4M5NA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
HMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5nA00
1KBRA 3HD1A 3HSJA 4M5KA 3UD5A 3KUHA 5ETOA 4AD6A 4M5GA 3HSDA 4M5NA 4CWBA 1RU1A 1RTZA 3HD2A 5ETTA 5ETVA 4CYUA 3MCOA 3ILJA 1RAOA 3ILLA 5ETPA 1TMJA 1TMMA 5ETNA 4CYUB 1RB0A 2F63A 5ETSA 3ILOA 2BMBA 3MCNA 1RU2A 4M5IA 4F7VA 3KUGA 4M5HA 4M5MA 5ETKA 1EX8A 3MCMA 5ETQA 5ETLA 5ETMA 1F9HA 1G4CA 2QX0A 4PZVA 3UDEA 2F65A 4CRJA 3KUEA 5ETRA 3HSGA 1Q0NA 3HT0A 1EQ0A 1IM6A 3UDVA 3ILIA 1DY3A 1HKAA 1EQMA 2CG8A 4M5JA 1CBKA 1HQ2A 4M5LA 3IP0A 3HSZA 3QBCA 3HCXA
chains in the Genus database with same CATH superfamily
2HQ3A 4LSLA 2FJAB 3PRDA 4PXDA 2ZOGA 4ZCLA 2EFGA 3MAQA 2BOAA 1N32J 4LSLB 2DH8A 1TFYA 3EDRB 3MMCA 4A8FA 3A3OB 3MOZA 2OEJA 4LSNB 4F04B 4RU2A 3MMCB 3OTOJ 4WWSA 2AGPA 4G1PA 2RAQA 3HDSA 1KSPA 1NJWA 3KYLA 3M8ZA 4DZ6A 2W9BB 1X4HA 3TQ1A 1E6YB 1WHYA 2XG8A 3D3CJ 4DDFA 4E8UA 5HMXA 3OTOF 3I55S 2MZ1A 4DV1J 4OHXA 2FYXA 3RBZA 5HVHA 4BS2A 2CJQA 5DS7A 5AXNA 2HZVA 2M52A 5HN0A 2HWIA 4P6QA 3TVYA 3D6TB 3PACA 5KFEA 2BZ2A 1KLMB 1P6TA 1H2VZ 2PD1A 5D78A 1XNRJ 1UKUA 4GKJJ 1M5SA 1S1WA 4L73A 4RW8A 3JS9A 1N0UA 4Q5VA 2PI5A 3MI7X 4ECSA 2D3ZA 2DISA 3KLFA 3LUYA 3PYGA 5A8RB 5BR8J 3EX7B 3UN2A 3QSYB 2ASJA 1VOMA 1JQGA 1LFPA 1P9QC 3GCWP 2DEJA 3QT8A 5E2QA 3U1LA 2K8GA 2MXYA 3VAJA 3I31A 3KHHA 5DDQC 2HVDA 4A8XA 5C25A 5HMYA 1VIXA 3DRRB 4I4BA 2DHGA 4J90A 4RBTA 3AA9A 4WTOB 1SJ4P 3D9BA 3OSPA 5J1PA 2MKIA 3OLAA 5A8KB 1QE1B 3BREA 5HBMB 4NCGA 4QWEA 2ZDOA 4DUZJ 4TYAA 2ZOFA 1RAIB 2R42A 4D3HA 4DR4F 4FF4A 2N7YA 2V8DA 3C66A 5HK4A 3QGGA 4QWAA 4J9UE 5F3TA 4C11A 4WK1A 2MGZB 1D9FA 2HZCA 2JLGA 2HW3A 4USHA 4IR9A 4MH8A 1ZZNA 2GC8A 1VBZA 2JH3A 4ZJLA 5LSRA 1U48A 3N9UC 4Q8FA 3MR7A 3CJTA 3IWXA 1DHMA 1BQNB 2OD4A 5L39A 3H20A 1X9WA 4RJVA 4AL5A 1NMEB 2VPZB 5LT5A 1Q5YA 4LQ9A 2HQCA 3FQKA 2KXNB 3M9MB 3AB4B 3QGIA 3DDNA 4PYAA 3GYNA 1JMTA 2AJ4A 2M3DA 2YTCA 3HHLA 4QIFA 1QAJA 5JMNA 3HO1A 3PYEA 1HQUA 2C2MB 5HP1B 2CPEA 2I5JA 2YKMB 4PG5A 2RRNA 5ETRA 4N47A 1IKWA 1FTCA 2I5JB 2IJNA 4KGZB 2Z30B 2V4RA 1X4FA 2QFIA 1UZDA 4C8ZA 3VGSA 3AOBA 4J9MA 3I4PA 1QUVA 2B8QA 4N8NA 2EFNA 1HHQA 1X4GA 2BANB 2BJ1A 2ZZTA 3D4JA 3HD1A 4LR8A 1YK9A 5HATA 4CTAB 2QL7B 3NMAA 4O44B 3UCUP 2QLXA 4OI4A 2KT3A 4ID8A 2Z2YB 1RWNB 3CDEA 1JLFA 1WC1A 2WSFC 3MEDB 2O01C 1FDAA 3LP0B 2IM2A 1K73T 1D9DA 4QOTA 1OY8A 4QIWD 3ZZPA 2W2PP 5L1IA 3ULHA 4JI0J 4U7CA 3EMTA 3FCHA 1RKIA 1CJKB 1UPPA 1I51B 4LF6F 4CH7A 2MKKA 4IG3A 1IJEB 4ICLB 2KHCA 3AXKA 1UWBB 3UDCA 5DDPC 4IUFA 1DFDA 4CO5A 4DXLA 3MECA 3KLHB 1RKJA 3BR8A 4X65F 3FDSA 3PCOB 2VJUA 4XPCA 3RB6A 1VQLS 1O6XA 1RAAB 2MZSA 4DR5J 1KEKA 2A6OA 3PXGa 5A2QY 1Y5LB 2KJWA 1S0OA 2JEGA 1FDBA 2G0IA 3UE2A 4CO4A 2KO1A 2X3DA 4OJGA 3M9OB 4EO6A 3WIUA 3BO2A 1JJHA 4Q45A 3JTOA 3X3UA 4ED5A 2E44A 3CD7A 1P9YA 1MROB 1FX4A 1RB0A 3EGNA 1XN9A 2M9KA 5LSLA 5AJ3J 1TL1B 1KTVA 1SIZA 1RU2A 2GCFA 1VGYA 2GAGC 2Q6CA 2SXLA 1H72C 4EI2A 2YWHA 3MM7A 4XDCA 2ZUGA 4DG1A 4LF1A 3C6TB 1OYEA 1WC5A 4NASA 2LCWA 1K44A 4TNOA 4ZLPA 1YVFA 2FC8A 2OPQA 3IGNA 1VCTA 3VGVA 2CQ0A 4DUTA 4ETXA 3L4BC 1LWEA 4HVZA 2CQDA 2I38A 5D0HA 1JKHA 5AT1B 1RTDA 3EJMA 4X2BA 1JLEB 4U8VA 5JJBA 1RTDB 4DQSA 1KHVA 2UUAJ 3KHRA 3I56S 1SH2A 2J7UA 3VGUA 3SCLE 2C3MA 3M30A 3LANA 2X1BA 2CZVC 2Y1LB 1RHUB 2KRRA 1HBOB 8AT1B 1XBWA 4CLLA 1U09A 1YGYA 2HRYA 2MQMA 3F56A 2ACMA 2FLPA 2UUAF 3CE8A 4FXWA 3G6ES 4LF5F 2QMXA 3AD8C 3FNNA 4NLSA 4FDFA 2YXLA 2BOPA 4NLYA 4C4WA 4O23A 3MFHA 2R7VA 3FBCA 2ZJPQ 2ACYA 5L1KA 2DKOB 2OSQA 1LFWA 1QAXA 2CNOB 1RYRA 1ZTWA 3CJ0A 1Q8LA 4YP3A 4G65A 2F65A 2K1RA 1U49A 1RUSA 4HDGA 2ZKUA 4U96A 1VQ4S 3IR7B 3Q22A 1GXUA 3M1VB 5LMNJ 1TL5A 1VJQA 4LRAA 3DRSA 2ZC4A 4QIVA 3H7HB 3AQOA 5GMDA 4CLTA 5DGAA 3KNGA 3OHAA 2VG7B 2WVBA 3W65A 3FZ2A 4FXDA 4KKOA 3DHWC 4NA2A 2FVQA 3DLLQ 1UFWA 4YMEA 3PKYA 3P3DA 4WPAA 1WG4A 4FPIA 3NG8A 1QSLA 3NNHA 2IM0A 4CLFA 1VHFA 3LP2B 2M70A 3OJSA 1BE4A 5MAOA 1NHUA 2NREA 4O3PA 5AJ3F 3T1YF 3R7NB 4WYLA 2XGQA 2J0XA 4WBFA 3CNQP 4NOHA 1REGX 1Y4ZB 2EBGA 3UR0A 2OFHX 4KQZA 3GSDA 4NLPA 4USJC 2XM3A 2AYBA 2B51A 1V6HA 1NK9A 4B02A 4USVA 1NRKA 4DV2J 4B9MA 1WUUA 3IAM9 5AXKA 4WZMA 2DGWA 5CZXA 4LUBA 4U7UD 3SCKE 1KLMA 5LXYA 4JI5J 3DCAA 2H5IB 1IBKJ 4ID5A 1FRJA 2ZBRA 2MY7A 4X62J 4OLPA 4RW8B 2QA4S 3TARA 4DN9A 1S10A 4B9VA 2VFTA 1RE1B 4KV8B 4OJ3A 4OYWA 3K89A 3NGDA 2IBKA 4O3QA 3LP1A 5KG1A 3OTDA 4R5PA 1FKPB 1OPIA 1PC5A 1TR0A 1FJ7A 1NK7A 1HNZJ 4RW4A 2H51B 3D28A 1HYSA 4OYAA 4F7VA 4DS5A 4ZCMA 4UW2A 4PWDB 4H4OB 2HYIB 3DRRA 3THPA 4OI1A 3Q8RB 1GMVA 1CS4A 2R7QA 2Q79A 3CCZA 3MAAA 4Y28C 5CHCB 3SQGB 2XQCA 3K8WA 1AB8A 4JV2A 3G87A 5JXSA 3PX4A 3MFIA 3AOAA 2HHUA 1EQMA 3CSKA 2HPUA 1SH3A 1VQSA 5ITHA 5G4DA 1FRMA 4DR3F 3U1NA 3V81B 2AEJA 4CNYA 1F9EB 2BW7A 3QGHA 1F0XA 3MURP 4DUYF 4ELUA 4PCQA 1FNMA 2R3VA 1FXDA 3GIJA 3DYAA 4ER8A 3L95X 2GW8A 1P27B 3L7UA 3MPWA 2GJ2A 3OXGA 1SKSA 1PBAA 4J9PA 1TV6B 4IOBA 5KFGA 1ZA1B 1S9EA 2AJFE 1JLCA 4F25A 5DG9A 2ASLA 3V6JA 4KFBB 1S9EB 1KVKA 4MK8A 4PPDA 4J9NA 1XMOF 3OL9A 1BQXA 4EYHB 3R7SB 1UW4A 2RQKA 1N5YA 4N8OA 1BUXA 1V3ZA 2R2TA 2YNIA 3B54A 3M2VA 2CUYA 4QR1A 2JEFA 4M94A 1Z2ZA 4PAAA 4C48A 3M6WA 3CCRS 2FZGB 4LMZA 1TKXA 2RUGA 4WIIA 1HWIA 3GV8B 2ASDA 2Y0BB 3W62A 3W8GA 1HPZB 2MB0B 2HHWA 2Q43A 3S1TA 3FBFA 5AE2A 1JXVA 3EE3A 3CJSA 4WFYA 5AXMA 4UOGA 3OVBA 5H9EK 4OQJA 3U02A 4ATNA 3F41A 5C42B 3RU0A 1VQ8S 4JV1A 1Q1KA 5KT5A 1RT6B 3B82A 1FRXA 4B3RJ 5ETVA 3M05A 5C42A 3ETOA 4HHUA 4ZN1A 5EX0A 3H2LA 1JJ2R 3QO9B 1B4SA 2J0SD 3T9ZA 1GNKA 3EXYA 1F5AA 3VWSA 1S1TB 4DV0J 4RNMA 3BGUA 4IH7A 3ISND 3IFEA 2HLTA 2DNRA 4DR5F 4F36A 2CQCA 2CJ9A 4OZ1A 4WFZA 2G9OA 3MM9A 2F4FA 3HT0A 1NH7A 4XTTA 3W60A 4ED6A 1Q79A 2Q6BA 3BYRA 1BMQB 1DY3A 3I87A 2JNJA 4F02A 4LF8F 2XCAA 1C0UA 1F5BA 1ZA2B 5D77A 4CH0S 5KFKA 2LEPA 1GAOA 2DXFA 1WF0A 1CJTA 1T03A 4TY8A 1U8WA 1FD8A 4UQTA 2B9YA 2W7OA 2HQGA 3IRWP 2RF2A 2DT9A 3DOLB 1N34J 1KQFB 1TL3A 2VONA 4OZLA 3OL7A 2EPIA 3IRXA 4OL8A 2W7PA 4WP9A 4FYWB 4TU8A 4GKKF 2MJNA 2GVDB 2FVPA 2V8PA 3OQ2A 1R0AA 3KWMA 2FLNA 2HVIA 2DRBA 1BWVA 4EBCA 4WU2A 2BJ7A 3J7YI 2DR6A 1B7FA 1FVQA 1H7XA 1HD1A 3QJJA 4PABA 1L3SA 4F0MA 4OX9J 2BRLA 2GO9A 2F5GA 1TQLA 4JI4J 2OKQA 3LWMA 3MM8B 1NAQA 4OX7A 1MNEA 5E3PA 1WEXA 3FGVA 3MM8A 4HHHA 4R0JA 1JLAB 3Q2TC 1JLEA 2YWEA 4J5OA 3G2XA 2P8IA 1IBMF 2J6SA 1GFWB 5A8RA 4O3OA 4DQQA 4OX6A 4TU7A 1TU0B 1RBOB 4ECYA 4UY8T 2VBZA 1VK8A 1NSAA 2H3EB 1NJZA 4KHPJ 3C2PA 2YKPA 4E2FB 2WK4A 5E3AA 1XNQF 4KY3A 5IQQA 2HZAA 2CAJA 3PEHA 4Z7YA 5HVFA 4OMFG 3RRKA 3W1YC 3HJFA 1IXKA 2Z4PA 1RACB 1T8EA 2JRSA 2XS2A 1MWYA 3TX8A 4DF8A 4RW7B 2OPRB 4F67A 4NE9C 4LFCF 3T19A 3ICLA 1QLNA 4PWUA 1BQMA 3HHLD 2OAUA 4ZHRB 3BSNA 5IV4A 5BR8F 2ZH6A 1VC6A 3N0VA 2BKNA 3GCXP 4CI0B 2OLWA 3LGMA 4LIWA 4MKVA 3HULA 4B17A 2RKIB 2U2FA 1P1TA 4KRWA 5SUHA 2RSQA 2RD5C 4M5NA 1XR5A 1IKXB 2HWHA 1VDHA 1VS3A 3PW0A 4IR1A 3FSIA 1RHQB 2Y1IA 1PIEA 2FB0A 1YRTA 4P2FA 1M1HA 1SL0A 4ANDA 3UD4P 1WHVA 3MUMP 4K4ZA 2W4DA 3FSXA 2WW4A 2GO8A 4RUHA 2QTWA 3GE9A 4ZS6A 3ZO7A 2W24A 2HHXA 1CSJA 2DGXA 2O67A 4ZPBA 2N7CA 4X4RA 2BR0A 5T7LB 5E33A 3A3NB 4A8SA 1N32F 1RAGB 3R5JB 1KLNA 1ZPVA 3DHXA 2BANA 4JI1J 4B3OB 3JQJA 1MLAA 3IWLA 4KT0C 4B3MJ 2VQFJ 4MJKA 3FFIA 3C3LA 4ID5B 4EWTA 1V5VA 2CNNB 1T7PA 4Y65A 2PFDA 5LMUF 3IA0A 1CULB 4B9LA 1AXQA 5HSPA 4EZ9A 1IQZA 5LJ5Y 1CULA 1PJ6A 5CH7B 1GTHA 2DHSA 3J81U 1FNXH 3E51A 3KLGB 1N6QA 1FKPA 1KQKA 3DNCA 4RLEA 2MQLA 3VAHA 2HS4A 4RW4B 4DU8A 2MDAA 2VD3A 2XNQA 4ICLA 4CLUA 4QQBA 1Z1ZA 3OV7A 2K3KA 2FC9A 4KE5A 2B4PA 2G2OA 2KU7A 4X4PA 4O0NA 4QJVA 1S1UB 2DBBA 2HK2A 3D5MA 4ZP6A 1Y11A 3TI0A 1M5PC 4LFCJ 5AE1A 5D6GA 3H59A 1Z2LA 2VQEF 2YBVA 3M8WA 3DM2A 4NEYA 3WX8A 4ZKAA 2A2DA 1S99A 5M2PA 1X5PA 1RT7A 2QG9B 3ADAC 1VQ5S 2M2BA 1X60A 1HWKA 2UZAA 3GZ7A 5DM7Q 2AX1A 4MYTA 3FMWA 4U8YA 4KHRA 4JBCA 4PUOB 4NI2B 1AW0A 2XMJA 2RB7A 3T5LA 3FCWA 3TJAA 2K7JA 3MM7B 5KFAA 4A48A 4OYMA 4PRFA 1CC8A 2KG0A 1KC8T 3TAQA 5KG0A 1WC4A 3PW5A 1DLOB 5LM7E 2ZWOA 3MGJA 4NCAA 1UVMA 3W64A 1TKTB 4DL4A 1QSSA 2JEIA 3W3SA 3D1HA 3EM1A 2E5JA 5J2NA 3C6UB 2MSTA 2WTFA 5J2NB 3KJFB 1RAHB 2HHPA 2WVFA 2ZITA 4NLTA 5KFYA 1UCNA 2UUTA 4N77A 3H5SA 2YKQA 2A1BA 3S01A 5IFMA 1SL1A 2ASYA 2YKNA 3R5DA 4BHQA 1VRUB 3BDPA 5KT3A 5M2UA 1YJUA 3ILJA 1RAOA 1RZMA 2YKNB 2XI3A 2XSJB 4XIUA 3BV8A 4ZDNA 4J7CA 4HH1A 1WF2A 2MKJA 1GXTA 3OR1B 3F73A 5C2CA 1OQ6A 2B56A 4NLQA 2YH1A 1S1TA 2QL5B 2OIHA 4WKYA 4WFXA 3ZZRA 2E5GA 3KG4A 1RT5B 4P74A 3C46A 5HLFA 1ZAWA 1H74A 2GQCA 2LQBA 3QAUA 4LBHA 2FGCA 3DRSB 4YEAA 3TAMB 2XY7A 3PKMA 1WSVA 4TY9A 3RAQA 2ZD1B 4JYAJ 1Y5NB 3ITHA 2FLLA 1UJ5A 2CZ4A 1WC3A 1U1PA 4IOAQ 1RQ0A 4TY8B 2I6WA 1RT2B 4QBUA 3VR1A 3FSYA 5I42B 5FD1A 2L9DA 3KK2A 1HLWA 1UL3A 4M8LA 3WBZA 3ZZUA 1HR0J 1F6TA 3KLVA 1LQ9A 2RVJA 3K5OA 1XMQJ 4G6VB 4N7TA 3DLKA 2WVCA 3GFXA 5M2RA 4C3KA 4P72A 1YRXA 3HHLC 2KM8C 3BQ1A 2DNGA 4I68A 4B3SF 3UWTA 2RHSB 4F26A 3MEGB 1N52B 1U1NA 4KHMA 5IWAF 1HHSA 1H2TZ 1T94A 1Y9OA 2HVEA 5LL6d 3E01A 4ALZA 2J7KA 4UOCA 3TYTA 3IP0A 2DITA 2O3DA 1KWMA 4OZ2A 1IBLF 2MY8A 2FQQB 3FUYA 1J5EJ 2Y8YA 2ROGA 5ETOA 4KV8A 3MXHP 2N4CA 3M8PB 4CM0A 2D3UA 2ZBQA 2DR8A 2RDIA 2GIQA 3IBFB 3M8PA 4ZP7A 3KLFB 1NPPA 2EI5A 2IAJA 2CVEA 2QL9B 3S7RA 4EBDA 3TNVA 1KHWA 1RT4B 1ZPWX 1QAIA 3US5A 4FS2A 1S12A 3P8BB 2OD6A 2KXHA 3KDOA 4CCHA 2C2KB 4NWBA 5A8KA 1RAEB 4QWDA 2ZM6J 3GTYX 2M4MA 3CCTA 9ATCB 2MQQA 5CXTA 1YG0A 2G1HA 1R8CA 2MSSA 4RPFA 2LQ9A 4DR2J 1R0BG 5KT4A 2D3OR 1S1XB 2IJRA 1T9YA 2ILZA 2OPRA 1KS2A 4A46A 1SJ1A 3K5NA 3PW7A 2R7SA 4ZVQB 1S1XA 1B0TA 2F9DA 1T9UA 4LRCA 3RW7A 4WFAQ 3UCZP 4FVCA 1T3NA 4QYZK 1NH8A 2AGQA 1FKOB 1HFEL 5HI7A 3TAPA 4RKUC 1PILA 4LF5J 2DNYA 2B3TB 3G82A 1T9XA 4PXCA 1GEHA 4Z37A 5C24B 3AJ2A 4C8LA 2VG5B 4NXNJ 3G82B 2HNYB 1FK9A 1XK8A 2R7OA 3JAMY 1B0PA 3QWUA 4ECQA 2AV5A 4NYOA 3UCGA 4V1Ak 3VQSA 3IN5A 3H8YA 1S0MA 2W7AA 4C97A 5J1NA 1WC0A 4IFYB 3CPWR 2IHR1 2HNDB 2FJVA 1CVJA 1KN6A 2XNRA 5LJ3Y 2XYGB 2KFZA 3W2WA 4WFNQ 2H65B 2QE5A 2YKMA 4FYYB 5CYJA 1F2HA 2V2VA 3GIMA 1XMQF 3RRGA 2QX0A 2C3UA 3BB5A 2W8LA 1M5HA 3DXBA 5F41A 3A3PB 2ZE2B 1UEKA 4CLKA 2CJYB 2DY9A 2JVRA 3O1LA 4CTAA 2YY3A 3OUYA 3Q89A 3HI9A 1KBRA 1H73A 2EK6A 1WOPA 2ZBIA 4DX6A 2DGOA 2NXNA 2BJDA 2PDAA 3M32B 2ZH4A 3N5BA 5D3GB 1YJRA 2H5JB 3TW0A 2RU3A 3LAMA 3VAMA 1WTBA 1QTNB 4ZLLA 1FWLA 3D2WA 2D1CA 6FD1A 4F4WA 4OIXA 3P5BP 2ZJQQ 2EFOA 5GVQA 5IOLA 1M5OC 2VASA 2MKHA 3OBIA 1UAWA 2BMBA 4ECTA 3SEOA 2V4JA 2MZRA 2W2OP 2V2ZA 3FK4A 4BCAA 1AZSA 5HJYA 3GJSB 3LW5C 4IFVA 1OYDA 1RABB 1YDLA 3K8VA 1NLKL 3LPEA 3M6VA 5GAEI 4EK2A 4UQGA 4J9SA 1VR6A 1HMVA 3BR9A 3OSNA 2W01A 5KFFA 4LREA 4DV6F 2R7UA 2L3MA 1HMVB 4DR2F 1WTFA 2R7XA 5GAGI 1T03B 2YNGB 4J9QA 3GV7B 1RT3A 2PE8A 3ELHA 5F8IA 2G2YA 1UMJA 3OT9A 3CUNA 3AFGA 3T1AA 4JI3J 2G4BA 1JXEA 4CNZA 2N4DA 2WVEA 2JDJA 1L3TA 4DCJB 4ED4A 1S9GA 2DNZA 2JVOA 4FP9A 5F8LA 4NLOA 2DR5A 2R7TA 4JI3F 4NMLA 2XSFA 3VHQA 1NSPA 3VGTA 3AD9C 3NMRA 5T14A 1NXIA 5E7OB 2ZDPA 3EPGA 3MHYA 5I4MA 1JLBA 2YPYA 1NEEA 3CCQS 2KYZA 5ETLA 5ETMA 4F4AA 5A8WB 3IMQJ 1FCAA 2IDLA 1ELOA 3UVJB 4ECXA 1W2BR 2DCUB 2EEYA 1WACA 1HWUA 4DL7A 2H1YA 4AE5A 4MK9A 3KOAA 3M30B 3ZC4A 3DFEA 3QRPA 3V6KA 1SKRA 1I3OB 1YBTA 4TYBA 1WKKA 4X4QA 2U1AA 1LOUA 3PX0A 4RW9A 1HD0A 1ROFA 2GZOA 2JC1A 5JVHQ 4KPYA 3MM5B 4R25A 3C16A 2R2SA 4ED7A 2WB4A 3HHEA 3C16B 1NK5A 2XY5A 3DGPB 3V4IA 5KFDA 5F8GA 3HX9A 2C2NA 2UV8G 1K1SA 4RBUA 4WE1B 4Y34A 4PG8A 1RCOB 3EVMA 3JQMA 1X4EA 2PI4A 1G1XA 5B0CA 3HHNB 1RLCL 2MLYA 5K8OA 4CH1A 2RT3A 4ZVSB 2Y3YA 2OGUA 4MTPA 4ZHRA 2O1PA 2OMOA 2HG4A 2ZZMA 1SBRA 5IV3A 2ZH3A 5CCMA 4M5LA 3S6EA 1U2RA 4ZITA 1HW9A 1IJFB 2M88A 1NKCA 3ETMA 2QT7A 3JSRA 4JI8F 4DSIA 4X66F 3DLEB 1IKXA 2VFVA 2QC3A 1KVJA 4RW6A 1GMWD 4F2SA 2FD2A 4K59A 9RUBA 3NWGA 1KRPA 2VBYA 1PJ7A 4LSNA 3RAXA 1XQIA 2RS8A 5K8MA 2MZJA 4K50A 1OPZA 4ED0A 2CNLB 2X3GA 3TA1A 2W9BA 4DR1F 3OXFA 4KIAA 3AD7C 4ZIWA 4LF8J 2FZKB 4ZPCA 1S72S 5HQMA 4QU7A 3B4DA 4HDHA 2AYGA 2E1RA 1M1GA 2ZHBA 3MEGA 3EVOA 1G3OA 1HKAA 2I9SA 3NEKA 3GJQB 3UQSA 3QZ8A 4DV5J 4DPXA 2AHOB 1RTIB 1WWHA 2LXUA 4EZ6A 4YR0A 2OUGA 2QJ3A 3KK1A 1YJVA 3V2UC 4P9SA 3T41A 3D6MB 2VKZG 2HS3A 2MQ8A 1X4CA 3QJLA 2DHAA 1WOOA 3SCJE 1NDKA 4I2PB 4A8OA 1N5QA 1YTYA 2BKPA 4M5DB 2IAJB 2GNKA 2AWZA 2CVIA 2XLKA 2AIRB 3QFWA 2VHGA 1EZZB 4QWCA 2KFNA 2CJBA 2PN6A 4KH1B 1RAFB 5A76A 3D6HB 5IM0B 1F1BB 1ZH5A 4DLEA 2YWWA 1X5SA 1MG7A 3DLGA 3J7Z5 4B9NA 4Q8EA 2BE9B 3CB4A 1WELA 4E0DA 4NPOA 3NP5A 3DMJB 1HNVA 4O3RA 1X5TA 2GMHA 2G13A 2H54B 2EKYA 4I0WA 3AH6A 3BGRA 2H5EA 2IMWP 4MKYA 1FKOA 3BBCA 5LMNF 1XNQJ 4YHHJ 5KFVA 4MYUA 2J8AA 4OHWA 4FNIA 2AQ4A 1S77D 1D8YA 1R89A 4KFBA 4ZA1A 3I5AA 1LNQA 3PIOQ 4PQAA 4FYDA 3MM6A 3HHDA 1FRKA 4H4KC 5K8NA 5HL7Q 3TA2A 1N5YB 1N36J 1VQMS 4Q0BA 1ZETA 3MMAA 1VJWA 3W2WB 2XZTB 4K7QA 3KKFA 4CLWA 3BJYA 5B7WA 1X9SA 2YNHA 1TKTA 2XY6A 1XMOJ 1SPBP 3K7RA 3K0JA 2HFUA 4UUWA 4ZVGA 1NJYA 5IT4A 3NGRA 5U47A 3RUBL 1KQSR 3TX0A 5DO2A 3DDIA 2NXUA 1TKXB 5KG3A 1IKVA 3PM9A 2FUG9 3QMQA 4ZVHA 2GIFA 1HI0P 4USKA 4M5KA 3QT5A 1UETA 2DXEA 2L48A 2NYHA 2HLUA 2NUHA 2HGLA 3IC1A 3U7JA 5KG5A 2W9CA 3BQ2A 3PVXA 1J5OA 4CWBA 3FVYA 4ENOA 4F4XA 1QM9A 3GG1A 1RT6A 1WEYA 2GHWA 1Q7LB 1Y00A 1H2UX 1Q16B 2A18A 2GIRA 4WK3A 4KPCA 1R8BA 1XTZA 3A8IA 1LEOA 1RJJA 1U0HA 5ETSA 4AT1B 3RB4A 1URNA 1GK8A 1JNZB 2UU9J 1BD6A 1U0HB 4ZVEA 4CT8A 1HNXF 4TQRA 4DQPA 2YX4A 1SVDA 3N28A 2B6AB 2J76E 2CPIA 1RT5A 4MIWA 5IQ6A 1KOOA 2M8DB 1PJ5A 3HM9A 4JI7J 3TAMA 4Y2KA 4PPZA 3ZZ0A 2CA9A 5KFWA 4ILMA 5L9XA 4FYVB 1KNZA 3QNWB 3WC0A 3OL8A 4HACB 5F0WA 3CCLS 1RTJA 1CC7A 4H4MA 2DGUA 4C8MA 1AYEA 1FXRA 2ZHOA 4ZVPB 2NXEA 4QZVB 3GP9A 1LV5A 2KM8B 5KFTA 4P7VA 3UPFA 3KK3B 4ED2A 3BKUA 1J2VA 1SXLA 3KK3A 1N4LA 4JYAF 2BABA 5B0FA 3W2VB 4CLYA 2XLJA 1ITPA 3GIIA 3CTRA 1SQEA 1TUVA 2G0JA 3SCIE 3QLHA 1SJQA 3CO0P 4XK8C 3TZZA 3RB3A 3ENAA 2BACA 2GVDA 4LF7J 2BBEA 5E0OA 2QSFA 4CM2A 1K8AT 1NK8A 5ETQA 4ZLNA 1JLBB 3JSYA 2XC9A 1IR2A 2PMWA 1JLGA 2UUBF 3LQVA 4FNHA 1SC1B 2KFYA 2ADCA 4ZPDA 1NPRA 2UXCF 4LRDA 3A1YG 2QV6A 3CT9A 3KG1A 2IBOA 1KFSA 4RO0A 2CJKA 3H42A 3FZBA 3HVWA 1JLAA 1L5UA 3GSIA 3KTQA 1QUPA 3V6HA 3L7OA 1WORA 2IM3A 4J9OA 1E6VB 4PR6A 3BO4A 4F3MA 2HFVA 3NS5A 1BLUA 1O8BA 4K5SA 1VC0A 5FJ4A 3ENQA 2UVRA 2HIQA 3CJ3A 4ZPWR 2KL8A 3O8WA 1NB2A 2CPDA 4WE1A 3TVZA 4NCGB 3ZZZA 5KOWA 2UVVA 1NK4A 4DR6F 4DSLA 3D54A 1BQMB 2KI2A 3BGOP 3R7BB 3BBBA 3EICA 1WD6A 2LQ5A 5H9FK 3B4MA 4M5JA 2ZFHA 2WHOA 3Q2SC 4X66J 1J5EF 2AYEA 1WDTA 2KT5A 2LLZA 4MK7A 4JP8A 4FS1A 4DSFA 1FJEB 3G86A 1DJ0A 3TUIC 5L38A 2HHHJ 5IS2A 1WF1A 4RL1A 4LBIA 4D3GA 3R5CA 3K59A 1X9MA 4DQRA 1K9MT 3MD3A 1TZ0A 1NKEA 3HJVA 4IFYA 4LF9F 1V5IB 2E1PA 3GB0A 3KDNA 3GYXB 3QT7A 4AQYF 5IT9Y 2JZ5A 2XMWA 1EETA 3M2RA 1XR7A 3G96A 2ZH2A 2ATLA 3G8QA 3L7PA 2HVZA 1KFDA 2YWFA 3DI6A 1OY6A 1XEZA 3LGHA 4Q2LA 4C98A 4EEYA 3DRYA 4DSKA 2ATCB 3IXQA 2VJVA 4IQMA 2WSEC 3DOKB 2BV3A 1DARA 1MMLA 2XMVA 4OV1A 4CO2A 4CRJA 2ZVSA 4DX7A 4RNHA 4DV7J 2AEMA 2MQNA 4C0OC 1FJGF 2HK3A 3CMQA 3QFHA 2IVFB 2R9LA 2P2CB 5GMEA 4AL7A 2C22A 4WTYA 3MUVP 3IS9A 3N79A 3QJPA 1SI9A 2LMIA 4IO1A 1X0PA 3MEEA 1KDNA 4C0HA 4A8WA 4QCLA 3MEDA 1JX4A 1RYSA 3QAEA 3PEJA 4CT9A 2B9WA 1UTAA 2X51A 4WJBA 5D15A 3UN5A 4B3MF 3TJ8A 4YR2A 3KLGA 1TMJA 3WC2A 3EPIA 2HAIA 2Z2LA 4Y6IA 1C0TB 1JK9B 3HZGA 4U9RA 1C0TA 1OJ4A 1EX8A 3MMJA 3H2VE 4PWDA 2GMJA 2VDHA 3CJ4A 2LECA 1RISA 5IM0A 3M8YA 4JI1F 2CWKA 3MAAB 4RBVA 3UDVA 3ZZYA 3P45B 3L3CA 4K4XA 2C2EA 4YQWA 3RBDA 2E1AA 4IG0B 3DM2B 4X4UA 3F0NA 5GAGU 4NMXA 1ULRA 3HCXA 2PEBA 4GVBB 4Y2AA 2JHEA 1H38A 2FVCA 4RX6A 4JI2J 4YN3B 2G2ZA 3ZTRA 5CA5A 3HSDA 1YJTA 4HT5A 4R0EA 3EWGA 1RU1A 2W2NP 1LW0B 4LVOP 4P75A 3I9V9 4ETZA 1WEZA 3EZ5A 3S8SA 2KZMA 2C1EB 2D41A 2DGVA 3KLIB 2FGOA 3B6BA 1Q5VA 4B9UA 1YQHA 1CLFA 3C6TA 3OL6A 1IR1A 4E98A 2D9PA 2W4CA 2VF3A 3QWPA 3CJKB 2QLFB 3OW2R 2J9DE 1IVZA 2AJ0A 2BRKA 3PHEA 4I64A 4DL6A 3V6DB 4KGVB 1YIJS 2MYFA 2POKA 2H4YB 2GMLA 4IYQA 4DLGA 3LWLA 3I32A 1S97A 1FERA 1HNWF 3B78A 5A6WA 2NXCA 3TOQA 5KT2A 2V9WA 3ZXWA 1YJ7A 2COLA 2LDIA 5KFMA 1SJFA 1GXLA 1Y3JA 2AT1B 3N6NA 2G0CA 2CWXA 3AOCA 4RW9B 3UD5A 3CCES 1CEZA 2VODA 1DAXA 1HHTP 1CG2A 4M95A 2VFUA 2BJ3A 4LR7A 4KAIA 3CDAA 4O3NA 5A2QU 3K5MA 5JVGQ 3R8YA 2LU1A 3R1LA 2XSJA 2LA6A 4C0BA 1WSRA 2IY5B 3BN7A 1U7LA 5B0EA 4JI7F 3QATA 3R9LA 1FE4A 4F4KA 3ENVA 1NCLA 2ZH9A 4KBIA 2XBPA 3RAMA 3HZEA 2A2CA 3CJQA 1RT1B 2UUCF 4L6V3 2FJEB 4YB7A 3CIMA 1SKUB 2DNMA 2B7BB 3MM9B 3T6JA 4LR9A 4ED8A 1URRA 4CQ1A 3K5PA 2HMIB 3H98A 1M1KT 4TKTA 2AX0A 4MKAA 3HVTA 1U0SA 1AUSL 3DLEA 4FKXA 1C0UB 1YZ7A 2B9XA 2HIYA 3HSJA 3SMZA 2YX1A 6FDRA 1DRZA 1CJTB 1PYTA 1U2FA 2KRBA 3QZ7A 2E9RX 2QGFB 1R27B 4Q7AA 2FHKA 1LWFB 2QLBB 4QR0A 2P9GA 4LBPA 2ZZNA 2HSEB 1YLXA 5DG7A 3TVKA 2UXDJ 5KFHA 1S59A 2HHTA 3DLKB 4RR5A 3A4TA 1FHTA 2DTJA 1ZS6A 1MN7A 3D7SB 3CIZA 3SDEB 3R2CJ 2F8HA 3H5YA 4NLUA 2OI2A 1R8PA 2PMZD 1TTHB 1HNIB 2BUNA 5F8JA 4N41A 2HFNA 4YY3F 4MMOA 4IOCQ 1HNIA 3ZTPA 4B08A 5THWA 3I0SA 1EAYC 3G4SS 2VL1A 3OFHA 1LWXA 4O0IA 3G6VA 4DUZF 4WXWA 1S1WB 2VPXB 3N01A 3ZZTA 3TUZC 1RWMB 3KK1B 4U95A 3BSAA 2CJXB 3KMSA 3NS6A 4S0MA 3SBMA 1AFIA 5HROA 1IKYB 1FTRA 2QO3A 1FA0A 2VBXA 4R5PB 3GV5B 1S5ZA 1VMBA 2DNPA 2MJUA 1U1RA 1IBLJ 1DBDA 2L9WA 1VQ6S 1VBYA 1HWLA 3M2UA 4B3RF 3QIPA 2FZCB 2ZEJA 1RT4A 2NXJA 2PSZA 3KNAA 4J9RA 1IWAA 2V2KA 4F0HA 4DV3J 1UFLA 3DLGB 5DJBA 2HNZA 3CDBA 2E9TA 2R2RA 1OY9A 2DK2A 3C8YA 2XWYA 2C28A 1HW8A 3BGFA 1VQ7S 1PG5B 1MN9A 4DV3F 3X1LB 5CYMB 4BWMA 1IBKF 4KTQA 3QYYA 2HVHA 2X1GA 4I67A 3M6UA 3QBCA 5A0YB 5C24A 3UD3P 2RNEA 1HQEB 4LJMA 1V3SA 1O0PA 4Q2MA 3RZAA 5A0YA 3GFHA 5ADZA 4QYZJ 1WDDA 3BPSP 2WBRA 4J9KA 4A8KA 3HPOA 1APSA 5HO4A 1RWKB 3GQCA 2OTLS 5HMWA 4WXOA 1BY9A 4V19X 4USTA 3MR3A 1M5KC 2E7WA 5F0UA 3A8JA 4TXSA 3TZXA 5MLCV 3VQTA 1HQUB 5HP1A 4DR6J 2KZZA 1ZTTA 1FT8A 2DH7A 5KFJA 1M5VC 2DY1A 1TL4A 1P8GA 2IVYA 2RIJA 2WCXA 4WCEQ 1X0FA 3PO5A 2EKNA 4YOEA 1IN0A 4RNFA 2QZ8A 4TLQA 2V67A 5T7LA 5K8PA 1MU2A 4KO0B 5KFZA 3G71S 1J5OB 2EK1A 3FCVA 2BQUA 3A12A 1VRTA 3NNCA 2EFQA 2HFZA 3FC9A 1H98A 4Q44A 1EJ7L 1FJCA 4TU9A 2VBWA 2W2QP 3PYFA 2NPFA 1DQAA 4CO0A 1XERA 3LOUA 1BC6A 2HBYB 3AA8A 3KG0A 4DS4A 4F3OA 1FFWB 1N6QB 4PEOA 2E7VA 5ETKA 2VIHA 2F1FA 1A7GE 2P6TA 2ZBCA 2EWHA 4HR2A 4ZN3A 1B0VA 1YJWS 4IFVB 4FF3A 4IG3B 1NM2A 2IRUA 1U1LA 1RWWB 1UWBA 2LA4A 2YKAA 3IR6B 4HACA 3W5XA 4AL6A 4PQUB 4BDPA 2IFXA 4LF4J 1I6JA 4USWA 2B9EA 3LALA 2EXUA 4OV6A 1DTTA 5K14B 2AJ1A 2JFDA 1QVFR 3FKBA 3CGIA 2DVIA 1IBCB 1DTTB 2E5LF 1Q53A 1RT3B 3BPDA 3OR2B 2AD9A 4KGXB 2N82B 2QEXS 2NZCA 2HQFA 4F4YA 5I3UB 3M8QB 1V3RA 5DRKA 3J7ZT 1OQ3A 1UFKA 3FEZA 4G1QB 2EC2A 1S9GB 2RUSA 1T95A 2KJVA 3NWRA 4OZJA 1S0VA 4WKRA 2P5VA 3ILOA 5H1SV 2G1DA 2MLZA 2MKCA 3H0PA 5BYRA 3DC2A 3K17A 2OH2A 4AQYJ 4LF9J 4DR4J 4K0KJ 2JX2A 2EW9A 4NCBA 1EARA 1OWXA 4X65J 4K2JA 4JV0A 2VUGA 2QLJB 4YB1P 3MTJA 2UVUA 3LH2S 1TKZA 3P4UB 4DUYJ 2XZWA 2Z58B 2PA3A 2ILYA 3GR0A 5D4NA 4DCOB 4ZK7M 1NZAA 4K4YA 4OJ1A 4OZNA 3W7BA 1I94F 2NPIA 4OZ5A 1PBUA 5EUHA 2OPSA 1E6VA 3I5CA 2KKHA 3JSMA 4IQXA 2R8GA 3AXMA 2IC3A 4LF2A 3JSMB 1RTZA 3D0IE 2K2PA 3Q86A 4CYUA 3CCUS 4J91A 3QRRA 3CDWA 4HYKA 4YB6A 4MAKA 4FKYA 3T1HJ 4DWIA 2VB6A 3MCNA 4JI6F 1FEHA 1GT8A 3EVWA 1JLQA 2B43A 2KVIA 2BJ8A 4EU0A 5B0BA 2V4QA 1T05A 1MMNA 1PGZA 1LW2A 1NHVA 4WF9Q 2E7XA 3DKDA 3TZYA 2UXCJ 4ZPTR 3T1HF 4GRSA 3UDEA 3W8PA 4GVLA 2YH0A 4ANCA 1WHXA 2HHQA 3EXCX 1VLYA 3ZZOA 1HI1A 1U8SA 3KHGA 4B3TJ 1ZM4A 2CPYA 1PO6A 2XS5A 2BJ9A 3VTIA 2FVRA 5L9NA 3BM7A 2GGPA 4DV2F 2DPJA 1L3KA 4P52A 2GGPB 3AODA 5I3PA 1N0VC 4LQ3A 4JI5F 2Z8QA 3TRGA 4Y3CA 2E5LJ 4I6YA 3VV2B 4USUA 2VG7A 4Y00A 1U47A 1EETB 1TK8A 3LP2A 2Y8WA 2BM0A 4KKOB 4WIQA 1C2PA 5KFNA 3NCRA 5DQIA 1UJ6A 3AJDA 2BQ3A 3LA0A 1MSWD 1DQ8A 2IA6A 1QSYA 4YDDB 3RGIA 1KKHA 4QU6A 1R3NA 2WB1D 3BKFA 3DRPB 3GWCA 2ADBA 1M90T 2J9DA 2E5HA 4PKDB 1AT1B 3D3BJ 3SQOP 2R7WA 1IQTA 4Y2IA 4ZVRB 3CC2S 4JI0F 1CQNA 2CADA 2HEKA 2I8EA 1T3OA 4A8MP 2WONB 1MWQA 1RTIA 3OTEA 3J7AN 1HBMA 3FBBA 2HHHF 2Z2MA 1NHKL 2E5IA 1FI4A 3CEDA 1YSJA 2F7VA 2LXIA 3DXSX 1NUEA 3N4WA 4QYRA 5KOXA 2A6MA 4ZLJA 2XTJP 3PV8A 3QSIA 4I56A 3W5YA 1RHMB 1RWXB 5B08A 3JYTA 3CCJS 2Q3PA 2EC0A 1UVNA 3OPKA 3BGLA 4MIAA 1KTQA 3M7VA 5DETA 5HROB 3HFZB 3MCOA 2YNFA 3G6XA 4NLGA 1TMMA 2DIUA 3OFGA 1TVRB 4DF4A 2YNFB 2VZ9A 5DM6Q 4M5DA 2AZ1A 2C2OB 4H4OA 3UO0A 5B0DA 1EP4B 1TVRA 3QIPB 3CULA 1AROP 2EFPA 2E1CA 1VLOA 4HT7A 1LXNA 3QIDA 4KGMA 4ZP8A 3T9NA 4L72B 2ZWPA 3DMJA 4C8OA 5HBMA 2CDRB 2AW0A 2GQ2A 4DN0A 2AEFA 2KYXA 4ECRA 2LVWA 2VQFF 3CJ5A 4LT6A 3V81A 5BJRA 2M5YA 7AT1B 5KTQA 3PY8A 5CYMA 3AQPA 4OX9F 1D3WA 1WI8A 2NLWA 3OTBA 2HS0A 1DTQA 2R4FA 3BKTA 3H5UA 4XDDA 5F8MA 3BGRB 2A3JA 1YI2S 1LW0A 3RYLA 3DLHA 4OI2A 5IT9U 1NSQA 1SCJB 2OO4A 2VG5A 1REVA 1S4EA 2NCKL 4N76A 2GA7A 4KGKA 4RNNA 4F2RA 1OO0B 3JQKA 4BWJA 3MPYA 1W26A 2PO4A 4DX8H 3SV3A 2MZTA 1BWEA 1JLCB 3BZQA 1VBKA 4UF4A 2UXDF 1YKWA 5HQ8A 2FHOB 1ZOTA 2R8JA 2YNHB 3QT6A 3HHLB 2FVSA 2V9KA 3J7A1 3J81Y 5DQGA 4QR2A 4NA3A 3OLBA 1VISA 5C2GA 3AHPA 3GIKA 3H4BA 2XMUA 1GH8A 3GFYA 1A9NB 2V68A 3J80U 2RQCA 1HPZA 2HHSA 1N5SA 3POTA 2FJBB 2LU2A 3C6UA 4NYZA 3CWJA 3POTB 4CDIA 3HK2A 4ZJQA 1RADB 2DNOA 4P2MA 2DJWA 2FJDB 4IH6A 4KB7A 4GC7A 2BKOA 2IDEA 4X84A 5C7PA 1S9FA 5D3GA 3TP2A 3EUNA 3VVTA 1EB0A 2A10A 3GU0A 3Q24A 1S6QA 3C14A 5H9EJ 1OMSA 4CIOA 1JLFB 4DHVA 1ZM2A 1MW7A 3C14B 5E5NA 3QO9A 1YHQS 2HRTA 5KFIA 2VOPA 4W92B 2ZVIA 4PWWA 1H7WA 2DHXA 2LP4A 1HBUB 4PG4A 2XS7A 1VQYA 3ET6A 5CYQA 1Q78A 1Y7PA 5KFPA 1HNWJ 3MR2A 1Q81T 2H9ZA 4RUAA 3I82A 3PJWA 5T41A 3PW4A 3EDQB 1W25A 2ZD1A 3NOGA 4NLRA 5F3ZA 4FF1A 3NAHA 3NGUA 4H4MB 2VH7A 4DL2A 3FRYA 3CXCR 1F2GA 4JI4F 4BLGA 3THVA 3CMES 3NGTA 5J2MB 2RF2B 2ZC3A 5B0GA 5EN1A 1YRUA 2XMAA 1YJ9S 1LWFA 2V2QA 2KTQA 3SSSA 2V8VA 1ZAXA 1WOSA 4HHJA 1OSDA 4OHYA 4OI3A 1B7YB 2LQ8A 3CJ8A 4EMDA 3W2VA 5DDRC 3O2IA 4OZ3A 3HT3A 3Q8SB 2OTJS 3PJ9A 2UUCJ 4AXJA 1NK6A 2DD8S 3Q23A 5J2QB 2HHVA 2W1BA 4DR7J 1KVIA 3D67A 1R8HA 2ROEA 3E8OA 3MMBA 5L1LA 3AAWB 2EG1A 2V8HA 3DU6A 1C4AA 4Y2CA 3WHIA 2UUWA 4JI2F 5DGBA 4ZIVA 2GVZB 2CNKB 4FBTA 1TKZB 2OELA 2GS8A 4L3NA 2YWGA 1C1CA 1RDRA 2GVZA 2ROPA 4C2MA 2UUBJ 3MTKA 3DLBA 3BDEA 2PT0A 2CQ3A 1C1CB 3BH6B 3GR1A 1PSDA 3FQLA 4ECUA 1IKYA 1UVKA 2P9EA 2KXFA 3Q8QB 4J9LA 4DFKA 2XWXA 3BSCA 3TEHB 1N36F 2Z57B 2C42A 2OPPA 3NGSA 1FX2A 4K4UA 4F8RA 3MM5A 2HRUA 4Q43A 4I6AA 3BYPA 4O4RA 4CYUB 3W5ZA 5J1EB 2BEFA 2KB2A 4LIRA 4K4TA 1ZM3A 2Q1LA 3T3FA 4LF6J 2GHVC 1FRLA 2LKZA 4RW7A 1NKBA 5KFSA 4A8YA 2FHJD 2AKWB 1TFWA 3EGWB 2VU5A 1WNEA 4B3OA 1LW2B 2UU9F 5L1JA 1U1OA 5LXRA 1HI8A 1FESA 3UR3C 2ZH8A 4DMZA 2MGZA 1JXLA 1R8AA 2YQ3A 4DL3A 2BA9A 2VA2A 4NXMF 5E41A 1K0VA 3AY0A 3HSZA 5F9NA 3L09A 2FHMA 4WFBQ 2XCPA 2V69A 4FBUA 2YKOA 1X4BA 2V0NA 1WKJA 3PW2A 1YX2A 3MOJB 2FJWA 1FK9B 2WBMA 3GMGA 2D74B 2XYPB 2DO4A 1EKSA 3ZFVA 2N3OA 4XPEA 1T11A 1R43A 4L76A 4JUZA 5KT7A 5J2PA 2HGNA 4AFFA 5ETNA 4EFAC 4TLRA 2B5JB 2F63A 3BQ0A 3EYZA 2IMOA 2B5JA 2HFSA 3M2RB 5IC4B 4ECWA 3Q0AA 5HJXA 3DOKA 5FLXU 2NR0A 1F9FA 3D66A 3G8SA 3GPAA 2Z56B 3KJNB 3RG6A 3KUEA 4LFAJ 3R5BA 2YX7A 3LO3A 5SZTA 2IA0A 2PIIA 5FLXY 3Q8PB 1YITS 1NJXA 3CCVS 4TQSA 4UOFA 1V9OA 4W98A 3KHLA 4KSEB 2CFXA 6AT1B 2OSRA 4ES1A 2WONA 3KFWX 4UTGA 3TJ9A 4NXNF 5KG4A 1HBMB 1VQKS 2JLFA 4RWXA 2DCLA 1A6LA 2M8HA 2DO0A 1UEUA 1FFGB 2ZH1A 5L8RC 1U1KA 1F5CA 2CQ1A 2L08A 2XI2A 4J37A 4USIA 4UZCA 1QD1A 2CDQA 5G0RA 4RUCA 4I2PA 1FEEA 2CKWA 3W63A 4IO9Q 3VAGA 1ACMB 1CJKA 5IWAJ 3IWNC 2OFGX 4NZ0A 4NRTA 2DNLA 4URGA 1EP4A 1VQNS 3VZHA 5D0RA 5IT0A 3MUTP 4L3KA 4IRKA 1A0OB 3K58A 4L75A 4EGLA 2CZ9A 5IXUA 2MQPA 1CS4B 4IRDA 4IG0A 2RDJA 4X4VA 1JWWA 5K14A 5HMZA 3V4MA 4ED3A 4U67Q 2E9ZA 3N6MA 1H6KX 2E29A 2DB1A 2HFOA 4NLWA 3R27A 1IUJA 4NXMJ 4KC5A 2QYGA 4G1QA 1Q86T 4X4TA 4AXIA 5C5JA 2V5HG 4X4NA 1KP6A 3MR6A 1XR6A 2X1AA 5K5MA 4DFJA 4RNOA 1U1MA 2AZ3A 2MLXA 2F8MA 4K8RA 2PGCA 1TV6A 4ZVFA 2V50A 1UWAA 3CO9A 4GO7X 1D9AA 3IBWA 1CJVB 1HL6A 1LK7A 1PAEX 3OJUA 3IAS9 1S6PB 4PZVA 4ZPAA 3MMAB 2ZOMA 1LWEB 1X5OA 1SUQA 4OYPA 1S6PA 4I69A 1JKHB 1IM4A 3MEKA 4HTIA 1WG1A 4ZVOB 3GLJA 2VA3A 2ZM6F 1TUWA 3RR8A 1CBKA 3NKYA 4PG6A 3MPVA 1D8ZA 3PFEA 4PXEA 4CO3A 3RB0A 1HA1A 2Y0SD 4ZJOA 1FXLA 2FY1A 4AD6A 2K06A 2NSCA 3FEXB 3W9IA 1AUDA 2J5AA 5D8HB 1HNZF 1S1VB 2B8PA 3HD2A 4MKBA 3NRBA 1RWUA 2BYCA 3DGPA 3NBPA 2DNHA 1NBEB 3K5LA 1S1VA 2WZ1A 3LPYA 3JSBA 4H4KA 1NPKA 1RGVA 3GG0A 1VIOA 2CPHA 2MEWA 2Q66A 3OR1A 3PX6A 4I7FA 2LQJA 3MF5A 4PG7A 5FDLA 4DX5A 1I5OB 2K1RB 4UUXA 4BC9A 1QTMA 2QLWA 3FBEA 4ZP9A 4CLPA 1N5VA 1TELA 2VV5A 2YPZA 8RUCA 4YR3A 2BJEA 1Q82T 3QQCD 2HMIA 4C6AA 1F60B 4F3QA 4B3SJ 4DV4J 4DPUA 1RHKB 3ENWA 5EHHA 1UJ4A 1RAJA 4R8UA 2DXDA 3FMBA 4P71A 3VVUA 2N3LA 4C7QA 2RHQB 1RT2A 3HVTB 7FDRA 1W2IA 1U24A 3KK2B 3M8SA 5J2MA 1UVIA 1JB0C 2AJQA 1DQ9A 1ICEB 3THTA 4X64J 2I0XA 2VG6B 4B9SA 4IRCA 1Z4UA 2ZNYA 4W90B 1BHNA 1PAUB 2WAQD 2R2UA 1S7HA 2WOMA 4OHZA 4KR0B 4OFZA 1X4DA 1TL7A 4FN5A 1EIYB 3DRPA 1U6BA 3HHKA 1E6YA 1XMBA 1TL7B 4LF4F 3DOMA 4MFBA 3TANA 1XNRF 3BBFA 3JTPA 4NLDA 4NEZA 3R2DJ 2B4VA 3MMBB 4UT4A 2FLOA 1HBNB 5HANA 3I4HX 2MPUA 2Y1RI 4CLZA 1S0NA 4YY3J 1SV5B 2F9JA 1HBNA 4ZCKA 5CABA 3HP6A 4ECZA 4CLSA 3B8HA 2D7SA 1SV5A 1GX5A 4H54A 4G3IA 1WC6A 2XYHB 3I5BA 3ISZA 2MQOA 4A8QA 2UXBJ 5GADU 2FIUA 1C4CA 2LDYA 2XZDB 1EKRA 1RBAA 1RWOB 2GV1A 5AXLA 1LWCB 5D4OA 4BBYA 4RZRA 2VOOA 4ZOSA 2W9AA 4ZCIA 1LWCA 2Y9HA 3MPDA 3DLJA 3HKZD 3JXOA 4HH0A 1FKAF 4LRBA 5CD4A 3RR7A 1UVLA 3KLEB 5C25B 2HNZB 3DDKA 4DSEA 1LK5A 2XMMA 3O3LA 3UFCX 3KLEA 3RBXA 3VCDA 1Y3KA 1F9HA 2OEKA 4OLOA 2F8EX 4ZVTB 1QE1A 2J7WA 3TR5A 3EGZA 1HNVB 2KDOA 2MHNA 5HAOA 3SYZA 3MR5A 3ONQA 2VPYB 1PC4A 5LOQA 1YJNS 3NL0A 2PC6A 4EYIB 4WYWA 3M8RA 1C1BB 3N6LA 2CPXA 2HURA 1VRQC 3LTOA 5HVGA 2IPOB 2ZHAA 5GAHI 1WKLA 1HQEA 3Q8YA 2BW2A 3ZNJ1 2C2RA 4OHVA 1FDDA 4L74A 4GKKJ 2R8HA 2XHWA 1UEVA 2RKIA 4NYPA 1SJ3P 4C8YA 4Z2XA 3C19A 3PIPQ 5F8HA 5DDOC 3MM6B 2RRAA 4YB5A 4LVNP 1S48A 4WP3A 4X64F 1Q8IA 4Q0BB 2MMYA 1VYAA 2AJ2A 2DEIA 3MD1A 1QY7A 3CCWA 2DPIA 1O5JA 3W9JA 1RBLA 3HVRA 2JOQA 4I2QB 4P7TA 2NQPA 2DYAA 1YBAA 1VQOS 4WP8A 3BEGB 4ILLA 3W66A 4JI8J 4O4GA 1MU2B 2DNNA 2MKYA 1PYOB 4KO0A 2RQMA 3OUYB 1I1GA 2YWKA 3OVAA 5KFLA 2IJFA 2EVZA 1UPMB 2V34A 1TK0A 3CDUA 4OYBA 2W9CB 3P6YC 2AP6A 2CQPA 1CJUB 3C15B 2BE7D 4FZVA 3FFIB 1KR4A 3IG1B 1CJUA 3UNYA 3IM9A 1VRTB 2LFVA 2LXFA 5ETTA 1K1QA 3CCMS 3I9ZA 2FTRA 5DG8A 1J27A 1MWZA 1JJCB 1U02A 3LP0A 5A6PA 2V4JB 4JOUA 4M5IA 1OS5A 2B4UA 2RJZA 3SSRA 3TZWA 3CC7S 4M5HA 3OFEA 3SXLA 3PR5B 1U2CA 1D1UA 1RCXB 3TEGA 1QDUB 3JTNA 5B0AA 1AZSB 1UA1A 4RWWA 2ZUAA 4DPTA 3AT1B 2CQBA 4DR1J 5KFBA 5GADI 4HLBA 2R7RA 2DR9A 2ABYA 4NA1A 4Z7CA 1ZZFA 2RQ4A 2KG1A 2F4VF 3DU5A 3ZTQA 2NSBA 2RE1A 2JL9A 4DOZA 3M8QA 3OVSA 5I3UA 3WX4A 1VBXA 1TL3B 1FVSA 2PMHA 3KJVA 2FJXA 1RA7A 3OR2A 1RHJB 1RT7B 2JJ4D 1T02A 2B4OA 1MROA 2C2DA 3OXLA 2VC1A 5D4PA 1TL1A 2X7IA 3KMQA 3RJMB 3AB2B 3TO8A 4V19J 4NI2A 1R0AB 1R6YA 4DG1B 3NAIA 4ANEA 1OIAA 2QFJA 3SV4A 5A8WA 5J2QA 1VQ9S 1WI6A 3WDOA 1CJVA 2HAFA 1S57A 1RLDA 4DV6J 4F4ZA 4NL5A 2BVZA 2W25A 3WZ0A 5B09A 5GAEU 1KD1T 4UY85 4K4WA 2PFFB 1B70B 1FWKA 2AF6A 5CD4H 4YHHF 2ZH7A 1HWJA 3UVJA 4A47A 3E2EA 1SL2A 2GFFA 1N48A 3O5TB 2OPSB 2PEHA 3PFOA 3H25A 2NS1B 1SQFA 1NO8A 1S49A 4WZQA 4JV5F 2V6AA 3TUJC 2WW8A 3GJRB 3MZIA 1L3UA 2BE2A 1T9TA 3PG9A 2WVDA 3ILLA 3CD0A 4IKAA 3F44A 5RUBA 2JSXA 4QPTA 1JLQB 2RH3A 1T05B 1JJ4A 2DH9A 5HQLA 3G8TA 1Y10A 4C8NA 5KAKA 2QMUB 3MWBA 2HQDA 2GJIA 1IR0A 1SIWB 2VFSA 4ZMMA 2BDPA 2X1FA 2DRDA 2HBRB 3K2YA 1JIHA 1N8RT 4OX8A 5FDLB 4FYXB 3HLUA 1VHIA 2W4PA 1TK5A 2J6TA 1XJWB 4QPXA 4DV1F 5L46A 2IIHA 1NJIT 2QSWA 3ISNC 2QMWA 3ILIA 3GILA 3MCSA 4M63A 2XMKA 1KOHA 2QN6B 2AYMA 3AJ1A 3CCSS 2J0QD 4GO5X 4QWBA 3ZTOA 3VAFA 4DV5F 3RBEA 2VICA 5AE3A 2KT2A 4RW6B 4C3LA 1RSCA 3PRVA 1UP1A 1FDNA 4YDXA 5KFCA 2AU0A 4ELVA 4DFMA 5IC6B 1NDLA 4URQU 4JI6J 3VAKA 2M0GB 2VG6A 2ZNZA 3CW2C 3EZOA 5EWEA 3NY0A 2DNKA 3IBCB 1S4FA 1R0CB 5KFQA 3T5HA 1B99A 1F3FA 2HQIA 4ZPVR 2H4WB 2OHDA 3VALA 5KFXA 2DGQA 1N88A 4B3TF 2XHCA 1PCAA 1YZ6A 2P9CA 3DOMB 4MFBB 4DU7A 5E3CA 2XGPA 4URSA 4X62F 1YBUA 3QPIA 1OSCA 1QVGR 1FE0A 1CQMA 1SC4B 3IS9B 4BC7A 4HL9A 4UOHA 4MIBA 3SFGA 1FO1A 3H90A 1ZBTA 3I96A 3PYDA 3JYTB 1G7CB 4U6PA 2GQQA 2QA1A 3DGVA 3DRXA 3H4DA 1I94J 1UW9A 4KJIA 1FRHA 2DGTA 2CPJA 2J8SA 3OFFA 3IO1A 3HMJG 4DV0F 2IVMA 2YVSA 3SIPB 4AUKA 5BYSA 2I2YA 3VAIA 1HYSB 4GKJF 1B3TA 4OYZA 4RUBA 2IRXA 4M5MA 1X31C 2PA8D 4P73A 1FJGJ 1Q95G 1S1UA 3BO3A 1WG5A 4K4VA 4ECVA 1EQ0A 1K0TA 1S6UA 3NXZA 2CRLA 4YS2A 2DRAA 2JFKA 2DNQA 5BXIA 1DTQB 1BXNA 2E66A 3TWZA 2APOA 4OYXA 4DPWA 3SZ2A 1CPZA 3EZUA 4DL0C 4F50A 1EHWA 3CMAS 4ED1A 3SFUA 3PR4A 1TUGB 2XO6A 2F40A 3JAMU 2ZH5A 2HNYA 4X4OA 1IBMJ 3OTCA 3CF5Q 1TAUA 4RU9A 2XULA 4TN2A 1RWPB 3FRZA 2VDIA 1G2EA 1FFSB 4CO1A 4KHPF 3KJQB 2CQHA 2Z0GA 3M2VB 4PXBA 1SUQB 3R5AA 1U4BA 4C8KA 2QA2A 4FVMA 2VKRA 5E3RA 3RTVA 1HNXJ 2YNIB 2UV8A 2HWTA 4K2XA 3VF0B 8ATCB 5CQGA 4ITSA 1IKVB 1SQGA 3P96A 1U1QA 4B9TA 4O4GB 4JB8B 2ZKTA 2J9EA 4I1TA 4AYBD 1T9WA 5CCLA 2EFVA 1U6FA 2F3JA 3FJ2A 5H9FJ 5EDWA 4DQIA 2UXBF 2O66A 2OMLA 2RILA 4XAKA 1QAYA 3TA0A 5KFUA 3R97A 2Y1JA 2FPHX 2EG2A 2BM1A 2W8KA 5IZHA 2UP1A 3PJXA 2GJFA 4QW8A 3K57A 1U25A 2WSCC 2J0WA 3NCPA 2B6AA 2CPZA 2DGSA 1TAQA 3D68A 3LGNA 3OD2A 3FEYB 3T5JA 1P1LA 5KG6A 2VPWB 4DFPA 1TP7A 2O5DA 7FD1A 4LF7F 1N54B 2HBZB 1HBUA 3BS9A 1PKUA 1JNRB 3T6BA 5KFOA 3J81j 2XLIA 3A8EA 1FRIA 3PDNA 1RA6A 1U6ZA 4FXVA 1QJHA 2FY8A 2A0FB 4MT1A 1RI7A 3KXDA 2D9OA 1RTJB 1XWLA 2QIFA 4NZ6A 5DQHA 5KG2A 3T1YJ 4NX9A 4DV7F 2GAHC 1LKZA 4NZ7A 1N33J 4C3MA 3A8KA 5I42A 4NRUA 4DJBA 1N34F 2AMCB 3D0HE 3L9ZA 4QIGA 5LSOA 1SJRA 3QRQA 3H2UB 3DOLA 2BQRA 1W7WA 1NZ8A 2WOMB 2ZJRQ 1ZYQA 3IRXB 3SDEA 3TQEA 3PO4A 3QLHB 4YUDA 5LMUJ 1UVJA 1JLGB 2VFRA 1F3VA 2KH9A 3G6YA 3I0SB 3NS7B 1RTHA 2I1RA 4C9DA 4HI1A 3E01B 1H0HB 5KG7A 2OP5A 1RTHB 2JC0A 2KVQE 4J9VA 1GX6A 2M7SA 3J80Y 2OPQB 3G9CA 2GHPA 1M0SA 1S7IA 4ELTA 3HXMA 1IWGA 4ILRA 4DR7F 3IGVA 2ZBPA 3LF0A 1FWPA 4IH5A 4M1KA 2QA4G 1RHRB 1RXOB 3D0GE 3KUHA 2LYVA 2GX8A 4OZ0A 2UVWA 2HBQB 1N5TA 1HBOA 1LXJA 3NOCA 2BXJA 3M2UB 1VFJA 3MDFA 4USMA 2OPPB 2J6UA 3P5TL 1K47A 1X4AA 3M6XA 4Y0FA 4N56A 4DI6A 5J1EA 1N56A 4P10A 2RS2A 2WRMA 1YWXA 1GQEA 2CG4A 3MPUB 4NLXA 2RU9A 3SI8A 2CQ2A 1G4CA 3Q83A 1X7VA 2IYIA 3W61A 2BX6A 3E3XA 1XIQA 1NDPA 1Q0NA 4NLVA 5F9LA 1RP5A 2AGOA 4FF2A 5F8NA 2KN4A 3IM8A 4C11B 4DBQA 1C1BA 1HARA 4OI0A 4CZCA 3CVKA 4HEA9 3U1MA 3HFVA 2NYIA 3NGKA 2XB2D 3DN9A 2XMTA 3Q8UA 5DLFA 1T9VA 1BQNA 1Q4RA 1NB7A 3O6QA 3P49B 1PYSB 3HVAA 1SKWA 1DZ5A 4WU3A 3V5RA 2JLEA 2XO7A 1VK3A 4HTJA 1XC9A 4HI2A 1NDCA 3IR5B 4P2SA 2HNDA 4DZDA 2C3OA 1WHWA 5J2PB 3DI6B 1WJ9A 2HGMA 2QYCA 3GONA 2D3O1 4K5RA 4OYOA 2R8KA 5K20B 1H3DA 2K7KA 3PRBA 4ES2A 4Y2MA 3MAHA 4I2QA 4DV4F 3A13A 2XEXA 3M9NB 1IKWB 1T0TV 3N5FA 3U27A 1FF2A 3D1QA 2ZE2A 4ES3A 5I3QA 1VC5A 3CD5A 1Q7YT 1D0EA 4K0KF 1IM6A 4TVAB 1RWVB 1R6VA 1HIYA 4IDKB 4DPOA 1KONA 2CG8A 2IYGA 3NCQA 4IDKA 4DL5A 1GMWA 1GMUA 3HFKA 3R6LB 4I6WA 1TKDA 2RRBA 3M32A 4O44A 2JEJA 1VQPS 1NSKL 3C15A 4OI6A 3CD6S 2YQ1A 1RK8A 3IG1A 1Q8KA 2VQEJ 2MTLA 3CJ2A 3GFZA 5EWGA 2L9NA 2MHEA 3MEEB 2CJAA 2EBEA 3UI3A 1G6BA 2CQGA 3VZIA 3WQPA 4N5SA 2CYYA 2CQIA 3LP1B 4DPYA 4DEZA 5G0RB 3RRHA 5DZ6A 2DR7A 4YFUA 3TUPA 4GMKA 2IM1A 3I0RB 3KUGA 1FD2A 2JWNA 4LFAF 1VI7A 3I0RA 5KFRA 4EUVA 4HKQA 1Y5IB 1AFJA 3MECB 2VC0A 3R3TA 2Z2ZA 5BYQA 3KLHA 3HSGA 2ERRA 2D69A 1AA1B 3SQGA 4PQUA 3RW6A 1D09B 2FDNA 5FIIA 4ERDA 4OYIA 2YNGA 4QW9A 1ZAVA 3NNAA 2NZ4A 3QGPA 2MKSA 5D0EA 3CC4S 4DSJA 2YQ0A 3V4IB 3NLCA 1Q8BA 2RDDA 1DURA 4EO8A 5CZVA 3WIVA 4DCPB 4GVBA 4W4MA 1BGXT 4F0KA 5KT6A 3KJVB 3HF5A 5DLGA 3R1HA 1U26A 3H40A 4EBEA 1SC3B 1MMDA 1NU4A 1SB6A 3T5KA 2DIVA 3ZTSA 4K4SA 2J9CA 4A4JA 3DYAB 1L3VA 5E3QA 5GAHU 3KLIA 3GYGA 2OJ3A 2F4VJ 1B64A 2CXEA 1REVB 2E1MC 3D1OA 3D6FB 4P2XA 2K3IA 3ZNUA 2KHDA 2C3PA 2QRRA 1ZM9A 4OJHA 4PYDA 1SC6A 2NUUG 2CIMA 5D4LA 3BF4A 2RMLA 1SH0A 2CPFA 1DLOA 3GJTB 3R5GA 3M4XA 2FHJA 3CJKA 5CAAA 3HKWA 4KYZA 3BN4A 3EGVA 3V6DA 1S76D 3W9HA 3CJRA 2C3YA 3OHBA 2IRYA 2L41A 3O44A 3PTWA 5D0GA 5JUMA 1U45A 3UNGC 4XO0A 2V8GA 2MZQA 3PZPA 2B7CB 3H5XA 4U7UK 1UZHA 4GC6A 3PNIA 1FNOA 5EX3A 2H48B 3LAKA 5GMKa 2P6SA 2IC3B 1O51A 3Q8VA 4LRFA 3GIRA 2BE2B 4M5GA 2B0GA 5DZ7A 1Y0HA 4PUOA 1X8DA 3R6GB 3I6PA 1UA0A 1NNDA 3J7YU 4LFBF 3UW1A 4X4SA 5ETPA 1R7IA 1R31A 4LSZB 1VRUA 1S6OA 1S6QB 5EGYA 3NBPB 4FPRA 4CP5A 4JV5J 1NK0A 2W2MP 1KQGB 1S79A 4LFBJ 1HR0F 3UDLA 3SSQA 2ALYB 2C2ZB 2OEMA 4I7FB 2HKEA 3MCMA 2DHHA 4KH0B 5K9FA 1RT1A 1GTEA 3BH7B 3BSOA 2LEBA 4UZBA 2R8IA 3PHTA 5EWFA 2V94A 3ET6B 2V63A 5CYQB 3M1VA 4QIEA 4DR3J 1N33F 3JB9k 2LEAA 4R8UB 3UN3A 5HLFB 3ITHB 1HQ2A 2ALZA 4ZVUB 4O3SA 4G1IA 2CQ4A
chains in the Genus database with same CATH topology
1KBRA 3HD1A 3HSJA 4M5KA 3UD5A 3KUHA 5ETOA 4AD6A 4M5GA 3HSDA 4M5NA 4CWBA 1RU1A 1RTZA 3HD2A 5ETTA 5ETVA 4CYUA 3MCOA 3ILJA 1RAOA 3ILLA 5ETPA 1TMJA 1TMMA 5ETNA 4CYUB 1RB0A 2F63A 5ETSA 3ILOA 2BMBA 3MCNA 1RU2A 4M5IA 4F7VA 3KUGA 4M5HA 4M5MA 5ETKA 1EX8A 3MCMA 5ETQA 5ETLA 5ETMA 1F9HA 1G4CA 2QX0A 4PZVA 3UDEA 2F65A 4CRJA 3KUEA 5ETRA 3HSGA 1Q0NA 3HT0A 1EQ0A 1IM6A 3UDVA 3ILIA 1DY3A 1HKAA 1EQMA 2CG8A 4M5JA 1CBKA 1HQ2A 4M5LA 3IP0A 3HSZA 3QBCA 3HCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBR A;  3HD1 A;  3HSJ A;  4M5K A;  3UD5 A;  3KUH A;  5ETO A;  4AD6 A;  4M5G A;  3HSD A;  4M5N A;  4CWB A;  1RU1 A;  1RTZ A;  3HD2 A;  5ETT A;  5ETV A;  4CYU A;  3MCO A;  3ILJ A;  1RAO A;  3ILL A;  5ETP A;  1TMJ A;  1TMM A;  5ETN A;  4CYU B;  1RB0 A;  2F63 A;  5ETS A;  3ILO A;  2BMB A;  3MCN A;  1RU2 A;  4M5I A;  4F7V A;  3KUG A;  4M5H A;  4M5M A;  5ETK A;  1EX8 A;  3MCM A;  5ETQ A;  5ETL A;  5ETM A;  1F9H A;  1G4C A;  2QX0 A;  4PZV A;  3UDE A;  2F65 A;  4CRJ A;  3KUE A;  5ETR A;  3HSG A;  1Q0N A;  3HT0 A;  1EQ0 A;  1IM6 A;  3UDV A;  3ILI A;  1DY3 A;  1HKA A;  1EQM A;  2CG8 A;  4M5J A;  1CBK A;  1HQ2 A;  4M5L A;  3IP0 A;  3HSZ A;  3QBC A;  3HCX A; 
#chains in the Genus database with same CATH topology
 2HQ3 A;  4LSL A;  2FJA B;  3PRD A;  4PXD A;  2ZOG A;  4ZCL A;  2EFG A;  3MAQ A;  2BOA A;  1N32 J;  4LSL B;  2DH8 A;  1TFY A;  3EDR B;  3MMC A;  4A8F A;  3A3O B;  3MOZ A;  2OEJ A;  4LSN B;  4F04 B;  4RU2 A;  3MMC B;  3OTO J;  4WWS A;  2AGP A;  4G1P A;  2RAQ A;  3HDS A;  1KSP A;  1NJW A;  3KYL A;  3M8Z A;  4DZ6 A;  2W9B B;  1X4H A;  3TQ1 A;  1E6Y B;  1WHY A;  2XG8 A;  3D3C J;  4DDF A;  4E8U A;  5HMX A;  3OTO F;  3I55 S;  2MZ1 A;  4DV1 J;  4OHX A;  2FYX A;  3RBZ A;  5HVH A;  4BS2 A;  2CJQ A;  5DS7 A;  5AXN A;  2HZV A;  2M52 A;  5HN0 A;  2HWI A;  4P6Q A;  3TVY A;  3D6T B;  3PAC A;  5KFE A;  2BZ2 A;  1KLM B;  1P6T A;  1H2V Z;  2PD1 A;  5D78 A;  1XNR J;  1UKU A;  4GKJ J;  1M5S A;  1S1W A;  4L73 A;  4RW8 A;  3JS9 A;  1N0U A;  4Q5V A;  2PI5 A;  3MI7 X;  4ECS A;  2D3Z A;  2DIS A;  3KLF A;  3LUY A;  3PYG A;  5A8R B;  5BR8 J;  3EX7 B;  3UN2 A;  3QSY B;  2ASJ A;  1VOM A;  1JQG A;  1LFP A;  1P9Q C;  3GCW P;  2DEJ A;  3QT8 A;  5E2Q A;  3U1L A;  2K8G A;  2MXY A;  3VAJ A;  3I31 A;  3KHH A;  5DDQ C;  2HVD A;  4A8X A;  5C25 A;  5HMY A;  1VIX A;  3DRR B;  4I4B A;  2DHG A;  4J90 A;  4RBT A;  3AA9 A;  4WTO B;  1SJ4 P;  3D9B A;  3OSP A;  5J1P A;  2MKI A;  3OLA A;  5A8K B;  1QE1 B;  3BRE A;  5HBM B;  4NCG A;  4QWE A;  2ZDO A;  4DUZ J;  4TYA A;  2ZOF A;  1RAI B;  2R42 A;  4D3H A;  4DR4 F;  4FF4 A;  2N7Y A;  2V8D A;  3C66 A;  5HK4 A;  3QGG A;  4QWA A;  4J9U E;  5F3T A;  4C11 A;  4WK1 A;  2MGZ B;  1D9F A;  2HZC A;  2JLG A;  2HW3 A;  4USH A;  4IR9 A;  4MH8 A;  1ZZN A;  2GC8 A;  1VBZ A;  2JH3 A;  4ZJL A;  5LSR A;  1U48 A;  3N9U C;  4Q8F A;  3MR7 A;  3CJT A;  3IWX A;  1DHM A;  1BQN B;  2OD4 A;  5L39 A;  3H20 A;  1X9W A;  4RJV A;  4AL5 A;  1NME B;  2VPZ B;  5LT5 A;  1Q5Y A;  4LQ9 A;  2HQC A;  3FQK A;  2KXN B;  3M9M B;  3AB4 B;  3QGI A;  3DDN A;  4PYA A;  3GYN A;  1JMT A;  2AJ4 A;  2M3D A;  2YTC A;  3HHL A;  4QIF A;  1QAJ A;  5JMN A;  3HO1 A;  3PYE A;  1HQU A;  2C2M B;  5HP1 B;  2CPE A;  2I5J A;  2YKM B;  4PG5 A;  2RRN A;  5ETR A;  4N47 A;  1IKW A;  1FTC A;  2I5J B;  2IJN A;  4KGZ B;  2Z30 B;  2V4R A;  1X4F A;  2QFI A;  1UZD A;  4C8Z A;  3VGS A;  3AOB A;  4J9M A;  3I4P A;  1QUV A;  2B8Q A;  4N8N A;  2EFN A;  1HHQ A;  1X4G A;  2BAN B;  2BJ1 A;  2ZZT A;  3D4J A;  3HD1 A;  4LR8 A;  1YK9 A;  5HAT A;  4CTA B;  2QL7 B;  3NMA A;  4O44 B;  3UCU P;  2QLX A;  4OI4 A;  2KT3 A;  4ID8 A;  2Z2Y B;  1RWN B;  3CDE A;  1JLF A;  1WC1 A;  2WSF C;  3MED B;  2O01 C;  1FDA A;  3LP0 B;  2IM2 A;  1K73 T;  1D9D A;  4QOT A;  1OY8 A;  4QIW D;  3ZZP A;  2W2P P;  5L1I A;  3ULH A;  4JI0 J;  4U7C A;  3EMT A;  3FCH A;  1RKI A;  1CJK B;  1UPP A;  1I51 B;  4LF6 F;  4CH7 A;  2MKK A;  4IG3 A;  1IJE B;  4ICL B;  2KHC A;  3AXK A;  1UWB B;  3UDC A;  5DDP C;  4IUF A;  1DFD A;  4CO5 A;  4DXL A;  3MEC A;  3KLH B;  1RKJ A;  3BR8 A;  4X65 F;  3FDS A;  3PCO B;  2VJU A;  4XPC A;  3RB6 A;  1VQL S;  1O6X A;  1RAA B;  2MZS A;  4DR5 J;  1KEK A;  2A6O A;  3PXG a;  5A2Q Y;  1Y5L B;  2KJW A;  1S0O A;  2JEG A;  1FDB A;  2G0I A;  3UE2 A;  4CO4 A;  2KO1 A;  2X3D A;  4OJG A;  3M9O B;  4EO6 A;  3WIU A;  3BO2 A;  1JJH A;  4Q45 A;  3JTO A;  3X3U A;  4ED5 A;  2E44 A;  3CD7 A;  1P9Y A;  1MRO B;  1FX4 A;  1RB0 A;  3EGN A;  1XN9 A;  2M9K A;  5LSL A;  5AJ3 J;  1TL1 B;  1KTV A;  1SIZ A;  1RU2 A;  2GCF A;  1VGY A;  2GAG C;  2Q6C A;  2SXL A;  1H72 C;  4EI2 A;  2YWH A;  3MM7 A;  4XDC A;  2ZUG A;  4DG1 A;  4LF1 A;  3C6T B;  1OYE A;  1WC5 A;  4NAS A;  2LCW A;  1K44 A;  4TNO A;  4ZLP A;  1YVF A;  2FC8 A;  2OPQ A;  3IGN A;  1VCT A;  3VGV A;  2CQ0 A;  4DUT A;  4ETX A;  3L4B C;  1LWE A;  4HVZ A;  2CQD A;  2I38 A;  5D0H A;  1JKH A;  5AT1 B;  1RTD A;  3EJM A;  4X2B A;  1JLE B;  4U8V A;  5JJB A;  1RTD B;  4DQS A;  1KHV A;  2UUA J;  3KHR A;  3I56 S;  1SH2 A;  2J7U A;  3VGU A;  3SCL E;  2C3M A;  3M30 A;  3LAN A;  2X1B A;  2CZV C;  2Y1L B;  1RHU B;  2KRR A;  1HBO B;  8AT1 B;  1XBW A;  4CLL A;  1U09 A;  1YGY A;  2HRY A;  2MQM A;  3F56 A;  2ACM A;  2FLP A;  2UUA F;  3CE8 A;  4FXW A;  3G6E S;  4LF5 F;  2QMX A;  3AD8 C;  3FNN A;  4NLS A;  4FDF A;  2YXL A;  2BOP A;  4NLY A;  4C4W A;  4O23 A;  3MFH A;  2R7V A;  3FBC A;  2ZJP Q;  2ACY A;  5L1K A;  2DKO B;  2OSQ A;  1LFW A;  1QAX A;  2CNO B;  1RYR A;  1ZTW A;  3CJ0 A;  1Q8L A;  4YP3 A;  4G65 A;  2F65 A;  2K1R A;  1U49 A;  1RUS A;  4HDG A;  2ZKU A;  4U96 A;  1VQ4 S;  3IR7 B;  3Q22 A;  1GXU A;  3M1V B;  5LMN J;  1TL5 A;  1VJQ A;  4LRA A;  3DRS A;  2ZC4 A;  4QIV A;  3H7H B;  3AQO A;  5GMD A;  4CLT A;  5DGA A;  3KNG A;  3OHA A;  2VG7 B;  2WVB A;  3W65 A;  3FZ2 A;  4FXD A;  4KKO A;  3DHW C;  4NA2 A;  2FVQ A;  3DLL Q;  1UFW A;  4YME A;  3PKY A;  3P3D A;  4WPA A;  1WG4 A;  4FPI A;  3NG8 A;  1QSL A;  3NNH A;  2IM0 A;  4CLF A;  1VHF A;  3LP2 B;  2M70 A;  3OJS A;  1BE4 A;  5MAO A;  1NHU A;  2NRE A;  4O3P A;  5AJ3 F;  3T1Y F;  3R7N B;  4WYL A;  2XGQ A;  2J0X A;  4WBF A;  3CNQ P;  4NOH A;  1REG X;  1Y4Z B;  2EBG A;  3UR0 A;  2OFH X;  4KQZ A;  3GSD A;  4NLP A;  4USJ C;  2XM3 A;  2AYB A;  2B51 A;  1V6H A;  1NK9 A;  4B02 A;  4USV A;  1NRK A;  4DV2 J;  4B9M A;  1WUU A;  3IAM 9;  5AXK A;  4WZM A;  2DGW A;  5CZX A;  4LUB A;  4U7U D;  3SCK E;  1KLM A;  5LXY A;  4JI5 J;  3DCA A;  2H5I B;  1IBK J;  4ID5 A;  1FRJ A;  2ZBR A;  2MY7 A;  4X62 J;  4OLP A;  4RW8 B;  2QA4 S;  3TAR A;  4DN9 A;  1S10 A;  4B9V A;  2VFT A;  1RE1 B;  4KV8 B;  4OJ3 A;  4OYW A;  3K89 A;  3NGD A;  2IBK A;  4O3Q A;  3LP1 A;  5KG1 A;  3OTD A;  4R5P A;  1FKP B;  1OPI A;  1PC5 A;  1TR0 A;  1FJ7 A;  1NK7 A;  1HNZ J;  4RW4 A;  2H51 B;  3D28 A;  1HYS A;  4OYA A;  4F7V A;  4DS5 A;  4ZCM A;  4UW2 A;  4PWD B;  4H4O B;  2HYI B;  3DRR A;  3THP A;  4OI1 A;  3Q8R B;  1GMV A;  1CS4 A;  2R7Q A;  2Q79 A;  3CCZ A;  3MAA A;  4Y28 C;  5CHC B;  3SQG B;  2XQC A;  3K8W A;  1AB8 A;  4JV2 A;  3G87 A;  5JXS A;  3PX4 A;  3MFI A;  3AOA A;  2HHU A;  1EQM A;  3CSK A;  2HPU A;  1SH3 A;  1VQS A;  5ITH A;  5G4D A;  1FRM A;  4DR3 F;  3U1N A;  3V81 B;  2AEJ A;  4CNY A;  1F9E B;  2BW7 A;  3QGH A;  1F0X A;  3MUR P;  4DUY F;  4ELU A;  4PCQ A;  1FNM A;  2R3V A;  1FXD A;  3GIJ A;  3DYA A;  4ER8 A;  3L95 X;  2GW8 A;  1P27 B;  3L7U A;  3MPW A;  2GJ2 A;  3OXG A;  1SKS A;  1PBA A;  4J9P A;  1TV6 B;  4IOB A;  5KFG A;  1ZA1 B;  1S9E A;  2AJF E;  1JLC A;  4F25 A;  5DG9 A;  2ASL A;  3V6J A;  4KFB B;  1S9E B;  1KVK A;  4MK8 A;  4PPD A;  4J9N A;  1XMO F;  3OL9 A;  1BQX A;  4EYH B;  3R7S B;  1UW4 A;  2RQK A;  1N5Y A;  4N8O A;  1BUX A;  1V3Z A;  2R2T A;  2YNI A;  3B54 A;  3M2V A;  2CUY A;  4QR1 A;  2JEF A;  4M94 A;  1Z2Z A;  4PAA A;  4C48 A;  3M6W A;  3CCR S;  2FZG B;  4LMZ A;  1TKX A;  2RUG A;  4WII A;  1HWI A;  3GV8 B;  2ASD A;  2Y0B B;  3W62 A;  3W8G A;  1HPZ B;  2MB0 B;  2HHW A;  2Q43 A;  3S1T A;  3FBF A;  5AE2 A;  1JXV A;  3EE3 A;  3CJS A;  4WFY A;  5AXM A;  4UOG A;  3OVB A;  5H9E K;  4OQJ A;  3U02 A;  4ATN A;  3F41 A;  5C42 B;  3RU0 A;  1VQ8 S;  4JV1 A;  1Q1K A;  5KT5 A;  1RT6 B;  3B82 A;  1FRX A;  4B3R J;  5ETV A;  3M05 A;  5C42 A;  3ETO A;  4HHU A;  4ZN1 A;  5EX0 A;  3H2L A;  1JJ2 R;  3QO9 B;  1B4S A;  2J0S D;  3T9Z A;  1GNK A;  3EXY A;  1F5A A;  3VWS A;  1S1T B;  4DV0 J;  4RNM A;  3BGU A;  4IH7 A;  3ISN D;  3IFE A;  2HLT A;  2DNR A;  4DR5 F;  4F36 A;  2CQC A;  2CJ9 A;  4OZ1 A;  4WFZ A;  2G9O A;  3MM9 A;  2F4F A;  3HT0 A;  1NH7 A;  4XTT A;  3W60 A;  4ED6 A;  1Q79 A;  2Q6B A;  3BYR A;  1BMQ B;  1DY3 A;  3I87 A;  2JNJ A;  4F02 A;  4LF8 F;  2XCA A;  1C0U A;  1F5B A;  1ZA2 B;  5D77 A;  4CH0 S;  5KFK A;  2LEP A;  1GAO A;  2DXF A;  1WF0 A;  1CJT A;  1T03 A;  4TY8 A;  1U8W A;  1FD8 A;  4UQT A;  2B9Y A;  2W7O A;  2HQG A;  3IRW P;  2RF2 A;  2DT9 A;  3DOL B;  1N34 J;  1KQF B;  1TL3 A;  2VON A;  4OZL A;  3OL7 A;  2EPI A;  3IRX A;  4OL8 A;  2W7P A;  4WP9 A;  4FYW B;  4TU8 A;  4GKK F;  2MJN A;  2GVD B;  2FVP A;  2V8P A;  3OQ2 A;  1R0A A;  3KWM A;  2FLN A;  2HVI A;  2DRB A;  1BWV A;  4EBC A;  4WU2 A;  2BJ7 A;  3J7Y I;  2DR6 A;  1B7F A;  1FVQ A;  1H7X A;  1HD1 A;  3QJJ A;  4PAB A;  1L3S A;  4F0M A;  4OX9 J;  2BRL A;  2GO9 A;  2F5G A;  1TQL A;  4JI4 J;  2OKQ A;  3LWM A;  3MM8 B;  1NAQ A;  4OX7 A;  1MNE A;  5E3P A;  1WEX A;  3FGV A;  3MM8 A;  4HHH A;  4R0J A;  1JLA B;  3Q2T C;  1JLE A;  2YWE A;  4J5O A;  3G2X A;  2P8I A;  1IBM F;  2J6S A;  1GFW B;  5A8R A;  4O3O A;  4DQQ A;  4OX6 A;  4TU7 A;  1TU0 B;  1RBO B;  4ECY A;  4UY8 T;  2VBZ A;  1VK8 A;  1NSA A;  2H3E B;  1NJZ A;  4KHP J;  3C2P A;  2YKP A;  4E2F B;  2WK4 A;  5E3A A;  1XNQ F;  4KY3 A;  5IQQ A;  2HZA A;  2CAJ A;  3PEH A;  4Z7Y A;  5HVF A;  4OMF G;  3RRK A;  3W1Y C;  3HJF A;  1IXK A;  2Z4P A;  1RAC B;  1T8E A;  2JRS A;  2XS2 A;  1MWY A;  3TX8 A;  4DF8 A;  4RW7 B;  2OPR B;  4F67 A;  4NE9 C;  4LFC F;  3T19 A;  3ICL A;  1QLN A;  4PWU A;  1BQM A;  3HHL D;  2OAU A;  4ZHR B;  3BSN A;  5IV4 A;  5BR8 F;  2ZH6 A;  1VC6 A;  3N0V A;  2BKN A;  3GCX P;  4CI0 B;  2OLW A;  3LGM A;  4LIW A;  4MKV A;  3HUL A;  4B17 A;  2RKI B;  2U2F A;  1P1T A;  4KRW A;  5SUH A;  2RSQ A;  2RD5 C;  4M5N A;  1XR5 A;  1IKX B;  2HWH A;  1VDH A;  1VS3 A;  3PW0 A;  4IR1 A;  3FSI A;  1RHQ B;  2Y1I A;  1PIE A;  2FB0 A;  1YRT A;  4P2F A;  1M1H A;  1SL0 A;  4AND A;  3UD4 P;  1WHV A;  3MUM P;  4K4Z A;  2W4D A;  3FSX A;  2WW4 A;  2GO8 A;  4RUH A;  2QTW A;  3GE9 A;  4ZS6 A;  3ZO7 A;  2W24 A;  2HHX A;  1CSJ A;  2DGX A;  2O67 A;  4ZPB A;  2N7C A;  4X4R A;  2BR0 A;  5T7L B;  5E33 A;  3A3N B;  4A8S A;  1N32 F;  1RAG B;  3R5J B;  1KLN A;  1ZPV A;  3DHX A;  2BAN A;  4JI1 J;  4B3O B;  3JQJ A;  1MLA A;  3IWL A;  4KT0 C;  4B3M J;  2VQF J;  4MJK A;  3FFI A;  3C3L A;  4ID5 B;  4EWT A;  1V5V A;  2CNN B;  1T7P A;  4Y65 A;  2PFD A;  5LMU F;  3IA0 A;  1CUL B;  4B9L A;  1AXQ A;  5HSP A;  4EZ9 A;  1IQZ A;  5LJ5 Y;  1CUL A;  1PJ6 A;  5CH7 B;  1GTH A;  2DHS A;  3J81 U;  1FNX H;  3E51 A;  3KLG B;  1N6Q A;  1FKP A;  1KQK A;  3DNC A;  4RLE A;  2MQL A;  3VAH A;  2HS4 A;  4RW4 B;  4DU8 A;  2MDA A;  2VD3 A;  2XNQ A;  4ICL A;  4CLU A;  4QQB A;  1Z1Z A;  3OV7 A;  2K3K A;  2FC9 A;  4KE5 A;  2B4P A;  2G2O A;  2KU7 A;  4X4P A;  4O0N A;  4QJV A;  1S1U B;  2DBB A;  2HK2 A;  3D5M A;  4ZP6 A;  1Y11 A;  3TI0 A;  1M5P C;  4LFC J;  5AE1 A;  5D6G A;  3H59 A;  1Z2L A;  2VQE F;  2YBV A;  3M8W A;  3DM2 A;  4NEY A;  3WX8 A;  4ZKA A;  2A2D A;  1S99 A;  5M2P A;  1X5P A;  1RT7 A;  2QG9 B;  3ADA C;  1VQ5 S;  2M2B A;  1X60 A;  1HWK A;  2UZA A;  3GZ7 A;  5DM7 Q;  2AX1 A;  4MYT A;  3FMW A;  4U8Y A;  4KHR A;  4JBC A;  4PUO B;  4NI2 B;  1AW0 A;  2XMJ A;  2RB7 A;  3T5L A;  3FCW A;  3TJA A;  2K7J A;  3MM7 B;  5KFA A;  4A48 A;  4OYM A;  4PRF A;  1CC8 A;  2KG0 A;  1KC8 T;  3TAQ A;  5KG0 A;  1WC4 A;  3PW5 A;  1DLO B;  5LM7 E;  2ZWO A;  3MGJ A;  4NCA A;  1UVM A;  3W64 A;  1TKT B;  4DL4 A;  1QSS A;  2JEI A;  3W3S A;  3D1H A;  3EM1 A;  2E5J A;  5J2N A;  3C6U B;  2MST A;  2WTF A;  5J2N B;  3KJF B;  1RAH B;  2HHP A;  2WVF A;  2ZIT A;  4NLT A;  5KFY A;  1UCN A;  2UUT A;  4N77 A;  3H5S A;  2YKQ A;  2A1B A;  3S01 A;  5IFM A;  1SL1 A;  2ASY A;  2YKN A;  3R5D A;  4BHQ A;  1VRU B;  3BDP A;  5KT3 A;  5M2U A;  1YJU A;  3ILJ A;  1RAO A;  1RZM A;  2YKN B;  2XI3 A;  2XSJ B;  4XIU A;  3BV8 A;  4ZDN A;  4J7C A;  4HH1 A;  1WF2 A;  2MKJ A;  1GXT A;  3OR1 B;  3F73 A;  5C2C A;  1OQ6 A;  2B56 A;  4NLQ A;  2YH1 A;  1S1T A;  2QL5 B;  2OIH A;  4WKY A;  4WFX A;  3ZZR A;  2E5G A;  3KG4 A;  1RT5 B;  4P74 A;  3C46 A;  5HLF A;  1ZAW A;  1H74 A;  2GQC A;  2LQB A;  3QAU A;  4LBH A;  2FGC A;  3DRS B;  4YEA A;  3TAM B;  2XY7 A;  3PKM A;  1WSV A;  4TY9 A;  3RAQ A;  2ZD1 B;  4JYA J;  1Y5N B;  3ITH A;  2FLL A;  1UJ5 A;  2CZ4 A;  1WC3 A;  1U1P A;  4IOA Q;  1RQ0 A;  4TY8 B;  2I6W A;  1RT2 B;  4QBU A;  3VR1 A;  3FSY A;  5I42 B;  5FD1 A;  2L9D A;  3KK2 A;  1HLW A;  1UL3 A;  4M8L A;  3WBZ A;  3ZZU A;  1HR0 J;  1F6T A;  3KLV A;  1LQ9 A;  2RVJ A;  3K5O A;  1XMQ J;  4G6V B;  4N7T A;  3DLK A;  2WVC A;  3GFX A;  5M2R A;  4C3K A;  4P72 A;  1YRX A;  3HHL C;  2KM8 C;  3BQ1 A;  2DNG A;  4I68 A;  4B3S F;  3UWT A;  2RHS B;  4F26 A;  3MEG B;  1N52 B;  1U1N A;  4KHM A;  5IWA F;  1HHS A;  1H2T Z;  1T94 A;  1Y9O A;  2HVE A;  5LL6 d;  3E01 A;  4ALZ A;  2J7K A;  4UOC A;  3TYT A;  3IP0 A;  2DIT A;  2O3D A;  1KWM A;  4OZ2 A;  1IBL F;  2MY8 A;  2FQQ B;  3FUY A;  1J5E J;  2Y8Y A;  2ROG A;  5ETO A;  4KV8 A;  3MXH P;  2N4C A;  3M8P B;  4CM0 A;  2D3U A;  2ZBQ A;  2DR8 A;  2RDI A;  2GIQ A;  3IBF B;  3M8P A;  4ZP7 A;  3KLF B;  1NPP A;  2EI5 A;  2IAJ A;  2CVE A;  2QL9 B;  3S7R A;  4EBD A;  3TNV A;  1KHW A;  1RT4 B;  1ZPW X;  1QAI A;  3US5 A;  4FS2 A;  1S12 A;  3P8B B;  2OD6 A;  2KXH A;  3KDO A;  4CCH A;  2C2K B;  4NWB A;  5A8K A;  1RAE B;  4QWD A;  2ZM6 J;  3GTY X;  2M4M A;  3CCT A;  9ATC B;  2MQQ A;  5CXT A;  1YG0 A;  2G1H A;  1R8C A;  2MSS A;  4RPF A;  2LQ9 A;  4DR2 J;  1R0B G;  5KT4 A;  2D3O R;  1S1X B;  2IJR A;  1T9Y A;  2ILZ A;  2OPR A;  1KS2 A;  4A46 A;  1SJ1 A;  3K5N A;  3PW7 A;  2R7S A;  4ZVQ B;  1S1X A;  1B0T A;  2F9D A;  1T9U A;  4LRC A;  3RW7 A;  4WFA Q;  3UCZ P;  4FVC A;  1T3N A;  4QYZ K;  1NH8 A;  2AGQ A;  1FKO B;  1HFE L;  5HI7 A;  3TAP A;  4RKU C;  1PIL A;  4LF5 J;  2DNY A;  2B3T B;  3G82 A;  1T9X A;  4PXC A;  1GEH A;  4Z37 A;  5C24 B;  3AJ2 A;  4C8L A;  2VG5 B;  4NXN J;  3G82 B;  2HNY B;  1FK9 A;  1XK8 A;  2R7O A;  3JAM Y;  1B0P A;  3QWU A;  4ECQ A;  2AV5 A;  4NYO A;  3UCG A;  4V1A k;  3VQS A;  3IN5 A;  3H8Y A;  1S0M A;  2W7A A;  4C97 A;  5J1N A;  1WC0 A;  4IFY B;  3CPW R;  2IHR 1;  2HND B;  2FJV A;  1CVJ A;  1KN6 A;  2XNR A;  5LJ3 Y;  2XYG B;  2KFZ A;  3W2W A;  4WFN Q;  2H65 B;  2QE5 A;  2YKM A;  4FYY B;  5CYJ A;  1F2H A;  2V2V A;  3GIM A;  1XMQ F;  3RRG A;  2QX0 A;  2C3U A;  3BB5 A;  2W8L A;  1M5H A;  3DXB A;  5F41 A;  3A3P B;  2ZE2 B;  1UEK A;  4CLK A;  2CJY B;  2DY9 A;  2JVR A;  3O1L A;  4CTA A;  2YY3 A;  3OUY A;  3Q89 A;  3HI9 A;  1KBR A;  1H73 A;  2EK6 A;  1WOP A;  2ZBI A;  4DX6 A;  2DGO A;  2NXN A;  2BJD A;  2PDA A;  3M32 B;  2ZH4 A;  3N5B A;  5D3G B;  1YJR A;  2H5J B;  3TW0 A;  2RU3 A;  3LAM A;  3VAM A;  1WTB A;  1QTN B;  4ZLL A;  1FWL A;  3D2W A;  2D1C A;  6FD1 A;  4F4W A;  4OIX A;  3P5B P;  2ZJQ Q;  2EFO A;  5GVQ A;  5IOL A;  1M5O C;  2VAS A;  2MKH A;  3OBI A;  1UAW A;  2BMB A;  4ECT A;  3SEO A;  2V4J A;  2MZR A;  2W2O P;  2V2Z A;  3FK4 A;  4BCA A;  1AZS A;  5HJY A;  3GJS B;  3LW5 C;  4IFV A;  1OYD A;  1RAB B;  1YDL A;  3K8V A;  1NLK L;  3LPE A;  3M6V A;  5GAE I;  4EK2 A;  4UQG A;  4J9S A;  1VR6 A;  1HMV A;  3BR9 A;  3OSN A;  2W01 A;  5KFF A;  4LRE A;  4DV6 F;  2R7U A;  2L3M A;  1HMV B;  4DR2 F;  1WTF A;  2R7X A;  5GAG I;  1T03 B;  2YNG B;  4J9Q A;  3GV7 B;  1RT3 A;  2PE8 A;  3ELH A;  5F8I A;  2G2Y A;  1UMJ A;  3OT9 A;  3CUN A;  3AFG A;  3T1A A;  4JI3 J;  2G4B A;  1JXE A;  4CNZ A;  2N4D A;  2WVE A;  2JDJ A;  1L3T A;  4DCJ B;  4ED4 A;  1S9G A;  2DNZ A;  2JVO A;  4FP9 A;  5F8L A;  4NLO A;  2DR5 A;  2R7T A;  4JI3 F;  4NML A;  2XSF A;  3VHQ A;  1NSP A;  3VGT A;  3AD9 C;  3NMR A;  5T14 A;  1NXI A;  5E7O B;  2ZDP A;  3EPG A;  3MHY A;  5I4M A;  1JLB A;  2YPY A;  1NEE A;  3CCQ S;  2KYZ A;  5ETL A;  5ETM A;  4F4A A;  5A8W B;  3IMQ J;  1FCA A;  2IDL A;  1ELO A;  3UVJ B;  4ECX A;  1W2B R;  2DCU B;  2EEY A;  1WAC A;  1HWU A;  4DL7 A;  2H1Y A;  4AE5 A;  4MK9 A;  3KOA A;  3M30 B;  3ZC4 A;  3DFE A;  3QRP A;  3V6K A;  1SKR A;  1I3O B;  1YBT A;  4TYB A;  1WKK A;  4X4Q A;  2U1A A;  1LOU A;  3PX0 A;  4RW9 A;  1HD0 A;  1ROF A;  2GZO A;  2JC1 A;  5JVH Q;  4KPY A;  3MM5 B;  4R25 A;  3C16 A;  2R2S A;  4ED7 A;  2WB4 A;  3HHE A;  3C16 B;  1NK5 A;  2XY5 A;  3DGP B;  3V4I A;  5KFD A;  5F8G A;  3HX9 A;  2C2N A;  2UV8 G;  1K1S A;  4RBU A;  4WE1 B;  4Y34 A;  4PG8 A;  1RCO B;  3EVM A;  3JQM A;  1X4E A;  2PI4 A;  1G1X A;  5B0C A;  3HHN B;  1RLC L;  2MLY A;  5K8O A;  4CH1 A;  2RT3 A;  4ZVS B;  2Y3Y A;  2OGU A;  4MTP A;  4ZHR A;  2O1P A;  2OMO A;  2HG4 A;  2ZZM A;  1SBR A;  5IV3 A;  2ZH3 A;  5CCM A;  4M5L A;  3S6E A;  1U2R A;  4ZIT A;  1HW9 A;  1IJF B;  2M88 A;  1NKC A;  3ETM A;  2QT7 A;  3JSR A;  4JI8 F;  4DSI A;  4X66 F;  3DLE B;  1IKX A;  2VFV A;  2QC3 A;  1KVJ A;  4RW6 A;  1GMW D;  4F2S A;  2FD2 A;  4K59 A;  9RUB A;  3NWG A;  1KRP A;  2VBY A;  1PJ7 A;  4LSN A;  3RAX A;  1XQI A;  2RS8 A;  5K8M A;  2MZJ A;  4K50 A;  1OPZ A;  4ED0 A;  2CNL B;  2X3G A;  3TA1 A;  2W9B A;  4DR1 F;  3OXF A;  4KIA A;  3AD7 C;  4ZIW A;  4LF8 J;  2FZK B;  4ZPC A;  1S72 S;  5HQM A;  4QU7 A;  3B4D A;  4HDH A;  2AYG A;  2E1R A;  1M1G A;  2ZHB A;  3MEG A;  3EVO A;  1G3O A;  1HKA A;  2I9S A;  3NEK A;  3GJQ B;  3UQS A;  3QZ8 A;  4DV5 J;  4DPX A;  2AHO B;  1RTI B;  1WWH A;  2LXU A;  4EZ6 A;  4YR0 A;  2OUG A;  2QJ3 A;  3KK1 A;  1YJV A;  3V2U C;  4P9S A;  3T41 A;  3D6M B;  2VKZ G;  2HS3 A;  2MQ8 A;  1X4C A;  3QJL A;  2DHA A;  1WOO A;  3SCJ E;  1NDK A;  4I2P B;  4A8O A;  1N5Q A;  1YTY A;  2BKP A;  4M5D B;  2IAJ B;  2GNK A;  2AWZ A;  2CVI A;  2XLK A;  2AIR B;  3QFW A;  2VHG A;  1EZZ B;  4QWC A;  2KFN A;  2CJB A;  2PN6 A;  4KH1 B;  1RAF B;  5A76 A;  3D6H B;  5IM0 B;  1F1B B;  1ZH5 A;  4DLE A;  2YWW A;  1X5S A;  1MG7 A;  3DLG A;  3J7Z 5;  4B9N A;  4Q8E A;  2BE9 B;  3CB4 A;  1WEL A;  4E0D A;  4NPO A;  3NP5 A;  3DMJ B;  1HNV A;  4O3R A;  1X5T A;  2GMH A;  2G13 A;  2H54 B;  2EKY A;  4I0W A;  3AH6 A;  3BGR A;  2H5E A;  2IMW P;  4MKY A;  1FKO A;  3BBC A;  5LMN F;  1XNQ J;  4YHH J;  5KFV A;  4MYU A;  2J8A A;  4OHW A;  4FNI A;  2AQ4 A;  1S77 D;  1D8Y A;  1R89 A;  4KFB A;  4ZA1 A;  3I5A A;  1LNQ A;  3PIO Q;  4PQA A;  4FYD A;  3MM6 A;  3HHD A;  1FRK A;  4H4K C;  5K8N A;  5HL7 Q;  3TA2 A;  1N5Y B;  1N36 J;  1VQM S;  4Q0B A;  1ZET A;  3MMA A;  1VJW A;  3W2W B;  2XZT B;  4K7Q A;  3KKF A;  4CLW A;  3BJY A;  5B7W A;  1X9S A;  2YNH A;  1TKT A;  2XY6 A;  1XMO J;  1SPB P;  3K7R A;  3K0J A;  2HFU A;  4UUW A;  4ZVG A;  1NJY A;  5IT4 A;  3NGR A;  5U47 A;  3RUB L;  1KQS R;  3TX0 A;  5DO2 A;  3DDI A;  2NXU A;  1TKX B;  5KG3 A;  1IKV A;  3PM9 A;  2FUG 9;  3QMQ A;  4ZVH A;  2GIF A;  1HI0 P;  4USK A;  4M5K A;  3QT5 A;  1UET A;  2DXE A;  2L48 A;  2NYH A;  2HLU A;  2NUH A;  2HGL A;  3IC1 A;  3U7J A;  5KG5 A;  2W9C A;  3BQ2 A;  3PVX A;  1J5O A;  4CWB A;  3FVY A;  4ENO A;  4F4X A;  1QM9 A;  3GG1 A;  1RT6 A;  1WEY A;  2GHW A;  1Q7L B;  1Y00 A;  1H2U X;  1Q16 B;  2A18 A;  2GIR A;  4WK3 A;  4KPC A;  1R8B A;  1XTZ A;  3A8I A;  1LEO A;  1RJJ A;  1U0H A;  5ETS A;  4AT1 B;  3RB4 A;  1URN A;  1GK8 A;  1JNZ B;  2UU9 J;  1BD6 A;  1U0H B;  4ZVE A;  4CT8 A;  1HNX F;  4TQR A;  4DQP A;  2YX4 A;  1SVD A;  3N28 A;  2B6A B;  2J76 E;  2CPI A;  1RT5 A;  4MIW A;  5IQ6 A;  1KOO A;  2M8D B;  1PJ5 A;  3HM9 A;  4JI7 J;  3TAM A;  4Y2K A;  4PPZ A;  3ZZ0 A;  2CA9 A;  5KFW A;  4ILM A;  5L9X A;  4FYV B;  1KNZ A;  3QNW B;  3WC0 A;  3OL8 A;  4HAC B;  5F0W A;  3CCL S;  1RTJ A;  1CC7 A;  4H4M A;  2DGU A;  4C8M A;  1AYE A;  1FXR A;  2ZHO A;  4ZVP B;  2NXE A;  4QZV B;  3GP9 A;  1LV5 A;  2KM8 B;  5KFT A;  4P7V A;  3UPF A;  3KK3 B;  4ED2 A;  3BKU A;  1J2V A;  1SXL A;  3KK3 A;  1N4L A;  4JYA F;  2BAB A;  5B0F A;  3W2V B;  4CLY A;  2XLJ A;  1ITP A;  3GII A;  3CTR A;  1SQE A;  1TUV A;  2G0J A;  3SCI E;  3QLH A;  1SJQ A;  3CO0 P;  4XK8 C;  3TZZ A;  3RB3 A;  3ENA A;  2BAC A;  2GVD A;  4LF7 J;  2BBE A;  5E0O A;  2QSF A;  4CM2 A;  1K8A T;  1NK8 A;  5ETQ A;  4ZLN A;  1JLB B;  3JSY A;  2XC9 A;  1IR2 A;  2PMW A;  1JLG A;  2UUB F;  3LQV A;  4FNH A;  1SC1 B;  2KFY A;  2ADC A;  4ZPD A;  1NPR A;  2UXC F;  4LRD A;  3A1Y G;  2QV6 A;  3CT9 A;  3KG1 A;  2IBO A;  1KFS A;  4RO0 A;  2CJK A;  3H42 A;  3FZB A;  3HVW A;  1JLA A;  1L5U A;  3GSI A;  3KTQ A;  1QUP A;  3V6H A;  3L7O A;  1WOR A;  2IM3 A;  4J9O A;  1E6V B;  4PR6 A;  3BO4 A;  4F3M A;  2HFV A;  3NS5 A;  1BLU A;  1O8B A;  4K5S A;  1VC0 A;  5FJ4 A;  3ENQ A;  2UVR A;  2HIQ A;  3CJ3 A;  4ZPW R;  2KL8 A;  3O8W A;  1NB2 A;  2CPD A;  4WE1 A;  3TVZ A;  4NCG B;  3ZZZ A;  5KOW A;  2UVV A;  1NK4 A;  4DR6 F;  4DSL A;  3D54 A;  1BQM B;  2KI2 A;  3BGO P;  3R7B B;  3BBB A;  3EIC A;  1WD6 A;  2LQ5 A;  5H9F K;  3B4M A;  4M5J A;  2ZFH A;  2WHO A;  3Q2S C;  4X66 J;  1J5E F;  2AYE A;  1WDT A;  2KT5 A;  2LLZ A;  4MK7 A;  4JP8 A;  4FS1 A;  4DSF A;  1FJE B;  3G86 A;  1DJ0 A;  3TUI C;  5L38 A;  2HHH J;  5IS2 A;  1WF1 A;  4RL1 A;  4LBI A;  4D3G A;  3R5C A;  3K59 A;  1X9M A;  4DQR A;  1K9M T;  3MD3 A;  1TZ0 A;  1NKE A;  3HJV A;  4IFY A;  4LF9 F;  1V5I B;  2E1P A;  3GB0 A;  3KDN A;  3GYX B;  3QT7 A;  4AQY F;  5IT9 Y;  2JZ5 A;  2XMW A;  1EET A;  3M2R A;  1XR7 A;  3G96 A;  2ZH2 A;  2ATL A;  3G8Q A;  3L7P A;  2HVZ A;  1KFD A;  2YWF A;  3DI6 A;  1OY6 A;  1XEZ A;  3LGH A;  4Q2L A;  4C98 A;  4EEY A;  3DRY A;  4DSK A;  2ATC B;  3IXQ A;  2VJV A;  4IQM A;  2WSE C;  3DOK B;  2BV3 A;  1DAR A;  1MML A;  2XMV A;  4OV1 A;  4CO2 A;  4CRJ A;  2ZVS A;  4DX7 A;  4RNH A;  4DV7 J;  2AEM A;  2MQN A;  4C0O C;  1FJG F;  2HK3 A;  3CMQ A;  3QFH A;  2IVF B;  2R9L A;  2P2C B;  5GME A;  4AL7 A;  2C22 A;  4WTY A;  3MUV P;  3IS9 A;  3N79 A;  3QJP A;  1SI9 A;  2LMI A;  4IO1 A;  1X0P A;  3MEE A;  1KDN A;  4C0H A;  4A8W A;  4QCL A;  3MED A;  1JX4 A;  1RYS A;  3QAE A;  3PEJ A;  4CT9 A;  2B9W A;  1UTA A;  2X51 A;  4WJB A;  5D15 A;  3UN5 A;  4B3M F;  3TJ8 A;  4YR2 A;  3KLG A;  1TMJ A;  3WC2 A;  3EPI A;  2HAI A;  2Z2L A;  4Y6I A;  1C0T B;  1JK9 B;  3HZG A;  4U9R A;  1C0T A;  1OJ4 A;  1EX8 A;  3MMJ A;  3H2V E;  4PWD A;  2GMJ A;  2VDH A;  3CJ4 A;  2LEC A;  1RIS A;  5IM0 A;  3M8Y A;  4JI1 F;  2CWK A;  3MAA B;  4RBV A;  3UDV A;  3ZZY A;  3P45 B;  3L3C A;  4K4X A;  2C2E A;  4YQW A;  3RBD A;  2E1A A;  4IG0 B;  3DM2 B;  4X4U A;  3F0N A;  5GAG U;  4NMX A;  1ULR A;  3HCX A;  2PEB A;  4GVB B;  4Y2A A;  2JHE A;  1H38 A;  2FVC A;  4RX6 A;  4JI2 J;  4YN3 B;  2G2Z A;  3ZTR A;  5CA5 A;  3HSD A;  1YJT A;  4HT5 A;  4R0E A;  3EWG A;  1RU1 A;  2W2N P;  1LW0 B;  4LVO P;  4P75 A;  3I9V 9;  4ETZ A;  1WEZ A;  3EZ5 A;  3S8S A;  2KZM A;  2C1E B;  2D41 A;  2DGV A;  3KLI B;  2FGO A;  3B6B A;  1Q5V A;  4B9U A;  1YQH A;  1CLF A;  3C6T A;  3OL6 A;  1IR1 A;  4E98 A;  2D9P A;  2W4C A;  2VF3 A;  3QWP A;  3CJK B;  2QLF B;  3OW2 R;  2J9D E;  1IVZ A;  2AJ0 A;  2BRK A;  3PHE A;  4I64 A;  4DL6 A;  3V6D B;  4KGV B;  1YIJ S;  2MYF A;  2POK A;  2H4Y B;  2GML A;  4IYQ A;  4DLG A;  3LWL A;  3I32 A;  1S97 A;  1FER A;  1HNW F;  3B78 A;  5A6W A;  2NXC A;  3TOQ A;  5KT2 A;  2V9W A;  3ZXW A;  1YJ7 A;  2COL A;  2LDI A;  5KFM A;  1SJF A;  1GXL A;  1Y3J A;  2AT1 B;  3N6N A;  2G0C A;  2CWX A;  3AOC A;  4RW9 B;  3UD5 A;  3CCE S;  1CEZ A;  2VOD A;  1DAX A;  1HHT P;  1CG2 A;  4M95 A;  2VFU A;  2BJ3 A;  4LR7 A;  4KAI A;  3CDA A;  4O3N A;  5A2Q U;  3K5M A;  5JVG Q;  3R8Y A;  2LU1 A;  3R1L A;  2XSJ A;  2LA6 A;  4C0B A;  1WSR A;  2IY5 B;  3BN7 A;  1U7L A;  5B0E A;  4JI7 F;  3QAT A;  3R9L A;  1FE4 A;  4F4K A;  3ENV A;  1NCL A;  2ZH9 A;  4KBI A;  2XBP A;  3RAM A;  3HZE A;  2A2C A;  3CJQ A;  1RT1 B;  2UUC F;  4L6V 3;  2FJE B;  4YB7 A;  3CIM A;  1SKU B;  2DNM A;  2B7B B;  3MM9 B;  3T6J A;  4LR9 A;  4ED8 A;  1URR A;  4CQ1 A;  3K5P A;  2HMI B;  3H98 A;  1M1K T;  4TKT A;  2AX0 A;  4MKA A;  3HVT A;  1U0S A;  1AUS L;  3DLE A;  4FKX A;  1C0U B;  1YZ7 A;  2B9X A;  2HIY A;  3HSJ A;  3SMZ A;  2YX1 A;  6FDR A;  1DRZ A;  1CJT B;  1PYT A;  1U2F A;  2KRB A;  3QZ7 A;  2E9R X;  2QGF B;  1R27 B;  4Q7A A;  2FHK A;  1LWF B;  2QLB B;  4QR0 A;  2P9G A;  4LBP A;  2ZZN A;  2HSE B;  1YLX A;  5DG7 A;  3TVK A;  2UXD J;  5KFH A;  1S59 A;  2HHT A;  3DLK B;  4RR5 A;  3A4T A;  1FHT A;  2DTJ A;  1ZS6 A;  1MN7 A;  3D7S B;  3CIZ A;  3SDE B;  3R2C J;  2F8H A;  3H5Y A;  4NLU A;  2OI2 A;  1R8P A;  2PMZ D;  1TTH B;  1HNI B;  2BUN A;  5F8J A;  4N41 A;  2HFN A;  4YY3 F;  4MMO A;  4IOC Q;  1HNI A;  3ZTP A;  4B08 A;  5THW A;  3I0S A;  1EAY C;  3G4S S;  2VL1 A;  3OFH A;  1LWX A;  4O0I A;  3G6V A;  4DUZ F;  4WXW A;  1S1W B;  2VPX B;  3N01 A;  3ZZT A;  3TUZ C;  1RWM B;  3KK1 B;  4U95 A;  3BSA A;  2CJX B;  3KMS A;  3NS6 A;  4S0M A;  3SBM A;  1AFI A;  5HRO A;  1IKY B;  1FTR A;  2QO3 A;  1FA0 A;  2VBX A;  4R5P B;  3GV5 B;  1S5Z A;  1VMB A;  2DNP A;  2MJU A;  1U1R A;  1IBL J;  1DBD A;  2L9W A;  1VQ6 S;  1VBY A;  1HWL A;  3M2U A;  4B3R F;  3QIP A;  2FZC B;  2ZEJ A;  1RT4 A;  2NXJ A;  2PSZ A;  3KNA A;  4J9R A;  1IWA A;  2V2K A;  4F0H A;  4DV3 J;  1UFL A;  3DLG B;  5DJB A;  2HNZ A;  3CDB A;  2E9T A;  2R2R A;  1OY9 A;  2DK2 A;  3C8Y A;  2XWY A;  2C28 A;  1HW8 A;  3BGF A;  1VQ7 S;  1PG5 B;  1MN9 A;  4DV3 F;  3X1L B;  5CYM B;  4BWM A;  1IBK F;  4KTQ A;  3QYY A;  2HVH A;  2X1G A;  4I67 A;  3M6U A;  3QBC A;  5A0Y B;  5C24 A;  3UD3 P;  2RNE A;  1HQE B;  4LJM A;  1V3S A;  1O0P A;  4Q2M A;  3RZA A;  5A0Y A;  3GFH A;  5ADZ A;  4QYZ J;  1WDD A;  3BPS P;  2WBR A;  4J9K A;  4A8K A;  3HPO A;  1APS A;  5HO4 A;  1RWK B;  3GQC A;  2OTL S;  5HMW A;  4WXO A;  1BY9 A;  4V19 X;  4UST A;  3MR3 A;  1M5K C;  2E7W A;  5F0U A;  3A8J A;  4TXS A;  3TZX A;  5MLC V;  3VQT A;  1HQU B;  5HP1 A;  4DR6 J;  2KZZ A;  1ZTT A;  1FT8 A;  2DH7 A;  5KFJ A;  1M5V C;  2DY1 A;  1TL4 A;  1P8G A;  2IVY A;  2RIJ A;  2WCX A;  4WCE Q;  1X0F A;  3PO5 A;  2EKN A;  4YOE A;  1IN0 A;  4RNF A;  2QZ8 A;  4TLQ A;  2V67 A;  5T7L A;  5K8P A;  1MU2 A;  4KO0 B;  5KFZ A;  3G71 S;  1J5O B;  2EK1 A;  3FCV A;  2BQU A;  3A12 A;  1VRT A;  3NNC A;  2EFQ A;  2HFZ A;  3FC9 A;  1H98 A;  4Q44 A;  1EJ7 L;  1FJC A;  4TU9 A;  2VBW A;  2W2Q P;  3PYF A;  2NPF A;  1DQA A;  4CO0 A;  1XER A;  3LOU A;  1BC6 A;  2HBY B;  3AA8 A;  3KG0 A;  4DS4 A;  4F3O A;  1FFW B;  1N6Q B;  4PEO A;  2E7V A;  5ETK A;  2VIH A;  2F1F A;  1A7G E;  2P6T A;  2ZBC A;  2EWH A;  4HR2 A;  4ZN3 A;  1B0V A;  1YJW S;  4IFV B;  4FF3 A;  4IG3 B;  1NM2 A;  2IRU A;  1U1L A;  1RWW B;  1UWB A;  2LA4 A;  2YKA A;  3IR6 B;  4HAC A;  3W5X A;  4AL6 A;  4PQU B;  4BDP A;  2IFX A;  4LF4 J;  1I6J A;  4USW A;  2B9E A;  3LAL A;  2EXU A;  4OV6 A;  1DTT A;  5K14 B;  2AJ1 A;  2JFD A;  1QVF R;  3FKB A;  3CGI A;  2DVI A;  1IBC B;  1DTT B;  2E5L F;  1Q53 A;  1RT3 B;  3BPD A;  3OR2 B;  2AD9 A;  4KGX B;  2N82 B;  2QEX S;  2NZC A;  2HQF A;  4F4Y A;  5I3U B;  3M8Q B;  1V3R A;  5DRK A;  3J7Z T;  1OQ3 A;  1UFK A;  3FEZ A;  4G1Q B;  2EC2 A;  1S9G B;  2RUS A;  1T95 A;  2KJV A;  3NWR A;  4OZJ A;  1S0V A;  4WKR A;  2P5V A;  3ILO A;  5H1S V;  2G1D A;  2MLZ A;  2MKC A;  3H0P A;  5BYR A;  3DC2 A;  3K17 A;  2OH2 A;  4AQY J;  4LF9 J;  4DR4 J;  4K0K J;  2JX2 A;  2EW9 A;  4NCB A;  1EAR A;  1OWX A;  4X65 J;  4K2J A;  4JV0 A;  2VUG A;  2QLJ B;  4YB1 P;  3MTJ A;  2UVU A;  3LH2 S;  1TKZ A;  3P4U B;  4DUY J;  2XZW A;  2Z58 B;  2PA3 A;  2ILY A;  3GR0 A;  5D4N A;  4DCO B;  4ZK7 M;  1NZA A;  4K4Y A;  4OJ1 A;  4OZN A;  3W7B A;  1I94 F;  2NPI A;  4OZ5 A;  1PBU A;  5EUH A;  2OPS A;  1E6V A;  3I5C A;  2KKH A;  3JSM A;  4IQX A;  2R8G A;  3AXM A;  2IC3 A;  4LF2 A;  3JSM B;  1RTZ A;  3D0I E;  2K2P A;  3Q86 A;  4CYU A;  3CCU S;  4J91 A;  3QRR A;  3CDW A;  4HYK A;  4YB6 A;  4MAK A;  4FKY A;  3T1H J;  4DWI A;  2VB6 A;  3MCN A;  4JI6 F;  1FEH A;  1GT8 A;  3EVW A;  1JLQ A;  2B43 A;  2KVI A;  2BJ8 A;  4EU0 A;  5B0B A;  2V4Q A;  1T05 A;  1MMN A;  1PGZ A;  1LW2 A;  1NHV A;  4WF9 Q;  2E7X A;  3DKD A;  3TZY A;  2UXC J;  4ZPT R;  3T1H F;  4GRS A;  3UDE A;  3W8P A;  4GVL A;  2YH0 A;  4ANC A;  1WHX A;  2HHQ A;  3EXC X;  1VLY A;  3ZZO A;  1HI1 A;  1U8S A;  3KHG A;  4B3T J;  1ZM4 A;  2CPY A;  1PO6 A;  2XS5 A;  2BJ9 A;  3VTI A;  2FVR A;  5L9N A;  3BM7 A;  2GGP A;  4DV2 F;  2DPJ A;  1L3K A;  4P52 A;  2GGP B;  3AOD A;  5I3P A;  1N0V C;  4LQ3 A;  4JI5 F;  2Z8Q A;  3TRG A;  4Y3C A;  2E5L J;  4I6Y A;  3VV2 B;  4USU A;  2VG7 A;  4Y00 A;  1U47 A;  1EET B;  1TK8 A;  3LP2 A;  2Y8W A;  2BM0 A;  4KKO B;  4WIQ A;  1C2P A;  5KFN A;  3NCR A;  5DQI A;  1UJ6 A;  3AJD A;  2BQ3 A;  3LA0 A;  1MSW D;  1DQ8 A;  2IA6 A;  1QSY A;  4YDD B;  3RGI A;  1KKH A;  4QU6 A;  1R3N A;  2WB1 D;  3BKF A;  3DRP B;  3GWC A;  2ADB A;  1M90 T;  2J9D A;  2E5H A;  4PKD B;  1AT1 B;  3D3B J;  3SQO P;  2R7W A;  1IQT A;  4Y2I A;  4ZVR B;  3CC2 S;  4JI0 F;  1CQN A;  2CAD A;  2HEK A;  2I8E A;  1T3O A;  4A8M P;  2WON B;  1MWQ A;  1RTI A;  3OTE A;  3J7A N;  1HBM A;  3FBB A;  2HHH F;  2Z2M A;  1NHK L;  2E5I A;  1FI4 A;  3CED A;  1YSJ A;  2F7V A;  2LXI A;  3DXS X;  1NUE A;  3N4W A;  4QYR A;  5KOX A;  2A6M A;  4ZLJ A;  2XTJ P;  3PV8 A;  3QSI A;  4I56 A;  3W5Y A;  1RHM B;  1RWX B;  5B08 A;  3JYT A;  3CCJ S;  2Q3P A;  2EC0 A;  1UVN A;  3OPK A;  3BGL A;  4MIA A;  1KTQ A;  3M7V A;  5DET A;  5HRO B;  3HFZ B;  3MCO A;  2YNF A;  3G6X A;  4NLG A;  1TMM A;  2DIU A;  3OFG A;  1TVR B;  4DF4 A;  2YNF B;  2VZ9 A;  5DM6 Q;  4M5D A;  2AZ1 A;  2C2O B;  4H4O A;  3UO0 A;  5B0D A;  1EP4 B;  1TVR A;  3QIP B;  3CUL A;  1ARO P;  2EFP A;  2E1C A;  1VLO A;  4HT7 A;  1LXN A;  3QID A;  4KGM A;  4ZP8 A;  3T9N A;  4L72 B;  2ZWP A;  3DMJ A;  4C8O A;  5HBM A;  2CDR B;  2AW0 A;  2GQ2 A;  4DN0 A;  2AEF A;  2KYX A;  4ECR A;  2LVW A;  2VQF F;  3CJ5 A;  4LT6 A;  3V81 A;  5BJR A;  2M5Y A;  7AT1 B;  5KTQ A;  3PY8 A;  5CYM A;  3AQP A;  4OX9 F;  1D3W A;  1WI8 A;  2NLW A;  3OTB A;  2HS0 A;  1DTQ A;  2R4F A;  3BKT A;  3H5U A;  4XDD A;  5F8M A;  3BGR B;  2A3J A;  1YI2 S;  1LW0 A;  3RYL A;  3DLH A;  4OI2 A;  5IT9 U;  1NSQ A;  1SCJ B;  2OO4 A;  2VG5 A;  1REV A;  1S4E A;  2NCK L;  4N76 A;  2GA7 A;  4KGK A;  4RNN A;  4F2R A;  1OO0 B;  3JQK A;  4BWJ A;  3MPY A;  1W26 A;  2PO4 A;  4DX8 H;  3SV3 A;  2MZT A;  1BWE A;  1JLC B;  3BZQ A;  1VBK A;  4UF4 A;  2UXD F;  1YKW A;  5HQ8 A;  2FHO B;  1ZOT A;  2R8J A;  2YNH B;  3QT6 A;  3HHL B;  2FVS A;  2V9K A;  3J7A 1;  3J81 Y;  5DQG A;  4QR2 A;  4NA3 A;  3OLB A;  1VIS A;  5C2G A;  3AHP A;  3GIK A;  3H4B A;  2XMU A;  1GH8 A;  3GFY A;  1A9N B;  2V68 A;  3J80 U;  2RQC A;  1HPZ A;  2HHS A;  1N5S A;  3POT A;  2FJB B;  2LU2 A;  3C6U A;  4NYZ A;  3CWJ A;  3POT B;  4CDI A;  3HK2 A;  4ZJQ A;  1RAD B;  2DNO A;  4P2M A;  2DJW A;  2FJD B;  4IH6 A;  4KB7 A;  4GC7 A;  2BKO A;  2IDE A;  4X84 A;  5C7P A;  1S9F A;  5D3G A;  3TP2 A;  3EUN A;  3VVT A;  1EB0 A;  2A10 A;  3GU0 A;  3Q24 A;  1S6Q A;  3C14 A;  5H9E J;  1OMS A;  4CIO A;  1JLF B;  4DHV A;  1ZM2 A;  1MW7 A;  3C14 B;  5E5N A;  3QO9 A;  1YHQ S;  2HRT A;  5KFI A;  2VOP A;  4W92 B;  2ZVI A;  4PWW A;  1H7W A;  2DHX A;  2LP4 A;  1HBU B;  4PG4 A;  2XS7 A;  1VQY A;  3ET6 A;  5CYQ A;  1Q78 A;  1Y7P A;  5KFP A;  1HNW J;  3MR2 A;  1Q81 T;  2H9Z A;  4RUA A;  3I82 A;  3PJW A;  5T41 A;  3PW4 A;  3EDQ B;  1W25 A;  2ZD1 A;  3NOG A;  4NLR A;  5F3Z A;  4FF1 A;  3NAH A;  3NGU A;  4H4M B;  2VH7 A;  4DL2 A;  3FRY A;  3CXC R;  1F2G A;  4JI4 F;  4BLG A;  3THV A;  3CME S;  3NGT A;  5J2M B;  2RF2 B;  2ZC3 A;  5B0G A;  5EN1 A;  1YRU A;  2XMA A;  1YJ9 S;  1LWF A;  2V2Q A;  2KTQ A;  3SSS A;  2V8V A;  1ZAX A;  1WOS A;  4HHJ A;  1OSD A;  4OHY A;  4OI3 A;  1B7Y B;  2LQ8 A;  3CJ8 A;  4EMD A;  3W2V A;  5DDR C;  3O2I A;  4OZ3 A;  3HT3 A;  3Q8S B;  2OTJ S;  3PJ9 A;  2UUC J;  4AXJ A;  1NK6 A;  2DD8 S;  3Q23 A;  5J2Q B;  2HHV A;  2W1B A;  4DR7 J;  1KVI A;  3D67 A;  1R8H A;  2ROE A;  3E8O A;  3MMB A;  5L1L A;  3AAW B;  2EG1 A;  2V8H A;  3DU6 A;  1C4A A;  4Y2C A;  3WHI A;  2UUW A;  4JI2 F;  5DGB A;  4ZIV A;  2GVZ B;  2CNK B;  4FBT A;  1TKZ B;  2OEL A;  2GS8 A;  4L3N A;  2YWG A;  1C1C A;  1RDR A;  2GVZ A;  2ROP A;  4C2M A;  2UUB J;  3MTK A;  3DLB A;  3BDE A;  2PT0 A;  2CQ3 A;  1C1C B;  3BH6 B;  3GR1 A;  1PSD A;  3FQL A;  4ECU A;  1IKY A;  1UVK A;  2P9E A;  2KXF A;  3Q8Q B;  4J9L A;  4DFK A;  2XWX A;  3BSC A;  3TEH B;  1N36 F;  2Z57 B;  2C42 A;  2OPP A;  3NGS A;  1FX2 A;  4K4U A;  4F8R A;  3MM5 A;  2HRU A;  4Q43 A;  4I6A A;  3BYP A;  4O4R A;  4CYU B;  3W5Z A;  5J1E B;  2BEF A;  2KB2 A;  4LIR A;  4K4T A;  1ZM3 A;  2Q1L A;  3T3F A;  4LF6 J;  2GHV C;  1FRL A;  2LKZ A;  4RW7 A;  1NKB A;  5KFS A;  4A8Y A;  2FHJ D;  2AKW B;  1TFW A;  3EGW B;  2VU5 A;  1WNE A;  4B3O A;  1LW2 B;  2UU9 F;  5L1J A;  1U1O A;  5LXR A;  1HI8 A;  1FES A;  3UR3 C;  2ZH8 A;  4DMZ A;  2MGZ A;  1JXL A;  1R8A A;  2YQ3 A;  4DL3 A;  2BA9 A;  2VA2 A;  4NXM F;  5E41 A;  1K0V A;  3AY0 A;  3HSZ A;  5F9N A;  3L09 A;  2FHM A;  4WFB Q;  2XCP A;  2V69 A;  4FBU A;  2YKO A;  1X4B A;  2V0N A;  1WKJ A;  3PW2 A;  1YX2 A;  3MOJ B;  2FJW A;  1FK9 B;  2WBM A;  3GMG A;  2D74 B;  2XYP B;  2DO4 A;  1EKS A;  3ZFV A;  2N3O A;  4XPE A;  1T11 A;  1R43 A;  4L76 A;  4JUZ A;  5KT7 A;  5J2P A;  2HGN A;  4AFF A;  5ETN A;  4EFA C;  4TLR A;  2B5J B;  2F63 A;  3BQ0 A;  3EYZ A;  2IMO A;  2B5J A;  2HFS A;  3M2R B;  5IC4 B;  4ECW A;  3Q0A A;  5HJX A;  3DOK A;  5FLX U;  2NR0 A;  1F9F A;  3D66 A;  3G8S A;  3GPA A;  2Z56 B;  3KJN B;  3RG6 A;  3KUE A;  4LFA J;  3R5B A;  2YX7 A;  3LO3 A;  5SZT A;  2IA0 A;  2PII A;  5FLX Y;  3Q8P B;  1YIT S;  1NJX A;  3CCV S;  4TQS A;  4UOF A;  1V9O A;  4W98 A;  3KHL A;  4KSE B;  2CFX A;  6AT1 B;  2OSR A;  4ES1 A;  2WON A;  3KFW X;  4UTG A;  3TJ9 A;  4NXN F;  5KG4 A;  1HBM B;  1VQK S;  2JLF A;  4RWX A;  2DCL A;  1A6L A;  2M8H A;  2DO0 A;  1UEU A;  1FFG B;  2ZH1 A;  5L8R C;  1U1K A;  1F5C A;  2CQ1 A;  2L08 A;  2XI2 A;  4J37 A;  4USI A;  4UZC A;  1QD1 A;  2CDQ A;  5G0R A;  4RUC A;  4I2P A;  1FEE A;  2CKW A;  3W63 A;  4IO9 Q;  3VAG A;  1ACM B;  1CJK A;  5IWA J;  3IWN C;  2OFG X;  4NZ0 A;  4NRT A;  2DNL A;  4URG A;  1EP4 A;  1VQN S;  3VZH A;  5D0R A;  5IT0 A;  3MUT P;  4L3K A;  4IRK A;  1A0O B;  3K58 A;  4L75 A;  4EGL A;  2CZ9 A;  5IXU A;  2MQP A;  1CS4 B;  4IRD A;  4IG0 A;  2RDJ A;  4X4V A;  1JWW A;  5K14 A;  5HMZ A;  3V4M A;  4ED3 A;  4U67 Q;  2E9Z A;  3N6M A;  1H6K X;  2E29 A;  2DB1 A;  2HFO A;  4NLW A;  3R27 A;  1IUJ A;  4NXM J;  4KC5 A;  2QYG A;  4G1Q A;  1Q86 T;  4X4T A;  4AXI A;  5C5J A;  2V5H G;  4X4N A;  1KP6 A;  3MR6 A;  1XR6 A;  2X1A A;  5K5M A;  4DFJ A;  4RNO A;  1U1M A;  2AZ3 A;  2MLX A;  2F8M A;  4K8R A;  2PGC A;  1TV6 A;  4ZVF A;  2V50 A;  1UWA A;  3CO9 A;  4GO7 X;  1D9A A;  3IBW A;  1CJV B;  1HL6 A;  1LK7 A;  1PAE X;  3OJU A;  3IAS 9;  1S6P B;  4PZV A;  4ZPA A;  3MMA B;  2ZOM A;  1LWE B;  1X5O A;  1SUQ A;  4OYP A;  1S6P A;  4I69 A;  1JKH B;  1IM4 A;  3MEK A;  4HTI A;  1WG1 A;  4ZVO B;  3GLJ A;  2VA3 A;  2ZM6 F;  1TUW A;  3RR8 A;  1CBK A;  3NKY A;  4PG6 A;  3MPV A;  1D8Z A;  3PFE A;  4PXE A;  4CO3 A;  3RB0 A;  1HA1 A;  2Y0S D;  4ZJO A;  1FXL A;  2FY1 A;  4AD6 A;  2K06 A;  2NSC A;  3FEX B;  3W9I A;  1AUD A;  2J5A A;  5D8H B;  1HNZ F;  1S1V B;  2B8P A;  3HD2 A;  4MKB A;  3NRB A;  1RWU A;  2BYC A;  3DGP A;  3NBP A;  2DNH A;  1NBE B;  3K5L A;  1S1V A;  2WZ1 A;  3LPY A;  3JSB A;  4H4K A;  1NPK A;  1RGV A;  3GG0 A;  1VIO A;  2CPH A;  2MEW A;  2Q66 A;  3OR1 A;  3PX6 A;  4I7F A;  2LQJ A;  3MF5 A;  4PG7 A;  5FDL A;  4DX5 A;  1I5O B;  2K1R B;  4UUX A;  4BC9 A;  1QTM A;  2QLW A;  3FBE A;  4ZP9 A;  4CLP A;  1N5V A;  1TEL A;  2VV5 A;  2YPZ A;  8RUC A;  4YR3 A;  2BJE A;  1Q82 T;  3QQC D;  2HMI A;  4C6A A;  1F60 B;  4F3Q A;  4B3S J;  4DV4 J;  4DPU A;  1RHK B;  3ENW A;  5EHH A;  1UJ4 A;  1RAJ A;  4R8U A;  2DXD A;  3FMB A;  4P71 A;  3VVU A;  2N3L A;  4C7Q A;  2RHQ B;  1RT2 A;  3HVT B;  7FDR A;  1W2I A;  1U24 A;  3KK2 B;  3M8S A;  5J2M A;  1UVI A;  1JB0 C;  2AJQ A;  1DQ9 A;  1ICE B;  3THT A;  4X64 J;  2I0X A;  2VG6 B;  4B9S A;  4IRC A;  1Z4U A;  2ZNY A;  4W90 B;  1BHN A;  1PAU B;  2WAQ D;  2R2U A;  1S7H A;  2WOM A;  4OHZ A;  4KR0 B;  4OFZ A;  1X4D A;  1TL7 A;  4FN5 A;  1EIY B;  3DRP A;  1U6B A;  3HHK A;  1E6Y A;  1XMB A;  1TL7 B;  4LF4 F;  3DOM A;  4MFB A;  3TAN A;  1XNR F;  3BBF A;  3JTP A;  4NLD A;  4NEZ A;  3R2D J;  2B4V A;  3MMB B;  4UT4 A;  2FLO A;  1HBN B;  5HAN A;  3I4H X;  2MPU A;  2Y1R I;  4CLZ A;  1S0N A;  4YY3 J;  1SV5 B;  2F9J A;  1HBN A;  4ZCK A;  5CAB A;  3HP6 A;  4ECZ A;  4CLS A;  3B8H A;  2D7S A;  1SV5 A;  1GX5 A;  4H54 A;  4G3I A;  1WC6 A;  2XYH B;  3I5B A;  3ISZ A;  2MQO A;  4A8Q A;  2UXB J;  5GAD U;  2FIU A;  1C4C A;  2LDY A;  2XZD B;  1EKR A;  1RBA A;  1RWO B;  2GV1 A;  5AXL A;  1LWC B;  5D4O A;  4BBY A;  4RZR A;  2VOO A;  4ZOS A;  2W9A A;  4ZCI A;  1LWC A;  2Y9H A;  3MPD A;  3DLJ A;  3HKZ D;  3JXO A;  4HH0 A;  1FKA F;  4LRB A;  5CD4 A;  3RR7 A;  1UVL A;  3KLE B;  5C25 B;  2HNZ B;  3DDK A;  4DSE A;  1LK5 A;  2XMM A;  3O3L A;  3UFC X;  3KLE A;  3RBX A;  3VCD A;  1Y3K A;  1F9H A;  2OEK A;  4OLO A;  2F8E X;  4ZVT B;  1QE1 A;  2J7W A;  3TR5 A;  3EGZ A;  1HNV B;  2KDO A;  2MHN A;  5HAO A;  3SYZ A;  3MR5 A;  3ONQ A;  2VPY B;  1PC4 A;  5LOQ A;  1YJN S;  3NL0 A;  2PC6 A;  4EYI B;  4WYW A;  3M8R A;  1C1B B;  3N6L A;  2CPX A;  2HUR A;  1VRQ C;  3LTO A;  5HVG A;  2IPO B;  2ZHA A;  5GAH I;  1WKL A;  1HQE A;  3Q8Y A;  2BW2 A;  3ZNJ 1;  2C2R A;  4OHV A;  1FDD A;  4L74 A;  4GKK J;  2R8H A;  2XHW A;  1UEV A;  2RKI A;  4NYP A;  1SJ3 P;  4C8Y A;  4Z2X A;  3C19 A;  3PIP Q;  5F8H A;  5DDO C;  3MM6 B;  2RRA A;  4YB5 A;  4LVN P;  1S48 A;  4WP3 A;  4X64 F;  1Q8I A;  4Q0B B;  2MMY A;  1VYA A;  2AJ2 A;  2DEI A;  3MD1 A;  1QY7 A;  3CCW A;  2DPI A;  1O5J A;  3W9J A;  1RBL A;  3HVR A;  2JOQ A;  4I2Q B;  4P7T A;  2NQP A;  2DYA A;  1YBA A;  1VQO S;  4WP8 A;  3BEG B;  4ILL A;  3W66 A;  4JI8 J;  4O4G A;  1MU2 B;  2DNN A;  2MKY A;  1PYO B;  4KO0 A;  2RQM A;  3OUY B;  1I1G A;  2YWK A;  3OVA A;  5KFL A;  2IJF A;  2EVZ A;  1UPM B;  2V34 A;  1TK0 A;  3CDU A;  4OYB A;  2W9C B;  3P6Y C;  2AP6 A;  2CQP A;  1CJU B;  3C15 B;  2BE7 D;  4FZV A;  3FFI B;  1KR4 A;  3IG1 B;  1CJU A;  3UNY A;  3IM9 A;  1VRT B;  2LFV A;  2LXF A;  5ETT A;  1K1Q A;  3CCM S;  3I9Z A;  2FTR A;  5DG8 A;  1J27 A;  1MWZ A;  1JJC B;  1U02 A;  3LP0 A;  5A6P A;  2V4J B;  4JOU A;  4M5I A;  1OS5 A;  2B4U A;  2RJZ A;  3SSR A;  3TZW A;  3CC7 S;  4M5H A;  3OFE A;  3SXL A;  3PR5 B;  1U2C A;  1D1U A;  1RCX B;  3TEG A;  1QDU B;  3JTN A;  5B0A A;  1AZS B;  1UA1 A;  4RWW A;  2ZUA A;  4DPT A;  3AT1 B;  2CQB A;  4DR1 J;  5KFB A;  5GAD I;  4HLB A;  2R7R A;  2DR9 A;  2ABY A;  4NA1 A;  4Z7C A;  1ZZF A;  2RQ4 A;  2KG1 A;  2F4V F;  3DU5 A;  3ZTQ A;  2NSB A;  2RE1 A;  2JL9 A;  4DOZ A;  3M8Q A;  3OVS A;  5I3U A;  3WX4 A;  1VBX A;  1TL3 B;  1FVS A;  2PMH A;  3KJV A;  2FJX A;  1RA7 A;  3OR2 A;  1RHJ B;  1RT7 B;  2JJ4 D;  1T02 A;  2B4O A;  1MRO A;  2C2D A;  3OXL A;  2VC1 A;  5D4P A;  1TL1 A;  2X7I A;  3KMQ A;  3RJM B;  3AB2 B;  3TO8 A;  4V19 J;  4NI2 A;  1R0A B;  1R6Y A;  4DG1 B;  3NAI A;  4ANE A;  1OIA A;  2QFJ A;  3SV4 A;  5A8W A;  5J2Q A;  1VQ9 S;  1WI6 A;  3WDO A;  1CJV A;  2HAF A;  1S57 A;  1RLD A;  4DV6 J;  4F4Z A;  4NL5 A;  2BVZ A;  2W25 A;  3WZ0 A;  5B09 A;  5GAE U;  1KD1 T;  4UY8 5;  4K4W A;  2PFF B;  1B70 B;  1FWK A;  2AF6 A;  5CD4 H;  4YHH F;  2ZH7 A;  1HWJ A;  3UVJ A;  4A47 A;  3E2E A;  1SL2 A;  2GFF A;  1N48 A;  3O5T B;  2OPS B;  2PEH A;  3PFO A;  3H25 A;  2NS1 B;  1SQF A;  1NO8 A;  1S49 A;  4WZQ A;  4JV5 F;  2V6A A;  3TUJ C;  2WW8 A;  3GJR B;  3MZI A;  1L3U A;  2BE2 A;  1T9T A;  3PG9 A;  2WVD A;  3ILL A;  3CD0 A;  4IKA A;  3F44 A;  5RUB A;  2JSX A;  4QPT A;  1JLQ B;  2RH3 A;  1T05 B;  1JJ4 A;  2DH9 A;  5HQL A;  3G8T A;  1Y10 A;  4C8N A;  5KAK A;  2QMU B;  3MWB A;  2HQD A;  2GJI A;  1IR0 A;  1SIW B;  2VFS A;  4ZMM A;  2BDP A;  2X1F A;  2DRD A;  2HBR B;  3K2Y A;  1JIH A;  1N8R T;  4OX8 A;  5FDL B;  4FYX B;  3HLU A;  1VHI A;  2W4P A;  1TK5 A;  2J6T A;  1XJW B;  4QPX A;  4DV1 F;  5L46 A;  2IIH A;  1NJI T;  2QSW A;  3ISN C;  2QMW A;  3ILI A;  3GIL A;  3MCS A;  4M63 A;  2XMK A;  1KOH A;  2QN6 B;  2AYM A;  3AJ1 A;  3CCS S;  2J0Q D;  4GO5 X;  4QWB A;  3ZTO A;  3VAF A;  4DV5 F;  3RBE A;  2VIC A;  5AE3 A;  2KT2 A;  4RW6 B;  4C3L A;  1RSC A;  3PRV A;  1UP1 A;  1FDN A;  4YDX A;  5KFC A;  2AU0 A;  4ELV A;  4DFM A;  5IC6 B;  1NDL A;  4URQ U;  4JI6 J;  3VAK A;  2M0G B;  2VG6 A;  2ZNZ A;  3CW2 C;  3EZO A;  5EWE A;  3NY0 A;  2DNK A;  3IBC B;  1S4F A;  1R0C B;  5KFQ A;  3T5H A;  1B99 A;  1F3F A;  2HQI A;  4ZPV R;  2H4W B;  2OHD A;  3VAL A;  5KFX A;  2DGQ A;  1N88 A;  4B3T F;  2XHC A;  1PCA A;  1YZ6 A;  2P9C A;  3DOM B;  4MFB B;  4DU7 A;  5E3C A;  2XGP A;  4URS A;  4X62 F;  1YBU A;  3QPI A;  1OSC A;  1QVG R;  1FE0 A;  1CQM A;  1SC4 B;  3IS9 B;  4BC7 A;  4HL9 A;  4UOH A;  4MIB A;  3SFG A;  1FO1 A;  3H90 A;  1ZBT A;  3I96 A;  3PYD A;  3JYT B;  1G7C B;  4U6P A;  2GQQ A;  2QA1 A;  3DGV A;  3DRX A;  3H4D A;  1I94 J;  1UW9 A;  4KJI A;  1FRH A;  2DGT A;  2CPJ A;  2J8S A;  3OFF A;  3IO1 A;  3HMJ G;  4DV0 F;  2IVM A;  2YVS A;  3SIP B;  4AUK A;  5BYS A;  2I2Y A;  3VAI A;  1HYS B;  4GKJ F;  1B3T A;  4OYZ A;  4RUB A;  2IRX A;  4M5M A;  1X31 C;  2PA8 D;  4P73 A;  1FJG J;  1Q95 G;  1S1U A;  3BO3 A;  1WG5 A;  4K4V A;  4ECV A;  1EQ0 A;  1K0T A;  1S6U A;  3NXZ A;  2CRL A;  4YS2 A;  2DRA A;  2JFK A;  2DNQ A;  5BXI A;  1DTQ B;  1BXN A;  2E66 A;  3TWZ A;  2APO A;  4OYX A;  4DPW A;  3SZ2 A;  1CPZ A;  3EZU A;  4DL0 C;  4F50 A;  1EHW A;  3CMA S;  4ED1 A;  3SFU A;  3PR4 A;  1TUG B;  2XO6 A;  2F40 A;  3JAM U;  2ZH5 A;  2HNY A;  4X4O A;  1IBM J;  3OTC A;  3CF5 Q;  1TAU A;  4RU9 A;  2XUL A;  4TN2 A;  1RWP B;  3FRZ A;  2VDI A;  1G2E A;  1FFS B;  4CO1 A;  4KHP F;  3KJQ B;  2CQH A;  2Z0G A;  3M2V B;  4PXB A;  1SUQ B;  3R5A A;  1U4B A;  4C8K A;  2QA2 A;  4FVM A;  2VKR A;  5E3R A;  3RTV A;  1HNX J;  2YNI B;  2UV8 A;  2HWT A;  4K2X A;  3VF0 B;  8ATC B;  5CQG A;  4ITS A;  1IKV B;  1SQG A;  3P96 A;  1U1Q A;  4B9T A;  4O4G B;  4JB8 B;  2ZKT A;  2J9E A;  4I1T A;  4AYB D;  1T9W A;  5CCL A;  2EFV A;  1U6F A;  2F3J A;  3FJ2 A;  5H9F J;  5EDW A;  4DQI A;  2UXB F;  2O66 A;  2OML A;  2RIL A;  4XAK A;  1QAY A;  3TA0 A;  5KFU A;  3R97 A;  2Y1J A;  2FPH X;  2EG2 A;  2BM1 A;  2W8K A;  5IZH A;  2UP1 A;  3PJX A;  2GJF A;  4QW8 A;  3K57 A;  1U25 A;  2WSC C;  2J0W A;  3NCP A;  2B6A A;  2CPZ A;  2DGS A;  1TAQ A;  3D68 A;  3LGN A;  3OD2 A;  3FEY B;  3T5J A;  1P1L A;  5KG6 A;  2VPW B;  4DFP A;  1TP7 A;  2O5D A;  7FD1 A;  4LF7 F;  1N54 B;  2HBZ B;  1HBU A;  3BS9 A;  1PKU A;  1JNR B;  3T6B A;  5KFO A;  3J81 j;  2XLI A;  3A8E A;  1FRI A;  3PDN A;  1RA6 A;  1U6Z A;  4FXV A;  1QJH A;  2FY8 A;  2A0F B;  4MT1 A;  1RI7 A;  3KXD A;  2D9O A;  1RTJ B;  1XWL A;  2QIF A;  4NZ6 A;  5DQH A;  5KG2 A;  3T1Y J;  4NX9 A;  4DV7 F;  2GAH C;  1LKZ A;  4NZ7 A;  1N33 J;  4C3M A;  3A8K A;  5I42 A;  4NRU A;  4DJB A;  1N34 F;  2AMC B;  3D0H E;  3L9Z A;  4QIG A;  5LSO A;  1SJR A;  3QRQ A;  3H2U B;  3DOL A;  2BQR A;  1W7W A;  1NZ8 A;  2WOM B;  2ZJR Q;  1ZYQ A;  3IRX B;  3SDE A;  3TQE A;  3PO4 A;  3QLH B;  4YUD A;  5LMU J;  1UVJ A;  1JLG B;  2VFR A;  1F3V A;  2KH9 A;  3G6Y A;  3I0S B;  3NS7 B;  1RTH A;  2I1R A;  4C9D A;  4HI1 A;  3E01 B;  1H0H B;  5KG7 A;  2OP5 A;  1RTH B;  2JC0 A;  2KVQ E;  4J9V A;  1GX6 A;  2M7S A;  3J80 Y;  2OPQ B;  3G9C A;  2GHP A;  1M0S A;  1S7I A;  4ELT A;  3HXM A;  1IWG A;  4ILR A;  4DR7 F;  3IGV A;  2ZBP A;  3LF0 A;  1FWP A;  4IH5 A;  4M1K A;  2QA4 G;  1RHR B;  1RXO B;  3D0G E;  3KUH A;  2LYV A;  2GX8 A;  4OZ0 A;  2UVW A;  2HBQ B;  1N5T A;  1HBO A;  1LXJ A;  3NOC A;  2BXJ A;  3M2U B;  1VFJ A;  3MDF A;  4USM A;  2OPP B;  2J6U A;  3P5T L;  1K47 A;  1X4A A;  3M6X A;  4Y0F A;  4N56 A;  4DI6 A;  5J1E A;  1N56 A;  4P10 A;  2RS2 A;  2WRM A;  1YWX A;  1GQE A;  2CG4 A;  3MPU B;  4NLX A;  2RU9 A;  3SI8 A;  2CQ2 A;  1G4C A;  3Q83 A;  1X7V A;  2IYI A;  3W61 A;  2BX6 A;  3E3X A;  1XIQ A;  1NDP A;  1Q0N A;  4NLV A;  5F9L A;  1RP5 A;  2AGO A;  4FF2 A;  5F8N A;  2KN4 A;  3IM8 A;  4C11 B;  4DBQ A;  1C1B A;  1HAR A;  4OI0 A;  4CZC A;  3CVK A;  4HEA 9;  3U1M A;  3HFV A;  2NYI A;  3NGK A;  2XB2 D;  3DN9 A;  2XMT A;  3Q8U A;  5DLF A;  1T9V A;  1BQN A;  1Q4R A;  1NB7 A;  3O6Q A;  3P49 B;  1PYS B;  3HVA A;  1SKW A;  1DZ5 A;  4WU3 A;  3V5R A;  2JLE A;  2XO7 A;  1VK3 A;  4HTJ A;  1XC9 A;  4HI2 A;  1NDC A;  3IR5 B;  4P2S A;  2HND A;  4DZD A;  2C3O A;  1WHW A;  5J2P B;  3DI6 B;  1WJ9 A;  2HGM A;  2QYC A;  3GON A;  2D3O 1;  4K5R A;  4OYO A;  2R8K A;  5K20 B;  1H3D A;  2K7K A;  3PRB A;  4ES2 A;  4Y2M A;  3MAH A;  4I2Q A;  4DV4 F;  3A13 A;  2XEX A;  3M9N B;  1IKW B;  1T0T V;  3N5F A;  3U27 A;  1FF2 A;  3D1Q A;  2ZE2 A;  4ES3 A;  5I3Q A;  1VC5 A;  3CD5 A;  1Q7Y T;  1D0E A;  4K0K F;  1IM6 A;  4TVA B;  1RWV B;  1R6V A;  1HIY A;  4IDK B;  4DPO A;  1KON A;  2CG8 A;  2IYG A;  3NCQ A;  4IDK A;  4DL5 A;  1GMW A;  1GMU A;  3HFK A;  3R6L B;  4I6W A;  1TKD A;  2RRB A;  3M32 A;  4O44 A;  2JEJ A;  1VQP S;  1NSK L;  3C15 A;  4OI6 A;  3CD6 S;  2YQ1 A;  1RK8 A;  3IG1 A;  1Q8K A;  2VQE J;  2MTL A;  3CJ2 A;  3GFZ A;  5EWG A;  2L9N A;  2MHE A;  3MEE B;  2CJA A;  2EBE A;  3UI3 A;  1G6B A;  2CQG A;  3VZI A;  3WQP A;  4N5S A;  2CYY A;  2CQI A;  3LP1 B;  4DPY A;  4DEZ A;  5G0R B;  3RRH A;  5DZ6 A;  2DR7 A;  4YFU A;  3TUP A;  4GMK A;  2IM1 A;  3I0R B;  3KUG A;  1FD2 A;  2JWN A;  4LFA F;  1VI7 A;  3I0R A;  5KFR A;  4EUV A;  4HKQ A;  1Y5I B;  1AFJ A;  3MEC B;  2VC0 A;  3R3T A;  2Z2Z A;  5BYQ A;  3KLH A;  3HSG A;  2ERR A;  2D69 A;  1AA1 B;  3SQG A;  4PQU A;  3RW6 A;  1D09 B;  2FDN A;  5FII A;  4ERD A;  4OYI A;  2YNG A;  4QW9 A;  1ZAV A;  3NNA A;  2NZ4 A;  3QGP A;  2MKS A;  5D0E A;  3CC4 S;  4DSJ A;  2YQ0 A;  3V4I B;  3NLC A;  1Q8B A;  2RDD A;  1DUR A;  4EO8 A;  5CZV A;  3WIV A;  4DCP B;  4GVB A;  4W4M A;  1BGX T;  4F0K A;  5KT6 A;  3KJV B;  3HF5 A;  5DLG A;  3R1H A;  1U26 A;  3H40 A;  4EBE A;  1SC3 B;  1MMD A;  1NU4 A;  1SB6 A;  3T5K A;  2DIV A;  3ZTS A;  4K4S A;  2J9C A;  4A4J A;  3DYA B;  1L3V A;  5E3Q A;  5GAH U;  3KLI A;  3GYG A;  2OJ3 A;  2F4V J;  1B64 A;  2CXE A;  1REV B;  2E1M C;  3D1O A;  3D6F B;  4P2X A;  2K3I A;  3ZNU A;  2KHD A;  2C3P A;  2QRR A;  1ZM9 A;  4OJH A;  4PYD A;  1SC6 A;  2NUU G;  2CIM A;  5D4L A;  3BF4 A;  2RML A;  1SH0 A;  2CPF A;  1DLO A;  3GJT B;  3R5G A;  3M4X A;  2FHJ A;  3CJK A;  5CAA A;  3HKW A;  4KYZ A;  3BN4 A;  3EGV A;  3V6D A;  1S76 D;  3W9H A;  3CJR A;  2C3Y A;  3OHB A;  2IRY A;  2L41 A;  3O44 A;  3PTW A;  5D0G A;  5JUM A;  1U45 A;  3UNG C;  4XO0 A;  2V8G A;  2MZQ A;  3PZP A;  2B7C B;  3H5X A;  4U7U K;  1UZH A;  4GC6 A;  3PNI A;  1FNO A;  5EX3 A;  2H48 B;  3LAK A;  5GMK a;  2P6S A;  2IC3 B;  1O51 A;  3Q8V A;  4LRF A;  3GIR A;  2BE2 B;  4M5G A;  2B0G A;  5DZ7 A;  1Y0H A;  4PUO A;  1X8D A;  3R6G B;  3I6P A;  1UA0 A;  1NND A;  3J7Y U;  4LFB F;  3UW1 A;  4X4S A;  5ETP A;  1R7I A;  1R31 A;  4LSZ B;  1VRU A;  1S6O A;  1S6Q B;  5EGY A;  3NBP B;  4FPR A;  4CP5 A;  4JV5 J;  1NK0 A;  2W2M P;  1KQG B;  1S79 A;  4LFB J;  1HR0 F;  3UDL A;  3SSQ A;  2ALY B;  2C2Z B;  2OEM A;  4I7F B;  2HKE A;  3MCM A;  2DHH A;  4KH0 B;  5K9F A;  1RT1 A;  1GTE A;  3BH7 B;  3BSO A;  2LEB A;  4UZB A;  2R8I A;  3PHT A;  5EWF A;  2V94 A;  3ET6 B;  2V63 A;  5CYQ B;  3M1V A;  4QIE A;  4DR3 J;  1N33 F;  3JB9 k;  2LEA A;  4R8U B;  3UN3 A;  5HLF B;  3ITH B;  1HQ2 A;  2ALZ A;  4ZVU B;  4O3S A;  4G1I A;  2CQ4 A; 
#chains in the Genus database with same CATH homology
 1KBR A;  3HD1 A;  3HSJ A;  4M5K A;  3UD5 A;  3KUH A;  5ETO A;  4AD6 A;  4M5G A;  3HSD A;  4M5N A;  4CWB A;  1RU1 A;  1RTZ A;  3HD2 A;  5ETT A;  5ETV A;  4CYU A;  3MCO A;  3ILJ A;  1RAO A;  3ILL A;  5ETP A;  1TMJ A;  1TMM A;  5ETN A;  4CYU B;  1RB0 A;  2F63 A;  5ETS A;  3ILO A;  2BMB A;  3MCN A;  1RU2 A;  4M5I A;  4F7V A;  3KUG A;  4M5H A;  4M5M A;  5ETK A;  1EX8 A;  3MCM A;  5ETQ A;  5ETL A;  5ETM A;  1F9H A;  1G4C A;  2QX0 A;  4PZV A;  3UDE A;  2F65 A;  4CRJ A;  3KUE A;  5ETR A;  3HSG A;  1Q0N A;  3HT0 A;  1EQ0 A;  1IM6 A;  3UDV A;  3ILI A;  1DY3 A;  1HKA A;  1EQM A;  2CG8 A;  4M5J A;  1CBK A;  1HQ2 A;  4M5L A;  3IP0 A;  3HSZ A;  3QBC A;  3HCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...