3K2YA

Crystal structure of protein lp_0118 from lactobacillus plantarum,northeast structural genomics consortium target lpr91b
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein lp_0118
publication title Crystal structure of protein lp_0118 from Lactobacillus plantarum,northeast structural genomics consortium target LpR91B
rcsb
source organism Lactobacillus plantarum
molecule tags Nucleotide binding protein
total genus 19
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k2yA00
3K2YA
chains in the Genus database with same CATH superfamily
3IGNA 3BQ1A 1GMUA 3I5AA 2JEJA 3EDRB 3B82A 1LWFB 1LW0A 2VPXB 3V81B 2X7IA 1S99A 2C1EB 4GKKJ 4QIEA 4NLSA 3GCXP 4MFBA 5FIIA 4DZ6A 5DDRC 4X62J 2KKHA 4DL7A 4USHA 2FTRA 1CS4A 3KG0A 4N47A 3M9OB 1UPPA 3OTEA 3AY0A 2W7OA 3U27A 4GMKA 1JLGB 1OQ6A 4OZ3A 2J0XA 1PC5A 2ZE2B 2QA4S 3M8WA 3ZTRA 3IA0A 3PEHA 4X4OA 3H2UB 3MMAA 2A2CA 3OVBA 1S9GA 1R8PA 2ZOFA 2HZAA 5DG7A 3GJSB 4B9TA 4NLUA 2VG7B 2MHNA 3OVAA 3R2CJ 5C42A 4NLYA 2XM3A 4TLQA 2VFSA 1NB7A 2NPFA 4RL1A 2LEAA 1RWMB 1X4EA 3MTJA 3CJKA 4HHUA 3RR8A 3DGPA 1C4CA 2B8PA 4C8NA 3KTQA 1JJHA 4KO0B 3G82A 2XB2D 5K8NA 1VC5A 4DR4F 5B0EA 2GJIA 2DBBA 3WC2A 1TK5A 4JI3J 3MAHA 3QBCA 5HI7A 1RA6A 1HBMB 6FD1A 1MN9A 1WF0A 4OYPA 4WE1B 4KC5A 2YQ1A 3HP6A 2X3DA 3PV8A 4K4UA 5KFDA 1HD1A 4C4WA 2NPIA 3LA0A 2V8GA 3OTDA 7FDRA 5B7WA 4Y65A 1G2EA 1YZ6A 2QT7A 2YKMA 4FKYA 1KFSA 1TKZB 1NK6A 1RT7A 4NOHA 5EWGA 3J80U 3PW5A 1PC4A 2XBPA 3KK3A 1GQEA 3VAJA 5ETRA 1NDLA 3KLIA 2ZH7A 2VB6A 4LMZA 3WIUA 4EEYA 2FHKA 3WBZA 3BZQA 4E8UA 3W60A 1FKOB 2A0FB 2QL9B 4DN0A 3MURP 1SUQB 2BJ8A 1SL2A 2Z57B 3CT9A 2KZMA 2CQGA 1CJVA 2MKHA 1LV5A 3JTOA 3T1HF 4MIAA 1FTRA 2IBOA 4ER8A 3Q89A 3CPWR 3ETOA 3W8GA 1OY8A 3MM6A 3QLHB 2CZVC 2V0NA 2VONA 3MECA 2UUWA 1W7WA 3DLJA 2H4WB 3OL9A 3HD1A 5A8RA 4DV5J 4DL3A 1M5PC 2L08A 1S1XA 4EUVA 3JB9k 2HVDA 1Y5LB 4F0HA 2UVVA 1RTHB 3BPDA 3RW7A 4YFUA 2XZWA 1VRUA 3R97A 2BBEA 1C1CB 5F8GA 4ZVQB 9ATCB 1HNZJ 1S10A 3PX0A 2QMUB 2Y3YA 4O0NA 3AH6A 2MQPA 2C2EA 1N33J 2VJUA 2QE5A 1WEYA 5ETLA 5A2QY 2PA3A 2GHWA 3CJ3A 1FRLA 3BPSP 2NSBA 1X60A 5LMNF 3OFGA 3RAMA 2AT1B 1KQKA 1XMOF 1ZM4A 2LDYA 4LBIA 1RT1A 4OHXA 2V5HG 4J7CA 3K7RA 1RSCA 2E9ZA 1WC1A 3I6PA 1GEHA 1UEVA 1EQMA 2KRRA 3I0RA 3GV8B 3AXMA 4ZVOB 5ETOA 4ETZA 3UQSA 3CCVS 4DI6A 4JI5F 1SXLA 2WK4A 4M5NA 4OZ1A 1TL1B 1FDBA 4ECWA 3G6XA 3S8SA 4LF9J 3I87A 3FQLA 1YKWA 4DUYF 2PA8D 2W2MP 3T5KA 2ZBCA 4LF6J 4LRAA 4WFNQ 1HBOA 1EP4B 2F7VA 5L46A 4H4KC 2H5JB 3JYTA 1KTVA 2H5IB 1WHXA 5BR8F 4JI0J 3MM5A 2ASDA 2WOMA 3HHKA 1TZ0A 2CNNB 4FF2A 4ZMMA 4WFYA 2FJBB 5LJ3Y 2XMVA 3HT0A 4C3MA 3HD2A 4L6V3 2VDIA 3TZXA 1RAGB 3VVTA 1QSSA 2AJ1A 1IN0A 3VR1A 4DPOA 4JI4J 3LP1B 2ZDOA 2X3GA 3OD2A 3Q2SC 3QZ8A 2RDIA 3L09A 1XMBA 1I1GA 2WZ1A 2RH3A 4M63A 2KJVA 4CT8A 2V4JA 2QFIA 1FI4A 1UMJA 2QMWA 4LR8A 1FE4A 4XDCA 2AYEA 2VFVA 4DUTA 1LKZA 3FBCA 1Q5YA 2FDNA 4DQRA 2UUAJ 5K5MA 1R43A 3TAMB 4RW7A 4ZPAA 3CJSA 3C46A 2PGCA 3A3NB 4YB7A 2C28A 3M1VA 3K8WA 2V50A 2FD2A 4GC7A 2HURA 3AQPA 3ELHA 3NOGA 2G0IA 1YZ7A 1X9SA 4ES2A 2CQCA 3U7JA 2C3OA 2WONB 5CH7B 5I42A 4PWDB 1V3RA 1VISA 1H38A 3KMQA 3MCOA 1VC6A 3PIPQ 3CIZA 3F56A 2E9RX 1R0BG 4I0WA 4F4ZA 1S1UB 1EHWA 1VK8A 4M5DB 2C2DA 4B3RJ 5F41A 1LW2A 4M5LA 2AV5A 2B7CB 4JI6J 3M30B 4UZCA 2GQ2A 1REGX 4DR7J 2ZUGA 2VH7A 4X84A 5GMKa 4LR7A 4X65J 1N0VC 1VI7A 2VC0A 3MEDB 2XMUA 1N8RT 2HHQA 3RTVA 3FMWA 2UXDF 1M5OC 2ZOGA 4KBIA 1RLCL 3AJDA 3BR9A 1RE1B 3KJVB 3UE2A 1KOOA 1XJWB 3PO5A 2BJ9A 1MWYA 5EX0A 4F3QA 5HBMB 3R2DJ 4GVBB 1ZPWX 4Q44A 1TKTA 3HX9A 4CNYA 3MMJA 1A7GE 3K17A 2IDEA 4FP9A 3JAMY 4F7VA 3BF4A 2XWXA 2VICA 4TU7A 3VAGA 1AXQA 4UY8T 3GYXB 2GJ2A 4X4NA 2OAUA 3R1LA 1SJFA 5L39A 4HHHA 2CZ9A 5G0RB 2R7RA 4JV0A 4RBTA 2D9PA 3HHLC 1KQSR 1GH8A 1UWBA 4KFBB 3HDSA 3H5YA 4USIA 1BMQB 3GZ7A 4Y2CA 4C48A 3QQCD 4J5OA 2OH2A 5FD1A 2KT3A 2KHCA 3CCLS 1NB2A 4X4SA 5CYMB 4C3LA 1IWGA 2J6SA 5ETQA 2JL9A 3AFGA 4OI3A 4DV4J 2CWXA 2BE2B 1BC6A 1U0SA 3TW0A 2HIYA 2QL7B 1MG7A 1GX6A 1P9YA 2CPFA 1JJ4A 5CZVA 3ZXWA 2R4FA 2FJVA 4WFZA 2J8SA 5HLFB 8RUCA 3HHLB 1E6YB 4J37A 4TQSA 1RJJA 2QTWA 3ZC4A 5AJ3J 3QAUA 3ZZOA 2LQ8A 2HK3A 3D54A 5KAKA 2XO7A 4ZPDA 1NHUA 2XLJA 9RUBA 1R27B 1BUXA 5LT5A 2UUTA 3OJUA 2VDHA 3NL0A 2EKYA 1RZMA 1NSQA 3OTOJ 5KFNA 1SKRA 3FNNA 2XULA 4TY9A 1NM2A 2W7PA 1S1TB 1VIOA 5DGAA 1HBNB 3H42A 2HQ3A 3DOMA 2RVJA 3UD4P 4R5PA 1R7IA 2JX2A 4DFKA 4F67A 2RB7A 2Y1LB 1HI8A 4KE5A 4M5MA 1O8BA 3H4DA 4AT1B 4DR3F 3ET6A 2RHQB 3NMRA 3J80Y 2JEIA 4DX5A 5JMNA 2FVRA 2Q6CA 5CCLA 2WVDA 3C6UA 1PCAA 4LRCA 3VAMA 1R6VA 2R9LA 4RW6A 4KAIA 4EZ9A 2WBMA 4O3QA 1YJ7A 2R8IA 3UI3A 1WDDA 3V6KA 3J7ZT 5CCMA 4X4VA 1C4AA 1YJUA 2RMLA 1TFWA 2DPIA 1IXKA 2IAJA 5HAOA 4OHZA 2NXEA 4ZP9A 4YB1P 2VUGA 1PJ6A 3R7NB 1V3SA 1NK4A 2CPEA 3UD3P 4MH8A 4FNIA 2QA2A 1RTJB 3CNQP 2RS2A 5CYJA 2MY8A 3W65A 3HMJG 1DY3A 3NKYA 5C24A 2IRUA 3SBMA 2DNZA 3GILA 2Y1RI 4MK9A 2GGPA 2OI2A 2BM1A 1VC0A 4I6AA 1FE0A 4QIFA 3T1YF 4K0KF 1RT3B 4X64J 1I94J 2VODA 4ID8A 3MM7B 5KG7A 1VHIA 3O6QA 5AE1A 3HJFA 4F3MA 5KFOA 4CLWA 4TU9A 5KG0A 5ADZA 4PKDB 1Q86T 1YJWS 2YPZA 2EWHA 2J9DE 2B9EA 3BBCA 4IH7A 2J9CA 2DEJA 2B9YA 1YJTA 1U6FA 5F0WA 2C3PA 2F63A 2V8DA 3S1TA 1T05B 4AQYJ 1LK5A 1Y10A 4P7TA 2KTQA 1Y3KA 5KFXA 2HZCA 4B9VA 2B8QA 3S7RA 4OZLA 4WJBA 2P9EA 1FESA 2G9OA 5HK4A 2IC3A 2OD6A 4JV5F 1FRXA 1SV5A 4ILRA 2LKZA 5IQQA 1K8AT 3P3DA 1R8CA 2UUCF 2NR0A 2KRBA 3GPAA 4U7UD 1KR4A 3H4BA 3MM8A 3KMSA 1IKYB 4KGZB 1S49A 4GRSA 2IRYA 3W3SA 2NYHA 3W8PA 1UAWA 4YY3J 2XNRA 3IN5A 3KKFA 3IO1A 1CSJA 3QJPA 3GONA 2IM1A 3MR6A 1KLNA 3OQ2A 3ENVA 4ZJQA 4C2MA 4HTIA 4AFFA 2LU1A 4Z7YA 4NLGA 2OPQB 2UP1A 3A3OB 4BCAA 2J0SD 3QSYB 2CNLB 1O5JA 2WSFC 3ITHB 2D1CA 2BM0A 2BEFA 3GIIA 3QJLA 4DSLA 3FVYA 2BVZA 2GAGC 1VOMA 4MK8A 3VGTA 2W2PP 2J0QD 3V6DA 2BXJA 1CC8A 3DLKB 1RHUB 2C2NA 4W92B 1LWCB 1F3VA 1JXEA 4LBHA 5FDLA 4RW4A 5FLXU 1U0HB 5T41A 2Z8QA 4CLFA 2R7UA 1R8AA 3H5UA 4ECYA 1NK5A 3NRBA 2CJYB 1R8BA 2KFZA 2CPHA 4PWWA 2FB0A 1WC5A 2HHHJ 2OEJA 3RBZA 1S0VA 3VGUA 1WTBA 3MUMP 2LU2A 2AYMA 4O0IA 4PZVA 3DYAA 4CZCA 4K4WA 4TY8A 1IKVA 1HNVB 1O0PA 3MMCB 2DISA 4TN2A 4G1PA 5H9EJ 1FWLA 3KJNB 4F8RA 4NCGA 3GFZA 2QMXA 2HHTA 4CWBA 2W4CA 2C2MB 4EI2A 2V34A 1HPZB 2NZCA 1KHWA 3QATA 2Z2LA 3IAM9 4RWWA 5J2QA 3D9BA 2L9WA 4C98A 1PBAA 4CCHA 5ETPA 4A47A 2YNIA 3Q2TC 1FVQA 3C6TB 1TUVA 1B0TA 4HT7A 3BO2A 2YQ0A 2JH3A 5E7OB 1LK7A 1ZPVA 3HPOA 5MAOA 4I7FA 1SH3A 5JUMA 3AHPA 1RISA 3KFWX 4DV1F 4K59A 1IBMJ 3MMBA 3OSNA 3R5DA 2ZITA 3CVKA 4M5IA 1NK0A 1FNOA 3FJ2A 4OI4A 2CQHA 3EZOA 1B99A 3H98A 1WG1A 1N56A 3RUBL 1RT5B 2XMTA 4QPTA 1P8GA 5J2NB 4CLYA 1UJ5A 3CCQS 3RAXA 4NXMJ 3T5JA 3RRGA 2ILZA 3M2VA 1RYSA 4R8UA 1UVLA 2IVYA 4A8MP 4GC6A 2XS7A 4OHVA 1LW0B 3V4IA 3RB6A 4DOZA 2RU9A 4A48A 2AJ0A 4DPTA 4PQAA 3EMTA 3TZWA 2HHUA 2YPYA 2F8HA 1LQ9A 1D0EA 4HHJA 3DMJA 4IDKB 4G6VB 1SJ4P 2UXCF 3A3PB 2CKWA 4WZMA 2FLPA 1FXRA 1Q8IA 1UFWA 2AHOB 3TUPA 3R27A 2ZH5A 3K5NA 5K8MA 1HWUA 2HHPA 3W9IA 3PRVA 3G96A 3DOKB 2W8KA 3NNAA 4DV3J 2GHPA 3LUYA 4OZ2A 2FLLA 4TXSA 4QWAA 2MGZA 1S9GB 1S4FA 4USKA 4IFVA 3I4PA 2EFOA 1M5HA 2GVDA 1TVRA 3SIPB 3IGVA 1JJ2R 3UFCX 1HR0F 1XBWA 5D6GA 1S1WA 1FJGJ 4QCLA 5C42B 2MPUA 3H5XA 3NGTA 2KT2A 2E5GA 3W61A 3BBBA 4DV6F 4CM0A 4RX6A 4WTYA 4YS2A 2COLA 3D3BJ 4CO1A 2EC2A 3G82B 2XMMA 3MWBA 4LF5J 1Y5IB 2CPIA 2XNQA 1EARA 2EK6A 2FPHX 3L7PA 2RAQA 1VBYA 3THPA 3H8YA 3I0SA 1FX4A 3GCWP 2VFUA 3OUYA 1JLFA 3OW2R 4RJVA 1UEKA 3OLBA 3MAAA 4TU8A 1QE1B 3KDOA 3GFXA 2MYFA 4K5RA 2X1BA 2RIJA 3UR3C 1UVNA 3A12A 4DL5A 3L7OA 3MZIA 3OR1A 2MY7A 3LALA 1RP5A 2J6UA 4C8LA 1XMQJ 3ZZRA 4MKVA 4YDXA 1Y11A 1Z2ZA 4DN9A 1FEEA 2RQMA 3KLFA 3IWLA 1BHNA 4NPOA 4FKXA 1N6QA 2VG5B 1IUJA 1JLQB 3KHLA 3QNWB 1V3ZA 2XY6A 2DY9A 2OHDA 2EG2A 5EDWA 1HQEB 4ITSA 4HI2A 5A6PA 2IMOA 1CQNA 3P6YC 3SMZA 2DGVA 5KT7A 4MAKA 1MROB 5DDPC 2OTJS 3MM6B 1QAXA 4BHQA 2QSWA 5IOLA 4TQRA 1UETA 3U1LA 4MKYA 5E3CA 3D2WA 3MPUB 5KT6A 2AWZA 1VJQA 5J2MA 1ZYQA 1Y9OA 4FPIA 5A8KB 5KFTA 4YB5A 4PQUB 1SL0A 4I56A 1M5KC 4F0MA 3J7YU 2JLFA 3PO4A 3UDCA 1UWAA 3GSIA 3RU0A 1VRUB 2PI4A 1FDAA 2A6OA 2HBQB 1FCAA 5C7PA 4LF7F 2DNNA 4ZN3A 1MSWD 1YLXA 2JC0A 4OLOA 3CC4S 1HWIA 4USTA 2CJAA 4OLPA 2RKIA 3TQEA 4IRCA 2QRRA 1RT1B 3GR0A 2V68A 2MZQA 2MZ1A 3FZ2A 2AJQA 2BJ3A 4EWTA 1QAJA 1LWFA 4P7VA 4YP3A 1UFLA 2RSQA 3SCJE 2VQEF 4IOBA 3I0RB 3NGDA 1VQ5S 4OZ5A 4NI2A 1YX2A 4Q2MA 1P1TA 4D3HA 1FWPA 2EBEA 4F0KA 4PABA 3SQGA 3EUNA 1ZOTA 1N88A 1UVJA 5DQHA 1AW0A 3V5RA 2Q43A 3GG0A 1GX5A 3VVUA 3RRKA 2QZ8A 2DR5A 2N4DA 3O5TB 3ETMA 5D0EA 2ZE2A 2VA3A 2XLIA 2X51A 3IRWP 2WOMB 1RB0A 2N7YA 2FLNA 4ED2A 3RB0A 3RB3A 4ED1A 3IP0A 2DH8A 3HULA 3DLEA 1LOUA 2RE1A 4QU7A 2CA9A 4PG4A 4KHRA 4K4TA 1HMVA 4Y2KA 2MEWA 2X1AA 4KO0A 4OJ1A 4DF4A 4JBCA 4IG0A 2CXEA 3ZZPA 2V4JB 1XIQA 3U1MA 5FLXY 4IUFA 1MW7A 2L9DA 1JXVA 3R6GB 1HBMA 3EDQB 3SCLE 4NA3A 1B7FA 3TQ1A 4GKJJ 2IA0A 2MSSA 4WE1A 3N28A 4USJC 3KK1A 3GSDA 2VG6A 4IFYB 4RW7B 2YH1A 4AL7A 1EKRA 4LFAF 2M2BA 3N5FA 3M1VB 2F8EX 2DHGA 1HW8A 1JLAA 4WPAA 1TKZA 2AU0A 1T9TA 2UU9J 3OT9A 5I42B 3QGHA 1WEXA 2KHDA 3WZ0A 4L75A 1K1SA 2DT9A 3KLEB 2UV8A 1NBEB 2FLOA 4RU9A 2ZZNA 4F2SA 1FKOA 3HXMA 1SUQA 5HL7Q 4ICLB 1X5TA 1JLEB 2B5JB 4F2RA 2XO6A 2HBZB 4OI0A 3NXZA 2B9XA 1D9DA 4ED5A 4LF8J 2CAJA 3C8YA 2HKEA 4UOHA 3UDLA 4LR9A 2VV5A 4Y6IA 2ZVSA 1WHVA 3NBPB 4DR2J 1FF2A 2R42A 2PMZD 2VFRA 3EGVA 5D78A 4XK8C 1FTCA 1P9QC 3HFZB 2D3OR 1RTHA 1NJZA 4J9KA 2BJDA 3SSSA 4NCBA 3OV7A 2CQ2A 2BQRA 2MKCA 5B0FA 1YJRA 2HZVA 1RWKB 1S6QB 1FNXH 1C1CA 2M0GB 3LAMA 2M9KA 2AGOA 4KH1B 1RWUA 2AYGA 4O3SA 4HT5A 3GV7B 4DQSA 4LT6A 1CJKA 3GB0A 2H3EB 4CLZA 1AUSL 2HS4A 2NUHA 1GMWD 1U1MA 1X4DA 3GJQB 3L3CA 1N48A 4OV1A 2QLXA 2OUGA 4C7QA 5E3AA 4NEZA 4QW9A 2ASYA 2NYIA 2ROEA 3SI8A 3BKUA 1NRKA 5D15A 4MYUA 3C14A 2QJ3A 4FN5A 1EETA 4NXNJ 2HHSA 1RTIA 1IWAA 3MR2A 2GC8A 4C6AA 4C0HA 1UVMA 5KG5A 1VQ8S 3M6XA 4GKKF 1HBUB 3IM9A 1X4HA 4DSKA 2HAFA 4X62F 1KVKA 4RNNA 3PTWA 3VCDA 4V19X 3A8KA 1OPZA 2XY7A 3MR5A 2C42A 5A0YB 3FBFA 1VQMS 3H5SA 5B09A 2KH9A 2H9ZA 2R3VA 4IR9A 4JP8A 4A8XA 1SJRA 3RR7A 4V1Ak 4NL5A 3W5YA 2J6TA 1SKSA 1UA0A 5KFSA 4DV0J 4NLPA 3DRYA 4KY3A 1QVFR 3KG4A 3A8EA 3IR7B 4RR5A 4P72A 2YWKA 1Q8BA 2CG4A 4IG3B 4P74A 2W2QP 5CABA 4Z7CA 2ZOMA 4AYBD 1VYAA 4K4ZA 2VASA 3LP1A 2IM0A 2JJ4D 3DRXA 3OFHA 2V2KA 3LPYA 1H3DA 2NXJA 4TYBA 2QYGA 1N4LA 1RDRA 3ULHA 2AP6A 3TVZA 4H4KA 2ZH4A 1FJ7A 1BLUA 1WHYA 1KVJA 1RHKB 2P8IA 4JI3F 3J81U 2PIIA 3P45B 2DNQA 1SB6A 4G1QB 2HBYB 2QC3A 4KT0C 4DJBA 2BQ3A 5H9FK 3TAMA 2ABYA 3C16B 1DARA 2DIVA 3JS9A 3MPYA 1K9MT 1C0TA 2HFNA 3C6UB 2CNOB 3POTA 3HLUA 3DHXA 2P2CB 1CC7A 1FD2A 1V9OA 3FSYA 2DCUB 3EVWA 2W2OP 2DGOA 2YTCA 4M5KA 2ZKUA 1TV6A 4KV8A 3PW7A 1F2HA 4QQBA 2MKKA 4RNFA 1C0UB 1WC6A 1I51B 3JQMA 3CE8A 3MCNA 4ZVEA 1SVDA 1S1UA 3SZ2A 2DHXA 3HSJA 1Q1KA 1F3FA 2N3LA 3BQ0A 1T8EA 4N8OA 3M30A 4J9NA 1K0VA 2W8LA 2XI2A 2AX0A 1HI1A 2ZNYA 2HLTA 4LRBA 5LXRA 3MEDA 4G1IA 3CCMS 1OJ4A 4N7TA 1S0NA 5LMUJ 5C24B 3DI6B 3CD0A 2GGPB 3KJVA 1ICEB 4USWA 4QIVA 4RNHA 4OZJA 3D6FB 2IMWP 4QR2A 1WOSA 4OJGA 3AD7C 2NLWA 4ZKAA 3PYGA 4GVBA 2JEFA 2KG1A 1T9YA 4DL0C 8ATCB 3NOCA 3M8RA 3CDAA 3LH2S 2DHHA 2DO0A 1FHTA 2I5JB 1F0XA 3K5OA 1DAXA 1HNZF 3W66A 4NLXA 3AJ2A 3HT3A 2E5IA 2YNGA 1N33F 4L73A 4OJHA 2HRTA 1OIAA 4L3NA 4F25A 5G0RA 4NA2A 2P6SA 4A8FA 1RA7A 4YHHJ 1G4CA 1I5OB 3K2YA 5AXMA 4DU7A 2IC3B 5SUHA 2FHJD 1SV5B 2PD1A 2V63A 1Y5NB 1UFKA 4DPWA 2BE2A 2VQFJ 1KN6A 1UZDA 3KWMA 4DEZA 3CJ8A 3MM8B 1OMSA 1JNZB 4LF9F 1U6BA 3DN9A 4PEOA 3IR6B 4LF6F 2IVFB 2VFTA 3BYRA 1FRKA 4B9NA 4OYIA 4Q45A 5HLFA 4KGMA 4NRTA 3GFHA 3HHLA 3D66A 4Y2MA 2ZJQQ 1XQIA 2Z0GA 4JI0F 2IFXA 1P27B 4HKQA 2HS3A 4ANEA 1JXLA 3D0HE 1S0MA 2GV1A 1MMDA 2XYHB 5ETKA 4K5SA 1Q53A 1BQNB 4MIWA 2M8DB 1N5YB 2CPZA 2RF2A 3F0NA 4V19J 3IS9A 1VLOA 3AJ1A 4JI4F 5I4MA 4A8YA 4DR1J 1RU2A 1XR7A 1HBNA 3PXGa 3PM9A 2F9JA 4PCQA 1O6XA 1SBRA 1FKAF 4RW4B 3A13A 4RUAA 2AEFA 2LQBA 2HK2A 1TAQA 4C8ZA 1KD1T 5ETVA 3HVAA 2C2KB 2NS1B 1BXNA 2AKWB 1T95A 1QD1A 2Q79A 2ZH6A 7AT1B 4CO0A 1VBXA 2ROPA 3QGIA 3VV2B 2CQPA 1KBRA 3VALA 2FZGB 4JI5J 2XHCA 3DNCA 1IKVB 1UA1A 1HQUA 1XC9A 1CULB 3D6HB 2HHVA 4QWDA 1RWWB 2ZFHA 2D41A 5HMZA 4C3KA 2UZAA 1Q95G 3LO3A 2KJWA 2N4CA 4HDGA 1Q7YT 5J2QB 4B3RF 2VF3A 3K58A 1S9FA 4Q8FA 2OMOA 4C9DA 4JI6F 4S0MA 5HROB 3PJWA 2DXFA 1DBDA 5F3TA 4X65F 1UZHA 2APOA 1S4EA 3VQSA 1QSYA 5IT0A 3T41A 5KG3A 2DEIA 4I7FB 4OFZA 4NYOA 5DZ7A 1RT3A 2GVZA 4QR1A 2XS5A 1N32J 5KFJA 1MMNA 3GU0A 2CNKB 4NLRA 1DQ8A 1SI9A 1Z4UA 2E1PA 3LAKA 4DUZJ 3V2UC 1OYEA 4M5JA 4TVAB 3TI0A 4E0DA 5KFRA 4PG8A 3ZZYA 2BW2A 4A8KA 2GQQA 2PEHA 2E1RA 2QA1A 4LF4J 3BSOA 4YDDB 1RTDB 3K0JA 2G0CA 3JSBA 2J8AA 4B3TJ 3M2VB 4Q7AA 3CDWA 1NKCA 1AUDA 4FVMA 1T05A 2C3MA 2ZDPA 3GYGA 2QLFB 5A8WB 3Q8RB 5DETA 1NPPA 4YB6A 3TEGA 2DR9A 5HJYA 2QSFA 4FNHA 3QGPA 1YBTA 5E33A 2YX1A 4UUXA 1NAQA 4L74A 2LCWA 3SQOP 1N34J 4U8VA 3UO0A 5KT2A 4JV1A 1S9EA 1HNXJ 1YJNS 1K1QA 2HQIA 2POKA 2I9SA 5GAHU 1F9EB 2XG8A 3BJYA 2EEYA 4DV4F 2C2OB 4KYZA 3HVRA 4LSLB 2DCLA 2BANB 4NLQA 4BWMA 2AGPA 4NZ6A 4IFVB 1PJ7A 2OIHA 4ED4A 3JSYA 2GVDB 1TVRB 1TMMA 2UXDJ 2CQDA 2RRAA 2ZNZA 4WYWA 5LJ5Y 5HMWA 1ZM9A 3O3LA 1UTAA 4N5SA 1U1RA 4ZVRB 3F73A 3LP2B 1VIXA 2OPQA 4KHPF 5AJ3F 1RADB 1VFJA 3DRSA 4DS5A 3ITHA 1YBUA 5C2CA 2YQ3A 3X3UA 2OFGX 3JQKA 2OPSA 2J76E 2G2OA 3I0SB 3J81Y 3OTOF 3UN3A 2HWTA 4UZBA 2K8GA 1H6KX 1RAHB 3PNIA 1U0HA 2WCXA 4HTJA 3MAAB 1REVB 4AL5A 4EFAC 2LQJA 1X5PA 4P75A 3M6UA 5BYQA 3ZFVA 5ETMA 4ILMA 1MN7A 4RUCA 3M6WA 2WW4A 4ANCA 3QFWA 3I5BA 2B7BB 3W9JA 4MKAA 4PXBA 1KTQA 1HNVA 2PMHA 3H40A 4P73A 2DNHA 3MMCA 2ZH3A 4U95A 2HSEB 2BE9B 3D1HA 1ZH5A 2HLUA 1UVIA 3TYTA 5M2UA 1EB0A 4B3SJ 2FJAB 1BQXA 5L38A 2N7CA 3TJ8A 1HPZA 1IM4A 1ZA2B 1TKXB 3H20A 2YWFA 1VBZA 2OEMA 2NZ4A 2GCFA 3IBWA 1YJVA 4OYXA 2OELA 2I1RA 3C6TA 2GJFA 3GIKA 1FO1A 2DTJA 3OTCA 2IM3A 1SJQA 3CMQA 3E2EA 5HANA 2RQ4A 2W25A 2XWYA 4RNOA 2HG4A 4CLLA 2UXBJ 3EGNA 3MCMA 5LOQA 1KSPA 1O51A 2A3JA 2XMKA 1TL4A 1F9HA 2HRUA 1U7LA 2CQ4A 5LL6d 2FQQB 2QIFA 1EAYC 4X64F 1I94F 1IVZA 2OSQA 2DB1A 2E5LJ 1RT5A 1ZZFA 5J2NA 1M5SA 2RKIB 1JIHA 4G65A 2QX0A 3CTRA 1H98A 2P9CA 1RHRB 2HEKA 1PG5B 4DV2J 4RUHA 2HQCA 2V9WA 1M1HA 1FD8A 1L3TA 5D4OA 3KHRA 2DVIA 1VK3A 4YQWA 4XDDA 2R7VA 4NI2B 1L3UA 4F4KA 1YRXA 1BWEA 4NEYA 2DRAA 1U48A 1XNQJ 4AQYF 4I2QA 1EJ7L 4O44B 3SQGB 4BLGA 2AJ2A 3QRQA 3ISNC 2MLYA 3J7YI 2RRBA 3SDEB 3F44A 4IDKA 4EYIB 3TR5A 5HJXA 5HQMA 3EE3A 1SJ1A 1HFEL 2VKRA 4FYWB 3DOKA 1OY6A 5HQLA 3FC9A 3O44A 2R2SA 4YUDA 4UQTA 2LXIA 1RABB 3FK4A 5KFZA 2EXUA 3OFFA 2H48B 3M05A 3BYPA 1DFDA 2MMYA 4C8OA 1I3OB 1IKWB 3CJTA 1ROFA 4CO3A 2V69A 1VQ9S 3DLEB 1U02A 2HIQA 2MZJA 2YXLA 3C15A 1TU0B 3R6LB 1ZM3A 3BKTA 1HMVB 2RILA 1APSA 3CJ2A 3R8YA 1ZZNA 3MUTP 3MEEB 4IG0B 1SC1B 3JQJA 1B4SA 4LVOP 3HSDA 2HHXA 1D9AA 3CO9A 1J5OB 1CG2A 2MKYA 3R3TA 3KYLA 2QYCA 2DPJA 5EX3A 3WX4A 1RWVB 1HI0P 3KK1B 1LNQA 2VG6B 3D6MB 3GV5B 1EKSA 5IT9U 4GVLA 1QE1A 3HF5A 4Y3CA 2JDJA 1JLAB 4WF9Q 2V2ZA 1GT8A 1GMVA 3NCPA 1TK0A 2M5YA 3DU6A 3T3FA 4F4XA 2HHHF 3PX4A 4ZN1A 1PGZA 1RKJA 1RWXB 1QSLA 4J9UE 2VG5A 2VD3A 1JLQA 1HHQA 1A6LA 4ZOSA 3I5CA 1LWEB 1KWMA 3D67A 4UQGA 3AQOA 1HQEA 4KB7A 3LWMA 1T9VA 1PO6A 2ZHBA 1MROA 4NWBA 1M1GA 5F9NA 2FY8A 4I67A 4UOCA 1GXUA 1XN9A 2B4UA 4NYZA 3Q8VA 2Z2YB 2C2ZB 3AB2B 3TANA 1YVFA 3PACA 2Q1LA 1BGXT 3MEKA 3QIPB 2LXFA 4U7UK 5A8KA 1U1NA 4PQUA 4DHVA 3VAKA 2WW8A 1D09B 3TO8A 1YGYA 3VGSA 2LQ5A 2LP4A 3PRDA 4LSNA 2H5EA 2Y8WA 2LFVA 2BYCA 4QWCA 3OJSA 2AD9A 1IBMF 3AA9A 4WWSA 4Y28C 2D3ZA 1T3OA 1CJKB 4USMA 4NE9C 2G1DA 3L9ZA 4OQJA 3RBEA 4NMXA 3IC1A 3GFYA 4RLEA 4WXOA 5L1LA 2EVZA 4ZVUB 2A10A 5DRKA 3NNHA 4NXMF 3FCWA 2CVIA 1F2GA 2VHGA 3C14B 3QZ7A 1EETB 1RTIB 2PE8A 3HCXA 3OL6A 1LXJA 3EXYA 1H2UX 1QAYA 3QPIA 2IVMA 3Q0AA 1FXLA 5AXLA 4EO6A 3I55S 4UY85 1NJXA 2OKQA 4LUBA 2YNFB 4DZDA 4NLVA 2QLBB 2FZCB 1LEOA 1UKUA 3CGIA 3D0IE 2W9CB 1E6VB 1VQ7S 3Q8SB 2G4BA 4ZVPB 4DV3F 5HMXA 1IQTA 4LFCJ 1NDKA 3VHQA 2P5VA 4PG6A 1IM6A 2XLKA 5B0CA 3RRHA 2H4YB 2OJ3A 2F4FA 1KDNA 5CAAA 2RS8A 3LGHA 1FJGF 1GK8A 1KHVA 2MLZA 1TUWA 1RHMB 2WSEC 2JZ5A 2I0XA 4DLGA 2JSXA 1S59A 2XCAA 3AAWB 1U1LA 4RBUA 3NS7B 5D0HA 4EO8A 2SXLA 2VBWA 3HZGA 1VQ4S 4LF5F 4CRJA 2H51B 1X9WA 3H2VE 4KKOB 3GQCA 5E41A 4FXDA 3QT7A 4QYRA 3D7SB 5U47A 4J91A 4IFYA 2ZC3A 3M2UB 3G71S 5T7LA 1HNIB 3UVJA 2B9WA 1U49A 1N0UA 2ADBA 3MD1A 4F26A 1C0TB 3ICLA 2QA4G 3UCGA 3VAIA 2ADCA 3GIMA 3POTB 2H65B 4DCPB 2HFSA 4DMZA 3RYLA 4NCAA 1TV6B 1XK8A 1J2VA 3KLEA 4KV8B 1J5EJ 3AXKA 2HRYA 4ATNA 1XMQF 4LF2A 3E3XA 4J9LA 4NLWA 3LOUA 4ICLA 2QEXS 1JLEA 1YI2S 2B5JA 1PBUA 4O3RA 3NGKA 3SCKE 4KSEB 4WK3A 3LPEA 4WKRA 5DJBA 1DQ9A 2WHOA 3R5JB 2KG0A 3ILLA 4OYOA 2MZRA 2DH7A 3C66A 2XC9A 2GIRA 1HD0A 2V67A 1RQ0A 4NLDA 2HFZA 1HR0J 3NBPA 3K59A 1FDNA 3I31A 5KFIA 1ZETA 1TP7A 4H54A 3GIJA 3J7Z5 1F5AA 1EZZB 1XR6A 4DV6J 5GMEA 4CDIA 1S6QA 2ERRA 2Z58B 3FRZA 1X9MA 4A4JA 4DR5J 4RZRA 2N82B 3MEGB 1PAUB 3ZTOA 2I38A 4B3MJ 5G4DA 1OSDA 3UD5A 1HL6A 3CW2C 1S7IA 4OZ0A 2PSZA 3PIOQ 3BM7A 2YNGB 4K2XA 2QN6B 2F1FA 2YKQA 4L3KA 3R9LA 3RG6A 1VGYA 3K57A 3G8SA 1IJEB 4UUWA 4FF3A 3OPKA 1NSPA 2IYGA 3Q8QB 4ED6A 1VCTA 4GO5X 3HKWA 2HS0A 2YH0A 1KVIA 1HBUA 4C8KA 4B9LA 2HVIA 3FDSA 2BJ7A 3W2WB 4DXLA 3AB4B 1U8WA 4A8SA 5EWEA 2Y1IA 3DRRB 3AODA 4H4OB 5A0YA 4QYZJ 4O4GB 4QIWD 2LA6A 4WTOB 3CDUA 1C1BA 2CPYA 2R8KA 4BDPA 4ZPVR 3ENWA 2EW9A 4X4QA 2MQLA 1S77D 4I6WA 3SYZA 1IBKJ 4IH6A 1WI8A 4JYAJ 3Q22A 5IZHA 4LRFA 2RU3A 3KXDA 4IG3A 4LFBJ 2QGFB 4PWUA 3N6NA 3NMAA 2OSRA 3ADAC 1IKXB 4C8MA 2NXCA 1RACB 2RNEA 2AEJA 4QIGA 2RF2B 1T03B 4R0JA 3N01A 4ETXA 3IS9B 1RLDA 3OVSA 2BJ1A 2BJEA 3NAIA 4U67Q 3DFEA 3AOBA 2AF6A 3GP9A 2IPOB 1X4GA 1RHQB 5IT9Y 5DDQC 4EBEA 4JI7J 4G1QA 2MKIA 2ASJA 4C0OC 3KLGB 4HDHA 2HVHA 1U2CA 5KT4A 4OX6A 4GKJF 3L7UA 3B6BA 5IT4A 3C16A 2DR6A 1PJ5A 2E9TA 5A2QU 2XY5A 1F9FA 4ECXA 5KFWA 4DV7J 2DYAA 4ED7A 5IM0B 2KU7A 2DO4A 2RJZA 3I4HX 1U6ZA 3CCRS 2FHOB 3J7A1 2JNJA 3DM2A 4JOUA 5BYSA 2G1HA 2DHAA 1HQUB 3KG1A 2UU9F 1X5SA 4ECTA 2BA9A 1M90T 1C0UA 4IO9Q 1JKHB 2R7XA 3G87A 4WP8A 2M52A 1G7CB 2IIHA 3IFEA 5J1NA 3N0VA 2OPPA 1NK8A 1S76D 3Q23A 1JLCA 1RT2A 2IA6A 4I2PB 3BDEA 2H1YA 5K20B 1PAEX 3RGIA 1G6BA 1KEKA 4WYLA 3MOZA 2PN6A 2O67A 4LIRA 2DGQA 4LF8F 3EVOA 3W64A 3DI6A 2ZHOA 3FUYA 3NP5A 1D8ZA 3IG1B 2VU5A 4DR2F 1FVSA 3L4BC 3OXLA 4M1KA 3QRRA 1OPIA 2GVZB 3FRYA 2UVUA 2HNYB 1T3NA 1K0TA 1CLFA 3W5XA 3BGLA 1QTNB 3M2RB 5D4NA 1SC6A 2A18A 4ZPTR 3N6MA 4Q2LA 1UW9A 2OLWA 2I5JA 4ZIVA 3BO4A 1WSRA 4OYZA 1N5SA 3FCHA 2O66A 4WU2A 5HVGA 4O4RA 5DLGA 3TZYA 2N3OA 3DOLB 4J90A 4LFAJ 3B8HA 2V8HA 3B4MA 5J2PA 2ACMA 4ECVA 5KFFA 1ZS6A 2XTJP 1N5VA 2V4RA 2BV3A 4C11B 2W2NP 2KFYA 2ROGA 4F02A 4DFJA 4WFXA 2BW7A 4RWXA 4NXNF 2VA2A 4U7CA 1HWKA 3UW1A 4J9VA 1S9EB 3EXCX 3DXBA 4BBYA 3QO9A 4KRWA 3KOAA 3W2VB 4DG1A 4DS4A 2HVZA 5K8PA 4ALZA 4DR6J 3M8SA 3G6ES 1X8DA 3KUGA 2DD8S 3LP0A 2Z2MA 5HP1A 2ZWPA 4AXIA 3JSMB 5F9LA 3OHAA 2YKOA 3OBIA 2MXYA 3OTBA 2BOPA 4NX9A 2HHWA 3K5PA 4ZPCA 1RXOB 4ECZA 1KRPA 3D5MA 2HBRB 3NLCA 1X4BA 3PHEA 3DRSB 4HACB 1KFDA 2FJDB 2RDDA 3V6JA 4IYQA 1BQNA 1N5YA 3M4XA 4FVCA 2E1MC 4QR0A 2OPSB 5GAHI 1F5BA 1XERA 4J9SA 1R8HA 1NU4A 1S7HA 3D4JA 3ZTSA 4OX8A 2VOPA 1OO0B 4FBTA 5KTQA 4DX7A 4M94A 2RHSB 4W98A 2XSJA 5KG4A 3KUHA 5DQIA 2I6WA 3AD9C 1Q79A 2DGSA 1QJHA 5SZTA 2VPWB 3PKYA 3QIDA 2G2YA 4WXWA 2DGWA 4I69A 3T5LA 3N4WA 2M7SA 5ETTA 4Q0BA 3SEOA 1S6PA 1RCXB 2B3TB 2IYIA 1PYTA 5CHCB 2M88A 1CULA 2JEGA 2F4VJ 2CJBA 1WJ9A 1ZTWA 4K4SA 1P1LA 2L9NA 2ZH9A 1D1UA 4WIIA 3OHBA 3PJXA 2ZBRA 4HVZA 5JVHQ 1DLOB 1BY9A 1VQKS 2A1BA 2ZBQA 2DNMA 1N5QA 3US5A 5E0OA 1UJ4A 1T9XA 2ZM6J 1QM9A 1F60B 2VC1A 4CP5A 2XI3A 5HROA 3ZZUA 1DRZA 4I1TA 4CLSA 3IAS9 2EBGA 1B3TA 5T14A 4P2XA 3I96A 1L5UA 5KFBA 5LMUF 4TYAA 2CJQA 5KFLA 4E2FB 4OX9F 2BKNA 1RWOB 2BMBA 3PYDA 2OD4A 1VRTA 1RAJA 3I9ZA 3PY8A 2R7QA 1WI6A 2WRMA 2OO4A 5AT1B 2R2RA 4ELTA 4BWJA 3EZUA 3W63A 4X66J 2W9BB 5E2QA 4J9PA 3GR1A 1Y00A 1RTDA 5KFAA 5KFPA 2AIRB 3LGNA 2IM2A 4OZNA 4LVNP 4EMDA 1ACMB 3PFEA 5A8WA 3FMBA 4N76A 4I2QB 4O3NA 4FBUA 1JNRB 1M0SA 3DLBA 5B0BA 2YWWA 2DNLA 3R1HA 4YHHF 4K4VA 2KYXA 6FDRA 4KPYA 4ZVHA 1LWXA 4IH5A 1AA1B 2C3UA 2GIQA 2MZTA 3EVMA 4EU0A 5EWFA 3EYZA 1JLBB 4JI1F 4C0BA 4M8LA 4O3PA 2DRBA 5HMYA 4KJIA 4LSLA 1HIYA 2VQFF 5F8JA 4ELVA 2BANA 1ZM2A 5IWAJ 1CEZA 5CYQB 3ZO7A 2UUBJ 2YNHA 5KFQA 3QSIA 2KFNA 1RAEB 1HKAA 1UCNA 3PDNA 3LP2A 1NJIT 2WVBA 3IBFB 1VBKA 3C15B 2HWHA 2F65A 4WP3A 4PXDA 4OMFG 2UVRA 3RJMB 2MQMA 2MJUA 4ECUA 5D0GA 3VAFA 4BC7A 3M6VA 2XYGB 3BGRB 4PG5A 2ZH2A 3P96A 2C3YA 4DR1F 3DLGB 1F1BB 1PILA 4JI2J 1FEHA 4RPFA 4URQU 5KFGA 1IR0A 3Q8YA 3QYYA 1T9UA 2DY1A 4OJ3A 1REVA 3NWRA 2JWNA 1HLWA 2V94A 2PMWA 2Y8YA 4KPCA 1M5VC 2BR0A 3DRPB 2XZTB 4DCJB 8AT1B 4ENOA 3G6VA 4DSIA 2P9GA 2NSCA 1WKLA 2VPYB 3HHNB 2EC0A 3CDBA 4PAAA 1H73A 2AX1A 3NGSA 2CYYA 4NASA 3NGRA 3CJ0A 2CQ3A 2AGQA 3P4UB 5D0RA 5H9EK 3THTA 1R89A 1HYSB 1NXIA 2B6AB 3FKBA 1TKXA 2E66A 3GTYX 2ZZMA 2CADA 2J7KA 4USUA 4YR0A 5EGYA 2RDJA 2XYPB 1KLMB 2HWIA 1SPBP 3LGMA 1KKHA 3CIMA 2QLJB 4IR1A 2GO8A 2R7WA 1V5IB 5C25A 2IHR1 3E01B 1KOHA 1QAIA 2Z4PA 3WC0A 2EKNA 2OMLA 1OYDA 1YDLA 4LSNB 3KLVA 5KOWA 5GADU 1FDDA 3DXSX 1N32F 1H7WA 2K3IA 1HNWJ 4J9OA 5HVHA 2K06A 4F04B 4F50A 1VQYA 4K8RA 2K1RA 4DUZF 3UWTA 4DQIA 2KI2A 1CPZA 4K4XA 3KDNA 2F40A 3OSPA 1DJ0A 1N36J 4KTQA 2R2UA 2J7WA 4U96A 4LF4F 2EFNA 5ETNA 4B3TF 1JK9B 4DFPA 4LREA 4UW2A 4M5HA 1AFIA 4O44A 4HR2A 2WB4A 1U8SA 3SDEA 2F8MA 2HNZB 4RW9A 3K89A 5DQGA 3TAPA 1MU2A 3CMES 4B02A 3TUIC 4IKAA 1BQMA 3TA0A 4N56A 5DM7Q 4D3GA 2OEKA 3CULA 1N34F 4OYAA 1HNXF 3IR5B 4P6QA 1T9WA 1NJYA 2PDAA 2LDIA 1IBLF 5DG9A 3J7AN 2DGTA 5IXUA 1RWNB 1UP1A 3KNAA 4CTAA 4B3OA 3OR2B 3UR0A 4PYAA 1NUEA 5BYRA 3W5ZA 1IKWA 3TZZA 3MFHA 2UV8G 1GNKA 5D3GA 4IOCQ 1J27A 3M9MB 1XNRF 3PCOB 1G1XA 4PPDA 3IWXA 4ED8A 3RZAA 2DJWA 3MEEA 1KC8T 1JQGA 2D3O1 2YX4A 4ZVTB 1J5OA 3DKDA 2JFDA 4MYTA 3TA1A 3IXQA 2XGPA 2LYVA 1ELOA 3BO3A 3MXHP 2FJXA 3BSNA 2CUYA 3T9NA 3P5TL 2FVPA 3HFVA 1FNMA 1N5TA 1RCOB 5T7LB 1HQ2A 1AYEA 3UVJB 4DPYA 1YRTA 4CQ1A 2E5HA 3P49B 2MDAA 2X1GA 2FC9A 2JLGA 4EYHB 3KJFB 2K7JA 5L1KA 1QLNA 1FWKA 1T7PA 4MIBA 3A8IA 1T02A 4OI6A 3D28A 4DBQA 4OHWA 4Q43A 3MPDA 1B0VA 4H4MB 3BDPA 3OXGA 1CJTB 4IQMA 4PPZA 3HHEA 1S6UA 5I3UA 3VZIA 1LWEA 3CCES 2XEXA 1U1PA 2DIUA 2VKZG 2BACA 5IV4A 2AJFE 3C2PA 4QWEA 1FXDA 3JSRA 4P2FA 1WG4A 4B3SF 5DO2A 1TL7B 3KHHA 4ZP8A 1HW9A 2IY5B 2FUG9 3IRXB 3KHGA 4OYBA 3UPFA 3R5CA 3FSXA 4RNMA 3NG8A 2PC6A 2QG9B 2RQCA 3QIPA 4K7QA 4HLBA 5EUHA 1Q7LB 4OIXA 3X1LB 4KHPJ 3UN5A 2KZZA 2C22A 1TK8A 2H54B 3AOAA 2BZ2A 4XPCA 5KFMA 5JVGQ 1S1VA 2ZZTA 3W1YC 2VBYA 5KFYA 3AA8A 2UXBF 3VZHA 5B0DA 2WTFA 1NPKA 1NZAA 3CEDA 1RAIB 3NNCA 3W7BA 2LEBA 1C2PA 4HH0A 2KB2A 2E5LF 1Q8LA 2D74B 4EK2A 1KP6A 1DTQB 3G6YA 4ZP6A 4P2MA 4DV2F 2RUSA 1S72S 3PFOA 1Y0HA 4FF1A 1FKPB 3B78A 5AE2A 2FVQA 5D77A 3BSCA 2YWHA 5F3ZA 5KG6A 4MMOA 2HW3A 1XNQF 3CJRA 4B9UA 2JVOA 1BD6A 5MLCV 1R0AB 4PRFA 1TTHB 4DX6A 2D69A 2OTLS 1TFYA 1ULRA 2B4PA 2YNFA 2HFOA 1S79A 5ITHA 1RUSA 4U9RA 1XWLA 3Q8UA 3MM9B 2CDQA 5LSLA 4DSFA 2NQPA 1C1BB 3KK2B 1S57A 3H59A 3N9UC 1YK9A 1XTZA 2W9CA 1E6VA 3TUZC 3SFUA 2CG8A 5LM7E 1TMJA 2W4DA 3I56S 2MZSA 1R31A 1U24A 1F6TA 3D3CJ 2FC8A 4WKYA 4R25A 1H72C 3P5BP 1F5CA 4IQXA 2HMIB 5J1PA 4UTGA 1YBAA 3RBDA 3FEYB 2KDOA 4JI8J 5DS7A 3EWGA 1U1QA 3T6BA 2ZHAA 2F3JA 3EGWB 1M1KT 3CB4A 1S48A 2QLWA 2VPZB 4RUBA 3PR5B 4ZHRB 2O01C 4W4MA 2LXUA 2L3MA 1YHQS 1NK7A 2IRXA 4KKOA 1UEUA 4OYMA 2XMAA 2QL5B 5J1EB 2NXNA 2VBZA 3M2UA 1Z1ZA 2D7SA 3TEHB 3T5HA 3VF0B 2K7KA 5HO4A 1HNIA 5CQGA 3M32A 4CM2A 4DL4A 3K5MA 1KQGB 1RT4B 1HA1A 3PRBA 2LLZA 3UCZP 1RI7A 1RT6B 3DM2B 4ZVGA 1NSAA 3NGUA 2W1BA 4P10A 1FK9B 1U2FA 3O8WA 1P6TA 4FYDA 2AZ1A 2XMJA 4UOGA 2XMWA 2ZD1A 4Y0FA 3KLHA 1WEZA 3EJMA 4LQ3A 2FZKB 2OPPB 4ZVFA 1JLCB 1RT2B 2YKPA 3PYFA 5AXNA 2ILYA 4WZQA 2ZJPQ 1CJUB 1DTTB 3CDEA 1ZBTA 2WB1D 3TJAA 3VGVA 1Q82T 2JLEA 3ILOA 3LQVA 5IC6B 3U02A 3QT6A 1U47A 4PXEA 2B0GA 2JC1A 4FXWA 5H1SV 2IDLA 3IWNC 1PKUA 5KOXA 4P9SA 3TVKA 3MOJB 2GO9A 3FEZA 4X4TA 1SH0A 4DV5F 3T6JA 4PXCA 2CJ9A 2CQ1A 4CLPA 3KUEA 1D3WA 4JUZA 1QTMA 4DR4J 1YITS 1A9NB 1SH2A 1LXNA 3QJJA 1IBCB 1S5ZA 4I68A 1VR6A 3MEGA 2MTLA 2BKPA 1S12A 1CBKA 1NO8A 4CO4A 4ANDA 3C19A 1GTEA 1X0FA 3ZZTA 1QVGR 2EFVA 4QU6A 3BKFA 1VLYA 4Q8EA 4O23A 5J2PB 1Q0NA 4F4AA 1PYSB 5D4PA 5DGBA 1FA0A 5K14B 1IR1A 2I2YA 3M8ZA 1YG0A 3RW6A 2V2QA 2Z2ZA 2VOOA 2DNOA 4X4RA 4FYYB 2WAQD 4QBUA 4URGA 2DK2A 4YR3A 2DGUA 3PW0A 2MQOA 3CF5Q 2DXDA 3K8VA 3W2WA 5LSRA 2W7AA 4WU3A 3M8PA 2OPRB 1Y7PA 2CRLA 3DRRA 4H4OA 4NYPA 3WDOA 4LSZB 4AE5A 4O4GA 3QO9B 2AYBA 2NREA 5LXYA 3BR8A 2R8GA 4DG1B 3T1HJ 1AZSB 4B9SA 3OL8A 2Y9HA 3BV8A 1T0TV 3LP0B 1V5VA 3TNVA 3OL7A 4CIOA 5HP1B 5KG1A 4CLKA 1Y3JA 1YSJA 2E7XA 3VAHA 3WHIA 1YQHA 1WOPA 4DQPA 3TP2A 4MKBA 3I82A 4DSEA 5F0UA 4AXJA 2R7SA 1Q4RA 1IQZA 1UVKA 4LFCF 2YY3A 4PG7A 1WDTA 2W24A 3GWCA 3FFIA 3QAEA 3HVTA 1IKXA 3FBBA 2MLXA 2HQGA 4B17A 3SV3A 2PT0A 4K50A 4FYVB 2GMJA 4ZIWA 4R0EA 3Q83A 1T03A 3M8QB 4ECQA 4USVA 4DPXA 4GO7X 2DNKA 2RRNA 2HFUA 1NHVA 3OLAA 2VL1A 1VQNS 1GMWA 3CCZA 3THVA 1R3NA 2AEMA 1TL3B 3ISND 2ZBPA 2GQCA 5LMNJ 2XSJB 1XMOJ 3KLGA 1X31C 3HKZD 4NA1A 2HQDA 1SKUB 4B08A 3AD8C 3H7HB 4CYUB 4CO2A 2CJKA 2NCKL 1CVJA 2B4VA 1RU1A 3VQTA 1GXTA 2UUAF 3DDIA 3SXLA 3R7BB 5IM0A 5F8LA 4N41A 3I9V9 1NK9A 3CC7S 4Q0BB 1WUUA 1S6PB 4URSA 1AROP 5CD4H 3TJ9A 3H90A 1BE4A 4YOEA 4ED0A 4KGKA 4DF8A 4MFBB 4A46A 5L9XA 1JKHA 5GAGU 4ECRA 1CS4B 2V8VA 2GNKA 4DUYJ 4ZLPA 2U1AA 1J5EF 5KFCA 2XGQA 1W2BR 5M2RA 2L48A 5KFVA 4KHMA 2E1CA 2BE7D 4RO0A 5AE3A 4I2PA 1WTFA 5BR8J 1Q81T 1EIYB 3G2XA 3BS9A 4YR2A 4RW8A 4ID5A 5GAEU 3ZZZA 4DR7F 3MMAB 1K47A 3DU5A 2NUUG 4CNZA 2MKJA 2BX6A 4IO1A 3IG1A 4FZVA 3O1LA 4DQQA 2WSCC 3BN4A 2I8EA 3LTOA 2MSTA 2IJFA 2HNYA 3MCSA 4PUOA 1VRTB 3PVXA 4DLEA 3CJKB 3M2RA 1TL5A 3DGPB 3MI7X 2GW8A 3AOCA 3PKMA 1JWWA 2RD5C 1RBAA 4DL2A 3M7VA 3MF5A 3I32A 1XR5A 4HYKA 2PFDA 4DR5F 4B3MF 2J7UA 4RBVA 3WIVA 5DDOC 2CJXB 2KVQE 3DOLA 3CCJS 5A76A 2ZJRQ 2DKOB 3LWLA 2HAIA 1KONA 3UDEA 1WELA 1PSDA 2FJEB 2E5JA 2FIUA 4WBFA 2U2FA 3PR4A 3NEKA 4C11A 4P52A 2BOAA 5RUBA 3TARA 4FF4A 3CO0P 4ES1A 2YKMB 2CPXA 3C3LA 2VBXA 1RT7B 2J0WA 4CH7A 3KK3B 2ZKTA 3CD5A 5KG2A 3KLIB 1GFWB 2YKNA 4EZ6A 3BREA 2DHSA 5DG8A 4C97A 1NKBA 4HEA9 4RU2A 2XZDB 3UDVA 3W2VA 1U1KA 3CCSS 1N52B 2HGMA 2KVIA 2EFPA 6AT1B 4ZITA 1RGVA 4YN3B 1H2TZ 2KM8C 1CJVB 3D68A 5L9NA 4WK1A 3JSMA 4E98A 3CUNA 1WHWA 2GX8A 3LW5C 3JTNA 2Z56B 1IBKF 2YNHB 3T9ZA 2DNGA 1U25A 3MGJA 4XTTA 4JYAF 3CD6S 2MQ8A 3A1YG 3MECB 2HVEA 2ZEJA 5A8RB 2J9EA 3IBCB 4M95A 2Y0SD 3E51A 4HACA 1X4CA 5HSPA 1S1XB 4LFBF 3BQ2A 3HFKA 2GIFA 3MPWA 1SQFA 5B08A 4NMLA 2OFHX 5E3QA 5C5JA 2MKSA 2IBKA 1ZAVA 2XSFA 3PHTA 4QJVA 5IV3A 4MJKA 4BC9A 2HNDA 2Q3PA 5KFEA 2KM8B 1YTYA 4EBDA 3FGVA 4XO0A 1V6HA 4U6PA 4DPUA 5THWA 4JI7F 3DDKA 3TX8A 2B4OA 2FHJA 3OFEA 2ZH8A 4I64A 1FRHA 1X7VA 3V81A 3J81j 1W2IA 4CLUA 3HSGA 5JJBA 4DV7F 4J9RA 4KR0B 5HN0A 1MWQA 5K8OA 2AZ3A 4WFAQ 1X4FA 3MUVP 3N5BA 3SFGA 1DLOA 2D3UA 3BH6B 3K5LA 2R8HA 1JLGA 2VJVA 4JV2A 1HBOB 1Z2LA 2FHMA 2RQKA 1UL3A 1WWHA 3R7SB 3JYTB 2OGUA 3D0GE 3MM5B 1URNA 3T19A 2WVEA 1KS2A 3P8BB 3SV4A 5C25B 3S6EA 2VG7A 2XS2A 1Q8KA 1L3VA 1URRA 5CA5A 1FRIA 1U4BA 1OS5A 1WC3A 1K73T 3A8JA 2M4MA 3KNGA 5DZ6A 2ALYB 4A8WA 4XPEA 1QUPA 3B4DA 4QOTA 2O5DA 1HHTP 1Q16B 1SIZA 2K1RB 2W9BA 1WNEA 3ILJA 4F4YA 4BS2A 5B0AA 1CQMA 4ZCMA 3MAQA 3GE9A 3TA2A 5H9FJ 4Y34A 4DR3J 1FRJA 1TR0A 3HM9A 3BN7A 3Q86A 3RBXA 1NNDA 3ILIA 3DLLQ 2OP5A 3GLJA 1DURA 3NCRA 1SKWA 1SL1A 2YKAA 2X1FA 2NXUA 2CIMA 4RW9B 4UT4A 2GZOA 3TX0A 1AFJA 1RAFB 3FCVA 1MU2B 5GADI 1KNZA 3LANA 3D1QA 5HATA 1A0OB 1BQMB 3M9NB 2A6MA 2DR8A 2YVSA 1RWPB 5F8HA 1JJCB 3FQKA 3GMGA 1VHFA 2ZVIA 1X4AA 1JLBA 5I3PA 4ZCIA 2K3KA 5EN1A 4OYWA 1TELA 1VMBA 2ZC4A 2HFVA 1K44A 4IRDA 4ZK7M 1B0PA 1LW2B 1YIJS 2M70A 3D1OA 4CTAB 4B3OB 2GMHA 2JFKA 4N8NA 5CYQA 4FYXB 3HI9A 4DR6F 4TKTA 4YY3F 3QLHA 1H2VZ 2EPIA 4MT1A 2ATCB 5F8NA 2G13A 1H0HB 3UCUP 5D3GB 4K0KJ 3T1YJ 1RBLA 4LIWA 4F36A 2JOQA 2BDPA 3OXFA 3HHLD 3BB5A 2BRLA 2E44A 3FSIA 5M2PA 4ED3A 2E7WA 4WIQA 1TKTB 3BGRA 1NCLA 2PO4A 1EX8A 2ATLA 3QWPA 2VZ9A 3DLGA 2WVFA 4ZVSB 5F8MA 4MK7A 2FVCA 1U09A 1MMLA 2CFXA 2CQ0A 3EICA 5I3QA 3QGGA 3HK2A 3MPVA 4TNOA 1QY7A 3MD3A 1NSKL 4OHYA 3O2IA 1FJCA 1YWXA 3DRPA 2L41A 2D9OA 5D4LA 3HZEA 3PW4A 3MHYA 3BBFA 1UWBB 2AJ4A 3PJ9A 2Q6BA 3CSKA 2WBRA 4JV5J 2W4PA 3QFHA 4EBCA 1TL1A 2UUCJ 2B56A 5I3UB 3GG1A 1Q5VA 1NKEA 5IC4B 5DM6Q 1B70B 2F4VF 1HYSA 4HH1A 4HI1A 2GA7A 2B6AA 5B0GA 3H2LA 2HGLA 1RKIA 4DCOB 1EP4A 5KT5A 2EG1A 1KLMA 1S97A 3RB4A 1UPMB 2E7VA 2M3DA 2DGXA 2ZM6F 1H74A 4F3OA 3ZTQA 5CZXA 1WKKA 3EM1A 2ZWOA 3E01A 1YRUA 2HYIB 1RBOB 2K2PA 4G3IA 4NZ0A 4YEAA 3CD7A 4NZ7A 3PYEA 3DC2A 2P6TA 1S1VB 3QWUA 1RAOA 3MR7A 1VRQC 2QV6A 3BGOP 1ZAXA 2XQCA 1OWXA 2KT5A 2R7TA 4CI0B 4ZS6A 3BSAA 5D8HB 2EI5A 3HSZA 3PG9A 3DOMB 4X66F 3B54A 4R5PB 2KXFA 3RAQA 1OY9A 5CD4A 1TKDA 1NJWA 1IR2A 2BABA 2J9DA 1FT8A 3PW2A 4K4YA 2BKOA 2IJNA 1JX4A 3M8YA 3FBEA 2W9AA 1FJEB 4PR6A 4TLRA 3ET6B 3MR3A 3V6HA 2BQUA 3EX7B 5AXKA 3UN2A 2HNZA 3DHWC 2GS8A 1TAUA 1WSVA 2WONA 3VWSA 4RW6B 4PWDA 3MDFA 5GVQA 2R7OA 4KQZA 1X5OA 1FRMA 3W62A 3T1AA 3BGUA 2DITA 4J9QA 1NZ8A 2DXEA 2DH9A 4ZPBA 2IAJB 5E3PA 4ZJOA 2FVSA 4I4BA 2FY1A 4M5DA 3OR2A 3CCWA 2WVCA 1YJ9S 2V8PA 4HL9A 5IWAF 3HHDA 4U8YA 3CMAS 3G4SS 4Q5VA 3IM8A 3R5BA 2MQNA 1Y4ZB 2PFFB 3AT1B 5C2GA 4L76A 4ZLLA 3CCTA 1S6OA 2LQ9A 4ILLA 2UUBF 3UNGC 4AD6A 4DFMA 4OX9J 4ZP7A 4DWIA 4DV1J 1AB8A 1SC3B 3L95X 3TUJC 5HBMA 4ZLNA 1GTHA 2CZ4A 3R5GA 3HO1A 2IJRA 1RK8A 1T94A 2LECA 1VQSA 5KFKA 5L1IA 3CC2S 2V6AA 1SC4B 2YX7A 2YBVA 2Q66A 1WKJA 4OI1A 4JI2F 4O3OA 4ZLJA 3M32B 1NH8A 3WQPA 4DU8A 2LA4A 5F8IA 3GJTB 2O3DA 3CJ5A 2DRDA 4KH0B 3EGZA 3NWGA 4KFBA 3SCIE 4LRDA 2GHVC 4FXVA 1FFSB 1RTZA 3PEJA 2UXCJ 3TWZA 3DLHA 3R5AA 4AL6A 4RKUC 4Y2AA 2FJWA 3ZZ0A 1FERA 3SSQA 4H4MA 5EHHA 3MFIA 2G0JA 5CYMA 2ZD1B 2Y0BB 1CJTA 4WCEQ 2ZUAA 3KLHB 2ZBIA 1U1OA 2CPDA 4JI1J 4X2BA 2ZH1A 2JRSA 4I6YA 5E3RA 3FEXB 3ZNUA 4DX8H 3ENQA 1L3KA 1TL7A 3A4TA 4WFBQ 3IRXA 2VIHA 2BUNA 2KL8A 4OL8A 1T11A 3QRPA 3NCQA 1UJ6A 1ZAWA 1DZ5A 1D9FA 1E6YA 1PIEA 4UOFA 4QZVB 5L1JA 1MLAA 5ETSA 1NLKL 5JXSA 2DNRA 4YMEA 1NDCA 5LSOA 2EFGA 4Y00A 5KFHA 5A6WA 3NS5A 3KJQB 3UNYA 1WACA 2CPJA 1EQ0A 1SCJB 1S1TA 3V6DB 1HNWF 3NY0A 4CH0S 5L8RC 2AMCB 3TVYA 5FDLB 1VDHA 4FS1A 2GAHC 3S01A 4XAKA 2CQBA 1DTQA 4ES3A 4P71A 1N36F 2KYZA 2B51A 1R0CB 3EPIA 4IOAQ 1FKPA 5KT3A 3TRGA 5K9FA 1NEEA 1SIWB 1TUGB 1WF1A 3BH7B 1GAOA 2R2TA 1R0AA 3CWJA 2MQQA 3Q8PB 1XEZA 3DYAB 3M8PB 4TY8B 1SQEA 2J5AA 3NS6A 3NAHA 1RYRA 3MM9A 4DDFA 1OSCA 3GYNA 1NMEB 1X0PA 3KK2A 2LVWA 2AQ4A 2FGOA 3QT5A 2QFJA 4NCGB 2GMLA 1U26A 3U1NA 2MB0B 4WP9A 2HPUA 4KGXB 3ISZA 1RAAB 2KXNB 1NDPA 3IMQJ 4QWBA 2DR7A 2YNIB 5DLFA 1RTJA 1VJWA 2HMIA 4CO5A 4FPRA 4JB8B 3GJRB 3FFIB 3HVTB 4CT9A 1DHMA 1LFWA 4A8QA 2MHEA 1W25A 3ZNJ1 2KXHA 4CH1A 3EZ5A 2FYXA 4P2SA 4ZHRA 3QT8A 1Q78A 1AT1B 4LF7J 1WOOA 1HWLA 3H0PA 2UVWA 3CJQA 3SSRA 4ZPWR 3MM7A 1QDUB 3MMBB 4KIAA 3FZBA 5E5NA 4PYDA 1DQAA 1VS3A 2EK1A 4X4PA 4J9MA 3ONQA 3QMQA 4OI2A 1I6JA 1NPRA 5J1EA 1HWJA 5IQ6A 4Z37A 4FDFA 4CLTA 4DL6A 1PYOB 2VQEJ 4ELUA 2AW0A 1R6YA 4R8UB 4C8YA 1VQPS 1RT4A 4Y2IA 3E8OA 3V4IB 3DDNA 5CXTA 1U2RA 1W26A 1ZA1B 1MNEA 1RT6A 1VQ6S 3DCAA 3ENAA 4MTPA 1FK9A 5IS2A 1LFPA 3D6TB 4F4WA 4XIUA 1L3SA 3DMJB 2ACYA 3PZPA 3JTPA 1IJFB 2QO3A 2O1PA 3BGFA 2R8JA 1U45A 4W90B 2XHWA 2B43A 2GFFA 1IBLJ 2DNYA 1CJUA 1DTTA 1KQFB 3DGVA 2FGCA 1IKYA 1H7XA 1BWVA 4IRKA 2PI5A 5HVFA 4RW8B 1WD6A 2CDRB 4ID5B 3H25A 3TAQA 1QUVA 3ZTPA 4K2JA 2MGZB 2CQIA 4FS2A 2BRKA 2MJNA 2CWKA 3G8QA 1S1WB 1XNRJ 2JHEA 2V9KA 1GXLA 1HHSA 3V4MA 7FD1A 3PX6A 4X4UA 2LEPA 2F5GA 4PUOB 3WX8A 5BJRA 3CXCR 5GAGI 1NH7A 4N77A 1G3OA 3LF0A 3BEGB 3DLKA 2RUGA 1LWCA 3G8TA 3N79A 1RHJB 1VQOS 3OUYB 2LMIA 5GAEI 4OX7A 1JLFB 1VQLS 2EFQA 1FFWB 3HVWA 5BXIA 1D8YA 5K14A 3G86A 1OQ3A 2G2ZA 2W01A 4ZCKA 1JB0C 1SJ3P 1UW4A 4KGVB 1FFGB 4LBPA 2HGNA 1ZTTA 4Z2XA 3OR1B 1ITPA 3MTKA 3JXOA 4LF1A 2OPRA 4NLOA 2YWEA 2YKNB 2XCPA 2A2DA 3KLFB 2ASLA 5HQ8A 4M5GA 3Q24A 1WORA 2Z30B 4NLTA 1N6QB 4QYZK 4EGLA 1AZSA 4UF4A 1HARA 2JVRA 4L72B 2ALZA 2E1AA 2YWGA 4ZJLA 4LJMA 2M8HA 3F41A 4ZDNA 3TOQA 3W9HA 1N54B 1WC0A 2V4QA 3GIRA 4QPXA 2F9DA 1SQGA 1FX2A 4DV0F 1NHKL 2C2RA 4A8OA 4DSJA 5J2MB 4OV6A 5FJ4A 2KO1A 2RT3A 1JMTA 2E29A 2Y1JA 1WG5A 4LQ9A 1B64A 4QW8A 2DNPA 2KN4A 3M8QA 4JI8F 5KFUA 1B7YB 5IFMA 3CJ4A 2PEBA 3G9CA 5GMDA 1TQLA 4AUKA 3EPGA 1TL3A 2HNDB 3HJVA 1MWZA 3N6LA 4ECSA 4NRUA 2HQFA 1WF2A 1S0OA 4B9MA 2CVEA 4ZA1A 1WC4A 3VTIA 3JAMU 2V2VA 4ERDA 4CYUA 4ZCLA 3CCUS
chains in the Genus database with same CATH topology
2MZRA 1HMVA 2DH7A 4Y2KA 3C66A 2XC9A 2GIRA 2X1AA 1HD0A 4WU3A 3M8PA 2OPRB 4KO0A 1RQ0A 3IGNA 3BQ1A 1Y7PA 2CRLA 3DRRA 4H4OA 4OJ1A 4DF4A 4NYPA 4NLDA 3WDOA 2HFZA 4JBCA 3I5AA 2JEJA 4IG0A 3B82A 3NBPA 4AE5A 4O4GA 3QO9B 3ZZPA 3K59A 2AYBA 1FDNA 1LWFB 5LXYA 2NREA 3BR8A 2V4JB 3I31A 3U1MA 1LW0A 5KFIA 5FLXY 2R8GA 4DG1B 2VPXB 1ZETA 1TP7A 3V81B 4IUFA 1MW7A 4H54A 1S99A 3GIJA 2L9DA 3J7Z5 4B9SA 1F5AA 1HBMA 4QIEA 4NLSA 3OL8A 3SCLE 4NA3A 1B7FA 3TQ1A 1XR6A 3LP0B 2IA0A 3TNVA 2MSSA 3OL7A 4WE1A 4CIOA 5HP1B 5KG1A 4MFBA 5FIIA 5DDRC 3N28A 1Y3JA 2KKHA 4USJC 3KK1A 4DL7A 1YSJA 2E7XA 3VAHA 4USHA 3GSDA 2VG6A 1YQHA 4IFYB 4RW7B 2YH1A 2FTRA 4AL7A 3KG0A 4DQPA 1S6QA 3TP2A 4MKBA 2ERRA 3I82A 4N47A 4DSEA 4LFAF 2M2BA 3FRZA 3M9OB 5F0UA 4AXJA 1X9MA 1Q4RA 2R7SA 3N5FA 4A4JA 3M1VB 4RZRA 2N82B 3MEGB 2F8EX 1IQZA 2DHGA 1UVKA 2I38A 3OTEA 1HW8A 5G4DA 1OSDA 3AY0A 1JLAA 1HL6A 4LFCF 2W7OA 2YY3A 4PG7A 4OZ0A 2W24A 3U27A 3GWCA 4GMKA 1JLGB 3FFIA 3QAEA 2PSZA 1TKZA 3HVTA 1IKXA 3PIOQ 2AU0A 3BM7A 1OQ6A 2YNGB 4B17A 4K2XA 2J0XA 1PC5A 3QGHA 2ZE2B 5I42B 3SV3A 2PT0A 1WEXA 2F1FA 2YKQA 2QA4S 2KHDA 4K50A 2GMJA 3WZ0A 4R0EA 1K1SA 2DT9A 1T03A 3M8QB 3IA0A 3PEHA 4ECQA 1VGYA 3KLEB 3K57A 2UV8A 4X4OA 3H2UB 3G8SA 2FLOA 4GO7X 3MMAA 4RU9A 1IJEB 4UUWA 2A2CA 2ZZNA 2DNKA 4FF3A 3OPKA 3OVBA 2RRNA 4F2SA 1FKOA 1S9GA 3HXMA 1NHVA 3OLAA 2VL1A 1VQNS 1R8PA 2ZOFA 2IYGA 3CCZA 1SUQA 3THVA 5HL7Q 1R3NA 3Q8QB 4ICLB 5DG7A 4B9TA 1X5TA 4NLUA 4ED6A 1JLEB 2VG7B 2B5JB 1TL3B 2MHNA 3ISND 3OVAA 4F2RA 2GQCA 4OI0A 4GO5X 3HKWA 2HS0A 2XSJB 5C42A 4NLYA 2B9XA 3KLGA 4TLQA 2VFSA 1NB7A 3HKZD 2YH0A 1D9DA 1KVIA 1HBUA 4NA1A 4ED5A 4C8KA 4B9LA 2NPFA 2HVIA 4B08A 3FDSA 2LEAA 1X4EA 3MTJA 3CJKA 3W2WB 3AB4B 4CO2A 2CJKA 3RR8A 3DGPA 1CVJA 2B4VA 3C8YA 1C4CA 3VQTA 1GXTA 2UUAF 4C8NA 3UDLA 4A8SA 3KTQA 5EWEA 1JJHA 4KO0B 2XB2D 2Y1IA 2VV5A 3DRRB 5K8NA 4H4OB 3SXLA 4Y6IA 1VC5A 4DR4F 5B0EA 2ZVSA 2GJIA 5A0YA 4QYZJ 1WHVA 2DBBA 3NBPB 1FF2A 4O4GB 4QIWD 5IM0A 3WC2A 5F8LA 2LA6A 1TK5A 4N41A 2PMZD 3I9V9 3MAHA 1NK9A 3CC7S 4Q0BB 1S6PB 3CDUA 4URSA 1AROP 1C1BA 5CD4H 2VFRA 2CPYA 5D78A 2R8KA 5HI7A 4ZPVR 4BDPA 1RA6A 1HBMB 3ENWA 2EW9A 4X4QA 6FD1A 4YOEA 4XK8C 1FTCA 1WF0A 1P9QC 2MQLA 4ED0A 4KGKA 2D3OR 1RTHA 1S77D 4DF8A 4I6WA 4WE1B 3SYZA 1NJZA 4MFBB 4J9KA 2BJDA 4IH6A 1WI8A 4KC5A 4A46A 3SSSA 4NCBA 5L9XA 3OV7A 3HP6A 2CQ2A 2BQRA 1JKHA 2MKCA 3Q22A 5GAGU 4ECRA 5B0FA 1YJRA 3PV8A 4K4UA 1S6QB 5KFDA 1FNXH 1HD1A 2V8VA 2GNKA 1C1CA 4ZLPA 4C4WA 2M0GB 3LAMA 2NPIA 2U1AA 2M9KA 5IZHA 1J5EF 2AGOA 5KFCA 2RU3A 2V8GA 3OTDA 7FDRA 2XGQA 5B7WA 4Y65A 1RWUA 4IG3A 2AYGA 1W2BR 5M2RA 1G2EA 2L48A 5KFVA 4O3SA 4KHMA 4PWUA 4HT5A 2QT7A 2YKMA 3N6NA 3GV7B 3NMAA 1KFSA 4DQSA 2E1CA 2OSRA 1TKZB 1NK6A 1IKXB 4LT6A 4C8MA 5AE3A 3GB0A 4I2PA 1WTFA 2RNEA 1RT7A 4NOHA 5EWGA 3PW5A 1Q81T 1PC4A 2XBPA 3KK3A 1GQEA 3BS9A 4QIGA 3VAJA 2RF2B 4YR2A 4RW8A 4ID5A 3KLIA 2HS4A 2NUHA 1T03B 1U1MA 4R0JA 2ZH7A 1X4DA 3N01A 4ETXA 2VB6A 5GAEU 3ZZZA 3L3CA 1N48A 3IS9B 4DR7F 4EEYA 4LMZA 4OV1A 2QLXA 3OVSA 3MMAB 2FHKA 3DU5A 3WBZA 2NUUG 4CNZA 3BZQA 2MKJA 4E8UA 4C7QA 1FKOB 5E3AA 4IO1A 2BJEA 4QW9A 2ASYA 2NYIA 3NAIA 4DN0A 2ROEA 4U67Q 3MURP 3IG1A 1SUQB 4FZVA 3SI8A 1NRKA 3O1LA 3DFEA 4DQQA 4MYUA 2WSCC 1SL2A 3BN4A 4FN5A 2AF6A 1X4GA 1EETA 2HHSA 1RTIA 2I8EA 3CT9A 5DDQC 4EBEA 5IT9Y 3MR2A 2KZMA 2CQGA 2MSTA 2GC8A 2IJFA 4C0HA 2HNYA 3MCSA 1UVMA 4G1QA 2MKIA 2MKHA 5KG5A 3JTOA 4C0OC 3T1HF 3KLGB 2ASJA 3M6XA 4HDHA 4MIAA 1LV5A 1VQ8S 4GKKF 2HVHA 1FTRA 5KT4A 1HBUB 2IBOA 1VRTB 4PUOA 3PVXA 4OX6A 4GKJF 3CPWR 3CJKB 1X4HA 3ETOA 3M2RA 4DLEA 1TL5A 4DSKA 5IT4A 3MM6A 3MI7X 3QLHB 4X62F 4RNNA 2CZVC 2V0NA 3VCDA 2GW8A 4V19X 2E9TA 2VONA 2XY5A 1F9FA 3PKMA 3MECA 2RD5C 4DL2A 1JWWA 4ECXA 1OPZA 2UUWA 5KFWA 3MF5A 3MR5A 3I32A 2C42A 2XY7A 5A0YB 3DLJA 3OL9A 4ED7A 1XR5A 4HYKA 1VQMS 5IM0B 2KU7A 3H5SA 5A8RA 4DR5F 2DO4A 5B09A 2RJZA 4DL3A 2KH9A 3I4HX 1U6ZA 1M5PC 4B3MF 2H9ZA 2L08A 2FHOB 1S1XA 4EUVA 3CCRS 3JB9k 3J7A1 1Y5LB 2J7UA 4RBVA 3DM2A 4IR9A 5DDOC 4JOUA 4A8XA 5BYSA 2UVVA 1SJRA 2DHAA 3RR7A 1HQUB 3DOLA 1RTHB 3KG1A 3RW7A 2UU9F 4YFUA 3CCJS 4NL5A 1X5SA 2J6TA 4ECTA 2XZWA 1SKSA 2ZJRQ 2BA9A 1UA0A 3LWLA 2HAIA 1KONA 5KFSA 1M90T 1C0UA 4IO9Q 1JKHB 1VRUA 2R7XA 4NLPA 3DRYA 1WELA 1PSDA 2BBEA 1QVFR 3KG4A 3A8EA 2FJEB 2E5JA 2M52A 3IR7B 1C1CB 1G7CB 2FIUA 2U2FA 3IFEA 5F8GA 2YWKA 3PR4A 1Q8BA 5J1NA 3PX0A 1S10A 3N0VA 4C11A 2CG4A 3TARA 4FF4A 4IG3B 3AH6A 2OPPA 2MQPA 2C2EA 1NK8A 1S76D 3Q23A 4ES1A 1JLCA 2YKMB 1RT2A 2CPXA 2QE5A 1WEYA 5A2QY 2PA3A 3C3LA 2ZOMA 2IA6A 4AYBD 2GHWA 2VBXA 3BDEA 4I2PB 3CJ3A 1FRLA 1RT7B 2NSBA 4K4ZA 2VASA 2J0WA 5LMNF 3LP1A 3OFGA 3RAMA 4CH7A 3KK3B 1KQKA 2ZKTA 1XMOF 1G6BA 3CD5A 1ZM4A 1KEKA 2LDYA 4WYLA 2IM0A 1RT1A 4OHXA 2JJ4D 3MOZA 5KG2A 2V5HG 2PN6A 3DRXA 3KLIB 2O67A 2YKNA 4LIRA 3OFHA 2DGQA 4LF8F 4EZ6A 3K7RA 3BREA 2DHSA 5DG8A 4C97A 2E9ZA 1NKBA 2V2KA 3DI6A 2ZHOA 1H3DA 3LPYA 3NP5A 4HEA9 4RU2A 4TYBA 3I6PA 3W2VA 1UEVA 1U1KA 1D8ZA 3CCSS 1N52B 2HGMA 2KVIA 3IG1B 1N4LA 1RDRA 2EFPA 3ULHA 2KRRA 3I0RA 2AP6A 3TVZA 4H4KA 2ZH4A 3GV8B 4DR2F 1FVSA 1FJ7A 1BLUA 1RGVA 3OXLA 4M1KA 1OPIA 1WHYA 1KVJA 1H2TZ 2KM8C 4ETZA 3UQSA 4JI3F 3CCVS 3FRYA 2PIIA 2UVUA 2DNQA 2HNYB 1SB6A 4G1QB 1T3NA 4KT0C 4JI5F 4DJBA 1K0TA 1CLFA 1SXLA 2WK4A 2BQ3A 5L9NA 4WK1A 3JSMA 4OZ1A 3TAMA 4E98A 3CUNA 1WHWA 1TL1B 2GX8A 3LW5C 3BGLA 3JTNA 1FDBA 2ABYA 3M2RB 5D4NA 1SC6A 2A18A 4ZPTR 1IBKF 2YNHB 3T9ZA 3N6MA 2DNGA 1U25A 4Q2LA 3MGJA 4ECWA 4JYAF 3G6XA 3CD6S 1DARA 2DIVA 3S8SA 3I87A 2OLWA 3MPYA 2I5JA 3A1YG 1K9MT 3MECB 3FQLA 3BO4A 1C0TA 2HFNA 1N5SA 4DUYF 3FCHA 2O66A 2PA8D 3C6UB 5A8RB 3T5KA 2J9EA 2ZBCA 3POTA 4M95A 2Y0SD 3HLUA 3DHXA 3E51A 1X4CA 4WFNQ 1HBOA 4WU2A 1CC7A 1FD2A 1V9OA 1EP4B 1S1XB 2F7VA 3FSYA 2DCUB 4O4RA 4LFBF 3BQ2A 3HFKA 4H4KC 2DGOA 2YTCA 5DLGA 2N3OA 2ZKUA 3MPWA 3JYTA 1TV6A 3DOLB 1KTVA 5B08A 4KV8A 3PW7A 3B8HA 1WHXA 4NMLA 2V8HA 2OFHX 3B4MA 5BR8F 5J2PA 5E3QA 4QQBA 2MKKA 4ECVA 5C5JA 4RNFA 5KFFA 1C0UB 3MM5A 2ASDA 2WOMA 2MKSA 3HHKA 3CE8A 1TZ0A 4ZVEA 2IBKA 1ZAVA 1S1UA 2XSFA 4QJVA 2DHXA 3SZ2A 4FF2A 1Q1KA 1N5VA 4ZMMA 4MJKA 2V4RA 4WFYA 2FJBB 5LJ3Y 2BV3A 4BC9A 2HNDA 2Q3PA 4C11B 2N3LA 2XMVA 2KFYA 5KFEA 3BQ0A 2ROGA 2KM8B 4F02A 1T8EA 4DFJA 4N8OA 4C3MA 1YTYA 4L6V3 4WFXA 3M30A 4J9NA 4EBDA 1K0VA 3FGVA 4RWXA 4XO0A 1V6HA 2W8LA 1QSSA 2XI2A 2AX0A 2AJ1A 1HI1A 4U6PA 4NXNF 2ZNYA 2VA2A 1IN0A 2HLTA 4U7CA 3VR1A 4DPOA 1HWKA 3UW1A 5THWA 4JI7F 3LP1B 5LXRA 3DDKA 1S9EB 3TX8A 2ZDOA 2X3GA 3MEDA 2B4OA 4G1IA 3Q2SC 3QZ8A 3CCMS 2RDIA 3L09A 3EXCX 1XMBA 1S0NA 1I1GA 3DXBA 2RH3A 4BBYA 5C24B 2FHJA 3DI6B 3QO9A 4KRWA 3OFEA 4M63A 2KJVA 4I64A 4CT8A 1FRHA 2ZH8A 2V4JA 1X7VA 3CD0A 3W2VB 3KOAA 1UMJA 2GGPB 4DG1A 3KJVA 3V81A 1W2IA 4DS4A 2QMWA 2HVZA 5K8PA 5JJBA 1FE4A 4DV7F 4QIVA 4RNHA 4OZJA 4ALZA 4XDCA 2IMWP 3M8SA 3G6ES 1X8DA 4QR2A 2AYEA 2DD8S 4J9RA 3LP0A 2Z2MA 4OJGA 2VFVA 5HP1A 4KR0B 2NLWA 1LKZA 4ZKAA 4AXIA 5HN0A 2FDNA 4DQRA 5K8OA 4WFAQ 5K5MA 1R43A 3JSMB 3TAMB 2JEFA 4RW7A 2KG1A 4ZPAA 1X4FA 5F9LA 3C46A 3OHAA 4DL0C 2PGCA 2YKOA 3OBIA 4YB7A 2MXYA 2C28A 3MUVP 3OTBA 3M8RA 3CDAA 3M1VA 3K8WA 3N5BA 3LH2S 2BOPA 3SFGA 4NX9A 1DLOA 2D3UA 2DO0A 3K5LA 2HHWA 2FD2A 3K5PA 2I5JB 3AQPA 4ZPCA 4GC7A 1F0XA 1FHTA 3K5OA 4ECZA 2R8HA 1DAXA 3D5MA 1JLGA 1KRPA 3NLCA 1X4BA 1X9SA 1HNZF 4NLXA 3PHEA 3DRSB 4ES2A 2CQCA 3U7JA 2C3OA 3AJ2A 3HT3A 1KFDA 2E5IA 2WONB 2FJDB 1HBOB 2YNGA 5CH7B 3V6JA 5I42A 1Z2LA 4JV2A 4PWDB 2FHMA 1N33F 4IYQA 1BQNA 2RQKA 1UL3A 1V3RA 1N5YA 1H38A 1WWHA 3M4XA 3KMQA 3TAQA 4OJHA 3JYTB 1OIAA 1VC6A 4L3NA 4FVCA 3PIPQ 2E1MC 4QR0A 4F25A 3CIZA 5G0RA 2OPSB 3D0GE 3MM5B 5GAHI 3F56A 2E9RX 1URNA 1F5BA 1XERA 4J9SA 3T19A 1R8HA 1KS2A 3SV4A 5C25B 4I0WA 1NU4A 4NA2A 1S7HA 1S1UB 3S6EA 4F4ZA 4OX8A 1VK8A 2VG7A 2VOPA 2XS2A 2P6SA 4A8FA 1OO0B 1RA7A 4M5DB 2C2DA 4FBTA 1L3VA 5KTQA 1URRA 1LW2A 5F41A 4M94A 5CA5A 2AV5A 1FRIA 2XSJA 3K2YA 1U4BA 1OS5A 2B7CB 3M30B 5AXMA 5KG4A 1K73T 5DQIA 2M4MA 2GQ2A 3KNGA 2IC3B 2ZUGA 2VH7A 4X84A 5GMKa 4A8WA 4XPEA 1N0VC 1QUPA 5SUHA 2FHJD 1SV5B 1Q79A 1VI7A 2DGSA 2VC0A 2PD1A 3MEDB 3B4DA 1QJHA 4QOTA 2O5DA 2VPWB 5SZTA 1Y5NB 2XMUA 3PKYA 1N8RT 2HHQA 1HHTP 3RTVA 1Q16B 1SIZA 2BE2A 3FMWA 3QIDA 2UXDF 2K1RB 1KN6A 2W9BA 1M5OC 4WXWA 3KWMA 2ZOGA 4KBIA 1WNEA 2DGWA 4DEZA 3BR9A 4I69A 3MM8B 3T5LA 3N4WA 4F4YA 2M7SA 3KJVB 1U6BA 1JNZB 4LF9F 3UE2A 3SEOA 4Q0BA 1S6PA 4BS2A 5B0AA 1CQMA 3DN9A 3IR6B 1KOOA 4ZCMA 2B3TB 2IYIA 3MAQA 3PO5A 3GE9A 1MWYA 3TA2A 5H9FJ 5CHCB 2M88A 4LF6F 2IVFB 4Y34A 2VFTA 2JEGA 1FRKA 4B9NA 5EX0A 4F3QA 5HBMB 2CJBA 1FRJA 1TR0A 4Q45A 5HLFA 4KGMA 4NRTA 3GFHA 3HHLA 1ZTWA 1ZPWX 4Q44A 1TKTA 3HX9A 4CNYA 3HM9A 4K4SA 1P1LA 4Y2MA 3MMJA 3BN7A 2ZJQQ 2L9NA 1A7GE 2ZH9A 1D1UA 1NNDA 2Z0GA 4WIIA 4JI0F 2IFXA 3OHBA 1P27B 3PJXA 4FP9A 3JAMY 4HVZA 4HKQA 5JVHQ 2HS3A 3BF4A 1DLOB 2XWXA 3DLLQ 1BY9A 1VQKS 2OP5A 2A1BA 1DURA 3NCRA 1JXLA 2DNMA 1SKWA 1SL1A 4TU7A </