3GPAA

Crystal structure of the mimivirus ndk n62l mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gpaA00
1BHNA 3VGVA 4F4AA 3Q8YA 2VU5A 4ANCA 3B6BA 4FKXA 1HHQA 3FCWA 3PRVA 4ANDA 3Q89A 1ZS6A 3BH7B 1W7WA 3Q86A 3BBCA 4UOFA 3BH6B 3VGSA 3ZTOA 3BBBA 1KDNA 1XQIA 4S0MA 2DXEA 1U8WA 3NGSA 1JXVA 3EVOA 1NSPA 1NB2A 3PJ9A 3EVMA 1NSQA 1NLKL 3EJMA 3NGUA 3FKBA 1F3FA 4WBFA 3B54A 3FCVA 2B8QA 1NCLA 3NGTA 5BXIA 1S5ZA 1WKLA 5CABA 2DYAA 3EMTA 3JS9A 3EVWA 3Q83A 2DY9A 4C6AA 3DDIA 1NPKA 1WKJA 2CWKA 3ELHA 3ZTQA 1B4SA 4W98A 3Q8VA 3DKDA 2AZ1A 1PAEX 1BE4A 4F36A 4O0NA 3WX8A 3ZTRA 4ENOA 1LEOA 3FBEA 4UOHA 1PKUA 1UCNA 1EHWA 5IOLA 3GP9A 1NSKL 1NDKA 3Q8UA 1BUXA 1F6TA 3R9LA 1K44A 3EE3A 2ZUAA 1WKKA 5C7PA 4DI6A 1MN9A 3GPAA 4ANEA 3ZTPA 3FBBA 1MN7A 4EK2A 4UOGA 1NHKL 3VVUA 3G2XA 4DUTA 2NCKL 4FKYA 3ENAA 1NDCA 3EICA 3VGTA 2DXFA 3EM1A 3FC9A 1NDPA 3VVTA 4CP5A 1NUEA 1S57A 1S59A 1NDLA 2BX6A 3NGRA 2HVEA 1HLWA 2HURA 2AZ3A 1XIQA 3ETMA 1LWXA 3L7UA 2B8PA 2BEFA 3VGUA 5CAAA 1HIYA 3FBCA 4KPCA 3ZTSA 2DXDA 4HR2A 3BBFA 1VYAA 4DZ6A 3FBFA 2HVDA 3MPDA 1B99A
chains in the Genus database with same CATH superfamily
1SI9A 5A0YB 4DZDA 1ZETA 2FJAB 3ILIA 3MM9A 1U2FA 2NPFA 2VU5A 2QFIA 1WHXA 2BJEA 2D69A 3EUNA 3H25A 1U45A 1HHQA 3M6XA 1VRTA 2FGOA 4G1PA 4N8NA 4NEZA 5F41A 3W2WB 4DQPA 2V8HA 4ZPAA 4NWBA 4CLFA 3UDVA 1R0AB 4KY3A 2G1HA 2MQOA 1SL2A 2NUUG 3GE9A 4WK3A 4X84A 5KFXA 1RT6B 3ULHA 4NXNJ 3MECA 1BQMA 4ED5A 1K0TA 3QATA 3BBCA 4Y3CA 5D3GB 1T7PA 4C3LA 1Q16B 1RYRA 4IFVB 3KDOA 1NH7A 2CJXB 2DHXA 3NXZA 4JI7F 4KRWA 3ISZA 1C0TB 2VFRA 3K5MA 1SIZA 1TV6A 4F4WA 5KFZA 2LLZA 2GJIA 1EIYB 1U1PA 3MMBB 3PEJA 1BQNB 3ITHA 3OFEA 1FDDA 2Y1IA 1QAXA 5ETLA 1UWAA 2D1CA 4LF2A 2J9DA 2MSSA 5KFDA 3CUNA 3H90A 4LRAA 4KC5A 2BE2B 2H54B 2MPUA 4P7TA 2CPHA 2XWYA 4X4OA 3QIPB 3R5AA 3NEKA 1JLGB 2R7RA 2DY1A 2V69A 1VQ8S 2XS5A 2E5JA 4EUVA 1LWCB 2JNJA 3KJFB 4PQUA 3M8ZA 4HEA9 1J5EF 2OP5A 4LRDA 1TUGB 1NPPA 3M8PA 4BWJA 4J9OA 5T14A 4ICLB 4IG3A 2WW4A 3SDEA 3C6UA 2JVRA 2VPWB 4MYTA 5BYRA 3DYAB 4P2FA 4I2PB 5L1KA 1U7LA 2F8MA 2BOAA 3DI6B 5BJRA 3G9CA 4CM2A 3V4IA 4DV6J 1TKDA 3KOAA 1ROFA 1K1QA 4WFAQ 1SUQA 4V19J 3IFEA 4M5NA 2MKJA 2XCAA 1BD6A 1M5PC 3V6KA 4NXNF 1NKBA 2AV5A 2IM3A 2KJVA 2M88A 5L1JA 2WVBA 5GADI 2ZH6A 1X0FA 3R27A 3LQVA 3H5XA 4K2XA 4TQRA 2C2EA 4X4VA 3Q8UA 2BANB 1ZYQA 2BABA 4DCPB 4GO7X 4C98A 1HD0A 5LXYA 3HT3A 3M8RA 3VAKA 2R2SA 4GVBA 4DUYJ 2IA0A 4N8OA 1WC0A 3W64A 2FLNA 5D8HB 4EEYA 5DG8A 3CT9A 4DR7J 3PXGa 1G4CA 1QE1A 4QIFA 3EZOA 4Q0BA 1ZPWX 2C2NA 6AT1B 3I55S 4J9PA 3GTYX 3AOAA 1S12A 3R8YA 2WW8A 3H7HB 3M2RB 3ENWA 3MPYA 1UTAA 5KAKA 4YHHF 3I96A 2IJRA 3PYGA 1S9GB 1X4AA 2M9KA 5DO2A 2HHTA 4OYOA 4EZ6A 1ZAVA 5C2GA 2AX0A 2MZ1A 2YQ3A 4CWBA 4WK1A 4Z7CA 3EICA 5A8WA 4YS2A 3AXKA 3I5CA 4Y2KA 4DQQA 2XMKA 5HLFB 2KTQA 5H9FJ 3JTOA 3VVTA 4KGVB 2YNHA 3TA2A 2J7WA 3EWGA 4D3GA 1N56A 3CMES 3CCJS 3NGRA 2DR7A 2XLKA 1KVIA 3R5GA 1HBMA 2Y0SD 4NE9C 2CZ9A 5GAEI 4QW8A 3A8JA 2PIIA 4XK8C 4A8XA 1T3OA 1SQGA 3D67A 1Q1KA 6FDRA 3Q22A 2GVZA 4ZJLA 4KH1B 2K8GA 3G71S 2HZCA 3QSYB 3IBFB 1HMVA 4X4PA 1QDUB 5KFMA 4M5JA 1L3KA 4OI2A 1F0XA 4DR1J 2UZAA 2VPYB 3CPWR 1NKCA 4KT0C 2W9BB 1ZZNA 3DLGB 2NSBA 1LWEA 1QUVA 2EG1A 1WEYA 4JI4J 3GCXP 3S8SA 2RHQB 1P9QC 4IO1A 4PWUA 1R6VA 1UVIA 4WFBQ 1N88A 4IRDA 5LT5A 1VIXA 2E66A 3BKFA 3PRVA 4KH0B 4O4GA 3DXBA 1GXLA 2LDYA 5JVGQ 3LANA 4ZCKA 1KP6A 1RAHB 4OHWA 4TLRA 4RUCA 2IHR1 2LVWA 2M4MA 2HHHJ 2AX1A 4K4WA 1N36F 4JYAJ 1TUWA 4HDHA 1SV5A 1S6OA 2M0GB 2PD1A 4ZN3A 1ZA2B 3VZHA 4B3RJ 3TUZC 3GYNA 2J5AA 3I5BA 4XAKA 1N5YB 2XY7A 2M8HA 2KB2A 3BREA 4NYOA 1NSPA 2DGXA 2H65B 3G87A 1RTIB 2RT3A 3RRKA 2DVIA 4BHQA 2N4DA 5D15A 2IRUA 4TU8A 2X1BA 3J80Y 4LF6F 3MMJA 2DNMA 1UJ4A 3VF0B 3IO1A 3NGUA 2QIFA 2V94A 1N34J 2UXDF 3QO9B 1SKRA 5KG5A 3KK3B 1S7IA 1IBLF 5CABA 3CCRS 5L38A 1RQ0A 1S4FA 3EVWA 3CIZA 2DY9A 2KVIA 3PG9A 5GADU 3I82A 4HYKA 4DFPA 2JWNA 4DR4F 2CXEA 1JMTA 2W4CA 3OPKA 1KEKA 3TARA 4IO9Q 1OY8A 2OD4A 3A8EA 4DJBA 5ITHA 3OL6A 2ZBRA 2HK3A 2AGOA 1WF0A 4DS4A 2J0QD 4LF7J 2O3DA 5KT7A 1EX8A 1HBUA 3DHXA 3TAMB 3WX8A 3F73A 1U02A 3TI0A 2HBQB 2OSQA 2XMWA 1D9FA 4JI2J 4FYWB 3D4JA 1JXEA 1N0UA 3A4TA 4YB5A 2Y8YA 2HYIB 1RISA 4KHMA 4MK9A 4ZVTB 1AFIA 2MKIA 1KQGB 3Q0AA 2FJBB 2GZOA 1Y5IB 2W9BA 2VJUA 4ED1A 3VV2B 1LK5A 2V6AA 2Z56B 5MAOA 2HHPA 4F2RA 3GCWP 1PILA 2QJ3A 3FFIB 3HKZD 1SV5B 1FJCA 2F4VF 4QPXA 1HNWF 1FA0A 2VG7B 1SKSA 3DXSX 3G6YA 4XPCA 1H7XA 1L3TA 2YNIA 4IH6A 3LWMA 2WHOA 2KG0A 4O4GB 4K4TA 4FF1A 3W65A 2HAFA 5EWEA 1EARA 2WAQD 4U67Q 3K5PA 4TN2A 2H5JB 2H9ZA 2I5JB 4UUWA 4WXWA 3TJ9A 4CLSA 1LWEB 1VS3A 1NSAA 2YWWA 5KG3A 1NM2A 2YNHB 2GQCA 2OAUA 3K7RA 2KH9A 2FJWA 3TUPA 4O44B 4ZP8A 4AUKA 5HI7A 3D6FB 3QLHB 3TZXA 4NLTA 3TZYA 2NR0A 1IBMF 2CADA 2FY1A 2P2CB 1BQXA 1GXTA 2D7SA 2DEJA 3AOBA 4MKBA 4Q2MA 3UN3A 1M1GA 1YJ7A 2GVZB 1M0SA 3FNNA 4ZITA 2ATCB 2ZE2B 5J2QB 4F4KA 4DQSA 4OLOA 3R7NB 2W2NP 2QA1A 1CJTA 2KZZA 1HBMB 1RJJA 2BEFA 2NZCA 1B7YB 4K2JA 4A48A 4JI1F 2QLWA 3UNGC 4F0HA 2HQGA 1KS2A 3OHBA 3CJ0A 4Q0BB 4UY8T 2UXBF 2W2OP 4L73A 3SCKE 3KXDA 5ETOA 1KNZA 1A0OB 3NNAA 3LALA 3D1HA 3MPDA 3SIPB 2RJZA 2YWKA 3HLUA 3HHLB 4ILRA 5A8WB 3J80U 2IFXA 4NX9A 2F5GA 3PCOB 1VOMA 2Y3YA 2OELA 3VGVA 2HS3A 4RUBA 1JX4A 2VV5A 4FZVA 3NKYA 4HH1A 1RHUB 5AXNA 2VPZB 4EMDA 1SL0A 4DF8A 4OX6A 4WZQA 1T9VA 2LXFA 1R3NA 3O44A 2DH7A 3M2RA 4MIWA 2JLGA 4WFZA 4NLVA 1YG0A 3BM7A 4CCHA 1NZAA 3ZC4A 4CT9A 4J9VA 1AUSL 4A8FA 3AY0A 3V4IB 5IT4A 3DI6A 3L4BC 3MFHA 4L72B 3BSOA 1IKXA 5L1LA 2UVRA 1XK8A 1BWVA 1WC1A 3C6UB 1BY9A 1OYDA 1JNZB 2F9DA 2PFDA 2XULA 3CIMA 3TWZA 4K5RA 3ZTOA 1NEEA 2D3OR 4S0MA 2CIMA 2E5IA 3GU0A 1YJTA 2BANA 3POTB 2IBKA 1RDRA 1U8SA 4PQUB 3R2CJ 1FD2A 2G9OA 3DDNA 1HD1A 2UP1A 3D0IE 1J27A 2XMVA 1NSQA 4EZ9A 3BSCA 1IKWA 3DRSB 4Y2IA 3HF5A 3W8GA 4LF8F 2ZC4A 3MCNA 4JI0F 3PX0A 4I64A 2CQPA 2ASJA 1U2RA 4BC9A 4PYDA 4CO1A 2KDOA 1KLMA 3M30B 5FDLB 5B0BA 1BQNA 3ITHB 4DR6J 1UEUA 3CE8A 1V3RA 1LNQA 4QU6A 3GIKA 1RBLA 1H0HB 2V4QA 3M8PB 4LSZB 1FKPB 1PBAA 1C1BB 1QTNB 1C0TA 1WD6A 4JI8F 2OO4A 4M94A 4DDFA 1R0CB 3Q8QB 5KG4A 3M2UB 1RAOA 4DX8H 4JUZA 2D9OA 2EW9A 3BN4A 4W98A 4LF5J 1K1SA 4P6QA 4DV1F 4ZPWR 1PAEX 5DZ6A 5B08A 5D3GA 3ICLA 2CJKA 5ETVA 3MECB 1WHYA 3AODA 1RT6A 1U6ZA 4HL9A 2DNLA 3Q8PB 2CVEA 2GIFA 3JSBA 4ES3A 1GMUA 4W4MA 3N79A 1YZ7A 3V6DB 1U1RA 3VAHA 1YJ9S 3W5ZA 2UUWA 2VBZA 4I67A 1T9UA 2OJ3A 1FT8A 3DRRA 3BYPA 5A6PA 3J7AN 3LA0A 3PR5B 4F3OA 4PWDB 3IP0A 3M32B 3D68A 3AD7C 4DL6A 3RB0A 3RAXA 3TRGA 1V9OA 4DL5A 2E5GA 2MQMA 4A8SA 3OL9A 4QIWD 5F8LA 4OYIA 4IFVA 1R6YA 4ANEA 4JBCA 2QFJA 4DG1A 4K4YA 2G0IA 2HWHA 3TVYA 4ECUA 1B0TA 1BQMB 4RNFA 3QRRA 1NK7A 3MMCB 4C11B 4JI7J 3MFIA 2Z2MA 4HHJA 5DGAA 4IDKA 1O0PA 3OW2R 2OMOA 2JZ5A 2CYYA 1BWEA 4IFYB 1CBKA 2HLTA 4IH5A 3W2WA 4RBTA 3P8BB 4KHPJ 1TK0A 5D6GA 2Q6CA 2PA3A 3PRDA 4IYQA 4DR5F 2HQ3A 2YX7A 4AQYJ 1IWAA 1UJ5A 4B17A 4CO2A 3N6LA 1V3SA 1TTHB 1VLOA 2K7KA 3EM1A 3GLJA 4AE5A 2IC3B 2DCUB 5ETNA 3SYZA 4FXDA 4B3MJ 1U0HB 5E2QA 2QMUB 4LF1A 4RW8B 1FTRA 1DTQB 4LRCA 2NYIA 3PX6A 1RCXB 4WF9Q 5B0FA 5J2PB 4GVLA 1J5EJ 2AZ3A 4CLTA 1HYSA 2LDIA 3BGUA 1S6QB 3CEDA 1H6KX 5IM0B 2L08A 4DV3J 3DGVA 2YWHA 4JV5J 1VQPS 1CG2A 1V3ZA 1YJUA 3EPGA 2NS1B 1Y4ZB 1MWQA 3KMQA 2AJ4A 3R1HA 4MK7A 2LQ9A 3FBFA 4O3RA 4L3NA 5F8IA 1YX2A 2BJ3A 2HVDA 1XTZA 3ONQA 5IWAJ 3C14A 4ECQA 1VBYA 2YQ1A 1M5HA 1CJUB 4KAIA 2V4JA 3RB6A 1BHNA 2R8HA 4X65F 2W8KA 3T1YJ 3PFEA 5KFBA 2XMJA 2J76E 4CLUA 5AJ3J 1UVLA 2B9WA 4CNZA 1U1MA 5T41A 4NI2A 3M8WA 2KFYA 1YITS 4X2BA 4I6YA 1D9AA 1GMWD 5F8JA 4DFMA 1VR6A 4RW9B 2FB0A 3HI9A 4QYZK 2HHXA 2HNZB 3MAQA 3AJ2A 4PG8A 4DR7F 3ET6B 2QSWA 3K89A 3PYEA 4JI3F 3CJRA 3Q2TC 2GMHA 1D9DA 2HQDA 1DY3A 2FHOB 4KGKA 4HDGA 4LBPA 5EHHA 1C0UA 1FVSA 4YHHJ 2H4YB 1TL7B 2DRBA 2FHJA 2BJ9A 2JOQA 3MUMP 4G6VB 2Z30B 1T03B 3EVOA 2DH9A 3T41A 1RYSA 2BKNA 4A8QA 3D2WA 2IRXA 1HBOB 1Q95G 1WOPA 2Z4PA 2QL7B 4HKQA 4ELVA 1MWZA 1CC7A 4E2FB 2GNKA 3LP0A 2Z8QA 3QNWB 2FVPA 1ACMB 1LOUA 5BXIA 3IAM9 2XZWA 4HVZA 4CYUB 4ZPBA 1F9HA 5L8RC 3C66A 1FCAA 1FDNA 4I2QB 1Z2ZA 5I42B 3DLLQ 3UCGA 1H74A 1TMMA 1RLDA 1UWBA 4KFBA 4KKOB 3ZZ0A 1ZM9A 2GO9A 2LXUA 1U6FA 1YJVA 3UNYA 3AD8C 1EETB 4URQU 4FNHA 2CPZA 1LW2A 3HJFA 1XR7A 2GQQA 5KTQA 4PZVA 5DETA 5E33A 1NK9A 3T6JA 3NY0A 4OLPA 7FDRA 2XGQA 2ALYB 4JI4F 3ENVA 3PY8A 3PACA 2DGQA 2C3YA 5K8OA 3N9UC 4ZVUB 5B0AA 1MW7A 2VG6A 1DLOB 3NCPA 4L3KA 4MFBB 3UR0A 1E6VB 2XHWA 3R9LA 2HIYA 4LSLA 4ELUA 4E98A 2VQEJ 1S1XA 5JMNA 3BQ0A 2AYMA 4RJVA 4DI6A 2X1AA 2ZEJA 2MHNA 4QWDA 3OTDA 4JV2A 3O3LA 2C2RA 1KTQA 3S1TA 1U1LA 3E3XA 4JYAF 4FPRA 4U6PA 3W9HA 3PW5A 1GTHA 2CPFA 2K3IA 4ZVEA 5HBMB 5H1SV 4ZPVR 3QJJA 1U25A 2ILYA 3MM6A 5DDOC 5FIIA 3BB5A 3OUYB 3IWXA 3NAIA 3DGPB 3VVUA 3FSIA 1JQGA 4BLGA 2C28A 1N0VC 2LXIA 3E01B 4JB8B 2ERRA 3ENAA 2FZCB 1C4CA 1AZSB 2J8AA 2B4PA 1WHVA 3RJMB 2WTFA 1QSLA 1RA6A 1CVJA 3B4MA 4N77A 3FC9A 3JSMA 3KLFB 3IAS9 4CRJA 2FJDB 2DGWA 4FVCA 4CT8A 4EWTA 3OT9A 4Y2MA 4AL6A 1IBLJ 1HL6A 2CZVC 3QZ7A 4YR0A 1DTTA 3UCUP 2DB1A 4RPFA 4O3SA 1IM4A 1ZAWA 4Y2AA 3TW0A 1RTJA 4P9SA 4DR4J 1DHMA 3IWLA 2DO0A 4YOEA 2HW3A 2AYEA 5T7LB 2ZOFA 4USTA 4FS2A 4MJKA 3K5LA 1HIYA 1FFWB 3HFVA 1RSCA 2GO8A 4OJ1A 4DSKA 2BYCA 2CQ0A 1RTDB 1N32J 3WBZA 4UZBA 1FFGB 1SJ4P 3EGWB 1FERA 5ADZA 3J7ZT 4QCLA 3OD2A 3T5JA 3E2EA 2KT3A 4MTPA 2BV3A 1WSRA 4M5DA 4ZP7A 4OHYA 4WU2A 4F0MA 4IKAA 3R5CA 2K06A 3DOKA 4F67A 2C3PA 4FKXA 4ED4A 1FK9B 1Q82T 2AWZA 3D7SB 5B0CA 1C1CB 1S1WB 4ANDA 4B08A 2HRYA 2ZH1A 1Q79A 2ZNYA 3AAWB 2ADBA 1VQNS 4L75A 2LCWA 4NCAA 1MSWD 4Y00A 3NMRA 4B9MA 1F5CA 1IR2A 2LEAA 3VR1A 4R5PB 4QIVA 4ZIWA 1QLNA 3MEGA 4PPDA 4OHZA 2XI2A 4HI2A 1N6QA 3TANA 3S01A 2HGNA 3N28A 3RBXA 4L76A 3THPA 4LF4F 3QZ8A 2ZVSA 5JUMA 2DO4A 2B51A 2VC0A 5KT3A 1U4BA 1E6YB 1WI6A 1FRIA 2DITA 2IVFB 3H2LA 2VQFJ 4KO0B 3G6ES 3NNHA 2HNDB 4NZ6A 3L7OA 3SEOA 2CWXA 2ILZA 4OZ1A 4EGLA 1XEZA 3EJMA 3DRPA 2MGZA 1F3FA 1VJQA 2B8QA 2E1PA 3FCVA 4U8VA 3EZ5A 5EDWA 4NLPA 1TFYA 2DNQA 1NCLA 2FQQB 1IBKJ 1WKLA 5HAOA 1FX4A 3D28A 3OR1A 1ZM2A 1VQ6S 4FPIA 2YWEA 2MXYA 2XWXA 5C25B 2PEBA 4DLEA 2HGLA 1HARA 3QQCD 3UN2A 3D66A 3PEHA 3ELHA 3IN5A 2MLXA 2ZBQA 3DRYA 1XMOF 4JI1J 2ZVIA 4IH7A 2BR0A 2FJXA 3KMSA 3NS6A 5DG7A 1WC6A 4DR2J 2R2RA 3DRPB 3SMZA 2MGZB 4C8KA 1Q78A 1RWKB 2IVMA 2PT0A 3I87A 3FBEA 4OZNA 1CS4A 4RX6A 4XDCA 4YEAA 5C24A 1LXNA 4ATNA 3K59A 4LR9A 3QPIA 2A18A 3HKWA 4ECWA 3TX8A 1WTBA 4RW7B 5KFPA 3O1LA 1KVKA 3Q8RB 3M9NB 3R7SB 4F8RA 4LFAF 4M5HA 1FE4A 1K73T 3BR9A 4J9QA 1PO6A 4QIGA 3D1QA 1C4AA 1H7WA 3MEGB 1PYSB 3PKMA 3I0SB 3JXOA 1H2UX 3VAMA 2KHDA 1JLEA 3ZTPA 3CO0P 3MR2A 5HANA 4N5SA 1M5VC 3BS9A 3N6MA 2CFXA 4H4MA 1PC4A 4KQZA 1X60A 4XTTA 2LQJA 4B9LA 4BBYA 4EO8A 1FK9A 3GZ7A 4UY85 3T5HA 4NCGB 2L41A 5D0EA 1GH8A 2CNLB 3V4MA 1N33F 2IYGA 2E5LJ 2XLIA 3MHYA 4P2XA 1LXJA 4KJIA 3ISND 4CLLA 4AL5A 1VQMS 3FRZA 3ILLA 2CPIA 4WP9A 4ZIVA 4X62J 2DHGA 1Z2LA 3GIRA 3US5A 2EEYA 1FDBA 3THVA 2CJAA 4DR6F 4X4UA 2OPSB 2JC0A 1ZAXA 2BX6A 1S0VA 2G0JA 4N76A 5F9LA 3TVKA 2LQ8A 3DHWC 2HHQA 1WJ9A 1RTZA 2XC9A 3D54A 3GV5B 2E1MC 1BGXT 2CZ4A 3TVZA 2JC1A 5HJYA 2ROPA 1TELA 5CYQB 4LF5F 1R8BA 1OIAA 3FBCA 4DV1J 3TNVA 2M52A 1CSJA 2DXDA 3QWUA 3WZ0A 2BDPA 3PW7A 3PW2A 2E9ZA 3HJVA 4W90B 3TA1A 3VTIA 1VCTA 2MLYA 1YLXA 3AXMA 3GG1A 1YKWA 1MN9A 3CW2C 2R42A 1XN9A 3RB3A 4B3TJ 2BA9A 1JKHA 1OWXA 2FC8A 4ZK7M 5CYMB 4F4AA 4ZPCA 2EXUA 1YBAA 2DR6A 3R7BB 4WIIA 3DGPA 2L9WA 3L3CA 2W9CB 2DGOA 3FCWA 4OZ2A 2EG2A 4CLZA 3K58A 2XSJB 1WACA 1ZS6A 2AHOB 5GVQA 1GT8A 1TR0A 2YBVA 4I7FA 1FKOA 5GAHI 4X4QA 2ZZMA 1MROA 2GJ2A 2CJ9A 4KB7A 2HBZB 1HQUA 2R2UA 2YNFB 3T1HF 1S6PB 2W2MP 2R4FA 1OPZA 4DV0F 1R0BG 3MD3A 2W7OA 2O66A 2DCLA 2FY8A 3DM2B 3P4UB 4LVNP 4D3HA 3HD1A 2DNKA 3NGSA 3WHIA 1DLOA 4PG5A 1S6UA 1JXVA 4PQAA 5E7OB 3HVAA 2QLFB 4P10A 4OHVA 1JLFA 5KT6A 1SJFA 4KHPF 2CJYB 5AXKA 4PYAA 4XIUA 1NB2A 1N4LA 3EVMA 2LFVA 2O1PA 2P9EA 2XGPA 2KG1A 4DPXA 2I2YA 3T9NA 1QAJA 4K50A 1HNVB 1FRKA 3FKBA 2PMHA 4ECTA 2OFHX 4DSLA 3T5LA 3BYRA 1Z4UA 4UOCA 3W7BA 1WEZA 3D3BJ 3HD2A 1RTHB 3IA0A 1JLAB 3NGTA 3CGIA 4QR0A 2M8DB 4K4SA 4KFBB 1Q7YT 1RUSA 1N5TA 2A2CA 3SXLA 3RB4A 2CWKA 3GWCA 1CJKA 2FIUA 4DV3F 2D41A 5J1PA 1L3VA 2BQ3A 3BQ2A 3VAJA 2UUCF 2KFNA 2ZH8A 4LR8A 2NXCA 3ZZUA 3V81A 3AQPA 4ECYA 3WC0A 5HO4A 4FF3A 3SCLE 3LP2A 1YQHA 5ETTA 4CO0A 2ZDPA 3UDEA 4UT4A 1APSA 4RW4A 4OYXA 3T1YF 4X65J 1UCNA 1U2CA 1ZM4A 2AU0A 2V8VA 2CQ4A 2XBPA 5I3UA 2HMIB 1T03A 2UV8G 1PIEA 2X51A 4JOUA 3E8OA 5DQGA 1BUXA 1PSDA 2VDHA 3PHEA 1FD8A 1FWKA 2VBYA 2N7YA 2XYGB 5LSRA 2IY5B 4NLOA 1Z1ZA 2GGPB 1Q8KA 3CDUA 4ZVGA 3KHHA 1FKAF 3CJKA 4HTJA 3T1AA 3NAHA 3PJXA 1FWPA 2KZMA 2B56A 2FVQA 4HH0A 2N7CA 4C48A 3KHRA 4RUHA 1MN7A 1TMJA 1T9TA 2DBBA 2EBEA 5J1EA 1MU2B 3MPUB 4RR5A 3JAMY 3P45B 1HWIA 3W9IA 4F0KA 1GNKA 3G6VA 1PYOB 1TAUA 3MI7X 4NI2B 2GVDA 4XPEA 1U09A 2N4CA 3MEEA 5ETPA 2ZKTA 2ZH3A 1RB0A 1OSCA 2RAQA 2CQBA 2BE7D 2BJDA 2I9SA 3D0HE 1CJUA 1X4HA 1RT7B 3IRWP 5AE1A 1OQ6A 1VJWA 2F63A 4R0JA 5KFGA 3ZZZA 4EU0A 3ZO7A 4A4JA 2VF3A 4WFYA 3I32A 4F02A 3LP1B 1OSDA 3D6MB 3TQEA 2HVEA 2HURA 3PM9A 5IM0A 1KD1T 2EK1A 3DLBA 2HFOA 5HSPA 2XZDB 4H4OB 3UPFA 3QGPA 2DK2A 4WKYA 3BJYA 4TY8B 2B8PA 2HLUA 1FNMA 4KV8B 4YDDB 1H2TZ 4Q5VA 1DTQA 3EDRB 2B9XA 3KYLA 2QA4S 1X8DA 4R8UA 3MEDB 3BBFA 3LGMA 3M7VA 2CJQA 4AD6A 1S9FA 3A3NB 2VFSA 2NUHA 3MZIA 1IM6A 1ZTTA 2LP4A 2EC0A 3QJPA 1RGVA 2YKNB 5GAGU 4U8YA 1WOOA 5F8NA 5HN0A 4DX6A 2J9EA 1FRMA 3CJQA 3IMQJ 1CPZA 4GC7A 1SC3B 2ZOMA 4DEZA 2NXNA 2OFGX 3MM5B 2Z0GA 1TKXA 1W26A 2XB2D 2CQIA 4EBDA 2KKHA 3BH7B 2V2ZA 5E3CA 4C11A 4TQSA 1VQ9S 4Z2XA 4ZCLA 1WC3A 1S0OA 4DG1B 3BPDA 4RWWA 3GIIA 1FRLA 1V5IB 3F0NA 1AFJA 5IFMA 4OV1A 2BOPA 2V8GA 5LM7E 1VQSA 2RILA 5HVGA 1WI8A 5HMZA 2XO7A 1EQ0A 4QZVB 2DXEA 4YUDA 1REVB 1ULRA 3KK2A 5KG6A 3CJ4A 3HSJA 3IRXB 1VC5A 1ICEB 3DRRB 4ZP9A 2XM3A 4E8UA 2YPZA 5DM7Q 2J0SD 1TVRA 1XR6A 1YJNS 1IVZA 1NJXA 4CLYA 1Y00A 3CVKA 4PWDA 2P5VA 3ETOA 2VUGA 3B78A 1CULA 4WBFA 4HLBA 4LVOP 3ZZPA 3VAGA 1AA1B 2PN6A 5HK4A 2VHGA 5B0EA 3A13A 1FDAA 1VGYA 3OR2A 3EMTA 2C2ZB 3QMQA 2DNOA 1T9YA 4G3IA 3QAUA 4ZVRB 2XO6A 3KK2B 1RI7A 1REVA 1UP1A 2UUBJ 2HIQA 2JJ4D 2E1CA 4YMEA 3G4SS 2ZH9A 2WCXA 1NXIA 4WIQA 4WXOA 2JHEA 2C42A 2CKWA 1XR5A 3WDOA 2ADCA 3M30A 4PR6A 3B4DA 4Y28C 5LOQA 4J9MA 1M1KT 4ILLA 3L7PA 4H4KA 5DZ7A 2DGTA 3O5TB 3EPIA 3QRQA 1EQMA 5LSOA 3DRSA 4UTGA 4DWIA 2K1RA 3EZUA 4B9TA 4IRCA 3DRXA 2C22A 4DL0C 1X31C 1RLCL 5CD4H 3CC2S 3KLEA 1X5TA 1FXLA 3JYTA 2YH1A 2ASLA 2VONA 4K7QA 2MKYA 2YKNA 3WQPA 2HHSA 2BUNA 3A1YG 2AJ2A 2L9NA 3BSNA 3FRYA 1U47A 1QAIA 2HHHF 1IKXB 1HR0F 3UO0A 1SQEA 3HSZA 4YB1P 3MEDA 5CH7B 1LFWA 1S9EA 2GX8A 2MHEA 1YDLA 4R8UB 3H40A 5KG2A 4OI4A 3H2UB 1S1TA 2WSEC 1TZ0A 3T19A 3KG4A 2Z58B 4TY8A 2XTJP 1O6XA 2HFZA 1L3UA 4LF4J 1LWFA 2DRAA 5RUBA 3KUGA 2OH2A 4O3PA 3OJSA 4OI1A 3GILA 5CXTA 4PG4A 2GA7A 2KM8C 2B7CB 2YNGA 3FEXB 4DL3A 1FJEB 4C97A 3CMQA 3HHLA 3OFFA 4LF6J 1VIOA 2EFNA 1D8YA 4QOTA 2ZUGA 4CLKA 1XNQF 5L39A 1N34F 4ECZA 1C2PA 2UXDJ 4N41A 2Z2LA 3BGOP 5EUHA 1Q4RA 1S4EA 2AMCB 2Z57B 3OXLA 3MEEB 4CH7A 1IBKF 1SJ1A 1QY7A 2QYGA 2GVDB 4NRUA 4NOHA 2ZBIA 2XS2A 1KC8T 2FHMA 2BJ1A 1GFWB 2ZWOA 3AA9A 1FRXA 3H0PA 1PJ7A 2XMAA 1QTMA 1N48A 1VBXA 1QSYA 1IWGA 1RCOB 2ZE2A 4I68A 5D77A 1CQNA 4I69A 1R89A 2DJWA 5ETRA 4B3OA 2G0CA 1H73A 4ZPDA 3W66A 2W7PA 3R3TA 1JLQB 1SKUB 2GGPA 4RUAA 4DPWA 4P2SA 3I4PA 4QYRA 2X3GA 3HCXA 1GK8A 3LAKA 1OY9A 2L48A 1N8RT 1WG1A 2I5JA 2CPEA 4MIAA 1DARA 4TLQA 1LW0A 4USMA 1EP4B 3PX4A 1KFSA 1KBRA 1O8BA 1KHWA 2MQLA 2MZTA 2MTLA 2JEGA 2NXUA 2YNIB 4OJ3A 1NAQA 4KGXB 2FVSA 1NH8A 2A1BA 2RS8A 2VG7A 2IDLA 3CCZA 4NLRA 5K8NA 4NLUA 5E41A 5HQLA 1G3OA 3QGIA 2DNNA 3FVYA 4K0KJ 4FVMA 2ASYA 2ZFHA 2DT9A 1F5AA 2WRMA 1NJZA 2MKSA 4YFUA 1SH2A 2HK2A 4A8MP 4A8YA 3HVTB 4AFFA 2YKQA 1CJKB 1RT1B 4I6AA 1ZBTA 3PR4A 3MURP 1M5KC 3WX4A 2QA4G 1RK8A 3AB2B 5FD1A 4RU2A 5IS2A 4YB7A 5HQMA 3DNCA 3UN5A 1WNEA 2MMYA 2CQDA 3MR7A 3W1YC 3BV8A 1VQ4S 2JVOA 4WJBA 1TK8A 9ATCB 2LA6A 5KFQA 1RT3A 1FWLA 4WTYA 4AXJA 3SQGA 3GSDA 5F9NA 1LKZA 5DDRC 4LBIA 3PW4A 4ZKAA 1EKRA 3QT8A 4H54A 5M2PA 4J9KA 3JB9k 3AJ1A 2I38A 5GAGI 2QTWA 2VL1A 4ZDNA 1U24A 5FLXU 4DV7J 1TQLA 3DM2A 5BR8F 2ZOGA 2MKCA 1SCJB 4QWBA 5KFCA 4GKKJ 1S6PA 1UVKA 2ZBPA 4M5LA 4M5KA 1F9FA 1QM9A 2GFFA 2DNHA 2UXBJ 4NMXA 1FKOB 3RW7A 5A8KB 4I7FB 2KI2A 3MM8A 1RWMB 1RT4B 2VKZG 3WC2A 2XZTB 2HS4A 2J6UA 3PO4A 4B3TF 4HHUA 3OL8A 4LQ3A 3PJWA 2YX1A 1RTIA 4LREA 5K20B 3C19A 5ETMA 1Q8BA 5IQ6A 5KFYA 1SXLA 3FEZA 2RQCA 4DS5A 1N5YA 2NQPA 1S99A 5KFOA 1RWVB 4BDPA 1QUPA 1T11A 5HQ8A 2N3OA 2BXJA 2RIJA 3CULA 3K5OA 3M2VB 2JH3A 2C1EB 3KG1A 2EFGA 4BWMA 5K8PA 3BZQA 3PTWA 4J91A 4KE5A 1YI2S 2V2QA 5GMDA 4DV0J 2ACMA 4CZCA 2ZM6J 4IR1A 5SUHA 2AT1B 3SV4A 3VCDA 3DU6A 1UZDA 2V8DA 1H3DA 5KT2A 4WCEQ 3H4BA 4DFKA 2VC1A 4MH8A 4TNOA 2HFVA 1SL1A 2QE5A 3GB0A 1NDCA 3OTEA 1TFWA 3MPVA 5CCLA 2H4WB 5EX3A 4IOBA 2OEJA 3SQOP 2U1AA 1UA0A 1HMVB 4M5MA 2RUSA 1Y3JA 3H4DA 3CF5Q 4NLGA 4WKRA 3BSAA 1VISA 2EK6A 2YKMB 3H20A 2G2OA 4ZOSA 3QSIA 1QAYA 5KFFA 1WORA 2COLA 3MMAB 3QFWA 1X5SA 3TP2A 2Y8WA 4NL5A 3QRPA 3R6LB 5LMNJ 3L7UA 1LWXA 4B9UA 2UUAJ 1IR1A 4DUZF 3IM9A 2EFPA 2UUCJ 2E29A 1MMLA 2F7VA 3H5UA 1FXRA 2IBOA 4FBUA 4GKJJ 3UR3C 3AJDA 3IM8A 5CYJA 2KT5A 3A8IA 3RYLA 3RAQA 2BW7A 5CHCB 3H5SA 4ES2A 1B64A 1WUUA 4WPAA 4AT1B 3TZZA 1F2HA 2HNYA 3ILOA 4F3MA 1TKZA 3FK4A 3OXFA 5DQHA 1R8PA 2RD5C 1EB0A 2WSFC 4XDDA 4LFCJ 4LR7A 1S9GA 3NWRA 2HAIA 1RWOB 2LKZA 3HVWA 4U7CA 1RAFB 1ZM3A 2R7QA 2M2BA 4PKDB 3CCMS 1LFPA 1RABB 1IKYB 2KYXA 4PXDA 1S49A 5KFRA 5EWFA 3D1OA 4B3SF 2P6TA 1HQEA 4G1IA 3H5YA 4O23A 1WELA 2RSQA 2CQ2A 1QE1B 3H98A 2IVYA 2VFTA 1DBDA 1ZPVA 3BH6B 4A8KA 1UFKA 2XMMA 4GVBB 1VDHA 4WWSA 3NBPB 5KFUA 3TEHB 4ED7A 4JV0A 1RKJA 4X4NA 1G6BA 3KLIA 4DPUA 1FVQA 3CCTA 3R5JB 2F8EX 4J9RA 4DV4J 2DR8A 1HWLA 4C0BA 1HNIA 1RAJA 1SC4B 3C6TB 2V4RA 1FHTA 4DR5J 1KOHA 3IR5B 2WONB 5D4OA 3U02A 4AQYF 4OX9J 3HM9A 4J9UE 4FF4A 1SUQB 1GX5A 3M6VA 2FZKB 1CJVB 2MQNA 3GONA 1RAIB 3R5BA 4G65A 4KIAA 4YR3A 1JLCA 2AJFE 1KONA 4CLPA 1I94J 4B3MF 1EAYC 3MCMA 1E6YA 2BBEA 3CDEA 4IG3B 2ROEA 3CCUS 2YXLA 2OHDA 3Q2SC 2DR5A 4FYVB 4DV2F 3K0JA 1RADB 1RT5B 2M5YA 2M7SA 5DG9A 3R1LA 1LWCA 1Q81T 3TX0A 4JV5F 3OTCA 5IXUA 2AJ0A 1FI4A 1WF2A 1JLGA 3QIPA 2G13A 2NXEA 2RHSB 2VFUA 4QR2A 2HSEB 2BE2A 2UVVA 3F56A 5IWAF 3BF4A 3M9MB 4ED0A 1FTCA 2MSTA 1LEOA 4UOHA 2HG4A 3KG0A 3TOQA 4A8OA 4U9RA 5F3TA 1EHWA 2RB7A 4UZCA 4RZRA 3MF5A 3MWBA 1SC6A 2DIUA 4RU9A 4FBTA 5F0UA 4DHVA 1RU2A 4FYYB 3BDEA 3FQKA 3K57A 4B9NA 2OPRA 3VQTA 3DC2A 4KSEB 2H3EB 4M5DB 5DLFA 2WK4A 2W2QP 2D74B 5LL6d 1IR0A 1WWHA 3HSGA 3LF0A 5E3PA 1RTDA 4TVAB 4ED2A 2GV1A 1CC8A 3KNGA 3NS7B 2DHHA 2RS2A 4WZMA 4OIXA 2V2KA 3PYDA 3SCIE 2NYHA 1FESA 4RNOA 3DLKA 4Y6IA 3EGVA 1RTJB 4RBUA 4LRFA 1WSVA 1VRTB 4J90A 1HA1A 2KXFA 4ILMA 3W2VB 2CDRB 5ETQA 2O67A 3IR6B 3K8WA 3MM9B 2DNGA 2HZVA 2GAHC 4ERDA 1F60B 2A0FB 2YKOA 3QT5A 2WOMB 1FXDA 4LBHA 4K5SA 4WE1A 2IJNA 1OS5A 2DGSA 3IG1B 4OYWA 2QMXA 4Q45A 2HVIA 5IV3A 1AXQA 4E0DA 3LWLA 3E01A 5AE3A 4DR3F 1S57A 2J9CA 1S59A 3KUEA 5F8MA 4PUOA 4Q8FA 5F8HA 3UE2A 2ZJPQ 1HLWA 2CQHA 3OUYA 5IV4A 3ETMA 5DDQC 2AF6A 3W8PA 2BRLA 5C2CA 5DM6Q 5J2MA 1YBUA 2UUBF 1KFDA 2HQFA 2LECA 1KSPA 1J5OB 3G82B 3EXCX 4P71A 4NZ7A 4A46A 3DLEA 4V1Ak 2X7IA 2Q1LA 3R5DA 1K0VA 2J6SA 2B5JA 4J37A 4EYHB 3B82A 1ZOTA 4MYUA 1VC0A 1PG5B 3N5BA 1T8EA 2CQ1A 5KOWA 4OX8A 1B99A 5D0RA 3LGNA 4LSLB 1FJGF 3U27A 2VICA 2VG6B 1S77D 3CJ8A 4EYIB 1NO8A 1SC1B 2MKHA 2O5DA 4IOAQ 1X4BA 2APOA 3M4XA 4U7UD 2OEKA 2OPPA 1YIJS 1VFJA 1S72S 1W2IA 4IQXA 3K5NA 3ZZTA 2XY5A 1HR0J 1N5VA 1S1UA 1TUVA 3THTA 3NP5A 4I56A 3MTKA 5THWA 2KU7A 5KT4A 2UU9J 1P9YA 3BBBA 2DR9A 1KDNA 2V68A 1IXKA 5I42A 3SSQA 4QQBA 4ZLJA 2HS0A 2J0XA 4JI6F 2RDIA 3CC7S 1LV5A 3PJ9A 2ZJRQ 4OYMA 4CQ1A 4K4ZA 5ETSA 4G1QB 2OUGA 4NYZA 3OVAA 3HVRA 1QVFR 4EBEA 3PDNA 4KYZA 4OJHA 1SJ3P 2RF2B 1XNQJ 4LUBA 4ZVFA 9RUBA 3CMAS 2ZBCA 3S6EA 3LUYA 5BYQA 2DIVA 4OMFG 1KQSR 4G1QA 2R3VA 3GYGA 2CUYA 4QWAA 1RACB 3OQ2A 3Q24A 3M1VA 2OPQA 1AYEA 3UDLA 1TL7A 1JLBB 3SV3A 2DTJA 1D09B 4A47A 5FLXY 4OZ5A 1YRTA 1N5QA 8RUCA 2OPQB 4GO5X 4YQWA 3HHLD 3T5KA 5KFLA 1AT1B 2XHCA 3ET6A 3M8SA 4M1KA 3R6GB 3IS9B 2QEXS 4M5GA 2E9RX 2RF2A 1WEXA 4ZVOB 1PGZA 4U96A 3NG8A 4BCAA 1MWYA 2XI3A 1RKIA 2DHAA 3ZZRA 5LJ5Y 3J7YI 3KLVA 1S0MA 4PRFA 3G96A 3ZXWA 2LU2A 1NJIT 1JNRB 4M63A 4WTOB 4YR2A 2VODA 3KJQB 1SIWB 1RBAA 1UPPA 2NSCA 5E3RA 1AROP 2V4JB 4DV5F 2W4PA 4ZHRB 3PZPA 3GR0A 5IC4B 5C7PA 2R7UA 1H72C 2W7AA 3FMWA 4B02A 5C42A 1HHTP 5G4DA 4ED6A 1TL4A 1D1UA 3KNAA 2EWHA 1MNEA 1U0SA 1T9WA 2CNKB 2H48B 3HT0A 3DLEB 3PV8A 2KN4A 4MAKA 3G82A 1I1GA 4HACB 4LT6A 4OL8A 1Y11A 4UOGA 3LOUA 1S6QA 2OPPB 3NCQA 5J2MB 1FEEA 1B3TA 3MDFA 2MZSA 2QG9B 2AEMA 3PIPQ 4EI2A 2E7VA 2OGUA 1U0HA 3CDAA 4FKYA 4PABA 4RW8A 2LQBA 4ALZA 4Z7YA 2VQFF 1YJWS 2IC3A 2BQUA 3WIVA 4DL7A 3AFGA 3CDBA 4WE1B 4WU3A 1VQ5S 2B5JB 2EKYA 2WOMA 2BQRA 3P6YC 2AGQA 2BM0A 2JRSA 1R31A 3JQKA 2BMBA 1IBCB 1UJ6A 2F8HA 2XQCA 1S97A 3M9OB 2W01A 2GJFA 2GIRA 1WC5A 2HGMA 4DV7F 4C8LA 4AYBD 4IDKB 3DLKB 5BR8J 1ZTWA 8AT1B 5M2RA 2HFUA 3MMCA 4I0WA 4PUOB 1ZZFA 3CNQP 1PCAA 2MJUA 4GKKF 1LQ9A 4PXEA 3GR1A 2ASDA 3J7YU 3GJSB 2ABYA 1VYAA 2MY7A 3G8QA 5HP1B 3GFXA 2LYVA 1KWMA 3CDWA 4I6WA 3M32A 4DSFA 3W2VA 1GMVA 1X4DA 2V63A 2RH3A 3V6DA 1NK4A 4LFAJ 3HK2A 2B43A 4NXMJ 3TZWA 2NZ4A 1UL3A 2ALZA 3VAFA 2QMWA 1IKVA 1ZA1B 5B09A 2HHVA 3G8SA 4JI5F 4QJVA 3V5RA 3LO3A 3FDSA 5DGBA 2ZC3A 4PAAA 5E5NA 2RNEA 3J81U 1K8AT 1NBEB 2MZQA 3M2UA 4PG6A 4ZLLA 2XG8A 2ZM6F 1RT5A 2PA8D 5D4PA 2GW8A 1C1BA 3M05A 1FKPA 3A12A 2OPRB 3K2YA 3PRBA 4CTAA 1BC6A 5B0DA 5JJBA 2R8GA 3KLHB 3LGHA 1REGX 1UW4A 1JLCB 4GMKA 1RWXB 2QO3A 1KLMB 5FDLA 2ZHAA 4X4TA 5AXMA 3QJLA 1KTVA 2VZ9A 3PHTA 2XMTA 4LQ9A 3W61A 3LPEA 2G2YA 2V8PA 3NCRA 3EGZA 4F25A 1IKWB 2F4FA 3TUIC 4M5IA 3P49B 1M5OC 4NCBA 3I56S 1YVFA 3OV7A 1HNIB 2GS8A 4LSNA 1HBNB 3CCWA 3RZAA 2AKWB 2DEIA 3POTA 4C6AA 5LMNF 5K14B 2EBGA 3I4HX 1VBZA 2YVSA 4DX5A 4MIBA 3UWTA 2CAJA 4KPYA 2BE9B 3ZTQA 1FRJA 5L46A 5G0RB 1K9MT 2P6SA 1W25A 5C5JA 5A2QY 3HFZB 2C2DA 4Z37A 4GKJF 1CJVA 1HQEB 2VPXB 3CSKA 3AA8A 4HTIA 3C16A 5A76A 3OVSA 3T3FA 4JV1A 1HI0P 4DL2A 4LF9J 4FNIA 3MR5A 2WONA 2OEMA 2JSXA 5IOLA 1NK6A 3FSYA 3PNIA 1NSKL 3C6TA 2CJBA 3MAAB 4F7VA 2HFNA 3KLIB 1XMBA 2A3JA 2HNYB 4USJC 1U6BA 1G1XA 1PJ6A 3M6UA 3NBPA 3EE3A 4RWXA 4ECXA 4ES1A 1N5SA 2AYGA 2OKQA 2HHWA 5EX0A 1DQ8A 1H98A 4UQTA 2ZKUA 1B70B 3T1HJ 2FHKA 2IPOB 1KOOA 2PMWA 1XJWB 1IKYA 2QN6B 3IWNC 3M6WA 1OO0B 1CJTB 2VQEF 1KQKA 4DL4A 3TAPA 4DV4F 4KR0B 3MR3A 2UXCJ 2AJQA 1I5OB 4NRTA 5J2QA 4AXIA 3BR8A 2QX0A 3MMAA 1RBOB 3AH6A 3NS5A 1TKZB 3Q23A 3UVJA 2W2PP 3AB4B 3DLHA 2DNYA 4DN9A 2YKMA 1UVNA 5EGYA 1EKSA 4EFAC 3KJNB 3QLHA 2OD6A 3NWGA 2C2KB 4HI1A 1O5JA 4J7CA 4K59A 1U26A 2V67A 4O44A 2KRBA 5IZHA 1I94F 2QLBB 2YPYA 2GMJA 4PG7A 4CM0A 5GAHU 2FHJD 4K4UA 2PDAA 2RDJA 2QRRA 4NLYA 1HI8A 5HJXA 3NGKA 1T05A 1ZH5A 4ZLNA 3KKFA 1NU4A 2B6AA 4O0IA 3OBIA 3MPWA 4KPCA 3ZNUA 2YKAA 1QJHA 1X0PA 2QGFB 4DSIA 5CZVA 3FFIA 5HMXA 2YY3A 4IOCQ 3DDKA 1JJHA 1BMQB 4USHA 1VQKS 4OYAA 2DD8S 2QL5B 2W25A 2WVDA 2N82B 4C8NA 3W9JA 4X4SA 2JEFA 3CD6S 1Y5LB 2VG5A 1SBRA 3MXHP 2OIHA 2EFOA 3L9ZA 4DUYF 3W3SA 1NB7A 2RQKA 1GXUA 1HBUB 2K7JA 2RE1A 3TAMA 3BGFA 2WVCA 1R43A 4PWWA 7AT1B 3Q8SB 3BEGB 4FS1A 2DPIA 2UVUA 2GAGC 2P9CA 3M2VA 2Z2ZA 4CLWA 3QGHA 3OSPA 5KFHA 2LEBA 3BGLA 1WDTA 1XQIA 2C2MB 4NYPA 3CJ2A 4CH1A 1UVMA 2L9DA 3VZIA 1D3WA 4F26A 2Z2YB 4Q2LA 4W92B 2Q66A 4U7UK 4RNMA 3GQCA 3TEGA 1YBTA 2WB4A 3KK1A 3EX7B 2LEPA 2CPJA 2VH7A 3KK3A 1RT3B 2HVZA 3C46A 1A6LA 3JAMU 3QO9A 4YB6A 1EJ7L 1RT4A 1UAWA 1F1BB 3MM8B 4FYXB 4NMLA 4XO0A 4N56A 4KTQA 1UZHA 5A8KA 2B7BB 3RR7A 5GMKa 1Q5VA 1ITPA 5KFJA 3PYFA 1YRUA 5HATA 3CD7A 4DR3J 1SJRA 2HFSA 1T94A 4ID5A 3WIUA 2WBRA 4H4KC 1TU0B 2CNNB 2Y1RI 2ZD1A 3D6HB 2C3OA 3DU5A 2XLJA 1OYEA 4NA2A 2HVHA 3VWSA 5HL7Q 4J9LA 2OLWA 1RT1A 5L1IA 3UW1A 5IT0A 3HVTA 3DOLA 3NOCA 4K8RA 3J81Y 3O8WA 1Q86T 1A7GE 2AYBA 3FCHA 1FF2A 3SQGB 8ATCB 2DNPA 4ZVHA 5KFTA 2RKIB 4ZS6A 4ZJQA 2VOPA 1FE0A 5KOXA 1KVJA 3RRGA 3SFGA 4USWA 2LU1A 1FRHA 2B3TB 1WF1A 4OYBA 2RVJA 2C3MA 1QSSA 3CJTA 4TU9A 1DQ9A 1LW0B 2QT7A 4JI5J 4J9NA 2R7TA 4DN0A 1AB8A 2LA4A 2AEJA 1SVDA 3DLGA 2K2PA 1RWWB 2PI4A 1NKEA 5J1NA 5H9FK 2C3UA 3IBWA 1JXLA 2ZUAA 3D3CJ 5IT9Y 1WKKA 2PEHA 4DUZJ 1VQLS 3BDPA 5CZXA 1OQ3A 4HHHA 2D3UA 4OYPA 2FTRA 1JLQA 2EFQA 2ZNZA 3GPAA 4KBIA 3V2UC 5KG7A 1N54B 2MQ8A 4QBUA 1KQFB 4UW2A 4B3OB 3FBBA 4PPZA 1GMWA 4EK2A 2ZDOA 4FXWA 2KM8B 1UVJA 5LXRA 4MK8A 3W60A 3I31A 4DX7A 2E9TA 1EP4A 1RAGB 3DLJA 3G2XA 2H1YA 1OPIA 3HFKA 3IGNA 1WG4A 3DCAA 1HWJA 4OX7A 2X1GA 4P73A 5AE2A 4DCOB 2J0WA 1N52B 4MKYA 4HT5A 1R8CA 3HHEA 3OFGA 5HLFA 4MT1A 4DFJA 1HHSA 3QYYA 1J2VA 1R7IA 4QW9A 1HWKA 3TA0A 2IA6A 5A8RA 2YNGB 1NUEA 3HPOA 1FNOA 1Q53A 4Y2CA 5I3PA 1NHUA 1TAQA 3CCQS 5KFIA 2MQQA 2A6OA 2XCPA 2IM0A 2QSFA 1UW9A 2BKPA 1LWFB 1WTFA 3MUVP 4Q8EA 2KRRA 3VHQA 1I51B 3UCZP 3CCES 1X4EA 1X9WA 2WB1D 2I1RA 2QA2A 7FD1A 2O01C 2DNZA 1S9EB 3MCOA 2ZJQQ 1G2EA 3LW5C 2NXJA 4LF7F 2VASA 4NA1A 2VA2A 5IT9U 1UKUA 3MOZA 3U1LA 1HNXF 1UFWA 3NMAA 3BO3A 3JYTB 5EWGA 2RUGA 3UQSA 2YX4A 2DISA 3TJAA 4ZPTR 3B6BA 2AJ1A 1P6TA 5D0GA 4CI0B 1P27B 2BKOA 2K1RB 5IC6B 4DLGA 3UD3P 2JEJA 3RR8A 3FZBA 4BS2A 1RA7A 1JK9B 4QWEA 4PXCA 1S1TB 4RL1A 4N7TA 2OSRA 4ZVPB 5HVFA 3UFCX 3TO8A 4UQGA 2Q3PA 4Q44A 3OTOJ 4NLDA 1RT2B 2IRYA 3NRBA 4I2PA 3DYAA 4UOFA 3J81j 1HNWJ 4LFBF 1MMNA 3SDEB 2DGUA 1U1QA 4ICLA 2B4VA 2RRBA 4NPOA 1RHQB 3A8KA 3ILJA 2BJ8A 3HO1A 2WVEA 3KLEB 5GAEU 1HNZJ 3OLAA 3QFHA 1NNDA 5CA5A 4CDIA 1U1OA 3CTRA 3CJ3A 1Y9OA 4M8LA 2R7OA 5D4LA 4QPTA 1IUJA 3BGRA 2PSZA 2QLXA 1UMJA 3ENQA 5D4NA 4Y0FA 3MMBA 3GYXB 4WYLA 5J2NB 3KFWX 1LK7A 2DYAA 3PFOA 3JS9A 2J6TA 2XS7A 1EZZB 2CQ3A 4R25A 1YWXA 3IRXA 4CO3A 2BJ7A 1TV6B 2FJEB 2FUG9 1NPKA 3F41A 5AXLA 1JWWA 1B4SA 2X3DA 2JX2A 3HZEA 3OR2B 2W8LA 1NK5A 2ZZNA 5J2NA 1RHRB 3DKDA 4X66F 1S7HA 1B0VA 2E7XA 1CULB 2CG4A 1RP5A 3BGRB 5DRKA 1CQMA 3ZTRA 4F3QA 4V19X 1NZ8A 1PKUA 2E1RA 2QC3A 3G8TA 2K3KA 4RKUC 1R0AA 3MM5A 1T95A 2GIQA 3NL0A 3EDQB 1JJCB 1TVRB 3MD1A 2KL8A 2BM1A 4PXBA 2FLPA 2IM2A 1FNXH 2DGVA 1NDKA 2WSCC 1B7FA 2RRAA 1VHFA 2CQCA 1F6TA 3IGVA 3KDNA 1SB6A 4LIRA 5A0YA 4F4ZA 3CJSA 3HP6A 4DQIA 4NXMF 2OTJS 1HPZA 1V5VA 3IXQA 3LAMA 4USIA 2MQPA 1I6JA 4F2SA 4NLQA 1RT2A 1H2VZ 2FGCA 4K0KF 1RAEB 2QYCA 5EN1A 3H8YA 4FDFA 2GMLA 3TUJC 5KFKA 3GJQB 3M8QA 4URGA 3KJVA 3T9ZA 5K8MA 1TKXB 4H4OA 4OZJA 3T6BA 4IG0A 2R7VA 1SJQA 3JSYA 5KFSA 2OMLA 5L9NA 1Y5NB 2XNQA 3LP1A 2R8KA 1WOSA 3MM7A 5LJ3Y 3N5FA 1XNRJ 3QBCA 1AW0A 4DPOA 4WYWA 1R8AA 1BXNA 1X4FA 2V0NA 2RU3A 3KHLA 3GFYA 2HQIA 2DXFA 2HPUA 1X5PA 2ZITA 3MTJA 2HWIA 3OTBA 5KG1A 2GQ2A 4DF4A 5H9EK 1SQFA 3CB4A 1BLUA 2PC6A 2AD9A 4ZCMA 3LTOA 4ZP6A 1NDLA 1UEKA 4BC7A 3IR7B 3SSSA 2YKPA 3RBEA 3PO5A 4KV8A 2MKKA 2IAJA 3QIDA 4L74A 1MU2A 1VRQC 1RWPB 5K9FA 5J1EB 3J7Z5 4JI8J 3KUHA 5B0GA 3VGUA 2VIHA 1KKHA 1MMDA 1VQYA 2CRLA 4ZN1A 4Q43A 2J9DE 2ZZTA 3NLCA 5A8RB 2UVWA 1IQZA 5LMUJ 1RT7A 3DFEA 4YDXA 2MY8A 3R2DJ 1TL3B 2VBXA 1CLFA 2A6MA 3GIJA 3Q8YA 1RU1A 1Q0NA 3VALA 1GQEA 4ANCA 4C4WA 3P5BP 3MEKA 4RNHA 4ZLPA 3N6NA 1WG5A 4MKAA 3GJTB 3SCJE 1NJYA 1S48A 3Q89A 4RW4B 4DXLA 1F3VA 5B7WA 5M2UA 2AIRB 1FFSB 3LP2B 2XYHB 2MEWA 3FUYA 4ITSA 4P2MA 3W5XA 3V81B 2D9PA 2HQCA 2CA9A 2MYFA 2XSFA 5A2QU 3CJKB 2A10A 3I0RA 3BN7A 1XMQF 3VGSA 1KRPA 2EPIA 1X4CA 2FYXA 2QV6A 3HSDA 4NEYA 4X64F 2VA3A 3VAIA 2EC2A 5I4MA 5KT5A 5HROA 5I3UB 1HI1A 3DN9A 4O4RA 1JLAA 2HMIA 5HMYA 1U49A 2XY6A 5F3ZA 1K47A 2KT2A 4NZ0A 5JXSA 1HNVA 2V34A 2FLLA 3OSNA 2EVZA 5LSLA 4EO6A 4Y65A 3UD4P 2RKIA 3B54A 1S10A 2R7SA 2BACA 3AQOA 5DDPC 3RW6A 2BVZA 4ECSA 3JSRA 1TK5A 1S5ZA 2R8IA 1JLFB 2YH0A 2XMUA 3J7A1 3DOLB 4ZMMA 4ETXA 5CCMA 3KTQA 1UPMB 1WKJA 4P75A 3HDSA 3ZZYA 2EFVA 2UUAF 2ZD1B 2ZWPA 3V6JA 1DFDA 2KO1A 4ID5B 4DQRA 1JJ4A 1PYTA 3Q8VA 2YNFA 4QWCA 1RTHA 2AZ1A 1R27B 3HXMA 3DOMA 3GV8B 3JTNA 5E0OA 4QYZJ 1BE4A 3H2VE 4YY3F 1NHVA 5I3QA 2P8IA 1GX6A 2AEFA 1RXOB 2FLOA 2MLZA 2Q79A 1URRA 1IN0A 2SXLA 4ENOA 2KXNB 1NK8A 2I8EA 2XSJA 2R7WA 2G1DA 3MAHA 5AJ3F 2W9CA 2Y1LB 3KK1B 3CJ5A 1VLYA 4LFCF 5F0WA 2HBYB 5CYMA 2IJFA 1DRZA 2MJNA 2M70A 1S79A 2AW0A 1HWUA 2IIHA 2B4OA 2BZ2A 2A2DA 1F9EB 4X4RA 3PKYA 3KHGA 3LH2S 1PJ5A 2AQ4A 2GCFA 1HQUB 1B0PA 4JI3J 1MROB 4F4YA 2D3ZA 2PGCA 2YWGA 1S1VB 4YP3A 2ATLA 5CYQA 5CQGA 4DMZA 4WP3A 2CVIA 3KLGA 4WFNQ 2L3MA 4A8WA 2EI5A 1TL1A 2VG5B 3C15B 2WBMA 4P72A 1TL5A 2ZHOA 5KFNA 5D78A 2ROGA 3HHDA 1VRUA 2JLFA 2G4BA 1JKHB 4PEOA 2AGPA 3ZFVA 3ADAC 1VHIA 3NOGA 4OX9F 1RWNB 3LPYA 5AT1B 3HX9A 2BW2A 4TYAA 5KG0A 2FZGB 4OHXA 2R9LA 2YWFA 1HKAA 1RHKB 2YTCA 3HHNB 1VI7A 2B6AB 2RRNA 4CIOA 4B3SJ 1F5BA 2KFZA 1T05B 1NJWA 1NK0A 2F3JA 1JB0C 2PE8A 5KFAA 3SFUA 1XERA 2MDAA 3RUBL 2F1FA 4DV2J 1TKTA 4ZVQB 1Y3KA 1XC9A 4H4MB 3R97A 4P74A 1Q7LB 1VK3A 3H42A 4LJMA 4TKTA 3U1NA 4AL7A 3P3DA 2F9JA 3GG0A 1WC4A 2OPSA 4KGMA 2WZ1A 4RW6A 4C3MA 5F8GA 4HR2A 3FJ2A 3I0SA 4DV6F 2HRTA 1U48A 3DMJA 5DLGA 4OYZA 1IQTA 1HW9A 1I3OB 1NMEB 2KJWA 3QT6A 3RU0A 5K5MA 1UA1A 3OXGA 3FMBA 4KHRA 3D0GE 4Y34A 2ZH5A 4RW7A 1HQ2A 3UVJB 4DSEA 3A3PB 2E5HA 3A3OB 5DJBA 2W24A 4C2MA 1OJ4A 1SKWA 4NCGA 4UUXA 2B0GA 2QLJB 2VB6A 2VJVA 3BPSP 3V6HA 3X3UA 3TYTA 1T9XA 4B9VA 3PIOQ 2HHUA 4ER8A 2MB0B 1D8ZA 1RZMA 3K17A 5C24B 2CPXA 1IJFB 3I9V9 2ACYA 2RQ4A 1W7WA 1R8HA 1JLEB 3CCLS 4J9SA 3W63A 2FVRA 4K4VA 1X9SA 1RE1B 3UD5A 4HT7A 1PBUA 1M1HA 2E1AA 1XWLA 4I4BA 3PW0A 1FJ7A 1URNA 3U7JA 4U95A 6FD1A 4C8MA 1U8WA 3FZ2A 1S76D 2D3O1 3MAAA 3VQSA 2J8SA 1UETA 3OR1B 2ZH4A 4OI0A 1X9MA 2V50A 1NLKL 3CD0A 1YRXA 3GIMA 2KVQE 1YJRA 1CS4B 3CCSS 3EXYA 3D9BA 3C16B 4NLXA 3D6TB 2JDJA 2C2OB 3QAEA 4C8YA 3C2PA 2HNDA 3QT7A 4KO0A 4UF4A 2CG8A 4DCJB 5MLCV 2KHCA 3AOCA 3GJRB 5G0RA 2W4DA 3Q83A 4EBCA 2E44A 2J7KA 3I5AA 3DDIA 2GHPA 1RAAB 5K14A 3NNCA 4P52A 5C25A 1HBNA 4JP8A 4LSNB 3RAMA 1OMSA 1N6QB 3FSXA 4CO4A 1IJEB 5E3QA 1U1KA 2HWTA 2NPIA 4R5PA 4F04B 3OHAA 1W2BR 1N32F 4NA3A 4C8OA 4O0NA 3L95X 1UEVA 1MLAA 2XYPB 4USUA 2NLWA 1HNXJ 4DR1F 3FGVA 1HFEL 1C1CA 1S1WA 1FJGJ 2XNRA 2VD3A 4R0EA 3OLBA 2HKEA 3GP9A 3KLHA 2FVCA 3GV7B 3L09A 2DRDA 4CTAB 1GTEA 2W1BA 3QGGA 4ELTA 4CO5A 4MMOA 4Q7AA 1K44A 1L5UA 1YK9A 4O3QA 2ZHBA 1VQ7S 2HEKA 4FXVA 2QL9B 3G6XA 4DOZA 2CPDA 3DMJB 2GHVC 2N3LA 5KFVA 3MOJB 2H5IB 4P7VA 1WDDA 1N36J 4WP8A 3OTOF 1P1TA 4RW6B 4FYDA 3M8YA 3OL7A 5HVHA 4LFBJ 3O6QA 1IKVB 4I1TA 1RHJB 2UU9F 1KHVA 2GHWA 1SH3A 1TKTB 3SBMA 5CD4A 4B3RF 4LRBA 1NHKL 1TP7A 4C0HA 3HMJG 1JJ2R 4JI6J 3S7RA 2JEIA 1VK8A 3DOKB 5ETKA 2NCKL 2J7UA 3IBCB 4DU8A 1HNZF 4DSJA 2F40A 2RQMA 2I6WA 3AT1B 3JSMB 4NLSA 2V9KA 4DU7A 5DS7A 5HP1A 4O3NA 3HZGA 3AHPA 2IM1A 4ZJOA 1AZSA 2IMOA 1G7CB 2M3DA 4URSA 1KN6A 4IR9A 5E3AA 1VRUB 3P96A 3BO4A 5H9EJ 2CPYA 1PC5A 2DPJA 2PFFB 3SSRA 5SZTA 3FQLA 4RO0A 5T7LA 4K4XA 1DAXA 1O51A 3C15A 1TL1B 3D5MA 4USVA 3RBZA 1DQAA 3I6PA 3MM6B 1M90T 2DHSA 3N0VA 3KLGB 5CAAA 3W5YA 1XMOJ 4FF2A 1L3SA 1DTTB 3X1LB 1S1VA 2V9WA 2DH8A 1X7VA 4X66J 1VC6A 3MR6A 2LQ5A 2VBWA 3KLFA 2E7WA 4DR2F 5KFWA 2Y0BB 1P1LA 3CCVS 2XEXA 2X1FA 2FJVA 5JVHQ 1SPBP 4JI2F 3JQMA 1A9NB 4RLEA 3HHKA 1HW8A 4KGZB 4ID8A 2KXHA 2JL9A 2JFKA 3AD9C 1KR4A 3CD5A 3HHLC 1NPRA 4ETZA 1FEHA 1H38A 2CNOB 4LIWA 2PO4A 4ECVA 4ED8A 4RNNA 4DV5J 2CDQA 3RG6A 3ISNC 3G86A 5HBMA 3TAQA 2VOOA 3GFZA 2AP6A 4HACA 4C9DA 3GFHA 2HZAA 5GMEA 1YSJA 3Q86A 5U47A 4OZ0A 2WVFA 4WFXA 4OI6A 3DOMB 3TQ1A 2MZRA 1RWUA 1Y10A 2KYZA 2VFVA 3CWJA 1AUDA 2F4VJ 3QWPA 5C42B 2B9EA 1FX2A 4LMZA 2DKOB 3KWMA 1S1XB 3W62A 2FD2A 2RMLA 4ZHRA 1X5OA 1E6VA 4I2QA 4MFBA 1T0TV 4L6V3 4C3KA 1FO1A 2GC8A 2IDEA 2H51B 2JFDA 2V5HG 2RDDA 3BKTA 2VDIA 3CXCR 4FP9A 1VMBA 3ZZOA 2PI5A 1SH0A 1KLNA 3I9ZA 3IC1A 1N33J 3RGIA 3JTPA 2E5LF 1OY6A 4IRKA 1XNRF 4B9SA 4GRSA 5L9XA 3ZNJ1 1LW2B 2JLEA 1GEHA 3MGJA 4X62F 4TU7A 3IS9A 1EETA 2W9AA 3PVXA 2H5EA 1T3NA 2ZH7A 1IBMJ 1T02A 3K8VA 1DZ5A 4FN5A 5A6WA 4OJGA 4USKA 3UI3A 2R2TA 4GC6A 5BYSA 5HROB 5D0HA 2HRUA 4TYBA 1UWBB 3OVBA 4KKOA 2OTLS 4QIEA 2POKA 1XBWA 1C0UB 1WHWA 1YZ6A 3H59A 1JIHA 1JLBA 1DJ0A 3CO9A 3M1VB 2QZ8A 2Q6BA 4CYUA 3I0RB 2IYIA 4TXSA 2FC9A 4DPYA 3LP0B 3EGNA 3SZ2A 2LMIA 1MG7A 1Q8IA 4ZVSB 5IQQA 4F36A 1S0NA 5LMUF 2IMWP 3EYZA 1QVGR 1QD1A 1HBOA 1UFLA 4CH0S 1U1NA 1PAUB 4OZLA 4RW9A 1YTYA 2B4UA 3HULA 3BQ1A 2PMZD 2Y9HA 2BRKA 3GSIA 1Q5YA 4OQJA 3B8HA 2I0XA 1Q8LA 3JQJA 4QU7A 3F44A 1NRKA 4F50A 1ELOA 1TL3A 3GMGA 4O3OA 1F2GA 3N4WA 2B9YA 2FPHX 2P9GA 2ZH2A 3TJ8A 3UDCA 4ZA1A 4OFZA 1D0EA 5FJ4A 1X4GA 3MUTP 1YGYA 1Y7PA 2CQGA 2UV8A 1S1UB 4NLWA 2UUTA 2V2VA 4PCQA 4DPTA 2DNRA 4OI3A 2Y1JA 1XMQJ 1CEZA 2HNZA 2Q43A 4C8ZA 2HBRB 4NASA 3SI8A 2UXCF 2G2ZA 3FEYB 5HMWA 4IQMA 2IAJB 4X64J 5KFEA 1VBKA 3N01A 4N47A 4IUFA 4DUTA 2NREA 3RTVA 4ECRA 4OZ3A 4LF8J 1RHMB 1GAOA 2R8JA 4JI0J 3C14B 3VGTA 3OFHA 3C3LA 3MCSA 5DQIA 1NDPA 4CP5A 3MM7B 2OI2A 1V6HA 1M5SA 4F4XA 1J5OA 1YHQS 3BO2A 2F65A 3NGDA 4IG0B 3U1MA 1XIQA 2U2FA 4IFYA 4RBVA 2YQ0A 4YN3B 3KJVB 4C7QA 1P8GA 3C8YA 3M8QB 3OJUA 1DURA 3BKUA 3CC4S 5J2PA 3TR5A 1HYSB 2EKNA 3P5TL 2VKRA 4CNYA 2FDNA 4ZCIA 4TY9A 4C0OC 4ED3A 3ZTSA 4MKVA 2RU9A 4QR1A 1Y0HA 4OV6A 4DZ6A 3RBDA 3IG1A 4YY3J 2R7XA 4J5OA 4M95A 4DBQA 2MZJA 1HPZB 3E51A 1VQOS 4LF9F 3RRHA 3O2IA
chains in the Genus database with same CATH topology
1BHNA 3VGVA 4F4AA 3Q8YA 2VU5A 4ANCA 3B6BA 4FKXA 1HHQA 3FCWA 3PRVA 4ANDA 3Q89A 1ZS6A 3BH7B 1W7WA 3Q86A 3BBCA 4UOFA 3BH6B 3VGSA 3ZTOA 3BBBA 1KDNA 1XQIA 4S0MA 2DXEA 1U8WA 3NGSA 1JXVA 3EVOA 1NSPA 1NB2A 3PJ9A 3EVMA 1NSQA 1NLKL 3EJMA 3NGUA 3FKBA 1F3FA 4WBFA 3B54A 3FCVA 2B8QA 1NCLA 3NGTA 5BXIA 1S5ZA 1WKLA 5CABA 2DYAA 3EMTA 3JS9A 3EVWA 3Q83A 2DY9A 4C6AA 3DDIA 1NPKA 1WKJA 2CWKA 3ELHA 3ZTQA 1B4SA 4W98A 3Q8VA 3DKDA 2AZ1A 1PAEX 1BE4A 4F36A 4O0NA 3WX8A 3ZTRA 4ENOA 1LEOA 3FBEA 4UOHA 1PKUA 1UCNA 1EHWA 5IOLA 3GP9A 1NSKL 1NDKA 3Q8UA 1BUXA 1F6TA 3R9LA 1K44A 3EE3A 2ZUAA 1WKKA 5C7PA 4DI6A 1MN9A 3GPAA 4ANEA 3ZTPA 3FBBA 1MN7A 4EK2A 4UOGA 1NHKL 3VVUA 3G2XA 4DUTA 2NCKL 4FKYA 3ENAA 1NDCA 3EICA 3VGTA 2DXFA 3EM1A 3FC9A 1NDPA 3VVTA 4CP5A 1NUEA 1S57A 1S59A 1NDLA 2BX6A 3NGRA 2HVEA 1HLWA 2HURA 2AZ3A 1XIQA 3ETMA 1LWXA 3L7UA 2B8PA 2BEFA 3VGUA 5CAAA 1HIYA 3FBCA 4KPCA 3ZTSA 2DXDA 4HR2A 3BBFA 1VYAA 4DZ6A 3FBFA 2HVDA 3MPDA 1B99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHN A;  3VGV A;  4F4A A;  3Q8Y A;  2VU5 A;  4ANC A;  3B6B A;  4FKX A;  1HHQ A;  3FCW A;  3PRV A;  4AND A;  3Q89 A;  1ZS6 A;  3BH7 B;  1W7W A;  3Q86 A;  3BBC A;  4UOF A;  3BH6 B;  3VGS A;  3ZTO A;  3BBB A;  1KDN A;  1XQI A;  4S0M A;  2DXE A;  1U8W A;  3NGS A;  1JXV A;  3EVO A;  1NSP A;  1NB2 A;  3PJ9 A;  3EVM A;  1NSQ A;  1NLK L;  3EJM A;  3NGU A;  3FKB A;  1F3F A;  4WBF A;  3B54 A;  3FCV A;  2B8Q A;  1NCL A;  3NGT A;  5BXI A;  1S5Z A;  1WKL A;  5CAB A;  2DYA A;  3EMT A;  3JS9 A;  3EVW A;  3Q83 A;  2DY9 A;  4C6A A;  3DDI A;  1NPK A;  1WKJ A;  2CWK A;  3ELH A;  3ZTQ A;  1B4S A;  4W98 A;  3Q8V A;  3DKD A;  2AZ1 A;  1PAE X;  1BE4 A;  4F36 A;  4O0N A;  3WX8 A;  3ZTR A;  4ENO A;  1LEO A;  3FBE A;  4UOH A;  1PKU A;  1UCN A;  1EHW A;  5IOL A;  3GP9 A;  1NSK L;  1NDK A;  3Q8U A;  1BUX A;  1F6T A;  3R9L A;  1K44 A;  3EE3 A;  2ZUA A;  1WKK A;  5C7P A;  4DI6 A;  1MN9 A;  3GPA A;  4ANE A;  3ZTP A;  3FBB A;  1MN7 A;  4EK2 A;  4UOG A;  1NHK L;  3VVU A;  3G2X A;  4DUT A;  2NCK L;  4FKY A;  3ENA A;  1NDC A;  3EIC A;  3VGT A;  2DXF A;  3EM1 A;  3FC9 A;  1NDP A;  3VVT A;  4CP5 A;  1NUE A;  1S57 A;  1S59 A;  1NDL A;  2BX6 A;  3NGR A;  2HVE A;  1HLW A;  2HUR A;  2AZ3 A;  1XIQ A;  3ETM A;  1LWX A;  3L7U A;  2B8P A;  2BEF A;  3VGU A;  5CAA A;  1HIY A;  3FBC A;  4KPC A;  3ZTS A;  2DXD A;  4HR2 A;  3BBF A;  1VYA A;  4DZ6 A;  3FBF A;  2HVD A;  3MPD A;  1B99 A; 
#chains in the Genus database with same CATH topology
 1SI9 A;  5A0Y B;  4DZD A;  1ZET A;  2FJA B;  3ILI A;  3MM9 A;  1U2F A;  2NPF A;  2VU5 A;  2QFI A;  1WHX A;  2BJE A;  2D69 A;  3EUN A;  3H25 A;  1U45 A;  1HHQ A;  3M6X A;  1VRT A;  2FGO A;  4G1P A;  4N8N A;  4NEZ A;  5F41 A;  3W2W B;  4DQP A;  2V8H A;  4ZPA A;  4NWB A;  4CLF A;  3UDV A;  1R0A B;  4KY3 A;  2G1H A;  2MQO A;  1SL2 A;  2NUU G;  3GE9 A;  4WK3 A;  4X84 A;  5KFX A;  1RT6 B;  3ULH A;  4NXN J;  3MEC A;  1BQM A;  4ED5 A;  1K0T A;  3QAT A;  3BBC A;  4Y3C A;  5D3G B;  1T7P A;  4C3L A;  1Q16 B;  1RYR A;  4IFV B;  3KDO A;  1NH7 A;  2CJX B;  2DHX A;  3NXZ A;  4JI7 F;  4KRW A;  3ISZ A;  1C0T B;  2VFR A;  3K5M A;  1SIZ A;  1TV6 A;  4F4W A;  5KFZ A;  2LLZ A;  2GJI A;  1EIY B;  1U1P A;  3MMB B;  3PEJ A;  1BQN B;  3ITH A;  3OFE A;  1FDD A;  2Y1I A;  1QAX A;  5ETL A;  1UWA A;  2D1C A;  4LF2 A;  2J9D A;  2MSS A;  5KFD A;  3CUN A;  3H90 A;  4LRA A;  4KC5 A;  2BE2 B;  2H54 B;  2MPU A;  4P7T A;  2CPH A;  2XWY A;  4X4O A;  3QIP B;  3R5A A;  3NEK A;  1JLG B;  2R7R A;  2DY1 A;  2V69 A;  1VQ8 S;  2XS5 A;  2E5J A;  4EUV A;  1LWC B;  2JNJ A;  3KJF B;  4PQU A;  3M8Z A;  4HEA 9;  1J5E F;  2OP5 A;  4LRD A;  1TUG B;  1NPP A;  3M8P A;  4BWJ A;  4J9O A;  5T14 A;  4ICL B;  4IG3 A;  2WW4 A;  3SDE A;  3C6U A;  2JVR A;  2VPW B;  4MYT A;  5BYR A;  3DYA B;  4P2F A;  4I2P B;  5L1K A;  1U7L A;  2F8M A;  2BOA A;  3DI6 B;  5BJR A;  3G9C A;  4CM2 A;  3V4I A;  4DV6 J;  1TKD A;  3KOA A;  1ROF A;  1K1Q A;  4WFA Q;  1SUQ A;  4V19 J;  3IFE A;  4M5N A;  2MKJ A;  2XCA A;  1BD6 A;  1M5P C;  3V6K A;  4NXN F;  1NKB A;  2AV5 A;  2IM3 A;  2KJV A;  2M88 A;  5L1J A;  2WVB A;  5GAD I;  2ZH6 A;  1X0F A;  3R27 A;  3LQV A;  3H5X A;  4K2X A;  4TQR A;  2C2E A;  4X4V A;  3Q8U A;  2BAN B;  1ZYQ A;  2BAB A;  4DCP B;  4GO7 X;  4C98 A;  1HD0 A;  5LXY A;  3HT3 A;  3M8R A;  3VAK A;  2R2S A;  4GVB A;  4DUY J;  2IA0 A;  4N8O A;  1WC0 A;  3W64 A;  2FLN A;  5D8H B;  4EEY A;  5DG8 A;  3CT9 A;  4DR7 J;  3PXG a;  1G4C A;  1QE1 A;  4QIF A;  3EZO A;  4Q0B A;  1ZPW X;  2C2N A;  6AT1 B;  3I55 S;  4J9P A;  3GTY X;  3AOA A;  1S12 A;  3R8Y A;  2WW8 A;  3H7H B;  3M2R B;  3ENW A;  3MPY A;  1UTA A;  5KAK A;  4YHH F;  3I96 A;  2IJR A;  3PYG A;  1S9G B;  1X4A A;  2M9K A;  5DO2 A;  2HHT A;  4OYO A;  4EZ6 A;  1ZAV A;  5C2G A;  2AX0 A;  2MZ1 A;  2YQ3 A;  4CWB A;  4WK1 A;  4Z7C A;  3EIC A;  5A8W A;  4YS2 A;  3AXK A;  3I5C A;  4Y2K A;  4DQQ A;  2XMK A;  5HLF B;  2KTQ A;  5H9F J;  3JTO A;  3VVT A;  4KGV B;  2YNH A;  3TA2 A;  2J7W A;  3EWG A;  4D3G A;  1N56 A;  3CME S;  3CCJ S;  3NGR A;  2DR7 A;  2XLK A;  1KVI A;  3R5G A;  1HBM A;  2Y0S D;  4NE9 C;  2CZ9 A;  5GAE I;  4QW8 A;  3A8J A;  2PII A;  4XK8 C;  4A8X A;  1T3O A;  1SQG A;  3D67 A;  1Q1K A;  6FDR A;  3Q22 A;  2GVZ A;  4ZJL A;  4KH1 B;  2K8G A;  3G71 S;  2HZC A;  3QSY B;  3IBF B;  1HMV A;  4X4P A;  1QDU B;  5KFM A;  4M5J A;  1L3K A;  4OI2 A;  1F0X A;  4DR1 J;  2UZA A;  2VPY B;  3CPW R;  1NKC A;  4KT0 C;  2W9B B;  1ZZN A;  3DLG B;  2NSB A;  1LWE A;  1QUV A;  2EG1 A;  1WEY A;  4JI4 J;  3GCX P;  3S8S A;  2RHQ B;  1P9Q C;  4IO1 A;  4PWU A;  1R6V A;  1UVI A;  4WFB Q;  1N88 A;  4IRD A;  5LT5 A;  1VIX A;  2E66 A;  3BKF A;  3PRV A;  4KH0 B;  4O4G A;  3DXB A;  1GXL A;  2LDY A;  5JVG Q;  3LAN A;  4ZCK A;  1KP6 A;  1RAH B;  4OHW A;  4TLR A;  4RUC A;  2IHR 1;  2LVW A;  2M4M A;  2HHH J;  2AX1 A;  4K4W A;  1N36 F;  4JYA J;  1TUW A;  4HDH A;  1SV5 A;  1S6O A;  2M0G B;  2PD1 A;  4ZN3 A;  1ZA2 B;  3VZH A;  4B3R J;  3TUZ C;  3GYN A;  2J5A A;  3I5B A;  4XAK A;  1N5Y B;  2XY7 A;  2M8H A;  2KB2 A;  3BRE A;  4NYO A;  1NSP A;  2DGX A;  2H65 B;  3G87 A;  1RTI B;  2RT3 A;  3RRK A;  2DVI A;  4BHQ A;  2N4D A;  5D15 A;  2IRU A;  4TU8 A;  2X1B A;  3J80 Y;  4LF6 F;  3MMJ A;  2DNM A;  1UJ4 A;  3VF0 B;  3IO1 A;  3NGU A;  2QIF A;  2V94 A;  1N34 J;  2UXD F;  3QO9 B;  1SKR A;  5KG5 A;  3KK3 B;  1S7I A;  1IBL F;  5CAB A;  3CCR S;  5L38 A;  1RQ0 A;  1S4F A;  3EVW A;  3CIZ A;  2DY9 A;  2KVI A;  3PG9 A;  5GAD U;  3I82 A;  4HYK A;  4DFP A;  2JWN A;  4DR4 F;  2CXE A;  1JMT A;  2W4C A;  3OPK A;  1KEK A;  3TAR A;  4IO9 Q;  1OY8 A;  2OD4 A;  3A8E A;  4DJB A;  5ITH A;  3OL6 A;  2ZBR A;  2HK3 A;  2AGO A;  1WF0 A;  4DS4 A;  2J0Q D;  4LF7 J;  2O3D A;  5KT7 A;  1EX8 A;  1HBU A;  3DHX A;  3TAM B;  3WX8 A;  3F73 A;  1U02 A;  3TI0 A;  2HBQ B;  2OSQ A;  2XMW A;  1D9F A;  4JI2 J;  4FYW B;  3D4J A;  1JXE A;  1N0U A;  3A4T A;  4YB5 A;  2Y8Y A;  2HYI B;  1RIS A;  4KHM A;  4MK9 A;  4ZVT B;  1AFI A;  2MKI A;  1KQG B;  3Q0A A;  2FJB B;  2GZO A;  1Y5I B;  2W9B A;  2VJU A;  4ED1 A;  3VV2 B;  1LK5 A;  2V6A A;  2Z56 B;  5MAO A;  2HHP A;  4F2R A;  3GCW P;  1PIL A;  2QJ3 A;  3FFI B;  3HKZ D;  1SV5 B;  1FJC A;  2F4V F;  4QPX A;  1HNW F;  1FA0 A;  2VG7 B;  1SKS A;  3DXS X;  3G6Y A;  4XPC A;  1H7X A;  1L3T A;  2YNI A;  4IH6 A;  3LWM A;  2WHO A;  2KG0 A;  4O4G B;  4K4T A;  4FF1 A;  3W65 A;  2HAF A;  5EWE A;  1EAR A;  2WAQ D;  4U67 Q;  3K5P A;  4TN2 A;  2H5J B;  2H9Z A;  2I5J B;  4UUW A;  4WXW A;  3TJ9 A;  4CLS A;  1LWE B;  1VS3 A;  1NSA A;  2YWW A;  5KG3 A;  1NM2 A;  2YNH B;  2GQC A;  2OAU A;  3K7R A;  2KH9 A;  2FJW A;  3TUP A;  4O44 B;  4ZP8 A;  4AUK A;  5HI7 A;  3D6F B;  3QLH B;  3TZX A;  4NLT A;  3TZY A;  2NR0 A;  1IBM F;  2CAD A;  2FY1 A;  2P2C B;  1BQX A;  1GXT A;  2D7S A;  2DEJ A;  3AOB A;  4MKB A;  4Q2M A;  3UN3 A;  1M1G A;  1YJ7 A;  2GVZ B;  1M0S A;  3FNN A;  4ZIT A;  2ATC B;  2ZE2 B;  5J2Q B;  4F4K A;  4DQS A;  4OLO A;  3R7N B;  2W2N P;  2QA1 A;  1CJT A;  2KZZ A;  1HBM B;  1RJJ A;  2BEF A;  2NZC A;  1B7Y B;  4K2J A;  4A48 A;  4JI1 F;  2QLW A;  3UNG C;  4F0H A;  2HQG A;  1KS2 A;  3OHB A;  3CJ0 A;  4Q0B B;  4UY8 T;  2UXB F;  2W2O P;  4L73 A;  3SCK E;  3KXD A;  5ETO A;  1KNZ A;  1A0O B;  3NNA A;  3LAL A;  3D1H A;  3MPD A;  3SIP B;  2RJZ A;  2YWK A;  3HLU A;  3HHL B;  4ILR A;  5A8W B;  3J80 U;  2IFX A;  4NX9 A;  2F5G A;  3PCO B;  1VOM A;  2Y3Y A;  2OEL A;  3VGV A;  2HS3 A;  4RUB A;  1JX4 A;  2VV5 A;  4FZV A;  3NKY A;  4HH1 A;  1RHU B;  5AXN A;  2VPZ B;  4EMD A;  1SL0 A;  4DF8 A;  4OX6 A;  4WZQ A;  1T9V A;  2LXF A;  1R3N A;  3O44 A;  2DH7 A;  3M2R A;  4MIW A;  2JLG A;  4WFZ A;  4NLV A;  1YG0 A;  3BM7 A;  4CCH A;  1NZA A;  3ZC4 A;  4CT9 A;  4J9V A;  1AUS L;  4A8F A;  3AY0 A;  3V4I B;  5IT4 A;  3DI6 A;  3L4B C;  3MFH A;  4L72 B;  3BSO A;  1IKX A;  5L1L A;  2UVR A;  1XK8 A;  1BWV A;  1WC1 A;  3C6U B;  1BY9 A;  1OYD A;  1JNZ B;  2F9D A;  2PFD A;  2XUL A;  3CIM A;  3TWZ A;  4K5R A;  3ZTO A;  1NEE A;  2D3O R;  4S0M A;  2CIM A;  2E5I A;  3GU0 A;  1YJT A;  2BAN A;  3POT B;  2IBK A;  1RDR A;  1U8S A;  4PQU B;  3R2C J;  1FD2 A;  2G9O A;  3DDN A;  1HD1 A;  2UP1 A;  3D0I E;  1J27 A;  2XMV A;  1NSQ A;  4EZ9 A;  3BSC A;  1IKW A;  3DRS B;  4Y2I A;  3HF5 A;  3W8G A;  4LF8 F;  2ZC4 A;  3MCN A;  4JI0 F;  3PX0 A;  4I64 A;  2CQP A;  2ASJ A;  1U2R A;  4BC9 A;  4PYD A;  4CO1 A;  2KDO A;  1KLM A;  3M30 B;  5FDL B;  5B0B A;  1BQN A;  3ITH B;  4DR6 J;  1UEU A;  3CE8 A;  1V3R A;  1LNQ A;  4QU6 A;  3GIK A;  1RBL A;  1H0H B;  2V4Q A;  3M8P B;  4LSZ B;  1FKP B;  1PBA A;  1C1B B;  1QTN B;  1C0T A;  1WD6 A;  4JI8 F;  2OO4 A;  4M94 A;  4DDF A;  1R0C B;  3Q8Q B;  5KG4 A;  3M2U B;  1RAO A;  4DX8 H;  4JUZ A;  2D9O A;  2EW9 A;  3BN4 A;  4W98 A;  4LF5 J;  1K1S A;  4P6Q A;  4DV1 F;  4ZPW R;  1PAE X;  5DZ6 A;  5B08 A;  5D3G A;  3ICL A;  2CJK A;  5ETV A;  3MEC B;  1WHY A;  3AOD A;  1RT6 A;  1U6Z A;  4HL9 A;  2DNL A;  3Q8P B;  2CVE A;  2GIF A;  3JSB A;  4ES3 A;  1GMU A;  4W4M A;  3N79 A;  1YZ7 A;  3V6D B;  1U1R A;  3VAH A;  1YJ9 S;  3W5Z A;  2UUW A;  2VBZ A;  4I67 A;  1T9U A;  2OJ3 A;  1FT8 A;  3DRR A;  3BYP A;  5A6P A;  3J7A N;  3LA0 A;  3PR5 B;  4F3O A;  4PWD B;  3IP0 A;  3M32 B;  3D68 A;  3AD7 C;  4DL6 A;  3RB0 A;  3RAX A;  3TRG A;  1V9O A;  4DL5 A;  2E5G A;  2MQM A;  4A8S A;  3OL9 A;  4QIW D;  5F8L A;  4OYI A;  4IFV A;  1R6Y A;  4ANE A;  4JBC A;  2QFJ A;  4DG1 A;  4K4Y A;  2G0I A;  2HWH A;  3TVY A;  4ECU A;  1B0T A;  1BQM B;  4RNF A;  3QRR A;  1NK7 A;  3MMC B;  4C11 B;  4JI7 J;  3MFI A;  2Z2M A;  4HHJ A;  5DGA A;  4IDK A;  1O0P A;  3OW2 R;  2OMO A;  2JZ5 A;  2CYY A;  1BWE A;  4IFY B;  1CBK A;  2HLT A;  4IH5 A;  3W2W A;  4RBT A;  3P8B B;  4KHP J;  1TK0 A;  5D6G A;  2Q6C A;  2PA3 A;  3PRD A;  4IYQ A;  4DR5 F;  2HQ3 A;  2YX7 A;  4AQY J;  1IWA A;  1UJ5 A;  4B17 A;  4CO2 A;  3N6L A;  1V3S A;  1TTH B;  1VLO A;  2K7K A;  3EM1 A;  3GLJ A;  4AE5 A;  2IC3 B;  2DCU B;  5ETN A;  3SYZ A;  4FXD A;  4B3M J;  1U0H B;  5E2Q A;  2QMU B;  4LF1 A;  4RW8 B;  1FTR A;  1DTQ B;  4LRC A;  2NYI A;  3PX6 A;  1RCX B;  4WF9 Q;  5B0F A;  5J2P B;  4GVL A;  1J5E J;  2AZ3 A;  4CLT A;  1HYS A;  2LDI A;  3BGU A;  1S6Q B;  3CED A;  1H6K X;  5IM0 B;  2L08 A;  4DV3 J;  3DGV A;  2YWH A;  4JV5 J;  1VQP S;  1CG2 A;  1V3Z A;  1YJU A;  3EPG A;  2NS1 B;  1Y4Z B;  1MWQ A;  3KMQ A;  2AJ4 A;  3R1H A;  4MK7 A;  2LQ9 A;  3FBF A;  4O3R A;  4L3N A;  5F8I A;  1YX2 A;  2BJ3 A;  2HVD A;  1XTZ A;  3ONQ A;  5IWA J;  3C14 A;  4ECQ A;  1VBY A;  2YQ1 A;  1M5H A;  1CJU B;  4KAI A;  2V4J A;  3RB6 A;  1BHN A;  2R8H A;  4X65 F;  2W8K A;  3T1Y J;  3PFE A;  5KFB A;  2XMJ A;  2J76 E;  4CLU A;  5AJ3 J;  1UVL A;  2B9W A;  4CNZ A;  1U1M A;  5T41 A;  4NI2 A;  3M8W A;  2KFY A;  1YIT S;  4X2B A;  4I6Y A;  1D9A A;  1GMW D;  5F8J A;  4DFM A;  1VR6 A;  4RW9 B;  2FB0 A;  3HI9 A;  4QYZ K;  2HHX A;  2HNZ B;  3MAQ A;  3AJ2 A;  4PG8 A;  4DR7 F;  3ET6 B;  2QSW A;  3K89 A;  3PYE A;  4JI3 F;  3CJR A;  3Q2T C;  2GMH A;  1D9D A;  2HQD A;  1DY3 A;  2FHO B;  4KGK A;  4HDG A;  4LBP A;  5EHH A;  1C0U A;  1FVS A;  4YHH J;  2H4Y B;  1TL7 B;  2DRB A;  2FHJ A;  2BJ9 A;  2JOQ A;  3MUM P;  4G6V B;  2Z30 B;  1T03 B;  3EVO A;  2DH9 A;  3T41 A;  1RYS A;  2BKN A;  4A8Q A;  3D2W A;  2IRX A;  1HBO B;  1Q95 G;  1WOP A;  2Z4P A;  2QL7 B;  4HKQ A;  4ELV A;  1MWZ A;  1CC7 A;  4E2F B;  2GNK A;  3LP0 A;  2Z8Q A;  3QNW B;  2FVP A;  1ACM B;  1LOU A;  5BXI A;  3IAM 9;  2XZW A;  4HVZ A;  4CYU B;  4ZPB A;  1F9H A;  5L8R C;  3C66 A;  1FCA A;  1FDN A;  4I2Q B;  1Z2Z A;  5I42 B;  3DLL Q;  3UCG A;  1H74 A;  1TMM A;  1RLD A;  1UWB A;  4KFB A;  4KKO B;  3ZZ0 A;  1ZM9 A;  2GO9 A;  2LXU A;  1U6F A;  1YJV A;  3UNY A;  3AD8 C;  1EET B;  4URQ U;  4FNH A;  2CPZ A;  1LW2 A;  3HJF A;  1XR7 A;  2GQQ A;  5KTQ A;  4PZV A;  5DET A;  5E33 A;  1NK9 A;  3T6J A;  3NY0 A;  4OLP A;  7FDR A;  2XGQ A;  2ALY B;  4JI4 F;  3ENV A;  3PY8 A;  3PAC A;  2DGQ A;  2C3Y A;  5K8O A;  3N9U C;  4ZVU B;  5B0A A;  1MW7 A;  2VG6 A;  1DLO B;  3NCP A;  4L3K A;  4MFB B;  3UR0 A;  1E6V B;  2XHW A;  3R9L A;  2HIY A;  4LSL A;  4ELU A;  4E98 A;  2VQE J;  1S1X A;  5JMN A;  3BQ0 A;  2AYM A;  4RJV A;  4DI6 A;  2X1A A;  2ZEJ A;  2MHN A;  4QWD A;  3OTD A;  4JV2 A;  3O3L A;  2C2R A;  1KTQ A;  3S1T A;  1U1L A;  3E3X A;  4JYA F;  4FPR A;  4U6P A;  3W9H A;  3PW5 A;  1GTH A;  2CPF A;  2K3I A;  4ZVE A;  5HBM B;  5H1S V;  4ZPV R;  3QJJ A;  1U25 A;  2ILY A;  3MM6 A;  5DDO C;  5FII A;  3BB5 A;  3OUY B;  3IWX A;  3NAI A;  3DGP B;  3VVU A;  3FSI A;  1JQG A;  4BLG A;  2C28 A;  1N0V C;  2LXI A;  3E01 B;  4JB8 B;  2ERR A;  3ENA A;  2FZC B;  1C4C A;  1AZS B;  2J8A A;  2B4P A;  1WHV A;  3RJM B;  2WTF A;  1QSL A;  1RA6 A;  1CVJ A;  3B4M A;  4N77 A;  3FC9 A;  3JSM A;  3KLF B;  3IAS 9;  4CRJ A;  2FJD B;  2DGW A;  4FVC A;  4CT8 A;  4EWT A;  3OT9 A;  4Y2M A;  4AL6 A;  1IBL J;  1HL6 A;  2CZV C;  3QZ7 A;  4YR0 A;  1DTT A;  3UCU P;  2DB1 A;  4RPF A;  4O3S A;  1IM4 A;  1ZAW A;  4Y2A A;  3TW0 A;  1RTJ A;  4P9S A;  4DR4 J;  1DHM A;  3IWL A;  2DO0 A;  4YOE A;  2HW3 A;  2AYE A;  5T7L B;  2ZOF A;  4UST A;  4FS2 A;  4MJK A;  3K5L A;  1HIY A;  1FFW B;  3HFV A;  1RSC A;  2GO8 A;  4OJ1 A;  4DSK A;  2BYC A;  2CQ0 A;  1RTD B;  1N32 J;  3WBZ A;  4UZB A;  1FFG B;  1SJ4 P;  3EGW B;  1FER A;  5ADZ A;  3J7Z T;  4QCL A;  3OD2 A;  3T5J A;  3E2E A;  2KT3 A;  4MTP A;  2BV3 A;  1WSR A;  4M5D A;  4ZP7 A;  4OHY A;  4WU2 A;  4F0M A;  4IKA A;  3R5C A;  2K06 A;  3DOK A;  4F67 A;  2C3P A;  4FKX A;  4ED4 A;  1FK9 B;  1Q82 T;  2AWZ A;  3D7S B;  5B0C A;  1C1C B;  1S1W B;  4AND A;  4B08 A;  2HRY A;  2ZH1 A;  1Q79 A;  2ZNY A;  3AAW B;  2ADB A;  1VQN S;  4L75 A;  2LCW A;  4NCA A;  1MSW D;  4Y00 A;  3NMR A;  4B9M A;  1F5C A;  1IR2 A;  2LEA A;  3VR1 A;  4R5P B;  4QIV A;  4ZIW A;  1QLN A;  3MEG A;  4PPD A;  4OHZ A;  2XI2 A;  4HI2 A;  1N6Q A;  3TAN A;  3S01 A;  2HGN A;  3N28 A;  3RBX A;  4L76 A;  3THP A;  4LF4 F;  3QZ8 A;  2ZVS A;  5JUM A;  2DO4 A;  2B51 A;  2VC0 A;  5KT3 A;  1U4B A;  1E6Y B;  1WI6 A;  1FRI A;  2DIT A;  2IVF B;  3H2L A;  2VQF J;  4KO0 B;  3G6E S;  3NNH A;  2HND B;  4NZ6 A;  3L7O A;  3SEO A;  2CWX A;  2ILZ A;  4OZ1 A;  4EGL A;  1XEZ A;  3EJM A;  3DRP A;  2MGZ A;  1F3F A;  1VJQ A;  2B8Q A;  2E1P A;  3FCV A;  4U8V A;  3EZ5 A;  5EDW A;  4NLP A;  1TFY A;  2DNQ A;  1NCL A;  2FQQ B;  1IBK J;  1WKL A;  5HAO A;  1FX4 A;  3D28 A;  3OR1 A;  1ZM2 A;  1VQ6 S;  4FPI A;  2YWE A;  2MXY A;  2XWX A;  5C25 B;  2PEB A;  4DLE A;  2HGL A;  1HAR A;  3QQC D;  3UN2 A;  3D66 A;  3PEH A;  3ELH A;  3IN5 A;  2MLX A;  2ZBQ A;  3DRY A;  1XMO F;  4JI1 J;  2ZVI A;  4IH7 A;  2BR0 A;  2FJX A;  3KMS A;  3NS6 A;  5DG7 A;  1WC6 A;  4DR2 J;  2R2R A;  3DRP B;  3SMZ A;  2MGZ B;  4C8K A;  1Q78 A;  1RWK B;  2IVM A;  2PT0 A;  3I87 A;  3FBE A;  4OZN A;  1CS4 A;  4RX6 A;  4XDC A;  4YEA A;  5C24 A;  1LXN A;  4ATN A;  3K59 A;  4LR9 A;  3QPI A;  2A18 A;  3HKW A;  4ECW A;  3TX8 A;  1WTB A;  4RW7 B;  5KFP A;  3O1L A;  1KVK A;  3Q8R B;  3M9N B;  3R7S B;  4F8R A;  4LFA F;  4M5H A;  1FE4 A;  1K73 T;  3BR9 A;  4J9Q A;  1PO6 A;  4QIG A;  3D1Q A;  1C4A A;  1H7W A;  3MEG B;  1PYS B;  3PKM A;  3I0S B;  3JXO A;  1H2U X;  3VAM A;  2KHD A;  1JLE A;  3ZTP A;  3CO0 P;  3MR2 A;  5HAN A;  4N5S A;  1M5V C;  3BS9 A;  3N6M A;  2CFX A;  4H4M A;  1PC4 A;  4KQZ A;  1X60 A;  4XTT A;  2LQJ A;  4B9L A;  4BBY A;  4EO8 A;  1FK9 A;  3GZ7 A;  4UY8 5;  3T5H A;  4NCG B;  2L41 A;  5D0E A;  1GH8 A;  2CNL B;  3V4M A;  1N33 F;  2IYG A;  2E5L J;  2XLI A;  3MHY A;  4P2X A;  1LXJ A;  4KJI A;  3ISN D;  4CLL A;  4AL5 A;  1VQM S;  3FRZ A;  3ILL A;  2CPI A;  4WP9 A;  4ZIV A;  4X62 J;  2DHG A;  1Z2L A;  3GIR A;  3US5 A;  2EEY A;  1FDB A;  3THV A;  2CJA A;  4DR6 F;  4X4U A;  2OPS B;  2JC0 A;  1ZAX A;  2BX6 A;  1S0V A;  2G0J A;  4N76 A;  5F9L A;  3TVK A;  2LQ8 A;  3DHW C;  2HHQ A;  1WJ9 A;  1RTZ A;  2XC9 A;  3D54 A;  3GV5 B;  2E1M C;  1BGX T;  2CZ4 A;  3TVZ A;  2JC1 A;  5HJY A;  2ROP A;  1TEL A;  5CYQ B;  4LF5 F;  1R8B A;  1OIA A;  3FBC A;  4DV1 J;  3TNV A;  2M52 A;  1CSJ A;  2DXD A;  3QWU A;  3WZ0 A;  2BDP A;  3PW7 A;  3PW2 A;  2E9Z A;  3HJV A;  4W90 B;  3TA1 A;  3VTI A;  1VCT A;  2MLY A;  1YLX A;  3AXM A;  3GG1 A;  1YKW A;  1MN9 A;  3CW2 C;  2R42 A;  1XN9 A;  3RB3 A;  4B3T J;  2BA9 A;  1JKH A;  1OWX A;  2FC8 A;  4ZK7 M;  5CYM B;  4F4A A;  4ZPC A;  2EXU A;  1YBA A;  2DR6 A;  3R7B B;  4WII A;  3DGP A;  2L9W A;  3L3C A;  2W9C B;  2DGO A;  3FCW A;  4OZ2 A;  2EG2 A;  4CLZ A;  3K58 A;  2XSJ B;  1WAC A;  1ZS6 A;  2AHO B;  5GVQ A;  1GT8 A;  1TR0 A;  2YBV A;  4I7F A;  1FKO A;  5GAH I;  4X4Q A;  2ZZM A;  1MRO A;  2GJ2 A;  2CJ9 A;  4KB7 A;  2HBZ B;  1HQU A;  2R2U A;  2YNF B;  3T1H F;  1S6P B;  2W2M P;  2R4F A;  1OPZ A;  4DV0 F;  1R0B G;  3MD3 A;  2W7O A;  2O66 A;  2DCL A;  2FY8 A;  3DM2 B;  3P4U B;  4LVN P;  4D3H A;  3HD1 A;  2DNK A;  3NGS A;  3WHI A;  1DLO A;  4PG5 A;  1S6U A;  1JXV A;  4PQA A;  5E7O B;  3HVA A;  2QLF B;  4P10 A;  4OHV A;  1JLF A;  5KT6 A;  1SJF A;  4KHP F;  2CJY B;  5AXK A;  4PYA A;  4XIU A;  1NB2 A;  1N4L A;  3EVM A;  2LFV A;  2O1P A;  2P9E A;  2XGP A;  2KG1 A;  4DPX A;  2I2Y A;  3T9N A;  1QAJ A;  4K50 A;  1HNV B;  1FRK A;  3FKB A;  2PMH A;  4ECT A;  2OFH X;  4DSL A;  3T5L A;  3BYR A;  1Z4U A;  4UOC A;  3W7B A;  1WEZ A;  3D3B J;  3HD2 A;  1RTH B;  3IA0 A;  1JLA B;  3NGT A;  3CGI A;  4QR0 A;  2M8D B;  4K4S A;  4KFB B;  1Q7Y T;  1RUS A;  1N5T A;  2A2C A;  3SXL A;  3RB4 A;  2CWK A;  3GWC A;  1CJK A;  2FIU A;  4DV3 F;  2D41 A;  5J1P A;  1L3V A;  2BQ3 A;  3BQ2 A;  3VAJ A;  2UUC F;  2KFN A;  2ZH8 A;  4LR8 A;  2NXC A;  3ZZU A;  3V81 A;  3AQP A;  4ECY A;  3WC0 A;  5HO4 A;  4FF3 A;  3SCL E;  3LP2 A;  1YQH A;  5ETT A;  4CO0 A;  2ZDP A;  3UDE A;  4UT4 A;  1APS A;  4RW4 A;  4OYX A;  3T1Y F;  4X65 J;  1UCN A;  1U2C A;  1ZM4 A;  2AU0 A;  2V8V A;  2CQ4 A;  2XBP A;  5I3U A;  2HMI B;  1T03 A;  2UV8 G;  1PIE A;  2X51 A;  4JOU A;  3E8O A;  5DQG A;  1BUX A;  1PSD A;  2VDH A;  3PHE A;  1FD8 A;  1FWK A;  2VBY A;  2N7Y A;  2XYG B;  5LSR A;  2IY5 B;  4NLO A;  1Z1Z A;  2GGP B;  1Q8K A;  3CDU A;  4ZVG A;  3KHH A;  1FKA F;  3CJK A;  4HTJ A;  3T1A A;  3NAH A;  3PJX A;  1FWP A;  2KZM A;  2B56 A;  2FVQ A;  4HH0 A;  2N7C A;  4C48 A;  3KHR A;  4RUH A;  1MN7 A;  1TMJ A;  1T9T A;  2DBB A;  2EBE A;  5J1E A;  1MU2 B;  3MPU B;  4RR5 A;  3JAM Y;  3P45 B;  1HWI A;  3W9I A;  4F0K A;  1GNK A;  3G6V A;  1PYO B;  1TAU A;  3MI7 X;  4NI2 B;  2GVD A;  4XPE A;  1U09 A;  2N4C A;  3MEE A;  5ETP A;  2ZKT A;  2ZH3 A;  1RB0 A;  1OSC A;  2RAQ A;  2CQB A;  2BE7 D;  2BJD A;  2I9S A;  3D0H E;  1CJU A;  1X4H A;  1RT7 B;  3IRW P;  5AE1 A;  1OQ6 A;  1VJW A;  2F63 A;  4R0J A;  5KFG A;  3ZZZ A;  4EU0 A;  3ZO7 A;  4A4J A;  2VF3 A;  4WFY A;  3I32 A;  4F02 A;  3LP1 B;  1OSD A;  3D6M B;  3TQE A;  2HVE A;  2HUR A;  3PM9 A;  5IM0 A;  1KD1 T;  2EK1 A;  3DLB A;  2HFO A;  5HSP A;  2XZD B;  4H4O B;  3UPF A;  3QGP A;  2DK2 A;  4WKY A;  3BJY A;  4TY8 B;  2B8P A;  2HLU A;  1FNM A;  4KV8 B;  4YDD B;  1H2T Z;  4Q5V A;  1DTQ A;  3EDR B;  2B9X A;  3KYL A;  2QA4 S;  1X8D A;  4R8U A;  3MED B;  3BBF A;  3LGM A;  3M7V A;  2CJQ A;  4AD6 A;  1S9F A;  3A3N B;  2VFS A;  2NUH A;  3MZI A;  1IM6 A;  1ZTT A;  2LP4 A;  2EC0 A;  3QJP A;  1RGV A;  2YKN B;  5GAG U;  4U8Y A;  1WOO A;  5F8N A;  5HN0 A;  4DX6 A;  2J9E A;  1FRM A;  3CJQ A;  3IMQ J;  1CPZ A;  4GC7 A;  1SC3 B;  2ZOM A;  4DEZ A;  2NXN A;  2OFG X;  3MM5 B;  2Z0G A;  1TKX A;  1W26 A;  2XB2 D;  2CQI A;  4EBD A;  2KKH A;  3BH7 B;  2V2Z A;  5E3C A;  4C11 A;  4TQS A;  1VQ9 S;  4Z2X A;  4ZCL A;  1WC3 A;  1S0O A;  4DG1 B;  3BPD A;  4RWW A;  3GII A;  1FRL A;  1V5I B;  3F0N A;  1AFJ A;  5IFM A;  4OV1 A;  2BOP A;  2V8G A;  5LM7 E;  1VQS A;  2RIL A;  5HVG A;  1WI8 A;  5HMZ A;  2XO7 A;  1EQ0 A;  4QZV B;  2DXE A;  4YUD A;  1REV B;  1ULR A;  3KK2 A;  5KG6 A;  3CJ4 A;  3HSJ A;  3IRX B;  1VC5 A;  1ICE B;  3DRR B;  4ZP9 A;  2XM3 A;  4E8U A;  2YPZ A;  5DM7 Q;  2J0S D;  1TVR A;  1XR6 A;  1YJN S;  1IVZ A;  1NJX A;  4CLY A;  1Y00 A;  3CVK A;  4PWD A;  2P5V A;  3ETO A;  2VUG A;  3B78 A;  1CUL A;  4WBF A;  4HLB A;  4LVO P;  3ZZP A;  3VAG A;  1AA1 B;  2PN6 A;  5HK4 A;  2VHG A;  5B0E A;  3A13 A;  1FDA A;  1VGY A;  3OR2 A;  3EMT A;  2C2Z B;  3QMQ A;  2DNO A;  1T9Y A;  4G3I A;  3QAU A;  4ZVR B;  2XO6 A;  3KK2 B;  1RI7 A;  1REV A;  1UP1 A;  2UUB J;  2HIQ A;  2JJ4 D;  2E1C A;  4YME A;  3G4S S;  2ZH9 A;  2WCX A;  1NXI A;  4WIQ A;  4WXO A;  2JHE A;  2C42 A;  2CKW A;  1XR5 A;  3WDO A;  2ADC A;  3M30 A;  4PR6 A;  3B4D A;  4Y28 C;  5LOQ A;  4J9M A;  1M1K T;  4ILL A;  3L7P A;  4H4K A;  5DZ7 A;  2DGT A;  3O5T B;  3EPI A;  3QRQ A;  1EQM A;  5LSO A;  3DRS A;  4UTG A;  4DWI A;  2K1R A;  3EZU A;  4B9T A;  4IRC A;  3DRX A;  2C22 A;  4DL0 C;  1X31 C;  1RLC L;  5CD4 H;  3CC2 S;  3KLE A;  1X5T A;  1FXL A;  3JYT A;  2YH1 A;  2ASL A;  2VON A;  4K7Q A;  2MKY A;  2YKN A;  3WQP A;  2HHS A;  2BUN A;  3A1Y G;  2AJ2 A;  2L9N A;  3BSN A;  3FRY A;  1U47 A;  1QAI A;  2HHH F;  1IKX B;  1HR0 F;  3UO0 A;  1SQE A;  3HSZ A;  4YB1 P;  3MED A;  5CH7 B;  1LFW A;  1S9E A;  2GX8 A;  2MHE A;  1YDL A;  4R8U B;  3H40 A;  5KG2 A;  4OI4 A;  3H2U B;  1S1T A;  2WSE C;  1TZ0 A;  3T19 A;  3KG4 A;  2Z58 B;  4TY8 A;  2XTJ P;  1O6X A;  2HFZ A;  1L3U A;  4LF4 J;  1LWF A;  2DRA A;  5RUB A;  3KUG A;  2OH2 A;  4O3P A;  3OJS A;  4OI1 A;  3GIL A;  5CXT A;  4PG4 A;  2GA7 A;  2KM8 C;  2B7C B;  2YNG A;  3FEX B;  4DL3 A;  1FJE B;  4C97 A;  3CMQ A;  3HHL A;  3OFF A;  4LF6 J;  1VIO A;  2EFN A;  1D8Y A;  4QOT A;  2ZUG A;  4CLK A;  1XNQ F;  5L39 A;  1N34 F;  4ECZ A;  1C2P A;  2UXD J;  4N41 A;  2Z2L A;  3BGO P;  5EUH A;  1Q4R A;  1S4E A;  2AMC B;  2Z57 B;  3OXL A;  3MEE B;  4CH7 A;  1IBK F;  1SJ1 A;  1QY7 A;  2QYG A;  2GVD B;  4NRU A;  4NOH A;  2ZBI A;  2XS2 A;  1KC8 T;  2FHM A;  2BJ1 A;  1GFW B;  2ZWO A;  3AA9 A;  1FRX A;  3H0P A;  1PJ7 A;  2XMA A;  1QTM A;  1N48 A;  1VBX A;  1QSY A;  1IWG A;  1RCO B;  2ZE2 A;  4I68 A;  5D77 A;  1CQN A;  4I69 A;  1R89 A;  2DJW A;  5ETR A;  4B3O A;  2G0C A;  1H73 A;  4ZPD A;  3W66 A;  2W7P A;  3R3T A;  1JLQ B;  1SKU B;  2GGP A;  4RUA A;  4DPW A;  4P2S A;  3I4P A;  4QYR A;  2X3G A;  3HCX A;  1GK8 A;  3LAK A;  1OY9 A;  2L48 A;  1N8R T;  1WG1 A;  2I5J A;  2CPE A;  4MIA A;  1DAR A;  4TLQ A;  1LW0 A;  4USM A;  1EP4 B;  3PX4 A;  1KFS A;  1KBR A;  1O8B A;  1KHW A;  2MQL A;  2MZT A;  2MTL A;  2JEG A;  2NXU A;  2YNI B;  4OJ3 A;  1NAQ A;  4KGX B;  2FVS A;  1NH8 A;  2A1B A;  2RS8 A;  2VG7 A;  2IDL A;  3CCZ A;  4NLR A;  5K8N A;  4NLU A;  5E41 A;  5HQL A;  1G3O A;  3QGI A;  2DNN A;  3FVY A;  4K0K J;  4FVM A;  2ASY A;  2ZFH A;  2DT9 A;  1F5A A;  2WRM A;  1NJZ A;  2MKS A;  4YFU A;  1SH2 A;  2HK2 A;  4A8M P;  4A8Y A;  3HVT B;  4AFF A;  2YKQ A;  1CJK B;  1RT1 B;  4I6A A;  1ZBT A;  3PR4 A;  3MUR P;  1M5K C;  3WX4 A;  2QA4 G;  1RK8 A;  3AB2 B;  5FD1 A;  4RU2 A;  5IS2 A;  4YB7 A;  5HQM A;  3DNC A;  3UN5 A;  1WNE A;  2MMY A;  2CQD A;  3MR7 A;  3W1Y C;  3BV8 A;  1VQ4 S;  2JVO A;  4WJB A;  1TK8 A;  9ATC B;  2LA6 A;  5KFQ A;  1RT3 A;  1FWL A;  4WTY A;  4AXJ A;  3SQG A;  3GSD A;  5F9N A;  1LKZ A;  5DDR C;  4LBI A;  3PW4 A;  4ZKA A;  1EKR A;  3QT8 A;  4H54 A;  5M2P A;  4J9K A;  3JB9 k;  3AJ1 A;  2I38 A;  5GAG I;  2QTW A;  2VL1 A;  4ZDN A;  1U24 A;  5FLX U;  4DV7 J;  1TQL A;  3DM2 A;  5BR8 F;  2ZOG A;  2MKC A;  1SCJ B;  4QWB A;  5KFC A;  4GKK J;  1S6P A;  1UVK A;  2ZBP A;  4M5L A;  4M5K A;  1F9F A;  1QM9 A;  2GFF A;  2DNH A;  2UXB J;  4NMX A;  1FKO B;  3RW7 A;  5A8K B;  4I7F B;  2KI2 A;  3MM8 A;  1RWM B;  1RT4 B;  2VKZ G;  3WC2 A;  2XZT B;  2HS4 A;  2J6U A;  3PO4 A;  4B3T F;  4HHU A;  3OL8 A;  4LQ3 A;  3PJW A;  2YX1 A;  1RTI A;  4LRE A;  5K20 B;  3C19 A;  5ETM A;  1Q8B A;  5IQ6 A;  5KFY A;  1SXL A;  3FEZ A;  2RQC A;  4DS5 A;  1N5Y A;  2NQP A;  1S99 A;  5KFO A;  1RWV B;  4BDP A;  1QUP A;  1T11 A;  5HQ8 A;  2N3O A;  2BXJ A;  2RIJ A;  3CUL A;  3K5O A;  3M2V B;  2JH3 A;  2C1E B;  3KG1 A;  2EFG A;  4BWM A;  5K8P A;  3BZQ A;  3PTW A;  4J91 A;  4KE5 A;  1YI2 S;  2V2Q A;  5GMD A;  4DV0 J;  2ACM A;  4CZC A;  2ZM6 J;  4IR1 A;  5SUH A;  2AT1 B;  3SV4 A;  3VCD A;  3DU6 A;  1UZD A;  2V8D A;  1H3D A;  5KT2 A;  4WCE Q;  3H4B A;  4DFK A;  2VC1 A;  4MH8 A;  4TNO A;  2HFV A;  1SL1 A;  2QE5 A;  3GB0 A;  1NDC A;  3OTE A;  1TFW A;  3MPV A;  5CCL A;  2H4W B;  5EX3 A;  4IOB A;  2OEJ A;  3SQO P;  2U1A A;  1UA0 A;  1HMV B;  4M5M A;  2RUS A;  1Y3J A;  3H4D A;  3CF5 Q;  4NLG A;  4WKR A;  3BSA A;  1VIS A;  2EK6 A;  2YKM B;  3H20 A;  2G2O A;  4ZOS A;  3QSI A;  1QAY A;  5KFF A;  1WOR A;  2COL A;  3MMA B;  3QFW A;  1X5S A;  3TP2 A;  2Y8W A;  4NL5 A;  3QRP A;  3R6L B;  5LMN J;  3L7U A;  1LWX A;  4B9U A;  2UUA J;  1IR1 A;  4DUZ F;  3IM9 A;  2EFP A;  2UUC J;  2E29 A;  1MML A;  2F7V A;  3H5U A;  1FXR A;  2IBO A;  4FBU A;  4GKJ J;  3UR3 C;  3AJD A;  3IM8 A;  5CYJ A;  2KT5 A;  3A8I A;  3RYL A;  3RAQ A;  2BW7 A;  5CHC B;  3H5S A;  4ES2 A;  1B64 A;  1WUU A;  4WPA A;  4AT1 B;  3TZZ A;  1F2H A;  2HNY A;  3ILO A;  4F3M A;  1TKZ A;  3FK4 A;  3OXF A;  5DQH A;  1R8P A;  2RD5 C;  1EB0 A;  2WSF C;  4XDD A;  4LFC J;  4LR7 A;  1S9G A;  3NWR A;  2HAI A;  1RWO B;  2LKZ A;  3HVW A;  4U7C A;  1RAF B;  1ZM3 A;  2R7Q A;  2M2B A;  4PKD B;  3CCM S;  1LFP A;  1RAB B;  1IKY B;  2KYX A;  4PXD A;  1S49 A;  5KFR A;  5EWF A;  3D1O A;  4B3S F;  2P6T A;  1HQE A;  4G1I A;  3H5Y A;  4O23 A;  1WEL A;  2RSQ A;  2CQ2 A;  1QE1 B;  3H98 A;  2IVY A;  2VFT A;  1DBD A;  1ZPV A;  3BH6 B;  4A8K A;  1UFK A;  2XMM A;  4GVB B;  1VDH A;  4WWS A;  3NBP B;  5KFU A;  3TEH B;  4ED7 A;  4JV0 A;  1RKJ A;  4X4N A;  1G6B A;  3KLI A;  4DPU A;  1FVQ A;  3CCT A;  3R5J B;  2F8E X;  4J9R A;  4DV4 J;  2DR8 A;  1HWL A;  4C0B A;  1HNI A;  1RAJ A;  1SC4 B;  3C6T B;  2V4R A;  1FHT A;  4DR5 J;  1KOH A;  3IR5 B;  2WON B;  5D4O A;  3U02 A;  4AQY F;  4OX9 J;  3HM9 A;  4J9U E;  4FF4 A;  1SUQ B;  1GX5 A;  3M6V A;  2FZK B;  1CJV B;  2MQN A;  3GON A;  1RAI B;  3R5B A;  4G65 A;  4KIA A;  4YR3 A;  1JLC A;  2AJF E;  1KON A;  4CLP A;  1I94 J;  4B3M F;  1EAY C;  3MCM A;  1E6Y A;  2BBE A;  3CDE A;  4IG3 B;  2ROE A;  3CCU S;  2YXL A;  2OHD A;  3Q2S C;  2DR5 A;  4FYV B;  4DV2 F;  3K0J A;  1RAD B;  1RT5 B;  2M5Y A;  2M7S A;  5DG9 A;  3R1L A;  1LWC A;  1Q81 T;  3TX0 A;  4JV5 F;  3OTC A;  5IXU A;  2AJ0 A;  1FI4 A;  1WF2 A;  1JLG A;  3QIP A;  2G13 A;  2NXE A;  2RHS B;  2VFU A;  4QR2 A;  2HSE B;  2BE2 A;  2UVV A;  3F56 A;  5IWA F;  3BF4 A;  3M9M B;  4ED0 A;  1FTC A;  2MST A;  1LEO A;  4UOH A;  2HG4 A;  3KG0 A;  3TOQ A;  4A8O A;  4U9R A;  5F3T A;  1EHW A;  2RB7 A;  4UZC A;  4RZR A;  3MF5 A;  3MWB A;  1SC6 A;  2DIU A;  4RU9 A;  4FBT A;  5F0U A;  4DHV A;  1RU2 A;  4FYY B;  3BDE A;  3FQK A;  3K57 A;  4B9N A;  2OPR A;  3VQT A;  3DC2 A;  4KSE B;  2H3E B;  4M5D B;  5DLF A;  2WK4 A;  2W2Q P;  2D74 B;  5LL6 d;  1IR0 A;  1WWH A;  3HSG A;  3LF0 A;  5E3P A;  1RTD A;  4TVA B;  4ED2 A;  2GV1 A;  1CC8 A;  3KNG A;  3NS7 B;  2DHH A;  2RS2 A;  4WZM A;  4OIX A;  2V2K A;  3PYD A;  3SCI E;  2NYH A;  1FES A;  4RNO A;  3DLK A;  4Y6I A;  3EGV A;  1RTJ B;  4RBU A;  4LRF A;  1WSV A;  1VRT B;  4J90 A;  1HA1 A;  2KXF A;  4ILM A;  3W2V B;  2CDR B;  5ETQ A;  2O67 A;  3IR6 B;  3K8W A;  3MM9 B;  2DNG A;  2HZV A;  2GAH C;  4ERD A;  1F60 B;  2A0F B;  2YKO A;  3QT5 A;  2WOM B;  1FXD A;  4LBH A;  4K5S A;  4WE1 A;  2IJN A;  1OS5 A;  2DGS A;  3IG1 B;  4OYW A;  2QMX A;  4Q45 A;  2HVI A;  5IV3 A;  1AXQ A;  4E0D A;  3LWL A;  3E01 A;  5AE3 A;  4DR3 F;  1S57 A;  2J9C A;  1S59 A;  3KUE A;  5F8M A;  4PUO A;  4Q8F A;  5F8H A;  3UE2 A;  2ZJP Q;  1HLW A;  2CQH A;  3OUY A;  5IV4 A;  3ETM A;  5DDQ C;  2AF6 A;  3W8P A;  2BRL A;  5C2C A;  5DM6 Q;  5J2M A;  1YBU A;  2UUB F;  1KFD A;  2HQF A;  2LEC A;  1KSP A;  1J5O B;  3G82 B;  3EXC X;  4P71 A;  4NZ7 A;  4A46 A;  3DLE A;  4V1A k;  2X7I A;  2Q1L A;  3R5D A;  1K0V A;  2J6S A;  2B5J A;  4J37 A;  4EYH B;  3B82 A;  1ZOT A;  4MYU A;  1VC0 A;  1PG5 B;  3N5B A;  1T8E A;  2CQ1 A;  5KOW A;  4OX8 A;  1B99 A;  5D0R A;  3LGN A;  4LSL B;  1FJG F;  3U27 A;  2VIC A;  2VG6 B;  1S77 D;  3CJ8 A;  4EYI B;  1NO8 A;  1SC1 B;  2MKH A;  2O5D A;  4IOA Q;  1X4B A;  2APO A;  3M4X A;  4U7U D;  2OEK A;  2OPP A;  1YIJ S;  1VFJ A;  1S72 S;  1W2I A;  4IQX A;  3K5N A;  3ZZT A;  2XY5 A;  1HR0 J;  1N5V A;  1S1U A;  1TUV A;  3THT A;  3NP5 A;  4I56 A;  3MTK A;  5THW A;  2KU7 A;  5KT4 A;  2UU9 J;  1P9Y A;  3BBB A;  2DR9 A;  1KDN A;  2V68 A;  1IXK A;  5I42 A;  3SSQ A;  4QQB A;  4ZLJ A;  2HS0 A;  2J0X A;  4JI6 F;  2RDI A;  3CC7 S;  1LV5 A;  3PJ9 A;  2ZJR Q;  4OYM A;  4CQ1 A;  4K4Z A;  5ETS A;  4G1Q B;  2OUG A;  4NYZ A;  3OVA A;  3HVR A;  1QVF R;  4EBE A;  3PDN A;  4KYZ A;  4OJH A;  1SJ3 P;  2RF2 B;  1XNQ J;  4LUB A;  4ZVF A;  9RUB A;  3CMA S;  2ZBC A;  3S6E A;  3LUY A;  5BYQ A;  2DIV A;  4OMF G;  1KQS R;  4G1Q A;  2R3V A;  3GYG A;  2CUY A;  4QWA A;  1RAC B;  3OQ2 A;  3Q24 A;  3M1V A;  2OPQ A;  1AYE A;  3UDL A;  1TL7 A;  1JLB B;  3SV3 A;  2DTJ A;  1D09 B;  4A47 A;  5FLX Y;  4OZ5 A;  1YRT A;  1N5Q A;  8RUC A;  2OPQ B;  4GO5 X;  4YQW A;  3HHL D;  3T5K A;  5KFL A;  1AT1 B;  2XHC A;  3ET6 A;  3M8S A;  4M1K A;  3R6G B;  3IS9 B;  2QEX S;  4M5G A;  2E9R X;  2RF2 A;  1WEX A;  4ZVO B;  1PGZ A;  4U96 A;  3NG8 A;  4BCA A;  1MWY A;  2XI3 A;  1RKI A;  2DHA A;  3ZZR A;  5LJ5 Y;  3J7Y I;  3KLV A;  1S0M A;  4PRF A;  3G96 A;  3ZXW A;  2LU2 A;  1NJI T;  1JNR B;  4M63 A;  4WTO B;  4YR2 A;  2VOD A;  3KJQ B;  1SIW B;  1RBA A;  1UPP A;  2NSC A;  5E3R A;  1ARO P;  2V4J B;  4DV5 F;  2W4P A;  4ZHR B;  3PZP A;  3GR0 A;  5IC4 B;  5C7P A;  2R7U A;  1H72 C;  2W7A A;  3FMW A;  4B02 A;  5C42 A;  1HHT P;  5G4D A;  4ED6 A;  1TL4 A;  1D1U A;  3KNA A;  2EWH A;  1MNE A;  1U0S A;  1T9W A;  2CNK B;  2H48 B;  3HT0 A;  3DLE B;  3PV8 A;  2KN4 A;  4MAK A;  3G82 A;  1I1G A;  4HAC B;  4LT6 A;  4OL8 A;  1Y11 A;  4UOG A;  3LOU A;  1S6Q A;  2OPP B;  3NCQ A;  5J2M B;  1FEE A;  1B3T A;  3MDF A;  2MZS A;  2QG9 B;  2AEM A;  3PIP Q;  4EI2 A;  2E7V A;  2OGU A;  1U0H A;  3CDA A;  4FKY A;  4PAB A;  4RW8 A;  2LQB A;  4ALZ A;  4Z7Y A;  2VQF F;  1YJW S;  2IC3 A;  2BQU A;  3WIV A;  4DL7 A;  3AFG A;  3CDB A;  4WE1 B;  4WU3 A;  1VQ5 S;  2B5J B;  2EKY A;  2WOM A;  2BQR A;  3P6Y C;  2AGQ A;  2BM0 A;  2JRS A;  1R31 A;  3JQK A;  2BMB A;  1IBC B;  1UJ6 A;  2F8H A;  2XQC A;  1S97 A;  3M9O B;  2W01 A;  2GJF A;  2GIR A;  1WC5 A;  2HGM A;  4DV7 F;  4C8L A;  4AYB D;  4IDK B;  3DLK B;  5BR8 J;  1ZTW A;  8AT1 B;  5M2R A;  2HFU A;  3MMC A;  4I0W A;  4PUO B;  1ZZF A;  3CNQ P;  1PCA A;  2MJU A;  4GKK F;  1LQ9 A;  4PXE A;  3GR1 A;  2ASD A;  3J7Y U;  3GJS B;  2ABY A;  1VYA A;  2MY7 A;  3G8Q A;  5HP1 B;  3GFX A;  2LYV A;  1KWM A;  3CDW A;  4I6W A;  3M32 A;  4DSF A;  3W2V A;  1GMV A;  1X4D A;  2V63 A;  2RH3 A;  3V6D A;  1NK4 A;  4LFA J;  3HK2 A;  2B43 A;  4NXM J;  3TZW A;  2NZ4 A;  1UL3 A;  2ALZ A;  3VAF A;  2QMW A;  1IKV A;  1ZA1 B;  5B09 A;  2HHV A;  3G8S A;  4JI5 F;  4QJV A;  3V5R A;  3LO3 A;  3FDS A;  5DGB A;  2ZC3 A;  4PAA A;  5E5N A;  2RNE A;  3J81 U;  1K8A T;  1NBE B;  2MZQ A;  3M2U A;  4PG6 A;  4ZLL A;  2XG8 A;  2ZM6 F;  1RT5 A;  2PA8 D;  5D4P A;  2GW8 A;  1C1B A;  3M05 A;  1FKP A;  3A12 A;  2OPR B;  3K2Y A;  3PRB A;  4CTA A;  1BC6 A;  5B0D A;  5JJB A;  2R8G A;  3KLH B;  3LGH A;  1REG X;  1UW4 A;  1JLC B;  4GMK A;  1RWX B;  2QO3 A;  1KLM B;  5FDL A;  2ZHA A;  4X4T A;  5AXM A;  3QJL A;  1KTV A;  2VZ9 A;  3PHT A;  2XMT A;  4LQ9 A;  3W61 A;  3LPE A;  2G2Y A;  2V8P A;  3NCR A;  3EGZ A;  4F25 A;  1IKW B;  2F4F A;  3TUI C;  4M5I A;  3P49 B;  1M5O C;  4NCB A;  3I56 S;  1YVF A;  3OV7 A;  1HNI B;  2GS8 A;  4LSN A;  1HBN B;  3CCW A;  3RZA A;  2AKW B;  2DEI A;  3POT A;  4C6A A;  5LMN F;  5K14 B;  2EBG A;  3I4H X;  1VBZ A;  2YVS A;  4DX5 A;  4MIB A;  3UWT A;  2CAJ A;  4KPY A;  2BE9 B;  3ZTQ A;  1FRJ A;  5L46 A;  5G0R B;  1K9M T;  2P6S A;  1W25 A;  5C5J A;  5A2Q Y;  3HFZ B;  2C2D A;  4Z37 A;  4GKJ F;  1CJV A;  1HQE B;  2VPX B;  3CSK A;  3AA8 A;  4HTI A;  3C16 A;  5A76 A;  3OVS A;  3T3F A;  4JV1 A;  1HI0 P;  4DL2 A;  4LF9 J;  4FNI A;  3MR5 A;  2WON A;  2OEM A;  2JSX A;  5IOL A;  1NK6 A;  3FSY A;  3PNI A;  1NSK L;  3C6T A;  2CJB A;  3MAA B;  4F7V A;  2HFN A;  3KLI B;  1XMB A;  2A3J A;  2HNY B;  4USJ C;  1U6B A;  1G1X A;  1PJ6 A;  3M6U A;  3NBP A;  3EE3 A;  4RWX A;  4ECX A;  4ES1 A;  1N5S A;  2AYG A;  2OKQ A;  2HHW A;  5EX0 A;  1DQ8 A;  1H98 A;  4UQT A;  2ZKU A;  1B70 B;  3T1H J;  2FHK A;  2IPO B;  1KOO A;  2PMW A;  1XJW B;  1IKY A;  2QN6 B;  3IWN C;  3M6W A;  1OO0 B;  1CJT B;  2VQE F;  1KQK A;  4DL4 A;  3TAP A;  4DV4 F;  4KR0 B;  3MR3 A;  2UXC J;  2AJQ A;  1I5O B;  4NRT A;  5J2Q A;  4AXI A;  3BR8 A;  2QX0 A;  3MMA A;  1RBO B;  3AH6 A;  3NS5 A;  1TKZ B;  3Q23 A;  3UVJ A;  2W2P P;  3AB4 B;  3DLH A;  2DNY A;  4DN9 A;  2YKM A;  1UVN A;  5EGY A;  1EKS A;  4EFA C;  3KJN B;  3QLH A;  2OD6 A;  3NWG A;  2C2K B;  4HI1 A;  1O5J A;  4J7C A;  4K59 A;  1U26 A;  2V67 A;  4O44 A;  2KRB A;  5IZH A;  1I94 F;  2QLB B;  2YPY A;  2GMJ A;  4PG7 A;  4CM0 A;  5GAH U;  2FHJ D;  4K4U A;  2PDA A;  2RDJ A;  2QRR A;  4NLY A;  1HI8 A;  5HJX A;  3NGK A;  1T05 A;  1ZH5 A;  4ZLN A;  3KKF A;  1NU4 A;  2B6A A;  4O0I A;  3OBI A;  3MPW A;  4KPC A;  3ZNU A;  2YKA A;  1QJH A;  1X0P A;  2QGF B;  4DSI A;  5CZV A;  3FFI A;  5HMX A;  2YY3 A;  4IOC Q;  3DDK A;  1JJH A;  1BMQ B;  4USH A;  1VQK S;  4OYA A;  2DD8 S;  2QL5 B;  2W25 A;  2WVD A;  2N82 B;  4C8N A;  3W9J A;  4X4S A;  2JEF A;  3CD6 S;  1Y5L B;  2VG5 A;  1SBR A;  3MXH P;  2OIH A;  2EFO A;  3L9Z A;  4DUY F;  3W3S A;  1NB7 A;  2RQK A;  1GXU A;  1HBU B;  2K7J A;  2RE1 A;  3TAM A;  3BGF A;  2WVC A;  1R43 A;  4PWW A;  7AT1 B;  3Q8S B;  3BEG B;  4FS1 A;  2DPI A;  2UVU A;  2GAG C;  2P9C A;  3M2V A;  2Z2Z A;  4CLW A;  3QGH A;  3OSP A;  5KFH A;  2LEB A;  3BGL A;  1WDT A;  1XQI A;  2C2M B;  4NYP A;  3CJ2 A;  4CH1 A;  1UVM A;  2L9D A;  3VZI A;  1D3W A;  4F26 A;  2Z2Y B;  4Q2L A;  4W92 B;  2Q66 A;  4U7U K;  4RNM A;  3GQC A;  3TEG A;  1YBT A;  2WB4 A;  3KK1 A;  3EX7 B;  2LEP A;  2CPJ A;  2VH7 A;  3KK3 A;  1RT3 B;  2HVZ A;  3C46 A;  1A6L A;  3JAM U;  3QO9 A;  4YB6 A;  1EJ7 L;  1RT4 A;  1UAW A;  1F1B B;  3MM8 B;  4FYX B;  4NML A;  4XO0 A;  4N56 A;  4KTQ A;  1UZH A;  5A8K A;  2B7B B;  3RR7 A;  5GMK a;  1Q5V A;  1ITP A;  5KFJ A;  3PYF A;  1YRU A;  5HAT A;  3CD7 A;  4DR3 J;  1SJR A;  2HFS A;  1T94 A;  4ID5 A;  3WIU A;  2WBR A;  4H4K C;  1TU0 B;  2CNN B;  2Y1R I;  2ZD1 A;  3D6H B;  2C3O A;  3DU5 A;  2XLJ A;  1OYE A;  4NA2 A;  2HVH A;  3VWS A;  5HL7 Q;  4J9L A;  2OLW A;  1RT1 A;  5L1I A;  3UW1 A;  5IT0 A;  3HVT A;  3DOL A;  3NOC A;  4K8R A;  3J81 Y;  3O8W A;  1Q86 T;  1A7G E;  2AYB A;  3FCH A;  1FF2 A;  3SQG B;  8ATC B;  2DNP A;  4ZVH A;  5KFT A;  2RKI B;  4ZS6 A;  4ZJQ A;  2VOP A;  1FE0 A;  5KOX A;  1KVJ A;  3RRG A;  3SFG A;  4USW A;  2LU1 A;  1FRH A;  2B3T B;  1WF1 A;  4OYB A;  2RVJ A;  2C3M A;  1QSS A;  3CJT A;  4TU9 A;  1DQ9 A;  1LW0 B;  2QT7 A;  4JI5 J;  4J9N A;  2R7T A;  4DN0 A;  1AB8 A;  2LA4 A;  2AEJ A;  1SVD A;  3DLG A;  2K2P A;  1RWW B;  2PI4 A;  1NKE A;  5J1N A;  5H9F K;  2C3U A;  3IBW A;  1JXL A;  2ZUA A;  3D3C J;  5IT9 Y;  1WKK A;  2PEH A;  4DUZ J;  1VQL S;  3BDP A;  5CZX A;  1OQ3 A;  4HHH A;  2D3U A;  4OYP A;  2FTR A;  1JLQ A;  2EFQ A;  2ZNZ A;  3GPA A;  4KBI A;  3V2U C;  5KG7 A;  1N54 B;  2MQ8 A;  4QBU A;  1KQF B;  4UW2 A;  4B3O B;  3FBB A;  4PPZ A;  1GMW A;  4EK2 A;  2ZDO A;  4FXW A;  2KM8 B;  1UVJ A;  5LXR A;  4MK8 A;  3W60 A;  3I31 A;  4DX7 A;  2E9T A;  1EP4 A;  1RAG B;  3DLJ A;  3G2X A;  2H1Y A;  1OPI A;  3HFK A;  3IGN A;  1WG4 A;  3DCA A;  1HWJ A;  4OX7 A;  2X1G A;  4P73 A;  5AE2 A;  4DCO B;  2J0W A;  1N52 B;  4MKY A;  4HT5 A;  1R8C A;  3HHE A;  3OFG A;  5HLF A;  4MT1 A;  4DFJ A;  1HHS A;  3QYY A;  1J2V A;  1R7I A;  4QW9 A;  1HWK A;  3TA0 A;  2IA6 A;  5A8R A;  2YNG B;  1NUE A;  3HPO A;  1FNO A;  1Q53 A;  4Y2C A;  5I3P A;  1NHU A;  1TAQ A;  3CCQ S;  5KFI A;  2MQQ A;  2A6O A;  2XCP A;  2IM0 A;  2QSF A;  1UW9 A;  2BKP A;  1LWF B;  1WTF A;  3MUV P;  4Q8E A;  2KRR A;  3VHQ A;  1I51 B;  3UCZ P;  3CCE S;  1X4E A;  1X9W A;  2WB1 D;  2I1R A;  2QA2 A;  7FD1 A;  2O01 C;  2DNZ A;  1S9E B;  3MCO A;  2ZJQ Q;  1G2E A;  3LW5 C;  2NXJ A;  4LF7 F;  2VAS A;  4NA1 A;  2VA2 A;  5IT9 U;  1UKU A;  3MOZ A;  3U1L A;  1HNX F;  1UFW A;  3NMA A;  3BO3 A;  3JYT B;  5EWG A;  2RUG A;  3UQS A;  2YX4 A;  2DIS A;  3TJA A;  4ZPT R;  3B6B A;  2AJ1 A;  1P6T A;  5D0G A;  4CI0 B;  1P27 B;  2BKO A;  2K1R B;  5IC6 B;  4DLG A;  3UD3 P;  2JEJ A;  3RR8 A;  3FZB A;  4BS2 A;  1RA7 A;  1JK9 B;  4QWE A;  4PXC A;  1S1T B;  4RL1 A;  4N7T A;  2OSR A;  4ZVP B;  5HVF A;  3UFC X;  3TO8 A;  4UQG A;  2Q3P A;  4Q44 A;  3OTO J;  4NLD A;  1RT2 B;  2IRY A;  3NRB A;  4I2P A;  3DYA A;  4UOF A;  3J81 j;  1HNW J;  4LFB F;  1MMN A;  3SDE B;  2DGU A;  1U1Q A;  4ICL A;  2B4V A;  2RRB A;  4NPO A;  1RHQ B;  3A8K A;  3ILJ A;  2BJ8 A;  3HO1 A;  2WVE A;  3KLE B;  5GAE U;  1HNZ J;  3OLA A;  3QFH A;  1NND A;  5CA5 A;  4CDI A;  1U1O A;  3CTR A;  3CJ3 A;  1Y9O A;  4M8L A;  2R7O A;  5D4L A;  4QPT A;  1IUJ A;  3BGR A;  2PSZ A;  2QLX A;  1UMJ A;  3ENQ A;  5D4N A;  4Y0F A;  3MMB A;  3GYX B;  4WYL A;  5J2N B;  3KFW X;  1LK7 A;  2DYA A;  3PFO A;  3JS9 A;  2J6T A;  2XS7 A;  1EZZ B;  2CQ3 A;  4R25 A;  1YWX A;  3IRX A;  4CO3 A;  2BJ7 A;  1TV6 B;  2FJE B;  2FUG 9;  1NPK A;  3F41 A;  5AXL A;  1JWW A;  1B4S A;  2X3D A;  2JX2 A;  3HZE A;  3OR2 B;  2W8L A;  1NK5 A;  2ZZN A;  5J2N A;  1RHR B;  3DKD A;  4X66 F;  1S7H A;  1B0V A;  2E7X A;  1CUL B;  2CG4 A;  1RP5 A;  3BGR B;  5DRK A;  1CQM A;  3ZTR A;  4F3Q A;  4V19 X;  1NZ8 A;  1PKU A;  2E1R A;  2QC3 A;  3G8T A;  2K3K A;  4RKU C;  1R0A A;  3MM5 A;  1T95 A;  2GIQ A;  3NL0 A;  3EDQ B;  1JJC B;  1TVR B;  3MD1 A;  2KL8 A;  2BM1 A;  4PXB A;  2FLP A;  2IM2 A;  1FNX H;  2DGV A;  1NDK A;  2WSC C;  1B7F A;  2RRA A;  1VHF A;  2CQC A;  1F6T A;  3IGV A;  3KDN A;  1SB6 A;  4LIR A;  5A0Y A;  4F4Z A;  3CJS A;  3HP6 A;  4DQI A;  4NXM F;  2OTJ S;  1HPZ A;  1V5V A;  3IXQ A;  3LAM A;  4USI A;  2MQP A;  1I6J A;  4F2S A;  4NLQ A;  1RT2 A;  1H2V Z;  2FGC A;  4K0K F;  1RAE B;  2QYC A;  5EN1 A;  3H8Y A;  4FDF A;  2GML A;  3TUJ C;  5KFK A;  3GJQ B;  3M8Q A;  4URG A;  3KJV A;  3T9Z A;  5K8M A;  1TKX B;  4H4O A;  4OZJ A;  3T6B A;  4IG0 A;  2R7V A;  1SJQ A;  3JSY A;  5KFS A;  2OML A;  5L9N A;  1Y5N B;  2XNQ A;  3LP1 A;  2R8K A;  1WOS A;  3MM7 A;  5LJ3 Y;  3N5F A;  1XNR J;  3QBC A;  1AW0 A;  4DPO A;  4WYW A;  1R8A A;  1BXN A;  1X4F A;  2V0N A;  2RU3 A;  3KHL A;  3GFY A;  2HQI A;  2DXF A;  2HPU A;  1X5P A;  2ZIT A;  3MTJ A;  2HWI A;  3OTB A;  5KG1 A;  2GQ2 A;  4DF4 A;  5H9E K;  1SQF A;  3CB4 A;  1BLU A;  2PC6 A;  2AD9 A;  4ZCM A;  3LTO A;  4ZP6 A;  1NDL A;  1UEK A;  4BC7 A;  3IR7 B;  3SSS A;  2YKP A;  3RBE A;  3PO5 A;  4KV8 A;  2MKK A;  2IAJ A;  3QID A;  4L74 A;  1MU2 A;  1VRQ C;  1RWP B;  5K9F A;  5J1E B;  3J7Z 5;  4JI8 J;  3KUH A;  5B0G A;  3VGU A;  2VIH A;  1KKH A;  1MMD A;  1VQY A;  2CRL A;  4ZN1 A;  4Q43 A;  2J9D E;  2ZZT A;  3NLC A;  5A8R B;  2UVW A;  1IQZ A;  5LMU J;  1RT7 A;  3DFE A;  4YDX A;  2MY8 A;  3R2D J;  1TL3 B;  2VBX A;  1CLF A;  2A6M A;  3GIJ A;  3Q8Y A;  1RU1 A;  1Q0N A;  3VAL A;  1GQE A;  4ANC A;  4C4W A;  3P5B P;  3MEK A;  4RNH A;  4ZLP A;  3N6N A;  1WG5 A;  4MKA A;  3GJT B;  3SCJ E;  1NJY A;  1S48 A;  3Q89 A;  4RW4 B;  4DXL A;  1F3V A;  5B7W A;  5M2U A;  2AIR B;  1FFS B;  3LP2 B;  2XYH B;  2MEW A;  3FUY A;  4ITS A;  4P2M A;  3W5X A;  3V81 B;  2D9P A;  2HQC A;  2CA9 A;  2MYF A;  2XSF A;  5A2Q U;  3CJK B;  2A10 A;  3I0R A;  3BN7 A;  1XMQ F;  3VGS A;  1KRP A;  2EPI A;  1X4C A;  2FYX A;  2QV6 A;  3HSD A;  4NEY A;  4X64 F;  2VA3 A;  3VAI A;  2EC2 A;  5I4M A;  5KT5 A;  5HRO A;  5I3U B;  1HI1 A;  3DN9 A;  4O4R A;  1JLA A;  2HMI A;  5HMY A;  1U49 A;  2XY6 A;  5F3Z A;  1K47 A;  2KT2 A;  4NZ0 A;  5JXS A;  1HNV A;  2V34 A;  2FLL A;  3OSN A;  2EVZ A;  5LSL A;  4EO6 A;  4Y65 A;  3UD4 P;  2RKI A;  3B54 A;  1S10 A;  2R7S A;  2BAC A;  3AQO A;  5DDP C;  3RW6 A;  2BVZ A;  4ECS A;  3JSR A;  1TK5 A;  1S5Z A;  2R8I A;  1JLF B;  2YH0 A;  2XMU A;  3J7A 1;  3DOL B;  4ZMM A;  4ETX A;  5CCM A;  3KTQ A;  1UPM B;  1WKJ A;  4P75 A;  3HDS A;  3ZZY A;  2EFV A;  2UUA F;  2ZD1 B;  2ZWP A;  3V6J A;  1DFD A;  2KO1 A;  4ID5 B;  4DQR A;  1JJ4 A;  1PYT A;  3Q8V A;  2YNF A;  4QWC A;  1RTH A;  2AZ1 A;  1R27 B;  3HXM A;  3DOM A;  3GV8 B;  3JTN A;  5E0O A;  4QYZ J;  1BE4 A;  3H2V E;  4YY3 F;  1NHV A;  5I3Q A;  2P8I A;  1GX6 A;  2AEF A;  1RXO B;  2FLO A;  2MLZ A;  2Q79 A;  1URR A;  1IN0 A;  2SXL A;  4ENO A;  2KXN B;  1NK8 A;  2I8E A;  2XSJ A;  2R7W A;  2G1D A;  3MAH A;  5AJ3 F;  2W9C A;  2Y1L B;  3KK1 B;  3CJ5 A;  1VLY A;  4LFC F;  5F0W A;  2HBY B;  5CYM A;  2IJF A;  1DRZ A;  2MJN A;  2M70 A;  1S79 A;  2AW0 A;  1HWU A;  2IIH A;  2B4O A;  2BZ2 A;  2A2D A;  1F9E B;  4X4R A;  3PKY A;  3KHG A;  3LH2 S;  1PJ5 A;  2AQ4 A;  2GCF A;  1HQU B;  1B0P A;  4JI3 J;  1MRO B;  4F4Y A;  2D3Z A;  2PGC A;  2YWG A;  1S1V B;  4YP3 A;  2ATL A;  5CYQ A;  5CQG A;  4DMZ A;  4WP3 A;  2CVI A;  3KLG A;  4WFN Q;  2L3M A;  4A8W A;  2EI5 A;  1TL1 A;  2VG5 B;  3C15 B;  2WBM A;  4P72 A;  1TL5 A;  2ZHO A;  5KFN A;  5D78 A;  2ROG A;  3HHD A;  1VRU A;  2JLF A;  2G4B A;  1JKH B;  4PEO A;  2AGP A;  3ZFV A;  3ADA C;  1VHI A;  3NOG A;  4OX9 F;  1RWN B;  3LPY A;  5AT1 B;  3HX9 A;  2BW2 A;  4TYA A;  5KG0 A;  2FZG B;  4OHX A;  2R9L A;  2YWF A;  1HKA A;  1RHK B;  2YTC A;  3HHN B;  1VI7 A;  2B6A B;  2RRN A;  4CIO A;  4B3S J;  1F5B A;  2KFZ A;  1T05 B;  1NJW A;  1NK0 A;  2F3J A;  1JB0 C;  2PE8 A;  5KFA A;  3SFU A;  1XER A;  2MDA A;  3RUB L;  2F1F A;  4DV2 J;  1TKT A;  4ZVQ B;  1Y3K A;  1XC9 A;  4H4M B;  3R97 A;  4P74 A;  1Q7L B;  1VK3 A;  3H42 A;  4LJM A;  4TKT A;  3U1N A;  4AL7 A;  3P3D A;  2F9J A;  3GG0 A;  1WC4 A;  2OPS A;  4KGM A;  2WZ1 A;  4RW6 A;  4C3M A;  5F8G A;  4HR2 A;  3FJ2 A;  3I0S A;  4DV6 F;  2HRT A;  1U48 A;  3DMJ A;  5DLG A;  4OYZ A;  1IQT A;  1HW9 A;  1I3O B;  1NME B;  2KJW A;  3QT6 A;  3RU0 A;  5K5M A;  1UA1 A;  3OXG A;  3FMB A;  4KHR A;  3D0G E;  4Y34 A;  2ZH5 A;  4RW7 A;  1HQ2 A;  3UVJ B;  4DSE A;  3A3P B;  2E5H A;  3A3O B;  5DJB A;  2W24 A;  4C2M A;  1OJ4 A;  1SKW A;  4NCG A;  4UUX A;  2B0G A;  2QLJ B;  2VB6 A;  2VJV A;  3BPS P;  3V6H A;  3X3U A;  3TYT A;  1T9X A;  4B9V A;  3PIO Q;  2HHU A;  4ER8 A;  2MB0 B;  1D8Z A;  1RZM A;  3K17 A;  5C24 B;  2CPX A;  1IJF B;  3I9V 9;  2ACY A;  2RQ4 A;  1W7W A;  1R8H A;  1JLE B;  3CCL S;  4J9S A;  3W63 A;  2FVR A;  4K4V A;  1X9S A;  1RE1 B;  3UD5 A;  4HT7 A;  1PBU A;  1M1H A;  2E1A A;  1XWL A;  4I4B A;  3PW0 A;  1FJ7 A;  1URN A;  3U7J A;  4U95 A;  6FD1 A;  4C8M A;  1U8W A;  3FZ2 A;  1S76 D;  2D3O 1;  3MAA A;  3VQS A;  2J8S A;  1UET A;  3OR1 B;  2ZH4 A;  4OI0 A;  1X9M A;  2V50 A;  1NLK L;  3CD0 A;  1YRX A;  3GIM A;  2KVQ E;  1YJR A;  1CS4 B;  3CCS S;  3EXY A;  3D9B A;  3C16 B;  4NLX A;  3D6T B;  2JDJ A;  2C2O B;  3QAE A;  4C8Y A;  3C2P A;  2HND A;  3QT7 A;  4KO0 A;  4UF4 A;  2CG8 A;  4DCJ B;  5MLC V;  2KHC A;  3AOC A;  3GJR B;  5G0R A;  2W4D A;  3Q83 A;  4EBC A;  2E44 A;  2J7K A;  3I5A A;  3DDI A;  2GHP A;  1RAA B;  5K14 A;  3NNC A;  4P52 A;  5C25 A;  1HBN A;  4JP8 A;  4LSN B;  3RAM A;  1OMS A;  1N6Q B;  3FSX A;  4CO4 A;  1IJE B;  5E3Q A;  1U1K A;  2HWT A;  2NPI A;  4R5P A;  4F04 B;  3OHA A;  1W2B R;  1N32 F;  4NA3 A;  4C8O A;  4O0N A;  3L95 X;  1UEV A;  1MLA A;  2XYP B;  4USU A;  2NLW A;  1HNX J;  4DR1 F;  3FGV A;  1HFE L;  1C1C A;  1S1W A;  1FJG J;  2XNR A;  2VD3 A;  4R0E A;  3OLB A;  2HKE A;  3GP9 A;  3KLH A;  2FVC A;  3GV7 B;  3L09 A;  2DRD A;  4CTA B;  1GTE A;  2W1B A;  3QGG A;  4ELT A;  4CO5 A;  4MMO A;  4Q7A A;  1K44 A;  1L5U A;  1YK9 A;  4O3Q A;  2ZHB A;  1VQ7 S;  2HEK A;  4FXV A;  2QL9 B;  3G6X A;  4DOZ A;  2CPD A;  3DMJ B;  2GHV C;  2N3L A;  5KFV A;  3MOJ B;  2H5I B;  4P7V A;  1WDD A;  1N36 J;  4WP8 A;  3OTO F;  1P1T A;  4RW6 B;  4FYD A;  3M8Y A;  3OL7 A;  5HVH A;  4LFB J;  3O6Q A;  1IKV B;  4I1T A;  1RHJ B;  2UU9 F;  1KHV A;  2GHW A;  1SH3 A;  1TKT B;  3SBM A;  5CD4 A;  4B3R F;  4LRB A;  1NHK L;  1TP7 A;  4C0H A;  3HMJ G;  1JJ2 R;  4JI6 J;  3S7R A;  2JEI A;  1VK8 A;  3DOK B;  5ETK A;  2NCK L;  2J7U A;  3IBC B;  4DU8 A;  1HNZ F;  4DSJ A;  2F40 A;  2RQM A;  2I6W A;  3AT1 B;  3JSM B;  4NLS A;  2V9K A;  4DU7 A;  5DS7 A;  5HP1 A;  4O3N A;  3HZG A;  3AHP A;  2IM1 A;  4ZJO A;  1AZS A;  2IMO A;  1G7C B;  2M3D A;  4URS A;  1KN6 A;  4IR9 A;  5E3A A;  1VRU B;  3P96 A;  3BO4 A;  5H9E J;  2CPY A;  1PC5 A;  2DPJ A;  2PFF B;  3SSR A;  5SZT A;  3FQL A;  4RO0 A;  5T7L A;  4K4X A;  1DAX A;  1O51 A;  3C15 A;  1TL1 B;  3D5M A;  4USV A;  3RBZ A;  1DQA A;  3I6P A;  3MM6 B;  1M90 T;  2DHS A;  3N0V A;  3KLG B;  5CAA A;  3W5Y A;  1XMO J;  4FF2 A;  1L3S A;  1DTT B;  3X1L B;  1S1V A;  2V9W A;  2DH8 A;  1X7V A;  4X66 J;  1VC6 A;  3MR6 A;  2LQ5 A;  2VBW A;  3KLF A;  2E7W A;  4DR2 F;  5KFW A;  2Y0B B;  1P1L A;  3CCV S;  2XEX A;  2X1F A;  2FJV A;  5JVH Q;  1SPB P;  4JI2 F;  3JQM A;  1A9N B;  4RLE A;  3HHK A;  1HW8 A;  4KGZ B;  4ID8 A;  2KXH A;  2JL9 A;  2JFK A;  3AD9 C;  1KR4 A;  3CD5 A;  3HHL C;  1NPR A;  4ETZ A;  1FEH A;  1H38 A;  2CNO B;  4LIW A;  2PO4 A;  4ECV A;  4ED8 A;  4RNN A;  4DV5 J;  2CDQ A;  3RG6 A;  3ISN C;  3G86 A;  5HBM A;  3TAQ A;  2VOO A;  3GFZ A;  2AP6 A;  4HAC A;  4C9D A;  3GFH A;  2HZA A;  5GME A;  1YSJ A;  3Q86 A;  5U47 A;  4OZ0 A;  2WVF A;  4WFX A;  4OI6 A;  3DOM B;  3TQ1 A;  2MZR A;  1RWU A;  1Y10 A;  2KYZ A;  2VFV A;  3CWJ A;  1AUD A;  2F4V J;  3QWP A;  5C42 B;  2B9E A;  1FX2 A;  4LMZ A;  2DKO B;  3KWM A;  1S1X B;  3W62 A;  2FD2 A;  2RML A;  4ZHR A;  1X5O A;  1E6V A;  4I2Q A;  4MFB A;  1T0T V;  4L6V 3;  4C3K A;  1FO1 A;  2GC8 A;  2IDE A;  2H51 B;  2JFD A;  2V5H G;  2RDD A;  3BKT A;  2VDI A;  3CXC R;  4FP9 A;  1VMB A;  3ZZO A;  2PI5 A;  1SH0 A;  1KLN A;  3I9Z A;  3IC1 A;  1N33 J;  3RGI A;  3JTP A;  2E5L F;  1OY6 A;  4IRK A;  1XNR F;  4B9S A;  4GRS A;  5L9X A;  3ZNJ 1;  1LW2 B;  2JLE A;  1GEH A;  3MGJ A;  4X62 F;  4TU7 A;  3IS9 A;  1EET A;  2W9A A;  3PVX A;  2H5E A;  1T3N A;  2ZH7 A;  1IBM J;  1T02 A;  3K8V A;  1DZ5 A;  4FN5 A;  5A6W A;  4OJG A;  4USK A;  3UI3 A;  2R2T A;  4GC6 A;  5BYS A;  5HRO B;  5D0H A;  2HRU A;  4TYB A;  1UWB B;  3OVB A;  4KKO A;  2OTL S;  4QIE A;  2POK A;  1XBW A;  1C0U B;  1WHW A;  1YZ6 A;  3H59 A;  1JIH A;  1JLB A;  1DJ0 A;  3CO9 A;  3M1V B;  2QZ8 A;  2Q6B A;  4CYU A;  3I0R B;  2IYI A;  4TXS A;  2FC9 A;  4DPY A;  3LP0 B;  3EGN A;  3SZ2 A;  2LMI A;  1MG7 A;  1Q8I A;  4ZVS B;  5IQQ A;  4F36 A;  1S0N A;  5LMU F;  2IMW P;  3EYZ A;  1QVG R;  1QD1 A;  1HBO A;  1UFL A;  4CH0 S;  1U1N A;  1PAU B;  4OZL A;  4RW9 A;  1YTY A;  2B4U A;  3HUL A;  3BQ1 A;  2PMZ D;  2Y9H A;  2BRK A;  3GSI A;  1Q5Y A;  4OQJ A;  3B8H A;  2I0X A;  1Q8L A;  3JQJ A;  4QU7 A;  3F44 A;  1NRK A;  4F50 A;  1ELO A;  1TL3 A;  3GMG A;  4O3O A;  1F2G A;  3N4W A;  2B9Y A;  2FPH X;  2P9G A;  2ZH2 A;  3TJ8 A;  3UDC A;  4ZA1 A;  4OFZ A;  1D0E A;  5FJ4 A;  1X4G A;  3MUT P;  1YGY A;  1Y7P A;  2CQG A;  2UV8 A;  1S1U B;  4NLW A;  2UUT A;  2V2V A;  4PCQ A;  4DPT A;  2DNR A;  4OI3 A;  2Y1J A;  1XMQ J;  1CEZ A;  2HNZ A;  2Q43 A;  4C8Z A;  2HBR B;  4NAS A;  3SI8 A;  2UXC F;  2G2Z A;  3FEY B;  5HMW A;  4IQM A;  2IAJ B;  4X64 J;  5KFE A;  1VBK A;  3N01 A;  4N47 A;  4IUF A;  4DUT A;  2NRE A;  3RTV A;  4ECR A;  4OZ3 A;  4LF8 J;  1RHM B;  1GAO A;  2R8J A;  4JI0 J;  3C14 B;  3VGT A;  3OFH A;  3C3L A;  3MCS A;  5DQI A;  1NDP A;  4CP5 A;  3MM7 B;  2OI2 A;  1V6H A;  1M5S A;  4F4X A;  1J5O A;  1YHQ S;  3BO2 A;  2F65 A;  3NGD A;  4IG0 B;  3U1M A;  1XIQ A;  2U2F A;  4IFY A;  4RBV A;  2YQ0 A;  4YN3 B;  3KJV B;  4C7Q A;  1P8G A;  3C8Y A;  3M8Q B;  3OJU A;  1DUR A;  3BKU A;  3CC4 S;  5J2P A;  3TR5 A;  1HYS B;  2EKN A;  3P5T L;  2VKR A;  4CNY A;  2FDN A;  4ZCI A;  4TY9 A;  4C0O C;  4ED3 A;  3ZTS A;  4MKV A;  2RU9 A;  4QR1 A;  1Y0H A;  4OV6 A;  4DZ6 A;  3RBD A;  3IG1 A;  4YY3 J;  2R7X A;  4J5O A;  4M95 A;  4DBQ A;  2MZJ A;  1HPZ B;  3E51 A;  1VQO S;  4LF9 F;  3RRH A;  3O2I A; 
#chains in the Genus database with same CATH homology
 1BHN A;  3VGV A;  4F4A A;  3Q8Y A;  2VU5 A;  4ANC A;  3B6B A;  4FKX A;  1HHQ A;  3FCW A;  3PRV A;  4AND A;  3Q89 A;  1ZS6 A;  3BH7 B;  1W7W A;  3Q86 A;  3BBC A;  4UOF A;  3BH6 B;  3VGS A;  3ZTO A;  3BBB A;  1KDN A;  1XQI A;  4S0M A;  2DXE A;  1U8W A;  3NGS A;  1JXV A;  3EVO A;  1NSP A;  1NB2 A;  3PJ9 A;  3EVM A;  1NSQ A;  1NLK L;  3EJM A;  3NGU A;  3FKB A;  1F3F A;  4WBF A;  3B54 A;  3FCV A;  2B8Q A;  1NCL A;  3NGT A;  5BXI A;  1S5Z A;  1WKL A;  5CAB A;  2DYA A;  3EMT A;  3JS9 A;  3EVW A;  3Q83 A;  2DY9 A;  4C6A A;  3DDI A;  1NPK A;  1WKJ A;  2CWK A;  3ELH A;  3ZTQ A;  1B4S A;  4W98 A;  3Q8V A;  3DKD A;  2AZ1 A;  1PAE X;  1BE4 A;  4F36 A;  4O0N A;  3WX8 A;  3ZTR A;  4ENO A;  1LEO A;  3FBE A;  4UOH A;  1PKU A;  1UCN A;  1EHW A;  5IOL A;  3GP9 A;  1NSK L;  1NDK A;  3Q8U A;  1BUX A;  1F6T A;  3R9L A;  1K44 A;  3EE3 A;  2ZUA A;  1WKK A;  5C7P A;  4DI6 A;  1MN9 A;  3GPA A;  4ANE A;  3ZTP A;  3FBB A;  1MN7 A;  4EK2 A;  4UOG A;  1NHK L;  3VVU A;  3G2X A;  4DUT A;  2NCK L;  4FKY A;  3ENA A;  1NDC A;  3EIC A;  3VGT A;  2DXF A;  3EM1 A;  3FC9 A;  1NDP A;  3VVT A;  4CP5 A;  1NUE A;  1S57 A;  1S59 A;  1NDL A;  2BX6 A;  3NGR A;  2HVE A;  1HLW A;  2HUR A;  2AZ3 A;  1XIQ A;  3ETM A;  1LWX A;  3L7U A;  2B8P A;  2BEF A;  3VGU A;  5CAA A;  1HIY A;  3FBC A;  4KPC A;  3ZTS A;  2DXD A;  4HR2 A;  3BBF A;  1VYA A;  4DZ6 A;  3FBF A;  2HVD A;  3MPD A;  1B99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...