1F9FA

Crystal structure of the hpv-18 e2 dna-binding domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
76
Chain Sequence
HMTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein E2
publication title The structural basis of DNA target discrimination by papillomavirus E2 proteins.
pubmed doi rcsb
source organism Human papillomavirus type 18
molecule tags Transcription
total genus 21
structure length 76
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f9fA00
1R8PA 1M5PC 5DDQC 3HHNB 2DNMA 3R27A 2E5GA 5GVQA 1WG4A 3BO2A 2FY1A 2WBRA 2MGZB 3VALA 2MZTA 2MQMA 4UQTA 2CQDA 2OIHA 2X1GA 3CTRA 3SDEA 4EGLA 2J0SD 1ZZNA 1Q7YT 2DISA 2KM8C 1S79A 2J8AA 3V4MA 2X1BA 2LECA 5D78A 2N7CA 2CPYA 2RRAA 1D9AA 4YOEA 1U6FA 3BEGB 5JVHQ 3S7RA 2AYMA 2XS5A 5MLCV 3PIPQ 1WEZA 2LQ5A 1YHQS 2ZJRQ 2HGNA 1FJCA 3R1HA 2O3DA 2XS7A 2DIVA 2KYXA 1VQ8S 4CH0S 5LXYA 3UE2A 3MD1A 3ZZZA 1YJNS 3P5TL 1ZH5A 1JJ2R 2CPZA 1P27B 1UFWA 2XNQA 3L3CA 4TLQA 1FNXH 4BS2A 2LYVA 1Q81T 1JMTA 4CIOA 2DH8A 2AYGA 1M5VC 1D8ZA 5DDRC 2QFJA 2MZRA 2E5HA 2MKJA 1PO6A 2DHAA 3J7YU 3CCLS 4FXVA 1N88A 3MI7X 3G4SS 3H2VE 2SXLA 5EN1A 4Z2XA 3MUTP 5CYJA 2LKZA 5FJ4A 3H2UB 2KXHA 3G8TA 1WF2A 1SJFA 2RVJA 2OJ3A 3EX7B 1WWHA 3FEYB 2KXNB 1VQOS 3CUNA 4WFNQ 2DNPA 1U1OA 4LJMA 2BZ2A 1R8HA 1DRZA 2XB2D 3PIOQ 3CCUS 2JX2A 1VQNS 2DH7A 1H2TZ 2CQPA 2YWKA 3J7ZT 1HA1A 2K3KA 1WF1A 2MHNA 4TU9A 2FHOB 4V19X 1RKJA 3MOJB 2OSQA 2D9PA 3VAIA 5LJ5Y 2XS2A 3S01A 3OW2R 2KU7A 2X1FA 2CQGA 2CQ3A 3MUVP 5LSOA 1VQPS 1OIAA 1SJ3P 2U2FA 3CC7S 4IOCQ 1X5TA 4IO9Q 1A9NB 1A7GE 2DNKA 5GAHU 1KC8T 5D77A 3UWTA 3Q2TC 1YI2S 3NS5A 1OWXA 1VQ5S 1QVFR 2E5JA 3TO8A 4CQ1A 2RRBA 2RUGA 3UD4P 2HGLA 1X4CA 3NS6A 3P3DA 2FPHX 2AD9A 2KVIA 5DDPC 4F25A 2J76E 2KM8B 2N3OA 2X1AA 1VC5A 4C0OC 3MDFA 3K0JA 4C7QA 5IQQA 2KRBA 3MXHP 2GO9A 1WHYA 2RT3A 3G8SA 2VOPA 1SJRA 1M5OC 2QA4S 2I2YA 2KG0A 1KQSR 1X4EA 2YKAA 1WHXA 2LMIA 4WFAQ 2OTJS 1X5SA 2M70A 2F9JA 5GAGU 1FHTA 2CQ4A 1VQMS 1FJEB 3TYTA 1FT8A 3CD6S 2LCWA 2MZQA 1HD1A 2KHCA 2MGZA 1KOOA 2DGSA 5ITHA 1ZZFA 4WCEQ 1VBYA 5IFMA 3ZZYA 1XN9A 2OTLS 2XSFA 2MKHA 1U1KA 2VODA 1WI8A 1U1PA 3U1MA 5DDOC 3JB9k 2CQBA 3R1LA 4YUDA 4LMZA 1JJHA 2L41A 2DGTA 4OZ1A 3S6EA 1VQ4S 2KH9A 1WG1A 4Y00A 2MYFA 2VOOA 2A3JA 5GMKa 2KI2A 1NO8A 3VAHA 3BS9A 2RQ4A 2MSSA 2DH9A 3CXCR 4C4WA 3VAGA 1WHWA 5JVGQ 2M52A 2DNLA 1P1TA 2KG1A 3CULA 2DNYA 2MKIA 1OO0B 3RW7A 3ULHA 2MZSA 4WKRA 1VQ9S 3CCMS 1WI6A 1U1RA 2DNNA 2MQOA 2DNOA 2G0CA 3VAJA 2M7SA 1U6BA 1DBDA 4CH1A 2MY7A 2RNEA 4QPTA 4QU7A 2HGMA 1QVGR 1K8AT 3NNCA 2MJNA 5DETA 1G2EA 3I56S 2KN4A 2CPHA 5CXTA 1HD0A 4WFBQ 4FXWA 4W90B 2F3JA 2RS2A 2G4BA 2L08A 2JVRA 2DITA 2BOPA 4PR6A 1DHMA 2DGWA 1YWXA 3BO3A 2V94A 3EGNA 1U1QA 1URNA 4U67Q 5GADU 1WHVA 4WIIA 2DB1A 2ZJQQ 2EK1A 2KT5A 4J5OA 5LJ3Y 3CF5Q 5CA5A 1NU4A 3DLLQ 2JWNA 3EGZA 2LA4A 3B4DA 3UCZP 2K8GA 1VC6A 3NNAA 4WF9Q 3BO4A 1Q82T 2Q79A 1YJ9S 1H2VZ 1H6KX 2DO0A 2M4MA 3US5A 2LXUA 3G71S 3LQVA 1U1LA 2CPIA 2I38A 1DZ5A 3CCES 2MMYA 3DXBA 2DO4A 4UY8T 2G1DA 2HYIB 2DNZA 1VQ7S 2E5IA 2DGVA 2DNGA 3NMRA 1BY9A 2DK2A 3SXLA 1SXLA 4F02A 4IUFA 1X5PA 3G96A 2CQIA 1U2FA 2M88A 1N52B 1WTBA 4IOAQ 2OSRA 2DNRA 2E44A 4TU7A 1FJ7A 2DIUA 1WELA 2M0GB 3VAMA 3CMES 2ERRA 2MQQA 3VAFA 2JVOA 2AYBA 3CC4S 1B7FA 3P49B 3B4MA 2CQ2A 2JRSA 2L9WA 1X4BA 2MKCA 3UD3P 3CCJS 1IQTA 1FO1A 4A8XA 2MXYA 5HO4A 2MQNA 2CPXA 2GHPA 2FC8A 1L3KA 4W92B 2QEXS 5IM0B 3NNHA 1W2BR 1CVJA 3IRWP 2LEBA 1KD1T 1M1KT 2PEHA 1F9FA 2M8HA 1YTYA 2MB0B 2J0QD 2RQCA 2MQLA 4ERDA 2KXFA 2MPUA 4PRFA 3I55S 4QQBA 2MY8A 2ZJPQ 5HL7Q 1SJQA 1RK8A 2DNQA 2MKSA 1VC0A 3S8SA 3UCGA 1FXLA 1OPIA 4RU2A 3G9CA 2HZCA 5DM6Q 2FC9A 1SJ4P 4ZKAA 2LA6A 4YB1P 5IM0A 5GAEU 3U1LA 1VQ6S 3MD3A 1NJIT 1UW4A 3THTA 2D9OA 5LXRA 4TU8A 4P6QA 3CCQS 2DGXA 2EVZA 1X0FA 2VONA 2DNHA 1X4DA 2M9KA 1WEXA 1X4HA 4F26A 1VBZA 2DGUA 4Y0FA 2M8DB 3MURP 2KFYA 5BJRA 3FEXB 2CQ0A 4M5DB 1U1MA 1VQKS 1PGZA 3D2WA 2RS8A 2MKKA 2N82B 2UP1A 1X4FA 1QM9A 2LEAA 2DGOA 5DM7Q 2RU3A 2NZ4A 2XNRA 3HI9A 4OZ0A 3CCVS 2NLWA 2YTCA 3UCUP 1N8RT 3RW6A 4PKDB 2MQPA 1VQLS 1WF0A 2EK6A 3TP2A 1M5KC 5H1SV 2CJKA 2F9DA 1VBXA 5LSLA 1O0PA 2PE8A 2CPDA 1UAWA 2B0GA 2DHXA 2CPFA 2HVZA 1K73T 2MJUA 1KOHA 2DHSA 3LPYA 2MZ1A 2D3OR 3Q2SC 1WG5A 1JJ4A 4ED5A 2U1AA 3P6YC 2CQCA 3G6ES 3SMZA 2ADCA 3CMAS 1U1NA 3VF0B 4LIRA 1UP1A 2AYEA 1X5OA 2M2BA 1X4AA 2ADBA 1AUDA 2CPEA 2LXIA 2CQ1A 3CCSS 1S72S 2KRRA 3IWNC 3CC2S 2N3LA 1M90T 1X4GA 3VAKA 3THPA 3N9UC 2CPJA 1YITS 4QU6A 1H2UX 2CQHA 2YH0A 3CCRS 1Q86T 1HL6A 1YJWS 1K9MT 1WEYA 3SDEB 2MZJA 1YIJS 1N54B 2DHGA 3CPWR 2YH1A 3MUMP 2MSTA 2DGQA
chains in the Genus database with same CATH superfamily
3DLKB 1TP7A 3VQSA 2BABA 4CTAA 1W7WA 2WBRA 1RHMB 4J7CA 3KDNA 2MQMA 2X1GA 3CTRA 3V4IB 3GIRA 4TXSA 1DQ9A 1JNRB 1F2GA 3QRRA 2XMKA 1PYOB 3K7RA 3GIJA 4ELVA 2Y3YA 3QJJA 2IFXA 5MLCV 2E9ZA 3DN9A 1RWNB 3RB3A 4CLKA 1SC1B 3HZEA 4DR5F 1VQ8S 4ZK7M 3UE2A 3L4BC 1DTTA 1LW0A 1YJNS 3P5TL 1ZH5A 1JJ2R 2HHHJ 1UCNA 1HBOA 2V63A 4J9LA 2DD8S 5SZTA 5HQLA 4I69A 3MM5A 2QE5A 3J7YU 1QY7A 1NCLA 5J2NA 4KT0C 4NPOA 3FEYB 1HHTP 2KXNB 3HJFA 3PM9A 3CUNA 1GAOA 4LQ3A 4UQGA 4DQRA 4PWDB 4BC7A 4FNIA 4LF8J 1JLGA 4TY9A 1RYSA 3RG6A 4AL6A 4PXBA 2JEIA 1IKWB 3MWBA 4RNMA 2YKMA 4XO0A 3HLUA 2HWIA 4UOCA 3H4DA 2RRNA 2XEXA 2Q1LA 2WVEA 1TELA 2F4VJ 5IT9Y 1FTCA 1SUQB 2V0NA 1NHVA 1U0SA 2ZUGA 3MCOA 1KVJA 4DI6A 5F8JA 3CD0A 2OD4A 3GWCA 3GPAA 3MDFA 2XY5A 4ZCMA 2ZWOA 1KQGB 1NK0A 4F4KA 1EP4A 4WFAQ 5L9NA 2R9LA 4ZVUB 3CDUA 1FJEB 2R2UA 4RW6A 1EETA 3Q8RB 2AGOA 1HI1A 2HRYA 4MYTA 2GHVC 3H7HB 2PDAA 1S77D 1KOOA 3NGDA 2M3DA 3AJ1A 1XN9A 3JB9k 4FYVB 4NWBA 2UUCF 3EGVA 5M2RA 2QFIA 1WG1A 5KFMA 3OJSA 2ZDOA 3AD8C 1B64A 1R89A 5C24B 4JI5J 5KFFA 5B0CA 5KFLA 3L9ZA 3O3LA 3PHTA 2ZOGA 3JYTA 2JC1A 1H73A 4WKRA 4K7QA 5IQ6A 1KONA 1S10A 2RB7A 2RNEA 1TL1A 5A2QY 1LK5A 4ZIWA 1DY3A 1VDHA 2XC9A 3OUYA 3M8YA 2BJ8A 4OI6A 2A2CA 1K1QA 1S4EA 3QYYA 1LNQA 2KT5A 2C28A 5F3ZA 3K8VA 2BQRA 5HBMB 3B4DA 5KFAA 2K8GA 2EBGA 4KKOB 1NK5A 1D0EA 4MT1A 4RUAA 2KT2A 3AB2B 5CH7B 4UUWA 1T9VA 4F3MA 3NMRA 4KHPJ 2WW4A 2CQIA 2DYAA 2NXJA 4EI2A 3AA8A 2HHWA 4WTOB 3DOKB 1WTBA 2OSRA 1J5OB 1OS5A 1HYSB 2R3VA 4AE5A 1RZMA 1M0SA 1MMLA 4JYAJ 2JRSA 4WZQA 4OJ1A 4DZDA 2YBVA 4ZITA 3I9V9 4GVBB 3MEEA 2CJBA 2MB0B 2RJZA 2RQCA 2MQLA 2YQ0A 2KXFA 4PRFA 2OELA 2XCPA 4QQBA 1HNZJ 2DNQA 2MKSA 1SIWB 2VFUA 1MU2B 3KMQA 3D7SB 3FZBA 2EVZA 5ETMA 5AXNA 1X4DA 4B9LA 3TVYA 5KFQA 5ETKA 5BJRA 3H0PA 1P6TA 4RUHA 3W5YA 2OKQA 4NLVA 2HHUA 1NNDA 2DGOA 4ALZA 2NZ4A 2A18A 2V68A 2AT1B 1K44A 3HDSA 2A6MA 3IFEA 4CH7A 1WF0A 1FDDA 1RT5B 3C8YA 1IWAA 4P72A 2QA1A 4KFBA 2C3YA 3C15B 2P5VA 4NA3A 1BUXA 3Q2SC 2IY5B 1JJ4A 3TJ8A 3RBXA 1CJKB 1YDLA 1FFGB 3IR6B 3DRYA 1LW2B 1UWBA 1X5OA 2ADBA 1GXTA 1S72S 2KRRA 4H4MA 3RU0A 1X4GA 2MKYA 3N6MA 4NLDA 3PJWA 3DGVA 5HATA 4NCBA 3D28A 1N54B 4V1Ak 1TQLA 4ED8A 5JUMA 4NZ6A 2DXFA 3MPVA 4U96A 1U7LA 4ED7A 1TKXA 2OMOA 3MECA 3CJRA 4LR8A 2ABYA 2J8AA 3KLFB 4LSNA 2GGPA 3KNGA 1Q8KA 3BEGB 2LQBA 4J9NA 1R43A 9RUBA 2MHEA 1OSDA 1RBLA 2GQQA 3IBCB 5E3RA 3ITHA 1NAQA 2DY9A 3LP0A 1TKTB 1Q81T 2VFTA 2J8SA 3R5DA 2HQGA 3MR7A 1TL7A 1QUPA 4DV4J 1U2RA 3LPEA 2E1MC 1RU2A 1WF2A 2RVJA 3TZWA 2H5JB 3RUBL 4WFNQ 4DL7A 4LJMA 2BZ2A 1R8HA 3QO9A 1N5YA 4X4OA 2ZH5A 4EYHB 1VQNS 4Y2IA 1OY6A 2B6AA 2Y1LB 4FF1A 3PRBA 3MMAB 1NXIA 2I5JB 4RW8B 2HQDA 1RT7B 2RKIA 2JC0A 2UXCF 3UN5A 2X1FA 4RJVA 3H90A 1BQNA 2LDIA 2EG2A 4M5MA 4M5LA 4M8LA 3CJ0A 4DL3A 1YZ7A 3G82B 2L9NA 5DDPC 1U49A 2J76E 5I42B 4Q43A 3IN5A 3DRXA 4DV7J 4DPUA 1Y11A 5HVFA 3SSRA 3QZ8A 1N32J 4X4QA 4K4YA 3G8SA 3I32A 1IQZA 2PMZD 1TL3A 2YKAA 2LMIA 4DLEA 1PIEA 3R8YA 3KMSA 2UUAJ 1VQSA 3H98A 3K2YA 3RB6A 2MZQA 3AD9C 1U4BA 3Q23A 3OL8A 3J7A1 4WCEQ 1VBYA 2HHHF 4JI0J 2MKHA 5IC4B 1U1PA 3UNYA 4MMOA 1KKHA 5L1KA 2GJIA 2YNGB 4R25A 3WC0A 2RSQA 2DNLA 4DHVA 4FXDA 1FE4A 2QLJB 3OL6A 4DF4A 3CCMS 3IGNA 1Q79A 4M5HA 1DBDA 4TY8B 4K4SA 2HGMA 5F8IA 2Y8WA 2VPZB 4JI4F 4B3SJ 3I0SB 3AJDA 2OFGX 1D9FA 4PR6A 2DGWA 1YWXA 2MQ8A 1RT2A 5DS7A 2C22A 4LF1A 3UDLA 1YRUA 2LA4A 2Y9HA 3T1YF 3W3SA 1HWUA 3MGJA 1JX4A 1V5IB 2Z8QA 4URQU 4A8QA 1RWMB 2DNZA 2DGVA 4LF2A 4ZP6A 1E6VB 3DLEB 5C5JA 2X3DA 4LF9J 4RW7B 3EVOA 5DG7A 5KFCA 1RAFB 3GFXA 4ECSA 1Q5VA 3CJTA 2DR9A 2CQ2A 3GG0A 4XIUA 1FO1A 4YB7A 4KE5A 4EEYA 1CVJA 1NB7A 4M5GA 1DAXA 3H25A 3TX0A 1P9YA 4JI5F 2B56A 4G6VB 5F8HA 2JEGA 5HL7Q 4LRBA 1FRJA 3FMBA 1WDTA 4DR2J 3L09A 4F0KA 2FGOA 4A8MP 4RNFA 4ATNA 4PG7A 5CZVA 3GLJA 3BQ1A 5B0FA 5DG8A 1NJXA 1IJFB 1DJ0A 2L48A 1SC6A 1O8BA 3NGKA 5AE2A 1V9OA 2JLGA 1VRTB 3M2VB 3QT5A 5HROB 1U45A 4QIGA 5B0DA 3UD5A 4MK8A 3Q83A 2NPFA 1FRXA 1HR0J 1DQAA 1ZAVA 5C7PA 2AEFA 2E29A 3K17A 3HSDA 1KFDA 2CPFA 2R8GA 3LW5C 5DZ7A 4KHPF 1UEKA 1W2IA 1UWAA 4GKJJ 1JLQA 1PJ6A 1SC3B 3T1HF 3GR0A 1JLEA 2X7IA 3CC2S 1CULA 3V2UC 2OPPA 4OX7A 1PAEX 3CDBA 2CQHA 3SSQA 4J9SA 1GH8A 4C8ZA 3QIPA 2XHWA 3TZYA 2UZAA 4JI1F 5CYMA 3SDEB 4DR7F 4IH5A 2W7AA 1GMWA 1C1BA 3EUNA 3HFVA 1AT1B 5K9FA 1RAAB 4C3KA 5DDQC 4H4KA 3E8OA 1RHUB 1RE1B 4QW9A 3LA0A 1ZZNA 4PXDA 4PPZA 1JB0C 2KM8C 2V4RA 4ECQA 4HH0A 2N7CA 2PN6A 3H42A 4G65A 5KFVA 1UPMB 2B4OA 5LMUJ 3R1HA 4X4RA 1FRLA 1AZSB 4HACB 1ZM2A 1X60A 1G3OA 2AJFE 4MKAA 2LQ9A 4P2XA 4NLTA 1KLMB 2BR0A 3FGVA 4NLXA 3O44A 5D3GA 4GO5X 2AYGA 3Q8QB 2QIFA 2QFJA 3F41A 3M6WA 2I0XA 3MI7X 3ENQA 3LWMA 2DY1A 4ETZA 4Z2XA 2RILA 4R0EA 1G1XA 1N6QB 4RPFA 1TUGB 2XZTB 4CT8A 3CCUS 4IQXA 2ZFHA 5J1NA 4RO0A 3K5LA 3CVKA 1S9FA 4OYOA 1SCJB 3A3OB 1WF1A 3DYAB 2NZCA 4ZS6A 5KTQA 2OSQA 1TVRA 5D4LA 4YB5A 3PXGa 1QLNA 4OI3A 3KOAA 4CO4A 5L1IA 2QL5B 4KY3A 2H48B 3X1LB 2GMHA 2AIRB 1FVSA 5U47A 4Q45A 4ZN1A 2CUYA 2LXFA 1PC4A 3D3BJ 1FX2A 3PG9A 1RHRB 3SQOP 2BBEA 4P74A 2HHPA 3G8QA 3CCTA 3C16A 4IOBA 3B6BA 1GT8A 5KFGA 2RT3A 4NYZA 3HSGA 2OD6A 4ETXA 2I2YA 1BGXT 1RWPB 2OPQA 3D54A 3BYPA 1VGYA 3CO9A 5E3CA 4ZIVA 2MLZA 3TRGA 3EXCX 4YR0A 2A10A 2HNDB 1FNMA 1TV6A 5D0GA 5K8PA 4Q44A 5K8NA 2D3UA 3UDVA 2OO4A 3S6EA 1TL4A 3M9NB 5IOLA 2I8EA 3NCRA 1JLBA 3BS9A 4DV4F 2HHVA 2K1RB 2CKWA 2YWEA 2A1BA 2GX8A 1N5QA 3VAJA 4DSIA 2PEBA 3IR5B 3PO5A 4DPYA 2Z2ZA 3I56S 3KK1A 3KLHB 1KNZA 1HWLA 2KN4A 2YQ1A 4WFBQ 3V6DA 3AQOA 3JAMU 1NZAA 3KXDA 1PYTA 3QLHA 1RAIB 3EGNA 2V6AA 1T3OA 2BRLA 3EVMA 4J5OA 2EXUA 5CA5A 1HI0P 4DBQA 3NNAA 4QWCA 3TAMB 1RI7A 1K0TA 3NOCA 4DX8H 3PACA 1HKAA 3J80Y 3QRPA 1HBMB 3O1LA 4DV7F 3QT6A 4B3MJ 4NXNJ 3FSXA 3NMAA 1ZM3A 3DI6B 2QL7B 1N32F 2KJWA 4L6V3 1ZS6A 4P2MA 4E98A 4W98A 2ATCB 2UUAF 2HSEB 3B4MA 2P9CA 3UD3P 4ANCA 4JI0F 1L3KA 4LBIA 3QPIA 3CJKA 1VISA 4IG3A 3I55S 2B51A 1RK8A 1CQMA 4X4UA 1VC0A 4HT7A 3NP5A 2GVZA 1UW4A 3EM1A 3HX9A 2H51B 2L9DA 2RIJA 2ZHBA 2VONA 4AT1B 2JLFA 1R0CB 4ZPTR 3FEXB 2HMIA 4OYXA 4XPCA 4ZLNA 3T19A 4CO5A 2AU0A 8AT1B 5T7LB 1M5KC 5H1SV 2RUSA 2CPDA 1REGX 2DHXA 1AXQA 2W8KA 5DGAA 3IS9A 3M32A 4ZLLA 2U1AA 4TYBA 3BGFA 4ILLA 3G6ES 2DR8A 1HQUB 4LF9F 4P7VA 2AYEA 2OUGA 3H59A 3CCSS 3SZ2A 5JJBA 3VAKA 5I3UA 5ETPA 3KJFB 2F63A 2XTJP 1RXOB 1UW9A 4KTQA 2YWHA 4OL8A 1I51B 1UEVA 2ZNZA 1M5PC 2DNMA 5F8MA 3AD7C 2MZTA 2CQDA 4DR2F 3FJ2A 2MDAA 3J7Z5 4LQ9A 4C8YA 4UUXA 1IM4A 4ILMA 1U6FA 2VJVA 1HMVA 3EE3A 4G1IA 2VG5B 3HT0A 4X2BA 3DRPB 2E9RX 1I94F 3WIUA 2CWXA 3E3XA 3FQLA 5D4NA 3T6JA 1U48A 3EMTA 3PW4A 2SXLA 3TQ1A 1H72C 3MR2A 5KG6A 3EX7B 5ADZA 4M94A 3QJPA 1FK9B 1U1OA 4WP9A 4USKA 2F8MA 2J6TA 4KR0B 1GNKA 1C1CB 3AOBA 4X62J 4GKJF 1SL2A 2V9WA 3I31A 3NGSA 4USJC 2D69A 2C1EB 3OTEA 1RWUA 3BKUA 5HSPA 4DDFA 1KC8T 1FFWB 3FRZA 1HNWJ 2FUG9 2RRBA 2WZ1A 3T5KA 4M5KA 9ATCB 1D3WA 4DSEA 4OHZA 4WFYA 2J0XA 3R5CA 1B0TA 4DEZA 4ZHRB 4KAIA 2QN6B 3B78A 3VR1A 2RDDA 2GO9A 1P9QC 4QR0A 4YHHJ 5KG1A 1ZTWA 4FKXA 1WHXA 1NDLA 2WK4A 3JSBA 4DUYJ 2WONA 3TYTA 3H5SA 2VG7B 3CD6S 3BGRB 3T1AA 3D66A 2KHCA 2D3ZA 1AW0A 5ITHA 4QIVA 4ZVOB 5DDOC 1SQGA 2GW8A 1F9HA 4OZ1A 5L8RC 3UN2A 2RQ4A 3GJSB 4C4WA 2W8LA 2J9CA 1GXLA 4ED2A 2KG1A 3FEZA 5EWEA 2MZSA 2XMVA 1VJWA 2E5LF 2FTRA 2Z0GA 2JEFA 3ZTRA 5DETA 3RBDA 2CNNB 2V2QA 4DMZA 1ZBTA 1Q1KA 4MIBA 4ZMMA 2G4BA 5GMDA 2DITA 4NLYA 3R5GA 4L75A 3ZFVA 4X66J 2LU2A 4K59A 2EK1A 4UOGA 2H54B 3BN4A 2ASLA 4QWBA 1HNXF 1QSLA 1NU4A 3MM9B 2QLBB 3DDNA 3QSIA 1H6KX 3G71S 3LQVA 4GC6A 4PQUA 4ID5B 3AFGA 3MPUB 2MMYA 4OZLA 4WFZA 3P96A 1O51A 3SXLA 2IVMA 2B8PA 3KTQA 4Y2CA 4TU7A 4C0HA 3C3LA 1FDNA 1WELA 1GXUA 4DUTA 1NSPA 1B7FA 4DSJA 4UZCA 4EO6A 1T9UA 3Q8SB 4QR1A 2Y1RI 2FC8A 2EC2A 3DKDA 3W64A 1W2BR 1IWGA 3R7BB 2UU9J 1RHQB 2J7KA 3ZXWA 2ZJPQ 1VS3A 3KUGA 4MTPA 3C46A 1IUJA 4OLOA 2FC9A 3HPOA 5GAEU 4UW2A 3MEDA 1R0AB 4K4TA 3PX4A 4LFAF 4DG1A 4Y0FA 3VGTA 2POKA 1JLCB 4NLOA 3OD2A 1QD1A 3EDQB 3PYFA 3D2WA 2VQFJ 1ACMB 3EGWB 1JKHB 4Q7AA 4WYLA 1S1TB 4TY8A 3D1QA 1L3UA 3ET6B 1TAUA 1F60B 2DPJA 4H4OB 4JI2J 2G2YA 1RT4B 4NXNF 3BBBA 3IMQJ 1SH2A 3PRDA 2ADCA 4YY3J 2YNIB 4Y2KA 4KHRA 2LQJA 3CW2C 1M90T 1NSAA 1TKDA 2YKOA 4MFBA 4FNHA 3A4TA 2F8EX 1CJVB 2E1PA 4MJKA 5EWFA 1E6VA 2DHGA 2PI4A 2MEWA 4R8UA 2ZBPA 2BV3A 3NGUA 4ZVQB 4ZPWR 4X64J 2R7RA 2F8HA 3OTBA 2JJ4D 4DV6F 4YS2A 4YOEA 1Y00A 2GQCA 4G1QA 2H5IB 1RP5A 3PIPQ 2B4PA 3DLHA 3MD1A 5K14B 3ZZZA 1LEOA 3MMBA 1BQMA 4I6AA 1ZTTA 2ZC3A 1LK7A 2Z2YB 2WB4A 5HJXA 5BR8J 1RGVA 3OQ2A 4O44B 3BF4A 3IRXB 4XDDA 3OR1B 4C8NA 1Z1ZA 4FXVA 5A0YA 2WCXA 1O5JA 2OHDA 2OGUA 2PGCA 3W2WB 2HBQB 2XLKA 3EJMA 3A8KA 3PCOB 4NYOA 2HWHA 4ILRA 1RACB 3KJVA 4LFBJ 2FJBB 2DH7A 1RHJB 1UVKA 2R7OA 3FSYA 2B4UA 3DOLA 2KU7A 4RW9B 5LSOA 4ZP8A 4IO9Q 1BWEA 3EPIA 4QWDA 2QLFB 1UVIA 1FEEA 3BGOP 3CDWA 2VPWB 4Y65A 3HZGA 2ZKUA 1HNVB 5E3QA 3DNCA 2BM1A 4C0OC 4ELUA 4XTTA 3MXHP 1GK8A 3RAXA 3Q86A 1IN0A 3ENVA 1S0VA 1H7WA 2OTJS 1M5HA 2F9JA 5GAGU 1SV5A 4Z7YA 2YKNA 4NLUA 5KG7A 2ZH2A 4DQPA 2BACA 4H4KC 3D1OA 3KHHA 4DR6J 3T6BA 1U1KA 3U1MA 1Z2ZA 3PNIA 1F1BB 1JJHA 3ZTSA 5E0OA 2DXDA 3Q8VA 3LUYA 5GAEI 4K4WA 4USIA 2J7WA 1FKPA 4L74A 2XI3A 3CE8A 3AOCA 3CDAA 2BKOA 1FWPA 3MFHA 4WU3A 3PW5A 3NOGA 1F6TA 4Q0BA 1X9MA 5EUHA 3V6JA 5KFTA 1NSQA 3CNQP 1JK9B 5FLXU 1CJTA 5D0EA 2XULA 3BO3A 1WHVA 1KLNA 2R2SA 3MHYA 3MR5A 4JI3J 2ZDPA 2IC3B 4WF9Q 1VC6A 2W24A 2DO0A 2PMWA 4LVNP 1REVA 2VC1A 3ILOA 1DZ5A 3DXBA 4DR3J 4DWIA 3HHLA 4DS5A 1PJ5A 1R27B 3KLIA 1U26A 2O66A 1QSSA 3TEHB 1UL3A 3BQ0A 4L3NA 2WVFA 4QIFA 4YR2A 3RYLA 2VQEF 4PXCA 1LXNA 2VIHA 5LL6d 2DHHA 1RT6B 1VRUA 2AJ2A 3UPFA 2L9WA 2PFFB 4A8XA 2MQNA 5EGYA 3DMJB 3OR2A 5EDWA 2XMUA 1M1KT 3CT9A 3VZIA 3ETOA 3ADAC 1OPIA 2HIQA 2IA6A 2HNDA 4ZKAA 3OSNA 2BW2A 3OJUA 5LXRA 2HLUA 3M30A 3TVKA 3JXOA 3CJ5A 3V81A 4Y34A 1HHQA 2QTWA 2GQ2A 3AXMA 1HPZB 1U1MA 3D0HE 2N82B 2K1RA 2LEAA 4X66F 5B0BA 3LANA 4CRJA 4LF7F 3IM8A 4K4ZA 1SL0A 3O8WA 3QQCD 4DL2A 4KPCA 4ZCKA 1HBUB 5EX3A 4NA1A 5T41A 3KUHA 1C0UA 3NBPB 3R6LB 1KWMA 3GZ7A 2HNYA 1S49A 2KFNA 1S1WB 1BWVA 5F8GA 4QU6A 4OZNA 1DQ8A 2R7SA 2AX0A 2VG6B 3BN7A 1P8GA 3DI6A 4PG4A 2YH1A 1S4FA 3H8YA 2UU9F 3KFWX 4USUA 1T3NA 3DRSA 1BLUA 1SKRA 5GVQA 3RTVA 2JEJA 1HQEA 2FJXA 1B3TA 3DLGA 3QT8A 4F7VA 3TAPA 1S1UB 5J2PA 2YNHA 4EZ6A 5A8KB 3BB5A 5BYRA 3DHWC 4ZJOA 4C98A 5KFJA 5IZHA 3WX4A 1RAGB 2KYXA 2WOMB 4O3QA 2VQFF 4OJ3A 2XY6A 1YZ6A 1UFWA 3L3CA 1A6LA 4B9NA 2RHSB 4TLQA 2H5EA 5B0EA 4KBIA 1D8ZA 5KG2A 5ETLA 4GO7X 1PO6A 3H2VE 4JI6J 5EN1A 2F1FA 2CXEA 3GP9A 3MM8A 5CCMA 3G8TA 1UZHA 2OJ3A 5A8RA 1HW8A 4Y2MA 3W62A 2O5DA 2HNZA 3ZNUA 4DV3F 2CG4A 1Y5LB 2IVYA 4YY3F 1XIQA 1MMNA 4IDKB 2ZE2A 1N56A 4M5JA 3POTA 2U2FA 5KFHA 5DZ6A 2FGCA 4NYPA 4A8FA 2HFZA 5AE1A 1RTDA 3SQGB 1U8WA 3DHXA 1NM2A 4J9PA 1XNRJ 4ZPDA 2ALYB 2FLPA 1X4CA 1NPKA 3P3DA 4WE1A 4LSZB 1TFYA 2ZBIA 2R7UA 2AX1A 2N3OA 2QO3A 4X64F 4TVAB 2XY7A 2V8PA 4IRCA 3BBFA 2QC3A 3VCDA 4RR5A 3RBZA 2WSFC 1L3VA 3PVXA 3NAHA 3RR7A 5F0WA 4QYZK 2P2CB 2PT0A 2HHSA 3G86A 3W7BA 2UXDJ 1VQMS 1HBNB 3JSRA 3QFHA 2IRUA 2W2MP 4I6WA 2JLEA 4K4UA 4NZ7A 3T5HA 3ZZYA 2C2ZB 4K2JA 2QX0A 1VK3A 4J90A 2W01A 4DUZF 1RTIA 2KZMA 2KI2A 2HPUA 2B5JA 3MPYA 1IVZA 3NY0A 1YBUA 3M2UB 3JQKA 5ETOA 3RGIA 2G0CA 4CNZA 4LFBF 1IKXA 1SH3A 3GE9A 1SKSA 2J9DE 2R8JA 5L1LA 4PABA 1QAYA 3I5BA 4OZ3A 4RW4B 4QYZJ 1NH7A 2RU9A 5D4PA 4WWSA 3T5LA 3MAAA 3GU0A 4V19J 3QRQA 2BDPA 1LQ9A 1S1VA 2NSBA 4B3OB 1ELOA 1UTAA 5ETRA 2AEJA 4KRWA 1TK8A 2QZ8A 3ZO7A 3KK3B 4XPEA 1BY9A 5L39A 1Y3JA 3G96A 1VCTA 3ZC4A 4AQYJ 2B7CB 3DRRB 1N52B 4WTYA 2ATLA 4ECVA 2BUNA 1XNQJ 4KHMA 4RZRA 3D9BA 2W9BB 1XR5A 4ZA1A 2C2DA 3N0VA 1XMBA 4J91A 3SEOA 1MMDA 3OTOJ 4GMKA 2NXNA 2AF6A 2GHPA 1VOMA 4CLSA 4W92B 5IM0B 3ISNC 3NS7B 1KS2A 2BANA 5CYQB 4OYBA 2RD5C 1F9FA 1R6YA 3IR7B 3JSMA 2YNFA 2LQ8A 1FXLA 2P9GA 3ILLA 1N33J 4A8KA 2NXUA 3PFOA 3TAQA 2WAQD 1MROB 3HVAA 5KT6A 1NHKL 1OYEA 2G0JA 2XYPB 6AT1B 4DX6A 3D6MB 4IFVA 3LO3A 3WX8A 4O3RA 3QMQA 3GV7B 1M5SA 4N56A 4K5SA 3X3UA 3HVTB 4KO0B 2ZOMA 3MMCB 1N8RT 2KB2A 1XMQJ 3BR9A 1BQXA 4M5DA 2WVDA 2J6SA 3GYXB 5J1PA 1LWEA 4USWA 3LH2S 3T9NA 1S1XB 1S59A 5HVHA 1KOHA 4K0KJ 1PBAA 5KOWA 3ZTPA 3G6YA 2PIIA 4PYAA 4J9KA 1YRTA 4RL1A 2V4JA 2CZ9A 3WZ0A 2IRXA 1R31A 4LSLA 1U0HA 2CQ1A 1YQHA 3NKYA 4F8RA 3C19A 5G0RA 4NLRA 3VVTA 4JI7F 1H2UX 2ZH3A 3JSYA 3PYDA 3GG1A 2DPIA 3H40A 2ROGA 2BE9B 2CAJA 5A6PA 2V67A 4D3HA 3MUMP 2DBBA 4JI8F 4LF4F 3BO2A 2EPIA 3C6UA 3GIIA 4DV0J 1JLAB 3MEGB 4M5IA 3V4MA 3TWZA 4RU9A 1WKKA 3RZAA 4CLTA 2HHXA 4LF6F 3TA0A 3SCLE 4NCAA 1RWXB 5F9NA 1APSA 4CH0S 1R7IA 2ZEJA 2YVSA 2RE1A 4ZCLA 1RT1B 1U2CA 2HBZB 1FKOB 4FN5A 2E5HA 3CCLS 1GTHA 4DFPA 2HFOA 2H4YB 3FFIB 4ZVFA 1NSKL 1JNZB 2KXHA 4YB6A 5ETNA 1U02A 5HN0A 4YP3A 3WDOA 1JIHA 3PIOQ 2VPXB 4NLPA 2OPSA 1JKHA 1D09B 2GVDB 1UJ4A 2YWKA 4N41A 1FJGF 5RUBA 1S1TA 1XC9A 1S9EA 4RWWA 2VH7A 2X51A 2CQ3A 1C2PA 4IOCQ 1A7GE 2GCFA 4ZVHA 4RUBA 1H3DA 4B3RF 3DM2B 3D5MA 4HI1A 3RRGA 4CQ1A 3UD4P 4KPYA 2HGLA 4O4GB 3FSIA 4CO1A 1PG5B 2CNOB 1RT3A 5ETVA 2L3MA 5IQQA 3IM9A 1KSPA 3M8ZA 2N7YA 1ZA1B 3G87A 3CCWA 4U95A 2QLXA 2LCWA 4NXMJ 1CJUB 5HP1A 5IFMA 3I9ZA 2FZKB 2QG9B 1VQ4S 3GMGA 2A3JA 3M2RB 4U8YA 1VRQC 5C25B 3E01B 4TN2A 2MKIA 3RW7A 2VKRA 4I4BA 5F0UA 5F41A 3HXMA 2OPRA 2MQOA 1S99A 2XSJB 1QVGR 2MJNA 3CDEA 1S0MA 2ZC4A 2RS2A 3A3PB 2ZITA 2IDLA 1SC4B 4CCHA 2BVZA 1NLKL 4JBCA 4ER8A 3M9OB 1V5VA 3IBFB 3BSOA 2IJFA 5B0GA 3SV4A 5I3QA 1Y4ZB 2CPIA 4K8RA 2I38A 3OXLA 2B9EA 1UMJA 4NL5A 4F02A 5J2QB 4L73A 2HVHA 2BOAA 3GV5B 3EZ5A 4MH8A 3W2VB 1K0VA 2ERRA 2OEKA 3P4UB 3LGNA 2W4CA 4ELTA 3O6QA 1PBUA 1BD6A 2RQKA 3BPDA 2J0QD 1CS4A 4QIWD 4I7FA 4QPXA 3UCGA 2AQ4A 1CBKA 1YJUA 1VQ6S 3L95X 5IS2A 4I2QA 4P6QA 2VKZG 3SCIE 3N5BA 2DNHA 4BWMA 2YKPA 5HMZA 1JQGA 2D7SA 4DX7A 4LFCJ 1IBMJ 3HI9A 1UVNA 3TUZC 2HFSA 3CCVS 3FK4A 1J2VA 2AMCB 2NLWA 2YTCA 2FJAB 3DGPA 2ZBQA 4DFJA 4KJIA 3P8BB 1P1LA 2UV8G 4ECTA 1T03B 3ZTOA 4X4TA 2QSFA 3K5PA 2YWFA 2NQPA 3LPYA 4EUVA 2GIQA 1HNIA 3H5UA 4P10A 2IVFB 2HK3A 3C14A 4LIRA 3IWNC 2CG8A 5IC6B 4FF2A 4CZCA 1RADB 2I1RA 1TL5A 3SI8A 4CTAB 3KHRA 3HHLC 2CNKB 5HMWA 3AAWB 4O3SA 2ZWPA 2XYHB 4EU0A 2XMAA 4ZVRB 3QBCA 3HHNB 3KDOA 4OYIA 4UQTA 2BE7D 2X1BA 1CC7A 1HBOB 5JVHQ 2A0FB 2VZ9A 4ZVPB 3MM7A 4ZN3A 3SFGA 2V2VA 2WRMA 3MM5B 4FYDA 4J9QA 2XGPA 5J2NB 3A13A 2QT7A 4NZ0A 1FNXH 2RH3A 3W9JA 4OMFG 4I68A 2ACYA 1XMQF 3TW0A 3HKWA 2MZRA 2ZH8A 4I67A 3DLJA 2DHAA 4F2SA 1EZZB 1JLGB 3O5TB 1ROFA 3MUTP 3BGLA 1Y0HA 2NS1B 2YKMB 2VHGA 3L7PA 4RBUA 2W9CA 3UVJA 4IH6A 2JX2A 4IG0A 3K89A 3HHEA 4C11A 5MAOA 2K3KA 1IBLF 5IT4A 2EW9A 1RAOA 2ZH7A 1GFWB 2FYXA 4CM0A 2Z30B 1XTZA 3UWTA 2QSWA 3LP1A 2UVVA 3NS6A 4J9UE 1NBEB 4RW6B 1EETB 2X1AA 4DV0F 2AV5A 3K0JA 1RA6A 1FFSB 4FYWB 2Q6CA 2E7XA 2FD2A 4HKQA 3JQJA 3M6UA 4FPRA 3CIZA 2W9AA 3KLEA 3TVZA 4OI4A 4OJHA 1NK7A 2AP6A 3JYTB 2YY3A 4GVLA 3W63A 4JP8A 2R8HA 2RAQA 3MPWA 5DRKA 3NL0A 1AYEA 3AXKA 1TL1B 2QRRA 5EX0A 1K1SA 1NPPA 2N4DA 1WHWA 2E1RA 1KTVA 5LSRA 4OYZA 3OUYB 4PYDA 4JV5F 1F5BA 1VQ9S 2E1CA 3KLGB 3PHEA 1U1RA 2DNNA 1ZM4A 3HCXA 1VHFA 4ECUA 1XBWA 3DOMA 3W5ZA 5J2MA 1SKWA 4U6PA 1KEKA 1HHSA 4OX9J 2BW7A 4U9RA 1T05A 1NJZA 4W90B 4P2SA 4MIWA 5GADI 1DHMA 3ISND 1URNA 4A8WA 1Q16B 1TKZA 3GCXP 3TUPA 3R5AA 3ELHA 5FDLA 1HWJA 1U1LA 1Z2LA 3TANA 5A8WA 3M8QA 1J5EJ 3MF5A 4X4VA 1NDCA 3RAMA 4IR9A 2HIYA 2B8QA 1MLAA 2DNRA 4P73A 3CJQA 2HQ3A 3SQGA 3MEEB 3M8WA 3VAFA 2AYBA 4C48A 5A76A 4DV5J 2CZ4A 2D3O1 5HLFA 1ZETA 1RTJA 1IJEB 7FDRA 5CHCB 4IO1A 4TQRA 1YJ7A 3LOUA 2MY8A 2FJDB 4KSEB 5E33A 2W7OA 4L3KA 3S8SA 4DSKA 4OHXA 3M8RA 1IM6A 1YBTA 2FIUA 4DR4J 1VLYA 2ZNYA 4RBTA 4JOUA 3D4JA 1NJWA 2R2RA 1X0FA 1QE1B 4MK7A 1TR0A 4RWXA 3PX0A 2UXBF 2M9KA 1FXDA 2DGUA 1WOSA 3KJQB 2J9EA 2R42A 3R9LA 2FZGB 2HURA 2IA0A 4MIAA 4KFBB 4USHA 5KAKA 4L72B 4EFAC 1V3ZA 1VIXA 4HR2A 1VBXA 1UWBB 1UAWA 2V5HG 2CJYB 4H4MB 4DL5A 4ED4A 2AHOB 2IAJA 2W7PA 2QJ3A 2D3OR 3F0NA 4I2PB 3RR8A 4CLZA 1S6QA 5FLXY 2K7KA 1Q4RA 4K4VA 4ZLPA 4J9VA 2VBYA 4NI2A 2W2QP 4DV2J 2CPJA 4DF8A 1RBOB 4TLRA 2ZH1A 1S76D 1YJWS 3KK3A 1TKXB 1T9YA 3MECB 5B09A 2VFVA 3CJ4A 3FQKA 4LSNB 4X84A 2CDRB 1N34J 2GGPB 1B7YB 1T0TV 3R27A 4P71A 2E5GA 3FBFA 2V8DA 5KT3A 1LWFA 3AB4B 2DISA 3K59A 3ITHB 5D78A 2JOQA 2ZHOA 3M4XA 3LP0B 4B9UA 2JH3A 1NKEA 1LWCA 1XERA 4QBUA 2GMLA 8ATCB 1EQ0A 1FJCA 1TL7B 2KJVA 3W61A 4DQIA 3BSAA 1IBMF 3HK2A 4DR5J 4B3TJ 1JMTA 3L7OA 3QO9B 3KK2A 1N5YB 1VFJA 2B6AB 1MWZA 5FJ4A 3PW2A 3BH7B 4LF8F 5L1JA 2V2ZA 4ZPBA 4Y6IA 1VQOS 4ZDNA 2R7XA 4FVCA 1BQNB 1NJYA 4PUOA 1S6PB 2Z56B 1V6HA 4S0MA 2RF2A 3A8EA 5F8LA 2VA2A 2FHOB 3MOJB 2K3IA 2F4VF 1CSJA 1OIAA 3PEJA 3C6TA 1PYSB 1T02A 2H65B 3UO0A 4WKYA 2VC0A 4OI0A 1TL3B 1RAHB 3FZ2A 1S9GA 4U7UD 1CPZA 2KRBA 4N77A 5HQMA 1F0XA 1B0VA 2JFDA 3VZHA 1C0TA 1X4EA 3I0RA 3PKYA 3FRYA 4CYUA 4J9MA 1HD1A 2MLXA 1Q8BA 3VHQA 2DGSA 2GC8A 1FRIA 1T9TA 5KG5A 2DT9A 1KHVA 2NR0A 2KH9A 2MYFA 2YX1A 4UY85 5GMKa 4BLGA 3I6PA 3JQMA 1S7IA 1V3SA 2UUCJ 2DNYA 2YX7A 1MNEA 2HFUA 1JJCB 5AXMA 2QMWA 4CH1A 2NUHA 3H4BA 2CPHA 5CXTA 3DDIA 1G7CB 2BE2A 2AZ3A 3VVUA 1U1QA 1ZPWX 4U67Q 4NLGA 4WIIA 1GMUA 3AODA 2UUTA 3SIPB 1W26A 3A1YG 2XMMA 1H2VZ 4USTA 1UJ5A 3W5XA 4YR3A 4A46A 1HIYA 1WKLA 3N79A 1E6YA 1FERA 3LP2A 2Y1JA 2KDOA 4RKUC 5G4DA 2ZH6A 1S6OA 2G0IA 2GO8A 4TYAA 4JYAF 1N0UA 2I6WA 2FB0A 1UZDA 5KFBA 3K58A 1ZAXA 1HFEL 4HEA9 2F65A 2MXYA 2VJUA 4KYZA 1JWWA 1HNZF 2QEXS 2IM3A 4IFYA 2HKEA 1LOUA 2R8KA 2ZUAA 2GAHC 1IKYA 4R5PA 1HWIA 4FP9A 3UDEA 2QV6A 4C8KA 2W1BA 2BJ7A 4X4NA 1RB0A 3AH6A 3R97A 1WEXA 2XZWA 3N01A 4BC9A 1KTQA 3HHLD 3M2RA 4DSLA 5IT0A 5C25A 2ZD1A 4DJBA 4EO8A 4WIQA 4NLWA 5CCLA 2DEJA 2P8IA 1WJ9A 3KG0A 3MAHA 3R5BA 4B9VA 2XGQA 1JLQB 1JLEB 4ZPAA 3DCAA 3MZIA 2KTQA 4XK8C 5A6WA 1CULB 5J1EA 1J5EF 1WG5A 1NPRA 2OPPB 4NOHA 3MTJA 1VYAA 3QIPB 3IBWA 3MEKA 1U1NA 3I87A 1F9EB 1AUDA 4OZ2A 2AJ1A 2GIFA 3BYRA 1C1BB 2VBXA 3CD7A 3H5XA 1YITS 4O0NA 4HLBA 4QCLA 4DV5F 1DTQA 3UFCX 4PWUA 5E2QA 4ANDA 2JDJA 4O3OA 3UN3A 2ZVIA 5J2QA 1TFWA 2HRUA 2MSTA 3Q8YA 4C3LA 1FDAA 1YSJA 2CJXB 4URSA 3J81j 3Q89A 4EGLA 1NK6A 4F4XA 1VR6A 2DJWA 2C3PA 3MM6A 4ICLA 2BJEA 2CPYA 3DLKA 2O67A 2NSCA 2NUUG 2BJDA 1URRA 1YHQS 5D3GB 2HGNA 1UFKA 3V4IA 2HWTA 3QT7A 4UF4A 2C2EA 7AT1B 2K2PA 2CJ9A 4WK3A 1YKWA 3LALA 4FS1A 1T95A 1EHWA 5KFKA 5LMNJ 1FXRA 1TVRB 3OLAA 4AL5A 2WVCA 1EQMA 2DNPA 5KOXA 2AJQA 1XK8A 2H3EB 2P6SA 3WC2A 3FBCA 3OHAA 1LWXA 1WD6A 3J7ZT 4G3IA 1HA1A 4N8OA 2YWGA 2C2OB 3NWGA 1RKJA 4EBCA 3VAIA 2LDYA 4OYAA 1UJ6A 3U02A 3OW2R 1NK9A 3TR5A 4DV2F 1T7PA 3ILJA 3MUVP 1SJ3P 1RU1A 1A9NB 4PWDA 2F4FA 2DNKA 2UXCJ 5HK4A 1IKWA 5DQHA 5C2GA 2OPQB 4F25A 2DR5A 1LFPA 3B54A 1VC5A 2G13A 1SUQA 2M5YA 5M2PA 1TV6B 2ZZTA 3BREA 3CD5A 3QNWB 5AXKA 3VGVA 2E7VA 5IXUA 4B9SA 3K8WA 2CJAA 1TTHB 2JNJA 3OTDA 2D74B 2ASJA 1JLBB 1GX5A 3I5AA 1RSCA 1FCAA 3JTNA 2HS0A 2ZHAA 3KG1A 3A8IA 4ZJQA 1T9XA 2FHJA 1WI8A 2ACMA 4B3TF 2CQBA 3AA9A 1R8AA 1SJ1A 4Y00A 3CJ8A 3N6NA 3ISZA 3TZZA 4EYIB 2R2TA 3KK1B 3AY0A 2OH2A 3V6DB 2QL9B 4LF5J 4N47A 2EI5A 3QLHB 4NMXA 4BDPA 4B3SF 1KHWA 1TMJA 2HAFA 1D1UA 4QU7A 5C24A 2Z57B 3SYZA 2XCAA 4LRFA 3BKFA 2ZH9A 3GTYX 1FKAF 1JXLA 2F3JA 1H38A 3T9ZA 3GQCA 4K5RA 2BOPA 5B08A 1SL1A 4ZJLA 4JI4J 3PW0A 4P75A 4CLFA 3MFIA 2IRYA 3PR5B 1TZ0A 4MKVA 1O6XA 1LFWA 3UCZP 1FE0A 2LXUA 3HFKA 3MMJA 3ONQA 3NCQA 1WTFA 3T1YJ 4C8OA 5HBMA 1DFDA 4IUFA 3U1NA 4KKOA 3FDSA 2AJ0A 3UR0A 1FESA 1ZOTA 3GCWP 1T94A 2E44A 3CJKB 3B8HA 1ICEB 2C2NA 3CC4S 4IG3B 3P49B 2D41A 4CLUA 2J0WA 4JV1A 1RA7A 3DOKA 5DQIA 1J5OA 1TK5A 2AJ4A 5KT2A 2FZCB 1HYSA 2GVZB 1YTYA 2F5GA 3A8JA 5B7WA 5FD1A 2VICA 4RU2A 2HMIB 1HARA 1S12A 3MD3A 4GVBA 1NKBA 3THTA 1BHNA 4PCQA 4TU8A 1YJRA 2JZ5A 3RRHA 3GONA 2M8DB 2V50A 2VASA 2JFKA 3F44A 3NLCA 1MU2A 1Z4UA 2RS8A 3OBIA 2F7VA 4UZBA 1UVMA 3F73A 1HR0F 2IBKA 2XNRA 4OZ0A 2IYIA 1ULRA 3KLGA 3UCUP 3IS9B 3M32B 4OJGA 2MQPA 2R8IA 3NAIA 1Q7LB 3HHDA 3PYGA 1AB8A 4OLPA 5I3UB 5DJBA 2BEFA 3QGGA 3AHPA 3W65A 4OQJA 1RT5A 1IBKJ 3C15A 2IDEA 4DSFA 3T1HJ 1CJKA 1YGYA 4ES3A 3H5YA 2PMHA 3CCRS 1HL6A 5KG3A 3OT9A 1LW2A 3O2IA 1YIJS 3IP0A 3LGMA 1R6VA 2DGQA 1D8YA 4JI1J 4DR7J 1SBRA 4QWEA 1R8PA 3HVWA 1U47A 4BWJA 3HT3A 3I5CA 1HMVB 2LVWA 3BKTA 3Q8PB 2OIHA 2J0SD 2G2ZA 3EDRB 3U7JA 4HDHA 1R8BA 1NDPA 3D0IE 5LMUF 2LECA 4KQZA 2VBWA 2RRAA 1D9AA 4ITSA 3OL7A 4IR1A 2AYMA 2XBPA 3EYZA 4PWWA 5IWAJ 1XWLA 4OHYA 3KLFA 1WOPA 2CPZA 1P27B 2ZVSA 4Y28C 3UQSA 4DN0A 3VTIA 2XWYA 1YG0A 2DH8A 3J7YI 4ZP7A 1NUEA 5H9FK 2GMJA 4FVMA 4DPXA 2ASDA 1QE1A 3G4SS 3M6VA 1SJFA 1S48A 1TKTA 1EKSA 1RYRA 2MLYA 4K2XA 2FLNA 2BMBA 4WP3A 2ZOFA 4DQSA 4TU9A 4AL7A 3S01A 4ES1A 2P9EA 4DPTA 4HI2A 4Q8FA 3LF0A 1CC8A 4KGVB 5KFDA 3MMAA 2I5JA 4J9OA 1QVFR 2E5JA 4I2PA 3FCVA 4MK9A 4RW8A 1RT7A 2RUGA 1GQEA 3BPSP 2WONB 5AE3A 5H9FJ 1XR7A 4QW8A 2Q3PA 4DFKA 2PFDA 2VOPA 4ECYA 2KG0A 3G82A 1FHTA 3A12A 5I42A 3LGHA 1Y5NB 1MWQA 1GEHA 1FD8A 3GFYA 4I0WA 5D0RA 5E7OB 1K47A 2JHEA 1OQ3A 3K5OA 3ZZOA 2M52A 4P2FA 3CULA 2DCLA 5LMNF 2EEYA 1FWKA 3M8SA 1WSVA 2VFRA 2J5AA 3OXGA 2YNGA 3ZTQA 1U6BA 4ZP9A 4LR7A 4QPTA 2V2KA 3NNCA 4DFMA 3GSIA 2K7JA 5HAOA 3FNNA 1RWOB 4FXWA 5K5MA 5K8OA 1NKCA 3JS9A 4PQUB 2CYYA 3K57A 3T41A 2V4QA 2UVWA 1WNEA 2VPYB 3BJYA 5CQGA 2C2KB 4HYKA 4IRKA 3I0SA 3M6XA 1S6PA 2J7UA 3BO4A 1QTMA 1QAIA 4B3MF 4B17A 4K50A 3DU6A 4YEAA 4OI1A 3T3FA 3HVRA 1MW7A 4C8MA 1F5CA 3WQPA 4JV0A 5JMNA 2CJQA 2VD3A 5THWA 1B70B 1XR6A 2CNLB 1OMSA 4A4JA 2DXEA 2M0GB 1X4BA 5BXIA 3DLEA 2CPXA 4RW7A 4NX9A 3NNHA 1RLDA 3TA2A 4KH1B 3MEDB 3HP6A 1KD1T 3ZZ0A 2HW3A 4DG1B 3GV8B 4F4AA 4LF5F 4YB1P 2HVEA 3R5JB 2PA8D 1RTHB 4AXIA 4AXJA 1Y9OA 3CCQS 1I5OB 1N48A 1MG7A 5C42B 4USVA 4I6YA 1VBZA 3JTPA 1VQKS 3CEDA 2APOA 4ZPCA 4ECXA 1TUWA 1VQLS 2EK6A 1RABB 2CJKA 2V8VA 3GIMA 5H9EK 1VRTA 1KBRA 3M2VA 4RNOA 1HWKA 1OSCA 5HROA 2ZH4A 2B7BB 1TUVA 1NRKA 2ILZA 4YFUA 1WORA 1CQNA 4MFBB 3LTOA 4QR2A 1X7VA 2CRLA 2GNKA 2VA3A 4ZVGA 1UETA 3I96A 2N3LA 1Y3KA 2B4VA 3THPA 4C2MA 3VV2B 4R8UB 3RBEA 4Q2LA 3WIVA 3OPKA 3HSZA 3PV8A 2NYHA 4ED0A 1WEYA 2MZJA 1NMEB 4F67A 2PD1A 4ZCIA 2UV8A 1X9SA 4ENOA 4G1QB 3DDKA 2FDNA 3SDEA 2W25A 3M9MB 1B0PA 1Q7YT 5DO2A 5H9EJ 3MMBB 1BQMB 3FC9A 1L3TA 1WC6A 3RJMB 2HFVA 5CABA 1WEZA 3TQEA 2XS7A 5CD4H 2UUWA 2HBYB 5K20B 5A0YB 3R2DJ 1MSWD 4PG8A 2E7WA 3GJTB 5AXLA 2LYVA 2BRKA 2Y0SD 2RDIA 1I94J 5DDRC 3KJVB 1SPBP 1AZSA 1M1GA 4HACA 1FI4A 2AWZA 2LKZA 4X62F 3DOLB 1KLMA 4DL4A 1H0HB 2XB2D 1PSDA 1IBKF 3TI0A 1PC5A 4QZVB 1FEHA 2CVEA 2D9PA 5LJ5Y 4NCGB 1N6QA 3OV7A 2CQGA 2V8GA 1HNWF 2C2MB 2HHQA 4KIAA 4DS4A 4M1KA 3DYAA 3C66A 2YPYA 2VFSA 1UA1A 3CO0P 4OZJA 1SV5B 4YHHF 2YKNB 1RDRA 1R0BG 1KQFB 4DUYF 2IHR1 1XQIA 1H7XA 4U7UK 1Q8LA 2QA4G 4MAKA 1ZA2B 4LVOP 3HFZB 4FBUA 2WSEC 1FKPB 5IWAF 3NRBA 3Q8UA 1OYDA 3I4PA 4ZPVR 1UPPA 1RLCL 4JV2A 4C9DA 4Q0BB 2VOOA 2V8HA 2MSSA 2DH9A 3VQTA 3QGPA 1NK8A 1WC3A 3K5MA 2WHOA 1OO0B 4BBYA 4CDIA 1TU0B 1CJTB 1VMBA 2Z4PA 2XG8A 3CJ3A 4OV6A 3G6XA 1RCXB 1F5AA 2EFGA 2E5LJ 2KT3A 4WJBA 4CWBA 1REVB 4ZOSA 1FTRA 3ZZPA 2DB1A 3HHLB 5I4MA 3KLHA 3KLIB 1S57A 2HS3A 2JWNA 3EGZA 3M1VB 3HJVA 1PKUA 2Q79A 2RDJA 1HNXJ 1OJ4A 4KV8B 3BSCA 3N4WA 1Y7PA 4BCAA 2CZVC 3IWXA 1AFJA 1Q0NA 2DO4A 1VRUB 2G1DA 2HYIB 1VQ7S 3A3NB 2DK2A 1SXLA 2PA3A 4ZLJA 2M88A 1AA1B 1WUUA 2DR6A 3TAMA 4IOAQ 5M2UA 4EMDA 3OR2B 1C4AA 4C6AA 2ALZA 3W60A 1SB6A 1HBMA 4NA2A 3F56A 2VDHA 3H2LA 3LAKA 3J81Y 3NCPA 1FRKA 3UI3A 4DU8A 3EZOA 2WB1D 1QAJA 1IXKA 1OY8A 2MPUA 3MR6A 2LU1A 3M30B 2J9DA 5D15A 3V81B 4FKYA 4RNHA 4GC7A 1RWVB 2DEIA 1IR1A 1SJ4P 4PQAA 2YQ3A 2VBZA 2D9OA 5B0AA 4FPIA 2W2PP 5KFWA 1NH8A 2WBMA 2KFYA 3TEGA 3SBMA 4LFAJ 4R0JA 2B3TB 1R8CA 2UP1A 1X4FA 1QTNB 4KGXB 1FRMA 1T11A 3EZUA 4FS2A 1FX4A 2BA9A 4FBTA 2HLTA 5HVGA 4PKDB 4O3PA 1RKIA 4WBFA 1C0UB 4JI2F 4CNYA 4PAAA 2LP4A 4G1PA 3WBZA 2HNYB 3RAQA 3ICLA 2BM0A 1K73T 2DHSA 4ED5A 2CQCA 5T7LA 1DARA 3SMZA 2XLJA 3BGUA 4C97A 1RJJA 4LRCA 1GX6A 1HI8A 1L5UA 3CB4A 3DRSB 5D4OA 5CD4A 1HQEB 1Q86T 1HQUA 5D0HA 1EB0A 3DLGB 4DN9A 3CPWR 1S6UA 3E2EA 3FCWA 2W4DA 2BQ3A 5J2PB 2YNHB 2I9SA 4WK1A 1G6BA 1N36J 2UUBJ 2MGZB 4CLPA 3RB0A 3QWPA 4B08A 1ZAWA 4X65J 3DFEA 3S7RA 3HM9A 4DV6J 2DIVA 5KFZA 5BR8F 2BYCA 1CLFA 3TJ9A 4B9TA 1VLOA 4MYUA 3MM8B 4U7CA 5A8RB 1OQ6A 4CIOA 2J6UA 1UEUA 4HHUA 3I82A 2OMLA 2DTJA 2HNZB 2VG5A 2XLIA 4ZVEA 3DRPA 2ZE2B 1WWHA 5DG9A 3POTB 4DOZA 3D6FB 2OI2A 1B99A 1N5VA 4CT9A 3KHLA 2G2OA 4ECZA 2MHNA 1RTDB 4QOTA 5BYQA 1IR2A 1FK9A 3W1YC 3CC7S 1RCOB 4WE1B 5ETQA 1C1CA 1RQ0A 1NHUA 2VDIA 2G9OA 4QJVA 2XI2A 1YI2S 3NS5A 3GILA 5EHHA 2KYZA 3TO8A 3GB0A 3W9HA 2ZZMA 4EZ9A 3G6VA 2VF3A 4C7QA 1NK4A 2AW0A 1WHYA 2E66A 1SJRA 1JLFB 2QA4S 1KQSR 3LAMA 4I56A 4WU2A 1X5SA 4ZHRA 2FJVA 3R6GB 5KT7A 4DR6F 1RTIB 3QSYB 1H98A 2B5JB 4F0HA 1UKUA 4RBVA 2EG1A 2Y0BB 5D8HB 1EJ7L 1ZZFA 4O4RA 2BQUA 3VGSA 1VK8A 1RTZA 2L41A 2DGTA 4C3MA 2VG7A 1N5TA 3IAM9 3VAHA 1IKXB 3BGRA 3FUYA 3IG1B 2R7QA 2BJ1A 2W4PA 2AGQA 2GHWA 2QA2A 2Y8YA 2QMUB 2DNOA 2HQFA 2M7SA 1K8AT 3MAAB 3RB4A 3NGRA 4WXWA 1S1VB 2L08A 3TA1A 1AUSL 4JI3F 4P52A 5L46A 4F2RA 2ZJQQ 5LJ3Y 3CF5Q 4CLLA 4KC5A 2F40A 5DLGA 4LRAA 3DLLQ 4DR3F 5HMXA 1Q82T 1UVJA 5IV4A 1F3VA 1YK9A 2D1CA 2N4CA 1T9WA 2E5IA 4DL0C 4WFXA 2VV5A 1NEEA 1OY9A 3MM9A 2EFQA 3H20A 2WSCC 2FVPA 4ID5A 3CIMA 2QYGA 1FDBA 2BANB 2BKPA 2CWKA 2JVOA 2VQEJ 4OHWA 4USMA 3JSMB 2YNFB 2EFNA 3KLVA 3OFGA 3CCJS 1QAXA 4B02A 4CP5A 3ENAA 2IMWP 3PY8A 1IR0A 2M8HA 1TAQA 1SVDA 1RWWB 1AFIA 3Q22A 2HZCA 4CI0B 2PO4A 3FBEA 4IFVB 7FD1A 3D3CJ 4LREA 2NREA 4O0IA 2CADA 3BDEA 2BJ3A 6FDRA 1KR4A 3ZZRA 4HDGA 2R7VA 2GZOA 4HL9A 4WZMA 3QGIA 5KFXA 4QWAA 4M5DB 1WC4A 3IGVA 1LWEB 1R0AA 5D6GA 4WYWA 4QIEA 2EFOA 3PR4A 1X31C 3HKZD 4UOFA 1JLCA 5IT9U 3TP2A 4P9SA 3I4HX 3D6TB 4LF7J 2OEMA 2ILYA 2F9DA 2V4JB 4NE9C 1O0PA 4LSLB 1U0HB 2B0GA 3MCNA 3W9IA 4DQQA 5G0RB 3P6YC 2GV1A 3ET6A 1X8DA 4OI2A 3VF0B 2OP5A 2M2BA 1X4AA 4H4OA 4I1TA 3D0GE 4F04B 1RT4A 4GRSA 3R2CJ 1G4CA 3C6UB 2MTLA 1S5ZA 2LFVA 1K9MT 3N6LA 2YNIA 3M7VA 2PSZA 3KJNB 1KQKA 2YWWA 4DV1J 3PJ9A 1WG4A 3THVA 3BBCA 3VALA 4NASA 1CJVA 4CM2A 4DCJB 1U8SA 4E8UA 2KKHA 2XO7A 2AEMA 3D68A 2R4FA 2ZJRQ 3V6HA 4IRDA 4DX5A 5L38A 5A2QU 1KFSA 3NXZA 4PG5A 3CGIA 3U27A 3QFWA 3FMWA 2XNQA 3KUEA 3PFEA 2VB6A 3M8PB 4JI6F 2IYGA 4OIXA 1M5VC 1RTHA 2HS4A 3IAS9 2OPSB 4X4SA 5KFIA 2OEJA 5K14A 5C42A 3PEHA 5HMYA 1VHIA 3QATA 4ES2A 1S9EB 2BXJA 1RAJA 4IQMA 1TMMA 3D1HA 5C2CA 1DRZA 4O44A 2FVCA 3IRXA 2EWHA 2BJ9A 3OR1A 1FRHA 3M05A 3SFUA 1ITPA 3SCJE 2ZZNA 2UVRA 3W2WA 4YDDB 4DV3J 3OFHA 2JSXA 1VQPS 1FWLA 1XNRF 4KH0B 4EBDA 1RT3B 3CSKA 5GAHU 3DXSX 5D77A 2KVQE 1VQ5S 4WP8A 3WHIA 1VI7A 1WKJA 3RRKA 4DCPB 1FD2A 4RW9A 4ECRA 4LBPA 3KNAA 2AD9A 2Z58B 1N36F 2KM8B 2UUBF 4OX8A 2RHQB 2C2RA 1N4LA 2UXDF 1M5OC 2LLZA 5HP1B 1WDDA 4X65F 1HNVA 4KGMA 1KRPA 5AT1B 2M70A 4WPAA 3EWGA 2P6TA 3C2PA 5LOQA 1EX8A 3PJXA 2EFVA 5LT5A 2OTLS 4YUDA 2OPRB 2QYCA 5E5NA 1IKVB 1RISA 3PTWA 1XEZA 3CXCR 2YX4A 5K8MA 3VAGA 3BDPA 2QLWA 4EBEA 4DUZJ 1MN7A 4Q8EA 2KZZA 4FF4A 3KHGA 1WI6A 4CLWA 3N5FA 1NZ8A 1DLOB 5ETTA 1U25A 1G2EA 2ROEA 4IYQA 1HD0A 3TZXA 3G2XA 2V94A 5GADU 4OX6A 2IJRA 2CFXA 2HK2A 4EK2A 5CZXA 2H1YA 1SH0A 3EXYA 1QJHA 5T14A 1WC0A 4O3NA 5E41A 1LV5A 4AQYF 4DZ6A 2FHJD 4NCGA 4LR9A 4LUBA 2IC3A 3SV3A 1XNQF 1U2FA 2DRAA 3TUJC 3PX6A 2COLA 3UDCA 3OHBA 2NXCA 3AJ2A 3OTOF 3CMES 2MQQA 1CS4B 2Q66A 2MKCA 2ZKTA 4I7FB 3SCKE 5HO4A 4LT6A 1KN6A 2LEBA 1RT6A 4I2QB 1XJWB 4ERDA 1N33F 1DTTB 1LW0B 1SJQA 1RAEB 4OHVA 4YN3B 5FIIA 3DMJA 2HZVA 3NWRA 3ETMA 1HW9A 1RBAA 3CCZA 2DGXA 1YJTA 2CVIA 2XZDB 3HULA 4F26A 5AJ3J 2ZM6J 2IM0A 3DGPB 4I64A 5E3AA 1XMOJ 6FD1A 2Q6BA 3ENWA 1PGZA 3KKFA 2MKKA 2ROPA 1QM9A 3MOZA 3GFHA 2R7TA 2Q43A 4RNNA 1Q8IA 4ANEA 1BC6A 5KG4A 4OYPA 1RUSA 1HNIB 3AQPA 3NEKA 4LBHA 1J27A 1HPZA 2FJWA 3C14B 4K0KF 1Q53A 5ETSA 4IH7A 4UT4A 5KFSA 1PJ7A 1YLXA 2FY8A 1Q5YA 2MZ1A 1JXEA 1QUVA 3VWSA 4CO2A 1QDUB 4PEOA 1VJQA 4TKTA 1BXNA 5GAHI 2LXIA 3M1VA 1S0NA 1HBUA 3GYGA 2YXLA 2OFHX 1WC5A 2XWXA 1VIOA 4KV8A 4AUKA 1EP4B 3W8GA 2NCKL 4FZVA 3NBPA 4UTGA 3T5JA 4AFFA 3CMQA 4JI7J 3EVWA 1S1WA 3OVSA 3OFEA 4JUZA 2AGPA 1YVFA 3MM7B 5KG0A 2VG6A 4JI8J 2C3MA 4LF4J 3DC2A 1WACA 1S79A 4U8VA 4CLYA 3PW7A 5DLFA 3AT1B 4ED6A 1L3SA 2O3DA 5DGBA 5LXYA 5KFUA 4LF6J 1X0PA 1YX2A 2DVIA 2OAUA 1S1UA 2HQCA 3QWUA 5A8KA 1C4CA 2IMOA 5KFRA 2W9CB 3UVJB 2BX6A 4IG0B 2MKJA 3CJSA 2WOMA 4C11B 1N88A 2FHKA 2IIHA 3GJRB 2CDQA 1SKUB 5CYJA 3MTKA 1WC1A 2G1HA 3OVBA 3TNVA 3PKMA 4URGA 2ZBCA 5HJYA 1H2TZ 1WSRA 3ZNJ1 3IO1A 4FYYB 3LP1B 4V19X 2UVUA 3FBBA 2XS2A 4N8NA 2FLLA 1I3OB 5KFOA 1SQEA 1FJGJ 2DKOB 1MWYA 2IPOB 4B9MA 2XHCA 3P45B 4DL6A 3OSPA 4IDKA 2GIRA 2O1PA 4DV1F 2KVIA 4B3RJ 5KT5A 3ILIA 4PPDA 2K06A 4LRDA 3KLEB 3UW1A 5BYSA 4M63A 5GAGI 2GJ2A 2IM1A 4NXMF 1VBKA 1SQFA 1FT8A 1U24A 3EPGA 3IA0A 4J9RA 3SSSA 5HANA 2MGZA 3OLBA 2WTFA 2VODA 2XMWA 4Z7CA 3Q0AA 1UFLA 1Q78A 2GAGC 1U09A 4IKAA 1HBNA 4UOHA 3DOMB 5J2MB 4DXLA 1NO8A 2Z2MA 2ASYA 1CEZA 1ZPVA 4GKKJ 3ZZTA 5JVGQ 1T05B 1P1TA 4OV1A 1NDKA 3HD1A 3KWMA 3TX8A 5GMEA 2DR7A 1CG2A 3QIDA 2NYIA 1KVIA 1TKZB 2NPIA 4L76A 3M2UA 3D6HB 2PI5A 2HRTA 4DR1J 5FDLB 2XO6A 2HBRB 3HHKA 3V5RA 3GYNA 1JXVA 4W4MA 5A8WB 3M8QB 1M1HA 3K5NA 3MAQA 1IBCB 4MKBA 1PAUB 2M4MA 4RW4A 4XAKA 4NMLA 3CCES 4UY8T 1AROP 3NGTA 2DNGA 3R7NB 4YMEA 1FNOA 1T8EA 3OVAA 4B3OA 3OL9A 2OLWA 2E1AA 2H9ZA 5F8NA 1EAYC 5HLFB 1RTJB 1FJ7A 2DIUA 4K4XA 2EC0A 3R7SB 2EFPA 5I3PA 2IM2A 4HHJA 3TOQA 3NG8A 5EWGA 3MCSA 4P7TA 3DRRA 3GIKA 4JB8B 3IRWP 1JLFA 4NRTA 2PEHA 2W9BA 4ZVSB 4DU7A 4Q2MA 2HVIA 3IWLA 1PILA 2LA6A 4A8SA 2HFNA 5IM0A 1NB2A 4ECWA 5CYQA 4PZVA 3DLBA 2YPZA 2FQQB 4LFCF 1KVKA 2JL9A 3JTOA 2PC6A 3QJLA 4FYXB 2CQ0A 3IG1A 2RMLA 1BE4A 2X3GA 1H74A 1MROA 3UR3C 1X9WA 1TK0A 1EKRA 2C3OA 2IAJB 3BSNA 2XMJA 2RKIB 3FKBA 1S6QB 1D9DA 5LSLA 2PE8A 4EWTA 2HVZA 4NI2B 1YJVA 2MJUA 3HVTA 4KO0A 3MMCA 1ZM9A 2KHDA 3IC1A 3GJQB 5KFYA 3CMAS 4F36A 4D3GA 2C3UA 4DPOA 1S1XA 1SIZA 4PG6A 1SI9A 5JXSA 3N9UC 2B9YA 4BHQA 3TUIC 2B9WA 3J81U 1R3NA 2YH0A 4AD6A 4TNOA 5E3PA 4YQWA 1WOOA 1LWFB 3VGUA 4HVZA 4HTJA 1S0OA 4FDFA 1S7HA 3BH6B 3R3TA 1MN9A 2DCUB 3QAEA 1LWCB 2VUGA 2FY1A 4J37A 1QSYA 4ID8A 5F3TA 4OYMA 2VU5A 4NEYA 2HG4A 1HQ2A 4CO0A 2XS5A 2LQ5A 1Y10A 5AJ3F 3KK2B 3S1TA 4F4ZA 2ZM6F 1XMOF 2DRBA 3HD2A 1JLAA 2EBEA 3E51A 1N5SA 3MEGA 4N5SA 1A0OB 4Y2AA 2XMTA 4PXEA 4BS2A 3ZZUA 3N28A 2KO1A 4NLSA 4KGKA 5LM7E 4PUOB 4F4WA 5KFPA 3HO1A 4X4PA 2RF2B 5CAAA 2DRDA 1UVLA 1RT2B 3H2UB 1RT1A 4O23A 1DURA 5KT4A 3QZ7A 2EKNA 3BQ2A 1VQYA 1FKOA 3J80U 1I1GA 4CO3A 3C6TB 2CQPA 3UNGC 5IV3A 4HTIA 2A2DA 3FFIA 1LKZA 3MR3A 3JAMY 2QMXA 4RX6A 1S9GB 4WXOA 1Q95G 2KFZA 1X5TA 1IBLJ 2WW8A 4NRUA 2GVDA 4A8OA 1F3FA 4E2FB 3Q2TC 3L7UA 1OWXA 2AZ1A 1C0TB 1FVQA 4OYWA 4HH1A 2C42A 2FPHX 3I0RB 2V69A 3CJ2A 5HI7A 8RUCA 4CYUB 3LWLA 4AYBD 4M95A 3DM2A 1EIYB 3Q24A 1W25A 4O4GA 4A47A 1FA0A 4A48A 4NLQA 2HVDA 3MPDA 2CA9A 2CQ4A 2AKWB 2BKNA 2ZBRA 1FF2A 1KDNA 3CWJA 4OZ5A 3D67A 4DCOB 4A8YA 2E9TA 1OPZA 4C0BA 3PZPA 2H4WB 2XSFA 3R1LA 4XDCA 4HT5A 5DQGA 4F4YA 4LMZA 2Z2LA 2QGFB 1YRXA 3PDNA 1CJUA 1GMVA 4LIWA 1UA0A 5F9LA 3MCMA 4RLEA 3ULHA 2BE2B 2HQIA 4C8LA 4OX9F 1F2HA 1S97A 2FVRA 2MY7A 2W2OP 2IBOA 3PO4A 4JV5J 3M8PA 3E01A 4QYRA 4F3QA 3V6KA 1I6JA 2GA7A 2JVRA 1GMWD 4MKYA 1LXJA 1U6ZA 2FHMA 2XSJA 2NXEA 3PRVA 2CIMA 3KYLA 2GS8A 1E6YB 3KG4A 3FVYA 3GSDA 3IXQA 4Z37A 3LP2B 1N0VC 2KL8A 4HHHA 1RWKB 3BV8A 1YJ9S 1RHKB 3HSJA 3US5A 4RUCA 2W2NP 4ED3A 2B43A 4F0MA 1EARA 2IJNA 4M5NA 4N7TA 4Y3CA 4F50A 5SUHA 5CYMB 2HHTA 1X5PA 3HF5A 2O01C 4H54A 3W66A 2XQCA 4FF3A 4IFYB 3VAMA 2LEPA 2HAIA 3EICA 3DU5A 1IKYB 4KGZB 4N76A 3AOAA 2A6OA 1IQTA 2HEKA 1HLWA 3GFZA 2HZAA 2XYGB 1PCAA 4R5PB 3BR8A 3W2VA 4TQSA 3BM7A 4GKKF 4DR4F 4DLGA 2GJFA 3G9CA 2GFFA 5DM6Q 4E0DA 3BZQA 2ZD1B 4Q5VA 3OTCA 3U1LA 2B9XA 1NJIT 1GTEA 2FVSA 1X4HA 4YDXA 3MURP 1IKVA 4DR1F 3HMJG 2UXBJ 1V3RA 1Y5IB 4DPWA 5DM7Q 4OFZA 5KFNA 2RU3A 3PYEA 4ZVTB 3OFFA 5J1EB 3B82A 3RW6A 1DLOA 2YKQA 3TJAA 1B4SA 2V9KA 2VL1A 3GR1A 2Y1IA 1KP6A 5KFEA 2V34A 2R7WA 5L9XA 3QAUA 1UP1A 2EKYA 1DTQB 1T03A 2CPEA 3P5BP 3QGHA 4ED1A 2RQMA 2FLOA 2XM3A 3C16B 4KB7A 2FVQA 3TARA 3W8PA 3FCHA 4NEZA 1N34F 4F3OA 2FJEB 5HQ8A 3J7AN 2WVBA 3OXFA 1BMQB 3MM6B 4ICLB 1ZYQA 1YBAA
chains in the Genus database with same CATH topology
3DLKB 2YNHB 2GGPB 1TP7A 2I9SA 4WK1A 3VQSA 4R8UA 2BABA 4CTAA 1G6BA 3R27A 2BV3A 2E5GA 2WBRA 2MGZB 2MQMA 2X1GA 3CTRA 4ZPWR 2R7RA 3V4IB 3RB0A 2F8HA 2V8DA 5KT3A 1LWFA 3AB4B 3OTBA 2DISA 2JJ4D 3QWPA 4TXSA 4B08A 3K59A 4DV6F 1DQ9A 1JNRB 1F2GA 1ZAWA 3ITHB 5D78A 2JOQA 2ZHOA 2XMKA 4YOEA 1Y00A 3K7RA 2GQCA 3LP0B 3M4XA 2JH3A 3GIJA 4B9UA 4ELVA 4G1QA 3QJJA 3DFEA 1LWCA 1RP5A 2IFXA 3S7RA 1NKEA 5MLCV 3PIPQ 1XERA 3HM9A 3DN9A 2E9ZA 4QBUA 2GMLA 1FJCA 3RB3A 3HZEA 2DIVA 4DR5F 2KJVA 5KFZA 4ZK7M 1VQ8S 2B4PA 3UE2A 3DLHA 3MD1A 4DQIA 5K14B 1DTTA 1LW0A 5BR8F 2BYCA 3ZZZA 1CLFA 1YJNS 3BSAA 3MMBA 3P5TL 1BQMA 1ZH5A 1JJ2R 4B9TA 4MYUA 4I6AA 1IBMF 3HK2A 3MM8B 1ZTTA 1HBOA 1LK7A 2ZC3A 4U7CA 5A8RB 4J9LA 2WB4A 1JMTA 1OQ6A 2DD8S 4CIOA 1RGVA 3L7OA 5SZTA 3OQ2A 2J6UA 1UEUA 3QO9B 3I82A 3KK2A 4O44B 3BF4A 3IRXB 1N5YB 2OMLA 4XDDA 2DTJA 4I69A 3OR1B 2HNZB 1VFJA 4C8NA 1Z1ZA 2VG5A 3MM5A 2XLIA 4ZVEA 2QE5A 3J7YU 1QY7A 2B6AB 4FXVA 5A0YA 5J2NA 3DRPA 2WCXA 1MWZA 4KT0C 5FJ4A 3PW2A 1O5JA 4NPOA 2PGCA 3W2WB 4LF8F 2ZE2B 5L1JA 2XLKA 1WWHA 3FEYB 4ZPBA 5DG9A 4Y6IA 2KXNB 1VQOS 1HHTP 3PM9A 3POTB 3CUNA 1GAOA 4NYOA 3HJFA 4LQ3A 2HWHA 4ZDNA 2R7XA 4FVCA 4ILRA 1BQNB 1NJYA 4PUOA 1S6PB 3KJVA 4DOZA 4UQGA 4DQRA 4PWDB 2FJBB 4BC7A 4FNIA 1N5VA 1V6HA 2DH7A 4CT9A 2RF2A 3A8EA 1UVKA 5F8LA 3KHLA 1JLGA 4TY9A 1RYSA 4ECZA 2R7OA 4AL6A 2MHNA 2VA2A 3FSYA 2FHOB 4PXBA 1RTDB 2JEIA 1IKWB 3MOJB 4QOTA 2B4UA 2K3IA 3MWBA 4RNMA 3DOLA 2YKMA 2KU7A 4XO0A 5BYQA 2F4VF 1FK9A 1CSJA 4RW9B 3HLUA 2HWIA 5LSOA 1OIAA 3PEJA 4UOCA 4ZP8A 3H4DA 3CC7S 4IO9Q 2RRNA 2XEXA 4WE1B 1BWEA 1C1CA 1RQ0A 3C6TA 3EPIA 1NHUA 2Q1LA 5IT9Y 4QWDA 1T02A 1FTCA 1SUQB 2G9OA 4QJVA 1UVIA 2V0NA 1NHVA 4WKYA 2XI2A 2VC0A 1FEEA 1YI2S 3NS5A 3GILA 5EHHA 3CDWA 2VPWB 2ZUGA 4Y65A 2KYZA 3HZGA 4OI0A 1TL3B 3FZ2A 3TO8A 1KVJA 1S9GA 2ZKUA 1HNVB 5F8JA 1CPZA 3GB0A 3CD0A 5E3QA 3DNCA 2OD4A 3GWCA 2ZZMA 4EZ9A 2BM1A 3G6VA 4C0OC 4ELUA 3MDFA 2XY5A 4C7QA 1NK4A 4ZCMA 2KRBA 3MXHP 1KQGB 3RAXA 2AW0A 4N77A 1WHYA 2E66A 1NK0A 1F0XA 1B0VA 1EP4A 2JFDA 4F4KA 1SJRA 1JLFB 1IN0A 3VZHA 2QA4S 1C0TA 3ENVA 1KQSR 1X4EA 3I0RA 1S0VA 3LAMA 4I56A 5L9NA 4WFAQ 1H7WA 4WU2A 2R9LA 1M5HA 2OTJS 3CDUA 1X5SA 4ZHRA 2F9JA 5GAGU 1SV5A 3PKYA 1FJEB 2FJVA 2R2UA 5KT7A 4UY85 4RW6A 1EETA 3Q8RB 2YKNA 2AGOA 4DR6F 1RTIB 4NLUA 1HI1A 2HRYA 1H98A 4MYTA 2GHVC 3FRYA 2B5JB 2PDAA 4J9MA 5KG7A 1HD1A 1UKUA 4RBVA 2EG1A 2ZH2A 4DQPA 1S77D 5D8HB 2BACA 4H4KC 1Q8BA 1KOOA 3D1OA 3NGDA 2DGSA 1ZZFA 2GC8A 1FRIA 2M3DA 3AJ1A 4O4RA 3KHHA 1XN9A 3T6BA 1U1KA 2BQUA 3U1MA 1Z2ZA 3JB9k 3PNIA 2DT9A 5KG5A 1VK8A 1JJHA 5E0OA 2L41A 1KHVA 2DGTA 4NWBA 5M2RA 2UUCF 2NR0A 2KH9A 1WG1A 3LUYA 2MYFA 4C3MA 2YX1A 2ZDOA 2VG7A 4USIA 5GAEI 1N5TA 1R89A 3IAM9 5GMKa 3OJSA 3VAHA 1B64A 1IKXB 3BGRA 5C24B 2J7WA 1FKPA 3IG1B 5KFFA 2R7QA 3I6PA 5B0CA 5KFLA 2XI3A 1V3SA 3CE8A 2W4PA 3O3LA 2AGQA 3CDAA 2DNYA 2ZOGA 2GHWA 2YX7A 1MNEA 2JC1A 2QA2A 3MFHA 3JYTA 4WKRA 5IQ6A 4WU3A 1KONA 3PW5A 4Q0BA 2DNOA 1S10A 2M7SA 2RB7A 5AXMA 1X9MA 2QMWA 2RNEA 4CH1A 1K8AT 1TL1A 2NUHA 5EUHA 5A2QY 3H4BA 1LK5A 3V6JA 2XC9A 2CPHA 5KFTA 5CXTA 3RB4A 3OUYA 4WXWA 1G7CB 2BE2A 1S1VB 1JK9B 2L08A 3TA1A 4JI3F 2XULA 4OI6A 2A2CA 1K1QA 3BO3A 1U1QA 1ZPWX 4U67Q 4NLGA 1WHVA 3QYYA 4WIIA 2R2SA 1KLNA 4F2RA 2ZJQQ 3MHYA 2KT5A 5LJ3Y 3MR5A 3CF5Q 2C28A 5F3ZA 4KC5A 2F40A 3K8VA 2UUTA 5DLGA 2BQRA 3DLLQ 2ZDPA 2IC3B 5HBMB 3B4DA 5KFAA 2K8GA 3A1YG 1VC6A 4WF9Q 4DR3F 2XMMA 5HMXA 1Q82T 2EBGA 1H2VZ 4KKOB 1NK5A 2W24A 1D0EA 2DO0A 1UJ5A 4LVNP 1REVA 1UVJA 4RUAA 2VC1A 1DZ5A 2KT2A 2D1CA 2N4CA 3DXBA 3HHLA 4DWIA 4DS5A 3AB2B 5CH7B 4UUWA 4YR3A 4A46A 1R27B 5KFMA 3KLIA 2E5IA 4F3MA 3NMRA 1U26A 3N79A 1E6YA 4DL0C 2O66A 1FERA 4WFXA 3BQ0A 1UL3A 3LP2A 1QSSA 2VV5A 1NEEA 2Y1JA 3MM9A 2KDOA 4L3NA 2CQIA 2EFQA 3H20A 4QIFA 4YR2A 2WSCC 4RKUC 5G4DA 2ZH6A 3AA8A 2HHWA 1S6OA 3RYLA 3DOKB 2VQEF 2GO8A 1WTBA 4TYAA 2OSRA 2FVPA 4ID5A 1J5OB 4PXCA 1N0UA 1LXNA 4JYAF 1OS5A 2FB0A 3CIMA 1FDBA 5KFBA 1HYSB 5LL6d 2BANB 1RT6B 1VRUA 4AE5A 2JVOA 1M0SA 3K58A 1MMLA 1ZAXA 3UPFA 4OHWA 3JSMB 2JRSA 2L9WA 1HFEL 2YNFB 2EFNA 4WZQA 4HEA9 3KLVA 3OFGA 3CCJS 4OJ1A 2PFFB 4A8XA 2MXYA 1QAXA 2MQNA 5EGYA 1JWWA 3DMJB 3OR2A 1HNZF 5EDWA 2QEXS 2IM3A 2XMUA 4B02A 2IMWP 4IFYA 3PY8A 3I9V9 3MEEA 1M1KT 1IR0A 1LOUA 2CJBA 2M8HA 3CT9A 2MB0B 1TAQA 2RJZA 2R8KA 2RQCA 2MQLA 2KXFA 3VZIA 3ETOA 4PRFA 1IKYA 2XCPA 4QQBA 2DNQA 2MKSA 1SIWB 1AFIA 1OPIA 2HIQA 3Q22A 2IA6A 2VFUA 2HNDA 2HZCA 4ZKAA 4CI0B 3OSNA 4R5PA 1MU2B 1HWIA 2PO4A 4IFVB 7FD1A 2NREA 4FP9A 4O0IA 2BW2A 2QV6A 3KMQA 3BDEA 3OJUA 5LXRA 4C8KA 2HLUA 3FZBA 2EVZA 3M30A 6FDRA 1KR4A 3ZZRA 4X4NA 3TVKA 3AH6A 1X4DA 5AXNA 4B9LA 1WEXA 2XZWA 3CJ5A 3N01A 3V81A 4HDGA 2R7VA 4HL9A 3TVYA 4WZMA 5KFQA 4Y34A 3QGIA 5KFXA 4BC9A 1KTQA 3HHLD 3M2RA 4QWAA 5BJRA 2GQ2A 4M5DB 1HPZB 1U1MA 4DSLA 1P6TA 5IT0A 5C25A 2ZD1A 3D0HE 4RUHA <