4M5NA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
HMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5nA00
3UDVA 4PZVA 1F9HA 4CYUA 3HSGA 4CRJA 1RU1A 3KUEA 5ETVA 2F65A 5ETSA 2F63A 4M5HA 1RAOA 1EQMA 4CWBA 4F7VA 4M5NA 1HKAA 2QX0A 4M5GA 1TMJA 3ILJA 1KBRA 3MCOA 1Q0NA 5ETQA 3UDEA 5ETPA 3IP0A 5ETKA 1EX8A 3KUGA 4M5MA 1RTZA 3ILLA 4CYUB 3ILIA 3KUHA 4M5LA 1RB0A 1TMMA 3HCXA 3MCNA 3QBCA 5ETLA 3HSDA 5ETOA 5ETNA 4M5JA 2BMBA 1IM6A 5ETTA 1EQ0A 3HSZA 3UD5A 3HD2A 4AD6A 1DY3A 1G4CA 1HQ2A 5ETRA 3HT0A 2CG8A 3HD1A 3ILOA 3MCMA 4M5IA 1RU2A 5ETMA 1CBKA 3HSJA 4M5KA
chains in the Genus database with same CATH superfamily
5FD1A 4QWBA 2OEMA 1KTQA 2CG4A 2UUWA 2MJNA 4ZVQB 2OH2A 4DFJA 1NDPA 1F6TA 1FRXA 3UNYA 3ISZA 5CCLA 4ED2A 4NI2A 4DQRA 3TQ1A 1KS2A 2R42A 1GT8A 2WSCC 1X60A 3EGWB 4KBIA 2JVOA 4LF4F 1UL3A 4LBPA 3M8RA 3ZZZA 2UXCF 3AT1B 5DQHA 1HWLA 3GYGA 3UR0A 5FLXU 4USUA 2B4UA 4M5JA 1JXLA 3HD2A 4RUBA 3MCSA 4H4KC 2QMWA 2CJAA 5F8MA 1AROP 1UJ4A 3BYRA 1EIYB 2R3VA 1I51B 3GILA 3R27A 1MROA 3TO8A 5FLXY 5LMUF 2V8GA 1S77D 4QOTA 2HW3A 4DL5A 3R7BB 5B0CA 1WHXA 1WSVA 4BC9A 4R8UA 4X4PA 1RWMB 1PC4A 3BB5A 3G4SS 1S9EA 1AYEA 1QE1A 2ZOGA 4NASA 1JLFA 3DLBA 3J7AN 2IAJA 4PWDA 2CQIA 2E9ZA 2VPWB 2I5JB 2X3GA 2Y1LB 2J9EA 3M2VA 3TUZC 3FGVA 4IH5A 4RW4B 2FVSA 4KQZA 5KTQA 1CEZA 1YITS 4M94A 3Q23A 4DV2J 2J0WA 1HMVA 1T94A 2WVEA 5EWFA 1FRKA 4R25A 4ANDA 3BJYA 4YUDA 2Z58B 1SJFA 2F8EX 1X9WA 3H42A 2HK2A 4C9DA 3ZNJ1 4K4UA 4M5GA 3IGNA 2NR0A 1R6VA 1T9VA 2XMUA 4Q43A 2PDAA 3D0IE 1KN6A 2KJVA 4JI2F 1SJ3P 1RHJB 4X65F 4K59A 3JQKA 1LWCA 3AXKA 2L48A 4ILLA 3POTA 3D1OA 4ICLB 5F8LA 4WFZA 4F0MA 4FS2A 2H9ZA 2KM8B 1RWOB 4DL3A 3PRBA 2YWEA 4DV7F 4C8YA 2DHAA 2FVCA 4F7VA 5F8GA 2PMWA 1XIQA 1KQKA 2RDJA 4C0BA 1IR2A 6AT1B 1JJCB 1IQZA 2G0CA 5E33A 2R7WA 1LWXA 3LAMA 5KG0A 3RB4A 3TZWA 1UVMA 2N4DA 4DHVA 1X4BA 4MH8A 4WXWA 4EGLA 2WONA 1IKXA 3FEXB 1TL7B 3JB9k 3MUVP 2DGWA 4ZLJA 2AYGA 1VRTB 2NXNA 3PM9A 3TA0A 1P8GA 3GQCA 3KUHA 3NGTA 3Q22A 3HHLC 4KH1B 4B3MF 4HHJA 4K8RA 4ECXA 1F9FA 1DBDA 1GTHA 4BWMA 3ISND 3RW7A 1SL0A 2XWYA 3UR3C 4IRCA 5A8RA 3PXGa 5J1PA 3EGVA 2NLWA 4DCOB 4NX9A 4IRDA 4LF2A 3CIZA 3IWLA 2CWKA 2G9OA 3MPWA 1EARA 3W62A 5KOWA 3J7A1 4B9SA 2ZHAA 1S0OA 4M5DA 1GQEA 3G87A 4LF8J 2KT2A 3ZTSA 5KFZA 4J9SA 2NXJA 2E1RA 1S4EA 2DNKA 3EVMA 5C25B 4TQRA 3U27A 1W25A 1L5UA 4OX6A 3OTDA 5SUHA 4CLLA 1WSRA 2WTFA 4NMXA 4CCHA 4ZP9A 3P5BP 2CWXA 1AA1B 5JJBA 3CGIA 2VG6A 3TJ8A 3H5XA 4LR9A 1DTTB 3U1NA 5GAHI 3P8BB 4DUYF 5IM0B 1S99A 2J9CA 3OLBA 2R8KA 2WZ1A 3PYFA 2VQFJ 2ASLA 1HYSB 3MGJA 2MKKA 4MK7A 4ELVA 3EGZA 1IKVA 2KDOA 2LQ9A 1GMWD 2HHUA 1UFWA 4TLRA 2DGUA 3K8VA 2ROGA 3CDAA 1RQ0A 2UZAA 4X4VA 5DDQC 4CH0S 4KH0B 1Y3KA 4DR4J 2V63A 4O44A 1KC8T 1C0TB 4AXJA 2IA0A 4I7FA 4U96A 2B7CB 3CO0P 1YLXA 1Y10A 1DARA 2QA4S 4NYZA 3T41A 3M2UB 2RAQA 2E1PA 3BGOP 4ZIVA 2EI5A 2OTJS 1RTIA 3NGSA 4IOBA 3P5TL 5ITHA 3D3CJ 5CD4A 4QWAA 1BXNA 4DX8H 1OPIA 4JI3F 1JLEA 2KTQA 3DOMA 4XO0A 4B3TF 3PW4A 1FEEA 1XWLA 5GAGI 4WKRA 4IFVB 4YB1P 4DV6F 2Q3PA 1W2BR 3AY0A 3EZOA 4CLZA 3TEHB 3I0RB 1AUSL 5F0WA 1ZTTA 2ZJQQ 1YHQS 1TUWA 3R3TA 4ED1A 4HT7A 2BJ3A 1H3DA 2UVRA 4BBYA 2XY6A 2FVQA 2R7SA 1L3TA 4TXSA 2ZH8A 3MUTP 4DG1A 4PR6A 2PFFB 3NNCA 2VBYA 2F63A 4G1QA 2QMUB 2BOPA 2Z57B 2QYGA 4L74A 1VK3A 3FVYA 1WF1A 3CXCR 1UEUA 3PFOA 1UZDA 4CLTA 2EPIA 3HVWA 4DV3F 2MQOA 5DS7A 1FT8A 1P9YA 1N5YA 2M4MA 1G3OA 3LGHA 2R7QA 4X64J 4DR3F 4Y2AA 4U6PA 1S6UA 2E66A 3V81A 1JXEA 3OUYB 2VUGA 1LWEA 4I0WA 2NSCA 8AT1B 4JI6J 4GKKF 1Q86T 1QAXA 5DG9A 3CPWR 4DQQA 2VFSA 2E29A 2KFYA 2IJFA 1FFGB 1QUVA 1ZM4A 4LJMA 1YRXA 1WDTA 2FQQB 2CAJA 1KDNA 3VR1A 3NBPB 4DPWA 4A8MP 2J5AA 1ZTWA 1LK7A 4EWTA 1RT6B 2NXEA 4TU8A 2MHNA 3RB6A 2G1HA 2ZJPQ 1U6BA 3CC4S 1T05A 3OTCA 2L9WA 1G7CB 2L9DA 2KL8A 3UNGC 1R89A 3CJKA 2CYYA 2M7SA 1TKXB 2JRSA 3MF5A 4PXEA 3KXDA 5AE1A 1HQEA 4DDFA 1T03A 4DSFA 4USKA 3EVOA 2EFPA 2XMMA 4RNNA 4GVBB 4OYOA 3MTJA 3T1YF 4ZVGA 3PR4A 1U1LA 5L1KA 1JLAB 1CQMA 3E2EA 2CDRB 2V2KA 1WNEA 2K1RA 2BM0A 4ZCLA 1PCAA 1OIAA 1RHKB 1SVDA 4RUHA 2RJZA 4K2XA 3TEGA 1IJFB 5LT5A 3MM9B 2AJ0A 4FXVA 2CPEA 5L1JA 3RZAA 3RUBL 3EE3A 4RU2A 1VQ8S 2ZH6A 3CUNA 1VRUA 2BE2A 4E8UA 2AP6A 2EFVA 4DOZA 4Q0BB 5CA5A 2A10A 4LRDA 3H25A 1W2IA 2GHVC 2KT3A 2WW8A 1F5BA 2UXBF 2XLIA 3EMTA 3MHYA 1NJXA 3SCLE 1RI7A 3CJ5A 3LP0B 1YTYA 2IRUA 1BY9A 3CMAS 3VAMA 2PMZD 1KOHA 3CF5Q 4YMEA 2CNNB 3MFIA 4HH1A 1RTDB 3GFYA 2DR5A 4F02A 1C0UB 2VPZB 2I6WA 1RE1B 1UEKA 3GV5B 2KKHA 2HHHF 4OHZA 3Q8QB 1OS5A 1JLGB 1URRA 1SQGA 9ATCB 4U7CA 3BBBA 2QSFA 2XLKA 2Q43A 1AXQA 4PQUB 2H1YA 4HR2A 5GAHU 2CJKA 1D1UA 2ZFHA 3BH6B 2WRMA 3OL8A 1QD1A 3LA0A 4KHPJ 3N6LA 2XTJP 2XYPB 3JAMU 2AW0A 2Z2LA 2ZH1A 3QIDA 1RT4A 2VIHA 1BUXA 4XPCA 2RQKA 4LSLB 3MZIA 4UY85 5HVFA 3F73A 3TWZA 5E3PA 5L1LA 1DJ0A 4LSZB 1PG5B 1Y7PA 1XTZA 5F8HA 4DV4F 2ZZMA 2GO9A 2W2MP 2O66A 1DQ8A 1LK5A 2N82B 1N56A 1Z4UA 1WOPA 2WBRA 2YH1A 3CCSS 2X1FA 1H2VZ 2SXLA 5G0RA 4AXIA 4KE5A 2E9RX 4ER8A 3FCVA 4B3SJ 1S1UA 3RG6A 2XZDB 3ENWA 2DGXA 1VQNS 1NDCA 2ZVSA 4P2SA 3S6EA 4KB7A 5GAGU 4LSNA 4CYUA 1FO1A 2IM3A 3VVTA 1RAEB 3AAWB 3MR6A 4ID8A 3VTIA 1BGXT 1HNZJ 3W65A 2V5HG 1R0BG 4QWCA 4E98A 1ZPVA 2ACMA 3HSJA 1K0TA 2MB0B 3P6YC 4PPDA 3EUNA 4EBDA 2QX0A 3DGPB 1UVLA 4PUOB 4KKOB 2G2OA 2HWHA 1HBMA 4DCJB 4CLKA 4A47A 1RWUA 3DLKB 2IIHA 1KQSR 4LR8A 1SUQB 1PILA 4NA1A 4JI7F 2M8HA 2CVEA 4I2QA 1KQGB 3US5A 3L7OA 3CJTA 2VHGA 4HDGA 3AQOA 4K5SA 2IMOA 3VQTA 4DV5J 4KGZB 5AT1B 5KG2A 5KFBA 4YFUA 4EFAC 4RNHA 4CO3A 3A3PB 3MURP 1S0MA 2U2FA 3ZO7A 4PQAA 2IJRA 5D15A 2KB2A 4J9LA 4BWJA 2CPIA 4UF4A 4FYDA 3GFXA 4KPCA 2CPDA 5HJXA 1U0HB 3X3UA 1NB7A 2VQEF 1ZOTA 4CT8A 1VHIA 1F3FA 3DM2A 4DUTA 1WC1A 4K7QA 4UQTA 3M2RA 4YS2A 5IC4B 3PW2A 4DLEA 4NRTA 2NZ4A 1HBNB 1YRTA 2MKHA 2B56A 2DK2A 3KYLA 3D0HE 4OZ2A 2IAJB 1N48A 2UUBJ 5A8WA 2KM8C 5JVHQ 4NLSA 3IGVA 4PWDB 2XZWA 2DEJA 2V6AA 1XEZA 8ATCB 4IO1A 2H5IB 2EWHA 5J2QA 2MMYA 3GPAA 2LXIA 2KVQE 2ATLA 2MGZA 1GNKA 2DO4A 1NHVA 5T7LA 1KHWA 1HMVB 1I94J 3A3NB 3BV8A 1D8ZA 1FE0A 3VAGA 2P2CB 2A2CA 2HBYB 3RBEA 1MU2A 3KDNA 2YNHA 3VALA 3VZHA 1UCNA 4C48A 3I55S 3AD7C 3OHBA 3HT0A 1TFWA 1IKYB 2UV8G 2VFUA 2YKOA 4NZ7A 4OZJA 2NPIA 4V19X 3OFEA 5HROA 2ZD1A 1FHTA 3JTPA 3IM8A 1EETA 2DNQA 2GQ2A 3OHAA 1VC6A 1LOUA 4USMA 1VQ4S 1LWFB 3POTB 3LP2A 2R8HA 2JL9A 1FKAF 2XZTB 2MPUA 3A8JA 2QO3A 3H5YA 1T02A 4G1PA 3FCWA 2HRYA 2B9EA 5HANA 2F5GA 4URSA 1RXOB 2QZ8A 1QAYA 3KHHA 3LANA 4X4UA 3AODA 5HMWA 2XMKA 2B8QA 3EPIA 2JEFA 4G6VB 2K7JA 3ZTPA 1M5KC 2ALYB 4N5SA 2PI5A 3TP2A 3PJXA 2C22A 4IOAQ 5E0OA 3PNIA 1JXVA 2WONB 1IKXB 1FWKA 3DRPA 3IR6B 3M6XA 2CQCA 2JX2A 3GJRB 4W98A 1UWBA 4DSIA 2DIUA 5E3AA 3MUMP 2HG4A 2OPRB 1B7YB 2RDIA 1VQYA 1HNWJ 4OX9F 4P71A 5CABA 3ITHA 5BJRA 3GYXB 2M9KA 1T11A 5T41A 4NZ0A 2QLBB 3LO3A 1RAAB 2HNYA 2HNDA 2VL1A 3QT6A 2DGTA 2BQUA 2B4PA 2QJ3A 2W7AA 3IAM9 1NK4A 3HHNB 2C3UA 1RUSA 4YEAA 4M5DB 2I38A 2V4RA 2R4FA 4OZ0A 2IHR1 2K8GA 4CQ1A 2YNIA 1RTHA 4UY8T 2CADA 4HLBA 1HARA 2HZAA 1P1LA 1H72C 1KR4A 1R27B 2NCKL 3MPDA 5IC6B 5GAEI 2XY5A 1A6LA 1RYSA 2CQPA 4M63A 4FF1A 5CQGA 1Q53A 5IZHA 2VG6B 1FVQA 2QRRA 1JLQA 3SIPB 5A6PA 2LXUA 3KJQB 1SH2A 4OL8A 5KFGA 3MR7A 4IG3A 3DYAB 1RHQB 4AE5A 4Y28C 3KLIA 1A9NB 3KWMA 1SB6A 1KOOA 1N34J 3PX4A 1BQMA 4F0KA 3VAFA 3NGKA 2DISA 3EZUA 4NE9C 4J9OA 2FZKB 1GEHA 3HFZB 3C6UA 3N6MA 3QAEA 2P6TA 2CZ9A 1HR0J 3N79A 4O44B 2MZQA 5CZVA 3B78A 2P6SA 2FHJD 4O3OA 4I7FB 5A8KB 1XMOF 1CSJA 3DLGB 3QWUA 4DF8A 2HEKA 4ELTA 3QGPA 4I2PB 1ZAWA 1NKBA 3OL7A 2W4DA 3BQ2A 1RTIB 4RW6A 2ZZTA 5D0GA 4MKAA 1B64A 1GX6A 3QLHB 1FX4A 3H40A 5DETA 5LL6d 3LP1B 4HHUA 4USJC 5D0HA 2RVJA 1JLEB 2CPXA 1M90T 4JI8J 3CTRA 2OSQA 1H7XA 3MAHA 1SH0A 1D3WA 1H2UX 2NYHA 4OZLA 1SKRA 3SZ2A 3RB0A 1Q4RA 1ZM3A 3C14A 2IA6A 1YSJA 4AD6A 3DHXA 4XIUA 4LF6F 5KFAA 1ROFA 4X4RA 2XHCA 4DG1B 2ATCB 2ZE2A 1M1KT 4QJVA 3FSIA 3OTOJ 3HK2A 2DT9A 4X4OA 4PRFA 1C2PA 4F4ZA 1FDAA 4HH0A 2E7VA 2R2SA 4G1QB 4ED6A 3UO0A 4E0DA 1UMJA 3KK1A 5DJBA 1OY9A 4DPUA 3RAQA 2DEIA 2AMCB 2IMWP 4QPTA 1LNQA 1VLOA 2OJ3A 1DLOB 1G2EA 1Y3JA 4ITSA 4QWDA 1EHWA 1Q16B 4C8NA 2HQGA 1FJCA 3CC2S 2AJ4A 2EC0A 1K44A 2BANA 5DGAA 1OYEA 5I3PA 1LWEB 1WEXA 2PSZA 3PEJA 5L8RC 3W64A 3HM9A 5AXKA 3QJPA 1WG5A 1XR6A 1G6BA 4GC6A 3R97A 3PO4A 3MCMA 3KG4A 3EPGA 4J9QA 3UD3P 3HJVA 3SCKE 3BSOA 1RT2A 4I68A 1X5TA 5FIIA 3CDWA 4CM0A 3HSZA 3RW6A 3OSNA 3H0PA 5H9EK 1HI1A 1S1WA 3R6GB 6FDRA 1T05B 3DRXA 3RU0A 2DPIA 4OHXA 2F65A 3D5MA 1X8DA 3QIPB 2RHSB 2W9AA 3NOGA 1L3VA 2VJVA 3QSIA 1HHSA 5J2MA 4H54A 1GXUA 4IQMA 3MEKA 3UCZP 2NREA 3UI3A 2FVRA 1S6QA 1NSAA 2DKOB 3K0JA 4KT0C 3D6TB 1ZA2B 3FEZA 2MKYA 1H0HB 3DCAA 3JSRA 3E51A 3Q8UA 4OZ3A 3ILIA 2YKMA 5IT9Y 5F8NA 1T7PA 3HVTB 3MM5A 4UZBA 3U1LA 4HKQA 4ZCIA 2DNHA 3CJRA 1F2GA 4MYUA 2JWNA 4ZPDA 1U48A 3CJSA 1CULA 3WX8A 1L3SA 3PJWA 5JVGQ 2K1RB 1U8WA 3TA2A 4QU6A 2L9NA 2RKIA 2CQ2A 1IJEB 2B8PA 4Q2LA 5CCMA 3OJUA 1TL1A 4I4BA 1M5OC 3P3DA 1VMBA 2CJ9A 1N5SA 3A1YG 3GZ7A 4J9KA 2HMIA 3KG0A 1C1CA 4P7TA 1ZM9A 2FTRA 1QVGR 3NGRA 1VRUB 2BE2B 2LQ8A 3TVZA 2GJFA 4RX6A 4TQSA 4HACB 3R5DA 3CMQA 3UCGA 2LA4A 1CJUB 1RA7A 1B99A 1VR6A 5HSPA 2GIFA 4F2SA 3GCWP 4C0OC 5DM7Q 3FKBA 4A8SA 1CG2A 3T5HA 1MLAA 4CLUA 1ZZFA 2C2MB 5EWGA 4OYWA 1REVB 1VQPS 5GAEU 3CCWA 4ECYA 4MIBA 1RTJA 5IWAJ 5HP1A 1VJQA 3DDNA 2XNQA 1RZMA 2DH8A 2X1BA 2IDEA 4S0MA 4DV7J 1M5VC 4F4WA 3PW7A 2MQLA 3TR5A 3MD3A 2ZKTA 4DFMA 3QQCD 4B3RF 1IKWA 1V9OA 2X3DA 3HHKA 3MTKA 4UUXA 4DMZA 2L41A 4FF3A 1IM6A 2ZBPA 2OELA 3MMJA 3CJ0A 2V8PA 4TYAA 1RT4B 1X9MA 2C2KB 2VICA 4C98A 1WTFA 2MZ1A 3IWXA 1TELA 1U02A 5ETLA 2MYFA 2FJVA 3FRYA 2CG8A 3KNGA 5CYMA 1N32J 2DH9A 4Y0FA 5C24B 3M9MB 4WK1A 2O1PA 2DNGA 2W24A 3NOCA 3OD2A 4NCAA 4QYZJ 3CCZA 1RAHB 1X31C 2UUCF 2F9JA 3WDOA 2F4FA 1UVNA 4ZHRB 3MR3A 2HPUA 1M1HA 2VC0A 2OKQA 2CZVC 2HHXA 4JUZA 1WJ9A 5DO2A 1RHUB 4OJGA 2RS2A 4JI4F 4TKTA 1HBUB 2BA9A 2E9TA 2W9BA 4CM2A 1KFDA 3SBMA 1IR1A 3DC2A 4WXOA 3Q83A 2ILZA 4PG7A 2WAQD 1VC0A 2FYXA 4LSNB 5GMDA 4H4KA 4CYUB 2DXEA 2G1DA 4C8OA 1TAQA 3VGVA 3H59A 4X4NA 2FGCA 2VKZG 5I42A 4JI0F 4UOFA 3SFUA 1YJVA 2ZITA 3MOZA 1BD6A 1SC6A 3KLGA 3KK3A 1IWGA 4B17A 1GXTA 5B0DA 3UCUP 1NPRA 1HI8A 1IBKJ 2KRBA 5KFOA 5D0EA 3CJ4A 2E7WA 1VIOA 4ZK7M 3THTA 4LF9J 1MSWD 2HKEA 2MTLA 1SH3A 5AJ3F 3CC7S 3JSMB 2V4QA 3UD4P 5U47A 4QR2A 2BKNA 2FY8A 4DPYA 4CLWA 3TUIC 2NQPA 4F04B 5DDOC 4RNOA 1U26A 2CQ4A 4FZVA 2DD8S 3I87A 4DLGA 1Y11A 2F40A 2WOMB 3DRYA 1DHMA 3HFKA 3S7RA 2RRAA 1RWKB 3GP9A 4CIOA 4CTAB 4DR5F 4MIWA 4WPAA 2F9DA 4LF7J 3GONA 2QT7A 2AZ1A 2LLZA 2QLWA 4P7VA 1TU0B 2CNKB 2DO0A 1Q7YT 4Z7YA 1U45A 3MEDB 1QY7A 4LFBJ 1K9MT 3RRGA 4DR2F 1L3KA 3H4DA 3CCQS 4N77A 4KC5A 2P5VA 4QIEA 2H4YB 4WU3A 1VISA 3D4JA 3OR2A 3M6UA 3CCJS 1RBAA 4CRJA 1H98A 4ES3A 3ETMA 2GC8A 4Y2KA 2HGNA 4M5MA 5KFEA 2F8HA 3HMJG 3BGUA 1KFSA 3GJTB 4QZVB 2BYCA 3DM2B 1PBUA 1S48A 2PEBA 3UN3A 1K0VA 3TQEA 1NSKL 3N0VA 2HVIA 1S9FA 3M2RB 2OGUA 1WF2A 2ZH2A 4ID5B 4ILRA 1GFWB 1RA6A 1VGYA 4NPOA 1RABB 2AYEA 5A8WB 2FJWA 4F8RA 3AXMA 2ZH7A 3I96A 1Q7LB 1T3OA 3QJLA 4FDFA 4RW8A 5A6WA 2EG2A 2P9EA 2FJBB 2IYIA 1IM4A 2VB6A 3PRVA 1T9YA 2CJQA 1KTVA 4K4TA 5J2QB 4C8KA 3TA1A 4CNZA 3SDEA 1GMUA 1YDLA 4UOHA 2MGZB 3FDSA 3Q8VA 4HHHA 4P10A 5T7LB 5HBMA 3GSIA 3GE9A 1NHKL 4RZRA 1WHYA 2F4VF 1NLKL 2YQ1A 2VFRA 5AXNA 2CQDA 1PO6A 1J5EJ 4EYIB 2MEWA 3AJ2A 2JC0A 3DMJA 4P72A 2Z0GA 4O0NA 3JSYA 3OFGA 4WFBQ 3VF0B 3QSYB 4WIQA 4H4MB 3TAMA 3IR7B 4C7QA 3PCOB 2JNJA 2MQMA 3H2LA 4DN0A 3MOJB 2ZD1B 1M0SA 4B3OA 3ZZRA 1RAOA 2K2PA 2RD5C 2R8GA 4OYZA 3LP2B 4H4OB 4NCGA 5EHHA 3QBCA 2HGLA 2G2YA 2V2QA 4QYRA 1NHUA 5DQIA 5DZ6A 4WKYA 2GMLA 2B9YA 2W25A 3DXSX 4EU0A 2LEBA 4OLOA 4MKVA 4Y3CA 1UAWA 3M1VA 4LBHA 1PYSB 2M52A 2ZUAA 3OVAA 4P2MA 3FEYB 4IRKA 4W92B 1UVJA 4FS1A 2IJNA 3TAQA 3KOAA 3DDIA 4YB5A 2QN6B 1R8CA 4MKYA 3DRPB 5DLGA 4AUKA 5AXMA 2ZH5A 1NK7A 4ZVTB 5LOQA 2DNNA 1NK6A 2LEAA 4JI1J 4CH1A 5I3UA 4MJKA 4DN9A 1U24A 2XQCA 2JLFA 1FK9A 2J8SA 2V34A 2VJUA 1M5HA 5HQLA 1RWXB 2CUYA 2DJWA 3ITHB 2A6MA 2GJ2A 3RYLA 1GK8A 3DU5A 3KHRA 2OO4A 3RAXA 4HVZA 2HNDB 5IT4A 5K8MA 3FBFA 1FX2A 5AXLA 3VAIA 1FVSA 5CZXA 5E2QA 2PIIA 3GWCA 3TZYA 4WP3A 5K8NA 3W60A 4DSJA 2QE5A 4DR1J 3LGMA 4QWEA 4N47A 4A8QA 4DV2F 1AT1B 2HWTA 2YNIB 2P8IA 4A8OA 4IFYA 5L39A 3WIUA 1DY3A 1NKCA 2Y9HA 3T6BA 3MMCA 3C66A 3M30A 1JWWA 3R2DJ 1JIHA 2VFVA 2QV6A 3BN4A 1TMMA 1CPZA 4P9SA 1QJHA 3PEHA 1Q78A 3W3SA 1VC5A 2WSEC 3K7RA 4MFBA 1JLQB 3J81U 3AA8A 2FLLA 2OMLA 1YJ7A 3V4MA 2JFDA 4J37A 3FFIA 3DLJA 3KJVB 2DR9A 3GYNA 3KLIB 3THVA 2AYMA 4CLSA 3ENQA 1P9QC 1MG7A 1BQMB 2YNGA 3NL0A 2JOQA 2DIVA 3C6UB 3HPOA 4DQPA 3D2WA 4FKYA 3IS9A 4YR3A 3K59A 4DFKA 4LRCA 2R2UA 5THWA 1SKUB 2APOA 2CPYA 1C1BA 4WFYA 1CS4A 4Y2CA 1SJRA 2OEJA 4AYBD 1TZ0A 1WOOA 1DURA 2JHEA 3BR8A 2D9OA 3T9NA 3BKFA 3Q8PB 2XMAA 1QAIA 1IUJA 2YWKA 1B0TA 5D4LA 2W8KA 5ETRA 2HQIA 1UPMB 1HWJA 3GIKA 3RJMB 1NH7A 5D6GA 5KT7A 4X62J 5HMYA 1GMWA 1I5OB 2ASJA 4QW9A 4U7UD 2G0JA 2LA6A 3MPVA 1D09B 2E7XA 3T5KA 1I1GA 4U67Q 1TR0A 1N88A 5D4PA 5BYSA 4JV5J 1LW0A 3C14B 3UDCA 4IKAA 2V69A 4ILMA 4ANEA 5D4NA 4C11A 3HO1A 5B0BA 3CDUA 3MFHA 2UV8A 3P45B 4LF8F 1NK5A 4A8KA 3TNVA 2IC3A 3M32A 2M8DB 1WTBA 3KK1B 3CB4A 1SL2A 1JJ2R 5M2PA 4DV1J 1NK9A 4RNMA 2YVSA 3DLEA 3LPEA 2OD6A 1UZHA 4RJVA 1X5OA 3KJFB 5H9FK 3FBCA 3AD8C 2J7UA 2ZOFA 2FVPA 2Q79A 3BKTA 3GCXP 1YJRA 2RMLA 4F4XA 1YJWS 4WFXA 4PXBA 4X2BA 2XG8A 4EZ6A 3MWBA 3HCXA 2VQFF 3IBFB 2BACA 4ZVOB 2OPPB 2O67A 1NJIT 4KGKA 3KK2B 3PIPQ 1RT2B 2Z2MA 3PG9A 5D3GA 1J5OB 1FXLA 3G71S 2NXCA 3DDKA 5J1EB 1TL3A 2VD3A 4BS2A 2YH0A 3BQ0A 2CQ0A 4DR4F 1VJWA 4FXDA 2KZMA 4F3OA 1U1QA 4ZP6A 4WYWA 1OJ4A 3X1LB 5J2MB 5BYRA 5KFCA 1FKPB 2CJYB 1U2FA 2H5EA 1TAUA 4P52A 3GR1A 4PKDB 1B70B 2GX8A 2YKMB 1YBUA 1N5QA 2HFUA 3G6ES 3CIMA 1YG0A 5A2QY 5ETPA 1JQGA 2VQEJ 1U1MA 3M8ZA 1VI7A 1CULB 3F0NA 1X4FA 4GMKA 4YDXA 4WYLA 1UJ5A 2E5LF 2N7YA 4G65A 2V4JB 1YRUA 2AYBA 1RT7A 1JMTA 3R1HA 3CCTA 2W7PA 3MEEA 2G13A 1U4BA 5B08A 1TL1B 3OL9A 4RBVA 4TU9A 4TY8A 2VKRA 5LJ3Y 4AL5A 1Y00A 1TKZB 4ZLNA 4NLXA 2HMIB 1TK0A 1C1CB 1QVFR 2DVIA 1YGYA 2X51A 4EEYA 4RUCA 2ACYA 1PYOB 4HT5A 3CDBA 1UA0A 2DGVA 1TK8A 2H3EB 1WHVA 1J2VA 4F4KA 1T3NA 1UVIA 1S7IA 3HF5A 4DX5A 1F9EB 4X64F 5ETQA 2C42A 3JSBA 5HQ8A 4DS4A 2FZCB 2HIQA 3FZBA 4JI6F 2GW8A 2M3DA 3UDEA 2POKA 1URNA 4K0KJ 2XBPA 3IFEA 2WK4A 4I6WA 2MXYA 4B9TA 1VBXA 3MMBA 1X4GA 5A76A 4N41A 3KUGA 2L3MA 2Y0BB 4FF4A 3MCNA 3HHLD 1NDLA 2NUUG 3W63A 3FRZA 1IBLJ 1XNRJ 3JYTA 2V9KA 1VK8A 2GHWA 4HI2A 3ZZYA 2DNYA 1IKWB 2V67A 4ZPWR 5LJ5Y 3CW2C 4A46A 2C1EB 4PYAA 3ZXWA 2ZWPA 3HULA 3DOLA 4KV8B 2DB1A 5KFDA 3AD9C 2DGOA 1YZ7A 4LF5J 1SC1B 3O44A 3I4PA 2XMTA 2E1MC 1X0FA 3EVWA 5CYMB 3GJQB 2GIQA 1X9SA 2HIYA 4OX9J 1YKWA 2WVDA 3Q8YA 2ZHOA 2WHOA 3EXYA 4IH7A 1OSDA 3M7VA 4C8MA 2KVIA 3BPDA 3MD1A 5LXYA 5K5MA 3G8TA 3CEDA 1Y9OA 4QBUA 1R31A 2W9BB 1F5CA 4NEYA 4NYPA 4RW4A 2P9GA 5J1NA 3DKDA 2RT3A 4FF2A 1FKOA 2W8LA 2CJBA 1KHVA 2BJ7A 2MLYA 4ALZA 3IRWP 3JQMA 4ZDNA 4DXLA 1BE4A 1KLMB 4FBUA 2ZBIA 2VBXA 3DOKA 4C8LA 5I42B 5KT6A 3SCJE 3SEOA 1TUGB 2BBEA 2KH9A 4YOEA 3I5BA 2KXHA 3QRPA 1BHNA 3KK3B 3KLGB 4YY3J 2VG5B 3FC9A 3TUPA 4YHHF 1T95A 1WORA 1SL1A 4CP5A 3ZZOA 1OSCA 4O3QA 1VRQC 4X66J 2OSRA 4OYIA 2I1RA 2R9LA 1NJYA 2IFXA 2LVWA 7AT1B 1XR5A 1FJGJ 3D54A 5ETOA 3QFHA 5BXIA 3QMQA 3ZFVA 3HXMA 2LQJA 2D1CA 1H2TZ 1S1XB 3OVSA 2R7OA 4DZ6A 1ZA1B 1IBMJ 3D7SB 1X7VA 3NXZA 1Z1ZA 1LEOA 3AA9A 2GGPA 3OL6A 4Y2IA 5C42A 4ZN3A 3O2IA 5KFMA 1RYRA 1NK0A 5HVGA 3GIJA 5C7PA 1FNOA 1HBOA 4EBEA 3ZZPA 6FD1A 3NP5A 3DRRA 1HHQA 4M5NA 3GB0A 3JS9A 1RDRA 1N4LA 3EJMA 1KONA 3PDNA 3KHGA 4YR2A 1F3VA 4QYZK 1Y5NB 1HIYA 3GTYX 4DPOA 1R8AA 3LF0A 3OR2B 3LQVA 4CNYA 3NMRA 3GIIA 4WF9Q 2V2ZA 2Z56B 4DX6A 4X4QA 3N4WA 2HLTA 5FDLB 2MKCA 5D4OA 2KFNA 4DUZJ 1SIWB 3EDRB 4DFPA 2LCWA 4B02A 3TOQA 4ECUA 1PJ5A 2LFVA 4LF6J 2E1AA 2M0GB 5E3RA 4PPZA 4WTOB 4QIVA 4K4SA 4OYPA 4DR7J 3HKZD 2G2ZA 4F2RA 4AFFA 4P2FA 1K73T 2UXDF 5HJYA 3S01A 3K5MA 2RQMA 4QW8A 1MW7A 1HNZF 1SKSA 3TAPA 3IR5B 3OFHA 2DNRA 5JUMA 3C46A 5H9EJ 1EQMA 4GVLA 4LRFA 1OWXA 1NSQA 2FD2A 1UFKA 1CJVB 4OI2A 3SSQA 4DR6J 2W9CA 5HBMB 3BGRA 4F3MA 1S76D 4WE1B 2LYVA 4WK3A 1W7WA 1FDNA 1Q0NA 4J5OA 2IVYA 3DMJB 2LEPA 1HNIB 1CJKA 1KLNA 3UWTA 2YX1A 2Z8QA 4P6QA 4GKJJ 2GIRA 4W4MA 1RAGB 3TAMB 1U25A 2HLUA 3L7UA 4KPYA 4DZDA 3IP0A 1Y4ZB 4PEOA 2HZVA 4ZLLA 2ERRA 3OVBA 3BSCA 1K47A 3HJFA 4L3NA 3R5JB 3BSAA 1D9FA 1ZAXA 5IFMA 2C2OB 4MK8A 3KLVA 4BHQA 1VQ5S 2RQCA 3EXCX 4DV5F 5LSLA 2DHXA 3M1VB 4ECZA 4LIWA 4MMOA 2C3MA 2DHGA 4I6AA 1DQ9A 4USHA 1PKUA 1RWNB 3SCIE 1HPZB 4PWWA 2C2RA 2PE8A 4K2JA 3W2VA 2VG7A 2N3OA 3R8YA 4KTQA 4G3IA 1IR0A 4HL9A 4ZPBA 4ZN1A 1T9TA 2DHSA 2VU5A 1Q5YA 4JYAJ 2CDQA 3MCOA 4JI5J 2AIRB 4RBTA 2CRLA 2LDIA 3Q8SB 1CJTB 5I3UB 2RQ4A 2JEIA 3I82A 1HWKA 4F26A 1S59A 3P49B 1DTQB 1V5VA 3ZZ0A 2J76E 4ZVPB 1P6TA 2XS7A 1J27A 5KFRA 2D3OR 1VQ9S 2FJAB 1Q8LA 2DY1A 2UUBF 2XMVA 4PZVA 4WBFA 4KSEB 3Q2SC 1UJ6A 4NRUA 1M5PC 2DRDA 3QZ8A 1I6JA 4TN2A 2VOOA 3Q86A 1XJWB 4LMZA 1Q5VA 3CD0A 4C0HA 4TU7A 3OUYA 1I94F 3K5NA 1O8BA 1XK8A 1X4HA 2EFGA 3HT3A 4QQBA 1HQ2A 4HTJA 1NUEA 4AQYJ 3KKFA 4EI2A 4ATNA 5BR8J 2ZBQA 4B9UA 3BKUA 2R7RA 2XSJB 5ETSA 5JMNA 3QT5A 2HBZB 2HQFA 1JLCB 4OJHA 1Q8BA 3LGNA 2K3IA 2B5JA 2QTWA 4AL6A 1KRPA 3MAQA 1QTMA 2JDJA 1CLFA 2FJXA 2J9DE 5MLCV 1ULRA 5ETTA 2BRKA 3N5BA 2FLOA 2R7VA 1TKXA 3ZTQA 4NLPA 2HHSA 3A3OB 4QIFA 1KVIA 1S6OA 1N6QA 3WIVA 3HI9A 2PD1A 1X4CA 1N33J 1OPZA 3MM6B 3EZ5A 4O4GA 1YBAA 3KMQA 4M5LA 3SQGA 1FWLA 1XNQJ 2JC1A 2JFKA 3M8PB 3VGTA 1YJUA 3KLEA 1REGX 3HVAA 2J8AA 1TMJA 1JLBB 4OI6A 3H8YA 3KG1A 5EDWA 2PO4A 1FNXH 5F0UA 4ZIWA 1RKIA 3TX8A 2GMHA 3K5OA 4DX7A 2FC9A 2KRRA 2GVZA 2YWFA 3R1LA 5KFHA 2FHJA 4Q0BA 3C6TB 2BJDA 1VQLS 2GS8A 3SV4A 3IBCB 4DSEA 7FDRA 4OI3A 2NPFA 4C11B 1S72S 2WB4A 1V5IB 2XGPA 1IWAA 2YX4A 4K4VA 3M6WA 3LP0A 3B4DA 3AFGA 1FERA 3H2VE 4ANCA 3LWLA 3TZXA 2IC3B 4YR0A 2VOPA 2R2TA 2KO1A 3L4BC 2QL9B 1WC5A 5GMKa 4NXNJ 1RAJA 4KJIA 2JEJA 3J81j 1BQNA 4J9NA 4P75A 3IRXB 2H51B 3HSDA 2AEFA 2B6AA 5J2PB 4DL6A 3I6PA 3D28A 4OYBA 2FY1A 1N5TA 1C0UA 2ZH9A 5AJ3J 4J9UE 1EZZB 3PRDA 3ILJA 2IDLA 2NXUA 5KFIA 4DV0J 2V8VA 4LIRA 1RT5A 3NMAA 3BYPA 3H98A 5DLFA 1R6YA 2FGOA 5HK4A 1PAUB 4WP9A 2ZC3A 3SMZA 4X4SA 1RU1A 2R2RA 1FESA 2AJFE 4ETZA 1PBAA 1VDHA 4FYXB 3TI0A 1NK8A 5D3GB 5ETNA 2N7CA 5L9XA 2FHKA 4ES1A 3NCQA 3HD1A 4F4AA 4EYHB 1EKRA 2A2DA 5B0EA 4JOUA 2R7UA 3VVUA 2IY5B 2J0XA 2ZZNA 1T0TV 3T5LA 2K3KA 4LSLA 4OJ3A 1S1TA 1Q8KA 2XCPA 3CJ2A 2ZM6J 3G6YA 2FC8A 4QR1A 2C2DA 2ZHBA 2H48B 2UUTA 3GV8B 5IV3A 1ZM2A 1TTHB 3AHPA 3FBBA 1HW8A 3PJ9A 3D6HB 4JI8F 3PX0A 4CDIA 3F44A 5DG8A 4IOCQ 2CQGA 2RSQA 1RT7B 3MEEB 2DITA 4O0IA 4CI0B 2IM2A 1R8BA 4USIA 4TY8B 3V4IA 2IYGA 3LPYA 1OMSA 5KFLA 4WWSA 1FRIA 4UT4A 2WVFA 2AX1A 5D8HB 2HAFA 2QMXA 3OTOF 5ETMA 3D1HA 1UVKA 2RHQB 1KKHA 3QGIA 4NI2B 2IRYA 3SI8A 3DGPA 2YX7A 2XB2D 4PUOA 3G6XA 3GFZA 4QIWD 3VV2B 3OXGA 3W9HA 2J7KA 2I8EA 1B7FA 2VC1A 2XGQA 3FZ2A 1S97A 1RK8A 3IA0A 4YP3A 1XMQJ 3E3XA 3I31A 4ETXA 1WG4A 1YWXA 5C2CA 1QUPA 2OP5A 1VBYA 2G4BA 1B0VA 1H7WA 1APSA 1LV5A 5J2NA 2W4CA 3MMBB 4ZCMA 1MROB 2GAGC 3RRHA 5LMNF 5BYQA 4WZMA 1RHMB 3TARA 1IVZA 4R8UB 3VZIA 1GTEA 2E5JA 4C2MA 3JYTB 1VS3A 3M8QA 1S9EB 5GADI 2HS3A 1QE1B 3T1HF 4OZ5A 1U2RA 2MJUA 3LUYA 4B9VA 5DM6Q 1JLFB 3WHIA 3V6DA 3BDPA 3OBIA 2UUAF 1SV5A 4B9LA 1GXLA 2D7SA 1RISA 4B9NA 2MQQA 3M2VB 2JSXA 2MDAA 2XLJA 4TNOA 3DOLB 3B4MA 5IS2A 1OY8A 3SSSA 1U0HA 2OPQA 1HWIA 4ED5A 1CC7A 4LRAA 1KQFB 1PC5A 2OLWA 1R0AA 1FJEB 1FWPA 3KTQA 1WELA 4ZJQA 2D41A 2HS4A 2X1AA 2AU0A 1CVJA 1Y0HA 1U1NA 1TVRA 1FRJA 1JK9B 2WCXA 1JNZB 3R5AA 1HBNA 3Q2TC 4UUWA 3K57A 2DR8A 3W5YA 3K8WA 2PFDA 4OFZA 2OUGA 2QIFA 2M88A 4Q45A 1LWCB 1WOSA 5K8OA 2FDNA 4RW7A 4LR7A 2D3UA 2YWHA 1VYAA 3OLAA 3NWGA 1FKOB 2DTJA 1PAEX 3FQLA 1JKHA 1TV6A 4DCPB 4OX8A 1M5SA 4UTGA 3DOKB 3VAKA 1Q81T 3MPYA 5CHCB 4KO0A 1FEHA 4C3MA 4U95A 5KOXA 4NLGA 4WCEQ 1H74A 3MECA 2FLPA 3THPA 3I9ZA 1WC0A 1A0OB 1IKYA 2RU3A 1UP1A 2GVDA 2BOAA 4BCAA 3QWPA 1S12A 1D8YA 4P2XA 1FCAA 1LWFA 2NUHA 3R7SB 1EP4A 1LXJA 1CQNA 4ENOA 5IWAF 1R7IA 3W8PA 2HBRB 4KFBA 3NEKA 1WD6A 4HYKA 2UU9J 2WW4A 4U8YA 2QLXA 3GLJA 4OI4A 1FD2A 1VFJA 4PWUA 1VQ6S 4ECRA 5A8RB 2K7KA 1M1GA 2EEYA 2ALZA 5KAKA 1WF0A 5KT2A 2GGPB 3K17A 2XS5A 5C42B 2ABYA 4RNFA 3IC1A 5KFSA 5KFVA 1JJ4A 1AZSA 5KFXA 2QFIA 1HBOB 2BJ8A 3DRRB 2AHOB 3I0SA 1RT3A 5IT0A 4F36A 1YJ9S 2PA3A 2VONA 3LALA 2KXNB 1U2CA 4O3PA 2WB1D 1FDDA 2OPRA 1RB0A 3J7Z5 4NXMJ 1N32F 4WZQA 1FFSB 1T9UA 1HNXF 5ADZA 2UP1A 2I0XA 4RO0A 2FHMA 2RB7A 3F56A 2PT0A 4QPXA 2FUG9 3BR9A 3PYEA 2AGOA 2ROEA 3BPSP 4OYMA 4DU7A 2VDIA 1SPBP 5H9FJ 4U9RA 2DH7A 5F9NA 3E01A 3UVJA 2BXJA 1DQAA 1S1VA 3PO5A 1NBEB 3CO9A 4O23A 1V3RA 1IKVB 4ZS6A 2CA9A 4U8VA 2AJ1A 4WTYA 2R8JA 1DFDA 1N5VA 2DY9A 4RL1A 3FSYA 2KI2A 4IUFA 3VAJA 1IBKF 4CO5A 4NCBA 3QT7A 4V19J 2W9CB 3LAKA 1KBRA 2YNFA 3BGRB 1FA0A 4ZVFA 4J9MA 4LF9F 5E7OB 2AV5A 2BE7D 3DYAA 2ZEJA 1CJKB 4PAAA 3IXQA 4LF1A 3KUEA 3ICLA 2Z4PA 3QFWA 5HLFA 5HMXA 2VODA 3BREA 3M8YA 4DU8A 3QJJA 1LW2A 3DOMB 1VOMA 2D74B 2IM0A 3T19A 4I64A 4FBTA 4AT1B 5FJ4A 3MR2A 2VPXB 2ZDPA 2CQ1A 4OX7A 2B9WA 3W7BA 2BZ2A 4LF7F 5A8KA 3DLGA 4EK2A 1FTRA 4MK9A 3NNAA 3CT9A 2AJ2A 4I2PA 2V94A 4RW9A 1R0CB 2HHVA 4LFBF 3MPUB 3V6HA 1MMLA 1R3NA 3HZGA 3QLHA 1O0PA 4LFCF 5E3CA 5E5NA 2AEMA 3LP1A 4L76A 3RAMA 3P4UB 4CZCA 3W2VB 2VG7B 3DHWC 5GADU 2MQPA 1FF2A 1NJZA 3NCRA 2P9CA 2ILYA 1YI2S 1N5YB 2E5LJ 4K4XA 3ISNC 2V9WA 4KR0B 3W66A 3PY8A 1RKJA 5IQ6A 1UWAA 3V81B 3HSGA 1TKTA 4ED4A 2JZ5A 2XI3A 2LQ5A 5K8PA 4F0HA 4UQGA 2OIHA 1IXKA 1A7GE 1EJ7L 1SQFA 3U1MA 1PYTA 4DEZA 1VQKS 4EUVA 2GHPA 3KFWX 4C3LA 2RILA 2EKYA 1VQMS 3FNNA 5DRKA 2DHHA 4CLYA 3M8WA 1FXDA 3N01A 5CAAA 1DLOA 4HDHA 3BBFA 5KFUA 1WKKA 3K2YA 3ZTOA 3GIRA 2GCFA 3BBCA 1DRZA 5IT9U 4KHRA 2BR0A 1T9WA 2R7TA 4LF4J 3CJKB 3BH7B 3QO9A 5A0YA 5F3TA 2UXCJ 4J90A 3QRRA 1QDUB 2BVZA 2KHCA 2ADBA 3ULHA 4PG8A 1J5EF 3NWRA 5IOLA 1HQEB 3V5RA 3OPKA 2QL7B 4LQ3A 4OHYA 1T03B 3CJQA 1I3OB 3QPIA 2HYIB 2O01C 2XEXA 5CH7B 2R7XA 3N5FA 1O6XA 1PGZA 1FRLA 2ZH4A 5LMUJ 3T3FA 4WFAQ 4TYBA 3A4TA 2B5JB 2OEKA 3AOAA 3F41A 2RNEA 3DFEA 4L3KA 1TFYA 2CJXB 3RRKA 1G4CA 2DXFA 3DI6A 2MLZA 3FQKA 3QIPA 4NLDA 1RHRB 2KN4A 5CXTA 4YB7A 2YPZA 5HAOA 1BLUA 1UETA 2RS8A 3C16A 2YKPA 1MMDA 3JTNA 1V3ZA 5KG3A 2RUSA 3KNAA 4NLTA 1BC6A 3MAAA 4ED0A 3H20A 4CO1A 3HVTA 1N6QB 5HO4A 1N36F 3CCLS 1SJ1A 2VASA 3HX9A 3G96A 1ZAVA 2C2ZB 4O4GB 3SQGB 4FXWA 4JI1F 4NLUA 3NNHA 4C4WA 3KLEB 1NEEA 2I2YA 2DCUB 1SQEA 4Q7AA 2RH3A 2AZ3A 5EGYA 4ZJOA 4JI2J 2VF3A 1ACMB 3TUJC 1RBOB 4X65J 4N56A 4KGVB 2W2OP 3ET6A 4ZCKA 3SV3A 2GVZB 5KT5A 5IXUA 4PG6A 3PVXA 5DG7A 1RT1A 2DR6A 5LSRA 1S4FA 4XK8C 3SYZA 3HZEA 4DR1F 4LFAF 4HACA 3Q8RB 1P27B 5LM7E 3UN5A 3DRSA 3LTOA 2V8DA 1CJUA 3MDFA 1U6ZA 1Q82T 2HFVA 2MLXA 1F0XA 3VGUA 3U02A 3J80U 2RRNA 3CCUS 4YHHJ 2EFOA 4QCLA 1RGVA 4PYDA 3J7ZT 1MWZA 4ZPVR 1WKLA 1BQNB 1NPPA 3C2PA 2HWIA 4NOHA 3W2WA 2B6AB 1EKSA 5B7WA 4Z37A 2WSFC 1RWWB 1UA1A 4P73A 1REVA 3J80Y 4USVA 2GMJA 1RWVB 1S9GA 3MR5A 3UD5A 4XDDA 2KT5A 2HRTA 2KZZA 1WC3A 2AQ4A 2D3ZA 1RT5B 1HLWA 4B3MJ 3UQSA 3BF4A 2N4CA 1XERA 2QA4G 4M8LA 2EG1A 3FCHA 4J9VA 3OV7A 2PC6A 4LVOP 3AB4B 3EDQB 1R43A 2A0FB 2B43A 2D9PA 4F50A 2LXFA 1TKDA 5G0RB 2HQ3A 1X5PA 2MZTA 3ETOA 4QU7A 1S1UB 1U1KA 2B4OA 2EW9A 2MQNA 5GMEA 4G1IA 1S6PA 1S1TB 4EZ9A 2YKQA 2HAIA 3QZ7A 2CZ4A 1RLCL 4K4WA 1PSDA 3JAMY 5T14A 2WVBA 3C8YA 2PEHA 2IBOA 3K58A 5C24A 3L95X 3B82A 2OPSA 1SUQA 2EFNA 2YWWA 5DDRC 2LDYA 4K4ZA 3Q24A 3QGGA 4ZHRA 1DZ5A 4X62F 2W2NP 1O51A 2XS2A 4UOGA 1RBLA 2M70A 2VZ9A 2LMIA 1K1QA 2C3PA 1HBUA 4ZP8A 4DUYJ 1BWVA 4JV5F 1HBMB 1NSPA 5KFYA 4Y2MA 4ZVRB 3BQ1A 3QGHA 1TL4A 3V4IB 3RBXA 1FXRA 1YVFA 3DGVA 1B4SA 4CO2A 5L9NA 3OFFA 2UXDJ 5RUBA 2Q1LA 1VHFA 1S5ZA 4I2QB 1C4CA 3M05A 3RBDA 5HN0A 4URQU 1AFJA 4IYQA 4PG4A 2DGSA 4V1Ak 2PA8D 4DPTA 3NG8A 2KYXA 3NS6A 5CYQA 5M2RA 2DNLA 4FYVB 3T1AA 4DV1F 5CYJA 2BW2A 1NH8A 4IO9Q 2IPOB 2AGPA 2GFFA 1WG1A 2XWXA 1SCJB 1F60B 3JSMA 2V68A 3HP6A 3GV7B 4USTA 1SJ4P 1YJTA 3IM9A 4K4YA 4JI3J 1L3UA 4B3TJ 4U7UK 3RTVA 3D66A 1ZH5A 3ZNUA 2WOMA 4LBIA 4IDKA 4NLRA 2J6UA 3N28A 5J2NB 2C2EA 3HDSA 1OY6A 1YBTA 5ETKA 1NPKA 4DV6J 4ZKAA 4CTAA 2B51A 1P1TA 1C4AA 1JJHA 2XM3A 4KY3A 5E41A 4N76A 3W5XA 2J6SA 1YJNS 1SBRA 2I9SA 2AGQA 4ZOSA 1ZS6A 4MIAA 4GO7X 2F8MA 3M8QB 1UKUA 1EAYC 5B0GA 1VLYA 3MM7A 3G82A 3MEDA 2RUGA 4Z2XA 3IG1A 3DU6A 3V6DB 4CO0A 3G8SA 2V0NA 4R5PA 1SV5B 2YBVA 3VAHA 1RJJA 2DPJA 5KFNA 3ILLA 1X0PA 4DV3J 2MZRA 2EK6A 3GG0A 2OPQB 5EX3A 4DR3J 1AB8A 3PW5A 4NLQA 2ASDA 2W4PA 3DLHA 3HHLA 4PG5A 1W26A 3LWMA 2CPJA 3TYTA 2VA2A 2OHDA 1R0AB 1RACB 1MWYA 2J0SD 4DL7A 3CCRS 5C5JA 1H6KX 3J7YI 4J9RA 4GKKJ 2Y3YA 3OR1A 3G2XA 2IRXA 2CQHA 2ZBRA 1MU2B 2YNHB 1X4DA 1D0EA 3CD6S 1RCOB 3MEGA 1TVRB 4ID5A 1WC6A 3M4XA 4ECTA 3R5CA 2CVIA 5EWEA 4DL0C 2BABA 5KFWA 3ADAC 5KFPA 2LU1A 5HROB 1KVJA 3PV8A 1EETB 4RW7B 4X4TA 1VBZA 1TUVA 2D69A 1SXLA 1O5JA 1FJ7A 1F1BB 1JKHB 1TV6B 1WI6A 4ZPTR 3M8SA 3MI7X 4J9PA 3DNCA 5F41A 4LRBA 2QYCA 5K9FA 3BN7A 3I5AA 4FN5A 1TL5A 2ZNYA 4KO0B 3MECB 1XR7A 2XO6A 2YWGA 2ASYA 5KG6A 3K5LA 2KJWA 4M5IA 2FIUA 4K0KF 4H4MA 4Y00A 2GVDB 3T1YJ 2ZDOA 3PX6A 3TZZA 3D9BA 2ZVIA 2DRAA 2EXUA 1UWBB 1EP4B 3NS5A 4H4OA 4WFNQ 1IBLF 4C3KA 2AT1B 1NB2A 4MTPA 1XNRF 5K14A 4FKXA 2AX0A 4KFBB 2ZNZA 2AD9A 2OTLS 1HQUA 5HL7Q 1U49A 3ZZTA 1U0SA 2BQRA 5KG5A 2A18A 3VCDA 2MSTA 2HNYB 3QRQA 5KFTA 3BGFA 1NU4A 3IAS9 1EB0A 4OV6A 4OZ1A 1FRHA 1AZSB 3NAIA 3L09A 1NNDA 2UXBJ 3W5ZA 2B3TB 3I0SB 2QSWA 5LSOA 4LF5F 4UZCA 1RT3B 2J6TA 1RTHB 3R9LA 2HHPA 1DAXA 3SQOP 4DF4A 2HQCA 1UEVA 3D0GE 3MXHP 4ZLPA 1TK5A 1R8HA 1LKZA 1U6FA 4FVCA 2MKSA 3W8GA 1UW4A 2Y8WA 2BKOA 1GAOA 1WEYA 2JLGA 1U1PA 2HHHJ 3PW0A 4ZP7A 4IQXA 3BDEA 3BSNA 1HL6A 5EUHA 4IG3B 1FDBA 5KT3A 1LXNA 4BDPA 3B6BA 3E01B 5EN1A 3UVJB 2C2NA 3M9NB 1E6VA 4Y65A 3E8OA 2ZOMA 1S1VB 4Q8FA 4A8FA 3VQSA 2XCAA 4GC7A 5IQQA 1U47A 1XQIA 2IBKA 2BKPA 5KG4A 2GAHC 2Y1JA 2AEJA 2DGQA 4YY3F 4ELUA 1ZYQA 4IG0A 2EBGA 4N8OA 4WIIA 5AE2A 1NRKA 4RPFA 3SFGA 2JEGA 1UPPA 2EFQA 4A8WA 2QLFB 4X66F 1RADB 4KIAA 2YNFB 1NM2A 3O1LA 2Z2YB 1IN0A 2XO7A 3MM8A 4RW6B 1HKAA 2ZBCA 1FJGF 3EICA 1AUDA 3KJVA 4DV4J 3I9V9 3KLFA 2E5GA 3D3BJ 2C28A 3HLUA 5HLFB 4OI1A 3V2UC 3IBWA 1LW2B 1FNMA 4K5RA 4A8XA 4RWXA 1IBMF 1NZAA 2DNOA 4ZPAA 2XY7A 1H73A 2RRBA 3TJ9A 4ERDA 3HVRA 3DLLQ 1FTCA 4Q8EA 2QA1A 2XYGB 3GU0A 2HBQB 3RGIA 4KYZA 2HHWA 4UW2A 2AJQA 4RW9B 4CT9A 1RLDA 2ZE2B 4M5KA 3FMWA 4HTIA 2CPZA 3ENVA 4EMDA 4LUBA 2DCLA 2MQ8A 1TP7A 1EX8A 1NDKA 5D77A 1RWPB 4XTTA 4KGMA 3QYYA 3OXFA 2VBZA 4LREA 2MY8A 5KG1A 3NAHA 4FYWB 2BJ9A 5L46A 3CJ3A 1HD0A 1N54B 1TKTB 3SXLA 2BANB 4DUZF 4YN3B 1T8EA 4JI7J 4ECWA 4WJBA 3C15A 4OLPA 4DR7F 3A13A 5I3QA 3O3LA 3J7YU 1VBKA 2EVZA 4N8NA 3PHTA 4URGA 3FBEA 2ZKUA 1S1WB 2BE9B 5AE3A 2BRLA 3C19A 2BV3A 1KWMA 1BWEA 1QSLA 4CO4A 5H1SV 3K5PA 5G4DA 3NRBA 3GMGA 3QO9B 5A0YB 4DR6F 1PJ6A 5A2QU 5HMZA 1NKEA 4LVNP 3I56S 1S6QB 2R8IA 1E6YA 2RF2A 3FJ2A 2J7WA 1LQ9A 4OV1A 4FNIA 2YKNA 2Z30B 4JB8B 3PHEA 1U1OA 2OD4A 3MM5B 3KLHA 4NLYA 2EBEA 1HFEL 3L7PA 4GKJF 2HVHA 2OPPA 3L9ZA 3KK2A 2C3YA 1J5OA 2XHWA 4NWBA 2VDHA 2HVEA 3NCPA 5LMNJ 1JNRB 3CNQP 5J1EA 4OYAA 3GSDA 2HNZA 1WI8A 1FD8A 3CWJA 4HI1A 2RKIB 2F3JA 2MHEA 4IH6A 3DI6B 2RDDA 4DBQA 3A12A 3L3CA 8RUCA 1TQLA 3H90A 4O3SA 1NMEB 1YQHA 1AFIA 3IMQJ 3GG1A 2QC3A 3T1HJ 3A8EA 3I32A 4RUAA 1FKPA 2GA7A 4USWA 2X1GA 3JQJA 3C16B 2KU7A 5C2GA 3MAAB 2UUAJ 4ZMMA 2VBWA 1VQ7S 3FMBA 2XSFA 3CJ8A 1N0UA 1QSYA 3UW1A 3EYZA 2QGFB 1HNVA 1S49A 3MMAA 3PKYA 2HVDA 3D1QA 1SIZA 2BUNA 4JYAF 3UE2A 2V4JA 3RB3A 3WQPA 2FB0A 4JI5F 3R5BA 3CCMS 3N9UC 5B0AA 2ROPA 4PXDA 2Q66A 2YY3A 4OIXA 4RKUC 1RTZA 2CKWA 1TKZA 3H2UB 2W2PP 4A48A 5MAOA 4EO8A 4Q2MA 2BJ1A 3JXOA 4F67A 3ET6B 2RE1A 3S1TA 3WBZA 1MMNA 5EX0A 1JX4A 4RU9A 3Q0AA 2WBMA 4D3GA 3IO1A 1EQ0A 4OYXA 1RT1B 1RTJB 2B4VA 5HP1B 4L73A 2COLA 1WDDA 3NY0A 2DNMA 3DRSB 3CULA 4JP8A 4NLVA 2A1BA 1NO8A 3AJDA 4KRWA 3BO2A 2Y0SD 3D6FB 2RIJA 2YKAA 1YZ6A 2HFZA 2LU2A 3EX7B 4AQYF 5DQGA 3KJNB 2GJIA 2F7VA 5BR8F 3C3LA 3W2WB 4ZPCA 1KNZA 3W1YC 2GO8A 2FLNA 1S9GB 2XMJA 2BQ3A 4NA3A 2HS0A 1S0VA 3WZ0A 4MAKA 1ZZNA 4I56A 2W7OA 2ADCA 1Q1KA 4ED7A 1D9AA 1OO0B 4CWBA 5DGBA 4RBUA 3PACA 2H54B 4DL4A 1UW9A 2X7IA 5B09A 4C6AA 2HFOA 3RR8A 1MN9A 2U1AA 2I5JA 4DWIA 2XNRA 2ZUGA 2IM1A 1MWQA 3D68A 2OAUA 4WP8A 4KV8A 1V3SA 4JV2A 4WU2A 1VQOS 1N33F 2O3DA 3GIMA 5D78A 1S6PB 3H5SA 3FK4A 1XNQF 2NSBA 2ZJRQ 3WC2A 2OPSB 5L1IA 1HNXJ 2UVUA 3GR0A 4JV0A 2HHTA 4OHWA 2EK1A 2CFXA 1SC4B 2MSSA 2FJDB 1SJQA 5M2UA 3OQ2A 3TW0A 4ICLA 2DXDA 2H4WB 3RBZA 4FVMA 3AB2B 1WEZA 1KLMA 4X84A 4DPXA 3SSRA 2UVWA 1GH8A 1SI9A 2VG5A 3O5TB 1GX5A 2QEXS 5GVQA 5CYQB 4W90B 1SKWA 4KHPF 4NXNF 1XMOJ 1K1SA 2GNKA 2DNZA 2G0IA 2C3OA 1CBKA 5KT4A 3DXBA 2YTCA 1FFWB 3LH2S 1TL7A 3OW2R 3HHDA 4C97A 2HRUA 4KAIA 3HFVA 1VRTA 2BMBA 2YXLA 4DV0F 2XULA 3TVYA 1IQTA 4R0EA 3AOCA 1S1XA 4ECSA 1FE4A 4IDKB 2KG1A 1YX2A 3KMSA 5B0FA 3CD7A 3PR5B 4Q44A 1HWUA 4TVAB 1B3TA 3NKYA 1X4EA 2F1FA 2BW7A 2B9XA 2Y1IA 3FSXA 1LFPA 4B3SF 4IR1A 2EKNA 3CVKA 4NL5A 3PIOQ 3ILOA 3MM7B 4PXCA 3KHLA 1U7LA 3G82B 1S79A 5HATA 3IG1B 2FZGB 1S57A 4UOCA 2XC9A 2GV1A 4LFCJ 1F2HA 4R5PB 2ZM6F 1YIJS 1V6HA 5C25A 1N52B 4C8ZA 2QLJB 4RW8B 1KP6A 4F4YA 3OJSA 3ZTRA 2HVZA 1F9HA 4Y34A 4A8YA 4NMLA 3SDEB 2XI2A 3A8KA 3ZZUA 5FDLA 3H4BA 2LKZA 4RWWA 3HHLB 3BO3A 2K06A 2YQ0A 2IVMA 1DTTA 2HFNA 3U7JA 3OR1B 2CQ3A 5IM0A 2HHQA 4A4JA 3PTWA 1NZ8A 3JTOA 1X5SA 5KFQA 3MEGB 3UFCX 2VPYB 3B54A 3CMES 4ZVEA 2ZC4A 3UN2A 1IBCB 1HYSA 4YDDB 3G86A 4DJBA 1Z2ZA 3QT8A 3H5UA 4M1KA 2CNLB 2H65B 1ZBTA 4B3OB 4DSLA 2JJ4D 5IV4A 3W9IA 3GFHA 4LT6A 2WVCA 4JV1A 3CCES 4NCGB 1C0TA 2OFGX 5LXRA 4FNHA 4OQJA 1CJVA 1PJ7A 1D9DA 2FHOB 3M2UA 2HK3A 4IR9A 4GRSA 4WE1A 4QIGA 3AJ1A 3BS9A 2BX6A 2AKWB 1UTAA 1HNIA 1MNEA 1QLNA 5CD4H 1XMQF 4N7TA 3VWSA 3CDEA 5KFFA 1WACA 1R8PA 2B7BB 3V6KA 5F8JA 1JB0C 4Z7CA 3NGUA 1GMVA 3D6MB 3UDVA 4IFVA 3T9ZA 1U09A 4AL7A 2Y1RI 3PYDA 3NGDA 2H5JB 2A6OA 2D3O1 5D0RA 2PGCA 1OQ3A 2DBBA 2HZCA 3I0RA 4NA2A 1XC9A 1FK9B 4O3NA 3QATA 4I1TA 5K14B 3NLCA 4M95A 4P74A 2RU9A 5KFKA 4J7CA 3IWNC 4NYOA 4Y6IA 1HQUB 1RAFB 5HI7A 3BM7A 5KFJA 4DSKA 1K8AT 2AF6A 1HPZA 2HQDA 5DDPC 4ZA1A 3TANA 1N36J 2PN6A 2VH7A 3T5JA 4MYTA 2O5DA 5HQMA 1HI0P 2XMWA 4DS5A 2Y8YA 2GQCA 2W2QP 2MZJA 3PYGA 2VFTA 1CC8A 2JH3A 4IFYB 2OFHX 1CJTA 2QA2A 3FUYA 1NJWA 2DRBA 3P96A 3M9OB 2NS1B 3MMCB 5DZ7A 3M30B 4OI0A 3S8SA 4FP9A 3R5GA 1ZETA 1DTQA 1B0PA 4RLEA 2HSEB 4Q5VA 1HA1A 3N6NA 3M6VA 4BC7A 3NBPA 4MFBB 3B8HA 4DQSA 1T9XA 4R0JA 2IVFB 2CPHA 2LP4A 1RT6A 2CPFA 3BEGB 2GZOA 4ECQA 3ONQA 3W9JA 4PABA 1N0VC 4XPEA 3OXLA 3FFIB 1RP5A 2OMOA 4LFAJ 1E6VB 1ELOA 4ED8A 3G8QA 2HFSA 4OJ1A 4D3HA 4B3RJ 4TLQA 2YNGB 1QSSA 1X4AA 2UVVA 1HHTP 1MN7A 4ZVUB 1RSCA 3IS9B 4CLPA 4O3RA 4IG0B 2XSJA 1WC4A 4GVBA 4F25A 5E3QA 3CSKA 5F3ZA 3WC0A 1ZPWX 4J91A 1JLCA 3LOUA 4M5HA 4QR0A 1JLAA 1C1BB 4L72B 3KDOA 2BJEA 1CS4B 1XBWA 1Q95G 3I4HX 3MM8B 3PKMA 2EC2A 2Z2ZA 3TJAA 4FYYB 3KLFB 1KD1T 3BGLA 2UUCJ 3J81Y 4I6YA 3MM9A 1Q79A 2UU9F 1HNWF 4ZJLA 3OTEA 1KSPA 3GJSB 3VGSA 3DN9A 4L6V3 1QAJA 3PFEA 3HHEA 1QTNB 4JI4J 1NCLA 3G6VA 3ZC4A 3ELHA 1LW0B 2MKJA 2BM1A 2MZSA 9RUBA 4B9MA 2MY7A 1AW0A 3VHQA 4DL2A 2E5HA 3MM6A 5L38A 2XYHB 2PMHA 2MKIA 3T6JA 5F8IA 4KHMA 3CCVS 1F5AA 3H7HB 3M8PA 2FJEB 1VCTA 4JI0J 2CQBA 3M32B 1RAIB 4L75A 5I4MA 1BQXA 2NZCA 4RR5A 1JLBA 2QG9B 4NXMF 3OT9A 3HKWA 1Y5LB 4FPRA 3UDLA 4MT1A 1NAQA 3DLEB 3O6QA 3RR7A 2QL5B 1RTDA 4GO5X 2J9DA 4B08A 4KGXB 3O8WA 4ED3A 2DR7A 2CXEA 4I69A 4OMFG 2Q6CA 3C6TA 3WX4A 4TY9A 1Y5IB 4BLGA 1XMBA 2KXFA 1JLGA 1OYDA 1WUUA 2CIMA 5SZTA 2A3JA 1YK9A 3G9CA 3PZPA 2KFZA 2N3LA 3Q89A 4DQIA 3IN5A 2ZWOA 2E5IA 4NLOA 3C15B 4PQUA 1VQSA 1NXIA 1N34F 1UFLA 4ZITA 2KYZA 4DI6A 5K20B 3NS7B 3UPFA 4O4RA 2KG0A 4YQWA 1XN9A 4ES2A 1U1RA 4DR5J 2BDPA 5F9LA 4EBCA 4F3QA 1BMQB 4NEZA 1TL3B 4XDCA 2CNOB 1HR0F 3IRXA 2OI2A 1KVKA 3QAUA 3V6JA 4NZ6A 4XAKA 3TX0A 4CLFA 5J2PA 1U8SA 4FPIA 3R7NB 3TRGA 4HEA9 2JLEA 2W01A 2Q6BA 4DR2J 4E2FB 1RU2A 1E6YB 2RF2B 1S10A 3W61A 1WHWA 4ZVSB 2YKNB 2DNPA 3KLHB 1S0NA 1WKJA 3CD5A 4EO6A 2JVRA 1RCXB 1LFWA 2DYAA 2PI4A 3BZQA 7FD1A 1WWHA 3TVKA 3OTBA 4OZNA 4ECVA 1Q8IA 2E44A 2W1BA 3AOBA 2ZH3A 5HVHA 2HNZB 2QFJA 2AWZA 2KHDA 1FI4A 4I67A 1S7HA 1FRMA 3I5CA 2VA3A 1VIXA 4ZVHA 1HW9A 3R2CJ 2VV5A 2J0QD 4K50A 4CH7A 1ITPA 4NLWA 3BO4A 1G1XA 5KG7A 3EM1A 2HGMA 3ENAA 1QM9A 2GQQA 3EGNA 2LECA 2NYIA 1HD1A 3LW5C 2LQBA 1H38A 3EWGA 3R6LB 3D67A 2YQ3A 1KEKA 1Z2LA 2BEFA 2B0GA 3CE8A 1OQ6A 1HNVB 3MMAB 4PCQA 1ICEB 3AH6A 3AQPA 4MKBA 4LQ9A 4KKOA 2FPHX 1N8RT 1PIEA 2F4VJ 5ETVA 2E1CA 2M2BA 5JXSA 2HURA 3A8IA 2V2VA 2V8HA 2L08A 4OHVA 3QNWB 4YB6A 2YPYA 3DLKA 4JBCA 3K89A 2V50A 2M5YA 1SC3B 3OSPA
chains in the Genus database with same CATH topology
3UDVA 4PZVA 1F9HA 4CYUA 3HSGA 4CRJA 1RU1A 3KUEA 5ETVA 2F65A 5ETSA 2F63A 4M5HA 1RAOA 1EQMA 4CWBA 4F7VA 4M5NA 1HKAA 2QX0A 4M5GA 1TMJA 3ILJA 1KBRA 3MCOA 1Q0NA 5ETQA 3UDEA 5ETPA 3IP0A 5ETKA 1EX8A 3KUGA 4M5MA 1RTZA 3ILLA 4CYUB 3ILIA 3KUHA 4M5LA 1RB0A 1TMMA 3HCXA 3MCNA 3QBCA 5ETLA 3HSDA 5ETOA 5ETNA 4M5JA 2BMBA 1IM6A 5ETTA 1EQ0A 3HSZA 3UD5A 3HD2A 4AD6A 1DY3A 1G4CA 1HQ2A 5ETRA 3HT0A 2CG8A 3HD1A 3ILOA 3MCMA 4M5IA 1RU2A 5ETMA 1CBKA 3HSJA 4M5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDV A;  4PZV A;  1F9H A;  4CYU A;  3HSG A;  4CRJ A;  1RU1 A;  3KUE A;  5ETV A;  2F65 A;  5ETS A;  2F63 A;  4M5H A;  1RAO A;  1EQM A;  4CWB A;  4F7V A;  4M5N A;  1HKA A;  2QX0 A;  4M5G A;  1TMJ A;  3ILJ A;  1KBR A;  3MCO A;  1Q0N A;  5ETQ A;  3UDE A;  5ETP A;  3IP0 A;  5ETK A;  1EX8 A;  3KUG A;  4M5M A;  1RTZ A;  3ILL A;  4CYU B;  3ILI A;  3KUH A;  4M5L A;  1RB0 A;  1TMM A;  3HCX A;  3MCN A;  3QBC A;  5ETL A;  3HSD A;  5ETO A;  5ETN A;  4M5J A;  2BMB A;  1IM6 A;  5ETT A;  1EQ0 A;  3HSZ A;  3UD5 A;  3HD2 A;  4AD6 A;  1DY3 A;  1G4C A;  1HQ2 A;  5ETR A;  3HT0 A;  2CG8 A;  3HD1 A;  3ILO A;  3MCM A;  4M5I A;  1RU2 A;  5ETM A;  1CBK A;  3HSJ A;  4M5K A; 
#chains in the Genus database with same CATH topology
 5FD1 A;  4QWB A;  2OEM A;  1KTQ A;  2CG4 A;  2UUW A;  2MJN A;  4ZVQ B;  2OH2 A;  4DFJ A;  1NDP A;  1F6T A;  1FRX A;  3UNY A;  3ISZ A;  5CCL A;  4ED2 A;  4NI2 A;  4DQR A;  3TQ1 A;  1KS2 A;  2R42 A;  1GT8 A;  2WSC C;  1X60 A;  3EGW B;  4KBI A;  2JVO A;  4LF4 F;  1UL3 A;  4LBP A;  3M8R A;  3ZZZ A;  2UXC F;  3AT1 B;  5DQH A;  1HWL A;  3GYG A;  3UR0 A;  5FLX U;  4USU A;  2B4U A;  4M5J A;  1JXL A;  3HD2 A;  4RUB A;  3MCS A;  4H4K C;  2QMW A;  2CJA A;  5F8M A;  1ARO P;  1UJ4 A;  3BYR A;  1EIY B;  2R3V A;  1I51 B;  3GIL A;  3R27 A;  1MRO A;  3TO8 A;  5FLX Y;  5LMU F;  2V8G A;  1S77 D;  4QOT A;  2HW3 A;  4DL5 A;  3R7B B;  5B0C A;  1WHX A;  1WSV A;  4BC9 A;  4R8U A;  4X4P A;  1RWM B;  1PC4 A;  3BB5 A;  3G4S S;  1S9E A;  1AYE A;  1QE1 A;  2ZOG A;  4NAS A;  1JLF A;  3DLB A;  3J7A N;  2IAJ A;  4PWD A;  2CQI A;  2E9Z A;  2VPW B;  2I5J B;  2X3G A;  2Y1L B;  2J9E A;  3M2V A;  3TUZ C;  3FGV A;  4IH5 A;  4RW4 B;  2FVS A;  4KQZ A;  5KTQ A;  1CEZ A;  1YIT S;  4M94 A;  3Q23 A;  4DV2 J;  2J0W A;  1HMV A;  1T94 A;  2WVE A;  5EWF A;  1FRK A;  4R25 A;  4AND A;  3BJY A;  4YUD A;  2Z58 B;  1SJF A;  2F8E X;  1X9W A;  3H42 A;  2HK2 A;  4C9D A;  3ZNJ 1;  4K4U A;  4M5G A;  3IGN A;  2NR0 A;  1R6V A;  1T9V A;  2XMU A;  4Q43 A;  2PDA A;  3D0I E;  1KN6 A;  2KJV A;  4JI2 F;  1SJ3 P;  1RHJ B;  4X65 F;  4K59 A;  3JQK A;  1LWC A;  3AXK A;  2L48 A;  4ILL A;  3POT A;  3D1O A;  4ICL B;  5F8L A;  4WFZ A;  4F0M A;  4FS2 A;  2H9Z A;  2KM8 B;  1RWO B;  4DL3 A;  3PRB A;  2YWE A;  4DV7 F;  4C8Y A;  2DHA A;  2FVC A;  4F7V A;  5F8G A;  2PMW A;  1XIQ A;  1KQK A;  2RDJ A;  4C0B A;  1IR2 A;  6AT1 B;  1JJC B;  1IQZ A;  2G0C A;  5E33 A;  2R7W A;  1LWX A;  3LAM A;  5KG0 A;  3RB4 A;  3TZW A;  1UVM A;  2N4D A;  4DHV A;  1X4B A;  4MH8 A;  4WXW A;  4EGL A;  2WON A;  1IKX A;  3FEX B;  1TL7 B;  3JB9 k;  3MUV P;  2DGW A;  4ZLJ A;  2AYG A;  1VRT B;  2NXN A;  3PM9 A;  3TA0 A;  1P8G A;  3GQC A;  3KUH A;  3NGT A;  3Q22 A;  3HHL C;  4KH1 B;  4B3M F;  4HHJ A;  4K8R A;  4ECX A;  1F9F A;  1DBD A;  1GTH A;  4BWM A;  3ISN D;  3RW7 A;  1SL0 A;  2XWY A;  3UR3 C;  4IRC A;  5A8R A;  3PXG a;  5J1P A;  3EGV A;  2NLW A;  4DCO B;  4NX9 A;  4IRD A;  4LF2 A;  3CIZ A;  3IWL A;  2CWK A;  2G9O A;  3MPW A;  1EAR A;  3W62 A;  5KOW A;  3J7A 1;  4B9S A;  2ZHA A;  1S0O A;  4M5D A;  1GQE A;  3G87 A;  4LF8 J;  2KT2 A;  3ZTS A;  5KFZ A;  4J9S A;  2NXJ A;  2E1R A;  1S4E A;  2DNK A;  3EVM A;  5C25 B;  4TQR A;  3U27 A;  1W25 A;  1L5U A;  4OX6 A;  3OTD A;  5SUH A;  4CLL A;  1WSR A;  2WTF A;  4NMX A;  4CCH A;  4ZP9 A;  3P5B P;  2CWX A;  1AA1 B;  5JJB A;  3CGI A;  2VG6 A;  3TJ8 A;  3H5X A;  4LR9 A;  1DTT B;  3U1N A;  5GAH I;  3P8B B;  4DUY F;  5IM0 B;  1S99 A;  2J9C A;  3OLB A;  2R8K A;  2WZ1 A;  3PYF A;  2VQF J;  2ASL A;  1HYS B;  3MGJ A;  2MKK A;  4MK7 A;  4ELV A;  3EGZ A;  1IKV A;  2KDO A;  2LQ9 A;  1GMW D;  2HHU A;  1UFW A;  4TLR A;  2DGU A;  3K8V A;  2ROG A;  3CDA A;  1RQ0 A;  2UZA A;  4X4V A;  5DDQ C;  4CH0 S;  4KH0 B;  1Y3K A;  4DR4 J;  2V63 A;  4O44 A;  1KC8 T;  1C0T B;  4AXJ A;  2IA0 A;  4I7F A;  4U96 A;  2B7C B;  3CO0 P;  1YLX A;  1Y10 A;  1DAR A;  2QA4 S;  4NYZ A;  3T41 A;  3M2U B;  2RAQ A;  2E1P A;  3BGO P;  4ZIV A;  2EI5 A;  2OTJ S;  1RTI A;  3NGS A;  4IOB A;  3P5T L;  5ITH A;  3D3C J;  5CD4 A;  4QWA A;  1BXN A;  4DX8 H;  1OPI A;  4JI3 F;  1JLE A;  2KTQ A;  3DOM A;  4XO0 A;  4B3T F;  3PW4 A;  1FEE A;  1XWL A;  5GAG I;  4WKR A;  4IFV B;  4YB1 P;  4DV6 F;  2Q3P A;  1W2B R;  3AY0 A;  3EZO A;  4CLZ A;  3TEH B;  3I0R B;  1AUS L;  5F0W A;  1ZTT A;  2ZJQ Q;  1YHQ S;  1TUW A;  3R3T A;  4ED1 A;  4HT7 A;  2BJ3 A;  1H3D A;  2UVR A;  4BBY A;  2XY6 A;  2FVQ A;  2R7S A;  1L3T A;  4TXS A;  2ZH8 A;  3MUT P;  4DG1 A;  4PR6 A;  2PFF B;  3NNC A;  2VBY A;  2F63 A;  4G1Q A;  2QMU B;  2BOP A;  2Z57 B;  2QYG A;  4L74 A;  1VK3 A;  3FVY A;  1WF1 A;  3CXC R;  1UEU A;  3PFO A;  1UZD A;  4CLT A;  2EPI A;  3HVW A;  4DV3 F;  2MQO A;  5DS7 A;  1FT8 A;  1P9Y A;  1N5Y A;  2M4M A;  1G3O A;  3LGH A;  2R7Q A;  4X64 J;  4DR3 F;  4Y2A A;  4U6P A;  1S6U A;  2E66 A;  3V81 A;  1JXE A;  3OUY B;  2VUG A;  1LWE A;  4I0W A;  2NSC A;  8AT1 B;  4JI6 J;  4GKK F;  1Q86 T;  1QAX A;  5DG9 A;  3CPW R;  4DQQ A;  2VFS A;  2E29 A;  2KFY A;  2IJF A;  1FFG B;  1QUV A;  1ZM4 A;  4LJM A;  1YRX A;  1WDT A;  2FQQ B;  2CAJ A;  1KDN A;  3VR1 A;  3NBP B;  4DPW A;  4A8M P;  2J5A A;  1ZTW A;  1LK7 A;  4EWT A;  1RT6 B;  2NXE A;  4TU8 A;  2MHN A;  3RB6 A;  2G1H A;  2ZJP Q;  1U6B A;  3CC4 S;  1T05 A;  3OTC A;  2L9W A;  1G7C B;  2L9D A;  2KL8 A;  3UNG C;  1R89 A;  3CJK A;  2CYY A;  2M7S A;  1TKX B;  2JRS A;  3MF5 A;  4PXE A;  3KXD A;  5AE1 A;  1HQE A;  4DDF A;  1T03 A;  4DSF A;  4USK A;  3EVO A;  2EFP A;  2XMM A;  4RNN A;  4GVB B;  4OYO A;  3MTJ A;  3T1Y F;  4ZVG A;  3PR4 A;  1U1L A;  5L1K A;  1JLA B;  1CQM A;  3E2E A;  2CDR B;  2V2K A;  1WNE A;  2K1R A;  2BM0 A;  4ZCL A;  1PCA A;  1OIA A;  1RHK B;  1SVD A;  4RUH A;  2RJZ A;  4K2X A;  3TEG A;  1IJF B;  5LT5 A;  3MM9 B;  2AJ0 A;  4FXV A;  2CPE A;  5L1J A;  3RZA A;  3RUB L;  3EE3 A;  4RU2 A;  1VQ8 S;  2ZH6 A;  3CUN A;  1VRU A;  2BE2 A;  4E8U A;  2AP6 A;  2EFV A;  4DOZ A;  4Q0B B;  5CA5 A;  2A10 A;  4LRD A;  3H25 A;  1W2I A;  2GHV C;  2KT3 A;  2WW8 A;  1F5B A;  2UXB F;  2XLI A;  3EMT A;  3MHY A;  1NJX A;  3SCL E;  1RI7 A;  3CJ5 A;  3LP0 B;  1YTY A;  2IRU A;  1BY9 A;  3CMA S;  3VAM A;  2PMZ D;  1KOH A;  3CF5 Q;  4YME A;  2CNN B;  3MFI A;  4HH1 A;  1RTD B;  3GFY A;  2DR5 A;  4F02 A;  1C0U B;  2VPZ B;  2I6W A;  1RE1 B;  1UEK A;  3GV5 B;  2KKH A;  2HHH F;  4OHZ A;  3Q8Q B;  1OS5 A;  1JLG B;  1URR A;  1SQG A;  9ATC B;  4U7C A;  3BBB A;  2QSF A;  2XLK A;  2Q43 A;  1AXQ A;  4PQU B;  2H1Y A;  4HR2 A;  5GAH U;  2CJK A;  1D1U A;  2ZFH A;  3BH6 B;  2WRM A;  3OL8 A;  1QD1 A;  3LA0 A;  4KHP J;  3N6L A;  2XTJ P;  2XYP B;  3JAM U;  2AW0 A;  2Z2L A;  2ZH1 A;  3QID A;  1RT4 A;  2VIH A;  1BUX A;  4XPC A;  2RQK A;  4LSL B;  3MZI A;  4UY8 5;  5HVF A;  3F73 A;  3TWZ A;  5E3P A;  5L1L A;  1DJ0 A;  4LSZ B;  1PG5 B;  1Y7P A;  1XTZ A;  5F8H A;  4DV4 F;  2ZZM A;  2GO9 A;  2W2M P;  2O66 A;  1DQ8 A;  1LK5 A;  2N82 B;  1N56 A;  1Z4U A;  1WOP A;  2WBR A;  2YH1 A;  3CCS S;  2X1F A;  1H2V Z;  2SXL A;  5G0R A;  4AXI A;  4KE5 A;  2E9R X;  4ER8 A;  3FCV A;  4B3S J;  1S1U A;  3RG6 A;  2XZD B;  3ENW A;  2DGX A;  1VQN S;  1NDC A;  2ZVS A;  4P2S A;  3S6E A;  4KB7 A;  5GAG U;  4LSN A;  4CYU A;  1FO1 A;  2IM3 A;  3VVT A;  1RAE B;  3AAW B;  3MR6 A;  4ID8 A;  3VTI A;  1BGX T;  1HNZ J;  3W65 A;  2V5H G;  1R0B G;  4QWC A;  4E98 A;  1ZPV A;  2ACM A;  3HSJ A;  1K0T A;  2MB0 B;  3P6Y C;  4PPD A;  3EUN A;  4EBD A;  2QX0 A;  3DGP B;  1UVL A;  4PUO B;  4KKO B;  2G2O A;  2HWH A;  1HBM A;  4DCJ B;  4CLK A;  4A47 A;  1RWU A;  3DLK B;  2IIH A;  1KQS R;  4LR8 A;  1SUQ B;  1PIL A;  4NA1 A;  4JI7 F;  2M8H A;  2CVE A;  4I2Q A;  1KQG B;  3US5 A;  3L7O A;  3CJT A;  2VHG A;  4HDG A;  3AQO A;  4K5S A;  2IMO A;  3VQT A;  4DV5 J;  4KGZ B;  5AT1 B;  5KG2 A;  5KFB A;  4YFU A;  4EFA C;  4RNH A;  4CO3 A;  3A3P B;  3MUR P;  1S0M A;  2U2F A;  3ZO7 A;  4PQA A;  2IJR A;  5D15 A;  2KB2 A;  4J9L A;  4BWJ A;  2CPI A;  4UF4 A;  4FYD A;  3GFX A;  4KPC A;  2CPD A;  5HJX A;  1U0H B;  3X3U A;  1NB7 A;  2VQE F;  1ZOT A;  4CT8 A;  1VHI A;  1F3F A;  3DM2 A;  4DUT A;  1WC1 A;  4K7Q A;  4UQT A;  3M2R A;  4YS2 A;  5IC4 B;  3PW2 A;  4DLE A;  4NRT A;  2NZ4 A;  1HBN B;  1YRT A;  2MKH A;  2B56 A;  2DK2 A;  3KYL A;  3D0H E;  4OZ2 A;  2IAJ B;  1N48 A;  2UUB J;  5A8W A;  2KM8 C;  5JVH Q;  4NLS A;  3IGV A;  4PWD B;  2XZW A;  2DEJ A;  2V6A A;  1XEZ A;  8ATC B;  4IO1 A;  2H5I B;  2EWH A;  5J2Q A;  2MMY A;  3GPA A;  2LXI A;  2KVQ E;  2ATL A;  2MGZ A;  1GNK A;  2DO4 A;  1NHV A;  5T7L A;  1KHW A;  1HMV B;  1I94 J;  3A3N B;  3BV8 A;  1D8Z A;  1FE0 A;  3VAG A;  2P2C B;  2A2C A;  2HBY B;  3RBE A;  1MU2 A;  3KDN A;  2YNH A;  3VAL A;  3VZH A;  1UCN A;  4C48 A;  3I55 S;  3AD7 C;  3OHB A;  3HT0 A;  1TFW A;  1IKY B;  2UV8 G;  2VFU A;  2YKO A;  4NZ7 A;  4OZJ A;  2NPI A;  4V19 X;  3OFE A;  5HRO A;  2ZD1 A;  1FHT A;  3JTP A;  3IM8 A;  1EET A;  2DNQ A;  2GQ2 A;  3OHA A;  1VC6 A;  1LOU A;  4USM A;  1VQ4 S;  1LWF B;  3POT B;  3LP2 A;  2R8H A;  2JL9 A;  1FKA F;  2XZT B;  2MPU A;  3A8J A;  2QO3 A;  3H5Y A;  1T02 A;  4G1P A;  3FCW A;  2HRY A;  2B9E A;  5HAN A;  2F5G A;  4URS A;  1RXO B;  2QZ8 A;  1QAY A;  3KHH A;  3LAN A;  4X4U A;  3AOD A;  5HMW A;  2XMK A;  2B8Q A;  3EPI A;  2JEF A;  4G6V B;  2K7J A;  3ZTP A;  1M5K C;  2ALY B;  4N5S A;  2PI5 A;  3TP2 A;  3PJX A;  2C22 A;  4IOA Q;  5E0O A;  3PNI A;  1JXV A;  2WON B;  1IKX B;  1FWK A;  3DRP A;  3IR6 B;  3M6X A;  2CQC A;  2JX2 A;  3GJR B;  4W98 A;  1UWB A;  4DSI A;  2DIU A;  5E3A A;  3MUM P;  2HG4 A;  2OPR B;  1B7Y B;  2RDI A;  1VQY A;  1HNW J;  4OX9 F;  4P71 A;  5CAB A;  3ITH A;  5BJR A;  3GYX B;  2M9K A;  1T11 A;  5T41 A;  4NZ0 A;  2QLB B;  3LO3 A;  1RAA B;  2HNY A;  2HND A;  2VL1 A;  3QT6 A;  2DGT A;  2BQU A;  2B4P A;  2QJ3 A;  2W7A A;  3IAM 9;  1NK4 A;  3HHN B;  2C3U A;  1RUS A;  4YEA A;  4M5D B;  2I38 A;  2V4R A;  2R4F A;  4OZ0 A;  2IHR 1;  2K8G A;  4CQ1 A;  2YNI A;  1RTH A;  4UY8 T;  2CAD A;  4HLB A;  1HAR A;  2HZA A;  1P1L A;  1H72 C;  1KR4 A;  1R27 B;  2NCK L;  3MPD A;  5IC6 B;  5GAE I;  2XY5 A;  1A6L A;  1RYS A;  2CQP A;  4M63 A;  4FF1 A;  5CQG A;  1Q53 A;  5IZH A;  2VG6 B;  1FVQ A;  2QRR A;  1JLQ A;  3SIP B;  5A6P A;  2LXU A;  3KJQ B;  1SH2 A;  4OL8 A;  5KFG A;  3MR7 A;  4IG3 A;  3DYA B;  1RHQ B;  4AE5 A;  4Y28 C;  3KLI A;  1A9N B;  3KWM A;  1SB6 A;  1KOO A;  1N34 J;  3PX4 A;  1BQM A;  4F0K A;  3VAF A;  3NGK A;  2DIS A;  3EZU A;  4NE9 C;  4J9O A;  2FZK B;  1GEH A;  3HFZ B;  3C6U A;  3N6M A;  3QAE A;  2P6T A;  2CZ9 A;  1HR0 J;  3N79 A;  4O44 B;  2MZQ A;  5CZV A;  3B78 A;  2P6S A;  2FHJ D;  4O3O A;  4I7F B;  5A8K B;  1XMO F;  1CSJ A;  3DLG B;  3QWU A;  4DF8 A;  2HEK A;  4ELT A;  3QGP A;  4I2P B;  1ZAW A;  1NKB A;  3OL7 A;  2W4D A;  3BQ2 A;  1RTI B;  4RW6 A;  2ZZT A;  5D0G A;  4MKA A;  1B64 A;  1GX6 A;  3QLH B;  1FX4 A;  3H40 A;  5DET A;  5LL6 d;  3LP1 B;  4HHU A;  4USJ C;  5D0H A;  2RVJ A;  1JLE B;  2CPX A;  1M90 T;  4JI8 J;  3CTR A;  2OSQ A;  1H7X A;  3MAH A;  1SH0 A;  1D3W A;  1H2U X;  2NYH A;  4OZL A;  1SKR A;  3SZ2 A;  3RB0 A;  1Q4R A;  1ZM3 A;  3C14 A;  2IA6 A;  1YSJ A;  4AD6 A;  3DHX A;  4XIU A;  4LF6 F;  5KFA A;  1ROF A;  4X4R A;  2XHC A;  4DG1 B;  2ATC B;  2ZE2 A;  1M1K T;  4QJV A;  3FSI A;  3OTO J;  3HK2 A;  2DT9 A;  4X4O A;  4PRF A;  1C2P A;  4F4Z A;  1FDA A;  4HH0 A;  2E7V A;  2R2S A;  4G1Q B;  4ED6 A;  3UO0 A;  4E0D A;  1UMJ A;  3KK1 A;  5DJB A;  1OY9 A;  4DPU A;  3RAQ A;  2DEI A;  2AMC B;  2IMW P;  4QPT A;  1LNQ A;  1VLO A;  2OJ3 A;  1DLO B;  1G2E A;  1Y3J A;  4ITS A;  4QWD A;  1EHW A;  1Q16 B;  4C8N A;  2HQG A;  1FJC A;  3CC2 S;  2AJ4 A;  2EC0 A;  1K44 A;  2BAN A;  5DGA A;  1OYE A;  5I3P A;  1LWE B;  1WEX A;  2PSZ A;  3PEJ A;  5L8R C;  3W64 A;  3HM9 A;  5AXK A;  3QJP A;  1WG5 A;  1XR6 A;  1G6B A;  4GC6 A;  3R97 A;  3PO4 A;  3MCM A;  3KG4 A;  3EPG A;  4J9Q A;  3UD3 P;  3HJV A;  3SCK E;  3BSO A;  1RT2 A;  4I68 A;  1X5T A;  5FII A;  3CDW A;  4CM0 A;  3HSZ A;  3RW6 A;  3OSN A;  3H0P A;  5H9E K;  1HI1 A;  1S1W A;  3R6G B;  6FDR A;  1T05 B;  3DRX A;  3RU0 A;  2DPI A;  4OHX A;  2F65 A;  3D5M A;  1X8D A;  3QIP B;  2RHS B;  2W9A A;  3NOG A;  1L3V A;  2VJV A;  3QSI A;  1HHS A;  5J2M A;  4H54 A;  1GXU A;  4IQM A;  3MEK A;  3UCZ P;  2NRE A;  3UI3 A;  2FVR A;  1S6Q A;  1NSA A;  2DKO B;  3K0J A;  4KT0 C;  3D6T B;  1ZA2 B;  3FEZ A;  2MKY A;  1H0H B;  3DCA A;  3JSR A;  3E51 A;  3Q8U A;  4OZ3 A;  3ILI A;  2YKM A;  5IT9 Y;  5F8N A;  1T7P A;  3HVT B;  3MM5 A;  4UZB A;  3U1L A;  4HKQ A;  4ZCI A;  2DNH A;  3CJR A;  1F2G A;  4MYU A;  2JWN A;  4ZPD A;  1U48 A;  3CJS A;  1CUL A;  3WX8 A;  1L3S A;  3PJW A;  5JVG Q;  2K1R B;  1U8W A;  3TA2 A;  4QU6 A;  2L9N A;  2RKI A;  2CQ2 A;  1IJE B;  2B8P A;  4Q2L A;  5CCM A;  3OJU A;  1TL1 A;  4I4B A;  1M5O C;  3P3D A;  1VMB A;  2CJ9 A;  1N5S A;  3A1Y G;  3GZ7 A;  4J9K A;  2HMI A;  3KG0 A;  1C1C A;  4P7T A;  1ZM9 A;  2FTR A;  1QVG R;  3NGR A;  1VRU B;  2BE2 B;  2LQ8 A;  3TVZ A;  2GJF A;  4RX6 A;  4TQS A;  4HAC B;  3R5D A;  3CMQ A;  3UCG A;  2LA4 A;  1CJU B;  1RA7 A;  1B99 A;  1VR6 A;  5HSP A;  2GIF A;  4F2S A;  3GCW P;  4C0O C;  5DM7 Q;  3FKB A;  4A8S A;  1CG2 A;  3T5H A;  1MLA A;  4CLU A;  1ZZF A;  2C2M B;  5EWG A;  4OYW A;  1REV B;  1VQP S;  5GAE U;  3CCW A;  4ECY A;  4MIB A;  1RTJ A;  5IWA J;  5HP1 A;  1VJQ A;  3DDN A;  2XNQ A;  1RZM A;  2DH8 A;  2X1B A;  2IDE A;  4S0M A;  4DV7 J;  1M5V C;  4F4W A;  3PW7 A;  2MQL A;  3TR5 A;  3MD3 A;  2ZKT A;  4DFM A;  3QQC D;  4B3R F;  1IKW A;  1V9O A;  2X3D A;  3HHK A;  3MTK A;  4UUX A;  4DMZ A;  2L41 A;  4FF3 A;  1IM6 A;  2ZBP A;  2OEL A;  3MMJ A;  3CJ0 A;  2V8P A;  4TYA A;  1RT4 B;  1X9M A;  2C2K B;  2VIC A;  4C98 A;  1WTF A;  2MZ1 A;  3IWX A;  1TEL A;  1U02 A;  5ETL A;  2MYF A;  2FJV A;  3FRY A;  2CG8 A;  3KNG A;  5CYM A;  1N32 J;  2DH9 A;  4Y0F A;  5C24 B;  3M9M B;  4WK1 A;  2O1P A;  2DNG A;  2W24 A;  3NOC A;  3OD2 A;  4NCA A;  4QYZ J;  3CCZ A;  1RAH B;  1X31 C;  2UUC F;  2F9J A;  3WDO A;  2F4F A;  1UVN A;  4ZHR B;  3MR3 A;  2HPU A;  1M1H A;  2VC0 A;  2OKQ A;  2CZV C;  2HHX A;  4JUZ A;  1WJ9 A;  5DO2 A;  1RHU B;  4OJG A;  2RS2 A;  4JI4 F;  4TKT A;  1HBU B;  2BA9 A;  2E9T A;  2W9B A;  4CM2 A;  1KFD A;  3SBM A;  1IR1 A;  3DC2 A;  4WXO A;  3Q83 A;  2ILZ A;  4PG7 A;  2WAQ D;  1VC0 A;  2FYX A;  4LSN B;  5GMD A;  4H4K A;  4CYU B;  2DXE A;  2G1D A;  4C8O A;  1TAQ A;  3VGV A;  3H59 A;  4X4N A;  2FGC A;  2VKZ G;  5I42 A;  4JI0 F;  4UOF A;  3SFU A;  1YJV A;  2ZIT A;  3MOZ A;  1BD6 A;  1SC6 A;  3KLG A;  3KK3 A;  1IWG A;  4B17 A;  1GXT A;  5B0D A;  3UCU P;  1NPR A;  1HI8 A;  1IBK J;  2KRB A;  5KFO A;  5D0E A;  3CJ4 A;  2E7W A;  1VIO A;  4ZK7 M;  3THT A;  4LF9 J;  1MSW D;  2HKE A;  2MTL A;  1SH3 A;  5AJ3 F;  3CC7 S;  3JSM B;  2V4Q A;  3UD4 P;  5U47 A;  4QR2 A;  2BKN A;  2FY8 A;  4DPY A;  4CLW A;  3TUI C;  2NQP A;  4F04 B;  5DDO C;  4RNO A;  1U26 A;  2CQ4 A;  4FZV A;  2DD8 S;  3I87 A;  4DLG A;  1Y11 A;  2F40 A;  2WOM B;  3DRY A;  1DHM A;  3HFK A;  3S7R A;  2RRA A;  1RWK B;  3GP9 A;  4CIO A;  4CTA B;  4DR5 F;  4MIW A;  4WPA A;  2F9D A;  4LF7 J;  3GON A;  2QT7 A;  2AZ1 A;  2LLZ A;  2QLW A;  4P7V A;  1TU0 B;  2CNK B;  2DO0 A;  1Q7Y T;  4Z7Y A;  1U45 A;  3MED B;  1QY7 A;  4LFB J;  1K9M T;  3RRG A;  4DR2 F;  1L3K A;  3H4D A;  3CCQ S;  4N77 A;  4KC5 A;  2P5V A;  4QIE A;  2H4Y B;  4WU3 A;  1VIS A;  3D4J A;  3OR2 A;  3M6U A;  3CCJ S;  1RBA A;  4CRJ A;  1H98 A;  4ES3 A;  3ETM A;  2GC8 A;  4Y2K A;  2HGN A;  4M5M A;  5KFE A;  2F8H A;  3HMJ G;  3BGU A;  1KFS A;  3GJT B;  4QZV B;  2BYC A;  3DM2 B;  1PBU A;  1S48 A;  2PEB A;  3UN3 A;  1K0V A;  3TQE A;  1NSK L;  3N0V A;  2HVI A;  1S9F A;  3M2R B;  2OGU A;  1WF2 A;  2ZH2 A;  4ID5 B;  4ILR A;  1GFW B;  1RA6 A;  1VGY A;  4NPO A;  1RAB B;  2AYE A;  5A8W B;  2FJW A;  4F8R A;  3AXM A;  2ZH7 A;  3I96 A;  1Q7L B;  1T3O A;  3QJL A;  4FDF A;  4RW8 A;  5A6W A;  2EG2 A;  2P9E A;  2FJB B;  2IYI A;  1IM4 A;  2VB6 A;  3PRV A;  1T9Y A;  2CJQ A;  1KTV A;  4K4T A;  5J2Q B;  4C8K A;  3TA1 A;  4CNZ A;  3SDE A;  1GMU A;  1YDL A;  4UOH A;  2MGZ B;  3FDS A;  3Q8V A;  4HHH A;  4P10 A;  5T7L B;  5HBM A;  3GSI A;  3GE9 A;  1NHK L;  4RZR A;  1WHY A;  2F4V F;  1NLK L;  2YQ1 A;  2VFR A;  5AXN A;  2CQD A;  1PO6 A;  1J5E J;  4EYI B;  2MEW A;  3AJ2 A;  2JC0 A;  3DMJ A;  4P72 A;  2Z0G A;  4O0N A;  3JSY A;  3OFG A;  4WFB Q;  3VF0 B;  3QSY B;  4WIQ A;  4H4M B;  3TAM A;  3IR7 B;  4C7Q A;  3PCO B;  2JNJ A;  2MQM A;  3H2L A;  4DN0 A;  3MOJ B;  2ZD1 B;  1M0S A;  4B3O A;  3ZZR A;  1RAO A;  2K2P A;  2RD5 C;  2R8G A;  4OYZ A;  3LP2 B;  4H4O B;  4NCG A;  5EHH A;  3QBC A;  2HGL A;  2G2Y A;  2V2Q A;  4QYR A;  1NHU A;  5DQI A;  5DZ6 A;  4WKY A;  2GML A;  2B9Y A;  2W25 A;  3DXS X;  4EU0 A;  2LEB A;  4OLO A;  4MKV A;  4Y3C A;  1UAW A;  3M1V A;  4LBH A;  1PYS B;  2M52 A;  2ZUA A;  3OVA A;  4P2M A;  3FEY B;  4IRK A;  4W92 B;  1UVJ A;  4FS1 A;  2IJN A;  3TAQ A;  3KOA A;  3DDI A;  4YB5 A;  2QN6 B;  1R8C A;  4MKY A;  3DRP B;  5DLG A;  4AUK A;  5AXM A;  2ZH5 A;  1NK7 A;  4ZVT B;  5LOQ A;  2DNN A;  1NK6 A;  2LEA A;  4JI1 J;  4CH1 A;  5I3U A;  4MJK A;  4DN9 A;  1U24 A;  2XQC A;  2JLF A;  1FK9 A;  2J8S A;  2V34 A;  2VJU A;  1M5H A;  5HQL A;  1RWX B;  2CUY A;  2DJW A;  3ITH B;  2A6M A;  2GJ2 A;  3RYL A;  1GK8 A;  3DU5 A;  3KHR A;  2OO4 A;  3RAX A;  4HVZ A;  2HND B;  5IT4 A;  5K8M A;  3FBF A;  1FX2 A;  5AXL A;  3VAI A;  1FVS A;  5CZX A;  5E2Q A;  2PII A;  3GWC A;  3TZY A;  4WP3 A;  5K8N A;  3W60 A;  4DSJ A;  2QE5 A;  4DR1 J;  3LGM A;  4QWE A;  4N47 A;  4A8Q A;  4DV2 F;  1AT1 B;  2HWT A;  2YNI B;  2P8I A;  4A8O A;  4IFY A;  5L39 A;  3WIU A;  1DY3 A;  1NKC A;  2Y9H A;  3T6B A;  3MMC A;  3C66 A;  3M30 A;  1JWW A;  3R2D J;  1JIH A;  2VFV A;  2QV6 A;  3BN4 A;  1TMM A;  1CPZ A;  4P9S A;  1QJH A;  3PEH A;  1Q78 A;  3W3S A;  1VC5 A;  2WSE C;  3K7R A;  4MFB A;  1JLQ B;  3J81 U;  3AA8 A;  2FLL A;  2OML A;  1YJ7 A;  3V4M A;  2JFD A;  4J37 A;  3FFI A;  3DLJ A;  3KJV B;  2DR9 A;  3GYN A;  3KLI B;  3THV A;  2AYM A;  4CLS A;  3ENQ A;  1P9Q C;  1MG7 A;  1BQM B;  2YNG A;  3NL0 A;  2JOQ A;  2DIV A;  3C6U B;  3HPO A;  4DQP A;  3D2W A;  4FKY A;  3IS9 A;  4YR3 A;  3K59 A;  4DFK A;  4LRC A;  2R2U A;  5THW A;  1SKU B;  2APO A;  2CPY A;  1C1B A;  4WFY A;  1CS4 A;  4Y2C A;  1SJR A;  2OEJ A;  4AYB D;  1TZ0 A;  1WOO A;  1DUR A;  2JHE A;  3BR8 A;  2D9O A;  3T9N A;  3BKF A;  3Q8P B;  2XMA A;  1QAI A;  1IUJ A;  2YWK A;  1B0T A;  5D4L A;  2W8K A;  5ETR A;  2HQI A;  1UPM B;  1HWJ A;  3GIK A;  3RJM B;  1NH7 A;  5D6G A;  5KT7 A;  4X62 J;  5HMY A;  1GMW A;  1I5O B;  2ASJ A;  4QW9 A;  4U7U D;  2G0J A;  2LA6 A;  3MPV A;  1D09 B;  2E7X A;  3T5K A;  1I1G A;  4U67 Q;  1TR0 A;  1N88 A;  5D4P A;  5BYS A;  4JV5 J;  1LW0 A;  3C14 B;  3UDC A;  4IKA A;  2V69 A;  4ILM A;  4ANE A;  5D4N A;  4C11 A;  3HO1 A;  5B0B A;  3CDU A;  3MFH A;  2UV8 A;  3P45 B;  4LF8 F;  1NK5 A;  4A8K A;  3TNV A;  2IC3 A;  3M32 A;  2M8D B;  1WTB A;  3KK1 B;  3CB4 A;  1SL2 A;  1JJ2 R;  5M2P A;  4DV1 J;  1NK9 A;  4RNM A;  2YVS A;  3DLE A;  3LPE A;  2OD6 A;  1UZH A;  4RJV A;  1X5O A;  3KJF B;  5H9F K;  3FBC A;  3AD8 C;  2J7U A;  2ZOF A;  2FVP A;  2Q79 A;  3BKT A;  3GCX P;  1YJR A;  2RML A;  4F4X A;  1YJW S;  4WFX A;  4PXB A;  4X2B A;  2XG8 A;  4EZ6 A;  3MWB A;  3HCX A;  2VQF F;  3IBF B;  2BAC A;  4ZVO B;  2OPP B;  2O67 A;  1NJI T;  4KGK A;  3KK2 B;  3PIP Q;  1RT2 B;  2Z2M A;  3PG9 A;  5D3G A;  1J5O B;  1FXL A;  3G71 S;  2NXC A;  3DDK A;  5J1E B;  1TL3 A;  2VD3 A;  4BS2 A;  2YH0 A;  3BQ0 A;  2CQ0 A;  4DR4 F;  1VJW A;  4FXD A;  2KZM A;  4F3O A;  1U1Q A;  4ZP6 A;  4WYW A;  1OJ4 A;  3X1L B;  5J2M B;  5BYR A;  5KFC A;  1FKP B;  2CJY B;  1U2F A;  2H5E A;  1TAU A;  4P52 A;  3GR1 A;  4PKD B;  1B70 B;  2GX8 A;  2YKM B;  1YBU A;  1N5Q A;  2HFU A;  3G6E S;  3CIM A;  1YG0 A;  5A2Q Y;  5ETP A;  1JQG A;  2VQE J;  1U1M A;  3M8Z A;  1VI7 A;  1CUL B;  3F0N A;  1X4F A;  4GMK A;  4YDX A;  4WYL A;  1UJ5 A;  2E5L F;  2N7Y A;  4G65 A;  2V4J B;  1YRU A;  2AYB A;  1RT7 A;  1JMT A;  3R1H A;  3CCT A;  2W7P A;  3MEE A;  2G13 A;  1U4B A;  5B08 A;  1TL1 B;  3OL9 A;  4RBV A;  4TU9 A;  4TY8 A;  2VKR A;  5LJ3 Y;  4AL5 A;  1Y00 A;  1TKZ B;  4ZLN A;  4NLX A;  2HMI B;  1TK0 A;  1C1C B;  1QVF R;  2DVI A;  1YGY A;  2X51 A;  4EEY A;  4RUC A;  2ACY A;  1PYO B;  4HT5 A;  3CDB A;  1UA0 A;  2DGV A;  1TK8 A;  2H3E B;  1WHV A;  1J2V A;  4F4K A;  1T3N A;  1UVI A;  1S7I A;  3HF5 A;  4DX5 A;  1F9E B;  4X64 F;  5ETQ A;  2C42 A;  3JSB A;  5HQ8 A;  4DS4 A;  2FZC B;  2HIQ A;  3FZB A;  4JI6 F;  2GW8 A;  2M3D A;  3UDE A;  2POK A;  1URN A;  4K0K J;  2XBP A;  3IFE A;  2WK4 A;  4I6W A;  2MXY A;  4B9T A;  1VBX A;  3MMB A;  1X4G A;  5A76 A;  4N41 A;  3KUG A;  2L3M A;  2Y0B B;  4FF4 A;  3MCN A;  3HHL D;  1NDL A;  2NUU G;  3W63 A;  3FRZ A;  1IBL J;  1XNR J;  3JYT A;  2V9K A;  1VK8 A;  2GHW A;  4HI2 A;  3ZZY A;  2DNY A;  1IKW B;  2V67 A;  4ZPW R;  5LJ5 Y;  3CW2 C;  4A46 A;  2C1E B;  4PYA A;  3ZXW A;  2ZWP A;  3HUL A;  3DOL A;  4KV8 B;  2DB1 A;  5KFD A;  3AD9 C;  2DGO A;  1YZ7 A;  4LF5 J;  1SC1 B;  3O44 A;  3I4P A;  2XMT A;  2E1M C;  1X0F A;  3EVW A;  5CYM B;  3GJQ B;  2GIQ A;  1X9S A;  2HIY A;  4OX9 J;  1YKW A;  2WVD A;  3Q8Y A;  2ZHO A;  2WHO A;  3EXY A;  4IH7 A;  1OSD A;  3M7V A;  4C8M A;  2KVI A;  3BPD A;  3MD1 A;  5LXY A;  5K5M A;  3G8T A;  3CED A;  1Y9O A;  4QBU A;  1R31 A;  2W9B B;  1F5C A;  4NEY A;  4NYP A;  4RW4 A;  2P9G A;  5J1N A;  3DKD A;  2RT3 A;  4FF2 A;  1FKO A;  2W8L A;  2CJB A;  1KHV A;  2BJ7 A;  2MLY A;  4ALZ A;  3IRW P;  3JQM A;  4ZDN A;  4DXL A;  1BE4 A;  1KLM B;  4FBU A;  2ZBI A;  2VBX A;  3DOK A;  4C8L A;  5I42 B;  5KT6 A;  3SCJ E;  3SEO A;  1TUG B;  2BBE A;  2KH9 A;  4YOE A;  3I5B A;  2KXH A;  3QRP A;  1BHN A;  3KK3 B;  3KLG B;  4YY3 J;  2VG5 B;  3FC9 A;  3TUP A;  4YHH F;  1T95 A;  1WOR A;  1SL1 A;  4CP5 A;  3ZZO A;  1OSC A;  4O3Q A;  1VRQ C;  4X66 J;  2OSR A;  4OYI A;  2I1R A;  2R9L A;  1NJY A;  2IFX A;  2LVW A;  7AT1 B;  1XR5 A;  1FJG J;  3D54 A;  5ETO A;  3QFH A;  5BXI A;  3QMQ A;  3ZFV A;  3HXM A;  2LQJ A;  2D1C A;  1H2T Z;  1S1X B;  3OVS A;  2R7O A;  4DZ6 A;  1ZA1 B;  1IBM J;  3D7S B;  1X7V A;  3NXZ A;  1Z1Z A;  1LEO A;  3AA9 A;  2GGP A;  3OL6 A;  4Y2I A;  5C42 A;  4ZN3 A;  3O2I A;  5KFM A;  1RYR A;  1NK0 A;  5HVG A;  3GIJ A;  5C7P A;  1FNO A;  1HBO A;  4EBE A;  3ZZP A;  6FD1 A;  3NP5 A;  3DRR A;  1HHQ A;  4M5N A;  3GB0 A;  3JS9 A;  1RDR A;  1N4L A;  3EJM A;  1KON A;  3PDN A;  3KHG A;  4YR2 A;  1F3V A;  4QYZ K;  1Y5N B;  1HIY A;  3GTY X;  4DPO A;  1R8A A;  3LF0 A;  3OR2 B;  3LQV A;  4CNY A;  3NMR A;  3GII A;  4WF9 Q;  2V2Z A;  2Z56 B;  4DX6 A;  4X4Q A;  3N4W A;  2HLT A;  5FDL B;  2MKC A;  5D4O A;  2KFN A;  4DUZ J;  1SIW B;  3EDR B;  4DFP A;  2LCW A;  4B02 A;  3TOQ A;  4ECU A;  1PJ5 A;  2LFV A;  4LF6 J;  2E1A A;  2M0G B;  5E3R A;  4PPZ A;  4WTO B;  4QIV A;  4K4S A;  4OYP A;  4DR7 J;  3HKZ D;  2G2Z A;  4F2R A;  4AFF A;  4P2F A;  1K73 T;  2UXD F;  5HJY A;  3S01 A;  3K5M A;  2RQM A;  4QW8 A;  1MW7 A;  1HNZ F;  1SKS A;  3TAP A;  3IR5 B;  3OFH A;  2DNR A;  5JUM A;  3C46 A;  5H9E J;  1EQM A;  4GVL A;  4LRF A;  1OWX A;  1NSQ A;  2FD2 A;  1UFK A;  1CJV B;  4OI2 A;  3SSQ A;  4DR6 J;  2W9C A;  5HBM B;  3BGR A;  4F3M A;  1S76 D;  4WE1 B;  2LYV A;  4WK3 A;  1W7W A;  1FDN A;  1Q0N A;  4J5O A;  2IVY A;  3DMJ B;  2LEP A;  1HNI B;  1CJK A;  1KLN A;  3UWT A;  2YX1 A;  2Z8Q A;  4P6Q A;  4GKJ J;  2GIR A;  4W4M A;  1RAG B;  3TAM B;  1U25 A;  2HLU A;  3L7U A;  4KPY A;  4DZD A;  3IP0 A;  1Y4Z B;  4PEO A;  2HZV A;  4ZLL A;  2ERR A;  3OVB A;  3BSC A;  1K47 A;  3HJF A;  4L3N A;  3R5J B;  3BSA A;  1D9F A;  1ZAX A;  5IFM A;  2C2O B;  4MK8 A;  3KLV A;  4BHQ A;  1VQ5 S;  2RQC A;  3EXC X;  4DV5 F;  5LSL A;  2DHX A;  3M1V B;  4ECZ A;  4LIW A;  4MMO A;  2C3M A;  2DHG A;  4I6A A;  1DQ9 A;  4USH A;  1PKU A;  1RWN B;  3SCI E;  1HPZ B;  4PWW A;  2C2R A;  2PE8 A;  4K2J A;  3W2V A;  2VG7 A;  2N3O A;  3R8Y A;  4KTQ A;  4G3I A;  1IR0 A;  4HL9 A;  4ZPB A;  4ZN1 A;  1T9T A;  2DHS A;  2VU5 A;  1Q5Y A;  4JYA J;  2CDQ A;  3MCO A;  4JI5 J;  2AIR B;  4RBT A;  2CRL A;  2LDI A;  3Q8S B;  1CJT B;  5I3U B;  2RQ4 A;  2JEI A;  3I82 A;  1HWK A;  4F26 A;  1S59 A;  3P49 B;  1DTQ B;  1V5V A;  3ZZ0 A;  2J76 E;  4ZVP B;  1P6T A;  2XS7 A;  1J27 A;  5KFR A;  2D3O R;  1VQ9 S;  2FJA B;  1Q8L A;  2DY1 A;  2UUB F;  2XMV A;  4PZV A;  4WBF A;  4KSE B;  3Q2S C;  1UJ6 A;  4NRU A;  1M5P C;  2DRD A;  3QZ8 A;  1I6J A;  4TN2 A;  2VOO A;  3Q86 A;  1XJW B;  4LMZ A;  1Q5V A;  3CD0 A;  4C0H A;  4TU7 A;  3OUY A;  1I94 F;  3K5N A;  1O8B A;  1XK8 A;  1X4H A;  2EFG A;  3HT3 A;  4QQB A;  1HQ2 A;  4HTJ A;  1NUE A;  4AQY J;  3KKF A;  4EI2 A;  4ATN A;  5BR8 J;  2ZBQ A;  4B9U A;  3BKU A;  2R7R A;  2XSJ B;  5ETS A;  5JMN A;  3QT5 A;  2HBZ B;  2HQF A;  1JLC B;  4OJH A;  1Q8B A;  3LGN A;  2K3I A;  2B5J A;  2QTW A;  4AL6 A;  1KRP A;  3MAQ A;  1QTM A;  2JDJ A;  1CLF A;  2FJX A;  2J9D E;  5MLC V;  1ULR A;  5ETT A;  2BRK A;  3N5B A;  2FLO A;  2R7V A;  1TKX A;  3ZTQ A;  4NLP A;  2HHS A;  3A3O B;  4QIF A;  1KVI A;  1S6O A;  1N6Q A;  3WIV A;  3HI9 A;  2PD1 A;  1X4C A;  1N33 J;  1OPZ A;  3MM6 B;  3EZ5 A;  4O4G A;  1YBA A;  3KMQ A;  4M5L A;  3SQG A;  1FWL A;  1XNQ J;  2JC1 A;  2JFK A;  3M8P B;  3VGT A;  1YJU A;  3KLE A;  1REG X;  3HVA A;  2J8A A;  1TMJ A;  1JLB B;  4OI6 A;  3H8Y A;  3KG1 A;  5EDW A;  2PO4 A;  1FNX H;  5F0U A;  4ZIW A;  1RKI A;  3TX8 A;  2GMH A;  3K5O A;  4DX7 A;  2FC9 A;  2KRR A;  2GVZ A;  2YWF A;  3R1L A;  5KFH A;  2FHJ A;  4Q0B A;  3C6T B;  2BJD A;  1VQL S;  2GS8 A;  3SV4 A;  3IBC B;  4DSE A;  7FDR A;  4OI3 A;  2NPF A;  4C11 B;  1S72 S;  2WB4 A;  1V5I B;  2XGP A;  1IWA A;  2YX4 A;  4K4V A;  3M6W A;  3LP0 A;  3B4D A;  3AFG A;  1FER A;  3H2V E;  4ANC A;  3LWL A;  3TZX A;  2IC3 B;  4YR0 A;  2VOP A;  2R2T A;  2KO1 A;  3L4B C;  2QL9 B;  1WC5 A;  5GMK a;  4NXN J;  1RAJ A;  4KJI A;  2JEJ A;  3J81 j;  1BQN A;  4J9N A;  4P75 A;  3IRX B;  2H51 B;  3HSD A;  2AEF A;  2B6A A;  5J2P B;  4DL6 A;  3I6P A;  3D28 A;  4OYB A;  2FY1 A;  1N5T A;  1C0U A;  2ZH9 A;  5AJ3 J;  4J9U E;  1EZZ B;  3PRD A;  3ILJ A;  2IDL A;  2NXU A;  5KFI A;  4DV0 J;  2V8V A;  4LIR A;  1RT5 A;  3NMA A;  3BYP A;  3H98 A;  5DLF A;  1R6Y A;  2FGO A;  5HK4 A;  1PAU B;  4WP9 A;  2ZC3 A;  3SMZ A;  4X4S A;  1RU1 A;  2R2R A;  1FES A;  2AJF E;  4ETZ A;  1PBA A;  1VDH A;  4FYX B;  3TI0 A;  1NK8 A;  5D3G B;  5ETN A;  2N7C A;  5L9X A;  2FHK A;  4ES1 A;  3NCQ A;  3HD1 A;  4F4A A;  4EYH B;  1EKR A;  2A2D A;  5B0E A;  4JOU A;  2R7U A;  3VVU A;  2IY5 B;  2J0X A;  2ZZN A;  1T0T V;  3T5L A;  2K3K A;  4LSL A;  4OJ3 A;  1S1T A;  1Q8K A;  2XCP A;  3CJ2 A;  2ZM6 J;  3G6Y A;  2FC8 A;  4QR1 A;  2C2D A;  2ZHB A;  2H48 B;  2UUT A;  3GV8 B;  5IV3 A;  1ZM2 A;  1TTH B;  3AHP A;  3FBB A;  1HW8 A;  3PJ9 A;  3D6H B;  4JI8 F;  3PX0 A;  4CDI A;  3F44 A;  5DG8 A;  4IOC Q;  2CQG A;  2RSQ A;  1RT7 B;  3MEE B;  2DIT A;  4O0I A;  4CI0 B;  2IM2 A;  1R8B A;  4USI A;  4TY8 B;  3V4I A;  2IYG A;  3LPY A;  1OMS A;  5KFL A;  4WWS A;  1FRI A;  4UT4 A;  2WVF A;  2AX1 A;  5D8H B;  2HAF A;  2QMX A;  3OTO F;  5ETM A;  3D1H A;  1UVK A;  2RHQ B;  1KKH A;  3QGI A;  4NI2 B;  2IRY A;  3SI8 A;  3DGP A;  2YX7 A;  2XB2 D;  4PUO A;  3G6X A;  3GFZ A;  4QIW D;  3VV2 B;  3OXG A;  3W9H A;  2J7K A;  2I8E A;  1B7F A;  2VC1 A;  2XGQ A;  3FZ2 A;  1S97 A;  1RK8 A;  3IA0 A;  4YP3 A;  1XMQ J;  3E3X A;  3I31 A;  4ETX A;  1WG4 A;  1YWX A;  5C2C A;  1QUP A;  2OP5 A;  1VBY A;  2G4B A;  1B0V A;  1H7W A;  1APS A;  1LV5 A;  5J2N A;  2W4C A;  3MMB B;  4ZCM A;  1MRO B;  2GAG C;  3RRH A;  5LMN F;  5BYQ A;  4WZM A;  1RHM B;  3TAR A;  1IVZ A;  4R8U B;  3VZI A;  1GTE A;  2E5J A;  4C2M A;  3JYT B;  1VS3 A;  3M8Q A;  1S9E B;  5GAD I;  2HS3 A;  1QE1 B;  3T1H F;  4OZ5 A;  1U2R A;  2MJU A;  3LUY A;  4B9V A;  5DM6 Q;  1JLF B;  3WHI A;  3V6D A;  3BDP A;  3OBI A;  2UUA F;  1SV5 A;  4B9L A;  1GXL A;  2D7S A;  1RIS A;  4B9N A;  2MQQ A;  3M2V B;  2JSX A;  2MDA A;  2XLJ A;  4TNO A;  3DOL B;  3B4M A;  5IS2 A;  1OY8 A;  3SSS A;  1U0H A;  2OPQ A;  1HWI A;  4ED5 A;  1CC7 A;  4LRA A;  1KQF B;  1PC5 A;  2OLW A;  1R0A A;  1FJE B;  1FWP A;  3KTQ A;  1WEL A;  4ZJQ A;  2D41 A;  2HS4 A;  2X1A A;  2AU0 A;  1CVJ A;  1Y0H A;  1U1N A;  1TVR A;  1FRJ A;  1JK9 B;  2WCX A;  1JNZ B;  3R5A A;  1HBN A;  3Q2T C;  4UUW A;  3K57 A;  2DR8 A;  3W5Y A;  3K8W A;  2PFD A;  4OFZ A;  2OUG A;  2QIF A;  2M88 A;  4Q45 A;  1LWC B;  1WOS A;  5K8O A;  2FDN A;  4RW7 A;  4LR7 A;  2D3U A;  2YWH A;  1VYA A;  3OLA A;  3NWG A;  1FKO B;  2DTJ A;  1PAE X;  3FQL A;  1JKH A;  1TV6 A;  4DCP B;  4OX8 A;  1M5S A;  4UTG A;  3DOK B;  3VAK A;  1Q81 T;  3MPY A;  5CHC B;  4KO0 A;  1FEH A;  4C3M A;  4U95 A;  5KOX A;  4NLG A;  4WCE Q;  1H74 A;  3MEC A;  2FLP A;  3THP A;  3I9Z A;  1WC0 A;  1A0O B;  1IKY A;  2RU3 A;  1UP1 A;  2GVD A;  2BOA A;  4BCA A;  3QWP A;  1S12 A;  1D8Y A;  4P2X A;  1FCA A;  1LWF A;  2NUH A;  3R7S B;  1EP4 A;  1LXJ A;  1CQN A;  4ENO A;  5IWA F;  1R7I A;  3W8P A;  2HBR B;  4KFB A;  3NEK A;  1WD6 A;  4HYK A;  2UU9 J;  2WW4 A;  4U8Y A;  2QLX A;  3GLJ A;  4OI4 A;  1FD2 A;  1VFJ A;  4PWU A;  1VQ6 S;  4ECR A;  5A8R B;  2K7K A;  1M1G A;  2EEY A;  2ALZ A;  5KAK A;  1WF0 A;  5KT2 A;  2GGP B;  3K17 A;  2XS5 A;  5C42 B;  2ABY A;  4RNF A;  3IC1 A;  5KFS A;  5KFV A;  1JJ4 A;  1AZS A;  5KFX A;  2QFI A;  1HBO B;  2BJ8 A;  3DRR B;  2AHO B;  3I0S A;  1RT3 A;  5IT0 A;  4F36 A;  1YJ9 S;  2PA3 A;  2VON A;  3LAL A;  2KXN B;  1U2C A;  4O3P A;  2WB1 D;  1FDD A;  2OPR A;  1RB0 A;  3J7Z 5;  4NXM J;  1N32 F;  4WZQ A;  1FFS B;  1T9U A;  1HNX F;  5ADZ A;  2UP1 A;  2I0X A;  4RO0 A;  2FHM A;  2RB7 A;  3F56 A;  2PT0 A;  4QPX A;  2FUG 9;  3BR9 A;  3PYE A;  2AGO A;  2ROE A;  3BPS P;  4OYM A;  4DU7 A;  2VDI A;  1SPB P;  5H9F J;  4U9R A;  2DH7 A;  5F9N A;  3E01 A;  3UVJ A;  2BXJ A;  1DQA A;  1S1V A;  3PO5 A;  1NBE B;  3CO9 A;  4O23 A;  1V3R A;  1IKV B;  4ZS6 A;  2CA9 A;  4U8V A;  2AJ1 A;  4WTY A;  2R8J A;  1DFD A;  1N5V A;  2DY9 A;  4RL1 A;  3FSY A;  2KI2 A;  4IUF A;  3VAJ A;  1IBK F;  4CO5 A;  4NCB A;  3QT7 A;  4V19 J;  2W9C B;  3LAK A;  1KBR A;  2YNF A;  3BGR B;  1FA0 A;  4ZVF A;  4J9M A;  4LF9 F;  5E7O B;  2AV5 A;  2BE7 D;  3DYA A;  2ZEJ A;  1CJK B;  4PAA A;  3IXQ A;  4LF1 A;  3KUE A;  3ICL A;  2Z4P A;  3QFW A;  5HLF A;  5HMX A;  2VOD A;  3BRE A;  3M8Y A;  4DU8 A;  3QJJ A;  1LW2 A;  3DOM B;  1VOM A;  2D74 B;  2IM0 A;  3T19 A;  4I64 A;  4FBT A;  4AT1 B;  5FJ4 A;  3MR2 A;  2VPX B;  2ZDP A;  2CQ1 A;  4OX7 A;  2B9W A;  3W7B A;  2BZ2 A;  4LF7 F;  5A8K A;  3DLG A;  4EK2 A;  1FTR A;  4MK9 A;  3NNA A;  3CT9 A;  2AJ2 A;  4I2P A;  2V94 A;  4RW9 A;  1R0C B;  2HHV A;  4LFB F;  3MPU B;  3V6H A;  1MML A;  1R3N A;  3HZG A;  3QLH A;  1O0P A;  4LFC F;  5E3C A;  5E5N A;  2AEM A;  3LP1 A;  4L76 A;  3RAM A;  3P4U B;  4CZC A;  3W2V B;  2VG7 B;  3DHW C;  5GAD U;  2MQP A;  1FF2 A;  1NJZ A;  3NCR A;  2P9C A;  2ILY A;  1YI2 S;  1N5Y B;  2E5L J;  4K4X A;  3ISN C;  2V9W A;  4KR0 B;  3W66 A;  3PY8 A;  1RKJ A;  5IQ6 A;  1UWA A;  3V81 B;  3HSG A;  1TKT A;  4ED4 A;  2JZ5 A;  2XI3 A;  2LQ5 A;  5K8P A;  4F0H A;  4UQG A;  2OIH A;  1IXK A;  1A7G E;  1EJ7 L;  1SQF A;  3U1M A;  1PYT A;  4DEZ A;  1VQK S;  4EUV A;  2GHP A;  3KFW X;  4C3L A;  2RIL A;  2EKY A;  1VQM S;  3FNN A;  5DRK A;  2DHH A;  4CLY A;  3M8W A;  1FXD A;  3N01 A;  5CAA A;  1DLO A;  4HDH A;  3BBF A;  5KFU A;  1WKK A;  3K2Y A;  3ZTO A;  3GIR A;  2GCF A;  3BBC A;  1DRZ A;  5IT9 U;  4KHR A;  2BR0 A;  1T9W A;  2R7T A;  4LF4 J;  3CJK B;  3BH7 B;  3QO9 A;  5A0Y A;  5F3T A;  2UXC J;  4J90 A;  3QRR A;  1QDU B;  2BVZ A;  2KHC A;  2ADB A;  3ULH A;  4PG8 A;  1J5E F;  3NWR A;  5IOL A;  1HQE B;  3V5R A;  3OPK A;  2QL7 B;  4LQ3 A;  4OHY A;  1T03 B;  3CJQ A;  1I3O B;  3QPI A;  2HYI B;  2O01 C;  2XEX A;  5CH7 B;  2R7X A;  3N5F A;  1O6X A;  1PGZ A;  1FRL A;  2ZH4 A;  5LMU J;  3T3F A;  4WFA Q;  4TYB A;  3A4T A;  2B5J B;  2OEK A;  3AOA A;  3F41 A;  2RNE A;  3DFE A;  4L3K A;  1TFY A;  2CJX B;  3RRK A;  1G4C A;  2DXF A;  3DI6 A;  2MLZ A;  3FQK A;  3QIP A;  4NLD A;  1RHR B;  2KN4 A;  5CXT A;  4YB7 A;  2YPZ A;  5HAO A;  1BLU A;  1UET A;  2RS8 A;  3C16 A;  2YKP A;  1MMD A;  3JTN A;  1V3Z A;  5KG3 A;  2RUS A;  3KNA A;  4NLT A;  1BC6 A;  3MAA A;  4ED0 A;  3H20 A;  4CO1 A;  3HVT A;  1N6Q B;  5HO4 A;  1N36 F;  3CCL S;  1SJ1 A;  2VAS A;  3HX9 A;  3G96 A;  1ZAV A;  2C2Z B;  4O4G B;  3SQG B;  4FXW A;  4JI1 F;  4NLU A;  3NNH A;  4C4W A;  3KLE B;  1NEE A;  2I2Y A;  2DCU B;  1SQE A;  4Q7A A;  2RH3 A;  2AZ3 A;  5EGY A;  4ZJO A;  4JI2 J;  2VF3 A;  1ACM B;  3TUJ C;  1RBO B;  4X65 J;  4N56 A;  4KGV B;  2W2O P;  3ET6 A;  4ZCK A;  3SV3 A;  2GVZ B;  5KT5 A;  5IXU A;  4PG6 A;  3PVX A;  5DG7 A;  1RT1 A;  2DR6 A;  5LSR A;  1S4F A;  4XK8 C;  3SYZ A;  3HZE A;  4DR1 F;  4LFA F;  4HAC A;  3Q8R B;  1P27 B;  5LM7 E;  3UN5 A;  3DRS A;  3LTO A;  2V8D A;  1CJU A;  3MDF A;  1U6Z A;  1Q82 T;  2HFV A;  2MLX A;  1F0X A;  3VGU A;  3U02 A;  3J80 U;  2RRN A;  3CCU S;  4YHH J;  2EFO A;  4QCL A;  1RGV A;  4PYD A;  3J7Z T;  1MWZ A;  4ZPV R;  1WKL A;  1BQN B;  1NPP A;  3C2P A;  2HWI A;  4NOH A;  3W2W A;  2B6A B;  1EKS A;  5B7W A;  4Z37 A;  2WSF C;  1RWW B;  1UA1 A;  4P73 A;  1REV A;  3J80 Y;  4USV A;  2GMJ A;  1RWV B;  1S9G A;  3MR5 A;  3UD5 A;  4XDD A;  2KT5 A;  2HRT A;  2KZZ A;  1WC3 A;  2AQ4 A;  2D3Z A;  1RT5 B;  1HLW A;  4B3M J;  3UQS A;  3BF4 A;  2N4C A;  1XER A;  2QA4 G;  4M8L A;  2EG1 A;  3FCH A;  4J9V A;  3OV7 A;  2PC6 A;  4LVO P;  3AB4 B;  3EDQ B;  1R43 A;  2A0F B;  2B43 A;  2D9P A;  4F50 A;  2LXF A;  1TKD A;  5G0R B;  2HQ3 A;  1X5P A;  2MZT A;  3ETO A;  4QU7 A;  1S1U B;  1U1K A;  2B4O A;  2EW9 A;  2MQN A;  5GME A;  4G1I A;  1S6P A;  1S1T B;  4EZ9 A;  2YKQ A;  2HAI A;  3QZ7 A;  2CZ4 A;  1RLC L;  4K4W A;  1PSD A;  3JAM Y;  5T14 A;  2WVB A;  3C8Y A;  2PEH A;  2IBO A;  3K58 A;  5C24 A;  3L95 X;  3B82 A;  2OPS A;  1SUQ A;  2EFN A;  2YWW A;  5DDR C;  2LDY A;  4K4Z A;  3Q24 A;  3QGG A;  4ZHR A;  1DZ5 A;  4X62 F;  2W2N P;  1O51 A;  2XS2 A;  4UOG A;  1RBL A;  2M70 A;  2VZ9 A;  2LMI A;  1K1Q A;  2C3P A;  1HBU A;  4ZP8 A;  4DUY J;  1BWV A;  4JV5 F;  1HBM B;  1NSP A;  5KFY A;  4Y2M A;  4ZVR B;  3BQ1 A;  3QGH A;  1TL4 A;  3V4I B;  3RBX A;  1FXR A;  1YVF A;  3DGV A;  1B4S A;  4CO2 A;  5L9N A;  3OFF A;  2UXD J;  5RUB A;  2Q1L A;  1VHF A;  1S5Z A;  4I2Q B;  1C4C A;  3M05 A;  3RBD A;  5HN0 A;  4URQ U;  1AFJ A;  4IYQ A;  4PG4 A;  2DGS A;  4V1A k;  2PA8 D;  4DPT A;  3NG8 A;  2KYX A;  3NS6 A;  5CYQ A;  5M2R A;  2DNL A;  4FYV B;  3T1A A;  4DV1 F;  5CYJ A;  2BW2 A;  1NH8 A;  4IO9 Q;  2IPO B;  2AGP A;  2GFF A;  1WG1 A;  2XWX A;  1SCJ B;  1F60 B;  3JSM A;  2V68 A;  3HP6 A;  3GV7 B;  4UST A;  1SJ4 P;  1YJT A;  3IM9 A;  4K4Y A;  4JI3 J;  1L3U A;  4B3T J;  4U7U K;  3RTV A;  3D66 A;  1ZH5 A;  3ZNU A;  2WOM A;  4LBI A;  4IDK A;  4NLR A;  2J6U A;  3N28 A;  5J2N B;  2C2E A;  3HDS A;  1OY6 A;  1YBT A;  5ETK A;  1NPK A;  4DV6 J;  4ZKA A;  4CTA A;  2B51 A;  1P1T A;  1C4A A;  1JJH A;  2XM3 A;  4KY3 A;  5E41 A;  4N76 A;  3W5X A;  2J6S A;  1YJN S;  1SBR A;  2I9S A;  2AGQ A;  4ZOS A;  1ZS6 A;  4MIA A;  4GO7 X;  2F8M A;  3M8Q B;  1UKU A;  1EAY C;  5B0G A;  1VLY A;  3MM7 A;  3G82 A;  3MED A;  2RUG A;  4Z2X A;  3IG1 A;  3DU6 A;  3V6D B;  4CO0 A;  3G8S A;  2V0N A;  4R5P A;  1SV5 B;  2YBV A;  3VAH A;  1RJJ A;  2DPJ A;  5KFN A;  3ILL A;  1X0P A;  4DV3 J;  2MZR A;  2EK6 A;  3GG0 A;  2OPQ B;  5EX3 A;  4DR3 J;  1AB8 A;  3PW5 A;  4NLQ A;  2ASD A;  2W4P A;  3DLH A;  3HHL A;  4PG5 A;  1W26 A;  3LWM A;  2CPJ A;  3TYT A;  2VA2 A;  2OHD A;  1R0A B;  1RAC B;  1MWY A;  2J0S D;  4DL7 A;  3CCR S;  5C5J A;  1H6K X;  3J7Y I;  4J9R A;  4GKK J;  2Y3Y A;  3OR1 A;  3G2X A;  2IRX A;  2CQH A;  2ZBR A;  1MU2 B;  2YNH B;  1X4D A;  1D0E A;  3CD6 S;  1RCO B;  3MEG A;  1TVR B;  4ID5 A;  1WC6 A;  3M4X A;  4ECT A;  3R5C A;  2CVI A;  5EWE A;  4DL0 C;  2BAB A;  5KFW A;  3ADA C;  5KFP A;  2LU1 A;  5HRO B;  1KVJ A;  3PV8 A;  1EET B;  4RW7 B;  4X4T A;  1VBZ A;  1TUV A;  2D69 A;  1SXL A;  1O5J A;  1FJ7 A;  1F1B B;  1JKH B;  1TV6 B;  1WI6 A;  4ZPT R;  3M8S A;  3MI7 X;  4J9P A;  3DNC A;  5F41 A;  4LRB A;  2QYC A;  5K9F A;  3BN7 A;  3I5A A;  4FN5 A;  1TL5 A;  2ZNY A;  4KO0 B;  3MEC B;  1XR7 A;  2XO6 A;  2YWG A;  2ASY A;  5KG6 A;  3K5L A;  2KJW A;  4M5I A;  2FIU A;  4K0K F;  4H4M A;  4Y00 A;  2GVD B;  3T1Y J;  2ZDO A;  3PX6 A;  3TZZ A;  3D9B A;  2ZVI A;  2DRA A;  2EXU A;  1UWB B;  1EP4 B;  3NS5 A;  4H4O A;  4WFN Q;  1IBL F;  4C3K A;  2AT1 B;  1NB2 A;  4MTP A;  1XNR F;  5K14 A;  4FKX A;  2AX0 A;  4KFB B;  2ZNZ A;  2AD9 A;  2OTL S;  1HQU A;  5HL7 Q;  1U49 A;  3ZZT A;  1U0S A;  2BQR A;  5KG5 A;  2A18 A;  3VCD A;  2MST A;  2HNY B;  3QRQ A;  5KFT A;  3BGF A;  1NU4 A;  3IAS 9;  1EB0 A;  4OV6 A;  4OZ1 A;  1FRH A;  1AZS B;  3NAI A;  3L09 A;  1NND A;  2UXB J;  3W5Z A;  2B3T B;  3I0S B;  2QSW A;  5LSO A;  4LF5 F;  4UZC A;  1RT3 B;  2J6T A;  1RTH B;  3R9L A;  2HHP A;  1DAX A;  3SQO P;  4DF4 A;  2HQC A;  1UEV A;  3D0G E;  3MXH P;  4ZLP A;  1TK5 A;  1R8H A;  1LKZ A;  1U6F A;  4FVC A;  2MKS A;  3W8G A;  1UW4 A;  2Y8W A;  2BKO A;  1GAO A;  1WEY A;  2JLG A;  1U1P A;  2HHH J;  3PW0 A;  4ZP7 A;  4IQX A;  3BDE A;  3BSN A;  1HL6 A;  5EUH A;  4IG3 B;  1FDB A;  5KT3 A;  1LXN A;  4BDP A;  3B6B A;  3E01 B;  5EN1 A;  3UVJ B;  2C2N A;  3M9N B;  1E6V A;  4Y65 A;  3E8O A;  2ZOM A;  1S1V B;  4Q8F A;  4A8F A;  3VQS A;  2XCA A;  4GC7 A;  5IQQ A;  1U47 A;  1XQI A;  2IBK A;  2BKP A;  5KG4 A;  2GAH C;  2Y1J A;  2AEJ A;  2DGQ A;  4YY3 F;  4ELU A;  1ZYQ A;  4IG0 A;  2EBG A;  4N8O A;  4WII A;  5AE2 A;  1NRK A;  4RPF A;  3SFG A;  2JEG A;  1UPP A;  2EFQ A;  4A8W A;  2QLF B;  4X66 F;  1RAD B;  4KIA A;  2YNF B;  1NM2 A;  3O1L A;  2Z2Y B;  1IN0 A;  2XO7 A;  3MM8 A;  4RW6 B;  1HKA A;  2ZBC A;  1FJG F;  3EIC A;  1AUD A;  3KJV A;  4DV4 J;  3I9V 9;  3KLF A;  2E5G A;  3D3B J;  2C28 A;  3HLU A;  5HLF B;  4OI1 A;  3V2U C;  3IBW A;  1LW2 B;  1FNM A;  4K5R A;  4A8X A;  4RWX A;  1IBM F;  1NZA A;  2DNO A;  4ZPA A;  2XY7 A;  1H73 A;  2RRB A;  3TJ9 A;  4ERD A;  3HVR A;  3DLL Q;  1FTC A;  4Q8E A;  2QA1 A;  2XYG B;  3GU0 A;  2HBQ B;  3RGI A;  4KYZ A;  2HHW A;  4UW2 A;  2AJQ A;  4RW9 B;  4CT9 A;  1RLD A;  2ZE2 B;  4M5K A;  3FMW A;  4HTI A;  2CPZ A;  3ENV A;  4EMD A;  4LUB A;  2DCL A;  2MQ8 A;  1TP7 A;  1EX8 A;  1NDK A;  5D77 A;  1RWP B;  4XTT A;  4KGM A;  3QYY A;  3OXF A;  2VBZ A;  4LRE A;  2MY8 A;  5KG1 A;  3NAH A;  4FYW B;  2BJ9 A;  5L46 A;  3CJ3 A;  1HD0 A;  1N54 B;  1TKT B;  3SXL A;  2BAN B;  4DUZ F;  4YN3 B;  1T8E A;  4JI7 J;  4ECW A;  4WJB A;  3C15 A;  4OLP A;  4DR7 F;  3A13 A;  5I3Q A;  3O3L A;  3J7Y U;  1VBK A;  2EVZ A;  4N8N A;  3PHT A;  4URG A;  3FBE A;  2ZKU A;  1S1W B;  2BE9 B;  5AE3 A;  2BRL A;  3C19 A;  2BV3 A;  1KWM A;  1BWE A;  1QSL A;  4CO4 A;  5H1S V;  3K5P A;  5G4D A;  3NRB A;  3GMG A;  3QO9 B;  5A0Y B;  4DR6 F;  1PJ6 A;  5A2Q U;  5HMZ A;  1NKE A;  4LVN P;  3I56 S;  1S6Q B;  2R8I A;  1E6Y A;  2RF2 A;  3FJ2 A;  2J7W A;  1LQ9 A;  4OV1 A;  4FNI A;  2YKN A;  2Z30 B;  4JB8 B;  3PHE A;  1U1O A;  2OD4 A;  3MM5 B;  3KLH A;  4NLY A;  2EBE A;  1HFE L;  3L7P A;  4GKJ F;  2HVH A;  2OPP A;  3L9Z A;  3KK2 A;  2C3Y A;  1J5O A;  2XHW A;  4NWB A;  2VDH A;  2HVE A;  3NCP A;  5LMN J;  1JNR B;  3CNQ P;  5J1E A;  4OYA A;  3GSD A;  2HNZ A;  1WI8 A;  1FD8 A;  3CWJ A;  4HI1 A;  2RKI B;  2F3J A;  2MHE A;  4IH6 A;  3DI6 B;  2RDD A;  4DBQ A;  3A12 A;  3L3C A;  8RUC A;  1TQL A;  3H90 A;  4O3S A;  1NME B;  1YQH A;  1AFI A;  3IMQ J;  3GG1 A;  2QC3 A;  3T1H J;  3A8E A;  3I32 A;  4RUA A;  1FKP A;  2GA7 A;  4USW A;  2X1G A;  3JQJ A;  3C16 B;  2KU7 A;  5C2G A;  3MAA B;  2UUA J;  4ZMM A;  2VBW A;  1VQ7 S;  3FMB A;  2XSF A;  3CJ8 A;  1N0U A;  1QSY A;  3UW1 A;  3EYZ A;  2QGF B;  1HNV A;  1S49 A;  3MMA A;  3PKY A;  2HVD A;  3D1Q A;  1SIZ A;  2BUN A;  4JYA F;  3UE2 A;  2V4J A;  3RB3 A;  3WQP A;  2FB0 A;  4JI5 F;  3R5B A;  3CCM S;  3N9U C;  5B0A A;  2ROP A;  4PXD A;  2Q66 A;  2YY3 A;  4OIX A;  4RKU C;  1RTZ A;  2CKW A;  1TKZ A;  3H2U B;  2W2P P;  4A48 A;  5MAO A;  4EO8 A;  4Q2M A;  2BJ1 A;  3JXO A;  4F67 A;  3ET6 B;  2RE1 A;  3S1T A;  3WBZ A;  1MMN A;  5EX0 A;  1JX4 A;  4RU9 A;  3Q0A A;  2WBM A;  4D3G A;  3IO1 A;  1EQ0 A;  4OYX A;  1RT1 B;  1RTJ B;  2B4V A;  5HP1 B;  4L73 A;  2COL A;  1WDD A;  3NY0 A;  2DNM A;  3DRS B;  3CUL A;  4JP8 A;  4NLV A;  2A1B A;  1NO8 A;  3AJD A;  4KRW A;  3BO2 A;  2Y0S D;  3D6F B;  2RIJ A;  2YKA A;  1YZ6 A;  2HFZ A;  2LU2 A;  3EX7 B;  4AQY F;  5DQG A;  3KJN B;  2GJI A;  2F7V A;  5BR8 F;  3C3L A;  3W2W B;  4ZPC A;  1KNZ A;  3W1Y C;  2GO8 A;  2FLN A;  1S9G B;  2XMJ A;  2BQ3 A;  4NA3 A;  2HS0 A;  1S0V A;  3WZ0 A;  4MAK A;  1ZZN A;  4I56 A;  2W7O A;  2ADC A;  1Q1K A;  4ED7 A;  1D9A A;  1OO0 B;  4CWB A;  5DGB A;  4RBU A;  3PAC A;  2H54 B;  4DL4 A;  1UW9 A;  2X7I A;  5B09 A;  4C6A A;  2HFO A;  3RR8 A;  1MN9 A;  2U1A A;  2I5J A;  4DWI A;  2XNR A;  2ZUG A;  2IM1 A;  1MWQ A;  3D68 A;  2OAU A;  4WP8 A;  4KV8 A;  1V3S A;  4JV2 A;  4WU2 A;  1VQO S;  1N33 F;  2O3D A;  3GIM A;  5D78 A;  1S6P B;  3H5S A;  3FK4 A;  1XNQ F;  2NSB A;  2ZJR Q;  3WC2 A;  2OPS B;  5L1I A;  1HNX J;  2UVU A;  3GR0 A;  4JV0 A;  2HHT A;  4OHW A;  2EK1 A;  2CFX A;  1SC4 B;  2MSS A;  2FJD B;  1SJQ A;  5M2U A;  3OQ2 A;  3TW0 A;  4ICL A;  2DXD A;  2H4W B;  3RBZ A;  4FVM A;  3AB2 B;  1WEZ A;  1KLM A;  4X84 A;  4DPX A;  3SSR A;  2UVW A;  1GH8 A;  1SI9 A;  2VG5 A;  3O5T B;  1GX5 A;  2QEX S;  5GVQ A;  5CYQ B;  4W90 B;  1SKW A;  4KHP F;  4NXN F;  1XMO J;  1K1S A;  2GNK A;  2DNZ A;  2G0I A;  2C3O A;  1CBK A;  5KT4 A;  3DXB A;  2YTC A;  1FFW B;  3LH2 S;  1TL7 A;  3OW2 R;  3HHD A;  4C97 A;  2HRU A;  4KAI A;  3HFV A;  1VRT A;  2BMB A;  2YXL A;  4DV0 F;  2XUL A;  3TVY A;  1IQT A;  4R0E A;  3AOC A;  1S1X A;  4ECS A;  1FE4 A;  4IDK B;  2KG1 A;  1YX2 A;  3KMS A;  5B0F A;  3CD7 A;  3PR5 B;  4Q44 A;  1HWU A;  4TVA B;  1B3T A;  3NKY A;  1X4E A;  2F1F A;  2BW7 A;  2B9X A;  2Y1I A;  3FSX A;  1LFP A;  4B3S F;  4IR1 A;  2EKN A;  3CVK A;  4NL5 A;  3PIO Q;  3ILO A;  3MM7 B;  4PXC A;  3KHL A;  1U7L A;  3G82 B;  1S79 A;  5HAT A;  3IG1 B;  2FZG B;  1S57 A;  4UOC A;  2XC9 A;  2GV1 A;  4LFC J;  1F2H A;  4R5P B;  2ZM6 F;  1YIJ S;  1V6H A;  5C25 A;  1N52 B;  4C8Z A;  2QLJ B;  4RW8 B;  1KP6 A;  4F4Y A;  3OJS A;  3ZTR A;  2HVZ A;  1F9H A;  4Y34 A;  4A8Y A;  4NML A;  3SDE B;  2XI2 A;  3A8K A;  3ZZU A;  5FDL A;  3H4B A;  2LKZ A;  4RWW A;  3HHL B;  3BO3 A;  2K06 A;  2YQ0 A;  2IVM A;  1DTT A;  2HFN A;  3U7J A;  3OR1 B;  2CQ3 A;  5IM0 A;  2HHQ A;  4A4J A;  3PTW A;  1NZ8 A;  3JTO A;  1X5S A;  5KFQ A;  3MEG B;  3UFC X;  2VPY B;  3B54 A;  3CME S;  4ZVE A;  2ZC4 A;  3UN2 A;  1IBC B;  1HYS A;  4YDD B;  3G86 A;  4DJB A;  1Z2Z A;  3QT8 A;  3H5U A;  4M1K A;  2CNL B;  2H65 B;  1ZBT A;  4B3O B;  4DSL A;  2JJ4 D;  5IV4 A;  3W9I A;  3GFH A;  4LT6 A;  2WVC A;  4JV1 A;  3CCE S;  4NCG B;  1C0T A;  2OFG X;  5LXR A;  4FNH A;  4OQJ A;  1CJV A;  1PJ7 A;  1D9D A;  2FHO B;  3M2U A;  2HK3 A;  4IR9 A;  4GRS A;  4WE1 A;  4QIG A;  3AJ1 A;  3BS9 A;  2BX6 A;  2AKW B;  1UTA A;  1HNI A;  1MNE A;  1QLN A;  5CD4 H;  1XMQ F;  4N7T A;  3VWS A;  3CDE A;  5KFF A;  1WAC A;  1R8P A;  2B7B B;  3V6K A;  5F8J A;  1JB0 C;  4Z7C A;  3NGU A;  1GMV A;  3D6M B;  3UDV A;  4IFV A;  3T9Z A;  1U09 A;  4AL7 A;  2Y1R I;  3PYD A;  3NGD A;  2H5J B;  2A6O A;  2D3O 1;  5D0R A;  2PGC A;  1OQ3 A;  2DBB A;  2HZC A;  3I0R A;  4NA2 A;  1XC9 A;  1FK9 B;  4O3N A;  3QAT A;  4I1T A;  5K14 B;  3NLC A;  4M95 A;  4P74 A;  2RU9 A;  5KFK A;  4J7C A;  3IWN C;  4NYO A;  4Y6I A;  1HQU B;  1RAF B;  5HI7 A;  3BM7 A;  5KFJ A;  4DSK A;  1K8A T;  2AF6 A;  1HPZ A;  2HQD A;  5DDP C;  4ZA1 A;  3TAN A;  1N36 J;  2PN6 A;  2VH7 A;  3T5J A;  4MYT A;  2O5D A;  5HQM A;  1HI0 P;  2XMW A;  4DS5 A;  2Y8Y A;  2GQC A;  2W2Q P;  2MZJ A;  3PYG A;  2VFT A;  1CC8 A;  2JH3 A;  4IFY B;  2OFH X;  1CJT A;  2QA2 A;  3FUY A;  1NJW A;  2DRB A;  3P96 A;  3M9O B;  2NS1 B;  3MMC B;  5DZ7 A;  3M30 B;  4OI0 A;  3S8S A;  4FP9 A;  3R5G A;  1ZET A;  1DTQ A;  1B0P A;  4RLE A;  2HSE B;  4Q5V A;  1HA1 A;  3N6N A;  3M6V A;  4BC7 A;  3NBP A;  4MFB B;  3B8H A;  4DQS A;  1T9X A;  4R0J A;  2IVF B;  2CPH A;  2LP4 A;  1RT6 A;  2CPF A;  3BEG B;  2GZO A;  4ECQ A;  3ONQ A;  3W9J A;  4PAB A;  1N0V C;  4XPE A;  3OXL A;  3FFI B;  1RP5 A;  2OMO A;  4LFA J;  1E6V B;  1ELO A;  4ED8 A;  3G8Q A;  2HFS A;  4OJ1 A;  4D3H A;  4B3R J;  4TLQ A;  2YNG B;  1QSS A;  1X4A A;  2UVV A;  1HHT P;  1MN7 A;  4ZVU B;  1RSC A;  3IS9 B;  4CLP A;  4O3R A;  4IG0 B;  2XSJ A;  1WC4 A;  4GVB A;  4F25 A;  5E3Q A;  3CSK A;  5F3Z A;  3WC0 A;  1ZPW X;  4J91 A;  1JLC A;  3LOU A;  4M5H A;  4QR0 A;  1JLA A;  1C1B B;  4L72 B;  3KDO A;  2BJE A;  1CS4 B;  1XBW A;  1Q95 G;  3I4H X;  3MM8 B;  3PKM A;  2EC2 A;  2Z2Z A;  3TJA A;  4FYY B;  3KLF B;  1KD1 T;  3BGL A;  2UUC J;  3J81 Y;  4I6Y A;  3MM9 A;  1Q79 A;  2UU9 F;  1HNW F;  4ZJL A;  3OTE A;  1KSP A;  3GJS B;  3VGS A;  3DN9 A;  4L6V 3;  1QAJ A;  3PFE A;  3HHE A;  1QTN B;  4JI4 J;  1NCL A;  3G6V A;  3ZC4 A;  3ELH A;  1LW0 B;  2MKJ A;  2BM1 A;  2MZS A;  9RUB A;  4B9M A;  2MY7 A;  1AW0 A;  3VHQ A;  4DL2 A;  2E5H A;  3MM6 A;  5L38 A;  2XYH B;  2PMH A;  2MKI A;  3T6J A;  5F8I A;  4KHM A;  3CCV S;  1F5A A;  3H7H B;  3M8P A;  2FJE B;  1VCT A;  4JI0 J;  2CQB A;  3M32 B;  1RAI B;  4L75 A;  5I4M A;  1BQX A;  2NZC A;  4RR5 A;  1JLB A;  2QG9 B;  4NXM F;  3OT9 A;  3HKW A;  1Y5L B;  4FPR A;  3UDL A;  4MT1 A;  1NAQ A;  3DLE B;  3O6Q A;  3RR7 A;  2QL5 B;  1RTD A;  4GO5 X;  2J9D A;  4B08 A;  4KGX B;  3O8W A;  4ED3 A;  2DR7 A;  2CXE A;  4I69 A;  4OMF G;  2Q6C A;  3C6T A;  3WX4 A;  4TY9 A;  1Y5I B;  4BLG A;  1XMB A;  2KXF A;  1JLG A;  1OYD A;  1WUU A;  2CIM A;  5SZT A;  2A3J A;  1YK9 A;  3G9C A;  3PZP A;  2KFZ A;  2N3L A;  3Q89 A;  4DQI A;  3IN5 A;  2ZWO A;  2E5I A;  4NLO A;  3C15 B;  4PQU A;  1VQS A;  1NXI A;  1N34 F;  1UFL A;  4ZIT A;  2KYZ A;  4DI6 A;  5K20 B;  3NS7 B;  3UPF A;  4O4R A;  2KG0 A;  4YQW A;  1XN9 A;  4ES2 A;  1U1R A;  4DR5 J;  2BDP A;  5F9L A;  4EBC A;  4F3Q A;  1BMQ B;  4NEZ A;  1TL3 B;  4XDC A;  2CNO B;  1HR0 F;  3IRX A;  2OI2 A;  1KVK A;  3QAU A;  3V6J A;  4NZ6 A;  4XAK A;  3TX0 A;  4CLF A;  5J2P A;  1U8S A;  4FPI A;  3R7N B;  3TRG A;  4HEA 9;  2JLE A;  2W01 A;  2Q6B A;  4DR2 J;  4E2F B;  1RU2 A;  1E6Y B;  2RF2 B;  1S10 A;  3W61 A;  1WHW A;  4ZVS B;  2YKN B;  2DNP A;  3KLH B;  1S0N A;  1WKJ A;  3CD5 A;  4EO6 A;  2JVR A;  1RCX B;  1LFW A;  2DYA A;  2PI4 A;  3BZQ A;  7FD1 A;  1WWH A;  3TVK A;  3OTB A;  4OZN A;  4ECV A;  1Q8I A;  2E44 A;  2W1B A;  3AOB A;  2ZH3 A;  5HVH A;  2HNZ B;  2QFJ A;  2AWZ A;  2KHD A;  1FI4 A;  4I67 A;  1S7H A;  1FRM A;  3I5C A;  2VA3 A;  1VIX A;  4ZVH A;  1HW9 A;  3R2C J;  2VV5 A;  2J0Q D;  4K50 A;  4CH7 A;  1ITP A;  4NLW A;  3BO4 A;  1G1X A;  5KG7 A;  3EM1 A;  2HGM A;  3ENA A;  1QM9 A;  2GQQ A;  3EGN A;  2LEC A;  2NYI A;  1HD1 A;  3LW5 C;  2LQB A;  1H38 A;  3EWG A;  3R6L B;  3D67 A;  2YQ3 A;  1KEK A;  1Z2L A;  2BEF A;  2B0G A;  3CE8 A;  1OQ6 A;  1HNV B;  3MMA B;  4PCQ A;  1ICE B;  3AH6 A;  3AQP A;  4MKB A;  4LQ9 A;  4KKO A;  2FPH X;  1N8R T;  1PIE A;  2F4V J;  5ETV A;  2E1C A;  2M2B A;  5JXS A;  2HUR A;  3A8I A;  2V2V A;  2V8H A;  2L08 A;  4OHV A;  3QNW B;  4YB6 A;  2YPY A;  3DLK A;  4JBC A;  3K89 A;  2V50 A;  2M5Y A;  1SC3 B;  3OSP A; 
#chains in the Genus database with same CATH homology
 3UDV A;  4PZV A;  1F9H A;  4CYU A;  3HSG A;  4CRJ A;  1RU1 A;  3KUE A;  5ETV A;  2F65 A;  5ETS A;  2F63 A;  4M5H A;  1RAO A;  1EQM A;  4CWB A;  4F7V A;  4M5N A;  1HKA A;  2QX0 A;  4M5G A;  1TMJ A;  3ILJ A;  1KBR A;  3MCO A;  1Q0N A;  5ETQ A;  3UDE A;  5ETP A;  3IP0 A;  5ETK A;  1EX8 A;  3KUG A;  4M5M A;  1RTZ A;  3ILL A;  4CYU B;  3ILI A;  3KUH A;  4M5L A;  1RB0 A;  1TMM A;  3HCX A;  3MCN A;  3QBC A;  5ETL A;  3HSD A;  5ETO A;  5ETN A;  4M5J A;  2BMB A;  1IM6 A;  5ETT A;  1EQ0 A;  3HSZ A;  3UD5 A;  3HD2 A;  4AD6 A;  1DY3 A;  1G4C A;  1HQ2 A;  5ETR A;  3HT0 A;  2CG8 A;  3HD1 A;  3ILO A;  3MCM A;  4M5I A;  1RU2 A;  5ETM A;  1CBK A;  3HSJ A;  4M5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...