1F9FA

Crystal structure of the hpv-18 e2 dna-binding domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
76
Chain Sequence
HMTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of DNA target discrimination by papillomavirus E2 proteins.
pubmed doi rcsb
source organism Human papillomavirus type 18
molecule tags Transcription
molecule keywords Regulatory protein E2
total genus 21
structure length 76
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f9fA00
1YTYA 5DDPC 4F25A 4U67Q 2U2FA 1U1PA 4CQ1A 3CXCR 2CJKA 3RW6A 3S6EA 2KHCA 4TU8A 2KT5A 3ZZYA 2JVRA 3UCGA 2VONA 2DK2A 1WEZA 2ZJRQ 4Y00A 2MY7A 3NS5A 2J76E 4QU7A 4CIOA 2XB2D 3K0JA 4W90B 1X4FA 2B0GA 3P3DA 1FNXH 4C7QA 1AUDA 1N52B 3L3CA 1ZH5A 2MJUA 2DHAA 1K9MT 3IRWP 2BZ2A 2HVZA 3EGNA 1JJ4A 2DNPA 5LJ5Y 3MI7X 3CF5Q 1W2BR 1HD1A 2DGVA 1U1RA 2JX2A 5DDQC 2DNGA 2X1BA 3TYTA 2CQCA 1K73T 2DNYA 2GO9A 2N3OA 2WBRA 4OZ0A 3US5A 3R1LA 1WTBA 1WEXA 1VQNS 2XS7A 1QVFR 3DXBA 3MOJB 5GAGU 2MSSA 2MGZA 5ITHA 1N8RT 3NNHA 2JVOA 1X4AA 1X4CA 2KXNB 3J7YU 1FHTA 1OO0B 5JVGQ 2YH0A 3D2WA 4PR6A 1VC5A 3VF0B 5DDRC 5H1SV 1YITS 2DNMA 5EN1A 2RU3A 4TLQA 2YTCA 1JJ2R 5LJ3Y 1CVJA 1P27B 3VAGA 2CQ0A 5LSOA 4LJMA 3LQVA 2EVZA 4LIRA 2UP1A 2XNRA 2MQOA 2E5GA 3G71S 2DGTA 4FXWA 4Y0FA 1X4GA 4OZ1A 1Q82T 2M70A 1IQTA 3VAJA 1WG4A 2M88A 1VQLS 1PGZA 2DISA 2HGLA 1WHVA 3UCUP 2KRRA 1SJRA 2RNEA 5MLCV 3NNCA 3Q2TC 2MZTA 1JJHA 5DDOC 4ED5A 2CQGA 1YJWS 2MZJA 1A9NB 4LMZA 3G4SS 3CCVS 2DHXA 3G8TA 3CUNA 3VAIA 1VQ8S 5DM6Q 2DNNA 2I38A 2DH7A 1YJNS 2G4BA 2LQ5A 1L3KA 2XSFA 1Q7YT 1KC8T 1QVGR 4WIIA 1NU4A 2OSRA 3H2UB 1F9FA 1U6BA 1WF2A 2E5IA 2MQMA 2MY8A 5D78A 1VQ4S 3S8SA 2KU7A 1KD1T 1BY9A 3BS9A 3ZZZA 3HI9A 2MQQA 1VC6A 4WFAQ 3CTRA 2U1AA 2DIUA 1FJ7A 1VBYA 1SXLA 2YKAA 2EK1A 1VQOS 2DIVA 3TO8A 3CCMS 2CPJA 3BO4A 3MXHP 2M4MA 2A3JA 5DETA 2DGOA 1X5OA 2RQ4A 4TU7A 3BO2A 2G1DA 1YIJS 2HGMA 2LKZA 2F9DA 2DH9A 2PEHA 3NNAA 2QA4S 1S79A 2CQIA 2JRSA 2SXLA 1WI8A 1WG5A 1HL6A 2AYMA 2XNQA 1S72S 1ZZNA 3MD3A 3VAKA 1PO6A 2CPIA 3MD1A 3FEYB 1X4EA 2DHSA 2BOPA 3R1HA 3Q2SC 3VALA 5IM0A 2OJ3A 1WF0A 1SJ3P 4PRFA 2QEXS 2L9WA 5IFMA 2DGUA 1KOOA 2DNKA 2N7CA 4F02A 4PKDB 2ZJPQ 4YOEA 5GADU 3I55S 2MQLA 5IM0B 1FT8A 2LMIA 3MDFA 4F26A 3G8SA 1VQMS 2MZRA 1NJIT 2D9PA 4IUFA 2FPHX 2XS5A 2DGXA 1XN9A 2CPZA 2LYVA 4YUDA 2NZ4A 5LXRA 2KFYA 2MQPA 3CC4S 2Q79A 2MPUA 3NMRA 1ZZFA 3UWTA 5CXTA 2DITA 2OSQA 2OIHA 3H2VE 5BJRA 1FJCA 5CA5A 4EGLA 3CPWR 3G6ES 3MUTP 1DBDA 1Q81T 2KM8C 1H6KX 1X4BA 2YWKA 1VQ5S 1KQSR 1UP1A 2CQ4A 1R8PA 2X1FA 3EGZA 3IWNC 2D3OR 1VQ9S 3DLLQ 4BS2A 1X5SA 2RT3A 3CMAS 1M90T 4CH1A 3CMES 3G96A 1WI6A 4V19X 2JWNA 2DHGA 3R27A 2KXFA 2KH9A 2PE8A 4WFBQ 3J7ZT 2VODA 2KYXA 2NLWA 4M5DB 2KN4A 4P6QA 1D8ZA 2MGZB 2CQPA 1U1QA 4WKRA 1UFWA 3ULHA 3CCUS 2M8DB 2F3JA 2KI2A 1R8HA 1DRZA 5FJ4A 2MJNA 5GAHU 2L41A 2DGQA 2MKJA 2O3DA 1WHXA 2D9OA 3CCLS 2AYEA 2MSTA 1YI2S 2AYBA 5D77A 2KG1A 3MUMP 2LECA 4QU6A 3NS6A 3PIOQ 2VOPA 2CQ3A 1YWXA 3I56S 3CCQS 5JVHQ 2DGSA 2RRBA 2RS8A 2DGWA 2CPDA 4YB1P 1FJEB 2QFJA 4WF9Q 3THPA 2N82B 2X1AA 2MMYA 3EX7B 1VC0A 5GAEU 2J0SD 1VQ7S 1A7GE 2MKKA 2K8GA 1M5KC 3RW7A 2LA6A 2CQ1A 2KVIA 4TU9A 2DNQA 1SJ4P 2AYGA 2XS2A 1VQ6S 1FXLA 1M5OC 2FHOB 1OPIA 1SJFA 1B7FA 1QM9A 2FC8A 2MZQA 4FXVA 1VBZA 1JMTA 3UD4P 2ERRA 2DNOA 2ADCA 2KXHA 1DHMA 2CPFA 2MKHA 3CULA 2J8AA 2VOOA 3CD6S 2CPYA 1X5TA 3P6YC 1Q86T 5HL7Q 3VAHA 1RKJA 4RU2A 4A8XA 2MB0B 1H2UX 2DO0A 2CQ2A 3HHNB 1U1LA 1M5VC 2MYFA 3SDEA 3S7RA 3UE2A 3SMZA 1VQPS 2HYIB 3VAFA 3G9CA 1U2FA 2DO4A 3B4MA 4C4WA 4ZKAA 4CH0S 3CCJS 2X1GA 3MUVP 1SJQA 1UAWA 1YHQS 1YJ9S 2M0GB 2M9KA 4W92B 2HGNA 3THTA 3U1LA 4IOAQ 2HZCA 1X5PA 2DB1A 2OTLS 3TP2A 2LA4A 4UY8T 5CYJA 2M52A 2MKIA 1VBXA 2CPXA 1U6FA 1D9AA 1HD0A 2CQHA 2MKSA 1P1TA 1WF1A 2YH1A 2CQBA 2F9JA 3PIPQ 1X0FA 5LSLA 3U1MA 4ERDA 4IOCQ 4C0OC 3LPYA 3VAMA 3P49B 1N54B 2LCWA 1U1MA 1WHWA 2MHNA 2LEAA 3S01A 3CC7S 5IQQA 1URNA 1NO8A 2E5JA 2LXIA 3BO3A 2RS2A 2CPEA 2J0QD 2DH8A 1FO1A 4WFNQ 2KG0A 1OIAA 3UCZP 2KRBA 2LEBA 1G2EA 2I2YA 3MURP 1VQKS 2KM8B 4WCEQ 1RK8A 2MXYA 1X4DA 2G0CA 2OTJS 1WWHA 1U1KA 2DNZA 2RUGA 4QPTA 1U1NA 4QQBA 1WELA 3V4MA 2MZSA 3CCSS 1OWXA 1WEYA 3N9UC 1WHYA 2CPHA 2AD9A 1DZ5A 2EK6A 3JB9k 2DNRA 1M5PC 2FC9A 1O0PA 1UW4A 1X4HA 2FY1A 1N88A 3UD3P 4IO9Q 5GMKa 2E5HA 2K3KA 1WG1A 2GHPA 4UQTA 2CQDA 2RRAA 5GVQA 2M8HA 2DNLA 1H2VZ 4Z2XA 5HO4A 2RQCA 2MQNA 2L08A 3SDEB 2MZ1A 1H2TZ 3FEXB 2N3LA 3SXLA 4J5OA 3CCES 1KOHA 3BEGB 2MKCA 2ADBA 2M7SA 1U1OA 2ZJQQ 2E44A 1M1KT 3CC2S 2LXUA 5DM7Q 1HA1A 3OW2R 3P5TL 2M2BA 2RVJA 5LXYA 2V94A 3B4DA 1K8AT 3CCRS 2DNHA
chains in the Genus database with same CATH superfamily
2V6AA 4PZVA 2OPQB 3HVRA 2GW8A 4F2RA 4RO0A 4UUXA 4DFMA 2P6TA 1RAIB 2U2FA 1X7VA 2AZ1A 3CJ3A 3DRRA 4ID5B 3WQPA 5KFDA 3BSCA 4LSNB 2D41A 5IT9U 3K17A 4KFBA 2ZH5A 1EIYB 2IC3A 3S6EA 2D3UA 3PYEA 1CJKB 3CWJA 1YG0A 4Q2LA 2KT5A 4W98A 3AT1B 5DZ7A 4TVAB 2QN6B 4Y65A 4TU8A 3LP0A 1YK9A 3KK3B 4ZLPA 1CBKA 5KOXA 3OTOF 3LO3A 3FSIA 3FFIA 3H5YA 4O3PA 1J5OB 3T1YF 3RR8A 2VHGA 4I2PB 2GS8A 2MY7A 5HJXA 3NMRA 5ETNA 1IR0A 2GQCA 2UUWA 1MWYA 3Q8UA 4W90B 4ECVA 2ZM6J 3NBPB 2ZHAA 2XY5A 3M2RB 2B7CB 4DR7F 3PKMA 3RB0A 3K2YA 5LMUF 1AUDA 2RUSA 4F4AA 4LF9F 2DHAA 5F8JA 4JI6J 2HVZA 3BDEA 2F63A 1LK5A 4HDGA 3TVKA 1HD1A 2AMCB 3MI7X 3IA0A 4NLDA 1W2BR 1K0VA 4EEYA 1JLAA 2FVSA 1IWGA 4WIQA 5C2GA 1YVFA 4PXDA 4DU8A 6AT1B 2IYIA 2BE7D 4NZ6A 2PMZD 5KFOA 2NREA 1K73T 4H4OB 4DJBA 3A4TA 3GE9A 2CWKA 4O4RA 1EJ7L 2AEJA 5D4NA 2N3OA 5F8GA 3FBCA 5MAOA 3US5A 2V8VA 4F3OA 1Q5VA 1W25A 1WEXA 5GADI 1XNQJ 1PIEA 2GA7A 3DDKA 3DXBA 4F36A 1TKDA 1IBMJ 1QVFR 3NOCA 5GAGU 4KH0B 5J2NB 4P7TA 4NE9C 3EICA 4WZMA 3CE8A 2JZ5A 4KHMA 1OS5A 2Y8YA 1X4AA 2YKMB 3QATA 2GVDB 2OEJA 4A8WA 1X9MA 1ZYQA 1IBLJ 2L9DA 4DV4F 2Q1LA 2ALZA 1FFWB 3J7YU 1IM6A 1OO0B 2F4FA 2WB1D 2WW8A 4PR6A 3CJ0A 3RBZA 2VQEF 5H9EJ 1VC5A 2VA2A 3E8OA 4ZN3A 1N32J 2OHDA 2QG9B 5IT4A 4WBFA 5KTQA 5KFRA 4PG5A 3MPDA 4LFAJ 3QFHA 4O3QA 1QE1B 3NGUA 4RX6A 4ZJOA 3DHWC 2WTFA 4K5SA 1Y5NB 3VAGA 2H3EB 5I42A 2BUNA 2EVZA 1GEHA 2CDRB 4LIRA 5EX3A 5D6GA 4KKOB 2E5GA 4XPCA 2DGTA 3HHLB 1OPZA 4C97A 1B64A 2FHJD 2QSFA 4FXWA 2W4PA 3W62A 4F2SA 2ZBCA 2HBQB 3MCSA 2QX0A 1LXJA 3OTCA 3W5XA 5AJ3F 1Z2LA 1UVKA 3R5GA 4FP9A 3W2VB 5LSRA 1UW9A 3O8WA 3OVBA 1JKHA 2WBMA 1PGZA 4HLBA 4MK9A 3JTOA 2HGLA 3T6JA 2IM2A 1JXVA 3CDAA 3T19A 2FZKB 2XQCA 3OJUA 2IHR1 1HBNA 1U09A 2OEMA 1V3ZA 2H1YA 3IO1A 1GMUA 1ZM4A 1VK8A 2KRRA 1ZAXA 1C0TA 2BVZA 3KXDA 4MAKA 1LWFB 4GKJF 5KFAA 4IQXA 3KYLA 3DLJA 3DM2A 1NHUA 1RT5B 1F1BB 2ZM6F 1N6QB 2W9CB 1IVZA 2I9SA 3LUYA 1T05B 5D4PA 4LF5F 2MZJA 4U8YA 3MR2A 1FFSB 5B0BA 4ECWA 4LMZA 1UVIA 2OMOA 1OSDA 1WDDA 3T5KA 3BZQA 1OY6A 4F3MA 4LF8J 4GKJJ 3DDIA 3PDNA 2DNNA 1S4EA 5DGAA 1YJNS 2LQ5A 1L3KA 4K4SA 1FKPB 5A6WA 2IMOA 1RT1B 4Y2MA 2AJ2A 4NRUA 4K4XA 1KC8T 2HAIA 3G6XA 1C4AA 1TL7A 4PG6A 1HMVB 2XI2A 2BMBA 4ELTA 1R0BG 1TQLA 4E8UA 1RWOB 5J1EB 5B0CA 1U6BA 2QO3A 2BXJA 1XWLA 3MCOA 4ZIVA 1QE1A 2DRAA 1O51A 5D78A 4ZVEA 1TL5A 4X4PA 1URNA 1KLNA 3BN4A 4HH0A 3JYTA 3B78A 5HLFB 1KD1T 5BYSA 3NRBA 1Y3JA 1N0VC 1C0UA 3ZZZA 3MR3A 3THVA 3UFCX 1YZ7A 2MQQA 4A46A 3NL0A 3CT9A 3A3OB 4MKAA 3M32A 4WFAQ 5IV4A 3IAM9 3MPUB 2XCAA 3Q8YA 3TVYA 3ET6A 2GVDA 4ECSA 1IKVB 3DRYA 1RQ0A 2B6AB 2UXCF 3RRHA 3CCMS 1AFJA 2M4MA 1HI1A 2JSXA 1IBLF 3G82A 2JH3A 3OFHA 1W26A 1VGYA 4TU7A 4YB7A 1CJTA 1DURA 2FHMA 2VBZA 3BO2A 4JI5J 1F2GA 4AL5A 2IVMA 2OLWA 4ZIWA 1R0AA 1YIJS 4LFAF 5I42B 1S10A 2F9DA 3LP2A 2DH9A 4K59A 5F9NA 4LT6A 2VJUA 2PEHA 3AB2B 3ZC4A 5K20B 2O5DA 3JSMA 3C8YA 3K8VA 3QGPA 2FLNA 3GFZA 3GJQB 3EDQB 4LIWA 3ETOA 2J0WA 1WI8A 3AQOA 3NGSA 2H5JB 4DL3A 4FN5A 2JC0A 1JXLA 2GGPA 2XNQA 3JAMU 4RUAA 2IRUA 1NUEA 2ZBQA 5CYQA 4BLGA 1ZTWA 1LOUA 2CPIA 4B9SA 4DF8A 2RKIA 3ITHA 2HHTA 2HZVA 1P1LA 4I1TA 1S1VB 4JOUA 3DOLA 4A8MP 1X9SA 4CO3A 3D9BA 4KSEB 3DMJA 3CCTA 3Q8QB 3NGTA 2H4WB 1S59A 1HHSA 1TKTB 2DGUA 4USIA 2H54B 3OR1B 2HBRB 3OQ2A 4DG1B 8RUCA 5IQ6A 2QFIA 4M5LA 1U1QA 4ZP7A 4F02A 1T95A 3D1HA 1L3VA 1XERA 4LSLB 2FHJA 1UEVA 2JLFA 2IM1A 2QC3A 4JB8B 4M5GA 3TZZA 1HBOA 2K7JA 3H4BA 1TKTA 5GADU 2G0JA 3AXMA 3EVMA 2C3UA 4O3SA 2RSQA 1VQMS 2LMIA 3G8SA 4JI6F 3CEDA 4KFBB 4P2FA 2R7OA 2MZRA 3BGUA 4K4UA 1T11A 4K50A 2XY6A 2QYGA 3MGJA 3TAMB 2E66A 2D9PA 2VFRA 2PC6A 3DGPB 1RT6B 2FPHX 1Y9OA 3TUIC 3D0HE 2DPIA 5H9FK 2CA9A 2YY3A 3R5AA 4F4XA 2UXBJ 2XMKA 4JI4F 1SV5A 4NLGA 1SUQB 3N6NA 3ONQA 4U7UK 4LF5J 1WORA 4ED8A 4KGMA 1GAOA 2RQMA 1XJWB 2ROPA 5A8KB 1U2RA 1YRUA 2XMVA 3H2VE 3TJ9A 4CP5A 4ER8A 3RB3A 1FJCA 4QIVA 5DO2A 5KFJA 3IRXB 4M5NA 2ACMA 3F0NA 2FJBB 2KM8C 4G6VB 4OIXA 3CCRS 5DQGA 1H6KX 1IQZA 2OKQA 2YWKA 3IM9A 2EC2A 2HMIA 2FVRA 2WSCC 3G6YA 2V68A 3D28A 5C24B 2GFFA 1CJKA 1Q95G 2X1FA 1IKVA 2GX8A 1RYSA 1RTZA 2C3YA 1KWMA 2G2OA 4ECZA 5KAKA 3QLHB 1RWVB 4DUZF 4K4ZA 2G9OA 1X5SA 3NOGA 4DPYA 6FDRA 4PYDA 1Y00A 2ZWOA 4DR4J 5A8RB 3KNAA 2FGOA 2B9XA 5HAOA 3SSQA 5H9FJ 1S99A 2C2OB 2F1FA 2FIUA 2KXFA 2Z30B 3RZAA 3W7BA 2KH9A 4WFBQ 5D4LA 5C42B 2KN4A 4I7FB 1D8ZA 2EXUA 2HAFA 2J0XA 3HHKA 4U8VA 1SQEA 2AIRB 2YKNA 3PHEA 5HROB 1IN0A 3TAPA 2XMAA 1NM2A 4ENOA 4KGVB 2KI2A 4WK1A 5E41A 1H0HB 4B9VA 3I4HX 3M9NB 2DR6A 1N0UA 3DLGA 2W9BB 1UWBB 2KHDA 2L41A 2DGQA 1T9UA 2O3DA 1HBUA 2O01C 4NLOA 1ELOA 2BW7A 3DNCA 3L95X 4F3QA 3CJ5A 3CCLS 2AYEA 3T1HJ 1RXOB 2C2EA 1RT5A 2HZAA 4F8RA 2HHXA 1R0CB 5ETMA 5KFUA 3VTIA 3OFEA 4CNZA 1SL1A 4Y2CA 3NAIA 1C0TB 4C8ZA 1I3OB 4IQMA 3QWUA 3R7NB 4V19J 2IDEA 3V4IA 1CQNA 1YWXA 2CIMA 1EETA 3SQGB 2V4JA 4CYUB 2Z2YB 2IRXA 5B09A 1Q5YA 1WOPA 3CCWA 5HP1B 2V5HG 1JKHB 2VUGA 4ZPVR 3OTOJ 2H5IB 1ZA2B 2DT9A 1N5YB 2FYXA 1VC0A 2ZNZA 1QLNA 5C2CA 2J7WA 3RB4A 1G6BA 2IYGA 3IBCB 3IAS9 3H98A 1CEZA 1FRMA 2QL7B 2LA6A 2C2MB 3OL7A 2R4FA 1KRPA 2DNQA 2FJDB 3I0RB 4QIGA 4UT4A 1BC6A 1M5OC 1WOOA 1X31C 5AXLA 1OPIA 1P9YA 5K8NA 2AQ4A 1B7FA 2DR7A 1WSRA 4YQWA 2FC8A 1ZBTA 1VBZA 3PJ9A 5HSPA 4IRKA 2CJ9A 5GAEI 4UZBA 3G96A 4OYXA 2DEIA 3Q8RB 2CDQA 4RW6A 1B70B 2KXHA 5F8MA 1RACB 1FRLA 4OI3A 2A2CA 1S1WB 1RCOB 4JBCA 2MKHA 1FTCA 3POTB 2ASDA 1XBWA 3CJ8A 4FNIA 2QA4G 5KFWA 2Y1RI 7FD1A 2Q3PA 4NXNF 4WXOA 2V9KA 1FX2A 5KFXA 1Q86T 2KFNA 3VAHA 1RKJA 1YBUA 1HWUA 3I87A 1NLKL 2BRLA 2FGCA 4P2MA 4EO6A 3SZ2A 2J7KA 2CQ2A 2YNHB 2E1RA 3D6HB 1VK3A 3P4UB 5ETVA 2VQEJ 4HHJA 5D3GB 1M5VC 4DR6F 1N32F 3GV8B 1ZS6A 2GAHC 2KT3A 2FZCB 2MLXA 4AUKA 1OYDA 2HHHJ 1RAOA 2GMHA 3TUJC 2HYIB 4NA3A 3G9CA 5IOLA 2VPZB 4OHXA 4ZKAA 2HNYB 2O66A 2HNDB 2X1GA 4RKUC 4URSA 1RHUB 1SJQA 1YHQS 1HPZB 4AFFA 1YJ9S 2UVRA 1E6VA 2OO4A 3OUYA 2VIHA 1WTFA 2YNIA 3GYXB 3U1LA 3ZNJ1 3M8WA 4DQPA 4DSIA 2Z57B 2CKWA 3J80Y 3I0SB 4R0JA 2DB1A 4HDHA 2J7UA 2OTLS 3PY8A 2LA4A 1T94A 4UY8T 1NHVA 3KHLA 3GJRB 4O4GB 1GK8A 2MKSA 1WF1A 4RW4A 5KFFA 2F9JA 4YDDB 3U1NA 2EFVA 3U1MA 1FDNA 1JLBB 3K7RA 3KK3A 3EZUA 4C0OC 1CULA 4RNNA 3M2VA 1S97A 2JDJA 4CT8A 2EBGA 4OYAA 3Q8SB 1UA1A 2CJQA 4USVA 4U7UD 1WHWA 1HYSB 1FJGJ 4JI8J 3O3LA 1K0TA 3W8PA 3MM5B 4A47A 5IQQA 4DR7J 1NO8A 1T8EA 1FWLA 4Y3CA 3DRXA 3QFWA 4MIWA 3HCXA 5LL6d 4CLZA 3LGNA 1PAUB 4L73A 4C8KA 5KFMA 4YS2A 1RSCA 1V5VA 2CJAA 3K5LA 2FLPA 1N5SA 2ZZTA 1FJGF 1MU2B 4MTPA 3ZNUA 4DN0A 3MR6A 1JLFA 3HX9A 1BUXA 2ZUGA 4WFNQ 4M5JA 2ASYA 5J2QB 1VQOS 4CM0A 2FJXA 2ZUAA 3ILOA 4OX8A 1S6UA 4AXJA 3CO0P 2AWZA 2VFVA 3AD8C 4KPCA 3N79A 4O23A 1AB8A 3MURP 3GJSB 2I2YA 2HPUA 1QAYA 1QUVA 1RE1B 3N01A 3I5CA 1RK8A 2RE1A 1FDDA 2HRUA 4L3NA 4BC7A 4DX5A 4Q2MA 1WWHA 4AL7A 2XMWA 1TAUA 2VG7A 4F4WA 2HVIA 3HHDA 2PSZA 2RUGA 2R7XA 4UOGA 2VFTA 3HFKA 3KHHA 4QW9A 1FXRA 1WC5A 3N28A 1NHKL 1UJ6A 2CZ9A 4QQBA 3V4MA 3KG0A 4LQ3A 1OWXA 2Y1JA 1RAEB 4NCAA 2CPHA 4QPXA 4ECRA 1RHQB 2EK6A 4DPUA 3T9ZA 2YQ1A 2IDLA 1PILA 3DDNA 3VGVA 2JFDA 2DCUB 3R97A 2HKEA 2ZDPA 3SCJE 2B5JB 4NX9A 2HHHF 2FC9A 5EUHA 1X4HA 2FY1A 2BDPA 3V2UC 4TLRA 2ZZNA 3RRKA 1HKAA 1F3FA 2E5HA 1HWIA 1NB7A 4KR0B 2FUG9 2I5JA 3K5MA 1JB0C 3MEEA 4NMLA 2XWYA 1XMOF 3G86A 1WOSA 2H51B 1H2VZ 2M8HA 3CD5A 3PHTA 4L72B 3HPOA 2C3PA 4ED0A 3GSDA 4AYBD 4AL6A 4PWWA 3M2VB 5THWA 2FJEB 4B3OB 4DQQA 3NS7B 1OYEA 4DCOB 4DUZJ 2DY9A 2GMJA 3VWSA 3GMGA 4J5OA 3GIJA 1PC5A 1CLFA 3ILIA 2WVEA 4ZPTR 3KNGA 1JLGB 3W9IA 4NEYA 4K0KF 1WDTA 3LOUA 1XEZA 3VGSA 1SJ1A 2ZH9A 4X62F 3Q24A 5KG4A 2ABYA 1OJ4A 2VFSA 1HNVB 1RHMB 4J37A 4PABA 3C6UA 3D66A 4RZRA 3H25A 2HURA 3MPYA 5DM7Q 1EAYC 4NA1A 4YHHF 1HA1A 2O67A 3OW2R 3FSYA 1UEKA 3P5TL 1HPZA 1VQYA 3KLHB 2HLTA 1RWPB 2XO6A 1S77D 1FTRA 4LF9J 5KFSA 1YTYA 5LMUJ 2IMWP 2G1HA 2BQRA 4FDFA 4PPZA 4F25A 1JIHA 5J2PB 3DLKB 2P5VA 3H0PA 2RIJA 1L3SA 2KJWA 2CJKA 3RW6A 4MIAA 3KG4A 2J6UA 5KOWA 1FKOB 4ANEA 2WW4A 2KHCA 2W2MP 1YJVA 2PDAA 1WD6A 4PAAA 1IKYB 2B4UA 3JTPA 2F40A 4ZHRA 2VBXA 1AZSA 3ZZYA 2AJ0A 3Q2TC 2GMLA 2Y0BB 3UCGA 2HBZB 1WEZA 1I51B 1R27B 3C6TA 2K2PA 4IR1A 2OAUA 1SQFA 4IG0A 2CNLB 3MM6A 3M8SA 4EZ9A 1CQMA 4CIOA 1HQUB 2R7WA 1N36J 4LF4J 1FD8A 2GJIA 1XR5A 3QJPA 4X64F 1X4FA 2XLIA 2QMWA 2C28A 1ULRA 1RWNB 1TUWA 4L75A 2W2NP 2HVEA 3NP5A 4FPIA 3IWLA 3M6VA 5A8WB 2Y1LB 1KTQA 4UOHA 5E2QA 2R8IA 1OMSA 8ATCB 3PX0A 4JP8A 3MEDB 2WK4A 2CNKB 3KJNB 4NXMJ 4WFYA 3CDUA 3H59A 4I0WA 4ZITA 1VFJA 1JJ4A 2DNPA 2V2VA 3CF5Q 3TEHB 2RF2A 3QIPB 1U1RA 4KBIA 5DDQC 2NXEA 2UXDF 4DV2J 4NI2A 5B08A 4DUYJ 4IR9A 1T3OA 1R43A 2IM3A 4X84A 1QSLA 2HHUA 3BYRA 1VRTB 2F8EX 2XZTB 2W8KA 3ISZA 5E3QA 2RRNA 3WIVA 4G3IA 4A48A 1PYOB 2QLFB 3M2UB 3P96A 3VCDA 1WTBA 2LQ8A 1Q8KA 2GNKA 3MOZA 4OI4A 5ETQA 3C15A 1IXKA 4C98A 2MGZA 4ZMMA 2ILYA 3L7PA 1FXDA 5ITHA 4DFJA 4NLYA 2QT7A 2YVSA 3FZ2A 2BE9B 1RP5A 4MK8A 3DOKA 3FVYA 4IFYB 5F8IA 4QWAA 1N33J 1R6YA 1HNIA 5E33A 2HQIA 4CI0B 4YR0A 3W1YC 2UUCF 1HNVA 3GONA 1FRHA 4ZPAA 4OX9J 1Q53A 3D3CJ 3A8EA 4ZP8A 1C1BB 3MPWA 1VYAA 4FYDA 4DSLA 3HVAA 3VF0B 2B4VA 1SIWB 3K8WA 4FF3A 2Q43A 3WX4A 4FKYA 5IWAF 3PRBA 1NKEA 1HI0P 4FBTA 2ZVSA 3A8JA 2N4CA 2R3VA 2VG7B 3FGVA 2VPXB 2XBPA 5I3UA 1TK5A 1CVJA 1P27B 2BJ8A 2IVYA 3QZ7A 1QSSA 5DS7A 4B3OA 3W5ZA 3VVUA 3OL9A 4D3HA 2ZHOA 2XNRA 2MQOA 2WVDA 2KB2A 4Y0FA 4S0MA 2DPJA 4DQSA 5J2MB 1B0TA 2HIQA 2OGUA 2E9RX 1IQTA 4R0EA 3KJFB 4DHVA 3AOCA 3KLGA 5EGYA 1EARA 2XSJA 2M88A 3N4WA 1FK9B 2PN6A 3R5BA 4J7CA 4ECUA 2UVUA 1BQMA 1NBEB 1I94F 5KFZA 3C46A 4OZ2A 2H65B 2OFGX 4L76A 4DL0C 2Z2MA 2ZOFA 4OX6A 1T0TV 1EHWA 2F8MA 3QJLA 2BKPA 5MLCV 3GIIA 1YBTA 2YWHA 4ALZA 4PQAA 1HLWA 1JJHA 1JLFB 5HMWA 4XIUA 4YMEA 4NZ0A 1YJWS 5J1NA 2AGQA 4NWBA 2GV1A 1T7PA 3MTKA 3J81U 1GMVA 3HD1A 1FK9A 5C5JA 3OHBA 2F65A 5B7WA 3G8TA 5HI7A 3G4SS 3F44A 3ZZTA 2ZH8A 3CUNA 1VQ8S 1D9DA 5J1PA 2AJQA 4P9SA 4JI8F 2HLUA 4LF7F 4WFXA 4DMZA 1FWPA 1HR0F 2IAJB 2G4BA 2XSFA 4ICLA 5DZ6A 2QZ8A 1DQ9A 5KT4A 1YKWA 4WIIA 2VG5B 1NDPA 1XMQF 3LANA 1WF2A 3T5LA 4FXDA 2KFZA 1RISA 3GV5B 3DMJB 2ASLA 1HIYA 3AXKA 2YNIB 1RT7A 3PO4A 3A8KA 4FBUA 2KU7A 4JI3F 4Q44A 3BS9A 2CYYA 2EPIA 2VA3A 1JNRB 4R5PA 2GJ2A 5ETLA 4USMA 4YY3J 5JUMA 3JQJA 2HS0A 3MZIA 4O44A 4L3KA 3IWXA 8AT1B 3TWZA 5B0DA 4J9NA 1VC6A 1HNXJ 2U1AA 3E3XA 2K3IA 2DIUA 3BYPA 2P9CA 3IGVA 3JTNA 4CLLA 1VBYA 3MMBA 1SXLA 2W4DA 2YKAA 3MCMA 3NWRA 5E3AA 4QWCA 5DG9A 1Q1KA 3SQOP 2WSEC 2P8IA 3EUNA 4EU0A 2DIVA 3TO8A 2N4DA 1CULB 2NR0A 2ROEA 2UUCJ 5F0UA 1W7WA 5LM7E 4KHPJ 2DGOA 2HIYA 4JUZA 2WVCA 1Y5LB 2RQ4A 3EE3A 4F4KA 3UN3A 2B4OA 4ZVHA 4ETXA 1SB6A 2IY5B 1YGYA 3D0GE 5L1IA 1VRQC 3R2DJ 2FB0A 3DI6B 2LKZA 3PXGa 4U95A 2NSCA 2R2TA 3FBEA 2ZH7A 4JI1F 1XNRJ 1LW0A 1NK7A 2QA4S 3NNAA 1UMJA 1AA1B 1S79A 2F8HA 1SC6A 1FI4A 2B6AA 2JRSA 1FE4A 3HSDA 3NCQA 3QT5A 4MMOA 3TQ1A 3TI0A 2G2ZA 4LFBF 1RAHB 4BDPA 1WG5A 3CW2C 2RKIB 3ITHB 1NK6A 2ZOMA 4OI2A 4USHA 2MLYA 4JI3J 1UJ5A 2G13A 5AXNA 2XC9A 1S72S 1J5EF 1S76D 3P8BB 3MD3A 3GFYA 2ROGA 3VGTA 3TUZC 1JLCB 4H54A 3FEYB 2DHSA 2X3DA 3OL8A 3KKFA 3PNIA 1PJ6A 2BOPA 3FUYA 1URRA 2B4PA 2MEWA 3Q2SC 2VDHA 1HWLA 2WHOA 4RWXA 4X4QA 1HW8A 3BREA 2HK3A 3BKUA 1B7YB 1HHQA 1HNWJ 2QEXS 2L9WA 1F9EB 3MM6B 5F41A 4NLPA 3TRGA 1S12A 1Z4UA 1FDBA 1TL7B 3EGVA 4KGKA 1KOOA 2RAQA 4ZA1A 2DNKA 4ZVQB 2XHCA 2A6MA 1T9TA 4CLUA 2QSWA 3VV2B 2FJAB 2W8LA 4LRAA 2R9LA 4LF4F 2ZJPQ 2QIFA 4HI2A 2XZWA 5AXMA 4WU3A 1RBLA 5IXUA 2JHEA 4DR5J 3WC0A 2E1CA 3HO1A 5IM0B 4IFVB 3BPSP 4OYOA 1MW7A 1FVQA 1EETB 1LKZA 2DXDA 2WZ1A 2YNGB 3SQGA 4PXBA 3U27A 5HJYA 1P8GA 2UUBJ 3CJ4A 2XGPA 1IBKF 4IUFA 1RLDA 1RU1A 4Y2IA 1APSA 4DL5A 3CDBA 4IG3B 2CPZA 4IKAA 4P10A 4FYYB 3F56A 4RL1A 1RTIB 4DR5F 3WDOA 4C8NA 2NZ4A 3QQCD 3CJSA 3OFGA 1IKXB 2VU5A 2POKA 2YNGA 3D3BJ 3DU6A 1S9GB 2MQPA 1HBUB 3CC4S 4UTGA 2Q79A 3I9V9 2VG6B 4IFVA 5KFHA 2AP6A 4X66F 3Q0AA 4KO0A 5CXTA 2OSQA 2QV6A 3SV3A 3QT7A 1D1UA 1U4BA 1U7LA 5CA5A 4ZVSB 4QZVB 1P6TA 3M05A 3OXGA 4QW8A 3G6ES 3MUTP 2KJVA 1Q81T 1KDNA 3L4BC 3HHLA 3C66A 5IS2A 1UWBA 4RW9A 5K8OA 5SUHA 2B43A 4OV1A 1SIZA 3RUBL 3TA2A 1VQ5S 1UP1A 2OH2A 1I6JA 2EEYA 1KQKA 5KG1A 3H8YA 2CZVC 2LEPA 2QRRA 1YJRA 3N0VA 1JLEA 2IA0A 1NH8A 2YX7A 1F5AA 3DRPA 4ZOSA 3QSYB 4K4WA 3MMAA 5KFCA 3DLLQ 1S1UB 4DR2J 4BS2A 1HQ2A 4KH1B 4U6PA 2RT3A 2WONA 1M90T 4FYXB 3CMES 2Z58B 2R7QA 4ED3A 3DKDA 4MFBA 4PYAA 4I7FA 1HQEA 1S0VA 1LWFA 1K44A 1Y4ZB 1WI6A 2AF6A 4PG7A 2D1CA 4QR1A 3IM8A 4RLEA 3W2WA 4M5MA 5FLXY 2H5EA 2R7RA 4ECTA 4YDXA 5RUBA 2ZC3A 3K5PA 4C8OA 3BR9A 4DPTA 3J7ZT 3UDCA 2XO7A 2KYXA 2I1RA 2XYHB 4PXCA 4P6QA 3FMBA 3LAMA 2QGFB 3ZZUA 3DLGB 4ZLJA 5B0EA 5J2NA 1CJUA 1JLQA 3D6MB 3GR1A 4UOFA 1UFWA 3ULHA 3CCUS 2C2DA 4KT0C 4WKRA 1IJFB 2FHKA 4UQGA 3H5SA 4LRFA 2VJVA 2B56A 1N34F 2PI4A 4OMFG 4MKYA 4K4VA 4UW2A 1R8HA 1RT3A 4M63A 4WXWA 3NY0A 2HVDA 2AHOB 3MMJA 5CAAA 3I4PA 1GT8A 1L3TA 1TAQA 1BQXA 1CG2A 1FDAA 3I31A 4KC5A 2KT2A 3PW0A 2MJNA 3OTEA 4AT1B 3RRGA 4H4OA 4W4MA 3GZ7A 4DI6A 4ED4A 4LREA 1WHXA 2Z8QA 3GIKA 3PX6A 1IR2A 1AROP 1TFYA 4NCGA 3H90A 4JI7J 3M8RA 3M6UA 1TKXA 3HHLD 1YBAA 1IJEB 3TJAA 4DN9A 2R2RA 4J9MA 1KBRA 2NXNA 2LECA 1NDCA 3NS6A 4O44B 3ZFVA 3PIOQ 4QU6A 3TJ8A 2VOPA 1N36F 5ADZA 3QGGA 3TAMA 2W1BA 5JVHQ 2UXBF 2DGSA 2RRBA 3PR4A 1Q4RA 1RT7B 3AJ2A 3V6DB 3BGRA 2QE5A 4CNYA 4A8KA 3AH6A 3MM5A 1J2VA 4RPFA 1FJEB 4LF7J 3H7HB 2EKYA 1Y5IB 3BGLA 3C19A 4OZ3A 1HBOB 3VHQA 2N82B 2X1AA 2MMYA 1I94J 3KTQA 2NQPA 1RHKB 4OZJA 1YSJA 3M8YA 2J0SD 4HEA9 2HG4A 1VQ7S 1TKZA 1A7GE 2K8GA 2HSEB 2E9TA 2CQ1A 1SVDA 3GCXP 2VF3A 4L6V3 3RGIA 1T9YA 4KRWA 4ANDA 1SKSA 4I67A 2EFGA 4XPEA 3KHGA 2V4RA 1VQ6S 3DOLB 5G0RA 4K8RA 5C7PA 4ES3A 3KLVA 1SJFA 5BR8F 1QM9A 2QLXA 1SV5B 5ETKA 9ATCB 4FF1A 4QJVA 1UFLA 2MZQA 1JMTA 2ZWPA 2C2RA 4LQ9A 1NDKA 1J27A 2ILZA 3WC2A 1E6VB 3OUYB 2J6TA 4LR7A 2GIRA 4B3TJ 4LF6J 2ADCA 1RABB 3T5HA 4TYBA 3HVWA 4QYZJ 2W4CA 3M9OB 2OPRA 2VOOA 2CPYA 3H2LA 5HMXA 3EVWA 4KGZB 5K8PA 1BLUA 3P6YC 5J2MA 4J9PA 3ILLA 5ETTA 2V0NA 4RU2A 1TUVA 2HFSA 4A8XA 2MB0B 1H2UX 1NSQA 2DO0A 4KHRA 1NNDA 2VC0A 2ZEJA 1VJWA 4XO0A 2BJEA 2CZ4A 1XK8A 3MAAB 4Q8FA 4P74A 3SMZA 1VQPS 4QYZK 3CD0A 2CAJA 1MG7A 2DO4A 4E2FB 1RUSA 2E1PA 2V50A 1U0HA 4YFUA 4CLFA 3AOBA 4I68A 1Q16B 2GGPB 1VRUB 1VOMA 3TARA 1SC3B 2CJYB 2UVWA 4ED2A 4O3RA 1WC6A 3LF0A 4P52A 4C48A 2VBWA 2PIIA 4M1KA 3M32B 1EKSA 2QLBB 2HGNA 3DOKB 2BR0A 4IOAQ 3MMCA 3TANA 5K5MA 4U9RA 1C0UB 3TP2A 4N5SA 3IC1A 3TEGA 1RU2A 1GTEA 2M52A 3EDRB 1NSAA 2MKIA 4RUHA 2BANB 2CPXA 1U6FA 1Q8IA 2V2KA 3MMAB 2CQHA 3DRPB 4RW9B 4F0KA 3M2UA 2QTWA 2CQBA 3PIPQ 3WZ0A 4DEZA 3UNYA 1XMQJ 4GC6A 4DSJA 3SEOA 3AQPA 4C3KA 2HFNA 4IOCQ 2CJBA 2Y9HA 4U7CA 4M94A 1FNOA 1I1GA 4ZPBA 1FWKA 1PAEX 3HSJA 3P49B 1NB2A 4PPDA 4Q8EA 1VLOA 4B9TA 3B6BA 1EX8A 4Z7YA 3TVZA 4ATNA 2LEAA 5FDLB 3SCLE 2CVEA 3CC7S 4IRDA 2ZITA 2FTRA 1Y3KA 1PBAA 1RHRB 2KYZA 1Y7PA 4G1QA 4H4MA 3MMCB 2R8GA 4JI4J 1MSWD 2LXIA 2J9DE 3BO3A 4JYAJ 2UUBF 3KUEA 4PG8A 4PWUA 2C3MA 1F5BA 3ILJA 3ZZ0A 3HFVA 2XULA 4FNHA 1KLMA 4N47A 4NYZA 3TZYA 3HZEA 2XMJA 4R25A 4H4MB 4RBTA 2NPFA 4TNOA 3W5YA 3W64A 5HVGA 4GMKA 1S6OA 3OL6A 4C8YA 3O44A 2LEBA 2DRBA 1G2EA 4DQIA 4B9NA 4JYAF 1SBRA 2KM8B 3MAAA 4B9LA 3H5XA 3KLIA 2X51A 4K5RA 5I3PA 4OYZA 5FD1A 3HULA 1LW0B 1UTAA 2HNZB 4I64A 3LAKA 3W2VA 2JLEA 4N41A 3CIZA 2OTJS 2YKOA 1GX6A 4DQRA 2R8JA 5KFYA 1JQGA 3EZOA 4QPTA 5JMNA 1U1NA 4TY8B 4NLRA 4ZPWR 3IFEA 1H7WA 2HBYB 4YR3A 3JXOA 3BJYA 5J2PA 1WELA 3M8QB 2MZSA 2XY7A 5T7LB 4URGA 1JLCA 1RLCL 1TL3B 1WHYA 1TELA 2MLZA 3DM2B 4QYRA 5DGBA 5KT3A 2AD9A 1KVJA 2NYHA 4M5DA 2DNRA 5E0OA 3LPEA 3RG6A 1WJ9A 2YBVA 1N48A 2AGPA 1M5PC 4JI7F 4DL6A 2NSBA 3D67A 4RNMA 3MHYA 3MWBA 3W9JA 2K3KA 1WG1A 3PJWA 4O0NA 4UQTA 1CC8A 2ZH2A 1ZPWX 4LBPA 2MTLA 2VDIA 1CS4A 3J7YI 3HJVA 2QLWA 4ECYA 3BR8A 1F0XA 2NCKL 3I9ZA 5C24A 1T03A 3CJRA 4WTYA 2BJ7A 1NXIA 2HFOA 5L1KA 4DR2F 2DTJA 2N3LA 4WU2A 1U47A 7AT1B 1S0MA 4QCLA 1H72C 3CCES 4URQU 2BKNA 2QMUB 3LGMA 4XDDA 2A1BA 5EDWA 1HWJA 1REVA 3RAQA 2YWFA 5CHCB 3LWLA 1JLAB 2YX4A 4CLTA 1NDLA 2ADBA 3MEEB 2HQ3A 2LDYA 2E44A 5LSOA 1FRJA 4U96A 3TQEA 9RUBA 5DQIA 3J81Y 3GJTB 3V6DA 3AHPA 4QIEA 1S1TA 1DLOA 3ENQA 3FRZA 2B5JA 3BSOA 1U25A 2V2QA 4OJ1A 1EP4B 2WVFA 3SIPB 5LXYA 3JS9A 1KR4A 1UZDA 4DV7J 2RDIA 4EBEA 1HBMA 2RILA 3DGPA 3UD4P 2DNHA 3FCVA 1FJ7A 5DDPC 2V63A 2FJVA 3BF4A 4NYOA 4B9MA 2C3OA 2PMWA 1RDRA 3KLFB 4CQ1A 3CXCR 4JI0J 4X64J 4M5IA 4NPOA 4CCHA 1K47A 1HR0J 3FQLA 2OD4A 3DXSX 4ZJLA 3KLGB 1QTMA 1TKZB 2VD3A 3B8HA 1VISA 2VONA 2DK2A 2YXLA 1DARA 3RBXA 4ICLB 3I5BA 3OR1A 2F5GA 4Y00A 4CO5A 2RH3A 1RTJB 2BACA 4X4OA 1VJQA 3JSYA 3UDLA 4QU7A 2J76E 1QY7A 5G4DA 3KK2B 2FVQA 3MCNA 2COLA 4DCPB 2XB2D 3K0JA 3ICLA 3FSXA 2LQJA 5A2QU 1RWUA 2VBYA 3P3DA 1SPBP 1FF2A 3AD7C 4DL7A 1LWEB 4C7QA 4X4NA 5ETPA 1AYEA 1MU2A 4DR3F 3VQTA 1B0PA 1N52B 4TY9A 5CYQB 1BQMB 2FY8A 3IRWP 4KJIA 2ZBIA 4FVMA 3EGNA 4XDCA 1NZAA 4J9OA 4ZVOB 4OJGA 3OV7A 5EX0A 4B3RJ 3GYNA 3JSMB 2DNGA 3BH6B 3RBDA 1ZPVA 2X1BA 3NMAA 3TYTA 1HYSA 1KHWA 2VFUA 1MN9A 2CQCA 2AEFA 3M8ZA 3MM9B 3QJJA 3ISNC 3RR7A 2XEXA 2RQKA 4JV2A 5DLFA 4RUBA 1FKAF 1LW2B 3R1LA 3LP1A 4RW4B 2HHWA 2A10A 3DOMB 2YPYA 3G82B 5EHHA 2W01A 3IBWA 1YRXA 1VQNS 4IH5A 4J9LA 4ELVA 3ZTQA 3MM8B 1C1BA 3OLAA 2L48A 4OHZA 2W9AA 2HQGA 2ZVIA 4TYAA 1N34J 4AD6A 1X4CA 1QTNB 3QIPA 4IOBA 5KFLA 1NJXA 1TMJA 2M5YA 2QLJB 4GKKJ 1HQEB 4IG3A 2YH0A 2WONB 1VLYA 2NXUA 4KV8B 1OSCA 3D2WA 1PG5B 3QRQA 4ZLLA 5HLFA 2HHPA 3M4XA 4FVCA 5HQMA 2EFPA 4FKXA 5H1SV 4OL8A 4X2BA 3OPKA 3BKTA 4TLQA 4HTIA 2I0XA 2JFKA 1RI7A 2YTCA 1UWAA 4EI2A 1JJ2R 5LJ3Y 1X9WA 1WSVA 1VRTA 2CJXB 2Y3YA 1FRKA 3Q89A 3GQCA 1NPPA 1B3TA 2UXDJ 2D3O1 2BOAA 2HWTA 4P2SA 4HACB 2AU0A 5F8NA 1Q82T 1U26A 3UN5A 1T3NA 4DSEA 2RF2B 1AZSB 1WG4A 3CVKA 3DCAA 3M6WA 5K14A 1IKYA 2RHSB 4A8OA 3KJVA 3B82A 3L09A 1HFEL 5E3PA 2ACYA 4FYVB 2E29A 3EM1A 2X7IA 1NCLA 4EBDA 2HW3A 3T6BA 4OFZA 3H4DA 3HJFA 3UCUP 3FK4A 1UL3A 3X1LB 2L3MA 4A8SA 1SJRA 1VQSA 2RNEA 4FZVA 2C42A 3NNCA 3GILA 2MZTA 1B0VA 2B8PA 1MWZA 5CD4H 1D8YA 1HBNB 1IM4A 2WCXA 2CQGA 1A9NB 1SH3A 2B7BB 2IRYA 1YJTA 3MEGA 1Q78A 4I4BA 4CRJA 2DHXA 5HATA 4LVNP 3R7SB 5L9NA 1JK9B 1LWCB 2C2ZB 2EWHA 4ZCIA 5DM6Q 2I38A 2CVIA 2DH7A 4HT7A 1NJWA 1TFWA 1YX2A 3UR0A 1AT1B 4LRDA 4H4KA 4D3GA 1U49A 1Q7YT 4DV0F 1NH7A 4DWIA 1QVGR 1GNKA 4ZVRB 2JLGA 5HQ8A 3MF5A 3QYYA 4OLPA 3J81j 3BQ2A 1N5YA 2OSRA 3VQSA 1F5CA 2DR9A 1F9FA 3NGDA 1HNZJ 3FQKA 2E5IA 1NJZA 4RNHA 1F3VA 2MY8A 3DLBA 2HHSA 5GAHI 3DLKA 1CSJA 2K1RA 3KG1A 2V4JB 3MPVA 3NGRA 3OXFA 4CYUA 4OJ3A 1X8DA 2W7PA 3HI9A 1TVRB 3EGWB 2XGQA 3D5MA 3IG1A 3TX8A 4Y28C 4X62J 1CPZA 1EKRA 3BM7A 3PRDA 1Q8LA 2RHQB 1NKCA 3TUPA 4EUVA 1G4CA 2EK1A 5CQGA 3BQ0A 4GO5X 4Q45A 3BO4A 3MXHP 3RJMB 3AJDA 4BWMA 3RBEA 3Q8VA 1X5OA 5D8HB 2V69A 1V9OA 4NLUA 4PUOA 3IMQJ 5CZVA 4DOZA 2Z56B 2QL9B 4K7QA 4DV5F 2AYGA 1LW2A 1NMEB 2HGMA 4G65A 1TZ0A 4NLXA 2OD6A 4USTA 2IJNA 4YR2A 1U8WA 3HVTB 1G3OA 3ZTRA 1M1GA 3OBIA 1H38A 2E1AA 5KFEA 1WC0A 2A2DA 2BW2A 5IC4B 4ZVUB 3HT3A 1HL6A 3UI3A 5ETSA 3E2EA 2PA3A 4DV6J 2YKQA 1ZZNA 2VL1A 5C25A 4R5PB 1PO6A 2ZH4A 5KT5A 2XM3A 2OFHX 3MD1A 2D7SA 1KEKA 2BA9A 3ZZRA 4TN2A 1NSPA 3M2RA 3R1HA 2HWIA 4LR9A 3VALA 2OJ3A 1DY3A 4DZDA 1GXTA 1WF0A 2EG2A 1SJ3P 4PRFA 1H7XA 4HHUA 2VG5A 4DSFA 3PZPA 1JNZB 5KFTA 3BB5A 3G8QA 3PACA 2J9DA 2OPSA 4DLEA 4Z7CA 1RTJA 2HHVA 6FD1A 2N7CA 2QJ3A 4C0HA 2I6WA 4PKDB 4MJKA 1N56A 4YOEA 5IZHA 3TA0A 3MM9A 4KTQA 4L74A 3PVXA 1R7IA 2DR5A 1JLBA 3TW0A 1R6VA 4F4ZA 2JJ4D 2OI2A 2VPYB 2VC1A 4LSNA 3F41A 3UO0A 4F26A 4Q43A 1U45A 1S6PA 2XTJP 3W3SA 3KLFA 2JNJA 2ZFHA 4CT9A 2RB7A 1NJIT 3UW1A 2XWXA 2IVFB 2DGXA 5HBMB 4A8YA 2BRKA 1XN9A 4JI0F 3FCHA 5D0GA 4C3MA 4CDIA 5C25B 4I2QA 1F2HA 1I5OB 3W61A 1EP4A 2MQ8A 4HT5A 1ZAVA 4YUDA 3C2PA 2HFUA 2V8PA 3GFXA 1S1TB 3D7SB 4GVBA 4ZVGA 1JWWA 4C6AA 2MPUA 3DN9A 2XSJB 4YB5A 4BBYA 4X65J 1R8BA 5JJBA 1OY8A 1VHIA 2GQQA 3SV4A 4AQYJ 1M0SA 2DITA 5I3QA 2OIHA 1UCNA 1IUJA 1RA6A 2NPIA 2YQ0A 4AE5A 5BJRA 5KT2A 2K06A 1KONA 1NPRA 5DRKA 3TX0A 3CPWR 1LEOA 1DBDA 5F3ZA 4F7VA 5KFPA 1KQSR 4ED1A 4LBIA 2OELA 3VR1A 3AJ1A 5I3UB 4ZLNA 3NEKA 4OI1A 2V4QA 2BKOA 2CQ4A 3I0SA 1R8PA 3AY0A 1T03B 2R7UA 1VI7A 2XMTA 1Y10A 5IV3A 1VQ9S 1CS4B 2ZZMA 2KKHA 4KHPF 2XMUA 4ES1A 5KT7A 3VZIA 3SBMA 4OYBA 3D1QA 4QOTA 1SC1B 1HBMB 3MTJA 1TV6A 3IG1B 3POTA 4RUCA 3PW4A 2HS4A 1V3RA 1S0NA 2BQUA 4PCQA 4V19X 2JWNA 4X4RA 2R8HA 1KNZA 1S6QA 1KSPA 4JI1J 1XNRF 2DHGA 1RZMA 3AB4B 4JV1A 2IJFA 3E01A 1D0EA 3I32A 2GZOA 3FC9A 3D6TB 3ENVA 1TK0A 2NLWA 4M5DB 3DRSA 2PFDA 4GVLA 2MGZB 4K0KJ 1SQGA 3C15B 2KTQA 2CQPA 2GIFA 1NK4A 3DLHA 4BC9A 3MECB 2YNHA 5D3GA 1MROA 2M8DB 2F3JA 3W60A 4NLSA 4I69A 4LBHA 1KFDA 1DRZA 4PUOB 2QMXA 4F04B 1CJTB 4PWDA 1S9FA 2JEFA 4J91A 4DFPA 3HXMA 2DR8A 2GCFA 5M2UA 5DG7A 1U2CA 3BPDA 5I4MA 4ZPDA 1QJHA 1VR6A 4LUBA 3QMQA 5CABA 1TL1A 4RW7B 1YI2S 2QL5B 2UUTA 3PM9A 3A1YG 2BM1A 5D77A 4CLPA 4GRSA 4ZVTB 2XZDB 2KG1A 1RWXB 1B99A 3MAQA 5GMEA 3V6KA 3DFEA 2IBOA 3CCZA 3JQKA 4OJHA 3I56S 4JI2J 2FLOA 1NEEA 3JYTB 3J7A1 2RS8A 2IA6A 5FIIA 3FBFA 3I0RA 3QO9B 2UV8A 4NZ7A 3OHAA 2H4YB 1IBKJ 4YB1P 5AXKA 3CJKA 3SSRA 3KJVB 4C2MA 5BYQA 2QFJA 3KOAA 3THPA 4WF9Q 2ZD1B 3FRYA 1S9EB 1HMVA 1YQHA 4XAKA 4UY85 3EX7B 1UPPA 1EB0A 1JLGA 3GWCA 1JJCB 3GYGA 5GAEU 3MFHA 4ECXA 2JEIA 2EFNA 2KL8A 5D0EA 4CH7A 1RT4A 4J9VA 2MKKA 1XQIA 1M5KC 2MDAA 1NKBA 4OYWA 2GVZB 3DLEB 3M9MB 4DR1J 2AX0A 2KVIA 4ZPCA 4A4JA 4TU9A 3KLIB 4M5HA 3GV7B 4PG4A 4TQSA 5HP1A 3A8IA 1FXLA 1KFSA 2HWHA 3HZGA 2DXEA 1P9QC 3V4IB 3QGIA 1HNWF 5KFVA 4JV5J 3Q23A 1N6QA 2JEJA 4TKTA 1GH8A 2CADA 4MK7A 4TXSA 3WBZA 3LALA 5IWAJ 2XLJA 3BSAA 2ERRA 2W24A 1S5ZA 3M8PB 1VS3A 2DNOA 4B08A 1DHMA 2YWGA 4EK2A 1DTQB 1UFKA 2ZKUA 3C6UB 2FZGB 3O6QA 3HP6A 4FS2A 1BD6A 2UVVA 1R3NA 4ECQA 2J8AA 1V6HA 5KG0A 2PD1A 3VZHA 1T9XA 4OLOA 4Y34A 1Q79A 5FDLA 3EPIA 3QZ8A 2O1PA 1X5TA 3FMWA 4HACA 2EKNA 2CWXA 2RU9A 3M6XA 3ETMA 4J9UE 1BQNB 4CM2A 1H3DA 2ALYB 2DKOB 3HHNB 1FX4A 1Y11A 2AW0A 5B0AA 4DS4A 1RAJA 1UEUA 4P75A 2AZ3A 3UE2A 1TU0B 1TUGB 2FVCA 3QRPA 3R6GB 5AE1A 3V6HA 3AA9A 3H40A 3QPIA 2LQ9A 5A8KA 4CH0S 1BGXT 2DHHA 4P2XA 5A8RA 1D09B 1EZZB 3MUVP 1ZOTA 3R2CJ 1UAWA 1KTVA 3ZTPA 2C1EB 3KLEB 3UQSA 4W92B 5ETOA 3MM7A 3T9NA 3THTA 2W25A 4OV6A 1U0HB 1FEHA 2E5LF 1RT6A 1FCAA 3ZXWA 5CYJA 4I56A 2HMIB 1D9AA 1HD0A 1ZM3A 1S48A 4X4VA 5BYRA 1X0FA 5DG8A 1XR6A 3BBCA 2GC8A 3LWMA 4ERDA 2CG4A 2LU1A 2B9EA 1VBKA 1ITPA 3LPYA 1S1XA 4QWBA 4N8NA 1N54B 2LCWA 1U1MA 3SFGA 3R7BB 1O8BA 4H4KC 1VDHA 3IRXA 3TA1A 3PV8A 4KYZA 1SC4B 4XK8C 3PW7A 4OHWA 3MR5A 1WC4A 4B02A 4DX6A 1RB0A 1ZH5A 3AODA 3MAHA 2E5JA 4OZNA 2DY1A 2HVHA 3Q86A 1TK8A 3BGRB 1KHVA 2RS2A 2CPEA 1S1VA 3CNQP 4QR2A 2RMLA 1ICEB 2BX6A 1SUQA 2LLZA 4X4SA 5BR8J 2R7SA 4CLSA 1FO1A 2KG0A 4FPRA 3A3PB 2IPOB 2DBBA 2V8HA 3HKWA 4CLKA 3KK2A 1AUSL 1O5JA 2CNOB 3UCZP 3A13A 3PYDA 2Q6CA 4NCGB 2KVQE 1VQKS 2E7XA 4UF4A 3R5CA 1J5OA 5DJBA 4DG1A 4ANCA 1GQEA 2BYCA 3N5FA 4I6WA 2MXYA 5AJ3J 3KHRA 4DPOA 1MMDA 1U1KA 2D3ZA 2OP5A 2Z4PA 4DZ6A 4CLYA 4J9RA 2FDNA 1TR0A 2F4VJ 2HEKA 2RD5C 2G0IA 2XI3A 3GSIA 4IYQA 4YHHJ 3CCSS 1PC4A 2LU2A 3MR7A 1FESA 4Q5VA 2AT1B 1DAXA 1T02A 2IM0A 4RW6B 1AXQA 2HFZA 1YDLA 3GLJA 4M95A 1SL0A 4Z37A 1O0PA 1UW4A 2YPZA 2V34A 4OX9F 1N88A 4RNOA 2AJFE 5KFKA 4NCBA 2HNYA 2PFFB 2W2PP 1TL3A 3TR5A 4IO9Q 3NG8A 4GKKF 4C8LA 3SYZA 1PCAA 3DHXA 2RRAA 5GVQA 1S1UA 4J90A 5HO4A 3BBBA 2RQCA 4UZCA 1SL2A 4E0DA 1WKLA 3X3UA 2MQNA 2W7OA 1FD2A 4DR4F 3HM9A 5J1EA 2MZ1A 1CJVA 4EYHB 2HNZA 3EYZA 1R0AB 3SXLA 3BV8A 4IO1A 1VIXA 1AFIA 4ELUA 1RT1A 2A6OA 2ATLA 3CO9A 2HQCA 1WKJA 4LVOP 1K1QA 4B3MJ 4OZLA 5F8HA 1DQ8A 1CJUB 1JLQB 1TL4A 1VMBA 2ZDOA 4Y2AA 4DXLA 4TQRA 2ZJQQ 2UU9J 4I6YA 2QYCA 2NZCA 5AE2A 4KPYA 3UNGC 1KLMB 1S9GA 5H9EK 1BE4A 1IKXA 4DS5A 2UP1A 3MEKA 2GHWA 2M2BA 3M8PA 3UD5A 3W2WB 1UVNA 3BN7A 4LF1A 1PSDA 4QR0A 4MFBB 4G1QB 3BH7B 1RCXB 1MN7A 1R8CA 2DCLA 2B9YA 4RW8A 4U67Q 3H42A 2IIHA 4NEZA 2FLLA 5A76A 1RT2A 4LF6F 1S0OA 1U1PA 3EXYA 2J8SA 3D4JA 2E9ZA 4EBCA 4ZVPB 3JAMY 1FHTA 2BE2B 3M1VA 2CXEA 2ZC4A 5LMNJ 4NASA 2NUUG 3DGVA 1MLAA 2CG8A 1FEEA 2JVRA 2YWEA 1RT4B 3VGUA 2E7WA 2K7KA 4WYLA 4AQYF 1FA0A 1S4FA 3FCWA 2ZJRQ 4ED6A 2B51A 3OSPA 1U8SA 3IXQA 4HH1A 5AT1B 5GAGI 3NS5A 2JC1A 3HF5A 2Z2LA 3M1VB 1F9HA 3PG9A 1ZM2A 3K5NA 4UUWA 1M5SA 3NLCA 4KO0B 3CJKB 2VG6A 2B0GA 1FNXH 2H9ZA 3HFZB 3IR7B 4WP8A 1DTQA 1RAFB 4NLVA 4PQUA 4N8OA 1T05A 3H5UA 4NLTA 2XG8A 2A0FB 1RTIA 3AOAA 3CJQA 2MJUA 3ZTOA 3ZZOA 2DXFA 3LGHA 4EMDA 4DV7F 1K9MT 5K8MA 2BZ2A 3OJSA 4LFCJ 1FERA 3ENAA 3UR3C 2E7VA 4RU9A 2VICA 5LJ5Y 3M7VA 3NXZA 4WWSA 2DGVA 2ZOGA 1UPMB 4OX7A 5L9XA 2JX2A 3G2XA 1WACA 1KP6A 3FNNA 4WP9A 4HYKA 4USKA 2NS1B 5KG7A 1J5EJ 2DEJA 4IH6A 2W9BA 3PX4A 2KZMA 4LR8A 2NXCA 2LXFA 4F50A 2BE2A 2DNYA 3UDEA 2XYPB 1A0OB 3RAMA 2GO9A 4N56A 1MNEA 2WBRA 2WB4A 4OZ0A 5JXSA 1HARA 2C22A 2BBEA 3QIDA 3GPAA 1RWKB 3I6PA 4RW8B 1CJVB 1UVMA 5M2RA 2XS7A 3MOJB 2Y1IA 2GHVC 1Z2ZA 2OPRB 1Q8BA 2D74B 2MSSA 3BBFA 3OD2A 4NYPA 3UN2A 5KFNA 4USWA 1N8RT 5EWGA 2V9WA 7FDRA 2JVOA 2GIQA 4N77A 4NXNJ 3NNHA 2VV5A 4DV6F 2HRYA 4CO4A 4BHQA 2V8DA 2XLKA 2PO4A 2PGCA 1S6QB 4O3NA 2OUGA 2KXNB 4HHHA 2UXCJ 2GJFA 4GO7X 5JVGQ 4FS1A 5DDRC 2GO8A 4RR5A 4DX8H 5KFGA 1IBMF 3K58A 1QUPA 2YKMA 2DNMA 1IWAA 2QA2A 3LH2S 1YITS 5EN1A 4WK3A 2RU3A 1FRXA 4DPXA 1ROFA 2DD8S 1KQFB 4YY3F 4WJBA 1PJ7A 1RJJA 1Y0HA 2H48B 2CQ0A 3OT9A 3DI6A 4M8LA 2BABA 1LQ9A 3LQVA 3R5DA 4LJMA 5E3CA 1RBOB 5GMDA 4E98A 5FLXU 2J6SA 2P2CB 4LSLA 4P72A 3G71S 2AGOA 3PYFA 3KUHA 4B3MF 4N76A 1REGX 1X4GA 4OZ1A 1SH0A 2M70A 3FDSA 1MROB 1ACMB 2YWWA 3VAJA 3QNWB 1KVIA 2IJRA 3HSGA 3EGZA 4Y2KA 1YJ7A 4ES2A 1BMQB 4DV0J 3FJ2A 1VQLS 2DISA 4LSZB 4OI6A 1LFWA 5D0HA 5CCLA 3ADAC 3U7JA 3PR5B 4NXMF 1QDUB 3HSZA 4ZP6A 4BCAA 1NK0A 1G1XA 5D4OA 1WHVA 3D68A 3NWGA 2UZAA 1SKUB 4KAIA 4I2QB 3PO5A 4RWWA 3NAHA 5F9LA 3NCPA 1UVLA 2Q6BA 3KDOA 4JI2F 1TKXB 2XHWA 5DDOC 4ED5A 1RBAA 1KVKA 2N7YA 3HDSA 1NAQA 2W2OP 5CH7B 5G0RB 4C3LA 5CD4A 1S6PB 3CCVS 2AJ1A 4ZVFA 4MYTA 3VAIA 3T5JA 3D6FB 3FFIB 3ISND 3NBPA 3BGFA 4G1IA 1S1XB 4FF4A 3T1HF 2MHEA 3E51A 1RGVA 3CJTA 3GFHA 2BJ9A 3D54A 4I2PA 4CO2A 3HMJG 5EWFA 3KJQB 1RT3B 2W7AA 3K57A 4LF8F 1QSYA 4HTJA 3NKYA 2CRLA 4DLGA 2HHQA 1FE0A 2YNFA 3GR0A 5DQHA 2OPSB 4CLWA 1NU4A 1R8AA 1HWKA 3HT0A 3H2UB 3FKBA 4NL5A 5CZXA 3T41A 3W66A 5IT9Y 2R42A 2JL9A 2MQMA 4RBUA 1E6YB 1OQ3A 3AAWB 1VQ4S 3ET6B 2OEKA 4M5KA 3OR2A 5LOQA 3S8SA 3KLEA 1BY9A 3EZ5A 4ZCKA 2B3TB 2OPQA 3PCOB 2LP4A 1WC1A 3BKFA 3O1LA 1GX5A 3OTDA 1EQMA 4ZP9A 5E7OB 3TNVA 2R2UA 5U47A 4KGXB 1XC9A 4WE1A 2AEMA 3MM7B 1M5HA 1C1CB 2B9WA 2BJ1A 3CB4A 3CTRA 3QWPA 3TZWA 3UPFA 4ILMA 3ENWA 2D69A 4IFYA 3LTOA 4CZCA 2GQ2A 1ZA1B 1JLEB 4DV5J 2UUAJ 4F4YA 3L9ZA 4X4UA 2CPJA 3LP2B 3R9LA 2A3JA 2PT0A 5DETA 1N5TA 4EZ6A 1BHNA 2CUYA 1BQNA 2KDOA 2LQBA 4ED7A 3W63A 1FKPA 3IBFB 4HKQA 2EI5A 2G1DA 3N6MA 1WC3A 4IH7A 4GC7A 3SCIE 1BXNA 3C16A 3O5TB 1MMLA 2CQIA 3RAXA 2JEGA 2SXLA 4NI2B 3GP9A 2ZE2A 2LVWA 2DYAA 3KMSA 3D0IE 1XIQA 5L1JA 3CDWA 4N7TA 4UOCA 2W9CA 3V6JA 1K1SA 5KG2A 3EJMA 2AYMA 1RWMB 2HRTA 2V2ZA 4B9UA 5HMYA 4KB7A 4P73A 3ZZPA 4DUYF 3M30A 2V8GA 3CIMA 4XTTA 1TVRA 4WTOB 3VAKA 4DL2A 1GXLA 1X4EA 4PQUB 1ZAWA 3Q83A 4RBVA 5A8WA 1X60A 3A3NB 2ZH6A 1F60B 3HK2A 2X3GA 5IM0A 2BQ3A 2IBKA 3GG0A 4Q0BB 3J7Z5 2PA8D 4JV5F 4A8QA 1B4SA 1GXUA 4ITSA 3EPGA 1L3UA 1FVSA 5IFMA 1X0PA 2KO1A 3R3TA 4X66J 1RYRA 3OLBA 1S7IA 4X65F 2FD2A 3F73A 1AW0A 3WX8A 3HKZD 2VKZG 4DR1F 1GTHA 1RTHB 2OPPA 3V81B 2GVZA 3DLEA 3J80U 3K89A 3L3CA 4B3RF 3G87A 3I55S 3HLUA 4R8UB 3CSKA 5KG6A 4QWEA 2MQLA 1FT8A 1V3SA 3HHEA 3MDFA 3DU5A 3PJXA 2C2KB 3GIMA 1LV5A 4LFCF 4ETZA 1S9EA 1LFPA 1RKIA 2NUHA 4DV3J 4F67A 1GFWB 2WOMA 1HI8A 2XS5A 3GB0A 4WPAA 4F0HA 1YLXA 1YZ6A 3QO9A 4RJVA 5KFIA 4USJC 2LYVA 5SZTA 5L38A 1F6TA 3MEDA 3KLHA 2M3DA 5LXRA 2KFYA 2WAQD 3RU0A 2NXJA 3P5BP 1FNMA 3PRVA 1DTTB 5CCMA 5E5NA 4FYWB 1QD1A 1ZZFA 3UWTA 1RAAB 3IP0A 2PEBA 3OFFA 4KIAA 2MKYA 4MIBA 2XMMA 5E3RA 1NJYA 1TL1B 4RW7A 4K4TA 1RA7A 3Q8PB 1NRKA 1Q0NA 1PKUA 2E1MC 2HS3A 4IG0B 4EGLA 4YP3A 2RDJA 3IS9B 1ZM9A 1O6XA 4KE5A 5HN0A 3TAQA 4KKOA 1A6LA 2J9CA 1S7HA 2UU9F 1X4BA 2ZD1A 4OZ5A 1UA0A 1FFGB 4QIFA 1KQGB 1QAIA 1N5QA 4C11A 1SI9A 2E5LJ 1Q7LB 1R89A 1H73A 4JI5F 3IR6B 4Q0BA 3R6LB 3MEGB 3T3FA 2D3OR 3IWNC 3E01B 4F0MA 2VASA 5CYMA 2J9EA 3MECA 5BXIA 2DJWA 3CMAS 3U02A 4CH1A 4J9QA 4WKYA 1XMBA 3DRSB 5HMZA 2UUAF 2NYIA 4MH8A 3CMQA 3R27A 4A8FA 1XNQF 2PE8A 3V5RA 4CWBA 1OY9A 2VODA 3N6LA 2B8QA 1YRTA 1NK5A 2FJWA 3MM8A 4DV4J 1MWQA 4DR6J 2F7VA 5L8RC 1HHTP 2HQFA 4DV1F 3HHLC 4OYPA 4YEAA 4B3SF 2VB6A 5A6PA 4DL4A 2ZHBA 4OYMA 3W8GA 3P45B 5FJ4A 1R31A 3RB6A 5IC6B 1RADB 3JSBA 1JXEA 3WHIA 5GAHU 2UV8G 1HNXF 4ZS6A 1RAGB 3L7OA 1DJ0A 1U24A 2MKJA 4DF4A 1U02A 3MMBB 4ID5A 4OYIA 5EWEA 1NPKA 3DRRB 4DR3J 2D9OA 4CO1A 2MSTA 3KMQA 4B3TF 2AYBA 4WZQA 3PW5A 5HVHA 3PEHA 4KV8A 4OHYA 3MUMP 1TV6B 2A18A 5HK4A 4X4TA 2XYGB 3AA8A 4EFAC 3PW2A 3BDPA 1EQ0A 2CQ3A 2V67A 4IDKB 5KFBA 2R8KA 2VPWB 1D9FA 3J7AN 3DC2A 3CCQS 4V1Ak 3OR2B 3T1YJ 1ZETA 1PYTA 4QWDA 2XCPA 2DGWA 5L39A 3FZBA 1IKWB 5HBMA 1QAJA 2CPDA 5F8LA 1RTDB 2HK2A 3SI8A 4CTAA 5F0WA 3KWMA 2EW9A 3DOMA 4FF2A 2YNFB 3JSRA 3UVJB 3O2IA 3OVSA 2IAJA 2BM0A 1FRIA 1DQAA 2CNNB 3LP0B 5L1LA 5LT5A 1Z1ZA 1QAXA 4I6AA 1IR1A 4NLQA 4WFZA 3RW7A 4EWTA 4HR2A 1BWVA 1SKRA 3PTWA 1SJ4P 1RTDA 1WNEA 2IC3B 2Y8WA 2XS2A 2FHOB 2BJDA 3RYLA 5K9FA 4KY3A 2Q66A 2ATCB 4O4GA 3EXCX 4KQZA 4P7VA 3S1TA 4CTAB 3QRRA 1T9VA 4FXVA 1IKWA 4MKBA 4EO8A 3K5OA 5L46A 1C2PA 3GCWP 3KDNA 3GU0A 3OVAA 1KKHA 3IN5A 4P71A 4ZCMA 4O0IA 1LWEA 4EYIB 3QAUA 2BEFA 2CPFA 4DDFA 1S57A 3CULA 3EVOA 2HQDA 4JV0A 5A2QY 3CD6S 1SH2A 5T41A 5AE3A 5F3TA 3PFOA 3PEJA 1UVJA 3R8YA 4NLWA 2Z0GA 1UJ4A 2RJZA 5CYMB 5DLGA 1U48A 1N33F 4LFBJ 5HL7Q 5KFQA 2EC0A 3HVTA 4ZCLA 2Y0SD 4ILRA 3KUGA 1TMMA 2WVBA 1U1LA 4MYUA 2MYFA 3C14A 4C8MA 1NZ8A 3SDEA 4DU7A 4NOHA 3S7RA 3ZO7A 1VIOA 3ZTSA 1VCTA 1H74A 2BV3A 2JOQA 3VAFA 1U2FA 3MFIA 3B4MA 3OTBA 4C4WA 3TOQA 1OQ6A 2LDIA 3CJ2A 4B17A 4DPWA 3CCJS 2EBEA 3KK1A 2YX1A 4WP3A 1NK8A 5HANA 1HNIB 1DTTA 3TZXA 2KZZA 1T9WA 1TTHB 3CGIA 4LF2A 2ZKTA 1XTZA 4LRCA 4MKVA 4DUTA 4DV3F 1DLOB 4USUA 1M1HA 2K1RB 2M0GB 2M9KA 4HI1A 3I82A 2P6SA 2HNDA 2HZCA 1X5PA 3DYAB 1RHJB 3EWGA 3QT6A 2I8EA 5A0YA 3WIUA 1DFDA 4C11B 4DCJB 2WOMB 5B0GA 5T7LA 4HVZA 1VBXA 2PI5A 1PBUA 3L7UA 3I96A 2LFVA 2R7TA 2J5AA 1REVB 3KFWX 3QT8A 1P1TA 2HFVA 4HL9A 2YH1A 1U0SA 1U6ZA 5LSLA 2P9EA 4Y6IA 3SSSA 5B0FA 2C2NA 4QBUA 3QGHA 4ZHRB 4ZJQA 4J9KA 3VAMA 3CD7A 1RTHA 4NA2A 1FKOA 5HQLA 2W2QP 4RNFA 4NMXA 2R7VA 3BSNA 1G7CB 3EMTA 3GIRA 3IS9A 3PYGA 3T1AA 5ETRA 2ZNYA 2MHNA 2GAGC 3S01A 3AFGA 3FEZA 2AX1A 3DYAA 3N5BA 5A0YB 1UKUA 4DSKA 3SFUA 1TP7A 1S1WA 2VQFJ 1SKWA 1GMWA 1BWEA 3I5AA 1SCJB 5T14A 3QSIA 4DBQA 4YB6A 3NGKA 2J0QD 5KT6A 2DH8A 5D15A 1LXNA 3RTVA 3HD2A 3PKYA 3IGNA 2ZBPA 1HQUA 4ZN1A 1OIAA 5LMNF 1UZHA 3M8QA 3VVTA 4OHVA 2KRBA 3H20A 4K2XA 3W65A 4PEOA 3V81A 4K2JA 4TY8A 2VQFF 3C6TB 5M2PA 2FQQB 3C14B 4PXEA 4WCEQ 2ZH3A 2YKPA 4R8UA 5K14B 2APOA 3B54A 1X4DA 3C16B 4PWDB 2G0CA 4DX7A 1LWCA 3R5JB 2OPPB 3OSNA 2DNZA 2CFXA 1HW9A 2R2SA 4OQJA 2PMHA 5KG5A 1KS2A 3A12A 1MMNA 1RT2B 2EFQA 2ZBRA 2BANA 3GTYX 1RWWB 3IR5B 5IT0A 1WEYA 1C4CA 3N9UC 3GG1A 4J9SA 1S49A 4NRTA 3M30B 1KN6A 1YJUA 1N4LA 4AXIA 4ZK7M 3JB9k 1DZ5A 2DVIA 5C42A 2RDDA 3OXLA 3QBCA 1GMWD 1V5IB 3LA0A 1UETA 2IFXA 2AKWB 3FBBA 4BWJA 1C1CA 1LNQA 4WYWA 2P9GA 3KK1B 1W2IA 4WE1B 3UD3P 3NCRA 1VRUA 4ILLA 2EG1A 5GMKa 4C0BA 5D0RA 2GHPA 2CQDA 4LRBA 4Q7AA 2ASJA 1VHFA 2ZH1A 4DFKA 3QLHA 2DNLA 2L9NA 2ZE2B 4Z2XA 3K59A 3LP1B 3Q22A 2Z2ZA 2L08A 3SDEB 3LW5C 3JQMA 3D1OA 3SCKE 4IRCA 1LWXA 2G2YA 4DV1J 1XMOJ 3G6VA 1H2TZ 1ZTTA 3FEXB 5KG3A 1IBCB 2VKRA 2FVPA 3PFEA 1WKKA 2YQ3A 4C9DA 4MT1A 1KOHA 2OMLA 3UVJA 3BEGB 3ELHA 2VZ9A 4QIWD 2MKCA 4YN3B 4O3OA 2I5JB 4K4YA 2AV5A 1NK9A 1JX4A 4OI0A 5HROA 1D3WA 2M7SA 1CC7A 1U1OA 3QAEA 2YKNB 3C3LA 1WUUA 1LK7A 4G1PA 3W9HA 1N5VA 2DRDA 3CDEA 1PYSB 4DV2F 4ID8A 1L5UA 4CO0A 1XR7A 4GVBB 5J2QA 3UDVA 3CC2S 2LXUA 4ZDNA 2VH7A 1PJ5A 2WSFC 1M1KT 4B3SJ 3AD9C 4IDKA 2WRMA 2BJ3A 2RVJA 1E6YA 2V94A 1H98A 1NSKL 3B4DA 5HVFA 3BQ1A 2QA1A 2AJ4A 1K8AT 3BGOP 2F4VF 2EFOA 1HNZF
chains in the Genus database with same CATH topology
2OPQB 3HVRA 2GW8A 4F2RA 4UUXA 4DFMA 2P6TA 2U2FA 3DRRA 1X7VA 3CJ3A 4ID5B 5KFDA 3BSCA 4LSNB 2D41A 4KFBA 2ZH5A 2IC3A 3S6EA 2D3UA 4Q2LA 3CWJA 1YG0A 4TU8A 2KT5A 4Y65A 3LP0A 3KK3B 4ZLPA 5KOXA 3OTOF 3LO3A 3FSIA 3FFIA 3H5YA 4O3PA 1J5OB 3T1YF 3RR8A 4I2PB 2MY7A 1IR0A 2GQCA 2UUWA 1MWYA 4W90B 4ECVA 3NBPB 2ZHAA 2XY5A 3M2RB 2B7CB 4DR7F 3PKMA 3RB0A 3K2YA 5LMUF 1AUDA 4LF9F 2DHAA 5F8JA 2HVZA 3BDEA 1LK5A 4HDGA 3TVKA 1HD1A 3MI7X 3IA0A 4NLDA 1W2BR 1K0VA 4EEYA 1JLAA 2FVSA 1YVFA 4PXDA 2IYIA 4NZ6A 2PMZD 5KFOA 1K73T 4H4OB 4DJBA 3GE9A 4O4RA 5D4NA 2N3OA 4F3OA 5F8GA 5MAOA 3US5A 2V8VA 1W25A 1WEXA 5GADI 2GA7A 3DDKA 3DXBA 1TKDA 1QVFR 5GAGU 5J2NB 4P7TA 4WZMA 3CE8A 2JZ5A 4KHMA 1OS5A 1X4AA 2YKMB 4A8WA 1X9MA 1ZYQA 2L9DA 4DV4F 2Q1LA 2ALZA 3J7YU 1OO0B 2WB1D 2WW8A 4PR6A 3CJ0A 5H9EJ 2VQEF 1VC5A 2VA2A 3E8OA 5IT4A 5KTQA 5KFRA 4PG5A 4O3QA 1QE1B 4RX6A 3DHWC 2WTFA 4K5SA 1Y5NB 3VAGA 5I42A 2BUNA 2EVZA 4LIRA 5EX3A 4XPCA 5D6GA 4KKOB 2E5GA 2DGTA 3HHLB 1OPZA 4C97A 1B64A 2FHJD 2QSFA 4FXWA 2W4PA 4F2SA 2ZBCA 3MCSA 1LXJA 3OTCA 5AJ3F 1Z2LA 1UVKA 4FP9A 3W2VB 5LSRA 3O8WA 3OVBA 1JKHA 2WBMA 1PGZA 4HLBA 4MK9A 3JTOA 2HGLA 3T6JA 2IM2A 3CDAA 3T19A 3OJUA 2IHR1 1HBNA 1U09A 1V3ZA 3IO1A 1ZM4A 2KRRA 1VK8A 4MAKA 1ZAXA 1C0TA 2BVZA 1LWFB 4GKJF 5KFAA 4IQXA 3KYLA 3DLJA 3DM2A 1NHUA 1RT5B 2ZM6F 1N6QB 2W9CB 2I9SA 3LUYA 1T05B 5D4PA 4LF5F 2MZJA 3MR2A 4ECWA 5B0BA 4LMZA 1UVIA 2OMOA 1OSDA 3T5KA 3BZQA 4F3MA 3PDNA 2DNNA 5DGAA 1YJNS 2LQ5A 1L3KA 4K4SA 1FKPB 5A6WA 2IMOA 1RT1B 4Y2MA 4NRUA 4K4XA 1KC8T 2HAIA 3G6XA 1C4AA 4PG6A 1HMVB 2XI2A 4ELTA 1TQLA 4E8UA 5J1EB 5B0CA 1U6BA 2QO3A 2BXJA 1XWLA 1QE1A 2DRAA 1O51A 5D78A 4ZVEA 1TL5A 4X4PA 1KLNA 3BN4A 4HH0A 3JYTA 3B78A 5HLFB 1KD1T 5BYSA 3NRBA 1Y3JA 1N0VC 1C0UA 3ZZZA 3MR3A 3THVA 3UFCX 2MQQA 4A46A 3NL0A 3CT9A 4MKAA 3M32A 4WFAQ 3IAM9 2XCAA 3TVYA 4ECSA 1IKVB 3DRYA 1RQ0A 2B6AB 2UXCF 3RRHA 3CCMS 1AFJA 2M4MA 1HI1A 2JSXA 1IBLF 2JH3A 3OFHA 1VGYA 4TU7A 4YB7A 1DURA 2VBZA 2FHMA 3BO2A 1F2GA 4AL5A 2IVMA 2OLWA 1R0AA 4LFAF 1YIJS 5I42B 1S10A 2F9DA 3LP2A 2DH9A 4K59A 5F9NA 4LT6A 2PEHA 3AB2B 3ZC4A 2O5DA 3JSMA 3C8YA 3K8VA 3QGPA 3GFZA 4LIWA 3ETOA 2J0WA 1WI8A 3AQOA 4DL3A 4FN5A 2JC0A 1JXLA 2GGPA 2XNQA 4RUAA 2IRUA 5CYQA 1ZTWA 1LOUA 2CPIA 4B9SA 4DF8A 2RKIA 3ITHA 2HHTA 1P1LA 4I1TA 1S1VB 4JOUA 3DOLA 4A8MP 1X9SA 4CO3A 4KSEB 3DMJA 3CCTA 3Q8QB 1HHSA 1TKTB 2DGUA 4USIA 3OR1B 3OQ2A 4DG1B 5IQ6A 4ZP7A 4F02A 1T95A 3D1HA 1L3VA 1XERA 4LSLB 2FHJA 1UEVA 2JLFA 2IM1A 3H4BA 4QCLA 1HBOA 2K7JA 1TKTA 5GADU 2C3UA 4O3SA 2RSQA 1VQMS 2LMIA 3G8SA 4JI6F 3CEDA 4KFBB 4K4UA 2R7OA 2MZRA 3BGUA 4K50A 2XY6A 3MGJA 3TAMB 2E66A 2D9PA 2VFRA 2PC6A 1RT6B 2FPHX 1Y9OA 3TUIC 3D0HE 2DPIA 2YY3A 3R5AA 4F4XA 2XMKA 4JI4F 1SV5A 4NLGA 1SUQB 3N6NA 3ONQA 4U7UK 4ED8A 4KGMA 1GAOA 2RQMA 2ROPA 5A8KB 1U2RA 1YRUA 2XMVA 3H2VE 3RB3A 1FJCA 4QIVA 5DO2A 5KFJA 3IRXB 2FJBB 2KM8C 4G6VB 4OIXA 5DQGA 1H6KX 1IQZA 2OKQA 2YWKA 2HMIA 2FVRA 2WSCC 3G6YA 3D28A 5C24B 2GFFA 2X1FA 1IKVA 2GX8A 1RYSA 2C3YA 4ECZA 5KAKA 3QLHB 4DUZF 4K4ZA 2G9OA 1X5SA 6FDRA 1Y00A 5A8RB 3KNAA 2FGOA 2B9XA 3SSQA 5H9FJ 1S99A 2F1FA 2FIUA 2KXFA 2KH9A 3RZAA 3W7BA 4WFBQ 5D4LA 5C42B 2KN4A 4I7FB 1D8ZA 3HHKA 2J0XA 1SQEA 2YKNA 3PHEA 5HROB 1IN0A 3TAPA 2KI2A 4WK1A 5E41A 1H0HB 4B9VA 3I4HX 3M9NB 2W9BB 1N0UA 3DLGA 1UWBB 2KHDA 2L41A 2DGQA 2O3DA 1HBUA 2O01C 4NLOA 1ELOA 3L95X 3DNCA 4F3QA 3CJ5A 3CCLS 2AYEA 2C2EA 1RT5A 4F8RA 2HHXA 5KFUA 3VTIA 3OFEA 4CNZA 1SL1A 4Y2CA 3NAIA 1C0TB 4C8ZA 4IQMA 3QWUA 4V19J 3V4IA 1CQNA 1YWXA 2CIMA 1EETA 3SQGB 2V4JA 5B09A 2IRXA 3CCWA 5HP1B 2V5HG 1JKHB 2VUGA 4ZPVR 2DT9A 1N5YB 1VC0A 2ZNZA 1QLNA 2J7WA 1G6BA 2IYGA 3IAS9 3H98A 1CEZA 1FRMA 2LA6A 3OL7A 2R4FA 1KRPA 2DNQA 2FJDB 3I0RB 4QIGA 1BC6A 1M5OC 5AXLA 2AQ4A 5K8NA 1OPIA 1B7FA 2DR7A 4YQWA 2FC8A 1ZBTA 1VBZA 4IRKA 2CJ9A 5GAEI 3Q8RB 2CDQA 4RW6A 2KXHA 5F8MA 1FRLA 4OI3A 2A2CA 1S1WB 4JBCA 2MKHA 1FTCA 3POTB 2ASDA 1XBWA 4FNIA 2QA4G 5KFWA 2Y1RI 7FD1A 2Q3PA 4NXNF 4WXOA 2V9KA 5KFXA 1Q86T 2KFNA 3VAHA 1RKJA 1HWUA 3I87A 2BRLA 2FGCA 4EO6A 3SZ2A 2J7KA 2CQ2A 2YNHB 2E1RA 5D3GB 1VK3A 1N32F 4HHJA 1M5VC 4DR6F 3GV8B 2KT3A 4AUKA 2GMHA 3TUJC 2HYIB 4NA3A 3G9CA 4ZKAA 2VPZB 4OHXA 2HNYB 2O66A 2HNDB 2X1GA 4RKUC 4URSA 1SJQA 1YHQS 1HPZB 4AFFA 1YJ9S 2UVRA 1E6VA 2OO4A 3OUYA 1WTFA 2YNIA 3GYXB 3U1LA 4DQPA 4DSIA 2CKWA 3J80Y 3I0SB 4R0JA 2DB1A 4HDHA 2J7UA 2OTLS 3PY8A 2LA4A 1T94A 4UY8T 1NHVA 3KHLA 4O4GB 2MKSA 1WF1A 4RW4A 5KFFA 2F9JA 4YDDB 3U1NA 2EFVA 3U1MA 1FDNA 1JLBB 3K7RA 3KK3A 3EZUA 4C0OC 4RNNA 3M2VA 1S97A 2JDJA 4CT8A 2EBGA 3Q8SB 1UA1A 2CJQA 1WHWA 1HYSB 3O3LA 3MM5B 4A47A 5IQQA 1NO8A 1T8EA 4Y3CA 3DRXA 4MIWA 5LL6d 3LGNA 4C8KA 5KFMA 3K5LA 2FLPA 2CJAA 1N5SA 1FJGF 1MU2B 4MTPA 3MR6A 4DN0A 1JLFA 3HX9A 2ZUGA 4WFNQ 5J2QB 2ASYA 2FJXA 4OX8A 1S6UA 4AXJA 4O23A 2AWZA 2VFVA 3N79A 2I2YA 3MURP 2HPUA 1QAYA