3GPAA

Crystal structure of the mimivirus ndk n62l mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 41
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3gpaA00
3MPDA 3ELHA 3FBFA 3JS9A 2B8PA 4DZ6A 3VVTA 2BX6A 2HURA 3DKDA 3FBBA 4ENOA 1LEOA 3EICA 1NSPA 2DXFA 2CWKA 2DXEA 4KPCA 1EHWA 4C6AA 3VGUA 3NGUA 3VVUA 1S57A 3G2XA 1HHQA 1XQIA 3B6BA 3NGSA 5CABA 1NDCA 1F6TA 5BXIA 1UCNA 1NSQA 1S59A 4ANCA 1NHKL 3GPAA 2AZ1A 3Q8UA 4UOGA 1ZS6A 1XIQA 3Q83A 4S0MA 3FC9A 3ZTOA 1NB2A 2ZUAA 4FKYA 1BUXA 4HR2A 2HVEA 2BEFA 3DDIA 3FBEA 3BBBA 2HVDA 2VU5A 3EE3A 3VGVA 1WKKA 3BBCA 3VGTA 3ZTQA 1WKJA 1NDPA 1NSKL 1S5ZA 4ANEA 1PKUA 1B4SA 1BHNA 3BBFA 1NCLA 3EMTA 1PAEX 3B54A 2DYAA 3BH7B 2DY9A 3Q89A 4DI6A 4EK2A 1WKLA 1BE4A 4O0NA 1NLKL 1HIYA 1B99A 2DXDA 5IOLA 5C7PA 4DUTA 3NGRA 3ENAA 4UOHA 2B8QA 3GP9A 3PJ9A 3BH6B 3EVOA 3EVWA 1LWXA 4F4AA 3ZTPA 4W98A 3FKBA 4WBFA 3FBCA 1KDNA 1NUEA 3R9LA 3ZTRA 1NPKA 3VGSA 4UOFA 1F3FA 3NGTA 4CP5A 2NCKL 1K44A 3PRVA 1NDLA 4ANDA 1MN9A 1NDKA 1MN7A 4F36A 2AZ3A 1W7WA 1HLWA 3EM1A 1U8WA 1JXVA 5CAAA 3L7UA 3FCWA 3Q8VA 3Q8YA 3EJMA 3ZTSA 3EVMA 3ETMA 3Q86A 3WX8A 3FCVA 1VYAA 4FKXA
chains in the Genus database with same CATH superfamily
4FF1A 1CQMA 3AT1B 4NCBA 2E7VA 2BJDA 3CJRA 1MMNA 3CPWR 2XC9A 2M9KA 3UR3C 3PJXA 2VQEJ 4KIAA 2DNZA 2NQPA 4C6AA 3GJQB 2DNNA 3KXDA 5L9NA 4RZRA 4OHZA 5AE2A 1Q78A 4AUKA 4C8MA 4X65F 4YOEA 3Q83A 4XAKA 1U4BA 3UVJB 2KHDA 1PYOB 2JEGA 3ZZPA 1LQ9A 4DQIA 2YX7A 5K20B 2EW9A 3T5HA 2M88A 3IRWP 1UZDA 1FDDA 4N8NA 4Q0BA 3AFGA 4ELUA 1N54B 3HFZB 4DR7J 3O2IA 3LP0A 3THPA 4IOCQ 1RT6A 3HHDA 3QJLA 1HQUA 3UD5A 5A6WA 4J9NA 4F36A 4RKUC 1AFJA 3SMZA 2JX2A 1OY6A 2N3OA 1XNQF 3FCVA 2MZRA 1XWLA 3JQJA 4UF4A 3CJSA 3J7A1 2I2YA 4ILMA 2V0NA 4KJIA 3TAPA 2VZ9A 3LQVA 3DDNA 5EX0A 2PIIA 1Y9OA 3OTBA 1UJ4A 3KMSA 1N32F 3PX6A 3K8WA 2LQ5A 3MD3A 1S76D 3ZTOA 4B3TF 3QT6A 3G82B 2ABYA 1ROFA 1BQMB 2LA4A 3GCXP 4ECVA 1WKJA 2VFSA 1YJVA 1CJKB 3D0GE 2O3DA 3M2VB 1GQEA 5HMYA 4ID8A 3QLHA 2JNJA 3AY0A 2RHSB 1M5KC 4O44A 2RDJA 2FGOA 3HHLD 3GTYX 4F3QA 3CDEA 4DZDA 3SSRA 1V5IB 2F8EX 3GYXB 1KVIA 1XNRJ 4C0HA 4DL7A 3Q24A 1WC3A 1GMWD 1WEXA 2W2MP 2EVZA 2JRSA 3PDNA 4LR7A 5LJ5Y 2W8KA 1TL7B 3K7RA 3D6MB 4JI8F 5DDRC 2BRKA 2FC8A 3PW4A 3UD4P 1WHXA 3MM6A 3N6NA 2YNGA 4NI2B 4IYQA 1YRTA 2OAUA 4GVLA 2DPJA 1YZ6A 4YFUA 2XCPA 3D1HA 2QE5A 3RR7A 3RU0A 1M5PC 2OO4A 5E5NA 3GG0A 1UPMB 3S6EA 3EDQB 4L76A 3DLGA 1YK9A 3CDAA 1URNA 1RTHB 3CD5A 3D9BA 1QVFR 5DRKA 3TW0A 2HWHA 3HF5A 4MIBA 5F8HA 3EVWA 4HDGA 2HAIA 1VCTA 2AYEA 4L73A 4F4ZA 3I82A 2DEJA 4QIVA 2UU9F 3H2UB 4DQPA 2HBRB 4ECSA 3UDLA 3CUNA 4K0KJ 5CXTA 4KSEB 1H7XA 2RU3A 1NK6A 1KS2A 4NWBA 3DLKA 4DLEA 4JYAJ 2XCAA 2IY5B 2CWKA 1IBMJ 1S1TA 2XLJA 3E3XA 1RWOB 3B6BA 3RR8A 5IWAJ 2K2PA 5HROB 4ZPTR 3LGHA 4UOGA 4LIWA 2CWXA 1KLMB 2D74B 3HXMA 3HVRA 3LWLA 3MM9B 5ETNA 2BM0A 3IAM9 1V3RA 1K9MT 3IBWA 4ZLJA 1NSKL 4OLPA 4NEZA 5G4DA 1RTZA 4C8NA 2WVEA 1Q82T 1I1GA 3IBCB 1EP4A 2VV5A 2XO7A 1KBRA 2E1AA 4P52A 2OFGX 4ZCLA 4N56A 3VZIA 1T02A 5ITHA 3CJ4A 3QBCA 3FK4A 2IA0A 2QYCA 2AW0A 2QMUB 2IM2A 2KJVA 2QIFA 2W24A 3QZ8A 2LQJA 4I4BA 4OYBA 2IYGA 3KJVA 2QFIA 4DPOA 4RU2A 4OYWA 3T6JA 3OV7A 2J6TA 1BQNA 2MZQA 3PHTA 4JOUA 2MQPA 4Y2KA 1C1BB 2F9DA 1FJEB 1WC4A 3I87A 1X5SA 1RHJB 4P9SA 3EE3A 4RL1A 1CJUB 2PGCA 1AROP 4TY8B 5H9FK 4WP3A 4DCJB 4DR4F 3X1LB 4PXDA 4RBUA 4URQU 4KT0C 5LOQA 3OFGA 5G0RB 5KT5A 2RKIB 4CO3A 3CCSS 3MPWA 4WFBQ 5HVGA 4CP5A 1CJVB 3N28A 2HBZB 1RWPB 5K5MA 2WRMA 1WI6A 1R0BG 2FLNA 2Q79A 3G6XA 4WXWA 2RNEA 2CQCA 3NOGA 1BXNA 1FE4A 2NYHA 4ZPBA 4J9SA 3VVTA 3ISND 3LAMA 3NNAA 2EPIA 3W1YC 2OPSB 4WU2A 2HQ3A 3DGVA 1SKSA 2HFUA 4B9SA 2QL5B 2XMJA 3MI7X 3VR1A 1NSAA 1GXLA 5L38A 1VQOS 2J7UA 5I3QA 1FKAF 6FD1A 1VGYA 1H73A 3DHXA 3UVJA 2VICA 2AX0A 1TL4A 4DX7A 3GV5B 5L46A 4CLZA 5HLFB 1QUVA 5B0FA 2RVJA 3BBCA 1MSWD 3T1AA 1S5ZA 1UMJA 2YX1A 1LWFA 2FHKA 5A8KB 1Q8LA 1APSA 4XO0A 2R8KA 2F4VF 4LFBJ 4LRDA 2HNDB 1P9QC 5HQLA 3WHIA 3HT3A 2APOA 1N8RT 1SC4B 5D77A 4TU9A 1ZM9A 3U1NA 2UUTA 1IQZA 3FBCA 2GFFA 4ECQA 1YHQS 1T11A 3K59A 2VJVA 1MROA 3CCES 3R8YA 3OR2B 1R8HA 2IA6A 1S72S 3NS7B 1JLCB 2ALYB 2N3LA 4QR0A 2CYYA 5KG5A 4DFPA 3D6TB 2Q6BA 3HKZD 2ZBIA 1GTEA 5RUBA 1T9XA 1R89A 3ZO7A 2FJDB 3P49B 2RF2B 4HL9A 3Q8QB 3G82A 1BQMA 2JLGA 5IT0A 3MMCB 3M2VA 3ISNC 1U47A 1S6QB 1KFDA 1JLAB 4O3SA 4P7TA 3QPIA 1HFEL 4LF5J 3WBZA 1VBKA 1UVLA 3V4IB 1TFYA 4HT7A 3PTWA 2E1CA 4TNOA 3CMAS 2PT0A 1TKXB 4QU6A 1RTJB 4NMXA 2UP1A 2GNKA 2HHXA 1PJ7A 2V50A 3SCLE 4OX9F 2BV3A 1VRUB 3G6YA 1DRZA 4O0IA 2B4PA 3OVAA 2ZJQQ 1YI2S 4PQUB 3MPDA 1B7FA 1Q5VA 4DR2F 1Y7PA 3K5MA 1GH8A 3ZC4A 1HWKA 4X65J 4NI2A 2CQGA 1SV5B 4H4OA 2AF6A 1EQMA 1PGZA 5KT6A 2XMWA 4H4MB 3ILIA 5I42A 2AJQA 4DR3F 2AT1B 2CIMA 1U2RA 4ZPVR 2JSXA 3U27A 2MZTA 1SJ3P 2WB4A 4OYAA 3CVKA 1ZS6A 2YQ3A 2DNGA 4F4YA 5D4OA 2ZZTA 2ZHOA 2VFUA 4ED3A 3HHEA 3A8JA 4M5MA 1REVB 1TK0A 3MAQA 1RT3B 4HH1A 1GX5A 2AGOA 2W8LA 3CULA 1KEKA 1JLEA 4F4WA 2DGQA 3OTCA 1BWVA 1LXNA 1XMQF 2V8GA 3C16B 5FDLB 5THWA 2HQIA 3T5KA 2OD6A 1VQKS 2BUNA 1UEVA 5K8PA 4IO9Q 5DM7Q 3CW2C 1WACA 1SKUB 3ZTSA 1KFSA 1KKHA 5B0BA 2GHVC 3D7SB 1MWZA 4DV7J 2PMZD 3C14B 3D67A 5HROA 2E1MC 3D1QA 2ZC4A 3KLGB 2KT5A 2XTJP 1KLMA 2H54B 2M4MA 4Y2IA 4J9MA 4FS2A 3ZZZA 4YR0A 3ZNUA 3BZQA 1HWUA 3MM9A 5DG8A 5DDPC 1QDUB 2G0JA 3B4MA 4ZJLA 3OW2R 2IPOB 2HQDA 1UVJA 2X7IA 1WC0A 1ZH5A 2OSRA 1BY9A 3PKMA 1TP7A 2FJEB 4Y0FA 3PEHA 1JLQB 3TEGA 2V68A 3TUIC 3MUVP 2FIUA 2QLWA 5KFZA 3Q8RB 3BKTA 1WC6A 2BJ8A 2B8QA 1U09A 4Q8FA 5M2PA 4NE9C 2Q1LA 3QSYB 3AJ1A 2IVMA 1L5UA 1WHVA 1RI7A 1FEEA 1XMBA 3THTA 4DL0C 2ZBCA 3T19A 1W7WA 4DV5J 2NUHA 4QIEA 2PMWA 1CLFA 4Y28C 2ZH7A 1YDLA 5LSLA 1QE1A 3RTVA 4P7VA 2VHGA 4DL5A 3M6VA 3RGIA 1VDHA 3GSDA 2GIFA 1S0MA 4FNHA 4YB7A 1C1BA 1ZA2B 1NZ8A 2PA8D 3MTKA 2EBEA 2VDHA 4LVNP 4Q43A 3N4WA 2DEIA 5HO4A 2ZVSA 4NXNF 1LWEB 1Z4UA 4P71A 1DLOB 2DJWA 4FF4A 3IC1A 2QMWA 4TY8A 4RBTA 2EC2A 2EK1A 2YWHA 2O1PA 4YP3A 4OZ3A 3D4JA 3QGGA 4FNIA 2R7WA 5KG1A 2A1BA 4ETXA 1RWKB 2AGQA 2E7WA 4PYAA 2KYZA 2V4JB 4E8UA 2ZM6F 2VBZA 2YXLA 5G0RA 4DFJA 2CQ3A 4ZMMA 5IM0B 4JI4J 3L7PA 1CJVA 2CJBA 1VJQA 3ZTRA 3ZZTA 1HA1A 1RKJA 1NPKA 2GC8A 3HJVA 2IMOA 4PG6A 1HD1A 5CAAA 5GMKa 2HNYB 5DG7A 1XK8A 2XMAA 2EFGA 3NAHA 4I56A 2Z57B 2OPSA 1K8AT 4URGA 4ECYA 1IM4A 2XSFA 2PC6A 4EBCA 2VA3A 3FEXB 4A8YA 1S57A 1X9MA 2CAJA 1HNIB 2P8IA 1H6KX 3SZ2A 4BCAA 3BV8A 4NRUA 4DPUA 5C42B 1SUQB 4LJMA 5HLFA 1IQTA 3VQTA 1FERA 2LXFA 4PYDA 2DGXA 3JSMB 3EZ5A 2LQ9A 3ET6B 4LF7F 1XR7A 3H8YA 2DYAA 2HNDA 3M2RB 2V6AA 2XY7A 1D8YA 4EK2A 5L9XA 2MSSA 3TA1A 1QM9A 5KFDA 1G1XA 3GIIA 2LXUA 4DU7A 4IRDA 4YHHJ 1HQEB 1ZOTA 3HKWA 3A8KA 4QIGA 4OI3A 5DZ6A 2QLXA 1JLCA 1U1OA 2HVIA 5LL6d 5KFBA 2HEKA 5HMXA 3EUNA 3K5LA 5IZHA 4WFZA 4TQSA 2FD2A 1HHTP 2MHNA 4AT1B 3DRSB 3HD2A 4CM2A 2E5IA 4OZLA 1D9DA 2GO9A 1S4EA 4B17A 1WNEA 3MMCA 1AUSL 4YDDB 3Q8UA 2ZH2A 1RAJA 3QT7A 1JQGA 2XYHB 3RB6A 1YJRA 1S6QA 1JLAA 3W2WB 1GFWB 3V4IA 2DH8A 4OI4A 4FPRA 4CM0A 4ZLPA 1TZ0A 1QUPA 3B54A 2RS2A 4C3MA 1WG5A 4K2XA 4PG7A 1TL3B 4F7VA 2P9EA 2MSTA 3MPVA 1T95A 1TKXA 2C3PA 1NK5A 1PO6A 3MDFA 3V6HA 2R4FA 4Q2LA 1FF2A 2QTWA 4W98A 2K3IA 3R9LA 1NJIT 4TVAB 1SPBP 1AYEA 1LKZA 4PQUA 1Q79A 2R42A 2HK2A 3IR7B 3TAMB 1WEZA 3HPOA 3I4HX 2G0IA 2RQKA 2V94A 1SV5A 2KJWA 3DOKB 4D3HA 2AJ4A 2HHPA 2NPFA 2F7VA 3G87A 3QWUA 4B3RJ 2CZ9A 4LIRA 4ZCKA 3V6DA 4B02A 3KLEB 1NSQA 3DLBA 5E3CA 1FK9A 1S6PA 1CS4B 2AWZA 4KE5A 1HWJA 2HHHF 2HVEA 2I38A 1M90T 2BEFA 1WOPA 2DTJA 1RT3A 4DBQA 1IM6A 1RLDA 2FJAB 4R0EA 3SQOP 3SIPB 1OQ6A 1BE4A 4OIXA 4LFAJ 3C16A 2W25A 1YITS 5FDLA 3WQPA 4NLDA 2XULA 4DOZA 1IJFB 2DNOA 2JVOA 4FXWA 1VIXA 5B08A 2YTCA 3UPFA 2QMXA 2MKYA 1IR2A 1IXKA 2IJRA 2M52A 3I0RA 5KT3A 2KVQE 4C8OA 1VYAA 4M5DB 2HKEA 3US5A 3JS9A 3C14A 1KONA 3KLGA 3OXLA 3R5DA 2XB2D 3QT8A 4IO1A 2XWYA 4ED8A 3E51A 2UUAF 5C25B 1QTMA 1VRQC 4ANCA 2HHQA 2YVSA 3RBXA 4W4MA 1QY7A 4FKYA 1QAJA 4OJ3A 3CDUA 3VTIA 3AXKA 3VGTA 1TMJA 4OJ1A 2C3YA 2LEPA 1JLQA 3AD9C 1CC7A 3TRGA 2V63A 4MMOA 1RAIB 3G8SA 2VONA 3MFHA 3PO4A 2ZHAA 3R1HA 3N6MA 1N33F 3BEGB 5K8OA 2EWHA 3PJ9A 1VQ5S 3I55S 3A3NB 4UTGA 3W62A 1K1QA 4ZPDA 4ICLB 4X64J 1CEZA 3UD3P 1R31A 1QSSA 3KG4A 1FNXH 2GIQA 1HARA 3HSGA 2DITA 3ELHA 5A0YB 4DR6F 4IRKA 2MEWA 3CXCR 2OKQA 2Y1LB 1JKHB 3SFGA 2EI5A 2WSFC 2B9EA 3W7BA 2W1BA 1UWBA 2HS4A 3R1LA 3BO3A 1LWEA 1DLOA 2MQ8A 1W25A 3GPAA 4LSZB 2VQFF 5J1PA 1WTFA 1B0PA 3U1MA 1HHSA 2H5JB 3MFIA 4QWAA 5EWEA 1XMQJ 4JI3J 2CQ4A 4QOTA 2DNYA 1NBEB 2XZTB 1Q8BA 4JI1F 2HRTA 2FHMA 2V4JA 1VQ4S 1I94F 2FQQB 2W2QP 2FJVA 3UDEA 4CYUB 4DLGA 4P6QA 2QLBB 1TU0B 2J7WA 1R7IA 2G9OA 2HK3A 4TLRA 3JSRA 4DQRA 2HNYA 4KGKA 1YJUA 4ITSA 4NXMF 3TANA 2V9WA 3MMBA 2J9EA 2DRBA 2CG8A 2HNZB 1HNIA 3BSOA 3GQCA 3D6FB 3GFYA 1MMDA 5FJ4A 4ZN3A 2B7CB 3OLAA 4OI0A 2GJFA 5HATA 2PSZA 2QL7B 5C42A 1SUQA 3FFIB 1HI1A 1R8PA 1EX8A 3JSMA 4JI5J 1FXLA 3ET6A 2HHSA 4DU8A 3BBBA 1T9TA 3QFWA 2F3JA 3SFUA 3KHHA 4MFBB 2YNIB 2WZ1A 4OI1A 2M8HA 3N79A 5F8LA 2FLOA 2KHCA 3JTOA 2V8VA 1RTIA 1JMTA 2JHEA 2CJ9A 1HQEA 2KFYA 4B3MF 3QGPA 2RHQB 3VAJA 4NLVA 1KDNA 4B3SF 3IP0A 1M5OC 1WSRA 2GQQA 2VG6B 5CYMB 5GADU 3NMAA 5E0OA 2G4BA 2RDDA 5EUHA 2VBWA 2KG1A 4RX6A 4U7CA 2FZCB 5L39A 4IH7A 3D0IE 4NXNJ 1AT1B 3IXQA 2D9OA 2EG1A 2JEFA 1UZHA 5BYRA 2P6TA 1RT4B 4DUYF 4RJVA 4USVA 3M4XA 1OPZA 3W2WA 4L74A 1FJCA 3HCXA 4YY3J 4CO2A 2ZBQA 4C4WA 4P10A 1NK7A 1TL3A 1VLYA 3CD6S 2AEJA 3SDEB 1T05B 2J0QD 2XBPA 4WIIA 2XGPA 2C3UA 2J6SA 2G13A 4ED7A 4FBUA 1ICEB 3BGFA 5KFFA 3NBPB 2L08A 3N9UC 4BWMA 4K4YA 2PDAA 3CJQA 3MAAB 3TAMA 3W3SA 3MM5A 3T3FA 4ZVOB 1JXVA 1VQPS 3DOKA 4Y65A 4OYZA 1ELOA 1XTZA 2NXEA 3HLUA 2DRDA 3KK2B 4DV4F 1WI8A 1FDAA 2XQCA 3KLEA 1UEUA 1Y10A 1UA1A 2ILZA 4QU7A 3FRZA 3QSIA 2DNMA 1CS4A 5J2QA 3BGLA 2R2UA 1HI8A 2CVEA 3EPGA 2BE9B 2J76E 1S9EB 4ED5A 1ZTTA 4B9MA 2ADBA 2BABA 3IM9A 4KV8B 3MR3A 1D09B 1WKLA 4JV5F 3AAWB 1NH7A 4NOHA 1X4BA 3JXOA 1WOSA 4XPCA 1RACB 4XDCA 3CJ2A 2W4DA 3T41A 1C2PA 1KP6A 3HMJG 1IJEB 2HRYA 2NS1B 4A48A 1L3UA 4N76A 4IDKB 1Y5NB 4NLXA 3TZWA 4KKOB 1PCAA 1RK8A 5F9LA 5T7LA 2QG9B 5E3RA 5A76A 3FQLA 3HHLB 3B82A 2YWKA 1KD1T 2ZD1B 4Z37A 2H4YB 3MCMA 3JTPA 1G6BA 4ECZA 1EETB 4I2QB 3HI9A 1ZETA 5L1JA 3OXFA 2B43A 4KPYA 4DCOB 3NGDA 1KLNA 1Q0NA 1KHWA 3DCAA 4O4GB 5ETLA 4Y00A 3K8VA 4LFCF 2JLEA 3GJSB 4BS2A 2CPEA 3PM9A 4NEYA 2UV8G 2WB1D 1BC6A 4DUZJ 3BKFA 3QFHA 4N41A 1RU2A 1A7GE 3IWLA 2I9SA 4PG8A 2D69A 2P2CB 3HX9A 3UNGC 4ICLA 2V67A 4PXBA 3RAXA 4DL6A 1PAUB 4CH7A 1EJ7L 2Q43A 3O5TB 3NNHA 2ZH5A 5M2RA 1FFSB 5A0YA 2RU9A 4DN9A 3RB3A 4LRCA 1JKHA 3UI3A 4ES2A 3KLVA 4PXEA 4X4RA 3W60A 3LGNA 4MT1A 2ZWPA 2HHHJ 5T41A 3VAGA 2DY1A 2EXUA 3FMWA 4EWTA 2QSFA 4CLSA 4RLEA 5HVFA 4CRJA 2BKNA 4NCGB 5F41A 3DDIA 1T9VA 5AXMA 2HVDA 2VU5A 3VGVA 1ULRA 1A0OB 4EFAC 5KG4A 4PAAA 4NCAA 2Y0SD 3ISZA 5AE1A 2K7JA 1HMVB 4CO0A 1RADB 2DNKA 2B0GA 2K8GA 2WOMA 3C19A 4LF6F 1SJRA 3NEKA 2LQ8A 3TVZA 3PRVA 3UN2A 3DI6B 3EGZA 3PG9A 3OTOF 2AEMA 4CZCA 2ZDPA 2DH9A 3UR0A 3KUHA 3EJMA 1N56A 4IQMA 3ZZYA 1HWIA 4F50A 2MPUA 1NJZA 3MMAB 3R2DJ 3M9OB 1UA0A 2IJNA 1LNQA 2FDNA 5CD4H 3U7JA 5F8GA 2A6MA 4OFZA 5GAHI 3FFIA 4AD6A 2B3TB 1VQ7S 4HDHA 3CJ3A 2M3DA 4HI1A 3GV8B 1WOOA 2ZBPA 1HYSB 3PO5A 2G2YA 2KB2A 2IBOA 4YR3A 4HEA9 5GAHU 2JOQA 2ZC3A 3HVTB 3H5XA 3SV3A 4MFBA 3Q2TC 3MEDB 1N33J 5CH7B 4URSA 3CSKA 3GWCA 3BGRB 2PE8A 4DR7F 4LT6A 2YBVA 2C3MA 1GMUA 4PABA 4RNMA 2BRLA 1EIYB 1NB7A 2Z56B 4DV6J 3GFXA 4CWBA 5F8JA 1JIHA 1FNMA 2RILA 4I68A 4RNNA 3OL7A 3Q8VA 1C4AA 3ETMA 4KR0B 2BYCA 3I32A 2Y1IA 1YRXA 3N0VA 1NPRA 5KTQA 1VQ9S 2HBQB 4TLQA 5DDQC 2OGUA 4KC5A 5FD1A 1RT4A 3T5LA 5LMUF 2DR5A 3AA8A 1K1SA 5E3QA 2FJBB 5AJ3J 4EBDA 4PEOA 4JP8A 3RB4A 4MK7A 2DIUA 2VPWB 3SDEA 1I94J 1T05A 1XN9A 5T14A 1JX4A 2HQFA 1A6LA 2B9XA 5B09A 2MGZB 5DGAA 4PZVA 4ZCIA 2N82B 3N01A 1RWNB 4NXMJ 4RW4B 4F3OA 3MAAA 2EFNA 3J7YI 1HD0A 4E0DA 4RPFA 4ANDA 4N47A 4FF3A 4HKQA 2Y3YA 4U96A 1U8WA 4MKYA 3RBZA 4JI7J 3GCWP 3J7YU 4ED1A 2A10A 2PD1A 1RQ0A 4TY9A 2E66A 9ATCB 3KK2A 4LR9A 3DYAB 2KTQA 3HD1A 2PN6A 2XM3A 5DDOC 1KOOA 3U1LA 5IT9U 3MD1A 1YBTA 2IRYA 3EYZA 2NXUA 3LANA 3GLJA 3M8RA 1K47A 1PILA 4DX5A 3D6HB 2Q3PA 1JXEA 2J9CA 4YR2A 1S9EA 4WU3A 1FX4A 1Q7LB 5DLFA 2RUSA 2YH0A 3TQ1A 4KY3A 1DY3A 3QGIA 3MGJA 4B3MJ 4KV8A 1BHNA 4DJBA 4Y6IA 1O6XA 3WX4A 2QL9B 3W61A 4WE1B 4B3SJ 5L8RC 3KOAA 5IT9Y 2DXDA 2V9KA 3TJ8A 3CC2S 2EFVA 4X62J 4OX8A 1Q4RA 3GE9A 1TQLA 5F0WA 4ZK7M 1YLXA 2ZWOA 5H9EJ 3D54A 3AOCA 4WK1A 5KG0A 2XYGB 4ZOSA 3KK1A 3H25A 3HHLA 4DZ6A 4QCLA 5JVHQ 3R5JB 4HHUA 4ECTA 2LFVA 1IBMF 1EETA 4I2QA 4QYZK 3I96A 5IWAF 1QAIA 3MECB 2GX8A 3DRRB 1XR6A 1GMWA 1BWEA 2MXYA 3K5PA 4LBHA 4O4GA 3DU5A 2CPIA 1BMQB 3W63A 1TKZB 2DO4A 1X5OA 4USUA 3E01B 4A46A 2YKPA 3T6BA 3DM2B 2QA4G 1NAQA 5LSRA 1Z2ZA 4B08A 4DQQA 3B78A 2OPQA 4USIA 5C7PA 2HSEB 2C2KB 3CB4A 3JSYA 5BYQA 1UVIA 2UVWA 2QC3A 1FRJA 1TTHB 4JV1A 4R8UA 4CLYA 2EK6A 5H9FJ 5DQHA 3JYTB 4KRWA 2LQBA 3J7Z5 2R2TA 2KI2A 3NCPA 3R7BB 2B6AA 3GIMA 4OL8A 1GAOA 4WFXA 5KG2A 4KPCA 3QRQA 1VBYA 2KO1A 3LWMA 1G7CB 3DN9A 4NCGA 3NP5A 3AD8C 2W2NP 3QJPA 2PA3A 4C3LA 3KLFB 4M5HA 3C6TB 4IFYA 4NLOA 1L3TA 3MF5A 2BE2A 2M0GB 4MAKA 5LM7E 3ZZOA 2K1RB 1SVDA 1WDDA 1HMVA 2E29A 3OUYB 3ENAA 2IAJB 3QAEA 2HIQA 4WZMA 4I6AA 3KLIA 4C8KA 3HFKA 4Q2MA 4C98A 4OYXA 3DOMA 2DCUB 1KN6A 2YKNB 3LAKA 3M8ZA 1SBRA 4MK9A 2R7OA 3TP2A 2E5JA 3MMAA 3GIKA 1TKTB 3HHKA 3RUBL 2BXJA 3RBEA 2G1DA 3PW0A 3HO1A 3IN5A 2M5YA 5CCLA 4CTAB 4UQGA 1HYSA 1IKVB 1V6HA 2J9DA 4ZVSB 1NKCA 4RW8B 4I1TA 1D0EA 2POKA 3HVTA 1RAHB 4R0JA 1YIJS 4CLPA 2QGFB 3P6YC 2LDIA 5LXRA 4Y2CA 2Y8YA 2B7BB 1X4GA 1I5OB 4R5PB 2VPZB 1REGX 2N7CA 5MLCV 5EWGA 4NLSA 3BGRA 1VI7A 3JB9k 4HHHA 1LK5A 1U48A 4Q45A 1FD2A 2C2DA 1Q8KA 1RJJA 3V4MA 1SL1A 1FTRA 1TL1B 5KFMA 4MKVA 3A4TA 4CLKA 2GJIA 2J9DE 2DB1A 3QIPA 2BZ2A 4U95A 4LF2A 3KWMA 1DBDA 1N4LA 2NCKL 4A8MP 2RE1A 1J2VA 3CC7S 4IOBA 1XMOJ 1CSJA 2OEKA 1WC5A 1OO0B 4PWDB 3FBFA 1UTAA 2EKYA 1UW9A 3W5XA 1WTBA 2BX6A 2R8JA 4X4SA 3JAMU 2CJQA 1YVFA 3H7HB 2QV6A 5ETOA 3VVUA 1H7WA 3TVKA 3R5AA 3KHGA 2V2ZA 2DHGA 4TYAA 1S6UA 5F0UA 2ZUAA 2MKIA 3GJRB 3R3TA 3PZPA 3HVAA 2M7SA 4OYIA 3M8PA 4FN5A 2GMHA 4LF5F 2KT3A 1CQNA 3OVSA 1FJ7A 1S7IA 4PR6A 2OPRB 3OTOJ 3JAMY 1WHWA 3V6KA 3QATA 4P2SA 1QSLA 2VOPA 4P72A 4A8QA 4AQYJ 4WIQA 1SI9A 2ZVIA 4HTIA 4OLOA 1MN7A 4DPYA 3DYAA 3SEOA 1VS3A 1IVZA 3K57A 3H40A 1VC0A 4I2PA 2HWIA 5HMWA 4K4WA 1B0VA 3M32B 5AT1B 4RWWA 4MH8A 4CO5A 5KFVA 2WBRA 1NDCA 2FYXA 1RABB 2LECA 4HH0A 5GAEI 3KK3B 1LK7A 1NXIA 4DF8A 2CNLB 4WE1A 1KR4A 1HR0F 3KDOA 5GAEU 1JJ2R 1YWXA 4CI0B 1HW9A 3G71S 2J8AA 4ETZA 1TK5A 4CLLA 4ZVHA 1RUSA 4AXIA 4EO6A 1S97A 1WELA 1CULA 4RU9A 1YX2A 3UW1A 2Y1JA 2MQNA 1NDKA 2GW8A 3I5CA 1C1CB 5LMUJ 4PXCA 1S9GA 3LH2S 4K4VA 7FDRA 1MWQA 4DV7F 2F9JA 5GMEA 2E9RX 4ENOA 3MECA 2VJUA 2XLKA 3EICA 3DRRA 2FZKB 1EHWA 1RTDA 2HIYA 4QBUA 4DR5J 5JMNA 2DGVA 1CBKA 1TKZA 2YX4A 2LDYA 1F5CA 3PYDA 1AZSB 1U6ZA 2EEYA 2XS5A 2OPPB 2BKPA 4LVOP 4FXVA 3J7ZT 4J9OA 2VC1A 3BB5A 5C2GA 3PYGA 5HJXA 4LQ9A 2W2PP 1JLFB 5JXSA 4CLWA 1NU4A 3Q0AA 3O1LA 4KFBB 5I3PA 5GVQA 1RZMA 4WJBA 3GJTB 5KAKA 2FC9A 1YGYA 4USHA 2VPXB 4BWJA 3H5SA 3C66A 4I67A 5LT5A 2DH7A 4JV0A 3NY0A 2I5JB 4DV5F 1FESA 1HL6A 2BOPA 4FS1A 1I3OB 3DU6A 4ALZA 5J2PB 1JWWA 2KZMA 3D0HE 2H9ZA 3IR5B 4OQJA 3W9JA 3H42A 5KFXA 3ZFVA 3NOCA 4MIAA 2KDOA 2XS2A 4DSIA 3NL0A 4PWWA 2HYIB 4ECXA 3FEYB 3R6LB 1YJ7A 4EYIB 3C6TA 2ZOFA 3RBDA 2E1RA 3SQGB 1FKOB 5CA5A 1KQGB 2K1RA 1SJFA 2XMKA 5IC6B 1S0VA 1RT7B 1S1UA 1RWMB 1E6VB 3NGKA 2ZH9A 3OTDA 9RUBA 4DS5A 2HQCA 3OUYA 5D15A 2IAJA 3N5FA 4IH6A 4JI4F 2JFKA 4WYLA 3MR5A 3ENWA 2D3OR 3GU0A 2YKNA 3NGTA 1K44A 3W5YA 3OFHA 3ENQA 1TKTA 4X84A 4PG4A 3VAMA 2YWGA 2WVFA 2UUBJ 2LEAA 2MLXA 1IKVA 1WEYA 4RW8A 3TUZC 4CLTA 4NYPA 2HHUA 1VR6A 1R8CA 1NJYA 1N6QB 3OR1B 1EB0A 1KC8T 1OS5A 4G1IA 1FVQA 4UQTA 4ZVTB 5H9EK 4R5PA 1NM2A 1NB2A 4YB1P 4F0HA 3CNQP 4X4UA 3LP2B 1NPPA 2RD5C 4QIFA 3CT9A 2VG5B 5BR8J 2QSWA 4K4TA 3MXHP 2GMJA 5DS7A 2LCWA 3T1HJ 1RHRB 4K59A 1T03B 2QFJA 2E5LJ 2GVDA 3TJ9A 2V2VA 3RJMB 5L1LA 3O44A 3KHLA 4ZHRB 4YHHF 4DN0A 5A8RB 1WF2A 2BR0A 3JTNA 3SSSA 3TX8A 4QR2A 3GR1A 1R8BA 2GQCA 4CT8A 2AKWB 4DV0J 4A8KA 4PWDA 4M5IA 3GMGA 2MB0B 1FXRA 2KT2A 2VUGA 3ZXWA 4J9RA 2CZ4A 2K3KA 2L48A 4MYTA 3CCVS 4ZPWR 3AB4B 4QZVB 3VV2B 2DGOA 1X60A 3AA9A 1RWUA 3H2VE 2UVVA 4NL5A 3Q2SC 4OYOA 2XMUA 1UFLA 1MG7A 3D5MA 5HSPA 1RT2B 2AZ1A 2YKOA 3SSQA 4QW8A 4WKRA 4OZJA 4B3OB 1WWHA 4U6PA 2X1GA 2F1FA 3HFVA 4ILRA 3QAUA 3L3CA 1T9UA 3J81U 1SC1B 1WC1A 1DTQB 2YH1A 3MM8A 3KNGA 3KTQA 4O3PA 3M2UB 5E7OB 2OPRA 5A2QU 4IG0B 2AYMA 4LF9J 5FIIA 2ZFHA 1MW7A 5D4LA 4RNOA 2R8IA 5A8WB 3OL8A 1P6TA 2RQCA 3CMQA 1MN9A 1S12A 3RW7A 5M2UA 4OZ1A 5HVHA 2Z4PA 2XI3A 4NPOA 3M30B 2FVSA 5KT4A 1T7PA 4B3RF 3M32A 7AT1B 3JSBA 1YZ7A 5A2QY 4U8YA 3BREA 3PW7A 4WFAQ 4PPDA 5J1NA 2M70A 4K2JA 4KHPF 3W9HA 2IDEA 2RRAA 4OJHA 3FUYA 2HZVA 1Q81T 3K89A 4YN3B 3UWTA 1NKEA 3OFFA 3C15B 5ETRA 6FDRA 3NWGA 2VBXA 2LYVA 2DHSA 2DR8A 2VKRA 2UUCJ 5GAGI 4UT4A 4LFAF 2YNHB 4OZ5A 2E9ZA 2DPIA 3RB0A 1RB0A 2FVPA 4LF1A 2IVFB 4H54A 1WF0A 1YRUA 5GAGU 5IV4A 4UOHA 3ZZRA 4ZVEA 5KFSA 2AQ4A 3H98A 1KQKA 4U67Q 3OD2A 3JQMA 5K14B 4CLFA 3VCDA 1FKPB 1ZM4A 3OFEA 3WX8A 1OYDA 2CPYA 3QT5A 1UPPA 3H20A 4C8LA 3LP0B 4K5SA 1CJKA 1UFWA 4WKYA 2OPPA 4ED2A 1GNKA 2AGPA 4WCEQ 3TARA 4X4QA 3MEKA 2VC0A 2X51A 5JVGQ 3POTB 2DHAA 2IJFA 4C0OC 1MLAA 4KFBA 3VAFA 1GX6A 5J2NB 3ILLA 1TL7A 3GIRA 1JLBB 2C2MB 2VH7A 5AE3A 4DQSA 1HBNB 3RYLA 3HSDA 4J5OA 1MWYA 5EWFA 1RYSA 4LUBA 2I5JA 3CF5Q 4X64F 5J2PA 1FD8A 1ACMB 4JI0J 2NUUG 3M7VA 3C2PA 2AZ3A 3PW5A 1XERA 2EKNA 4IFVB 2BQ3A 4NLPA 3F73A 4YMEA 3BO2A 2B56A 2EFQA 2RT3A 3SBMA 3PACA 1RTHA 3NGUA 1DAXA 3KJQB 2A6OA 1VHFA 1ZA1B 4UY85 2Z2ZA 3MUMP 3H4DA 4C3KA 1CG2A 1VISA 3CCTA 3SQGA 1HR0J 2ZZNA 2Z0GA 2C28A 1FKOA 4XTTA 2OMOA 4JI3F 4ILLA 1DZ5A 2DK2A 1RT7A 1HNXF 2OIHA 2BW2A 1E6VA 1X0PA 3ITHB 3AH6A 4LREA 2IHR1 4K50A 3QWPA 2XG8A 3CJ5A 2ZBRA 1XEZA 1R3NA 1F2HA 2G2OA 3QJJA 4MK8A 1JNZB 1MNEA 3I9V9 1FFGB 3TUJC 3UDVA 1OSDA 4ZP8A 3DLLQ 1IUJA 2VF3A 4WWSA 3DLGB 4LBPA 4ZIVA 2FHJD 1F9HA 2D9PA 3C6UB 4O3QA 2VG7B 2CPXA 3MHYA 3EVMA 3Q8PB 3MWBA 2CQDA 1VBZA 3UO0A 2Z58B 2ZUGA 3OLBA 1H2UX 3LW5C 5KFWA 2AJ2A 2JVRA 2I1RA 5KFRA 1N6QA 2A3JA 2HLUA 1JK9B 1UL3A 2XI2A 1U7LA 5KFHA 3IR6B 1TK8A 1HBUB 2DT9A 2NZ4A 1FCAA 2WAQD 4GO5X 2BQRA 4JI5F 4DV1J 1X9SA 1QSYA 2QA4S 4ZP6A 3P4UB 2EBGA 1RWVB 2RQ4A 3K17A 3ICLA 1S1TB 3K5NA 1T03A 5DLGA 1VLOA 4MKBA 5EHHA 4NZ6A 2CJYB 4FYWB 1FRMA 3NXZA 1NJXA 2O66A 2B51A 4DUTA 2PI4A 1LXJA 3M1VB 2ILYA 4ZP7A 2XHWA 2OMLA 4PKDB 2KRBA 4FPIA 1NDLA 4FYDA 5ETTA 3DLHA 1C0TB 1AXQA 3HT0A 3E8OA 2CA9A 2NR0A 1U6FA 1EP4B 1FRXA 3IGNA 4Z2XA 2W7AA 1G2EA 4RNFA 1OYEA 1VRTB 3VF0B 4X4TA 3NRBA 4MKAA 1IWGA 1P1TA 1H72C 1CJUA 2MY8A 4IH5A 2I0XA 2ADCA 5ETPA 1RT2A 3M6WA 5F3TA 2VDIA 3GB0A 1RHKB 1MU2B 3CDBA 5EX3A 4B3OA 5AXNA 1P27B 1DARA 3TNVA 2BVZA 4OJGA 2FZGB 4S0MA 1NHUA 4YY3F 1DTQA 4IRCA 3PR5B 3AJ2A 5HMZA 1Q7YT 3HSZA 3T1YJ 3LTOA 2RKIA 4FBTA 3M2UA 1QVGR 4IG0A 1YBUA 2CPZA 1U1NA 1AB8A 5KG6A 1P8GA 4P2MA 1RWXB 2H3EB 3ENVA 4ZCMA 3Q22A 4A8OA 3OSPA 3IM8A 4FXDA 2AJ0A 1HNWF 2UVUA 4WBFA 2OLWA 1Z1ZA 5SZTA 2M2BA 2W9AA 5D0GA 4KGMA 5ETSA 1S79A 2HVZA 3S01A 3BN4A 3FSIA 1J27A 1FI4A 4OHXA 3M30A 5D6GA 5HN0A 3DRYA 3Q86A 1DFDA 3TZXA 3QZ7A 2W7PA 2W9CB 3NMRA 3MMJA 2VOOA 3VWSA 4JI2F 2VODA 2R3VA 1ZM2A 2IVYA 1SIWB 2IC3B 3UE2A 4EBEA 2OI2A 5A8KA 1U49A 1F5AA 4ZLLA 1UAWA 1R0CB 5FLXU 3C15A 5JJBA 1IKXB 3CWJA 2F40A 3AOBA 4DSFA 4LR8A 3G8QA 3O8WA 2G0CA 1DHMA 2AJ1A 3ZTQA 2YNHA 2Y8WA 4UUXA 2JEJA 5IQQA 4G6VB 3OR2A 4ZS6A 5DQIA 2ROEA 4JI6J 1F3VA 2HGMA 2LVWA 3PYEA 2JZ5A 1F1BB 2UXDF 2DD8S 1OQ3A 2OH2A 5FLXY 3L7OA 3KLHB 5K14A 3PW2A 1FKPA 1OY8A 4RUHA 1NK4A 1LWFB 2ATLA 2RF2A 2C2EA 1N34J 3IMQJ 1RT5B 2EFPA 1NEEA 4EGLA 4ECUA 3W64A 1URRA 3QNWB 3CCQS 4WTYA 1F5BA 4F67A 1P9YA 3FDSA 3OL9A 4DDFA 3HZEA 2Q66A 2YY3A 1MROB 4OI2A 1S6OA 1E6YB 3POTA 2VL1A 2KL8A 1FWKA 1RTJA 4UUWA 1BD6A 1W2BR 5J2NA 3K2YA 1LWCB 1FO1A 4DUZF 1U0HB 4GKJF 3DHWC 3MEEB 1VRUA 3PFOA 1JLBA 2AU0A 4Y3CA 2FJWA 2UXBJ 1HBNA 1NLKL 1RAGB 2KXFA 4A47A 2BBEA 4UY8T 3I5BA 4FDFA 4GKKJ 3OBIA 2ZH1A 1UVKA 3M8WA 3OPKA 4CT9A 4H4MA 2XYPB 4WYWA 2A2CA 4IFVA 1AA1B 5F8NA 2O5DA 3QQCD 5KT2A 4FF2A 1U0SA 4DL4A 4KHPJ 3AQOA 2JWNA 2F63A 2OD4A 2AYBA 2R2RA 3H4BA 4L3NA 3V2UC 1RA6A 5KFKA 1RA7A 1REVA 1N52B 5B0AA 4CDIA 5J2MB 5BJRA 3NS6A 3C3LA 2HZCA 1M1HA 4WP9A 2MZSA 5CYQB 4JV2A 5D0EA 2GMLA 4ERDA 4F25A 4HR2A 3CCLS 3ITHA 3NLCA 2Y0BB 3L4BC 4ELVA 4H4OB 1PKUA 3LALA 2DHXA 5I42B 4U7UK 4DX8H 1C0UB 4DEZA 5L1IA 4O23A 4MJKA 4X2BA 4NLYA 3I5AA 3EVOA 1N36J 3HJFA 3TUPA 4CH1A 3C6UA 1V9OA 3UN3A 3IG1B 2VG7A 3NCRA 3DXBA 4L6V3 1YSJA 1IR0A 1QLNA 4QW9A 3EGNA 2PEBA 1JLEB 2J0XA 4NYZA 4DPXA 3BR9A 2IRUA 1ZTWA 1XBWA 2FVQA 3GYGA 4KBIA 3HDSA 2BJ9A 4LF8J 2OUGA 4G1QB 4C48A 3DKDA 3BJYA 2CQ2A 2HHVA 3QRRA 2KFNA 4F04B 2IDLA 1HBUA 2QX0A 2C2RA 3BGUA 3HHLC 2ASJA 2YKMB 2GVZB 2XZWA 4M5JA 4DV3F 2CVIA 2DNHA 1FRLA 4Q8EA 2OFHX 3GG1A 3W5ZA 5F8MA 1WUUA 2Z2LA 8AT1B 1F9FA 2MHEA 1KRPA 3FC9A 1FRHA 4TKTA 3TAQA 1S1WB 1WJ9A 2OP5A 2GAGC 4J90A 1N5SA 1Z2LA 3JQKA 4Y34A 3R5BA 2DRAA 5EGYA 1EQ0A 1Q86T 3M1VA 3NGRA 3LP1B 2WBMA 3MR7A 1S9FA 2OELA 4DV6F 1U45A 1C0TA 4RNHA 4USJC 1WF1A 4UOFA 3DFEA 2CQIA 4OZNA 1S49A 2RMLA 2BM1A 2Z30B 2WSCC 3AJDA 2DNLA 2QYGA 5KFNA 1VRTA 2DBBA 2IRXA 2V8DA 2C2ZB 1H98A 1FVSA 1Y5LB 1PYSB 2RS8A 2BKOA 2HS3A 4CO1A 2BW7A 1MU2A 1NSPA 2XY5A 3THVA 1HNXJ 5AJ3F 3IGVA 2ZZMA 1KVJA 3MOJB 2FLPA 1YJWS 3MZIA 2BQUA 4YB6A 4FVCA 5IC4B 1QE1B 5IM0A 1ZPVA 4JUZA 2G1HA 1U02A 4M5NA 5B7WA 1H0HB 1X7VA 2B4VA 1J5EF 3PVXA 2CFXA 2V4QA 5ETMA 2OEJA 1RCXB 3WDOA 1Q95G 2VA2A 2UVRA 1NJWA 4NA1A 2CPDA 3EXCX 2BA9A 1I6JA 2AHOB 1LFWA 3F0NA 2OSQA 3GFZA 4M5KA 1F3FA 2GAHC 2L9NA 4JI7F 3GIJA 4NLTA 2HFSA 2W9CA 1YJ9S 1SQEA 4FKXA 3KYLA 4X66J 2XNQA 1VOMA 4DV2J 4DSJA 2IC3A 2BJ7A 4QWEA 1CVJA 1VQYA 4KGVB 4NLRA 3CIZA 4ID5B 2FY1A 1IKXA 3M2RA 3N6LA 3KDNA 4QWCA 2ASYA 2CNKB 1FXDA 2V5HG 1B64A 1N88A 4QIWD 1TR0A 3CJ0A 2KM8C 1SH0A 3DRXA 3H0PA 3BN7A 1HNVB 3TI0A 4YS2A 1U1KA 4HHJA 4QYZJ 3W66A 2D3O1 4C9DA 4DL2A 3TA0A 1IBLF 2DO0A 2R7XA 3OQ2A 1HQ2A 4XDDA 1VHIA 3TX0A 4M5LA 2HFZA 1SJQA 5MAOA 4FVMA 4ZVFA 3KLHA 4OYPA 3FEZA 4X62F 3AHPA 3BH6B 3DRSA 1XR5A 4ZPCA 3OJSA 2F4FA 3P8BB 2N4CA 1FX2A 5I3UB 1RT5A 5HL7Q 1TELA 5H1SV 2ZJPQ 3A3PB 4ZPAA 2KFZA 3NS5A 4WK3A 4WPAA 4ZVUB 4ZJOA 2L41A 5DG9A 1X4EA 2NREA 4HTJA 4A4JA 4X4NA 1JNRB 2MJUA 3MCSA 4P74A 1E6YA 5KFCA 4CLUA 4ZVQB 2HVHA 1U8SA 1X5TA 2FUG9 2FJXA 4Z7CA 2CXEA 4J9KA 1S4FA 4G65A 4AL7A 1LWCA 1U0HA 3MEEA 3PV8A 2WVBA 4GMKA 4HLBA 5AXKA 1HNWJ 1GXUA 3DRPB 3IAS9 2BDPA 1VQNS 1FDBA 2XWXA 3A13A 4I6YA 4A8XA 3TVYA 4AXJA 1OSCA 2GCFA 4C8YA 3M05A 4DR1F 4H4KA 2WVCA 2J6UA 4JI2J 1FDNA 2JFDA 3L7UA 3FJ2A 1NRKA 1TUVA 2HWTA 4CH0S 5HP1B 4YB5A 1VQ6S 2DNPA 3UNYA 2DGWA 2MZ1A 2MKJA 1F0XA 5E41A 5J2MA 2YWEA 4OMFG 2CUYA 2QA1A 2WW8A 2NXJA 5CYQA 2C3OA 3IS9B 5CABA 1NK9A 4OZ2A 3SYZA 1UCNA 3HHNB 1RAFB 1B70B 1VBXA 3I31A 3V5RA 2VBYA 2GGPB 1PG5B 3N5BA 1C0UA 5CCMA 3V6DB 3AB2B 4EUVA 2UXDJ 1PC4A 2ATCB 5KOXA 3D3BJ 4KHRA 4M5DA 1FK9B 1FJGF 1QAXA 2IFXA 1S6PB 3CEDA 2CQ1A 3M9NB 4KAIA 3IG1A 4N7TA 4ZP9A 2CQHA 2QRRA 1IN0A 4J91A 1RISA 4E98A 1TKDA 2DGTA 4V1Ak 2CJKA 4G1PA 2CQPA 2KXHA 2ZHBA 1RAEB 2ZH3A 5C25A 4M94A 3UFCX 4G1QA 4C97A 3FSXA 4ZVPB 1XNQJ 3MAHA 3MTJA 4NASA 2LMIA 1LW0B 1RBAA 3EDRB 2YKMA 1UETA 2GVZA 2DXEA 3CD7A 3RZAA 2J0WA 2XHCA 3DLJA 4O3RA 1HHQA 1RT1B 3OHBA 4OV6A 2WONB 4GKJJ 1N32J 3I0RB 1QTNB 1GXTA 1YQHA 1S1WA 2G2ZA 2C1EB 2ZKTA 4B3TJ 1K0VA 3H5YA 4GO7X 4USKA 3KKFA 1FRKA 4OYMA 2NXCA 5DQGA 2ZH6A 2E7XA 3K5OA 2MKHA 3LP1A 4CNZA 1FFWB 3PIOQ 1LW2B 2FB0A 2QLFB 3MR6A 2J7KA 1U2CA 4C8ZA 3FKBA 4F26A 3C8YA 3TOQA 1VC6A 2CNNB 2D3ZA 2MJNA 1XMOF 2ALZA 1SCJB 2ASLA 2A18A 2BJ1A 4ATNA 3R5GA 2PEHA 4JI8J 2GQ2A 2JDJA 2LU1A 1YBAA 3BS9A 4HYKA 2RRBA 4DHVA 4CQ1A 2OEMA 1RAAB 3MR2A 1PJ6A 1Y0HA 4LRFA 5DGBA 3NKYA 2D1CA 2CADA 2QEXS 2WK4A 2HFOA 1RP5A 3ZZ0A 4PPZA 2DGUA 4CYUA 4OI6A 1TMMA 4HVZA 4EEYA 1LV5A 2W01A 4MTPA 2V34A 4F4KA 1UWBB 4AFFA 3BF4A 4Y2AA 1YKWA 2VFRA 3C46A 2AJFE 1DQ9A 4HACB 2M8DB 3PR4A 2FPHX 4EO8A 2HNZA 4F2RA 4AQYF 1IBKF 4LRAA 4ED6A 3R2CJ 1VQLS 3ONQA 1HWLA 2VFVA 5HBMB 2UU9J 3HULA 1TUWA 5IXUA 3CJTA 5HAOA 2ZOMA 3DMJB 6AT1B 4F0KA 1RWWB 1HBOB 4DV3J 2JC1A 1OWXA 2CRLA 3SCJE 4ID5A 4A8FA 2DXFA 2D41A 3T9ZA 2YNIA 4DSLA 3GV7B 2YQ1A 5LJ3Y 3CMES 3M8QB 2OTLS 1HNZF 3IWNC 5E33A 5KFQA 1UEKA 4I6WA 1DJ0A 3ULHA 1HNVA 2XMVA 3MMBB 4YDXA 4WTOB 4YEAA 3P5TL 3K58A 4ED0A 2AYGA 3VZHA 2JH3A 3BM7A 3NCQA 2VG6A 2D7SA 2H48B 1PSDA 5CYMA 3EMTA 1X4FA 3BSCA 2YKAA 3K0JA 3GR0A 3W2VB 5HQ8A 1JLGB 2Y9HA 1RYRA 2DCLA 4TN2A 4NA2A 3HSJA 3BR8A 5I3UA 1NKBA 1Q8IA 3DLEB 2DISA 2MZJA 2RB7A 3BSAA 2XO6A 1UJ6A 3VALA 1Q16B 2VASA 3TO8A 1YJTA 2MQQA 3TA2A 4NYOA 2MQMA 4PUOB 3U02A 1RTIB 2KZZA 2MYFA 2WVDA 2B4UA 2R7TA 4ZIWA 5F8IA 3PRBA 5D78A 2MKKA 1PYTA 4DR5F 2FGCA 2V8PA 4B9NA 2FVRA 2Z2YB 1L3SA 1FHTA 1UJ5A 3LA0A 3ZZUA 1F2GA 3DNCA 4EMDA 2YKQA 2C2OB 3B8HA 4QPTA 1NHKL 2QA2A 1J5EJ 1RBLA 4ZLNA 4ZDNA 2H1YA 2VIHA 1VQMS 1B3TA 2QLJB 2ZNZA 3NBPA 3WC0A 4KYZA 3J81j 5HANA 4ZKAA 4DX6A 1IR1A 1FE0A 2Q6CA 2KN4A 4IOAQ 3DRPA 4QQBA 3BPSP 1PAEX 1SH2A 3BYPA 2E9TA 4LSNB 5ADZA 2XSJB 4NLGA 2ZITA 4DR4J 4FYXB 4O3OA 8RUCA 2J0SD 2V69A 2VB6A 4RO0A 2ACMA 1B0TA 2N4DA 2HRUA 4J9VA 3KUGA 3MM7B 2HMIB 3VAIA 1T94A 2R9LA 4EU0A 2EFOA 1RU1A 5HP1A 3WIUA 5DJBA 1M5HA 4IUFA 2CJXB 1AUDA 2PMHA 2UV8A 4OHWA 3IFEA 2IM1A 1WDTA 4CIOA 4RW7B 2H65B 3NAIA 2DR7A 1VC5A 2IMWP 5KFGA 1KTVA 2COLA 3IS9A 4EI2A 4IR1A 3A1YG 3NGSA 3IRXB 3S1TA 3CCMS 3MM5B 1U6BA 3IO1A 4IG3B 1IBLJ 2GGPA 3LGMA 1BUXA 2C22A 1M5SA 2B5JB 3FBEA 1PIEA 1LFPA 4F2SA 5CHCB 1N5VA 1X4DA 1ZZFA 1RHMB 3E2EA 4IDKA 5HJYA 5D4PA 5J2QB 2Y1RI 5HQMA 3WZ0A 4KKOA 2F4VJ 2NSBA 2I8EA 3F44A 4ZJQA 3SV4A 2RQMA 1U1MA 4M1KA 2W4PA 2ZD1A 1UW4A 3VGSA 1DQAA 4TU7A 1S0NA 4NLWA 2HG4A 3BYRA 1AFIA 3M6XA 2XMTA 1LW0A 2X1AA 1FT8A 4N8OA 2ROGA 2UUBF 4ED4A 1C4CA 5IT4A 2UUWA 4RUAA 3W65A 2YWFA 3ILJA 1RT1A 1KNZA 2WONA 5A6PA 2IBKA 2GS8A 1HBMB 4L72B 2HPUA 3T5JA 1ZM3A 4LMZA 1D8ZA 4FYVB 7FD1A 4QYRA 4RW9B 2R8GA 3QYYA 5T7LB 1TVRB 2GA7A 1R6VA 5BR8F 4ANEA 5LSOA 2AD9A 3HK2A 1ZAXA 3Q8SB 4V19J 3MCNA 3T1HF 4DR1J 5KFJA 2L9DA 2CDQA 3LPEA 2E5LF 1M0SA 1U1LA 1P1LA 2GZOA 1Y4ZB 1O8BA 1ZYQA 1FNOA 1LW2A 3AXMA 2L9WA 4CNYA 2QZ8A 3J80U 4W92B 4AE5A 1ITPA 2XGQA 1U2FA 2BJEA 4G3IA 3L09A 3V81B 4FYYB 4DV0F 1U1RA 1UVNA 4OX9J 3TQEA 1I51B 4C7QA 1TV6B 1H38A 3ILOA 5KFUA 4IKAA 5HI7A 1SIZA 2ZDOA 4DR2J 4A8WA 1RGVA 3G4SS 1U1PA 5K9FA 5I4MA 3PX4A 4C2MA 2XZDB 4LRBA 3PHEA 4DL3A 4DR3J 2GO8A 3J80Y 3UDCA 3TJAA 3DGPB 2D3UA 2L3MA 4HI2A 4NMLA 3D2WA 1FJGJ 3FCHA 2JJ4D 4MIWA 2R7UA 1WHYA 3DI6A 2GHPA 2HGLA 5KFTA 4TXSA 5EN1A 2J5AA 4USWA 3CJ8A 4HACA 2R2SA 4LF9F 4LQ3A 2DNRA 1EZZB 1Y00A 4O0NA 1M5VC 2OJ3A 4J9PA 3KMQA 1NHVA 1EKRA 4R25A 4UW2A 4Q7AA 5IQ6A 3I0SB 2AEFA 3DXSX 5HBMA 2JL9A 4ER8A 3DMJA 1SKRA 1CJTB 1HBOA 5C24B 1H2VZ 3QMQA 4DPTA 3KNAA 1LOUA 1T9YA 1PC5A 3MEDA 2HFVA 3IBFB 3D3CJ 2HBYB 3M8QA 2WOMB 3CDWA 1NO8A 4Y2MA 3RG6A 2CG4A 4M5GA 4F4XA 8ATCB 3O6QA 1NK8A 2W9BB 2YNFB 1ZBTA 3Q23A 3BPDA 2UZAA 1TFWA 2UUCF 1WG4A 3CE8A 4NZ0A 2V4RA 1NCLA 1S48A 1ZZNA 3W2VA 1BLUA 2IIHA 1JLGA 1XJWB 1FEHA 3CJKB 4B9VA 1YTYA 1S1XB 4UZCA 1SH3A 1X4HA 5CYJA 1M1GA 5AXLA 4KO0B 3DLEA 3O3LA 4I0WA 2RSQA 1V3ZA 1UKUA 4KGXB 2B9YA 2LLZA 4PUOA 4N5SA 3FQKA 2XLIA 1S10A 5GADI 3LUYA 4DFKA 1VJWA 2JC0A 5CQGA 1X4CA 1DTTB 2LA6A 3BO4A 3FBBA 5B0EA 2H4WB 3IWXA 3VHQA 3B4DA 3G2XA 1WORA 2MGZA 1W2IA 2BJ3A 1H74A 4MYUA 3G9CA 3FNNA 3VQSA 4RUCA 4RW4A 2KVIA 3TZZA 3A12A 1M1KT 5DZ7A 2NXNA 4V19X 3QO9B 4GVBB 4LSNA 3EX7B 5KG3A 2XSJA 4ZN1A 2GIRA 2BMBA 2C2NA 3D1OA 1IBKJ 1HIYA 2MQLA 3TZYA 3IA0A 4W90B 5IOLA 2R7VA 1S7HA 3MM7A 2HMIA 2ZM6J 3NWRA 2W2OP 3AOAA 3ZTPA 1KQSR 4I64A 4JI0F 2BACA 3ETOA 1K0TA 3LO3A 1RBOB 2LP4A 3R7SB 4IQXA 1HKAA 3TYTA 4I7FB 3P96A 3MURP 1DQ8A 2XS7A 4CO4A 4RW7A 3AD7C 5JUMA 1H3DA 2YQ0A 1OY9A 1RCOB 1HNZJ 1RDRA 3GZ7A 2NPIA 1FWLA 1X0FA 3IRXA 2JLFA 4EZ9A 1RHQB 3ADAC 5B0DA 4M63A 4OHYA 3M8SA 2P9CA 4IG3A 1KVKA 1RSCA 3MEGB 4LF4F 2RJZA 3LOUA 3L9ZA 2W4CA 2B5JA 4WF9Q 2R7RA 4X4PA 1WKKA 1EKSA 1R0AB 4M95A 4P2XA 1X31C 3OSNA 4LF7J 2BE7D 4RR5A 3A3OB 5LMNF 3G86A 3HZGA 3S7RA 1RHUB 4BLGA 4EYHB 2PO4A 2UXCF 2HW3A 2DR9A 3SI8A 3TEHB 4ECRA 3GONA 3AODA 4DF4A 3LPYA 1O0PA 2CQBA 3SCKE 3CC4S 3DOLB 3QRPA 2Z8QA 1JB0C 1Y5IB 1SC6A 3BQ0A 3NNCA 3VAKA 3EWGA 4U8VA 3E01A 3D66A 3BKUA 3DM2A 1HBMA 3EZOA 4GC7A 1J5OB 1N48A 3FMBA 1IWAA 1MMLA 4RW9A 1VK3A 4DV1F 1F60B 1TVRA 1FWPA 2Z2MA 3KK1B 4BHQA 2HGNA 1L3VA 1ZAVA 4F3MA 1JJHA 4B9LA 1W26A 3D68A 3BDPA 3HP6A 2GV1A 5D3GB 1IKWB 3R6GB 2W7OA 1SL0A 3JYTA 2ZH8A 4DXLA 1EAYC 2WTFA 4QR1A 2QN6B 2NSCA 4KGZB 4K8RA 1SQGA 1RAOA 1JJCB 3V81A 1OMSA 2KXNB 4QPXA 2AIRB 2MTLA 1TV6A 4UZBA 2MKSA 4DFMA 1G3OA 2OPQB 2NYIA 3NG8A 1UWAA 3HM9A 3GYNA 1O5JA 3KLFA 5DM6Q 2EC0A 1SXLA 4LSLB 4R8UB 4OX7A 4ZVRB 1EARA 1SL2A 4WZQA 3W9IA 3DGPA 3W8PA 2FHJA 2F8MA 2N7YA 4RW6B 2KG0A 2O67A 2H5EA 2ZE2B 3I4PA 1VMBA 4K4SA 2X1BA 3T1YF 1N5YB 1T3NA 2XY6A 2B6AB 2JEIA 1BQXA 5E3PA 3PKYA 5L1KA 5KFPA 3PYFA 2DY9A 3Q89A 3RRHA 1FRIA 3FGVA 3QIDA 3M8YA 2ZKUA 1IKYB 2H51B 3I0SA 3CCUS 5CZXA 4DSEA 3EZUA 1X8DA 1PBUA 2VKZG 1S0OA 4WFYA 4CTAA 4IFYB 2HZAA 1JXLA 3PNIA 1CJTA 3CIMA 5B0CA 4UOCA 3OHAA 5C24A 2BE2B 4PCQA 1UFKA 2OHDA 2WSEC 4OV1A 2KRRA 3R7NB 3G6VA 4DMZA 2R8HA 1V3SA 2PFFB 2HAFA 3FRYA 1N0UA 1XC9A 1U1QA 3SXLA 2RDIA 3KLIB 2W9BA 4ES3A 3VGUA 2YNFA 3F56A 2XEXA 5CZVA 1X5PA 3DOMB 2E5HA 3MUTP 3KHRA 2LEBA 4IR9A 4OZ0A 3CO9A 2CKWA 5C5JA 2A2DA 2XNRA 2UUAJ 2KH9A 1TL1A 3UQSA 1XIQA 2K7KA 2VQEF 5C2CA 4E2FB 3RRKA 4PQAA 4XIUA 1H2TZ 1A9NB 4NLQA 1O51A 1X9WA 3CJKA 2KM8B 3CD0A 1S1XA 5E2QA 2F5GA 2AV5A 4JI6F 3KFWX 1Q5YA 1FTCA 1QJHA 3CCZA 4KO0A 2J8SA 4ZVGA 3CCJS 1D9AA 1GK8A 4K7QA 3W8GA 4O3NA 4KB7A 2OTJS 5K8MA 3A8IA 3FSYA 4K4XA 5D0RA 2ROPA 5J1EB 4PG5A 2ZH4A 1SQFA 3H2LA 5EDWA 1VK8A 2BANB 1U25A 4BBYA 1N34F 1NNDA 3PFEA 1HLWA 3G6ES 3EGWB 3EM1A 4DCPB 3UCZP 1OPIA 1UP1A 4USMA 1S77D 1DTTA 1KQFB 2E1PA 5ETVA 3AQPA 4WXOA 3OVBA 4DR6J 3H59A 4DG1B 2HURA 3QIPB 2ZOGA 1K73T 3PRDA 3D28A 1T9WA 4L75A 2V2QA 5BXIA 2H5IB 2RRNA 1S59A 2B4OA 2U1AA 1HPZB 3RRGA 2CNOB 4KQZA 2DGSA 2HHTA 3QO9A 1YG0A 2VQFJ 4GVBA 3TWZA 5BYSA 2FLLA 2KKHA 1AW0A 2IYIA 4NLUA 4B9TA 5U47A 1G4CA 3BH7B 1SJ1A 4JI1J 2UXBF 3RAQA 3M6UA 3FZ2A 4C11B 4WP8A 1B99A 3H90A 3J81Y 1U24A 4GKKF 3L95X 4ECWA 2MLZA 4DS4A 3M8PB 1R43A 4I7FA 1WG1A 2P6SA 4BDPA 1XNRF 2RUGA 5SUHA 3WIVA 1QAYA 1RKIA 1ZPWX 2CPFA 5KFYA 3KK3A 1S1VB 2B8PA 2ASDA 4GRSA 1HW8A 2IM3A 3OXGA 5D0HA 3BGOP 5KFLA 4QWDA 3MEGA 1ZAWA 4Q44A 2CPJA 1XQIA 4J9QA 3CCWA 3F41A 2CZVC 2E5GA 1YJNS 1GMVA 4JB8B 1T8EA 4K4ZA 4OX6A 5D8HB 1GEHA 1Y11A 1R0AA 2KYXA 3FZBA 2SXLA 4M8LA 1NH8A 1L3KA 4L3KA 4I2PB 4NX9A 1B4SA 3TR5A 3T9NA 5B0GA 4J37A 1WD6A 4DI6A 2MQOA 1C1CA 3EGVA 1PBAA 1N36F 1D1UA 4Q0BB 1GTHA 3I56S 2RAQA 2CQ0A 2V2KA 3KJNB 3DOLA 1RT6B 1N5TA 1HQUB 2P9GA 4PWUA 1Y3JA 3KJFB 2AX1A 3I6PA 3PCOB 3G8TA 4B9UA 2PI5A 2WHOA 1AZSA 2F8HA 3PY8A 4LF8F 4AL5A 2FHOB 3OJUA 1OIAA 4ELTA 2ZEJA 3MCOA 4DWIA 1J5OA 4X4OA 2ZJRQ 1CULB 3SCIE 1RLCL 1JLFA 2U2FA 4K0KF 2ACYA 1RXOB 2DKOB 3CTRA 2PFDA 5DETA 3UCGA 3V6JA 1FA0A 5ETQA 4DUYJ 2B9WA 2MMYA 4JYAF 2AMCB 3HVWA 1BGXT 1S9GB 2XMMA 5D3GA 2WW4A 1IKWA 1CC8A 4YUDA 2CDRB 2QT7A 4K5RA 2YPYA 1SJ4P 1RTDB 4I69A 5KOWA 3OTEA 4ZITA 2DIVA 2HQGA 3QLHB 2X1FA 1Q1KA 1F9EB 1N0VC 4O44B 2FTRA 4ZA1A 5D4NA 3BSNA 2R7SA 3UN5A 2LXIA 4F0MA 2V8HA 5F3ZA 1LWXA 1S99A 1NUEA 1NMEB 3VAHA 1OJ4A 3J7AN 4P73A 1DURA 3I9ZA 1KSPA 4O4RA 4QJVA 3CO0P 3Q8YA 4H4KC 1D9FA 1R27B 5DO2A 1NK0A 4LF4J 2WCXA 4LSLA 3S8SA 1X4AA 3RW6A 4DV4J 3PEJA 3MM6B 1Q53A 4RW6A 2GHWA 2HS0A 1F6TA 2YNGB 2NZCA 2ZE2A 2HFNA 5LXYA 1N5YA 2MLYA 3MPYA 3GFHA 3KG1A 2AP6A 3PJWA 4U9RA 5LMNJ 1JJ4A 2E44A 4USTA 4EZ6A 1TL5A 3DDKA 4TYBA 3GILA 4K4UA 1NDPA 4QWBA 4AYBD 3BBFA 3EPIA 1IKYA 2UXCJ 3FVYA 1Y3KA 4N77A 4GC6A 2GJ2A 1VIOA 4NRTA 4JV5J 2KU7A 2MKCA 4NA3A 4NZ7A 3BQ1A 1VQ8S 1TAUA 3A8EA 5KFEA 2CJAA 2DR6A 2LKZA 3EXYA 1NZAA 5IS2A 4DPWA 3P45B 1GT8A 2I6WA 3R27A 3OR1A 4XPEA 2VD3A 1S1UB 4J9LA 1N5QA 5IV3A 1SB6A 3UCUP 5KFAA 4TQRA 4RUBA 4X66F 4AL6A 4LBIA 4DV2F 1KWMA 3OT9A 3LF0A 3M9MB 2P5VA 3RAMA 3X3UA 3LP2A 4U7UD 1TUGB 4P75A 4FP9A 2VG5A 3DLKB 4JBCA 5CD4A 2VPYB 3KG0A 3PIPQ 2CPHA 4DSKA 4KTQA 1KTQA 2EG2A 2A0FB 2NLWA 5IFMA 4KH0B 4FZVA 5ETKA 4BC9A 2YPZA 1KHVA 4ZHRA 1R8AA 2QJ3A 5A8RA 2DVIA 1RE1B 4BC7A 4LFCJ 3R5CA 2HHWA 4PRFA 1V5VA 2HLTA 5KT7A 3DC2A 2R7QA 4RBVA 3KUEA 2DHHA 5KFIA 3CCRS 3QGHA 4J9UE 3GSIA 4YQWA 3R97A 2FVCA 1T3OA 2ZNYA 2MDAA 5J1EA 1HI0P 2RH3A 2BOAA 3H5UA 4XK8C 2BANA 2ERRA 3P3DA 4J7CA 5HK4A 2FY8A 4LFBF 4Q5VA 2C42A 1TAQA 2DNQA 2O01C 2IM0A 2GVDB 4DG1A 1SKWA 4KH1B 4OHVA 4F02A 4KHMA 1LEOA 4P2FA 5F9NA 3WC2A 1HPZA 4ES1A 1VFJA 3KJVB 1KOHA 2LU2A 2RIJA 5GMDA 5E3AA 2X3GA 3BQ2A 4A8SA 1BQNB 1B7YB 5A8WA 4HT5A 5KG7A 2K06A 4TU8A 3CGIA 1PJ5A 4X4VA 3OL6A 1IBCB 4C11A 4F8RA 4Z7YA 1D3WA 3PX0A 4D3GA 3PXGa 1R6YA 5K8NA 3MPUB 1QD1A 1T0TV 3ZNJ1 1CPZA 2QO3A 1U26A 2YWWA 3GP9A 5KFOA 2X3DA 2F65A 4F4AA 1SC3B 4WFNQ 1VQSA 4RWXA 3P5BP 3MM8B 4LF6J 1UVMA 1WSVA 3BDEA 2VFTA 3MOZA 2MY7A 3FCWA 3G96A 1S1VA 4C0BA 4CCHA
chains in the Genus database with same CATH topology
3MPDA 3ELHA 3FBFA 3JS9A 2B8PA 4DZ6A 3VVTA 2BX6A 2HURA 3DKDA 3FBBA 4ENOA 1LEOA 3EICA 1NSPA 2DXFA 2CWKA 2DXEA 4KPCA 1EHWA 4C6AA 3VGUA 3NGUA 3VVUA 1S57A 3G2XA 1HHQA 1XQIA 3B6BA 3NGSA 5CABA 1NDCA 1F6TA 5BXIA 1UCNA 1NSQA 1S59A 4ANCA 1NHKL 3GPAA 2AZ1A 3Q8UA 4UOGA 1ZS6A 1XIQA 3Q83A 4S0MA 3FC9A 3ZTOA 1NB2A 2ZUAA 4FKYA 1BUXA 4HR2A 2HVEA 2BEFA 3DDIA 3FBEA 3BBBA 2HVDA 2VU5A 3EE3A 3VGVA 1WKKA 3BBCA 3VGTA 3ZTQA 1WKJA 1NDPA 1NSKL 1S5ZA 4ANEA 1PKUA 1B4SA 1BHNA 3BBFA 1NCLA 3EMTA 1PAEX 3B54A 2DYAA 3BH7B 2DY9A 3Q89A 4DI6A 4EK2A 1WKLA 1BE4A 4O0NA 1NLKL 1HIYA 1B99A 2DXDA 5IOLA 5C7PA 4DUTA 3NGRA 3ENAA 4UOHA 2B8QA 3GP9A 3PJ9A 3BH6B 3EVOA 3EVWA 1LWXA 4F4AA 3ZTPA 4W98A 3FKBA 4WBFA 3FBCA 1KDNA 1NUEA 3R9LA 3ZTRA 1NPKA 3VGSA 4UOFA 1F3FA 3NGTA 4CP5A 2NCKL 1K44A 3PRVA 1NDLA 4ANDA 1MN9A 1NDKA 1MN7A 4F36A 2AZ3A 1W7WA 1HLWA 3EM1A 1U8WA 1JXVA 5CAAA 3L7UA 3FCWA 3Q8VA 3Q8YA 3EJMA 3ZTSA 3EVMA 3ETMA 3Q86A 3WX8A 3FCVA 1VYAA 4FKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPD A;  3ELH A;  3FBF A;  3JS9 A;  2B8P A;  4DZ6 A;  3VVT A;  2BX6 A;  2HUR A;  3DKD A;  3FBB A;  4ENO A;  1LEO A;  3EIC A;  1NSP A;  2DXF A;  2CWK A;  2DXE A;  4KPC A;  1EHW A;  4C6A A;  3VGU A;  3NGU A;  3VVU A;  1S57 A;  3G2X A;  1HHQ A;  1XQI A;  3B6B A;  3NGS A;  5CAB A;  1NDC A;  1F6T A;  5BXI A;  1UCN A;  1NSQ A;  1S59 A;  4ANC A;  1NHK L;  3GPA A;  2AZ1 A;  3Q8U A;  4UOG A;  1ZS6 A;  1XIQ A;  3Q83 A;  4S0M A;  3FC9 A;  3ZTO A;  1NB2 A;  2ZUA A;  4FKY A;  1BUX A;  4HR2 A;  2HVE A;  2BEF A;  3DDI A;  3FBE A;  3BBB A;  2HVD A;  2VU5 A;  3EE3 A;  3VGV A;  1WKK A;  3BBC A;  3VGT A;  3ZTQ A;  1WKJ A;  1NDP A;  1NSK L;  1S5Z A;  4ANE A;  1PKU A;  1B4S A;  1BHN A;  3BBF A;  1NCL A;  3EMT A;  1PAE X;  3B54 A;  2DYA A;  3BH7 B;  2DY9 A;  3Q89 A;  4DI6 A;  4EK2 A;  1WKL A;  1BE4 A;  4O0N A;  1NLK L;  1HIY A;  1B99 A;  2DXD A;  5IOL A;  5C7P A;  4DUT A;  3NGR A;  3ENA A;  4UOH A;  2B8Q A;  3GP9 A;  3PJ9 A;  3BH6 B;  3EVO A;  3EVW A;  1LWX A;  4F4A A;  3ZTP A;  4W98 A;  3FKB A;  4WBF A;  3FBC A;  1KDN A;  1NUE A;  3R9L A;  3ZTR A;  1NPK A;  3VGS A;  4UOF A;  1F3F A;  3NGT A;  4CP5 A;  2NCK L;  1K44 A;  3PRV A;  1NDL A;  4AND A;  1MN9 A;  1NDK A;  1MN7 A;  4F36 A;  2AZ3 A;  1W7W A;  1HLW A;  3EM1 A;  1U8W A;  1JXV A;  5CAA A;  3L7U A;  3FCW A;  3Q8V A;  3Q8Y A;  3EJM A;  3ZTS A;  3EVM A;  3ETM A;  3Q86 A;  3WX8 A;  3FCV A;  1VYA A;  4FKX A; 
#chains in the Genus database with same CATH topology
 4FF1 A;  1CQM A;  3AT1 B;  4NCB A;  2E7V A;  2BJD A;  3CJR A;  1MMN A;  3CPW R;  2XC9 A;  2M9K A;  3UR3 C;  3PJX A;  2VQE J;  4KIA A;  2DNZ A;  2NQP A;  4C6A A;  3GJQ B;  2DNN A;  3KXD A;  5L9N A;  4RZR A;  4OHZ A;  5AE2 A;  1Q78 A;  4AUK A;  4C8M A;  4X65 F;  4YOE A;  3Q83 A;  4XAK A;  1U4B A;  3UVJ B;  2KHD A;  1PYO B;  2JEG A;  3ZZP A;  1LQ9 A;  4DQI A;  2YX7 A;  5K20 B;  2EW9 A;  3T5H A;  2M88 A;  3IRW P;  1UZD A;  1FDD A;  4N8N A;  4Q0B A;  3AFG A;  4ELU A;  1N54 B;  3HFZ B;  4DR7 J;  3O2I A;  3LP0 A;  3THP A;  4IOC Q;  1RT6 A;  3HHD A;  3QJL A;  1HQU A;  3UD5 A;  5A6W A;  4J9N A;  4F36 A;  4RKU C;  1AFJ A;  3SMZ A;  2JX2 A;  1OY6 A;  2N3O A;  1XNQ F;  3FCV A;  2MZR A;  1XWL A;  3JQJ A;  4UF4 A;  3CJS A;  3J7A 1;  2I2Y A;  4ILM A;  2V0N A;  4KJI A;  3TAP A;  2VZ9 A;  3LQV A;  3DDN A;  5EX0 A;  2PII A;  1Y9O A;  3OTB A;  1UJ4 A;  3KMS A;  1N32 F;  3PX6 A;  3K8W A;  2LQ5 A;  3MD3 A;  1S76 D;  3ZTO A;  4B3T F;  3QT6 A;  3G82 B;  2ABY A;  1ROF A;  1BQM B;  2LA4 A;  3GCX P;  4ECV A;  1WKJ A;  2VFS A;  1YJV A;  1CJK B;  3D0G E;  2O3D A;  3M2V B;  1GQE A;  5HMY A;  4ID8 A;  3QLH A;  2JNJ A;  3AY0 A;  2RHS B;  1M5K C;  4O44 A;  2RDJ A;  2FGO A;  3HHL D;  3GTY X;  4F3Q A;  3CDE A;  4DZD A;  3SSR A;  1V5I B;  2F8E X;  3GYX B;  1KVI A;  1XNR J;  4C0H A;  4DL7 A;  3Q24 A;  1WC3 A;  1GMW D;  1WEX A;  2W2M P;  2EVZ A;  2JRS A;  3PDN A;  4LR7 A;  5LJ5 Y;  2W8K A;  1TL7 B;  3K7R A;  3D6M B;  4JI8 F;  5DDR C;  2BRK A;  2FC8 A;  3PW4 A;  3UD4 P;  1WHX A;  3MM6 A;  3N6N A;  2YNG A;  4NI2 B;  4IYQ A;  1YRT A;  2OAU A;  4GVL A;  2DPJ A;  1YZ6 A;  4YFU A;  2XCP A;  3D1H A;  2QE5 A;  3RR7 A;  3RU0 A;  1M5P C;  2OO4 A;  5E5N A;  3GG0 A;  1UPM B;  3S6E A;  3EDQ B;  4L76 A;  3DLG A;  1YK9 A;  3CDA A;  1URN A;  1RTH B;  3CD5 A;  3D9B A;  1QVF R;  5DRK A;  3TW0 A;  2HWH A;  3HF5 A;  4MIB A;  5F8H A;  3EVW A;  4HDG A;  2HAI A;  1VCT A;  2AYE A;  4L73 A;  4F4Z A;  3I82 A;  2DEJ A;  4QIV A;  2UU9 F;  3H2U B;  4DQP A;  2HBR B;  4ECS A;  3UDL A;  3CUN A;  4K0K J;  5CXT A;  4KSE B;  1H7X A;  2RU3 A;  1NK6 A;  1KS2 A;  4NWB A;  3DLK A;  4DLE A;  4JYA J;  2XCA A;  2IY5 B;  2CWK A;  1IBM J;  1S1T A;  2XLJ A;  3E3X A;  1RWO B;  3B6B A;  3RR8 A;  5IWA J;  2K2P A;  5HRO B;  4ZPT R;  3LGH A;  4UOG A;  4LIW A;  2CWX A;  1KLM B;  2D74 B;  3HXM A;  3HVR A;  3LWL A;  3MM9 B;  5ETN A;  2BM0 A;  3IAM 9;  1V3R A;  1K9M T;  3IBW A;  4ZLJ A;  1NSK L;  4OLP A;  4NEZ A;  5G4D A;  1RTZ A;  4C8N A;  2WVE A;  1Q82 T;  1I1G A;  3IBC B;  1EP4 A;  2VV5 A;  2XO7 A;  1KBR A;  2E1A A;  4P52 A;  2OFG X;  4ZCL A;  4N56 A;  3VZI A;  1T02 A;  5ITH A;  3CJ4 A;  3QBC A;  3FK4 A;  2IA0 A;  2QYC A;  2AW0 A;  2QMU B;  2IM2 A;  2KJV A;  2QIF A;  2W24 A;  3QZ8 A;  2LQJ A;  4I4B A;  4OYB A;  2IYG A;  3KJV A;  2QFI A;  4DPO A;  4RU2 A;  4OYW A;  3T6J A;  3OV7 A;  2J6T A;  1BQN A;  2MZQ A;  3PHT A;  4JOU A;  2MQP A;  4Y2K A;  1C1B B;  2F9D A;  1FJE B;  1WC4 A;  3I87 A;  1X5S A;  1RHJ B;  4P9S A;  3EE3 A;  4RL1 A;  1CJU B;  2PGC A;  1ARO P;  4TY8 B;  5H9F K;  4WP3 A;  4DCJ B;  4DR4 F;  3X1L B;  4PXD A;  4RBU A;  4URQ U;  4KT0 C;  5LOQ A;  3OFG A;  5G0R B;  5KT5 A;  2RKI B;  4CO3 A;  3CCS S;  3MPW A;  4WFB Q;  5HVG A;  4CP5 A;  1CJV B;  3N28 A;  2HBZ B;  1RWP B;  5K5M A;  2WRM A;  1WI6 A;  1R0B G;  2FLN A;  2Q79 A;  3G6X A;  4WXW A;  2RNE A;  2CQC A;  3NOG A;  1BXN A;  1FE4 A;  2NYH A;  4ZPB A;  4J9S A;  3VVT A;  3ISN D;  3LAM A;  3NNA A;  2EPI A;  3W1Y C;  2OPS B;  4WU2 A;  2HQ3 A;  3DGV A;  1SKS A;  2HFU A;  4B9S A;  2QL5 B;  2XMJ A;  3MI7 X;  3VR1 A;  1NSA A;  1GXL A;  5L38 A;  1VQO S;  2J7U A;  5I3Q A;  1FKA F;  6FD1 A;  1VGY A;  1H73 A;  3DHX A;  3UVJ A;  2VIC A;  2AX0 A;  1TL4 A;  4DX7 A;  3GV5 B;  5L46 A;  4CLZ A;  5HLF B;  1QUV A;  5B0F A;  2RVJ A;  3BBC A;  1MSW D;  3T1A A;  1S5Z A;  1UMJ A;  2YX1 A;  1LWF A;  2FHK A;  5A8K B;  1Q8L A;  1APS A;  4XO0 A;  2R8K A;  2F4V F;  4LFB J;  4LRD A;  2HND B;  1P9Q C;  5HQL A;  3WHI A;  3HT3 A;  2APO A;  1N8R T;  1SC4 B;  5D77 A;  4TU9 A;  1ZM9 A;  3U1N A;  2UUT A;  1IQZ A;  3FBC A;  2GFF A;  4ECQ A;  1YHQ S;  1T11 A;  3K59 A;  2VJV A;  1MRO A;  3CCE S;  3R8Y A;  3OR2 B;  1R8H A;  2IA6 A;  1S72 S;  3NS7 B;  1JLC B;  2ALY B;  2N3L A;  4QR0 A;  2CYY A;  5KG5 A;  4DFP A;  3D6T B;  2Q6B A;  3HKZ D;  2ZBI A;  1GTE A;  5RUB A;  1T9X A;  1R89 A;  3ZO7 A;  2FJD B;  3P49 B;  2RF2 B;  4HL9 A;  3Q8Q B;  3G82 A;  1BQM A;  2JLG A;  5IT0 A;  3MMC B;  3M2V A;  3ISN C;  1U47 A;  1S6Q B;  1KFD A;  1JLA B;  4O3S A;  4P7T A;  3QPI A;  1HFE L;  4LF5 J;  3WBZ A;  1VBK A;  1UVL A;  3V4I B;  1TFY A;  4HT7 A;  3PTW A;  2E1C A;  4TNO A;  3CMA S;  2PT0 A;  1TKX B;  4QU6 A;  1RTJ B;  4NMX A;  2UP1 A;  2GNK A;  2HHX A;  1PJ7 A;  2V50 A;  3SCL E;  4OX9 F;  2BV3 A;  1VRU B;  3G6Y A;  1DRZ A;  4O0I A;  2B4P A;  3OVA A;  2ZJQ Q;  1YI2 S;  4PQU B;  3MPD A;  1B7F A;  1Q5V A;  4DR2 F;  1Y7P A;  3K5M A;  1GH8 A;  3ZC4 A;  1HWK A;  4X65 J;  4NI2 A;  2CQG A;  1SV5 B;  4H4O A;  2AF6 A;  1EQM A;  1PGZ A;  5KT6 A;  2XMW A;  4H4M B;  3ILI A;  5I42 A;  2AJQ A;  4DR3 F;  2AT1 B;  2CIM A;  1U2R A;  4ZPV R;  2JSX A;  3U27 A;  2MZT A;  1SJ3 P;  2WB4 A;  4OYA A;  3CVK A;  1ZS6 A;  2YQ3 A;  2DNG A;  4F4Y A;  5D4O A;  2ZZT A;  2ZHO A;  2VFU A;  4ED3 A;  3HHE A;  3A8J A;  4M5M A;  1REV B;  1TK0 A;  3MAQ A;  1RT3 B;  4HH1 A;  1GX5 A;  2AGO A;  2W8L A;  3CUL A;  1KEK A;  1JLE A;  4F4W A;  2DGQ A;  3OTC A;  1BWV A;  1LXN A;  1XMQ F;  2V8G A;  3C16 B;  5FDL B;  5THW A;  2HQI A;  3T5K A;  2OD6 A;  1VQK S;  2BUN A;  1UEV A;  5K8P A;  4IO9 Q;  5DM7 Q;  3CW2 C;  1WAC A;  1SKU B;  3ZTS A;  1KFS A;  1KKH A;  5B0B A;  2GHV C;  3D7S B;  1MWZ A;  4DV7 J;  2PMZ D;  3C14 B;  3D67 A;  5HRO A;  2E1M C;  3D1Q A;  2ZC4 A;  3KLG B;  2KT5 A;  2XTJ P;  1KLM A;  2H54 B;  2M4M A;  4Y2I A;  4J9M A;  4FS2 A;  3ZZZ A;  4YR0 A;  3ZNU A;  3BZQ A;  1HWU A;  3MM9 A;  5DG8 A;  5DDP C;  1QDU B;  2G0J A;  3B4M A;  4ZJL A;  3OW2 R;  2IPO B;  2HQD A;  1UVJ A;  2X7I A;  1WC0 A;  1ZH5 A;  2OSR A;  1BY9 A;  3PKM A;  1TP7 A;  2FJE B;  4Y0F A;  3PEH A;  1JLQ B;  3TEG A;  2V68 A;  3TUI C;  3MUV P;  2FIU A;  2QLW A;  5KFZ A;  3Q8R B;  3BKT A;  1WC6 A;  2BJ8 A;  2B8Q A;  1U09 A;  4Q8F A;  5M2P A;  4NE9 C;  2Q1L A;  3QSY B;  3AJ1 A;  2IVM A;  1L5U A;  1WHV A;  1RI7 A;  1FEE A;  1XMB A;  3THT A;  4DL0 C;  2ZBC A;  3T19 A;  1W7W A;  4DV5 J;  2NUH A;  4QIE A;  2PMW A;  1CLF A;  4Y28 C;  2ZH7 A;  1YDL A;  5LSL A;  1QE1 A;  3RTV A;  4P7V A;  2VHG A;  4DL5 A;  3M6V A;  3RGI A;  1VDH A;  3GSD A;  2GIF A;  1S0M A;  4FNH A;  4YB7 A;  1C1B A;  1ZA2 B;  1NZ8 A;  2PA8 D;  3MTK A;  2EBE A;  2VDH A;  4LVN P;  4Q43 A;  3N4W A;  2DEI A;  5HO4 A;  2ZVS A;  4NXN F;  1LWE B;  1Z4U A;  4P71 A;  1DLO B;  2DJW A;  4FF4 A;  3IC1 A;  2QMW A;  4TY8 A;  4RBT A;  2EC2 A;  2EK1 A;  2YWH A;  2O1P A;  4YP3 A;  4OZ3 A;  3D4J A;  3QGG A;  4FNI A;  2R7W A;  5KG1 A;  2A1B A;  4ETX A;  1RWK B;  2AGQ A;  2E7W A;  4PYA A;  2KYZ A;  2V4J B;  4E8U A;  2ZM6 F;  2VBZ A;  2YXL A;  5G0R A;  4DFJ A;  2CQ3 A;  4ZMM A;  5IM0 B;  4JI4 J;  3L7P A;  1CJV A;  2CJB A;  1VJQ A;  3ZTR A;  3ZZT A;  1HA1 A;  1RKJ A;  1NPK A;  2GC8 A;  3HJV A;  2IMO A;  4PG6 A;  1HD1 A;  5CAA A;  5GMK a;  2HNY B;  5DG7 A;  1XK8 A;  2XMA A;  2EFG A;  3NAH A;  4I56 A;  2Z57 B;  2OPS A;  1K8A T;  4URG A;  4ECY A;  1IM4 A;  2XSF A;  2PC6 A;  4EBC A;  2VA3 A;  3FEX B;  4A8Y A;  1S57 A;  1X9M A;  2CAJ A;  1HNI B;  2P8I A;  1H6K X;  3SZ2 A;  4BCA A;  3BV8 A;  4NRU A;  4DPU A;  5C42 B;  1SUQ B;  4LJM A;  5HLF A;  1IQT A;  3VQT A;  1FER A;  2LXF A;  4PYD A;  2DGX A;  3JSM B;  3EZ5 A;  2LQ9 A;  3ET6 B;  4LF7 F;  1XR7 A;  3H8Y A;  2DYA A;  2HND A;  3M2R B;  2V6A A;  2XY7 A;  1D8Y A;  4EK2 A;  5L9X A;  2MSS A;  3TA1 A;  1QM9 A;  5KFD A;  1G1X A;  3GII A;  2LXU A;  4DU7 A;  4IRD A;  4YHH J;  1HQE B;  1ZOT A;  3HKW A;  3A8K A;  4QIG A;  4OI3 A;  5DZ6 A;  2QLX A;  1JLC A;  1U1O A;  2HVI A;  5LL6 d;  5KFB A;  2HEK A;  5HMX A;  3EUN A;  3K5L A;  5IZH A;  4WFZ A;  4TQS A;  2FD2 A;  1HHT P;  2MHN A;  4AT1 B;  3DRS B;  3HD2 A;  4CM2 A;  2E5I A;  4OZL A;  1D9D A;  2GO9 A;  1S4E A;  4B17 A;  1WNE A;  3MMC A;  1AUS L;  4YDD B;  3Q8U A;  2ZH2 A;  1RAJ A;  3QT7 A;  1JQG A;  2XYH B;  3RB6 A;  1YJR A;  1S6Q A;  1JLA A;  3W2W B;  1GFW B;  3V4I A;  2DH8 A;  4OI4 A;  4FPR A;  4CM0 A;  4ZLP A;  1TZ0 A;  1QUP A;  3B54 A;  2RS2 A;  4C3M A;  1WG5 A;  4K2X A;  4PG7 A;  1TL3 B;  4F7V A;  2P9E A;  2MST A;  3MPV A;  1T95 A;  1TKX A;  2C3P A;  1NK5 A;  1PO6 A;  3MDF A;  3V6H A;  2R4F A;  4Q2L A;  1FF2 A;  2QTW A;  4W98 A;  2K3I A;  3R9L A;  1NJI T;  4TVA B;  1SPB P;  1AYE A;  1LKZ A;  4PQU A;  1Q79 A;  2R42 A;  2HK2 A;  3IR7 B;  3TAM B;  1WEZ A;  3HPO A;  3I4H X;  2G0I A;  2RQK A;  2V94 A;  1SV5 A;  2KJW A;  3DOK B;  4D3H A;  2AJ4 A;  2HHP A;  2NPF A;  2F7V A;  3G87 A;  3QWU A;  4B3R J;  2CZ9 A;  4LIR A;  4ZCK A;  3V6D A;  4B02 A;  3KLE B;  1NSQ A;  3DLB A;  5E3C A;  1FK9 A;  1S6P A;  1CS4 B;  2AWZ A;  4KE5 A;  1HWJ A;  2HHH F;  2HVE A;  2I38 A;  1M90 T;  2BEF A;  1WOP A;  2DTJ A;  1RT3 A;  4DBQ A;  1IM6 A;  1RLD A;  2FJA B;  4R0E A;  3SQO P;  3SIP B;  1OQ6 A;  1BE4 A;  4OIX A;  4LFA J;  3C16 A;  2W25 A;  1YIT S;  5FDL A;  3WQP A;  4NLD A;  2XUL A;  4DOZ A;  1IJF B;  2DNO A;  2JVO A;  4FXW A;  1VIX A;  5B08 A;  2YTC A;  3UPF A;  2QMX A;  2MKY A;  1IR2 A;  1IXK A;  2IJR A;  2M52 A;  3I0R A;  5KT3 A;  2KVQ E;  4C8O A;  1VYA A;  4M5D B;  2HKE A;  3US5 A;  3JS9 A;  3C14 A;  1KON A;  3KLG A;  3OXL A;  3R5D A;  2XB2 D;  3QT8 A;  4IO1 A;  2XWY A;  4ED8 A;  3E51 A;  2UUA F;  5C25 B;  1QTM A;  1VRQ C;  4ANC A;  2HHQ A;  2YVS A;  3RBX A;  4W4M A;  1QY7 A;  4FKY A;  1QAJ A;  4OJ3 A;  3CDU A;  3VTI A;  3AXK A;  3VGT A;  1TMJ A;  4OJ1 A;  2C3Y A;  2LEP A;  1JLQ A;  3AD9 C;  1CC7 A;  3TRG A;  2V63 A;  4MMO A;  1RAI B;  3G8S A;  2VON A;  3MFH A;  3PO4 A;  2ZHA A;  3R1H A;  3N6M A;  1N33 F;  3BEG B;  5K8O A;  2EWH A;  3PJ9 A;  1VQ5 S;  3I55 S;  3A3N B;  4UTG A;  3W62 A;  1K1Q A;  4ZPD A;  4ICL B;  4X64 J;  1CEZ A;  3UD3 P;  1R31 A;  1QSS A;  3KG4 A;  1FNX H;  2GIQ A;  1HAR A;  3HSG A;  2DIT A;  3ELH A;  5A0Y B;  4DR6 F;  4IRK A;  2MEW A;  3CXC R;  2OKQ A;  2Y1L B;  1JKH B;  3SFG A;  2EI5 A;  2WSF C;  2B9E A;  3W7B A;  2W1B A;  1UWB A;  2HS4 A;  3R1L A;  3BO3 A;  1LWE A;  1DLO A;  2MQ8 A;  1W25 A;  3GPA A;  4LSZ B;  2VQF F;  5J1P A;  1WTF A;  1B0P A;  3U1M A;  1HHS A;  2H5J B;  3MFI A;  4QWA A;  5EWE A;  1XMQ J;  4JI3 J;  2CQ4 A;  4QOT A;  2DNY A;  1NBE B;  2XZT B;  1Q8B A;  4JI1 F;  2HRT A;  2FHM A;  2V4J A;  1VQ4 S;  1I94 F;  2FQQ B;  2W2Q P;  2FJV A;  3UDE A;  4CYU B;  4DLG A;  4P6Q A;  2QLB B;  1TU0 B;  2J7W A;  1R7I A;  2G9O A;  2HK3 A;  4TLR A;  3JSR A;  4DQR A;  2HNY A;  4KGK A;  1YJU A;  4ITS A;  4NXM F;  3TAN A;  2V9W A;  3MMB A;  2J9E A;  2DRB A;  2CG8 A;  2HNZ B;  1HNI A;  3BSO A;  3GQC A;  3D6F B;  3GFY A;  1MMD A;  5FJ4 A;  4ZN3 A;  2B7C B;  3OLA A;  4OI0 A;  2GJF A;  5HAT A;  2PSZ A;  2QL7 B;  5C42 A;  1SUQ A;  3FFI B;  1HI1 A;  1R8P A;  1EX8 A;  3JSM A;  4JI5 J;  1FXL A;  3ET6 A;  2HHS A;  4DU8 A;  3BBB A;  1T9T A;  3QFW A;  2F3J A;  3SFU A;  3KHH A;  4MFB B;  2YNI B;  2WZ1 A;  4OI1 A;  2M8H A;  3N79 A;  5F8L A;  2FLO A;  2KHC A;  3JTO A;  2V8V A;  1RTI A;  1JMT A;  2JHE A;  2CJ9 A;  1HQE A;  2KFY A;  4B3M F;  3QGP A;  2RHQ B;  3VAJ A;  4NLV A;  1KDN A;  4B3S F;  3IP0 A;  1M5O C;  1WSR A;  2GQQ A;  2VG6 B;  5CYM B;  5GAD U;  3NMA A;  5E0O A;  2G4B A;  2RDD A;  5EUH A;  2VBW A;  2KG1 A;  4RX6 A;  4U7C A;  2FZC B;  5L39 A;  4IH7 A;  3D0I E;  4NXN J;  1AT1 B;  3IXQ A;  2D9O A;  2EG1 A;  2JEF A;  1UZH A;  5BYR A;  2P6T A;  1RT4 B;  4DUY F;  4RJV A;  4USV A;  3M4X A;  1OPZ A;  3W2W A;  4L74 A;  1FJC A;  3HCX A;  4YY3 J;  4CO2 A;  2ZBQ A;  4C4W A;  4P10 A;  1NK7 A;  1TL3 A;  1VLY A;  3CD6 S;  2AEJ A;  3SDE B;  1T05 B;  2J0Q D;  2XBP A;  4WII A;  2XGP A;  2C3U A;  2J6S A;  2G13 A;  4ED7 A;  4FBU A;  1ICE B;  3BGF A;  5KFF A;  3NBP B;  2L08 A;  3N9U C;  4BWM A;  4K4Y A;  2PDA A;  3CJQ A;  3MAA B;  3TAM A;  3W3S A;  3MM5 A;  3T3F A;  4ZVO B;  1JXV A;  1VQP S;  3DOK A;  4Y65 A;  4OYZ A;  1ELO A;  1XTZ A;  2NXE A;  3HLU A;  2DRD A;  3KK2 B;  4DV4 F;  1WI8 A;  1FDA A;  2XQC A;  3KLE A;  1UEU A;  1Y10 A;  1UA1 A;  2ILZ A;  4QU7 A;  3FRZ A;  3QSI A;  2DNM A;  1CS4 A;  5J2Q A;  3BGL A;  2R2U A;  1HI8 A;  2CVE A;  3EPG A;  2BE9 B;  2J76 E;  1S9E B;  4ED5 A;  1ZTT A;  4B9M A;  2ADB A;  2BAB A;  3IM9 A;  4KV8 B;  3MR3 A;  1D09 B;  1WKL A;  4JV5 F;  3AAW B;  1NH7 A;  4NOH A;  1X4B A;  3JXO A;  1WOS A;  4XPC A;  1RAC B;  4XDC A;  3CJ2 A;  2W4D A;  3T41 A;  1C2P A;  1KP6 A;  3HMJ G;  1IJE B;  2HRY A;  2NS1 B;  4A48 A;  1L3U A;  4N76 A;  4IDK B;  1Y5N B;  4NLX A;  3TZW A;  4KKO B;  1PCA A;  1RK8 A;  5F9L A;  5T7L A;  2QG9 B;  5E3R A;  5A76 A;  3FQL A;  3HHL B;  3B82 A;  2YWK A;  1KD1 T;  2ZD1 B;  4Z37 A;  2H4Y B;  3MCM A;  3JTP A;  1G6B A;  4ECZ A;  1EET B;  4I2Q B;  3HI9 A;  1ZET A;  5L1J A;  3OXF A;  2B43 A;  4KPY A;  4DCO B;  3NGD A;  1KLN A;  1Q0N A;  1KHW A;  3DCA A;  4O4G B;  5ETL A;  4Y00 A;  3K8V A;  4LFC F;  2JLE A;  3GJS B;  4BS2 A;  2CPE A;  3PM9 A;  4NEY A;  2UV8 G;  2WB1 D;  1BC6 A;  4DUZ J;  3BKF A;  3QFH A;  4N41 A;  1RU2 A;  1A7G E;  3IWL A;  2I9S A;  4PG8 A;  2D69 A;  2P2C B;  3HX9 A;  3UNG C;  4ICL A;  2V67 A;  4PXB A;  3RAX A;  4DL6 A;  1PAU B;  4CH7 A;  1EJ7 L;  2Q43 A;  3O5T B;  3NNH A;  2ZH5 A;  5M2R A;  1FFS B;  5A0Y A;  2RU9 A;  4DN9 A;  3RB3 A;  4LRC A;  1JKH A;  3UI3 A;  4ES2 A;  3KLV A;  4PXE A;  4X4R A;  3W60 A;  3LGN A;  4MT1 A;  2ZWP A;  2HHH J;  5T41 A;  3VAG A;  2DY1 A;  2EXU A;  3FMW A;  4EWT A;  2QSF A;  4CLS A;  4RLE A;  5HVF A;  4CRJ A;  2BKN A;  4NCG B;  5F41 A;  3DDI A;  1T9V A;  5AXM A;  2HVD A;  2VU5 A;  3VGV A;  1ULR A;  1A0O B;  4EFA C;  5KG4 A;  4PAA A;  4NCA A;  2Y0S D;  3ISZ A;  5AE1 A;  2K7J A;  1HMV B;  4CO0 A;  1RAD B;  2DNK A;  2B0G A;  2K8G A;  2WOM A;  3C19 A;  4LF6 F;  1SJR A;  3NEK A;  2LQ8 A;  3TVZ A;  3PRV A;  3UN2 A;  3DI6 B;  3EGZ A;  3PG9 A;  3OTO F;  2AEM A;  4CZC A;  2ZDP A;  2DH9 A;  3UR0 A;  3KUH A;  3EJM A;  1N56 A;  4IQM A;  3ZZY A;  1HWI A;  4F50 A;  2MPU A;  1NJZ A;  3MMA B;  3R2D J;  3M9O B;  1UA0 A;  2IJN A;  1LNQ A;  2FDN A;  5CD4 H;  3U7J A;  5F8G A;  2A6M A;  4OFZ A;  5GAH I;  3FFI A;  4AD6 A;  2B3T B;  1VQ7 S;  4HDH A;  3CJ3 A;  2M3D A;  4HI1 A;  3GV8 B;  1WOO A;  2ZBP A;  1HYS B;  3PO5 A;  2G2Y A;  2KB2 A;  2IBO A;  4YR3 A;  4HEA 9;  5GAH U;  2JOQ A;  2ZC3 A;  3HVT B;  3H5X A;  3SV3 A;  4MFB A;  3Q2T C;  3MED B;  1N33 J;  5CH7 B;  4URS A;  3CSK A;  3GWC A;  3BGR B;  2PE8 A;  4DR7 F;  4LT6 A;  2YBV A;  2C3M A;  1GMU A;  4PAB A;  4RNM A;  2BRL A;  1EIY B;  1NB7 A;  2Z56 B;  4DV6 J;  3GFX A;  4CWB A;  5F8J A;  1JIH A;  1FNM A;  2RIL A;  4I68 A;  4RNN A;  3OL7 A;  3Q8V A;  1C4A A;  3ETM A;  4KR0 B;  2BYC A;  3I32 A;  2Y1I A;  1YRX A;  3N0V A;  1NPR A;  5KTQ A;  1VQ9 S;  2HBQ B;  4TLQ A;  5DDQ C;  2OGU A;  4KC5 A;  5FD1 A;  1RT4 A;  3T5L A;  5LMU F;  2DR5 A;  3AA8 A;  1K1S A;  5E3Q A;  2FJB B;  5AJ3 J;  4EBD A;  4PEO A;  4JP8 A;  3RB4 A;  4MK7 A;  2DIU A;  2VPW B;  3SDE A;  1I94 J;  1T05 A;  1XN9 A;  5T14 A;  1JX4 A;  2HQF A;  1A6L A;  2B9X A;  5B09 A;  2MGZ B;  5DGA A;  4PZV A;  4ZCI A;  2N82 B;  3N01 A;  1RWN B;  4NXM J;  4RW4 B;  4F3O A;  3MAA A;  2EFN A;  3J7Y I;  1HD0 A;  4E0D A;  4RPF A;  4AND A;  4N47 A;  4FF3 A;  4HKQ A;  2Y3Y A;  4U96 A;  1U8W A;  4MKY A;  3RBZ A;  4JI7 J;  3GCW P;  3J7Y U;  4ED1 A;  2A10 A;  2PD1 A;  1RQ0 A;  4TY9 A;  2E66 A;  9ATC B;  3KK2 A;  4LR9 A;  3DYA B;  2KTQ A;  3HD1 A;  2PN6 A;  2XM3 A;  5DDO C;  1KOO A;  3U1L A;  5IT9 U;  3MD1 A;  1YBT A;  2IRY A;  3EYZ A;  2NXU A;  3LAN A;  3GLJ A;  3M8R A;  1K47 A;  1PIL A;  4DX5 A;  3D6H B;  2Q3P A;  1JXE A;  2J9C A;  4YR2 A;  1S9E A;  4WU3 A;  1FX4 A;  1Q7L B;  5DLF A;  2RUS A;  2YH0 A;  3TQ1 A;  4KY3 A;  1DY3 A;  3QGI A;  3MGJ A;  4B3M J;  4KV8 A;  1BHN A;  4DJB A;  4Y6I A;  1O6X A;  3WX4 A;  2QL9 B;  3W61 A;  4WE1 B;  4B3S J;  5L8R C;  3KOA A;  5IT9 Y;  2DXD A;  2V9K A;  3TJ8 A;  3CC2 S;  2EFV A;  4X62 J;  4OX8 A;  1Q4R A;  3GE9 A;  1TQL A;  5F0W A;  4ZK7 M;  1YLX A;  2ZWO A;  5H9E J;  3D54 A;  3AOC A;  4WK1 A;  5KG0 A;  2XYG B;  4ZOS A;  3KK1 A;  3H25 A;  3HHL A;  4DZ6 A;  4QCL A;  5JVH Q;  3R5J B;  4HHU A;  4ECT A;  2LFV A;  1IBM F;  1EET A;  4I2Q A;  4QYZ K;  3I96 A;  5IWA F;  1QAI A;  3MEC B;  2GX8 A;  3DRR B;  1XR6 A;  1GMW A;  1BWE A;  2MXY A;  3K5P A;  4LBH A;  4O4G A;  3DU5 A;  2CPI A;  1BMQ B;  3W63 A;  1TKZ B;  2DO4 A;  1X5O A;  4USU A;  3E01 B;  4A46 A;  2YKP A;  3T6B A;  3DM2 B;  2QA4 G;  1NAQ A;  5LSR A;  1Z2Z A;  4B08 A;  4DQQ A;  3B78 A;  2OPQ A;  4USI A;  5C7P A;  2HSE B;  2C2K B;  3CB4 A;  3JSY A;  5BYQ A;  1UVI A;  2UVW A;  2QC3 A;  1FRJ A;  1TTH B;  4JV1 A;  4R8U A;  4CLY A;  2EK6 A;  5H9F J;  5DQH A;  3JYT B;  4KRW A;  2LQB A;  3J7Z 5;  2R2T A;  2KI2 A;  3NCP A;  3R7B B;  2B6A A;  3GIM A;  4OL8 A;  1GAO A;  4WFX A;  5KG2 A;  4KPC A;  3QRQ A;  1VBY A;  2KO1 A;  3LWM A;  1G7C B;  3DN9 A;  4NCG A;  3NP5 A;  3AD8 C;  2W2N P;  3QJP A;  2PA3 A;  4C3L A;  3KLF B;  4M5H A;  3C6T B;  4IFY A;  4NLO A;  1L3T A;  3MF5 A;  2BE2 A;  2M0G B;  4MAK A;  5LM7 E;  3ZZO A;  2K1R B;  1SVD A;  1WDD A;  1HMV A;  2E29 A;  3OUY B;  3ENA A;  2IAJ B;  3QAE A;  2HIQ A;  4WZM A;  4I6A A;  3KLI A;  4C8K A;  3HFK A;  4Q2M A;  4C98 A;  4OYX A;  3DOM A;  2DCU B;  1KN6 A;  2YKN B;  3LAK A;  3M8Z A;  1SBR A;  4MK9 A;  2R7O A;  3TP2 A;  2E5J A;  3MMA A;  3GIK A;  1TKT B;  3HHK A;  3RUB L;  2BXJ A;  3RBE A;  2G1D A;  3PW0 A;  3HO1 A;  3IN5 A;  2M5Y A;  5CCL A;  4CTA B;  4UQG A;  1HYS A;  1IKV B;  1V6H A;  2J9D A;  4ZVS B;  1NKC A;  4RW8 B;  4I1T A;  1D0E A;  2POK A;  3HVT A;  1RAH B;  4R0J A;  1YIJ S;  4CLP A;  2QGF B;  3P6Y C;  2LDI A;  5LXR A;  4Y2C A;  2Y8Y A;  2B7B B;  1X4G A;  1I5O B;  4R5P B;  2VPZ B;  1REG X;  2N7C A;  5MLC V;  5EWG A;  4NLS A;  3BGR A;  1VI7 A;  3JB9 k;  4HHH A;  1LK5 A;  1U48 A;  4Q45 A;  1FD2 A;  2C2D A;  1Q8K A;  1RJJ A;  3V4M A;  1SL1 A;  1FTR A;  1TL1 B;  5KFM A;  4MKV A;  3A4T A;  4CLK A;  2GJI A;  2J9D E;  2DB1 A;  3QIP A;  2BZ2 A;  4U95 A;  4LF2 A;  3KWM A;  1DBD A;  1N4L A;  2NCK L;  4A8M P;  2RE1 A;  1J2V A;  3CC7 S;  4IOB A;  1XMO J;  1CSJ A;  2OEK A;  1WC5 A;  1OO0 B;  4PWD B;  3FBF A;  1UTA A;  2EKY A;  1UW9 A;  3W5X A;  1WTB A;  2BX6 A;  2R8J A;  4X4S A;  3JAM U;  2CJQ A;  1YVF A;  3H7H B;  2QV6 A;  5ETO A;  3VVU A;  1H7W A;  3TVK A;  3R5A A;  3KHG A;  2V2Z A;  2DHG A;  4TYA A;  1S6U A;  5F0U A;  2ZUA A;  2MKI A;  3GJR B;  3R3T A;  3PZP A;  3HVA A;  2M7S A;  4OYI A;  3M8P A;  4FN5 A;  2GMH A;  4LF5 F;  2KT3 A;  1CQN A;  3OVS A;  1FJ7 A;  1S7I A;  4PR6 A;  2OPR B;  3OTO J;  3JAM Y;  1WHW A;  3V6K A;  3QAT A;  4P2S A;  1QSL A;  2VOP A;  4P72 A;  4A8Q A;  4AQY J;  4WIQ A;  1SI9 A;  2ZVI A;  4HTI A;  4OLO A;  1MN7 A;  4DPY A;  3DYA A;  3SEO A;  1VS3 A;  1IVZ A;  3K57 A;  3H40 A;  1VC0 A;  4I2P A;  2HWI A;  5HMW A;  4K4W A;  1B0V A;  3M32 B;  5AT1 B;  4RWW A;  4MH8 A;  4CO5 A;  5KFV A;  2WBR A;  1NDC A;  2FYX A;  1RAB B;  2LEC A;  4HH0 A;  5GAE I;  3KK3 B;  1LK7 A;  1NXI A;  4DF8 A;  2CNL B;  4WE1 A;  1KR4 A;  1HR0 F;  3KDO A;  5GAE U;  1JJ2 R;  1YWX A;  4CI0 B;  1HW9 A;  3G71 S;  2J8A A;  4ETZ A;  1TK5 A;  4CLL A;  4ZVH A;  1RUS A;  4AXI A;  4EO6 A;  1S97 A;  1WEL A;  1CUL A;  4RU9 A;  1YX2 A;  3UW1 A;  2Y1J A;  2MQN A;  1NDK A;  2GW8 A;  3I5C A;  1C1C B;  5LMU J;  4PXC A;  1S9G A;  3LH2 S;  4K4V A;  7FDR A;  1MWQ A;  4DV7 F;  2F9J A;  5GME A;  2E9R X;  4ENO A;  3MEC A;  2VJU A;  2XLK A;  3EIC A;  3DRR A;  2FZK B;  1EHW A;  1RTD A;  2HIY A;  4QBU A;  4DR5 J;  5JMN A;  2DGV A;  1CBK A;  1TKZ A;  2YX4 A;  2LDY A;  1F5C A;  3PYD A;  1AZS B;  1U6Z A;  2EEY A;  2XS5 A;  2OPP B;  2BKP A;  4LVO P;  4FXV A;  3J7Z T;  4J9O A;  2VC1 A;  3BB5 A;  5C2G A;  3PYG A;  5HJX A;  4LQ9 A;  2W2P P;  1JLF B;  5JXS A;  4CLW A;  1NU4 A;  3Q0A A;  3O1L A;  4KFB B;  5I3P A;  5GVQ A;  1RZM A;  4WJB A;  3GJT B;  5KAK A;  2FC9 A;  1YGY A;  4USH A;  2VPX B;  4BWJ A;  3H5S A;  3C66 A;  4I67 A;  5LT5 A;  2DH7 A;  4JV0 A;  3NY0 A;  2I5J B;  4DV5 F;  1FES A;  1HL6 A;  2BOP A;  4FS1 A;  1I3O B;  3DU6 A;  4ALZ A;  5J2P B;  1JWW A;  2KZM A;  3D0H E;  2H9Z A;  3IR5 B;  4OQJ A;  3W9J A;  3H42 A;  5KFX A;  3ZFV A;  3NOC A;  4MIA A;  2KDO A;  2XS2 A;  4DSI A;  3NL0 A;  4PWW A;  2HYI B;  4ECX A;  3FEY B;  3R6L B;  1YJ7 A;  4EYI B;  3C6T A;  2ZOF A;  3RBD A;  2E1R A;  3SQG B;  1FKO B;  5CA5 A;  1KQG B;  2K1R A;  1SJF A;  2XMK A;  5IC6 B;  1S0V A;  1RT7 B;  1S1U A;  1RWM B;  1E6V B;  3NGK A;  2ZH9 A;  3OTD A;  9RUB A;  4DS5 A;  2HQC A;  3OUY A;  5D15 A;  2IAJ A;  3N5F A;  4IH6 A;  4JI4 F;  2JFK A;  4WYL A;  3MR5 A;  3ENW A;  2D3O R;  3GU0 A;  2YKN A;  3NGT A;  1K44 A;  3W5Y A;  3OFH A;  3ENQ A;  1TKT A;  4X84 A;  4PG4 A;  3VAM A;  2YWG A;  2WVF A;  2UUB J;  2LEA A;  2MLX A;  1IKV A;  1WEY A;  4RW8 A;  3TUZ C;  4CLT A;  4NYP A;  2HHU A;  1VR6 A;  1R8C A;  1NJY A;  1N6Q B;  3OR1 B;  1EB0 A;  1KC8 T;  1OS5 A;  4G1I A;  1FVQ A;  4UQT A;  4ZVT B;  5H9E K;  4R5P A;  1NM2 A;  1NB2 A;  4YB1 P;  4F0H A;  3CNQ P;  4X4U A;  3LP2 B;  1NPP A;  2RD5 C;  4QIF A;  3CT9 A;  2VG5 B;  5BR8 J;  2QSW A;  4K4T A;  3MXH P;  2GMJ A;  5DS7 A;  2LCW A;  3T1H J;  1RHR B;  4K59 A;  1T03 B;  2QFJ A;  2E5L J;  2GVD A;  3TJ9 A;  2V2V A;  3RJM B;  5L1L A;  3O44 A;  3KHL A;  4ZHR B;  4YHH F;  4DN0 A;  5A8R B;  1WF2 A;  2BR0 A;  3JTN A;  3SSS A;  3TX8 A;  4QR2 A;  3GR1 A;  1R8B A;  2GQC A;  4CT8 A;  2AKW B;  4DV0 J;  4A8K A;  4PWD A;  4M5I A;  3GMG A;  2MB0 B;  1FXR A;  2KT2 A;  2VUG A;  3ZXW A;  4J9R A;  2CZ4 A;  2K3K A;  2L48 A;  4MYT A;  3CCV S;  4ZPW R;  3AB4 B;  4QZV B;  3VV2 B;  2DGO A;  1X60 A;  3AA9 A;  1RWU A;  3H2V E;  2UVV A;  4NL5 A;  3Q2S C;  4OYO A;  2XMU A;  1UFL A;  1MG7 A;  3D5M A;  5HSP A;  1RT2 B;  2AZ1 A;  2YKO A;  3SSQ A;  4QW8 A;  4WKR A;  4OZJ A;  4B3O B;  1WWH A;  4U6P A;  2X1G A;  2F1F A;  3HFV A;  4ILR A;  3QAU A;  3L3C A;  1T9U A;  3J81 U;  1SC1 B;  1WC1 A;  1DTQ B;  2YH1 A;  3MM8 A;  3KNG A;  3KTQ A;  4O3P A;  3M2U B;  5E7O B;  2OPR A;  5A2Q U;  4IG0 B;  2AYM A;  4LF9 J;  5FII A;  2ZFH A;  1MW7 A;  5D4L A;  4RNO A;  2R8I A;  5A8W B;  3OL8 A;  1P6T A;  2RQC A;  3CMQ A;  1MN9 A;  1S12 A;  3RW7 A;  5M2U A;  4OZ1 A;  5HVH A;  2Z4P A;  2XI3 A;  4NPO A;  3M30 B;  2FVS A;  5KT4 A;  1T7P A;  4B3R F;  3M32 A;  7AT1 B;  3JSB A;  1YZ7 A;  5A2Q Y;  4U8Y A;  3BRE A;  3PW7 A;  4WFA Q;  4PPD A;  5J1N A;  2M70 A;  4K2J A;  4KHP F;  3W9H A;  2IDE A;  2RRA A;  4OJH A;  3FUY A;  2HZV A;  1Q81 T;  3K89 A;  4YN3 B;  3UWT A;  1NKE A;  3OFF A;  3C15 B;  5ETR A;  6FDR A;  3NWG A;  2VBX A;  2LYV A;  2DHS A;  2DR8 A;  2VKR A;  2UUC J;  5GAG I;  4UT4 A;  4LFA F;  2YNH B;  4OZ5 A;  2E9Z A;  2DPI A;  3RB0 A;  1RB0 A;  2FVP A;  4LF1 A;  2IVF B;  4H54 A;  1WF0 A;  1YRU A;  5GAG U;  5IV4 A;  4UOH A;  3ZZR A;  4ZVE A;  5KFS A;  2AQ4 A;  3H98 A;  1KQK A;  4U67 Q;  3OD2 A;  3JQM A;  5K14 B;  4CLF A;  3VCD A;  1FKP B;  1ZM4 A;  3OFE A;  3WX8 A;  1OYD A;  2CPY A;  3QT5 A;  1UPP A;  3H20 A;  4C8L A;  3LP0 B;  4K5S A;  1CJK A;  1UFW A;  4WKY A;  2OPP A;  4ED2 A;  1GNK A;  2AGP A;  4WCE Q;  3TAR A;  4X4Q A;  3MEK A;  2VC0 A;  2X51 A;  5JVG Q;  3POT B;  2DHA A;  2IJF A;  4C0O C;  1MLA A;  4KFB A;  3VAF A;  1GX6 A;  5J2N B;  3ILL A;  1TL7 A;  3GIR A;  1JLB B;  2C2M B;  2VH7 A;  5AE3 A;  4DQS A;  1HBN B;  3RYL A;  3HSD A;  4J5O A;  1MWY A;  5EWF A;  1RYS A;  4LUB A;  2I5J A;  3CF5 Q;  4X64 F;  5J2P A;  1FD8 A;  1ACM B;  4JI0 J;  2NUU G;  3M7V A;  3C2P A;  2AZ3 A;  3PW5 A;  1XER A;  2EKN A;  4IFV B;  2BQ3 A;  4NLP A;  3F73 A;  4YME A;  3BO2 A;  2B56 A;  2EFQ A;  2RT3 A;  3SBM A;  3PAC A;  1RTH A;  3NGU A;  1DAX A;  3KJQ B;  2A6O A;  1VHF A;  1ZA1 B;  4UY8 5;  2Z2Z A;  3MUM P;  3H4D A;  4C3K A;  1CG2 A;  1VIS A;  3CCT A;  3SQG A;  1HR0 J;  2ZZN A;  2Z0G A;  2C28 A;  1FKO A;  4XTT A;  2OMO A;  4JI3 F;  4ILL A;  1DZ5 A;  2DK2 A;  1RT7 A;  1HNX F;  2OIH A;  2BW2 A;  1E6V A;  1X0P A;  3ITH B;  3AH6 A;  4LRE A;  2IHR 1;  4K50 A;  3QWP A;  2XG8 A;  3CJ5 A;  2ZBR A;  1XEZ A;  1R3N A;  1F2H A;  2G2O A;  3QJJ A;  4MK8 A;  1JNZ B;  1MNE A;  3I9V 9;  1FFG B;  3TUJ C;  3UDV A;  1OSD A;  4ZP8 A;  3DLL Q;  1IUJ A;  2VF3 A;  4WWS A;  3DLG B;  4LBP A;  4ZIV A;  2FHJ D;  1F9H A;  2D9P A;  3C6U B;  4O3Q A;  2VG7 B;  2CPX A;  3MHY A;  3EVM A;  3Q8P B;  3MWB A;  2CQD A;  1VBZ A;  3UO0 A;  2Z58 B;  2ZUG A;  3OLB A;  1H2U X;  3LW5 C;  5KFW A;  2AJ2 A;  2JVR A;  2I1R A;  5KFR A;  1N6Q A;  2A3J A;  2HLU A;  1JK9 B;  1UL3 A;  2XI2 A;  1U7L A;  5KFH A;  3IR6 B;  1TK8 A;  1HBU B;  2DT9 A;  2NZ4 A;  1FCA A;  2WAQ D;  4GO5 X;  2BQR A;  4JI5 F;  4DV1 J;  1X9S A;  1QSY A;  2QA4 S;  4ZP6 A;  3P4U B;  2EBG A;  1RWV B;  2RQ4 A;  3K17 A;  3ICL A;  1S1T B;  3K5N A;  1T03 A;  5DLG A;  1VLO A;  4MKB A;  5EHH A;  4NZ6 A;  2CJY B;  4FYW B;  1FRM A;  3NXZ A;  1NJX A;  2O66 A;  2B51 A;  4DUT A;  2PI4 A;  1LXJ A;  3M1V B;  2ILY A;  4ZP7 A;  2XHW A;  2OML A;  4PKD B;  2KRB A;  4FPI A;  1NDL A;  4FYD A;  5ETT A;  3DLH A;  1C0T B;  1AXQ A;  3HT0 A;  3E8O A;  2CA9 A;  2NR0 A;  1U6F A;  1EP4 B;  1FRX A;  3IGN A;  4Z2X A;  2W7A A;  1G2E A;  4RNF A;  1OYE A;  1VRT B;  3VF0 B;  4X4T A;  3NRB A;  4MKA A;  1IWG A;  1P1T A;  1H72 C;  1CJU A;  2MY8 A;  4IH5 A;  2I0X A;  2ADC A;  5ETP A;  1RT2 A;  3M6W A;  5F3T A;  2VDI A;  3GB0 A;  1RHK B;  1MU2 B;  3CDB A;  5EX3 A;  4B3O A;  5AXN A;  1P27 B;  1DAR A;  3TNV A;  2BVZ A;  4OJG A;  2FZG B;  4S0M A;  1NHU A;  4YY3 F;  1DTQ A;  4IRC A;  3PR5 B;  3AJ2 A;  5HMZ A;  1Q7Y T;  3HSZ A;  3T1Y J;  3LTO A;  2RKI A;  4FBT A;  3M2U A;  1QVG R;  4IG0 A;  1YBU A;  2CPZ A;  1U1N A;  1AB8 A;  5KG6 A;  1P8G A;  4P2M A;  1RWX B;  2H3E B;  3ENV A;  4ZCM A;  3Q22 A;  4A8O A;  3OSP A;  3IM8 A;  4FXD A;  2AJ0 A;  1HNW F;  2UVU A;  4WBF A;  2OLW A;  1Z1Z A;  5SZT A;  2M2B A;  2W9A A;  5D0G A;  4KGM A;  5ETS A;  1S79 A;  2HVZ A;  3S01 A;  3BN4 A;  3FSI A;  1J27 A;  1FI4 A;  4OHX A;  3M30 A;  5D6G A;  5HN0 A;  3DRY A;  3Q86 A;  1DFD A;  3TZX A;  3QZ7 A;  2W7P A;  2W9C B;  3NMR A;  3MMJ A;  2VOO A;  3VWS A;  4JI2 F;  2VOD A;  2R3V A;  1ZM2 A;  2IVY A;  1SIW B;  2IC3 B;  3UE2 A;  4EBE A;  2OI2 A;  5A8K A;  1U49 A;  1F5A A;  4ZLL A;  1UAW A;  1R0C B;  5FLX U;  3C15 A;  5JJB A;  1IKX B;  3CWJ A;  2F40 A;  3AOB A;  4DSF A;  4LR8 A;  3G8Q A;  3O8W A;  2G0C A;  1DHM A;  2AJ1 A;  3ZTQ A;  2YNH A;  2Y8W A;  4UUX A;  2JEJ A;  5IQQ A;  4G6V B;  3OR2 A;  4ZS6 A;  5DQI A;  2ROE A;  4JI6 J;  1F3V A;  2HGM A;  2LVW A;  3PYE A;  2JZ5 A;  1F1B B;  2UXD F;  2DD8 S;  1OQ3 A;  2OH2 A;  5FLX Y;  3L7O A;  3KLH B;  5K14 A;  3PW2 A;  1FKP A;  1OY8 A;  4RUH A;  1NK4 A;  1LWF B;  2ATL A;  2RF2 A;  2C2E A;  1N34 J;  3IMQ J;  1RT5 B;  2EFP A;  1NEE A;  4EGL A;  4ECU A;  3W64 A;  1URR A;  3QNW B;  3CCQ S;  4WTY A;  1F5B A;  4F67 A;  1P9Y A;  3FDS A;  3OL9 A;  4DDF A;  3HZE A;  2Q66 A;  2YY3 A;  1MRO B;  4OI2 A;  1S6O A;  1E6Y B;  3POT A;  2VL1 A;  2KL8 A;  1FWK A;  1RTJ A;  4UUW A;  1BD6 A;  1W2B R;  5J2N A;  3K2Y A;  1LWC B;  1FO1 A;  4DUZ F;  1U0H B;  4GKJ F;  3DHW C;  3MEE B;  1VRU A;  3PFO A;  1JLB A;  2AU0 A;  4Y3C A;  2FJW A;  2UXB J;  1HBN A;  1NLK L;  1RAG B;  2KXF A;  4A47 A;  2BBE A;  4UY8 T;  3I5B A;  4FDF A;  4GKK J;  3OBI A;  2ZH1 A;  1UVK A;  3M8W A;  3OPK A;  4CT9 A;  4H4M A;  2XYP B;  4WYW A;  2A2C A;  4IFV A;  1AA1 B;  5F8N A;  2O5D A;  3QQC D;  5KT2 A;  4FF2 A;  1U0S A;  4DL4 A;  4KHP J;  3AQO A;  2JWN A;  2F63 A;  2OD4 A;  2AYB A;  2R2R A;  3H4B A;  4L3N A;  3V2U C;  1RA6 A;  5KFK A;  1RA7 A;  1REV A;  1N52 B;  5B0A A;  4CDI A;  5J2M B;  5BJR A;  3NS6 A;  3C3L A;  2HZC A;  1M1H A;  4WP9 A;  2MZS A;  5CYQ B;  4JV2 A;  5D0E A;  2GML A;  4ERD A;  4F25 A;  4HR2 A;  3CCL S;  3ITH A;  3NLC A;  2Y0B B;  3L4B C;  4ELV A;  4H4O B;  1PKU A;  3LAL A;  2DHX A;  5I42 B;  4U7U K;  4DX8 H;  1C0U B;  4DEZ A;  5L1I A;  4O23 A;  4MJK A;  4X2B A;  4NLY A;  3I5A A;  3EVO A;  1N36 J;  3HJF A;  3TUP A;  4CH1 A;  3C6U A;  1V9O A;  3UN3 A;  3IG1 B;  2VG7 A;  3NCR A;  3DXB A;  4L6V 3;  1YSJ A;  1IR0 A;  1QLN A;  4QW9 A;  3EGN A;  2PEB A;  1JLE B;  2J0X A;  4NYZ A;  4DPX A;  3BR9 A;  2IRU A;  1ZTW A;  1XBW A;  2FVQ A;  3GYG A;  4KBI A;  3HDS A;  2BJ9 A;  4LF8 J;  2OUG A;  4G1Q B;  4C48 A;  3DKD A;  3BJY A;  2CQ2 A;  2HHV A;  3QRR A;  2KFN A;  4F04 B;  2IDL A;  1HBU A;  2QX0 A;  2C2R A;  3BGU A;  3HHL C;  2ASJ A;  2YKM B;  2GVZ B;  2XZW A;  4M5J A;  4DV3 F;  2CVI A;  2DNH A;  1FRL A;  4Q8E A;  2OFH X;  3GG1 A;  3W5Z A;  5F8M A;  1WUU A;  2Z2L A;  8AT1 B;  1F9F A;  2MHE A;  1KRP A;  3FC9 A;  1FRH A;  4TKT A;  3TAQ A;  1S1W B;  1WJ9 A;  2OP5 A;  2GAG C;  4J90 A;  1N5S A;  1Z2L A;  3JQK A;  4Y34 A;  3R5B A;  2DRA A;  5EGY A;  1EQ0 A;  1Q86 T;  3M1V A;  3NGR A;  3LP1 B;  2WBM A;  3MR7 A;  1S9F A;  2OEL A;  4DV6 F;  1U45 A;  1C0T A;  4RNH A;  4USJ C;  1WF1 A;  4UOF A;  3DFE A;  2CQI A;  4OZN A;  1S49 A;  2RML A;  2BM1 A;  2Z30 B;  2WSC C;  3AJD A;  2DNL A;  2QYG A;  5KFN A;  1VRT A;  2DBB A;  2IRX A;  2V8D A;  2C2Z B;  1H98 A;  1FVS A;  1Y5L B;  1PYS B;  2RS8 A;  2BKO A;  2HS3 A;  4CO1 A;  2BW7 A;  1MU2 A;  1NSP A;  2XY5 A;  3THV A;  1HNX J;  5AJ3 F;  3IGV A;  2ZZM A;  1KVJ A;  3MOJ B;  2FLP A;  1YJW S;  3MZI A;  2BQU A;  4YB6 A;  4FVC A;  5IC4 B;  1QE1 B;  5IM0 A;  1ZPV A;  4JUZ A;  2G1H A;  1U02 A;  4M5N A;  5B7W A;  1H0H B;  1X7V A;  2B4V A;  1J5E F;  3PVX A;  2CFX A;  2V4Q A;  5ETM A;  2OEJ A;  1RCX B;  3WDO A;  1Q95 G;  2VA2 A;  2UVR A;  1NJW A;  4NA1 A;  2CPD A;  3EXC X;  2BA9 A;  1I6J A;  2AHO B;  1LFW A;  3F0N A;  2OSQ A;  3GFZ A;  4M5K A;  1F3F A;  2GAH C;  2L9N A;  4JI7 F;  3GIJ A;  4NLT A;  2HFS A;  2W9C A;  1YJ9 S;  1SQE A;  4FKX A;  3KYL A;  4X66 J;  2XNQ A;  1VOM A;  4DV2 J;  4DSJ A;  2IC3 A;  2BJ7 A;  4QWE A;  1CVJ A;  1VQY A;  4KGV B;  4NLR A;  3CIZ A;  4ID5 B;  2FY1 A;  1IKX A;  3M2R A;  3N6L A;  3KDN A;  4QWC A;  2ASY A;  2CNK B;  1FXD A;  2V5H G;  1B64 A;  1N88 A;  4QIW D;  1TR0 A;  3CJ0 A;  2KM8 C;  1SH0 A;  3DRX A;  3H0P A;  3BN7 A;  1HNV B;  3TI0 A;  4YS2 A;  1U1K A;  4HHJ A;  4QYZ J;  3W66 A;  2D3O 1;  4C9D A;  4DL2 A;  3TA0 A;  1IBL F;  2DO0 A;  2R7X A;  3OQ2 A;  1HQ2 A;  4XDD A;  1VHI A;  3TX0 A;  4M5L A;  2HFZ A;  1SJQ A;  5MAO A;  4FVM A;  4ZVF A;  3KLH A;  4OYP A;  3FEZ A;  4X62 F;  3AHP A;  3BH6 B;  3DRS A;  1XR5 A;  4ZPC A;  3OJS A;  2F4F A;  3P8B B;  2N4C A;  1FX2 A;  5I3U B;  1RT5 A;  5HL7 Q;  1TEL A;  5H1S V;  2ZJP Q;  3A3P B;  4ZPA A;  2KFZ A;  3NS5 A;  4WK3 A;  4WPA A;  4ZVU B;  4ZJO A;  2L41 A;  5DG9 A;  1X4E A;  2NRE A;  4HTJ A;  4A4J A;  4X4N A;  1JNR B;  2MJU A;  3MCS A;  4P74 A;  1E6Y A;  5KFC A;  4CLU A;  4ZVQ B;  2HVH A;  1U8S A;  1X5T A;  2FUG 9;  2FJX A;  4Z7C A;  2CXE A;  4J9K A;  1S4F A;  4G65 A;  4AL7 A;  1LWC A;  1U0H A;  3MEE A;  3PV8 A;  2WVB A;  4GMK A;  4HLB A;  5AXK A;  1HNW J;  1GXU A;  3DRP B;  3IAS 9;  2BDP A;  1VQN S;  1FDB A;  2XWX A;  3A13 A;  4I6Y A;  4A8X A;  3TVY A;  4AXJ A;  1OSC A;  2GCF A;  4C8Y A;  3M05 A;  4DR1 F;  4H4K A;  2WVC A;  2J6U A;  4JI2 J;  1FDN A;  2JFD A;  3L7U A;  3FJ2 A;  1NRK A;  1TUV A;  2HWT A;  4CH0 S;  5HP1 B;  4YB5 A;  1VQ6 S;  2DNP A;  3UNY A;  2DGW A;  2MZ1 A;  2MKJ A;  1F0X A;  5E41 A;  5J2M A;  2YWE A;  4OMF G;  2CUY A;  2QA1 A;  2WW8 A;  2NXJ A;  5CYQ A;  2C3O A;  3IS9 B;  5CAB A;  1NK9 A;  4OZ2 A;  3SYZ A;  1UCN A;  3HHN B;  1RAF B;  1B70 B;  1VBX A;  3I31 A;  3V5R A;  2VBY A;  2GGP B;  1PG5 B;  3N5B A;  1C0U A;  5CCM A;  3V6D B;  3AB2 B;  4EUV A;  2UXD J;  1PC4 A;  2ATC B;  5KOX A;  3D3B J;  4KHR A;  4M5D A;  1FK9 B;  1FJG F;  1QAX A;  2IFX A;  1S6P B;  3CED A;  2CQ1 A;  3M9N B;  4KAI A;  3IG1 A;  4N7T A;  4ZP9 A;  2CQH A;  2QRR A;  1IN0 A;  4J91 A;  1RIS A;  4E98 A;  1TKD A;  2DGT A;  4V1A k;  2CJK A;  4G1P A;  2CQP A;  2KXH A;  2ZHB A;  1RAE B;  2ZH3 A;  5C25 A;  4M94 A;  3UFC X;  4G1Q A;  4C97 A;  3FSX A;  4ZVP B;  1XNQ J;  3MAH A;  3MTJ A;  4NAS A;  2LMI A;  1LW0 B;  1RBA A;  3EDR B;  2YKM A;  1UET A;  2GVZ A;  2DXE A;  3CD7 A;  3RZA A;  2J0W A;  2XHC A;  3DLJ A;  4O3R A;  1HHQ A;  1RT1 B;  3OHB A;  4OV6 A;  2WON B;  4GKJ J;  1N32 J;  3I0R B;  1QTN B;  1GXT A;  1YQH A;  1S1W A;  2G2Z A;  2C1E B;  2ZKT A;  4B3T J;  1K0V A;  3H5Y A;  4GO7 X;  4USK A;  3KKF A;  1FRK A;  4OYM A;  2NXC A;  5DQG A;  2ZH6 A;  2E7X A;  3K5O A;  2MKH A;  3LP1 A;  4CNZ A;  1FFW B;  3PIO Q;  1LW2 B;  2FB0 A;  2QLF B;  3MR6 A;  2J7K A;  1U2C A;  4C8Z A;  3FKB A;  4F26 A;  3C8Y A;  3TOQ A;  1VC6 A;  2CNN B;  2D3Z A;  2MJN A;  1XMO F;  2ALZ A;  1SCJ B;  2ASL A;  2A18 A;  2BJ1 A;  4ATN A;  3R5G A;  2PEH A;  4JI8 J;  2GQ2 A;  2JDJ A;  2LU1 A;  1YBA A;  3BS9 A;  4HYK A;  2RRB A;  4DHV A;  4CQ1 A;  2OEM A;  1RAA B;  3MR2 A;  1PJ6 A;  1Y0H A;  4LRF A;  5DGB A;  3NKY A;  2D1C A;  2CAD A;  2QEX S;  2WK4 A;  2HFO A;  1RP5 A;  3ZZ0 A;  4PPZ A;  2DGU A;  4CYU A;  4OI6 A;  1TMM A;  4HVZ A;  4EEY A;  1LV5 A;  2W01 A;  4MTP A;  2V34 A;  4F4K A;  1UWB B;  4AFF A;  3BF4 A;  4Y2A A;  1YKW A;  2VFR A;  3C46 A;  2AJF E;  1DQ9 A;  4HAC B;  2M8D B;  3PR4 A;  2FPH X;  4EO8 A;  2HNZ A;  4F2R A;  4AQY F;  1IBK F;  4LRA A;  4ED6 A;  3R2C J;  1VQL S;  3ONQ A;  1HWL A;  2VFV A;  5HBM B;  2UU9 J;  3HUL A;  1TUW A;  5IXU A;  3CJT A;  5HAO A;  2ZOM A;  3DMJ B;  6AT1 B;  4F0K A;  1RWW B;  1HBO B;  4DV3 J;  2JC1 A;  1OWX A;  2CRL A;  3SCJ E;  4ID5 A;  4A8F A;  2DXF A;  2D41 A;  3T9Z A;  2YNI A;  4DSL A;  3GV7 B;  2YQ1 A;  5LJ3 Y;  3CME S;  3M8Q B;  2OTL S;  1HNZ F;  3IWN C;  5E33 A;  5KFQ A;  1UEK A;  4I6W A;  1DJ0 A;  3ULH A;  1HNV A;  2XMV A;  3MMB B;  4YDX A;  4WTO B;  4YEA A;  3P5T L;  3K58 A;  4ED0 A;  2AYG A;  3VZH A;  2JH3 A;  3BM7 A;  3NCQ A;  2VG6 A;  2D7S A;  2H48 B;  1PSD A;  5CYM A;  3EMT A;  1X4F A;  3BSC A;  2YKA A;  3K0J A;  3GR0 A;  3W2V B;  5HQ8 A;  1JLG B;  2Y9H A;  1RYR A;  2DCL A;  4TN2 A;  4NA2 A;  3HSJ A;  3BR8 A;  5I3U A;  1NKB A;  1Q8I A;  3DLE B;  2DIS A;  2MZJ A;  2RB7 A;  3BSA A;  2XO6 A;  1UJ6 A;  3VAL A;  1Q16 B;  2VAS A;  3TO8 A;  1YJT A;  2MQQ A;  3TA2 A;  4NYO A;  2MQM A;  4PUO B;  3U02 A;  1RTI B;  2KZZ A;  2MYF A;  2WVD A;  2B4U A;  2R7T A;  4ZIW A;  5F8I A;  3PRB A;  5D78 A;  2MKK A;  1PYT A;  4DR5 F;  2FGC A;  2V8P A;  4B9N A;  2FVR A;  2Z2Y B;  1L3S A;  1FHT A;  1UJ5 A;  3LA0 A;  3ZZU A;  1F2G A;  3DNC A;  4EMD A;  2YKQ A;  2C2O B;  3B8H A;  4QPT A;  1NHK L;  2QA2 A;  1J5E J;  1RBL A;  4ZLN A;  4ZDN A;  2H1Y A;  2VIH A;  1VQM S;  1B3T A;  2QLJ B;  2ZNZ A;  3NBP A;  3WC0 A;  4KYZ A;  3J81 j;  5HAN A;  4ZKA A;  4DX6 A;  1IR1 A;  1FE0 A;  2Q6C A;  2KN4 A;  4IOA Q;  3DRP A;  4QQB A;  3BPS P;  1PAE X;  1SH2 A;  3BYP A;  2E9T A;  4LSN B;  5ADZ A;  2XSJ B;  4NLG A;  2ZIT A;  4DR4 J;  4FYX B;  4O3O A;  8RUC A;  2J0S D;  2V69 A;  2VB6 A;  4RO0 A;  2ACM A;  1B0T A;  2N4D A;  2HRU A;  4J9V A;  3KUG A;  3MM7 B;  2HMI B;  3VAI A;  1T94 A;  2R9L A;  4EU0 A;  2EFO A;  1RU1 A;  5HP1 A;  3WIU A;  5DJB A;  1M5H A;  4IUF A;  2CJX B;  1AUD A;  2PMH A;  2UV8 A;  4OHW A;  3IFE A;  2IM1 A;  1WDT A;  4CIO A;  4RW7 B;  2H65 B;  3NAI A;  2DR7 A;  1VC5 A;  2IMW P;  5KFG A;  1KTV A;  2COL A;  3IS9 A;  4EI2 A;  4IR1 A;  3A1Y G;  3NGS A;  3IRX B;  3S1T A;  3CCM S;  3MM5 B;  1U6B A;  3IO1 A;  4IG3 B;  1IBL J;  2GGP A;  3LGM A;  1BUX A;  2C22 A;  1M5S A;  2B5J B;  3FBE A;  1PIE A;  1LFP A;  4F2S A;  5CHC B;  1N5V A;  1X4D A;  1ZZF A;  1RHM B;  3E2E A;  4IDK A;  5HJY A;  5D4P A;  5J2Q B;  2Y1R I;  5HQM A;  3WZ0 A;  4KKO A;  2F4V J;  2NSB A;  2I8E A;  3F44 A;  4ZJQ A;  3SV4 A;  2RQM A;  1U1M A;  4M1K A;  2W4P A;  2ZD1 A;  1UW4 A;  3VGS A;  1DQA A;  4TU7 A;  1S0N A;  4NLW A;  2HG4 A;  3BYR A;  1AFI A;  3M6X A;  2XMT A;  1LW0 A;  2X1A A;  1FT8 A;  4N8O A;  2ROG A;  2UUB F;  4ED4 A;  1C4C A;  5IT4 A;  2UUW A;  4RUA A;  3W65 A;  2YWF A;  3ILJ A;  1RT1 A;  1KNZ A;  2WON A;  5A6P A;  2IBK A;  2GS8 A;  1HBM B;  4L72 B;  2HPU A;  3T5J A;  1ZM3 A;  4LMZ A;  1D8Z A;  4FYV B;  7FD1 A;  4QYR A;  4RW9 B;  2R8G A;  3QYY A;  5T7L B;  1TVR B;  2GA7 A;  1R6V A;  5BR8 F;  4ANE A;  5LSO A;  2AD9 A;  3HK2 A;  1ZAX A;  3Q8S B;  4V19 J;  3MCN A;  3T1H F;  4DR1 J;  5KFJ A;  2L9D A;  2CDQ A;  3LPE A;  2E5L F;  1M0S A;  1U1L A;  1P1L A;  2GZO A;  1Y4Z B;  1O8B A;  1ZYQ A;  1FNO A;  1LW2 A;  3AXM A;  2L9W A;  4CNY A;  2QZ8 A;  3J80 U;  4W92 B;  4AE5 A;  1ITP A;  2XGQ A;  1U2F A;  2BJE A;  4G3I A;  3L09 A;  3V81 B;  4FYY B;  4DV0 F;  1U1R A;  1UVN A;  4OX9 J;  3TQE A;  1I51 B;  4C7Q A;  1TV6 B;  1H38 A;  3ILO A;  5KFU A;  4IKA A;  5HI7 A;  1SIZ A;  2ZDO A;  4DR2 J;  4A8W A;  1RGV A;  3G4S S;  1U1P A;  5K9F A;  5I4M A;  3PX4 A;  4C2M A;  2XZD B;  4LRB A;  3PHE A;  4DL3 A;  4DR3 J;  2GO8 A;  3J80 Y;  3UDC A;  3TJA A;  3DGP B;  2D3U A;  2L3M A;  4HI2 A;  4NML A;  3D2W A;  1FJG J;  3FCH A;  2JJ4 D;  4MIW A;  2R7U A;  1WHY A;  3DI6 A;  2GHP A;  2HGL A;  5KFT A;  4TXS A;  5EN1 A;  2J5A A;  4USW A;  3CJ8 A;  4HAC A;  2R2S A;  4LF9 F;  4LQ3 A;  2DNR A;  1EZZ B;  1Y00 A;  4O0N A;  1M5V C;  2OJ3 A;  4J9P A;  3KMQ A;  1NHV A;  1EKR A;  4R25 A;  4UW2 A;  4Q7A A;  5IQ6 A;  3I0S B;  2AEF A;  3DXS X;  5HBM A;  2JL9 A;  4ER8 A;  3DMJ A;  1SKR A;  1CJT B;  1HBO A;  5C24 B;  1H2V Z;  3QMQ A;  4DPT A;  3KNA A;  1LOU A;  1T9Y A;  1PC5 A;  3MED A;  2HFV A;  3IBF B;  3D3C J;  2HBY B;  3M8Q A;  2WOM B;  3CDW A;  1NO8 A;  4Y2M A;  3RG6 A;  2CG4 A;  4M5G A;  4F4X A;  8ATC B;  3O6Q A;  1NK8 A;  2W9B B;  2YNF B;  1ZBT A;  3Q23 A;  3BPD A;  2UZA A;  1TFW A;  2UUC F;  1WG4 A;  3CE8 A;  4NZ0 A;  2V4R A;  1NCL A;  1S48 A;  1ZZN A;  3W2V A;  1BLU A;  2IIH A;  1JLG A;  1XJW B;  1FEH A;  3CJK B;  4B9V A;  1YTY A;  1S1X B;  4UZC A;  1SH3 A;  1X4H A;  5CYJ A;  1M1G A;  5AXL A;  4KO0 B;  3DLE A;  3O3L A;  4I0W A;  2RSQ A;  1V3Z A;  1UKU A;  4KGX B;  2B9Y A;  2LLZ A;  4PUO A;  4N5S A;  3FQK A;  2XLI A;  1S10 A;  5GAD I;  3LUY A;  4DFK A;  1VJW A;  2JC0 A;  5CQG A;  1X4C A;  1DTT B;  2LA6 A;  3BO4 A;  3FBB A;  5B0E A;  2H4W B;  3IWX A;  3VHQ A;  3B4D A;  3G2X A;  1WOR A;  2MGZ A;  1W2I A;  2BJ3 A;  1H74 A;  4MYU A;  3G9C A;  3FNN A;  3VQS A;  4RUC A;  4RW4 A;  2KVI A;  3TZZ A;  3A12 A;  1M1K T;  5DZ7 A;  2NXN A;  4V19 X;  3QO9 B;  4GVB B;  4LSN A;  3EX7 B;  5KG3 A;  2XSJ A;  4ZN1 A;  2GIR A;  2BMB A;  2C2N A;  3D1O A;  1IBK J;  1HIY A;  2MQL A;  3TZY A;  3IA0 A;  4W90 B;  5IOL A;  2R7V A;  1S7H A;  3MM7 A;  2HMI A;  2ZM6 J;  3NWR A;  2W2O P;  3AOA A;  3ZTP A;  1KQS R;  4I64 A;  4JI0 F;  2BAC A;  3ETO A;  1K0T A;  3LO3 A;  1RBO B;  2LP4 A;  3R7S B;  4IQX A;  1HKA A;  3TYT A;  4I7F B;  3P96 A;  3MUR P;  1DQ8 A;  2XS7 A;  4CO4 A;  4RW7 A;  3AD7 C;  5JUM A;  1H3D A;  2YQ0 A;  1OY9 A;  1RCO B;  1HNZ J;  1RDR A;  3GZ7 A;  2NPI A;  1FWL A;  1X0F A;  3IRX A;  2JLF A;  4EZ9 A;  1RHQ B;  3ADA C;  5B0D A;  4M63 A;  4OHY A;  3M8S A;  2P9C A;  4IG3 A;  1KVK A;  1RSC A;  3MEG B;  4LF4 F;  2RJZ A;  3LOU A;  3L9Z A;  2W4C A;  2B5J A;  4WF9 Q;  2R7R A;  4X4P A;  1WKK A;  1EKS A;  1R0A B;  4M95 A;  4P2X A;  1X31 C;  3OSN A;  4LF7 J;  2BE7 D;  4RR5 A;  3A3O B;  5LMN F;  3G86 A;  3HZG A;  3S7R A;  1RHU B;  4BLG A;  4EYH B;  2PO4 A;  2UXC F;  2HW3 A;  2DR9 A;  3SI8 A;  3TEH B;  4ECR A;  3GON A;  3AOD A;  4DF4 A;  3LPY A;  1O0P A;  2CQB A;  3SCK E;  3CC4 S;  3DOL B;  3QRP A;  2Z8Q A;  1JB0 C;  1Y5I B;  1SC6 A;  3BQ0 A;  3NNC A;  3VAK A;  3EWG A;  4U8V A;  3E01 A;  3D66 A;  3BKU A;  3DM2 A;  1HBM A;  3EZO A;  4GC7 A;  1J5O B;  1N48 A;  3FMB A;  1IWA A;  1MML A;  4RW9 A;  1VK3 A;  4DV1 F;  1F60 B;  1TVR A;  1FWP A;  2Z2M A;  3KK1 B;  4BHQ A;  2HGN A;  1L3V A;  1ZAV A;  4F3M A;  1JJH A;  4B9L A;  1W26 A;  3D68 A;  3BDP A;  3HP6 A;  2GV1 A;  5D3G B;  1IKW B;  3R6G B;  2W7O A;  1SL0 A;  3JYT A;  2ZH8 A;  4DXL A;  1EAY C;  2WTF A;  4QR1 A;  2QN6 B;  2NSC A;  4KGZ B;  4K8R A;  1SQG A;  1RAO A;  1JJC B;  3V81 A;  1OMS A;  2KXN B;  4QPX A;  2AIR B;  2MTL A;  1TV6 A;  4UZB A;  2MKS A;  4DFM A;  1G3O A;  2OPQ B;  2NYI A;  3NG8 A;  1UWA A;  3HM9 A;  3GYN A;  1O5J A;  3KLF A;  5DM6 Q;  2EC0 A;  1SXL A;  4LSL B;  4R8U B;  4OX7 A;  4ZVR B;  1EAR A;  1SL2 A;  4WZQ A;  3W9I A;  3DGP A;  3W8P A;  2FHJ A;  2F8M A;  2N7Y A;  4RW6 B;  2KG0 A;  2O67 A;  2H5E A;  2ZE2 B;  3I4P A;  1VMB A;  4K4S A;  2X1B A;  3T1Y F;  1N5Y B;  1T3N A;  2XY6 A;  2B6A B;  2JEI A;  1BQX A;  5E3P A;  3PKY A;  5L1K A;  5KFP A;  3PYF A;  2DY9 A;  3Q89 A;  3RRH A;  1FRI A;  3FGV A;  3QID A;  3M8Y A;  2ZKU A;  1IKY B;  2H51 B;  3I0S A;  3CCU S;  5CZX A;  4DSE A;  3EZU A;  1X8D A;  1PBU A;  2VKZ G;  1S0O A;  4WFY A;  4CTA A;  4IFY B;  2HZA A;  1JXL A;  3PNI A;  1CJT A;  3CIM A;  5B0C A;  4UOC A;  3OHA A;  5C24 A;  2BE2 B;  4PCQ A;  1UFK A;  2OHD A;  2WSE C;  4OV1 A;  2KRR A;  3R7N B;  3G6V A;  4DMZ A;  2R8H A;  1V3S A;  2PFF B;  2HAF A;  3FRY A;  1N0U A;  1XC9 A;  1U1Q A;  3SXL A;  2RDI A;  3KLI B;  2W9B A;  4ES3 A;  3VGU A;  2YNF A;  3F56 A;  2XEX A;  5CZV A;  1X5P A;  3DOM B;  2E5H A;  3MUT P;  3KHR A;  2LEB A;  4IR9 A;  4OZ0 A;  3CO9 A;  2CKW A;  5C5J A;  2A2D A;  2XNR A;  2UUA J;  2KH9 A;  1TL1 A;  3UQS A;  1XIQ A;  2K7K A;  2VQE F;  5C2C A;  4E2F B;  3RRK A;  4PQA A;  4XIU A;  1H2T Z;  1A9N B;  4NLQ A;  1O51 A;  1X9W A;  3CJK A;  2KM8 B;  3CD0 A;  1S1X A;  5E2Q A;  2F5G A;  2AV5 A;  4JI6 F;  3KFW X;  1Q5Y A;  1FTC A;  1QJH A;  3CCZ A;  4KO0 A;  2J8S A;  4ZVG A;  3CCJ S;  1D9A A;  1GK8 A;  4K7Q A;  3W8G A;  4O3N A;  4KB7 A;  2OTJ S;  5K8M A;  3A8I A;  3FSY A;  4K4X A;  5D0R A;  2ROP A;  5J1E B;  4PG5 A;  2ZH4 A;  1SQF A;  3H2L A;  5EDW A;  1VK8 A;  2BAN B;  1U25 A;  4BBY A;  1N34 F;  1NND A;  3PFE A;  1HLW A;  3G6E S;  3EGW B;  3EM1 A;  4DCP B;  3UCZ P;  1OPI A;  1UP1 A;  4USM A;  1S77 D;  1DTT A;  1KQF B;  2E1P A;  5ETV A;  3AQP A;  4WXO A;  3OVB A;  4DR6 J;  3H59 A;  4DG1 B;  2HUR A;  3QIP B;  2ZOG A;  1K73 T;  3PRD A;  3D28 A;  1T9W A;  4L75 A;  2V2Q A;  5BXI A;  2H5I B;  2RRN A;  1S59 A;  2B4O A;  2U1A A;  1HPZ B;  3RRG A;  2CNO B;  4KQZ A;  2DGS A;  2HHT A;  3QO9 A;  1YG0 A;  2VQF J;  4GVB A;  3TWZ A;  5BYS A;  2FLL A;  2KKH A;  1AW0 A;  2IYI A;  4NLU A;  4B9T A;  5U47 A;  1G4C A;  3BH7 B;  1SJ1 A;  4JI1 J;  2UXB F;  3RAQ A;  3M6U A;  3FZ2 A;  4C11 B;  4WP8 A;  1B99 A;  3H90 A;  3J81 Y;  1U24 A;  4GKK F;  3L95 X;  4ECW A;  2MLZ A;  4DS4 A;  3M8P B;  1R43 A;  4I7F A;  1WG1 A;  2P6S A;  4BDP A;  1XNR F;  2RUG A;  5SUH A;  3WIV A;  1QAY A;  1RKI A;  1ZPW X;  2CPF A;  5KFY A;  3KK3 A;  1S1V B;  2B8P A;  2ASD A;  4GRS A;  1HW8 A;  2IM3 A;  3OXG A;  5D0H A;  3BGO P;  5KFL A;  4QWD A;  3MEG A;  1ZAW A;  4Q44 A;  2CPJ A;  1XQI A;  4J9Q A;  3CCW A;  3F41 A;  2CZV C;  2E5G A;  1YJN S;  1GMV A;  4JB8 B;  1T8E A;  4K4Z A;  4OX6 A;  5D8H B;  1GEH A;  1Y11 A;  1R0A A;  2KYX A;  3FZB A;  2SXL A;  4M8L A;  1NH8 A;  1L3K A;  4L3K A;  4I2P B;  4NX9 A;  1B4S A;  3TR5 A;  3T9N A;  5B0G A;  4J37 A;  1WD6 A;  4DI6 A;  2MQO A;  1C1C A;  3EGV A;  1PBA A;  1N36 F;  1D1U A;  4Q0B B;  1GTH A;  3I56 S;  2RAQ A;  2CQ0 A;  2V2K A;  3KJN B;  3DOL A;  1RT6 B;  1N5T A;  1HQU B;  2P9G A;  4PWU A;  1Y3J A;  3KJF B;  2AX1 A;  3I6P A;  3PCO B;  3G8T A;  4B9U A;  2PI5 A;  2WHO A;  1AZS A;  2F8H A;  3PY8 A;  4LF8 F;  4AL5 A;  2FHO B;  3OJU A;  1OIA A;  4ELT A;  2ZEJ A;  3MCO A;  4DWI A;  1J5O A;  4X4O A;  2ZJR Q;  1CUL B;  3SCI E;  1RLC L;  1JLF A;  2U2F A;  4K0K F;  2ACY A;  1RXO B;  2DKO B;  3CTR A;  2PFD A;  5DET A;  3UCG A;  3V6J A;  1FA0 A;  5ETQ A;  4DUY J;  2B9W A;  2MMY A;  4JYA F;  2AMC B;  3HVW A;  1BGX T;  1S9G B;  2XMM A;  5D3G A;  2WW4 A;  1IKW A;  1CC8 A;  4YUD A;  2CDR B;  2QT7 A;  4K5R A;  2YPY A;  1SJ4 P;  1RTD B;  4I69 A;  5KOW A;  3OTE A;  4ZIT A;  2DIV A;  2HQG A;  3QLH B;  2X1F A;  1Q1K A;  1F9E B;  1N0V C;  4O44 B;  2FTR A;  4ZA1 A;  5D4N A;  3BSN A;  2R7S A;  3UN5 A;  2LXI A;  4F0M A;  2V8H A;  5F3Z A;  1LWX A;  1S99 A;  1NUE A;  1NME B;  3VAH A;  1OJ4 A;  3J7A N;  4P73 A;  1DUR A;  3I9Z A;  1KSP A;  4O4R A;  4QJV A;  3CO0 P;  3Q8Y A;  4H4K C;  1D9F A;  1R27 B;  5DO2 A;  1NK0 A;  4LF4 J;  2WCX A;  4LSL A;  3S8S A;  1X4A A;  3RW6 A;  4DV4 J;  3PEJ A;  3MM6 B;  1Q53 A;  4RW6 A;  2GHW A;  2HS0 A;  1F6T A;  2YNG B;  2NZC A;  2ZE2 A;  2HFN A;  5LXY A;  1N5Y A;  2MLY A;  3MPY A;  3GFH A;  3KG1 A;  2AP6 A;  3PJW A;  4U9R A;  5LMN J;  1JJ4 A;  2E44 A;  4UST A;  4EZ6 A;  1TL5 A;  3DDK A;  4TYB A;  3GIL A;  4K4U A;  1NDP A;  4QWB A;  4AYB D;  3BBF A;  3EPI A;  1IKY A;  2UXC J;  3FVY A;  1Y3K A;  4N77 A;  4GC6 A;  2GJ2 A;  1VIO A;  4NRT A;  4JV5 J;  2KU7 A;  2MKC A;  4NA3 A;  4NZ7 A;  3BQ1 A;  1VQ8 S;  1TAU A;  3A8E A;  5KFE A;  2CJA A;  2DR6 A;  2LKZ A;  3EXY A;  1NZA A;  5IS2 A;  4DPW A;  3P45 B;  1GT8 A;  2I6W A;  3R27 A;  3OR1 A;  4XPE A;  2VD3 A;  1S1U B;  4J9L A;  1N5Q A;  5IV3 A;  1SB6 A;  3UCU P;  5KFA A;  4TQR A;  4RUB A;  4X66 F;  4AL6 A;  4LBI A;  4DV2 F;  1KWM A;  3OT9 A;  3LF0 A;  3M9M B;  2P5V A;  3RAM A;  3X3U A;  3LP2 A;  4U7U D;  1TUG B;  4P75 A;  4FP9 A;  2VG5 A;  3DLK B;  4JBC A;  5CD4 A;  2VPY B;  3KG0 A;  3PIP Q;  2CPH A;  4DSK A;  4KTQ A;  1KTQ A;  2EG2 A;  2A0F B;  2NLW A;  5IFM A;  4KH0 B;  4FZV A;  5ETK A;  4BC9 A;  2YPZ A;  1KHV A;  4ZHR A;  1R8A A;  2QJ3 A;  5A8R A;  2DVI A;  1RE1 B;  4BC7 A;  4LFC J;  3R5C A;  2HHW A;  4PRF A;  1V5V A;  2HLT A;  5KT7 A;  3DC2 A;  2R7Q A;  4RBV A;  3KUE A;  2DHH A;  5KFI A;  3CCR S;  3QGH A;  4J9U E;  3GSI A;  4YQW A;  3R97 A;  2FVC A;  1T3O A;  2ZNY A;  2MDA A;  5J1E A;  1HI0 P;  2RH3 A;  2BOA A;  3H5U A;  4XK8 C;  2BAN A;  2ERR A;  3P3D A;  4J7C A;  5HK4 A;  2FY8 A;  4LFB F;  4Q5V A;  2C42 A;  1TAQ A;  2DNQ A;  2O01 C;  2IM0 A;  2GVD B;  4DG1 A;  1SKW A;  4KH1 B;  4OHV A;  4F02 A;  4KHM A;  1LEO A;  4P2F A;  5F9N A;  3WC2 A;  1HPZ A;  4ES1 A;  1VFJ A;  3KJV B;  1KOH A;  2LU2 A;  2RIJ A;  5GMD A;  5E3A A;  2X3G A;  3BQ2 A;  4A8S A;  1BQN B;  1B7Y B;  5A8W A;  4HT5 A;  5KG7 A;  2K06 A;  4TU8 A;  3CGI A;  1PJ5 A;  4X4V A;  3OL6 A;  1IBC B;  4C11 A;  4F8R A;  4Z7Y A;  1D3W A;  3PX0 A;  4D3G A;  3PXG a;  1R6Y A;  5K8N A;  3MPU B;  1QD1 A;  1T0T V;  3ZNJ 1;  1CPZ A;  2QO3 A;  1U26 A;  2YWW A;  3GP9 A;  5KFO A;  2X3D A;  2F65 A;  4F4A A;  1SC3 B;  4WFN Q;  1VQS A;  4RWX A;  3P5B P;  3MM8 B;  4LF6 J;  1UVM A;  1WSV A;  3BDE A;  2VFT A;  3MOZ A;  2MY7 A;  3FCW A;  3G96 A;  1S1V A;  4C0B A;  4CCH A; 
#chains in the Genus database with same CATH homology
 3MPD A;  3ELH A;  3FBF A;  3JS9 A;  2B8P A;  4DZ6 A;  3VVT A;  2BX6 A;  2HUR A;  3DKD A;  3FBB A;  4ENO A;  1LEO A;  3EIC A;  1NSP A;  2DXF A;  2CWK A;  2DXE A;  4KPC A;  1EHW A;  4C6A A;  3VGU A;  3NGU A;  3VVU A;  1S57 A;  3G2X A;  1HHQ A;  1XQI A;  3B6B A;  3NGS A;  5CAB A;  1NDC A;  1F6T A;  5BXI A;  1UCN A;  1NSQ A;  1S59 A;  4ANC A;  1NHK L;  3GPA A;  2AZ1 A;  3Q8U A;  4UOG A;  1ZS6 A;  1XIQ A;  3Q83 A;  4S0M A;  3FC9 A;  3ZTO A;  1NB2 A;  2ZUA A;  4FKY A;  1BUX A;  4HR2 A;  2HVE A;  2BEF A;  3DDI A;  3FBE A;  3BBB A;  2HVD A;  2VU5 A;  3EE3 A;  3VGV A;  1WKK A;  3BBC A;  3VGT A;  3ZTQ A;  1WKJ A;  1NDP A;  1NSK L;  1S5Z A;  4ANE A;  1PKU A;  1B4S A;  1BHN A;  3BBF A;  1NCL A;  3EMT A;  1PAE X;  3B54 A;  2DYA A;  3BH7 B;  2DY9 A;  3Q89 A;  4DI6 A;  4EK2 A;  1WKL A;  1BE4 A;  4O0N A;  1NLK L;  1HIY A;  1B99 A;  2DXD A;  5IOL A;  5C7P A;  4DUT A;  3NGR A;  3ENA A;  4UOH A;  2B8Q A;  3GP9 A;  3PJ9 A;  3BH6 B;  3EVO A;  3EVW A;  1LWX A;  4F4A A;  3ZTP A;  4W98 A;  3FKB A;  4WBF A;  3FBC A;  1KDN A;  1NUE A;  3R9L A;  3ZTR A;  1NPK A;  3VGS A;  4UOF A;  1F3F A;  3NGT A;  4CP5 A;  2NCK L;  1K44 A;  3PRV A;  1NDL A;  4AND A;  1MN9 A;  1NDK A;  1MN7 A;  4F36 A;  2AZ3 A;  1W7W A;  1HLW A;  3EM1 A;  1U8W A;  1JXV A;  5CAA A;  3L7U A;  3FCW A;  3Q8V A;  3Q8Y A;  3EJM A;  3ZTS A;  3EVM A;  3ETM A;  3Q86 A;  3WX8 A;  3FCV A;  1VYA A;  4FKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...