4M5NA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
HMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5nA00
1HQ2A 3HCXA 4M5MA 4CRJA 4CYUB 1RB0A 4M5LA 1EX8A 4PZVA 1TMMA 4M5JA 5ETRA 1EQMA 4M5IA 5ETLA 1KBRA 4M5GA 3HSJA 1F9HA 3HSZA 5ETOA 3KUGA 3ILJA 3MCOA 5ETMA 1Q0NA 3UDEA 1TMJA 1DY3A 3MCNA 5ETQA 3ILOA 3HSGA 3IP0A 2QX0A 1RU1A 1HKAA 1CBKA 5ETSA 5ETNA 4CYUA 5ETPA 3QBCA 2F63A 1RTZA 3HD1A 3ILIA 4M5KA 5ETVA 1RAOA 5ETKA 3ILLA 3MCMA 3UDVA 4CWBA 1G4CA 1IM6A 3KUHA 4AD6A 1EQ0A 2CG8A 5ETTA 3KUEA 4M5NA 3HT0A 3UD5A 4F7VA 4M5HA 3HD2A 2BMBA 2F65A 1RU2A 3HSDA
chains in the Genus database with same CATH superfamily
2EFVA 4LF5F 2IVFB 1RACB 2DKOB 2XULA 1WSRA 3FJ2A 3RBXA 1ZAXA 2G2ZA 3CJ2A 2LDYA 1NSQA 2RE1A 3TQEA 3SI8A 1YHQS 3I9V9 4P7TA 1FD8A 2EG1A 2Z8QA 4PEOA 1RTIB 3EGWB 3MAHA 5CH7B 3J81U 4ZJQA 4ZOSA 1JLGB 2V94A 1RGVA 3EGVA 3UN3A 4MIAA 3GQCA 3M32A 4BBYA 1FKAF 2GNKA 3ULHA 1TKTB 3UQSA 2CJAA 4LVOP 4FBUA 2Y3YA 1IKYB 4M5DA 1H7WA 7FDRA 1HHQA 3MM6A 1K1QA 1ACMB 2BABA 2H1YA 3HVTB 3W9JA 3PKMA 2FJBB 3DC2A 1B64A 1KLNA 1FNOA 4I7FB 1UJ4A 1TKZA 3A13A 1P1LA 1UPPA 3HT0A 4TY8B 3D6HB 3CCWA 2MY7A 2C3MA 4Z37A 3CGIA 4DZDA 1JXVA 2LYVA 2UVWA 4RZRA 4DN0A 4DR6J 1S1TA 4QYZK 3BGRA 1KBRA 1RABB 3FMBA 2OPPA 3FSXA 2V4JB 1HWJA 3BB5A 1IQZA 2YWWA 3L09A 3T19A 5JMNA 3GP9A 4Y6IA 1VQ5S 4Y2KA 2FZKB 5L1IA 1Y4ZB 1KEKA 2CQBA 4WU3A 3G8SA 2UVRA 1TV6A 2V63A 3DRRB 1N6QB 2J8SA 3CCES 1SL0A 3O5TB 2F63A 2BM0A 2GZOA 4IFYB 2C2EA 3TAMB 1JJ4A 3LTOA 4I0WA 4USVA 3SYZA 1D09B 3MAAA 3SFUA 1PYTA 2GQQA 2ZH2A 1NU4A 1GMWA 1RT5A 2IAJA 2KYZA 5HMXA 2C2KB 3C15A 1KKHA 2B5JB 2XY6A 3NL0A 1G6BA 4RLEA 4ZVSB 3CJ8A 1UWAA 1Z2ZA 2B43A 3AT1B 2UUBF 1FDAA 4I6AA 3RUBL 3PXGa 2DNMA 2KVQE 2JL9A 1VQOS 4ANDA 4NXMJ 4G65A 2HBZB 2HGNA 1GFWB 1VBYA 1MROB 3ZZTA 2FVCA 3G4SS 2N4DA 3CMQA 5HAOA 4ED0A 2R7TA 4JV5F 3NNCA 1SH3A 1OS5A 3I9ZA 3D6TB 1IKXB 5CYQB 4ZVPB 3IS9B 4DLEA 2MQNA 2JLFA 5K9FA 3KLEA 3PO5A 2E29A 4LQ9A 1TUVA 4DOZA 2W24A 1Q16B 3M30A 1YJRA 3IWXA 1XR6A 3CF5Q 2XWXA 2BJ8A 3HT3A 3RZAA 2R3VA 1MWQA 5IOLA 2ALZA 3JQKA 4LFBF 4HH1A 4ZPAA 2K7JA 5B0AA 8ATCB 1RBLA 1UVKA 2GW8A 2R8KA 4BLGA 3KMSA 2OELA 4Y2AA 2XSJB 3TAPA 1IQTA 3MPYA 1TL1B 1X4AA 2F4FA 4CO0A 4OFZA 2CA9A 3NGTA 4ZN3A 2XCPA 1RTDA 2RRAA 2FB0A 2C1EB 1HMVB 3QO9B 2B6AB 4RO0A 2M9KA 3ISND 4DHVA 4C8ZA 1DBDA 1T9WA 2C3YA 1TUWA 2VKZG 5LMNF 3EXYA 4B3RJ 3KHRA 3BGLA 4IUFA 4HLBA 5G0RB 3G6ES 3S8SA 3BO3A 3V4IA 1LW2B 1M0SA 4X4VA 3DRXA 3MM9B 1KONA 4YS2A 2JEIA 1JLCB 1GAOA 1M5SA 1FVSA 2J7KA 2OEMA 2ZVIA 5EDWA 1KLMB 3TWZA 1MSWD 4DSEA 4YMEA 4EGLA 3LW5C 1VI7A 1YBTA 3FSYA 1P6TA 4P10A 1UVLA 3BS9A 3W62A 1S1XB 1QTMA 4A8FA 1Q4RA 2E7VA 1SUQA 1FRIA 2OHDA 5IT0A 5D3GB 3PFOA 1O0PA 2QT7A 2ZUGA 3MPUB 3TZWA 5KT3A 5B0CA 4YR3A 1ZTWA 1D9DA 4V19J 1FEEA 1EHWA 4QWEA 4B08A 1KSPA 3PACA 4ID5A 3PDNA 4ZPTR 5KFLA 4KV8A 4OJGA 4ES2A 4ETXA 1KFSA 2BOPA 3HPOA 4OX9J 4YR0A 3QAEA 2QLWA 4DDFA 2YNFA 2ASJA 4KE5A 2Y0SD 2BKPA 2HZAA 2DPIA 1Y3JA 1AROP 1HBNA 1VISA 2A1BA 3GE9A 3LALA 3CCRS 1S0MA 3E8OA 3FRZA 1WI8A 3KJFB 3HF5A 3CCSS 2R7WA 1K1SA 2B4OA 2H9ZA 3BGUA 4K5RA 4C9DA 1WF0A 1N48A 2AW0A 3KK3B 3MPWA 2IJFA 1XC9A 3MOJB 4LFBJ 1RTIA 2KXNB 1Q5YA 4DFJA 2MZJA 2X7IA 1VCTA 5E3QA 2CQ4A 4NA2A 1VRUB 4ZJLA 5KT6A 2NLWA 3CT9A 1NNDA 4WYLA 5J2MA 3IBWA 1VGYA 1VC5A 4MFBA 4ZIWA 3RB4A 5A0YA 1TMMA 4RW4B 5F41A 4AL6A 3SQOP 5ETRA 1N54B 3QMQA 1H7XA 1NDLA 4JV5J 2MLYA 3PJXA 1WTBA 1NM2A 1RT6A 3CW2C 4PPZA 4L74A 3SCKE 4DV0F 4J9RA 3EX7B 4PR6A 5GAGI 3RRGA 1ZPWX 5LJ5Y 5KT4A 1PC4A 4ELTA 2NUUG 1S9FA 1S6QB 2CQ1A 2JZ5A 3CTRA 4Q7AA 2D3OR 2XTJP 1HQUB 2H65B 5J2NB 1U09A 3GFZA 5KFXA 3PEJA 3DRSB 4A46A 5KFPA 4I2QB 3IWLA 2WK4A 2ATCB 4P73A 3BKTA 2DH7A 4QPXA 3EMTA 5IM0B 3W8PA 5IWAJ 3VF0B 4DFPA 4BC7A 5MLCV 3PZPA 1HWIA 2OPRB 4M5MA 2NPFA 1O6XA 1X4DA 2AX0A 1NHUA 3FUYA 4CTAB 5HVGA 2YKMA 3NBPA 5A8WA 3GR1A 8AT1B 1VJWA 2XMUA 2V50A 2HK3A 3PRDA 1FT8A 2V8HA 1NAQA 2V9KA 1VK8A 3R5CA 4ED3A 3HHLB 2UZAA 1SH0A 3D2WA 3WC0A 1YQHA 2DGUA 3BDEA 3D6MB 4ZK7M 1WG1A 3G82B 3OL8A 4KAIA 2FLNA 2AYMA 3PVXA 1RWXB 4ECTA 4OYIA 4TVAB 4M5KA 4KPYA 4ILLA 3WDOA 1N33J 2DYAA 4QR2A 4H4OB 2JSXA 3C3LA 2NSCA 5CZXA 2B7BB 3AB2B 2DR7A 3D4JA 2BV3A 3CC4S 2VG6B 3FCHA 4BWMA 1ZPVA 2ZBCA 5KFSA 1M1HA 5B08A 3QFWA 3LWLA 2EEYA 2MKJA 2AYGA 3EVMA 3KXDA 2D74B 2G1HA 3Q22A 4N76A 2C2OB 1HPZB 1CJUB 2K1RA 2V69A 1MWYA 4QR0A 2AKWB 3ONQA 3ZZUA 1U2CA 4E0DA 1K0VA 3H0PA 4QW9A 2KYXA 4DS5A 1R3NA 4C3MA 4OYAA 4RKUC 4ZLPA 2LDIA 2PIIA 3KLIA 3C6TA 1DARA 1Q86T 2OAUA 1OQ6A 4FYXB 1T95A 1EJ7L 1X4BA 2P6TA 3MCNA 4H54A 5D0GA 4IFVB 1D0EA 4L6V3 1TK5A 2XSJA 2AGQA 1VQKS 1JMTA 3CJ5A 4LF5J 4Y2IA 2DNZA 2MZTA 4PG4A 4MKYA 4A48A 2HS0A 3SEOA 3UDVA 1IUJA 2PEHA 1SCJB 1LWFA 3PYFA 4Y2MA 4ZVFA 5B0DA 1E6YB 5K8MA 4RUAA 4OZJA 4OQJA 3BZQA 1XR7A 3ZZPA 4A8SA 2G2YA 2GIRA 3ZTRA 3OTOJ 4ICLA 4Q2MA 4USKA 3BSOA 1KC8T 2PMHA 2ACMA 2RHQB 4GVBB 1WF1A 4EBCA 2M4MA 2HQIA 2OMOA 3CDUA 3T5JA 2BJ1A 3OXLA 1L3UA 4MKVA 3T1YJ 1PKUA 2OP5A 3JSYA 2PMZD 1BMQB 4GO5X 1R8AA 2YWHA 2ZFHA 1RTHB 4KFBB 1VQ8S 5L8RC 4DSLA 4HI1A 4OI2A 4F0MA 2UXDF 1GEHA 3R5DA 3QBCA 3L7PA 5KG3A 1GT8A 4OHVA 4NCBA 4FDFA 4K50A 1Q53A 1MMNA 1YJVA 2RF2B 3IGNA 3JTNA 4I2PA 2MZQA 2R2SA 1SBRA 1UWBA 2C2RA 1H0HB 3R7SB 1C2PA 1LEOA 4HT7A 4QR1A 4HR2A 4UOHA 2DO0A 3GIRA 1RU2A 2HHWA 4D3GA 3W5XA 2DR9A 2Z4PA 2HLTA 2I38A 3T6JA 2UXBF 2CIMA 3N6LA 3LP1A 3NGSA 1S6PB 3WHIA 1SQGA 3LP2A 2LP4A 2U1AA 3HKZD 4B3TJ 2YTCA 2LKZA 1BUXA 2IM2A 1YJ7A 3MMBA 2MQOA 2W8KA 5F3TA 2CQ3A 5KFJA 3C6UB 1MG7A 2R9LA 3KK2B 3B4MA 3HJVA 5J2MB 4DL6A 4F2RA 4NZ7A 2JOQA 2GVZB 1S7HA 4FBTA 1UPMB 2R2TA 3PKYA 3ZZYA 2FJWA 1H74A 4JI6F 1TL3B 5HMYA 3VHQA 1SV5B 3MMCA 5HI7A 4DXLA 3CCQS 3D0IE 1H98A 3QFHA 5F9LA 4YP3A 2XCAA 1JLFB 1S57A 2JX2A 2DNGA 3M6XA 3MM5A 3W9HA 1NJYA 1T7PA 4J9UE 4B9UA 1IR0A 4DSKA 4F4ZA 2B4UA 2CDRB 4S0MA 3IR5B 4TNOA 5AE3A 4I4BA 1KVKA 2MZ1A 1FKPA 2N82B 1URNA 4PQUB 1T9YA 3RJMB 2N3OA 3RTVA 4NASA 5DJBA 3GV7B 1YG0A 2HHUA 1S1UB 2FC9A 2M88A 4ILMA 2PMWA 4ZLNA 3J81Y 4J9PA 3CCTA 2FQQB 4ZPBA 1PBUA 1VQYA 3OXGA 4MMOA 5D0HA 2CFXA 4OX7A 3NGDA 4LF6F 5EN1A 1IBKF 2MLZA 2RUGA 4KGKA 4K4YA 4UOFA 1HNXJ 2IDLA 3QRPA 3CB4A 4FZVA 2V8PA 2ZEJA 3J7A1 4NRTA 5T7LB 3TARA 4CO4A 1CC8A 3DKDA 1JLGA 3OVAA 5HBMB 1YRUA 2A6OA 4RW7B 2HG4A 2C3UA 3G82A 1NPRA 1NDKA 4DUZJ 3MECA 3PO4A 3G6XA 2GO8A 1HARA 3IG1A 1CJTA 4Q0BA 3LP0A 1WC4A 4ZHRA 4CO2A 4EBDA 3BGFA 4WXOA 2AYBA 2LQ5A 2CWXA 3FDSA 3H4DA 2EW9A 4YHHF 4URGA 4NLVA 3DGPB 3M8QA 1I94F 1VQ6S 3HHEA 2WSEC 1WG4A 2E5GA 2FD2A 5D0EA 1EP4A 1GTHA 5B0FA 3SCIE 3ISZA 4XO0A 4ZVTB 2O01C 4NXMF 1X9WA 3LGNA 1NJIT 3DLGB 4B3OA 2F40A 2Q6CA 4AQYF 1PAUB 2QA4S 4RR5A 4C0OC 3R27A 4TU9A 3J80Y 4QZVB 5KG1A 3DHXA 2ASYA 4CRJA 3EZOA 2MTLA 3V6KA 3VGVA 2IBKA 1V5IB 3P96A 3AODA 2ASDA 3J7AN 5SZTA 3Q2SC 1QAYA 5DZ7A 3TVKA 2DTJA 7AT1B 4RNMA 1Q95G 3H5UA 4ZLLA 1U47A 2ADBA 1T9XA 2VD3A 1PJ7A 4A8OA 4WFNQ 1W7WA 4WIIA 5IT9U 1RWKB 2HURA 1Q8BA 2XMVA 4CM2A 1WC6A 3A3PB 3AXMA 2M3DA 3S7RA 4Y00A 1U0HB 1N36F 1GXLA 5CYMB 3MEDB 3T5KA 2YH1A 1AFIA 3M1VB 4EYHB 3NCQA 5F0UA 2UU9J 1DQ9A 1TFWA 4NLXA 1WHWA 4WKYA 2IM0A 1AUSL 5IT9Y 2OPSB 1S48A 4UUXA 4M5HA 5CYQA 2HVHA 3TO8A 2C2ZB 2ZH1A 4DV3J 1X8DA 5KFRA 2ZBIA 4WPAA 4TU7A 3MR6A 2UUCJ 1WEYA 3FZBA 1C4AA 3GJRB 3D54A 4X64J 1N5YA 3OW2R 1U1RA 1X5TA 3HO1A 2JJ4D 4ZVRB 4ECWA 2XNQA 3VVTA 1V6HA 3GFXA 3W63A 4YHHJ 4X62J 2E1AA 3CMAS 3GMGA 4WJBA 1KQFB 4MT1A 2V8VA 1B7FA 4QCLA 4ER8A 4WXWA 2H54B 4JI3J 1M90T 1RT4A 4GVLA 3PYDA 3EVWA 3LP1B 4WFZA 1CLFA 2FJVA 4WBFA 3QO9A 4HTIA 2VONA 3D66A 5KFMA 1DTQB 3CDEA 2X1BA 5DM7Q 4I64A 3NS7B 2ZE2B 3HP6A 3RAQA 5FD1A 1F3FA 1RAHB 1LW2A 2VUGA 1URRA 3R1LA 1HQEA 4PG6A 3FNNA 5J2PB 3MFHA 5CCLA 3TAQA 1XK8A 1TK8A 3KMQA 1WWHA 1RT3B 2QL7B 2FPHX 5DDOC 3IBFB 5EGYA 1F9HA 2GA7A 1RCOB 3M2RB 3M2VA 3NP5A 2Q66A 1X4FA 5GADU 1FVQA 3MCOA 2L08A 4IH5A 3THPA 2RU9A 2CPFA 2YXLA 2CNLB 3CJTA 4QWAA 3DI6A 1P27B 2YNGA 3I5CA 3M8RA 1PGZA 5D3GA 1FJGJ 4C8KA 1F1BB 1PJ6A 3GLJA 5KG2A 1D9FA 4PABA 2VG5A 3FCWA 2VL1A 3AJ1A 1RTZA 4C7QA 3E3XA 3M2UB 5KFVA 3RB3A 2H4YB 1UTAA 3R8YA 3W64A 2KKHA 4DEZA 5DQGA 3CCLS 2CQDA 4RPFA 1TL7B 3K7RA 3ET6B 1FRKA 4RW8B 4K5SA 2IYIA 3MM7B 3Q23A 4J9NA 4O44A 2UUBJ 5GMEA 1DFDA 2HS4A 1KOHA 2CDQA 2GMLA 3ZZ0A 1FCAA 2ZH6A 4B3SF 2DGXA 1RTJB 2LQ8A 2WW4A 4G1QA 2HAFA 4NZ6A 2YWEA 3HSZA 1X4EA 1M1KT 2BE7D 2ZZNA 4DX7A 3G9CA 5DDQC 4NI2B 5J1EA 1SJRA 3NNAA 3K59A 4PQAA 2AJ1A 4YB5A 1RT7A 2IRXA 3B4DA 4UF4A 1I1GA 5FDLA 5IS2A 1ZAWA 3EXCX 2KXFA 2WONB 2WW8A 5A0YB 3ZC4A 3UCZP 3QSIA 3U1MA 1X9MA 2DIUA 3RAXA 1CULA 3TNVA 3UD3P 4ZCLA 2CJXB 2DNRA 2HNDB 2IDEA 2HLUA 4IO9Q 1WC1A 1X0PA 2QLJB 1TV6B 2BVZA 4YR2A 1N6QA 1VQMS 3E2EA 2MMYA 3BEGB 1IVZA 5DO2A 1HNZF 1DURA 3PCOB 3PTWA 1UVJA 2HRUA 5L46A 2FVQA 2VFVA 4ANEA 2DHHA 4X4RA 1BGXT 2NYIA 3RRHA 4N8NA 1K47A 2W9AA 4A8KA 1R27B 1EQMA 2H4WB 2YKOA 3HKWA 3H2LA 5K8OA 2V9WA 3OFEA 3MFIA 2B5JA 5ETOA 3JQMA 4LFCJ 5H9FJ 2PI4A 1XQIA 4XK8C 5EUHA 5I3UA 2Z2MA 1RHQB 2ZH4A 1REVA 2WBRA 1RAIB 3PW7A 3I0RB 2EKYA 1S76D 2YNHA 2YY3A 2Z56B 4TXSA 5E7OB 3IO1A 2A2DA 4OI1A 3NMRA 1WD6A 1X60A 3KLHA 3K57A 2D9OA 1IKXA 2B8PA 2HHPA 3T6BA 4EI2A 2QA4G 5EWEA 2KFZA 1CJKA 2G1DA 1BXNA 1TU0B 2CG8A 2NPIA 2M8HA 3CDWA 3M4XA 2BE2B 4NCGB 3I96A 5B7WA 3KYLA 3TRGA 1PCAA 3H5XA 1VC0A 2A10A 2QMUB 5F8LA 1RAJA 2YH0A 5RUBA 3SSRA 3WIUA 4DV6J 4LSLB 1D1UA 2LVWA 1MU2A 1T03B 3DYAB 2K3KA 3HHLC 4EEYA 2R8IA 2AP6A 2H5JB 1MLAA 5KFKA 2QEXS 1NSAA 3JSMA 3KTQA 2R7VA 1TL4A 4C11A 1LFPA 4QYRA 1UA0A 3HLUA 1TL1A 4IG0A 2F8MA 3E01B 1C0TB 2ZBQA 4NA3A 4TY8A 1PC5A 3CJRA 3EICA 2ZNZA 1XJWB 5IZHA 1JLEB 2F7VA 2W2PP 1AXQA 1ZOTA 2HPUA 3EDQB 3FEZA 4KYZA 3TZXA 2MZSA 2QO3A 2WZ1A 4QIWD 5E0OA 1WKKA 2OJ3A 4LRAA 4NWBA 3LPEA 5JXSA 3NKYA 2WVBA 1JKHB 1U8SA 5GAEU 1SJ4P 2ZC4A 2R7QA 1L3TA 4DG1B 1WSVA 4DQSA 4B9MA 1XR5A 4PYAA 1UAWA 2GCFA 1VR6A 2HQCA 2W9CB 1CEZA 2O1PA 2IC3B 5K8NA 3PW5A 1ITPA 1WEZA 3H2VE 2W4PA 3MAAB 2D3O1 2VDIA 2XMMA 4FVMA 3KDNA 4XDCA 2UVUA 2UVVA 4HT5A 4LF9F 2B8QA 2VB6A 3OD2A 2CPIA 1JJHA 2FHOB 2CPEA 2CNOB 2QA2A 3ENQA 3O2IA 1DRZA 1Y10A 2BA9A 4IR9A 3LO3A 4OIXA 1Q1KA 2Q6BA 4PCQA 4B9LA 2CJBA 1C1CB 1H2UX 1UP1A 3A12A 3GJTB 1BHNA 4W92B 1P9YA 1PG5B 4RU9A 1T3NA 2WB1D 4MK7A 2MSSA 1BWVA 4M5NA 1R0CB 4FYWB 4ZPCA 2JC0A 2W25A 4P9SA 2RS2A 1RT2A 3DI6B 1FJGF 2K8GA 3OFFA 2XLJA 3Q8UA 1YITS 2DB1A 4K4VA 3PY8A 1NZ8A 2J6SA 2RRNA 1F9FA 2QA1A 5LSOA 4ELUA 2Q79A 4DU8A 2XQCA 4NXNF 3QSYB 4OZ3A 1QUVA 1TAUA 3VV2B 3FQLA 2CJYB 2YBVA 2HNZB 4Z7CA 1WTFA 4DV4J 1V9OA 1HBMA 2JEJA 3MMAB 1ZYQA 2VQEF 1NKBA 4HYKA 4WZQA 2P5VA 4NMLA 4CLPA 5KOXA 1P1TA 3MEKA 3KHHA 4DV5F 1LWEB 1G1XA 3P5TL 4O3RA 3BQ0A 3AQOA 3ZTOA 5ADZA 1IKWA 1KOOA 1RT6B 1Y9OA 3POTA 3CUNA 4WKRA 2ZKUA 1RTJA 4G1QB 4LREA 1XERA 3CIZA 2P8IA 4JI5J 4KB7A 3MD1A 1VJQA 3HD2A 2F65A 3NY0A 1UW9A 2QMXA 1ZM4A 1Y00A 2V67A 3DOMB 3RYLA 1Q8LA 2EFPA 2FIUA 1JJCB 5THWA 3RG6A 1R0BG 3UDCA 5LM7E 4JI8F 2P6SA 2ZD1B 4L3NA 3H4BA 1X4GA 1S79A 1RT1A 4OZ0A 2XO6A 3KHGA 5EHHA 2FHMA 4EK2A 4LFCF 3M8ZA 3JYTA 2O3DA 3PX6A 1S9GB 1JLAB 3ICLA 5KG4A 5HLFA 2OUGA 2U2FA 4F3OA 2PA3A 2XLIA 2NREA 1RWWB 4B9NA 4YOEA 1RAEB 4X4NA 1RAAB 2JEGA 4QU7A 3MDFA 3ILLA 1TKXA 2F1FA 2OI2A 4FKXA 3KUHA 2AF6A 4DI6A 5AXNA 2ZH3A 2GHWA 3G8TA 2V4RA 4P6QA 4NLTA 5EX3A 5AXKA 3PR4A 4MKBA 4NMXA 5D4OA 4F4XA 1B3TA 1HNXF 1KWMA 2D9PA 1YIJS 4TQSA 1R0AA 4N7TA 3MM6B 1ZZFA 2GVDA 4TYAA 4C0HA 2NYHA 3GB0A 1D9AA 1VIXA 1NDPA 3GJQB 3BH6B 3DDIA 2XM3A 4DFMA 1XMQF 4ZP6A 1S5ZA 3J81j 5ITHA 2YQ0A 2XYPB 1CSJA 4FNHA 4IOBA 3DLJA 4V1Ak 5KFAA 2ZHBA 5ETQA 4AXJA 3OUYB 3HXMA 2NS1B 5T7LA 4DV5J 2YX4A 2BR0A 2VC0A 1VQ4S 1TAQA 3P3DA 3VAIA 1NB2A 2GFFA 3ZFVA 2XBPA 3QT7A 2Z58B 3D1HA 1H72C 3QATA 4JUZA 3M05A 2VJUA 2VJVA 2HHHJ 3EVOA 3THVA 4GKJF 1ICEB 1KQGB 4ZS6A 2FYXA 2YQ1A 3HVWA 1CJTB 3AA8A 2W7AA 2IRUA 4IFVA 1RDRA 4OZLA 3UVJB 4A4JA 4DUYF 3NCRA 3MMJA 2HRYA 3D6FB 3NAHA 4X65J 3MURP 3OTCA 4DR7J 2XMKA 3KG1A 1ZAVA 2Y1RI 3CNQP 3IP0A 1I51B 4KGVB 4EO6A 4U67Q 5BYSA 1C0TA 1NHKL 1HI1A 1HQUA 1JLBA 1QY7A 2MKKA 4FF3A 3M8QB 2VPWB 2GHPA 4LJMA 8RUCA 2IAJB 2D7SA 3UNYA 3M7VA 4LIWA 1SH2A 2DEIA 4F4KA 1B99A 2ZWPA 2RU3A 3CEDA 3JSBA 1T0TV 2KT2A 4OYWA 2AJ0A 2KDOA 3UN5A 2ZJQQ 3CCJS 4QU6A 2XLKA 1MN9A 2VOOA 3Q8SB 3LH2S 5KFEA 1KHWA 3SQGA 3H40A 4ECZA 3NBPB 5A8WB 2LXIA 2HVDA 2Z2YB 1F5CA 1WOSA 5EWGA 4P72A 1A9NB 1Y3KA 1HBOB 3KK1B 2IC3A 1UJ6A 4LFAJ 4MK8A 2BJ3A 2P9EA 2FZGB 4Q43A 3VAGA 3GJSB 1B0TA 2E1PA 4DCOB 4W4MA 1FD2A 4ETZA 4W98A 2CG4A 1WUUA 2C3PA 2HEKA 3V6JA 3CD7A 5HN0A 3KWMA 3DLHA 4H4OA 3T41A 2F4VJ 1FRLA 3M1VA 3KUGA 2HSEB 5LXRA 4ZJOA 1WNEA 2FJAB 4J7CA 4DL0C 2NQPA 3IR6B 5FLXY 4FP9A 2W2MP 1RT2B 3HX9A 3QGHA 3M6UA 2ZH8A 3Q8YA 4J9QA 2HWIA 4UOGA 3HDSA 1VQPS 1TK0A 1RAOA 1Z1ZA 2B9YA 3KJQB 4BC9A 4DPTA 3G8QA 4X84A 1LW0B 2C2NA 2MZRA 3NS6A 4TY9A 3RBDA 2F9JA 2GJIA 2W9BA 2J0SD 2YPZA 2P9GA 2FLPA 2HYIB 5C2GA 1HWKA 1T94A 2IPOB 1JB0C 3H5SA 3NXZA 1X31C 4CP5A 1YJNS 1RYSA 4JI0J 1OSDA 1S49A 2HWHA 4HL9A 4N77A 3GYNA 4UY85 5C25A 2DITA 1XBWA 4BCAA 5IT4A 2MSTA 4ZPDA 2VPZB 1N52B 2YKPA 2DVIA 2JDJA 4R8UA 3DRPB 2L9NA 3Q24A 1Q8IA 1VQ7S 4PUOB 4JI8J 2RS8A 4LF2A 1FRJA 3CJ0A 2DT9A 4N47A 2JNJA 3BJYA 1FKOA 1AFJA 1HKAA 3OSPA 4K0KF 1TKDA 2BX6A 2L48A 1WI6A 2RJZA 4HACB 4B3MF 4GVBA 4U9RA 4CIOA 4ELVA 4ECSA 4CLLA 3UCGA 3GSIA 2DRBA 4LR9A 1S7IA 4AQYJ 5HO4A 3NAIA 2GJ2A 2OMLA 1N56A 1C1BA 1S9EB 2R7XA 3NGRA 2N3LA 2DXDA 3OR1A 2RQCA 4USWA 1W2BR 1U2RA 2I0XA 3NGUA 1VYAA 3I0SB 2K2PA 4K2JA 3UWTA 4TLQA 5D4NA 5HQ8A 5LSLA 3CWJA 2VQEJ 1S72S 5KFUA 5KFQA 2IVMA 4DSJA 2ZZMA 1CQNA 2OSRA 1UL3A 1Z4UA 3ETMA 4DX5A 3HI9A 4CLFA 3SZ2A 1Q8KA 2HQFA 2I6WA 2DNLA 2EPIA 1TKXB 1LFWA 3D1QA 3TJ8A 2C2DA 3G96A 3MUMP 4FYDA 2MKHA 3V5RA 2DHGA 3X1LB 3MM7A 3OTEA 2MKIA 3FKBA 1RWNB 4DN9A 2CQPA 4NLOA 1A7GE 5E3AA 4OYMA 5AJ3J 3J7YU 4YY3F 4PWDA 2EKNA 1Y5LB 2DXFA 3IG1B 2CAJA 2OPQA 1ZETA 4PXCA 4N41A 4ILRA 2VV5A 3PRBA 1JLQB 5HANA 3FVYA 5L38A 2W8LA 4A8XA 1YTYA 1S6PA 4AD6A 1VBXA 4O4RA 2AT1B 2DGQA 3SCJE 1PYSB 2N4CA 4QYZJ 2UV8A 3LP2B 5KFZA 1ZTTA 4RBTA 4NRUA 3P45B 3OUYA 1DLOA 4DR3J 1L5UA 2R8HA 2FVPA 1IBMJ 2LCWA 3BR8A 2D3ZA 2WVEA 2Y0BB 3BBBA 2H5EA 3T9NA 2ZH7A 3CJQA 3VR1A 2EC2A 4ZA1A 4LF9J 2I5JA 4M5JA 2QTWA 2SXLA 3B6BA 4WCEQ 1LOUA 1N5TA 3JQJA 5A6PA 2KM8C 2UP1A 3N0VA 1JIHA 4J9MA 1SC1B 3V81A 4HDGA 2HNDA 2M2BA 4NLRA 4O3QA 4H4KA 4JI4J 4MYTA 1S97A 3R5GA 1FRMA 2RKIA 1J5EJ 4DPOA 3DU5A 3HFKA 4QW8A 3M8YA 1FJ7A 2E7XA 2E66A 4HEA9 1HHTP 1IKVA 2HQGA 2QE5A 4P2FA 3KNAA 5HROA 2J0XA 2YVSA 1F5AA 2R4FA 4HH0A 4CDIA 4KJIA 1UJ5A 1CS4B 1QVGR 1DTTA 1SJQA 1GX6A 1YSJA 2D3UA 2ZUAA 3LAKA 4KHMA 3KLVA 4ECRA 1KHVA 2X1FA 1N33F 2A0FB 1S1UA 1FDNA 4ZKAA 4DQIA 4M5DB 1HBNB 3NRBA 3CCZA 3WX8A 3IRXA 3HMJG 5L1JA 2PFFB 3I0RA 4ZP7A 1HL6A 2QL9B 2M7SA 4QJVA 4USMA 5DG7A 1TP7A 3GFYA 4FXWA 4RUBA 5AT1B 1W2IA 4J9KA 2OD4A 2R2UA 3M6VA 2EFGA 1HHSA 1UEUA 4A8WA 1NKEA 1NJWA 1LXNA 1YZ7A 3HFVA 3CIMA 5DGBA 3VQTA 3QIPA 1SKUB 4CLUA 3MF5A 1XMQJ 1TQLA 3QJPA 2OPPB 1IM6A 3OV7A 4AL5A 5IV4A 1BQXA 4JV0A 4KGZB 4JI1F 3MEEB 4F7VA 4DR3F 4Q8EA 1S12A 2HFSA 1QTNB 5DS7A 4DZ6A 1MMLA 5C42B 4USJC 3FCVA 1S6QA 2DR5A 2QLFB 4P7VA 4CLZA 5IV3A 5A8KA 1FWKA 1QD1A 1HD1A 3C15B 1RWPB 1LW0A 1XIQA 4B3OB 5CZVA 1X4HA 1NK8A 2VQFJ 2BUNA 3IAS9 2B9WA 4RUCA 3G86A 5HP1B 1ZZNA 2FJXA 3D5MA 4LSNB 5E3CA 4O0IA 4K7QA 3OHAA 4CO5A 1RZMA 2LECA 3GPAA 1UMJA 2CPHA 4ECXA 1OY6A 5C25B 2K06A 5CD4A 3L4BC 4IH7A 4L73A 4OJ3A 5IC6B 2DGVA 3WQPA 2KG1A 3BBFA 3DOLA 3R7BB 2MQMA 1OMSA 1CJVB 2VKRA 2CQHA 2HWTA 2WOMA 2XEXA 2YNGB 3OPKA 4HTJA 4ZVHA 3CVKA 1GMUA 3HHLA 4LF7F 2C28A 4KY3A 3THTA 1HW9A 5CYJA 2WVDA 1HQ2A 1OJ4A 3IRWP 2BW7A 2HFOA 2RB7A 4JP8A 1NJXA 4F3QA 2OTJS 3EWGA 4CQ1A 4M5IA 4RW8A 5J2QA 2ZH9A 4PYDA 4DCPB 4O3SA 5GVQA 1HYSA 5KFYA 3TJ9A 4QPTA 2WSCC 4JI7J 1B0VA 4WK1A 5LXYA 1DAXA 2OFGX 2OGUA 4WFYA 3US5A 3H25A 3QT5A 2Z2LA 3WZ0A 4EFAC 2GQ2A 1IBLJ 3ZNUA 2M0GB 3CD6S 4NXNJ 5ETKA 1Y5IB 2YNIB 1NK0A 3ZTQA 3BYPA 2MQ8A 1RJJA 3OVSA 1HLWA 3RB6A 1OPZA 2IJNA 3C6TB 1XN9A 4DCJB 3LWMA 1Q82T 3KNGA 3NG8A 1X7VA 5FDLB 1CC7A 5C5JA 4AL7A 2CQ2A 5D78A 4C48A 4AUKA 5HL7Q 3IXQA 4DUYJ 2YWGA 5A8RB 1T3OA 1LWEA 2KVIA 3H98A 3PRVA 4ZPWR 1BWEA 2VBWA 1T9VA 2H5IB 1L3KA 1NK5A 4NLSA 1N5QA 2ZKTA 3VAFA 1SC6A 2DGOA 2HIQA 2MYFA 4RW9A 1IR1A 2AZ1A 2BKNA 2ROPA 2VFSA 3DLKB 3HHLD 3VVUA 3MUVP 1KTVA 1TVRB 2MJNA 1KVJA 4CNZA 4CZCA 5EX0A 2XHCA 2I5JB 1HNVB 3CJ4A 3LUYA 2J6TA 4PXDA 1QSLA 5GAEI 3IWNC 2GS8A 1Q5VA 4AFFA 5GAHI 2AEFA 4K8RA 4F0KA 3JAMU 1RTHA 3EPGA 2V34A 4EMDA 1XNQJ 4DV2J 1B70B 1NPPA 1S1VA 2CPYA 2EFOA 1RB0A 4F26A 3C8YA 5B0GA 4DV1F 2QL5B 3SV3A 1YI2S 1NB7A 2MXYA 2AEMA 2XGQA 4JI7F 2IIHA 2GAHC 2RUSA 5D15A 4DR4F 2AEJA 4YN3B 1WHYA 2XZTB 1SVDA 1TL7A 2QGFB 4X64F 2G0CA 4LBPA 3HHNB 1LWCB 1C0UA 1RLCL 3QLHB 2UXCJ 4RW4A 3T1HJ 1FXLA 3EJMA 3F0NA 2BANB 1I3OB 2XYHB 4RL1A 4YEAA 1VC6A 4ZHRB 4HHJA 3OVBA 3VZHA 4QOTA 5DQIA 3OBIA 2DY1A 1OIAA 2DR6A 3QQCD 3G6YA 5M2UA 4DR7F 3IM8A 2CQGA 2W7PA 3W8GA 5DGAA 1JK9B 1HWLA 4DR5J 1S99A 5IC4B 1S6UA 1RHRB 2MJUA 3PW2A 1M1GA 3KG0A 4P52A 2E5LJ 3CULA 4ID8A 3E51A 1TKTA 2CUYA 3H5YA 2G0JA 5LMUF 6FDRA 3AH6A 4M5GA 4DS4A 3TVZA 3MPDA 1FO1A 2DRAA 1KP6A 2ZJPQ 1SJFA 3WIVA 4ZITA 2YKMB 1G7CB 2LU1A 4KSEB 5C42A 4FF2A 2F9DA 4KBIA 1FF2A 3MM5B 4C6AA 4ZVOB 3BM7A 4ED4A 2AGPA 1YJ9S 3QRRA 4NX9A 2AJFE 1H73A 2V68A 4OV1A 3KLGA 2XWYA 5E5NA 5DQHA 1UVMA 5D77A 1WC3A 4EUVA 3KUEA 2FHJD 2IM3A 3RB0A 3JB9k 2OH2A 1V3SA 4B17A 3C14B 2G4BA 3W3SA 2VA2A 2NZCA 4F4WA 2ILZA 1QSYA 4ZVGA 3W2WB 2APOA 3HVAA 1EKSA 1T9TA 3ZTPA 1VK3A 3MPVA 1AT1B 2AJ4A 3TZYA 2N7YA 2V2QA 2VIHA 2VOPA 1U1MA 4I7FA 3A8IA 4IFYA 2HHXA 2IRYA 4FN5A 1CJKB 1CJUA 2BRLA 3HSGA 5HQMA 2AMCB 4EZ6A 4WTYA 3FEXB 4MIBA 1YWXA 3W66A 2XS5A 3GTYX 4I56A 4KIAA 1YRTA 2HFZA 3HZEA 5DRKA 2QSWA 1N34F 2DGWA 3FZ2A 4JOUA 2CJKA 4PAAA 4R5PA 3EZ5A 2JH3A 5A2QY 4JV2A 1S4FA 1XMBA 3V2UC 1GH8A 1RWVB 1VDHA 2IA0A 4KPCA 5B0BA 5BR8F 4GRSA 4NEYA 3TAMA 3K5MA 1GTEA 2KT5A 5K8PA 3DLEA 2ZOMA 1NXIA 5F8HA 1JLEA 3V6HA 2CXEA 1WKJA 3J7YI 3N4WA 4MKAA 5B0EA 2W4DA 2VBZA 2IYGA 3UO0A 2DISA 2KI2A 3H42A 5GADI 2CWKA 2M8DB 1JKHA 5E3RA 1RT3A 3I82A 2FHJA 3NOCA 2VPXB 5L9NA 5LSRA 1M5OC 4J9OA 1RI7A 2L3MA 5KOWA 4JB8B 1GQEA 3TA0A 1OWXA 4JI6J 2F5GA 4WTOB 2MB0B 3EUNA 3IS9A 1YBUA 2HZCA 2DO4A 3DXSX 3NEKA 5GMDA 4G3IA 1LV5A 1UVNA 1OO0B 2GV1A 1CG2A 3KLEB 5A6WA 2E1RA 5A2QU 2LXFA 1BLUA 1BQMB 2FJEB 2J9EA 2VG5B 3IGVA 2NUHA 1KFDA 4OLOA 4RW6B 5CABA 2ZJRQ 5KFOA 2H48B 4DSFA 4IRCA 2HNYA 1AB8A 3NLCA 4WIQA 2X3DA 4HACA 4M8LA 2DCLA 4U7CA 3UR3C 4L76A 1S6OA 3PG9A 5LT5A 4ERDA 2AZ3A 2BW2A 3FFIB 1FESA 1U02A 2BEFA 3GV8B 3OQ2A 4EYIB 4YFUA 1RHUB 5JUMA 1Q0NA 3I5BA 2AD9A 1DY3A 1E6VB 2MPUA 1PYOB 3DM2B 4FYYB 5I3QA 4DR6F 4XTTA 2HK2A 1EETB 4F4AA 1X4CA 2QV6A 2YWFA 5AXLA 1FE4A 3B54A 4DV0J 3OLAA 2ZBPA 4K2XA 2OIHA 3A8EA 3K8VA 3GU0A 2DCUB 4E2FB 1EAYC 4NI2A 2A6MA 3CE8A 5J1EB 1FNXH 3QRQA 3TUPA 2UUCF 2VF3A 5KFCA 1AA1B 1F2HA 3TANA 1KN6A 3JTOA 4G6VB 2FY8A 4TLRA 1AZSB 3JSRA 4GMKA 3CO9A 4K0KJ 2FLLA 3BQ1A 1NK6A 2AIRB 2MEWA 3DMJA 1D8ZA 1I5OB 2E44A 3A8KA 2RDIA 3FC9A 1N36J 2DH8A 3U02A 1B7YB 1HFEL 1BC6A 3QIDA 2YKNB 3GCXP 3K8WA 4WK3A 2HGMA 3A4TA 4M63A 9RUBA 3W5ZA 5I42B 2PEBA 2QX0A 3H8YA 3N5BA 2Y8YA 2L9DA 3H20A 4KR0B 3P8BB 4CYUA 4KRWA 4KV8B 3IC1A 3UR0A 3OTOF 4NE9C 2MHEA 2ZD1A 4NYZA 1Q78A 4WP8A 1DQ8A 2QFIA 4PWWA 2OO4A 4AYBD 1VIOA 3KKFA 3JTPA 2QFJA 4C8YA 2CQIA 2D41A 5DETA 4J90A 1JJ2R 3OFGA 1UEVA 3GIIA 4HHHA 1FTCA 2XMJA 4L75A 4ES1A 4QWCA 5HLFB 2UXCF 4AT1B 3C16A 3TUIC 3BF4A 2AU0A 5D4PA 4ES3A 1HBOA 1HBUB 2KFNA 2W2OP 2XO7A 4DR4J 2J7WA 3CD0A 1CS4A 3C46A 3FMWA 2KB2A 5LL6d 1MNEA 1F60B 1RCXB 3EE3A 2ZM6J 4DX8H 1MU2B 4OI6A 4YDDB 1I6JA 1UVIA 3K5NA 3D1OA 3PR5B 3D7SB 5KAKA 3AFGA 2JLGA 4DPXA 2ROEA 4FF1A 2B7CB 2OPRA 4U8VA 3GZ7A 3OT9A 1RSCA 2YKAA 2GJFA 2DH9A 4K59A 1TTHB 1YLXA 4MYUA 3DGPA 4W90B 1FNMA 2WRMA 4RBUA 4I2QA 2QLXA 4M5LA 2Y1JA 5IM0A 4OI0A 4K4SA 2W9BB 2RSQA 2WONA 1VOMA 4IG3B 3NWRA 1BQNB 1DHMA 3R2DJ 1SL2A 1FDDA 1LXJA 5J1NA 5L1KA 4ED2A 4ED7A 1V3ZA 1U1PA 1REGX 4CTAA 2HHHF 1IN0A 5IFMA 1IWGA 1Q7LB 5BJRA 2RDJA 1N88A 1OSCA 2W7OA 1TKZB 3BN7A 1RADB 4R8UB 4B9VA 1SPBP 2EBEA 2ZVSA 1QJHA 1SKSA 3MR5A 6FD1A 1L3SA 2YX1A 2HVZA 3GONA 1M5KC 2RRBA 2C3OA 2R42A 4USIA 3U7JA 2HVEA 2IA6A 1OQ3A 2V4JA 4CLTA 4RNOA 4J9LA 3PM9A 1C1CA 1OPIA 4DU7A 2DEJA 4ED6A 5H9EJ 3G87A 2DHSA 1NKCA 1A0OB 4A8YA 4Z2XA 4U95A 2KRBA 3QPIA 3OR1B 4OZNA 4YDXA 3RGIA 3TP2A 5AXMA 1U1QA 3KJVB 1FWLA 2DNKA 2CQCA 1FFSB 1HNIB 2EI5A 4KKOB 3W2VB 3BYRA 3QZ7A 2DHXA 1T05A 1N4LA 1VHIA 4ZLJA 4Q0BB 2IY5B 2GGPA 1R8BA 3VAMA 3AQPA 4FXDA 3O3LA 3BSCA 3P49B 4LSLA 2PDAA 1RA6A 2MKYA 3DYAA 3GYGA 3I4HX 4F4YA 2X51A 1UCNA 2HNZA 1YJWS 1XTZA 1HBMB 1FHTA 5KT5A 2DBBA 4A47A 2VBXA 4ZVEA 1DQAA 4C2MA 1U49A 3VGUA 3BR9A 1DJ0A 4L72B 1U6ZA 4KH0B 4NOHA 3PEHA 3HJFA 2KM8B 3CD5A 5MAOA 2J9DE 3VCDA 3CMES 2H3EB 3AOAA 4F50A 1IXKA 5D4LA 2X1GA 2G9OA 3ZZZA 4X4TA 1Q79A 3G6VA 2YNIA 1K73T 2MQLA 3DOKA 3OL6A 4LQ3A 3M8WA 5HMZA 2GMHA 2XG8A 3OL9A 4USHA 3BKFA 4CH1A 3PJWA 3RAMA 3F73A 1EARA 2DNYA 2VODA 5KG7A 5GAHU 2RMLA 3W1YC 4OMFG 4IR1A 3MTKA 4UY8T 1TR0A 4FS1A 4ZMMA 1U26A 3V4MA 2RQ4A 3M2VB 1SQEA 2BE9B 2V8DA 3D3CJ 2J9DA 1RTDB 2AQ4A 2JFDA 4ZVUB 1U2FA 5IXUA 4LF4J 3PX0A 4GKKJ 3DDNA 1GMWD 1WKLA 3GIJA 2JWNA 4U6PA 2RDDA 2KH9A 3PW0A 4A8QA 1QUPA 3W9IA 4GKJJ 1VMBA 4RW9B 3F56A 1R8PA 4RNNA 1J5OA 1QSSA 1K44A 1F3VA 2Y1IA 1RWMB 1YRXA 3W61A 1RP5A 4DV4F 1QAIA 1NK7A 2EG2A 5FIIA 4AE5A 1IWAA 5BXIA 1C1BB 1S9EA 1TMJA 1SI9A 2HGLA 2XY5A 2Z2ZA 3Q8RB 3R2CJ 1SJ1A 2GVDB 2VH7A 1CBKA 1FRHA 3DRYA 4JV1A 3BO2A 3N9UC 3TYTA 4N5SA 3AD7C 2MHNA 2HMIA 2ZNYA 4PQUA 4CI0B 1M5VC 3MTJA 1HI0P 4ZN1A 4N8OA 2XI3A 5HQLA 2K7KA 1U25A 1H2TZ 4I6YA 3C66A 1FEHA 4XDDA 2HAIA 4O4GA 3M9NB 1F2GA 1G3OA 4N56A 4TYBA 2GVZA 1NUEA 2FUG9 3AOBA 4UQTA 1U24A 2RT3A 2OPQB 3VGTA 3ENWA 3UN2A 4DL4A 5AE1A 2Y8WA 1S1WB 5KFHA 5H9FK 3AHPA 3POTB 5SUHA 4NL5A 4ED1A 2RQMA 3UDEA 3Q86A 3P5BP 1QAJA 3H2UB 2FY1A 2KO1A 1W25A 4MIWA 1DLOB 1WC0A 1XNQF 1FK9B 2QN6B 2Z57B 3FBEA 3TA2A 3UPFA 2ATLA 3R5AA 3GR0A 4QIVA 4D3HA 2AHOB 5ETVA 3BGRB 4YB7A 5BYQA 2RQKA 2DJWA 4HDHA 3PJ9A 5FLXU 5HVFA 5KG0A 2GAGC 1BQNA 2NSBA 4MH8A 4DUZF 4LRDA 4JYAJ 5ETTA 2UXBJ 3BPDA 4DQQA 1SC4B 2ZC3A 3LP0B 4OZ2A 1XNRF 2YPYA 1HD0A 4E8UA 3T5LA 2CPJA 2IBOA 4ECYA 3ITHA 2E9TA 5AJ3F 4OX6A 3RR8A 4YB1P 2AJQA 3QJJA 2LA6A 3PFEA 2CZ4A 1IKVB 4R0JA 3GV5B 2DGTA 2JHEA 5J2NA 1RT5B 1KTQA 1DTTB 4O23A 5JJBA 2W2NP 3CCMS 3N6NA 1NSKL 2BJ7A 2CPDA 2RH3A 2Z30B 1VRTA 2V5HG 4DLGA 1SJ3P 2UXDJ 1OY8A 4H4MA 4U8YA 5KFTA 4IRDA 1VHFA 4IOCQ 1R0AB 4Y28C 3W2WA 2IVYA 3UI3A 4EWTA 5C24B 1VQNS 4C11B 4CLSA 4UT4A 2GMJA 4C0BA 4FPIA 4GC7A 1SIWB 1VRQC 2VZ9A 3JAMY 5E3PA 2VFTA 3IM9A 3ENAA 4CCHA 4P71A 2OKQA 2QJ3A 2ZHOA 1FI4A 2GQCA 2DGSA 3LQVA 2YKQA 4FXVA 3KHLA 2D1CA 2OEKA 4F3MA 4O3NA 4P75A 4DF8A 2KU7A 4URQU 5K14A 2E5JA 2EK6A 1VBKA 2A2CA 5CYMA 4ZCKA 1K8AT 2J8AA 4ECUA 5F8GA 2GC8A 3T1HF 5GMKa 2P9CA 4B3TF 3IAM9 3JS9A 3U1NA 1APSA 2K1RB 4PPDA 4RWWA 3K2YA 3ZZRA 2RIJA 5EWFA 4PUOA 4PRFA 3EGNA 3FRYA 2EVZA 5CHCB 4X4OA 5KT7A 3F44A 3DOKB 2UUTA 2BOAA 1LWXA 2Q43A 5G0RA 2VU5A 5HATA 3TVYA 5I3PA 4PKDB 3MM9A 4R0EA 5I4MA 3CXCR 1HI8A 5C7PA 4K4ZA 1UFLA 4X4SA 1V3RA 3MEDA 1R31A 3BV8A 3PIPQ 2VQFF 1GK8A 2XB2D 1VLYA 1UZHA 2E5IA 3UDLA 3FEYB 1NK4A 2BJ9A 2DPJA 2KFYA 1YGYA 3DDKA 3CJKB 3WX4A 3EZUA 1LWFB 1CJVA 4DJBA 5DLFA 4MAKA 2GIQA 2ABYA 2R7OA 4ICLB 4TKTA 4EZ9A 1ZM9A 1PJ5A 1FE0A 2DK2A 4JI1J 2HNYB 1YX2A 3DLBA 2E5HA 3MR2A 1U1LA 2QRRA 2E9RX 1G4CA 2CPZA 2JEFA 5J2QB 4LF1A 2PA8D 5F3ZA 3UCUP 1YK9A 1JNZB 4C4WA 3IN5A 1GXTA 2EWHA 3K17A 4CO1A 3S6EA 4A8MP 4O0NA 3WC2A 1RWOB 3HM9A 4QWDA 3GFHA 2KXHA 2QZ8A 4PXEA 4C8OA 1H6KX 4G1IA 3GILA 4NYOA 1DTQA 1UZDA 5IWAF 3CPWR 1FXDA 2O66A 3ZXWA 4NLWA 4NLGA 2CVIA 3A3OB 3BSAA 5CCMA 2EFQA 1HW8A 1HQEB 5DDPC 5J2PA 4PG7A 4C97A 3I55S 2VG7A 1HNWF 4O4GB 3Q8VA 3OJSA 3MOZA 4F2SA 2QYGA 3MUTP 5E33A 2EK1A 1Q81T 3KDOA 4NLDA 3HD1A 3M6WA 3ZO7A 4URSA 1LQ9A 3V81B 4QIEA 1BE4A 1N32J 1U6BA 2PC6A 1JLAA 4WU2A 2B4VA 1HR0J 1NEEA 2Y9HA 2RVJA 3MWBA 3D0HE 3M8PA 2QIFA 4DV2F 2YKNA 2WAQD 3OFHA 4DR1J 3PHEA 1J5EF 4OYPA 4M95A 1S0VA 1LK5A 4ALZA 3Q2TC 4K4TA 3MM8B 3NGKA 3V4IB 1RT7B 1EX8A 2J76E 2O5DA 1VQ9S 2OTLS 2NZ4A 1UETA 4RUHA 3BQ2A 3QGIA 4O44B 2P2CB 1LKZA 3SXLA 4YUDA 1S0OA 2RILA 4OYZA 2BACA 3KLFB 4WP3A 4FS2A 2KHCA 5F0WA 3J7Z5 4IRKA 2GIFA 2VFUA 4ZP8A 2C2MB 5ETNA 3SSSA 1EKRA 1JLFA 2GHVC 3O1LA 4Y2CA 3T1AA 2CZVC 3FK4A 2XMAA 1YVFA 3R9LA 2VA3A 1UFWA 3P6YC 4FF4A 4OX9F 2V6AA 2OFHX 3HULA 3SIPB 2B56A 1XEZA 7FD1A 4ID5B 4GO7X 1T8EA 4KHRA 4KO0B 2ZHAA 1FKPB 3M32B 4OHYA 2GX8A 2ZWOA 3Q8QB 1D8YA 3TW0A 3QLHA 4BDPA 2POKA 3L95X 2XZWA 4LR8A 3UVJA 4X66J 2IMOA 4Y0FA 5ETLA 5C24A 3S1TA 3TEHB 4EO8A 1XMOF 2M5YA 2BJDA 1X5OA 1N0VC 1S59A 4WE1B 1UFKA 4IOAQ 1CPZA 3NMAA 3OXFA 4OL8A 2BXJA 5G4DA 1U48A 2Q1LA 2LQBA 1WHXA 2BE2A 4L3KA 4OZ1A 4UZCA 2AYEA 2DD8S 2HBQB 1OY9A 2M70A 3R97A 4RNFA 3PIOQ 4DR1F 3MCMA 1R43A 2LMIA 4ZDNA 5HP1A 3K5LA 4ENOA 3PV8A 2E5LF 4DUTA 1UKUA 1P8GA 1FTRA 2MKSA 1F0XA 4OV6A 3SQGB 5F8IA 4Y3CA 2LEAA 5KFFA 5HJXA 4G1PA 2WCXA 1YDLA 3TZZA 4U96A 5D6GA 4CLWA 3KLHB 1RWUA 2MGZA 1RHMB 4H4KC 1J2VA 3DOLB 4USUA 1ZM2A 3QWPA 1PILA 1TELA 5HROB 3D9BA 3DRSA 1QM9A 4F36A 3AB4B 3BBCA 1FFGB 2RD5C 2L9WA 1ZM3A 3ILOA 1SKRA 1WELA 2LEBA 2GO9A 2ROGA 3MHYA 3R7NB 3N5FA 2DNNA 3C14A 4U7UD 4P2XA 2NR0A 4UUWA 2KZZA 4NCAA 3HHDA 1FERA 2R8JA 1HYSB 1QLNA 3D3BJ 5IQQA 2ACYA 3W60A 4Q8FA 1RAFB 3AAWB 2ASLA 4IG0B 1WACA 1SQFA 1B4SA 3E01A 4KFBA 5KG5A 4NLPA 2WTFA 2W9CA 1U45A 1C4CA 4WWSA 1IBMF 4USTA 5KFWA 2UUWA 3OL7A 2IHR1 3T9ZA 2V4QA 4DQPA 5E2QA 4LRFA 3LGHA 2XYGB 2XMTA 3O8WA 4Q2LA 4DL2A 2O67A 2RHSB 2KT3A 2FJDB 3OJUA 2JLEA 2KL8A 4IH6A 2R2RA 4PXBA 3SMZA 1SC3B 3HVTA 4DG1A 2UUAF 4K4UA 4YY3J 1T9UA 4BWJA 3FBCA 2XS2A 5LMNJ 4DV7F 4B3RF 4RX6A 5F9NA 2R7SA 5J1PA 3OLBA 2ZZTA 3AY0A 1QVFR 3DRPA 4JBCA 5U47A 2X1AA 2HHVA 5F8NA 2B6AA 3CC7S 5A8KB 2B9EA 1MN7A 2ILYA 2MKCA 1HR0F 2XSFA 4U7UK 2LQJA 5M2RA 1X5SA 3DLKA 1QDUB 2CYYA 3AJDA 1VQSA 3NCPA 3TEGA 4AXIA 4J37A 2VICA 2J6UA 2VG7B 4DL3A 4PG8A 4DL7A 4LSNA 2YWKA 1HWUA 2NXNA 1LK7A 3PHTA 4UQGA 1MWZA 5L39A 4I69A 1ZBTA 1RLDA 2Z0GA 4KTQA 2XI2A 1IM4A 2EBGA 1TL3A 3DXBA 4QBUA 3W7BA 4Q44A 5L9XA 1E6YA 4HI2A 5H1SV 3NS5A 3FGVA 3RBEA 2ZM6F 2I2YA 2HHQA 1JNRB 1RU1A 2KG0A 4JI4F 3IA0A 1O51A 1FRXA 1Y5NB 2ZE2A 3LF0A 4RJVA 3DCAA 5K5MA 3BH7B 1K9MT 4X65F 1RXOB 2PE8A 3DOMA 2CRLA 3TUJC 1J5OB 3QAUA 3UFCX 3NNHA 3ELHA 2LLZA 4DF4A 1NJZA 3U1LA 3QT8A 1LWCA 4MTPA 1NRKA 3VAHA 2G2OA 1FFWB 1MROA 2F3JA 1RYRA 1E6VA 3DM2A 2BMBA 3JYTB 4JI0F 1NDCA 3IBCB 3DN9A 1OYEA 1S9GA 1Y0HA 2CPXA 3HCXA 2AJ2A 3HFZB 1FX2A 4LVNP 3GIKA 3CC2S 3PW4A 1NZAA 1WJ9A 4I1TA 3HVRA 4LUBA 1S77D 3BREA 1R89A 3M30B 2HHSA 3KOAA 3T3FA 4X4PA 1NK9A 1T11A 3SSQA 2RF2A 4I2PB 2JC1A 4HHUA 4X66F 2DIVA 3ET6A 4F02A 3QWUA 2WSFC 1ZH5A 3R6LB 4MFBB 3GWCA 5F8MA 3MECB 2XS7A 1SKWA 1KNZA 1RT1B 2HRTA 5KFGA 3RRKA 2HFNA 4CNYA 1S1WA 1PAEX 1R6VA 2C42A 1VFJA 4E98A 4IQMA 1FA0A 2XC9A 1U8WA 4DMZA 4KGMA 5CD4H 4XPEA 2HQ3A 2WVCA 2LFVA 3TA1A 1X0FA 1ULRA 1TL5A 4QQBA 3Q8PB 1IJFB 2OSQA 3P4UB 4HVZA 4RBVA 4CT9A 4CYUB 3KLGB 1JXLA 5KFIA 1S0NA 1B0PA 4XIUA 4LFAF 1JLCA 3MGJA 1N5VA 2DNOA 3D67A 5IQ6A 1KLMA 1KS2A 3DLGA 4KC5A 3TX0A 4OYOA 1DZ5A 4DPUA 3RU0A 3K0JA 2K3IA 2F8EX 1EZZB 1FWPA 2FDNA 4DFKA 2J7UA 1W26A 4F0HA 4IKAA 2W4CA 3ISNC 2HKEA 1AW0A 2CNNB 3SV4A 1S1VB 1H38A 3LGMA 3ILIA 5DLGA 1EQ0A 4FPRA 3Q83A 1WEXA 2MDAA 3FBFA 3OSNA 4ED8A 1KVIA 1JLBB 1IR2A 3CDBA 4KKOA 3W2VA 1WC5A 4Q45A 1VBZA 1M5PC 2C22A 4UOCA 2QYCA 2FVRA 3AXKA 3QIPB 3F41A 1HA1A 4LF8J 4NYPA 4EBEA 3QYYA 2BQUA 4I6WA 3FBBA 3A3NB 1JX4A 4PWDB 4K4XA 4Z7YA 3QZ8A 1HNWJ 4QIFA 3N28A 1U1KA 2WB4A 3SBMA 1J27A 2YNHB 3MEEA 4DR2F 2I8EA 5KFDA 2OPSA 4UW2A 2FVSA 4GC6A 3KK3A 2PD1A 1UA1A 3KK1A 2R8GA 4IDKB 3CSKA 3DHWC 5KT2A 5DG9A 2JFKA 2ADCA 4ZPVR 1N5YB 4LMZA 3ETOA 3J80U 1QE1B 1XNRJ 1RQ0A 4QIGA 4CLYA 4JYAF 1T02A 1RE1B 9ATCB 2B51A 3GG0A 3KLIB 3VGSA 3C2PA 4UTGA 4CLKA 2FGOA 4J5OA 1N8RT 2HBYB 5T14A 2EFNA 3M9MB 1R7IA 2CJ9A 2FLOA 4LT6A 1UEKA 1NLKL 5T41A 4JI3F 1WDTA 3G2XA 1ZS6A 2HBRB 2V2KA 4Y34A 3JSMB 1PBAA 1KRPA 4C8LA 1QAXA 1H3DA 1VS3A 2F4VF 5CA5A 2WBMA 1RT4B 1ROFA 5A76A 5E41A 3UE2A 2V2VA 2WHOA 4YB6A 2E7WA 1NMEB 2WOMB 3LAMA 2MQQA 2VASA 3FQKA 3EGZA 2Y1LB 2QLBB 3EPIA 2HIYA 3ILJA 3V6DA 3OR2B 2ZDPA 1PO6A 4NA1A 4DX6A 3UW1A 2UV8G 5BYRA 2HVIA 4OI3A 5ETSA 3N01A 2VBYA 1FX4A 3MEGB 3WBZA 4RU2A 1HNZJ 3HK2A 2BQRA 4KHPJ 2RAQA 1SXLA 2ZBRA 4CWBA 1X9SA 2HZVA 2W01A 3TUZC 5CXTA 1GMVA 3M8SA 1NSPA 1H2VZ 2I1RA 3MR3A 2VFRA 1EETA 3T5HA 1JQGA 3CJKA 1NPKA 2PO4A 4R25A 3CCVS 2R7RA 2HMIB 2DHAA 4NLQA 4UZBA 4KT0C 4C3LA 2V0NA 2OLWA 2GGPB 1TUGB 4OYBA 4JI5F 3AD9C 1R6YA 1P9QC 2A3JA 1YZ6A 2LA4A 3I4PA 1UWBB 3I56S 2BDPA 4QWBA 2AWZA 4NEZA 3QNWB 1OYDA 3L7UA 3HZGA 4R5PB 3B78A 1N5SA 4B3MJ 4XPCA 1K0TA 2VG6A 4ED5A 3DMJB 2HW3A 3H59A 5ETPA 3AOCA 3R1HA 3TI0A 4LF7J 1SIZA 2CADA 2J9CA 3IFEA 1HPZA 4O3PA 4TN2A 1HMVA 1ZA1B 3FSIA 1EIYB 2XY7A 3BN4A 5D0RA 5I42A 4NLYA 4C8NA 1A6LA 4DWIA 3MMBB 3V6DB 1TVRA 2NXEA 2Q3PA 3VQSA 3HSDA 3DU6A 4CH0S 3SDEB 2HQDA 3KK2A 3G71S 4P74A 3IR7B 4PZVA 3NWGA 3BO4A 2JVRA 4MJKA 4WFBQ 3KFWX 4OZ5A 1Q7YT 5KTQA 2KZMA 4KHPF 4RNHA 3JXOA 4K4WA 1SUQB 4ECQA 2ZOFA 1RHJB 1SV5A 3MMCB 5K20B 2G0IA 5L1LA 2KHDA 3M8PB 4WF9Q 3LA0A 4P2SA 3PYGA 4RW6A 2KJWA 3ZNJ1 4ATNA 2KTQA 2E9ZA 4DV1J 2J0QD 3MM8A 3Q89A 4WFXA 4DQRA 4KQZA 1CQMA 1NH8A 3TOQA 1RBAA 2YNFB 3DLLQ 3S01A 3QT6A 5HMWA 1NCLA 4LF6J 1VLOA 1IJEB 2B3TB 5DZ6A 3RW7A 2LEPA 1FJCA 3EM1A 2J5AA 2IM1A 1NO8A 1NHVA 3K5OA 4JI2F 2MQPA 2OEJA 3R6GB 3KJNB 2RKIB 5CAAA 1R8CA 3MXHP 2ALYB 5HK4A 4C3KA 2AV5A 1N32F 1D3WA 3HSJA 4O3OA 1R8HA 3W5YA 4X62F 4FKYA 2M52A 4CT8A 3AJ2A 5ETMA 5KFNA 2CQ0A 1VRUA 2PT0A 1EB0A 2R7UA 1G2EA 2W1BA 4FYVB 3TR5A 3DNCA 2JRSA 1YBAA 1RAGB 3Q0AA 1AZSA 2CNKB 2KJVA 3MD3A 4DR2J 1T03A 4HKQA 2OD6A 5F8JA 5K14B 2DNHA 1SB6A 4OJ1A 2XZDB 3AA9A 3CJ3A 4YQWA 3IRXB 3D0GE 4F25A 3BKUA 4OHXA 2UU9F 1BD6A 3DGVA 3EDRB 2BKOA 4F04B 1MW7A 2PSZA 2QG9B 4WE1A 4ZVQB 3J7ZT 1AUDA 4B9TA 3K89A 3U27A 4IDKA 4TU8A 2LU2A 2W2QP 1Y11A 3I32A 1U0SA 1MMDA 3VZIA 1S10A 3L7OA 4NZ0A 2XHWA 3KG4A 4OHZA 2RNEA 3C6UA 2VHGA 1QE1A 4PWUA 3L3CA 1O5JA 3GCWP 4J9VA 2XGPA 4WYWA 1NH7A 2COLA 4NLUA 1F6TA 1V5VA 3SCLE 1IBLF 2IJRA 2YQ3A 2XMWA 1CULB 1ZA2B 4OYXA 4NPOA 3ZTSA 3CCUS 2ZOGA 4IYQA 3VWSA 4F8RA 2B4PA 1SL1A 4OX8A 2X3GA 3ITHB 2ERRA 2HS3A 4WP9A 3C16B 2PI5A 3KJVA 2MGZB 2I9SA 2HHTA 1HBUA 1RKIA 1WG5A 3K58A 3TQ1A 4KH1B 1HNIA 4LF4F 4GKKF 1Z2LA 4JI2J 3PX4A 1RISA 2MY8A 2FTRA 1LNQA 5GAGU 2E1CA 2CZ9A 3OR2A 4I67A 3QJLA 4EU0A 1GX5A 3VAKA 4WZMA 2DNPA 2DR8A 3D28A 1VRTB 4ZCMA 2BZ2A 1KQSR 4H4MB 1IKYA 2IFXA 3MEGA 1U6FA 2YX7A 3ADAC 1S4EA 4ECVA 4ANCA 3I31A 5JVGQ 4RWXA 1XMOJ 4KGXB 1ELOA 5HVHA 1U4BA 3VTIA 2DY9A 3W65A 3CDAA 3MI7X 2N7CA 1BY9A 1KDNA 2AGOA 3DLEB 3C19A 4I68A 2XNRA 4CO3A 4NCGA 2PGCA 4IO1A 5AE2A 3GG1A 2BRKA 2QSFA 4OI4A 5HBMA 5LJ3Y 2FZCB 1S1TB 1YJTA 3O44A 4RW7A 4M94A 4DBQA 6AT1B 4TQRA 1F5BA 3RW6A 1WOPA 4X2BA 4IG3A 4DPYA 5M2PA 1PSDA 2B0GA 1WOOA 5DG8A 4DV6F 3HHKA 2WVFA 3I6PA 2E1MC 3OTBA 2MLXA 3MMAA 4DL5A 2J0WA 1KR4A 4LIRA 2PN6A 3R5BA 4OJHA 3DRRA 4Q5VA 2LQ9A 1JXEA 1N0UA 1RA7A 2FHKA 2HFUA 2LXUA 3N79A 2NXUA 4PG5A 4ZP9A 4B9SA 3TJAA 1IKWB 2NXCA 4LSZB 4LRBA 4DPWA 4WFAQ 1WDDA 1PIEA 1X5PA 3GIMA 4ITSA 3K5PA 1RKJA 2A18A 1BQMA 1EP4B 4XAKA 3DFEA 2BBEA 2PFDA 4M1KA 5C2CA 1JWWA 2G13A 3I87A 3BDPA 4J9SA 2CKWA 1U1OA 4J91A 4OHWA 3VAJA 2CJQA 3SDEA 5BR8J 3L9ZA 3FFIA 4X4QA 1F9EB 1RBOB 1HIYA 1IBCB 2CVEA 3BSNA 3TX8A 4BS2A 4F67A 2DRDA 1O8BA 2V8GA 3OTDA 3KLFA 3M2RA 3ENVA 3QGPA 3RR7A 2ZITA 1I94J 1M5HA 2BYCA 2ZDOA 1T05B 2BJEA 3PNIA 3LOUA 3H7HB 4MK9A 1GXUA 5DDRC 3A1YG 2FC8A 1FKOB 2NCKL 1U7LA 3M2UA 4LRCA 2KRRA 3UNGC 3I5AA 5DM6Q 3GSDA 2NXJA 4KO0A 5B09A 1RK8A 1RUSA 1U0HA 4DV7J 1CVJA 4C98A 3MAQA 1HNVA 3BGOP 5LOQA 3EYZA 1Y7PA 2UUAJ 2V2ZA 1TZ0A 5A8RA 4LF8F 1NBEB 2FGCA 3D68A 3UD4P 1WORA 2ZH5A 1FXRA 2VC1A 3BPSP 3GYXB 3I0SA 1UW4A 3IMQJ 3PYEA 3SFGA 4X4UA 5KFBA 4B3SJ 5HSPA 4IQXA 3AD8C 5D8HB 3CO0P 4OLPA 1WHVA 5KG6A 2L41A 3X3UA 4CM0A 2B9XA 3OHBA 3LPYA 5CQGA 1IBKJ 1FK9A 4FVCA 4DSIA 4DV3F 4LBIA 2VDHA 3H90A 1TFYA 2QMWA 2H51B 3N6MA 3MCSA 3MR7A 2D69A 1C0UB 3RBZA 4CH7A 3ZZOA 4B02A 1L3VA 2IMWP 2DXEA 2DNQA 1S1XA 2BM1A 1RHKB 1WF2A 3R5JB 4ZIVA 3M9OB 4C8MA 4LBHA 2QC3A 4LR7A 1KD1T 3T1YF 1JLQA 3QGGA 2HFVA 5LMUJ 2AX1A 1YKWA 3B82A 2JVOA 5HJYA 2EC0A 2KN4A 4P2MA 3B8HA 2BQ3A 2EXUA 1FDBA 1VQLS 1AYEA 5JVHQ 4FNIA 4ZCIA 2VPYB 3MZIA 4Y65A 5H9EK 3LANA 4BHQA 3NOGA 4DR5F 1GNKA 4V19X 3A8JA 1N34J 5I3UB 1XWLA 5FJ4A 3CJSA 1KQKA 1U1NA 3UD5A 1FJEB 1REVB 2F8HA 2BANA 1YJUA 3O6QA 3R3TA 3VALA
chains in the Genus database with same CATH topology
1HQ2A 3HCXA 4M5MA 4CRJA 4CYUB 1RB0A 4M5LA 1EX8A 4PZVA 1TMMA 4M5JA 5ETRA 1EQMA 4M5IA 5ETLA 1KBRA 4M5GA 3HSJA 1F9HA 3HSZA 5ETOA 3KUGA 3ILJA 3MCOA 5ETMA 1Q0NA 3UDEA 1TMJA 1DY3A 3MCNA 5ETQA 3ILOA 3HSGA 3IP0A 2QX0A 1RU1A 1HKAA 1CBKA 5ETSA 5ETNA 4CYUA 5ETPA 3QBCA 2F63A 1RTZA 3HD1A 3ILIA 4M5KA 5ETVA 1RAOA 5ETKA 3ILLA 3MCMA 3UDVA 4CWBA 1G4CA 1IM6A 3KUHA 4AD6A 1EQ0A 2CG8A 5ETTA 3KUEA 4M5NA 3HT0A 3UD5A 4F7VA 4M5HA 3HD2A 2BMBA 2F65A 1RU2A 3HSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ2 A;  3HCX A;  4M5M A;  4CRJ A;  4CYU B;  1RB0 A;  4M5L A;  1EX8 A;  4PZV A;  1TMM A;  4M5J A;  5ETR A;  1EQM A;  4M5I A;  5ETL A;  1KBR A;  4M5G A;  3HSJ A;  1F9H A;  3HSZ A;  5ETO A;  3KUG A;  3ILJ A;  3MCO A;  5ETM A;  1Q0N A;  3UDE A;  1TMJ A;  1DY3 A;  3MCN A;  5ETQ A;  3ILO A;  3HSG A;  3IP0 A;  2QX0 A;  1RU1 A;  1HKA A;  1CBK A;  5ETS A;  5ETN A;  4CYU A;  5ETP A;  3QBC A;  2F63 A;  1RTZ A;  3HD1 A;  3ILI A;  4M5K A;  5ETV A;  1RAO A;  5ETK A;  3ILL A;  3MCM A;  3UDV A;  4CWB A;  1G4C A;  1IM6 A;  3KUH A;  4AD6 A;  1EQ0 A;  2CG8 A;  5ETT A;  3KUE A;  4M5N A;  3HT0 A;  3UD5 A;  4F7V A;  4M5H A;  3HD2 A;  2BMB A;  2F65 A;  1RU2 A;  3HSD A; 
#chains in the Genus database with same CATH topology
 2EFV A;  4LF5 F;  2IVF B;  1RAC B;  2DKO B;  2XUL A;  1WSR A;  3FJ2 A;  3RBX A;  1ZAX A;  2G2Z A;  3CJ2 A;  2LDY A;  1NSQ A;  2RE1 A;  3TQE A;  3SI8 A;  1YHQ S;  3I9V 9;  4P7T A;  1FD8 A;  2EG1 A;  2Z8Q A;  4PEO A;  1RTI B;  3EGW B;  3MAH A;  5CH7 B;  3J81 U;  4ZJQ A;  4ZOS A;  1JLG B;  2V94 A;  1RGV A;  3EGV A;  3UN3 A;  4MIA A;  3GQC A;  3M32 A;  4BBY A;  1FKA F;  2GNK A;  3ULH A;  1TKT B;  3UQS A;  2CJA A;  4LVO P;  4FBU A;  2Y3Y A;  1IKY B;  4M5D A;  1H7W A;  7FDR A;  1HHQ A;  3MM6 A;  1K1Q A;  1ACM B;  2BAB A;  2H1Y A;  3HVT B;  3W9J A;  3PKM A;  2FJB B;  3DC2 A;  1B64 A;  1KLN A;  1FNO A;  4I7F B;  1UJ4 A;  1TKZ A;  3A13 A;  1P1L A;  1UPP A;  3HT0 A;  4TY8 B;  3D6H B;  3CCW A;  2MY7 A;  2C3M A;  4Z37 A;  3CGI A;  4DZD A;  1JXV A;  2LYV A;  2UVW A;  4RZR A;  4DN0 A;  4DR6 J;  1S1T A;  4QYZ K;  3BGR A;  1KBR A;  1RAB B;  3FMB A;  2OPP A;  3FSX A;  2V4J B;  1HWJ A;  3BB5 A;  1IQZ A;  2YWW A;  3L09 A;  3T19 A;  5JMN A;  3GP9 A;  4Y6I A;  1VQ5 S;  4Y2K A;  2FZK B;  5L1I A;  1Y4Z B;  1KEK A;  2CQB A;  4WU3 A;  3G8S A;  2UVR A;  1TV6 A;  2V63 A;  3DRR B;  1N6Q B;  2J8S A;  3CCE S;  1SL0 A;  3O5T B;  2F63 A;  2BM0 A;  2GZO A;  4IFY B;  2C2E A;  3TAM B;  1JJ4 A;  3LTO A;  4I0W A;  4USV A;  3SYZ A;  1D09 B;  3MAA A;  3SFU A;  1PYT A;  2GQQ A;  2ZH2 A;  1NU4 A;  1GMW A;  1RT5 A;  2IAJ A;  2KYZ A;  5HMX A;  2C2K B;  3C15 A;  1KKH A;  2B5J B;  2XY6 A;  3NL0 A;  1G6B A;  4RLE A;  4ZVS B;  3CJ8 A;  1UWA A;  1Z2Z A;  2B43 A;  3AT1 B;  2UUB F;  1FDA A;  4I6A A;  3RUB L;  3PXG a;  2DNM A;  2KVQ E;  2JL9 A;  1VQO S;  4AND A;  4NXM J;  4G65 A;  2HBZ B;  2HGN A;  1GFW B;  1VBY A;  1MRO B;  3ZZT A;  2FVC A;  3G4S S;  2N4D A;  3CMQ A;  5HAO A;  4ED0 A;  2R7T A;  4JV5 F;  3NNC A;  1SH3 A;  1OS5 A;  3I9Z A;  3D6T B;  1IKX B;  5CYQ B;  4ZVP B;  3IS9 B;  4DLE A;  2MQN A;  2JLF A;  5K9F A;  3KLE A;  3PO5 A;  2E29 A;  4LQ9 A;  1TUV A;  4DOZ A;  2W24 A;  1Q16 B;  3M30 A;  1YJR A;  3IWX A;  1XR6 A;  3CF5 Q;  2XWX A;  2BJ8 A;  3HT3 A;  3RZA A;  2R3V A;  1MWQ A;  5IOL A;  2ALZ A;  3JQK A;  4LFB F;  4HH1 A;  4ZPA A;  2K7J A;  5B0A A;  8ATC B;  1RBL A;  1UVK A;  2GW8 A;  2R8K A;  4BLG A;  3KMS A;  2OEL A;  4Y2A A;  2XSJ B;  3TAP A;  1IQT A;  3MPY A;  1TL1 B;  1X4A A;  2F4F A;  4CO0 A;  4OFZ A;  2CA9 A;  3NGT A;  4ZN3 A;  2XCP A;  1RTD A;  2RRA A;  2FB0 A;  2C1E B;  1HMV B;  3QO9 B;  2B6A B;  4RO0 A;  2M9K A;  3ISN D;  4DHV A;  4C8Z A;  1DBD A;  1T9W A;  2C3Y A;  1TUW A;  2VKZ G;  5LMN F;  3EXY A;  4B3R J;  3KHR A;  3BGL A;  4IUF A;  4HLB A;  5G0R B;  3G6E S;  3S8S A;  3BO3 A;  3V4I A;  1LW2 B;  1M0S A;  4X4V A;  3DRX A;  3MM9 B;  1KON A;  4YS2 A;  2JEI A;  1JLC B;  1GAO A;  1M5S A;  1FVS A;  2J7K A;  2OEM A;  2ZVI A;  5EDW A;  1KLM B;  3TWZ A;  1MSW D;  4DSE A;  4YME A;  4EGL A;  3LW5 C;  1VI7 A;  1YBT A;  3FSY A;  1P6T A;  4P10 A;  1UVL A;  3BS9 A;  3W62 A;  1S1X B;  1QTM A;  4A8F A;  1Q4R A;  2E7V A;  1SUQ A;  1FRI A;  2OHD A;  5IT0 A;  5D3G B;  3PFO A;  1O0P A;  2QT7 A;  2ZUG A;  3MPU B;  3TZW A;  5KT3 A;  5B0C A;  4YR3 A;  1ZTW A;  1D9D A;  4V19 J;  1FEE A;  1EHW A;  4QWE A;  4B08 A;  1KSP A;  3PAC A;  4ID5 A;  3PDN A;  4ZPT R;  5KFL A;  4KV8 A;  4OJG A;  4ES2 A;  4ETX A;  1KFS A;  2BOP A;  3HPO A;  4OX9 J;  4YR0 A;  3QAE A;  2QLW A;  4DDF A;  2YNF A;  2ASJ A;  4KE5 A;  2Y0S D;  2BKP A;  2HZA A;  2DPI A;  1Y3J A;  1ARO P;  1HBN A;  1VIS A;  2A1B A;  3GE9 A;  3LAL A;  3CCR S;  1S0M A;  3E8O A;  3FRZ A;  1WI8 A;  3KJF B;  3HF5 A;  3CCS S;  2R7W A;  1K1S A;  2B4O A;  2H9Z A;  3BGU A;  4K5R A;  4C9D A;  1WF0 A;  1N48 A;  2AW0 A;  3KK3 B;  3MPW A;  2IJF A;  1XC9 A;  3MOJ B;  4LFB J;  1RTI A;  2KXN B;  1Q5Y A;  4DFJ A;  2MZJ A;  2X7I A;  1VCT A;  5E3Q A;  2CQ4 A;  4NA2 A;  1VRU B;  4ZJL A;  5KT6 A;  2NLW A;  3CT9 A;  1NND A;  4WYL A;  5J2M A;  3IBW A;  1VGY A;  1VC5 A;  4MFB A;  4ZIW A;  3RB4 A;  5A0Y A;  1TMM A;  4RW4 B;  5F41 A;  4AL6 A;  3SQO P;  5ETR A;  1N54 B;  3QMQ A;  1H7X A;  1NDL A;  4JV5 J;  2MLY A;  3PJX A;  1WTB A;  1NM2 A;  1RT6 A;  3CW2 C;  4PPZ A;  4L74 A;  3SCK E;  4DV0 F;  4J9R A;  3EX7 B;  4PR6 A;  5GAG I;  3RRG A;  1ZPW X;  5LJ5 Y;  5KT4 A;  1PC4 A;  4ELT A;  2NUU G;  1S9F A;  1S6Q B;  2CQ1 A;  2JZ5 A;  3CTR A;  4Q7A A;  2D3O R;  2XTJ P;  1HQU B;  2H65 B;  5J2N B;  1U09 A;  3GFZ A;  5KFX A;  3PEJ A;  3DRS B;  4A46 A;  5KFP A;  4I2Q B;  3IWL A;  2WK4 A;  2ATC B;  4P73 A;  3BKT A;  2DH7 A;  4QPX A;  3EMT A;  5IM0 B;  3W8P A;  5IWA J;  3VF0 B;  4DFP A;  4BC7 A;  5MLC V;  3PZP A;  1HWI A;  2OPR B;  4M5M A;  2NPF A;  1O6X A;  1X4D A;  2AX0 A;  1NHU A;  3FUY A;  4CTA B;  5HVG A;  2YKM A;  3NBP A;  5A8W A;  3GR1 A;  8AT1 B;  1VJW A;  2XMU A;  2V50 A;  2HK3 A;  3PRD A;  1FT8 A;  2V8H A;  1NAQ A;  2V9K A;  1VK8 A;  3R5C A;  4ED3 A;  3HHL B;  2UZA A;  1SH0 A;  3D2W A;  3WC0 A;  1YQH A;  2DGU A;  3BDE A;  3D6M B;  4ZK7 M;  1WG1 A;  3G82 B;  3OL8 A;  4KAI A;  2FLN A;  2AYM A;  3PVX A;  1RWX B;  4ECT A;  4OYI A;  4TVA B;  4M5K A;  4KPY A;  4ILL A;  3WDO A;  1N33 J;  2DYA A;  4QR2 A;  4H4O B;  2JSX A;  3C3L A;  2NSC A;  5CZX A;  2B7B B;  3AB2 B;  2DR7 A;  3D4J A;  2BV3 A;  3CC4 S;  2VG6 B;  3FCH A;  4BWM A;  1ZPV A;  2ZBC A;  5KFS A;  1M1H A;  5B08 A;  3QFW A;  3LWL A;  2EEY A;  2MKJ A;  2AYG A;  3EVM A;  3KXD A;  2D74 B;  2G1H A;  3Q22 A;  4N76 A;  2C2O B;  1HPZ B;  1CJU B;  2K1R A;  2V69 A;  1MWY A;  4QR0 A;  2AKW B;  3ONQ A;  3ZZU A;  1U2C A;  4E0D A;  1K0V A;  3H0P A;  4QW9 A;  2KYX A;  4DS5 A;  1R3N A;  4C3M A;  4OYA A;  4RKU C;  4ZLP A;  2LDI A;  2PII A;  3KLI A;  3C6T A;  1DAR A;  1Q86 T;  2OAU A;  1OQ6 A;  4FYX B;  1T95 A;  1EJ7 L;  1X4B A;  2P6T A;  3MCN A;  4H54 A;  5D0G A;  4IFV B;  1D0E A;  4L6V 3;  1TK5 A;  2XSJ A;  2AGQ A;  1VQK S;  1JMT A;  3CJ5 A;  4LF5 J;  4Y2I A;  2DNZ A;  2MZT A;  4PG4 A;  4MKY A;  4A48 A;  2HS0 A;  3SEO A;  3UDV A;  1IUJ A;  2PEH A;  1SCJ B;  1LWF A;  3PYF A;  4Y2M A;  4ZVF A;  5B0D A;  1E6Y B;  5K8M A;  4RUA A;  4OZJ A;  4OQJ A;  3BZQ A;  1XR7 A;  3ZZP A;  4A8S A;  2G2Y A;  2GIR A;  3ZTR A;  3OTO J;  4ICL A;  4Q2M A;  4USK A;  3BSO A;  1KC8 T;  2PMH A;  2ACM A;  2RHQ B;  4GVB B;  1WF1 A;  4EBC A;  2M4M A;  2HQI A;  2OMO A;  3CDU A;  3T5J A;  2BJ1 A;  3OXL A;  1L3U A;  4MKV A;  3T1Y J;  1PKU A;  2OP5 A;  3JSY A;  2PMZ D;  1BMQ B;  4GO5 X;  1R8A A;  2YWH A;  2ZFH A;  1RTH B;  4KFB B;  1VQ8 S;  5L8R C;  4DSL A;  4HI1 A;  4OI2 A;  4F0M A;  2UXD F;  1GEH A;  3R5D A;  3QBC A;  3L7P A;  5KG3 A;  1GT8 A;  4OHV A;  4NCB A;  4FDF A;  4K50 A;  1Q53 A;  1MMN A;  1YJV A;  2RF2 B;  3IGN A;  3JTN A;  4I2P A;  2MZQ A;  2R2S A;  1SBR A;  1UWB A;  2C2R A;  1H0H B;  3R7S B;  1C2P A;  1LEO A;  4HT7 A;  4QR1 A;  4HR2 A;  4UOH A;  2DO0 A;  3GIR A;  1RU2 A;  2HHW A;  4D3G A;  3W5X A;  2DR9 A;  2Z4P A;  2HLT A;  2I38 A;  3T6J A;  2UXB F;  2CIM A;  3N6L A;  3LP1 A;  3NGS A;  1S6P B;  3WHI A;  1SQG A;  3LP2 A;  2LP4 A;  2U1A A;  3HKZ D;  4B3T J;  2YTC A;  2LKZ A;  1BUX A;  2IM2 A;  1YJ7 A;  3MMB A;  2MQO A;  2W8K A;  5F3T A;  2CQ3 A;  5KFJ A;  3C6U B;  1MG7 A;  2R9L A;  3KK2 B;  3B4M A;  3HJV A;  5J2M B;  4DL6 A;  4F2R A;  4NZ7 A;  2JOQ A;  2GVZ B;  1S7H A;  4FBT A;  1UPM B;  2R2T A;  3PKY A;  3ZZY A;  2FJW A;  1H74 A;  4JI6 F;  1TL3 B;  5HMY A;  3VHQ A;  1SV5 B;  3MMC A;  5HI7 A;  4DXL A;  3CCQ S;  3D0I E;  1H98 A;  3QFH A;  5F9L A;  4YP3 A;  2XCA A;  1JLF B;  1S57 A;  2JX2 A;  2DNG A;  3M6X A;  3MM5 A;  3W9H A;  1NJY A;  1T7P A;  4J9U E;  4B9U A;  1IR0 A;  4DSK A;  4F4Z A;  2B4U A;  2CDR B;  4S0M A;  3IR5 B;  4TNO A;  5AE3 A;  4I4B A;  1KVK A;  2MZ1 A;  1FKP A;  2N82 B;  1URN A;  4PQU B;  1T9Y A;  3RJM B;  2N3O A;  3RTV A;  4NAS A;  5DJB A;  3GV7 B;  1YG0 A;  2HHU A;  1S1U B;  2FC9 A;  2M88 A;  4ILM A;  2PMW A;  4ZLN A;  3J81 Y;  4J9P A;  3CCT A;  2FQQ B;  4ZPB A;  1PBU A;  1VQY A;  3OXG A;  4MMO A;  5D0H A;  2CFX A;  4OX7 A;  3NGD A;  4LF6 F;  5EN1 A;  1IBK F;  2MLZ A;  2RUG A;  4KGK A;  4K4Y A;  4UOF A;  1HNX J;  2IDL A;  3QRP A;  3CB4 A;  4FZV A;  2V8P A;  2ZEJ A;  3J7A 1;  4NRT A;  5T7L B;  3TAR A;  4CO4 A;  1CC8 A;  3DKD A;  1JLG A;  3OVA A;  5HBM B;  1YRU A;  2A6O A;  4RW7 B;  2HG4 A;  2C3U A;  3G82 A;  1NPR A;  1NDK A;  4DUZ J;  3MEC A;  3PO4 A;  3G6X A;  2GO8 A;  1HAR A;  3IG1 A;  1CJT A;  4Q0B A;  3LP0 A;  1WC4 A;  4ZHR A;  4CO2 A;  4EBD A;  3BGF A;  4WXO A;  2AYB A;  2LQ5 A;  2CWX A;  3FDS A;  3H4D A;  2EW9 A;  4YHH F;  4URG A;  4NLV A;  3DGP B;  3M8Q A;  1I94 F;  1VQ6 S;  3HHE A;  2WSE C;  1WG4 A;  2E5G A;  2FD2 A;  5D0E A;  1EP4 A;  1GTH A;  5B0F A;  3SCI E;  3ISZ A;  4XO0 A;  4ZVT B;  2O01 C;  4NXM F;  1X9W A;  3LGN A;  1NJI T;  3DLG B;  4B3O A;  2F40 A;  2Q6C A;  4AQY F;  1PAU B;  2QA4 S;  4RR5 A;  4C0O C;  3R27 A;  4TU9 A;  3J80 Y;  4QZV B;  5KG1 A;  3DHX A;  2ASY A;  4CRJ A;  3EZO A;  2MTL A;  3V6K A;  3VGV A;  2IBK A;  1V5I B;  3P96 A;  3AOD A;  2ASD A;  3J7A N;  5SZT A;  3Q2S C;  1QAY A;  5DZ7 A;  3TVK A;  2DTJ A;  7AT1 B;  4RNM A;  1Q95 G;  3H5U A;  4ZLL A;  1U47 A;  2ADB A;  1T9X A;  2VD3 A;  1PJ7 A;  4A8O A;  4WFN Q;  1W7W A;  4WII A;  5IT9 U;  1RWK B;  2HUR A;  1Q8B A;  2XMV A;  4CM2 A;  1WC6 A;  3A3P B;  3AXM A;  2M3D A;  3S7R A;  4Y00 A;  1U0H B;  1N36 F;  1GXL A;  5CYM B;  3MED B;  3T5K A;  2YH1 A;  1AFI A;  3M1V B;  4EYH B;  3NCQ A;  5F0U A;  2UU9 J;  1DQ9 A;  1TFW A;  4NLX A;  1WHW A;  4WKY A;  2IM0 A;  1AUS L;  5IT9 Y;  2OPS B;  1S48 A;  4UUX A;  4M5H A;  5CYQ A;  2HVH A;  3TO8 A;  2C2Z B;  2ZH1 A;  4DV3 J;  1X8D A;  5KFR A;  2ZBI A;  4WPA A;  4TU7 A;  3MR6 A;  2UUC J;  1WEY A;  3FZB A;  1C4A A;  3GJR B;  3D54 A;  4X64 J;  1N5Y A;  3OW2 R;  1U1R A;  1X5T A;  3HO1 A;  2JJ4 D;  4ZVR B;  4ECW A;  2XNQ A;  3VVT A;  1V6H A;  3GFX A;  3W63 A;  4YHH J;  4X62 J;  2E1A A;  3CMA S;  3GMG A;  4WJB A;  1KQF B;  4MT1 A;  2V8V A;  1B7F A;  4QCL A;  4ER8 A;  4WXW A;  2H54 B;  4JI3 J;  1M90 T;  1RT4 A;  4GVL A;  3PYD A;  3EVW A;  3LP1 B;  4WFZ A;  1CLF A;  2FJV A;  4WBF A;  3QO9 A;  4HTI A;  2VON A;  3D66 A;  5KFM A;  1DTQ B;  3CDE A;  2X1B A;  5DM7 Q;  4I64 A;  3NS7 B;  2ZE2 B;  3HP6 A;  3RAQ A;  5FD1 A;  1F3F A;  1RAH B;  1LW2 A;  2VUG A;  1URR A;  3R1L A;  1HQE A;  4PG6 A;  3FNN A;  5J2P B;  3MFH A;  5CCL A;  3TAQ A;  1XK8 A;  1TK8 A;  3KMQ A;  1WWH A;  1RT3 B;  2QL7 B;  2FPH X;  5DDO C;  3IBF B;  5EGY A;  1F9H A;  2GA7 A;  1RCO B;  3M2R B;  3M2V A;  3NP5 A;  2Q66 A;  1X4F A;  5GAD U;  1FVQ A;  3MCO A;  2L08 A;  4IH5 A;  3THP A;  2RU9 A;  2CPF A;  2YXL A;  2CNL B;  3CJT A;  4QWA A;  3DI6 A;  1P27 B;  2YNG A;  3I5C A;  3M8R A;  1PGZ A;  5D3G A;  1FJG J;  4C8K A;  1F1B B;  1PJ6 A;  3GLJ A;  5KG2 A;  1D9F A;  4PAB A;  2VG5 A;  3FCW A;  2VL1 A;  3AJ1 A;  1RTZ A;  4C7Q A;  3E3X A;  3M2U B;  5KFV A;  3RB3 A;  2H4Y B;  1UTA A;  3R8Y A;  3W64 A;  2KKH A;  4DEZ A;  5DQG A;  3CCL S;  2CQD A;  4RPF A;  1TL7 B;  3K7R A;  3ET6 B;  1FRK A;  4RW8 B;  4K5S A;  2IYI A;  3MM7 B;  3Q23 A;  4J9N A;  4O44 A;  2UUB J;  5GME A;  1DFD A;  2HS4 A;  1KOH A;  2CDQ A;  2GML A;  3ZZ0 A;  1FCA A;  2ZH6 A;  4B3S F;  2DGX A;  1RTJ B;  2LQ8 A;  2WW4 A;  4G1Q A;  2HAF A;  4NZ6 A;  2YWE A;  3HSZ A;  1X4E A;  1M1K T;  2BE7 D;  2ZZN A;  4DX7 A;  3G9C A;  5DDQ C;  4NI2 B;  5J1E A;  1SJR A;  3NNA A;  3K59 A;  4PQA A;  2AJ1 A;  4YB5 A;  1RT7 A;  2IRX A;  3B4D A;  4UF4 A;  1I1G A;  5FDL A;  5IS2 A;  1ZAW A;  3EXC X;  2KXF A;  2WON B;  2WW8 A;  5A0Y B;  3ZC4 A;  3UCZ P;  3QSI A;  3U1M A;  1X9M A;  2DIU A;  3RAX A;  1CUL A;  3TNV A;  3UD3 P;  4ZCL A;  2CJX B;  2DNR A;  2HND B;  2IDE A;  2HLU A;  4IO9 Q;  1WC1 A;  1X0P A;  2QLJ B;  1TV6 B;  2BVZ A;  4YR2 A;  1N6Q A;  1VQM S;  3E2E A;  2MMY A;  3BEG B;  1IVZ A;  5DO2 A;  1HNZ F;  1DUR A;  3PCO B;  3PTW A;  1UVJ A;  2HRU A;  5L46 A;  2FVQ A;  2VFV A;  4ANE A;  2DHH A;  4X4R A;  1BGX T;  2NYI A;  3RRH A;  4N8N A;  1K47 A;  2W9A A;  4A8K A;  1R27 B;  1EQM A;  2H4W B;  2YKO A;  3HKW A;  3H2L A;  5K8O A;  2V9W A;  3OFE A;  3MFI A;  2B5J A;  5ETO A;  3JQM A;  4LFC J;  5H9F J;  2PI4 A;  1XQI A;  4XK8 C;  5EUH A;  5I3U A;  2Z2M A;  1RHQ B;  2ZH4 A;  1REV A;  2WBR A;  1RAI B;  3PW7 A;  3I0R B;  2EKY A;  1S76 D;  2YNH A;  2YY3 A;  2Z56 B;  4TXS A;  5E7O B;  3IO1 A;  2A2D A;  4OI1 A;  3NMR A;  1WD6 A;  1X60 A;  3KLH A;  3K57 A;  2D9O A;  1IKX A;  2B8P A;  2HHP A;  3T6B A;  4EI2 A;  2QA4 G;  5EWE A;  2KFZ A;  1CJK A;  2G1D A;  1BXN A;  1TU0 B;  2CG8 A;  2NPI A;  2M8H A;  3CDW A;  3M4X A;  2BE2 B;  4NCG B;  3I96 A;  5B7W A;  3KYL A;  3TRG A;  1PCA A;  3H5X A;  1VC0 A;  2A10 A;  2QMU B;  5F8L A;  1RAJ A;  2YH0 A;  5RUB A;  3SSR A;  3WIU A;  4DV6 J;  4LSL B;  1D1U A;  2LVW A;  1MU2 A;  1T03 B;  3DYA B;  2K3K A;  3HHL C;  4EEY A;  2R8I A;  2AP6 A;  2H5J B;  1MLA A;  5KFK A;  2QEX S;  1NSA A;  3JSM A;  3KTQ A;  2R7V A;  1TL4 A;  4C11 A;  1LFP A;  4QYR A;  1UA0 A;  3HLU A;  1TL1 A;  4IG0 A;  2F8M A;  3E01 B;  1C0T B;  2ZBQ A;  4NA3 A;  4TY8 A;  1PC5 A;  3CJR A;  3EIC A;  2ZNZ A;  1XJW B;  5IZH A;  1JLE B;  2F7V A;  2W2P P;  1AXQ A;  1ZOT A;  2HPU A;  3EDQ B;  3FEZ A;  4KYZ A;  3TZX A;  2MZS A;  2QO3 A;  2WZ1 A;  4QIW D;  5E0O A;  1WKK A;  2OJ3 A;  4LRA A;  4NWB A;  3LPE A;  5JXS A;  3NKY A;  2WVB A;  1JKH B;  1U8S A;  5GAE U;  1SJ4 P;  2ZC4 A;  2R7Q A;  1L3T A;  4DG1 B;  1WSV A;  4DQS A;  4B9M A;  1XR5 A;  4PYA A;  1UAW A;  2GCF A;  1VR6 A;  2HQC A;  2W9C B;  1CEZ A;  2O1P A;  2IC3 B;  5K8N A;  3PW5 A;  1ITP A;  1WEZ A;  3H2V E;  2W4P A;  3MAA B;  2D3O 1;  2VDI A;  2XMM A;  4FVM A;  3KDN A;  4XDC A;  2UVU A;  2UVV A;  4HT5 A;  4LF9 F;  2B8Q A;  2VB6 A;  3OD2 A;  2CPI A;  1JJH A;  2FHO B;  2CPE A;  2CNO B;  2QA2 A;  3ENQ A;  3O2I A;  1DRZ A;  1Y10 A;  2BA9 A;  4IR9 A;  3LO3 A;  4OIX A;  1Q1K A;  2Q6B A;  4PCQ A;  4B9L A;  2CJB A;  1C1C B;  1H2U X;  1UP1 A;  3A12 A;  3GJT B;  1BHN A;  4W92 B;  1P9Y A;  1PG5 B;  4RU9 A;  1T3N A;  2WB1 D;  4MK7 A;  2MSS A;  1BWV A;  4M5N A;  1R0C B;  4FYW B;  4ZPC A;  2JC0 A;  2W25 A;  4P9S A;  2RS2 A;  1RT2 A;  3DI6 B;  1FJG F;  2K8G A;  3OFF A;  2XLJ A;  3Q8U A;  1YIT S;  2DB1 A;  4K4V A;  3PY8 A;  1NZ8 A;  2J6S A;  2RRN A;  1F9F A;  2QA1 A;  5LSO A;  4ELU A;  2Q79 A;  4DU8 A;  2XQC A;  4NXN F;  3QSY B;  4OZ3 A;  1QUV A;  1TAU A;  3VV2 B;  3FQL A;  2CJY B;  2YBV A;  2HNZ B;  4Z7C A;  1WTF A;  4DV4 J;  1V9O A;  1HBM A;  2JEJ A;  3MMA B;  1ZYQ A;  2VQE F;  1NKB A;  4HYK A;  4WZQ A;  2P5V A;  4NML A;  4CLP A;  5KOX A;  1P1T A;  3MEK A;  3KHH A;  4DV5 F;  1LWE B;  1G1X A;  3P5T L;  4O3R A;  3BQ0 A;  3AQO A;  3ZTO A;  5ADZ A;  1IKW A;  1KOO A;  1RT6 B;  1Y9O A;  3POT A;  3CUN A;  4WKR A;  2ZKU A;  1RTJ A;  4G1Q B;  4LRE A;  1XER A;  3CIZ A;  2P8I A;  4JI5 J;  4KB7 A;  3MD1 A;  1VJQ A;  3HD2 A;  2F65 A;  3NY0 A;  1UW9 A;  2QMX A;  1ZM4 A;  1Y00 A;  2V67 A;  3DOM B;  3RYL A;  1Q8L A;  2EFP A;  2FIU A;  1JJC B;  5THW A;  3RG6 A;  1R0B G;  3UDC A;  5LM7 E;  4JI8 F;  2P6S A;  2ZD1 B;  4L3N A;  3H4B A;  1X4G A;  1S79 A;  1RT1 A;  4OZ0 A;  2XO6 A;  3KHG A;  5EHH A;  2FHM A;  4EK2 A;  4LFC F;  3M8Z A;  3JYT A;  2O3D A;  3PX6 A;  1S9G B;  1JLA B;  3ICL A;  5KG4 A;  5HLF A;  2OUG A;  2U2F A;  4F3O A;  2PA3 A;  2XLI A;  2NRE A;  1RWW B;  4B9N A;  4YOE A;  1RAE B;  4X4N A;  1RAA B;  2JEG A;  4QU7 A;  3MDF A;  3ILL A;  1TKX A;  2F1F A;  2OI2 A;  4FKX A;  3KUH A;  2AF6 A;  4DI6 A;  5AXN A;  2ZH3 A;  2GHW A;  3G8T A;  2V4R A;  4P6Q A;  4NLT A;  5EX3 A;  5AXK A;  3PR4 A;  4MKB A;  4NMX A;  5D4O A;  4F4X A;  1B3T A;  1HNX F;  1KWM A;  2D9P A;  1YIJ S;  4TQS A;  1R0A A;  4N7T A;  3MM6 B;  1ZZF A;  2GVD A;  4TYA A;  4C0H A;  2NYH A;  3GB0 A;  1D9A A;  1VIX A;  1NDP A;  3GJQ B;  3BH6 B;  3DDI A;  2XM3 A;  4DFM A;  1XMQ F;  4ZP6 A;  1S5Z A;  3J81 j;  5ITH A;  2YQ0 A;  2XYP B;  1CSJ A;  4FNH A;  4IOB A;  3DLJ A;  4V1A k;  5KFA A;  2ZHB A;  5ETQ A;  4AXJ A;  3OUY B;  3HXM A;  2NS1 B;  5T7L A;  4DV5 J;  2YX4 A;  2BR0 A;  2VC0 A;  1VQ4 S;  1TAQ A;  3P3D A;  3VAI A;  1NB2 A;  2GFF A;  3ZFV A;  2XBP A;  3QT7 A;  2Z58 B;  3D1H A;  1H72 C;  3QAT A;  4JUZ A;  3M05 A;  2VJU A;  2VJV A;  2HHH J;  3EVO A;  3THV A;  4GKJ F;  1ICE B;  1KQG B;  4ZS6 A;  2FYX A;  2YQ1 A;  3HVW A;  1CJT B;  3AA8 A;  2W7A A;  2IRU A;  4IFV A;  1RDR A;  4OZL A;  3UVJ B;  4A4J A;  4DUY F;  3NCR A;  3MMJ A;  2HRY A;  3D6F B;  3NAH A;  4X65 J;  3MUR P;  3OTC A;  4DR7 J;  2XMK A;  3KG1 A;  1ZAV A;  2Y1R I;  3CNQ P;  3IP0 A;  1I51 B;  4KGV B;  4EO6 A;  4U67 Q;  5BYS A;  1C0T A;  1NHK L;  1HI1 A;  1HQU A;  1JLB A;  1QY7 A;  2MKK A;  4FF3 A;  3M8Q B;  2VPW B;  2GHP A;  4LJM A;  8RUC A;  2IAJ B;  2D7S A;  3UNY A;  3M7V A;  4LIW A;  1SH2 A;  2DEI A;  4F4K A;  1B99 A;  2ZWP A;  2RU3 A;  3CED A;  3JSB A;  1T0T V;  2KT2 A;  4OYW A;  2AJ0 A;  2KDO A;  3UN5 A;  2ZJQ Q;  3CCJ S;  4QU6 A;  2XLK A;  1MN9 A;  2VOO A;  3Q8S B;  3LH2 S;  5KFE A;  1KHW A;  3SQG A;  3H40 A;  4ECZ A;  3NBP B;  5A8W B;  2LXI A;  2HVD A;  2Z2Y B;  1F5C A;  1WOS A;  5EWG A;  4P72 A;  1A9N B;  1Y3K A;  1HBO B;  3KK1 B;  2IC3 A;  1UJ6 A;  4LFA J;  4MK8 A;  2BJ3 A;  2P9E A;  2FZG B;  4Q43 A;  3VAG A;  3GJS B;  1B0T A;  2E1P A;  4DCO B;  4W4M A;  1FD2 A;  4ETZ A;  4W98 A;  2CG4 A;  1WUU A;  2C3P A;  2HEK A;  3V6J A;  3CD7 A;  5HN0 A;  3KWM A;  3DLH A;  4H4O A;  3T41 A;  2F4V J;  1FRL A;  3M1V A;  3KUG A;  2HSE B;  5LXR A;  4ZJO A;  1WNE A;  2FJA B;  4J7C A;  4DL0 C;  2NQP A;  3IR6 B;  5FLX Y;  4FP9 A;  2W2M P;  1RT2 B;  3HX9 A;  3QGH A;  3M6U A;  2ZH8 A;  3Q8Y A;  4J9Q A;  2HWI A;  4UOG A;  3HDS A;  1VQP S;  1TK0 A;  1RAO A;  1Z1Z A;  2B9Y A;  3KJQ B;  4BC9 A;  4DPT A;  3G8Q A;  4X84 A;  1LW0 B;  2C2N A;  2MZR A;  3NS6 A;  4TY9 A;  3RBD A;  2F9J A;  2GJI A;  2W9B A;  2J0S D;  2YPZ A;  2P9G A;  2FLP A;  2HYI B;  5C2G A;  1HWK A;  1T94 A;  2IPO B;  1JB0 C;  3H5S A;  3NXZ A;  1X31 C;  4CP5 A;  1YJN S;  1RYS A;  4JI0 J;  1OSD A;  1S49 A;  2HWH A;  4HL9 A;  4N77 A;  3GYN A;  4UY8 5;  5C25 A;  2DIT A;  1XBW A;  4BCA A;  5IT4 A;  2MST A;  4ZPD A;  2VPZ B;  1N52 B;  2YKP A;  2DVI A;  2JDJ A;  4R8U A;  3DRP B;  2L9N A;  3Q24 A;  1Q8I A;  1VQ7 S;  4PUO B;  4JI8 J;  2RS8 A;  4LF2 A;  1FRJ A;  3CJ0 A;  2DT9 A;  4N47 A;  2JNJ A;  3BJY A;  1FKO A;  1AFJ A;  1HKA A;  3OSP A;  4K0K F;  1TKD A;  2BX6 A;  2L48 A;  1WI6 A;  2RJZ A;  4HAC B;  4B3M F;  4GVB A;  4U9R A;  4CIO A;  4ELV A;  4ECS A;  4CLL A;  3UCG A;  3GSI A;  2DRB A;  4LR9 A;  1S7I A;  4AQY J;  5HO4 A;  3NAI A;  2GJ2 A;  2OML A;  1N56 A;  1C1B A;  1S9E B;  2R7X A;  3NGR A;  2N3L A;  2DXD A;  3OR1 A;  2RQC A;  4USW A;  1W2B R;  1U2R A;  2I0X A;  3NGU A;  1VYA A;  3I0S B;  2K2P A;  4K2J A;  3UWT A;  4TLQ A;  5D4N A;  5HQ8 A;  5LSL A;  3CWJ A;  2VQE J;  1S72 S;  5KFU A;  5KFQ A;  2IVM A;  4DSJ A;  2ZZM A;  1CQN A;  2OSR A;  1UL3 A;  1Z4U A;  3ETM A;  4DX5 A;  3HI9 A;  4CLF A;  3SZ2 A;  1Q8K A;  2HQF A;  2I6W A;  2DNL A;  2EPI A;  1TKX B;  1LFW A;  3D1Q A;  3TJ8 A;  2C2D A;  3G96 A;  3MUM P;  4FYD A;  2MKH A;  3V5R A;  2DHG A;  3X1L B;  3MM7 A;  3OTE A;  2MKI A;  3FKB A;  1RWN B;  4DN9 A;  2CQP A;  4NLO A;  1A7G E;  5E3A A;  4OYM A;  5AJ3 J;  3J7Y U;  4YY3 F;  4PWD A;  2EKN A;  1Y5L B;  2DXF A;  3IG1 B;  2CAJ A;  2OPQ A;  1ZET A;  4PXC A;  4N41 A;  4ILR A;  2VV5 A;  3PRB A;  1JLQ B;  5HAN A;  3FVY A;  5L38 A;  2W8L A;  4A8X A;  1YTY A;  1S6P A;  4AD6 A;  1VBX A;  4O4R A;  2AT1 B;  2DGQ A;  3SCJ E;  1PYS B;  2N4C A;  4QYZ J;  2UV8 A;  3LP2 B;  5KFZ A;  1ZTT A;  4RBT A;  4NRU A;  3P45 B;  3OUY A;  1DLO A;  4DR3 J;  1L5U A;  2R8H A;  2FVP A;  1IBM J;  2LCW A;  3BR8 A;  2D3Z A;  2WVE A;  2Y0B B;  3BBB A;  2H5E A;  3T9N A;  2ZH7 A;  3CJQ A;  3VR1 A;  2EC2 A;  4ZA1 A;  4LF9 J;  2I5J A;  4M5J A;  2QTW A;  2SXL A;  3B6B A;  4WCE Q;  1LOU A;  1N5T A;  3JQJ A;  5A6P A;  2KM8 C;  2UP1 A;  3N0V A;  1JIH A;  4J9M A;  1SC1 B;  3V81 A;  4HDG A;  2HND A;  2M2B A;  4NLR A;  4O3Q A;  4H4K A;  4JI4 J;  4MYT A;  1S97 A;  3R5G A;  1FRM A;  2RKI A;  1J5E J;  4DPO A;  3DU5 A;  3HFK A;  4QW8 A;  3M8Y A;  1FJ7 A;  2E7X A;  2E66 A;  4HEA 9;  1HHT P;  1IKV A;  2HQG A;  2QE5 A;  4P2F A;  3KNA A;  5HRO A;  2J0X A;  2YVS A;  1F5A A;  2R4F A;  4HH0 A;  4CDI A;  4KJI A;  1UJ5 A;  1CS4 B;  1QVG R;  1DTT A;  1SJQ A;  1GX6 A;  1YSJ A;  2D3U A;  2ZUA A;  3LAK A;  4KHM A;  3KLV A;  4ECR A;  1KHV A;  2X1F A;  1N33 F;  2A0F B;  1S1U A;  1FDN A;  4ZKA A;  4DQI A;  4M5D B;  1HBN B;  3NRB A;  3CCZ A;  3WX8 A;  3IRX A;  3HMJ G;  5L1J A;  2PFF B;  3I0R A;  4ZP7 A;  1HL6 A;  2QL9 B;  2M7S A;  4QJV A;  4USM A;  5DG7 A;  1TP7 A;  3GFY A;  4FXW A;  4RUB A;  5AT1 B;  1W2I A;  4J9K A;  2OD4 A;  2R2U A;  3M6V A;  2EFG A;  1HHS A;  1UEU A;  4A8W A;  1NKE A;  1NJW A;  1LXN A;  1YZ7 A;  3HFV A;  3CIM A;  5DGB A;  3VQT A;  3QIP A;  1SKU B;  4CLU A;  3MF5 A;  1XMQ J;  1TQL A;  3QJP A;  2OPP B;  1IM6 A;  3OV7 A;  4AL5 A;  5IV4 A;  1BQX A;  4JV0 A;  4KGZ B;  4JI1 F;  3MEE B;  4F7V A;  4DR3 F;  4Q8E A;  1S12 A;  2HFS A;  1QTN B;  5DS7 A;  4DZ6 A;  1MML A;  5C42 B;  4USJ C;  3FCV A;  1S6Q A;  2DR5 A;  2QLF B;  4P7V A;  4CLZ A;  5IV3 A;  5A8K A;  1FWK A;  1QD1 A;  1HD1 A;  3C15 B;  1RWP B;  1LW0 A;  1XIQ A;  4B3O B;  5CZV A;  1X4H A;  1NK8 A;  2VQF J;  2BUN A;  3IAS 9;  2B9W A;  4RUC A;  3G86 A;  5HP1 B;  1ZZN A;  2FJX A;  3D5M A;  4LSN B;  5E3C A;  4O0I A;  4K7Q A;  3OHA A;  4CO5 A;  1RZM A;  2LEC A;  3GPA A;  1UMJ A;  2CPH A;  4ECX A;  1OY6 A;  5C25 B;  2K06 A;  5CD4 A;  3L4B C;  4IH7 A;  4L73 A;  4OJ3 A;  5IC6 B;  2DGV A;  3WQP A;  2KG1 A;  3BBF A;  3DOL A;  3R7B B;  2MQM A;  1OMS A;  1CJV B;  2VKR A;  2CQH A;  2HWT A;  2WOM A;  2XEX A;  2YNG B;  3OPK A;  4HTJ A;  4ZVH A;  3CVK A;  1GMU A;  3HHL A;  4LF7 F;  2C28 A;  4KY3 A;  3THT A;  1HW9 A;  5CYJ A;  2WVD A;  1HQ2 A;  1OJ4 A;  3IRW P;  2BW7 A;  2HFO A;  2RB7 A;  4JP8 A;  1NJX A;  4F3Q A;  2OTJ S;  3EWG A;  4CQ1 A;  4M5I A;  4RW8 A;  5J2Q A;  2ZH9 A;  4PYD A;  4DCP B;  4O3S A;  5GVQ A;  1HYS A;  5KFY A;  3TJ9 A;  4QPT A;  2WSC C;  4JI7 J;  1B0V A;  4WK1 A;  5LXY A;  1DAX A;  2OFG X;  2OGU A;  4WFY A;  3US5 A;  3H25 A;  3QT5 A;  2Z2L A;  3WZ0 A;  4EFA C;  2GQ2 A;  1IBL J;  3ZNU A;  2M0G B;  3CD6 S;  4NXN J;  5ETK A;  1Y5I B;  2YNI B;  1NK0 A;  3ZTQ A;  3BYP A;  2MQ8 A;  1RJJ A;  3OVS A;  1HLW A;  3RB6 A;  1OPZ A;  2IJN A;  3C6T B;  1XN9 A;  4DCJ B;  3LWM A;  1Q82 T;  3KNG A;  3NG8 A;  1X7V A;  5FDL B;  1CC7 A;  5C5J A;  4AL7 A;  2CQ2 A;  5D78 A;  4C48 A;  4AUK A;  5HL7 Q;  3IXQ A;  4DUY J;  2YWG A;  5A8R B;  1T3O A;  1LWE A;  2KVI A;  3H98 A;  3PRV A;  4ZPW R;  1BWE A;  2VBW A;  1T9V A;  2H5I B;  1L3K A;  1NK5 A;  4NLS A;  1N5Q A;  2ZKT A;  3VAF A;  1SC6 A;  2DGO A;  2HIQ A;  2MYF A;  4RW9 A;  1IR1 A;  2AZ1 A;  2BKN A;  2ROP A;  2VFS A;  3DLK B;  3HHL D;  3VVU A;  3MUV P;  1KTV A;  1TVR B;  2MJN A;  1KVJ A;  4CNZ A;  4CZC A;  5EX0 A;  2XHC A;  2I5J B;  1HNV B;  3CJ4 A;  3LUY A;  2J6T A;  4PXD A;  1QSL A;  5GAE I;  3IWN C;  2GS8 A;  1Q5V A;  4AFF A;  5GAH I;  2AEF A;  4K8R A;  4F0K A;  3JAM U;  1RTH A;  3EPG A;  2V34 A;  4EMD A;  1XNQ J;  4DV2 J;  1B70 B;  1NPP A;  1S1V A;  2CPY A;  2EFO A;  1RB0 A;  4F26 A;  3C8Y A;  5B0G A;  4DV1 F;  2QL5 B;  3SV3 A;  1YI2 S;  1NB7 A;  2MXY A;  2AEM A;  2XGQ A;  4JI7 F;  2IIH A;  2GAH C;  2RUS A;  5D15 A;  4DR4 F;  2AEJ A;  4YN3 B;  1WHY A;  2XZT B;  1SVD A;  1TL7 A;  2QGF B;  4X64 F;  2G0C A;  4LBP A;  3HHN B;  1LWC B;  1C0U A;  1RLC L;  3QLH B;  2UXC J;  4RW4 A;  3T1H J;  1FXL A;  3EJM A;  3F0N A;  2BAN B;  1I3O B;  2XYH B;  4RL1 A;  4YEA A;  1VC6 A;  4ZHR B;  4HHJ A;  3OVB A;  3VZH A;  4QOT A;  5DQI A;  3OBI A;  2DY1 A;  1OIA A;  2DR6 A;  3QQC D;  3G6Y A;  5M2U A;  4DR7 F;  3IM8 A;  2CQG A;  2W7P A;  3W8G A;  5DGA A;  1JK9 B;  1HWL A;  4DR5 J;  1S99 A;  5IC4 B;  1S6U A;  1RHR B;  2MJU A;  3PW2 A;  1M1G A;  3KG0 A;  4P52 A;  2E5L J;  3CUL A;  4ID8 A;  3E51 A;  1TKT A;  2CUY A;  3H5Y A;  2G0J A;  5LMU F;  6FDR A;  3AH6 A;  4M5G A;  4DS4 A;  3TVZ A;  3MPD A;  1FO1 A;  2DRA A;  1KP6 A;  2ZJP Q;  1SJF A;  3WIV A;  4ZIT A;  2YKM B;  1G7C B;  2LU1 A;  4KSE B;  5C42 A;  4FF2 A;  2F9D A;  4KBI A;  1FF2 A;  3MM5 B;  4C6A A;  4ZVO B;  3BM7 A;  4ED4 A;  2AGP A;  1YJ9 S;  3QRR A;  4NX9 A;  2AJF E;  1H73 A;  2V68 A;  4OV1 A;  3KLG A;  2XWY A;  5E5N A;  5DQH A;  1UVM A;  5D77 A;  1WC3 A;  4EUV A;  3KUE A;  2FHJ D;  2IM3 A;  3RB0 A;  3JB9 k;  2OH2 A;  1V3S A;  4B17 A;  3C14 B;  2G4B A;  3W3S A;  2VA2 A;  2NZC A;  4F4W A;  2ILZ A;  1QSY A;  4ZVG A;  3W2W B;  2APO A;  3HVA A;  1EKS A;  1T9T A;  3ZTP A;  1VK3 A;  3MPV A;  1AT1 B;  2AJ4 A;  3TZY A;  2N7Y A;  2V2Q A;  2VIH A;  2VOP A;  1U1M A;  4I7F A;  3A8I A;  4IFY A;  2HHX A;  2IRY A;  4FN5 A;  1CJK B;  1CJU A;  2BRL A;  3HSG A;  5HQM A;  2AMC B;  4EZ6 A;  4WTY A;  3FEX B;  4MIB A;  1YWX A;  3W66 A;  2XS5 A;  3GTY X;  4I56 A;  4KIA A;  1YRT A;  2HFZ A;  3HZE A;  5DRK A;  2QSW A;  1N34 F;  2DGW A;  3FZ2 A;  4JOU A;  2CJK A;  4PAA A;  4R5P A;  3EZ5 A;  2JH3 A;  5A2Q Y;  4JV2 A;  1S4F A;  1XMB A;  3V2U C;  1GH8 A;  1RWV B;  1VDH A;  2IA0 A;  4KPC A;  5B0B A;  5BR8 F;  4GRS A;  4NEY A;  3TAM A;  3K5M A;  1GTE A;  2KT5 A;  5K8P A;  3DLE A;  2ZOM A;  1NXI A;  5F8H A;  1JLE A;  3V6H A;  2CXE A;  1WKJ A;  3J7Y I;  3N4W A;  4MKA A;  5B0E A;  2W4D A;  2VBZ A;  2IYG A;  3UO0 A;  2DIS A;  2KI2 A;  3H42 A;  5GAD I;  2CWK A;  2M8D B;  1JKH A;  5E3R A;  1RT3 A;  3I82 A;  2FHJ A;  3NOC A;  2VPX B;  5L9N A;  5LSR A;  1M5O C;  4J9O A;  1RI7 A;  2L3M A;  5KOW A;  4JB8 B;  1GQE A;  3TA0 A;  1OWX A;  4JI6 J;  2F5G A;  4WTO B;  2MB0 B;  3EUN A;  3IS9 A;  1YBU A;  2HZC A;  2DO4 A;  3DXS X;  3NEK A;  5GMD A;  4G3I A;  1LV5 A;  1UVN A;  1OO0 B;  2GV1 A;  1CG2 A;  3KLE B;  5A6W A;  2E1R A;  5A2Q U;  2LXF A;  1BLU A;  1BQM B;  2FJE B;  2J9E A;  2VG5 B;  3IGV A;  2NUH A;  1KFD A;  4OLO A;  4RW6 B;  5CAB A;  2ZJR Q;  5KFO A;  2H48 B;  4DSF A;  4IRC A;  2HNY A;  1AB8 A;  3NLC A;  4WIQ A;  2X3D A;  4HAC A;  4M8L A;  2DCL A;  4U7C A;  3UR3 C;  4L76 A;  1S6O A;  3PG9 A;  5LT5 A;  4ERD A;  2AZ3 A;  2BW2 A;  3FFI B;  1FES A;  1U02 A;  2BEF A;  3GV8 B;  3OQ2 A;  4EYI B;  4YFU A;  1RHU B;  5JUM A;  1Q0N A;  3I5B A;  2AD9 A;  1DY3 A;  1E6V B;  2MPU A;  1PYO B;  3DM2 B;  4FYY B;  5I3Q A;  4DR6 F;  4XTT A;  2HK2 A;  1EET B;  4F4A A;  1X4C A;  2QV6 A;  2YWF A;  5AXL A;  1FE4 A;  3B54 A;  4DV0 J;  3OLA A;  2ZBP A;  4K2X A;  2OIH A;  3A8E A;  3K8V A;  3GU0 A;  2DCU B;  4E2F B;  1EAY C;  4NI2 A;  2A6M A;  3CE8 A;  5J1E B;  1FNX H;  3QRQ A;  3TUP A;  2UUC F;  2VF3 A;  5KFC A;  1AA1 B;  1F2H A;  3TAN A;  1KN6 A;  3JTO A;  4G6V B;  2FY8 A;  4TLR A;  1AZS B;  3JSR A;  4GMK A;  3CO9 A;  4K0K J;  2FLL A;  3BQ1 A;  1NK6 A;  2AIR B;  2MEW A;  3DMJ A;  1D8Z A;  1I5O B;  2E44 A;  3A8K A;  2RDI A;  3FC9 A;  1N36 J;  2DH8 A;  3U02 A;  1B7Y B;  1HFE L;  1BC6 A;  3QID A;  2YKN B;  3GCX P;  3K8W A;  4WK3 A;  2HGM A;  3A4T A;  4M63 A;  9RUB A;  3W5Z A;  5I42 B;  2PEB A;  2QX0 A;  3H8Y A;  3N5B A;  2Y8Y A;  2L9D A;  3H20 A;  4KR0 B;  3P8B B;  4CYU A;  4KRW A;  4KV8 B;  3IC1 A;  3UR0 A;  3OTO F;  4NE9 C;  2MHE A;  2ZD1 A;  4NYZ A;  1Q78 A;  4WP8 A;  1DQ8 A;  2QFI A;  4PWW A;  2OO4 A;  4AYB D;  1VIO A;  3KKF A;  3JTP A;  2QFJ A;  4C8Y A;  2CQI A;  2D41 A;  5DET A;  4J90 A;  1JJ2 R;  3OFG A;  1UEV A;  3GII A;  4HHH A;  1FTC A;  2XMJ A;  4L75 A;  4ES1 A;  4QWC A;  5HLF B;  2UXC F;  4AT1 B;  3C16 A;  3TUI C;  3BF4 A;  2AU0 A;  5D4P A;  4ES3 A;  1HBO A;  1HBU B;  2KFN A;  2W2O P;  2XO7 A;  4DR4 J;  2J7W A;  3CD0 A;  1CS4 A;  3C46 A;  3FMW A;  2KB2 A;  5LL6 d;  1MNE A;  1F60 B;  1RCX B;  3EE3 A;  2ZM6 J;  4DX8 H;  1MU2 B;  4OI6 A;  4YDD B;  1I6J A;  1UVI A;  3K5N A;  3D1O A;  3PR5 B;  3D7S B;  5KAK A;  3AFG A;  2JLG A;  4DPX A;  2ROE A;  4FF1 A;  2B7C B;  2OPR A;  4U8V A;  3GZ7 A;  3OT9 A;  1RSC A;  2YKA A;  2GJF A;  2DH9 A;  4K59 A;  1TTH B;  1YLX A;  4MYU A;  3DGP A;  4W90 B;  1FNM A;  2WRM A;  4RBU A;  4I2Q A;  2QLX A;  4M5L A;  2Y1J A;  5IM0 A;  4OI0 A;  4K4S A;  2W9B B;  2RSQ A;  2WON A;  1VOM A;  4IG3 B;  3NWR A;  1BQN B;  1DHM A;  3R2D J;  1SL2 A;  1FDD A;  1LXJ A;  5J1N A;  5L1K A;  4ED2 A;  4ED7 A;  1V3Z A;  1U1P A;  1REG X;  4CTA A;  2HHH F;  1IN0 A;  5IFM A;  1IWG A;  1Q7L B;  5BJR A;  2RDJ A;  1N88 A;  1OSC A;  2W7O A;  1TKZ B;  3BN7 A;  1RAD B;  4R8U B;  4B9V A;  1SPB P;  2EBE A;  2ZVS A;  1QJH A;  1SKS A;  3MR5 A;  6FD1 A;  1L3S A;  2YX1 A;  2HVZ A;  3GON A;  1M5K C;  2RRB A;  2C3O A;  2R42 A;  4USI A;  3U7J A;  2HVE A;  2IA6 A;  1OQ3 A;  2V4J A;  4CLT A;  4RNO A;  4J9L A;  3PM9 A;  1C1C A;  1OPI A;  4DU7 A;  2DEJ A;  4ED6 A;  5H9E J;  3G87 A;  2DHS A;  1NKC A;  1A0O B;  4A8Y A;  4Z2X A;  4U95 A;  2KRB A;  3QPI A;  3OR1 B;  4OZN A;  4YDX A;  3RGI A;  3TP2 A;  5AXM A;  1U1Q A;  3KJV B;  1FWL A;  2DNK A;  2CQC A;  1FFS B;  1HNI B;  2EI5 A;  4KKO B;  3W2V B;  3BYR A;  3QZ7 A;  2DHX A;  1T05 A;  1N4L A;  1VHI A;  4ZLJ A;  4Q0B B;  2IY5 B;  2GGP A;  1R8B A;  3VAM A;  3AQP A;  4FXD A;  3O3L A;  3BSC A;  3P49 B;  4LSL A;  2PDA A;  1RA6 A;  2MKY A;  3DYA A;  3GYG A;  3I4H X;  4F4Y A;  2X51 A;  1UCN A;  2HNZ A;  1YJW S;  1XTZ A;  1HBM B;  1FHT A;  5KT5 A;  2DBB A;  4A47 A;  2VBX A;  4ZVE A;  1DQA A;  4C2M A;  1U49 A;  3VGU A;  3BR9 A;  1DJ0 A;  4L72 B;  1U6Z A;  4KH0 B;  4NOH A;  3PEH A;  3HJF A;  2KM8 B;  3CD5 A;  5MAO A;  2J9D E;  3VCD A;  3CME S;  2H3E B;  3AOA A;  4F50 A;  1IXK A;  5D4L A;  2X1G A;  2G9O A;  3ZZZ A;  4X4T A;  1Q79 A;  3G6V A;  2YNI A;  1K73 T;  2MQL A;  3DOK A;  3OL6 A;  4LQ3 A;  3M8W A;  5HMZ A;  2GMH A;  2XG8 A;  3OL9 A;  4USH A;  3BKF A;  4CH1 A;  3PJW A;  3RAM A;  3F73 A;  1EAR A;  2DNY A;  2VOD A;  5KG7 A;  5GAH U;  2RML A;  3W1Y C;  4OMF G;  4IR1 A;  3MTK A;  4UY8 T;  1TR0 A;  4FS1 A;  4ZMM A;  1U26 A;  3V4M A;  2RQ4 A;  3M2V B;  1SQE A;  2BE9 B;  2V8D A;  3D3C J;  2J9D A;  1RTD B;  2AQ4 A;  2JFD A;  4ZVU B;  1U2F A;  5IXU A;  4LF4 J;  3PX0 A;  4GKK J;  3DDN A;  1GMW D;  1WKL A;  3GIJ A;  2JWN A;  4U6P A;  2RDD A;  2KH9 A;  3PW0 A;  4A8Q A;  1QUP A;  3W9I A;  4GKJ J;  1VMB A;  4RW9 B;  3F56 A;  1R8P A;  4RNN A;  1J5O A;  1QSS A;  1K44 A;  1F3V A;  2Y1I A;  1RWM B;  1YRX A;  3W61 A;  1RP5 A;  4DV4 F;  1QAI A;  1NK7 A;  2EG2 A;  5FII A;  4AE5 A;  1IWA A;  5BXI A;  1C1B B;  1S9E A;  1TMJ A;  1SI9 A;  2HGL A;  2XY5 A;  2Z2Z A;  3Q8R B;  3R2C J;  1SJ1 A;  2GVD B;  2VH7 A;  1CBK A;  1FRH A;  3DRY A;  4JV1 A;  3BO2 A;  3N9U C;  3TYT A;  4N5S A;  3AD7 C;  2MHN A;  2HMI A;  2ZNY A;  4PQU A;  4CI0 B;  1M5V C;  3MTJ A;  1HI0 P;  4ZN1 A;  4N8O A;  2XI3 A;  5HQL A;  2K7K A;  1U25 A;  1H2T Z;  4I6Y A;  3C66 A;  1FEH A;  4XDD A;  2HAI A;  4O4G A;  3M9N B;  1F2G A;  1G3O A;  4N56 A;  4TYB A;  2GVZ A;  1NUE A;  2FUG 9;  3AOB A;  4UQT A;  1U24 A;  2RT3 A;  2OPQ B;  3VGT A;  3ENW A;  3UN2 A;  4DL4 A;  5AE1 A;  2Y8W A;  1S1W B;  5KFH A;  5H9F K;  3AHP A;  3POT B;  5SUH A;  4NL5 A;  4ED1 A;  2RQM A;  3UDE A;  3Q86 A;  3P5B P;  1QAJ A;  3H2U B;  2FY1 A;  2KO1 A;  1W25 A;  4MIW A;  1DLO B;  1WC0 A;  1XNQ F;  1FK9 B;  2QN6 B;  2Z57 B;  3FBE A;  3TA2 A;  3UPF A;  2ATL A;  3R5A A;  3GR0 A;  4QIV A;  4D3H A;  2AHO B;  5ETV A;  3BGR B;  4YB7 A;  5BYQ A;  2RQK A;  2DJW A;  4HDH A;  3PJ9 A;  5FLX U;  5HVF A;  5KG0 A;  2GAG C;  1BQN A;  2NSB A;  4MH8 A;  4DUZ F;  4LRD A;  4JYA J;  5ETT A;  2UXB J;  3BPD A;  4DQQ A;  1SC4 B;  2ZC3 A;  3LP0 B;  4OZ2 A;  1XNR F;  2YPY A;  1HD0 A;  4E8U A;  3T5L A;  2CPJ A;  2IBO A;  4ECY A;  3ITH A;  2E9T A;  5AJ3 F;  4OX6 A;  3RR8 A;  4YB1 P;  2AJQ A;  3QJJ A;  2LA6 A;  3PFE A;  2CZ4 A;  1IKV B;  4R0J A;  3GV5 B;  2DGT A;  2JHE A;  5J2N A;  1RT5 B;  1KTQ A;  1DTT B;  4O23 A;  5JJB A;  2W2N P;  3CCM S;  3N6N A;  1NSK L;  2BJ7 A;  2CPD A;  2RH3 A;  2Z30 B;  1VRT A;  2V5H G;  4DLG A;  1SJ3 P;  2UXD J;  1OY8 A;  4H4M A;  4U8Y A;  5KFT A;  4IRD A;  1VHF A;  4IOC Q;  1R0A B;  4Y28 C;  3W2W A;  2IVY A;  3UI3 A;  4EWT A;  5C24 B;  1VQN S;  4C11 B;  4CLS A;  4UT4 A;  2GMJ A;  4C0B A;  4FPI A;  4GC7 A;  1SIW B;  1VRQ C;  2VZ9 A;  3JAM Y;  5E3P A;  2VFT A;  3IM9 A;  3ENA A;  4CCH A;  4P71 A;  2OKQ A;  2QJ3 A;  2ZHO A;  1FI4 A;  2GQC A;  2DGS A;  3LQV A;  2YKQ A;  4FXV A;  3KHL A;  2D1C A;  2OEK A;  4F3M A;  4O3N A;  4P75 A;  4DF8 A;  2KU7 A;  4URQ U;  5K14 A;  2E5J A;  2EK6 A;  1VBK A;  2A2C A;  5CYM A;  4ZCK A;  1K8A T;  2J8A A;  4ECU A;  5F8G A;  2GC8 A;  3T1H F;  5GMK a;  2P9C A;  4B3T F;  3IAM 9;  3JS9 A;  3U1N A;  1APS A;  2K1R B;  4PPD A;  4RWW A;  3K2Y A;  3ZZR A;  2RIJ A;  5EWF A;  4PUO A;  4PRF A;  3EGN A;  3FRY A;  2EVZ A;  5CHC B;  4X4O A;  5KT7 A;  3F44 A;  3DOK B;  2UUT A;  2BOA A;  1LWX A;  2Q43 A;  5G0R A;  2VU5 A;  5HAT A;  3TVY A;  5I3P A;  4PKD B;  3MM9 A;  4R0E A;  5I4M A;  3CXC R;  1HI8 A;  5C7P A;  4K4Z A;  1UFL A;  4X4S A;  1V3R A;  3MED A;  1R31 A;  3BV8 A;  3PIP Q;  2VQF F;  1GK8 A;  2XB2 D;  1VLY A;  1UZH A;  2E5I A;  3UDL A;  3FEY B;  1NK4 A;  2BJ9 A;  2DPJ A;  2KFY A;  1YGY A;  3DDK A;  3CJK B;  3WX4 A;  3EZU A;  1LWF B;  1CJV A;  4DJB A;  5DLF A;  4MAK A;  2GIQ A;  2ABY A;  2R7O A;  4ICL B;  4TKT A;  4EZ9 A;  1ZM9 A;  1PJ5 A;  1FE0 A;  2DK2 A;  4JI1 J;  2HNY B;  1YX2 A;  3DLB A;  2E5H A;  3MR2 A;  1U1L A;  2QRR A;  2E9R X;  1G4C A;  2CPZ A;  2JEF A;  5J2Q B;  4LF1 A;  2PA8 D;  5F3Z A;  3UCU P;  1YK9 A;  1JNZ B;  4C4W A;  3IN5 A;  1GXT A;  2EWH A;  3K17 A;  4CO1 A;  3S6E A;  4A8M P;  4O0N A;  3WC2 A;  1RWO B;  3HM9 A;  4QWD A;  3GFH A;  2KXH A;  2QZ8 A;  4PXE A;  4C8O A;  1H6K X;  4G1I A;  3GIL A;  4NYO A;  1DTQ A;  1UZD A;  5IWA F;  3CPW R;  1FXD A;  2O66 A;  3ZXW A;  4NLW A;  4NLG A;  2CVI A;  3A3O B;  3BSA A;  5CCM A;  2EFQ A;  1HW8 A;  1HQE B;  5DDP C;  5J2P A;  4PG7 A;  4C97 A;  3I55 S;  2VG7 A;  1HNW F;  4O4G B;  3Q8V A;  3OJS A;  3MOZ A;  4F2S A;  2QYG A;  3MUT P;  5E33 A;  2EK1 A;  1Q81 T;  3KDO A;  4NLD A;  3HD1 A;  3M6W A;  3ZO7 A;  4URS A;  1LQ9 A;  3V81 B;  4QIE A;  1BE4 A;  1N32 J;  1U6B A;  2PC6 A;  1JLA A;  4WU2 A;  2B4V A;  1HR0 J;  1NEE A;  2Y9H A;  2RVJ A;  3MWB A;  3D0H E;  3M8P A;  2QIF A;  4DV2 F;  2YKN A;  2WAQ D;  3OFH A;  4DR1 J;  3PHE A;  1J5E F;  4OYP A;  4M95 A;  1S0V A;  1LK5 A;  4ALZ A;  3Q2T C;  4K4T A;  3MM8 B;  3NGK A;  3V4I B;  1RT7 B;  1EX8 A;  2J76 E;  2O5D A;  1VQ9 S;  2OTL S;  2NZ4 A;  1UET A;  4RUH A;  3BQ2 A;  3QGI A;  4O44 B;  2P2C B;  1LKZ A;  3SXL A;  4YUD A;  1S0O A;  2RIL A;  4OYZ A;  2BAC A;  3KLF B;  4WP3 A;  4FS2 A;  2KHC A;  5F0W A;  3J7Z 5;  4IRK A;  2GIF A;  2VFU A;  4ZP8 A;  2C2M B;  5ETN A;  3SSS A;  1EKR A;  1JLF A;  2GHV C;  3O1L A;  4Y2C A;  3T1A A;  2CZV C;  3FK4 A;  2XMA A;  1YVF A;  3R9L A;  2VA3 A;  1UFW A;  3P6Y C;  4FF4 A;  4OX9 F;  2V6A A;  2OFH X;  3HUL A;  3SIP B;  2B56 A;  1XEZ A;  7FD1 A;  4ID5 B;  4GO7 X;  1T8E A;  4KHR A;  4KO0 B;  2ZHA A;  1FKP B;  3M32 B;  4OHY A;  2GX8 A;  2ZWO A;  3Q8Q B;  1D8Y A;  3TW0 A;  3QLH A;  4BDP A;  2POK A;  3L95 X;  2XZW A;  4LR8 A;  3UVJ A;  4X66 J;  2IMO A;  4Y0F A;  5ETL A;  5C24 A;  3S1T A;  3TEH B;  4EO8 A;  1XMO F;  2M5Y A;  2BJD A;  1X5O A;  1N0V C;  1S59 A;  4WE1 B;  1UFK A;  4IOA Q;  1CPZ A;  3NMA A;  3OXF A;  4OL8 A;  2BXJ A;  5G4D A;  1U48 A;  2Q1L A;  2LQB A;  1WHX A;  2BE2 A;  4L3K A;  4OZ1 A;  4UZC A;  2AYE A;  2DD8 S;  2HBQ B;  1OY9 A;  2M70 A;  3R97 A;  4RNF A;  3PIO Q;  4DR1 F;  3MCM A;  1R43 A;  2LMI A;  4ZDN A;  5HP1 A;  3K5L A;  4ENO A;  3PV8 A;  2E5L F;  4DUT A;  1UKU A;  1P8G A;  1FTR A;  2MKS A;  1F0X A;  4OV6 A;  3SQG B;  5F8I A;  4Y3C A;  2LEA A;  5KFF A;  5HJX A;  4G1P A;  2WCX A;  1YDL A;  3TZZ A;  4U96 A;  5D6G A;  4CLW A;  3KLH B;  1RWU A;  2MGZ A;  1RHM B;  4H4K C;  1J2V A;  3DOL B;  4USU A;  1ZM2 A;  3QWP A;  1PIL A;  1TEL A;  5HRO B;  3D9B A;  3DRS A;  1QM9 A;  4F36 A;  3AB4 B;  3BBC A;  1FFG B;  2RD5 C;  2L9W A;  1ZM3 A;  3ILO A;  1SKR A;  1WEL A;  2LEB A;  2GO9 A;  2ROG A;  3MHY A;  3R7N B;  3N5F A;  2DNN A;  3C14 A;  4U7U D;  4P2X A;  2NR0 A;  4UUW A;  2KZZ A;  4NCA A;  3HHD A;  1FER A;  2R8J A;  1HYS B;  1QLN A;  3D3B J;  5IQQ A;  2ACY A;  3W60 A;  4Q8F A;  1RAF B;  3AAW B;  2ASL A;  4IG0 B;  1WAC A;  1SQF A;  1B4S A;  3E01 A;  4KFB A;  5KG5 A;  4NLP A;  2WTF A;  2W9C A;  1U45 A;  1C4C A;  4WWS A;  1IBM F;  4UST A;  5KFW A;  2UUW A;  3OL7 A;  2IHR 1;  3T9Z A;  2V4Q A;  4DQP A;  5E2Q A;  4LRF A;  3LGH A;  2XYG B;  2XMT A;  3O8W A;  4Q2L A;  4DL2 A;  2O67 A;  2RHS B;  2KT3 A;  2FJD B;  3OJU A;  2JLE A;  2KL8 A;  4IH6 A;  2R2R A;  4PXB A;  3SMZ A;  1SC3 B;  3HVT A;  4DG1 A;  2UUA F;  4K4U A;  4YY3 J;  1T9U A;  4BWJ A;  3FBC A;  2XS2 A;  5LMN J;  4DV7 F;  4B3R F;  4RX6 A;  5F9N A;  2R7S A;  5J1P A;  3OLB A;  2ZZT A;  3AY0 A;  1QVF R;  3DRP A;  4JBC A;  5U47 A;  2X1A A;  2HHV A;  5F8N A;  2B6A A;  3CC7 S;  5A8K B;  2B9E A;  1MN7 A;  2ILY A;  2MKC A;  1HR0 F;  2XSF A;  4U7U K;  2LQJ A;  5M2R A;  1X5S A;  3DLK A;  1QDU B;  2CYY A;  3AJD A;  1VQS A;  3NCP A;  3TEG A;  4AXI A;  4J37 A;  2VIC A;  2J6U A;  2VG7 B;  4DL3 A;  4PG8 A;  4DL7 A;  4LSN A;  2YWK A;  1HWU A;  2NXN A;  1LK7 A;  3PHT A;  4UQG A;  1MWZ A;  5L39 A;  4I69 A;  1ZBT A;  1RLD A;  2Z0G A;  4KTQ A;  2XI2 A;  1IM4 A;  2EBG A;  1TL3 A;  3DXB A;  4QBU A;  3W7B A;  4Q44 A;  5L9X A;  1E6Y A;  4HI2 A;  5H1S V;  3NS5 A;  3FGV A;  3RBE A;  2ZM6 F;  2I2Y A;  2HHQ A;  1JNR B;  1RU1 A;  2KG0 A;  4JI4 F;  3IA0 A;  1O51 A;  1FRX A;  1Y5N B;  2ZE2 A;  3LF0 A;  4RJV A;  3DCA A;  5K5M A;  3BH7 B;  1K9M T;  4X65 F;  1RXO B;  2PE8 A;  3DOM A;  2CRL A;  3TUJ C;  1J5O B;  3QAU A;  3UFC X;  3NNH A;  3ELH A;  2LLZ A;  4DF4 A;  1NJZ A;  3U1L A;  3QT8 A;  1LWC A;  4MTP A;  1NRK A;  3VAH A;  2G2O A;  1FFW B;  1MRO A;  2F3J A;  1RYR A;  1E6V A;  3DM2 A;  2BMB A;  3JYT B;  4JI0 F;  1NDC A;  3IBC B;  3DN9 A;  1OYE A;  1S9G A;  1Y0H A;  2CPX A;  3HCX A;  2AJ2 A;  3HFZ B;  1FX2 A;  4LVN P;  3GIK A;  3CC2 S;  3PW4 A;  1NZA A;  1WJ9 A;  4I1T A;  3HVR A;  4LUB A;  1S77 D;  3BRE A;  1R89 A;  3M30 B;  2HHS A;  3KOA A;  3T3F A;  4X4P A;  1NK9 A;  1T11 A;  3SSQ A;  2RF2 A;  4I2P B;  2JC1 A;  4HHU A;  4X66 F;  2DIV A;  3ET6 A;  4F02 A;  3QWU A;  2WSF C;  1ZH5 A;  3R6L B;  4MFB B;  3GWC A;  5F8M A;  3MEC B;  2XS7 A;  1SKW A;  1KNZ A;  1RT1 B;  2HRT A;  5KFG A;  3RRK A;  2HFN A;  4CNY A;  1S1W A;  1PAE X;  1R6V A;  2C42 A;  1VFJ A;  4E98 A;  4IQM A;  1FA0 A;  2XC9 A;  1U8W A;  4DMZ A;  4KGM A;  5CD4 H;  4XPE A;  2HQ3 A;  2WVC A;  2LFV A;  3TA1 A;  1X0F A;  1ULR A;  1TL5 A;  4QQB A;  3Q8P B;  1IJF B;  2OSQ A;  3P4U B;  4HVZ A;  4RBV A;  4CT9 A;  4CYU B;  3KLG B;  1JXL A;  5KFI A;  1S0N A;  1B0P A;  4XIU A;  4LFA F;  1JLC A;  3MGJ A;  1N5V A;  2DNO A;  3D67 A;  5IQ6 A;  1KLM A;  1KS2 A;  3DLG A;  4KC5 A;  3TX0 A;  4OYO A;  1DZ5 A;  4DPU A;  3RU0 A;  3K0J A;  2K3I A;  2F8E X;  1EZZ B;  1FWP A;  2FDN A;  4DFK A;  2J7U A;  1W26 A;  4F0H A;  4IKA A;  2W4C A;  3ISN C;  2HKE A;  1AW0 A;  2CNN B;  3SV4 A;  1S1V B;  1H38 A;  3LGM A;  3ILI A;  5DLG A;  1EQ0 A;  4FPR A;  3Q83 A;  1WEX A;  2MDA A;  3FBF A;  3OSN A;  4ED8 A;  1KVI A;  1JLB B;  1IR2 A;  3CDB A;  4KKO A;  3W2V A;  1WC5 A;  4Q45 A;  1VBZ A;  1M5P C;  2C22 A;  4UOC A;  2QYC A;  2FVR A;  3AXK A;  3QIP B;  3F41 A;  1HA1 A;  4LF8 J;  4NYP A;  4EBE A;  3QYY A;  2BQU A;  4I6W A;  3FBB A;  3A3N B;  1JX4 A;  4PWD B;  4K4X A;  4Z7Y A;  3QZ8 A;  1HNW J;  4QIF A;  3N28 A;  1U1K A;  2WB4 A;  3SBM A;  1J27 A;  2YNH B;  3MEE A;  4DR2 F;  2I8E A;  5KFD A;  2OPS A;  4UW2 A;  2FVS A;  4GC6 A;  3KK3 A;  2PD1 A;  1UA1 A;  3KK1 A;  2R8G A;  4IDK B;  3CSK A;  3DHW C;  5KT2 A;  5DG9 A;  2JFK A;  2ADC A;  4ZPV R;  1N5Y B;  4LMZ A;  3ETO A;  3J80 U;  1QE1 B;  1XNR J;  1RQ0 A;  4QIG A;  4CLY A;  4JYA F;  1T02 A;  1RE1 B;  9ATC B;  2B51 A;  3GG0 A;  3KLI B;  3VGS A;  3C2P A;  4UTG A;  4CLK A;  2FGO A;  4J5O A;  1N8R T;  2HBY B;  5T14 A;  2EFN A;  3M9M B;  1R7I A;  2CJ9 A;  2FLO A;  4LT6 A;  1UEK A;  1NLK L;  5T41 A;  4JI3 F;  1WDT A;  3G2X A;  1ZS6 A;  2HBR B;  2V2K A;  4Y34 A;  3JSM B;  1PBA A;  1KRP A;  4C8L A;  1QAX A;  1H3D A;  1VS3 A;  2F4V F;  5CA5 A;  2WBM A;  1RT4 B;  1ROF A;  5A76 A;  5E41 A;  3UE2 A;  2V2V A;  2WHO A;  4YB6 A;  2E7W A;  1NME B;  2WOM B;  3LAM A;  2MQQ A;  2VAS A;  3FQK A;  3EGZ A;  2Y1L B;  2QLB B;  3EPI A;  2HIY A;  3ILJ A;  3V6D A;  3OR2 B;  2ZDP A;  1PO6 A;  4NA1 A;  4DX6 A;  3UW1 A;  2UV8 G;  5BYR A;  2HVI A;  4OI3 A;  5ETS A;  3N01 A;  2VBY A;  1FX4 A;  3MEG B;  3WBZ A;  4RU2 A;  1HNZ J;  3HK2 A;  2BQR A;  4KHP J;  2RAQ A;  1SXL A;  2ZBR A;  4CWB A;  1X9S A;  2HZV A;  2W01 A;  3TUZ C;  5CXT A;  1GMV A;  3M8S A;  1NSP A;  1H2V Z;  2I1R A;  3MR3 A;  2VFR A;  1EET A;  3T5H A;  1JQG A;  3CJK A;  1NPK A;  2PO4 A;  4R25 A;  3CCV S;  2R7R A;  2HMI B;  2DHA A;  4NLQ A;  4UZB A;  4KT0 C;  4C3L A;  2V0N A;  2OLW A;  2GGP B;  1TUG B;  4OYB A;  4JI5 F;  3AD9 C;  1R6Y A;  1P9Q C;  2A3J A;  1YZ6 A;  2LA4 A;  3I4P A;  1UWB B;  3I56 S;  2BDP A;  4QWB A;  2AWZ A;  4NEZ A;  3QNW B;  1OYD A;  3L7U A;  3HZG A;  4R5P B;  3B78 A;  1N5S A;  4B3M J;  4XPC A;  1K0T A;  2VG6 A;  4ED5 A;  3DMJ B;  2HW3 A;  3H59 A;  5ETP A;  3AOC A;  3R1H A;  3TI0 A;  4LF7 J;  1SIZ A;  2CAD A;  2J9C A;  3IFE A;  1HPZ A;  4O3P A;  4TN2 A;  1HMV A;  1ZA1 B;  3FSI A;  1EIY B;  2XY7 A;  3BN4 A;  5D0R A;  5I42 A;  4NLY A;  4C8N A;  1A6L A;  4DWI A;  3MMB B;  3V6D B;  1TVR A;  2NXE A;  2Q3P A;  3VQS A;  3HSD A;  3DU6 A;  4CH0 S;  3SDE B;  2HQD A;  3KK2 A;  3G71 S;  4P74 A;  3IR7 B;  4PZV A;  3NWG A;  3BO4 A;  2JVR A;  4MJK A;  4WFB Q;  3KFW X;  4OZ5 A;  1Q7Y T;  5KTQ A;  2KZM A;  4KHP F;  4RNH A;  3JXO A;  4K4W A;  1SUQ B;  4ECQ A;  2ZOF A;  1RHJ B;  1SV5 A;  3MMC B;  5K20 B;  2G0I A;  5L1L A;  2KHD A;  3M8P B;  4WF9 Q;  3LA0 A;  4P2S A;  3PYG A;  4RW6 A;  2KJW A;  3ZNJ 1;  4ATN A;  2KTQ A;  2E9Z A;  4DV1 J;  2J0Q D;  3MM8 A;  3Q89 A;  4WFX A;  4DQR A;  4KQZ A;  1CQM A;  1NH8 A;  3TOQ A;  1RBA A;  2YNF B;  3DLL Q;  3S01 A;  3QT6 A;  5HMW A;  1NCL A;  4LF6 J;  1VLO A;  1IJE B;  2B3T B;  5DZ6 A;  3RW7 A;  2LEP A;  1FJC A;  3EM1 A;  2J5A A;  2IM1 A;  1NO8 A;  1NHV A;  3K5O A;  4JI2 F;  2MQP A;  2OEJ A;  3R6G B;  3KJN B;  2RKI B;  5CAA A;  1R8C A;  3MXH P;  2ALY B;  5HK4 A;  4C3K A;  2AV5 A;  1N32 F;  1D3W A;  3HSJ A;  4O3O A;  1R8H A;  3W5Y A;  4X62 F;  4FKY A;  2M52 A;  4CT8 A;  3AJ2 A;  5ETM A;  5KFN A;  2CQ0 A;  1VRU A;  2PT0 A;  1EB0 A;  2R7U A;  1G2E A;  2W1B A;  4FYV B;  3TR5 A;  3DNC A;  2JRS A;  1YBA A;  1RAG B;  3Q0A A;  1AZS A;  2CNK B;  2KJV A;  3MD3 A;  4DR2 J;  1T03 A;  4HKQ A;  2OD6 A;  5F8J A;  5K14 B;  2DNH A;  1SB6 A;  4OJ1 A;  2XZD B;  3AA9 A;  3CJ3 A;  4YQW A;  3IRX B;  3D0G E;  4F25 A;  3BKU A;  4OHX A;  2UU9 F;  1BD6 A;  3DGV A;  3EDR B;  2BKO A;  4F04 B;  1MW7 A;  2PSZ A;  2QG9 B;  4WE1 A;  4ZVQ B;  3J7Z T;  1AUD A;  4B9T A;  3K89 A;  3U27 A;  4IDK A;  4TU8 A;  2LU2 A;  2W2Q P;  1Y11 A;  3I32 A;  1U0S A;  1MMD A;  3VZI A;  1S10 A;  3L7O A;  4NZ0 A;  2XHW A;  3KG4 A;  4OHZ A;  2RNE A;  3C6U A;  2VHG A;  1QE1 A;  4PWU A;  3L3C A;  1O5J A;  3GCW P;  4J9V A;  2XGP A;  4WYW A;  1NH7 A;  2COL A;  4NLU A;  1F6T A;  1V5V A;  3SCL E;  1IBL F;  2IJR A;  2YQ3 A;  2XMW A;  1CUL B;  1ZA2 B;  4OYX A;  4NPO A;  3ZTS A;  3CCU S;  2ZOG A;  4IYQ A;  3VWS A;  4F8R A;  2B4P A;  1SL1 A;  4OX8 A;  2X3G A;  3ITH B;  2ERR A;  2HS3 A;  4WP9 A;  3C16 B;  2PI5 A;  3KJV A;  2MGZ B;  2I9S A;  2HHT A;  1HBU A;  1RKI A;  1WG5 A;  3K58 A;  3TQ1 A;  4KH1 B;  1HNI A;  4LF4 F;  4GKK F;  1Z2L A;  4JI2 J;  3PX4 A;  1RIS A;  2MY8 A;  2FTR A;  1LNQ A;  5GAG U;  2E1C A;  2CZ9 A;  3OR2 A;  4I67 A;  3QJL A;  4EU0 A;  1GX5 A;  3VAK A;  4WZM A;  2DNP A;  2DR8 A;  3D28 A;  1VRT B;  4ZCM A;  2BZ2 A;  1KQS R;  4H4M B;  1IKY A;  2IFX A;  3MEG A;  1U6F A;  2YX7 A;  3ADA C;  1S4E A;  4ECV A;  4ANC A;  3I31 A;  5JVG Q;  4RWX A;  1XMO J;  4KGX B;  1ELO A;  5HVH A;  1U4B A;  3VTI A;  2DY9 A;  3W65 A;  3CDA A;  3MI7 X;  2N7C A;  1BY9 A;  1KDN A;  2AGO A;  3DLE B;  3C19 A;  4I68 A;  2XNR A;  4CO3 A;  4NCG A;  2PGC A;  4IO1 A;  5AE2 A;  3GG1 A;  2BRK A;  2QSF A;  4OI4 A;  5HBM A;  5LJ3 Y;  2FZC B;  1S1T B;  1YJT A;  3O44 A;  4RW7 A;  4M94 A;  4DBQ A;  6AT1 B;  4TQR A;  1F5B A;  3RW6 A;  1WOP A;  4X2B A;  4IG3 A;  4DPY A;  5M2P A;  1PSD A;  2B0G A;  1WOO A;  5DG8 A;  4DV6 F;  3HHK A;  2WVF A;  3I6P A;  2E1M C;  3OTB A;  2MLX A;  3MMA A;  4DL5 A;  2J0W A;  1KR4 A;  4LIR A;  2PN6 A;  3R5B A;  4OJH A;  3DRR A;  4Q5V A;  2LQ9 A;  1JXE A;  1N0U A;  1RA7 A;  2FHK A;  2HFU A;  2LXU A;  3N79 A;  2NXU A;  4PG5 A;  4ZP9 A;  4B9S A;  3TJA A;  1IKW B;  2NXC A;  4LSZ B;  4LRB A;  4DPW A;  4WFA Q;  1WDD A;  1PIE A;  1X5P A;  3GIM A;  4ITS A;  3K5P A;  1RKJ A;  2A18 A;  1BQM A;  1EP4 B;  4XAK A;  3DFE A;  2BBE A;  2PFD A;  4M1K A;  5C2C A;  1JWW A;  2G13 A;  3I87 A;  3BDP A;  4J9S A;  2CKW A;  1U1O A;  4J91 A;  4OHW A;  3VAJ A;  2CJQ A;  3SDE A;  5BR8 J;  3L9Z A;  3FFI A;  4X4Q A;  1F9E B;  1RBO B;  1HIY A;  1IBC B;  2CVE A;  3BSN A;  3TX8 A;  4BS2 A;  4F67 A;  2DRD A;  1O8B A;  2V8G A;  3OTD A;  3KLF A;  3M2R A;  3ENV A;  3QGP A;  3RR7 A;  2ZIT A;  1I94 J;  1M5H A;  2BYC A;  2ZDO A;  1T05 B;  2BJE A;  3PNI A;  3LOU A;  3H7H B;  4MK9 A;  1GXU A;  5DDR C;  3A1Y G;  2FC8 A;  1FKO B;  2NCK L;  1U7L A;  3M2U A;  4LRC A;  2KRR A;  3UNG C;  3I5A A;  5DM6 Q;  3GSD A;  2NXJ A;  4KO0 A;  5B09 A;  1RK8 A;  1RUS A;  1U0H A;  4DV7 J;  1CVJ A;  4C98 A;  3MAQ A;  1HNV A;  3BGO P;  5LOQ A;  3EYZ A;  1Y7P A;  2UUA J;  2V2Z A;  1TZ0 A;  5A8R A;  4LF8 F;  1NBE B;  2FGC A;  3D68 A;  3UD4 P;  1WOR A;  2ZH5 A;  1FXR A;  2VC1 A;  3BPS P;  3GYX B;  3I0S A;  1UW4 A;  3IMQ J;  3PYE A;  3SFG A;  4X4U A;  5KFB A;  4B3S J;  5HSP A;  4IQX A;  3AD8 C;  5D8H B;  3CO0 P;  4OLP A;  1WHV A;  5KG6 A;  2L41 A;  3X3U A;  4CM0 A;  2B9X A;  3OHB A;  3LPY A;  5CQG A;  1IBK J;  1FK9 A;  4FVC A;  4DSI A;  4DV3 F;  4LBI A;  2VDH A;  3H90 A;  1TFY A;  2QMW A;  2H51 B;  3N6M A;  3MCS A;  3MR7 A;  2D69 A;  1C0U B;  3RBZ A;  4CH7 A;  3ZZO A;  4B02 A;  1L3V A;  2IMW P;  2DXE A;  2DNQ A;  1S1X A;  2BM1 A;  1RHK B;  1WF2 A;  3R5J B;  4ZIV A;  3M9O B;  4C8M A;  4LBH A;  2QC3 A;  4LR7 A;  1KD1 T;  3T1Y F;  1JLQ A;  3QGG A;  2HFV A;  5LMU J;  2AX1 A;  1YKW A;  3B82 A;  2JVO A;  5HJY A;  2EC0 A;  2KN4 A;  4P2M A;  3B8H A;  2BQ3 A;  2EXU A;  1FDB A;  1VQL S;  1AYE A;  5JVH Q;  4FNI A;  4ZCI A;  2VPY B;  3MZI A;  4Y65 A;  5H9E K;  3LAN A;  4BHQ A;  3NOG A;  4DR5 F;  1GNK A;  4V19 X;  3A8J A;  1N34 J;  5I3U B;  1XWL A;  5FJ4 A;  3CJS A;  1KQK A;  1U1N A;  3UD5 A;  1FJE B;  1REV B;  2F8H A;  2BAN A;  1YJU A;  3O6Q A;  3R3T A;  3VAL A; 
#chains in the Genus database with same CATH homology
 1HQ2 A;  3HCX A;  4M5M A;  4CRJ A;  4CYU B;  1RB0 A;  4M5L A;  1EX8 A;  4PZV A;  1TMM A;  4M5J A;  5ETR A;  1EQM A;  4M5I A;  5ETL A;  1KBR A;  4M5G A;  3HSJ A;  1F9H A;  3HSZ A;  5ETO A;  3KUG A;  3ILJ A;  3MCO A;  5ETM A;  1Q0N A;  3UDE A;  1TMJ A;  1DY3 A;  3MCN A;  5ETQ A;  3ILO A;  3HSG A;  3IP0 A;  2QX0 A;  1RU1 A;  1HKA A;  1CBK A;  5ETS A;  5ETN A;  4CYU A;  5ETP A;  3QBC A;  2F63 A;  1RTZ A;  3HD1 A;  3ILI A;  4M5K A;  5ETV A;  1RAO A;  5ETK A;  3ILL A;  3MCM A;  3UDV A;  4CWB A;  1G4C A;  1IM6 A;  3KUH A;  4AD6 A;  1EQ0 A;  2CG8 A;  5ETT A;  3KUE A;  4M5N A;  3HT0 A;  3UD5 A;  4F7V A;  4M5H A;  3HD2 A;  2BMB A;  2F65 A;  1RU2 A;  3HSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...