3GPAA

Crystal structure of the mimivirus ndk n62l mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
b'AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gpaA00
2CWKA 1W7WA 1UCNA 3VVUA 3BBBA 1BHNA 3MPDA 2DXDA 3EMTA 3EVMA 3EM1A 3Q8YA 1HIYA 1XIQA 1LWXA 3BBCA 1NSQA 4UOFA 3Q83A 3VGSA 1JXVA 3Q8UA 1K44A 3FBBA 4ENOA 3FCWA 4HR2A 4DZ6A 1MN9A 4S0MA 3ZTOA 3ZTPA 3NGRA 3VGVA 3FCVA 3ENAA 1WKJA 2DXFA 3ZTRA 2BX6A 3R9LA 3ELHA 1EHWA 3NGTA 4EK2A 3EE3A 4WBFA 4F4AA 4O0NA 3VVTA 3ETMA 3NGSA 2NCKL 1NPKA 4FKYA 1NHKL 2ZUAA 3BH6B 3VGTA 2BEFA 3EICA 2AZ1A 5CABA 1MN7A 3FKBA 2DYAA 4DI6A 3ZTQA 1LEOA 1S57A 1BE4A 3NGUA 1ZS6A 3B54A 1KDNA 2HURA 2B8QA 3GP9A 4CP5A 1NDCA 1S5ZA 1NDKA 1U8WA 3PJ9A 3Q86A 4UOGA 5CAAA 1VYAA 1B4SA 1S59A 3Q8VA 3G2XA 1PKUA 3PRVA 3EVOA 2DXEA 1NSPA 1XQIA 1NDPA 1NSKL 2HVEA 4C6AA 3DKDA 3EVWA 3FBEA 3L7UA 3ZTSA 2B8PA 4W98A 1NUEA 1NB2A 3BBFA 1HHQA 2AZ3A 1F6TA 3Q89A 4FKXA 1B99A 1HLWA 3BH7B 4KPCA 2DY9A 3FC9A 4F36A 4ANEA 1WKLA 2VU5A 1NCLA 4DUTA 3EJMA 4ANDA 3GPAA 5BXIA 1NDLA 1WKKA 1BUXA 4UOHA 3FBCA 3FBFA 3VGUA 3JS9A 1NLKL 3WX8A 3B6BA 1PAEX 4ANCA 5C7PA 5IOLA 2HVDA 1F3FA 3DDIA
chains in the Genus database with same CATH superfamily
3TVYA 5KFEA 1RTDA 2C2EA 5GAGU 4HLBA 4DV4J 1RT7B 1EETA 4OI0A 4PWUA 2AWZA 1S1WB 5HLFA 4Y00A 2E7WA 4UUXA 3PNIA 3HZGA 2R3VA 1KFDA 4HTJA 3BDEA 5DQHA 2YWEA 4P2FA 4JI0J 1C1CA 2DNHA 4AL6A 4DMZA 2FJBB 4ZCKA 1RT2A 1H2VZ 2P9GA 3DLEA 3WZ0A 5ADZA 4CRJA 3F0NA 3QJPA 1FVQA 3NBPA 5D0HA 4DF8A 2VG5B 4IG3A 5F8IA 4BHQA 3N5FA 1IKXA 3FVYA 4PXBA 1Q7YT 4LF6F 1FJ7A 1VBYA 1SJFA 3EGWB 3B78A 5H9FJ 4JI5J 5D3GB 4W92B 2W7OA 2KJWA 2FPHX 3CB4A 2N7CA 1V5VA 2KKHA 1T0TV 4UW2A 2J0QD 3M7VA 4DS4A 4MK7A 1B70B 1OY8A 1JLGB 1HQEA 3ZTPA 3ENAA 2DXFA 3P96A 7AT1B 1H3DA 2GQCA 1XNRF 4WIIA 3FEYB 3J7ZT 1R3NA 4M5LA 3ILJA 4JV1A 4K4SA 2VOPA 2KYXA 5LSRA 3C6TA 2EXUA 3A8IA 1RJJA 4YB7A 4LMZA 3VALA 1F3VA 3G8SA 3K5MA 2HLUA 2YNHA 4G6VB 3P45B 4OZJA 4HKQA 1BQNA 2R2UA 3QQCD 4PABA 2F4VF 4DSFA 1HWKA 2FVSA 2GJ2A 1PC4A 2ZHOA 4KTQA 2PDAA 1FK9A 2L3MA 4ECRA 1RBAA 2VQEJ 2RDIA 3D0HE 1G7CB 1CG2A 5L1LA 2VKRA 4V1Ak 1NSQA 3MMBA 4WFYA 3ITHA 3KG4A 3TVKA 4DV3F 3FDSA 3MUVP 5EWGA 3HKZD 1AW0A 2UXCF 3IP0A 1ZAXA 4GMKA 2JOQA 4YR3A 3ELHA 1JLEB 3DLGB 3TAMB 3V4MA 2W7PA 2JL9A 2DNMA 4ZP7A 1X4GA 2FHKA 4Z7YA 1D0EA 1HBOA 3RBZA 3GYGA 4F3MA 1TELA 4AT1B 4TY9A 4YP3A 4GO7X 5FDLB 4DCJB 1RCOB 1RAOA 3MEGB 4DR1F 4ED1A 1LFPA 2H1YA 4ELVA 4PG6A 4DR3F 4CM0A 2HG4A 3ZTSA 2L9NA 4GC7A 5L9XA 3Q22A 3LO3A 1FWKA 4ZJOA 3BO2A 3FCHA 1HYSB 1VRTA 4Q7AA 4P2SA 3VAMA 2K1RB 4HI1A 2Q3PA 1RWMB 3Q8SB 3W9IA 2VUGA 2E1MC 3T19A 2YWHA 2ZUGA 4ZVTB 3THVA 3I82A 3GQCA 4ERDA 2KDOA 4DV5J 1P6TA 3A1YG 2B56A 2DTJA 4ED2A 3R7SB 2MKYA 3UNYA 4NA3A 2XO6A 2QO3A 2F40A 4ZN3A 2YWFA 2PC6A 3CD0A 5DM6Q 2MKSA 3ETMA 2VD3A 5BYRA 4Z2XA 4BDPA 2QEXS 5HMXA 1NO8A 4H4KC 3GJRB 2HFUA 5L9NA 3LUYA 3PW2A 4USTA 3TARA 5F9LA 4KC5A 1C0UB 4JV5F 3HVWA 1PBAA 2DGVA 1F5BA 3MEDB 3THTA 1FDAA 4QW8A 1FDBA 3NL0A 4IRDA 1DTTB 3CJKA 2ATLA 3PRBA 1UA1A 3QGHA 2MKKA 1NK9A 2CG8A 3UR0A 4LF7J 4P7VA 4AD6A 3GFZA 2XS7A 2CVIA 2BQRA 2DY9A 2ZHBA 2QA4G 3J7A1 5E0OA 1UWBB 3GLJA 4Y2MA 4H4MA 5D4LA 4Z7CA 3QRQA 2C1EB 2AHOB 4I68A 4OI4A 2J9DA 3TA1A 5A6PA 1TVRA 1WG1A 3HSDA 5IV3A 3SDEA 3US5A 1JXVA 4NCGA 1ZA2B 3IGVA 3PO5A 2OKQA 2FLNA 1WKJA 2PA8D 3CJ8A 1U1RA 1RT3A 4OHWA 4KRWA 4FZVA 2CPEA 2GV1A 2PFDA 2JLGA 1WELA 4DSLA 1RHMB 2XYHB 3QIDA 2AV5A 2K06A 3BDPA 3N5BA 5J2PA 1MROB 2FC8A 3R5DA 4J37A 1HW9A 3CCLS 4NLPA 1S10A 2GVDA 1NSPA 2Z4PA 2QJ3A 3FBEA 1VQ9S 2LP4A 4WTYA 4IOAQ 2JJ4D 4CH1A 3HT3A 4CLKA 2XY7A 3TUPA 3IS9A 1RA7A 4C11A 1U1PA 2RDJA 1PCAA 2V8PA 3FRZA 1RTHB 1RTIA 2MSTA 1D09B 4ES3A 2B7BB 4CO2A 1KTQA 2DR6A 2QLBB 3Q8UA 3UCZP 4K50A 2LDYA 4X4RA 2DCUB 3ZTOA 1IBMF 3NNAA 4DL5A 5KFRA 3NCQA 2GZOA 4WU2A 4A8SA 2AJ1A 3CJRA 4EBCA 4JI3F 1KD1T 5F8HA 3ZZPA 3VVTA 1YJNS 3BO3A 4I2PA 3IRXB 3KHRA 1HQ2A 5KFJA 2QLXA 4LF5F 3KLEB 3IR6B 1N8RT 1KDNA 3UWTA 4QWDA 3IG1A 3D2WA 5CAAA 3AJDA 1UVKA 1JJ4A 3QMQA 4GRSA 3PACA 3EPGA 4DN9A 3UPFA 4KSEB 3AJ1A 4A8YA 3M8YA 5J2MB 2XTJP 3CF5Q 1I6JA 4OZNA 2QZ8A 3V6DA 3MR7A 5FD1A 3UCUP 3M8PB 1TL4A 3O1LA 2W9AA 3HPOA 1SUQA 1OO0B 3PFEA 1VQSA 2K2PA 3CD7A 4DV7J 3R8YA 5KT4A 4FS2A 1T9TA 4YB5A 5ETNA 2IM2A 4IR9A 4A8OA 1CJUA 1HIYA 1Y0HA 3J80Y 3GIRA 5EHHA 3OVSA 1HKAA 2RRBA 4A46A 3FCVA 3MR2A 2EVZA 2XMVA 1LOUA 2WZ1A 2HAIA 2H4WB 2LXFA 3K5PA 4DV0F 1SH2A 3PDNA 2BRLA 2HFNA 3DN9A 3UVJB 4CO1A 2J5AA 2CJKA 2LVWA 3RAQA 1R6VA 1VIOA 5ETSA 2E1CA 1QE1B 2OPSB 3BR8A 2EEYA 3ZZYA 4CLUA 1VS3A 1R8HA 3T1YF 2J9CA 1TK8A 3Q2SC 5J1PA 5CZVA 2AGOA 3GFHA 4NLGA 1FRJA 2V34A 2WSCC 1S1VA 1LWFA 2YVSA 2N3OA 4C8KA 1U2CA 1RAAB 5A8KA 2HWIA 2GCFA 2VG7A 4PRFA 3SZ2A 4X4UA 2KZZA 3MPWA 2RRNA 3OJSA 3POTB 3MEEA 2PMWA 3QZ8A 2HGNA 1WF2A 4CQ1A 1OWXA 2BUNA 4X4NA 1PSDA 1Q5VA 4RKUC 4B3MJ 3JQKA 4IH6A 3UN5A 1KC8T 2HRTA 1JX4A 3IA0A 4DL0C 4RNNA 3NS7B 3OL9A 1IR1A 4KO0A 4NEZA 1ULRA 2IBOA 1C1CB 3I87A 4GKKF 2C3MA 1VGYA 1FKPA 1S9FA 3MM5A 4JI1J 2A1BA 3DLEB 2UVWA 5DLGA 2F9JA 3QLHA 2MY8A 2AEJA 5F8NA 3UNGC 3NRBA 4NXNF 3KMSA 2DPIA 2N82B 1MMDA 5KTQA 3JTNA 3NBPB 4LRCA 2RF2B 4TLQA 4JB8B 3MDFA 3I31A 3ENWA 2XQCA 1IKXB 1F6TA 4J9UE 2XWXA 4RZRA 4N41A 1TZ0A 1GXLA 3QWUA 1ZAWA 3BJYA 1N5YA 2XEXA 2E1AA 4CT9A 3K5NA 1NZAA 2DISA 4DR6J 3S01A 5D8HB 1SBRA 1HNXF 3NAIA 2NSBA 2VQFJ 4KPYA 4QYRA 3BF4A 3X3UA 4HTIA 1M5SA 4LQ9A 3TUJC 2CJBA 1SC4B 3PKMA 4OYXA 1KKHA 3GJTB 4S0MA 5C2CA 2BJ8A 4P52A 1LW0B 1XC9A 4J9LA 3I9V9 3KMQA 1VQ8S 3PZPA 1XTZA 2XC9A 2ADCA 4AQYJ 4CIOA 3C19A 4OV1A 5B08A 3VGTA 3O8WA 3MAQA 2KG0A 3C6TB 1H0HB 4USVA 1D1UA 1RWKB 3KLVA 3H40A 1VBKA 2AEMA 2BV3A 1F1BB 2XMMA 1F9EB 4ED7A 4C8LA 2GQ2A 2YNHB 4LFCF 2QLFB 3NLCA 1KLMA 1GK8A 5LT5A 1XK8A 2MYFA 2QMXA 4XO0A 2CQCA 4Y2KA 3C14A 5IWAJ 4G65A 1UPMB 5KG1A 5CH7B 2HFOA 3KJNB 1QAYA 2Y3YA 4KQZA 3CMES 1BY9A 1GXTA 2RS8A 4FVMA 4EZ6A 3MM6A 4F02A 2FVRA 1N34F 5E3RA 1HPZB 2MJUA 5K8MA 5GMEA 1NXIA 1ZOTA 2OO4A 1UAWA 4CCHA 4RW8A 2QFJA 2J7KA 3MMBB 4U7UD 4JV2A 1X5TA 5LXYA 1NJWA 1URRA 3KK1A 4NZ0A 3E51A 4I6YA 3W5ZA 2Y9HA 2FLPA 1HW8A 3K0JA 4RU2A 4F26A 5H1SV 1TKXA 3NXZA 4OMFG 2NCKL 3TZZA 4ECUA 5CXTA 1X4HA 3QIPA 3QGGA 2CPHA 3C16A 2BACA 3T6BA 4ECVA 2J6TA 1HBOB 1SKSA 1ZETA 3RTVA 2B51A 4KH0B 2YX4A 1PAUB 2ZNYA 1Q81T 2HS0A 2WK4A 2M7SA 3TA2A 1OIAA 1WF1A 5A6WA 1FTCA 2HVHA 4ZP9A 1KQGB 4LRBA 4I4BA 2QC3A 3PEJA 4A47A 3TZYA 3H90A 3L3CA 2XZDB 1W2IA 1EZZB 2YX7A 2EG1A 3T5KA 3K7RA 4F25A 3TJ8A 1IVZA 2PIIA 2B3TB 2H5IB 2OIHA 3I0RB 3TI0A 3P4UB 1RAHB 2C2MB 2CA9A 1LXJA 5HQMA 3DRSB 2H3EB 4GO5X 3KLGA 5D77A 3NGRA 3I0SB 4YDDB 2YWWA 4NRTA 3BQ2A 1Z2ZA 3MUTP 1UFLA 1C0TA 2Q43A 3N79A 1SH3A 3R2CJ 2VDHA 3MECB 1S48A 4E8UA 1U48A 4KHPJ 3LTOA 3E3XA 4KGXB 2ERRA 3SEOA 4NI2A 3K57A 4DR4J 2JEJA 3QT8A 3BQ0A 3HULA 4KH1B 3M9NB 4A48A 2PD1A 1RLDA 1TL1A 1WOOA 2B43A 4CDIA 2ZBCA 1OSDA 2XZWA 2W2PP 4P73A 1WKKA 3VQTA 1A9NB 1JJHA 4RW6A 2HNYB 3P49B 3MUMP 2OLWA 1AT1B 1W25A 1FDDA 2LLZA 2EFOA 3DOKA 4IH7A 1K8AT 2RAQA 5KFPA 1TVRB 2YKNA 4RNMA 4O0IA 4I64A 2Z56B 4GVBA 3H98A 2LA4A 4J9OA 3KNAA 4UOFA 4C8ZA 2XYPB 3M8QA 4NL5A 2CQ2A 1K44A 4FYVB 3UN2A 3JSMA 1IJEB 2V5HG 1RT3B 1TKTB 2RSQA 1UJ4A 3KLFB 3DLBA 4L76A 3NGTA 2W7AA 3M32B 1SJ1A 1T8EA 4OJ3A 3E01A 3UDLA 1NJIT 1WC5A 4PXEA 1O0PA 4Y0FA 3CNQP 4GKJF 2W2QP 1HNZJ 3HHLD 1YGYA 3NOCA 3A3OB 4USHA 2C42A 1IKYA 1Z1ZA 3T3FA 4UY85 3DKDA 5IM0A 1REGX 2MQPA 1BLUA 2AMCB 2DH7A 1VQMS 2MGZA 3UN3A 4CWBA 4N5SA 1Q4RA 3GPAA 2OAUA 3D1QA 1Y5NB 3M30B 3IMQJ 1FRHA 2BANA 5B0DA 2HNDB 3HHLA 4OLPA 1N5VA 1W7WA 2AJQA 2Q6CA 1TUGB 3W8GA 2XGPA 3H42A 2GHPA 2CPFA 5J2QA 4X2BA 2UUBF 4L72B 2YKPA 4J9KA 2Z2MA 1ZM3A 4MKYA 3R9LA 1N5SA 4UQGA 3I6PA 2IPOB 1KVIA 4DSEA 3D6HB 1Q79A 4E98A 4I0WA 2ZFHA 4X4TA 1RT5B 2C3OA 1VR6A 5HATA 4BBYA 2IYGA 5A0YA 2HFZA 2BQ3A 8ATCB 3P5BP 1YK9A 1X8DA 4LSLB 2HIYA 4F0MA 2BKOA 1FEHA 2FZGB 1V5IB 2KM8C 1HBUA 1FJEB 3SMZA 1NRKA 1R43A 2L9DA 1ZM4A 2V68A 3TZXA 4A8WA 4CLYA 3O3LA 2UUCF 4P7TA 2RHQB 3FQLA 5K8NA 5B0GA 4RUAA 1U09A 2MLYA 5KFZA 1XNQJ 4ICLA 4U8VA 2WONB 1WC4A 2KFZA 5ETVA 1JLQB 3PYEA 3WIVA 3LP1A 3VAJA 1FCAA 3SQGA 1FT8A 4OHVA 3K59A 2HNZA 4AL5A 4Q45A 6FDRA 2OFHX 4AE5A 3AOBA 4DSKA 1RT1A 5L39A 4O3SA 4WK3A 5KFXA 2X3DA 1FRKA 1OMSA 4X66J 4B3TF 4PWDA 2J0SD 2GHWA 2RU3A 5KFAA 4J91A 2UXBJ 3FMWA 3BSAA 4DV6J 3LQVA 1KFSA 1HBMA 5J1EB 5HVHA 1S1VB 3OTEA 1YIJS 4ES1A 1LWFB 2NXJA 1NSAA 4O3QA 2OI2A 4QIGA 5FIIA 1KSPA 3G6XA 1HHSA 2Y0SD 1S4EA 2BR0A 3MXHP 4DDFA 5T14A 2CQPA 5E2QA 4LF2A 4IQMA 2QIFA 1N32J 5M2PA 2DO0A 3DRYA 1AFJA 2DBBA 4I1TA 1APSA 1IKWB 1IKVA 2QA2A 2WB1D 3SFGA 5FLXY 3MAAA 1S12A 1NHKL 2W9CB 1FKPB 5CABA 3MPUB 1S6PB 4USJC 3QLHB 4PPDA 3MMCB 1UTAA 1NDKA 2D69A 1U0HB 4LIWA 4JYAJ 3MCOA 3BZQA 2RD5C 4NMLA 3RBDA 4PG7A 3NNHA 2IM0A 1PC5A 2R7OA 2VZ9A 3DGPA 3AQPA 3KK2A 3A8JA 2H51B 4ANEA 3LPEA 2CDRB 2DNOA 4HDGA 3JQMA 2HLTA 2VOOA 4Q43A 2F7VA 1Y00A 1D9FA 1NLKL 4EBEA 4XDDA 5HI7A 4ANCA 4IG0A 2ZH9A 4PYAA 4QU6A 2L08A 1VMBA 3LGMA 1VIXA 2J8SA 3PYFA 2VH7A 5DQIA 4QR1A 3RYLA 1S1UB 1FWLA 1RBLA 4PQUA 3S7RA 2CADA 1PYOB 5CYMA 5I3UA 2HZVA 1NK5A 5KFTA 4P72A 2DVIA 3SV4A 1CULA 1RBOB 1DHMA 4DPYA 2KT5A 2RQMA 3QGIA 2YWGA 4OX6A 3TANA 2KH9A 2DO4A 3NMRA 2E5IA 3P3DA 1UETA 5DGAA 1V3SA 4LT6A 2KTQA 5HP1B 3NY0A 4NXMF 3AD8C 1KLMB 3QATA 2ABYA 5GMKa 1C1BA 1VQYA 2HK2A 1KBRA 1WJ9A 3LPYA 1HWUA 1U47A 4F04B 1U1MA 5C5JA 4X65J 4DR2F 4LF9J 8AT1B 4DG1B 1U24A 3D6TB 4UOHA 2JLEA 1WOSA 4ED5A 1SJ3P 1IJFB 2YNFA 4HI2A 2GVZA 1SVDA 3I5CA 4Q8FA 3R2DJ 2EW9A 3KK1B 3AB4B 3M6VA 1M90T 4LVOP 5F0WA 2ZD1A 5KFMA 1OYEA 3M2UA 3GYNA 4HL9A 2DNNA 1TKXB 4F7VA 1Y4ZB 2ZH3A 2HHHF 1V6HA 4FKYA 1G6BA 3MI7X 2KI2A 1LK5A 1FFSB 3M8ZA 3HMJG 4KB7A 3NEKA 1XMOF 2CPDA 1RE1B 1EP4B 2CDQA 3SXLA 5HBMB 3H5YA 3SIPB 1GMUA 4K0KJ 1J5EJ 1ZYQA 3H8YA 1GMVA 2R7VA 4ED3A 4NLOA 2PGCA 2Y0BB 1UW4A 2Z2YB 5I4MA 2ZZNA 1R27B 5BJRA 2V69A 1NZ8A 5MAOA 1RK8A 2HRUA 4ECQA 1N5QA 1T11A 3VCDA 1S1XA 3EXCX 1JLFA 3TQ1A 2AJ0A 5HK4A 4NYPA 4ZJQA 3HP6A 5CD4H 3CDWA 3GMGA 5KOWA 3EVMA 2Q66A 3K8WA 2B6AA 3CDUA 3U27A 2ZE2A 3KLGB 2LYVA 4BS2A 5HAOA 1BQMA 2XULA 4OL8A 2FVPA 2BDPA 3JYTA 4EYHB 1WC0A 4NA2A 3D54A 5E3AA 4LBPA 1P1TA 3M2VA 4B3MF 6AT1B 4QYZJ 3PJ9A 3MM7A 5C25A 2OJ3A 2DNGA 3MFHA 3L7OA 3ZFVA 1S1TA 4A8KA 2NPFA 1TL1B 4J9RA 3KDOA 2WTFA 1LWEA 1IUJA 3GR1A 4DCPB 2M5YA 4CNYA 3PRDA 4C4WA 3BSOA 2FY1A 3LOUA 4QWAA 2IVYA 4F4YA 3TX0A 2CPZA 1XR7A 3RBXA 3UD4P 4NLQA 1ZM2A 1VQOS 3JAMY 1HR0F 3EMTA 4OX8A 3DHWC 3Q8YA 5K8OA 4H4OA 3EXYA 1IR0A 3DRPB 4DR7F 3CCWA 3CJ5A 5DDQC 4NLWA 5DDRC 4F50A 5IFMA 4OYAA 4HACB 1N56A 2R8JA 4CH0S 2BVZA 2HBQB 1FVSA 1PYTA 2B4UA 3HHDA 3NGKA 1IQTA 1REVA 3CE8A 4ZHRA 4LBIA 2YKQA 2OEJA 4PUOA 2M70A 4JV0A 2XSJB 3GWCA 3AXMA 3W8PA 1IKYB 2M8DB 1FJGF 5IT9U 3W61A 4WXWA 3L9ZA 1RLCL 4U6PA 3CO9A 3OVBA 4AQYF 2LFVA 2RKIA 4ZPCA 3I4HX 3MD1A 3PIPQ 3KJFB 3QAEA 2A6OA 3PCOB 4FPRA 4EO6A 3WX8A 4MYUA 2YH0A 4M5HA 4NZ7A 5A8RB 4UOCA 2YWKA 4RBUA 1JNZB 2PT0A 1MSWD 1YDLA 4B9SA 2HFVA 2RE1A 2ZM6J 5IC4B 3OW2R 5J2QB 3PHTA 1ZH5A 3RW6A 2QMUB 5DGBA 1VOMA 2IMWP 4NZ6A 1Q5YA 3EE3A 2LEPA 3NS6A 3NGSA 2WOMA 4FF3A 5C24A 2W4DA 3AA8A 4O23A 3AT1B 1U26A 3H5SA 3K8VA 2W8LA 4IFVB 1E6VB 4NA1A 4RW9A 4IOCQ 4JI7J 1P9QC 3CCRS 5KG6A 1YBAA 1HWJA 1CSJA 3M9OB 2B5JA 1GX5A 4FKXA 5A76A 4N8NA 2J9DE 1AUDA 3IBFB 3D6MB 2YQ3A 2Z57B 1BQXA 2E9ZA 4L3NA 3QO9A 1DBDA 1HQUA 3OBIA 4IDKA 4DUYJ 5I42A 4QOTA 1K1QA 4DFPA 2DNLA 4DBQA 3KK3B 5J2NB 2H5EA 5J1NA 2Y1LB 2DPJA 5KFVA 4FS1A 4FF1A 2E7XA 3DM2A 2QGFB 3FK4A 4M5MA 2B4OA 2DH9A 4G1QB 3ET6A 1RT4A 1TU0B 3KJVA 3GZ7A 4AYBD 2M88A 2Z0GA 3MZIA 2O01C 2OTJS 1LXNA 1RT1B 2LQ9A 1N48A 4EWTA 1W26A 2POKA 4ZDNA 5M2RA 3GR0A 3ZTQA 2H4YB 3W1YC 1TV6A 4B3SF 1NDCA 3CJ2A 2JVOA 2MJNA 1U1KA 2GHVC 3OLAA 2UXDF 1HBMB 3CJ3A 2DNZA 1ZA1B 4OI1A 4DQQA 3M1VA 5KG5A 1TL7A 2HQIA 3KNGA 2J76E 3HVAA 2D3UA 4C0BA 2PSZA 1D9AA 2W9BB 3G87A 4JI6F 1RWWB 4ANDA 2CJ9A 3T1HJ 4QIVA 3GV7B 4EO8A 3DRXA 2YQ1A 4M5IA 1YJTA 3PXGa 2C2ZB 2CWKA 4QJVA 2UV8G 3M9MB 3QFHA 2J8AA 1SC6A 4Y6IA 4ATNA 2HHPA 3G8TA 2IYIA 4DX5A 5LOQA 3W62A 1QUPA 4CTAB 1HD1A 2JZ5A 2BX6A 4ZP6A 1TUVA 2E5LF 2ZWOA 3MCMA 2J6SA 2CPXA 3PVXA 1K47A 1ZBTA 4R8UB 1G4CA 2XY6A 4ECWA 3IBCB 1VYAA 1WF0A 5LSLA 1B4SA 1FEEA 1LNQA 4CNZA 3CJ0A 2K7KA 5B0FA 1Y3JA 2YNGA 2CWXA 2IDEA 1SC1B 2FQQB 2V2KA 3QGPA 1R8BA 2AJFE 1IR2A 3KK2B 4B9NA 2EKYA 1R0AB 2I5JB 1NCLA 3W7BA 3R1HA 1VRUB 4C9DA 5IC6B 2G13A 4IG0B 2XBPA 5KFUA 5AJ3F 3PW7A 2W1BA 2VC0A 3MURP 3EDQB 3VVUA 1IWAA 4PQUB 1AXQA 2DGTA 2QYCA 2B9EA 1IBLJ 1GTHA 1RACB 1KP6A 2QX0A 3BKUA 3CVKA 4ZVGA 2OPRA 2WW8A 2LA6A 5HJXA 2IIHA 4C3MA 1F9HA 2QA1A 2DGQA 2WAQD 3V6JA 2BE9B 4WYWA 3T9NA 5LM7E 3M8WA 1YZ6A 4OZ5A 1QUVA 4HH1A 3FGVA 3OR1A 4ZCLA 3QT6A 2ZHAA 2W8KA 4WE1B 2ZOGA 2DNKA 2DRBA 1CBKA 4LFBF 4NLTA 1HNIA 3AXKA 3SSSA 3W63A 1SJ4P 2MQNA 1RWXB 5BR8F 5FJ4A 3DLKB 1R0BG 2UVVA 1UKUA 1S4FA 3H25A 4IUFA 5HVGA 2HMIA 2DIVA 3ICLA 2IC3B 4YEAA 3BGLA 1EKSA 3LA0A 2R2TA 4N47A 1VC6A 1IWGA 3OFGA 2GVZB 1YTYA 1FNXH 1UW9A 2VFUA 4MMOA 1CC8A 2VPWB 3CTRA 1X4AA 4WZQA 2NUUG 2ZD1B 3IWXA 1UVNA 1RWOB 4MK9A 3IGNA 1D3WA 1NPRA 1PJ7A 1GMWD 4JI4J 3N28A 1FRXA 1AUSL 3TJ9A 5DG8A 4R5PA 2BEFA 3UCGA 3VHQA 3LGNA 3UDEA 3ZZRA 1RA6A 1S9GB 3ZO7A 2ZJPQ 5AXLA 4RW4A 6FD1A 4B3OB 2XLIA 4OZ0A 4MT1A 4K4XA 5AXMA 2CNLB 1GMWA 2ACYA 1RWUA 4WCEQ 3SQOP 4KHRA 1F60B 1MLAA 3UDVA 2DR9A 2RT3A 3W65A 1S1XB 2FLLA 4X84A 3UE2A 2IAJA 4IKAA 3H4DA 2JNJA 2FYXA 2FTRA 4CLLA 3TWZA 3VV2B 1VDHA 4I2QA 2MQLA 4DUZJ 3KHLA 3I96A 3OSPA 3NCRA 4MFBB 4G3IA 1MW7A 2PMHA 3EZOA 3GG0A 1RHKB 4OJHA 3JYTB 2OEKA 3IAS9 1RAJA 4YY3J 3JSYA 1Y7PA 5K14A 3AFGA 3T6JA 1KVJA 2VBYA 3K58A 4LF4F 1LQ9A 3M2VB 5KFCA 4CYUA 4F4XA 1RQ0A 3MM7B 4UOGA 2EC0A 4FDFA 4ZP8A 1F9FA 1ROFA 3RB6A 2QSFA 1J5OB 2VA2A 4F3OA 4LBHA 4LSNB 5F41A 3K17A 2YKMA 2IRYA 3PX6A 2Z58B 3LP0A 4ELUA 3LAMA 4DL7A 4KKOB 4DV1F 3RGIA 5JMNA 4LJMA 2ROPA 4KFBA 3N9UC 3HZEA 2L9WA 4C98A 1K9MT 3DDKA 3RUBL 4DR5F 5U47A 1R8AA 4BCAA 3MM9A 4N8OA 2I6WA 2VA3A 3R3TA 4J9VA 3GIIA 5IQ6A 1EHWA 5M2UA 3OUYB 3HM9A 3H5XA 3DMJB 4ZLPA 4AXIA 2AEFA 4K4VA 4OHXA 3UFCX 4MYTA 4B9UA 4EGLA 3R7NB 1QJHA 2ZH1A 4OX9F 1FKOB 3DCAA 3DYAB 2XNQA 4ER8A 1BGXT 1KONA 3C15B 1XMQJ 2HRYA 3JTPA 2OPPB 3D3BJ 4ZPVR 1RHRB 2AIRB 2R4FA 3GILA 2BM0A 5HQLA 2P9EA 5KG3A 2LECA 3HHEA 4ZVUB 1TMJA 3HO1A 3W2VB 1S7IA 1N33J 3Q83A 1WC1A 1B64A 1JWWA 3OFHA 3OXLA 2ZBIA 1TKZB 1HNWF 2HHQA 5DETA 2BJEA 4WP8A 3CCTA 2XB2D 5HQ8A 1NK6A 2X7IA 1N36F 1SKWA 3PY8A 2KRBA 3Q86A 4DL4A 4WPAA 5LSOA 3IWNC 2UUAJ 1KOHA 4O44B 3EVOA 1RTJB 2FZKB 4JI2F 1U8SA 1LWCA 3GV5B 3BSNA 1UFWA 2KXNB 1VQLS 3Q89A 4KE5A 5L1IA 2EI5A 4RL1A 2GGPA 3RR8A 2V0NA 1S6QB 2C3UA 4I6AA 2CQDA 5K9FA 2GW8A 2RUSA 2L48A 4WU3A 3V4IA 3BBBA 2G2YA 4B9MA 2D7SA 2KB2A 4FYYB 3CD6S 4KGZB 5B09A 2NZCA 3DM2B 4URSA 1MN9A 3MWBA 2HPUA 2ZBRA 3FJ2A 1AZSB 2P6TA 2UZAA 2LXIA 2F63A 4DL3A 1UEVA 2FJAB 2C28A 1YI2S 1LW2A 1JLAA 3K2YA 2HZAA 1FF2A 2HVZA 1FXLA 2F65A 4LVNP 2BE2A 1URNA 4RBVA 3GP9A 2JC1A 2W4CA 4KHMA 2W25A 2CNOB 1U1OA 4JBCA 2VDIA 3LP2A 1WWHA 2DR5A 2P8IA 4LF6J 3HFKA 3CEDA 3G9CA 4DX6A 2OPQA 2HYIB 1SKUB 4QR0A 5T7LB 1OPIA 1Q1KA 4C8NA 1UFKA 1CS4A 1RHUB 2F3JA 3K5OA 4TY8A 1E6YA 1U1QA 3C3LA 1KHWA 1VI7A 1XNRJ 1KOOA 2VHGA 4PR6A 1CJKA 1VFJA 2PEBA 1KLNA 1U49A 2JX2A 5E3PA 1TL3A 2HS3A 1FO1A 4DFKA 4X4QA 4QZVB 5GADI 4N56A 5DLFA 3TAPA 2V4RA 2GQQA 3M2RA 3OLBA 1K0TA 1JLCA 4OYIA 1HWIA 2J7WA 4DOZA 1WI8A 3J80U 4UZBA 5ETRA 1TQLA 4YB6A 1NJXA 2MTLA 3DOMA 3V81B 2F4VJ 5KG2A 3BPDA 4FBTA 1GTEA 4F36A 2Z8QA 3I9ZA 3RW7A 2QFIA 3WQPA 3U02A 4IQXA 4K2JA 3QRRA 3OXGA 4HHJA 3MPVA 1OYDA 2G1DA 2FHOB 3QPIA 1O8BA 4JUZA 2RU9A 3RAXA 4DV3J 5CZXA 3TYTA 4D3GA 2YNIA 4KR0B 1HWLA 1Q78A 3OTOF 4N7TA 3DXBA 4ECTA 1LV5A 4OI6A 4CI0B 4ETZA 2MKIA 4IH5A 2RRAA 3CT9A 3OR1B 4IYQA 4DR1J 4NCAA 4ZPAA 1C4AA 3JSBA 4DR3J 2JRSA 1EB0A 2ZM6F 1G2EA 2CQIA 4IR1A 1PKUA 1Q86T 1FJCA 1HNIB 4B9VA 1M5OC 2YQ0A 2PMZD 4J9QA 3FFIB 1L3TA 3T41A 4CM2A 3BH7B 2HMIB 2ZH4A 2CJAA 5D4PA 1Y5IB 3PV8A 2DHAA 2HHXA 1U7LA 4RUHA 1CQNA 1B7YB 3NGDA 2XZTB 2G1HA 2X3GA 3W3SA 2BYCA 3M8SA 4OHZA 3CMQA 5KG4A 1KTVA 2DD8S 3ENQA 4DV2F 1XIQA 4Y3CA 1T9UA 2MLXA 4UTGA 1VLYA 2GJIA 1VQKS 3G6ES 2VJUA 1FWPA 1W2BR 3PX4A 2RILA 2ASJA 2DCLA 2IM3A 2DEIA 4R5PB 2VPYB 3G4SS 4JV5J 1JLBA 2ZNZA 5IQQA 2HEKA 1N88A 1C4CA 2Y1RI 3MAHA 1S1WA 2QA4S 1KQKA 3C2PA 1F5CA 4EUVA 5IT0A 4KBIA 2PEHA 1X0PA 3X1LB 4DXLA 3CXCR 3CCVS 3R27A 1B0PA 4Y28C 5L46A 5DDOC 2VU5A 2L41A 3V6KA 1FXRA 2E7VA 1B3TA 2ZJQQ 5KT6A 1HL6A 1DLOB 2GC8A 3O5TB 1HBNB 2MQOA 1LKZA 1UCNA 1AFIA 2UVRA 3C66A 5D0EA 3CCUS 2ZOMA 3TUZC 1SL2A 1UJ6A 3GG1A 3Q8RB 1WHWA 1XBWA 1IQZA 1T9VA 4ENOA 3B4DA 3CDEA 5D3GA 1SCJB 4DLEA 3PTWA 5SUHA 3CC2S 2JEGA 2C3YA 3SSQA 2XI2A 1FFGB 1ZS6A 4CYUB 3GYXB 4NCBA 1JLGA 4O3NA 1S6UA 4P74A 2BA9A 2R2SA 4OI2A 3TO8A 1FRMA 3G2XA 1TFYA 1NU4A 3TP2A 4W98A 1HI0P 2DK2A 2KVIA 4LFAF 2ZKUA 2XYGB 3BR9A 3RR7A 1YBTA 3PIOQ 3HT0A 4YS2A 3EDRB 4WFXA 3DLLQ 3HF5A 1YX2A 4E2FB 1U1LA 3NCPA 4F67A 4CLWA 5F8JA 1IBMJ 4GC6A 3GU0A 2BJ1A 3TA0A 3JQJA 3MM9B 2Q1LA 2C2OB 1FHTA 3WC2A 4NLYA 3V5RA 4LF5J 2P2CB 1S0MA 2R8KA 1NK7A 2IJRA 2VC1A 2BKNA 4Q0BA 3D1HA 1NH8A 1F5AA 2JWNA 4ID8A 1ITPA 3MD3A 1N6QB 1CJVA 5KFOA 1JLEA 2VPZB 5ETQA 3QRPA 5D6GA 5L38A 3TAMA 1U0SA 4TVAB 4RPFA 3T9ZA 4C6AA 1T7PA 1ZTWA 3BBFA 2APOA 2XHCA 3DI6B 5KFNA 3D0IE 3RB3A 1JNRB 4M8LA 3MEGA 1SV5B 1RUSA 4LR9A 2BJ3A 1EJ7L 1TUWA 2MZ1A 1M1HA 4USIA 2YH1A 1DTQB 2MB0B 3KLHB 1UVIA 1KRPA 2O66A 5HVFA 1HYSA 1B0TA 1WSVA 1NHVA 1DARA 2QSWA 2V63A 4OHYA 4DV0J 2ZZMA 3A8KA 2K1RA 4DEZA 2KXHA 1S79A 2GO8A 1SL1A 2B4PA 4ZPDA 3TOQA 1O51A 4P71A 1FX4A 3CMAS 3HJVA 2WSFC 4WKRA 3T1YJ 2KN4A 3DFEA 2GIQA 1CQMA 2MKHA 4U8YA 2W4PA 1P1LA 1RAGB 2DB1A 2DNQA 4YHHF 2HGLA 1T05B 3A8EA 1AA1B 5D78A 3TUIC 4PQAA 4TU9A 2M0GB 4OYBA 4WXOA 4JI4F 1K0VA 1RTDB 1C0UA 1UZHA 2EFGA 3MEDA 2F5GA 2GGPB 1JXLA 3MOJB 1EETB 1H38A 3S8SA 5HLFB 4OZLA 3IRWP 2M9KA 1DQ8A 4WJBA 2IDLA 2QYGA 1IBKF 4FXWA 2H9ZA 3ZNJ1 3MGJA 2W24A 1RT2B 1UWBA 4ZK7M 3KHGA 2GAGC 1GFWB 1RTZA 4GKKJ 4ECZA 1YWXA 5HO4A 4RNFA 2XCAA 4EK2A 3S1TA 2IVFB 4F0HA 2XHWA 3GSDA 4IG3B 5GMDA 2MZQA 2JEIA 4NXNJ 2CYYA 5HROA 3ADAC 1JK9B 3MEKA 4NE9C 1R7IA 3KUGA 3QNWB 3B82A 3IR5B 5DO2A 2HQ3A 4WK1A 3CDAA 4J9MA 5F9NA 3I32A 4MIAA 3UD5A 4X62F 1EARA 2J7UA 4KGMA 4XAKA 1TTHB 4X64F 4MTPA 1Q0NA 1MROA 1IXKA 5JVHQ 1WD6A 5ITHA 1HNXJ 3SFUA 2MLZA 1P27B 3THPA 1HQEB 2CJYB 5E33A 1BWEA 3PJWA 5C42A 2FGCA 1Y11A 3VQSA 2WBRA 2DGOA 3TVZA 1QSYA 2A0FB 3PM9A 3VGSA 3TJAA 2WBMA 1ZZFA 4G1IA 4DX8H 1Y10A 2GIRA 1WORA 1RISA 2M52A 2OEMA 1N52B 3HD2A 4FF4A 1KNZA 1UL3A 2CZ4A 4C3LA 4JOUA 3J7YI 2AW0A 1BQNB 2MKJA 3M2RB 1X9MA 1I94F 3EZUA 1RKIA 3RZAA 2HURA 4LFCJ 4AUKA 4DHVA 4DQRA 3OL8A 1S59A 2D3O1 5GAHI 3IRXA 2MPUA 5E41A 1FK9B 4LF8F 1SJRA 3PYGA 3AODA 4LR8A 2A18A 1N34J 4OYOA 4L73A 5IV4A 3ITHB 4DFMA 2U1AA 1H72C 3ENVA 4O4RA 4F3QA 3GJQB 3V6HA 3M8PA 3C46A 2YNIB 2D9OA 3L95X 1SI9A 5A8WA 4TQSA 1DJ0A 4J7CA 4OI3A 3ULHA 5DZ6A 1H6KX 1I3OB 3PG9A 5HMWA 4B17A 4B02A 2COLA 3BO4A 5KT3A 2IRUA 2ZZTA 3FSXA 2O5DA 1L3VA 1NKCA 4M95A 4MIWA 3MHYA 4URQU 3ZXWA 1VC5A 1NKBA 1CJTA 3DNCA 5A2QY 5LMUF 4H4KA 3W9HA 2UU9F 1PILA 3E8OA 1VRTB 4R0EA 2PN6A 2E9RX 3U1MA 4QBUA 3H0PA 3UVJA 4CT8A 5FLXU 3J7AN 5EGYA 4PAAA 1QE1A 1GQEA 5EWFA 4DU7A 2KU7A 2LU2A 1KS2A 2OFGX 2MZSA 2VJVA 2R8GA 2YPYA 1FRIA 3CSKA 4YR0A 1NK8A 3BSCA 1BWVA 3D9BA 1GT8A 4Z37A 3HSGA 1U02A 3MPYA 2E5GA 1VQNS 2KYZA 3BBCA 3HX9A 4LREA 2HHSA 4Q2MA 3R1LA 8RUCA 2CNNB 2F9DA 4C3KA 4DV4F 5GVQA 3POTA 2ASLA 3UQSA 4OV6A 3CJKB 5AT1B 3PKYA 1JLBB 4NLRA 1SKRA 1JJCB 5LL6d 1TAQA 1FESA 2DYAA 3K5LA 3RBEA 2DGXA 3Q24A 4JI0F 3OFEA 1GNKA 4WFAQ 1YG0A 2B9XA 1WEZA 4WFNQ 5HJYA 2H65B 3SCJE 1DAXA 1TP7A 3KG1A 2FLOA 4H4MB 3IFEA 3L7UA 3FZBA 1S0NA 1VQ4S 2ALYB 3VAKA 2Q6BA 1I1GA 2XO7A 3HJFA 3HVTA 4ILMA 1EX8A 5KFQA 3SDEB 4NCGB 3SCIE 2MY7A 3FBFA 3SV3A 4L75A 4A8FA 2RF2A 4DQPA 4P9SA 2AYMA 3W2WA 1Q8KA 1N0UA 1Q8LA 2EKNA 2G0IA 2A2CA 2O67A 3D0GE 1VQ5S 3MMAA 2Z2LA 3HK2A 4JI5F 1RU1A 2JFDA 1XERA 4A8MP 4F2RA 1TR0A 2QE5A 4TYBA 2BJDA 2LQ5A 3DC2A 5J2PB 3DDNA 2HQGA 4GKJJ 4OYMA 2GVDB 2OGUA 5K20B 1NNDA 1EKRA 4NEYA 1LEOA 1BE4A 4EBDA 1P9YA 3IR7B 3IO1A 4CP5A 1LW0A 3BGRA 3IS9B 3CC7S 4C11B 1B0VA 2ALZA 4WWSA 3JTOA 3D6FB 4IFYA 3FSIA 5KOXA 5IS2A 5AE2A 3OV7A 1UA0A 4C8YA 1UEUA 1RTIB 3PW0A 3N4WA 1HHTP 2RQCA 3CCZA 4GVLA 2WRMA 5CCLA 2HVDA 5LJ3Y 1RAEB 2IM1A 3AAWB 5HMZA 5D0RA 2DXDA 2CQ3A 4I2PB 5KFLA 3RG6A 2IY5B 2BJ9A 1RWNB 5E3CA 2UUBJ 1VCTA 3C6UA 1D8YA 3Q0AA 1WDTA 1HD0A 3QZ7A 3IG1B 2VQEF 2RB7A 1Y9OA 2CQGA 1HPZA 3NOGA 3BPSP 3UDCA 2NS1B 2ROGA 4K4ZA 3OFFA 4Q0BB 2DHSA 2V50A 3BV8A 1C2PA 1U2RA 5KFFA 3V6DB 3PR5B 3J81Y 3KTQA 1KVKA 2MMYA 4P2MA 1CJVB 1SUQB 3ZZZA 1YITS 1VC0A 2AP6A 2CG4A 1YJRA 1SQEA 1JB0C 4FVCA 2H5JB 4WP3A 3JXOA 4PG5A 2BOPA 1CJUB 4L6V3 3IC1A 2HS4A 4YN3B 2UUCJ 2LQJA 3HD1A 2A2DA 4I6WA 5KFKA 5F8LA 4QIWD 4QYZK 4I56A 4OX7A 4F0KA 3BN7A 4EEYA 1MWYA 5DQGA 3R5BA 2O1PA 5I3PA 4G1PA 1FE0A 2KT2A 3OQ2A 3DRRA 5T41A 3I56S 4QU7A 3TQEA 1MMNA 3SBMA 4HH0A 4ZIVA 4CH7A 1NM2A 1JQGA 2CIMA 2V2VA 3R7BB 2R9LA 4DV5F 3D66A 4C0HA 4O4GA 3I0RA 2MHNA 3D7SB 2ZH5A 4B3TJ 2D3ZA 3UD3P 3HCXA 9ATCB 2VIHA 1N0VC 1TMMA 3DRSA 2DY1A 1UVLA 3DXSX 2DNRA 2R42A 3JAMU 3I0SA 2G0CA 3H59A 2IBKA 5KAKA 5A8KB 2VG7B 2MZRA 3NWGA 1FDNA 1PGZA 4WFZA 4X4PA 1H74A 1SL0A 3MECA 2AYGA 2JSXA 5BYSA 3BS9A 2ZBQA 3MEEB 5GAGI 3UW1A 1S7HA 4L3KA 2NUHA 1QM9A 3I55S 1WOPA 4ED6A 2LU1A 1FI4A 4DUTA 3U7JA 4LF7F 4FNHA 3B6BA 2G4BA 2HFSA 1S9EA 5IXUA 2BW7A 3BYRA 2I0XA 4J9PA 3JSRA 3HFVA 4LSZB 1RHJB 4KO0B 3CJQA 4URGA 5KG0A 3AOCA 1O6XA 4P75A 3RAMA 2VF3A 5LXRA 3MM5B 2HNYA 3CCJS 1H7WA 5KT7A 3ZTRA 3ONQA 4ZPBA 4RNOA 2XSFA 4F4AA 4FYDA 1SXLA 1DQAA 1FA0A 2HBYB 1S72S 3NKYA 1RYRA 5E3QA 4FYWB 5HROB 2YTCA 2R7SA 4IO9Q 1TKTA 3KLFA 4OFZA 3G82A 2ASDA 4PKDB 1H98A 2LKZA 3QYYA 1N5YB 1IM6A 2J9EA 3M32A 4RLEA 2Z30B 4XK8C 4ZVRB 2RH3A 2YY3A 4NMXA 4ED4A 3W5XA 3LANA 2CNKB 1RWPB 3SCKE 3VTIA 1YRTA 4FP9A 1BUXA 4MKBA 1BC6A 3D3CJ 2CQHA 2C2DA 2M8HA 4MKAA 5C42B 4E0DA 3AHPA 4RWXA 2HHWA 2P9CA 2XMTA 3PJXA 1YHQS 3OD2A 4WFBQ 1TK0A 4TXSA 3G6YA 1A7GE 2ZWPA 3M30A 3V2UC 1D8ZA 4DCOB 5K5MA 2E9TA 2MEWA 4NRUA 2VFTA 2HNDA 3CUNA 1PIEA 3W64A 2ZKTA 4ZVQB 1X0FA 3J7Z5 4UZCA 1QY7A 5LJ5Y 1QAJA 3C14B 2K8GA 3QSIA 5BYQA 4ZITA 4IRCA 4NXMJ 2BJ7A 1RB0A 1T9WA 2FB0A 2FVQA 2EFQA 1M5PC 1BMQB 3G6VA 3MM6B 4DJBA 4CLSA 4DR2J 4DU8A 4NASA 2R7WA 4X4SA 1FRLA 3D67A 1RT5A 3SCLE 4RW8B 3HHLC 1M5KC 1KQSR 2KO1A 2RNEA 4LSLA 3F44A 2PA3A 3GCXP 1OSCA 2DH8A 2ZBPA 2RS2A 4DV7F 3QIPB 5A8WB 4Q44A 4NPOA 3C16B 2OP5A 1S49A 4NLXA 4FXVA 4RBTA 3QBCA 4EMDA 5F3TA 3N01A 5IT4A 2HHHJ 3AY0A 1CPZA 3OPKA 4TQRA 2XMAA 3TW0A 5D4NA 2NR0A 3BYPA 4TYAA 2FJWA 2J0XA 4O0NA 1NPKA 1WACA 4J9SA 2YXLA 1XMOJ 1IBCB 3HLUA 3D4JA 3A3PB 2WONA 3CCQS 1CJTB 2B8QA 1JLQA 4YB1P 2GA7A 1YZ7A 1S5ZA 2DRAA 2HQCA 3DU6A 4A4JA 2ROEA 1YJ9S 2EBEA 1GH8A 2F8MA 2QN6B 2E66A 3BGFA 2GNKA 5KFBA 3QT7A 5L8RC 1F0XA 2HHUA 3NNCA 2IFXA 4LR7A 2AYBA 4PXDA 5CCMA 1YQHA 5J1EA 1PAEX 1R8CA 2FD2A 1OY6A 1WG5A 3DDIA 2HBZB 1WUUA 4YMEA 1C0TB 2CVEA 2W01A 5ETMA 1XEZA 4AXJA 3KWMA 4NI2B 1YJUA 3P5TL 2KHCA 2QL5B 1U6FA 1VHFA 1X5SA 3OJUA 5EDWA 3A12A 2WVEA 2X51A 3AD7C 2ZDPA 1S76D 3H2UB 4K4UA 1L3SA 1IKWA 4ECXA 3MR5A 3EPIA 4LF1A 2W2NP 3RRKA 2BM1A 4RW6B 2WVBA 4JI1F 1QTNB 1VRQC 2W9CA 2UV8A 2NYIA 2IVMA 3DOKB 1S6PA 2DT9A 4UUWA 2YKNB 3IXQA 3ISND 3MMCA 3HVTB 1ZPVA 4GVBB 2KG1A 4K2XA 3EJMA 1NDLA 3M8QB 1U0HA 1FFWB 3UR3C 5CHCB 1HR0J 3JSMB 4ETXA 3AA9A 2FC9A 3W2WB 2OSQA 2VB6A 3BQ1A 4ECSA 2CFXA 2J0WA 1QD1A 3MMAB 1EIYB 2F4FA 2FGOA 4DR7J 1X4FA 4OIXA 4DR6F 3E01B 3GSIA 3TZWA 3EGZA 4X4OA 3VF0B 2VQFF 3NWRA 3U1LA 2PI5A 1Q16B 2ZVIA 3H5UA 3WHIA 4PZVA 1AROP 1QSSA 1S1UA 2KL8A 4P2XA 2B7CB 3W60A 2LQBA 3CO0P 1ACMB 3WIUA 5IM0B 3DLJA 1OQ3A 4RR5A 3OTCA 2GO9A 1VJWA 2E44A 1QTMA 3O44A 1FJGJ 3BGRB 5I3QA 2MGZB 4ZLLA 1VJQA 1UVJA 3WX4A 4IFYB 4MJKA 1X4BA 2BANB 5EN1A 3GTYX 2NSCA 3HHLB 1S77D 4DPOA 3B8HA 2DGWA 1ZM9A 4PG8A 1JJ2R 4ITSA 1MWQA 1GEHA 3OR2A 4NLVA 3CIZA 2LDIA 2JHEA 2NXEA 2DEJA 1RXOB 4RX6A 3N6LA 3ILLA 5IWAF 3FRYA 5HP1A 3GFXA 5DS7A 4WKYA 3PO4A 3HVRA 1HA1A 5B0BA 2JEFA 2BABA 2WVFA 1SB6A 2C22A 1WHYA 2V2ZA 2MKCA 2DHHA 4U9RA 3C6UB 1WDDA 4DG1A 4BC7A 2CZ9A 5KFSA 2GAHC 3FBBA 4DZ6A 3G71S 4M63A 3ILIA 2AT1B 3W66A 5A0YB 4WBFA 4ZOSA 2V4JA 1PG5B 4IOBA 2R7TA 2DGUA 1YSJA 4DPWA 2P6SA 1RU2A 2G2OA 1SH0A 1VQ6S 1HBUB 1WTFA 1Q8IA 2CJQA 2IRXA 1HFEL 2V4QA 4EYIB 4I7FA 4ZVFA 5F0UA 4KPCA 4J9NA 1EP4A 5HBMA 4ICLB 5CD4A 3ETOA 3FBCA 1H2TZ 1DZ5A 4PG4A 3LP1B 2F8HA 3SQGB 3EGNA 3ZZ0A 2HNZB 3NGUA 4FNIA 3AJ2A 1KWMA 2KZMA 1YJ7A 3MPDA 2DJWA 2AX0A 4U67Q 1MU2A 3DRRB 1T3OA 3QAUA 1UEKA 2OUGA 2MSSA 1HARA 5LMNJ 3MM8A 4PWDB 2BKPA 2YBVA 3B4MA 1NH7A 4O4GB 2B4VA 1VK8A 4B3SJ 2DKOB 5AE3A 3NS5A 4Y2AA 2Y8WA 1XJWB 5CYQA 2UXDJ 2GMLA 2IJFA 4UQTA 5F8GA 2XS5A 2LCWA 5HMYA 4KHPF 2I38A 4HT7A 2UP1A 1WC6A 1M1KT 4ZVSB 2FDNA 2QG9B 4ZS6A 4HDHA 3CD5A 4DR4F 3TAQA 4JI6J 2OD4A 1YLXA 2AZ3A 5H9EK 3QSYB 2VODA 1U45A 2QL7B 2MZTA 2N3LA 1XN9A 2C2KB 1S9EB 4C8OA 1IKVB 3VAHA 4ID5A 4DFJA 4KJIA 3F73A 3MAAB 4ZA1A 2K3KA 2V67A 3EM1A 4YDXA 3H20A 2X1AA 1U6BA 4ED8A 1X7VA 1YVFA 1CLFA 2XM3A 4USMA 1S99A 1NHUA 4OYPA 5KFIA 2E5LJ 2VICA 4LRFA 4ES2A 3GCWP 2WHOA 4L74A 2QLWA 3KFWX 4HT5A 4ED0A 2KHDA 4CLFA 1Q82T 3BKTA 3OSNA 3DRPA 1KN6A 3DGPB 5AXKA 3UI3A 2RQ4A 3G82B 1K1SA 3JB9k 4HACA 2ADBA 2DHGA 1CC7A 1QAIA 2XWYA 1HNZF 1WEYA 2HKEA 3KG0A 2B8PA 1ZAVA 1WHVA 5DRKA 1X31C 4EZ9A 3R5JB 5AJ3J 1WKLA 2XSJA 2RMLA 4OJGA 4DX7A 3VZIA 2JDJA 5CYMB 4EU0A 5I3UB 2EWHA 3VGUA 3D5MA 2FJXA 1CULB 3BKFA 2XG8A 2HBRB 4NYZA 1Q95G 3IM9A 3LGHA 4FF2A 2F1FA 1WNEA 4XPCA 2RDDA 3ZZUA 3EYZA 3DOLA 2QTWA 2GMJA 1TKDA 1T03A 1KEKA 4Y2CA 2XS2A 4MIBA 3R5CA 3HFZB 1NBEB 4ZCIA 4LUBA 4M5DA 3ZZTA 1T3NA 3N6MA 5A8RA 3ISNC 1C1BB 3HDSA 3EICA 2R8IA 4MKVA 4LIRA 2U2FA 2ACMA 3FKBA 2JFKA 1KR4A 5DM7Q 2EFVA 4LFBJ 1X9SA 5AXNA 1R0CB 4HHHA 4U95A 4H54A 3G86A 5B7WA 3R6LB 2VONA 2LEBA 5BR8J 4OJ1A 2V8DA 3TEGA 1T95A 1QDUB 2NPIA 3M6WA 2Y8YA 2YNFB 3OL6A 3OXFA 4IFVA 1E6VA 3TR5A 4CO0A 4ZVEA 2R7QA 4PPZA 1V3RA 2JVRA 2LQ8A 2OHDA 2NQPA 5THWA 4LQ3A 1MWZA 4BWMA 2JC0A 1PYSB 1NKEA 3NAHA 3M2UB 3EUNA 2V2QA 2JLFA 4LRAA 2LMIA 4QWBA 5EX3A 4Q8EA 3OTBA 5H9FK 1B7FA 5DG9A 4RUCA 3A4TA 1HI8A 4YFUA 1JKHA 3R5AA 1XNQF 2QLJB 1VLOA 2QT7A 4FYXB 4WZMA 2XMKA 3PEHA 1ELOA 2PI4A 2BZ2A 3KK3A 5J2NA 1T9XA 1G3OA 2W2OP 1RCXB 2MQ8A 2KRRA 3I4PA 4B3RJ 2B0GA 3CGIA 4OZ2A 5GAEU 1T02A 2HIQA 1NJYA 2UUWA 1U6ZA 3ZZOA 4USKA 4G1QA 2EK1A 4X66F 2AKWB 2KVQE 4TLRA 2HW3A 4NYOA 4XIUA 1JLFB 3EVWA 2VBWA 2UXBF 4DV6F 2N4DA 4KYZA 4BWJA 2CQ0A 2W2MP 1G1XA 1AB8A 1FNMA 3BREA 3MFIA 1YJVA 2E5HA 2B6AB 3I5AA 3HXMA 4C2MA 1NJZA 2ZE2B 1QVGR 3WC0A 4QQBA 2CXEA 4WYLA 3FUYA 2VG6A 2ZEJA 1BQMB 2KFYA 4PYDA 3I5BA 4Y2IA 2CKWA 3LALA 2GS8A 2W9BA 5DDPC 3GIKA 2QRRA 3KYLA 4WF9Q 5E7OB 4ZIWA 1AYEA 1N32F 1WG4A 1F2GA 2QL9B 1X4DA 1RADB 5C25B 3J81j 3QJLA 2HAFA 4M1KA 3LWMA 4LF4J 2FJEB 1S1TB 4DI6A 4CTAA 2X1FA 1LWEB 4M5JA 4NLUA 4HEA9 4DPXA 4W4MA 3QT5A 5AE1A 1Z4UA 1D9DA 5E5NA 5GADU 1A0OB 5F3ZA 2K7JA 2ATCB 1NB2A 4JYAF 1OS5A 2FUG9 3PFOA 3BB5A 4DV1J 2VFVA 5JVGQ 4R8UA 1Q8BA 3FQKA 4H4OB 2R2RA 4KT0C 2NZ4A 4W90B 1ICEB 4R0JA 4EI2A 1IN0A 2SXLA 3WDOA 4M5KA 2GFFA 2MQQA 2X1GA 2MXYA 5ETKA 1F2HA 1ZTTA 1F3FA 4DR5J 3M6XA 5JXSA 2ASYA 2OMLA 5D15A 1JIHA 1S0OA 5KFDA 1R0AA 1QSLA 2I5JA 1LWXA 1VRUA 2CRLA 1REVB 4ZHRB 3EWGA 3CDBA 3FCWA 4HR2A 2YX1A 4PUOB 4NX9A 2VASA 2FY8A 4DQIA 1HMVA 3KLIA 4DSJA 1DQ9A 3CW2C 1TK5A 3DGVA 4ZLNA 2D3OR 2V8VA 2XCPA 1CVJA 1K73T 1X9WA 2GX8A 2KT3A 4C48A 1H2UX 1UPPA 4DLGA 4O3RA 2FIUA 4HYKA 2RKIB 2MQMA 3DU5A 1OQ6A 5CQGA 4OX9J 1PO6A 2A10A 3PYDA 1EQMA 3FNNA 3AOAA 1N4LA 3GV8B 1R31A 4JI8J 2ZITA 1UP1A 1VQPS 3OR2B 2OMOA 4QWCA 1O5JA 4WE1A 4ZVPB 5HANA 3GONA 5B0CA 3L09A 1YJWS 2R7UA 4X65F 4CZCA 2KM8B 4OYZA 3RB4A 4LF9F 3M8RA 3CCMS 4R25A 2CJXB 2I2YA 3LW5C 3DLKA 3LF0A 2WOMB 5C24B 2GMHA 3TRGA 1VK3A 1HNWJ 5KG7A 3W5YA 3MTKA 5HN0A 3RJMB 3KUEA 2IC3A 4RW9B 4ZLJA 2HHVA 2HGMA 3SSRA 1RYSA 1OPZA 3P8BB 4RUBA 1N36J 1UVMA 2BQUA 1R89A 2VKZG 4NOHA 2V4JB 3BEGB 1I5OB 4DN0A 2RHSB 1HI1A 2B5JB 2R8HA 3VAGA 1S0VA 1GXUA 4QR2A 2BW2A 4AL7A 4TKTA 3R5GA 4RW7A 4TN2A 4JI2J 1VHIA 1JXEA 5MLCV 1XWLA 4YUDA 2E29A 2IA6A 3QO9B 1HQUB 2RQKA 4IDKB 2OELA 5I42B 3L4BC 1QLNA 3U1NA 4I7FB 4K0KF 1NK4A 1J5EF 1SQGA 2VFSA 4LRDA 5BXIA 1S9GA 1PJ5A 5GAEI 1DURA 2I9SA 3DHXA 3GJSB 3R6GB 3ZC4A 1Y5LB 4IRKA 1SIWB 5ETPA 3QWPA 4B3OA 3ET6B 1RT4B 3KJVB 3K89A 1FXDA 1Z2LA 5IZHA 2EG2A 4M5NA 1MU2B 3CIMA 4IO1A 3OHAA 4DQSA 2VBXA 4CO5A 4MK8A 3HHKA 4U96A 4B9LA 2QV6A 3MM8B 1TV6B 3VGVA 2D41A 5G0RA 4QWEA 2NLWA 2XGQA 3BM7A 1KHVA 3RRGA 1H7XA 2K3IA 1M1GA 2G9OA 2HSEB 3M1VB 3TNVA 3VZHA 1TL7B 4A8XA 2C2NA 5CYQB 1S57A 5B0AA 1XR6A 3OHBA 4MFBA 1A6LA 3H7HB 3E2EA 4I67A 1BXNA 1HNVA 3Q8VA 2J6UA 3H2LA 1NSKL 1VQ7S 2M3DA 2HVIA 3P6YC 1HHQA 4ZVHA 1YKWA 2CQ1A 2IHR1 1FE4A 2UUTA 1U4BA 3NMAA 3KUHA 2FJVA 4ECYA 1RAFB 3AH6A 4KY3A 4QW9A 2VL1A 2MZJA 4ID5B 2CQ4A 4XPEA 4Y65A 1J5OA 1TFWA 2ILZA 3IBWA 5L1KA 2XMJA 4NWBA 4LSNA 2CPYA 4YR2A 4M94A 4O3OA 1BD6A 1UJ5A 1VBZA 1U2FA 4DWIA 2NYHA 2Z2ZA 4USWA 4KKOA 5KT2A 4K7QA 1OY9A 4OQJA 4F8RA 4QPTA 1M5VC 1YRXA 4AFFA 2DRDA 2KJVA 2NREA 4UF4A 2YNGB 4BLGA 1RKJA 1QAXA 2DR7A 4C0OC 5G4DA 4OZ1A 3F41A 3ZNUA 2IMOA 3OUYA 3DMJA 3TEHB 3CWJA 2A3JA 4YQWA 2QMWA 1ZZNA 3LH2S 4B9TA 2UXCJ 3MF5A 2XMUA 5K8PA 3FEXB 3A13A 4ILRA 4B08A 3KHHA 2UVUA 2OPRB 1FX2A 1FKOA 3OTOJ 1BHNA 3DYAA 2DIUA 5KT5A 3C15A 2FVCA 3IAM9 2OPPA 3PHEA 3DOLB 1ZPWX 2XI3A 1T03B 4U7UK 4RO0A 2EFNA 2VV5A 1NK0A 4M5DB 9RUBA 5D0GA 4OLOA 2MDAA 1UWAA 4WIQA 3W2VA 2V9KA 2JH3A 2X1BA 4ZJLA 3ILOA 3HSJA 1TKZA 1JMTA 1VBXA 4K5RA 7FDRA 3RB0A 1XR5A 4JI7F 2XMWA 4HVZA 2EPIA 1SC3B 4KV8A 4F4KA 2E1RA 4QIFA 3HI9A 1PBUA 1EAYC 1RT6A 2HWHA 3T5JA 4O44A 3G96A 5CA5A 4DZDA 1RTJA 4DV2J 4DS5A 4EFAC 4MAKA 1EQ0A 3SI8A 2LEAA 4J90A 4DUYF 1WC3A 2EBGA 4CLZA 4K4WA 1JKHB 1S97A 4NLSA 1S6QA 1RT7A 1X5PA 2C3PA 2BMBA 2IA0A 4FPIA 1CEZA 4RW4B 2BOAA 2AGPA 3S6EA 2D1CA 4C7QA 4ZPWR 3MOZA 3NG8A 1RDRA 4TU8A 2N4CA 1SPBP 3IWLA 3R97A 2ZH8A 3M05A 1AZSA 2FZCB 2ZVSA 3PRVA 1WEXA 5LMNF 3VWSA 2BXJA 1X4CA 1NDPA 2IAJB 2VG5A 2YKOA 3GB0A 1NB7A 3KOAA 1XMBA 3FC9A 1LK7A 2RIJA 4I2QB 2AD9A 2XY5A 3QFWA 4DL6A 2DR8A 4MH8A 3GIJA 2VG6B 4DPUA 3T1HF 3H4BA 3MMJA 1SJQA 2XLKA 2R7XA 4N77A 5K14B 3BGOP 5KFHA 3CJSA 2BRKA 5T7LA 4RJVA 3A3NB 3BN4A 2ZH7A 3DLHA 4V19X 1Q7LB 2D74B 4USUA 2N7YA 3GIMA 1TL5A 5DG7A 5ETOA 2R7RA 4RNHA 1RP5A 1Q53A 5EX0A 3N6NA 5SZTA 2YKMB 2H48B 1NEEA 2I1RA 1WSRA 3LP0B 4HHUA 2CZVC 4LFAJ 2XLJA 1MG7A 3J7YU 3MTJA 1PJ6A 4KFBB 2EC2A 4PWWA 1X60A 4TU7A 3Q8PB 4K4YA 2FJDB 4JI3J 2OSRA 5A2QU 5JJBA 3V81A 7FD1A 5GAHU 1T9YA 2RVJA 2E5JA 3MCNA 2M4MA 4Y34A 1U25A 2GJFA 3FMBA 3GFYA 2OH2A 4ZCMA 3C8YA 3OTDA 1FD2A 1GAOA 2KFNA 1HMVB 3KLIB 1IBLF 2ZOFA 1TAUA 2NXUA 2CPJA 2MHEA 3M4XA 3DLGA 4XDCA 1DY3A 1RGVA 1R8PA 1MMLA 2Y1JA 2AZ1A 2V6AA 4KGVB 3B54A 2AF6A 2H54B 3T1AA 1U8WA 4KAIA 2HK3A 5B0EA 5FDLA 1FTRA 3CJTA 2ZC3A 2WW4A 3D28A 2DITA 2YKAA 2HQFA 2RUGA 2P5VA 2RJZA 3RRHA 3CJ4A 4C8MA 1YRUA 4X4VA 1Y3KA 4ALZA 2B9WA 3FSYA 4F4ZA 3CULA 1N5TA 1L3KA 3FFIA 1R6YA 5F8MA 4YOEA 1X4EA 4D3HA 2V8GA 2FHJD 2AU0A 1DRZA 3AD9C 2AX1A 5IT9Y 4TNOA 2WCXA 1RI7A 2EK6A 3IM8A 3SYZA 3O2IA 1YBUA 1N54B 5JUMA 1MNEA 1UMJA 4UT4A 4A8QA 1H73A 1T94A 1J2VA 2ZUAA 5HSPA 2AYEA 3CCSS 1LWCB 3FEZA 3KKFA 3HKWA 4YHHJ 4RW7B 2FHJA 4F2SA 4CO4A 4P10A 3RU0A 1FKAF 1DTTA 5L1JA 2E1PA 2EFPA 4ELTA 2HVEA 4KIAA 2PO4A 2CQBA 3LAKA 2CPIA 5D4OA 3V4IB 3PR4A 1I51B 2YPZA 2HQDA 3QJJA 3Q2TC 1NAQA 2ZDOA 2C2RA 3OVAA 2Q79A 4B3RF 3AB2B 1FD8A 5KFWA 5IOLA 1IBKJ 3D1OA 2IJNA 4DSIA 4PXCA 4PCQA 4K8RA 4RWWA 3ISZA 1LW2B 1JLAB 4ZVOB 2AGQA 4WTOB 3NP5A 4K5SA 3UO0A 3HHNB 2WSEC 3KDNA 2BE2B 2PFFB 5G0RB 4DUZF 1DLOA 3BGUA 3KJQB 4FBUA 3OL7A 1HBNA 4XTTA 3LP2B 1FNOA 3VAFA 2DHXA 3F56A 5ETTA 5DZ7A 2GIFA 1GX6A 4Q5VA 2O3DA 4UY8T 3LWLA 2DNYA 1M5HA 1NPPA 4K59A 2OPQB 4YY3F 2AJ2A 4FXDA 1KQFB 3EGVA 1HNVB 3CCES 4X62J 3MR3A 2CAJA 3GE9A 3VAIA 4X64J 5HL7Q 1V3ZA 1CS4B 2ZJRQ 1S6OA 1L3UA 2BE7D 4TY8B 2LXUA 3HSZA 1HLWA 2V94A 1E6YB 5ETLA 5EUHA 2G2ZA 4K4TA 3D68A 2I8EA 3J81U 2PE8A 1CJKB 4ZKAA 1SIZA 3EZ5A 4ZPTR 4DL2A 4PEOA 1TL3B 4BC9A 4QCLA 1RTHA 5KFYA 3MCSA 3T5HA 2BBEA 3MR6A 2HHTA 5EWEA 1JLCB 3FZ2A 2OTLS 2KXFA 3L7PA 2A6MA 4ILLA 2Y1IA 1WHXA 2FHMA 4CLPA 1P8GA 2M2BA 1I94J 1V9OA 4RU9A 3VR1A 4ZMMA 2DGSA 3AQOA 2ILYA 2V8HA 3W9JA 3G8QA 3DOMB 4I69A 1SQFA 2OD6A 3OT9A 3KLEA 1MN7A 4OYWA 3TX8A 2VFRA 1RWVB 4M5GA 3M6UA 4DF4A 4LF8J 1LFWA 5H9EJ 4ZN1A 2XNRA 2VBZA 3EX7B 3H2VE 2DXEA 2AJ4A 1XQIA 5J2MA 4O3PA 1QVFR 4J5OA 2G0JA 1RSCA 4OZ3A 4Q2LA 1N6QA 1DFDA 3Q8QB 2HZCA 3JS9A 4U7CA 2WVCA 2V9WA 1L5UA 1XMQF 2NXNA 4P6QA 4DPTA 2VPXB 3CC4S 4NLDA 2DNPA 2HWTA 3DI6A 4JI8F 3IN5A 1X5OA 1SV5A 4C97A 3PW5A 1RAIB 2F8EX 1U1NA 1N33F 1DTQA 5DJBA 4CLTA 1M0SA 4FN5A 3KLHA 4QPXA 2ZH6A 3PW4A 1NMEB 4F4WA 1WTBA 2ZC4A 3BH6B 2ZH2A 2WB4A 5CYJA 4CO3A 5LMUJ 1VISA 2UU9J 1RHQB 4JP8A 2OPSA 4QIEA 2NXCA 2B9YA 1RZMA 4V19J 2AQ4A 1UZDA 5C2GA 2D9PA 1FERA 2UUAF 3N0VA 1NUEA 2CUYA 1J27A 4KV8B 2WVDA 3CPWR 1OJ4A 5KFGA 1B99A 3PX0A 1RABB 1RT6B 5RUBA 3WBZA 4N76A 1IM4A 3O6QA 1T05A 4WP9A 4KGKA 3T5LA 5C7PA 1WI6A 3KXDA 3Q23A
chains in the Genus database with same CATH topology
2CWKA 1W7WA 1UCNA 3VVUA 3BBBA 1BHNA 3MPDA 2DXDA 3EMTA 3EVMA 3EM1A 3Q8YA 1HIYA 1XIQA 1LWXA 3BBCA 1NSQA 4UOFA 3Q83A 3VGSA 1JXVA 3Q8UA 1K44A 3FBBA 4ENOA 3FCWA 4HR2A 4DZ6A 1MN9A 4S0MA 3ZTOA 3ZTPA 3NGRA 3VGVA 3FCVA 3ENAA 1WKJA 2DXFA 3ZTRA 2BX6A 3R9LA 3ELHA 1EHWA 3NGTA 4EK2A 3EE3A 4WBFA 4F4AA 4O0NA 3VVTA 3ETMA 3NGSA 2NCKL 1NPKA 4FKYA 1NHKL 2ZUAA 3BH6B 3VGTA 2BEFA 3EICA 2AZ1A 5CABA 1MN7A 3FKBA 2DYAA 4DI6A 3ZTQA 1LEOA 1S57A 1BE4A 3NGUA 1ZS6A 3B54A 1KDNA 2HURA 2B8QA 3GP9A 4CP5A 1NDCA 1S5ZA 1NDKA 1U8WA 3PJ9A 3Q86A 4UOGA 5CAAA 1VYAA 1B4SA 1S59A 3Q8VA 3G2XA 1PKUA 3PRVA 3EVOA 2DXEA 1NSPA 1XQIA 1NDPA 1NSKL 2HVEA 4C6AA 3DKDA 3EVWA 3FBEA 3L7UA 3ZTSA 2B8PA 4W98A 1NUEA 1NB2A 3BBFA 1HHQA 2AZ3A 1F6TA 3Q89A 4FKXA 1B99A 1HLWA 3BH7B 4KPCA 2DY9A 3FC9A 4F36A 4ANEA 1WKLA 2VU5A 1NCLA 4DUTA 3EJMA 4ANDA 3GPAA 5BXIA 1NDLA 1WKKA 1BUXA 4UOHA 3FBCA 3FBFA 3VGUA 3JS9A 1NLKL 3WX8A 3B6BA 1PAEX 4ANCA 5C7PA 5IOLA 2HVDA 1F3FA 3DDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWK A;  1W7W A;  1UCN A;  3VVU A;  3BBB A;  1BHN A;  3MPD A;  2DXD A;  3EMT A;  3EVM A;  3EM1 A;  3Q8Y A;  1HIY A;  1XIQ A;  1LWX A;  3BBC A;  1NSQ A;  4UOF A;  3Q83 A;  3VGS A;  1JXV A;  3Q8U A;  1K44 A;  3FBB A;  4ENO A;  3FCW A;  4HR2 A;  4DZ6 A;  1MN9 A;  4S0M A;  3ZTO A;  3ZTP A;  3NGR A;  3VGV A;  3FCV A;  3ENA A;  1WKJ A;  2DXF A;  3ZTR A;  2BX6 A;  3R9L A;  3ELH A;  1EHW A;  3NGT A;  4EK2 A;  3EE3 A;  4WBF A;  4F4A A;  4O0N A;  3VVT A;  3ETM A;  3NGS A;  2NCK L;  1NPK A;  4FKY A;  1NHK L;  2ZUA A;  3BH6 B;  3VGT A;  2BEF A;  3EIC A;  2AZ1 A;  5CAB A;  1MN7 A;  3FKB A;  2DYA A;  4DI6 A;  3ZTQ A;  1LEO A;  1S57 A;  1BE4 A;  3NGU A;  1ZS6 A;  3B54 A;  1KDN A;  2HUR A;  2B8Q A;  3GP9 A;  4CP5 A;  1NDC A;  1S5Z A;  1NDK A;  1U8W A;  3PJ9 A;  3Q86 A;  4UOG A;  5CAA A;  1VYA A;  1B4S A;  1S59 A;  3Q8V A;  3G2X A;  1PKU A;  3PRV A;  3EVO A;  2DXE A;  1NSP A;  1XQI A;  1NDP A;  1NSK L;  2HVE A;  4C6A A;  3DKD A;  3EVW A;  3FBE A;  3L7U A;  3ZTS A;  2B8P A;  4W98 A;  1NUE A;  1NB2 A;  3BBF A;  1HHQ A;  2AZ3 A;  1F6T A;  3Q89 A;  4FKX A;  1B99 A;  1HLW A;  3BH7 B;  4KPC A;  2DY9 A;  3FC9 A;  4F36 A;  4ANE A;  1WKL A;  2VU5 A;  1NCL A;  4DUT A;  3EJM A;  4AND A;  3GPA A;  5BXI A;  1NDL A;  1WKK A;  1BUX A;  4UOH A;  3FBC A;  3FBF A;  3VGU A;  3JS9 A;  1NLK L;  3WX8 A;  3B6B A;  1PAE X;  4ANC A;  5C7P A;  5IOL A;  2HVD A;  1F3F A;  3DDI A; 
#chains in the Genus database with same CATH topology
 3TVY A;  5KFE A;  1RTD A;  2C2E A;  5GAG U;  4HLB A;  4DV4 J;  1RT7 B;  1EET A;  4OI0 A;  4PWU A;  2AWZ A;  1S1W B;  5HLF A;  4Y00 A;  2E7W A;  4UUX A;  3PNI A;  3HZG A;  2R3V A;  1KFD A;  4HTJ A;  3BDE A;  5DQH A;  2YWE A;  4P2F A;  4JI0 J;  1C1C A;  2DNH A;  4AL6 A;  4DMZ A;  2FJB B;  4ZCK A;  1RT2 A;  1H2V Z;  2P9G A;  3DLE A;  3WZ0 A;  5ADZ A;  4CRJ A;  3F0N A;  3QJP A;  1FVQ A;  3NBP A;  5D0H A;  4DF8 A;  2VG5 B;  4IG3 A;  5F8I A;  4BHQ A;  3N5F A;  1IKX A;  3FVY A;  4PXB A;  1Q7Y T;  4LF6 F;  1FJ7 A;  1VBY A;  1SJF A;  3EGW B;  3B78 A;  5H9F J;  4JI5 J;  5D3G B;  4W92 B;  2W7O A;  2KJW A;  2FPH X;  3CB4 A;  2N7C A;  1V5V A;  2KKH A;  1T0T V;  4UW2 A;  2J0Q D;  3M7V A;  4DS4 A;  4MK7 A;  1B70 B;  1OY8 A;  1JLG B;  1HQE A;  3ZTP A;  3ENA A;  2DXF A;  3P96 A;  7AT1 B;  1H3D A;  2GQC A;  1XNR F;  4WII A;  3FEY B;  3J7Z T;  1R3N A;  4M5L A;  3ILJ A;  4JV1 A;  4K4S A;  2VOP A;  2KYX A;  5LSR A;  3C6T A;  2EXU A;  3A8I A;  1RJJ A;  4YB7 A;  4LMZ A;  3VAL A;  1F3V A;  3G8S A;  3K5M A;  2HLU A;  2YNH A;  4G6V B;  3P45 B;  4OZJ A;  4HKQ A;  1BQN A;  2R2U A;  3QQC D;  4PAB A;  2F4V F;  4DSF A;  1HWK A;  2FVS A;  2GJ2 A;  1PC4 A;  2ZHO A;  4KTQ A;  2PDA A;  1FK9 A;  2L3M A;  4ECR A;  1RBA A;  2VQE J;  2RDI A;  3D0H E;  1G7C B;  1CG2 A;  5L1L A;  2VKR A;  4V1A k;  1NSQ A;  3MMB A;  4WFY A;  3ITH A;  3KG4 A;  3TVK A;  4DV3 F;  3FDS A;  3MUV P;  5EWG A;  3HKZ D;  1AW0 A;  2UXC F;  3IP0 A;  1ZAX A;  4GMK A;  2JOQ A;  4YR3 A;  3ELH A;  1JLE B;  3DLG B;  3TAM B;  3V4M A;  2W7P A;  2JL9 A;  2DNM A;  4ZP7 A;  1X4G A;  2FHK A;  4Z7Y A;  1D0E A;  1HBO A;  3RBZ A;  3GYG A;  4F3M A;  1TEL A;  4AT1 B;  4TY9 A;  4YP3 A;  4GO7 X;  5FDL B;  4DCJ B;  1RCO B;  1RAO A;  3MEG B;  4DR1 F;  4ED1 A;  1LFP A;  2H1Y A;  4ELV A;  4PG6 A;  4DR3 F;  4CM0 A;  2HG4 A;  3ZTS A;  2L9N A;  4GC7 A;  5L9X A;  3Q22 A;  3LO3 A;  1FWK A;  4ZJO A;  3BO2 A;  3FCH A;  1HYS B;  1VRT A;  4Q7A A;  4P2S A;  3VAM A;  2K1R B;  4HI1 A;  2Q3P A;  1RWM B;  3Q8S B;  3W9I A;  2VUG A;  2E1M C;  3T19 A;  2YWH A;  2ZUG A;  4ZVT B;  3THV A;  3I82 A;  3GQC A;  4ERD A;  2KDO A;  4DV5 J;  1P6T A;  3A1Y G;  2B56 A;  2DTJ A;  4ED2 A;  3R7S B;  2MKY A;  3UNY A;  4NA3 A;  2XO6 A;  2QO3 A;  2F40 A;  4ZN3 A;  2YWF A;  2PC6 A;  3CD0 A;  5DM6 Q;  2MKS A;  3ETM A;  2VD3 A;  5BYR A;  4Z2X A;  4BDP A;  2QEX S;  5HMX A;  1NO8 A;  4H4K C;  3GJR B;  2HFU A;  5L9N A;  3LUY A;  3PW2 A;  4UST A;  3TAR A;  5F9L A;  4KC5 A;  1C0U B;  4JV5 F;  3HVW A;  1PBA A;  2DGV A;  1F5B A;  3MED B;  3THT A;  1FDA A;  4QW8 A;  1FDB A;  3NL0 A;  4IRD A;  1DTT B;  3CJK A;  2ATL A;  3PRB A;  1UA1 A;  3QGH A;  2MKK A;  1NK9 A;  2CG8 A;  3UR0 A;  4LF7 J;  4P7V A;  4AD6 A;  3GFZ A;  2XS7 A;  2CVI A;  2BQR A;  2DY9 A;  2ZHB A;  2QA4 G;  3J7A 1;  5E0O A;  1UWB B;  3GLJ A;  4Y2M A;  4H4M A;  5D4L A;  4Z7C A;  3QRQ A;  2C1E B;  2AHO B;  4I68 A;  4OI4 A;  2J9D A;  3TA1 A;  5A6P A;  1TVR A;  1WG1 A;  3HSD A;  5IV3 A;  3SDE A;  3US5 A;  1JXV A;  4NCG A;  1ZA2 B;  3IGV A;  3PO5 A;  2OKQ A;  2FLN A;  1WKJ A;  2PA8 D;  3CJ8 A;  1U1R A;  1RT3 A;  4OHW A;  4KRW A;  4FZV A;  2CPE A;  2GV1 A;  2PFD A;  2JLG A;  1WEL A;  4DSL A;  1RHM B;  2XYH B;  3QID A;  2AV5 A;  2K06 A;  3BDP A;  3N5B A;  5J2P A;  1MRO B;  2FC8 A;  3R5D A;  4J37 A;  1HW9 A;  3CCL S;  4NLP A;  1S10 A;  2GVD A;  1NSP A;  2Z4P A;  2QJ3 A;  3FBE A;  1VQ9 S;  2LP4 A;  4WTY A;  4IOA Q;  2JJ4 D;  4CH1 A;  3HT3 A;  4CLK A;  2XY7 A;  3TUP A;  3IS9 A;  1RA7 A;  4C11 A;  1U1P A;  2RDJ A;  1PCA A;  2V8P A;  3FRZ A;  1RTH B;  1RTI A;  2MST A;  1D09 B;  4ES3 A;  2B7B B;  4CO2 A;  1KTQ A;  2DR6 A;  2QLB B;  3Q8U A;  3UCZ P;  4K50 A;  2LDY A;  4X4R A;  2DCU B;  3ZTO A;  1IBM F;  3NNA A;  4DL5 A;  5KFR A;  3NCQ A;  2GZO A;  4WU2 A;  4A8S A;  2AJ1 A;  3CJR A;  4EBC A;  4JI3 F;  1KD1 T;  5F8H A;  3ZZP A;  3VVT A;  1YJN S;  3BO3 A;  4I2P A;  3IRX B;  3KHR A;  1HQ2 A;  5KFJ A;  2QLX A;  4LF5 F;  3KLE B;  3IR6 B;  1N8R T;  1KDN A;  3UWT A;  4QWD A;  3IG1 A;  3D2W A;  5CAA A;  3AJD A;  1UVK A;  1JJ4 A;  3QMQ A;  4GRS A;  3PAC A;  3EPG A;  4DN9 A;  3UPF A;  4KSE B;  3AJ1 A;  4A8Y A;  3M8Y A;  5J2M B;  2XTJ P;  3CF5 Q;  1I6J A;  4OZN A;  2QZ8 A;  3V6D A;  3MR7 A;  5FD1 A;  3UCU P;  3M8P B;  1TL4 A;  3O1L A;  2W9A A;  3HPO A;  1SUQ A;  1OO0 B;  3PFE A;  1VQS A;  2K2P A;  3CD7 A;  4DV7 J;  3R8Y A;  5KT4 A;  4FS2 A;  1T9T A;  4YB5 A;  5ETN A;  2IM2 A;  4IR9 A;  4A8O A;  1CJU A;  1HIY A;  1Y0H A;  3J80 Y;  3GIR A;  5EHH A;  3OVS A;  1HKA A;  2RRB A;  4A46 A;  3FCV A;  3MR2 A;  2EVZ A;  2XMV A;  1LOU A;  2WZ1 A;  2HAI A;  2H4W B;  2LXF A;  3K5P A;  4DV0 F;  1SH2 A;  3PDN A;  2BRL A;  2HFN A;  3DN9 A;  3UVJ B;  4CO1 A;  2J5A A;  2CJK A;  2LVW A;  3RAQ A;  1R6V A;  1VIO A;  5ETS A;  2E1C A;  1QE1 B;  2OPS B;  3BR8 A;  2EEY A;  3ZZY A;  4CLU A;  1VS3 A;  1R8H A;  3T1Y F;  2J9C A;  1TK8 A;  3Q2S C;  5J1P A;  5CZV A;  2AGO A;  3GFH A;  4NLG A;  1FRJ A;  2V34 A;  2WSC C;  1S1V A;  1LWF A;  2YVS A;  2N3O A;  4C8K A;  1U2C A;  1RAA B;  5A8K A;  2HWI A;  2GCF A;  2VG7 A;  4PRF A;  3SZ2 A;  4X4U A;  2KZZ A;  3MPW A;  2RRN A;  3OJS A;  3POT B;  3MEE A;  2PMW A;  3QZ8 A;  2HGN A;  1WF2 A;  4CQ1 A;  1OWX A;  2BUN A;  4X4N A;  1PSD A;  1Q5V A;  4RKU C;  4B3M J;  3JQK A;  4IH6 A;  3UN5 A;  1KC8 T;  2HRT A;  1JX4 A;  3IA0 A;  4DL0 C;  4RNN A;  3NS7 B;  3OL9 A;  1IR1 A;  4KO0 A;  4NEZ A;  1ULR A;  2IBO A;  1C1C B;  3I87 A;  4GKK F;  2C3M A;  1VGY A;  1FKP A;  1S9F A;  3MM5 A;  4JI1 J;  2A1B A;  3DLE B;  2UVW A;  5DLG A;  2F9J A;  3QLH A;  2MY8 A;  2AEJ A;  5F8N A;  3UNG C;  3NRB A;  4NXN F;  3KMS A;  2DPI A;  2N82 B;  1MMD A;  5KTQ A;  3JTN A;  3NBP B;  4LRC A;  2RF2 B;  4TLQ A;  4JB8 B;  3MDF A;  3I31 A;  3ENW A;  2XQC A;  1IKX B;  1F6T A;  4J9U E;  2XWX A;  4RZR A;  4N41 A;  1TZ0 A;  1GXL A;  3QWU A;  1ZAW A;  3BJY A;  1N5Y A;  2XEX A;  2E1A A;  4CT9 A;  3K5N A;  1NZA A;  2DIS A;  4DR6 J;  3S01 A;  5D8H B;  1SBR A;  1HNX F;  3NAI A;  2NSB A;  2VQF J;  4KPY A;  4QYR A;  3BF4 A;  3X3U A;  4HTI A;  1M5S A;  4LQ9 A;  3TUJ C;  2CJB A;  1SC4 B;  3PKM A;  4OYX A;  1KKH A;  3GJT B;  4S0M A;  5C2C A;  2BJ8 A;  4P52 A;  1LW0 B;  1XC9 A;  4J9L A;  3I9V 9;  3KMQ A;  1VQ8 S;  3PZP A;  1XTZ A;  2XC9 A;  2ADC A;  4AQY J;  4CIO A;  3C19 A;  4OV1 A;  5B08 A;  3VGT A;  3O8W A;  3MAQ A;  2KG0 A;  3C6T B;  1H0H B;  4USV A;  1D1U A;  1RWK B;  3KLV A;  3H40 A;  1VBK A;  2AEM A;  2BV3 A;  1F1B B;  2XMM A;  1F9E B;  4ED7 A;  4C8L A;  2GQ2 A;  2YNH B;  4LFC F;  2QLF B;  3NLC A;  1KLM A;  1GK8 A;  5LT5 A;  1XK8 A;  2MYF A;  2QMX A;  4XO0 A;  2CQC A;  4Y2K A;  3C14 A;  5IWA J;  4G65 A;  1UPM B;  5KG1 A;  5CH7 B;  2HFO A;  3KJN B;  1QAY A;  2Y3Y A;  4KQZ A;  3CME S;  1BY9 A;  1GXT A;  2RS8 A;  4FVM A;  4EZ6 A;  3MM6 A;  4F02 A;  2FVR A;  1N34 F;  5E3R A;  1HPZ B;  2MJU A;  5K8M A;  5GME A;  1NXI A;  1ZOT A;  2OO4 A;  1UAW A;  4CCH A;  4RW8 A;  2QFJ A;  2J7K A;  3MMB B;  4U7U D;  4JV2 A;  1X5T A;  5LXY A;  1NJW A;  1URR A;  3KK1 A;  4NZ0 A;  3E51 A;  4I6Y A;  3W5Z A;  2Y9H A;  2FLP A;  1HW8 A;  3K0J A;  4RU2 A;  4F26 A;  5H1S V;  1TKX A;  3NXZ A;  4OMF G;  2NCK L;  3TZZ A;  4ECU A;  5CXT A;  1X4H A;  3QIP A;  3QGG A;  2CPH A;  3C16 A;  2BAC A;  3T6B A;  4ECV A;  2J6T A;  1HBO B;  1SKS A;  1ZET A;  3RTV A;  2B51 A;  4KH0 B;  2YX4 A;  1PAU B;  2ZNY A;  1Q81 T;  2HS0 A;  2WK4 A;  2M7S A;  3TA2 A;  1OIA A;  1WF1 A;  5A6W A;  1FTC A;  2HVH A;  4ZP9 A;  1KQG B;  4LRB A;  4I4B A;  2QC3 A;  3PEJ A;  4A47 A;  3TZY A;  3H90 A;  3L3C A;  2XZD B;  1W2I A;  1EZZ B;  2YX7 A;  2EG1 A;  3T5K A;  3K7R A;  4F25 A;  3TJ8 A;  1IVZ A;  2PII A;  2B3T B;  2H5I B;  2OIH A;  3I0R B;  3TI0 A;  3P4U B;  1RAH B;  2C2M B;  2CA9 A;  1LXJ A;  5HQM A;  3DRS B;  2H3E B;  4GO5 X;  3KLG A;  5D77 A;  3NGR A;  3I0S B;  4YDD B;  2YWW A;  4NRT A;  3BQ2 A;  1Z2Z A;  3MUT P;  1UFL A;  1C0T A;  2Q43 A;  3N79 A;  1SH3 A;  3R2C J;  2VDH A;  3MEC B;  1S48 A;  4E8U A;  1U48 A;  4KHP J;  3LTO A;  3E3X A;  4KGX B;  2ERR A;  3SEO A;  4NI2 A;  3K57 A;  4DR4 J;  2JEJ A;  3QT8 A;  3BQ0 A;  3HUL A;  4KH1 B;  3M9N B;  4A48 A;  2PD1 A;  1RLD A;  1TL1 A;  1WOO A;  2B43 A;  4CDI A;  2ZBC A;  1OSD A;  2XZW A;  2W2P P;  4P73 A;  1WKK A;  3VQT A;  1A9N B;  1JJH A;  4RW6 A;  2HNY B;  3P49 B;  3MUM P;  2OLW A;  1AT1 B;  1W25 A;  1FDD A;  2LLZ A;  2EFO A;  3DOK A;  4IH7 A;  1K8A T;  2RAQ A;  5KFP A;  1TVR B;  2YKN A;  4RNM A;  4O0I A;  4I64 A;  2Z56 B;  4GVB A;  3H98 A;  2LA4 A;  4J9O A;  3KNA A;  4UOF A;  4C8Z A;  2XYP B;  3M8Q A;  4NL5 A;  2CQ2 A;  1K44 A;  4FYV B;  3UN2 A;  3JSM A;  1IJE B;  2V5H G;  1RT3 B;  1TKT B;  2RSQ A;  1UJ4 A;  3KLF B;  3DLB A;  4L76 A;  3NGT A;  2W7A A;  3M32 B;  1SJ1 A;  1T8E A;  4OJ3 A;  3E01 A;  3UDL A;  1NJI T;  1WC5 A;  4PXE A;  1O0P A;  4Y0F A;  3CNQ P;  4GKJ F;  2W2Q P;  1HNZ J;  3HHL D;  1YGY A;  3NOC A;  3A3O B;  4USH A;  2C42 A;  1IKY A;  1Z1Z A;  3T3F A;  4UY8 5;  3DKD A;  5IM0 A;  1REG X;  2MQP A;  1BLU A;  2AMC B;  2DH7 A;  1VQM S;  2MGZ A;  3UN3 A;  4CWB A;  4N5S A;  1Q4R A;  3GPA A;  2OAU A;  3D1Q A;  1Y5N B;  3M30 B;  3IMQ J;  1FRH A;  2BAN A;  5B0D A;  2HND B;  3HHL A;  4OLP A;  1N5V A;  1W7W A;  2AJQ A;  2Q6C A;  1TUG B;  3W8G A;  2XGP A;  3H42 A;  2GHP A;  2CPF A;  5J2Q A;  4X2B A;  2UUB F;  4L72 B;  2YKP A;  4J9K A;  2Z2M A;  1ZM3 A;  4MKY A;  3R9L A;  1N5S A;  4UQG A;  3I6P A;  2IPO B;  1KVI A;  4DSE A;  3D6H B;  1Q79 A;  4E98 A;  4I0W A;  2ZFH A;  4X4T A;  1RT5 B;  2C3O A;  1VR6 A;  5HAT A;  4BBY A;  2IYG A;  5A0Y A;  2HFZ A;  2BQ3 A;  8ATC B;  3P5B P;  1YK9 A;  1X8D A;  4LSL B;  2HIY A;  4F0M A;  2BKO A;  1FEH A;  2FZG B;  1V5I B;  2KM8 C;  1HBU A;  1FJE B;  3SMZ A;  1NRK A;  1R43 A;  2L9D A;  1ZM4 A;  2V68 A;  3TZX A;  4A8W A;  4CLY A;  3O3L A;  2UUC F;  4P7T A;  2RHQ B;  3FQL A;  5K8N A;  5B0G A;  4RUA A;  1U09 A;  2MLY A;  5KFZ A;  1XNQ J;  4ICL A;  4U8V A;  2WON B;  1WC4 A;  2KFZ A;  5ETV A;  1JLQ B;  3PYE A;  3WIV A;  3LP1 A;  3VAJ A;  1FCA A;  3SQG A;  1FT8 A;  4OHV A;  3K59 A;  2HNZ A;  4AL5 A;  4Q45 A;  6FDR A;  2OFH X;  4AE5 A;  3AOB A;  4DSK A;  1RT1 A;  5L39 A;  4O3S A;  4WK3 A;  5KFX A;  2X3D A;  1FRK A;  1OMS A;  4X66 J;  4B3T F;  4PWD A;  2J0S D;  2GHW A;  2RU3 A;  5KFA A;  4J91 A;  2UXB J;  3FMW A;  3BSA A;  4DV6 J;  3LQV A;  1KFS A;  1HBM A;  5J1E B;  5HVH A;  1S1V B;  3OTE A;  1YIJ S;  4ES1 A;  1LWF B;  2NXJ A;  1NSA A;  4O3Q A;  2OI2 A;  4QIG A;  5FII A;  1KSP A;  3G6X A;  1HHS A;  2Y0S D;  1S4E A;  2BR0 A;  3MXH P;  4DDF A;  5T14 A;  2CQP A;  5E2Q A;  4LF2 A;  4IQM A;  2QIF A;  1N32 J;  5M2P A;  2DO0 A;  3DRY A;  1AFJ A;  2DBB A;  4I1T A;  1APS A;  1IKW B;  1IKV A;  2QA2 A;  2WB1 D;  3SFG A;  5FLX Y;  3MAA A;  1S12 A;  1NHK L;  2W9C B;  1FKP B;  5CAB A;  3MPU B;  1S6P B;  4USJ C;  3QLH B;  4PPD A;  3MMC B;  1UTA A;  1NDK A;  2D69 A;  1U0H B;  4LIW A;  4JYA J;  3MCO A;  3BZQ A;  2RD5 C;  4NML A;  3RBD A;  4PG7 A;  3NNH A;  2IM0 A;  1PC5 A;  2R7O A;  2VZ9 A;  3DGP A;  3AQP A;  3KK2 A;  3A8J A;  2H51 B;  4ANE A;  3LPE A;  2CDR B;  2DNO A;  4HDG A;  3JQM A;  2HLT A;  2VOO A;  4Q43 A;  2F7V A;  1Y00 A;  1D9F A;  1NLK L;  4EBE A;  4XDD A;  5HI7 A;  4ANC A;  4IG0 A;  2ZH9 A;  4PYA A;  4QU6 A;  2L08 A;  1VMB A;  3LGM A;  1VIX A;  2J8S A;  3PYF A;  2VH7 A;  5DQI A;  4QR1 A;  3RYL A;  1S1U B;  1FWL A;  1RBL A;  4PQU A;  3S7R A;  2CAD A;  1PYO B;  5CYM A;  5I3U A;  2HZV A;  1NK5 A;  5KFT A;  4P72 A;  2DVI A;  3SV4 A;  1CUL A;  1RBO B;  1DHM A;  4DPY A;  2KT5 A;  2RQM A;  3QGI A;  2YWG A;  4OX6 A;  3TAN A;  2KH9 A;  2DO4 A;  3NMR A;  2E5I A;  3P3D A;  1UET A;  5DGA A;  1V3S A;  4LT6 A;  2KTQ A;  5HP1 B;  3NY0 A;  4NXM F;  3AD8 C;  1KLM B;  3QAT A;  2ABY A;  5GMK a;  1C1B A;  1VQY A;  2HK2 A;  1KBR A;  1WJ9 A;  3LPY A;  1HWU A;  1U47 A;  4F04 B;  1U1M A;  5C5J A;  4X65 J;  4DR2 F;  4LF9 J;  8AT1 B;  4DG1 B;  1U24 A;  3D6T B;  4UOH A;  2JLE A;  1WOS A;  4ED5 A;  1SJ3 P;  1IJF B;  2YNF A;  4HI2 A;  2GVZ A;  1SVD A;  3I5C A;  4Q8F A;  3R2D J;  2EW9 A;  3KK1 B;  3AB4 B;  3M6V A;  1M90 T;  4LVO P;  5F0W A;  2ZD1 A;  5KFM A;  1OYE A;  3M2U A;  3GYN A;  4HL9 A;  2DNN A;  1TKX B;  4F7V A;  1Y4Z B;  2ZH3 A;  2HHH F;  1V6H A;  4FKY A;  1G6B A;  3MI7 X;  2KI2 A;  1LK5 A;  1FFS B;  3M8Z A;  3HMJ G;  4KB7 A;  3NEK A;  1XMO F;  2CPD A;  1RE1 B;  1EP4 B;  2CDQ A;  3SXL A;  5HBM B;  3H5Y A;  3SIP B;  1GMU A;  4K0K J;  1J5E J;  1ZYQ A;  3H8Y A;  1GMV A;  2R7V A;  4ED3 A;  4NLO A;  2PGC A;  2Y0B B;  1UW4 A;  2Z2Y B;  5I4M A;  2ZZN A;  1R27 B;  5BJR A;  2V69 A;  1NZ8 A;  5MAO A;  1RK8 A;  2HRU A;  4ECQ A;  1N5Q A;  1T11 A;  3VCD A;  1S1X A;  3EXC X;  1JLF A;  3TQ1 A;  2AJ0 A;  5HK4 A;  4NYP A;  4ZJQ A;  3HP6 A;  5CD4 H;  3CDW A;  3GMG A;  5KOW A;  3EVM A;  2Q66 A;  3K8W A;  2B6A A;  3CDU A;  3U27 A;  2ZE2 A;  3KLG B;  2LYV A;  4BS2 A;  5HAO A;  1BQM A;  2XUL A;  4OL8 A;  2FVP A;  2BDP A;  3JYT A;  4EYH B;  1WC0 A;  4NA2 A;  3D54 A;  5E3A A;  4LBP A;  1P1T A;  3M2V A;  4B3M F;  6AT1 B;  4QYZ J;  3PJ9 A;  3MM7 A;  5C25 A;  2OJ3 A;  2DNG A;  3MFH A;  3L7O A;  3ZFV A;  1S1T A;  4A8K A;  2NPF A;  1TL1 B;  4J9R A;  3KDO A;  2WTF A;  1LWE A;  1IUJ A;  3GR1 A;  4DCP B;  2M5Y A;  4CNY A;  3PRD A;  4C4W A;  3BSO A;  2FY1 A;  3LOU A;  4QWA A;  2IVY A;  4F4Y A;  3TX0 A;  2CPZ A;  1XR7 A;  3RBX A;  3UD4 P;  4NLQ A;  1ZM2 A;  1VQO S;  3JAM Y;  1HR0 F;  3EMT A;  4OX8 A;  3DHW C;  3Q8Y A;  5K8O A;  4H4O A;  3EXY A;  1IR0 A;  3DRP B;  4DR7 F;  3CCW A;  3CJ5 A;  5DDQ C;  4NLW A;  5DDR C;  4F50 A;  5IFM A;  4OYA A;  4HAC B;  1N56 A;  2R8J A;  4CH0 S;  2BVZ A;  2HBQ B;  1FVS A;  1PYT A;  2B4U A;  3HHD A;  3NGK A;  1IQT A;  1REV A;  3CE8 A;  4ZHR A;  4LBI A;  2YKQ A;  2OEJ A;  4PUO A;  2M70 A;  4JV0 A;  2XSJ B;  3GWC A;  3AXM A;  3W8P A;  1IKY B;  2M8D B;  1FJG F;  5IT9 U;  3W61 A;  4WXW A;  3L9Z A;  1RLC L;  4U6P A;  3CO9 A;  3OVB A;  4AQY F;  2LFV A;  2RKI A;  4ZPC A;  3I4H X;  3MD1 A;  3PIP Q;  3KJF B;  3QAE A;  2A6O A;  3PCO B;  4FPR A;  4EO6 A;  3WX8 A;  4MYU A;  2YH0 A;  4M5H A;  4NZ7 A;  5A8R B;  4UOC A;  2YWK A;  4RBU A;  1JNZ B;  2PT0 A;  1MSW D;  1YDL A;  4B9S A;  2HFV A;  2RE1 A;  2ZM6 J;  5IC4 B;  3OW2 R;  5J2Q B;  3PHT A;  1ZH5 A;  3RW6 A;  2QMU B;  5DGB A;  1VOM A;  2IMW P;  4NZ6 A;  1Q5Y A;  3EE3 A;  2LEP A;  3NS6 A;  3NGS A;  2WOM A;  4FF3 A;  5C24 A;  2W4D A;  3AA8 A;  4O23 A;  3AT1 B;  1U26 A;  3H5S A;  3K8V A;  2W8L A;  4IFV B;  1E6V B;  4NA1 A;  4RW9 A;  4IOC Q;  4JI7 J;  1P9Q C;  3CCR S;  5KG6 A;  1YBA A;  1HWJ A;  1CSJ A;  3M9O B;  2B5J A;  1GX5 A;  4FKX A;  5A76 A;  4N8N A;  2J9D E;  1AUD A;  3IBF B;  3D6M B;  2YQ3 A;  2Z57 B;  1BQX A;  2E9Z A;  4L3N A;  3QO9 A;  1DBD A;  1HQU A;  3OBI A;  4IDK A;  4DUY J;  5I42 A;  4QOT A;  1K1Q A;  4DFP A;  2DNL A;  4DBQ A;  3KK3 B;  5J2N B;  2H5E A;  5J1N A;  2Y1L B;  2DPJ A;  5KFV A;  4FS1 A;  4FF1 A;  2E7X A;  3DM2 A;  2QGF B;  3FK4 A;  4M5M A;  2B4O A;  2DH9 A;  4G1Q B;  3ET6 A;  1RT4 A;  1TU0 B;  3KJV A;  3GZ7 A;  4AYB D;  2M88 A;  2Z0G A;  3MZI A;  2O01 C;  2OTJ S;  1LXN A;  1RT1 B;  2LQ9 A;  1N48 A;  4EWT A;  1W26 A;  2POK A;  4ZDN A;  5M2R A;  3GR0 A;  3ZTQ A;  2H4Y B;  3W1Y C;  1TV6 A;  4B3S F;  1NDC A;  3CJ2 A;  2JVO A;  2MJN A;  1U1K A;  2GHV C;  3OLA A;  2UXD F;  1HBM B;  3CJ3 A;  2DNZ A;  1ZA1 B;  4OI1 A;  4DQQ A;  3M1V A;  5KG5 A;  1TL7 A;  2HQI A;  3KNG A;  2J76 E;  3HVA A;  2D3U A;  4C0B A;  2PSZ A;  1D9A A;  2W9B B;  3G87 A;  4JI6 F;  1RWW B;  4AND A;  2CJ9 A;  3T1H J;  4QIV A;  3GV7 B;  4EO8 A;  3DRX A;  2YQ1 A;  4M5I A;  1YJT A;  3PXG a;  2C2Z B;  2CWK A;  4QJV A;  2UV8 G;  3M9M B;  3QFH A;  2J8A A;  1SC6 A;  4Y6I A;  4ATN A;  2HHP A;  3G8T A;  2IYI A;  4DX5 A;  5LOQ A;  3W62 A;  1QUP A;  4CTA B;  1HD1 A;  2JZ5 A;  2BX6 A;  4ZP6 A;  1TUV A;  2E5L F;  2ZWO A;  3MCM A;  2J6S A;  2CPX A;  3PVX A;  1K47 A;  1ZBT A;  4R8U B;  1G4C A;  2XY6 A;  4ECW A;  3IBC B;  1VYA A;  1WF0 A;  5LSL A;  1B4S A;  1FEE A;  1LNQ A;  4CNZ A;  3CJ0 A;  2K7K A;  5B0F A;  1Y3J A;  2YNG A;  2CWX A;  2IDE A;  1SC1 B;  2FQQ B;  2V2K A;  3QGP A;  1R8B A;  2AJF E;  1IR2 A;  3KK2 B;  4B9N A;  2EKY A;  1R0A B;  2I5J B;  1NCL A;  3W7B A;  3R1H A;  1VRU B;  4C9D A;  5IC6 B;  2G13 A;  4IG0 B;  2XBP A;  5KFU A;  5AJ3 F;  3PW7 A;  2W1B A;  2VC0 A;  3MUR P;  3EDQ B;  3VVU A;  1IWA A;  4PQU B;  1AXQ A;  2DGT A;  2QYC A;  2B9E A;  1IBL J;  1GTH A;  1RAC B;  1KP6 A;  2QX0 A;  3BKU A;  3CVK A;  4ZVG A;  2OPR A;  2WW8 A;  2LA6 A;  5HJX A;  2IIH A;  4C3M A;  1F9H A;  2QA1 A;  2DGQ A;  2WAQ D;  3V6J A;  2BE9 B;  4WYW A;  3T9N A;  5LM7 E;  3M8W A;  1YZ6 A;  4OZ5 A;  1QUV A;  4HH1 A;  3FGV A;  3OR1 A;  4ZCL A;  3QT6 A;  2ZHA A;  2W8K A;  4WE1 B;  2ZOG A;  2DNK A;  2DRB A;  1CBK A;  4LFB F;  4NLT A;  1HNI A;  3AXK A;  3SSS A;  3W63 A;  1SJ4 P;  2MQN A;  1RWX B;  5BR8 F;  5FJ4 A;  3DLK B;  1R0B G;  2UVV A;  1UKU A;  1S4F A;  3H25 A;  4IUF A;  5HVG A;  2HMI A;  2DIV A;  3ICL A;  2IC3 B;  4YEA A;  3BGL A;  1EKS A;  3LA0 A;  2R2T A;  4N47 A;  1VC6 A;  1IWG A;  3OFG A;  2GVZ B;  1YTY A;  1FNX H;  1UW9 A;  2VFU A;  4MMO A;  1CC8 A;  2VPW B;  3CTR A;  1X4A A;  4WZQ A;  2NUU G;  2ZD1 B;  3IWX A;  1UVN A;  1RWO B;  4MK9 A;  3IGN A;  1D3W A;  1NPR A;  1PJ7 A;  1GMW D;  4JI4 J;  3N28 A;  1FRX A;  1AUS L;  3TJ9 A;  5DG8 A;  4R5P A;  2BEF A;  3UCG A;  3VHQ A;  3LGN A;  3UDE A;  3ZZR A;  1RA6 A;  1S9G B;  3ZO7 A;  2ZJP Q;  5AXL A;  4RW4 A;  6FD1 A;  4B3O B;  2XLI A;  4OZ0 A;  4MT1 A;  4K4X A;  5AXM A;  2CNL B;  1GMW A;  2ACY A;  1RWU A;  4WCE Q;  3SQO P;  4KHR A;  1F60 B;  1MLA A;  3UDV A;  2DR9 A;  2RT3 A;  3W65 A;  1S1X B;  2FLL A;  4X84 A;  3UE2 A;  2IAJ A;  4IKA A;  3H4D A;  2JNJ A;  2FYX A;  2FTR A;  4CLL A;  3TWZ A;  3VV2 B;  1VDH A;  4I2Q A;  2MQL A;  4DUZ J;  3KHL A;  3I96 A;  3OSP A;  3NCR A;  4MFB B;  4G3I A;  1MW7 A;  2PMH A;  3EZO A;  3GG0 A;  1RHK B;  4OJH A;  3JYT B;  2OEK A;  3IAS 9;  1RAJ A;  4YY3 J;  3JSY A;  1Y7P A;  5K14 A;  3AFG A;  3T6J A;  1KVJ A;  2VBY A;  3K58 A;  4LF4 F;  1LQ9 A;  3M2V B;  5KFC A;  4CYU A;  4F4X A;  1RQ0 A;  3MM7 B;  4UOG A;  2EC0 A;  4FDF A;  4ZP8 A;  1F9F A;  1ROF A;  3RB6 A;  2QSF A;  1J5O B;  2VA2 A;  4F3O A;  4LBH A;  4LSN B;  5F41 A;  3K17 A;  2YKM A;  2IRY A;  3PX6 A;  2Z58 B;  3LP0 A;  4ELU A;  3LAM A;  4DL7 A;  4KKO B;  4DV1 F;  3RGI A;  5JMN A;  4LJM A;  2ROP A;  4KFB A;  3N9U C;  3HZE A;  2L9W A;  4C98 A;  1K9M T;  3DDK A;  3RUB L;  4DR5 F;  5U47 A;  1R8A A;  4BCA A;  3MM9 A;  4N8O A;  2I6W A;  2VA3 A;  3R3T A;  4J9V A;  3GII A;  5IQ6 A;  1EHW A;  5M2U A;  3OUY B;  3HM9 A;  3H5X A;  3DMJ B;  4ZLP A;  4AXI A;  2AEF A;  4K4V A;  4OHX A;  3UFC X;  4MYT A;  4B9U A;  4EGL A;  3R7N B;  1QJH A;  2ZH1 A;  4OX9 F;  1FKO B;  3DCA A;  3DYA B;  2XNQ A;  4ER8 A;  1BGX T;  1KON A;  3C15 B;  1XMQ J;  2HRY A;  3JTP A;  2OPP B;  3D3B J;  4ZPV R;  1RHR B;  2AIR B;  2R4F A;  3GIL A;  2BM0 A;  5HQL A;  2P9E A;  5KG3 A;  2LEC A;  3HHE A;  4ZVU B;  1TMJ A;  3HO1 A;  3W2V B;  1S7I A;  1N33 J;  3Q83 A;  1WC1 A;  1B64 A;  1JWW A;  3OFH A;  3OXL A;  2ZBI A;  1TKZ B;  1HNW F;  2HHQ A;  5DET A;  2BJE A;  4WP8 A;  3CCT A;  2XB2 D;  5HQ8 A;  1NK6 A;  2X7I A;  1N36 F;  1SKW A;  3PY8 A;  2KRB A;  3Q86 A;  4DL4 A;  4WPA A;  5LSO A;  3IWN C;  2UUA J;  1KOH A;  4O44 B;  3EVO A;  1RTJ B;  2FZK B;  4JI2 F;  1U8S A;  1LWC A;  3GV5 B;  3BSN A;  1UFW A;  2KXN B;  1VQL S;  3Q89 A;  4KE5 A;  5L1I A;  2EI5 A;  4RL1 A;  2GGP A;  3RR8 A;  2V0N A;  1S6Q B;  2C3U A;  4I6A A;  2CQD A;  5K9F A;  2GW8 A;  2RUS A;  2L48 A;  4WU3 A;  3V4I A;  3BBB A;  2G2Y A;  4B9M A;  2D7S A;  2KB2 A;  4FYY B;  3CD6 S;  4KGZ B;  5B09 A;  2NZC A;  3DM2 B;  4URS A;  1MN9 A;  3MWB A;  2HPU A;  2ZBR A;  3FJ2 A;  1AZS B;  2P6T A;  2UZA A;  2LXI A;  2F63 A;  4DL3 A;  1UEV A;  2FJA B;  2C28 A;  1YI2 S;  1LW2 A;  1JLA A;  3K2Y A;  2HZA A;  1FF2 A;  2HVZ A;  1FXL A;  2F65 A;  4LVN P;  2BE2 A;  1URN A;  4RBV A;  3GP9 A;  2JC1 A;  2W4C A;  4KHM A;  2W25 A;  2CNO B;  1U1O A;  4JBC A;  2VDI A;  3LP2 A;  1WWH A;  2DR5 A;  2P8I A;  4LF6 J;  3HFK A;  3CED A;  3G9C A;  4DX6 A;  2OPQ A;  2HYI B;  1SKU B;  4QR0 A;  5T7L B;  1OPI A;  1Q1K A;  4C8N A;  1UFK A;  1CS4 A;  1RHU B;  2F3J A;  3K5O A;  4TY8 A;  1E6Y A;  1U1Q A;  3C3L A;  1KHW A;  1VI7 A;  1XNR J;  1KOO A;  2VHG A;  4PR6 A;  1CJK A;  1VFJ A;  2PEB A;  1KLN A;  1U49 A;  2JX2 A;  5E3P A;  1TL3 A;  2HS3 A;  1FO1 A;  4DFK A;  4X4Q A;  4QZV B;  5GAD I;  4N56 A;  5DLF A;  3TAP A;  2V4R A;  2GQQ A;  3M2R A;  3OLB A;  1K0T A;  1JLC A;  4OYI A;  1HWI A;  2J7W A;  4DOZ A;  1WI8 A;  3J80 U;  4UZB A;  5ETR A;  1TQL A;  4YB6 A;  1NJX A;  2MTL A;  3DOM A;  3V81 B;  2F4V J;  5KG2 A;  3BPD A;  4FBT A;  1GTE A;  4F36 A;  2Z8Q A;  3I9Z A;  3RW7 A;  2QFI A;  3WQP A;  3U02 A;  4IQX A;  4K2J A;  3QRR A;  3OXG A;  4HHJ A;  3MPV A;  1OYD A;  2G1D A;  2FHO B;  3QPI A;  1O8B A;  4JUZ A;  2RU9 A;  3RAX A;  4DV3 J;  5CZX A;  3TYT A;  4D3G A;  2YNI A;  4KR0 B;  1HWL A;  1Q78 A;  3OTO F;  4N7T A;  3DXB A;  4ECT A;  1LV5 A;  4OI6 A;  4CI0 B;  4ETZ A;  2MKI A;  4IH5 A;  2RRA A;  3CT9 A;  3OR1 B;  4IYQ A;  4DR1 J;  4NCA A;  4ZPA A;  1C4A A;  3JSB A;  4DR3 J;  2JRS A;  1EB0 A;  2ZM6 F;  1G2E A;  2CQI A;  4IR1 A;  1PKU A;  1Q86 T;  1FJC A;  1HNI B;  4B9V A;  1M5O C;  2YQ0 A;  2PMZ D;  4J9Q A;  3FFI B;  1L3T A;  3T41 A;  4CM2 A;  3BH7 B;  2HMI B;  2ZH4 A;  2CJA A;  5D4P A;  1Y5I B;  3PV8 A;  2DHA A;  2HHX A;  1U7L A;  4RUH A;  1CQN A;  1B7Y B;  3NGD A;  2XZT B;  2G1H A;  2X3G A;  3W3S A;  2BYC A;  3M8S A;  4OHZ A;  3CMQ A;  5KG4 A;  1KTV A;  2DD8 S;  3ENQ A;  4DV2 F;  1XIQ A;  4Y3C A;  1T9U A;  2MLX A;  4UTG A;  1VLY A;  2GJI A;  1VQK S;  3G6E S;  2VJU A;  1FWP A;  1W2B R;  3PX4 A;  2RIL A;  2ASJ A;  2DCL A;  2IM3 A;  2DEI A;  4R5P B;  2VPY B;  3G4S S;  4JV5 J;  1JLB A;  2ZNZ A;  5IQQ A;  2HEK A;  1N88 A;  1C4C A;  2Y1R I;  3MAH A;  1S1W A;  2QA4 S;  1KQK A;  3C2P A;  1F5C A;  4EUV A;  5IT0 A;  4KBI A;  2PEH A;  1X0P A;  3X1L B;  4DXL A;  3CXC R;  3CCV S;  3R27 A;  1B0P A;  4Y28 C;  5L46 A;  5DDO C;  2VU5 A;  2L41 A;  3V6K A;  1FXR A;  2E7V A;  1B3T A;  2ZJQ Q;  5KT6 A;  1HL6 A;  1DLO B;  2GC8 A;  3O5T B;  1HBN B;  2MQO A;  1LKZ A;  1UCN A;  1AFI A;  2UVR A;  3C66 A;  5D0E A;  3CCU S;  2ZOM A;  3TUZ C;  1SL2 A;  1UJ6 A;  3GG1 A;  3Q8R B;  1WHW A;  1XBW A;  1IQZ A;  1T9V A;  4ENO A;  3B4D A;  3CDE A;  5D3G A;  1SCJ B;  4DLE A;  3PTW A;  5SUH A;  3CC2 S;  2JEG A;  2C3Y A;  3SSQ A;  2XI2 A;  1FFG B;  1ZS6 A;  4CYU B;  3GYX B;  4NCB A;  1JLG A;  4O3N A;  1S6U A;  4P74 A;  2BA9 A;  2R2S A;  4OI2 A;  3TO8 A;  1FRM A;  3G2X A;  1TFY A;  1NU4 A;  3TP2 A;  4W98 A;  1HI0 P;  2DK2 A;  2KVI A;  4LFA F;  2ZKU A;  2XYG B;  3BR9 A;  3RR7 A;  1YBT A;  3PIO Q;  3HT0 A;  4YS2 A;  3EDR B;  4WFX A;  3DLL Q;  3HF5 A;  1YX2 A;  4E2F B;  1U1L A;  3NCP A;  4F67 A;  4CLW A;  5F8J A;  1IBM J;  4GC6 A;  3GU0 A;  2BJ1 A;  3TA0 A;  3JQJ A;  3MM9 B;  2Q1L A;  2C2O B;  1FHT A;  3WC2 A;  4NLY A;  3V5R A;  4LF5 J;  2P2C B;  1S0M A;  2R8K A;  1NK7 A;  2IJR A;  2VC1 A;  2BKN A;  4Q0B A;  3D1H A;  1NH8 A;  1F5A A;  2JWN A;  4ID8 A;  1ITP A;  3MD3 A;  1N6Q B;  1CJV A;  5KFO A;  1JLE A;  2VPZ B;  5ETQ A;  3QRP A;  5D6G A;  5L38 A;  3TAM A;  1U0S A;  4TVA B;  4RPF A;  3T9Z A;  4C6A A;  1T7P A;  1ZTW A;  3BBF A;  2APO A;  2XHC A;  3DI6 B;  5KFN A;  3D0I E;  3RB3 A;  1JNR B;  4M8L A;  3MEG A;  1SV5 B;  1RUS A;  4LR9 A;  2BJ3 A;  1EJ7 L;  1TUW A;  2MZ1 A;  1M1H A;  4USI A;  2YH1 A;  1DTQ B;  2MB0 B;  3KLH B;  1UVI A;  1KRP A;  2O66 A;  5HVF A;  1HYS A;  1B0T A;  1WSV A;  1NHV A;  1DAR A;  2QSW A;  2V63 A;  4OHY A;  4DV0 J;  2ZZM A;  3A8K A;  2K1R A;  4DEZ A;  2KXH A;  1S79 A;  2GO8 A;  1SL1 A;  2B4P A;  4ZPD A;  3TOQ A;  1O51 A;  4P71 A;  1FX4 A;  3CMA S;  3HJV A;  2WSF C;  4WKR A;  3T1Y J;  2KN4 A;  3DFE A;  2GIQ A;  1CQM A;  2MKH A;  4U8Y A;  2W4P A;  1P1L A;  1RAG B;  2DB1 A;  2DNQ A;  4YHH F;  2HGL A;  1T05 B;  3A8E A;  1AA1 B;  5D78 A;  3TUI C;  4PQA A;  4TU9 A;  2M0G B;  4OYB A;  4WXO A;  4JI4 F;  1K0V A;  1RTD B;  1C0U A;  1UZH A;  2EFG A;  3MED A;  2F5G A;  2GGP B;  1JXL A;  3MOJ B;  1EET B;  1H38 A;  3S8S A;  5HLF B;  4OZL A;  3IRW P;  2M9K A;  1DQ8 A;  4WJB A;  2IDL A;  2QYG A;  1IBK F;  4FXW A;  2H9Z A;  3ZNJ 1;  3MGJ A;  2W24 A;  1RT2 B;  1UWB A;  4ZK7 M;  3KHG A;  2GAG C;  1GFW B;  1RTZ A;  4GKK J;  4ECZ A;  1YWX A;  5HO4 A;  4RNF A;  2XCA A;  4EK2 A;  3S1T A;  2IVF B;  4F0H A;  2XHW A;  3GSD A;  4IG3 B;  5GMD A;  2MZQ A;  2JEI A;  4NXN J;  2CYY A;  5HRO A;  3ADA C;  1JK9 B;  3MEK A;  4NE9 C;  1R7I A;  3KUG A;  3QNW B;  3B82 A;  3IR5 B;  5DO2 A;  2HQ3 A;  4WK1 A;  3CDA A;  4J9M A;  5F9N A;  3I32 A;  4MIA A;  3UD5 A;  4X62 F;  1EAR A;  2J7U A;  4KGM A;  4XAK A;  1TTH B;  4X64 F;  4MTP A;  1Q0N A;  1MRO A;  1IXK A;  5JVH Q;  1WD6 A;  5ITH A;  1HNX J;  3SFU A;  2MLZ A;  1P27 B;  3THP A;  1HQE B;  2CJY B;  5E33 A;  1BWE A;  3PJW A;  5C42 A;  2FGC A;  1Y11 A;  3VQS A;  2WBR A;  2DGO A;  3TVZ A;  1QSY A;  2A0F B;  3PM9 A;  3VGS A;  3TJA A;  2WBM A;  1ZZF A;  4G1I A;  4DX8 H;  1Y10 A;  2GIR A;  1WOR A;  1RIS A;  2M52 A;  2OEM A;  1N52 B;  3HD2 A;  4FF4 A;  1KNZ A;  1UL3 A;  2CZ4 A;  4C3L A;  4JOU A;  3J7Y I;  2AW0 A;  1BQN B;  2MKJ A;  3M2R B;  1X9M A;  1I94 F;  3EZU A;  1RKI A;  3RZA A;  2HUR A;  4LFC J;  4AUK A;  4DHV A;  4DQR A;  3OL8 A;  1S59 A;  2D3O 1;  5GAH I;  3IRX A;  2MPU A;  5E41 A;  1FK9 B;  4LF8 F;  1SJR A;  3PYG A;  3AOD A;  4LR8 A;  2A18 A;  1N34 J;  4OYO A;  4L73 A;  5IV4 A;  3ITH B;  4DFM A;  2U1A A;  1H72 C;  3ENV A;  4O4R A;  4F3Q A;  3GJQ B;  3V6H A;  3M8P A;  3C46 A;  2YNI B;  2D9O A;  3L95 X;  1SI9 A;  5A8W A;  4TQS A;  1DJ0 A;  4J7C A;  4OI3 A;  3ULH A;  5DZ6 A;  1H6K X;  1I3O B;  3PG9 A;  5HMW A;  4B17 A;  4B02 A;  2COL A;  3BO4 A;  5KT3 A;  2IRU A;  2ZZT A;  3FSX A;  2O5D A;  1L3V A;  1NKC A;  4M95 A;  4MIW A;  3MHY A;  4URQ U;  3ZXW A;  1VC5 A;  1NKB A;  1CJT A;  3DNC A;  5A2Q Y;  5LMU F;  4H4K A;  3W9H A;  2UU9 F;  1PIL A;  3E8O A;  1VRT B;  4R0E A;  2PN6 A;  2E9R X;  3U1M A;  4QBU A;  3H0P A;  3UVJ A;  4CT8 A;  5FLX U;  3J7A N;  5EGY A;  4PAA A;  1QE1 A;  1GQE A;  5EWF A;  4DU7 A;  2KU7 A;  2LU2 A;  1KS2 A;  2OFG X;  2MZS A;  2VJV A;  2R8G A;  2YPY A;  1FRI A;  3CSK A;  4YR0 A;  1NK8 A;  3BSC A;  1BWV A;  3D9B A;  1GT8 A;  4Z37 A;  3HSG A;  1U02 A;  3MPY A;  2E5G A;  1VQN S;  2KYZ A;  3BBC A;  3HX9 A;  4LRE A;  2HHS A;  4Q2M A;  3R1L A;  8RUC A;  2CNN B;  2F9D A;  4C3K A;  4DV4 F;  5GVQ A;  3POT A;  2ASL A;  3UQS A;  4OV6 A;  3CJK B;  5AT1 B;  3PKY A;  1JLB B;  4NLR A;  1SKR A;  1JJC B;  5LL6 d;  1TAQ A;  1FES A;  2DYA A;  3K5L A;  3RBE A;  2DGX A;  3Q24 A;  4JI0 F;  3OFE A;  1GNK A;  4WFA Q;  1YG0 A;  2B9X A;  1WEZ A;  4WFN Q;  5HJY A;  2H65 B;  3SCJ E;  1DAX A;  1TP7 A;  3KG1 A;  2FLO A;  4H4M B;  3IFE A;  3L7U A;  3FZB A;  1S0N A;  1VQ4 S;  2ALY B;  3VAK A;  2Q6B A;  1I1G A;  2XO7 A;  3HJF A;  3HVT A;  4ILM A;  1EX8 A;  5KFQ A;  3SDE B;  4NCG B;  3SCI E;  2MY7 A;  3FBF A;  3SV3 A;  4L75 A;  4A8F A;  2RF2 A;  4DQP A;  4P9S A;  2AYM A;  3W2W A;  1Q8K A;  1N0U A;  1Q8L A;  2EKN A;  2G0I A;  2A2C A;  2O67 A;  3D0G E;  1VQ5 S;  3MMA A;  2Z2L A;  3HK2 A;  4JI5 F;  1RU1 A;  2JFD A;  1XER A;  4A8M P;  4F2R A;  1TR0 A;  2QE5 A;  4TYB A;  2BJD A;  2LQ5 A;  3DC2 A;  5J2P B;  3DDN A;  2HQG A;  4GKJ J;  4OYM A;  2GVD B;  2OGU A;  5K20 B;  1NND A;  1EKR A;  4NEY A;  1LEO A;  1BE4 A;  4EBD A;  1P9Y A;  3IR7 B;  3IO1 A;  4CP5 A;  1LW0 A;  3BGR A;  3IS9 B;  3CC7 S;  4C11 B;  1B0V A;  2ALZ A;  4WWS A;  3JTO A;  3D6F B;  4IFY A;  3FSI A;  5KOX A;  5IS2 A;  5AE2 A;  3OV7 A;  1UA0 A;  4C8Y A;  1UEU A;  1RTI B;  3PW0 A;  3N4W A;  1HHT P;  2RQC A;  3CCZ A;  4GVL A;  2WRM A;  5CCL A;  2HVD A;  5LJ3 Y;  1RAE B;  2IM1 A;  3AAW B;  5HMZ A;  5D0R A;  2DXD A;  2CQ3 A;  4I2P B;  5KFL A;  3RG6 A;  2IY5 B;  2BJ9 A;  1RWN B;  5E3C A;  2UUB J;  1VCT A;  3C6U A;  1D8Y A;  3Q0A A;  1WDT A;  1HD0 A;  3QZ7 A;  3IG1 B;  2VQE F;  2RB7 A;  1Y9O A;  2CQG A;  1HPZ A;  3NOG A;  3BPS P;  3UDC A;  2NS1 B;  2ROG A;  4K4Z A;  3OFF A;  4Q0B B;  2DHS A;  2V50 A;  3BV8 A;  1C2P A;  1U2R A;  5KFF A;  3V6D B;  3PR5 B;  3J81 Y;  3KTQ A;  1KVK A;  2MMY A;  4P2M A;  1CJV B;  1SUQ B;  3ZZZ A;  1YIT S;  1VC0 A;  2AP6 A;  2CG4 A;  1YJR A;  1SQE A;  1JB0 C;  4FVC A;  2H5J B;  4WP3 A;  3JXO A;  4PG5 A;  2BOP A;  1CJU B;  4L6V 3;  3IC1 A;  2HS4 A;  4YN3 B;  2UUC J;  2LQJ A;  3HD1 A;  2A2D A;  4I6W A;  5KFK A;  5F8L A;  4QIW D;  4QYZ K;  4I56 A;  4OX7 A;  4F0K A;  3BN7 A;  4EEY A;  1MWY A;  5DQG A;  3R5B A;  2O1P A;  5I3P A;  4G1P A;  1FE0 A;  2KT2 A;  3OQ2 A;  3DRR A;  5T41 A;  3I56 S;  4QU7 A;  3TQE A;  1MMN A;  3SBM A;  4HH0 A;  4ZIV A;  4CH7 A;  1NM2 A;  1JQG A;  2CIM A;  2V2V A;  3R7B B;  2R9L A;  4DV5 F;  3D66 A;  4C0H A;  4O4G A;  3I0R A;  2MHN A;  3D7S B;  2ZH5 A;  4B3T J;  2D3Z A;  3UD3 P;  3HCX A;  9ATC B;  2VIH A;  1N0V C;  1TMM A;  3DRS A;  2DY1 A;  1UVL A;  3DXS X;  2DNR A;  2R42 A;  3JAM U;  3I0S A;  2G0C A;  3H59 A;  2IBK A;  5KAK A;  5A8K B;  2VG7 B;  2MZR A;  3NWG A;  1FDN A;  1PGZ A;  4WFZ A;  4X4P A;  1H74 A;  1SL0 A;  3MEC A;  2AYG A;  2JSX A;  5BYS A;  3BS9 A;  2ZBQ A;  3MEE B;  5GAG I;  3UW1 A;  1S7H A;  4L3K A;  2NUH A;  1QM9 A;  3I55 S;  1WOP A;  4ED6 A;  2LU1 A;  1FI4 A;  4DUT A;  3U7J A;  4LF7 F;  4FNH A;  3B6B A;  2G4B A;  2HFS A;  1S9E A;  5IXU A;  2BW7 A;  3BYR A;  2I0X A;  4J9P A;  3JSR A;  3HFV A;  4LSZ B;  1RHJ B;  4KO0 B;  3CJQ A;  4URG A;  5KG0 A;  3AOC A;  1O6X A;  4P75 A;  3RAM A;  2VF3 A;  5LXR A;  3MM5 B;  2HNY A;  3CCJ S;  1H7W A;  5KT7 A;  3ZTR A;  3ONQ A;  4ZPB A;  4RNO A;  2XSF A;  4F4A A;  4FYD A;  1SXL A;  1DQA A;  1FA0 A;  2HBY B;  1S72 S;  3NKY A;  1RYR A;  5E3Q A;  4FYW B;  5HRO B;  2YTC A;  2R7S A;  4IO9 Q;  1TKT A;  3KLF A;  4OFZ A;  3G82 A;  2ASD A;  4PKD B;  1H98 A;  2LKZ A;  3QYY A;  1N5Y B;  1IM6 A;  2J9E A;  3M32 A;  4RLE A;  2Z30 B;  4XK8 C;  4ZVR B;  2RH3 A;  2YY3 A;  4NMX A;  4ED4 A;  3W5X A;  3LAN A;  2CNK B;  1RWP B;  3SCK E;  3VTI A;  1YRT A;  4FP9 A;  1BUX A;  4MKB A;  1BC6 A;  3D3C J;  2CQH A;  2C2D A;  2M8H A;  4MKA A;  5C42 B;  4E0D A;  3AHP A;  4RWX A;  2HHW A;  2P9C A;  2XMT A;  3PJX A;  1YHQ S;  3OD2 A;  4WFB Q;  1TK0 A;  4TXS A;  3G6Y A;  1A7G E;  2ZWP A;  3M30 A;  3V2U C;  1D8Z A;  4DCO B;  5K5M A;  2E9T A;  2MEW A;  4NRU A;  2VFT A;  2HND A;  3CUN A;  1PIE A;  3W64 A;  2ZKT A;  4ZVQ B;  1X0F A;  3J7Z 5;  4UZC A;  1QY7 A;  5LJ5 Y;  1QAJ A;  3C14 B;  2K8G A;  3QSI A;  5BYQ A;  4ZIT A;  4IRC A;  4NXM J;  2BJ7 A;  1RB0 A;  1T9W A;  2FB0 A;  2FVQ A;  2EFQ A;  1M5P C;  1BMQ B;  3G6V A;  3MM6 B;  4DJB A;  4CLS A;  4DR2 J;  4DU8 A;  4NAS A;  2R7W A;  4X4S A;  1FRL A;  3D67 A;  1RT5 A;  3SCL E;  4RW8 B;  3HHL C;  1M5K C;  1KQS R;  2KO1 A;  2RNE A;  4LSL A;  3F44 A;  2PA3 A;  3GCX P;  1OSC A;  2DH8 A;  2ZBP A;  2RS2 A;  4DV7 F;  3QIP B;  5A8W B;  4Q44 A;  4NPO A;  3C16 B;  2OP5 A;  1S49 A;  4NLX A;  4FXV A;  4RBT A;  3QBC A;  4EMD A;  5F3T A;  3N01 A;  5IT4 A;  2HHH J;  3AY0 A;  1CPZ A;  3OPK A;  4TQR A;  2XMA A;  3TW0 A;  5D4N A;  2NR0 A;  3BYP A;  4TYA A;  2FJW A;  2J0X A;  4O0N A;  1NPK A;  1WAC A;  4J9S A;  2YXL A;  1XMO J;  1IBC B;  3HLU A;  3D4J A;  3A3P B;  2WON A;  3CCQ S;  1CJT B;  2B8Q A;  1JLQ A;  4YB1 P;  2GA7 A;  1YZ7 A;  1S5Z A;  2DRA A;  2HQC A;  3DU6 A;  4A4J A;  2ROE A;  1YJ9 S;  2EBE A;  1GH8 A;  2F8M A;  2QN6 B;  2E66 A;  3BGF A;  2GNK A;  5KFB A;  3QT7 A;  5L8R C;  1F0X A;  2HHU A;  3NNC A;  2IFX A;  4LR7 A;  2AYB A;  4PXD A;  5CCM A;  1YQH A;  5J1E A;  1PAE X;  1R8C A;  2FD2 A;  1OY6 A;  1WG5 A;  3DDI A;  2HBZ B;  1WUU A;  4YME A;  1C0T B;  2CVE A;  2W01 A;  5ETM A;  1XEZ A;  4AXJ A;  3KWM A;  4NI2 B;  1YJU A;  3P5T L;  2KHC A;  2QL5 B;  1U6F A;  1VHF A;  1X5S A;  3OJU A;  5EDW A;  3A12 A;  2WVE A;  2X51 A;  3AD7 C;  2ZDP A;  1S76 D;  3H2U B;  4K4U A;  1L3S A;  1IKW A;  4ECX A;  3MR5 A;  3EPI A;  4LF1 A;  2W2N P;  3RRK A;  2BM1 A;  4RW6 B;  2WVB A;  4JI1 F;  1QTN B;  1VRQ C;  2W9C A;  2UV8 A;  2NYI A;  2IVM A;  3DOK B;  1S6P A;  2DT9 A;  4UUW A;  2YKN B;  3IXQ A;  3ISN D;  3MMC A;  3HVT B;  1ZPV A;  4GVB B;  2KG1 A;  4K2X A;  3EJM A;  1NDL A;  3M8Q B;  1U0H A;  1FFW B;  3UR3 C;  5CHC B;  1HR0 J;  3JSM B;  4ETX A;  3AA9 A;  2FC9 A;  3W2W B;  2OSQ A;  2VB6 A;  3BQ1 A;  4ECS A;  2CFX A;  2J0W A;  1QD1 A;  3MMA B;  1EIY B;  2F4F A;  2FGO A;  4DR7 J;  1X4F A;  4OIX A;  4DR6 F;  3E01 B;  3GSI A;  3TZW A;  3EGZ A;  4X4O A;  3VF0 B;  2VQF F;  3NWR A;  3U1L A;  2PI5 A;  1Q16 B;  2ZVI A;  3H5U A;  3WHI A;  4PZV A;  1ARO P;  1QSS A;  1S1U A;  2KL8 A;  4P2X A;  2B7C B;  3W60 A;  2LQB A;  3CO0 P;  1ACM B;  3WIU A;  5IM0 B;  3DLJ A;  1OQ3 A;  4RR5 A;  3OTC A;  2GO9 A;  1VJW A;  2E44 A;  1QTM A;  3O44 A;  1FJG J;  3BGR B;  5I3Q A;  2MGZ B;  4ZLL A;  1VJQ A;  1UVJ A;  3WX4 A;  4IFY B;  4MJK A;  1X4B A;  2BAN B;  5EN1 A;  3GTY X;  2NSC A;  3HHL B;  1S77 D;  4DPO A;  3B8H A;  2DGW A;  1ZM9 A;  4PG8 A;  1JJ2 R;  4ITS A;  1MWQ A;  1GEH A;  3OR2 A;  4NLV A;  3CIZ A;  2LDI A;  2JHE A;  2NXE A;  2DEJ A;  1RXO B;  4RX6 A;  3N6L A;  3ILL A;  5IWA F;  3FRY A;  5HP1 A;  3GFX A;  5DS7 A;  4WKY A;  3PO4 A;  3HVR A;  1HA1 A;  5B0B A;  2JEF A;  2BAB A;  2WVF A;  1SB6 A;  2C22 A;  1WHY A;  2V2Z A;  2MKC A;  2DHH A;  4U9R A;  3C6U B;  1WDD A;  4DG1 A;  4BC7 A;  2CZ9 A;  5KFS A;  2GAH C;  3FBB A;  4DZ6 A;  3G71 S;  4M63 A;  3ILI A;  2AT1 B;  3W66 A;  5A0Y B;  4WBF A;  4ZOS A;  2V4J A;  1PG5 B;  4IOB A;  2R7T A;  2DGU A;  1YSJ A;  4DPW A;  2P6S A;  1RU2 A;  2G2O A;  1SH0 A;  1VQ6 S;  1HBU B;  1WTF A;  1Q8I A;  2CJQ A;  2IRX A;  1HFE L;  2V4Q A;  4EYI B;  4I7F A;  4ZVF A;  5F0U A;  4KPC A;  4J9N A;  1EP4 A;  5HBM A;  4ICL B;  5CD4 A;  3ETO A;  3FBC A;  1H2T Z;  1DZ5 A;  4PG4 A;  3LP1 B;  2F8H A;  3SQG B;  3EGN A;  3ZZ0 A;  2HNZ B;  3NGU A;  4FNI A;  3AJ2 A;  1KWM A;  2KZM A;  1YJ7 A;  3MPD A;  2DJW A;  2AX0 A;  4U67 Q;  1MU2 A;  3DRR B;  1T3O A;  3QAU A;  1UEK A;  2OUG A;  2MSS A;  1HAR A;  5LMN J;  3MM8 A;  4PWD B;  2BKP A;  2YBV A;  3B4M A;  1NH7 A;  4O4G B;  2B4V A;  1VK8 A;  4B3S J;  2DKO B;  5AE3 A;  3NS5 A;  4Y2A A;  2Y8W A;  1XJW B;  5CYQ A;  2UXD J;  2GML A;  2IJF A;  4UQT A;  5F8G A;  2XS5 A;  2LCW A;  5HMY A;  4KHP F;  2I38 A;  4HT7 A;  2UP1 A;  1WC6 A;  1M1K T;  4ZVS B;  2FDN A;  2QG9 B;  4ZS6 A;  4HDH A;  3CD5 A;  4DR4 F;  3TAQ A;  4JI6 J;  2OD4 A;  1YLX A;  2AZ3 A;  5H9E K;  3QSY B;  2VOD A;  1U45 A;  2QL7 B;  2MZT A;  2N3L A;  1XN9 A;  2C2K B;  1S9E B;  4C8O A;  1IKV B;  3VAH A;  4ID5 A;  4DFJ A;  4KJI A;  3F73 A;  3MAA B;  4ZA1 A;  2K3K A;  2V67 A;  3EM1 A;  4YDX A;  3H20 A;  2X1A A;  1U6B A;  4ED8 A;  1X7V A;  1YVF A;  1CLF A;  2XM3 A;  4USM A;  1S99 A;  1NHU A;  4OYP A;  5KFI A;  2E5L J;  2VIC A;  4LRF A;  4ES2 A;  3GCW P;  2WHO A;  4L74 A;  2QLW A;  3KFW X;  4HT5 A;  4ED0 A;  2KHD A;  4CLF A;  1Q82 T;  3BKT A;  3OSN A;  3DRP A;  1KN6 A;  3DGP B;  5AXK A;  3UI3 A;  2RQ4 A;  3G82 B;  1K1S A;  3JB9 k;  4HAC A;  2ADB A;  2DHG A;  1CC7 A;  1QAI A;  2XWY A;  1HNZ F;  1WEY A;  2HKE A;  3KG0 A;  2B8P A;  1ZAV A;  1WHV A;  5DRK A;  1X31 C;  4EZ9 A;  3R5J B;  5AJ3 J;  1WKL A;  2XSJ A;  2RML A;  4OJG A;  4DX7 A;  3VZI A;  2JDJ A;  5CYM B;  4EU0 A;  5I3U B;  2EWH A;  3VGU A;  3D5M A;  2FJX A;  1CUL B;  3BKF A;  2XG8 A;  2HBR B;  4NYZ A;  1Q95 G;  3IM9 A;  3LGH A;  4FF2 A;  2F1F A;  1WNE A;  4XPC A;  2RDD A;  3ZZU A;  3EYZ A;  3DOL A;  2QTW A;  2GMJ A;  1TKD A;  1T03 A;  1KEK A;  4Y2C A;  2XS2 A;  4MIB A;  3R5C A;  3HFZ B;  1NBE B;  4ZCI A;  4LUB A;  4M5D A;  3ZZT A;  1T3N A;  3N6M A;  5A8R A;  3ISN C;  1C1B B;  3HDS A;  3EIC A;  2R8I A;  4MKV A;  4LIR A;  2U2F A;  2ACM A;  3FKB A;  2JFK A;  1KR4 A;  5DM7 Q;  2EFV A;  4LFB J;  1X9S A;  5AXN A;  1R0C B;  4HHH A;  4U95 A;  4H54 A;  3G86 A;  5B7W A;  3R6L B;  2VON A;  2LEB A;  5BR8 J;  4OJ1 A;  2V8D A;  3TEG A;  1T95 A;  1QDU B;  2NPI A;  3M6W A;  2Y8Y A;  2YNF B;  3OL6 A;  3OXF A;  4IFV A;  1E6V A;  3TR5 A;  4CO0 A;  4ZVE A;  2R7Q A;  4PPZ A;  1V3R A;  2JVR A;  2LQ8 A;  2OHD A;  2NQP A;  5THW A;  4LQ3 A;  1MWZ A;  4BWM A;  2JC0 A;  1PYS B;  1NKE A;  3NAH A;  3M2U B;  3EUN A;  2V2Q A;  2JLF A;  4LRA A;  2LMI A;  4QWB A;  5EX3 A;  4Q8E A;  3OTB A;  5H9F K;  1B7F A;  5DG9 A;  4RUC A;  3A4T A;  1HI8 A;  4YFU A;  1JKH A;  3R5A A;  1XNQ F;  2QLJ B;  1VLO A;  2QT7 A;  4FYX B;  4WZM A;  2XMK A;  3PEH A;  1ELO A;  2PI4 A;  2BZ2 A;  3KK3 A;  5J2N A;  1T9X A;  1G3O A;  2W2O P;  1RCX B;  2MQ8 A;  2KRR A;  3I4P A;  4B3R J;  2B0G A;  3CGI A;  4OZ2 A;  5GAE U;  1T02 A;  2HIQ A;  1NJY A;  2UUW A;  1U6Z A;  3ZZO A;  4USK A;  4G1Q A;  2EK1 A;  4X66 F;  2AKW B;  2KVQ E;  4TLR A;  2HW3 A;  4NYO A;  4XIU A;  1JLF B;  3EVW A;  2VBW A;  2UXB F;  4DV6 F;  2N4D A;  4KYZ A;  4BWJ A;  2CQ0 A;  2W2M P;  1G1X A;  1AB8 A;  1FNM A;  3BRE A;  3MFI A;  1YJV A;  2E5H A;  2B6A B;  3I5A A;  3HXM A;  4C2M A;  1NJZ A;  2ZE2 B;  1QVG R;  3WC0 A;  4QQB A;  2CXE A;  4WYL A;  3FUY A;  2VG6 A;  2ZEJ A;  1BQM B;  2KFY A;  4PYD A;  3I5B A;  4Y2I A;  2CKW A;  3LAL A;  2GS8 A;  2W9B A;  5DDP C;  3GIK A;  2QRR A;  3KYL A;  4WF9 Q;  5E7O B;  4ZIW A;  1AYE A;  1N32 F;  1WG4 A;  1F2G A;  2QL9 B;  1X4D A;  1RAD B;  5C25 B;  3J81 j;  3QJL A;  2HAF A;  4M1K A;  3LWM A;  4LF4 J;  2FJE B;  1S1T B;  4DI6 A;  4CTA A;  2X1F A;  1LWE B;  4M5J A;  4NLU A;  4HEA 9;  4DPX A;  4W4M A;  3QT5 A;  5AE1 A;  1Z4U A;  1D9D A;  5E5N A;  5GAD U;  1A0O B;  5F3Z A;  2K7J A;  2ATC B;  1NB2 A;  4JYA F;  1OS5 A;  2FUG 9;  3PFO A;  3BB5 A;  4DV1 J;  2VFV A;  5JVG Q;  4R8U A;  1Q8B A;  3FQK A;  4H4O B;  2R2R A;  4KT0 C;  2NZ4 A;  4W90 B;  1ICE B;  4R0J A;  4EI2 A;  1IN0 A;  2SXL A;  3WDO A;  4M5K A;  2GFF A;  2MQQ A;  2X1G A;  2MXY A;  5ETK A;  1F2H A;  1ZTT A;  1F3F A;  4DR5 J;  3M6X A;  5JXS A;  2ASY A;  2OML A;  5D15 A;  1JIH A;  1S0O A;  5KFD A;  1R0A A;  1QSL A;  2I5J A;  1LWX A;  1VRU A;  2CRL A;  1REV B;  4ZHR B;  3EWG A;  3CDB A;  3FCW A;  4HR2 A;  2YX1 A;  4PUO B;  4NX9 A;  2VAS A;  2FY8 A;  4DQI A;  1HMV A;  3KLI A;  4DSJ A;  1DQ9 A;  3CW2 C;  1TK5 A;  3DGV A;  4ZLN A;  2D3O R;  2V8V A;  2XCP A;  1CVJ A;  1K73 T;  1X9W A;  2GX8 A;  2KT3 A;  4C48 A;  1H2U X;  1UPP A;  4DLG A;  4O3R A;  2FIU A;  4HYK A;  2RKI B;  2MQM A;  3DU5 A;  1OQ6 A;  5CQG A;  4OX9 J;  1PO6 A;  2A10 A;  3PYD A;  1EQM A;  3FNN A;  3AOA A;  1N4L A;  3GV8 B;  1R31 A;  4JI8 J;  2ZIT A;  1UP1 A;  1VQP S;  3OR2 B;  2OMO A;  4QWC A;  1O5J A;  4WE1 A;  4ZVP B;  5HAN A;  3GON A;  5B0C A;  3L09 A;  1YJW S;  2R7U A;  4X65 F;  4CZC A;  2KM8 B;  4OYZ A;  3RB4 A;  4LF9 F;  3M8R A;  3CCM S;  4R25 A;  2CJX B;  2I2Y A;  3LW5 C;  3DLK A;  3LF0 A;  2WOM B;  5C24 B;  2GMH A;  3TRG A;  1VK3 A;  1HNW J;  5KG7 A;  3W5Y A;  3MTK A;  5HN0 A;  3RJM B;  3KUE A;  2IC3 A;  4RW9 B;  4ZLJ A;  2HHV A;  2HGM A;  3SSR A;  1RYS A;  1OPZ A;  3P8B B;  4RUB A;  1N36 J;  1UVM A;  2BQU A;  1R89 A;  2VKZ G;  4NOH A;  2V4J B;  3BEG B;  1I5O B;  4DN0 A;  2RHS B;  1HI1 A;  2B5J B;  2R8H A;  3VAG A;  1S0V A;  1GXU A;  4QR2 A;  2BW2 A;  4AL7 A;  4TKT A;  3R5G A;  4RW7 A;  4TN2 A;  4JI2 J;  1VHI A;  1JXE A;  5MLC V;  1XWL A;  4YUD A;  2E29 A;  2IA6 A;  3QO9 B;  1HQU B;  2RQK A;  4IDK B;  2OEL A;  5I42 B;  3L4B C;  1QLN A;  3U1N A;  4I7F B;  4K0K F;  1NK4 A;  1J5E F;  1SQG A;  2VFS A;  4LRD A;  5BXI A;  1S9G A;  1PJ5 A;  5GAE I;  1DUR A;  2I9S A;  3DHX A;  3GJS B;  3R6G B;  3ZC4 A;  1Y5L B;  4IRK A;  1SIW B;  5ETP A;  3QWP A;  4B3O A;  3ET6 B;  1RT4 B;  3KJV B;  3K89 A;  1FXD A;  1Z2L A;  5IZH A;  2EG2 A;  4M5N A;  1MU2 B;  3CIM A;  4IO1 A;  3OHA A;  4DQS A;  2VBX A;  4CO5 A;  4MK8 A;  3HHK A;  4U96 A;  4B9L A;  2QV6 A;  3MM8 B;  1TV6 B;  3VGV A;  2D41 A;  5G0R A;  4QWE A;  2NLW A;  2XGQ A;  3BM7 A;  1KHV A;  3RRG A;  1H7X A;  2K3I A;  1M1G A;  2G9O A;  2HSE B;  3M1V B;  3TNV A;  3VZH A;  1TL7 B;  4A8X A;  2C2N A;  5CYQ B;  1S57 A;  5B0A A;  1XR6 A;  3OHB A;  4MFB A;  1A6L A;  3H7H B;  3E2E A;  4I67 A;  1BXN A;  1HNV A;  3Q8V A;  2J6U A;  3H2L A;  1NSK L;  1VQ7 S;  2M3D A;  2HVI A;  3P6Y C;  1HHQ A;  4ZVH A;  1YKW A;  2CQ1 A;  2IHR 1;  1FE4 A;  2UUT A;  1U4B A;  3NMA A;  3KUH A;  2FJV A;  4ECY A;  1RAF B;  3AH6 A;  4KY3 A;  4QW9 A;  2VL1 A;  2MZJ A;  4ID5 B;  2CQ4 A;  4XPE A;  4Y65 A;  1J5O A;  1TFW A;  2ILZ A;  3IBW A;  5L1K A;  2XMJ A;  4NWB A;  4LSN A;  2CPY A;  4YR2 A;  4M94 A;  4O3O A;  1BD6 A;  1UJ5 A;  1VBZ A;  1U2F A;  4DWI A;  2NYH A;  2Z2Z A;  4USW A;  4KKO A;  5KT2 A;  4K7Q A;  1OY9 A;  4OQJ A;  4F8R A;  4QPT A;  1M5V C;  1YRX A;  4AFF A;  2DRD A;  2KJV A;  2NRE A;  4UF4 A;  2YNG B;  4BLG A;  1RKJ A;  1QAX A;  2DR7 A;  4C0O C;  5G4D A;  4OZ1 A;  3F41 A;  3ZNU A;  2IMO A;  3OUY A;  3DMJ A;  3TEH B;  3CWJ A;  2A3J A;  4YQW A;  2QMW A;  1ZZN A;  3LH2 S;  4B9T A;  2UXC J;  3MF5 A;  2XMU A;  5K8P A;  3FEX B;  3A13 A;  4ILR A;  4B08 A;  3KHH A;  2UVU A;  2OPR B;  1FX2 A;  1FKO A;  3OTO J;  1BHN A;  3DYA A;  2DIU A;  5KT5 A;  3C15 A;  2FVC A;  3IAM 9;  2OPP A;  3PHE A;  3DOL B;  1ZPW X;  2XI3 A;  1T03 B;  4U7U K;  4RO0 A;  2EFN A;  2VV5 A;  1NK0 A;  4M5D B;  9RUB A;  5D0G A;  4OLO A;  2MDA A;  1UWA A;  4WIQ A;  3W2V A;  2V9K A;  2JH3 A;  2X1B A;  4ZJL A;  3ILO A;  3HSJ A;  1TKZ A;  1JMT A;  1VBX A;  4K5R A;  7FDR A;  3RB0 A;  1XR5 A;  4JI7 F;  2XMW A;  4HVZ A;  2EPI A;  1SC3 B;  4KV8 A;  4F4K A;  2E1R A;  4QIF A;  3HI9 A;  1PBU A;  1EAY C;  1RT6 A;  2HWH A;  3T5J A;  4O44 A;  3G96 A;  5CA5 A;  4DZD A;  1RTJ A;  4DV2 J;  4DS5 A;  4EFA C;  4MAK A;  1EQ0 A;  3SI8 A;  2LEA A;  4J90 A;  4DUY F;  1WC3 A;  2EBG A;  4CLZ A;  4K4W A;  1JKH B;  1S97 A;  4NLS A;  1S6Q A;  1RT7 A;  1X5P A;  2C3P A;  2BMB A;  2IA0 A;  4FPI A;  1CEZ A;  4RW4 B;  2BOA A;  2AGP A;  3S6E A;  2D1C A;  4C7Q A;  4ZPW R;  3MOZ A;  3NG8 A;  1RDR A;  4TU8 A;  2N4C A;  1SPB P;  3IWL A;  3R97 A;  2ZH8 A;  3M05 A;  1AZS A;  2FZC B;  2ZVS A;  3PRV A;  1WEX A;  5LMN F;  3VWS A;  2BXJ A;  1X4C A;  1NDP A;  2IAJ B;  2VG5 A;  2YKO A;  3GB0 A;  1NB7 A;  3KOA A;  1XMB A;  3FC9 A;  1LK7 A;  2RIJ A;  4I2Q B;  2AD9 A;  2XY5 A;  3QFW A;  4DL6 A;  2DR8 A;  4MH8 A;  3GIJ A;  2VG6 B;  4DPU A;  3T1H F;  3H4B A;  3MMJ A;  1SJQ A;  2XLK A;  2R7X A;  4N77 A;  5K14 B;  3BGO P;  5KFH A;  3CJS A;  2BRK A;  5T7L A;  4RJV A;  3A3N B;  3BN4 A;  2ZH7 A;  3DLH A;  4V19 X;  1Q7L B;  2D74 B;  4USU A;  2N7Y A;  3GIM A;  1TL5 A;  5DG7 A;  5ETO A;  2R7R A;  4RNH A;  1RP5 A;  1Q53 A;  5EX0 A;  3N6N A;  5SZT A;  2YKM B;  2H48 B;  1NEE A;  2I1R A;  1WSR A;  3LP0 B;  4HHU A;  2CZV C;  4LFA J;  2XLJ A;  1MG7 A;  3J7Y U;  3MTJ A;  1PJ6 A;  4KFB B;  2EC2 A;  4PWW A;  1X60 A;  4TU7 A;  3Q8P B;  4K4Y A;  2FJD B;  4JI3 J;  2OSR A;  5A2Q U;  5JJB A;  3V81 A;  7FD1 A;  5GAH U;  1T9Y A;  2RVJ A;  2E5J A;  3MCN A;  2M4M A;  4Y34 A;  1U25 A;  2GJF A;  3FMB A;  3GFY A;  2OH2 A;  4ZCM A;  3C8Y A;  3OTD A;  1FD2 A;  1GAO A;  2KFN A;  1HMV B;  3KLI B;  1IBL F;  2ZOF A;  1TAU A;  2NXU A;  2CPJ A;  2MHE A;  3M4X A;  3DLG A;  4XDC A;  1DY3 A;  1RGV A;  1R8P A;  1MML A;  2Y1J A;  2AZ1 A;  2V6A A;  4KGV B;  3B54 A;  2AF6 A;  2H54 B;  3T1A A;  1U8W A;  4KAI A;  2HK3 A;  5B0E A;  5FDL A;  1FTR A;  3CJT A;  2ZC3 A;  2WW4 A;  3D28 A;  2DIT A;  2YKA A;  2HQF A;  2RUG A;  2P5V A;  2RJZ A;  3RRH A;  3CJ4 A;  4C8M A;  1YRU A;  4X4V A;  1Y3K A;  4ALZ A;  2B9W A;  3FSY A;  4F4Z A;  3CUL A;  1N5T A;  1L3K A;  3FFI A;  1R6Y A;  5F8M A;  4YOE A;  1X4E A;  4D3H A;  2V8G A;  2FHJ D;  2AU0 A;  1DRZ A;  3AD9 C;  2AX1 A;  5IT9 Y;  4TNO A;  2WCX A;  1RI7 A;  2EK6 A;  3IM8 A;  3SYZ A;  3O2I A;  1YBU A;  1N54 B;  5JUM A;  1MNE A;  1UMJ A;  4UT4 A;  4A8Q A;  1H73 A;  1T94 A;  1J2V A;  2ZUA A;  5HSP A;  2AYE A;  3CCS S;  1LWC B;  3FEZ A;  3KKF A;  3HKW A;  4YHH J;  4RW7 B;  2FHJ A;  4F2S A;  4CO4 A;  4P10 A;  3RU0 A;  1FKA F;  1DTT A;  5L1J A;  2E1P A;  2EFP A;  4ELT A;  2HVE A;  4KIA A;  2PO4 A;  2CQB A;  3LAK A;  2CPI A;  5D4O A;  3V4I B;  3PR4 A;  1I51 B;  2YPZ A;  2HQD A;  3QJJ A;  3Q2T C;  1NAQ A;  2ZDO A;  2C2R A;  3OVA A;  2Q79 A;  4B3R F;  3AB2 B;  1FD8 A;  5KFW A;  5IOL A;  1IBK J;  3D1O A;  2IJN A;  4DSI A;  4PXC A;  4PCQ A;  4K8R A;  4RWW A;  3ISZ A;  1LW2 B;  1JLA B;  4ZVO B;  2AGQ A;  4WTO B;  3NP5 A;  4K5S A;  3UO0 A;  3HHN B;  2WSE C;  3KDN A;  2BE2 B;  2PFF B;  5G0R B;  4DUZ F;  1DLO A;  3BGU A;  3KJQ B;  4FBU A;  3OL7 A;  1HBN A;  4XTT A;  3LP2 B;  1FNO A;  3VAF A;  2DHX A;  3F56 A;  5ETT A;  5DZ7 A;  2GIF A;  1GX6 A;  4Q5V A;  2O3D A;  4UY8 T;  3LWL A;  2DNY A;  1M5H A;  1NPP A;  4K59 A;  2OPQ B;  4YY3 F;  2AJ2 A;  4FXD A;  1KQF B;  3EGV A;  1HNV B;  3CCE S;  4X62 J;  3MR3 A;  2CAJ A;  3GE9 A;  3VAI A;  4X64 J;  5HL7 Q;  1V3Z A;  1CS4 B;  2ZJR Q;  1S6O A;  1L3U A;  2BE7 D;  4TY8 B;  2LXU A;  3HSZ A;  1HLW A;  2V94 A;  1E6Y B;  5ETL A;  5EUH A;  2G2Z A;  4K4T A;  3D68 A;  2I8E A;  3J81 U;  2PE8 A;  1CJK B;  4ZKA A;  1SIZ A;  3EZ5 A;  4ZPT R;  4DL2 A;  4PEO A;  1TL3 B;  4BC9 A;  4QCL A;  1RTH A;  5KFY A;  3MCS A;  3T5H A;  2BBE A;  3MR6 A;  2HHT A;  5EWE A;  1JLC B;  3FZ2 A;  2OTL S;  2KXF A;  3L7P A;  2A6M A;  4ILL A;  2Y1I A;  1WHX A;  2FHM A;  4CLP A;  1P8G A;  2M2B A;  1I94 J;  1V9O A;  4RU9 A;  3VR1 A;  4ZMM A;  2DGS A;  3AQO A;  2ILY A;  2V8H A;  3W9J A;  3G8Q A;  3DOM B;  4I69 A;  1SQF A;  2OD6 A;  3OT9 A;  3KLE A;  1MN7 A;  4OYW A;  3TX8 A;  2VFR A;  1RWV B;  4M5G A;  3M6U A;  4DF4 A;  4LF8 J;  1LFW A;  5H9E J;  4ZN1 A;  2XNR A;  2VBZ A;  3EX7 B;  3H2V E;  2DXE A;  2AJ4 A;  1XQI A;  5J2M A;  4O3P A;  1QVF R;  4J5O A;  2G0J A;  1RSC A;  4OZ3 A;  4Q2L A;  1N6Q A;  1DFD A;  3Q8Q B;  2HZC A;  3JS9 A;  4U7C A;  2WVC A;  2V9W A;  1L5U A;  1XMQ F;  2NXN A;  4P6Q A;  4DPT A;  2VPX B;  3CC4 S;  4NLD A;  2DNP A;  2HWT A;  3DI6 A;  4JI8 F;  3IN5 A;  1X5O A;  1SV5 A;  4C97 A;  3PW5 A;  1RAI B;  2F8E X;  1U1N A;  1N33 F;  1DTQ A;  5DJB A;  4CLT A;  1M0S A;  4FN5 A;  3KLH A;  4QPX A;  2ZH6 A;  3PW4 A;  1NME B;  4F4W A;  1WTB A;  2ZC4 A;  3BH6 B;  2ZH2 A;  2WB4 A;  5CYJ A;  4CO3 A;  5LMU J;  1VIS A;  2UU9 J;  1RHQ B;  4JP8 A;  2OPS A;  4QIE A;  2NXC A;  2B9Y A;  1RZM A;  4V19 J;  2AQ4 A;  1UZD A;  5C2G A;  2D9P A;  1FER A;  2UUA F;  3N0V A;  1NUE A;  2CUY A;  1J27 A;  4KV8 B;  2WVD A;  3CPW R;  1OJ4 A;  5KFG A;  1B99 A;  3PX0 A;  1RAB B;  1RT6 B;  5RUB A;  3WBZ A;  4N76 A;  1IM4 A;  3O6Q A;  1T05 A;  4WP9 A;  4KGK A;  3T5L A;  5C7P A;  1WI6 A;  3KXD A;  3Q23 A; 
#chains in the Genus database with same CATH homology
 2CWK A;  1W7W A;  1UCN A;  3VVU A;  3BBB A;  1BHN A;  3MPD A;  2DXD A;  3EMT A;  3EVM A;  3EM1 A;  3Q8Y A;  1HIY A;  1XIQ A;  1LWX A;  3BBC A;  1NSQ A;  4UOF A;  3Q83 A;  3VGS A;  1JXV A;  3Q8U A;  1K44 A;  3FBB A;  4ENO A;  3FCW A;  4HR2 A;  4DZ6 A;  1MN9 A;  4S0M A;  3ZTO A;  3ZTP A;  3NGR A;  3VGV A;  3FCV A;  3ENA A;  1WKJ A;  2DXF A;  3ZTR A;  2BX6 A;  3R9L A;  3ELH A;  1EHW A;  3NGT A;  4EK2 A;  3EE3 A;  4WBF A;  4F4A A;  4O0N A;  3VVT A;  3ETM A;  3NGS A;  2NCK L;  1NPK A;  4FKY A;  1NHK L;  2ZUA A;  3BH6 B;  3VGT A;  2BEF A;  3EIC A;  2AZ1 A;  5CAB A;  1MN7 A;  3FKB A;  2DYA A;  4DI6 A;  3ZTQ A;  1LEO A;  1S57 A;  1BE4 A;  3NGU A;  1ZS6 A;  3B54 A;  1KDN A;  2HUR A;  2B8Q A;  3GP9 A;  4CP5 A;  1NDC A;  1S5Z A;  1NDK A;  1U8W A;  3PJ9 A;  3Q86 A;  4UOG A;  5CAA A;  1VYA A;  1B4S A;  1S59 A;  3Q8V A;  3G2X A;  1PKU A;  3PRV A;  3EVO A;  2DXE A;  1NSP A;  1XQI A;  1NDP A;  1NSK L;  2HVE A;  4C6A A;  3DKD A;  3EVW A;  3FBE A;  3L7U A;  3ZTS A;  2B8P A;  4W98 A;  1NUE A;  1NB2 A;  3BBF A;  1HHQ A;  2AZ3 A;  1F6T A;  3Q89 A;  4FKX A;  1B99 A;  1HLW A;  3BH7 B;  4KPC A;  2DY9 A;  3FC9 A;  4F36 A;  4ANE A;  1WKL A;  2VU5 A;  1NCL A;  4DUT A;  3EJM A;  4AND A;  3GPA A;  5BXI A;  1NDL A;  1WKK A;  1BUX A;  4UOH A;  3FBC A;  3FBF A;  3VGU A;  3JS9 A;  1NLK L;  3WX8 A;  3B6B A;  1PAE X;  4ANC A;  5C7P A;  5IOL A;  2HVD A;  1F3F A;  3DDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...