4CYUB

Staphylococcus aureus 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase in complex with ampcpp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
155
Chain Sequence
b'MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-PYROPHOSPHOKINASE
publication title Structure-Based Design and Development of Functionalized Mercaptoguanine Derivatives as Inhibitors of the Folate Biosynthesis Pathway Enzyme 6-Hydroxymethyl-7,8-Dihydropterin Pyrophosphokinase from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 40
structure length 155
sequence length 158
chains with identical sequence C, D
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2014-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4cyuB00
5ETSA 3MCMA 1EQMA 3KUHA 3ILJA 5ETLA 3KUEA 5ETNA 3HCXA 1CBKA 2CG8A 3HD1A 5ETQA 1Q0NA 2F63A 3HSZA 5ETKA 1EX8A 3HSDA 3MCNA 1IM6A 4PZVA 1TMJA 1G4CA 3IP0A 2BMBA 4CYUA 1F9HA 3ILLA 4M5KA 4M5MA 1EQ0A 5ETTA 3QBCA 3HD2A 1RB0A 1KBRA 3ILOA 4M5IA 3HSJA 3ILIA 2QX0A 1RU1A 3MCOA 5ETMA 4CRJA 4M5LA 1HKAA 5ETPA 1RU2A 1TMMA 1HQ2A 4M5HA 3HT0A 3HSGA 4M5JA 4M5NA 1RTZA 3UDEA 4CYUB 4M5GA 5ETVA 5ETOA 1DY3A 5ETRA 3UDVA 3UD5A 4AD6A 2F65A 4F7VA 1RAOA 3KUGA 4CWBA
chains in the Genus database with same CATH superfamily
2DH7A 3PIPQ 5HL7Q 4B3TF 2PA3A 3T41A 2B9XA 1UEKA 5CYQB 4RZRA 2K3IA 1FFGB 3EWGA 2ZE2B 2DXEA 1XEZA 2YBVA 3N28A 2HFSA 2AJ2A 1CULB 1SIWB 2IY5B 3TI0A 1RT4A 3U1LA 3AT1B 2RU3A 3K5PA 1CSJA 4NLSA 2CPDA 1R0AB 5D4PA 3N01A 2NSBA 5FDLA 2YKPA 1AZSB 2WONB 4DR3J 3ENWA 1TMMA 1IM4A 2KDOA 2IA0A 3AD7C 2GGPA 3ISNC 2QMXA 2CFXA 2OPPB 3JXOA 4LQ9A 3GP9A 2GQCA 4LMZA 1BMQB 4DXLA 5LOQA 2HGLA 2BX6A 1NU4A 3HFKA 4O4GA 3JSYA 1RTDB 4A8MP 1VLYA 3M9OB 2I8EA 4RW4A 5M2PA 4M95A 5DLGA 2WBRA 2Z30B 2DRDA 4C8ZA 5I3PA 2R8JA 5BYRA 4DFPA 1X4EA 3KLFB 1X0FA 4WCEQ 2LLZA 3HHLD 1GK8A 4JI6F 4ZPTR 3HT0A 1S1XB 4CO5A 1PILA 4Z2XA 4DQRA 3KDOA 5E3AA 2R9LA 2R7VA 3TNVA 1SUQB 4ECSA 3QIDA 3QJLA 2QLFB 3D68A 3C2PA 5B09A 4ZS6A 2HS0A 5DZ7A 4PEOA 2C2MB 2X1AA 3I0SA 1FJ7A 1UFKA 1W2BR 2VG7B 3AH6A 2ZEJA 1ZAWA 4GVLA 2OH2A 2HFVA 2BJ7A 4CRJA 4CNZA 2YKMB 5HJXA 4X62F 3GV8B 2RQMA 4LF1A 5FD1A 5AT1B 1N54B 4L3NA 4C97A 1FD8A 2HRUA 1HNZF 2CQHA 1Y9OA 4CO2A 2FY8A 3N79A 3OTCA 2AJFE 1R6VA 3RYLA 5J2PB 1U6BA 4TKTA 3OTDA 3TUPA 1GMVA 2R7QA 4M5MA 4LUBA 4I6WA 1UVNA 3MEKA 2ASYA 2HQIA 3LALA 4U8YA 1GX5A 4EBEA 3MMBB 3ITHA 1DQ9A 4OI3A 2V69A 3RB4A 1VHIA 1WEZA 3P4UB 4H54A 3R27A 2EC0A 4YOEA 2ZZMA 2FQQB 2AYBA 4OHWA 4BHQA 3ZZOA 3HPOA 3T1HJ 2KVQE 3H2VE 3IXQA 2HFUA 1KLMA 1DJ0A 1SQGA 4FPIA 3I87A 3SXLA 4OFZA 3CD6S 2NS1B 2P8IA 3CCTA 4WP9A 4TVAB 2RKIB 1ZPVA 1S72S 4B3MF 3M8SA 1N5VA 4ZP9A 1YDLA 4B08A 3D0GE 3KHLA 3C6TA 4U9RA 3HVWA 1T9WA 1SJ3P 4QZVB 1C4AA 2SXLA 1G3OA 4AE5A 2LQJA 3OW2R 4IDKB 3ZZ0A 5E3RA 5I3QA 4D3GA 4OYBA 1BWVA 3QRQA 3OSNA 1VQPS 2V4RA 1F9EB 1XTZA 2ZOMA 3MPVA 2DNYA 1C0UB 2VKRA 3ZO7A 1T03A 4FYXB 2HRTA 2CQIA 4CQ1A 4OQJA 1JLCA 4NPOA 1OPZA 3FVYA 3GG1A 1HHTP 1NDLA 2XY5A 2YQ3A 4IG3A 2VG6A 2M8HA 4P75A 3DU6A 4NL5A 3W2VA 1WC0A 3BF4A 2A6OA 3PG9A 3NOCA 4F50A 3DGVA 3Q8PB 4WFNQ 4ZCIA 1HNVA 2UUCJ 4ZP8A 1R0CB 2Z56B 5D0GA 3B6BA 4DLEA 4J9NA 1UZDA 4ED8A 3LWMA 4Q8FA 2XY6A 1VLOA 1H72C 3CCSS 4G6VB 1VJQA 2DH8A 3LANA 3MECB 3TRGA 2HNYA 3IWLA 3TAQA 2YWGA 5KG3A 1SB6A 1IXKA 2ROGA 2ZH8A 3M2RA 2J9DA 2ALZA 4K4WA 2KFZA 3M2VB 1BXNA 3C14A 2NXEA 2FJVA 4DUYJ 5JUMA 3QIPB 2XMKA 4IFYA 5DM7Q 5HSPA 4NZ7A 3MEDA 2FIUA 4NYOA 3PYGA 1L3SA 2K2PA 2IJFA 4AT1B 4MMOA 1RAOA 4USTA 2XO7A 2ZHBA 1LW0A 1FK9B 4LFBF 1KS2A 5KT4A 4J9MA 4LVNP 1TMJA 4C11B 2BM0A 3QGGA 1UKUA 3BH7B 4ZHRB 1XR5A 1QAIA 2D69A 4EZ6A 3SBMA 5L39A 1HBUA 3UDCA 4KHMA 4M94A 3EVOA 2XSFA 4LFCJ 1YRUA 5KFJA 3DC2A 3EPGA 1SJQA 4B9LA 1HQEA 4JUZA 4WYLA 1NPKA 2H4YB 1UW4A 2DK2A 1Q86T 5JVHQ 3HSJA 3TUJC 2W25A 5HVGA 4EYHB 2OO4A 2AJ4A 2XULA 4B02A 4I0WA 3M9MB 2AGOA 3R5JB 4OX9F 4DR4J 1M5SA 4HT5A 1HD1A 2HFNA 4IRDA 3M1VA 4F2SA 1S4EA 4O3RA 3DLGA 1S5ZA 2B7CB 1CVJA 3ZZRA 3BZQA 4G1PA 3D7SB 3ENQA 3W66A 4LIWA 4R5PB 1E6YA 2IMWP 4ZJOA 3ZTPA 1NKBA 1WG1A 4LF8F 1JX4A 3R5AA 4RBUA 3ISZA 2GVDB 3KG0A 4TY8B 2E9RX 1KOHA 4IOBA 3AD9C 2QV6A 3K5NA 1X4GA 4H4KA 3ETOA 2MPUA 2X1GA 2KXNB 2AWZA 3D1OA 2RRBA 5ETMA 1CS4A 1P8GA 1MG7A 1PC4A 2VG5B 3BQ1A 2EBEA 5GMKa 2CJ9A 3GR1A 2IBKA 3QZ8A 2HHPA 5HP1A 2CG8A 2Z4PA 1FFWB 3P49B 4CM0A 1JLQB 3UI3A 2ADBA 9RUBA 4KHRA 2RAQA 3R97A 1KDNA 1Y00A 3S01A 1KRPA 3RUBL 2PMWA 1DARA 2U2FA 4PG5A 2JWNA 5FDLB 4MIBA 2XO6A 4ERDA 5D15A 2ALYB 2B51A 5LMUF 3KJFB 1YWXA 3RBZA 3EGVA 2C2DA 3K8VA 3N6LA 2RB7A 1P9YA 1RCOB 2ZH6A 3GIKA 2EFOA 1I5OB 3KNGA 3L7OA 1FRKA 1F5BA 2JLEA 1V3RA 2H3EB 4O4GB 1SBRA 1Z1ZA 4DDFA 2VHGA 2FVQA 4ECRA 2XY7A 3G87A 3N0VA 4QU6A 1N0UA 3BGLA 4DV0J 5IV4A 2PO4A 3Q2SC 1A6LA 3O8WA 2KG0A 4F3OA 1B7FA 1WTFA 1YJ7A 4DR7F 2LEPA 3T1HF 4DR6F 4FS1A 4J9SA 3IGNA 4X4VA 2J8SA 4F4ZA 2CJYB 4U95A 5D8HB 2HZCA 3JSMA 3FFIA 4ES3A 2BYCA 2AP6A 3O6QA 4IH6A 4EYIB 4USJC 1UETA 2BRKA 2B43A 2IDLA 4TYBA 2J0QD 3HJFA 5DQIA 1BLUA 4NXMJ 2F65A 2FLPA 3L4BC 4C8NA 2OEKA 2OMOA 5IM0A 2OIHA 3BKFA 3OL8A 4DPOA 3I0SB 2UZAA 1P1LA 2JOQA 2HS3A 1R43A 3GG0A 3DOMA 2HWTA 3KKFA 5EWGA 1YJTA 4DI6A 3MAAA 4NLVA 3BSNA 5KFTA 1T9UA 1VQSA 1FI4A 3EPIA 3GJRB 3MMAA 1I3OB 3TA2A 4J5OA 2XWYA 1N36J 4M5JA 4NCGA 2J0SD 4OLOA 2N7YA 3MPUB 2VD3A 1S10A 2J0WA 2JEGA 3GIIA 4LRBA 1REGX 5CQGA 2FHOB 3D28A 4H4KC 3H2LA 4YR3A 4A8XA 5HVFA 5ETRA 2BKNA 4KGXB 2UUCF 3LUYA 3VAMA 2ZOGA 3HMJG 3UVJA 3ITHB 1AUDA 2XTJP 4J9UE 3QWUA 3SDEA 2K7JA 3DRPA 3BKUA 2K8GA 3TQ1A 2IC3A 4F4YA 2BOAA 4DV2J 1S0MA 1L5UA 1FJCA 2HNZA 1UEVA 3JSRA 5ETQA 1KLMB 3MPWA 1FDNA 1RYSA 2E7VA 5A8RA 1TKXA 3RU0A 2Y1RI 2XMUA 5I3UA 4DUYF 4X4RA 2E1CA 1CLFA 1B99A 2APOA 1LWCA 2XMWA 5AXLA 3C6TB 5HVHA 2ZH4A 2DGVA 2LXIA 1OWXA 3OXGA 1VC6A 3BSOA 2BKPA 1F3FA 1Y5IB 2HHQA 2FC8A 4EO6A 3HFVA 2HQFA 1UP1A 1T9VA 1FTRA 3L7PA 2CWKA 2M2BA 2OD4A 3FZ2A 2FZGB 4FF3A 1RQ0A 1Q1KA 1T03B 2C22A 4GO7X 3UN3A 1SIZA 3W63A 2K3KA 2RUSA 3PHTA 3BQ0A 1H2UX 3TZYA 4DL0C 2J6UA 2MY8A 4IG3B 4RKUC 1X5OA 4KPYA 2OHDA 2IIHA 3V6KA 3PX0A 3RBEA 4A8WA 2YNFA 4K2JA 2D3O1 1VBYA 5EX0A 8RUCA 2OPSA 2WVFA 1X8DA 3CJ8A 4LF2A 3DKDA 1HNVB 2G2ZA 3JTOA 1XC9A 2B3TB 2X51A 4R8UB 1Q95G 2CZ4A 4PPDA 3W5YA 4CT8A 1GMWA 2CQGA 2OJ3A 2R7TA 2WRMA 2HNYB 2IAJB 4OHXA 3NCPA 1R8PA 3G8TA 3J80Y 3IFEA 2PC6A 3HHDA 3E2EA 4IR9A 1JJ4A 1UPMB 5KFHA 4U6PA 2DNHA 3C14B 3MR2A 1YGYA 4NWBA 1RZMA 1SJ4P 4IFYB 1M90T 4JP8A 2KT3A 3K89A 1P9QC 3MM8B 3SCJE 3MFHA 5A2QU 2JSXA 2K06A 2HBZB 2JC0A 2CQBA 3AAWB 4KFBB 3ENAA 3D1HA 3U1MA 1YJWS 3LAMA 1VQMS 1KONA 1LW0B 3BEGB 3QYYA 4GKJJ 3TANA 4ZVQB 3DLHA 3J7AN 4AL7A 2MZTA 3LGMA 1EB0A 2EPIA 2CKWA 3M6XA 2QMWA 3BO4A 5KG0A 2HNDB 4E98A 5KFEA 1N56A 1RWUA 4ZVPB 1HBOB 1N5TA 3CCES 1HBUB 4ZLNA 5F8IA 1Q53A 3CW2C 2F9JA 1FJGJ 2AZ1A 3CD5A 3NMRA 2BJ8A 3BO3A 4LF5J 2JVOA 4KQZA 5LSOA 3SCKE 1RT5A 2MKKA 1YRTA 3FRZA 1K0TA 1HQEB 1RT1A 3LOUA 4DR5J 3GLJA 1S6QB 3UQSA 3GFYA 3CJ4A 2ZJRQ 1MSWD 1RWMB 4DZ6A 4DFKA 2IJNA 4Q8EA 2YNIB 3CT9A 1RWWB 3LH2S 2WSFC 3M1VB 4KKOA 1R6YA 4YR0A 2EI5A 1QAYA 1F60B 3R6GB 4ED1A 1NMEB 1SH3A 2I1RA 5LMNF 5B0FA 4LRFA 1NUEA 3KK3A 1E6YB 1EKRA 2W2PP 4ED4A 4I6YA 3G4SS 3JQMA 2CPEA 5THWA 3W65A 5I42A 2BW7A 2BJ3A 1YJUA 1VBKA 2PN6A 2ZHOA 5HJYA 1Y4ZB 1AROP 1HQ2A 1TV6A 4ILRA 1CS4B 4OZ3A 4P9SA 5K8MA 3NGDA 5KFAA 4Y0FA 5GAGU 1SJFA 3CJ3A 2LQ9A 2PFDA 3T5JA 3TJ8A 1DURA 1N32J 2I0XA 1NH7A 3BKTA 2PDAA 3NAIA 1TKTA 1X9SA 2M8DB 2VBXA 2RD5C 1Q0NA 3OJSA 1ZAVA 3K5LA 3OFGA 4DV1F 2MXYA 5E33A 4C8KA 1TK5A 2HIQA 1URRA 4RJVA 3K8WA 1S6UA 3MPYA 1IQZA 2OFGX 3NP5A 4PYAA 2R42A 4PCQA 2ZUGA 2V2QA 3IBWA 4PAAA 1RTJA 1N36F 2Q43A 3FKBA 2HHWA 4DSEA 5J1PA 3T1AA 2YTCA 4M63A 3H8YA 5KT5A 3HSGA 3VAIA 3TP2A 3Q8UA 4CI0B 3US5A 2VF3A 5FLXY 1UFWA 5J1NA 3ZTQA 3MMJA 5T7LA 1Y11A 5G4DA 5DRKA 1C1CB 4XPCA 5GADI 4X4QA 5DETA 3MM7A 4P7VA 3LA0A 2B9EA 3LAKA 3NBPA 4OJ1A 3CCQS 2NREA 1NJZA 5J2QA 1U24A 3DHXA 4DV2F 1UA1A 2HHVA 1LXJA 4M5IA 4CLLA 2WHOA 1U1QA 4F67A 3JSMB 3PO4A 3Q8YA 1QE1A 3FFIB 3OTEA 3PR5B 4J9RA 1X7VA 2N4CA 4PZVA 1BE4A 1J5EJ 4OZ1A 2VUGA 1TKDA 3ZFVA 4C3KA 4UT4A 1RT6A 1YHQS 2HSEB 3OUYB 3R8YA 5D6GA 3VVTA 5IM0B 4NI2B 4FVCA 4KGVB 1GX6A 3FZBA 2XZWA 3D6FB 3I82A 3DOMB 4WIIA 3J81U 4LF4J 1FKAF 4RO0A 2NPFA 3C16A 3PYDA 3MAAB 4WK1A 3HKZD 2A10A 2E1PA 5A8KB 2VC0A 2V5HG 3L9ZA 1HI8A 2BMBA 3EGZA 1D3WA 1RA6A 3MMAB 2HFZA 1H7XA 1HKAA 3G8QA 3J7YI 1PJ5A 1PG5B 4KJIA 1WHVA 2W9BA 2VDHA 4USUA 3CDAA 3C46A 3J7Z5 4DF8A 3SYZA 4OI6A 3ZXWA 4CCHA 2LFVA 4OYAA 3OSPA 3OTOJ 3A4TA 4M5LA 2M70A 1NEEA 4KRWA 3TEGA 3DDIA 1NSQA 3T1YJ 3U1NA 3FNNA 5E41A 5EN1A 1T11A 2QL5B 3UVJB 1W2IA 2DIUA 3Q89A 4PKDB 4L74A 2H65B 3MD3A 4JV5J 2IC3B 4K2XA 2Z2MA 4RW8A 3LP0A 3A3PB 2CQ4A 2CUYA 2HNZB 3QAEA 3FMBA 1IJFB 3GJQB 3SSQA 4WBFA 3S8SA 1S77D 1KR4A 1NK7A 4AL5A 3DRRA 3PYEA 2MQPA 4IUFA 2CJQA 3K0JA 1JWWA 5A8RB 4OYMA 2O5DA 1TKXB 4LF9J 2OKQA 2BVZA 2DD8S 1QSSA 5I3UB 4NE9C 4JI3J 4HHJA 1LWCB 2LEBA 3THTA 2AJ0A 1UCNA 2GAHC 5ETPA 1S1TA 4FF2A 1U4BA 1RHUB 4J9KA 1HQUA 1U1PA 5A6PA 3VQTA 5FJ4A 2CAJA 3EZOA 3S6EA 3IAS9 2HLUA 3D6TB 2V50A 4DR2J 1C2PA 1HD0A 3MM9A 3UO0A 4RPFA 3WX8A 3FBEA 4ZCMA 1TL3A 1EAYC 2A2DA 1LWFA 4WE1A 3BO2A 2F8EX 4LF5F 2J76E 1VFJA 1NCLA 2Q79A 1YRXA 4P2MA 4N77A 4BS2A 3EDQB 4IH5A 2CNKB 1U26A 2N3LA 1S0OA 3SMZA 2OPSB 1TVRB 4DR5F 1QUVA 3TAPA 3DHWC 1CJUA 3P45B 2YX4A 3PW5A 3QSYB 2FLOA 2H51B 5CZXA 3A8JA 1RE1B 2PI4A 2G4BA 4HKQA 3MCOA 1QTMA 3DOKA 2OEMA 2RHQB 1RWVB 3W62A 1S59A 1ZM3A 3HVTA 2NUHA 4TNOA 2DT9A 2FJBB 2MZ1A 3GQCA 1PCAA 2ZH7A 5B7WA 2EBGA 1IKVA 3Q2TC 4F4AA 2AEJA 3M30B 4DUZJ 2QC3A 3IR6B 3UE2A 4G65A 4JI5J 4K0KJ 2R2SA 4LR8A 4C8MA 4O0NA 1FRXA 1IR2A 3HLUA 5DS7A 3R7SB 4I1TA 1H6KX 2FB0A 1SC4B 3CD0A 5B0EA 5IWAJ 4DSIA 4WK3A 4GC6A 2HHHF 2EFVA 3MZIA 4BC7A 2ILZA 3I9V9 3MCSA 4FN5A 3SZ2A 2Z8QA 3UN2A 1RT5B 4EEYA 1RT2A 2G1DA 1RT1B 3U02A 2KKHA 1BQMA 5F9NA 2HGMA 5L1JA 3MGJA 4NLGA 3BN7A 2B7BB 1VQ5S 2MLXA 5B0GA 2P9CA 1NPPA 3CIMA 3MFIA 4FS2A 5J2NA 1G6BA 5LXYA 3QQCD 2IYGA 1TL1A 2AKWB 4GKKJ 4KKOB 2YQ0A 2F4FA 1N0VC 3PJXA 2Z2LA 2JFDA 4CO1A 4KSEB 1A9NB 2XZDB 1RACB 2MHNA 2VFUA 2D7SA 1N33J 1VQLS 3Q24A 3MR7A 3KK3B 3RG6A 1ZETA 2YPZA 2ZUAA 2W1BA 3D4JA 5HK4A 3TQEA 5I42B 4KBIA 2PD1A 3K59A 2V8HA 1D8ZA 2YWEA 2QYGA 2I5JA 4NLQA 3Q0AA 1IM6A 2OELA 1X5PA 4OHYA 4WFBQ 2RRNA 3QPIA 5DG9A 1TV6B 1HBMA 2YWKA 1MNEA 4EBDA 2YX7A 5HLFB 4YDXA 2C2ZB 4FXDA 3HDSA 3ET6A 2D74B 1CQNA 4KHPJ 2FVRA 3FBFA 1FWKA 2ZNZA 2J7UA 2BE2A 4H4OA 2HS4A 1TKTB 2JEFA 2XLJA 3BBCA 4LF4F 4GO5X 4USHA 2CPXA 2KFYA 1SKSA 2OMLA 1D8YA 3HZGA 2DJWA 2QN6B 3FCWA 3D66A 3IR5B 2ZKUA 1B64A 1RCXB 1C1BA 3KLHB 2HHUA 4DN0A 3RB0A 2R8GA 1RTJB 4FVMA 3B54A 1N4LA 3NLCA 4LJMA 1M1KT 3T5HA 3M32A 3RJMB 2MKHA 2V4JA 1Q7YT 3SFGA 5T7LB 4DLGA 1RGVA 2ZM6J 5EX3A 1UW9A 2HK2A 3OXFA 2OPQB 5IXUA 3EZUA 2FVPA 3GFHA 3MM7B 4R0EA 3IAM9 2MHEA 2AMCB 2DHAA 3NBPB 3DOLA 4JV5F 2E1AA 1MWQA 5J2QB 4LBPA 3V6JA 1R3NA 1NSPA 3GJSB 2QA4S 4DV6J 2IJRA 4ZLLA 1QE1B 3CNQP 2GJFA 4LF9F 4RUCA 3KMSA 2CJBA 4J9QA 1QDUB 2JFKA 4C2MA 3CCRS 5D4LA 3O5TB 2UUAJ 1RT6B 1IR1A 3KK2B 4CLZA 4HVZA 2MB0B 3TAMA 3R2CJ 4IRCA 2FYXA 1OIAA 2PIIA 5F8HA 4ELVA 2VFVA 2B0GA 4ZCLA 2RILA 4A47A 1RTZA 3NWGA 1ZBTA 1V9OA 4F26A 3FQKA 2R7SA 2N3OA 4UTGA 2H54B 4OZ2A 1VQ4S 5KG5A 1VGYA 1WD6A 3KFWX 2YWHA 5CA5A 1RAJA 3SFUA 2MGZA 2W9BB 4NCAA 2VU5A 2NLWA 4ELUA 4N47A 3ADAC 5J1EA 2AF6A 2KM8C 4K4ZA 2RJZA 4QWAA 3LF0A 3MM5A 1YJNS 3BGRA 4OJ3A 2DCUB 1KN6A 3CJKA 2YNHA 2XI2A 1JIHA 2V2ZA 2BA9A 4PYDA 2MLZA 3C8YA 4X64F 4CYUA 4OJHA 2GZOA 1QLNA 2MKSA 4RW8B 4DV3F 3LP1B 1WEYA 1ZA2B 4DS5A 1P6TA 2Y1IA 3DLJA 4ECTA 1N34F 3UWTA 4LRAA 5B0BA 4ICLB 4FKYA 1I6JA 2MKIA 1Q16B 3IS9B 4ZPBA 3F73A 3N5FA 3I5AA 3H5UA 3KTQA 4KY3A 3MUMP 5F8MA 3FQLA 1S1TB 1LQ9A 1FESA 4JI5F 1HQUB 2HBRB 3CD7A 5IC4B 1SXLA 3LQVA 4Q0BB 1NAQA 4L72B 1QTNB 2VB6A 1Z2LA 4HDHA 4DQQA 1F9HA 3ZTSA 3CB4A 1AW0A 4K4UA 3I56S 2NR0A 1NKEA 2F8HA 1RSCA 3MM9B 1XNQJ 5IWAF 4I2PA 1RAAB 2PGCA 1UVLA 4YS2A 1GAOA 1LWFB 1IUJA 5BR8F 3QMQA 3RR8A 4DU7A 1F9FA 1NK6A 1T9YA 1XWLA 4L76A 4K4XA 1TAUA 1H2VZ 4NLRA 2KO1A 4TXSA 2VA3A 1RKJA 1O51A 2DY9A 3O1LA 4Y00A 4MK8A 3QT8A 4KTQA 1RHKB 1MMLA 2AW0A 1CJUB 3GB0A 2JEIA 4OI4A 4ZK7M 4ZVEA 1L3UA 4GKKF 5EWEA 3OL7A 4IO9Q 3DOKB 5BYQA 4K4TA 3LTOA 4E2FB 1N33F 3PO5A 2EFPA 3M2UB 2HYIB 3P5BP 1UEUA 1UL3A 1Y5NB 3MCNA 4QIFA 3VALA 3OL6A 3RBDA 4KO0A 5IQ6A 5J2MA 1T9TA 3VHQA 3GYGA 5B0CA 1XBWA 1Q79A 4Y2CA 1FNMA 5DJBA 1S9GA 3CE8A 3PDNA 5AE2A 2ZBQA 1VQ6S 1GXLA 2DRBA 4G1IA 1X31C 2AYEA 4CH7A 2V8PA 4KHPF 3TEHB 2RNEA 1KNZA 2ZH3A 4DL2A 2WB4A 2B9WA 2P5VA 3NS6A 4JI8J 4GC7A 2B8PA 4P52A 2F1FA 3FK4A 4TY9A 4RNHA 1RT2B 1U0SA 4XDCA 3H40A 1B4SA 1I51B 3HP6A 1H98A 1FWLA 1BQMB 2UUBF 3HVAA 3Q86A 2WVBA 4YDDB 2QA4G 4E0DA 1FX4A 2D9PA 4JI2J 4HI2A 1D1UA 2XG8A 2DITA 3AXKA 4OI1A 3PM9A 5J2NB 5L9XA 3FEYB 2FUG9 1HR0J 3DYAA 1LW2B 5GMEA 4B9TA 1UFLA 2RS8A 2FJXA 3BDEA 1SH2A 4CO0A 4OL8A 4UZBA 3JQKA 2ZZNA 4JI7F 3CCUS 2KRBA 4YB1P 2DO0A 2XNRA 2YKMA 3KMQA 3CJQA 1ROFA 2E7WA 2CQ0A 5KFPA 2HKEA 3BBFA 2CJXB 3F44A 3W2WA 2KM8B 2I5JB 3MMCA 3I55S 4DV6F 3BYRA 3CO0P 2C2EA 2AQ4A 5J2PA 1S48A 3P8BB 3KLGA 3CJSA 2LQ8A 2MKYA 3KUEA 1TUWA 1X4FA 4RU2A 1FDDA 2LU1A 4F4WA 2M3DA 1D9DA 5HATA 4MYTA 5KFQA 2D3OR 2OD6A 3T3FA 3EGWB 4H4OB 2L3MA 3MOJB 4USKA 2C3PA 1S1WA 2ZH1A 2PEHA 2FC9A 1SL0A 1JNZB 2Y0BB 2ZBCA 4EI2A 5C2CA 2WSCC 1C1BB 5JVGQ 2J7WA 2CDQA 3QO9A 1UPPA 5KG1A 2DGUA 1KHWA 3KG4A 1R8AA 1T8EA 2EFQA 2YKNB 4OX7A 5L1LA 5FIIA 5E3PA 1VQOS 2QT7A 2V4JB 3OXLA 1VK8A 3AY0A 4W92B 1LXNA 5DG8A 3NAHA 2IRUA 3JS9A 1LEOA 4ZLPA 3WIVA 2RSQA 1N48A 1C0UA 3FBBA 1NJYA 1CBKA 4C9DA 4O3SA 3H42A 4ID8A 4ZVTB 1U1KA 2FLNA 4J90A 3DOLB 3N6MA 5K14B 5H9EJ 2HVIA 5CD4A 4QQBA 7AT1B 1JNRB 4LF6J 4PXEA 1K44A 2J6SA 3ILLA 2X7IA 1JKHA 1ZTTA 2GQ2A 4PXDA 4X65J 2E5HA 4L73A 4USWA 5HN0A 1NK4A 2UXCF 4B3SJ 1SL2A 1J2VA 3HD1A 3UNYA 3C66A 2DGQA 4MIAA 1XNRJ 4WPAA 2EK6A 4JI1F 2CA9A 2PFFB 1JXEA 3R7BB 4ED6A 1F0XA 2EEYA 4X4NA 4EWTA 1BD6A 1ELOA 4B9VA 1NO8A 3MECA 5E0OA 2NUUG 3HCXA 1U8SA 3Q8VA 1FJEB 4ED5A 2JVRA 1XNQF 3G2XA 1EP4A 3PRVA 1QVGR 3PYFA 5IT9Y 4AD6A 1UJ6A 2MGZB 1K47A 4DG1B 2J9CA 4KR0B 2VC1A 5J1EB 3OVAA 1RU1A 1DAXA 1S12A 4W4MA 1H2TZ 3D67A 3EZ5A 3NGRA 2CPIA 3MM5B 3ZNJ1 4MKVA 2I2YA 2JLFA 1QM9A 3CJKB 2YNHB 2DO4A 1FO1A 2Q1LA 4R0JA 1LOUA 3M4XA 4ZHRA 3KLEA 4DMZA 4YFUA 1D0EA 1KFSA 1RBAA 3PIOQ 4CYUB 2FGOA 2NSCA 3G6ES 1WWHA 1U1MA 2RMLA 3BR8A 3OHAA 2XBPA 1NHKL 4KV8A 3M7VA 3QFWA 3RAQA 4QW9A 2V8DA 2VQEF 1RKIA 4PUOA 3WHIA 4HYKA 2DPIA 2M7SA 1WEXA 4QWDA 1FE0A 4FPRA 2B9YA 3E01A 4ZJLA 2MJNA 1O6XA 3G71S 4KAIA 1N5YB 4F0MA 1EX8A 1RI7A 2XS2A 1K73T 3R6LB 1NJWA 3UNGC 2NQPA 1H73A 4DV4J 1QVFR 2CPFA 4FYDA 3VWSA 1F2GA 1HWLA 2ATCB 3QJPA 3KUGA 1VQKS 4I2PB 2MZSA 5CCLA 4R5PA 1QAJA 3KLIA 4ZKAA 2AGPA 2DH9A 1EETB 2BANA 3VCDA 4TY8A 3VGSA 3PW2A 3PJWA 4A8YA 4QPXA 2N7CA 1YQHA 5D77A 3DRXA 3UCGA 4MJKA 3LPEA 4ITSA 2UXDJ 4P7TA 1G7CB 4AXJA 4B3RJ 3EM1A 4JI2F 4L75A 1I1GA 3CPWR 1OO0B 4EU0A 1E6VB 5DGAA 1JLQA 4ILLA 1FD2A 2J9EA 1MN7A 1HNXF 4O3QA 3I32A 3DNCA 1U6ZA 1VBXA 4O4RA 1ACMB 3LO3A 3MUTP 4KO0B 2LEAA 5J2MB 1R8HA 1M0SA 1S7IA 3IN5A 2PMZD 4JI0J 4FKXA 1S9GB 1FA0A 5ETTA 3DI6B 5K5MA 5BYSA 5H9FJ 3BN4A 5K8OA 4LIRA 3N9UC 1GTHA 2AGQA 3OV7A 1NHUA 4ZN3A 2QRRA 1VC5A 4Y2AA 2V0NA 2ZC4A 1KTQA 2UUTA 5DLFA 2QLXA 1VIXA 1PO6A 2DNPA 2HVZA 5EUHA 4UF4A 2V67A 1D9FA 4K4VA 1U0HB 2VJUA 2Q6CA 2ZD1A 5E2QA 2XCAA 1GMWD 3FBCA 3LWLA 5L9NA 3VVUA 1HNIB 4UY8T 3DYAB 1UVJA 5KFKA 3I9ZA 3L3CA 5JXSA 3CVKA 2F4VF 2XGPA 1FVSA 4BC9A 1SJRA 1U1LA 1HA1A 2MSSA 1TK0A 2AD9A 5HMXA 1PKUA 1RLCL 4DZDA 2OP5A 2VH7A 2M0GB 2GJ2A 3Q83A 2GHVC 3W2WB 3MMCB 4IFVB 4O44B 1R8CA 1FDBA 4TU7A 2FHJA 2J7KA 2M4MA 3KLGB 3X3UA 1CG2A 2C2KB 5A6WA 2XSJA 3K57A 4X65F 2QFJA 1XR6A 4IR1A 4V19J 3CO9A 5IOLA 5T41A 3EXYA 3TJAA 2W2QP 1GH8A 2PEBA 4CWBA 5CYJA 3J80U 1U48A 3GILA 1N52B 1F6TA 1Q8LA 4DEZA 4Q45A 4AUKA 1S1WB 3CTRA 2OPRB 5BJRA 5HBMA 5HQMA 4KH1B 3HX9A 4ECYA 3GV5B 2O66A 3CMQA 3QO9B 4QWEA 2LQBA 2MMYA 2L41A 4NEZA 3RRGA 1PIEA 2KG1A 1YITS 4O0IA 1G1XA 1ZAXA 3OVSA 2HURA 4KPCA 2KVIA 3FC9A 2BZ2A 4X4PA 3HULA 2UVWA 5IT4A 3AOAA 4CP5A 3TARA 1MN9A 3NY0A 2CQ2A 4IG0B 1F1BB 1ZH5A 1VYAA 4YHHJ 3AHPA 2GO9A 2V2KA 2XLKA 3S7RA 3A13A 3I0RB 2NXNA 3C3LA 3Q8QB 4WYWA 2GV1A 2RQKA 2B6AB 2H5JB 2L48A 2KTQA 2Y8YA 1JKHB 5KFYA 3V5RA 2MYFA 2IM2A 5HANA 1FNOA 2J5AA 1MWZA 1U8WA 1NLKL 2YH0A 1NPRA 4WFYA 1Q8IA 4JYAF 4RNOA 4OZJA 1ZM9A 2DNLA 3V2UC 2VA2A 3TA0A 4C0BA 4DS4A 1FDAA 4USVA 1XMOJ 4R8UA 2LA6A 3SV4A 4XAKA 4LFAJ 1IBLJ 6FD1A 3CDWA 3N5BA 2WB1D 5LL6d 5SZTA 2IAJA 1URNA 4DV4F 2ZH2A 1WF1A 3BGOP 4YN3B 3CCMS 4ECWA 5I4MA 2BV3A 4IOCQ 1EP4B 3GSDA 4FXWA 4WP8A 4QOTA 1HYSA 4AQYF 1RHQB 4QR2A 3X1LB 5IZHA 1EIYB 3MM8A 1OJ4A 2EXUA 3QGIA 1NDCA 5K8NA 1IKWA 1F5AA 4KFBA 5ETOA 3PX6A 1ZM4A 1RHRB 1ZA1B 1VS3A 2OTJS 4B3RF 1EQMA 2KU7A 3Q23A 2YQ1A 3T9NA 1HBNA 3BV8A 2M5YA 3KLEB 3NKYA 4B17A 1S6PB 2HNDA 3V4MA 1KSPA 1HBOA 3QLHA 4NXNJ 1IKXB 4V19X 1DTTA 3J7A1 3S1TA 3GR0A 1XMQJ 1SCJB 4KV8B 1DTQB 2HAFA 3PNIA 4DHVA 2GIFA 1SKUB 3FEXB 4PUOB 1APSA 4J9OA 4DR3F 4ID5A 5F8NA 3IP0A 4DL4A 3NGTA 2R7XA 3E01B 2N4DA 4I69A 1S6QA 4JI0F 3AOCA 1O8BA 1WDTA 2POKA 3DGPA 3IM8A 4LT6A 3A3NB 1TR0A 1KEKA 3EYZA 2YNIA 2KFNA 4OJGA 3F56A 4JV0A 1T7PA 3JB9k 3M8RA 4ILMA 3KOAA 4DCPB 2C2OB 5A0YA 4Q44A 4Y2MA 4RNMA 2XWXA 3THVA 1FCAA 4NLWA 3B8HA 4HR2A 2XC9A 3KLIB 2W4DA 2W4CA 4WWSA 1WHXA 1H74A 2BANB 5AJ3J 2C3OA 3KK1A 5T14A 1SC6A 5D4OA 1FT8A 1VOMA 1VR6A 4ELTA 1CJTA 3CC4S 3ENVA 4N56A 2GQQA 4F3QA 5EGYA 1O0PA 1TUGB 2YWFA 2D3ZA 2X1FA 2DHSA 5L38A 1WI6A 1RUSA 3H2UB 3MTKA 4HHUA 1IWAA 2CVEA 1PJ6A 1GFWB 3A8EA 5B08A 2V4QA 1TQLA 3EVWA 3HJVA 2E29A 1FXLA 3NNCA 4AXIA 4ZVHA 3MHYA 4WFZA 1J5OB 4RX6A 3KG1A 4ZCKA 1DZ5A 1NB7A 2NYHA 4NYPA 3TVKA 4N7TA 4ED0A 4CIOA 3Q22A 1EZZB 4NZ0A 1M5OC 2MSTA 4DSKA 1U2FA 5K20B 2AX0A 1NHVA 3LGNA 4IQXA 1A0OB 2F8MA 4RBTA 1RTIA 1NK0A 4FZVA 5KOXA 3K7RA 1C1CA 2GIRA 1HFEL 1JK9B 1FVQA 3BREA 3WC0A 1X4BA 3I4PA 3AQPA 3D9BA 2C3UA 5KFFA 3IBCB 2CZ9A 1VC0A 1YBTA 3NL0A 2G0IA 2GVZA 3VGTA 3G6YA 4DQSA 1CEZA 2KXHA 1OSDA 1NDPA 4NA1A 2ZD1B 1LFWA 4WKRA 1BY9A 1UZHA 1RB0A 2DBBA 3UR3C 3T6BA 3BPDA 1ZTWA 4OV1A 5AXMA 3OUYA 2DXDA 3GIJA 4NI2A 1WKLA 1HL6A 2O67A 3IGVA 2AHOB 4Z37A 4K4YA 3JTPA 2YKQA 5F9LA 3PACA 2W7AA 4XTTA 1VISA 1WC6A 3A8IA 3NCQA 4RW9B 4CNYA 3B4DA 1OYEA 3PEJA 5KT7A 2OI2A 1YJRA 5A8KA 4YHHF 2GFFA 2D9OA 4HI1A 4ED3A 2DNRA 1RA7A 2O01C 1W7WA 3T9ZA 1RT3B 2NCKL 2FVSA 3UPFA 2GHWA 2OEJA 2MQ8A 1TTHB 2V94A 3LPYA 2KYZA 5IC6B 3RW6A 2XSJB 4QYZJ 4MH8A 4JB8B 2A3JA 2E1MC 4I56A 3UD4P 4NOHA 1XMOF 2QSFA 2H48B 1SVDA 9ATCB 4TQRA 1PYSB 2RRAA 3OHBA 4V1Ak 5G0RA 3AQOA 1HWKA 1Y3KA 4ZN1A 4J7CA 4RR5A 2JH3A 3IMQJ 4I68A 1QUPA 2DR7A 7FD1A 4ANDA 2VPZB 5HBMB 1PC5A 1S7HA 3R5GA 1TP7A 4D3HA 2B5JA 1MU2A 3TO8A 1QJHA 1BGXT 1RXOB 2HWHA 3DRSA 2X1BA 6AT1B 2CQPA 5C25A 3CC7S 2DGWA 1TK8A 2P2CB 3WC2A 2D3UA 1HI0P 4WTYA 3BQ2A 4M5DB 1S0VA 1PAUB 1UVMA 1HLWA 2H5IB 2HZAA 1LK7A 3V81B 4L3KA 3IRXB 4DX7A 1QAXA 3FUYA 3H59A 5HROB 3A12A 3TA1A 2HBQB 4ZIVA 4B3MJ 3OPKA 3N6NA 1V6HA 1P1TA 3HF5A 3SV3A 1WACA 5RUBA 2AZ3A 1XMQF 5F3ZA 3AODA 4RW7A 4LFCF 1HPZA 4URSA 4OI0A 4ZPDA 4Y3CA 3MXHP 3KYLA 1HI1A 2GIQA 3UFCX 2ZDPA 2VBZA 4A8KA 3POTA 2ZITA 1TVRA 4WZMA 1VRUB 2F9DA 4QR0A 4ZP6A 2DYAA 2DRAA 2A18A 5LXRA 1Z2ZA 4EZ9A 3W61A 4DR4F 4NMLA 1H3DA 1RAEB 1KVIA 2CNNB 1BC6A 1IQTA 2LMIA 1HWIA 2QLWA 3P6YC 4A46A 2AIRB 1HHQA 5M2UA 5F41A 2CXEA 1HYSB 1YJVA 3V6DB 1FRLA 2VBWA 1CC7A 3TX8A 3HHKA 2CPHA 2CZVC 4QYRA 1GMUA 4LSZB 3M30A 4P72A 1IKWB 4CH1A 2COLA 1U25A 2RF2A 1T94A 5AE3A 3VGVA 4W98A 3DLEB 2DNNA 1HBNB 4GRSA 2VONA 5D0RA 1U1OA 3QGPA 4I6AA 3QLHB 1DTTB 3PKMA 2IBOA 3TUIC 4A4JA 2R2UA 1D09B 2WCXA 2DR5A 3T19A 4KH0B 3I4HX 1FRMA 2Z58B 3QJJA 1PYOB 3L95X 4X4SA 2EVZA 3W7BA 1XK8A 2OGUA 4F8RA 3HSZA 1KD1T 4ID5B 2FZCB 3UDLA 2HVHA 4J37A 2BE9B 2CVIA 2BABA 3W1YC 3DGPB 2WOMB 4QIWD 1A7GE 1PSDA 4J9LA 1WC1A 2DVIA 3VAKA 3H20A 2BACA 3KHRA 1SI9A 4RUBA 4OYXA 4O23A 4PWDB 1KVKA 4EO8A 2W2MP 2DR9A 1HMVA 4OX8A 3ULHA 2XNQA 5A0YB 3G86A 3TR5A 1YBAA 1AFIA 2Q66A 2AYGA 4MKYA 3VZIA 4DV0F 1M5KC 4Q2MA 4OX9J 3UCZP 2IDEA 4F36A 3TZWA 3KHHA 2R2RA 2FTRA 3C19A 4MT1A 4I7FA 3E8OA 1DHMA 1GT8A 3KK1B 4Q43A 3L09A 1Y3JA 2VFTA 3ZZZA 4C8LA 2CPZA 1DBDA 1DLOA 2W7OA 4OX6A 1CJTB 3UW1A 1JB0C 4NEYA 4K50A 4LF8J 2V9KA 3MD1A 4MK7A 5HLFA 2LVWA 1LWXA 4NXMF 4RNFA 2PA8D 4CT9A 1RABB 4K7QA 1BQXA 4YY3J 5KG6A 3H90A 2DHGA 4OYIA 2LA4A 4DJBA 4DOZA 5F0UA 2UVUA 2LECA 2FJDB 4ZOSA 2ZBPA 1SV5B 2DNQA 1VRTA 3D2WA 3KLHA 3J81j 3Q8SB 1U1NA 2DISA 4C3LA 4DPUA 1QD1A 4ES2A 2GS8A 2ZH5A 2WW8A 1JLEA 2I6WA 4MKBA 3CXCR 4WU3A 2HQ3A 1JLFB 2DEIA 5C24B 1RTIB 3HHNB 1T3OA 2FY1A 1T9XA 2DR8A 2OPQA 1T02A 1NK8A 2XYPB 2V6AA 4Y6IA 5LMUJ 4WFXA 4OYPA 1Q5YA 4RL1A 5F8JA 4HH1A 1TFYA 4UOHA 4JV1A 2FD2A 2R3VA 3EGNA 1U2RA 2QA2A 2ZDOA 1T0TV 1UJ5A 2YPYA 2GJIA 1JLAB 2GVZB 4LR9A 4JOUA 2ACMA 1X9WA 4CM2A 1UVIA 2LYVA 1YG0A 2DCLA 1V5IB 2JNJA 1ULRA 2OSQA 5LT5A 1IKYA 1X5SA 3HHEA 3RZAA 2ZC3A 2W9AA 2R7UA 4RUHA 3VAGA 5D3GA 2V8GA 4JV2A 1T95A 3JAMY 3QRRA 3KK2A 4DR7J 3GONA 1HWUA 4DR6J 4QPTA 4KYZA 2Y1JA 1RLDA 4LBIA 1PBUA 5HMYA 1YX2A 5E5NA 2VPYB 2Z57B 4WTOB 1Q78A 2XCPA 1S9EB 2NXUA 5EDWA 2DGOA 4WXWA 3OL9A 2FZKB 2FGCA 3QZ7A 1U1RA 4QBUA 4HACA 2ABYA 1S6OA 4HT7A 1RBLA 2WBMA 5JJBA 1HARA 2RUGA 1SH0A 1OPIA 3AFGA 4P2XA 3MI7X 1R7IA 3MR3A 3K17A 3FCHA 5KFMA 2IPOB 2KN4A 3MF5A 1W26A 2MTLA 2BJDA 1ITPA 3CMES 3EX7B 2ZNYA 4NMXA 1TL5A 5D78A 3DLKA 2O1PA 2WW4A 1G2EA 2GO8A 5G0RB 1PBAA 5DDRC 2R4FA 4PQUB 3CJ0A 2YNGA 5AE1A 2IA6A 1RAIB 2HPUA 3LP1A 4KT0C 4F4KA 1N5QA 2ZVSA 2XEXA 4NLTA 1DQ8A 4I4BA 3L7UA 2E5GA 2VOPA 5KFBA 2B5JB 1MU2B 3ILIA 3W64A 2FPHX 4ICLA 2HHSA 3DRSB 1WF0A 3IS9A 3F41A 4MAKA 4TQSA 4Q7AA 1X4CA 5C25B 4N5SA 3U27A 2PE8A 4DPYA 3PW4A 3AA8A 3UR0A 1Q81T 4ZVSB 4M1KA 3TX0A 3U7JA 3KXDA 2XYGB 4RUAA 4GKJF 4DCOB 4Q0BA 4IOAQ 3HZEA 2RDJA 3SCIE 1MWYA 2MKJA 1TZ0A 3HO1A 5A8WA 3DMJB 4FP9A 2HLTA 2QL9B 3TUZC 5HMZA 1FJGF 3W5ZA 4RW7B 3AB2B 3W5XA 3D0HE 1HW9A 1HPZB 5HQLA 2VDIA 2EK1A 3M9NB 2H5EA 5B0AA 3NGKA 5KTQA 3O44A 1F3VA 3POTB 3ZC4A 4ANCA 2DNGA 4LSLA 3GJTB 2PMHA 6FDRA 3ZZYA 2ZWOA 5KAKA 3CJ2A 1NNDA 4NLXA 2M52A 1B0VA 3RBXA 3WBZA 3NGUA 1TFWA 3OFHA 5E3CA 4WZQA 4RNNA 3OR1A 4Z7CA 4CZCA 4PWWA 2DEJA 3M2UA 2GNKA 3RB3A 4Q2LA 2F63A 2VOOA 4HTIA 1K0VA 2XMJA 1U02A 2NZCA 4KE5A 3MEGA 1U2CA 4A8SA 2HQDA 3NS5A 2RF2B 1VIOA 3G9CA 2VFSA 4B9MA 1FKOB 3AJ1A 4FNHA 1FRIA 2ACYA 3GCXP 2YH1A 1RK8A 2QZ8A 3MEEA 1JJHA 2MQMA 4H4MA 4DQPA 2QA1A 3AOBA 3PR4A 3DFEA 3GFZA 3GTYX 1WTBA 3SSSA 2HRYA 2D41A 1N32F 4HH0A 1H0HB 3P96A 3CCJS 3QBCA 4YY3F 1R8BA 4NASA 2R7OA 2NPIA 3M8ZA 1KQGB 1GXUA 1NSAA 1YKWA 4CO4A 4C3MA 4DFJA 3RRKA 2BDPA 2C3MA 2BJ9A 2X3DA 1TKZA 3PFOA 2VJVA 5C42A 3FEZA 1RT4B 4ZPVR 4C0OC 2MJUA 5GADU 5M2RA 4FBUA 3NCRA 2CQCA 3HD2A 4LQ3A 1S1VA 1LW2A 3NXZA 5DQGA 1YJ9S 1ZYQA 2EKNA 1WG5A 3CJ5A 1HMVB 2GGPB 2RT3A 4CLKA 4PG8A 2UU9J 4C7QA 4DX8H 1RHMB 1RADB 4O3PA 5CYMA 2VL1A 4HDGA 4NRTA 2HW3A 3AB4B 3WX4A 2W8LA 3B82A 4QIEA 4I7FB 1C4CA 4TLQA 5C7PA 2E44A 3MAHA 4HLBA 1DLOB 3DXSX 1NK5A 2GX8A 5LMNJ 4U7UD 4N76A 2JJ4D 2MDAA 3DDKA 2GA7A 5H9EK 2DIVA 2H1YA 1J5EF 4RW4B 3MCMA 3H0PA 2IVFB 2J0XA 4PABA 5CD4H 2WVCA 2QFIA 4YMEA 2XLIA 3RAMA 4UOGA 1MMDA 3GSIA 2CPYA 3RB6A 4RLEA 4F25A 4OHZA 1IWGA 1KP6A 2V2VA 2E1RA 3PTWA 2AJ1A 3PJ9A 3R1HA 4PXBA 3J7YU 2HHXA 5IT9U 1ZS6A 1XN9A 4ATNA 5HI7A 5IT0A 5IS2A 2AV5A 2XM3A 1VRTB 2YKOA 5KT2A 3MAQA 2QGFB 2QLBB 3W60A 4DV7J 3IWXA 3K5OA 3ZZTA 1S76D 5GAGI 3M8PA 1YLXA 4ZVGA 2G1HA 3ONQA 2YKNA 1JLEB 2Y3YA 4DV1J 2HMIA 3M6UA 4B9NA 1N5SA 3OTOF 4CLWA 3A8KA 3WIUA 2HAIA 4DV5J 3T1YF 3EVMA 1W25A 4IQMA 2HG4A 2Z2YB 4HHHA 4FDFA 3CMAS 1FF2A 1MLAA 2V9WA 4LF7J 5K14A 5KFZA 5B0DA 1VQ9S 1NB2A 3BPSP 2BR0A 4ECXA 1WOPA 4PG4A 4DR1J 3D54A 4LR7A 3HXMA 3QT6A 1DFDA 1IKYB 4JI3F 2ATLA 4DUTA 2B56A 4Y28C 1S99A 4HL9A 1KQSR 1UAWA 1TELA 1OY6A 5D3GB 1JJCB 3JQJA 5AXKA 1RT7A 3UDVA 2EG2A 1AB8A 2G9OA 1JMTA 3G8SA 3AXMA 1RAHB 3NEKA 4CDIA 3W9HA 3UCUP 2CQ1A 1FFSB 1OS5A 2X3GA 3TWZA 1JJ2R 4OYOA 4ECZA 4C8OA 2UVRA 1KQKA 1WC3A 2E7XA 4NCBA 1FEHA 1WI8A 4LREA 4DR2F 1P27B 1X0PA 2OAUA 2RDDA 4A8FA 2E5IA 4OYWA 1LFPA 4DPXA 1H7WA 2Q6BA 5KOWA 4FF1A 2H9ZA 5DDQC 4EUVA 5LSLA 5LJ3Y 4ETXA 4HACB 1FXRA 4P2FA 3P3DA 4DG1A 2NYIA 4A48A 3EMTA 4NYZA 3K5MA 2W2OP 2BRLA 4PPZA 3UN5A 2E9ZA 3VAHA 1RAFB 5ETSA 1I94J 2LP4A 1SKWA 2E5LJ 1JLCB 2VPXB 2ASJA 5DDPC 3PY8A 2EG1A 1PAEX 4LRCA 4WIQA 3DLKB 2RHSB 1VQ7S 3FJ2A 3Q8RB 2VG6B 2YNGB 2XMMA 2E5JA 4DL6A 4WXOA 3W2VB 4K4SA 2IM1A 4F02A 3NNAA 2AX1A 1MW7A 1KQFB 3HHLA 2RVJA 5EHHA 2W9CA 4M5HA 4ZLJA 4UY85 4G1QA 4DU8A 1HW8A 4DQIA 3CF5Q 4CLYA 1J27A 3PV8A 2WK4A 2R7RA 4BCAA 3PEHA 4UOFA 3MM6A 1X4HA 3B78A 4DUZF 1S0NA 2J8AA 2LXUA 4DSLA 2UVVA 4GVBA 2GHPA 5ITHA 4X2BA 4F0HA 3M2RB 4K0KF 3FCVA 2C28A 1N5YA 2LQ5A 4LSNA 4ZITA 4X84A 3CJTA 2J6TA 2W01A 1RYRA 5A8WB 3W8PA 2A0FB 3MEDB 2OFHX 2RE1A 5H9FK 2FHJD 4UUWA 3OT9A 4WFAQ 2DHHA 2GMLA 2W2NP 4C0HA 4DSJA 4B9UA 1EETA 4X66J 3CWJA 2EFGA 2P6SA 3SQGA 3CULA 1OMSA 1T05A 3VQSA 4ANEA 4AL6A 1VQNS 2QSWA 3C15A 4LSLB 4BBYA 3HT3A 2A2CA 4WF9Q 3KHGA 2OSRA 2W8KA 2ZH9A 1E6VA 2D1CA 2QL7B 2ZVIA 2JHEA 1YI2S 3H4BA 2Z0GA 1CC8A 1X9MA 3JYTA 4CH0S 4F4XA 3OR1B 3BGFA 3PW0A 2ZFHA 2UU9F 3LW5C 3NG8A 2F7VA 2JEJA 4PR6A 4NZ6A 4LBHA 4JBCA 2ZOFA 3OLBA 2R7WA 2BQ3A 2YX1A 3IG1A 5F8GA 2IM0A 2UXBJ 3BS9A 3MEGB 3DLGB 4NLUA 5A76A 2WAQD 4YUDA 3I31A 1N8RT 3QGHA 3DI6A 4DFMA 1FE4A 2ROPA 1SQEA 2I38A 3LGHA 2QIFA 4QWBA 3H7HB 2MZJA 1WKJA 2MQOA 3MEEB 2FHKA 3BH6B 4H4MB 4CLUA 2C42A 2C1EB 1NZAA 4DPTA 1KLNA 1S49A 3GWCA 2ZBRA 5CHCB 2IHR1 5IQQA 2VBYA 4XIUA 5KG7A 4X4TA 4MIWA 3HK2A 2Y1LB 2R2TA 4I2QA 4NLOA 4DL7A 5HP1B 3CJRA 4KGKA 4C48A 1Y10A 1U0HA 3CDUA 2M88A 1TKZB 3HHLC 3TW0A 3IBFB 2EC2A 2HHHJ 3BGUA 1CJKA 5C42B 3QRPA 4DV7F 4ZVFA 3QSIA 3VZHA 1HNIA 3NRBA 2ZJPQ 1R27B 1S1VB 3EICA 4A8QA 3QATA 1UJ4A 3VTIA 1IN0A 4F2RA 1ZM2A 2ZM6F 1YBUA 4DV5F 3VV2B 4QCLA 1RWXB 4P74A 4BWMA 1UTAA 1YSJA 4LF7F 1AFJA 2K1RA 5CYMB 2XGQA 1K9MT 4IFVA 4O44A 4P6QA 3AA9A 4DR1F 1Z4UA 2JDJA 5EWFA 3DU5A 2UV8A 5KG4A 3DLBA 5CXTA 3ZNUA 5ETVA 1VQYA 5HO4A 2KXFA 4MYUA 2MZRA 2JRSA 4UW2A 1ZZNA 4OLPA 4XDDA 4P73A 4ZPAA 1EARA 1N6QA 3GCWP 2UUAF 3GFXA 1C0TA 5K9FA 1FERA 3I96A 1GNKA 3H5SA 1SC1B 2W4PA 3VAJA 1B3TA 2OPRA 4ZA1A 5KFCA 5AXNA 3BBBA 2B4UA 2CJAA 4NRUA 4RW6A 1X4DA 2CRLA 4URQU 2E66A 3MPDA 5SUHA 2CADA 4ZP7A 1RWPB 2HBYB 1LWEA 3M8PB 3EE3A 4TLRA 2ZKTA 7FDRA 2HMIB 1MROA 3AJDA 3C6UA 4DF4A 2LDIA 3NGSA 4MTPA 4PQAA 3F0NA 1VJWA 1V3SA 2HIYA 1S79A 1U09A 2CIMA 2B4PA 4MFBA 3CIZA 1I94F 3IC1A 4KC5A 2E5LF 4RWXA 1K8AT 4WU2A 4NCGB 2EKYA 1WC5A 2P6TA 8ATCB 3CCLS 4IG0A 1RWNB 4OZNA 1RAGB 2FLLA 3BYPA 1RWKB 3NNHA 5KG2A 5KFWA 2DB1A 1REVA 3I0RA 1LK5A 2YVSA 1VRQC 3KJNB 3BJYA 3KWMA 1DRZA 1HIYA 2B6AA 3UD3P 4Q5VA 4DN9A 1GXTA 5KFIA 3ZZPA 3G82A 2DHXA 2U1AA 4USIA 1OQ6A 3GU0A 4W90B 4YB7A 3SDEB 3DRPB 3CC2S 2DPJA 4OIXA 1RDRA 1RT7B 4PG7A 1S9FA 1M5VC 3BM7A 3R7NB 2J9DE 4ED2A 2AEMA 3R2DJ 3HKWA 2DTJA 4B9SA 2B8QA 5KFVA 2MZQA 2XMTA 2NZ4A 3LP2A 1B0PA 3PX4A 2XB2D 3OFFA 4M8LA 4J9VA 4N41A 1NH8A 3KDNA 4X4UA 2VIHA 1IBMJ 3MUVP 2LU2A 4N8OA 5KFNA 4X66F 4UQGA 3ZTOA 1NSKL 4ZMMA 2ZBIA 2C3YA 1R31A 4ED7A 1YK9A 2CYYA 4URGA 5KFGA 1BQNA 3RGIA 1KKHA 4PG6A 1PYTA 4F0KA 1LNQA 4PRFA 1FWPA 1NZ8A 4Y65A 1S6PA 1RWOB 3GIRA 1RJJA 3N4WA 2JX2A 1IKXA 3UD5A 2YNFB 1WORA 1JLGA 5GAHI 1AXQA 1DTQA 3HHLB 2JZ5A 4ECVA 5L8RC 1X60A 2W9CB 2VV5A 1Y5LB 4G1QB 4X64J 1ZZFA 2K7KA 5L1IA 4I67A 3DM2A 4BLGA 2ILYA 2VQFJ 5D4NA 2UXBF 1VQ8S 4DV3J 1RISA 2KRRA 2XHCA 3MM6B 1UA0A 4J91A 4GVBB 4FXVA 1N34J 5U47A 1D9AA 4UUXA 5CABA 3TVZA 4U7CA 4LSNB 4XK8C 2YWWA 4AYBD 2RQ4A 1N88A 2YY3A 5L1KA 5F8LA 1U6FA 1FX2A 2F5GA 5IV3A 4WJBA 2MQQA 1IBCB 5C5JA 3PRDA 4AFFA 2XMVA 2XS7A 2EWHA 4ZPWR 1YVFA 3B4MA 4JI8F 4MKAA 2ERRA 2VPWB 4DL5A 1EHWA 3D6MB 4OMFG 1VK3A 2CPJA 2GAGC 2DGSA 3SQGB 3SIPB 1T05B 3V4IA 4IH7A 2XQCA 4M5KA 2WSEC 3C15B 3CUNA 1WSRA 5BR8J 4RU9A 4I64A 1X5TA 2P9EA 1VI7A 3KLVA 3QNWB 4NA3A 4KGMA 2VODA 1HR0F 2G13A 1B7YB 4YB6A 2QE5A 1JLBA 5MAOA 1RU2A 4DL3A 3JYTB 2EW9A 1U49A 3HVRA 2BEFA 3TZZA 1YZ6A 2VZ9A 2NXJA 2KZZA 1SC3B 4OHVA 1CJVA 1TU0B 3RW7A 3GMGA 3BR9A 1J5OA 4KB7A 5KFRA 1RTHA 3IG1B 1IJEB 1ZOTA 3TZXA 5E3QA 3QFHA 1KTVA 3ISND 2C2NA 1VBZA 4XPEA 3ZZUA 4K5SA 2XMAA 2CQ3A 3GZ7A 3WQPA 3M8QA 4QIGA 4C4WA 3NS7B 5GVQA 3H5XA 3OBIA 4Y2IA 1JXLA 1K1QA 4QYZK 2IVYA 2L9WA 4F04B 2A6MA 1JXVA 5A2QY 5HAOA 4I2QB 1IBKJ 1OY9A 3DXBA 1M5PC 2WZ1A 2CNLB 3OR2A 2YKAA 3SEOA 1CJKB 3I5CA 1WOOA 1TL7A 1U45A 4FYWB 4U7UK 3KJVA 3K58A 2BM1A 1LV5A 4OI2A 1AUSL 1AYEA 1GTEA 1Q7LB 2UUBJ 4CLPA 2OLWA 3PVXA 2A1BA 4BDPA 3HFZB 4RW9A 4NLYA 3RR7A 4DPWA 4HEA9 3QT5A 1SQFA 3EJMA 1WC4A 4F7VA 2K1RB 4B3OA 3KUHA 2QTWA 3MR5A 5CH7B 2B4VA 1RT3A 2L9NA 3PHEA 3SCLE 1QSYA 2CNOB 4LF6F 2WVDA 3OJUA 1K1SA 2UUWA 1AT1B 1DY3A 4JI7J 2FHMA 2BOPA 2BJ1A 3EUNA 2PSZA 3BDPA 1F2HA 1WG4A 1N6QB 4YB5A 2E9TA 1XR7A 1OQ3A 2IMOA 4B3SF 3ICLA 2FJWA 3UDEA 1XJWB 1Y7PA 3KJQB 1XNRF 3W8GA 1C0TB 2XHWA 1M1HA 4OZLA 3DN9A 2FJEB 3FRYA 3T6JA 3T5KA 1PGZA 1WELA 1FRHA 2B4OA 4U96A 4RW6B 5ADZA 3RRHA 1RBOB 3ILJA 2BBEA 1UWBA 3VAFA 1G4CA 2QG9B 3O3LA 3NOGA 1IBMF 4K5RA 2Y8WA 1SKRA 2V34A 2N82B 1LWEB 1R89A 4IO1A 1SJ1A 3C16B 4M5DA 1MROB 3C6UB 2Y9HA 1OY8A 2KI2A 1CPZA 4QJVA 3V81A 1CQMA 3IRXA 4ZJQA 4MFBB 5GAHU 5HROA 2UV8G 3NWRA 2XS5A 1KFDA 3D1QA 4EFAC 1PJ7A 2AEFA 3OQ2A 1VMBA 3W9JA 1OSCA 1REVB 1RHJB 1BHNA 2F40A 3R1LA 1HWJA 2V63A 4F3MA 3IO1A 4PWUA 1TAQA 1S97A 8AT1B 3BSAA 4BWJA 3G82B 3TYTA 5DO2A 1H38A 3MTJA 2XI3A 2CQDA 2BXJA 4DSFA 4TN2A 2VQFF 4FNIA 1VRUA 1WNEA 3D3CJ 3LP0B 1OYDA 3DRRB 1BWEA 2CDRB 1IR0A 4YP3A 2QEXS 3A1YG 3AD8C 1WHWA 3M6WA 4R25A 1QSLA 2HQGA 1S1UA 3P5TL 3RTVA 5IFMA 3FSXA 4FBTA 3LP2B 3ELHA 4CTAA 3FSYA 2UXCJ 2KJWA 5DM6Q 2F3JA 5DDOC 3FSIA 1KBRA 2KHCA 4IYQA 2HHTA 1YTYA 5DQHA 2W7PA 4JI1J 4Y2KA 2IYIA 2KH9A 2BKOA 1GEHA 1Q4RA 1V3ZA 3V6DA 4KIAA 1DQAA 2R8HA 2VASA 2UP1A 1WUUA 2L9DA 4JI4J 2DR6A 1MMNA 2UXDF 2GCFA 2ROEA 4ZIWA 2DXFA 3DLEA 1BQNB 1FKPA 3J81Y 1UWAA 1YIJS 1TL3B 1EJ7L 4NLDA 3OVBA 4WE1B 2BUNA 2V8VA 1EQ0A 4LVOP 2BW2A 5CAAA 2QX0A 5F0WA 2HGNA 2RDIA 5E7OB 5ETLA 1JLGB 4HTJA 4FF4A 4ETZA 3PRBA 2ADCA 2W24A 5GAEI 2RQCA 3M8YA 4YR2A 5CYQA 4DWIA 3DM2B 2JC1A 2ZE2A 3GV7B 3FMWA 5FLXU 1CULA 2WOMA 3HVTB 3VR1A 2VQEJ 4NLPA 5HQ8A 4E8UA 3AJ2A 1EKSA 2QO3A 4KGZB 3M8WA 1R0AA 1M1GA 3CCWA 4PWDA 1AZSA 3PZPA 2WONA 3WDOA 2ZHAA 2KHDA 3HM9A 1IKVB 4CO3A 2GW8A 4RBVA 3TJ9A 2XZTB 2WTFA 3M05A 2OPPA 4ECQA 1LKZA 5KFUA 5L46A 4NX9A 1FRJA 3GIMA 5DZ6A 3ILOA 1WJ9A 2BE7D 3ETMA 4M5GA 3H4DA 4DX6A 1IBKF 3H25A 2M9KA 3CCVS 2FVCA 3D6HB 2P9GA 1O5JA 4EGLA 3JAMU 3V4IB 4LRDA 3J7ZT 1NJXA 1RTDA 2HEKA 2QJ3A 4OV6A 5GMDA 1Q8KA 3IM9A 1ZPWX 3QT7A 3DLLQ 2OTLS 1HNWJ 5CCMA 2R8IA 3SQOP 2HVEA 2MY7A 5JMNA 3KLFA 1KVJA 2CWXA 2DNZA 4P71A 1S1XA 1JLBB 3DDNA 1FTCA 2MKCA 3BSCA 3R5DA 3W3SA 2IRYA 2HQCA 2HFOA 2QLJB 4OYZA 5LJ5Y 1SUQA 2KT2A 3HSDA 3SSRA 1CJVB 1WF2A 3RAXA 2JLGA 4B3TJ 1SV5A 2KYXA 2G2YA 4XO0A 3WZ0A 4M5NA 5KT6A 1UVKA 1RTHB 1TL1B 1FEEA 2DGXA 4PXCA 1HNXJ 4TU8A 2VG7A 1NXIA 2V68A 5DG7A 2FJAB 1L3TA 5KFDA 1KWMA 2MQLA 5MLCV 5KFLA 3MURP 4TYAA 1JLFA 3FDSA 5C24A 1U47A 1WOSA 4UQTA 1YZ7A 2RS2A 4U67Q 3M8QB 2C2RA 2DKOB 3CDBA 4O3OA 3JSBA 4ECUA 1TL4A 2HWIA 3D0IE 3CDEA 2DNMA 2H4WB 2LXFA 1HBMB 4TU9A 3FGVA 3PKYA 5LSRA 3O2IA 1KHVA 2WVEA 1L3KA 1JLAA 4EK2A 3ET6B 5KFSA 4GMKA 3MMBA 3OR2B 4MK9A 5H1SV 2CG4A 4WP3A 2QYCA 3H98A 3D3BJ 1BUXA 3JTNA 4QWCA 1NJIT 2BE2B 2AT1B 3EDRB 5ETKA 4IRKA 2R8KA 3PCOB 3NMAA 2G0JA 2G0CA 1HHSA 1TL7B 3K2YA 5F3TA 2KB2A 4EBCA 3M6VA 2GC8A 3KJVB 2YXLA 3BB5A 4ZVRB 1V5VA 4OZ0A 3PXGa 4YEAA 4JI6J 4J9PA 2DGTA 1M5HA 1SL1A 1GQEA 3MR6A 4N8NA 5KFOA 3R9LA 4ZDNA 3GYXB 1VDHA 5DGBA 1WHYA 2NXCA 1S57A 2RKIA 2Z2ZA 4NA2A 3DCAA 2EFNA 2CJKA 1WDDA 2DNOA 3M32B 1FNXH 2VFRA 1S9EA 4ZVOB 4B3OB 1Y0HA 2JL9A 3DRYA 1TUVA 5C2GA 3KNAA 3VGUA 4CLSA 3W9IA 4IDKA 3OD2A 5D0EA 3GE9A 2IM3A 3GYNA 1U7LA 3R5CA 3IRWP 2F4VJ 4DX5A 4ER8A 1NK9A 4X62J 4USMA 1XMBA 4UOCA 2IRXA 4C8YA 4C98A 1HNZJ 1L3VA 2HK3A 4P10A 3VF0B 2ZWPA 1NDKA 4DBQA 1QY7A 4FYYB 4RWWA 4LFAF 1VCTA 2L08A 2IVMA 4QIVA 1IBLF 3HI9A 4PQUA 2LCWA 3G6VA 4QR1A 1Q8BA 2KJVA 1SPBP 1B70B 3CGIA 4CLTA 3CEDA 1WSVA 1UWBB 2BJEA 3TAMB 3TOQA 1B0TA 3D5MA 2XYHB 4C6AA 4WKYA 2AYMA 4JI4F 4Y34A 2DNKA 2PI5A 2LKZA 2KZMA 1ICEB 2OUGA 4YQWA 1XIQA 3M2VA 5KFXA 2ZZTA 3R5BA 2VKZG 3R3TA 4O3NA 1F5CA 3MOZA 3QIPA 2HVDA 1FXDA 1XERA 4FYVB 3DMJA 3I6PA 1XQIA 1WKKA 1RP5A 4U8VA 3H5YA 4UZCA 1Q82T 4NXNF 2Y0SD 1AA1B 3MDFA 2MLYA 2RU9A 4ENOA 5HMWA 5GAEU 2ASDA 3I5BA 4L6V3 2O3DA 4S0MA 2HZVA 3SI8A 3BGRB 2ZJQQ 1FK9A 5ETNA 1JQGA 4C11A 3OFEA 3QAUA 3OLAA 4QW8A 2GMJA 2KT5A 4P2SA 4X4OA 1NM2A 2AU0A 4ES1A 3EXCX 4IKAA 1KOOA 3QWPA 4CLFA 3GPAA 2MEWA 2G2OA 4OZ5A 3CSKA 3G96A 1IVZA 4DCJB 1S1UB 3E3XA 2MQNA 2AJQA 3V6HA 2VICA 4CTAB 4JYAJ 2FDNA 2Q3PA 5KT3A 2BQUA 3OTBA 3IWNC 3TVYA 2KL8A 2LDYA 3A3OB 2BQRA 5LM7E 1KC8T 4QU7A 5AJ3F 2RH3A 1UMJA 3PFEA 1NKCA 5CZVA 3ZTRA 1FHTA 3PW7A 4ALZA 1FKOA 1FKPB 4EMDA 2RIJA 4ZPCA 2QMUB 5D0HA 1NBEB 4K8RA 3THPA 4AQYJ 3T5LA 2DY1A 3CCZA 5BXIA 2I9SA 2GVDA 3G6XA 4G3IA 1HNWF 1Q5VA 5K8PA 4K59A 3E51A 4Z7YA 1R0BG 2ASLA 4ZVUB 3IA0A 1T3NA 1VHFA 2GMHA 1S4FA 4LFBJ 1X4AA 2IFXA 2VG5A 4A8OA 3MWBA 3IR7B 1NRKA 2PT0A
chains in the Genus database with same CATH topology
5ETSA 3MCMA 1EQMA 3KUHA 3ILJA 5ETLA 3KUEA 5ETNA 3HCXA 1CBKA 2CG8A 3HD1A 5ETQA 1Q0NA 2F63A 3HSZA 5ETKA 1EX8A 3HSDA 3MCNA 1IM6A 4PZVA 1TMJA 1G4CA 3IP0A 2BMBA 4CYUA 1F9HA 3ILLA 4M5KA 4M5MA 1EQ0A 5ETTA 3QBCA 3HD2A 1RB0A 1KBRA 3ILOA 4M5IA 3HSJA 3ILIA 2QX0A 1RU1A 3MCOA 5ETMA 4CRJA 4M5LA 1HKAA 5ETPA 1RU2A 1TMMA 1HQ2A 4M5HA 3HT0A 3HSGA 4M5JA 4M5NA 1RTZA 3UDEA 4CYUB 4M5GA 5ETVA 5ETOA 1DY3A 5ETRA 3UDVA 3UD5A 4AD6A 2F65A 4F7VA 1RAOA 3KUGA 4CWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETS A;  3MCM A;  1EQM A;  3KUH A;  3ILJ A;  5ETL A;  3KUE A;  5ETN A;  3HCX A;  1CBK A;  2CG8 A;  3HD1 A;  5ETQ A;  1Q0N A;  2F63 A;  3HSZ A;  5ETK A;  1EX8 A;  3HSD A;  3MCN A;  1IM6 A;  4PZV A;  1TMJ A;  1G4C A;  3IP0 A;  2BMB A;  4CYU A;  1F9H A;  3ILL A;  4M5K A;  4M5M A;  1EQ0 A;  5ETT A;  3QBC A;  3HD2 A;  1RB0 A;  1KBR A;  3ILO A;  4M5I A;  3HSJ A;  3ILI A;  2QX0 A;  1RU1 A;  3MCO A;  5ETM A;  4CRJ A;  4M5L A;  1HKA A;  5ETP A;  1RU2 A;  1TMM A;  1HQ2 A;  4M5H A;  3HT0 A;  3HSG A;  4M5J A;  4M5N A;  1RTZ A;  3UDE A;  4CYU B;  4M5G A;  5ETV A;  5ETO A;  1DY3 A;  5ETR A;  3UDV A;  3UD5 A;  4AD6 A;  2F65 A;  4F7V A;  1RAO A;  3KUG A;  4CWB A; 
#chains in the Genus database with same CATH topology
 2DH7 A;  3PIP Q;  5HL7 Q;  4B3T F;  2PA3 A;  3T41 A;  2B9X A;  1UEK A;  5CYQ B;  4RZR A;  2K3I A;  1FFG B;  3EWG A;  2ZE2 B;  2DXE A;  1XEZ A;  2YBV A;  3N28 A;  2HFS A;  2AJ2 A;  1CUL B;  1SIW B;  2IY5 B;  3TI0 A;  1RT4 A;  3U1L A;  3AT1 B;  2RU3 A;  3K5P A;  1CSJ A;  4NLS A;  2CPD A;  1R0A B;  5D4P A;  3N01 A;  2NSB A;  5FDL A;  2YKP A;  1AZS B;  2WON B;  4DR3 J;  3ENW A;  1TMM A;  1IM4 A;  2KDO A;  2IA0 A;  3AD7 C;  2GGP A;  3ISN C;  2QMX A;  2CFX A;  2OPP B;  3JXO A;  4LQ9 A;  3GP9 A;  2GQC A;  4LMZ A;  1BMQ B;  4DXL A;  5LOQ A;  2HGL A;  2BX6 A;  1NU4 A;  3HFK A;  4O4G A;  3JSY A;  1RTD B;  4A8M P;  1VLY A;  3M9O B;  2I8E A;  4RW4 A;  5M2P A;  4M95 A;  5DLG A;  2WBR A;  2Z30 B;  2DRD A;  4C8Z A;  5I3P A;  2R8J A;  5BYR A;  4DFP A;  1X4E A;  3KLF B;  1X0F A;  4WCE Q;  2LLZ A;  3HHL D;  1GK8 A;  4JI6 F;  4ZPT R;  3HT0 A;  1S1X B;  4CO5 A;  1PIL A;  4Z2X A;  4DQR A;  3KDO A;  5E3A A;  2R9L A;  2R7V A;  3TNV A;  1SUQ B;  4ECS A;  3QID A;  3QJL A;  2QLF B;  3D68 A;  3C2P A;  5B09 A;  4ZS6 A;  2HS0 A;  5DZ7 A;  4PEO A;  2C2M B;  2X1A A;  3I0S A;  1FJ7 A;  1UFK A;  1W2B R;  2VG7 B;  3AH6 A;  2ZEJ A;  1ZAW A;  4GVL A;  2OH2 A;  2HFV A;  2BJ7 A;  4CRJ A;  4CNZ A;  2YKM B;  5HJX A;  4X62 F;  3GV8 B;  2RQM A;  4LF1 A;  5FD1 A;  5AT1 B;  1N54 B;  4L3N A;  4C97 A;  1FD8 A;  2HRU A;  1HNZ F;  2CQH A;  1Y9O A;  4CO2 A;  2FY8 A;  3N79 A;  3OTC A;  2AJF E;  1R6V A;  3RYL A;  5J2P B;  1U6B A;  4TKT A;  3OTD A;  3TUP A;  1GMV A;  2R7Q A;  4M5M A;  4LUB A;  4I6W A;  1UVN A;  3MEK A;  2ASY A;  2HQI A;  3LAL A;  4U8Y A;  1GX5 A;  4EBE A;  3MMB B;  3ITH A;  1DQ9 A;  4OI3 A;  2V69 A;  3RB4 A;  1VHI A;  1WEZ A;  3P4U B;  4H54 A;  3R27 A;  2EC0 A;  4YOE A;  2ZZM A;  2FQQ B;  2AYB A;  4OHW A;  4BHQ A;  3ZZO A;  3HPO A;  3T1H J;  2KVQ E;  3H2V E;  3IXQ A;  2HFU A;  1KLM A;  1DJ0 A;  1SQG A;  4FPI A;  3I87 A;  3SXL A;  4OFZ A;  3CD6 S;  2NS1 B;  2P8I A;  3CCT A;  4WP9 A;  4TVA B;  2RKI B;  1ZPV A;  1S72 S;  4B3M F;  3M8S A;  1N5V A;  4ZP9 A;  1YDL A;  4B08 A;  3D0G E;  3KHL A;  3C6T A;  4U9R A;  3HVW A;  1T9W A;  1SJ3 P;  4QZV B;  1C4A A;  2SXL A;  1G3O A;  4AE5 A;  2LQJ A;  3OW2 R;  4IDK B;  3ZZ0 A;  5E3R A;  5I3Q A;  4D3G A;  4OYB A;  1BWV A;  3QRQ A;  3OSN A;  1VQP S;  2V4R A;  1F9E B;  1XTZ A;  2ZOM A;  3MPV A;  2DNY A;  1C0U B;  2VKR A;  3ZO7 A;  1T03 A;  4FYX B;  2HRT A;  2CQI A;  4CQ1 A;  4OQJ A;  1JLC A;  4NPO A;  1OPZ A;  3FVY A;  3GG1 A;  1HHT P;  1NDL A;  2XY5 A;  2YQ3 A;  4IG3 A;  2VG6 A;  2M8H A;  4P75 A;  3DU6 A;  4NL5 A;  3W2V A;  1WC0 A;  3BF4 A;  2A6O A;  3PG9 A;  3NOC A;  4F50 A;  3DGV A;  3Q8P B;  4WFN Q;  4ZCI A;  1HNV A;  2UUC J;  4ZP8 A;  1R0C B;  2Z56 B;  5D0G A;  3B6B A;  4DLE A;  4J9N A;  1UZD A;  4ED8 A;  3LWM A;  4Q8F A;  2XY6 A;  1VLO A;  1H72 C;  3CCS S;  4G6V B;  1VJQ A;  2DH8 A;  3LAN A;  3MEC B;  3TRG A;  2HNY A;  3IWL A;  3TAQ A;  2YWG A;  5KG3 A;  1SB6 A;  1IXK A;  2ROG A;  2ZH8 A;  3M2R A;  2J9D A;  2ALZ A;  4K4W A;  2KFZ A;  3M2V B;  1BXN A;  3C14 A;  2NXE A;  2FJV A;  4DUY J;  5JUM A;  3QIP B;  2XMK A;  4IFY A;  5DM7 Q;  5HSP A;  4NZ7 A;  3MED A;  2FIU A;  4NYO A;  3PYG A;  1L3S A;  2K2P A;  2IJF A;  4AT1 B;  4MMO A;  1RAO A;  4UST A;  2XO7 A;  2ZHB A;  1LW0 A;  1FK9 B;  4LFB F;  1KS2 A;  5KT4 A;  4J9M A;  4LVN P;  1TMJ A;  4C11 B;  2BM0 A;  3QGG A;  1UKU A;  3BH7 B;  4ZHR B;  1XR5 A;  1QAI A;  2D69 A;  4EZ6 A;  3SBM A;  5L39 A;  1HBU A;  3UDC A;  4KHM A;  4M94 A;  3EVO A;  2XSF A;  4LFC J;  1YRU A;  5KFJ A;  3DC2 A;  3EPG A;  1SJQ A;  4B9L A;  1HQE A;  4JUZ A;  4WYL A;  1NPK A;  2H4Y B;  1UW4 A;  2DK2 A;  1Q86 T;  5JVH Q;  3HSJ A;  3TUJ C;  2W25 A;  5HVG A;  4EYH B;  2OO4 A;  2AJ4 A;  2XUL A;  4B02 A;  4I0W A;  3M9M B;  2AGO A;  3R5J B;  4OX9 F;  4DR4 J;  1M5S A;  4HT5 A;  1HD1 A;  2HFN A;  4IRD A;  3M1V A;  4F2S A;  1S4E A;  4O3R A;  3DLG A;  1S5Z A;  2B7C B;  1CVJ A;  3ZZR A;  3BZQ A;  4G1P A;  3D7S B;  3ENQ A;  3W66 A;  4LIW A;  4R5P B;  1E6Y A;  2IMW P;  4ZJO A;  3ZTP A;  1NKB A;  1WG1 A;  4LF8 F;  1JX4 A;  3R5A A;  4RBU A;  3ISZ A;  2GVD B;  3KG0 A;  4TY8 B;  2E9R X;  1KOH A;  4IOB A;  3AD9 C;  2QV6 A;  3K5N A;  1X4G A;  4H4K A;  3ETO A;  2MPU A;  2X1G A;  2KXN B;  2AWZ A;  3D1O A;  2RRB A;  5ETM A;  1CS4 A;  1P8G A;  1MG7 A;  1PC4 A;  2VG5 B;  3BQ1 A;  2EBE A;  5GMK a;  2CJ9 A;  3GR1 A;  2IBK A;  3QZ8 A;  2HHP A;  5HP1 A;  2CG8 A;  2Z4P A;  1FFW B;  3P49 B;  4CM0 A;  1JLQ B;  3UI3 A;  2ADB A;  9RUB A;  4KHR A;  2RAQ A;  3R97 A;  1KDN A;  1Y00 A;  3S01 A;  1KRP A;  3RUB L;  2PMW A;  1DAR A;  2U2F A;  4PG5 A;  2JWN A;  5FDL B;  4MIB A;  2XO6 A;  4ERD A;  5D15 A;  2ALY B;  2B51 A;  5LMU F;  3KJF B;  1YWX A;  3RBZ A;  3EGV A;  2C2D A;  3K8V A;  3N6L A;  2RB7 A;  1P9Y A;  1RCO B;  2ZH6 A;  3GIK A;  2EFO A;  1I5O B;  3KNG A;  3L7O A;  1FRK A;  1F5B A;  2JLE A;  1V3R A;  2H3E B;  4O4G B;  1SBR A;  1Z1Z A;  4DDF A;  2VHG A;  2FVQ A;  4ECR A;  2XY7 A;  3G87 A;  3N0V A;  4QU6 A;  1N0U A;  3BGL A;  4DV0 J;  5IV4 A;  2PO4 A;  3Q2S C;  1A6L A;  3O8W A;  2KG0 A;  4F3O A;  1B7F A;  1WTF A;  1YJ7 A;  4DR7 F;  2LEP A;  3T1H F;  4DR6 F;  4FS1 A;  4J9S A;  3IGN A;  4X4V A;  2J8S A;  4F4Z A;  2CJY B;  4U95 A;  5D8H B;  2HZC A;  3JSM A;  3FFI A;  4ES3 A;  2BYC A;  2AP6 A;  3O6Q A;  4IH6 A;  4EYI B;  4USJ C;  1UET A;  2BRK A;  2B43 A;  2IDL A;  4TYB A;  2J0Q D;  3HJF A;  5DQI A;  1BLU A;  4NXM J;  2F65 A;  2FLP A;  3L4B C;  4C8N A;  2OEK A;  2OMO A;  5IM0 A;  2OIH A;  3BKF A;  3OL8 A;  4DPO A;  3I0S B;  2UZA A;  1P1L A;  2JOQ A;  2HS3 A;  1R43 A;  3GG0 A;  3DOM A;  2HWT A;  3KKF A;  5EWG A;  1YJT A;  4DI6 A;  3MAA A;  4NLV A;  3BSN A;  5KFT A;  1T9U A;  1VQS A;  1FI4 A;  3EPI A;  3GJR B;  3MMA A;  1I3O B;  3TA2 A;  4J5O A;  2XWY A;  1N36 J;  4M5J A;  4NCG A;  2J0S D;  4OLO A;  2N7Y A;  3MPU B;  2VD3 A;  1S10 A;  2J0W A;  2JEG A;  3GII A;  4LRB A;  1REG X;  5CQG A;  2FHO B;  3D28 A;  4H4K C;  3H2L A;  4YR3 A;  4A8X A;  5HVF A;  5ETR A;  2BKN A;  4KGX B;  2UUC F;  3LUY A;  3VAM A;  2ZOG A;  3HMJ G;  3UVJ A;  3ITH B;  1AUD A;  2XTJ P;  4J9U E;  3QWU A;  3SDE A;  2K7J A;  3DRP A;  3BKU A;  2K8G A;  3TQ1 A;  2IC3 A;  4F4Y A;  2BOA A;  4DV2 J;  1S0M A;  1L5U A;  1FJC A;  2HNZ A;  1UEV A;  3JSR A;  5ETQ A;  1KLM B;  3MPW A;  1FDN A;  1RYS A;  2E7V A;  5A8R A;  1TKX A;  3RU0 A;  2Y1R I;  2XMU A;  5I3U A;  4DUY F;  4X4R A;  2E1C A;  1CLF A;  1B99 A;  2APO A;  1LWC A;  2XMW A;  5AXL A;  3C6T B;  5HVH A;  2ZH4 A;  2DGV A;  2LXI A;  1OWX A;  3OXG A;  1VC6 A;  3BSO A;  2BKP A;  1F3F A;  1Y5I B;  2HHQ A;  2FC8 A;  4EO6 A;  3HFV A;  2HQF A;  1UP1 A;  1T9V A;  1FTR A;  3L7P A;  2CWK A;  2M2B A;  2OD4 A;  3FZ2 A;  2FZG B;  4FF3 A;  1RQ0 A;  1Q1K A;  1T03 B;  2C22 A;  4GO7 X;  3UN3 A;  1SIZ A;  3W63 A;  2K3K A;  2RUS A;  3PHT A;  3BQ0 A;  1H2U X;  3TZY A;  4DL0 C;  2J6U A;  2MY8 A;  4IG3 B;  4RKU C;  1X5O A;  4KPY A;  2OHD A;  2IIH A;  3V6K A;  3PX0 A;  3RBE A;  4A8W A;  2YNF A;  4K2J A;  2D3O 1;  1VBY A;  5EX0 A;  8RUC A;  2OPS A;  2WVF A;  1X8D A;  3CJ8 A;  4LF2 A;  3DKD A;  1HNV B;  2G2Z A;  3JTO A;  1XC9 A;  2B3T B;  2X51 A;  4R8U B;  1Q95 G;  2CZ4 A;  4PPD A;  3W5Y A;  4CT8 A;  1GMW A;  2CQG A;  2OJ3 A;  2R7T A;  2WRM A;  2HNY B;  2IAJ B;  4OHX A;  3NCP A;  1R8P A;  3G8T A;  3J80 Y;  3IFE A;  2PC6 A;  3HHD A;  3E2E A;  4IR9 A;  1JJ4 A;  1UPM B;  5KFH A;  4U6P A;  2DNH A;  3C14 B;  3MR2 A;  1YGY A;  4NWB A;  1RZM A;  1SJ4 P;  4IFY B;  1M90 T;  4JP8 A;  2KT3 A;  3K89 A;  1P9Q C;  3MM8 B;  3SCJ E;  3MFH A;  5A2Q U;  2JSX A;  2K06 A;  2HBZ B;  2JC0 A;  2CQB A;  3AAW B;  4KFB B;  3ENA A;  3D1H A;  3U1M A;  1YJW S;  3LAM A;  1VQM S;  1KON A;  1LW0 B;  3BEG B;  3QYY A;  4GKJ J;  3TAN A;  4ZVQ B;  3DLH A;  3J7A N;  4AL7 A;  2MZT A;  3LGM A;  1EB0 A;  2EPI A;  2CKW A;  3M6X A;  2QMW A;  3BO4 A;  5KG0 A;  2HND B;  4E98 A;  5KFE A;  1N56 A;  1RWU A;  4ZVP B;  1HBO B;  1N5T A;  3CCE S;  1HBU B;  4ZLN A;  5F8I A;  1Q53 A;  3CW2 C;  2F9J A;  1FJG J;  2AZ1 A;  3CD5 A;  3NMR A;  2BJ8 A;  3BO3 A;  4LF5 J;  2JVO A;  4KQZ A;  5LSO A;  3SCK E;  1RT5 A;  2MKK A;  1YRT A;  3FRZ A;  1K0T A;  1HQE B;  1RT1 A;  3LOU A;  4DR5 J;  3GLJ A;  1S6Q B;  3UQS A;  3GFY A;  3CJ4 A;  2ZJR Q;  1MSW D;  1RWM B;  4DZ6 A;  4DFK A;  2IJN A;  4Q8E A;  2YNI B;  3CT9 A;  1RWW B;  3LH2 S;  2WSF C;  3M1V B;  4KKO A;  1R6Y A;  4YR0 A;  2EI5 A;  1QAY A;  1F60 B;  3R6G B;  4ED1 A;  1NME B;  1SH3 A;  2I1R A;  5LMN F;  5B0F A;  4LRF A;  1NUE A;  3KK3 A;  1E6Y B;  1EKR A;  2W2P P;  4ED4 A;  4I6Y A;  3G4S S;  3JQM A;  2CPE A;  5THW A;  3W65 A;  5I42 A;  2BW7 A;  2BJ3 A;  1YJU A;  1VBK A;  2PN6 A;  2ZHO A;  5HJY A;  1Y4Z B;  1ARO P;  1HQ2 A;  1TV6 A;  4ILR A;  1CS4 B;  4OZ3 A;  4P9S A;  5K8M A;  3NGD A;  5KFA A;  4Y0F A;  5GAG U;  1SJF A;  3CJ3 A;  2LQ9 A;  2PFD A;  3T5J A;  3TJ8 A;  1DUR A;  1N32 J;  2I0X A;  1NH7 A;  3BKT A;  2PDA A;  3NAI A;  1TKT A;  1X9S A;  2M8D B;  2VBX A;  2RD5 C;  1Q0N A;  3OJS A;  1ZAV A;  3K5L A;  3OFG A;  4DV1 F;  2MXY A;  5E33 A;  4C8K A;  1TK5 A;  2HIQ A;  1URR A;  4RJV A;  3K8W A;  1S6U A;  3MPY A;  1IQZ A;  2OFG X;  3NP5 A;  4PYA A;  2R42 A;  4PCQ A;  2ZUG A;  2V2Q A;  3IBW A;  4PAA A;  1RTJ A;  1N36 F;  2Q43 A;  3FKB A;  2HHW A;  4DSE A;  5J1P A;  3T1A A;  2YTC A;  4M63 A;  3H8Y A;  5KT5 A;  3HSG A;  3VAI A;  3TP2 A;  3Q8U A;  4CI0 B;  3US5 A;  2VF3 A;  5FLX Y;  1UFW A;  5J1N A;  3ZTQ A;  3MMJ A;  5T7L A;  1Y11 A;  5G4D A;  5DRK A;  1C1C B;  4XPC A;  5GAD I;  4X4Q A;  5DET A;  3MM7 A;  4P7V A;  3LA0 A;  2B9E A;  3LAK A;  3NBP A;  4OJ1 A;  3CCQ S;  2NRE A;  1NJZ A;  5J2Q A;  1U24 A;  3DHX A;  4DV2 F;  1UA1 A;  2HHV A;  1LXJ A;  4M5I A;  4CLL A;  2WHO A;  1U1Q A;  4F67 A;  3JSM B;  3PO4 A;  3Q8Y A;  1QE1 A;  3FFI B;  3OTE A;  3PR5 B;  4J9R A;  1X7V A;  2N4C A;  4PZV A;  1BE4 A;  1J5E J;  4OZ1 A;  2VUG A;  1TKD A;  3ZFV A;  4C3K A;  4UT4 A;  1RT6 A;  1YHQ S;  2HSE B;  3OUY B;  3R8Y A;  5D6G A;  3VVT A;  5IM0 B;  4NI2 B;  4FVC A;  4KGV B;  1GX6 A;  3FZB A;  2XZW A;  3D6F B;  3I82 A;  3DOM B;  4WII A;  3J81 U;  4LF4 J;  1FKA F;  4RO0 A;  2NPF A;  3C16 A;  3PYD A;  3MAA B;  4WK1 A;  3HKZ D;  2A10 A;  2E1P A;  5A8K B;  2VC0 A;  2V5H G;  3L9Z A;  1HI8 A;  2BMB A;  3EGZ A;  1D3W A;  1RA6 A;  3MMA B;  2HFZ A;  1H7X A;  1HKA A;  3G8Q A;  3J7Y I;  1PJ5 A;  1PG5 B;  4KJI A;  1WHV A;  2W9B A;  2VDH A;  4USU A;  3CDA A;  3C46 A;  3J7Z 5;  4DF8 A;  3SYZ A;  4OI6 A;  3ZXW A;  4CCH A;  2LFV A;  4OYA A;  3OSP A;  3OTO J;  3A4T A;  4M5L A;  2M70 A;  1NEE A;  4KRW A;  3TEG A;  3DDI A;  1NSQ A;  3T1Y J;  3U1N A;  3FNN A;  5E41 A;  5EN1 A;  1T11 A;  2QL5 B;  3UVJ B;  1W2I A;  2DIU A;  3Q89 A;  4PKD B;  4L74 A;  2H65 B;  3MD3 A;  4JV5 J;  2IC3 B;  4K2X A;  2Z2M A;  4RW8 A;  3LP0 A;  3A3P B;  2CQ4 A;  2CUY A;  2HNZ B;  3QAE A;  3FMB A;  1IJF B;  3GJQ B;  3SSQ A;  4WBF A;  3S8S A;  1S77 D;  1KR4 A;  1NK7 A;  4AL5 A;  3DRR A;  3PYE A;  2MQP A;  4IUF A;  2CJQ A;  3K0J A;  1JWW A;  5A8R B;  4OYM A;  2O5D A;  1TKX B;  4LF9 J;  2OKQ A;  2BVZ A;  2DD8 S;  1QSS A;  5I3U B;  4NE9 C;  4JI3 J;  4HHJ A;  1LWC B;  2LEB A;  3THT A;  2AJ0 A;  1UCN A;  2GAH C;  5ETP A;  1S1T A;  4FF2 A;  1U4B A;  1RHU B;  4J9K A;  1HQU A;  1U1P A;  5A6P A;  3VQT A;  5FJ4 A;  2CAJ A;  3EZO A;  3S6E A;  3IAS 9;  2HLU A;  3D6T B;  2V50 A;  4DR2 J;  1C2P A;  1HD0 A;  3MM9 A;  3UO0 A;  4RPF A;  3WX8 A;  3FBE A;  4ZCM A;  1TL3 A;  1EAY C;  2A2D A;  1LWF A;  4WE1 A;  3BO2 A;  2F8E X;  4LF5 F;  2J76 E;  1VFJ A;  1NCL A;  2Q79 A;  1YRX A;  4P2M A;  4N77 A;  4BS2 A;  3EDQ B;  4IH5 A;  2CNK B;  1U26 A;  2N3L A;  1S0O A;  3SMZ A;  2OPS B;  1TVR B;  4DR5 F;  1QUV A;  3TAP A;  3DHW C;  1CJU A;  3P45 B;  2YX4 A;  3PW5 A;  3QSY B;  2FLO A;  2H51 B;  5CZX A;  3A8J A;  1RE1 B;  2PI4 A;  2G4B A;  4HKQ A;  3MCO A;  1QTM A;  3DOK A;  2OEM A;  2RHQ B;  1RWV B;  3W62 A;  1S59 A;  1ZM3 A;  3HVT A;  2NUH A;  4TNO A;  2DT9 A;  2FJB B;  2MZ1 A;  3GQC A;  1PCA A;  2ZH7 A;  5B7W A;  2EBG A;  1IKV A;  3Q2T C;  4F4A A;  2AEJ A;  3M30 B;  4DUZ J;  2QC3 A;  3IR6 B;  3UE2 A;  4G65 A;  4JI5 J;  4K0K J;  2R2S A;  4LR8 A;  4C8M A;  4O0N A;  1FRX A;  1IR2 A;  3HLU A;  5DS7 A;  3R7S B;  4I1T A;  1H6K X;  2FB0 A;  1SC4 B;  3CD0 A;  5B0E A;  5IWA J;  4DSI A;  4WK3 A;  4GC6 A;  2HHH F;  2EFV A;  3MZI A;  4BC7 A;  2ILZ A;  3I9V 9;  3MCS A;  4FN5 A;  3SZ2 A;  2Z8Q A;  3UN2 A;  1RT5 B;  4EEY A;  1RT2 A;  2G1D A;  1RT1 B;  3U02 A;  2KKH A;  1BQM A;  5F9N A;  2HGM A;  5L1J A;  3MGJ A;  4NLG A;  3BN7 A;  2B7B B;  1VQ5 S;  2MLX A;  5B0G A;  2P9C A;  1NPP A;  3CIM A;  3MFI A;  4FS2 A;  5J2N A;  1G6B A;  5LXY A;  3QQC D;  2IYG A;  1TL1 A;  2AKW B;  4GKK J;  4KKO B;  2YQ0 A;  2F4F A;  1N0V C;  3PJX A;  2Z2L A;  2JFD A;  4CO1 A;  4KSE B;  1A9N B;  2XZD B;  1RAC B;  2MHN A;  2VFU A;  2D7S A;  1N33 J;  1VQL S;  3Q24 A;  3MR7 A;  3KK3 B;  3RG6 A;  1ZET A;  2YPZ A;  2ZUA A;  2W1B A;  3D4J A;  5HK4 A;  3TQE A;  5I42 B;  4KBI A;  2PD1 A;  3K59 A;  2V8H A;  1D8Z A;  2YWE A;  2QYG A;  2I5J A;  4NLQ A;  3Q0A A;  1IM6 A;  2OEL A;  1X5P A;  4OHY A;  4WFB Q;  2RRN A;  3QPI A;  5DG9 A;  1TV6 B;  1HBM A;  2YWK A;  1MNE A;  4EBD A;  2YX7 A;  5HLF B;  4YDX A;  2C2Z B;  4FXD A;  3HDS A;  3ET6 A;  2D74 B;  1CQN A;  4KHP J;  2FVR A;  3FBF A;  1FWK A;  2ZNZ A;  2J7U A;  2BE2 A;  4H4O A;  2HS4 A;  1TKT B;  2JEF A;  2XLJ A;  3BBC A;  4LF4 F;  4GO5 X;  4USH A;  2CPX A;  2KFY A;  1SKS A;  2OML A;  1D8Y A;  3HZG A;  2DJW A;  2QN6 B;  3FCW A;  3D66 A;  3IR5 B;  2ZKU A;  1B64 A;  1RCX B;  1C1B A;  3KLH B;  2HHU A;  4DN0 A;  3RB0 A;  2R8G A;  1RTJ B;  4FVM A;  3B54 A;  1N4L A;  3NLC A;  4LJM A;  1M1K T;  3T5H A;  3M32 A;  3RJM B;  2MKH A;  2V4J A;  1Q7Y T;  3SFG A;  5T7L B;  4DLG A;  1RGV A;  2ZM6 J;  5EX3 A;  1UW9 A;  2HK2 A;  3OXF A;  2OPQ B;  5IXU A;  3EZU A;  2FVP A;  3GFH A;  3MM7 B;  4R0E A;  3IAM 9;  2MHE A;  2AMC B;  2DHA A;  3NBP B;  3DOL A;  4JV5 F;  2E1A A;  1MWQ A;  5J2Q B;  4LBP A;  3V6J A;  1R3N A;  1NSP A;  3GJS B;  2QA4 S;  4DV6 J;  2IJR A;  4ZLL A;  1QE1 B;  3CNQ P;  2GJF A;  4LF9 F;  4RUC A;  3KMS A;  2CJB A;  4J9Q A;  1QDU B;  2JFK A;  4C2M A;  3CCR S;  5D4L A;  3O5T B;  2UUA J;  1RT6 B;  1IR1 A;  3KK2 B;  4CLZ A;  4HVZ A;  2MB0 B;  3TAM A;  3R2C J;  4IRC A;  2FYX A;  1OIA A;  2PII A;  5F8H A;  4ELV A;  2VFV A;  2B0G A;  4ZCL A;  2RIL A;  4A47 A;  1RTZ A;  3NWG A;  1ZBT A;  1V9O A;  4F26 A;  3FQK A;  2R7S A;  2N3O A;  4UTG A;  2H54 B;  4OZ2 A;  1VQ4 S;  5KG5 A;  1VGY A;  1WD6 A;  3KFW X;  2YWH A;  5CA5 A;  1RAJ A;  3SFU A;  2MGZ A;  2W9B B;  4NCA A;  2VU5 A;  2NLW A;  4ELU A;  4N47 A;  3ADA C;  5J1E A;  2AF6 A;  2KM8 C;  4K4Z A;  2RJZ A;  4QWA A;  3LF0 A;  3MM5 A;  1YJN S;  3BGR A;  4OJ3 A;  2DCU B;  1KN6 A;  3CJK A;  2YNH A;  2XI2 A;  1JIH A;  2V2Z A;  2BA9 A;  4PYD A;  2MLZ A;  3C8Y A;  4X64 F;  4CYU A;  4OJH A;  2GZO A;  1QLN A;  2MKS A;  4RW8 B;  4DV3 F;  3LP1 B;  1WEY A;  1ZA2 B;  4DS5 A;  1P6T A;  2Y1I A;  3DLJ A;  4ECT A;  1N34 F;  3UWT A;  4LRA A;  5B0B A;  4ICL B;  4FKY A;  1I6J A;  2MKI A;  1Q16 B;  3IS9 B;  4ZPB A;  3F73 A;  3N5F A;  3I5A A;  3H5U A;  3KTQ A;  4KY3 A;  3MUM P;  5F8M A;  3FQL A;  1S1T B;  1LQ9 A;  1FES A;  4JI5 F;  1HQU B;  2HBR B;  3CD7 A;  5IC4 B;  1SXL A;  3LQV A;  4Q0B B;  1NAQ A;  4L72 B;  1QTN B;  2VB6 A;  1Z2L A;  4HDH A;  4DQQ A;  1F9H A;  3ZTS A;  3CB4 A;  1AW0 A;  4K4U A;  3I56 S;  2NR0 A;  1NKE A;  2F8H A;  1RSC A;  3MM9 B;  1XNQ J;  5IWA F;  4I2P A;  1RAA B;  2PGC A;  1UVL A;  4YS2 A;  1GAO A;  1LWF B;  1IUJ A;  5BR8 F;  3QMQ A;  3RR8 A;  4DU7 A;  1F9F A;  1NK6 A;  1T9Y A;  1XWL A;  4L76 A;  4K4X A;  1TAU A;  1H2V Z;  4NLR A;  2KO1 A;  4TXS A;  2VA3 A;  1RKJ A;  1O51 A;  2DY9 A;  3O1L A;  4Y00 A;  4MK8 A;  3QT8 A;  4KTQ A;  1RHK B;  1MML A;  2AW0 A;  1CJU B;  3GB0 A;  2JEI A;  4OI4 A;  4ZK7 M;  4ZVE A;  1L3U A;  4GKK F;  5EWE A;  3OL7 A;  4IO9 Q;  3DOK B;  5BYQ A;  4K4T A;  3LTO A;  4E2F B;  1N33 F;  3PO5 A;  2EFP A;  3M2U B;  2HYI B;  3P5B P;  1UEU A;  1UL3 A;  1Y5N B;  3MCN A;  4QIF A;  3VAL A;  3OL6 A;  3RBD A;  4KO0 A;  5IQ6 A;  5J2M A;  1T9T A;  3VHQ A;  3GYG A;  5B0C A;  1XBW A;  1Q79 A;  4Y2C A;  1FNM A;  5DJB A;  1S9G A;  3CE8 A;  3PDN A;  5AE2 A;  2ZBQ A;  1VQ6 S;  1GXL A;  2DRB A;  4G1I A;  1X31 C;  2AYE A;  4CH7 A;  2V8P A;  4KHP F;  3TEH B;  2RNE A;  1KNZ A;  2ZH3 A;  4DL2 A;  2WB4 A;  2B9W A;  2P5V A;  3NS6 A;  4JI8 J;  4GC7 A;  2B8P A;  4P52 A;  2F1F A;  3FK4 A;  4TY9 A;  4RNH A;  1RT2 B;  1U0S A;  4XDC A;  3H40 A;  1B4S A;  1I51 B;  3HP6 A;  1H98 A;  1FWL A;  1BQM B;  2UUB F;  3HVA A;  3Q86 A;  2WVB A;  4YDD B;  2QA4 G;  4E0D A;  1FX4 A;  2D9P A;  4JI2 J;  4HI2 A;  1D1U A;  2XG8 A;  2DIT A;  3AXK A;  4OI1 A;  3PM9 A;  5J2N B;  5L9X A;  3FEY B;  2FUG 9;  1HR0 J;  3DYA A;  1LW2 B;  5GME A;  4B9T A;  1UFL A;  2RS8 A;  2FJX A;  3BDE A;  1SH2 A;  4CO0 A;  4OL8 A;  4UZB A;  3JQK A;  2ZZN A;  4JI7 F;  3CCU S;  2KRB A;  4YB1 P;  2DO0 A;  2XNR A;  2YKM A;  3KMQ A;  3CJQ A;  1ROF A;  2E7W A;  2CQ0 A;  5KFP A;  2HKE A;  3BBF A;  2CJX B;  3F44 A;  3W2W A;  2KM8 B;  2I5J B;  3MMC A;  3I55 S;  4DV6 F;  3BYR A;  3CO0 P;  2C2E A;  2AQ4 A;  5J2P A;  1S48 A;  3P8B B;  3KLG A;  3CJS A;  2LQ8 A;  2MKY A;  3KUE A;  1TUW A;  1X4F A;  4RU2 A;  1FDD A;  2LU1 A;  4F4W A;  2M3D A;  1D9D A;  5HAT A;  4MYT A;  5KFQ A;  2D3O R;  2OD6 A;  3T3F A;  3EGW B;  4H4O B;  2L3M A;  3MOJ B;  4USK A;  2C3P A;  1S1W A;  2ZH1 A;  2PEH A;  2FC9 A;  1SL0 A;  1JNZ B;  2Y0B B;  2ZBC A;  4EI2 A;  5C2C A;  2WSC C;  1C1B B;  5JVG Q;  2J7W A;  2CDQ A;  3QO9 A;  1UPP A;  5KG1 A;  2DGU A;  1KHW A;  3KG4 A;  1R8A A;  1T8E A;  2EFQ A;  2YKN B;  4OX7 A;  5L1L A;  5FII A;  5E3P A;  1VQO S;  2QT7 A;  2V4J B;  3OXL A;  1VK8 A;  3AY0 A;  4W92 B;  1LXN A;  5DG8 A;  3NAH A;  2IRU A;  3JS9 A;  1LEO A;  4ZLP A;  3WIV A;  2RSQ A;  1N48 A;  1C0U A;  3FBB A;  1NJY A;  1CBK A;  4C9D A;  4O3S A;  3H42 A;  4ID8 A;  4ZVT B;  1U1K A;  2FLN A;  4J90 A;  3DOL B;  3N6M A;  5K14 B;  5H9E J;  2HVI A;  5CD4 A;  4QQB A;  7AT1 B;  1JNR B;  4LF6 J;  4PXE A;  1K44 A;  2J6S A;  3ILL A;  2X7I A;  1JKH A;  1ZTT A;  2GQ2 A;  4PXD A;  4X65 J;  2E5H A;  4L73 A;  4USW A;  5HN0 A;  1NK4 A;  2UXC F;  4B3S J;  1SL2 A;  1J2V A;  3HD1 A;  3UNY A;  3C66 A;  2DGQ A;  4MIA A;  1XNR J;  4WPA A;  2EK6 A;  4JI1 F;  2CA9 A;  2PFF B;  1JXE A;  3R7B B;  4ED6 A;  1F0X A;  2EEY A;  4X4N A;  4EWT A;  1BD6 A;  1ELO A;  4B9V A;  1NO8 A;  3MEC A;  5E0O A;  2NUU G;  3HCX A;  1U8S A;  3Q8V A;  1FJE B;  4ED5 A;  2JVR A;  1XNQ F;  3G2X A;  1EP4 A;  3PRV A;  1QVG R;  3PYF A;  5IT9 Y;  4AD6 A;  1UJ6 A;  2MGZ B;  1K47 A;  4DG1 B;  2J9C A;  4KR0 B;  2VC1 A;  5J1E B;  3OVA A;  1RU1 A;  1DAX A;  1S12 A;  4W4M A;  1H2T Z;  3D67 A;  3EZ5 A;  3NGR A;  2CPI A;  3MM5 B;  3ZNJ 1;  4MKV A;  2I2Y A;  2JLF A;  1QM9 A;  3CJK B;  2YNH B;  2DO4 A;  1FO1 A;  2Q1L A;  4R0J A;  1LOU A;  3M4X A;  4ZHR A;  3KLE A;  4DMZ A;  4YFU A;  1D0E A;  1KFS A;  1RBA A;  3PIO Q;  4CYU B;  2FGO A;  2NSC A;  3G6E S;  1WWH A;  1U1M A;  2RML A;  3BR8 A;  3OHA A;  2XBP A;  1NHK L;  4KV8 A;  3M7V A;  3QFW A;  3RAQ A;  4QW9 A;  2V8D A;  2VQE F;  1RKI A;  4PUO A;  3WHI A;  4HYK A;  2DPI A;  2M7S A;  1WEX A;  4QWD A;  1FE0 A;  4FPR A;  2B9Y A;  3E01 A;  4ZJL A;  2MJN A;  1O6X A;  3G71 S;  4KAI A;  1N5Y B;  4F0M A;  1EX8 A;  1RI7 A;  2XS2 A;  1K73 T;  3R6L B;  1NJW A;  3UNG C;  2NQP A;  1H73 A;  4DV4 J;  1QVF R;  2CPF A;  4FYD A;  3VWS A;  1F2G A;  1HWL A;  2ATC B;  3QJP A;  3KUG A;  1VQK S;  4I2P B;  2MZS A;  5CCL A;  4R5P A;  1QAJ A;  3KLI A;  4ZKA A;  2AGP A;  2DH9 A;  1EET B;  2BAN A;  3VCD A;  4TY8 A;  3VGS A;  3PW2 A;  3PJW A;  4A8Y A;  4QPX A;  2N7C A;  1YQH A;  5D77 A;  3DRX A;  3UCG A;  4MJK A;  3LPE A;  4ITS A;  2UXD J;  4P7T A;  1G7C B;  4AXJ A;  4B3R J;  3EM1 A;  4JI2 F;  4L75 A;  1I1G A;  3CPW R;  1OO0 B;  4EU0 A;  1E6V B;  5DGA A;  1JLQ A;  4ILL A;  1FD2 A;  2J9E A;  1MN7 A;  1HNX F;  4O3Q A;  3I32 A;  3DNC A;  1U6Z A;  1VBX A;  4O4R A;  1ACM B;  3LO3 A;  3MUT P;  4KO0 B;  2LEA A;  5J2M B;  1R8H A;  1M0S A;  1S7I A;  3IN5 A;  2PMZ D;  4JI0 J;  4FKX A;  1S9G B;  1FA0 A;  5ETT A;  3DI6 B;  5K5M A;  5BYS A;  5H9F J;  3BN4 A;  5K8O A;  4LIR A;  3N9U C;  1GTH A;  2AGQ A;  3OV7 A;  1NHU A;  4ZN3 A;  2QRR A;  1VC5 A;  4Y2A A;  2V0N A;  2ZC4 A;  1KTQ A;  2UUT A;  5DLF A;  2QLX A;  1VIX A;  1PO6 A;  2DNP A;  2HVZ A;  5EUH A;  4UF4 A;  2V67 A;  1D9F A;  4K4V A;  1U0H B;  2VJU A;  2Q6C A;  2ZD1 A;  5E2Q A;  2XCA A;  1GMW D;  3FBC A;  3LWL A;  5L9N A;  3VVU A;  1HNI B;  4UY8 T;  3DYA B;  1UVJ A;  5KFK A;  3I9Z A;  3L3C A;  5JXS A;  3CVK A;  2F4V F;  2XGP A;  1FVS A;  4BC9 A;  1SJR A;  1U1L A;  1HA1 A;  2MSS A;  1TK0 A;  2AD9 A;  5HMX A;  1PKU A;  1RLC L;  4DZD A;  2OP5 A;  2VH7 A;  2M0G B;  2GJ2 A;  3Q83 A;  2GHV C;  3W2W B;  3MMC B;  4IFV B;  4O44 B;  1R8C A;  1FDB A;  4TU7 A;  2FHJ A;  2J7K A;  2M4M A;  3KLG B;  3X3U A;  1CG2 A;  2C2K B;  5A6W A;  2XSJ A;  3K57 A;  4X65 F;  2QFJ A;  1XR6 A;  4IR1 A;  4V19 J;  3CO9 A;  5IOL A;  5T41 A;  3EXY A;  3TJA A;  2W2Q P;  1GH8 A;  2PEB A;  4CWB A;  5CYJ A;  3J80 U;  1U48 A;  3GIL A;  1N52 B;  1F6T A;  1Q8L A;  4DEZ A;  4Q45 A;  4AUK A;  1S1W B;  3CTR A;  2OPR B;  5BJR A;  5HBM A;  5HQM A;  4KH1 B;  3HX9 A;  4ECY A;  3GV5 B;  2O66 A;  3CMQ A;  3QO9 B;  4QWE A;  2LQB A;  2MMY A;  2L41 A;  4NEZ A;  3RRG A;  1PIE A;  2KG1 A;  1YIT S;  4O0I A;  1G1X A;  1ZAX A;  3OVS A;  2HUR A;  4KPC A;  2KVI A;  3FC9 A;  2BZ2 A;  4X4P A;  3HUL A;  2UVW A;  5IT4 A;  3AOA A;  4CP5 A;  3TAR A;  1MN9 A;  3NY0 A;  2CQ2 A;  4IG0 B;  1F1B B;  1ZH5 A;  1VYA A;  4YHH J;  3AHP A;  2GO9 A;  2V2K A;  2XLK A;  3S7R A;  3A13 A;  3I0R B;  2NXN A;  3C3L A;  3Q8Q B;  4WYW A;  2GV1 A;  2RQK A;  2B6A B;  2H5J B;  2L48 A;  2KTQ A;  2Y8Y A;  1JKH B;  5KFY A;  3V5R A;  2MYF A;  2IM2 A;  5HAN A;  1FNO A;  2J5A A;  1MWZ A;  1U8W A;  1NLK L;  2YH0 A;  1NPR A;  4WFY A;  1Q8I A;  4JYA F;  4RNO A;  4OZJ A;  1ZM9 A;  2DNL A;  3V2U C;  2VA2 A;  3TA0 A;  4C0B A;  4DS4 A;  1FDA A;  4USV A;  1XMO J;  4R8U A;  2LA6 A;  3SV4 A;  4XAK A;  4LFA J;  1IBL J;  6FD1 A;  3CDW A;  3N5B A;  2WB1 D;  5LL6 d;  5SZT A;  2IAJ A;  1URN A;  4DV4 F;  2ZH2 A;  1WF1 A;  3BGO P;  4YN3 B;  3CCM S;  4ECW A;  5I4M A;  2BV3 A;  4IOC Q;  1EP4 B;  3GSD A;  4FXW A;  4WP8 A;  4QOT A;  1HYS A;  4AQY F;  1RHQ B;  4QR2 A;  3X1L B;  5IZH A;  1EIY B;  3MM8 A;  1OJ4 A;  2EXU A;  3QGI A;  1NDC A;  5K8N A;  1IKW A;  1F5A A;  4KFB A;  5ETO A;  3PX6 A;  1ZM4 A;  1RHR B;  1ZA1 B;  1VS3 A;  2OTJ S;  4B3R F;  1EQM A;  2KU7 A;  3Q23 A;  2YQ1 A;  3T9N A;  1HBN A;  3BV8 A;  2M5Y A;  3KLE B;  3NKY A;  4B17 A;  1S6P B;  2HND A;  3V4M A;  1KSP A;  1HBO A;  3QLH A;  4NXN J;  1IKX B;  4V19 X;  1DTT A;  3J7A 1;  3S1T A;  3GR0 A;  1XMQ J;  1SCJ B;  4KV8 B;  1DTQ B;  2HAF A;  3PNI A;  4DHV A;  2GIF A;  1SKU B;  3FEX B;  4PUO B;  1APS A;  4J9O A;  4DR3 F;  4ID5 A;  5F8N A;  3IP0 A;  4DL4 A;  3NGT A;  2R7X A;  3E01 B;  2N4D A;  4I69 A;  1S6Q A;  4JI0 F;  3AOC A;  1O8B A;  1WDT A;  2POK A;  3DGP A;  3IM8 A;  4LT6 A;  3A3N B;  1TR0 A;  1KEK A;  3EYZ A;  2YNI A;  2KFN A;  4OJG A;  3F56 A;  4JV0 A;  1T7P A;  3JB9 k;  3M8R A;  4ILM A;  3KOA A;  4DCP B;  2C2O B;  5A0Y A;  4Q44 A;  4Y2M A;  4RNM A;  2XWX A;  3THV A;  1FCA A;  4NLW A;  3B8H A;  4HR2 A;  2XC9 A;  3KLI B;  2W4D A;  2W4C A;  4WWS A;  1WHX A;  1H74 A;  2BAN B;  5AJ3 J;  2C3O A;  3KK1 A;  5T14 A;  1SC6 A;  5D4O A;  1FT8 A;  1VOM A;  1VR6 A;  4ELT A;  1CJT A;  3CC4 S;  3ENV A;  4N56 A;  2GQQ A;  4F3Q A;  5EGY A;  1O0P A;  1TUG B;  2YWF A;  2D3Z A;  2X1F A;  2DHS A;  5L38 A;  1WI6 A;  1RUS A;  3H2U B;  3MTK A;  4HHU A;  1IWA A;  2CVE A;  1PJ6 A;  1GFW B;  3A8E A;  5B08 A;  2V4Q A;  1TQL A;  3EVW A;  3HJV A;  2E29 A;  1FXL A;  3NNC A;  4AXI A;  4ZVH A;  3MHY A;  4WFZ A;  1J5O B;  4RX6 A;  3KG1 A;  4ZCK A;  1DZ5 A;  1NB7 A;  2NYH A;  4NYP A;  3TVK A;  4N7T A;  4ED0 A;  4CIO A;  3Q22 A;  1EZZ B;  4NZ0 A;  1M5O C;  2MST A;  4DSK A;  1U2F A;  5K20 B;  2AX0 A;  1NHV A;  3LGN A;  4IQX A;  1A0O B;  2F8M A;  4RBT A;  1RTI A;  1NK0 A;  4FZV A;  5KOX A;  3K7R A;  1C1C A;  2GIR A;  1HFE L;  1JK9 B;  1FVQ A;  3BRE A;  3WC0 A;  1X4B A;  3I4P A;  3AQP A;  3D9B A;  2C3U A;  5KFF A;  3IBC B;  2CZ9 A;  1VC0 A;  1YBT A;  3NL0 A;  2G0I A;  2GVZ A;  3VGT A;  3G6Y A;  4DQS A;  1CEZ A;  2KXH A;  1OSD A;  1NDP A;  4NA1 A;  2ZD1 B;  1LFW A;  4WKR A;  1BY9 A;  1UZH A;  1RB0 A;  2DBB A;  3UR3 C;  3T6B A;  3BPD A;  1ZTW A;  4OV1 A;  5AXM A;  3OUY A;  2DXD A;  3GIJ A;  4NI2 A;  1WKL A;  1HL6 A;  2O67 A;  3IGV A;  2AHO B;  4Z37 A;  4K4Y A;  3JTP A;  2YKQ A;  5F9L A;  3PAC A;  2W7A A;  4XTT A;  1VIS A;  1WC6 A;  3A8I A;  3NCQ A;  4RW9 B;  4CNY A;  3B4D A;  1OYE A;  3PEJ A;  5KT7 A;  2OI2 A;  1YJR A;  5A8K A;  4YHH F;  2GFF A;  2D9O A;  4HI1 A;  4ED3 A;  2DNR A;  1RA7 A;  2O01 C;  1W7W A;  3T9Z A;  1RT3 B;  2NCK L;  2FVS A;  3UPF A;  2GHW A;  2OEJ A;  2MQ8 A;  1TTH B;  2V94 A;  3LPY A;  2KYZ A;  5IC6 B;  3RW6 A;  2XSJ B;  4QYZ J;  4MH8 A;  4JB8 B;  2A3J A;  2E1M C;  4I56 A;  3UD4 P;  4NOH A;  1XMO F;  2QSF A;  2H48 B;  1SVD A;  9ATC B;  4TQR A;  1PYS B;  2RRA A;  3OHB A;  4V1A k;  5G0R A;  3AQO A;  1HWK A;  1Y3K A;  4ZN1 A;  4J7C A;  4RR5 A;  2JH3 A;  3IMQ J;  4I68 A;  1QUP A;  2DR7 A;  7FD1 A;  4AND A;  2VPZ B;  5HBM B;  1PC5 A;  1S7H A;  3R5G A;  1TP7 A;  4D3H A;  2B5J A;  1MU2 A;  3TO8 A;  1QJH A;  1BGX T;  1RXO B;  2HWH A;  3DRS A;  2X1B A;  6AT1 B;  2CQP A;  5C25 A;  3CC7 S;  2DGW A;  1TK8 A;  2P2C B;  3WC2 A;  2D3U A;  1HI0 P;  4WTY A;  3BQ2 A;  4M5D B;  1S0V A;  1PAU B;  1UVM A;  1HLW A;  2H5I B;  2HZA A;  1LK7 A;  3V81 B;  4L3K A;  3IRX B;  4DX7 A;  1QAX A;  3FUY A;  3H59 A;  5HRO B;  3A12 A;  3TA1 A;  2HBQ B;  4ZIV A;  4B3M J;  3OPK A;  3N6N A;  1V6H A;  1P1T A;  3HF5 A;  3SV3 A;  1WAC A;  5RUB A;  2AZ3 A;  1XMQ F;  5F3Z A;  3AOD A;  4RW7 A;  4LFC F;  1HPZ A;  4URS A;  4OI0 A;  4ZPD A;  4Y3C A;  3MXH P;  3KYL A;  1HI1 A;  2GIQ A;  3UFC X;  2ZDP A;  2VBZ A;  4A8K A;  3POT A;  2ZIT A;  1TVR A;  4WZM A;  1VRU B;  2F9D A;  4QR0 A;  4ZP6 A;  2DYA A;  2DRA A;  2A18 A;  5LXR A;  1Z2Z A;  4EZ9 A;  3W61 A;  4DR4 F;  4NML A;  1H3D A;  1RAE B;  1KVI A;  2CNN B;  1BC6 A;  1IQT A;  2LMI A;  1HWI A;  2QLW A;  3P6Y C;  4A46 A;  2AIR B;  1HHQ A;  5M2U A;  5F41 A;  2CXE A;  1HYS B;  1YJV A;  3V6D B;  1FRL A;  2VBW A;  1CC7 A;  3TX8 A;  3HHK A;  2CPH A;  2CZV C;  4QYR A;  1GMU A;  4LSZ B;  3M30 A;  4P72 A;  1IKW B;  4CH1 A;  2COL A;  1U25 A;  2RF2 A;  1T94 A;  5AE3 A;  3VGV A;  4W98 A;  3DLE B;  2DNN A;  1HBN B;  4GRS A;  2VON A;  5D0R A;  1U1O A;  3QGP A;  4I6A A;  3QLH B;  1DTT B;  3PKM A;  2IBO A;  3TUI C;  4A4J A;  2R2U A;  1D09 B;  2WCX A;  2DR5 A;  3T19 A;  4KH0 B;  3I4H X;  1FRM A;  2Z58 B;  3QJJ A;  1PYO B;  3L95 X;  4X4S A;  2EVZ A;  3W7B A;  1XK8 A;  2OGU A;  4F8R A;  3HSZ A;  1KD1 T;  4ID5 B;  2FZC B;  3UDL A;  2HVH A;  4J37 A;  2BE9 B;  2CVI A;  2BAB A;  3W1Y C;  3DGP B;  2WOM B;  4QIW D;  1A7G E;  1PSD A;  4J9L A;  1WC1 A;  2DVI A;  3VAK A;  3H20 A;  2BAC A;  3KHR A;  1SI9 A;  4RUB A;  4OYX A;  4O23 A;  4PWD B;  1KVK A;  4EO8 A;  2W2M P;  2DR9 A;  1HMV A;  4OX8 A;  3ULH A;  2XNQ A;  5A0Y B;  3G86 A;  3TR5 A;  1YBA A;  1AFI A;  2Q66 A;  2AYG A;  4MKY A;  3VZI A;  4DV0 F;  1M5K C;  4Q2M A;  4OX9 J;  3UCZ P;  2IDE A;  4F36 A;  3TZW A;  3KHH A;  2R2R A;  2FTR A;  3C19 A;  4MT1 A;  4I7F A;  3E8O A;  1DHM A;  1GT8 A;  3KK1 B;  4Q43 A;  3L09 A;  1Y3J A;  2VFT A;  3ZZZ A;  4C8L A;  2CPZ A;  1DBD A;  1DLO A;  2W7O A;  4OX6 A;  1CJT B;  3UW1 A;  1JB0 C;  4NEY A;  4K50 A;  4LF8 J;  2V9K A;  3MD1 A;  4MK7 A;  5HLF A;  2LVW A;  1LWX A;  4NXM F;  4RNF A;  2PA8 D;  4CT9 A;  1RAB B;  4K7Q A;  1BQX A;  4YY3 J;  5KG6 A;  3H90 A;  2DHG A;  4OYI A;  2LA4 A;  4DJB A;  4DOZ A;  5F0U A;  2UVU A;  2LEC A;  2FJD B;  4ZOS A;  2ZBP A;  1SV5 B;  2DNQ A;  1VRT A;  3D2W A;  3KLH A;  3J81 j;  3Q8S B;  1U1N A;  2DIS A;  4C3L A;  4DPU A;  1QD1 A;  4ES2 A;  2GS8 A;  2ZH5 A;  2WW8 A;  1JLE A;  2I6W A;  4MKB A;  3CXC R;  4WU3 A;  2HQ3 A;  1JLF B;  2DEI A;  5C24 B;  1RTI B;  3HHN B;  1T3O A;  2FY1 A;  1T9X A;  2DR8 A;  2OPQ A;  1T02 A;  1NK8 A;  2XYP B;  2V6A A;  4Y6I A;  5LMU J;  4WFX A;  4OYP A;  1Q5Y A;  4RL1 A;  5F8J A;  4HH1 A;  1TFY A;  4UOH A;  4JV1 A;  2FD2 A;  2R3V A;  3EGN A;  1U2R A;  2QA2 A;  2ZDO A;  1T0T V;  1UJ5 A;  2YPY A;  2GJI A;  1JLA B;  2GVZ B;  4LR9 A;  4JOU A;  2ACM A;  1X9W A;  4CM2 A;  1UVI A;  2LYV A;  1YG0 A;  2DCL A;  1V5I B;  2JNJ A;  1ULR A;  2OSQ A;  5LT5 A;  1IKY A;  1X5S A;  3HHE A;  3RZA A;  2ZC3 A;  2W9A A;  2R7U A;  4RUH A;  3VAG A;  5D3G A;  2V8G A;  4JV2 A;  1T95 A;  3JAM Y;  3QRR A;  3KK2 A;  4DR7 J;  3GON A;  1HWU A;  4DR6 J;  4QPT A;  4KYZ A;  2Y1J A;  1RLD A;  4LBI A;  1PBU A;  5HMY A;  1YX2 A;  5E5N A;  2VPY B;  2Z57 B;  4WTO B;  1Q78 A;  2XCP A;  1S9E B;  2NXU A;  5EDW A;  2DGO A;  4WXW A;  3OL9 A;  2FZK B;  2FGC A;  3QZ7 A;  1U1R A;  4QBU A;  4HAC A;  2ABY A;  1S6O A;  4HT7 A;  1RBL A;  2WBM A;  5JJB A;  1HAR A;  2RUG A;  1SH0 A;  1OPI A;  3AFG A;  4P2X A;  3MI7 X;  1R7I A;  3MR3 A;  3K17 A;  3FCH A;  5KFM A;  2IPO B;  2KN4 A;  3MF5 A;  1W26 A;  2MTL A;  2BJD A;  1ITP A;  3CME S;  3EX7 B;  2ZNY A;  4NMX A;  1TL5 A;  5D78 A;  3DLK A;  2O1P A;  2WW4 A;  1G2E A;  2GO8 A;  5G0R B;  1PBA A;  5DDR C;  2R4F A;  4PQU B;  3CJ0 A;  2YNG A;  5AE1 A;  2IA6 A;  1RAI B;  2HPU A;  3LP1 A;  4KT0 C;  4F4K A;  1N5Q A;  2ZVS A;  2XEX A;  4NLT A;  1DQ8 A;  4I4B A;  3L7U A;  2E5G A;  2VOP A;  5KFB A;  2B5J B;  1MU2 B;  3ILI A;  3W64 A;  2FPH X;  4ICL A;  2HHS A;  3DRS B;  1WF0 A;  3IS9 A;  3F41 A;  4MAK A;  4TQS A;  4Q7A A;  1X4C A;  5C25 B;  4N5S A;  3U27 A;  2PE8 A;  4DPY A;  3PW4 A;  3AA8 A;  3UR0 A;  1Q81 T;  4ZVS B;  4M1K A;  3TX0 A;  3U7J A;  3KXD A;  2XYG B;  4RUA A;  4GKJ F;  4DCO B;  4Q0B A;  4IOA Q;  3HZE A;  2RDJ A;  3SCI E;  1MWY A;  2MKJ A;  1TZ0 A;  3HO1 A;  5A8W A;  3DMJ B;  4FP9 A;  2HLT A;  2QL9 B;  3TUZ C;  5HMZ A;  1FJG F;  3W5Z A;  4RW7 B;  3AB2 B;  3W5X A;  3D0H E;  1HW9 A;  1HPZ B;  5HQL A;  2VDI A;  2EK1 A;  3M9N B;  2H5E A;  5B0A A;  3NGK A;  5KTQ A;  3O44 A;  1F3V A;  3POT B;  3ZC4 A;  4ANC A;  2DNG A;  4LSL A;  3GJT B;  2PMH A;  6FDR A;  3ZZY A;  2ZWO A;  5KAK A;  3CJ2 A;  1NND A;  4NLX A;  2M52 A;  1B0V A;  3RBX A;  3WBZ A;  3NGU A;  1TFW A;  3OFH A;  5E3C A;  4WZQ A;  4RNN A;  3OR1 A;  4Z7C A;  4CZC A;  4PWW A;  2DEJ A;  3M2U A;  2GNK A;  3RB3 A;  4Q2L A;  2F63 A;  2VOO A;  4HTI A;  1K0V A;  2XMJ A;  1U02 A;  2NZC A;  4KE5 A;  3MEG A;  1U2C A;  4A8S A;  2HQD A;  3NS5 A;  2RF2 B;  1VIO A;  3G9C A;  2VFS A;  4B9M A;  1FKO B;  3AJ1 A;  4FNH A;  1FRI A;  2ACY A;  3GCX P;  2YH1 A;  1RK8 A;  2QZ8 A;  3MEE A;  1JJH A;  2MQM A;  4H4M A;  4DQP A;  2QA1 A;  3AOB A;  3PR4 A;  3DFE A;  3GFZ A;  3GTY X;  1WTB A;  3SSS A;  2HRY A;  2D41 A;  1N32 F;  4HH0 A;  1H0H B;  3P96 A;  3CCJ S;  3QBC A;  4YY3 F;  1R8B A;  4NAS A;  2R7O A;  2NPI A;  3M8Z A;  1KQG B;  1GXU A;  1NSA A;  1YKW A;  4CO4 A;  4C3M A;  4DFJ A;  3RRK A;  2BDP A;  2C3M A;  2BJ9 A;  2X3D A;  1TKZ A;  3PFO A;  2VJV A;  5C42 A;  3FEZ A;  1RT4 B;  4ZPV R;  4C0O C;  2MJU A;  5GAD U;  5M2R A;  4FBU A;  3NCR A;  2CQC A;  3HD2 A;  4LQ3 A;  1S1V A;  1LW2 A;  3NXZ A;  5DQG A;  1YJ9 S;  1ZYQ A;  2EKN A;  1WG5 A;  3CJ5 A;  1HMV B;  2GGP B;  2RT3 A;  4CLK A;  4PG8 A;  2UU9 J;  4C7Q A;  4DX8 H;  1RHM B;  1RAD B;  4O3P A;  5CYM A;  2VL1 A;  4HDG A;  4NRT A;  2HW3 A;  3AB4 B;  3WX4 A;  2W8L A;  3B82 A;  4QIE A;  4I7F B;  1C4C A;  4TLQ A;  5C7P A;  2E44 A;  3MAH A;  4HLB A;  1DLO B;  3DXS X;  1NK5 A;  2GX8 A;  5LMN J;  4U7U D;  4N76 A;  2JJ4 D;  2MDA A;  3DDK A;  2GA7 A;  5H9E K;  2DIV A;  2H1Y A;  1J5E F;  4RW4 B;  3MCM A;  3H0P A;  2IVF B;  2J0X A;  4PAB A;  5CD4 H;  2WVC A;  2QFI A;  4YME A;  2XLI A;  3RAM A;  4UOG A;  1MMD A;  3GSI A;  2CPY A;  3RB6 A;  4RLE A;  4F25 A;  4OHZ A;  1IWG A;  1KP6 A;  2V2V A;  2E1R A;  3PTW A;  2AJ1 A;  3PJ9 A;  3R1H A;  4PXB A;  3J7Y U;  2HHX A;  5IT9 U;  1ZS6 A;  1XN9 A;  4ATN A;  5HI7 A;  5IT0 A;  5IS2 A;  2AV5 A;  2XM3 A;  1VRT B;  2YKO A;  5KT2 A;  3MAQ A;  2QGF B;  2QLB B;  3W60 A;  4DV7 J;  3IWX A;  3K5O A;  3ZZT A;  1S76 D;  5GAG I;  3M8P A;  1YLX A;  4ZVG A;  2G1H A;  3ONQ A;  2YKN A;  1JLE B;  2Y3Y A;  4DV1 J;  2HMI A;  3M6U A;  4B9N A;  1N5S A;  3OTO F;  4CLW A;  3A8K A;  3WIU A;  2HAI A;  4DV5 J;  3T1Y F;  3EVM A;  1W25 A;  4IQM A;  2HG4 A;  2Z2Y B;  4HHH A;  4FDF A;  3CMA S;  1FF2 A;  1MLA A;  2V9W A;  4LF7 J;  5K14 A;  5KFZ A;  5B0D A;  1VQ9 S;  1NB2 A;  3BPS P;  2BR0 A;  4ECX A;  1WOP A;  4PG4 A;  4DR1 J;  3D54 A;  4LR7 A;  3HXM A;  3QT6 A;  1DFD A;  1IKY B;  4JI3 F;  2ATL A;  4DUT A;  2B56 A;  4Y28 C;  1S99 A;  4HL9 A;  1KQS R;  1UAW A;  1TEL A;  1OY6 A;  5D3G B;  1JJC B;  3JQJ A;  5AXK A;  1RT7 A;  3UDV A;  2EG2 A;  1AB8 A;  2G9O A;  1JMT A;  3G8S A;  3AXM A;  1RAH B;  3NEK A;  4CDI A;  3W9H A;  3UCU P;  2CQ1 A;  1FFS B;  1OS5 A;  2X3G A;  3TWZ A;  1JJ2 R;  4OYO A;  4ECZ A;  4C8O A;  2UVR A;  1KQK A;  1WC3 A;  2E7X A;  4NCB A;  1FEH A;  1WI8 A;  4LRE A;  4DR2 F;  1P27 B;  1X0P A;  2OAU A;  2RDD A;  4A8F A;  2E5I A;  4OYW A;  1LFP A;  4DPX A;  1H7W A;  2Q6B A;  5KOW A;  4FF1 A;  2H9Z A;  5DDQ C;  4EUV A;  5LSL A;  5LJ3 Y;  4ETX A;  4HAC B;  1FXR A;  4P2F A;  3P3D A;  4DG1 A;  2NYI A;  4A48 A;  3EMT A;  4NYZ A;  3K5M A;  2W2O P;  2BRL A;  4PPZ A;  3UN5 A;  2E9Z A;  3VAH A;  1RAF B;  5ETS A;  1I94 J;  2LP4 A;  1SKW A;  2E5L J;  1JLC B;  2VPX B;  2ASJ A;  5DDP C;  3PY8 A;  2EG1 A;  1PAE X;  4LRC A;  4WIQ A;  3DLK B;  2RHS B;  1VQ7 S;  3FJ2 A;  3Q8R B;  2VG6 B;  2YNG B;  2XMM A;  2E5J A;  4DL6 A;  4WXO A;  3W2V B;  4K4S A;  2IM1 A;  4F02 A;  3NNA A;  2AX1 A;  1MW7 A;  1KQF B;  3HHL A;  2RVJ A;  5EHH A;  2W9C A;  4M5H A;  4ZLJ A;  4UY8 5;  4G1Q A;  4DU8 A;  1HW8 A;  4DQI A;  3CF5 Q;  4CLY A;  1J27 A;  3PV8 A;  2WK4 A;  2R7R A;  4BCA A;  3PEH A;  4UOF A;  3MM6 A;  1X4H A;  3B78 A;  4DUZ F;  1S0N A;  2J8A A;  2LXU A;  4DSL A;  2UVV A;  4GVB A;  2GHP A;  5ITH A;  4X2B A;  4F0H A;  3M2R B;  4K0K F;  3FCV A;  2C28 A;  1N5Y A;  2LQ5 A;  4LSN A;  4ZIT A;  4X84 A;  3CJT A;  2J6T A;  2W01 A;  1RYR A;  5A8W B;  3W8P A;  2A0F B;  3MED B;  2OFH X;  2RE1 A;  5H9F K;  2FHJ D;  4UUW A;  3OT9 A;  4WFA Q;  2DHH A;  2GML A;  2W2N P;  4C0H A;  4DSJ A;  4B9U A;  1EET A;  4X66 J;  3CWJ A;  2EFG A;  2P6S A;  3SQG A;  3CUL A;  1OMS A;  1T05 A;  3VQS A;  4ANE A;  4AL6 A;  1VQN S;  2QSW A;  3C15 A;  4LSL B;  4BBY A;  3HT3 A;  2A2C A;  4WF9 Q;  3KHG A;  2OSR A;  2W8K A;  2ZH9 A;  1E6V A;  2D1C A;  2QL7 B;  2ZVI A;  2JHE A;  1YI2 S;  3H4B A;  2Z0G A;  1CC8 A;  1X9M A;  3JYT A;  4CH0 S;  4F4X A;  3OR1 B;  3BGF A;  3PW0 A;  2ZFH A;  2UU9 F;  3LW5 C;  3NG8 A;  2F7V A;  2JEJ A;  4PR6 A;  4NZ6 A;  4LBH A;  4JBC A;  2ZOF A;  3OLB A;  2R7W A;  2BQ3 A;  2YX1 A;  3IG1 A;  5F8G A;  2IM0 A;  2UXB J;  3BS9 A;  3MEG B;  3DLG B;  4NLU A;  5A76 A;  2WAQ D;  4YUD A;  3I31 A;  1N8R T;  3QGH A;  3DI6 A;  4DFM A;  1FE4 A;  2ROP A;  1SQE A;  2I38 A;  3LGH A;  2QIF A;  4QWB A;  3H7H B;  2MZJ A;  1WKJ A;  2MQO A;  3MEE B;  2FHK A;  3BH6 B;  4H4M B;  4CLU A;  2C42 A;  2C1E B;  1NZA A;  4DPT A;  1KLN A;  1S49 A;  3GWC A;  2ZBR A;  5CHC B;  2IHR 1;  5IQQ A;  2VBY A;  4XIU A;  5KG7 A;  4X4T A;  4MIW A;  3HK2 A;  2Y1L B;  2R2T A;  4I2Q A;  4NLO A;  4DL7 A;  5HP1 B;  3CJR A;  4KGK A;  4C48 A;  1Y10 A;  1U0H A;  3CDU A;  2M88 A;  1TKZ B;  3HHL C;  3TW0 A;  3IBF B;  2EC2 A;  2HHH J;  3BGU A;  1CJK A;  5C42 B;  3QRP A;  4DV7 F;  4ZVF A;  3QSI A;  3VZH A;  1HNI A;  3NRB A;  2ZJP Q;  1R27 B;  1S1V B;  3EIC A;  4A8Q A;  3QAT A;  1UJ4 A;  3VTI A;  1IN0 A;  4F2R A;  1ZM2 A;  2ZM6 F;  1YBU A;  4DV5 F;  3VV2 B;  4QCL A;  1RWX B;  4P74 A;  4BWM A;  1UTA A;  1YSJ A;  4LF7 F;  1AFJ A;  2K1R A;  5CYM B;  2XGQ A;  1K9M T;  4IFV A;  4O44 A;  4P6Q A;  3AA9 A;  4DR1 F;  1Z4U A;  2JDJ A;  5EWF A;  3DU5 A;  2UV8 A;  5KG4 A;  3DLB A;  5CXT A;  3ZNU A;  5ETV A;  1VQY A;  5HO4 A;  2KXF A;  4MYU A;  2MZR A;  2JRS A;  4UW2 A;  1ZZN A;  4OLP A;  4XDD A;  4P73 A;  4ZPA A;  1EAR A;  1N6Q A;  3GCW P;  2UUA F;  3GFX A;  1C0T A;  5K9F A;  1FER A;  3I96 A;  1GNK A;  3H5S A;  1SC1 B;  2W4P A;  3VAJ A;  1B3T A;  2OPR A;  4ZA1 A;  5KFC A;  5AXN A;  3BBB A;  2B4U A;  2CJA A;  4NRU A;  4RW6 A;  1X4D A;  2CRL A;  4URQ U;  2E66 A;  3MPD A;  5SUH A;  2CAD A;  4ZP7 A;  1RWP B;  2HBY B;  1LWE A;  3M8P B;  3EE3 A;  4TLR A;  2ZKT A;  7FDR A;  2HMI B;  1MRO A;  3AJD A;  3C6U A;  4DF4 A;  2LDI A;  3NGS A;  4MTP A;  4PQA A;  3F0N A;  1VJW A;  1V3S A;  2HIY A;  1S79 A;  1U09 A;  2CIM A;  2B4P A;  4MFB A;  3CIZ A;  1I94 F;  3IC1 A;  4KC5 A;  2E5L F;  4RWX A;  1K8A T;  4WU2 A;  4NCG B;  2EKY A;  1WC5 A;  2P6T A;  8ATC B;  3CCL S;  4IG0 A;  1RWN B;  4OZN A;  1RAG B;  2FLL A;  3BYP A;  1RWK B;  3NNH A;  5KG2 A;  5KFW A;  2DB1 A;  1REV A;  3I0R A;  1LK5 A;  2YVS A;  1VRQ C;  3KJN B;  3BJY A;  3KWM A;  1DRZ A;  1HIY A;  2B6A A;  3UD3 P;  4Q5V A;  4DN9 A;  1GXT A;  5KFI A;  3ZZP A;  3G82 A;  2DHX A;  2U1A A;  4USI A;  1OQ6 A;  3GU0 A;  4W90 B;  4YB7 A;  3SDE B;  3DRP B;  3CC2 S;  2DPJ A;  4OIX A;  1RDR A;  1RT7 B;  4PG7 A;  1S9F A;  1M5V C;  3BM7 A;  3R7N B;  2J9D E;  4ED2 A;  2AEM A;  3R2D J;  3HKW A;  2DTJ A;  4B9S A;  2B8Q A;  5KFV A;  2MZQ A;  2XMT A;  2NZ4 A;  3LP2 A;  1B0P A;  3PX4 A;  2XB2 D;  3OFF A;  4M8L A;  4J9V A;  4N41 A;  1NH8 A;  3KDN A;  4X4U A;  2VIH A;  1IBM J;  3MUV P;  2LU2 A;  4N8O A;  5KFN A;  4X66 F;  4UQG A;  3ZTO A;  1NSK L;  4ZMM A;  2ZBI A;  2C3Y A;  1R31 A;  4ED7 A;  1YK9 A;  2CYY A;  4URG A;  5KFG A;  1BQN A;  3RGI A;  1KKH A;  4PG6 A;  1PYT A;  4F0K A;  1LNQ A;  4PRF A;  1FWP A;  1NZ8 A;  4Y65 A;  1S6P A;  1RWO B;  3GIR A;  1RJJ A;  3N4W A;  2JX2 A;  1IKX A;  3UD5 A;  2YNF B;  1WOR A;  1JLG A;  5GAH I;  1AXQ A;  1DTQ A;  3HHL B;  2JZ5 A;  4ECV A;  5L8R C;  1X60 A;  2W9C B;  2VV5 A;  1Y5L B;  4G1Q B;  4X64 J;  1ZZF A;  2K7K A;  5L1I A;  4I67 A;  3DM2 A;  4BLG A;  2ILY A;  2VQF J;  5D4N A;  2UXB F;  1VQ8 S;  4DV3 J;  1RIS A;  2KRR A;  2XHC A;  3MM6 B;  1UA0 A;  4J91 A;  4GVB B;  4FXV A;  1N34 J;  5U47 A;  1D9A A;  4UUX A;  5CAB A;  3TVZ A;  4U7C A;  4LSN B;  4XK8 C;  2YWW A;  4AYB D;  2RQ4 A;  1N88 A;  2YY3 A;  5L1K A;  5F8L A;  1U6F A;  1FX2 A;  2F5G A;  5IV3 A;  4WJB A;  2MQQ A;  1IBC B;  5C5J A;  3PRD A;  4AFF A;  2XMV A;  2XS7 A;  2EWH A;  4ZPW R;  1YVF A;  3B4M A;  4JI8 F;  4MKA A;  2ERR A;  2VPW B;  4DL5 A;  1EHW A;  3D6M B;  4OMF G;  1VK3 A;  2CPJ A;  2GAG C;  2DGS A;  3SQG B;  3SIP B;  1T05 B;  3V4I A;  4IH7 A;  2XQC A;  4M5K A;  2WSE C;  3C15 B;  3CUN A;  1WSR A;  5BR8 J;  4RU9 A;  4I64 A;  1X5T A;  2P9E A;  1VI7 A;  3KLV A;  3QNW B;  4NA3 A;  4KGM A;  2VOD A;  1HR0 F;  2G13 A;  1B7Y B;  4YB6 A;  2QE5 A;  1JLB A;  5MAO A;  1RU2 A;  4DL3 A;  3JYT B;  2EW9 A;  1U49 A;  3HVR A;  2BEF A;  3TZZ A;  1YZ6 A;  2VZ9 A;  2NXJ A;  2KZZ A;  1SC3 B;  4OHV A;  1CJV A;  1TU0 B;  3RW7 A;  3GMG A;  3BR9 A;  1J5O A;  4KB7 A;  5KFR A;  1RTH A;  3IG1 B;  1IJE B;  1ZOT A;  3TZX A;  5E3Q A;  3QFH A;  1KTV A;  3ISN D;  2C2N A;  1VBZ A;  4XPE A;  3ZZU A;  4K5S A;  2XMA A;  2CQ3 A;  3GZ7 A;  3WQP A;  3M8Q A;  4QIG A;  4C4W A;  3NS7 B;  5GVQ A;  3H5X A;  3OBI A;  4Y2I A;  1JXL A;  1K1Q A;  4QYZ K;  2IVY A;  2L9W A;  4F04 B;  2A6M A;  1JXV A;  5A2Q Y;  5HAO A;  4I2Q B;  1IBK J;  1OY9 A;  3DXB A;  1M5P C;  2WZ1 A;  2CNL B;  3OR2 A;  2YKA A;  3SEO A;  1CJK B;  3I5C A;  1WOO A;  1TL7 A;  1U45 A;  4FYW B;  4U7U K;  3KJV A;  3K58 A;  2BM1 A;  1LV5 A;  4OI2 A;  1AUS L;  1AYE A;  1GTE A;  1Q7L B;  2UUB J;  4CLP A;  2OLW A;  3PVX A;  2A1B A;  4BDP A;  3HFZ B;  4RW9 A;  4NLY A;  3RR7 A;  4DPW A;  4HEA 9;  3QT5 A;  1SQF A;  3EJM A;  1WC4 A;  4F7V A;  2K1R B;  4B3O A;  3KUH A;  2QTW A;  3MR5 A;  5CH7 B;  2B4V A;  1RT3 A;  2L9N A;  3PHE A;  3SCL E;  1QSY A;  2CNO B;  4LF6 F;  2WVD A;  3OJU A;  1K1S A;  2UUW A;  1AT1 B;  1DY3 A;  4JI7 J;  2FHM A;  2BOP A;  2BJ1 A;  3EUN A;  2PSZ A;  3BDP A;  1F2H A;  1WG4 A;  1N6Q B;  4YB5 A;  2E9T A;  1XR7 A;  1OQ3 A;  2IMO A;  4B3S F;  3ICL A;  2FJW A;  3UDE A;  1XJW B;  1Y7P A;  3KJQ B;  1XNR F;  3W8G A;  1C0T B;  2XHW A;  1M1H A;  4OZL A;  3DN9 A;  2FJE B;  3FRY A;  3T6J A;  3T5K A;  1PGZ A;  1WEL A;  1FRH A;  2B4O A;  4U96 A;  4RW6 B;  5ADZ A;  3RRH A;  1RBO B;  3ILJ A;  2BBE A;  1UWB A;  3VAF A;  1G4C A;  2QG9 B;  3O3L A;  3NOG A;  1IBM F;  4K5R A;  2Y8W A;  1SKR A;  2V34 A;  2N82 B;  1LWE B;  1R89 A;  4IO1 A;  1SJ1 A;  3C16 B;  4M5D A;  1MRO B;  3C6U B;  2Y9H A;  1OY8 A;  2KI2 A;  1CPZ A;  4QJV A;  3V81 A;  1CQM A;  3IRX A;  4ZJQ A;  4MFB B;  5GAH U;  5HRO A;  2UV8 G;  3NWR A;  2XS5 A;  1KFD A;  3D1Q A;  4EFA C;  1PJ7 A;  2AEF A;  3OQ2 A;  1VMB A;  3W9J A;  1OSC A;  1REV B;  1RHJ B;  1BHN A;  2F40 A;  3R1L A;  1HWJ A;  2V63 A;  4F3M A;  3IO1 A;  4PWU A;  1TAQ A;  1S97 A;  8AT1 B;  3BSA A;  4BWJ A;  3G82 B;  3TYT A;  5DO2 A;  1H38 A;  3MTJ A;  2XI3 A;  2CQD A;  2BXJ A;  4DSF A;  4TN2 A;  2VQF F;  4FNI A;  1VRU A;  1WNE A;  3D3C J;  3LP0 B;  1OYD A;  3DRR B;  1BWE A;  2CDR B;  1IR0 A;  4YP3 A;  2QEX S;  3A1Y G;  3AD8 C;  1WHW A;  3M6W A;  4R25 A;  1QSL A;  2HQG A;  1S1U A;  3P5T L;  3RTV A;  5IFM A;  3FSX A;  4FBT A;  3LP2 B;  3ELH A;  4CTA A;  3FSY A;  2UXC J;  2KJW A;  5DM6 Q;  2F3J A;  5DDO C;  3FSI A;  1KBR A;  2KHC A;  4IYQ A;  2HHT A;  1YTY A;  5DQH A;  2W7P A;  4JI1 J;  4Y2K A;  2IYI A;  2KH9 A;  2BKO A;  1GEH A;  1Q4R A;  1V3Z A;  3V6D A;  4KIA A;  1DQA A;  2R8H A;  2VAS A;  2UP1 A;  1WUU A;  2L9D A;  4JI4 J;  2DR6 A;  1MMN A;  2UXD F;  2GCF A;  2ROE A;  4ZIW A;  2DXF A;  3DLE A;  1BQN B;  1FKP A;  3J81 Y;  1UWA A;  1YIJ S;  1TL3 B;  1EJ7 L;  4NLD A;  3OVB A;  4WE1 B;  2BUN A;  2V8V A;  1EQ0 A;  4LVO P;  2BW2 A;  5CAA A;  2QX0 A;  5F0W A;  2HGN A;  2RDI A;  5E7O B;  5ETL A;  1JLG B;  4HTJ A;  4FF4 A;  4ETZ A;  3PRB A;  2ADC A;  2W24 A;  5GAE I;  2RQC A;  3M8Y A;  4YR2 A;  5CYQ A;  4DWI A;  3DM2 B;  2JC1 A;  2ZE2 A;  3GV7 B;  3FMW A;  5FLX U;  1CUL A;  2WOM A;  3HVT B;  3VR1 A;  2VQE J;  4NLP A;  5HQ8 A;  4E8U A;  3AJ2 A;  1EKS A;  2QO3 A;  4KGZ B;  3M8W A;  1R0A A;  1M1G A;  3CCW A;  4PWD A;  1AZS A;  3PZP A;  2WON A;  3WDO A;  2ZHA A;  2KHD A;  3HM9 A;  1IKV B;  4CO3 A;  2GW8 A;  4RBV A;  3TJ9 A;  2XZT B;  2WTF A;  3M05 A;  2OPP A;  4ECQ A;  1LKZ A;  5KFU A;  5L46 A;  4NX9 A;  1FRJ A;  3GIM A;  5DZ6 A;  3ILO A;  1WJ9 A;  2BE7 D;  3ETM A;  4M5G A;  3H4D A;  4DX6 A;  1IBK F;  3H25 A;  2M9K A;  3CCV S;  2FVC A;  3D6H B;  2P9G A;  1O5J A;  4EGL A;  3JAM U;  3V4I B;  4LRD A;  3J7Z T;  1NJX A;  1RTD A;  2HEK A;  2QJ3 A;  4OV6 A;  5GMD A;  1Q8K A;  3IM9 A;  1ZPW X;  3QT7 A;  3DLL Q;  2OTL S;  1HNW J;  5CCM A;  2R8I A;  3SQO P;  2HVE A;  2MY7 A;  5JMN A;  3KLF A;  1KVJ A;  2CWX A;  2DNZ A;  4P71 A;  1S1X A;  1JLB B;  3DDN A;  1FTC A;  2MKC A;  3BSC A;  3R5D A;  3W3S A;  2IRY A;  2HQC A;  2HFO A;  2QLJ B;  4OYZ A;  5LJ5 Y;  1SUQ A;  2KT2 A;  3HSD A;  3SSR A;  1CJV B;  1WF2 A;  3RAX A;  2JLG A;  4B3T J;  1SV5 A;  2KYX A;  2G2Y A;  4XO0 A;  3WZ0 A;  4M5N A;  5KT6 A;  1UVK A;  1RTH B;  1TL1 B;  1FEE A;  2DGX A;  4PXC A;  1HNX J;  4TU8 A;  2VG7 A;  1NXI A;  2V68 A;  5DG7 A;  2FJA B;  1L3T A;  5KFD A;  1KWM A;  2MQL A;  5MLC V;  5KFL A;  3MUR P;  4TYA A;  1JLF A;  3FDS A;  5C24 A;  1U47 A;  1WOS A;  4UQT A;  1YZ7 A;  2RS2 A;  4U67 Q;  3M8Q B;  2C2R A;  2DKO B;  3CDB A;  4O3O A;  3JSB A;  4ECU A;  1TL4 A;  2HWI A;  3D0I E;  3CDE A;  2DNM A;  2H4W B;  2LXF A;  1HBM B;  4TU9 A;  3FGV A;  3PKY A;  5LSR A;  3O2I A;  1KHV A;  2WVE A;  1L3K A;  1JLA A;  4EK2 A;  3ET6 B;  5KFS A;  4GMK A;  3MMB A;  3OR2 B;  4MK9 A;  5H1S V;  2CG4 A;  4WP3 A;  2QYC A;  3H98 A;  3D3B J;  1BUX A;  3JTN A;  4QWC A;  1NJI T;  2BE2 B;  2AT1 B;  3EDR B;  5ETK A;  4IRK A;  2R8K A;  3PCO B;  3NMA A;  2G0J A;  2G0C A;  1HHS A;  1TL7 B;  3K2Y A;  5F3T A;  2KB2 A;  4EBC A;  3M6V A;  2GC8 A;  3KJV B;  2YXL A;  3BB5 A;  4ZVR B;  1V5V A;  4OZ0 A;  3PXG a;  4YEA A;  4JI6 J;  4J9P A;  2DGT A;  1M5H A;  1SL1 A;  1GQE A;  3MR6 A;  4N8N A;  5KFO A;  3R9L A;  4ZDN A;  3GYX B;  1VDH A;  5DGB A;  1WHY A;  2NXC A;  1S57 A;  2RKI A;  2Z2Z A;  4NA2 A;  3DCA A;  2EFN A;  2CJK A;  1WDD A;  2DNO A;  3M32 B;  1FNX H;  2VFR A;  1S9E A;  4ZVO B;  4B3O B;  1Y0H A;  2JL9 A;  3DRY A;  1TUV A;  5C2G A;  3KNA A;  3VGU A;  4CLS A;  3W9I A;  4IDK A;  3OD2 A;  5D0E A;  3GE9 A;  2IM3 A;  3GYN A;  1U7L A;  3R5C A;  3IRW P;  2F4V J;  4DX5 A;  4ER8 A;  1NK9 A;  4X62 J;  4USM A;  1XMB A;  4UOC A;  2IRX A;  4C8Y A;  4C98 A;  1HNZ J;  1L3V A;  2HK3 A;  4P10 A;  3VF0 B;  2ZWP A;  1NDK A;  4DBQ A;  1QY7 A;  4FYY B;  4RWW A;  4LFA F;  1VCT A;  2L08 A;  2IVM A;  4QIV A;  1IBL F;  3HI9 A;  4PQU A;  2LCW A;  3G6V A;  4QR1 A;  1Q8B A;  2KJV A;  1SPB P;  1B70 B;  3CGI A;  4CLT A;  3CED A;  1WSV A;  1UWB B;  2BJE A;  3TAM B;  3TOQ A;  1B0T A;  3D5M A;  2XYH B;  4C6A A;  4WKY A;  2AYM A;  4JI4 F;  4Y34 A;  2DNK A;  2PI5 A;  2LKZ A;  2KZM A;  1ICE B;  2OUG A;  4YQW A;  1XIQ A;  3M2V A;  5KFX A;  2ZZT A;  3R5B A;  2VKZ G;  3R3T A;  4O3N A;  1F5C A;  3MOZ A;  3QIP A;  2HVD A;  1FXD A;  1XER A;  4FYV B;  3DMJ A;  3I6P A;  1XQI A;  1WKK A;  1RP5 A;  4U8V A;  3H5Y A;  4UZC A;  1Q82 T;  4NXN F;  2Y0S D;  1AA1 B;  3MDF A;  2MLY A;  2RU9 A;  4ENO A;  5HMW A;  5GAE U;  2ASD A;  3I5B A;  4L6V 3;  2O3D A;  4S0M A;  2HZV A;  3SI8 A;  3BGR B;  2ZJQ Q;  1FK9 A;  5ETN A;  1JQG A;  4C11 A;  3OFE A;  3QAU A;  3OLA A;  4QW8 A;  2GMJ A;  2KT5 A;  4P2S A;  4X4O A;  1NM2 A;  2AU0 A;  4ES1 A;  3EXC X;  4IKA A;  1KOO A;  3QWP A;  4CLF A;  3GPA A;  2MEW A;  2G2O A;  4OZ5 A;  3CSK A;  3G96 A;  1IVZ A;  4DCJ B;  1S1U B;  3E3X A;  2MQN A;  2AJQ A;  3V6H A;  2VIC A;  4CTA B;  4JYA J;  2FDN A;  2Q3P A;  5KT3 A;  2BQU A;  3OTB A;  3IWN C;  3TVY A;  2KL8 A;  2LDY A;  3A3O B;  2BQR A;  5LM7 E;  1KC8 T;  4QU7 A;  5AJ3 F;  2RH3 A;  1UMJ A;  3PFE A;  1NKC A;  5CZV A;  3ZTR A;  1FHT A;  3PW7 A;  4ALZ A;  1FKO A;  1FKP B;  4EMD A;  2RIJ A;  4ZPC A;  2QMU B;  5D0H A;  1NBE B;  4K8R A;  3THP A;  4AQY J;  3T5L A;  2DY1 A;  3CCZ A;  5BXI A;  2I9S A;  2GVD A;  3G6X A;  4G3I A;  1HNW F;  1Q5V A;  5K8P A;  4K59 A;  3E51 A;  4Z7Y A;  1R0B G;  2ASL A;  4ZVU B;  3IA0 A;  1T3N A;  1VHF A;  2GMH A;  1S4F A;  4LFB J;  1X4A A;  2IFX A;  2VG5 A;  4A8O A;  3MWB A;  3IR7 B;  1NRK A;  2PT0 A; 
#chains in the Genus database with same CATH homology
 5ETS A;  3MCM A;  1EQM A;  3KUH A;  3ILJ A;  5ETL A;  3KUE A;  5ETN A;  3HCX A;  1CBK A;  2CG8 A;  3HD1 A;  5ETQ A;  1Q0N A;  2F63 A;  3HSZ A;  5ETK A;  1EX8 A;  3HSD A;  3MCN A;  1IM6 A;  4PZV A;  1TMJ A;  1G4C A;  3IP0 A;  2BMB A;  4CYU A;  1F9H A;  3ILL A;  4M5K A;  4M5M A;  1EQ0 A;  5ETT A;  3QBC A;  3HD2 A;  1RB0 A;  1KBR A;  3ILO A;  4M5I A;  3HSJ A;  3ILI A;  2QX0 A;  1RU1 A;  3MCO A;  5ETM A;  4CRJ A;  4M5L A;  1HKA A;  5ETP A;  1RU2 A;  1TMM A;  1HQ2 A;  4M5H A;  3HT0 A;  3HSG A;  4M5J A;  4M5N A;  1RTZ A;  3UDE A;  4CYU B;  4M5G A;  5ETV A;  5ETO A;  1DY3 A;  5ETR A;  3UDV A;  3UD5 A;  4AD6 A;  2F65 A;  4F7V A;  1RAO A;  3KUG A;  4CWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...