3GPAA

Crystal structure of the mimivirus ndk n62l mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gpaA00
2B8PA 3EE3A 1MN7A 3ENAA 3EMTA 3FC9A 3ZTOA 3MPDA 3NGRA 3GP9A 4WBFA 1S57A 1XIQA 1W7WA 3EM1A 5BXIA 1B99A 3VGUA 4FKXA 3DKDA 1BHNA 1NHKL 1NCLA 3NGTA 1F6TA 3NGSA 4EK2A 3Q8YA 1NDCA 4O0NA 1HIYA 3GPAA 3B6BA 1B4SA 1MN9A 1ZS6A 3B54A 3FCWA 3VVTA 3ZTRA 1S59A 1EHWA 1NDLA 1BE4A 2HURA 4UOGA 4F4AA 2DY9A 1F3FA 4FKYA 1U8WA 4HR2A 2BEFA 1NSQA 3VGTA 5CABA 3ZTQA 4ANDA 3ETMA 1NPKA 1HLWA 3FBFA 1NUEA 2DXEA 3BH6B 3Q86A 5IOLA 4CP5A 2CWKA 3BH7B 3Q8UA 4UOHA 5CAAA 1NSPA 2ZUAA 3Q83A 4DUTA 3FBCA 4KPCA 2BX6A 3Q8VA 3DDIA 3G2XA 3VGSA 4C6AA 1VYAA 3EJMA 2HVEA 3FBBA 2NCKL 3ZTPA 2B8QA 2DXDA 1NLKL 3WX8A 3FKBA 1WKKA 2DXFA 3EICA 1NSKL 3VGVA 3ZTSA 3ELHA 4W98A 1LWXA 4DZ6A 3NGUA 3JS9A 1JXVA 3VVUA 1KDNA 4ANEA 3BBFA 3EVOA 3BBCA 3PRVA 4ENOA 2AZ1A 2HVDA 3L7UA 5C7PA 4F36A 1S5ZA 2DYAA 3EVWA 1HHQA 1XQIA 4DI6A 1NDKA 1NB2A 1LEOA 3Q89A 4ANCA 1WKLA 3R9LA 3FCVA 3EVMA 1NDPA 1UCNA 1WKJA 3FBEA 3PJ9A 1PAEX 1K44A 2VU5A 2AZ3A 4UOFA 4S0MA 1PKUA 3BBBA 1BUXA
chains in the Genus database with same CATH superfamily
1Q0NA 4RNHA 2W9BB 2BJ9A 3MM7B 2VBXA 2V69A 3M32B 1Q4RA 3WDOA 3NS5A 5KG6A 1RTDA 3HKZD 4UY8T 2E7VA 3NGRA 3QO9B 3S8SA 2C28A 5BR8J 2MLXA 1S9GA 1WD6A 1UJ6A 2RS8A 1H7XA 1UPPA 2BW2A 2KHCA 2YQ3A 1Q53A 3IR6B 5L9NA 4NLOA 5M2UA 2ZH8A 2J9DE 2EC2A 2LXIA 3G8SA 4CO4A 1HQEB 2CPZA 3UVJB 2OLWA 3HM9A 1J27A 1QSYA 3QIPB 5B0CA 3PEJA 1JLBA 3NS6A 4DPTA 2CPIA 3FEYB 5D8HB 3Q8YA 2AX1A 2LU2A 2NPIA 3BSNA 4P9SA 1YJNS 4TLQA 1ZM4A 2CJQA 3I32A 1S59A 1RWXB 1TKTB 1XMBA 2DHHA 1UEVA 2QL9B 1C1CA 2VFVA 3JQKA 1HBNB 3EDQB 5KT2A 3IRWP 1VQ7S 2C2KB 2MXYA 2YX7A 2WSCC 1RBOB 1UVIA 1MMNA 2E29A 1U6BA 1G2EA 3K0JA 1NK9A 3VAFA 2O5DA 4IG3A 3NEKA 1TMJA 2GIRA 3VCDA 2MTLA 3IS9B 2H5JB 2J9CA 5F3TA 2HZVA 4M63A 1LWCB 4RX6A 1T03A 2WOMA 4LF4J 4JV0A 1AZSB 2BJ3A 2G1DA 4B9UA 4XDDA 1H2VZ 3KMQA 3PVXA 1RU2A 1NZAA 2DR6A 3TQEA 2XGQA 5U47A 4K4WA 2Q3PA 3QJLA 3VF0B 1CQNA 5LXYA 3ZTQA 1GH8A 3A8EA 3QNWB 2DNMA 3ISNC 1N48A 2OD4A 2ADBA 3DLKB 3FMBA 2Y1IA 2NSBA 1F5BA 2NXNA 4DX6A 2CPDA 5K8MA 5GMDA 2AJ0A 2R7QA 3I31A 2GIQA 5D4OA 3H5UA 4KYZA 5FD1A 3L3CA 4QYZJ 4B3OA 5L8RC 1MWQA 3DLEA 1FE4A 2EFPA 5HROB 1SUQB 2V4JA 4C8LA 5D4LA 3KKFA 4ZPBA 3VGSA 1CS4A 1QM9A 1LWFA 1TKZB 2GS8A 3DMJA 4DL2A 4DV5J 3UNGC 4C8NA 1DFDA 3L7OA 2PFFB 5L46A 2V2KA 1VQLS 2F5GA 1NNDA 3PRBA 2FYXA 1LXJA 3TUJC 4FDFA 1CJVB 1FTRA 4MYTA 3H4DA 5F0UA 4YHHJ 2ZBRA 2F65A 4DSEA 1Q8LA 1S7IA 3CCZA 3RBXA 5F8LA 3I56S 2FB0A 5HVHA 4EU0A 5FLXY 5IT9U 3PYDA 3I96A 4N76A 1YWXA 2KXFA 1S1WA 1Q1KA 4F50A 5KT6A 4QCLA 3HHLA 1TVRA 3MM5A 1YBUA 1LK7A 3DRSA 5LJ3Y 4KHMA 4HTJA 1JKHB 2KFYA 3BO3A 5J2NA 2UUCF 2WVCA 4OZNA 4KBIA 3CC2S 4OX9F 3D6TB 5KT7A 1OIAA 1ELOA 1KHWA 2AJQA 3FZ2A 5KFCA 4OJ3A 4DL3A 4LSLB 2GQCA 5KAKA 2MDAA 1KLNA 1VQSA 3DRRA 1NH8A 4WIQA 3BDEA 2LQ5A 3KG4A 4LF6J 2K3IA 4QU7A 5A8KB 4A8XA 5HJYA 1FCAA 2A2CA 4NA2A 3R1LA 1FD8A 1T9UA 1LEOA 1U6FA 4ZVGA 4ZVFA 1R8CA 2LA4A 2BJ7A 1F5CA 3M30A 2RRNA 3LOUA 3FCVA 3EGZA 3T19A 3BR9A 4HL9A 2VIHA 1WNEA 1WKJA 4D3GA 1TQLA 4A46A 1Q7LB 3H8YA 5KFRA 5ETNA 5KFKA 2NUHA 2ZOMA 2AYMA 1TL7B 2B6AB 4ID5B 1U0HA 3SV4A 3NNAA 1BUXA 3IP0A 3LP2B 4FXVA 2R7VA 2LDYA 1X4HA 3IXQA 1BQMB 3KK3A 1PSDA 3BN7A 2ZH1A 1U47A 4I6YA 4HH0A 8ATCB 1S4EA 1KBRA 1H2TZ 1WHWA 4L74A 2F3JA 2Z58B 1O51A 3A3PB 1B99A 4FYDA 3GYXB 4DPOA 4RNOA 1S76D 2VBZA 2HFNA 4ZOSA 3AOBA 3ILLA 3ONQA 4ZP9A 2NREA 2HG4A 1AFJA 1X0PA 4FS1A 2DEJA 1NCLA 1YRUA 3FRZA 5KFTA 2BUNA 2XC9A 4ES3A 2E5IA 1RABB 3MM9B 3UDLA 3DGVA 3A3OB 3I0SA 4CLLA 1RAGB 3G8TA 1ZZNA 2XS2A 5CD4H 2WVEA 4C8YA 1IUJA 2JVRA 4M5DB 4ID5A 3SCJE 3CD7A 3GG0A 1KONA 2ZC4A 5FDLA 4UOGA 1DAXA 1F3FA 1JQGA 3GLJA 4G65A 2LQ9A 4PXDA 3W2WA 3QT5A 4NXNJ 2OAUA 3JYTB 3TA2A 4FKYA 4WK3A 3SQGA 1KP6A 1RYRA 2G2ZA 4KR0B 1H98A 2VBYA 2PEBA 1HNVA 1WEZA 4H4OA 2B5JB 1YJVA 2CNOB 4KB7A 3CJKB 3F73A 1N6QA 3KLFA 2JEJA 2H3EB 4DWIA 4WFAQ 2W25A 1NU4A 3H20A 3NBPB 3OTOJ 1RHJB 3NRBA 5LMUJ 3CJ5A 1JJHA 4OZLA 3RRHA 3C14A 1S10A 3FBCA 3BREA 4AL5A 3DRSB 2HW3A 4USKA 3MEDA 4DCPB 4YY3F 1WI8A 4XPCA 2N4CA 2W8LA 2MQOA 3OLBA 1B7FA 2SXLA 5IV4A 2UZAA 4ED8A 5CHCB 4BC7A 2A18A 2M8DB 4K4SA 4BCAA 5EHHA 2JFKA 3MUTP 2VKRA 2OMLA 3F56A 1HBOB 1N5SA 2HRUA 5E3RA 1N8RT 4FYYB 4A48A 5KFPA 2IA6A 4YB6A 5AE2A 4UQGA 3M30B 4PCQA 1VQMS 1XR6A 2O01C 2MSSA 1RJJA 1GMWA 1U2FA 1WELA 2MZ1A 2L9DA 1DTQB 1B64A 2ZH5A 3ENVA 4C7QA 5DG7A 1U8SA 3G9CA 5DETA 4P2XA 4U6PA 1WUUA 3V81A 1XR5A 2IMWP 2FJWA 1JXVA 1YLXA 1AXQA 3V6JA 2HNYA 2IAJA 5D78A 3PX6A 5KFDA 3M05A 1Y0HA 4Y2IA 2QA1A 1VR6A 2OEKA 1BMQB 3NNHA 5HQLA 4NCGA 1NKBA 1VRQC 3PV8A 1JLAA 3DHWC 3BF4A 4P71A 2YKQA 2KT2A 1HPZA 3TRGA 1PGZA 3MPWA 4V19X 4RNMA 5JVGQ 1YJ9S 2J8AA 2HVIA 2F4FA 2XNQA 4HT5A 4LVOP 3GILA 3T5LA 4J9QA 4HI2A 2UUBF 1S7HA 2M8HA 2JEIA 1NB2A 2E66A 1HWLA 3TAMB 1SC1B 1Y4ZB 2GQQA 3MAAB 2CYYA 4MTPA 4A4JA 4F25A 5IV3A 2YH1A 1IBKJ 4NLYA 4J37A 4HDGA 2ILZA 1AB8A 3QMQA 3W60A 2AD9A 4OHWA 1T9VA 4HLBA 4LREA 3L9ZA 3U1NA 4B9SA 2DGUA 1KVJA 1RAJA 1B0VA 5HQMA 2VF3A 2OTJS 1V3RA 4NRTA 2VU5A 4A8MP 4LQ9A 3IMQJ 1C2PA 1EZZB 1EJ7L 3HFZB 4UOFA 5D15A 4O3QA 4CZCA 2LA6A 3D1HA 3PKYA 4DFMA 1N34J 3G87A 2R3VA 4TXSA 3HK2A 3PTWA 2QMUB 2IJFA 2E1MC 1G4CA 4OFZA 3ZTOA 5A8WB 4DPYA 2W7AA 1DARA 1OQ6A 3D1OA 1RA6A 4ED1A 3O5TB 2V2QA 4C3MA 5J1NA 3M8SA 3OVBA 4PEOA 2QYCA 4KHRA 4AYBD 3CCLS 2KJVA 2YKNA 3DKDA 3CJQA 5EN1A 2CJAA 2WAQD 1S9GB 2B6AA 2XMWA 2XWYA 5HL7Q 3K5NA 3VAMA 3CC4S 1N0UA 2FZCB 3D9BA 1VC6A 1TL1B 2Y0BB 4KC5A 1S9EB 1F6TA 4DR4J 4PYDA 3SCIE 4CLZA 5KFAA 4X4VA 1HIYA 2QLJB 3TAQA 2GIFA 1SVDA 4K0KJ 1K1QA 1S9EA 4WIIA 3VVTA 3CUNA 5F41A 2YH0A 1S9FA 4O3PA 3TEHB 1QAXA 4RUCA 5I42B 1S99A 1EAYC 5A2QY 2BRKA 1S6OA 1OS5A 2K2PA 3PYEA 3GCWP 3K8VA 5T41A 5KFEA 2DRAA 1WC1A 2Z2YB 2G13A 2V8GA 2MKJA 4DPXA 3CCES 3DM2B 1YG0A 5ETQA 2DPIA 2XMAA 1N56A 2XI2A 2VA3A 4RW9B 5KFQA 4I4BA 3FEZA 2HQFA 1FK9B 1P9QC 1NJWA 1U8WA 3DOLA 4OYAA 3I82A 3PW2A 3CVKA 1LXNA 4J90A 1D09B 4I67A 1E6YB 2HLUA 3VGTA 2Q1LA 3M8YA 4CH1A 3M2UA 3UN3A 4E2FB 4H4KA 1KWMA 2YQ0A 4JI5F 2V67A 1M5OC 2DCLA 1URRA 3Q2SC 2J0WA 2D9PA 2I8EA 3DOMA 1YITS 3VAIA 2YWGA 2QLBB 4CP5A 1T95A 3ILIA 3O44A 3Q8UA 1ZOTA 4OIXA 4YDDB 1EKRA 2BW7A 1V6HA 3RBZA 1YJ7A 3P96A 4IOBA 4OYBA 3SEOA 4DUTA 4F3MA 4J9MA 3RR8A 3BPDA 2VFRA 2ZKUA 5HJXA 3M6XA 2W4CA 5KFMA 1CEZA 3BGRA 4F4WA 3EZUA 3C19A 4EZ6A 3UO0A 4JI3J 2NCKL 2X3DA 4OI4A 1C1CB 3TEGA 1NHUA 2CQPA 4O44A 1UW4A 4Y0FA 1CLFA 4IDKB 1TUVA 1X0FA 1CJTB 3ET6B 1OMSA 1Y3JA 1HR0F 3QGIA 1SJRA 1JLBB 1NSKL 4NMXA 2CRLA 3NGDA 2Y8YA 3QT7A 3EZOA 1X9SA 4DZ6A 2QJ3A 4O0IA 2V94A 6FDRA 1R6VA 1Z1ZA 3JS9A 1HARA 1UZDA 2XY6A 4PZVA 2CQ4A 4F3QA 2V8DA 3G4SS 5CXTA 3RR7A 2MMYA 2ROGA 2WOMB 5HANA 5IS2A 4FYVB 2CQ3A 4CO5A 4ZVHA 3T9ZA 4C2MA 1WI6A 3CJTA 4L3KA 2E1PA 4CWBA 1IJFB 3DRXA 1RT7B 3M1VB 2UU9J 2VPZB 1NDKA 4WYWA 2ZHAA 1NJXA 3N0VA 3I6PA 5DDQC 2F63A 2R2SA 1NK6A 4F3OA 1SH0A 5K8PA 3VZHA 3AA8A 4OYPA 3RU0A 1HL6A 2HKEA 3HF5A 4RU9A 2JSXA 3KK1A 1QTMA 3QIPA 4RWWA 3KK2A 2JLFA 4NLSA 4F4KA 2GMHA 3GIRA 2PSZA 3HDSA 1WC3A 2QG9B 1PO6A 3BBBA 2XMUA 3OR1B 4H4OB 3BB5A 4KGZB 3TI0A 3AD8C 3K17A 2KG1A 2JOQA 4X4UA 1WACA 5DG8A 1W2IA 3CMQA 4KH1B 4L75A 1VHFA 5EUHA 5KFNA 2BQRA 1JLEA 4B9MA 2PDAA 4DFPA 1U1QA 2QMXA 2IRYA 3JQJA 3S1TA 4MIAA 5F8HA 1RT4A 1S57A 1X4AA 3CSKA 1FRJA 3GCXP 3FMWA 5C2GA 4XO0A 4DR1J 3T3FA 1GK8A 4JI4F 2Y9HA 2M70A 2HMIB 3M2RA 4PXEA 5A76A 5HAOA 2N82B 2AU0A 3GYNA 1J5OB 2DO4A 4FXDA 3PW7A 3ISND 1VLYA 2FJAB 1GQEA 3C6TB 1N36J 1NRKA 1QUPA 1QTNB 4OX9J 1QLNA 3GV5B 5D77A 2XYGB 4ZJQA 4FF3A 4FYWB 2ZE2A 1O6XA 2AIRB 2BKOA 2XHCA 3CD5A 1JLCB 3AQPA 5LMNF 2HFVA 2F4VJ 4Y2KA 4LRDA 1CJKB 1NDLA 2RF2B 1GNKA 2OPRB 2HFUA 4R8UB 1REVB 5L1LA 3SYZA 1G7CB 3R5DA 5E0OA 3MEEA 3W5ZA 2ZJPQ 1IM4A 3OVSA 3LWMA 2ZH2A 4DR5J 4PUOB 3GFHA 3D0IE 3TW0A 2OTLS 2OFHX 2PT0A 3D68A 2R2TA 2J0QD 2V9WA 1U24A 1PC4A 3MFIA 4IH5A 1L3UA 1SL1A 5CABA 3F41A 1VS3A 5IXUA 2VZ9A 4ED6A 3R3TA 1KFSA 1V5VA 1Y5IB 2DGWA 3LUYA 3KOAA 4IFVB 1RSCA 2HNDA 1N34F 3RJMB 2FJDB 3V4IA 1CC8A 4DCOB 4R5PB 1YHQS 2A6OA 2ALZA 3MTJA 3CC7S 4IQXA 1XNRJ 1FF2A 2I5JB 5H9FJ 4UOHA 1AA1B 1L3KA 2LP4A 4DQIA 3IM9A 2FHMA 2R7TA 4DR3F 3GIJA 1TL4A 2GHWA 3DRPB 1IR2A 3M8ZA 2KB2A 1RACB 1FXDA 2MKYA 4TVAB 2HBRB 4Z37A 1J2VA 1VRTA 2GVZA 3AD7C 3ETOA 2V8PA 4OHZA 1NH7A 5RUBA 4LFBF 1FFGB 2ZDPA 2DPJA 4DR4F 3RW6A 3N28A 2BQUA 4QWDA 3EDRB 1NKCA 3HZGA 4FP9A 2JJ4D 3DRPA 5KFHA 1YJWS 1NSAA 3BR8A 4O3NA 1GEHA 2DXFA 2ZD1A 2FJVA 4NA3A 3ZO7A 3C16B 2DHGA 4X2BA 3ZZ0A 1PG5B 3MF5A 1S0OA 1A9NB 2YWFA 1S4FA 3JSRA 2HNDB 4YS2A 2E1CA 5DDOC 5D3GB 1KSPA 4GRSA 4IRKA 2EFQA 2A3JA 2H5IB 1U26A 2ILYA 2XG8A 1BQXA 2G0IA 2CUYA 4C8ZA 1HBMB 1T9TA 2AZ1A 3AODA 3LH2S 4QYZK 5E3QA 1KRPA 3C6UA 4F36A 2OPPB 3ICLA 4QR2A 1MROA 1Z2LA 3BS9A 3U1MA 5L38A 3LA0A 2VC0A 3IG1A 5LSOA 2ZBPA 1SKRA 1HHQA 2HHHJ 1B70B 1ZH5A 2HBYB 3PFEA 2ASJA 4ILMA 2AP6A 4A8WA 2GVZB 3W63A 2UVUA 4DR6J 1S0VA 2Z2LA 3GTYX 4P6QA 3TQ1A 2KT5A 3IG1B 3R8YA 3OFHA 4ZMMA 1H73A 2YNFA 2B9XA 2JC1A 2XMVA 4ZDNA 3KMSA 3R5CA 4GMKA 4YDXA 3GFZA 4F67A 1S49A 3QRPA 1V3SA 4MJKA 1UEUA 3TA0A 4QPXA 1RT5A 2DGVA 2BANA 3W66A 2ZNZA 4NMLA 4U7UK 1BWVA 2EKNA 3W7BA 5KFFA 1APSA 3EMTA 4JI1J 2Y1RI 4IH7A 5FIIA 1WG5A 4M95A 1HD1A 2N7CA 1M90T 2IIHA 3BPSP 4KO0B 1WC0A 2MJUA 2DISA 3MUMP 5ETMA 4B3SF 2LVWA 3LP1A 3POTA 3QWUA 2MPUA 5I3UA 1M5VC 3DC2A 2AT1B 4AL6A 1FKPB 2BYCA 3MD3A 4IH6A 2E1RA 2Z30B 4OMFG 1OY9A 2O1PA 3A8IA 3OR1A 3VR1A 5HN0A 2C22A 4TYBA 3SDEB 4CO2A 4R8UA 3MR7A 4I68A 4MKVA 4XAKA 3X3UA 3OLAA 5C24B 2V4QA 3GPAA 1EB0A 3IFEA 3TUIC 4X4RA 2D41A 1RTIB 4ES2A 1EQMA 2G1HA 1LKZA 2HVZA 3AB4B 4CYUB 2PA3A 2I5JA 2ASDA 1C1BA 1TUGB 3D67A 4J9NA 2HURA 1RYSA 4R5PA 1HYSA 4LQ3A 4N8NA 2Y8WA 3OR2B 1IKWA 4CNZA 2MQQA 1NJZA 4HVZA 2H1YA 3EX7B 5HBMB 5HMZA 4DF8A 1RWWB 4C3KA 4C0BA 4MFBB 5AE1A 3U27A 4Q5VA 3CIZA 3N5BA 2VG5B 2LU1A 3W1YC 4ZJLA 4QR0A 2HRTA 3TWZA 5L39A 1SKSA 4LSZB 4V19J 4DR3J 3I9ZA 3QSIA 5ETPA 4JUZA 2OIHA 5CZXA 2AX0A 3DNCA 2RD5C 1NHVA 4AT1B 2EG2A 4ERDA 2IA0A 2RILA 1EP4B 4WTOB 2Z0GA 1CJKA 2RF2A 1KTVA 5F9LA 2UV8A 1BC6A 5IFMA 3EUNA 3LO3A 5DM7Q 3MM8B 4EBCA 3GB0A 3CO0P 3RTVA 2RDIA 1JLFB 3WX4A 2DTJA 4PG7A 3GFYA 1R0AA 2CQ2A 4F26A 4WCEQ 1SJ4P 3HSGA 1TK0A 4YEAA 1I1GA 3FBBA 1UZHA 3MMCA 3C6TA 3LP0B 3KNAA 1A0OB 1GFWB 3VTIA 1B0TA 2HAIA 1Q95G 4JYAJ 1FRKA 4L6V3 2HHSA 1KQFB 2WBRA 4H4MB 3RBEA 3MR2A 1UVNA 2HHUA 1IVZA 3I4PA 2R8IA 1YRXA 5ETSA 3DLJA 2HS0A 2BBEA 2F9DA 3BSAA 3ENWA 4YB7A 4F02A 2PE8A 2I38A 4ZHRB 5EGYA 2J6TA 2F4VF 1BXNA 1Q8KA 3ZFVA 5HP1B 2KVQE 1ZTWA 1N5YB 4H4KC 2BJDA 3PR4A 2OPSB 1IKWB 1RLCL 4PWWA 3K5MA 3RB0A 2DGTA 1ZA1B 2OFGX 2GW8A 1HNIB 4UW2A 1T9XA 3MMCB 5IWAJ 2ZBIA 4NCBA 2VDHA 4RR5A 1Q16B 4OHVA 2CNLB 5B0AA 2DYAA 1KKHA 2C2OB 3EVWA 3R7BB 4NZ6A 1D0EA 2R7SA 3DOKA 3V6DA 1CJTA 4DR1F 5DQGA 5GMKa 3MI7X 3I55S 2Y3YA 2HHQA 4LSNB 4ECUA 1NXIA 4ZIVA 1Y00A 1OO0B 2VQFF 3Q89A 4KHPF 1HBUB 1WOSA 4LRCA 2OD6A 2DD8S 1FA0A 5BYRA 1RQ0A 3ZNJ1 3MFHA 1YKWA 2RB7A 3M2VB 5LL6d 1TELA 2E1AA 5ETKA 1SPBP 3W62A 3L4BC 1UA0A 1UFWA 2LDIA 2FZKB 4WU3A 1K44A 1YGYA 1YVFA 5KG1A 2KFZA 2OH2A 3O1LA 3UI3A 5D0RA 5M2PA 1TKDA 1JJCB 4DEZA 3JXOA 2FC9A 3QAUA 2Q6CA 1RB0A 1L3VA 4RW6A 4C8MA 2H9ZA 4I69A 4N77A 3S01A 4DV2F 3PJWA 1AROP 2YVSA 2LFVA 2PMWA 1LOUA 1VISA 4KE5A 1R31A 2HGLA 4X62F 4LF4F 2C2MB 5I3PA 5A8WA 1FWLA 2NXJA 1NAQA 3BN4A 2WB1D 1FESA 1WSVA 4NZ7A 4WWSA 5C24A 4ZVEA 4CO1A 3LWLA 1R3NA 3J7YI 4ECYA 5CYJA 3D0HE 3V6KA 4K4VA 2BMBA 2UXBF 2QSWA 2P6SA 4YB5A 2YNIB 2MQMA 3CW2C 2BR0A 1DZ5A 3FCWA 3MR6A 2R7RA 3PM9A 3GIKA 3T41A 1UVMA 4CLYA 1PJ7A 1XK8A 2OPQB 2QSFA 2BA9A 4O4GB 3RB3A 2E9TA 1G1XA 3N9UC 2LEPA 1AUSL 2AJ4A 4RNNA 4JI0F 4B02A 3T5HA 2VOOA 3KUEA 2KFNA 1HR0J 5T7LB 5H1SV 2KYXA 2IM3A 3TZZA 3C15B 4AXJA 5BR8F 3JQMA 4IOAQ 2QT7A 1UEKA 2Q6BA 2YNHA 1WHXA 4NE9C 1NSQA 4U8YA 1NMEB 3MMBB 1LW2B 3TX8A 1CULA 1U0SA 2VFTA 3CCVS 9RUBA 1U4BA 1L5UA 2QN6B 3OXGA 3LTOA 2QZ8A 3MZIA 3P5TL 3IN5A 4IFYB 4NLRA 1VQ5S 2WVFA 2GNKA 2P8IA 4DX7A 1WC5A 3AH6A 1NKEA 4F8RA 2J7WA 3RAMA 4DU8A 5CAAA 4OI6A 3V81B 5IZHA 1Q82T 2ZUGA 2CVEA 3D0GE 2E9ZA 1MWYA 3G82B 4I7FB 3HD2A 2OPPA 1N5VA 2JEFA 3C2PA 4OHXA 3KLIA 2CPHA 3GR1A 3CCRS 1GX6A 1HWUA 3HVTB 4J9UE 4DR6F 3J80U 4EI2A 5HK4A 2BQ3A 4DOZA 5CA5A 3MD1A 4ZVRB 2FY1A 2C3OA 2AGPA 3QRQA 2P9GA 5J2QB 1WDDA 1NLKL 1FTCA 4U7CA 2LQJA 3WX8A 3ZNUA 1X31C 2XSFA 5K5MA 3D2WA 4J9VA 4F0KA 1N88A 3OUYA 2KL8A 1XMOF 3D3BJ 3D1QA 1DHMA 4P10A 3AXKA 4YQWA 2DHSA 2B4OA 2MKCA 3EXCX 4EO8A 2XHWA 4I6AA 4FN5A 4RLEA 4RPFA 4IG0B 3NL0A 1HKAA 3PDNA 1LK5A 3TX0A 3BKTA 1AW0A 4K7QA 4Q2LA 1VRTB 4NA1A 4ANEA 2QYGA 1YJTA 3PRVA 4ED5A 2YWHA 1N4LA 1T7PA 1RT3A 4FZVA 3L7UA 1JLCA 2DNNA 1H7WA 2C2NA 2N7YA 2ZE2B 1XERA 2CPJA 2VG6A 3KG1A 3NOCA 3KLEB 1N32F 3QZ7A 3C8YA 1S77D 1T9WA 1ZAXA 1XQIA 5ETTA 2AEFA 5DZ7A 4CLKA 4A8KA 3R2DJ 2YPYA 1PBUA 3FCHA 2FDNA 3JSMA 4Y6IA 4IFVA 3E01B 3UCGA 3G6VA 4M5IA 1SQFA 2DHAA 4ZPTR 5JJBA 4UTGA 1HQUB 2XMMA 1R0BG 1MMDA 2VFUA 3PHEA 5GMEA 4LRAA 1W2BR 2HHXA 4CTAB 1FE0A 5DRKA 2D3ZA 3HULA 3G6ES 1S1UA 2AZ3A 4DQRA 5J2MB 1E6VB 1UKUA 4RUBA 1TKXB 3CJ4A 4LIWA 2HQGA 3EE3A 5JUMA 1MN7A 1VMBA 4U95A 4X66J 1IBKF 3ENAA 1TKXA 2EC0A 3H40A 5DO2A 4Q8FA 5HVFA 1X5TA 3T1YF 3CDBA 4WBFA 2MKHA 4L73A 1JB0C 1NPRA 3GONA 2G0CA 4K59A 5I3QA 4DUYF 2NUUG 4F7VA 2QEXS 2X1GA 1N5TA 2CQBA 2DNOA 3MPYA 1JK9B 1X8DA 4TQRA 1HBOA 5B08A 2Q66A 3W9IA 2FUG9 4M5NA 1C0TB 1TV6A 2MZJA 4QJVA 1G3OA 2L9WA 4M5DA 4DXLA 2P2CB 3J7YU 2FVSA 4LF5J 2Z4PA 2CXEA 3KJFB 4QIFA 2ZH3A 4DS4A 1CC7A 1VJWA 3KLEA 2B4UA 1X4DA 3RGIA 5E33A 4LF7J 1JLEB 3W65A 2BE9B 3BSOA 1IR0A 1BE4A 4NLWA 4QQBA 1S6UA 5DDRC 1N36F 5IM0B 4LFBJ 2LYVA 3NCRA 1K0VA 4FBUA 1FX4A 1HI1A 1ZZFA 4GKJJ 1ZM2A 3D6FB 2V50A 3PIOQ 2B5JA 1RWPB 4NPOA 2EFOA 2OSQA 1DTTA 2IM2A 2KU7A 3OTEA 3H5XA 3QFHA 3OL8A 1XMQF 1F2HA 4LSLA 1QVFR 1FI4A 3VALA 2IC3A 3CCUS 4NLGA 4DV1F 4GVLA 4CLFA 4YY3J 2D74B 4DDFA 3UWTA 1RAOA 5LSRA 2CKWA 2EXUA 1SV5B 1PJ5A 2CQDA 3BH6B 1D9AA 3DXSX 3CO9A 5AE3A 1JLQB 3HO1A 3M4XA 2FJEB 4QW8A 3BH7B 3MEGA 4UOCA 4X4TA 1FKAF 1NSPA 4U8VA 1CG2A 2GHPA 4RUAA 1JXLA 2CZ9A 1JJ4A 3HVTA 2UVRA 4NI2A 2KT3A 4KGXB 3EYZA 2KXHA 2V9KA 5AXLA 4YB1P 1K8AT 4CCHA 1FXLA 4OI0A 4Q8EA 5H9FK 2R2RA 2K7KA 1JLGB 2MLZA 4K8RA 2DR7A 2LECA 1ICEB 3DMJB 2L48A 3IM8A 2EI5A 4HDHA 5C25B 1RK8A 2DNLA 2ZBCA 2VL1A 1S12A 3M2UB 3WZ0A 1OYEA 2RRBA 1W26A 2F8HA 2ZVIA 3IRXB 4HHUA 4XPEA 2XZTB 4WYLA 2RDDA 4ECVA 4B3OB 4DR2J 2WZ1A 4OX8A 1WTBA 1PAUB 4IR1A 1CULB 3PYFA 4OL8A 2KG0A 3QT8A 4EYIB 4F4YA 2YY3A 3GIMA 4PYAA 2GJFA 1F9FA 2KJWA 1IKYB 4ECXA 1Y10A 4XDCA 3TANA 1I5OB 4USIA 1UETA 2EK6A 1SKUB 2CNNB 1SB6A 3BBCA 3M8PB 4IUFA 4Y2MA 2UUTA 2RNEA 2V0NA 3CNQP 3CTRA 4TU7A 4DR2F 2NPFA 3CJRA 3IC1A 3DI6B 2RE1A 2R7OA 4MT1A 5G0RA 4ED7A 4O3RA 3UR0A 4EGLA 2IM0A 1WORA 3GFXA 6AT1B 4Q44A 4JV5J 4ZKAA 2G2OA 2V63A 4LRBA 1TL5A 1F0XA 1TL1A 2D7SA 2Q79A 4I7FA 2EFGA 4NYPA 3KLGB 4MKYA 2I0XA 3H2VE 4JI3F 4X62J 1F2GA 2DNHA 1FDBA 1U6ZA 2HIQA 4ZVSB 4WZQA 2OEJA 2XLJA 2V6AA 1Z4UA 4OQJA 2JLEA 3QIDA 4GVBA 2OJ3A 4B3MJ 4K50A 5KFJA 2XTJP 2E5LF 3QPIA 1GMVA 5E5NA 4TYAA 3VWSA 4KKOA 3R7NB 3Q0AA 3J7Z5 1RISA 5KT4A 4CIOA 2BE7D 2QLXA 4JI2J 4OV6A 2E7WA 2KHDA 2YNHB 2DCUB 2PMHA 5E3PA 2FHJD 3DLKA 4NL5A 3ZZRA 4RU2A 4WFYA 5DJBA 1M5PC 4PQUB 1X4EA 2J0XA 2ZOFA 4PWUA 5HMWA 4A8QA 1U1OA 5IQ6A 2C2EA 4ED0A 1RA7A 3D4JA 2CWXA 4NLVA 2UXCF 1FHTA 2OPQA 4O4GA 2AYEA 4OX7A 2E5GA 1KN6A 2COLA 3PO4A 5KFUA 4F0MA 3DI6A 5G0RB 4ZCKA 3KFWX 3DU6A 2B43A 2VASA 2F9JA 3FK4A 1JLQA 1KFDA 3EXYA 2MSTA 2F8MA 2GZOA 5GAHU 1BLUA 3GR0A 3KDOA 4QR1A 3VAKA 4HHHA 2GAHC 1MG7A 2E7XA 4G1QB 5GVQA 1HPZB 3QT6A 4LVNP 5HO4A 3JTNA 4OJHA 1T8EA 2IMOA 3DOKB 3V6DB 1JWWA 3Q23A 3FUYA 4RW4B 5DQHA 3R5GA 2YBVA 2IVFB 5KFXA 2X1AA 4AQYJ 2PD1A 4U67Q 2HEKA 3DLGB 2RU9A 1NK4A 5F8JA 4JYAF 1NK8A 4ZPVR 4OZJA 3SSRA 3V2UC 2JWNA 3MAHA 5A6WA 3W8GA 1KEKA 5HMXA 1HW9A 1WC4A 3IWLA 3QO9A 4KGKA 1RHQB 4DV6J 2XY5A 3K5OA 2PI4A 1LWCA 1T03B 3KJNB 4DL6A 4X65F 2QLWA 1K1SA 2GA7A 1UP1A 1H2UX 3BZQA 2DBBA 1ZAVA 4IG3B 2DEIA 3MAAA 4NEYA 3AXMA 2OEMA 4LFCF 2PFDA 1JMTA 4TY8A 1KTQA 4DG1B 1TV6B 2CWKA 2IM1A 4A8SA 5B7WA 4U7UD 2GCFA 4USUA 1Z2ZA 3MEDB 4Q0BB 4WJBA 1RU1A 4X4NA 1PJ6A 2ZM6J 2HHPA 4QIEA 5E41A 1RZMA 1D9FA 1NZ8A 1YZ6A 2IC3B 2IRXA 3A1YG 2BE2A 4ZCIA 4QBUA 2MB0B 3PKMA 2GHVC 2MYFA 1TK5A 2DXDA 2XSJB 2B56A 3GMGA 4AXIA 3UDCA 1YX2A 4LIRA 1YI2S 2DT9A 3H90A 3TOQA 3RUBL 5J1PA 3OJUA 3ZZYA 3G6YA 3B82A 4X4SA 3FEXB 5IC4B 3H5YA 5HP1A 3OHBA 5K14A 4C11A 2KO1A 3JYTA 2FTRA 1SH2A 4I6WA 3UCZP 2BOAA 3G96A 2RDJA 1XNQJ 1VGYA 2H54B 5L1IA 4P72A 4QZVB 3U7JA 2E44A 3TA1A 2GQ2A 2FQQB 3O8WA 4DHVA 5GADU 2ZH6A 1SJ1A 1C0TA 3FZBA 3OR2A 2HBQB 1T11A 3EZ5A 4J9RA 2RUGA 3PW0A 2HFZA 4I56A 2WSEC 3OT9A 1HW8A 2EBGA 3CWJA 4K4UA 1RHRB 4C48A 4Q45A 2W7OA 4CH0S 4B3TF 3ZZOA 3CXCR 3UD3P 2C2RA 3I87A 3PJXA 2W2PP 2UV8G 4LMZA 1DTTB 4QW9A 3SDEA 3JAMY 4N7TA 5D4NA 4ECQA 3SSSA 3HHLC 5CD4A 2IVMA 1ITPA 3H42A 2CPXA 3GV7B 2XEXA 2GC8A 5JMNA 3PRDA 3OFEA 5K8OA 1EETB 5A0YA 1PKUA 5EWEA 2XMTA 1HNXJ 2LXUA 3LAKA 3PNIA 5DZ6A 5C2CA 2B8PA 1NM2A 2WVDA 3HX9A 3V4MA 3QZ8A 3MUVP 3VQTA 1V9OA 2HRYA 1OSDA 2BKPA 2K8GA 2Y1LB 2FZGB 2JHEA 2H5EA 3M8WA 5DQIA 3SV3A 3J7ZT 5HLFB 2WK4A 1P6TA 3QJPA 3ZC4A 4LJMA 1GXLA 1GXUA 3AFGA 3MM9A 4JI6F 4CNYA 4ZITA 5AJ3F 1VQ6S 3ADAC 1IR1A 2W1BA 2UVWA 4ILLA 3QJJA 1QE1B 1RCOB 4PKDB 4DV4F 4OYZA 2LEBA 2ROEA 2W2OP 5E7OB 1RKJA 3NGSA 3GJRB 3GJSB 2YQ1A 3NWRA 3B4MA 1UVLA 3BV8A 3UD5A 1O5JA 1B4SA 3UW1A 2K3KA 1FKPA 4ZP6A 1XNQF 5ADZA 3D7SB 2MHNA 2ABYA 1XC9A 1T3OA 2G0JA 2BABA 5KFBA 5GAEU 2BZ2A 2DY1A 2MGZA 1KQSR 1F3VA 3US5A 1P9YA 2UXDF 2GFFA 3CCTA 3JSYA 1FX2A 1TVRB 2XYPB 3MM5B 2IYIA 4LBPA 5J2QA 2OSRA 1U0HB 2HQIA 1X4BA 1OYDA 2V2ZA 4BC9A 4DV0J 2I2YA 2F1FA 4JV2A 1CJUB 1S0NA 2XI3A 4ZLPA 4URGA 4DR7F 3HT0A 1VQKS 1IWGA 2IDLA 1SQGA 4CDIA 4X4QA 4HI1A 3HHNB 1RT6B 3Q2TC 1SH3A 4ZCMA 2ZNYA 2LCWA 2WONA 4EZ9A 1WG1A 2ACMA 1S1VA 5F8GA 3KHRA 2ZM6F 5JVHQ 4BHQA 5IQQA 1SQEA 4EO6A 4HT7A 4DSJA 4AUKA 1DQ8A 4LBIA 1H38A 1F60B 4Y00A 1DY3A 1RHUB 1SUQA 3UFCX 2U2FA 3DCAA 3K8WA 3TJ8A 4IG0A 2HQ3A 2PO4A 4USTA 3VV2B 1QAYA 4NYZA 3R97A 4JV1A 4WXWA 3THTA 4C97A 4X65J 2EFNA 2FVRA 2VQFJ 1QJHA 2K06A 1HI0P 4KHPJ 2AKWB 2HVEA 4K4YA 3ZTPA 4WZMA 3I5BA 3CCQS 5J1EB 5LM7E 4X4PA 3UN5A 4KFBB 4UZBA 4K4TA 3V4IB 2P9CA 4LF6F 2MQ8A 1KLMA 4DR5F 1RT2A 1F1BB 3R27A 3O3LA 1VQOS 2CJKA 4L76A 2OP5A 2JX2A 4ES1A 4WE1A 3HP6A 5DS7A 1LV5A 3KLIB 3KDNA 3ULHA 4FYXB 1K47A 3G82A 3H0PA 5KG7A 1T05A 4K5RA 1RTJB 1U1MA 1RHMB 4DV7F 3NAHA 4I2PB 2UUAJ 4P2SA 4F0HA 3UE2A 2JNJA 4JBCA 4UQTA 5BYQA 3H7HB 3AY0A 1LQ9A 4P7TA 2V2VA 1VQ9S 4CLUA 4WK1A 5C42A 4PWDA 3PO5A 1D9DA 1FFSB 4ZLNA 3WIVA 2DIUA 2J7KA 2AQ4A 1HWIA 1UA1A 2BDPA 2UXCJ 3GJTB 4YN3B 1W25A 4DI6A 1HQEA 2B4VA 3UVJA 4Q43A 4DV5F 4JOUA 2FLPA 2KRRA 2MQLA 3TZYA 2VA2A 2NZCA 1VQ8S 4ANCA 1HNIA 2PI5A 1VIXA 4ZP8A 1Q5YA 3BO4A 2V8VA 2VDIA 2XYHB 1X4FA 4KV8B 5KG4A 2ZFHA 1NK7A 1J5OA 1QSLA 2B7BB 1JNZB 3VAHA 3PJ9A 1HA1A 2HS4A 3OTDA 1RTDB 1PCAA 2CG8A 1RBLA 3FDSA 3ILJA 2DR9A 3M32A 3F44A 4KY3A 2AGQA 4MK7A 5HSPA 1Q78A 3H5SA 2Q43A 2E5LJ 4CT9A 3M6UA 4ETZA 2I9SA 4LRFA 3AOCA 3LANA 4DL5A 5H9EK 2MZSA 1PYTA 3CD0A 2FVQA 2IBKA 3J80Y 2EG1A 5LSLA 3KHHA 3A3NB 1TKTA 3DYAA 2Y1JA 2ASLA 4PG6A 2HNZA 2VFSA 2D1CA 2LEAA 3GYGA 1IBLF 1JLFA 3KK1B 4WP9A 2M2BA 4DN9A 4WFNQ 3MCMA 5KOXA 1C4CA 2ZHOA 5HVGA 1S0MA 1BHNA 4F4XA 1P1TA 4M5GA 1G6BA 2L41A 2AWZA 3ITHB 3AJ1A 3M6VA 3QQCD 3THVA 2ASYA 2E5JA 4YR0A 2BVZA 4OZ0A 4NOHA 1RP5A 4G6VB 5GAGU 3RB4A 3M2RB 1QSSA 2Z56B 1S1XA 1PC5A 2O67A 5F8MA 3KJVA 5ETOA 2LKZA 2L9NA 4GC7A 4DV4J 4MFBA 3CT9A 4IO9Q 2HPUA 2J5AA 4ECTA 2W9BA 4CRJA 4JI6J 4O3SA 4GKKF 4QWEA 4B3SJ 2KH9A 2GMLA 1RLDA 4HR2A 4N8OA 2RU3A 1RTHB 2A6MA 4A47A 5KFLA 4JP8A 4OI2A 3MHYA 3UDVA 3Q8QB 4ZPAA 2R9LA 2BE2B 4ANDA 4DU7A 5D4PA 3CB4A 4RW7A 1HNZJ 3P6YC 2ZVSA 4DSIA 3EWGA 1XN9A 3FNNA 3Q86A 5IOLA 4M5JA 1RTHA 1HHTP 4DSLA 1D3WA 2CNKB 3HJVA 4GO5X 3IGVA 5K8NA 2ZH4A 1D8ZA 3PHTA 4N41A 1X5SA 2HGMA 2OPSA 3CULA 3NS7B 5F0WA 3SI8A 1FERA 1RTJA 3L95X 3Q8VA 1RKIA 4HHJA 2ADCA 1N5YA 1M5KC 1S6QB 1URNA 4YR2A 1TFWA 3KLHA 4IRDA 3G8QA 4TY9A 5A8RA 3T6BA 2AEMA 2VPWB 4LBHA 3WHIA 2WTFA 2ZH7A 3BO2A 1XMQJ 3KLHB 4H4MA 4PR6A 2FJBB 2QV6A 3N79A 3MAQA 2YWWA 4LUBA 5KG0A 3TO8A 2BANB 4B9NA 4B3TJ 4CO0A 2GJ2A 4KV8A 2VJUA 2J0SD 1VBYA 4PG8A 3BQ0A 2XS7A 4WFBQ 1XEZA 1YQHA 1UMJA 2ALYB 4XK8C 3WIUA 4ZVQB 2YNFB 3N6NA 3N6LA 3TVZA 4Y34A 5KFYA 2JRSA 3O6QA 2ZDOA 1RWKB 1B0PA 2Z8QA 3DOLB 3ZZTA 3HKWA 2M0GB 5ITHA 2IJRA 5KFWA 1TAUA 4LF8J 3MM8A 2X51A 5H9EJ 4EMDA 3LAMA 2YX4A 1ZYQA 2P6TA 1EP4A 1WTFA 4O44B 4YR3A 3RB6A 1LNQA 1MLAA 3JTOA 1H0HB 1KR4A 2ZITA 4USJC 1RI7A 2YNGB 1U1KA 1N52B 2BV3A 1SJ3P 3CD6S 1ULRA 1PBAA 4I2QA 2IJNA 3V6HA 1V3ZA 2G2YA 2KRBA 1DLOB 3LALA 2VG5A 3UR3C 7AT1B 1HBMA 3HSZA 4DL7A 2A1BA 2IYGA 3TP2A 2W2NP 4PPZA 4DLGA 4J91A 1RT2B 2AF6A 4NXMJ 2MZRA 1K0TA 3FVYA 4P7VA 2DK2A 1KC8T 4TN2A 1FNMA 2NQPA 1YTYA 4BLGA 4NLXA 4LFAJ 3UQSA 3VAGA 4FPIA 4AL7A 2ZJQQ 1ZETA 1Q8BA 4K2JA 2WW8A 5C42B 3DM2A 5AXNA 2HWIA 2EVZA 4LF2A 2DNKA 3DYAB 4UF4A 4MYUA 5IT0A 1FO1A 4DL4A 2VG7A 4KRWA 3NOGA 5ETVA 4XTTA 4RBUA 1OSCA 3QYYA 3NLCA 3KLVA 4ECSA 4I2PA 2CJ9A 2J8SA 3WBZA 3AJ2A 1TK8A 2I6WA 1SIZA 1FRLA 1S1TA 2HQDA 3T1HF 2CDRB 2DNZA 2M88A 4ZS6A 4OI3A 3CCSS 4B9VA 1NHKL 1VCTA 3C66A 1YIJS 2JC0A 5KT3A 1LFWA 1DJ0A 3I5CA 1CJUA 4ZN3A 5BYSA 5D3GA 1ROFA 2DNQA 5AT1B 1O8BA 3DGPB 5AXKA 1VI7A 4USMA 1JX4A 2QA4G 2DR8A 1ZS6A 3B54A 2D69A 1MWZA 4DCJB 2QX0A 1TU0B 1VRUA 1GAOA 1IQTA 3C16A 3TJ9A 1IBMJ 4NLUA 5E3AA 3MR3A 3GJQB 2M9KA 4URQU 4NWBA 2MHEA 1DQ9A 1BD6A 2C1EB 2QE5A 3G86A 3GWCA 2V8HA 3MEEB 4FPRA 4DL0C 4NYOA 3KTQA 1RAIB 1UWBA 2BEFA 2ZWOA 4R0JA 1IM6A 5EX0A 4WPAA 4QIGA 1H6KX 4BS2A 1MU2B 4M5MA 3W61A 1UL3A 2EPIA 3EGVA 3ETMA 1NPKA 2MZQA 3JTPA 5D6GA 1KQGB 5M2RA 3FBFA 1NUEA 2DO0A 2KDOA 2E5HA 1QUVA 2M5YA 4JI2F 5F3ZA 2RRAA 5KT5A 3PY8A 4NLTA 1I94F 4URSA 1RXOB 3OTOF 2VD3A 3PIPQ 2I1RA 5J2PA 1CPZA 3Q83A 1RWUA 3R5BA 1M5SA 3PZPA 2FVCA 3KWMA 4TU8A 1HMVB 1FKOA 2L08A 4KFBA 2W8KA 2ZJRQ 1P27B 1SV5A 4G1IA 4Q2MA 8RUCA 4A8FA 2CVIA 2YXLA 1QD1A 2MQPA 3OL6A 2JL9A 2NYIA 1VYAA 3L09A 3DRYA 2QC3A 4EWTA 1EETA 4WKYA 5A0YB 3MURP 1JLAB 4PAAA 3W8PA 1UFLA 3UPFA 5K14B 1VOMA 2LQ8A 4IO1A 5KFVA 3N4WA 3QWPA 4I2QB 4ELTA 2XMJA 1EARA 1EX8A 2B7CB 5B09A 2RQKA 3ZZPA 4PRFA 1U45A 2FY8A 3SCKE 2M52A 2XCAA 3KHLA 3EPGA 2VPXB 3NWGA 5B0EA 5EWFA 3OW2R 5DLFA 2Z57B 3VZIA 4UUXA 5CCMA 1DTQA 3SQGB 4ATNA 1JJ2R 1S1VB 3A8JA 1QY7A 2IVYA 4MIWA 1KDNA 1IXKA 1RT6A 2R2UA 3W2WB 1M1GA 2DH8A 3BQ1A 5FDLB 2GVDA 3D6MB 3D5MA 1K9MT 4QWAA 4TY8B 4DG1A 3I5AA 3R5AA 3MDFA 3OQ2A 1D8YA 3Q8PB 1FDDA 3HXMA 3RYLA 2MJNA 2NXUA 4F04B 1T3NA 1IBLJ 3HSDA 1K73T 2KZMA 1HHSA 2IBOA 4OLOA 1S6QA 1GXTA 4J9PA 3W9HA 2RUSA 1RUSA 2CDQA 3TYTA 2AEJA 2BKNA 1VFJA 1XJWB 1M0SA 1WEYA 4DV3J 1FJGJ 1N33J 1NEEA 3K7RA 1FWKA 4Y2AA 5T14A 1REVA 1HNVB 1R8BA 3RAXA 1FRMA 1X5PA 3AT1B 4J5OA 4FBTA 1RBAA 1E6VA 5CH7B 2WRMA 4M8LA 5LJ5Y 3F0NA 4RW7B 3SSQA 2L3MA 1M1HA 3DFEA 1GTHA 2RS2A 4IDKA 3BGOP 2JEGA 2YWEA 3FC9A 2D3UA 4RW8B 4UUWA 2CZ4A 1U02A 5DGAA 3UD4P 4TLRA 3JSMB 2LXFA 3CDEA 3CJ8A 3EM1A 4DFJA 4QU6A 1OWXA 2CQCA 1XTZA 1VC0A 1NO8A 2IRUA 4FKXA 2MEWA 3HHKA 3I0SB 1V5IB 2VHGA 1IBMF 4G1PA 4GKJF 1RGVA 2JH3A 2JFDA 2MY7A 3M8QB 3KJVB 4E0DA 2ZZNA 1MMLA 2KKHA 2HK3A 4Z7CA 4ZLJA 4LF7F 2CPEA 2PC6A 3TUZC 4ZVTB 3HHDA 2FPHX 4B3RF 4K0KF 1UTAA 2NXCA 2DNPA 3M7VA 3UNYA 4JI8J 4L72B 4QIWD 4LF5F 2DITA 3HHLD 2U1AA 2CG4A 2WCXA 3AJDA 1RADB 4ZJOA 1WJ9A 1VQNS 1S6PA 5E3CA 4YHHF 3OUYB 1BQMA 1JKHA 3MWBA 4MK8A 1XBWA 4NRUA 2KYZA 3P8BB 4WP3A 3Q8RB 1LW0A 1RDRA 2DIVA 2MQNA 4UT4A 4DN0A 5CYQA 1FRHA 2XO6A 3M1VA 3JAMU 1JXEA 4A8YA 2KXNB 3MMAB 3KLGA 3FRYA 4OV1A 2MZTA 2W4PA 3ISZA 3AAWB 4B17A 2QFIA 1HLWA 2O66A 4JI4J 4ZLLA 1U1NA 4IQMA 4A8OA 1C0UB 1U25A 1R0CB 4C11B 2XGPA 2VQEF 1S97A 2ACYA 3MGJA 2RH3A 3BEGB 3DOMB 4OZ1A 4YFUA 3MECB 3E2EA 5A8KA 1LWFB 3IA0A 4NLDA 4NEZA 4USWA 3W64A 1S79A 4IYQA 4IFYA 1Q7YT 5LT5A 4FVCA 1VK8A 3DN9A 2EBEA 2KI2A 1TP7A 2EFVA 4C0OC 3QSYB 1S72S 1U2CA 2XS5A 3PXGa 4G3IA 2F7VA 3BM7A 1ZPWX 4RW4A 1QDUB 4N5SA 2E9RX 3HSJA 4PWDB 2HFOA 3FQKA 1N32J 4ITSA 4J7CA 3IWXA 4QOTA 1FXRA 3G71S 3W9JA 5IT4A 3R6GB 4RBTA 5C25A 3ZTSA 2N3OA 2VICA 2YKPA 3MECA 5F9NA 2XWXA 3IAS9 1YJUA 4JI1F 1R8HA 4MAKA 1YSJA 1OQ3A 3MOJB 2KM8B 3NMAA 1WSRA 1AZSA 4UZCA 2ZZTA 2AGOA 3CDWA 3IBFB 3LPYA 2CZVC 4PQAA 1NB7A 4GO7X 3KXDA 1OJ4A 3VVUA 2B4PA 2XO7A 4LF8F 1Y7PA 3BBFA 3QGPA 4M5KA 3T6JA 1U1LA 2NXEA 2O3DA 1XMOJ 2GV1A 3CCWA 1KLMB 4U96A 3HFKA 3LPEA 1S5ZA 3M8PA 3R6LB 3PFOA 5CYMB 1SJQA 2VBWA 3G6XA 5J1EA 4WFXA 4EYHB 5AJ3J 2V4JB 3BGFA 2CPFA 4HEA9 1VQYA 3HD1A 3KG0A 3DLEB 3OSPA 1ZA2B 2A2DA 4Z2XA 5EWGA 2VONA 4NCGB 2Z2ZA 2UXBJ 4ED3A 2WBMA 4IRCA 1I6JA 2WHOA 2J6SA 1DRZA 2JVOA 1VQ4S 2V34A 4OYMA 2P5VA 5EDWA 2AJFE 3IRXA 4G1QA 3R9LA 3TZXA 3JB9k 4ELUA 4K5SA 1NDPA 3FBEA 1H3DA 1R0AB 1S48A 3ZXWA 1FEHA 4RL1A 1PILA 3GE9A 3LW5C 7FD1A 4DQQA 4X64J 2R7XA 3R1HA 2C3UA 3M8QA 4V1Ak 3NNCA 2QFJA 2PEHA 3L7PA 6FD1A 1ZPVA 1RT1B 1VBZA 4N47A 1NPPA 1VC5A 2DVIA 4ER8A 2XNRA 3MMAA 3RAQA 4F2SA 3MEGB 3PX4A 4P2MA 3HLUA 1ZAWA 4KQZA 1PYSB 2UVVA 4PQUA 2ZBQA 3AHPA 2DHXA 4LSNA 2HWTA 4NXNF 2HHHF 5KFSA 1IKVA 1YBTA 2XMKA 2V5HG 5B0FA 4J9KA 3KUGA 3HHEA 1GTEA 2DRDA 1S6PB 2RKIA 2W2MP 1RCXB 4ECWA 4JI0J 3KYLA 3EPIA 2H48B 3IBWA 2DNGA 2GMJA 2RSQA 3BGLA 2NLWA 4KKOB 1YBAA 1FJCA 3NG8A 2FD2A 2NS1B 2D9OA 4KGMA 4EK2A 2QTWA 1GMWD 1UPMB 3AQOA 3CF5Q 3P49B 4PG5A 2ZHBA 2AJ2A 3QGGA 4PXCA 3J81Y 3MR5A 1QE1A 1JLGA 1T94A 1IBCB 1EHWA 2W01A 3FSYA 3HI9A 4DBQA 1HD0A 5HQ8A 3BDPA 3X1LB 4Y3CA 4OYWA 3E51A 1C0UA 1RAEB 4ZIWA 2OMOA 4NI2B 1RWVB 4HACB 2FLNA 4X84A 2ZEJA 3TAMA 2XULA 3H2UB 5K20B 1T9YA 3E01A 4CO3A 2P9EA 3H98A 4M1KA 2N3LA 2HBZB 3P3DA 4YUDA 2VH7A 4DV2J 4FNHA 1HNZF 1LW0B 3QAEA 1R8PA 1SKWA 1RWMB 4ELVA 3THPA 1VIOA 4WKRA 4OJ1A 3DDKA 5F8IA 3BKFA 1I3OB 1KOOA 2R8KA 2G4BA 1NJIT 2HHWA 1U1RA 3A13A 1XNRF 2FHKA 1RT3B 4OJGA 4NLPA 1SCJB 2ZUAA 3OXFA 3BQ2A 3GSIA 4FF2A 1F9HA 2HNYB 2FC8A 2IAJB 3CJKA 4CT8A 3FSXA 4DUZJ 2OELA 3NGKA 3DDIA 2BM0A 4FS2A 2DRBA 1CQMA 3PW5A 1RAFB 2OI2A 1HFEL 2J76E 2XCPA 2NYHA 2VOPA 4AFFA 2H4WB 4MKBA 1HNWJ 3VHQA 1HQUA 4ZPWR 2OHDA 3MM6B 4DQPA 1WF0A 3A12A 3MCOA 1XWLA 1QVGR 2FGOA 5GAHI 2VV5A 5L1KA 4PG4A 4W98A 1FRXA 2GJIA 1ZM3A 3FQLA 4JI8F 4CM0A 5LMNJ 4WTYA 3GSDA 4DV7J 4KTQA 1X5OA 4CYUA 1WOOA 4LF9J 3B4DA 1VJQA 2RAQA 2QA2A 5DLGA 5DM6Q 3PR5B 3NBPA 3CGIA 2G9OA 4LR8A 2F8EX 2CQHA 3T5KA 2R8JA 3KLFB 2R8HA 3OFGA 5GADI 4DSFA 2KTQA 2XSJA 3A8KA 3SZ2A 2IPOB 1U7LA 3DRRB 5J2MA 4OYIA 2ZOGA 1HNWF 2KM8C 2CAJA 1X9WA 1ZM9A 2XLIA 3J7A1 2CIMA 4CTAA 1AUDA 2HVHA 4BWMA 5J2NB 4DUZF 3HHLB 1UW9A 3E3XA 1FKOB 2CA9A 4B3RJ 2XZWA 1R7IA 1TL7A 3EVMA 1OY6A 3CMAS 4OX6A 4OYOA 1U1PA 1IWAA 4FNIA 1TTHB 2GVDB 1HI8A 5IC6B 2RT3A 1RT1A 1VBKA 2RHSB 1HWJA 2YTCA 4HACA 4O4RA 3B8HA 5D0GA 5AXMA 3HVAA 4IKAA 4PABA 4DV3F 4F4ZA 4MIBA 4KJIA 1CJVA 4B3MF 1N33F 1S1TB 1F9EB 1B7YB 1Y3KA 2FHOB 3FGVA 2HGNA 4R25A 3DHXA 4EBDA 4ZA1A 2ATLA 2B9EA 5KTQA 2DR5A 2GO8A 1OPZA 5D0HA 2FHJA 3BYPA 2FVPA 2DKOB 1X60A 3GP9A 2AV5A 2XQCA 2VG7B 4DV0F 5BXIA 4DJBA 3FSIA 2W4DA 3K59A 4JV5F 3OHAA 4ICLA 2AMCB 3MOZA 2W9CB 1UVKA 1UVJA 1S1UB 3BKUA 1OPIA 1MROB 2RVJA 5KFIA 5KOWA 3NKYA 4KSEB 4DQSA 4DF4A 2FGCA 2MKSA 3CDAA 2RKIB 3W2VA 2BXJA 4D3HA 2RQCA 5IT9Y 3H59A 2VKZG 3KK3B 2B9WA 1IKVB 1VRUB 3LGNA 1Q8IA 2X1FA 1MN9A 3LP2A 1VBXA 1HMVA 3D3CJ 3HVWA 3QFWA 5SZTA 4EFAC 1YZ7A 3TZWA 1WHYA 1M5HA 3SMZA 5J2PB 3BJYA 3DLHA 4C9DA 4JB8B 2MKKA 1Q81T 1L3TA 2DB1A 2HQCA 3IS9A 2XY7A 4DPUA 2HYIB 2DY9A 2ZD1B 3W5XA 2W2QP 2JZ5A 3MCSA 2C42A 2R8GA 1REGX 3PCOB 2CQGA 2HS3A 4HTIA 2YNIA 4ZPDA 3UDEA 4ZK7M 3CPWR 4UY85 7FDRA 5LXRA 1D1UA 2YNGA 3S7RA 3GQCA 1CS4B 1IKXB 1TKZA 2DH7A 3NY0A 4C8KA 4P75A 4F2RA 5D0EA 3UN2A 4CI0B 3M8RA 4O3OA 1X9MA 1N5QA 1HNXF 4DR7J 1CVJA 3LQVA 1LW2A 2VUGA 4P74A 2D3O1 2WVBA 2JDJA 1I94J 3T5JA 2HLTA 1Y11A 2A10A 4GVBB 2EEYA 3I4HX 4ED4A 3OL7A 3IWNC 4N56A 5CYMA 1A6LA 1VK3A 3D6HB 1NBEB 5DG9A 1S1WB 1SC4B 3DGPA 1RE1B 3A4TA 3G2XA 4DV1J 1VLOA 3MPUB 1FFWB 3O2IA 3J7AN 4RJVA 2IY5B 3GV8B 2MKIA 5B0GA 3K5LA 2W24A 2B8QA 3LF0A 4NX9A 1R43A 3TARA 2XLKA 2J7UA 2C3YA 3TR5A 4ED2A 3MM7A 2YX1A 4IR9A 3D66A 2PN6A 2B3TB 5MAOA 1X4GA 1HQ2A 3FKBA 3R5JB 3SQOP 1WKKA 4ZP7A 3VGVA 3OFFA 3M9NB 5CYQB 3WC2A 1H72C 1R6YA 1JNRB 3ELHA 3LP0A 2GGPA 4O23A 4OI1A 1IKYA 1FD2A 4RO0A 2HHVA 5CQGA 1SC3B 4MH8A 5HROA 1P8GA 2FJXA 1L3SA 1ZBTA 1F5AA 3MEKA 1OY8A 4Y2CA 3K58A 3VQSA 4KH0B 3EVOA 4NCAA 4KT0C 2YWKA 2KZZA 2K7JA 2LQBA 3OD2A 1I51B 2EWHA 3C15A 3P45B 2CFXA 2K1RB 3I0RB 2YKAA 3QATA 5KFZA 3N6MA 3T1HJ 2AYGA 3HJFA 1UJ4A 4CM2A 4DUYJ 4PPDA 4ZVPB 2A0FB 2HMIA 3QLHB 2ZC3A 2AW0A 2PA8D 3BGUA 5HMYA 1RT4B 3V5RA 3ILOA 4HYKA 3PW4A 2F40A 1KS2A 4DX5A 1RHKB 3HPOA 3IO1A 1DLOA 3CE8A 1WKLA 2X3GA 3PYGA 4I0WA 3CJ2A 4ZPCA 4BBYA 1EIYB 1RWNB 1DURA 2RQ4A 4LF1A 1IJEB 1WDTA 4P52A 5KG2A 4JI7J 4LFAF 1HBNA 4RW8A 2DGOA 1KOHA 1SIWB 1C1BB 2VQEJ 1FDNA 3M6WA 2XM3A 3AA9A 1PYOB 3IAM9 4Q7AA 3IR7B 2C2DA 3CJ3A 1BQNA 4K2XA 4QYRA 3CCJS 4LFCJ 3FFIB 1YRTA 4I1TA 1HWKA 2R7WA 3CMES 1BQNB 4YP3A 3H4BA 3AD9C 2HNZB 4OZ2A 3HVRA 1TMMA 3QGHA 4DV6F 3MPDA 1Y5LB 3RRGA 4K4XA 1FVQA 4RW6B 1BWEA 3OSNA 3ENQA 1W7WA 1A7GE 3RG6A 2VJVA 4K4ZA 2Y0SD 3VGUA 2MLYA 4DPWA 4RWXA 5IM0A 4AQYF 5I3UB 4MKAA 1FEEA 2RMLA 3PG9A 4YMEA 2JLGA 5ETLA 4WFZA 3NGTA 2EKYA 2QL7B 2ATCB 2XB2D 2PMZD 3QLHA 3SIPB 1NDCA 1S1XB 2CADA 1FT8A 1MSWD 3B6BA 4ZVOB 3ZTRA 1MNEA 1N0VC 2AJ1A 2APOA 3TVYA 4ZVUB 1RT5B 2BJ1A 1HBUA 3CJ0A 3EGWB 3R7SB 3D54A 4PXBA 2N4DA 5KG3A 4ECRA 1SL2A 1HYSB 4WP8A 4RBVA 3I0RA 1U48A 3KJQB 3UCUP 5G4DA 3ZZZA 3PX0A 3GZ7A 1GT8A 4RKUC 2R7UA 1TR0A 1WF1A 1RTIA 1TUWA 1TZ0A 3U1LA 2ERRA 2CJBA 4TU9A 3VAJA 2QRRA 1J5EF 3T9NA 2W9AA 4C98A 2XZDB 4L3NA 1RWOB 2EK1A 4CLSA 3DU5A 1AYEA 1Q86T 1Y5NB 4WXOA 3C46A 3HFVA 4RZRA 1WF2A 3K5PA 1YDLA 1T05B 2IDEA 4KPYA 3LP1B 3POTB 1X7VA 1FJ7A 2DXEA 2VC1A 2XBPA 1EKSA 4C0HA 1R8AA 3C6UB 1C4AA 3H2LA 4CH7A 1FJEB 4AD6A 4FF1A 2HZAA 3J81j 2IFXA 2ZZMA 1KVKA 3SFGA 5EX3A 3TNVA 4DMZA 1WWHA 3NAIA 4KPCA 5FJ4A 4WF9Q 1VDHA 2CQ1A 4BWJA 2GAGC 2B51A 1WOPA 5SUHA 3WC0A 1VHIA 3EJMA 1KD1T 4RUHA 2J9EA 5DGBA 4C3LA 4GKKJ 3CJSA 3K89A 2UU9F 2VG6B 1FDAA 2ZH9A 2RJZA 4GC6A 1FJGF 1EQ0A 5BJRA 2GO9A 2POKA 2H4YB 3U02A 4RW9A 4ETXA 3CDUA 3B78A 4U9RA 3EICA 1PIEA 1YK9A 3QBCA 3K57A 5DDPC 3K2YA 2CQIA 2LLZA 3P5BP 2OKQA 2DGSA 3MTKA 3DLBA 4FVMA 3KUHA 3DDNA 3NGUA 3SBMA 4B08A 4W90B 5I42A 1SBRA 4WU2A 4CLWA 4IOCQ 2BM1A 2W7PA 5A6PA 4OZ5A 2QL5B 2M3DA 2WONB 4KO0A 4ENOA 3RBDA 1SL0A 3LGMA 4WE1B 4AE5A 5A2QU 4C4WA 1GX5A 1LWEB 8AT1B 4E8UA 4EEYA 4TKTA 3NP5A 5LOQA 1VQPS 5HBMA 1RAHB 1TL3A 2M4MA 2BJ8A 3HZEA 1LFPA 3R2CJ 4W4MA 4B9TA 2YKNB 3GIIA 3D28A 2QA4S 3GG1A 3E8OA 2B9YA 3PACA 3OPKA 4FXWA 1T0TV 4QWBA 3W2VB 4ZCLA 3NXZA 4USHA 5THWA 3Q24A 3Q22A 4ECZA 4DZDA 3SXLA 2YPZA 1MU2A 2QIFA 2HHTA 1NJYA 2NZ4A 1FRIA 2LMIA 4W92B 4OYXA 3OBIA 1UWBB 2BRLA 5GAGI 1PAEX 2J6UA 1IKXA 3NCQA 3P4UB 1O0PA 2RIJA 3M9OB 2DH9A 2DNYA 4S0MA 2OUGA 3OVAA 2NSCA 1TAQA 2X7IA 2M7SA 4JI5J 2H51B 1U49A 4NLQA 2Z2MA 4QPTA 3MMBA 1R89A 1H74A 3MCNA 1U09A 1BGXT 2YKMA 3AB2B 5KG5A 1J5EJ 3DLLQ 4BDPA 1X4CA 4LT6A 1XIQA 3QRRA 5T7LA 3I9V9 2H65B 4KAIA 4CLTA 2WB4A 1IN0A 1WC6A 3SFUA 5C5JA 3PEHA 4LR9A 1TL3B 4OLPA 2DNRA 4H54A 3HT3A 2YKMB 3BSCA 1UFKA 3RW7A 2UP1A 3MMJA 4LR7A 3N5FA 4C8OA 4OHYA 4DFKA 3MPVA 2MGZB 1KQKA 3W5YA 5B0BA 2WSFC 3M9MB 2HFSA 2UUAF 5I4MA 4O0NA 2UUCJ 4YOEA 5IWAF 4LF9F 2HK2A 3DXBA 4HH1A 4ID8A 4ICLB 2W9CA 1MW7A 4PUOA 4X4OA 2ROPA 9ATCB 4KIAA 5CCLA 2VODA 4ZN1A 3Q8SB 5L1JA 1QAIA 4P73A 4DX8H 4TNOA 5GAEI 2QLFB 4CQ1A 4OZ3A 4R0EA 3FJ2A 2ZWPA 1DBDA 1P1LA 3CEDA 3JSBA 3TVKA 4F4AA 2BOPA 1KNZA 2BJEA 4XIUA 2C2ZB 1SJFA 2VPYB 4M5LA 3HMJG 1AFIA 2CQ0A 2CJXB 5K9FA 5HLFA 3T1YJ 3C3LA 1N54B 2C3MA 1UJ5A 4ALZA 3HCXA 3H25A 1KHVA 1UAWA 2UUWA 4X66F 1CSJA 1TFYA 1QAJA 1UWAA 2RHQB 3AOAA 3TAPA 4B9LA 1IQZA 1FNXH 3KHGA 1LWEA 3IBCB 2FLOA 2J9DA 3MM6A 3WQPA 3RRKA 2KVIA 3NMRA 2R4FA 1SC6A 3C14B 2OO4A 5A8RB 2V4RA 2MY8A 2WW4A 3M2VA 4CLPA 4JI7F 4QWCA 2VB6A 5B0DA 2B0GA 2BX6A 2PGCA 5CZVA 5JXSA 4J9SA 2CJYB 3KNGA 1N6QB 1RTZA 4M94A 4NXMF 1FNOA 4C6AA 4HKQA 5FLXU 4KGVB 3TJAA 4EBEA 1WG4A 4MMOA 2QGFB 1GMUA 2UUBJ 2PIIA 4DS5A 3OJSA 1FWPA 1R27B 3FFIA 4P2FA 3NCPA 3EGNA 5ETRA 2OGUA 3CCMS 1B3TA 4QIVA 3GU0A 2IHR1 1Q79A 1WHVA 2V68A 5MLCV 4TQSA 1NK0A 1CBKA 4J9OA 3OXLA 2UXDJ 1LWXA 2R42A 3N01A 2D3OR 1ACMB 2EW9A 2DGQA 2AHOB 4NZ0A 1U2RA 2YKOA 1DQAA 3OV7A 1M1KT 3W3SA 3ZZUA 4J9LA 1ZTTA 4RNFA 1SI9A 4ZHRA 1AT1B 2GX8A 3BYRA 3J81U 1XR7A 2HZCA 4DLEA 1Q5VA 4ILRA 1Y9OA 3SCLE 5HATA 3MXHP 2KN4A 5HI7A 2HVDA 2QO3A 2X1BA 4NASA 5C7PA 2FLLA 3S6EA 3OL9A 4MK9A 2HIYA 2HAFA 3OTBA 4DSKA 2ZKTA 2HSEB 4M5HA 2NR0A 1SXLA 4EUVA 2K1RA 3ITHA 5E2QA 3DLGA 3OTCA 4FF4A 3TUPA 1E6YA 2OPRA 2QMWA 3CIMA 3IGNA 4Z7YA 3KK2B 2FIUA 2DJWA 1T02A 2C3PA 1FK9A 5KFOA 4Y65A 2DGXA 2CPYA 4I64A 5F8NA 1BY9A 2RQMA 1RAAB 3ET6A 4E98A 4USVA 2BACA 1NK5A 5KFGA 3IR5B 1UCNA 3LGHA 5LMUF 4Q0BA 5L9XA 2GGPB 1FVSA 2HWHA 4X64F 3T1AA 1JIHA 1KVIA 2AYBA 3BGRB 1YJRA 1WEXA 4Y28C 1RT7A 3RZAA
chains in the Genus database with same CATH topology
2B8PA 3EE3A 1MN7A 3ENAA 3EMTA 3FC9A 3ZTOA 3MPDA 3NGRA 3GP9A 4WBFA 1S57A 1XIQA 1W7WA 3EM1A 5BXIA 1B99A 3VGUA 4FKXA 3DKDA 1BHNA 1NHKL 1NCLA 3NGTA 1F6TA 3NGSA 4EK2A 3Q8YA 1NDCA 4O0NA 1HIYA 3GPAA 3B6BA 1B4SA 1MN9A 1ZS6A 3B54A 3FCWA 3VVTA 3ZTRA 1S59A 1EHWA 1NDLA 1BE4A 2HURA 4UOGA 4F4AA 2DY9A 1F3FA 4FKYA 1U8WA 4HR2A 2BEFA 1NSQA 3VGTA 5CABA 3ZTQA 4ANDA 3ETMA 1NPKA 1HLWA 3FBFA 1NUEA 2DXEA 3BH6B 3Q86A 5IOLA 4CP5A 2CWKA 3BH7B 3Q8UA 4UOHA 5CAAA 1NSPA 2ZUAA 3Q83A 4DUTA 3FBCA 4KPCA 2BX6A 3Q8VA 3DDIA 3G2XA 3VGSA 4C6AA 1VYAA 3EJMA 2HVEA 3FBBA 2NCKL 3ZTPA 2B8QA 2DXDA 1NLKL 3WX8A 3FKBA 1WKKA 2DXFA 3EICA 1NSKL 3VGVA 3ZTSA 3ELHA 4W98A 1LWXA 4DZ6A 3NGUA 3JS9A 1JXVA 3VVUA 1KDNA 4ANEA 3BBFA 3EVOA 3BBCA 3PRVA 4ENOA 2AZ1A 2HVDA 3L7UA 5C7PA 4F36A 1S5ZA 2DYAA 3EVWA 1HHQA 1XQIA 4DI6A 1NDKA 1NB2A 1LEOA 3Q89A 4ANCA 1WKLA 3R9LA 3FCVA 3EVMA 1NDPA 1UCNA 1WKJA 3FBEA 3PJ9A 1PAEX 1K44A 2VU5A 2AZ3A 4UOFA 4S0MA 1PKUA 3BBBA 1BUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8P A;  3EE3 A;  1MN7 A;  3ENA A;  3EMT A;  3FC9 A;  3ZTO A;  3MPD A;  3NGR A;  3GP9 A;  4WBF A;  1S57 A;  1XIQ A;  1W7W A;  3EM1 A;  5BXI A;  1B99 A;  3VGU A;  4FKX A;  3DKD A;  1BHN A;  1NHK L;  1NCL A;  3NGT A;  1F6T A;  3NGS A;  4EK2 A;  3Q8Y A;  1NDC A;  4O0N A;  1HIY A;  3GPA A;  3B6B A;  1B4S A;  1MN9 A;  1ZS6 A;  3B54 A;  3FCW A;  3VVT A;  3ZTR A;  1S59 A;  1EHW A;  1NDL A;  1BE4 A;  2HUR A;  4UOG A;  4F4A A;  2DY9 A;  1F3F A;  4FKY A;  1U8W A;  4HR2 A;  2BEF A;  1NSQ A;  3VGT A;  5CAB A;  3ZTQ A;  4AND A;  3ETM A;  1NPK A;  1HLW A;  3FBF A;  1NUE A;  2DXE A;  3BH6 B;  3Q86 A;  5IOL A;  4CP5 A;  2CWK A;  3BH7 B;  3Q8U A;  4UOH A;  5CAA A;  1NSP A;  2ZUA A;  3Q83 A;  4DUT A;  3FBC A;  4KPC A;  2BX6 A;  3Q8V A;  3DDI A;  3G2X A;  3VGS A;  4C6A A;  1VYA A;  3EJM A;  2HVE A;  3FBB A;  2NCK L;  3ZTP A;  2B8Q A;  2DXD A;  1NLK L;  3WX8 A;  3FKB A;  1WKK A;  2DXF A;  3EIC A;  1NSK L;  3VGV A;  3ZTS A;  3ELH A;  4W98 A;  1LWX A;  4DZ6 A;  3NGU A;  3JS9 A;  1JXV A;  3VVU A;  1KDN A;  4ANE A;  3BBF A;  3EVO A;  3BBC A;  3PRV A;  4ENO A;  2AZ1 A;  2HVD A;  3L7U A;  5C7P A;  4F36 A;  1S5Z A;  2DYA A;  3EVW A;  1HHQ A;  1XQI A;  4DI6 A;  1NDK A;  1NB2 A;  1LEO A;  3Q89 A;  4ANC A;  1WKL A;  3R9L A;  3FCV A;  3EVM A;  1NDP A;  1UCN A;  1WKJ A;  3FBE A;  3PJ9 A;  1PAE X;  1K44 A;  2VU5 A;  2AZ3 A;  4UOF A;  4S0M A;  1PKU A;  3BBB A;  1BUX A; 
#chains in the Genus database with same CATH topology
 1Q0N A;  4RNH A;  2W9B B;  2BJ9 A;  3MM7 B;  2VBX A;  2V69 A;  3M32 B;  1Q4R A;  3WDO A;  3NS5 A;  5KG6 A;  1RTD A;  3HKZ D;  4UY8 T;  2E7V A;  3NGR A;  3QO9 B;  3S8S A;  2C28 A;  5BR8 J;  2MLX A;  1S9G A;  1WD6 A;  1UJ6 A;  2RS8 A;  1H7X A;  1UPP A;  2BW2 A;  2KHC A;  2YQ3 A;  1Q53 A;  3IR6 B;  5L9N A;  4NLO A;  5M2U A;  2ZH8 A;  2J9D E;  2EC2 A;  2LXI A;  3G8S A;  4CO4 A;  1HQE B;  2CPZ A;  3UVJ B;  2OLW A;  3HM9 A;  1J27 A;  1QSY A;  3QIP B;  5B0C A;  3PEJ A;  1JLB A;  3NS6 A;  4DPT A;  2CPI A;  3FEY B;  5D8H B;  3Q8Y A;  2AX1 A;  2LU2 A;  2NPI A;  3BSN A;  4P9S A;  1YJN S;  4TLQ A;  1ZM4 A;  2CJQ A;  3I32 A;  1S59 A;  1RWX B;  1TKT B;  1XMB A;  2DHH A;  1UEV A;  2QL9 B;  1C1C A;  2VFV A;  3JQK A;  1HBN B;  3EDQ B;  5KT2 A;  3IRW P;  1VQ7 S;  2C2K B;  2MXY A;  2YX7 A;  2WSC C;  1RBO B;  1UVI A;  1MMN A;  2E29 A;  1U6B A;  1G2E A;  3K0J A;  1NK9 A;  3VAF A;  2O5D A;  4IG3 A;  3NEK A;  1TMJ A;  2GIR A;  3VCD A;  2MTL A;  3IS9 B;  2H5J B;  2J9C A;  5F3T A;  2HZV A;  4M63 A;  1LWC B;  4RX6 A;  1T03 A;  2WOM A;  4LF4 J;  4JV0 A;  1AZS B;  2BJ3 A;  2G1D A;  4B9U A;  4XDD A;  1H2V Z;  3KMQ A;  3PVX A;  1RU2 A;  1NZA A;  2DR6 A;  3TQE A;  2XGQ A;  5U47 A;  4K4W A;  2Q3P A;  3QJL A;  3VF0 B;  1CQN A;  5LXY A;  3ZTQ A;  1GH8 A;  3A8E A;  3QNW B;  2DNM A;  3ISN C;  1N48 A;  2OD4 A;  2ADB A;  3DLK B;  3FMB A;  2Y1I A;  2NSB A;  1F5B A;  2NXN A;  4DX6 A;  2CPD A;  5K8M A;  5GMD A;  2AJ0 A;  2R7Q A;  3I31 A;  2GIQ A;  5D4O A;  3H5U A;  4KYZ A;  5FD1 A;  3L3C A;  4QYZ J;  4B3O A;  5L8R C;  1MWQ A;  3DLE A;  1FE4 A;  2EFP A;  5HRO B;  1SUQ B;  2V4J A;  4C8L A;  5D4L A;  3KKF A;  4ZPB A;  3VGS A;  1CS4 A;  1QM9 A;  1LWF A;  1TKZ B;  2GS8 A;  3DMJ A;  4DL2 A;  4DV5 J;  3UNG C;  4C8N A;  1DFD A;  3L7O A;  2PFF B;  5L46 A;  2V2K A;  1VQL S;  2F5G A;  1NND A;  3PRB A;  2FYX A;  1LXJ A;  3TUJ C;  4FDF A;  1CJV B;  1FTR A;  4MYT A;  3H4D A;  5F0U A;  4YHH J;  2ZBR A;  2F65 A;  4DSE A;  1Q8L A;  1S7I A;  3CCZ A;  3RBX A;  5F8L A;  3I56 S;  2FB0 A;  5HVH A;  4EU0 A;  5FLX Y;  5IT9 U;  3PYD A;  3I96 A;  4N76 A;  1YWX A;  2KXF A;  1S1W A;  1Q1K A;  4F50 A;  5KT6 A;  4QCL A;  3HHL A;  1TVR A;  3MM5 A;  1YBU A;  1LK7 A;  3DRS A;  5LJ3 Y;  4KHM A;  4HTJ A;  1JKH B;  2KFY A;  3BO3 A;  5J2N A;  2UUC F;  2WVC A;  4OZN A;  4KBI A;  3CC2 S;  4OX9 F;  3D6T B;  5KT7 A;  1OIA A;  1ELO A;  1KHW A;  2AJQ A;  3FZ2 A;  5KFC A;  4OJ3 A;  4DL3 A;  4LSL B;  2GQC A;  5KAK A;  2MDA A;  1KLN A;  1VQS A;  3DRR A;  1NH8 A;  4WIQ A;  3BDE A;  2LQ5 A;  3KG4 A;  4LF6 J;  2K3I A;  4QU7 A;  5A8K B;  4A8X A;  5HJY A;  1FCA A;  2A2C A;  4NA2 A;  3R1L A;  1FD8 A;  1T9U A;  1LEO A;  1U6F A;  4ZVG A;  4ZVF A;  1R8C A;  2LA4 A;  2BJ7 A;  1F5C A;  3M30 A;  2RRN A;  3LOU A;  3FCV A;  3EGZ A;  3T19 A;  3BR9 A;  4HL9 A;  2VIH A;  1WNE A;  1WKJ A;  4D3G A;  1TQL A;  4A46 A;  1Q7L B;  3H8Y A;  5KFR A;  5ETN A;  5KFK A;  2NUH A;  2ZOM A;  2AYM A;  1TL7 B;  2B6A B;  4ID5 B;  1U0H A;  3SV4 A;  3NNA A;  1BUX A;  3IP0 A;  3LP2 B;  4FXV A;  2R7V A;  2LDY A;  1X4H A;  3IXQ A;  1BQM B;  3KK3 A;  1PSD A;  3BN7 A;  2ZH1 A;  1U47 A;  4I6Y A;  4HH0 A;  8ATC B;  1S4E A;  1KBR A;  1H2T Z;  1WHW A;  4L74 A;  2F3J A;  2Z58 B;  1O51 A;  3A3P B;  1B99 A;  4FYD A;  3GYX B;  4DPO A;  4RNO A;  1S76 D;  2VBZ A;  2HFN A;  4ZOS A;  3AOB A;  3ILL A;  3ONQ A;  4ZP9 A;  2NRE A;  2HG4 A;  1AFJ A;  1X0P A;  4FS1 A;  2DEJ A;  1NCL A;  1YRU A;  3FRZ A;  5KFT A;  2BUN A;  2XC9 A;  4ES3 A;  2E5I A;  1RAB B;  3MM9 B;  3UDL A;  3DGV A;  3A3O B;  3I0S A;  4CLL A;  1RAG B;  3G8T A;  1ZZN A;  2XS2 A;  5CD4 H;  2WVE A;  4C8Y A;  1IUJ A;  2JVR A;  4M5D B;  4ID5 A;  3SCJ E;  3CD7 A;  3GG0 A;  1KON A;  2ZC4 A;  5FDL A;  4UOG A;  1DAX A;  1F3F A;  1JQG A;  3GLJ A;  4G65 A;  2LQ9 A;  4PXD A;  3W2W A;  3QT5 A;  4NXN J;  2OAU A;  3JYT B;  3TA2 A;  4FKY A;  4WK3 A;  3SQG A;  1KP6 A;  1RYR A;  2G2Z A;  4KR0 B;  1H98 A;  2VBY A;  2PEB A;  1HNV A;  1WEZ A;  4H4O A;  2B5J B;  1YJV A;  2CNO B;  4KB7 A;  3CJK B;  3F73 A;  1N6Q A;  3KLF A;  2JEJ A;  2H3E B;  4DWI A;  4WFA Q;  2W25 A;  1NU4 A;  3H20 A;  3NBP B;  3OTO J;  1RHJ B;  3NRB A;  5LMU J;  3CJ5 A;  1JJH A;  4OZL A;  3RRH A;  3C14 A;  1S10 A;  3FBC A;  3BRE A;  4AL5 A;  3DRS B;  2HW3 A;  4USK A;  3MED A;  4DCP B;  4YY3 F;  1WI8 A;  4XPC A;  2N4C A;  2W8L A;  2MQO A;  3OLB A;  1B7F A;  2SXL A;  5IV4 A;  2UZA A;  4ED8 A;  5CHC B;  4BC7 A;  2A18 A;  2M8D B;  4K4S A;  4BCA A;  5EHH A;  2JFK A;  3MUT P;  2VKR A;  2OML A;  3F56 A;  1HBO B;  1N5S A;  2HRU A;  5E3R A;  1N8R T;  4FYY B;  4A48 A;  5KFP A;  2IA6 A;  4YB6 A;  5AE2 A;  4UQG A;  3M30 B;  4PCQ A;  1VQM S;  1XR6 A;  2O01 C;  2MSS A;  1RJJ A;  1GMW A;  1U2F A;  1WEL A;  2MZ1 A;  2L9D A;  1DTQ B;  1B64 A;  2ZH5 A;  3ENV A;  4C7Q A;  5DG7 A;  1U8S A;  3G9C A;  5DET A;  4P2X A;  4U6P A;  1WUU A;  3V81 A;  1XR5 A;  2IMW P;  2FJW A;  1JXV A;  1YLX A;  1AXQ A;  3V6J A;  2HNY A;  2IAJ A;  5D78 A;  3PX6 A;  5KFD A;  3M05 A;  1Y0H A;  4Y2I A;  2QA1 A;  1VR6 A;  2OEK A;  1BMQ B;  3NNH A;  5HQL A;  4NCG A;  1NKB A;  1VRQ C;  3PV8 A;  1JLA A;  3DHW C;  3BF4 A;  4P71 A;  2YKQ A;  2KT2 A;  1HPZ A;  3TRG A;  1PGZ A;  3MPW A;  4V19 X;  4RNM A;  5JVG Q;  1YJ9 S;  2J8A A;  2HVI A;  2F4F A;  2XNQ A;  4HT5 A;  4LVO P;  3GIL A;  3T5L A;  4J9Q A;  4HI2 A;  2UUB F;  1S7H A;  2M8H A;  2JEI A;  1NB2 A;  2E66 A;  1HWL A;  3TAM B;  1SC1 B;  1Y4Z B;  2GQQ A;  3MAA B;  2CYY A;  4MTP A;  4A4J A;  4F25 A;  5IV3 A;  2YH1 A;  1IBK J;  4NLY A;  4J37 A;  4HDG A;  2ILZ A;  1AB8 A;  3QMQ A;  3W60 A;  2AD9 A;  4OHW A;  1T9V A;  4HLB A;  4LRE A;  3L9Z A;  3U1N A;  4B9S A;  2DGU A;  1KVJ A;  1RAJ A;  1B0V A;  5HQM A;  2VF3 A;  2OTJ S;  1V3R A;  4NRT A;  2VU5 A;  4A8M P;  4LQ9 A;  3IMQ J;  1C2P A;  1EZZ B;  1EJ7 L;  3HFZ B;  4UOF A;  5D15 A;  4O3Q A;  4CZC A;  2LA6 A;  3D1H A;  3PKY A;  4DFM A;  1N34 J;  3G87 A;  2R3V A;  4TXS A;  3HK2 A;  3PTW A;  2QMU B;  2IJF A;  2E1M C;  1G4C A;  4OFZ A;  3ZTO A;  5A8W B;  4DPY A;  2W7A A;  1DAR A;  1OQ6 A;  3D1O A;  1RA6 A;  4ED1 A;  3O5T B;  2V2Q A;  4C3M A;  5J1N A;  3M8S A;  3OVB A;  4PEO A;  2QYC A;  4KHR A;  4AYB D;  3CCL S;  2KJV A;  2YKN A;  3DKD A;  3CJQ A;  5EN1 A;  2CJA A;  2WAQ D;  1S9G B;  2B6A A;  2XMW A;  2XWY A;  5HL7 Q;  3K5N A;  3VAM A;  3CC4 S;  1N0U A;  2FZC B;  3D9B A;  1VC6 A;  1TL1 B;  2Y0B B;  4KC5 A;  1S9E B;  1F6T A;  4DR4 J;  4PYD A;  3SCI E;  4CLZ A;  5KFA A;  4X4V A;  1HIY A;  2QLJ B;  3TAQ A;  2GIF A;  1SVD A;  4K0K J;  1K1Q A;  1S9E A;  4WII A;  3VVT A;  3CUN A;  5F41 A;  2YH0 A;  1S9F A;  4O3P A;  3TEH B;  1QAX A;  4RUC A;  5I42 B;  1S99 A;  1EAY C;  5A2Q Y;  2BRK A;  1S6O A;  1OS5 A;  2K2P A;  3PYE A;  3GCW P;  3K8V A;  5T41 A;  5KFE A;  2DRA A;  1WC1 A;  2Z2Y B;  2G13 A;  2V8G A;  2MKJ A;  4DPX A;  3CCE S;  3DM2 B;  1YG0 A;  5ETQ A;  2DPI A;  2XMA A;  1N56 A;  2XI2 A;  2VA3 A;  4RW9 B;  5KFQ A;  4I4B A;  3FEZ A;  2HQF A;  1FK9 B;  1P9Q C;  1NJW A;  1U8W A;  3DOL A;  4OYA A;  3I82 A;  3PW2 A;  3CVK A;  1LXN A;  4J90 A;  1D09 B;  4I67 A;  1E6Y B;  2HLU A;  3VGT A;  2Q1L A;  3M8Y A;  4CH1 A;  3M2U A;  3UN3 A;  4E2F B;  4H4K A;  1KWM A;  2YQ0 A;  4JI5 F;  2V67 A;  1M5O C;  2DCL A;  1URR A;  3Q2S C;  2J0W A;  2D9P A;  2I8E A;  3DOM A;  1YIT S;  3VAI A;  2YWG A;  2QLB B;  4CP5 A;  1T95 A;  3ILI A;  3O44 A;  3Q8U A;  1ZOT A;  4OIX A;  4YDD B;  1EKR A;  2BW7 A;  1V6H A;  3RBZ A;  1YJ7 A;  3P96 A;  4IOB A;  4OYB A;  3SEO A;  4DUT A;  4F3M A;  4J9M A;  3RR8 A;  3BPD A;  2VFR A;  2ZKU A;  5HJX A;  3M6X A;  2W4C A;  5KFM A;  1CEZ A;  3BGR A;  4F4W A;  3EZU A;  3C19 A;  4EZ6 A;  3UO0 A;  4JI3 J;  2NCK L;  2X3D A;  4OI4 A;  1C1C B;  3TEG A;  1NHU A;  2CQP A;  4O44 A;  1UW4 A;  4Y0F A;  1CLF A;  4IDK B;  1TUV A;  1X0F A;  1CJT B;  3ET6 B;  1OMS A;  1Y3J A;  1HR0 F;  3QGI A;  1SJR A;  1JLB B;  1NSK L;  4NMX A;  2CRL A;  3NGD A;  2Y8Y A;  3QT7 A;  3EZO A;  1X9S A;  4DZ6 A;  2QJ3 A;  4O0I A;  2V94 A;  6FDR A;  1R6V A;  1Z1Z A;  3JS9 A;  1HAR A;  1UZD A;  2XY6 A;  4PZV A;  2CQ4 A;  4F3Q A;  2V8D A;  3G4S S;  5CXT A;  3RR7 A;  2MMY A;  2ROG A;  2WOM B;  5HAN A;  5IS2 A;  4FYV B;  2CQ3 A;  4CO5 A;  4ZVH A;  3T9Z A;  4C2M A;  1WI6 A;  3CJT A;  4L3K A;  2E1P A;  4CWB A;  1IJF B;  3DRX A;  1RT7 B;  3M1V B;  2UU9 J;  2VPZ B;  1NDK A;  4WYW A;  2ZHA A;  1NJX A;  3N0V A;  3I6P A;  5DDQ C;  2F63 A;  2R2S A;  1NK6 A;  4F3O A;  1SH0 A;  5K8P A;  3VZH A;  3AA8 A;  4OYP A;  3RU0 A;  1HL6 A;  2HKE A;  3HF5 A;  4RU9 A;  2JSX A;  3KK1 A;  1QTM A;  3QIP A;  4RWW A;  3KK2 A;  2JLF A;  4NLS A;  4F4K A;  2GMH A;  3GIR A;  2PSZ A;  3HDS A;  1WC3 A;  2QG9 B;  1PO6 A;  3BBB A;  2XMU A;  3OR1 B;  4H4O B;  3BB5 A;  4KGZ B;  3TI0 A;  3AD8 C;  3K17 A;  2KG1 A;  2JOQ A;  4X4U A;  1WAC A;  5DG8 A;  1W2I A;  3CMQ A;  4KH1 B;  4L75 A;  1VHF A;  5EUH A;  5KFN A;  2BQR A;  1JLE A;  4B9M A;  2PDA A;  4DFP A;  1U1Q A;  2QMX A;  2IRY A;  3JQJ A;  3S1T A;  4MIA A;  5F8H A;  1RT4 A;  1S57 A;  1X4A A;  3CSK A;  1FRJ A;  3GCX P;  3FMW A;  5C2G A;  4XO0 A;  4DR1 J;  3T3F A;  1GK8 A;  4JI4 F;  2Y9H A;  2M70 A;  2HMI B;  3M2R A;  4PXE A;  5A76 A;  5HAO A;  2N82 B;  2AU0 A;  3GYN A;  1J5O B;  2DO4 A;  4FXD A;  3PW7 A;  3ISN D;  1VLY A;  2FJA B;  1GQE A;  3C6T B;  1N36 J;  1NRK A;  1QUP A;  1QTN B;  4OX9 J;  1QLN A;  3GV5 B;  5D77 A;  2XYG B;  4ZJQ A;  4FF3 A;  4FYW B;  2ZE2 A;  1O6X A;  2AIR B;  2BKO A;  2XHC A;  3CD5 A;  1JLC B;  3AQP A;  5LMN F;  2HFV A;  2F4V J;  4Y2K A;  4LRD A;  1CJK B;  1NDL A;  2RF2 B;  1GNK A;  2OPR B;  2HFU A;  4R8U B;  1REV B;  5L1L A;  3SYZ A;  1G7C B;  3R5D A;  5E0O A;  3MEE A;  3W5Z A;  2ZJP Q;  1IM4 A;  3OVS A;  3LWM A;  2ZH2 A;  4DR5 J;  4PUO B;  3GFH A;  3D0I E;  3TW0 A;  2OTL S;  2OFH X;  2PT0 A;  3D68 A;  2R2T A;  2J0Q D;  2V9W A;  1U24 A;  1PC4 A;  3MFI A;  4IH5 A;  1L3U A;  1SL1 A;  5CAB A;  3F41 A;  1VS3 A;  5IXU A;  2VZ9 A;  4ED6 A;  3R3T A;  1KFS A;  1V5V A;  1Y5I B;  2DGW A;  3LUY A;  3KOA A;  4IFV B;  1RSC A;  2HND A;  1N34 F;  3RJM B;  2FJD B;  3V4I A;  1CC8 A;  4DCO B;  4R5P B;  1YHQ S;  2A6O A;  2ALZ A;  3MTJ A;  3CC7 S;  4IQX A;  1XNR J;  1FF2 A;  2I5J B;  5H9F J;  4UOH A;  1AA1 B;  1L3K A;  2LP4 A;  4DQI A;  3IM9 A;  2FHM A;  2R7T A;  4DR3 F;  3GIJ A;  1TL4 A;  2GHW A;  3DRP B;  1IR2 A;  3M8Z A;  2KB2 A;  1RAC B;  1FXD A;  2MKY A;  4TVA B;  2HBR B;  4Z37 A;  1J2V A;  1VRT A;  2GVZ A;  3AD7 C;  3ETO A;  2V8P A;  4OHZ A;  1NH7 A;  5RUB A;  4LFB F;  1FFG B;  2ZDP A;  2DPJ A;  4DR4 F;  3RW6 A;  3N28 A;  2BQU A;  4QWD A;  3EDR B;  1NKC A;  3HZG A;  4FP9 A;  2JJ4 D;  3DRP A;  5KFH A;  1YJW S;  1NSA A;  3BR8 A;  4O3N A;  1GEH A;  2DXF A;  2ZD1 A;  2FJV A;  4NA3 A;  3ZO7 A;  3C16 B;  2DHG A;  4X2B A;  3ZZ0 A;  1PG5 B;  3MF5 A;  1S0O A;  1A9N B;  2YWF A;  1S4F A;  3JSR A;  2HND B;  4YS2 A;  2E1C A;  5DDO C;  5D3G B;  1KSP A;  4GRS A;  4IRK A;  2EFQ A;  2A3J A;  2H5I B;  1U26 A;  2ILY A;  2XG8 A;  1BQX A;  2G0I A;  2CUY A;  4C8Z A;  1HBM B;  1T9T A;  2AZ1 A;  3AOD A;  3LH2 S;  4QYZ K;  5E3Q A;  1KRP A;  3C6U A;  4F36 A;  2OPP B;  3ICL A;  4QR2 A;  1MRO A;  1Z2L A;  3BS9 A;  3U1M A;  5L38 A;  3LA0 A;  2VC0 A;  3IG1 A;  5LSO A;  2ZBP A;  1SKR A;  1HHQ A;  2HHH J;  1B70 B;  1ZH5 A;  2HBY B;  3PFE A;  2ASJ A;  4ILM A;  2AP6 A;  4A8W A;  2GVZ B;  3W63 A;  2UVU A;  4DR6 J;  1S0V A;  2Z2L A;  3GTY X;  4P6Q A;  3TQ1 A;  2KT5 A;  3IG1 B;  3R8Y A;  3OFH A;  4ZMM A;  1H73 A;  2YNF A;  2B9X A;  2JC1 A;  2XMV A;  4ZDN A;  3KMS A;  3R5C A;  4GMK A;  4YDX A;  3GFZ A;  4F67 A;  1S49 A;  3QRP A;  1V3S A;  4MJK A;  1UEU A;  3TA0 A;  4QPX A;  1RT5 A;  2DGV A;  2BAN A;  3W66 A;  2ZNZ A;  4NML A;  4U7U K;  1BWV A;  2EKN A;  3W7B A;  5KFF A;  1APS A;  3EMT A;  4JI1 J;  2Y1R I;  4IH7 A;  5FII A;  1WG5 A;  4M95 A;  1HD1 A;  2N7C A;  1M90 T;  2IIH A;  3BPS P;  4KO0 B;  1WC0 A;  2MJU A;  2DIS A;  3MUM P;  5ETM A;  4B3S F;  2LVW A;  3LP1 A;  3POT A;  3QWU A;  2MPU A;  5I3U A;  1M5V C;  3DC2 A;  2AT1 B;  4AL6 A;  1FKP B;  2BYC A;  3MD3 A;  4IH6 A;  2E1R A;  2Z30 B;  4OMF G;  1OY9 A;  2O1P A;  3A8I A;  3OR1 A;  3VR1 A;  5HN0 A;  2C22 A;  4TYB A;  3SDE B;  4CO2 A;  4R8U A;  3MR7 A;  4I68 A;  4MKV A;  4XAK A;  3X3U A;  3OLA A;  5C24 B;  2V4Q A;  3GPA A;  1EB0 A;  3IFE A;  3TUI C;  4X4R A;  2D41 A;  1RTI B;  4ES2 A;  1EQM A;  2G1H A;  1LKZ A;  2HVZ A;  3AB4 B;  4CYU B;  2PA3 A;  2I5J A;  2ASD A;  1C1B A;  1TUG B;  3D67 A;  4J9N A;  2HUR A;  1RYS A;  4R5P A;  1HYS A;  4LQ3 A;  4N8N A;  2Y8W A;  3OR2 B;  1IKW A;  4CNZ A;  2MQQ A;  1NJZ A;  4HVZ A;  2H1Y A;  3EX7 B;  5HBM B;  5HMZ A;  4DF8 A;  1RWW B;  4C3K A;  4C0B A;  4MFB B;  5AE1 A;  3U27 A;  4Q5V A;  3CIZ A;  3N5B A;  2VG5 B;  2LU1 A;  3W1Y C;  4ZJL A;  4QR0 A;  2HRT A;  3TWZ A;  5L39 A;  1SKS A;  4LSZ B;  4V19 J;  4DR3 J;  3I9Z A;  3QSI A;  5ETP A;  4JUZ A;  2OIH A;  5CZX A;  2AX0 A;  3DNC A;  2RD5 C;  1NHV A;  4AT1 B;  2EG2 A;  4ERD A;  2IA0 A;  2RIL A;  1EP4 B;  4WTO B;  2Z0G A;  1CJK A;  2RF2 A;  1KTV A;  5F9L A;  2UV8 A;  1BC6 A;  5IFM A;  3EUN A;  3LO3 A;  5DM7 Q;  3MM8 B;  4EBC A;  3GB0 A;  3CO0 P;  3RTV A;  2RDI A;  1JLF B;  3WX4 A;  2DTJ A;  4PG7 A;  3GFY A;  1R0A A;  2CQ2 A;  4F26 A;  4WCE Q;  1SJ4 P;  3HSG A;  1TK0 A;  4YEA A;  1I1G A;  3FBB A;  1UZH A;  3MMC A;  3C6T A;  3LP0 B;  3KNA A;  1A0O B;  1GFW B;  3VTI A;  1B0T A;  2HAI A;  1Q95 G;  4JYA J;  1FRK A;  4L6V 3;  2HHS A;  1KQF B;  2WBR A;  4H4M B;  3RBE A;  3MR2 A;  1UVN A;  2HHU A;  1IVZ A;  3I4P A;  2R8I A;  1YRX A;  5ETS A;  3DLJ A;  2HS0 A;  2BBE A;  2F9D A;  3BSA A;  3ENW A;  4YB7 A;  4F02 A;  2PE8 A;  2I38 A;  4ZHR B;  5EGY A;  2J6T A;  2F4V F;  1BXN A;  1Q8K A;  3ZFV A;  5HP1 B;  2KVQ E;  1ZTW A;  1N5Y B;  4H4K C;  2BJD A;  3PR4 A;  2OPS B;  1IKW B;  1RLC L;  4PWW A;  3K5M A;  3RB0 A;  2DGT A;  1ZA1 B;  2OFG X;  2GW8 A;  1HNI B;  4UW2 A;  1T9X A;  3MMC B;  5IWA J;  2ZBI A;  4NCB A;  2VDH A;  4RR5 A;  1Q16 B;  4OHV A;  2CNL B;  5B0A A;  2DYA A;  1KKH A;  2C2O B;  3EVW A;  3R7B B;  4NZ6 A;  1D0E A;  2R7S A;  3DOK A;  3V6D A;  1CJT A;  4DR1 F;  5DQG A;  5GMK a;  3MI7 X;  3I55 S;  2Y3Y A;  2HHQ A;  4LSN B;  4ECU A;  1NXI A;  4ZIV A;  1Y00 A;  1OO0 B;  2VQF F;  3Q89 A;  4KHP F;  1HBU B;  1WOS A;  4LRC A;  2OD6 A;  2DD8 S;  1FA0 A;  5BYR A;  1RQ0 A;  3ZNJ 1;  3MFH A;  1YKW A;  2RB7 A;  3M2V B;  5LL6 d;  1TEL A;  2E1A A;  5ETK A;  1SPB P;  3W62 A;  3L4B C;  1UA0 A;  1UFW A;  2LDI A;  2FZK B;  4WU3 A;  1K44 A;  1YGY A;  1YVF A;  5KG1 A;  2KFZ A;  2OH2 A;  3O1L A;  3UI3 A;  5D0R A;  5M2P A;  1TKD A;  1JJC B;  4DEZ A;  3JXO A;  2FC9 A;  3QAU A;  2Q6C A;  1RB0 A;  1L3V A;  4RW6 A;  4C8M A;  2H9Z A;  4I69 A;  4N77 A;  3S01 A;  4DV2 F;  3PJW A;  1ARO P;  2YVS A;  2LFV A;  2PMW A;  1LOU A;  1VIS A;  4KE5 A;  1R31 A;  2HGL A;  4X62 F;  4LF4 F;  2C2M B;  5I3P A;  5A8W A;  1FWL A;  2NXJ A;  1NAQ A;  3BN4 A;  2WB1 D;  1FES A;  1WSV A;  4NZ7 A;  4WWS A;  5C24 A;  4ZVE A;  4CO1 A;  3LWL A;  1R3N A;  3J7Y I;  4ECY A;  5CYJ A;  3D0H E;  3V6K A;  4K4V A;  2BMB A;  2UXB F;  2QSW A;  2P6S A;  4YB5 A;  2YNI B;  2MQM A;  3CW2 C;  2BR0 A;  1DZ5 A;  3FCW A;  3MR6 A;  2R7R A;  3PM9 A;  3GIK A;  3T41 A;  1UVM A;  4CLY A;  1PJ7 A;  1XK8 A;  2OPQ B;  2QSF A;  2BA9 A;  4O4G B;  3RB3 A;  2E9T A;  1G1X A;  3N9U C;  2LEP A;  1AUS L;  2AJ4 A;  4RNN A;  4JI0 F;  4B02 A;  3T5H A;  2VOO A;  3KUE A;  2KFN A;  1HR0 J;  5T7L B;  5H1S V;  2KYX A;  2IM3 A;  3TZZ A;  3C15 B;  4AXJ A;  5BR8 F;  3JQM A;  4IOA Q;  2QT7 A;  1UEK A;  2Q6B A;  2YNH A;  1WHX A;  4NE9 C;  1NSQ A;  4U8Y A;  1NME B;  3MMB B;  1LW2 B;  3TX8 A;  1CUL A;  1U0S A;  2VFT A;  3CCV S;  9RUB A;  1U4B A;  1L5U A;  2QN6 B;  3OXG A;  3LTO A;  2QZ8 A;  3MZI A;  3P5T L;  3IN5 A;  4IFY B;  4NLR A;  1VQ5 S;  2WVF A;  2GNK A;  2P8I A;  4DX7 A;  1WC5 A;  3AH6 A;  1NKE A;  4F8R A;  2J7W A;  3RAM A;  4DU8 A;  5CAA A;  4OI6 A;  3V81 B;  5IZH A;  1Q82 T;  2ZUG A;  2CVE A;  3D0G E;  2E9Z A;  1MWY A;  3G82 B;  4I7F B;  3HD2 A;  2OPP A;  1N5V A;  2JEF A;  3C2P A;  4OHX A;  3KLI A;  2CPH A;  3GR1 A;  3CCR S;  1GX6 A;  1HWU A;  3HVT B;  4J9U E;  4DR6 F;  3J80 U;  4EI2 A;  5HK4 A;  2BQ3 A;  4DOZ A;  5CA5 A;  3MD1 A;  4ZVR B;  2FY1 A;  2C3O A;  2AGP A;  3QRQ A;  2P9G A;  5J2Q B;  1WDD A;  1NLK L;  1FTC A;  4U7C A;  2LQJ A;  3WX8 A;  3ZNU A;  1X31 C;  2XSF A;  5K5M A;  3D2W A;  4J9V A;  4F0K A;  1N88 A;  3OUY A;  2KL8 A;  1XMO F;  3D3B J;  3D1Q A;  1DHM A;  4P10 A;  3AXK A;  4YQW A;  2DHS A;  2B4O A;  2MKC A;  3EXC X;  4EO8 A;  2XHW A;  4I6A A;  4FN5 A;  4RLE A;  4RPF A;  4IG0 B;  3NL0 A;  1HKA A;  3PDN A;  1LK5 A;  3TX0 A;  3BKT A;  1AW0 A;  4K7Q A;  4Q2L A;  1VRT B;  4NA1 A;  4ANE A;  2QYG A;  1YJT A;  3PRV A;  4ED5 A;  2YWH A;  1N4L A;  1T7P A;  1RT3 A;  4FZV A;  3L7U A;  1JLC A;  2DNN A;  1H7W A;  2C2N A;  2N7Y A;  2ZE2 B;  1XER A;  2CPJ A;  2VG6 A;  3KG1 A;  3NOC A;  3KLE B;  1N32 F;  3QZ7 A;  3C8Y A;  1S77 D;  1T9W A;  1ZAX A;  1XQI A;  5ETT A;  2AEF A;  5DZ7 A;  4CLK A;  4A8K A;  3R2D J;  2YPY A;  1PBU A;  3FCH A;  2FDN A;  3JSM A;  4Y6I A;  4IFV A;  3E01 B;  3UCG A;  3G6V A;  4M5I A;  1SQF A;  2DHA A;  4ZPT R;  5JJB A;  4UTG A;  1HQU B;  2XMM A;  1R0B G;  1MMD A;  2VFU A;  3PHE A;  5GME A;  4LRA A;  1W2B R;  2HHX A;  4CTA B;  1FE0 A;  5DRK A;  2D3Z A;  3HUL A;  3G6E S;  1S1U A;  2AZ3 A;  4DQR A;  5J2M B;  1E6V B;  1UKU A;  4RUB A;  1TKX B;  3CJ4 A;  4LIW A;  2HQG A;  3EE3 A;  5JUM A;  1MN7 A;  1VMB A;  4U95 A;  4X66 J;  1IBK F;  3ENA A;  1TKX A;  2EC0 A;  3H40 A;  5DO2 A;  4Q8F A;  5HVF A;  1X5T A;  3T1Y F;  3CDB A;  4WBF A;  2MKH A;  4L73 A;  1JB0 C;  1NPR A;  3GON A;  2G0C A;  4K59 A;  5I3Q A;  4DUY F;  2NUU G;  4F7V A;  2QEX S;  2X1G A;  1N5T A;  2CQB A;  2DNO A;  3MPY A;  1JK9 B;  1X8D A;  4TQR A;  1HBO A;  5B08 A;  2Q66 A;  3W9I A;  2FUG 9;  4M5N A;  1C0T B;  1TV6 A;  2MZJ A;  4QJV A;  1G3O A;  2L9W A;  4M5D A;  4DXL A;  2P2C B;  3J7Y U;  2FVS A;  4LF5 J;  2Z4P A;  2CXE A;  3KJF B;  4QIF A;  2ZH3 A;  4DS4 A;  1CC7 A;  1VJW A;  3KLE A;  2B4U A;  1X4D A;  3RGI A;  5E33 A;  4LF7 J;  1JLE B;  3W65 A;  2BE9 B;  3BSO A;  1IR0 A;  1BE4 A;  4NLW A;  4QQB A;  1S6U A;  5DDR C;  1N36 F;  5IM0 B;  4LFB J;  2LYV A;  3NCR A;  1K0V A;  4FBU A;  1FX4 A;  1HI1 A;  1ZZF A;  4GKJ J;  1ZM2 A;  3D6F B;  2V50 A;  3PIO Q;  2B5J A;  1RWP B;  4NPO A;  2EFO A;  2OSQ A;  1DTT A;  2IM2 A;  2KU7 A;  3OTE A;  3H5X A;  3QFH A;  3OL8 A;  1XMQ F;  1F2H A;  4LSL A;  1QVF R;  1FI4 A;  3VAL A;  2IC3 A;  3CCU S;  4NLG A;  4DV1 F;  4GVL A;  4CLF A;  4YY3 J;  2D74 B;  4DDF A;  3UWT A;  1RAO A;  5LSR A;  2CKW A;  2EXU A;  1SV5 B;  1PJ5 A;  2CQD A;  3BH6 B;  1D9A A;  3DXS X;  3CO9 A;  5AE3 A;  1JLQ B;  3HO1 A;  3M4X A;  2FJE B;  4QW8 A;  3BH7 B;  3MEG A;  4UOC A;  4X4T A;  1FKA F;  1NSP A;  4U8V A;  1CG2 A;  2GHP A;  4RUA A;  1JXL A;  2CZ9 A;  1JJ4 A;  3HVT A;  2UVR A;  4NI2 A;  2KT3 A;  4KGX B;  3EYZ A;  2KXH A;  2V9K A;  5AXL A;  4YB1 P;  1K8A T;  4CCH A;  1FXL A;  4OI0 A;  4Q8E A;  5H9F K;  2R2R A;  2K7K A;  1JLG B;  2MLZ A;  4K8R A;  2DR7 A;  2LEC A;  1ICE B;  3DMJ B;  2L48 A;  3IM8 A;  2EI5 A;  4HDH A;  5C25 B;  1RK8 A;  2DNL A;  2ZBC A;  2VL1 A;  1S12 A;  3M2U B;  3WZ0 A;  1OYE A;  2RRB A;  1W26 A;  2F8H A;  2ZVI A;  3IRX B;  4HHU A;  4XPE A;  2XZT B;  4WYL A;  2RDD A;  4ECV A;  4B3O B;  4DR2 J;  2WZ1 A;  4OX8 A;  1WTB A;  1PAU B;  4IR1 A;  1CUL B;  3PYF A;  4OL8 A;  2KG0 A;  3QT8 A;  4EYI B;  4F4Y A;  2YY3 A;  3GIM A;  4PYA A;  2GJF A;  1F9F A;  2KJW A;  1IKY B;  4ECX A;  1Y10 A;  4XDC A;  3TAN A;  1I5O B;  4USI A;  1UET A;  2EK6 A;  1SKU B;  2CNN B;  1SB6 A;  3BBC A;  3M8P B;  4IUF A;  4Y2M A;  2UUT A;  2RNE A;  2V0N A;  3CNQ P;  3CTR A;  4TU7 A;  4DR2 F;  2NPF A;  3CJR A;  3IC1 A;  3DI6 B;  2RE1 A;  2R7O A;  4MT1 A;  5G0R A;  4ED7 A;  4O3R A;  3UR0 A;  4EGL A;  2IM0 A;  1WOR A;  3GFX A;  6AT1 B;  4Q44 A;  4JV5 J;  4ZKA A;  2G2O A;  2V63 A;  4LRB A;  1TL5 A;  1F0X A;  1TL1 A;  2D7S A;  2Q79 A;  4I7F A;  2EFG A;  4NYP A;  3KLG B;  4MKY A;  2I0X A;  3H2V E;  4JI3 F;  4X62 J;  1F2G A;  2DNH A;  1FDB A;  1U6Z A;  2HIQ A;  4ZVS B;  4WZQ A;  2OEJ A;  2XLJ A;  2V6A A;  1Z4U A;  4OQJ A;  2JLE A;  3QID A;  4GVB A;  2OJ3 A;  4B3M J;  4K50 A;  5KFJ A;  2XTJ P;  2E5L F;  3QPI A;  1GMV A;  5E5N A;  4TYA A;  3VWS A;  4KKO A;  3R7N B;  3Q0A A;  3J7Z 5;  1RIS A;  5KT4 A;  4CIO A;  2BE7 D;  2QLX A;  4JI2 J;  4OV6 A;  2E7W A;  2KHD A;  2YNH B;  2DCU B;  2PMH A;  5E3P A;  2FHJ D;  3DLK A;  4NL5 A;  3ZZR A;  4RU2 A;  4WFY A;  5DJB A;  1M5P C;  4PQU B;  1X4E A;  2J0X A;  2ZOF A;  4PWU A;  5HMW A;  4A8Q A;  1U1O A;  5IQ6 A;  2C2E A;  4ED0 A;  1RA7 A;  3D4J A;  2CWX A;  4NLV A;  2UXC F;  1FHT A;  2OPQ A;  4O4G A;  2AYE A;  4OX7 A;  2E5G A;  1KN6 A;  2COL A;  3PO4 A;  5KFU A;  4F0M A;  3DI6 A;  5G0R B;  4ZCK A;  3KFW X;  3DU6 A;  2B43 A;  2VAS A;  2F9J A;  3FK4 A;  1JLQ A;  1KFD A;  3EXY A;  2MST A;  2F8M A;  2GZO A;  5GAH U;  1BLU A;  3GR0 A;  3KDO A;  4QR1 A;  3VAK A;  4HHH A;  2GAH C;  1MG7 A;  2E7X A;  4G1Q B;  5GVQ A;  1HPZ B;  3QT6 A;  4LVN P;  5HO4 A;  3JTN A;  4OJH A;  1T8E A;  2IMO A;  3DOK B;  3V6D B;  1JWW A;  3Q23 A;  3FUY A;  4RW4 B;  5DQH A;  3R5G A;  2YBV A;  2IVF B;  5KFX A;  2X1A A;  4AQY J;  2PD1 A;  4U67 Q;  2HEK A;  3DLG B;  2RU9 A;  1NK4 A;  5F8J A;  4JYA F;  1NK8 A;  4ZPV R;  4OZJ A;  3SSR A;  3V2U C;  2JWN A;  3MAH A;  5A6W A;  3W8G A;  1KEK A;  5HMX A;  1HW9 A;  1WC4 A;  3IWL A;  3QO9 A;  4KGK A;  1RHQ B;  4DV6 J;  2XY5 A;  3K5O A;  2PI4 A;  1LWC A;  1T03 B;  3KJN B;  4DL6 A;  4X65 F;  2QLW A;  1K1S A;  2GA7 A;  1UP1 A;  1H2U X;  3BZQ A;  2DBB A;  1ZAV A;  4IG3 B;  2DEI A;  3MAA A;  4NEY A;  3AXM A;  2OEM A;  4LFC F;  2PFD A;  1JMT A;  4TY8 A;  1KTQ A;  4DG1 B;  1TV6 B;  2CWK A;  2IM1 A;  4A8S A;  5B7W A;  4U7U D;  2GCF A;  4USU A;  1Z2Z A;  3MED B;  4Q0B B;  4WJB A;  1RU1 A;  4X4N A;  1PJ6 A;  2ZM6 J;  2HHP A;  4QIE A;  5E41 A;  1RZM A;  1D9F A;  1NZ8 A;  1YZ6 A;  2IC3 B;  2IRX A;  3A1Y G;  2BE2 A;  4ZCI A;  4QBU A;  2MB0 B;  3PKM A;  2GHV C;  2MYF A;  1TK5 A;  2DXD A;  2XSJ B;  2B56 A;  3GMG A;  4AXI A;  3UDC A;  1YX2 A;  4LIR A;  1YI2 S;  2DT9 A;  3H90 A;  3TOQ A;  3RUB L;  5J1P A;  3OJU A;  3ZZY A;  3G6Y A;  3B82 A;  4X4S A;  3FEX B;  5IC4 B;  3H5Y A;  5HP1 A;  3OHB A;  5K14 A;  4C11 A;  2KO1 A;  3JYT A;  2FTR A;  1SH2 A;  4I6W A;  3UCZ P;  2BOA A;  3G96 A;  2RDJ A;  1XNQ J;  1VGY A;  2H54 B;  5L1I A;  4P72 A;  4QZV B;  3U7J A;  2E44 A;  3TA1 A;  2GQ2 A;  2FQQ B;  3O8W A;  4DHV A;  5GAD U;  2ZH6 A;  1SJ1 A;  1C0T A;  3FZB A;  3OR2 A;  2HBQ B;  1T11 A;  3EZ5 A;  4J9R A;  2RUG A;  3PW0 A;  2HFZ A;  4I56 A;  2WSE C;  3OT9 A;  1HW8 A;  2EBG A;  3CWJ A;  4K4U A;  1RHR B;  4C48 A;  4Q45 A;  2W7O A;  4CH0 S;  4B3T F;  3ZZO A;  3CXC R;  3UD3 P;  2C2R A;  3I87 A;  3PJX A;  2W2P P;  2UV8 G;  4LMZ A;  1DTT B;  4QW9 A;  3SDE A;  3JAM Y;  4N7T A;  5D4N A;  4ECQ A;  3SSS A;  3HHL C;  5CD4 A;  2IVM A;  1ITP A;  3H42 A;  2CPX A;  3GV7 B;  2XEX A;  2GC8 A;  5JMN A;  3PRD A;  3OFE A;  5K8O A;  1EET B;  5A0Y A;  1PKU A;  5EWE A;  2XMT A;  1HNX J;  2LXU A;  3LAK A;  3PNI A;  5DZ6 A;  5C2C A;  2B8P A;  1NM2 A;  2WVD A;  3HX9 A;  3V4M A;  3QZ8 A;  3MUV P;  3VQT A;  1V9O A;  2HRY A;  1OSD A;  2BKP A;  2K8G A;  2Y1L B;  2FZG B;  2JHE A;  2H5E A;  3M8W A;  5DQI A;  3SV3 A;  3J7Z T;  5HLF B;  2WK4 A;  1P6T A;  3QJP A;  3ZC4 A;  4LJM A;  1GXL A;  1GXU A;  3AFG A;  3MM9 A;  4JI6 F;  4CNY A;  4ZIT A;  5AJ3 F;  1VQ6 S;  3ADA C;  1IR1 A;  2W1B A;  2UVW A;  4ILL A;  3QJJ A;  1QE1 B;  1RCO B;  4PKD B;  4DV4 F;  4OYZ A;  2LEB A;  2ROE A;  2W2O P;  5E7O B;  1RKJ A;  3NGS A;  3GJR B;  3GJS B;  2YQ1 A;  3NWR A;  3B4M A;  1UVL A;  3BV8 A;  3UD5 A;  1O5J A;  1B4S A;  3UW1 A;  2K3K A;  1FKP A;  4ZP6 A;  1XNQ F;  5ADZ A;  3D7S B;  2MHN A;  2ABY A;  1XC9 A;  1T3O A;  2G0J A;  2BAB A;  5KFB A;  5GAE U;  2BZ2 A;  2DY1 A;  2MGZ A;  1KQS R;  1F3V A;  3US5 A;  1P9Y A;  2UXD F;  2GFF A;  3CCT A;  3JSY A;  1FX2 A;  1TVR B;  2XYP B;  3MM5 B;  2IYI A;  4LBP A;  5J2Q A;  2OSR A;  1U0H B;  2HQI A;  1X4B A;  1OYD A;  2V2Z A;  4BC9 A;  4DV0 J;  2I2Y A;  2F1F A;  4JV2 A;  1CJU B;  1S0N A;  2XI3 A;  4ZLP A;  4URG A;  4DR7 F;  3HT0 A;  1VQK S;  1IWG A;  2IDL A;  1SQG A;  4CDI A;  4X4Q A;  4HI1 A;  3HHN B;  1RT6 B;  3Q2T C;  1SH3 A;  4ZCM A;  2ZNY A;  2LCW A;  2WON A;  4EZ9 A;  1WG1 A;  2ACM A;  1S1V A;  5F8G A;  3KHR A;  2ZM6 F;  5JVH Q;  4BHQ A;  5IQQ A;  1SQE A;  4EO6 A;  4HT7 A;  4DSJ A;  4AUK A;  1DQ8 A;  4LBI A;  1H38 A;  1F60 B;  4Y00 A;  1DY3 A;  1RHU B;  1SUQ A;  3UFC X;  2U2F A;  3DCA A;  3K8W A;  3TJ8 A;  4IG0 A;  2HQ3 A;  2PO4 A;  4UST A;  3VV2 B;  1QAY A;  4NYZ A;  3R97 A;  4JV1 A;  4WXW A;  3THT A;  4C97 A;  4X65 J;  2EFN A;  2FVR A;  2VQF J;  1QJH A;  2K06 A;  1HI0 P;  4KHP J;  2AKW B;  2HVE A;  4K4Y A;  3ZTP A;  4WZM A;  3I5B A;  3CCQ S;  5J1E B;  5LM7 E;  4X4P A;  3UN5 A;  4KFB B;  4UZB A;  4K4T A;  3V4I B;  2P9C A;  4LF6 F;  2MQ8 A;  1KLM A;  4DR5 F;  1RT2 A;  1F1B B;  3R27 A;  3O3L A;  1VQO S;  2CJK A;  4L76 A;  2OP5 A;  2JX2 A;  4ES1 A;  4WE1 A;  3HP6 A;  5DS7 A;  1LV5 A;  3KLI B;  3KDN A;  3ULH A;  4FYX B;  1K47 A;  3G82 A;  3H0P A;  5KG7 A;  1T05 A;  4K5R A;  1RTJ B;  1U1M A;  1RHM B;  4DV7 F;  3NAH A;  4I2P B;  2UUA J;  4P2S A;  4F0H A;  3UE2 A;  2JNJ A;  4JBC A;  4UQT A;  5BYQ A;  3H7H B;  3AY0 A;  1LQ9 A;  4P7T A;  2V2V A;  1VQ9 S;  4CLU A;  4WK1 A;  5C42 A;  4PWD A;  3PO5 A;  1D9D A;  1FFS B;  4ZLN A;  3WIV A;  2DIU A;  2J7K A;  2AQ4 A;  1HWI A;  1UA1 A;  2BDP A;  2UXC J;  3GJT B;  4YN3 B;  1W25 A;  4DI6 A;  1HQE A;  2B4V A;  3UVJ A;  4Q43 A;  4DV5 F;  4JOU A;  2FLP A;  2KRR A;  2MQL A;  3TZY A;  2VA2 A;  2NZC A;  1VQ8 S;  4ANC A;  1HNI A;  2PI5 A;  1VIX A;  4ZP8 A;  1Q5Y A;  3BO4 A;  2V8V A;  2VDI A;  2XYH B;  1X4F A;  4KV8 B;  5KG4 A;  2ZFH A;  1NK7 A;  1J5O A;  1QSL A;  2B7B B;  1JNZ B;  3VAH A;  3PJ9 A;  1HA1 A;  2HS4 A;  3OTD A;  1RTD B;  1PCA A;  2CG8 A;  1RBL A;  3FDS A;  3ILJ A;  2DR9 A;  3M32 A;  3F44 A;  4KY3 A;  2AGQ A;  4MK7 A;  5HSP A;  1Q78 A;  3H5S A;  2Q43 A;  2E5L J;  4CT9 A;  3M6U A;  4ETZ A;  2I9S A;  4LRF A;  3AOC A;  3LAN A;  4DL5 A;  5H9E K;  2MZS A;  1PYT A;  3CD0 A;  2FVQ A;  2IBK A;  3J80 Y;  2EG1 A;  5LSL A;  3KHH A;  3A3N B;  1TKT A;  3DYA A;  2Y1J A;  2ASL A;  4PG6 A;  2HNZ A;  2VFS A;  2D1C A;  2LEA A;  3GYG A;  1IBL F;  1JLF A;  3KK1 B;  4WP9 A;  2M2B A;  4DN9 A;  4WFN Q;  3MCM A;  5KOX A;  1C4C A;  2ZHO A;  5HVG A;  1S0M A;  1BHN A;  4F4X A;  1P1T A;  4M5G A;  1G6B A;  2L41 A;  2AWZ A;  3ITH B;  3AJ1 A;  3M6V A;  3QQC D;  3THV A;  2ASY A;  2E5J A;  4YR0 A;  2BVZ A;  4OZ0 A;  4NOH A;  1RP5 A;  4G6V B;  5GAG U;  3RB4 A;  3M2R B;  1QSS A;  2Z56 B;  1S1X A;  1PC5 A;  2O67 A;  5F8M A;  3KJV A;  5ETO A;  2LKZ A;  2L9N A;  4GC7 A;  4DV4 J;  4MFB A;  3CT9 A;  4IO9 Q;  2HPU A;  2J5A A;  4ECT A;  2W9B A;  4CRJ A;  4JI6 J;  4O3S A;  4GKK F;  4QWE A;  4B3S J;  2KH9 A;  2GML A;  1RLD A;  4HR2 A;  4N8O A;  2RU3 A;  1RTH B;  2A6M A;  4A47 A;  5KFL A;  4JP8 A;  4OI2 A;  3MHY A;  3UDV A;  3Q8Q B;  4ZPA A;  2R9L A;  2BE2 B;  4AND A;  4DU7 A;  5D4P A;  3CB4 A;  4RW7 A;  1HNZ J;  3P6Y C;  2ZVS A;  4DSI A;  3EWG A;  1XN9 A;  3FNN A;  3Q86 A;  5IOL A;  4M5J A;  1RTH A;  1HHT P;  4DSL A;  1D3W A;  2CNK B;  3HJV A;  4GO5 X;  3IGV A;  5K8N A;  2ZH4 A;  1D8Z A;  3PHT A;  4N41 A;  1X5S A;  2HGM A;  2OPS A;  3CUL A;  3NS7 B;  5F0W A;  3SI8 A;  1FER A;  1RTJ A;  3L95 X;  3Q8V A;  1RKI A;  4HHJ A;  2ADC A;  1N5Y A;  1M5K C;  1S6Q B;  1URN A;  4YR2 A;  1TFW A;  3KLH A;  4IRD A;  3G8Q A;  4TY9 A;  5A8R A;  3T6B A;  2AEM A;  2VPW B;  4LBH A;  3WHI A;  2WTF A;  2ZH7 A;  3BO2 A;  1XMQ J;  3KLH B;  4H4M A;  4PR6 A;  2FJB B;  2QV6 A;  3N79 A;  3MAQ A;  2YWW A;  4LUB A;  5KG0 A;  3TO8 A;  2BAN B;  4B9N A;  4B3T J;  4CO0 A;  2GJ2 A;  4KV8 A;  2VJU A;  2J0S D;  1VBY A;  4PG8 A;  3BQ0 A;  2XS7 A;  4WFB Q;  1XEZ A;  1YQH A;  1UMJ A;  2ALY B;  4XK8 C;  3WIU A;  4ZVQ B;  2YNF B;  3N6N A;  3N6L A;  3TVZ A;  4Y34 A;  5KFY A;  2JRS A;  3O6Q A;  2ZDO A;  1RWK B;  1B0P A;  2Z8Q A;  3DOL B;  3ZZT A;  3HKW A;  2M0G B;  5ITH A;  2IJR A;  5KFW A;  1TAU A;  4LF8 J;  3MM8 A;  2X51 A;  5H9E J;  4EMD A;  3LAM A;  2YX4 A;  1ZYQ A;  2P6T A;  1EP4 A;  1WTF A;  4O44 B;  4YR3 A;  3RB6 A;  1LNQ A;  1MLA A;  3JTO A;  1H0H B;  1KR4 A;  2ZIT A;  4USJ C;  1RI7 A;  2YNG B;  1U1K A;  1N52 B;  2BV3 A;  1SJ3 P;  3CD6 S;  1ULR A;  1PBA A;  4I2Q A;  2IJN A;  3V6H A;  1V3Z A;  2G2Y A;  2KRB A;  1DLO B;  3LAL A;  2VG5 A;  3UR3 C;  7AT1 B;  1HBM A;  3HSZ A;  4DL7 A;  2A1B A;  2IYG A;  3TP2 A;  2W2N P;  4PPZ A;  4DLG A;  4J91 A;  1RT2 B;  2AF6 A;  4NXM J;  2MZR A;  1K0T A;  3FVY A;  4P7V A;  2DK2 A;  1KC8 T;  4TN2 A;  1FNM A;  2NQP A;  1YTY A;  4BLG A;  4NLX A;  4LFA J;  3UQS A;  3VAG A;  4FPI A;  4AL7 A;  2ZJQ Q;  1ZET A;  1Q8B A;  4K2J A;  2WW8 A;  5C42 B;  3DM2 A;  5AXN A;  2HWI A;  2EVZ A;  4LF2 A;  2DNK A;  3DYA B;  4UF4 A;  4MYU A;  5IT0 A;  1FO1 A;  4DL4 A;  2VG7 A;  4KRW A;  3NOG A;  5ETV A;  4XTT A;  4RBU A;  1OSC A;  3QYY A;  3NLC A;  3KLV A;  4ECS A;  4I2P A;  2CJ9 A;  2J8S A;  3WBZ A;  3AJ2 A;  1TK8 A;  2I6W A;  1SIZ A;  1FRL A;  1S1T A;  2HQD A;  3T1H F;  2CDR B;  2DNZ A;  2M88 A;  4ZS6 A;  4OI3 A;  3CCS S;  4B9V A;  1NHK L;  1VCT A;  3C66 A;  1YIJ S;  2JC0 A;  5KT3 A;  1LFW A;  1DJ0 A;  3I5C A;  1CJU A;  4ZN3 A;  5BYS A;  5D3G A;  1ROF A;  2DNQ A;  5AT1 B;  1O8B A;  3DGP B;  5AXK A;  1VI7 A;  4USM A;  1JX4 A;  2QA4 G;  2DR8 A;  1ZS6 A;  3B54 A;  2D69 A;  1MWZ A;  4DCJ B;  2QX0 A;  1TU0 B;  1VRU A;  1GAO A;  1IQT A;  3C16 A;  3TJ9 A;  1IBM J;  4NLU A;  5E3A A;  3MR3 A;  3GJQ B;  2M9K A;  4URQ U;  4NWB A;  2MHE A;  1DQ9 A;  1BD6 A;  2C1E B;  2QE5 A;  3G86 A;  3GWC A;  2V8H A;  3MEE B;  4FPR A;  4DL0 C;  4NYO A;  3KTQ A;  1RAI B;  1UWB A;  2BEF A;  2ZWO A;  4R0J A;  1IM6 A;  5EX0 A;  4WPA A;  4QIG A;  1H6K X;  4BS2 A;  1MU2 B;  4M5M A;  3W61 A;  1UL3 A;  2EPI A;  3EGV A;  3ETM A;  1NPK A;  2MZQ A;  3JTP A;  5D6G A;  1KQG B;  5M2R A;  3FBF A;  1NUE A;  2DO0 A;  2KDO A;  2E5H A;  1QUV A;  2M5Y A;  4JI2 F;  5F3Z A;  2RRA A;  5KT5 A;  3PY8 A;  4NLT A;  1I94 F;  4URS A;  1RXO B;  3OTO F;  2VD3 A;  3PIP Q;  2I1R A;  5J2P A;  1CPZ A;  3Q83 A;  1RWU A;  3R5B A;  1M5S A;  3PZP A;  2FVC A;  3KWM A;  4TU8 A;  1HMV B;  1FKO A;  2L08 A;  4KFB A;  2W8K A;  2ZJR Q;  1P27 B;  1SV5 A;  4G1I A;  4Q2M A;  8RUC A;  4A8F A;  2CVI A;  2YXL A;  1QD1 A;  2MQP A;  3OL6 A;  2JL9 A;  2NYI A;  1VYA A;  3L09 A;  3DRY A;  2QC3 A;  4EWT A;  1EET A;  4WKY A;  5A0Y B;  3MUR P;  1JLA B;  4PAA A;  3W8P A;  1UFL A;  3UPF A;  5K14 B;  1VOM A;  2LQ8 A;  4IO1 A;  5KFV A;  3N4W A;  3QWP A;  4I2Q B;  4ELT A;  2XMJ A;  1EAR A;  1EX8 A;  2B7C B;  5B09 A;  2RQK A;  3ZZP A;  4PRF A;  1U45 A;  2FY8 A;  3SCK E;  2M52 A;  2XCA A;  3KHL A;  3EPG A;  2VPX B;  3NWG A;  5B0E A;  5EWF A;  3OW2 R;  5DLF A;  2Z57 B;  3VZI A;  4UUX A;  5CCM A;  1DTQ A;  3SQG B;  4ATN A;  1JJ2 R;  1S1V B;  3A8J A;  1QY7 A;  2IVY A;  4MIW A;  1KDN A;  1IXK A;  1RT6 A;  2R2U A;  3W2W B;  1M1G A;  2DH8 A;  3BQ1 A;  5FDL B;  2GVD A;  3D6M B;  3D5M A;  1K9M T;  4QWA A;  4TY8 B;  4DG1 A;  3I5A A;  3R5A A;  3MDF A;  3OQ2 A;  1D8Y A;  3Q8P B;  1FDD A;  3HXM A;  3RYL A;  2MJN A;  2NXU A;  4F04 B;  1T3N A;  1IBL J;  3HSD A;  1K73 T;  2KZM A;  1HHS A;  2IBO A;  4OLO A;  1S6Q A;  1GXT A;  4J9P A;  3W9H A;  2RUS A;  1RUS A;  2CDQ A;  3TYT A;  2AEJ A;  2BKN A;  1VFJ A;  1XJW B;  1M0S A;  1WEY A;  4DV3 J;  1FJG J;  1N33 J;  1NEE A;  3K7R A;  1FWK A;  4Y2A A;  5T14 A;  1REV A;  1HNV B;  1R8B A;  3RAX A;  1FRM A;  1X5P A;  3AT1 B;  4J5O A;  4FBT A;  1RBA A;  1E6V A;  5CH7 B;  2WRM A;  4M8L A;  5LJ5 Y;  3F0N A;  4RW7 B;  3SSQ A;  2L3M A;  1M1H A;  3DFE A;  1GTH A;  2RS2 A;  4IDK A;  3BGO P;  2JEG A;  2YWE A;  3FC9 A;  2D3U A;  4RW8 B;  4UUW A;  2CZ4 A;  1U02 A;  5DGA A;  3UD4 P;  4TLR A;  3JSM B;  2LXF A;  3CDE A;  3CJ8 A;  3EM1 A;  4DFJ A;  4QU6 A;  1OWX A;  2CQC A;  1XTZ A;  1VC0 A;  1NO8 A;  2IRU A;  4FKX A;  2MEW A;  3HHK A;  3I0S B;  1V5I B;  2VHG A;  1IBM F;  4G1P A;  4GKJ F;  1RGV A;  2JH3 A;  2JFD A;  2MY7 A;  3M8Q B;  3KJV B;  4E0D A;  2ZZN A;  1MML A;  2KKH A;  2HK3 A;  4Z7C A;  4ZLJ A;  4LF7 F;  2CPE A;  2PC6 A;  3TUZ C;  4ZVT B;  3HHD A;  2FPH X;  4B3R F;  4K0K F;  1UTA A;  2NXC A;  2DNP A;  3M7V A;  3UNY A;  4JI8 J;  4L72 B;  4QIW D;  4LF5 F;  2DIT A;  3HHL D;  2U1A A;  2CG4 A;  2WCX A;  3AJD A;  1RAD B;  4ZJO A;  1WJ9 A;  1VQN S;  1S6P A;  5E3C A;  4YHH F;  3OUY B;  1BQM A;  1JKH A;  3MWB A;  4MK8 A;  1XBW A;  4NRU A;  2KYZ A;  3P8B B;  4WP3 A;  3Q8R B;  1LW0 A;  1RDR A;  2DIV A;  2MQN A;  4UT4 A;  4DN0 A;  5CYQ A;  1FRH A;  2XO6 A;  3M1V A;  3JAM U;  1JXE A;  4A8Y A;  2KXN B;  3MMA B;  3KLG A;  3FRY A;  4OV1 A;  2MZT A;  2W4P A;  3ISZ A;  3AAW B;  4B17 A;  2QFI A;  1HLW A;  2O66 A;  4JI4 J;  4ZLL A;  1U1N A;  4IQM A;  4A8O A;  1C0U B;  1U25 A;  1R0C B;  4C11 B;  2XGP A;  2VQE F;  1S97 A;  2ACY A;  3MGJ A;  2RH3 A;  3BEG B;  3DOM B;  4OZ1 A;  4YFU A;  3MEC B;  3E2E A;  5A8K A;  1LWF B;  3IA0 A;  4NLD A;  4NEZ A;  4USW A;  3W64 A;  1S79 A;  4IYQ A;  4IFY A;  1Q7Y T;  5LT5 A;  4FVC A;  1VK8 A;  3DN9 A;  2EBE A;  2KI2 A;  1TP7 A;  2EFV A;  4C0O C;  3QSY B;  1S72 S;  1U2C A;  2XS5 A;  3PXG a;  4G3I A;  2F7V A;  3BM7 A;  1ZPW X;  4RW4 A;  1QDU B;  4N5S A;  2E9R X;  3HSJ A;  4PWD B;  2HFO A;  3FQK A;  1N32 J;  4ITS A;  4J7C A;  3IWX A;  4QOT A;  1FXR A;  3G71 S;  3W9J A;  5IT4 A;  3R6G B;  4RBT A;  5C25 A;  3ZTS A;  2N3O A;  2VIC A;  2YKP A;  3MEC A;  5F9N A;  2XWX A;  3IAS 9;  1YJU A;  4JI1 F;  1R8H A;  4MAK A;  1YSJ A;  1OQ3 A;  3MOJ B;  2KM8 B;  3NMA A;  1WSR A;  1AZS A;  4UZC A;  2ZZT A;  2AGO A;  3CDW A;  3IBF B;  3LPY A;  2CZV C;  4PQA A;  1NB7 A;  4GO7 X;  3KXD A;  1OJ4 A;  3VVU A;  2B4P A;  2XO7 A;  4LF8 F;  1Y7P A;  3BBF A;  3QGP A;  4M5K A;  3T6J A;  1U1L A;  2NXE A;  2O3D A;  1XMO J;  2GV1 A;  3CCW A;  1KLM B;  4U96 A;  3HFK A;  3LPE A;  1S5Z A;  3M8P A;  3R6L B;  3PFO A;  5CYM B;  1SJQ A;  2VBW A;  3G6X A;  5J1E A;  4WFX A;  4EYH B;  5AJ3 J;  2V4J B;  3BGF A;  2CPF A;  4HEA 9;  1VQY A;  3HD1 A;  3KG0 A;  3DLE B;  3OSP A;  1ZA2 B;  2A2D A;  4Z2X A;  5EWG A;  2VON A;  4NCG B;  2Z2Z A;  2UXB J;  4ED3 A;  2WBM A;  4IRC A;  1I6J A;  2WHO A;  2J6S A;  1DRZ A;  2JVO A;  1VQ4 S;  2V34 A;  4OYM A;  2P5V A;  5EDW A;  2AJF E;  3IRX A;  4G1Q A;  3R9L A;  3TZX A;  3JB9 k;  4ELU A;  4K5S A;  1NDP A;  3FBE A;  1H3D A;  1R0A B;  1S48 A;  3ZXW A;  1FEH A;  4RL1 A;  1PIL A;  3GE9 A;  3LW5 C;  7FD1 A;  4DQQ A;  4X64 J;  2R7X A;  3R1H A;  2C3U A;  3M8Q A;  4V1A k;  3NNC A;  2QFJ A;  2PEH A;  3L7P A;  6FD1 A;  1ZPV A;  1RT1 B;  1VBZ A;  4N47 A;  1NPP A;  1VC5 A;  2DVI A;  4ER8 A;  2XNR A;  3MMA A;  3RAQ A;  4F2S A;  3MEG B;  3PX4 A;  4P2M A;  3HLU A;  1ZAW A;  4KQZ A;  1PYS B;  2UVV A;  4PQU A;  2ZBQ A;  3AHP A;  2DHX A;  4LSN A;  2HWT A;  4NXN F;  2HHH F;  5KFS A;  1IKV A;  1YBT A;  2XMK A;  2V5H G;  5B0F A;  4J9K A;  3KUG A;  3HHE A;  1GTE A;  2DRD A;  1S6P B;  2RKI A;  2W2M P;  1RCX B;  4ECW A;  4JI0 J;  3KYL A;  3EPI A;  2H48 B;  3IBW A;  2DNG A;  2GMJ A;  2RSQ A;  3BGL A;  2NLW A;  4KKO B;  1YBA A;  1FJC A;  3NG8 A;  2FD2 A;  2NS1 B;  2D9O A;  4KGM A;  4EK2 A;  2QTW A;  1GMW D;  1UPM B;  3AQO A;  3CF5 Q;  3P49 B;  4PG5 A;  2ZHB A;  2AJ2 A;  3QGG A;  4PXC A;  3J81 Y;  3MR5 A;  1QE1 A;  1JLG A;  1T94 A;  1IBC B;  1EHW A;  2W01 A;  3FSY A;  3HI9 A;  4DBQ A;  1HD0 A;  5HQ8 A;  3BDP A;  3X1L B;  4Y3C A;  4OYW A;  3E51 A;  1C0U A;  1RAE B;  4ZIW A;  2OMO A;  4NI2 B;  1RWV B;  4HAC B;  2FLN A;  4X84 A;  2ZEJ A;  3TAM A;  2XUL A;  3H2U B;  5K20 B;  1T9Y A;  3E01 A;  4CO3 A;  2P9E A;  3H98 A;  4M1K A;  2N3L A;  2HBZ B;  3P3D A;  4YUD A;  2VH7 A;  4DV2 J;  4FNH A;  1HNZ F;  1LW0 B;  3QAE A;  1R8P A;  1SKW A;  1RWM B;  4ELV A;  3THP A;  1VIO A;  4WKR A;  4OJ1 A;  3DDK A;  5F8I A;  3BKF A;  1I3O B;  1KOO A;  2R8K A;  2G4B A;  1NJI T;  2HHW A;  1U1R A;  3A13 A;  1XNR F;  2FHK A;  1RT3 B;  4OJG A;  4NLP A;  1SCJ B;  2ZUA A;  3OXF A;  3BQ2 A;  3GSI A;  4FF2 A;  1F9H A;  2HNY B;  2FC8 A;  2IAJ B;  3CJK A;  4CT8 A;  3FSX A;  4DUZ J;  2OEL A;  3NGK A;  3DDI A;  2BM0 A;  4FS2 A;  2DRB A;  1CQM A;  3PW5 A;  1RAF B;  2OI2 A;  1HFE L;  2J76 E;  2XCP A;  2NYH A;  2VOP A;  4AFF A;  2H4W B;  4MKB A;  1HNW J;  3VHQ A;  1HQU A;  4ZPW R;  2OHD A;  3MM6 B;  4DQP A;  1WF0 A;  3A12 A;  3MCO A;  1XWL A;  1QVG R;  2FGO A;  5GAH I;  2VV5 A;  5L1K A;  4PG4 A;  4W98 A;  1FRX A;  2GJI A;  1ZM3 A;  3FQL A;  4JI8 F;  4CM0 A;  5LMN J;  4WTY A;  3GSD A;  4DV7 J;  4KTQ A;  1X5O A;  4CYU A;  1WOO A;  4LF9 J;  3B4D A;  1VJQ A;  2RAQ A;  2QA2 A;  5DLG A;  5DM6 Q;  3PR5 B;  3NBP A;  3CGI A;  2G9O A;  4LR8 A;  2F8E X;  2CQH A;  3T5K A;  2R8J A;  3KLF B;  2R8H A;  3OFG A;  5GAD I;  4DSF A;  2KTQ A;  2XSJ A;  3A8K A;  3SZ2 A;  2IPO B;  1U7L A;  3DRR B;  5J2M A;  4OYI A;  2ZOG A;  1HNW F;  2KM8 C;  2CAJ A;  1X9W A;  1ZM9 A;  2XLI A;  3J7A 1;  2CIM A;  4CTA A;  1AUD A;  2HVH A;  4BWM A;  5J2N B;  4DUZ F;  3HHL B;  1UW9 A;  3E3X A;  1FKO B;  2CA9 A;  4B3R J;  2XZW A;  1R7I A;  1TL7 A;  3EVM A;  1OY6 A;  3CMA S;  4OX6 A;  4OYO A;  1U1P A;  1IWA A;  4FNI A;  1TTH B;  2GVD B;  1HI8 A;  5IC6 B;  2RT3 A;  1RT1 A;  1VBK A;  2RHS B;  1HWJ A;  2YTC A;  4HAC A;  4O4R A;  3B8H A;  5D0G A;  5AXM A;  3HVA A;  4IKA A;  4PAB A;  4DV3 F;  4F4Z A;  4MIB A;  4KJI A;  1CJV A;  4B3M F;  1N33 F;  1S1T B;  1F9E B;  1B7Y B;  1Y3K A;  2FHO B;  3FGV A;  2HGN A;  4R25 A;  3DHX A;  4EBD A;  4ZA1 A;  2ATL A;  2B9E A;  5KTQ A;  2DR5 A;  2GO8 A;  1OPZ A;  5D0H A;  2FHJ A;  3BYP A;  2FVP A;  2DKO B;  1X60 A;  3GP9 A;  2AV5 A;  2XQC A;  2VG7 B;  4DV0 F;  5BXI A;  4DJB A;  3FSI A;  2W4D A;  3K59 A;  4JV5 F;  3OHA A;  4ICL A;  2AMC B;  3MOZ A;  2W9C B;  1UVK A;  1UVJ A;  1S1U B;  3BKU A;  1OPI A;  1MRO B;  2RVJ A;  5KFI A;  5KOW A;  3NKY A;  4KSE B;  4DQS A;  4DF4 A;  2FGC A;  2MKS A;  3CDA A;  2RKI B;  3W2V A;  2BXJ A;  4D3H A;  2RQC A;  5IT9 Y;  3H59 A;  2VKZ G;  3KK3 B;  2B9W A;  1IKV B;  1VRU B;  3LGN A;  1Q8I A;  2X1F A;  1MN9 A;  3LP2 A;  1VBX A;  1HMV A;  3D3C J;  3HVW A;  3QFW A;  5SZT A;  4EFA C;  1YZ7 A;  3TZW A;  1WHY A;  1M5H A;  3SMZ A;  5J2P B;  3BJY A;  3DLH A;  4C9D A;  4JB8 B;  2MKK A;  1Q81 T;  1L3T A;  2DB1 A;  2HQC A;  3IS9 A;  2XY7 A;  4DPU A;  2HYI B;  2DY9 A;  2ZD1 B;  3W5X A;  2W2Q P;  2JZ5 A;  3MCS A;  2C42 A;  2R8G A;  1REG X;  3PCO B;  2CQG A;  2HS3 A;  4HTI A;  2YNI A;  4ZPD A;  3UDE A;  4ZK7 M;  3CPW R;  4UY8 5;  7FDR A;  5LXR A;  1D1U A;  2YNG A;  3S7R A;  3GQC A;  1CS4 B;  1IKX B;  1TKZ A;  2DH7 A;  3NY0 A;  4C8K A;  4P75 A;  4F2R A;  5D0E A;  3UN2 A;  4CI0 B;  3M8R A;  4O3O A;  1X9M A;  1N5Q A;  1HNX F;  4DR7 J;  1CVJ A;  3LQV A;  1LW2 A;  2VUG A;  4P74 A;  2D3O 1;  2WVB A;  2JDJ A;  1I94 J;  3T5J A;  2HLT A;  1Y11 A;  2A10 A;  4GVB B;  2EEY A;  3I4H X;  4ED4 A;  3OL7 A;  3IWN C;  4N56 A;  5CYM A;  1A6L A;  1VK3 A;  3D6H B;  1NBE B;  5DG9 A;  1S1W B;  1SC4 B;  3DGP A;  1RE1 B;  3A4T A;  3G2X A;  4DV1 J;  1VLO A;  3MPU B;  1FFW B;  3O2I A;  3J7A N;  4RJV A;  2IY5 B;  3GV8 B;  2MKI A;  5B0G A;  3K5L A;  2W24 A;  2B8Q A;  3LF0 A;  4NX9 A;  1R43 A;  3TAR A;  2XLK A;  2J7U A;  2C3Y A;  3TR5 A;  4ED2 A;  3MM7 A;  2YX1 A;  4IR9 A;  3D66 A;  2PN6 A;  2B3T B;  5MAO A;  1X4G A;  1HQ2 A;  3FKB A;  3R5J B;  3SQO P;  1WKK A;  4ZP7 A;  3VGV A;  3OFF A;  3M9N B;  5CYQ B;  3WC2 A;  1H72 C;  1R6Y A;  1JNR B;  3ELH A;  3LP0 A;  2GGP A;  4O23 A;  4OI1 A;  1IKY A;  1FD2 A;  4RO0 A;  2HHV A;  5CQG A;  1SC3 B;  4MH8 A;  5HRO A;  1P8G A;  2FJX A;  1L3S A;  1ZBT A;  1F5A A;  3MEK A;  1OY8 A;  4Y2C A;  3K58 A;  3VQS A;  4KH0 B;  3EVO A;  4NCA A;  4KT0 C;  2YWK A;  2KZZ A;  2K7J A;  2LQB A;  3OD2 A;  1I51 B;  2EWH A;  3C15 A;  3P45 B;  2CFX A;  2K1R B;  3I0R B;  2YKA A;  3QAT A;  5KFZ A;  3N6M A;  3T1H J;  2AYG A;  3HJF A;  1UJ4 A;  4CM2 A;  4DUY J;  4PPD A;  4ZVP B;  2A0F B;  2HMI A;  3QLH B;  2ZC3 A;  2AW0 A;  2PA8 D;  3BGU A;  5HMY A;  1RT4 B;  3V5R A;  3ILO A;  4HYK A;  3PW4 A;  2F40 A;  1KS2 A;  4DX5 A;  1RHK B;  3HPO A;  3IO1 A;  1DLO A;  3CE8 A;  1WKL A;  2X3G A;  3PYG A;  4I0W A;  3CJ2 A;  4ZPC A;  4BBY A;  1EIY B;  1RWN B;  1DUR A;  2RQ4 A;  4LF1 A;  1IJE B;  1WDT A;  4P52 A;  5KG2 A;  4JI7 J;  4LFA F;  1HBN A;  4RW8 A;  2DGO A;  1KOH A;  1SIW B;  1C1B B;  2VQE J;  1FDN A;  3M6W A;  2XM3 A;  3AA9 A;  1PYO B;  3IAM 9;  4Q7A A;  3IR7 B;  2C2D A;  3CJ3 A;  1BQN A;  4K2X A;  4QYR A;  3CCJ S;  4LFC J;  3FFI B;  1YRT A;  4I1T A;  1HWK A;  2R7W A;  3CME S;  1BQN B;  4YP3 A;  3H4B A;  3AD9 C;  2HNZ B;  4OZ2 A;  3HVR A;  1TMM A;  3QGH A;  4DV6 F;  3MPD A;  1Y5L B;  3RRG A;  4K4X A;  1FVQ A;  4RW6 B;  1BWE A;  3OSN A;  3ENQ A;  1W7W A;  1A7G E;  3RG6 A;  2VJV A;  4K4Z A;  2Y0S D;  3VGU A;  2MLY A;  4DPW A;  4RWX A;  5IM0 A;  4AQY F;  5I3U B;  4MKA A;  1FEE A;  2RML A;  3PG9 A;  4YME A;  2JLG A;  5ETL A;  4WFZ A;  3NGT A;  2EKY A;  2QL7 B;  2ATC B;  2XB2 D;  2PMZ D;  3QLH A;  3SIP B;  1NDC A;  1S1X B;  2CAD A;  1FT8 A;  1MSW D;  3B6B A;  4ZVO B;  3ZTR A;  1MNE A;  1N0V C;  2AJ1 A;  2APO A;  3TVY A;  4ZVU B;  1RT5 B;  2BJ1 A;  1HBU A;  3CJ0 A;  3EGW B;  3R7S B;  3D54 A;  4PXB A;  2N4D A;  5KG3 A;  4ECR A;  1SL2 A;  1HYS B;  4WP8 A;  4RBV A;  3I0R A;  1U48 A;  3KJQ B;  3UCU P;  5G4D A;  3ZZZ A;  3PX0 A;  3GZ7 A;  1GT8 A;  4RKU C;  2R7U A;  1TR0 A;  1WF1 A;  1RTI A;  1TUW A;  1TZ0 A;  3U1L A;  2ERR A;  2CJB A;  4TU9 A;  3VAJ A;  2QRR A;  1J5E F;  3T9N A;  2W9A A;  4C98 A;  2XZD B;  4L3N A;  1RWO B;  2EK1 A;  4CLS A;  3DU5 A;  1AYE A;  1Q86 T;  1Y5N B;  4WXO A;  3C46 A;  3HFV A;  4RZR A;  1WF2 A;  3K5P A;  1YDL A;  1T05 B;  2IDE A;  4KPY A;  3LP1 B;  3POT B;  1X7V A;  1FJ7 A;  2DXE A;  2VC1 A;  2XBP A;  1EKS A;  4C0H A;  1R8A A;  3C6U B;  1C4A A;  3H2L A;  4CH7 A;  1FJE B;  4AD6 A;  4FF1 A;  2HZA A;  3J81 j;  2IFX A;  2ZZM A;  1KVK A;  3SFG A;  5EX3 A;  3TNV A;  4DMZ A;  1WWH A;  3NAI A;  4KPC A;  5FJ4 A;  4WF9 Q;  1VDH A;  2CQ1 A;  4BWJ A;  2GAG C;  2B51 A;  1WOP A;  5SUH A;  3WC0 A;  1VHI A;  3EJM A;  1KD1 T;  4RUH A;  2J9E A;  5DGB A;  4C3L A;  4GKK J;  3CJS A;  3K89 A;  2UU9 F;  2VG6 B;  1FDA A;  2ZH9 A;  2RJZ A;  4GC6 A;  1FJG F;  1EQ0 A;  5BJR A;  2GO9 A;  2POK A;  2H4Y B;  3U02 A;  4RW9 A;  4ETX A;  3CDU A;  3B78 A;  4U9R A;  3EIC A;  1PIE A;  1YK9 A;  3QBC A;  3K57 A;  5DDP C;  3K2Y A;  2CQI A;  2LLZ A;  3P5B P;  2OKQ A;  2DGS A;  3MTK A;  3DLB A;  4FVM A;  3KUH A;  3DDN A;  3NGU A;  3SBM A;  4B08 A;  4W90 B;  5I42 A;  1SBR A;  4WU2 A;  4CLW A;  4IOC Q;  2BM1 A;  2W7P A;  5A6P A;  4OZ5 A;  2QL5 B;  2M3D A;  2WON B;  4KO0 A;  4ENO A;  3RBD A;  1SL0 A;  3LGM A;  4WE1 B;  4AE5 A;  5A2Q U;  4C4W A;  1GX5 A;  1LWE B;  8AT1 B;  4E8U A;  4EEY A;  4TKT A;  3NP5 A;  5LOQ A;  1VQP S;  5HBM A;  1RAH B;  1TL3 A;  2M4M A;  2BJ8 A;  3HZE A;  1LFP A;  3R2C J;  4W4M A;  4B9T A;  2YKN B;  3GII A;  3D28 A;  2QA4 S;  3GG1 A;  3E8O A;  2B9Y A;  3PAC A;  3OPK A;  4FXW A;  1T0T V;  4QWB A;  3W2V B;  4ZCL A;  3NXZ A;  4USH A;  5THW A;  3Q24 A;  3Q22 A;  4ECZ A;  4DZD A;  3SXL A;  2YPZ A;  1MU2 A;  2QIF A;  2HHT A;  1NJY A;  2NZ4 A;  1FRI A;  2LMI A;  4W92 B;  4OYX A;  3OBI A;  1UWB B;  2BRL A;  5GAG I;  1PAE X;  2J6U A;  1IKX A;  3NCQ A;  3P4U B;  1O0P A;  2RIJ A;  3M9O B;  2DH9 A;  2DNY A;  4S0M A;  2OUG A;  3OVA A;  2NSC A;  1TAQ A;  2X7I A;  2M7S A;  4JI5 J;  2H51 B;  1U49 A;  4NLQ A;  2Z2M A;  4QPT A;  3MMB A;  1R89 A;  1H74 A;  3MCN A;  1U09 A;  1BGX T;  2YKM A;  3AB2 B;  5KG5 A;  1J5E J;  3DLL Q;  4BDP A;  1X4C A;  4LT6 A;  1XIQ A;  3QRR A;  5T7L A;  3I9V 9;  2H65 B;  4KAI A;  4CLT A;  2WB4 A;  1IN0 A;  1WC6 A;  3SFU A;  5C5J A;  3PEH A;  4LR9 A;  1TL3 B;  4OLP A;  2DNR A;  4H54 A;  3HT3 A;  2YKM B;  3BSC A;  1UFK A;  3RW7 A;  2UP1 A;  3MMJ A;  4LR7 A;  3N5F A;  4C8O A;  4OHY A;  4DFK A;  3MPV A;  2MGZ B;  1KQK A;  3W5Y A;  5B0B A;  2WSF C;  3M9M B;  2HFS A;  2UUA F;  5I4M A;  4O0N A;  2UUC J;  4YOE A;  5IWA F;  4LF9 F;  2HK2 A;  3DXB A;  4HH1 A;  4ID8 A;  4ICL B;  2W9C A;  1MW7 A;  4PUO A;  4X4O A;  2ROP A;  9ATC B;  4KIA A;  5CCL A;  2VOD A;  4ZN1 A;  3Q8S B;  5L1J A;  1QAI A;  4P73 A;  4DX8 H;  4TNO A;  5GAE I;  2QLF B;  4CQ1 A;  4OZ3 A;  4R0E A;  3FJ2 A;  2ZWP A;  1DBD A;  1P1L A;  3CED A;  3JSB A;  3TVK A;  4F4A A;  2BOP A;  1KNZ A;  2BJE A;  4XIU A;  2C2Z B;  1SJF A;  2VPY B;  4M5L A;  3HMJ G;  1AFI A;  2CQ0 A;  2CJX B;  5K9F A;  5HLF A;  3T1Y J;  3C3L A;  1N54 B;  2C3M A;  1UJ5 A;  4ALZ A;  3HCX A;  3H25 A;  1KHV A;  1UAW A;  2UUW A;  4X66 F;  1CSJ A;  1TFY A;  1QAJ A;  1UWA A;  2RHQ B;  3AOA A;  3TAP A;  4B9L A;  1IQZ A;  1FNX H;  3KHG A;  1LWE A;  3IBC B;  2FLO A;  2J9D A;  3MM6 A;  3WQP A;  3RRK A;  2KVI A;  3NMR A;  2R4F A;  1SC6 A;  3C14 B;  2OO4 A;  5A8R B;  2V4R A;  2MY8 A;  2WW4 A;  3M2V A;  4CLP A;  4JI7 F;  4QWC A;  2VB6 A;  5B0D A;  2B0G A;  2BX6 A;  2PGC A;  5CZV A;  5JXS A;  4J9S A;  2CJY B;  3KNG A;  1N6Q B;  1RTZ A;  4M94 A;  4NXM F;  1FNO A;  4C6A A;  4HKQ A;  5FLX U;  4KGV B;  3TJA A;  4EBE A;  1WG4 A;  4MMO A;  2QGF B;  1GMU A;  2UUB J;  2PII A;  4DS5 A;  3OJS A;  1FWP A;  1R27 B;  3FFI A;  4P2F A;  3NCP A;  3EGN A;  5ETR A;  2OGU A;  3CCM S;  1B3T A;  4QIV A;  3GU0 A;  2IHR 1;  1Q79 A;  1WHV A;  2V68 A;  5MLC V;  4TQS A;  1NK0 A;  1CBK A;  4J9O A;  3OXL A;  2UXD J;  1LWX A;  2R42 A;  3N01 A;  2D3O R;  1ACM B;  2EW9 A;  2DGQ A;  2AHO B;  4NZ0 A;  1U2R A;  2YKO A;  1DQA A;  3OV7 A;  1M1K T;  3W3S A;  3ZZU A;  4J9L A;  1ZTT A;  4RNF A;  1SI9 A;  4ZHR A;  1AT1 B;  2GX8 A;  3BYR A;  3J81 U;  1XR7 A;  2HZC A;  4DLE A;  1Q5V A;  4ILR A;  1Y9O A;  3SCL E;  5HAT A;  3MXH P;  2KN4 A;  5HI7 A;  2HVD A;  2QO3 A;  2X1B A;  4NAS A;  5C7P A;  2FLL A;  3S6E A;  3OL9 A;  4MK9 A;  2HIY A;  2HAF A;  3OTB A;  4DSK A;  2ZKT A;  2HSE B;  4M5H A;  2NR0 A;  1SXL A;  4EUV A;  2K1R A;  3ITH A;  5E2Q A;  3DLG A;  3OTC A;  4FF4 A;  3TUP A;  1E6Y A;  2OPR A;  2QMW A;  3CIM A;  3IGN A;  4Z7Y A;  3KK2 B;  2FIU A;  2DJW A;  1T02 A;  2C3P A;  1FK9 A;  5KFO A;  4Y65 A;  2DGX A;  2CPY A;  4I64 A;  5F8N A;  1BY9 A;  2RQM A;  1RAA B;  3ET6 A;  4E98 A;  4USV A;  2BAC A;  1NK5 A;  5KFG A;  3IR5 B;  1UCN A;  3LGH A;  5LMU F;  4Q0B A;  5L9X A;  2GGP B;  1FVS A;  2HWH A;  4X64 F;  3T1A A;  1JIH A;  1KVI A;  2AYB A;  3BGR B;  1YJR A;  1WEX A;  4Y28 C;  1RT7 A;  3RZA A; 
#chains in the Genus database with same CATH homology
 2B8P A;  3EE3 A;  1MN7 A;  3ENA A;  3EMT A;  3FC9 A;  3ZTO A;  3MPD A;  3NGR A;  3GP9 A;  4WBF A;  1S57 A;  1XIQ A;  1W7W A;  3EM1 A;  5BXI A;  1B99 A;  3VGU A;  4FKX A;  3DKD A;  1BHN A;  1NHK L;  1NCL A;  3NGT A;  1F6T A;  3NGS A;  4EK2 A;  3Q8Y A;  1NDC A;  4O0N A;  1HIY A;  3GPA A;  3B6B A;  1B4S A;  1MN9 A;  1ZS6 A;  3B54 A;  3FCW A;  3VVT A;  3ZTR A;  1S59 A;  1EHW A;  1NDL A;  1BE4 A;  2HUR A;  4UOG A;  4F4A A;  2DY9 A;  1F3F A;  4FKY A;  1U8W A;  4HR2 A;  2BEF A;  1NSQ A;  3VGT A;  5CAB A;  3ZTQ A;  4AND A;  3ETM A;  1NPK A;  1HLW A;  3FBF A;  1NUE A;  2DXE A;  3BH6 B;  3Q86 A;  5IOL A;  4CP5 A;  2CWK A;  3BH7 B;  3Q8U A;  4UOH A;  5CAA A;  1NSP A;  2ZUA A;  3Q83 A;  4DUT A;  3FBC A;  4KPC A;  2BX6 A;  3Q8V A;  3DDI A;  3G2X A;  3VGS A;  4C6A A;  1VYA A;  3EJM A;  2HVE A;  3FBB A;  2NCK L;  3ZTP A;  2B8Q A;  2DXD A;  1NLK L;  3WX8 A;  3FKB A;  1WKK A;  2DXF A;  3EIC A;  1NSK L;  3VGV A;  3ZTS A;  3ELH A;  4W98 A;  1LWX A;  4DZ6 A;  3NGU A;  3JS9 A;  1JXV A;  3VVU A;  1KDN A;  4ANE A;  3BBF A;  3EVO A;  3BBC A;  3PRV A;  4ENO A;  2AZ1 A;  2HVD A;  3L7U A;  5C7P A;  4F36 A;  1S5Z A;  2DYA A;  3EVW A;  1HHQ A;  1XQI A;  4DI6 A;  1NDK A;  1NB2 A;  1LEO A;  3Q89 A;  4ANC A;  1WKL A;  3R9L A;  3FCV A;  3EVM A;  1NDP A;  1UCN A;  1WKJ A;  3FBE A;  3PJ9 A;  1PAE X;  1K44 A;  2VU5 A;  2AZ3 A;  4UOF A;  4S0M A;  1PKU A;  3BBB A;  1BUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...