4M5NA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
HMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5nA00
4M5MA 1DY3A 4M5KA 5ETVA 1EX8A 5ETMA 1IM6A 1TMJA 1TMMA 2BMBA 3HD2A 5ETKA 2F65A 3HT0A 3ILIA 1CBKA 3HSGA 5ETSA 1RB0A 4F7VA 3QBCA 3HSJA 5ETRA 3ILOA 1EQMA 2CG8A 4CRJA 4CYUB 1RU1A 1RTZA 2F63A 4PZVA 3KUGA 4CYUA 1HQ2A 3HSDA 1Q0NA 4AD6A 1HKAA 3HD1A 3HCXA 1F9HA 2QX0A 3HSZA 5ETOA 3KUEA 3MCMA 4M5NA 4CWBA 4M5GA 3ILLA 4M5JA 5ETTA 4M5IA 5ETPA 1G4CA 5ETQA 1KBRA 1RAOA 3UDVA 1EQ0A 3UDEA 5ETLA 4M5HA 1RU2A 3MCOA 5ETNA 3UD5A 3IP0A 3KUHA 3MCNA 3ILJA 4M5LA
chains in the Genus database with same CATH superfamily
2MKCA 1A6LA 3OTOF 2ZHOA 2I2YA 4YB5A 5D0RA 3CCJS 2AEJA 2DRAA 4DV0F 1F1BB 1HBNA 5J1EA 2VBWA 1RZMA 4OFZA 2X1GA 4Q0BA 2YH1A 2M70A 5J2QB 3W63A 4YQWA 1SPBP 2RVJA 4F4KA 2ATLA 2CADA 3L9ZA 2QMUB 2WW4A 3OVBA 1S57A 2ZUGA 3BDPA 2K2PA 2RDJA 5F8GA 4Y2MA 1JNRB 1NH8A 3W5XA 4RNMA 2VUGA 4OJHA 1N56A 4NLGA 3UCZP 3SCJE 5E3QA 4I4BA 4AUKA 2XMUA 1JLBB 4DG1B 3CTRA 7FDRA 1VBYA 4M95A 3BBFA 2VPXB 2B51A 2W1BA 2RIJA 4WJBA 3T1YJ 2R7QA 2JEFA 5JXSA 4DF4A 3GZ7A 1R43A 3RBEA 3GR1A 3KUGA 2HGMA 1HNIB 3R6GB 3ZFVA 1PJ7A 4U95A 5B7WA 1UEKA 2KZZA 4N47A 3D54A 3H2LA 2RB7A 4P2FA 4O0IA 3D1HA 1T9UA 3LP0A 4CO2A 2HHTA 2UUBJ 4CRJA 3KHRA 1JK9B 1W7WA 2Z56B 1SC4B 1X31C 1NZAA 2EK6A 1S48A 4NXMF 4M5LA 2PA3A 4ZVPB 2ZOGA 4DFMA 1RYSA 4JI5F 3BJYA 1OY6A 3LOUA 4XPCA 3K7RA 4DUYF 4KGZB 3BQ1A 1KBRA 3R97A 3S01A 4ED2A 1VQOS 3I9ZA 3DOMA 3KLFA 3R1HA 4ZLPA 1MROA 2B4UA 3DRPB 4ZVEA 4TVAB 3OL6A 2D3UA 3MEGB 4DUTA 1YLXA 3NBPB 1NDCA 3M9OB 4RWXA 3MZIA 4NLTA 2W9AA 1RHKB 1YK9A 4IO9Q 4WP8A 1KEKA 1N54B 2HBRB 3U1MA 5GVQA 4YB1P 1HQ2A 2P5VA 1EQ0A 3HXMA 1BXNA 3N9UC 4I6YA 2VV5A 3EUNA 2CPHA 1H0HB 2XMVA 1NHUA 5KT4A 4DR5J 2B9YA 1GXTA 4OZ3A 3W66A 1YJNS 4HYKA 4M63A 1FNOA 2GJ2A 2GJFA 3M6UA 2ADBA 3GQCA 5AE3A 2F4VF 3A4TA 5FJ4A 3UN3A 5E3PA 1SL1A 2OPPA 2DRBA 2AJ4A 2AYGA 1HMVA 4HI1A 5KT6A 2E5LJ 2FGCA 2MXYA 3BBBA 4F4XA 1LWXA 3A3NB 2HEKA 2KYXA 2RSQA 1U2CA 4I0WA 3E51A 4RNHA 1QE1B 2YWGA 3MAAB 2AD9A 2CDRB 4C3MA 2BX6A 4MH8A 1RLDA 1N88A 1Y00A 4DSKA 3TQ1A 3V6JA 4JI1F 3OLAA 1RAAB 5I3PA 4QR2A 3RBDA 4MKAA 1FKAF 3SV4A 1O8BA 1WHWA 4JI4F 1CEZA 4OHXA 3QZ7A 1YIJS 2B7CB 2ILYA 1VBXA 4U7UK 1RA6A 1IQZA 3I56S 4OHWA 2IJRA 3MR3A 3UD5A 3OTDA 1Y5NB 2XMTA 3CJ2A 4IG3B 3AHPA 1TUGB 1N36F 2NUUG 1S9FA 4QWCA 1KLMA 3GIJA 5ETQA 4FF2A 3HVWA 2B43A 2FYXA 3B6BA 4DL4A 1KRPA 5KFLA 3BF4A 1YBTA 1GTHA 4FYDA 2H9ZA 4OV6A 1URNA 2DB1A 2DGOA 1NKBA 1HQEA 4OHYA 1N6QA 1HD0A 3G87A 3DLBA 1N52B 2MKIA 4ILLA 2UXCJ 4PG7A 2ZHAA 1S12A 2R7UA 1SL0A 4CLYA 4AL5A 1NBEB 1VRTB 4KYZA 2FJEB 2HHWA 2GHWA 4TYBA 3U27A 5J2MB 2J9CA 3DRYA 4KPYA 4ED5A 2V68A 3HO1A 4EWTA 3SV3A 4NLOA 1MMNA 3AOCA 1HHTP 2XYHB 4FF1A 4PUOB 2CJKA 1LV5A 1MMDA 3LP1A 2GA7A 3PW7A 4ZVHA 5EDWA 1RHMB 1VBKA 3KJNB 3HCXA 2J0SD 3S6EA 4UOCA 4MK8A 4HACB 4QPXA 1PCAA 4W90B 1FF2A 4LF8J 1EIYB 4UQGA 3MI7X 1KD1T 1QDUB 3GG0A 1R89A 1KR4A 5B0BA 1WWHA 1B0TA 1M5HA 3AH6A 4GMKA 3FJ2A 1QTNB 5L46A 1KQGB 2A2CA 2IBKA 5A6PA 1NPKA 4KV8A 1SXLA 3PYDA 2XZDB 3EE3A 1LWEA 1ZM4A 1NEEA 4M5NA 3VVUA 2OMLA 2ZD1A 2AW0A 3EGNA 1SIZA 2QL9B 2C2OB 1HNVA 2VBYA 3CCMS 3R8YA 1FWLA 5HP1B 2P6SA 3RR8A 4GKJJ 1WORA 1XBWA 1C1BA 3FRZA 2ZZTA 5GADI 2YNGA 4M5GA 1S6QA 2F7VA 4FYVB 1LFPA 4PG4A 3NAIA 4YOEA 3Q83A 1HNWF 2QYCA 4DV3F 2VG6B 4DR3F 1CJTB 4K4XA 3AOBA 3HULA 2QTWA 4A8WA 3UN2A 2ZH6A 2IM3A 4X62F 1X4HA 3CSKA 4JI8J 3PRVA 4GKKF 2VB6A 3DLKA 4J9VA 2CQHA 4JBCA 2XBPA 4DU8A 1M0SA 1QLNA 3PEJA 4KO0B 2BE2B 3QZ8A 2IJFA 1EAYC 1XR6A 5K20B 4K4VA 2OI2A 4KFBB 4IOBA 1QD1A 5F8NA 2ZBIA 2NSCA 4ZOSA 3IS9A 3K89A 4IFVA 4M5DB 5E3RA 1N5YA 4IR1A 1X4DA 4X4TA 2MZTA 3GR0A 4U8VA 2LA4A 3KHLA 4DJBA 2R42A 1ZTTA 2KI2A 1G3OA 2XSFA 1YDLA 3C2PA 5KG3A 9ATCB 2J7UA 3MEEA 2ZEJA 4K4TA 3C6UB 1WKJA 1KONA 1Y10A 1YZ7A 3MDFA 3TJ9A 3C15B 2KYZA 1FEHA 4QQBA 5DS7A 1RISA 4MMOA 2QZ8A 3NMAA 4CLSA 1YJ9S 4USIA 2CUYA 2P2CB 1WOOA 3GCWP 3D6TB 3PX0A 4B3TJ 5SZTA 1EARA 4OYAA 3TA1A 3RAQA 5KFHA 2VDHA 4Q43A 4LSLB 3TAQA 1JB0C 3UDCA 1DLOA 2LEPA 1L3SA 4DPOA 2NR0A 3ZZZA 2CQ4A 1R8CA 4RUCA 3PR4A 2ROGA 1LW2A 4PWWA 2VA3A 2CWKA 2FHJA 5B09A 5DO2A 2VOPA 5IQ6A 3HMJG 4ZDNA 4C8YA 5AXNA 2IVFB 3CC7S 1HI1A 2PIIA 5KFPA 2DNZA 3KLIB 3ZTQA 1HBMA 4GC6A 1KQKA 3CJKB 4ID5B 2H51B 1JXVA 3IGVA 1HW9A 3W5YA 3BGLA 2R2SA 1Q7YT 2VOOA 1BQMA 3DN9A 3CC2S 3WC0A 2YNFA 3P4UB 4C3KA 4QWEA 3G4SS 1YJVA 1N5QA 2LCWA 5IT9Y 4LFBJ 4HKQA 3RG6A 3T1HF 2W9BA 4JI2F 3EXYA 1LW0A 1RWWB 3V6DB 1RCXB 3PFOA 4K4SA 2QLFB 1K0VA 2KRRA 3T1AA 1ULRA 3F56A 3GPAA 3M2VB 2UZAA 3DLLQ 3V4IA 2RILA 1RTHA 3GTYX 5D4LA 3OW2R 3JSMB 2O3DA 4D3HA 1UPMB 2JOQA 4ES1A 1H3DA 2MZSA 4DL0C 3I4PA 1BHNA 2E9TA 4KHRA 1ZAXA 3PKMA 5C5JA 5M2RA 1RE1B 1UTAA 1UETA 1ZAWA 2X1AA 5I3UA 1JJ4A 4X4QA 1KOHA 3W2VB 1D9DA 2SXLA 5D77A 3U02A 1S6PB 4I69A 3MUVP 1IUJA 1Q8BA 3D66A 2YNHA 3CGIA 2M4MA 2HVEA 4DR2F 3TUJC 2LQ9A 2R2TA 2B8QA 2ZE2A 4MTPA 2J8SA 3EX7B 4NLYA 3CT9A 1U1LA 2UVRA 4DEZA 2JLFA 1K1SA 4WPAA 2CPIA 3L7PA 5KT2A 4LQ9A 2C3OA 4M1KA 4RUAA 3CDEA 1QAJA 1RBLA 2DNOA 4ILRA 4C8OA 1U45A 1U0HB 1LQ9A 3M30B 3JYTB 3P5TL 3FMBA 4P73A 2HQIA 2ROEA 2X7IA 5HVFA 3SCKE 3DMJA 3FGVA 3NMRA 2BQUA 5KFIA 5DLGA 4B3OB 1NDKA 4AE5A 2KFYA 1BLUA 2DHHA 3H59A 3ZO7A 3TAMA 3AQOA 3DLGB 4NMLA 1F5CA 4L3KA 1LK7A 2AQ4A 4A8KA 1B7YB 5CH7B 4ETZA 2K8GA 3GMGA 1UWBB 2JH3A 3M32B 4LFAF 2C2EA 4FKYA 3M9NB 1VRUA 2AGPA 2EFQA 3H0PA 5HVHA 3VHQA 5IM0A 1N0UA 2WCXA 5AE2A 4OHVA 2UUCJ 5CYQA 3QIPB 1BE4A 1JLQB 2XG8A 3AD7C 4ZPDA 1H2UX 4M5JA 3RGIA 4U67Q 3UFCX 4X66F 2W9CA 2E7WA 2HFNA 1ZZFA 2RUSA 1T3NA 2F8HA 3HHLA 2DYAA 2PN6A 1LFWA 3PJWA 1GAOA 4M5IA 4NMXA 4W4MA 3NGUA 1R7IA 3THPA 5L1LA 1NSPA 4A8FA 2VC1A 4K4WA 5LXYA 4NLVA 1WF1A 2CVIA 2HK3A 4TN2A 2CVEA 2ZH8A 3FSXA 2JRSA 2OIHA 1UVJA 2GX8A 2DNMA 1L3VA 1VQ5S 2FTRA 2HWHA 2XTJP 3BPSP 5CYMA 1WG1A 3I0SB 1RT4B 2F4FA 2Q66A 3IRXB 4DG1A 3TARA 2PMWA 2NUHA 5ETTA 4NEYA 4ZHRB 2HNYB 2DKOB 3PXGa 2G1HA 5I42B 4KSEB 2CXEA 1NAQA 3DDIA 5KFAA 1O51A 3BKUA 2VHGA 1E6YB 1VQMS 2UXBJ 2DH8A 4ZJQA 3TVYA 1OYEA 5D15A 3FCHA 2M52A 5CCLA 3GIMA 2BDPA 2ILZA 4DL7A 5GAGI 3MFIA 1RAEB 2ZC4A 3LP2B 1Q82T 4BC9A 4OQJA 3IGNA 1LWFA 3T9ZA 4LFCJ 3JS9A 3EGZA 2CRLA 3QGHA 2C3MA 4HDHA 4RW4B 4ZP9A 1U6BA 4ECWA 5C7PA 2VDIA 2XGPA 4K4YA 3FFIB 5JVHQ 1G6BA 3GWCA 2G4BA 3CF5Q 2A3JA 4NLRA 4UOGA 3EICA 4OYWA 3W9IA 3BH6B 5LMNF 5EWGA 4DZ6A 2JX2A 2HWIA 4DI6A 3NEKA 4JI3J 2E5IA 3MM7B 3G6XA 2DGTA 2W2PP 3D9BA 5EHHA 4KGXB 3CD5A 4MJKA 3QT5A 3SFUA 4WBFA 4IQMA 5B0GA 3MEGA 1FHTA 3NBPA 2AJ2A 2LDIA 3E01A 1C4CA 1S9EA 3V4MA 3CDBA 1FTCA 1VBZA 4DV5F 2XY7A 3AA8A 1PILA 2RD5C 1N33F 2AWZA 2FLPA 4DL5A 2JL9A 4C11B 2HRTA 2MPUA 5HI7A 4ZP8A 3RUBL 3DRSA 1HKAA 3RJMB 4FZVA 2AT1B 1S0OA 2L3MA 1KTQA 2XMWA 7FD1A 1H7WA 2A6OA 4LIWA 4WP9A 2A1BA 2F65A 2WK4A 2R3VA 4Y2IA 1I94F 2ASJA 3P3DA 4ED0A 4HH1A 2DJWA 2V0NA 2CZ9A 4DV2J 2YKNB 1RHJB 2GJIA 4H4MA 4MKYA 3CMES 3PJ9A 2W7AA 4KE5A 4YR3A 3VTIA 1Q79A 2ZBCA 2I8EA 1HPZA 1SIWB 1L3KA 2EKNA 4L76A 2H5JB 3GILA 1RWKB 2RQCA 1PAEX 1FNXH 2J6UA 2CPJA 4DSIA 3Q24A 2ZC3A 2B0GA 4L73A 4NXNJ 2DPJA 4O3OA 5ADZA 4J9QA 1SKSA 4ES2A 3TWZA 2DGQA 2ZOFA 4MYUA 4ALZA 2Q79A 3PO4A 3IG1A 1CJUB 1QE1A 4P7VA 5T7LA 5KFTA 1QSLA 3TUIC 3CD6S 3ZZYA 3DRRA 1N5TA 3CJ4A 4LSNB 4LF7F 2R2UA 5KFCA 1IR0A 4NYPA 2WW8A 1J5OB 3QJPA 4I6AA 1CC7A 3FQLA 2P9CA 5DQGA 4K4ZA 1UPPA 2PSZA 3CC4S 1FD8A 3D3BJ 4RW7A 3LO3A 2LEAA 2FY8A 2NXUA 3DU6A 2ZH5A 3NWRA 1U02A 5E7OB 3W5ZA 3J81Y 5IC4B 4R8UB 1RKIA 2Q6BA 6AT1B 4NL5A 4IG3A 1TMMA 4ANDA 2YY3A 1VQ9S 3OHAA 2E7VA 3KFWX 2E44A 1SV5B 3PVXA 3DU5A 1GXUA 3VGTA 5CA5A 4P2SA 3VQSA 1Y9OA 4Y6IA 4RW8B 2I1RA 1U6ZA 3S1TA 3ZTOA 2LMIA 5GADU 3IRWP 4NCGA 2I38A 2OEMA 4FBTA 2FJBB 3G9CA 1VQYA 4GO7X 5ETNA 3ZZOA 2YPZA 3R5DA 4YHHJ 4J9PA 4QIGA 4URQU 2F8MA 4LF6F 2DR8A 1FD2A 1F9FA 4HTJA 4FNHA 2LXIA 2ZDOA 2RQ4A 2ZOMA 2OEKA 2WVBA 1TELA 4HHHA 3LANA 1FXRA 3QGPA 3MAHA 3N79A 1KVKA 4CI0B 4JI7F 2HFOA 2GHVC 3GFXA 4QYZJ 5HSPA 1UVNA 3W1YC 1WUUA 4C2MA 4K8RA 4LVOP 5J2MA 3UD4P 2AEMA 2YVSA 2HRUA 2FY1A 5KFWA 5KFOA 4PUOA 4ID8A 1C0TB 4ELTA 1S6OA 2GQ2A 4QCLA 5EWFA 2HNDB 4QIEA 3H5SA 3FC9A 4R0EA 1PYOB 4HACA 2DNRA 1VR6A 4I67A 4DPWA 2XLJA 4L72B 1RTJA 1TAUA 2YQ1A 3US5A 3L09A 2YX4A 5F8LA 4QU6A 4ICLB 1AYEA 3F73A 2RS2A 2M7SA 4HL9A 3OL8A 2IC3B 1TL7A 3AD8C 4LMZA 1XR5A 3NS7B 2Y1LB 3FBCA 2Q3PA 3I6PA 4DCOB 1XMOF 5KFYA 4MK7A 5F0WA 1S97A 1QAYA 3J81j 1UJ6A 3TNVA 2R7RA 1EZZB 4PKDB 5CZVA 4X64F 5G4DA 4LVNP 2FHMA 5EWEA 2C2MB 5HP1A 5HROB 4LRAA 1VRQC 4C4WA 3BM7A 1REGX 5IQQA 5K8PA 3KXDA 2CQGA 5L8RC 1VS3A 2J6SA 3SQGB 4LF9J 1YJRA 1RLCL 1OJ4A 1TL1B 4JI0F 4RO0A 1FWKA 1V3SA 2BOAA 2XZWA 5DM7Q 5D8HB 1CJTA 3M4XA 2IYGA 1M5PC 1PKUA 1IBCB 4I2PA 2VA2A 3GJSB 2Z2MA 2AX0A 1QTMA 2EI5A 4J9UE 3GV5B 3VAFA 2D7SA 5DRKA 1SVDA 1TV6B 3EPIA 1HI0P 3H90A 3E3XA 2AKWB 1J5EJ 5HO4A 2EK1A 1RSCA 2MQOA 2V8HA 3SDEB 2L41A 2OSRA 4KFBA 1UFWA 4J9LA 4B3RJ 2JWNA 2ZNYA 2F8EX 2PC6A 1BMQB 3VCDA 3BR9A 4B3SJ 4DSLA 1HR0J 3EVOA 2VH7A 5K14A 1YJ7A 4OLOA 2RRNA 2Y0BB 3PZPA 1NRKA 3MPYA 3IM9A 3JAMU 5DG8A 4A8YA 3J7AN 3C15A 3EDQB 4K5SA 4JV5J 4DXLA 3JTPA 2UXDJ 4KKOB 5E41A 3J7ZT 2KB2A 5B08A 2VODA 3CJRA 5J1EB 2DXEA 4QYZK 4RBVA 1NKEA 2XS5A 3MGJA 4J9KA 3SYZA 3JTOA 1SQFA 2H54B 5EX3A 3PNIA 3QLHB 3P5BP 2OTJS 2R7WA 1IR1A 4QOTA 4DQIA 2W25A 1NLKL 2VKZG 4NLWA 1DTTB 3CJQA 5F9LA 1IBLF 5A2QY 3KLIA 5DM6Q 4FF4A 2KM8B 5CXTA 3CJKA 1QUPA 1Q53A 2IVYA 1TZ0A 3I87A 1U8SA 5E3CA 4WTOB 3ET6B 5E2QA 3ZNUA 4QYRA 2XS7A 2W4DA 4USHA 3CCLS 4AXIA 1D9AA 1AW0A 3AA9A 4DR1F 1BQXA 2KXFA 1HNZF 2M5YA 1P9YA 4JV0A 2UUWA 3BO3A 1VC5A 3M2VA 5B0DA 2VBXA 1K8AT 1Q86T 2DR6A 2CNKB 2BVZA 3JSMA 4CLLA 2IBOA 2VPYB 2HZVA 3MR2A 4G1QB 2EFVA 3W7BA 4Z2XA 1V5VA 4C6AA 4HVZA 4N5SA 5IWAF 2XY5A 2RQKA 2HWTA 2DHAA 2CG4A 2XMJA 1WC5A 4JI6J 5L9XA 1WELA 3SSSA 2UU9F 4Q8FA 2GAHC 2WVEA 1XTZA 5J1PA 2PGCA 5F9NA 1OO0B 2FLOA 4KGVB 5L9NA 4RU9A 1NHKL 1H98A 2DH9A 1ZZNA 3W2VA 1M90T 1FX4A 1S76D 4C9DA 1FDBA 2LP4A 1S6PA 4ZPVR 2D1CA 3FCVA 5C2GA 2C3PA 2DY9A 1HARA 2OD4A 5E5NA 1HNXJ 3LTOA 2OHDA 1VQ8S 1DQ8A 2RMLA 4UQTA 5GAHI 1NK4A 1TUVA 4F2SA 2WHOA 4AL7A 3MHYA 2RDIA 4RW6A 5JUMA 1VFJA 2FJWA 4N56A 1NDPA 3D68A 2Z4PA 1X4AA 3I31A 1RWUA 4TU8A 1VC6A 3GYXB 1RAFB 4BBYA 1QY7A 4R5PB 1MLAA 2DNYA 3JYTA 4J9MA 2GV1A 4IKAA 2BJ8A 2F9DA 4C8NA 1RT6B 2V8PA 3AFGA 4OJ3A 1UKUA 3H5UA 2CJAA 2MJNA 4DU7A 1T03B 1S72S 4USVA 1JXLA 4LF4J 2RUGA 2QA4G 4DF8A 1UEUA 1LWCB 2HK2A 4U6PA 1UWBA 5GAGU 4F8RA 2CNNB 3M32A 1JLAA 1IM4A 1HMVB 4EGLA 2BJ7A 1FKPB 2MQNA 3QATA 2ABYA 4OZNA 1UA0A 3CDWA 2H4WB 3IBCB 1H74A 1VHFA 4DPUA 3OL9A 2VC0A 1F6TA 2XQCA 1V3RA 1ZPVA 3QIPA 1NKCA 1JLQA 3O3LA 3D67A 3GIKA 2AF6A 1BWEA 3TZWA 5KG2A 1RAHB 3QYYA 4RR5A 2NREA 3TX0A 3CUNA 1KS2A 4B9TA 3ZXWA 1N32J 3FNNA 1RCOB 3V6HA 1SB6A 4A4JA 1T9XA 2HIQA 3ZZ0A 2VQFJ 5FLXU 2HQDA 3RAMA 5DGAA 3VVTA 4EYHB 2V2VA 1GK8A 1D0EA 4YY3J 1KLMB 1XWLA 2BW7A 2W2NP 1O6XA 4OX9J 2BW2A 4DR4J 4NZ6A 4P6QA 1X7VA 1WHYA 2KXNB 2E7XA 3RR7A 1NXIA 1RT4A 1FVSA 4LT6A 2HKEA 1HQEB 1SI9A 1N6QB 2R7XA 2CQPA 4CLPA 4ZHRA 2HNYA 2AGQA 5ETVA 3UNYA 3RW7A 5I42A 3LF0A 1MN7A 3RRKA 4F7VA 4C8ZA 4XO0A 1NK7A 1Q95G 2FVSA 2NXCA 1C1CA 2XI3A 3EWGA 3BQ2A 4ITSA 2UUAJ 4WXOA 2QIFA 1FRMA 3SSQA 2VU5A 5HBMA 1CJVA 2BYCA 4DSEA 4MIAA 2XMMA 2BQ3A 2VQEJ 3FDSA 3D1OA 3DKDA 2XLIA 4HDGA 5IV3A 3IAS9 1FRKA 4O23A 2BKOA 3N5FA 5IZHA 2ACYA 2QA1A 3CCVS 2LXUA 3LP1B 4RW4A 1KFSA 4B9MA 1RHUB 2G2YA 3R2CJ 4C48A 1S7HA 2QLJB 1TP7A 4WIIA 2EEYA 2AJ1A 3UCUP 4RNFA 2DEJA 1KQFB 1R27B 1J27A 3R7SB 1NB2A 1HWLA 4OYBA 1XJWB 2DNNA 3M8WA 2WSCC 3D6MB 3PG9A 4DUZF 3AJDA 4ZCMA 2DR9A 2CKWA 2CNOB 3KG1A 2XMAA 3G2XA 4KGKA 2XC9A 4ED3A 5ETLA 3O8WA 3KUHA 2QMXA 2L9NA 2XNRA 4YMEA 2GVDB 4PCQA 5RUBA 4LRCA 1ZBTA 1TR0A 1LWEB 4LRBA 2LQBA 2Q43A 3HKWA 3CJ8A 1NSAA 1N5SA 3I96A 5KT3A 5B0EA 3QSYB 3W65A 1YRUA 1IM6A 1KC8T 4C11A 5BR8F 4C7QA 4WXWA 4CO1A 3QRQA 3BGOP 4OMFG 2B8PA 1CG2A 1S6QB 2B3TB 5KT5A 4HT7A 2DGXA 1F2HA 2CPYA 3TQEA 4P72A 2ZUAA 1KN6A 2DIVA 4ZIVA 4ZLJA 1TKDA 1TKTA 1RT7A 4YR2A 3D28A 3M1VA 2YKNA 4J7CA 2LVWA 2LA6A 4NE9C 1GX5A 3Q0AA 3HLUA 3UO0A 3ZTSA 3IBWA 1FXDA 2V69A 2OPSA 1OPZA 4Y2CA 2V2KA 3Q86A 3QAEA 1T05B 4PXCA 3PR5B 3HVAA 3CPWR 4RZRA 2V4JA 2KHCA 2DO0A 2WOMB 1OS5A 2DO4A 1SJ4P 4OZ0A 2OUGA 2IA0A 2YTCA 5CD4H 2ZDPA 3DHWC 2R4FA 1U1OA 1WEXA 2LYVA 1CJUA 3IS9B 1HIYA 2ZJPQ 3WHIA 3SCIE 3VGUA 2M8HA 4IFVB 4FF3A 1N5YB 2RJZA 5LSOA 4IO1A 4IH5A 1IWGA 1S1VA 4LSNA 1AZSB 2F63A 2HRYA 3Q8QB 2MLXA 1F3FA 2VFTA 1DAXA 3DDNA 1R8AA 2H5EA 1Q5VA 2M0GB 4B9UA 5BYQA 4DR6J 2F3JA 3K5OA 4UF4A 1DARA 3H8YA 3T5LA 4R8UA 5A8WA 3JSBA 3OLBA 1OIAA 1GMWD 4DR7F 1CSJA 2ZM6J 3DHXA 3EMTA 1WEYA 4ZCIA 3CCZA 3R5BA 3KK1A 1SV5A 1QVFR 1H38A 3JQMA 2W2MP 2N3LA 2RAQA 1AFJA 3A3OB 1T0TV 3RU0A 3H5XA 1DLOB 1F2GA 5LSRA 1EX8A 1TMJA 4WZMA 2L08A 4YUDA 1Q78A 4DX7A 4YEAA 5DG7A 3M6XA 1VLOA 2YQ0A 4DV4J 2UVUA 1XMQF 3BO2A 2W24A 2DHSA 2W2OP 2CPDA 2MJUA 4E2FB 1HQUB 4PG8A 3OFFA 3CJ0A 1KKHA 3K17A 4F3OA 1HBMB 3Q23A 4KTQA 3WX8A 4LJMA 4E8UA 3V6KA 1Q4RA 1V5IB 1T95A 3QSIA 1KTVA 2HFZA 2YWFA 4DPYA 3BGUA 1GMWA 4WIQA 1RT1B 2OJ3A 2CDQA 1VJWA 3OVAA 1C0TA 4EU0A 3IR5B 1RACB 1WC4A 2YNIB 2HNDA 3MM5B 3V4IB 2X1BA 2GNKA 2GO8A 3BS9A 3W60A 4GO5X 3R1LA 2COLA 5M2UA 4X4NA 1PGZA 4KHPJ 1TVRB 3M8QA 2PD1A 3CWJA 1QVGR 4ICLA 3PKYA 4QZVB 2IC3A 2KDOA 1WDTA 5F3ZA 4ZVUB 5I3UB 1SUQB 1WHXA 2HFUA 1PBUA 4CWBA 5IT9U 1Q7LB 1VQ6S 2IAJB 3R3TA 2O1PA 1PJ6A 4DHVA 1IN0A 4KH1B 5KFGA 1HW8A 1S0NA 3M8PA 1YG0A 5HROA 1RDRA 1SC3B 3RBXA 2BANA 1LNQA 2B56A 2IHR1 3I5BA 1KQSR 5MLCV 1Q5YA 3W61A 1TKXA 3SQGA 1NK9A 3SIPB 4X65J 3OTEA 2O66A 4NRTA 1IBKJ 4QW9A 2J76E 1NSKL 4H4KA 4CLWA 4YR0A 3OR2B 4EBEA 1WOSA 1CVJA 1TU0B 4L6V3 4C98A 1UAWA 4J9OA 4WYWA 3CW2C 1UVLA 3HZEA 1RBAA 1TV6A 3JAMY 4NWBA 4CCHA 3BYPA 2HHHF 1S1UB 3DLHA 2RH3A 1PSDA 2QFIA 1H73A 2F9JA 1UA1A 3NCRA 2HFSA 3SDEA 1TL3A 3UCGA 2WTFA 4Q2LA 1UW4A 2E5GA 5KFQA 4CLKA 2Y3YA 1WHVA 2NS1B 3WIVA 2GMLA 5J2PB 1K73T 1P6TA 3T41A 2YX7A 4ZS6A 3MAQA 3R2DJ 1IBMJ 3OTBA 2C3YA 4ED4A 3U1LA 1H2TZ 1Z4UA 4BHQA 3UDVA 5CYQB 4CO4A 2XB2D 2ZH1A 1UFLA 2IRYA 3PW2A 1WDDA 3NAHA 1FX2A 4RWWA 4K4UA 3GV7B 1F3VA 4ZVSB 4KHMA 2PI4A 3Q8RB 3K58A 1ZETA 4CLFA 2W9CB 1D09B 1S6UA 4NYOA 5HN0A 1RT3A 4KKOA 4C0BA 3HHLB 3NKYA 1VHIA 3N6MA 1B0VA 2ZBPA 1VK8A 3ZZUA 1JQGA 1HBOB 3GFHA 1U1RA 1RADB 3JSRA 5GAEI 1GXLA 1S4EA 1UZDA 2DEIA 5HATA 3P6YC 1YZ6A 1ZH5A 3QLHA 2D3OR 3MMAA 4ZMMA 2A0FB 3FRYA 3VALA 5LL6d 2KT2A 1TAQA 2EFPA 3TW0A 3ONQA 4N8OA 1RTIA 1DTTA 5L1JA 5CYMB 4NA1A 4L3NA 2CPXA 3O6QA 5M2PA 2ZJQQ 4W92B 4NLXA 4WK3A 3EJMA 3MMCB 2AZ1A 2ZKUA 1LKZA 1NJWA 1FJGF 1ZS6A 2JNJA 2LQ8A 3ET6A 4Y28C 2OD6A 3EXCX 2JC0A 1XNRJ 3R5JB 2HHQA 3PM9A 4PQUB 5C24B 3MF5A 4QR1A 4DV1F 4AXJA 2C3UA 1M5VC 1LWFB 3AJ1A 2RDDA 3FVYA 2MMYA 4DL6A 4Q7AA 4USTA 1S1TA 2J8AA 1ZM3A 3WBZA 4XTTA 2EWHA 2HBYB 2FHKA 3A13A 4RL1A 4B02A 1NCLA 4G1QA 4CH0S 2AX1A 2L9DA 4CNZA 4IRDA 5E0OA 3CVKA 2W8KA 3VAHA 1EP4B 3S8SA 4Y3CA 3LA0A 4HI2A 3FUYA 1RK8A 3T6JA 3ILIA 4DCJB 2MY7A 2V4QA 3D5MA 4RW9B 2HHSA 2B6AB 1XNQJ 5IFMA 3MD3A 5D4OA 5EUHA 3TVZA 1FRLA 2DHXA 2XSJA 4P9SA 4OHZA 4DV7J 4K0KF 4BLGA 2D69A 3HT0A 3E01B 3W8PA 5THWA 1S9EB 3MR7A 4QWAA 1KLNA 2RHQB 1DTQA 4WFAQ 2DGUA 1FE0A 3M2RB 1F0XA 1NK8A 4LF5F 1BGXT 4IYQA 4FBUA 1Z2LA 1SKWA 3DNCA 2MQLA 4C0OC 4ECZA 3DRSB 2NQPA 1YJUA 1FRHA 1TKZA 4DSFA 4JV1A 3VR1A 4R5PA 2PI5A 2GIRA 2EC2A 1RT6A 2D3ZA 1DBDA 4P10A 6FD1A 1BD6A 4DPXA 4NEZA 1PG5B 4H4MB 1YVFA 1R8BA 1T03A 4DQQA 1UP1A 3PW0A 2WONA 4EBCA 4OX6A 1U1PA 5F8JA 1HPZB 1LWCA 3CCWA 8ATCB 1GX6A 4Z7YA 2N3OA 3BH7B 5DDOC 5FLXY 1U8WA 1MWQA 4DFJA 1FKPA 1WOPA 4OYZA 2WSFC 2FLLA 4JYAJ 1W2IA 3MMJA 2CFXA 3IG1B 4DV6J 3HFKA 5T7LB 3D2WA 2GS8A 3PACA 2XCPA 5ETKA 1MU2B 3DRXA 3BQ0A 3DRRB 3EZOA 3SEOA 1FRJA 1T94A 4O3RA 2XYGB 4RW7B 1GNKA 1P1TA 3MWBA 3GV8B 4DX8H 2MY8A 4WFBQ 3E2EA 3DM2A 3IBFB 2DITA 3VV2B 2E5HA 1NK0A 3POTB 6FDRA 1N8RT 3QGIA 1YJWS 1JWWA 2QT7A 2IPOB 1MWYA 4NPOA 3BSCA 2KVQE 4I1TA 2RU3A 1U26A 2EFNA 2MLZA 1RBOB 1NM2A 1JNZB 2FJVA 2VFUA 4ZCLA 2CQIA 5A8KA 3RYLA 4PG5A 3OXFA 4UW2A 2ZITA 1Q16B 3D1QA 3UR0A 2AYMA 1S79A 4F4AA 3OTOJ 4NCGB 3VAKA 1VOMA 4P75A 2AYBA 5DLFA 4DV0J 2EKYA 5A6WA 1U2RA 2K3IA 3T19A 5C42B 5KFVA 2KVIA 3W3SA 2WZ1A 3FCWA 1N5VA 3J81U 3QBCA 3DXBA 4EZ9A 3DOKB 3FSIA 3CJSA 3PYGA 2MKSA 4HR2A 1SJQA 1X9SA 4ED8A 2GO9A 3ICLA 3MECB 5BYRA 3CDUA 3O1LA 2B7BB 3MEKA 3G8SA 4ECVA 2B4OA 3BPDA 3HHLC 2X3GA 2VJUA 3WC2A 1EETB 2C42A 1UVMA 3NCPA 3B54A 2DK2A 4KT0C 2D41A 4NASA 2QC3A 4RX6A 3C3LA 1UJ4A 2VG7A 1M1GA 2JLGA 4O4GA 4V19J 2WB4A 1WI8A 1DFDA 3H2UB 1RTJB 2R2RA 3ENWA 2NZCA 3KNGA 1I5OB 4NA2A 1D8ZA 1P1LA 1U1KA 5E33A 4PWUA 1M1KT 2FDNA 3FEYB 1TQLA 3LQVA 3QQCD 1TL7B 5D6GA 3D7SB 2GVDA 4RU2A 4NXMJ 1M5SA 1YKWA 3ISZA 4FN5A 2A18A 4JI5J 3KLEB 3BSAA 3FQKA 1WI6A 4DUYJ 4NLDA 3CIMA 1RHRB 5AXLA 4M5MA 1VDHA 4B3MF 2IRUA 2ZWOA 4NOHA 5DETA 2W01A 1YBAA 2APOA 1HHQA 4A8MP 1KVIA 4ER8A 1ZTWA 2MQQA 2CWXA 2LKZA 3MPUB 2DHGA 2CQ3A 5U47A 2YKOA 1NDLA 1EKSA 3HSJA 1CULB 4LBPA 5IOLA 1YSJA 5KFFA 4D3GA 3ZC4A 4F36A 3N6NA 3A12A 1D3WA 2RNEA 4I2PB 2OPRA 4OYOA 4TKTA 3MR6A 2Z2LA 1DURA 2Y1JA 4YS2A 3RRGA 1RABB 3KDOA 4Q44A 1KP6A 5D3GA 2HYIB 2GGPB 1SL2A 1T05A 1X4FA 5AJ3F 2BXJA 4AQYF 4ETXA 3A8EA 2Z8QA 3QGGA 2FVPA 2WOMA 2CQBA 2CQ0A 2QL7B 3MM9B 5CZXA 3F41A 3GU0A 1FWPA 2FHJD 4B9VA 3NNAA 1NB7A 3P49B 4K7QA 1CBKA 1E6VA 4ZVRB 2F4VJ 1NH7A 1T7PA 1AZSA 3MR5A 5K14B 3N28A 1RT5A 2WBRA 1G4CA 4WZQA 4LRFA 5FDLA 5CQGA 4OX8A 2V67A 2MKHA 2ZVIA 1AROP 4YFUA 2E1RA 2OLWA 4NI2B 4MIBA 3Q8VA 2BRKA 5DDRC 2EXUA 1T9TA 3HM9A 1ZYQA 2AYEA 1RGVA 2MZJA 2H1YA 3N5BA 1IJFB 2HBQB 4JI1J 2VONA 2IM2A 4N77A 3ETMA 4LBIA 4RBUA 3W2WB 5K5MA 1BY9A 3I55S 1B0PA 3EGVA 4PPZA 4NLSA 4JI4J 3A8JA 4LF2A 4WU3A 4EEYA 3VQTA 4USWA 4ED7A 3TR5A 2IYIA 3GFYA 3PX6A 2G1DA 1HQUA 4N7TA 2VFVA 5F3TA 4OYPA 4FPRA 3PFEA 4KJIA 4WWSA 5KAKA 2ZBRA 1VQSA 1EKRA 1S59A 1G7CB 3MPDA 1U6FA 3T1YF 4RLEA 4ZVQB 3HJVA 1YBUA 4OL8A 2A10A 4O0NA 3R5CA 5F41A 5K9FA 1FE4A 1IJEB 1RWPB 3PIPQ 2E1CA 2BA9A 1RT1A 2HHXA 4RBTA 2BM0A 5H9EJ 2ZJRQ 3LALA 5J1NA 2UUBF 4I68A 1VYAA 1TUWA 3PIOQ 2YNIA 3MM5A 3PW5A 3I5AA 1YQHA 3I0RB 3W8GA 3DYAA 2RE1A 4OZ1A 2BJ9A 2RF2B 5A2QU 3DOLB 1G1XA 4URGA 4KH0B 1TVRA 3C6TB 4O3NA 1ZOTA 1RP5A 4IOCQ 2H5IB 2J5AA 2LFVA 2FVCA 1HHSA 3UDLA 2AU0A 2YPYA 4TYAA 1SUQA 1SQEA 2Q1LA 4A8OA 1UVKA 1ZAVA 3FBFA 1LEOA 5DG9A 4P2MA 2IAJA 1S0VA 2XEXA 2KO1A 2DGSA 1AA1B 2VD3A 4J9RA 2WBMA 1CQMA 3OUYB 1NO8A 4TY9A 5GAEU 2ZH7A 4B17A 2JVOA 4CDIA 1UZHA 1WG4A 3HJFA 2KN4A 3TRGA 4RW6B 3J80Y 1X4BA 4EFAC 1XN9A 3OR2A 2RU9A 4Y34A 4DR5F 1ICEB 2WB1D 3H40A 5LXRA 2BBEA 3A1YG 3HHLD 1R0AA 3DI6A 1RAIB 3J7YI 4GRSA 4F0MA 1S1UA 2MQMA 1TK5A 4R0JA 3PCOB 2ATCB 2BJDA 4I7FB 2GIFA 4U7CA 3ISNC 1HNWJ 3T9NA 2G13A 2FUG9 1ZM9A 2G2ZA 4DV3J 1VK3A 4NCBA 2HS0A 3LUYA 2VL1A 2D74B 3UVJA 4DR3J 1JLAB 2YWWA 1ZPWX 2E5LF 5H1SV 3I32A 5HQLA 5J2PA 2UP1A 1RKJA 4DS4A 5BYSA 3MTKA 1PJ5A 1JMTA 2C2NA 4C3LA 4P52A 2X51A 1R6YA 4X62J 2JDJA 4GKKJ 2C2RA 5DJBA 4ES3A 5HVGA 5DZ7A 1UW9A 5I3QA 3SQOP 1RHQB 3AODA 2JLEA 4A46A 4C8MA 2YXLA 4CYUA 4F50A 1XMBA 3AD9C 4W98A 3GG1A 3D0GE 3G8QA 5D4NA 2W4CA 3G96A 2X3DA 1TK8A 1O0PA 1WEZA 2OO4A 3Q8SB 1B64A 3MCSA 2VZ9A 1HBOA 2NCKL 3C14B 1FJEB 4WFNQ 4JUZA 3PJXA 1H6KX 1RA7A 1RQ0A 3K8WA 3MFHA 5HLFA 1Z1ZA 2GMHA 3TUZC 4NZ7A 3VF0B 3M2UB 1FRXA 4PYDA 1NPRA 5HMXA 2YKMA 5H9EK 2YX1A 3BN4A 4URSA 4CO5A 2B5JA 3TZYA 1X4GA 2AMCB 2CQ1A 4USUA 3OSNA 3OXGA 2ZFHA 5LJ3Y 4A48A 1ROFA 2VICA 3MMCA 2DNGA 2BACA 4R25A 3OQ2A 2MHNA 4WFYA 2UXCF 1ITPA 1B70B 2V4RA 4JB8B 4QWDA 4QJVA 3HFVA 1FCAA 2HHVA 1C1CB 4PQUA 5C24A 3M8SA 4FVCA 2HQFA 5HBMB 4P71A 1CJVB 1JIHA 1NUEA 2W7PA 3DC2A 3RTVA 5D0HA 1EHWA 1X5PA 2LXFA 2PT0A 1KFDA 2M88A 5KFEA 1JX4A 1C0UB 4ZLNA 3UE2A 2OEJA 2UV8G 4PRFA 3MPWA 4DFKA 1S10A 4AL6A 5F8MA 3BBCA 1EP4A 1S77D 3K57A 4LF8F 3T1HJ 1B3TA 4JI2J 3PDNA 1RU1A 4RW9A 2W7OA 3IWNC 2DIUA 4DN0A 2B6AA 2CNLB 5I4MA 4IR9A 2CA9A 2AIRB 2X1FA 2AP6A 2FVRA 1M5OC 2QO3A 2CJBA 1V9OA 1GT8A 2DR5A 3EZ5A 3VAJA 2IJNA 3FKBA 3G82A 2HVZA 4HHJA 2MGZB 4ZN3A 1DRZA 4CZCA 2DNKA 3M2RA 2C2DA 1DZ5A 2KZMA 3NWGA 4GKJF 5IS2A 4KY3A 4RKUC 3KLVA 1IKVB 2J9DE 2H4YB 4KGMA 3TZXA 2HURA 3D6FB 4G6VB 2BABA 3E8OA 1F60B 3GYGA 4DR2J 1TKTB 2YWEA 1RT7B 2G2OA 3KLGB 1IVZA 2Y8YA 3M1VB 2FB0A 5HMZA 4C97A 2KTQA 1PYTA 2YKAA 1FRIA 4QIFA 3IA0A 3M6VA 2IA6A 2MEWA 4XDDA 2OPSB 4JI8F 1RT2A 4Z37A 3O44A 4ZK7M 2HQCA 3K0JA 4KRWA 4UZCA 2V4JB 3OSPA 5GMDA 2OELA 4XAKA 4ANCA 2O67A 2QX0A 2VF3A 3HK2A 1HA1A 2QGFB 1REVB 3ENQA 1WC6A 2NZ4A 5KFMA 1MU2A 4I2QA 1S1VB 2FJDB 1HWKA 2QSWA 4GVBA 2PE8A 5GMKa 2FLNA 4ED6A 1HBUB 1NK6A 4LFAJ 3JQJA 3KG4A 4F3QA 1WSRA 4PYAA 1LK5A 3POTA 3WZ0A 5A8WB 3MCMA 3B8HA 3HPOA 3QWPA 2GVZB 4A8XA 4DX5A 2CZ4A 3PV8A 4CT9A 1FXLA 1H7XA 4YB7A 1U4BA 4G3IA 3W9HA 1MG7A 3KK1B 3RB4A 3MOJB 4HH0A 4OLPA 4B3TF 1TK0A 4OI4A 3EYZA 4C0HA 4BWMA 4IFYA 4X66J 1IKXA 2FPHX 3C16B 1HYSB 2FHOB 2Y8WA 3GE9A 1PO6A 1NMEB 2PFFB 2IM0A 2J7WA 3KUEA 1FERA 2R7VA 3I5CA 3H5YA 5C42A 2GIQA 2BMBA 2K7JA 3ISND 4UUXA 3G71S 3DOKA 2ROPA 1SJ1A 2Z30B 2U2FA 3BGRB 3RAXA 4QWBA 3IP0A 1JLCB 3OD2A 1U25A 3WQPA 4PQAA 1NK5A 3MECA 2JC1A 4A8QA 4OZ2A 5GMEA 5LMUJ 2OH2A 1JXEA 3LWLA 2MSTA 2HNZB 4TY8B 3HI9A 4DQRA 2QEXS 3MD1A 2YWKA 1UFKA 2K1RA 3QJJA 2HVDA 4CTAB 4LFBF 2V94A 1EETA 1CS4B 1U2FA 3KHGA 2LU1A 1DQ9A 1VQNS 2CG8A 3QT6A 1X4EA 4AD6A 3Q89A 5KG6A 3HDSA 1QAXA 2OTLS 5LT5A 1XR7A 4ECSA 1JLFA 5DQHA 2MLYA 1JLGB 4WKRA 5ETSA 3J7Z5 5D0EA 3M8QB 4LSZB 1Q1KA 3DGPB 3PYEA 1R0CB 1RWVB 2HAFA 2ASDA 2QG9B 1D9FA 2ZZMA 2F1FA 4M94A 1APSA 3QFHA 5C25B 3EPGA 1PC5A 1YITS 2H48B 3KLEA 3HSDA 3A3PB 3NP5A 3GONA 4WCEQ 3IWXA 3CE8A 3MCOA 4ANEA 5FD1A 2NXEA 1WJ9A 2F5GA 2NYHA 1T9YA 4ZJLA 2V34A 3M8PB 3T5HA 2FZGB 5LMNJ 2BANB 1U1NA 4WP3A 3PRDA 1T3OA 1TKXB 3OFHA 1S1WA 4TNOA 1RXOB 4X4UA 1P27B 3ETOA 1N0VC 2RKIA 1X0FA 3TJ8A 2QA4S 4F0KA 1CULA 4X84A 3P96A 1NHVA 5LJ5Y 1X9MA 4DV5J 3X1LB 3HVTA 1RWXB 1KHVA 1N33J 2E66A 1PYSB 1B7FA 1Y3KA 1B4SA 1V3ZA 3VZHA 4ZCKA 1NSQA 4F25A 2GGPA 3VZIA 2ASLA 3R27A 4OYMA 1OMSA 1L3UA 2N4DA 4XIUA 2FC8A 2AV5A 1HLWA 1TL3B 1YGYA 3NS5A 5AXMA 1I94J 5G0RB 3MM9A 2J7KA 3TA0A 4LR9A 5LOQA 1O5JA 2E9RX 2HHUA 1KOOA 2ALYB 4ENOA 3IM8A 3IWLA 4NRUA 3NXZA 3PHTA 4IDKA 3NGTA 2LEBA 1YRTA 3ELHA 3K5NA 3R7BB 1FA0A 2EPIA 2OGUA 2MQPA 4B08A 4E0DA 1DJ0A 1I6JA 2UUCF 4C8LA 3R5AA 1WTFA 1T11A 1SH0A 2CAJA 1WC0A 2KT3A 3SMZA 3IFEA 2CQ2A 4NI2A 3H4BA 3OJUA 4C8KA 1AB8A 3SFGA 5KG5A 4OI6A 3AT1B 3C46A 2R8JA 3ITHB 5IV4A 1RT3B 2XULA 3KWMA 4AT1B 4WTYA 2QLBB 2FZKB 4F02A 3CXCR 2BE9B 4LF7J 1VGYA 4H4OB 3SSRA 4P7TA 4DS5A 3MM8B 1UCNA 3W2WA 1U24A 2BM1A 1GQEA 4EK2A 3KK3A 4UZBA 1VMBA 1SKUB 4CP5A 4EYIB 3MMAB 3P45B 4DOZA 2P6TA 4PXDA 4TU7A 1RTIB 4X4OA 3THTA 1HL6A 1VI7A 3ZTPA 3IC1A 2OPQA 1L3TA 2LECA 3ILLA 1R8HA 4U7UD 4BDPA 3QFWA 3K5PA 1FT8A 1K47A 4ERDA 2MSSA 4DLEA 1S5ZA 4I56A 4ZP7A 2UXBF 3J7YU 4UOHA 1HFEL 2ZZNA 1CJKA 4F2RA 4J91A 2JSXA 2DRDA 2HAIA 3KDNA 3ENAA 3M05A 4TXSA 4X2BA 5K8OA 3NGRA 1T9WA 1HWJA 3KLHA 1WTBA 5HANA 4LF6J 2D3O1 1A9NB 1BQNB 2V6AA 4LFCF 4LUBA 3LGMA 3HSZA 5ETOA 1WF0A 3I0RA 1NJYA 4CLZA 1VQKS 4ZITA 1S1TB 1K1QA 4ECYA 4RPFA 4JI7J 5AE1A 2RF2A 3HD2A 3DOLA 4YN3B 4BCAA 5DZ6A 1EQMA 2F40A 4YB6A 2DBBA 3C6TA 4OJ1A 3T3FA 3G6ES 2QL5B 4KB7A 1Y5LB 4KAIA 3GJQB 3NY0A 4F67A 5H9FJ 3KG0A 2DXFA 4M5KA 5KFNA 2DXDA 4F0HA 3OXLA 4JI3F 4RUBA 1RAOA 5D4PA 2XSJB 4NLQA 3RB3A 3NLCA 4QIWD 3NCQA 4PXEA 2XI2A 5LM7E 1IKWA 3I4HX 2KHDA 2HMIA 1F9EB 3OUYA 3LGHA 2PMZD 1UL3A 2NPIA 3C8YA 1QM9A 3IR6B 2ZH3A 2C1EB 1DTQB 4LR7A 3BKFA 3UR3C 4KPCA 3DLEA 3OR1B 3HHKA 4FS1A 4UY85 3HF5A 2LU2A 3ULHA 1YX2A 2AJ0A 3V81B 4ECQA 4OI3A 2XYPB 1MN9A 2LQ5A 1XMOJ 2CJXB 3NS6A 1TKZB 3NGKA 4F04B 3CNQP 4MKBA 1NNDA 2PA8D 3LAKA 4X64J 2KRBA 4DMZA 4ZJOA 4LREA 3OL7A 3TZZA 3RW6A 4DV2F 3HVRA 3TA2A 3ADAC 1V6HA 3ILJA 4LR8A 4ZKAA 2WONB 4I7FA 4EO8A 4JI0J 3PO5A 1XC9A 4O44B 3RRHA 4CT8A 4ECUA 3GSIA 2VBZA 4NXNF 3FBEA 3QJLA 3QPIA 4B9LA 2DNPA 4PWDB 5KT7A 1WG5A 1J2VA 3Q8UA 1FDDA 1MMLA 4L74A 1D1UA 1QSSA 4QIVA 1I3OB 5D78A 1JKHA 3QO9B 5KG7A 3GIRA 4DCPB 4G1IA 4H4KC 2IDLA 1XEZA 2NXNA 3D0HE 1FFSB 4FDFA 3DM2B 8AT1B 1S1XB 3TYTA 2GW8A 3MM6B 4MFBA 4ZVGA 2CZVC 1P9QC 3GP9A 4K2XA 4ECRA 4WU2A 1OY8A 3C14A 2UVWA 2G0CA 2VG5B 2HZAA 4BWJA 3OFGA 1YHQS 2E1AA 3T5KA 1S0MA 4ATNA 3M2UA 2DISA 2QFJA 3EZUA 2JFDA 2BOPA 1FO1A 5A8KB 1YRXA 1KHWA 3M6WA 5L39A 2E1MC 2HVIA 3CB4A 1U1QA 5ETRA 4CIOA 2HIYA 4OI2A 4PAAA 3WIUA 3PTWA 4YHHF 1L5UA 2EG1A 4YDDB 3BO4A 5J2QA 2DCUB 1FJCA 2W8LA 2GC8A 1IR2A 4MIWA 5H9FK 2CQDA 4LBHA 3CMAS 3H2VE 3HX9A 2MDAA 3OHBA 3EM1A 2HGLA 2D9PA 3H98A 3LPEA 5HMWA 2DGVA 5LMUF 1RB0A 3B4DA 2DNQA 2ZH2A 2KL8A 1IBLJ 5HJYA 1FEEA 1JLBA 3D3CJ 5D0GA 1C0UA 2V5HG 4HLBA 2PDAA 3NRBA 3I82A 2CJ9A 2DVIA 1HNIA 5E3AA 4X4VA 2J9EA 1WC3A 2VG7B 2RT3A 4O4GB 2XWYA 2O5DA 2VPZB 3EVMA 3KJQB 3ENVA 2MB0B 4YDXA 2WVFA 4PPDA 5A8RB 4WYLA 4DR1J 3UNGC 1HNZJ 3CO0P 5CABA 4J90A 3KMSA 4XDCA 5L38A 3RZAA 2GFFA 2FC9A 2RRBA 5KFUA 2KM8C 1UJ5A 2MZQA 1ACMB 3HHDA 1ZA2B 4AFFA 5DDQC 5IWAJ 4FXVA 1T02A 1FNMA 1GTEA 1AT1B 3Q2TC 2MGZA 4PXBA 2CPEA 2UU9J 3G86A 2MTLA 5KOXA 2XLKA 4X4PA 4XK8C 3B82A 1IKVA 2VPWB 4M8LA 2ERRA 4Z7CA 3AY0A 4MKVA 3DRPA 3NOGA 4IOAQ 4LF9F 2P8IA 3BKTA 3CJ5A 1FKOB 3M8RA 1PBAA 3KLGA 1W25A 2O01C 1FK9B 5KFKA 1MSWD 2KJWA 5KG1A 2OPRB 5A0YB 1UEVA 3MTJA 3HHNB 4USKA 3V5RA 2L9WA 3KK2B 2Y1IA 5D3GB 2U1AA 1N34J 5B0FA 3BGFA 4J9SA 1J5EF 2ACMA 2MYFA 2XWXA 3KJFB 4WE1B 3MMBB 2M3DA 1FFWB 3BZQA 4MK9A 4L75A 2QE5A 4V1Ak 4B3RF 1REVA 2A6MA 3CMQA 5IC6B 3A8IA 2R8KA 1E6VB 2IIHA 1JLEB 3QRRA 3GFZA 4B3SF 3DDKA 4OI1A 3ZZPA 1HR0F 2R8IA 4K50A 3H20A 1RT5B 3ZZTA 4F4WA 5FDLB 1Y3JA 3M9MB 1YTYA 2HLTA 2NSBA 3ZZRA 2XO6A 1HBUA 1CQNA 2EVZA 2MKYA 4P2XA 4KC5A 4LQ3A 2JEJA 1F9HA 4NLPA 1BWVA 4I6WA 4Y0FA 1KSPA 4JV5F 2GVZA 1RI7A 3PEHA 3AAWB 3BYRA 3MAAA 2UXDF 4DPTA 2HQ3A 3GSDA 3QT7A 3KMQA 3Q2SC 1VJQA 4PZVA 3IR7B 1AUDA 4ZVTB 4WFXA 1RU2A 3D6HB 5KG0A 2BKNA 3VWSA 2MKKA 2UV8A 1IWAA 2N4CA 1OYDA 3C16A 1HYSA 4IUFA 2VKRA 3GB0A 1NJXA 3JQKA 2QMWA 4CH1A 2LLZA 3GLJA 2VASA 2JHEA 1NJZA 3BR8A 1MW7A 3BGRA 3QIDA 1C4AA 5L1KA 2BJ3A 2EBEA 2JVRA 1JLCA 2OFGX 2OKQA 2OP5A 1T9VA 2IMWP 1XERA 1CPZA 3ZTRA 3LAMA 3SZ2A 2D9OA 2HNZA 4TY8A 4CTAA 4DZDA 3TOQA 1HI8A 4DBQA 1CS4A 1LXJA 3K59A 3TJAA 1R6VA 4TQRA 1D8YA 3QMQA 3CCUS 2VFSA 2QV6A 1NZ8A 4EMDA 3KJVB 3AB2B 1Z2ZA 5IXUA 1SQGA 1W26A 3DYAB 5KFJA 2C2KB 2FVQA 3AXMA 2B4PA 1JLGA 2J0QD 2J9DA 1N4LA 3KTQA 1DQAA 1VRTA 5F0UA 4K59A 1FESA 1RTDB 4OZJA 3HP6A 2DNLA 3JXOA 4JP8A 2YH0A 3UPFA 3DGPA 1SBRA 3C19A 4JI6F 4USJC 1K0TA 3BSOA 5DDPC 2DCLA 5C25A 2I5JB 1IKYB 1NU4A 1OPIA 1VLYA 1R8PA 2DY1A 5SUHA 5J2NB 1PIEA 4RUHA 2ZHBA 3UD3P 2CQCA 1Q8IA 5DQIA 1FDAA 3BN7A 3NNCA 4OZ5A 2ASYA 1PC4A 3T6BA 4DUZJ 1HNXF 3CD7A 3R5GA 2E29A 4PR6A 3TEHB 2LDYA 2P9EA 3OPKA 2GCFA 2M8DB 3CCSS 4WF9Q 3OFEA 2WSEC 2IRXA 3LWMA 4EI2A 5HJXA 4CLTA 4WFZA 2QLWA 2IMOA 1T8EA 4A47A 1X5TA 1U0SA 3HSGA 2KKHA 5IT0A 5BR8J 1OWXA 3MEDB 1R0AB 3DI6B 2JEIA 4IG0B 2BJ1A 1Q8KA 3FEXB 5ETPA 2QRRA 1LOUA 1Y0HA 1RWMB 2MQ8A 1JJCB 4FYXB 3KOAA 1A0OB 3ZNJ1 4FS2A 2EBGA 4LF4F 5G0RA 2YQ3A 1GMVA 3UVJB 3I9V9 2HS3A 2VG6A 1IXKA 2OFHX 2GQQA 1WF2A 4O3QA 1S99A 3MURP 3KHHA 1SJFA 2V8GA 1ZA1B 3GCXP 2XM3A 3GYNA 3J80U 3HFZB 5KTQA 2FJXA 3NGSA 2BZ2A 4NZ0A 3UN5A 1K9MT 4KO0A 3K5MA 2BE2A 2KG1A 4CYUB 1Q8LA 3M7VA 1VISA 3O2IA 3X3UA 5CCMA 3ITHA 1N32F 2RRAA 3DXSX 4M5DA 1X5OA 3D4JA 5BJRA 1WKLA 1M5KC 2R8GA 4BC7A 3AB4B 2VQFF 4FPIA 4H4OA 1BC6A 3MM8A 5HLFB 1FDNA 3QNWB 2WVCA 1F5AA 3NNHA 3Q8PB 4N8NA 1VQ4S 3LW5C 4TLRA 2BUNA 4YY3F 3DGVA 3L3CA 3C6UA 2YKMB 1SCJB 4TQSA 3F0NA 4OX9F 4X4SA 3MUMP 4DR4F 2BQRA 1HWIA 2JZ5A 1CC8A 1S9GB 3NG8A 2QLXA 5C2CA 3N0VA 4DR7J 4Q2MA 5GAHU 2XGQA 4H54A 2B5JB 4KR0B 5HQMA 1QUVA 4FYYB 1HBNB 2UVVA 3R6LB 4Q0BB 5HL7Q 3AQPA 2HFVA 3K5LA 2LQJA 3TEGA 1VIXA 3TUPA 4LSLA 1GH8A 1TFYA 3H4DA 1WNEA 1SH3A 4Q45A 3BB5A 4KIAA 4OI0A 3JSYA 2RS8A 3IO1A 4Y2KA 4U9RA 4DQPA 4OZLA 3Q8YA 2UUAF 5KFDA 1IQTA 2K06A 1XMQJ 1H2VZ 3CIZA 4AYBD 1UMJA 3T5JA 2VQEF 2A2DA 1BQNA 4CNYA 1WKKA 4LF1A 2H3EB 2VIHA 4J9NA 3N6LA 4WKYA 1U1MA 4ID5A 2KH9A 2ZWPA 4O3SA 1QSYA 5CYJA 4UTGA 1OSDA 3MXHP 2YWHA 4CQ1A 4S0MA 1XIQA 8RUCA 3W9JA 4RJVA 3LP0B 3UI3A 5T14A 3V6DA 2J0XA 2GZOA 4U96A 4CO0A 4QPTA 4Y00A 2H65B 5F8HA 2AZ3A 2AGOA 2Z0GA 2KT5A 4ZVOB 3FSYA 3BDEA 3RB6A 7AT1B 3CCES 3TI0A 3HZGA 3D0IE 3H25A 4N76A 2DD8S 2CPFA 3G82B 3AJ2A 3VAMA 2QSFA 2ADCA 5HMYA 3DOMB 3KLFB 3OR1A 2FGOA 2VFRA 5AXKA 1AUSL 1S4FA 4U8YA 3V81A 1MROB 4X4RA 2V2QA 4OX7A 4IH6A 2UUTA 4XPEA 2HBZB 3LPYA 4NX9A 2XO7A 2R7SA 5JJBA 4ECTA 3UWTA 3FMWA 2PO4A 4IRCA 2W2QP 2V9KA 4I64A 2OSQA 2FIUA 4P74A 1SH2A 4DLGA 1RT2B 1N34F 5AT1B 4QR0A 4IQXA 5A76A 1U49A 4O44A 2Q6CA 3R9LA 3PX4A 4IH7A 1U0HA 4B9SA 4UOFA 2EFGA 2HQGA 2EFOA 2HZCA 1WSVA 3M30A 4PWDA 4MYTA 2IFXA 2R7OA 2Z58B 3L95X 3BEGB 2OAUA 4B3OA 3CEDA 2HHHJ 1HD1A 3F44A 1SKRA 5L1IA 3W62A 3DLGA 4I2QB 3PRBA 3QRPA 4B9NA 2GQCA 4GVBB 1GEHA 1U48A 3B78A 2Z2YB 2BR0A 3QO9A 2N82B 3H42A 2XHWA 5JVGQ 1QJHA 2OPPB 4HEA9 4DR6F 2JFKA 4J5OA 1NJIT 1H72C 2I6WA 3P8BB 4EBDA 1S1XA 2XHCA 3MM6A 5BXIA 1TL4A 2Y0SD 2ZM6F 1X4CA 2VG5A 4DL2A 1YI2S 2DT9A 2FQQB 3MPVA 5T41A 3OBIA 3NOCA 1VQPS 2ZH9A 2BKPA 4RNNA 3Q22A 1SC1B 2HGNA 2YKQA 4HHUA 2PFDA 2IDEA 3CULA 1DHMA 4FXWA 2FD2A 2B9EA 2QA2A 4IFYB 3JTNA 1IKXB 4G65A 2M2BA 2DNHA 4DL3A 1SJRA 3TAPA 1JJHA 3THVA 4Y2AA 1FJ7A 4DV4F 4FXDA 3L4BC 4FVMA 2KFNA 2NPFA 2R9LA 3R7NB 1B99A 4A8SA 3BREA 3GJRB 1TTHB 2E1PA 3OJSA 2HS4A 4EUVA 1FI4A 4QBUA 2WAQD 3L7UA 4E98A 3I0SA 2B4VA 4CM2A 3IN5A 3IRXA 1RJJA 2K3KA 2K1RB 5KFRA 1LXNA 3PY8A 5KFBA 1YWXA 3NGDA 3GJTB 2WRMA 1Y7PA 3LGNA 1RWNB 1EJ7L 1OY9A 4HTIA 1FJGJ 3A8KA 2MZ1A 2QYGA 4NA3A 2KXHA 3SI8A 1E6YA 4UY8T 4ZLLA 2WVDA 3QT8A 2XZTB 4QU7A 3G6VA 1MWZA 2Z57B 2IM1A 1JLFB 2JEGA 3PYFA 4EO6A 1RUSA 2J6TA 4DV1J 5A8RA 4KHPF 1I51B 3LP2A 4JOUA 2QN6B 3S7RA 2I9SA 2NYIA 2HW3A 3UDEA 2N7YA 1XK8A 2RHSB 3V2UC 3IXQA 4V19X 2DH7A 4ZPWR 1RYRA 2ALZA 1R31A 3SBMA 2CJYB 3VGVA 2KFZA 3FFIA 3TO8A 4N41A 4DFPA 4PABA 2HHPA 5ITHA 2XS2A 4BS2A 2CPZA 2C22A 1SJ3P 4J37A 1RTZA 4DDFA 2MZRA 2G0IA 4ELUA 4ZA1A 5IT4A 3MM7A 1Y11A 4DN9A 2P9GA 2V2ZA 5DGBA 2BV3A 1S1WB 1C2PA 2G0JA 4X65F 2GMJA 2CJQA 4K0KJ 2HSEB 1A7GE 3CD0A 1PAUB 2N7CA 1IBKF 2RKIB 4Q5VA 4KV8B 1FKOA 3BSNA 5MAOA 2V50A 5CD4A 1R3NA 1RAJA 1FK9A 2ZD1B 4Y65A 3FZ2A 4NLUA 3HVTB 2AJFE 3CCQS 1HNVB 3J7A1 3GIIA 5A0YA 3HT3A 2R8HA 4LF5J 3CO9A 3KK2A 2ZH4A 2AJQA 1KVJA 1C1BB 1KWMA 2YNGB 3MOZA 4CO3A 4HT5A 1S49A 4MT1A 1TL5A 1VQLS 4WE1A 5F8IA 4KQZA 3MMBA 3AXKA 2L48A 2E9ZA 2AHOB 2XMKA 2V63A 4LIRA 3N01A 1NPPA 3WDOA 3OT9A 3VGSA 3IMQJ 1URRA 2GAGC 3MCNA 4IDKB 1I1GA 3WX4A 1AFIA 3RBZA 1JLEA 3DCAA 1IBMF 1WC1A 5JMNA 2CIMA 2PMHA 1VQ7S 3DLKB 4M5HA 4O3PA 2HPUA 2XCAA 2BJEA 5KOWA 3NL0A 3KYLA 5KFSA 2VJVA 2EW9A 3CCTA 4GC7A 3EGWB 3TP2A 1SC6A 3JB9k 5K8NA 1DY3A 4LRDA 3UW1A 2NXJA 3ILOA 3U7JA 4CH7A 1J5OA 2XY6A 5EN1A 4G1PA 2V9WA 2FJAB 1QAIA 4DWIA 3MEEB 3KK3B 5K8MA 3G6YA 4WK1A 1CLFA 3QAUA 2IY5B 4FNIA 4K2JA 1VIOA 1U47A 2W4PA 2XNQA 3U1NA 3PW4A 3CJ3A 4ECXA 2OPQB 1N36J 3FEZA 3OTCA 1R0BG 3SCLE 2BRLA 3PHEA 3HD1A 3BV8A 3G8TA 2ZKTA 3L7OA 1RWOB 4RW8A 1JJ2R 1ELOA 4RNOA 2ZNZA 1RAGB 1N48A 1KNZA 1CJKB 3O5TB 1LW2B 1XNRF 2CYYA 2AEFA 1P8GA 1TFWA 1VCTA 3KLHB 4ED1A 3M8YA 3K2YA 4OYXA 3CDAA 3HHEA 4FYWB 5FIIA 3KJVA 2B9XA 2I0XA 2RQMA 4FKXA 4CLUA 2KG0A 2K7KA 1XQIA 2DTJA 2Z2ZA 4OJGA 1W2BR 1KDNA 1BQMB 1U09A 1RTDA 2YBVA 2YNFB 2KU7A 1WACA 3M8ZA 3C66A 3HKZD 4F3MA 2FZCB 2W9BB 3FZBA 5EX0A 1LW0B 3FBBA 2G9OA 1EB0A 2R7TA 2I5JA 1IKYA 4ILMA 4ZP6A 1XNQF 2OMOA 3TANA 2J0WA 2MHEA 4PEOA 1RTHB 5J2NA 4UUWA 4GVLA 2V8VA 4DV7F 1OSCA 2PEBA 4ZPBA 3K8VA 4DQSA 2POKA 1VC0A 1IKWB 4PG6A 1ZM2A 4YP3A 4ZIWA 2HMIB 4OIXA 5CAAA 2V8DA 4ZPTR 1X9WA 4FP9A 5KFZA 1UVIA 2C28A 2BE7D 2IVMA 3OVSA 2MKJA 3DLEB 2B9WA 4F4YA 3AOAA 3IAM9 1UWAA 4TLQA 4QW8A 1X0PA 5LSLA 2YKPA 5HAOA 5EGYA 4ZN1A 2C2ZB 1X8DA 3H7HB 4IRKA 1Q81T 3KKFA 5ETMA 2HVHA 2YNHB 4B3MJ 3LH2S 9RUBA 2DPIA 3QWUA 4TU9A 2Y1RI 3MEDA 1BUXA 3UQSA 2ZE2B 4IG0A 1Y4ZB 1WD6A 5B0AA 3DLJA 1FVQA 3OV7A 1GMUA 2GHPA 5KFXA 4CM0A 1G2EA 4EZ6A 1TL1A 2M9KA 3VAIA 1Y5IB 4NYZA 4O4RA 3MUTP 2DGWA 2Y9HA 3SXLA 2EC0A 2KJVA 4JV2A 4NCAA 4JYAF 2PEHA 2E5JA 4F26A 4UT4A 5B0CA 1FFGB 3DMJB 3FK4A 2DR7A 4OV1A 1U7LA 4DV6F 4ZPAA 2ZBQA 3RB0A 3EVWA 5AJ3J 1S7IA 4AQYJ 3B4MA 3TAMB 1AXQA 1YJTA 3CJTA 1F5BA 3W64A 4ELVA 4F4ZA 4K5RA 3KNAA 3VAGA 1JKHB 1GFWB 2NLWA 2HLUA 3TX8A 1X60A 1X5SA 2JJ4D 2ZVSA 2QJ3A 1M1HA 1OQ6A 1FTRA 1VRUB 4MFBB 4DX6A 1HWUA 4ZVFA 5HQ8A 3DFEA 1K44A 5KG4A 5IM0B 4KBIA 3CCRS 3N4WA 3TVKA 4ZPCA 5CHCB 4Q8EA 2EG2A 4USMA 4MAKA 4OYIA 2HG4A 5HK4A 3EDRB 1MNEA 1Q0NA 1OQ3A 4DSJA 1S9GA 2BEFA
chains in the Genus database with same CATH topology
4M5MA 1DY3A 4M5KA 5ETVA 1EX8A 5ETMA 1IM6A 1TMJA 1TMMA 2BMBA 3HD2A 5ETKA 2F65A 3HT0A 3ILIA 1CBKA 3HSGA 5ETSA 1RB0A 4F7VA 3QBCA 3HSJA 5ETRA 3ILOA 1EQMA 2CG8A 4CRJA 4CYUB 1RU1A 1RTZA 2F63A 4PZVA 3KUGA 4CYUA 1HQ2A 3HSDA 1Q0NA 4AD6A 1HKAA 3HD1A 3HCXA 1F9HA 2QX0A 3HSZA 5ETOA 3KUEA 3MCMA 4M5NA 4CWBA 4M5GA 3ILLA 4M5JA 5ETTA 4M5IA 5ETPA 1G4CA 5ETQA 1KBRA 1RAOA 3UDVA 1EQ0A 3UDEA 5ETLA 4M5HA 1RU2A 3MCOA 5ETNA 3UD5A 3IP0A 3KUHA 3MCNA 3ILJA 4M5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M5M A;  1DY3 A;  4M5K A;  5ETV A;  1EX8 A;  5ETM A;  1IM6 A;  1TMJ A;  1TMM A;  2BMB A;  3HD2 A;  5ETK A;  2F65 A;  3HT0 A;  3ILI A;  1CBK A;  3HSG A;  5ETS A;  1RB0 A;  4F7V A;  3QBC A;  3HSJ A;  5ETR A;  3ILO A;  1EQM A;  2CG8 A;  4CRJ A;  4CYU B;  1RU1 A;  1RTZ A;  2F63 A;  4PZV A;  3KUG A;  4CYU A;  1HQ2 A;  3HSD A;  1Q0N A;  4AD6 A;  1HKA A;  3HD1 A;  3HCX A;  1F9H A;  2QX0 A;  3HSZ A;  5ETO A;  3KUE A;  3MCM A;  4M5N A;  4CWB A;  4M5G A;  3ILL A;  4M5J A;  5ETT A;  4M5I A;  5ETP A;  1G4C A;  5ETQ A;  1KBR A;  1RAO A;  3UDV A;  1EQ0 A;  3UDE A;  5ETL A;  4M5H A;  1RU2 A;  3MCO A;  5ETN A;  3UD5 A;  3IP0 A;  3KUH A;  3MCN A;  3ILJ A;  4M5L A; 
#chains in the Genus database with same CATH topology
 2MKC A;  1A6L A;  3OTO F;  2ZHO A;  2I2Y A;  4YB5 A;  5D0R A;  3CCJ S;  2AEJ A;  2DRA A;  4DV0 F;  1F1B B;  1HBN A;  5J1E A;  2VBW A;  1RZM A;  4OFZ A;  2X1G A;  4Q0B A;  2YH1 A;  2M70 A;  5J2Q B;  3W63 A;  4YQW A;  1SPB P;  2RVJ A;  4F4K A;  2ATL A;  2CAD A;  3L9Z A;  2QMU B;  2WW4 A;  3OVB A;  1S57 A;  2ZUG A;  3BDP A;  2K2P A;  2RDJ A;  5F8G A;  4Y2M A;  1JNR B;  1NH8 A;  3W5X A;  4RNM A;  2VUG A;  4OJH A;  1N56 A;  4NLG A;  3UCZ P;  3SCJ E;  5E3Q A;  4I4B A;  4AUK A;  2XMU A;  1JLB B;  4DG1 B;  3CTR A;  7FDR A;  1VBY A;  4M95 A;  3BBF A;  2VPX B;  2B51 A;  2W1B A;  2RIJ A;  4WJB A;  3T1Y J;  2R7Q A;  2JEF A;  5JXS A;  4DF4 A;  3GZ7 A;  1R43 A;  3RBE A;  3GR1 A;  3KUG A;  2HGM A;  1HNI B;  3R6G B;  3ZFV A;  1PJ7 A;  4U95 A;  5B7W A;  1UEK A;  2KZZ A;  4N47 A;  3D54 A;  3H2L A;  2RB7 A;  4P2F A;  4O0I A;  3D1H A;  1T9U A;  3LP0 A;  4CO2 A;  2HHT A;  2UUB J;  4CRJ A;  3KHR A;  1JK9 B;  1W7W A;  2Z56 B;  1SC4 B;  1X31 C;  1NZA A;  2EK6 A;  1S48 A;  4NXM F;  4M5L A;  2PA3 A;  4ZVP B;  2ZOG A;  4DFM A;  1RYS A;  4JI5 F;  3BJY A;  1OY6 A;  3LOU A;  4XPC A;  3K7R A;  4DUY F;  4KGZ B;  3BQ1 A;  1KBR A;  3R97 A;  3S01 A;  4ED2 A;  1VQO S;  3I9Z A;  3DOM A;  3KLF A;  3R1H A;  4ZLP A;  1MRO A;  2B4U A;  3DRP B;  4ZVE A;  4TVA B;  3OL6 A;  2D3U A;  3MEG B;  4DUT A;  1YLX A;  3NBP B;  1NDC A;  3M9O B;  4RWX A;  3MZI A;  4NLT A;  2W9A A;  1RHK B;  1YK9 A;  4IO9 Q;  4WP8 A;  1KEK A;  1N54 B;  2HBR B;  3U1M A;  5GVQ A;  4YB1 P;  1HQ2 A;  2P5V A;  1EQ0 A;  3HXM A;  1BXN A;  3N9U C;  4I6Y A;  2VV5 A;  3EUN A;  2CPH A;  1H0H B;  2XMV A;  1NHU A;  5KT4 A;  4DR5 J;  2B9Y A;  1GXT A;  4OZ3 A;  3W66 A;  1YJN S;  4HYK A;  4M63 A;  1FNO A;  2GJ2 A;  2GJF A;  3M6U A;  2ADB A;  3GQC A;  5AE3 A;  2F4V F;  3A4T A;  5FJ4 A;  3UN3 A;  5E3P A;  1SL1 A;  2OPP A;  2DRB A;  2AJ4 A;  2AYG A;  1HMV A;  4HI1 A;  5KT6 A;  2E5L J;  2FGC A;  2MXY A;  3BBB A;  4F4X A;  1LWX A;  3A3N B;  2HEK A;  2KYX A;  2RSQ A;  1U2C A;  4I0W A;  3E51 A;  4RNH A;  1QE1 B;  2YWG A;  3MAA B;  2AD9 A;  2CDR B;  4C3M A;  2BX6 A;  4MH8 A;  1RLD A;  1N88 A;  1Y00 A;  4DSK A;  3TQ1 A;  3V6J A;  4JI1 F;  3OLA A;  1RAA B;  5I3P A;  4QR2 A;  3RBD A;  4MKA A;  1FKA F;  3SV4 A;  1O8B A;  1WHW A;  4JI4 F;  1CEZ A;  4OHX A;  3QZ7 A;  1YIJ S;  2B7C B;  2ILY A;  1VBX A;  4U7U K;  1RA6 A;  1IQZ A;  3I56 S;  4OHW A;  2IJR A;  3MR3 A;  3UD5 A;  3OTD A;  1Y5N B;  2XMT A;  3CJ2 A;  4IG3 B;  3AHP A;  1TUG B;  1N36 F;  2NUU G;  1S9F A;  4QWC A;  1KLM A;  3GIJ A;  5ETQ A;  4FF2 A;  3HVW A;  2B43 A;  2FYX A;  3B6B A;  4DL4 A;  1KRP A;  5KFL A;  3BF4 A;  1YBT A;  1GTH A;  4FYD A;  2H9Z A;  4OV6 A;  1URN A;  2DB1 A;  2DGO A;  1NKB A;  1HQE A;  4OHY A;  1N6Q A;  1HD0 A;  3G87 A;  3DLB A;  1N52 B;  2MKI A;  4ILL A;  2UXC J;  4PG7 A;  2ZHA A;  1S12 A;  2R7U A;  1SL0 A;  4CLY A;  4AL5 A;  1NBE B;  1VRT B;  4KYZ A;  2FJE B;  2HHW A;  2GHW A;  4TYB A;  3U27 A;  5J2M B;  2J9C A;  3DRY A;  4KPY A;  4ED5 A;  2V68 A;  3HO1 A;  4EWT A;  3SV3 A;  4NLO A;  1MMN A;  3AOC A;  1HHT P;  2XYH B;  4FF1 A;  4PUO B;  2CJK A;  1LV5 A;  1MMD A;  3LP1 A;  2GA7 A;  3PW7 A;  4ZVH A;  5EDW A;  1RHM B;  1VBK A;  3KJN B;  3HCX A;  2J0S D;  3S6E A;  4UOC A;  4MK8 A;  4HAC B;  4QPX A;  1PCA A;  4W90 B;  1FF2 A;  4LF8 J;  1EIY B;  4UQG A;  3MI7 X;  1KD1 T;  1QDU B;  3GG0 A;  1R89 A;  1KR4 A;  5B0B A;  1WWH A;  1B0T A;  1M5H A;  3AH6 A;  4GMK A;  3FJ2 A;  1QTN B;  5L46 A;  1KQG B;  2A2C A;  2IBK A;  5A6P A;  1NPK A;  4KV8 A;  1SXL A;  3PYD A;  2XZD B;  3EE3 A;  1LWE A;  1ZM4 A;  1NEE A;  4M5N A;  3VVU A;  2OML A;  2ZD1 A;  2AW0 A;  3EGN A;  1SIZ A;  2QL9 B;  2C2O B;  1HNV A;  2VBY A;  3CCM S;  3R8Y A;  1FWL A;  5HP1 B;  2P6S A;  3RR8 A;  4GKJ J;  1WOR A;  1XBW A;  1C1B A;  3FRZ A;  2ZZT A;  5GAD I;  2YNG A;  4M5G A;  1S6Q A;  2F7V A;  4FYV B;  1LFP A;  4PG4 A;  3NAI A;  4YOE A;  3Q83 A;  1HNW F;  2QYC A;  4DV3 F;  2VG6 B;  4DR3 F;  1CJT B;  4K4X A;  3AOB A;  3HUL A;  2QTW A;  4A8W A;  3UN2 A;  2ZH6 A;  2IM3 A;  4X62 F;  1X4H A;  3CSK A;  4JI8 J;  3PRV A;  4GKK F;  2VB6 A;  3DLK A;  4J9V A;  2CQH A;  4JBC A;  2XBP A;  4DU8 A;  1M0S A;  1QLN A;  3PEJ A;  4KO0 B;  2BE2 B;  3QZ8 A;  2IJF A;  1EAY C;  1XR6 A;  5K20 B;  4K4V A;  2OI2 A;  4KFB B;  4IOB A;  1QD1 A;  5F8N A;  2ZBI A;  2NSC A;  4ZOS A;  3IS9 A;  3K89 A;  4IFV A;  4M5D B;  5E3R A;  1N5Y A;  4IR1 A;  1X4D A;  4X4T A;  2MZT A;  3GR0 A;  4U8V A;  2LA4 A;  3KHL A;  4DJB A;  2R42 A;  1ZTT A;  2KI2 A;  1G3O A;  2XSF A;  1YDL A;  3C2P A;  5KG3 A;  9ATC B;  2J7U A;  3MEE A;  2ZEJ A;  4K4T A;  3C6U B;  1WKJ A;  1KON A;  1Y10 A;  1YZ7 A;  3MDF A;  3TJ9 A;  3C15 B;  2KYZ A;  1FEH A;  4QQB A;  5DS7 A;  1RIS A;  4MMO A;  2QZ8 A;  3NMA A;  4CLS A;  1YJ9 S;  4USI A;  2CUY A;  2P2C B;  1WOO A;  3GCW P;  3D6T B;  3PX0 A;  4B3T J;  5SZT A;  1EAR A;  4OYA A;  3TA1 A;  3RAQ A;  5KFH A;  2VDH A;  4Q43 A;  4LSL B;  3TAQ A;  1JB0 C;  3UDC A;  1DLO A;  2LEP A;  1L3S A;  4DPO A;  2NR0 A;  3ZZZ A;  2CQ4 A;  1R8C A;  4RUC A;  3PR4 A;  2ROG A;  1LW2 A;  4PWW A;  2VA3 A;  2CWK A;  2FHJ A;  5B09 A;  5DO2 A;  2VOP A;  5IQ6 A;  3HMJ G;  4ZDN A;  4C8Y A;  5AXN A;  2IVF B;  3CC7 S;  1HI1 A;  2PII A;  5KFP A;  2DNZ A;  3KLI B;  3ZTQ A;  1HBM A;  4GC6 A;  1KQK A;  3CJK B;  4ID5 B;  2H51 B;  1JXV A;  3IGV A;  1HW9 A;  3W5Y A;  3BGL A;  2R2S A;  1Q7Y T;  2VOO A;  1BQM A;  3DN9 A;  3CC2 S;  3WC0 A;  2YNF A;  3P4U B;  4C3K A;  4QWE A;  3G4S S;  1YJV A;  1N5Q A;  2LCW A;  5IT9 Y;  4LFB J;  4HKQ A;  3RG6 A;  3T1H F;  2W9B A;  4JI2 F;  3EXY A;  1LW0 A;  1RWW B;  3V6D B;  1RCX B;  3PFO A;  4K4S A;  2QLF B;  1K0V A;  2KRR A;  3T1A A;  1ULR A;  3F56 A;  3GPA A;  3M2V B;  2UZA A;  3DLL Q;  3V4I A;  2RIL A;  1RTH A;  3GTY X;  5D4L A;  3OW2 R;  3JSM B;  2O3D A;  4D3H A;  1UPM B;  2JOQ A;  4ES1 A;  1H3D A;  2MZS A;  4DL0 C;  3I4P A;  1BHN A;  2E9T A;  4KHR A;  1ZAX A;  3PKM A;  5C5J A;  5M2R A;  1RE1 B;  1UTA A;  1UET A;  1ZAW A;  2X1A A;  5I3U A;  1JJ4 A;  4X4Q A;  1KOH A;  3W2V B;  1D9D A;  2SXL A;  5D77 A;  3U02 A;  1S6P B;  4I69 A;  3MUV P;  1IUJ A;  1Q8B A;  3D66 A;  2YNH A;  3CGI A;  2M4M A;  2HVE A;  4DR2 F;  3TUJ C;  2LQ9 A;  2R2T A;  2B8Q A;  2ZE2 A;  4MTP A;  2J8S A;  3EX7 B;  4NLY A;  3CT9 A;  1U1L A;  2UVR A;  4DEZ A;  2JLF A;  1K1S A;  4WPA A;  2CPI A;  3L7P A;  5KT2 A;  4LQ9 A;  2C3O A;  4M1K A;  4RUA A;  3CDE A;  1QAJ A;  1RBL A;  2DNO A;  4ILR A;  4C8O A;  1U45 A;  1U0H B;  1LQ9 A;  3M30 B;  3JYT B;  3P5T L;  3FMB A;  4P73 A;  2HQI A;  2ROE A;  2X7I A;  5HVF A;  3SCK E;  3DMJ A;  3FGV A;  3NMR A;  2BQU A;  5KFI A;  5DLG A;  4B3O B;  1NDK A;  4AE5 A;  2KFY A;  1BLU A;  2DHH A;  3H59 A;  3ZO7 A;  3TAM A;  3AQO A;  3DLG B;  4NML A;  1F5C A;  4L3K A;  1LK7 A;  2AQ4 A;  4A8K A;  1B7Y B;  5CH7 B;  4ETZ A;  2K8G A;  3GMG A;  1UWB B;  2JH3 A;  3M32 B;  4LFA F;  2C2E A;  4FKY A;  3M9N B;  1VRU A;  2AGP A;  2EFQ A;  3H0P A;  5HVH A;  3VHQ A;  5IM0 A;  1N0U A;  2WCX A;  5AE2 A;  4OHV A;  2UUC J;  5CYQ A;  3QIP B;  1BE4 A;  1JLQ B;  2XG8 A;  3AD7 C;  4ZPD A;  1H2U X;  4M5J A;  3RGI A;  4U67 Q;  3UFC X;  4X66 F;  2W9C A;  2E7W A;  2HFN A;  1ZZF A;  2RUS A;  1T3N A;  2F8H A;  3HHL A;  2DYA A;  2PN6 A;  1LFW A;  3PJW A;  1GAO A;  4M5I A;  4NMX A;  4W4M A;  3NGU A;  1R7I A;  3THP A;  5L1L A;  1NSP A;  4A8F A;  2VC1 A;  4K4W A;  5LXY A;  4NLV A;  1WF1 A;  2CVI A;  2HK3 A;  4TN2 A;  2CVE A;  2ZH8 A;  3FSX A;  2JRS A;  2OIH A;  1UVJ A;  2GX8 A;  2DNM A;  1L3V A;  1VQ5 S;  2FTR A;  2HWH A;  2XTJ P;  3BPS P;  5CYM A;  1WG1 A;  3I0S B;  1RT4 B;  2F4F A;  2Q66 A;  3IRX B;  4DG1 A;  3TAR A;  2PMW A;  2NUH A;  5ETT A;  4NEY A;  4ZHR B;  2HNY B;  2DKO B;  3PXG a;  2G1H A;  5I42 B;  4KSE B;  2CXE A;  1NAQ A;  3DDI A;  5KFA A;  1O51 A;  3BKU A;  2VHG A;  1E6Y B;  1VQM S;  2UXB J;  2DH8 A;  4ZJQ A;  3TVY A;  1OYE A;  5D15 A;  3FCH A;  2M52 A;  5CCL A;  3GIM A;  2BDP A;  2ILZ A;  4DL7 A;  5GAG I;  3MFI A;  1RAE B;  2ZC4 A;  3LP2 B;  1Q82 T;  4BC9 A;  4OQJ A;  3IGN A;  1LWF A;  3T9Z A;  4LFC J;  3JS9 A;  3EGZ A;  2CRL A;  3QGH A;  2C3M A;  4HDH A;  4RW4 B;  4ZP9 A;  1U6B A;  4ECW A;  5C7P A;  2VDI A;  2XGP A;  4K4Y A;  3FFI B;  5JVH Q;  1G6B A;  3GWC A;  2G4B A;  3CF5 Q;  2A3J A;  4NLR A;  4UOG A;  3EIC A;  4OYW A;  3W9I A;  3BH6 B;  5LMN F;  5EWG A;  4DZ6 A;  2JX2 A;  2HWI A;  4DI6 A;  3NEK A;  4JI3 J;  2E5I A;  3MM7 B;  3G6X A;  2DGT A;  2W2P P;  3D9B A;  5EHH A;  4KGX B;  3CD5 A;  4MJK A;  3QT5 A;  3SFU A;  4WBF A;  4IQM A;  5B0G A;  3MEG A;  1FHT A;  3NBP A;  2AJ2 A;  2LDI A;  3E01 A;  1C4C A;  1S9E A;  3V4M A;  3CDB A;  1FTC A;  1VBZ A;  4DV5 F;  2XY7 A;  3AA8 A;  1PIL A;  2RD5 C;  1N33 F;  2AWZ A;  2FLP A;  4DL5 A;  2JL9 A;  4C11 B;  2HRT A;  2MPU A;  5HI7 A;  4ZP8 A;  3RUB L;  3DRS A;  1HKA A;  3RJM B;  4FZV A;  2AT1 B;  1S0O A;  2L3M A;  1KTQ A;  2XMW A;  7FD1 A;  1H7W A;  2A6O A;  4LIW A;  4WP9 A;  2A1B A;  2F65 A;  2WK4 A;  2R3V A;  4Y2I A;  1I94 F;  2ASJ A;  3P3D A;  4ED0 A;  4HH1 A;  2DJW A;  2V0N A;  2CZ9 A;  4DV2 J;  2YKN B;  1RHJ B;  2GJI A;  4H4M A;  4MKY A;  3CME S;  3PJ9 A;  2W7A A;  4KE5 A;  4YR3 A;  3VTI A;  1Q79 A;  2ZBC A;  2I8E A;  1HPZ A;  1SIW B;  1L3K A;  2EKN A;  4L76 A;  2H5J B;  3GIL A;  1RWK B;  2RQC A;  1PAE X;  1FNX H;  2J6U A;  2CPJ A;  4DSI A;  3Q24 A;  2ZC3 A;  2B0G A;  4L73 A;  4NXN J;  2DPJ A;  4O3O A;  5ADZ A;  4J9Q A;  1SKS A;  4ES2 A;  3TWZ A;  2DGQ A;  2ZOF A;  4MYU A;  4ALZ A;  2Q79 A;  3PO4 A;  3IG1 A;  1CJU B;  1QE1 A;  4P7V A;  5T7L A;  5KFT A;  1QSL A;  3TUI C;  3CD6 S;  3ZZY A;  3DRR A;  1N5T A;  3CJ4 A;  4LSN B;  4LF7 F;  2R2U A;  5KFC A;  1IR0 A;  4NYP A;  2WW8 A;  1J5O B;  3QJP A;  4I6A A;  1CC7 A;  3FQL A;  2P9C A;  5DQG A;  4K4Z A;  1UPP A;  2PSZ A;  3CC4 S;  1FD8 A;  3D3B J;  4RW7 A;  3LO3 A;  2LEA A;  2FY8 A;  2NXU A;  3DU6 A;  2ZH5 A;  3NWR A;  1U02 A;  5E7O B;  3W5Z A;  3J81 Y;  5IC4 B;  4R8U B;  1RKI A;  2Q6B A;  6AT1 B;  4NL5 A;  4IG3 A;  1TMM A;  4AND A;  2YY3 A;  1VQ9 S;  3OHA A;  2E7V A;  3KFW X;  2E44 A;  1SV5 B;  3PVX A;  3DU5 A;  1GXU A;  3VGT A;  5CA5 A;  4P2S A;  3VQS A;  1Y9O A;  4Y6I A;  4RW8 B;  2I1R A;  1U6Z A;  3S1T A;  3ZTO A;  2LMI A;  5GAD U;  3IRW P;  4NCG A;  2I38 A;  2OEM A;  4FBT A;  2FJB B;  3G9C A;  1VQY A;  4GO7 X;  5ETN A;  3ZZO A;  2YPZ A;  3R5D A;  4YHH J;  4J9P A;  4QIG A;  4URQ U;  2F8M A;  4LF6 F;  2DR8 A;  1FD2 A;  1F9F A;  4HTJ A;  4FNH A;  2LXI A;  2ZDO A;  2RQ4 A;  2ZOM A;  2OEK A;  2WVB A;  1TEL A;  4HHH A;  3LAN A;  1FXR A;  3QGP A;  3MAH A;  3N79 A;  1KVK A;  4CI0 B;  4JI7 F;  2HFO A;  2GHV C;  3GFX A;  4QYZ J;  5HSP A;  1UVN A;  3W1Y C;  1WUU A;  4C2M A;  4K8R A;  4LVO P;  5J2M A;  3UD4 P;  2AEM A;  2YVS A;  2HRU A;  2FY1 A;  5KFW A;  5KFO A;  4PUO A;  4ID8 A;  1C0T B;  4ELT A;  1S6O A;  2GQ2 A;  4QCL A;  5EWF A;  2HND B;  4QIE A;  3H5S A;  3FC9 A;  4R0E A;  1PYO B;  4HAC A;  2DNR A;  1VR6 A;  4I67 A;  4DPW A;  2XLJ A;  4L72 B;  1RTJ A;  1TAU A;  2YQ1 A;  3US5 A;  3L09 A;  2YX4 A;  5F8L A;  4QU6 A;  4ICL B;  1AYE A;  3F73 A;  2RS2 A;  2M7S A;  4HL9 A;  3OL8 A;  2IC3 B;  1TL7 A;  3AD8 C;  4LMZ A;  1XR5 A;  3NS7 B;  2Y1L B;  3FBC A;  2Q3P A;  3I6P A;  4DCO B;  1XMO F;  5KFY A;  4MK7 A;  5F0W A;  1S97 A;  1QAY A;  3J81 j;  1UJ6 A;  3TNV A;  2R7R A;  1EZZ B;  4PKD B;  5CZV A;  4X64 F;  5G4D A;  4LVN P;  2FHM A;  5EWE A;  2C2M B;  5HP1 A;  5HRO B;  4LRA A;  1VRQ C;  4C4W A;  3BM7 A;  1REG X;  5IQQ A;  5K8P A;  3KXD A;  2CQG A;  5L8R C;  1VS3 A;  2J6S A;  3SQG B;  4LF9 J;  1YJR A;  1RLC L;  1OJ4 A;  1TL1 B;  4JI0 F;  4RO0 A;  1FWK A;  1V3S A;  2BOA A;  2XZW A;  5DM7 Q;  5D8H B;  1CJT A;  3M4X A;  2IYG A;  1M5P C;  1PKU A;  1IBC B;  4I2P A;  2VA2 A;  3GJS B;  2Z2M A;  2AX0 A;  1QTM A;  2EI5 A;  4J9U E;  3GV5 B;  3VAF A;  2D7S A;  5DRK A;  1SVD A;  1TV6 B;  3EPI A;  1HI0 P;  3H90 A;  3E3X A;  2AKW B;  1J5E J;  5HO4 A;  2EK1 A;  1RSC A;  2MQO A;  2V8H A;  3SDE B;  2L41 A;  2OSR A;  4KFB A;  1UFW A;  4J9L A;  4B3R J;  2JWN A;  2ZNY A;  2F8E X;  2PC6 A;  1BMQ B;  3VCD A;  3BR9 A;  4B3S J;  4DSL A;  1HR0 J;  3EVO A;  2VH7 A;  5K14 A;  1YJ7 A;  4OLO A;  2RRN A;  2Y0B B;  3PZP A;  1NRK A;  3MPY A;  3IM9 A;  3JAM U;  5DG8 A;  4A8Y A;  3J7A N;  3C15 A;  3EDQ B;  4K5S A;  4JV5 J;  4DXL A;  3JTP A;  2UXD J;  4KKO B;  5E41 A;  3J7Z T;  2KB2 A;  5B08 A;  2VOD A;  3CJR A;  5J1E B;  2DXE A;  4QYZ K;  4RBV A;  1NKE A;  2XS5 A;  3MGJ A;  4J9K A;  3SYZ A;  3JTO A;  1SQF A;  2H54 B;  5EX3 A;  3PNI A;  3QLH B;  3P5B P;  2OTJ S;  2R7W A;  1IR1 A;  4QOT A;  4DQI A;  2W25 A;  1NLK L;  2VKZ G;  4NLW A;  1DTT B;  3CJQ A;  5F9L A;  1IBL F;  5A2Q Y;  3KLI A;  5DM6 Q;  4FF4 A;  2KM8 B;  5CXT A;  3CJK A;  1QUP A;  1Q53 A;  2IVY A;  1TZ0 A;  3I87 A;  1U8S A;  5E3C A;  4WTO B;  3ET6 B;  5E2Q A;  3ZNU A;  4QYR A;  2XS7 A;  2W4D A;  4USH A;  3CCL S;  4AXI A;  1D9A A;  1AW0 A;  3AA9 A;  4DR1 F;  1BQX A;  2KXF A;  1HNZ F;  2M5Y A;  1P9Y A;  4JV0 A;  2UUW A;  3BO3 A;  1VC5 A;  3M2V A;  5B0D A;  2VBX A;  1K8A T;  1Q86 T;  2DR6 A;  2CNK B;  2BVZ A;  3JSM A;  4CLL A;  2IBO A;  2VPY B;  2HZV A;  3MR2 A;  4G1Q B;  2EFV A;  3W7B A;  4Z2X A;  1V5V A;  4C6A A;  4HVZ A;  4N5S A;  5IWA F;  2XY5 A;  2RQK A;  2HWT A;  2DHA A;  2CG4 A;  2XMJ A;  1WC5 A;  4JI6 J;  5L9X A;  1WEL A;  3SSS A;  2UU9 F;  4Q8F A;  2GAH C;  2WVE A;  1XTZ A;  5J1P A;  2PGC A;  5F9N A;  1OO0 B;  2FLO A;  4KGV B;  5L9N A;  4RU9 A;  1NHK L;  1H98 A;  2DH9 A;  1ZZN A;  3W2V A;  1M90 T;  1FX4 A;  1S76 D;  4C9D A;  1FDB A;  2LP4 A;  1S6P A;  4ZPV R;  2D1C A;  3FCV A;  5C2G A;  2C3P A;  2DY9 A;  1HAR A;  2OD4 A;  5E5N A;  1HNX J;  3LTO A;  2OHD A;  1VQ8 S;  1DQ8 A;  2RML A;  4UQT A;  5GAH I;  1NK4 A;  1TUV A;  4F2S A;  2WHO A;  4AL7 A;  3MHY A;  2RDI A;  4RW6 A;  5JUM A;  1VFJ A;  2FJW A;  4N56 A;  1NDP A;  3D68 A;  2Z4P A;  1X4A A;  3I31 A;  1RWU A;  4TU8 A;  1VC6 A;  3GYX B;  1RAF B;  4BBY A;  1QY7 A;  4R5P B;  1MLA A;  2DNY A;  3JYT A;  4J9M A;  2GV1 A;  4IKA A;  2BJ8 A;  2F9D A;  4C8N A;  1RT6 B;  2V8P A;  3AFG A;  4OJ3 A;  1UKU A;  3H5U A;  2CJA A;  2MJN A;  4DU7 A;  1T03 B;  1S72 S;  4USV A;  1JXL A;  4LF4 J;  2RUG A;  2QA4 G;  4DF8 A;  1UEU A;  1LWC B;  2HK2 A;  4U6P A;  1UWB A;  5GAG U;  4F8R A;  2CNN B;  3M32 A;  1JLA A;  1IM4 A;  1HMV B;  4EGL A;  2BJ7 A;  1FKP B;  2MQN A;  3QAT A;  2ABY A;  4OZN A;  1UA0 A;  3CDW A;  2H4W B;  3IBC B;  1H74 A;  1VHF A;  4DPU A;  3OL9 A;  2VC0 A;  1F6T A;  2XQC A;  1V3R A;  1ZPV A;  3QIP A;  1NKC A;  1JLQ A;  3O3L A;  3D67 A;  3GIK A;  2AF6 A;  1BWE A;  3TZW A;  5KG2 A;  1RAH B;  3QYY A;  4RR5 A;  2NRE A;  3TX0 A;  3CUN A;  1KS2 A;  4B9T A;  3ZXW A;  1N32 J;  3FNN A;  1RCO B;  3V6H A;  1SB6 A;  4A4J A;  1T9X A;  2HIQ A;  3ZZ0 A;  2VQF J;  5FLX U;  2HQD A;  3RAM A;  5DGA A;  3VVT A;  4EYH B;  2V2V A;  1GK8 A;  1D0E A;  4YY3 J;  1KLM B;  1XWL A;  2BW7 A;  2W2N P;  1O6X A;  4OX9 J;  2BW2 A;  4DR4 J;  4NZ6 A;  4P6Q A;  1X7V A;  1WHY A;  2KXN B;  2E7X A;  3RR7 A;  1NXI A;  1RT4 A;  1FVS A;  4LT6 A;  2HKE A;  1HQE B;  1SI9 A;  1N6Q B;  2R7X A;  2CQP A;  4CLP A;  4ZHR A;  2HNY A;  2AGQ A;  5ETV A;  3UNY A;  3RW7 A;  5I42 A;  3LF0 A;  1MN7 A;  3RRK A;  4F7V A;  4C8Z A;  4XO0 A;  1NK7 A;  1Q95 G;  2FVS A;  2NXC A;  1C1C A;  2XI3 A;  3EWG A;  3BQ2 A;  4ITS A;  2UUA J;  4WXO A;  2QIF A;  1FRM A;  3SSQ A;  2VU5 A;  5HBM A;  1CJV A;  2BYC A;  4DSE A;  4MIA A;  2XMM A;  2BQ3 A;  2VQE J;  3FDS A;  3D1O A;  3DKD A;  2XLI A;  4HDG A;  5IV3 A;  3IAS 9;  1FRK A;  4O23 A;  2BKO A;  3N5F A;  5IZH A;  2ACY A;  2QA1 A;  3CCV S;  2LXU A;  3LP1 B;  4RW4 A;  1KFS A;  4B9M A;  1RHU B;  2G2Y A;  3R2C J;  4C48 A;  1S7H A;  2QLJ B;  1TP7 A;  4WII A;  2EEY A;  2AJ1 A;  3UCU P;  4RNF A;  2DEJ A;  1KQF B;  1R27 B;  1J27 A;  3R7S B;  1NB2 A;  1HWL A;  4OYB A;  1XJW B;  2DNN A;  3M8W A;  2WSC C;  3D6M B;  3PG9 A;  4DUZ F;  3AJD A;  4ZCM A;  2DR9 A;  2CKW A;  2CNO B;  3KG1 A;  2XMA A;  3G2X A;  4KGK A;  2XC9 A;  4ED3 A;  5ETL A;  3O8W A;  3KUH A;  2QMX A;  2L9N A;  2XNR A;  4YME A;  2GVD B;  4PCQ A;  5RUB A;  4LRC A;  1ZBT A;  1TR0 A;  1LWE B;  4LRB A;  2LQB A;  2Q43 A;  3HKW A;  3CJ8 A;  1NSA A;  1N5S A;  3I96 A;  5KT3 A;  5B0E A;  3QSY B;  3W65 A;  1YRU A;  1IM6 A;  1KC8 T;  4C11 A;  5BR8 F;  4C7Q A;  4WXW A;  4CO1 A;  3QRQ A;  3BGO P;  4OMF G;  2B8P A;  1CG2 A;  1S6Q B;  2B3T B;  5KT5 A;  4HT7 A;  2DGX A;  1F2H A;  2CPY A;  3TQE A;  4P72 A;  2ZUA A;  1KN6 A;  2DIV A;  4ZIV A;  4ZLJ A;  1TKD A;  1TKT A;  1RT7 A;  4YR2 A;  3D28 A;  3M1V A;  2YKN A;  4J7C A;  2LVW A;  2LA6 A;  4NE9 C;  1GX5 A;  3Q0A A;  3HLU A;  3UO0 A;  3ZTS A;  3IBW A;  1FXD A;  2V69 A;  2OPS A;  1OPZ A;  4Y2C A;  2V2K A;  3Q86 A;  3QAE A;  1T05 B;  4PXC A;  3PR5 B;  3HVA A;  3CPW R;  4RZR A;  2V4J A;  2KHC A;  2DO0 A;  2WOM B;  1OS5 A;  2DO4 A;  1SJ4 P;  4OZ0 A;  2OUG A;  2IA0 A;  2YTC A;  5CD4 H;  2ZDP A;  3DHW C;  2R4F A;  1U1O A;  1WEX A;  2LYV A;  1CJU A;  3IS9 B;  1HIY A;  2ZJP Q;  3WHI A;  3SCI E;  3VGU A;  2M8H A;  4IFV B;  4FF3 A;  1N5Y B;  2RJZ A;  5LSO A;  4IO1 A;  4IH5 A;  1IWG A;  1S1V A;  4LSN A;  1AZS B;  2F63 A;  2HRY A;  3Q8Q B;  2MLX A;  1F3F A;  2VFT A;  1DAX A;  3DDN A;  1R8A A;  2H5E A;  1Q5V A;  2M0G B;  4B9U A;  5BYQ A;  4DR6 J;  2F3J A;  3K5O A;  4UF4 A;  1DAR A;  3H8Y A;  3T5L A;  4R8U A;  5A8W A;  3JSB A;  3OLB A;  1OIA A;  1GMW D;  4DR7 F;  1CSJ A;  2ZM6 J;  3DHX A;  3EMT A;  1WEY A;  4ZCI A;  3CCZ A;  3R5B A;  3KK1 A;  1SV5 A;  1QVF R;  1H38 A;  3JQM A;  2W2M P;  2N3L A;  2RAQ A;  1AFJ A;  3A3O B;  1T0T V;  3RU0 A;  3H5X A;  1DLO B;  1F2G A;  5LSR A;  1EX8 A;  1TMJ A;  4WZM A;  2L08 A;  4YUD A;  1Q78 A;  4DX7 A;  4YEA A;  5DG7 A;  3M6X A;  1VLO A;  2YQ0 A;  4DV4 J;  2UVU A;  1XMQ F;  3BO2 A;  2W24 A;  2DHS A;  2W2O P;  2CPD A;  2MJU A;  4E2F B;  1HQU B;  4PG8 A;  3OFF A;  3CJ0 A;  1KKH A;  3K17 A;  4F3O A;  1HBM B;  3Q23 A;  4KTQ A;  3WX8 A;  4LJM A;  4E8U A;  3V6K A;  1Q4R A;  1V5I B;  1T95 A;  3QSI A;  1KTV A;  2HFZ A;  2YWF A;  4DPY A;  3BGU A;  1GMW A;  4WIQ A;  1RT1 B;  2OJ3 A;  2CDQ A;  1VJW A;  3OVA A;  1C0T A;  4EU0 A;  3IR5 B;  1RAC B;  1WC4 A;  2YNI B;  2HND A;  3MM5 B;  3V4I B;  2X1B A;  2GNK A;  2GO8 A;  3BS9 A;  3W60 A;  4GO5 X;  3R1L A;  2COL A;  5M2U A;  4X4N A;  1PGZ A;  4KHP J;  1TVR B;  3M8Q A;  2PD1 A;  3CWJ A;  1QVG R;  4ICL A;  3PKY A;  4QZV B;  2IC3 A;  2KDO A;  1WDT A;  5F3Z A;  4ZVU B;  5I3U B;  1SUQ B;  1WHX A;  2HFU A;  1PBU A;  4CWB A;  5IT9 U;  1Q7L B;  1VQ6 S;  2IAJ B;  3R3T A;  2O1P A;  1PJ6 A;  4DHV A;  1IN0 A;  4KH1 B;  5KFG A;  1HW8 A;  1S0N A;  3M8P A;  1YG0 A;  5HRO A;  1RDR A;  1SC3 B;  3RBX A;  2BAN A;  1LNQ A;  2B56 A;  2IHR 1;  3I5B A;  1KQS R;  5MLC V;  1Q5Y A;  3W61 A;  1TKX A;  3SQG A;  1NK9 A;  3SIP B;  4X65 J;  3OTE A;  2O66 A;  4NRT A;  1IBK J;  4QW9 A;  2J76 E;  1NSK L;  4H4K A;  4CLW A;  4YR0 A;  3OR2 B;  4EBE A;  1WOS A;  1CVJ A;  1TU0 B;  4L6V 3;  4C98 A;  1UAW A;  4J9O A;  4WYW A;  3CW2 C;  1UVL A;  3HZE A;  1RBA A;  1TV6 A;  3JAM Y;  4NWB A;  4CCH A;  3BYP A;  2HHH F;  1S1U B;  3DLH A;  2RH3 A;  1PSD A;  2QFI A;  1H73 A;  2F9J A;  1UA1 A;  3NCR A;  2HFS A;  3SDE A;  1TL3 A;  3UCG A;  2WTF A;  4Q2L A;  1UW4 A;  2E5G A;  5KFQ A;  4CLK A;  2Y3Y A;  1WHV A;  2NS1 B;  3WIV A;  2GML A;  5J2P B;  1K73 T;  1P6T A;  3T41 A;  2YX7 A;  4ZS6 A;  3MAQ A;  3R2D J;  1IBM J;  3OTB A;  2C3Y A;  4ED4 A;  3U1L A;  1H2T Z;  1Z4U A;  4BHQ A;  3UDV A;  5CYQ B;  4CO4 A;  2XB2 D;  2ZH1 A;  1UFL A;  2IRY A;  3PW2 A;  1WDD A;  3NAH A;  1FX2 A;  4RWW A;  4K4U A;  3GV7 B;  1F3V A;  4ZVS B;  4KHM A;  2PI4 A;  3Q8R B;  3K58 A;  1ZET A;  4CLF A;  2W9C B;  1D09 B;  1S6U A;  4NYO A;  5HN0 A;  1RT3 A;  4KKO A;  4C0B A;  3HHL B;  3NKY A;  1VHI A;  3N6M A;  1B0V A;  2ZBP A;  1VK8 A;  3ZZU A;  1JQG A;  1HBO B;  3GFH A;  1U1R A;  1RAD B;  3JSR A;  5GAE I;  1GXL A;  1S4E A;  1UZD A;  2DEI A;  5HAT A;  3P6Y C;  1YZ6 A;  1ZH5 A;  3QLH A;  2D3O R;  3MMA A;  4ZMM A;  2A0F B;  3FRY A;  3VAL A;  5LL6 d;  2KT2 A;  1TAQ A;  2EFP A;  3TW0 A;  3ONQ A;  4N8O A;  1RTI A;  1DTT A;  5L1J A;  5CYM B;  4NA1 A;  4L3N A;  2CPX A;  3O6Q A;  5M2P A;  2ZJQ Q;  4W92 B;  4NLX A;  4WK3 A;  3EJM A;  3MMC B;  2AZ1 A;  2ZKU A;  1LKZ A;  1NJW A;  1FJG F;  1ZS6 A;  2JNJ A;  2LQ8 A;  3ET6 A;  4Y28 C;  2OD6 A;  3EXC X;  2JC0 A;  1XNR J;  3R5J B;  2HHQ A;  3PM9 A;  4PQU B;  5C24 B;  3MF5 A;  4QR1 A;  4DV1 F;  4AXJ A;  2C3U A;  1M5V C;  1LWF B;  3AJ1 A;  2RDD A;  3FVY A;  2MMY A;  4DL6 A;  4Q7A A;  4UST A;  1S1T A;  2J8A A;  1ZM3 A;  3WBZ A;  4XTT A;  2EWH A;  2HBY B;  2FHK A;  3A13 A;  4RL1 A;  4B02 A;  1NCL A;  4G1Q A;  4CH0 S;  2AX1 A;  2L9D A;  4CNZ A;  4IRD A;  5E0O A;  3CVK A;  2W8K A;  3VAH A;  1EP4 B;  3S8S A;  4Y3C A;  3LA0 A;  4HI2 A;  3FUY A;  1RK8 A;  3T6J A;  3ILI A;  4DCJ B;  2MY7 A;  2V4Q A;  3D5M A;  4RW9 B;  2HHS A;  2B6A B;  1XNQ J;  5IFM A;  3MD3 A;  5D4O A;  5EUH A;  3TVZ A;  1FRL A;  2DHX A;  2XSJ A;  4P9S A;  4OHZ A;  4DV7 J;  4K0K F;  4BLG A;  2D69 A;  3HT0 A;  3E01 B;  3W8P A;  5THW A;  1S9E B;  3MR7 A;  4QWA A;  1KLN A;  2RHQ B;  1DTQ A;  4WFA Q;  2DGU A;  1FE0 A;  3M2R B;  1F0X A;  1NK8 A;  4LF5 F;  1BGX T;  4IYQ A;  4FBU A;  1Z2L A;  1SKW A;  3DNC A;  2MQL A;  4C0O C;  4ECZ A;  3DRS B;  2NQP A;  1YJU A;  1FRH A;  1TKZ A;  4DSF A;  4JV1 A;  3VR1 A;  4R5P A;  2PI5 A;  2GIR A;  2EC2 A;  1RT6 A;  2D3Z A;  1DBD A;  4P10 A;  6FD1 A;  1BD6 A;  4DPX A;  4NEZ A;  1PG5 B;  4H4M B;  1YVF A;  1R8B A;  1T03 A;  4DQQ A;  1UP1 A;  3PW0 A;  2WON A;  4EBC A;  4OX6 A;  1U1P A;  5F8J A;  1HPZ B;  1LWC A;  3CCW A;  8ATC B;  1GX6 A;  4Z7Y A;  2N3O A;  3BH7 B;  5DDO C;  5FLX Y;  1U8W A;  1MWQ A;  4DFJ A;  1FKP A;  1WOP A;  4OYZ A;  2WSF C;  2FLL A;  4JYA J;  1W2I A;  3MMJ A;  2CFX A;  3IG1 B;  4DV6 J;  3HFK A;  5T7L B;  3D2W A;  2GS8 A;  3PAC A;  2XCP A;  5ETK A;  1MU2 B;  3DRX A;  3BQ0 A;  3DRR B;  3EZO A;  3SEO A;  1FRJ A;  1T94 A;  4O3R A;  2XYG B;  4RW7 B;  1GNK A;  1P1T A;  3MWB A;  3GV8 B;  4DX8 H;  2MY8 A;  4WFB Q;  3E2E A;  3DM2 A;  3IBF B;  2DIT A;  3VV2 B;  2E5H A;  1NK0 A;  3POT B;  6FDR A;  1N8R T;  3QGI A;  1YJW S;  1JWW A;  2QT7 A;  2IPO B;  1MWY A;  4NPO A;  3BSC A;  2KVQ E;  4I1T A;  2RU3 A;  1U26 A;  2EFN A;  2MLZ A;  1RBO B;  1NM2 A;  1JNZ B;  2FJV A;  2VFU A;  4ZCL A;  2CQI A;  5A8K A;  3RYL A;  4PG5 A;  3OXF A;  4UW2 A;  2ZIT A;  1Q16 B;  3D1Q A;  3UR0 A;  2AYM A;  1S79 A;  4F4A A;  3OTO J;  4NCG B;  3VAK A;  1VOM A;  4P75 A;  2AYB A;  5DLF A;  4DV0 J;  2EKY A;  5A6W A;  1U2R A;  2K3I A;  3T19 A;  5C42 B;  5KFV A;  2KVI A;  3W3S A;  2WZ1 A;  3FCW A;  1N5V A;  3J81 U;  3QBC A;  3DXB A;  4EZ9 A;  3DOK B;  3FSI A;  3CJS A;  3PYG A;  2MKS A;  4HR2 A;  1SJQ A;  1X9S A;  4ED8 A;  2GO9 A;  3ICL A;  3MEC B;  5BYR A;  3CDU A;  3O1L A;  2B7B B;  3MEK A;  3G8S A;  4ECV A;  2B4O A;  3BPD A;  3HHL C;  2X3G A;  2VJU A;  3WC2 A;  1EET B;  2C42 A;  1UVM A;  3NCP A;  3B54 A;  2DK2 A;  4KT0 C;  2D41 A;  4NAS A;  2QC3 A;  4RX6 A;  3C3L A;  1UJ4 A;  2VG7 A;  1M1G A;  2JLG A;  4O4G A;  4V19 J;  2WB4 A;  1WI8 A;  1DFD A;  3H2U B;  1RTJ B;  2R2R A;  3ENW A;  2NZC A;  3KNG A;  1I5O B;  4NA2 A;  1D8Z A;  1P1L A;  1U1K A;  5E33 A;  4PWU A;  1M1K T;  2FDN A;  3FEY B;  1TQL A;  3LQV A;  3QQC D;  1TL7 B;  5D6G A;  3D7S B;  2GVD A;  4RU2 A;  4NXM J;  1M5S A;  1YKW A;  3ISZ A;  4FN5 A;  2A18 A;  4JI5 J;  3KLE B;  3BSA A;  3FQK A;  1WI6 A;  4DUY J;  4NLD A;  3CIM A;  1RHR B;  5AXL A;  4M5M A;  1VDH A;  4B3M F;  2IRU A;  2ZWO A;  4NOH A;  5DET A;  2W01 A;  1YBA A;  2APO A;  1HHQ A;  4A8M P;  1KVI A;  4ER8 A;  1ZTW A;  2MQQ A;  2CWX A;  2LKZ A;  3MPU B;  2DHG A;  2CQ3 A;  5U47 A;  2YKO A;  1NDL A;  1EKS A;  3HSJ A;  1CUL B;  4LBP A;  5IOL A;  1YSJ A;  5KFF A;  4D3G A;  3ZC4 A;  4F36 A;  3N6N A;  3A12 A;  1D3W A;  2RNE A;  4I2P B;  2OPR A;  4OYO A;  4TKT A;  3MR6 A;  2Z2L A;  1DUR A;  2Y1J A;  4YS2 A;  3RRG A;  1RAB B;  3KDO A;  4Q44 A;  1KP6 A;  5D3G A;  2HYI B;  2GGP B;  1SL2 A;  1T05 A;  1X4F A;  5AJ3 F;  2BXJ A;  4AQY F;  4ETX A;  3A8E A;  2Z8Q A;  3QGG A;  2FVP A;  2WOM A;  2CQB A;  2CQ0 A;  2QL7 B;  3MM9 B;  5CZX A;  3F41 A;  3GU0 A;  1FWP A;  2FHJ D;  4B9V A;  3NNA A;  1NB7 A;  3P49 B;  4K7Q A;  1CBK A;  1E6V A;  4ZVR B;  2F4V J;  1NH7 A;  1T7P A;  1AZS A;  3MR5 A;  5K14 B;  3N28 A;  1RT5 A;  2WBR A;  1G4C A;  4WZQ A;  4LRF A;  5FDL A;  5CQG A;  4OX8 A;  2V67 A;  2MKH A;  2ZVI A;  1ARO P;  4YFU A;  2E1R A;  2OLW A;  4NI2 B;  4MIB A;  3Q8V A;  2BRK A;  5DDR C;  2EXU A;  1T9T A;  3HM9 A;  1ZYQ A;  2AYE A;  1RGV A;  2MZJ A;  2H1Y A;  3N5B A;  1IJF B;  2HBQ B;  4JI1 J;  2VON A;  2IM2 A;  4N77 A;  3ETM A;  4LBI A;  4RBU A;  3W2W B;  5K5M A;  1BY9 A;  3I55 S;  1B0P A;  3EGV A;  4PPZ A;  4NLS A;  4JI4 J;  3A8J A;  4LF2 A;  4WU3 A;  4EEY A;  3VQT A;  4USW A;  4ED7 A;  3TR5 A;  2IYI A;  3GFY A;  3PX6 A;  2G1D A;  1HQU A;  4N7T A;  2VFV A;  5F3T A;  4OYP A;  4FPR A;  3PFE A;  4KJI A;  4WWS A;  5KAK A;  2ZBR A;  1VQS A;  1EKR A;  1S59 A;  1G7C B;  3MPD A;  1U6F A;  3T1Y F;  4RLE A;  4ZVQ B;  3HJV A;  1YBU A;  4OL8 A;  2A10 A;  4O0N A;  3R5C A;  5F41 A;  5K9F A;  1FE4 A;  1IJE B;  1RWP B;  3PIP Q;  2E1C A;  2BA9 A;  1RT1 A;  2HHX A;  4RBT A;  2BM0 A;  5H9E J;  2ZJR Q;  3LAL A;  5J1N A;  2UUB F;  4I68 A;  1VYA A;  1TUW A;  3PIO Q;  2YNI A;  3MM5 A;  3PW5 A;  3I5A A;  1YQH A;  3I0R B;  3W8G A;  3DYA A;  2RE1 A;  4OZ1 A;  2BJ9 A;  2RF2 B;  5A2Q U;  3DOL B;  1G1X A;  4URG A;  4KH0 B;  1TVR A;  3C6T B;  4O3N A;  1ZOT A;  1RP5 A;  4IOC Q;  2H5I B;  2J5A A;  2LFV A;  2FVC A;  1HHS A;  3UDL A;  2AU0 A;  2YPY A;  4TYA A;  1SUQ A;  1SQE A;  2Q1L A;  4A8O A;  1UVK A;  1ZAV A;  3FBF A;  1LEO A;  5DG9 A;  4P2M A;  2IAJ A;  1S0V A;  2XEX A;  2KO1 A;  2DGS A;  1AA1 B;  2VD3 A;  4J9R A;  2WBM A;  1CQM A;  3OUY B;  1NO8 A;  4TY9 A;  5GAE U;  2ZH7 A;  4B17 A;  2JVO A;  4CDI A;  1UZH A;  1WG4 A;  3HJF A;  2KN4 A;  3TRG A;  4RW6 B;  3J80 Y;  1X4B A;  4EFA C;  1XN9 A;  3OR2 A;  2RU9 A;  4Y34 A;  4DR5 F;  1ICE B;  2WB1 D;  3H40 A;  5LXR A;  2BBE A;  3A1Y G;  3HHL D;  1R0A A;  3DI6 A;  1RAI B;  3J7Y I;  4GRS A;  4F0M A;  1S1U A;  2MQM A;  1TK5 A;  4R0J A;  3PCO B;  2ATC B;  2BJD A;  4I7F B;  2GIF A;  4U7C A;  3ISN C;  1HNW J;  3T9N A;  2G13 A;  2FUG 9;  1ZM9 A;  2G2Z A;  4DV3 J;  1VK3 A;  4NCB A;  2HS0 A;  3LUY A;  2VL1 A;  2D74 B;  3UVJ A;  4DR3 J;  1JLA B;  2YWW A;  1ZPW X;  2E5L F;  5H1S V;  3I32 A;  5HQL A;  5J2P A;  2UP1 A;  1RKJ A;  4DS4 A;  5BYS A;  3MTK A;  1PJ5 A;  1JMT A;  2C2N A;  4C3L A;  4P52 A;  2X51 A;  1R6Y A;  4X62 J;  2JDJ A;  4GKK J;  2C2R A;  5DJB A;  4ES3 A;  5HVG A;  5DZ7 A;  1UW9 A;  5I3Q A;  3SQO P;  1RHQ B;  3AOD A;  2JLE A;  4A46 A;  4C8M A;  2YXL A;  4CYU A;  4F50 A;  1XMB A;  3AD9 C;  4W98 A;  3GG1 A;  3D0G E;  3G8Q A;  5D4N A;  2W4C A;  3G96 A;  2X3D A;  1TK8 A;  1O0P A;  1WEZ A;  2OO4 A;  3Q8S B;  1B64 A;  3MCS A;  2VZ9 A;  1HBO A;  2NCK L;  3C14 B;  1FJE B;  4WFN Q;  4JUZ A;  3PJX A;  1H6K X;  1RA7 A;  1RQ0 A;  3K8W A;  3MFH A;  5HLF A;  1Z1Z A;  2GMH A;  3TUZ C;  4NZ7 A;  3VF0 B;  3M2U B;  1FRX A;  4PYD A;  1NPR A;  5HMX A;  2YKM A;  5H9E K;  2YX1 A;  3BN4 A;  4URS A;  4CO5 A;  2B5J A;  3TZY A;  1X4G A;  2AMC B;  2CQ1 A;  4USU A;  3OSN A;  3OXG A;  2ZFH A;  5LJ3 Y;  4A48 A;  1ROF A;  2VIC A;  3MMC A;  2DNG A;  2BAC A;  4R25 A;  3OQ2 A;  2MHN A;  4WFY A;  2UXC F;  1ITP A;  1B70 B;  2V4R A;  4JB8 B;  4QWD A;  4QJV A;  3HFV A;  1FCA A;  2HHV A;  1C1C B;  4PQU A;  5C24 A;  3M8S A;  4FVC A;  2HQF A;  5HBM B;  4P71 A;  1CJV B;  1JIH A;  1NUE A;  2W7P A;  3DC2 A;  3RTV A;  5D0H A;  1EHW A;  1X5P A;  2LXF A;  2PT0 A;  1KFD A;  2M88 A;  5KFE A;  1JX4 A;  1C0U B;  4ZLN A;  3UE2 A;  2OEJ A;  2UV8 G;  4PRF A;  3MPW A;  4DFK A;  1S10 A;  4AL6 A;  5F8M A;  3BBC A;  1EP4 A;  1S77 D;  3K57 A;  4LF8 F;  3T1H J;  1B3T A;  4JI2 J;  3PDN A;  1RU1 A;  4RW9 A;  2W7O A;  3IWN C;  2DIU A;  4DN0 A;  2B6A A;  2CNL B;  5I4M A;  4IR9 A;  2CA9 A;  2AIR B;  2X1F A;  2AP6 A;  2FVR A;  1M5O C;  2QO3 A;  2CJB A;  1V9O A;  1GT8 A;  2DR5 A;  3EZ5 A;  3VAJ A;  2IJN A;  3FKB A;  3G82 A;  2HVZ A;  4HHJ A;  2MGZ B;  4ZN3 A;  1DRZ A;  4CZC A;  2DNK A;  3M2R A;  2C2D A;  1DZ5 A;  2KZM A;  3NWG A;  4GKJ F;  5IS2 A;  4KY3 A;  4RKU C;  3KLV A;  1IKV B;  2J9D E;  2H4Y B;  4KGM A;  3TZX A;  2HUR A;  3D6F B;  4G6V B;  2BAB A;  3E8O A;  1F60 B;  3GYG A;  4DR2 J;  1TKT B;  2YWE A;  1RT7 B;  2G2O A;  3KLG B;  1IVZ A;  2Y8Y A;  3M1V B;  2FB0 A;  5HMZ A;  4C97 A;  2KTQ A;  1PYT A;  2YKA A;  1FRI A;  4QIF A;  3IA0 A;  3M6V A;  2IA6 A;  2MEW A;  4XDD A;  2OPS B;  4JI8 F;  1RT2 A;  4Z37 A;  3O44 A;  4ZK7 M;  2HQC A;  3K0J A;  4KRW A;  4UZC A;  2V4J B;  3OSP A;  5GMD A;  2OEL A;  4XAK A;  4ANC A;  2O67 A;  2QX0 A;  2VF3 A;  3HK2 A;  1HA1 A;  2QGF B;  1REV B;  3ENQ A;  1WC6 A;  2NZ4 A;  5KFM A;  1MU2 A;  4I2Q A;  1S1V B;  2FJD B;  1HWK A;  2QSW A;  4GVB A;  2PE8 A;  5GMK a;  2FLN A;  4ED6 A;  1HBU B;  1NK6 A;  4LFA J;  3JQJ A;  3KG4 A;  4F3Q A;  1WSR A;  4PYA A;  1LK5 A;  3POT A;  3WZ0 A;  5A8W B;  3MCM A;  3B8H A;  3HPO A;  3QWP A;  2GVZ B;  4A8X A;  4DX5 A;  2CZ4 A;  3PV8 A;  4CT9 A;  1FXL A;  1H7X A;  4YB7 A;  1U4B A;  4G3I A;  3W9H A;  1MG7 A;  3KK1 B;  3RB4 A;  3MOJ B;  4HH0 A;  4OLP A;  4B3T F;  1TK0 A;  4OI4 A;  3EYZ A;  4C0H A;  4BWM A;  4IFY A;  4X66 J;  1IKX A;  2FPH X;  3C16 B;  1HYS B;  2FHO B;  2Y8W A;  3GE9 A;  1PO6 A;  1NME B;  2PFF B;  2IM0 A;  2J7W A;  3KUE A;  1FER A;  2R7V A;  3I5C A;  3H5Y A;  5C42 A;  2GIQ A;  2BMB A;  2K7J A;  3ISN D;  4UUX A;  3G71 S;  3DOK A;  2ROP A;  1SJ1 A;  2Z30 B;  2U2F A;  3BGR B;  3RAX A;  4QWB A;  3IP0 A;  1JLC B;  3OD2 A;  1U25 A;  3WQP A;  4PQA A;  1NK5 A;  3MEC A;  2JC1 A;  4A8Q A;  4OZ2 A;  5GME A;  5LMU J;  2OH2 A;  1JXE A;  3LWL A;  2MST A;  2HNZ B;  4TY8 B;  3HI9 A;  4DQR A;  2QEX S;  3MD1 A;  2YWK A;  1UFK A;  2K1R A;  3QJJ A;  2HVD A;  4CTA B;  4LFB F;  2V94 A;  1EET A;  1CS4 B;  1U2F A;  3KHG A;  2LU1 A;  1DQ9 A;  1VQN S;  2CG8 A;  3QT6 A;  1X4E A;  4AD6 A;  3Q89 A;  5KG6 A;  3HDS A;  1QAX A;  2OTL S;  5LT5 A;  1XR7 A;  4ECS A;  1JLF A;  5DQH A;  2MLY A;  1JLG B;  4WKR A;  5ETS A;  3J7Z 5;  5D0E A;  3M8Q B;  4LSZ B;  1Q1K A;  3DGP B;  3PYE A;  1R0C B;  1RWV B;  2HAF A;  2ASD A;  2QG9 B;  1D9F A;  2ZZM A;  2F1F A;  4M94 A;  1APS A;  3QFH A;  5C25 B;  3EPG A;  1PC5 A;  1YIT S;  2H48 B;  3KLE A;  3HSD A;  3A3P B;  3NP5 A;  3GON A;  4WCE Q;  3IWX A;  3CE8 A;  3MCO A;  4ANE A;  5FD1 A;  2NXE A;  1WJ9 A;  2F5G A;  2NYH A;  1T9Y A;  4ZJL A;  2V34 A;  3M8P B;  3T5H A;  2FZG B;  5LMN J;  2BAN B;  1U1N A;  4WP3 A;  3PRD A;  1T3O A;  1TKX B;  3OFH A;  1S1W A;  4TNO A;  1RXO B;  4X4U A;  1P27 B;  3ETO A;  1N0V C;  2RKI A;  1X0F A;  3TJ8 A;  2QA4 S;  4F0K A;  1CUL A;  4X84 A;  3P96 A;  1NHV A;  5LJ5 Y;  1X9M A;  4DV5 J;  3X1L B;  3HVT A;  1RWX B;  1KHV A;  1N33 J;  2E66 A;  1PYS B;  1B7F A;  1Y3K A;  1B4S A;  1V3Z A;  3VZH A;  4ZCK A;  1NSQ A;  4F25 A;  2GGP A;  3VZI A;  2ASL A;  3R27 A;  4OYM A;  1OMS A;  1L3U A;  2N4D A;  4XIU A;  2FC8 A;  2AV5 A;  1HLW A;  1TL3 B;  1YGY A;  3NS5 A;  5AXM A;  1I94 J;  5G0R B;  3MM9 A;  2J7K A;  3TA0 A;  4LR9 A;  5LOQ A;  1O5J A;  2E9R X;  2HHU A;  1KOO A;  2ALY B;  4ENO A;  3IM8 A;  3IWL A;  4NRU A;  3NXZ A;  3PHT A;  4IDK A;  3NGT A;  2LEB A;  1YRT A;  3ELH A;  3K5N A;  3R7B B;  1FA0 A;  2EPI A;  2OGU A;  2MQP A;  4B08 A;  4E0D A;  1DJ0 A;  1I6J A;  2UUC F;  4C8L A;  3R5A A;  1WTF A;  1T11 A;  1SH0 A;  2CAJ A;  1WC0 A;  2KT3 A;  3SMZ A;  3IFE A;  2CQ2 A;  4NI2 A;  3H4B A;  3OJU A;  4C8K A;  1AB8 A;  3SFG A;  5KG5 A;  4OI6 A;  3AT1 B;  3C46 A;  2R8J A;  3ITH B;  5IV4 A;  1RT3 B;  2XUL A;  3KWM A;  4AT1 B;  4WTY A;  2QLB B;  2FZK B;  4F02 A;  3CXC R;  2BE9 B;  4LF7 J;  1VGY A;  4H4O B;  3SSR A;  4P7T A;  4DS5 A;  3MM8 B;  1UCN A;  3W2W A;  1U24 A;  2BM1 A;  1GQE A;  4EK2 A;  3KK3 A;  4UZB A;  1VMB A;  1SKU B;  4CP5 A;  4EYI B;  3MMA B;  3P45 B;  4DOZ A;  2P6T A;  4PXD A;  4TU7 A;  1RTI B;  4X4O A;  3THT A;  1HL6 A;  1VI7 A;  3ZTP A;  3IC1 A;  2OPQ A;  1L3T A;  2LEC A;  3ILL A;  1R8H A;  4U7U D;  4BDP A;  3QFW A;  3K5P A;  1FT8 A;  1K47 A;  4ERD A;  2MSS A;  4DLE A;  1S5Z A;  4I56 A;  4ZP7 A;  2UXB F;  3J7Y U;  4UOH A;  1HFE L;  2ZZN A;  1CJK A;  4F2R A;  4J91 A;  2JSX A;  2DRD A;  2HAI A;  3KDN A;  3ENA A;  3M05 A;  4TXS A;  4X2B A;  5K8O A;  3NGR A;  1T9W A;  1HWJ A;  3KLH A;  1WTB A;  5HAN A;  4LF6 J;  2D3O 1;  1A9N B;  1BQN B;  2V6A A;  4LFC F;  4LUB A;  3LGM A;  3HSZ A;  5ETO A;  1WF0 A;  3I0R A;  1NJY A;  4CLZ A;  1VQK S;  4ZIT A;  1S1T B;  1K1Q A;  4ECY A;  4RPF A;  4JI7 J;  5AE1 A;  2RF2 A;  3HD2 A;  3DOL A;  4YN3 B;  4BCA A;  5DZ6 A;  1EQM A;  2F40 A;  4YB6 A;  2DBB A;  3C6T A;  4OJ1 A;  3T3F A;  3G6E S;  2QL5 B;  4KB7 A;  1Y5L B;  4KAI A;  3GJQ B;  3NY0 A;  4F67 A;  5H9F J;  3KG0 A;  2DXF A;  4M5K A;  5KFN A;  2DXD A;  4F0H A;  3OXL A;  4JI3 F;  4RUB A;  1RAO A;  5D4P A;  2XSJ B;  4NLQ A;  3RB3 A;  3NLC A;  4QIW D;  3NCQ A;  4PXE A;  2XI2 A;  5LM7 E;  1IKW A;  3I4H X;  2KHD A;  2HMI A;  1F9E B;  3OUY A;  3LGH A;  2PMZ D;  1UL3 A;  2NPI A;  3C8Y A;  1QM9 A;  3IR6 B;  2ZH3 A;  2C1E B;  1DTQ B;  4LR7 A;  3BKF A;  3UR3 C;  4KPC A;  3DLE A;  3OR1 B;  3HHK A;  4FS1 A;  4UY8 5;  3HF5 A;  2LU2 A;  3ULH A;  1YX2 A;  2AJ0 A;  3V81 B;  4ECQ A;  4OI3 A;  2XYP B;  1MN9 A;  2LQ5 A;  1XMO J;  2CJX B;  3NS6 A;  1TKZ B;  3NGK A;  4F04 B;  3CNQ P;  4MKB A;  1NND A;  2PA8 D;  3LAK A;  4X64 J;  2KRB A;  4DMZ A;  4ZJO A;  4LRE A;  3OL7 A;  3TZZ A;  3RW6 A;  4DV2 F;  3HVR A;  3TA2 A;  3ADA C;  1V6H A;  3ILJ A;  4LR8 A;  4ZKA A;  2WON B;  4I7F A;  4EO8 A;  4JI0 J;  3PO5 A;  1XC9 A;  4O44 B;  3RRH A;  4CT8 A;  4ECU A;  3GSI A;  2VBZ A;  4NXN F;  3FBE A;  3QJL A;  3QPI A;  4B9L A;  2DNP A;  4PWD B;  5KT7 A;  1WG5 A;  1J2V A;  3Q8U A;  1FDD A;  1MML A;  4L74 A;  1D1U A;  1QSS A;  4QIV A;  1I3O B;  5D78 A;  1JKH A;  3QO9 B;  5KG7 A;  3GIR A;  4DCP B;  4G1I A;  4H4K C;  2IDL A;  1XEZ A;  2NXN A;  3D0H E;  1FFS B;  4FDF A;  3DM2 B;  8AT1 B;  1S1X B;  3TYT A;  2GW8 A;  3MM6 B;  4MFB A;  4ZVG A;  2CZV C;  1P9Q C;  3GP9 A;  4K2X A;  4ECR A;  4WU2 A;  1OY8 A;  3C14 A;  2UVW A;  2G0C A;  2VG5 B;  2HZA A;  4BWJ A;  3OFG A;  1YHQ S;  2E1A A;  3T5K A;  1S0M A;  4ATN A;  3M2U A;  2DIS A;  2QFJ A;  3EZU A;  2JFD A;  2BOP A;  1FO1 A;  5A8K B;  1YRX A;  1KHW A;  3M6W A;  5L39 A;  2E1M C;  2HVI A;  3CB4 A;  1U1Q A;  5ETR A;  4CIO A;  2HIY A;  4OI2 A;  4PAA A;  3WIU A;  3PTW A;  4YHH F;  1L5U A;  2EG1 A;  4YDD B;  3BO4 A;  5J2Q A;  2DCU B;  1FJC A;  2W8L A;  2GC8 A;  1IR2 A;  4MIW A;  5H9F K;  2CQD A;  4LBH A;  3CMA S;  3H2V E;  3HX9 A;  2MDA A;  3OHB A;  3EM1 A;  2HGL A;  2D9P A;  3H98 A;  3LPE A;  5HMW A;  2DGV A;  5LMU F;  1RB0 A;  3B4D A;  2DNQ A;  2ZH2 A;  2KL8 A;  1IBL J;  5HJY A;  1FEE A;  1JLB A;  3D3C J;  5D0G A;  1C0U A;  2V5H G;  4HLB A;  2PDA A;  3NRB A;  3I82 A;  2CJ9 A;  2DVI A;  1HNI A;  5E3A A;  4X4V A;  2J9E A;  1WC3 A;  2VG7 B;  2RT3 A;  4O4G B;  2XWY A;  2O5D A;  2VPZ B;  3EVM A;  3KJQ B;  3ENV A;  2MB0 B;  4YDX A;  2WVF A;  4PPD A;  5A8R B;  4WYL A;  4DR1 J;  3UNG C;  1HNZ J;  3CO0 P;  5CAB A;  4J90 A;  3KMS A;  4XDC A;  5L38 A;  3RZA A;  2GFF A;  2FC9 A;  2RRB A;  5KFU A;  2KM8 C;  1UJ5 A;  2MZQ A;  1ACM B;  3HHD A;  1ZA2 B;  4AFF A;  5DDQ C;  5IWA J;  4FXV A;  1T02 A;  1FNM A;  1GTE A;  1AT1 B;  3Q2T C;  2MGZ A;  4PXB A;  2CPE A;  2UU9 J;  3G86 A;  2MTL A;  5KOX A;  2XLK A;  4X4P A;  4XK8 C;  3B82 A;  1IKV A;  2VPW B;  4M8L A;  2ERR A;  4Z7C A;  3AY0 A;  4MKV A;  3DRP A;  3NOG A;  4IOA Q;  4LF9 F;  2P8I A;  3BKT A;  3CJ5 A;  1FKO B;  3M8R A;  1PBA A;  3KLG A;  1W25 A;  2O01 C;  1FK9 B;  5KFK A;  1MSW D;  2KJW A;  5KG1 A;  2OPR B;  5A0Y B;  1UEV A;  3MTJ A;  3HHN B;  4USK A;  3V5R A;  2L9W A;  3KK2 B;  2Y1I A;  5D3G B;  2U1A A;  1N34 J;  5B0F A;  3BGF A;  4J9S A;  1J5E F;  2ACM A;  2MYF A;  2XWX A;  3KJF B;  4WE1 B;  3MMB B;  2M3D A;  1FFW B;  3BZQ A;  4MK9 A;  4L75 A;  2QE5 A;  4V1A k;  4B3R F;  1REV A;  2A6M A;  3CMQ A;  5IC6 B;  3A8I A;  2R8K A;  1E6V B;  2IIH A;  1JLE B;  3QRR A;  3GFZ A;  4B3S F;  3DDK A;  4OI1 A;  3ZZP A;  1HR0 F;  2R8I A;  4K50 A;  3H20 A;  1RT5 B;  3ZZT A;  4F4W A;  5FDL B;  1Y3J A;  3M9M B;  1YTY A;  2HLT A;  2NSB A;  3ZZR A;  2XO6 A;  1HBU A;  1CQN A;  2EVZ A;  2MKY A;  4P2X A;  4KC5 A;  4LQ3 A;  2JEJ A;  1F9H A;  4NLP A;  1BWV A;  4I6W A;  4Y0F A;  1KSP A;  4JV5 F;  2GVZ A;  1RI7 A;  3PEH A;  3AAW B;  3BYR A;  3MAA A;  2UXD F;  4DPT A;  2HQ3 A;  3GSD A;  3QT7 A;  3KMQ A;  3Q2S C;  1VJQ A;  4PZV A;  3IR7 B;  1AUD A;  4ZVT B;  4WFX A;  1RU2 A;  3D6H B;  5KG0 A;  2BKN A;  3VWS A;  2MKK A;  2UV8 A;  1IWA A;  2N4C A;  1OYD A;  3C16 A;  1HYS A;  4IUF A;  2VKR A;  3GB0 A;  1NJX A;  3JQK A;  2QMW A;  4CH1 A;  2LLZ A;  3GLJ A;  2VAS A;  2JHE A;  1NJZ A;  3BR8 A;  1MW7 A;  3BGR A;  3QID A;  1C4A A;  5L1K A;  2BJ3 A;  2EBE A;  2JVR A;  1JLC A;  2OFG X;  2OKQ A;  2OP5 A;  1T9V A;  2IMW P;  1XER A;  1CPZ A;  3ZTR A;  3LAM A;  3SZ2 A;  2D9O A;  2HNZ A;  4TY8 A;  4CTA A;  4DZD A;  3TOQ A;  1HI8 A;  4DBQ A;  1CS4 A;  1LXJ A;  3K59 A;  3TJA A;  1R6V A;  4TQR A;  1D8Y A;  3QMQ A;  3CCU S;  2VFS A;  2QV6 A;  1NZ8 A;  4EMD A;  3KJV B;  3AB2 B;  1Z2Z A;  5IXU A;  1SQG A;  1W26 A;  3DYA B;  5KFJ A;  2C2K B;  2FVQ A;  3AXM A;  2B4P A;  1JLG A;  2J0Q D;  2J9D A;  1N4L A;  3KTQ A;  1DQA A;  1VRT A;  5F0U A;  4K59 A;  1FES A;  1RTD B;  4OZJ A;  3HP6 A;  2DNL A;  3JXO A;  4JP8 A;  2YH0 A;  3UPF A;  3DGP A;  1SBR A;  3C19 A;  4JI6 F;  4USJ C;  1K0T A;  3BSO A;  5DDP C;  2DCL A;  5C25 A;  2I5J B;  1IKY B;  1NU4 A;  1OPI A;  1VLY A;  1R8P A;  2DY1 A;  5SUH A;  5J2N B;  1PIE A;  4RUH A;  2ZHB A;  3UD3 P;  2CQC A;  1Q8I A;  5DQI A;  1FDA A;  3BN7 A;  3NNC A;  4OZ5 A;  2ASY A;  1PC4 A;  3T6B A;  4DUZ J;  1HNX F;  3CD7 A;  3R5G A;  2E29 A;  4PR6 A;  3TEH B;  2LDY A;  2P9E A;  3OPK A;  2GCF A;  2M8D B;  3CCS S;  4WF9 Q;  3OFE A;  2WSE C;  2IRX A;  3LWM A;  4EI2 A;  5HJX A;  4CLT A;  4WFZ A;  2QLW A;  2IMO A;  1T8E A;  4A47 A;  1X5T A;  1U0S A;  3HSG A;  2KKH A;  5IT0 A;  5BR8 J;  1OWX A;  3MED B;  1R0A B;  3DI6 B;  2JEI A;  4IG0 B;  2BJ1 A;  1Q8K A;  3FEX B;  5ETP A;  2QRR A;  1LOU A;  1Y0H A;  1RWM B;  2MQ8 A;  1JJC B;  4FYX B;  3KOA A;  1A0O B;  3ZNJ 1;  4FS2 A;  2EBG A;  4LF4 F;  5G0R A;  2YQ3 A;  1GMV A;  3UVJ B;  3I9V 9;  2HS3 A;  2VG6 A;  1IXK A;  2OFH X;  2GQQ A;  1WF2 A;  4O3Q A;  1S99 A;  3MUR P;  3KHH A;  1SJF A;  2V8G A;  1ZA1 B;  3GCX P;  2XM3 A;  3GYN A;  3J80 U;  3HFZ B;  5KTQ A;  2FJX A;  3NGS A;  2BZ2 A;  4NZ0 A;  3UN5 A;  1K9M T;  4KO0 A;  3K5M A;  2BE2 A;  2KG1 A;  4CYU B;  1Q8L A;  3M7V A;  1VIS A;  3O2I A;  3X3U A;  5CCM A;  3ITH A;  1N32 F;  2RRA A;  3DXS X;  4M5D A;  1X5O A;  3D4J A;  5BJR A;  1WKL A;  1M5K C;  2R8G A;  4BC7 A;  3AB4 B;  2VQF F;  4FPI A;  4H4O A;  1BC6 A;  3MM8 A;  5HLF B;  1FDN A;  3QNW B;  2WVC A;  1F5A A;  3NNH A;  3Q8P B;  4N8N A;  1VQ4 S;  3LW5 C;  4TLR A;  2BUN A;  4YY3 F;  3DGV A;  3L3C A;  3C6U A;  2YKM B;  1SCJ B;  4TQS A;  3F0N A;  4OX9 F;  4X4S A;  3MUM P;  4DR4 F;  2BQR A;  1HWI A;  2JZ5 A;  1CC8 A;  1S9G B;  3NG8 A;  2QLX A;  5C2C A;  3N0V A;  4DR7 J;  4Q2M A;  5GAH U;  2XGQ A;  4H54 A;  2B5J B;  4KR0 B;  5HQM A;  1QUV A;  4FYY B;  1HBN B;  2UVV A;  3R6L B;  4Q0B B;  5HL7 Q;  3AQP A;  2HFV A;  3K5L A;  2LQJ A;  3TEG A;  1VIX A;  3TUP A;  4LSL A;  1GH8 A;  1TFY A;  3H4D A;  1WNE A;  1SH3 A;  4Q45 A;  3BB5 A;  4KIA A;  4OI0 A;  3JSY A;  2RS8 A;  3IO1 A;  4Y2K A;  4U9R A;  4DQP A;  4OZL A;  3Q8Y A;  2UUA F;  5KFD A;  1IQT A;  2K06 A;  1XMQ J;  1H2V Z;  3CIZ A;  4AYB D;  1UMJ A;  3T5J A;  2VQE F;  2A2D A;  1BQN A;  4CNY A;  1WKK A;  4LF1 A;  2H3E B;  2VIH A;  4J9N A;  3N6L A;  4WKY A;  1U1M A;  4ID5 A;  2KH9 A;  2ZWP A;  4O3S A;  1QSY A;  5CYJ A;  4UTG A;  1OSD A;  3MXH P;  2YWH A;  4CQ1 A;  4S0M A;  1XIQ A;  8RUC A;  3W9J A;  4RJV A;  3LP0 B;  3UI3 A;  5T14 A;  3V6D A;  2J0X A;  2GZO A;  4U96 A;  4CO0 A;  4QPT A;  4Y00 A;  2H65 B;  5F8H A;  2AZ3 A;  2AGO A;  2Z0G A;  2KT5 A;  4ZVO B;  3FSY A;  3BDE A;  3RB6 A;  7AT1 B;  3CCE S;  3TI0 A;  3HZG A;  3D0I E;  3H25 A;  4N76 A;  2DD8 S;  2CPF A;  3G82 B;  3AJ2 A;  3VAM A;  2QSF A;  2ADC A;  5HMY A;  3DOM B;  3KLF B;  3OR1 A;  2FGO A;  2VFR A;  5AXK A;  1AUS L;  1S4F A;  4U8Y A;  3V81 A;  1MRO B;  4X4R A;  2V2Q A;  4OX7 A;  4IH6 A;  2UUT A;  4XPE A;  2HBZ B;  3LPY A;  4NX9 A;  2XO7 A;  2R7S A;  5JJB A;  4ECT A;  3UWT A;  3FMW A;  2PO4 A;  4IRC A;  2W2Q P;  2V9K A;  4I64 A;  2OSQ A;  2FIU A;  4P74 A;  1SH2 A;  4DLG A;  1RT2 B;  1N34 F;  5AT1 B;  4QR0 A;  4IQX A;  5A76 A;  1U49 A;  4O44 A;  2Q6C A;  3R9L A;  3PX4 A;  4IH7 A;  1U0H A;  4B9S A;  4UOF A;  2EFG A;  2HQG A;  2EFO A;  2HZC A;  1WSV A;  3M30 A;  4PWD A;  4MYT A;  2IFX A;  2R7O A;  2Z58 B;  3L95 X;  3BEG B;  2OAU A;  4B3O A;  3CED A;  2HHH J;  1HD1 A;  3F44 A;  1SKR A;  5L1I A;  3W62 A;  3DLG A;  4I2Q B;  3PRB A;  3QRP A;  4B9N A;  2GQC A;  4GVB B;  1GEH A;  1U48 A;  3B78 A;  2Z2Y B;  2BR0 A;  3QO9 A;  2N82 B;  3H42 A;  2XHW A;  5JVG Q;  1QJH A;  2OPP B;  4HEA 9;  4DR6 F;  2JFK A;  4J5O A;  1NJI T;  1H72 C;  2I6W A;  3P8B B;  4EBD A;  1S1X A;  2XHC A;  3MM6 A;  5BXI A;  1TL4 A;  2Y0S D;  2ZM6 F;  1X4C A;  2VG5 A;  4DL2 A;  1YI2 S;  2DT9 A;  2FQQ B;  3MPV A;  5T41 A;  3OBI A;  3NOC A;  1VQP S;  2ZH9 A;  2BKP A;  4RNN A;  3Q22 A;  1SC1 B;  2HGN A;  2YKQ A;  4HHU A;  2PFD A;  2IDE A;  3CUL A;  1DHM A;  4FXW A;  2FD2 A;  2B9E A;  2QA2 A;  4IFY B;  3JTN A;  1IKX B;  4G65 A;  2M2B A;  2DNH A;  4DL3 A;  1SJR A;  3TAP A;  1JJH A;  3THV A;  4Y2A A;  1FJ7 A;  4DV4 F;  4FXD A;  3L4B C;  4FVM A;  2KFN A;  2NPF A;  2R9L A;  3R7N B;  1B99 A;  4A8S A;  3BRE A;  3GJR B;  1TTH B;  2E1P A;  3OJS A;  2HS4 A;  4EUV A;  1FI4 A;  4QBU A;  2WAQ D;  3L7U A;  4E98 A;  3I0S A;  2B4V A;  4CM2 A;  3IN5 A;  3IRX A;  1RJJ A;  2K3K A;  2K1R B;  5KFR A;  1LXN A;  3PY8 A;  5KFB A;  1YWX A;  3NGD A;  3GJT B;  2WRM A;  1Y7P A;  3LGN A;  1RWN B;  1EJ7 L;  1OY9 A;  4HTI A;  1FJG J;  3A8K A;  2MZ1 A;  2QYG A;  4NA3 A;  2KXH A;  3SI8 A;  1E6Y A;  4UY8 T;  4ZLL A;  2WVD A;  3QT8 A;  2XZT B;  4QU7 A;  3G6V A;  1MWZ A;  2Z57 B;  2IM1 A;  1JLF B;  2JEG A;  3PYF A;  4EO6 A;  1RUS A;  2J6T A;  4DV1 J;  5A8R A;  4KHP F;  1I51 B;  3LP2 A;  4JOU A;  2QN6 B;  3S7R A;  2I9S A;  2NYI A;  2HW3 A;  3UDE A;  2N7Y A;  1XK8 A;  2RHS B;  3V2U C;  3IXQ A;  4V19 X;  2DH7 A;  4ZPW R;  1RYR A;  2ALZ A;  1R31 A;  3SBM A;  2CJY B;  3VGV A;  2KFZ A;  3FFI A;  3TO8 A;  4N41 A;  4DFP A;  4PAB A;  2HHP A;  5ITH A;  2XS2 A;  4BS2 A;  2CPZ A;  2C22 A;  1SJ3 P;  4J37 A;  1RTZ A;  4DDF A;  2MZR A;  2G0I A;  4ELU A;  4ZA1 A;  5IT4 A;  3MM7 A;  1Y11 A;  4DN9 A;  2P9G A;  2V2Z A;  5DGB A;  2BV3 A;  1S1W B;  1C2P A;  2G0J A;  4X65 F;  2GMJ A;  2CJQ A;  4K0K J;  2HSE B;  1A7G E;  3CD0 A;  1PAU B;  2N7C A;  1IBK F;  2RKI B;  4Q5V A;  4KV8 B;  1FKO A;  3BSN A;  5MAO A;  2V50 A;  5CD4 A;  1R3N A;  1RAJ A;  1FK9 A;  2ZD1 B;  4Y65 A;  3FZ2 A;  4NLU A;  3HVT B;  2AJF E;  3CCQ S;  1HNV B;  3J7A 1;  3GII A;  5A0Y A;  3HT3 A;  2R8H A;  4LF5 J;  3CO9 A;  3KK2 A;  2ZH4 A;  2AJQ A;  1KVJ A;  1C1B B;  1KWM A;  2YNG B;  3MOZ A;  4CO3 A;  4HT5 A;  1S49 A;  4MT1 A;  1TL5 A;  1VQL S;  4WE1 A;  5F8I A;  4KQZ A;  3MMB A;  3AXK A;  2L48 A;  2E9Z A;  2AHO B;  2XMK A;  2V63 A;  4LIR A;  3N01 A;  1NPP A;  3WDO A;  3OT9 A;  3VGS A;  3IMQ J;  1URR A;  2GAG C;  3MCN A;  4IDK B;  1I1G A;  3WX4 A;  1AFI A;  3RBZ A;  1JLE A;  3DCA A;  1IBM F;  1WC1 A;  5JMN A;  2CIM A;  2PMH A;  1VQ7 S;  3DLK B;  4M5H A;  4O3P A;  2HPU A;  2XCA A;  2BJE A;  5KOW A;  3NL0 A;  3KYL A;  5KFS A;  2VJV A;  2EW9 A;  3CCT A;  4GC7 A;  3EGW B;  3TP2 A;  1SC6 A;  3JB9 k;  5K8N A;  1DY3 A;  4LRD A;  3UW1 A;  2NXJ A;  3ILO A;  3U7J A;  4CH7 A;  1J5O A;  2XY6 A;  5EN1 A;  4G1P A;  2V9W A;  2FJA B;  1QAI A;  4DWI A;  3MEE B;  3KK3 B;  5K8M A;  3G6Y A;  4WK1 A;  1CLF A;  3QAU A;  2IY5 B;  4FNI A;  4K2J A;  1VIO A;  1U47 A;  2W4P A;  2XNQ A;  3U1N A;  3PW4 A;  3CJ3 A;  4ECX A;  2OPQ B;  1N36 J;  3FEZ A;  3OTC A;  1R0B G;  3SCL E;  2BRL A;  3PHE A;  3HD1 A;  3BV8 A;  3G8T A;  2ZKT A;  3L7O A;  1RWO B;  4RW8 A;  1JJ2 R;  1ELO A;  4RNO A;  2ZNZ A;  1RAG B;  1N48 A;  1KNZ A;  1CJK B;  3O5T B;  1LW2 B;  1XNR F;  2CYY A;  2AEF A;  1P8G A;  1TFW A;  1VCT A;  3KLH B;  4ED1 A;  3M8Y A;  3K2Y A;  4OYX A;  3CDA A;  3HHE A;  4FYW B;  5FII A;  3KJV A;  2B9X A;  2I0X A;  2RQM A;  4FKX A;  4CLU A;  2KG0 A;  2K7K A;  1XQI A;  2DTJ A;  2Z2Z A;  4OJG A;  1W2B R;  1KDN A;  1BQM B;  1U09 A;  1RTD A;  2YBV A;  2YNF B;  2KU7 A;  1WAC A;  3M8Z A;  3C66 A;  3HKZ D;  4F3M A;  2FZC B;  2W9B B;  3FZB A;  5EX0 A;  1LW0 B;  3FBB A;  2G9O A;  1EB0 A;  2R7T A;  2I5J A;  1IKY A;  4ILM A;  4ZP6 A;  1XNQ F;  2OMO A;  3TAN A;  2J0W A;  2MHE A;  4PEO A;  1RTH B;  5J2N A;  4UUW A;  4GVL A;  2V8V A;  4DV7 F;  1OSC A;  2PEB A;  4ZPB A;  3K8V A;  4DQS A;  2POK A;  1VC0 A;  1IKW B;  4PG6 A;  1ZM2 A;  4YP3 A;  4ZIW A;  2HMI B;  4OIX A;  5CAA A;  2V8D A;  4ZPT R;  1X9W A;  4FP9 A;  5KFZ A;  1UVI A;  2C28 A;  2BE7 D;  2IVM A;  3OVS A;  2MKJ A;  3DLE B;  2B9W A;  4F4Y A;  3AOA A;  3IAM 9;  1UWA A;  4TLQ A;  4QW8 A;  1X0P A;  5LSL A;  2YKP A;  5HAO A;  5EGY A;  4ZN1 A;  2C2Z B;  1X8D A;  3H7H B;  4IRK A;  1Q81 T;  3KKF A;  5ETM A;  2HVH A;  2YNH B;  4B3M J;  3LH2 S;  9RUB A;  2DPI A;  3QWU A;  4TU9 A;  2Y1R I;  3MED A;  1BUX A;  3UQS A;  2ZE2 B;  4IG0 A;  1Y4Z B;  1WD6 A;  5B0A A;  3DLJ A;  1FVQ A;  3OV7 A;  1GMU A;  2GHP A;  5KFX A;  4CM0 A;  1G2E A;  4EZ6 A;  1TL1 A;  2M9K A;  3VAI A;  1Y5I B;  4NYZ A;  4O4R A;  3MUT P;  2DGW A;  2Y9H A;  3SXL A;  2EC0 A;  2KJV A;  4JV2 A;  4NCA A;  4JYA F;  2PEH A;  2E5J A;  4F26 A;  4UT4 A;  5B0C A;  1FFG B;  3DMJ B;  3FK4 A;  2DR7 A;  4OV1 A;  1U7L A;  4DV6 F;  4ZPA A;  2ZBQ A;  3RB0 A;  3EVW A;  5AJ3 J;  1S7I A;  4AQY J;  3B4M A;  3TAM B;  1AXQ A;  1YJT A;  3CJT A;  1F5B A;  3W64 A;  4ELV A;  4F4Z A;  4K5R A;  3KNA A;  3VAG A;  1JKH B;  1GFW B;  2NLW A;  2HLU A;  3TX8 A;  1X60 A;  1X5S A;  2JJ4 D;  2ZVS A;  2QJ3 A;  1M1H A;  1OQ6 A;  1FTR A;  1VRU B;  4MFB B;  4DX6 A;  1HWU A;  4ZVF A;  5HQ8 A;  3DFE A;  1K44 A;  5KG4 A;  5IM0 B;  4KBI A;  3CCR S;  3N4W A;  3TVK A;  4ZPC A;  5CHC B;  4Q8E A;  2EG2 A;  4USM A;  4MAK A;  4OYI A;  2HG4 A;  5HK4 A;  3EDR B;  1MNE A;  1Q0N A;  1OQ3 A;  4DSJ A;  1S9G A;  2BEF A; 
#chains in the Genus database with same CATH homology
 4M5M A;  1DY3 A;  4M5K A;  5ETV A;  1EX8 A;  5ETM A;  1IM6 A;  1TMJ A;  1TMM A;  2BMB A;  3HD2 A;  5ETK A;  2F65 A;  3HT0 A;  3ILI A;  1CBK A;  3HSG A;  5ETS A;  1RB0 A;  4F7V A;  3QBC A;  3HSJ A;  5ETR A;  3ILO A;  1EQM A;  2CG8 A;  4CRJ A;  4CYU B;  1RU1 A;  1RTZ A;  2F63 A;  4PZV A;  3KUG A;  4CYU A;  1HQ2 A;  3HSD A;  1Q0N A;  4AD6 A;  1HKA A;  3HD1 A;  3HCX A;  1F9H A;  2QX0 A;  3HSZ A;  5ETO A;  3KUE A;  3MCM A;  4M5N A;  4CWB A;  4M5G A;  3ILL A;  4M5J A;  5ETT A;  4M5I A;  5ETP A;  1G4C A;  5ETQ A;  1KBR A;  1RAO A;  3UDV A;  1EQ0 A;  3UDE A;  5ETL A;  4M5H A;  1RU2 A;  3MCO A;  5ETN A;  3UD5 A;  3IP0 A;  3KUH A;  3MCN A;  3ILJ A;  4M5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...