4CYUB

Staphylococcus aureus 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase in complex with ampcpp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
155
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-PYROPHOSPHOKINASE
publication title Structure-Based Design and Development of Functionalized Mercaptoguanine Derivatives as Inhibitors of the Folate Biosynthesis Pathway Enzyme 6-Hydroxymethyl-7,8-Dihydropterin Pyrophosphokinase from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 40
structure length 155
sequence length 158
chains with identical sequence C, D
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2014-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4cyuB00
3HSJA 5ETLA 5ETQA 5ETSA 2BMBA 3ILIA 2QX0A 3ILLA 3HCXA 4M5KA 1RAOA 2F63A 3UD5A 1HQ2A 1RTZA 1Q0NA 4M5JA 3HD1A 4F7VA 1EQ0A 1IM6A 3HT0A 3HSGA 4M5GA 3KUEA 1DY3A 1EX8A 2CG8A 3MCNA 1TMMA 1EQMA 3ILOA 3KUHA 3HSDA 1G4CA 3UDVA 1CBKA 5ETKA 5ETTA 5ETPA 4AD6A 5ETVA 4M5HA 4CYUA 1RU2A 2F65A 3MCOA 3HSZA 1RU1A 1F9HA 4M5NA 3ILJA 4CYUB 3MCMA 4M5IA 4M5MA 5ETMA 5ETRA 1TMJA 4CRJA 3QBCA 4CWBA 5ETNA 3UDEA 3KUGA 5ETOA 4M5LA 1RB0A 4PZVA 3IP0A 3HD2A 1HKAA 1KBRA
chains in the Genus database with same CATH superfamily
3TVYA 3OL6A 4ZS6A 3HLUA 2FHMA 5BYRA 2HQCA 3DXSX 4PCQA 2LVWA 2G13A 4KY3A 2MQNA 1R0BG 3GFHA 3IGNA 4NXMJ 3BS9A 1J5OA 4AL7A 2VB6A 3SEOA 2AJ1A 3NG8A 3LALA 4YHHJ 4J37A 4EGLA 1RHRB 2DNMA 2XI2A 4ES1A 4U7UK 3J81j 4I7FB 3I56S 3ZZ0A 2DJWA 2R2SA 3LANA 2D3O1 1JLGA 2YKPA 1VR6A 1U02A 5D6GA 4YP3A 3N5BA 3K5MA 1NK6A 4OI0A 1O51A 3SZ2A 4ANCA 5LXYA 4DZ6A 3T1HF 3LAKA 1P8GA 2LA4A 2HG4A 1CJKB 3MEGA 1FKOA 1O6XA 4C97A 3DLBA 2XY7A 5G0RA 3RAMA 2GQ2A 5HP1A 4I68A 2H5JB 3VGUA 2WB1D 3G8SA 4DX8H 2MKIA 2ZUAA 4JI5F 4LF2A 3OJSA 1KQKA 1X4HA 2PMWA 2CG4A 3UCGA 2FY1A 3HPOA 1P9YA 1Q4RA 4TQSA 4GKJJ 3GP9A 3IG1B 4KE5A 2H65B 3QGHA 1VS3A 4NZ0A 3HZGA 4PZVA 4XO0A 2HGLA 4ZDNA 3EPGA 2AV5A 4FXDA 3EUNA 1X4FA 4EEYA 1QE1B 3JYTA 1VC0A 3BN7A 3OD2A 1K1SA 1BQXA 4DCJB 5DQGA 2AX0A 1OY8A 2HQGA 2WVDA 4YR0A 4RNHA 2OGUA 4PYAA 1N32F 1DZ5A 1V3SA 4ZKAA 1Q78A 1CQMA 4BC7A 4RW9B 1NHVA 4UOCA 3CCZA 1VQLS 1LK5A 1Z1ZA 5GAEU 4W90B 1D8YA 4DXLA 4OYOA 4EBEA 4X65F 4CQ1A 4KKOB 1U1OA 3Q8SB 1Y10A 2LYVA 3CF5Q 2W2OP 1VHIA 2EG1A 4LRBA 2XCPA 4TLRA 4JI7J 5D15A 4FYWB 1L3UA 1HR0F 1LNQA 3R9LA 3CUNA 4C8OA 5LMUF 3G4SS 2EK1A 2VDHA 2QSWA 2K3IA 1TKZB 1SPBP 2RQKA 3FEXB 2DGWA 5SUHA 3T5KA 2V94A 2N3OA 1XNQJ 4O44B 4A4JA 1Y00A 3M9OB 2EFQA 2R3VA 1KC8T 1DARA 3V2UC 3W8PA 4CT8A 3ET6B 3D28A 2AYGA 1WUUA 5CAAA 4QYZJ 3A8EA 3TJ9A 4QWCA 3BO2A 4OZ5A 1F5CA 4MH8A 4BDPA 5CYQB 2G1HA 4OHVA 1S9FA 3OXGA 4LF5J 2E1PA 4QIVA 3R97A 1DURA 2FZCB 3GPAA 3HO1A 3I0RA 1H74A 3UNYA 3FCWA 1XJWB 5K9FA 1C0TA 4OYAA 4B3OA 1ZS6A 1MWZA 1IM6A 3K5NA 2XWXA 4TYBA 2QLBB 3DLLQ 1NK4A 1XIQA 1B4SA 3DM2A 3QLHA 2ZD1B 2CQHA 2DNNA 2C28A 3BQ1A 1NHUA 3VAFA 3H98A 3PW4A 1P1LA 1EP4B 4KSEB 4PWDB 3TP2A 2HHSA 4GMKA 1IN0A 4WYWA 3PO5A 3TR5A 1Q8IA 4CO5A 1KTQA 3QT6A 2GVZA 2R8GA 4GVBA 1CJUB 2MZQA 2GVDB 1GK8A 1YK9A 3J80U 3VR1A 1QAXA 4DFMA 2CYYA 2GX8A 2QJ3A 4AE5A 4WE1B 5H9FK 2Z8QA 5L46A 3G6XA 1Y5NB 4USVA 2QT7A 3N6NA 3QGIA 4KGZB 1FJGF 4NL5A 4M5MA 2GGPB 1EHWA 5KFKA 3MEEB 1YKWA 1NDLA 3T1YJ 1NDPA 5AE1A 3PIPQ 3VGTA 2MQMA 4KJIA 4OYWA 3GWCA 4ZLLA 3L09A 2B0GA 1LXJA 4LREA 5IV4A 2ZE2A 4PEOA 2MZSA 1S0VA 2RIJA 1T03A 1HBOB 3MXHP 3D6TB 3WHIA 3GFYA 2VL1A 2OMLA 4OYBA 2L9DA 2YWKA 4DL4A 3BO4A 1V6HA 3J80Y 3PM9A 4R8UB 2PI4A 3FBBA 4L74A 3DOKB 1QY7A 1RWXB 3GJRB 2B43A 4DPUA 2VJUA 1IKVA 4WFYA 5ETVA 3D0GE 3QIDA 1AUDA 5D0GA 4H4MA 1U1MA 4LFCF 2I8EA 2F40A 3CT9A 5C7PA 2DKOB 2AKWB 4OI1A 5KFIA 3CCJS 1U1KA 3DLGA 2V2KA 2RMLA 4M5HA 5IC4B 2FGCA 3HM9A 3CO9A 1FEHA 1UA1A 4F4ZA 1IBLF 4DR7F 1S7IA 2E5IA 1HHQA 2DR7A 2AIRB 3M32B 2VONA 2VPYB 3N6LA 2MQOA 3HKWA 2YNIB 2HMIA 5LM7E 1FDDA 3PIOQ 3Q2SC 5BYQA 4ID8A 1VC6A 1N36J 4YR2A 3PW5A 4NLTA 2IPOB 3Q0AA 1R0CB 1EJ7L 3NOGA 5ETKA 1FJ7A 1TP7A 1WD6A 2HNDA 3M30B 3Q89A 3TA0A 2JFDA 5DDQC 3PDNA 4KPYA 3F0NA 2P6TA 1H0HB 2B6AB 3SMZA 4URGA 1T3OA 2B9XA 2Z2LA 3FBEA 1X9SA 2BE2A 2W7AA 4I6YA 3CCTA 3POTB 1DTQA 1S48A 2WSEC 3SFUA 2DGOA 1PAEX 1FXDA 2R8HA 3JSRA 4OYIA 3EE3A 2HAFA 3W2VB 8RUCA 2DHSA 2X1BA 5HBMA 3OV7A 5A8WA 4AQYF 3ENWA 1X4CA 2DHGA 2ZC4A 2UXDJ 2CPZA 1T9UA 3CJKB 4ETZA 1WG4A 2CXEA 2AJ0A 5IXUA 5KFPA 4TU7A 2JSXA 1XERA 1SV5A 1K73T 2DISA 2R7XA 4MIWA 1BXNA 3NGTA 2DXEA 2LXUA 4LIRA 1RT2B 2W4DA 4DR2F 3V6JA 4OZ0A 3S01A 4CCHA 4UOGA 3PX4A 1ELOA 2J0QD 4TN2A 1WOPA 2ILYA 1GT8A 3EJMA 3P49B 1X9MA 1LXNA 3DHWC 1NSQA 3GG0A 1SL1A 3PFOA 2CPDA 1VRQC 4IDKA 4OYXA 3FUYA 4O23A 1CPZA 2K7JA 2ZEJA 1G7CB 2IDLA 1S9GB 4ZCLA 1H38A 1SC4B 3MR3A 4IO1A 1S57A 2VKZG 2W4CA 3E2EA 2PEBA 1U6BA 1CG2A 2YTCA 1NPKA 2ZZMA 2VBYA 4YQWA 2G1DA 1D3WA 1KOOA 3OUYB 3DYAB 1FD8A 2Q6BA 4JP8A 5KTQA 2ZJQQ 2H9ZA 3E8OA 4QOTA 1UWAA 5HVHA 3KWMA 1U1NA 2RHSB 4K0KF 5HMYA 4FVMA 4WXWA 1KONA 4J9SA 1FRLA 4NXNF 4MYTA 1AXQA 2YPZA 4WFNQ 4P2MA 1XEZA 4ZN1A 2YNGA 4P2XA 3LOUA 3JQJA 2QIFA 3SV4A 4DV4F 2C3PA 1UWBA 4PKDB 1N33J 1IBCB 3MPUB 3TO8A 5I42A 4EBCA 3M8YA 2CNNB 5C42B 4P74A 2UUCF 2MZJA 4DFKA 3FVYA 1HR0J 2FZGB 4ZCIA 4AL6A 1UVIA 1VJWA 1U24A 4C8MA 3SQOP 3D67A 4MTPA 2UXBJ 2B7BB 3UW1A 1K0VA 2FVSA 4LMZA 2QFJA 4B3RJ 3CJ2A 2IM0A 1OO0B 5DM6Q 4MK7A 3MAQA 3G6YA 3HVRA 3UWTA 2CQIA 2BW2A 3BGUA 5JUMA 1WKLA 1S0MA 2H54B 2Y3YA 3M6XA 4F0HA 3HT3A 2VPWB 5SZTA 5H9EK 4WWSA 4YY3F 1VBKA 1IKYA 2BJDA 3AXKA 3NS5A 1QAYA 4DUZJ 1EKRA 1QAIA 4DV5J 2KU7A 4DN9A 2FPHX 1Q7YT 3HFKA 1VQ9S 5HLFA 1YWXA 4USIA 4N41A 2G9OA 1B3TA 2EKNA 3UN2A 3GR0A 3L4BC 4DHVA 2E5JA 4CLKA 3TAMA 3EWGA 3HHLD 1VISA 4ZVUB 2M7SA 1UKUA 3C3LA 2IC3B 3I4HX 2UVUA 3QSYB 3U7JA 3KK3A 3HHEA 1TKTA 4B3TF 2CWKA 1JLAB 3OVBA 3TEGA 5C25B 2R8IA 5F8HA 1TK5A 4FYYB 3GU0A 4NA1A 2RRAA 1GNKA 4LF8F 4YN3B 1UPPA 2V50A 2QYGA 5CYMB 2ZDOA 4FP9A 2X1FA 4DPTA 1FRMA 2F3JA 1I1GA 3ADAC 3HZEA 4L73A 5ETOA 1FE4A 3KG1A 2KDOA 3O6QA 1S6OA 2FGOA 4WU2A 1T9YA 2EFNA 3MCSA 4LSNB 4WIIA 4ILMA 1HBNB 3KFWX 3HVAA 4FDFA 3OVAA 3RAQA 5E41A 5KFDA 1YJ9S 1F5BA 1RP5A 1LEOA 1LWCA 4CO4A 1JXEA 5HJXA 1KQGB 2DNPA 1GX5A 1T7PA 1LFWA 3CMQA 1R8CA 1SB6A 3R2DJ 2UUBJ 3IAS9 2KYZA 5T41A 1LKZA 3OR2B 4NMLA 3I31A 3MEDB 2MGZB 4I1TA 1PYTA 1HD0A 2WSFC 1PC4A 2UUTA 4CZCA 4RLEA 2UUWA 1WC6A 2YNHA 2X3DA 1AT1B 2AQ4A 1I94J 1WHYA 2ZNZA 4OZLA 2UVVA 1RT4A 1T02A 4Y65A 1JKHB 1HYSB 3HHLA 3NCRA 4WK3A 3KDNA 5BJRA 3B6BA 1W7WA 3C15B 2AF6A 2AGQA 1HNIA 2DNGA 3IGVA 3FBCA 1BMQB 1VI7A 2XSJB 3SQGB 2LXIA 5DG9A 3SDEA 5LT5A 3BB5A 4XPEA 2VZ9A 3KK1B 4Y6IA 3HJVA 1UVNA 4ID5B 1S1UA 2DNKA 4J9QA 2HFZA 1OY6A 3DRYA 4G65A 4FXWA 3A3OB 1KVKA 3W66A 1FRKA 1JLCA 2V4JA 2HHXA 2WBMA 1YBAA 2XLIA 1VRTB 2ERRA 3SI8A 2LQ9A 1REVA 1FX4A 4NX9A 5HMWA 2HFNA 4NYZA 2HBZB 2O5DA 2HRTA 2VUGA 3DRSB 4ZHRA 2OKQA 1UP1A 2M8DB 3KJVB 4ANEA 1XMBA 2NZ4A 1RXOB 4WKYA 3FK4A 3MHYA 3NNCA 4ZA1A 3MWBA 4Y3CA 1ZH5A 4ED0A 2AX1A 5D78A 2KG0A 2UU9J 4DR1J 3CD5A 2VA3A 3UDVA 2YQ0A 1FVSA 3B78A 4LR9A 4RNOA 2PO4A 2RNEA 4HEA9 2OELA 3CTRA 2DEIA 1RT7B 2ZHAA 2DCUB 1JNZB 1UVJA 3KLVA 1FCAA 3DCAA 4I4BA 2YKMB 4C11B 2P9CA 4LRAA 1UEVA 2VG7B 5JVHQ 4EMDA 4I64A 4ZK7M 5KT4A 2ZHBA 2EFGA 2BQUA 2A2CA 1FDNA 2UUAF 4OHWA 3K7RA 2AU0A 4X4UA 2B9EA 2EFOA 2IYGA 2A6OA 4OI6A 4C8KA 3RRGA 4J9NA 5KFAA 2J6TA 3CD6S 2HS0A 3C8YA 4WP9A 4LF4J 4G1IA 1TZ0A 1S1VA 4FS1A 3W1YC 3ENQA 3DRPB 4CLPA 2FJVA 1U8SA 3P45B 1SI9A 3QO9A 2NUHA 1VBZA 5D0HA 1ITPA 4JI3F 1FKPB 2DCLA 3CCWA 4USMA 1LOUA 2HHVA 1OYDA 3D4JA 5KFUA 5DETA 3JTPA 1WHVA 1FESA 4EO6A 4QJVA 5IWAF 1VBXA 4P10A 3R5BA 2MQLA 5A2QU 2VPXB 4MYUA 4FF2A 2OAUA 1WTFA 5C5JA 2YXLA 3M2VB 1OY9A 3TUZC 2YH0A 2ZM6F 1RT1A 2GHVC 1M5SA 4P71A 3DGPB 5KFLA 1DQAA 2V6AA 4EFAC 3QSIA 1VIXA 4ELVA 4LSLA 1WSVA 7FD1A 1U1LA 2B3TB 3EGVA 4Q8EA 4CYUA 2DNZA 3C16A 3CD0A 1MROA 1RWVB 4DR4F 2J0XA 3GONA 3BSAA 4PG5A 2V2VA 1RAJA 3MFIA 1HPZB 3Q22A 1HQEA 2QLXA 4IUFA 1KLMA 3OFEA 1UW9A 5A2QY 2ZZTA 1S72S 3AH6A 3UD5A 4LF7F 4PUOB 3PACA 4CLYA 2UUCJ 3MR5A 4N47A 3MM9B 4NI2B 1NB7A 3LP1A 1RT6A 2DY1A 5C2CA 4LRCA 1B7FA 3BGRB 1U0SA 5D0EA 4R25A 1S9EB 2XMUA 4PXBA 1Z2ZA 1UTAA 2W2QP 2QTWA 2ZKUA 3R5CA 2G4BA 4IRDA 1F5AA 2RF2A 3H40A 2FIUA 1RI7A 4PR6A 3BH6B 3T19A 4DL0C 2HHHJ 1ROFA 3C2PA 2DHAA 2EBGA 2OEKA 1DLOB 1FDAA 2KB2A 1F2GA 2W2MP 3AAWB 3TRGA 1F9HA 2K1RA 4Q7AA 2GJ2A 4JI4F 1C1BA 4ZLPA 2YNFA 2ZC3A 3FC9A 1LWEB 3UDEA 1U48A 3EVWA 1DTTA 4R5PA 4JBCA 1UPMB 2ABYA 2FTRA 4C8NA 3QBCA 1BE4A 2WZ1A 3CJ5A 1Q53A 2QLJB 4EO8A 2D9OA 3WDOA 4QR2A 5KFYA 1SKSA 1AW0A 1YJTA 3ZTQA 1S6UA 1RBOB 2JEFA 1MU2B 4J9UE 2NXUA 5FDLB 4KFBB 4QWDA 4LFAJ 3KNGA 3MPVA 3I32A 1J5EF 5DG7A 1YTYA 3Q8YA 2YWHA 1UJ5A 1TELA 2HVIA 3NCQA 4AUKA 1Q16B 2HVHA 3DLEA 2ZH6A 2KFNA 3EVOA 3MFHA 2E44A 1DY3A 1PBUA 1IWAA 3T5HA 3AJDA 4F3OA 4NLOA 2VFRA 1NSKL 3OQ2A 4JYAJ 3R5AA 1UA0A 4UQTA 3DXBA 3M8PA 1C1CB 1ZM3A 1HBUB 4BCAA 5KFGA 5AE2A 1WHXA 4BLGA 1R6VA 3DI6A 2XYHB 3Q86A 5LMNJ 1RYRA 2BE7D 3IFEA 1FFSB 3RRHA 2CZ9A 1RAOA 3LQVA 3J7A1 4IG3A 1FK9B 2I9SA 5I3UB 5FIIA 2J7UA 3C6UA 3BGOP 4DPWA 1N48A 1CJVB 1U2CA 2BKPA 3DMJB 1ULRA 1CJTA 4M5LA 4J5OA 5KFWA 4DF4A 3J7YI 3HP6A 3PFEA 2GIQA 2FLOA 2ZKTA 2FYXA 3OLAA 3CW2C 4HTJA 4RWXA 5E0OA 4Q43A 3IO1A 2M70A 3C19A 1KSPA 4TY8B 4ZVRB 4FZVA 3H25A 1HNWF 5LSOA 1I5OB 4IRKA 1PJ5A 1N56A 3PRVA 3G82A 3JSMB 4P73A 4A8OA 2LQBA 5A0YA 3TOQA 1CS4A 3KG4A 3CMES 2F4VJ 3J7AN 2FHOB 4IQMA 4C0HA 1XBWA 1XR6A 3OTCA 2LU2A 1HARA 5KG4A 3CJ8A 4A8WA 1Q5YA 2OPQA 4EK2A 2YH1A 2A0FB 2B9YA 1XNRF 4ZPTR 1FTRA 3BGFA 2BJ8A 1WWHA 1RISA 2J5AA 4Q0BB 3QATA 3ISNC 4ALZA 4BS2A 3PYEA 2LCWA 1TUWA 3OR1A 1RBLA 5HVGA 3TJAA 2DO4A 5CHCB 2FHKA 3AHPA 5KFXA 3HVWA 4L75A 4QIEA 1UVLA 4YMEA 2W9CB 4ED1A 3GTYX 2DGSA 2NYHA 3L9ZA 3HHDA 3THPA 3UVJB 1JLFA 2Q3PA 3KMQA 4OYPA 1SJFA 1IVZA 4DV1F 4JV5F 4DFPA 1FRHA 2FD2A 2MKSA 2VG6A 2N7CA 4DL3A 4QWAA 4DX7A 1JQGA 3B4MA 2FZKB 1OS5A 5DG8A 2FJWA 1YG0A 3CJ0A 2DVIA 3KKFA 3T1AA 3ILLA 1VK3A 4I0WA 3D1QA 3NBPB 3PYFA 2PT0A 1T05B 5D0RA 3QQCD 2RVJA 5EX3A 3ZNJ1 2MKJA 3ENAA 4E2FB 4E8UA 5KG5A 1SJ4P 4DR5F 3CNQP 4DS5A 2DNOA 1ZPWX 4FBUA 1BQNA 3LAMA 4AT1B 5HMZA 3DRXA 4WPAA 4QBUA 3EX7B 2UUAJ 3DFEA 2DHHA 3G96A 2ASJA 2MY7A 4Q5VA 2ZBRA 4U7UD 2VPZB 3ZTRA 2HGMA 4QU6A 2V4QA 1U1RA 3GJQB 3NMRA 4OJ3A 3HVTB 2VD3A 4WFAQ 1E6YA 2FJBB 2LXFA 4DR6F 2CPXA 5B0BA 3V6HA 2DRAA 2A18A 2XG8A 1IBMJ 4JI2J 1RU1A 1S49A 1U2RA 2J9DA 3OTBA 1NO8A 3LPEA 3M6WA 2QL5B 4PAAA 2NPIA 1VQKS 1JLBB 1OMSA 1NB2A 3DHXA 3T41A 1XMQJ 3U1MA 1YRXA 4DQPA 1JLGB 2MHNA 3KJFB 4LSZB 3QAUA 4L3NA 4UUWA 1F6TA 3D0HE 1JLEB 2RU3A 3A1YG 3MM7B 3QJLA 4LR7A 4EYHB 4LF1A 3KLEB 1HNVA 4ZPBA 3TWZA 3KYLA 3KHGA 2XMTA 1S12A 4DF8A 4XDCA 4IFYB 4GKKJ 4ZPWR 3UR0A 4ZJOA 1YRTA 3BEGB 4LRDA 3MEGB 3TARA 3W65A 1JJ4A 2C42A 4FS2A 2ACYA 2R7QA 3CB4A 5EX0A 5G0RB 4NPOA 4MFBB 2HLTA 2ASYA 5DZ7A 2V9WA 4DCPB 5BYSA 2H5IB 4DJBA 5IQ6A 4GVLA 4E0DA 1XMOJ 1IJEB 2NSCA 2QA4S 3N79A 1G3OA 1TUVA 2XC9A 1RAFB 2W7PA 3V6DA 4NCAA 3IP0A 1C0UB 4B9LA 4I7FA 2GIFA 3PXGa 4QZVB 4I6WA 1FT8A 3BH7B 2KT5A 1OQ3A 4RBTA 4JI6F 2JC1A 4ATNA 4DWIA 5CCLA 1YBUA 2W9BA 1NZAA 1ZA1B 4DL5A 4O3QA 2B56A 5B0AA 1UZHA 2V69A 4NLWA 4ZJQA 4FYXB 5J2MA 3NNAA 4Y2KA 1SQFA 2JEGA 3PX0A 1FHTA 4C7QA 1FEEA 2OEJA 4CH1A 3O2IA 2QE5A 3P5BP 5AXLA 4HDGA 3TA2A 3KJQB 4PABA 3A8IA 4CH0S 4KGXB 1BWVA 3MD3A 1M5PC 3MMCA 2YVSA 4JI4J 3BF4A 2KH9A 5CD4A 3SSSA 3UCUP 3R7BB 4C0OC 4ES2A 1U0HA 4J9VA 2KVQE 4WBFA 4LUBA 3SBMA 3KG0A 2VICA 1M0SA 5KOWA 4P7TA 3CJTA 4JI1J 2JWNA 5F0WA 4BBYA 1URNA 4NLVA 5DQHA 4OYMA 1W2BR 3CDWA 2ADCA 4O4GA 2E5LF 1R8PA 4RJVA 2AGOA 1S6QB 5L39A 3MR6A 3IG1A 5KFNA 2ZH8A 1R7IA 1PJ7A 4USHA 1ZM2A 1TL7A 1Y3JA 3M8WA 4OI2A 3V6KA 4DMZA 2RUSA 2DH9A 1R27B 1FJEB 4H4OB 2XMKA 1RDRA 4ECYA 4YB5A 1QE1A 4ZVHA 4XDDA 1SC3B 3BJYA 1R0AB 4TXSA 4X4SA 3D68A 4CLTA 2BACA 2GO9A 3GIKA 4IRCA 1M1KT 5C24B 2WHOA 2YWEA 2DIUA 2GV1A 3S6EA 4B3MJ 4JV0A 1QUVA 3QGPA 3NY0A 2EWHA 3TZZA 5B08A 1SC1B 2VC1A 4F4WA 4O3OA 4KKOA 3RB6A 1RADB 5EDWA 1J27A 5IT9U 4C8LA 4ICLA 1FFWB 4P52A 5E2QA 3ENVA 4A8KA 3I0RB 2HIYA 4EBDA 3F41A 1ZTWA 2BKOA 1TK0A 1WG5A 1RUSA 3I87A 1TKZA 2JZ5A 4UTGA 4X62F 1KVIA 1SCJB 1SJQA 4KC5A 4U67Q 4DG1A 3RW7A 3BSCA 5L9NA 4WKRA 2I5JA 2PE8A 2B5JA 5LJ3Y 4MMOA 4NE9C 3ZZPA 1Z4UA 2G0IA 2JOQA 3PRDA 4USKA 4CO3A 2ROPA 3ET6A 2GVZB 3R8YA 3PX6A 5IT9Y 4QIGA 2CJYB 1YLXA 3K0JA 2EEYA 4DOZA 1MN9A 1AUSL 3SCJE 3CC4S 3KMSA 1AYEA 2AJQA 2QC3A 3BPSP 2EPIA 2NREA 2AW0A 3MF5A 4U8YA 2E7VA 2VHGA 1OJ4A 2JC0A 4AXJA 3G6ES 3UFCX 2XY5A 4R0JA 5ETTA 1F3VA 4ZVSB 1FWPA 3M7VA 1Q8BA 2ZD1A 1SL2A 1GMWA 3ZTOA 2KHCA 3GMGA 1PAUB 1J2VA 4Y2CA 1QD1A 2LA6A 3QT5A 3MTKA 3FZBA 3HHNB 4MKAA 4PWDA 4NEYA 2XLJA 4N7TA 2QMUB 2UVRA 2FVCA 3BREA 5B0FA 5E3CA 1ICEB 1CC8A 2JEIA 1QLNA 5L1KA 3Q8VA 3PW0A 1L3SA 2XMWA 3FQLA 3CULA 1D9AA 2R42A 4S0MA 1F9FA 1R8AA 1IKVB 4B3SF 2PGCA 4YB1P 1JLQB 3MMBB 2LMIA 1JXVA 1KQSR 4KGKA 5LSLA 2E1AA 5A8KB 2YKNB 3JSBA 1H2VZ 2DD8S 3ZTSA 3M8QA 1URRA 1TU0B 1ZZNA 1X8DA 1RWUA 3UPFA 2I1RA 3VGVA 3FGVA 3IS9A 3N9UC 3MR7A 2YQ3A 2HMIB 4DV0F 4DV3F 5ETPA 1VQMS 3A12A 4RW8B 4V19X 3EPIA 2MLZA 2CJQA 1HD1A 1H7XA 2DNRA 1VYAA 4DV6F 1Q5VA 2M8HA 3DOKA 3T6JA 4CIOA 3MM6B 4LF9F 4PWWA 3IR6B 4NYPA 1X31C 5D77A 4KO0A 2BE2B 2IVYA 3QRPA 2XS2A 4J9PA 4DUYJ 3ZZUA 2CUYA 3AXMA 3HKZD 2I0XA 2AD9A 1TL4A 2CPJA 1IR1A 2JFKA 4LFBF 3D3CJ 3R6LB 3CCES 2J6SA 1S76D 4ZVOB 2AWZA 5HBMB 2HEKA 3B4DA 5D3GB 5A8WB 2HNZB 1S1TA 3PO4A 1IKWB 5AXMA 5G4DA 3M32A 4K50A 5AJ3J 2NLWA 2YNIA 1SV5B 3IM8A 2ZH2A 1IQZA 2Y1LB 2VA2A 3MM8B 2UZAA 4B08A 3BDPA 1MMNA 3IWNC 4K5RA 3DOLA 2V8GA 4M8LA 5H1SV 3M4XA 2AYBA 1NM2A 3NWRA 2DPIA 3M2UA 1VQ4S 2YX4A 3N01A 2V2ZA 2HVDA 3M30A 2W01A 3EGNA 3VV2B 4FNIA 2ZH5A 1OQ6A 1G6BA 1R3NA 2ZNYA 4Y2MA 2I6WA 2YX1A 5EUHA 2IMOA 1Z2LA 3QIPB 3PR4A 3BQ0A 3IWXA 2C2KB 3POTA 1KP6A 2RDIA 2CQ4A 2CG8A 4IDKB 4QPXA 2V8HA 2CJKA 3DN9A 1ZOTA 1YI2S 1MN7A 1W26A 4NLQA 2KM8B 1RJJA 3RR8A 3JB9k 4KHMA 4TKTA 3MPYA 3NS6A 2B8PA 4OX9J 3MOZA 3CJKA 1EETA 2C22A 4V1Ak 5K5MA 2GMJA 2CWXA 4HHUA 3VAGA 5HROA 3TZWA 3EXCX 1WF1A 4F4KA 1SIZA 3LGHA 1RT5B 2FVQA 4QWEA 1S1WA 2HYIB 3LGMA 5BR8J 4IOCQ 2QZ8A 4NWBA 3IAM9 4ETXA 2AP6A 1WHWA 2L08A 1X4AA 4FF1A 1S99A 1UEKA 4ECRA 2DXFA 4Z7CA 3U1LA 2YWGA 4A8MP 2XBPA 2JDJA 2XM3A 4A8FA 4QCLA 4NEZA 2W2PP 1YVFA 2JVRA 2W24A 1SKUB 3N5FA 4MKVA 4CLWA 2I38A 2QMWA 1UWBB 1S9GA 1RWKB 2ZUGA 3AA8A 3PTWA 3KUGA 4CT9A 4Y34A 3N28A 1Q1KA 1FA0A 3MMJA 4OHYA 3ZZOA 2VQFF 1ZZFA 4C3MA 1HKAA 4DPYA 2GAGC 4KBIA 3MURP 4OI4A 4CLLA 2J6UA 2OTJS 4LVOP 1U1PA 3C6TA 5L1LA 2MDAA 3V4MA 2MEWA 2OPSB 3EYZA 2AHOB 2OHDA 3HSGA 1SJ3P 5GMKa 3NWGA 2OFHX 5DLGA 4DS4A 1T9XA 3VZHA 1L5UA 3HT0A 2R4FA 3DLHA 2Y1JA 4USTA 4C3KA 2HPUA 2IBKA 5HLFB 1RTDA 1VIOA 4PG6A 3VQTA 4H4KA 5KT6A 4RBVA 4L6V3 2CJAA 2OPRA 4JI0F 1B64A 5ETLA 1JIHA 4IG0B 1LW2B 1Q0NA 4JI8F 3OLBA 2KXNB 4DV7F 2E1MC 3GV8B 1S59A 2BZ2A 3F56A 2BANB 4MKBA 3HMJG 1FJCA 1HI8A 1A9NB 1RGVA 5MLCV 1UVKA 3NP5A 3K59A 4P7VA 1HNXJ 3M6VA 3KK3B 2ACMA 3D1OA 1TKTB 1HMVA 1RCOB 1TL3B 1S0NA 2HFOA 4ZCKA 2RKIA 3M9MB 2GZOA 2SXLA 3AQOA 1S10A 4Y0FA 4LBHA 5LXRA 2XWYA 5HVFA 4ED5A 2WVCA 2ZZNA 2ZHOA 5L38A 3FDSA 2R7RA 3FCHA 2RD5C 3RU0A 4DN0A 2C2OB 3T9NA 3UDCA 2BYCA 4C8YA 2UV8G 2YBVA 4GO7X 2BA9A 2D3ZA 1T9WA 3SXLA 4B9SA 2RJZA 1RKIA 4DR3F 4LQ3A 3MCOA 4ECVA 3OTOF 2OFGX 2L41A 4AFFA 1D9DA 1EZZB 1I3OB 3B54A 1YBTA 2QYCA 4QW8A 3MM5A 3OFGA 2CQ1A 4OHXA 3JQKA 1LK7A 2V2QA 5J1EB 2ZH7A 3OPKA 4ZP9A 5DGAA 1SH0A 1JMTA 2ATLA 3H5XA 3D66A 2YNHB 3HDSA 1JLAA 1WJ9A 2M88A 1VJQA 1WC5A 3KJNB 5EHHA 4KHPJ 2UXCF 1SC6A 2GCFA 2F8HA 4Q45A 1RT4B 2JNJA 2VC0A 2V5HG 2HURA 3P6YC 1V3RA 5CYMA 2VG5B 5F8GA 1KHWA 3K8VA 1M5KC 3Q2TC 2GFFA 2N3LA 3M8RA 1FTCA 3HHLB 3KHLA 1CQNA 3QWPA 2CNOB 4CTAB 1HNIB 1NEEA 2ZH9A 1HBNA 3CJRA 3UQSA 4C48A 3SDEB 2DGTA 2C2EA 4F8RA 1AB8A 5E3RA 1GX6A 1S1UB 2QFIA 4GRSA 2U2FA 1FWKA 2JX2A 3TQEA 2BUNA 4RL1A 1EKSA 1SVDA 4CP5A 1HNZF 4V19J 3R6GB 4CLZA 3MEDA 3G2XA 5KT3A 2MGZA 4DV3J 4IFVA 5KFFA 2V63A 3AA9A 1R8BA 1REVB 1FF2A 1HWJA 3CIZA 3DDNA 3TUIC 1S97A 3ZZYA 4OZ1A 1SIWB 3NS7B 4ECSA 5E5NA 5E3PA 3JTNA 1H98A 4NLUA 4CM2A 2PMZD 4XK8C 1D1UA 1UW4A 3H4BA 3EDRB 1M5OC 1S79A 2QL7B 2HWHA 2XSJA 4EZ9A 3RB3A 1GAOA 3SQGA 5EWFA 2LFVA 4K4UA 3VF0B 4I2PA 3W9HA 3VTIA 4RW7B 2VFSA 2QRRA 3H42A 2CFXA 4ID5A 1UVMA 4MIBA 4ED6A 2EG2A 3VCDA 3UR3C 3KLFA 1O5JA 4KGVB 4UY85 2WTFA 2VIHA 3QJJA 2ASDA 2RHQB 4MT1A 2HNYA 5LOQA 4DV2J 3QRRA 3CJ3A 3NAHA 2DNHA 1AZSB 4P2FA 4FKYA 3Q8RB 4IOBA 1PKUA 4ECUA 1BUXA 2DNLA 4L72B 5F8LA 3BKTA 4CDIA 1GQEA 3PCOB 2DH8A 3KJVA 2Q79A 5MAOA 2R7WA 2EC0A 2W8KA 4CO0A 5J2PA 2HRYA 3LWLA 5GMEA 1UAWA 2NSBA 4N77A 3SYZA 4NCGB 1NJZA 2MTLA 5A76A 1P9QC 3ICLA 3CJQA 3KDOA 1Q95G 3LGNA 2XYGB 4DU7A 1F2HA 3IN5A 4LF6J 2VQEJ 2QO3A 4ED4A 4O3RA 4QR0A 2GO8A 1NSAA 3GJTB 2MPUA 3GIMA 1HWLA 2M52A 4C11A 2VG7A 1RU2A 5GVQA 2HHTA 1DAXA 1KBRA 2DGXA 2EBEA 3QGGA 3SV3A 4WFXA 4HI1A 4MIAA 2LDIA 3NNHA 2CZVC 3SCKE 1QUPA 1HQUB 1N5SA 1MMDA 1BQMA 2BJ3A 4OQJA 2MJNA 1TL1B 3KLIB 1NDCA 4CYUB 4NXMF 1MROB 3BKFA 4YHHF 2C3OA 2WOMA 3GZ7A 3L7OA 1HQEB 2OPPA 2WVFA 1KLMB 1MW7A 3I0SA 2CPYA 3D3BJ 3UD4P 4A48A 4F2RA 3HX9A 4HT7A 5CABA 2YKAA 4DSKA 3HFZB 1GMVA 3H5SA 1VQSA 1SKRA 5CCMA 1XR5A 3GYXB 4YOEA 1X9WA 4IH5A 1RT6B 3UCZP 4DL7A 2JLGA 1XWLA 2WAQD 3RB0A 2MB0B 3CDAA 3FCVA 1TAUA 3M2VA 4HDHA 4DBQA 4K4SA 5F8IA 3KUHA 1JXLA 1K1QA 2IIHA 3DGPA 4B9UA 2PD1A 2CQ2A 2BDPA 1M5HA 5KFOA 1UJ4A 2K06A 4UOFA 1IR0A 3W64A 5IOLA 1U49A 4BWMA 2V8PA 2VOOA 5GMDA 1A0OB 1NH8A 2BM0A 4M1KA 6FDRA 1M1GA 5KFJA 3H7HB 1QM9A 5KFHA 2KJWA 2MLYA 2EFVA 3Q83A 3QWUA 2HHPA 4ED8A 1YJUA 3LUYA 2B4VA 4GKJF 5DJBA 3QRQA 5ETRA 1X4EA 2C2RA 4KYZA 2XNQA 4NI2A 5CXTA 3HSJA 3EDQB 4FNHA 2P9EA 4H4KC 4KT0C 3BGRA 5HJYA 2K7KA 3I9ZA 1NMEB 1FE0A 1VRUA 1NLKL 4ED3A 4KV8B 3T1HJ 4Z2XA 1FXLA 1N8RT 4OV6A 1WELA 5A6PA 4ENOA 4J9KA 3BSNA 1NK7A 2QX0A 1LWEA 1YDLA 1TKXB 3MECB 4FPRA 2QA1A 2JEJA 3PKMA 2E9RX 4FVCA 4XAKA 4JI5J 1XN9A 4YR3A 4FF3A 4JI7F 1HIYA 1ZAWA 1KWMA 2XYPB 2IDEA 3M05A 2BRLA 3MAAA 2R7TA 3M2RB 1B70B 3PHTA 3R1LA 3THVA 4M5JA 5FDLA 4KFBA 4M5DB 2WRMA 1L3TA 1RLCL 2HZAA 2Z0GA 3GFXA 2QL9B 1XNQF 3MGJA 5EWEA 2LQ5A 2E1CA 2NCKL 2KHDA 5K8OA 2W4PA 4NLRA 4I67A 1RWPB 2CQ0A 2FLNA 1N32J 4EYIB 3TVKA 1WDDA 5KFZA 1NJYA 5IT4A 4FYVB 2J76E 3G82B 2HHWA 3VAJA 2RDDA 1CS4B 4X65J 1C1CA 1HBUA 4LF5F 4IH7A 1K9MT 5F8MA 4WFZA 2D74B 2VV5A 2KRBA 4ZJLA 1Q86T 1SJRA 2Q66A 2OPQB 3BM7A 4K4YA 3OHBA 3I55S 4OLPA 1U7LA 2Y1IA 2LDYA 2MKHA 5H9EJ 2KG1A 5LMUJ 2BW7A 3IA0A 3Q8UA 1FK9A 1VGYA 4OX6A 2I2YA 3P96A 5I3UA 4IR1A 3RZAA 1TVRB 4ECWA 3I96A 3OR1B 2RSQA 4K4TA 3T6BA 4EI2A 3FSYA 4IR9A 5J2QB 2OTLS 1E6VB 2CVIA 4J91A 3W3SA 3L3CA 3G71S 1F60B 4TY8A 2ZWOA 2IBOA 2UV8A 1TMMA 2MKCA 1GTHA 4G6VB 3THTA 2ROGA 5F8JA 3PYGA 3TAQA 2O67A 5KG0A 2KN4A 1RAIB 3W61A 1VK8A 2DH7A 1RQ0A 2VG6B 2FVPA 4K8RA 3IRXA 4OI3A 1G1XA 6AT1B 3GLJA 2XZWA 3G86A 5KAKA 4WTYA 5A6WA 3T1YF 4W4MA 3ILIA 1VQ8S 4F7VA 4ECTA 4UUXA 4TU8A 2RAQA 2F4FA 3H2VE 3TVZA 3VVUA 4P72A 4Q0BA 4B17A 3NLCA 2Z2ZA 5E7OB 5T7LA 1BGXT 4F3MA 2AEMA 4UOHA 2DXDA 5ETSA 4F4AA 4WTOB 2A1BA 2RRNA 1T9TA 3W9IA 3MMAA 2PFFB 2K2PA 2IVMA 2B51A 4N56A 2CAJA 2W9CA 3ISND 2BE9B 3W63A 3HHKA 1D9FA 2KFYA 3K8WA 2IJRA 1UJ6A 5LSRA 5I3QA 4XIUA 3OL9A 3J7YU 1E6YB 4O3SA 4X4VA 2WVEA 3CCSS 4CWBA 4NLSA 3VAKA 2AJ2A 4I56A 3WIUA 1TQLA 4FN5A 1JJ2R 1YHQS 2MSTA 2MZTA 5IM0A 2R7UA 4H54A 3C14B 2CJBA 4U7CA 1FJGJ 5U47A 1H73A 3MEKA 4NOHA 1NJWA 4ER8A 5E3QA 5HQMA 1MNEA 3OXLA 4LJMA 4PG8A 2XMAA 4ES3A 3LP2A 1AROP 1XK8A 4RW6B 3TX8A 1QTNB 1N36F 4ILLA 1YZ6A 4QIWD 5B0GA 2DY9A 3CCUS 1TTHB 6FD1A 1PJ6A 2C2NA 2BRKA 1S4EA 2A3JA 3OFHA 2AZ1A 5F41A 3HVTA 2O1PA 1P27B 4JV2A 1JNRB 4UF4A 4P6QA 3HSDA 2IM1A 1KTVA 4ZPVR 4ZVQB 3S1TA 3RAXA 1ZYQA 1WORA 2KO1A 4Q8FA 4LFCJ 2RDJA 3TANA 1RTHA 3JAMU 1TR0A 2EXUA 2NPFA 2GHWA 4W98A 4A47A 3V6DB 3BV8A 2APOA 1JLBA 4DSJA 4QIFA 2ZBPA 3QT7A 2NQPA 3KLHA 3S8SA 2J7WA 3AB4B 3SCIE 2E5HA 3UN5A 4QWBA 1IBLJ 3BR8A 3NL0A 2UXDF 4DR7J 2ZVSA 2XNRA 3JTOA 4DCOB 3PEJA 1R31A 3HK2A 4USJC 2W9BB 2FY8A 2FVRA 3D6HB 2W9AA 3OJUA 1JLEA 2RU9A 4RNMA 3MM7A 3CC7S 1RA7A 2H51B 2RQCA 4KAIA 3KLEA 4RUBA 1TV6A 4EWTA 5J2MB 4JB8B 3T3FA 4IFYA 1KS2A 3KLGA 2XEXA 4LBPA 3DLJA 2DRDA 3CO0P 2J0WA 3CD7A 1V3ZA 4HACA 4O0IA 1R43A 4MFBA 5GADI 3JAMY 3KK2B 1EQMA 4PQUA 1RWWB 3MMCB 4HI2A 1Q8KA 2PC6A 4TNOA 1IM4A 1WDTA 5D8HB 2HQ3A 1U0HB 4O0NA 3TEHB 1Q82T 1VQ7S 1OSCA 2XHCA 1SKWA 2YWFA 1RSCA 2LKZA 3P4UB 1T94A 1C0UA 4O4GB 2XQCA 4FYDA 2QEXS 4AQYJ 1U25A 1UETA 3RW6A 1C4AA 3TJ8A 1SH3A 1TL7B 1VQPS 1PYSB 3FFIA 3CDEA 1HQ2A 2GQQA 2WONB 1LW0A 1EX8A 4HR2A 3PW7A 2HFVA 1CBKA 1SBRA 2QLFB 2R8KA 2H48B 2MQ8A 3TX0A 2XO7A 5I4MA 2Q1LA 3TYTA 4BC9A 3EZUA 1WEYA 4HL9A 3CIMA 1V5VA 4DL6A 4DR2J 2QA4G 1NCLA 4M94A 5DDOC 1RWNB 4J9RA 3MPWA 3CDBA 2RS2A 3OL8A 2C3YA 1U6ZA 4I69A 5GAHI 1QDUB 4NLYA 3RGIA 4RW4B 4C3LA 4I2QB 4ICLB 1N33F 2DITA 5M2UA 1YSJA 2D1CA 4DI6A 2BM1A 2D7SA 5GAGI 4NLGA 1S6QA 4F0MA 1GH8A 1HBMA 1H3DA 1N5QA 5E33A 2L9NA 3CGIA 3ITHB 3CVKA 3NKYA 4YB6A 2MHEA 3D1HA 5K14B 2EK6A 2XHWA 4H4OA 1N5YB 1KFSA 4AL5A 2UXBF 1Y9OA 1SUQA 2BX6A 4DG1B 1R0AA 1KKHA 2I5JB 2NXJA 2B5JB 4HVZA 4M5IA 2R7OA 2CPIA 1CEZA 4B3RF 2P9GA 1RWOB 3FEYB 2OMOA 1UL3A 1R89A 5C24A 3R7SB 2ZBQA 1FD2A 1PILA 2WSCC 2Z2YB 4K0KJ 3EZ5A 2GA7A 4AD6A 4ED2A 4NXNJ 2HW3A 3DU6A 2IAJB 1DHMA 3QYYA 4K4XA 3QT8A 3RBXA 5IV3A 3FMBA 2EVZA 2J8SA 3GB0A 3KNAA 2R7SA 2VF3A 4DV4J 4DUZF 4RU2A 2CQDA 4DV5F 5J2NB 2QG9B 1B0TA 4LBIA 4NYOA 2GJFA 4ILRA 5HQ8A 1C2PA 3DC2A 5J1PA 4OIXA 4PG7A 4MAKA 4A8YA 1FXRA 4J9OA 1N88A 2HWTA 4HLBA 2D41A 4OZ2A 3H90A 5KT7A 4OZ3A 4QYZK 5A8RB 1KEKA 1RA6A 1QSLA 5KG3A 2EKYA 3E01B 3DNCA 1RZMA 2PFDA 2NYIA 3UE2A 4WXOA 3PG9A 4J7CA 3HD1A 1KQFB 2DT9A 3D0IE 4ELTA 1VMBA 1GXTA 1T3NA 2N4DA 2XO6A 4ZP8A 2NUUG 4K7QA 4X4QA 3W2WB 1NKBA 1BHNA 4CLUA 4ECZA 3TUJC 4YY3J 2GIRA 1T9VA 4U96A 5KG6A 3QAEA 3OSNA 4X4OA 5KFQA 3U02A 3GSIA 3MZIA 1RHUB 2RH3A 5ETQA 4X84A 5T14A 3M8QB 2CQCA 3VAIA 1CULB 2CJ9A 3MUTP 2E9ZA 4WJBA 3ZZZA 1ACMB 3QPIA 1EB0A 2UUBF 3ZZTA 2BV3A 4C2MA 1RT3B 2GNKA 3IS9B 3AY0A 5AXNA 1N6QA 2QMXA 1APSA 2OSRA 1RLDA 1PCAA 3K2YA 4FXVA 5JVGQ 3I4PA 1Q8LA 1FX2A 2BJ7A 3W5XA 4ZOSA 4B3TJ 4UT4A 1I94F 3EICA 1H2TZ 1LWFA 4Y2AA 2OO4A 1RTJB 3P3DA 4LF8J 2ROEA 4RX6A 4AXIA 1PC5A 3IR7B 1C4CA 2HWIA 2ZBIA 1MMLA 1JLQA 1GMUA 3MMBA 4KO0B 4Z7YA 1H6KX 1IKXB 5KG1A 2RUGA 2R2TA 5A8KA 2YKNA 3I5CA 2ZOGA 1QJHA 3RG6A 4FKXA 3AODA 4PPZA 2IRXA 3ZFVA 3LWMA 1S1TB 3SIPB 2CRLA 1B0PA 4ZVEA 2M5YA 1XQIA 3A3PB 2KZMA 2IRYA 3DOMB 1XR7A 3DOLB 4RW8A 2BQRA 3R5DA 1FNMA 1ZPVA 2BKNA 2OP5A 3T5JA 1S0OA 2GHPA 3M2UB 3ELHA 1S1XB 3H20A 4J9MA 1LWXA 3MM6A 2B4UA 5F9NA 4LR8A 2RE1A 3PEHA 2ZOFA 5KFMA 2V8DA 4GC7A 2LEAA 2GQCA 2UU9F 1BC6A 4U6PA 2F9JA 1YGYA 8AT1B 3QZ8A 2D3UA 2ALZA 4DR1F 1RAGB 4WP8A 1HLWA 2YKOA 2DGVA 5F8NA 1N0UA 3BYRA 3UO0A 4G1QB 2ZVIA 3AJ1A 2D69A 1WOSA 3R2CJ 2ZH4A 5D3GA 1FWLA 5L8RC 2HNZA 2W2NP 3J7ZT 1IKWA 4CNYA 3M1VB 1KHVA 2HZVA 1EETB 2HBYB 2OH2A 5HROB 3K5OA 4YDDB 1NUEA 1TKDA 3MM8A 1CSJA 1K44A 1FERA 1S1WB 3LPYA 4RR5A 3DLKA 2FUG9 2XZDB 1V5IB 3R27A 1K8AT 2IFXA 1NDKA 3V4IA 4C6AA 4LF4F 3SSQA 2DR6A 4C8ZA 2X1AA 5F3TA 2D3OR 2M4MA 3TI0A 3QIPA 1B0VA 5I3PA 1FVQA 4IH6A 2UP1A 5KFVA 1QSYA 1KOHA 2P8IA 2WCXA 1X0PA 3ZTPA 2V0NA 1B99A 1NKEA 2KZZA 3QMQA 3KTQA 2NXCA 2KFZA 2R8JA 3ZC4A 2ZITA 3GIJA 5KFRA 1KN6A 3CE8A 3FRYA 1TFYA 4DX5A 1GTEA 1QVFR 3NGKA 2HZCA 1L3VA 3OVSA 1RT5A 3LP0A 2MQPA 2H4WB 1NKCA 2Y0SD 3QFWA 3EVMA 2BVZA 2XLKA 3VWSA 3RBEA 2KVIA 3IBWA 1S6PB 3SCLE 3QNWB 5DDPC 3C6TB 3O8WA 1O8BA 3MI7X 3DRRB 2PMHA 2AT1B 3FRZA 1NNDA 3RTVA 5CZVA 4PXEA 3V81A 4B9TA 3PJ9A 2E7WA 2IY5B 3W5YA 3MR2A 5C2GA 4QW9A 1IWGA 2BOAA 4LIWA 1J5OB 4U9RA 1EARA 2QN6B 2WBRA 3OT9A 1XTZA 1RK8A 1H72C 2GJIA 2OEMA 3PJWA 3LO3A 4JI3J 1O0PA 4F67A 2Y8YA 3ZZRA 4OFZA 4KIAA 2RT3A 1SQEA 1RTDB 3UDLA 2IA6A 3BBFA 3VHQA 2BABA 5IWAJ 3I82A 2OPRB 3E3XA 4Q2MA 1KR4A 2OSQA 5KOXA 3F73A 2DEJA 1KFDA 3BO3A 3KHRA 2V34A 1U26A 1UMJA 4K4WA 2GAHC 5M2RA 2BQ3A 5GAEI 2CDRB 4KH1B 1M5VC 1RTIA 1NU4A 1HMVB 2CPHA 2HHHF 2RKIB 2ZM6J 2OPSA 3P8BB 9ATCB 4QPTA 3IR5B 2J8AA 2HK2A 1FKOB 1G4CA 3KXDA 4PWUA 5HP1B 2L3MA 4HHJA 2MZRA 4L76A 4U95A 4NA2A 5CA5A 1WG1A 4ZIWA 3CJ4A 4HTIA 4DR4J 3FSXA 3UN3A 1DJ0A 2DBBA 3DDKA 4P9SA 2ADBA 4F4XA 4HHHA 2L48A 5CD4H 4NZ7A 1YJVA 4LF7J 4F0KA 2KT2A 2JHEA 4IG0A 2VASA 1LW2A 2Z30B 3NEKA 5F3ZA 3PR5B 4PXCA 4LFAF 2BANA 2VBWA 1NPRA 2Z58B 3I6PA 1DBDA 2MY8A 3MM5B 4C98A 3GIIA 3JYTB 5K8PA 2AEFA 3BDEA 1HWKA 3GQCA 1TL3A 1GEHA 5K8MA 5LL6d 4RUAA 1LV5A 4ZLNA 1CJKA 3DGVA 3GE9A 4OZJA 2F7VA 5L1JA 4Z37A 3T5LA 1UFLA 1NZ8A 9RUBA 4KGMA 2JLFA 1ZA2B 3ILJA 5HATA 1NK9A 1FRXA 2DYAA 4N8NA 4JYAF 4ZP7A 1X4DA 4OMFG 4EU0A 5LMNF 2FDNA 1L3KA 1YIJS 1VLYA 3CCLS 1YX2A 4F04B 2J9EA 1HA1A 4ECXA 1NK5A 2R2UA 4WFBQ 4YDXA 4J90A 2A6MA 4ZP6A 3KHHA 3U1NA 3N0VA 3PNIA 2DR8A 2HLUA 4KRWA 4OJGA 1RHQB 3TZYA 2HS4A 3KOAA 3W8GA 1LFPA 1WEZA 2UVWA 2BR0A 5J1EA 1J5EJ 1D09B 3WBZA 2XULA 1SQGA 3MCNA 4IFVB 1YQHA 1YJWS 5B0DA 2HSEB 1DQ8A 3EZOA 1HI0P 4OYZA 1Q7LB 2BJ9A 1FNOA 1U45A 1AA1B 1GMWD 2DR5A 2FQQB 4RW9A 2BXJA 4XTTA 4URQU 1WOOA 2VG5A 3E51A 2ZJRQ 1M1HA 2RILA 2VODA 3OTDA 4ZIVA 2JJ4D 2F4VF 4DFJA 5F9LA 3AOAA 3R1HA 2KL8A 3AD8C 4CTAA 2Y9HA 5DGBA 2BEFA 2V9KA 1HHSA 3CCQS 3CCVS 2NXEA 3M8SA 1C0TB 2U1AA 4I2PB 4B3OB 1F3FA 4N5SA 1NAQA 3WQPA 3DM2B 3QLHB 5AXKA 3GILA 5RUBA 2XS5A 1NJIT 3KLFB 1IXKA 2IM3A 3K5LA 2CQPA 2HNYB 3BBCA 3CJSA 1TMJA 5DM7Q 3MUVP 1YJNS 2MKYA 3L95X 4O44A 2RQMA 3EM1A 4U8VA 2VFTA 3Q23A 1FRIA 4DPOA 1U47A 2HFSA 1Y3KA 3R5GA 3MAHA 1DQ9A 4YS2A 3M8ZA 1HNWJ 5K20B 4ZPDA 3D2WA 4GVBB 3MTJA 3N6MA 2E1RA 4A8QA 5J2PB 4G1PA 4DSIA 2AJFE 3GCXP 5CYQA 2AJ4A 3BYPA 3BQ2A 1VC5A 2BBEA 4TVAB 3CDUA 2PIIA 1KNZA 2NXNA 2N4CA 4RW7A 3VAMA 2IHR1 2ZBCA 2HGNA 3M6UA 4HH0A 3B82A 1CC7A 1XNRJ 5D4LA 4NZ6A 1S7HA 1Y7PA 1YITS 2GC8A 4X66F 2ZE2B 5HO4A 3MOJB 5EN1A 1RAAB 1EP4A 1T03B 2ZJPQ 5KFEA 1VDHA 3C66A 1AZSA 3O5TB 1X5TA 2OD6A 4UQGA 1RHKB 2RQ4A 2QV6A 3LTOA 3L7PA 3FZ2A 2XZTB 2RB7A 1KRPA 2DGUA 4JOUA 4CNZA 2EC2A 3HI9A 2XMJA 2LEBA 1CJUA 1BQMB 3GR1A 4F36A 2GVDA 3IC1A 3SFGA 2ZFHA 3HCXA 5JJBA 5HI7A 1UEUA 5CZXA 2ZH3A 4NCGA 4DV1J 2C3MA 4JV5J 4KR0B 4WE1A 1IBMF 4JI2F 4IKAA 4OHZA 4RUHA 4USWA 3IBCB 2DGQA 4H4MB 1UFWA 2WOMB 2OPPB 2O3DA 3TQ1A 2GGPA 2VU5A 3MEEA 3DLGB 2VH7A 2G2ZA 3I0SB 1XMQF 1U4BA 2PN6A 2XI3A 2KM8C 2K8GA 2IYIA 5FD1A 4QR1A 4OX7A 1HBOA 2NS1B 1T8EA 2V4RA 4DR5J 2C2ZB 2FLLA 3RB4A 3PV8A 2DNQA 2JL9A 1RAEB 3LH2S 1I6JA 4PG4A 1WF2A 2HQFA 4OJ1A 4OLOA 4IYQA 4GKKF 1VBYA 1R6YA 4R8UA 2HNDB 1HQUA 4LVNP 3DKDA 4ZVPB 2B4PA 1TL1A 3KLIA 1SXLA 5IS2A 4DR6J 1NJXA 1GXLA 5HL7Q 2J9DE 2F5GA 1XMOF 1DTQB 1SJ1A 2ZDPA 1WC1A 4Q44A 2FJXA 5HQLA 2KXFA 3IRWP 4K59A 3V5RA 4TLQA 1NK0A 2V68A 4A8SA 1VQ5S 4UW2A 3IMQJ 2G0CA 2CQGA 2JVOA 1PGZA 2FJDB 3NMAA 3FJ2A 3MCMA 2H5EA 4P2SA 4X4PA 1HWUA 3O3LA 1QSSA 3TAPA 2G2YA 2IMWP 2LQJA 4RNFA 2ALYB 1VRUB 5LJ5Y 4F25A 2YWWA 5L1IA 3D5MA 3CMAS 4CO1A 1N54B 5THWA 1BWEA 1ZTTA 2F9DA 2R9LA 2B4OA 3SSRA 2B6AA 1TUGB 3B8HA 5B09A 2E5GA 1RKJA 4CRJA 3VALA 4DSFA 1IR2A 2IRUA 4MJKA 3CC2S 1TL5A 3FQKA 1VLOA 4X4RA 2R2RA 5EGYA 4JI1F 4DDFA 4PPDA 2V67A 3W2VA 2MMYA 1I51B 4BHQA 2HQDA 2HBRB 2FJAB 7AT1B 4DEZA 3VVTA 2N7YA 2BJEA 3T9ZA 4JI6J 4NLDA 3MAAB 1B7YB 2CJXB 1PO6A 4KHRA 2BOPA 2DRBA 3RBZA 3G87A 2DR9A 3MPDA 2ZOMA 1TAQA 1TK8A 5FLXU 2XMVA 3MD1A 4LRFA 1RT2A 4KV8A 2A10A 1RYSA 2GMLA 3TZXA 4UZCA 1N34F 2BJ1A 2CIMA 4B3MF 5KT2A 2F63A 3A3NB 2HAIA 4RO0A 3K17A 2DO0A 2QSFA 1UZDA 1TKXA 2YKQA 3MECA 1T11A 3VQSA 2YNGB 1GXUA 4K4ZA 3AOBA 2VBZA 1REGX 2XS7A 4OJHA 2YQ1A 3J7Z5 2DK2A 5I42B 3O1LA 4ZPAA 2E5LJ 1CVJA 2X51A 2IVFB 3OW2R 1U09A 5FLXY 1NSPA 5DZ6A 2A2DA 2MLXA 3DYAA 3F44A 3M2RA 3OUYA 2OJ3A 4UZBA 2ZWPA 5D4NA 2FC8A 4M5DA 2L9WA 3EXYA 1JK9B 2CDQA 4CLFA 5DLFA 2IA0A 5ITHA 1PSDA 3CXCR 1NPPA 4HT5A 2FJEB 2YY3A 3C46A 2KKHA 2RRBA 4M63A 1WI6A 5BXIA 2WW8A 4F26A 2YPYA 1WNEA 1AFJA 5DS7A 2B8QA 3ZNUA 4DUTA 3H2UB 1BY9A 1OYEA 2HHUA 1JJHA 4MK8A 4GO5X 4K2JA 1X5PA 2AZ3A 5AE3A 4DSEA 4F50A 1RCXB 3U27A 1IKYB 2WK4A 3Q8PB 3IRXB 2BMBA 2N82B 2VOPA 4K2XA 1T95A 4QU7A 3HHLC 2Y8WA 5C42A 1P6TA 4M5NA 4M95A 3AB2B 2KT3A 3TAMB 1ZM4A 4X62J 5T7LB 1TVRA 2Z57B 3PKYA 4Q2LA 3O44A 4RWWA 4CH7A 3NRBA 2CPEA 2P5VA 5B0CA 3MMAB 2F8MA 5KFBA 5IT0A 5J2QA 1N0VC 1E6VA 3K5PA 2Y1RI 2HVZA 7FDRA 5HAOA 3EGWB 4USUA 1RBAA 2CNLB 4PRFA 4PXDA 3I5AA 1FI4A 5IC6B 2LEPA 3HFVA 3TA1A 3AT1B 1MLAA 3HF5A 3FNNA 4RZRA 3GV7B 4C4WA 4DQQA 1ZETA 5IM0B 2ZH1A 1RTZA 3W62A 4MKYA 5EWGA 2Z4PA 2W8LA 1LQ9A 1DFDA 3CPWR 3NGSA 3US5A 2OUGA 1LWCB 4G3IA 4ZPCA 1PG5B 2JRSA 2LP4A 4W92B 5HN0A 4X66J 2XGPA 3H4DA 3PZPA 2IC3A 4X64F 1KDNA 3LP2B 3NGRA 2VJVA 2LLZA 5KFCA 1WSRA 5ETNA 1HW9A 2CQBA 4DU8A 3BPDA 4DLGA 2HK3A 3QJPA 2Y0BB 5C25A 4WU3A 3G8QA 1M90T 1MWQA 1AFIA 1Q81T 2XB2D 2VFVA 3RJMB 4O4RA 2KYXA 8ATCB 4B3SJ 1A6LA 1U1QA 2B9WA 3H2LA 4DUYF 5JMNA 2Z56B 4RNNA 4GC6A 2HIQA 4LSNA 3A8KA 2EFPA 2XY6A 3C14A 4WK1A 1RTHB 4IOAQ 4EUVA 4OL8A 1SH2A 3KLHB 4NA3A 3BN4A 4ED7A 3OSPA 2AYEA 2E66A 2MSSA 1NHKL 1ZAVA 5CH7B 3I9V9 3LF0A 4DQSA 4FF4A 5AJ3F 3DU5A 2FB0A 3UD3P 3OR2A 1JLCB 2V4JB 3OHAA 2PI5A 4RW6A 5E3AA 1Q79A 4DV0J 5AT1B 4ZVGA 3GIRA 1TV6B 2KRRA 3G6VA 3DDIA 3MDFA 4DV6J 2X3GA 3CEDA 3KLGB 1ZBTA 4ZHRB 2MXYA 2M2BA 4HACB 4LF9J 2J0SD 2DNYA 4HH1A 2C2MB 1JKHA 3R7NB 4DX6A 2O01C 1HYSA 2H1YA 3WIVA 4PQUB 4EZ6A 2KXHA 4LT6A 3C15A 1IBKF 2F65A 3VZIA 4LQ9A 5F0UA 4A8XA 5ADZA 4LFBJ 2F8EX 2M9KA 4R0EA 3KK1A 5DO2A 2IJNA 2R7VA 1JWWA 1V9OA 4OX9F 4CO2A 5H9FJ 4DPXA 5HANA 3FFIB 3WX8A 1JB0C 2CADA 1LW0B 2K3KA 2PSZA 3K89A 4TY9A 3GV5B 1OIAA 1VRTA 3AFGA 5BR8F 2G0JA 1NH7A 5KFSA 2E29A 3CCMS 4NLXA 1WTBA 4NRUA 4ZVTB 4DZDA 2IJFA 4O3PA 2DPJA 3J81U 3DRSA 3HD2A 4PYDA 4K5SA 4NCBA 2Z2MA 3RUBL 2P2CB 4ECQA 4IO9Q 3KK2A 1HHTP 4Y28C 3QZ7A 1S1VB 4J9LA 3H8YA 3GJSB 5IQQA 3UNGC 1OPZA 3QO9B 1EIYB 3RBDA 2DTJA 1OPIA 2W25A 1YJRA 3PHEA 3HSZA 2CKWA 3GYNA 3RYLA 3FBFA 5HMXA 4X2BA 1RT7A 1EAYC 3NXZA 1P1TA 1HBMB 3H5UA 2YKMA 1IJFB 2POKA 2MJUA 2WONA 1Y5LB 5ETMA 2LECA 3J81Y 4ZITA 3D6FB 1SUQB 3RR7A 3Q8QB 3X3UA 1S77D 2JLEA 1YJ7A 4UY8T 1UCNA 3AD7C 2RS8A 2ATCB 3MUMP 4NASA 1RT1B 4ITSA 2P6SA 2ILZA 2CA9A 1N34J 3QFHA 4WIQA 3ULHA 5CQGA 4F02A 4LSLB 1RHJB 2J7KA 1WACA 3DRPA 2GW8A 4ZCMA 2HRUA 3K58A 3C16B 1CLFA 1RAHB 3VGSA 4NMXA 3NGUA 4L3KA 1X5SA 1IQTA 4RW4A 4I2QA 1FNXH 2MQQA 4N8OA 3WZ0A 2M0GB 1W2IA 1FKPA 4RBUA 3K57A 4XPCA 3ZO7A 4DLEA 2E7XA 5GADU 3FMWA 2HHQA 2PA8D 1QVGR 1H7WA 2PDAA 3ITHA 5K8NA 2CNKB 1F9EB 2HKEA 3AD9C 3LP1B 5K14A 3D9BA 2VQFJ 1TFWA 1N5YA 3X1LB 1W25A 2CPFA 1OWXA 2ASLA 2G2OA 4ZMMA 2CQ3A 1HNXF 2VDIA 3AQPA 1FFGB 1WC4A 2RF2B 2NZCA 2XMMA 4DL2A 2EW9A 1HI1A 4RU9A 3TW0A 4ERDA 4ELUA 3N4WA 2GS8A 5HSPA 1NRKA 1U2FA 2IAJA 3R5JB 3D7SB 4DQRA 3KUEA 3CSKA 3A13A 2K1RB 1RE1B 1C1BB 2YNFB 3ZXWA 3JSYA 1DTTB 2E9TA 4R5PB 2J9CA 3HULA 1HPZA 2PA3A 2FHJD 5L9XA 5JXSA 4F3QA 5J2NA 3PY8A 4ZN3A 4WZQA 5DRKA 4PUOA 3MM9A 1G2EA 2YX7A 2AYMA 5GAHU 3PYDA 4JI0J 2AMCB 3FSIA 4JI8J 1OSDA 1HFEL 3FEZA 2DHXA 4P75A 4Y2IA 4DV7J 2COLA 2C1EB 1S9EA 1N6QB 1FDBA 5A8RA 3GFZA 5GAGU 5M2PA 3E01A 1IUJA 2X7IA 3OFFA 4JUZA 2HBQB 3NOCA 4F2SA 2VFUA 4C9DA 2WW4A 5IFMA 3R3TA 3LA0A 2H3EB 4KHPF 3DLEB 1DLOA 1LWFB 2HQIA 1RHMB 3IBFB 3TUPA 1WC0A 3H59A 3W2WA 1EQ0A 4NLPA 1D0EA 3Q24A 3ILOA 3BKUA 2CVEA 1T0TV 2XCAA 4IQXA 3TNVA 2Q6CA 3EMTA 3BBBA 3M8PB 1GFWB 1X0FA 3DI6B 3ETOA 3NGDA 3M9NB 4Y00A 1K0TA 1HW8A 2AGPA 2XGQA 1VOMA 1NBEB 1CULA 4DR3J 3OTOJ 2HFUA 5D4OA 4C0BA 4YEAA 3OBIA 3H5YA 1KVJA 2QLWA 4IG3B 4RUCA 1BLUA 3AJ2A 1H2UX 1MU2A 4A46A 1RT3A 4CM0A 2B7CB 1MG7A 4JV1A 3C6UB 2CZ4A 1VCTA 4X64J 2EI5A 1MSWD 1CJTB 2OIHA 1VQ6S 4KPCA 3W5ZA 4WZMA 3BR9A 1S4FA 1VQNS 2FHJA 2MKKA 1F1BB 3A4TA 2HS3A 4OZNA 4TYAA 2IM2A 3GSDA 3LW5C 1RWMB 2X1GA 3W7BA 5DDRC 2UXCJ 1QAJA 1RTJA 3PW2A 3A8JA 1U6FA 2XSFA 1MWYA 4M5KA 4E98A 5D4PA 4K4VA 4DSLA 5A0YB 4ZLJA 3ETMA 3IXQA 1IKXA 1VQOS 2D9PA 4RKUC 1ZM9A 1Y5IB 2MZ1A 1N52B 2OD4A 4WCEQ 2F1FA 1FO1A 4CI0B 3G8TA 4OV1A 1X4GA 4URSA 4I6AA 4D3GA 3S7RA 4B02A 5B0EA 3ONQA 1N5TA 4PQAA 2H4YB 2W7OA 3CWJA 5J1NA 4ANDA 3NCPA 3VAHA 2LU1A 4HKQA 1VQYA 4YUDA 1CJVA 1YRUA 3UI3A 4DV2F 1QTMA 1PYOB 3DMJA 3W60A 4HYKA 1HNZJ 1WF0A 4OX8A 3RRKA 1Y11A 4M5GA 3GG1A 2O66A 4KH0B 3DOMA 3DLKB 1PBAA 4KQZA 1S1XA 5CYJA 3AOCA 4AYBD 1F0XA 3W9JA 3H0PA 1VFJA 3V4IB 4WP3A 1FRJA 3NAIA 1X4BA 2QGFB 2V8VA 3JSMA 1JLFB 3OL7A 3GCWP 3GYGA 4KTQA 2QA2A 1U8WA 2DB1A 4QQBA 3D6MB 5KFTA 2LQ8A 1IBKJ 4LF6F 2VQEF 5KG2A 1FKAF 1HWIA 3EGZA 4G1QA 1RABB 4BWJA 3OTEA 4X4TA 1WKKA 2HVEA 3M1VA 1N4LA 4RPFA 3PRBA 4F4YA 3LP0B 3JS9A 5FJ4A 1BQNB 3ISZA 3WC0A 2PEHA 2KJVA 1WI8A 2JH3A 4O3NA 1YZ7A 1BD6A 2M3DA 1N5VA 4YFUA 5IZHA 3BGLA 1X5OA 2OLWA 4WYLA 2W1BA 2OI2A 1RACB 1Y4ZB 3PJXA 3WX4A 5HK4A 3D54A 1KLNA 4DQIA 1UFKA 3UVJA 2WB4A 1S5ZA 3V81B 2WVBA 1Y0HA 1JX4A 2KTQA 2AEJA 5B7WA 4B9MA 4MK9A 1NXIA 5DQIA 1XC9A 3L7UA 1KD1T 4NRTA 4X4NA 1DRZA 4N76A 3IWLA 3HJFA 1NK8A 1HL6A 2DIVA 1A7GE 1WEXA 2FC9A 3NBPA 3HXMA 2VBXA 1T05A 1R8HA 4ZVFA 3I5BA 4B9NA 1RB0A 4TQRA 1ZAXA 5KT5A 1WC3A 4D3HA 3CCRS 2FLPA 3G9CA 4QYRA 4B9VA 3BZQA 2NR0A 3PVXA 3OXFA 3IM9A 3FKBA 2GMHA 1X7VA 4WF9Q 4YB7A 1X60A 1VHFA 3WC2A 2XTJP 4TU9A 1SL0A 1PIEA 3BSOA 1S6PA 4CLSA 1HNVB 2C3UA 1RTIB 4KB7A 4FBTA 5KG7A 2KI2A 2MYFA 2C2DA 3P5TL 1WKJA 1JJCB 2VKRA 3DRRA 3JXOA 1K47A 4FPIA 1D8ZA 2Q43A 3JQMA
chains in the Genus database with same CATH topology
3HSJA 5ETLA 5ETQA 5ETSA 2BMBA 3ILIA 2QX0A 3ILLA 3HCXA 4M5KA 1RAOA 2F63A 3UD5A 1HQ2A 1RTZA 1Q0NA 4M5JA 3HD1A 4F7VA 1EQ0A 1IM6A 3HT0A 3HSGA 4M5GA 3KUEA 1DY3A 1EX8A 2CG8A 3MCNA 1TMMA 1EQMA 3ILOA 3KUHA 3HSDA 1G4CA 3UDVA 1CBKA 5ETKA 5ETTA 5ETPA 4AD6A 5ETVA 4M5HA 4CYUA 1RU2A 2F65A 3MCOA 3HSZA 1RU1A 1F9HA 4M5NA 3ILJA 4CYUB 3MCMA 4M5IA 4M5MA 5ETMA 5ETRA 1TMJA 4CRJA 3QBCA 4CWBA 5ETNA 3UDEA 3KUGA 5ETOA 4M5LA 1RB0A 4PZVA 3IP0A 3HD2A 1HKAA 1KBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSJ A;  5ETL A;  5ETQ A;  5ETS A;  2BMB A;  3ILI A;  2QX0 A;  3ILL A;  3HCX A;  4M5K A;  1RAO A;  2F63 A;  3UD5 A;  1HQ2 A;  1RTZ A;  1Q0N A;  4M5J A;  3HD1 A;  4F7V A;  1EQ0 A;  1IM6 A;  3HT0 A;  3HSG A;  4M5G A;  3KUE A;  1DY3 A;  1EX8 A;  2CG8 A;  3MCN A;  1TMM A;  1EQM A;  3ILO A;  3KUH A;  3HSD A;  1G4C A;  3UDV A;  1CBK A;  5ETK A;  5ETT A;  5ETP A;  4AD6 A;  5ETV A;  4M5H A;  4CYU A;  1RU2 A;  2F65 A;  3MCO A;  3HSZ A;  1RU1 A;  1F9H A;  4M5N A;  3ILJ A;  4CYU B;  3MCM A;  4M5I A;  4M5M A;  5ETM A;  5ETR A;  1TMJ A;  4CRJ A;  3QBC A;  4CWB A;  5ETN A;  3UDE A;  3KUG A;  5ETO A;  4M5L A;  1RB0 A;  4PZV A;  3IP0 A;  3HD2 A;  1HKA A;  1KBR A; 
#chains in the Genus database with same CATH topology
 3TVY A;  3OL6 A;  4ZS6 A;  3HLU A;  2FHM A;  5BYR A;  2HQC A;  3DXS X;  4PCQ A;  2LVW A;  2G13 A;  4KY3 A;  2MQN A;  1R0B G;  3GFH A;  3IGN A;  4NXM J;  3BS9 A;  1J5O A;  4AL7 A;  2VB6 A;  3SEO A;  2AJ1 A;  3NG8 A;  3LAL A;  4YHH J;  4J37 A;  4EGL A;  1RHR B;  2DNM A;  2XI2 A;  4ES1 A;  4U7U K;  3J81 j;  4I7F B;  3I56 S;  3ZZ0 A;  2DJW A;  2R2S A;  3LAN A;  2D3O 1;  1JLG A;  2YKP A;  1VR6 A;  1U02 A;  5D6G A;  4YP3 A;  3N5B A;  3K5M A;  1NK6 A;  4OI0 A;  1O51 A;  3SZ2 A;  4ANC A;  5LXY A;  4DZ6 A;  3T1H F;  3LAK A;  1P8G A;  2LA4 A;  2HG4 A;  1CJK B;  3MEG A;  1FKO A;  1O6X A;  4C97 A;  3DLB A;  2XY7 A;  5G0R A;  3RAM A;  2GQ2 A;  5HP1 A;  4I68 A;  2H5J B;  3VGU A;  2WB1 D;  3G8S A;  4DX8 H;  2MKI A;  2ZUA A;  4JI5 F;  4LF2 A;  3OJS A;  1KQK A;  1X4H A;  2PMW A;  2CG4 A;  3UCG A;  2FY1 A;  3HPO A;  1P9Y A;  1Q4R A;  4TQS A;  4GKJ J;  3GP9 A;  3IG1 B;  4KE5 A;  2H65 B;  3QGH A;  1VS3 A;  4NZ0 A;  3HZG A;  4PZV A;  4XO0 A;  2HGL A;  4ZDN A;  3EPG A;  2AV5 A;  4FXD A;  3EUN A;  1X4F A;  4EEY A;  1QE1 B;  3JYT A;  1VC0 A;  3BN7 A;  3OD2 A;  1K1S A;  1BQX A;  4DCJ B;  5DQG A;  2AX0 A;  1OY8 A;  2HQG A;  2WVD A;  4YR0 A;  4RNH A;  2OGU A;  4PYA A;  1N32 F;  1DZ5 A;  1V3S A;  4ZKA A;  1Q78 A;  1CQM A;  4BC7 A;  4RW9 B;  1NHV A;  4UOC A;  3CCZ A;  1VQL S;  1LK5 A;  1Z1Z A;  5GAE U;  4W90 B;  1D8Y A;  4DXL A;  4OYO A;  4EBE A;  4X65 F;  4CQ1 A;  4KKO B;  1U1O A;  3Q8S B;  1Y10 A;  2LYV A;  3CF5 Q;  2W2O P;  1VHI A;  2EG1 A;  4LRB A;  2XCP A;  4TLR A;  4JI7 J;  5D15 A;  4FYW B;  1L3U A;  1HR0 F;  1LNQ A;  3R9L A;  3CUN A;  4C8O A;  5LMU F;  3G4S S;  2EK1 A;  2VDH A;  2QSW A;  2K3I A;  1TKZ B;  1SPB P;  2RQK A;  3FEX B;  2DGW A;  5SUH A;  3T5K A;  2V94 A;  2N3O A;  1XNQ J;  4O44 B;  4A4J A;  1Y00 A;  3M9O B;  2EFQ A;  2R3V A;  1KC8 T;  1DAR A;  3V2U C;  3W8P A;  4CT8 A;  3ET6 B;  3D28 A;  2AYG A;  1WUU A;  5CAA A;  4QYZ J;  3A8E A;  3TJ9 A;  4QWC A;  3BO2 A;  4OZ5 A;  1F5C A;  4MH8 A;  4BDP A;  5CYQ B;  2G1H A;  4OHV A;  1S9F A;  3OXG A;  4LF5 J;  2E1P A;  4QIV A;  3R97 A;  1DUR A;  2FZC B;  3GPA A;  3HO1 A;  3I0R A;  1H74 A;  3UNY A;  3FCW A;  1XJW B;  5K9F A;  1C0T A;  4OYA A;  4B3O A;  1ZS6 A;  1MWZ A;  1IM6 A;  3K5N A;  2XWX A;  4TYB A;  2QLB B;  3DLL Q;  1NK4 A;  1XIQ A;  1B4S A;  3DM2 A;  3QLH A;  2ZD1 B;  2CQH A;  2DNN A;  2C28 A;  3BQ1 A;  1NHU A;  3VAF A;  3H98 A;  3PW4 A;  1P1L A;  1EP4 B;  4KSE B;  4PWD B;  3TP2 A;  2HHS A;  4GMK A;  1IN0 A;  4WYW A;  3PO5 A;  3TR5 A;  1Q8I A;  4CO5 A;  1KTQ A;  3QT6 A;  2GVZ A;  2R8G A;  4GVB A;  1CJU B;  2MZQ A;  2GVD B;  1GK8 A;  1YK9 A;  3J80 U;  3VR1 A;  1QAX A;  4DFM A;  2CYY A;  2GX8 A;  2QJ3 A;  4AE5 A;  4WE1 B;  5H9F K;  2Z8Q A;  5L46 A;  3G6X A;  1Y5N B;  4USV A;  2QT7 A;  3N6N A;  3QGI A;  4KGZ B;  1FJG F;  4NL5 A;  4M5M A;  2GGP B;  1EHW A;  5KFK A;  3MEE B;  1YKW A;  1NDL A;  3T1Y J;  1NDP A;  5AE1 A;  3PIP Q;  3VGT A;  2MQM A;  4KJI A;  4OYW A;  3GWC A;  4ZLL A;  3L09 A;  2B0G A;  1LXJ A;  4LRE A;  5IV4 A;  2ZE2 A;  4PEO A;  2MZS A;  1S0V A;  2RIJ A;  1T03 A;  1HBO B;  3MXH P;  3D6T B;  3WHI A;  3GFY A;  2VL1 A;  2OML A;  4OYB A;  2L9D A;  2YWK A;  4DL4 A;  3BO4 A;  1V6H A;  3J80 Y;  3PM9 A;  4R8U B;  2PI4 A;  3FBB A;  4L74 A;  3DOK B;  1QY7 A;  1RWX B;  3GJR B;  2B43 A;  4DPU A;  2VJU A;  1IKV A;  4WFY A;  5ETV A;  3D0G E;  3QID A;  1AUD A;  5D0G A;  4H4M A;  1U1M A;  4LFC F;  2I8E A;  2F40 A;  3CT9 A;  5C7P A;  2DKO B;  2AKW B;  4OI1 A;  5KFI A;  3CCJ S;  1U1K A;  3DLG A;  2V2K A;  2RML A;  4M5H A;  5IC4 B;  2FGC A;  3HM9 A;  3CO9 A;  1FEH A;  1UA1 A;  4F4Z A;  1IBL F;  4DR7 F;  1S7I A;  2E5I A;  1HHQ A;  2DR7 A;  2AIR B;  3M32 B;  2VON A;  2VPY B;  3N6L A;  2MQO A;  3HKW A;  2YNI B;  2HMI A;  5LM7 E;  1FDD A;  3PIO Q;  3Q2S C;  5BYQ A;  4ID8 A;  1VC6 A;  1N36 J;  4YR2 A;  3PW5 A;  4NLT A;  2IPO B;  3Q0A A;  1R0C B;  1EJ7 L;  3NOG A;  5ETK A;  1FJ7 A;  1TP7 A;  1WD6 A;  2HND A;  3M30 B;  3Q89 A;  3TA0 A;  2JFD A;  5DDQ C;  3PDN A;  4KPY A;  3F0N A;  2P6T A;  1H0H B;  2B6A B;  3SMZ A;  4URG A;  1T3O A;  2B9X A;  2Z2L A;  3FBE A;  1X9S A;  2BE2 A;  2W7A A;  4I6Y A;  3CCT A;  3POT B;  1DTQ A;  1S48 A;  2WSE C;  3SFU A;  2DGO A;  1PAE X;  1FXD A;  2R8H A;  3JSR A;  4OYI A;  3EE3 A;  2HAF A;  3W2V B;  8RUC A;  2DHS A;  2X1B A;  5HBM A;  3OV7 A;  5A8W A;  4AQY F;  3ENW A;  1X4C A;  2DHG A;  2ZC4 A;  2UXD J;  2CPZ A;  1T9U A;  3CJK B;  4ETZ A;  1WG4 A;  2CXE A;  2AJ0 A;  5IXU A;  5KFP A;  4TU7 A;  2JSX A;  1XER A;  1SV5 A;  1K73 T;  2DIS A;  2R7X A;  4MIW A;  1BXN A;  3NGT A;  2DXE A;  2LXU A;  4LIR A;  1RT2 B;  2W4D A;  4DR2 F;  3V6J A;  4OZ0 A;  3S01 A;  4CCH A;  4UOG A;  3PX4 A;  1ELO A;  2J0Q D;  4TN2 A;  1WOP A;  2ILY A;  1GT8 A;  3EJM A;  3P49 B;  1X9M A;  1LXN A;  3DHW C;  1NSQ A;  3GG0 A;  1SL1 A;  3PFO A;  2CPD A;  1VRQ C;  4IDK A;  4OYX A;  3FUY A;  4O23 A;  1CPZ A;  2K7J A;  2ZEJ A;  1G7C B;  2IDL A;  1S9G B;  4ZCL A;  1H38 A;  1SC4 B;  3MR3 A;  4IO1 A;  1S57 A;  2VKZ G;  2W4C A;  3E2E A;  2PEB A;  1U6B A;  1CG2 A;  2YTC A;  1NPK A;  2ZZM A;  2VBY A;  4YQW A;  2G1D A;  1D3W A;  1KOO A;  3OUY B;  3DYA B;  1FD8 A;  2Q6B A;  4JP8 A;  5KTQ A;  2ZJQ Q;  2H9Z A;  3E8O A;  4QOT A;  1UWA A;  5HVH A;  3KWM A;  1U1N A;  2RHS B;  4K0K F;  5HMY A;  4FVM A;  4WXW A;  1KON A;  4J9S A;  1FRL A;  4NXN F;  4MYT A;  1AXQ A;  2YPZ A;  4WFN Q;  4P2M A;  1XEZ A;  4ZN1 A;  2YNG A;  4P2X A;  3LOU A;  3JQJ A;  2QIF A;  3SV4 A;  4DV4 F;  2C3P A;  1UWB A;  4PKD B;  1N33 J;  1IBC B;  3MPU B;  3TO8 A;  5I42 A;  4EBC A;  3M8Y A;  2CNN B;  5C42 B;  4P74 A;  2UUC F;  2MZJ A;  4DFK A;  3FVY A;  1HR0 J;  2FZG B;  4ZCI A;  4AL6 A;  1UVI A;  1VJW A;  1U24 A;  4C8M A;  3SQO P;  3D67 A;  4MTP A;  2UXB J;  2B7B B;  3UW1 A;  1K0V A;  2FVS A;  4LMZ A;  2QFJ A;  4B3R J;  3CJ2 A;  2IM0 A;  1OO0 B;  5DM6 Q;  4MK7 A;  3MAQ A;  3G6Y A;  3HVR A;  3UWT A;  2CQI A;  2BW2 A;  3BGU A;  5JUM A;  1WKL A;  1S0M A;  2H54 B;  2Y3Y A;  3M6X A;  4F0H A;  3HT3 A;  2VPW B;  5SZT A;  5H9E K;  4WWS A;  4YY3 F;  1VBK A;  1IKY A;  2BJD A;  3AXK A;  3NS5 A;  1QAY A;  4DUZ J;  1EKR A;  1QAI A;  4DV5 J;  2KU7 A;  4DN9 A;  2FPH X;  1Q7Y T;  3HFK A;  1VQ9 S;  5HLF A;  1YWX A;  4USI A;  4N41 A;  2G9O A;  1B3T A;  2EKN A;  3UN2 A;  3GR0 A;  3L4B C;  4DHV A;  2E5J A;  4CLK A;  3TAM A;  3EWG A;  3HHL D;  1VIS A;  4ZVU B;  2M7S A;  1UKU A;  3C3L A;  2IC3 B;  3I4H X;  2UVU A;  3QSY B;  3U7J A;  3KK3 A;  3HHE A;  1TKT A;  4B3T F;  2CWK A;  1JLA B;  3OVB A;  3TEG A;  5C25 B;  2R8I A;  5F8H A;  1TK5 A;  4FYY B;  3GU0 A;  4NA1 A;  2RRA A;  1GNK A;  4LF8 F;  4YN3 B;  1UPP A;  2V50 A;  2QYG A;  5CYM B;  2ZDO A;  4FP9 A;  2X1F A;  4DPT A;  1FRM A;  2F3J A;  1I1G A;  3ADA C;  3HZE A;  4L73 A;  5ETO A;  1FE4 A;  3KG1 A;  2KDO A;  3O6Q A;  1S6O A;  2FGO A;  4WU2 A;  1T9Y A;  2EFN A;  3MCS A;  4LSN B;  4WII A;  4ILM A;  1HBN B;  3KFW X;  3HVA A;  4FDF A;  3OVA A;  3RAQ A;  5E41 A;  5KFD A;  1YJ9 S;  1F5B A;  1RP5 A;  1LEO A;  1LWC A;  4CO4 A;  1JXE A;  5HJX A;  1KQG B;  2DNP A;  1GX5 A;  1T7P A;  1LFW A;  3CMQ A;  1R8C A;  1SB6 A;  3R2D J;  2UUB J;  3IAS 9;  2KYZ A;  5T41 A;  1LKZ A;  3OR2 B;  4NML A;  3I31 A;  3MED B;  2MGZ B;  4I1T A;  1PYT A;  1HD0 A;  2WSF C;  1PC4 A;  2UUT A;  4CZC A;  4RLE A;  2UUW A;  1WC6 A;  2YNH A;  2X3D A;  1AT1 B;  2AQ4 A;  1I94 J;  1WHY A;  2ZNZ A;  4OZL A;  2UVV A;  1RT4 A;  1T02 A;  4Y65 A;  1JKH B;  1HYS B;  3HHL A;  3NCR A;  4WK3 A;  3KDN A;  5BJR A;  3B6B A;  1W7W A;  3C15 B;  2AF6 A;  2AGQ A;  1HNI A;  2DNG A;  3IGV A;  3FBC A;  1BMQ B;  1VI7 A;  2XSJ B;  3SQG B;  2LXI A;  5DG9 A;  3SDE A;  5LT5 A;  3BB5 A;  4XPE A;  2VZ9 A;  3KK1 B;  4Y6I A;  3HJV A;  1UVN A;  4ID5 B;  1S1U A;  2DNK A;  4J9Q A;  2HFZ A;  1OY6 A;  3DRY A;  4G65 A;  4FXW A;  3A3O B;  1KVK A;  3W66 A;  1FRK A;  1JLC A;  2V4J A;  2HHX A;  2WBM A;  1YBA A;  2XLI A;  1VRT B;  2ERR A;  3SI8 A;  2LQ9 A;  1REV A;  1FX4 A;  4NX9 A;  5HMW A;  2HFN A;  4NYZ A;  2HBZ B;  2O5D A;  2HRT A;  2VUG A;  3DRS B;  4ZHR A;  2OKQ A;  1UP1 A;  2M8D B;  3KJV B;  4ANE A;  1XMB A;  2NZ4 A;  1RXO B;  4WKY A;  3FK4 A;  3MHY A;  3NNC A;  4ZA1 A;  3MWB A;  4Y3C A;  1ZH5 A;  4ED0 A;  2AX1 A;  5D78 A;  2KG0 A;  2UU9 J;  4DR1 J;  3CD5 A;  2VA3 A;  3UDV A;  2YQ0 A;  1FVS A;  3B78 A;  4LR9 A;  4RNO A;  2PO4 A;  2RNE A;  4HEA 9;  2OEL A;  3CTR A;  2DEI A;  1RT7 B;  2ZHA A;  2DCU B;  1JNZ B;  1UVJ A;  3KLV A;  1FCA A;  3DCA A;  4I4B A;  2YKM B;  4C11 B;  2P9C A;  4LRA A;  1UEV A;  2VG7 B;  5JVH Q;  4EMD A;  4I64 A;  4ZK7 M;  5KT4 A;  2ZHB A;  2EFG A;  2BQU A;  2A2C A;  1FDN A;  2UUA F;  4OHW A;  3K7R A;  2AU0 A;  4X4U A;  2B9E A;  2EFO A;  2IYG A;  2A6O A;  4OI6 A;  4C8K A;  3RRG A;  4J9N A;  5KFA A;  2J6T A;  3CD6 S;  2HS0 A;  3C8Y A;  4WP9 A;  4LF4 J;  4G1I A;  1TZ0 A;  1S1V A;  4FS1 A;  3W1Y C;  3ENQ A;  3DRP B;  4CLP A;  2FJV A;  1U8S A;  3P45 B;  1SI9 A;  3QO9 A;  2NUH A;  1VBZ A;  5D0H A;  1ITP A;  4JI3 F;  1FKP B;  2DCL A;  3CCW A;  4USM A;  1LOU A;  2HHV A;  1OYD A;  3D4J A;  5KFU A;  5DET A;  3JTP A;  1WHV A;  1FES A;  4EO6 A;  4QJV A;  5IWA F;  1VBX A;  4P10 A;  3R5B A;  2MQL A;  5A2Q U;  2VPX B;  4MYU A;  4FF2 A;  2OAU A;  1WTF A;  5C5J A;  2YXL A;  3M2V B;  1OY9 A;  3TUZ C;  2YH0 A;  2ZM6 F;  1RT1 A;  2GHV C;  1M5S A;  4P71 A;  3DGP B;  5KFL A;  1DQA A;  2V6A A;  4EFA C;  3QSI A;  1VIX A;  4ELV A;  4LSL A;  1WSV A;  7FD1 A;  1U1L A;  2B3T B;  3EGV A;  4Q8E A;  4CYU A;  2DNZ A;  3C16 A;  3CD0 A;  1MRO A;  1RWV B;  4DR4 F;  2J0X A;  3GON A;  3BSA A;  4PG5 A;  2V2V A;  1RAJ A;  3MFI A;  1HPZ B;  3Q22 A;  1HQE A;  2QLX A;  4IUF A;  1KLM A;  3OFE A;  1UW9 A;  5A2Q Y;  2ZZT A;  1S72 S;  3AH6 A;  3UD5 A;  4LF7 F;  4PUO B;  3PAC A;  4CLY A;  2UUC J;  3MR5 A;  4N47 A;  3MM9 B;  4NI2 B;  1NB7 A;  3LP1 A;  1RT6 A;  2DY1 A;  5C2C A;  4LRC A;  1B7F A;  3BGR B;  1U0S A;  5D0E A;  4R25 A;  1S9E B;  2XMU A;  4PXB A;  1Z2Z A;  1UTA A;  2W2Q P;  2QTW A;  2ZKU A;  3R5C A;  2G4B A;  4IRD A;  1F5A A;  2RF2 A;  3H40 A;  2FIU A;  1RI7 A;  4PR6 A;  3BH6 B;  3T19 A;  4DL0 C;  2HHH J;  1ROF A;  3C2P A;  2DHA A;  2EBG A;  2OEK A;  1DLO B;  1FDA A;  2KB2 A;  1F2G A;  2W2M P;  3AAW B;  3TRG A;  1F9H A;  2K1R A;  4Q7A A;  2GJ2 A;  4JI4 F;  1C1B A;  4ZLP A;  2YNF A;  2ZC3 A;  3FC9 A;  1LWE B;  3UDE A;  1U48 A;  3EVW A;  1DTT A;  4R5P A;  4JBC A;  1UPM B;  2ABY A;  2FTR A;  4C8N A;  3QBC A;  1BE4 A;  2WZ1 A;  3CJ5 A;  1Q53 A;  2QLJ B;  4EO8 A;  2D9O A;  3WDO A;  4QR2 A;  5KFY A;  1SKS A;  1AW0 A;  1YJT A;  3ZTQ A;  1S6U A;  1RBO B;  2JEF A;  1MU2 B;  4J9U E;  2NXU A;  5FDL B;  4KFB B;  4QWD A;  4LFA J;  3KNG A;  3MPV A;  3I32 A;  1J5E F;  5DG7 A;  1YTY A;  3Q8Y A;  2YWH A;  1UJ5 A;  1TEL A;  2HVI A;  3NCQ A;  4AUK A;  1Q16 B;  2HVH A;  3DLE A;  2ZH6 A;  2KFN A;  3EVO A;  3MFH A;  2E44 A;  1DY3 A;  1PBU A;  1IWA A;  3T5H A;  3AJD A;  4F3O A;  4NLO A;  2VFR A;  1NSK L;  3OQ2 A;  4JYA J;  3R5A A;  1UA0 A;  4UQT A;  3DXB A;  3M8P A;  1C1C B;  1ZM3 A;  1HBU B;  4BCA A;  5KFG A;  5AE2 A;  1WHX A;  4BLG A;  1R6V A;  3DI6 A;  2XYH B;  3Q86 A;  5LMN J;  1RYR A;  2BE7 D;  3IFE A;  1FFS B;  3RRH A;  2CZ9 A;  1RAO A;  3LQV A;  3J7A 1;  4IG3 A;  1FK9 B;  2I9S A;  5I3U B;  5FII A;  2J7U A;  3C6U A;  3BGO P;  4DPW A;  1N48 A;  1CJV B;  1U2C A;  2BKP A;  3DMJ B;  1ULR A;  1CJT A;  4M5L A;  4J5O A;  5KFW A;  4DF4 A;  3J7Y I;  3HP6 A;  3PFE A;  2GIQ A;  2FLO A;  2ZKT A;  2FYX A;  3OLA A;  3CW2 C;  4HTJ A;  4RWX A;  5E0O A;  4Q43 A;  3IO1 A;  2M70 A;  3C19 A;  1KSP A;  4TY8 B;  4ZVR B;  4FZV A;  3H25 A;  1HNW F;  5LSO A;  1I5O B;  4IRK A;  1PJ5 A;  1N56 A;  3PRV A;  3G82 A;  3JSM B;  4P73 A;  4A8O A;  2LQB A;  5A0Y A;  3TOQ A;  1CS4 A;  3KG4 A;  3CME S;  2F4V J;  3J7A N;  2FHO B;  4IQM A;  4C0H A;  1XBW A;  1XR6 A;  3OTC A;  2LU2 A;  1HAR A;  5KG4 A;  3CJ8 A;  4A8W A;  1Q5Y A;  2OPQ A;  4EK2 A;  2YH1 A;  2A0F B;  2B9Y A;  1XNR F;  4ZPT R;  1FTR A;  3BGF A;  2BJ8 A;  1WWH A;  1RIS A;  2J5A A;  4Q0B B;  3QAT A;  3ISN C;  4ALZ A;  4BS2 A;  3PYE A;  2LCW A;  1TUW A;  3OR1 A;  1RBL A;  5HVG A;  3TJA A;  2DO4 A;  5CHC B;  2FHK A;  3AHP A;  5KFX A;  3HVW A;  4L75 A;  4QIE A;  1UVL A;  4YME A;  2W9C B;  4ED1 A;  3GTY X;  2DGS A;  2NYH A;  3L9Z A;  3HHD A;  3THP A;  3UVJ B;  1JLF A;  2Q3P A;  3KMQ A;  4OYP A;  1SJF A;  1IVZ A;  4DV1 F;  4JV5 F;  4DFP A;  1FRH A;  2FD2 A;  2MKS A;  2VG6 A;  2N7C A;  4DL3 A;  4QWA A;  4DX7 A;  1JQG A;  3B4M A;  2FZK B;  1OS5 A;  5DG8 A;  2FJW A;  1YG0 A;  3CJ0 A;  2DVI A;  3KKF A;  3T1A A;  3ILL A;  1VK3 A;  4I0W A;  3D1Q A;  3NBP B;  3PYF A;  2PT0 A;  1T05 B;  5D0R A;  3QQC D;  2RVJ A;  5EX3 A;  3ZNJ 1;  2MKJ A;  3ENA A;  4E2F B;  4E8U A;  5KG5 A;  1SJ4 P;  4DR5 F;  3CNQ P;  4DS5 A;  2DNO A;  1ZPW X;  4FBU A;  1BQN A;  3LAM A;  4AT1 B;  5HMZ A;  3DRX A;  4WPA A;  4QBU A;  3EX7 B;  2UUA J;  3DFE A;  2DHH A;  3G96 A;  2ASJ A;  2MY7 A;  4Q5V A;  2ZBR A;  4U7U D;  2VPZ B;  3ZTR A;  2HGM A;  4QU6 A;  2V4Q A;  1U1R A;  3GJQ B;  3NMR A;  4OJ3 A;  3HVT B;  2VD3 A;  4WFA Q;  1E6Y A;  2FJB B;  2LXF A;  4DR6 F;  2CPX A;  5B0B A;  3V6H A;  2DRA A;  2A18 A;  2XG8 A;  1IBM J;  4JI2 J;  1RU1 A;  1S49 A;  1U2R A;  2J9D A;  3OTB A;  1NO8 A;  3LPE A;  3M6W A;  2QL5 B;  4PAA A;  2NPI A;  1VQK S;  1JLB B;  1OMS A;  1NB2 A;  3DHX A;  3T41 A;  1XMQ J;  3U1M A;  1YRX A;  4DQP A;  1JLG B;  2MHN A;  3KJF B;  4LSZ B;  3QAU A;  4L3N A;  4UUW A;  1F6T A;  3D0H E;  1JLE B;  2RU3 A;  3A1Y G;  3MM7 B;  3QJL A;  4LR7 A;  4EYH B;  4LF1 A;  3KLE B;  1HNV A;  4ZPB A;  3TWZ A;  3KYL A;  3KHG A;  2XMT A;  1S12 A;  4DF8 A;  4XDC A;  4IFY B;  4GKK J;  4ZPW R;  3UR0 A;  4ZJO A;  1YRT A;  3BEG B;  4LRD A;  3MEG B;  3TAR A;  3W65 A;  1JJ4 A;  2C42 A;  4FS2 A;  2ACY A;  2R7Q A;  3CB4 A;  5EX0 A;  5G0R B;  4NPO A;  4MFB B;  2HLT A;  2ASY A;  5DZ7 A;  2V9W A;  4DCP B;  5BYS A;  2H5I B;  4DJB A;  5IQ6 A;  4GVL A;  4E0D A;  1XMO J;  1IJE B;  2NSC A;  2QA4 S;  3N79 A;  1G3O A;  1TUV A;  2XC9 A;  1RAF B;  2W7P A;  3V6D A;  4NCA A;  3IP0 A;  1C0U B;  4B9L A;  4I7F A;  2GIF A;  3PXG a;  4QZV B;  4I6W A;  1FT8 A;  3BH7 B;  2KT5 A;  1OQ3 A;  4RBT A;  4JI6 F;  2JC1 A;  4ATN A;  4DWI A;  5CCL A;  1YBU A;  2W9B A;  1NZA A;  1ZA1 B;  4DL5 A;  4O3Q A;  2B56 A;  5B0A A;  1UZH A;  2V69 A;  4NLW A;  4ZJQ A;  4FYX B;  5J2M A;  3NNA A;  4Y2K A;  1SQF A;  2JEG A;  3PX0 A;  1FHT A;  4C7Q A;  1FEE A;  2OEJ A;  4CH1 A;  3O2I A;  2QE5 A;  3P5B P;  5AXL A;  4HDG A;  3TA2 A;  3KJQ B;  4PAB A;  3A8I A;  4CH0 S;  4KGX B;  1BWV A;  3MD3 A;  1M5P C;  3MMC A;  2YVS A;  4JI4 J;  3BF4 A;  2KH9 A;  5CD4 A;  3SSS A;  3UCU P;  3R7B B;  4C0O C;  4ES2 A;  1U0H A;  4J9V A;  2KVQ E;  4WBF A;  4LUB A;  3SBM A;  3KG0 A;  2VIC A;  1M0S A;  5KOW A;  4P7T A;  3CJT A;  4JI1 J;  2JWN A;  5F0W A;  4BBY A;  1URN A;  4NLV A;  5DQH A;  4OYM A;  1W2B R;  3CDW A;  2ADC A;  4O4G A;  2E5L F;  1R8P A;  4RJV A;  2AGO A;  1S6Q B;  5L39 A;  3MR6 A;  3IG1 A;  5KFN A;  2ZH8 A;  1R7I A;  1PJ7 A;  4USH A;  1ZM2 A;  1TL7 A;  1Y3J A;  3M8W A;  4OI2 A;  3V6K A;  4DMZ A;  2RUS A;  2DH9 A;  1R27 B;  1FJE B;  4H4O B;  2XMK A;  1RDR A;  4ECY A;  4YB5 A;  1QE1 A;  4ZVH A;  4XDD A;  1SC3 B;  3BJY A;  1R0A B;  4TXS A;  4X4S A;  3D68 A;  4CLT A;  2BAC A;  2GO9 A;  3GIK A;  4IRC A;  1M1K T;  5C24 B;  2WHO A;  2YWE A;  2DIU A;  2GV1 A;  3S6E A;  4B3M J;  4JV0 A;  1QUV A;  3QGP A;  3NY0 A;  2EWH A;  3TZZ A;  5B08 A;  1SC1 B;  2VC1 A;  4F4W A;  4O3O A;  4KKO A;  3RB6 A;  1RAD B;  5EDW A;  1J27 A;  5IT9 U;  4C8L A;  4ICL A;  1FFW B;  4P52 A;  5E2Q A;  3ENV A;  4A8K A;  3I0R B;  2HIY A;  4EBD A;  3F41 A;  1ZTW A;  2BKO A;  1TK0 A;  1WG5 A;  1RUS A;  3I87 A;  1TKZ A;  2JZ5 A;  4UTG A;  4X62 F;  1KVI A;  1SCJ B;  1SJQ A;  4KC5 A;  4U67 Q;  4DG1 A;  3RW7 A;  3BSC A;  5L9N A;  4WKR A;  2I5J A;  2PE8 A;  2B5J A;  5LJ3 Y;  4MMO A;  4NE9 C;  3ZZP A;  1Z4U A;  2G0I A;  2JOQ A;  3PRD A;  4USK A;  4CO3 A;  2ROP A;  3ET6 A;  2GVZ B;  3R8Y A;  3PX6 A;  5IT9 Y;  4QIG A;  2CJY B;  1YLX A;  3K0J A;  2EEY A;  4DOZ A;  1MN9 A;  1AUS L;  3SCJ E;  3CC4 S;  3KMS A;  1AYE A;  2AJQ A;  2QC3 A;  3BPS P;  2EPI A;  2NRE A;  2AW0 A;  3MF5 A;  4U8Y A;  2E7V A;  2VHG A;  1OJ4 A;  2JC0 A;  4AXJ A;  3G6E S;  3UFC X;  2XY5 A;  4R0J A;  5ETT A;  1F3V A;  4ZVS B;  1FWP A;  3M7V A;  1Q8B A;  2ZD1 A;  1SL2 A;  1GMW A;  3ZTO A;  2KHC A;  3GMG A;  1PAU B;  1J2V A;  4Y2C A;  1QD1 A;  2LA6 A;  3QT5 A;  3MTK A;  3FZB A;  3HHN B;  4MKA A;  4PWD A;  4NEY A;  2XLJ A;  4N7T A;  2QMU B;  2UVR A;  2FVC A;  3BRE A;  5B0F A;  5E3C A;  1ICE B;  1CC8 A;  2JEI A;  1QLN A;  5L1K A;  3Q8V A;  3PW0 A;  1L3S A;  2XMW A;  3FQL A;  3CUL A;  1D9A A;  2R42 A;  4S0M A;  1F9F A;  1R8A A;  1IKV B;  4B3S F;  2PGC A;  4YB1 P;  1JLQ B;  3MMB B;  2LMI A;  1JXV A;  1KQS R;  4KGK A;  5LSL A;  2E1A A;  5A8K B;  2YKN B;  3JSB A;  1H2V Z;  2DD8 S;  3ZTS A;  3M8Q A;  1URR A;  1TU0 B;  1ZZN A;  1X8D A;  1RWU A;  3UPF A;  2I1R A;  3VGV A;  3FGV A;  3IS9 A;  3N9U C;  3MR7 A;  2YQ3 A;  2HMI B;  4DV0 F;  4DV3 F;  5ETP A;  1VQM S;  3A12 A;  4RW8 B;  4V19 X;  3EPI A;  2MLZ A;  2CJQ A;  1HD1 A;  1H7X A;  2DNR A;  1VYA A;  4DV6 F;  1Q5V A;  2M8H A;  3DOK A;  3T6J A;  4CIO A;  3MM6 B;  4LF9 F;  4PWW A;  3IR6 B;  4NYP A;  1X31 C;  5D77 A;  4KO0 A;  2BE2 B;  2IVY A;  3QRP A;  2XS2 A;  4J9P A;  4DUY J;  3ZZU A;  2CUY A;  3AXM A;  3HKZ D;  2I0X A;  2AD9 A;  1TL4 A;  2CPJ A;  1IR1 A;  2JFK A;  4LFB F;  3D3C J;  3R6L B;  3CCE S;  2J6S A;  1S76 D;  4ZVO B;  2AWZ A;  5HBM B;  2HEK A;  3B4D A;  5D3G B;  5A8W B;  2HNZ B;  1S1T A;  3PO4 A;  1IKW B;  5AXM A;  5G4D A;  3M32 A;  4K50 A;  5AJ3 J;  2NLW A;  2YNI A;  1SV5 B;  3IM8 A;  2ZH2 A;  1IQZ A;  2Y1L B;  2VA2 A;  3MM8 B;  2UZA A;  4B08 A;  3BDP A;  1MMN A;  3IWN C;  4K5R A;  3DOL A;  2V8G A;  4M8L A;  5H1S V;  3M4X A;  2AYB A;  1NM2 A;  3NWR A;  2DPI A;  3M2U A;  1VQ4 S;  2YX4 A;  3N01 A;  2V2Z A;  2HVD A;  3M30 A;  2W01 A;  3EGN A;  3VV2 B;  4FNI A;  2ZH5 A;  1OQ6 A;  1G6B A;  1R3N A;  2ZNY A;  4Y2M A;  2I6W A;  2YX1 A;  5EUH A;  2IMO A;  1Z2L A;  3QIP B;  3PR4 A;  3BQ0 A;  3IWX A;  2C2K B;  3POT A;  1KP6 A;  2RDI A;  2CQ4 A;  2CG8 A;  4IDK B;  4QPX A;  2V8H A;  2CJK A;  3DN9 A;  1ZOT A;  1YI2 S;  1MN7 A;  1W26 A;  4NLQ A;  2KM8 B;  1RJJ A;  3RR8 A;  3JB9 k;  4KHM A;  4TKT A;  3MPY A;  3NS6 A;  2B8P A;  4OX9 J;  3MOZ A;  3CJK A;  1EET A;  2C22 A;  4V1A k;  5K5M A;  2GMJ A;  2CWX A;  4HHU A;  3VAG A;  5HRO A;  3TZW A;  3EXC X;  1WF1 A;  4F4K A;  1SIZ A;  3LGH A;  1RT5 B;  2FVQ A;  4QWE A;  1S1W A;  2HYI B;  3LGM A;  5BR8 J;  4IOC Q;  2QZ8 A;  4NWB A;  3IAM 9;  4ETX A;  2AP6 A;  1WHW A;  2L08 A;  1X4A A;  4FF1 A;  1S99 A;  1UEK A;  4ECR A;  2DXF A;  4Z7C A;  3U1L A;  2YWG A;  4A8M P;  2XBP A;  2JDJ A;  2XM3 A;  4A8F A;  4QCL A;  4NEZ A;  2W2P P;  1YVF A;  2JVR A;  2W24 A;  1SKU B;  3N5F A;  4MKV A;  4CLW A;  2I38 A;  2QMW A;  1UWB B;  1S9G A;  1RWK B;  2ZUG A;  3AA8 A;  3PTW A;  3KUG A;  4CT9 A;  4Y34 A;  3N28 A;  1Q1K A;  1FA0 A;  3MMJ A;  4OHY A;  3ZZO A;  2VQF F;  1ZZF A;  4C3M A;  1HKA A;  4DPY A;  2GAG C;  4KBI A;  3MUR P;  4OI4 A;  4CLL A;  2J6U A;  2OTJ S;  4LVO P;  1U1P A;  3C6T A;  5L1L A;  2MDA A;  3V4M A;  2MEW A;  2OPS B;  3EYZ A;  2AHO B;  2OHD A;  3HSG A;  1SJ3 P;  5GMK a;  3NWG A;  2OFH X;  5DLG A;  4DS4 A;  1T9X A;  3VZH A;  1L5U A;  3HT0 A;  2R4F A;  3DLH A;  2Y1J A;  4UST A;  4C3K A;  2HPU A;  2IBK A;  5HLF B;  1RTD A;  1VIO A;  4PG6 A;  3VQT A;  4H4K A;  5KT6 A;  4RBV A;  4L6V 3;  2CJA A;  2OPR A;  4JI0 F;  1B64 A;  5ETL A;  1JIH A;  4IG0 B;  1LW2 B;  1Q0N A;  4JI8 F;  3OLB A;  2KXN B;  4DV7 F;  2E1M C;  3GV8 B;  1S59 A;  2BZ2 A;  3F56 A;  2BAN B;  4MKB A;  3HMJ G;  1FJC A;  1HI8 A;  1A9N B;  1RGV A;  5MLC V;  1UVK A;  3NP5 A;  3K59 A;  4P7V A;  1HNX J;  3M6V A;  3KK3 B;  2ACM A;  3D1O A;  1TKT B;  1HMV A;  1RCO B;  1TL3 B;  1S0N A;  2HFO A;  4ZCK A;  2RKI A;  3M9M B;  2GZO A;  2SXL A;  3AQO A;  1S10 A;  4Y0F A;  4LBH A;  5LXR A;  2XWY A;  5HVF A;  4ED5 A;  2WVC A;  2ZZN A;  2ZHO A;  5L38 A;  3FDS A;  2R7R A;  3FCH A;  2RD5 C;  3RU0 A;  4DN0 A;  2C2O B;  3T9N A;  3UDC A;  2BYC A;  4C8Y A;  2UV8 G;  2YBV A;  4GO7 X;  2BA9 A;  2D3Z A;  1T9W A;  3SXL A;  4B9S A;  2RJZ A;  1RKI A;  4DR3 F;  4LQ3 A;  3MCO A;  4ECV A;  3OTO F;  2OFG X;  2L41 A;  4AFF A;  1D9D A;  1EZZ B;  1I3O B;  3B54 A;  1YBT A;  2QYC A;  4QW8 A;  3MM5 A;  3OFG A;  2CQ1 A;  4OHX A;  3JQK A;  1LK7 A;  2V2Q A;  5J1E B;  2ZH7 A;  3OPK A;  4ZP9 A;  5DGA A;  1SH0 A;  1JMT A;  2ATL A;  3H5X A;  3D66 A;  2YNH B;  3HDS A;  1JLA A;  1WJ9 A;  2M88 A;  1VJQ A;  1WC5 A;  3KJN B;  5EHH A;  4KHP J;  2UXC F;  1SC6 A;  2GCF A;  2F8H A;  4Q45 A;  1RT4 B;  2JNJ A;  2VC0 A;  2V5H G;  2HUR A;  3P6Y C;  1V3R A;  5CYM A;  2VG5 B;  5F8G A;  1KHW A;  3K8V A;  1M5K C;  3Q2T C;  2GFF A;  2N3L A;  3M8R A;  1FTC A;  3HHL B;  3KHL A;  1CQN A;  3QWP A;  2CNO B;  4CTA B;  1HNI B;  1NEE A;  2ZH9 A;  1HBN A;  3CJR A;  3UQS A;  4C48 A;  3SDE B;  2DGT A;  2C2E A;  4F8R A;  1AB8 A;  5E3R A;  1GX6 A;  1S1U B;  2QFI A;  4GRS A;  2U2F A;  1FWK A;  2JX2 A;  3TQE A;  2BUN A;  4RL1 A;  1EKS A;  1SVD A;  4CP5 A;  1HNZ F;  4V19 J;  3R6G B;  4CLZ A;  3MED A;  3G2X A;  5KT3 A;  2MGZ A;  4DV3 J;  4IFV A;  5KFF A;  2V63 A;  3AA9 A;  1R8B A;  1REV B;  1FF2 A;  1HWJ A;  3CIZ A;  3DDN A;  3TUI C;  1S97 A;  3ZZY A;  4OZ1 A;  1SIW B;  3NS7 B;  4ECS A;  5E5N A;  5E3P A;  3JTN A;  1H98 A;  4NLU A;  4CM2 A;  2PMZ D;  4XK8 C;  1D1U A;  1UW4 A;  3H4B A;  3EDR B;  1M5O C;  1S79 A;  2QL7 B;  2HWH A;  2XSJ A;  4EZ9 A;  3RB3 A;  1GAO A;  3SQG A;  5EWF A;  2LFV A;  4K4U A;  3VF0 B;  4I2P A;  3W9H A;  3VTI A;  4RW7 B;  2VFS A;  2QRR A;  3H42 A;  2CFX A;  4ID5 A;  1UVM A;  4MIB A;  4ED6 A;  2EG2 A;  3VCD A;  3UR3 C;  3KLF A;  1O5J A;  4KGV B;  4UY8 5;  2WTF A;  2VIH A;  3QJJ A;  2ASD A;  2RHQ B;  4MT1 A;  2HNY A;  5LOQ A;  4DV2 J;  3QRR A;  3CJ3 A;  3NAH A;  2DNH A;  1AZS B;  4P2F A;  4FKY A;  3Q8R B;  4IOB A;  1PKU A;  4ECU A;  1BUX A;  2DNL A;  4L72 B;  5F8L A;  3BKT A;  4CDI A;  1GQE A;  3PCO B;  2DH8 A;  3KJV A;  2Q79 A;  5MAO A;  2R7W A;  2EC0 A;  2W8K A;  4CO0 A;  5J2P A;  2HRY A;  3LWL A;  5GME A;  1UAW A;  2NSB A;  4N77 A;  3SYZ A;  4NCG B;  1NJZ A;  2MTL A;  5A76 A;  1P9Q C;  3ICL A;  3CJQ A;  3KDO A;  1Q95 G;  3LGN A;  2XYG B;  4DU7 A;  1F2H A;  3IN5 A;  4LF6 J;  2VQE J;  2QO3 A;  4ED4 A;  4O3R A;  4QR0 A;  2GO8 A;  1NSA A;  3GJT B;  2MPU A;  3GIM A;  1HWL A;  2M52 A;  4C11 A;  2VG7 A;  1RU2 A;  5GVQ A;  2HHT A;  1DAX A;  1KBR A;  2DGX A;  2EBE A;  3QGG A;  3SV3 A;  4WFX A;  4HI1 A;  4MIA A;  2LDI A;  3NNH A;  2CZV C;  3SCK E;  1QUP A;  1HQU B;  1N5S A;  1MMD A;  1BQM A;  2BJ3 A;  4OQJ A;  2MJN A;  1TL1 B;  3KLI B;  1NDC A;  4CYU B;  4NXM F;  1MRO B;  3BKF A;  4YHH F;  2C3O A;  2WOM A;  3GZ7 A;  3L7O A;  1HQE B;  2OPP A;  2WVF A;  1KLM B;  1MW7 A;  3I0S A;  2CPY A;  3D3B J;  3UD4 P;  4A48 A;  4F2R A;  3HX9 A;  4HT7 A;  5CAB A;  2YKA A;  4DSK A;  3HFZ B;  1GMV A;  3H5S A;  1VQS A;  1SKR A;  5CCM A;  1XR5 A;  3GYX B;  4YOE A;  1X9W A;  4IH5 A;  1RT6 B;  3UCZ P;  4DL7 A;  2JLG A;  1XWL A;  2WAQ D;  3RB0 A;  2MB0 B;  3CDA A;  3FCV A;  1TAU A;  3M2V A;  4HDH A;  4DBQ A;  4K4S A;  5F8I A;  3KUH A;  1JXL A;  1K1Q A;  2IIH A;  3DGP A;  4B9U A;  2PD1 A;  2CQ2 A;  2BDP A;  1M5H A;  5KFO A;  1UJ4 A;  2K06 A;  4UOF A;  1IR0 A;  3W64 A;  5IOL A;  1U49 A;  4BWM A;  2V8P A;  2VOO A;  5GMD A;  1A0O B;  1NH8 A;  2BM0 A;  4M1K A;  6FDR A;  1M1G A;  5KFJ A;  3H7H B;  1QM9 A;  5KFH A;  2KJW A;  2MLY A;  2EFV A;  3Q83 A;  3QWU A;  2HHP A;  4ED8 A;  1YJU A;  3LUY A;  2B4V A;  4GKJ F;  5DJB A;  3QRQ A;  5ETR A;  1X4E A;  2C2R A;  4KYZ A;  2XNQ A;  4NI2 A;  5CXT A;  3HSJ A;  3EDQ B;  4FNH A;  2P9E A;  4H4K C;  4KT0 C;  3BGR A;  5HJY A;  2K7K A;  3I9Z A;  1NME B;  1FE0 A;  1VRU A;  1NLK L;  4ED3 A;  4KV8 B;  3T1H J;  4Z2X A;  1FXL A;  1N8R T;  4OV6 A;  1WEL A;  5A6P A;  4ENO A;  4J9K A;  3BSN A;  1NK7 A;  2QX0 A;  1LWE A;  1YDL A;  1TKX B;  3MEC B;  4FPR A;  2QA1 A;  2JEJ A;  3PKM A;  2E9R X;  4FVC A;  4XAK A;  4JI5 J;  1XN9 A;  4YR3 A;  4FF3 A;  4JI7 F;  1HIY A;  1ZAW A;  1KWM A;  2XYP B;  2IDE A;  3M05 A;  2BRL A;  3MAA A;  2R7T A;  3M2R B;  1B70 B;  3PHT A;  3R1L A;  3THV A;  4M5J A;  5FDL A;  4KFB A;  4M5D B;  2WRM A;  1L3T A;  1RLC L;  2HZA A;  2Z0G A;  3GFX A;  2QL9 B;  1XNQ F;  3MGJ A;  5EWE A;  2LQ5 A;  2E1C A;  2NCK L;  2KHD A;  5K8O A;  2W4P A;  4NLR A;  4I67 A;  1RWP B;  2CQ0 A;  2FLN A;  1N32 J;  4EYI B;  3TVK A;  1WDD A;  5KFZ A;  1NJY A;  5IT4 A;  4FYV B;  2J76 E;  3G82 B;  2HHW A;  3VAJ A;  2RDD A;  1CS4 B;  4X65 J;  1C1C A;  1HBU A;  4LF5 F;  4IH7 A;  1K9M T;  5F8M A;  4WFZ A;  2D74 B;  2VV5 A;  2KRB A;  4ZJL A;  1Q86 T;  1SJR A;  2Q66 A;  2OPQ B;  3BM7 A;  4K4Y A;  3OHB A;  3I55 S;  4OLP A;  1U7L A;  2Y1I A;  2LDY A;  2MKH A;  5H9E J;  2KG1 A;  5LMU J;  2BW7 A;  3IA0 A;  3Q8U A;  1FK9 A;  1VGY A;  4OX6 A;  2I2Y A;  3P96 A;  5I3U A;  4IR1 A;  3RZA A;  1TVR B;  4ECW A;  3I96 A;  3OR1 B;  2RSQ A;  4K4T A;  3T6B A;  4EI2 A;  3FSY A;  4IR9 A;  5J2Q B;  2OTL S;  1E6V B;  2CVI A;  4J91 A;  3W3S A;  3L3C A;  3G71 S;  1F60 B;  4TY8 A;  2ZWO A;  2IBO A;  2UV8 A;  1TMM A;  2MKC A;  1GTH A;  4G6V B;  3THT A;  2ROG A;  5F8J A;  3PYG A;  3TAQ A;  2O67 A;  5KG0 A;  2KN4 A;  1RAI B;  3W61 A;  1VK8 A;  2DH7 A;  1RQ0 A;  2VG6 B;  2FVP A;  4K8R A;  3IRX A;  4OI3 A;  1G1X A;  6AT1 B;  3GLJ A;  2XZW A;  3G86 A;  5KAK A;  4WTY A;  5A6W A;  3T1Y F;  4W4M A;  3ILI A;  1VQ8 S;  4F7V A;  4ECT A;  4UUX A;  4TU8 A;  2RAQ A;  2F4F A;  3H2V E;  3TVZ A;  3VVU A;  4P72 A;  4Q0B A;  4B17 A;  3NLC A;  2Z2Z A;  5E7O B;  5T7L A;  1BGX T;  4F3M A;  2AEM A;  4UOH A;  2DXD A;  5ETS A;  4F4A A;  4WTO B;  2A1B A;  2RRN A;  1T9T A;  3W9I A;  3MMA A;  2PFF B;  2K2P A;  2IVM A;  2B51 A;  4N56 A;  2CAJ A;  2W9C A;  3ISN D;  2BE9 B;  3W63 A;  3HHK A;  1D9F A;  2KFY A;  3K8W A;  2IJR A;  1UJ6 A;  5LSR A;  5I3Q A;  4XIU A;  3OL9 A;  3J7Y U;  1E6Y B;  4O3S A;  4X4V A;  2WVE A;  3CCS S;  4CWB A;  4NLS A;  3VAK A;  2AJ2 A;  4I56 A;  3WIU A;  1TQL A;  4FN5 A;  1JJ2 R;  1YHQ S;  2MST A;  2MZT A;  5IM0 A;  2R7U A;  4H54 A;  3C14 B;  2CJB A;  4U7C A;  1FJG J;  5U47 A;  1H73 A;  3MEK A;  4NOH A;  1NJW A;  4ER8 A;  5E3Q A;  5HQM A;  1MNE A;  3OXL A;  4LJM A;  4PG8 A;  2XMA A;  4ES3 A;  3LP2 A;  1ARO P;  1XK8 A;  4RW6 B;  3TX8 A;  1QTN B;  1N36 F;  4ILL A;  1YZ6 A;  4QIW D;  5B0G A;  2DY9 A;  3CCU S;  1TTH B;  6FD1 A;  1PJ6 A;  2C2N A;  2BRK A;  1S4E A;  2A3J A;  3OFH A;  2AZ1 A;  5F41 A;  3HVT A;  2O1P A;  1P27 B;  4JV2 A;  1JNR B;  4UF4 A;  4P6Q A;  3HSD A;  2IM1 A;  1KTV A;  4ZPV R;  4ZVQ B;  3S1T A;  3RAX A;  1ZYQ A;  1WOR A;  2KO1 A;  4Q8F A;  4LFC J;  2RDJ A;  3TAN A;  1RTH A;  3JAM U;  1TR0 A;  2EXU A;  2NPF A;  2GHW A;  4W98 A;  4A47 A;  3V6D B;  3BV8 A;  2APO A;  1JLB A;  4DSJ A;  4QIF A;  2ZBP A;  3QT7 A;  2NQP A;  3KLH A;  3S8S A;  2J7W A;  3AB4 B;  3SCI E;  2E5H A;  3UN5 A;  4QWB A;  1IBL J;  3BR8 A;  3NL0 A;  2UXD F;  4DR7 J;  2ZVS A;  2XNR A;  3JTO A;  4DCO B;  3PEJ A;  1R31 A;  3HK2 A;  4USJ C;  2W9B B;  2FY8 A;  2FVR A;  3D6H B;  2W9A A;  3OJU A;  1JLE A;  2RU9 A;  4RNM A;  3MM7 A;  3CC7 S;  1RA7 A;  2H51 B;  2RQC A;  4KAI A;  3KLE A;  4RUB A;  1TV6 A;  4EWT A;  5J2M B;  4JB8 B;  3T3F A;  4IFY A;  1KS2 A;  3KLG A;  2XEX A;  4LBP A;  3DLJ A;  2DRD A;  3CO0 P;  2J0W A;  3CD7 A;  1V3Z A;  4HAC A;  4O0I A;  1R43 A;  4MFB A;  5GAD I;  3JAM Y;  3KK2 B;  1EQM A;  4PQU A;  1RWW B;  3MMC B;  4HI2 A;  1Q8K A;  2PC6 A;  4TNO A;  1IM4 A;  1WDT A;  5D8H B;  2HQ3 A;  1U0H B;  4O0N A;  3TEH B;  1Q82 T;  1VQ7 S;  1OSC A;  2XHC A;  1SKW A;  2YWF A;  1RSC A;  2LKZ A;  3P4U B;  1T94 A;  1C0U A;  4O4G B;  2XQC A;  4FYD A;  2QEX S;  4AQY J;  1U25 A;  1UET A;  3RW6 A;  1C4A A;  3TJ8 A;  1SH3 A;  1TL7 B;  1VQP S;  1PYS B;  3FFI A;  3CDE A;  1HQ2 A;  2GQQ A;  2WON B;  1LW0 A;  1EX8 A;  4HR2 A;  3PW7 A;  2HFV A;  1CBK A;  1SBR A;  2QLF B;  2R8K A;  2H48 B;  2MQ8 A;  3TX0 A;  2XO7 A;  5I4M A;  2Q1L A;  3TYT A;  4BC9 A;  3EZU A;  1WEY A;  4HL9 A;  3CIM A;  1V5V A;  4DL6 A;  4DR2 J;  2QA4 G;  1NCL A;  4M94 A;  5DDO C;  1RWN B;  4J9R A;  3MPW A;  3CDB A;  2RS2 A;  3OL8 A;  2C3Y A;  1U6Z A;  4I69 A;  5GAH I;  1QDU B;  4NLY A;  3RGI A;  4RW4 B;  4C3L A;  4I2Q B;  4ICL B;  1N33 F;  2DIT A;  5M2U A;  1YSJ A;  2D1C A;  4DI6 A;  2BM1 A;  2D7S A;  5GAG I;  4NLG A;  1S6Q A;  4F0M A;  1GH8 A;  1HBM A;  1H3D A;  1N5Q A;  5E33 A;  2L9N A;  3CGI A;  3ITH B;  3CVK A;  3NKY A;  4YB6 A;  2MHE A;  3D1H A;  5K14 B;  2EK6 A;  2XHW A;  4H4O A;  1N5Y B;  1KFS A;  4AL5 A;  2UXB F;  1Y9O A;  1SUQ A;  2BX6 A;  4DG1 B;  1R0A A;  1KKH A;  2I5J B;  2NXJ A;  2B5J B;  4HVZ A;  4M5I A;  2R7O A;  2CPI A;  1CEZ A;  4B3R F;  2P9G A;  1RWO B;  3FEY B;  2OMO A;  1UL3 A;  1R89 A;  5C24 A;  3R7S B;  2ZBQ A;  1FD2 A;  1PIL A;  2WSC C;  2Z2Y B;  4K0K J;  3EZ5 A;  2GA7 A;  4AD6 A;  4ED2 A;  4NXN J;  2HW3 A;  3DU6 A;  2IAJ B;  1DHM A;  3QYY A;  4K4X A;  3QT8 A;  3RBX A;  5IV3 A;  3FMB A;  2EVZ A;  2J8S A;  3GB0 A;  3KNA A;  2R7S A;  2VF3 A;  4DV4 J;  4DUZ F;  4RU2 A;  2CQD A;  4DV5 F;  5J2N B;  2QG9 B;  1B0T A;  4LBI A;  4NYO A;  2GJF A;  4ILR A;  5HQ8 A;  1C2P A;  3DC2 A;  5J1P A;  4OIX A;  4PG7 A;  4MAK A;  4A8Y A;  1FXR A;  4J9O A;  1N88 A;  2HWT A;  4HLB A;  2D41 A;  4OZ2 A;  3H90 A;  5KT7 A;  4OZ3 A;  4QYZ K;  5A8R B;  1KEK A;  1RA6 A;  1QSL A;  5KG3 A;  2EKY A;  3E01 B;  3DNC A;  1RZM A;  2PFD A;  2NYI A;  3UE2 A;  4WXO A;  3PG9 A;  4J7C A;  3HD1 A;  1KQF B;  2DT9 A;  3D0I E;  4ELT A;  1VMB A;  1GXT A;  1T3N A;  2N4D A;  2XO6 A;  4ZP8 A;  2NUU G;  4K7Q A;  4X4Q A;  3W2W B;  1NKB A;  1BHN A;  4CLU A;  4ECZ A;  3TUJ C;  4YY3 J;  2GIR A;  1T9V A;  4U96 A;  5KG6 A;  3QAE A;  3OSN A;  4X4O A;  5KFQ A;  3U02 A;  3GSI A;  3MZI A;  1RHU B;  2RH3 A;  5ETQ A;  4X84 A;  5T14 A;  3M8Q B;  2CQC A;  3VAI A;  1CUL B;  2CJ9 A;  3MUT P;  2E9Z A;  4WJB A;  3ZZZ A;  1ACM B;  3QPI A;  1EB0 A;  2UUB F;  3ZZT A;  2BV3 A;  4C2M A;  1RT3 B;  2GNK A;  3IS9 B;  3AY0 A;  5AXN A;  1N6Q A;  2QMX A;  1APS A;  2OSR A;  1RLD A;  1PCA A;  3K2Y A;  4FXV A;  5JVG Q;  3I4P A;  1Q8L A;  1FX2 A;  2BJ7 A;  3W5X A;  4ZOS A;  4B3T J;  4UT4 A;  1I94 F;  3EIC A;  1H2T Z;  1LWF A;  4Y2A A;  2OO4 A;  1RTJ B;  3P3D A;  4LF8 J;  2ROE A;  4RX6 A;  4AXI A;  1PC5 A;  3IR7 B;  1C4C A;  2HWI A;  2ZBI A;  1MML A;  1JLQ A;  1GMU A;  3MMB A;  4KO0 B;  4Z7Y A;  1H6K X;  1IKX B;  5KG1 A;  2RUG A;  2R2T A;  5A8K A;  2YKN A;  3I5C A;  2ZOG A;  1QJH A;  3RG6 A;  4FKX A;  3AOD A;  4PPZ A;  2IRX A;  3ZFV A;  3LWM A;  1S1T B;  3SIP B;  2CRL A;  1B0P A;  4ZVE A;  2M5Y A;  1XQI A;  3A3P B;  2KZM A;  2IRY A;  3DOM B;  1XR7 A;  3DOL B;  4RW8 A;  2BQR A;  3R5D A;  1FNM A;  1ZPV A;  2BKN A;  2OP5 A;  3T5J A;  1S0O A;  2GHP A;  3M2U B;  3ELH A;  1S1X B;  3H20 A;  4J9M A;  1LWX A;  3MM6 A;  2B4U A;  5F9N A;  4LR8 A;  2RE1 A;  3PEH A;  2ZOF A;  5KFM A;  2V8D A;  4GC7 A;  2LEA A;  2GQC A;  2UU9 F;  1BC6 A;  4U6P A;  2F9J A;  1YGY A;  8AT1 B;  3QZ8 A;  2D3U A;  2ALZ A;  4DR1 F;  1RAG B;  4WP8 A;  1HLW A;  2YKO A;  2DGV A;  5F8N A;  1N0U A;  3BYR A;  3UO0 A;  4G1Q B;  2ZVI A;  3AJ1 A;  2D69 A;  1WOS A;  3R2C J;  2ZH4 A;  5D3G A;  1FWL A;  5L8R C;  2HNZ A;  2W2N P;  3J7Z T;  1IKW A;  4CNY A;  3M1V B;  1KHV A;  2HZV A;  1EET B;  2HBY B;  2OH2 A;  5HRO B;  3K5O A;  4YDD B;  1NUE A;  1TKD A;  3MM8 A;  1CSJ A;  1K44 A;  1FER A;  1S1W B;  3LPY A;  4RR5 A;  3DLK A;  2FUG 9;  2XZD B;  1V5I B;  3R27 A;  1K8A T;  2IFX A;  1NDK A;  3V4I A;  4C6A A;  4LF4 F;  3SSQ A;  2DR6 A;  4C8Z A;  2X1A A;  5F3T A;  2D3O R;  2M4M A;  3TI0 A;  3QIP A;  1B0V A;  5I3P A;  1FVQ A;  4IH6 A;  2UP1 A;  5KFV A;  1QSY A;  1KOH A;  2P8I A;  2WCX A;  1X0P A;  3ZTP A;  2V0N A;  1B99 A;  1NKE A;  2KZZ A;  3QMQ A;  3KTQ A;  2NXC A;  2KFZ A;  2R8J A;  3ZC4 A;  2ZIT A;  3GIJ A;  5KFR A;  1KN6 A;  3CE8 A;  3FRY A;  1TFY A;  4DX5 A;  1GTE A;  1QVF R;  3NGK A;  2HZC A;  1L3V A;  3OVS A;  1RT5 A;  3LP0 A;  2MQP A;  2H4W B;  1NKC A;  2Y0S D;  3QFW A;  3EVM A;  2BVZ A;  2XLK A;  3VWS A;  3RBE A;  2KVI A;  3IBW A;  1S6P B;  3SCL E;  3QNW B;  5DDP C;  3C6T B;  3O8W A;  1O8B A;  3MI7 X;  3DRR B;  2PMH A;  2AT1 B;  3FRZ A;  1NND A;  3RTV A;  5CZV A;  4PXE A;  3V81 A;  4B9T A;  3PJ9 A;  2E7W A;  2IY5 B;  3W5Y A;  3MR2 A;  5C2G A;  4QW9 A;  1IWG A;  2BOA A;  4LIW A;  1J5O B;  4U9R A;  1EAR A;  2QN6 B;  2WBR A;  3OT9 A;  1XTZ A;  1RK8 A;  1H72 C;  2GJI A;  2OEM A;  3PJW A;  3LO3 A;  4JI3 J;  1O0P A;  4F67 A;  2Y8Y A;  3ZZR A;  4OFZ A;  4KIA A;  2RT3 A;  1SQE A;  1RTD B;  3UDL A;  2IA6 A;  3BBF A;  3VHQ A;  2BAB A;  5IWA J;  3I82 A;  2OPR B;  3E3X A;  4Q2M A;  1KR4 A;  2OSQ A;  5KOX A;  3F73 A;  2DEJ A;  1KFD A;  3BO3 A;  3KHR A;  2V34 A;  1U26 A;  1UMJ A;  4K4W A;  2GAH C;  5M2R A;  2BQ3 A;  5GAE I;  2CDR B;  4KH1 B;  1M5V C;  1RTI A;  1NU4 A;  1HMV B;  2CPH A;  2HHH F;  2RKI B;  2ZM6 J;  2OPS A;  3P8B B;  9ATC B;  4QPT A;  3IR5 B;  2J8A A;  2HK2 A;  1FKO B;  1G4C A;  3KXD A;  4PWU A;  5HP1 B;  2L3M A;  4HHJ A;  2MZR A;  4L76 A;  4U95 A;  4NA2 A;  5CA5 A;  1WG1 A;  4ZIW A;  3CJ4 A;  4HTI A;  4DR4 J;  3FSX A;  3UN3 A;  1DJ0 A;  2DBB A;  3DDK A;  4P9S A;  2ADB A;  4F4X A;  4HHH A;  2L48 A;  5CD4 H;  4NZ7 A;  1YJV A;  4LF7 J;  4F0K A;  2KT2 A;  2JHE A;  4IG0 A;  2VAS A;  1LW2 A;  2Z30 B;  3NEK A;  5F3Z A;  3PR5 B;  4PXC A;  4LFA F;  2BAN A;  2VBW A;  1NPR A;  2Z58 B;  3I6P A;  1DBD A;  2MY8 A;  3MM5 B;  4C98 A;  3GII A;  3JYT B;  5K8P A;  2AEF A;  3BDE A;  1HWK A;  3GQC A;  1TL3 A;  1GEH A;  5K8M A;  5LL6 d;  4RUA A;  1LV5 A;  4ZLN A;  1CJK A;  3DGV A;  3GE9 A;  4OZJ A;  2F7V A;  5L1J A;  4Z37 A;  3T5L A;  1UFL A;  1NZ8 A;  9RUB A;  4KGM A;  2JLF A;  1ZA2 B;  3ILJ A;  5HAT A;  1NK9 A;  1FRX A;  2DYA A;  4N8N A;  4JYA F;  4ZP7 A;  1X4D A;  4OMF G;  4EU0 A;  5LMN F;  2FDN A;  1L3K A;  1YIJ S;  1VLY A;  3CCL S;  1YX2 A;  4F04 B;  2J9E A;  1HA1 A;  4ECX A;  1NK5 A;  2R2U A;  4WFB Q;  4YDX A;  4J90 A;  2A6M A;  4ZP6 A;  3KHH A;  3U1N A;  3N0V A;  3PNI A;  2DR8 A;  2HLU A;  4KRW A;  4OJG A;  1RHQ B;  3TZY A;  2HS4 A;  3KOA A;  3W8G A;  1LFP A;  1WEZ A;  2UVW A;  2BR0 A;  5J1E A;  1J5E J;  1D09 B;  3WBZ A;  2XUL A;  1SQG A;  3MCN A;  4IFV B;  1YQH A;  1YJW S;  5B0D A;  2HSE B;  1DQ8 A;  3EZO A;  1HI0 P;  4OYZ A;  1Q7L B;  2BJ9 A;  1FNO A;  1U45 A;  1AA1 B;  1GMW D;  2DR5 A;  2FQQ B;  4RW9 A;  2BXJ A;  4XTT A;  4URQ U;  1WOO A;  2VG5 A;  3E51 A;  2ZJR Q;  1M1H A;  2RIL A;  2VOD A;  3OTD A;  4ZIV A;  2JJ4 D;  2F4V F;  4DFJ A;  5F9L A;  3AOA A;  3R1H A;  2KL8 A;  3AD8 C;  4CTA A;  2Y9H A;  5DGB A;  2BEF A;  2V9K A;  1HHS A;  3CCQ S;  3CCV S;  2NXE A;  3M8S A;  1C0T B;  2U1A A;  4I2P B;  4B3O B;  1F3F A;  4N5S A;  1NAQ A;  3WQP A;  3DM2 B;  3QLH B;  5AXK A;  3GIL A;  5RUB A;  2XS5 A;  1NJI T;  3KLF B;  1IXK A;  2IM3 A;  3K5L A;  2CQP A;  2HNY B;  3BBC A;  3CJS A;  1TMJ A;  5DM7 Q;  3MUV P;  1YJN S;  2MKY A;  3L95 X;  4O44 A;  2RQM A;  3EM1 A;  4U8V A;  2VFT A;  3Q23 A;  1FRI A;  4DPO A;  1U47 A;  2HFS A;  1Y3K A;  3R5G A;  3MAH A;  1DQ9 A;  4YS2 A;  3M8Z A;  1HNW J;  5K20 B;  4ZPD A;  3D2W A;  4GVB B;  3MTJ A;  3N6M A;  2E1R A;  4A8Q A;  5J2P B;  4G1P A;  4DSI A;  2AJF E;  3GCX P;  5CYQ A;  2AJ4 A;  3BYP A;  3BQ2 A;  1VC5 A;  2BBE A;  4TVA B;  3CDU A;  2PII A;  1KNZ A;  2NXN A;  2N4C A;  4RW7 A;  3VAM A;  2IHR 1;  2ZBC A;  2HGN A;  3M6U A;  4HH0 A;  3B82 A;  1CC7 A;  1XNR J;  5D4L A;  4NZ6 A;  1S7H A;  1Y7P A;  1YIT S;  2GC8 A;  4X66 F;  2ZE2 B;  5HO4 A;  3MOJ B;  5EN1 A;  1RAA B;  1EP4 A;  1T03 B;  2ZJP Q;  5KFE A;  1VDH A;  3C66 A;  1AZS A;  3O5T B;  1X5T A;  2OD6 A;  4UQG A;  1RHK B;  2RQ4 A;  2QV6 A;  3LTO A;  3L7P A;  3FZ2 A;  2XZT B;  2RB7 A;  1KRP A;  2DGU A;  4JOU A;  4CNZ A;  2EC2 A;  3HI9 A;  2XMJ A;  2LEB A;  1CJU A;  1BQM B;  3GR1 A;  4F36 A;  2GVD A;  3IC1 A;  3SFG A;  2ZFH A;  3HCX A;  5JJB A;  5HI7 A;  1UEU A;  5CZX A;  2ZH3 A;  4NCG A;  4DV1 J;  2C3M A;  4JV5 J;  4KR0 B;  4WE1 A;  1IBM F;  4JI2 F;  4IKA A;  4OHZ A;  4RUH A;  4USW A;  3IBC B;  2DGQ A;  4H4M B;  1UFW A;  2WOM B;  2OPP B;  2O3D A;  3TQ1 A;  2GGP A;  2VU5 A;  3MEE A;  3DLG B;  2VH7 A;  2G2Z A;  3I0S B;  1XMQ F;  1U4B A;  2PN6 A;  2XI3 A;  2KM8 C;  2K8G A;  2IYI A;  5FD1 A;  4QR1 A;  4OX7 A;  1HBO A;  2NS1 B;  1T8E A;  2V4R A;  4DR5 J;  2C2Z B;  2FLL A;  3RB4 A;  3PV8 A;  2DNQ A;  2JL9 A;  1RAE B;  3LH2 S;  1I6J A;  4PG4 A;  1WF2 A;  2HQF A;  4OJ1 A;  4OLO A;  4IYQ A;  4GKK F;  1VBY A;  1R6Y A;  4R8U A;  2HND B;  1HQU A;  4LVN P;  3DKD A;  4ZVP B;  2B4P A;  1TL1 A;  3KLI A;  1SXL A;  5IS2 A;  4DR6 J;  1NJX A;  1GXL A;  5HL7 Q;  2J9D E;  2F5G A;  1XMO F;  1DTQ B;  1SJ1 A;  2ZDP A;  1WC1 A;  4Q44 A;  2FJX A;  5HQL A;  2KXF A;  3IRW P;  4K59 A;  3V5R A;  4TLQ A;  1NK0 A;  2V68 A;  4A8S A;  1VQ5 S;  4UW2 A;  3IMQ J;  2G0C A;  2CQG A;  2JVO A;  1PGZ A;  2FJD B;  3NMA A;  3FJ2 A;  3MCM A;  2H5E A;  4P2S A;  4X4P A;  1HWU A;  3O3L A;  1QSS A;  3TAP A;  2G2Y A;  2IMW P;  2LQJ A;  4RNF A;  2ALY B;  1VRU B;  5LJ5 Y;  4F25 A;  2YWW A;  5L1I A;  3D5M A;  3CMA S;  4CO1 A;  1N54 B;  5THW A;  1BWE A;  1ZTT A;  2F9D A;  2R9L A;  2B4O A;  3SSR A;  2B6A A;  1TUG B;  3B8H A;  5B09 A;  2E5G A;  1RKJ A;  4CRJ A;  3VAL A;  4DSF A;  1IR2 A;  2IRU A;  4MJK A;  3CC2 S;  1TL5 A;  3FQK A;  1VLO A;  4X4R A;  2R2R A;  5EGY A;  4JI1 F;  4DDF A;  4PPD A;  2V67 A;  3W2V A;  2MMY A;  1I51 B;  4BHQ A;  2HQD A;  2HBR B;  2FJA B;  7AT1 B;  4DEZ A;  3VVT A;  2N7Y A;  2BJE A;  3T9Z A;  4JI6 J;  4NLD A;  3MAA B;  1B7Y B;  2CJX B;  1PO6 A;  4KHR A;  2BOP A;  2DRB A;  3RBZ A;  3G87 A;  2DR9 A;  3MPD A;  2ZOM A;  1TAQ A;  1TK8 A;  5FLX U;  2XMV A;  3MD1 A;  4LRF A;  1RT2 A;  4KV8 A;  2A10 A;  1RYS A;  2GML A;  3TZX A;  4UZC A;  1N34 F;  2BJ1 A;  2CIM A;  4B3M F;  5KT2 A;  2F63 A;  3A3N B;  2HAI A;  4RO0 A;  3K17 A;  2DO0 A;  2QSF A;  1UZD A;  1TKX A;  2YKQ A;  3MEC A;  1T11 A;  3VQS A;  2YNG B;  1GXU A;  4K4Z A;  3AOB A;  2VBZ A;  1REG X;  2XS7 A;  4OJH A;  2YQ1 A;  3J7Z 5;  2DK2 A;  5I42 B;  3O1L A;  4ZPA A;  2E5L J;  1CVJ A;  2X51 A;  2IVF B;  3OW2 R;  1U09 A;  5FLX Y;  1NSP A;  5DZ6 A;  2A2D A;  2MLX A;  3DYA A;  3F44 A;  3M2R A;  3OUY A;  2OJ3 A;  4UZB A;  2ZWP A;  5D4N A;  2FC8 A;  4M5D A;  2L9W A;  3EXY A;  1JK9 B;  2CDQ A;  4CLF A;  5DLF A;  2IA0 A;  5ITH A;  1PSD A;  3CXC R;  1NPP A;  4HT5 A;  2FJE B;  2YY3 A;  3C46 A;  2KKH A;  2RRB A;  4M63 A;  1WI6 A;  5BXI A;  2WW8 A;  4F26 A;  2YPY A;  1WNE A;  1AFJ A;  5DS7 A;  2B8Q A;  3ZNU A;  4DUT A;  3H2U B;  1BY9 A;  1OYE A;  2HHU A;  1JJH A;  4MK8 A;  4GO5 X;  4K2J A;  1X5P A;  2AZ3 A;  5AE3 A;  4DSE A;  4F50 A;  1RCX B;  3U27 A;  1IKY B;  2WK4 A;  3Q8P B;  3IRX B;  2BMB A;  2N82 B;  2VOP A;  4K2X A;  1T95 A;  4QU7 A;  3HHL C;  2Y8W A;  5C42 A;  1P6T A;  4M5N A;  4M95 A;  3AB2 B;  2KT3 A;  3TAM B;  1ZM4 A;  4X62 J;  5T7L B;  1TVR A;  2Z57 B;  3PKY A;  4Q2L A;  3O44 A;  4RWW A;  4CH7 A;  3NRB A;  2CPE A;  2P5V A;  5B0C A;  3MMA B;  2F8M A;  5KFB A;  5IT0 A;  5J2Q A;  1N0V C;  1E6V A;  3K5P A;  2Y1R I;  2HVZ A;  7FDR A;  5HAO A;  3EGW B;  4USU A;  1RBA A;  2CNL B;  4PRF A;  4PXD A;  3I5A A;  1FI4 A;  5IC6 B;  2LEP A;  3HFV A;  3TA1 A;  3AT1 B;  1MLA A;  3HF5 A;  3FNN A;  4RZR A;  3GV7 B;  4C4W A;  4DQQ A;  1ZET A;  5IM0 B;  2ZH1 A;  1RTZ A;  3W62 A;  4MKY A;  5EWG A;  2Z4P A;  2W8L A;  1LQ9 A;  1DFD A;  3CPW R;  3NGS A;  3US5 A;  2OUG A;  1LWC B;  4G3I A;  4ZPC A;  1PG5 B;  2JRS A;  2LP4 A;  4W92 B;  5HN0 A;  4X66 J;  2XGP A;  3H4D A;  3PZP A;  2IC3 A;  4X64 F;  1KDN A;  3LP2 B;  3NGR A;  2VJV A;  2LLZ A;  5KFC A;  1WSR A;  5ETN A;  1HW9 A;  2CQB A;  4DU8 A;  3BPD A;  4DLG A;  2HK3 A;  3QJP A;  2Y0B B;  5C25 A;  4WU3 A;  3G8Q A;  1M90 T;  1MWQ A;  1AFI A;  1Q81 T;  2XB2 D;  2VFV A;  3RJM B;  4O4R A;  2KYX A;  8ATC B;  4B3S J;  1A6L A;  1U1Q A;  2B9W A;  3H2L A;  4DUY F;  5JMN A;  2Z56 B;  4RNN A;  4GC6 A;  2HIQ A;  4LSN A;  3A8K A;  2EFP A;  2XY6 A;  3C14 A;  4WK1 A;  1RTH B;  4IOA Q;  4EUV A;  4OL8 A;  1SH2 A;  3KLH B;  4NA3 A;  3BN4 A;  4ED7 A;  3OSP A;  2AYE A;  2E66 A;  2MSS A;  1NHK L;  1ZAV A;  5CH7 B;  3I9V 9;  3LF0 A;  4DQS A;  4FF4 A;  5AJ3 F;  3DU5 A;  2FB0 A;  3UD3 P;  3OR2 A;  1JLC B;  2V4J B;  3OHA A;  2PI5 A;  4RW6 A;  5E3A A;  1Q79 A;  4DV0 J;  5AT1 B;  4ZVG A;  3GIR A;  1TV6 B;  2KRR A;  3G6V A;  3DDI A;  3MDF A;  4DV6 J;  2X3G A;  3CED A;  3KLG B;  1ZBT A;  4ZHR B;  2MXY A;  2M2B A;  4HAC B;  4LF9 J;  2J0S D;  2DNY A;  4HH1 A;  2C2M B;  1JKH A;  3R7N B;  4DX6 A;  2O01 C;  1HYS A;  2H1Y A;  3WIV A;  4PQU B;  4EZ6 A;  2KXH A;  4LT6 A;  3C15 A;  1IBK F;  2F65 A;  3VZI A;  4LQ9 A;  5F0U A;  4A8X A;  5ADZ A;  4LFB J;  2F8E X;  2M9K A;  4R0E A;  3KK1 A;  5DO2 A;  2IJN A;  2R7V A;  1JWW A;  1V9O A;  4OX9 F;  4CO2 A;  5H9F J;  4DPX A;  5HAN A;  3FFI B;  3WX8 A;  1JB0 C;  2CAD A;  1LW0 B;  2K3K A;  2PSZ A;  3K89 A;  4TY9 A;  3GV5 B;  1OIA A;  1VRT A;  3AFG A;  5BR8 F;  2G0J A;  1NH7 A;  5KFS A;  2E29 A;  3CCM S;  4NLX A;  1WTB A;  4NRU A;  4ZVT B;  4DZD A;  2IJF A;  4O3P A;  2DPJ A;  3J81 U;  3DRS A;  3HD2 A;  4PYD A;  4K5S A;  4NCB A;  2Z2M A;  3RUB L;  2P2C B;  4ECQ A;  4IO9 Q;  3KK2 A;  1HHT P;  4Y28 C;  3QZ7 A;  1S1V B;  4J9L A;  3H8Y A;  3GJS B;  5IQQ A;  3UNG C;  1OPZ A;  3QO9 B;  1EIY B;  3RBD A;  2DTJ A;  1OPI A;  2W25 A;  1YJR A;  3PHE A;  3HSZ A;  2CKW A;  3GYN A;  3RYL A;  3FBF A;  5HMX A;  4X2B A;  1RT7 A;  1EAY C;  3NXZ A;  1P1T A;  1HBM B;  3H5U A;  2YKM A;  1IJF B;  2POK A;  2MJU A;  2WON A;  1Y5L B;  5ETM A;  2LEC A;  3J81 Y;  4ZIT A;  3D6F B;  1SUQ B;  3RR7 A;  3Q8Q B;  3X3U A;  1S77 D;  2JLE A;  1YJ7 A;  4UY8 T;  1UCN A;  3AD7 C;  2RS8 A;  2ATC B;  3MUM P;  4NAS A;  1RT1 B;  4ITS A;  2P6S A;  2ILZ A;  2CA9 A;  1N34 J;  3QFH A;  4WIQ A;  3ULH A;  5CQG A;  4F02 A;  4LSL B;  1RHJ B;  2J7K A;  1WAC A;  3DRP A;  2GW8 A;  4ZCM A;  2HRU A;  3K58 A;  3C16 B;  1CLF A;  1RAH B;  3VGS A;  4NMX A;  3NGU A;  4L3K A;  1X5S A;  1IQT A;  4RW4 A;  4I2Q A;  1FNX H;  2MQQ A;  4N8O A;  3WZ0 A;  2M0G B;  1W2I A;  1FKP A;  4RBU A;  3K57 A;  4XPC A;  3ZO7 A;  4DLE A;  2E7X A;  5GAD U;  3FMW A;  2HHQ A;  2PA8 D;  1QVG R;  1H7W A;  2PDA A;  3ITH A;  5K8N A;  2CNK B;  1F9E B;  2HKE A;  3AD9 C;  3LP1 B;  5K14 A;  3D9B A;  2VQF J;  1TFW A;  1N5Y A;  3X1L B;  1W25 A;  2CPF A;  1OWX A;  2ASL A;  2G2O A;  4ZMM A;  2CQ3 A;  1HNX F;  2VDI A;  3AQP A;  1FFG B;  1WC4 A;  2RF2 B;  2NZC A;  2XMM A;  4DL2 A;  2EW9 A;  1HI1 A;  4RU9 A;  3TW0 A;  4ERD A;  4ELU A;  3N4W A;  2GS8 A;  5HSP A;  1NRK A;  1U2F A;  2IAJ A;  3R5J B;  3D7S B;  4DQR A;  3KUE A;  3CSK A;  3A13 A;  2K1R B;  1RE1 B;  1C1B B;  2YNF B;  3ZXW A;  3JSY A;  1DTT B;  2E9T A;  4R5P B;  2J9C A;  3HUL A;  1HPZ A;  2PA3 A;  2FHJ D;  5L9X A;  5JXS A;  4F3Q A;  5J2N A;  3PY8 A;  4ZN3 A;  4WZQ A;  5DRK A;  4PUO A;  3MM9 A;  1G2E A;  2YX7 A;  2AYM A;  5GAH U;  3PYD A;  4JI0 J;  2AMC B;  3FSI A;  4JI8 J;  1OSD A;  1HFE L;  3FEZ A;  2DHX A;  4P75 A;  4Y2I A;  4DV7 J;  2COL A;  2C1E B;  1S9E A;  1N6Q B;  1FDB A;  5A8R A;  3GFZ A;  5GAG U;  5M2P A;  3E01 A;  1IUJ A;  2X7I A;  3OFF A;  4JUZ A;  2HBQ B;  3NOC A;  4F2S A;  2VFU A;  4C9D A;  2WW4 A;  5IFM A;  3R3T A;  3LA0 A;  2H3E B;  4KHP F;  3DLE B;  1DLO A;  1LWF B;  2HQI A;  1RHM B;  3IBF B;  3TUP A;  1WC0 A;  3H59 A;  3W2W A;  1EQ0 A;  4NLP A;  1D0E A;  3Q24 A;  3ILO A;  3BKU A;  2CVE A;  1T0T V;  2XCA A;  4IQX A;  3TNV A;  2Q6C A;  3EMT A;  3BBB A;  3M8P B;  1GFW B;  1X0F A;  3DI6 B;  3ETO A;  3NGD A;  3M9N B;  4Y00 A;  1K0T A;  1HW8 A;  2AGP A;  2XGQ A;  1VOM A;  1NBE B;  1CUL A;  4DR3 J;  3OTO J;  2HFU A;  5D4O A;  4C0B A;  4YEA A;  3OBI A;  3H5Y A;  1KVJ A;  2QLW A;  4IG3 B;  4RUC A;  1BLU A;  3AJ2 A;  1H2U X;  1MU2 A;  4A46 A;  1RT3 A;  4CM0 A;  2B7C B;  1MG7 A;  4JV1 A;  3C6U B;  2CZ4 A;  1VCT A;  4X64 J;  2EI5 A;  1MSW D;  1CJT B;  2OIH A;  1VQ6 S;  4KPC A;  3W5Z A;  4WZM A;  3BR9 A;  1S4F A;  1VQN S;  2FHJ A;  2MKK A;  1F1B B;  3A4T A;  2HS3 A;  4OZN A;  4TYA A;  2IM2 A;  3GSD A;  3LW5 C;  1RWM B;  2X1G A;  3W7B A;  5DDR C;  2UXC J;  1QAJ A;  1RTJ A;  3PW2 A;  3A8J A;  1U6F A;  2XSF A;  1MWY A;  4M5K A;  4E98 A;  5D4P A;  4K4V A;  4DSL A;  5A0Y B;  4ZLJ A;  3ETM A;  3IXQ A;  1IKX A;  1VQO S;  2D9P A;  4RKU C;  1ZM9 A;  1Y5I B;  2MZ1 A;  1N52 B;  2OD4 A;  4WCE Q;  2F1F A;  1FO1 A;  4CI0 B;  3G8T A;  4OV1 A;  1X4G A;  4URS A;  4I6A A;  4D3G A;  3S7R A;  4B02 A;  5B0E A;  3ONQ A;  1N5T A;  4PQA A;  2H4Y B;  2W7O A;  3CWJ A;  5J1N A;  4AND A;  3NCP A;  3VAH A;  2LU1 A;  4HKQ A;  1VQY A;  4YUD A;  1CJV A;  1YRU A;  3UI3 A;  4DV2 F;  1QTM A;  1PYO B;  3DMJ A;  3W60 A;  4HYK A;  1HNZ J;  1WF0 A;  4OX8 A;  3RRK A;  1Y11 A;  4M5G A;  3GG1 A;  2O66 A;  4KH0 B;  3DOM A;  3DLK B;  1PBA A;  4KQZ A;  1S1X A;  5CYJ A;  3AOC A;  4AYB D;  1F0X A;  3W9J A;  3H0P A;  1VFJ A;  3V4I B;  4WP3 A;  1FRJ A;  3NAI A;  1X4B A;  2QGF B;  2V8V A;  3JSM A;  1JLF B;  3OL7 A;  3GCW P;  3GYG A;  4KTQ A;  2QA2 A;  1U8W A;  2DB1 A;  4QQB A;  3D6M B;  5KFT A;  2LQ8 A;  1IBK J;  4LF6 F;  2VQE F;  5KG2 A;  1FKA F;  1HWI A;  3EGZ A;  4G1Q A;  1RAB B;  4BWJ A;  3OTE A;  4X4T A;  1WKK A;  2HVE A;  3M1V A;  1N4L A;  4RPF A;  3PRB A;  4F4Y A;  3LP0 B;  3JS9 A;  5FJ4 A;  1BQN B;  3ISZ A;  3WC0 A;  2PEH A;  2KJV A;  1WI8 A;  2JH3 A;  4O3N A;  1YZ7 A;  1BD6 A;  2M3D A;  1N5V A;  4YFU A;  5IZH A;  3BGL A;  1X5O A;  2OLW A;  4WYL A;  2W1B A;  2OI2 A;  1RAC B;  1Y4Z B;  3PJX A;  3WX4 A;  5HK4 A;  3D54 A;  1KLN A;  4DQI A;  1UFK A;  3UVJ A;  2WB4 A;  1S5Z A;  3V81 B;  2WVB A;  1Y0H A;  1JX4 A;  2KTQ A;  2AEJ A;  5B7W A;  4B9M A;  4MK9 A;  1NXI A;  5DQI A;  1XC9 A;  3L7U A;  1KD1 T;  4NRT A;  4X4N A;  1DRZ A;  4N76 A;  3IWL A;  3HJF A;  1NK8 A;  1HL6 A;  2DIV A;  1A7G E;  1WEX A;  2FC9 A;  3NBP A;  3HXM A;  2VBX A;  1T05 A;  1R8H A;  4ZVF A;  3I5B A;  4B9N A;  1RB0 A;  4TQR A;  1ZAX A;  5KT5 A;  1WC3 A;  4D3H A;  3CCR S;  2FLP A;  3G9C A;  4QYR A;  4B9V A;  3BZQ A;  2NR0 A;  3PVX A;  3OXF A;  3IM9 A;  3FKB A;  2GMH A;  1X7V A;  4WF9 Q;  4YB7 A;  1X60 A;  1VHF A;  3WC2 A;  2XTJ P;  4TU9 A;  1SL0 A;  1PIE A;  3BSO A;  1S6P A;  4CLS A;  1HNV B;  2C3U A;  1RTI B;  4KB7 A;  4FBT A;  5KG7 A;  2KI2 A;  2MYF A;  2C2D A;  3P5T L;  1WKJ A;  1JJC B;  2VKR A;  3DRR A;  3JXO A;  1K47 A;  4FPI A;  1D8Z A;  2Q43 A;  3JQM A; 
#chains in the Genus database with same CATH homology
 3HSJ A;  5ETL A;  5ETQ A;  5ETS A;  2BMB A;  3ILI A;  2QX0 A;  3ILL A;  3HCX A;  4M5K A;  1RAO A;  2F63 A;  3UD5 A;  1HQ2 A;  1RTZ A;  1Q0N A;  4M5J A;  3HD1 A;  4F7V A;  1EQ0 A;  1IM6 A;  3HT0 A;  3HSG A;  4M5G A;  3KUE A;  1DY3 A;  1EX8 A;  2CG8 A;  3MCN A;  1TMM A;  1EQM A;  3ILO A;  3KUH A;  3HSD A;  1G4C A;  3UDV A;  1CBK A;  5ETK A;  5ETT A;  5ETP A;  4AD6 A;  5ETV A;  4M5H A;  4CYU A;  1RU2 A;  2F65 A;  3MCO A;  3HSZ A;  1RU1 A;  1F9H A;  4M5N A;  3ILJ A;  4CYU B;  3MCM A;  4M5I A;  4M5M A;  5ETM A;  5ETR A;  1TMJ A;  4CRJ A;  3QBC A;  4CWB A;  5ETN A;  3UDE A;  3KUG A;  5ETO A;  4M5L A;  1RB0 A;  4PZV A;  3IP0 A;  3HD2 A;  1HKA A;  1KBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...