1F9FA

Crystal structure of the hpv-18 e2 dna-binding domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
76
Chain Sequence
HMTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Regulatory protein E2
publication title The structural basis of DNA target discrimination by papillomavirus E2 proteins.
pubmed doi rcsb
source organism Human papillomavirus type 18
total genus 21
structure length 76
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f9fA00
1VQKS 2X1GA 2DIVA 3ZZYA 2DHGA 2E5IA 1SJ4P 1HD0A 3CD6S 2CPZA 2DNOA 3G8SA 2KRBA 3SDEA 2MQPA 1M1KT 2MY7A 1OPIA 1Q82T 2AYBA 2FY1A 1DRZA 2HYIB 1DZ5A 1UP1A 4UQTA 3NNCA 2EVZA 2YH1A 2X1BA 5LJ5Y 1S79A 2GHPA 1U2FA 5DDQC 2MHNA 2MKSA 3BO2A 2MQOA 2OSRA 2ERRA 1YJNS 4PRFA 3S6EA 1M5KC 2AD9A 2N3OA 2DNNA 1VBZA 5DDPC 2XNRA 1KOHA 1N54B 4Z2XA 4WCEQ 3CUNA 2B0GA 1H2VZ 1JJ2R 2MB0B 4OZ0A 1O0PA 3RW7A 3TO8A 3D2WA 3K0JA 3VAKA 3G8TA 1K73T 4QU6A 2E5JA 1YIJS 2YWKA 2DH8A 2NZ4A 4OZ1A 3CCVS 3MD1A 3G9CA 5DM6Q 1RKJA 2CQ2A 5LSLA 5CXTA 2LQ5A 3SMZA 1D9AA 1XN9A 3CCUS 1X5TA 2MKKA 2MQNA 4YUDA 2MSSA 1FJEB 3S8SA 1WEXA 1WEYA 4IO9Q 5IQQA 2L41A 1HL6A 4LMZA 3LPYA 1FT8A 3BS9A 3ZZZA 2DH7A 2DNYA 4C7QA 5IFMA 2XSFA 2X1AA 1ZZNA 2KHCA 3ULHA 5EN1A 2ADCA 2I38A 4W90B 2E5HA 1JMTA 4WIIA 5IM0A 2DNPA 3HI9A 2KXNB 5MLCV 2M0GB 2ADBA 1K9MT 1M90T 1X0FA 1VQ9S 2J0QD 3CCRS 2DHSA 4ED5A 3I55S 3S7RA 3EX7B 5H1SV 2U2FA 2RNEA 2KN4A 3CPWR 2KI2A 1X4CA 2CQDA 2M8HA 4IUFA 4U67Q 1Q86T 1VQ4S 3SXLA 3G6ES 1SJ3P 2DO0A 2DNQA 3HHNB 1WF0A 2E44A 3LQVA 1WELA 2EK1A 2MPUA 1WI6A 3MD3A 3SDEB 1VC6A 3UE2A 1L3KA 1X4EA 3TP2A 1M5OC 3NS5A 2MJNA 1U6FA 2DGVA 2CQ4A 2KM8B 1WG4A 1SXLA 5ITHA 3NNAA 2CQPA 2KXHA 3VALA 3MXHP 3CC4S 2KVIA 1BY9A 2RVJA 1Q81T 4UY8T 1NU4A 5CA5A 3U1LA 5DM7Q 4RU2A 4BS2A 3P6YC 2CPIA 2LMIA 2XS2A 2DGWA 1UAWA 1KQSR 1WF2A 3MOJB 1X4FA 2KG1A 2MY8A 3CF5Q 2DHXA 2VOPA 2A3JA 3FEXB 1X5PA 2KFYA 3MUTP 1VQ8S 1U1NA 3MDFA 2DNRA 2OIHA 1VQLS 2LECA 2GO9A 2RRAA 2L9WA 1WEZA 3EGZA 1YJWS 1QM9A 2V94A 1P27B 2VOOA 1S72S 4CH1A 2CPFA 3R27A 2VONA 2MKIA 5LXYA 2FPHX 3V4MA 1JJHA 3JB9k 5DDRC 4QQBA 1FHTA 2KG0A 2MQMA 2M4MA 1VQ7S 2CQIA 2YH0A 3EGNA 2U1AA 2M9KA 3THTA 2DNZA 2LXUA 2CPYA 3CXCR 1OO0B 2CQHA 1H2TZ 5IM0B 3VAGA 2G4BA 2G0CA 3G71S 2MKHA 2FHOB 1RK8A 2D9OA 1FJ7A 3Q2TC 2CQCA 1H2UX 2DO4A 2RQ4A 4V19X 5FJ4A 1YHQS 4J5OA 4LJMA 1F9FA 2LEBA 1VQMS 1WG1A 3FEYB 1VQPS 1M5VC 1WG5A 3IWNC 4IOAQ 2DNHA 3P5TL 5DETA 1VQOS 1YI2S 5D78A 1A7GE 2CQ3A 2F3JA 3P49B 1UFWA 2JVOA 4TU8A 1URNA 4W92B 4Y00A 2MGZB 3MUMP 1AUDA 2D3OR 2DGTA 3MURP 2O3DA 2RQCA 2CQGA 1WHWA 2K8GA 2QFJA 3MUVP 2RUGA 3PIOQ 2DHAA 3G4SS 5GAGU 4ERDA 2HGMA 1PO6A 1UW4A 4TLQA 3VAHA 4ZKAA 2VODA 4PKDB 2CPEA 3J7YU 1WTBA 2HVZA 2UP1A 5HL7Q 1ZZFA 1DBDA 2D9PA 3CC7S 3UD3P 3N9UC 1N52B 2HGLA 2M52A 2M70A 1X4AA 1U1KA 2FC8A 1WHXA 3CCQS 3US5A 2CPJA 1U1MA 5GADU 1JJ4A 5HO4A 3B4MA 2WBRA 1D8ZA 1N8RT 1WI8A 2DK2A 1OIAA 1H6KX 2KXFA 1WHVA 2RT3A 2CPDA 2XB2D 3NNHA 1KOOA 4YB1P 1YWXA 2DB1A 2LKZA 2BOPA 3OW2R 3J7ZT 2JX2A 2CJKA 1KD1T 2KU7A 2DNGA 1WF1A 4C4WA 2MKJA 1IQTA 1FNXH 3CCMS 3R1HA 2AYGA 4C0OC 2MZ1A 2LA4A 2YTCA 1YITS 2DGUA 4F26A 2DGQA 3L3CA 2DGSA 3TYTA 3BEGB 1FJCA 2J76E 3CC2S 1VC0A 2N7CA 2J0SD 2HGNA 4WFNQ 1WWHA 1VBXA 4F25A 1PGZA 5GAEU 2OJ3A 2DITA 3MI7X 2XS7A 1G2EA 3NMRA 2LXIA 1U1QA 2MZQA 3BO4A 2RS8A 2AYMA 4CQ1A 3R1LA 1SJRA 1FO1A 3VAIA 2MQQA 5GVQA 2KH9A 3P3DA 1B7FA 2DNMA 2N82B 1NJIT 5GAHU 3I56S 2F9DA 4WFAQ 1VC5A 3CULA 2JWNA 2M88A 3UWTA 2RRBA 1U1OA 1KC8T 2M8DB 2M2BA 4FXVA 2MZRA 3NS6A 1X5SA 5LJ3Y 5LSOA 3UCUP 2XNQA 2DIUA 3CCSS 1X4BA 2NLWA 2ZJRQ 2MKCA 4P6QA 4WKRA 1VQNS 4TU9A 2G1DA 2BZ2A 2Q79A 4FXWA 2PE8A 2CQ0A 2KRRA 1X4GA 2J8AA 2KYXA 5D77A 2SXLA 1QVFR 3CMAS 2CQBA 2DNKA 2YKAA 2LCWA 4F02A 1U1RA 2MJUA 2MQLA 2MZSA 2MZJA 2X1FA 4A8XA 2I2YA 3RW6A 2LEAA 1HA1A 3CTRA 1U1LA 4EGLA 2OTJS 2M7SA 1X5OA 5BJRA 2K3KA 2DNLA 4WFBQ 5JVHQ 2FC9A 3VF0B 3DLLQ 4YOEA 2DGXA 4Y0FA 1QVGR 1U1PA 1NO8A 3CCLS 2OTLS 2AYEA 1YTYA 1CVJA 4QU7A 3U1MA 3S01A 4IOCQ 3G96A 1R8HA 1U6BA 1OWXA 2XS5A 2MXYA 1HD1A 2MMYA 2HZCA 1SJFA 1W2BR 2MZTA 2PEHA 1Q7YT 3BO3A 2KT5A 3CCJS 4M5DB 1FXLA 1DHMA 2KM8C 3THPA 3UCGA 3PIPQ 2RS2A 1M5PC 3H2UB 3DXBA 1ZH5A 2EK6A 3H2VE 5GMKa 3CMES 2LYVA 2CQ1A 5JVGQ 2QEXS 4PR6A 1N88A 1P1TA 4TU7A 2MYFA 2LA6A 5DDOC 3VAJA 1VQ6S 3UCZP 2CPXA 1X4HA 2RU3A 1YJ9S 2JRSA 2L08A 1WHYA 2MGZA 1VQ5S 2DGOA 4CIOA 2OSQA 1SJQA 2DISA 2F9JA 3CCES 4QPTA 3IRWP 2CPHA 2N3LA 1K8AT 1VBYA 1R8PA 2E5GA 2ZJPQ 5CYJA 2JVRA 3B4DA 2DH9A 1X4DA 2MSTA 1A9NB 3Q2SC 5LXRA 3UD4P 3VAMA 4CH0S 2ZJQQ 4WF9Q 4LIRA 3VAFA 2QA4S
chains in the Genus database with same CATH superfamily
3HPOA 3MFHA 3D6TB 3K8WA 2GJIA 2FY1A 1QTNB 4MMOA 5DGBA 2MLYA 5CQGA 3NRBA 3EZ5A 4PRFA 2YKNB 1G6BA 5DGAA 1KOHA 4ZP7A 3FQLA 5K20B 2MB0B 4Q43A 4OZ0A 5KT6A 3DLKB 1JLBA 3TX0A 3CIZA 2OPPA 3EZOA 1U4BA 1QY7A 2FHJD 1I94F 3CCUS 1D9AA 1UJ4A 1WEXA 4PG5A 3ZZZA 3MCSA 1WOPA 5EN1A 4H4MB 3W61A 2UV8G 1EZZB 1EETA 2ZH9A 1T05A 2KXNB 1VRUB 2XHCA 3FCWA 4XK8C 4DSFA 2OH2A 1WTFA 4MTPA 2KYZA 4CYUB 2QMXA 2AV5A 2VB6A 2POKA 1RWPB 2A10A 2E1RA 5IV4A 1RT6A 5KFUA 3QNWB 2XSJB 3UFCX 4ZCKA 2BJ1A 1U6FA 1FEEA 3HK2A 3U7JA 3ICLA 1SXLA 3KDOA 5ITHA 2XHWA 3MXHP 2XWYA 1NHUA 4ZN3A 3CSKA 2HS3A 5A6PA 1T3NA 1U8WA 4A8MP 4YEAA 4IQMA 4LF9F 2OD4A 4ZIWA 1U1NA 2LDIA 2F1FA 2ZFHA 2DNRA 2F4VF 2W4PA 2LECA 4LSZB 5AT1B 4PXEA 1SVDA 1YJWS 3JSMB 5D4LA 4O3SA 3TVKA 2R7VA 3PR5B 4ID5A 4NYZA 2I0XA 5D6GA 4YFUA 1R43A 3EGNA 3GV7B 2HFZA 2U1AA 3A12A 3BBCA 2DNZA 1OO0B 2E9TA 3FVYA 2ZE2A 1IKYB 2UUAF 1FK9A 2XC9A 3FSXA 3SSSA 3HFZB 4LR7A 1RTDA 2DPIA 2KKHA 2B6AA 2AKWB 1D9FA 4B3OB 5DJBA 1SKRA 3T41A 3WQPA 5K8PA 2RQCA 2QFJA 4ECUA 5CCLA 3MEDA 2JEFA 1S0VA 3OTDA 1Y5LB 2P2CB 1PO6A 3V2UC 4KTQA 1RACB 3Q8SB 4RR5A 3CDWA 5F0WA 2HNDA 5KFBA 1U1KA 2HQGA 1Y10A 1YJTA 5HBMB 5GADU 3FFIA 4DG1A 3FJ2A 5KFRA 3HHKA 2KXFA 4MT1A 2XB2D 4A48A 1NSPA 5KG0A 4B3TJ 3O44A 4GO7X 4EYHB 3R3TA 2JX2A 1KLMB 1WF1A 2MKJA 3R1HA 3Q8QB 2BJ9A 5HLFB 2Y9HA 3PJXA 4N76A 1JNRB 4O4RA 2RB7A 3DGPA 1HMVA 2HIQA 2OJ3A 2EFOA 3MPDA 4Y65A 3NMRA 3IG1B 4ZLNA 5M2RA 5GVQA 4DV3J 2E7XA 2EKNA 2GIRA 2HAIA 4ATNA 1U1OA 2NCKL 1RBAA 5L1KA 1Y9OA 3T6BA 2CDQA 3W5YA 4OZJA 5J2NA 1NAQA 4P6QA 2YBVA 1NDLA 2DT9A 2FDNA 4FXWA 2CQ0A 3QFHA 6AT1B 4ZVUB 2DNKA 4CO3A 1CSJA 5C42B 4TNOA 5FLXU 1WC0A 4FPIA 1PBAA 3PW2A 4C0HA 2W9BA 3NXZA 4BWJA 4B9SA 2I5JB 3S01A 4RW4A 4P72A 2HNZA 4LSLB 4A8FA 3KLIA 2HZCA 4KPCA 2I1RA 3M8RA 3AB4B 2KM8C 4MFBA 3THPA 2LP4A 2CJQA 4OV6A 2AZ3A 1JIHA 4DS5A 4IO1A 4B9NA 2G1HA 2O66A 2QEXS 4PXDA 2GMJA 4ECVA 2LA6A 4WU3A 4MKAA 1U48A 1WC5A 1T9XA 1WHYA 1XC9A 3TJAA 4YB6A 3RZAA 2CNLB 4K2JA 5F41A 1WOSA 2OPSA 1S77D 4RNMA 2GS8A 4YR2A 1N5YA 2CWXA 3CJ8A 4ZPBA 2DHGA 3R6GB 5B7WA 1Y3KA 3CMQA 1UP1A 3IWXA 2PD1A 2WONB 1J5OA 1S6PA 4YHHJ 3PACA 5KFOA 5BYQA 2MKSA 3LP0B 2ERRA 2DNNA 1GEHA 5B0GA 2GAGC 5KG3A 2IRUA 3GMGA 5CH7B 5A0YA 4B3MJ 1N6QB 1YIJS 3TEHB 1UEUA 4QYRA 5D0EA 1RKJA 3CJTA 5IV3A 5LSLA 4UY85 4DSKA 2ROPA 3GSDA 1NK0A 2VQEF 5AJ3J 3KUGA 1FXRA 1WDDA 4W90B 4Y2MA 3JYTA 3GJSB 3OTOF 1U25A 4I2PB 2R8HA 4YY3J 1R6VA 2DNPA 2YQ3A 1VQ9S 4ZJOA 5H1SV 4R5PA 4CP5A 3TARA 1RDRA 4LF4J 3DLGA 4DR6J 2DNQA 3M8WA 1LNQA 2BE2B 1WI6A 3H5UA 2C3MA 1RTHA 1U2CA 2HK3A 3VALA 4RBTA 3GR0A 3GLJA 1YJRA 2WOMB 3S1TA 5KFFA 1T95A 4O0NA 3MOJB 2R7OA 4RNFA 2NPFA 5AE1A 3QT8A 2MHEA 2H9ZA 2HS0A 2CG8A 2IHR1 3EJMA 3MR5A 2KJVA 3FCHA 4CRJA 3KJQB 4I64A 3GCXP 1FKAF 1R8AA 2IY5B 5C5JA 3MR6A 2W7PA 4LF7J 1NCLA 3ZTPA 3CD7A 3SBMA 2QTWA 4C98A 2G4BA 4NZ6A 1LWCB 2FHOB 4DR2F 4F4XA 3DLEA 3BBBA 1BLUA 2DO4A 1H2UX 1T03B 2NYHA 3CNQP 4DFPA 2PMZD 2IM0A 2OP5A 1YG0A 3J80Y 4WFXA 4HI2A 2ZDOA 3JQJA 1NDCA 2VPYB 2LQBA 4TKTA 4W92B 1RAHB 2JLGA 3QYYA 1QE1A 4GKJJ 1SUQA 4U7CA 3AAWB 3VHQA 3KUEA 1E6VB 2ZNYA 4JI7J 4FZVA 2R7RA 1X9WA 1Y0HA 4RNOA 3GIMA 2XMTA 2WVDA 5HL7Q 3ZTRA 4JB8B 2RILA 1DBDA 3JTNA 2HRUA 4Y2KA 1ZA1B 1VJQA 1S6QB 2HHPA 4RO0A 1KP6A 2XZWA 1XEZA 2M3DA 3MM7B 3D1QA 8AT1B 4C9DA 1HYSA 4U7UK 2D1CA 1NEEA 1S1XA 4DV6F 1S6OA 3HJFA 2HS4A 2MZ1A 4JI3J 5HVFA 3AJ2A 5F0UA 4WFNQ 1BHNA 4I1TA 1IBKJ 3UVJA 3P96A 4HH0A 1U49A 2VJVA 3P3DA 1OSCA 1YVFA 3MCNA 4WFAQ 4RL1A 3HDSA 1KNZA 5AXKA 1KR4A 2FZKB 1FKPB 1XWLA 3J81j 1SL2A 2ZH8A 3J7A1 3M9OB 1XERA 2BZ2A 5ETOA 2HLUA 4DSIA 3V6KA 1K1SA 1SQGA 4FYYB 4UW2A 4UTGA 2QC3A 3F41A 4LF6J 1M0SA 4TN2A 4NXMF 1S59A 1R8CA 3DRRB 1U1PA 3RU0A 2YKQA 3MCMA 2C2KB 1JLQA 4QIEA 3OTEA 3CJKB 1UZDA 3EVOA 4JI3F 4ILLA 2OFGX 2F8HA 4M5DB 2VU5A 2EFNA 4XPEA 4KH0B 1IBKF 1FDBA 3T1YF 1GQEA 5C24B 1SC3B 4DFKA 1HBNB 4M5IA 1Q16B 2DGOA 1QD1A 3HFKA 4PWDB 3BH6B 3NKYA 3M2UB 3LW5C 3LP2B 1RHJB 5MAOA 4KB7A 1A9NB 3KFWX 4JP8A 4LF1A 1UJ5A 2ZUAA 1N4LA 2RQMA 4CCHA 4X65J 4IG3B 4C8YA 3CIMA 4ALZA 4JV0A 2QMWA 1T8EA 3DI6B 3W8PA 4LF6F 5ETKA 3NNCA 3UR3C 2ZH1A 1QLNA 2J0XA 4N8OA 4JUZA 1S1VA 4ZVOB 4AD6A 3NGUA 2HHSA 2FVRA 1YRUA 1JJ2R 1AFJA 4DS4A 4HR2A 4JI2J 4P75A 4A8KA 3HZEA 3R8YA 1NK8A 2FTRA 2GCFA 4A8QA 2GO8A 1RWWB 4O3RA 3Q8PB 2GHWA 3RAMA 5JXSA 2JNJA 5KT4A 1MMLA 2ZZTA 2YQ0A 2KHCA 2AEJA 5DQIA 3POTB 5T7LA 4TYBA 2JC1A 4EO6A 4LT6A 1E6YA 1HHTP 1BC6A 2Y8YA 1ZM9A 2VD3A 1FRKA 3CPWR 1S9FA 3MCOA 4I6WA 3VGUA 4OI3A 4OYMA 5KG4A 3R2DJ 2ZBPA 3ET6A 4EO8A 4PG7A 3MM6B 2EFQA 3GFHA 2JJ4D 1BY9A 4UY8T 4B9VA 1DAXA 2Z2MA 3PYDA 3NCPA 1R8BA 1WF2A 3KG0A 4K50A 1UVLA 5KG5A 1C1CB 1LQ9A 2HVHA 1TUWA 2UUCF 4CLFA 4P71A 3VGSA 1C1BA 2K1RB 1EQMA 2VOOA 3PW7A 2IJNA 1MMDA 3M6WA 3QWPA 2FVSA 1XMQF 3ZXWA 4KHMA 4A8OA 2HQCA 2DCUB 2LXUA 3DHWC 2CQHA 3W9IA 2BJ7A 4GVBA 5KTQA 4DR7J 1N32F 5FJ4A 4DZ6A 4DV0J 4H4OA 1YGYA 2F40A 2VG7B 1EKSA 3A8KA 3KJVA 1NK5A 1NRKA 3C16A 2JVOA 4C8ZA 1X60A 3TVYA 4XDDA 1OQ6A 1J27A 5F8NA 3CDUA 4JV2A 1V3RA 4OX9F 4CWBA 2Z58B 2JC0A 3CDAA 3GV5B 2OMOA 4OI4A 2AMCB 4EZ6A 2E1PA 3OR1A 3FMWA 5F8JA 1U1MA 1UJ6A 5HO4A 3T5KA 3C14A 2V63A 1RT5B 1X9SA 1H6KX 4J7CA 1IUJA 2RT3A 1RWVB 3D6MB 2CZ9A 3HSGA 3Q24A 3M8YA 3MAAB 2DNGA 5L9NA 5L46A 4F2RA 3LAMA 2C28A 3FSYA 1N5VA 1HW8A 3KMQA 2AEFA 1XK8A 3UDCA 1YKWA 1TV6A 4YB5A 1U47A 2N7CA 1JLAB 3TUJC 4U8YA 3CCWA 5EHHA 2JDJA 4GC7A 2LXIA 4OIXA 4HI1A 1U0HA 2KH9A 9ATCB 5KFHA 2GQQA 2QGFB 4L76A 3T1HF 3IMQJ 3PNIA 3FRZA 4PQAA 4FXVA 4CLLA 2GQ2A 2B7BB 3VZIA 3Q0AA 4EWTA 3I0SA 4WKRA 3OVAA 1RAIB 3OFFA 3KJNB 4ZP8A 1T02A 4RKUC 3I5BA 1LWFA 4AFFA 2MZSA 3JSBA 1S1UB 1SCJB 2LEAA 2GX8A 4AE5A 2B8PA 2W01A 2K3KA 3HHLD 3T6JA 4RZRA 2Z2ZA 1SJFA 2YNFA 3B8HA 3TJ9A 1Q5YA 3MMBB 4DX6A 2RSQA 1QTMA 5CZVA 5GMKa 3SEOA 1Q8LA 3QGGA 4KR0B 1GXUA 2XO7A 3MAHA 3K5MA 4ZVTB 4F3OA 1TK0A 1VQ5S 1PJ5A 2CPHA 3EZUA 1JQGA 2ZJPQ 5IS2A 1HPZB 1X4DA 2IVMA 3K59A 3HP6A 4PG6A 4LVNP 2DRBA 3TWZA 2Z8QA 2XMUA 3DYAB 1VQKS 3JXOA 2B51A 2DIVA 3PJWA 4PEOA 4HT5A 3M8QA 4F8RA 2B56A 2GVZB 4KAIA 1Q82T 4NXNJ 4JI0F 3D3CJ 2XY7A 3FSIA 3TA1A 2WK4A 2LVWA 1LW2A 4UQTA 1ZYQA 4K4XA 3OPKA 4RX6A 1HARA 3PYFA 3MFIA 2W25A 5I3PA 1KQFB 1F5AA 2OGUA 3OL7A 3PJ9A 4WTYA 3JSYA 3HHLA 5LM7E 3DRSA 2F5GA 2QO3A 3AQOA 3M1VB 1XN9A 4NZ7A 1NHKL 2W8KA 1WEYA 4J9PA 2QL7B 4NZ0A 3AD8C 3TUZC 5KG7A 2HQ3A 4B3SJ 1ZZNA 1BQMA 3JSRA 3E2EA 1VISA 2E1AA 4KHPF 3QT5A 3VQTA 4WIIA 5IM0A 4X62J 1IKXB 4LFCJ 4Q8EA 4FF2A 3D4JA 2ZM6J 3TA2A 1WSRA 2HHHJ 1KTQA 4IG0A 4U67Q 3H4DA 1Q86T 3W2WB 4F4WA 4DUZF 3TP2A 3RB0A 2MJNA 1CJTB 2VV5A 3OBIA 3NNAA 5FDLB 1Q1KA 1TU0B 2BXJA 4ITSA 3IAM9 3MMAA 5KG2A 4AQYJ 4L75A 4DXLA 4ES3A 2HZAA 4WK1A 2MY8A 1RLCL 1FA0A 3CF5Q 1W2IA 1CLFA 1X5PA 4ZHRA 2HMIA 2OIHA 3CW2C 1FE4A 1TKTA 1RT2A 3EVWA 4F7VA 1HI1A 5KAKA 4OZLA 3PYGA 3V4MA 3SYZA 3JB9k 4OQJA 3MOZA 2M4MA 2YH0A 1JLCB 3O3LA 4DQSA 1Q53A 2MKHA 3HLUA 4MJKA 4X62F 5G0RA 4LFCF 2W2PP 2KZZA 2ZM6F 5L39A 1YLXA 4FNIA 4IOAQ 1EP4A 2ACMA 4D3GA 1FVSA 3PCOB 3I96A 3J81Y 1TL7B 3NG8A 4WZMA 2RF2A 4CTAA 1IJFB 1FKOB 1YJ7A 1T9UA 4AQYF 2QLFB 1HQUB 3N4WA 1V3SA 3CE8A 5AXMA 1NM2A 3D5MA 2RJZA 2ZVSA 3BDPA 2BQ3A 4OI6A 4NI2B 5C25B 1Q5VA 3T3FA 2AZ1A 4Q8FA 5J1PA 1N8RT 3W5XA 1UW9A 3NAHA 3SFUA 4JI4F 3CD0A 2H48B 2IC3B 3TZWA 4DPWA 5BR8J 2D3O1 3C6UA 2K06A 4DV5J 4NLVA 4ZVHA 4F3QA 4F50A 1LXNA 2RRNA 2CZ4A 5L1LA 4F26A 4NLQA 3CJQA 4C97A 3V6HA 5GAEU 4PWWA 1XNRJ 1LEOA 2IYIA 1CULB 1F0XA 1FO1A 3VAIA 2DNMA 3FZ2A 1KWMA 4YDDB 2JWNA 2GVDA 4KRWA 1TVRB 2WW4A 3TAMB 5CYQB 5H9EJ 4IRDA 2M2BA 4DF4A 4RW7A 1TKXA 5B0AA 1RSCA 1S7HA 5IQ6A 3EXCX 4UOCA 1TFYA 1SV5B 5KFPA 4FF3A 5F3ZA 3DOLB 2AX1A 3OFEA 1FFSB 4F04B 2YKMA 3RW6A 3JAMU 1ZTTA 3VF0B 4YOEA 3W2VB 5A6WA 4M95A 1TL4A 1CVJA 3QQCD 2B5JA 2GHVC 5KFNA 1JXVA 2MXYA 4JI6J 3AQPA 4IQXA 3G82A 3CJ3A 5J2MB 4CLPA 3RR7A 1O51A 5KG1A 3DXBA 3OTCA 3AOBA 2LYVA 1XNRF 4BDPA 2YKOA 4OLOA 1OS5A 2UUBF 1T7PA 2V68A 3MPYA 3PKMA 3BR8A 1R8PA 2XMJA 4DLGA 4UQGA 3GONA 2IM1A 3Q2SC 2V2VA 2ILYA 3IBWA 3VAMA 4ZP9A 4NLPA 3QSIA 1SI9A 3PKYA 2PI4A 1S5ZA 3K7RA 2DNOA 2GGPB 1RHMB 2HYIB 2OFHX 1HNXJ 1NSQA 3C6TB 2B4UA 1N36F 4PG4A 2D69A 3BO2A 2OSRA 4DI6A 2N3OA 1IN0A 3OSNA 1GXTA 5A8WB 3BR9A 3A8IA 5L8RC 1OY8A 1OY6A 4F36A 2HFSA 2IVYA 1YBTA 2ZH4A 4NA3A 4PUOA 2K2PA 5IQQA 3H90A 3BS9A 4FNHA 4O23A 4HACB 1N5QA 2ADCA 2CJ9A 1RKIA 4FP9A 4X4UA 4P74A 2V8PA 3FZBA 4B9UA 1T9VA 2E44A 3SDEB 1TL3B 4QJVA 5AXLA 2EC2A 4ECTA 4M5HA 4CNZA 5EX3A 2OPRB 3GFYA 3QLHB 4JYAJ 3T5JA 1WNEA 1VI7A 1XQIA 2LMIA 4ZDNA 1UAWA 3BPDA 1KQSR 3TAQA 2HWIA 2KFYA 1TKZA 3LP1B 4LRAA 2VUGA 5DRKA 2XTJP 2WZ1A 2HQIA 1WEZA 2WHOA 3EVMA 2FZCB 1N5TA 1UFKA 2UVRA 4XTTA 4ECWA 2B4VA 2C2OB 3BH7B 1FHTA 2KG0A 1VIOA 5HQ8A 2IPOB 4KY3A 3IFEA 5DG9A 3T5LA 5A2QY 2CPYA 3K2YA 4NYPA 1PYSB 4IRCA 3K58A 1K47A 3M2VB 3CEDA 4BLGA 4X84A 1VQPS 3KK3B 3FQKA 3PM9A 4WU2A 5DETA 3K8VA 1F5CA 3OTBA 3R5DA 1H7XA 1A7GE 1PJ7A 2N4CA 3GP9A 3DDNA 4O3QA 3IBCB 5IOLA 1Y00A 1JNZB 2RUGA 3R7NB 3KLHA 1XIQA 4JYAF 5GAGU 2J9DE 2VPWB 2H4YB 2A2CA 4ZKAA 4PKDB 4I68A 3HVTB 1BWEA 1I51B 1HNZJ 2XWXA 1N52B 5EDWA 4J9NA 3M2RA 4ED0A 1WHXA 3OXGA 1TAUA 4OHVA 2L9NA 1JJ4A 4PCQA 4DV1J 2DK2A 3SQGB 2CAJA 4N41A 2F65A 3R7BB 3MGJA 3FUYA 3CB4A 1RAJA 4RNHA 3NY0A 1Z2LA 1OQ3A 4HYKA 2ZDPA 2D74B 4ZPDA 3CO0P 1SPBP 2DGSA 3CJ0A 4ELVA 2GMHA 3ITHB 3MMCA 1VBXA 1S9EB 2CNOB 5GADI 4Q0BA 3MI7X 2C22A 3SCIE 3KLEB 3KOAA 1RP5A 2OMLA 1B7FA 1NMEB 5IT0A 2BANA 1T05B 2VQFF 1IWAA 1TMJA 5B0BA 2YWHA 2CNNB 4L74A 1GFWB 2CADA 2EBEA 1B64A 2NSCA 5HMYA 1HNZF 3D66A 4AXJA 3B6BA 2B4OA 5D77A 4DU7A 2ROGA 3QSYB 1FRLA 1NB2A 2NXNA 4HH1A 4KC5A 2C2ZB 5E3QA 1F60B 4WFBQ 3ZO7A 2AYEA 4MYTA 2YKNA 4QU7A 3G96A 5IT9Y 1UL3A 1KFDA 2E66A 1KVJA 1TP7A 3E8OA 3DLKA 2KT5A 3CCJS 4DX5A 1B0PA 4QIWD 1RHUB 4OZNA 4AL5A 4QWAA 3T9ZA 3DOKB 4BC9A 4K0KJ 1AFIA 3DNCA 4L6V3 1HR0J 4OJ1A 3AT1B 3QFWA 2OHDA 2MGZA 1FX2A 4H4MA 3R5CA 4M5NA 2Z30B 5E5NA 1VRUA 4QYZJ 4CYUA 1VK3A 4FDFA 1I1GA 4LIRA 3VAFA 1S9GB 2JL9A 3M9NB 4USMA 4ECXA 5B0CA 4C6AA 4ED2A 2XSJA 4Q44A 4DCPB 3GYXB 3GJTB 1HBMB 1DZ5A 2UXCJ 2XYHB 1Y4ZB 5EWFA 1W7WA 3BYRA 3BN4A 3R9LA 4N77A 2BX6A 5DDPC 4MKBA 1WSVA 4ED8A 3K57A 1V5IB 3M6XA 4EU0A 3QIDA 2RHQB 2YWKA 2VFTA 1RAEB 3DXSX 4DSJA 4ECQA 3JSMA 2MKKA 2MQNA 3ENWA 1FT8A 1C4CA 3W1YC 4OFZA 3ISNC 1IKYA 2BJ3A 3I55S 3HFVA 3PHEA 2AGPA 2E5LF 4ZP6A 4B3OA 1BQXA 3LQVA 4NLXA 4N7TA 3HSJA 3A13A 3ILOA 2GW8A 3H59A 2HKEA 4M5MA 1WC1A 3MAQA 2HFVA 4ZPVR 5L1JA 3NWRA 3D28A 1Q81T 3V4IB 3BYPA 4H4KC 4OYWA 2VOPA 2H51B 4R8UB 2BACA 4F0HA 2UXBJ 2CPFA 2WCXA 3B82A 5HBMA 5LXYA 4Q45A 2Q43A 2YX4A 4OZ3A 2PFDA 4MAKA 2RQKA 4NOHA 3THTA 2F4FA 1ZA2B 4B17A 3VVUA 1VYAA 1KLMA 3DN9A 4FYXB 5AXNA 3PW4A 3O2IA 1AROP 3PX6A 2LEBA 1WG1A 1NSAA 2VL1A 3OT9A 3RRKA 1UVNA 4FF4A 1YI2S 1J2VA 4NYOA 5D3GB 3EGWB 1FJGF 5A8RB 2DR7A 4EBDA 4USJC 2CXEA 4C0BA 3H8YA 1GT8A 4NEYA 4ER8A 1JWWA 4TY8B 2HFUA 2KT2A 2BQRA 5B0EA 4NCGB 3EYZA 2ZH3A 1MWZA 3TVZA 1RT4B 4OHXA 5J2QB 3I82A 1YZ7A 4OHWA 1ZZFA 4K4UA 2HGLA 4MH8A 5KFMA 1O5JA 3TNVA 4C11A 1UA1A 3W8GA 5C42A 2K3IA 1J5OB 3WC2A 2V0NA 1XMOF 3ILLA 2AGQA 4RUCA 4ZIVA 2IFXA 2LLZA 2I5JA 3TANA 2CJKA 3MPVA 4KFBB 2R7XA 1PAUB 4LSLA 2JEJA 2AYGA 4QW8A 2RDDA 2FJWA 2YTCA 4Y28C 1V9OA 2WSCC 4RW8B 2MQ8A 4ETXA 1VC0A 1RWMB 4F25A 2ABYA 3MEKA 4ZPCA 3H5XA 4DFMA 3ZZOA 2FHMA 3LUYA 1Y5NB 1CPZA 1M1HA 4XDCA 3BB5A 3R5JB 4DQRA 4HHJA 4LBIA 2ZJRQ 3CVKA 1H3DA 1UKUA 4CT8A 4JI8F 2CJAA 4TYAA 4JI5F 2KRRA 3DRXA 8ATCB 2XI3A 3SSQA 1Q8KA 3CJ2A 5DLGA 5KG6A 2ZH5A 2VF3A 4OHZA 4ED1A 4P2XA 2WONA 2VICA 2OUGA 2R2TA 4XIUA 2BE7D 3C8YA 4Y0FA 3LP0A 1MSWD 4FS2A 1YTYA 4WP9A 2DYAA 3BGLA 2PEHA 3KHRA 1Q7YT 1N6QA 4Y3CA 5D0GA 4DR5J 2V2ZA 3D7SB 2RS2A 4QWEA 4TQSA 2EC0A 3FGVA 2CQ1A 4QCLA 2BR0A 1HBOB 2VC0A 3MEGB 1RUSA 2OSQA 5K8MA 4URGA 3C2PA 4F4AA 4I2PA 3THVA 1T11A 1FWLA 3VV2B 2CJBA 3UO0A 5IWAF 4KQZA 1HNVB 2MSTA 2XLJA 3UN2A 3AB2B 3PY8A 2FIUA 2QLJB 3FDSA 3J80U 3DM2B 4ENOA 5F9NA 2VFVA 4UUWA 1FWKA 1SJ4P 3VR1A 2BE2A 1FNOA 3M32B 3NL0A 4M8LA 3UR0A 4O44B 4KYZA 1VGYA 1Q78A 3DFEA 3UDLA 4OI2A 1RT3B 2WOMA 3WC0A 2J9DA 1KVIA 3F73A 4A8YA 2ZUGA 4HDGA 2KHDA 2QL9B 2AHOB 2IVFB 2FLLA 4LFBF 3Q83A 1UETA 1H74A 1HYSB 3RTVA 4NLWA 1N48A 3M05A 2J5AA 1JMTA 3EICA 3UNGC 3MM9B 1HBUB 1LWCA 2PO4A 3UDVA 1TK5A 2QA2A 3ZTSA 3W7BA 2CJXB 3IM8A 1T3OA 3AD9C 4MIAA 3NOCA 1JKHB 3ENVA 1L3UA 3FBFA 5M2UA 1JXLA 2KM8B 3R7SB 2RHSB 2YVSA 4RPFA 4V1Ak 2DD8S 1L3TA 2B3TB 1PJ6A 2RVJA 4F4ZA 3QJJA 1E6VA 1ZM3A 2R7SA 4FF1A 5HATA 2CPIA 2OI2A 4NA1A 3DHXA 3ZC4A 1QSSA 2AF6A 4ZLPA 2GIQA 4DL4A 1VQLS 4GKKJ 1S6QA 1S72S 3Q8UA 4CLKA 4DL5A 2VKRA 4UZBA 1RQ0A 2VFUA 3MM7A 1W26A 3IS9B 3HM9A 4ZVFA 3SV4A 2BJDA 2M9KA 2XZDB 4EK2A 2UU9J 2V2KA 3G71S 3U02A 4QYZK 1GK8A 2CQCA 4E98A 1KRPA 4LJMA 2D41A 4PZVA 5D78A 1H7WA 1APSA 4X4OA 2AW0A 3KLFA 3P49B 1URNA 1QDUB 4KGXB 3CJRA 3MURP 3BGFA 5EWEA 2C2DA 3H5SA 3AODA 3W63A 4R0EA 2DY9A 4I6AA 2NUUG 4HL9A 1P1LA 1XNQF 4URSA 4I0WA 1R0CB 2NR0A 1EQ0A 4ERDA 1FKPA 1HWJA 2HGMA 2G0IA 4Z7YA 3VAHA 1Z2ZA 4RW9A 5B0DA 2D9PA 3CC7S 3SIPB 4B9LA 2M70A 2YNHB 2HIYA 3C66A 5JMNA 2P8IA 1I94J 5RUBA 2V4JA 4QR0A 3HKZD 3DRRA 3J7ZT 2R42A 1H73A 1D3WA 3CJKA 3R6LB 3DGVA 3RBXA 1A0OB 4WE1B 4M5DA 3TYTA 3BJYA 4ZCLA 5C24A 2MZQA 3R1LA 2XO6A 3LWLA 1HBNA 2IDEA 4J9RA 5T7LB 4ELUA 4PWDA 1E6YB 2DVIA 3M2UA 2DXEA 3LP2A 5ETQA 2R9LA 2XNQA 1XR6A 2QN6B 3K5PA 3EXYA 4LF9J 3GIRA 1HNWF 3DU6A 1B3TA 2F4VJ 2J8AA 2ASLA 2UZAA 4IG3A 1P9YA 3CMAS 4G1PA 3N01A 1Y11A 1S0OA 3ET6B 3DI6A 4WJBA 4OL8A 4R0JA 3BBFA 4I2QB 2HWTA 2MKYA 5BJRA 5JVHQ 1OMSA 3AFGA 4RBVA 5E3RA 3CCLS 2DEIA 1MLAA 2UUAJ 3NMAA 2C2NA 1PC4A 2C3UA 4UT4A 4DPUA 3GJRB 2YX1A 3NWGA 2V67A 1VQ6S 2PFFB 2A2DA 1VQSA 4CIOA 1Q8BA 3AHPA 1IR0A 1CC7A 2QFIA 5K14B 1CQMA 1QUPA 5CYJA 2VC1A 3AJ1A 3NBPB 4DSEA 3UD4P 2FJXA 4G65A 1TR0A 2HHUA 2R7QA 2HAFA 1Q4RA 2E1MC 1HI0P 4CO2A 2W2MP 1JK9B 3OXLA 2CDRB 1FDAA 3PVXA 4ES1A 4IFYA 1QAJA 2FHJA 5KFEA 4B9TA 2FQQB 3H25A 4M94A 2ZOFA 3CUNA 4O3OA 1O0PA 4DX7A 1C1CA 2O01C 1TZ0A 1IBMF 1WD6A 4LRDA 1RWUA 3OR1B 2K1RA 3G9CA 2CQ2A 2R8GA 4WK3A 2AJQA 4QBUA 5IXUA 3S8SA 5E3PA 2L41A 1IKWB 1T0TV 2DNYA 2X1AA 4G1QB 1J5EF 2F63A 4CM2A 1FCAA 2BRLA 2C2MB 2HLTA 5KFLA 1GAOA 2DHSA 3EX7B 3LGHA 3AA8A 4K2XA 3I0RB 3A3OB 2Y1IA 2VG7A 5IC4B 2KJWA 2ILZA 1U8SA 3GQCA 2QZ8A 2RKIB 3PXGa 1M5OC 4HVZA 3RRHA 1D09B 4WFYA 4FBUA 4LF8F 2Q1LA 2V8HA 1RTJB 2O5DA 3U1LA 2BJEA 1ROFA 5DG8A 3W62A 3M6VA 4ANDA 4NMXA 3C19A 1RTIB 2KG1A 3ZZTA 3QZ8A 2IM2A 4I7FB 1RA7A 2WAQD 2KB2A 3MEEB 4W98A 2RRAA 2VBZA 1LWFB 1HWLA 1IVZA 2NREA 3DU5A 5KFTA 5DDRC 4QR1A 2E7WA 3MZIA 1NDPA 2NQPA 4X2BA 1F2HA 3MAAA 2E9RX 2D3UA 2FYXA 1U0SA 3GILA 4K4WA 2R2RA 1LWEB 3CO9A 1YHQS 1VMBA 1S1WB 3V81A 2LDYA 1JLAA 2GA7A 2XLIA 4OI0A 2FJBB 4CH7A 2H54B 3CCTA 3FMBA 2WW8A 1PKUA 3DMJB 2KVQE 5K9FA 1REVA 3M30B 2ZHAA 4LF5J 4CLYA 1HIYA 2CIMA 4KV8B 2WB1D 2MDAA 4WPAA 4B3RF 3IBFB 3NOGA 1VLYA 3OLAA 1PYTA 4PXCA 2XZTB 5C7PA 1LW2B 5DLFA 1FI4A 1S1UA 5L38A 2VQEJ 3O5TB 3RJMB 2O67A 2RMLA 3PV8A 5A8KB 4PWUA 1KD1T 4U96A 3OTOJ 2Z0GA 2H5JB 5KOXA 1HKAA 3Q8VA 3QO9B 3IXQA 4FYVB 2CKWA 4HEA9 3MMBA 1NH8A 4PYAA 2J6UA 3BEGB 1L5UA 2HGNA 3MWBA 1PGZA 5KT5A 4FN5A 3ZNUA 1HHQA 4J9SA 2AYMA 1TELA 3PTWA 4WKYA 1NJIT 4DV4F 4FYWB 1DTTB 3UDEA 4X66F 1HLWA 3RGIA 2G2ZA 2J0WA 3NS6A 3AA9A 2HHQA 4LF5F 4IG0B 4USVA 4YR0A 1OJ4A 2AX0A 3DYAA 5DO2A 1VQNS 2G1DA 2PE8A 1EB0A 2GVZA 2H5EA 1VCTA 3RAXA 2KFNA 2QG9B 4WZQA 5KFJA 1C4AA 4C3KA 2OTJS 4UOFA 2IMWP 2PC6A 3DLLQ 1GXLA 5CD4A 1NO8A 1NB7A 1G7CB 3A3PB 4U9RA 2XG8A 3P5BP 3C46A 4DR2J 1S4FA 2FGOA 5C2GA 3QBCA 4AYBD 3H2UB 7AT1B 3M1VA 4CT9A 4DUYF 5DG7A 4TU7A 4ZVRB 3TI0A 3IR5B 4JV5F 4OYZA 2Q66A 2ALZA 3HJVA 4H54A 1CQNA 3NCRA 5H9FK 2J7UA 3CCES 1UTAA 1K8AT 2X3GA 1SC1B 1IKXA 1FTRA 5HMXA 3B4DA 1AA1B 2PN6A 2WB4A 3OXFA 2RIJA 3SCLE 1NZ8A 3HULA 3WHIA 5HMZA 2XMAA 2X1GA 1FRMA 3W2WA 2CPZA 2F8MA 2MQPA 3HVRA 2MY7A 1OPIA 4X4RA 2AYBA 1CJTA 3J81U 1H38A 3RB4A 5FDLA 5J1NA 3OQ2A 3ONQA 1S79A 5EWGA 2G13A 2F7VA 3NEKA 4DV6J 1CS4B 3FNNA 4WCEQ 3ENAA 2EPIA 3PYEA 1KQKA 4B08A 1UA0A 3VAKA 2P6SA 4JI1F 2ZNZA 2BMBA 1I6JA 4DU8A 2XI2A 1AZSB 1JLCA 5F3TA 2BE9B 4DCJB 3V5RA 3DDIA 2M0GB 2ADBA 4ZPWR 1U09A 3F44A 3AH6A 1HHSA 2KI2A 1NK6A 2M8HA 3H20A 4L3KA 2EK1A 2BABA 2VHGA 1FFGB 1X4EA 2DGVA 1RYSA 4A47A 3NP5A 1TL7A 1RHKB 1T9WA 2G2YA 1DLOB 4YN3B 3CC4S 2KVIA 1FKOA 4NXMJ 5DM7Q 4QIFA 4RU2A 4KJIA 1F3FA 1HQUA 3N5FA 5I3UB 2DHXA 3D1HA 4U95A 1RT1B 3AOAA 5C25A 4QPXA 1DARA 2HRYA 3R27A 3Q8RB 1M1GA 2IBOA 3T1YJ 1S48A 3MM5B 4X64J 1G1XA 2IC3A 1F9EB 1XMBA 2RAQA 4Y34A 2FLPA 1YSJA 5IT4A 1FVQA 3KLGB 2JEGA 4J5OA 3ZZPA 1NPPA 1WG5A 4M5KA 1TL1B 2NSBA 4DN9A 4L72B 4AT1B 1BXNA 4TU8A 1RBLA 1CULA 1Y7PA 4Y00A 1K0TA 1N34J 2KTQA 5GAHI 3BQ0A 3H2LA 1TVRA 3TAMA 2VDHA 5CYQA 3D0IE 1IR1A 2DHAA 2WVEA 3TA0A 1GMWD 4CLZA 5BXIA 4LBPA 1SV5A 5L1IA 1ZBTA 3OVSA 2B8QA 1LV5A 4HTJA 1LFPA 1QJHA 3D9BA 3DOLA 2M52A 4ZA1A 4O3NA 4PQUB 2N4DA 3BPSP 4Q2MA 3IC1A 3N0VA 4PABA 4X4TA 1UPMB 4ETZA 2VG5A 1NDKA 4ZLLA 4PPDA 5DQGA 4C8LA 1CJUB 4X64F 4N47A 4LUBA 5GAGI 3DLHA 3W2VA 3OW2R 2LXFA 1K0VA 1WACA 3L09A 5HAOA 4C4WA 1FNXH 3CCMS 5I42B 2EFPA 2FJDB 5J2MA 4GC6A 4C48A 3IN5A 3L3CA 1T94A 1QAXA 1UFLA 2AJFE 3BV8A 2LU2A 5J2PB 2XS7A 2QIFA 2C1EB 4NL5A 1Q7LB 1SJRA 4IH5A 5LMNF 1N34F 1TKDA 3G2XA 5E41A 3CULA 2LQ9A 4ZN1A 5HVHA 1NH7A 3IRXB 2WTFA 1TK8A 2EBGA 2MZRA 4QWBA 2O1PA 3D67A 4FKXA 3ZFVA 4NLDA 3W3SA 1RE1B 1S1TA 1V5VA 3RB6A 4DR1F 1GMWA 3JS9A 1S76D 3VZHA 5E3CA 2KYXA 3R5GA 3EM1A 2GGPA 2UUCJ 4KGMA 4QR2A 3VGVA 2MJUA 2HPUA 2AP6A 1FRHA 4A8XA 5LMUF 3C6TA 5HJXA 4DF8A 4OYAA 1XMQJ 1D0EA 1L3VA 4TXSA 3BGOP 2GMLA 1R8HA 1UWBA 3MPWA 1HD1A 5A8WA 1VRTB 1D8YA 2FVQA 2KFZA 1N32J 1VOMA 3OD2A 3PIPQ 1RBOB 3IGNA 2R2SA 3E01B 4ZS6A 4QW9A 4KGZB 4I67A 3VAJA 2QSWA 2JRSA 4RW6B 3OHAA 3NGRA 4HACA 1SJQA 5A2QU 3HHLC 2FB0A 3EGVA 4Q5VA 4OX9J 2FLNA 1CG2A 2ZJQQ 4DBQA 1B0VA 1FX4A 2ATCB 3K5LA 3IR7B 1KSPA 4WYLA 3SDEA 1TL3A 4UZCA 2ZEJA 4DWIA 4A46A 2XMMA 2V5HG 2OPRA 4DPOA 3QLHA 4E0DA 3RYLA 2MHNA 2ZWPA 1TAQA 3G6VA 2ZKTA 2A18A 4KO0B 5J1EB 2YNIB 2HNYB 3LP1A 2W7OA 3K0JA 3PO5A 1UCNA 3KG1A 2OELA 2G2OA 1MWQA 4X4SA 1Z1ZA 2NXCA 3C15B 1MNEA 3OR2B 4X4VA 4LMZA 1VJWA 5KFAA 4OX7A 1EX8A 1ACMB 3T1HJ 4W4MA 3M8ZA 1WC3A 1LOUA 3HF5A 1MMNA 5E3AA 3W9JA 2J0QD 4KKOB 1UPPA 3M2VA 2AU0A 3KK3A 2FJAB 2LU1A 1DFDA 4Q0BB 2Y8WA 3SXLA 3G6ES 4USUA 5FIIA 2ZOGA 3KG4A 2BJ8A 2QE5A 5C2CA 1VHIA 3MR3A 2CQPA 2KXHA 3QIPB 1UVKA 2QT7A 3OL8A 3AD7C 4ZVQB 2BOAA 4GRSA 1IKVB 3P6YC 1S0NA 1URRA 5ETNA 1SIZA 3HVTA 1MROB 4P52A 4FS1A 2GZOA 2BDPA 4OLPA 1QM9A 4CH1A 3BGRA 2CWKA 5DS7A 1ITPA 2ZOMA 2V50A 3AY0A 3SQGA 1NBEB 1KHWA 5GMEA 4NX9A 4N5SA 4RWWA 8RUCA 2G0CA 5IT9U 4KBIA 3ZTQA 3GB0A 2MTLA 4WTOB 2CVEA 4CZCA 2QLWA 2QA1A 3TX8A 3ITHA 4Q2LA 4DQIA 1S9EA 2AT1B 3KLEA 2CJYB 2MGZB 2LEPA 3MUMP 4OV1A 4JI0J 4OHYA 9RUBA 4OX8A 1WHWA 4J90A 2OO4A 3PIOQ 3TRGA 2WVFA 4HDHA 2HVZA 3M7VA 4IR1A 3D0GE 3Q89A 3DRPB 2BUNA 4USWA 4N56A 1EARA 2WSFC 2FC8A 1HNIA 3CCQS 3US5A 4X4NA 1UVJA 3B4MA 3T1AA 4WP8A 1PIEA 3NNHA 2BOPA 1S6UA 4KHPJ 4JBCA 4CLSA 1C0UB 1IQTA 2BW7A 1FRXA 4X4PA 4O4GB 3NGSA 3G6YA 2YWEA 3MR2A 2J76E 3CC2S 2VPXB 1BWVA 2UVWA 1SC4B 2OD6A 4CO5A 3CDBA 3DOKA 5F8GA 3B78A 3BKTA 1ZAVA 2BYCA 4DUZJ 3KK1B 2N82B 2Y1LB 3DDKA 1SKWA 3UWTA 3L7OA 3M4XA 5LJ3Y 3CGIA 2JEIA 5LOQA 4NMLA 2J7WA 3UQSA 4ICLB 1HWIA 1S9GA 5KFGA 4LSNB 2YWFA 1EKRA 3GYNA 3OL6A 1JLEA 3QRRA 2HBZB 3HKWA 1HBMA 1U1RA 4ZJLA 4QWCA 2MZJA 2VZ9A 4B02A 2I2YA 4CO0A 1X7VA 2UUWA 1KEKA 4TQRA 5GMDA 1D1UA 2FC9A 4V19J 2Q6BA 2XS5A 3TQEA 4F0MA 2Z56B 4RLEA 3TZYA 2R4FA 2DR8A 2C3PA 2W24A 1NXIA 4NRTA 2DHHA 2EK6A 1YBUA 3CMES 5JVGQ 1P1TA 1AXQA 4IDKB 2CPXA 3RR8A 3PO4A 1FNMA 1ZOTA 2P9CA 2N3LA 5F8LA 1H0HB 2MEWA 4YP3A 2GAHC 5LXRA 2L9DA 1B0TA 1QAIA 4USIA 1F9HA 1GMVA 5D0HA 4WWSA 1DURA 2ZBRA 1HD0A 5F9LA 5ETVA 4GO5X 4RUAA 2IIHA 2YH1A 4XAKA 2VASA 3GE9A 1N0UA 3V4IA 4JI4J 1U2FA 2WBMA 1SH0A 3MM8B 2IA0A 2J6SA 5HSPA 1VBZA 1ZM4A 4P2SA 3KK2A 2XNRA 3W64A 3N6NA 4ECZA 4DPTA 3QGPA 3TO8A 3D2WA 4R8UA 1RWNB 4C11B 2BQUA 3QPIA 2K7JA 3FBEA 2Y1JA 1X5TA 1HWKA 1YJUA 4IO9Q 2LFVA 2XY5A 4B3TF 3SFGA 3ULHA 5CD4H 3KTQA 2E5HA 2DR6A 2X7IA 4ZK7M 4E8UA 4OMFG 1HI8A 2R8IA 4F3MA 2V8VA 1HFEL 1RAAB 1NPRA 4KT0C 1MU2B 4FKYA 4LR9A 1VQ4S 1C2PA 4HT7A 5D3GA 5A8RA 3MD3A 3SCKE 3SI8A 4J9OA 2R8JA 2K7KA 4DV3F 2E9ZA 1FD8A 2OPQB 1HQEB 5HROA 4K59A 4TY8A 4OJ3A 3A8JA 1LK7A 3O8WA 4NCGA 4DMZA 2ZD1B 3JQKA 5ETMA 5IC6B 1NK9A 3NS7B 1R3NA 4NEZA 1RT4A 5J2QA 2W2NP 1CEZA 3MUTP 3X1LB 3KHHA 1AT1B 1HW9A 1VS3A 2OEJA 4ED3A 3N5BA 4I56A 2VFRA 2DBBA 5HVGA 1RT7B 4OYBA 2VDIA 1YJVA 4Y2AA 1CJVB 2RH3A 3V6DB 3GG0A 2UUBJ 2AIRB 3GYGA 3HSDA 4KFBA 3MECB 3VAGA 3BQ2A 3I6PA 5JJBA 3N79A 2W9CA 3LALA 1FD2A 3FEYB 4RW8A 3IWNC 2DNHA 3EUNA 3HT3A 1O8BA 2R7TA 4TLRA 2CQ3A 3GTYX 2F3JA 1QAYA 2Q6CA 4EBEA 4QWDA 2D3OR 4MKVA 2ASDA 2CRLA 4FBTA 3MUVP 1U6ZA 3QMQA 1N36J 4KH1B 3P4UB 1WTBA 1S4EA 2OAUA 5KFZA 3UD3P 5DZ6A 2ACYA 3EPIA 2FJVA 2RDJA 3EMTA 2WBRA 1SL0A 1JJCB 1R0AB 4YHHF 3HVWA 5HN0A 3I4PA 1OPZA 3RG6A 4LVOP 5I3QA 2ZZNA 5F8IA 4NLYA 1SKUB 1HWUA 1H72C 1JLFB 5CYMB 4MK8A 4B3MF 2YNGB 3VCDA 2DGUA 5LL6d 1JLGB 3ZZRA 3A1YG 5T14A 2PI5A 3IGVA 2YY3A 5B0FA 4ZPAA 5AJ3F 2IAJB 4ZOSA 2ZZMA 4IFVB 1KLNA 1HBOA 2B43A 2H4WB 3MEGA 2GNKA 2IJRA 1VBKA 4YY3F 2VPZB 3EPGA 3HD1A 3GWCA 1YDLA 3IO1A 1HNVA 2CUYA 3DOMB 3C3LA 3LA0A 4LF4F 3M8PB 4DR6F 3DRYA 1RLDA 3DM2A 2XULA 2Q79A 1GMUA 2SXLA 4C8NA 1WUUA 3M32A 4M5LA 3DCAA 4ZLJA 1NK4A 1OSDA 1JB0C 2YKAA 2P5VA 4O44A 3L7UA 1Q79A 1FESA 5E2QA 2UVVA 2JFKA 1Q8IA 1HA1A 2DNLA 4XO0A 1YK9A 4O0IA 1RTZA 1RT3A 1YX2A 5F8MA 3ILJA 4IOCQ 5K8OA 3OUYB 2DR5A 3P8BB 3HD2A 3M9MB 4A4JA 2KDOA 3H40A 1MN7A 1RAOA 1BQNB 1YZ6A 2V69A 3CJ5A 1CJKB 5U47A 4PR6A 1N88A 2BVZA 3KNAA 5DDOC 3E3XA 1X4HA 2GJ2A 2HVDA 3LGNA 2Y1RI 4LF7F 3QZ7A 2F9JA 4QPTA 2LQJA 3IRWP 3MM9A 1H98A 1HBUA 5ADZA 1IJEB 3PZPA 1FRJA 1EJ7L 4CH0S 2VA3A 1T9TA 1JKHA 1RA6A 3KLFB 1M1KT 4I69A 1DRZA 4GKJF 1C0TB 3KJFB 5D0RA 4JI7F 3I32A 1MG7A 1S57A 3GCWP 3PW5A 2AD9A 4DX8H 3QAUA 1RCXB 5B08A 2IA6A 2B9EA 4RW9B 2NXJA 3DKDA 1RHRB 3Q22A 3LTOA 1LW0B 4OZ1A 1DTQB 2YPYA 1U45A 2V4JB 3FBBA 4ED6A 3IS9A 4P7VA 3TW0A 2DCLA 2DH7A 4E2FB 4DQQA 1EHWA 4C7QA 2HHXA 2HEKA 5ETSA 3HI9A 2VQFJ 3ZZ0A 4DL2A 3KMSA 1WJ9A 2KN4A 2OLWA 1OYDA 1S7IA 2DY1A 1SJ3P 2DO0A 7FDRA 3HO1A 1N33J 3OHBA 4USHA 4DPYA 1NKBA 1WG4A 3V6JA 3E51A 2HQDA 1W25A 3MTKA 2XCAA 1U24A 2HBYB 2IM3A 4UOGA 1CBKA 2VG6A 4Y6IA 5HP1A 3QRQA 3H98A 3U1NA 2PDAA 3ENQA 5HQLA 4J9KA 1L3SA 4NPOA 1FXDA 2NS1B 3JQMA 1JLBB 2W8LA 2OPPB 2YNHA 4PAAA 5HMWA 1YRTA 2H5IB 5CAAA 2CYYA 1EETB 3F56A 2A1BA 1OYEA 3R5BA 3GG1A 3BM7A 5EUHA 4WE1A 3FKBA 3BSNA 2R7WA 4ZVGA 5KFQA 1YBAA 1RT6B 4HKQA 5ETTA 1S0MA 1N33F 4YMEA 4NLGA 1NJZA 2Z2LA 3D6FB 1TMMA 2W4DA 2QL5B 5KFWA 5KFXA 3HMJG 4OJGA 5AE2A 2ZWOA 4ZVEA 5FD1A 3J7YU 3MMJA 3KUHA 4X65F 3FC9A 3CDEA 3EDQB 3GR1A 3L7PA 4I2QA 4IFYB 2CPDA 4ID5B 2HHVA 4YB1P 3PG9A 2IMOA 4EYIB 4EZ9A 2I8EA 2ZE2B 5B09A 5HI7A 1FK9B 4YB7A 1WC4A 4LFAJ 4JI2F 3Q8YA 3FRYA 3KNGA 1FJCA 4PG8A 1RTDB 2B6AB 3I9V9 2E5LJ 1XR7A 1NZAA 4CQ1A 3WX8A 4P2FA 1IWGA 1LK5A 1P9QC 3ISZA 1FDNA 3N28A 1BMQB 4X4QA 3M8SA 2V8DA 4WXWA 3MEDB 5K14A 2DKOB 3LGMA 5KOWA 3SCJE 3AXMA 4IYQA 2AGOA 5LSOA 3NBPA 2C3YA 3ETOA 3ETMA 4M63A 2V9KA 2LQ8A 1ZS6A 2OEKA 3H4BA 2PGCA 1RI7A 2HNDB 2CFXA 2V9WA 4OYOA 4EBCA 3BZQA 4QIGA 3FFIB 4DG1B 1SH3A 1U1LA 2VIHA 1LWXA 3OVBA 1AYEA 2HBQB 1F3VA 1S99A 1QVGR 4G3IA 5DZ7A 4K4TA 5H9EK 3OLBA 4DCOB 4ECSA 4J91A 2DR9A 4WFZA 1NSKL 3GFZA 4DLEA 3BO3A 3TZZA 4LFAF 3P45B 5KT7A 4U6PA 4WP3A 2CNKB 3DGPB 1HMVB 4CM0A 2VFSA 4IH6A 4CNYA 5BYRA 4DL0C 2ZITA 1FJGJ 1IKWA 3UCZP 1JX4A 1R31A 4KSEB 2L08A 2B9WA 4MYUA 4K4ZA 4G1QA 4NLUA 4K4YA 2JVRA 4DR7F 3PHTA 3V81B 2FUG9 4DV0F 2H65B 2BV3A 3PFOA 4G6VB 4BCAA 5J2NB 2J9EA 2NPIA 1IM4A 2W9AA 3I0RA 3QJPA 1P8GA 4DSLA 3ZZYA 3OFHA 2RKIA 4KHRA 4K7QA 2R7UA 1U7LA 1R89A 2QV6A 1OY9A 4R25A 1REVB 3GSIA 1X0PA 3GIKA 1PAEX 3IA0A 1XMOJ 2V8GA 4C8KA 1RTJA 2W9BB 1WKLA 1D9DA 4ZITA 3NGTA 4RW4B 2HNZB 1CC8A 1RTIA 4Z2XA 2G9OA 1O6XA 1R27B 3KLIB 2HQFA 5HLFA 4I7FA 3G8TA 2R8KA 2W1BA 4QU6A 2E5JA 3MEEA 4MFBB 3MF5A 2PIIA 4P7TA 2VA2A 5CXTA 4DFJA 1Y3JA 4LREA 3T19A 1DQ9A 3GPAA 1HL6A 3IG1A 3LPYA 4ILRA 1X31C 5M2PA 3QRPA 3BREA 1K9MT 3GZ7A 3HX9A 1X0FA 2COLA 1LWEA 3S7RA 4NWBA 2V2QA 2OPSB 1S1WA 3GJQB 2R2UA 1N5YB 4AL6A 4IUFA 2XEXA 1BGXT 4JI8J 4JI5J 2NUHA 3DMJA 3NS5A 3PW0A 1EAYC 5FLXY 2QYCA 3M30A 5SUHA 1S6PB 3L95X 4JV1A 2EG2A 5CA5A 2EWHA 3TJ8A 4KV8A 4BC7A 3OFGA 2A3JA 1VQ8S 1BUXA 3MDFA 3GU0A 4LQ9A 5A0YB 2GO9A 4L73A 3KKFA 4UUXA 1DY3A 4RNNA 1VDHA 2V94A 1P27B 5HQMA 3BQ1A 2KL8A 2MKIA 1MW7A 4C8OA 1JJHA 3SZ2A 2MQMA 1VQ7S 3DLJA 5A8KA 2D7SA 2FD2A 3JYTB 5ETRA 1H2TZ 3UPFA 2D9OA 1FJ7A 3QO9A 5HANA 3QATA 5IWAJ 2ATLA 1UVMA 1I3OB 4R5PB 3R2CJ 1F9FA 1VQMS 2YKPA 4KGKA 4NA2A 2JZ5A 3DLGB 2J9CA 2P6TA 3IP0A 4S0MA 2HW3A 1WOOA 1N0VC 2NZCA 3QWUA 2BM1A 1RTHB 1DTTA 3OL9A 1S12A 4C3MA 2APOA 4I4BA 2ZBQA 3K89A 4ANEA 4CO1A 4C2MA 3G8QA 2IRXA 4NLOA 4ZMMA 2FGCA 4NXNF 2ZVIA 2EKYA 5KT2A 2C2EA 5D4NA 2H3EB 4M5GA 4LFBJ 1NHVA 4LRBA 3PR4A 2KU7A 4AL7A 2ZC3A 6FD1A 3DLEB 5LSRA 3H42A 1GTHA 4NLRA 4OZ5A 3WBZA 1T9YA 2UVUA 4LR8A 1R7IA 3N6MA 3BO4A 2RS8A 3PRVA 2MQQA 4B3SF 4UOHA 2EG1A 1VC5A 1QE1B 2YWGA 2DEJA 4ZPTR 1SUQB 5L9XA 4TVAB 2HHWA 1KC8T 2RRBA 2M8DB 3DLBA 3NGKA 2HHHF 4HHHA 4QZVB 3UW1A 2MKCA 5D4OA 2QA4G 4AXIA 3FK4A 3NCQA 1X4GA 3O6QA 4M5JA 4HLBA 3Q23A 4QIVA 2LCWA 4F02A 3ADAC 1RADB 2X1FA 3TUPA 3CTRA 3SV3A 5KFYA 2M7SA 5F8HA 4RJVA 1RAFB 4KGVB 2DGXA 1S1XB 2Z2YB 1CS4A 1HQ2A 1ZETA 4Q7AA 2UV8A 3MR7A 4Y2CA 1T03A 1UEKA 4M1KA 3D3BJ 1TL5A 3UVJB 2HHTA 5KFIA 1N56A 1AZSA 1UEVA 4XPCA 1QSYA 3I87A 2B9YA 3OJUA 1GX5A 3RB3A 1FE0A 3H0PA 4LIWA 5K8NA 1XNQJ 4ANCA 4P2MA 2BA9A 1IM6A 4ED7A 1VRQC 1KDNA 1WDTA 3VWSA 1A6LA 3LOUA 4DOZA 4C8MA 3BF4A 2EVZA 1DLOA 2X1BA 2FLOA 3S6EA 1JLQB 3I31A 1KKHA 1N54B 1H2VZ 5I3UA 3LANA 2L3MA 2RD5C 5ETPA 1RT1A 4BBYA 1K73T 2YWWA 2NZ4A 2FZGB 3MD1A 4GMKA 2VG5B 1VK8A 2MSSA 3MM5A 2JOQA 2PMWA 1B4SA 5IFMA 5BR8F 2GFFA 3GV8B 2I38A 1PILA 3D1OA 1KFSA 4DV5F 3KLGA 5KT3A 4CLTA 1Y5IB 2Y0SD 3KDNA 2U2FA 3EDRB 2UUTA 4KIAA 1X4CA 2G0JA 2CQDA 1TL1A 3BN7A 2HURA 2JFDA 3X3UA 1HNWJ 3EE3A 3HHNB 1WF0A 2HWHA 4IH7A 1WELA 3OSPA 1ULRA 3BDEA 2MLZA 3UE2A 2QJ3A 3ZNJ1 5A76A 2B7CB 1IBLJ 4ZVPB 2X3DA 4EI2A 3L4BC 1S1VB 5D15A 4KPYA 4BS2A 4DJBA 4OI1A 3KXDA 2DGWA 1S1TB 4N8NA 3QGHA 1UVIA 4USKA 4EUVA 2EFGA 1BE4A 2FY8A 3KYLA 2L9WA 4Z37A 2HFNA 2HG4A 3EGZA 1LFWA 3TUIC 4PQUA 5CCMA 3BSCA 1G4CA 2VONA 2WRMA 4ES2A 1SH2A 3HSZA 4QQBA 1U2RA 2BW2A 1B99A 1CJUA 2ZHOA 4NRUA 3UN5A 2HVIA 2WVCA 3CXCR 2C2RA 1UWBB 4JI6F 5I42A 5CZXA 3Q2TC 2VKZG 2JLFA 2QMUB 1RWKB 1GH8A 4BHQA 1KS2A 5DQHA 3P5TL 1U26A 5J2PA 6FDRA 3G87A 3VGTA 1S49A 2CA9A 1SB6A 2BEFA 1IXKA 2DGTA 3WDOA 3KHLA 2O3DA 1IBLF 1SL1A 1KN6A 1WKKA 3FBCA 5E33A 3IRXA 2NXUA 3G4SS 4URQU 2BKNA 4J9MA 3PRBA 3TQ1A 2FJEB 2EI5A 3ZZUA 2Y0BB 2UP1A 1RZMA 2D3ZA 1IBMJ 2IRYA 1C1BB 4YDXA 1HNXF 4F0KA 1IR2A 3D0HE 2P9GA 2HVEA 1WI8A 2VBXA 1XTZA 2EXUA 4J9QA 1YWXA 4DL6A 2V6AA 3IR6B 4ZCMA 1J5EJ 3POTA 4ID8A 4TY9A 4HHUA 1V6HA 4C0OC 1F1BB 4GVBB 1NKCA 4K5SA 3KWMA 1YITS 1VRTA 1NPKA 1TQLA 1RCOB 2J0SD 4H4OB 1K44A 3KJVB 1DQ8A 3E01A 4YS2A 3C16B 5E7OB 1XJWB 1ZAXA 2JH3A 4DV7J 1SBRA 2XY6A 2PA8D 2V34A 5AE3A 4RW6A 5GAHU 1RWOB 3I56S 3RAQA 2F9DA 3FEZA 2M88A 3MM6A 2RE1A 1GNKA 3RBDA 1ZAWA 4LF8J 5JUMA 4Y2IA 4DV2J 1DJ0A 2VBWA 3HHEA 2XMVA 4FVMA 3I9ZA 4TU9A 2HZVA 2N7YA 3CJSA 3OJSA 1QVFR 3TAPA 1MWYA 1RU2A 4PPZA 1BD6A 3GIJA 4ELTA 3C14B 2YXLA 1TTHB 2FVCA 4MKYA 2E29A 4EGLA 1NK7A 2HK2A 3O1LA 2W4CA 4MIWA 2AJ0A 4KO0A 3G86A 4OJHA 4LQ3A 1OWXA 5J1EA 2YNIA 2MMYA 3A4TA 2HNYA 4DR4J 2DRDA 4I6YA 1DHMA 4CO4A 1TV6B 1GX6A 1M5PC 1ZH5A 4D3HA 3BGRB 3H2VE 2J7KA 3C15A 3OR2A 2MYFA 1U0HB 4FXDA 4MK7A 4DV7F 2XYGB 4A8WA 2P9EA 1NJWA 2E5GA 4KKOA 1AB8A 4RUBA 1ZTWA 2J6TA 4DV2F 3I0SB 1NJYA 1VIXA 3AXKA 2BBEA 4B3RJ 3CD6S 3G8SA 1VFJA 2KRBA 5KFSA 2X51A 2F8EX 3RBEA 3JTPA 3VTIA 3QIPA 4YQWA 3PX4A 1MN9A 1RT5A 5LT5A 1RYRA 2ROEA 3TR5A 4UF4A 3LAKA 1IKVA 2MQOA 1YJNS 2HSEB 2XBPA 1RU1A 3GIIA 2B0GA 1P6TA 5G4DA 1MROA 3RW7A 3MHYA 4J9UE 2YNFB 2YX7A 4DR4F 3DC2A 4DDFA 1HNIB 3CCVS 4ILMA 2DXFA 3CJ4A 4DV1F 2LQ5A 2DTJA 1M5HA 1FJEB 5EGYA 3ELHA 2XSFA 2XM3A 3AOCA 4DV4J 4K8RA 1GTEA 4X66J 4GVLA 1KTVA 5MLCV 4O3PA 3IAS9 1M90T 3CCRS 2DJWA 1NKEA 1TFWA 4DZDA 4ED5A 1VR6A 2KO1A 2PMHA 2RNEA 2AQ4A 1FWPA 3BSOA 5ETLA 1YRXA 3T9NA 3I4HX 2RDIA 1KONA 2MPUA 3M8QB 7FD1A 2DRAA 1JXEA 2GC8A 1L3KA 2EW9A 2CQ4A 2V4RA 3HCXA 3WX4A 4F4KA 2OEMA 1UMJA 4RUHA 1NU4A 2XS2A 4PXBA 4KE5A 3OV7A 4CDIA 2ZH7A 3HHLB 3UD5A 2QSFA 1ELOA 1PSDA 1JLEB 3MPUB 3DRPA 3DRSB 1IQZA 3UNYA 4F2SA 1Q95G 4MIBA 2GV1A 3D68A 3W66A 4DUYJ 2UXDJ 3K5NA 4LF2A 2QRRA 4JV5J 1S97A 2RU9A 2JLEA 2W2OP 3LPEA 1SIWB 1VQYA 3FCVA 3UN3A 1BQMB 2ZH6A 3KHGA 2ASYA 3MTJA 1KVKA 1PBUA 5IM0B 1C0UA 3TEGA 2I6WA 3VVTA 1K1QA 3W65A 4O4GA 4V19X 1HPZA 4DUTA 3G6XA 1M5VC 4U8VA 1VLOA 3HHDA 1SQEA 4ECRA 1VQOS 3QJLA 4K0KF 5GAEI 5HJYA 1HR0F 4NLTA 3KK1A 2VH7A 1AUDA 2L48A 1REGX 1AUSL 2DXDA 1XBWA 3MMAB 2XMKA 3VQSA 4EFAC 4F4YA 1UW4A 5HK4A 2CPEA 4ICLA 3BGUA 4ZHRB 3R97A 2HMIB 3I5AA 3PEHA 4LSNA 1TKTB 2AJ1A 5SZTA 3IM9A 1RT2B 1RJJA 4NASA 1FDDA 4J9LA 1X4AA 5KFCA 2C42A 2UXCF 4CLUA 4JI1J 2CPJA 1TUGB 2YPZA 1D8ZA 3R5AA 1OIAA 2UXDF 1AW0A 1WHVA 3CWJA 5KFDA 2ZHBA 3PEJA 3K5OA 2W7AA 1KOOA 2DB1A 3KK2B 2ASJA 1Q0NA 1FF2A 1U02A 3W60A 5G0RB 2LA4A 3H5YA 3AJDA 2WVBA 3CCZA 1EP4B 4DEZA 2CVIA 1WWHA 3H7HB 4FVCA 4ZJQA 1NLKL 3WIVA 1QSLA 4DN0A 4WIQA 4IDKA 2ZKUA 1UWAA 1LXJA 4FYDA 3A8EA 2VBYA 2RF2B 3ILIA 2EEYA 4CTAB 1IBCB 3SQOP 4DL3A 3HVAA 4LBHA 4IKAA 1KBRA 3HT0A 1X4BA 4FPRA 1M5SA 1N5SA 1WORA 1TUVA 2B4PA 3J7Z5 3BSAA 3UI3A 3J7AN 1PG5B 1X9MA 2IYGA 2MQLA 5HROB 4G1IA 3QGIA 1X5OA 4OYXA 2WSEC 4CLWA 3GFXA 3C6UB 3MM8A 1U6BA 2A6MA 4RBUA 2QLBB 2R3VA 2MZTA 1ICEB 1FXLA 2UXBF 3UCGA 2ZH2A 3TZXA 2ZBCA 2VJUA 1FEHA 2ZC4A 4DL7A 2RU3A 3IWLA 1YJ9S 3CT9A 2GVDB 1NUEA 1XR5A 3LWMA 5THWA 1VBYA 4RW7B 4J9VA 1TKXB 2W9CB 3N6LA 3W5ZA 5I4MA 4WBFA 4P10A 1RISA 4WF9Q 2QLXA 3D6HB 1V3ZA 2QA4S 5KFKA 1MU2A 4ECYA 2I9SA 4NCAA 1SC6A 2E5IA 3KLVA 5BYSA 5IZHA 2IDLA 3A3NB 5D8HB 1ZM2A 4NI2A 2A6OA 1RGVA 2YKMB 4LRFA 1RHQB 3M6UA 3PFEA 3PRDA 2OPQA 1F5BA 1HQEA 5LJ5Y 4OYPA 2BRKA 2GHPA 3LF0A 5DDQC 4AUKA 2ZD1A 1M5KC 3ISND 4J37A 2B5JB 4K4VA 2AWZA 2PA3A 3G82B 2QYGA 2E1CA 3PDNA 1NNDA 3B54A 2JHEA 4ZCIA 1S10A 1WKJA 4F67A 4A8SA 2DH8A 4OX6A 5DM6Q 2J8SA 3SMZA 5CABA 1RT7A 1I5OB 1PYOB 4YUDA 1R6YA 3W9HA 1CJVA 1F6TA 5LMNJ 3V6DA 3EWGA 4P9SA 1WC6A 3MECA 2HRTA 2B9XA 2EFVA 2M5YA 1QUVA 3WIUA 4DR1J 1Z4UA 2IBKA 2DPJA 2ALYB 2FHKA 4YR3A 1VC6A 3JTOA 2HFOA 4HTIA 2AEMA 4ED4A 2XGPA 1UZHA 3K17A 5LMUJ 3JAMY 2BKPA 4ZVSB 4LRCA 3RRGA 4OYIA 1X4FA 3QT6A 5K5MA 3HXMA 1RXOB 3FEXB 2CG4A 3NLCA 2GQCA 1YQHA 2FPHX 4PUOB 4DHVA 1RAGB 4DQPA 1R0AA 2GJFA 2CQIA 3U27A 2XLKA 1FRIA 1RK8A 2AJ2A 2XYPB 2RQ4A 1JLFA 5CYMA 2YNGA 4DR5F 4P73A 1JLGA 4H4KA 3I5CA 2Z4PA 4MK9A 1RABB 4K5RA 1UFWA 2IAJA 2Z57B 3ZTOA 1R0BG 4IFVA 3WZ0A 3BKUA 1VHFA 1G3OA 2CQGA 2K8GA 3PX0A 4K4SA 3TOQA 2PEBA 4L3NA 2FVPA 3DOMA 4IR9A 4TLQA 2JSXA 3CD5A 2VODA 2E7VA 3M8PA 1TKZB 3F0NA 3N9UC 4DR3J 1SKSA 2PSZA 5E0OA 1F2GA 4JOUA 4USTA 5CHCB 4EMDA 1EIYB 4RU9A 2LKZA 1PC5A 3OUYA 2HBRB 2XCPA 3J7YI 4WYWA 2OKQA 1B70B 2XQCA 5T41A 2DGQA 3Q86A 1X8DA 3BKFA 1KHVA 2GIFA 2H1YA 1BQNA 1CJKA 3RBZA 2DITA 1G2EA 1U1QA 2XMWA 2V4QA 2BKOA 2AJ4A 5EX0A 2W2QP 3NGDA 4PYDA 2KT3A 1NJXA 2QX0A 1RWXB 3KLHB 1X5SA 4IOBA 3UCUP 4WXOA 2DIUA 2XGQA 2Q3PA 3CCSS 2NLWA 1FERA 2C3OA 2BM0A 5KFVA 4Z7CA 4C3LA 2CZVC 3QAEA 4DR3F 3M2RB 4NLSA 1SQFA 2CQBA 3HZGA 4DPXA 2IJFA 5H9FJ 2YQ1A 1C0TA 3QT7A 5D4PA 4RWXA 2VG6B 2MLXA 5HP1B 1ZPVA 4B9MA 2NXEA 2NYIA 1PCAA 4QOTA 2OTLS 1FFWB 4OZ2A 3U1MA 2PT0A 3T5HA 2A0FB 1ZPWX 1W2BR 1B7YB 4GKKF 3LH2S 1FTCA 1LKZA 1LW0A 3L9ZA 4BWMA 1DTQA 3MMCB 1RB0A 4NE9C 1DQAA 4CI0B 4U7UD 3SSRA 1KQGB 2BANB 4IRKA 3D54A 2DISA 2UU9F 2RUSA 3LO3A 2ZBIA 2DH9A 2Y3YA 1SJ1A 3RUBL 2KZMA 4NCBA 3NAIA 4EEYA
chains in the Genus database with same CATH topology
2X1GA 3PKYA 2PI4A 1FRMA 1P8GA 3HPOA 3W2WA 4DSLA 3MFHA 3K7RA 3ZZYA 3K8WA 2CPZA 2DNOA 2F8MA 2GGPB 3OFHA 2RKIA 2MQPA 4KHRA 3HVRA 2MY7A 1OPIA 1U7LA 2GJIA 4X4RA 1R89A 2AYBA 2FY1A 2QV6A 2HYIB 2OFHX 1H38A 3RB4A 4MMOA 4R25A 5DGBA 1REVB 1X0PA 3C6TB 3GIKA 5FDLA 5J1NA 3OQ2A 3ONQA 3IA0A 5CQGA 3NRBA 1S79A 2V8GA 2B4UA 4C8KA 5EWGA 3EZ5A 1N36F 1RTJA 4PG4A 2G13A 2W9BB 1D9DA 3BO2A 2OSRA 4PRFA 2F7VA 2N3OA 1IN0A 2YKNB 3OSNA 3FNNA 4RW4B 1G6BA 2HNZB 1CC8A 1GXTA 1RTIA 5DGAA 1KOHA 2G9OA 4Z2XA 4WCEQ 1R27B 4ZP7A 3FQLA 2MB0B 4Q43A 2EPIA 4OZ0A 3KLIB 5KT6A 5A8WB 1KQKA 4B08A 5HLFA 3DLKB 4I7FA 1UA0A 3BR9A 1JLBA 3VAKA 3G8TA 2R8KA 4QU6A 2P6SA 2E5JA 5L8RC 3CIZA 3MEEA 4MFBB 2OPPA 2PIIA 3MF5A 4P7TA 1U4BA 4JI1F 2VA2A 2IVYA 1QY7A 2FHJD 1I94F 2ZNZA 5CXTA 3CCUS 1D9AA 1Y3JA 4DFJA 1UJ4A 2ZH4A 4NA3A 1I6JA 2K2PA 1DQ9A 3T19A 4PUOA 2XI2A 1WEXA 5IQQA 4PG5A 1HL6A 3IG1A 3LPYA 3BS9A 4ILRA 3ZZZA 4FNHA 4O23A 3MCSA 1JLCA 5M2PA 5EN1A 1N5QA 2ADCA 4H4MB 2CJ9A 5F3TA 3V5RA 2UV8G 1RKIA 1EETA 4FP9A 4X4UA 2ZH9A 1T05A 2KXNB 2M0GB 2ADBA 3BREA 1K9MT 3GZ7A 1VRUB 4XK8C 4DSFA 3HX9A 1X0FA 2COLA 2OH2A 4ZPWR 1WTFA 1LWEA 4MTPA 1U09A 3F44A 2KYZA 3S7RA 4NWBA 3AH6A 2OPSB 1S1WA 2QMXA 3FZBA 2R2UA 1HHSA 2AV5A 2KI2A 2VB6A 2POKA 1N5YB 4AL6A 4B9UA 1NK6A 2A10A 2M8HA 3H20A 4IUFA 2E1RA 2XEXA 1BGXT 1RT6A 5KFUA 2E44A 2EK1A 2NUHA 2XSJB 2BABA 3SDEB 3UFCX 1TL3B 4ZCKA 1X4EA 3DMJA 4QJVA 3NS5A 3PW0A 1U6FA 2DGVA 1RYSA 1FEEA 3HK2A 5AXLA 3U7JA 4A47A 3NP5A 3ICLA 1SXLA 5ITHA 4ECTA 2XHWA 4CNZA 5FLXY 2QYCA 3M30A 5SUHA 3MXHP 2XWYA 5EX3A 1DLOB 1NHUA 2OPRB 2KVIA 3CC4S 1S6PB 1FKOA 3GFYA 3QLHB 3L95X 4JV1A 2EG2A 3CSKA 5CA5A 3T5JA 5DM7Q 1VI7A 2HS3A 4QIFA 5A6PA 4RU2A 1WNEA 4KJIA 2EWHA 1T3NA 2LMIA 4ZDNA 4A8MP 1HQUA 3N5FA 1UAWA 4KV8A 1KQSR 4YEAA 4BC7A 3TAQA 3OFGA 2HWIA 4IQMA 4LF9F 5I3UB 2DHXA 2OD4A 2A3JA 3D1HA 1VQ8S 2KFYA 1TKZA 1U1NA 3LP1B 3MDFA 2LDIA 2F1FA 2ZFHA 2DNRA 2F4VF 1RT1B 5DRKA 2VUGA 4LQ9A 2W4PA 5A0YB 2LECA 2GO9A 3KKFA 4UUXA 4PXEA 2HQIA 1WEZA 4RNNA 1YJWS 2V94A 1P27B 3BQ1A 5C25A 2WHOA 4QPXA 1DARA 2HRYA 3R27A 1N5TA 3JSMB 2UVRA 2MKIA 1MW7A 3Q8RB 2IBOA 5D4LA 4ECWA 4C8OA 4O3SA 2B4VA 1JJHA 3TVKA 2R7VA 1S48A 3PR5B 3MM5B 4ID5A 4NYZA 2KG0A 2MQMA 1VIOA 2I0XA 5D6GA 3SZ2A 4YFUA 1R43A 1VQ7S 5HQ8A 1G1XA 2IC3A 1XMBA 3EGNA 3IFEA 3DLJA 5A8KA 2HFZA 2U1AA 5DG9A 3GV7B 3T5LA 5A2QY 2D7SA 2DNZA 2FD2A 4Y34A 2CPYA 3JYTB 1OO0B 3K2YA 4NYPA 2E9TA 1H2TZ 3UPFA 4IRCA 3FVYA 2FLPA 3K58A 2ZE2A 1IKYB 1YSJA 2D9OA 1FVQA 5IT4A 3KLGB 2JEGA 2UUAF 1FJ7A 3QO9A 1FK9A 2ATLA 1UVMA 3M2VB 2XC9A 4R5PB 3CEDA 3FSXA 4J5OA 4X84A 3SSSA 3ZZPA 1F9FA 1VQMS 1VQPS 3KK3B 1WG5A 1RTDA 3FQKA 2YKPA 3PM9A 4KGKA 4NA2A 1TL1B 2KKHA 2JZ5A 3DLGB 2B6AA 3K8VA 4WU2A 5DETA 1F5CA 2J9CA 2NSBA 3OTBA 3R5DA 1H7XA 2P6TA 1D9FA 2HW3A 1A7GE 4DN9A 4B3OB 5DJBA 4L72B 2N4CA 1N0VC 3DDNA 4TU8A 1Y7PA 1SKRA 4Y00A 4O3QA 1K0TA 3QWUA 2BM1A 2KTQA 1RTHB 1DTTA 5K8PA 2RQCA 1Y00A 5GAHI 3OL9A 1JNZB 3BQ0A 3H2LA 2QFJA 4ECUA 1TVRA 2RUGA 5CCLA 3TAMA 3MEDA 5CYQA 2JEFA 1S0VA 3D0IE 3KLHA 2DHAA 3TA0A 4JYAF 3OTDA 5GAGU 2J9DE 2VPWB 4C3MA 1Y5LB 2A2CA 1PO6A 2APOA 3V2UC 4I4BA 4ZKAA 4PKDB 4KTQA 4I68A 4CO1A 1SV5A 3HVTB 1ZBTA 4C2MA 3OVSA 3Q8SB 5L1IA 1BWEA 3CDWA 3G8QA 4HTJA 1LV5A 1LFPA 5F0WA 1QJHA 2IRXA 4NLOA 3DOLA 2HNDA 4ZMMA 2XWXA 1N52B 5EDWA 2M52A 2FGCA 4J9NA 5KFBA 3M2RA 4ZA1A 4NXNF 4O3NA 1U1KA 4PQUB 2N4DA 4ED0A 4Q2MA 1WHXA 2EKYA 3IC1A 3N0VA 3OXGA 1YJTA 4X4TA 1TAUA 4OHVA 5KT2A 2L9NA 5HBMB 5GADU 3FFIA 4PCQA 2C2EA 1JJ4A 4ETZA 4DG1A 3FJ2A 2DK2A 2VG5A 5KFRA 5D4NA 3HHKA 2KXFA 4PPDA 5DQGA 2XB2D 3SQGB 4A48A 5KG0A 4C8LA 4X64F 1NHVA 4N47A 4LUBA 3O44A 4GO7X 3W2VA 5GAGI 3DLHA 3OW2R 4N41A 3MGJA 4EYHB 3CB4A 3R3TA 2LXFA 3PR4A 1K0VA 2JX2A 1RAJA 2KU7A 4RNHA 1KLMB 1WACA 3L09A 1WF1A 4AL7A 4C4WA 2MKJA 2ZC3A 1Z2LA 1FNXH 6FD1A 3CCMS 3R1HA 5I42B 3Q8QB 5HLFB 1OQ3A 3DLEB 4HYKA 2ZDPA 2EFPA 3PJXA 5LSRA 2FJDB 5J2MA 4GC6A 4N76A 1JNRB 1GTHA 2D74B 4ZPDA 3IN5A 3L3CA 2DGSA 4NLRA 4OZ5A 3WBZA 1T94A 4O4RA 1QAXA 1UFLA 2RB7A 3CJ0A 3DGPA 2UVUA 1HMVA 2GMHA 4ELVA 2AJFE 3ITHB 3MMCA 2HIQA 1R7IA 1VBXA 2LU2A 1S9EB 2OJ3A 2EFOA 4Y65A 5J2PB 5GADI 4Q0BA 3MI7X 2XS7A 2QIFA 4NL5A 3NMRA 3N6MA 1Q7LB 3IG1B 2C22A 3SCIE 3BO4A 2RS8A 5M2RA 3KLEB 1SJRA 4IH5A 2MQQA 5GVQA 3KOAA 1RP5A 2OMLA 5LMNF 4B3SF 1B7FA 5IT0A 1N34F 2BANA 1TKDA 5E41A 2EG1A 1VC5A 1QE1B 2YWGA 3CULA 2E7XA 2LQ9A 4ZPTR 1SUQB 5L9XA 2GIRA 1T05B 2HHWA 2HAIA 4ATNA 1U1OA 2RRBA 1KC8T 1NH7A 2VQFF 3IRXB 2M8DB 2WTFA 1TK8A 2EBGA 2MZRA 4QWBA 2O1PA 3DLBA 3NGKA 5L1KA 1Y9OA 5B0BA 2HHHF 3T6BA 3ZFVA 2CDQA 4QZVB 3UW1A 2YWHA 4NLDA 4OZJA 5J2NA 3W3SA 1NAQA 1S1TA 3RB6A 2MKCA 4P6QA 5D4OA 4DR1F 2QA4G 2EBEA 1B64A 2DT9A 4AXIA 2FDNA 1S76D 2NSCA 3VZHA 5HMYA 1HNZF 4FXWA 5E3CA 4AXJA 2CQ0A 2B4OA 1X4GA 3NCQA 2KYXA 3O6QA 5D77A 4HLBA 2GGPA 2DNKA 4CO3A 4KGMA 4QR2A 2ROGA