3K2YA

Crystal structure of protein lp_0118 from lactobacillus plantarum,northeast structural genomics consortium target lpr91b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein lp_0118 from Lactobacillus plantarum,northeast structural genomics consortium target LpR91B
rcsb
source organism Lactobacillus plantarum
molecule tags Nucleotide binding protein
molecule keywords uncharacterized protein lp_0118
total genus 19
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k2yA00
3K2YA
chains in the Genus database with same CATH superfamily
4W98A 1VQ6S 3EWGA 2X3DA 2VICA 2XCAA 1RWUA 1MWZA 2YKMA 3NCQA 1FFWB 3F44A 4DS5A 2IC3B 2QE5A 2ZEJA 4LF8J 3FJ2A 4DL7A 1LW2A 1VQPS 1T9YA 3G82B 4H4MA 4J9OA 1RTJA 5CABA 2IC3A 4IQMA 1X5SA 2DHGA 4OYXA 3CC2S 1UFWA 2JNJA 3Q8PB 3N79A 3MAAB 2W7AA 2V9KA 1X4GA 3CC7S 4OYBA 4P2SA 3HPOA 1VOMA 2OD4A 2V67A 4B3MF 1JJHA 2EKYA 3K5NA 1C0UB 1DLOB 4HDGA 3MFIA 3QO9B 3HFZB 3C3LA 4DR1J 1IKVA 3FEXB 1SB6A 2DH8A 2RQCA 1WJ9A 5K20B 2MJNA 2VFTA 2VFVA 3GV8B 4Z7YA 3CD6S 4WF9Q 2E5HA 2IM3A 3I5CA 1Y10A 3GILA 1LW0B 5LSLA 3FDSA 1FD2A 3W9HA 2DVIA 1JJ4A 2CZVC 3VALA 2POKA 1KDNA 3DRSA 3R5JB 3ZNJ1 4DX5A 4OJ1A 1LWEA 1HQEA 3UFCX 2OUGA 3AODA 1TL1B 3TYTA 2GAGC 3DRSB 5GMEA 4F4AA 4DV7J 3L09A 5F3TA 2AD9A 2AYEA 2VC0A 6AT1B 1XNRF 3SZ2A 2N4CA 1FDNA 2YY3A 1P8GA 1BQNA 3GIJA 2EW9A 3Q8YA 3CIMA 3KUEA 3H20A 5F8GA 4LRBA 5KFBA 3IRWP 4RW9B 1F9FA 1XIQA 1YTYA 1MN9A 2CPJA 1S9EB 4BDPA 4NMLA 4CT8A 3I0SA 3HHLC 3DLHA 2W2OP 2C3MA 3D9BA 4LSNB 3W65A 1S1TB 2XC9A 1T05B 5F8JA 3GYXB 1P27B 4W92B 4H4KC 1R31A 2JVOA 1D8YA 1YJ9S 1S1TA 2V2QA 3PYDA 4J90A 4LRCA 1TR0A 1HNZF 3VV2B 3DRPA 5KFYA 5ETOA 1WNEA 2HFNA 2IM0A 3AJ1A 4ZVPB 1GXLA 2MQ8A 4R8UB 3BBFA 3KLGA 4EO6A 3HK2A 1MU2A 1JIHA 2XHWA 1FX4A 4QR1A 2W8LA 1TAQA 4ZVEA 3NGDA 3A8IA 4USMA 2CA9A 2OO4A 5A76A 4MK9A 4JUZA 3I87A 5GAHI 4XO0A 1Q8KA 3RRHA 4CQ1A 2DNLA 5HROB 5IWAF 1UEVA 5KG4A 4ZIVA 5EGYA 1WI8A 4DFMA 3MECA 4LR9A 2XZDB 4MIBA 4K5RA 4C8YA 3LWLA 1S1WA 1N36J 4MKYA 2H1YA 1PJ7A 4R5PB 4CH7A 2GAHC 2RILA 4D3HA 3IO1A 2RD5C 3TANA 2W24A 2C2NA 2XYGB 3US5A 1OMSA 3N5FA 2CG4A 3PHEA 1KOOA 3M8QA 4KR0B 4NLXA 5KFRA 5SZTA 3I9V9 3VHQA 4J9QA 3V6DB 3DM2B 2QLBB 4NZ7A 5IM0A 1YWXA 1HLWA 2BOAA 2B8QA 2ZITA 5A6WA 3UCZP 1U1OA 3RBEA 1YJNS 3AXMA 1RT3B 2U1AA 4ZHRA 3HMJG 4J9MA 3LP2B 1DURA 4OZ3A 3MMAB 2I6WA 1Y0HA 1TKXA 5KG6A 2ZH8A 1Q16B 3JB9k 3NAIA 4Q45A 5KFXA 3MUMP 3CCSS 1NK5A 1AZSA 1U8WA 1SC4B 1SI9A 1T0TV 4RWXA 1CJVB 5C5JA 2BJ3A 2WHOA 3HKWA 4L3NA 1G7CB 3SXLA 1TL3B 1TAUA 3P5TL 2HHVA 1BC6A 1RA6A 2ACYA 2L9WA 3MM6B 1FVQA 1VQSA 1UZHA 2J8AA 1RAAB 2Y3YA 4FVMA 5EHHA 4DR5F 4ECRA 1LXNA 2CJBA 2YKQA 4EYHB 1HWLA 3V2UC 4DU7A 3G82A 3P5BP 1UVKA 2HQ3A 2HZCA 3CJRA 3QGIA 5DG7A 1C2PA 4H4OB 3RB3A 1NJZA 5KFEA 3T5JA 5LMNF 3HKZD 4KSEB 3ILOA 4GKJJ 1RKIA 1W7WA 2F5GA 1B7FA 4YY3F 3PW4A 1V3ZA 1MMDA 4F3QA 2Y1JA 2F4VJ 2ALZA 4Q8EA 2IJNA 2JEFA 2HRUA 4OLPA 2QT7A 1WSRA 2AJ4A 3BQ0A 2LU2A 3GZ7A 3NS5A 2B4OA 5E0OA 1U1NA 2CNNB 3FMBA 2GVDB 3TO8A 4I7FA 2DNGA 3DNCA 4OV6A 1Q8LA 1KQKA 3ZFVA 1GTEA 5J1EB 5THWA 2MSTA 2E5IA 3GR1A 5GVQA 1EKRA 3I5AA 3T1AA 4EO8A 2GVZA 2R2RA 4B3MJ 2Y8WA 2PGCA 4DDFA 2FGCA 4PQAA 4Y2KA 3TJ8A 2LQ8A 2QIFA 4ZJLA 1N6QA 3M7VA 5T14A 1SJ4P 1U45A 2K1RA 3KNGA 3BGUA 1S99A 1U0HA 3M05A 1FJGF 2DNKA 4DCJB 2VIHA 3H98A 3JSBA 3OL8A 3NL0A 3TUJC 3ILIA 5KFZA 4OX9J 4DR4F 2DKOB 3TOQA 1NO8A 3JSRA 4JI7J 2CPFA 4ZCKA 1VIOA 4B9LA 1XNQJ 1UW4A 2CXEA 3ET6B 3GONA 5DDOC 1MROA 2OP5A 4WP3A 1S6PA 3PR4A 5H9EK 1PO6A 2KXNB 5KG5A 2IA6A 5HSPA 2HNYA 4UOCA 1UMJA 1RZMA 3ET6A 5HL7Q 3K59A 3CCQS 2CZ9A 3LUYA 2Q66A 2CPXA 3HCXA 2KM8C 3LALA 1NMEB 1SKRA 1FERA 4ZPWR 2OMOA 4PUOB 4LSLB 2HNYB 3D54A 2ADCA 3AT1B 1BLUA 5B0GA 4DSKA 5CZXA 1P1TA 3GWCA 3BH7B 1S76D 2V4JB 5L9XA 2MZRA 1KTQA 1Q5YA 2DEJA 4P75A 5DS7A 1JLBA 5GADU 1TVRB 3G87A 4WKRA 2IAJB 1YKWA 4WTOB 1S1VB 3K5LA 3G96A 4KH0B 2Y9HA 2OI2A 1Y11A 1TVRA 2YPYA 1UPMB 1MU2B 1VK3A 2KDOA 1WHVA 2RE1A 1U1KA 1KVJA 1H72C 2Q79A 2Z2LA 5KTQA 2KN4A 2BE2A 2XMKA 4J9PA 1TK5A 3QWPA 3ZZZA 4BS2A 3OL9A 4OJ3A 4FKYA 5DDPC 4CTAA 2X1AA 2GGPA 1WORA 4C3LA 1X4FA 2QG9B 2YKPA 2ZBQA 3NBPA 5HROA 4FXDA 1S57A 4MFBA 3QNWB 3CO9A 3RYLA 5IZHA 5D6GA 2YH1A 2FVPA 2V2KA 3NBPB 3O5TB 5KFVA 4DV4F 3EVOA 5CD4H 4OYPA 4QIEA 3LPYA 1R0AB 5L1JA 1XMOJ 1NJIT 2G2OA 1DARA 1T3OA 2KT2A 3OPKA 3QT8A 5E2QA 4CLSA 3GPAA 4O44B 4XPCA 1U8SA 2NSBA 1N5SA 1NDPA 3DMJA 1SIZA 3CO0P 3GFYA 2IPOB 3OR1B 4WFAQ 2CQ2A 2DIVA 3BH6B 2HMIA 2VZ9A 3FSXA 3WIUA 2EFGA 1IR1A 3M30B 2V34A 5KFTA 2MKYA 3ISNC 4URGA 1N52B 3OR2B 3WHIA 1FXRA 4R0EA 4RU2A 1YJRA 2VL1A 2JDJA 4KH1B 4DSFA 3W9IA 4Z37A 3GIMA 1X9SA 5CYJA 3U27A 3PDNA 2WCXA 4YHHF 1YHQS 3JYTB 4ECZA 3VAGA 4A8YA 3G86A 3RAXA 1X4AA 2MPUA 3CDBA 2V9WA 3C15A 2HHHF 1HARA 1QTMA 1CULB 2FUG9 1X4BA 1B7YB 5B7WA 4DQPA 3P96A 1DLOA 2H5IB 3A12A 2R2UA 2KXFA 1HNIA 1CULA 2CVIA 3TEHB 5J2QA 4JI4F 2XS2A 1IQTA 3J81U 2CUYA 4AXJA 4DPWA 2W7PA 1XR5A 4K8RA 5KT6A 1XC9A 2OSQA 3HXMA 5HBMB 2DJWA 2IM2A 3KDNA 4DPYA 5ETRA 3GSDA 3S6EA 1AW0A 2UUTA 1Q79A 1NK8A 4TU7A 3CGIA 3D0IE 2RQ4A 5FLXU 7FDRA 3DOMB 4Y65A 4RUCA 1H6KX 2WRMA 4O0NA 4PG4A 4X4PA 4M5GA 2EFVA 3A8KA 3EGWB 2ZVSA 3E8OA 3GG1A 1FWKA 2OPQB 2HKEA 4I7FB 4G3IA 1EP4B 4X4UA 4RBTA 4LJMA 2O3DA 4U7UD 3ULHA 2FVCA 2GQCA 2PI5A 4WP9A 1BHNA 1SVDA 2H3EB 4XDDA 5E5NA 4C8NA 1PYSB 2HS0A 1FNOA 2YWGA 4PR6A 1FNMA 4K0KJ 4QYZJ 1HWUA 4DQIA 4NA2A 3M8YA 4ZN1A 1UEUA 2XWXA 3UW1A 1IBMJ 3Q8SB 4B3TF 3RJMB 2GS8A 4A47A 4R25A 1Q7LB 4F2SA 5DDRC 2BUNA 2ZE2A 2Z8QA 1T05A 1PKUA 1UJ5A 2QLJB 5FDLA 3F41A 5ETNA 3JSYA 5CHCB 2VODA 4A8MP 2BBEA 3NOGA 1ACMB 3PIPQ 1HMVA 2HIQA 3HHEA 1GK8A 2DXEA 3UD5A 3VZHA 1QD1A 2W01A 4XPEA 1RT6A 4NA3A 2ZM6F 4OZNA 1ZOTA 3I6PA 2IBKA 2IA0A 1HI1A 3D68A 3W5XA 2B9YA 2HBQB 2X3GA 4X2BA 2V2VA 2WAQD 3OUYA 4M95A 3NS6A 3KLEB 1OWXA 1WHYA 2C2RA 5D4LA 1SJFA 3ZZYA 4IO1A 1XMQJ 4UZCA 4IRDA 3RB6A 3FVYA 2LFVA 1FI4A 4NYZA 1PAEX 3B4DA 3KLIA 3FK4A 1ZPVA 1RHRB 4H54A 3KG4A 4PABA 1U48A 1J5EJ 4YN3B 1CBKA 2L48A 2DGSA 1NRKA 4YP3A 4CLYA 4EGLA 4DUYJ 2XY5A 3NP5A 3F0NA 2R8JA 5H9FK 2CPYA 1FKAF 2BE2B 1RWVB 3QAEA 2MSSA 3CULA 2ZWOA 1FX2A 2MDAA 3MEEA 1GMWD 3NCRA 4YMEA 1RK8A 2BZ2A 5IM0B 1T03A 1HI8A 2XBPA 3I31A 4I64A 2I8EA 3HJVA 3IP0A 4DV7F 3D7SB 4ZCMA 3FZBA 2HVEA 2XGPA 3Q86A 2U2FA 3Q8QB 4N56A 2VFRA 3PIOQ 1NZ8A 1B0PA 1M0SA 5FIIA 1UEKA 2V5HG 4YDDB 4JV0A 4AL5A 2QJ3A 2F1FA 3K5OA 1VRQC 4WP8A 1N34J 4ZPCA 4KHRA 2SXLA 3MCSA 3C6TB 4RW8A 5SUHA 2XI2A 1U6ZA 3CDEA 5DDQC 1XERA 3OR1A 4ZPAA 4TQRA 1LWCB 1A6LA 2CKWA 2ZJRQ 3QJPA 3EX7B 2YNGA 3GCXP 2XNQA 1CPZA 2NQPA 4P52A 1Q8IA 2XYPB 1HBUB 2J9DE 3M6VA 2WTFA 1RTHA 2WOMB 3JXOA 4FPIA 3KUHA 2PMZD 1RTZA 3UNYA 4CLFA 4C3MA 2OKQA 4P73A 6FD1A 1T7PA 4NASA 1JMTA 3GTYX 1WDDA 4B3OA 4X64J 1X4DA 1TL7A 2XLKA 2ILZA 1ZA1B 2VC1A 4C2MA 2P8IA 3EM1A 2OSRA 4DF4A 3L7OA 4ECUA 3UN3A 2GZOA 3QGGA 1RTIB 4PAAA 5D3GB 1PYOB 1HHQA 4JI2F 1HR0F 2QLWA 3U1MA 4AT1B 1OQ3A 4DFPA 1S0NA 1OQ6A 4XAKA 3QRPA 1SH2A 1YBAA 5BYRA 2JFDA 4MKVA 2GVDA 2W2MP 4HHHA 1HYSB 2BYCA 3PW7A 1RXOB 4Y34A 5J1EA 2O66A 2KH9A 4F4KA 2W9BA 1Z4UA 2D74B 2E9ZA 4RJVA 4L76A 1WI6A 5AE3A 4ECYA 2MLZA 3MXHP 1QSSA 3TRGA 4TLQA 1TL1A 4B9NA 3PM9A 1K1SA 5ETTA 1C1BB 1C4CA 2CJXB 2JVRA 1FRMA 2QZ8A 3PFOA 4J5OA 2DNNA 4NX9A 3W1YC 2UUBF 2VA2A 2GC8A 4QIWD 2MMYA 3FCWA 4DS4A 3NGKA 1H98A 3M8PB 4CO5A 3JSMB 4DF8A 1ZZFA 2F8MA 2R8IA 1H2TZ 4PWUA 3O1LA 2DNQA 2KVQE 1RADB 2G1HA 3CJ8A 5I4MA 1TK8A 4X4OA 1MROB 4IDKA 5J2PA 1UVIA 2RF2A 3L4BC 4KY3A 4E98A 1XJWB 3K57A 4ID5A 3Q0AA 2Z57B 1E6YA 4LSNA 2R8HA 2IDLA 3A3PB 2ZNZA 4MIWA 2RF2B 3GR0A 4ZOSA 1SXLA 5BR8J 2E66A 4UUWA 3V6KA 5L38A 1M5HA 2B3TB 2VQFJ 3VAKA 2HHQA 3FBFA 2KKHA 5CH7B 2J7KA 3DXSX 1IKWA 3MWBA 4K59A 5HJXA 1U1LA 3FSIA 5E3QA 1BQMB 4A8QA 1MMNA 4IR9A 2DY9A 2IAJA 3ITHA 3CCLS 3CMES 3DDKA 1RU1A 1CG2A 3MEKA 3EUNA 3F56A 2P2CB 3MPVA 2XSJB 3UN5A 1KLNA 4M8LA 2DH7A 2OTLS 2M3DA 4QR2A 2UUAJ 3QYYA 4NLRA 4JI0J 1YBTA 1A9NB 2IJRA 2VPXB 3LAMA 2VJUA 1NB2A 5AT1B 3BSAA 3DCAA 3SFGA 1RBAA 4DUZJ 2RS2A 1H2UX 2BVZA 3KTQA 3LP0B 2HFSA 4NLSA 1RAFB 1O5JA 1WKLA 1K1QA 3QT6A 4M5LA 1YRTA 3UD4P 4LF9J 3NY0A 4IRKA 4G1QA 3A8EA 3HD2A 4OI4A 2UU9F 3RUBL 2BR0A 1DQAA 2QRRA 3MOZA 4ZP7A 3R27A 2H51B 4I2PB 3TZWA 4C3KA 4HL9A 1WTBA 4JI3J 3I5BA 2OH2A 2GA7A 1CS4B 4EMDA 1SCJB 2HK2A 1RT3A 3J80Y 4DV0J 4QWCA 4F4WA 1N0VC 3Q8RB 4XDCA 5J2NB 2FGOA 4F02A 3SDEB 2YNFA 4LREA 4HTIA 5MLCV 3M2RB 3RG6A 1NK9A 1AZSB 5J2NA 1XBWA 2GO9A 3FBBA 4CI0B 2VG6B 1N5TA 2EG1A 3AXKA 4BHQA 4CLLA 1GFWB 4X4QA 4GVLA 2DHSA 2HLUA 1PC5A 3T1YJ 4DR3J 2JC1A 3MM9A 2MZSA 2MQPA 3ADAC 3KJNB 4I6WA 2HPUA 3PYEA 4OYIA 5F8IA 2HIYA 3W5ZA 3PW2A 3JYTA 2R8GA 3GE9A 2EWHA 3MM9B 2YNGB 4RUHA 2JOQA 2QFJA 2JX2A 1DZ5A 3WZ0A 1CEZA 1RTHB 1CJTB 1Y5NB 2WOMA 4WFNQ 2ZH4A 2FZKB 4P7TA 3BEGB 2VOPA 2M0GB 5HP1A 4KJIA 2PN6A 1EKSA 1N5YA 2CDRB 1CJTA 1HNIB 2ZUAA 2K8GA 1WHXA 2A2DA 1RQ0A 4IFVA 4U8VA 2L41A 1M5OC 2R7VA 2PFDA 3ICLA 2BQUA 1TV6A 2UXCF 4OLOA 2E5GA 1N32J 5ETKA 1TP7A 1J5OA 1LOUA 2C2MB 3DGVA 2LA6A 4QYRA 2VPZB 1VMBA 4PWDB 2XMVA 4PCQA 2XMAA 3THVA 4CM2A 2UVWA 1VQ8S 1NHKL 1NSKL 4C0BA 2W7OA 5KOWA 2GJ2A 2HWHA 2K3KA 2OHDA 2QMUB 3ILLA 3FZ2A 2D7SA 3CJ4A 2VBWA 5J2MA 4B02A 4J9KA 3R3TA 4G65A 4WCEQ 1QVFR 3OQ2A 4O3NA 2HQFA 2YWEA 3LP1B 4K50A 1JLCB 5CXTA 5A0YB 2XZTB 3M2UB 5G4DA 4ZLLA 3JAMU 3PVXA 1HQEB 4RZRA 4IG3B 4J9VA 1VGYA 2J76E 3W61A 2PT0A 4FYDA 4ZK7M 5L8RC 3BN4A 4A48A 3CCES 5DO2A 4ZP9A 4GKKJ 2XMUA 3R5DA 2FHKA 3N4WA 2D41A 4FN5A 2DXDA 2HFZA 3MTKA 1DY3A 5D77A 4DR4J 3QRQA 1KBRA 1RAEB 3I32A 4GC7A 2LQJA 3ZC4A 3LAKA 4IDKB 4TN2A 4UF4A 2XQCA 1I94J 5KFOA 3IC1A 4F4XA 3LQVA 2IHR1 4K4ZA 2FDNA 4C8LA 5E3PA 3EPGA 1QLNA 1WC6A 4G1IA 3Q8UA 1HNZJ 4DL2A 2D69A 4WU3A 1Q82T 2KFNA 1R7IA 3KLEA 4YB5A 2O1PA 3AD7C 4OZ1A 1QUVA 4EZ6A 4CH0S 2DBBA 1RCXB 3T3FA 1K44A 4O23A 4KHPF 4NI2A 1N0UA 2KT5A 3PCOB 3UDLA 3H5XA 1HD1A 5KFLA 2W8KA 2CRLA 4KHMA 4ZJOA 5B0BA 3CCJS 1RT2A 2JRSA 5KFCA 4YOEA 2FZGB 3VAJA 4IG0A 2MB0B 4WYLA 3AQPA 4E8UA 4RNOA 2B0GA 2OGUA 2GGPB 4PG5A 4NLDA 1A0OB 4IRCA 4OYMA 4ENOA 2VKRA 2QA2A 1YJTA 2NXEA 4IG0B 5HLFA 4LFAF 1TFYA 1CLFA 1VS3A 3FNNA 1A7GE 2HAIA 2JFKA 1IN0A 1X0PA 3K89A 3M6UA 4TVAB 4IOAQ 4P2FA 3HSJA 4HH1A 3MECB 1ZZNA 3B8HA 4F3MA 1TUGB 1WOPA 2BJ8A 1KQFB 1R3NA 1FD8A 3HVWA 2JLGA 2W2PP 2C2DA 1BQXA 4CNZA 4ES2A 3BBBA 1VR6A 4OX8A 4RW4B 2BXJA 1ROFA 2MY8A 4L74A 2NS1B 1NH8A 1D1UA 2CJYB 1T94A 4KRWA 2F8EX 1SL2A 1NDCA 2P6TA 3TX0A 3J7YU 1URNA 3FBEA 2VJVA 9ATCB 2UU9J 1GX6A 4NZ6A 2NXNA 3G8TA 3PACA 3HVRA 3QIDA 4IH7A 1M5KC 2G0JA 1PSDA 1RAOA 1LW2B 3CIZA 1LWFA 2AV5A 3GIIA 1ZM3A 3H59A 4DFKA 4Y2AA 5DM7Q 3IS9B 3VAHA 1NJYA 1GAOA 1Q0NA 1S4FA 2VV5A 4JYAF 5U47A 1EX8A 5H1SV 4B3OB 2N7YA 3AB4B 1M90T 2GIRA 2B4UA 4C8MA 4DSEA 1IKXB 3QZ7A 4DV3J 2CADA 3QMQA 5ITHA 3PRVA 3TAMB 4A8XA 5CCMA 5D3GA 1S7IA 4RL1A 3BGRB 1G6BA 1S12A 4C8ZA 3E51A 3ZXWA 4ED8A 5HBMA 1TUVA 1ZS6A 1IKVB 1HW9A 2CQBA 2DNMA 3Q8VA 1V3RA 4NLTA 4ILLA 1S6OA 1R8CA 1UCNA 4DR5J 3LANA 1EB0A 3CCVS 1HQ2A 4I2QB 2DD8S 3BGLA 4KO0A 4MMOA 4NZ0A 1LW0A 4I56A 1HBNB 1HBMA 3B4MA 2XMMA 2OLWA 4LR7A 2E5LF 3GG0A 4O3OA 4B9TA 2RHSB 2XZWA 2YQ0A 1C1BA 1FJ7A 1DAXA 4QU6A 1GXUA 1RAHB 2P5VA 2LLZA 1JXEA 4GKJF 2G13A 1WG1A 4M5MA 1D9FA 3NG8A 3OT9A 1CC8A 3BGFA 1HIYA 1SQFA 5IT9Y 4DFJA 3EDRB 3D6TB 2WB4A 3D1QA 3HO1A 2HGMA 4DZDA 1KSPA 2EK6A 4C0HA 5IV4A 5GAEU 1JLCA 2M88A 1JJ2R 4FF1A 2PI4A 1H7WA 1FE4A 2K7KA 1KR4A 4ZPBA 3MR2A 2JLEA 1T9VA 2ZZTA 1VQNS 2I38A 4KGXB 1UJ6A 1RHMB 3CJ0A 2I9SA 2DNHA 2EVZA 2LQ9A 1TZ0A 4Q5VA 3KLHB 1MSWD 1KVKA 3TUIC 4CLZA 1PJ5A 4F4ZA 3SCKE 4ZJQA 3TUPA 1S6PB 1FT8A 5KFUA 4LBPA 1U2CA 2BDPA 4KAIA 1ZM2A 4FBTA 2DRBA 2F3JA 2R7QA 3J7Z5 1WWHA 3HHLD 3L7PA 2WSCC 4AQYF 3K17A 4X4NA 4OQJA 2HBYB 4RU9A 4L6V3 3Q2TC 1U2RA 2AGPA 4P2XA 4V19J 1RP5A 4USJC 1K0VA 2AJ2A 3GFXA 1WC0A 1N5QA 2B4VA 3JTPA 3EDQB 2ATLA 5KT5A 3ZTPA 2MKSA 4FYYB 4K2JA 5IQ6A 1NK0A 3NWRA 1H38A 4IFYA 1PJ6A 2EXUA 2HNZB 5D4NA 3RW7A 4LF4F 2QA1A 3CCWA 2M9KA 2R42A 1G2EA 3S7RA 2J9DA 4YR0A 1CJUB 3A4TA 3OVBA 5LJ5Y 2O67A 3M8QB 4OX9F 3TP2A 3QATA 1LFPA 1U24A 2RDJA 2HLTA 2UVVA 4JOUA 4MFBB 4RUBA 1B64A 3HSDA 3KHRA 4ZHRB 2ZH1A 2MTLA 1NSQA 4PPZA 4A8KA 2KJWA 2EPIA 2J0WA 3I82A 1X9MA 2XLIA 2DY1A 3KFWX 2A2CA 1ZPWX 5C25A 3ISND 2DR8A 3EZOA 3H5SA 1Q5VA 2FQQB 4HR2A 4Z2XA 2N4DA 1D09B 5I42B 2UZAA 2MKJA 4C98A 4CO1A 4QW9A 2E5LJ 1IXKA 3MEDA 5EX0A 4WKYA 4I6AA 4B3SJ 2HS4A 5LOQA 3OSPA 2B8PA 4A4JA 3RB0A 1NHVA 1PCAA 2CWXA 3DU6A 3MM6A 3PNIA 2BQ3A 3M9NB 4IO9Q 3VQTA 2DPJA 2XI3A 3MUVP 5DRKA 2Z2YB 3FCVA 2B6AA 4IKAA 5ADZA 4X4TA 5CCLA 2VU5A 1DTTB 2RNEA 2MHNA 3MCNA 2AQ4A 3TZXA 3KNAA 3IR6B 2DO0A 2ASDA 4E2FB 2VKZG 1L3VA 3O2IA 4LF2A 5L1LA 5DQIA 3SIPB 1N33J 4KPCA 4KFBA 3H8YA 4WFYA 4O3PA 3T41A 3HFVA 4CO0A 1CQMA 2CNLB 2CVEA 1RISA 1J5OB 2MQOA 5DGAA 1KC8T 2D3O1 2RUSA 4DV4J 4JYAJ 2BEFA 3I0RA 2WSEC 3OBIA 3BM7A 4ED3A 1QUPA 2LEBA 2BW2A 5E7OB 5KFPA 3P8BB 4ED7A 1HW8A 2MYFA 2J8SA 4ZA1A 3W2WA 4OZJA 1S0VA 1WACA 5KFKA 5AXKA 3M8ZA 5LMUJ 2AYBA 1D9DA 1QAJA 2DTJA 4LF4J 5D8HB 4F2RA 4J9NA 4MT1A 2Y0BB 4EK2A 1SQEA 1JLAB 3GIKA 3CCUS 5LT5A 1GMUA 1WC1A 2PDAA 3NAHA 4L72B 1SV5B 3HI9A 2RRAA 5IWAJ 1JLAA 3V5RA 3KJVB 5KT2A 3FQLA 2OPQA 3CMAS 4C97A 3GFZA 1TMMA 3EGNA 4JI8F 1S1UA 1FF2A 3ELHA 3IRXB 3NXZA 4LFCJ 1UPPA 1VDHA 1WSVA 3MPYA 4U6PA 3KK3A 5L39A 5HANA 2V4QA 2AJ0A 5E33A 1HNWJ 2GJIA 3I4PA 4EWTA 1S1UB 5I3QA 4OX6A 5I3UB 2ACMA 3SQOP 3LO3A 4WYWA 4CYUB 3MEGB 5F8HA 2R4FA 4ICLB 3J81Y 2C42A 4DR3F 2V8PA 3RBZA 1K8AT 1F5BA 4ILMA 5I3UA 2AMCB 2BE7D 2H4YB 3SQGA 2HHHJ 2CYYA 1U09A 3Q2SC 1AT1B 1FXLA 2ZHOA 1IKWB 1FRHA 4KT0C 1Y00A 1L5UA 3KMSA 4ZVUB 4KV8B 3SQGB 2V4JA 2EFOA 3JTNA 4WIQA 4RNNA 4DV5F 4F0KA 2NYIA 1X5PA 2CIMA 4USHA 4DR2F 2ZKTA 3VAFA 1NLKL 3KG0A 2WSFC 2M7SA 3CB4A 3DDIA 1R0BG 3I96A 4YUDA 4RW6B 5F8NA 4JV5J 1U1PA 4LQ3A 2FLLA 1FK9B 5DGBA 4DPUA 4YQWA 2H5JB 5KFSA 4C4WA 2AW0A 4WPAA 3IBWA 1L3KA 1RAGB 4B3SF 1OIAA 4OYAA 5K14B 4YEAA 3G9CA 1XQIA 1WDTA 4PXCA 1YG0A 3V6DA 4WFXA 4YY3J 1H73A 2AX1A 2F4VF 2XB2D 2KHDA 3SSRA 1U4BA 1HD0A 3QJJA 3TVYA 2ZVIA 3UI3A 4DZ6A 3VTIA 2XLJA 1WOSA 1UWBA 4IH6A 5D4PA 3SDEA 2DGVA 3FRYA 5CYMB 3H90A 2E44A 4CO2A 5JUMA 1T03B 1IBLF 4B9UA 4Q0BB 4USVA 2OTJS 1F60B 3KJQB 1TKXB 1VC6A 2DNPA 5DG9A 1MNEA 3UDEA 2PFFB 3G6XA 2XO6A 2L08A 4PWWA 1UKUA 4NE9C 4RNFA 2KU7A 3X1LB 5F9LA 1VQ7S 3N6MA 4YR2A 1HR0J 4FZVA 2MJUA 2IYIA 1CJVA 3NEKA 3OJUA 5C42A 3R7BB 5A8WB 3J7ZT 1HNWF 4K4SA 5KFDA 4AE5A 1VQLS 2YXLA 5D15A 4OHVA 1VIXA 1JXLA 4WXOA 2B5JA 5AE1A 2IVMA 2FJVA 2DYAA 3N5BA 5F3ZA 4OL8A 2Z0GA 3WC0A 4MIAA 5K8OA 1H74A 3TAMA 1HBUA 1FXDA 3OXLA 1VJQA 4PXEA 1HFEL 2ZBRA 4DL4A 2RU3A 1SL0A 2XS7A 5C2CA 1FRIA 3DLGB 3HVTB 1RTDA 1RTJB 1REGX 4ZP8A 5GMKa 2EFPA 4ZVSB 2I5JB 2RKIB 2BKOA 2A0FB 4F26A 2MKIA 2VHGA 1RHJB 1JK9B 4KO0B 3RBDA 1NDKA 1RTIA 2F40A 1RWWB 3C46A 3ENQA 2CNKB 2DIUA 4ECQA 1Q86T 3R9LA 4GRSA 4RW7A 2FYXA 3VCDA 1NKBA 1TFWA 1C0UA 1N33F 4P2MA 5B0EA 4G1PA 3EYZA 2GVZB 3MF5A 3R5GA 2MKHA 3N01A 2ZD1A 1Y4ZB 3QT7A 2E1AA 5A0YA 2W9BB 2A10A 2WBRA 1C0TA 3CJ3A 5T7LA 4K4XA 3A13A 2DEIA 8RUCA 1LQ9A 4TY8A 1HNXJ 4F25A 1EETA 3R2DJ 4NLQA 1N4LA 4DL5A 1C0TB 2OFHX 3MR3A 2BJEA 3CPWR 1S9GB 5KFFA 4U7UK 1IBKJ 2FD2A 5A2QU 3G6YA 2FJXA 4KC5A 3AOAA 1PAUB 2Q3PA 2ZE2B 3O3LA 2QA4G 2IBOA 2V50A 2AWZA 5CAAA 1UA1A 4K4VA 2ZH7A 5B08A 1TUWA 4M5HA 1T02A 3MM5B 1F3FA 4UOFA 3MM7A 1TKDA 2BRKA 1HMVB 2ZDPA 4IR1A 2KT3A 2KL8A 3MEGA 5KG2A 1WF1A 4ID5B 2F8HA 1JLQB 2AHOB 4CRJA 1R27B 1C4AA 2M8DB 2ABYA 1YLXA 3T19A 2QEXS 1YRUA 1DTQB 1J5EF 4ZVFA 5K8MA 1KRPA 1FEHA 4JB8B 3WC2A 4Y0FA 3V6JA 5GAEI 2G4BA 4KV8A 2NUUG 4DR1F 4KB7A 3K2YA 3OTBA 8AT1B 4E0DA 2Z2ZA 4OI1A 2HYIB 4HVZA 2BACA 3HX9A 5KFMA 1NK6A 1FDAA 4ETZA 1I6JA 2NZ4A 1FCAA 2HNZA 1JLFB 1IWAA 3L9ZA 5GAHU 4FBUA 3WX8A 3R2CJ 2C2EA 4MYUA 5DQGA 2ASJA 2DR7A 5DQHA 1OY6A 1ZA2B 1JLFA 1CJUA 1YBUA 1VC0A 3HHKA 1VQKS 2UVRA 2UUBJ 2EEYA 2DGWA 1ELOA 4N7TA 1NBEB 2KFYA 1NCLA 2CJKA 4NLOA 1WHWA 3OTEA 3UWTA 2N7CA 1RHKB 4LF6F 3ENWA 2W9CB 3UCGA 2R2TA 4NRUA 2V2ZA 4UY85 5KG7A 2PIIA 3BR9A 3WX4A 4DCOB 2Z2MA 1NKCA 1Q95G 4K7QA 1E6VA 3MR6A 2LQ5A 4HEA9 4AD6A 1F6TA 1QJHA 1RT1B 1JNRB 4R5PA 2XWYA 2QLFB 2AGOA 4QU7A 4J9UE 3UD3P 4J9RA 1UVLA 1LFWA 4BCAA 2LMIA 3C6TA 2FJDB 2HSEB 4RW8B 3SBMA 3TA0A 4QWEA 1FRXA 2V8VA 4GVBB 3SMZA 4DR6F 2QLXA 2WW8A 4FNIA 1LWCA 2P9CA 2WVEA 2YNFB 3R5CA 4YB1P 2JEGA 1U47A 1KONA 3QIPA 2OD6A 3ILJA 3MR7A 1LWXA 2R7UA 3MDFA 4DV0F 3CDUA 3D67A 4NLUA 5ETSA 3QIPB 2JH3A 5C42B 1RWKB 2ZOFA 3GQCA 1UTAA 2NPFA 4F0HA 2MZ1A 1QVGR 1IKXA 3QGHA 1SKSA 3MM8B 5FJ4A 4K0KF 3EGVA 4MK7A 2ZBPA 3FEYB 4FS1A 3QSYB 4LF9F 4O4RA 3NWGA 3OL7A 2WK4A 2ZC4A 4ZPVR 1DBDA 3MURP 1FDBA 1I51B 2KJVA 2VPYB 1XTZA 2I2YA 3N6LA 1U6FA 3V4IB 2HHWA 2FTRA 1FRJA 4A8SA 3RRGA 4HT5A 3W63A 1WG4A 1NKEA 1RT7A 3IMQJ 4O3RA 3H0PA 3T9NA 5KFGA 5EDWA 1JLGA 4Y2IA 1VRUB 1IR0A 5A8RB 3OFFA 4JI3F 4NYPA 2WZ1A 2VDHA 5HI7A 2FB0A 3BPDA 5EWFA 1BE4A 1JLGB 1WD6A 2O5DA 2WVFA 1VFJA 1WG5A 2EI5A 2IFXA 1Y3JA 1EP4A 5B09A 3A8JA 2E9TA 2EC0A 1U1QA 3BR8A 2WVDA 2QL7B 2OPPB 3OV7A 3KDOA 3IN5A 3T1HJ 3D6MB 4NXMF 3BKFA 1Z2LA 2MY7A 3JSMA 2CQCA 1I3OB 4LBHA 4U96A 2AGQA 5EWGA 2NPIA 4WE1B 4F04B 1TK0A 1KNZA 3K8VA 4DLGA 4HHJA 3GSIA 2HHUA 3DHWC 4YB7A 1O51A 2HWTA 1AB8A 3LTOA 3EXYA 5LM7E 4KE5A 4OZ5A 1I5OB 4ICLA 1U6BA 3R97A 3AD9C 3NGRA 1TELA 4C11B 5DG8A 1TKTB 3VGUA 2MZQA 4ED0A 3Q23A 4ED2A 2AZ3A 3AHPA 1PILA 4MTPA 2BABA 3K5MA 2NZCA 3H5YA 3MMCB 3CF5Q 1BY9A 1XR6A 5HVFA 1X4EA 4IOCQ 1NPRA 2C22A 2PA8D 2PD1A 4YR3A 3QZ8A 4NXNJ 2G2YA 3M9OB 2CAJA 3TWZA 3SV3A 2UXCJ 1FNXH 1JLEA 1J27A 2QL9B 1FESA 2XCPA 3RR7A 4HACA 2LECA 3EVMA 2MGZA 4UUXA 3G8QA 2XG8A 4ANCA 1X31C 3TI0A 1SKWA 2NSCA 1S59A 3KK2B 1XMOF 2X1BA 5GADI 5IT9U 4HACB 1M5PC 3IXQA 2C2KB 1TMJA 4JI5J 3MOJB 4D3GA 2ZZMA 3DLKB 2E7VA 5DJBA 3W8PA 2J6SA 3OD2A 2GCFA 4DSJA 1AUDA 3CJ2A 4OHXA 3GV7B 5HMYA 5BXIA 3QT5A 3UR0A 2VG5A 1YI2S 1S1VA 1VQYA 4NL5A 5L46A 2J6TA 3RAMA 4G1QB 3OTOF 4C9DA 5D0HA 5F8LA 5KFWA 4X64F 1P6TA 1DJ0A 4USIA 1WEZA 3L3CA 4CLWA 3NGSA 3OTOJ 4JI2J 4DJBA 2IDEA 2GJFA 2Z56B 3ZTRA 1RKJA 3HHNB 2W2NP 1HHSA 3PKMA 1S4EA 1HQUA 4ZMMA 3M2RA 2J5AA 7FD1A 4N5SA 1SJQA 5T41A 1NB7A 4CIOA 2V69A 4ZLPA 1GTHA 1S6QA 2C28A 5FLXY 4EUVA 3QFWA 3TZZA 1S49A 1T9WA 3DI6A 5KG0A 8ATCB 3T6BA 3IM9A 1RGVA 1X4CA 2N3LA 5IC6B 3GU0A 3MCMA 3KKFA 4DPTA 2ZH5A 4HDHA 5JVGQ 4J9SA 2KTQA 2YNHA 3H2LA 5E3AA 2ZH3A 2G2ZA 1LKZA 3PHTA 1YRXA 2B6AB 3M30A 4EU0A 2HNDA 4YHHJ 4CZCA 1IM4A 2AKWB 4LRFA 4P71A 4GMKA 4DG1A 5EUHA 3T5LA 3DLBA 3CMQA 3M1VA 3QAUA 3MFHA 2FHMA 3HVTA 5KG1A 5L1IA 2BQRA 3R6GB 3ZZOA 3MAAA 1RTDB 5F0UA 3EGZA 3CEDA 3GJQB 4IFVB 1JKHA 3BDEA 5LL6d 3MM8A 2R7OA 3NMRA 4M5JA 3IFEA 1D8ZA 5BR8F 3BO3A 1I1GA 2EFQA 2BKNA 1N5VA 3ZZUA 2LXUA 3VWSA 1Y5IB 2HBRB 2KFZA 2VQFF 1GH8A 3ZZPA 2W1BA 3MTJA 4XIUA 2PEHA 4C0OC 1RAIB 2C3UA 3V4IA 3LF0A 1U26A 3MAQA 4M5DA 3SCIE 2AZ1A 1X5TA 4ANDA 4NCAA 3KHGA 4V19X 3HZGA 1FA0A 2IVFB 2F7VA 4W4MA 4DV6J 2PEBA 4JV2A 1SH0A 1KVIA 4ATNA 2CNOB 1T3NA 4LF8F 2LDIA 5IS2A 4RNHA 4FXWA 3PKYA 5A8KA 5AE2A 1VK8A 3DOMA 4CLUA 3I56S 1Y7PA 1WEYA 1IQZA 2DXFA 3GJSB 3CVKA 2RT3A 3HF5A 4OI2A 2OPPA 1KLMA 3B82A 1FFGB 3MHYA 2GMHA 2RVJA 4BWJA 4PZVA 2YNIA 1VBYA 3FEZA 3JAMY 4CYUA 1KLMB 4RWWA 1UL3A 3TQ1A 2DR5A 1S1XB 3W2VA 3P4UB 4ED1A 2VFUA 4JI8J 3GIRA 4XTTA 4LFCF 4CLPA 2XMTA 2H5EA 2Y0SD 4K4WA 1TL4A 4Q2MA 2Q43A 1RWOB 4USWA 2HRTA 3D6HB 3W8GA 1EIYB 2LA4A 4M5KA 3E2EA 2HHXA 2KB2A 2ERRA 1IVZA 3BZQA 5HO4A 1EJ7L 4EBEA 1U7LA 2Q6BA 4JI1J 3MMCA 2M2BA 1OPZA 1BMQB 2CQGA 1BQMA 2KVIA 4I0WA 4LRAA 3KLHA 4DLEA 3P6YC 1NM2A 3MPWA 3HVAA 1KFDA 3QBCA 2VOOA 5K8PA 1HWKA 2DNZA 3AJDA 2FPHX 3H5UA 1RT6B 4LMZA 4RW6A 2JEIA 1RT2B 1H0HB 1FRLA 3AD8C 1HBOB 4PG8A 3NNCA 2Y1LB 3KK2A 3RW6A 3AA8A 3X3UA 3C6UA 1U1RA 1NPKA 3CSKA 1HBOA 3DLKA 3FGVA 4ZP6A 3IG1B 4O0IA 1NSAA 1F2HA 2KZZA 2XMJA 3H40A 2BRLA 2GV1A 3KLVA 1WELA 4IFYB 1Y5LB 1NPPA 3H42A 5CYQA 4NLVA 2HVHA 3MUTP 4DEZA 1RWNB 1WC4A 1DQ8A 2LVWA 4CLTA 3EZ5A 1NSPA 1B0VA 3CCTA 3EZUA 2QV6A 4AL7A 2B9EA 3ONQA 1XEZA 3NGUA 4F8RA 4OI0A 4P72A 2QC3A 2E1PA 3M4XA 2A1BA 4GVBA 4P7VA 1CSJA 1YSJA 4BBYA 3PW5A 3OFGA 4WFZA 4K4TA 4PQUB 5RUBA 3NMAA 1HQUB 4QR0A 1IBLJ 5GAGU 4HH0A 1QTNB 2BM1A 4IUFA 2HHPA 2YWWA 4MKAA 4U7CA 3C16A 2D9PA 4V1Ak 4ZPDA 2VBXA 4GO7X 2R7RA 2RDIA 4YFUA 3KHLA 4UZBA 1HNXF 2XMWA 1V5IB 4FP9A 3D2WA 2YPZA 2YX1A 3IA0A 3UNGC 2EFNA 2YX7A 3OL6A 1X9WA 1O0PA 5LSOA 1APSA 2IYGA 2BX6A 2F4FA 3DLGA 3PZPA 1K0TA 2OEJA 4NA1A 3KHHA 3M32B 3NS7B 2E9RX 1RABB 1F2GA 1XK8A 3BGRA 3WIVA 2C2OB 2GMLA 2ZZNA 1DTTA 4QQBA 2ATCB 2XTJP 1TL7B 1G3OA 1FRKA 3HD1A 4X4SA 5IC4B 1MWQA 1RBOB 3OXGA 3CJQA 1CQNA 2HQGA 4KFBB 1Q78A 4OYOA 1SPBP 5IT0A 5CD4A 2V4RA 4PWDA 1VYAA 3IAM9 1PG5B 3SEOA 4U95A 4F36A 5A6PA 4HT7A 4OV1A 4AUKA 2CQIA 3KXDA 2VUGA 1C1CB 2R8KA 2ZC3A 4C48A 3TX8A 3PX6A 4I1TA 5T7LB 1RLDA 3AQOA 3PJ9A 3LP1A 1VBXA 1C1CA 3PEHA 2E7WA 5DZ7A 4WE1A 5BJRA 3M2UA 1PC4A 2K1RB 2V6AA 2QMXA 2YKNB 3W9JA 4CH1A 1S9GA 1QAXA 3D3CJ 4QIVA 1RB0A 2A3JA 2QSWA 2W2QP 3D0GE 3P45B 3V6HA 3PW0A 1MW7A 4KGZB 2ZJPQ 2FLPA 2J0QD 2OAUA 3CC4S 1AFIA 1TKTA 2R9LA 2RRBA 2ZFHA 3M8PA 1UJ4A 3MM7B 4X65J 2YNIB 3R5AA 1LNQA 4RX6A 3KK3B 2BANB 1N34F 1T9TA 2YWFA 4M5NA 1RCOB 5ETMA 1S1XA 5AXMA 3W2VB 1ZM9A 2VA3A 5MAOA 2DRAA 1VHFA 3E01A 4ECSA 2RRNA 2H48B 1R6YA 5FD1A 4DSLA 4JI7F 1E6YB 4QWDA 4ETXA 4X66J 3SSQA 2RU9A 1YJVA 4ZCIA 3G71S 3MI7X 4ED6A 1ZH5A 5H9FJ 4IOBA 1EQMA 2FC8A 1DFDA 3H2UB 1IKYA 4O4GB 3UVJB 3DLEB 3FQKA 4NI2B 3BQ1A 2VBZA 4Y00A 1WTFA 3RZAA 1H2VZ 3DU5A 2DGUA 3Q83A 4LIRA 3P3DA 4RBUA 1QE1A 2I1RA 4UOGA 1X60A 2VONA 2KHCA 3MMJA 1RWMB 1VHIA 2AX0A 1FWPA 3KYLA 3PX0A 4USTA 4N77A 4TYAA 3A3NB 3BB5A 1UVJA 4LF7F 1S0OA 2C3OA 3LPEA 1KS2A 2CQDA 2DISA 2M8HA 3TR5A 2AIRB 2FVQA 2W9CA 1P9QC 1I94F 2RAQA 1FFSB 2KM8B 1FK9A 4M5IA 1G1XA 2PMWA 1T9UA 2BJ1A 5KOXA 1X0FA 4NXMJ 1R8PA 2IRYA 3I9ZA 3HJFA 4G6VB 4URSA 3TJAA 4QCLA 2HFUA 4JI6F 2JLFA 2WVBA 2XY7A 1T9XA 1WC5A 5K14A 2ZOMA 3WQPA 1YJUA 1F5AA 4EBDA 5EN1A 2NXUA 1S1WB 4M94A 3VF0B 2VBYA 1N88A 3TQEA 4CLKA 3GV5B 3GB0A 5C25B 1RUSA 3Q22A 2WB1D 1WC3A 2CQ0A 2H4WB 2HQIA 3ZO7A 3DI6B 2XULA 2DCLA 3KMQA 1LXJA 3CJTA 3TVKA 3AOCA 4Q0BA 3JQMA 4UQTA 1BGXT 3D6FB 2YNHB 2N82B 1UETA 2C3YA 5HN0A 3DOKA 1G4CA 1FKOA 2YVSA 4OX7A 3NGTA 4R0JA 2ZH6A 3GP9A 3AH6A 3NCPA 1Q1KA 1R89A 2PC6A 4DU8A 1NAQA 1NXIA 3G4SS 4MAKA 1U49A 1KEKA 3SYZA 4OZ0A 2GMJA 3E3XA 1XN9A 2QL5B 2HWIA 5A8WA 3VVTA 1NJWA 4PRFA 1CC7A 2RQKA 3MD3A 1JKHB 3EE3A 2OMLA 1YQHA 4RKUC 2XS5A 2CZ4A 2YKMB 3WDOA 5A2QY 4B3TJ 1YZ7A 2IRUA 2D3OR 2DO4A 1XMBA 3PYFA 4LR8A 1SL1A 1QSLA 1AUSL 3BQ2A 1Q81T 2OPRB 3POTA 5HQ8A 3V81A 2FY8A 2YQ1A 3BO4A 1T8EA 2YWKA 3EVWA 3J7AN 2ILYA 4WU2A 1N5YB 1URRA 3T6JA 2BV3A 3D3BJ 1ZETA 5KFHA 2D1CA 2I5JA 2RKIA 3BBCA 3HT3A 1BWVA 4JI0F 1HNVA 2MZJA 1TV6B 3RBXA 5H9EJ 1JXVA 3PO4A 2GHPA 1UZDA 4RO0A 4PG7A 2VQEF 1ITPA 2YKOA 2FJEB 1HNVB 5HMWA 5A8KB 2LXIA 2VG7B 4FNHA 4LVOP 3DLLQ 1SV5A 1DRZA 3N0VA 4RUAA 2VG7A 3BSCA 2HHSA 2DR6A 4WIIA 2LYVA 2XGQA 4M1KA 2M70A 3C66A 2HFVA 1KOHA 3M8WA 1WF0A 4NRTA 4ZLNA 1B3TA 2UUWA 4JI6J 1VQOS 1B4SA 3NKYA 2DGTA 3HLUA 2YKNA 3ZTOA 4C11A 3VVUA 4DUYF 1KQSR 5HVHA 1VI7A 4I4BA 1EETB 1TTHB 4NEZA 5B0FA 4TU9A 2DB1A 1FE0A 1FJEB 5G0RB 2B56A 2HQCA 2LCWA 1YZ6A 2J9CA 3RRKA 2Y8YA 4GO5X 1FTCA 4OYZA 4Y2MA 4ZCLA 3V4MA 4Y28C 2QFIA 2E7XA 5G0RA 4RLEA 2JWNA 4J91A 1JLEB 2XYHB 1YIJS 4ED4A 2E5JA 2QX0A 2VF3A 3CXCR 5DLFA 1YJWS 1N48A 4FF3A 1P1LA 1UFKA 2NR0A 2GW8A 2HQDA 3CD0A 4C7QA 3TA2A 3AB2B 3EXCX 1JLQA 4AFFA 3RTVA 1X7VA 2Q6CA 3T5HA 4ID8A 3QWUA 3A3OB 5D0EA 3M8RA 3LGMA 4PUOA 2UV8G 4DR7F 4LVNP 5JJBA 4DUTA 2ZHAA 1VBKA 2B9XA 3CWJA 3DDNA 1SC6A 1TL5A 1W2IA 1X4HA 2V8HA 4FKXA 4RBVA 2R7WA 2E1CA 1KQGB 5IT4A 1QE1B 1JLBB 3GCWP 3KLGB 4F7VA 1JJCB 4WFBQ 1VLOA 4ECWA 2HHTA 2M5YA 4KGKA 3BS9A 4J37A 3MMBA 4LT6A 4TLRA 5J1NA 3LOUA 2A6OA 5CYQB 2CFXA 2G1DA 2CQ3A 2O01C 2FJBB 2PE8A 1QDUB 3C14B 2AJ1A 3I4HX 3MMBB 3S8SA 4K4YA 1UVNA 4ER8A 1UFLA 1F5CA 1PIEA 1U0SA 2DNYA 2FHOB 4A8FA 2XO7A 4LIWA 2VASA 4P10A 3TVZA 4A8OA 1NH7A 3Q89A 5CYMA 3ZTQA 1SUQB 1KTVA 2KRBA 2QA4S 2MQQA 4ZVOB 3NLCA 4TKTA 2X51A 4BLGA 3HDSA 4W90B 2Z58B 2JC0A 1JQGA 1HA1A 3C8YA 1EZZB 1SUQA 1GMVA 4TY9A 1D3WA 1S5ZA 3DM2A 2DHAA 3MZIA 4PEOA 3KWMA 4TNOA 4U8YA 5IQQA 5C24B 2GHVC 1WEXA 3DFEA 2RIJA 5KFQA 4ZS6A 4U67Q 5HMXA 2BW7A 2BM0A 4LUBA 2FHJD 1RT5A 2B5JB 3FMWA 2D9OA 4Q8FA 3R1LA 1FJGJ 3PG9A 3TJ9A 1BWEA 3HSZA 1B0TA 2LDYA 4S0MA 3K0JA 1AROP 1RI7A 1EHWA 1NHUA 2NCKL 2ZOGA 1RT5B 3BKTA 1U25A 3DOKB 3DRYA 3M1VB 2RQMA 4H4MB 2ZH2A 2KRRA 2HVDA 3AFGA 2UP1A 1MG7A 1Y3KA 2QGFB 2WVCA 2RJZA 4B17A 2QSFA 5LJ3Y 1M1HA 3CTRA 4PXBA 3CE8A 3R8YA 3HM9A 2DCUB 2UUCF 2UVUA 4KPYA 2A18A 3G8SA 1SJ3P 2P9EA 4NLPA 3OLBA 5D4OA 5ETQA 1RWPB 3C2PA 1U02A 5HVGA 1VQMS 2JJ4D 4M5DB 2QN6B 2XEXA 3UCUP 4H4OA 4DCPB 1Q7YT 2UXBJ 2GO8A 4M63A 3W2WB 3RR8A 3ZZRA 4MH8A 4N8NA 4FYVB 3IM8A 2ROEA 1ZBTA 2DITA 3GLJA 4NXNF 1XNRJ 1RE1B 3TARA 4C6AA 3HSGA 2ZD1B 1VISA 2B51A 2VB6A 2BOPA 3GFHA 3W7BA 3ZZ0A 4DL3A 2R7XA 2KG1A 1RACB 2IY5B 2K2PA 3KJVA 3CW2C 3ETMA 1HWIA 1T11A 2B7BB 1O6XA 3FKBA 4FPRA 4KGMA 4OJGA 2J9EA 3FFIB 4FYWB 1TQLA 4DHVA 1Q53A 1UA0A 2CJAA 4HYKA 2P9GA 3W66A 2BMBA 3HT0A 3ZNUA 2FVRA 3MGJA 1W25A 5B0DA 1H7XA 1NK4A 4B3RJ 1ICEB 1SBRA 2IJFA 3HHDA 1CJKB 3QLHB 2I0XA 2ZH9A 3KLFB 4DL6A 2DPIA 3O6QA 4ILRA 2R2SA 5B0AA 4I67A 1GX5A 1OY9A 2KI2A 3IGVA 3PEJA 3PJWA 1W2BR 2B7CB 2PMHA 3DRRA 2YWHA 2AEMA 2ZM6J 4PYAA 3LWMA 5KFAA 3DLEA 1SIWB 2B9WA 3U1NA 2ROGA 1WF2A 5FDLB 2YH0A 2ZUGA 1QAYA 2F63A 1ZAXA 1SJRA 2ZDOA 3DOLA 3IBFB 1RA7A 2Y1RI 3SV4A 2CQHA 1HHTP 2X1FA 3UN2A 1FTRA 3VAMA 2AP6A 5KG3A 3MCOA 4J7CA 1NDLA 5L1KA 2V0NA 1JX4A 5HQMA 3T1YF 1MN7A 2CJQA 2CDQA 3FRZA 1HWJA 3THPA 3H4BA 2ZHBA 2XHCA 4JP8A 1OJ4A 1HI0P 4LF5F 3R5BA 5LXYA 3LP0A 2RUGA 4N8OA 5HATA 4QYZK 5EX3A 2XM3A 2RSQA 1RAJA 1OY8A 3MR5A 2HZAA 1K47A 2KG0A 1YGYA 3BKUA 3FCHA 3Q24A 4LF5J 1EAYC 1U1MA 1XR7A 4ELVA 3TA1A 1EARA 2UV8A 1LK7A 3KLIB 2AEFA 4I2PA 1S7HA 1AXQA 4ELTA 1E6VB 4B08A 1GMWA 2J0XA 4CP5A 4UTGA 1N56A 1CS4A 2KYZA 3KJFB 4DMZA 5CA5A 2BJDA 2CPIA 2LQBA 3BGOP 2MHEA 4ES1A 3QJLA 4OIXA 2HVIA 3LGHA 4PQUA 2YQ3A 4QIGA 4DI6A 4J9LA 4P74A 2VH7A 1RHUB 4CNYA 3ENVA 4QW8A 4DX7A 3JS9A 5CZVA 3TAQA 2VG6A 3OJSA 1R0AA 1FKOB 3MPUB 4QWAA 2W9AA 1JWWA 2K3IA 3LW5C 3AY0A 3D5MA 2P6SA 2WONB 1K9MT 1FHTA 3AJ2A 3ZZTA 2UUAF 3CUNA 2IIHA 1JNZB 3DMJB 1S6QB 4MJKA 4Q7AA 4B3RF 1NK7A 1REVB 1V5VA 2OPSA 5LMNJ 2M52A 4HI2A 2HMIB 2CPDA 3KK1B 1R43A 1REVA 3P49B 3CNQP 6FDRA 4X84A 5HP1B 1OO0B 2GFFA 2CWKA 1PYTA 2W4PA 3TW0A 4DG1B 1ZTTA 4I6YA 1VQ4S 1IM6A 2YTCA 2MLXA 4AXIA 2J6UA 1OSCA 1S79A 2GHWA 2V94A 2E1RA 1ZYQA 2NYHA 3HZEA 3K58A 3R1HA 4B9VA 4F4YA 2LKZA 5KT4A 4WTYA 4CWBA 4LF7J 3G2XA 2CG8A 3C15B 5GAGI 2HVZA 4F50A 2ZJQQ 4RW7B 3TNVA 5KT3A 3CJKA 1YX2A 2FVSA 1GEHA 2H54B 2LEPA 2YBVA 5IFMA 1R8AA 2OFGX 4RNMA 1NJXA 1D9AA 4PPDA 5J2QB 1RSCA 2H9ZA 1KFSA 4DXLA 2KO1A 2ROPA 3I0RB 2UUCJ 2QYGA 1Y9OA 2QO3A 3H4DA 1RDRA 3DGPB 2ALYB 3H2VE 1OPIA 4I68A 1SH3A 4WXWA 2GIFA 3T5KA 4YDXA 3IAS9 1T95A 3D4JA 2RHQB 3OXFA 4TY8B 2EG2A 3J81j 1L3UA 1KD1T 4ELUA 3B6BA 3QSIA 2UXBF 3QGPA 4DR2J 1VRTA 1U0HB 2OEMA 4C8KA 4UOHA 4LBIA 5DM6Q 1TKZB 4CCHA 4OMFG 2GX8A 2X1GA 1VRTB 3FFIA 1OYDA 4QPTA 4PKDB 2VD3A 2JL9A 3D1OA 4Z7CA 3MM5A 2HBZB 4PXDA 3IRXA 3JTOA 3IGNA 4UQGA 5AXLA 3IWLA 1L3TA 3TEGA 1BQNB 4KTQA 4HKQA 2ZNYA 1CJKA 1SQGA 2BJ9A 2Z4PA 3QLHA 2PA3A 4LSZB 2RDDA 2MLYA 3RU0A 3TZYA 2L3MA 4KIAA 4QBUA 1DTQA 2MEWA 3GYNA 3QPIA 1RT4B 4RW9A 2HFOA 4O4GA 4MKBA 2VQEJ 1KKHA 2DGOA 2KYXA 2UXDF 3CCZA 2G9OA 3PRDA 1QM9A 1AYEA 2DH9A 4OZLA 2AJFE 1RT4A 4HHUA 3BREA 2RMLA 1RYRA 1JB0C 2LP4A 2OJ3A 5LMUF 4QWBA 4TXSA 2FHJA 3RB4A 4DOZA 5IXUA 3OTCA 2HZVA 4DX6A 5HMZA 4DV6F 1N8RT 3U1LA 2V63A 3DRPB 1SC3B 2Q1LA 3CT9A 4DV1J 3ENAA 2VG5B 4KGVB 1KWMA 1UW9A 4KQZA 4DUZF 2R7SA 2RH3A 3CDAA 3W62A 3DYAB 3NOCA 7AT1B 4ZPTR 3C14A 2FZCB 1HL6A 5JXSA 2BE9B 3C6UB 4K2XA 1VCTA 1WOOA 3O44A 5LXRA 4A8WA 3MPDA 2DRDA 2QYCA 2XSFA 4BC9A 1R0CB 1F0XA 5LSRA 1PBAA 5M2PA 1XNQF 2J7UA 1X8DA 2ZWPA 3DRXA 1YJ7A 2ZBCA 5E3CA 2JHEA 3ISZA 5E41A 3IWNC 1WKJA 3H25A 1Z2ZA 2HAFA 4NLYA 5AXNA 4ES3A 3K8WA 4KKOB 2HGLA 4RW4A 3J7A1 4FYXB 2HS3A 4X4RA 4JI4J 2BA9A 2CPZA 4ITSA 4QIFA 4ZVQB 2A6MA 4X4VA 4KKOA 1SJ1A 1UAWA 2K06A 2PSZA 4EI2A 4EBCA 3OTDA 2DR9A 1F9HA 1UWBB 3VQSA 5F41A 3PR5B 5GMDA 5F8MA 4OHZA 4DQRA 2RB7A 4OZ2A 4DR7J 3UDCA 5F0WA 4WBFA 4NMXA 1WKKA 3L95X 4IQXA 4LQ9A 2COLA 2F9JA 4WK1A 5M2RA 2HG4A 3OR2A 2ASLA 4QZVB 1S97A 5DETA 3RGIA 3MMAA 5KFNA 2MZTA 2HNDB 2DNOA 3W60A 2J7WA 3IS9A 4F0MA 1TU0B 2EBEA 3NNHA 2AU0A 4ZKAA 3OFHA 4QOTA 4OFZA 4GC6A 3T9ZA 3HHLB 1NUEA 2IVYA 3UO0A 2X7IA 1IR2A 3DXBA 3HULA 4EEYA 4JV5F 2OPRA 3POTB 3OW2R 1O8BA 1MWYA 3KK1A 4N76A 1VQ5S 2JEJA 3V81B 2NXJA 1TL3A 4MYTA 4RPFA 5K5MA 4EFAC 3PY8A 2C3PA 4X66F 4FF2A 5K8NA 5HQLA 3BYPA 1KN6A 1IBKF 1IJFB 1RT7B 3BDPA 2EC2A 1VJWA 3AA9A 3BV8A 1J2VA 1GXTA 4ZDNA 3WBZA 1FEEA 1VRUA 4X65F 4NOHA 5ETPA 3N6NA 4DV1F 4NWBA 4DPOA 2D3UA 3UR3C 5ETVA 4ECVA 2R3VA 3U7JA 3MD1A 3D0HE 2ZBIA 3M8SA 2Y1IA 2K7JA 3NRBA 2WBMA 3CJSA 5ETLA 1R8HA 3CJKB 4A46A 3HP6A 3KOAA 4O3QA 3R7NB 3I55S 3A1YG 1FDDA 5DZ6A 1HYSA 2KXHA 2B4PA 3EICA 3EMTA 2E1MC 1UP1A 3N9UC 1VQ9S 2UXDJ 3PX4A 1N36F 2DHHA 2Z30B 5BYSA 4B9MA 3M6WA 1ULRA 2DGQA 3MAHA 4U9RA 5D0RA 5KT7A 1D0EA 2IRXA 1EQ0A 4WWSA 5J2MB 3KUGA 4ECXA 3EPIA 3N28A 1F9EB 1RWXB 4P9SA 4PG6A 1BD6A 3W64A 1CVJA 1R8BA 2EBGA 4NCBA 3KLFA 4USUA 2C1EB 1BUXA 4L75A 5E3RA 4X62F 5IOLA 4TQSA 3NNAA 1TKZA 3B54A 2NREA 4Y2CA 1S72S 1U2FA 3F73A 3W3SA 3DHXA 4DX8H 3DRRB 1SC1B 3J7YI 4Q2LA 2L9DA 4AL6A 4O3SA 1AFJA 4WJBA 4ZN3A 3JQKA 1K73T 4LFBJ 3BYRA 3ZTSA 1ZAWA 1UVMA 3DOLB 3JQJA 1GNKA 3OVSA 1XWLA 2MGZB 1Q8BA 4WZQA 1B99A 1S9EA 3E01B 2FLOA 3DLJA 2FY1A 2C2ZB 3QRRA 4DV2F 2PO4A 3GMGA 4OI6A 2FC9A 5I3PA 3OUYB 4Y6IA 1YITS 2IMWP 1DHMA 2MQLA 1Q4RA 1FWLA 3IBCB 4LSLA 4QPXA 2JSXA 2QTWA 3UVJA 3BN7A 3J80U 3SFUA 5M2UA 2MXYA 1P9YA 2APOA 4YB6A 3ITHB 5HJYA 1ZTWA 1IBCB 2XNRA 3GYGA 3SSSA 1M1GA 1F3VA 2XSJA 3AAWB 3FBCA 4L73A 4DL0C 1SKUB 4FF4A 4RR5A 3UE2A 5JVHQ 4JBCA 4DQQA 2LEAA 4ZVTB 3MEEB 3DYAA 3PRBA 5IV3A 2MKKA 2W4CA 1MMLA 2DGXA 2NUHA 4DPXA 3TUZC 2HEKA 5KAKA 2L9NA 5L9NA 4JV1A 1YK9A 4HLBA 4GKKF 2OIHA 2HK3A 1N54B 3DN9A 1LK5A 3LH2S 5BYQA 1PGZA 4DN9A 3FUYA 4XK8C 2NLWA 1RU2A 4CM0A 1V6HA 3THTA 3GJTB 2V8DA 3OFEA 5C24A 3PFEA 4LF1A 2G0IA 3GJRB 4MK8A 4DWIA 2GQQA 5CQGA 1RT1A 2AEJA 4KYZA 4K4UA 3H7HB 5I42A 2R7TA 2WONA 1RBLA 2MQMA 3C16B 4KBIA 3OSNA 2RS8A 3MEDB 3ETOA 3D66A 1QY7A 4BC7A 3G6ES 1VBZA 1QAIA 4N41A 4ECTA 1QSYA 4IYQA 2DNRA 3R7SB 3VZIA 4X62J 2GNKA 2B43A 1LV5A 2HURA 3CDWA 4DN0A 3UPFA 2HW3A 4EZ9A 2XY6A 2OELA 3M32A 4FXVA 3M2VA 3D28A 3CCMS 4ZVHA 1LWFB 1YVFA 4ZIWA 3EJMA 1NNDA 2AT1B 3M2VB 3PXGa 1FKPB 1IWGA 3BPSP 2LXFA 4NPOA 3PV8A 4HTJA 2V68A 3QQCD 4NCGB 4LF6J 1ZM4A 1S77D 9RUBA 1FKPA 1AA1B 4ZVRB 1GT8A 2LU1A 2D3ZA 3W5YA 4QJVA 5EWEA 4UY8T 2J0SD 2IM1A 1NU4A 2E29A 3QO9A 4NCGA 1IUJA 4JI1F 4ANEA 2JZ5A 4KHPJ 1M1KT 5AJ3F 1BXNA 4BWMA 5D0GA 3DGPA 3QFHA 1ZAVA 1Z1ZA 4L3KA 1V9OA 1S48A 3UQSA 4ALZA 4URQU 5DLGA 1S10A 4IH5A 2BKPA 1PBUA 5D78A 1FO1A 2FIUA 5A8RA 3TAPA 3VGVA 3PTWA 3S1TA 5AJ3J 4I2QA 4LFAJ 4B9SA 2WW4A 1LWEB 4ZLJA 3VAIA 1HBNA 1HBMB 4DR6J 4TU8A 1GQEA 2EK1A 3CD5A 3CCRS 4TYBA 2GIQA 1S6UA 3M6XA 5KFIA 2M4MA 5F9NA 1M5SA 4FVCA 1HPZA 4ERDA 3OVAA 5J1PA 4DQSA 1F1BB 2BJ7A 2G0CA 2OEKA 3IR5B 2CQ4A 2DK2A 4OJHA 3FC9A 2CQPA 4NLWA 4CO4A 1HPZB 1RYSA 5J2PB 4JI5F 1N6QB 1IJEB 1W26A 2BANA 3S01A 4NEYA 3UDVA 3SI8A 3OLAA 3KG1A 5B0CA 4IG3A 3R6LB 2EKNA 3I0SB 4OI3A 3CJ5A 1OSDA 2AYMA 2ZKUA 2KZMA 3OHBA 1UWAA 5HAOA 3PO5A 4N47A 2CQ1A 3DC2A 3LGNA 3BJYA 3IWXA 3PYGA 1IKYB 4OYWA 1MLAA 4ZVGA 3BSNA 1VC5A 1FJCA 1FVSA 2AF6A 3SCJE 4K5SA 4PYDA 2HRYA 3SCLE 3VGTA 4Q44A 4UT4A 3OHAA 1WUUA 3RAQA 4Y3CA 4R8UA 2W25A 3U02A 1X5OA 2QMWA 3BF4A 1XMQF 2VFSA 3LA0A 4FDFA 4Q43A 2MQNA 4DV3F 4CDIA 4NYOA 1YDLA 4P6QA 4LFBF 4CO3A 5KFJA 3IG1A 4C8OA 1KP6A 2CPEA 3L7UA 4HI1A 1S9FA 2FJWA 1KHVA 3B78A 4F67A 3PJXA 5C7PA 1L3SA 1VLYA 2F9DA 2FJAB 4AYBD 2DT9A 3BO2A 4FS2A 1OS5A 2N3OA 3T1HF 2FLNA 2YX4A 3K5PA 5JMNA 4DBQA 4DV2J 2CPHA 1LEOA 1DQ9A 4OHWA 2MKCA 1OYEA 3FSYA 3AOBA 5HK4A 1H3DA 3VR1A 5C2GA 4EYIB 2AJQA 2V8GA 1RHQB 4YS2A 2H65B 2VDIA 3C19A 1V3SA 3O8WA 2DHXA 2YKAA 4CTAB 5HLFB 4NLGA 2VPWB 1R6VA 3HFKA 2ASYA 4DSIA 1N32F 1S0MA 3BSOA 1IBMF 3K7RA 3D1HA 2W4DA 4USKA 1KHWA 3LP2A 1HKAA 3M9MB 4F3OA 4ZITA 2AYGA 1B70B 3G6VA 4DV5J 1RLCL 1NZAA 2HGNA 1RJJA 2IMOA 3VGSA 4WK3A 5K9FA 3IR7B 2F65A 3CD7A 1NEEA 2GQ2A 4I69A 4LRDA 2CJ9A 4H4KA 2OPSB 4AQYJ 2ADBA 3DKDA 4O44A 4UW2A 2NXCA 4WZMA 4ED5A 3HHLA 4OHYA 1M5VC 4CT9A
chains in the Genus database with same CATH topology
1VQ6S 2XCAA 1RWUA 1MWZA 2YKMA 3NCQA 4DS5A 3F44A 2IC3B 2QE5A 3FJ2A 4DL7A 1LW2A 1VQPS 4H4MA 4J9OA 1RTJA 2IC3A 4IQMA 1X5SA 2DHGA 3CC2S 1UFWA 3Q8PB 3N79A 2W7AA 2V9KA 1X4GA 3CC7S 4P2SA 3HPOA 1VOMA 2OD4A 4B3MF 1JJHA 2EKYA 3K5NA 1C0UB 1DLOB 4HDGA 3MFIA 3QO9B 3C3LA 1IKVA 3FEXB 1SB6A 2DH8A 2RQCA 2MJNA 2VFTA 2VFVA 3GV8B 3CD6S 4WF9Q 2E5HA 2IM3A 3I5CA 3GILA 1LW0B 5LSLA 3FDSA 1FD2A 2DVIA 1JJ4A 2CZVC 3VALA 2POKA 3DRSA 4OJ1A 1LWEA 1HQEA 3UFCX 1TL1B 3TYTA 3DRSB 2AD9A 3L09A 5F3TA 2AYEA 2VC0A 1XNRF 3SZ2A 2N4CA 1FDNA 2YY3A 1P8GA 1BQNA 3GIJA 2EW9A 3CIMA 3H20A 5F8GA 5KFBA 3IRWP 4RW9B 1F9FA 1YTYA 2CPJA 1S9EB 4BDPA 4NMLA 4CT8A 3I0SA 3HHLC 3DLHA 2C3MA 4LSNB 2XC9A 1T05B 1S1TB 5F8JA 3GYXB 1P27B 4W92B 4H4KC 1R31A 2JVOA 1D8YA 1YJ9S 1S1TA 1TR0A 1HNZF 3DRPA 5KFYA 1WNEA 2HFNA 2IM0A 3AJ1A 1GXLA 4R8UB 3KLGA 3HK2A 4EO6A 1MU2A 1JIHA 2XHWA 4QR1A 2W8LA 1TAQA 4ZVEA 3NGDA 5GAHI 4YFUA 2OO4A 4XO0A 3RRHA 4MK9A 4JUZA 3I87A 4CQ1A 2DNLA 5HROB 5IWAF 1UEVA 5KG4A 5EGYA 4DFMA 1WI8A 3MECA 4MIBA 4K5RA 4C8YA 3LWLA 1S1WA 4MKYA 4R5PB 4CH7A 2RILA 4D3HA 3TANA 3IO1A 2RD5C 2W24A 3US5A 5KFRA 3N5FA 2CG4A 3PHEA 1KOOA 3M8QA 4KR0B 4NLXA 5SZTA 4J9QA 3I9V9 3V6DB 1QTMA 3DM2B 4NZ7A 5IM0A 1YWXA 5A6WA 2ZITA 3UCZP 1U1OA 3RBEA 1YJNS 1RT3B 2U1AA 4ZHRA 3HMJG 4J9MA 3LP2B 1DURA 3MMAB 1Y0HA 1TKXA 5KG6A 2ZH8A 1Q16B 3JB9k 3NAIA 4Q45A 5KFXA 3MUMP 3CCSS 1NK5A 1SI9A 4RWXA 5C5JA 3HKWA 2WHOA 4L3NA 1G7CB 3SXLA 1TL3B 1TAUA 3P5TL 2HHVA 1BC6A 1RA6A 2ACYA 2L9WA 3MM6B 1FVQA 1VQSA 2J8AA 4FVMA 5EHHA 3EYZA 4DR5F 4ECRA 1LXNA 2CJBA 2YKQA 4EYHB 1HWLA 3V2UC 3RB3A 1UVKA 2HQ3A 2HZCA 3QGIA 5DG7A 1C2PA 4H4OB 5KFEA 3T5JA 5LMNF 3HKZD 4KSEB 1RKIA 1B7FA 4YY3F 3PW4A 1V3ZA 1MMDA 4F3QA 2Y1JA 2ALZA 4Q8EA 2IJNA 2JEFA 2HRUA 4OLPA 2QT7A 2AJ4A 3BQ0A 2LU2A 3GZ7A 3NS5A 2B4OA 5E0OA 1U1NA 3FMBA 3TO8A 4I7FA 2DNGA 3DNCA 1Q8LA 1KQKA 3ZFVA 1GTEA 5J1EB 5THWA 2MSTA 2E5IA 3GR1A 5GVQA 3T1AA 3I5AA 4EO8A 2R2RA 2PGCA 4DDFA 2FGCA 4PQAA 4Y2KA 1N6QA 2QIFA 5T14A 1SJ4P 1U45A 2K1RA 3KNGA 3BGUA 1S99A 3M05A 1FJGF 2DNKA 3H98A 3JSBA 3OL8A 3NL0A 3TUJC 5KFZA 4DR4F 3TOQA 1NO8A 3JSRA 2CPFA 4ZCKA 1VIOA 4B9LA 1UW4A 3PR4A 5DDOC 1MROA 2OP5A 1S6PA 1PO6A 2KXNB 5KG5A 2IA6A 2HNYA 4UOCA 1UMJA 5HL7Q 3K59A 3CCQS 3LUYA 2Q66A 2CPXA 2KM8C 3LALA 1SKRA 1FERA 4ZPWR 2OMOA 4PUOB 4LSLB 2HNYB 3D54A 1BLUA 5B0GA 4DSKA 5CZXA 1P1TA 3GWCA 1S76D 2V4JB 5L9XA 2MZRA 1KTQA 5DS7A 5GADU 1JLBA 1TVRB 4WKRA 2IAJB 1S1VB 3K5LA 3G96A 4O3SA 1TVRA 2RE1A 1MU2B 1VK3A 2KDOA 1WHVA 1U1KA 1KVJA 2Q79A 2Z2LA 5KTQA 2KN4A 2BE2A 2XMKA 4J9PA 1TK5A 3QWPA 3ZZZA 4BS2A 3OL9A 4OJ3A 5DDPC 4CTAA 2X1AA 2GGPA 4C3LA 1X4FA 2YKPA 3NBPA 5HROA 4FXDA 4MFBA 3CO9A 3RYLA 5IZHA 5D6GA 2YH1A 2FVPA 2V2KA 3NBPB 3O5TB 5KFVA 4DV4F 5CD4H 4QIEA 1R0AB 3LPYA 5L1JA 1NJIT 1DARA 1T3OA 2KT2A 3OPKA 5E2QA 4XPCA 4O44B 1U8SA 2NSBA 1N5SA 3DMJA 1SIZA 3GFYA 3OR1B 4WFAQ 2CQ2A 2DIVA 2HMIA 2VZ9A 3FSXA 2EFGA 3M30B 5KFTA 3ISNC 4URGA 1N52B 3OR2B 1FXRA 4R0EA 4RU2A 1YJRA 2VL1A 2JDJA 4DSFA 4Z37A 3GIMA 1X9SA 5CYJA 3U27A 3PDNA 2WCXA 4YHHF 1YHQS 3JYTB 4ECZA 3VAGA 4A8YA 3G86A 3RAXA 1X4AA 2MPUA 3CDBA 2V9WA 2HHHF 1HARA 2FUG9 1X4BA 5B7WA 4DQPA 3P96A 1DLOA 5J2QA 2R2UA 2KXFA 1HNIA 4JI4F 2CVIA 2XS2A 1IQTA 2W7PA 4AXJA 1XC9A 1XR5A 5KT6A 2OSQA 3HXMA 5HBMB 2DJWA 2IM2A 3GSDA 3S6EA 1AW0A 2UUTA 1Q79A 1NK8A 4TU7A 3CGIA 3D0IE 2RQ4A 7FDRA 4Y65A 4RUCA 1H6KX 2WRMA 4X4PA 4PG4A 2EFVA 3EGWB 2ZVSA 3E8OA 3GG1A 4G3IA 2OPQB 4I7FB 4X4UA 1EP4B 4RBTA 4LJMA 2O3DA 3ULHA 2FVCA 2GQCA 2PI5A 4XDDA 5E5NA 4C8NA 2HS0A 1FNOA 2YWGA 4PR6A 1FNMA 4QYZJ 1HWUA 4DQIA 4NA2A 1UEUA 2XWXA 3UW1A 3Q8SB 4B3TF 4A47A 4R25A 1Q7LB 4F2SA 5DDRC 2BUNA 2ZE2A 2Z8QA 1T05A 1UJ5A 5FDLA 3F41A 3JSYA 5CHCB 2VODA 4A8MP 2BBEA 3PIPQ 1HMVA 2HIQA 3HHEA 3VZHA 4XPEA 1RT6A 4NA3A 2ZM6F 4OZNA 1ZOTA 3I6PA 2IBKA 2IA0A 1HI1A 2B9YA 2X3GA 4X2BA 3OUYA 2WAQD 4M95A 3NS6A 3KLEB 1OWXA 1WHYA 2C2RA 5D4LA 1SJFA 3ZZYA 4IO1A 4IRDA 3RB6A 3FVYA 4NYZA 3B4DA 3KLIA 1ZPVA 4H54A 3KG4A 1U48A 4YP3A 2L48A 2DGSA 1NRKA 4EGLA 2XY5A 3NP5A 2R8JA 2CPYA 1FKAF 2BE2B 3QAEA 2MSSA 3CULA 3MEEA 2MDAA 3NCRA 4YMEA 1RK8A 2BZ2A 5IM0B 1T03A 1HI8A 2XBPA 3I31A 4I64A 2I8EA 4DV7F 4ZCMA 3FZBA 2XGPA 2U2FA 3Q8QB 4N56A 2VFRA 3PIOQ 1B0PA 1M0SA 5FIIA 2V5HG 4YDDB 4JV0A 4AL5A 2F1FA 3K5OA 4ZPCA 4KHRA 2SXLA 3MCSA 3C6TB 4RW8A 5SUHA 2XI2A 1U6ZA 3CDEA 5DDQC 1XERA 3OR1A 4ZPAA 4TQRA 1LWCB 1A6LA 2CKWA 2ZJRQ 3QJPA 3EX7B 2YNGA 1CPZA 2XNQA 2NQPA 1Q8IA 3M6VA 1HBUB 2J9DE 2WTFA 1RTHA 2WOMB 2PMZD 1T7PA 6FD1A 4C3MA 2OKQA 1JMTA 4B3OA 1X4DA 2ILZA 2VC1A 4C2MA 2OSRA 4DF4A 3L7OA 4ECUA 3QGGA 1RTIB 5D3GB 4JI2F 1HR0F 2QLWA 3U1MA 1OQ3A 4DFPA 1S0NA 1OQ6A 4XAKA 1SH2A 1YBAA 5BYRA 2JFDA 1HYSB 2BYCA 3PW7A 5J1EA 4Y34A 2KH9A 2O66A 4F4KA 2W9BA 1Z4UA 2D74B 2E9ZA 1WI6A 5AE3A 4ECYA 3MXHP 1QSSA 3TRGA 4TLQA 1TL1A 3PM9A 1K1SA 1C1BB 1C4CA 3PFOA 2QZ8A 1FRMA 2JVRA 4J5OA 4NX9A 2DNNA 2VA2A 2UUBF 2GC8A 4QIWD 2MMYA 4DS4A 3NGKA 1H98A 3M8PB 4CO5A 3JSMB 4DF8A 1ZZFA 2F8MA 2R8IA 1H2TZ 4PWUA 3O1LA 2DNQA 5I4MA 4X4OA 1MROB 4IDKA 5J2PA 1UVIA 2RF2A 4E98A 3K57A 4ID5A 3Q0AA 1E6YA 4LSNA 2R8HA 4MIWA 2ZNZA 4ZOSA 2RF2B 3GR0A 1SXLA 2E66A 4UUWA 3V6KA 5L38A 1M5HA 2B3TB 3VAKA 2HHQA 2KKHA 5CH7B 2J7KA 3DXSX 1IKWA 3MWBA 4K59A 1U1LA 3FSIA 5E3QA 1BQMB 4A8QA 1MMNA 4IR9A 2IAJA 3ITHA 3CCLS 3CMES 3DDKA 1CG2A 3MEKA 3EUNA 3F56A 3MPVA 2XSJB 1KLNA 4M8LA 2DH7A 2OTLS 2M3DA 4QR2A 3QYYA 4NLRA 1A9NB 2VPXB 3LAMA 3SFGA 2NZ4A 3BSAA 3DCAA 2RS2A 1H2UX 2BVZA 3LP0B 4NLSA 3UD4P 1O5JA 1K1QA 1YRTA 4IRKA 4G1QA 3A8EA 4OI4A 2UU9F 2BR0A 1DQAA 2QRRA 3MOZA 4ZP7A 3R27A 4C3KA 4I2PB 4HL9A 1WTBA 3I5BA 2OH2A 2GA7A 3J80Y 1RT3A 4QWCA 4F4WA 1N0VC 3Q8RB 4XDCA 5J2NB 2FGOA 4F02A 3SDEB 2YNFA 4HTIA 5MLCV 3M2RB 1NK9A 5J2NA 1XBWA 2GO9A 4CI0B 2VG6B 1N5TA 2EG1A 4BHQA 4X4QA 2DHSA 2HLUA 1PC5A 2JC1A 3MM9A 2MZSA 2MQPA 4I6WA 2HPUA 5F8IA 3PW2A 3JYTA 2R8GA 3GE9A 2EWHA 3MM9B 2YNGB 4RUHA 2JOQA 2QFJA 2JX2A 1DZ5A 3WZ0A 1CEZA 1RTHB 1Y5NB 2WOMA 4WFNQ 2ZH4A 2VOPA 4P7TA 3BEGB 2M0GB 5HP1A 4KJIA 2PN6A 1N5YA 1HNIB 1M5OC 2K8GA 1WHXA 2A2DA 1RQ0A 4IFVA 2L41A 2R7VA 3ICLA 2BQUA 1TV6A 2UXCF 4OLOA 2E5GA 1TP7A 1J5OA 1LOUA 4PWDB 2LA6A 4QYRA 2VPZB 1VMBA 2XMVA 4PCQA 3THVA 2UVWA 1VQ8S 4C0BA 2W7OA 5KOWA 2GJ2A 2HWHA 2K3KA 3FZ2A 2D7SA 3CJ4A 2VBWA 5J2MA 4B02A 4J9KA 3R3TA 4WCEQ 1QVFR 3OQ2A 4O3NA 4K50A 2YWEA 3LP1B 1JLCB 5CXTA 5A0YB 3M2UB 5G4DA 3PVXA 1HQEB 4RZRA 4IG3B 1VGYA 2J76E 4FYDA 2PT0A 4ZK7M 5L8RC 3BN4A 4A48A 3CCES 5DO2A 4ZP9A 2XMUA 3R5DA 2FHKA 3N4WA 2D41A 4FN5A 2HFZA 3MTKA 5D77A 3I32A 4GC7A 2LQJA 3ZC4A 3LAKA 4IDKB 4TN2A 5KFOA 3IC1A 4K4ZA 3LQVA 2IHR1 2FDNA 4C8LA 5E3PA 1QLNA 4G1IA 4DL2A 2KFNA 4WU3A 1Q82T 1R7IA 3KLEA 4YB5A 2O1PA 4OZ1A 1QUVA 4EZ6A 4CH0S 2DBBA 3T3FA 4O23A 4KHPF 1N0UA 2KT5A 3UDLA 1HD1A 3H5XA 5KFLA 2W8KA 2CRLA 4KHMA 5B0BA 3CCJS 1RT2A 2JRSA 5KFCA 4YOEA 3VAJA 4IG0A 2MB0B 4WYLA 3AQPA 4E8UA 4RNOA 2B0GA 2GGPB 4PG5A 4NLDA 4IRCA 2VKRA 2QA2A 1YJTA 4IG0B 4LFAF 5HLFA 1CLFA 1TFYA 1VS3A 3FNNA 1A7GE 2HAIA 2JFKA 1IN0A 1X0PA 3M6UA 4IOAQ 4HH1A 3MECB 1ZZNA 3B8HA 4F3MA 1KQFB 1R3NA 1FD8A 3HVWA 2JLGA 2C2DA 1BQXA 4CNZA 4ES2A 4OX8A 4RW4B 2BXJA 1ROFA 2MY8A 2NS1B 1NH8A 1D1UA 1T94A 4KRWA 2F8EX 1SL2A 3J7YU 2P6TA 1GX6A 4NZ6A 3G8TA 3PACA 3HVRA 3QIDA 4IH7A 1M5KC 1PSDA 3CIZA 1LW2B 1LWFA 2AV5A 3GIIA 1ZM3A 3H59A 4DFKA 4Y2AA 5DM7Q 3IS9B 3VAHA 1NJYA 1GAOA 1S4FA 2VV5A 4JYAF 4B3OB 5U47A 5H1SV 2N7YA 3AB4B 1M90T 2GIRA 2B4UA 4C8MA 4DSEA 1IKXB 3QZ7A 3QMQA 5ITHA 4A8XA 3TAMB 5CCMA 5D3GA 3BGRB 1G6BA 4C8ZA 3E51A 4ED8A 5HBMA 1TUVA 1IKVB 1HW9A 2CQBA 2DNMA 1V3RA 4NLTA 4ILLA 1S6OA 1R8CA 3LANA 3CCVS 4I2QB 2DD8S 3BGLA 4KO0A 4MMOA 4NZ0A 1LW0A 4I56A 1HBNB 1HBMA 3B4MA 2XMMA 2OLWA 2E5LF 3GG0A 4O3OA 4B9TA 2XZWA 1FJ7A 1C1BA 1DAXA 4QU6A 1GXUA 2P5VA 2LLZA 1JXEA 4GKJF 2G13A 1WG1A 1D9FA 3NG8A 1CC8A 3BGFA 5IT9Y 4DFJA 2WB4A 3D1QA 3HO1A 2HGMA 1KSPA 2EK6A 4C0HA 5GAEU 1JJ2R 1JLCA 2M88A 4FF1A 2PI4A 1H7WA 1FE4A 2K7KA 1KR4A 4ZPBA 3MR2A 2JLEA 1VQNS 2I38A 1UJ6A 3CJ0A 2I9SA 2DNHA 2EVZA 2LQ9A 1TZ0A 4Q5VA 3KLHB 1MSWD 3TUIC 4F4ZA 3SCKE 1S6PB 1FT8A 5KFUA 2BDPA 4KAIA 1ZM2A 4FBTA 2DRBA 2F3JA 2R7QA 3J7Z5 1WWHA 3HHLD 3L7PA 2WSCC 4AQYF 4X4NA 4OQJA 4RU9A 4L6V3 3Q2TC 1U2RA 2AGPA 4V19J 1RP5A 4USJC 1K0VA 3GFXA 2ATLA 1N5QA 2B4VA 3JTPA 5KT5A 2MKSA 5IQ6A 1NK0A 1H38A 4IFYA 2HNZB 5D4NA 3RW7A 4LF4F 2QA1A 3CCWA 2M9KA 1G2EA 3S7RA 2J9DA 4YR0A 3OVBA 5LJ5Y 2O67A 3M8QB 4OX9F 3TP2A 1LFPA 1U24A 2RDJA 2HLTA 2UVVA 4JOUA 4MFBB 1B64A 3KHRA 4ZHRB 2ZH1A 4PPZA 4A8KA 2KJWA 2EPIA 2J0WA 3I82A 1X9MA 2XLIA 3KFWX 2A2CA 1ZPWX 5C25A 3ISND 2DR8A 4Z2XA 3H5SA 2N4DA 5I42B 2UZAA 2MKJA 4C98A 4CO1A 4QW9A 1IXKA 3MEDA 5EX0A 4WKYA 4I6AA 2HS4A 3OSPA 4A4JA 3RB0A 2FJWA 1NHVA 3DU6A 3MM6A 3PNIA 2BQ3A 3M9NB 4IO9Q 3VQTA 2XI3A 3MUVP 5DRKA 2B6AA 4IKAA 5ADZA 4X4TA 5CCLA 2AQ4A 1DTTB 2RNEA 2MHNA 3KNAA 3IR6B 2DO0A 2ASDA 1L3VA 2VKZG 3O2IA 5L1LA 5DQIA 4KFBA 3H8YA