4CYUB

Staphylococcus aureus 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase in complex with ampcpp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
155
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-PYROPHOSPHOKINASE
publication title Structure-Based Design and Development of Functionalized Mercaptoguanine Derivatives as Inhibitors of the Folate Biosynthesis Pathway Enzyme 6-Hydroxymethyl-7,8-Dihydropterin Pyrophosphokinase from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 40
structure length 155
sequence length 158
chains with identical sequence C, D
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2014-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4cyuB00
1HQ2A 1RB0A 3HCXA 5ETSA 3MCOA 5ETMA 3UDEA 1CBKA 2F65A 3ILOA 4AD6A 4M5GA 1RTZA 5ETKA 4CRJA 3HSJA 4CWBA 3HD1A 5ETNA 1RAOA 3KUEA 1IM6A 3HT0A 5ETRA 1G4CA 2BMBA 1EQMA 3UD5A 3MCMA 2QX0A 3IP0A 3KUGA 5ETVA 2CG8A 3ILIA 4M5NA 5ETTA 5ETPA 1DY3A 3MCNA 4M5KA 3HSGA 1RU2A 1EX8A 1TMMA 3KUHA 4M5IA 4F7VA 1HKAA 3HD2A 5ETQA 1KBRA 4PZVA 3ILLA 4M5MA 1Q0NA 1RU1A 3UDVA 4CYUB 5ETOA 3ILJA 4M5HA 4M5JA 3QBCA 1TMJA 4M5LA 4CYUA 1EQ0A 2F63A 1F9HA 3HSZA 3HSDA 5ETLA
chains in the Genus database with same CATH superfamily
1VQNS 2QE5A 3T5HA 4DX6A 2N3LA 5HMXA 2ACYA 4O0IA 1GH8A 2BYCA 2VPZB 1HNVB 5KFTA 5EWFA 4I2QB 1B7FA 1LW2B 4B9VA 3R5AA 4BC7A 4DUYF 2GGPA 3F56A 1N5SA 2YKAA 2V8DA 1R27B 5FIIA 1AA1B 4X62F 2H65B 2CJXB 5GAEI 4K4ZA 3TZWA 1G7CB 2BJDA 2G4BA 4RUCA 1NKEA 2DRDA 2B7BB 2CWKA 3KLHB 5D3GB 4JV2A 1SPBP 1SQEA 4USTA 4WXOA 5KFCA 3LAKA 3GSDA 3OQ2A 1H7WA 1RK8A 3RBZA 3AT1B 3CGIA 4DU8A 1S1VB 2KG1A 2I5JA 3QWPA 3L7PA 4FZVA 4IH6A 1FXLA 1I94J 5F8JA 2BXJA 1RWUA 2RMLA 3EE3A 4LF5F 5F3TA 3HSGA 2OTLS 3G82B 3GIRA 2M4MA 4KHMA 2UXDF 1UEVA 3WHIA 3OV7A 3IMQJ 4ZP7A 5DG9A 1Q5VA 2HNZA 2XMKA 3R6GB 4LBPA 5FD1A 1RT1B 4MH8A 3ILLA 2AHOB 3I5BA 1EQ0A 3MECB 4RWXA 4ELUA 2A0FB 1RAEB 1B0PA 4Z37A 2LQBA 3IWLA 4A48A 5KFZA 5D78A 3IO1A 2AJFE 1FRLA 2W2OP 4K4UA 1TU0B 1S1XA 1CJTA 3W7BA 3M8QA 3M8SA 1U47A 3BBFA 3FUYA 4FBTA 5KG4A 2G0JA 1S0OA 4BDPA 2VIHA 3D1OA 3CE8A 3ZZUA 2E5JA 4J9MA 1Q16B 4NCGB 4LFAF 2HHXA 3EVWA 3UO0A 5ETNA 2F8EX 1RTHA 3QJPA 2IRXA 3K58A 2BQ3A 2DO0A 1FRXA 1P27B 9ATCB 1H7XA 3FBBA 1UTAA 3CIMA 4CWBA 3P6YC 1HNXF 4QYZJ 2ALYB 3BGOP 3TZZA 3AB2B 2X1AA 4OFZA 1EETB 3T1YJ 1IKWA 3MM9A 1L3KA 3MMCA 2WB4A 3M2UA 3IM8A 4ZCLA 4C48A 3MEEA 1KDNA 2QFJA 1L5UA 5CXTA 1FKPB 1T9YA 3HVRA 3Q8VA 1S77D 5GVQA 2E7WA 4Y28C 3BKTA 3FCVA 2P9GA 4PQUB 3PV8A 2ZNZA 2B51A 1UL3A 2B5JA 2HWTA 3QO9A 1YLXA 2EC0A 1S99A 2E9ZA 3EDQB 2BEFA 3D2WA 3M8WA 5GMEA 4B3SF 4LR7A 2WBRA 5CYJA 1X4HA 2BR0A 1RTIA 4WJBA 3ZZPA 3LGHA 3IA0A 1JLFA 2ZHBA 3PW4A 2FC9A 3WQPA 1FO1A 3V6DA 3GFXA 4LSLB 5D0RA 3WC2A 4KGVB 3E3XA 5A0YB 4CRJA 2A6OA 1MLAA 2M8DB 2AT1B 4I6WA 1FXDA 2ZH4A 2DY1A 2Z58B 4OLPA 4URQU 1CSJA 3GQCA 5JVGQ 1IN0A 3DYAB 1I3OB 4A8OA 1SKUB 1OIAA 2JC0A 3ISNC 3FDSA 2QMXA 3CCQS 2JLGA 3ZFVA 2KYZA 1FE4A 2MZTA 1WTFA 3FBEA 3KG1A 2JLFA 4DV7J 5KFEA 3H40A 4N8OA 2NS1B 1Q4RA 5CD4H 3QZ8A 3BBCA 1KS2A 1GMVA 2L41A 3MI7X 2IY5B 2UU9F 4CLPA 3FRZA 3POTB 1F9FA 2V94A 1X5SA 1NB7A 4TU9A 4FNHA 2D74B 3F73A 4DX8H 3JB9k 3P5TL 5E33A 2HHHJ 1WHXA 5E7OB 2C2KB 3FCWA 1IWAA 2EW9A 1UCNA 2G1HA 3H90A 2GA7A 4UQTA 1HYSB 2DCUB 4DV5F 4MT1A 1Q82T 5D4OA 3OTOF 2R42A 2B4VA 4ED4A 3HM9A 2Q43A 4H4MA 2ILZA 5HLFB 4MFBB 3UDVA 2AJ0A 4YDDB 4KPYA 2GHPA 4HHHA 3MEDB 5G4DA 1BGXT 1Q5YA 4DSEA 4KB7A 1URNA 4LFCF 5KFIA 4ETZA 3MEKA 4AUKA 1TMMA 3ETOA 2OAUA 3D0HE 5EN1A 5GMDA 4TLRA 3M2VB 3GIIA 2EFPA 2BUNA 3BYRA 2OO4A 1UWBB 1REVB 5KFHA 1JIHA 1N32F 1DQ8A 5CH7B 5EWGA 4QQBA 2W24A 4UY8T 5FLXY 5DDOC 1D1UA 3L09A 3IAS9 4OZ2A 2I6WA 4KC5A 8ATCB 1E6YA 3DRYA 2KI2A 1LEOA 4U7UK 3TWZA 1H6KX 4JI7J 4DSKA 1W2BR 4YN3B 3BH6B 4PUOB 2HWIA 1RWPB 3SFGA 3LP2B 4Y3CA 1OY9A 5IC6B 5IT4A 3MM7A 3GFHA 4LF9J 3PRBA 5KFKA 2XY5A 1S48A 2IM3A 2Z0GA 2NYHA 4M94A 2KVIA 6AT1B 4NMXA 3HHEA 4OI2A 3OL6A 1IKXB 3IRWP 4RPFA 2KU7A 2GC8A 1W26A 2Z4PA 1V5IB 3D68A 3PG9A 3TUPA 2HK3A 4OIXA 4CLKA 1RP5A 2L9DA 2IM1A 3K5PA 1PC4A 3JAMU 1N6QB 4CT9A 4F2RA 1R7IA 3NGKA 2J9CA 2MPUA 2XCAA 3JTNA 2DBBA 1X4EA 3CMQA 3T1HF 3TJAA 3GR1A 1KTQA 2CVIA 1KVJA 4DQIA 4C4WA 3C14A 4FF2A 3KK1A 2WVCA 4C3KA 4F25A 2AJ2A 4IR1A 4C11A 5I3QA 1ZM4A 3PFOA 4NX9A 3V6HA 2MGZA 2JVRA 5HQ8A 1YQHA 5E3PA 1ZOTA 4PYAA 1MW7A 1YK9A 1VR6A 4L73A 1ZAVA 4RO0A 1WC3A 5SZTA 8AT1B 1VQKS 1G6BA 3MAAB 2VODA 2VZ9A 3X1LB 4B3TJ 4DS5A 4JI6F 2ZVSA 2XHCA 4YB1P 4KTQA 2K1RB 4A8FA 4ER8A 2HNYA 2VG6B 3CCSS 2X1GA 1WHYA 5DQGA 4AL5A 4ED5A 3ETMA 1UWAA 1SJ3P 1HW9A 1X5TA 2VG5B 2W9CA 4AYBD 4ES3A 2O66A 3RU0A 1U1OA 4CLLA 1Y11A 4IFVA 1TK8A 4R5PB 1DTTB 1CJUA 1J5OA 1BWVA 3EPGA 1NK9A 4J7CA 1WTBA 3SZ2A 4XIUA 3QJLA 2E44A 1QUVA 5LL6d 2XEXA 2V34A 1DFDA 1K73T 4USIA 2BKPA 3V4IB 2MKHA 4DDFA 5E2QA 3M8PA 4RX6A 1VRTB 3BB5A 2AEFA 1S9FA 1XMQJ 4RNMA 1SJ4P 4ALZA 2ZH3A 3VWSA 2D3UA 4P2MA 3D6HB 1TL1B 4FVCA 3DLGB 1PYSB 2E1PA 2WW8A 2KM8B 2AEMA 2EFOA 1FDBA 3FMBA 5F8LA 1KOHA 2IRUA 3EXYA 4K2JA 2ZE2B 1AYEA 3N6MA 2ZZTA 3GCWP 3GG0A 4DR5F 1AFIA 2IJFA 3G71S 1DRZA 4RW8B 1IJFB 2G1DA 1H3DA 4KV8B 4GC6A 4DG1B 1XC9A 2DEJA 1EKSA 2PA3A 5A8RA 1JKHB 4LF1A 5LSRA 5J2PB 4FYDA 2KXNB 1Z4UA 3VGSA 4DR1F 3OPKA 1JLEA 2KB2A 2WTFA 1VISA 2EK1A 3CC4S 2DIUA 3J81j 3A8EA 5KFFA 5FJ4A 4L74A 1FJ7A 4I7FA 2LLZA 4FS1A 2Z2YB 3HCXA 5LSOA 5D4LA 1A6LA 1FT8A 4G1IA 2RF2A 1RAGB 3EZUA 5KFUA 2APOA 1JXVA 4NLSA 2CPEA 2DNYA 3HDSA 4EYHB 4P74A 3SQGB 4DUYJ 4JV5F 2RB7A 4B02A 2HVZA 2WOMA 3B6BA 3KYLA 3N9UC 2A18A 5DQHA 3CMES 1FXRA 2Z56B 5D0HA 5H9FJ 5AE3A 5D0EA 3AXMA 3OXGA 3H5SA 4M1KA 3V4MA 1EIYB 1G2EA 5D8HB 3WBZA 4MKBA 4PPZA 4F67A 4CLUA 2POKA 1F1BB 5E41A 2UUCF 1TFYA 4LF5J 1WNEA 3T9NA 3HZGA 2Z57B 3HVTB 2JZ5A 4LQ9A 5HI7A 1UMJA 1WDTA 3TOQA 5M2RA 3TAQA 3LPYA 2UXDJ 5IT9Y 1D9AA 4UZCA 4Y34A 5EDWA 3ZO7A 3TVZA 3PRVA 2W2NP 3ZZOA 1S1XB 1CJTB 3H59A 2QV6A 3M8QB 1C1BB 4NLVA 4DX7A 3ITHA 1H73A 3HFZB 2GMJA 3CCLS 2GQ2A 5KFBA 5J2NA 2ZD1A 1JK9B 2C28A 4RNNA 2JOQA 1KFDA 4PG8A 3OL9A 3M4XA 4Y6IA 4OYXA 1PAEX 4P7TA 1YG0A 4NXNJ 1TL3B 2FGOA 2CJAA 4OL8A 5A8KA 3CJRA 3G8SA 4QWAA 4ZVSB 4C98A 2EI5A 5AXNA 1QVGR 4BHQA 2WSEC 1IVZA 2HVDA 4HLBA 1S1WA 5HP1B 1TUGB 2BE2B 1KN6A 2DRBA 4OZJA 4DWIA 3FC9A 3PJWA 5F8IA 3MM9B 2R8IA 2LEAA 5LMUF 1S72S 3M2UB 4QIWD 2AJ4A 2MQQA 2DISA 1Q7YT 3MEEB 1ZM3A 1H98A 3BQ1A 1ZM9A 2YXLA 4JBCA 2XGQA 5AE2A 1WWHA 1DJ0A 3PX4A 1Y5NB 2WK4A 2LCWA 1ROFA 5DGBA 2XULA 3CDAA 2AIRB 4NXMF 2MLXA 2BE7D 3CJ8A 4WZMA 3TW0A 4ECZA 1T02A 1SL1A 3PY8A 5E3RA 4IFYB 3NEKA 4O3SA 3PXGa 1N0VC 3QSIA 1YJWS 1G4CA 1U7LA 4LF2A 2ZHOA 4F04B 2P9CA 2V2QA 4ZITA 4OMFG 2AW0A 4ID8A 3TARA 5JUMA 1HMVA 1YTYA 3GILA 1TKTA 2KG0A 2PEBA 4KO0A 4B3SJ 3TA1A 1ZTTA 1WD6A 2NXEA 1S9GA 3IP0A 3JYTB 3GV7B 3MURP 1WOPA 3C2PA 1X4CA 2WVDA 5IM0A 1QUPA 4OYAA 1KLMA 3RW7A 4J90A 4LT6A 2Y0BB 2EFQA 4DV6J 3CCVS 1S97A 4YB6A 2L3MA 4KR0B 3T3FA 1NDCA 3KLIB 2BKOA 1K0TA 2PFDA 1R6YA 1LWCA 3TAMB 3MWBA 4RNHA 4CDIA 3ZZRA 4LSNA 4LF6J 3NS7B 2OSRA 4V19X 2VF3A 4NLTA 1NB2A 1X8DA 1UA0A 2HQCA 4X2BA 1FRMA 2X1BA 2O1PA 1QAJA 2J7UA 1RKJA 2ROPA 2FHJA 4RUAA 4MKVA 3QIDA 2FIUA 3AA8A 4ED6A 2XLKA 4JI8F 4PPDA 1JLAA 2CPIA 4HL9A 4NYPA 1FNOA 1NKCA 3SIPB 4OHYA 1RI7A 4EO6A 4JI1F 8RUCA 3R2DJ 3FFIA 5GAGU 4WF9Q 2QLXA 2ZJQQ 2FVPA 3VAGA 2DIVA 1QVFR 4DN9A 3TVKA 4LFBF 4ZP8A 4Z7YA 3D4JA 2IVMA 3NKYA 1SI9A 4NLUA 1CS4B 2IRYA 4GRSA 2FVSA 5DM6Q 1T9XA 1T03B 4OYPA 1Q7LB 4FXVA 2J5AA 1YZ7A 4O44B 3OTOJ 3MGJA 4ZCIA 5BYRA 2R8JA 3A3NB 1YJNS 2R8KA 1YZ6A 3ILOA 3KLEA 5C42B 3VZIA 1FD2A 1RAJA 4J37A 1Q8LA 2CPFA 4J9RA 4DR4F 4DV2F 4TQRA 2UVWA 3AXKA 5F8GA 1JJHA 1SVDA 4E98A 5ETSA 5K14B 1N54B 3IG1B 4LR8A 4ZLPA 1GAOA 3CT9A 4XK8C 4KGZB 2J7WA 1NSAA 5DZ6A 3IN5A 1FJEB 2YWEA 5T41A 3HT3A 3I0SA 1NSQA 4ECSA 1A0OB 1CJKB 1R6VA 2H5IB 3UCUP 4IKAA 1XMOJ 5H9EK 4IDKB 2I9SA 3KUGA 3JSMA 3HHKA 2VB6A 2CKWA 3NL0A 4NE9C 2AU0A 2R2TA 3Q8QB 4QIFA 5DM7Q 3GIMA 4DV3F 1WC0A 4P9SA 4ZLNA 1O51A 2E7VA 3CCUS 2GVDA 4TN2A 2GO8A 4DL2A 2WSCC 2QA4S 1S0MA 4GKKF 2MKCA 3ET6B 1RAAB 4Q2LA 1WEYA 2GFFA 1S5ZA 3CW2C 2R7SA 1VJWA 2DGUA 5HMYA 4KIAA 5D0GA 2HFVA 4Y00A 2IPOB 1VC6A 3K8VA 3TJ8A 1X9SA 2W2PP 4JUZA 3MM5A 3QT7A 3ENQA 2Q6CA 3H2LA 3R8YA 1KC8T 4FF4A 1FNXH 1HBOA 1B3TA 2BW2A 4JI3F 1HNIA 1RE1B 2EVZA 5E3AA 2CJQA 1YKWA 3U27A 2OH2A 1RTJA 4BS2A 1RWOB 3J7YU 2DRAA 3PCOB 2CNLB 1IBCB 3MOZA 1HBMB 1YVFA 2MSTA 4F2SA 2HK2A 2EEYA 2LDYA 3FZ2A 4ZDNA 1HI8A 3UVJB 3GFZA 4ECWA 2PIIA 1TVRA 2LQ9A 4QWEA 2W01A 3CD0A 4AT1B 2DR8A 3GCXP 4U96A 2W9BA 4DL6A 4ED7A 2PO4A 2QSWA 4RR5A 4O3NA 2PMHA 3EGWB 1PJ6A 1R8BA 2VUGA 4XDDA 1TUWA 4CP5A 4IFVB 2Q1LA 3PHTA 1QDUB 3R3TA 2ATCB 3D1QA 2UV8G 1X9WA 4C8YA 2DH9A 4DHVA 4KGXB 2NUUG 4C2MA 5A6WA 4WU3A 2KKHA 5GADU 5DZ7A 3LA0A 1UP1A 4DL0C 1LK7A 1LWFA 3NCQA 5GAGI 3MPVA 4DFMA 3ONQA 2HBRB 2QL7B 4P2SA 3A1YG 3R27A 2LEPA 1AT1B 4X4TA 1RTZA 5IXUA 2BRLA 1RCOB 1SQGA 3I5CA 2M7SA 2B9WA 4HACA 3CCES 4UOGA 4M5IA 2R7XA 3W8GA 1U0HA 2FB0A 1UVJA 1WEXA 3VR1A 2G0IA 1FRKA 5DS7A 3KG0A 2J0SD 3W2VA 4B17A 3GP9A 2C2MB 4M8LA 1IBLF 4MYTA 3OT9A 1RU1A 4WFYA 2AZ3A 3FNNA 1CBKA 2D69A 4C8MA 5IV3A 2LP4A 3CJ0A 2RT3A 1FRIA 2LXUA 3ZTPA 5A8RB 4PKDB 2LXFA 3V5RA 4WFNQ 4DR5J 1UEUA 2W7AA 1EZZB 5HN0A 5K8MA 3LGNA 1RBOB 1U1RA 2NZ4A 4GO5X 3H0PA 2RNEA 4A8QA 4ED2A 4C8LA 3OR1A 1YBUA 4NMLA 4YY3F 4PWDB 2XSJB 2CQ2A 3JAMY 4GVBB 2QA1A 4MK7A 4ZVFA 4FXWA 2R3VA 2QRRA 4K4YA 1OPZA 3HO1A 2ZOFA 4B3MF 1XJWB 1G3OA 5AXMA 1HIYA 1DARA 1P6TA 1B70B 1FK9A 4RZRA 4ECXA 4OYIA 2ZFHA 3BYPA 4H4OA 3E8OA 4WFZA 4WFXA 2Y9HA 2QO3A 3GE9A 3NS6A 1XNRF 1PJ5A 3BR8A 4M5HA 5LSLA 2VG7B 1S1TB 2KXFA 2AYBA 1RWXB 4ECUA 2KT2A 1SJQA 2W8KA 4OJHA 3D3CJ 2VBXA 1NJWA 5CYQB 1VRQC 5AJ3F 2DHSA 2XY7A 1UFKA 1RHRB 3CUNA 2PMZD 3CJ2A 4ID5B 4HI1A 2DD8S 3J7Z5 1RTDB 2CPZA 2LVWA 2HEKA 2B3TB 4CQ1A 5C24A 1ZZNA 3SSRA 1NLKL 2VBZA 1JJ2R 5EGYA 1JX4A 4F50A 3J7YI 3C6UB 3M2RA 2UUCJ 3PVXA 1RT5B 3OUYA 2HRTA 4QBUA 1F9HA 3DLKA 2P6TA 4NA3A 1N36J 2D41A 3PNIA 2ZKTA 5IS2A 5J2NB 1JLQB 1DTQA 1OSDA 3TAPA 3CCMS 2IDEA 4YB5A 3QPIA 2B8PA 7AT1B 3CEDA 1FEEA 2HHQA 1HBNA 2W25A 1SJ1A 3W9IA 4M5GA 3O2IA 2EBGA 5ETVA 3MEGB 2FY8A 3LP1B 2AX1A 5A8KB 3TEGA 2IC3A 3SV4A 2UXCJ 4NASA 2HBZB 5HATA 5C5JA 2FY1A 3AQPA 4DPYA 4CTAA 1GX6A 1SB6A 1H2UX 1VBZA 4WTYA 2WRMA 4CZCA 3VV2B 4X66F 2FVRA 2F4VF 1LV5A 4LF4J 4BWMA 1ZAWA 1GXTA 5GADI 3OHAA 4RBTA 1T05A 2HLTA 1QAIA 2PMWA 3VQSA 3MAHA 4EYIB 3AH6A 2AV5A 3FRYA 3AD8C 3PKYA 3CXCR 4QWDA 3MXHP 2YKQA 3P4UB 4LF7F 3D54A 3IRXA 1JNRB 2DR9A 1BD6A 3HSJA 4KGKA 2GIQA 2V4QA 4QWCA 1VJQA 2XNRA 5C25A 4X4NA 2OI2A 3FMWA 2MEWA 3K7RA 5HSPA 1M5VC 5LXRA 3VTIA 4O4RA 2Z8QA 3BQ2A 1QD1A 2J6SA 2C3UA 3H20A 5LT5A 4RW7B 5IQ6A 3GZ7A 3T19A 3D7SB 3AQOA 3AD7C 4DUZF 1HNVA 2KDOA 2BX6A 4I2QA 1LW2A 4KH1B 1FKAF 1YJVA 9RUBA 4BCAA 4DR6F 2ZH2A 2IMOA 3IWXA 2RIJA 5L8RC 1D8ZA 3L7OA 4RBUA 4O3OA 2BQRA 5DJBA 3V6KA 3BGFA 1S10A 5IM0B 3DLEB 2VQEF 1RCXB 2ZITA 3KLHA 5D3GA 4JI0F 1SXLA 3C6TA 5IQQA 3AFGA 2DXDA 5KFQA 3BV8A 3CD7A 3IM9A 1S1VA 1ZETA 1HKAA 1LWCB 1NAQA 3MD1A 2J7KA 1U8SA 2OKQA 1YJ9S 3HVAA 1T8EA 1RKIA 2LDIA 2HZVA 2CFXA 4GKJJ 5HL7Q 3RBXA 3BJYA 3UCZP 4ECTA 1PJ7A 3AOBA 4LSNB 2ZVIA 1Q81T 4UOFA 2ZH8A 2A10A 1K1QA 1HQUB 3OXLA 1XBWA 3KMSA 3DGVA 2H5JB 3OD2A 1WOOA 3G82A 4ZP6A 1S0NA 1U2FA 1LQ9A 3R5GA 1RT2B 3BDPA 2DNPA 1RT1A 1CC7A 3FQKA 4TVAB 5DGAA 2RS2A 2C1EB 2BACA 2VJUA 3M8YA 2I1RA 1U02A 4X4VA 2ASJA 3GJTB 4LRFA 2BKNA 3TYTA 1CULB 3ILJA 4F0HA 3AAWB 1VQLS 4DXLA 2SXLA 5F0UA 2VONA 4LF8F 4ECYA 2AKWB 2YX7A 3VCDA 2MY8A 4QYRA 5ETLA 2ADBA 3K5OA 3G96A 4NCGA 1VQ8S 3MFIA 3HFVA 4OYBA 3IS9A 4DZ6A 5HVHA 3UE2A 2FVQA 1CG2A 3SMZA 4FF1A 5KG7A 3UFCX 2KT3A 1JQGA 1HBUB 1PCAA 2VQFJ 2Y1RI 4C0HA 1YI2S 2FJVA 1SCJB 3FBCA 4YP3A 4CO3A 3KUEA 2R7OA 3BN4A 1RABB 1U1QA 1VC5A 3BR9A 2B9EA 1EETA 4DV2J 3RB3A 4O23A 2NPFA 1VC0A 4FYXB 4CO2A 1U4BA 3TQEA 1UVIA 3Q2TC 2QLWA 3KOAA 5KT7A 1WG1A 4X64J 2N7YA 4PQUA 2MHNA 1RAFB 2A3JA 3WIVA 1RSCA 2VKZG 1SC4B 2DNKA 1XERA 1IM6A 3FVYA 4DL4A 2HQ3A 1RT4B 1EX8A 2P8IA 2Q79A 5M2PA 2GVDB 3PM9A 4E2FB 4OZNA 2XMUA 4ENOA 2J0WA 3VZHA 1VIXA 3O5TB 4I68A 2DXEA 1CJVB 3GR0A 5MLCV 3HZEA 2JX2A 2K8GA 2PDAA 2BA9A 4YHHJ 4LSLA 3EVOA 4DL7A 3CB4A 1UA1A 1P9QC 4USMA 1WOSA 1FFSB 1P8GA 2CQPA 2WHOA 2V2KA 1KRPA 4LSZB 1IR0A 2LYVA 3DYAA 4LBHA 4ELVA 1JLBB 2ILYA 3RRGA 5DQIA 2DNQA 1DY3A 1R8PA 2N7CA 2RDIA 5J1EB 2GW8A 1KLNA 3US5A 1HARA 4NZ7A 1NJXA 3SBMA 3UDEA 4JI3J 1OYDA 3DI6A 2CQ1A 5HANA 4DR2J 2LQJA 4RU2A 2VPXB 4LRCA 3FBFA 1NNDA 3POTA 1VQYA 3NWRA 4FYYB 1ZYQA 4MK8A 2UV8A 1EP4B 1R89A 2HQDA 2ZDOA 3J81U 3SQOP 1X4AA 2ZBQA 3HHDA 2GIFA 2DT9A 2H51B 2CA9A 3KMQA 3Q8UA 3GMGA 3HHLD 4MIWA 4DV1J 4DV0F 2VDHA 1HYSA 3Q8YA 4ECQA 4OJGA 4RL1A 3OVBA 2VV5A 5ETPA 5AXKA 3OTDA 1E6VA 5HLFA 1SC3B 4NA1A 4ILMA 2GJFA 2W4PA 4P71A 3DMJA 2YTCA 2LU2A 2HHVA 1UJ5A 3BGUA 2RQ4A 3MEDA 4YQWA 3WDOA 3TI0A 2X3GA 3PEJA 1LWFB 3VAKA 2YVSA 2BJ7A 3BDEA 4EBDA 4USHA 2OPQB 4F4XA 3M2VA 2XMTA 3IBFB 4EZ9A 3TA2A 2QEXS 2HQIA 3I5AA 4P75A 4CNZA 3QAUA 1UWBA 1REVA 5EX3A 5L9NA 2JHEA 3W62A 4AQYJ 1LFPA 4QR2A 2RQKA 1IBKF 1S9EB 4TY9A 2QSFA 4WFBQ 4QZVB 2AP6A 4OZLA 1YBTA 3W2VB 4PWUA 1WACA 4EEYA 1R0CB 2MZQA 1UJ4A 2CXEA 3WX4A 2RRAA 2EFNA 3GV8B 2NPIA 3THVA 2E7XA 2KO1A 4KH0B 1OO0B 3QYYA 4PUOA 4HHUA 2ZOGA 1M90T 2CQ4A 2XZDB 3CJKB 4O3QA 2MKKA 2PT0A 5KFDA 3CCZA 1N5TA 1FD8A 5L1LA 2MKSA 1I5OB 3CPWR 4ZCMA 3TA0A 2I8EA 4YOEA 4LQ3A 5EWEA 3DRRB 4BLGA 4QU7A 2R7TA 3J80U 4KKOB 4K8RA 4Q44A 1TQLA 3DOMB 3K89A 3ICLA 3M6UA 1N88A 5KFWA 2ZBIA 3FGVA 1V5VA 1N6QA 1NM2A 4YY3J 4LVNP 4YR0A 4I6YA 3UR0A 3V81B 2K3KA 2LQ8A 1MN7A 4H4OB 2Q6BA 2WW4A 1NZ8A 2YQ0A 3I82A 4F36A 2YX4A 4B3MJ 3P5BP 1YBAA 4F26A 4J9QA 4OYMA 2LQ5A 2JH3A 1L3VA 2G0CA 2I2YA 1XNRJ 4EGLA 3K5NA 1UVLA 3Q8RB 3UN3A 2HMIB 2BOAA 2BBEA 3MAAA 1ZZFA 1NBEB 5HROB 4USWA 3MF5A 1S6UA 3N0VA 2K1RA 3PR4A 3OJUA 1FX4A 2RSQA 2VG6A 4UW2A 3KHHA 1WG4A 4WP3A 2ASDA 2JFDA 5KG3A 5AJ3J 2VG5A 4CLZA 3I9V9 5A76A 1RT3B 3H25A 4OZ5A 4Y65A 1V6HA 2QL9B 4TU7A 3J7AN 1HFEL 3QJJA 2U1AA 2MSSA 2JEFA 1OYEA 2PGCA 4R5PA 1DTTA 3HXMA 4G1QB 1KBRA 3DU5A 2ZBCA 2OUGA 3CJ4A 1WSVA 3LH2S 5KFJA 2HNDB 1Q86T 2KTQA 3IR5B 3T6BA 1ELOA 3VHQA 1UFLA 3V4IA 3LW5C 1OSCA 2KFYA 1VRTA 3MR7A 2R7UA 2MJNA 3SDEB 2XLJA 4HI2A 5F8MA 1TKXB 5KG5A 4ZK7M 2CUYA 1TL1A 3NMRA 5J1NA 2WBMA 4JOUA 4LR9A 3VGTA 2H1YA 4YR3A 3M9OB 2AYMA 2G2YA 2ZE2A 4JYAF 5HMWA 3DN9A 2UVUA 5RUBA 4X66J 4HYKA 5SUHA 2F4VJ 2R2UA 5J2MB 3IRXB 2JL9A 2COLA 3GWCA 4NLWA 2ZH1A 4IYQA 4DG1A 2KZZA 3W65A 1VBXA 2DKOB 5C25B 3CD5A 2PE8A 5HQLA 1Y4ZB 2I0XA 1JKHA 5J2PA 3TUJC 1ZS6A 3OL8A 2W4CA 3ZXWA 4LF7J 2DEIA 4IO9Q 2HBYB 4Z2XA 4ZPCA 3LP0B 3W1YC 2EFGA 1KQFB 2C3MA 4FVMA 3DOKA 1JNZB 1AFJA 1XR5A 1F5CA 2KRBA 2MMYA 2C2RA 1KTVA 3H7HB 2DTJA 2E1CA 3N4WA 2WSFC 3C6TB 2D1CA 1Q8KA 4OI0A 4B9NA 2VDIA 1VOMA 3SQGA 4DR6J 3V6JA 2BANB 2CQBA 3DDKA 2AJ1A 4CM0A 4MIAA 3D6MB 1HD1A 1UW9A 3LO3A 1S4FA 1RJJA 2V0NA 4EO8A 2BMBA 1YIJS 4CM2A 1N5VA 2V69A 2BJ1A 3JSYA 2RAQA 1QE1B 2H4WB 3KFWX 3EUNA 5H9EJ 2J0QD 5M2UA 1TTHB 5C7PA 1DLOB 3MMAB 2L08A 3HJFA 2NYIA 3IBWA 2WAQD 3UR3C 4TNOA 4BWJA 2YNFB 3HVTA 5B08A 1W25A 2PI5A 4WP8A 2ABYA 3VAFA 1N5QA 3JQKA 5HQMA 4KPCA 3OTBA 5D6GA 4YFUA 2UXBF 3DXSX 3D0IE 4WK3A 3MPDA 4XDCA 1C1BA 5HVFA 2OFHX 1SUQA 3FZBA 3SSSA 2RKIB 4K5RA 3NP5A 3IS9B 4QOTA 1TL3A 2KXHA 4LF8J 1RZMA 3R7BB 3EXCX 4URGA 5L46A 4Q43A 3QRPA 1ZAXA 1PGZA 2HIQA 3QATA 4ZVOB 1MU2B 4MKAA 1FDDA 3EM1A 1SJRA 5HP1A 1XK8A 1WI6A 2DVIA 2BE2A 4X4RA 3MD3A 4D3HA 2VU5A 3L7UA 4DMZA 3ZNJ1 3VGUA 1S4EA 4DL3A 5L39A 3R1HA 2YNGB 1M1KT 1M1HA 4FDFA 1IBMJ 3DRPB 3KLGB 1DURA 2CQ3A 1AUSL 4IOBA 2B4OA 1SH0A 3C15A 1FERA 3PTWA 5DLFA 4EWTA 1TL4A 5LMNJ 1Z1ZA 3R2CJ 4FYVB 1YJTA 2NCKL 4K0KJ 4K2XA 1HNWF 2KM8C 4ZPAA 4LJMA 2GZOA 4NRTA 4F7VA 3AOAA 1HPZB 2PEHA 3CNQP 2OD4A 4UOCA 1BUXA 4IFYA 2HHUA 1UPPA 1FKOB 1TAQA 5D77A 3GYNA 2HKEA 3MUVP 3QGIA 2V6AA 4PEOA 2XCPA 3T41A 4OX6A 5B0EA 1FFGB 1LWEB 2IFXA 3W3SA 3IWNC 2MY7A 5CYMB 5LM7E 4UT4A 3DLBA 3JYTA 1VCTA 1X4GA 3TX0A 1M5KC 1S6QB 4M5LA 3I31A 4DZDA 3DGPB 3QMQA 1RAIB 2E5IA 1WDDA 3HF5A 4EMDA 3KLIA 5KTQA 1NXIA 3LWLA 2HFSA 3CSKA 3G6YA 4ZPBA 3TAMA 1T7PA 2HRYA 2J8SA 4TYAA 2FC8A 3QNWB 3D66A 3A12A 3QLHB 3PRDA 4ECVA 4ZVTB 4RNOA 3DI6B 3MCSA 1CQMA 2MKJA 1FA0A 1YJRA 4I2PB 3NG8A 4DU7A 2V5HG 1M5HA 4ZLLA 4G1PA 3D9BA 3PACA 3W2WB 2YX1A 4C9DA 3ZZ0A 4ED1A 2H9ZA 4DPWA 3LAMA 1RA7A 4EUVA 1RLDA 4WU2A 5G0RB 2DR7A 2JDJA 4KRWA 4ZKAA 1N34J 3EGNA 3UWTA 2ACMA 2XC9A 2R7VA 2WONB 2JC1A 4OHWA 1X0FA 1WHVA 2HGLA 1GXUA 1VHIA 3HKWA 3NRBA 3BS9A 1E6VB 1CS4A 4P2XA 4V19J 3VGVA 3DMJB 1T03A 4X65J 4DV0J 2YNIA 1ZPWX 1RQ0A 5KFVA 1Y5IB 2HYIB 2ZDPA 4A8KA 4O44A 4LMZA 3HHLB 3T1YF 3C16B 3CC7S 4Q8EA 3DRSA 3TNVA 4ZVUB 2RILA 4LIWA 1R8HA 5KG2A 5C42A 2W1BA 4CO5A 4JP8A 1HNZJ 5JMNA 2CPDA 1RT7B 2YWGA 4URSA 2IBKA 2GIRA 1RACB 1H38A 2MZJA 4JI2F 2OPRB 5K14A 4K4TA 1QY7A 4DSJA 3IG1A 3B54A 4CLTA 1JLGB 3KK2B 2DR5A 4CI0B 2IVYA 1GTEA 4BC9A 4L3NA 1NK0A 2E1AA 2J0XA 4X4OA 3HJVA 2JVOA 4UUXA 1FTCA 1KD1T 5U47A 1TK0A 1CJKA 4L3KA 3I4PA 2HGMA 4IDKA 1K8AT 3KUHA 1VGYA 4USVA 4C0OC 1FRJA 2NQPA 1T94A 2C2NA 2QLBB 2FUG9 2IMWP 1HQEB 2QA2A 1KSPA 3G6VA 4YS2A 4A8MP 2WVEA 4JI5F 3TUIC 1WC6A 3UDCA 3S6EA 2OIHA 1YITS 5DO2A 3UD4P 1VQOS 4U7CA 3ET6A 5B7WA 2HZCA 2E9TA 2GCFA 1VRUA 1YRXA 3W9HA 2L9WA 2V2VA 4ZN3A 3PX0A 4DV7F 3ADAC 1B0VA 2HBQB 3AD9C 2FZCB 4QWBA 1WKJA 3KJVB 1NUEA 2DGWA 4DCPB 3MR3A 1TR0A 1X4BA 4OX9J 6FDRA 5EHHA 1PSDA 4FYWB 4PWWA 2DR6A 5I3UA 2DHXA 1TL7B 1N52B 4X4SA 2CQHA 1T9WA 5K8OA 1I1GA 3RB6A 1Y9OA 3RBDA 1GTHA 4F4AA 1FFWB 3I9ZA 2QLJB 2HHHF 3MCNA 3G6XA 2PA8D 5HMZA 1SJFA 1PBUA 2KYXA 5F8NA 4RW4B 4PXBA 4QIGA 6FD1A 1SIZA 2ASLA 3J81Y 3KLVA 3WIUA 1HBMA 3E2EA 1FJCA 2RVJA 4QU6A 3R9LA 3MR2A 5AXLA 3DU6A 4PXEA 3UVJA 3KXDA 2ZEJA 4PXCA 3FEXB 3MMBB 1BWEA 1V3ZA 3FEZA 4ZPVR 1KHWA 3QRQA 1OS5A 2CQDA 2H48B 2XM3A 2QMUB 3EX7B 1P9YA 3FSXA 1D9DA 4CLYA 1UKUA 1BXNA 3NS5A 7FD1A 2YKNB 3ENVA 3AJDA 1FE0A 1GMWD 2Z2LA 2G2ZA 1EQMA 2CNNB 2FHMA 5B0AA 3BKFA 2AGPA 5J1PA 1FWLA 2AD9A 1RWKB 5KFLA 2F7VA 3PYDA 5KAKA 1U8WA 3GB0A 2RQCA 5CZVA 1VQMS 2CADA 2Y1LB 5GMKa 4DLEA 1VMBA 2CZ9A 1BY9A 1NEEA 5K5MA 1Z2ZA 4UF4A 2YKMB 2RRNA 2XBPA 3M30B 2QYCA 5DLGA 1U1LA 4ZJQA 2V9KA 2Y3YA 4ZIWA 2GVZB 1FHTA 1D0EA 3KNGA 2F9DA 2IHR1 1D09B 4AFFA 4ES1A 4LF9F 3R7NB 4F4WA 1F0XA 1Z2LA 3BSAA 1TUVA 2RDJA 4KHRA 4U9RA 2FTRA 4P73A 2AGQA 2DB1A 2CQGA 3BEGB 4Y2AA 4JI4F 3MTJA 1L3TA 2BRKA 2VFSA 2J6UA 4NWBA 4F0KA 1F5BA 2QN6B 2FJXA 2MKYA 4FKXA 2VA2A 5IWAF 1R8AA 5DG7A 2OTJS 5CCLA 2BQUA 4OHZA 2QTWA 2OPPA 4A8YA 4OV1A 5EUHA 1IKYB 1SKSA 3OHBA 4YDXA 3BSOA 3J80Y 2QGFB 1U2CA 1LKZA 3NY0A 4EI2A 3OR2B 4OLOA 1MWZA 3DOKB 4PWDA 4I64A 2XSJA 1KWMA 2AGOA 4GVBA 2DNMA 1FX2A 1NK7A 2J9EA 3RR7A 1Q78A 2DNZA 4ZOSA 3CJ3A 1Y5LB 2CJKA 4KJIA 4M5MA 1GQEA 1C2PA 4P7VA 3S7RA 4DPOA 2H4YB 4HDGA 3M9NB 3EJMA 2JEIA 2QG9B 3CCTA 4WYLA 1G1XA 4X62J 3C8YA 4B3TF 4U7UD 3H4BA 1F5AA 1X5PA 3T1AA 3UN2A 2CPXA 2VG7A 1Y0HA 4R8UB 3VAHA 1S1TA 4UOHA 3MUMP 2XMWA 4USUA 1R8CA 5A8WB 3TZXA 4AL6A 3M32B 1HL6A 2JSXA 3W5XA 2ALZA 3KG4A 5CYQA 1X0PA 5IFMA 4ID5A 4F3OA 5I42B 2HG4A 1GFWB 1KHVA 2CPHA 1RTDA 1NK5A 5KFGA 1UW4A 1L3SA 3DCAA 4DN0A 4ZHRB 3L3CA 1VYAA 1ZPVA 4DFKA 1VI7A 5LJ5Y 3CJSA 4Y0FA 4QR0A 3B4DA 3C6UA 4RW6B 1RT5A 1XMQF 2NXNA 3W5ZA 4C8OA 1S7IA 5ETMA 1O8BA 3KJNB 2KL8A 2CRLA 4PG7A 1JLQA 1SUQB 1FWPA 3DM2B 4NPOA 2IAJB 3R5DA 4JV0A 5HBMB 3OTCA 2DYAA 3MM6A 2VICA 3PYFA 2UXBJ 4CO0A 2Y0SD 1QTNB 3GLJA 3DKDA 4C0BA 2BJEA 4GVLA 4MK9A 2YPZA 3MEGA 3LP1A 2VPYB 2HVHA 2HGNA 4NLRA 3N6NA 1TMJA 4WE1B 1MROB 2EPIA 4FPRA 4LFAJ 4QW9A 1UZHA 3OSPA 3NAIA 3LTOA 3AY0A 4PZVA 2YH0A 3G9CA 4X4PA 1KR4A 3ISND 3J7ZT 3PO4A 2JNJA 1SKWA 2XG8A 4IRDA 4CH1A 1TV6A 1HNXJ 3PJ9A 3GSIA 3C15B 2UUAF 2YQ3A 1R0BG 1T9UA 4B9UA 2OEKA 1RA6A 2AQ4A 1QLNA 5KG1A 4IOAQ 1NMEB 2DCLA 1TL5A 3FSYA 5KT5A 1PBAA 2YKOA 3UW1A 4W4MA 5K20B 2LA6A 3G2XA 1R0AB 3H5UA 2MQMA 3KTQA 1YJ7A 4RW7A 2JEJA 1HNWJ 1M0SA 2RJZA 2FYXA 3NNCA 1F6TA 1N56A 2CJYB 4OJ1A 2CVEA 2XS7A 4FXDA 3TVYA 4GO7X 2FJAB 3W64A 1A7GE 4B3RF 5HVGA 2QZ8A 2M8HA 3DLEA 3H5YA 4ILLA 2V2ZA 1MG7A 1WUUA 4ZPTR 4KQZA 2EFVA 4Z7CA 2BV3A 1SH2A 1HHQA 2OMOA 5J2QA 4I67A 3FJ2A 2MXYA 3BO4A 2V63A 4OYZA 4TYBA 2HHPA 1J5EF 3H5XA 4C8ZA 2VFVA 2N4DA 4DSIA 2RHSB 5DDQC 4ILRA 1U48A 1H2TZ 1HQUA 1WKKA 2V4JA 4Q5VA 1SC1B 3OSNA 4MTPA 1RT2A 2N82B 2FZGB 3ZZYA 4P6QA 4ZVRB 1FVQA 2R2SA 4ZPDA 2MZ1A 2DGTA 4HEA9 1V3RA 4IG3A 2UU9J 4ZVPB 1HWLA 3RGIA 4RUHA 4TKTA 4NXNF 4I69A 3UPFA 2WCXA 1TKZB 3NBPB 4DLGA 1APSA 4XPEA 2QT7A 5KFAA 3B82A 2VASA 1S76D 3GTYX 2XS5A 1CULA 5ITHA 4MAKA 1RT6B 1DZ5A 2DPIA 4CCHA 3Q2SC 2UZAA 1TP7A 1XTZA 1RBAA 1N0UA 2YNIB 3QIPB 1RDRA 2OSQA 4C3MA 4DV5J 4KT0C 3ELHA 3P45B 1UVMA 3I6PA 3DRSB 3LALA 2LECA 4GC7A 2PC6A 1VLOA 3V2UC 2BM1A 3E01B 5CD4A 3AB4B 4ZIVA 3HD2A 3U1LA 4LFCJ 1HBUA 2B43A 2F1FA 1Q1KA 3CDBA 2RDDA 1MSWD 4N77A 4J9KA 1NCLA 3EYZA 1CEZA 1H74A 1NO8A 2AF6A 2W7OA 4PYDA 2HHSA 2ZBRA 1OPIA 4JI2J 1WI8A 3CMAS 1N32J 2ZZNA 3TRGA 2VHGA 4HTJA 2VA3A 1NH7A 1URRA 3TX8A 4P72A 5F8HA 2KHCA 4ZPWR 3QRRA 5CAAA 1LXNA 2HWHA 4TY8B 1RB0A 2F8HA 1HHSA 4NI2B 5AT1B 1VIOA 2M88A 1RT4A 4U95A 4OYOA 2V8VA 2J6TA 3PYGA 2ZWPA 3MM8B 4C7QA 5HAOA 4DV6F 5LXYA 2OMLA 3DHXA 2AZ1A 3W61A 5CCMA 3RUBL 1GMUA 3PYEA 2LEBA 1CJVA 1VRUB 3CDWA 4MMOA 3NOCA 4JI5J 4LF6F 2XY6A 1MMLA 4NRUA 4DR7F 1WF1A 3C3LA 1QSSA 4L72B 3F0NA 5ETQA 4CYUA 1IKVA 3SCKE 4IG0B 2CIMA 3SV3A 4OYWA 4M5DB 4Q2MA 4TU8A 5I3UB 2M0GB 2UVRA 1JLBA 2D9OA 1LFWA 4Q7AA 3A3PB 1PKUA 4EFAC 4IR9A 1TFWA 1YRUA 4OHXA 3VVTA 5J1EA 1KQSR 5JVHQ 3T1HJ 4CO4A 1NK4A 2IA6A 1Y00A 5E0OA 4R0JA 1KFSA 2C2DA 4ANCA 1VK8A 2MQOA 4RWWA 2O67A 3MZIA 3NNAA 2OD6A 1SH3A 3PW7A 4PRFA 1VS3A 2HHWA 2RHQB 4WCEQ 3EZOA 1JLCB 2RUSA 2DNNA 1EP4A 4DSLA 5KFYA 2RH3A 2IM0A 3A8JA 3RAMA 2V67A 1AZSA 4K50A 3D6FB 1U25A 1VLYA 4K59A 2AJQA 5CABA 4A8SA 4JI6J 2KT5A 4FBUA 1U24A 2Z30B 3GONA 4RW9B 4ELTA 3RB4A 3F41A 1DQAA 4ICLB 4B9TA 4LRBA 2YNHB 1CC8A 4WK1A 3GJSB 4B08A 1GK8A 2CG8A 2V4RA 1T95A 3VQTA 2OPQA 4CH7A 1OY6A 2YPYA 2HHTA 5F0WA 2ROEA 4CLFA 1KVKA 1XMOF 1VHFA 4W98A 2GAHC 2OPSB 2DNLA 2EC2A 1SV5B 4M95A 4YR2A 1BQNA 2QC3A 4F0MA 4I6AA 1S9EA 1VQ9S 1U1KA 1AB8A 3HD1A 3KKFA 1KVIA 2Y8YA 4OI4A 1FRHA 3DOLB 4DQQA 3JQMA 1F3FA 2UP1A 2B9XA 2K7JA 2WZ1A 1YX2A 1QM9A 1TK5A 1BHNA 3WX8A 4LVOP 3M1VB 4M5KA 4QPTA 2XO7A 3CJKA 4KFBB 2MQNA 2OPPB 1BQXA 3A8IA 1VBKA 5D4PA 3PX6A 3M8ZA 4JI4J 2AYEA 3TANA 3P3DA 2E5GA 1RAOA 4KGMA 3EVMA 1CQNA 1U45A 4LBIA 3DRRA 1TKDA 3CTRA 3CWJA 5IWAJ 3PW5A 3D28A 2VD3A 3OFFA 3HPOA 2EKYA 4HR2A 3ISZA 4FS2A 4KKOA 2E1RA 2P5VA 3D0GE 3BGLA 1RGVA 4DPTA 3IFEA 1JWWA 4DR1J 1HW8A 5IV4A 2VC1A 2FJEB 4NLPA 1U09A 3DOMA 2CPYA 3GJRB 4B3OB 5FDLB 2A2CA 1QAYA 3I87A 3NGTA 1NDLA 5C2CA 3QWUA 1FDNA 3UNYA 2FHOB 3V81A 2M52A 3I0RB 2FZKB 3DLHA 2CPJA 1S6PA 3K2YA 1Q0NA 5F9LA 2FJDB 2F63A 2EKNA 3MPYA 1MNEA 1NPKA 3Q8SB 3NOGA 4QW8A 3BGRB 1RYSA 4JV5J 1N8RT 2L9NA 2K06A 1HWJA 1DQ9A 1FJGF 3A3OB 2ZBPA 4PG4A 2B6AB 3ZTRA 2A2DA 1QTMA 4DQSA 3Q86A 2HMIA 2QA4G 2FQQB 2ASYA 4KY3A 2HS4A 2P9EA 1MWQA 1PILA 1FEHA 4Q0BB 2CZ4A 4O4GB 4J9SA 5HROA 3EMTA 2NZCA 3JSRA 1KQGB 1NDKA 3W5YA 1LOUA 1W2IA 2BZ2A 1ZM2A 4ZJOA 2FJBB 5KT2A 1UETA 4OZ1A 1RT3A 3BO2A 2DGXA 2XNQA 2ZH6A 3IXQA 5H1SV 4M63A 1K44A 4J9NA 1BQMB 3HKZD 4Q45A 2IYGA 4G1QA 4IQMA 3KJFB 1T11A 2PI4A 3SCLE 4ATNA 2CDQA 3MM6B 2R7WA 1NHKL 3H4DA 2HNDA 5CQGA 1RWWB 4FNIA 4NYOA 5BXIA 3Q0AA 4EBCA 5T7LB 2GAGC 4NLXA 3SI8A 2D9PA 3RYLA 1UPMB 3OJSA 2XMMA 2MZSA 4J9LA 1XWLA 4A4JA 1XIQA 3SDEA 4PR6A 4CIOA 1TKXA 2DH7A 1C1CB 4N7TA 1S79A 3CIZA 2HFZA 1H72C 3QFHA 1N48A 2MQPA 4RLEA 3TR5A 5B0CA 2HSEB 4DFPA 3D67A 1OY8A 2QIFA 1U1PA 4PG6A 1QAXA 4N47A 3NGRA 2E29A 1U26A 1LW0B 2UUTA 1TV6B 4GMKA 1R3NA 5HJYA 2DITA 3IR7B 1Q53A 1S1UB 3OL7A 1KNZA 1S12A 5J2MA 2N4CA 4Y2IA 3PW0A 1NU4A 3DHWC 4WPAA 3S1TA 5LMUJ 2GHVC 3BPDA 2PN6A 2NXJA 3G87A 2K7KA 4DR3F 2A1BA 1SKRA 5B0DA 2UUAJ 1WG5A 4F4KA 2M70A 2GGPB 3JS9A 2P2CB 3LP0A 1C0UA 3BSNA 4QCLA 4NXMJ 4I0WA 3KHLA 1RHUB 4QR1A 4CO1A 1VDHA 1C4AA 1HR0F 1V9OA 5JXSA 2EG2A 3QFWA 2ZUAA 3PIPQ 3WZ0A 2X51A 2GO9A 2I5JB 1NSKL 3HVWA 1XNQF 2XYPB 1JJCB 1XMBA 3CVKA 4FP9A 4CLWA 1O0PA 3KLFA 2D7SA 2BANA 3M6WA 5J2QB 2W2MP 3GU0A 5DDPC 3GIJA 1PIEA 1RAHB 4JV1A 4B3RJ 5KOXA 2LA4A 2BJ8A 1NHVA 3BQ0A 1M5OC 4A8WA 2HNZB 3EGVA 1U6BA 2MQLA 3K5LA 3IR6B 2V4JB 4NLQA 1B99A 1QE1A 4NOHA 2P6SA 1N36F 1NSPA 1P1TA 2OLWA 1J5EJ 2ZH5A 1O6XA 1DLOA 3MMAA 4X4UA 1J2VA 2J8AA 3UD5A 2XZTB 2YNFA 4ZVQB 4IG3B 2CDRB 4UTGA 3AA9A 3Q83A 2HFOA 2Q66A 3SXLA 4IOCQ 4ETXA 2NLWA 4JI8J 3AJ2A 2UXCF 2D3O1 3M6VA 3PJXA 2ADCA 4ZJLA 2CAJA 2CYYA 4HTIA 4JI1J 4DQRA 1RTHB 1FDAA 2RKIA 3OLAA 4LF4F 1MMNA 4LFBJ 5K8PA 4U6PA 2DGVA 1L3UA 4K4WA 3HI9A 4WWSA 3C19A 2G13A 3DFEA 2E5LF 4R0EA 5ETRA 1H0HB 3GYGA 1XEZA 2IVFB 1I51B 1XQIA 1Y7PA 2MZRA 2GS8A 3PEHA 3DLJA 1IKWB 1MU2A 2OHDA 3MMCB 4WIIA 1N5YA 1VBYA 4DF4A 5D4NA 4F02A 2YWKA 1LK5A 1C4CA 2YNGA 4DR4J 3G4SS 2IBOA 3FK4A 3MAQA 1WKLA 2B4UA 4E8UA 3DRPA 3KLGA 2B5JB 2CNKB 4HVZA 2K3IA 3QO9B 3CJTA 1IXKA 2IJNA 1GNKA 5KFSA 2CNOB 4RBVA 4OQJA 3KDOA 2CWXA 3CDUA 4ZS6A 1RTIB 5GAHU 3BH7B 1W7WA 2QJ3A 3T5KA 1JLFB 1FESA 1HPZA 3Q23A 3BBBA 3NGSA 1GEHA 3V6DB 5T14A 1FKOA 2MDAA 3T5LA 3QT5A 1EARA 2VBYA 3FQLA 1RWMB 1R31A 4HKQA 2RU3A 4DV3J 2XZWA 2XLIA 3H8YA 5L1KA 3W66A 4PABA 1LWEA 4GKJF 1KP6A 3ENAA 4G3IA 2NUHA 3DNCA 5CYMA 4OZ0A 4PXDA 4RU9A 1MWYA 1U1NA 4TLQA 4GKKJ 2FHJD 4F4ZA 4ZVEA 2YY3A 2GQQA 4CYUB 4DFJA 1IKVB 3TJ9A 3SCIE 3DDIA 1S6QA 4WZQA 3MTKA 4J9UE 1X9MA 3DGPA 1LXJA 5DRKA 2YWWA 3EZ5A 3DDNA 4Y2CA 3ZZZA 4DR7J 4OZ3A 2GNKA 2G9OA 3IGNA 4UY85 4RNFA 3QLHA 2EWHA 2HVEA 2I38A 2NXCA 2QX0A 4I2PA 3G8TA 2V8PA 1BE4A 3SSQA 5ETOA 3PKMA 2RD5C 3W2WA 4K5SA 3OVSA 3KK3A 1IJEB 5E3QA 3THPA 1JXLA 3KJQB 1ULRA 1CVJA 1X4DA 2GMHA 3OFEA 1AZSB 3M6XA 5G0RA 2MHEA 2B4PA 4U67Q 2VFTA 3S01A 1SBRA 4H4MB 2VBWA 4W90B 4IUFA 3K57A 1WC5A 2WONA 4FN5A 3G6ES 3GFYA 3CO0P 4ANDA 3NGUA 4YMEA 3SCJE 3X3UA 3P8BB 3HMJG 3GPAA 1CPZA 4I1TA 2VQFF 1FWKA 3HFKA 2F3JA 3VALA 2GQCA 1VFJA 2WB1D 3LOUA 3I96A 2X7IA 3WC0A 2VOPA 1M1GA 3HHLA 2FHKA 4ED0A 3C16A 3KNAA 3EWGA 2FDNA 2DXFA 1KKHA 1ICEB 3TZYA 7FDRA 2M5YA 4NLOA 1BMQB 2OEJA 4X64F 1RT7A 4EZ6A 1KONA 2AEJA 1BQNB 2HURA 4FF3A 1ACMB 2OPRA 2JFKA 1E6YB 4J9PA 4J9OA 1UVKA 1JLGA 3KK2A 2RQMA 3LQVA 3AODA 2DGOA 3BPSP 5F3ZA 4E0DA 3SYZA 4KSEB 1HI0P 4HH1A 1M5SA 3N01A 2XMJA 3MM7B 2ROGA 2PD1A 1QJHA 2DHGA 3W63A 3UDLA 2R7RA 3P96A 2BVZA 1HWKA 2KVQE 3HP6A 3TUZC 4F4YA 4ZVGA 4YHHF 1IBLJ 1C0TA 1RWNB 3QQCD 2MKIA 2HQFA 4ZVHA 1HWIA 4WBFA 3THTA 1GX5A 1DHMA 1HQEA 3R5JB 2PSZA 5B0GA 4RKUC 2CJBA 2XWXA 1VK3A 1REGX 4FPIA 3O1LA 1RXOB 2IA0A 2UVVA 5LJ3Y 4UZBA 4PAAA 4J91A 1WC1A 4V1Ak 2N3OA 3KWMA 1DBDA 5GAHI 2KZMA 3KJVA 2F9JA 2R7QA 2F65A 2HRUA 4AD6A 3C14B 1IQZA 3KK1B 3AHPA 2AX0A 2FGCA 2KJWA 4DR2F 3R1LA 2FJWA 4QYZK 4N76A 3ZTQA 1S6PB 3UNGC 4C11B 1ITPA 1TL7A 2EK6A 3H98A 4QIEA 2O01C 2R2RA 4ERDA 2KJVA 3G8QA 1EKRA 2MGZB 2MB0B 3NAHA 2DO4A 3FEYB 3ENWA 3O3LA 3TQ1A 4DCOB 4DV1F 5ETTA 2VKRA 4K4SA 5KFOA 4Y2KA 4LIRA 4OHVA 1RUSA 4RW4A 2GV1A 2C3PA 2CQIA 2ZM6F 2D3OR 3RTVA 2HNYB 3P49B 1NK8A 2M3DA 4LUBA 4IH5A 5KFMA 2ZJRQ 1X4FA 4O3PA 3ZTSA 3RB0A 3A8KA 1FJGJ 3S8SA 1NPRA 5A2QU 3MMBA 2W9CB 4HT7A 2DNHA 2VPWB 1BLUA 5E3CA 3HHNB 4WTOB 2DNRA 2KFNA 3IAM9 3EICA 3JXOA 3KHGA 1FVSA 2YKNA 1CJUB 1J5OB 2HZAA 4DX5A 3W8PA 3DLLQ 1WF2A 2F40A 2C3OA 3N79A 2XS2A 1RHJB 4KHPF 1K47A 4N41A 3JTPA 1PAUB 1PYTA 4YUDA 4AQYF 3GYXB 3D3BJ 3NLCA 3TO8A 3M8PB 3NNHA 2FD2A 1QSLA 1IUJA 3CULA 5IZHA 2XO6A 1AROP 4ZMMA 3RW6A 3RBEA 3JQJA 2BOPA 5I4MA 3Q89A 2YBVA 4WIQA 3NMAA 3L9ZA 2YKMA 3M30A 1ZH5A 1FTRA 1MN9A 1HI1A 1PC5A 2OP5A 2GVZA 3K0JA 4IRCA 3NGDA 4UQGA 1LNQA 4DV4F 3HHLC 3PDNA 3LWMA 4P52A 2ZOMA 4DJBA 1B7YB 2YH1A 2M2BA 4G65A 2MJUA 3N5FA 4U8YA 2XTJP 4XAKA 3C66A 1N33F 2IJRA 4DS4A 1UZDA 1SQFA 3JTOA 2VOOA 2E66A 4LRAA 1JLEB 3K59A 3QGGA 5K9FA 2QLFB 4DI6A 4C97A 1SL2A 4KYZA 2UUBF 1NJYA 1IKYA 2OFGX 4I7FB 2B9YA 4KBIA 2BJ3A 1F2HA 4G6VB 1YHQS 1HA1A 2RF2B 4EBEA 3TP2A 1C0UB 3MPUB 3MR5A 3OR2A 4H4KA 4A8XA 4DR3J 3RJMB 2HIYA 4C8NA 1PYOB 2M9KA 2ZWOA 1T9VA 1R43A 3L4BC 2KH9A 4DPXA 3MOJB 2J9DE 3CO9A 4LREA 3QGHA 4QJVA 2WOMB 2E9RX 1OQ3A 2NSBA 1JXEA 4DUZJ 1JJ4A 2EBEA 2ZKUA 1DAXA 2V8GA 2O3DA 3KLFB 1HR0J 3HK2A 1VQPS 2R4FA 3CJ5A 4CH0S 1PO6A 5KT6A 2H54B 3OFHA 3CCWA 2VQEJ 4N56A 4R8UA 4JI0J 1XNQJ 3RRKA 4TXSA 3BREA 5B0BA 1TAUA 2VH7A 1SIWB 5A8WA 1WELA 1D8YA 2HW3A 3M32A 1I6JA 3RAXA 2R8GA 1ZTWA 2DHAA 1RWVB 2ZH7A 4YEAA 3IBCB 3O6QA 5BR8F 1Q79A 4MYUA 5I42A 2OEMA 2DNGA 5CZXA 1JB0C 3QGPA 3U1NA 1IR2A 5HJXA 3NXZA 5BYQA 2JRSA 4ITSA 1WSRA 3IGVA 4W92B 1NDPA 4ZHRA 2BW7A 2JEGA 3K8WA 3D5MA 3ITHB 2BJ9A 1U2RA 2CZVC 5IC4B 2ZD1B 2EG1A 4RW6A 5D15A 3PHEA 1VQSA 3DM2A 1RHKB 2G2OA 3QZ7A 2IAJA 3GG1A 2Y1JA 5HBMA 1QSYA 4IO1A 2BDPA 3ZNUA 4Q8FA 4TQSA 3B8HA 5B09A 1HQ2A 1KQKA 3MHYA 5L9XA 1S1WB 2J9DA 4NA2A 4CT8A 2BM0A 4ZP9A 3ZTOA 3ILIA 3MUTP 2U2FA 3G86A 1SC6A 2R9LA 1EB0A 4WE1A 2QYGA 1N5YB 3H2VE 1MROA 2DJWA 2E5LJ 2F4FA 4XTTA 2HQGA 1EHWA 2Y1IA 5I3PA 2FLLA 2ZHAA 2ZC4A 3UCGA 1U6ZA 1BC6A 3DC2A 3CD6S 2B8QA 4C8KA 1MMDA 4RUBA 2KRRA 4OI1A 4JB8B 1WHWA 1U49A 1AW0A 2X1FA 3N5BA 4AXJA 4LRDA 5F41A 3VVUA 4I56A 3R5CA 2CQ0A 1IR1A 4F3MA 4OJ3A 3I32A 4L75A 2VJVA 3C46A 1S6OA 2H5EA 2C22A 4L6V3 5KFRA 3U7JA 3KDNA 1Y3KA 1HMVB 1NK6A 1R0AA 4ZN1A 1TKTB 3BKUA 4KO0B 3UQSA 3RRHA 3GJQB 1S9GB 4ANEA 2XMAA 2ZZMA 4IH7A 3OXFA 1I94F 2VL1A 4ED3A 3MPWA 1NZAA 2FLOA 2W4DA 1KLMB 2V9WA 2XI2A 5F9NA 2MYFA 2VC0A 4NLDA 3CF5Q 2DH8A 1FI4A 3O44A 2XGPA 2MLZA 4K7QA 1B64A 2DY9A 4M5JA 2GJIA 3RG6A 4WKRA 3HSDA 4DUTA 2ZC3A 4H4KC 2K2PA 1GT8A 2F8MA 2JWNA 4DL5A 2V8HA 2Y8WA 2BE9B 3VAJA 3ZC4A 4HH0A 1RLCL 4USJC 4OX8A 5IOLA 3OLBA 2AMCB 3HSZA 1P1LA 1OJ4A 2FLNA 1JLAB 4DCJB 4XO0A 2UUWA 3EDRB 3RR8A 1VQ4S 1KEKA 3KK3B 5ADZA 3MECA 4N8NA 3VAMA 1YJUA 1Y3JA 3FFIB 3EPIA 4B9MA 1SL0A 2DK2A 1HWUA 3U02A 4AL7A 1F2GA 4A47A 4DBQA 5THWA 3M8RA 1T0TV 5KG6A 1RHQB 2QFIA 1TKZA 3NBPA 1JMTA 2MQ8A 4NLGA 2GHWA 1LWXA 2KN4A 3PIOQ 4NZ6A 2DGQA 1RT6A 2HPUA 1D9FA 4AXIA 2IYIA 2WVFA 2ERRA 2C2ZB 2D3ZA 4XPCA 3HULA 1XN9A 1HLWA 2J76E 3QIPA 3KLEB 2LFVA 3UN5A 2XHWA 4YB7A 3D6TB 4DEZA 4PG5A 3E51A 2XSFA 3I4HX 1UFWA 4NL5A 1WF0A 2O5DA 2AYGA 1IBMF 2HS3A 2MTLA 4MJKA 4OV6A 3LPEA 3E01A 5BYSA 5H9FK 5E5NA 1V3SA 2XYHB 3I56S 1FCAA 2C2EA 2FVCA 3I0SB 5LMNF 1NJIT 4K0KF 4J5OA 5FLXU 1NRKA 3PW2A 4O3RA 2LXIA 2PFFB 3D1HA 4ZCKA 1FKPA 3A13A 3BO3A 3JSMB 1K1SA 2XQCA 2IIHA 1NJZA 5KOWA 3N6LA 1X31C 2JLEA 4U8VA 5ETKA 1IBKJ 3KHRA 3CJQA 3MFHA 3MCMA 3PR5B 1S59A 2Q3PA 4ZA1A 4DOZA 1C0TB 4C6AA 1CLFA 1HHTP 4TY8A 4HDHA 3BN7A 4WFAQ 3BF4A 3DXBA 1EJ7L 4NI2A 3RAQA 2R8HA 1RU2A 3VF0B 2LU1A 3BM7A 4IRKA 3MM8A 2NXUA 5MAOA 3Q8PB 2YWFA 4R25A 5A0YA 5K8NA 1YWXA 3HX9A 4H54A 5LOQA 2E1MC 4CNYA 3MM5B 5KG0A 5JJBA 2MLYA 2YWHA 1HBOB 3CC2S 2BABA 1HNIB 1H2VZ 3N28A 3J7A1 3GIKA 2NREA 3OBIA 5KFPA 3MDFA 3NCPA 1N4LA 4IG0A 3UI3A 3I55S 4M5DA 1RTJB 1GXLA 1NPPA 3TEHB 1A9NB 3R6LB 3NCRA 1T3NA 4NCAA 3M7VA 5AE1A 2OJ3A 2XYGB 5KFNA 1WEZA 1N34F 1YRTA 4M5NA 4PCQA 1F3VA 4DQPA 3R5BA 2VFRA 4F8RA 1M5PC 2RU9A 5BJRA 1TVRB 3MMJA 5KT3A 4I4BA 4X84A 1B4SA 1EAYC 2ATLA 1YSJA 2W9BB 4Y2MA 1OWXA 2QL5B 4X65F 1TELA 1F60B 2W9AA 1JLCA 2RRBA 2HVIA 4QPXA 3R97A 3T6JA 2ZM6J 1NHUA 1O5JA 1S57A 5DG8A 1K0VA 1Q8BA 3VAIA 2LMIA 4MFBA 4D3GA 1HNZF 3K5MA 3UD3P 1S7HA 4RW9A 3RZAA 4DF8A 4UUWA 2C42A 2B0GA 2RS8A 2DNOA 4ICLA 1XR7A 2F5GA 2IDLA 1RISA 4NEYA 2YNHA 2RUGA 1AXQA 5DDRC 4IQXA 4HACB 4KHPJ 4KAIA 5DETA 4MIBA 1OMSA 4O0NA 1U0HB 1T3OA 4OX7A 3H2UB 4JI7F 2AWZA 4WKYA 4B9SA 1YDLA 1GMWA 2EXUA 2DGSA 2OPSA 4ES2A 4DPUA 1SV5A 4P10A 1U0SA 1ZA1B 2W2QP 4K4VA 2YQ1A 2XMVA 3HLUA 3W9JA 3PZPA 2ZH9A 5IT0A 1F9EB 3F44A 3DOLA 2HAFA 1HD0A 2GJ2A 1UVNA 3A4TA 2JJ4D 3LP2A 3K17A 3LGMA 3QT8A 5GAEU 1WJ9A 3LANA 4C3LA 3AOCA 1B0TA 2A6MA 3T9ZA 4DV4J 2X3DA 1WORA 5L1IA 2NR0A 1RADB 2GX8A 1S49A 1ZA2B 4KE5A 2FLPA 3QT6A 4JYAJ 3M1VA 3IC1A 1IKXA 3SFUA 4NLYA 4KFBA 3QAEA 3Q24A 4WP9A 1Y10A 3B4MA 1N33J 2HFNA 3NWGA 3OR1B 1UJ6A 3T5JA 1RYRA 2XI3A 4OX9F 3GV5B 1T9TA 1X7VA 3U1MA 4L76A 4K4XA 5CA5A 2CQCA 2HAIA 2Z2ZA 3LUYA 1ZBTA 3QBCA 3R7SB 2UUBJ 2NSCA 2C3YA 1FK9B 2DPJA 3HT0A 3BSCA 2W8LA 3CCJS 3JSBA 4HT5A 3CCRS 3OVAA 3MR6A 4B3OA 5FDLA 5HK4A 1Q8IA 2C2OB 3FSIA 1KOOA 4MKYA 2KFZA 1NKBA 2H3EB 4NYZA 4A46A 4EU0A 3FKBA 3I0RA 2ZNYA 4PQAA 5A6PA 1VQ5S 3OTEA 2B7CB 2E5HA 4AE5A 4USKA 5L38A 2YKPA 3EGZA 3BGRA 3H42A 3W60A 3FCHA 4RJVA 4N5SA 2HFUA 2DHHA 2OGUA 1RHMB 1Q95G 4QIVA 4S0MA 3BZQA 2B6AA 2OELA 2V68A 5A2QY 1VQ7S 3MCOA 5C24B 1IQTA 1IWGA 1FNMA 1PG5B 3O8WA 3M9MB 4Q0BA 4O4GA 4WXWA 3OW2R 1K9MT 3M2RB 2XB2D 3OUYB 4ZLJA 3DRXA 2XWYA 1S0VA 3CDEA 3DLKB 2HLUA 1VQ6S 1TZ0A 5IT9U 3Q22A 1DTQB 4OI6A 1OQ6A 3PO5A 4P2FA 5BR8J 1NH8A 4DSFA 2W7PA 2WVBA 4ECRA 2ZJPQ 2FPHX 4NCBA 5EX0A 1HBNB 1X60A 4F3QA 4EK2A 2CJ9A 1BQMA 1UAWA 1FF2A 2Z2MA 4CLSA 2ZUGA 5B0FA 1U1MA 1RBLA 2IC3B 4OI3A 1WC4A 1XR6A 4HHJA 2V50A 5T7LA 3SEOA 4CTAB 4X4QA 2KHDA 2CG4A 3L95X 5KT4A 2QMWA 4NEZA 2L48A 1YGYA 3B78A 4J9VA 3DLGA 5C2GA 2B56A 1AUDA 3M05A 4ED8A 1D3WA 1U6FA 2LKZA 1T05B 3PFEA 1J27A 2VFUA 1C1CA 2RE1A 3QSYB 5KFXA 3LF0A 4NZ0A 4B9LA 4RW8A 1IM4A 3ULHA 3ZZTA 3OFGA 4KV8A 5HO4A 1LW0A 2HS0A 4BBYA 1UEKA 5L1JA 3AJ1A 1X5OA 5CHCB 1S1UA 2IM2A 4FKYA 2GMLA 4WYWA
chains in the Genus database with same CATH topology
1HQ2A 1RB0A 3HCXA 5ETSA 3MCOA 5ETMA 3UDEA 1CBKA 2F65A 3ILOA 4AD6A 4M5GA 1RTZA 5ETKA 4CRJA 3HSJA 4CWBA 3HD1A 5ETNA 1RAOA 3KUEA 1IM6A 3HT0A 5ETRA 1G4CA 2BMBA 1EQMA 3UD5A 3MCMA 2QX0A 3IP0A 3KUGA 5ETVA 2CG8A 3ILIA 4M5NA 5ETTA 5ETPA 1DY3A 3MCNA 4M5KA 3HSGA 1RU2A 1EX8A 1TMMA 3KUHA 4M5IA 4F7VA 1HKAA 3HD2A 5ETQA 1KBRA 4PZVA 3ILLA 4M5MA 1Q0NA 1RU1A 3UDVA 4CYUB 5ETOA 3ILJA 4M5HA 4M5JA 3QBCA 1TMJA 4M5LA 4CYUA 1EQ0A 2F63A 1F9HA 3HSZA 3HSDA 5ETLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ2 A;  1RB0 A;  3HCX A;  5ETS A;  3MCO A;  5ETM A;  3UDE A;  1CBK A;  2F65 A;  3ILO A;  4AD6 A;  4M5G A;  1RTZ A;  5ETK A;  4CRJ A;  3HSJ A;  4CWB A;  3HD1 A;  5ETN A;  1RAO A;  3KUE A;  1IM6 A;  3HT0 A;  5ETR A;  1G4C A;  2BMB A;  1EQM A;  3UD5 A;  3MCM A;  2QX0 A;  3IP0 A;  3KUG A;  5ETV A;  2CG8 A;  3ILI A;  4M5N A;  5ETT A;  5ETP A;  1DY3 A;  3MCN A;  4M5K A;  3HSG A;  1RU2 A;  1EX8 A;  1TMM A;  3KUH A;  4M5I A;  4F7V A;  1HKA A;  3HD2 A;  5ETQ A;  1KBR A;  4PZV A;  3ILL A;  4M5M A;  1Q0N A;  1RU1 A;  3UDV A;  4CYU B;  5ETO A;  3ILJ A;  4M5H A;  4M5J A;  3QBC A;  1TMJ A;  4M5L A;  4CYU A;  1EQ0 A;  2F63 A;  1F9H A;  3HSZ A;  3HSD A;  5ETL A; 
#chains in the Genus database with same CATH topology
 1VQN S;  2QE5 A;  3T5H A;  4DX6 A;  2N3L A;  5HMX A;  2ACY A;  4O0I A;  1GH8 A;  2BYC A;  2VPZ B;  1HNV B;  5KFT A;  5EWF A;  4I2Q B;  1B7F A;  1LW2 B;  4B9V A;  3R5A A;  4BC7 A;  4DUY F;  2GGP A;  3F56 A;  1N5S A;  2YKA A;  2V8D A;  1R27 B;  5FII A;  1AA1 B;  4X62 F;  2H65 B;  2CJX B;  5GAE I;  4K4Z A;  3TZW A;  1G7C B;  2BJD A;  2G4B A;  4RUC A;  1NKE A;  2DRD A;  2B7B B;  2CWK A;  3KLH B;  5D3G B;  4JV2 A;  1SPB P;  1SQE A;  4UST A;  4WXO A;  5KFC A;  3LAK A;  3GSD A;  3OQ2 A;  1H7W A;  1RK8 A;  3RBZ A;  3AT1 B;  3CGI A;  4DU8 A;  1S1V B;  2KG1 A;  2I5J A;  3QWP A;  3L7P A;  4FZV A;  4IH6 A;  1FXL A;  1I94 J;  5F8J A;  2BXJ A;  1RWU A;  2RML A;  3EE3 A;  4LF5 F;  5F3T A;  3HSG A;  2OTL S;  3G82 B;  3GIR A;  2M4M A;  4KHM A;  2UXD F;  1UEV A;  3WHI A;  3OV7 A;  3IMQ J;  4ZP7 A;  5DG9 A;  1Q5V A;  2HNZ A;  2XMK A;  3R6G B;  4LBP A;  5FD1 A;  1RT1 B;  4MH8 A;  3ILL A;  2AHO B;  3I5B A;  1EQ0 A;  3MEC B;  4RWX A;  4ELU A;  2A0F B;  1RAE B;  1B0P A;  4Z37 A;  2LQB A;  3IWL A;  4A48 A;  5KFZ A;  5D78 A;  3IO1 A;  2AJF E;  1FRL A;  2W2O P;  4K4U A;  1TU0 B;  1S1X A;  1CJT A;  3W7B A;  3M8Q A;  3M8S A;  1U47 A;  3BBF A;  3FUY A;  4FBT A;  5KG4 A;  2G0J A;  1S0O A;  4BDP A;  2VIH A;  3D1O A;  3CE8 A;  3ZZU A;  2E5J A;  4J9M A;  1Q16 B;  4NCG B;  4LFA F;  2HHX A;  3EVW A;  3UO0 A;  5ETN A;  2F8E X;  1RTH A;  3QJP A;  2IRX A;  3K58 A;  2BQ3 A;  2DO0 A;  1FRX A;  1P27 B;  9ATC B;  1H7X A;  3FBB A;  1UTA A;  3CIM A;  4CWB A;  3P6Y C;  1HNX F;  4QYZ J;  2ALY B;  3BGO P;  3TZZ A;  3AB2 B;  2X1A A;  4OFZ A;  1EET B;  3T1Y J;  1IKW A;  3MM9 A;  1L3K A;  3MMC A;  2WB4 A;  3M2U A;  3IM8 A;  4ZCL A;  4C48 A;  3MEE A;  1KDN A;  2QFJ A;  1L5U A;  5CXT A;  1FKP B;  1T9Y A;  3HVR A;  3Q8V A;  1S77 D;  5GVQ A;  2E7W A;  4Y28 C;  3BKT A;  3FCV A;  2P9G A;  4PQU B;  3PV8 A;  2ZNZ A;  2B51 A;  1UL3 A;  2B5J A;  2HWT A;  3QO9 A;  1YLX A;  2EC0 A;  1S99 A;  2E9Z A;  3EDQ B;  2BEF A;  3D2W A;  3M8W A;  5GME A;  4B3S F;  4LR7 A;  2WBR A;  5CYJ A;  1X4H A;  2BR0 A;  1RTI A;  4WJB A;  3ZZP A;  3LGH A;  3IA0 A;  1JLF A;  2ZHB A;  3PW4 A;  2FC9 A;  3WQP A;  1FO1 A;  3V6D A;  3GFX A;  4LSL B;  5D0R A;  3WC2 A;  4KGV B;  3E3X A;  5A0Y B;  4CRJ A;  2A6O A;  1MLA A;  2M8D B;  2AT1 B;  4I6W A;  1FXD A;  2ZH4 A;  2DY1 A;  2Z58 B;  4OLP A;  4URQ U;  1CSJ A;  3GQC A;  5JVG Q;  1IN0 A;  3DYA B;  1I3O B;  4A8O A;  1SKU B;  1OIA A;  2JC0 A;  3ISN C;  3FDS A;  2QMX A;  3CCQ S;  2JLG A;  3ZFV A;  2KYZ A;  1FE4 A;  2MZT A;  1WTF A;  3FBE A;  3KG1 A;  2JLF A;  4DV7 J;  5KFE A;  3H40 A;  4N8O A;  2NS1 B;  1Q4R A;  5CD4 H;  3QZ8 A;  3BBC A;  1KS2 A;  1GMV A;  2L41 A;  3MI7 X;  2IY5 B;  2UU9 F;  4CLP A;  3FRZ A;  3POT B;  1F9F A;  2V94 A;  1X5S A;  1NB7 A;  4TU9 A;  4FNH A;  2D74 B;  3F73 A;  4DX8 H;  3JB9 k;  3P5T L;  5E33 A;  2HHH J;  1WHX A;  5E7O B;  2C2K B;  3FCW A;  1IWA A;  2EW9 A;  1UCN A;  2G1H A;  3H90 A;  2GA7 A;  4UQT A;  1HYS B;  2DCU B;  4DV5 F;  4MT1 A;  1Q82 T;  5D4O A;  3OTO F;  2R42 A;  2B4V A;  4ED4 A;  3HM9 A;  2Q43 A;  4H4M A;  2ILZ A;  5HLF B;  4MFB B;  3UDV A;  2AJ0 A;  4YDD B;  4KPY A;  2GHP A;  4HHH A;  3MED B;  5G4D A;  1BGX T;  1Q5Y A;  4DSE A;  4KB7 A;  1URN A;  4LFC F;  5KFI A;  4ETZ A;  3MEK A;  4AUK A;  1TMM A;  3ETO A;  2OAU A;  3D0H E;  5EN1 A;  5GMD A;  4TLR A;  3M2V B;  3GII A;  2EFP A;  2BUN A;  3BYR A;  2OO4 A;  1UWB B;  1REV B;  5KFH A;  1JIH A;  1N32 F;  1DQ8 A;  5CH7 B;  5EWG A;  4QQB A;  2W24 A;  4UY8 T;  5FLX Y;  5DDO C;  1D1U A;  3L09 A;  3IAS 9;  4OZ2 A;  2I6W A;  4KC5 A;  8ATC B;  1E6Y A;  3DRY A;  2KI2 A;  1LEO A;  4U7U K;  3TWZ A;  1H6K X;  4JI7 J;  4DSK A;  1W2B R;  4YN3 B;  3BH6 B;  4PUO B;  2HWI A;  1RWP B;  3SFG A;  3LP2 B;  4Y3C A;  1OY9 A;  5IC6 B;  5IT4 A;  3MM7 A;  3GFH A;  4LF9 J;  3PRB A;  5KFK A;  2XY5 A;  1S48 A;  2IM3 A;  2Z0G A;  2NYH A;  4M94 A;  2KVI A;  6AT1 B;  4NMX A;  3HHE A;  4OI2 A;  3OL6 A;  1IKX B;  3IRW P;  4RPF A;  2KU7 A;  2GC8 A;  1W26 A;  2Z4P A;  1V5I B;  3D68 A;  3PG9 A;  3TUP A;  2HK3 A;  4OIX A;  4CLK A;  1RP5 A;  2L9D A;  2IM1 A;  3K5P A;  1PC4 A;  3JAM U;  1N6Q B;  4CT9 A;  4F2R A;  1R7I A;  3NGK A;  2J9C A;  2MPU A;  2XCA A;  3JTN A;  2DBB A;  1X4E A;  3CMQ A;  3T1H F;  3TJA A;  3GR1 A;  1KTQ A;  2CVI A;  1KVJ A;  4DQI A;  4C4W A;  3C14 A;  4FF2 A;  3KK1 A;  2WVC A;  4C3K A;  4F25 A;  2AJ2 A;  4IR1 A;  4C11 A;  5I3Q A;  1ZM4 A;  3PFO A;  4NX9 A;  3V6H A;  2MGZ A;  2JVR A;  5HQ8 A;  1YQH A;  5E3P A;  1ZOT A;  4PYA A;  1MW7 A;  1YK9 A;  1VR6 A;  4L73 A;  1ZAV A;  4RO0 A;  1WC3 A;  5SZT A;  8AT1 B;  1VQK S;  1G6B A;  3MAA B;  2VOD A;  2VZ9 A;  3X1L B;  4B3T J;  4DS5 A;  4JI6 F;  2ZVS A;  2XHC A;  4YB1 P;  4KTQ A;  2K1R B;  4A8F A;  4ER8 A;  2HNY A;  2VG6 B;  3CCS S;  2X1G A;  1WHY A;  5DQG A;  4AL5 A;  4ED5 A;  3ETM A;  1UWA A;  1SJ3 P;  1HW9 A;  1X5T A;  2VG5 B;  2W9C A;  4AYB D;  4ES3 A;  2O66 A;  3RU0 A;  1U1O A;  4CLL A;  1Y11 A;  4IFV A;  1TK8 A;  4R5P B;  1DTT B;  1CJU A;  1J5O A;  1BWV A;  3EPG A;  1NK9 A;  4J7C A;  1WTB A;  3SZ2 A;  4XIU A;  3QJL A;  2E44 A;  1QUV A;  5LL6 d;  2XEX A;  2V34 A;  1DFD A;  1K73 T;  4USI A;  2BKP A;  3V4I B;  2MKH A;  4DDF A;  5E2Q A;  3M8P A;  4RX6 A;  1VRT B;  3BB5 A;  2AEF A;  1S9F A;  1XMQ J;  4RNM A;  1SJ4 P;  4ALZ A;  2ZH3 A;  3VWS A;  2D3U A;  4P2M A;  3D6H B;  1TL1 B;  4FVC A;  3DLG B;  1PYS B;  2E1P A;  2WW8 A;  2KM8 B;  2AEM A;  2EFO A;  1FDB A;  3FMB A;  5F8L A;  1KOH A;  2IRU A;  3EXY A;  4K2J A;  2ZE2 B;  1AYE A;  3N6M A;  2ZZT A;  3GCW P;  3GG0 A;  4DR5 F;  1AFI A;  2IJF A;  3G71 S;  1DRZ A;  4RW8 B;  1IJF B;  2G1D A;  1H3D A;  4KV8 B;  4GC6 A;  4DG1 B;  1XC9 A;  2DEJ A;  1EKS A;  2PA3 A;  5A8R A;  1JKH B;  4LF1 A;  5LSR A;  5J2P B;  4FYD A;  2KXN B;  1Z4U A;  3VGS A;  4DR1 F;  3OPK A;  1JLE A;  2KB2 A;  2WTF A;  1VIS A;  2EK1 A;  3CC4 S;  2DIU A;  3J81 j;  3A8E A;  5KFF A;  5FJ4 A;  4L74 A;  1FJ7 A;  4I7F A;  2LLZ A;  4FS1 A;  2Z2Y B;  3HCX A;  5LSO A;  5D4L A;  1A6L A;  1FT8 A;  4G1I A;  2RF2 A;  1RAG B;  3EZU A;  5KFU A;  2APO A;  1JXV A;  4NLS A;  2CPE A;  2DNY A;  3HDS A;  4EYH B;  4P74 A;  3SQG B;  4DUY J;  4JV5 F;  2RB7 A;  4B02 A;  2HVZ A;  2WOM A;  3B6B A;  3KYL A;  3N9U C;  2A18 A;  5DQH A;  3CME S;  1FXR A;  2Z56 B;  5D0H A;  5H9F J;  5AE3 A;  5D0E A;  3AXM A;  3OXG A;  3H5S A;  4M1K A;  3V4M A;  1EIY B;  1G2E A;  5D8H B;  3WBZ A;  4MKB A;  4PPZ A;  4F67 A;  4CLU A;  2POK A;  1F1B B;  5E41 A;  2UUC F;  1TFY A;  4LF5 J;  1WNE A;  3T9N A;  3HZG A;  2Z57 B;  3HVT B;  2JZ5 A;  4LQ9 A;  5HI7 A;  1UMJ A;  1WDT A;  3TOQ A;  5M2R A;  3TAQ A;  3LPY A;  2UXD J;  5IT9 Y;  1D9A A;  4UZC A;  4Y34 A;  5EDW A;  3ZO7 A;  3TVZ A;  3PRV A;  2W2N P;  3ZZO A;  1S1X B;  1CJT B;  3H59 A;  2QV6 A;  3M8Q B;  1C1B B;  4NLV A;  4DX7 A;  3ITH A;  1H73 A;  3HFZ B;  2GMJ A;  3CCL S;  2GQ2 A;  5KFB A;  5J2N A;  2ZD1 A;  1JK9 B;  2C28 A;  4RNN A;  2JOQ A;  1KFD A;  4PG8 A;  3OL9 A;  3M4X A;  4Y6I A;  4OYX A;  1PAE X;  4P7T A;  1YG0 A;  4NXN J;  1TL3 B;  2FGO A;  2CJA A;  4OL8 A;  5A8K A;  3CJR A;  3G8S A;  4QWA A;  4ZVS B;  4C98 A;  2EI5 A;  5AXN A;  1QVG R;  4BHQ A;  2WSE C;  1IVZ A;  2HVD A;  4HLB A;  1S1W A;  5HP1 B;  1TUG B;  2BE2 B;  1KN6 A;  2DRB A;  4OZJ A;  4DWI A;  3FC9 A;  3PJW A;  5F8I A;  3MM9 B;  2R8I A;  2LEA A;  5LMU F;  1S72 S;  3M2U B;  4QIW D;  2AJ4 A;  2MQQ A;  2DIS A;  1Q7Y T;  3MEE B;  1ZM3 A;  1H98 A;  3BQ1 A;  1ZM9 A;  2YXL A;  4JBC A;  2XGQ A;  5AE2 A;  1WWH A;  1DJ0 A;  3PX4 A;  1Y5N B;  2WK4 A;  2LCW A;  1ROF A;  5DGB A;  2XUL A;  3CDA A;  2AIR B;  4NXM F;  2MLX A;  2BE7 D;  3CJ8 A;  4WZM A;  3TW0 A;  4ECZ A;  1T02 A;  1SL1 A;  3PY8 A;  5E3R A;  4IFY B;  3NEK A;  4O3S A;  3PXG a;  1N0V C;  3QSI A;  1YJW S;  1G4C A;  1U7L A;  4LF2 A;  2ZHO A;  4F04 B;  2P9C A;  2V2Q A;  4ZIT A;  4OMF G;  2AW0 A;  4ID8 A;  3TAR A;  5JUM A;  1HMV A;  1YTY A;  3GIL A;  1TKT A;  2KG0 A;  2PEB A;  4KO0 A;  4B3S J;  3TA1 A;  1ZTT A;  1WD6 A;  2NXE A;  1S9G A;  3IP0 A;  3JYT B;  3GV7 B;  3MUR P;  1WOP A;  3C2P A;  1X4C A;  2WVD A;  5IM0 A;  1QUP A;  4OYA A;  1KLM A;  3RW7 A;  4J90 A;  4LT6 A;  2Y0B B;  2EFQ A;  4DV6 J;  3CCV S;  1S97 A;  4YB6 A;  2L3M A;  4KR0 B;  3T3F A;  1NDC A;  3KLI B;  2BKO A;  1K0T A;  2PFD A;  1R6Y A;  1LWC A;  3TAM B;  3MWB A;  4RNH A;  4CDI A;  3ZZR A;  4LSN A;  4LF6 J;  3NS7 B;  2OSR A;  4V19 X;  2VF3 A;  4NLT A;  1NB2 A;  1X8D A;  1UA0 A;  2HQC A;  4X2B A;  1FRM A;  2X1B A;  2O1P A;  1QAJ A;  2J7U A;  1RKJ A;  2ROP A;  2FHJ A;  4RUA A;  4MKV A;  3QID A;  2FIU A;  3AA8 A;  4ED6 A;  2XLK A;  4JI8 F;  4PPD A;  1JLA A;  2CPI A;  4HL9 A;  4NYP A;  1FNO A;  1NKC A;  3SIP B;  4OHY A;  1RI7 A;  4EO6 A;  4JI1 F;  8RUC A;  3R2D J;  3FFI A;  5GAG U;  4WF9 Q;  2QLX A;  2ZJQ Q;  2FVP A;  3VAG A;  2DIV A;  1QVF R;  4DN9 A;  3TVK A;  4LFB F;  4ZP8 A;  4Z7Y A;  3D4J A;  2IVM A;  3NKY A;  1SI9 A;  4NLU A;  1CS4 B;  2IRY A;  4GRS A;  2FVS A;  5DM6 Q;  1T9X A;  1T03 B;  4OYP A;  1Q7L B;  4FXV A;  2J5A A;  1YZ7 A;  4O44 B;  3OTO J;  3MGJ A;  4ZCI A;  5BYR A;  2R8J A;  3A3N B;  1YJN S;  2R8K A;  1YZ6 A;  3ILO A;  3KLE A;  5C42 B;  3VZI A;  1FD2 A;  1RAJ A;  4J37 A;  1Q8L A;  2CPF A;  4J9R A;  4DR4 F;  4DV2 F;  4TQR A;  2UVW A;  3AXK A;  5F8G A;  1JJH A;  1SVD A;  4E98 A;  5ETS A;  5K14 B;  1N54 B;  3IG1 B;  4LR8 A;  4ZLP A;  1GAO A;  3CT9 A;  4XK8 C;  4KGZ B;  2J7W A;  1NSA A;  5DZ6 A;  3IN5 A;  1FJE B;  2YWE A;  5T41 A;  3HT3 A;  3I0S A;  1NSQ A;  4ECS A;  1A0O B;  1CJK B;  1R6V A;  2H5I B;  3UCU P;  4IKA A;  1XMO J;  5H9E K;  4IDK B;  2I9S A;  3KUG A;  3JSM A;  3HHK A;  2VB6 A;  2CKW A;  3NL0 A;  4NE9 C;  2AU0 A;  2R2T A;  3Q8Q B;  4QIF A;  5DM7 Q;  3GIM A;  4DV3 F;  1WC0 A;  4P9S A;  4ZLN A;  1O51 A;  2E7V A;  3CCU S;  2GVD A;  4TN2 A;  2GO8 A;  4DL2 A;  2WSC C;  2QA4 S;  1S0M A;  4GKK F;  2MKC A;  3ET6 B;  1RAA B;  4Q2L A;  1WEY A;  2GFF A;  1S5Z A;  3CW2 C;  2R7S A;  1VJW A;  2DGU A;  5HMY A;  4KIA A;  5D0G A;  2HFV A;  4Y00 A;  2IPO B;  1VC6 A;  3K8V A;  3TJ8 A;  1X9S A;  2W2P P;  4JUZ A;  3MM5 A;  3QT7 A;  3ENQ A;  2Q6C A;  3H2L A;  3R8Y A;  1KC8 T;  4FF4 A;  1FNX H;  1HBO A;  1B3T A;  2BW2 A;  4JI3 F;  1HNI A;  1RE1 B;  2EVZ A;  5E3A A;  2CJQ A;  1YKW A;  3U27 A;  2OH2 A;  1RTJ A;  4BS2 A;  1RWO B;  3J7Y U;  2DRA A;  3PCO B;  2CNL B;  1IBC B;  3MOZ A;  1HBM B;  1YVF A;  2MST A;  4F2S A;  2HK2 A;  2EEY A;  2LDY A;  3FZ2 A;  4ZDN A;  1HI8 A;  3UVJ B;  3GFZ A;  4ECW A;  2PII A;  1TVR A;  2LQ9 A;  4QWE A;  2W01 A;  3CD0 A;  4AT1 B;  2DR8 A;  3GCX P;  4U96 A;  2W9B A;  4DL6 A;  4ED7 A;  2PO4 A;  2QSW A;  4RR5 A;  4O3N A;  2PMH A;  3EGW B;  1PJ6 A;  1R8B A;  2VUG A;  4XDD A;  1TUW A;  4CP5 A;  4IFV B;  2Q1L A;  3PHT A;  1QDU B;  3R3T A;  2ATC B;  3D1Q A;  2UV8 G;  1X9W A;  4C8Y A;  2DH9 A;  4DHV A;  4KGX B;  2NUU G;  4C2M A;  5A6W A;  4WU3 A;  2KKH A;  5GAD U;  5DZ7 A;  3LA0 A;  1UP1 A;  4DL0 C;  1LK7 A;  1LWF A;  3NCQ A;  5GAG I;  3MPV A;  4DFM A;  3ONQ A;  2HBR B;  2QL7 B;  4P2S A;  3A1Y G;  3R27 A;  2LEP A;  1AT1 B;  4X4T A;  1RTZ A;  5IXU A;  2BRL A;  1RCO B;  1SQG A;  3I5C A;  2M7S A;  2B9W A;  4HAC A;  3CCE S;  4UOG A;  4M5I A;  2R7X A;  3W8G A;  1U0H A;  2FB0 A;  1UVJ A;  1WEX A;  3VR1 A;  2G0I A;  1FRK A;  5DS7 A;  3KG0 A;  2J0S D;  3W2V A;  4B17 A;  3GP9 A;  2C2M B;  4M8L A;  1IBL F;  4MYT A;  3OT9 A;  1RU1 A;  4WFY A;  2AZ3 A;  3FNN A;  1CBK A;  2D69 A;  4C8M A;  5IV3 A;  2LP4 A;  3CJ0 A;  2RT3 A;  1FRI A;  2LXU A;  3ZTP A;  5A8R B;  4PKD B;  2LXF A;  3V5R A;  4WFN Q;  4DR5 J;  1UEU A;  2W7A A;  1EZZ B;  5HN0 A;  5K8M A;  3LGN A;  1RBO B;  1U1R A;  2NZ4 A;  4GO5 X;  3H0P A;  2RNE A;  4A8Q A;  4ED2 A;  4C8L A;  3OR1 A;  1YBU A;  4NML A;  4YY3 F;  4PWD B;  2XSJ B;  2CQ2 A;  3JAM Y;  4GVB B;  2QA1 A;  4MK7 A;  4ZVF A;  4FXW A;  2R3V A;  2QRR A;  4K4Y A;  1OPZ A;  3HO1 A;  2ZOF A;  4B3M F;  1XJW B;  1G3O A;  5AXM A;  1HIY A;  1DAR A;  1P6T A;  1B70 B;  1FK9 A;  4RZR A;  4ECX A;  4OYI A;  2ZFH A;  3BYP A;  4H4O A;  3E8O A;  4WFZ A;  4WFX A;  2Y9H A;  2QO3 A;  3GE9 A;  3NS6 A;  1XNR F;  1PJ5 A;  3BR8 A;  4M5H A;  5LSL A;  2VG7 B;  1S1T B;  2KXF A;  2AYB A;  1RWX B;  4ECU A;  2KT2 A;  1SJQ A;  2W8K A;  4OJH A;  3D3C J;  2VBX A;  1NJW A;  5CYQ B;  1VRQ C;  5AJ3 F;  2DHS A;  2XY7 A;  1UFK A;  1RHR B;  3CUN A;  2PMZ D;  3CJ2 A;  4ID5 B;  4HI1 A;  2DD8 S;  3J7Z 5;  1RTD B;  2CPZ A;  2LVW A;  2HEK A;  2B3T B;  4CQ1 A;  5C24 A;  1ZZN A;  3SSR A;  1NLK L;  2VBZ A;  1JJ2 R;  5EGY A;  1JX4 A;  4F50 A;  3J7Y I;  3C6U B;  3M2R A;  2UUC J;  3PVX A;  1RT5 B;  3OUY A;  2HRT A;  4QBU A;  1F9H A;  3DLK A;  2P6T A;  4NA3 A;  1N36 J;  2D41 A;  3PNI A;  2ZKT A;  5IS2 A;  5J2N B;  1JLQ B;  1DTQ A;  1OSD A;  3TAP A;  3CCM S;  2IDE A;  4YB5 A;  3QPI A;  2B8P A;  7AT1 B;  3CED A;  1FEE A;  2HHQ A;  1HBN A;  2W25 A;  1SJ1 A;  3W9I A;  4M5G A;  3O2I A;  2EBG A;  5ETV A;  3MEG B;  2FY8 A;  3LP1 B;  2AX1 A;  5A8K B;  3TEG A;  2IC3 A;  3SV4 A;  2UXC J;  4NAS A;  2HBZ B;  5HAT A;  5C5J A;  2FY1 A;  3AQP A;  4DPY A;  4CTA A;  1GX6 A;  1SB6 A;  1H2U X;  1VBZ A;  4WTY A;  2WRM A;  4CZC A;  3VV2 B;  4X66 F;  2FVR A;  2F4V F;  1LV5 A;  4LF4 J;  4BWM A;  1ZAW A;  1GXT A;  5GAD I;  3OHA A;  4RBT A;  1T05 A;  2HLT A;  1QAI A;  2PMW A;  3VQS A;  3MAH A;  4EYI B;  3AH6 A;  2AV5 A;  3FRY A;  3AD8 C;  3PKY A;  3CXC R;  4QWD A;  3MXH P;  2YKQ A;  3P4U B;  4LF7 F;  3D54 A;  3IRX A;  1JNR B;  2DR9 A;  1BD6 A;  3HSJ A;  4KGK A;  2GIQ A;  2V4Q A;  4QWC A;  1VJQ A;  2XNR A;  5C25 A;  4X4N A;  2OI2 A;  3FMW A;  2MEW A;  3K7R A;  5HSP A;  1M5V C;  5LXR A;  3VTI A;  4O4R A;  2Z8Q A;  3BQ2 A;  1QD1 A;  2J6S A;  2C3U A;  3H20 A;  5LT5 A;  4RW7 B;  5IQ6 A;  3GZ7 A;  3T19 A;  3D7S B;  3AQO A;  3AD7 C;  4DUZ F;  1HNV A;  2KDO A;  2BX6 A;  4I2Q A;  1LW2 A;  4KH1 B;  1FKA F;  1YJV A;  9RUB A;  4BCA A;  4DR6 F;  2ZH2 A;  2IMO A;  3IWX A;  2RIJ A;  5L8R C;  1D8Z A;  3L7O A;  4RBU A;  4O3O A;  2BQR A;  5DJB A;  3V6K A;  3BGF A;  1S10 A;  5IM0 B;  3DLE B;  2VQE F;  1RCX B;  2ZIT A;  3KLH A;  5D3G A;  4JI0 F;  1SXL A;  3C6T A;  5IQQ A;  3AFG A;  2DXD A;  5KFQ A;  3BV8 A;  3CD7 A;  3IM9 A;  1S1V A;  1ZET A;  1HKA A;  1LWC B;  1NAQ A;  3MD1 A;  2J7K A;  1U8S A;  2OKQ A;  1YJ9 S;  3HVA A;  1T8E A;  1RKI A;  2LDI A;  2HZV A;  2CFX A;  4GKJ J;  5HL7 Q;  3RBX A;  3BJY A;  3UCZ P;  4ECT A;  1PJ7 A;  3AOB A;  4LSN B;  2ZVI A;  1Q81 T;  4UOF A;  2ZH8 A;  2A10 A;  1K1Q A;  1HQU B;  3OXL A;  1XBW A;  3KMS A;  3DGV A;  2H5J B;  3OD2 A;  1WOO A;  3G82 A;  4ZP6 A;  1S0N A;  1U2F A;  1LQ9 A;  3R5G A;  1RT2 B;  3BDP A;  2DNP A;  1RT1 A;  1CC7 A;  3FQK A;  4TVA B;  5DGA A;  2RS2 A;  2C1E B;  2BAC A;  2VJU A;  3M8Y A;  2I1R A;  1U02 A;  4X4V A;  2ASJ A;  3GJT B;  4LRF A;  2BKN A;  3TYT A;  1CUL B;  3ILJ A;  4F0H A;  3AAW B;  1VQL S;  4DXL A;  2SXL A;  5F0U A;  2VON A;  4LF8 F;  4ECY A;  2AKW B;  2YX7 A;  3VCD A;  2MY8 A;  4QYR A;  5ETL A;  2ADB A;  3K5O A;  3G96 A;  4NCG A;  1VQ8 S;  3MFI A;  3HFV A;  4OYB A;  3IS9 A;  4DZ6 A;  5HVH A;  3UE2 A;  2FVQ A;  1CG2 A;  3SMZ A;  4FF1 A;  5KG7 A;  3UFC X;  2KT3 A;  1JQG A;  1HBU B;  1PCA A;  2VQF J;  2Y1R I;  4C0H A;  1YI2 S;  2FJV A;  1SCJ B;  3FBC A;  4YP3 A;  4CO3 A;  3KUE A;  2R7O A;  3BN4 A;  1RAB B;  1U1Q A;  1VC5 A;  3BR9 A;  2B9E A;  1EET A;  4DV2 J;  3RB3 A;  4O23 A;  2NPF A;  1VC0 A;  4FYX B;  4CO2 A;  1U4B A;  3TQE A;  1UVI A;  3Q2T C;  2QLW A;  3KOA A;  5KT7 A;  1WG1 A;  4X64 J;  2N7Y A;  4PQU A;  2MHN A;  1RAF B;  2A3J A;  3WIV A;  1RSC A;  2VKZ G;  1SC4 B;  2DNK A;  1XER A;  1IM6 A;  3FVY A;  4DL4 A;  2HQ3 A;  1RT4 B;  1EX8 A;  2P8I A;  2Q79 A;  5M2P A;  2GVD B;  3PM9 A;  4E2F B;  4OZN A;  2XMU A;  4ENO A;  2J0W A;  3VZH A;  1VIX A;  3O5T B;  4I68 A;  2DXE A;  1CJV B;  3GR0 A;  5MLC V;  3HZE A;  2JX2 A;  2K8G A;  2PDA A;  2BA9 A;  4YHH J;  4LSL A;  3EVO A;  4DL7 A;  3CB4 A;  1UA1 A;  1P9Q C;  4USM A;  1WOS A;  1FFS B;  1P8G A;  2CQP A;  2WHO A;  2V2K A;  1KRP A;  4LSZ B;  1IR0 A;  2LYV A;  3DYA A;  4LBH A;  4ELV A;  1JLB B;  2ILY A;  3RRG A;  5DQI A;  2DNQ A;  1DY3 A;  1R8P A;  2N7C A;  2RDI A;  5J1E B;  2GW8 A;  1KLN A;  3US5 A;  1HAR A;  4NZ7 A;  1NJX A;  3SBM A;  3UDE A;  4JI3 J;  1OYD A;  3DI6 A;  2CQ1 A;  5HAN A;  4DR2 J;  2LQJ A;  4RU2 A;  2VPX B;  4LRC A;  3FBF A;  1NND A;  3POT A;  1VQY A;  3NWR A;  4FYY B;  1ZYQ A;  4MK8 A;  2UV8 A;  1EP4 B;  1R89 A;  2HQD A;  2ZDO A;  3J81 U;  3SQO P;  1X4A A;  2ZBQ A;  3HHD A;  2GIF A;  2DT9 A;  2H51 B;  2CA9 A;  3KMQ A;  3Q8U A;  3GMG A;  3HHL D;  4MIW A;  4DV1 J;  4DV0 F;  2VDH A;  1HYS A;  3Q8Y A;  4ECQ A;  4OJG A;  4RL1 A;  3OVB A;  2VV5 A;  5ETP A;  5AXK A;  3OTD A;  1E6V A;  5HLF A;  1SC3 B;  4NA1 A;  4ILM A;  2GJF A;  2W4P A;  4P71 A;  3DMJ A;  2YTC A;  2LU2 A;  2HHV A;  1UJ5 A;  3BGU A;  2RQ4 A;  3MED A;  4YQW A;  3WDO A;  3TI0 A;  2X3G A;  3PEJ A;  1LWF B;  3VAK A;  2YVS A;  2BJ7 A;  3BDE A;  4EBD A;  4USH A;  2OPQ B;  4F4X A;  3M2V A;  2XMT A;  3IBF B;  4EZ9 A;  3TA2 A;  2QEX S;  2HQI A;  3I5A A;  4P75 A;  4CNZ A;  3QAU A;  1UWB A;  1REV A;  5EX3 A;  5L9N A;  2JHE A;  3W62 A;  4AQY J;  1LFP A;  4QR2 A;  2RQK A;  1IBK F;  1S9E B;  4TY9 A;  2QSF A;  4WFB Q;  4QZV B;  2AP6 A;  4OZL A;  1YBT A;  3W2V B;  4PWU A;  1WAC A;  4EEY A;  1R0C B;  2MZQ A;  1UJ4 A;  2CXE A;  3WX4 A;  2RRA A;  2EFN A;  3GV8 B;  2NPI A;  3THV A;  2E7X A;  2KO1 A;  4KH0 B;  1OO0 B;  3QYY A;  4PUO A;  4HHU A;  2ZOG A;  1M90 T;  2CQ4 A;  2XZD B;  3CJK B;  4O3Q A;  2MKK A;  2PT0 A;  5KFD A;  3CCZ A;  1N5T A;  1FD8 A;  5L1L A;  2MKS A;  1I5O B;  3CPW R;  4ZCM A;  3TA0 A;  2I8E A;  4YOE A;  4LQ3 A;  5EWE A;  3DRR B;  4BLG A;  4QU7 A;  2R7T A;  3J80 U;  4KKO B;  4K8R A;  4Q44 A;  1TQL A;  3DOM B;  3K89 A;  3ICL A;  3M6U A;  1N88 A;  5KFW A;  2ZBI A;  3FGV A;  1V5V A;  1N6Q A;  1NM2 A;  4YY3 J;  4LVN P;  4YR0 A;  4I6Y A;  3UR0 A;  3V81 B;  2K3K A;  2LQ8 A;  1MN7 A;  4H4O B;  2Q6B A;  2WW4 A;  1NZ8 A;  2YQ0 A;  3I82 A;  4F36 A;  2YX4 A;  4B3M J;  3P5B P;  1YBA A;  4F26 A;  4J9Q A;  4OYM A;  2LQ5 A;  2JH3 A;  1L3V A;  2G0C A;  2I2Y A;  1XNR J;  4EGL A;  3K5N A;  1UVL A;  3Q8R B;  3UN3 A;  2HMI B;  2BOA A;  2BBE A;  3MAA A;  1ZZF A;  1NBE B;  5HRO B;  4USW A;  3MF5 A;  1S6U A;  3N0V A;  2K1R A;  3PR4 A;  3OJU A;  1FX4 A;  2RSQ A;  2VG6 A;  4UW2 A;  3KHH A;  1WG4 A;  4WP3 A;  2ASD A;  2JFD A;  5KG3 A;  5AJ3 J;  2VG5 A;  4CLZ A;  3I9V 9;  5A76 A;  1RT3 B;  3H25 A;  4OZ5 A;  4Y65 A;  1V6H A;  2QL9 B;  4TU7 A;  3J7A N;  1HFE L;  3QJJ A;  2U1A A;  2MSS A;  2JEF A;  1OYE A;  2PGC A;  4R5P A;  1DTT A;  3HXM A;  4G1Q B;  1KBR A;  3DU5 A;  2ZBC A;  2OUG A;  3CJ4 A;  1WSV A;  3LH2 S;  5KFJ A;  2HND B;  1Q86 T;  2KTQ A;  3IR5 B;  3T6B A;  1ELO A;  3VHQ A;  1UFL A;  3V4I A;  3LW5 C;  1OSC A;  2KFY A;  1VRT A;  3MR7 A;  2R7U A;  2MJN A;  3SDE B;  2XLJ A;  4HI2 A;  5F8M A;  1TKX B;  5KG5 A;  4ZK7 M;  2CUY A;  1TL1 A;  3NMR A;  5J1N A;  2WBM A;  4JOU A;  4LR9 A;  3VGT A;  2H1Y A;  4YR3 A;  3M9O B;  2AYM A;  2G2Y A;  2ZE2 A;  4JYA F;  5HMW A;  3DN9 A;  2UVU A;  5RUB A;  4X66 J;  4HYK A;  5SUH A;  2F4V J;  2R2U A;  5J2M B;  3IRX B;  2JL9 A;  2COL A;  3GWC A;  4NLW A;  2ZH1 A;  4IYQ A;  4DG1 A;  2KZZ A;  3W65 A;  1VBX A;  2DKO B;  5C25 B;  3CD5 A;  2PE8 A;  5HQL A;  1Y4Z B;  2I0X A;  1JKH A;  5J2P A;  3TUJ C;  1ZS6 A;  3OL8 A;  2W4C A;  3ZXW A;  4LF7 J;  2DEI A;  4IO9 Q;  2HBY B;  4Z2X A;  4ZPC A;  3LP0 B;  3W1Y C;  2EFG A;  1KQF B;  2C3M A;  4FVM A;  3DOK A;  1JNZ B;  1AFJ A;  1XR5 A;  1F5C A;  2KRB A;  2MMY A;  2C2R A;  1KTV A;  3H7H B;  2DTJ A;  2E1C A;  3N4W A;  2WSF C;  3C6T B;  2D1C A;  1Q8K A;  4OI0 A;  4B9N A;  2VDI A;  1VOM A;  3SQG A;  4DR6 J;  3V6J A;  2BAN B;  2CQB A;  3DDK A;  2AJ1 A;  4CM0 A;  4MIA A;  3D6M B;  1HD1 A;  1UW9 A;  3LO3 A;  1S4F A;  1RJJ A;  2V0N A;  4EO8 A;  2BMB A;  1YIJ S;  4CM2 A;  1N5V A;  2V69 A;  2BJ1 A;  3JSY A;  2RAQ A;  1QE1 B;  2H4W B;  3KFW X;  3EUN A;  5H9E J;  2J0Q D;  5M2U A;  1TTH B;  5C7P A;  1DLO B;  3MMA B;  2L08 A;  3HJF A;  2NYI A;  3IBW A;  2WAQ D;  3UR3 C;  4TNO A;  4BWJ A;  2YNF B;  3HVT A;  5B08 A;  1W25 A;  2PI5 A;  4WP8 A;  2ABY A;  3VAF A;  1N5Q A;  3JQK A;  5HQM A;  4KPC A;  3OTB A;  5D6G A;  4YFU A;  2UXB F;  3DXS X;  3D0I E;  4WK3 A;  3MPD A;  4XDC A;  1C1B A;  5HVF A;  2OFH X;  1SUQ A;  3FZB A;  3SSS A;  2RKI B;  4K5R A;  3NP5 A;  3IS9 B;  4QOT A;  1TL3 A;  2KXH A;  4LF8 J;  1RZM A;  3R7B B;  3EXC X;  4URG A;  5L46 A;  4Q43 A;  3QRP A;  1ZAX A;  1PGZ A;  2HIQ A;  3QAT A;  4ZVO B;  1MU2 B;  4MKA A;  1FDD A;  3EM1 A;  1SJR A;  5HP1 A;  1XK8 A;  1WI6 A;  2DVI A;  2BE2 A;  4X4R A;  3MD3 A;  4D3H A;  2VU5 A;  3L7U A;  4DMZ A;  3ZNJ 1;  3VGU A;  1S4E A;  4DL3 A;  5L39 A;  3R1H A;  2YNG B;  1M1K T;  1M1H A;  4FDF A;  1IBM J;  3DRP B;  3KLG B;  1DUR A;  2CQ3 A;  1AUS L;  4IOB A;  2B4O A;  1SH0 A;  3C15 A;  1FER A;  3PTW A;  5DLF A;  4EWT A;  1TL4 A;  5LMN J;  1Z1Z A;  3R2C J;  4FYV B;  1YJT A;  2NCK L;  4K0K J;  4K2X A;  1HNW F;  2KM8 C;  4ZPA A;  4LJM A;  2GZO A;  4NRT A;  4F7V A;  3AOA A;  1HPZ B;  2PEH A;  3CNQ P;  2OD4 A;  4UOC A;  1BUX A;  4IFY A;  2HHU A;  1UPP A;  1FKO B;  1TAQ A;  5D77 A;  3GYN A;  2HKE A;  3MUV P;  3QGI A;  2V6A A;  4PEO A;  2XCP A;  3T41 A;  4OX6 A;  5B0E A;  1FFG B;  1LWE B;  2IFX A;  3W3S A;  3IWN C;  2MY7 A;  5CYM B;  5LM7 E;  4UT4 A;  3DLB A;  3JYT A;  1VCT A;  1X4G A;  3TX0 A;  1M5K C;  1S6Q B;  4M5L A;  3I31 A;  4DZD A;  3DGP B;  3QMQ A;  1RAI B;  2E5I A;  1WDD A;  3HF5 A;  4EMD A;  3KLI A;  5KTQ A;  1NXI A;  3LWL A;  2HFS A;  3CSK A;  3G6Y A;  4ZPB A;  3TAM A;  1T7P A;  2HRY A;  2J8S A;  4TYA A;  2FC8 A;  3QNW B;  3D66 A;  3A12 A;  3QLH B;  3PRD A;  4ECV A;  4ZVT B;  4RNO A;  3DI6 B;  3MCS A;  1CQM A;  2MKJ A;  1FA0 A;  1YJR A;  4I2P B;  3NG8 A;  4DU7 A;  2V5H G;  1M5H A;  4ZLL A;  4G1P A;  3D9B A;  3PAC A;  3W2W B;  2YX1 A;  4C9D A;  3ZZ0 A;  4ED1 A;  2H9Z A;  4DPW A;  3LAM A;  1RA7 A;  4EUV A;  1RLD A;  4WU2 A;  5G0R B;  2DR7 A;  2JDJ A;  4KRW A;  4ZKA A;  1N34 J;  3EGN A;  3UWT A;  2ACM A;  2XC9 A;  2R7V A;  2WON B;  2JC1 A;  4OHW A;  1X0F A;  1WHV A;  2HGL A;  1GXU A;  1VHI A;  3HKW A;  3NRB A;  3BS9 A;  1E6V B;  1CS4 A;  4P2X A;  4V19 J;  3VGV A;  3DMJ B;  1T03 A;  4X65 J;  4DV0 J;  2YNI A;  1ZPW X;  1RQ0 A;  5KFV A;  1Y5I B;  2HYI B;  2ZDP A;  4A8K A;  4O44 A;  4LMZ A;  3HHL B;  3T1Y F;  3C16 B;  3CC7 S;  4Q8E A;  3DRS A;  3TNV A;  4ZVU B;  2RIL A;  4LIW A;  1R8H A;  5KG2 A;  5C42 A;  2W1B A;  4CO5 A;  4JP8 A;  1HNZ J;  5JMN A;  2CPD A;  1RT7 B;  2YWG A;  4URS A;  2IBK A;  2GIR A;  1RAC B;  1H38 A;  2MZJ A;  4JI2 F;  2OPR B;  5K14 A;  4K4T A;  1QY7 A;  4DSJ A;  3IG1 A;  3B54 A;  4CLT A;  1JLG B;  3KK2 B;  2DR5 A;  4CI0 B;  2IVY A;  1GTE A;  4BC9 A;  4L3N A;  1NK0 A;  2E1A A;  2J0X A;  4X4O A;  3HJV A;  2JVO A;  4UUX A;  1FTC A;  1KD1 T;  5U47 A;  1TK0 A;  1CJK A;  4L3K A;  3I4P A;  2HGM A;  4IDK A;  1K8A T;  3KUH A;  1VGY A;  4USV A;  4C0O C;  1FRJ A;  2NQP A;  1T94 A;  2C2N A;  2QLB B;  2FUG 9;  2IMW P;  1HQE B;  2QA2 A;  1KSP A;  3G6V A;  4YS2 A;  4A8M P;  2WVE A;  4JI5 F;  3TUI C;  1WC6 A;  3UDC A;  3S6E A;  2OIH A;  1YIT S;  5DO2 A;  3UD4 P;  1VQO S;  4U7C A;  3ET6 A;  5B7W A;  2HZC A;  2E9T A;  2GCF A;  1VRU A;  1YRX A;  3W9H A;  2L9W A;  2V2V A;  4ZN3 A;  3PX0 A;  4DV7 F;  3ADA C;  1B0V A;  2HBQ B;  3AD9 C;  2FZC B;  4QWB A;  1WKJ A;  3KJV B;  1NUE A;  2DGW A;  4DCP B;  3MR3 A;  1TR0 A;  1X4B A;  4OX9 J;  6FDR A;  5EHH A;  1PSD A;  4FYW B;  4PWW A;  2DR6 A;  5I3U A;  2DHX A;  1TL7 B;  1N52 B;  4X4S A;  2CQH A;  1T9W A;  5K8O A;  1I1G A;  3RB6 A;  1Y9O A;  3RBD A;  1GTH A;  4F4A A;  1FFW B;  3I9Z A;  2QLJ B;  2HHH F;  3MCN A;  3G6X A;  2PA8 D;  5HMZ A;  1SJF A;  1PBU A;  2KYX A;  5F8N A;  4RW4 B;  4PXB A;  4QIG A;  6FD1 A;  1SIZ A;  2ASL A;  3J81 Y;  3KLV A;  3WIU A;  1HBM A;  3E2E A;  1FJC A;  2RVJ A;  4QU6 A;  3R9L A;  3MR2 A;  5AXL A;  3DU6 A;  4PXE A;  3UVJ A;  3KXD A;  2ZEJ A;  4PXC A;  3FEX B;  3MMB B;  1BWE A;  1V3Z A;  3FEZ A;  4ZPV R;  1KHW A;  3QRQ A;  1OS5 A;  2CQD A;  2H48 B;  2XM3 A;  2QMU B;  3EX7 B;  1P9Y A;  3FSX A;  1D9D A;  4CLY A;  1UKU A;  1BXN A;  3NS5 A;  7FD1 A;  2YKN B;  3ENV A;  3AJD A;  1FE0 A;  1GMW D;  2Z2L A;  2G2Z A;  1EQM A;  2CNN B;  2FHM A;  5B0A A;  3BKF A;  2AGP A;  5J1P A;  1FWL A;  2AD9 A;  1RWK B;  5KFL A;  2F7V A;  3PYD A;  5KAK A;  1U8W A;  3GB0 A;  2RQC A;  5CZV A;  1VQM S;  2CAD A;  2Y1L B;  5GMK a;  4DLE A;  1VMB A;  2CZ9 A;  1BY9 A;  1NEE A;  5K5M A;  1Z2Z A;  4UF4 A;  2YKM B;  2RRN A;  2XBP A;  3M30 B;  2QYC A;  5DLG A;  1U1L A;  4ZJQ A;  2V9K A;  2Y3Y A;  4ZIW A;  2GVZ B;  1FHT A;  1D0E A;  3KNG A;  2F9D A;  2IHR 1;  1D09 B;  4AFF A;  4ES1 A;  4LF9 F;  3R7N B;  4F4W A;  1F0X A;  1Z2L A;  3BSA A;  1TUV A;  2RDJ A;  4KHR A;  4U9R A;  2FTR A;  4P73 A;  2AGQ A;  2DB1 A;  2CQG A;  3BEG B;  4Y2A A;  4JI4 F;  3MTJ A;  1L3T A;  2BRK A;  2VFS A;  2J6U A;  4NWB A;  4F0K A;  1F5B A;  2QN6 B;  2FJX A;  2MKY A;  4FKX A;  2VA2 A;  5IWA F;  1R8A A;  5DG7 A;  2OTJ S;  5CCL A;  2BQU A;  4OHZ A;  2QTW A;  2OPP A;  4A8Y A;  4OV1 A;  5EUH A;  1IKY B;  1SKS A;  3OHB A;  4YDX A;  3BSO A;  3J80 Y;  2QGF B;  1U2C A;  1LKZ A;  3NY0 A;  4EI2 A;  3OR2 B;  4OLO A;  1MWZ A;  3DOK B;  4PWD A;  4I64 A;  2XSJ A;  1KWM A;  2AGO A;  4GVB A;  2DNM A;  1FX2 A;  1NK7 A;  2J9E A;  3RR7 A;  1Q78 A;  2DNZ A;  4ZOS A;  3CJ3 A;  1Y5L B;  2CJK A;  4KJI A;  4M5M A;  1GQE A;  1C2P A;  4P7V A;  3S7R A;  4DPO A;  2H4Y B;  4HDG A;  3M9N B;  3EJM A;  2JEI A;  2QG9 B;  3CCT A;  4WYL A;  1G1X A;  4X62 J;  3C8Y A;  4B3T F;  4U7U D;  3H4B A;  1F5A A;  1X5P A;  3T1A A;  3UN2 A;  2CPX A;  2VG7 A;  1Y0H A;  4R8U B;  3VAH A;  1S1T A;  4UOH A;  3MUM P;  2XMW A;  4USU A;  1R8C A;  5A8W B;  3TZX A;  4AL6 A;  3M32 B;  1HL6 A;  2JSX A;  3W5X A;  2ALZ A;  3KG4 A;  5CYQ A;  1X0P A;  5IFM A;  4ID5 A;  4F3O A;  5I42 B;  2HG4 A;  1GFW B;  1KHV A;  2CPH A;  1RTD A;  1NK5 A;  5KFG A;  1UW4 A;  1L3S A;  3DCA A;  4DN0 A;  4ZHR B;  3L3C A;  1VYA A;  1ZPV A;  4DFK A;  1VI7 A;  5LJ5 Y;  3CJS A;  4Y0F A;  4QR0 A;  3B4D A;  3C6U A;  4RW6 B;  1RT5 A;  1XMQ F;  2NXN A;  3W5Z A;  4C8O A;  1S7I A;  5ETM A;  1O8B A;  3KJN B;  2KL8 A;  2CRL A;  4PG7 A;  1JLQ A;  1SUQ B;  1FWP A;  3DM2 B;  4NPO A;  2IAJ B;  3R5D A;  4JV0 A;  5HBM B;  3OTC A;  2DYA A;  3MM6 A;  2VIC A;  3PYF A;  2UXB J;  4CO0 A;  2Y0S D;  1QTN B;  3GLJ A;  3DKD A;  4C0B A;  2BJE A;  4GVL A;  4MK9 A;  2YPZ A;  3MEG A;  3LP1 A;  2VPY B;  2HVH A;  2HGN A;  4NLR A;  3N6N A;  1TMJ A;  4WE1 B;  1MRO B;  2EPI A;  4FPR A;  4LFA J;  4QW9 A;  1UZH A;  3OSP A;  3NAI A;  3LTO A;  3AY0 A;  4PZV A;  2YH0 A;  3G9C A;  4X4P A;  1KR4 A;  3ISN D;  3J7Z T;  3PO4 A;  2JNJ A;  1SKW A;  2XG8 A;  4IRD A;  4CH1 A;  1TV6 A;  1HNX J;  3PJ9 A;  3GSI A;  3C15 B;  2UUA F;  2YQ3 A;  1R0B G;  1T9U A;  4B9U A;  2OEK A;  1RA6 A;  2AQ4 A;  1QLN A;  5KG1 A;  4IOA Q;  1NME B;  2DCL A;  1TL5 A;  3FSY A;  5KT5 A;  1PBA A;  2YKO A;  3UW1 A;  4W4M A;  5K20 B;  2LA6 A;  3G2X A;  1R0A B;  3H5U A;  2MQM A;  3KTQ A;  1YJ7 A;  4RW7 A;  2JEJ A;  1HNW J;  1M0S A;  2RJZ A;  2FYX A;  3NNC A;  1F6T A;  1N56 A;  2CJY B;  4OJ1 A;  2CVE A;  2XS7 A;  4FXD A;  3TVY A;  4GO7 X;  2FJA B;  3W64 A;  1A7G E;  4B3R F;  5HVG A;  2QZ8 A;  2M8H A;  3DLE A;  3H5Y A;  4ILL A;  2V2Z A;  1MG7 A;  1WUU A;  4ZPT R;  4KQZ A;  2EFV A;  4Z7C A;  2BV3 A;  1SH2 A;  1HHQ A;  2OMO A;  5J2Q A;  4I67 A;  3FJ2 A;  2MXY A;  3BO4 A;  2V63 A;  4OYZ A;  4TYB A;  2HHP A;  1J5E F;  3H5X A;  4C8Z A;  2VFV A;  2N4D A;  4DSI A;  2RHS B;  5DDQ C;  4ILR A;  1U48 A;  1H2T Z;  1HQU A;  1WKK A;  2V4J A;  4Q5V A;  1SC1 B;  3OSN A;  4MTP A;  1RT2 A;  2N82 B;  2FZG B;  3ZZY A;  4P6Q A;  4ZVR B;  1FVQ A;  2R2S A;  4ZPD A;  2MZ1 A;  2DGT A;  4HEA 9;  1V3R A;  4IG3 A;  2UU9 J;  4ZVP B;  1HWL A;  3RGI A;  4RUH A;  4TKT A;  4NXN F;  4I69 A;  3UPF A;  2WCX A;  1TKZ B;  3NBP B;  4DLG A;  1APS A;  4XPE A;  2QT7 A;  5KFA A;  3B82 A;  2VAS A;  1S76 D;  3GTY X;  2XS5 A;  1CUL A;  5ITH A;  4MAK A;  1RT6 B;  1DZ5 A;  2DPI A;  4CCH A;  3Q2S C;  2UZA A;  1TP7 A;  1XTZ A;  1RBA A;  1N0U A;  2YNI B;  3QIP B;  1RDR A;  2OSQ A;  4C3M A;  4DV5 J;  4KT0 C;  3ELH A;  3P45 B;  1UVM A;  3I6P A;  3DRS B;  3LAL A;  2LEC A;  4GC7 A;  2PC6 A;  1VLO A;  3V2U C;  2BM1 A;  3E01 B;  5CD4 A;  3AB4 B;  4ZIV A;  3HD2 A;  3U1L A;  4LFC J;  1HBU A;  2B43 A;  2F1F A;  1Q1K A;  3CDB A;  2RDD A;  1MSW D;  4N77 A;  4J9K A;  1NCL A;  3EYZ A;  1CEZ A;  1H74 A;  1NO8 A;  2AF6 A;  2W7O A;  4PYD A;  2HHS A;  2ZBR A;  1OPI A;  4JI2 J;  1WI8 A;  3CMA S;  1N32 J;  2ZZN A;  3TRG A;  2VHG A;  4HTJ A;  2VA3 A;  1NH7 A;  1URR A;  3TX8 A;  4P72 A;  5F8H A;  2KHC A;  4ZPW R;  3QRR A;  5CAA A;  1LXN A;  2HWH A;  4TY8 B;  1RB0 A;  2F8H A;  1HHS A;  4NI2 B;  5AT1 B;  1VIO A;  2M88 A;  1RT4 A;  4U95 A;  4OYO A;  2V8V A;  2J6T A;  3PYG A;  2ZWP A;  3MM8 B;  4C7Q A;  5HAO A;  4DV6 F;  5LXY A;  2OML A;  3DHX A;  2AZ1 A;  3W61 A;  5CCM A;  3RUB L;  1GMU A;  3PYE A;  2LEB A;  1CJV A;  1VRU B;  3CDW A;  4MMO A;  3NOC A;  4JI5 J;  4LF6 F;  2XY6 A;  1MML A;  4NRU A;  4DR7 F;  1WF1 A;  3C3L A;  1QSS A;  4L72 B;  3F0N A;  5ETQ A;  4CYU A;  1IKV A;  3SCK E;  4IG0 B;  2CIM A;  3SV3 A;  4OYW A;  4M5D B;  4Q2M A;  4TU8 A;  5I3U B;  2M0G B;  2UVR A;  1JLB A;  2D9O A;  1LFW A;  4Q7A A;  3A3P B;  1PKU A;  4EFA C;  4IR9 A;  1TFW A;  1YRU A;  4OHX A;  3VVT A;  5J1E A;  1KQS R;  5JVH Q;  3T1H J;  4CO4 A;  1NK4 A;  2IA6 A;  1Y00 A;  5E0O A;  4R0J A;  1KFS A;  2C2D A;  4ANC A;  1VK8 A;  2MQO A;  4RWW A;  2O67 A;  3MZI A;  3NNA A;  2OD6 A;  1SH3 A;  3PW7 A;  4PRF A;  1VS3 A;  2HHW A;  2RHQ B;  4WCE Q;  3EZO A;  1JLC B;  2RUS A;  2DNN A;  1EP4 A;  4DSL A;  5KFY A;  2RH3 A;  2IM0 A;  3A8J A;  3RAM A;  2V67 A;  1AZS A;  4K50 A;  3D6F B;  1U25 A;  1VLY A;  4K59 A;  2AJQ A;  5CAB A;  4A8S A;  4JI6 J;  2KT5 A;  4FBU A;  1U24 A;  2Z30 B;  3GON A;  4RW9 B;  4ELT A;  3RB4 A;  3F41 A;  1DQA A;  4ICL B;  4B9T A;  4LRB A;  2YNH B;  1CC8 A;  4WK1 A;  3GJS B;  4B08 A;  1GK8 A;  2CG8 A;  2V4R A;  1T95 A;  3VQT A;  2OPQ A;  4CH7 A;  1OY6 A;  2YPY A;  2HHT A;  5F0W A;  2ROE A;  4CLF A;  1KVK A;  1XMO F;  1VHF A;  4W98 A;  2GAH C;  2OPS B;  2DNL A;  2EC2 A;  1SV5 B;  4M95 A;  4YR2 A;  1BQN A;  2QC3 A;  4F0M A;  4I6A A;  1S9E A;  1VQ9 S;  1U1K A;  1AB8 A;  3HD1 A;  3KKF A;  1KVI A;  2Y8Y A;  4OI4 A;  1FRH A;  3DOL B;  4DQQ A;  3JQM A;  1F3F A;  2UP1 A;  2B9X A;  2K7J A;  2WZ1 A;  1YX2 A;  1QM9 A;  1TK5 A;  1BHN A;  3WX8 A;  4LVO P;  3M1V B;  4M5K A;  4QPT A;  2XO7 A;  3CJK A;  4KFB B;  2MQN A;  2OPP B;  1BQX A;  3A8I A;  1VBK A;  5D4P A;  3PX6 A;  3M8Z A;  4JI4 J;  2AYE A;  3TAN A;  3P3D A;  2E5G A;  1RAO A;  4KGM A;  3EVM A;  1CQN A;  1U45 A;  4LBI A;  3DRR A;  1TKD A;  3CTR A;  3CWJ A;  5IWA J;  3PW5 A;  3D28 A;  2VD3 A;  3OFF A;  3HPO A;  2EKY A;  4HR2 A;  3ISZ A;  4FS2 A;  4KKO A;  2E1R A;  2P5V A;  3D0G E;  3BGL A;  1RGV A;  4DPT A;  3IFE A;  1JWW A;  4DR1 J;  1HW8 A;  5IV4 A;  2VC1 A;  2FJE B;  4NLP A;  1U09 A;  3DOM A;  2CPY A;  3GJR B;  4B3O B;  5FDL B;  2A2C A;  1QAY A;  3I87 A;  3NGT A;  1NDL A;  5C2C A;  3QWU A;  1FDN A;  3UNY A;  2FHO B;  3V81 A;  2M52 A;  3I0R B;  2FZK B;  3DLH A;  2CPJ A;  1S6P A;  3K2Y A;  1Q0N A;  5F9L A;  2FJD B;  2F63 A;  2EKN A;  3MPY A;  1MNE A;  1NPK A;  3Q8S B;  3NOG A;  4QW8 A;  3BGR B;  1RYS A;  4JV5 J;  1N8R T;  2L9N A;  2K06 A;  1HWJ A;  1DQ9 A;  1FJG F;  3A3O B;  2ZBP A;  4PG4 A;  2B6A B;  3ZTR A;  2A2D A;  1QTM A;  4DQS A;  3Q86 A;  2HMI A;  2QA4 G;  2FQQ B;  2ASY A;  4KY3 A;  2HS4 A;  2P9E A;  1MWQ A;  1PIL A;  1FEH A;  4Q0B B;  2CZ4 A;  4O4G B;  4J9S A;  5HRO A;  3EMT A;  2NZC A;  3JSR A;  1KQG B;  1NDK A;  3W5Y A;  1LOU A;  1W2I A;  2BZ2 A;  1ZM2 A;  4ZJO A;  2FJB B;  5KT2 A;  1UET A;  4OZ1 A;  1RT3 A;  3BO2 A;  2DGX A;  2XNQ A;  2ZH6 A;  3IXQ A;  5H1S V;  4M63 A;  1K44 A;  4J9N A;  1BQM B;  3HKZ D;  4Q45 A;  2IYG A;  4G1Q A;  4IQM A;  3KJF B;  1T11 A;  2PI4 A;  3SCL E;  4ATN A;  2CDQ A;  3MM6 B;  2R7W A;  1NHK L;  3H4D A;  2HND A;  5CQG A;  1RWW B;  4FNI A;  4NYO A;  5BXI A;  3Q0A A;  4EBC A;  5T7L B;  2GAG C;  4NLX A;  3SI8 A;  2D9P A;  3RYL A;  1UPM B;  3OJS A;  2XMM A;  2MZS A;  4J9L A;  1XWL A;  4A4J A;  1XIQ A;  3SDE A;  4PR6 A;  4CIO A;  1TKX A;  2DH7 A;  1C1C B;  4N7T A;  1S79 A;  3CIZ A;  2HFZ A;  1H72 C;  3QFH A;  1N48 A;  2MQP A;  4RLE A;  3TR5 A;  5B0C A;  2HSE B;  4DFP A;  3D67 A;  1OY8 A;  2QIF A;  1U1P A;  4PG6 A;  1QAX A;  4N47 A;  3NGR A;  2E29 A;  1U26 A;  1LW0 B;  2UUT A;  1TV6 B;  4GMK A;  1R3N A;  5HJY A;  2DIT A;  3IR7 B;  1Q53 A;  1S1U B;  3OL7 A;  1KNZ A;  1S12 A;  5J2M A;  2N4C A;  4Y2I A;  3PW0 A;  1NU4 A;  3DHW C;  4WPA A;  3S1T A;  5LMU J;  2GHV C;  3BPD A;  2PN6 A;  2NXJ A;  3G87 A;  2K7K A;  4DR3 F;  2A1B A;  1SKR A;  5B0D A;  2UUA J;  1WG5 A;  4F4K A;  2M70 A;  2GGP B;  3JS9 A;  2P2C B;  3LP0 A;  1C0U A;  3BSN A;  4QCL A;  4NXM J;  4I0W A;  3KHL A;  1RHU B;  4QR1 A;  4CO1 A;  1VDH A;  1C4A A;  1HR0 F;  1V9O A;  5JXS A;  2EG2 A;  3QFW A;  2ZUA A;  3PIP Q;  3WZ0 A;  2X51 A;  2GO9 A;  2I5J B;  1NSK L;  3HVW A;  1XNQ F;  2XYP B;  1JJC B;  1XMB A;  3CVK A;  4FP9 A;  4CLW A;  1O0P A;  3KLF A;  2D7S A;  2BAN A;  3M6W A;  5J2Q B;  2W2M P;  3GU0 A;  5DDP C;  3GIJ A;  1PIE A;  1RAH B;  4JV1 A;  4B3R J;  5KOX A;  2LA4 A;  2BJ8 A;  1NHV A;  3BQ0 A;  1M5O C;  4A8W A;  2HNZ B;  3EGV A;  1U6B A;  2MQL A;  3K5L A;  3IR6 B;  2V4J B;  4NLQ A;  1B99 A;  1QE1 A;  4NOH A;  2P6S A;  1N36 F;  1NSP A;  1P1T A;  2OLW A;  1J5E J;  2ZH5 A;  1O6X A;  1DLO A;  3MMA A;  4X4U A;  1J2V A;  2J8A A;  3UD5 A;  2XZT B;  2YNF A;  4ZVQ B;  4IG3 B;  2CDR B;  4UTG A;  3AA9 A;  3Q83 A;  2HFO A;  2Q66 A;  3SXL A;  4IOC Q;  4ETX A;  2NLW A;  4JI8 J;  3AJ2 A;  2UXC F;  2D3O 1;  3M6V A;  3PJX A;  2ADC A;  4ZJL A;  2CAJ A;  2CYY A;  4HTI A;  4JI1 J;  4DQR A;  1RTH B;  1FDA A;  2RKI A;  3OLA A;  4LF4 F;  1MMN A;  4LFB J;  5K8P A;  4U6P A;  2DGV A;  1L3U A;  4K4W A;  3HI9 A;  4WWS A;  3C19 A;  2G13 A;  3DFE A;  2E5L F;  4R0E A;  5ETR A;  1H0H B;  3GYG A;  1XEZ A;  2IVF B;  1I51 B;  1XQI A;  1Y7P A;  2MZR A;  2GS8 A;  3PEH A;  3DLJ A;  1IKW B;  1MU2 A;  2OHD A;  3MMC B;  4WII A;  1N5Y A;  1VBY A;  4DF4 A;  5D4N A;  4F02 A;  2YWK A;  1LK5 A;  1C4C A;  2YNG A;  4DR4 J;  3G4S S;  2IBO A;  3FK4 A;  3MAQ A;  1WKL A;  2B4U A;  4E8U A;  3DRP A;  3KLG A;  2B5J B;  2CNK B;  4HVZ A;  2K3I A;  3QO9 B;  3CJT A;  1IXK A;  2IJN A;  1GNK A;  5KFS A;  2CNO B;  4RBV A;  4OQJ A;  3KDO A;  2CWX A;  3CDU A;  4ZS6 A;  1RTI B;  5GAH U;  3BH7 B;  1W7W A;  2QJ3 A;  3T5K A;  1JLF B;  1FES A;  1HPZ A;  3Q23 A;  3BBB A;  3NGS A;  1GEH A;  3V6D B;  5T14 A;  1FKO A;  2MDA A;  3T5L A;  3QT5 A;  1EAR A;  2VBY A;  3FQL A;  1RWM B;  1R31 A;  4HKQ A;  2RU3 A;  4DV3 J;  2XZW A;  2XLI A;  3H8Y A;  5L1K A;  3W66 A;  4PAB A;  1LWE A;  4GKJ F;  1KP6 A;  3ENA A;  4G3I A;  2NUH A;  3DNC A;  5CYM A;  4OZ0 A;  4PXD A;  4RU9 A;  1MWY A;  1U1N A;  4TLQ A;  4GKK J;  2FHJ D;  4F4Z A;  4ZVE A;  2YY3 A;  2GQQ A;  4CYU B;  4DFJ A;  1IKV B;  3TJ9 A;  3SCI E;  3DDI A;  1S6Q A;  4WZQ A;  3MTK A;  4J9U E;  1X9M A;  3DGP A;  1LXJ A;  5DRK A;  2YWW A;  3EZ5 A;  3DDN A;  4Y2C A;  3ZZZ A;  4DR7 J;  4OZ3 A;  2GNK A;  2G9O A;  3IGN A;  4UY8 5;  4RNF A;  3QLH A;  2EWH A;  2HVE A;  2I38 A;  2NXC A;  2QX0 A;  4I2P A;  3G8T A;  2V8P A;  1BE4 A;  3SSQ A;  5ETO A;  3PKM A;  2RD5 C;  3W2W A;  4K5S A;  3OVS A;  3KK3 A;  1IJE B;  5E3Q A;  3THP A;  1JXL A;  3KJQ B;  1ULR A;  1CVJ A;  1X4D A;  2GMH A;  3OFE A;  1AZS B;  3M6X A;  5G0R A;  2MHE A;  2B4P A;  4U67 Q;  2VFT A;  3S01 A;  1SBR A;  4H4M B;  2VBW A;  4W90 B;  4IUF A;  3K57 A;  1WC5 A;  2WON A;  4FN5 A;  3G6E S;  3GFY A;  3CO0 P;  4AND A;  3NGU A;  4YME A;  3SCJ E;  3X3U A;  3P8B B;  3HMJ G;  3GPA A;  1CPZ A;  4I1T A;  2VQF F;  1FWK A;  3HFK A;  2F3J A;  3VAL A;  2GQC A;  1VFJ A;  2WB1 D;  3LOU A;  3I96 A;  2X7I A;  3WC0 A;  2VOP A;  1M1G A;  3HHL A;  2FHK A;  4ED0 A;  3C16 A;  3KNA A;  3EWG A;  2FDN A;  2DXF A;  1KKH A;  1ICE B;  3TZY A;  7FDR A;  2M5Y A;  4NLO A;  1BMQ B;  2OEJ A;  4X64 F;  1RT7 A;  4EZ6 A;  1KON A;  2AEJ A;  1BQN B;  2HUR A;  4FF3 A;  1ACM B;  2OPR A;  2JFK A;  1E6Y B;  4J9P A;  4J9O A;  1UVK A;  1JLG A;  3KK2 A;  2RQM A;  3LQV A;  3AOD A;  2DGO A;  3BPS P;  5F3Z A;  4E0D A;  3SYZ A;  4KSE B;  1HI0 P;  4HH1 A;  1M5S A;  3N01 A;  2XMJ A;  3MM7 B;  2ROG A;  2PD1 A;  1QJH A;  2DHG A;  3W63 A;  3UDL A;  2R7R A;  3P96 A;  2BVZ A;  1HWK A;  2KVQ E;  3HP6 A;  3TUZ C;  4F4Y A;  4ZVG A;  4YHH F;  1IBL J;  1C0T A;  1RWN B;  3QQC D;  2MKI A;  2HQF A;  4ZVH A;  1HWI A;  4WBF A;  3THT A;  1GX5 A;  1DHM A;  1HQE A;  3R5J B;  2PSZ A;  5B0G A;  4RKU C;  2CJB A;  2XWX A;  1VK3 A;  1REG X;  4FPI A;  3O1L A;  1RXO B;  2IA0 A;  2UVV A;  5LJ3 Y;  4UZB A;  4PAA A;  4J91 A;  1WC1 A;  4V1A k;  2N3O A;  3KWM A;  1DBD A;  5GAH I;  2KZM A;  3KJV A;  2F9J A;  2R7Q A;  2F65 A;  2HRU A;  4AD6 A;  3C14 B;  1IQZ A;  3KK1 B;  3AHP A;  2AX0 A;  2FGC A;  2KJW A;  4DR2 F;  3R1L A;  2FJW A;  4QYZ K;  4N76 A;  3ZTQ A;  1S6P B;  3UNG C;  4C11 B;  1ITP A;  1TL7 A;  2EK6 A;  3H98 A;  4QIE A;  2O01 C;  2R2R A;  4ERD A;  2KJV A;  3G8Q A;  1EKR A;  2MGZ B;  2MB0 B;  3NAH A;  2DO4 A;  3FEY B;  3ENW A;  3O3L A;  3TQ1 A;  4DCO B;  4DV1 F;  5ETT A;  2VKR A;  4K4S A;  5KFO A;  4Y2K A;  4LIR A;  4OHV A;  1RUS A;  4RW4 A;  2GV1 A;  2C3P A;  2CQI A;  2ZM6 F;  2D3O R;  3RTV A;  2HNY B;  3P49 B;  1NK8 A;  2M3D A;  4LUB A;  4IH5 A;  5KFM A;  2ZJR Q;  1X4F A;  4O3P A;  3ZTS A;  3RB0 A;  3A8K A;  1FJG J;  3S8S A;  1NPR A;  5A2Q U;  3MMB A;  2W9C B;  4HT7 A;  2DNH A;  2VPW B;  1BLU A;  5E3C A;  3HHN B;  4WTO B;  2DNR A;  2KFN A;  3IAM 9;  3EIC A;  3JXO A;  3KHG A;  1FVS A;  2YKN A;  1CJU B;  1J5O B;  2HZA A;  4DX5 A;  3W8P A;  3DLL Q;  1WF2 A;  2F40 A;  2C3O A;  3N79 A;  2XS2 A;  1RHJ B;  4KHP F;  1K47 A;  4N41 A;  3JTP A;  1PAU B;  1PYT A;  4YUD A;  4AQY F;  3GYX B;  3D3B J;  3NLC A;  3TO8 A;  3M8P B;  3NNH A;  2FD2 A;  1QSL A;  1IUJ A;  3CUL A;  5IZH A;  2XO6 A;  1ARO P;  4ZMM A;  3RW6 A;  3RBE A;  3JQJ A;  2BOP A;  5I4M A;  3Q89 A;  2YBV A;  4WIQ A;  3NMA A;  3L9Z A;  2YKM A;  3M30 A;  1ZH5 A;  1FTR A;  1MN9 A;  1HI1 A;  1PC5 A;  2OP5 A;  2GVZ A;  3K0J A;  4IRC A;  3NGD A;  4UQG A;  1LNQ A;  4DV4 F;  3HHL C;  3PDN A;  3LWM A;  4P52 A;  2ZOM A;  4DJB A;  1B7Y B;  2YH1 A;  2M2B A;  4G65 A;  2MJU A;  3N5F A;  4U8Y A;  2XTJ P;  4XAK A;  3C66 A;  1N33 F;  2IJR A;  4DS4 A;  1UZD A;  1SQF A;  3JTO A;  2VOO A;  2E66 A;  4LRA A;  1JLE B;  3K59 A;  3QGG A;  5K9F A;  2QLF B;  4DI6 A;  4C97 A;  1SL2 A;  4KYZ A;  2UUB F;  1NJY A;  1IKY A;  2OFG X;  4I7F B;  2B9Y A;  4KBI A;  2BJ3 A;  1F2H A;  4G6V B;  1YHQ S;  1HA1 A;  2RF2 B;  4EBE A;  3TP2 A;  1C0U B;  3MPU B;  3MR5 A;  3OR2 A;  4H4K A;  4A8X A;  4DR3 J;  3RJM B;  2HIY A;  4C8N A;  1PYO B;  2M9K A;  2ZWO A;  1T9V A;  1R43 A;  3L4B C;  2KH9 A;  4DPX A;  3MOJ B;  2J9D E;  3CO9 A;  4LRE A;  3QGH A;  4QJV A;  2WOM B;  2E9R X;  1OQ3 A;  2NSB A;  1JXE A;  4DUZ J;  1JJ4 A;  2EBE A;  2ZKU A;  1DAX A;  2V8G A;  2O3D A;  3KLF B;  1HR0 J;  3HK2 A;  1VQP S;  2R4F A;  3CJ5 A;  4CH0 S;  1PO6 A;  5KT6 A;  2H54 B;  3OFH A;  3CCW A;  2VQE J;  4N56 A;  4R8U A;  4JI0 J;  1XNQ J;  3RRK A;  4TXS A;  3BRE A;  5B0B A;  1TAU A;  2VH7 A;  1SIW B;  5A8W A;  1WEL A;  1D8Y A;  2HW3 A;  3M32 A;  1I6J A;  3RAX A;  2R8G A;  1ZTW A;  2DHA A;  1RWV B;  2ZH7 A;  4YEA A;  3IBC B;  3O6Q A;  5BR8 F;  1Q79 A;  4MYU A;  5I42 A;  2OEM A;  2DNG A;  5CZX A;  1JB0 C;  3QGP A;  3U1N A;  1IR2 A;  5HJX A;  3NXZ A;  5BYQ A;  2JRS A;  4ITS A;  1WSR A;  3IGV A;  4W92 B;  1NDP A;  4ZHR A;  2BW7 A;  2JEG A;  3K8W A;  3D5M A;  3ITH B;  2BJ9 A;  1U2R A;  2CZV C;  5IC4 B;  2ZD1 B;  2EG1 A;  4RW6 A;  5D15 A;  3PHE A;  1VQS A;  3DM2 A;  1RHK B;  2G2O A;  3QZ7 A;  2IAJ A;  3GG1 A;  2Y1J A;  5HBM A;  1QSY A;  4IO1 A;  2BDP A;  3ZNU A;  4Q8F A;  4TQS A;  3B8H A;  5B09 A;  1HQ2 A;  1KQK A;  3MHY A;  5L9X A;  1S1W B;  2J9D A;  4NA2 A;  4CT8 A;  2BM0 A;  4ZP9 A;  3ZTO A;  3ILI A;  3MUT P;  2U2F A;  3G86 A;  1SC6 A;  2R9L A;  1EB0 A;  4WE1 A;  2QYG A;  1N5Y B;  3H2V E;  1MRO A;  2DJW A;  2E5L J;  2F4F A;  4XTT A;  2HQG A;  1EHW A;  2Y1I A;  5I3P A;  2FLL A;  2ZHA A;  2ZC4 A;  3UCG A;  1U6Z A;  1BC6 A;  3DC2 A;  3CD6 S;  2B8Q A;  4C8K A;  1MMD A;  4RUB A;  2KRR A;  4OI1 A;  4JB8 B;  1WHW A;  1U49 A;  1AW0 A;  2X1F A;  3N5B A;  4AXJ A;  4LRD A;  5F41 A;  3VVU A;  4I56 A;  3R5C A;  2CQ0 A;  1IR1 A;  4F3M A;  4OJ3 A;  3I32 A;  4L75 A;  2VJV A;  3C46 A;  1S6O A;  2H5E A;  2C22 A;  4L6V 3;  5KFR A;  3U7J A;  3KDN A;  1Y3K A;  1HMV B;  1NK6 A;  1R0A A;  4ZN1 A;  1TKT B;  3BKU A;  4KO0 B;  3UQS A;  3RRH A;  3GJQ B;  1S9G B;  4ANE A;  2XMA A;  2ZZM A;  4IH7 A;  3OXF A;  1I94 F;  2VL1 A;  4ED3 A;  3MPW A;  1NZA A;  2FLO A;  2W4D A;  1KLM B;  2V9W A;  2XI2 A;  5F9N A;  2MYF A;  2VC0 A;  4NLD A;  3CF5 Q;  2DH8 A;  1FI4 A;  3O44 A;  2XGP A;  2MLZ A;  4K7Q A;  1B64 A;  2DY9 A;  4M5J A;  2GJI A;  3RG6 A;  4WKR A;  3HSD A;  4DUT A;  2ZC3 A;  4H4K C;  2K2P A;  1GT8 A;  2F8M A;  2JWN A;  4DL5 A;  2V8H A;  2Y8W A;  2BE9 B;  3VAJ A;  3ZC4 A;  4HH0 A;  1RLC L;  4USJ C;  4OX8 A;  5IOL A;  3OLB A;  2AMC B;  3HSZ A;  1P1L A;  1OJ4 A;  2FLN A;  1JLA B;  4DCJ B;  4XO0 A;  2UUW A;  3EDR B;  3RR8 A;  1VQ4 S;  1KEK A;  3KK3 B;  5ADZ A;  3MEC A;  4N8N A;  3VAM A;  1YJU A;  1Y3J A;  3FFI B;  3EPI A;  4B9M A;  1SL0 A;  2DK2 A;  1HWU A;  3U02 A;  4AL7 A;  1F2G A;  4A47 A;  4DBQ A;  5THW A;  3M8R A;  1T0T V;  5KG6 A;  1RHQ B;  2QFI A;  1TKZ A;  3NBP A;  1JMT A;  2MQ8 A;  4NLG A;  2GHW A;  1LWX A;  2KN4 A;  3PIO Q;  4NZ6 A;  2DGQ A;  1RT6 A;  2HPU A;  1D9F A;  4AXI A;  2IYI A;  2WVF A;  2ERR A;  2C2Z B;  2D3Z A;  4XPC A;  3HUL A;  1XN9 A;  1HLW A;  2J76 E;  3QIP A;  3KLE B;  2LFV A;  3UN5 A;  2XHW A;  4YB7 A;  3D6T B;  4DEZ A;  4PG5 A;  3E51 A;  2XSF A;  3I4H X;  1UFW A;  4NL5 A;  1WF0 A;  2O5D A;  2AYG A;  1IBM F;  2HS3 A;  2MTL A;  4MJK A;  4OV6 A;  3LPE A;  3E01 A;  5BYS A;  5H9F K;  5E5N A;  1V3S A;  2XYH B;  3I56 S;  1FCA A;  2C2E A;  2FVC A;  3I0S B;  5LMN F;  1NJI T;  4K0K F;  4J5O A;  5FLX U;  1NRK A;  3PW2 A;  4O3R A;  2LXI A;  2PFF B;  3D1H A;  4ZCK A;  1FKP A;  3A13 A;  3BO3 A;  3JSM B;  1K1S A;  2XQC A;  2IIH A;  1NJZ A;  5KOW A;  3N6L A;  1X31 C;  2JLE A;  4U8V A;  5ETK A;  1IBK J;  3KHR A;  3CJQ A;  3MFH A;  3MCM A;  3PR5 B;  1S59 A;  2Q3P A;  4ZA1 A;  4DOZ A;  1C0T B;  4C6A A;  1CLF A;  1HHT P;  4TY8 A;  4HDH A;  3BN7 A;  4WFA Q;  3BF4 A;  3DXB A;  1EJ7 L;  4NI2 A;  3RAQ A;  2R8H A;  1RU2 A;  3VF0 B;  2LU1 A;  3BM7 A;  4IRK A;  3MM8 A;  2NXU A;  5MAO A;  3Q8P B;  2YWF A;  4R25 A;  5A0Y A;  5K8N A;  1YWX A;  3HX9 A;  4H54 A;  5LOQ A;  2E1M C;  4CNY A;  3MM5 B;  5KG0 A;  5JJB A;  2MLY A;  2YWH A;  1HBO B;  3CC2 S;  2BAB A;  1HNI B;  1H2V Z;  3N28 A;  3J7A 1;  3GIK A;  2NRE A;  3OBI A;  5KFP A;  3MDF A;  3NCP A;  1N4L A;  4IG0 A;  3UI3 A;  3I55 S;  4M5D A;  1RTJ B;  1GXL A;  1NPP A;  3TEH B;  1A9N B;  3R6L B;  3NCR A;  1T3N A;  4NCA A;  3M7V A;  5AE1 A;  2OJ3 A;  2XYG B;  5KFN A;  1WEZ A;  1N34 F;  1YRT A;  4M5N A;  4PCQ A;  1F3V A;  4DQP A;  3R5B A;  2VFR A;  4F8R A;  1M5P C;  2RU9 A;  5BJR A;  1TVR B;  3MMJ A;  5KT3 A;  4I4B A;  4X84 A;  1B4S A;  1EAY C;  2ATL A;  1YSJ A;  2W9B B;  4Y2M A;  1OWX A;  2QL5 B;  4X65 F;  1TEL A;  1F60 B;  2W9A A;  1JLC A;  2RRB A;  2HVI A;  4QPX A;  3R97 A;  3T6J A;  2ZM6 J;  1NHU A;  1O5J A;  1S57 A;  5DG8 A;  1K0V A;  1Q8B A;  3VAI A;  2LMI A;  4MFB A;  4D3G A;  1HNZ F;  3K5M A;  3UD3 P;  1S7H A;  4RW9 A;  3RZA A;  4DF8 A;  4UUW A;  2C42 A;  2B0G A;  2RS8 A;  2DNO A;  4ICL A;  1XR7 A;  2F5G A;  2IDL A;  1RIS A;  4NEY A;  2YNH A;  2RUG A;  1AXQ A;  5DDR C;  4IQX A;  4HAC B;  4KHP J;  4KAI A;  5DET A;  4MIB A;  1OMS A;  4O0N A;  1U0H B;  1T3O A;  4OX7 A;  3H2U B;  4JI7 F;  2AWZ A;  4WKY A;  4B9S A;  1YDL A;  1GMW A;  2EXU A;  2DGS A;  2OPS A;  4ES2 A;  4DPU A;  1SV5 A;  4P10 A;  1U0S A;  1ZA1 B;  2W2Q P;  4K4V A;  2YQ1 A;  2XMV A;  3HLU A;  3W9J A;  3PZP A;  2ZH9 A;  5IT0 A;  1F9E B;  3F44 A;  3DOL A;  2HAF A;  1HD0 A;  2GJ2 A;  1UVN A;  3A4T A;  2JJ4 D;  3LP2 A;  3K17 A;  3LGM A;  3QT8 A;  5GAE U;  1WJ9 A;  3LAN A;  4C3L A;  3AOC A;  1B0T A;  2A6M A;  3T9Z A;  4DV4 J;  2X3D A;  1WOR A;  5L1I A;  2NR0 A;  1RAD B;  2GX8 A;  1S49 A;  1ZA2 B;  4KE5 A;  2FLP A;  3QT6 A;  4JYA J;  3M1V A;  3IC1 A;  1IKX A;  3SFU A;  4NLY A;  4KFB A;  3QAE A;  3Q24 A;  4WP9 A;  1Y10 A;  3B4M A;  1N33 J;  2HFN A;  3NWG A;  3OR1 B;  1UJ6 A;  3T5J A;  1RYR A;  2XI3 A;  4OX9 F;  3GV5 B;  1T9T A;  1X7V A;  3U1M A;  4L76 A;  4K4X A;  5CA5 A;  2CQC A;  2HAI A;  2Z2Z A;  3LUY A;  1ZBT A;  3QBC A;  3R7S B;  2UUB J;  2NSC A;  2C3Y A;  1FK9 B;  2DPJ A;  3HT0 A;  3BSC A;  2W8L A;  3CCJ S;  3JSB A;  4HT5 A;  3CCR S;  3OVA A;  3MR6 A;  4B3O A;  5FDL A;  5HK4 A;  1Q8I A;  2C2O B;  3FSI A;  1KOO A;  4MKY A;  2KFZ A;  1NKB A;  2H3E B;  4NYZ A;  4A46 A;  4EU0 A;  3FKB A;  3I0R A;  2ZNY A;  4PQA A;  5A6P A;  1VQ5 S;  3OTE A;  2B7C B;  2E5H A;  4AE5 A;  4USK A;  5L38 A;  2YKP A;  3EGZ A;  3BGR A;  3H42 A;  3W60 A;  3FCH A;  4RJV A;  4N5S A;  2HFU A;  2DHH A;  2OGU A;  1RHM B;  1Q95 G;  4QIV A;  4S0M A;  3BZQ A;  2B6A A;  2OEL A;  2V68 A;  5A2Q Y;  1VQ7 S;  3MCO A;  5C24 B;  1IQT A;  1IWG A;  1FNM A;  1PG5 B;  3O8W A;  3M9M B;  4Q0B A;  4O4G A;  4WXW A;  3OW2 R;  1K9M T;  3M2R B;  2XB2 D;  3OUY B;  4ZLJ A;  3DRX A;  2XWY A;  1S0V A;  3CDE A;  3DLK B;  2HLU A;  1VQ6 S;  1TZ0 A;  5IT9 U;  3Q22 A;  1DTQ B;  4OI6 A;  1OQ6 A;  3PO5 A;  4P2F A;  5BR8 J;  1NH8 A;  4DSF A;  2W7P A;  2WVB A;  4ECR A;  2ZJP Q;  2FPH X;  4NCB A;  5EX0 A;  1HBN B;  1X60 A;  4F3Q A;  4EK2 A;  2CJ9 A;  1BQM A;  1UAW A;  1FF2 A;  2Z2M A;  4CLS A;  2ZUG A;  5B0F A;  1U1M A;  1RBL A;  2IC3 B;  4OI3 A;  1WC4 A;  1XR6 A;  4HHJ A;  2V50 A;  5T7L A;  3SEO A;  4CTA B;  4X4Q A;  2KHD A;  2CG4 A;  3L95 X;  5KT4 A;  2QMW A;  4NEZ A;  2L48 A;  1YGY A;  3B78 A;  4J9V A;  3DLG A;  5C2G A;  2B56 A;  1AUD A;  3M05 A;  4ED8 A;  1D3W A;  1U6F A;  2LKZ A;  1T05 B;  3PFE A;  1J27 A;  2VFU A;  1C1C A;  2RE1 A;  3QSY B;  5KFX A;  3LF0 A;  4NZ0 A;  4B9L A;  4RW8 A;  1IM4 A;  3ULH A;  3ZZT A;  3OFG A;  4KV8 A;  5HO4 A;  1LW0 A;  2HS0 A;  4BBY A;  1UEK A;  5L1J A;  3AJ1 A;  1X5O A;  5CHC B;  1S1U A;  2IM2 A;  4FKY A;  2GML A;  4WYW A; 
#chains in the Genus database with same CATH homology
 1HQ2 A;  1RB0 A;  3HCX A;  5ETS A;  3MCO A;  5ETM A;  3UDE A;  1CBK A;  2F65 A;  3ILO A;  4AD6 A;  4M5G A;  1RTZ A;  5ETK A;  4CRJ A;  3HSJ A;  4CWB A;  3HD1 A;  5ETN A;  1RAO A;  3KUE A;  1IM6 A;  3HT0 A;  5ETR A;  1G4C A;  2BMB A;  1EQM A;  3UD5 A;  3MCM A;  2QX0 A;  3IP0 A;  3KUG A;  5ETV A;  2CG8 A;  3ILI A;  4M5N A;  5ETT A;  5ETP A;  1DY3 A;  3MCN A;  4M5K A;  3HSG A;  1RU2 A;  1EX8 A;  1TMM A;  3KUH A;  4M5I A;  4F7V A;  1HKA A;  3HD2 A;  5ETQ A;  1KBR A;  4PZV A;  3ILL A;  4M5M A;  1Q0N A;  1RU1 A;  3UDV A;  4CYU B;  5ETO A;  3ILJ A;  4M5H A;  4M5J A;  3QBC A;  1TMJ A;  4M5L A;  4CYU A;  1EQ0 A;  2F63 A;  1F9H A;  3HSZ A;  3HSD A;  5ETL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...