1F9FA

Crystal structure of the hpv-18 e2 dna-binding domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
76
Chain Sequence
HMTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of DNA target discrimination by papillomavirus E2 proteins.
pubmed doi rcsb
source organism Human papillomavirus type 18
molecule tags Transcription
molecule keywords Regulatory protein E2
total genus 21
structure length 76
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f9fA00
2DGWA 2K3KA 1UAWA 2QA4S 3CD6S 4YB1P 1WG5A 3BO2A 2KI2A 5FJ4A 4J5OA 3TO8A 3CC4S 2HGMA 4ZKAA 2GO9A 3FEYB 2DHXA 2KRRA 2X1BA 1ZZNA 2RRBA 1WI8A 2DIUA 2OSRA 2V94A 3SMZA 1Q86T 2AYGA 1KOHA 1ZH5A 2M8DB 1OO0B 3MOJB 2LECA 1U6FA 1VQ6S 2FY1A 2L41A 2E44A 3RW7A 4UY8T 1R8PA 1NO8A 1HD1A 2ADCA 1G2EA 3D2WA 1QVGR 4TU9A 1YWXA 2MKCA 2M0GB 2LXIA 1WHXA 2X1AA 3CPWR 2DITA 3CCQS 2EK6A 2MKHA 4TU8A 2BOPA 3CCES 1VQPS 3CXCR 1YTYA 3NS5A 2MZRA 2ADBA 2KXHA 4WIIA 2D3OR 3UD3P 2F9DA 1X4FA 2CQHA 1S79A 3MI7X 5JVHQ 1WHYA 1W2BR 1AUDA 2M70A 1R8HA 2N3OA 4U67Q 1JJHA 1U1PA 5CXTA 4Y00A 3VAMA 4WF9Q 1SJ3P 2DH8A 2JVOA 5IQQA 2KRBA 2DGOA 2DGQA 1Q82T 4LMZA 3UE2A 1H2UX 2DNZA 3VALA 4Y0FA 2KVIA 2E5GA 1D8ZA 3B4DA 2DB1A 1M5VC 1WELA 3NMRA 3J7YU 2F9JA 1H2VZ 1NU4A 2D9OA 2MXYA 3LQVA 3CCSS 4CH1A 3BO3A 3CULA 4QU6A 3NNCA 5LSOA 1WF0A 3THTA 2XS2A 1WF1A 2XB2D 1X4AA 2RS8A 1KQSR 1WTBA 2KM8B 2KXFA 4M5DB 3SDEA 3CCRS 1WG4A 3MUTP 5LJ5Y 4WCEQ 1YIJS 2RQ4A 3L3CA 3Q2TC 3P3DA 3MDFA 2KHCA 4CH0S 2DNQA 2CPEA 2EVZA 4IO9Q 4Z2XA 4CIOA 3MD3A 3G8TA 2FC8A 1WWHA 3EX7B 2MKSA 1DHMA 1UW4A 2QFJA 5D77A 2MMYA 2DH7A 1WEXA 3OW2R 3S8SA 1VQLS 3NNAA 2YH1A 2D9PA 2KG0A 1H2TZ 5H1SV 2CQ1A 3ULHA 3U1LA 1P1TA 1VQ8S 2KXNB 3S01A 2I2YA 1U1NA 1SXLA 2LEBA 1K73T 4W92B 1FT8A 4IOCQ 1X5PA 1U1MA 2MB0B 2DO4A 4C7QA 2DO0A 2MKJA 2MY7A 2JVRA 5LJ3Y 1QM9A 2RU3A 2RS2A 2VODA 3ZZZA 2DHAA 2L9WA 1M1KT 2J76E 1IQTA 1N52B 4OZ0A 1DBDA 4ED5A 4RU2A 4C4WA 2OJ3A 2MZQA 2MZ1A 2M7SA 2CQDA 1WG1A 5DDOC 2DGSA 2MY8A 4V19X 2M88A 3VAKA 1X4DA 3FEXB 5GAHU 3CTRA 1M90T 1S72S 2Q79A 1SJFA 1M5OC 2DNPA 2KT5A 2RUGA 1U1QA 2OTLS 2DGVA 2HGNA 2MQNA 3B4MA 2L08A 3RW6A 1OWXA 1JMTA 2BZ2A 1SJRA 3G71S 4OZ1A 5LXYA 2ZJQQ 5CA5A 2XS5A 4YUDA 3G8SA 2AYBA 3VAGA 1SJ4P 3IRWP 2SXLA 4PKDB 2X1FA 2YH0A 5JVGQ 4FXVA 2U1AA 4QPTA 4WFAQ 4C0OC 4FXWA 2XNQA 1U1KA 1YJWS 3VAIA 2K8GA 2MQPA 1Q7YT 5MLCV 3EGNA 3R1LA 1PO6A 1OIAA 5DM7Q 1WF2A 1QVFR 3CMES 2CPXA 2CPYA 2F3JA 2DNMA 3MD1A 2NLWA 5BJRA 4YOEA 2LQ5A 3UWTA 2KU7A 2CPJA 2ZJPQ 1X0FA 2XNRA 1U2FA 3UD4P 2DNNA 4F26A 1SJQA 1VC5A 2YKAA 1CVJA 2M8HA 4LJMA 2E5HA 2RQCA 1WHVA 4WFNQ 2DH9A 2N82B 2UP1A 3CCJS 3VAJA 2MQLA 2OSQA 5HL7Q 1FJCA 2DNGA 5D78A 4A8XA 2MQOA 2WBRA 3MUVP 2MYFA 3EGZA 2VONA 5DETA 2DNKA 2RNEA 1M5PC 2MJNA 4F25A 5DM6Q 2MGZA 2QEXS 1X4BA 4P6QA 1JJ4A 1KOOA 2FHOB 3J7ZT 3VAHA 1HA1A 2OIHA 3H2UB 4UQTA 1X4CA 1X4EA 2J0SD 1YJ9S 1K9MT 1ZZFA 3G96A 1FJEB 4PR6A 3CF5Q 2XS7A 1VBZA 2DNHA 5IM0B 2MQQA 2MPUA 1F9FA 1VC0A 2RVJA 3N9UC 5DDQC 2CPZA 2M2BA 2J0QD 1FJ7A 3S6EA 2MSTA 2KG1A 3I55S 2LXUA 1VQNS 3CCVS 1OPIA 2DGUA 2CQ2A 2MHNA 4WFBQ 1VC6A 3HHNB 1YI2S 3SXLA 5DDRC 4TLQA 2I38A 4IUFA 4CQ1A 3TP2A 1X5SA 1UFWA 1X4GA 2HYIB 3Q2SC 2O3DA 5GADU 2HZCA 1VQ9S 3G4SS 3BEGB 2CQ4A 2MZJA 2U2FA 5LXRA 2DGTA 3P5TL 4PRFA 3UCUP 1U6BA 5LSLA 2CPDA 1U1RA 3VAFA 2PEHA 2LYVA 2EK1A 1KC8T 2DHGA 2AD9A 5HO4A 3VF0B 2VOOA 1KD1T 1VQMS 2DGXA 5GMKa 2YTCA 1VBYA 4ERDA 2X1GA 3MUMP 2RT3A 4IOAQ 3US5A 4EGLA 1URNA 1P27B 5GAGU 1UP1A 1VQKS 3DLLQ 2MSSA 2AYMA 5GVQA 2G1DA 3MXHP 1WI6A 2CQGA 3K0JA 1WEYA 1H6KX 1FHTA 5IM0A 1YJNS 3V4MA 1X5OA 2DK2A 1K8AT 3CCLS 2M52A 3IWNC 1FXLA 2CQ3A 2ZJRQ 1FO1A 1U1OA 3UCZP 1U1LA 2JWNA 3UCGA 1WHWA 3BS9A 5DDPC 3CCMS 2XSFA 3I56S 2LCWA 4QQBA 2E5JA 2CPIA 2LA4A 2CQPA 2A3JA 2MGZB 1YHQS 3P6YC 2DNLA 2DHSA 1M5KC 2GHPA 4BS2A 3TYTA 2DNYA 2CQBA 2LMIA 3NS6A 3R27A 3R1HA 5ITHA 2B0GA 4W90B 5IFMA 2E5IA 2N3LA 1X5TA 2CQCA 3S7RA 4QU7A 1N54B 2VOPA 2JX2A 3JB9k 1VQ7S 1VQ4S 3P49B 3ZZYA 3BO4A 5CYJA 3CUNA 3NNHA 2LA6A 2RRAA 2OTJS 2DNOA 1WEZA 2CPHA 3CC7S 2MJUA 1D9AA 2MZSA 2DISA 1VBXA 1DRZA 1A7GE 2MZTA 1X4HA 4LIRA 3PIPQ 2DIVA 2FPHX 2CPFA 1N8RT 2HGLA 1BY9A 1FNXH 1RKJA 2KYXA 2MKIA 3THPA 1HD0A 2LKZA 2PE8A 3H2VE 2KH9A 1B7FA 2MKKA 4TU7A 1PGZA 5EN1A 1VQ5S 3CMAS 1DZ5A 1XN9A 3MURP 2G0CA 1NJIT 2HVZA 2KN4A 2CQ0A 1HL6A 2DNRA 2CJKA 2FC9A 1L3KA 2M9KA 2G4BA 3CCUS 1RK8A 1N88A 2KFYA 1YITS 2AYEA 1Q81T 3LPYA 1A9NB 2KM8C 2MQMA 2JRSA 3CC2S 3PIOQ 5GAEU 2N7CA 2LEAA 2NZ4A 2M4MA 3G6ES 2ERRA 3DXBA 3U1MA 1O0PA 4WKRA 1JJ2R 3SDEB 2J8AA 3HI9A 4F02A 3G9CA 2CQIA 1VQOS 2YWKA
chains in the Genus database with same CATH superfamily
3PCOB 4OLOA 2J9DA 4YB7A 4YB1P 1XTZA 4J5OA 3IM8A 3TO8A 3ZZRA 2HGMA 4P2MA 3D7SB 3MAAB 3HZEA 2NREA 2P5VA 3DDKA 3OBIA 2GO9A 4IG3A 2V8VA 4WFZA 3NGKA 2DHXA 5E3AA 2KRRA 2IC3A 2X1BA 4WKYA 4K4YA 4JI3F 2R7XA 2RRBA 4LBIA 4M5MA 3KHRA 2V94A 3C16B 3SMZA 3KK3A 2LVWA 3Q0AA 3I0SB 1NJZA 3TW0A 4BLGA 2OKQA 4X4OA 1MWZA 2QE5A 2R2RA 1F5AA 2GO8A 1S9EA 4OHXA 1U6FA 4WWSA 3TVZA 2CYYA 4K7QA 4DN0A 5HVHA 3GU0A 4PG8A 1FK9B 4O3NA 3TQEA 2ASDA 4UY8T 2PFFB 2ZH1A 2HHTA 3W9IA 3RR8A 2DEJA 4J9UE 1S12A 1TKZA 3LP1A 3GTYX 1VK3A 1ZA2B 1Y10A 3H5SA 4DX6A 1FXDA 3OVAA 4UUWA 6FDRA 1HBUA 3MFIA 3WC0A 2VASA 3CCUS 1SL2A 3PFEA 2AZ1A 1WKKA 2D74B 1RTJA 4FYYB 2XMUA 3LGHA 1IWGA 4DR1F 1AW0A 1N5TA 2HIQA 3T5HA 1ZM2A 3G6XA 2Y8WA 3D66A 4OHYA 1RTIA 2K1RB 2QL9B 2BOPA 3CCES 4RBVA 5HROA 1T03A 3C6TB 3E3XA 1TK8A 4PYAA 3Q86A 4LF2A 3BQ1A 1QSLA 3EGWB 2L9DA 2G1HA 1H7WA 2EC2A 1ZBTA 4RW9A 1V3RA 5GMDA 4ZLJA 1U47A 1HR0F 1X4FA 1O6XA 3KYLA 5F8LA 4PWUA 1VJWA 3MI7X 2GHVC 4DZ6A 1WHYA 3A1YG 3GMGA 3HHKA 5KFAA 5HP1B 2UVUA 2VKZG 4C48A 5GADI 3IMQJ 5KFVA 2IM3A 3UQSA 1R8HA 2CNOB 2N3OA 4DQSA 1SKSA 1V6HA 1HNVA 2R42A 2NPFA 3VAMA 3DOLB 2OMOA 1YZ6A 1PBUA 2HBQB 2ROPA 1RCOB 4LRFA 3HPOA 4I0WA 2KRBA 4LT6A 4H4KA 1RT5B 1SV5A 2DGQA 1YKWA 4TQSA 2JL9A 2AU0A 4JI1F 3NBPB 5K14A 2HMIA 1ZM4A 3AQPA 4HDGA 3UE2A 2W8KA 2QLXA 2HQGA 5B0GA 3OL9A 1C0UA 2QV6A 2E5LF 2HLTA 3MR2A 2YNGA 4Y0FA 4X4PA 3M30B 5DGBA 1RKIA 1EP4B 1MROB 2E5GA 4XDCA 4X65F 1HNWJ 3NOGA 2RRNA 5FD1A 2DPIA 2PMHA 2VFVA 1GMVA 3BPSP 2C3MA 3ENQA 3EVWA 2UUAJ 4XIUA 5FDLA 5KG4A 5DG8A 5B7WA 3FKBA 2XTJP 2GV1A 2MXYA 4FDFA 4IG0B 2EC0A 4KGMA 2V8GA 3TJ8A 4K4TA 4HHHA 1FRHA 3UI3A 3IA0A 1F2HA 1FRXA 4NZ7A 3CULA 4QU6A 3BBCA 5AE3A 5HVFA 2B4UA 3MR3A 2YWFA 3V2UC 3ITHB 5C42A 2J8SA 2XQCA 3V6DA 2CRLA 1SL1A 3OVSA 1TVRB 1Z2ZA 3HFVA 1X4AA 2RS8A 1S99A 2VL1A 3DC2A 4I6YA 4UOHA 4ZCKA 4JI8F 1WTBA 4PUOB 1RACB 1PCAA 1UVJA 3CCRS 4DFKA 2ZWPA 1S1TB 1WG4A 4C8NA 3CD7A 5KFSA 1W7WA 1S7HA 4LF7F 4CO1A 1RBAA 1MWQA 2HNYB 3I32A 1GX5A 3M32A 4WCEQ 2JEJA 2VPWB 2I1RA 3JQMA 3M30A 3ZFVA 1HI8A 3GCWP 5C24A 3TX0A 3MDFA 1LK7A 3BV8A 2EG1A 5KFEA 1LW0B 5HJXA 3FSXA 2XMKA 1IKVA 1CJVB 1HFEL 2XYGB 3GG1A 4DF8A 1HNXJ 2B6AB 1CQNA 3I5BA 4Z2XA 1R0AA 4WIQA 3WBZA 3UW1A 5A76A 3D6TB 3EX7B 2KVQE 2MKSA 2QFJA 3JS9A 1I51B 2HBYB 2A2CA 3CWJA 4HVZA 4AUKA 2VQEF 2AGOA 4KPCA 3S8SA 2W01A 2J6TA 1HNVB 3NKYA 3CE8A 2BR0A 3OVBA 4K5RA 1XNRF 3OL7A 3MEEA 1HQEA 5ETRA 1JLFA 4PQAA 3KHLA 1H2TZ 5H1SV 2R9LA 3TEHB 3PKMA 2GFFA 3S01A 5IV4A 3BZQA 1PYOB 1H74A 4JV0A 2PD1A 3IGNA 2V4RA 1D1UA 2RHSB 3QATA 4QBUA 1FT8A 1LFWA 4IOCQ 2VFTA 3NG8A 3GYNA 2EEYA 4Y6IA 3QWUA 2D3UA 4C7QA 3M1VA 2YNIA 4K2XA 1NKEA 4J9PA 1I5OB 1OQ3A 4TYAA 5LJ3Y 5K8NA 4DFMA 2W2NP 5L39A 3BF4A 1SQGA 1ZS6A 3B82A 3JXOA 3UN2A 5D3GB 2HHWA 1YBUA 4EZ6A 3ZZZA 4NI2A 2L9WA 1JLGB 1X7VA 2IVYA 2J76E 4KGZB 3VQTA 2HFOA 4B17A 4OZ0A 3RJMB 3UPFA 1HHSA 1VRTA 1UZDA 2HS4A 3MWBA 4N5SA 3KLFA 1UEKA 4UZBA 3OJUA 4RW4B 1SQEA 4ITSA 2M7SA 4KAIA 4ZPDA 5A2QU 2XB2D 2JHEA 4OYAA 4ENOA 1OPZA 1WG1A 3MHYA 5T41A 3RAMA 4B9VA 4LBPA 4V19J 5IS2A 2WW8A 5DQIA 2HHXA 1QTNB 2GJ2A 2P2CB 2ZH2A 2VFUA 2HS3A 1YJ7A 2IPOB 3AT1B 4PYDA 1P1LA 2VICA 2ACYA 1XNRJ 1RP5A 1S72S 1IBKF 4MT1A 1BWEA 2FHJA 5EHHA 1ACMB 4LR7A 2IVFB 2HQIA 2RKIA 1NM2A 5F3ZA 2XBPA 3TANA 2G2OA 3LA0A 1TKXB 2F4VF 1KHWA 2KT5A 2RUGA 4DPYA 2XEXA 3DGPB 4RO0A 3F56A 1PC4A 2DGVA 4WXOA 1FNOA 5CH7B 5DJBA 1LWFA 2BZ2A 4KY3A 3FVYA 4OZ1A 1RT2A 4TY9A 1SJ1A 2AEJA 2QYGA 4J9SA 3ZZ0A 5JJBA 1FKAF 3C6UA 2IMOA 4O0NA 2EFGA 2W9CA 2C2RA 1SUQA 1P6TA 4K4ZA 1JLFB 5CYQA 1AROP 4AE5A 1JNZB 3CDEA 3QT7A 2DR5A 4ZOSA 4KHPF 3T1HJ 3J7A1 2GGPA 3K5NA 1RAHB 4DL5A 1UFKA 1H72C 3TI0A 2ZDOA 4C0OC 2KFNA 5J2QB 2FLNA 4ED3A 1VFJA 2XSJA 3DHXA 3M8YA 5F8IA 5EWGA 2YQ0A 2N7YA 3G87A 3D1QA 2XHCA 1R8BA 1Q7YT 2ASYA 5LMUJ 1OIAA 4RPFA 1WF2A 5DM7Q 1B0TA 4DPOA 1QVFR 2R7UA 3GSDA 5RUBA 2HVDA 4DV3F 1S10A 4KKOA 4DSLA 2RAQA 2F3JA 4PG6A 5LOQA 3MD1A 3TNVA 5BJRA 3DOKB 3UWTA 1S6QB 2B4OA 4BCAA 3SYZA 2Y9HA 4CLFA 2IAJB 2YKMA 4LSLA 2XNRA 2L3MA 3TAQA 3D3BJ 1VC5A 4ZN3A 4RKUC 1R0CB 4KFBB 5F41A 2Q3PA 5C42B 4Q44A 1T03B 3ZTRA 1WC1A 4F67A 5KG2A 1WOOA 3BDEA 4N77A 3ZTQA 4DR7F 1WHVA 2HFZA 1CPZA 2B51A 3VR1A 2UP1A 3CCJS 2B8PA 2MQLA 2KDOA 4GO5X 1CULA 3J81U 4X4QA 4JI4J 1LWEA 4ZHRB 4LF4F 1WACA 1FFSB 1JLQA 1YRUA 4ECUA 4NE9C 2LFVA 4O4GA 3H90A 8RUCA 4A8XA 4DPTA 2MQOA 1TFYA 2WBRA 3IS9A 4Q0BB 4YN3B 4F4XA 1NPKA 5HLFA 3GILA 4LSNB 1VRQC 2J6UA 2HIYA 3D1OA 3AB2B 2DNKA 4Q7AA 4A8OA 5EWEA 1M5PC 3DOKA 5DM6Q 2MGZA 4Q8FA 5K8OA 1URRA 1RTHA 3SCIE 1KOOA 2FJEB 1QAXA 3M6UA 4QWBA 3VAHA 2PMWA 4NXMJ 1HA1A 2OIHA 1REVA 1T02A 3H2UB 2RQMA 4JBCA 4DUZF 4WYLA 1XQIA 3PACA 4CI0B 2ZH6A 2ASJA 4B9NA 1UPMB 2QA1A 1SKUB 3U7JA 4DFPA 2RDDA 4UW2A 3RB0A 5KG6A 3G96A 4ED7A 5HAOA 2XS7A 4LF5J 2FB0A 1N34J 1RABB 2XI2A 1ZTTA 2LDYA 5IM0B 5HK4A 2MQQA 1GMUA 2CNLB 5E41A 1I94J 2GGPB 3IRXB 4RWWA 1ZPWX 3EVOA 3N9UC 5SZTA 2LDIA 2E1RA 4FVMA 5I3UA 4OZNA 5A2QY 1HHQA 1FJ7A 3M7VA 4C9DA 3QO9B 2MSTA 1VQYA 4TYBA 1BGXT 2WOMB 1FXRA 2EXUA 2MHNA 3TUJC 1VHIA 1VC6A 5KG1A 2E7WA 4RNOA 4TLQA 3KLHA 4IUFA 2D3ZA 2ALZA 1MNEA 3GYGA 3Q8YA 3L9ZA 4G1QB 3GQCA 4LR9A 4MJKA 4MFBB 3H5YA 4J9RA 2JJ4D 1UFWA 2C2NA 3PKYA 1HW8A 4JI0J 1K1QA 3BGRB 3KNAA 1NJWA 1KLMA 4I67A 9ATCB 5AXMA 4ZCMA 5IC4B 3NOCA 1GAOA 2RF2A 1NPRA 4C8OA 3D67A 3KMQA 4ZPBA 1N48A 1VQ9S 2Y0SD 2UU9J 1BUXA 4USTA 4PUOA 2AJQA 3OUYA 3PV8A 2OHDA 1KTVA 2W4CA 4I68A 3KLEB 4HHUA 4USWA 2BYCA 2V4JA 3RRHA 2AX0A 2AD9A 1UJ4A 5A8KB 2AGPA 4QW9A 3TR5A 3VF0B 3AA9A 3WDOA 2VOOA 4FYWB 4DSJA 4M5GA 4JB8B 2IY5B 4Y2MA 1VQMS 2V50A 1RISA 3MM7B 1C4CA 4WU3A 3MAAA 3SV3A 1WSRA 3KLHB 2FZGB 3THVA 3MUMP 5F9NA 3DM2A 1VI7A 2VH7A 3ET6B 1NSKL 3D9BA 3US5A 4EGLA 5E2QA 1OYEA 3BGUA 3J7YI 1VQKS 1IBLF 3EICA 4DSKA 3G2XA 4RL1A 4RW7A 3MFHA 2X51A 4WFYA 3ZZTA 2G1DA 4K59A 2DEIA 4NCGA 2EFVA 1TV6B 4X4TA 2RILA 5IM0A 1YJNS 1H7XA 2AJ2A 1IXKA 3V4MA 2DK2A 4B3TF 1LK5A 1HNIA 1I3OB 3CCLS 2M52A 4K8RA 5I4MA 2YNHB 1XNQJ 4OZ5A 2CAJA 2MTLA 1XNQF 4DR7J 5HN0A 2H5IB 1FXLA 2JEGA 2QLJB 4QIFA 1KRPA 2RQKA 3OLAA 2DPJA 1U1LA 3A8IA 2DCUB 2EFQA 1S6PA 2R4FA 1Q8LA 1FJGF 1WHWA 2A2DA 2V2KA 2VDIA 3K5PA 4ZP7A 1W2IA 3ZNJ1 1HIYA 2ZH3A 3CCMS 5J1PA 2ZKTA 4MYUA 2FJDB 2XWYA 3FBCA 3MECA 4CNYA 2DXDA 3GV5B 2OPRA 1U0HA 2CPIA 1AB8A 2VDHA 2HQCA 1FVQA 2A3JA 1IKVB 2BJ3A 3ET6A 1Y0HA 4YR2A 4OZ3A 1HNZJ 3GV7B 4ZS6A 3NGRA 4BS2A 2XYPB 2CG8A 5K8MA 2LMIA 3NS6A 2B8QA 2LXFA 4M1KA 1UWBA 2XMVA 1BQNB 1XR5A 2CQCA 2HQ3A 3S7RA 3EZ5A 2EG2A 2YQ1A 1RI7A 5T14A 1GQEA 5D0EA 2PI5A 5KFWA 1S59A 2CWKA 2ZE2B 1TVRA 2F8HA 1IN0A 3N79A 2V6AA 4FKXA 2CKWA 4R5PB 3QRPA 4JI6J 5H9FK 3K5LA 3D5MA 1FX2A 3BO4A 4PPZA 3SCJE 1WSVA 2BX6A 2NXEA 5KFDA 1H38A 2LA6A 4LFCF 1TKZB 1SBRA 4C0BA 1APSA 3I9ZA 4FXDA 2GIRA 3GJRB 1REGX 3HSZA 3MEDB 4CLWA 3PX6A 3HP6A 1JLAB 5KFQA 2NQPA 4IDKA 4H4OA 2V9WA 2XLKA 4K4SA 3UDEA 4F04B 2Z2LA 2Z2MA 3ILJA 2DBBA 3OD2A 2QLFB 3HD2A 3NGTA 4LIRA 1FRJA 4Q2LA 4URQU 2KKHA 2PO4A 4IKAA 3VCDA 5L9NA 3BJYA 2HFNA 3EZUA 3SFUA 2JZ5A 3HHLA 4USMA 5D3GA 3NMAA 3MM6A 2OP5A 4X4VA 4F4AA 2VC1A 1Q8BA 4ZA1A 1RKJA 2KYXA 4JV5J 2MKIA 1HD0A 1FKOA 2BV3A 2LKZA 2D7SA 4DFJA 1RYRA 4FF2A 4I7FA 4TU7A 2BVZA 4JV2A 1PGZA 2DXEA 2DTJA 5KT6A 1TV6A 4MIAA 4URSA 4FNIA 4DQQA 2HWTA 2C2OB 2Y1RI 1DQ9A 2W9CB 3V4IB 1OSCA 4LFBF 1N6QA 2C3UA 4YR0A 2XMAA 5E3PA 2FC9A 3K7RA 3HT3A 2M9KA 1RT2B 4J37A 3TEGA 3M8PA 2G4BA 1MMDA 1XMOF 1L3UA 4RZRA 4JV1A 1N88A 2KFYA 2DRAA 3OLBA 4DUZJ 4H4OB 2CNKB 2AYEA 1F2GA 4AFFA 1RAOA 2QLBB 5IT9Y 3AODA 3MAHA 3K89A 1RTHB 1KTQA 2MDAA 3MMBA 4OX6A 2OGUA 3GIKA 1D9FA 1YG0A 3CIZA 4OJGA 5IT9U 3JTOA 5B0CA 1MG7A 1UPPA 3PIOQ 1WOPA 2YPZA 3CD5A 2UXCJ 1HBMB 2J0WA 1HHTP 4X64J 3M2VA 2MLXA 4Q5VA 1RHKB 4OJHA 3C15B 3ILIA 3EDQB 3IP0A 4RU9A 3AHPA 3HFKA 2KB2A 3W7BA 2J8AA 2BE2A 3HI9A 1ITPA 1LWEB 4OI4A 4ZHRA 1VOMA 5KFMA 4OFZA 2P8IA 1HI0P 2OEMA 2DGWA 2K3KA 3BYPA 4OX9F 4RUAA 3J7AN 1ZA1B 2CFXA 4TN2A 3N5BA 3CO0P 2XGQA 3GV8B 2DXFA 3JSYA 3FEYB 1R89A 2RE1A 2P6SA 3BKUA 4P71A 3KHGA 1NB7A 2YX4A 4FF4A 4ZP8A 4USIA 2DIUA 2AYGA 2HBRB 5FDLB 1Q86T 5CABA 2CDRB 3M2UB 5J2PA 4NOHA 2M8DB 2RMLA 2VQEJ 4DX5A 5EDWA 3PVXA 4KTQA 2UVRA 2UUBF 1B0VA 2UUCJ 2HURA 2MKYA 3FJ2A 3PX4A 1X60A 4OHVA 5JMNA 2L41A 4DL2A 1XR7A 3M2RA 2XY5A 1KP6A 4YY3J 1IR2A 5J2NA 1NKBA 4DV6F 2J6SA 1N5YB 1ZM9A 2DR7A 3HJFA 1QVGR 1EIYB 2QSWA 2B5JB 1KQKA 5CYMB 3HVRA 3NS7B 4TU9A 4Y2AA 4F4ZA 1NK9A 2DVIA 1D0EA 1YJTA 5K9FA 2X1AA 2OPSA 4QW8A 3OR1B 1D3WA 3HVTB 3ZO7A 4CM2A 1BXNA 2MKHA 3KUHA 3QLHB 4TU8A 3QSIA 2JEIA 2FLLA 1I1GA 1QDUB 3DRRB 4FVCA 2HBZB 1RWMB 1U24A 2K2PA 4K4XA 3K5MA 1VCTA 2DKOB 5CHCB 3NS5A 3PRDA 4QWCA 2W1BA 4KHPJ 2K3IA 2B9YA 2D3OR 2F9DA 3RZAA 2B56A 3CSKA 5LMNF 1QSYA 3DYAA 4ZJOA 2F7VA 1R31A 2HRYA 5JVHQ 3HF5A 1V9OA 1ZTWA 2HHQA 3FBEA 5M2PA 4NEZA 4HI1A 2HAFA 3D0HE 4NZ0A 1H98A 4ELTA 2IJFA 4U67Q 1U1PA 3V6KA 4NZ6A 5CXTA 2Q66A 3LP2B 1ELOA 3M2VB 2HHSA 4WF9Q 2A1BA 2W9BB 3DLEB 1SJ3P 4KGVB 3RAXA 1F1BB 2JVOA 2DGOA 4DWIA 3QWPA 3AOAA 4A8FA 2E1CA 2YWEA 1Q82T 1V5VA 2G2YA 1K44A 4LR8A 3HXMA 4HYKA 2ZZTA 3R5CA 2DT9A 4NXNJ 4ED6A 2DNZA 3DMJA 4IR9A 2UVVA 4EZ9A 2QZ8A 4F4KA 4HTIA 3MECB 1D8ZA 3ILOA 3D6HB 1JLGA 5F8MA 2ZM6F 1M5VC 1DTTA 1DAXA 1S9EB 1QTMA 3BDPA 3U1NA 2W2OP 3LP0B 1Y3JA 4H4MB 5D0HA 4M8LA 5ETLA 2VBWA 1S1WA 4CT8A 3J7YU 3BSNA 1MU2A 3HHDA 1AUSL 2HSEB 2WB4A 2ZBRA 4EWTA 4AL7A 2IYIA 3KJFB 4MKBA 3GYXB 5AXNA 4P2FA 3LQVA 1N5QA 3CCSS 2IJRA 5BYSA 3TUZC 4CH1A 1N5YA 5H9EJ 2A6MA 4DG1A 5K5MA 2UXCF 3NNCA 1WF0A 2XS2A 4PXBA 2YNHA 4RUCA 5J2NB 4UTGA 3AD9C 4ZDNA 4PWDA 3P8BB 2YWGA 4NRTA 2HHPA 1BQMA 2AX1A 3A8JA 2QIFA 3EXYA 2Y1LB 5A8RB 3J80Y 2E9ZA 2B9EA 4NCGB 2F8EX 5CYQB 3KOAA 4NMXA 2H48B 3CNQP 3QSYB 3IAM9 2IHR1 4ZPWR 4IR1A 4RUHA 5LJ5Y 4AL5A 1RWPB 4DDFA 2CJXB 4OIXA 1YIJS 2A6OA 2BKPA 5H9EK 4C8YA 1VJQA 2AJ0A 2FY8A 2C2KB 2UVWA 2GVZA 2VKRA 1WD6A 4C11A 1NLKL 2YX7A 1R0AB 3BSOA 3MMCA 2KJVA 4DUYJ 4IO9Q 1RYSA 1M5HA 3G8TA 1R8AA 2FC8A 2MQ8A 4QZVB 2HVIA 4MKYA 1WWHA 4F50A 2YWHA 1DHMA 1T95A 3T5LA 2CZVC 4JUZA 3N5FA 4FBTA 1RA7A 3MEGA 2CG4A 1WEXA 2Z58B 2HNYA 2BE2B 2UZAA 4KO0B 3WHIA 7FD1A 3UVJB 4JV5F 4ED0A 1RT1A 4CLZA 2G0IA 2FD2A 2W8LA 1NK4A 4QWDA 2CJBA 1VQ8S 2KXNB 3GWCA 4L76A 2VG7B 1TELA 1FFGB 3O44A 1U49A 4ID5B 1J5EJ 2BUNA 2HNDA 3OR2A 3RG6A 3D3CJ 4TY8A 1FA0A 1K73T 4CYUA 1TUWA 4HTJA 1SB6A 1TL4A 1X5PA 5ETOA 3WX4A 3RBZA 1U1MA 2MB0B 4XK8C 3CO9A 3DLGB 4H54A 3Q8PB 1N5VA 5HATA 1P9YA 5CZVA 5C25A 1K47A 1DURA 2BABA 3NRBA 2ZWOA 3VZIA 4IG3B 2RS2A 2WOMA 2VODA 2HPUA 3GIRA 3BKFA 4ZVQB 3VVTA 2D41A 4OYXA 3RGIA 3W64A 4DL0C 3TA2A 5DO2A 2Q43A 3UFCX 1LNQA 1WKLA 5DLGA 2MZQA 3PHTA 1ROFA 3NBPA 4URGA 1RJJA 3GR0A 5DDOC 3QRRA 5LSRA 4UF4A 4V19X 1ZETA 2YXLA 4ALZA 4NLQA 2B9WA 4R0EA 1ULRA 3D6FB 3PTWA 1L3SA 3FEXB 1GNKA 2H1YA 4B3SF 2CVEA 4IYQA 3CTRA 3AOBA 3CJ0A 3JQJA 4YDXA 5GAHU 2KYZA 2Q79A 1RT3A 3M9OB 4OX7A 2ZH8A 5I42A 1JJCB 4HHJA 1SJFA 4QYRA 3M6XA 3W3SA 5ETVA 2ZC3A 3A3NB 3Q89A 5HANA 4D3GA 1L5UA 5A8KA 3MR7A 3B4MA 1VK8A 3G9CA 5J2MA 2E1PA 3RW6A 2QMXA 1KDNA 1JMTA 2QJ3A 3DXSX 3R5BA 3W2WA 3OL6A 3KLGA 3AJDA 4XTTA 4DV5J 5DGAA 3T6BA 2E1MC 3Q23A 2WB1D 5F0UA 3T1AA 1PIEA 4P52A 1VHFA 3G8SA 4F4WA 4DR6F 4O4GB 3BM7A 2AYBA 1JLBB 2HQDA 2RF2B 2ROEA 5IT4A 3MR5A 4PCQA 2X1FA 4NA2A 3M9NB 5JVGQ 4FXVA 3BN4A 4U7UK 2EFPA 3HHLD 4CO2A 1TKDA 5KFJA 2MEWA 2W25A 1FERA 4FXWA 3TAMA 2JLGA 1U1KA 3CDAA 4DSEA 2IA0A 4W4MA 4DPUA 2K8GA 4IH6A 2OFHX 2JFKA 3FFIA 2I8EA 3M05A 2R2UA 2VG6B 3PNIA 4M63A 4Q43A 4ILRA 5HQLA 3D54A 1SL0A 2H5EA 3CMES 3IR5B 4NXMF 5IXUA 2DNMA 1KONA 2UXBF 1HWLA 3KJVB 4YOEA 3ELHA 4R5PA 2KU7A 4ILLA 3UD4P 2FHMA 2DNNA 2FHKA 2XSJB 4ZCLA 2FVSA 1PAUB 1FX4A 1NZAA 3CJ2A 3DRRA 4O23A 5C2GA 3KK2B 4B3MJ 4DQIA 3MMJA 4IRDA 1UEVA 2XCAA 2E5HA 3L4BC 4ETZA 5DS7A 3A3OB 2G13A 2OD6A 2DJWA 4HH0A 5K20B 2N82B 3PO4A 1F6TA 2GVDB 2ZEJA 3KXDA 3CCZA 1Q1KA 2GZOA 4HT5A 5HL7Q 4DF4A 1FJCA 1IBKJ 2DNGA 3MPYA 3C6UB 5G4DA 5I3PA 3TAPA 1BE4A 2CWXA 1BC6A 3UN5A 1YBAA 1LKZA 4BC7A 5KT2A 4X66J 3MUVP 4I2PA 2JNJA 2MYFA 4WBFA 3CB4A 4DR4J 4NYZA 4P2SA 4P10A 3IN5A 4E0DA 2KJWA 4L73A 3VGSA 1LWFB 2RNEA 5DETA 2NYHA 2MJNA 4F25A 4LF8J 3PW5A 1IKWB 3T1YJ 2KHDA 3OQ2A 5CD4H 2LU2A 3Q8QB 3HKWA 3LWMA 5D6GA 4P2XA 5E33A 4OI0A 4GKJF 4C0HA 2ZH9A 3KNGA 3FZ2A 1CULB 1X4CA 4LF6J 3N6LA 3MF5A 1RLCL 2YKNB 3NXZA 3D0IE 2GJIA 3LP2A 4LF6F 1YJ9S 2J9CA 1K9MT 1Q5VA 4QR0A 1FWPA 1PJ6A 1RTJB 3MOZA 3ZC4A 1Q4RA 5B0DA 1VBZA 1T9UA 4ID5A 3OSPA 2IDEA 2AZ3A 3X3UA 3ZTSA 1FNMA 1IR1A 1F9FA 2VB6A 4C6AA 5EGYA 1SVDA 3UNGC 1UWAA 5KFNA 2Y1JA 3QNWB 3GONA 2XMTA 3TVYA 5DDQC 4DR2J 1T9YA 2WBMA 1GX6A 3I9V9 4X65J 3LOUA 5DG9A 1TL3A 3GCXP 1MN9A 2XM3A 2NXCA 3Q83A 2KG1A 5BR8F 4DR5F 1LV5A 4B3OA 4J9MA 1HARA 3HHNB 4ZLNA 3BQ2A 1AYEA 3QMQA 1JB0C 1FDDA 3W63A 1LQ9A 3TP2A 3IGVA 1Q78A 1LFPA 4OJ1A 5J2QA 1P9QC 3GB0A 2BJ8A 1PILA 1QD1A 1VMBA 1X4GA 2PSZA 4OYMA 3EUNA 4I2PB 1EQMA 2HYIB 1JWWA 3M8PB 2GMHA 3M8WA 3PJWA 3QFHA 1HQUA 1FEEA 3CDBA 1WC4A 2O3DA 1CEZA 1FRLA 2HZCA 4MTPA 4L6V3 1NSAA 3V4IA 2PA3A 3BEGB 4DBQA 2ZVSA 4O4RA 2U2FA 5LXRA 3KK1B 4EYIB 3BB5A 3MM5A 5L38A 4QJVA 1MMNA 2V9KA 3BH7B 1O5JA 2B9XA 1U6BA 2ZNZA 4A47A 5LSLA 4DG1B 2RUSA 3VAFA 4CTAA 4J9KA 2DHGA 3PRVA 4PQUB 1XK8A 2V2VA 5HI7A 1HPZA 5M2UA 1IJFB 1S48A 3HDSA 1B99A 4P7VA 2W7PA 2A0FB 2APOA 5GMKa 4DV4F 4TLRA 4DV4J 3C2PA 4ERDA 3MM8B 4C2MA 2RT3A 3QZ8A 5KFFA 3MR6A 2RB7A 3CEDA 5B0EA 3WC2A 5M2RA 1SPBP 1RZMA 1FDAA 2QO3A 1KBRA 1KKHA 1NUEA 3AB4B 3QIPA 2JLEA 1S9GB 2QYCA 4Q2MA 1DQAA 2BJ9A 5L9XA 2FTRA 3DLLQ 2MSSA 2JLFA 2LU1A 1ZAWA 5GVQA 1HBNB 3DDNA 1Y5IB 4NPOA 2CQGA 1FHTA 4P75A 1H6KX 1C2PA 2VBYA 3SCLE 1N36F 3D28A 2JEFA 2FJWA 3VTIA 2KO1A 1CJTA 1HBOB 3OSNA 1AFIA 4KYZA 1PC5A 4C8MA 4ANCA 2ZJRQ 4ECSA 4NI2B 4QCLA 2OPPA 5AJ3F 4PABA 5GMEA 3UCZP 1RBLA 4XDDA 3UNYA 5E3CA 5AJ3J 4A8WA 3BKTA 1E6VB 2I9SA 3UCGA 1C0TB 3ISND 2FZKB 1XC9A 3KG0A 4IRKA 2RU9A 5DDPC 3I56S 2HQFA 2LCWA 1TL7B 2W2MP 1UJ5A 1YGYA 2NZCA 2ZDPA 5LL6d 1C1CA 1JX4A 2OAUA 4JYAJ 2CQPA 3MMCB 3KWMA 4WZQA 3UDCA 2XMJA 1RHUB 4WTYA 2HWIA 3WIVA 5J2MB 3NLCA 5LM7E 2RD5C 1M5KC 2FZCB 1K0TA 4OV6A 2CQBA 3AAWB 3R27A 5ITHA 2B0GA 2HHHJ 1KHVA 3AXKA 3HZGA 3OTDA 3PG9A 2E5IA 1V5IB 3X1LB 3LUYA 1RT5A 1SV5B 2POKA 4B08A 2CZ9A 3QIDA 4EBEA 4QU7A 4RBUA 4CRJA 3RAQA 1TL5A 4DV0J 2FVQA 3I0RB 4OYZA 5KFHA 3PEJA 4CLYA 2J9DE 4X4UA 1RHQB 4PWDB 4CH7A 1UVKA 5I3QA 2LQBA 5CYMA 3JB9k 5B09A 2YKPA 3H0PA 3P49B 2BW2A 2WAQD 5CYJA 3CUNA 3NNHA 3MMAA 2LQ8A 1CJUB 2OTJS 3CC7S 2MJUA 3IG1A 1D9AA 5DZ6A 2WK4A 3LO3A 4R25A 4OJ3A 4N76A 2MZSA 1GH8A 3PHEA 3TZWA 3NGSA 3W2VB 3T5JA 4LRDA 1VBXA 2LQ9A 3DGVA 1TL7A 1X9MA 1DRZA 1X4HA 1QUVA 3PIPQ 4DEZA 1UTAA 4E2FB 1AA1B 1S1TA 2CPFA 2EI5A 1F3VA 3R5JB 3ICLA 2BQ3A 4G65A 4GO7X 4YHHJ 4N8NA 3G6VA 1S0MA 2BJEA 1G6BA 4CDIA 4QWAA 1WC6A 3H2VE 2KH9A 4OZLA 3CJKA 2XCPA 4M5KA 3V6HA 1HNXF 1TZ0A 2VV5A 4ZPVR 3PZPA 2E1AA 3M6VA 3NCQA 1WJ9A 1VQ5S 4OX9J 4EMDA 3CMAS 1DZ5A 4B9MA 3DLEA 1NB2A 2G0CA 4U8VA 1NJIT 3R2CJ 2HVZA 1CBKA 4KHMA 3LW5C 2KN4A 2IAJA 2BJDA 2YKMB 4LSLB 1VQOS 3RRKA 3BQ0A 1S77D 2DNRA 4ECYA 3QIPB 3A4TA 1HR0J 4ZPAA 4NLSA 1HWIA 2HVHA 4DX7A 3KLGB 1EX8A 3W2VA 5F8HA 2PEBA 2FHJD 1KQFB 4LFAJ 1FD8A 2OMLA 5BYQA 2QG9B 3NCRA 1A6LA 1SC4B 1T9VA 2AP6A 2F4FA 4LRCA 3BH6B 1NSQA 4FS2A 2BJ1A 1A9NB 1YQHA 2KM8C 1K0VA 2P9GA 3W9JA 3HFZB 5KOXA 1NK7A 5L1JA 1B3TA 1AT1B 2FQQB 2NUHA 3RBXA 2P6TA 1LW2B 3FSIA 2NZ4A 2M4MA 3GJTB 2J0XA 3TRGA 2OD4A 5IZHA 3U1MA 1MN7A 4AQYJ 3E2EA 4B9UA 1VDHA 1O0PA 1RWKB 2OI2A 1S0VA 4U7UD 2AHOB 5D8HB 2QL7B 3P5BP 4G1IA 4ZN1A 3DRSA 3M8QA 4ZVSB 4DPXA 4GC7A 1UW9A 1CC8A 1S6OA 4IFVB 4MK8A 5B08A 3GR1A 3Q8UA 4HL9A 2VG5B 3UR0A 2QA4S 2ASLA 1IR0A 1HMVB 1NRKA 1WG5A 4FPIA 2HG4A 4WJBA 1FDNA 1DLOA 2OPQA 4I7FB 3CC4S 3MCSA 2MLZA 1T05A 3DLKB 3EVMA 5B0AA 2V8DA 1Q53A 1J27A 4MKAA 1WKJA 2XHWA 4ZKAA 5HQMA 3ILLA 1RAJA 4DXLA 1ZZNA 3Q24A 4ECTA 4B3OB 1WI8A 2OSRA 1TAQA 2WVEA 4DHVA 4BDPA 4YB5A 1KOHA 1N0UA 4USJC 1ZOTA 2HVEA 4BC9A 2XLIA 1ZH5A 3KJVA 2UXBJ 1KQGB 5HBMB 1VQ6S 2ACMA 5KG5A 1R8CA 2NXNA 1SC1B 4TY8B 5L46A 3M9MB 4A8MP 5U47A 4ZVHA 1N32J 2E44A 2C3OA 3VGVA 1GXTA 1TKTB 5FLXY 4JI7F 1WNEA 1UVLA 4Y28C 3S1TA 1NO8A 2X7IA 2GC8A 5ETNA 4LF7J 1HD1A 3K5OA 3HKZD 3I4HX 3H98A 4ZPCA 3TQ1A 2Y3YA 1G2EA 3D2WA 2UXDJ 3CJKB 4F8RA 3PW4A 2Z2ZA 1JXVA 4OMFG 2AGQA 3T6JA 1KEKA 4A8KA 3DRXA 4ZVOB 2OH2A 3WQPA 3CPWR 1RU1A 2GA7A 3B8HA 3W65A 5K8PA 3Q8SB 1NMEB 4G3IA 3U02A 3DU6A 2ALYB 3BN7A 3EWGA 2F5GA 3CCQS 4DL6A 4OZJA 4FNHA 2W9AA 2VA3A 4LBHA 1Q95G 5CCLA 3ISNC 3HHEA 3EE3A 3CXCR 1TU0B 2O1PA 3PR4A 3DYAB 1HPZB 1YTYA 3W62A 2FJAB 4NWBA 2ADBA 1RHRB 1VRUB 1X31C 4MH8A 4LFBJ 2IM0A 3UD3P 4X4NA 2IJNA 2YVSA 1SH0A 3BREA 4OHZA 4WTOB 3H8YA 1S1VB 1S79A 1XIQA 2Q6CA 4N8OA 1FWKA 5IT0A 2NXJA 3F41A 3ONQA 1NH7A 1W2BR 3LWLA 1YX2A 2R8GA 2OELA 1BD6A 5E3RA 1HQUB 3HVTA 4M5JA 4R8UA 2UUCF 3VZHA 2GVDA 1OQ6A 2G0JA 4AL6A 4NLXA 1IKXB 3DFEA 4EYHB 2DH8A 2B5JA 5KT4A 1JKHB 4OHWA 2B6AA 4A46A 4F3OA 1UEUA 2VQFJ 3KDNA 3TUPA 2IRYA 2Q1LA 1GXUA 3OHAA 1U2RA 2HNZA 5KFTA 2JSXA 3D0GE 1M0SA 5DLFA 5DRKA 2KVIA 3JQKA 2DB1A 4JI6F 1WELA 2Z2YB 3DRYA 3FDSA 2HEKA 8AT1B 5F8GA 2Q6BA 2VFSA 3POTB 1RUSA 2H65B 3W9HA 3AH6A 2F65A 4OYOA 4IFYA 3CJRA 4UOCA 1H2VZ 2EFOA 2D9OA 3R8YA 3C3LA 3FCVA 1E6VA 2IIHA 2CNNB 2VPXB 2B7BB 3R5AA 2WSCC 3R7BB 4CLSA 3ETMA 4NA1A 2J7KA 4CZCA 5LSOA 4I64A 3KLEA 7FDRA 1WF1A 4ER8A 1WOSA 4M5IA 3G8QA 2BM0A 3E51A 5A6WA 5C2CA 2KM8B 1Q0NA 1RLDA 1UFLA 2Z4PA 2B7CB 3I96A 2VPZB 4RBTA 1FEHA 3CJTA 1S6QA 3TZYA 3AJ1A 2R8IA 1TK5A 1BQNA 4M94A 4DOZA 1UWBB 3W2WB 2RQ4A 1S9GA 4RW4A 3KLIB 3TWZA 3W5XA 3P3DA 3L3CA 3B6BA 3HSDA 4LF9J 3Q2TC 4JI5J 1IWAA 2KHCA 3CMQA 3KKFA 2VA2A 4ELUA 3CJQA 4WP3A 2VQFF 1IBMJ 3PJXA 2WVDA 3PRBA 3OHBA 1S6UA 3H20A 5ETPA 1JKHA 4C98A 4GKKF 3CJ8A 2IFXA 2IM1A 3M4XA 4KH0B 3PW7A 4QWEA 4EEYA 2GIQA 4J9LA 4MAKA 1UW4A 1RT3B 2YNIB 4RNHA 1PSDA 2LP4A 5D77A 1VLOA 5T7LB 2DH7A 2H51B 4ETXA 3DHWC 4XAKA 1NZ8A 3OR1A 3R7SB 4R8UB 2OEJA 2M3DA 2AKWB 3NNAA 2D9PA 2V34A 4RR5A 2XO7A 2KG0A 1FRKA 1Y5NB 3O1LA 4CM0A 3J81Y 5ETMA 4WE1B 4ZPTR 3ULHA 2Z30B 3U1LA 2HFSA 1ZAXA 3EPIA 3FBBA 1U0SA 3SQGA 4DU8A 4EFAC 4FF1A 4DS4A 4DCPB 1U1NA 1SXLA 3I6PA 4NYPA 5KG7A 2LEBA 4RW9B 3VVUA 3A13A 3B78A 3BBBA 1C1CB 1MLAA 1OMSA 1TMMA 2NYIA 4IH5A 4NL5A 2VC0A 4F0HA 2DO4A 1U45A 1M5SA 2DO0A 1FKPB 4RNMA 1SH2A 2QL5B 1VBKA 2MY7A 2QSFA 1N0VC 2BRKA 1S1WB 3DM2B 3BSAA 3CDWA 2RU3A 3VGTA 3I82A 4CCHA 2DHAA 2V5HG 3A8EA 5A0YA 2RDJA 1IQTA 1N52B 3FRZA 1DBDA 3OR2B 1XMQF 2M5YA 1PYSB 1X8DA 3G86A 4QOTA 2Y1IA 1CJKA 1MMLA 1XR6A 3KLIA 3JAMY 4USKA 3TA0A 4KJIA 2EKYA 2HNDB 1F60B 4C8LA 1BWVA 2CQDA 1B64A 4ZVGA 3PX0A 3ETOA 2DGSA 3IC1A 1WORA 2C2DA 2QC3A 3ADAC 1QAYA 3CDUA 2UUAF 2DR6A 1TUGB 1FTRA 2FVRA 4WK1A 2N4CA 1S49A 4ECZA 1M90T 2HZAA 1KFSA 4L75A 1S9FA 3UD5A 3H42A 3R5GA 2HLUA 4DCOB 4B9TA 1RBOB 4Y2CA 3NWGA 3KG1A 1AXQA 4UY85 1UVMA 4GC6A 2H4YB 1RA6A 3C19A 4PQUA 2EFNA 2H5JB 2HGNA 4RUBA 2XZWA 4LVNP 1SJRA 5HMYA 2VG5A 2QA2A 2R7OA 2ZJQQ 1YLXA 2ZKUA 1FFWB 1NSPA 3EXCX 5CA5A 3QO9A 3WZ0A 1XJWB 3H5UA 4NLOA 5HVGA 3KK1A 2Z57B 4Z7CA 5EUHA 1VISA 1QE1B 3K59A 1Z1ZA 4DV7F 4K0KF 5D4PA 2GX8A 2E7VA 1AZSA 3QAUA 5GAGI 3IRWP 3GIJA 1UA1A 1SJ4P 4LSZB 4JI8J 4OL8A 2ADCA 3W5YA 3J80U 3I0RA 2V2QA 3DRPA 2WONA 2R2TA 1XMQJ 2DR8A 1EQ0A 3ZXWA 4DUTA 4QPTA 3MM9A 5EX0A 4WFAQ 4LFAF 3DLJA 3QT5A 5ETTA 1TL1B 4NLWA 4ED5A 3JSMB 2XNQA 2BA9A 4PXCA 2K7JA 2ZOMA 4Q8EA 2DRDA 4NMLA 4O3PA 3SSSA 4PWWA 1FKOB 5A6PA 3Q8RB 1UCNA 4ED2A 3KUEA 3PDNA 3R1LA 4J7CA 2PC6A 1SUQB 3IR7B 3GFHA 1FWLA 4UUXA 1CG2A 1DTTB 3ZZUA 1KN6A 2BEFA 3LP0A 1LWCA 2VZ9A 1M1HA 1RWUA 2CPXA 4NLDA 2UUBJ 2HW3A 2WVFA 2LQ5A 2CPJA 1YBTA 2LQJA 1RAAB 3LPEA 1U2FA 4F26A 5BXIA 3RRGA 1KS2A 1YRTA 1XERA 2NPIA 4LVOP 4DQRA 2HK2A 1TKXA 2I5JA 1RTIB 1Y3KA 2M8HA 4LJMA 3I4PA 2XO6A 1TK0A 1HYSA 4QIWD 1B4SA 2RQCA 3IXQA 1JLQB 2QRRA 2ZOGA 4WFNQ 3BGLA 2DH9A 3IR6B 2P9EA 2W4DA 4QIVA 3OXGA 1UKUA 1H0HB 3JTPA 1E6YB 3FCHA 4PG7A 4WP8A 5D78A 1IKWA 3H4BA 3FRYA 5AT1B 3K2YA 4C11B 3MM8A 1JK9B 1CJKB 2HNZB 2XC9A 3EGZA 2KZZA 1VRTB 4WPAA 2VONA 1Y4ZB 1GXLA 4N41A 2CJYB 1C1BB 2QMUB 3SI8A 3DNCA 3TOQA 5KG3A 5KFOA 3MMBB 5LMNJ 2QEXS 1JLEA 3K17A 4P6QA 4FS1A 1JJ4A 4IO1A 3DI6A 1S6PB 3AD8C 3J7ZT 1DTQA 3M8ZA 3SV4A 4PEOA 2YPYA 4RJVA 1BQMB 3U27A 4CNZA 2IMWP 1X4EA 2W7AA 2J0SD 1NDPA 3CGIA 1F3FA 3GZ7A 1T94A 3TZXA 4TKTA 4YY3F 2ZHBA 3CF5Q 2D3O1 1FJEB 1RQ0A 1OJ4A 2DNHA 2FLPA 2BW7A 2DCLA 3W1YC 1IUJA 4X2BA 2V4QA 2GHWA 4RW8B 2R3VA 2BANB 1URNA 1VC0A 2RVJA 2QA4G 2PFDA 2JC1A 1FD2A 1XMBA 4K4WA 3MEEB 4O44B 1VRUA 4RW7B 1SC6A 2QGFB 3Q8VA 2E5LJ 2UU9F 1U7LA 2ILZA 5LT5A 2IRUA 4K5SA 4F3QA 2LXUA 3CCVS 1OPIA 3EM1A 3KJQB 3JSRA 3CJSA 2F8MA 1RT7B 2FGCA 2O66A 3SXLA 1YI2S 2KZMA 2I38A 3NAIA 4CQ1A 1UVNA 1NJYA 3UO0A 2AT1B 1Q5YA 2IA6A 3D68A 4Y2KA 3ZTOA 1FRMA 2NCKL 3QQCD 3H7HB 5HMWA 2VBZA 4HEA9 2HKEA 2ZHOA 5HLFB 2EW9A 2J7WA 1TR0A 3CT9A 1YZ7A 3M32B 1R27B 1D09B 1Y11A 4WZMA 3EPGA 3JTNA 1RT6A 2AJ4A 5ETQA 2MLYA 4WXWA 2E66A 3C15A 1E6YA 3G4SS 2F40A 1OYDA 3RYLA 1LXNA 1FDBA 3L95X 3OPKA 1KLMB 1RAEB 2K06A 4IOBA 2R7SA 3NEKA 3UCUP 4PRFA 2GMLA 3ITHA 4IRCA 4TQRA 5IWAJ 3MEGB 1U1RA 2PEHA 2LYVA 2EK1A 4Z37A 3DOMA 1NDLA 3CCTA 3KK3B 3PFOA 5HO4A 3CW2C 1KC8T 5CD4A 4CP5A 2H54B 2ZHAA 2XWXA 2BMBA 1FE4A 1SC3B 2NUUG 3C8YA 2B4VA 4HR2A 1T05B 1S1XB 4F0KA 4L74A 2X1GA 1LXJA 1YVFA 4Y3CA 5HSPA 1KQSR 4IOAQ 2OPSB 3CVKA 1U09A 2B43A 3QGIA 4KC5A 1P27B 3G82B 3LAKA 2FYXA 3EJMA 4LUBA 3KMSA 3DRSB 1J5OA 1UP1A 3QGPA 1TFWA 2NR0A 2JH3A 3TUIC 4M5DA 3TVKA 2QMWA 2J5AA 4F3MA 4W98A 2C3PA 4F7VA 4NA3A 2GQ2A 1WEYA 2AJFE 3K0JA 6AT1B 1K8AT 4IQXA 4PPDA 3JSMA 3FQLA 4X84A 1YSJA 1T9TA 2KFZA 5KAKA 4KIAA 3PW2A 2V2ZA 1R3NA 3AOCA 4AXIA 1HQEB 1HNIB 2FLOA 3DKDA 3IAS9 3TZZA 1U1OA 4DI6A 4U95A 2ATCB 4P73A 2DD8S 1FRIA 1RWNB 3KHHA 2CUYA 5C25B 2VFRA 1REVB 3BS9A 5BR8J 3KTQA 3ENVA 4QQBA 4NCAA 3FCWA 5F3TA 5ETSA 5KOWA 2E5JA 2NXUA 4LFCJ 2VD3A 1GTEA 1Q79A 2Z56B 5F9LA 1LEOA 3VGUA 5GAEI 5B0BA 2DNLA 2MGZB 5D15A 1Q16B 2DNYA 3TYTA 1G7CB 1B0PA 3GP9A 4MK9A 2VHGA 1JLAA 2XY7A 4L72B 3PYDA 2KL8A 4AXJA 4W90B 5IFMA 3TAMB 1T3NA 4MIWA 4CO5A 3IS9B 3C14A 4HACA 5KFBA 3OL8A 2R7VA 1JNRB 3EGVA 5L8RC 3QJPA 4DR4F 1C0TA 4V1Ak 1RTZA 2IYGA 3I5CA 4FYVB 3K57A 4Y65A 2AV5A 3FEZA 2QT7A 4CO0A 5LMUF 4DV0F 2RIJA 2JX2A 1YRXA 3P6YC 2WRMA 4PXDA 3FZBA 1TAUA 4ES3A 4QIGA 4ECRA 3OXLA 1VQ7S 5A8WB 1TUVA 3IBCB 5E5NA 2GIFA 3AJ2A 4EBDA 1XMOJ 2HHVA 3JSBA 1NHVA 2I6WA 4X66F 1J5EF 2RRAA 2DNOA 3R6GB 1WEZA 2CPHA 1NPPA 5KG0A 3IWXA 4UT4A 1V3ZA 1RHMB 1QAJA 4ZJLA 3GSIA 1UJ6A 7AT1B 4ZVUB 1HNWF 2DISA 3EYZA 5F8JA 4YR3A 4UOFA 3N4WA 2VBXA 4U6PA 5JUMA 2DIVA 5HMXA 4KV8B 5AXLA 5FJ4A 2FPHX 1LWCB 3O3LA 3QLHA 4O3OA 1GMWA 5IQ6A 1N8RT 2HGLA 3LANA 1KLNA 1BQXA 1DJ0A 1JIHA 2GQQA 3AXMA 5L1IA 3V81A 1RAIB 2J9EA 2D1CA 3DLKA 1QJHA 1S4EA 3MM9B 4DUYF 1NK6A 3MGJA 4GKKJ 5EN1A 2WONB 3FGVA 1ZM3A 1KNZA 3IRXA 2W24A 3ZZOA 1NDCA 2GQCA 3OTBA 1XN9A 1CC7A 3L09A 4DZDA 3QJLA 5C7PA 3HJVA 1FCAA 3R3TA 4RNFA 1MU2B 4P74A 1FVSA 4B02A 2R7QA 1T7PA 1HI1A 2AF6A 3G82A 4I56A 4DSFA 1L3KA 1JXEA 4B3TJ 4KQZA 3HLUA 1YITS 4MMOA 4CLPA 1WDTA 2BJ7A 2ZITA 3KLVA 3SIPB 4ZP6A 2UV8A 1Z2LA 1RWWB 1JLEB 2FVCA 2MQMA 3NGUA 5F0WA 2JRSA 3PY8A 1CJVA 4CYUB 3W66A 3TARA 2RKIB 1CJTB 1HBOA 3T1YF 4LQ3A 4NASA 3J81j 2UXDF 4F36A 2VG7A 3OXFA 3UDLA 2PT0A 3RU0A 2N7CA 2LEAA 4DR3J 1G3OA 4Q0BA 2GJFA 5AE2A 4NRUA 4X62J 5CQGA 4ZP9A 3G6ES 3DXBA 1FI4A 4DX8H 1CSJA 2CJQA 2ERRA 3GFXA 2AQ4A 4WKRA 4J9NA 3C14B 2BRLA 4HACB 1HBUB 4O3QA 4DV2J 4ED4A 2CQIA 3W60A 1UAWA 4F2SA 4I2QA 4F0MA 3CD6S 3BO2A 2KI2A 2FJVA 4JI3J 2BKOA 1HYSB 3MCOA 1HNZF 1QLNA 1NHKL 2R7RA 3RR7A 1T8EA 1SIZA 4ES1A 1SH3A 3IFEA 2FVPA 2BE7D 1PYTA 3MPDA 3NCPA 5FLXU 3CCWA 3IBFB 2GVZB 4ATNA 3DCAA 5KTQA 1VYAA 1XEZA 3M1VB 1IM4A 2WCXA 1O51A 4KT0C 3WIUA 5ADZA 1TP7A 1OO0B 1U2CA 4YB6A 5KT7A 3MOJB 1NEEA 2QN6B 3GG0A 4OI2A 4X4RA 2LECA 5KFZA 3F44A 1S0NA 1JLCA 1N6QB 2FY1A 4ZVRB 4B3SJ 1U48A 4K4UA 1MSWD 4ANDA 4K50A 3HT0A 4KBIA 2JDJA 2AIRB 1DLOB 2V67A 3E01B 3KFWX 5E3QA 3RW7A 5I3UB 1S1UA 1GTHA 5K14B 3T19A 3RB3A 2HMIB 1R8PA 4JOUA 3NGDA 1W26A 3N01A 4C3LA 3C46A 1NBEB 2O01C 3MPVA 3M2RB 2PI4A 3KG4A 4NLTA 2ZBPA 1RXOB 1RWXB 3PEHA 5KFCA 5L1KA 2VF3A 2WSFC 3FC9A 4DR3F 1IBLJ 1YWXA 2MKCA 3DLBA 2FJBB 2C2MB 2LXIA 2M0GB 1WHXA 4X62F 3H59A 4ECQA 3CD0A 2IBOA 5D4LA 3GJQB 1PG5B 2GAHC 1DFDA 2DITA 4IH7A 3O6QA 2EK6A 3DI6B 1T3OA 3FK4A 3HHLB 4D3HA 2E9TA 2LLZA 3G6YA 4EUVA 2Y8YA 1KVIA 1VQPS 4ECWA 1PJ7A 2IVMA 2MHEA 2ZZNA 3UN3A 2EWHA 2MZRA 3A3PB 4BWMA 3GIIA 4C8ZA 3PM9A 1C1BA 1HKAA 2IRXA 2CDQA 2KXHA 1Q8IA 1LW0A 2K7KA 4QIEA 4I4BA 4WIIA 4AT1B 4O0IA 1DY3A 4I2QB 3K58A 3TA1A 2CQHA 2OFGX 3OUYB 1FJGJ 3A8KA 3MEDA 5HJYA 3MCMA 2L9NA 3BPDA 1Y9OA 1RB0A 3DU5A 2NS1B 1AUDA 2YX1A 3IO1A 2W9BA 2M70A 2YQ3A 1HWKA 4MK7A 3UR3C 4A8QA 1C4AA 1OY9A 1JJHA 1YK9A 2V69A 4ES2A 4ED8A 3V6DB 1BHNA 3L7UA 4LREA 4Y00A 3QFWA 4RNNA 3BGRA 2Z0GA 4EO6A 4QR2A 1X9WA 4J90A 1GFWB 1T9WA 2OUGA 4OI6A 5IQQA 1W25A 2AJ1A 2BACA 2PDAA 3MEKA 2ILYA 3RUBL 4FBUA 2W4PA 4B3MF 4LMZA 5KFRA 1N56A 4ANEA 4DL3A 1HWUA 1H2UX 1X0PA 1JLBA 4ZJQA 3VALA 4GRSA 3VHQA 2HZVA 1Y5LB 3B4DA 2W2PP 3ISZA 1FE0A 4Y34A 4E8UA 5A0YB 2OPRB 2ZUAA 4J9VA 5CAAA 3OFEA 4I1TA 4KKOB 4KPYA 4I6WA 2F9JA 8ATCB 4Y2IA 2AEMA 4N56A 3HULA 2CVIA 2N4DA 2YNGB 1BLUA 1NU4A 3C16A 3QT8A 3RBEA 1D8YA 4TXSA 4M5HA 1NAQA 4NLRA 2EBGA 2W7OA 4FZVA 4ZCIA 3KDOA 3H25A 2OPQB 1EB0A 3BO3A 4AYBD 1N33J 2WTFA 4ZVEA 3KK2A 4OYPA 2HAIA 2P9CA 1EKRA 1WC0A 2XMWA 4HLBA 1S1UB 1HLWA 3THTA 4DV7J 1Y00A 3N6MA 2YKQA 3E01A 1NKCA 3GLJA 2KXFA 3O5TB 4M5DB 3R5DA 4RW6A 3SDEA 5KFPA 1UETA 3ZZPA 1RGVA 4OI3A 4LIWA 3KUGA 1EAYC 4L3KA 1RADB 3SSRA 4CWBA 4X4SA 4DLEA 3PO5A 1OSDA 3OTEA 4UZCA 3QPIA 3HMJG 3MUTP 1H73A 3CJ5A 2KT3A 1J5OB 4JI1J 3ENWA 3OFHA 3GFZA 3FUYA 3CJ3A 3P4UB 4IDKB 4LSNA 4PG4A 2DNQA 3QBCA 4CH0S 4YS2A 3DGPA 2CPEA 2DY9A 5J1NA 2WZ1A 4NXNF 3C6TA 2EVZA 4JI2F 4CIOA 2C2ZB 3MD3A 1Z4UA 3LF0A 4P72A 5KFLA 2PGCA 2PIIA 4DU7A 3T9ZA 3N0VA 3D6MB 2C3YA 1EZZB 2GCFA 2MMYA 1TL3B 1S76D 3OW2R 3VQSA 4CO4A 1VQLS 2VIHA 1T11A 2HK3A 4QPXA 2YH1A 4RLEA 2GS8A 4A8SA 1EKSA 1D9DA 4G1PA 2CQ1A 2FJXA 3BSCA 4DR5J 1P1TA 1RDRA 2ZH5A 3OFGA 1N34F 6FD1A 4I69A 4ZITA 1L3TA 1HBMA 2OEKA 4NLUA 5AXKA 3KLFB 3D1HA 1NK8A 1N4LA 1WUUA 3PYEA 2I2YA 2R8JA 2R7WA 1UVIA 2ZZMA 1VGYA 4B3RJ 3HSJA 1OS5A 4C97A 4DQPA 1FK9A 4W92B 2DYAA 5B0FA 4ZIVA 4C3KA 4FN5A 2R8KA 4U7CA 4ILMA 1RSCA 1O8BA 2RSQA 4OQJA 5THWA 1UA0A 5KFYA 2DRBA 2HWHA 2MKJA 2JVRA 4ICLB 4TNOA 3R2DJ 1QM9A 1QUPA 5DG7A 5I42B 1U25A 1IQZA 1ICEB 2QX0A 4DV1J 4DL7A 2AMCB 1M1KT 1TL1A 3W5ZA 2G9OA 3HD1A 4FPRA 3GPAA 4YQWA 4RU2A 4C8KA 4NLVA 4C4WA 5F8NA 1CQMA 4O44A 3QZ7A 4JI7J 2OJ3A 4YP3A 4MYTA 2MZ1A 2R7TA 1Y7PA 2H9ZA 2WW4A 2D69A 5HMZA 4S0MA 1GK8A 4WP9A 3QJJA 4WE1A 2XY6A 1WC5A 5SUHA 3SSQA 3MTKA 2J7UA 4EU0A 2MY8A 2X3GA 1FTCA 2M88A 5DQGA 4ELVA 4USUA 1OY8A 3VAKA 1X4DA 1KSPA 5D4NA 2C28A 3V81B 4LRBA 2VPYB 5JXSA 5DZ7A 4U96A 4CLKA 1KVJA 1WTFA 2E9RX 2H4WB 1M5OC 4YFUA 3NP5A 4LQ9A 4Q45A 5HP1A 1WDDA 1K1SA 2DNPA 4KV8A 4LF9F 4M5NA 2X3DA 1DTQB 1TTHB 3QAEA 1U1QA 2OTLS 4XO0A 1U02A 4EK2A 1PBAA 2MQNA 2L08A 1OWXA 5KFXA 5J1EB 1RTDB 3G71S 1XWLA 4H4MA 2R2SA 5LXYA 3HO1A 1ZAVA 2UUWA 2XS5A 4YUDA 4OV1A 4ID8A 2BKNA 1F9HA 4ZMMA 2BQUA 4B9SA 2IDLA 3VAGA 3DMJB 2XG8A 1RT6B 3IBWA 1QAIA 2SXLA 4PKDB 2DHHA 2B3TB 2XZTB 2YH0A 2ZE2A 3FBFA 4MIBA 4DR1J 3VWSA 3KJNB 3P96A 2OPPB 3R6LB 3JYTB 3RB6A 2RJZA 3E8OA 2U1AA 4FYXB 3BBFA 3EMTA 3V6JA 4UQGA 4KFBA 4DN9A 2BQRA 2ABYA 4OYWA 2YNFB 2KTQA 1YJWS 3HCXA 2WHOA 4DS5A 3VAIA 1RT7A 2MQPA 2YKNA 1TKTA 1B7YB 4WFXA 3EGNA 1R43A 4HT7A 1HBNA 3W61A 3TJAA 5MLCV 1PO6A 1HWJA 3N28A 1NK5A 3H5XA 1M1GA 4YMEA 5BYRA 2V8PA 4A48A 2CPYA 4J91A 3L7OA 4OLPA 4K0KJ 3FMWA 2NLWA 2LEPA 3R7NB 5FIIA 5AE1A 2ZJPQ 1X0FA 1RTDA 5A8RA 1N32F 5KFKA 1CJUA 4WYWA 1C0UB 1SJQA 4QR1A 2XGPA 3IG1B 3EDRB 4CLLA 5IOLA 4DLGA 3H40A 4JI2J 5ETKA 1HW9A 2YKAA 4RX6A 3NY0A 4CT9A 4ZLLA 2JOQA 4DV5F 3RB4A 2EBEA 1H3DA 3V5RA 1CVJA 2PA8D 3LH2S 2ZH4A 2IM2A 3DRPB 1RWOB 1SKRA 3SZ2A 3VAJA 3DOLA 1RT4A 2GAGC 2OSQA 3B54A 2YBVA 4N47A 1GEHA 4LF1A 1VQSA 5C5JA 2ZBIA 3D4JA 3T5KA 1S1VA 3ZTPA 4ZK7M 1AZSB 4GKJJ 1F5BA 1QE1A 2UUTA 2PMZD 1SI9A 3TJ9A 2E29A 3BGOP 1T0TV 2ZOFA 5CCMA 1FESA 1EHWA 1RHJB 2JC0A 4EI2A 1JLCB 4K2JA 1F9EB 2W2QP 3P45B 2ROGA 1X4BA 1TMJA 3R97A 3NL0A 2E7XA 4DSIA 1KR4A 3PJ9A 1KWMA 4CLTA 1SCJB 4QYZK 2FHOB 2CZ4A 5E7OB 4HDHA 5HROB 3M8RA 3DN9A 2RHQB 3FFIB 4UQTA 3HVWA 1I6JA 4DV1F 1QSSA 3SEOA 2ZUGA 3RBDA 3NMRA 1HQ2A 4PZVA 4GVBA 1ZZFA 4PR6A 3JAMU 1IKYA 5IWAF 1NCLA 3LP1B 2WVCA 2MPUA 4KE5A 2HS0A 4K4VA 2EPIA 2PN6A 3K8VA 1R6YA 4C3MA 1RWVB 4MFBA 2ZH7A 2OO4A 1RT1B 3M6WA 5KFUA 2JFDA 3BR8A 5G0RB 2CPZA 3UDVA 3UVJA 3VV2B 2C2EA 2M2BA 1NHUA 2HFUA 1XBWA 1S97A 4CLUA 2ZBCA 3BGFA 2J0QD 4LF4J 3S6EA 4A8YA 2CJ9A 3FMBA 2AWZA 3I55S 1VQNS 5L1LA 2DGUA 2CQ2A 4WFBQ 2IBKA 3OJSA 2VJUA 1S57A 3AY0A 3I0SA 3MCNA 5DDRC 4ECVA 1UZHA 3L7PA 4WU2A 4JI5F 4P7TA 2R8HA 4PG5A 5HQ8A 1DQ8A 1FKPA 1X5SA 2GW8A 1R7IA 3I31A 3QGGA 1MWYA 4NX9A 1NJXA 9RUBA 1N36J 3I87A 4O3SA 3F0NA 4GVLA 2BANA 2CA9A 3MPUB 4IFVA 3RTVA 1LWXA 4NYOA 2YWWA 2G2ZA 4GMKA 4FYDA 2V0NA 2FUG9 2A10A 2UV8G 3HVAA 2ZFHA 3OFFA 1F5CA 3Q2SC 3MM5B 2BOAA 3O8WA 5GADU 3MPWA 5GAHI 4DCJB 1A0OB 4USVA 1CS4A 4RW6B 2CQ4A 2MZJA 3I5AA 3F73A 2DR9A 2HFVA 2KT2A 4NLYA 3LTOA 2DGTA 3P5TL 4DPWA 2XLJA 1S0OA 1QY7A 1LOUA 3LGNA 2CPDA 2EKNA 2C42A 4U8YA 2V8HA 3EZOA 5T7LA 1BMQB 1LW2A 2QTWA 3M8SA 1S1XA 1G4CA 3HHLC 3GIMA 2XZDB 1Q7LB 4L3NA 2ZC4A 5CZXA 1KD1T 4J9QA 2DGXA 1RAFB 2F63A 1OY6A 2YTCA 3HM9A 1VBYA 2H3EB 2NSCA 1ZPVA 2FGOA 2V4JB 1RAGB 1B70B 1N33F 4UOGA 4ICLA 5C24B 1NK0A 4P9SA 2I0XA 2ZD1B 3N6NA 2CJAA 3NWRA 5E0OA 2ZVIA 5G0RA 5GAGU 3LAMA 2C22A 3WX8A 4YDDB 4OX8A 2AYMA 5KT3A 4O3RA 4KHRA 2VG6A 3AFGA 3DDIA 4B9LA 1SQFA 3CIMA 2A18A 3PW0A 1U8WA 3MXHP 1WI6A 4KSEB 2QFIA 3A12A 4A4JA 2GNKA 2O5DA 1X5OA 1PKUA 2BE9B 3ENAA 4DMZA 4E98A 3BR9A 2YNFA 4HI2A 4EBCA 1NH8A 2BBEA 3H4DA 3IWNC 4GVBB 4HKQA 4HH1A 4M5LA 1L3VA 1SKWA 4M95A 3R9LA 2Z8QA 2F4VJ 1IKYB 3OTCA 4RWXA 2CQ3A 3AA8A 5HBMA 5KFGA 1P8GA 1FO1A 3ZNUA 3OTOJ 3QRQA 3T9NA 3OTOF 3MAQA 1U26A 4N7TA 1Q8KA 2BM1A 2JWNA 4IG0A 5D0RA 4DV2F 3QYYA 3AQOA 4H4KC 4TVAB 4YEAA 2VUGA 4J9OA 3OT9A 3SFGA 1T9XA 5D4OA 1NNDA 2XSFA 4BHQA 2ATLA 1EETA 1JXLA 2ZNYA 2FIUA 1VIOA 2XYHB 3SQOP 5DQHA 4ECXA 4DL4A 4YHHF 1G1XA 2LA4A 1YHQS 3FNNA 4AQYF 1JQGA 1R0BG 2B4PA 2DHSA 2QLWA 5KFIA 2GHPA 5J1EA 3T3FA 1UMJA 2AEFA 4KR0B 1AFJA 1U0HB 1VLYA 3MMAB 4ZVPB 4RW8A 3SCKE 3R1HA 2XULA 4FF3A 1MW7A 2Y0BB 4FKYA 2N3LA 2VU5A 4LRAA 1X5TA 1IKXA 3FQKA 2WSEC 4X64F 1RT4B 3HK2A 1IBCB 1N54B 2O67A 3PXGa 3CJ4A 2AW0A 2VOPA 3LGMA 4NEYA 1J2VA 5MAOA 2FDNA 3QGHA 4IQMA 2BDPA 2HRTA 1NDKA 1PJ5A 4OZ2A 3W8GA 3GE9A 1R6VA 4KB7A 1PAEX 1VQ4S 2YY3A 3MM6B 1WC3A 1IM6A 3PYFA 4G6VB 2RH3A 3W8PA 2CADA 3ZZYA 4ZVFA 1GMWD 3FSYA 1IJEB 1IVZA 1SIWB 4EO8A 1YJRA 3LALA 4ZVTB 4BWJA 4U9RA 1F0XA 1YDLA 4JP8A 4DJBA 4BBYA 4JI4F 1KFDA 1S7IA 1VR6A 1A7GE 2XMMA 1EETB 2MZTA 4LF8F 4JI0F 2YKOA 4DV6J 1RE1B 3J7Z5 2F1FA 4F4YA 3M2UA 5J2PB 3K8WA 5A8WA 1TQLA 2CIMA 3MTJA 4JYAF 3MZIA 1BY9A 2K1RA 3MM7A 1FNXH 4F2RA 2RDIA 4USHA 1X9SA 2HHUA 3THPA 2PE8A 3DLGA 3T41A 2ZBQA 3O2IA 1B7FA 4OI1A 3C66A 2MKKA 3DOMB 4PAAA 3SBMA 2HRUA 4KGXB 5IC6B 4AD6A 5IV3A 2I5JB 4XPCA 3JYTA 1YJUA 4KH1B 1U8SA 4QYZJ 1U4BA 3MURP 1VS3A 2COLA 3QT6A 2V68A 3NAHA 3GFYA 4IFYB 1DARA 3BYRA 1FF2A 2CQ0A 3OV7A 4DR2F 1IBMF 3POTA 5H9FJ 4OYIA 4MKVA 1HL6A 2OLWA 2CJKA 2ZD1A 1EJ7L 4KO0A 1EARA 4OYBA 2DY1A 1N5SA 1EP4A 1MROA 1RU2A 1RK8A 1S5ZA 2WVBA 2XI3A 4R0JA 4KGKA 1GT8A 3IM9A 4DV3J 3IWLA 3Q22A 1Q81T 1CLFA 1YJVA 2IC3B 3LPYA 4WK3A 4G1QA 3PYGA 1I94F 1V3SA 4PXEA 3DLHA 4CO3A 4I6AA 3T1HF 4ZIWA 4XPEA 5KT5A 2C1EB 3HSGA 5EWFA 2CXEA 3CC2S 4CTAB 1U6ZA 4LF5F 3AD7C 1HMVA 1UL3A 3TX8A 2VJVA 3H2LA 1NXIA 2V63A 3SQGB 5GAEU 4FP9A 1ZYQA 3M8QB 4B3RF 1CS4B 4Z7YA 2NSBA 2L48A 4NLPA 5D0GA 4ED1A 4ZLPA 4DR6J 4NCBA 2GMJA 3HX9A 3GJSB 1JJ2R 3SDEB 2BXJA 5EX3A 1KVKA 1RCXB 1VIXA 1S4FA 4F02A 2ZM6J 4KRWA 3PR5B 2HHHF 4NLGA 2YWKA
chains in the Genus database with same CATH topology
4OLOA 2J9DA 4YB7A 4YB1P 1XTZA 4J5OA 3TO8A 3ZZRA 2HGMA 3HZEA 2NREA 2P5VA 3DDKA 3OBIA 2GO9A 4IG3A 2V8VA 4WFZA 3NGKA 2DHXA 5E3AA 2KRRA 2IC3A 2X1BA 4WKYA 4K4YA 4JI3F 2R7XA 2RRBA 3KHRA 2V94A 3SMZA 3Q0AA 3KK3A 2LVWA 1NJZA 3I0SB 3TW0A 2OKQA 4X4OA 1MWZA 2QE5A 2R2RA 1F5AA 2GO8A 1S9EA 4OHXA 1U6FA 3TVZA 2CYYA 4DN0A 4PG8A 1FK9B 4O3NA 2ASDA 4UY8T 2PFFB 2ZH1A 2HHTA 3RR8A 1TKZA 3LP1A 3H5SA 1VK3A 3OVAA 3MFIA 4DL3A 2ADCA 1FXDA 4UUWA 6FDRA 1HBUA 3WC0A 2VASA 1SL2A 3PFEA 2D74B 1RTJA 2XMUA 4DR1F 1AW0A 1N5TA 2HIQA 3T5HA 1ZM2A 3G6XA 4OHYA 1RTIA 2K1RB 2BOPA 3CCES 4RBVA 5HROA 1T03A 3C6TB 3E3XA 1TK8A 3BQ1A 1QSLA 3EGWB 2L9DA 1H7WA 4RW9A 1ZBTA 1V3RA 1U47A 1HR0F 1X4FA 3KYLA 5F8LA 4PWUA 1VJWA 3MI7X 2GHVC 1WHYA 3A1YG 3GMGA 3HHKA 5KFAA 5HP1B 2UVUA 2VKZG 5GADI 5KFVA 2IM3A 3UQSA 1R8HA 4DQSA 2N3OA 1SKSA 1V6HA 1HNVA 2NPFA 3VAMA 3DOLB 2OMOA 2ROPA 3HPOA 4I0WA 2KRBA 4LT6A 4H4KA 1RT5B 1SV5A 2DGQA 4TQSA 2AU0A 2JL9A 4JI1F 3NBPB 5K14A 2HMIA 1ZM4A 3AQPA 4HDGA 3UE2A 2W8KA 2QLXA 5B0GA 3OL9A 1C0UA 2QV6A 2E5LF 2HLTA 3MR2A 2YNGA 4Y0FA 4X4PA 3M30B 5DGBA 1RKIA 1MROB 1EP4B 2E5GA 4XDCA 4X65F 2RRNA 5FD1A 2DPIA 2PMHA 2VFVA 3ENQA 2C3MA 4XIUA 5FDLA 5KG4A 5DG8A 5B7WA 2GV1A 2MXYA 2EC0A 4IG0B 4KGMA 2V8GA 4K4TA 1FRHA 3UI3A 3IA0A 1FRXA 4NZ7A 3CULA 4QU6A 5AE3A 3MR3A 2B4UA 2YWFA 3V2UC 3ITHB 5C42A 3V6DA 2CRLA 1SL1A 3OVSA 1TVRB 1Z2ZA 4R5PA 1X4AA 2RS8A 1S99A 2VL1A 3DC2A 4I6YA 4ZCKA 4JI8F 1WTBA 4PUOB 1UVJA 3CCRS 4DFKA 1S1TB 1WG4A 4C8NA 3CD7A 5KFSA 1S7HA 4LF7F 4CO1A 2HNYB 3I32A 3M32A 2JEJA 1GX5A 4WCEQ 2VPWB 2I1RA 3M30A 3ZFVA 1HI8A 5C24A 3MDFA 1LK7A 2EG1A 5KFEA 1LW0B 3FSXA 2XMKA 1IKVA 1HFEL 3GG1A 4DF8A 2B6AB 1CQNA 3I5BA 4Z2XA 1R0AA 3WBZA 3UW1A 3EX7B 2MKSA 2QFJA 2VQEF 2A2CA 3CWJA 4HVZA 4AUKA 2AGOA 3S8SA 2J6TA 1HNVB 3NKYA 3CE8A 2BR0A 3OVBA 4K5RA 1XNRF 3OL7A 3MEEA 1HQEA 1JLFA 4PQAA 3KHLA 1H2TZ 5H1SV 2R9LA 3PKMA 2GFFA 3S01A 3BZQA 4JV0A 2PD1A 3IGNA 2V4RA 1D1UA 4QBUA 1FT8A 1LFWA 4IOCQ 2VFTA 3NG8A 3GYNA 4Y6IA 3QWUA 2D3UA 4C7QA 3M1VA 2YNIA 4K2XA 1NKEA 4J9PA 4TYAA 1OQ3A 5LJ3Y 5K8NA 4DFMA 5L39A 3BF4A 3B82A 5D3GB 2HHWA 4EZ6A 3ZZZA 2L9WA 1JLGB 1X7VA 2IVYA 2J76E 3VQTA 2HFOA 4B17A 4OZ0A 3UPFA 1HHSA 1VRTA 2HS4A 3MWBA 4N5SA 3KLFA 3OJUA 4RW4B 1SQEA 4ITSA 2M7SA 4KAIA 4ZPDA 2XB2D 2JHEA 4V19J 1OPZA 1WG1A 3MHYA 5T41A 3RAMA 4B9VA 5IS2A 2WW8A 5DQIA 2HHXA 2GJ2A 2ZH2A 2VFUA 2HS3A 1P1LA 2ACYA 1RP5A 1S72S 1IBKF 1BWEA 2FHJA 5EHHA 2IVFB 2HQIA 2RKIA 5F3ZA 2XBPA 3TANA 1TKXB 2F4VF 1KHWA 2KT5A 2RUGA 2XEXA 3F56A 1PC4A 2DGVA 4WXOA 1FNOA 5CH7B 5DJBA 1LWFA 2BZ2A 3FVYA 4OZ1A 1RT2A 4TY9A 1SJ1A 4J9SA 3ZZ0A 5JJBA 1FKAF 3C6UA 2IMOA 2EFGA 2W9CA 2C2RA 1SUQA 1P6TA 4K4ZA 1JLFB 5CYQA 1AROP 4AE5A 1JNZB 3CDEA 2DR5A 4KHPF 4ZOSA 3J7A1 2GGPA 3K5NA 4DL5A 3TI0A 2ZDOA 4C0OC 2KFNA 5J2QB 2FLNA 4ED3A 1VFJA 2XSJA 3DHXA 5F8IA 5EWGA 2N7YA 3D1QA 1R8BA 1Q7YT 2ASYA 1OIAA 5DM7Q 1WF2A 2R7UA 1B0TA 4DPOA 1QVFR 3GSDA 4DV3F 1S10A 4KKOA 4DSLA 2F3JA 4PG6A 3MD1A 3TNVA 5BJRA 3DOKB 3UWTA 1S6QB 2B4OA 4BCAA 3SYZA 2IAJB 2YKMA 4LSLA 2XNRA 2L3MA 3TAQA 1VC5A 4RKUC 4KFBB 5F41A 5C42B 2Q3PA 4Q44A 1T03B 4F67A 5KG2A 3BDEA 4N77A 4DR7F 1WHVA 2HFZA 1CPZA 2B51A 3VR1A 2UP1A 3CCJS 2MQLA 2KDOA 4GO5X 4LF4F 4X4QA 1LWEA 4ZHRB 1WACA 1JLQA 1YRUA 4ECUA 4O4GA 1TFYA 4A8XA 2MQOA 2WBRA 3IS9A 4Q0BB 5HLFA 3GILA 4LSNB 2J6UA 3D1OA 3AB2B 2DNKA 4Q7AA 4A8OA 5EWEA 1M5PC 3DOKA 5DM6Q 2MGZA 4Q8FA 5K8OA 1URRA 1RTHA 3SCIE 1KOOA 2FJEB 1QAXA 3M6UA 4QWBA 3VAHA 1HA1A 2OIHA 1REVA 1T02A 3H2UB 2RQMA 4JBCA 4DUZF 4WYLA 3PACA 4CI0B 2ZH6A 2ASJA 4B9NA 2QA1A 3U7JA 4DFPA 4UW2A 3RB0A 5KG6A 3G96A 4ED7A 2XS7A 2FB0A 2XI2A 1ZTTA 2LDYA 5IM0B 2MQQA 5E41A 2GGPB 3IRXB 4RWWA 1ZPWX 3N9UC 5SZTA 2LDIA 2E1RA 4FVMA 5I3UA 4OZNA 5A2QY 1FJ7A 4C9DA 3QO9B 2MSTA 1VQYA 4TYBA 1BGXT 2WOMB 1FXRA 2MHNA 3TUJC 1VC6A 5KG1A 2E7WA 4RNOA 4TLQA 3KLHA 4IUFA 2D3ZA 2ALZA 1MNEA 3GQCA 4G1QB 4MJKA 4MFBB 3H5YA 4J9RA 1UFWA 2JJ4D 3PKYA 1HW8A 1K1QA 3BGRB 3KNAA 1NJWA 1KLMA 4I67A 5AXMA 4ZCMA 1GAOA 2RF2A 4C8OA 3KMQA 4ZPBA 1N48A 1VQ9S 2Y0SD 4PUOA 2AJQA 3OUYA 3PV8A 1KTVA 2W4CA 4I68A 3KLEB 2BYCA 2V4JA 3RRHA 2AX0A 2AD9A 1UJ4A 5A8KB 2AGPA 3TR5A 3VF0B 3AA9A 3WDOA 2VOOA 4DSJA 4Y2MA 1VQMS 1RISA 3MM7B 1C4CA 4WU3A 3SV3A 3KLHB 3THVA 3MUMP 5F9NA 3DM2A 1VI7A 2VH7A 3US5A 4EGLA 5E2QA 3BGUA 3J7YI 1VQKS 1IBLF 4DSKA 4RW7A 3MFHA 2X51A 4WFYA 3ZZTA 2G1DA 4K59A 2EFVA 4NCGA 1TV6B 4X4TA 2RILA 5IM0A 1YJNS 1H7XA 3V4MA 1IXKA 4B3TF 2DK2A 1LK5A 1HNIA 3CCLS 2M52A 5I4MA 2YNHB 4OZ5A 1XNQF 5HN0A 1FXLA 2JEGA 4QIFA 1KRPA 2RQKA 3OLAA 1U1LA 2DCUB 2EFQA 1S6PA 2R4FA 1Q8LA 1FJGF 1WHWA 2A2DA 2V2KA 3K5PA 4ZP7A 1W2IA 2ZH3A 3CCMS 5J1PA 2ZKTA 4MYUA 2FJDB 2XWYA 3MECA 4CNYA 3GV5B 2OPRA 2CPIA 1FVQA 2A3JA 1IKVB 4YR2A 1Y0HA 3GV7B 4ZS6A 4BS2A 5K8MA 2LMIA 3NS6A 2LXFA 4M1KA 1UWBA 2XMVA 1BQNB 1XR5A 2CQCA 2HQ3A 3S7RA 3EZ5A 2EG2A