3K2YA

Crystal structure of protein lp_0118 from lactobacillus plantarum,northeast structural genomics consortium target lpr91b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotide binding protein
molecule keywords uncharacterized protein lp_0118
publication title Crystal structure of protein lp_0118 from Lactobacillus plantarum,northeast structural genomics consortium target LpR91B
rcsb
source organism Lactobacillus plantarum
total genus 19
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k2yA00
3K2YA
chains in the Genus database with same CATH superfamily
3H40A 3M6WA 2FY1A 4X4VA 2GIQA 4AFFA 1GFWB 4RBVA 4F04B 2BANA 3B4DA 1N5TA 4OZ5A 4C8LA 4IR9A 4B02A 1LW0B 4NLOA 2IRYA 1FO1A 2ZHBA 2KG1A 3CJ3A 4ZVPB 1R43A 3MCOA 4I68A 2F63A 3NXZA 3D3CJ 3TZWA 3OLAA 2VQEJ 5ADZA 1TKDA 3TWZA 4DV6J 3LALA 4KC5A 2J7KA 1C1CA 1MW7A 3BO2A 4TXSA 1KVIA 3IM8A 1E6YA 3VHQA 5DM7Q 3B78A 3R2CJ 2CG4A 1WC3A 5IS2A 2RNEA 4OLPA 2NSCA 2PN6A 2BOPA 5KG2A 4ILLA 4F3MA 3T6JA 5KFOA 4MYTA 3CIMA 2W4DA 3M8SA 1O51A 3A13A 1FJ7A 3V6JA 3PZPA 1LWEB 4ZPAA 4J9MA 4ED4A 1NK8A 3FBBA 4K7QA 3GV7B 2UXBJ 5FDLA 3P45B 4Q5VA 2ZJRQ 1CJUA 4RBUA 4NLXA 2CQBA 1NMEB 2VBZA 4FYDA 1BQNB 1X4EA 4QIEA 1N5YB 1H2TZ 5DZ7A 5D6GA 1RQ0A 2K3KA 1C1BA 3O6QA 4DL3A 2G0IA 2YX1A 4C3KA 1SKSA 4U7UK 1CS4A 3A4TA 2ZH9A 1RU1A 3DFEA 3EX7B 3K0JA 5B08A 1RT7A 1VQPS 3VR1A 4B9LA 2CG8A 3J7ZT 4JYAF 2HS3A 3QYYA 2B3TB 4ED1A 2XC9A 2GAGC 7FD1A 5RUBA 2HBZB 2LA4A 4DQPA 1P1TA 3FC9A 3BGLA 3U1LA 2W8LA 2RMLA 1IKXA 5J1EA 2E44A 1GH8A 4ECSA 4C8MA 1RUSA 4ICLA 3OFFA 4N76A 4OFZA 1N32F 1FWPA 4DR7F 2HVEA 3ZTOA 5L8RC 2DHAA 4DCJB 2XMAA 3L7OA 3MM8B 4UOCA 4CTAB 3R7SB 1JLEA 4UOGA 4CLLA 3BO3A 4V19X 4ER8A 1BQMA 1HYSA 2CPZA 1IR2A 4WXOA 4DLEA 1H38A 3AD9C 3EUNA 3VWSA 1HHSA 3GJSB 2NS1B 4YDDB 2UV8A 2EK6A 2VFSA 4WTOB 4P6QA 1WACA 4EBDA 2FVRA 3W7BA 4NL5A 3FGVA 4WP8A 4B3MF 2KRRA 3IWNC 4TY9A 2V2KA 1T9YA 4FP9A 3WC0A 2QLJB 2V9WA 4C8KA 1U48A 1XNQF 1VJWA 3A3PB 3ONQA 2CPEA 5D3GA 1NHUA 3UN5A 1I51B 1FF2A 1MROB 1S99A 3AXMA 4RU2A 1IQTA 5CCLA 1NJWA 4DQSA 1QSYA 4PG4A 1S77D 1RAFB 2W7PA 4KAIA 2WW4A 1NRKA 3WIVA 1LWFB 2JC1A 3HM9A 3IA0A 4L3KA 2E7WA 3W64A 3LP0A 3L4BC 3VAGA 3RB6A 2N7CA 2BABA 3UVJA 1KLMB 5HMWA 3QBCA 1RHUB 2D9PA 1FX2A 4DFMA 2VG5A 3N6MA 1UPPA 4WP9A 3CF5Q 2ZDPA 2HK2A 4FXWA 3FBCA 3AD7C 1ZA1B 2HHHJ 4WFNQ 2GQCA 1RWXB 3FBFA 4F4AA 1BE4A 1BWVA 3O8WA 4UUXA 1SH2A 1DZ5A 1S76D 2EFPA 1N33J 1LWCB 4WK3A 1FKOB 3MM9A 4LR9A 4QW8A 1UTAA 5CYMB 4YQWA 2AWZA 1VBKA 4NLVA 2WTFA 3S01A 2WCXA 3HKZD 2O1PA 1ZM2A 2LCWA 1MU2A 5L46A 4A8KA 2DGSA 1S1UA 1Q1KA 4N5SA 4FF1A 4Q2MA 1RHRB 1SIWB 1K9MT 2NUUG 4FPIA 5DM6Q 2LVWA 3KLEA 1I94J 1RTHA 2JLFA 2GO8A 2CNOB 2HWTA 2KZMA 2BQUA 2CRLA 5GMKa 4HHUA 4HYKA 3MAAA 3DLHA 4R8UA 2MMYA 3IO1A 3VGUA 5CYQA 3QWUA 1ZS6A 2W25A 1K73T 4ZJLA 3NWGA 2XI3A 4WP3A 5KFBA 1NM2A 2XHWA 3FEYB 2IHR1 1UETA 4Q45A 1JLBB 2VQEF 1V3ZA 1HBOB 4ZOSA 4N41A 3PG9A 1UVKA 4DV6F 4EUVA 3EZUA 3HFVA 3GV5B 2FTRA 3DM2A 4TLRA 3ZO7A 2ROEA 2UVVA 2YX4A 4LBHA 2J8AA 3MHYA 3MTJA 2PEHA 5KG6A 3J80Y 1SQGA 2OMLA 2VFTA 4P2MA 3NAIA 1ZZFA 4NA3A 3RB0A 2XZTB 1DURA 3US5A 4DV4J 1UVLA 4RWWA 3GONA 3P5BP 3TUPA 2Y1RI 1N54B 4B17A 2Y1JA 1Q78A 5ETKA 4ANDA 1KN6A 2VG7A 2DGVA 3WC2A 4DPYA 4RW6A 3EDRB 1SKRA 4TQSA 2E5JA 2YWHA 1HPZA 3E8OA 4PG7A 3F44A 1U1OA 2YPZA 2D7SA 3H59A 3OD2A 3UCGA 4X4QA 2BXJA 4X4SA 1FWLA 1RT6A 1Q8KA 3CD6S 1FKPA 3LO3A 2WVDA 1HHTP 4WZQA 3GYGA 1D8YA 1T8EA 2IM0A 1QSSA 3K5NA 1RAGB 2IJRA 1DQ8A 4YEAA 3OL8A 4OZLA 5CH7B 4PXBA 2JVRA 3OT9A 1NK0A 2KTQA 5H9FK 2CZ4A 2DEIA 1NSAA 3W2WB 2XGPA 2GFFA 3E2EA 1IN0A 3QO9A 3CJ0A 5D8HB 3MMAB 3IGVA 3U27A 4OHXA 4E2FB 3SQOP 4DFJA 4HEA9 2QT7A 3PX6A 4DX5A 3LGNA 1HD1A 1K1SA 2NXJA 1PSDA 2V4RA 2UVRA 2WBRA 2AIRB 1H6KX 4OI4A 3WIUA 1YZ6A 2MKYA 1IBMF 2LXFA 1WC4A 5DS7A 3GFYA 4NI2A 3D1QA 2CVIA 2RQKA 4DQQA 2OJ3A 3BBFA 1VISA 2BE2A 2IBOA 3MEDA 1L3UA 3ZZUA 4OI0A 1U6BA 2IPOB 4DDFA 4EWTA 3R6LB 3LTOA 3CJ2A 4OYZA 1VBZA 4DR2J 1M5KC 1UVMA 5HROA 2BW2A 3PRVA 2E1AA 1YJWS 1DY3A 2CPDA 4KPCA 3MUVP 2Y1IA 2HQDA 7AT1B 4WFAQ 5MAOA 4MFBB 4WF9Q 2AU0A 2PD1A 1TL4A 5B0FA 5CAAA 4MKBA 1JLGA 4KBIA 2ACYA 4HHJA 4BS2A 1GXUA 2ZD1A 3BR8A 4QYRA 4ZIWA 2HFUA 2OD6A 3KUEA 3GG1A 4XPEA 3DYAB 4OZNA 5AJ3F 4E0DA 2C2NA 2IC3A 1TU0B 1N33F 2RE1A 3I87A 2E1MC 2YKNB 1HNWF 1U1PA 4DXLA 3NLCA 1AUDA 1M1GA 2F8EX 2VJUA 1WHXA 1VQMS 3IBCB 2JJ4D 1L3SA 4C6AA 1FK9B 4Y28C 4ECXA 4TY8A 2JFKA 1I94F 2ATLA 4OI3A 5KT7A 1W26A 3BM7A 4M5DA 3HSGA 1HNZJ 1T9VA 2AJQA 3UDLA 2HVIA 3MR7A 2MYFA 4X4OA 3I82A 2NZ4A 3OTDA 1D8ZA 3CEDA 1WKJA 2AJFE 4YDXA 3SCLE 4DPWA 4PWDA 3FK4A 3CTRA 4ZPWR 3OV7A 2LQBA 2MKHA 3QFHA 4FNIA 4IQMA 2AGPA 1KOHA 3L9ZA 4J9NA 2JH3A 3H5UA 2XULA 1SC3B 4EGLA 4QQBA 1U25A 4CYUA 2JOQA 1NAQA 1S1TA 1XERA 5AXMA 2J6SA 1SJQA 3QWPA 1VHIA 2RD5C 2ZH2A 2H5IB 3W9IA 1ZAXA 4ID5B 4NZ0A 1U09A 5K8MA 2CQ0A 1DARA 4ZPDA 4DV4F 3P4UB 4QIWD 5ETOA 1AFIA 5A8WB 4RW8A 2BKOA 2ROPA 3UR3C 2BJ7A 4EMDA 1XTZA 1HNXJ 5DQHA 2ZH3A 4URSA 1X4BA 4FKYA 2R8HA 2BR0A 2C3OA 3TW0A 1W25A 2LQJA 4K0KF 1PG5B 4DSJA 1A6LA 3G8TA 3FQKA 1PC5A 1YBAA 1R6YA 3LGMA 1XR5A 2VODA 5DQIA 1AFJA 2QYCA 4TKTA 4U67Q 1RLCL 1TKXA 2OPQA 1BXNA 2DHSA 2R4FA 5E0OA 3Q23A 1YITS 3OXFA 4AYBD 4PUOA 4PG8A 2VD3A 3Q8QB 4M5JA 4RUAA 2R7UA 2M4MA 3N5BA 1UCNA 4K4XA 4NXNJ 3KMSA 3OR2B 2UP1A 3H25A 4EO6A 4OZ3A 2E29A 4DUTA 2GMJA 2EXUA 1EJ7L 2M5YA 4IUFA 4LBIA 2N82B 4ECZA 4IO9Q 1SC1B 2ZBQA 1CJTA 1P8GA 4I7FA 4LSNA 1FJCA 3FRYA 9ATCB 3GSIA 3TA2A 1TL1A 4L76A 2BANB 1Z2LA 3DLBA 2CQPA 4TU8A 3W9JA 2KXNB 5GAGI 4UY85 3HHLC 3M6UA 1B7FA 3IWLA 2K7KA 2M8HA 2GMHA 5IT0A 3ENVA 3D6HB 4H4OA 4IFYA 2J9EA 3FDSA 4ENOA 3NMRA 4EYIB 1U1KA 4AUKA 3GIRA 4EBEA 3I9V9 3H7HB 5KG1A 5CABA 4O44B 3H4DA 2PA8D 2BJDA 1F9EB 2B43A 3VAJA 3SIPB 4HACA 4JI5J 2Y8WA 4K8RA 4CM0A 2D41A 3B82A 4QPXA 1S6QA 2LECA 2QFIA 3HX9A 3FSXA 1R0AA 1VQNS 5KT5A 4P2XA 4HLBA 1APSA 3A8EA 3S7RA 5A8RB 1TFWA 4X84A 4NLWA 4RNFA 2VICA 4DL7A 2ZJPQ 2XY6A 5HP1A 1TUGB 5F8LA 2IA6A 1X0FA 4C0BA 1EHWA 3CD0A 5FDLB 5DDPC 1FJEB 3Q89A 2PE8A 3MFIA 1CJUB 2B6AA 5FLXY 2KT2A 1IKYA 3G86A 2FC8A 1GMVA 1X4DA 2WONA 1DRZA 1GTHA 2DD8S 4ED5A 3HFKA 1SQFA 1C1BB 3B8HA 1X9MA 3HSDA 4OX7A 1CS4B 1OYDA 5JVHQ 4I67A 3RU0A 1MMDA 3FMBA 3W62A 2KHDA 1WUUA 3MCSA 1TK8A 4USWA 3D66A 2R8IA 2YVSA 1LQ9A 4DV7J 4LRCA 2VPZB 5K8OA 3CCVS 3BN4A 4B3RJ 4NLRA 1IKXB 5J1EB 5K5MA 1VLYA 3RR7A 5L1KA 4F0KA 2VC0A 5DO2A 4ICLB 5DG8A 4M5IA 4U6PA 3DI6A 4CO3A 3M2VA 1KS2A 1RT4A 1SBRA 4O23A 1QD1A 4LF7J 5B0BA 1V3SA 1RBOB 3LAMA 4YS2A 1JLEB 6FD1A 1LXNA 4FDFA 3J81Y 4ECWA 4MTPA 1BQMB 3CCJS 2V2ZA 1GNKA 3NWRA 4Y2IA 2UUCJ 1Q0NA 3RBZA 4P2FA 1IKWA 2CNKB 5HATA 1ZM3A 4K4UA 4NEZA 3GIMA 5DDQC 2DH8A 2H4WB 5H9EJ 4NOHA 4H4MA 3Q8YA 4H4KC 5HLFB 2B56A 1FE0A 2DNLA 3PYFA 1NZ8A 4NLYA 2HNYA 1UFWA 3EJMA 2C2MB 2UUAF 2Y0BB 2KFYA 1S12A 2AKWB 5AXLA 5C24A 1KVJA 2MLYA 3CD5A 3WQPA 1T11A 2XMMA 3P5TL 5D3GB 3A12A 3QGGA 3RTVA 3L09A 1U6FA 4A8WA 4KY3A 4RW4A 4OV1A 1IBLJ 1IJFB 2ILYA 4NCAA 2OGUA 1HNXF 2R2UA 4E98A 2HIYA 2HHVA 3LP0B 3HHKA 1R0BG 1SUQA 2DNGA 4ID8A 2MEWA 2ZE2A 3UVJB 1FCAA 3RW6A 1R8PA 5B0GA 1Q82T 3BGRA 2PMWA 3W66A 2HZVA 3CUNA 3JB9k 2KH9A 2VG5B 1UFLA 3RR8A 3DGPA 2HRUA 2V2VA 1FJGJ 1MMLA 1NSKL 2H1YA 2DJWA 2GVDA 3R5DA 1DLOA 1FA0A 5LMNJ 1WF0A 3VZIA 1RTDA 4QU7A 1N8RT 2DBBA 4Q0BB 2F9JA 3KDOA 3CDBA 2VUGA 4KHMA 5DG7A 5EWFA 2X1GA 3MMJA 3C46A 3HZEA 1NB7A 3TVYA 3MM9B 1BWEA 2UU9F 1EQ0A 3CIZA 4N47A 1YX2A 2UV8G 1RAAB 3K58A 3PR4A 4ZN3A 1RT2A 3KKFA 1H98A 3BKTA 1S6OA 4DV0F 4JBCA 4J37A 1KWMA 2F65A 3KLEB 1RTHB 4OJGA 3HHEA 1ZZNA 3LP2A 5ETVA 2KB2A 4LF6J 3BSOA 3MAAB 4R8UB 1N36J 4JI6F 1IWAA 3P6YC 5D4LA 2V4JA 3FQLA 1F3FA 1SJFA 2RB7A 3MDFA 5L39A 3M7VA 1KLNA 1X60A 2M2BA 3QRQA 3FEZA 5IV4A 2OEJA 5D15A 3PW2A 3JQJA 5EN1A 1WJ9A 5LSRA 1TP7A 1NZAA 2MHNA 4M5LA 2WK4A 2QLBB 1CJKA 1RT5A 3K5LA 3PNIA 4M63A 1TK5A 2BV3A 4MK8A 2BOAA 3DOLA 4JI4F 3DM2B 1F5BA 2FJVA 1MMNA 4GMKA 5KT2A 4LSZB 5A0YA 3QRRA 2HNDB 4ILRA 4ZP6A 1FTCA 5HSPA 1HA1A 3A8KA 3QGPA 3PRBA 3WX4A 2K1RA 3TJ8A 3CPWR 3Q2TC 1DFDA 4PXCA 2B5JB 2BRKA 3ENAA 1DAXA 1YZ7A 1NBEB 2DNMA 2IVFB 2ASLA 3N28A 5BYQA 3MR3A 5IWAF 3GFZA 1S9GA 2HQGA 3CJTA 2DNYA 3BV8A 2VG7B 5C25B 1OIAA 3I5BA 5G4DA 4G6VB 1GAOA 3IMQJ 2HVDA 1U2RA 2ZOMA 2GHPA 4RW6B 4X62J 3QIPB 5D4NA 1HPZB 2CKWA 4A8XA 4IH5A 3N79A 5HK4A 2GS8A 3NCQA 3PFOA 2VFRA 2X1FA 2ZJQQ 3EGNA 3M30A 2QN6B 1U7LA 1RT6B 1HW8A 4ZPCA 4ECQA 1Q86T 4B3RF 4DPTA 1X0PA 4B9SA 4HDGA 4MMOA 4KGKA 1DJ0A 2LLZA 3W8GA 3RG6A 2YKAA 4NXMJ 1T02A 6AT1B 5HANA 3MAHA 3DRYA 4ZP7A 1QM9A 2QL5B 4YMEA 3PRDA 3MD1A 3PYDA 4IH7A 3QO9B 4A47A 5IZHA 3JQMA 2XZDB 3ADAC 2W7OA 3TX0A 1R3NA 2EVZA 3BPSP 5KFNA 2V50A 2WSCC 3FCWA 1ZOTA 4WPAA 2KXFA 1P6TA 5CD4A 1XC9A 5KOXA 3VGVA 4B9VA 2HS0A 1RTJA 4USUA 1JLQA 2KO1A 8AT1B 4NLQA 2LU1A 4C48A 3TZXA 3DOMA 1P1LA 4IQXA 4J90A 3D1HA 4NI2B 1OYEA 4J9UE 4MAKA 2J7UA 2MQLA 5GAGU 2MZJA 3UD5A 3JXOA 3IAS9 2EFGA 2BE2B 3MEDB 4BWJA 2EKYA 2GGPA 2P6SA 3H90A 2A6MA 2DT9A 4IG3A 4UTGA 3OW2R 4N8OA 3HJVA 1VMBA 1KFSA 1EAYC 1NPRA 4ED0A 2P8IA 1DHMA 1SC4B 1HWKA 3GP9A 2HLTA 3RJMB 4K59A 4P10A 4M5GA 2LFVA 2CDRB 4E8UA 2HGMA 3UPFA 1KNZA 5B0EA 4AXJA 4PABA 2KYZA 5KFGA 1FJGF 2BYCA 1JLGB 2W01A 3PJWA 2NXUA 2NZCA 3T5JA 2ZD1B 3O5TB 4OMFG 1K47A 5IC4B 4RX6A 4CT9A 4ILMA 2KVQE 1X4CA 2KJWA 2Z8QA 2NYHA 4IRDA 1RU2A 4DX6A 1K44A 4Z37A 3TR5A 2FDNA 2IC3B 4JI0J 2YQ1A 2AEFA 1QE1A 1TMJA 2RF2A 2PMHA 4Y0FA 3NGSA 3P96A 4NZ7A 4KKOA 3L3CA 4OYXA 4OI1A 5HI7A 5HN0A 1LFPA 2P9CA 2MZRA 2W7AA 4I6WA 1T03A 3DLKA 5L38A 1UEVA 1S1WA 2XTJP 3JSYA 3MMCA 2K8GA 4ES3A 1XK8A 2ZKUA 4M5DB 1UP1A 2XI2A 4YP3A 4ED6A 2DO0A 2Q79A 2HGNA 2XWXA 2R8GA 2XNQA 3DOKA 1JLAB 4YR0A 3QT8A 4YFUA 3T5LA 3MI7X 1NH8A 2V4QA 3KHRA 4OHYA 2OI2A 3VV2B 2KFZA 2DR7A 5D77A 3MM5A 4XPCA 2DR8A 3C6TA 3Q0AA 3R5GA 2DVIA 4CO1A 2NUHA 3SYZA 3CMQA 1S1TB 1SH0A 5HVHA 2AD9A 1RT1A 3UO0A 1GX5A 4ZN1A 4JB8B 1T95A 1REGX 2FHKA 1FT8A 1HMVA 3B6BA 1K1QA 4EZ6A 1T3OA 3M4XA 2ERRA 4RUHA 3BO4A 5BXIA 1HL6A 3RZAA 1KHWA 2HMIA 3H5SA 1LV5A 2M7SA 4FYYB 5IFMA 3MCNA 3JYTA 4RW8B 1RBLA 4LQ3A 4A46A 2BM1A 1FDAA 3UFCX 3KJNB 2V5HG 2HG4A 3N9UC 2HK3A 1UA0A 4AL5A 1FD8A 2RSQA 3CSKA 1G1XA 2D3O1 3MAQA 1OQ6A 2V8PA 4X62F 2XG8A 3AOBA 1Y00A 4DX8H 1XNRF 4L73A 2BUNA 2G1HA 4OX8A 5IXUA 5F9NA 3WX8A 4KV8B 3ZNJ1 3UDCA 5KFDA 3AFGA 3DXSX 1XMQJ 1UWBA 2GO9A 2BEFA 2AEMA 2V8HA 2RS8A 1VR6A 2ZC4A 4PUOB 3CB4A 3CCZA 1U1MA 1HARA 2VFUA 4GO7X 3NKYA 2J7WA 4NXMF 4FZVA 5DDOC 2AP6A 2XYHB 4NCGA 4P75A 5SZTA 4IOBA 5GAEI 1CJTB 3UNGC 1FRXA 4P74A 1H2UX 4I7FB 4ZPVR 4LSNB 1EETB 4YY3J 4EZ9A 2E5HA 4NZ6A 4W4MA 1PKUA 4HTIA 3I55S 3DNCA 1TL1B 5F9LA 1WOSA 2DEJA 4DG1A 3CDUA 4LT6A 1M90T 2AJ1A 2AF6A 3R8YA 4ELVA 1X4GA 1Y5NB 2WZ1A 3BS9A 4WCEQ 3M2UA 4H4OB 2EG1A 2E5IA 3NGRA 4RZRA 3RAMA 2MLZA 2YNHA 1N48A 3I4HX 2XNRA 4WE1B 4OX9J 3J81j 5LOQA 2GJ2A 1ZH5A 2CVEA 4HKQA 5JMNA 4HACB 3CCSS 1FRLA 1S6QB 2UUTA 5E3QA 2LYVA 3DHXA 1R0AB 2X1BA 3DRRA 2YH1A 4UW2A 3LF0A 2OP5A 4M5KA 4USJC 2HVHA 2WVBA 4NX9A 1D0EA 1N4LA 1HKAA 5I3UA 3EGVA 3TNVA 4F25A 1PJ6A 5HP1B 2CPJA 3CO9A 4DF8A 3FZBA 4BDPA 1SV5A 1LKZA 2VQFJ 3CCQS 1VS3A 4HDHA 4C0OC 3GILA 1DTTA 2B6AB 4OYBA 4TLQA 3CMES 4KHRA 4J9QA 3HHDA 4AQYF 4C4WA 3OSPA 2QSFA 2Y8YA 2V8DA 4G1QB 2ZH8A 1W2BR 2PC6A 1HBUA 2XB2D 3EZ5A 1IBCB 1RYSA 1J27A 2DCUB 2IM3A 3I0RA 1VRUB 1WHVA 2DNPA 2BRLA 4KJIA 1KSPA 2DKOB 2Z2MA 4M5HA 1CJVB 3HD2A 2EK1A 2NREA 3HF5A 2JLEA 5IM0A 4ZHRA 4LF1A 4F26A 3J80U 4P72A 3W2VB 1ZTTA 1PCAA 5JVGQ 2JFDA 2GHWA 3QATA 1M5SA 3DI6B 2CJBA 3M2VB 1WI6A 5F8HA 3NGDA 3IAM9 3VAIA 1RT4B 4Q44A 3OL7A 1O8BA 3HVAA 2CPXA 4GVBA 2M3DA 3R1LA 2V34A 3MM7A 4YR3A 3EZOA 4LREA 1VQKS 4ELTA 3DMJA 4DQRA 2YNGA 4DR1F 3TEHB 2OKQA 3AD8C 3NNAA 1YIJS 4KTQA 4WZMA 4I2PA 2L9DA 1CLFA 3D0GE 4O3QA 4ZPTR 4CP5A 2XO6A 1N5VA 2EG2A 4H4MB 4ZVFA 1EZZB 2QV6A 3IWXA 2EKNA 5I3QA 5J2PA 3EYZA 4DUZJ 1U1LA 1X4AA 3RGIA 3D28A 1CEZA 2HNYB 2EEYA 4WKYA 3WHIA 3KJVA 2CIMA 1A9NB 1XJWB 2ZBRA 5C24B 2W9CB 4I0WA 2M9KA 4WFYA 1Q8BA 3V4IA 1OPIA 4N56A 4JI8J 4DV5F 3GU0A 3TAPA 4OYOA 1T9TA 4RW4B 1REVB 3CCLS 3L7PA 5LSLA 1CG2A 2YKMB 2AX1A 4L74A 5K9FA 4I2QA 1FI4A 3T1YF 1YJNS 2JEGA 2UVUA 2VJVA 2HBQB 5G0RA 3KTQA 4ZVEA 1OY6A 3F0NA 2HW3A 2ZE2B 4LFAJ 2ZNZA 1HQEA 5F3ZA 3BGRB 3ULHA 2HFVA 1VHFA 4B9NA 4KFBA 1SPBP 3QAUA 4QIGA 2J0QD 2FZCB 2GVDB 1R8HA 1DLOB 1RTDB 2YWEA 3E51A 4A8MP 4ZCLA 1KRPA 1VJQA 1WELA 1N34J 2IVYA 2QLWA 2WSEC 4USTA 2ZOFA 4RO0A 2H51B 1KD1T 4I69A 3A1YG 1OPZA 2UXCF 1WHYA 2HQIA 2FB0A 5AE1A 2OPPA 2X3GA 2YKQA 2FLLA 4KGVB 1S1VA 3GTYX 1WG4A 5F3TA 2B8PA 3SCJE 5C42A 3VCDA 3LP2B 4EBCA 3HKWA 3ICLA 2V4JB 1RB0A 5J2NA 2FD2A 2U2FA 1Y5IB 3CC2S 1NPPA 3PHEA 4FVMA 3CXCR 2DR6A 5L9NA 3FSIA 1EX8A 1FWKA 3D6FB 2C2RA 2QA4G 4OV6A 1CJKB 1RT5B 4OX9F 1Q5VA 4AL7A 4P7TA 1JLCA 4G1IA 3TANA 1EIYB 3DOLB 3T1HF 3VVTA 3E3XA 4LSLA 3SSSA 4O3NA 2HHQA 5A0YB 1GX6A 1UWAA 2DGWA 1S6UA 4R5PA 4J9PA 1U26A 3GZ7A 1FFGB 4N77A 4WFZA 5T14A 2LEAA 2K1RB 1QLNA 1IWGA 3GMGA 4TYBA 4FNHA 5F8MA 3BN7A 1VRQC 4OYWA 3QZ7A 2CDQA 3OHAA 1Q7YT 4LFCF 4JYAJ 2VQFF 1NSQA 3R7BB 2ZUAA 2XHCA 1S9GB 1TKZA 3Q8VA 3Q24A 4DR3F 1GXLA 1BC6A 2LMIA 3E01A 1JXEA 4NE9C 2R3VA 1CPZA 2XWYA 5KG0A 2R2RA 3ZTPA 1N32J 3GJQB 2G2OA 1C2PA 4ZVHA 1KQSR 3J7YI 2D69A 2DHXA 2ZH1A 3MPYA 2CQCA 2RQ4A 2GHVC 1XBWA 3NBPA 4CO5A 1JJCB 1ZTWA 3GJTB 3PYGA 5B09A 1F3VA 3MOZA 4LFBF 2MQ8A 3K17A 2RIJA 3M30B 3IS9A 5KFYA 4QU6A 1H7XA 3JQKA 3K2YA 4W90B 4OIXA 2B4UA 3J7A1 3QLHA 2COLA 3BSAA 4F2SA 2BJEA 1N6QA 5KFMA 4B3MJ 2OFHX 2QLFB 4Y00A 3PW7A 3I4PA 3KK3A 2OMOA 2Y1LB 3HCXA 1VFJA 4KGXB 3IBWA 1SL2A 2OSQA 1XNQJ 4ZKAA 2Y0SD 1YWXA 3QJPA 3I31A 3DCAA 4A4JA 4J9LA 2FIUA 4LF2A 3BQ0A 4BLGA 4DV2J 1U0HB 2W9BA 1F1BB 4C3LA 2ZH6A 1TV6A 4DU7A 1MWQA 3GB0A 3TAQA 5GAEU 3BQ2A 1RTJB 2XLKA 1JLQB 2RILA 2C2EA 4AT1B 4NYPA 2G9OA 2JZ5A 1ELOA 1KDNA 4U8VA 1XIQA 4CCHA 4F50A 4FS1A 4LRAA 5KTQA 1VC0A 4JI8F 1DTQA 1RXOB 1SJ3P 2CQ4A 2EPIA 4D3HA 2BKPA 4NEYA 2GGPB 1WOOA 1G7CB 2FJAB 1EKRA 1IM6A 2VPXB 4IG3B 4HI1A 3TUJC 2HQ3A 3HHLA 3EGWB 3IG1B 3LW5C 4C2MA 1TL3A 3I5CA 5DETA 3D4JA 4J7CA 4AE5A 2B4VA 1HNVB 4KQZA 3O2IA 1HD0A 1JJ2R 3MUTP 2I5JB 3H20A 2OPSA 3M8RA 2XY7A 3OTOJ 2C3PA 2W4CA 2VOPA 3ZZRA 2XMTA 1SJ1A 4PG6A 3POTA 5M2RA 3D0IE 1CULB 5FD1A 3OXLA 4J91A 3ZC4A 5E7OB 3JTPA 2D74B 3NP5A 2N4DA 3MPUB 1N34F 1QE1B 1EP4A 2HNZB 3RRHA 2CJQA 2ZM6F 4KKOB 3AQOA 1SC6A 4J5OA 1Y9OA 5ETSA 1T03B 3DLKB 5J2QA 2WW8A 5FIIA 1FEHA 3HMJG 1S1WB 3HFZB 5A2QU 2V67A 2VG6B 3MMCB 2KM8B 4QYZK 1YI2S 1FFWB 1OY9A 1TL7A 1RWMB 4ZCIA 2W2NP 4LIRA 3AOAA 1TMMA 4YB1P 2JLGA 3DOKB 2RJZA 4CLKA 3M9OB 1F60B 3MM6A 1D3WA 5K8PA 4ATNA 4FYVB 5FLXU 3DHWC 1VC5A 2Z0GA 3C6TB 2XSJA 2E9ZA 3UCUP 2KM8C 1NK7A 3OLBA 3AY0A 4NMLA 1QSLA 4ZVSB 1NO8A 1JXLA 1RT1B 1WEXA 5CD4H 1HMVB 4XTTA 3SCIE 1KQGB 5F8NA 2AZ1A 1S79A 2B9XA 4KPYA 2L9NA 3ISND 3GWCA 2OHDA 5CCMA 1FEEA 4PQAA 4CDIA 4ZDNA 3F41A 3KLVA 4BHQA 2EFQA 2AJ2A 4H4KA 2RU9A 1YGYA 1UAWA 3RW7A 1AXQA 1BQNA 3T5KA 5HMYA 3TYTA 5IT9Y 1S0NA 4Q8EA 1LXJA 3CJSA 4ZP9A 2HYIB 2H65B 1PC4A 5IQQA 2R7VA 4DWIA 3J81U 2W2MP 3JTNA 1UA1A 4CLWA 2VDIA 4ED2A 1NXIA 3GFXA 1Y10A 3W8PA 4F8RA 1UWBB 1B99A 3ZZZA 5KFSA 1L5UA 2VF3A 3D68A 2ALYB 3NAHA 4RW7A 4FN5A 5KFWA 5KFXA 3NL0A 1WG1A 1ZM9A 3FFIB 2M8DB 2HURA 2CA9A 3VAMA 2LXIA 1IBMJ 5C2GA 2BKNA 3I32A 1M1KT 2FJBB 2N3OA 4ETZA 4NYZA 2MKKA 4JI3F 5CQGA 4OZJA 3TJ9A 3CW2C 1F9FA 1R8BA 2CQ3A 2AJ0A 2MQMA 2FZKB 4DV2F 2OPRA 4O3PA 1QAIA 3MFHA 3BGUA 3EM1A 3H4BA 2NR0A 4UZBA 1SH3A 5C5JA 2I1RA 4LF9J 4HT7A 1RT3A 3M2UB 5I3PA 3MZIA 4JOUA 4NRUA 5HMXA 4CNYA 2C1EB 1S6PA 3K89A 2KL8A 2WSFC 4K4TA 3TVKA 2YNHB 3H5XA 4ITSA 3FSYA 5B7WA 3MGJA 2B0GA 2QLXA 3D6MB 3TZYA 2C2DA 1QUVA 4KE5A 2NLWA 5IQ6A 3PACA 4ZP8A 1Q79A 3V6DA 2XLIA 3DRRB 2GMLA 5AJ3J 1NK9A 1X4FA 1UFKA 1FE4A 4M8LA 4O4GB 1I6JA 2QG9B 1HNWJ 3HVRA 1TELA 1TL5A 3LQVA 2C3UA 3OHBA 4DR5F 1SV5B 3V4MA 1URRA 1QTMA 3OTOF 2ADCA 5KFTA 2C2KB 2XMJA 4NWBA 1DTTB 1U8SA 2UUBJ 3C2PA 2FGCA 4CO2A 1RCOB 1B0TA 2V63A 1AROP 3QQCD 2CXEA 2NPIA 4PXEA 4ERDA 2DNZA 3DDNA 2BE7D 1YDLA 1Y4ZB 1HBUB 2HSEB 1YVFA 3TZZA 1X7VA 2RAQA 3KK1A 1H0HB 4AD6A 2QA4S 2M0GB 2QL7B 2ASYA 2J6TA 3AB2B 4MIBA 3D6TB 1FKOA 1FRMA 3IR7B 3OUYA 2DK2A 5LSOA 2GV1A 3Q86A 3ENWA 3J7YU 3QJLA 4ZHRB 2W2QP 4Y2MA 1GT8A 1U1RA 3MR5A 5KG5A 3KXDA 1WC0A 1WC5A 4Q8FA 4ZVOB 4CO4A 5DJBA 3P3DA 5EGYA 3HT3A 3GG0A 1JNRB 3JTOA 3R9LA 4GVBB 2DRDA 3MM7B 2JRSA 1V5VA 3L95X 2AV5A 1KOOA 4I4BA 1RWPB 4Y2AA 2YNGB 4KR0B 1F6TA 3GR1A 4TU7A 2EBEA 1WNEA 4I2PB 4K4YA 1BY9A 2FGOA 3G4SS 1JLBA 4DFPA 1FNOA 2P2CB 5EX3A 3AAWB 3CCUS 5J2PB 4PRFA 2CQ2A 2NPFA 4K0KJ 2BDPA 2AT1B 2LQ5A 5KFEA 5BR8F 2WOMA 3NS6A 2CPYA 1WSRA 3QSIA 3KJVB 1MWYA 4UUWA 1RAHB 4XK8C 3V4IB 1VQ4S 3LPEA 1H73A 3LH2S 1SCJB 3IRXB 4MT1A 4DS4A 4UY8T 1RHJB 2DNQA 2V2QA 4CLZA 1RZMA 4M5NA 4DL0C 4DL6A 3CJQA 3O3LA 3KDNA 2FY8A 4I2QB 5AXNA 3R5BA 4RUCA 2K7JA 4XDDA 5E5NA 3X3UA 4W98A 2PA3A 1UZHA 2R8KA 3VF0B 2V0NA 1MSWD 2ZNYA 3OTEA 1U8WA 3PX4A 1U47A 4IO1A 2ZWPA 1HQEB 2XSFA 2E7VA 5BJRA 2XMKA 1RTIA 1YJ9S 3PV8A 3FZ2A 2CZVC 2FHOB 1N88A 4KFBB 2YQ3A 3HI9A 2HPUA 1U02A 2I38A 4J9VA 3DLLQ 4PYAA 5D4PA 2RHQB 2BMBA 4HHHA 1WKLA 1YSJA 2F4VF 1BUXA 3W5ZA 2X3DA 3Q22A 2KYXA 2MB0B 3HZGA 2E5LF 1RKJA 2HFZA 4CH1A 4RR5A 4KHPJ 2J0SD 4B9TA 2RRAA 2UXDF 4NLTA 2OPPB 2FHJD 3C8YA 2R2TA 1S1VB 3W2WA 2H4YB 1U2CA 3SDEA 5LJ5Y 2ZBPA 3PW4A 3MMAA 1HWLA 2DNNA 4DF4A 2BQ3A 3SSQA 3ZZPA 4F4KA 4U9RA 3W61A 3TVZA 3EXCX 3AB4B 1NJXA 4LF8J 1HWIA 1VRTA 3VQTA 4PPDA 5J2NB 4LF9F 1Z2ZA 2P9GA 4IOCQ 2HIQA 3KJQB 1SKUB 1WD6A 1CBKA 2F8MA 2CJYB 4F4WA 2BQRA 4DQIA 3KOAA 3PW0A 4KGZB 2CPFA 4C3MA 3GV8B 4IKAA 5K20B 2AW0A 2DISA 2A2DA 3ENQA 4I6YA 1Q95G 2MSTA 3BH7B 3BSNA 1HIYA 3LAKA 1KKHA 2Q1LA 4LSLB 4QWCA 1YHQS 2BX6A 4ZVUB 3UDEA 2NCKL 4R5PB 1YTYA 4YR2A 3FCHA 4ES1A 2I8EA 1AZSA 4OJ3A 2DNHA 3P8BB 3LGHA 3C14A 3PJXA 2VDHA 4ED3A 3EXYA 1RJJA 3CT9A 4PPZA 3EVWA 3AH6A 4OZ0A 4Q43A 1N0UA 5CYJA 2UUBF 1TKZB 1RHQB 3M8QA 1V6HA 3EDQB 3UD4P 1AUSL 3MEGA 5DG9A 3E01B 3G6ES 3KLFA 3BF4A 1PAEX 4UQTA 2Z4PA 4JUZA 1X5TA 1NCLA 2B9YA 4O3RA 4USMA 3KLHB 4DV3J 2VFVA 1PIEA 3IR5B 2IAJB 4PQUA 2DIUA 1HQUB 2QTWA 1U4BA 1TVRB 1TAQA 1QJHA 2QX0A 3G2XA 3NBPB 3QT6A 4QWBA 2A0FB 1JK9B 2MSSA 4OX6A 3CE8A 2YKNA 4FF3A 1NH7A 1M5PC 2BZ2A 1CC8A 2W4PA 2RUSA 1LNQA 3M8PA 9RUBA 2B9EA 3G8SA 3CCMS 1NKEA 3QLHB 5H9FJ 5AE3A 1IJEB 1N6QB 2EFNA 2Z30B 4ZVQB 2GW8A 3N6NA 5D0HA 1FERA 3KK3B 4KH0B 1KONA 3K5MA 4F4ZA 3PDNA 4L72B 5DGAA 4BCAA 2UUAJ 1RAOA 4ZVRB 3SEOA 3FJ2A 3FBEA 3GFHA 4USVA 1FTRA 2VBXA 3I6PA 1YJ7A 4OI6A 1GMWD 2ZZMA 3M05A 1Q4RA 5EDWA 4B3SJ 2XCAA 4M95A 2W9BB 1WDTA 2ASJA 1TV6B 5C2CA 1IR0A 3M9NB 1QUPA 2VPWB 4R25A 1KEKA 3MOJB 3NS5A 2N3LA 2YWWA 1B0PA 5HQ8A 3DXBA 3QNWB 3LP1A 1YQHA 4LBPA 5KFPA 3DU5A 2WHOA 3C15A 1K8AT 3U1NA 2RUGA 2Y9HA 1PAUB 1BGXT 1P9YA 2QEXS 4J9SA 2J6UA 2VB6A 3JS9A 3VGTA 3QT7A 3V81A 2DIVA 4NLSA 3IXQA 4J9OA 2EFVA 3HHLB 2HHSA 3RBXA 1SI9A 3FEXB 2YX7A 3NGUA 4EU0A 1Q53A 5C7PA 2UU9J 3EPIA 4WTYA 2G2YA 3KLIB 4DBQA 1S97A 2OPSB 1F9HA 4LF5F 4ECUA 3TO8A 1PYSB 4PR6A 2O01C 1RABB 4DV0J 1GQEA 2CNNB 4AL6A 1HW9A 4ZJOA 5KFJA 4JI6J 3OVAA 2ILZA 1N0VC 3D54A 4FVCA 2AYBA 2MJNA 2W24A 3N5FA 3VTIA 2JHEA 5DDRC 1EP4B 4AXIA 1YG0A 2BVZA 4U7CA 1VI7A 4LVNP 4KHPF 3TP2A 3TJAA 2HHWA 3OR2A 2HAIA 3OQ2A 1HFEL 4Y2KA 1TTHB 3M32A 3FNNA 3OL9A 1M1HA 1M0SA 3FRZA 4OLOA 3QT5A 5IV3A 1XEZA 1C1CB 5J2QB 2G2ZA 4JI4J 5HAOA 1ZA2B 2VONA 2GQQA 1E6YB 3PXGa 2L08A 2BACA 3PCOB 5A2QY 2BE9B 4QR1A 2ZH5A 1SVDA 2WB1D 1SIZA 3NEKA 2R8JA 1C0UA 2LXUA 2C42A 4CLTA 1JKHA 4DR4J 4LF8F 4DR6J 1VK8A 3BYRA 3MM6B 1JNZB 2HHUA 1CSJA 3K57A 1V3RA 5D4OA 1SXLA 1ICEB 1RI7A 4K2XA 1IM4A 3HULA 2FYXA 5IWAJ 4P73A 3EPGA 1ZPWX 4YOEA 2XSJB 1L3VA 5E3AA 2A10A 2CUYA 1EARA 4O44A 2HWIA 4K4SA 3RUBL 2QMXA 1H2VZ 1RACB 1R6VA 3J7AN 4O4RA 4G3IA 3HSZA 3RBDA 2GQ2A 4JI2F 2JX2A 1G4CA 3MURP 2Z56B 3DN9A 2E1CA 1T7PA 1Y5LB 4GRSA 4C0HA 1PBUA 3JSMA 5A8RA 2DGXA 1U2FA 2ZHAA 1RT7B 3OR1A 3NNHA 3HVTA 2C2OB 1I3OB 2GA7A 2M70A 1C0TA 4TNOA 3UNYA 1YKWA 1LK5A 2QE5A 4X4PA 2MQNA 1TKTA 5KT6A 2IY5B 3LANA 1UKUA 3V2UC 4DV3F 4WK1A 3KMQA 2I9SA 3AT1B 1V9OA 2ZBIA 4IR1A 1ITPA 1HBMA 1VQ6S 1HYSB 3PVXA 4K4VA 3K5OA 4UZCA 4PKDB 4CT8A 4RW7B 3Q83A 4HT5A 2IRXA 1RADB 1SQEA 1HI0P 2RH3A 2QO3A 4NA1A 3V6HA 4WIIA 1X31C 2LP4A 4HI2A 1NDLA 2QA1A 2HFNA 4ZS6A 5HMZA 5LMUF 2H5JB 5E3PA 2FLNA 5AXKA 3S1TA 1XN9A 5GMEA 2GAHC 2MHEA 2H54B 2OPRB 4B3SF 1RWOB 3HT0A 4ZLJA 1Y3JA 2BBEA 1VBYA 3ZZOA 2G0CA 4ZMMA 2QJ3A 4DEZA 3AXKA 3TX8A 1M5HA 1RT3B 1OSDA 3D67A 3DRSA 2CJKA 5HLFA 2IYGA 1S6PB 1M5OC 1G6BA 1X4HA 1FVQA 4IFVA 4RKUC 3THTA 2IDEA 5E41A 3H2LA 2NSBA 2C3MA 3R5JB 3DRPA 3A3OB 1H3DA 2FUG9 2LU2A 3F73A 5T41A 3KNAA 4Z7CA 1JLFA 3V6DB 3KJFB 1VGYA 1PJ7A 3C6UA 1S0VA 4RNNA 2MY8A 1UPMB 2A2CA 4HL9A 2AGQA 4YN3B 5HQMA 3OL6A 3SMZA 3KG0A 1ZBTA 4X4UA 3T3FA 4CLUA 3G8QA 2L41A 1MU2B 3HDSA 4X2BA 4ANCA 3OJUA 1S1UB 2ZVSA 4DPUA 4LF4J 2RRNA 1DQAA 4DSFA 3PO4A 3PHTA 2JWNA 1NJIT 4K4WA 1BQXA 3TEGA 3ILJA 2GIRA 3ZFVA 4QPTA 2UUWA 3PX0A 5H1SV 4QW9A 1VLOA 4EEYA 5CYQB 4LIWA 3BB5A 4KSEB 2AEJA 1RA7A 3T9NA 4Q0BA 1KP6A 1WTBA 2FVSA 2HQCA 4O0NA 2JEIA 3KK1B 2PMZD 4DZDA 4ES2A 1UL3A 4C11A 1U0SA 4DCOB 4CNZA 4CRJA 5A6PA 2R7TA 3OUYB 3CJ4A 3OFEA 4HH1A 2QL9B 2IDLA 2LDIA 4LMZA 3ZZ0A 1ROFA 4JI7F 4OZ2A 4F2RA 5JXSA 1VOMA 3AJ2A 3QJJA 4X66J 1NSPA 1YJVA 2UZAA 2DHHA 3WBZA 4EK2A 4DLGA 4DR4F 2Q6BA 4DR6F 2AYMA 1Q8LA 2ZOGA 1WORA 1FHTA 1FRJA 2ZH7A 1Z4UA 4V19J 1QAYA 2XBPA 1YK9A 1FDDA 2IM2A 1LEOA 5DZ6A 4NYOA 4YUDA 1NHKL 5E3RA 4IG0A 4U7UD 4RWXA 5E3CA 3G82A 2X7IA 1SJRA 1YBTA 1YJTA 1VYAA 4WFXA 3QGIA 2L3MA 2E5GA 4NLUA 2HNDA 2WOMB 1X9WA 1VQLS 4FXDA 3DKDA 3CWJA 1XNRJ 3UDVA 2GJIA 4HVZA 2B5JA 5KFKA 3CJRA 2ZITA 4OZ1A 1WHWA 5DGBA 3T41A 1FKPB 2W2PP 3HJFA 4FPRA 2UXBF 2HHPA 5F0WA 4NCBA 3HVWA 2B51A 2YBVA 3CMAS 4GKJJ 5C25A 1XMBA 2GZOA 3CDWA 1OY8A 2HZAA 3BJYA 1YJUA 2VIHA 2KJVA 4P52A 2F5GA 1JB0C 2YTCA 3ITHA 1RTIB 4C8OA 3B54A 3SI8A 3QIPA 2YNIA 4LRBA 3PJ9A 1S48A 3UN2A 1RAEB 4DSEA 3MEEA 3ZZYA 2YWKA 2DRBA 2XYPB 4QR2A 1T9UA 4O3OA 1KHVA 4MKYA 4NLPA 2X1AA 2AX0A 1B4SA 1G3OA 2NXNA 2WVFA 4Q7AA 1ZAWA 4RL1A 3K5PA 2A18A 4A8SA 1MG7A 1RA6A 2HLUA 1LOUA 4QR0A 4ECYA 4S0MA 1RWVB 2J0WA 3CCES 3IC1A 2XS2A 1NU4A 4ECTA 2C3YA 3I0SA 1FRKA 5KFAA 4U95A 2Q43A 3TI0A 4DPXA 3KYLA 1R0CB 2E9TA 3NGTA 3O44A 1UW4A 2P9EA 1OSCA 4C8ZA 4FYXB 1IUJA 3SDEB 2FVCA 4ED8A 1O5JA 2IMWP 4HR2A 4QBUA 5LXRA 4TU9A 4ED7A 5BYSA 3M6XA 3J7Z5 1UMJA 2JEJA 4MKVA 3QSYB 5HROB 5ETRA 1J5OA 1VRTB 1Y3KA 1U49A 3IP0A 3D5MA 1U6ZA 4DZ6A 1MN9A 3HLUA 4EI2A 5GAHI 1UVIA 2EC0A 4UOHA 3TOQA 3RBEA 4B3OA 3HHLD 1NUEA 5EWEA 2BJ1A 2MPUA 4AQYJ 6FDRA 1YLXA 1MNEA 5I42A 3ETMA 3NOCA 2H3EB 1NK4A 5AE2A 1S0OA 1I1GA 1FRHA 2J5AA 1MLAA 4M5MA 1AZSB 2PSZA 5GVQA 4WFBQ 2H5EA 4QJVA 3C14B 4DCPB 2SXLA 1NEEA 2QC3A 2KU7A 4CH7A 2XY5A 4WKRA 3Q8UA 3UCZP 4UF4A 2GIFA 2I0XA 1QAXA 2DGOA 5K14A 2JDJA 2V8VA 4LF4F 1VQYA 3PFEA 3M8QB 1RHKB 5JJBA 3G87A 4TY8B 1G2EA 3MEGB 3JSRA 3KLFB 2EBGA 4I6AA 3ZTRA 4LRDA 2FJXA 2HQFA 2ZUGA 2RVJA 4F7VA 5KFZA 3LWLA 2Q6CA 3MF5A 4DS5A 2H48B 2L48A 2HHHF 2CYYA 4PQUB 4WWSA 4PWDB 5CXTA 2AQ4A 1WWHA 2XGQA 4GC6A 4DR1J 2MKCA 3PYEA 3K8VA 4DSLA 1X5PA 2FJDB 1N56A 3O1LA 1FFSB 3M8PB 1Q16B 5AT1B 4CYUB 1ZPVA 4QWDA 3L7UA 1RLDA 4X66F 1B70B 2OO4A 3RYLA 3R27A 1VQ5S 3LOUA 4EO8A 2ZZNA 4ETXA 2D3UA 1TQLA 1S0MA 3BGOP 3HPOA 4Y2CA 3LA0A 5L1IA 3MMBA 2KRBA 1JLAA 2WB4A 4DV5J 1WF1A 5L1JA 1J5EJ 1KQFB 5SUHA 3IRWP 1QVFR 1O0PA 4YB7A 4NLDA 1WEYA 2NQPA 3OTBA 1S57A 2D9OA 1SJ4P 3T1YJ 5B0CA 4RNMA 1R27B 2CPIA 3DLGA 4OYPA 5IT9U 3T1AA 1HBNA 4DSKA 1OMSA 2FC9A 3C19A 2D3OR 5D0RA 2IBKA 5THWA 3FUYA 3MWBA 2B7CB 1RHMB 2A3JA 1D1UA 3CGIA 2CAJA 3LP1B 4CH0S 2E7XA 4OJHA 3C15B 4K50A 4LVOP 2NXCA 5LJ3Y 1OQ3A 1UJ5A 1TKXB 2OPQB 4F4YA 1HNIA 3JAMY 1NNDA 3NS7B 1VIOA 3MR2A 1S7HA 3V81B 1LFWA 4K5SA 1YRUA 2F3JA 1C4AA 1H74A 2JNJA 3MECA 4GKJF 3AA8A 1UEKA 4RLEA 3FMWA 2OAUA 5ETPA 3QZ8A 2UXCJ 4WYWA 2EWHA 2OTLS 1AB8A 2DRAA 2E1RA 3ELHA 1SL0A 3DRXA 2GVZA 3DU6A 3BDPA 4LJMA 2CQDA 3LPYA 3UWTA 2MQPA 4KV8A 4USHA 2R7SA 4NA2A 4HH0A 1S59A 4X4RA 7FDRA 4NPOA 2XCPA 1B64A 3WDOA 4PWUA 2MGZA 3KLGA 1H72C 5KG7A 4JI1J 2VASA 4A48A 1A0OB 4IFYB 2IFXA 5F8IA 3D3BJ 2KDOA 3VGSA 3HHNB 2JC0A 2H9ZA 5H9EK 3UE2A 4DL5A 3M32B 3DLEA 4RBTA 3GJRB 1RBAA 4DUYJ 2G13A 2MXYA 2QYGA 4WU3A 3T1HJ 4F02A 2RDDA 4I56A 3G6XA 4ZK7M 3EVOA 1EETA 2VPYB 2C28A 2KG0A 5FJ4A 1B0VA 1C0UB 2YY3A 4PEOA 4MH8A 3MD3A 3S8SA 1JKHB 2F8HA 2IYIA 4NASA 1FX4A 3PW5A 2Z2YB 4B08A 3GIKA 1FDNA 2R7XA 4LFCJ 4IDKA 4X4NA 4N7TA 2RQMA 2LDYA 4KO0A 4QWAA 2IJFA 2VV5A 3NY0A 1HHQA 4O0IA 1XMOJ 4DR3J 1IKYB 1T3NA 4WE1A 5DRKA 2WONB 5HBMA 2K06A 5IT4A 1NDCA 4GO5X 5DQGA 4DX7A 2ZC3A 3MPWA 1HLWA 3CVKA 3D1OA 3KG4A 3CD7A 4WJBA 5DLGA 1S7IA 4Y3CA 3JSMB 4DR2F 1S1XA 2D3ZA 4H54A 1OJ4A 4ELUA 2VA2A 1LWXA 3OR1B 3HVTB 2CZ9A 4LFBJ 1QDUB 1IXKA 1ZM4A 5KFHA 1SB6A 1C0TB 1CQNA 2ZZTA 3B4MA 3C66A 3SFUA 2XMWA 3MUMP 2QGFB 3MXHP 4FYWB 4GKKJ 5ETLA 1TKTB 3DC2A 2I2YA 5BYRA 3I56S 3CJ8A 4XDCA 3QAEA 3BPDA 2KN4A 1NHVA 2QRRA 2WBMA 1MN7A 3VZHA 3GIIA 3H2UB 4URQU 4G1QA 2B4OA 4Z7YA 2RDIA 1HBMB 5K8NA 4B3TJ 3KWMA 4W92B 1T94A 3VVUA 3ISZA 1VRUA 1PJ5A 1AYEA 1IKWB 1RDRA 1CJVA 3W9HA 2M88A 4MJKA 5CA5A 2OFGX 1KR4A 1QTNB 5JUMA 1PBAA 2HBRB 3U02A 3GLJA 2KT5A 4Z2XA 4QZVB 2F4FA 3W2VA 1HNZF 1HWUA 3SV3A 2FJEB 3C16A 2XO7A 1Q7LB 1IKVA 1WOPA 1RSCA 1J5EF 1BLUA 2Q66A 1JIHA 3PR5B 5A76A 4U96A 4UQGA 2VZ9A 2YKOA 2PEBA 1YJRA 1SUQB 1KFDA 1WEZA 2J9DE 4RNHA 3DRSB 3TUZC 1X9SA 3CC4S 4RW9A 2LQ9A 1FNMA 2KI2A 2EW9A 4G1PA 4IFVB 1B7YB 2WRMA 5GADI 1FRIA 1LW2A 3DGPB 2W9CA 5J1NA 2FZGB 3DRPB 1S72S 3M6VA 5HJYA 1VDHA 2YNFA 4MK9A 3ET6A 1N5SA 2V68A 2V94A 4DFKA 4R0JA 1JLFB 2CJAA 2PGCA 1REVA 2BM0A 1Y7PA 3TAMA 2CFXA 3SBMA 3C6UB 4ECVA 4Y34A 1KTVA 5GAHU 2YKMA 3EMTA 3BEGB 1T9WA 3PTWA 1HI1A 1FXRA 2ZM6J 3OFHA 1RP5A 5ITHA 3BYPA 3M8WA 3ZTSA 1UW9A 4XAKA 2X51A 2R42A 2HFOA 5L9XA 3KNGA 4OL8A 1NK5A 2Z2LA 1RT2B 1R8AA 4CLYA 3BR9A 1TZ0A 5HVFA 4IH6A 2DXFA 3SV4A 2DY1A 3RRKA 1Q5YA 2LKZA 2O3DA 4JI1F 1K0TA 1RKIA 2VL1A 2K3IA 1QY7A 3OSNA 4C11B 5IOLA 2F9DA 4JV0A 4NXNF 2R2SA 4RPFA 2XLJA 1KVKA 4DUYF 2W2OP 5KFFA 4CZCA 3DDKA 1DBDA 1C4CA 4JP8A 3DDIA 5A8KA 1R8CA 2ATCB 2KFNA 2GX8A 4USKA 1F2HA 3U7JA 5I4MA 1IBKJ 1FVSA 1LK7A 2OD4A 5EUHA 4RUBA 2OUGA 1XR7A 3KG1A 3V5RA 5DLFA 1WI8A 3G96A 2BW7A 3SQGA 5EHHA 3PO5A 2KHCA 3G9CA 5LM7E 2AJ4A 2FLPA 2ZVIA 1XMOF 4ZLNA 5J2MA 1L3KA 1E6VA 5F41A 4P7VA 3DLJA 2YWFA 4IG0B 1WTFA 3KK2A 4JI5F 3G82B 2RDJA 2DXDA 2AYGA 4KT0C 2CNLB 4FF2A 3GYNA 3ZTQA 2XQCA 2QFJA 1B3TA 3U1MA 1NLKL 2CWKA 1TUWA 4LR8A 4PXDA 2J8SA 4DMZA 1RWUA 2YH0A 5B0AA 2WVCA 3T9ZA 1IR1A 2DO4A 3T5HA 2KXHA 3KFWX 1X8DA 2A6OA 3S6EA 4GKKF 3EVMA 2NYIA 3KHLA 1PO6A 1R31A 3GYXB 2IMOA 4YHHJ 1P9QC 2QMUB 3M1VA 4JV2A 2OLWA 2XMVA 2G1DA 4CLPA 4MKAA 2R7RA 3R7NB 4A8QA 1W7WA 3PEJA 3SSRA 2DNKA 2RKIA 2XM3A 4V1Ak 3RRGA 3ITHB 2PI4A 4JI3J 2O66A 2QZ8A 2YNIB 4B3TF 3UD3P 2MKJA 2AZ3A 2D1CA 3MEEB 2DXEA 3NCPA 1JJHA 1P27B 3R2DJ 3MPVA 4G65A 4WXWA 1HWJA 2ZH4A 1NKCA 5T7LA 4DV7F 3IGNA 3RAXA 4M94A 4WIQA 3TARA 3OJSA 5CHCB 4X65J 2P6TA 3R1HA 5E2QA 3HSJA 3OTCA 2V6AA 3BKFA 4A8YA 2EC2A 3DOMB 3OFGA 2HEKA 4Y65A 4ALZA 3I9ZA 1JWWA 2IM1A 3I0SB 1NJZA 4LF7F 1VCTA 3QRPA 4URGA 1RWWB 1K0VA 3FKBA 3BREA 3LWMA 2CQIA 2GJFA 2C22A 3CO0P 2UUCF 4DU8A 2A1BA 4JV5J 1U0HA 1AW0A 1J5OB 2MTLA 4P9SA 4K4ZA 5CZXA 2FJWA 2MDAA 2FHJA 2VA3A 4DR5J 2DCLA 4C9DA 1NDPA 3BZQA 3SXLA 4B3OB 3JSBA 1VK3A 1T05A 4C98A 2QIFA 1URNA 4D3GA 2ROGA 2OTJS 5I42B 1T9XA 3BH6B 3SZ2A 1IBLF 1S5ZA 2J9DA 1TR0A 3CJKA 2V8GA 3FVYA 3CCWA 2F1FA 4ZLPA 4F3OA 4QIFA 2O5DA 3QGHA 2RF2B 3M2RA 1ZYQA 3PKYA 3H8YA 1RAIB 2B4PA 2IIHA 3PM9A 5HJXA 4FKXA 3IG1A 2IJNA 2CWXA 2KVIA 4EFAC 1HNVA 1WKKA 2HAFA 1S9EA 5K14B 2I5JA 4J9KA 2ZHOA 3M8ZA 1O6XA 4XIUA 4CLSA 2OEKA 1XWLA 4MIWA 4DI6A 1NK6A 2L9WA 3RB4A 2DY9A 1CULA 4XO0A 1A7GE 3AA9A 3EGZA 4WYLA 3Q8SB 5LMNF 2DPJA 4P71A 1EKSA 4ZLLA 3M8YA 1TK0A 5LT5A 3NRBA 3ZZTA 1LW0A 2DR9A 4IRKA 2MJUA 5LL6d 2O67A 3MCMA 1WSVA 2HNZA 3IN5A 3VAKA 1Y0HA 3PIOQ 2YPYA 2IA0A 4FBUA 3MM5B 1BD6A 1UJ6A 1OS5A 1RISA 3VAHA 1ULRA 2OIHA 1GMUA 3IFEA 2VG6A 4PWWA 2N4CA 1IBKF 5BR8J 3HO1A 1N5QA 1MWZA 1D9AA 2WAQD 4LF6F 1N36F 3AJDA 1NKBA 4Y6IA 3MMBB 3MTKA 3R5AA 2HMIB 1KTQA 1S4FA 3GCXP 3BKUA 5KAKA 3D2WA 1LWEA 2J76E 4F67A 2AGOA 2QSWA 2JEFA 3JYTB 3OVBA 1JMTA 4I64A 5HO4A 2MKSA 3KHHA 5ETTA 3Q8PB 1RE1B 3CDEA 3CJ5A 4U8YA 3DLGB 2DNOA 2W8KA 1HBNB 2B9WA 4CIOA 1U1NA 1PGZA 3BDEA 4BC9A 3GPAA 3ZNUA 3THVA 1N5YA 3NOGA 1GMWA 1S49A 1NB2A 3QFWA 2IVMA 4C7QA 1UVJA 3MEKA 4F4XA 1KC8T 3IM9A 2DNRA 2BA9A 1HNIB 4F36A 3CULA 4KYZA 1D9DA 1F2GA 3AJ1A 4USIA 3Q8RB 1F5CA 2F4VJ 4ANEA 4YHHF 4LR7A 4TN2A 1AT1B 3MECB 5GADU 3W3SA 3R3TA 3TRGA 2G0JA 1UZDA 5KFIA 2E5LJ 1QVGR 4B9MA 4NCGB 3EE3A 2UXDJ 1RWNB 5J1PA 4UOFA 3THPA 4CM2A 3I96A 5KFVA 2DTJA 2YXLA 1VC6A 3A8JA 4DHVA 3MM8A 3C3LA 2GC8A 2GVZB 4CTAA 1XR6A 2RT3A 1FXLA 2KKHA 2Z57B 5ETMA 1GEHA 1UJ4A 1RCXB 2AMCB 4DG1B 1F0XA 1BHNA 5KG3A 2PIIA 3ZXWA 5KFCA 2MGZB 3KLGB 4X65F 2VKZG 5GMDA 5KFQA 3W5YA 2DGTA 3FFIA 2R9LA 4FXVA 3GR0A 4C97A 2HGLA 3D0HE 1FDBA 3GQCA 4ZITA 2RQCA 3DLEB 3G71S 5ETQA 4MIAA 1WF2A 4QYZJ 1X5SA 5F8GA 2GCFA 3N0VA 3A8IA 4A8OA 1MROA 2VBWA 1R89A 3HP6A 4IRCA 2EI5A 3IR6B 4JV5F 2CQHA 5M2PA 2HKEA 1CQMA 1CC7A 5I3UB 2QMWA 1LWFA 4EYHB 2GNKA 3AOCA 3GSDA 4CQ1A 4TVAB 4IDKB 4IYQA 4KO0B 4KB7A 4L75A 1KLMA 3RAQA 3N4WA 3N01A 4F0HA 3KUGA 3K7RA 5HBMB 2Q3PA 2XMUA 2Z58B 1VQSA 2CJ9A 3NCRA 2HZCA 4X4TA 4WU2A 4DL4A 5ETNA 4ZVTB 2DYAA 2OSRA 3WZ0A 4O4GA 1S1XB 1OO0B 3I0RB 3NNCA 5U47A 4UT4A 1LWCA 4J9RA 3ILLA 4LUBA 2J0XA 5CYMA 1I5OB 2VOOA 3PIPQ 4OHZA 1PYTA 2DGUA 4ZIVA 2LEBA 4F0MA 1R7IA 5HVGA 1VQ8S 1W2IA 3M9MB 2J9CA 2JSXA 5IM0B 2VC1A 1KBRA 3QMQA 3ILOA 4DJBA 3GIJA 3P49B 2APOA 1RWKB 4O3SA 1Q8IA 1RTZA 2DH7A 1RGVA 2B7BB 5B0DA 3H98A 1D09B 3N6LA 4JI0F 2DHGA 1IQZA 4TQRA 3DMJB 3BBBA 3VQSA 5D0EA 3PY8A 4L3NA 1D9FA 3T6BA 4BBYA 1HBOA 4PYDA 5IC6B 3K59A 2VU5A 1HI8A 2ABYA 2DH9A 3CNQP 4FBTA 1CVJA 2HBYB 1S10A 1JX4A 2MQOA 5KFLA 3ISNC 3MR6A 3I5AA 4DN0A 4KH1B 3UN3A 2F40A 2DITA 4DV1J 4OI2A 3UQSA 3C16B 4Q2LA 4TYAA 2CPHA 3OBIA 4GVLA 3TUIC 1IKVB 1FD2A 2C2ZB 2FLOA 1KQKA 4B9UA 4MK7A 2UVWA 4ZVGA 4ECRA 2MY7A 3BBCA 2YQ0A 4DPOA 1NDKA 1JJ4A 3VALA 2FHMA 2ADBA 1RYRA 5G0RB 2ZKTA 2N7YA 1BMQB 4RU9A 2OH2A 1HR0J 4RW9B 3CDAA 3GCWP 2XEXA 4X64J 1VBXA 3AODA 4OYMA 1QAJA 3PEHA 4LF5J 3G6YA 1LW2B 2POKA 2RHSB 1AA1B 2YNFB 4JV1A 4OYIA 2DB1A 3ET6B 2ZEJA 1M5VC 3CCTA 3IRXA 4DSIA 1HQ2A 3TAMB 2CJXB 2HWHA 4K5RA 3TQEA 1Q81T 4WBFA 1VQ9S 3QIDA 4CLFA 3D7SB 4P2SA 2MLXA 3W65A 4NMXA 2HRTA 3CC7S 4K2JA 3HXMA 2VH7A 1Y11A 1GXTA 1FKAF 5CZVA 4QCLA 4PCQA 2NXEA 3FCVA 1ACMB 1RK8A 4DOZA 2XZWA 2BJ8A 4ZCKA 1FXDA 2PT0A 3RB3A 2ALZA 2ZWOA 5C42B 2MQQA 1XMQF 2WVEA 2F7VA 3TA0A 2E1PA 2G4BA 2V9KA 4ZCMA 1ZAVA 2ACMA 3F56A 2V69A 4FF4A 3EWGA 2PI5A 3NMAA 2CQ1A 2HVZA 3W5XA 3H2VE 2LQ8A 3KHGA 5KT4A 1WC6A 3Q2SC 1NPKA 2YWGA 4YB5A 1WC1A 2I6WA 4CWBA 5M2UA 1F5AA 1JLCB 4QOTA 5HL7Q 1V5IB 3OXGA 2B8QA 1YRTA 1UEUA 2XS7A 1SL1A 2PDAA 1U24A 5A8KB 5KT3A 4YY3F 2DPIA 4FS2A 4JI2J 5L1LA 4BWMA 2FPHX 2JVOA 3NGKA 2JL9A 1N52B 1JQGA 5HQLA 3NG8A 1XQIA 3QPIA 2LEPA 4ZPBA 4KIAA 5D0GA 3SQGB 2EFOA 4MYUA 4QWEA 2XYGB 2R7WA 3IBFB 5KOWA 4DL2A 1U45A 1PILA 2ASDA 2PFDA 5J2MB 1E6VB 5EWGA 4MFBA 2KT3A 3CCRS 1S9FA 2HS4A 2R7OA 3KK2B 3W63A 2Z2ZA 3H42A 2E9RX 3SCKE 2VKRA 3DYAA 1EB0A 4NRTA 4RNOA 3BSCA 1JXVA 4OHWA 1RAJA 4YB6A 4RJVA 3KUHA 5F0UA 2VHGA 1VQ7S 3PKMA 2HHXA 4PAAA 4CO0A 2RRBA 3LUYA 3SFGA 3IS9B 2YKPA 2BJ3A 1S4EA 2MZ1A 2MZSA 2CADA 3BQ1A 1FK9A 3ETOA 3M1VB 3X1LB 3VAFA 3AHPA 1X5OA 1VIXA 3BGFA 1J2VA 1TFYA 2FVPA 5LMUJ 2CQGA 3W60A 4N8NA 2RKIB 4DR7J 3EICA 3KLHA 3TQ1A 2IAJA 2PFFB 1HQUA 1TVRA 2OEMA 5KFUA 3UR0A 4L6V3 3A3NB 5F8JA 4BC7A 1GTEA 2HRYA 2HHTA 5EX0A 2MZTA 3MPDA 4C8YA 5T7LB 1TAUA 4LRFA 3W1YC 5KFRA 3OPKA 3R97A 3UI3A 1FNXH 4C8NA 4PG5A 3H0PA 2E66A 2RS2A 1TUVA 4DV1F 2ZBCA 4ZJQA 3TA1A 2IRUA 2MZQA 4KGMA 4IOAQ 2KZZA 3HD1A 1DTQB 4ID5A 3OVSA 3JAMU 4I1TA 1H7WA 2RU3A 4OJ1A 2DGQA 3R6GB 4A8FA 1EQMA 2Y3YA 1DQ9A 3GE9A 5D78A 5MLCV 4OYAA 3DGVA 2LA6A 3D9BA 4GC7A 5A8WA 2FQQB 2ZFHA 4NLGA 1TL3B 1YRXA 4M1KA 4OHVA 4R0EA 1T0TV 1VQOS 2MKIA 4F3QA 1HR0F 4X64F 2PO4A 5A6WA 4ZA1A 1ZETA 1WDDA 2U1AA 3G6VA 4DUZF 8ATCB 2HFSA 1IVZA 3R5CA 2XS5A 1L3TA 1WG5A 3POTB 4OQJA 2BJ9A 3ILIA 1UVNA 3K8WA 2P5VA 1T05B 3V6KA 4HTJA 1YBUA 3UW1A 3AQPA 1OWXA 3T19A 3CJKB 2W1BA 2QA2A 2VBYA 2K2PA 2FVQA 2M52A 2W9AA 3M2RB 5LXYA 5KG4A 1PYOB 4DN9A 2AHOB 1U1QA 1SKWA 4LQ9A 1Z1ZA 5E33A 3H5YA 4LFAF 4PZVA 1S9EB 1FESA 2AYEA 3KLIA 4QIVA 4JI7J 2ZDOA 2R7QA 3HK2A 1GK8A 2DR5A 2OELA 4KRWA 1NJYA 4CI0B 1TL7B 8RUCA
chains in the Genus database with same CATH topology
3B4MA 3H40A 3C66A 1RTJA 3SFUA 3M6WA 2FY1A 4X4VA 2XMWA 3MUMP 2GIQA 1JLQA 3V4IB 4AFFA 4RBVA 2KO1A 3MXHP 2BANA 4NLQA 1VQ4S 3B4DA 1N5TA 4OZ5A 3LH2S 1TKTB 3DC2A 4C8LA 2I2YA 2LU1A 5BYRA 3I56S 3IRXB 3DOMA 4IR9A 1P1LA 4XDCA 4B02A 1LW0B 4NLOA 4IQXA 2IRYA 4DS4A 1FO1A 4UY8T 3QAEA 2DNQA 2ZHBA 3D1HA 2KG1A 4DL0C 4DL6A 3O3LA 4MAKA 2J7UA 2KN4A 2MQLA 3CJ3A 1NHVA 5GAGU 2MZJA 2QRRA 4I2QB 1R43A 2WBMA 5AXNA 3VZHA 3R5BA 4I68A 4RUCA 3GIIA 3IAS9 2EFGA 3H2UB 4URQU 2BE2B 4G1QA 2K7JA 2B4OA 3MEDB 4BWJA 2EKYA 4XDDA 5E5NA 3X3UA 2PA3A 2GGPA 2P6SA 3OLAA 2R8KA 2RDIA 1HBMB 5K8NA 3VF0B 5ADZA 1TKDA 2DT9A 3KWMA 2V0NA 3LALA 2ZNYA 2J7KA 3OTEA 4IG3A 4KC5A 1MSWD 1C1CA 3OW2R 4W92B 3PX4A 1U47A 4IO1A 4N8OA 1HQEB 1MW7A 1T94A 3ISZA 3BO2A 1VMBA 1KFSA 1VRUA 2XSFA 1IKWB 4TXSA 1KVIA 5BJRA 1E6YA 2XMKA 4ED0A 1RDRA 5DM7Q 1RTIA 1YJ9S 3B78A 3PV8A 2CG4A 5IS2A 3FZ2A 2CZVC 2FHOB 1DHMA 2RNEA 2M88A 4OLPA 2NSCA 1N88A 1HWKA 4KFBB 4MJKA 5CA5A 2YQ3A 3HI9A 2OFGX 2HPUA 2PN6A 2BOPA 2HLTA 2I38A 4K59A 5KG2A 4ILLA 1KR4A 5JUMA 3DLLQ 4F3MA 3T6JA 3U02A 5D4PA 5KFOA 4E8UA 4MYTA 3CIMA 2W4DA 2HGMA 2KT5A 4Z2XA 3UPFA 4QZVB 1KNZA 5B0EA 3M8SA 1O51A 1FJ7A 3V6JA 4AXJA 3W2VA 1HNZF 3PZPA 2KYZA 5KFGA 1LWEB 1FJGF 4ZPAA 2BYCA 1YSJA 2F4VF 1HWUA 3Q22A 4J9MA 3SV3A 2FJEB 1NK8A 1JLGB 3PJWA 2KYXA 3GV7B 2NXUA 3T5JA 2ZD1B 2MB0B 3HZGA 3O5TB 4OMFG 2XO7A 4RX6A 4CT9A 4ILMA 1Q7LB 1X4CA 2KJWA 2Z8QA 5FDLA 2E5LF 1IKVA 4Q5VA 2ZJRQ 1RKJA 4IRDA 2HFZA 4CH1A 4RBUA 4NLXA 4Z37A 2CQBA 1J5EF 1BLUA 3TR5A 2FDNA 2IC3B 4B9TA 2RRAA 2J0SD 2Q66A 2UXDF 2VBZA 1JIHA 3PR5B 4NLTA 4FYDA 2OPPB 1BQNB 1QE1A 2RF2A 2PMHA 4Y0FA 2FHJD 4UQGA 2VZ9A 3C8YA 1X4EA 3P96A 4NZ7A 2YKOA 4QIEA 2R2TA 1N5YB 1S1VB 1H2TZ 4KKOA 3W2WA 3L3CA 5D6GA 4OI1A 1RQ0A 5LJ5Y 2K3KA 3SDEA 1C1BA 3O6QA 5HI7A 1YJRA 1LFPA 5HN0A 4DL3A 1SUQB 1KFDA 2MZRA 2P9CA 3MMAA 3PW4A 1WEZA 2YX1A 2J9DE 4RNHA 1HWLA 2DNNA 3DRSB 2W7AA 4I6WA 4C3KA 4DF4A 2BQ3A 3SSQA 3TUZC 4U7UK 3ZZPA 1X9SA 1SKSA 1T03A 3DLKA 3CC4S 4RW9A 2LQ9A 2ZH9A 5L38A 1UEVA 4F4KA 4U9RA 3DFEA 3EX7B 3TVZA 3EXCX 3AB4B 3K0JA 1FNMA 2KI2A 1S1WA 1NJXA 5B08A 1RT7A 1VQPS 3JSYA 3VR1A 1HWIA 1VRTA 3J7ZT 3VQTA 4B9LA 3MMCA 4PPDA 5J2NB 2K8GA 2EW9A 2HS3A 4G1PA 4IFVB 4ES3A 2WRMA 4LF9F 1Z2ZA 3QYYA 2B3TB 4ED1A 2P9GA 1XK8A 5GADI 2XC9A 4IOCQ 2HIQA 1FRIA 2ZKUA 1LW2A 4M5DB 7FD1A 1UP1A 2XI2A 2LA4A 2W9CA 4YP3A 5J1NA 4ED6A 1WD6A 4DQPA 3DRPB 2F8MA 1S72S 1P1TA 3M6VA 2DO0A 4F4WA 2Q79A 2BQRA 4DQIA 2HGNA 2YNFA 3BGLA 4MK9A 2XWXA 3U1LA 3PW0A 2R8GA 2W8LA 1N5SA 2RMLA 2CPFA 1IKXA 2XNQA 3DOKA 1JLAB 5J1EA 4C3MA 2V94A 4DFKA 2E44A 1GH8A 3GV8B 4IKAA 4ECSA 4C8MA 2AW0A 2DISA 4R0JA 1JLFB 2CJAA 4ICLA 4YR0A 4YFUA 3T5LA 2PGCA 2A2DA 3MI7X 1REVA 1NH8A 2BM0A 3ENQA 3OFFA 1Y7PA 3TAMA 4N76A 2CFXA 4I6YA 3C6UB 4OFZA 4ECVA 4Y34A 1N32F 2V4QA 3KHRA 1KTVA 4DR7F 4OHYA 2MSTA 5GAHU 2YKMA 3BSNA 5L8RC 3LAKA 2DHAA 3BEGB 2Q1LA 4LSLB 4QWCA 3L7OA 1HI1A 1YHQS 1FXRA 2KFZA 2DR7A 3MM8B 4UOCA 5D77A 3MM5A 3OFHA 4XPCA 4R5PB 1RP5A 5ITHA 2DR8A 4CTAB 3C6TA 1YTYA 4YR2A 1JLEA 3FCHA 3Q0AA 3BO3A 4V19X 4ES1A 2DVIA 2I8EA 4CO1A 2NUHA 4OJ3A 2DNHA 1BQMA 4XAKA 2CPZA 2X51A 1HYSA 3SYZA 2HFOA 4WXOA 1S1TB 5L9XA 4DLEA 3PJXA 3KNGA 1H38A 3EUNA 3VWSA 4OL8A 1HHSA 1SH0A 4ED3A 1NK5A 2Z2LA 2NS1B 3EXYA 4YDDB 1RT2B 2UV8A 1RJJA 2AD9A 1RT1A 2EK6A 3CT9A 2VFSA 1R8AA 4PPZA 4P6QA 1GX5A 1WACA 3AH6A 4OZ0A 1T95A 4EBDA 2FHKA 3BR9A 1FT8A 1HMVA 2FVRA 1K1QA 3W7BA 1TZ0A 4Q43A 1N0UA 4EZ6A 1T3OA 3M4XA 4IH6A 4NL5A 2ERRA 3SV4A 4RUHA 5CYJA 3BO4A 3RRKA 3FGVA 1HL6A 2UUBF 4B3MF 2LKZA 1TKZB 3RZAA 2O3DA 2KRRA 3IWNC 3M8QA 4TY9A 1KHWA 1V6HA 2V2KA 2HMIA 3H5SA 3UD4P 4FP9A 1LV5A 4JI1F 1K0TA 5DG9A 3MEGA 1RKIA 3E01B 3G6ES 3WC0A 2VL1A 3KLFA 2V9WA 2M7SA 3BF4A 5IFMA 4C8KA 2K3IA 1U48A 1XNQF 1VJWA 1QY7A 4UQTA 3OSNA 2Z4PA 4JUZA 1X5TA 3ONQA 3JYTA 2B9YA 4I67A 4C11B 4RW8B 2F9DA 2CPEA 4JV0A 4LQ3A 4A46A 2R2SA 4NXNF 4O3RA 2BM1A 1NHUA 5D3GA 3KLHB 2VFVA 1FDAA 1FF2A 3UFCX 1MROB 3IR5B 2IAJB 2XLJA 1S99A 2V5HG 2HG4A 4PQUA 3N9UC 2DIUA 1HQUB 1U4BA 4RU2A 1IQTA 1TVRB 4DUYF 1TAQA 5CCLA 4DQSA 1UA0A 1NJWA 5KFFA 1QJHA 4AL5A 1FD8A 4QWBA 3NBPB 4PG4A 2RSQA 4CZCA 1QSYA 1S77D 1JK9B 3CSKA 1G1XA 2W7PA 4KAIA 3MAQA 1OQ6A 2MSSA 4OX6A 3CE8A 2YKNA 4X62F 1NRKA 2XG8A 4FF3A 1LWFB 3DDKA 1NH7A 1DBDA 2JC1A 1C4CA 1Y00A 1M5PC 5A8KA 2BZ2A 3HM9A 1R8CA 4DX8H 3IA0A 1CC8A 2E7WA 1XNRF 2KFNA 2GX8A 3LP0A 2BUNA 2W4PA 3U7JA 4OX8A 5I4MA 5IXUA 5F9NA 3VAGA 3RB6A 4KV8B 3M8PA 3UDCA 3G8SA 3CCMS 1NKEA 1FVSA 3QLHB 1LK7A 2OD4A 5EUHA 5KFDA 2N7CA 2BABA 3DXSX 5H9FJ 1XR7A 1UWBA 5AE3A 1KLMB 5HMWA 3KG1A 2GO9A 1IJEB 1N6QB 2EFNA 3V5RA 2GW8A 5DLFA 2V8HA 2D9PA 2RS8A 3N6NA 1WI8A 3G96A 1FERA 4DFMA 3KK3B 2VG5A 2ZC4A 4PUOB 3SQGA 1KONA 3CB4A 3N6MA 3K5MA 4F4ZA 3PDNA 3CCZA 5EHHA 2KHCA 3PO5A 4L72B 3CF5Q 5DGAA 4BCAA 1U1MA 3G9CA 1HARA 2VFUA 2ZDPA 4GO7X 2AJ4A 3NKYA 2FLPA 4FXWA 3SEOA 3FJ2A 1XMOF 2J7WA 4NXMF 3GFHA 4FZVA 5J2MA 1L3KA 1E6VA 1FTRA 4WFNQ 2GQCA 2VBXA 3I6PA 5F41A 5DDOC 4P7VA 3DLJA 2AP6A 2YWFA 4IG0B 4OI6A 1WTFA 4NCGA 3O8WA 3KK2A 2ZZMA 4JI5F 3M05A 1Q4RA 2RDJA 4UUXA 5SZTA 5EDWA 2AYGA 4IOBA 4KT0C 1SH2A 1DZ5A 1S76D 2EFPA 5GAEI 2XCAA 3UNGC 1LWCB 1FRXA 4WK3A 4M95A 2W9BB 4FF2A 1FKOB 3GYNA 1H2UX 4I7FB 4ZPVR 2ASJA 3MM9A 4QW8A 4LSNB 5CYMB 4YQWA 2QFJA 1EETB 1TV6B 2AWZA 1IR0A 4EZ9A 3U1MA 2E5HA 4NLVA 2WTFA 3S01A 2WCXA 3M9NB 4NZ6A 1QUPA 2VPWB 3HKZD 4HTIA 3I55S 3DNCA 1TL1B 2O1PA 4R25A 1ZM2A 1KEKA 3MOJB 4PXDA 4DMZA 2LCWA 1MU2A 1RWUA 3NS5A 5F9LA 2N3LA 2YH0A 4A8KA 2DGSA 5B0AA 1S1UA 1Q1KA 3T9ZA 3CDUA 4DG1A 1B0PA 4LT6A 4N5SA 1M90T 2AJ1A 4FF1A 2AF6A 4Q2MA 5HQ8A 2DO4A 3DXBA 4ELVA 3T5HA 1SIWB 1K9MT 2KXHA 2NUUG 3LP1A 3KFWX 1X4GA 1Y5NB 1YQHA 5DM6Q 1X8DA 2LVWA 3BS9A 5KFPA 3KLEA 3DU5A 4WCEQ 1RTHA 2JLFA 2GO8A 2WHOA 3M2UA 3S6EA 3U1NA 1K8AT 4GKKF 2NYIA 2HWTA 4H4OB 2RUGA 2KZMA 2EG1A 2BQUA 2CRLA 3KHLA 1PO6A 5GMKa 4HYKA 1R31A 3DLHA 4R8UA 2MMYA 3GYXB 3IO1A 2E5IA 4RZRA 2IMOA 1BGXT 1P9QC 3RAMA 2QEXS 3M1VA 5CYQA 4J9SA 2YNHA 2J6UA 1N48A 3QWUA 4JV2A 2OLWA 2W25A 2XMVA 2VB6A 2G1DA 1K73T 3I4HX 4MKAA 2XNRA 3V81A 4WE1B 2R7RA 4A8QA 2GJ2A 2XI3A 2DIVA 3NWGA 4NLSA 3SSRA 3PEJA 2CVEA 5KFBA 1ZH5A 2XHWA 3FEYB 4HKQA 3CCSS 3IXQA 1FRLA 2DNKA 2RKIA 2IHR1 4J9OA 2EFVA 1UETA 3HHLB 2HHSA 1S6QB 1SI9A 3ITHB 2UUTA 3RRGA 5E3QA 3FEXB 2PI4A 2LYVA 2O66A 2YX7A 4Q45A 1JLBB 2VQEF 4EU0A 1V3ZA 1HBOB 4ZOSA 2QZ8A 2YNIB 1Q53A 1UVKA 4B3TF 3DHXA 4DV6F 2X1BA 1R0AB 3DRRA 3EZUA 4EUVA 3UD3P 2YH1A 4UW2A 3LF0A 3GV5B 2OP5A 3EPIA 2MKJA 2FTRA 4USJC 4WTYA 2D1CA 3MEEB 3DM2A 2HVHA 3KLIB 4NX9A 4DBQA 1D0EA 3NCPA 1JJHA 4TLRA 1N4LA 2ROEA 1P27B 1S97A 5I3UA 2OPSB 3MPVA 4WXWA 2UVVA 1HWJA 3TNVA 4F25A 4LF5F 2YX4A 2ZH4A 1NKCA 4ECUA 5HP1B 2J8AA 3TO8A 2CPJA 3MHYA 5T7LA 3MTJA 4DV7F 2PEHA 4PR6A 3IGNA 5KG6A 2O01C 3J80Y 3CO9A 2OMLA 3RAXA 4M94A 4DF8A 2VFTA 3FZBA 3TARA 4BDPA 1SV5A 3OJSA 1LKZA 5CHCB 1GQEA 3NAIA 2P6TA 3CCQS 1ZZFA 4AL6A 4NA3A 1VS3A 1HW9A 4HDHA 3RB0A 3R1HA 5E2QA 4C0OC 3OTCA 3GILA 4A8YA 1DTTA 5KFJA 2B6AB 3OFGA 4Y65A 4ALZA 3OVAA 3I9ZA 2ILZA 1DURA 1N0VC 3US5A 3D54A 4TLQA 3CMES 4FVCA 4KHRA 2MJNA 2AYBA 1UVLA 4J9QA 1JWWA 2IM1A 2W24A 3I0SB 4RWWA 3HHDA 3N5FA 3VTIA 1NJZA 4LF7F 2JHEA 5DDRC 4AQYF 1EP4B 4C4WA 4URGA 2Y1RI 3OSPA 4AXIA 2QSFA 1N54B 1YG0A 2BVZA 4B17A 1K0VA 4U7CA 2Y1JA 1Q78A 1VI7A 2V8DA 4G1QB 4LVNP 2ZH8A 4KHPF 1KN6A 3TP2A 1W2BR 2VG7A 2HHWA 3BREA 2HAIA 3OR2A 2PC6A 3LWMA 3OQ2A 1HFEL 2CQIA 4Y2KA 1HBUA 2XB2D 3M32A 3FNNA 3EZ5A 3OL9A 4OLOA 1M0SA 3FRZA 2C22A 1XEZA 1RYSA 2UUCF 1C1CB 5J2QB 2DCUB 2DGVA 3WC2A 2A1BA 2IM3A 3I0RA 1VRUB 1WHVA 2DNPA 2VONA 2BRLA 2GQQA 1AW0A 4RW6A 4KJIA 1KSPA 1E6YB 3PXGa 2L08A 2Z2MA 1SKRA 1J5OB 4TQSA 2E5JA 4K4ZA 2BACA 5A2QY 5CZXA 2FJWA 2MDAA 2EK1A 2NREA 2FHJA 2YWHA 4QR1A 1HPZA 2ZH5A 2WB1D 1SIZA 3E8OA 2R8JA 1C0UA 2LXUA 3HF5A 4PG7A 2C42A 2VA3A 3F44A 1JKHA 4LF8F 1U1OA 2JLEA 1VK8A 2D7SA 3H59A 5IM0A 4ZHRA 4F26A 3UCGA 2DCLA 4C9DA 3BZQA 3SXLA 3MM6B 3W2VB 4X4QA 1ZTTA 1JNZB 2BXJA 2JFDA 5JVGQ 2GHWA 2HHUA 1CSJA 4X4SA 4B3OB 3JSBA 1RT6A 1VK3A 1M5SA 3K57A 1V3RA 1T05A 1FKPA 3DI6B 3CD6S 3LO3A 4C98A 2CJBA 5D4OA 3M2VB 1WI6A 5F8HA 3NGDA 1SXLA 2QIFA 3IAM9 3VAIA 1RT4B 1HHTP 1URNA 4Q44A 3OL7A 1RI7A 4K2XA 4D3GA 4WZQA 1IM4A 1D8YA 2ROGA 1O8BA 1T8EA 2IM0A 3HVAA 2OTJS 2CPXA 1QSSA 3K5NA 2M3DA 5I42B 4JYAF 1DQ8A 3R1LA 3EPGA 4YEAA 3SZ2A 3OL8A 3MM7A 1IBLF 4YR3A 1ZPWX 4YOEA 2XSJB 1L3VA 2J9DA 1TR0A 5E3AA 3CJKA 4OZLA 2V8GA 3FVYA 2A10A 3CCWA 2F1FA 4ZLPA 4O44A 1VQKS 4ELTA 5CH7B 3DMJA 4F3OA 2HWIA 2YNGA 4QIFA 4DR1F 4PXBA 4DQRA 4K4SA 2QMXA 2JVRA 2O5DA 3QGHA 1H2VZ 2RF2B 3M2RA 2OKQA 1ZYQA 1NK0A 2KTQA 3NNAA 4O4RA 2CZ4A 3PKYA 4G3IA 3H8YA 3RBDA 2B4PA 1YIJS 2GQ2A 4KTQA 4WZMA 3PM9A 3W2WB 4I2PA 2XGPA 4JI2F 2L9DA 1CLFA 2GFFA 3D0GE 3IG1A 4O3QA 2IJNA 2JX2A 3E2EA 3MURP 1IN0A 4ZPTR 3QO9A 3DN9A 3CJ0A 5D8HB 2KVIA 3MMAB 3IGVA 3U27A 1N5VA 2EG2A 4EFAC 4OHXA 1HNVA 4H4MB 4ZVFA