4CYUB

Staphylococcus aureus 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase in complex with ampcpp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
155
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Development of Functionalized Mercaptoguanine Derivatives as Inhibitors of the Folate Biosynthesis Pathway Enzyme 6-Hydroxymethyl-7,8-Dihydropterin Pyrophosphokinase from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords 7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-PYROPHOSPHOKINASE
total genus 40
structure length 155
sequence length 158
chains with identical sequence C, D
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2014-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4cyuB00
5ETKA 3HCXA 1KBRA 5ETMA 5ETTA 4M5MA 4M5GA 3HT0A 1IM6A 1RU1A 1TMMA 3HD1A 3HSDA 5ETOA 3ILIA 1G4CA 3ILJA 4CRJA 3HSJA 4M5HA 5ETPA 1EQ0A 4M5JA 3KUEA 2F65A 3HSGA 3ILOA 3MCNA 4M5LA 1Q0NA 4F7VA 4M5IA 4M5KA 5ETNA 1EQMA 3MCOA 3UDVA 4CYUA 2QX0A 1EX8A 3QBCA 3KUGA 3MCMA 3UDEA 1RB0A 3HD2A 1RU2A 2BMBA 1TMJA 4PZVA 5ETSA 5ETRA 3UD5A 5ETLA 3IP0A 3KUHA 5ETVA 1RTZA 2F63A 1CBKA 3HSZA 1DY3A 1HQ2A 1F9HA 3ILLA 4AD6A 1RAOA 5ETQA 2CG8A 4CWBA 1HKAA 4CYUB 4M5NA
chains in the Genus database with same CATH superfamily
2LVWA 5ETKA 1MWYA 3NS5A 4BCAA 4NL5A 1V5IB 3LAMA 2XYHB 2DIVA 3A12A 3ZZTA 3LPEA 3K57A 2HHHJ 1N52B 4H4OB 3D6MB 1UKUA 2V94A 2IVFB 5RUBA 3Q23A 2GGPB 2F65A 1MMDA 2XY7A 1YTYA 1TK5A 4DV6F 4PWDB 1F2HA 3M7VA 4EO8A 2EFVA 1VIXA 4ETZA 2RS2A 3PZPA 3R5BA 2DIUA 3LP1A 2A10A 4IH5A 5KT7A 4DLEA 4ER8A 1R27B 1AB8A 3RB4A 4ZLNA 5LT5A 4R5PB 5DDQC 3VGSA 4N8OA 1VBXA 4ECRA 5JJBA 2YBVA 2JSXA 2XCAA 3T9ZA 4WCEQ 2G0IA 1AYEA 1TVRB 2CG8A 1F3VA 3O3LA 1R0BG 3RAXA 5DZ7A 2ZITA 1GQEA 2FTRA 1E6YB 1OMSA 2EFPA 1UEVA 2AEJA 5KFJA 1HI0P 3MEKA 2DJWA 3MR6A 3ZNUA 1JLCA 3CDWA 3DYAB 1SJQA 1VCTA 2E7WA 4M5GA 1NO8A 3NCQA 4PG7A 5I42A 3D66A 3AXKA 2W2PP 3MOZA 1RYSA 4FN5A 1IKVA 4GC7A 2JEFA 4E0DA 3IG1A 4RBTA 1H0HB 1JXLA 2AGOA 1DLOA 2BANB 7FDRA 4Y0FA 1S1XA 3X1LB 1VOMA 3DHWC 3MI7X 4S0MA 3VGUA 5KFMA 4DSKA 3QYYA 3I4PA 3I96A 2MZJA 3VHQA 2DXDA 5FD1A 1HQUB 4I68A 1AW0A 1L3VA 1M5PC 3QIPA 4M5NA 3TR5A 4NLQA 5KFBA 1Q78A 4C48A 9RUBA 4IUFA 1WF1A 1QJHA 3QGIA 3KTQA 1CJTB 3D28A 3W5XA 4CNZA 1T05B 2IC3B 4CRJA 2KVIA 2ZE2A 3NAIA 5ADZA 3TZYA 1T0TV 4HT7A 2DYAA 2AYBA 2JFDA 4CP5A 1DRZA 1KLMB 4FBTA 1S49A 3MCOA 1DBDA 5C7PA 4OZNA 1S6OA 3D4JA 4PXBA 4Y6IA 1TAQA 4ZP8A 2DNOA 3M8QB 1LWCB 4CH0S 1LXNA 2HQDA 4OYXA 3WDOA 4CO4A 2ASJA 1A7GE 1YDLA 1B0VA 1QDUB 3D0HE 2XWYA 1WSVA 2Z2YB 5EWGA 3ILLA 2MKSA 3CCWA 1HARA 4LF7J 2HHWA 3G87A 3W64A 2F4VJ 4ANDA 1MN7A 3IO1A 3D2WA 4DR7F 3DKDA 4DV2F 1FT8A 1JLGB 3H0PA 4DV2J 1FFWB 4LFAF 2QYCA 2IRXA 1DTQA 1S79A 4ECWA 1EAYC 1FE0A 1YJNS 4AXJA 3SZ2A 1OSCA 2W1BA 3T1HF 5GAEU 3THPA 5AXLA 1HHTP 1UA1A 1BMQB 2DGTA 1WEXA 2FHJA 2UUTA 4QR2A 3S01A 1RT7B 4B02A 1PO6A 4LF9F 2KRBA 2MHEA 4JI6F 2QX0A 5DM6Q 4YB1P 4NLOA 2R8GA 2UVWA 1SH0A 1RWXB 4OYMA 3BN7A 1FKPA 1D8ZA 3BPSP 3W66A 2HNYA 4JB8B 5D4LA 1DZ5A 2R2TA 1NPKA 2MQOA 2WSCC 1VLOA 2WVEA 4I7FB 4IO1A 2DHSA 2A2CA 4B3OA 1HWKA 3TX8A 1XQIA 4EI2A 5K8NA 2ZKTA 5HLFA 2KYXA 1BWVA 1RCXB 4FBUA 4OHYA 2CQHA 2MZQA 1TL7A 1RT1A 5B0EA 1X9MA 1W26A 1WHXA 2ZM6F 1N4LA 2HWTA 2YWHA 2VQFF 5BXIA 2XMJA 2IJNA 2EFNA 1FEHA 2ZZTA 4QWDA 2VQEJ 1FJGJ 4K4UA 2D69A 2BJ1A 2QFIA 3DGVA 3CO0P 2XB2D 3PJWA 3OFFA 1O8BA 4B17A 5DQIA 2DPJA 1W2IA 5H9FK 3EVWA 1KFDA 4K8RA 2DR7A 2J6SA 2ABYA 4FXVA 1FRHA 4A47A 1S1UA 4EBEA 1JLFB 4C0HA 2GMHA 1XR6A 4MIBA 2GCFA 3JXOA 2F63A 5K8MA 4WTOB 2OGUA 4ELVA 4X64F 3ADAC 4UOHA 1UWBB 4BWJA 5JMNA 5IT9Y 3G2XA 3ULHA 3K0JA 5E3QA 3OR1B 5A8RA 1N34F 2FLLA 2DEJA 4DUYJ 3BQ0A 4IRCA 3FJ2A 2Q43A 1Y11A 3G6VA 1HW9A 1UJ6A 2HS3A 2VKRA 1OO0B 1ROFA 1WTFA 1JIHA 3JSRA 5DLGA 5HJYA 4YP3A 3CJ4A 5KT4A 4KQZA 2QLXA 1C1BB 3DU6A 3MM5B 2E9ZA 1BD6A 1X4AA 3ZZ0A 3DMJA 2KYZA 4JI8F 1KQSR 3ENAA 1K9MT 2R7VA 3DOLB 2BDPA 4RPFA 5KFFA 2OEJA 4ECQA 2YKNB 4CDIA 5F8JA 1N5QA 1TV6B 2Q1LA 3BN4A 2YPYA 3QLHB 1LW2B 4N56A 2DRBA 1BUXA 1UL3A 5JVGQ 2LQ8A 3Q89A 4FNIA 3M8YA 4ZVUB 4G1PA 4IH7A 5THWA 2W9AA 1EZZB 3MMAB 1IWGA 1YJTA 5I3UB 2PSZA 1HQ2A 3DRYA 3M9MB 2V2QA 1UPPA 3ETMA 4E2FB 1ZH5A 2W2MP 1HMVA 3I0SB 1CVJA 2UUWA 3Q86A 2D3OR 1K8AT 1HQEB 2CNOB 2CQ0A 1RTJB 3LP2A 3SDEA 2AZ1A 2QZ8A 1S97A 1NJIT 3KOAA 3A4TA 4NA2A 1VBZA 2MJUA 1HNXJ 2GS8A 1WUUA 4F04B 3C14A 4O3OA 1TL1A 1F5BA 1GT8A 2JX2A 4USHA 4P75A 1FX4A 1WEZA 3U1MA 4A48A 1JMTA 4F3MA 2H1YA 3KK3B 3EGZA 1JLAB 4GVBB 3GJTB 3SEOA 2RUGA 3U7JA 3TQ1A 5B0DA 5BYSA 1DARA 3BH7B 1DHMA 1VRTA 4CI0B 2N4CA 2OHDA 2VZ9A 2FLOA 5GADI 3JQMA 3K5NA 1FKOB 4TY8A 4ECSA 2AKWB 1XMOJ 1JJ4A 4M94A 1S9FA 3W8PA 1NK0A 1NHKL 1TR0A 4RUBA 1SV5A 1KFSA 3BGRA 5K14A 2JLGA 4DL6A 2AYGA 2R2RA 2AV5A 3PR5B 3PIOQ 1UZDA 5LXRA 4I2PA 3OW2R 2DVIA 5IC4B 4JV0A 3QJPA 2YQ1A 2G1DA 2DNHA 2QJ3A 5J2MA 3CJKB 4TU7A 4Y00A 4RW8B 2J9CA 3R3TA 4YB5A 3H2VE 4C8NA 2IMWP 2CQIA 4G3IA 1IJFB 1P27B 2D3UA 3O1LA 5IC6B 1I94J 2LQBA 1ZS6A 3QWUA 5KG5A 2OD4A 2R7SA 2WSEC 1XN9A 1C0UA 2OPSB 5HQ8A 1MW7A 2MKKA 3KLGA 2ZH5A 4F8RA 2HS4A 2BMBA 5ETLA 2UUCJ 4BLGA 2V8PA 4JV1A 1VLYA 3ZXWA 3RUBL 2YX1A 2IJRA 3V4IB 1GTEA 2BKNA 3DGPB 2FUG9 3GYNA 3C19A 1YJ7A 3HVTB 1S1VA 2UXBJ 2NPFA 4F4KA 4I4BA 1GXTA 1JXVA 3ISND 1URRA 3L9ZA 4MYUA 3FRYA 3RTVA 1APSA 1ZBTA 1HBOB 3KXDA 3P49B 1RK8A 4WKRA 3AD9C 2Z8QA 3W62A 3EPGA 3HFKA 3QZ8A 3JAMU 3KHLA 4NLSA 3ILJA 1QM9A 2DHHA 1GNKA 3AQOA 3DRRA 4P2SA 3K5LA 1NSAA 2Z0GA 3KJQB 2JDJA 3M8PA 4WE1A 5KFRA 4D3HA 1TUVA 1XBWA 3FUYA 5KFLA 1S4EA 2KXHA 3ZZOA 2VDIA 2J0QD 2P5VA 1PKUA 3G8QA 1HMVB 3I0SA 4ZIVA 1PYTA 4B3RF 3LGHA 4I67A 2WK4A 3V6DA 4HH1A 4C0BA 4JBCA 3BQ1A 4KFBA 3E01A 3ENVA 4LT6A 4B3TF 2GA7A 2FC9A 2BJ7A 3DRRB 3PR4A 4RU9A 2FJXA 2JEGA 3ITHB 1G2EA 1K0TA 2RH3A 3A3OB 5HVFA 2RDDA 3FZBA 4ANCA 4LF9J 1WELA 2CFXA 1SJ3P 1HHSA 3AB2B 1GMVA 4OMFG 2GJFA 4KE5A 1PAEX 4D3GA 3DMJB 2A3JA 3P3DA 3LQVA 1X0FA 1LWXA 2QV6A 3OTOJ 4ZVSB 4N41A 2IY5B 4JI2F 1OS5A 3R27A 3UNYA 2VICA 3GSDA 4DWIA 3NBPB 2BVZA 5KFYA 1ZTWA 1LEOA 5C2GA 4ZCKA 4O0NA 2ZBPA 2DRDA 2QMUB 2CKWA 2CJQA 4LREA 5IWAJ 4Y3CA 2X3GA 2KG0A 2RRAA 3NNAA 1SPBP 2C2KB 4LVNP 1RQ0A 4IFYB 4K2XA 1DURA 1HNVB 2VONA 1LFWA 1OQ6A 3KDNA 3FSXA 1K1QA 4CLYA 1HBNB 2UUAF 2XMMA 4DEZA 2C2DA 4LF1A 1EETB 3VQTA 1S59A 3I0RA 3EM1A 2LA6A 4N76A 4PXDA 1ZAXA 1MU2A 3GIKA 5A8WA 5ETMA 1YITS 1TP7A 1V9OA 3I56S 5M2RA 4DZDA 1EP4A 2DR5A 2RRBA 4O3SA 4DX8H 1NDKA 2Y1JA 3IBFB 5D77A 5LSLA 2V68A 4USIA 1RT1B 4ZKAA 3HM9A 1Q5YA 3V81A 1ZYQA 1D3WA 4LMZA 4QPXA 4MFBA 2R7TA 1EX8A 3T5JA 2DNKA 3CSKA 2HIQA 2M8HA 2DGOA 2HBRB 5E7OB 3UDEA 1TZ0A 2AJ4A 4C8OA 3MEGA 4LF6F 4G1QB 1REVB 4FYWB 1DQAA 5A0YB 3DLKB 3PYFA 4UZCA 2KM8B 2VL1A 3RBZA 2ASLA 1B3TA 4KHPJ 2Q6BA 1NJZA 1VQ6S 3SI8A 4C98A 4DR3F 1F3FA 4F4ZA 4ATNA 1SKSA 3PO5A 3O2IA 5DDOC 4GC6A 3HT0A 4FS1A 3TJ8A 1LK5A 2H5EA 4V19J 1HR0J 3UDLA 3OBIA 3DRSB 2GHWA 2X1GA 3IWXA 3W5YA 3SSSA 4LF2A 4BHQA 2VD3A 4OJHA 3JTNA 4B9UA 4DQRA 1N54B 4FNHA 2BYCA 2Z56B 3LF0A 5DM7Q 4X4VA 1PC4A 1RB0A 1TQLA 1VRUA 4MK7A 1R0AA 2V4JA 4RWWA 3K59A 3DLBA 1DAXA 3DRXA 3VF0B 3IN5A 5J2NA 4N47A 3AOCA 2FGOA 2CJXB 3AT1B 3OFGA 2O3DA 2IIHA 1TUWA 3BM7A 4RJVA 3FBEA 2CG4A 1H38A 3LP0A 2UXDF 1LWCA 1O6XA 3C66A 3UCGA 3WC2A 1Q8IA 5GAGI 3GQCA 4OZ5A 5HBMB 5K8PA 1F2GA 2I5JB 2ZEJA 4QPTA 3AXMA 3FEZA 4OIXA 2CNLB 3IS9A 1IBLJ 1IQTA 1XNQJ 3P96A 2G2OA 2ZBIA 2VG7B 3G8TA 4TY8B 1HA1A 1S4FA 2RU9A 3H98A 3AD8C 2FQQB 2CADA 3T1YF 2JNJA 4RBUA 4OX9F 4OV1A 3HMJG 3CCLS 4OX9J 3QIPB 1HYSB 1S1TB 1SQFA 3OR2A 3J7A1 1WI8A 3N6LA 4JI0F 2M88A 3CD0A 3D6HB 3BR9A 5ETRA 2ZUGA 2E7XA 3TEHB 3M2UA 4OFZA 1Q5VA 2QC3A 4I69A 1U4BA 2CPYA 4PG6A 2YQ0A 2CZVC 1CJKA 2VBWA 2VFVA 3M2VA 3TO8A 1WORA 4ID5B 5DZ6A 5IFMA 1YJRA 2ZOFA 1FK9B 3MPYA 4NRUA 8ATCB 3C16B 5KG3A 3QZ7A 2HNZA 1H98A 2GQCA 2DY1A 1RISA 1TL3A 1FEEA 4LRBA 4MH8A 4B3SF 1UEUA 2IPOB 3AH6A 5B08A 3GIMA 2NXEA 2LP4A 1KRPA 4KTQA 1RAIB 4CO3A 4MTPA 3NRBA 4NPOA 2L3MA 5CAAA 2A0FB 5L8RC 3LANA 4EBCA 3G6YA 2HMIA 2D9OA 4F02A 3FDSA 2RKIA 1CS4B 3ZTSA 2XMTA 4DR4F 1S9EA 2AYMA 2BEFA 1FJEB 3MCMA 2NREA 3LGMA 3UD5A 2DD8S 2O1PA 3MM9A 1Y5IB 2VPWB 5KFNA 2UP1A 4RO0A 5H9EJ 1KTQA 3NS7B 2HNDB 1S1WA 1YBUA 1TKTB 2EG2A 3CDEA 4GMKA 1TKXB 6FDRA 4DDFA 4DPXA 4QWAA 4M95A 2YH1A 1MG7A 4F0HA 5D0RA 4DX5A 4IQMA 1M5OC 2IM2A 3BSOA 4O0IA 1FWPA 1HBMA 4ILLA 4F50A 5K5MA 3W63A 5LL6d 5L1IA 3RBXA 3DXBA 4JI2J 3VALA 1JXEA 4DPOA 2HYIB 1IKXA 1NK8A 4OYAA 5CCMA 3OHBA 3GV8B 4QYZJ 2A1BA 2CRLA 3BKTA 1UFKA 4CLLA 3TI0A 1OY8A 3TZWA 4DSFA 4ILMA 2RILA 4ZPTR 2EXUA 1JLBB 8AT1B 4WFNQ 1VC0A 1S48A 4KGZB 2Z2MA 5FJ4A 1XEZA 4CO2A 4AXIA 2NUHA 2J7KA 3ENWA 4AD6A 3GR1A 1M90T 3VAKA 3M05A 4RX6A 1JJCB 2B7BB 4NLRA 4USMA 2VQEF 2BQUA 1KQGB 2ADCA 2PDAA 5HROB 3MPVA 2R8KA 2DTJA 3ELHA 3SQGA 4KSEB 1PSDA 4RLEA 3CCQS 4KV8A 4PXEA 1PILA 2ROPA 3ENQA 3H2UB 5HI7A 4DBQA 1FESA 2U2FA 2H9ZA 5CCLA 5M2PA 1UVLA 2CPIA 2CYYA 5ETPA 3Q8QB 1N5YB 3D0IE 1H7WA 3UVJA 1LW2A 4C2MA 4X4SA 3RR8A 1SKWA 3C15B 4I6AA 3UN5A 4F67A 2P2CB 2VU5A 3PTWA 2MKIA 3HD2A 5J2QA 3T1HJ 3FCVA 1U6BA 4YHHF 3IRWP 4WZMA 3MPDA 1Y10A 4YHHJ 2MKCA 4YMEA 2IRYA 3QT8A 4LF7F 3BBFA 4P52A 1AFIA 2VFRA 4A8QA 5C2CA 2YNHA 3CJ2A 4LUBA 5IT0A 3TJAA 3H5XA 4LF4F 2XG8A 3M6WA 4J9UE 2DKOB 1SCJB 2XLKA 4Y65A 4BWMA 4WK3A 4LIWA 4FYXB 2NYHA 2RD5C 1IM6A 4UQTA 4DPTA 5T7LB 5CYQA 3SBMA 1D9AA 4ZP9A 1S76D 1M1HA 2OUGA 3D5MA 4O23A 4ES2A 2W01A 4HHJA 4KBIA 3D6FB 1WDDA 4OI6A 3BJYA 3HJVA 2X1BA 3DLGA 4JOUA 3NLCA 4MT1A 4LFBJ 1RACB 1YRXA 2HPUA 4WFBQ 3LUYA 2V50A 2AF6A 4LSNB 4TLQA 5GAEI 4HDHA 2L08A 3M6UA 3K2YA 3DOLA 3G86A 4NA3A 4HEA9 4LVOP 4DUYF 3LAKA 4OL8A 4EK2A 2C22A 1GFWB 1VMBA 2ZKUA 1SL2A 3S1TA 2VOPA 4Q44A 4ED5A 2MGZB 3OUYB 3KHRA 4CLKA 4NYOA 3KJVB 1UCNA 3KHGA 1S9EB 3W2WB 3CCMS 3TAPA 4I64A 4CIOA 2UUBJ 2VKZG 4WFZA 1JLQB 3DI6B 3MM8B 3CDBA 1RI7A 1UEKA 2D41A 2DH8A 2QSFA 2XSJB 4LBIA 4F3QA 5C25B 5KT6A 3TVYA 1I94F 2B7CB 3NOGA 4DX7A 2QA4S 1U1NA 1U2RA 1IKYA 3UO0A 1TTHB 3FKBA 4CO0A 2R4FA 4ELUA 5HMYA 2MY7A 5GADU 2HNZB 1RTIA 3R7NB 1I1GA 2HQCA 3CW2C 1PAUB 1D9DA 4DSIA 2W7PA 4W4MA 4MMOA 1VISA 2FJDB 1DTTA 1N5VA 4CLWA 1H2VZ 2YWKA 2PA8D 3F0NA 3VVTA 3KLIA 4DR1F 2QL9B 1X4EA 3AB4B 2EK6A 5FIIA 2FY1A 1X9SA 5I42B 1F9HA 2HBYB 5DETA 2HZVA 1LNQA 3QGHA 1YWXA 2P9GA 2J0XA 3NXZA 1NCLA 1J27A 4O44A 4O3PA 2KH9A 3KK2A 5D4PA 1FRMA 3QGGA 2ACMA 1AUDA 1QSYA 4Q0BB 2CJ9A 2IVMA 2QEXS 3EXYA 5HN0A 4J91A 5B0FA 2F40A 3QATA 4OJGA 3LWMA 1G4CA 2DPIA 1BC6A 2XBPA 4YB7A 1NLKL 3HSJA 5A0YA 4IKAA 4U8YA 5KG7A 4JI4F 5DG8A 5AXKA 4ZVRB 3W2WA 2FZCB 3NKYA 1SQEA 3FEYB 1U48A 3PKYA 4DPWA 4NCGA 4WIIA 1IBMF 1JJ2R 1WG4A 4KJIA 1Q8LA 4C11B 1RAJA 4CH7A 1RT6B 1IKXB 2XEXA 3IGVA 5A8KA 4ZIWA 3VAIA 2EKNA 1CJTA 3RJMB 1RWWB 3H2LA 3TQEA 3PG9A 3TZXA 2W8LA 3Q24A 4X65F 1QE1A 3MMCB 2JEJA 4P2XA 3DC2A 1S6QB 1IWAA 3U27A 1G3OA 2WB1D 3L3CA 3CMQA 4OYPA 1S0VA 1HQUA 4QYZK 3A3PB 1T95A 1UJ4A 2FD2A 3FCHA 3O44A 1RU1A 4ICLA 2K8GA 4LJMA 2P6SA 3UE2A 4R0JA 2CPDA 1X5SA 5HVGA 1N32F 4QIFA 1YKWA 4A8OA 1S1XB 4P2MA 4USJC 3C46A 5G0RB 2NSBA 3M2RA 3I87A 3MF5A 2XMWA 2MZRA 3MEEA 2X51A 2HBQB 5KG2A 2YVSA 4X62F 3T3FA 3E3XA 4DS5A 3DLEB 1KLMA 1RTZA 2BE7D 2DH7A 2K1RB 1CBKA 3MCSA 4K5SA 4DJBA 4DN0A 2J5AA 2FJVA 4PKDB 3H42A 2KJWA 1EKSA 2FJEB 4H4KC 2F7VA 3ZTOA 1NUEA 1S5ZA 2F5GA 3AD7C 2UUCF 2OEKA 3DHXA 3EVMA 3CO9A 4PWUA 3VWSA 4WYLA 3T5LA 1KNZA 1MMNA 4ZPAA 3P5TL 3KJNB 4OYBA 5HP1B 1FFGB 2PEHA 2QIFA 1N6QB 5C5JA 4ITSA 1VFJA 1VQSA 3H5UA 2RDJA 1NNDA 4P7VA 2BJ3A 4A8KA 4LSNA 4DR3J 4IFVB 4X2BA 1WACA 2M4MA 4B3MJ 2QA1A 1OY9A 2WVFA 1RT3A 4QIGA 2GAGC 3HHLB 3L7PA 1OYDA 4USWA 3B78A 1QY7A 3PHEA 3MTKA 1EKRA 2QL5B 4WFXA 4LFCF 3SCJE 4J9LA 4X4UA 5AE3A 1VQLS 5HATA 2N3LA 3BGOP 4CWBA 2DXEA 2JZ5A 5K9FA 1SXLA 1Q4RA 2R42A 3DRPB 3PHTA 3OSNA 2N7YA 2V8HA 3FEXB 4USUA 3DOMB 4K4TA 2FC8A 4MAKA 4RBVA 2CPHA 5IV4A 2QMXA 3TA2A 5ETOA 5IXUA 2DGQA 3PW7A 3ONQA 4GO7X 3QT5A 2W9BB 1RA6A 2KU7A 2GMJA 4WU2A 1S7HA 3TYTA 3MFHA 2M2BA 3PY8A 4F4XA 2RQCA 5IT4A 3SSRA 3THTA 3QMQA 1VS3A 5DO2A 4FDFA 2HRTA 2DH9A 1SKUB 1IBLF 3QGPA 1SVDA 1V3SA 2B5JA 3M1VB 4U96A 2YKQA 2K7JA 3SSQA 1NKCA 2AEMA 2BJ8A 1VGYA 1R31A 4LF8J 3DRSA 4CTAB 4FZVA 5EWEA 5C42A 4U7UD 3G6ES 4UT4A 2GGPA 3FNNA 4PPDA 3K5OA 1TK0A 3GFYA 4RKUC 2ZH2A 4EU0A 1NMEB 4MKAA 5H1SV 2LDIA 3IS9B 5KFCA 4C8KA 2DR6A 4OYZA 5FDLA 5KFVA 1RGVA 2WONB 1JNZB 2WCXA 2G2ZA 3L4BC 1C1CB 2BQRA 4EBDA 1C4AA 1RXOB 3BREA 1FDNA 1R0CB 4NMXA 4DHVA 2E7VA 4IRDA 2DNYA 3S7RA 3I4HX 3ET6A 2XGPA 1ZPWX 1I6JA 1F0XA 1N0VC 5H9FJ 4CT9A 2NR0A 2LEAA 1EJ7L 2ATCB 4JI1J 2WBRA 4WJBA 5SZTA 4DZ6A 1SUQA 3QBCA 4KHPF 2DNZA 3HVTA 4WK1A 2FVPA 3M2VB 1U45A 1T8EA 1M5VC 2HHVA 1VC6A 1KDNA 3I5BA 3UR0A 2PE8A 4KAIA 4M63A 1N34J 1JX4A 2HZAA 4YDDB 3OXLA 2BOPA 1TUGB 3MM6B 1X60A 2DO0A 2YKOA 4CLPA 3MPWA 4X66F 2KM8C 3OVAA 3JSMB 4PUOB 1HYSA 2CJBA 2NUUG 4ZLJA 3BGFA 1XTZA 4K59A 2R7XA 1IJEB 3R6LB 1S9GB 2W2NP 4DV4F 4GKJF 5DLFA 2RKIB 1FNOA 3CJ8A 4I1TA 1UA0A 1RKJA 4LFBF 3WQPA 1HNVA 4M5HA 2FDNA 2WZ1A 4QBUA 3K58A 1YGYA 1LXJA 3ZFVA 2EVZA 4EGLA 1NH8A 3R8YA 3VGVA 4DL5A 3R2DJ 4DV5J 2C3OA 2QRRA 2V67A 2HWHA 3QAUA 2RVJA 1KP6A 1IBMJ 3HZGA 3QT7A 2RAQA 1CC8A 1RU2A 1SL1A 4KH0B 2EKYA 4B3SJ 4BC9A 3OUYA 3W3SA 1S12A 4LQ9A 3A13A 3BS9A 2OTLS 3M9OB 2W9BA 2HRYA 2RDIA 3MPUB 1NJWA 4PQUA 5IWAF 3CJ0A 1YBAA 2O66A 4BDPA 3GILA 1PJ6A 3M30A 1KEKA 5JXSA 5DG9A 2EBEA 1X4FA 2BJEA 5E0OA 5LMNF 4ED4A 2Q6CA 4RNFA 1AT1B 4M5MA 3TUJC 5KFAA 4DV1F 2ROEA 1GH8A 3C8YA 3KYLA 5F3ZA 1K0VA 4QU7A 3TRGA 4NOHA 4NYPA 3KKFA 1MN9A 1TKXA 2F9DA 2W2QP 5KOWA 4RR5A 4PRFA 4DUZJ 5DDRC 5ETNA 4DR1J 4KPYA 4JI8J 3SYZA 4RUHA 2C2RA 5GMEA 4DU7A 1N33F 3J80U 1JK9B 1CS4A 2KRRA 1WWHA 1IXKA 3HHEA 2W2OP 2AT1B 3QNWB 4ETXA 2A2DA 2MLYA 4ZVEA 2RNEA 4WFAQ 2XZDB 3OXGA 3GV7B 1SC6A 1W25A 4Z7CA 2QLWA 1FF2A 3V5RA 4QIEA 5J2QB 3HHDA 3R1LA 4CO5A 1NB7A 1LW0A 4ELTA 2KHCA 3W9JA 1R43A 3A3NB 3V4IA 2XY5A 1TMMA 3DGPA 3IFEA 2MXYA 3OJSA 4RNMA 5J2NB 3VV2B 2K1RA 4DCPB 1EQ0A 1RKIA 1ZPVA 5ITHA 3PX4A 1J5EJ 1LK7A 2JH3A 3A8IA 4M5IA 3W1YC 5A6PA 4LIRA 3PDNA 4NLYA 4TLRA 5FDLB 2V5HG 4CYUA 5IQ6A 1PBUA 2X3DA 4G6VB 2RT3A 1KQFB 3M8SA 1M1GA 2PC6A 3D1QA 2M7SA 1EIYB 2BW7A 3VAJA 4W98A 5LSRA 4QW9A 3B6BA 4PWWA 2RUSA 2VG7A 2XTJP 3CJTA 4WKYA 4Q2MA 2KHDA 3Q22A 3MEGB 1G7CB 4ZCLA 2E9RX 1OIAA 7AT1B 1RDRA 2J7UA 3U1NA 2RRNA 1IBKF 2DNRA 1SJ4P 1S10A 2HLUA 3CF5Q 2EG1A 2P6TA 2FVRA 1YVFA 2J6TA 4EYIB 4ED7A 1CULA 4M5JA 2PN6A 2EW9A 4OHVA 1U47A 2BW2A 2ILZA 3DRPA 3BGLA 1QTMA 1ZOTA 1U0HB 3G9CA 4B3OB 1MU2B 3OFEA 3WBZA 2B0GA 2OPRA 1GMWD 1F1BB 2OO4A 2ZNZA 3AODA 3ET6B 4LR9A 1QVGR 1AXQA 2F8MA 2V4RA 3GFHA 2HEKA 1RZMA 4J90A 5SUHA 1WSRA 2GJIA 1RTJA 2ZBQA 3LP2B 2BUNA 1RT3B 3SDEB 3NNHA 2HFSA 5E33A 1KC8T 2GIRA 1JNRB 4QR0A 2BBEA 5KAKA 4FKYA 4QWBA 3GIIA 4MKBA 3MR3A 2FLNA 3PNIA 3TAMB 1HW8A 5J1PA 1U2FA 5DGBA 1DFDA 3BGRB 3MMAA 1DJ0A 5I3UA 3IM9A 1MSWD 4PG4A 2LQ5A 4F2SA 5GAHU 1F9FA 2MQPA 1VHFA 4AQYF 4MK9A 3X3UA 2Z2LA 1Q86T 4K50A 2G1HA 3L95X 2QTWA 4ZLLA 1YLXA 1N8RT 1FK9A 1WG5A 2V34A 5CHCB 4ZCIA 4MIWA 3D0GE 4OZ2A 2XMKA 3WZ0A 1U1RA 2Z4PA 2HFNA 1KONA 1HLWA 1CC7A 2R7OA 1PJ7A 1TL1B 3F44A 1U1KA 2QT7A 2OIHA 4DUTA 1EP4B 4JI5J 4PYAA 1TELA 3TARA 4QIWD 1Q95G 3S8SA 4DL3A 1S0MA 4OI2A 1FRLA 2ZZMA 3PW4A 2V2KA 3UD3P 2E1CA 4Y2CA 4DQPA 3JQKA 4KRWA 4DQIA 5CZVA 3PXGa 5HL7Q 2V2ZA 3E01B 2R8HA 2HHTA 4R5PA 4NCBA 1YIJS 1H73A 4CH1A 1BE4A 4DI6A 1FRIA 1X4CA 2PD1A 2UZAA 2OFHX 3NGRA 3RYLA 2ZH9A 2CQDA 3D7SB 4URQU 5KFDA 3RB3A 2XNRA 3J7YI 5KG0A 5KG6A 3UPFA 1TMJA 2IM3A 2E1MC 1ZM4A 1L3UA 2C3YA 1KHWA 4ZPBA 1CULB 2DK2A 2XULA 1X8DA 4OJ3A 5D78A 2XYGB 5KFUA 2P9EA 2PT0A 4X64J 3OVBA 4B3RJ 4ED2A 1IR0A 2J9DA 3AHPA 1NB2A 3GR0A 3WIVA 3CMAS 5KFHA 4DF4A 3PX0A 1KBRA 2W8KA 4I7FA 1K73T 5DQGA 2M9KA 2Z30B 2HQ3A 4K5RA 2OLWA 3HFVA 3BF4A 2IAJA 3MWBA 1IR2A 2AJ2A 5J1EA 1FKPB 5HMWA 3MEEB 4YR3A 3J81U 5GMKa 1SIWB 2Y1IA 1X7VA 2WONA 1P1TA 1S9GA 3OL8A 2I8EA 1WHVA 4USVA 2YNGA 2KO1A 2V9WA 3BPDA 1SC4B 3DDNA 3UNGC 4LR8A 3JSMA 4J9SA 3VQSA 4L74A 2CNKB 3CJKA 3OV7A 4WP3A 3VR1A 4QZVB 1QVFR 2ZOGA 1UVMA 1AROP 1PG5B 2HFVA 3HFZB 5CD4H 4G1QA 3KHHA 2VH7A 4OZ1A 2WVDA 2V8GA 3NP5A 1VQ9S 2ZDPA 1TFYA 2B9WA 2ZD1B 4ED0A 3HLUA 4RW4B 1VBKA 4DOZA 1HHQA 4DPYA 2FHMA 3CCRS 1ZZFA 4ZJQA 1BWEA 1J2VA 3MXHP 4OYWA 1FI4A 1TL4A 3KJFB 3J7Z5 1RWUA 3EYZA 1ITPA 2FGCA 3H59A 1WC5A 3K89A 5AXMA 3KJVA 3SMZA 3W61A 4X65J 4K4XA 3KDOA 3NY0A 1WDTA 2SXLA 3EZUA 1EETA 2CQ4A 1VR6A 2H4WB 2NLWA 2CXEA 3DLHA 2J9DE 4JI3F 3PRVA 2XNQA 4UQGA 5I4MA 2DNMA 4NE9C 1RWKB 3UN2A 2OTJS 2GFFA 2ZBCA 3Q8YA 4HTJA 3RRGA 4AT1B 3H5YA 3M1VA 4XPCA 3KMSA 1LV5A 2MKHA 3NWRA 4DS4A 3RRKA 4ZVOB 1KS2A 3TVZA 2EK1A 2KXNB 5L1LA 2B6AB 2G9OA 1D9FA 4IQXA 3BR8A 4JI4J 4PQUB 1FKOA 2FB0A 1WC3A 1WKLA 4KGMA 1Q0NA 5KT5A 5HLFB 4P2FA 2IYGA 2HW3A 3MUVP 4LSZB 2JLEA 3DOMA 3PYEA 1N56A 1NU4A 4NLUA 1VQMS 1HNWF 2LDYA 3BV8A 4J9NA 1CQMA 2MHNA 4DPUA 1Y3JA 4NI2A 3JYTB 2C2ZB 3NGSA 4UTGA 5IM0B 4JI1F 4LRDA 2BV3A 2XSJA 5C25A 2KFYA 4DFPA 4Q43A 1SQGA 2FPHX 5IS2A 4L3NA 4WIQA 2ZWOA 3RBDA 2GVDB 1HKAA 3BSAA 2R8IA 2ZHBA 3RW6A 3TA0A 2ROGA 1S1UB 3KG0A 2J76E 1B7FA 2DHAA 3U02A 2L9NA 3LPYA 4IFVA 3ILIA 1TKZA 4EMDA 3T5KA 5KFQA 4HYKA 4PG5A 1TK8A 1T9UA 2PA3A 3G82B 4LQ3A 2KVQE 2RF2A 3M2UB 5DG7A 4ENOA 4L72B 1NKBA 4ZP7A 1CLFA 5B0AA 2UUAJ 2Z2ZA 1FXDA 4J5OA 4OHZA 2DBBA 3IAM9 3G71S 5KFTA 5HP1A 2ERRA 4TXSA 1N6QA 4GKJJ 3SQOP 2NZCA 3ZTQA 3OTCA 4WTYA 2FHOB 1KOHA 3SCLE 3SCIE 3FRZA 3IP0A 2JWNA 2GX8A 5E3RA 4DV5F 5T7LA 2HQFA 1IKWB 2H48B 2BXJA 3HHLC 4X66J 1IKVB 2DB1A 4EZ6A 4NCGB 3LWLA 5D4NA 2BKOA 3BYPA 4KR0B 3W60A 3P45B 4DV4J 3N4WA 2PMWA 4HL9A 4ZVQB 1S72S 4NZ0A 2DGWA 1VK3A 3BBCA 3UWTA 4HTIA 4ZVHA 4CLSA 3TA1A 2VB6A 4LSLB 3I9V9 3SIPB 3MZIA 2AX0A 3LALA 1NXIA 2GQQA 3R6GB 4I2QB 4TN2A 4KV8B 3B82A 1FVSA 1R8BA 2H54B 3EZOA 3TUZC 3C6TB 5KFPA 5E3CA 2P8IA 2CPEA 1S0NA 4O3QA 4KKOB 4ZLPA 1X4BA 1UFWA 2I1RA 1DTQB 5E2QA 1VIOA 2DNLA 2E5HA 1RWVB 2FHJD 2OSRA 3IA0A 4B9MA 3CJRA 5BYRA 1B70B 1F9EB 5F3TA 4PABA 4DV1J 2UXDJ 3KK3A 1ZA1B 3P5BP 6AT1B 3PW2A 2HHPA 2NYIA 2OPPB 2GAHC 5E5NA 3T1AA 2YNHB 2MZ1A 3BEGB 3DI6A 5DGAA 2AJQA 1Y00A 4YOEA 4WZQA 1X4HA 2AHOB 3PIPQ 4UY85 3C16A 3FSYA 1B0TA 2LMIA 4NLXA 4KB7A 3SFUA 2A6OA 3D6TB 2MGZA 3QRRA 2CDQA 2V0NA 1G1XA 1U1MA 4UZBA 4LRCA 3C15A 1RHKB 2IC3A 2CQ2A 1V5VA 4DL0C 4AYBD 2OAUA 1DY3A 3A8KA 3G82A 5F8HA 4DCJB 4K4WA 4RU2A 1HBMB 2UUBF 2B4VA 1NJXA 2GIFA 1RAFB 4O3RA 1U1PA 4UY8T 2KI2A 4LFCJ 3OLBA 3C6TA 3R7BB 1OY6A 2DNPA 2UXCJ 2BQ3A 1FDAA 1RWPB 2YNGB 2N3OA 4OZLA 3TWZA 2H3EB 5EDWA 1WF0A 3EZ5A 1NSKL 4C9DA 2HSEB 3DNCA 2HVZA 2EC2A 5EX0A 2KFNA 5A76A 1XERA 2CZ4A 2FVCA 3EMTA 3T41A 1KSPA 1M5SA 2QSWA 4F2RA 1VYAA 3OL9A 2VPXB 1TL5A 2WBMA 4K7QA 3GPAA 1BHNA 2OELA 4F4WA 1U49A 2I2YA 1JLQA 3GYGA 4HH0A 5LJ3Y 3FGVA 2HMIB 3HO1A 2X1AA 4NEZA 4PQAA 1X31C 2MZSA 1RAEB 2QA2A 2MKJA 2YKMB 2ZHOA 1MMLA 3BKUA 3CPWR 5L1KA 1RLDA 1W7WA 2W4DA 3KK1B 5F9LA 2E1AA 3Q8RB 1FRKA 3KG4A 4CT8A 1C0TB 2HIYA 3NAHA 3B4MA 1UTAA 2Q66A 2IFXA 4ZHRA 2HFUA 2H4YB 3E51A 4AL7A 1HWJA 1U7LA 3NCRA 5I3PA 1BQNB 1IQZA 4NLDA 3UVJB 1KLNA 3HD1A 1PBAA 3LW5C 3MMCA 4DQSA 1H7XA 4J9RA 1R6VA 1WC0A 4LF4J 1Q8KA 2B3TB 4NZ6A 4RW7A 2XM3A 4OI4A 1UP1A 1TKTA 3LP1B 5GMDA 1RT6A 4EO6A 2DT9A 2BJDA 5A8KB 2ZD1A 4C11A 1ICEB 5CYQB 4E8UA 1RHMB 3EWGA 1EQMA 5B09A 4CLUA 4YEAA 2C3UA 3CJ3A 2I5JA 2CPZA 1RCOB 5J2PA 1CG2A 2VODA 1SI9A 2PEBA 3A8JA 4P6QA 4H4OA 2BE9B 4LBPA 4X4PA 4QWCA 3OVSA 4J9MA 3BDEA 3QJJA 3EDRB 1E6VA 4DL4A 2NXJA 4ILRA 4AL6A 3CE8A 1NDCA 1FXRA 1Q79A 1XJWB 3K5PA 2XQCA 5AJ3F 1KN6A 4LFAJ 2QMWA 3K5MA 2J0SD 2W25A 4NLGA 3QPIA 4DX6A 3DCAA 3FSIA 2YY3A 2V4QA 1QSLA 2KT5A 3BQ2A 1KWMA 2V8VA 4WBFA 2MMYA 3OLAA 4C8ZA 5AE1A 4DV6J 1NK9A 1CJKB 1MLAA 1ZM9A 4KH1B 4URSA 5B0GA 1RUSA 3KUEA 1R0AB 4PYDA 1N36F 4F3OA 2XHCA 3N5BA 2CQPA 1HNIB 3D3CJ 4Y2KA 4FPIA 4R25A 2CVIA 2M70A 3IM8A 1S0OA 4OZ3A 3TAMA 4KPCA 2ZH7A 3CULA 3B8HA 3HI9A 2HVIA 2GVZA 2AQ4A 4B3MF 2ZVSA 2OP5A 5ETVA 5JVHQ 4JP8A 4CZCA 2XYPB 3JS9A 3GFXA 3WX8A 4XO0A 2EWHA 3ZNJ1 4HR2A 3MMJA 2IMOA 2OPQA 2XI3A 2DGVA 2B4UA 2GV1A 1VRQC 1UVKA 2BRLA 3GG0A 4NASA 1CSJA 4A8WA 1URNA 1PCAA 1AZSB 1CQNA 2MLXA 3CCVS 1YK9A 2E5LF 4W92B 1U26A 3MD3A 4MFBB 2G13A 1P9QC 1U6ZA 2PO4A 4ZVFA 2NZ4A 2M3DA 3AJ2A 3FFIA 1TAUA 3P8BB 4KGVB 4RNOA 1F6TA 1DQ8A 1IKWA 1RA7A 1RWNB 3F56A 3QQCD 3GV5B 2JEIA 2C2MB 1YQHA 5CYMB 4DR5F 4DR5J 1PYSB 2AW0A 2UVUA 2E5IA 4LR7A 4ID5A 2F3JA 4URGA 4TNOA 1G6BA 3H40A 4LF5J 2VASA 1XMOF 2LU1A 3C14B 3QAEA 4I56A 5D15A 5IT9U 3RAMA 3NGDA 1UW9A 1RAHB 1RAGB 1OPZA 2J8SA 3MM9B 1BLUA 2ZNYA 4LF8F 1UMJA 5B0BA 1FWKA 3EUNA 3HJFA 4ALZA 3GE9A 1U1LA 2AJFE 3OSPA 4DXLA 2AYEA 2KN4A 3F73A 2VPZB 4QW8A 3WIUA 2AU0A 4NYZA 4F36A 1RBLA 4ZOSA 1IR1A 3NWGA 8RUCA 2MKYA 4C8LA 1N33J 4AL5A 3Q0AA 2LA4A 4GKKJ 1VQ5S 1JLCB 2MLZA 3DYAA 4JUZA 5F8GA 3OPKA 3T1YJ 3NNCA 4WFYA 2OMLA 3R2CJ 3CEDA 4BC7A 2B56A 5KT3A 2W4CA 1Y9OA 2MJNA 2UV8A 3CCUS 1NK4A 2AMCB 4U6PA 4K4VA 5J1NA 1FJ7A 2QFJA 1N5YA 4XDCA 5BJRA 4DV0J 1FWLA 3N6MA 1QAJA 1Z4UA 3HX9A 2HHXA 4ZJOA 4WU3A 1RAAB 3KLHA 5LJ5Y 1RABB 2DNGA 2ZDOA 2B9EA 2YQ3A 2RE1A 4FVCA 4MYTA 3MM7A 4CQ1A 1S1TA 2JVOA 3N6NA 3OR2B 5A2QY 2VBYA 1VHIA 2EI5A 1MWQA 2GW8A 2H5JB 2I9SA 2IYIA 4USKA 4RZRA 1VQYA 3M8WA 3Q2SC 1WC1A 4JI5F 2HHQA 3BYRA 2CQ1A 2K2PA 2CUYA 4EFAC 1Q81T 2XS2A 2E1PA 2B9YA 3TEGA 3CD6S 2DGUA 2W24A 3KFWX 3R5CA 3R5JB 4NRTA 3VGTA 5T14A 4YUDA 4YR2A 1WC6A 1R7IA 3ZTRA 3MM6A 5F8IA 3R1HA 1WTBA 3M30B 3TVKA 4RW9A 1RTDB 1B0PA 4B3TJ 1MROA 2C2EA 4R8UA 1UZHA 2OJ3A 2HBZB 3MOJB 4DV3J 2B43A 2G2YA 3U1LA 2PFFB 2KT2A 4U7CA 1SL0A 2YXLA 3N79A 3D3BJ 3V81B 2XZTB 2MPUA 3ZO7A 2ZHAA 3BGUA 5L38A 2XZWA 3HSDA 3CC4S 5KTQA 4YQWA 2CPFA 2MDAA 4DR6F 3JTOA 3MECB 4H4MA 1S6PB 2ALYB 2ZJPQ 1WNEA 1S1WB 1FCAA 1RWMB 2HNDA 5MLCV 3CC2S 2KJVA 2WOMB 2N82B 2A18A 3OFHA 1HPZB 2LXUA 2RB7A 1M5HA 2E44A 4IDKB 4C3KA 4OX6A 2JC0A 1B99A 1KR4A 1QAYA 1Z1ZA 2KDOA 4OZ0A 2C1EB 1Q1KA 3SQGB 2IM0A 1ELOA 1GTHA 4A8FA 1T03B 2GJ2A 4WF9Q 3NOCA 2UVRA 4NX9A 2R2UA 1L3KA 1U09A 2MSTA 3DU5A 2FIUA 1RHUB 2BE2B 1U2CA 2F8HA 2M52A 2QG9B 3M8PB 4RW8A 3IRXB 1Q16B 5J1EB 3N5FA 4QIVA 4B9TA 1XR5A 3R7SB 2CA9A 2XS7A 4UOGA 1EHWA 2VC1A 2M8DB 2W7OA 1U0HA 3NGUA 3DLLQ 2GZOA 2ACYA 3IXQA 1RT4B 3K17A 1SH2A 1LFPA 4AUKA 1SUQB 2W9CB 3SV4A 3PO4A 1S77D 2KKHA 4RNNA 3HDSA 3M4XA 1Q7YT 4IRKA 5K20B 1QAXA 3QRQA 3M32A 4WWSA 3TNVA 4CNYA 1NEEA 3PYGA 4Z2XA 3CXCR 2PI5A 3GCXP 4C8YA 3MCNA 4G65A 4MJKA 2JL9A 4LBHA 5DS7A 1JKHA 1YRTA 3Q8UA 3UI3A 4NLWA 5A8RB 1T9XA 3KLHB 2PIIA 4DN9A 1X9WA 3AJDA 5HROA 2UU9J 4IG0A 4PCQA 1J5OA 1GK8A 4ZITA 4W90B 5DQHA 3GLJA 3BDPA 2BZ2A 4C3LA 2Q3PA 3FBBA 4WPAA 4ZP6A 3RW7A 4AE5A 2EC0A 2IM1A 1FTRA 2Y0BB 2CQGA 4Y2IA 2L9WA 4OX7A 2WHOA 2FJAB 4X4RA 2KZMA 1VJWA 2IA6A 3R9LA 2B5JB 3EICA 1TV6A 2MYFA 3UR3C 3JB9k 4FF2A 4ED1A 1YRUA 5EGYA 2D1CA 1GX6A 2AD9A 3C2PA 1YZ6A 2RU3A 4AFFA 3NMAA 3JSYA 4OI3A 1UVIA 1JLEA 5T41A 3HVRA 2QLBB 3CNQP 4WP8A 4KHMA 4IOCQ 2YNFA 2HVDA 4JV5J 4J9OA 4EEYA 1LW0B 1Y5LB 2VFUA 1U0SA 2Y9HA 3MAAB 5BR8J 4TU8A 4PZVA 3LGNA 1C1BA 3MM5A 1V6HA 3PACA 3J7YU 1KQKA 1YZ7A 3PYDA 2VJUA 4P73A 3R5GA 4P72A 3J80Y 4YN3B 2CJYB 5EUHA 2JJ4D 3HHNB 2D9PA 4YFUA 2MZTA 2C2NA 1T94A 2KB2A 1B4SA 1NZAA 2ASYA 4H54A 5E3AA 2Q79A 4L6V3 3UN3A 5D6GA 3BBBA 3RU0A 3UFCX 2AGPA 3MDFA 1FDDA 2ZM6J 2LCWA 2WVBA 4KGKA 4U8VA 4YDXA 2XY6A 1E6VB 4R8UB 1FTCA 5A2QU 3WC0A 5D3GB 1TFWA 2VJVA 1RP5A 3IRXA 1Q7LB 4DL2A 1T9YA 2XHWA 3HP6A 1L5UA 4OJ1A 2J6UA 2OPRB 1VQKS 3CJSA 4ZVTB 3MAHA 1D1UA 4YY3F 1BQXA 2OMOA 2ZVIA 1HBOA 3UDVA 2MY8A 1SJRA 2AX1A 2IA0A 3D1OA 2D7SA 2O01C 1WHWA 3IWLA 3W9HA 3K8VA 4FVMA 4PXCA 4RL1A 5L9XA 5F8MA 4ECUA 3EPIA 2ZZNA 2F9JA 3RR7A 1LQ9A 1WKJA 1REGX 3Q8SB 2R3VA 4DR7J 5CXTA 3W2VA 2E5LJ 3EE3A 4KIAA 2CZ9A 1D0EA 3DLEA 3OHAA 4ZDNA 4O3NA 3NGKA 5BYQA 4EZ9A 2YNIB 3KLGB 1X0PA 1P9YA 1QTNB 1Y7PA 4HKQA 3BH6B 3CVKA 2XI2A 2RSQA 3PEJA 4A8MP 1U25A 3HZEA 3KK1A 4AQYJ 5KFEA 1HBNA 2JOQA 2YX7A 1RWOB 4UOFA 4ZN1A 4P9SA 1BQMB 1UVJA 1YG0A 2HAFA 1XWLA 5BR8F 4IFYA 2KZZA 3RB0A 4O44B 1U6FA 3KK2B 2VHGA 2F8EX 1JLGA 1KKHA 3CJ5A 3I6PA 3J7AN 5HK4A 1HWIA 4EWTA 4MIAA 2VG5B 3QWPA 3MAQA 3PRDA 4PUOA 1SV5B 2FVQA 2H5IB 1FFSB 1UPMB 2HAIA 1Q82T 3OT9A 3L7OA 1DTTB 1VK8A 1QUVA 2LFVA 3H5SA 5ETQA 1DLOB 2BANA 2M0GB 2ZOMA 4IOBA 5IOLA 5J2PB 3OXFA 4HLBA 1RTIB 4DR2J 1JLAA 1N0UA 1VI7A 4GVBA 1U1OA 3GG1A 4IR9A 4J9PA 4JI7J 4NXMF 2J8AA 2QO3A 3V4MA 5LMNJ 2RHSB 1ZM3A 3PJXA 2JVRA 3NS6A 3TJ9A 4Z7YA 2F4FA 5IZHA 3CIMA 2CQBA 2ADBA 2KFZA 2VF3A 1PYOB 3CGIA 3LO3A 4F4AA 4ZHRB 3I31A 5A8WB 4ZPWR 4QWEA 1VJQA 2IBOA 3DOKB 3KUGA 2E5JA 3ZC4A 1UWBA 1NJYA 2EBGA 1Z2LA 3NG8A 3C3LA 1PC5A 2YX4A 2ZE2B 2LLZA 5D8HB 4X4TA 3CT9A 1RBOB 4ED6A 2ZJQQ 4YR0A 4DFMA 1AFJA 1R6YA 4ZA1A 2ALZA 3I5CA 2FJBB 3MR7A 1CJUA 1KVKA 1FERA 2E66A 3M2RB 4X4NA 3TAQA 3HT3A 3GU0A 1RSCA 4ECTA 3HHKA 2WSFC 1C0TA 2GHPA 2HURA 3CCTA 3DLJA 3MD1A 1GEHA 3IC1A 5EWFA 4J9KA 5E3PA 2I0XA 4KKOA 1V3RA 2G0CA 2HZCA 1NSPA 1X5TA 2H51B 2M5YA 3C6UA 5J2MB 3Q8PB 2YKMA 4F7VA 2KXFA 3RRHA 3HXMA 5CD4A 4LF6J 1S6QA 1N5SA 1NK7A 1J5EF 4NEYA 3IR7B 2IDLA 2LU2A 3TUIC 1RHJB 4GVLA 4ECZA 2LECA 3EDQB 2BX6A 3I82A 3QT6A 4LSLA 3O6QA 4MK8A 2XMAA 1XMQJ 2G4BA 1H3DA 3QSYB 4QJVA 4RUAA 2BJ9A 4U95A 1JQGA 1TU0B 5CYJA 2UXCF 2KTQA 2VDHA 2H65B 2WW4A 3FZ2A 4WXWA 2LQJA 3DOKA 3ZZUA 3R5DA 5HO4A 2PMZD 3MUMP 2Y3YA 3BB5A 2BACA 3RZAA 2LXIA 5HMZA 4DQQA 2ZUAA 4PAAA 4FF4A 2C2OB 3RBEA 3S6EA 1WKKA 3SCKE 2P9CA 1RE1B 3NMRA 5MAOA 2J7WA 5D0HA 4JI6J 4Y28C 3PKMA 1T3OA 3CDUA 3KLFA 2NCKL 2YWWA 5LSOA 3GJQB 3ZTPA 5HAOA 3POTA 1WHYA 4IH6A 3QO9B 1FVQA 3GIJA 1S1VB 4J9QA 1CEZA 1HNIA 3GIRA 4RW7B 3FBFA 3GP9A 5HANA 1SC3B 4RUCA 1FRXA 1D09B 3IG1B 1TKZB 1UETA 2J0WA 1Y4ZB 3IMQJ 1JWWA 3UD4P 4FYDA 3ISZA 1R89A 2BA9A 3MEDB 3MMBB 5HJXA 1RHRB 2FZKB 2CNNB 3TW0A 3DXSX 2YKPA 3NGTA 3NCPA 1NDPA 3GWCA 1BQMA 3RB6A 2LYVA 4ZS6A 1CJVB 5D4OA 2F4VF 3CIZA 4XAKA 4TQSA 1Y0HA 2R7RA 4KY3A 3ICLA 2I6WA 5LMUF 2Y1LB 3DFEA 1FA0A 4CM0A 1OWXA 1UFLA 4YY3J 2B4PA 2ZH3A 4DLGA 2NS1B 4FKXA 5KFZA 4I2PB 1S7IA 4GRSA 3O5TB 4L75A 1LWEA 2WB4A 1FKAF 4MKYA 4ECVA 2A6MA 2F1FA 4Y2MA 1JLEB 2FY8A 4CLFA 1QD1A 2COLA 5HSPA 2DXFA 1I3OB 2BOAA 2V2VA 4N5SA 3KLVA 5B7WA 2FJWA 4OX8A 3HULA 2XLIA 4FYVB 3G4SS 2XS5A 2DRAA 4XDDA 1RYRA 2XMUA 3KG1A 1QAIA 3D68A 1F60B 1JLBA 2ZFHA 1OJ4A 3BSCA 4FF3A 4CCHA 2AWZA 2ZC3A 1R8AA 3W65A 1VBYA 2HK2A 4DV7J 2OH2A 3HVAA 2Z58B 3AA9A 1KHVA 3THVA 5KFIA 1NHUA 1U02A 4MKVA 1NZ8A 1WF2A 3ZZZA 4C0OC 4HI1A 1MNEA 2E5GA 3VVUA 2VQFJ 1U8WA 2VBZA 2UV8G 5AE2A 1ZTTA 4Q0BA 1TVRA 3CJQA 4FXWA 2AP6A 5KFOA 4DV3F 1HI8A 2N4DA 2BM1A 4OV6A 2CPJA 2WAQD 3JSBA 2RF2B 3CD7A 4RW6B 2NXNA 3Q83A 3K8WA 1XNRJ 3D1HA 3N0VA 4RW4A 4DFKA 3TUPA 3VCDA 3MAAA 3LTOA 5D0GA 4CM2A 5F9NA 1IN0A 4XIUA 3KLFB 1F5AA 3DDKA 4LRAA 4K4ZA 1X4GA 5GAGU 3VTIA 2X7IA 2RHQB 5AT1B 4Q7AA 1NM2A 3T19A 3V2UC 5IQQA 3PFEA 1OSDA 1WOOA 3QJLA 4OI0A 3P4UB 3JYTA 4JI0J 5K8OA 4G1IA 3AOAA 1NK5A 2JHEA 1HNZJ 4DSEA 1F5CA 1RLCL 1W2BR 3AA8A 4Q8FA 3JQJA 2IBKA 3HVWA 4B9LA 1NH7A 2YTCA 1WJ9A 2B4OA 4OLOA 3DDIA 5AJ3J 5CA5A 3CCZA 1S6PA 1ZZNA 2DR8A 3JTPA 3MECA 3HSZA 2DR9A 4HT5A 4FPRA 3W7BA 4L3KA 3OD2A 4C7QA 1T9VA 1YSJA 2RJZA 2OPPA 2HRUA 2PFDA 3GSIA 1RT2A 4HACB 3TX0A 2JRSA 4Q8EA 2O67A 3G6XA 2V63A 3QRPA 4ZMMA 3CWJA 2L9DA 1BXNA 3LH2S 3OTBA 3PCOB 2KT3A 5F41A 3PVXA 2DNNA 1KVJA 3DLGB 2FYXA 4ED8A 1H74A 3PM9A 4CLZA 4EUVA 1AUSL 1JB0C 3FQLA 3AAWB 2Y8WA 2IJFA 4RW9B 2UU9F 4TU9A 2VOOA 4IR1A 5GVQA 3IAS9 1KOOA 2HK3A 3LA0A 4QQBA 3TZZA 1CJUB 2ZH4A 1HI1A 2ATLA 3IR5B 1YHQS 2W4PA 4NZ7A 2R2SA 2L41A 2HFOA 3GMGA 2HHUA 2GQ2A 2CPXA 2U1AA 4I6YA 3EX7B 2HQGA 5C24B 4OYIA 2YWGA 2DHGA 2EPIA 2CDRB 2VC0A 2VUGA 2BM0A 4NWBA 2BKPA 4OI1A 2DCUB 1T03A 4DSJA 2HG4A 5FLXY 4FXDA 2V4JB 1HR0F 1IBCB 2MSSA 1ZA2B 4CYUB 1VRUB 2JC1A 4M5DB 2OSQA 4F25A 4U9RA 1I51B 5B0CA 1RT7A 3UW1A 1SB6A 2CJAA 1NRKA 2C3PA 3EXCX 3H90A 4WYWA 5EX3A 1EARA 1QUPA 2V6AA 2FLPA 4DV7F 2XO6A 4DFJA 1IBKJ 1R8CA 2RQMA 1ULRA 4ZPCA 1ACMB 2WW8A 3ZZRA 2FHKA 3T5HA 4UW2A 2K3IA 4DMZA 1YJVA 3SFGA 3T6BA 2GNKA 4DR4J 2NXCA 3FK4A 2MB0B 5F8NA 1LWFB 1N5TA 2CIMA 1FJGF 5ETSA 3C6UB 3QIDA 5LM7E 1YJWS 1RT5B 4ERDA 3KUHA 4CLTA 7FD1A 2FZGB 2C42A 1RJJA 2HGNA 3DM2B 5HQMA 1RAOA 2D3ZA 3IWNC 3I55S 3QFHA 1REVA 4DR2F 2K3KA 1SIZA 3B4DA 3GFZA 3GCWP 4O4GB 1UWAA 4OQJA 2HVHA 1DQ9A 4KHRA 4X4OA 4DG1B 4GKKF 5CQGA 5L39A 2RMLA 9ATCB 3I32A 3NBPA 5ETTA 2KG1A 4NXMJ 1HFEL 4ZPVR 1PJ5A 4F4YA 2UXBF 2BABA 4C97A 4WP9A 3OL6A 2EFGA 2G0JA 4PG8A 2EFOA 5IM0A 4X4QA 4B08A 2YNIA 4NI2B 4ES1A 3MM7B 5KFSA 2HHHF 4NLTA 2YPZA 5HBMA 4UF4A 1U24A 5CH7B 4C8MA 5L46A 3TANA 2OKQA 3Q8VA 1RADB 2AJ1A 2LKZA 3W2VB 3V6JA 3LOUA 3VAGA 3PRBA 2YNFB 3IGNA 3I0RB 5F8LA 5H9EK 1SKRA 1QLNA 2WTFA 3Q2TC 4RNHA 5G4DA 1WD6A 1NK6A 3RGIA 1K47A 1UVNA 1X4DA 2AZ3A 4M1KA 3J81Y 2CJKA 2CQCA 1M5KC 3NEKA 1PGZA 1BGXT 1N36J 2OPQB 3FMWA 4C4WA 2DO4A 2MQ8A 3DM2A 4CTAA 1K44A 2BE2A 2MQMA 4IYQA 4TQRA 1L3SA 1KD1T 2Y8YA 4IOAQ 3MR2A 3V6HA 1VQOS 1ZETA 2N7CA 1O0PA 2HS0A 4A8SA 1TKDA 2FVSA 3N9UC 1EB0A 1TL3B 1U8SA 3MFIA 4OHXA 1RTHA 1S6UA 2D74B 3FMBA 4XK8C 1E6YA 1Q53A 4QYRA 3V6KA 4JV2A 1NDLA 3FCWA 2QLJB 3NL0A 3GYXB 3MEDA 3CB4A 2V69A 1WG1A 2R8JA 1R3NA 2VA3A 2VG6B 1WC4A 1OYEA 1B7YB 3KNGA 4IG3B 3L7UA 3DN9A 4KT0C 2DISA 2QN6B 3M32B 2B51A 1HIYA 1FHTA 1GMUA 2DGXA 1N88A 2R7UA 2L48A 4ED3A 1VC5A 1HNXF 1GXUA 3HKZD 3POTB 3V6DB 1UAWA 4Z37A 5L9NA 4ES3A 3MGJA 4N7TA 3KWMA 2V8DA 2IHR1 3VAFA 4OZJA 3CTRA 2APOA 4ZCMA 3G96A 3RAQA 1NBEB 1N32J 4I6WA 5FLXU 3FVYA 1A6LA 1HNZF 2XMVA 4M8LA 4A4JA 2XO7A 1VQ8S 3DLKA 4ID8A 4QR1A 2QL7B 3KLEA 3H8YA 2WRMA 3F41A 4QCLA 3BO3A 3EVOA 5HQLA 2BR0A 2GO8A 2K06A 3UCZP 4Y34A 4KO0B 3BSNA 2HHSA 1HD1A 3IR6B 4N8NA 1NHVA 2GHVC 5U47A 2VBXA 4A8YA 2B8QA 2HQIA 5GAHI 2WVCA 2BRKA 1T11A 1MWZA 3OTDA 3CMES 6FD1A 2AJ0A 3D54A 5KG1A 3HK2A 4IG0B 3VZIA 1BQNA 2VIHA 3CC7S 4C3MA 2YWFA 2CAJA 2DCLA 4ZVGA 1KTVA 3MHYA 1O5JA 2MQNA 2I38A 1GMWA 4J7CA 3W8GA 2E9TA 1FJCA 3PV8A 2VG6A 1H72C 4Y2AA 5M2UA 2W7AA 2ZJRQ 2QLFB 1OQ3A 2ZC4A 4KC5A 1UW4A 2XCPA 4HHHA 1R8HA 1U1QA 2VA2A 1RT4A 3GZ7A 5D0EA 1LKZA 2W9CA 4O4RA 4FF1A 3KMQA 1P8GA 3ISNC 2AGQA 3B54A 2J9EA 4U7UK 2QA4G 4DV0F 4Q5VA 3AOBA 4YB6A 3M8RA 4P7TA 5DRKA 1WEYA 2LXFA 3PFOA 4Q2LA 4EYHB 1XR7A 2B9XA 3CCES 5D3GA 3AFGA 4C6AA 3VAMA 1T3NA 3CCSS 1VRTB 4TYBA 4JYAF 2YKAA 1J5OB 2O5DA 1Z2ZA 5DJBA 4JYAJ 4IDKA 3H4BA 1V3ZA 5CZXA 2WOMA 3I5AA 3OL7A 2AEFA 4WE1B 1WI6A 1IM4A 1ZAVA 3EGVA 2CQ3A 1HWLA 3MTJA 4I0WA 3H7HB 4RW6A 2Z57B 4JV5F 4DUZF 2QYGA 1FE4A 2JLFA 3A8EA 4IG3A 4PR6A 4BBYA 4V1Ak 1RBAA 4K2JA 5JUMA 1HBUB 5LXYA 3IBCB 1XK8A 4FYYB 5LOQA 2DITA 1XNQF 2VPYB 4TVAB 2IDEA 2CWXA 3BO2A 4DG1A 4FS2A 1YJUA 1A0OB 4N77A 1P6TA 3R97A 1M0SA 4F0MA 3OTEA 1NPPA 4PPZA 3PJ9A 1SJFA 4F0KA 2YWEA 4DSLA 1C2PA 1JLFA 5HVHA 2EFQA 4NA1A 4ECYA 2PI4A 3FC9A 2KL8A 3EGWB 3GJRB 3OTOF 3AJ1A 3K7RA 3BO4A 4HHUA 2Y0SD 4DR6J 1S99A 3QLHA 2E29A 2YH0A 4TYAA 3H20A 2YKNA 3GTYX 1M1KT 3W9IA 3CCJS 3LP0B 3SXLA 1NKEA 1WOPA 5C42B 1H2TZ 2GVZB 3E8OA 2GC8A 3J7ZT 4L73A 4ZVPB 4P71A 2Y1RI 4IO9Q 4M5LA 3HF5A 3IBWA 5DDPC 2DY9A 2X1FA 2MQLA 3O8WA 1FXLA 3I9ZA 4Q45A 4V19X 2HKEA 1X5OA 2LQ9A 4H4MB 2R9LA 1SH3A 1XMBA 3HKWA 3QFWA 4ZK7M 4K4YA 3EGNA 3AQPA 1FD2A 3CD5A 4NCAA 2C3MA 2RQKA 1I5OB 1MROB 3D67A 3D9BA 3N28A 4KFBB 4TKTA 1BY9A 2DGSA 5E41A 3KLEB 3GB0A 4KO0A 3HCXA 3UQSA 1LOUA 4OYOA 2MTLA 3PEHA 3GONA 1HD0A 1NAQA 2HFZA 4HI2A 1FRJA 2D3O1 1N48A 4RWXA 4J9VA 2ZH1A 4BS2A 3N01A 3HSGA 2K7KA 3ILOA 3H25A 1C1CA 2ASDA 2NQPA 3MURP 1RT5A 4M5KA 1RTDA 4NMLA 3MUTP 5L1JA 4E98A 3HPOA 3PX6A 3WX4A 1SC1B 2B8PA 1TL7B 5KFWA 1GX5A 1R8PA 2HVEA 1K1SA 3W5ZA 4ECXA 1VQPS 1RT2B 4HACA 3MR5A 3CDAA 1HPZA 1VQ7S 2QGFB 1YJ9S 3ETOA 1FDBA 1YX2A 5KT2A 4NXNJ 1X5PA 3GJSB 2R7QA 1T7PA 5KFXA 4R0EA 2JFKA 2ZBRA 1AA1B 2HNYB 2NSCA 2VV5A 4HDGA 3JAMY 3OJUA 4K0KF 3M6VA 4I2QA 3M9NB 5CYMA 4K4SA 1FO1A 1RTHB 1SJ1A 1XC9A 1C0UB 1FNMA 2OPSA 1QSSA 4CO1A 3FBCA 3ZZPA 4DCOB 2GIQA 1JJHA 3AY0A 3H4DA 1T9WA 3M8ZA 2PGCA 3TOQA 2XLJA 4KYZA 2NXUA 5KG4A 4YS2A 3T9NA 3BZQA 4ZJLA 2RIJA 4ANEA 5C24A 1D8YA 1B64A 5IV3A 3VZHA 3KNAA 1CPZA 1IUJA 1PIEA 1RHQB 1XIQA 2VFSA 1Y5NB 1T02A 3OR1A 4NLPA 1NSQA 4A8XA 4DL7A 4F26A 4XTTA 5K14B 4X84A 1P1LA 3T6JA 4QU6A 4J37A 2B6AA 1HNWJ 1Y3KA 2DNQA 3PW5A 1YBTA 3HHLA 2POKA 4HVZA 1IVZA 4OHWA 2EEYA 3M6XA 2XSFA 2ZWPA 2RQ4A 3M8QA 2OFGX 1FX2A 2IVYA 3RG6A 5EHHA 5HMXA 1VQNS 1JKHB 1C4CA 3A1YG 1KVIA 2MEWA 1HBUA 2XGQA 2XWXA 4UUWA 3US5A 1GXLA 4ZN3A 2ZH8A 2GMLA 2IRUA 3ITHA 2HGMA 1OPIA 1NPRA 4U67Q 3R5AA 3UDCA 4B9VA 1H2UX 2OI2A 1XMQF 1T05A 2OD6A 1SBRA 1VDHA 2DEIA 2HWIA 1HQEA 2GVDA 2ZH6A 1XNRF 5A6WA 2R7WA 1AZSA 3VAHA 4DU8A 1ZM2A 4O4GA 3E2EA 3J81j 4JI3J 1S57A 4LF5F 4B9SA 2AIRB 4KGXB 5F0UA 1UJ5A 3FFIB 4P74A 5CABA 1Q8BA 1ZAWA 1VQ4S 2UVVA 5EN1A 4A46A 4DF8A 1O51A 1HL6A 2NPIA 3CUNA 3L09A 4OLPA 4QOTA 4ZPDA 3PW0A 1L3TA 1LWFA 3WHIA 4XPEA 4PWDA 2OEMA 3BKFA 1LWEB 3OQ2A 2CVEA 5G0RA 4NLVA 1YI2S 5AXNA 4TY9A 2GO9A 2HGLA 4UOCA 2MQQA 2ILYA 3KLIB 3HHLD 5F0WA 1GAOA 4X62J 3SV3A 1FD8A 4UUXA 2DHXA 3G8SA 4B9NA 2VG5A 4JI7F 3P6YC 1CJVA 2RS8A 2V9KA 2CWKA 4GO5X 2C28A 1WOSA 4H4KA 4P10A 1A9NB 4M5DA 2PMHA 5KFGA 4WXOA 2QE5A 4PEOA 3UCUP 1QE1B 1IKYB 3QSIA 4LRFA 5I3QA 3MMBA 2XC9A 5KOXA 2VFTA 2IAJB 3ZZYA 2LEBA 1HWUA 1FNXH 4USTA 4NXNF 1T9TA 2E1RA 3MM8A 3TP2A 5KFKA 2HLTA 3FQKA 3EJMA 4ICLB 1H6KX 4L76A 4FP9A 4K0KJ 2LEPA 3QO9A 5LMUJ
chains in the Genus database with same CATH topology
5ETKA 3HCXA 1KBRA 5ETMA 5ETTA 4M5MA 4M5GA 3HT0A 1IM6A 1RU1A 1TMMA 3HD1A 3HSDA 5ETOA 3ILIA 1G4CA 3ILJA 4CRJA 3HSJA 4M5HA 5ETPA 1EQ0A 4M5JA 3KUEA 2F65A 3HSGA 3ILOA 3MCNA 4M5LA 1Q0NA 4F7VA 4M5IA 4M5KA 5ETNA 1EQMA 3MCOA 3UDVA 4CYUA 2QX0A 1EX8A 3QBCA 3KUGA 3MCMA 3UDEA 1RB0A 3HD2A 1RU2A 2BMBA 1TMJA 4PZVA 5ETSA 5ETRA 3UD5A 5ETLA 3IP0A 3KUHA 5ETVA 1RTZA 2F63A 1CBKA 3HSZA 1DY3A 1HQ2A 1F9HA 3ILLA 4AD6A 1RAOA 5ETQA 2CG8A 4CWBA 1HKAA 4CYUB 4M5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETK A;  3HCX A;  1KBR A;  5ETM A;  5ETT A;  4M5M A;  4M5G A;  3HT0 A;  1IM6 A;  1RU1 A;  1TMM A;  3HD1 A;  3HSD A;  5ETO A;  3ILI A;  1G4C A;  3ILJ A;  4CRJ A;  3HSJ A;  4M5H A;  5ETP A;  1EQ0 A;  4M5J A;  3KUE A;  2F65 A;  3HSG A;  3ILO A;  3MCN A;  4M5L A;  1Q0N A;  4F7V A;  4M5I A;  4M5K A;  5ETN A;  1EQM A;  3MCO A;  3UDV A;  4CYU A;  2QX0 A;  1EX8 A;  3QBC A;  3KUG A;  3MCM A;  3UDE A;  1RB0 A;  3HD2 A;  1RU2 A;  2BMB A;  1TMJ A;  4PZV A;  5ETS A;  5ETR A;  3UD5 A;  5ETL A;  3IP0 A;  3KUH A;  5ETV A;  1RTZ A;  2F63 A;  1CBK A;  3HSZ A;  1DY3 A;  1HQ2 A;  1F9H A;  3ILL A;  4AD6 A;  1RAO A;  5ETQ A;  2CG8 A;  4CWB A;  1HKA A;  4CYU B;  4M5N A; 
#chains in the Genus database with same CATH topology
 2LVW A;  5ETK A;  1MWY A;  3NS5 A;  4BCA A;  4NL5 A;  1V5I B;  3LAM A;  2XYH B;  2DIV A;  3A12 A;  3ZZT A;  3LPE A;  3K57 A;  2HHH J;  1N52 B;  4H4O B;  3D6M B;  1UKU A;  2V94 A;  2IVF B;  5RUB A;  3Q23 A;  2GGP B;  2F65 A;  1MMD A;  2XY7 A;  1YTY A;  1TK5 A;  4DV6 F;  4PWD B;  1F2H A;  3M7V A;  4EO8 A;  2EFV A;  1VIX A;  4ETZ A;  2RS2 A;  3PZP A;  3R5B A;  2DIU A;  3LP1 A;  2A10 A;  4IH5 A;  5KT7 A;  4DLE A;  4ER8 A;  1R27 B;  1AB8 A;  3RB4 A;  4ZLN A;  5LT5 A;  4R5P B;  5DDQ C;  3VGS A;  4N8O A;  1VBX A;  4ECR A;  5JJB A;  2YBV A;  2JSX A;  2XCA A;  3T9Z A;  4WCE Q;  2G0I A;  1AYE A;  1TVR B;  2CG8 A;  1F3V A;  3O3L A;  1R0B G;  3RAX A;  5DZ7 A;  2ZIT A;  1GQE A;  2FTR A;  1E6Y B;  1OMS A;  2EFP A;  1UEV A;  2AEJ A;  5KFJ A;  1HI0 P;  3MEK A;  2DJW A;  3MR6 A;  3ZNU A;  1JLC A;  3CDW A;  3DYA B;  1SJQ A;  1VCT A;  2E7W A;  4M5G A;  1NO8 A;  3NCQ A;  4PG7 A;  5I42 A;  3D66 A;  3AXK A;  2W2P P;  3MOZ A;  1RYS A;  4FN5 A;  1IKV A;  4GC7 A;  2JEF A;  4E0D A;  3IG1 A;  4RBT A;  1H0H B;  1JXL A;  2AGO A;  1DLO A;  2BAN B;  7FDR A;  4Y0F A;  1S1X A;  3X1L B;  1VOM A;  3DHW C;  3MI7 X;  4S0M A;  3VGU A;  5KFM A;  4DSK A;  3QYY A;  3I4P A;  3I96 A;  2MZJ A;  3VHQ A;  2DXD A;  5FD1 A;  1HQU B;  4I68 A;  1AW0 A;  1L3V A;  1M5P C;  3QIP A;  4M5N A;  3TR5 A;  4NLQ A;  5KFB A;  1Q78 A;  4C48 A;  9RUB A;  4IUF A;  1WF1 A;  1QJH A;  3QGI A;  3KTQ A;  1CJT B;  3D28 A;  3W5X A;  4CNZ A;  1T05 B;  2IC3 B;  4CRJ A;  2KVI A;  2ZE2 A;  3NAI A;  5ADZ A;  3TZY A;  1T0T V;  4HT7 A;  2DYA A;  2AYB A;  2JFD A;  4CP5 A;  1DRZ A;  1KLM B;  4FBT A;  1S49 A;  3MCO A;  1DBD A;  5C7P A;  4OZN A;  1S6O A;  3D4J A;  4PXB A;  4Y6I A;  1TAQ A;  4ZP8 A;  2DNO A;  3M8Q B;  1LWC B;  4CH0 S;  1LXN A;  2HQD A;  4OYX A;  3WDO A;  4CO4 A;  2ASJ A;  1A7G E;  1YDL A;  1B0V A;  1QDU B;  3D0H E;  2XWY A;  1WSV A;  2Z2Y B;  5EWG A;  3ILL A;  2MKS A;  3CCW A;  1HAR A;  4LF7 J;  2HHW A;  3G87 A;  3W64 A;  2F4V J;  4AND A;  1MN7 A;  3IO1 A;  3D2W A;  4DR7 F;  3DKD A;  4DV2 F;  1FT8 A;  1JLG B;  3H0P A;  4DV2 J;  1FFW B;  4LFA F;  2QYC A;  2IRX A;  1DTQ A;  1S79 A;  4ECW A;  1EAY C;  1FE0 A;  1YJN S;  4AXJ A;  3SZ2 A;  1OSC A;  2W1B A;  3T1H F;  5GAE U;  3THP A;  5AXL A;  1HHT P;  1UA1 A;  1BMQ B;  2DGT A;  1WEX A;  2FHJ A;  2UUT A;  4QR2 A;  3S01 A;  1RT7 B;  4B02 A;  1PO6 A;  4LF9 F;  2KRB A;  2MHE A;  4JI6 F;  2QX0 A;  5DM6 Q;  4YB1 P;  4NLO A;  2R8G A;  2UVW A;  1SH0 A;  1RWX B;  4OYM A;  3BN7 A;  1FKP A;  1D8Z A;  3BPS P;  3W66 A;  2HNY A;  4JB8 B;  5D4L A;  1DZ5 A;  2R2T A;  1NPK A;  2MQO A;  2WSC C;  1VLO A;  2WVE A;  4I7F B;  4IO1 A;  2DHS A;  2A2C A;  4B3O A;  1HWK A;  3TX8 A;  1XQI A;  4EI2 A;  5K8N A;  2ZKT A;  5HLF A;  2KYX A;  1BWV A;  1RCX B;  4FBU A;  4OHY A;  2CQH A;  2MZQ A;  1TL7 A;  1RT1 A;  5B0E A;  1X9M A;  1W26 A;  1WHX A;  2ZM6 F;  1N4L A;  2HWT A;  2YWH A;  2VQF F;  5BXI A;  2XMJ A;  2IJN A;  2EFN A;  1FEH A;  2ZZT A;  4QWD A;  2VQE J;  1FJG J;  4K4U A;  2D69 A;  2BJ1 A;  2QFI A;  3DGV A;  3CO0 P;  2XB2 D;  3PJW A;  3OFF A;  1O8B A;  4B17 A;  5DQI A;  2DPJ A;  1W2I A;  5H9F K;  3EVW A;  1KFD A;  4K8R A;  2DR7 A;  2J6S A;  2ABY A;  4FXV A;  1FRH A;  4A47 A;  1S1U A;  4EBE A;  1JLF B;  4C0H A;  2GMH A;  1XR6 A;  4MIB A;  2GCF A;  3JXO A;  2F63 A;  5K8M A;  4WTO B;  2OGU A;  4ELV A;  4X64 F;  3ADA C;  4UOH A;  1UWB B;  4BWJ A;  5JMN A;  5IT9 Y;  3G2X A;  3ULH A;  3K0J A;  5E3Q A;  3OR1 B;  5A8R A;  1N34 F;  2FLL A;  2DEJ A;  4DUY J;  3BQ0 A;  4IRC A;  3FJ2 A;  2Q43 A;  1Y11 A;  3G6V A;  1HW9 A;  1UJ6 A;  2HS3 A;  2VKR A;  1OO0 B;  1ROF A;  1WTF A;  1JIH A;  3JSR A;  5DLG A;  5HJY A;  4YP3 A;  3CJ4 A;  5KT4 A;  4KQZ A;  2QLX A;  1C1B B;  3DU6 A;  3MM5 B;  2E9Z A;  1BD6 A;  1X4A A;  3ZZ0 A;  3DMJ A;  2KYZ A;  4JI8 F;  1KQS R;  3ENA A;  1K9M T;  2R7V A;  3DOL B;  2BDP A;  4RPF A;  5KFF A;  2OEJ A;  4ECQ A;  2YKN B;  4CDI A;  5F8J A;  1N5Q A;  1TV6 B;  2Q1L A;  3BN4 A;  2YPY A;  3QLH B;  1LW2 B;  4N56 A;  2DRB A;  1BUX A;  1UL3 A;  5JVG Q;  2LQ8 A;  3Q89 A;  4FNI A;  3M8Y A;  4ZVU B;  4G1P A;  4IH7 A;  5THW A;  2W9A A;  1EZZ B;  3MMA B;  1IWG A;  1YJT A;  5I3U B;  2PSZ A;  1HQ2 A;  3DRY A;  3M9M B;  2V2Q A;  1UPP A;  3ETM A;  4E2F B;  1ZH5 A;  2W2M P;  1HMV A;  3I0S B;  1CVJ A;  2UUW A;  3Q86 A;  2D3O R;  1K8A T;  1HQE B;  2CNO B;  2CQ0 A;  1RTJ B;  3LP2 A;  3SDE A;  2AZ1 A;  2QZ8 A;  1S97 A;  1NJI T;  3KOA A;  3A4T A;  4NA2 A;  1VBZ A;  2MJU A;  1HNX J;  2GS8 A;  1WUU A;  4F04 B;  3C14 A;  4O3O A;  1TL1 A;  1F5B A;  1GT8 A;  2JX2 A;  4USH A;  4P75 A;  1FX4 A;  1WEZ A;  3U1M A;  4A48 A;  1JMT A;  4F3M A;  2H1Y A;  3KK3 B;  3EGZ A;  1JLA B;  4GVB B;  3GJT B;  3SEO A;  2RUG A;  3U7J A;  3TQ1 A;  5B0D A;  5BYS A;  1DAR A;  3BH7 B;  1DHM A;  1VRT A;  4CI0 B;  2N4C A;  2OHD A;  2VZ9 A;  2FLO A;  5GAD I;  3JQM A;  3K5N A;  1FKO B;  4TY8 A;  4ECS A;  2AKW B;  1XMO J;  1JJ4 A;  4M94 A;  1S9F A;  3W8P A;  1NK0 A;  1NHK L;  1TR0 A;  4RUB A;  1SV5 A;  1KFS A;  3BGR A;  5K14 A;  2JLG A;  4DL6 A;  2AYG A;  2R2R A;  2AV5 A;  3PR5 B;  3PIO Q;  1UZD A;  5LXR A;  4I2P A;  3OW2 R;  2DVI A;  5IC4 B;  4JV0 A;  3QJP A;  2YQ1 A;  2G1D A;  2DNH A;  2QJ3 A;  5J2M A;  3CJK B;  4TU7 A;  4Y00 A;  4RW8 B;  2J9C A;  3R3T A;  4YB5 A;  3H2V E;  4C8N A;  2IMW P;  2CQI A;  4G3I A;  1IJF B;  1P27 B;  2D3U A;  3O1L A;  5IC6 B;  1I94 J;  2LQB A;  1ZS6 A;  3QWU A;  5KG5 A;  2OD4 A;  2R7S A;  2WSE C;  1XN9 A;  1C0U A;  2OPS B;  5HQ8 A;  1MW7 A;  2MKK A;  3KLG A;  2ZH5 A;  4F8R A;  2HS4 A;  2BMB A;  5ETL A;  2UUC J;  4BLG A;  2V8P A;  4JV1 A;  1VLY A;  3ZXW A;  3RUB L;  2YX1 A;  2IJR A;  3V4I B;  1GTE A;  2BKN A;  3DGP B;  2FUG 9;  3GYN A;  3C19 A;  1YJ7 A;  3HVT B;  1S1V A;  2UXB J;  2NPF A;  4F4K A;  4I4B A;  1GXT A;  1JXV A;  3ISN D;  1URR A;  3L9Z A;  4MYU A;  3FRY A;  3RTV A;  1APS A;  1ZBT A;  1HBO B;  3KXD A;  3P49 B;  1RK8 A;  4WKR A;  3AD9 C;  2Z8Q A;  3W62 A;  3EPG A;  3HFK A;  3QZ8 A;  3JAM U;  3KHL A;  4NLS A;  3ILJ A;  1QM9 A;  2DHH A;  1GNK A;  3AQO A;  3DRR A;  4P2S A;  3K5L A;  1NSA A;  2Z0G A;  3KJQ B;  2JDJ A;  3M8P A;  4WE1 A;  5KFR A;  4D3H A;  1TUV A;  1XBW A;  3FUY A;  5KFL A;  1S4E A;  2KXH A;  3ZZO A;  2VDI A;  2J0Q D;  2P5V A;  1PKU A;  3G8Q A;  1HMV B;  3I0S A;  4ZIV A;  1PYT A;  4B3R F;  3LGH A;  4I67 A;  2WK4 A;  3V6D A;  4HH1 A;  4C0B A;  4JBC A;  3BQ1 A;  4KFB A;  3E01 A;  3ENV A;  4LT6 A;  4B3T F;  2GA7 A;  2FC9 A;  2BJ7 A;  3DRR B;  3PR4 A;  4RU9 A;  2FJX A;  2JEG A;  3ITH B;  1G2E A;  1K0T A;  2RH3 A;  3A3O B;  5HVF A;  2RDD A;  3FZB A;  4ANC A;  4LF9 J;  1WEL A;  2CFX A;  1SJ3 P;  1HHS A;  3AB2 B;  1GMV A;  4OMF G;  2GJF A;  4KE5 A;  1PAE X;  4D3G A;  3DMJ B;  2A3J A;  3P3D A;  3LQV A;  1X0F A;  1LWX A;  2QV6 A;  3OTO J;  4ZVS B;  4N41 A;  2IY5 B;  4JI2 F;  1OS5 A;  3R27 A;  3UNY A;  2VIC A;  3GSD A;  4DWI A;  3NBP B;  2BVZ A;  5KFY A;  1ZTW A;  1LEO A;  5C2G A;  4ZCK A;  4O0N A;  2ZBP A;  2DRD A;  2QMU B;  2CKW A;  2CJQ A;  4LRE A;  5IWA J;  4Y3C A;  2X3G A;  2KG0 A;  2RRA A;  3NNA A;  1SPB P;  2C2K B;  4LVN P;  1RQ0 A;  4IFY B;  4K2X A;  1DUR A;  1HNV B;  2VON A;  1LFW A;  1OQ6 A;  3KDN A;  3FSX A;  1K1Q A;  4CLY A;  1HBN B;  2UUA F;  2XMM A;  4DEZ A;  2C2D A;  4LF1 A;  1EET B;  3VQT A;  1S59 A;  3I0R A;  3EM1 A;  2LA6 A;  4N76 A;  4PXD A;  1ZAX A;  1MU2 A;  3GIK A;  5A8W A;  5ETM A;  1YIT S;  1TP7 A;  1V9O A;  3I56 S;  5M2R A;  4DZD A;  1EP4 A;  2DR5 A;  2RRB A;  4O3S A;  4DX8 H;  1NDK A;  2Y1J A;  3IBF B;  5D77 A;  5LSL A;  2V68 A;  4USI A;  1RT1 B;  4ZKA A;  3HM9 A;  1Q5Y A;  3V81 A;  1ZYQ A;  1D3W A;  4LMZ A;  4QPX A;  4MFB A;  2R7T A;  1EX8 A;  3T5J A;  2DNK A;  3CSK A;  2HIQ A;  2M8H A;  2DGO A;  2HBR B;  5E7O B;  3UDE A;  1TZ0 A;  2AJ4 A;  4C8O A;  3MEG A;  4LF6 F;  4G1Q B;  1REV B;  4FYW B;  1DQA A;  5A0Y B;  3DLK B;  3PYF A;  4UZC A;  2KM8 B;  2VL1 A;  3RBZ A;  2ASL A;  1B3T A;  4KHP J;  2Q6B A;  1NJZ A;  1VQ6 S;  3SI8 A;  4C98 A;  4DR3 F;  1F3F A;  4F4Z A;  4ATN A;  1SKS A;  3PO5 A;  3O2I A;  5DDO C;  4GC6 A;  3HT0 A;  4FS1 A;  3TJ8 A;  1LK5 A;  2H5E A;  4V19 J;  1HR0 J;  3UDL A;  3OBI A;  3DRS B;  2GHW A;  2X1G A;  3IWX A;  3W5Y A;  3SSS A;  4LF2 A;  4BHQ A;  2VD3 A;  4OJH A;  3JTN A;  4B9U A;  4DQR A;  1N54 B;  4FNH A;  2BYC A;  2Z56 B;  3LF0 A;  5DM7 Q;  4X4V A;  1PC4 A;  1RB0 A;  1TQL A;  1VRU A;  4MK7 A;  1R0A A;  2V4J A;  4RWW A;  3K59 A;  3DLB A;  1DAX A;  3DRX A;  3VF0 B;  3IN5 A;  5J2N A;  4N47 A;  3AOC A;  2FGO A;  2CJX B;  3AT1 B;  3OFG A;  2O3D A;  2IIH A;  1TUW A;  3BM7 A;  4RJV A;  3FBE A;  2CG4 A;  1H38 A;  3LP0 A;  2UXD F;  1LWC A;  1O6X A;  3C66 A;  3UCG A;  3WC2 A;  1Q8I A;  5GAG I;  3GQC A;  4OZ5 A;  5HBM B;  5K8P A;  1F2G A;  2I5J B;  2ZEJ A;  4QPT A;  3AXM A;  3FEZ A;  4OIX A;  2CNL B;  3IS9 A;  1IBL J;  1IQT A;  1XNQ J;  3P96 A;  2G2O A;  2ZBI A;  2VG7 B;  3G8T A;  4TY8 B;  1HA1 A;  1S4F A;  2RU9 A;  3H98 A;  3AD8 C;  2FQQ B;  2CAD A;  3T1Y F;  2JNJ A;  4RBU A;  4OX9 F;  4OV1 A;  3HMJ G;  3CCL S;  4OX9 J;  3QIP B;  1HYS B;  1S1T B;  1SQF A;  3OR2 A;  3J7A 1;  1WI8 A;  3N6L A;  4JI0 F;  2M88 A;  3CD0 A;  3D6H B;  3BR9 A;  5ETR A;  2ZUG A;  2E7X A;  3TEH B;  3M2U A;  4OFZ A;  1Q5V A;  2QC3 A;  4I69 A;  1U4B A;  2CPY A;  4PG6 A;  2YQ0 A;  2CZV C;  1CJK A;  2VBW A;  2VFV A;  3M2V A;  3TO8 A;  1WOR A;  4ID5 B;  5DZ6 A;  5IFM A;  1YJR A;  2ZOF A;  1FK9 B;  3MPY A;  4NRU A;  8ATC B;  3C16 B;  5KG3 A;  3QZ7 A;  2HNZ A;  1H98 A;  2GQC A;  2DY1 A;  1RIS A;  1TL3 A;  1FEE A;  4LRB A;  4MH8 A;  4B3S F;  1UEU A;  2IPO B;  3AH6 A;  5B08 A;  3GIM A;  2NXE A;  2LP4 A;  1KRP A;  4KTQ A;  1RAI B;  4CO3 A;  4MTP A;  3NRB A;  4NPO A;  2L3M A;  5CAA A;  2A0F B;  5L8R C;  3LAN A;  4EBC A;  3G6Y A;  2HMI A;  2D9O A;  4F02 A;  3FDS A;  2RKI A;  1CS4 B;  3ZTS A;  2XMT A;  4DR4 F;  1S9E A;  2AYM A;  2BEF A;  1FJE B;  3MCM A;  2NRE A;  3LGM A;  3UD5 A;  2DD8 S;  2O1P A;  3MM9 A;  1Y5I B;  2VPW B;  5KFN A;  2UP1 A;  4RO0 A;  5H9E J;  1KTQ A;  3NS7 B;  2HND B;  1S1W A;  1YBU A;  1TKT B;  2EG2 A;  3CDE A;  4GMK A;  1TKX B;  6FDR A;  4DDF A;  4DPX A;  4QWA A;  4M95 A;  2YH1 A;  1MG7 A;  4F0H A;  5D0R A;  4DX5 A;  4IQM A;  1M5O C;  2IM2 A;  3BSO A;  4O0I A;  1FWP A;  1HBM A;  4ILL A;  4F50 A;  5K5M A;  3W63 A;  5LL6 d;  5L1I A;  3RBX A;  3DXB A;  4JI2 J;  3VAL A;  1JXE A;  4DPO A;  2HYI B;  1IKX A;  1NK8 A;  4OYA A;  5CCM A;  3OHB A;  3GV8 B;  4QYZ J;  2A1B A;  2CRL A;  3BKT A;  1UFK A;  4CLL A;  3TI0 A;  1OY8 A;  3TZW A;  4DSF A;  4ILM A;  2RIL A;  4ZPT R;  2EXU A;  1JLB B;  8AT1 B;  4WFN Q;  1VC0 A;  1S48 A;  4KGZ B;  2Z2M A;  5FJ4 A;  1XEZ A;  4CO2 A;  4AXI A;  2NUH A;  2J7K A;  3ENW A;  4AD6 A;  3GR1 A;  1M90 T;  3VAK A;  3M05 A;  4RX6 A;  1JJC B;  2B7B B;  4NLR A;  4USM A;  2VQE F;  2BQU A;  1KQG B;  2ADC A;  2PDA A;  5HRO B;  3MPV A;  2R8K A;  2DTJ A;  3ELH A;  3SQG A;  4KSE B;  1PSD A;  4RLE A;  3CCQ S;  4KV8 A;  4PXE A;  1PIL A;  2ROP A;  3ENQ A;  3H2U B;  5HI7 A;  4DBQ A;  1FES A;  2U2F A;  2H9Z A;  5CCL A;  5M2P A;  1UVL A;  2CPI A;  2CYY A;  5ETP A;  3Q8Q B;  1N5Y B;  3D0I E;  1H7W A;  3UVJ A;  1LW2 A;  4C2M A;  4X4S A;  3RR8 A;  1SKW A;  3C15 B;  4I6A A;  3UN5 A;  4F67 A;  2P2C B;  2VU5 A;  3PTW A;  2MKI A;  3HD2 A;  5J2Q A;  3T1H J;  3FCV A;  1U6B A;  4YHH F;  3IRW P;  4WZM A;  3MPD A;  1Y10 A;  4YHH J;  2MKC A;  4YME A;  2IRY A;  3QT8 A;  4LF7 F;  3BBF A;  4P52 A;  1AFI A;  2VFR A;  4A8Q A;  5C2C A;  2YNH A;  3CJ2 A;  4LUB A;  5IT0 A;  3TJA A;  3H5X A;  4LF4 F;  2XG8 A;  3M6W A;  4J9U E;  2DKO B;  1SCJ B;  2XLK A;  4Y65 A;  4BWM A;  4WK3 A;  4LIW A;  4FYX B;  2NYH A;  2RD5 C;  1IM6 A;  4UQT A;  4DPT A;  5T7L B;  5CYQ A;  3SBM A;  1D9A A;  4ZP9 A;  1S76 D;  1M1H A;  2OUG A;  3D5M A;  4O23 A;  4ES2 A;  2W01 A;  4HHJ A;  4KBI A;  3D6F B;  1WDD A;  4OI6 A;  3BJY A;  3HJV A;  2X1B A;  3DLG A;  4JOU A;  3NLC A;  4MT1 A;  4LFB J;  1RAC B;  1YRX A;  2HPU A;  4WFB Q;  3LUY A;  2V50 A;  2AF6 A;  4LSN B;  4TLQ A;  5GAE I;  4HDH A;  2L08 A;  3M6U A;  3K2Y A;  3DOL A;  3G86 A;  4NA3 A;  4HEA 9;  4LVO P;  4DUY F;  3LAK A;  4OL8 A;  4EK2 A;  2C22 A;  1GFW B;  1VMB A;  2ZKU A;  1SL2 A;  3S1T A;  2VOP A;  4Q44 A;  4ED5 A;  2MGZ B;  3OUY B;  3KHR A;  4CLK A;  4NYO A;  3KJV B;  1UCN A;  3KHG A;  1S9E B;  3W2W B;  3CCM S;  3TAP A;  4I64 A;  4CIO A;  2UUB J;  2VKZ G;  4WFZ A;  1JLQ B;  3DI6 B;  3MM8 B;  3CDB A;  1RI7 A;  1UEK A;  2D41 A;  2DH8 A;  2QSF A;  2XSJ B;  4LBI A;  4F3Q A;  5C25 B;  5KT6 A;  3TVY A;  1I94 F;  2B7C B;  3NOG A;  4DX7 A;  2QA4 S;  1U1N A;  1U2R A;  1IKY A;  3UO0 A;  1TTH B;  3FKB A;  4CO0 A;  2R4F A;  4ELU A;  5HMY A;  2MY7 A;  5GAD U;  2HNZ B;  1RTI A;  3R7N B;  1I1G A;  2HQC A;  3CW2 C;  1PAU B;  1D9D A;  4DSI A;  2W7P A;  4W4M A;  4MMO A;  1VIS A;  2FJD B;  1DTT A;  1N5V A;  4CLW A;  1H2V Z;  2YWK A;  2PA8 D;  3F0N A;  3VVT A;  3KLI A;  4DR1 F;  2QL9 B;  1X4E A;  3AB4 B;  2EK6 A;  5FII A;  2FY1 A;  1X9S A;  5I42 B;  1F9H A;  2HBY B;  5DET A;  2HZV A;  1LNQ A;  3QGH A;  1YWX A;  2P9G A;  2J0X A;  3NXZ A;  1NCL A;  1J27 A;  4O44 A;  4O3P A;  2KH9 A;  3KK2 A;  5D4P A;  1FRM A;  3QGG A;  2ACM A;  1AUD A;  1QSY A;  4Q0B B;  2CJ9 A;  2IVM A;  2QEX S;  3EXY A;  5HN0 A;  4J91 A;  5B0F A;  2F40 A;  3QAT A;  4OJG A;  3LWM A;  1G4C A;  2DPI A;  1BC6 A;  2XBP A;  4YB7 A;  1NLK L;  3HSJ A;  5A0Y A;  4IKA A;  4U8Y A;  5KG7 A;  4JI4 F;  5DG8 A;  5AXK A;  4ZVR B;  3W2W A;  2FZC B;  3NKY A;  1SQE A;  3FEY B;  1U48 A;  3PKY A;  4DPW A;  4NCG A;  4WII A;  1IBM F;  1JJ2 R;  1WG4 A;  4KJI A;  1Q8L A;  4C11 B;  1RAJ A;  4CH7 A;  1RT6 B;  1IKX B;  2XEX A;  3IGV A;  5A8K A;  4ZIW A;  3VAI A;  2EKN A;  1CJT A;  3RJM B;  1RWW B;  3H2L A;  3TQE A;  3PG9 A;  3TZX A;  2W8L A;  3Q24 A;  4X65 F;  1QE1 A;  3MMC B;  2JEJ A;  4P2X A;  3DC2 A;  1S6Q B;  1IWA A;  3U27 A;  1G3O A;  2WB1 D;  3L3C A;  3CMQ A;  4OYP A;  1S0V A;  1HQU A;  4QYZ K;  3A3P B;  1T95 A;  1UJ4 A;  2FD2 A;  3FCH A;  3O44 A;  1RU1 A;  4ICL A;  2K8G A;  4LJM A;  2P6S A;  3UE2 A;  4R0J A;  2CPD A;  1X5S A;  5HVG A;  1N32 F;  4QIF A;  1YKW A;  4A8O A;  1S1X B;  4P2M A;  4USJ C;  3C46 A;  5G0R B;  2NSB A;  3M2R A;  3I87 A;  3MF5 A;  2XMW A;  2MZR A;  3MEE A;  2X51 A;  2HBQ B;  5KG2 A;  2YVS A;  4X62 F;  3T3F A;  3E3X A;  4DS5 A;  3DLE B;  1KLM A;  1RTZ A;  2BE7 D;  2DH7 A;  2K1R B;  1CBK A;  3MCS A;  4K5S A;  4DJB A;  4DN0 A;  2J5A A;  2FJV A;  4PKD B;  3H42 A;  2KJW A;  1EKS A;  2FJE B;  4H4K C;  2F7V A;  3ZTO A;  1NUE A;  1S5Z A;  2F5G A;  3AD7 C;  2UUC F;  2OEK A;  3DHX A;  3EVM A;  3CO9 A;  4PWU A;  3VWS A;  4WYL A;  3T5L A;  1KNZ A;  1MMN A;  4ZPA A;  3P5T L;  3KJN B;  4OYB A;  5HP1 B;  1FFG B;  2PEH A;  2QIF A;  1N6Q B;  5C5J A;  4ITS A;  1VFJ A;  1VQS A;  3H5U A;  2RDJ A;  1NND A;  4P7V A;  2BJ3 A;  4A8K A;  4LSN A;  4DR3 J;  4IFV B;  4X2B A;  1WAC A;  2M4M A;  4B3M J;  2QA1 A;  1OY9 A;  2WVF A;  1RT3 A;  4QIG A;  2GAG C;  3HHL B;  3L7P A;  1OYD A;  4USW A;  3B78 A;  1QY7 A;  3PHE A;  3MTK A;  1EKR A;  2QL5 B;  4WFX A;  4LFC F;  3SCJ E;  4J9L A;  4X4U A;  5AE3 A;  1VQL S;  5HAT A;  2N3L A;  3BGO P;  4CWB A;  2DXE A;  2JZ5 A;  5K9F A;  1SXL A;  1Q4R A;  2R42 A;  3DRP B;  3PHT A;  3OSN A;  2N7Y A;  2V8H A;  3FEX B;  4USU A;  3DOM B;  4K4T A;  2FC8 A;  4MAK A;  4RBV A;  2CPH A;  5IV4 A;  2QMX A;  3TA2 A;  5ETO A;  5IXU A;  2DGQ A;  3PW7 A;  3ONQ A;  4GO7 X;  3QT5 A;  2W9B B;  1RA6 A;  2KU7 A;  2GMJ A;  4WU2 A;  1S7H A;  3TYT A;  3MFH A;  2M2B A;  3PY8 A;  4F4X A;  2RQC A;  5IT4 A;  3SSR A;  3THT A;  3QMQ A;  1VS3 A;  5DO2 A;  4FDF A;  2HRT A;  2DH9 A;  1SKU B;  1IBL F;  3QGP A;  1SVD A;  1V3S A;  2B5J A;  3M1V B;  4U96 A;  2YKQ A;  2K7J A;  3SSQ A;  1NKC A;  2AEM A;  2BJ8 A;  1VGY A;  1R31 A;  4LF8 J;  3DRS A;  4CTA B;  4FZV A;  5EWE A;  5C42 A;  4U7U D;  3G6E S;  4UT4 A;  2GGP A;  3FNN A;  4PPD A;  3K5O A;  1TK0 A;  3GFY A;  4RKU C;  2ZH2 A;  4EU0 A;  1NME B;  4MKA A;  5H1S V;  2LDI A;  3IS9 B;  5KFC A;  4C8K A;  2DR6 A;  4OYZ A;  5FDL A;  5KFV A;  1RGV A;  2WON B;  1JNZ B;  2WCX A;  2G2Z A;  3L4B C;  1C1C B;  2BQR A;  4EBD A;  1C4A A;  1RXO B;  3BRE A;  1FDN A;  1R0C B;  4NMX A;  4DHV A;  2E7V A;  4IRD A;  2DNY A;  3S7R A;  3I4H X;  3ET6 A;  2XGP A;  1ZPW X;  1I6J A;  1F0X A;  1N0V C;  5H9F J;  4CT9 A;  2NR0 A;  2LEA A;  1EJ7 L;  2ATC B;  4JI1 J;  2WBR A;  4WJB A;  5SZT A;  4DZ6 A;  1SUQ A;  3QBC A;  4KHP F;  2DNZ A;  3HVT A;  4WK1 A;  2FVP A;  3M2V B;  1U45 A;  1T8E A;  1M5V C;  2HHV A;  1VC6 A;  1KDN A;  3I5B A;  3UR0 A;  2PE8 A;  4KAI A;  4M63 A;  1N34 J;  1JX4 A;  2HZA A;  4YDD B;  3OXL A;  2BOP A;  1TUG B;  3MM6 B;  1X60 A;  2DO0 A;  2YKO A;  4CLP A;  3MPW A;  4X66 F;  2KM8 C;  3OVA A;  3JSM B;  4PUO B;  1HYS A;  2CJB A;  2NUU G;  4ZLJ A;  3BGF A;  1XTZ A;  4K59 A;  2R7X A;  1IJE B;  3R6L B;  1S9G B;  2W2N P;  4DV4 F;  4GKJ F;  5DLF A;  2RKI B;  1FNO A;  3CJ8 A;  4I1T A;  1UA0 A;  1RKJ A;  4LFB F;  3WQP A;  1HNV A;  4M5H A;  2FDN A;  2WZ1 A;  4QBU A;  3K58 A;  1YGY A;  1LXJ A;  3ZFV A;  2EVZ A;  4EGL A;  1NH8 A;  3R8Y A;  3VGV A;  4DL5 A;  3R2D J;  4DV5 J;  2C3O A;  2QRR A;  2V67 A;  2HWH A;  3QAU A;  2RVJ A;  1KP6 A;  1IBM J;  3HZG A;  3QT7 A;  2RAQ A;  1CC8 A;  1RU2 A;  1SL1 A;  4KH0 B;  2EKY A;  4B3S J;  4BC9 A;  3OUY A;  3W3S A;  1S12 A;  4LQ9 A;  3A13 A;  3BS9 A;  2OTL S;  3M9O B;  2W9B A;  2HRY A;  2RDI A;  3MPU B;  1NJW A;  4PQU A;  5IWA F;  3CJ0 A;  1YBA A;  2O66 A;  4BDP A;  3GIL A;  1PJ6 A;  3M30 A;  1KEK A;  5JXS A;  5DG9 A;  2EBE A;  1X4F A;  2BJE A;  5E0O A;  5LMN F;  4ED4 A;  2Q6C A;  4RNF A;  1AT1 B;  4M5M A;  3TUJ C;  5KFA A;  4DV1 F;  2ROE A;  1GH8 A;  3C8Y A;  3KYL A;  5F3Z A;  1K0V A;  4QU7 A;  3TRG A;  4NOH A;  4NYP A;  3KKF A;  1MN9 A;  1TKX A;  2F9D A;  2W2Q P;  5KOW A;  4RR5 A;  4PRF A;  4DUZ J;  5DDR C;  5ETN A;  4DR1 J;  4KPY A;  4JI8 J;  3SYZ A;  4RUH A;  2C2R A;  5GME A;  4DU7 A;  1N33 F;  3J80 U;  1JK9 B;  1CS4 A;  2KRR A;  1WWH A;  1IXK A;  3HHE A;  2W2O P;  2AT1 B;  3QNW B;  4ETX A;  2A2D A;  2MLY A;  4ZVE A;  2RNE A;  4WFA Q;  2XZD B;  3OXG A;  3GV7 B;  1SC6 A;  1W25 A;  4Z7C A;  2QLW A;  1FF2 A;  3V5R A;  4QIE A;  5J2Q B;  3HHD A;  3R1L A;  4CO5 A;  1NB7 A;  1LW0 A;  4ELT A;  2KHC A;  3W9J A;  1R43 A;  3A3N B;  3V4I A;  2XY5 A;  1TMM A;  3DGP A;  3IFE A;  2MXY A;  3OJS A;  4RNM A;  5J2N B;  3VV2 B;  2K1R A;  4DCP B;  1EQ0 A;  1RKI A;  1ZPV A;  5ITH A;  3PX4 A;  1J5E J;  1LK7 A;  2JH3 A;  3A8I A;  4M5I A;  3W1Y C;  5A6P A;  4LIR A;  3PDN A;  4NLY A;  4TLR A;  5FDL B;  2V5H G;  4CYU A;  5IQ6 A;  1PBU A;  2X3D A;  4G6V B;  2RT3 A;  1KQF B;  3M8S A;  1M1G A;  2PC6 A;  3D1Q A;  2M7S A;  1EIY B;  2BW7 A;  3VAJ A;  4W98 A;  5LSR A;  4QW9 A;  3B6B A;  4PWW A;  2RUS A;  2VG7 A;  2XTJ P;  3CJT A;  4WKY A;  4Q2M A;  2KHD A;  3Q22 A;  3MEG B;  1G7C B;  4ZCL A;  2E9R X;  1OIA A;  7AT1 B;  1RDR A;  2J7U A;  3U1N A;  2RRN A;  1IBK F;  2DNR A;  1SJ4 P;  1S10 A;  2HLU A;  3CF5 Q;  2EG1 A;  2P6T A;  2FVR A;  1YVF A;  2J6T A;  4EYI B;  4ED7 A;  1CUL A;  4M5J A;  2PN6 A;  2EW9 A;  4OHV A;  1U47 A;  2BW2 A;  2ILZ A;  3DRP A;  3BGL A;  1QTM A;  1ZOT A;  1U0H B;  3G9C A;  4B3O B;  1MU2 B;  3OFE A;  3WBZ A;  2B0G A;  2OPR A;  1GMW D;  1F1B B;  2OO4 A;  2ZNZ A;  3AOD A;  3ET6 B;  4LR9 A;  1QVG R;  1AXQ A;  2F8M A;  2V4R A;  3GFH A;  2HEK A;  1RZM A;  4J90 A;  5SUH A;  1WSR A;  2GJI A;  1RTJ A;  2ZBQ A;  3LP2 B;  2BUN A;  1RT3 B;  3SDE B;  3NNH A;  2HFS A;  5E33 A;  1KC8 T;  2GIR A;  1JNR B;  4QR0 A;  2BBE A;  5KAK A;  4FKY A;  4QWB A;  3GII A;  4MKB A;  3MR3 A;  2FLN A;  3PNI A;  3TAM B;  1HW8 A;  5J1P A;  1U2F A;  5DGB A;  1DFD A;  3BGR B;  3MMA A;  1DJ0 A;  5I3U A;  3IM9 A;  1MSW D;  4PG4 A;  2LQ5 A;  4F2S A;  5GAH U;  1F9F A;  2MQP A;  1VHF A;  4AQY F;  4MK9 A;  3X3U A;  2Z2L A;  1Q86 T;  4K50 A;  2G1H A;  3L95 X;  2QTW A;  4ZLL A;  1YLX A;  1N8R T;  1FK9 A;  1WG5 A;  2V34 A;  5CHC B;  4ZCI A;  4MIW A;  3D0G E;  4OZ2 A;  2XMK A;  3WZ0 A;  1U1R A;  2Z4P A;  2HFN A;  1KON A;  1HLW A;  1CC7 A;  2R7O A;  1PJ7 A;  1TL1 B;  3F44 A;  1U1K A;  2QT7 A;  2OIH A;  4DUT A;  1EP4 B;  4JI5 J;  4PYA A;  1TEL A;  3TAR A;  4QIW D;  1Q95 G;  3S8S A;  4DL3 A;  1S0M A;  4OI2 A;  1FRL A;  2ZZM A;  3PW4 A;  2V2K A;  3UD3 P;  2E1C A;  4Y2C A;  4DQP A;  3JQK A;  4KRW A;  4DQI A;  5CZV A;  3PXG a;  5HL7 Q;  2V2Z A;  3E01 B;  2R8H A;  2HHT A;  4R5P A;  4NCB A;  1YIJ S;  1H73 A;  4CH1 A;  1BE4 A;  4DI6 A;  1FRI A;  1X4C A;  2PD1 A;  2UZA A;  2OFH X;  3NGR A;  3RYL A;  2ZH9 A;  2CQD A;  3D7S B;  4URQ U;  5KFD A;  3RB3 A;  2XNR A;  3J7Y I;  5KG0 A;  5KG6 A;  3UPF A;  1TMJ A;  2IM3 A;  2E1M C;  1ZM4 A;  1L3U A;  2C3Y A;  1KHW A;  4ZPB A;  1CUL B;  2DK2 A;  2XUL A;  1X8D A;  4OJ3 A;  5D78 A;  2XYG B;  5KFU A;  2P9E A;  2PT0 A;  4X64 J;  3OVB A;  4B3R J;  4ED2 A;  1IR0 A;  2J9D A;  3AHP A;  1NB2 A;  3GR0 A;  3WIV A;  3CMA S;  5KFH A;  4DF4 A;  3PX0 A;  1KBR A;  2W8K A;  4I7F A;  1K73 T;  5DQG A;  2M9K A;  2Z30 B;  2HQ3 A;  4K5R A;  2OLW A;  3HFV A;  3BF4 A;  2IAJ A;  3MWB A;  1IR2 A;  2AJ2 A;  5J1E A;  1FKP B;  5HMW A;  3MEE B;  4YR3 A;  3J81 U;  5GMK a;  1SIW B;  2Y1I A;  1X7V A;  2WON A;  1P1T A;  1S9G A;  3OL8 A;  2I8E A;  1WHV A;  4USV A;  2YNG A;  2KO1 A;  2V9W A;  3BPD A;  1SC4 B;  3DDN A;  3UNG C;  4LR8 A;  3JSM A;  4J9S A;  3VQS A;  4L74 A;  2CNK B;  3CJK A;  3OV7 A;  4WP3 A;  3VR1 A;  4QZV B;  1QVF R;  2ZOG A;  1UVM A;  1ARO P;  1PG5 B;  2HFV A;  3HFZ B;  5CD4 H;  4G1Q A;  3KHH A;  2VH7 A;  4OZ1 A;  2WVD A;  2V8G A;  3NP5 A;  1VQ9 S;  2ZDP A;  1TFY A;  2B9W A;  2ZD1 B;  4ED0 A;  3HLU A;  4RW4 B;  1VBK A;  4DOZ A;  1HHQ A;  4DPY A;  2FHM A;  3CCR S;  1ZZF A;  4ZJQ A;  1BWE A;  1J2V A;  3MXH P;  4OYW A;  1FI4 A;  1TL4 A;  3KJF B;  3J7Z 5;  1RWU A;  3EYZ A;  1ITP A;  2FGC A;  3H59 A;  1WC5 A;  3K89 A;  5AXM A;  3KJV A;  3SMZ A;  3W61 A;  4X65 J;  4K4X A;  3KDO A;  3NY0 A;  1WDT A;  2SXL A;  3EZU A;  1EET A;  2CQ4 A;  1VR6 A;  2H4W B;  2NLW A;  2CXE A;  3DLH A;  2J9D E;  4JI3 F;  3PRV A;  2XNQ A;  4UQG A;  5I4M A;  2DNM A;  4NE9 C;  1RWK B;  3UN2 A;  2OTJ S;  2GFF A;  2ZBC A;  3Q8Y A;  4HTJ A;  3RRG A;  4AT1 B;  3H5Y A;  3M1V A;  4XPC A;  3KMS A;  1LV5 A;  2MKH A;  3NWR A;  4DS4 A;  3RRK A;  4ZVO B;  1KS2 A;  3TVZ A;  2EK1 A;  2KXN B;  5L1L A;  2B6A B;  2G9O A;  1D9F A;  4IQX A;  3BR8 A;  4JI4 J;  4PQU B;  1FKO A;  2FB0 A;  1WC3 A;  1WKL A;  4KGM A;  1Q0N A;  5KT5 A;  5HLF B;  4P2F A;  2IYG A;  2HW3 A;  3MUV P;  4LSZ B;  2JLE A;  3DOM A;  3PYE A;  1N56 A;  1NU4 A;  4NLU A;  1VQM S;  1HNW F;  2LDY A;  3BV8 A;  4J9N A;  1CQM A;  2MHN A;  4DPU A;  1Y3J A;  4NI2 A;  3JYT B;  2C2Z B;  3NGS A;  4UTG A;  5IM0 B;  4JI1 F;  4LRD A;  2BV3 A;  2XSJ A;  5C25 A;  2KFY A;  4DFP A;  4Q43 A;  1SQG A;  2FPH X;  5IS2 A;  4L3N A;  4WIQ A;  2ZWO A;  3RBD A;  2GVD B;  1HKA A;  3BSA A;  2R8I A;  2ZHB A;  3RW6 A;  3TA0 A;  2ROG A;  1S1U B;  3KG0 A;  2J76 E;  1B7F A;  2DHA A;  3U02 A;  2L9N A;  3LPY A;  4IFV A;  3ILI A;  1TKZ A;  4EMD A;  3T5K A;  5KFQ A;  4HYK A;  4PG5 A;  1TK8 A;  1T9U A;  2PA3 A;  3G82 B;  4LQ3 A;  2KVQ E;  2RF2 A;  3M2U B;  5DG7 A;  4ENO A;  4L72 B;  1NKB A;  4ZP7 A;  1CLF A;  5B0A A;  2UUA J;  2Z2Z A;  1FXD A;  4J5O A;  4OHZ A;  2DBB A;  3IAM 9;  3G71 S;  5KFT A;  5HP1 A;  2ERR A;  4TXS A;  1N6Q A;  4GKJ J;  3SQO P;  2NZC A;  3ZTQ A;  3OTC A;  4WTY A;  2FHO B;  1KOH A;  3SCL E;  3SCI E;  3FRZ A;  3IP0 A;  2JWN A;  2GX8 A;  5E3R A;  4DV5 F;  5T7L A;  2HQF A;  1IKW B;  2H48 B;  2BXJ A;  3HHL C;  4X66 J;  1IKV B;  2DB1 A;  4EZ6 A;  4NCG B;  3LWL A;  5D4N A;  2BKO A;  3BYP A;  4KR0 B;  3W60 A;  3P45 B;  4DV4 J;  3N4W A;  2PMW A;  4HL9 A;  4ZVQ B;  1S72 S;  4NZ0 A;  2DGW A;  1VK3 A;  3BBC A;  3UWT A;  4HTI A;  4ZVH A;  4CLS A;  3TA1 A;  2VB6 A;  4LSL B;  3I9V 9;  3SIP B;  3MZI A;  2AX0 A;  3LAL A;  1NXI A;  2GQQ A;  3R6G B;  4I2Q B;  4TN2 A;  4KV8 B;  3B82 A;  1FVS A;  1R8B A;  2H54 B;  3EZO A;  3TUZ C;  3C6T B;  5KFP A;  5E3C A;  2P8I A;  2CPE A;  1S0N A;  4O3Q A;  4KKO B;  4ZLP A;  1X4B A;  1UFW A;  2I1R A;  1DTQ B;  5E2Q A;  1VIO A;  2DNL A;  2E5H A;  1RWV B;  2FHJ D;  2OSR A;  3IA0 A;  4B9M A;  3CJR A;  5BYR A;  1B70 B;  1F9E B;  5F3T A;  4PAB A;  4DV1 J;  2UXD J;  3KK3 A;  1ZA1 B;  3P5B P;  6AT1 B;  3PW2 A;  2HHP A;  2NYI A;  2OPP B;  2GAH C;  5E5N A;  3T1A A;  2YNH B;  2MZ1 A;  3BEG B;  3DI6 A;  5DGA A;  2AJQ A;  1Y00 A;  4YOE A;  4WZQ A;  1X4H A;  2AHO B;  3PIP Q;  4UY8 5;  3C16 A;  3FSY A;  1B0T A;  2LMI A;  4NLX A;  4KB7 A;  3SFU A;  2A6O A;  3D6T B;  2MGZ A;  3QRR A;  2CDQ A;  2V0N A;  1G1X A;  1U1M A;  4UZB A;  4LRC A;  3C15 A;  1RHK B;  2IC3 A;  2CQ2 A;  1V5V A;  4DL0 C;  4AYB D;  2OAU A;  1DY3 A;  3A8K A;  3G82 A;  5F8H A;  4DCJ B;  4K4W A;  4RU2 A;  1HBM B;  2UUB F;  2B4V A;  1NJX A;  2GIF A;  1RAF B;  4O3R A;  1U1P A;  4UY8 T;  2KI2 A;  4LFC J;  3OLB A;  3C6T A;  3R7B B;  1OY6 A;  2DNP A;  2UXC J;  2BQ3 A;  1FDA A;  1RWP B;  2YNG B;  2N3O A;  4OZL A;  3TWZ A;  2H3E B;  5EDW A;  1WF0 A;  3EZ5 A;  1NSK L;  4C9D A;  2HSE B;  3DNC A;  2HVZ A;  2EC2 A;  5EX0 A;  2KFN A;  5A76 A;  1XER A;  2CZ4 A;  2FVC A;  3EMT A;  3T41 A;  1KSP A;  1M5S A;  2QSW A;  4F2R A;  1VYA A;  3OL9 A;  2VPX B;  1TL5 A;  2WBM A;  4K7Q A;  3GPA A;  1BHN A;  2OEL A;  4F4W A;  1U49 A;  2I2Y A;  1JLQ A;  3GYG A;  4HH0 A;  5LJ3 Y;  3FGV A;  2HMI B;  3HO1 A;  2X1A A;  4NEZ A;  4PQA A;  1X31 C;  2MZS A;  1RAE B;  2QA2 A;  2MKJ A;  2YKM B;  2ZHO A;  1MML A;  3BKU A;  3CPW R;  5L1K A;  1RLD A;  1W7W A;  2W4D A;  3KK1 B;  5F9L A;  2E1A A;  3Q8R B;  1FRK A;  3KG4 A;  4CT8 A;  1C0T B;  2HIY A;  3NAH A;  3B4M A;  1UTA A;  2Q66 A;  2IFX A;  4ZHR A;  2HFU A;  2H4Y B;  3E51 A;  4AL7 A;  1HWJ A;  1U7L A;  3NCR A;  5I3P A;  1BQN B;  1IQZ A;  4NLD A;  3UVJ B;  1KLN A;  3HD1 A;  1PBA A;  3LW5 C;  3MMC A;  4DQS A;  1H7X A;  4J9R A;  1R6V A;  1WC0 A;  4LF4 J;  1Q8K A;  2B3T B;  4NZ6 A;  4RW7 A;  2XM3 A;  4OI4 A;  1UP1 A;  1TKT A;  3LP1 B;  5GMD A;  1RT6 A;  4EO6 A;  2DT9 A;  2BJD A;  5A8K B;  2ZD1 A;  4C11 A;  1ICE B;  5CYQ B;  4E8U A;  1RHM B;  3EWG A;  1EQM A;  5B09 A;  4CLU A;  4YEA A;  2C3U A;  3CJ3 A;  2I5J A;  2CPZ A;  1RCO B;  5J2P A;  1CG2 A;  2VOD A;  1SI9 A;  2PEB A;  3A8J A;  4P6Q A;  4H4O A;  2BE9 B;  4LBP A;  4X4P A;  4QWC A;  3OVS A;  4J9M A;  3BDE A;  3QJJ A;  3EDR B;  1E6V A;  4DL4 A;  2NXJ A;  4ILR A;  4AL6 A;  3CE8 A;  1NDC A;  1FXR A;  1Q79 A;  1XJW B;  3K5P A;  2XQC A;  5AJ3 F;  1KN6 A;  4LFA J;  2QMW A;  3K5M A;  2J0S D;  2W25 A;  4NLG A;  3QPI A;  4DX6 A;  3DCA A;  3FSI A;  2YY3 A;  2V4Q A;  1QSL A;  2KT5 A;  3BQ2 A;  1KWM A;  2V8V A;  4WBF A;  2MMY A;  3OLA A;  4C8Z A;  5AE1 A;  4DV6 J;  1NK9 A;  1CJK B;  1MLA A;  1ZM9 A;  4KH1 B;  4URS A;  5B0G A;  1RUS A;  3KUE A;  1R0A B;  4PYD A;  1N36 F;  4F3O A;  2XHC A;  3N5B A;  2CQP A;  1HNI B;  3D3C J;  4Y2K A;  4FPI A;  4R25 A;  2CVI A;  2M70 A;  3IM8 A;  1S0O A;  4OZ3 A;  3TAM A;  4KPC A;  2ZH7 A;  3CUL A;  3B8H A;  3HI9 A;  2HVI A;  2GVZ A;  2AQ4 A;  4B3M F;  2ZVS A;  2OP5 A;  5ETV A;  5JVH Q;  4JP8 A;  4CZC A;  2XYP B;  3JS9 A;  3GFX A;  3WX8 A;  4XO0 A;  2EWH A;  3ZNJ 1;  4HR2 A;  3MMJ A;  2IMO A;  2OPQ A;  2XI3 A;  2DGV A;  2B4U A;  2GV1 A;  1VRQ C;  1UVK A;  2BRL A;  3GG0 A;  4NAS A;  1CSJ A;  4A8W A;  1URN A;  1PCA A;  1AZS B;  1CQN A;  2MLX A;  3CCV S;  1YK9 A;  2E5L F;  4W92 B;  1U26 A;  3MD3 A;  4MFB B;  2G13 A;  1P9Q C;  1U6Z A;  2PO4 A;  4ZVF A;  2NZ4 A;  2M3D A;  3AJ2 A;  3FFI A;  1TAU A;  3P8B B;  4KGV B;  4RNO A;  1F6T A;  1DQ8 A;  1IKW A;  1RA7 A;  1RWN B;  3F56 A;  3QQC D;  3GV5 B;  2JEI A;  2C2M B;  1YQH A;  5CYM B;  4DR5 F;  4DR5 J;  1PYS B;  2AW0 A;  2UVU A;  2E5I A;  4LR7 A;  4ID5 A;  2F3J A;  4URG A;  4TNO A;  1G6B A;  3H40 A;  4LF5 J;  2VAS A;  1XMO F;  2LU1 A;  3C14 B;  3QAE A;  4I56 A;  5D15 A;  5IT9 U;  3RAM A;  3NGD A;  1UW9 A;  1RAH B;  1RAG B;  1OPZ A;  2J8S A;  3MM9 B;  1BLU A;  2ZNY A;  4LF8 F;  1UMJ A;  5B0B A;  1FWK A;  3EUN A;  3HJF A;  4ALZ A;  3GE9 A;  1U1L A;  2AJF E;  3OSP A;  4DXL A;  2AYE A;  2KN4 A;  3F73 A;  2VPZ B;  4QW8 A;  3WIU A;  2AU0 A;  4NYZ A;  4F36 A;  1RBL A;  4ZOS A;  1IR1 A;  3NWG A;  8RUC A;  2MKY A;  4C8L A;  1N33 J;  4AL5 A;  3Q0A A;  2LA4 A;  4GKK J;  1VQ5 S;  1JLC B;  2MLZ A;  3DYA A;  4JUZ A;  5F8G A;  3OPK A;  3T1Y J;  3NNC A;  4WFY A;  2OML A;  3R2C J;  3CED A;  4BC7 A;  2B56 A;  5KT3 A;  2W4C A;  1Y9O A;  2MJN A;  2UV8 A;  3CCU S;  1NK4 A;  2AMC B;  4U6P A;  4K4V A;  5J1N A;  1FJ7 A;  2QFJ A;  1N5Y A;  4XDC A;  5BJR A;  4DV0 J;  1FWL A;  3N6M A;  1QAJ A;  1Z4U A;  3HX9 A;  2HHX A;  4ZJO A;  4WU3 A;  1RAA B;  3KLH A;  5LJ5 Y;  1RAB B;  2DNG A;  2ZDO A;  2B9E A;  2YQ3 A;  2RE1 A;  4FVC A;  4MYT A;  3MM7 A;  4CQ1 A;  1S1T A;  2JVO A;  3N6N A;  3OR2 B;  5A2Q Y;  2VBY A;  1VHI A;  2EI5 A;  1MWQ A;  2GW8 A;  2H5J B;  2I9S A;  2IYI A;  4USK A;  4RZR A;  1VQY A;  3M8W A;  3Q2S C;  1WC1 A;  4JI5 F;  2HHQ A;  3BYR A;  2CQ1 A;  2K2P A;  2CUY A;  4EFA C;  1Q81 T;  2XS2 A;  2E1P A;  2B9Y A;  3TEG A;  3CD6 S;  2DGU A;  2W24 A;  3KFW X;  3R5C A;  3R5J B;  4NRT A;  3VGT A;  5T14 A;  4YUD A;  4YR2 A;  1WC6 A;  1R7I A;  3ZTR A;  3MM6 A;  5F8I A;  3R1H A;  1WTB A;  3M30 B;  3TVK A;  4RW9 A;  1RTD B;  1B0P A;  4B3T J;  1MRO A;  2C2E A;  4R8U A;  1UZH A;  2OJ3 A;  2HBZ B;  3MOJ B;  4DV3 J;  2B43 A;  2G2Y A;  3U1L A;  2PFF B;  2KT2 A;  4U7C A;  1SL0 A;  2YXL A;  3N79 A;  3D3B J;  3V81 B;  2XZT B;  2MPU A;  3ZO7 A;  2ZHA A;  3BGU A;  5L38 A;  2XZW A;  3HSD A;  3CC4 S;  5KTQ A;  4YQW A;  2CPF A;  2MDA A;  4DR6 F;  3JTO A;  3MEC B;  4H4M A;  1S6P B;  2ALY B;  2ZJP Q;  1WNE A;  1S1W B;  1FCA A;  1RWM B;  2HND A;  5MLC V;  3CC2 S;  2KJV A;  2WOM B;  2N82 B;  2A18 A;  3OFH A;  1HPZ B;  2LXU A;  2RB7 A;  1M5H A;  2E44 A;  4IDK B;  4C3K A;  4OX6 A;  2JC0 A;  1B99 A;  1KR4 A;  1QAY A;  1Z1Z A;  2KDO A;  4OZ0 A;  2C1E B;  1Q1K A;  3SQG B;  2IM0 A;  1ELO A;  1GTH A;  4A8F A;  1T03 B;  2GJ2 A;  4WF9 Q;  3NOC A;  2UVR A;  4NX9 A;  2R2U A;  1L3K A;  1U09 A;  2MST A;  3DU5 A;  2FIU A;  1RHU B;  2BE2 B;  1U2C A;  2F8H A;  2M52 A;  2QG9 B;  3M8P B;  4RW8 A;  3IRX B;  1Q16 B;  5J1E B;  3N5F A;  4QIV A;  4B9T A;  1XR5 A;  3R7S B;  2CA9 A;  2XS7 A;  4UOG A;  1EHW A;  2VC1 A;  2M8D B;  2W7O A;  1U0H A;  3NGU A;  3DLL Q;  2GZO A;  2ACY A;  3IXQ A;  1RT4 B;  3K17 A;  1SH2 A;  1LFP A;  4AUK A;  1SUQ B;  2W9C B;  3SV4 A;  3PO4 A;  1S77 D;  2KKH A;  4RNN A;  3HDS A;  3M4X A;  1Q7Y T;  4IRK A;  5K20 B;  1QAX A;  3QRQ A;  3M32 A;  4WWS A;  3TNV A;  4CNY A;  1NEE A;  3PYG A;  4Z2X A;  3CXC R;  2PI5 A;  3GCX P;  4C8Y A;  3MCN A;  4G65 A;  4MJK A;  2JL9 A;  4LBH A;  5DS7 A;  1JKH A;  1YRT A;  3Q8U A;  3UI3 A;  4NLW A;  5A8R B;  1T9X A;  3KLH B;  2PII A;  4DN9 A;  1X9W A;  3AJD A;  5HRO A;  2UU9 J;  4IG0 A;  4PCQ A;  1J5O A;  1GK8 A;  4ZIT A;  4W90 B;  5DQH A;  3GLJ A;  3BDP A;  2BZ2 A;  4C3L A;  2Q3P A;  3FBB A;  4WPA A;  4ZP6 A;  3RW7 A;  4AE5 A;  2EC0 A;  2IM1 A;  1FTR A;  2Y0B B;  2CQG A;  4Y2I A;  2L9W A;  4OX7 A;  2WHO A;  2FJA B;  4X4R A;  2KZM A;  1VJW A;  2IA6 A;  3R9L A;  2B5J B;  3EIC A;  1TV6 A;  2MYF A;  3UR3 C;  3JB9 k;  4FF2 A;  4ED1 A;  1YRU A;  5EGY A;  2D1C A;  1GX6 A;  2AD9 A;  3C2P A;  1YZ6 A;  2RU3 A;  4AFF A;  3NMA A;  3JSY A;  4OI3 A;  1UVI A;  1JLE A;  5T41 A;  3HVR A;  2QLB B;  3CNQ P;  4WP8 A;  4KHM A;  4IOC Q;  2YNF A;  2HVD A;  4JV5 J;  4J9O A;  4EEY A;  1LW0 B;  1Y5L B;  2VFU A;  1U0S A;  2Y9H A;  3MAA B;  5BR8 J;  4TU8 A;  4PZV A;  3LGN A;  1C1B A;  3MM5 A;  1V6H A;  3PAC A;  3J7Y U;  1KQK A;  1YZ7 A;  3PYD A;  2VJU A;  4P73 A;  3R5G A;  4P72 A;  3J80 Y;  4YN3 B;  2CJY B;  5EUH A;  2JJ4 D;  3HHN B;  2D9P A;  4YFU A;  2MZT A;  2C2N A;  1T94 A;  2KB2 A;  1B4S A;  1NZA A;  2ASY A;  4H54 A;  5E3A A;  2Q79 A;  4L6V 3;  3UN3 A;  5D6G A;  3BBB A;  3RU0 A;  3UFC X;  2AGP A;  3MDF A;  1FDD A;  2ZM6 J;  2LCW A;  2WVB A;  4KGK A;  4U8V A;  4YDX A;  2XY6 A;  1E6V B;  4R8U B;  1FTC A;  5A2Q U;  3WC0 A;  5D3G B;  1TFW A;  2VJV A;  1RP5 A;  3IRX A;  1Q7L B;  4DL2 A;  1T9Y A;  2XHW A;  3HP6 A;  1L5U A;  4OJ1 A;  2J6U A;  2OPR B;  1VQK S;  3CJS A;  4ZVT B;  3MAH A;  1D1U A;  4YY3 F;  1BQX A;  2OMO A;  2ZVI A;  1HBO A;  3UDV A;  2MY8 A;  1SJR A;  2AX1 A;  2IA0 A;  3D1O A;  2D7S A;  2O01 C;  1WHW A;  3IWL A;  3W9H A;  3K8V A;  4FVM A;  4PXC A;  4RL1 A;  5L9X A;  5F8M A;  4ECU A;  3EPI A;  2ZZN A;  2F9J A;  3RR7 A;  1LQ9 A;  1WKJ A;  1REG X;  3Q8S B;  2R3V A;  4DR7 J;  5CXT A;  3W2V A;  2E5L J;  3EE3 A;  4KIA A;  2CZ9 A;  1D0E A;  3DLE A;  3OHA A;  4ZDN A;  4O3N A;  3NGK A;  5BYQ A;  4EZ9 A;  2YNI B;  3KLG B;  1X0P A;  1P9Y A;  1QTN B;  1Y7P A;  4HKQ A;  3BH6 B;  3CVK A;  2XI2 A;  2RSQ A;  3PEJ A;  4A8M P;  1U25 A;  3HZE A;  3KK1 A;  4AQY J;  5KFE A;  1HBN A;  2JOQ A;  2YX7 A;  1RWO B;  4UOF A;  4ZN1 A;  4P9S A;  1BQM B;  1UVJ A;  1YG0 A;  2HAF A;  1XWL A;  5BR8 F;  4IFY A;  2KZZ A;  3RB0 A;  4O44 B;  1U6F A;  3KK2 B;  2VHG A;  2F8E X;  1JLG A;  1KKH A;  3CJ5 A;  3I6P A;  3J7A N;  5HK4 A;  1HWI A;  4EWT A;  4MIA A;  2VG5 B;  3QWP A;  3MAQ A;  3PRD A;  4PUO A;  1SV5 B;  2FVQ A;  2H5I B;  1FFS B;  1UPM B;  2HAI A;  1Q82 T;  3OT9 A;  3L7O A;  1DTT B;  1VK8 A;  1QUV A;  2LFV A;  3H5S A;  5ETQ A;  1DLO B;  2BAN A;  2M0G B;  2ZOM A;  4IOB A;  5IOL A;  5J2P B;  3OXF A;  4HLB A;  1RTI B;  4DR2 J;  1JLA A;  1N0U A;  1VI7 A;  4GVB A;  1U1O A;  3GG1 A;  4IR9 A;  4J9P A;  4JI7 J;  4NXM F;  2J8A A;  2QO3 A;  3V4M A;  5LMN J;  2RHS B;  1ZM3 A;  3PJX A;  2JVR A;  3NS6 A;  3TJ9 A;  4Z7Y A;  2F4F A;  5IZH A;  3CIM A;  2CQB A;  2ADB A;  2KFZ A;  2VF3 A;  1PYO B;  3CGI A;  3LO3 A;  4F4A A;  4ZHR B;  3I31 A;  5A8W B;  4ZPW R;  4QWE A;  1VJQ A;  2IBO A;  3DOK B;  3KUG A;  2E5J A;  3ZC4 A;  1UWB A;  1NJY A;  2EBG A;  1Z2L A;  3NG8 A;  3C3L A;  1PC5 A;  2YX4 A;  2ZE2 B;  2LLZ A;  5D8H B;  4X4T A;  3CT9 A;  1RBO B;  4ED6 A;  2ZJQ Q;  4YR0 A;  4DFM A;  1AFJ A;  1R6Y A;  4ZA1 A;  2ALZ A;  3I5C A;  2FJB B;  3MR7 A;  1CJU A;  1KVK A;  1FER A;  2E66 A;  3M2R B;  4X4N A;  3TAQ A;  3HT3 A;  3GU0 A;  1RSC A;  4ECT A;  3HHK A;  2WSF C;  1C0T A;  2GHP A;  2HUR A;  3CCT A;  3DLJ A;  3MD1 A;  1GEH A;  3IC1 A;  5EWF A;  4J9K A;  5E3P A;  2I0X A;  4KKO A;  1V3R A;  2G0C A;  2HZC A;  1NSP A;  1X5T A;  2H51 B;  2M5Y A;  3C6U A;  5J2M B;  3Q8P B;  2YKM A;  4F7V A;  2KXF A;  3RRH A;  3HXM A;  5CD4 A;  4LF6 J;  1S6Q A;  1N5S A;  1NK7 A;  1J5E F;  4NEY A;  3IR7 B;  2IDL A;  2LU2 A;  3TUI C;  1RHJ B;  4GVL A;  4ECZ A;  2LEC A;  3EDQ B;  2BX6 A;  3I82 A;  3QT6 A;  4LSL A;  3O6Q A;  4MK8 A;  2XMA A;  1XMQ J;  2G4B A;  1H3D A;  3QSY B;  4QJV A;  4RUA A;  2BJ9 A;  4U95 A;  1JQG A;  1TU0 B;  5CYJ A;  2UXC F;  2KTQ A;  2VDH A;  2H65 B;  2WW4 A;  3FZ2 A;  4WXW A;  2LQJ A;  3DOK A;  3ZZU A;  3R5D A;  5HO4 A;  2PMZ D;  3MUM P;  2Y3Y A;  3BB5 A;  2BAC A;  3RZA A;  2LXI A;  5HMZ A;  4DQQ A;  2ZUA A;  4PAA A;  4FF4 A;  2C2O B;  3RBE A;  3S6E A;  1WKK A;  3SCK E;  2P9C A;  1RE1 B;  3NMR A;  5MAO A;  2J7W A;  5D0H A;  4JI6 J;  4Y28 C;  3PKM A;  1T3O A;  3CDU A;  3KLF A;  2NCK L;  2YWW A;  5LSO A;  3GJQ B;  3ZTP A;  5HAO A;  3POT A;  1WHY A;  4IH6 A;  3QO9 B;  1FVQ A;  3GIJ A;  1S1V B;  4J9Q A;  1CEZ A;  1HNI A;  3GIR A;  4RW7 B;  3FBF A;  3GP9 A;  5HAN A;  1SC3 B;  4RUC A;  1FRX A;  1D09 B;  3IG1 B;  1TKZ B;  1UET A;  2J0W A;  1Y4Z B;  3IMQ J;  1JWW A;  3UD4 P;  4FYD A;  3ISZ A;  1R89 A;  2BA9 A;  3MED B;  3MMB B;  5HJX A;  1RHR B;  2FZK B;  2CNN B;  3TW0 A;  3DXS X;  2YKP A;  3NGT A;  3NCP A;  1NDP A;  3GWC A;  1BQM A;  3RB6 A;  2LYV A;  4ZS6 A;  1CJV B;  5D4O A;  2F4V F;  3CIZ A;  4XAK A;  4TQS A;  1Y0H A;  2R7R A;  4KY3 A;  3ICL A;  2I6W A;  5LMU F;  2Y1L B;  3DFE A;  1FA0 A;  4CM0 A;  1OWX A;  1UFL A;  4YY3 J;  2B4P A;  2ZH3 A;  4DLG A;  2NS1 B;  4FKX A;  5KFZ A;  4I2P B;  1S7I A;  4GRS A;  3O5T B;  4L75 A;  1LWE A;  2WB4 A;  1FKA F;  4MKY A;  4ECV A;  2A6M A;  2F1F A;  4Y2M A;  1JLE B;  2FY8 A;  4CLF A;  1QD1 A;  2COL A;  5HSP A;  2DXF A;  1I3O B;  2BOA A;  2V2V A;  4N5S A;  3KLV A;  5B7W A;  2FJW A;  4OX8 A;  3HUL A;  2XLI A;  4FYV B;  3G4S S;  2XS5 A;  2DRA A;  4XDD A;  1RYR A;  2XMU A;  3KG1 A;  1QAI A;  3D68 A;  1F60 B;  1JLB A;  2ZFH A;  1OJ4 A;  3BSC A;  4FF3 A;  4CCH A;  2AWZ A;  2ZC3 A;  1R8A A;  3W65 A;  1VBY A;  2HK2 A;  4DV7 J;  2OH2 A;  3HVA A;  2Z58 B;  3AA9 A;  1KHV A;  3THV A;  5KFI A;  1NHU A;  1U02 A;  4MKV A;  1NZ8 A;  1WF2 A;  3ZZZ A;  4C0O C;  4HI1 A;  1MNE A;  2E5G A;  3VVU A;  2VQF J;  1U8W A;  2VBZ A;  2UV8 G;  5AE2 A;  1ZTT A;  4Q0B A;  1TVR A;  3CJQ A;  4FXW A;  2AP6 A;  5KFO A;  4DV3 F;  1HI8 A;  2N4D A;  2BM1 A;  4OV6 A;  2CPJ A;  2WAQ D;  3JSB A;  2RF2 B;  3CD7 A;  4RW6 B;  2NXN A;  3Q83 A;  3K8W A;  1XNR J;  3D1H A;  3N0V A;  4RW4 A;  4DFK A;  3TUP A;  3VCD A;  3MAA A;  3LTO A;  5D0G A;  4CM2 A;  5F9N A;  1IN0 A;  4XIU A;  3KLF B;  1F5A A;  3DDK A;  4LRA A;  4K4Z A;  1X4G A;  5GAG U;  3VTI A;  2X7I A;  2RHQ B;  5AT1 B;  4Q7A A;  1NM2 A;  3T19 A;  3V2U C;  5IQQ A;  3PFE A;  1OSD A;  1WOO A;  3QJL A;  4OI0 A;  3P4U B;  3JYT A;  4JI0 J;  5K8O A;  4G1I A;  3AOA A;  1NK5 A;  2JHE A;  1HNZ J;  4DSE A;  1F5C A;  1RLC L;  1W2B R;  3AA8 A;  4Q8F A;  3JQJ A;  2IBK A;  3HVW A;  4B9L A;  1NH7 A;  2YTC A;  1WJ9 A;  2B4O A;  4OLO A;  3DDI A;  5AJ3 J;  5CA5 A;  3CCZ A;  1S6P A;  1ZZN A;  2DR8 A;  3JTP A;  3MEC A;  3HSZ A;  2DR9 A;  4HT5 A;  4FPR A;  3W7B A;  4L3K A;  3OD2 A;  4C7Q A;  1T9V A;  1YSJ A;  2RJZ A;  2OPP A;  2HRU A;  2PFD A;  3GSI A;  1RT2 A;  4HAC B;  3TX0 A;  2JRS A;  4Q8E A;  2O67 A;  3G6X A;  2V63 A;  3QRP A;  4ZMM A;  3CWJ A;  2L9D A;  1BXN A;  3LH2 S;  3OTB A;  3PCO B;  2KT3 A;  5F41 A;  3PVX A;  2DNN A;  1KVJ A;  3DLG B;  2FYX A;  4ED8 A;  1H74 A;  3PM9 A;  4CLZ A;  4EUV A;  1AUS L;  1JB0 C;  3FQL A;  3AAW B;  2Y8W A;  2IJF A;  4RW9 B;  2UU9 F;  4TU9 A;  2VOO A;  4IR1 A;  5GVQ A;  3IAS 9;  1KOO A;  2HK3 A;  3LA0 A;  4QQB A;  3TZZ A;  1CJU B;  2ZH4 A;  1HI1 A;  2ATL A;  3IR5 B;  1YHQ S;  2W4P A;  4NZ7 A;  2R2S A;  2L41 A;  2HFO A;  3GMG A;  2HHU A;  2GQ2 A;  2CPX A;  2U1A A;  4I6Y A;  3EX7 B;  2HQG A;  5C24 B;  4OYI A;  2YWG A;  2DHG A;  2EPI A;  2CDR B;  2VC0 A;  2VUG A;  2BM0 A;  4NWB A;  2BKP A;  4OI1 A;  2DCU B;  1T03 A;  4DSJ A;  2HG4 A;  5FLX Y;  4FXD A;  2V4J B;  1HR0 F;  1IBC B;  2MSS A;  1ZA2 B;  4CYU B;  1VRU B;  2JC1 A;  4M5D B;  2OSQ A;  4F25 A;  4U9R A;  1I51 B;  5B0C A;  1RT7 A;  3UW1 A;  1SB6 A;  2CJA A;  1NRK A;  2C3P A;  3EXC X;  3H90 A;  4WYW A;  5EX3 A;  1EAR A;  1QUP A;  2V6A A;  2FLP A;  4DV7 F;  2XO6 A;  4DFJ A;  1IBK J;  1R8C A;  2RQM A;  1ULR A;  4ZPC A;  1ACM B;  2WW8 A;  3ZZR A;  2FHK A;  3T5H A;  4UW2 A;  2K3I A;  4DMZ A;  1YJV A;  3SFG A;  3T6B A;  2GNK A;  4DR4 J;  2NXC A;  3FK4 A;  2MB0 B;  5F8N A;  1LWF B;  1N5T A;  2CIM A;  1FJG F;  5ETS A;  3C6U B;  3QID A;  5LM7 E;  1YJW S;  1RT5 B;  4ERD A;  3KUH A;  4CLT A;  7FD1 A;  2FZG B;  2C42 A;  1RJJ A;  2HGN A;  3DM2 B;  5HQM A;  1RAO A;  2D3Z A;  3IWN C;  3I55 S;  3QFH A;  1REV A;  4DR2 F;  2K3K A;  1SIZ A;  3B4D A;  3GFZ A;  3GCW P;  4O4G B;  1UWA A;  4OQJ A;  2HVH A;  1DQ9 A;  4KHR A;  4X4O A;  4DG1 B;  4GKK F;  5CQG A;  5L39 A;  2RML A;  9ATC B;  3I32 A;  3NBP A;  5ETT A;  2KG1 A;  4NXM J;  1HFE L;  4ZPV R;  1PJ5 A;  4F4Y A;  2UXB F;  2BAB A;  4C97 A;  4WP9 A;  3OL6 A;  2EFG A;  2G0J A;  4PG8 A;  2EFO A;  5IM0 A;  4X4Q A;  4B08 A;  2YNI A;  4NI2 B;  4ES1 A;  3MM7 B;  5KFS A;  2HHH F;  4NLT A;  2YPZ A;  5HBM A;  4UF4 A;  1U24 A;  5CH7 B;  4C8M A;  5L46 A;  3TAN A;  2OKQ A;  3Q8V A;  1RAD B;  2AJ1 A;  2LKZ A;  3W2V B;  3V6J A;  3LOU A;  3VAG A;  3PRB A;  2YNF B;  3IGN A;  3I0R B;  5F8L A;  5H9E K;  1SKR A;  1QLN A;  2WTF A;  3Q2T C;  4RNH A;  5G4D A;  1WD6 A;  1NK6 A;  3RGI A;  1K47 A;  1UVN A;  1X4D A;  2AZ3 A;  4M1K A;  3J81 Y;  2CJK A;  2CQC A;  1M5K C;  3NEK A;  1PGZ A;  1BGX T;  1N36 J;  2OPQ B;  3FMW A;  4C4W A;  2DO4 A;  2MQ8 A;  3DM2 A;  4CTA A;  1K44 A;  2BE2 A;  2MQM A;  4IYQ A;  4TQR A;  1L3S A;  1KD1 T;  2Y8Y A;  4IOA Q;  3MR2 A;  3V6H A;  1VQO S;  1ZET A;  2N7C A;  1O0P A;  2HS0 A;  4A8S A;  1TKD A;  2FVS A;  3N9U C;  1EB0 A;  1TL3 B;  1U8S A;  3MFI A;  4OHX A;  1RTH A;  1S6U A;  2D74 B;  3FMB A;  4XK8 C;  1E6Y A;  1Q53 A;  4QYR A;  3V6K A;  4JV2 A;  1NDL A;  3FCW A;  2QLJ B;  3NL0 A;  3GYX B;  3MED A;  3CB4 A;  2V69 A;  1WG1 A;  2R8J A;  1R3N A;  2VA3 A;  2VG6 B;  1WC4 A;  1OYE A;  1B7Y B;  3KNG A;  4IG3 B;  3L7U A;  3DN9 A;  4KT0 C;  2DIS A;  2QN6 B;  3M32 B;  2B51 A;  1HIY A;  1FHT A;  1GMU A;  2DGX A;  1N88 A;  2R7U A;  2L48 A;  4ED3 A;  1VC5 A;  1HNX F;  1GXU A;  3HKZ D;  3POT B;  3V6D B;  1UAW A;  4Z37 A;  5L9N A;  4ES3 A;  3MGJ A;  4N7T A;  3KWM A;  2V8D A;  2IHR 1;  3VAF A;  4OZJ A;  3CTR A;  2APO A;  4ZCM A;  3G96 A;  3RAQ A;  1NBE B;  1N32 J;  4I6W A;  5FLX U;  3FVY A;  1A6L A;  1HNZ F;  2XMV A;  4M8L A;  4A4J A;  2XO7 A;  1VQ8 S;  3DLK A;  4ID8 A;  4QR1 A;  2QL7 B;  3KLE A;  3H8Y A;  2WRM A;  3F41 A;  4QCL A;  3BO3 A;  3EVO A;  5HQL A;  2BR0 A;  2GO8 A;  2K06 A;  3UCZ P;  4Y34 A;  4KO0 B;  3BSN A;  2HHS A;  1HD1 A;  3IR6 B;  4N8N A;  1NHV A;  2GHV C;  5U47 A;  2VBX A;  4A8Y A;  2B8Q A;  2HQI A;  5GAH I;  2WVC A;  2BRK A;  1T11 A;  1MWZ A;  3OTD A;  3CME S;  6FD1 A;  2AJ0 A;  3D54 A;  5KG1 A;  3HK2 A;  4IG0 B;  3VZI A;  1BQN A;  2VIH A;  3CC7 S;  4C3M A;  2YWF A;  2CAJ A;  2DCL A;  4ZVG A;  1KTV A;  3MHY A;  1O5J A;  2MQN A;  2I38 A;  1GMW A;  4J7C A;  3W8G A;  2E9T A;  1FJC A;  3PV8 A;  2VG6 A;  1H72 C;  4Y2A A;  5M2U A;  2W7A A;  2ZJR Q;  2QLF B;  1OQ3 A;  2ZC4 A;  4KC5 A;  1UW4 A;  2XCP A;  4HHH A;  1R8H A;  1U1Q A;  2VA2 A;  1RT4 A;  3GZ7 A;  5D0E A;  1LKZ A;  2W9C A;  4O4R A;  4FF1 A;  3KMQ A;  1P8G A;  3ISN C;  2AGQ A;  3B54 A;  2J9E A;  4U7U K;  2QA4 G;  4DV0 F;  4Q5V A;  3AOB A;  4YB6 A;  3M8R A;  4P7T A;  5DRK A;  1WEY A;  2LXF A;  3PFO A;  4Q2L A;  4EYH B;  1XR7 A;  2B9X A;  3CCE S;  5D3G A;  3AFG A;  4C6A A;  3VAM A;  1T3N A;  3CCS S;  1VRT B;  4TYB A;  4JYA F;  2YKA A;  1J5O B;  2O5D A;  1Z2Z A;  5DJB A;  4JYA J;  4IDK A;  3H4B A;  1V3Z A;  5CZX A;  2WOM A;  3I5A A;  3OL7 A;  2AEF A;  4WE1 B;  1WI6 A;  1IM4 A;  1ZAV A;  3EGV A;  2CQ3 A;  1HWL A;  3MTJ A;  4I0W A;  3H7H B;  4RW6 A;  2Z57 B;  4JV5 F;  4DUZ F;  2QYG A;  1FE4 A;  2JLF A;  3A8E A;  4IG3 A;  4PR6 A;  4BBY A;  4V1A k;  1RBA A;  4K2J A;  5JUM A;  1HBU B;  5LXY A;  3IBC B;  1XK8 A;  4FYY B;  5LOQ A;  2DIT A;  1XNQ F;  2VPY B;  4TVA B;  2IDE A;  2CWX A;  3BO2 A;  4DG1 A;  4FS2 A;  1YJU A;  1A0O B;  4N77 A;  1P6T A;  3R97 A;  1M0S A;  4F0M A;  3OTE A;  1NPP A;  4PPZ A;  3PJ9 A;  1SJF A;  4F0K A;  2YWE A;  4DSL A;  1C2P A;  1JLF A;  5HVH A;  2EFQ A;  4NA1 A;  4ECY A;  2PI4 A;  3FC9 A;  2KL8 A;  3EGW B;  3GJR B;  3OTO F;  3AJ1 A;  3K7R A;  3BO4 A;  4HHU A;  2Y0S D;  4DR6 J;  1S99 A;  3QLH A;  2E29 A;  2YH0 A;  4TYA A;  3H20 A;  2YKN A;  3GTY X;  1M1K T;  3W9I A;  3CCJ S;  3LP0 B;  3SXL A;  1NKE A;  1WOP A;  5C42 B;  1H2T Z;  2GVZ B;  3E8O A;  2GC8 A;  3J7Z T;  4L73 A;  4ZVP B;  4P71 A;  2Y1R I;  4IO9 Q;  4M5L A;  3HF5 A;  3IBW A;  5DDP C;  2DY9 A;  2X1F A;  2MQL A;  3O8W A;  1FXL A;  3I9Z A;  4Q45 A;  4V19 X;  2HKE A;  1X5O A;  2LQ9 A;  4H4M B;  2R9L A;  1SH3 A;  1XMB A;  3HKW A;  3QFW A;  4ZK7 M;  4K4Y A;  3EGN A;  3AQP A;  1FD2 A;  3CD5 A;  4NCA A;  2C3M A;  2RQK A;  1I5O B;  1MRO B;  3D67 A;  3D9B A;  3N28 A;  4KFB B;  4TKT A;  1BY9 A;  2DGS A;  5E41 A;  3KLE B;  3GB0 A;  4KO0 A;  3HCX A;  3UQS A;  1LOU A;  4OYO A;  2MTL A;  3PEH A;  3GON A;  1HD0 A;  1NAQ A;  2HFZ A;  4HI2 A;  1FRJ A;  2D3O 1;  1N48 A;  4RWX A;  4J9V A;  2ZH1 A;  4BS2 A;  3N01 A;  3HSG A;  2K7K A;  3ILO A;  3H25 A;  1C1C A;  2ASD A;  2NQP A;  3MUR P;  1RT5 A;  4M5K A;  1RTD A;  4NML A;  3MUT P;  5L1J A;  4E98 A;  3HPO A;  3PX6 A;  3WX4 A;  1SC1 B;  2B8P A;  1TL7 B;  5KFW A;  1GX5 A;  1R8P A;  2HVE A;  1K1S A;  3W5Z A;  4ECX A;  1VQP S;  1RT2 B;  4HAC A;  3MR5 A;  3CDA A;  1HPZ A;  1VQ7 S;  2QGF B;  1YJ9 S;  3ETO A;  1FDB A;  1YX2 A;  5KT2 A;  4NXN J;  1X5P A;  3GJS B;  2R7Q A;  1T7P A;  5KFX A;  4R0E A;  2JFK A;  2ZBR A;  1AA1 B;  2HNY B;  2NSC A;  2VV5 A;  4HDG A;  3JAM Y;  3OJU A;  4K0K F;  3M6V A;  4I2Q A;  3M9N B;  5CYM A;  4K4S A;  1FO1 A;  1RTH B;  1SJ1 A;  1XC9 A;  1C0U B;  1FNM A;  2OPS A;  1QSS A;  4CO1 A;  3FBC A;  3ZZP A;  4DCO B;  2GIQ A;  1JJH A;  3AY0 A;  3H4D A;  1T9W A;  3M8Z A;  2PGC A;  3TOQ A;  2XLJ A;  4KYZ A;  2NXU A;  5KG4 A;  4YS2 A;  3T9N A;  3BZQ A;  4ZJL A;  2RIJ A;  4ANE A;  5C24 A;  1D8Y A;  1B64 A;  5IV3 A;  3VZH A;  3KNA A;  1CPZ A;  1IUJ A;  1PIE A;  1RHQ B;  1XIQ A;  2VFS A;  1Y5N B;  1T02 A;  3OR1 A;  4NLP A;  1NSQ A;  4A8X A;  4DL7 A;  4F26 A;  4XTT A;  5K14 B;  4X84 A;  1P1L A;  3T6J A;  4QU6 A;  4J37 A;  2B6A A;  1HNW J;  1Y3K A;  2DNQ A;  3PW5 A;  1YBT A;  3HHL A;  2POK A;  4HVZ A;  1IVZ A;  4OHW A;  2EEY A;  3M6X A;  2XSF A;  2ZWP A;  2RQ4 A;  3M8Q A;  2OFG X;  1FX2 A;  2IVY A;  3RG6 A;  5EHH A;  5HMX A;  1VQN S;  1JKH B;  1C4C A;  3A1Y G;  1KVI A;  2MEW A;  1HBU A;  2XGQ A;  2XWX A;  4UUW A;  3US5 A;  1GXL A;  4ZN3 A;  2ZH8 A;  2GML A;  2IRU A;  3ITH A;  2HGM A;  1OPI A;  1NPR A;  4U67 Q;  3R5A A;  3UDC A;  4B9V A;  1H2U X;  2OI2 A;  1XMQ F;  1T05 A;  2OD6 A;  1SBR A;  1VDH A;  2DEI A;  2HWI A;  1HQE A;  2GVD A;  2ZH6 A;  1XNR F;  5A6W A;  2R7W A;  1AZS A;  3VAH A;  4DU8 A;  1ZM2 A;  4O4G A;  3E2E A;  3J81 j;  4JI3 J;  1S57 A;  4LF5 F;  4B9S A;  2AIR B;  4KGX B;  5F0U A;  1UJ5 A;  3FFI B;  4P74 A;  5CAB A;  1Q8B A;  1ZAW A;  1VQ4 S;  2UVV A;  5EN1 A;  4A46 A;  4DF8 A;  1O51 A;  1HL6 A;  2NPI A;  3CUN A;  3L09 A;  4OLP A;  4QOT A;  4ZPD A;  3PW0 A;  1L3T A;  1LWF A;  3WHI A;  4XPE A;  4PWD A;  2OEM A;  3BKF A;  1LWE B;  3OQ2 A;  2CVE A;  5G0R A;  4NLV A;  1YI2 S;  5AXN A;  4TY9 A;  2GO9 A;  2HGL A;  4UOC A;  2MQQ A;  2ILY A;  3KLI B;  3HHL D;  5F0W A;  1GAO A;  4X62 J;  3SV3 A;  1FD8 A;  4UUX A;  2DHX A;  3G8S A;  4B9N A;  2VG5 A;  4JI7 F;  3P6Y C;  1CJV A;  2RS8 A;  2V9K A;  2CWK A;  4GO5 X;  2C28 A;  1WOS A;  4H4K A;  4P10 A;  1A9N B;  4M5D A;  2PMH A;  5KFG A;  4WXO A;  2QE5 A;  4PEO A;  3UCU P;  1QE1 B;  1IKY B;  3QSI A;  4LRF A;  5I3Q A;  3MMB A;  2XC9 A;  5KOX A;  2VFT A;  2IAJ B;  3ZZY A;  2LEB A;  1HWU A;  1FNX H;  4UST A;  4NXN F;  1T9T A;  2E1R A;  3MM8 A;  3TP2 A;  5KFK A;  2HLT A;  3FQK A;  3EJM A;  4ICL B;  1H6K X;  4L76 A;  4FP9 A;  4K0K J;  2LEP A;  3QO9 A;  5LMU J; 
#chains in the Genus database with same CATH homology
 5ETK A;  3HCX A;  1KBR A;  5ETM A;  5ETT A;  4M5M A;  4M5G A;  3HT0 A;  1IM6 A;  1RU1 A;  1TMM A;  3HD1 A;  3HSD A;  5ETO A;  3ILI A;  1G4C A;  3ILJ A;  4CRJ A;  3HSJ A;  4M5H A;  5ETP A;  1EQ0 A;  4M5J A;  3KUE A;  2F65 A;  3HSG A;  3ILO A;  3MCN A;  4M5L A;  1Q0N A;  4F7V A;  4M5I A;  4M5K A;  5ETN A;  1EQM A;  3MCO A;  3UDV A;  4CYU A;  2QX0 A;  1EX8 A;  3QBC A;  3KUG A;  3MCM A;  3UDE A;  1RB0 A;  3HD2 A;  1RU2 A;  2BMB A;  1TMJ A;  4PZV A;  5ETS A;  5ETR A;  3UD5 A;  5ETL A;  3IP0 A;  3KUH A;  5ETV A;  1RTZ A;  2F63 A;  1CBK A;  3HSZ A;  1DY3 A;  1HQ2 A;  1F9H A;  3ILL A;  4AD6 A;  1RAO A;  5ETQ A;  2CG8 A;  4CWB A;  1HKA A;  4CYU B;  4M5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...