTA 1IUJA 3DM2A 1N5YA 1WKKA 2U2FA 5B7WA 5K8NA 1S0VA 2KG1A 2Y1LB 5KG6A 3FFIB 2G9OA 3J7ZT 1AYEA 3FVYA 1B99A 4C48A 4AFFA 5F8HA 3MAQA 4RUAA 3KMQA 4OHWA 1HR0F 5KT5A 1WHXA 1H38A 5J1NA 1UCNA 3FDSA 4Y28C 4NZ6A 3D0HE 4P2SA 5IT4A 2CJKA 2GMLA 2KJVA 1TELA 2CNNB 3RU0A 1N54B 1Y3KA 4I69A 1RT6B 1HFEL 4DZ6A 1SJ3P 4HT7A 2G0CA 4YUDA 5D3GA 3UR0A 3EXCX 5F3TA 3T41A 2EFGA 2MLYA 2WB1D 2A2DA 1Q1KA 1PKUA 4CM2A 1R7IA 4O4RA 3LF0A 3OHBA 4NYOA 5B08A 3PX4A 4ZN1A 1SIWB 4J9QA 2FHKA 3QGPA 4ILLA 3ZNUA 4H4OA 4FZVA 4YDXA 5HANA 1S9FA 1KVKA 3K7RA 1JLAB 4GVBA 3C2PA 1YWXA 5CXTA 1SUQA 1T02A 2MQLA 3MM9B 2VB6A 1F3VA 4K5SA 2HWIA 4NYPA 2OTLS 3CCQS 5A2QU 4R0EA 2UUAJ 4DFPA 2VICA 1GMWD 2XWXA 2EK6A 4AT1B 2F5GA 1CPZA 1P1TA 1TL4A 3DRSA 2GCFA 4HTJA 3H5YA 1H0HB 4DR6F 1QM9A 3BBBA 3T9NA 1TAUA 4X66J 2RD5C 2DGWA 1IR0A 3W63A 4LF4J 5CABA 1CVJA 3P5TL 1R0BG 2ADCA 3MM6B 1JLCA 1ZPWX 5KOXA 4B3TJ 2IHR1 1B3TA 1E6VB 5KT2A 2JLFA 2EG1A 2ZJPQ 3G6VA 2JFDA 1VIXA 4KTQA 2GGPA 1NSKL 5L38A 4NLGA 1BQNB 3SYZA 4DN9A 4NYZA 1VRUB 1CJVB 2Y3YA 3D66A 1KN6A 4ZVEA 1RHRB 4MTPA 3EVWA 1N0VC 1JXLA 1FNMA 4ID8A 5A8WB 1N32F 1CC8A 1C1CB 5H1SV 2V8DA 3W8PA 2XY6A 3LP1A 3N9UC 3Q8SB 2YX7A 3GMGA 2RRNA 1R43A 1TU0B 1WUUA 1S6PA 2E1PA 3S6EA 2OKQA 4JV5J 3FEZA 1WNEA 3MUMP 4DX5A 1WEYA 2AJ2A 1IBCB 4I2QA 1U1RA 1O5JA 2JEJA 1BQMB 1RAJA 1QE1A 3VZHA 1JLEA 3DLKB 2VJVA 3RW7A 1N56A 2D9OA 2V2KA 4NX9A 1H6KX 2LMIA 4X4QA 4MK9A 1UA1A 3R1LA 1U47A 1RAAB 1ZETA 1GNKA 3CCUS 2ERRA 2ZZTA 3NAIA 2GQ2A 2LEPA 3RB4A 5H9FK 1HWJA 1GMWA 4X4RA 3L3CA 1FD2A 4WP9A 4WJBA 2W7OA 3GJQB 2C3UA 3TW0A 2ABYA 2NSBA 4ECRA 4P52A 2CQIA 1PCAA 1G2EA 5IC4B 2X3GA 4I6WA 4BDPA 2UV8G 2C3PA 1D9DA 2CAJA 1XMQJ 1U0SA 4B9LA 5K9FA 4LF9F 1N6QA 4PRFA 1KFSA 2HQFA 3IAM9 5LMUJ 1M5SA 2J8SA 1X4BA 1K47A 3M7VA 1N33F 3HVAA 2MKCA 4NEZA 3B78A 1VBKA 2M7SA 4LF7F 4KIAA 1GT8A 1EKRA 2UZAA 5GVQA 5RUBA 1VHFA 4LRFA 1VQ6S 3MUVP 4UF4A 3IR6B 1IWGA 2POKA 1JJCB 2B9EA 4YB1P 3KJVA 4IQXA 2IY5B 1FTCA 1S6QB 1HWLA 5KFYA 5A2QY 4DR1F 1NPPA 4EYIB 3Q8RB 3Q8QB 1QSYA 1SV5B 2BE2B 1XBWA 4RL1A 2MZTA 3VCDA 2MXYA 2DHGA 2CQPA 4KHPJ 3H98A 5HAOA 4WP3A 4ZPDA 5AJ3F 2DEIA 2M2BA 5D8HB 5IFMA 2F4VF 1R27B 2HAIA 1RJJA 1FK9A 3PX0A 2R2SA 4OHYA 5ITHA 3HJFA 3VWSA 4LF5J 3KJNB 1S1UA 2JEGA 1VFJA 1NJZA 3TYTA 1LFPA 3MHYA 4PYAA 1QLNA 1IBMJ 1Y10A 3W3SA 5HBMB 3C15A 4QR1A 3UCUP 1UA0A 2PSZA 1M1GA 3OXFA 3HFKA 4K4VA 2R7TA 2NXNA 3NGRA 5F8JA 4CIOA 4IKAA 4ZVOB 4OLPA 1OPZA 6FDRA 4WZQA 3DGPA 1W2BR 5ETVA 4LFCF 2KHCA 2JVRA 3IBFB 1UVLA 1NB7A 5M2RA 4NA1A 4X4TA 3RRGA 1LWCB 1NU4A 1JWWA 1P8GA 2C3YA 1K0VA 4PZVA 3D28A 4ANEA 1U4BA 3AOAA 3KLEB 3ENQA 2ZE2B 1LK5A 2DR5A 1QJHA 3OQ2A 1MMLA 2LLZA 3IXQA 5KG2A 3Q0AA 2DT9A 1HNVB 3IM9A 2YQ1A 2B4VA 4ZPBA 1R0CB 3OUYA 3KLHB 4ECZA 2N7YA 2I9SA 3KNGA 3ISND 3BGUA 2WVBA 2HHWA 5D4NA 2VFVA 2HIYA 3QRRA 1BMQB 2XM3A 3MEDB 2BM0A 1TKZA 3JQKA 2GX8A 4FF2A 2XLKA 3P96A 5I3QA 3EDRB 4CLKA 2XB2D 2V2VA 3IA0A 2DNYA 3QJJA 2QA4G 4OYIA 3PEHA 2G1HA 1S1WB 2MZSA 1HKAA 3R5GA 4GRSA 1PC4A 3AODA 2HNZA 3ZC4A 2FLLA 3DFEA 3OR2A 2V0NA 5DS7A 5KFUA 2CJAA 2W2NP 1F9EB 4J9KA 3DDKA 5D15A 1R8AA 3KHLA 4N8OA 1Q5VA 3N6NA 3C46A 1YDLA 5KFMA 2CQCA 4PG7A 1RTJB 3SCKE 3WX4A 4IG3B 2J6UA 2VBWA 4ZDNA 5CHCB 4LIWA 2LEAA 4TU9A 4OYPA 2HLUA 2QSFA 4LR8A 1Q79A 3FRYA 2M8DB 2EBGA 2I8EA 2ILYA 2OP5A 1LWEA 4DV3J 1LOUA 4ZA1A 3RBDA 2Y1IA 2YKNA 3BH6B 4MIAA 2J0XA 2VQFJ 2D9PA 4DUYJ 1XJWB 3G9CA 2HEKA 7AT1B 3MMBB 3MCMA 2JRSA 4L3KA 5KFNA 2BZ2A 2A18A 5CCMA 2WCXA 4F0HA 1YBAA 1HWIA 4ED1A 5F8IA 4A46A 3H2VE 1HI1A 3WIUA 2V9KA 3OTCA 2ZUGA 4DL6A 1FE4A 1TZ0A 3OVAA 3FEXB 5DETA 4PQAA 1PYSB 3QQCD 2J0SD 3ZFVA 1Y4ZB 2EKYA 3FBEA 4PXDA 5D0GA 4QBUA 1TKTB 5IXUA 3CJTA 1VQ8S 1JB0C 1IM4A 2PFFB 4M5DB 5EWEA 2PGCA 4C9DA 3MMAA 1J5EF 2F8MA 2CJBA 2CG4A 2D69A 4JI0J 4RU9A 1DHMA 1JJ4A 3TZXA 3TWZA 9RUBA 2ZKUA 2G2OA 2HNDA 2UVUA 2JVOA 1RTIB 3FQKA 3MWBA 5F41A 3LH2S 4GC6A 4ECYA 2ZUAA 2DISA 4C0HA 1ITPA 2DGVA 2VDIA 2RT3A 2NXCA 3THTA 1D3WA 2R8GA 3D7SB 1YHQS 1K9MT 5KFQA 3W9IA 3PX6A 3BKTA 4OZ5A 4OV6A 2UUCF 2FDNA 1T0TV 4ZHRA 2Z2YB 4UTGA 1TMMA 1HMVA 4P7VA 3U27A 3W2WA 1FRJA 4OHZA 1NK6A 4PXCA 3H8YA 2N4DA 1WHWA 3V4IB 1JLGB 2CKWA 2GQQA 2BW7A 1U2FA 3GIMA 4FKYA 1N5YB 4HDGA 8RUCA 4AQYJ 4PAAA 2RU3A 3IS9A 3TQ1A 3IBCB 3MDFA 3Q86A 4HLBA 3SCJE 3E8OA 4X4VA 2UV8A 3ILJA 1TP7A 5LJ5Y 1XNRF 3BDPA 4RNNA 4ES2A 4L76A 3DHWC 2GZOA 2VZ9A 5E33A 4EO8A 2XS5A 2MY7A 3D6HB 3VAFA 3KOAA 2QLJB 2BA9A 4B08A 1PJ5A 5GMKa 2C1EB 2ZH5A 3TA0A 4M94A 3DNCA 4WIIA 1IR2A 2H4YB 2BRKA 5D3GB 4CZCA 2CQ3A 3DDNA 1VQKS 1NXIA 3BDEA 1WEZA 5EX0A 4ZITA 2KT5A 3IMQJ 4UOGA 3NNAA 4EBDA 1DJ0A 2FZKB 1TMJA 1U8WA 2F4FA 3I82A 4KKOA 4F3QA 4OLOA 3I5BA 3THVA 2EVZA 2R7RA 4H4OB 3NMRA 2EFOA 4ZJLA 1ZAVA 4X4NA 4YR2A 3QFHA 3BZQA 3K8VA 4GVBB 1O0PA 5G4DA 1U2RA 2DBBA 1MMDA 3S7RA 4C97A 3JAMU 1SUQB 1DTTB 2VKRA 4GKKF 2IRYA 3H20A 4F8RA 3T6JA 4DR2F 2M8HA 4IRDA 1FRXA 4RW6A 4EBCA 4I1TA 3DKDA 5B0AA 3DRPA 3UN5A 3DRSB 2LEBA 1KQSR 3OR1A 4NA2A 1SC6A 2IA0A 6FD1A 5KFCA 4WWSA 2CQDA 2DNNA 3VZIA 1SJRA 3G4SS 1OPIA 4BHQA 2E5LF 4DV7J 1ZBTA 1EX8A 2GO9A 2MQ8A 3MEKA 4ECSA 2MKJA 3G6XA 1DARA 1JLCB 5HL7Q 4WXWA 1OWXA 1HQUA 3IR5B 2AZ1A 4EYHB 2BM1A 2HSEB 2JOQA 5B09A 4DV5F 2D41A 3MMJA 4WFBQ 4DR3J 4JI5J 1FRMA 1WC0A 3VAKA 1S10A 2NS1B 4IO1A 4BLGA 2BX6A 2CNLB 4USJC 4IOBA 4QYRA 3GIIA 2KXHA 2XGPA 4IG0A 2KM8B 4WTOB 1X0FA 2UXCJ 1L5UA 4HR2A 4LIRA 2R8KA 5EDWA 3LP1B 3POTA 2YPZA 4DL2A 5C2GA 3BREA 2J7UA 1XTZA 2MLXA 4LBPA 4A8KA 3T1HF 1LXJA 1RWKB 2OD4A 3TA2A 4I2QB 4KBIA 5KFPA 2CPFA 1HNWF 1QE1B 1JLEB 4I0WA 3CD6S 5C5JA 2VFRA 5ETRA 2ROPA 2ZITA 4NLWA 4V19J 4JI6F 4IRKA 5L1JA 1Q0NA 5ETLA 3C3LA 1SKWA 4MFBA 1H3DA 2VC0A 3KHRA 3H4DA 2DITA 2RUSA 3D0IE 4U8YA 2E5JA 2ZHBA 5T14A 1RTHB 4MKAA 2RS8A 3M4XA 4DF8A 1H98A 1UJ6A 3T3FA 4ED5A 3ISZA 3PFEA 2MQPA 2XC9A 1EZZB 3WHIA 3RGIA 3OD2A 4TU8A 2C2MB 4H4KC 2HHVA 2MGZB 2Z2ZA 2DIVA 2NZCA 2WVCA 1S9EA 1YZ6A 4QYZJ 1HNZJ 3CJ8A 3R7SB 4DCPB 2I1RA 4F0KA 3AY0A 1FE0A 1N6QB 2B6AA 1YZ7A 3ZZZA 2WVFA 1VHIA 3ONQA 1DQ8A 2EWHA 2AU0A 1S0OA 1WC6A 5IV4A 2XS2A 1OMSA 2HBZB 1X9SA 4IFVA 2JEIA 4TY8A 4KPCA 1FRIA 5HVHA 1RTDA 1S76D 3I56S 2B8QA 3KG0A 4ANDA 1T9TA 4DPXA 1SJ1A 1RT3A 1U8SA 3MMCA 4ECVA 2AJQA 4ECWA 4DPOA 1MSWD 1GH8A 6AT1B 3GCXP 3NS6A 5KFWA 4NCGA 2O67A 4ZVQB 4Y0FA 1WJ9A 5HROA 2RJZA 3D1HA 3ULHA 4FN5A 4I6AA 2KRRA 2ZOFA 1SL1A 2DGUA 1NK9A 5J2MA 4OX8A 3OTOF 2QA4S 3ZZUA 2RF2A 2VOPA 4B3SF 1X5SA 4NRUA 1MMNA 1N88A 1UWBB 1MLAA 4ERDA 1S4FA 2RSQA 3I9ZA 1KEKA 3D3BJ 2ZHAA 3ICLA 2C2OB 1VYAA 3LO3A 2A0FB 1ZOTA 2K1RA 4KGZB 4UW2A 4DV2F 1V3ZA 1S1UB 3H5UA 4ZVFA 1RUSA 3HXMA 3V6DB 5IZHA 2KT2A 5SZTA 3ZO7A 3EGVA 1L3VA 4JI3F 3C15B 3UDCA 3PTWA 3K58A 1IBKF 2PN6A 2NREA 3BYPA 4DL5A 2HAFA 2XY5A 2MMYA 3R9LA 2FC8A 4PR6A 1OYEA 3Q23A 3PV8A 2IA6A 2X1GA 1TL7A 5D77A 3DGPB 3DHXA 3Q8VA 3M8ZA 2KFYA 2M88A 4DL0C 4NXMF 3ETMA 1U49A 3R3TA 2F65A 4WBFA 3S1TA 5CYQA 2UVWA 4FBTA 1RBOB 1PBAA 4CNYA 2GNKA 4ID5B 2HFOA 2Y8YA 3C6TA 1U45A 4F04B 2OEJA 4B02A 2HHTA 1S57A 8AT1B 1YTYA 3MAHA 1HARA 3R5CA 3NCPA 2IJRA 1UVIA 3R5JB 5LSOA 3ZTPA 1T9XA 5KFTA 1W2IA 4KY3A 4EGLA 1FNXH 1UJ5A 2WAQD 2VFTA 3GILA 2JFKA 1Q86T 2YPYA 1VQOS 4A48A 4JV2A 7FDRA 1ZH5A 3D67A 3QAUA 2BOPA 3ILLA 2BV3A 3UWTA 4ZIWA 3ILIA 4QPXA 4LF8J 3MECB 1TKZB 3TR5A 3DLGA 4IOCQ 1F0XA 1UW4A 4JI8J 1UKUA 1CS4A 4E0DA 1YI2S 4NOHA 2GVZA 3R5BA 3ZZOA 3KUGA 1FA0A 4NLYA 5J1EA 3KDOA 2HNZB 1CC7A 4Y2AA 2VBYA 3OSPA 2HQIA 2QRRA 3OR2B 1EAYC 4D3HA 2KU7A 4DL3A 2D3OR 4CM0A 1FWLA 1NHVA 2Y8WA 1ZAWA 2KL8A 1RI7A 4DSFA 4B3RF 2X3DA 2ZC4A 2CADA 1T03A 3EM1A 3DMJB 3FBCA 4PG8A 4DV6F 3HO1A 1FRHA 3RZAA 1R6VA 4WK1A 4AL7A 3KTQA 4USKA 1J2VA 4BC7A 3HI9A 1IBLF 1TKDA 4LSNA 2MY8A 2LQJA 5CH7B 2QLWA 3LWLA 5HMZA 3W7BA 1YRUA 1VLYA 4A8YA 3EPGA 4K5RA 3RTVA 2UP1A 3QT5A 1HHSA 4L75A 4IRCA 4J90A 2Y0BB 1XMBA 3LA0A 5BR8J 2UUBJ 3KLFB 4YP3A 2RDJA 2FVRA 2ZKTA 2WW4A 2JH3A 1G1XA 1FDAA 2DY1A 2QMXA 5DG9A 4B3MJ 3GQCA 1WC1A 2YY3A 1F60B 5MLCV 2NXUA 4V1Ak 4JI7F 4DX6A 5FDLB 5J1PA 4K4UA 3NNCA 1WSVA 3TUPA 3MFIA 2OIHA 1Y00A 1UJ4A 2J5AA 1KKHA 4P9SA 5IM0A 1H2UX 4JP8A 4NA3A 3D6TB 3PO4A 5KFKA 1VRTB 4CQ1A 1WSRA 4ZLNA 3PYGA 1N34F 1YJVA 4NXNJ 2FC9A 4KT0C 4YB7A 3MMAB 1NM2A 1OY6A 2HWHA 2VPXB 3GLJA 1M90T 2EFNA 3ZTOA 2XZDB 1HR0J 4OYZA 2B9YA 2FTRA 3VAHA 2WB4A 4IDKA 2NPFA 3A3PB 4LFBJ 5BYSA 5M2PA 4Z7YA 3NGTA 2VFUA 2L9WA 3OV7A 1XNQF 1KVIA 1ZM2A 2VG6A 1FTRA 4ECQA 2WVEA 2PI5A 4U96A 4CYUA 5B0BA 1X4HA 5EHHA 3J7AN 2YNIA 1R6YA 4NLUA 2W2PP 3W5ZA 5ETKA 2QSWA 1SBRA 3MI7X 2Q1LA 2ZBPA 3M8QB 2H65B 4URQU 2Z57B 3EZOA 4PXBA 2OMOA 1I94J 3JSBA 1Y5IB 4ZHRB 2HRUA 5KG1A 1H72C 1OYDA 2XTJP 1HMVB 1V6HA 5IT0A 1IKVA 1U25A 1Z2LA 4F7VA 3U1LA 1HQ2A 2FIUA 1F9FA 1CBKA 2ASLA 2BMBA 5DDRC 3SIPB 3WQPA 1S99A 3QAEA 3IS9B 3TAQA 5GAEU 2HGMA 1N5QA 2HBQB 1A9NB 3K5NA 4CP5A 5HVFA 3ELHA 2EW9A 4NCAA 4M5JA 1ZM3A 2CIMA 5E3RA 4DV1J 2IIHA 3H2UB 3UI3A 2J0QD 5C25A 1F5AA 3FBFA 3OSNA 3W62A 1P1LA 4F4ZA 4AYBD 2I2YA 1UTAA 1M1KT 2GVDA 1T94A 1WOPA 3QZ8A 1YVFA 4WYWA 3D68A 1FF2A 3AT1B 5G0RA 1CJKA 4ZPTR 1T7PA 3MPUB 2XULA 2CG8A 4LRAA 5L9XA 4FP9A 3NS5A 4IH5A 2C2RA 3VVTA 1VBXA 2EBEA 3VALA 5A8KA 2UXDF 4KKOB 1KOHA 3V5RA 3EGWB 2FHMA 1JNRB 5KFVA 2ZWOA 2W24A 2J9EA 2MEWA 4I7FA 5EWGA 2OEMA 1U7LA 4P2FA 4RW4A 2HS4A 2KHDA 2ZM6F 3VAGA 1HIYA 1BC6A 3HHLD 4QIVA 3BGFA 2XO7A 2L08A 5FLXU 1RHMB 4OYOA 4J7CA 3A4TA 1X60A 1XMOJ 1V5IB 5H9FJ 1MNEA 3SQGB 2VG7A 1HYSB 3JSRA 2B9XA 4P75A 4MKYA 2F9DA 4YS2A 1KC8T 2WZ1A 3CO0P 2DR9A 3HFZB 3HSZA 3DRPB 1NK8A 1QAJA 2DO4A 5DM6Q 3KDNA 3OR1B 3W65A 3MTKA 1PYTA 2G0JA 2CQHA 4CWBA 3O3LA 2CPIA 4DXLA 3OFGA 3MOJB 1K44A 4N7TA 4O3SA 4YHHF 5B0GA 2R7UA 1RAHB 2VONA 3MZIA 3R2CJ 1HQUB 3HMJG 1URRA 4DF4A 4R8UB 4DUTA 5BYRA 3G8TA 4X62J 3PXGa 3CJ5A 5DQGA 2DXFA 1YRTA 3ITHA 2P9CA 1TVRA 4WE1A 3CC4S 4JI1F 2CRLA 1TTHB 3B6BA 3ENVA 2UUWA 3O6QA 2Z2MA 1N8RT 4IG0B 1N33J 1N5VA 2FVPA 3ZNJ1 2DNLA 5M2UA 3QGHA 2GJIA 4TNOA 2M9KA 3FMWA 1IKXA 3CT9A 2VASA 3POTB 2EFVA 1KFDA 4WYLA 3O1LA 3WIVA 2YX1A 3V81A 5GAEI 1HLWA 2B4UA 1Z1ZA 3LUYA 1U09A 3NRBA 5E7OB 2HKEA 1FDNA 3AQPA 2EC2A 4BC9A 5L9NA 3VF0B 2JEFA 2G0IA 5HQLA 4MAKA 3HFVA 4DR1J 1J5OA 2KI2A 4TU7A 4U7UK 2IDEA 4TLQA 4B9UA 2YBVA 5FIIA 4QWBA 2XZTB 4MFBB 3CJ3A 4ZVSB 4WF9Q 5KAKA 1I6JA 2B5JA 3H40A 4Q7AA 3K89A 4U6PA 5J2PA 1TL5A 2G4BA 4LFAJ 2QA1A 2W9CA 2WOMA 2LQ8A 3NWGA 1S1TB 5GMDA 1BGXT 4C8MA 3ZTQA 5DG7A 5KTQA 3ET6A 4Y2KA 2V50A 4ED7A 1HBNB 4NPOA 5KG0A 5D0EA 1GX6A 4F50A 3IAS9 3TO8A 5DQHA 4A8MP 2OLWA 1WF0A 2LXIA 2B6AB 4IH6A 4DEZA 1ZPVA 3QGGA 4J9MA 1XQIA 3TRGA 3G2XA 4J9RA 2BE9B 1LWXA 1WC5A 4WIQA 4IFVB 4FXVA 4TY8B 1C1BA 1FO1A 5K14B 2C3MA 2V67A 3CCTA 3FSIA 3OJSA 2AYMA 1VQ4S 2G1DA 5FLXY 2IPOB 1RT3B 5JUMA 2CQ4A 2FHJD 3MMCB 3BQ0A 2ZNYA 3LP0A 3RBZA 1N4LA 3LPYA 3PACA 4H4MB 3W61A 1SKRA 4P73A 4UZCA 3P6YC 2HRTA 3HZGA 3SMZA 5HROB 4ECXA 1C0UB 1RBAA 2WHOA 3FBBA 1VQ9S 2MB0B 2FVSA 2HZVA 2XSJA 3DOKB 2EG2A 2IBOA 1V3SA 3TQEA 1TK8A 2ZZMA 3AH6A 2RF2B 3OXGA 3EGNA 2NR0A 4CLPA 2RUGA 2KRBA 2K1RB 1TL3A 1RT7A 1SI9A 4EI2A 2ZBCA 2VD3A 3M32B 5B0FA 2XNRA 1C0TA 3TOQA 3NGDA 3CDUA 1SXLA 3OL6A 2E1AA 1NEEA 4LQ3A 4DFKA 1B64A 1GTHA 1EARA 4DX8H 3OVBA 3I9V9 1RA6A 1ULRA 3DLJA 2AHOB 4FF1A 1AUSL 3K8WA 1ZAXA 4KV8A 3GG1A 5MAOA 4J9PA 3NGUA 4MIWA 2MKHA 1GK8A 1TV6A 4WFZA 2Z4PA 1TL7B 4F25A 3M6VA 3LAMA 1DLOA 2LCWA 5GAHU 3IM8A 3R97A 2HHHF 2BKPA 3OFEA 1WD6A 1YIJS 2C22A 1I5OB 4ZK7M 3BSNA 1UVNA 3BBFA 4UT4A 3H59A 4C3MA 4RX6A 4I2PA 1TK5A 1WI8A 1NHUA 3C6TB 4U9RA 3UO0A 2MSSA 4OI3A 2DNHA 2CJXB 1Z4UA 4R5PA 3M8SA 3M2UA 3RAMA 2ALZA 2OPSA 1EETB 2V2ZA 2XMWA 1MU2A 4LSLA 2DPIA 2ZEJA 4NWBA 3TAPA 1YBUA 1U1PA 5D4OA 2V34A 1VS3A 2B7CB 4UOFA 1JLQA 1VQLS 3EZUA 1BUXA 1I51B 2BJ9A 2FJXA 1M5VC 4AXJA 1YJUA 2FJBB 3GU0A 3DLGB 3EUNA 2AGQA 1FVSA 4IFYA 3OJUA 1CS4B 2F1FA 2L48A 1CQMA 3QPIA 3IO1A 3PCOB 4GO5X 2P6SA 5J1EB 2UUAF 3LGNA 3PHEA 2L41A 2BR0A 1NJYA 3B54A 2HS3A 3BV8A 1WC3A 4N47A 2HGLA 5IS2A 3MCOA 3MF5A 1RT5A 1X7VA 4N41A 3I4HX 5ETMA 4X66F 1RA7A 1T03B 1QVGR 3FJ2A 5EGYA 4LF4F 4OV1A 3SV3A 5AE1A 2HHXA 4DG1A 5CCLA 4B3TF 2DR6A 5J2QA 2CDQA 2DNZA 4ICLA 4LSNB 2ZH9A 2YNHB 3ZTRA 2BJEA 3VQSA 1SPBP 3NOGA 1Y5LB 5ETPA 3JYTA 2HMIA 1OY8A 4FYYB 3G82A 2VF3A 5HLFA 2RQCA 2K8GA 3CD7A 4ZJOA 2EC0A 2XYGB 1FDBA 3U02A 3HD2A 3CGIA 1B7FA 4JV5F 2HFVA 5E41A 4XPEA 2UUCJ 3DI6A 3PRDA 2FGOA 2IAJA 2RKIA 5GAHI 4NZ7A 2AKWB 3TJAA 4K4SA 1X9WA 5KFIA 2MPUA 5F8MA 3OBIA 2NCKL 3T19A 5A0YA 3M1VA 3GV5B 2B43A 2RQKA 1M5KC 2JLGA 1UPMB 1NBEB 2KYZA 1CEZA 4LRBA 2AJFE 1VISA 5B0CA 3E3XA 3QZ7A 1WTFA 1HBOA 3PYEA 2R2UA 3CXCR 4ZPCA 4OHVA 1UVKA 4K8RA 4P2MA 4OI2A 1QAYA 4P10A 2AZ3A 3RG6A 2I5JA 3IWLA 4IDKB 4LVOP 2E9RX 1E6YA 1FXRA 3CB4A 3C6UA 3Q8YA 1XMQF 3EZ5A 2R7WA 3U1NA 3KLGA 1F1BB 1WF2A 2QL7B 5B0EA 4JUZA 3GP9A 4USMA 1B0PA 4W98A 1FD8A 1B7YB 1RWVB 4V19X 2BKOA 1URNA 2FJWA 3PJXA 3G71S 5LMUF 3R7BB 1NKBA 2B9WA 1F3FA 4A8FA 1RHKB 4QU6A 2YNIB 1SJQA 1FJEB 1T3OA 2OMLA 3W60A 3CCRS 4Y00A 3HSJA 3M05A 5E3PA 2KB2A 3TI0A 2KXNB 3GYXB 3NCRA 3CDWA 3HHLC 4ZMMA 4F02A 1F5CA 1OS5A 5AT1B 4DSLA 1HPZA 4LQ9A 3OLBA 2AJ1A 2X1FA 4RUHA 3L4BC 4L6V3 5DDQC 1UFWA 2G13A 5DJBA 4GO7X 3FC9A 1JNZB 2RAQA 4RW7A 4ZS6A 4HTIA 2XI3A 1IKVB 4FVCA 1IKYA 2NXEA 4HDHA 5DQIA 1M0SA 1Y11A 2FY8A 2OEKA 3R1HA 3Q2SC 2JNJA 1NJXA 1K8AT 4DR2J 5C24A 4KHPF 3I5AA 3R5DA 3BGOP 1QSLA 1D8YA 3GIRA 2DNRA 2QFIA 1Q53A 3H4BA 1FVQA 2W01A 3SI8A 2EPIA 2B51A 2R4FA 3SDEA 1CLFA 3JSYA 3TEHB 5C25B 4FNIA 4LF5F 3BGLA 2F40A 3GWCA 5GADU 3QT7A 5HP1A 3RW6A 1IBMF 4DMZA 5G0RB 2QLFB 1CJKB 5KT6A 2BJ7A 1LKZA 2M4MA 4XIUA 1JLBA 2H48B 3BM7A 3AD8C 5F8GA 3AJ1A 4UY85 2AIRB 3M2RA 5A8KB 4P7TA 3O44A 3OPKA 1NK0A 2XMUA 3S01A 4ZLPA 1F5BA 3A3NB 4I7FB 2NUHA 2ZH1A 3HVWA 4RW4B 4KRWA 1FFSB 2CZ4A 2Y1JA 2V63A 1X4EA 4YN3B 1VMBA 3A8IA 1X9MA 3UD3P 3QFWA 3T1HJ 4MMOA 3M8RA 3W2VA 2VIHA 4PWWA 1M5OC 2QL9B 2VG7B 1AXQA 2VPZB 5U47A 1ICEB 2AEMA 2MKSA 2W25A 3JS9A 2GIRA 4DPUA 4QWDA 5E3AA 1SJ4P 3TZZA 4JYAJ 4WCEQ 5DDOC 1NJWA 1RZMA 4BS2A 4K0KJ 2PFDA 4B3OA 2DNQA 3PIOQ 4RZRA 2G2ZA 3CCZA 2JJ4D 2WW8A 1N5SA 3ZZ0A 3PJWA 4Y2MA 4P6QA 4BWMA 4ED6A 1RWNB 2BEFA 2OUGA 4NI2A 3A3OB 2GHPA 2KH9A 3CSKA 2XHCA 5KFBA 3M9NB 3ITHB 1S6UA 4ELVA 3DU6A 2MQOA 1TVRB 3JSMA 4WE1B 2EFQA 3VGUA 3MD1A 2VQEJ 4RBVA 1R0AA 3BN7A 3E01B 1HWUA 4G1PA 2YNGA 3W9JA 4LF1A 1KLNA 1GMUA 4D3GA 4ED4A 3G6ES 4X84A 1BQXA 4PEOA 3J80U 2B4OA 3EYZA 2YWEA 4ZVRB 3CF5Q 4FYDA 1X8DA 3I5CA 1BWEA 1LWFA 1J5OB 2OJ3A 4ECTA 4TLRA 3C16A 3DOMA 2K3IA 3DLEA 3PY8A 4QQBA 5GADI 4RWWA 2YWFA 5KT4A 1C4CA 1PYOB 2B5JB 1FWKA 2VQFF 4DUYF 2DHHA 5J2PB 1T95A 3UCGA 2N4CA 4AE5A 1BWVA 1UW9A 2W9BA 4PUOA 2V68A 2W9CB 2ROEA 2WOMB 5D0RA 4K4WA 1W7WA 3CEDA 2I38A 1TL1A 5ETNA 4A8SA 5KG3A 3ET6B 2JWNA 3V6KA 2PE8A 2LXFA 2FUG9 2W7PA 4DU8A 3LW5C 4QJVA 3H90A 4RW8A 3EPIA 3RAQA 1KBRA 2AEJA 1LW2A 4UUWA 1VK3A 1X5OA 2DGQA 2HHSA 1FRLA 4JI3J 4TY9A 5IWAF 1Z2ZA 4LREA 2WBMA 4DQRA 2OSRA 4Y2CA 2E9ZA 3D1QA 2IM2A 1H7WA 1NB2A 3OVSA 3P3DA 4O23A 2FB0A 3M9MB 5KFFA 3BSAA 4GMKA 1C1BB 1IJEB 1NZ8A 3IWXA 3GV7B 4M63A 3R5AA 3DOLA 4DQIA 2HK2A 5KG4A 4C8NA 3LP0B 2XYHB 2RQ4A 4MYUA 3QIPA 2XHWA 4JI0F 4TQSA 2V5HG 1NSPA 3A13A 2GV1A 4W90B 1UMJA 3ADAC 2F8EX 2DTJA 4EZ6A 4DFJA 4LSZB 3IRWP 2D1CA 2IC3A 4MIBA 3K5PA 3N79A 1FRKA 2Q3PA 2K06A 3K0JA 3QO9A 3TUZC 5JXSA 5KOWA 4S0MA 1U26A 2BJ3A 2ADBA 3M6UA 3WX8A 4DSIA 4ALZA 3HHDA 1VJQA 3PR5B 3JQJA 1TL3B 4B9TA 4ECUA 3CUNA 2IRXA 2J6TA 2R7VA 1MG7A 1NLKL 1UFLA 1MWZA 1U02A 1R8BA 3H42A 1FJGJ 1H2TZ 2P8IA 3F41A 2XMKA 3CMQA 2O66A 4KV8B 4DR7J 2B0GA 1K73T 5BYQA 3EWGA 3DU5A 3G87A 2RNEA 3J80Y 1S49A 4J5OA 1W26A 3WC0A 3A1YG 1WORA 1U1MA 1DLOB 2C2KB 3I32A 1U2CA 1LW0A 2DB1A 2K7JA 4DV6J 2F7VA 2DPJA 1VC0A 1SIZA 2EFPA 3HVTB 4C8ZA 2XY7A 4I2PB 2YNFA 3C14A 2N3OA 4FYWB 1RCOB 3BPDA 4UZBA 4KHMA 2BJ1A 2OFHX 4CO0A 2E7XA 3AD9C 4R5PB 3TVYA 3M2UB 4TQRA 1SL0A 1VRUA 1MU2B 1YRXA 3HM9A 4LSLB 3RBXA 2R7SA 3LALA 3GR1A 2P9GA 4N8NA 4U67Q 5A8WA 3DRYA 4DQPA 1JLQB 1FDDA 5T7LA 3DYAA 4J9NA 1NK7A 1ACMB 3FUYA 4OJHA 2H1YA 3FRZA 4YEAA 3X3UA 1QUPA 2ZOGA 1S1VA 4RBUA 4K59A 4RNMA 3QIDA 3SCLE 4IFYB 4CT8A 1BQMA 2FYXA 3FNNA 4C7QA 1U1LA 2P6TA 1APSA 1YX2A 3UDLA 3VAIA 1T9VA 1T05A 4YR3A 2HVEA 2DO0A 3CJKA 2FGCA 2V4RA 1GFWB 2AEFA 5AXKA 2IDLA 2NSCA 1NDKA 4X4UA 3MURP 1RT5B 3G8SA 4DFMA 3CIMA 3U1MA 1ZM4A 4DV7F 5AXNA 2ZD1A 4DG1B 3TP2A 2ZBQA 5DM7Q 4ZKAA 1RQ0A 1FKPA 3VAMA 5J2QB 5GMEA 4OIXA 5I3UA 1ZTTA 4ED8A 3BEGB 4DR3F 4JI5F 3I96A 1Q7LB 2IVMA 1XNQJ 4DSEA 2YX4A 4ZVUB 4WFNQ 1NKEA 2AT1B 3JYTB 2HMIB 3G82B 3H2LA 5HLFB 2RDDA 1Q8KA 4OYMA 4AD6A 1KONA 1FERA 2CDRB 1RWUA 2AMCB 2HRYA 2UXCF 1RABB 2QZ8A 4K4ZA 3HF5A 3HPOA 3VR1A 5EUHA 2C28A 2GIFA 3M9OB 2R7OA 1BHNA 1K1QA 4HHUA 2R8IA 3BKUA 3TVZA 2DXEA 2IAJB 2RKIB 1V5VA 1S6QA 4EO6A 1NMEB 2D3O1 1OO0B 1SV5A 2J9DA 2GA7A 2BE2A 3KLIA 4CLYA 5A0YB 3LTOA 3M1VB 4DR5J 4H4KA 3T5KA 1RLDA 4J91A 4ZLLA 1NSQA 4PQUA 1NH7A 3UW1A 3CJQA 4M5LA 1WF1A 4XDDA 3H7HB 1HBOB 2ZBRA 2E9TA 1CQNA 2HBYB 3D1OA 3KHHA 3TNVA 2CWXA 3L7OA 5D0HA 2H5JB 4QWEA 3T6BA 4LUBA 2I5JB 1UL3A 2O01C 5KFXA 2MJUA 1KOOA 3EVOA 1E6YB 4R25A 4OYBA 4JI2J 2HQ3A 2HNYA 2JX2A 3KLGB 2XLJA 3K5LA 4H54A 3SFGA 2DIUA 1X0PA 4KQZA 2LFVA 3TJ8A 3MEEA 5HBMA 2XG8A 3ZZPA 4JV1A 5ETTA 4QOTA 1CSJA 4HVZA 3NG8A 1VGYA 1X4FA 1MW7A 3N28A 3BQ2A 2EXUA 3CD0A 5CQGA 3KUHA 3BBCA 3W8GA 4ATNA 5JVGQ 3NWRA 4X4SA 3ZZYA 1FKOA 1H73A 4LRDA 2HHQA 3NY0A 1PJ6A 4RUBA 3T5JA 3MR3A 1RGVA 2AJ0A 2QMUB 4C3LA 1IKYB 2HG4A 4AXIA 4C0OC 2OPQB 2NYHA 4RNOA 3AD7C 4RPFA 2LA4A 4WFAQ 4PABA 3TZYA 3KLHA 4C0BA 5DGBA 2R2TA 3HHEA 3LWMA 2Z0GA 2MQQA 4F3OA 3SDEB 2LQBA 1TKXB 3PZPA 3DC2A 2ZDPA 1SH0A 2XLIA 2VG5B 3VAJA 3DXBA 4NLXA 4ILRA 5HP1B 3RRKA 2FPHX 1DRZA 3TARA 5LXYA 3CDEA 1RHJB 2QN6B 1TUVA 1RWMB 4ZCLA 2MJNA 1JLBB 3OFFA 3IC1A 2OI2A 3QSYB 2UU9F 4PPZA 3VGSA 5C42A 2NXJA 4X65J 3M2RB 2RVJA 2N3LA 1DFDA 1JK9B 2LQ5A 4KYZA 3TANA 3QJLA 3GONA 5CD4A 4NMXA 4B9NA 2MTLA 4UY8T 4Y2IA 3PO5A 5HVGA 3UCZP 1XR5A 3DM2B 1JLFA 4CDIA 3D4JA 2VPWB 2M0GB 2V6AA 4Q8FA 4DLGA 2CPHA 3RB6A 4USUA 3ZZTA 1KHWA 2XI2A 3QBCA 2LA6A 1C2PA 3MMBA 1VQ7S 4NCBA 4WP8A 1YKWA 3JTNA 5F8NA 3OLAA 1WEXA 2VHGA 1NDCA 3QWUA 4ZPAA 1AA1B 4LF8F 2Z8QA 4OX7A 1S72S 4CO5A 4FYXB 5GAGU 4N77A 2BKNA 3K17A 3KFWX 4NI2B 2W2QP 3CDBA 1EP4A 3L09A 3NMAA 3O5TB 3JSMB 3CJSA 7FD1A 2P2CB 1OSCA 4ED3A 2ILZA 1QVFR 1BE4A 2QEXS 1R0AB 2CPXA 4DV4F 2MLZA 4KGVB 5HATA 2YNGB 1RE1B 5LL6d 4DPYA 3OTBA 1U6BA 1RHUB 3EICA 2XEXA 3TEGA 4FPRA 1BLUA 3V6HA 3JXOA 3NAHA 3W66A 1VQ5S 2DVIA 5K5MA 2ASDA 1HQEA 4LJMA 1XC9A 1YG0A 3FCVA 1NPRA 2MQMA 1ROFA 1LWFB 1JQGA 1KLMA 1YLXA 3V2UC 1RTIA 2BBEA 2DHAA 3C16B 4UOCA 1XN9A 5KFAA 3DOMB 3TZWA 3VGTA 5DGAA 5I4MA 4HHHA 3V4MA 2H5IB 3N5BA 4JI4J 1NPKA 2W9BB 4PUOB 3GR0A 2Q6BA 5BR8F 3ZZRA 3HKWA 4P71A 2YQ3A 1TL1B 5KFJA 5I3PA 2RIJA 4B3MF 3UD4P 4O3PA 2ASJA 3JTOA 1RP5A 3Q8PB 2CVEA 2F63A 1N5TA 2GGPB 1NO8A 4RW8B 3Q89A 5EWFA 3ZTSA 3QRQA 1K1SA 4M5GA 5KFDA 3BO2A 2NPIA 2CZVC 4ZCIA 3IRXA 3NGKA 4YY3J 1PBUA 4J9VA 3D2WA 1GAOA 3E2EA 2WSEC 3PYDA 4NXNF 1S4EA 1S6PB 3UFCX 3DOLB 1G4CA 2HFZA 3UPFA 2NQPA 4CT9A 2GFFA 1GTEA 2KVQE 2GW8A 2HHHJ 4QWCA 1WELA 2MZ1A 3QIPB 4YR0A 4LFBF 4TYAA 4WU3A 3EDQB 2XGQA 2FLNA 2A2CA 4Q45A 2ZOMA 3K5OA 1S5ZA 4RWXA 4NLVA 1Q82T 5LOQA 3KUEA 3UNGC 2IC3B 2R2RA 5GAGI 1PJ7A 3J81j 1MN9A 3VHQA 4DUZF 4KH1B 2DNOA 2W2OP 4C3KA 4EEYA 5BJRA 2GAHC 1PAUB 3CD5A 4QU7A 2E7WA 2HS0A 1S6OA 3QO9B 2M52A 2E1CA 4KH0B 1G7CB 1X4DA 3Q8UA 4KPYA 4PWUA 1BY9A 1CJUA 1B4SA 4FNHA 2FZCB 1KS2A 1I94F 2B8PA 1VCTA 3F73A 2HBRB 4LF6F 1JIHA 1IXKA 2IM1A 4OZ2A 2PT0A 4ED0A 4CLZA 1X31C 2OO4A 4Y3CA 2X51A 3PG9A 1KP6A 2XCAA 2Z58B 1DTTA 4MH8A 5E3CA 3KG1A 4ZOSA 2MDAA 5A8RA 3QMQA 4K4YA 1S0NA 3QJPA 4X64J 3T1YJ 2RS2A 1RTZA 2R7QA 3CIZA 5C7PA 4OYXA 4J37A 1D0EA 1VR6A 3JB9k 2K3KA 2E66A 3CCVS 2LDIA 4DV1F 2HZCA 4FXWA 1LW0B 4QWAA 3DDIA 1EJ7L 1HW9A 3GSDA 1YITS 2OD6A 3FGVA 3KJVB 3R2DJ 1NAQA 1L3KA 3H5SA 2DNMA 3HLUA 2WONA 2YNFB 3C14B 2AF6A 5DZ6A 1HI0P 2C42A 4GC7A 1JJ2R 1WDDA 1KD1T 4DS4A 3DRXA 1KNZA 3MR6A 3MPDA 4DLEA 1WHVA 5F3ZA 3BSOA 2X1AA 2PD1A 4HT5A 1FK9B 2A6MA 2DGOA 3FQLA 4NEYA 2IJNA 1I3OB 1RT2A 1FXDA 2UVVA 4ANCA 5IC6B 3JTPA 3R6GB 4FKXA 4NLQA 5CA5A 4LT6A 5T7LB 3DYAB 4LBHA 1PC5A 1HNXJ 3MR5A 2WK4A 1XR7A 4USWA 3GV8B 2BE7D 3HZEA 1KSPA 3F44A 1S1VB 4C8OA 2IM0A 1J27A 4QIFA 3NXZA 2O1PA 4ED2A 1XMOF 3VGVA 5H9EK 4DQQA 4P74A 4HL9A 4USIA 1UAWA 2VUGA 4YDDB 1JJHA 1RT4A 3TVKA 3R6LB 2VFSA 5AXLA 1T05B 2COLA 2GQCA 3K59A 3LP2A 1YGYA 1EQ0A 3EX7B 4YMEA 3CJKB 4WPAA 1UZDA 1RTHA 2L9NA 4B9VA 4GKJF 2DXDA 4NE9C 1NKCA 2AYBA 3M2VA 3J7A1 2HHPA 2ZD1B 1WTBA 2MGZA 4WK3A 4OX9J 1FKPB 2B56A 4WKYA 1TUWA 5I3UB 2DHXA 4NL5A 4X62F 3BH7B 4O3RA 2LECA 3LGHA 1RHQB 2DY9A 4OZ1A 4QW8A 2QA2A 4MKVA 4NLSA 1KHVA 2MZRA 3RJMB 4PKDB 2QL5B 1QY7A 1Q7YT 3OUYB 4TKTA 4X4PA 4O44A 3CCJS 4KHRA 3WC2A 2Z30B 1U1NA 2RHSB 3R7NB 2XO6A 1H2VZ 3PHTA 3MM8A 1Q78A 4M5HA 4C6AA 5D4LA 2J6SA 5LM7E 4WZMA 4CLFA 2GMJA 2HK3A 2IRUA 1EQMA 2LVWA 3L95X 2BQUA 3CTRA 1RCXB 1OY9A 3FSYA 2CZ9A 1XERA 4USTA 3BKFA 3ZXWA 2OPRA 3UVJA 3KLIB 4CCHA 2DNGA 2QC3A 2PO4A 3CCMS 3MFHA 4ITSA 5LMNJ 3U7JA 1B70B 4PQUB 3K57A 4NLRA 4NASA 1D9FA 4LFAF 1WDTA 1U0HA 5HMXA 4J9UE 1UWBA 4DX7A 4EMDA 3LANA 4TYBA 3KHGA 3SSQA 3IP0A 2HQCA 2HNYB 1YK9A 1S59A
chains in the Genus database with same CATH topology
1IM6A 1KBRA 2CG8A 4M5KA 4CRJA 3HT0A 5ETNA 2F65A 4M5GA 4M5MA 5ETQA 4F7VA 3HD1A 3QBCA 1EQ0A 1HQ2A 1EQMA 3ILJA 4M5NA 1RU1A 4M5JA 3MCMA 3HSJA 1CBKA 1TMMA 3HCXA 3HSGA 5ETKA 4CWBA 5ETPA 4M5IA 2BMBA 1G4CA 1RB0A 3MCNA 1RU2A 3UDEA 3UD5A 5ETRA 2F63A 3KUHA 5ETOA 3ILLA 3KUGA 5ETSA 3ILOA 2QX0A 1DY3A 4PZVA 3HD2A 1TMJA 3MCOA 4M5LA 3HSDA 1Q0NA 3IP0A 3ILIA 5ETVA 1HKAA 4M5HA 5ETTA 5ETMA 3KUEA 4AD6A 5ETLA 1EX8A 3HSZA 4CYUB 3UDVA 1F9HA 1RAOA 1RTZA 4CYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IM6 A;  1KBR A;  2CG8 A;  4M5K A;  4CRJ A;  3HT0 A;  5ETN A;  2F65 A;  4M5G A;  4M5M A;  5ETQ A;  4F7V A;  3HD1 A;  3QBC A;  1EQ0 A;  1HQ2 A;  1EQM A;  3ILJ A;  4M5N A;  1RU1 A;  4M5J A;  3MCM A;  3HSJ A;  1CBK A;  1TMM A;  3HCX A;  3HSG A;  5ETK A;  4CWB A;  5ETP A;  4M5I A;  2BMB A;  1G4C A;  1RB0 A;  3MCN A;  1RU2 A;  3UDE A;  3UD5 A;  5ETR A;  2F63 A;  3KUH A;  5ETO A;  3ILL A;  3KUG A;  5ETS A;  3ILO A;  2QX0 A;  1DY3 A;  4PZV A;  3HD2 A;  1TMJ A;  3MCO A;  4M5L A;  3HSD A;  1Q0N A;  3IP0 A;  3ILI A;  5ETV A;  1HKA A;  4M5H A;  5ETT A;  5ETM A;  3KUE A;  4AD6 A;  5ETL A;  1EX8 A;  3HSZ A;  4CYU B;  3UDV A;  1F9H A;  1RAO A;  1RTZ A;  4CYU A; 
#chains in the Genus database with same CATH topology
 2VC1 A;  3QWP A;  1ZM9 A;  3SV4 A;  1LWE B;  2LP4 A;  3V6D A;  5IT9 U;  1U24 A;  3MEE B;  1X4C A;  4IYQ A;  1AZS A;  3D0G E;  2YKN B;  3IBW A;  2KFN A;  5HN0 A;  1Q16 B;  3SEO A;  1PIE A;  2B3T B;  3K5M A;  1FX4 A;  4RW9 A;  3W5Y A;  3NLC A;  2KZM A;  2LDY A;  1N36 F;  2XQC A;  2AX1 A;  2C2D A;  3BF4 A;  1X4G A;  1FKO B;  3ETO A;  4K50 A;  1FT8 A;  3B82 A;  4G1Q A;  4ID5 A;  4PG4 A;  1CJT A;  1AUD A;  2M3D A;  4I64 A;  4ZPW R;  1RAI B;  4PYD A;  3PDN A;  4ZP7 A;  3TJ9 A;  3QSI A;  1HA1 A;  4O4G A;  4U7U D;  1JKH A;  1NSA A;  5K8M A;  2ZC3 A;  2PA8 D;  3JQM A;  1VOM A;  3HDS A;  4Q0B A;  1DTQ A;  2Q6C A;  2W7A A;  4U8V A;  2A3J A;  2P5V A;  3EVM A;  1XR6 A;  3LPE A;  3L7U A;  2F8H A;  3MPV A;  2RIL A;  3FEY B;  3BJY A;  2JLE A;  3CWJ A;  3MM5 A;  4KO0 A;  2V8H A;  2ZJQ Q;  2KG0 A;  4KAI A;  3MEC A;  4DJB A;  2E1M C;  3HUL A;  2GMH A;  3KYL A;  5T41 A;  1VC6 A;  2HND B;  3N6M A;  2YWH A;  4QIE A;  3NEK A;  5CAA A;  2JL9 A;  5KFH A;  3SSR A;  4CH1 A;  4EFA C;  1P6T A;  2BJ8 A;  2FJE B;  5C42 B;  2GJF A;  1HBM A;  5KT7 A;  4DR4 F;  4Y34 A;  1VBZ A;  3RAX A;  3NL0 A;  3KG4 A;  3J81 U;  3FZB A;  4MKB A;  5KFR A;  3DMJ A;  2ALY B;  2YVS A;  4YB5 A;  3BS9 A;  2QV6 A;  3W2W B;  2PA3 A;  3RR8 A;  4KGK A;  3TAM A;  4M8L A;  3RB3 A;  2XMV A;  2BDP A;  4R0J A;  5IV3 A;  4IO9 Q;  2DGX A;  4OJG A;  1R8H A;  2KJW A;  2PEH A;  3HT3 A;  1JLF B;  2V9W A;  2KXF A;  4U95 A;  1O51 A;  4CI0 B;  4O0I A;  4YOE A;  2N82 B;  2CA9 A;  4ZVP B;  4DR6 J;  5CYM A;  4F4W A;  2X1B A;  3GFZ A;  4KSE B;  1YSJ A;  2E1R A;  2NZ4 A;  3KLF A;  4B9M A;  2QX0 A;  3PFO A;  1R31 A;  2QMW A;  3OTE A;  3FKB A;  4PXE A;  1G6B A;  2AD9 A;  2E5I A;  5IT9 Y;  2ATL A;  1SC1 B;  2JZ5 A;  2Q66 A;  3HHN B;  4ZCM A;  3HCX A;  3PJ9 A;  5FDL A;  2A10 A;  4LF2 A;  2FZG B;  2XZW A;  4ES1 A;  2OFG X;  1EP4 B;  3GJS B;  5IWA J;  2APO A;  2KYX A;  4CLL A;  2BAN A;  4ZPV R;  1Q8B A;  4CO3 A;  4WTY A;  2OPP A;  3GIK A;  1N32 J;  1VRT A;  4TVA B;  3BR9 A;  4NLD A;  1IQZ A;  3NCQ A;  2BAB A;  2CPE A;  1S9G A;  3GSI A;  5D4P A;  1HQE B;  1RAD B;  3AHP A;  4RKU C;  2KM8 C;  1ARO P;  3SZ2 A;  4CO2 A;  3VV2 B;  1QAI A;  3KJF B;  1KLM B;  2J9D E;  3AFG A;  2XMJ A;  1KVJ A;  3W5X A;  4DV0 F;  5D78 A;  1VQP S;  1TUG B;  1U1K A;  4RW6 B;  1KTQ A;  2CPZ A;  2CQB A;  2PMH A;  5HMW A;  5EX3 A;  1RU2 A;  1JMT A;  1PGZ A;  1TFW A;  4KJI A;  3M8Q A;  1UVM A;  2QO3 A;  2YKQ A;  4Q44 A;  3HX9 A;  3OXL A;  4C11 A;  3PKY A;  2D3Z A;  1SC4 B;  3BPS P;  5HO4 A;  4LF9 J;  3MM7 A;  2HVI A;  4M95 A;  4LR7 A;  3TA1 A;  3EGZ A;  3PRB A;  2LU1 A;  2ZZN A;  3MR7 A;  3GJR B;  3B8H A;  3IRX B;  4P72 A;  1X5T A;  5BXI A;  2KO1 A;  5ETS A;  2OEL A;  1OQ3 A;  3J81 Y;  4ZN3 A;  3LOU A;  3PKM A;  4DPT A;  2QFJ A;  2H51 B;  2E5G A;  4LF7 J;  4QR2 A;  2ZBI A;  2A6O A;  2VBX A;  4LVN P;  2DGS A;  2FD2 A;  2ZVS A;  2ACM A;  2DCU B;  2CPJ A;  2AJ4 A;  4EU0 A;  3A8E A;  2QIF A;  3GIJ A;  3HHL A;  2KVI A;  1L3S A;  3MPW A;  1NDP A;  1RAO A;  2KN4 A;  2IJF A;  3KK1 A;  1QSS A;  4HHJ A;  3FZ2 A;  3NBP A;  5LT5 A;  5AJ3 J;  4NLO A;  4DQS A;  2F4V J;  4DU7 A;  3NNH A;  4BBY A;  5F8L A;  1ZTW A;  2RRB A;  1CJU B;  1FHT A;  2I0X A;  4FYV B;  2HFN A;  1RWX B;  3IG1 A;  3M30 A;  1LEO A;  1S9E B;  1NDL A;  3GYN A;  2R9L A;  4ZLJ A;  1RT1 A;  2JC0 A;  4G3I A;  1Y9O A;  2YWW A;  1REV A;  3AJD A;  2MQN A;  4LRC A;  3PYF A;  3SQG A;  5A8R B;  2PI4 A;  2IYI A;  1KQF B;  1HYS A;  1DY3 A;  4CO4 A;  2YH0 A;  2IYG A;  1HBU A;  3B4D A;  1GMV A;  1R8C A;  4CRJ A;  1X4A A;  5HI7 A;  4Z37 A;  4HH0 A;  1NCL A;  5F0W A;  1RTD B;  4DSJ A;  1MWQ A;  3T9Z A;  4LFC J;  4FS2 A;  1OQ6 A;  2LYV A;  2FVQ A;  2PEB A;  3DXS X;  4GVL A;  3TX8 A;  5J2N A;  4F4Y A;  3V6J A;  4CO1 A;  4DSK A;  1T3N A;  4NCG B;  4CLS A;  1TFY A;  1RU1 A;  2QG9 B;  2BQ3 A;  2UXB F;  3L7P A;  2WON B;  2E5H A;  4HAC A;  3AB2 B;  1XEZ A;  2V8P A;  2VL1 A;  3AA9 A;  4OMF G;  2AV5 A;  4R8U A;  5F9N A;  4AUK A;  3A12 A;  3SFU A;  2XMM A;  1D09 B;  4OI0 A;  3HVR A;  4DL4 A;  4X2B A;  5J2M B;  2DR7 A;  2MZQ A;  3W1Y C;  1DUR A;  4M5I A;  4LBI A;  4ILM A;  4XO0 A;  1HD0 A;  2AW0 A;  1VQM S;  2CPD A;  4DZD A;  2H4W B;  1RT2 B;  5F0U A;  2CNK B;  1FEE A;  1UET A;  2QLX A;  3Q22 A;  1XK8 A;  3AXK A;  2KTQ A;  2DGT A;  3BB5 A;  2VBZ A;  1AFJ A;  3BO4 A;  3MAA A;  3QNW B;  1QUV A;  3I0S A;  4ZVT B;  2XSF A;  4O3Q A;  4CNZ A;  1VQN S;  1N52 B;  2YKM A;  3KK2 A;  3AOB A;  5KFL A;  1QD1 A;  1UEU A;  3EXY A;  3QYY A;  3M8P A;  2XNQ A;  1RT4 B;  3C66 A;  1PG5 B;  2GC8 A;  3DGV A;  1A6L A;  3LP2 B;  3PW5 A;  3MGJ A;  2O3D A;  3BGR A;  1SQG A;  2DRD A;  2IMO A;  4QIW D;  2J76 E;  1HW8 A;  2V4J A;  2M70 A;  4JYA F;  3RYL A;  1TR0 A;  3GZ7 A;  4F4X A;  3M2V B;  4RLE A;  4YFU A;  1S1T A;  1GEH A;  4K0K F;  1RYR A;  5CYQ B;  2W1B A;  2V94 A;  2YKP A;  3PM9 A;  3Q2T C;  1HBN A;  3QT8 A;  3SQO P;  2FHJ A;  3KK3 A;  1N48 A;  2K2P A;  4EWT A;  1BXN A;  2RDI A;  2VPY B;  1FFW B;  2VQE F;  2C3O A;  5IQQ A;  1QDU B;  4O44 B;  5HQM A;  1H74 A;  1MRO A;  1S7H A;  4DCO B;  4RR5 A;  2DHS A;  4OZJ A;  1P9Y A;  1WHY A;  4JOU A;  5K14 A;  1RB0 A;  2FJV A;  1T9W A;  5K8P A;  2GHV C;  3E51 A;  3MM8 B;  3CE8 A;  1IKW A;  3EJM A;  3JAM Y;  2ZH4 A;  1U1O A;  2DNK A;  2V2Q A;  1CUL A;  5L1K A;  3CC7 S;  4H4M A;  3SBM A;  3Q83 A;  2GVZ B;  4A47 A;  5L1I A;  1OIA A;  2RHQ B;  3N4W A;  2CQG A;  2I6W A;  1D9A A;  1FFG B;  2OPR B;  5F9L A;  1GXL A;  3UVJ B;  2PMZ D;  2Q79 A;  1NND A;  3AXM A;  2ASY A;  2C2Z B;  1C0U A;  3ISN C;  4USV A;  2DK2 A;  3VTI A;  5K8O A;  1L3U A;  4E98 A;  4TXS A;  2OTJ S;  1U1Q A;  1IVZ A;  3DOK A;  3FK4 A;  1QTM A;  3A8J A;  4Q2L A;  1U0H B;  3SSS A;  4C4W A;  5LJ3 Y;  1AFI A;  1LFW A;  1J5E J;  4Q43 A;  5EN1 A;  4IR1 A;  1JX4 A;  2V8G A;  3N01 A;  4B9S A;  3M32 A;  1ELO A;  3MCS A;  1T9Y A;  2DR8 A;  1NK4 A;  2FJA B;  1WKJ A;  3KKF A;  2DRA A;  2BJD A;  1AZS B;  3QLH A;  4XK8 C;  2R8J A;  2CQ0 A;  5A6W A;  1WOS A;  4A8W A;  5HSP A;  2UU9 J;  5I42 A;  3D5M A;  1VLO A;  3OL9 A;  4OQJ A;  4RW9 B;  2A1B A;  1B0V A;  1NUE A;  5DRK A;  2CQ2 A;  1Q81 T;  4MJK A;  2OGU A;  3MEG A;  1WG5 A;  1S1X A;  1KQG B;  3M8Y A;  4RNH A;  3CJR A;  2K7K A;  1DQA A;  4E2F B;  3RB0 A;  4G1Q B;  2CYY A;  2ATC B;  1CJT B;  4MK7 A;  4C8L A;  4FBU A;  3QAT A;  4QW9 A;  1LNQ A;  5IM0 B;  4O4G B;  1D8Z A;  2HIQ A;  1WG1 A;  3M8W A;  2F3J A;  1JKH B;  2PC6 A;  4ZJQ A;  3CVK A;  1EET A;  2W4D A;  1GQE A;  4A8X A;  4PCQ A;  4UOH A;  4Q0B B;  1DTQ B;  4RO0 A;  5KFE A;  4XTT A;  2KKH A;  2VOD A;  4M5M A;  4ZP6 A;  1XNR J;  3PNI A;  2CQ1 A;  2OSQ A;  2BUN A;  2RU9 A;  4KE5 A;  5KT3 A;  3MM5 B;  4DBQ A;  5B0D A;  2WTF A;  3AJ2 A;  4KO0 B;  2MHN A;  3K2Y A;  2VJU A;  3H0P A;  1Y0H A;  1S79 A;  2L9D A;  1VDH A;  1KRP A;  2VG6 B;  4PWD A;  1FJG F;  5CZV A;  4I56 A;  3DRR A;  2BVZ A;  1S7I A;  3GFX A;  4WKR A;  4CYU B;  4ETZ A;  5E0O A;  4DR7 F;  1KQK A;  3EE3 A;  3RUB L;  3I4P A;  1HL6 A;  2R7X A;  3C8Y A;  1KDN A;  2MKI A;  4HYK A;  4EZ9 A;  1UWA A;  1HBM B;  3HP6 A;  2AYE A;  4DV4 J;  2QE5 A;  3CME S;  4F36 A;  1DAX A;  2J9C A;  2PMW A;  4DOZ A;  3BYR A;  2RRA A;  3J7Y U;  1UEK A;  4M5N A;  3N0V A;  3M6X A;  4Z7C A;  1ZA2 B;  2ZDO A;  4MYT A;  5KFG A;  3TAM B;  5A6P A;  3OTD A;  2U1A A;  1ZYQ A;  4FVM A;  4GKK J;  3QGI A;  3I0R A;  1HI8 A;  2YNH A;  1X5P A;  3HK2 A;  1RWP B;  4K4X A;  5DLF A;  2J8A A;  3GCW P;  4PPD A;  3GB0 A;  4NLP A;  2KT3 A;  5ETO A;  2ZWP A;  1OSD A;  1T11 A;  3M6W A;  3WDO A;  1SL2 A;  1P27 B;  1HWK A;  1SJF A;  4N76 A;  5CYM B;  4Q5V A;  2MZJ A;  2P9E A;  4PG6 A;  2E5L J;  2ZH7 A;  1R8P A;  4L74 A;  4QCL A;  3OL7 A;  1ZA1 B;  1PO6 A;  3DLL Q;  1P9Q C;  4LMZ A;  2DH7 A;  4MT1 A;  2PII A;  4M1K A;  2GVD B;  2HUR A;  4DV5 J;  1RIS A;  4DL7 A;  1G3O A;  4HEA 9;  4OZN A;  2CFX A;  1SQF A;  2FY1 A;  1KR4 A;  2C2E A;  3FCH A;  2ZH3 A;  3C19 A;  1IWA A;  1YQH A;  1RSC A;  3AB4 B;  3D6F B;  5ETQ A;  3PVX A;  1RKI A;  2BAN B;  1DQ9 A;  1B0T A;  3MCN A;  2YH1 A;  2Y9H A;  2OPP B;  1FWP A;  4XDC A;  2WVD A;  3VVU A;  5JJB A;  2H3E B;  4Q8E A;  1S9G B;  5HJY A;  4HI1 A;  4K2X A;  3CCS S;  3BR8 A;  3ILO A;  1LK7 A;  1XIQ A;  4UUX A;  2RE1 A;  2SXL A;  3GPA A;  1HNW J;  2ZNZ A;  2NLW A;  3B4M A;  2LKZ A;  2XWY A;  5L8R C;  2BOA A;  4JI6 J;  3GJT B;  2BW2 A;  1RYS A;  4DUZ J;  4FF3 A;  4F4A A;  2RQM A;  4Y6I A;  4KFB A;  1QAX A;  4OZ3 A;  1LV5 A;  3CMA S;  2HFU A;  3G86 A;  2VDH A;  4C11 B;  1A0O B;  1W25 A;  2UVR A;  3I55 S;  2HQG A;  3NS7 B;  4ZCK A;  4LF6 J;  3I6P A;  4EK2 A;  3MM7 B;  1SCJ B;  3BO3 A;  3J7Y I;  2VA3 A;  3AAW B;  5CYJ A;  3N5F A;  4OYA A;  4DR5 F;  1VRQ C;  4FDF A;  2YXL A;  1TK0 A;  3UR3 C;  4RJV A;  4F0M A;  2BQR A;  5L39 A;  2VH7 A;  1M1H A;  1VIO A;  1IKX B;  2IFX A;  3V81 B;  4J9O A;  2D7S A;  1NH8 A;  1WAC A;  2H9Z A;  2EEY A;  2EK1 A;  3UDE A;  4OJ1 A;  2XS7 A;  4A4J A;  1HNI A;  2W4P A;  1UEV A;  2VU5 A;  2KFZ A;  3QRP A;  5KFO A;  4JI2 F;  3CPW R;  3MOZ A;  4CTA A;  3TX0 A;  1YJR A;  2DJW A;  4XAK A;  4DV3 F;  3CJ0 A;  3LQV A;  1F6T A;  4DHV A;  1SVD A;  3HHL B;  3P49 B;  3OT9 A;  1H7X A;  3KK1 B;  2GO8 A;  1U6F A;  4F67 A;  3NBP B;  4NLT A;  4F3M A;  4C2M A;  4C8Y A;  1AW0 A;  2NUU G;  1MWY A;  4CLT A;  3H5X A;  3ENW A;  3IFE A;  3DN9 A;  3OTO J;  4B3S J;  5H9E J;  4QZV B;  3CW2 C;  2W2M P;  3GYG A;  1VK8 A;  2RB7 A;  4AL6 A;  2Z2L A;  3IG1 B;  3MUT P;  2YWG A;  3M30 B;  1FES A;  4ZP9 A;  3HSG A;  3IN5 A;  4DV2 J;  4FXD A;  5DZ7 A;  4ETX A;  2HVH A;  2MHE A;  2AWZ A;  1RT1 B;  2YWK A;  4ZIV A;  2HGN A;  3J7Z 5;  3N6L A;  1VQY A;  1REV B;  3UN3 A;  4NZ0 A;  4UQG A;  4XPC A;  2HZA A;  1IBK J;  2FLP A;  1SH2 A;  2CPY A;  1HBU B;  3FFI A;  4DDF A;  5DG8 A;  4ELT A;  5JMN A;  5AE2 A;  1A7G E;  3H25 A;  4USH A;  4CLU A;  4GKJ J;  2G2Y A;  3DLH A;  4NXM J;  2HVD A;  2MKY A;  1QTN B;  2X7I A;  5J2N B;  1Y3J A;  5L46 A;  2GHW A;  2DRB A;  1VBY A;  3HJV A;  3KMS A;  4HAC B;  4YB6 A;  4RNF A;  3KXD A;  4DN0 A;  1RT6 A;  1Y5N B;  3CNQ P;  4IH7 A;  3BN4 A;  4Y65 A;  3SCI E;  2XSJ B;  1FX2 A;  1GXT A;  4K2J A;  1RAC B;  5LSR A;  1IJF B;  4X65 F;  2E29 A;  4KR0 B;  4UQT A;  1WWH A;  1Q4R A;  3WZ0 A;  4JV0 A;  3E01 A;  4J9L A;  2CNO B;  3T1A A;  2XMT A;  3F56 A;  4ER8 A;  2AGP A;  2AGO A;  2DH9 A;  3RR7 A;  5E3Q A;  1RT7 B;  2QGF B;  1C0T B;  1WC4 A;  4WFY A;  3MAA B;  1JLA A;  4OFZ A;  3I0S B;  4C98 A;  2NYI A;  4G6V B;  2W8L A;  2YKM B;  3MM9 A;  4WFX A;  5KFZ A;  3KK2 B;  2J0W A;  2ZH2 A;  2HLT A;  3R8Y A;  2BAC A;  3M8P B;  4AQY F;  2GAG C;  4ZVH A;  4O0N A;  4JBC A;  4I68 A;  4O3N A;  3BGR B;  1T8E A;  4F4K A;  1U48 A;  1TV6 B;  1RAG B;  1FJC A;  2V4J B;  1RLC L;  1RBL A;  2WRM A;  3GG0 A;  4I4B A;  4B3R J;  1RWO B;  2DEJ A;  4CH0 S;  1FXL A;  1FCA A;  4I6Y A;  3FCW A;  1ZS6 A;  1WI6 A;  3CO9 A;  5ADZ A;  2V8V A;  3MM6 A;  1HD1 A;  2FHO B;  4WU2 A;  2L3M A;  4U7C A;  1E6V A;  3GTY X;  4Q2M A;  4QIG A;  3T5L A;  1REG X;  1IBL J;  3KJQ B;  3KK3 B;  3PW7 A;  2ZH6 A;  2Y0S D;  1BQN A;  1S12 A;  3G6Y A;  2YKO A;  1HHQ A;  3KNA A;  2OPS B;  1CJV A;  4IQM A;  4W4M A;  1AT1 B;  4IOA Q;  2QYC A;  2IMW P;  4E8U A;  1Y7P A;  1MRO B;  1UP1 A;  2E7V A;  2BYC A;  2LXU A;  1C1C A;  4ENO A;  2QJ3 A;  2HWT A;  4OJ3 A;  4P2X A;  1HHT P;  1YJT A;  4KGM A;  3KLV A;  3TUJ C;  1FEH A;  1IKW B;  2Q43 A;  2XMA A;  4OI4 A;  1N36 J;  2MYF A;  4M5K A;  4QR0 A;  4JI7 J;  1CUL B;  3UE2 A;  1WOO A;  3US5 A;  3SXL A;  3DLK A;  1FJ7 A;  3W64 A;  5E2Q A;  2AYG A;  2W9A A;  2HVZ A;  3UDV A;  5AE3 A;  1IR1 A;  1EHW A;  1T9U A;  3CCE S;  2QLB B;  3RBE A;  2BRL A;  1Q8I A;  4Z2X A;  4F2S A;  1YBT A;  3O8W A;  4JI4 F;  2MST A;  3O2I A;  2FLO A;  4G65 A;  3DLB A;  2B4P A;  1N34 J;  4OZ0 A;  2W4C A;  2JHE A;  4NML A;  4L3N A;  4N5S A;  1LQ9 A;  3WBZ A;  1RAF B;  4I67 A;  3F0N A;  2WSF C;  4KC5 A;  1SKU B;  2JC1 A;  3NOC A;  3S8S A;  4ICL B;  5HQ8 A;  4NRT A;  2D3U A;  4DI6 A;  3CUL A;  3VQT A;  1DBD A;  3QLH B;  2CJ9 A;  3MD3 A;  1SKS A;  3MPY A;  2ROG A;  4W92 B;  4FS1 A;  2DNP A;  4YY3 F;  5LSL A;  4J9S A;  3PEJ A;  4FPI A;  3P8B B;  1PSD A;  3PR4 A;  1V9O A;  5I42 B;  1D1U A;  4DR4 J;  1UFK A;  2GJ2 A;  3DCA A;  4OX6 A;  1RWW B;  1EB0 A;  2EKN A;  4URG A;  2YQ0 A;  3MEG B;  1S1X B;  1S0M A;  5C2C A;  2H54 B;  4DWI A;  3IWN C;  2KDO A;  1YJ9 S;  3DI6 B;  1SH3 A;  2AQ4 A;  1YJN S;  3LAK A;  2VKZ G;  3PRV A;  3CCL S;  2HHU A;  1NHK L;  3I31 A;  3HVT A;  3A8K A;  2C2N A;  3RRH A;  4OI6 A;  2CWK A;  2KZZ A;  4RU2 A;  3HT0 A;  1NK5 A;  2HYI B;  5KG7 A;  2AP6 A;  3NP5 A;  4BCA A;  1KWM A;  1PAE X;  2HPU A;  2O5D A;  4OI1 A;  3X1L B;  4OYW A;  4L73 A;  3D3C J;  1IN0 A;  2F9J A;  3R27 A;  1EIY B;  4RBT A;  1ZZF A;  5FJ4 A;  3GFH A;  5A76 A;  1RAE B;  1SQE A;  2DKO B;  3HKZ D;  3UD5 A;  1K0T A;  4RUC A;  1RK8 A;  3HSD A;  3C6U B;  1Q8L A;  2J7K A;  1HNZ F;  1JXV A;  4MK8 A;  2N7C A;  3W9H A;  4PWD B;  1WG4 A;  1BD6 A;  3CJ4 A;  4PG5 A;  4K4T A;  3DRR B;  2D74 B;  2FVC A;  1O8B A;  3OFH A;  4DPW A;  5CD4 H;  2R8H A;  4KB7 A;  1S48 A;  4KGX B;  1L3T A;  4X64 F;  3UQS A;  2ZHO A;  3T1Y F;  5E5N A;  2DH8 A;  1VC5 A;  4QYZ K;  5KFS A;  3GFY A;  2UXD J;  1M5P C;  1Q5Y A;  2PDA A;  2JDJ A;  3PW4 A;  2BXJ A;  1UVJ A;  3BQ1 A;  1HPZ B;  3PW2 A;  9ATC B;  3D54 A;  4OL8 A;  4RW7 B;  1DZ5 A;  1LWC A;  2ZM6 J;  1YJ7 A;  1TQL A;  2CJQ A;  3I0R B;  3KLE A;  2ZE2 A;  1IM6 A;  1FNO A;  4HKQ A;  2OAU A;  2B7B B;  3P4U B;  2YKA A;  3CC2 S;  4DV0 J;  1ZZN A;  2V69 A;  5C24 B;  1HNV A;  5IOL A;  2GIQ A;  4OZL A;  2ZJR Q;  4CLW A;  3NGS A;  3GE9 A;  2VOO A;  1I1G A;  5HK4 A;  3FSX A;  1KTV A;  5AXM A;  1GX5 A;  1SC3 B;  3AA8 A;  5KG5 A;  4B17 A;  1HNX F;  5L1L A;  4YHH J;  2WBR A;  3CDA A;  3MED A;  2QT7 A;  3CCW A;  1NZA A;  2YTC A;  2EI5 A;  2DCL A;  2QTW A;  1XWL A;  3OHA A;  2OH2 A;  3FMB A;  2R3V A;  4EBE A;  1MN7 A;  3AQO A;  2IVY A;  2IM3 A;  3IR7 B;  2M5Y A;  4URS A;  3PW0 A;  1S1W A;  3THP A;  1NRK A;  1CG2 A;  2VV5 A;  2XYP B;  2LU2 A;  4FF4 A;  3OL8 A;  3NKY A;  4A8O A;  4JI1 J;  1R3N A;  1RDR A;  2IBK A;  2RML A;  4QPT A;  4CH7 A;  2FQQ B;  2AX0 A;  1RKJ A;  1RTJ A;  1F2G A;  4ES3 A;  3P45 B;  5CZX A;  4IG3 A;  4WXO A;  4K7Q A;  5SUH A;  5DO2 A;  4F26 A;  4EUV A;  4OX9 F;  2V4Q A;  2OHD A;  3L9Z A;  3MXH P;  3W2V B;  3D6M B;  1RXO B;  4BWJ A;  3IGN A;  1UPP A;  5FD1 A;  5K20 B;  2HQD A;  4IUF A;  1C4A A;  2R42 A;  2ACY A;  4KFB B;  2HW3 A;  4DS5 A;  3ENA A;  1EKS A;  1LXN A;  2XCP A;  8ATC B;  4ELU A;  1M5H A;  4IR9 A;  2QYG A;  1JXE A;  3MR2 A;  1VI7 A;  1UZH A;  4A8Q A;  4B3O B;  1FKA F;  4JI8 F;  4LR9 A;  5JVH Q;  1NJI T;  1WKL A;  1PIL A;  1YJW S;  2OPQ A;  2CUY A;  3IGV A;  4L72 B;  5LMN F;  1TKT A;  3UNY A;  4AL5 A;  2DYA A;  2Z56 B;  4TN2 A;  1VJW A;  3QT6 A;  1S97 A;  1V3R A;  4M5D A;  2GS8 A;  2ZH8 A;  2CVI A;  5HMY A;  3HD1 A;  4HI2 A;  4X4O A;  2LQ9 A;  1N0U A;  5HJX A;  2RH3 A;  1HNI B;  3TUI C;  3HHK A;  1TKX A;  1U6Z A;  4F2R A;  3T5H A;  1FI4 A;  3Q24 A;  1S77 D;  4G1I A;  2J7W A;  1SB6 A;  2MKK A;  4JB8 B;  5IQ6 A;  4HH1 A;  3KWM A;  4CTA B;  2UXB J;  2VG5 A;  2CXE A;  2WSC C;  1AB8 A;  2DD8 S;  1OJ4 A;  2ZVI A;  2XBP A;  3DLE B;  4ZVG A;  2ZFH A;  2E44 A;  1Q95 G;  4O3O A;  1F9H A;  2HFS A;  2JSX A;  3UN2 A;  4N56 A;  1TAQ A;  1GXU A;  3G96 A;  3BSC A;  3PIP Q;  2W8K A;  2UUB F;  2Y1R I;  4ZP8 A;  5DLG A;  4YQW A;  5DDP C;  3P5B P;  5THW A;  2H5E A;  5D6G A;  4C8K A;  2VA2 A;  1O6X A;  3LGM A;  4OHX A;  3D9B A;  5LXR A;  3G8Q A;  3I87 A;  3MTJ A;  1F2H A;  2IVF B;  2UUT A;  3CJ2 A;  3EMT A;  3OW2 R;  1VQS A;  3AOC A;  1LW2 B;  3V4I A;  2FJD B;  1JLG A;  2CJY B;  4DCJ B;  1R89 A;  1IQT A;  1IUJ A;  3DM2 A;  1N5Y A;  1WKK A;  2U2F A;  5B7W A;  5K8N A;  1S0V A;  2KG1 A;  2Y1L B;  5KG6 A;  3FFI B;  2G9O A;  3J7Z T;  1AYE A;  3FVY A;  1B99 A;  4C48 A;  4AFF A;  5F8H A;  3MAQ A;  4RUA A;  3KMQ A;  4OHW A;  1HR0 F;  5KT5 A;  1WHX A;  1H38 A;  5J1N A;  1UCN A;  3FDS A;  4Y28 C;  4NZ6 A;  3D0H E;  4P2S A;  5IT4 A;  2CJK A;  2GML A;  2KJV A;  1TEL A;  2CNN B;  3RU0 A;  1N54 B;  1Y3K A;  4I69 A;  1RT6 B;  1HFE L;  4DZ6 A;  1SJ3 P;  4HT7 A;  2G0C A;  4YUD A;  5D3G A;  3UR0 A;  3EXC X;  5F3T A;  3T41 A;  2EFG A;  2MLY A;  2WB1 D;  2A2D A;  1Q1K A;  1PKU A;  4CM2 A;  1R7I A;  4O4R A;  3LF0 A;  3OHB A;  4NYO A;  5B08 A;  3PX4 A;  4ZN1 A;  1SIW B;  4J9Q A;  2FHK A;  3QGP A;  4ILL A;  3ZNU A;  4H4O A;  4FZV A;  4YDX A;  5HAN A;  1S9F A;  1KVK A;  3K7R A;  1JLA B;  4GVB A;  3C2P A;  1YWX A;  5CXT A;  1SUQ A;  1T02 A;  2MQL A;  3MM9 B;  2VB6 A;  1F3V A;  4K5S A;  2HWI A;  4NYP A;  2OTL S;  3CCQ S;  5A2Q U;  4R0E A;  2UUA J;  4DFP A;  2VIC A;  1GMW D;  2XWX A;  2EK6 A;  4AT1 B;  2F5G A;  1CPZ A;  1P1T A;  1TL4 A;  3DRS A;  2GCF A;  4HTJ A;  3H5Y A;  1H0H B;  4DR6 F;  1QM9 A;  3BBB A;  3T9N A;  1TAU A;  4X66 J;  2RD5 C;  2DGW A;  1IR0 A;  3W63 A;  4LF4 J;  5CAB A;  1CVJ A;  3P5T L;  1R0B G;  2ADC A;  3MM6 B;  1JLC A;  1ZPW X;  5KOX A;  4B3T J;  2IHR 1;  1B3T A;  1E6V B;  5KT2 A;  2JLF A;  2EG1 A;  2ZJP Q;  3G6V A;  2JFD A;  1VIX A;  4KTQ A;  2GGP A;  1NSK L;  5L38 A;  4NLG A;  1BQN B;  3SYZ A;  4DN9 A;  4NYZ A;  1VRU B;  1CJV B;  2Y3Y A;  3D66 A;  1KN6 A;  4ZVE A;  1RHR B;  4MTP A;  3EVW A;  1N0V C;  1JXL A;  1FNM A;  4ID8 A;  5A8W B;  1N32 F;  1CC8 A;  1C1C B;  5H1S V;  2V8D A;  3W8P A;  2XY6 A;  3LP1 A;  3N9U C;  3Q8S B;  2YX7 A;  3GMG A;  2RRN A;  1R43 A;  1TU0 B;  1WUU A;  1S6P A;  2E1P A;  3S6E A;  2OKQ A;  4JV5 J;  3FEZ A;  1WNE A;  3MUM P;  4DX5 A;  1WEY A;  2AJ2 A;  1IBC B;  4I2Q A;  1U1R A;  1O5J A;  2JEJ A;  1BQM B;  1RAJ A;  1QE1 A;  3VZH A;  1JLE A;  3DLK B;  2VJV A;  3RW7 A;  1N56 A;  2D9O A;  2V2K A;  4NX9 A;  1H6K X;  2LMI A;  4X4Q A;  4MK9 A;  1UA1 A;  3R1L A;  1U47 A;  1RAA B;  1ZET A;  1GNK A;  3CCU S;  2ERR A;  2ZZT A;  3NAI A;  2GQ2 A;  2LEP A;  3RB4 A;  5H9F K;  1HWJ A;  1GMW A;  4X4R A;  3L3C A;  1FD2 A;  4WP9 A;  4WJB A;  2W7O A;  3GJQ B;  2C3U A;  3TW0 A;  2ABY A;  2NSB A;  4ECR A;  4P52 A;  2CQI A;  1PCA A;  1G2E A;  5IC4 B;  2X3G A;  4I6W A;  4BDP A;  2UV8 G;  2C3P A;  1D9D A;  2CAJ A;  1XMQ J;  1U0S A;  4B9L A;  5K9F A;  4LF9 F;  1N6Q A;  4PRF A;  1KFS A;  2HQF A;  3IAM 9;  5LMU J;  1M5S A;  2J8S A;  1X4B A;  1K47 A;  3M7V A;  1N33 F;  3HVA A;  2MKC A;  4NEZ A;  3B78 A;  1VBK A;  2M7S A;  4LF7 F;  4KIA A;  1GT8 A;  1EKR A;  2UZA A;  5GVQ A;  5RUB A;  1VHF A;  4LRF A;  1VQ6 S;  3MUV P;  4UF4 A;  3IR6 B;  1IWG A;  2POK A;  1JJC B;  2B9E A;  4YB1 P;  3KJV A;  4IQX A;  2IY5 B;  1FTC A;  1S6Q B;  1HWL A;  5KFY A;  5A2Q Y;  4DR1 F;  1NPP A;  4EYI B;  3Q8R B;  3Q8Q B;  1QSY A;  1SV5 B;  2BE2 B;  1XBW A;  4RL1 A;  2MZT A;  3VCD A;  2MXY A;  2DHG A;  2CQP A;  4KHP J;  3H98 A;  5HAO A;  4WP3 A;  4ZPD A;  5AJ3 F;  2DEI A;  2M2B A;  5D8H B;  5IFM A;  2F4V F;  1R27 B;  2HAI A;  1RJJ A;  1FK9 A;  3PX0 A;  2R2S A;  4OHY A;  5ITH A;  3HJF A;  3VWS A;  4LF5 J;  3KJN B;  1S1U A;  2JEG A;  1VFJ A;  1NJZ A;  3TYT A;  1LFP A;  3MHY A;  4PYA A;  1QLN A;  1IBM J;  1Y10 A;  3W3S A;  5HBM B;  3C15 A;  4QR1 A;  3UCU P;  1UA0 A;  2PSZ A;  1M1G A;  3OXF A;  3HFK A;  4K4V A;  2R7T A;  2NXN A;  3NGR A;  5F8J A;  4CIO A;  4IKA A;  4ZVO B;  4OLP A;  1OPZ A;  6FDR A;  4WZQ A;  3DGP A;  1W2B R;  5ETV A;  4LFC F;  2KHC A;  2JVR A;  3IBF B;  1UVL A;  1NB7 A;  5M2R A;  4NA1 A;  4X4T A;  3RRG A;  1LWC B;  1NU4 A;  1JWW A;  1P8G A;  2C3Y A;  1K0V A;  4PZV A;  3D28 A;  4ANE A;  1U4B A;  3AOA A;  3KLE B;  3ENQ A;  2ZE2 B;  1LK5 A;  2DR5 A;  1QJH A;  3OQ2 A;  1MML A;  2LLZ A;  3IXQ A;  5KG2 A;  3Q0A A;  2DT9 A;  1HNV B;  3IM9 A;  2YQ1 A;  2B4V A;  4ZPB A;  1R0C B;  3OUY A;  3KLH B;  4ECZ A;  2N7Y A;  2I9S A;  3KNG A;  3ISN D;  3BGU A;  2WVB A;  2HHW A;  5D4N A;  2VFV A;  2HIY A;  3QRR A;  1BMQ B;  2XM3 A;  3MED B;  2BM0 A;  1TKZ A;  3JQK A;  2GX8 A;  4FF2 A;  2XLK A;  3P96 A;  5I3Q A;  3EDR B;  4CLK A;  2XB2 D;  2V2V A;  3IA0 A;  2DNY A;  3QJJ A;  2QA4 G;  4OYI A;  3PEH A;  2G1H A;  1S1W B;  2MZS A;  1HKA A;  3R5G A;  4GRS A;  1PC4 A;  3AOD A;  2HNZ A;  3ZC4 A;  2FLL A;  3DFE A;  3OR2 A;  2V0N A;  5DS7 A;  5KFU A;  2CJA A;  2W2N P;  1F9E B;  4J9K A;  3DDK A;  5D15 A;  1R8A A;  3KHL A;  4N8O A;  1Q5V A;  3N6N A;  3C46 A;  1YDL A;  5KFM A;  2CQC A;  4PG7 A;  1RTJ B;  3SCK E;  3WX4 A;  4IG3 B;  2J6U A;  2VBW A;  4ZDN A;  5CHC B;  4LIW A;  2LEA A;  4TU9 A;  4OYP A;  2HLU A;  2QSF A;  4LR8 A;  1Q79 A;  3FRY A;  2M8D B;  2EBG A;  2I8E A;  2ILY A;  2OP5 A;  1LWE A;  4DV3 J;  1LOU A;  4ZA1 A;  3RBD A;  2Y1I A;  2YKN A;  3BH6 B;  4MIA A;  2J0X A;  2VQF J;  2D9P A;  4DUY J;  1XJW B;  3G9C A;  2HEK A;  7AT1 B;  3MMB B;  3MCM A;  2JRS A;  4L3K A;  5KFN A;  2BZ2 A;  2A18 A;  5CCM A;  2WCX A;  4F0H A;  1YBA A;  1HWI A;  4ED1 A;  5F8I A;  4A46 A;  3H2V E;  1HI1 A;  3WIU A;  2V9K A;  3OTC A;  2ZUG A;  4DL6 A;  1FE4 A;  1TZ0 A;  3OVA A;  3FEX B;  5DET A;  4PQA A;  1PYS B;  3QQC D;  2J0S D;  3ZFV A;  1Y4Z B;  2EKY A;  3FBE A;  4PXD A;  5D0G A;  4QBU A;  1TKT B;  5IXU A;  3CJT A;  1VQ8 S;  1JB0 C;  1IM4 A;  2PFF B;  4M5D B;  5EWE A;  2PGC A;  4C9D A;  3MMA A;  1J5E F;  2F8M A;  2CJB A;  2CG4 A;  2D69 A;  4JI0 J;  4RU9 A;  1DHM A;  1JJ4 A;  3TZX A;  3TWZ A;  9RUB A;  2ZKU A;  2G2O A;  2HND A;  2UVU A;  2JVO A;  1RTI B;  3FQK A;  3MWB A;  5F41 A;  3LH2 S;  4GC6 A;  4ECY A;  2ZUA A;  2DIS A;  4C0H A;  1ITP A;  2DGV A;  2VDI A;  2RT3 A;  2NXC A;  3THT A;  1D3W A;  2R8G A;  3D7S B;  1YHQ S;  1K9M T;  5KFQ A;  3W9I A;  3PX6 A;  3BKT A;  4OZ5 A;  4OV6 A;  2UUC F;  2FDN A;  1T0T V;  4ZHR A;  2Z2Y B;  4UTG A;  1TMM A;  1HMV A;  4P7V A;  3U27 A;  3W2W A;  1FRJ A;  4OHZ A;  1NK6 A;  4PXC A;  3H8Y A;  2N4D A;  1WHW A;  3V4I B;  1JLG B;  2CKW A;  2GQQ A;  2BW7 A;  1U2F A;  3GIM A;  4FKY A;  1N5Y B;  4HDG A;  8RUC A;  4AQY J;  4PAA A;  2RU3 A;  3IS9 A;  3TQ1 A;  3IBC B;  3MDF A;  3Q86 A;  4HLB A;  3SCJ E;  3E8O A;  4X4V A;  2UV8 A;  3ILJ A;  1TP7 A;  5LJ5 Y;  1XNR F;  3BDP A;  4RNN A;  4ES2 A;  4L76 A;  3DHW C;  2GZO A;  2VZ9 A;  5E33 A;  4EO8 A;  2XS5 A;  2MY7 A;  3D6H B;  3VAF A;  3KOA A;  2QLJ B;  2BA9 A;  4B08 A;  1PJ5 A;  5GMK a;  2C1E B;  2ZH5 A;  3TA0 A;  4M94 A;  3DNC A;  4WII A;  1IR2 A;  2H4Y B;  2BRK A;  5D3G B;  4CZC A;  2CQ3 A;  3DDN A;  1VQK S;  1NXI A;  3BDE A;  1WEZ A;  5EX0 A;  4ZIT A;  2KT5 A;  3IMQ J;  4UOG A;  3NNA A;  4EBD A;  1DJ0 A;  2FZK B;  1TMJ A;  1U8W A;  2F4F A;  3I82 A;  4KKO A;  4F3Q A;  4OLO A;  3I5B A;  3THV A;  2EVZ A;  2R7R A;  4H4O B;  3NMR A;  2EFO A;  4ZJL A;  1ZAV A;  4X4N A;  4YR2 A;  3QFH A;  3BZQ A;  3K8V A;  4GVB B;  1O0P A;  5G4D A;  1U2R A;  2DBB A;  1MMD A;  3S7R A;  4C97 A;  3JAM U;  1SUQ B;  1DTT B;  2VKR A;  4GKK F;  2IRY A;  3H20 A;  4F8R A;  3T6J A;  4DR2 F;  2M8H A;  4IRD A;  1FRX A;  4RW6 A;  4EBC A;  4I1T A;  3DKD A;  5B0A A;  3DRP A;  3UN5 A;  3DRS B;  2LEB A;  1KQS R;  3OR1 A;  4NA2 A;  1SC6 A;  2IA0 A;  6FD1 A;  5KFC A;  4WWS A;  2CQD A;  2DNN A;  3VZI A;  1SJR A;  3G4S S;  1OPI A;  4BHQ A;  2E5L F;  4DV7 J;  1ZBT A;  1EX8 A;  2GO9 A;  2MQ8 A;  3MEK A;  4ECS A;  2MKJ A;  3G6X A;  1DAR A;  1JLC B;  5HL7 Q;  4WXW A;  1OWX A;  1HQU A;  3IR5 B;  2AZ1 A;  4EYH B;  2BM1 A;  2HSE B;  2JOQ A;  5B09 A;  4DV5 F;  2D41 A;  3MMJ A;  4WFB Q;  4DR3 J;  4JI5 J;  1FRM A;  1WC0 A;  3VAK A;  1S10 A;  2NS1 B;  4IO1 A;  4BLG A;  2BX6 A;  2CNL B;  4USJ C;  4IOB A;  4QYR A;  3GII A;  2KXH A;  2XGP A;  4IG0 A;  2KM8 B;  4WTO B;  1X0F A;  2UXC J;  1L5U A;  4HR2 A;  4LIR A;  2R8K A;  5EDW A;  3LP1 B;  3POT A;  2YPZ A;  4DL2 A;  5C2G A;  3BRE A;  2J7U A;  1XTZ A;  2MLX A;  4LBP A;  4A8K A;  3T1H F;  1LXJ A;  1RWK B;  2OD4 A;  3TA2 A;  4I2Q B;  4KBI A;  5KFP A;  2CPF A;  1HNW F;  1QE1 B;  1JLE B;  4I0W A;  3CD6 S;  5C5J A;  2VFR A;  5ETR A;  2ROP A;  2ZIT A;  4NLW A;  4V19 J;  4JI6 F;  4IRK A;  5L1J A;  1Q0N A;  5ETL A;  3C3L A;  1SKW A;  4MFB A;  1H3D A;  2VC0 A;  3KHR A;  3H4D A;  2DIT A;  2RUS A;  3D0I E;  4U8Y A;  2E5J A;  2ZHB A;  5T14 A;  1RTH B;  4MKA A;  2RS8 A;  3M4X A;  4DF8 A;  1H98 A;  1UJ6 A;  3T3F A;  4ED5 A;  3ISZ A;  3PFE A;  2MQP A;  2XC9 A;  1EZZ B;  3WHI A;  3RGI A;  3OD2 A;  4TU8 A;  2C2M B;  4H4K C;  2HHV A;  2MGZ B;  2Z2Z A;  2DIV A;  2NZC A;  2WVC A;  1S9E A;  1YZ6 A;  4QYZ J;  1HNZ J;  3CJ8 A;  3R7S B;  4DCP B;  2I1R A;  4F0K A;  3AY0 A;  1FE0 A;  1N6Q B;  2B6A A;  1YZ7 A;  3ZZZ A;  2WVF A;  1VHI A;  3ONQ A;  1DQ8 A;  2EWH A;  2AU0 A;  1S0O A;  1WC6 A;  5IV4 A;  2XS2 A;  1OMS A;  2HBZ B;  1X9S A;  4IFV A;  2JEI A;  4TY8 A;  4KPC A;  1FRI A;  5HVH A;  1RTD A;  1S76 D;  3I56 S;  2B8Q A;  3KG0 A;  4AND A;  1T9T A;  4DPX A;  1SJ1 A;  1RT3 A;  1U8S A;  3MMC A;  4ECV A;  2AJQ A;  4ECW A;  4DPO A;  1MSW D;  1GH8 A;  6AT1 B;  3GCX P;  3NS6 A;  5KFW A;  4NCG A;  2O67 A;  4ZVQ B;  4Y0F A;  1WJ9 A;  5HRO A;  2RJZ A;  3D1H A;  3ULH A;  4FN5 A;  4I6A A;  2KRR A;  2ZOF A;  1SL1 A;  2DGU A;  1NK9 A;  5J2M A;  4OX8 A;  3OTO F;  2QA4 S;  3ZZU A;  2RF2 A;  2VOP A;  4B3S F;  1X5S A;  4NRU A;  1MMN A;  1N88 A;  1UWB B;  1MLA A;  4ERD A;  1S4F A;  2RSQ A;  3I9Z A;  1KEK A;  3D3B J;  2ZHA A;  3ICL A;  2C2O B;  1VYA A;  3LO3 A;  2A0F B;  1ZOT A;  2K1R A;  4KGZ B;  4UW2 A;  4DV2 F;  1V3Z A;  1S1U B;  3H5U A;  4ZVF A;  1RUS A;  3HXM A;  3V6D B;  5IZH A;  2KT2 A;  5SZT A;  3ZO7 A;  3EGV A;  1L3V A;  4JI3 F;  3C15 B;  3UDC A;  3PTW A;  3K58 A;  1IBK F;  2PN6 A;  2NRE A;  3BYP A;  4DL5 A;  2HAF A;  2XY5 A;  2MMY A;  3R9L A;  2FC8 A;  4PR6 A;  1OYE A;  3Q23 A;  3PV8 A;  2IA6 A;  2X1G A;  1TL7 A;  5D77 A;  3DGP B;  3DHX A;  3Q8V A;  3M8Z A;  2KFY A;  2M88 A;  4DL0 C;  4NXM F;  3ETM A;  1U49 A;  3R3T A;  2F65 A;  4WBF A;  3S1T A;  5CYQ A;  2UVW A;  4FBT A;  1RBO B;  1PBA A;  4CNY A;  2GNK A;  4ID5 B;  2HFO A;  2Y8Y A;  3C6T A;  1U45 A;  4F04 B;  2OEJ A;  4B02 A;  2HHT A;  1S57 A;  8AT1 B;  1YTY A;  3MAH A;  1HAR A;  3R5C A;  3NCP A;  2IJR A;  1UVI A;  3R5J B;  5LSO A;  3ZTP A;  1T9X A;  5KFT A;  1W2I A;  4KY3 A;  4EGL A;  1FNX H;  1UJ5 A;  2WAQ D;  2VFT A;  3GIL A;  2JFK A;  1Q86 T;  2YPY A;  1VQO S;  4A48 A;  4JV2 A;  7FDR A;  1ZH5 A;  3D67 A;  3QAU A;  2BOP A;  3ILL A;  2BV3 A;  3UWT A;  4ZIW A;  3ILI A;  4QPX A;  4LF8 J;  3MEC B;  1TKZ B;  3TR5 A;  3DLG A;  4IOC Q;  1F0X A;  1UW4 A;  4JI8 J;  1UKU A;  1CS4 A;  4E0D A;  1YI2 S;  4NOH A;  2GVZ A;  3R5B A;  3ZZO A;  3KUG A;  1FA0 A;  4NLY A;  5J1E A;  3KDO A;  2HNZ B;  1CC7 A;  4Y2A A;  2VBY A;  3OSP A;  2HQI A;  2QRR A;  3OR2 B;  1EAY C;  4D3H A;  2KU7 A;  4DL3 A;  2D3O R;  4CM0 A;  1FWL A;  1NHV A;  2Y8W A;  1ZAW A;  2KL8 A;  1RI7 A;  4DSF A;  4B3R F;  2X3D A;  2ZC4 A;  2CAD A;  1T03 A;  3EM1 A;  3DMJ B;  3FBC A;  4PG8 A;  4DV6 F;  3HO1 A;  1FRH A;  3RZA A;  1R6V A;  4WK1 A;  4AL7 A;  3KTQ A;  4USK A;  1J2V A;  4BC7 A;  3HI9 A;  1IBL F;  1TKD A;  4LSN A;  2MY8 A;  2LQJ A;  5CH7 B;  2QLW A;  3LWL A;  5HMZ A;  3W7B A;  1YRU A;  1VLY A;  4A8Y A;  3EPG A;  4K5R A;  3RTV A;  2UP1 A;  3QT5 A;  1HHS A;  4L75 A;  4IRC A;  4J90 A;  2Y0B B;  1XMB A;  3LA0 A;  5BR8 J;  2UUB J;  3KLF B;  4YP3 A;  2RDJ A;  2FVR A;  2ZKT A;  2WW4 A;  2JH3 A;  1G1X A;  1FDA A;  2DY1 A;  2QMX A;  5DG9 A;  4B3M J;  3GQC A;  1WC1 A;  2YY3 A;  1F60 B;  5MLC V;  2NXU A;  4V1A k;  4JI7 F;  4DX6 A;  5FDL B;  5J1P A;  4K4U A;  3NNC A;  1WSV A;  3TUP A;  3MFI A;  2OIH A;  1Y00 A;  1UJ4 A;  2J5A A;  1KKH A;  4P9S A;  5IM0 A;  1H2U X;  4JP8 A;  4NA3 A;  3D6T B;  3PO4 A;  5KFK A;  1VRT B;  4CQ1 A;  1WSR A;  4ZLN A;  3PYG A;  1N34 F;  1YJV A;  4NXN J;  2FC9 A;  4KT0 C;  4YB7 A;  3MMA B;  1NM2 A;  1OY6 A;  2HWH A;  2VPX B;  3GLJ A;  1M90 T;  2EFN A;  3ZTO A;  2XZD B;  1HR0 J;  4OYZ A;  2B9Y A;  2FTR A;  3VAH A;  2WB4 A;  4IDK A;  2NPF A;  3A3P B;  4LFB J;  5BYS A;  5M2P A;  4Z7Y A;  3NGT A;  2VFU A;  2L9W A;  3OV7 A;  1XNQ F;  1KVI A;  1ZM2 A;  2VG6 A;  1FTR A;  4ECQ A;  2WVE A;  2PI5 A;  4U96 A;  4CYU A;  5B0B A;  1X4H A;  5EHH A;  3J7A N;  2YNI A;  1R6Y A;  4NLU A;  2W2P P;  3W5Z A;  5ETK A;  2QSW A;  1SBR A;  3MI7 X;  2Q1L A;  2ZBP A;  3M8Q B;  2H65 B;  4URQ U;  2Z57 B;  3EZO A;  4PXB A;  2OMO A;  1I94 J;  3JSB A;  1Y5I B;  4ZHR B;  2HRU A;  5KG1 A;  1H72 C;  1OYD A;  2XTJ P;  1HMV B;  1V6H A;  5IT0 A;  1IKV A;  1U25 A;  1Z2L A;  4F7V A;  3U1L A;  1HQ2 A;  2FIU A;  1F9F A;  1CBK A;  2ASL A;  2BMB A;  5DDR C;  3SIP B;  3WQP A;  1S99 A;  3QAE A;  3IS9 B;  3TAQ A;  5GAE U;  2HGM A;  1N5Q A;  2HBQ B;  1A9N B;  3K5N A;  4CP5 A;  5HVF A;  3ELH A;  2EW9 A;  4NCA A;  4M5J A;  1ZM3 A;  2CIM A;  5E3R A;  4DV1 J;  2IIH A;  3H2U B;  3UI3 A;  2J0Q D;  5C25 A;  1F5A A;  3FBF A;  3OSN A;  3W62 A;  1P1L A;  4F4Z A;  4AYB D;  2I2Y A;  1UTA A;  1M1K T;  2GVD A;  1T94 A;  1WOP A;  3QZ8 A;  1YVF A;  4WYW A;  3D68 A;  1FF2 A;  3AT1 B;  5G0R A;  1CJK A;  4ZPT R;  1T7P A;  3MPU B;  2XUL A;  2CG8 A;  4LRA A;  5L9X A;  4FP9 A;  3NS5 A;  4IH5 A;  2C2R A;  3VVT A;  1VBX A;  2EBE A;  3VAL A;  5A8K A;  2UXD F;  4KKO B;  1KOH A;  3V5R A;  3EGW B;  2FHM A;  1JNR B;  5KFV A;  2ZWO A;  2W24 A;  2J9E A;  2MEW A;  4I7F A;  5EWG A;  2OEM A;  1U7L A;  4P2F A;  4RW4 A;  2HS4 A;  2KHD A;  2ZM6 F;  3VAG A;  1HIY A;  1BC6 A;  3HHL D;  4QIV A;  3BGF A;  2XO7 A;  2L08 A;  5FLX U;  1RHM B;  4OYO A;  4J7C A;  3A4T A;  1X60 A;  1XMO J;  1V5I B;  5H9F J;  1MNE A;  3SQG B;  2VG7 A;  1HYS B;  3JSR A;  2B9X A;  4P75 A;  4MKY A;  2F9D A;  4YS2 A;  1KC8 T;  2WZ1 A;  3CO0 P;  2DR9 A;  3HFZ B;  3HSZ A;  3DRP B;  1NK8 A;  1QAJ A;  2DO4 A;  5DM6 Q;  3KDN A;  3OR1 B;  3W65 A;  3MTK A;  1PYT A;  2G0J A;  2CQH A;  4CWB A;  3O3L A;  2CPI A;  4DXL A;  3OFG A;  3MOJ B;  1K44 A;  4N7T A;  4O3S A;  4YHH F;  5B0G A;  2R7U A;  1RAH B;  2VON A;  3MZI A;  3R2C J;  1HQU B;  3HMJ G;  1URR A;  4DF4 A;  4R8U B;  4DUT A;  5BYR A;  3G8T A;  4X62 J;  3PXG a;  3CJ5 A;  5DQG A;  2DXF A;  1YRT A;  3ITH A;  2P9C A;  1TVR A;  4WE1 A;  3CC4 S;  4JI1 F;  2CRL A;  1TTH B;  3B6B A;  3ENV A;  2UUW A;  3O6Q A;  2Z2M A;  1N8R T;  4IG0 B;  1N33 J;  1N5V A;  2FVP A;  3ZNJ 1;  2DNL A;  5M2U A;  3QGH A;  2GJI A;  4TNO A;  2M9K A;  3FMW A;  1IKX A;  3CT9 A;  2VAS A;  3POT B;  2EFV A;  1KFD A;  4WYL A;  3O1L A;  3WIV A;  2YX1 A;  3V81 A;  5GAE I;  1HLW A;  2B4U A;  1Z1Z A;  3LUY A;  1U09 A;  3NRB A;  5E7O B;  2HKE A;  1FDN A;  3AQP A;  2EC2 A;  4BC9 A;  5L9N A;  3VF0 B;  2JEF A;  2G0I A;  5HQL A;  4MAK A;  3HFV A;  4DR1 J;  1J5O A;  2KI2 A;  4TU7 A;  4U7U K;  2IDE A;  4TLQ A;  4B9U A;  2YBV A;  5FII A;  4QWB A;  2XZT B;  4MFB B;  3CJ3 A;  4ZVS B;  4WF9 Q;  5KAK A;  1I6J A;  2B5J A;  3H40 A;  4Q7A A;  3K89 A;  4U6P A;  5J2P A;  1TL5 A;  2G4B A;  4LFA J;  2QA1 A;  2W9C A;  2WOM A;  2LQ8 A;  3NWG A;  1S1T B;  5GMD A;  1BGX T;  4C8M A;  3ZTQ A;  5DG7 A;  5KTQ A;  3ET6 A;  4Y2K A;  2V50 A;  4ED7 A;  1HBN B;  4NPO A;  5KG0 A;  5D0E A;  1GX6 A;  4F50 A;  3IAS 9;  3TO8 A;  5DQH A;  4A8M P;  2OLW A;  1WF0 A;  2LXI A;  2B6A B;  4IH6 A;  4DEZ A;  1ZPV A;  3QGG A;  4J9M A;  1XQI A;  3TRG A;  3G2X A;  4J9R A;  2BE9 B;  1LWX A;  1WC5 A;  4WIQ A;  4IFV B;  4FXV A;  4TY8 B;  1C1B A;  1FO1 A;  5K14 B;  2C3M A;  2V67 A;  3CCT A;  3FSI A;  3OJS A;  2AYM A;  1VQ4 S;  2G1D A;  5FLX Y;  2IPO B;  1RT3 B;  5JUM A;  2CQ4 A;  2FHJ D;  3MMC B;  3BQ0 A;  2ZNY A;  3LP0 A;  3RBZ A;  1N4L A;  3LPY A;  3PAC A;  4H4M B;  3W61 A;  1SKR A;  4P73 A;  4UZC A;  3P6Y C;  2HRT A;  3HZG A;  3SMZ A;  5HRO B;  4ECX A;  1C0U B;  1RBA A;  2WHO A;  3FBB A;  1VQ9 S;  2MB0 B;  2FVS A;  2HZV A;  2XSJ A;  3DOK B;  2EG2 A;  2IBO A;  1V3S A;  3TQE A;  1TK8 A;  2ZZM A;  3AH6 A;  2RF2 B;  3OXG A;  3EGN A;  2NR0 A;  4CLP A;  2RUG A;  2KRB A;  2K1R B;  1TL3 A;  1RT7 A;  1SI9 A;  4EI2 A;  2ZBC A;  2VD3 A;  3M32 B;  5B0F A;  2XNR A;  1C0T A;  3TOQ A;  3NGD A;  3CDU A;  1SXL A;  3OL6 A;  2E1A A;  1NEE A;  4LQ3 A;  4DFK A;  1B64 A;  1GTH A;  1EAR A;  4DX8 H;  3OVB A;  3I9V 9;  1RA6 A;  1ULR A;  3DLJ A;  2AHO B;  4FF1 A;  1AUS L;  3K8W A;  1ZAX A;  4KV8 A;  3GG1 A;  5MAO A;  4J9P A;  3NGU A;  4MIW A;  2MKH A;  1GK8 A;  1TV6 A;  4WFZ A;  2Z4P A;  1TL7 B;  4F25 A;  3M6V A;  3LAM A;  1DLO A;  2LCW A;  5GAH U;  3IM8 A;  3R97 A;  2HHH F;  2BKP A;  3OFE A;  1WD6 A;  1YIJ S;  2C22 A;  1I5O B;  4ZK7 M;  3BSN A;  1UVN A;  3BBF A;  4UT4 A;  3H59 A;  4C3M A;  4RX6 A;  4I2P A;  1TK5 A;  1WI8 A;  1NHU A;  3C6T B;  4U9R A;  3UO0 A;  2MSS A;  4OI3 A;  2DNH A;  2CJX B;  1Z4U A;  4R5P A;  3M8S A;  3M2U A;  3RAM A;  2ALZ A;  2OPS A;  1EET B;  2V2Z A;  2XMW A;  1MU2 A;  4LSL A;  2DPI A;  2ZEJ A;  4NWB A;  3TAP A;  1YBU A;  1U1P A;  5D4O A;  2V34 A;  1VS3 A;  2B7C B;  4UOF A;  1JLQ A;  1VQL S;  3EZU A;  1BUX A;  1I51 B;  2BJ9 A;  2FJX A;  1M5V C;  4AXJ A;  1YJU A;  2FJB B;  3GU0 A;  3DLG B;  3EUN A;  2AGQ A;  1FVS A;  4IFY A;  3OJU A;  1CS4 B;  2F1F A;  2L48 A;  1CQM A;  3QPI A;  3IO1 A;  3PCO B;  4GO5 X;  2P6S A;  5J1E B;  2UUA F;  3LGN A;  3PHE A;  2L41 A;  2BR0 A;  1NJY A;  3B54 A;  2HS3 A;  3BV8 A;  1WC3 A;  4N47 A;  2HGL A;  5IS2 A;  3MCO A;  3MF5 A;  1RT5 A;  1X7V A;  4N41 A;  3I4H X;  5ETM A;  4X66 F;  1RA7 A;  1T03 B;  1QVG R;  3FJ2 A;  5EGY A;  4LF4 F;  4OV1 A;  3SV3 A;  5AE1 A;  2HHX A;  4DG1 A;  5CCL A;  4B3T F;  2DR6 A;  5J2Q A;  2CDQ A;  2DNZ A;  4ICL A;  4LSN B;  2ZH9 A;  2YNH B;  3ZTR A;  2BJE A;  3VQS A;  1SPB P;  3NOG A;  1Y5L B;  5ETP A;  3JYT A;  2HMI A;  1OY8 A;  4FYY B;  3G82 A;  2VF3 A;  5HLF A;  2RQC A;  2K8G A;  3CD7 A;  4ZJO A;  2EC0 A;  2XYG B;  1FDB A;  3U02 A;  3HD2 A;  3CGI A;  1B7F A;  4JV5 F;  2HFV A;  5E41 A;  4XPE A;  2UUC J;  3DI6 A;  3PRD A;  2FGO A;  2IAJ A;  2RKI A;  5GAH I;  4NZ7 A;  2AKW B;  3TJA A;  4K4S A;  1X9W A;  5KFI A;  2MPU A;  5F8M A;  3OBI A;  2NCK L;  3T19 A;  5A0Y A;  3M1V A;  3GV5 B;  2B43 A;  2RQK A;  1M5K C;  2JLG A;  1UPM B;  1NBE B;  2KYZ A;  1CEZ A;  4LRB A;  2AJF E;  1VIS A;  5B0C A;  3E3X A;  3QZ7 A;  1WTF A;  1HBO A;  3PYE A;  2R2U A;  3CXC R;  4ZPC A;  4OHV A;  1UVK A;  4K8R A;  4P2M A;  4OI2 A;  1QAY A;  4P10 A;  2AZ3 A;  3RG6 A;  2I5J A;  3IWL A;  4IDK B;  4LVO P;  2E9R X;  1E6Y A;  1FXR A;  3CB4 A;  3C6U A;  3Q8Y A;  1XMQ F;  3EZ5 A;  2R7W A;  3U1N A;  3KLG A;  1F1B B;  1WF2 A;  2QL7 B;  5B0E A;  4JUZ A;  3GP9 A;  4USM A;  1B0P A;  4W98 A;  1FD8 A;  1B7Y B;  1RWV B;  4V19 X;  2BKO A;  1URN A;  2FJW A;  3PJX A;  3G71 S;  5LMU F;  3R7B B;  1NKB A;  2B9W A;  1F3F A;  4A8F A;  1RHK B;  4QU6 A;  2YNI B;  1SJQ A;  1FJE B;  1T3O A;  2OML A;  3W60 A;  3CCR S;  4Y00 A;  3HSJ A;  3M05 A;  5E3P A;  2KB2 A;  3TI0 A;  2KXN B;  3GYX B;  3NCR A;  3CDW A;  3HHL C;  4ZMM A;  4F02 A;  1F5C A;  1OS5 A;  5AT1 B;  4DSL A;  1HPZ A;  4LQ9 A;  3OLB A;  2AJ1 A;  2X1F A;  4RUH A;  3L4B C;  4L6V 3;  5DDQ C;  1UFW A;  2G13 A;  5DJB A;  4GO7 X;  3FC9 A;  1JNZ B;  2RAQ A;  4RW7 A;  4ZS6 A;  4HTI A;  2XI3 A;  1IKV B;  4FVC A;  1IKY A;  2NXE A;  4HDH A;  5DQI A;  1M0S A;  1Y11 A;  2FY8 A;  2OEK A;  3R1H A;  3Q2S C;  2JNJ A;  1NJX A;  1K8A T;  4DR2 J;  5C24 A;  4KHP F;  3I5A A;  3R5D A;  3BGO P;  1QSL A;  1D8Y A;  3GIR A;  2DNR A;  2QFI A;  1Q53 A;  3H4B A;  1FVQ A;  2W01 A;  3SI8 A;  2EPI A;  2B51 A;  2R4F A;  3SDE A;  1CLF A;  3JSY A;  3TEH B;  5C25 B;  4FNI A;  4LF5 F;  3BGL A;  2F40 A;  3GWC A;  5GAD U;  3QT7 A;  5HP1 A;  3RW6 A;  1IBM F;  4DMZ A;  5G0R B;  2QLF B;  1CJK B;  5KT6 A;  2BJ7 A;  1LKZ A;  2M4M A;  4XIU A;  1JLB A;  2H48 B;  3BM7 A;  3AD8 C;  5F8G A;  3AJ1 A;  4UY8 5;  2AIR B;  3M2R A;  5A8K B;  4P7T A;  3O44 A;  3OPK A;  1NK0 A;  2XMU A;  3S01 A;  4ZLP A;  1F5B A;  3A3N B;  4I7F B;  2NUH A;  2ZH1 A;  3HVW A;  4RW4 B;  4KRW A;  1FFS B;  2CZ4 A;  2Y1J A;  2V63 A;  1X4E A;  4YN3 B;  1VMB A;  3A8I A;  1X9M A;  3UD3 P;  3QFW A;  3T1H J;  4MMO A;  3M8R A;  3W2V A;  2VIH A;  4PWW A;  1M5O C;  2QL9 B;  2VG7 B;  1AXQ A;  2VPZ B;  5U47 A;  1ICE B;  2AEM A;  2MKS A;  2W25 A;  3JS9 A;  2GIR A;  4DPU A;  4QWD A;  5E3A A;  1SJ4 P;  3TZZ A;  4JYA J;  4WCE Q;  5DDO C;  1NJW A;  1RZM A;  4BS2 A;  4K0K J;  2PFD A;  4B3O A;  2DNQ A;  3PIO Q;  4RZR A;  2G2Z A;  3CCZ A;  2JJ4 D;  2WW8 A;  1N5S A;  3ZZ0 A;  3PJW A;  4Y2M A;  4P6Q A;  4BWM A;  4ED6 A;  1RWN B;  2BEF A;  2OUG A;  4NI2 A;  3A3O B;  2GHP A;  2KH9 A;  3CSK A;  2XHC A;  5KFB A;  3M9N B;  3ITH B;  1S6U A;  4ELV A;  3DU6 A;  2MQO A;  1TVR B;  3JSM A;  4WE1 B;  2EFQ A;  3VGU A;  3MD1 A;  2VQE J;  4RBV A;  1R0A A;  3BN7 A;  3E01 B;  1HWU A;  4G1P A;  2YNG A;  3W9J A;  4LF1 A;  1KLN A;  1GMU A;  4D3G A;  4ED4 A;  3G6E S;  4X84 A;  1BQX A;  4PEO A;  3J80 U;  2B4O A;  3EYZ A;  2YWE A;  4ZVR B;  3CF5 Q;  4FYD A;  1X8D A;  3I5C A;  1BWE A;  1LWF A;  1J5O B;  2OJ3 A;  4ECT A;  4TLR A;  3C16 A;  3DOM A;  2K3I A;  3DLE A;  3PY8 A;  4QQB A;  5GAD I;  4RWW A;  2YWF A;  5KT4 A;  1C4C A;  1PYO B;  2B5J B;  1FWK A;  2VQF F;  4DUY F;  2DHH A;  5J2P B;  1T95 A;  3UCG A;  2N4C A;  4AE5 A;  1BWV A;  1UW9 A;  2W9B A;  4PUO A;  2V68 A;  2W9C B;  2ROE A;  2WOM B;  5D0R A;  4K4W A;  1W7W A;  3CED A;  2I38 A;  1TL1 A;  5ETN A;  4A8S A;  5KG3 A;  3ET6 B;  2JWN A;  3V6K A;  2PE8 A;  2LXF A;  2FUG 9;  2W7P A;  4DU8 A;  3LW5 C;  4QJV A;  3H90 A;  4RW8 A;  3EPI A;  3RAQ A;  1KBR A;  2AEJ A;  1LW2 A;  4UUW A;  1VK3 A;  1X5O A;  2DGQ A;  2HHS A;  1FRL A;  4JI3 J;  4TY9 A;  5IWA F;  1Z2Z A;  4LRE A;  2WBM A;  4DQR A;  2OSR A;  4Y2C A;  2E9Z A;  3D1Q A;  2IM2 A;  1H7W A;  1NB2 A;  3OVS A;  3P3D A;  4O23 A;  2FB0 A;  3M9M B;  5KFF A;  3BSA A;  4GMK A;  1C1B B;  1IJE B;  1NZ8 A;  3IWX A;  3GV7 B;  4M63 A;  3R5A A;  3DOL A;  4DQI A;  2HK2 A;  5KG4 A;  4C8N A;  3LP0 B;  2XYH B;  2RQ4 A;  4MYU A;  3QIP A;  2XHW A;  4JI0 F;  4TQS A;  2V5H G;  1NSP A;  3A13 A;  2GV1 A;  4W90 B;  1UMJ A;  3ADA C;  2F8E X;  2DTJ A;  4EZ6 A;  4DFJ A;  4LSZ B;  3IRW P;  2D1C A;  2IC3 A;  4MIB A;  3K5P A;  3N79 A;  1FRK A;  2Q3P A;  2K06 A;  3K0J A;  3QO9 A;  3TUZ C;  5JXS A;  5KOW A;  4S0M A;  1U26 A;  2BJ3 A;  2ADB A;  3M6U A;  3WX8 A;  4DSI A;  4ALZ A;  3HHD A;  1VJQ A;  3PR5 B;  3JQJ A;  1TL3 B;  4B9T A;  4ECU A;  3CUN A;  2IRX A;  2J6T A;  2R7V A;  1MG7 A;  1NLK L;  1UFL A;  1MWZ A;  1U02 A;  1R8B A;  3H42 A;  1FJG J;  1H2T Z;  2P8I A;  3F41 A;  2XMK A;  3CMQ A;  2O66 A;  4KV8 B;  4DR7 J;  2B0G A;  1K73 T;  5BYQ A;  3EWG A;  3DU5 A;  3G87 A;  2RNE A;  3J80 Y;  1S49 A;  4J5O A;  1W26 A;  3WC0 A;  3A1Y G;  1WOR A;  1U1M A;  1DLO B;  2C2K B;  3I32 A;  1U2C A;  1LW0 A;  2DB1 A;  2K7J A;  4DV6 J;  2F7V A;  2DPJ A;  1VC0 A;  1SIZ A;  2EFP A;  3HVT B;  4C8Z A;  2XY7 A;  4I2P B;  2YNF A;  3C14 A;  2N3O A;  4FYW B;  1RCO B;  3BPD A;  4UZB A;  4KHM A;  2BJ1 A;  2OFH X;  4CO0 A;  2E7X A;  3AD9 C;  4R5P B;  3TVY A;  3M2U B;  4TQR A;  1SL0 A;  1VRU A;  1MU2 B;  1YRX A;  3HM9 A;  4LSL B;  3RBX A;  2R7S A;  3LAL A;  3GR1 A;  2P9G A;  4N8N A;  4U67 Q;  5A8W A;  3DRY A;  4DQP A;  1JLQ B;  1FDD A;  5T7L A;  3DYA A;  4J9N A;  1NK7 A;  1ACM B;  3FUY A;  4OJH A;  2H1Y A;  3FRZ A;  4YEA A;  3X3U A;  1QUP A;  2ZOG A;  1S1V A;  4RBU A;  4K59 A;  4RNM A;  3QID A;  3SCL E;  4IFY B;  4CT8 A;  1BQM A;  2FYX A;  3FNN A;  4C7Q A;  1U1L A;  2P6T A;  1APS A;  1YX2 A;  3UDL A;  3VAI A;  1T9V A;  1T05 A;  4YR3 A;  2HVE A;  2DO0 A;  3CJK A;  2FGC A;  2V4R A;  1GFW B;  2AEF A;  5AXK A;  2IDL A;  2NSC A;  1NDK A;  4X4U A;  3MUR P;  1RT5 B;  3G8S A;  4DFM A;  3CIM A;  3U1M A;  1ZM4 A;  4DV7 F;  5AXN A;  2ZD1 A;  4DG1 B;  3TP2 A;  2ZBQ A;  5DM7 Q;  4ZKA A;  1RQ0 A;  1FKP A;  3VAM A;  5J2Q B;  5GME A;  4OIX A;  5I3U A;  1ZTT A;  4ED8 A;  3BEG B;  4DR3 F;  4JI5 F;  3I96 A;  1Q7L B;  2IVM A;  1XNQ J;  4DSE A;  2YX4 A;  4ZVU B;  4WFN Q;  1NKE A;  2AT1 B;  3JYT B;  2HMI B;  3G82 B;  3H2L A;  5HLF B;  2RDD A;  1Q8K A;  4OYM A;  4AD6 A;  1KON A;  1FER A;  2CDR B;  1RWU A;  2AMC B;  2HRY A;  2UXC F;  1RAB B;  2QZ8 A;  4K4Z A;  3HF5 A;  3HPO A;  3VR1 A;  5EUH A;  2C28 A;  2GIF A;  3M9O B;  2R7O A;  1BHN A;  1K1Q A;  4HHU A;  2R8I A;  3BKU A;  3TVZ A;  2DXE A;  2IAJ B;  2RKI B;  1V5V A;  1S6Q A;  4EO6 A;  1NME B;  2D3O 1;  1OO0 B;  1SV5 A;  2J9D A;  2GA7 A;  2BE2 A;  3KLI A;  4CLY A;  5A0Y B;  3LTO A;  3M1V B;  4DR5 J;  4H4K A;  3T5K A;  1RLD A;  4J91 A;  4ZLL A;  1NSQ A;  4PQU A;  1NH7 A;  3UW1 A;  3CJQ A;  4M5L A;  1WF1 A;  4XDD A;  3H7H B;  1HBO B;  2ZBR A;  2E9T A;  1CQN A;  2HBY B;  3D1O A;  3KHH A;  3TNV A;  2CWX A;  3L7O A;  5D0H A;  2H5J B;  4QWE A;  3T6B A;  4LUB A;  2I5J B;  1UL3 A;  2O01 C;  5KFX A;  2MJU A;  1KOO A;  3EVO A;  1E6Y B;  4R25 A;  4OYB A;  4JI2 J;  2HQ3 A;  2HNY A;  2JX2 A;  3KLG B;  2XLJ A;  3K5L A;  4H54 A;  3SFG A;  2DIU A;  1X0P A;  4KQZ A;  2LFV A;  3TJ8 A;  3MEE A;  5HBM A;  2XG8 A;  3ZZP A;  4JV1 A;  5ETT A;  4QOT A;  1CSJ A;  4HVZ A;  3NG8 A;  1VGY A;  1X4F A;  1MW7 A;  3N28 A;  3BQ2 A;  2EXU A;  3CD0 A;  5CQG A;  3KUH A;  3BBC A;  3W8G A;  4ATN A;  5JVG Q;  3NWR A;  4X4S A;  3ZZY A;  1FKO A;  1H73 A;  4LRD A;  2HHQ A;  3NY0 A;  1PJ6 A;  4RUB A;  3T5J A;  3MR3 A;  1RGV A;  2AJ0 A;  2QMU B;  4C3L A;  1IKY B;  2HG4 A;  4AXI A;  4C0O C;  2OPQ B;  2NYH A;  4RNO A;  3AD7 C;  4RPF A;  2LA4 A;  4WFA Q;  4PAB A;  3TZY A;  3KLH A;  4C0B A;  5DGB A;  2R2T A;  3HHE A;  3LWM A;  2Z0G A;  2MQQ A;  4F3O A;  3SDE B;  2LQB A;  1TKX B;  3PZP A;  3DC2 A;  2ZDP A;  1SH0 A;  2XLI A;  2VG5 B;  3VAJ A;  3DXB A;  4NLX A;  4ILR A;  5HP1 B;  3RRK A;  2FPH X;  1DRZ A;  3TAR A;  5LXY A;  3CDE A;  1RHJ B;  2QN6 B;  1TUV A;  1RWM B;  4ZCL A;  2MJN A;  1JLB B;  3OFF A;  3IC1 A;  2OI2 A;  3QSY B;  2UU9 F;  4PPZ A;  3VGS A;  5C42 A;  2NXJ A;  4X65 J;  3M2R B;  2RVJ A;  2N3L A;  1DFD A;  1JK9 B;  2LQ5 A;  4KYZ A;  3TAN A;  3QJL A;  3GON A;  5CD4 A;  4NMX A;  4B9N A;  2MTL A;  4UY8 T;  4Y2I A;  3PO5 A;  5HVG A;  3UCZ P;  1XR5 A;  3DM2 B;  1JLF A;  4CDI A;  3D4J A;  2VPW B;  2M0G B;  2V6A A;  4Q8F A;  4DLG A;  2CPH A;  3RB6 A;  4USU A;  3ZZT A;  1KHW A;  2XI2 A;  3QBC A;  2LA6 A;  1C2P A;  3MMB A;  1VQ7 S;  4NCB A;  4WP8 A;  1YKW A;  3JTN A;  5F8N A;  3OLA A;  1WEX A;  2VHG A;  1NDC A;  3QWU A;  4ZPA A;  1AA1 B;  4LF8 F;  2Z8Q A;  4OX7 A;  1S72 S;  4CO5 A;  4FYX B;  5GAG U;  4N77 A;  2BKN A;  3K17 A;  3KFW X;  4NI2 B;  2W2Q P;  3CDB A;  1EP4 A;  3L09 A;  3NMA A;  3O5T B;  3JSM B;  3CJS A;  7FD1 A;  2P2C B;  1OSC A;  4ED3 A;  2ILZ A;  1QVF R;  1BE4 A;  2QEX S;  1R0A B;  2CPX A;  4DV4 F;  2MLZ A;  4KGV B;  5HAT A;  2YNG B;  1RE1 B;  5LL6 d;  4DPY A;  3OTB A;  1U6B A;  1RHU B;  3EIC A;  2XEX A;  3TEG A;  4FPR A;  1BLU A;  3V6H A;  3JXO A;  3NAH A;  3W66 A;  1VQ5 S;  2DVI A;  5K5M A;  2ASD A;  1HQE A;  4LJM A;  1XC9 A;  1YG0 A;  3FCV A;  1NPR A;  2MQM A;  1ROF A;  1LWF B;  1JQG A;  1KLM A;  1YLX A;  3V2U C;  1RTI A;  2BBE A;  2DHA A;  3C16 B;  4UOC A;  1XN9 A;  5KFA A;  3DOM B;  3TZW A;  3VGT A;  5DGA A;  5I4M A;  4HHH A;  3V4M A;  2H5I B;  3N5B A;  4JI4 J;  1NPK A;  2W9B B;  4PUO B;  3GR0 A;  2Q6B A;  5BR8 F;  3ZZR A;  3HKW A;  4P71 A;  2YQ3 A;  1TL1 B;  5KFJ A;  5I3P A;  2RIJ A;  4B3M F;  3UD4 P;  4O3P A;  2ASJ A;  3JTO A;  1RP5 A;  3Q8P B;  2CVE A;  2F63 A;  1N5T A;  2GGP B;  1NO8 A;  4RW8 B;  3Q89 A;  5EWF A;  3ZTS A;  3QRQ A;  1K1S A;  4M5G A;  5KFD A;  3BO2 A;  2NPI A;  2CZV C;  4ZCI A;  3IRX A;  3NGK A;  4YY3 J;  1PBU A;  4J9V A;  3D2W A;  1GAO A;  3E2E A;  2WSE C;  3PYD A;  4NXN F;  1S4E A;  1S6P B;  3UFC X;  3DOL B;  1G4C A;  2HFZ A;  3UPF A;  2NQP A;  4CT9 A;  2GFF A;  1GTE A;  2KVQ E;  2GW8 A;  2HHH J;  4QWC A;  1WEL A;  2MZ1 A;  3QIP B;  4YR0 A;  4LFB F;  4TYA A;  4WU3 A;  3EDQ B;  2XGQ A;  2FLN A;  2A2C A;  4Q45 A;  2ZOM A;  3K5O A;  1S5Z A;  4RWX A;  4NLV A;  1Q82 T;  5LOQ A;  3KUE A;  3UNG C;  2IC3 B;  2R2R A;  5GAG I;  1PJ7 A;  3J81 j;  1MN9 A;  3VHQ A;  4DUZ F;  4KH1 B;  2DNO A;  2W2O P;  4C3K A;  4EEY A;  5BJR A;  2GAH C;  1PAU B;  3CD5 A;  4QU7 A;  2E7W A;  2HS0 A;  1S6O A;  3QO9 B;  2M52 A;  2E1C A;  4KH0 B;  1G7C B;  1X4D A;  3Q8U A;  4KPY A;  4PWU A;  1BY9 A;  1CJU A;  1B4S A;  4FNH A;  2FZC B;  1KS2 A;  1I94 F;  2B8P A;  1VCT A;  3F73 A;  2HBR B;  4LF6 F;  1JIH A;  1IXK A;  2IM1 A;  4OZ2 A;  2PT0 A;  4ED0 A;  4CLZ A;  1X31 C;  2OO4 A;  4Y3C A;  2X51 A;  3PG9 A;  1KP6 A;  2XCA A;  2Z58 B;  1DTT A;  4MH8 A;  5E3C A;  3KG1 A;  4ZOS A;  2MDA A;  5A8R A;  3QMQ A;  4K4Y A;  1S0N A;  3QJP A;  4X64 J;  3T1Y J;  2RS2 A;  1RTZ A;  2R7Q A;  3CIZ A;  5C7P A;  4OYX A;  4J37 A;  1D0E A;  1VR6 A;  3JB9 k;  2K3K A;  2E66 A;  3CCV S;  2LDI A;  4DV1 F;  2HZC A;  4FXW A;  1LW0 B;  4QWA A;  3DDI A;  1EJ7 L;  1HW9 A;  3GSD A;  1YIT S;  2OD6 A;  3FGV A;  3KJV B;  3R2D J;  1NAQ A;  1L3K A;  3H5S A;  2DNM A;  3HLU A;  2WON A;  2YNF B;  3C14 B;  2AF6 A;  5DZ6 A;  1HI0 P;  2C42 A;  4GC7 A;  1JJ2 R;  1WDD A;  1KD1 T;  4DS4 A;  3DRX A;  1KNZ A;  3MR6 A;  3MPD A;  4DLE A;  1WHV A;  5F3Z A;  3BSO A;  2X1A A;  2PD1 A;  4HT5 A;  1FK9 B;  2A6M A;  2DGO A;  3FQL A;  4NEY A;  2IJN A;  1I3O B;  1RT2 A;  1FXD A;  2UVV A;  4ANC A;  5IC6 B;  3JTP A;  3R6G B;  4FKX A;  4NLQ A;  5CA5 A;  4LT6 A;  5T7L B;  3DYA B;  4LBH A;  1PC5 A;  1HNX J;  3MR5 A;  2WK4 A;  1XR7 A;  4USW A;  3GV8 B;  2BE7 D;  3HZE A;  1KSP A;  3F44 A;  1S1V B;  4C8O A;  2IM0 A;  1J27 A;  4QIF A;  3NXZ A;  2O1P A;  4ED2 A;  1XMO F;  3VGV A;  5H9E K;  4DQQ A;  4P74 A;  4HL9 A;  4USI A;  1UAW A;  2VUG A;  4YDD B;  1JJH A;  1RT4 A;  3TVK A;  3R6L B;  2VFS A;  5AXL A;  1T05 B;  2COL A;  2GQC A;  3K59 A;  3LP2 A;  1YGY A;  1EQ0 A;  3EX7 B;  4YME A;  3CJK B;  4WPA A;  1UZD A;  1RTH A;  2L9N A;  4B9V A;  4GKJ F;  2DXD A;  4NE9 C;  1NKC A;  2AYB A;  3M2V A;  3J7A 1;  2HHP A;  2ZD1 B;  1WTB A;  2MGZ A;  4WK3 A;  4OX9 J;  1FKP B;  2B56 A;  4WKY A;  1TUW A;  5I3U B;  2DHX A;  4NL5 A;  4X62 F;  3BH7 B;  4O3R A;  2LEC A;  3LGH A;  1RHQ B;  2DY9 A;  4OZ1 A;  4QW8 A;  2QA2 A;  4MKV A;  4NLS A;  1KHV A;  2MZR A;  3RJM B;  4PKD B;  2QL5 B;  1QY7 A;  1Q7Y T;  3OUY B;  4TKT A;  4X4P A;  4O44 A;  3CCJ S;  4KHR A;  3WC2 A;  2Z30 B;  1U1N A;  2RHS B;  3R7N B;  2XO6 A;  1H2V Z;  3PHT A;  3MM8 A;  1Q78 A;  4M5H A;  4C6A A;  5D4L A;  2J6S A;  5LM7 E;  4WZM A;  4CLF A;  2GMJ A;  2HK3 A;  2IRU A;  1EQM A;  2LVW A;  3L95 X;  2BQU A;  3CTR A;  1RCX B;  1OY9 A;  3FSY A;  2CZ9 A;  1XER A;  4UST A;  3BKF A;  3ZXW A;  2OPR A;  3UVJ A;  3KLI B;  4CCH A;  2DNG A;  2QC3 A;  2PO4 A;  3CCM S;  3MFH A;  4ITS A;  5LMN J;  3U7J A;  1B70 B;  4PQU B;  3K57 A;  4NLR A;  4NAS A;  1D9F A;  4LFA F;  1WDT A;  1U0H A;  5HMX A;  4J9U E;  1UWB A;  4DX7 A;  4EMD A;  3LAN A;  4TYB A;  3KHG A;  3SSQ A;  3IP0 A;  2HQC A;  2HNY B;  1YK9 A;  1S59 A; 
#chains in the Genus database with same CATH homology
 1IM6 A;  1KBR A;  2CG8 A;  4M5K A;  4CRJ A;  3HT0 A;  5ETN A;  2F65 A;  4M5G A;  4M5M A;  5ETQ A;  4F7V A;  3HD1 A;  3QBC A;  1EQ0 A;  1HQ2 A;  1EQM A;  3ILJ A;  4M5N A;  1RU1 A;  4M5J A;  3MCM A;  3HSJ A;  1CBK A;  1TMM A;  3HCX A;  3HSG A;  5ETK A;  4CWB A;  5ETP A;  4M5I A;  2BMB A;  1G4C A;  1RB0 A;  3MCN A;  1RU2 A;  3UDE A;  3UD5 A;  5ETR A;  2F63 A;  3KUH A;  5ETO A;  3ILL A;  3KUG A;  5ETS A;  3ILO A;  2QX0 A;  1DY3 A;  4PZV A;  3HD2 A;  1TMJ A;  3MCO A;  4M5L A;  3HSD A;  1Q0N A;  3IP0 A;  3ILI A;  5ETV A;  1HKA A;  4M5H A;  5ETT A;  5ETM A;  3KUE A;  4AD6 A;  5ETL A;  1EX8 A;  3HSZ A;  4CYU B;  3UDV A;  1F9H A;  1RAO A;  1RTZ A;  4CYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...