1F9FA

Crystal structure of the hpv-18 e2 dna-binding domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
76
Chain Sequence
b'HMTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMTM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein E2
publication title The structural basis of DNA target discrimination by papillomavirus E2 proteins.
pubmed doi rcsb
source organism Human papillomavirus type 18
molecule tags Transcription
total genus 21
structure length 76
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f9fA00
1H6KX 2AYMA 4YUDA 3BO3A 1SJRA 1YJ9S 2N3OA 3NNHA 3L3CA 2KVIA 2XNQA 2DNZA 2MSSA 4ED5A 1VC5A 2M8HA 2CQGA 3UE2A 4M5DB 2QA4S 1D8ZA 2MSTA 3I56S 1WHWA 5LSOA 1U1MA 2MKSA 2CQ2A 4ERDA 2VODA 1YJWS 2N82B 1YIJS 2LEAA 1JJ4A 4WIIA 1FJEB 3HI9A 2XSFA 4QQBA 1M90T 1X5SA 2X1BA 1X4CA 2DISA 2DNHA 2RRAA 1VQ5S 5D77A 1H2UX 1K73T 1DRZA 1SJ4P 3SXLA 3TYTA 3RW6A 2YWKA 2M7SA 2E44A 3CMAS 3CPWR 2FC9A 3NS6A 2HYIB 3R1LA 1WF0A 2CPEA 4BS2A 2J76E 5IFMA 2KN4A 4U67Q 5DM6Q 1NU4A 3RW7A 2GHPA 3V4MA 4YB1P 5LJ3Y 1ZZNA 4FXVA 1X5PA 3VF0B 2KM8B 2YH0A 2CQIA 2ADCA 2MQOA 3CC4S 3THPA 2CJKA 3S01A 2M70A 1W2BR 1CVJA 1URNA 1D9AA 2YH1A 2RVJA 2MKHA 1VQPS 3P6YC 4WFNQ 3MURP 3IWNC 1NO8A 3SDEB 2RS2A 3G9CA 2MJNA 1DBDA 1A7GE 1P1TA 2U1AA 1U6FA 2RU3A 2ZJQQ 2QEXS 4IO9Q 3J7YU 1QVGR 3UCGA 2PE8A 2M88A 1FJCA 2QFJA 1M5PC 2CQCA 2LQ5A 1VQ4S 3MI7X 1ZZFA 2RNEA 2G4BA 3UD3P 3BS9A 3EX7B 2D3OR 3S6EA 3U1LA 1H2TZ 5CA5A 2MGZA 2DGSA 3CCSS 5DDOC 5CYJA 3CCLS 2MQPA 3B4MA 2MKKA 5H1SV 1HD1A 2E5IA 1B7FA 5LJ5Y 2Q79A 2XB2D 3MD3A 2UP1A 2XS2A 4W90B 1X4AA 3MD1A 1S72S 2RT3A 4WKRA 3CULA 3G96A 4UY8T 4F26A 1VBZA 2CPZA 3D2WA 4ZKAA 2GO9A 1X0FA 1WHYA 2YKAA 1YHQS 4WCEQ 4Z2XA 2SXLA 4PRFA 2KYXA 3S7RA 2DIUA 2MQQA 2OTLS 5LXRA 2DHXA 1WEZA 2CQDA 2HVZA 2CPFA 2WBRA 1S79A 2G0CA 2AYGA 2CPDA 1WI8A 4YOEA 2JVOA 2MZRA 2CPHA 2KXFA 5DDQC 2M9KA 2OSQA 4PKDB 2FHOB 2HGLA 1VQOS 4TU8A 1VQNS 1VQ7S 2I38A 3MDFA 3FEYB 5GAEU 3CMES 1M5OC 4LIRA 2FC8A 3PIOQ 1FXLA 2DITA 3MUTP 3CC7S 3MUMP 3EGZA 3G4SS 2K8GA 2LXUA 3B4DA 2B0GA 2L08A 1O0PA 1IQTA 2M0GB 5EN1A 2OJ3A 2FPHX 1YWXA 3OW2R 2CQ0A 3G6ES 2DGUA 2DNRA 2AD9A 3UWTA 1DHMA 1U1LA 2F9DA 1AUDA 3MUVP 1A9NB 2DHAA 3UD4P 2X1FA 3CCES 2KI2A 1YI2S 3Q2TC 2KG1A 1Q81T 2DGQA 2J8AA 2MKJA 2DIVA 2DH8A 4WFBQ 2D9OA 2U2FA 2HGMA 2MY7A 2M52A 2LEBA 4EGLA 2I2YA 2X1AA 2L9WA 5IM0A 1FNXH 4CH0S 4UQTA 1VC6A 3CD6S 1UFWA 2DNPA 1H2VZ 1FHTA 2CQ1A 2XS5A 4FXWA 2DNKA 2DHSA 2E5GA 4V19X 4J5OA 3TP2A 3K0JA 3CCJS 2LKZA 2EK1A 2BOPA 1UAWA 4WFAQ 2N7CA 1JMTA 2K3KA 3NS5A 1N52B 2KHCA 2JVRA 2DNYA 2V94A 1FO1A 1F9FA 2LCWA 5CXTA 3HHNB 2KT5A 2J0SD 2EK6A 1G2EA 1KOOA 3S8SA 5DETA 5HL7Q 2CPJA 2VONA 3VAIA 2G1DA 3H2UB 1XN9A 2A3JA 2DGTA 2KH9A 5FJ4A 2MZTA 1WELA 2JWNA 2DH9A 1P27B 2PEHA 1M5KC 1K9MT 2DNLA 2VOOA 2MMYA 2XNRA 2LXIA 1Q86T 1VQMS 2MKCA 4LJMA 3VAKA 5DDRC 3CXCR 1SJ3P 4F25A 2CQ3A 2YTCA 1M5VC 2E5HA 1WHVA 2EVZA 1VQ8S 2DH7A 3BO4A 3VALA 2MGZB 5D78A 3UCZP 3JB9k 2HZCA 1RKJA 1NJIT 2LECA 1U1OA 2XS7A 5IQQA 2DO0A 1YJNS 1Q82T 3THTA 1X4DA 2AYEA 3G8SA 1FT8A 1X4EA 3CCQS 3CCUS 3TO8A 1QM9A 2DNMA 1U1NA 2DHGA 2E5JA 4C4WA 1HD0A 1PO6A 1ZH5A 2CPIA 2NLWA 1N54B 4OZ1A 2CQHA 1PGZA 1YTYA 3NNCA 2ZJPQ 1SJQA 4PR6A 2BZ2A 1N8RT 2DO4A 1X4GA 3ZZYA 5JVGQ 1UW4A 3J7ZT 2CQBA 2MQMA 3G71S 2ERRA 2KFYA 2KG0A 1WWHA 5GAHU 1WF2A 1WG1A 2MXYA 4CIOA 3DLLQ 4IUFA 2ZJRQ 2LA4A 3CC2S 2MHNA 2MKIA 1U6BA 3NMRA 5ITHA 2RQCA 3MXHP 3VAJA 2KU7A 4A8XA 3SDEA 4LMZA 4W92B 1L3KA 4CQ1A 3BO2A 2AYBA 1N88A 5DM7Q 3NNAA 1X4BA 1WG4A 3EGNA 2J0QD 2ADBA 4P6QA 3FEXB 2DNNA 2DNQA 3N9UC 3CF5Q 5GVQA 1UP1A 3SMZA 2F3JA 5DDPC 1U1KA 2M4MA 2DNGA 4IOCQ 3U1MA 2LMIA 2KXHA 2X1GA 3P3DA 2MPUA 1YITS 1VBXA 2DB1A 2KRRA 3UCUP 1X5TA 4TU7A 3VAMA 1WEYA 1KOHA 1HL6A 4TU9A 1VQKS 2MZQA 1VQLS 2OIHA 5GADU 1K8AT 2MZJA 4WF9Q 4QU7A 3MOJB 1R8HA 1WI6A 1X4FA 2RQ4A 3ZZZA 3CUNA 1WHXA 3LPYA 2DNOA 2KXNB 1U2FA 4QU6A 3US5A 1HA1A 5GAGU 1FJ7A 1X4HA 3R27A 2OTJS 2M2BA 1KD1T 2DGXA 2JX2A 3BEGB 2MZ1A 1JJ2R 4RU2A 2DGVA 5HO4A 5MLCV 1U1RA 2VOPA 1JJHA 3LQVA 3R1HA 2DK2A 2HGNA 3IRWP 1OPIA 1X5OA 3CTRA 4F02A 1WTBA 2MY8A 4C0OC 1DZ5A 1U1PA 1OWXA 4TLQA 3CCMS 2MQLA 2LA6A 3DXBA 2CPYA 4CH1A 1Q7YT 3CCRS 4C7QA 2MZSA 5IM0B 1WEXA 2CQ4A 2F9JA 3CCVS 5LSLA 2KM8C 2RS8A 1VQ9S 1VBYA 1KQSR 4IOAQ 1VC0A 1OO0B 2DGOA 4OZ0A 5BJRA 1WG5A 3P49B 3H2VE 5GMKa 3VAGA 5LXYA 2NZ4A 4Y0FA 3PIPQ 3VAHA 2M8DB 1R8PA 2CQPA 2FY1A 2LYVA 1OIAA 2RUGA 2DGWA 2MB0B 3VAFA 2KRBA 1BY9A 3I55S 1KC8T 2D9PA 2MQNA 2O3DA 5JVHQ 1U1QA 1WF1A 3ULHA 1VQ6S 3Q2SC 1SJFA 2RRBA 4Y00A 1M1KT 3P5TL 1RK8A 4QPTA 2MYFA 2OSRA 2MJUA 2CPXA 3G8TA 2N3LA 2L41A 2JRSA 1SXLA 1QVFR
chains in the Genus database with same CATH superfamily
3C6TB 1LK7A 4M63A 3I0RA 3M30A 1SB6A 1VC5A 3JSMA 2B9YA 5ADZA 2HFOA 3KXDA 4TLRA 2MKSA 4HI1A 4MFBB 5IOLA 3LGNA 3CE8A 5F9LA 5KFQA 1AT1B 4OYXA 1NK5A 1UEKA 2NPFA 2VG6A 2XYHB 1U6ZA 3HHLC 2AGQA 3ILOA 2XYGB 2E44A 3CPWR 2ZVIA 3LW5C 4C0HA 4LF2A 4FS1A 3UVJA 1ZZNA 2DR6A 5FLXU 3MEEB 4ED8A 4X64J 2UU9F 4X62J 4LR9A 3IBFB 3KWMA 1KWMA 3MF5A 3W2WA 4FXDA 1P1TA 4QWEA 5HMWA 1TMJA 4AFFA 1WOSA 2RNEA 3GWCA 1U4BA 3MWBA 1TL4A 1URRA 5THWA 1HNIA 4R8UA 2Z8QA 4UY85 2Y1RI 2UUBF 3EDRB 2XSJA 2FZKB 2AJQA 2FYXA 1Y10A 4W90B 1N6QB 5KFDA 3QFHA 2WOMB 4EFAC 2CAJA 4I64A 1Y3KA 1JXLA 2PI4A 2PI5A 4Z2XA 3KUGA 2ZNYA 1WORA 5HVHA 4J90A 3PV8A 1D0EA 1NBEB 2YNIB 4HT7A 3DOKA 4WYWA 2JVOA 1T9YA 1XERA 2CZVC 2WVEA 2FZGB 4Q0BB 4J9MA 1LWCB 3T5HA 5E41A 9ATCB 4LIRA 1V6HA 1UVJA 2EFGA 4YR0A 2GV1A 1QDUB 3ZZRA 3B4DA 5DGAA 1V3SA 3QSYB 4IYQA 2I6WA 2W8KA 2W9CA 1JXVA 3KDOA 4H4MB 3MAHA 3Q8UA 5D4PA 1CJVA 4FPIA 2ASJA 5HLFB 4OQJA 2DGQA 1O5JA 1J5OA 3QLHA 2X1AA 4DEZA 3EICA 4UQTA 1VC6A 1S1XA 5H9FJ 4RW6B 4R25A 1EKSA 3H7HB 4DG1A 4ECUA 3PYGA 3DXSX 1W7WA 1JMTA 3NY0A 1SH3A 4KHPF 3EZUA 3DOLB 2I5JB 1HQUA 1HWIA 3NG8A 3W65A 3PYEA 3S8SA 3AB4B 4RW7B 3QT5A 2B5JB 4ETZA 2MZTA 1WELA 2FHJD 1RE1B 5B0CA 4OI2A 5ETKA 5EX0A 4I1TA 1RWMB 1K9MT 2NYHA 1SKSA 3JYTA 2MKCA 1T0TV 2E5LF 1RT5B 3GIIA 1NRKA 2C2DA 2RH3A 4CO5A 3VVTA 2XZTB 1S6UA 3W8PA 1B7YB 2CDRB 3KLHB 2DNMA 2J9EA 3LP1A 2IHR1 2NLWA 4LT6A 1C1CB 3P8BB 1X4GA 4O3NA 2RF2A 4URQU 2QT7A 1ROFA 3BO2A 5C5JA 3PG9A 1NAQA 2RQKA 3E2EA 1TL7A 3W7BA 4DWIA 1MWZA 2HURA 2KXHA 3QWPA 2X1GA 3IXQA 1JLGA 1D09B 4LIWA 3KLFA 4QOTA 5A0YB 4OI6A 1RISA 4C98A 1LWEA 1NMEB 2OIHA 1HLWA 2ZBRA 1K8AT 4OLOA 3MR7A 1HWKA 5ETOA 1HBMB 1WI6A 2RQ4A 2Y3YA 2QSFA 3OHBA 3P96A 1D1UA 2KKHA 1CS4B 2UU9J 2ZHOA 3SV4A 2M2BA 4ED6A 4ZS6A 4BC7A 2VOPA 4UOHA 5I3UA 1IKYA 2EC0A 3MTKA 3RRKA 1FRKA 3B8HA 2PFFB 5KAKA 3IBWA 1WD6A 2E9RX 3OR2B 3OD2A 2UUBJ 1M1GA 5BYQA 2FY1A 4PXCA 1ZTTA 4NOHA 3TJAA 2D9PA 4OFZA 4LVNP 3SSRA 2VG7B 1UFKA 1YGYA 3TWZA 3GPAA 2QC3A 4DR7F 1F6TA 2GJFA 1NM2A 4FN5A 4YUDA 2AGOA 5DRKA 2N3OA 2HNZB 4N8OA 3AOAA 2CQGA 3BR8A 3KDNA 1IM4A 4A47A 1ZA2B 2EFVA 1WHWA 3BDPA 2W4PA 1S97A 3DLGA 4XO0A 1S0VA 2HRTA 4ZIVA 2E9ZA 3DOMA 2XMUA 3CMAS 2C3PA 3JSRA 2XMWA 2R8IA 2IM0A 1KQFB 1KKHA 1UVMA 5H9FK 1KFDA 1DQ8A 4NWBA 1RWUA 2ZBQA 2YVSA 3C19A 4ED1A 3HSZA 1IR1A 3KLGB 3BDEA 1D9AA 2G1HA 1WKKA 5GMEA 2RS2A 4DR1F 4XK8C 2CRLA 1RWVB 4USIA 2UXCJ 1OY6A 3TZZA 4K2XA 2OGUA 3NBPA 1JKHB 1YX2A 3UD3P 2GCFA 2V69A 3IN5A 2HWHA 3FFIB 5B0GA 1IR0A 3ZNJ1 3FBCA 2ZH4A 1LW0B 2GQ2A 3EZ5A 3WX8A 2ATCB 3CCLS 3R2CJ 2Q79A 4KHPJ 2W1BA 1IXKA 2OFGX 4OZ3A 1NSKL 3T6JA 1ZPVA 4PRFA 5LL6d 2J9DA 3S7RA 2MQQA 4ZDNA 3K17A 1CJTA 2E5LJ 4F4KA 3C6UB 2AYGA 1S0OA 3T5KA 4YOEA 3WBZA 1DTQB 2OSQA 2GC8A 2BRKA 4KV8B 2HHQA 2Z30B 2C42A 4M5HA 3ZTOA 2ZH8A 4UUWA 1REVB 1NDPA 5CCLA 1BGXT 5DZ7A 4ZVTB 1GXTA 3HSGA 5EN1A 3W9IA 3E01A 5ETQA 3BN4A 2AD9A 2LP4A 3AB2B 2DTJA 1T8EA 3UFCX 1FEEA 1HYSA 1XMBA 4DZ6A 2HFSA 2MKJA 1FDBA 2FJAB 1MNEA 3V81B 2EPIA 1X7VA 3CO9A 1SUQA 3NCRA 2C2NA 1S0NA 3E3XA 2GHVC 3SSSA 2DNKA 3D5MA 3K0JA 2LKZA 5EX3A 2R8GA 1IWGA 4OI3A 5SUHA 4F0HA 4GMKA 4MK8A 3GIJA 1K0VA 2A2DA 5DETA 4IG3B 3GE9A 2DGTA 4BHQA 1SC1B 3NGSA 8ATCB 3HHKA 3QO9B 2FVSA 3V5RA 3IO1A 2BACA 2W4DA 3FZ2A 1UWBB 4USWA 2M3DA 3VALA 3K5LA 2YKMA 5J2MA 2A6OA 5CH7B 3IR7B 4MH8A 4JP8A 1X4DA 3CCQS 2BE2B 3LTOA 2E5JA 1PO6A 1QY7A 4DR7J 2JJ4D 3DNCA 2IC3A 1H73A 3MM7B 3J7ZT 7AT1B 4GKJF 3R8YA 3PKMA 2EFOA 3V6KA 4CQ1A 4CLSA 2ZH6A 4IH7A 2CJAA 2C2RA 3TAMA 3EGNA 3TZYA 4PXEA 1L3TA 3DI6B 4CLTA 4IG0A 3PR5B 2W2PP 2RUSA 4IOCQ 4LRCA 1QSYA 4YDDB 5K9FA 4U7CA 2XMVA 1X5TA 3TQ1A 1LWFA 3M6UA 1UA0A 4ECZA 3RU0A 2NXCA 1UVLA 1TAUA 2EBGA 4YR3A 1SL2A 4B3MJ 1T9VA 2DY9A 3A8EA 2YKNA 3LPYA 1JLFA 3TUZC 4Y34A 2GMLA 3ZNUA 3EXCX 4TY8B 2NXNA 4DR1J 2DGXA 3G86A 1JJ2R 5F8GA 4DUZF 4NXMF 4HI2A 5EUHA 3IRWP 1F2HA 3Q89A 2ABYA 2MQLA 3AJ2A 2F8EX 2EKNA 2NSBA 3GG0A 3OJUA 4DQRA 5KFWA 3R97A 4BWMA 3DRSA 2D41A 1T9UA 1MW7A 2HS3A 1RT6A 3VAFA 1IKXA 3I55S 2P9CA 4DV7F 3C2PA 2QX0A 1SJFA 2RRBA 2N3LA 1T7PA 4PUOA 1HQEB 3W5YA 1NDLA 4MKBA 2QZ8A 4IH6A 3W60A 2ROEA 3NNHA 2V9WA 1VHFA 4NCGB 2XNQA 3UE2A 1KQGB 2IA0A 3KMQA 4QPXA 2OPRB 3HCXA 3BM7A 3PJ9A 3C16B 2AZ3A 4WIIA 1JLEB 1X5SA 3K5PA 3BH6B 4RW4A 2VA2A 3H5UA 4ZLLA 1LWXA 1WJ9A 2VQEF 5L8RC 3KUHA 1NLKL 1WF0A 4G6VB 2VG5B 1U2CA 5A8KB 4DSKA 3M8YA 1OQ6A 4KR0B 1VOMA 2CYYA 2ASDA 5B0BA 4NLQA 3G8QA 3KJFB 2OLWA 2OMOA 1HBOA 8AT1B 2CVEA 1W2BR 3ITHB 2HK2A 3UR3C 4W4MA 3KOAA 3BR9A 2CG4A 4LSNB 2PMZD 2MQ8A 2WB4A 4PG6A 1VR6A 4X4UA 1G4CA 2E7WA 4OHVA 3J7YU 1M1HA 1TL3B 2K1RA 2YPYA 2FLPA 1S4EA 3MEDA 4KIAA 4CLZA 3RZAA 3EX7B 2HNDB 3D6HB 1FK9A 4F8RA 1MMNA 3RGIA 4QJVA 4PZVA 3F0NA 4C8OA 3NKYA 2RT3A 3EGWB 5F9NA 2XBPA 1HHQA 1EP4B 1IWAA 3QGPA 4TQSA 1FNMA 3RBDA 2IDEA 3C14B 3DRRB 3DU6A 3CVKA 4ECTA 2BJEA 1AROP 1S1TB 3HPOA 1N56A 2MZRA 2E7VA 2YWWA 3AFGA 2M9KA 3IRXA 1NK7A 4TU8A 1XR6A 1WC6A 4F3OA 3T5LA 1VISA 5L1IA 2BV3A 3CMES 1M5OC 5E3QA 2VIHA 1NSPA 2DITA 3MUTP 1B70B 4PPZA 3TRGA 3MFIA 5FDLA 2B0GA 3LANA 5L39A 2ZVSA 4Q45A 4GKJJ 4MK9A 3OW2R 2CQ0A 3KUEA 1DHMA 5EWFA 3MPWA 4RJVA 4ED0A 4U8YA 1NHVA 4HH0A 2XULA 4J9RA 1TTHB 2DH8A 1YRUA 1FXDA 2U2FA 1WDDA 4FYDA 2HEKA 4DFJA 1AUSL 3NAIA 2AQ4A 2YKQA 2XY5A 4V19X 4DR3F 5KFTA 2VZ9A 4TYAA 3Q22A 4BCAA 2UXBF 1K44A 2N7CA 3K5NA 3W2VB 2ZZMA 4PCQA 1VGYA 1G2EA 2AW0A 5A8RA 2V2VA 4C8YA 2E66A 4DUZJ 3H2UB 3KLIB 5ETNA 3UR0A 4RU9A 2G2YA 3EGVA 2HBRB 3VAKA 1ZETA 2FJXA 4U7UD 5KFFA 4YS2A 4PQUB 2VQFF 5D78A 2QL9B 4DHVA 5KT6A 4HTJA 3N79A 4DV7J 4JI3F 1U8WA 3KHRA 1HD0A 2JL9A 4AQYF 1EETB 1VCTA 4Y2MA 3OHAA 1S1UA 4F3QA 4L6V3 2DO4A 5KFIA 1VLYA 2ERRA 3BBBA 1FI4A 1HNVA 1FEHA 2V63A 4DPOA 1KFSA 2AYBA 3KK1B 3TARA 2WVBA 1D9DA 3RB0A 2VQEJ 3HSJA 2DXEA 2HLUA 1SKWA 3BQ2A 2VASA 4ZA1A 1HL6A 4NA1A 2F63A 4MTPA 1YJUA 3Q86A 4I6WA 3VHQA 2AJ1A 4MKYA 4F36A 3ENAA 2KHDA 4P73A 3KG4A 3KHHA 2MZ1A 4L76A 1D8YA 2ZBPA 1U0HA 1S6PB 4C0OC 2ROPA 1ZAWA 1HBNB 3N5FA 4QYZJ 3LGMA 2LLZA 1KVKA 5LSLA 3CNQP 1VBYA 4WPAA 4KBIA 5KFJA 3MEGB 5C24A 4NE9C 2XWXA 3DFEA 1FTCA 5CYQB 3MECB 2AKWB 4DL7A 1VK8A 2BANA 1YSJA 2RUGA 2KRBA 1D9FA 4WZQA 4NLRA 3T1HF 1RHMB 2W25A 4EYHB 1RTJA 3I5AA 2OD6A 3CJ2A 3FUYA 1SXLA 4ZIWA 3KLVA 4K4XA 5K5MA 3M2VA 3ILIA 2B9XA 2QA4S 3DLHA 1OS5A 3BQ1A 4TKTA 4B9VA 2ALZA 4FDFA 1MLAA 1VIXA 3VGVA 1MMLA 1N5TA 3RRHA 3RW6A 3W66A 4LR8A 2CPEA 3LF0A 2OI2A 4IRDA 2XGQA 1Q95G 4YB1P 2DEIA 4O0NA 4LRAA 4DI6A 4P2MA 3PYDA 1VBKA 4NI2A 3FQKA 2HK3A 4DV4F 1A0OB 3G82B 4TYBA 3WQPA 2U1AA 1XIQA 2XZDB 1W25A 5HP1B 2M88A 3RBEA 3LPEA 2V8DA 5IXUA 2RDDA 3UN3A 3NP5A 1GXUA 2PN6A 3S6EA 4DR3J 2MGZA 3N6MA 4ILLA 4DDFA 4Q7AA 2UXBJ 2EG1A 4A8MP 4DV6F 4OYZA 3CCTA 2DRBA 2E1PA 3FRYA 4ZOSA 2XCPA 3M6VA 1PYOB 2X3GA 3FSIA 4U95A 2CPZA 2YNFA 5HROA 1RYSA 1C1BA 4ETXA 1F0XA 1AB8A 1Q16B 3BPSP 5HQLA 2AJ2A 4GKKJ 2HS0A 4DOZA 5IC4B 1YZ6A 1WEZA 1HNZF 2EW9A 3ETMA 1I5OB 1WI8A 2VQFJ 2P2CB 5K14B 4RW8B 2XY7A 4ZCKA 5U47A 3HZGA 2JHEA 4N7TA 3IGNA 3NCQA 3D7SB 2XHCA 4JI3J 3HVTB 4UTGA 1FXLA 2GVDA 4CLUA 4P52A 3OXLA 4AQYJ 1QAJA 5GAGI 3VTIA 2Z56B 1IR2A 1X9SA 4CTAA 1M5SA 1R8BA 4ID5A 3K59A 1MU2B 4NLDA 5D15A 1F3FA 2FTRA 5KFHA 1HQ2A 3FBBA 3GTYX 1R0AB 1XQIA 2OPSA 2ZDPA 1CSJA 4H54A 2WTFA 3HKZD 3T5JA 5J2QA 1VRUB 3QRQA 4USVA 1APSA 4ELUA 1EARA 3OFGA 2WVFA 1FDAA 2W9BA 2HGMA 2VJUA 1QSSA 3ENWA 3I9V9 2AZ1A 4OZJA 4I2QB 5CD4A 1Y5NB 3W5XA 2G0JA 3CCJS 1F9EB 1Q78A 3E51A 1S77D 2AEMA 1RLCL 1WNEA 1T05A 3BKFA 2V8HA 5HVFA 2WRMA 1PAEX 1RT7A 2CFXA 1SPBP 3C6TA 3BSAA 2KT2A 3G6XA 1KSPA 4USJC 3QAEA 4JI5F 3PHEA 3TA1A 4MJKA 3UDLA 5DDRC 1Y3JA 2E5HA 2ILYA 1GFWB 4A8YA 3RRGA 1VQ8S 4DSEA 2R7XA 3DYAB 2YQ0A 4NEZA 1VRTB 3PW5A 1YBAA 2XYPB 5ETMA 3T1HJ 4Y3CA 3J7Z5 4ZVEA 2R8JA 3KHGA 4OZ1A 3KFWX 2JC0A 2ZJPQ 5D0GA 4LF9F 1SJQA 3LP0A 3MEEA 3HVWA 4LUBA 3HFVA 3I96A 3MCSA 1T02A 3UDEA 4CIOA 3G2XA 3M32B 3PW4A 1IKVB 1FVQA 3CJ4A 4BBYA 2K7KA 1RKIA 1UP1A 3SMZA 3GG1A 2XHWA 3MZIA 2OUGA 4EYIB 3BV8A 4CO2A 2HPUA 4QR2A 3QNWB 3CJKB 2QA1A 1VQLS 2J0WA 1S5ZA 1BE4A 4U6PA 4NLSA 3R5CA 2WOMA 4DV4J 3D6TB 5F3TA 1GMVA 5MLCV 2ZBIA 1RT1B 3Q8SB 5DQHA 1WACA 3D0IE 4TLQA 2Y9HA 2DY1A 2YNIA 2MZSA 2BBEA 1PSDA 1CULB 4B9LA 4MIBA 1TFYA 1JLAB 4DV6J 4Q0BA 3N5BA 4USHA 1LWCA 5MAOA 4UT4A 1T03B 2KZMA 4ZVGA 3PZPA 3Q2SC 3CD0A 3ZTSA 3TQEA 3E8OA 5H9EJ 3ZC4A 5HI7A 2AYMA 2Z58B 1GMUA 2R8KA 1RDRA 3GFYA 3MEKA 3L3CA 1HNZJ 3OVSA 2V9KA 1OY9A 2DXFA 5HLFA 2QLWA 3LO3A 2VU5A 1JJ4A 3GV8B 3HM9A 2DISA 2RRAA 1LEOA 1TAQA 4RW9B 1VI7A 2POKA 4RW6A 2NQPA 2BJ1A 4ER8A 3D4JA 3GV5B 2RAQA 5LJ3Y 2C22A 2BUNA 2KM8B 4M5KA 2CJKA 3WDOA 2M70A 3LOUA 5IS2A 2I5JA 3DCAA 2JFKA 3KKFA 1ACMB 2YBVA 2BW2A 4RW7A 3PFOA 3QZ7A 5K8PA 2B5JA 3SDEB 1DBDA 2B4PA 4U9RA 1U6FA 3GP9A 2HRYA 3UCGA 2XI2A 3NLCA 4C48A 2QFJA 4P7VA 4R5PB 1FJGJ 2QMWA 2HVEA 2F4VF 4K7QA 1RT5A 4OX9F 1DTTB 2R7SA 3TZWA 3KK3B 3I82A 2W7PA 4D3HA 3BGRB 4EU0A 3KLHA 2XS2A 5D6GA 1TK5A 3QIDA 2W7OA 5C25A 4TNOA 1C1CA 3PW2A 1PC4A 4JI5J 4ZCMA 3GFHA 4GC7A 1HI8A 2DHXA 4PWDB 1SQEA 4OYWA 5E5NA 4F4WA 4LSLB 3OL7A 2KXFA 2WONB 3VZHA 1KRPA 2JLEA 3JXOA 3ADAC 5JJBA 3MDFA 2CXEA 1S9GA 3PY8A 1ZAXA 5A0YA 4U8VA 1SV5B 4LF9J 3TUJC 1IQTA 1HBMA 4K2JA 2BJ8A 1VMBA 2IM1A 3UO0A 2AU0A 1CS4A 4OJ3A 1UEVA 4XPCA 3FSXA 1U1LA 4QW8A 1NB2A 3OJSA 1YI2S 2KG1A 1Q81T 2H48B 1S99A 3P45B 4FZVA 2DIVA 4IQMA 2M52A 2HFUA 1S49A 3W8GA 3MPYA 1FTRA 3QT7A 1V9OA 2YNGB 3QIPB 5KOWA 3OL6A 4FNHA 3QAUA 2XS5A 4FYXB 2WBMA 4ANDA 4J5OA 4K5SA 1RB0A 3W9HA 1QUPA 4IDKB 5J1EB 3NS5A 2VG7A 3M2RB 1GK8A 3VCDA 5GAHI 5DG9A 5M2RA 5KFUA 3KNAA 2HSEB 4F04B 4ZCIA 2KH9A 4NMLA 3TVZA 2COLA 2DNLA 3OR1B 4G1PA 2YX1A 1VQMS 3MM5B 3TVYA 2YNHB 3AT1B 5KFRA 2FLLA 1UW9A 1YK9A 1Q82T 2AYEA 4UW2A 3Q8VA 1X4EA 4ECRA 2JC1A 2QLFB 2DPJA 2CPIA 3FCVA 5IWAJ 3T1AA 2IAJB 4PR6A 4O3SA 1MSWD 4XDDA 2QN6B 3CGIA 2VFTA 2MXYA 3KLGA 1TFWA 3BKTA 3K8WA 2ZJRQ 2MKYA 2ZZTA 1U6BA 4H4KC 1WG4A 1IM6A 4P6QA 4HACA 2DNNA 1FA0A 1HHTP 4DL4A 1JKHA 1LW2B 2DNGA 2UVVA 2LMIA 1SIWB 2HHUA 1YITS 4DPXA 2UUTA 2KRRA 3FFIA 3U27A 2B9WA 2PGCA 4R0JA 2XM3A 3IMQJ 2RKIB 4P10A 1W26A 3ZZZA 1TKTA 3OVAA 2OFHX 5IT9Y 4JI6J 3IC1A 1ICEB 1BMQB 2VFRA 5AXMA 1H3DA 2DGVA 4IQXA 2Y1LB 1TKDA 3CCMS 2XO6A 2F4VJ 2OD4A 1HPZB 3RB6A 1Y11A 3C6UA 4Y6IA 5IM0B 2B3TB 4P7TA 2DCUB 2ZFHA 3HJVA 4FP9A 3VAGA 4KV8A 2Z2YB 3M9MB 3RB3A 4NLTA 1FESA 4FKXA 3HHLB 1REVA 3P5TL 2KYZA 2JZ5A 2NSCA 3PDNA 3BKUA 3OSPA 3BBCA 1VJQA 1UZDA 3OUYB 4HVZA 2IM3A 5BR8F 1ZOTA 4EI2A 1PJ5A 2N7YA 1YIJS 5DGBA 3V81A 1H2UX 1DRZA 3SXLA 3MR3A 1NJYA 1RADB 1LK5A 5BYSA 1PJ6A 3M6XA 1U0SA 2V4JA 4B9MA 4FXVA 3IS9B 3V6DB 4ZP6A 3IR6B 1ELOA 4C11A 1Y00A 1T9XA 2IBKA 1QSLA 2PMHA 4IG3A 2LU1A 4WFNQ 3IWNC 4OV1A 4UOCA 1XK8A 7FD1A 1QVGR 3QO9A 4DN9A 3OSNA 5RUBA 5L9NA 1FRMA 4OLPA 1UWBA 2D3OR 3DM2B 3HHDA 3RAQA 4X4VA 1T11A 2W2OP 1U7LA 5KT5A 2AV5A 5H1SV 2E5IA 4A48A 1MWQA 2BE2A 3MMAB 1EQMA 4KE5A 1YKWA 3MM7A 5HQ8A 3HF5A 1FRXA 2YKAA 2C28A 1YHQS 1U24A 4P71A 2IDLA 1Y9OA 3O2IA 4WFZA 8RUCA 2HVZA 3DLKB 2FIUA 1HBUA 2UVUA 4K5RA 1VQNS 4J9NA 2I1RA 1TL1B 3R7SB 3TNVA 3EGZA 2IPOB 3DN9A 1RBAA 1S9EB 4DPWA 3C3LA 2G9OA 5IT9U 2O66A 2HG4A 3R5BA 4OI4A 2YX7A 2LEBA 1RHQB 2IYGA 3ZZ0A 2LEPA 2H9ZA 4UZCA 2UV8A 4J9OA 1BQXA 2AJFE 1X9MA 3NS7B 4AYBD 2PFDA 4S0MA 1GNKA 4O44B 4K4ZA 5IV4A 2GAGC 2DNYA 2LCWA 4ITSA 1HQEA 3DDNA 1WUUA 3KJQB 3DLEA 4NCGA 3FNNA 1WC4A 2GFFA 3GJTB 2DKOB 2OPRA 4F25A 2CQ3A 1H74A 2EVZA 4CO1A 1JLEA 3RBZA 4K4SA 1X60A 4IRKA 4C3LA 1Q53A 1NJIT 1TK0A 5IQQA 2DO0A 4FYVB 1BQMB 2VG5A 1U1NA 3BGLA 5A8KA 1JLBB 2YWEA 3GSDA 3HD2A 3NNCA 3QJLA 3DRPB 3AA9A 3M2UB 2RB7A 3ITHA 2KG0A 1WF2A 3CDEA 3JAMY 3DLLQ 5BR8J 2ZC4A 1C0TB 3IAM9 3UNYA 3QSIA 1L3KA 1NDCA 5J1PA 4E0DA 4M5JA 2BKPA 5HSPA 1TL3A 2Q43A 4NYPA 3IFEA 3N9UC 2F5GA 2H65B 4LF7F 5I3QA 1KTQA 2HNDA 4O3QA 1TV6B 2CG8A 3NWRA 3UCUP 3UN2A 3PW0A 2FLNA 4KKOB 5KFGA 2D69A 2MZJA 4OYIA 4WF9Q 1RWOB 4DCPB 3US5A 5J2PA 2HS4A 2VPZB 4QZVB 2VBXA 3AJ1A 4DSIA 4URGA 3C14A 2EXUA 1RHRB 2HQCA 5KFEA 2HHPA 3W2WB 4A8FA 1RU1A 2ZH3A 1S1TA 2HHWA 2KM8C 2RS8A 3L7PA 3ILJA 2BEFA 1B3TA 1IBCB 3FGVA 1HWLA 3POTB 3PIPQ 1U49A 3I4PA 4WXOA 1KC8T 1RT2B 5C42B 2MYFA 3L9ZA 2XSJB 4WFYA 1RAGB 2ALYB 3A8JA 3FKBA 1M5HA 3F44A 2M8HA 1D8ZA 1N5YB 4BLGA 2DVIA 4ERDA 1AZSB 1M90T 2DNHA 4LF5F 3D67A 4I6AA 5IC6B 3OV7A 2FC9A 2VPYB 3R1LA 1TKXB 2B56A 3AOBA 4U67Q 4EK2A 3RW7A 2GHPA 5L9XA 4KGZB 3MMJA 4X84A 2YH0A 2CQIA 1QAYA 4GVBB 3ZFVA 3THPA 3W2VA 4X64F 3DDIA 4TXSA 5D4NA 4X4SA 2V6AA 4DL3A 4ZHRB 1DLOB 3IWXA 1HR0F 1CJVB 4XTTA 2RDIA 4Z7CA 3LAMA 2NS1B 1VK3A 3AY0A 4USUA 1MG7A 4ZPBA 3KJNB 4PQUA 2DGSA 3ISZA 3CDUA 5DDOC 1Q7LB 2IVYA 2MQPA 4LF8F 3MD3A 4DQIA 1EETA 4DL5A 2HQGA 1QJHA 3G6VA 2VBWA 2XMAA 4KGKA 4ILMA 3UDVA 4OI1A 2KYXA 3JAMU 1T3OA 1QTMA 1T9WA 1Y5IB 2KVQE 3KK1A 3JYTB 5GADI 1N5SA 4LF4F 2CNNB 4LQ9A 4G65A 2VC1A 3UW1A 5GMDA 1AA1B 2K3IA 2ZDOA 4DV0F 3CSKA 1YWXA 2JNJA 1SQGA 2A1BA 3T41A 4QIFA 2RF2B 3PTWA 4F4ZA 1S6PA 2R2RA 4KTQA 4LF7J 1HBNA 2FY8A 2W2MP 2CQ1A 2KDOA 3MEGA 1WC5A 2VPWB 2MDAA 4AL6A 1J27A 1KLNA 3ZXWA 5IV3A 2EK1A 4H4KA 3NRBA 3R5JB 2XC9A 1NJXA 2XI3A 3RR8A 2VUGA 2BKNA 5A76A 1VIOA 1PYTA 2DH9A 2BDPA 3R7NB 4DPUA 2QRRA 2ZHBA 1Q86T 1TKZB 3L7OA 4EBEA 1RAIB 3GYXB 1NB7A 3BSOA 5I3UB 1OSCA 2GX8A 1UPMB 3SI8A 2BJDA 1UJ6A 5I42B 5KG5A 3PNIA 2ZUAA 1XC9A 2CZ4A 1V3ZA 3N0VA 1Q1KA 1RP5A 4QWBA 2BZ2A 1N8RT 3GIKA 1CQNA 2MQMA 1Y0HA 2GW8A 3JSYA 4G1IA 1RLDA 4ES3A 3LUYA 2E7XA 2MKIA 3MXHP 3G82A 4NA2A 3CDAA 3BGFA 3J80U 3CJ8A 4AXIA 3GCXP 3TAPA 2ZH9A 4LF5J 5HP1A 1DFDA 3UPFA 2VJVA 4RNNA 4HYKA 1CJUB 2MPUA 1VBXA 1PILA 2DB1A 2YQ3A 3K5OA 3VAMA 4TU9A 3CJ0A 3T1YJ 2XTJP 1BWVA 4FKYA 1X4FA 4WK1A 4ED4A 2DNOA 4N47A 4JI4F 2IMWP 4HLBA 1HR0J 3GR0A 3HVRA 4JBCA 4K4VA 2E1RA 3MCMA 1X5OA 4X4NA 3M8RA 4Y2IA 4O3PA 1Z4UA 4LF1A 1UKUA 2CKWA 5K14A 2BE9B 1R27B 4IOAQ 4Q8EA 1E6YB 4F2SA 4O0IA 4OZ2A 1FRLA 1ULRA 2CQPA 2DR9A 3HVTA 5KG1A 4LF8J 3OLBA 2H4YB 2FVCA 1JLQB 1WKLA 4QPTA 1PBAA 1RT3B 3MM6B 2L41A 1J5EF 1MU2A 3GLJA 2B9EA 3RJMB 3M8WA 4DX6A 5KT7A 1R0AA 3PX0A 2J5AA 3G6YA 2HFZA 4DUYF 1MROB 3J7YI 1RACB 2LXFA 1IKWB 1VRUA 3CJTA 2LEAA 1JX4A 1AYEA 2EG2A 1EKRA 4WU2A 2XMTA 4E98A 3TYTA 4LF4J 4Q5VA 4I2QA 4PEOA 1I3OB 5T41A 3ZTPA 2OPPB 2IY5B 4DV0J 2IJRA 2VPXB 2B7CB 3MHYA 4RUHA 3TX8A 4CRJA 1SI9A 4M5NA 1F9HA 2UXCF 4WFXA 1JIHA 2O1PA 5L46A 4I2PB 2VBYA 4CT9A 4W98A 4ICLB 3Q8RB 2HAIA 3Q8PB 1VRQC 3DYAA 5D4LA 4C6AA 3Q23A 1VRTA 1QAIA 5KFZA 2Q6BA 3NGRA 3VQSA 1HD1A 2JEJA 4MAKA 4NLOA 5L1KA 4J37A 3MD1A 1SH0A 2ZOMA 2IA6A 4EZ9A 1UTAA 1X0FA 1WHYA 2HHVA 2OEKA 2Z57B 2UUCF 4NLVA 5M2PA 2H51B 2CVIA 2X51A 3ZZPA 3FCWA 4X4RA 2BQ3A 1IKVA 1U09A 2ATLA 5A8WB 2WB1D 4NL5A 5DJBA 4DU7A 1TZ0A 3PCOB 2QMUB 3D6MB 5HATA 2PEBA 3CJKA 3MR6A 1TP7A 1GTEA 1O0PA 2A10A 5D0RA 1HMVB 3KYLA 3TANA 2IC3B 4ZP8A 3DGPB 1AUDA 3D0HE 4AUKA 1RT1A 2QLXA 1LNQA 4UZBA 2VDIA 2GAHC 3W3SA 2D9OA 2Z0GA 3CDWA 2CNOB 2VF3A 4ZPAA 2OPQB 3CD6S 2RSQA 2BE7D 5J1NA 1FE4A 1JLAA 4K50A 2B6AB 3MOZA 4ELTA 1UAWA 2BX6A 2V5HG 4O4GB 1T03A 3J81j 3FEZA 4JI4J 2NZCA 4OHZA 3HHNB 2KT5A 1J2VA 2ZM6F 2A3JA 2XZWA 5F8MA 3SCIE 4KO0B 3TVKA 2ZC3A 1CC8A 3LA0A 2H5JB 3PEJA 4U7UK 2AT1B 4NLUA 3BO4A 1NCLA 4P2SA 2V2QA 1RAHB 1PAUB 4Z37A 4DFMA 4RW9A 2HHSA 1YJNS 4UOFA 4M8LA 4PG8A 3PYFA 2EFQA 1OYDA 4P74A 4NXNF 3DRSB 4CO3A 1J5EJ 5HMXA 4ES1A 2GMHA 3V4IB 2KFYA 4DUYJ 2JOQA 4RUCA 5J2NA 3L4BC 2MHNA 3CC2S 2HNYB 2H1YA 2KU7A 1FX4A 3SDEA 5LOQA 1TL5A 3NGUA 4WE1B 1F2GA 4USTA 2GNKA 4R5PA 4KH1B 5DZ6A 5I3PA 2PSZA 2B4VA 1F5AA 4TU7A 1DTTA 4C0BA 3KK3A 4B3MF 4F7VA 1R8HA 3BGRA 3CJ5A 2YXLA 5JMNA 3ETOA 2B8QA 4DU8A 3WIVA 5GAGU 2GHWA 4PQAA 4X4PA 2JX2A 2Y8YA 3MPUB 5KG0A 4B17A 4PWDA 3SSQA 2GA7A 3DLBA 4LSLA 1ZAVA 3Q24A 2WONA 4ZVPB 1DARA 2WAQD 5EHHA 1RCXB 4ZMMA 1R8PA 1KBRA 3UI3A 3FBEA 5E3RA 4KY3A 4RL1A 4N5SA 4ZK7M 2CPXA 1RHUB 2RJZA 4FS2A 4USKA 3AXMA 1S6OA 3H90A 3PRDA 3HFKA 1SJRA 2UUCJ 2P8IA 1BQNB 3I56S 3H2LA 2XLJA 3QBCA 2PIIA 1RSCA 1YJVA 3HHLD 2DCLA 2QLJB 2YNGA 3QIPA 3VGSA 3ZZTA 2HYIB 1FKAF 1D3WA 4A8SA 4RWXA 2V68A 5DM6Q 3TR5A 1RBOB 5J1EA 5KFSA 3S01A 2RVJA 3NWGA 2CZ9A 3I31A 5CAAA 3QJPA 3J81Y 1RAJA 3WC2A 1KQKA 3MM5A 2GMJA 3GJRB 4WTYA 2YNHA 3ONQA 4FNIA 2RRNA 5CA5A 2B7BB 1N32F 5DG8A 4P9SA 3CCSS 4DF4A 1GT8A 2APOA 4K4YA 4M94A 3BZQA 2JDJA 3V6JA 2FLOA 4GVLA 4ECSA 4EUVA 4CCHA 1FDDA 2IAJA 2IIHA 2ZM6J 5F0UA 4OZ5A 3N6NA 4XPEA 3PRVA 3UQSA 4I67A 4I69A 1XBWA 4TN2A 2CDQA 3Q0AA 3SQOP 5KFYA 2FHOB 2HGLA 3UD5A 1YJ7A 4CNZA 3CO0P 3TZXA 1LW2A 4NXNJ 1YLXA 2EWHA 1HWUA 1C0UA 3P5BP 3SYZA 1RQ0A 4DJBA 1N36F 2GZOA 2HHTA 5B0AA 1REGX 1ITPA 1YG0A 2EC2A 1CJKB 2X1FA 4K4TA 4P2XA 3CCES 3Q2TC 2J9DE 2RHQB 3AOCA 1B0PA 4WP3A 3O8WA 2V8VA 1Q0NA 2BJ9A 4DX7A 1P8GA 3GYNA 5IM0A 4CH0S 3R7BB 4OHYA 3H5XA 4TQRA 4FXWA 2DHSA 4H4OB 4K8RA 4OX6A 4TVAB 3RTVA 1F3VA 1RA6A 3HHLA 4WFAQ 5K8MA 4PXBA 3TEGA 2ASYA 2J0SD 2JSXA 3VAIA 5KFVA 1SL1A 3OUYA 2JWNA 1LXJA 4GC6A 2PO4A 2ZEJA 2LXIA 1RI7A 5ETTA 1SJ3P 3DMJA 1M5VC 2KB2A 2DH7A 1CBKA 2HZCA 4KC5A 4JV2A 1PKUA 1OQ3A 2QL5B 2E1CA 1LFWA 2HVHA 1RTHB 3KLEA 2HHXA 5FIIA 2XLIA 1WDTA 5JVGQ 3V6DA 3OL9A 1WWHA 3OFFA 4Q2LA 2CUYA 4RUAA 5E2QA 3D0GE 1FFWB 5AXLA 2D7SA 2IRUA 4ZJQA 3J81U 5KFKA 3DM2A 2QA2A 4MIWA 2ACYA 4Q44A 3SBMA 1VLOA 2J7KA 2RHSB 4G1QB 1SBRA 3B78A 5FLXY 3MMAA 4O3OA 4IFYB 3JTPA 1P9YA 3FDSA 1H7XA 2P9GA 1HNWF 4NI2B 4F02A 3VQTA 1U1PA 5GAEI 1VQYA 2C2MB 3H40A 2IM2A 1V3RA 1WEXA 4KJIA 3DLKA 1N32J 1WSRA 3P49B 3H2VE 5GMKa 4I56A 3NGDA 3I6PA 1KHVA 4LFBF 1BY9A 1TL1A 3I32A 3BPDA 5HMYA 1VQ6S 3PR4A 2HFVA 2FDNA 3M7VA 2DYAA 1YBUA 1FE0A 1U25A 2DNZA 2YNFB 4IR9A 4IFVB 1RBLA 3A3PB 4V19J 4LBHA 2VODA 1B64A 2N82B 3NAHA 1ZM3A 2X1BA 4I68A 1SJ4P 3VV2B 4O3RA 4Y2AA 3GONA 3H5SA 2F65A 1RCOB 2J76E 1QE1B 3D3BJ 4WIQA 4J9KA 2PDAA 5B7WA 1N36J 3V4MA 3HDSA 2GVDB 4O44A 5HK4A 5KG7A 5F8LA 2EBEA 3PX6A 1H98A 1I1GA 2YH1A 1VQPS 2B4UA 1SJ1A 2RQMA 4QIGA 4IO9Q 2BQUA 4ZLJA 1LKZA 2GIRA 2HBYB 2QE5A 4B3TF 3R3TA 4NZ6A 2W9BB 1H2TZ 1RTIB 2W24A 2O67A 3W61A 2Y1IA 1TVRB 1TELA 4ZVUB 3PJWA 3HULA 4ZPWR 1S1WB 4JI1F 1B7FA 4L72B 1BQMA 1HI1A 1K0TA 1JLBA 4ZN3A 4XDCA 1NPRA 3BBFA 5ETSA 2ILZA 1T05B 3DRPA 2VKZG 4GKKF 3GU0A 3M2UA 4IOBA 4ZKAA 4LFCF 2ZBCA 2Y1JA 3PO4A 3NCPA 5G0RA 3EYZA 1RT7B 5E3CA 1C0TA 2CQDA 2FB0A 3H4DA 3AQPA 1NPKA 5HAOA 2M5YA 3DHXA 4CLYA 4PKDB 4L74A 2VHGA 1DQ9A 3G87A 1RWNB 3FEYB 4ECQA 2W01A 3VVUA 5CQGA 3DRXA 1TV6A 4N77A 3MFHA 2JEGA 1QUVA 4LRBA 3H8YA 4KKOA 2FPHX 3DU5A 2VFUA 3LP0B 2F9DA 3DRYA 3MUVP 1NK8A 3SEOA 3UD4P 4OJGA 4DQQA 2J8AA 1U8SA 4EMDA 4BC9A 1CG2A 3HVAA 4DR4F 3EM1A 1U45A 1O8BA 4CO4A 4DS4A 3M8QB 4J9UE 4RNMA 1S1VB 3POTA 2Q3PA 5F0WA 3C15B 1RT2A 5E33A 5C42A 1HNXF 2JVRA 4URSA 1FKOB 1HNWJ 4DV1F 2CPJA 3H0PA 3A8IA 3GQCA 5FJ4A 2K2PA 1X8DA 4WXWA 5HN0A 7FDRA 1N5YA 1XR7A 4LJMA 2DJWA 2R2UA 1WHVA 4QW9A 4JI8F 1AZSA 5DO2A 4NLYA 2BJ3A 4LFBJ 4CP5A 2KZZA 4UQGA 3R5DA 1FRHA 4YB5A 3NGTA 1TKXA 4C4WA 4A8OA 2KFNA 5AT1B 3IAS9 4P2FA 1PGZA 1L3SA 1YTYA 2AJ4A 4GVBA 4CWBA 3GYGA 1UW4A 1WG1A 4IUFA 3TUIC 3FQLA 4OMFG 3C66A 1RA7A 5ITHA 2VICA 4ZHRA 3PEHA 1DLOA 1RHKB 2L3MA 5KT3A 1FRJA 3QT6A 4NRUA 3FEXB 4RWWA 5GVQA 3JQKA 3M9NB 5HJYA 3P3DA 1XR5A 4AXJA 4N56A 3AXKA 4U96A 3DDKA 2HMIB 4OYAA 1RTDB 4KSEB 4KAIA 2KXNB 1S48A 3IM9A 1HA1A 3A1YG 2AGPA 3U7JA 3HKWA 2N4DA 1FD2A 2WSCC 1IVZA 3OTBA 3CTRA 1WTBA 4DV5F 3AD7C 4P72A 1T94A 4B3TJ 2V4QA 1KVJA 1PCAA 1RGVA 3ZTQA 1NSQA 1SH2A 4JI1J 4IO1A 2YWHA 2LYVA 1OIAA 2CJQA 3MM9B 2O3DA 4D3GA 3ULHA 5F41A 3F56A 2MEWA 3X3UA 4LFCJ 1KEKA 1RAOA 2V2KA 1H6KX 2UXDF 5C25B 1UEUA 2ZOFA 4JYAF 3M8PB 2V2ZA 4M5DB 2MSTA 1KP6A 4IRCA 3A3OB 5CYMA 2H3EB 1CEZA 2IRYA 2D3O1 3DGVA 1Y7PA 1HW8A 1OPZA 1N5QA 1NH7A 4CZCA 1BUXA 4C8ZA 1OJ4A 3H5YA 1S9GB 3CDBA 3HT0A 3CC4S 2Q6CA 3CWJA 3RAXA 2GS8A 2QGFB 2J0XA 2WZ1A 1XJWB 1FVSA 1N0VC 3G9CA 2IVMA 2QIFA 2R2TA 3BF4A 1FJGF 2CWKA 4DR4J 1NJZA 3ET6B 3BREA 4A4JA 4DX5A 1TKZA 2VFVA 1ZZFA 1HI0P 3BS9A 3PXGa 5T7LA 3VZIA 1UPPA 4OX7A 2R3VA 4ECYA 3I0SB 1C4AA 4YFUA 2D1CA 3P4UB 1FDNA 3FMBA 5D3GB 3BGOP 5I42A 2E1AA 1HNXJ 2ZH7A 1H7WA 1X4AA 1EZZB 2GIQA 1E6VB 1IUJA 4DV1J 5AE3A 4CLPA 4ANCA 2ZKTA 4FYWB 3SFUA 3TEHB 4J7CA 1RAFB 2DIUA 4MFBA 2WSFC 1S7HA 1K1QA 1JLCB 1TQLA 2WBRA 2XLKA 5BYRA 4JI8J 2CPDA 5KT2A 1R0CB 3TJ8A 1PIEA 1VQOS 3JS9A 3PIOQ 1CJUA 2FHJA 1KONA 1YZ7A 4MYTA 4HKQA 3M1VB 2BKOA 1EJ7L 2LU2A 1CQMA 4OI0A 1YRXA 5G4DA 3W64A 1BC6A 2IVFB 3Q8YA 2DGUA 3UWTA 1B99A 4AD6A 4CDIA 1VS3A 2WW8A 4OJ1A 2MY7A 2HVIA 3UNGC 4OHXA 1KTVA 2I2YA 1EIYB 4PXDA 2V50A 3GIMA 4HACB 4KGMA 1E6YA 2GJIA 4QCLA 3M8SA 1VDHA 4KHMA 5KFAA 1RJJA 1N6QA 2HKEA 4M95A 2MLXA 2WSEC 1JLQA 2E29A 5AXKA 1RT3A 2KHCA 3MM6A 1GTHA 3VGUA 1FO1A 1F9FA 2RDJA 1TKTB 4KB7A 1BWEA 3AQOA 4DV5J 4YN3B 5KFLA 5HBMB 1H72C 2E9TA 1MROA 5DQIA 2EFPA 1IKWA 4CM0A 4NX9A 2B8PA 4JI0F 1LV5A 4ZN1A 2F40A 5KT4A 2CJ9A 3HXMA 3GFZA 1FD8A 1SVDA 3K7RA 1RHJB 1RKJA 4M5MA 4RX6A 1FT8A 2Y0BB 3D1HA 5IWAF 5E7OB 2QJ3A 3NEKA 5DLGA 2DD8S 2OPPA 4FBTA 4H4MA 4MKAA 3KJVB 3QWUA 2UXDJ 4Y2CA 3WC0A 2C1EB 3QYYA 4Y65A 3G71S 4JYAJ 1Q8IA 4F4AA 4X2BA 1UJ4A 3OBIA 2LA4A 1SC3B 2X7IA 4ZPDA 3ZZUA 1N88A 2AEJA 2WW4A 4CYUB 1Q8KA 2DPIA 3BQ0A 4OYPA 4I2PA 2DNQA 3MAAB 4ANEA 4ICLA 5DDPC 4EO6A 3QFWA 1FWKA 1NKBA 2GIFA 4YB6A 5AXNA 4WKYA 6FDRA 3GJQB 2MZQA 3DOLA 1NKCA 5GADU 2CNLB 2AF6A 1XNRF 3JQMA 4JI6F 4DN0A 2FJVA 1GEHA 4QR0A 3N01A 1I6JA 2V4JB 2ZITA 4Z7YA 3H59A 2UZAA 1KD1T 1SKUB 1NEEA 4JI2F 3BEGB 5HO4A 2V4RA 3IBCB 4C11B 2DK2A 2MY8A 5C7PA 2ZUGA 3D66A 4K4UA 3DXBA 2CPYA 3CW2C 4EZ6A 4CH1A 1XEZA 1Q7YT 5KFOA 2F9JA 3AA8A 5A8WA 4DQSA 5B0DA 1KQSR 1VC0A 2PMWA 2AEFA 2DGOA 2OELA 3TA2A 2AIRB 2E1MC 5D0HA 2I0XA 1Q8LA 4KHRA 3EE3A 1RABB 2M8DB 2IJNA 4UOGA 4HHHA 4OJHA 1QAXA 3WIUA 4KH0B 1KLMB 2JEFA 4OV6A 1WF1A 3FJ2A 4ZJOA 2LQBA 3TI0A 2MJUA 5E3PA 3IWLA 1SL0A 5LMUF 3CJSA 1HMVA 1XTZA 2ZWOA 3OXGA 2ZZNA 1FWLA 1R0BG 3SFGA 4F3MA 3DGPA 3C8YA 2DR7A 3QATA 3LP2B 5LSOA 4EBCA 2FVQA 1AFIA 4RNOA 4DX8H 1R6VA 3HI9A 2DT9A 4HEA9 1K1SA 5K8NA 1LXNA 2OPQA 1HBUB 2NXUA 2P6TA 2AWZA 2Q1LA 3MTJA 3MMCB 5F8IA 3EPIA 1WOOA 2YQ1A 1FKPB 2B6AA 5HVGA 1M0SA 1BHNA 1NU4A 4EEYA 2LFVA 4ECVA 3HZEA 3SQGB 2CJXB 4O4GA 1R89A 2ADCA 2MQOA 1KNZA 2GQCA 3OTCA 3JTOA 1QTNB 4YHHF 2MKHA 4BWJA 2R4FA 4RNHA 2MJNA 4ZITA 4KGXB 4KO0A 2C2OB 4AE5A 2PE8A 2F8HA 2CQCA 1UFLA 1VQ4S 3OR2A 4RPFA 4Q2MA 4Y2KA 2BW7A 3U1LA 2XEXA 4B3OB 1A6LA 1U02A 3OTOF 4K59A 1B4SA 5M2UA 4PWWA 4MKVA 2HNZA 2NXJA 4FYYB 3D2WA 1FRIA 3D6FB 1SC6A 4KFBB 3V4IA 3M6WA 4WCEQ 2BRLA 2C3YA 5LXRA 2HNYA 4PAAA 3DLEB 2PA8D 4OYBA 2FQQB 4JI0J 4WE1A 1EX8A 3RR7A 3M8ZA 4GO7X 1FWPA 2QYCA 1WC1A 2CJYB 2BABA 2P9EA 1VFJA 2BVZA 1PYSB 1NHKL 1OYEA 3VWSA 5HANA 2I9SA 3W63A 2ZD1B 3GCWP 3QRPA 4NLWA 2NUUG 2G0IA 2W2QP 1N0UA 2J6SA 4RUBA 4B08A 1NPPA 4HHJA 2GGPB 5EGYA 1S7IA 3M4XA 2ZOGA 3ZZOA 2QL7B 4B9SA 1A9NB 1BXNA 3HT3A 4HH1A 2KI2A 3OT9A 1AFJA 2FGOA 4LFAF 4WFBQ 2RE1A 4C97A 4WWSA 2J6UA 2V67A 2YKOA 1G1XA 2BOAA 4QWCA 2Z2LA 1NUEA 1LW0A 1H2VZ 1BLUA 1FHTA 3A8KA 3D28A 4V1Ak 3PRBA 1F5BA 4FF4A 1X0PA 1Z2ZA 1XNRJ 4YEAA 2K3KA 2CA9A 3SCLE 2FHKA 4JI2J 4KPCA 3H20A 3HSDA 3IG1B 1KHWA 5HL7Q 2HBQB 3T19A 5AJ3F 3PACA 1Y4ZB 1XN9A 5J2PB 4C8NA 3QGHA 5ETLA 2PEHA 1DTQA 1BQNA 2C3OA 3R5AA 2VOOA 2XNRA 5A6PA 2PA3A 2QO3A 2LDIA 3THTA 9RUBA 3MMBB 3KTQA 3OFEA 4KQZA 5LMUJ 1N54B 3KK2B 3I4HX 3TA0A 1S4FA 2MHEA 3MAQA 5LMNF 2CQBA 4KGVB 3EVWA 4M1KA 5L38A 1X9WA 1RWPB 1UZHA 2RQCA 5AE1A 4A8XA 2CWXA 4ZVOB 4HTIA 4AT1B 3A4TA 5DM7Q 5DG7A 4ECWA 3CJ3A 1ZS6A 5F8JA 3CCWA 2FHMA 2LDYA 2YKPA 3QQCD 2EEYA 3T6BA 4N76A 1WEYA 2JFDA 1KOHA 1YDLA 3RAMA 1XMQF 2NREA 4YHHJ 3K57A 1UVNA 1X31C 2W8LA 1U2FA 4WU3A 1BD6A 5I4MA 3GV7B 3R1HA 2HGNA 4OYMA 4YY3F 3I5BA 1DZ5A 1OWXA 4NXMJ 5JUMA 3W62A 3AAWB 4EO8A 3CCVS 4M5LA 4DUTA 1HIYA 2G2ZA 2BMBA 5BJRA 4TY9A 4NLPA 3A3NB 1RT4B 2OH2A 3CCZA 3O1LA 5DS7A 3OTOJ 2AP6A 2DGWA 5F8HA 2HW3A 1M1KT 1RK8A 2OSRA 1IJEB 3HHEA 4I7FB 2OP5A 4DS5A 4B02A 3L95X 3EPGA 1UVKA 2WVCA 3BO3A 4DLGA 3GSIA 4DPYA 2FJEB 2KVIA 4ED5A 1WSVA 1UCNA 1CJKA 3DI6A 2CQ2A 3F73A 1YJWS 5LT5A 4A46A 2QV6A 2XG8A 1NSAA 1K73T 1MN9A 5KFPA 3NS6A 4ED7A 1ZPWX 4BS2A 2L9DA 5IFMA 4H4OA 2J6TA 2UUAF 2GO8A 4TY8A 3CD5A 3MM8B 4EBDA 3NXZA 3AODA 3F41A 1S6QB 1QD1A 1T95A 2W2NP 4LFAJ 3PX4A 2DHHA 3H25A 2ZE2B 1N48A 5KOXA 1PBUA 3MR5A 3HD1A 5A2QY 3T9NA 3CT9A 2QTWA 5FD1A 4DPTA 2VC0A 3K8VA 2C3MA 3TOQA 3SCKE 2HFNA 4OL8A 2J7WA 3PW7A 2BR0A 4WKRA 5AJ3J 1RTHA 2A6MA 2V0NA 3QPIA 4OZNA 2XCAA 1FF2A 5IT4A 2OTLS 3C16A 2NYIA 5SZTA 2XMMA 5KFNA 3MPVA 1O6XA 2ACMA 3EXYA 2Z2MA 2BQRA 4F2RA 4I0WA 4LBIA 3GFXA 2NCKL 1P9QC 3CC7S 4NPOA 1U47A 3MUMP 1Z2LA 2XY6A 3G4SS 3D3CJ 2K8GA 4LRDA 4CI0B 2VBZA 2GVZB 4FF1A 2HIYA 5LMNJ 5C2GA 2M0GB 4G1QA 4NASA 3R2DJ 1SQFA 4LSNA 4QIEA 3I87A 3I0RB 4NYZA 2Y8WA 1B0VA 4IFYA 4ELVA 3M30B 3G6ES 4JI7F 2DNRA 3JSMB 2PD1A 2DHAA 1YQHA 4DFKA 3B82A 4DMZA 2FZCB 5B09A 4NZ7A 1RYRA 2VG6B 2YY3A 3R9LA 2ZH5A 2DNPA 3HLUA 1XMQJ 4FF2A 4XAKA 3UVJB 3RYLA 4ZP9A 1R6YA 1EP4A 2DEJA 2HBZB 3FRZA 2V94A 1NNDA 2BM0A 3DRRA 2EK6A 4ZVFA 4ID8A 2VONA 2RD5C 4YY3J 4ZVRB 4X4OA 5F3ZA 2MTLA 4DV2F 1CPZA 3CEDA 1FX2A 4IFVA 3CXCR 2CADA 3RB4A 1XWLA 2YTCA 1NJWA 4HHUA 1C4CA 1S10A 1NK0A 1HNIB 3JB9k 4R8UB 4X65F 4AL7A 3FMWA 4JV5F 2LECA 2XS7A 2CIMA 1KR4A 2LQ9A 2V34A 4HR2A 1QE1A 3JSBA 2AMCB 3R6GB 3TUPA 2UVWA 2BM1A 3BN7A 5CZXA 3SCJE 1JQGA 3DC2A 3WX4A 1NK6A 2L9NA 1V5VA 2R7TA 3NMRA 1L3UA 5D4OA 3VAJA 4JOUA 3KNGA 2LQ8A 3ENQA 4GRSA 3Q83A 3UDCA 2DR5A 3NNAA 3DOKB 2QA4G 4KPYA 4BDPA 2J0QD 2ADBA 1C2PA 2F7VA 1OMSA 3CF5Q 2KJWA 2F3JA 1VYAA 1VQSA 2FGCA 2X3DA 3VGTA 2YPZA 4C9DA 1RTIA 3T1YF 4OYOA 2UUAJ 4F50A 4DZDA 2EKYA 2C2KB 1TVRA 2H5EA 4QYZK 5A2QU 1S1WA 4WJBA 2W9CB 4DR6F 3KLIA 4Q43A 1TU0B 3H42A 1FJ7A 1WC0A 4J9LA 2HRUA 1OPIA 2NR0A 3K89A 6AT1B 1J5OB 2R7OA 3AHPA 2W9AA 3GR1A 5B0EA 5D0EA 3QLHB 3V6HA 3J7AN 1S1XB 1OO0B 2JH3A 4OZ0A 1R3NA 2F1FA 4PABA 4DG1B 2HWIA 2IJFA 4KT0C 4JV0A 3NL0A 4E2FB 1HQUB 4ZVQB 3N6LA 4LVOP 1G7CB 2HZVA 3HJFA 2WHOA 4RNFA 2KO1A 1Q4RA 1FXRA 2NUHA 4HDGA 4NLXA 3JTNA 1HHSA 2A2CA 3EZOA 3J7A1 3DHWC 4CLKA 3QZ8A 4F67A 4P75A 1FJEB 4QQBA 2XSFA 1IBKF 4NRTA 4DR2F 1JJCB 1XMOF 5CCMA 3B6BA 2FD2A 2WVDA 3M8QA 4MMOA 1ZM4A 1S1VA 3LP1B 1JB0C 3FC9A 1X5PA 3VF0B 2QYGA 3C15A 4JI7J 1RWXB 3GZ7A 4L73A 2F4FA 3M9OB 1FKOA 1GXLA 2OO4A 3P6YC 3AH6A 1KDNA 3THVA 3H4BA 4LF6F 2RU3A 2ZJQQ 2QEXS 5HMZA 1NDKA 2VL1A 1TL7B 3CMQA 4DL6A 1M5PC 2MLZA 5CYQA 3MECA 3HO1A 3EVOA 3IGVA 4CO0A 1JLGB 3KLFB 4I4BA 2FJBB 1LWEB 3B4MA 3NGKA 2XO7A 2QLBB 2NPIA 2HZAA 1JWWA 2JLGA 2GO9A 1H0HB 4Q8FA 1S57A 1OY8A 2G13A 4QIWD 4DV2J 3CD7A 1AW0A 1NKEA 2VD3A 1IKYB 1H38A 4B9UA 3CIMA 2ZKUA 5A6WA 2CPFA 4YDXA 1S79A 4LQ3A 3VR1A 2CPHA 1TUWA 3SZ2A 4UUXA 4ZP7A 4X65J 2N4CA 1R8AA 1U26A 1TUGB 4JV5J 1VQ7S 3N4WA 2I38A 5GAEU 2KT3A 5IZHA 3T3FA 2HMIA 1RTDA 3FBFA 1DQAA 2OJ3A 1EB0A 4ED3A 3K58A 2FVPA 5LM7E 3MR2A 2BYCA 4RBUA 2FUG9 5J2NB 1TMMA 5L1JA 4ES2A 1LOUA 3DLGB 5ETVA 4LRFA 4EGLA 3DOMB 4RBVA 3X1LB 5DLFA 1RUSA 5HJXA 3CB4A 1Q79A 2MLYA 4FVCA 4DR6J 1N33F 2BOPA 5E3AA 1FERA 3ENVA 3MM9A 4ALZA 3UN5A 4ED2A 2H5IB 5CXTA 4FBUA 2JLFA 1KOOA 3L09A 4B3RF 3DLJA 2DBBA 1S0MA 1P27B 3M8PA 1ZTWA 1M5KC 4RW8A 4M5DA 5DQGA 1Q5YA 2MMYA 3AJDA 4N8NA 3NBPB 4NLGA 4WTOB 1ZM9A 1Z1ZA 1QLNA 4DXLA 2J9CA 2VKRA 3GILA 1S59A 4ZCLA 3FSYA 1FFSB 5CZVA 4CLLA 2C3UA 2D3UA 1CC7A 2DHGA 5K8OA 3D9BA 3OFHA 2FJDB 4ILRA 3D1OA 1DY3A 2K06A 3BYPA 4ZLPA 4DSJA 3ZZYA 2KL8A 2HQ3A 5B0FA 4WZMA 4QR1A 1CJTB 3LWMA 1RWWB 3S1TA 3CJRA 3ISND 1IBKJ 2RU9A 4FPRA 3ET6A 4DR2J 1K47A 2HQFA 1VHIA 4YB7A 2B4OA 2GJ2A 1XMOJ 1MMDA 3WHIA 1U1KA 2IBOA 1P1LA 1DAXA 1YJTA 4MYUA 3A13A 3BH7B 2AHOB 3I0SA 2G2OA 2CJBA 4IR1A 5ETRA 1I51B 5D3GA 4QU7A 2ZWPA 4M5GA 3OPKA 3RG6A 1E6VA 3QJJA 4MK7A 3E01B 3T9ZA 3EWGA 3ICLA 4LF6J 1P6TA 3MPDA 4K0KF 1JJHA 3DKDA 1HYSB 2I8EA 5H9EK 1JLCA 2H4WB 1S12A 5EWGA 1SUQB 1JXEA 4J91A 2R7QA 1VQ9S 2KTQA 2HIQA 3EJMA 1WG5A 2CNKB 4PYDA 3GJSB 4JUZA 4XIUA 2JEIA 1WTFA 1Y5LB 4HDHA 3NOCA 3M05A 1U1QA 1EAYC 4Y00A 3M1VA 3W1YC 3M32A 2D74B 1YJ9S 4PWUA 1S76D 5HQMA 4CLWA 3HFZB 1TUVA 2R7VA 1TR0A 3QMQA 4ZLNA 1RZMA 2YKMB 5J2MB 1KVIA 5KG6A 4CLFA 4ZPTR 2YWKA 4DSLA 1SC4B 2M7SA 1UA1A 1YRTA 3MCOA 1NZAA 4X4QA 2P6SA 1C0UB 2DR8A 4NA3A 3EMTA 3IP0A 4FF3A 3TJ9A 2R9LA 4G3IA 1URNA 1IBMF 1R8CA 2YWGA 5CABA 3W5ZA 4N41A 1MN7A 5CD4H 1A7GE 3LALA 4C2MA 1I94F 1VJWA 4ZVSB 5HBMA 3TAMB 1CULA 1RTZA 2NXEA 1AXQA 2HHHF 2V8PA 2W7AA 4IG0B 3MI7X 2G4BA 3KG0A 1U48A 1LWFB 1N33J 2VA3A 1PJ7A 4OX9J 4RKUC 1FCAA 2XB2D 2UP1A 2YKNB 3IR5B 1JLFB 1NZ8A 4X66F 3CULA 3FK4A 3G96A 4UY8T 3I5CA 3KJVA 4B3RJ 1NXIA 4J9PA 2QFIA 3R5GA 2SXLA 1F60B 4NZ0A 2B51A 4DBQA 3H98A 1GQEA 3ELHA 1YBTA 4CYUA 2DXDA 3MAAA 3DMJB 2RILA 3EDQB 2PC6A 1RT6B 2FC8A 1IKXB 4CT8A 2AX0A 1Q8BA 2XQCA 4O23A 2L08A 1N5VA 4O4RA 3OLAA 4PUOB 3FCHA 2BA9A 1G3OA 3BGUA 2VV5A 4Y28C 3K2YA 3KLEB 4A8KA 1UL3A 1N34F 1F1BB 1XNQF 2L48A 2IMOA 3O3LA 4RW4B 1O51A 1PC5A 1FNXH 1UFWA 2ZHAA 1T9TA 4B3SF 3TP2A 2QMXA 3D1QA 1N4LA 1KLMA 1OSDA 4DQPA 1HBOB 1NK9A 1ZM2A 4WP9A 2ROGA 4PG7A 4NMXA 4F4XA 2ZH2A 2G1DA 4K0KJ 3ZTRA 5C2CA 2AX1A 4RO0A 4OIXA 2OMLA 4C3KA 4R0EA 1V5IB 1UWAA 3CIZA 2K1RB 3LP2A 3KMSA 5KG3A 4LBPA 2D3ZA 1GMWD 3MEDB 2DRAA 3OXFA 1FK9B 3Q8QB 3BJYA 3HP6A 1U1OA 3FVYA 2ZNZA 5T14A 1SV5A 3G8SA 3ZO7A 3MMCA 1T3NA 1QM9A 2Z2ZA 4MIAA 1FKPA 2V8GA 1ZH5A 4LSZB 5F8NA 2CQHA 1FFGB 1HARA 3SQGA 5KFXA 4C3MA 1JNRB 2Z4PA 1YJRA 4OX8A 3TX0A 1RXOB 2IYIA 4LMZA 4PYAA 4DL2A 3OTDA 2EI5A 3D68A 2XMJA 2WK4A 4JB8B 5EWEA 4RBTA 1RWKB 4DLEA 3RBXA 3IRXB 3N28A 4B9NA 3PFEA 4E8UA 4C8MA 5LSRA 2UVRA 2M4MA 3U1MA 1IJFB 1UETA 4RR5A 2O01C 5L1LA 4IDKA 5FDLB 2H54B 4B3OA 4F0KA 1LFPA 5KFBA 3M2RA 3MOJB 1UJ5A 3CUNA 3PO5A 4QWDA 1SCJB 3O44A 3GMGA 1IBMJ 5IQ6A 4NYOA 4QU6A 3R27A 2OTJS 3B54A 5IT0A 3LH2S 1I94J 1IBLF 3OR1A 1R7IA 4CNYA 4RU2A 4KFBA 2VFSA 4CM2A 2HHHJ 2HLTA 4DSFA 1MWYA 4I6YA 2A18A 4A8QA 3KG1A 4OHWA 1GX5A 4B9TA 4C7QA 2HAFA 4WP8A 4ZPVR 2CQ4A 1HKAA 3HX9A 4OZLA 3SV3A 5LXYA 2NZ4A 5CHCB 2J7UA 2ASLA 4DV3F 2MB0B 4UF4A 4X66J 3OL8A 2MQNA 3BB5A 5JVHQ 4NEYA 4ZVHA 3BSNA 2FVRA 4ATNA 2OHDA 4PPDA 3G8TA 3L7UA 5KFCA 2ZD1A 4AL5A 5AE2A 3QT8A 5A8RB 2EFNA 1W2IA 2WCXA 4J9VA 1L5UA 4LREA 4PG4A 2GGPA 4FVMA 2MSSA 2OEMA 4YR2A 4L75A 2RIJA 2R42A 3IM8A 1U1MA 5G0RB 4F4YA 5K20B 3O5TB 3BSCA 1TK8A 2Y0SD 1X4CA 1VQ5S 5D77A 2GQQA 3ISNC 2R8HA 3U02A 3K5MA 4YP3A 2RKIA 3SIPB 3JQJA 1GMWA 2KN4A 1JK9B 3PKYA 3HMJG 1S1UB 1KN6A 1NHUA 1ZBTA 4YMEA 1CVJA 4JV1A 1HNVB 1N34J 5KG4A 3IG1A 1XNQJ 4QBUA 2R7UA 3MURP 1NO8A 1DURA 1HPZA 1B0TA 2P5VA 5KG2A 4X4TA 1GH8A 2FJWA 1EHWA 1ZA1B 1IN0A 2XMKA 1FJCA 5EDWA 2LQ5A 4DR5F 4J9QA 4B3SJ 4QYRA 1RAAB 2C2EA 3IA0A 5CYJA 2MKKA 3MMBA 3AD8C 3GB0A 5LJ5Y 3PHTA 1S72S 2BJ7A 3R6LB 3KK2A 1VBZA 4F26A 4GO5X 4K4WA 4WYLA 3KHLA 2UUWA 4KYZA 1PG5B 3LGHA 3WZ0A 1U0HB 1ZYQA 1WKJA 4C8LA 3MCNA 3QGIA 2J8SA 2XWYA 2G0CA 3LWLA 2DRDA 5DDQC 5C24B 4NCAA 2OEJA 1GX6A 4EWTA 1RAEB 2BANB 1S9FA 3AD9C 4NCBA 5KFMA 2YWFA 1KS2A 1HW9A 3IS9A 2LXUA 4F0MA 1RTJB 3RUBL 3QGGA 3A12A 3TAQA 4RZRA 2Q66A 2R7WA 4PG5A 4IKAA 1F5CA 1Q5VA 3M2VB 2R7RA 1FNOA 4YQWA 1WC3A 1CLFA 3D54A 2R2SA 1HFEL 2F8MA 3GIRA 4X62F 3EVMA 2LVWA 3U1NA 3J80Y 4QIVA 4ECXA 1DJ0A 3C46A 1WOPA 3CJQA 2L9WA 5ETPA 2PT0A 1U2RA 3O6QA 4WK3A 2QG9B 4C8KA 1RT4A 2KJVA 2E5GA 4J9SA 2OKQA 2O5DA 4ZPCA 1N52B 4I7FA 1IBLJ 3QRRA 2HVDA 2VDHA 2C2ZB 1GAOA 1R31A 4MT1A 4DL0C 1L3VA 3PM9A 2MGZB 3UCZP 3OQ2A 4DV3J 2OAUA 2RMLA 3PJXA 1JNZB 2QSWA 4A8WA 1IQZA 1S9EA 3CCUS 3BYRA 3TO8A 2YX4A 1NK4A 3V2UC 2UV8G 4IH5A 2HQIA 4KRWA 2IFXA 3MGJA 5HROB 1R43A 1C1BB 2IRXA 5GAHU 3MM8A 1S6QA 4W92B 1UVIA 1X4BA 2ZE2A 3ILLA 3OVBA 2LQJA 5CYMB 3FZBA 4HL9A 1SIZA 3HK2A 3PVXA 1UMJA 1VQKS 4HT5A 2ZH1A 5D8HB 4LR7A 4CTAB 3NOGA 4ID5B 4QWAA 4ENOA 3OTEA 1WHXA 2BXJA 5B08A 2K7JA 1G6BA 4M5IA 1X4HA 4DFPA 2OPSB 2VB6A 5JXSA 4DF8A 1RU2A 4RLEA 4DCJB 2B43A 6FD1A 4L3NA 1U1RA 1HWJA 4DCOB 2HWTA 5J2QB 3LQVA 4ZJLA 3I9ZA 3W9JA 4USMA 4DR5J 2LA6A 2XGPA 3LAKA 2A0FB 3CCRS 5KTQA 3TW0A 1EQ0A 1YVFA 2AJ0A 4WBFA 2VH7A 5E0OA 4CH7A 4Y0FA 3VAHA 2HQDA 2KFZA 5T7LB 1LQ9A 2W4CA 1SKRA 5BXIA 1NH8A 2GVZA 4L3KA 3NMAA 2JRSA 3EUNA 1QVFR
chains in the Genus database with same CATH topology
3ZC4A 3L95X 3C6TB 1LK7A 5HI7A 3EPGA 1UVKA 1S6OA 2AYMA 4M63A 3PRDA 3HFKA 3BO3A 1SJRA 4DLGA 3I0RA 2R8KA 3M30A 2FJEB 1RDRA 3GFYA 2KVIA 3MEKA 3L3CA 3OVSA 4ED5A 1SB6A 1VC5A 3JSMA 2B9YA 5ADZA 2HFOA 1BQNB 3I56S 2V9KA 4TLRA 3DI6A 2MKSA 2CQ2A 3H2LA 2XLJA 5HLFA 3F73A 2QLWA 1YJWS 4HI1A 4MFBB 3LO3A 5LT5A 3LGNA 2PIIA 3CE8A 5F9LA 5KFQA 1JJ4A 3GV8B 3HM9A 4A46A 2QV6A 2DISA 1NK5A 2XG8A 2RRAA 1YJVA 1K73T 2NPFA 3HHLD 2VG6A 1U6ZA 1TAQA 4RW9B 3HHLC 2DCLA 2AGQA 2YNGA 3QIPA 2E44A 3CPWR 1VI7A 5KFPA 3NS6A 3ZZTA 4ED7A 2HYIB 3LW5C 2POKA 4RW6A 1ZPWX 1FKAF 2NQPA 4BS2A 1D3WA 2L9DA 5IFMA 4A8SA 4RWXA 4H4OA 4C0HA 2J6TA 3GV5B 5DM6Q 2UUAF 2GO8A 4FS1A 5LJ3Y 1ZZNA 2C22A 2BUNA 2KM8B 3MEEB 3TR5A 4TY8A 4ED8A 5J1EA 3CD5A 5KFSA 3S01A 2M70A 3WDOA 2CJKA 3LOUA 5IS2A 2I5JA 3DCAA 2JFKA 3KKFA 3MM8B 2RVJA 2UU9F 3NWGA 4EBDA 2BW2A 4RW7A 3PFOA 3QZ7A 3I31A 5K8PA 3KWMA 2B5JA 3F41A 3SDEB 1S6QB 3MF5A 3QJPA 1DBDA 2B4PA 3W2WA 4U9RA 1T95A 4FXDA 1P1TA 3PX4A 1U6FA 3J81Y 3H25A 1RAJA 3WC2A 2ZE2B 2HRYA 5HMWA 4QWEA 3UCGA 1KQKA 2XI2A 3NLCA 4AFFA 2QFJA 1N48A 4P7VA 4R5PB 2QMWA 3MM5A 2GMJA 5KOXA 4WTYA 2RNEA 2YNHA 3ONQA 2F4VF 3GWCA 1U4BA 3MWBA 1RT5A 4FNIA 2RRNA 3MR5A 1TL4A 1URRA 5THWA 5CA5A 2B7BB 4OX9F 5A2QY 3T9NA 1N32F 3CT9A 1HNIA 5DG8A 5FD1A 1DTTB 4R8UA 2R7SA 3CCSS 4DF4A 1GT8A 2APOA 2Z8QA 3KK3B 4K4YA 4UY85 3I82A 4M94A 2VC0A 3K8VA 2W7PA 2Y1RI 3BZQA 2C3MA 3TOQA 2UUBF 2XSJA 4D3HA 3BGRB 4EU0A 2JDJA 2AJQA 3V6JA 3SCKE 2HFNA 3KLHA 2FLOA 4GKKF 2XS2A 4OL8A 2J7WA 3PW7A 4W90B 2BR0A 5D6GA 1N6QB 1TK5A 4WKRA 3QIDA 5KFDA 2W7OA 4ECSA 4EUVA 5C25A 4CCHA 2WOMB 4EFAC 1FDDA 2IAJA 1RTHA 4I64A 4TNOA 1Y3KA 1C1CA 5F0UA 1JXLA 2PI4A 4OZ5A 2PI5A 2V0NA 3QPIA 4OZNA 3PW2A 1PC4A 3N6NA 4Z2XA 1FF2A 2XCAA 5IT4A 2ZNYA 4XPEA 4ZCMA 3GFHA 4GC7A 1HI8A 2OTLS 2DHXA 3UQSA 4PWDB 4I67A 1SQEA 3PV8A 1D0EA 5E5NA 4I69A 2NYIA 1XBWA 4F4WA 4TN2A 2YNIB 5SZTA 2CDQA 2XMMA 4HT7A 4LSLB 5KFNA 3OL7A 3DOKA 4WYWA 3Q0AA 2JVOA 3MPVA 2KXFA 5KFYA 2WONB 3VZHA 1XERA 2FHOB 3EXYA 2HGLA 2CZVC 1KRPA 2JLEA 2Z2MA 4CNZA 4Q0BB 2BQRA 4J9MA 4F2RA 5JJBA 1LWCB 1LW2A 4I0WA 3MDFA 3T5HA 5E41A 1S9GA 4LIRA 2EWHA 3GFXA 1V6HA 1UVJA 1P9QC 2EFGA 3CC7S 4NPOA 1HWUA 1C0UA 3MUMP 1U47A 1Z2LA 4YR0A 2GV1A 3PY8A 2XY6A 1ZAXA 5A0YA 3G4SS 2K8GA 3ZZRA 3B4DA 4CI0B 2VBZA 5DGAA 1SV5B 3SYZA 1RQ0A 1V3SA 4DJBA 4FF1A 4IYQA 3TUJC 1IQTA 1HBMA 1N36F 2M0GB 4G1QA 2W9CA 2W8KA 1VMBA 4LSNA 2HHTA 4QIEA 2IM1A 2AU0A 3I87A 5B0AA 3I0RB 4H4MB 4NYZA 1UEVA 1B0VA 4IFYA 4OJ3A 4ELVA 3M30B 4XPCA 3MAHA 3G6ES 4JI7F 2DNRA 1YG0A 5D4PA 3FSXA 1U1LA 4QW8A 3JSMB 2PD1A 2DHAA 1YQHA 3OJSA 2X1FA 4K4TA 3CCES 1YI2S 3Q2TC 2KG1A 1Q81T 2ASJA 1S99A 2J9DE 5HLFB 4OQJA 2DGQA 1O5JA 4DFKA 1B0PA 4FZVA 2DIVA 3B82A 4DMZA 4IQMA 1J5OA 5B09A 2M52A 3O8WA 4NZ7A 2V8VA 1S49A 3QLHA 2X1AA 1RYRA 1P8GA 2VG6B 3GYNA 4DEZA 2YY3A 5IM0A 3MPYA 1FTRA 4CH0S 4UQTA 1VC6A 4OHYA 2ZH5A 3H5XA 1V9OA 2YNGB 2DNPA 3QIPB 5KOWA 1S1XA 5H9FJ 4TQRA 3OL6A 4FNHA 3QAUA 2XS5A 2WBMA 4RW6B 4FXWA 4R25A 3HLUA 2DHSA 4H4OB 4J5OA 4DG1A 4OX6A 4FF2A 4ECUA 4XAKA 4K5SA 3RTVA 3RYLA 3DXSX 1RA6A 3HHLA 1QUPA 4ZP9A 4WFAQ 1JMTA 1EP4A 1R6YA 4IDKB 5K8MA 5J1EB 4PXBA 3NS5A 1SH3A 4KHPF 3EZUA 2ASYA 2VG7A 3DOLB 2I5JB 3FRZA 1HQUA 3M2RB 2V94A 1NNDA 2BM0A 3DRRA 2J0SD 2EK6A 3VCDA 5GAHI 1HWIA 5DG9A 4ZVFA 2JSXA 3NG8A 3S8SA 5M2RA 5KFUA 3AB4B 4RW7B 4ID8A 2VONA 3VAIA 2RD5C 3KNAA 2B5JB 5KFVA 4ETZA 4ZCIA 4X4OA 2KH9A 5F3ZA 2MZTA 1WELA 3OUYA 2FHJD 1SL1A 2JWNA 4NMLA 1LXJA 4GC6A 3TVZA 5B0CA 4OI2A 2COLA 5EX0A 2PO4A 4I1TA 4DV2F 2DNLA 1K9MT 1CPZA 3OR1B 4G1PA 1SKSA 3CEDA 2YX1A 2LXIA 1RI7A 3JYTA 1VQMS 2MKCA 3MM5B 4IFVA 1SJ3P 3CXCR 3TVYA 3DMJA 2E5LF 3RB4A 1XWLA 2YNHB 2YTCA 1NJWA 1M5VC 1C4CA 1RT5B 1S10A 2KB2A 3GIIA 2DH7A 1NRKA 5KFRA 1NK0A 2C2DA 1HNIB 2RH3A 3JB9k 4R8UB 4X65F 2HZCA 4KC5A 4CO5A 4AL7A 3FMWA 2FLLA 4JV5F 2LECA 4JV2A 2XS7A 2CIMA 1Q82T 2AYEA 4UW2A 1X4EA 1KR4A 2LQ9A 1OQ3A 1S6UA 4ECRA 2JC1A 3KLHB 2DNMA 1QE1A 3JSBA 2E1CA 1LFWA 2J9EA 2DPJA 3LP1A 2CPIA 2IHR1 2HVHA 2NLWA 4LT6A 2UVWA 3T1AA 2IAJB 1RTHB 2BM1A 3KLEA 3BN7A 1C1CB 4PR6A 2HHXA 5CZXA 3SCJE 5FIIA 2XLIA 4O3SA 1X4GA 5JVGQ 1MSWD 3DC2A 4XDDA 3WX4A 3V6DA 4O3NA 3OL9A 1NK6A 3CGIA 1WWHA 2L9NA 2VFTA 2MXYA 3KLGA 3OFFA 4Q2LA 1TFWA 2R7TA 3K8WA 2RF2A 2ZJRQ 3NMRA 1U6BA 1L3UA 5D4OA 3VAJA 4JOUA 3KNGA 4URQU 2QT7A 1ROFA 3ENQA 3BO2A 4RUAA 4H4KC 3UDCA 5C5JA 5E2QA 2DR5A 3NNAA 3DOKB 1NAQA 1WG4A 2RQKA 3D0GE 2QA4G 2ADBA 4P6QA 2J0QD 4BDPA 4KPYA 3E2EA 1C2PA 2F7VA 5AXLA 3W7BA 2D7SA 2DNNA 1FA0A 2IRUA 2KJWA 3CF5Q 1HHTP 4DWIA 2F3JA 4DL4A 1VQSA 1JKHA 1LW2B 2DNGA 2FGCA 2UVVA 1MWZA 5KFKA 2LMIA 2KXHA 3QWPA 2X1GA 3DM2A 1SIWB 2QA2A 2HHUA 3IXQA 1YITS 4C9DA 1RTIA 2UUTA 1JLGA 2KRRA 3FFIA 4MIWA 3T1YF 4LIWA 3KLFA 4QOTA 5A0YB 4F50A 4OI6A 2EKYA 3U27A 2B9WA 2ACYA 2PGCA 1RISA 1TVRA 2H5EA 4R0JA 1LWEA 4C98A 4Q44A 2OIHA