3MUTP

Crystal structure of the g20a/c92u mutant c-di-gmp riboswith bound to c-di-gmp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical determinants of ligand binding by the c-di-GMP riboswitch .
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mutP00
4C0OC 2BZ2A 3R1HA 2NZ4A 4TLQA 5DDOC 3DXBA 3VAIA 3MI7X 3THTA 2VONA 2I2YA 3P5TL 2NLWA 2MJNA 2DGSA 1A9NB 1BY9A 2MXYA 1WTBA 3US5A 1X5OA 2X1BA 1U1KA 5GMKa 3UE2A 2E5GA 4A8XA 2RS2A 2XB2D 3G8SA 2X1FA 1WHWA 3LQVA 3NNCA 5D77A 3UWTA 3ULHA 2DNMA 1K9MT 2I38A 2KYXA 5HO4A 1X0FA 1UP1A 2GHPA 3CC2S 3OW2R 1WEXA 1YI2S 5LJ3Y 2DNLA 3ZZZA 1K8AT 2N3LA 4QU7A 2MQMA 2LECA 2DIUA 2MKSA 1R8PA 3S01A 2QEXS 2M9KA 3LPYA 3VAMA 1VQPS 3K0JA 1O0PA 1FXLA 2E5HA 1X4GA 2KI2A 2BOPA 4WKRA 2MKCA 4PR6A 1QVGR 4F26A 2D9PA 4CH0S 5JVHQ 1U1QA 2PE8A 2AYEA 1N54B 3FEYB 1YJWS 2X1AA 2U2FA 3S7RA 5GAEU 2RU3A 1IQTA 2DITA 3MD3A 2PEHA 2LXIA 5LXYA 1HA1A 2DK2A 2ERRA 2J0QD 2YWKA 3EGNA 2KH9A 2AYGA 5ITHA 1OWXA 2YH1A 1SXLA 2CQCA 2AYBA 2RNEA 3CXCR 3CCRS 1YWXA 1UAWA 1UW4A 2HGMA 2HGNA 2Q79A 3UCGA 5CXTA 3IWNC 1H2VZ 3MDFA 1ZH5A 2CPYA 1KOOA 2G0CA 4Y0FA 4ZKAA 3CMES 5LXRA 4UQTA 2RQCA 5D78A 3CCJS 1WG1A 3BO4A 2KM8B 2DGVA 3MUTP 3CC4S 2M7SA 1KC8T 4WCEQ 3U1LA 3G96A 1WEYA 2N3OA 4CQ1A 1P27B 2CPIA 1QVFR 1VQ8S 1X5PA 1X4HA 2XSFA 2U1AA 1NO8A 3ZZYA 1FJCA 3UD3P 2LCWA 1PO6A 2EVZA 3UCUP 1G2EA 1D9AA 4TU7A 4FXVA 1OIAA 2MKHA 5GVQA 2DGQA 2CJKA 2DGXA 5FJ4A 2YH0A 1U1PA 3JB9k 1DRZA 4V19X 4YUDA 5IQQA 3UD4P 3BO2A 5H1SV 4CH1A 1JJ2R 1K73T 1U6FA 1WF2A 1X5TA 3HI9A 3I56S 1WHXA 2ZJRQ 1WI6A 2LA4A 2MQLA 3BEGB 2KXNB 2MQQA 2F3JA 2MMYA 2N7CA 2OTJS 3H2VE 2M8HA 3G71S 2ADBA 2MKJA 4C7QA 3RW6A 2MJUA 2UP1A 3FEXB 3VAGA 1ZZFA 4WF9Q 3B4DA 3MXHP 4ED5A 3N9UC 1FO1A 2CQBA 3NNHA 1URNA 1QM9A 2EK6A 2HGLA 3G6ES 3BO3A 1W2BR 3L3CA 3CMAS 5GAHU 3SDEA 3S8SA 1WI8A 4Y00A 2MZ1A 2VOOA 2DHXA 2MY8A 3TP2A 2CPEA 2MGZB 1WG5A 2FPHX 5JVGQ 2LXUA 2RQ4A 4WIIA 2F9JA 2KG0A 2HZCA 4F25A 2DNYA 3B4MA 3G8TA 5DM6Q 3UCZP 2LYVA 1UFWA 1VC5A 4W92B 1PGZA 1VQNS 2KG1A 2DGUA 2RT3A 2L41A 5DETA 4WFNQ 1OPIA 3VAHA 5DM7Q 2DH9A 2M52A 4QPTA 4IOCQ 1H2TZ 4TU9A 2OSRA 4P6QA 2VODA 1VQKS 2MHNA 1N52B 4UY8T 2DNKA 2KN4A 1XN9A 1M5VC 1FJEB 1S72S 2F9DA 1M1KT 2XS7A 1KQSR 2CQIA 2CPFA 2ADCA 2DNZA 3VAJA 3P6YC 2AD9A 2DNHA 4EGLA 4OZ0A 2J0SD 2VOPA 2OTLS 3CCUS 2DHAA 1WEZA 1U1RA 3TYTA 4QQBA 2J76E 1U1LA 3VAKA 1YJNS 2KXFA 2CPXA 2KHCA 1RKJA 4QU6A 2FC8A 5IM0A 2DISA 5LSOA 3TO8A 4ERDA 1JMTA 3J7YU 3CF5Q 2LEAA 1OO0B 2DH8A 4WFAQ 4IO9Q 1VQ4S 2CQ0A 3MOJB 1U6BA 3IRWP 2JRSA 2M0GB 3NS5A 2KRRA 2MZQA 1JJHA 1YITS 1AUDA 2QA4S 3CC7S 3R1LA 1YTYA 4J5OA 4PKDB 3P3DA 3CULA 2CQHA 3CCES 3CD6S 1VC6A 2M2BA 4IOAQ 1A7GE 3MUVP 1FHTA 4YOEA 2DHGA 2RRBA 3PIOQ 3CPWR 2ZJPQ 2DNQA 4FXWA 3CCVS 3MURP 1U1MA 1X4FA 2HVZA 4Z2XA 2JVRA 1VQ7S 2KT5A 1SJ3P 3G4SS 1DHMA 3PIPQ 1U1NA 2JX2A 3U1MA 2D9OA 2M4MA 1VQ6S 1NJIT 3Q2TC 2SXLA 2LQ5A 1H2UX 1L3KA 1WHVA 1H6KX 4C4WA 1HD0A 2DH7A 2CQ3A 1F9FA 3BS9A 2CPHA 4RU2A 2O3DA 1M90T 5EN1A 2CQGA 2DNOA 1RK8A 1X4EA 2RRAA 1VBXA 4LMZA 2KXHA 2DGTA 1FT8A 1VC0A 2YTCA 4F02A 1VQLS 1M5KC 1B7FA 4OZ1A 2CPJA 3VALA 5MLCV 1Q81T 1WF1A 1SJRA 2B0GA 2DO0A 3J7ZT 1WG4A 4IUFA 2YKAA 1VQMS 2E44A 1WHYA 1HL6A 2MPUA 1FNXH 2M8DB 2DB1A 1FJ7A 5LJ5Y 2MQPA 2MZJA 2CPDA 4CIOA 1VQ9S 1Q7YT 4M5DB 5DDRC 2M70A 4YB1P 1YIJS 3EX7B 2DGWA 1VQ5S 2A3JA 1N8RT 2E5JA 2V94A 1ZZNA 2RVJA 3CUNA 1NU4A 2L9WA 3VF0B 2D3OR 1VBZA 2DNNA 2DHSA 5GAGU 1SJQA 2AYMA 2JVOA 2KU7A 1KD1T 3NS6A 3SDEB 2MB0B 4BS2A 3CCSS 2E5IA 5CYJA 5DDQC 1X5SA 1WELA 2DGOA 2L08A 1KOHA 1X4CA 1U1OA 2CPZA 2M88A 1VQOS 3Q2SC 1X4DA 2MKIA 1M5OC 2KM8C 3SMZA 2LEBA 1P1TA 3P49B 2ZJQQ 1N88A 2X1GA 1DZ5A 2DNGA 1SJ4P 3V4MA 2MKKA 3CTRA 2MY7A 2HYIB 2MSSA 2CQ4A 1X4BA 3CCMS 1SJFA 3MUMP 4LIRA 2WBRA 1S79A 3EGZA 2XS2A 2MZSA 2XNRA 2MZTA 1HD1A 5GADU 2RS8A 2N82B 2OSQA 2KVIA 3RW7A 2JWNA 3R27A 2LMIA 2MSTA 3H2UB 1DBDA 4LJMA 1Q86T 2GO9A 2DNRA 2XS5A 5HL7Q 1M5PC 1D8ZA 3HHNB 5CA5A 1JJ4A 3NNAA 3VAFA 2DO4A 4PRFA 2J8AA 2K3KA 2CQ1A 5IM0B 3D2WA 1Q82T 2G4BA 2DNPA 2LKZA 4WFBQ 3SXLA 2CQ2A 3S6EA 3NMRA 2KRBA 2OIHA 1U2FA 1WWHA 2XNQA 3DLLQ 5IFMA 1YHQS 2FHOB 3MD1A 4U67Q 1X4AA 3THPA 5BJRA 1R8HA 4TU8A 3I55S 2MQNA 5LSLA 3CCQS 2FY1A 3CCLS 2OJ3A 2EK1A 1WF0A 2MYFA 2RUGA 4W90B 3G9CA 2FC9A 2QFJA 2CQDA 2K8GA 2G1DA 2MZRA 2MQOA 2MGZA 2KFYA 2LA6A 2CQPA 2DIVA 5DDPC 1VBYA 1CVJA 1YJ9S
chains in the Genus database with same CATH superfamily
2VFRA 3DLGA 3DRSB 1U48A 5DS7A 1X0PA 3I87A 3HXMA 3ENAA 2D3ZA 4GKKF 2YKMA 4OZJA 4A8XA 1FJGJ 3M4XA 2JEGA 4DR7F 3ULHA 4NLUA 4BC9A 4DR2F 4NYOA 2CIMA 3TWZA 3I0SB 2C42A 4NLQA 5J1EB 1R0AA 5HROA 4HKQA 5EWGA 3GV8B 1XMBA 5E3CA 3FSYA 3FUYA 2WONB 2UUBF 2JFDA 3CJKA 4KKOB 3VHQA 1RWNB 2JEJA 5HATA 1GH8A 2VQFF 2Q6CA 1JLBA 4DL3A 3H4BA 2HGMA 1REVA 2BXJA 2VG5B 2HFVA 4XTTA 3T19A 3L7UA 4A8QA 1KEKA 4N76A 4RW7A 2HVHA 4QYRA 2VG6A 3IGNA 2NQPA 1G2EA 3GFZA 2XY7A 1B0VA 4LRFA 2DGXA 1RTIA 3KK3B 1FK9A 1HNIB 2YX7A 2C2ZB 4OYIA 3HF5A 2XMMA 2PN6A 1C1CB 3MMAA 3IR7B 4ZHRA 1UMJA 4X62J 3H2VE 1N5YA 4CP5A 1T0TV 3MXHP 2R3VA 2VICA 1ZM2A 4F7VA 1QM9A 2HEKA 2IJNA 2FVQA 1H74A 4C0HA 5GMDA 4DPYA 6FDRA 3MR5A 2VQEJ 1RTJB 3C6UB 3BSOA 3FMBA 5KFVA 4DR3J 2GJIA 2HNYB 4ECXA 5LMNJ 2FLNA 1MG7A 4WFNQ 3QFHA 4LSLA 3R5CA 3Q83A 2QSWA 5L9NA 4KGKA 1FKAF 3VR1A 3P96A 2JLFA 4RBUA 2CNLB 2UVUA 4V19J 1DLOB 2GIFA 1WKLA 1ZA1B 4QQBA 2RKIA 4ZVGA 2KHCA 3DLKA 1RT2B 2VB6A 3QRQA 3B54A 1W7WA 2HVIA 1IR0A 4ZN3A 1S77D 2XMTA 3K5OA 4IO9Q 2CJBA 2CQ0A 4Y2IA 4AQYF 2HIQA 3PXGa 4F3MA 1YTYA 1HBUB 3W5YA 2BA9A 5B0EA 4MFBA 3QWPA 3UQSA 1GMVA 4JI2J 3MURP 5BXIA 1U1MA 5KAKA 1NPKA 3MAAB 3PIPQ 3I82A 3NCPA 1F9EB 1JLFB 1B0TA 3G82A 4AYBD 2D3O1 4C48A 3V4IB 3NWRA 1SL0A 3OXFA 2XWXA 3CD5A 4ZN1A 4U6PA 4HH0A 1Q16B 2I5JA 3M8ZA 1RDRA 3NGDA 3R7SB 3VALA 4LQ9A 1IBKF 3TUJC 1VISA 2BW2A 4WYWA 4LF4J 4F50A 2E44A 2XTJP 2GHVC 2J7KA 4LF9F 2Q43A 1V6HA 5DDRC 2YWFA 1S9FA 3B8HA 2YX1A 1RT1B 1GXUA 4J9NA 2D3OR 1VBZA 5IWAF 3QGPA 2C2RA 1SKUB 1CULA 1VIOA 2QJ3A 2JLEA 4K5SA 5E7OB 1XMOJ 2QA1A 3AB2B 3HSGA 2HNDB 5FDLA 1OY9A 4B9UA 2AEFA 1VRQC 4DUYF 2V69A 4USIA 4P72A 5EHHA 2R2TA 3MPYA 4G65A 5CD4A 1UVKA 3OL6A 2XMVA 3H2UB 4AE5A 4ILRA 4AFFA 3GJTB 4L3KA 1KDNA 4OZ5A 3JSBA 3VGVA 1ZAVA 1JLCA 2B8QA 1LEOA 4HVZA 2QA4G 4ED6A 3W60A 1R89A 2NYHA 1ACMB 3KMSA 1X4AA 1T9VA 5HVFA 3PYFA 8AT1B 3VGTA 5CZVA 4DSJA 1FKPA 3I0RB 5DDPC 1VBYA 1SKSA 1AYEA 2XZWA 5KFKA 4R8UA 1AXQA 3AH6A 3E3XA 3RAMA 2YNGA 4A8MP 3BSCA 1WUUA 2HVDA 1M5SA 1ZS6A 2XI3A 4LR9A 1LWXA 2I38A 4DX6A 4CM2A 4LF6J 1NNDA 2QMUB 3MPVA 1XNRJ 4FF3A 4KQZA 4CH7A 3L4BC 5D0RA 2BABA 2A6MA 4DX8H 2D9PA 2RF2A 1N54B 3OFGA 2VG7A 3GG1A 2ILYA 1UA1A 1HA1A 4K0KJ 2DK2A 4HI2A 3SV3A 1JLEB 2HHSA 3FCVA 2GVDA 4ZLJA 2BDPA 2LXFA 1YZ7A 2PMWA 2CPYA 4P2SA 2XHCA 5I3UA 5J2MB 2N4CA 2YKPA 3QAEA 2A1BA 4CQ1A 4DCOB 4N41A 2QC3A 4JI8J 2IM0A 2LDYA 3PR5B 2XSJB 4H54A 1VK3A 2IHR1 2KTQA 3NOCA 5BYQA 3W2VA 2AU0A 4U7UK 2VL1A 1NB7A 2EBEA 2UXBJ 3DRXA 4V19X 4UY85 3MM6A 4OZ2A 5LM7E 1UJ5A 1RZMA 3Q8SB 4NXMJ 3G71S 3QIPA 3FEXB 4ED5A 4K50A 2CQBA 3FZBA 2B43A 4RW4A 1PSDA 1WNEA 2VA3A 4C8ZA 1UWAA 1RI7A 4PWDA 4Y00A 2DHXA 3HFKA 5AE2A 4C3MA 2IIHA 5KOWA 1QJHA 1DQ8A 3MEDB 4IH7A 3FRZA 2QV6A 3ISZA 2EFNA 1CJTB 2XC9A 1N33F 3KWMA 1S72S 2IRYA 3HHLB 2CPFA 4PABA 1RACB 1VRUA 3JSMB 4DV7J 1UKUA 1U1LA 5L1KA 1AW0A 3POTB 2KXFA 1OYDA 4O4GA 4ERDA 1YSJA 4DV5J 2ZOFA 3CF5Q 4WFAQ 1OO0B 2V4RA 4JI3J 2Y8YA 1UPPA 1ZYQA 4ICLB 3SCIE 3EXYA 3K2YA 3R1LA 1RAGB 2EEYA 2XO6A 2NYIA 4NXNF 1U49A 2HVZA 1Y10A 5HAOA 1NHVA 4O0NA 4PXDA 2BQUA 1TQLA 2JX2A 3M1VB 2D9OA 4DQSA 3Q2TC 1IN0A 5KOXA 4DS5A 1YGYA 4KPCA 4JI0F 2DH7A 2DPIA 1RWUA 1ZBTA 4RL1A 4N56A 5D6GA 3ZZTA 3JAMY 1YLXA 3N4WA 2B4OA 2L9DA 1HKAA 3RBZA 5D8HB 1ELOA 1DTQB 3MM8B 3J7ZT 1NRKA 4AL6A 2V2ZA 2YKAA 2K7JA 3BDEA 3A1YG 2WSFC 4YS2A 2W9CB 2CPDA 1Q7YT 4M5DB 2FDNA 4WK3A 5H9EK 1VQ5S 3E01B 2VPZB 3M2RA 2J9CA 2G0JA 3VF0B 2EWHA 5LL6d 3GFYA 3HD2A 4M1KA 2B51A 4HI1A 5KFYA 2I6WA 2DTJA 4NLTA 1MWYA 1U24A 1U2RA 2KM8C 4ZCKA 3BGRB 3ZZPA 4WJBA 1PJ5A 3O44A 3OUYA 4JOUA 4IFVB 1Q95G 1JXLA 3MEGA 4KGXB 3HLUA 1LWFB 3FQKA 2XS2A 4WFXA 4ANDA 4JI5J 3BGLA 2YQ1A 3OL7A 2JWNA 4N8NA 2LMIA 4DF4A 4FXDA 4WP3A 2P5VA 3QATA 1HWIA 3ET6B 1DQAA 1U6ZA 3DKDA 4F0HA 3SI8A 3W63A 2UXCF 2R8GA 2E9TA 1VS3A 5H9FK 4B9TA 3CIMA 3C15B 5JUMA 1OMSA 2DHHA 2RIJA 2OEJA 4C98A 4CLZA 4EI2A 5J2QA 2WB4A 2DXEA 4LT6A 2AX0A 3I55S 4LRDA 1NK4A 3PZPA 1EJ7L 4O23A 2FC9A 3GV5B 3ELHA 3EE3A 4OX6A 2NR0A 3PW4A 3A3OB 3UW1A 2XI2A 5K8OA 3BH6B 5SUHA 1TVRB 2ZD1B 2P9EA 2NREA 1X5OA 2ACYA 1C0TA 1K9MT 1RB0A 1VFJA 2ABYA 5ADZA 2GHPA 3CD7A 3W2WA 4WFZA 2M9KA 4OZ3A 3VAMA 4Y34A 1YRUA 4WKRA 4AL7A 2YKNA 1QVGR 5K5MA 4ZCMA 1YJWS 4RW9B 2HMIB 3MD3A 2LXIA 1NK9A 4B3SJ 4M5NA 1ZPVA 1X7VA 2F7VA 3M8QA 3LUYA 2ZFHA 3CCRS 3Q23A 3UR3C 1OSCA 3KJQB 1DTTA 2C2KB 2KJWA 3H25A 1VHFA 4J91A 4B3RF 2I8EA 1KRPA 1KC8T 1SC4B 1DAXA 4QW8A 2EW9A 3IXQA 1IKYB 2XMAA 2CPIA 3TW0A 2V34A 4C8OA 3D7SB 2G1HA 4NZ7A 1MROB 4FF1A 1JLGB 1K1SA 1W2IA 2ZUGA 1LW2B 5GVQA 3MPDA 2CJKA 4CLLA 2YH0A 1P9YA 4CRJA 4CH1A 2V4QA 1JJ2R 2RSQA 2KT3A 2LA4A 5C2CA 1SIWB 5JJBA 1LV5A 3QGHA 3HCXA 2PA3A 2YY3A 2J0XA 4MH8A 4UZCA 3ZXWA 1QTMA 3UVJB 2LDIA 1HYSA 3M05A 1V9OA 4LF5F 2OPRB 3KLIB 3AQPA 2O67A 1JX4A 4C11B 4FYWB 1CJVA 1TL3A 1FRIA 3V81B 3GSIA 3K5LA 3DLGB 2HHVA 1VLOA 1Y7PA 2YKMB 3KKFA 4J9QA 3GYNA 1FTCA 2J7UA 4P6QA 3OSPA 1H7XA 2PT0A 1M1KT 3MPUB 3WIVA 3NKYA 4YEAA 4LF8F 3OVSA 1NJXA 4RUAA 1D09B 1R0AB 1YJNS 4JI6J 4UUXA 5HROB 4F0MA 3C6TA 2HWTA 3MTJA 4YR3A 2DH8A 1D9FA 1FDDA 4OX9F 2UVRA 3MOJB 3AY0A 3GV7B 3RBEA 2AGPA 2MZQA 2DJWA 1ZAWA 3CJ5A 3J7AN 2OGUA 3BH7B 4DFPA 1A7GE 1JLBB 5IC6B 1FHTA 3AOCA 2DCUB 4DLEA 3CCVS 5DQHA 1NM2A 1REVB 5AXMA 1U25A 1N6QA 1B0PA 1ROFA 2M4MA 1HW9A 4MYUA 2SXLA 1H2UX 1H6KX 2V8VA 3QGIA 1F9FA 4RW7B 1FESA 2CA9A 5KFHA 1IQZA 4WYLA 1J5EJ 4X4QA 3FNNA 3LO3A 1HWJA 5KFLA 2VG6B 3RU0A 1VBXA 5C7PA 4DR4J 4NCBA 3JSRA 4FBTA 2W7OA 1FVSA 3RJMB 2HW3A 1NPRA 1RTIB 2RHSB 3HDSA 1B4SA 3R97A 5F0WA 2QZ8A 2KL8A 2MPUA 2LEPA 4Y2KA 3TEGA 5LJ5Y 2HZAA 5F0UA 4ZHRB 4N5SA 2WVCA 1N5YB 3C66A 3MAHA 5ETLA 4MYTA 1RP5A 4OYWA 3RBXA 3OTEA 2BE9B 3T9ZA 5C24A 3OPKA 2VPXB 1H72C 2R2SA 2M88A 5HQLA 2HSEB 3FBCA 1X4DA 3PM9A 1YJVA 3H5XA 2X1GA 3IMQJ 3ISND 4LSLB 4YB6A 3EPIA 5IQ6A 4A48A 2AGQA 1BGXT 2MZTA 3T5KA 3PO5A 5GADU 3C16A 2EC2A 1REGX 1X9MA 2BUNA 3IS9A 2LLZA 1A6LA 2YPYA 2RKIB 4LQ3A 2D1CA 3DLKB 4YQWA 2ZH1A 2CVIA 3TVYA 2K2PA 1F5CA 3NOGA 1B7YB 3OTBA 3RB3A 1HLWA 1XTZA 3D5MA 1YHQS 1Y00A 2B5JA 2FHOB 4PAAA 1T05A 5ETPA 4FVMA 2CUYA 1T95A 4MFBB 2EK1A 4IH6A 4UTGA 2CRLA 2BV3A 4X4SA 1JKHA 3DFEA 4J9UE 1U45A 3G82B 3GJRB 3RRHA 5DDOC 2JEFA 3IO1A 4XPEA 1Q8BA 2ASLA 2DGSA 2NZCA 3US5A 1LQ9A 5GMKa 4OJHA 4MIBA 2B8PA 3D28A 1RAEB 5F3ZA 3DOLA 5HO4A 2I5JB 1MSWD 1YI2S 2W8KA 2ZZMA 3L09A 2XLJA 2PEBA 5IC4B 5KFIA 2XMWA 5F9NA 3GIRA 2X1AA 2U2FA 3UR0A 2KH9A 4ZVUB 2AYGA 2E5LF 4ZJLA 5LMUF 2PSZA 3NWGA 2AEMA 3N5FA 1YWXA 4NOHA 2Q79A 4ZS6A 1F5AA 4MK8A 4ECTA 4ZKAA 1QE1A 2P9GA 4WE1A 1FRKA 3JQKA 4X4VA 4XPCA 2VJUA 5FDLB 2PFFB 1NSAA 2HQIA 1CSJA 2E1CA 2ZH4A 4E0DA 3UN2A 3VVTA 5BR8F 3CDEA 2LCWA 3O5TB 1RT3B 2YNFA 3DDNA 4HHHA 1KVJA 4X4PA 1Y3JA 3TARA 1U8SA 3QWUA 1U6FA 3DOKA 1JLCB 4FF2A 2AJ4A 1TKTA 3V6JA 4HACA 2IMOA 2ADBA 1S99A 2MKJA 4WXWA 5HANA 1ZZFA 2W4PA 4JI7J 4J9OA 3NNHA 3HX9A 1QUVA 4KV8A 3KDNA 4PWWA 3C14B 1HMVA 2XGQA 2B9EA 3W8PA 1FKPB 1MMNA 2CPEA 3QJLA 5J2PB 2VBXA 2DR5A 2R42A 5ETRA 5F9LA 3B4MA 2FVRA 4QWBA 1RQ0A 4ZVTB 1VC5A 4LIWA 3HHLD 5HMYA 2M52A 1ZM9A 4QR1A 1N52B 3NY0A 2DNKA 2WAQD 4GVBA 4OJ1A 4B17A 4QWEA 4IYQA 4DV1J 1QD1A 2F9DA 3IAM9 5DLGA 4ECSA 3P6YC 5T7LB 1NK5A 2AD9A 2RJZA 2ATCB 1CJKA 3KMQA 1Q53A 3F41A 2OLWA 2VG7B 1U6BA 3S1TA 1NKBA 1Y5IB 3ZZOA 4QYZJ 1RLDA 2KRRA 3MFIA 1SVDA 5M2UA 4E98A 4AXJA 2GVDB 4CYUA 5DZ7A 4FXWA 3Q8PB 3G4SS 1DJ0A 5D0HA 4ZJOA 4QIFA 4L74A 2NCKL 5I3UB 1KKHA 5KFRA 2WHOA 4UF4A 2BKOA 1RA7A 2AZ3A 5EN1A 2CQGA 4FP9A 3QLHA 3W2VB 1FT8A 2XYGB 3M6UA 4ZVQB 3BSNA 4CLFA 5HMWA 3OVBA 2GVZA 1WG4A 2UXDF 1Y0HA 1N0VC 3KLVA 4ZIVA 2RE1A 4RJVA 4ZCIA 4DDFA 5I42A 4U9RA 4F3OA 3QIPB 2W2OP 1T94A 1Z1ZA 2EKNA 2UZAA 1XMQJ 1H38A 3IBCB 1T11A 1WKJA 1UEVA 3M9NB 2L9WA 3EWGA 3FC9A 4RW4B 4EUVA 3DC2A 1DY3A 3KLFB 2RRNA 3Q8RB 4C3KA 4QR0A 4PWDB 2OI2A 2BX6A 1VQOS 2PA8D 4N7TA 3P49B 2BVZA 2ZJQQ 4DUZJ 2OD4A 1S12A 5AJ3J 1LWEA 2Q66A 3EGZA 2HPUA 4DFJA 3RW7A 3R27A 4DV4F 7FD1A 2V8HA 1KWMA 1VRUB 2QT7A 5D4OA 3D66A 2R8IA 3K59A 1S1XA 3DU5A 3NCRA 3QSIA 2CQ2A 1RSCA 1U2FA 2V67A 3MD1A 1FDNA 2E1PA 3RAQA 3K5PA 3K89A 5T14A 2OAUA 2IBKA 1KQKA 4OI1A 3CCLS 3CGIA 1T3NA 2KVQE 2DR9A 1I94J 4IFYA 1DFDA 4OZLA 3CJ4A 4A4JA 3V2UC 4J9SA 2OH2A 3FFIA 2X1FA 3LQVA 4DV0F 1EKSA 4K4TA 3K8VA 1RWVB 1R8PA 3BJYA 1HWLA 5M2RA 3WQPA 2FD2A 1UJ6A 2J6UA 2E9ZA 4NLDA 5F8JA 2RU3A 2FVCA 3QZ8A 4ECWA 2ZOGA 3DRRA 4KRWA 1SV5A 4KHRA 1S10A 3AD8C 3H2LA 2CQCA 2FZGB 2GMLA 1T3OA 1KN6A 4CT8A 3GTYX 3VZHA 4K4YA 3I6PA 2OFHX 1L3UA 1WG1A 4FS2A 3IG1A 1LNQA 9ATCB 1Q8KA 4WCEQ 4H4OA 2N3OA 3CO9A 3WX4A 3FJ2A 3OUYB 1W26A 3MEGB 2HRYA 2IJRA 1X4HA 4USVA 1S6OA 4QOTA 3R6GB 1IKWA 5A0YB 3N79A 1FJGF 2PMZD 3HVAA 1JJCB 4ZP9A 2ZBPA 4LRCA 1HQUA 2V68A 1WF2A 1AFIA 4B9MA 2F3JA 4PPDA 1HPZB 1VJQA 4RUHA 3HJVA 2DR6A 2IBOA 4C7QA 1ITPA 3CB4A 5J2QB 4GVLA 2MLYA 2KZMA 1N32J 3SDEA 5KFAA 5J1EA 3PX0A 1BWEA 5HSPA 4YY3J 2LXUA 2RQ4A 2DPJA 3LW5C 2VBZA 5E3QA 1YJUA 2Y0BB 3G8TA 2ROPA 2C1EB 4UOFA 3PEJA 3B82A 3PYDA 4ED7A 1C0TB 1H2TZ 4ZPVR 1VQKS 2R7XA 2WW8A 3N28A 1TK0A 2IM1A 3I96A 2VG5A 1RTZA 3W2WB 1NHUA 2J0SD 5LSRA 1WEZA 2VBYA 2FC8A 4K4XA 2BJ7A 3BV8A 1PC5A 5DJBA 2Y1IA 2OPQA 2M0GB 2Z2YB 3NS5A 4X62F 5DG7A 3M8QB 2JJ4D 3MMCA 4IOAQ 2Z2ZA 3A4TA 2ZJPQ 2VHGA 1KQGB 4YFUA 4FYYB 1XEZA 3UDVA 3RR7A 5DG9A 4PXBA 5FIIA 2HHWA 1U2CA 1IBLJ 2EFOA 1C1CA 2VQEF 1VK8A 3D3CJ 1G3OA 1TL5A 4DQQA 1VLYA 4DR3F 4HEA9 3SFGA 3PNIA 1NLKL 1QSLA 4I1TA 1NDCA 1RK8A 5GAEI 2DGTA 5E33A 1A0OB 2ZM6J 1RTJA 4O44A 2ZKTA 3RB4A 4DV2F 3U27A 3W61A 1CG2A 3KYLA 2ZVIA 2W2MP 2Z58B 2OUGA 5KFOA 1VQMS 1QAYA 1WHYA 4K4VA 1BQNA 3KHLA 2QLBB 5K8PA 4YHHJ 4DPWA 2HHXA 4B3OA 1DLOA 1HYSB 3A12A 4FYDA 5E2QA 4DL5A 3FDSA 1X31C 5DGBA 3NRBA 2ACMA 3N6LA 1TL3B 2GA7A 3M30B 1IR2A 4JI2F 3PY8A 2UUTA 5EUHA 1RA6A 2FVSA 3OHAA 1HBUA 2OEMA 5KG7A 2V6AA 5KFCA 5FLXY 3DOMA 3W5XA 2RS8A 1EZZB 5CYQB 3QAUA 4DQPA 3MAAA 2NXEA 4OYMA 3NP5A 1EP4B 1NXIA 1M5PC 1H7WA 3OTDA 1RWWB 2GW8A 2K1RB 2CQ1A 1OY6A 4ZVFA 1PC4A 3C6TB 3FBFA 3VGUA 1TMMA 4LF4F 4DL6A 1KTVA 2JFKA 3QO9A 4MTPA 3FSXA 1XWLA 1D0EA 4ZPTR 2C3YA 3FMWA 2HK3A 4CLSA 2Z57B 1WF0A 4RR5A 4W4MA 4JYAF 4QWAA 3NBPB 3RRGA 1N6QB 1Q78A 1E6VA 3A3PB 2Z4PA 4TLQA 3M8PB 4URQU 1XMOF 1WTBA 1FRXA 2X1BA 4K8RA 2AJFE 2RS2A 4FS1A 2BQRA 3AOAA 5KFSA 2DNMA 2Y3YA 1D8YA 2UUAJ 5JXSA 3ENVA 4AUKA 4AT1B 3MMJA 3X1LB 2MQMA 2FJWA 1Q5YA 3GFXA 1FF2A 3NG8A 2HNDA 2BOPA 2J6TA 2HQCA 3PTWA 4KY3A 4CH0S 4KC5A 1S4FA 2YXLA 3C19A 1V5VA 2P8IA 3GIMA 2CJ9A 4WU2A 3ICLA 3DNCA 2YH1A 2DXFA 1CEZA 5C24B 5B09A 4OHVA 3IWNC 5KG4A 3AT1B 3PO4A 3T41A 2C2NA 3HULA 4IQXA 5HK4A 3V6KA 3KUGA 1SPBP 4FNIA 1YBTA 2DRAA 2RD5C 4USKA 2BACA 1VQ8S 2U1AA 5F8IA 5D3GA 3UD3P 3D6MB 2R2UA 4N77A 3C16B 4MKVA 3SZ2A 3TX0A 4ZP7A 5L38A 2O66A 3IS9B 4LFAJ 4X4RA 2QMWA 1RHRB 1T9TA 1NJWA 4NEYA 4IR1A 1X5TA 1S4EA 3HKZD 4RWWA 2ZOMA 4LF6F 1HI1A 3R3TA 1S57A 2AF6A 1XNRF 1TL7A 4WF9Q 2B5JB 2MLXA 2HGLA 2ZNYA 3BO3A 4OX7A 1T05B 1LXJA 4K0KF 1ZETA 4DPUA 4NCGB 2F4VJ 1JKHB 4Q2MA 4F36A 4B9NA 5D0GA 4WIIA 3T5HA 2F1FA 3GYGA 1RAOA 5HVHA 3OL8A 4JV5J 3D67A 1JLEA 3LP2A 1CQMA 2VZ9A 2CWXA 3Q8VA 4EBCA 4IG0B 3K5NA 3HSJA 4DLGA 1FJEB 4JI8F 3CJSA 3DOLB 2XS7A 4M63A 4EGLA 5J2MA 4CTAB 2UXBF 2E7WA 1RABB 4WK1A 1AUDA 4LBPA 1MWQA 2ASDA 3LF0A 4IG3A 4KSEB 2GX8A 2DHGA 2JZ5A 3CPWR 5KFQA 2BANA 4DR1J 3E51A 1BC6A 4CLPA 3EJMA 1MN9A 3BGUA 2DBBA 4QW9A 1N0UA 4HTIA 1WHVA 3Q24A 4WE1B 1T9YA 4OMFG 4CM0A 2UVVA 4ECUA 3CWJA 2HWHA 2KDOA 2AEJA 4ED8A 2YNFB 2A10A 1RWKB 2BYCA 3LTOA 1RJJA 2QLXA 2W2NP 2DO0A 2X3GA 3EZOA 3V6DA 2FVPA 3MEDA 2CG4A 4HT5A 1FNXH 4RBVA 3TUPA 4RNMA 1TKTB 3DDIA 4DSFA 4WXOA 4YB1P 3O6QA 3W64A 2V94A 4A8WA 2W2PP 2RVJA 2VBWA 4DV5F 4JI3F 2FHMA 3JSMA 4MK9A 4KV8B 2JDJA 5CYJA 4U8YA 5DDQC 2XCAA 3VQTA 2IM3A 4J9RA 1SQFA 4LF9J 1EQMA 2BRLA 3T1YJ 4P71A 2LEBA 2CDQA 3EM1A 4DPOA 2EFGA 2R7OA 2MEWA 3LGNA 1R8AA 4ZPWR 3CCMS 3UPFA 2IYIA 1M1HA 5A8KA 3P8BB 3AJDA 1WC3A 4GVBB 4IO1A 2CAJA 3CDAA 4F4AA 2H51B 2MSTA 3M1VA 1Q86T 2EBGA 5CAAA 1CJKB 2XBPA 1Q8IA 1Q82T 2GQQA 4X4NA 7FDRA 2MKYA 4XDDA 4ED0A 1F6TA 2A2CA 1RHJB 4ZVPB 1JIHA 2Z30B 2QL9B 3DLJA 2R7VA 2VJVA 3QT5A 4F4ZA 3JQJA 1DTQA 1TKXB 3CD0A 4CYUB 5HQ8A 2ATLA 1FKOA 1EKRA 2DIVA 3NLCA 3ILOA 3JAMU 1TL1A 2YBVA 1KONA 3MI7X 5C25B 3MM7A 4OIXA 4XIUA 2RILA 1BY9A 2MXYA 3PX4A 5KFNA 3BF4A 2QSFA 2XB2D 1URRA 4C2MA 4M95A 2EG2A 3QLHB 2KFZA 1X60A 4OI3A 1CQNA 3T1HJ 5AE3A 3EZUA 2GVZB 2LECA 4JI5F 3BGRA 2B56A 4C6AA 1WOOA 3TUZC 2KI2A 3UN5A 1O51A 1LWFA 3WIUA 5I42B 3OR1A 2HHTA 4EYIB 1UWBA 1GNKA 1OWXA 5CCLA 2ZZTA 1U4BA 2CZVC 3PX6A 4I67A 1UVLA 2XY6A 4A8YA 4D3HA 4EEYA 3P5BP 4DG1A 4UOGA 2OPSA 2W1BA 4RPFA 3J7A1 1KOOA 4MMOA 3R8YA 3BO4A 4WBFA 1CC8A 5C5JA 1HR0J 4I0WA 2F65A 5ETOA 3UO0A 4D3GA 1LFWA 4B08A 4DV6J 2V2QA 2QTWA 2UUCJ 3Q89A 5THWA 3OLBA 2O5DA 1S1XB 1XQIA 2HVEA 1WHXA 2AJ0A 3D9BA 5KFJA 4I6YA 1P1LA 4JUZA 2M8HA 3RW6A 5KG6A 3WC0A 2ASJA 4BBYA 2EK6A 1W2BR 1X9SA 3ZTPA 2X51A 3CMAS 2QA2A 3BR8A 3O1LA 1FFSB 2RB7A 3E8OA 2H5EA 3OJUA 3KG0A 2DNYA 4K5RA 2VFUA 4IFYB 4MT1A 3GJQB 4FF4A 2CNNB 3PW7A 4KTQA 1UFWA 1FDAA 4DI6A 5DETA 4DR6J 4EBDA 4NI2A 3BDPA 4TU9A 3MM9A 2GQCA 4EU0A 2E1AA 3J80Y 3BQ1A 2ADCA 4ZIWA 2DNZA 3TAQA 4EBEA 4OZ0A 2A18A 1Q4RA 1U1RA 4CNYA 3FCWA 1NSKL 1PYSB 4C8NA 2EXUA 3EDQB 4ZPAA 2HQGA 1R31A 1OYEA 4MK7A 4MKYA 3L7PA 4FBUA 4ED4A 4P9SA 1YITS 3DRRB 1SV5B 1N33J 3MUVP 1GFWB 1IKVA 1GQEA 1FE4A 4O3NA 1Q0NA 3JTOA 1WOSA 3LWLA 1N5SA 3OXGA 2DYAA 3IG1B 3B78A 4B9SA 2GHWA 2B3TB 2HBYB 4LMZA 4TXSA 3KLIA 1IKWB 2YTCA 4F02A 4NXNJ 2Q1LA 2QL7B 5L8RC 3T5LA 3IR6B 3FK4A 4KH1B 1JK9B 1HQUB 2YWGA 2VPWB 2LQ9A 2XEXA 3LP0A 3CJ3A 3U7JA 4JI6F 4NEZA 2A3JA 2JEIA 3HSZA 5KFFA 4FDFA 2E66A 4I56A 3SDEB 3UDLA 1SBRA 1WELA 2GO8A 1U1OA 2W2QP 3N0VA 4AD6A 2Z56B 4WFYA 3Q2SC 4DFMA 5HJXA 4IQMA 4J90A 4O3RA 4MKAA 4LRBA 3RB0A 3RB6A 2I9SA 1HQ2A 1H98A 1SJFA 5DQIA 1VQYA 4XAKA 2N7YA 2KVIA 2FJBB 5HBMA 1J5EF 1DBDA 3IBFB 3DRPA 2XS5A 3M2VA 4G3IA 4OV1A 4P2XA 2B9YA 4LF2A 3W62A 3S6EA 2V63A 3WC2A 3K5MA 2OPQB 3UI3A 1Y4ZB 3THPA 5LSLA 4YB7A 3MMCB 4UOCA 3CCQS 3HT3A 9RUBA 5GAGI 3H8YA 2NUUG 4DR5J 2V4JB 3Q8QB 1I51B 1BHNA 5DQGA 5B0AA 1RLCL 5IT9Y 4J9LA 3P5TL 4Q43A 2HQDA 1U1KA 3UE2A 3G8SA 4F4WA 5KG1A 5KT6A 4KE5A 4C0BA 4O44B 4WP9A 2IDLA 3CC2S 4NASA 2DNLA 2N3LA 4I2PA 3CCZA 4KGZB 4J9MA 3HK2A 3RAXA 1BQNB 2W25A 3ZNJ1 1U1QA 1GX5A 2J0QD 1APSA 2YWKA 4HHUA 3PFOA 4B3OB 1LK5A 3SCLE 4DU7A 4F0KA 2D3UA 4LFBJ 2UU9J 2IJFA 5IV4A 1SC6A 3CNQP 5CXTA 1NHKL 1Q5VA 3MDFA 2PDAA 2WVDA 2NXJA 3SSQA 4NZ0A 3R9LA 4PYAA 3WHIA 2LQBA 2G0CA 2XY5A 4USTA 3CC4S 2V8PA 3U1LA 4CI0B 3KHGA 3TVZA 3R5BA 3PKYA 1X5PA 1NZ8A 3E2EA 4ZLLA 3DOMB 4M5KA 1G1XA 4MKBA 2DD8S 1RBLA 2M3DA 2DGQA 1KHVA 1GMUA 4PXCA 3Q22A 1DRZA 2J5AA 4CLUA 4I6WA 4B3RJ 2BJDA 1WI6A 3KK1A 1FI4A 1NK6A 4NZ6A 1NJYA 3EVWA 4PQUB 3TEHB 4GC7A 3BYRA 3QO9B 3ENWA 4ZLPA 3GWCA 3L3CA 4B3TF 4KHPJ 1HNVA 2ZHBA 3KLEA 1D9DA 4B3MJ 1WI8A 2XWYA 1NZAA 3N6NA 2IA6A 1YVFA 1Y9OA 2BJEA 2AIRB 2B4UA 1C1BA 3GR0A 2ZUAA 2HS0A 2KG0A 1E6VB 3UDEA 4KAIA 2FGCA 5DM6Q 3R5JB 2ASYA 1K0TA 3PVXA 1GT8A 4ZVSB 4ECQA 1WDTA 2PGCA 2O1PA 2CQIA 3R2DJ 2K06A 1UVJA 1RTHA 3MCNA 2VOPA 2ZDOA 4F4KA 2CPXA 1UPMB 3TJ9A 2ZH3A 2HHUA 3C46A 3PW5A 2KO1A 3PRBA 2R7RA 2BBEA 1B70B 3KJFB 4GMKA 1S1WA 1RT3A 2F8HA 3LA0A 4QYZK 1F1BB 2FGOA 1VC6A 4YOEA 3AA8A 1SL2A 4JI7F 2Y0SD 4F67A 3MCOA 2LU1A 1DHMA 4USJC 2LQ5A 4FPRA 5I3QA 1KHWA 3PRVA 5G0RA 1NCLA 4RU2A 4P73A 2W7PA 5D3GB 1CLFA 1UEUA 2B7CB 3C14A 1M5KC 3TI0A 1RT4A 5J2PA 5F8HA 1WF1A 4DV1F 2AGOA 4IUFA 2H1YA 5A8WA 3G86A 1YBAA 3PEHA 4ZK7M 1C0UA 2MQPA 4CIOA 3J7YI 4ZVHA 2OMLA 4RX6A 1TL7B 3OV7A 1KFSA 4KR0B 2RDIA 2UV8G 1ZZNA 3CUNA 2Q3PA 2B6AB 2DNNA 3IR5B 4YB5A 5T7LA 4DZ6A 2L48A 1X5SA 5KT7A 1X4CA 3R2CJ 2CPZA 2F8MA 1GEHA 1J5OA 2H5JB 4N47A 3QYYA 3PFEA 3AXKA 2ZZNA 3KFWX 2KJVA 3MGJA 1DZ5A 3LP2B 2MKKA 1X4BA 3F0NA 4O3OA 2ZNZA 5AE1A 4Q8FA 2VFVA 3SEOA 2FUG9 1RT5A 4OI2A 3MOZA 4PPZA 1FE0A 2DNRA 3N6MA 4RU9A 5CA5A 1VHIA 5J2NB 4MIAA 4NRTA 3J81j 1ZAXA 1JXVA 1TL4A 3SXLA 2LQJA 2J6SA 3KJNB 4HH1A 3JTPA 1LKZA 1RWOB 4U67Q 4RO0A 1F2GA 2QLFB 2CNKB 4IG3B 2WVBA 1WC6A 2OJ3A 5L1JA 1R6YA 3AJ2A 2BANB 2XHWA 2CQDA 3M2UA 2MZRA 4WTYA 1YJ9S 5ETMA 1KTQA 4EO6A 4TQSA 1MMLA 3AD7C 4BWMA 2AJ2A 1HNWJ 3THTA 1SH3A 3M9MB 4ID5B 1B64A 4FPIA 3GPAA 3NNCA 3KLFA 1Z2ZA 2RU9A 2OD6A 4DUZF 3KNGA 5AJ3F 1S6UA 5LJ3Y 3ZZZA 7AT1B 3WX8A 2VV5A 3BZQA 1N48A 4ER8A 4H4KA 2Y1RI 5T41A 2EKYA 3V6DB 2HURA 3H98A 2DRDA 3CJ0A 3T3FA 4HDHA 4F26A 2HNZB 1EHWA 1IQTA 3NGRA 5LXYA 3LAMA 5KT2A 4A46A 2RMLA 2WCXA 3EGNA 3DLEA 5B08A 3DHWC 2J8SA 2RNEA 2CJQA 3R5DA 2CDRB 4RUCA 4DSIA 1MU2A 4YDDB 4NMLA 5A8RB 3L95X 1I94F 4U96A 5A8KB 2VU5A 3CCTA 3MR3A 5FD1A 4R5PA 3NAIA 4ED1A 1Q7LB 1RHQB 1FEEA 1FDBA 5IQQA 1S1TA 4ITSA 2RQMA 3BPDA 3D54A 2OTJS 4OX8A 4V1Ak 4PEOA 2YQ3A 4Y65A 2H5IB 1URNA 1JXEA 2WRMA 3MMBA 3GLJA 4WIQA 4UUWA 2MZ1A 6FD1A 4URGA 1BQXA 2HBRB 1FKOB 4ES1A 4H4MA 1S9EA 1F3FA 1LWCA 1TL1B 5HMXA 3MM7B 4W92B 2YWEA 1GXTA 1V3SA 4QPTA 4ZP6A 1M0SA 2VH7A 4W98A 2MHNA 2YNHA 3ZZRA 3ISNC 2EC0A 2LVWA 3EVMA 2GGPB 4CLWA 4FVCA 2IYGA 2DNHA 2JHEA 1T9UA 5D4PA 4I68A 1U8WA 4Q5VA 5IM0A 2F5GA 3M6XA 3IM9A 3OR1B 1XK8A 2IMWP 5A0YA 2QA4S 5LT5A 1UWBB 1T03B 1DARA 2CQHA 3O3LA 3DI6A 3PIOQ 4L3NA 1N32F 4DX5A 2JVRA 4DG1B 1VQ7S 4PQAA 2OPSB 3BM7A 1NK8A 2PFDA 4ZVEA 1HPZA 4QJVA 1U47A 3LWMA 2KZZA 2IDEA 3EICA 3AJ1A 1QDUB 2E7XA 4YY3F 5LOQA 3VQSA 3BSAA 4NYZA 1Q8LA 1U0HA 3LALA 1BD6A 2G2ZA 3GCWP 2H54B 1L5UA 4ED2A 4Q2LA 4OZ1A 4NLXA 5G4DA 1FVQA 1FWKA 1ZA2B 5D4NA 4YMEA 2HG4A 5ETQA 1S9GA 2EPIA 5CCMA 2M8DB 2BKNA 2D69A 4K4ZA 1YZ6A 4X2BA 2JVOA 2KU7A 3NS6A 3CCSS 5KFTA 5D0EA 4C9DA 4ANEA 2MKIA 1M5OC 2H65B 1GX6A 1DURA 1IBLF 4PG6A 5KFZA 2C3UA 1UETA 4NI2B 2Y1JA 4KFBA 3MM9B 1RAIB 4U7CA 1PBAA 4J9PA 2QFIA 3UD5A 1VOMA 3HZEA 2H9ZA 2D74B 2ZM6F 1SI9A 1XNQF 4CZCA 4Y2CA 4CDIA 3VAFA 3NNAA 3OFFA 3T5JA 4PRFA 4WKYA 2DY1A 3M8WA 4WFBQ 4ES2A 3KTQA 1YG0A 2KRBA 4PG7A 2CG8A 1R6VA 1HWUA 1OQ6A 4YHHF 2DXDA 2PMHA 4QCLA 4NLVA 4OHZA 1RBOB 1FNMA 1IKVB 4DEZA 3BQ0A 5CABA 3PYGA 5J1PA 3RGIA 5IV3A 1NK7A 1CVJA 4C0OC 2NZ4A 1ZOTA 3W8GA 3W9IA 3NEKA 3DXBA 4MAKA 1FXDA 3D0GE 1SUQA 5GMEA 2NLWA 3GIKA 1IUJA 2R7UA 1FRMA 3UWTA 3HHLC 4Y3CA 1TUWA 4IRCA 2KYXA 1N5TA 3C3LA 3MZIA 2Q6BA 4P52A 2C3MA 3M30A 1JLQA 2AX1A 4Q0BA 2XGPA 4HDGA 2DKOB 2MKCA 3T6JA 3LP0B 5JVHQ 3FEYB 2A6OA 4L72B 5CYQA 1I1GA 2CVEA 5F8MA 2HBQB 1EP4A 3CXCR 2J0WA 2K1RA 1J2VA 1CC7A 2ZH8A 2HHPA 3G6XA 4Y0FA 2CADA 4OYZA 3R5AA 2GMHA 2M7SA 5RUBA 2IY5B 5FLXU 3SIPB 2BMBA 4PG5A 2QX0A 5D4LA 2XULA 2K3IA 3A8JA 3NBPA 4TU7A 5HBMB 2XO7A 3HKWA 2ZHAA 1UL3A 4ZJQA 1IKXA 3DRPB 1R0BG 3GYXB 3M2VB 1I6JA 2UUAF 2HFZA 3M8PA 4OQJA 4DSKA 5K14B 3MFHA 2H4YB 1KLNA 4DSEA 1RISA 2IPOB 4L75A 3SCJE 3TAMA 4JI1J 4PUOA 5HN0A 3ILJA 3S8SA 2BW7A 5GADI 1VBKA 2WZ1A 4RBTA 1EQ0A 5JVGQ 2F9JA 1RT6A 5F8LA 4CLTA 4DL2A 5I3PA 4G1PA 1KNZA 1MNEA 2KB2A 2RT3A 5A6PA 3KNAA 2ZBQA 4HTJA 3LH2S 1FWPA 1S7HA 3HMJG 2KN4A 3BB5A 3M32A 2HHHJ 1T02A 4RNFA 2AJQA 3CCUS 1Y5NB 4I2PB 2J76E 3KLHA 4LFAF 2CJAA 5L1LA 3Q8UA 4M5MA 4M8LA 1KBRA 3PW2A 1YK9A 2HKEA 4BLGA 3VV2B 3LP1A 3DMJA 2HAFA 4FZVA 2FJVA 3IBWA 2VUGA 1NBEB 4DWIA 4USHA 3VGSA 2HWIA 2M2BA 3KUHA 3BPSP 1FA0A 5KFWA 4J9KA 1Q79A 2XLIA 2F4VF 1T9WA 2J7WA 3G6VA 2R7WA 4G6VB 4C4WA 2CQ3A 4OJGA 2V9KA 2AWZA 2GJ2A 2NSBA 1N34F 1IWAA 2RRAA 1OY8A 4JV5F 4NCGA 5DGAA 4G1QB 3I5BA 1XR6A 3IFEA 1ZPWX 1P9QC 3RTVA 3SYZA 2CZ4A 4WWSA 4TVAB 4LBIA 1HL6A 2YNIA 3H0PA 3KK1B 4ILMA 4LSNA 4IG0A 3V5RA 2AW0A 4N8OA 1RAHB 1RYSA 3KOAA 3HFVA 2CNOB 4URSA 4DV2J 5GAGU 2AYMA 2FJXA 1KD1T 1HBOA 3P45B 1HNVB 3DXSX 1LXNA 3KLEB 2IAJA 4P7TA 4CTAA 3CJ8A 1C1BB 1PAUB 3CIZA 4DR1F 4DF8A 2XM3A 1P1TA 1RWXB 2DCLA 3DYAA 3CTRA 2R4FA 3RUBL 4UQGA 2MZSA 1VYAA 4ETZA 1PIEA 1HIYA 1LW0A 1F0XA 2K7KA 1RTHB 3R6LB 3ILIA 4QBUA 2WB1D 4KGMA 3JSYA 1KSPA 2GC8A 2J8AA 3THVA 2LKZA 1YKWA 1JWWA 5A2QU 2UV8A 5E3PA 3CO0P 3IN5A 1JLAA 1S1WB 4DQIA 4ECYA 3DRYA 4KB7A 3UNGC 2GMJA 3WZ0A 2K8GA 1VCTA 3ZNUA 2CQPA 4NWBA 2FJEB 4DPXA 3MR6A 4USUA 2A0FB 3F56A 5G0RB 1W25A 2ZHOA 2P6TA 2L3MA 2GQ2A 3OTOJ 3T1YF 3ZTQA 2C2OB 4OL8A 3CE8A 3VWSA 4ZVRB 1TR0A 1UVNA 3QPIA 4JYAJ 4QWCA 1RT4B 3OW2R 2YWHA 1AA1B 2BOAA 3OJSA 2DIUA 2G0IA 2QEXS 3T1AA 5A8WB 3K0JA 1JQGA 1FXLA 4USWA 3RRKA 1C0UB 1RXOB 1QAIA 3S7RA 3TOQA 5B7WA 3J81U 2ERRA 1HNXF 1RWPB 5ETNA 1RT7A 4X4TA 1D1UA 1TU0B 3RBDA 1RBAA 4CLYA 4UZBA 1UW4A 5EX3A 3KJVA 4QIVA 1J27A 1L3VA 3W66A 1J5OB 3DM2B 3CT9A 1RADB 2KM8B 1EIYB 2IM2A 3CJQA 2W9AA 3VCDA 3W7BA 4OYXA 4OYAA 1TKXA 2ZH2A 1HFEL 2XZTB 1PO6A 1D9AA 3BKUA 2ZC4A 2WOMA 1RT5B 4IH5A 2J9DA 4K2JA 1G6BA 5K20B 4YUDA 1Y3KA 3IRXB 3T1HF 5C25A 5K8NA 2BR0A 1S5ZA 2R2RA 4I64A 1UJ4A 5F41A 5KT5A 1S6QA 2VIHA 2QYCA 3FQLA 3RZAA 4ID8A 3W5ZA 2FB0A 5B0GA 2GS8A 4QIWD 3M2UB 4WPAA 5KTQA 1NK0A 4P7VA 1WACA 1XJWB 2LYVA 4LF7J 4I7FB 1VQNS 2PC6A 3QZ7A 1HR0F 4L6V3 3DN9A 3CJRA 2VF3A 2VASA 3OHBA 3QNWB 2JLGA 2W8LA 5KFUA 3VAJA 4OJ3A 3Q0AA 3TYTA 3ETOA 3ZO7A 4DV6F 4DCJB 1S76D 2UUCF 1HNZJ 3J7YU 4CO5A 2BJ8A 1UVIA 2JRSA 1NPPA 1KVIA 3GMGA 3DLEB 4J5OA 4PKDB 1FRJA 2QLWA 4MJKA 2AT1B 4DJBA 1SJ3P 3HVWA 1UVMA 3D1QA 4ZDNA 1MU2B 3H20A 2ZH5A 1L3KA 3IGVA 2VKRA 2ZE2A 1HD0A 1S49A 3KK2A 4I6AA 1KR4A 3LGMA 3BS9A 1UFLA 3GJSB 1M90T 1SJ1A 3QT6A 1JNZB 3HVTA 3HT0A 4R5PB 3L9ZA 4DR6F 1AROP 4J37A 1RUSA 2B0GA 2IFXA 3BGOP 2ZEJA 3KXDA 1XERA 5SZTA 5C42A 1QUPA 1S1TB 3RYLA 2OPPA 1S1UA 2G13A 4Q8EA 3GILA 1VQ9S 4IDKB 3MEEA 4I4BA 5HI7A 3QFWA 3L7OA 2CFXA 3QGGA 3TAPA 1BXNA 2VFSA 3JYTA 4Q44A 3KHHA 3MMBB 2E1RA 3HVRA 4H4MB 1S9EB 1EARA 3AAWB 3NS7B 2HBZB 1LWCB 4F8RA 4NLRA 1SJ4P 4LSZB 2BE2A 3J80U 3FBEA 1S79A 4ZVOB 1GMWA 2YNHB 8RUCA 3GSDA 1WD6A 3N01A 3BN7A 4LJMA 4R0JA 1JB0C 3H4DA 4PXEA 4DFKA 1TMJA 4YDXA 5IM0B 1YQHA 5BYRA 2CJXB 3D68A 2UVWA 1FEHA 2AZ1A 4GC6A 2ALZA 3ZZUA 1CS4B 4A47A 3DI6B 1HBNA 2RUGA 2BM0A 4C8LA 4PG4A 2ALYB 2G1DA 4Z7CA 4DHVA 1GTEA 4ZPBA 1VRTA 3B6BA 1NJZA 3D0IE 1QSYA 2GAGC 1N36J 3ETMA 3MPWA 2BJ1A 1U0HB 2VPYB 5D77A 3PJWA 2R7TA 4OYOA 1RCOB 2HK2A 1E6YA 2W24A 2V9WA 4PCQA 1KVKA 2NXCA 3LPYA 2YVSA 3D0HE 2E5HA 1S9GB 3UN3A 1Q1KA 1RTDA 2DITA 5B0BA 3GR1A 4Z37A 3M7VA 2BEFA 5ETKA 4C97A 2AYBA 3OSNA 4K4UA 1K44A 1SL1A 1H2VZ 1ZH5A 3MWBA 2LP4A 3ZTRA 3W65A 3MECA 1TAQA 2HFNA 2DGVA 1IBMJ 4CO3A 1RHUB 2O01C 4DR5F 2AP6A 1P27B 3ZC4A 1PG5B 3CW2C 2RQKA 4P75A 4X66J 1ULRA 4KFBB 3DHXA 3MR7A 3DU6A 1YRTA 2VC0A 2QIFA 4ED3A 4LFCJ 4DPTA 2V4JA 2LFVA 3JB9k 2NXUA 5EWEA 1SIZA 5H1SV 3QMQA 3CDBA 3I56S 2MQLA 4JP8A 5L46A 4DN9A 2NS1B 4K4WA 5DZ6A 3QBCA 3TA2A 5LMNF 2V5HG 5EX0A 2Z2LA 5F3TA 2XLKA 1T8EA 1FTRA 4X4OA 1FFGB 2YKQA 1V3RA 3MCSA 3JTNA 3SQGA 5IT9U 4LFBF 1VMBA 2FPHX 2UU9F 3A8IA 5KG3A 3BQ2A 4X64J 2D7SA 4H4KC 2FY8A 3LPEA 4X65J 4FKYA 2XQCA 1SUQB 5J1NA 2RHQB 1PGZA 2DGUA 2FHJA 2OO4A 1R0CB 5M2PA 4IOCQ 2YQ0A 1NDLA 3TR5A 3G6YA 4BWJA 3TANA 1JLQB 1F5BA 4Q0BB 1RGVA 1BQMA 3OLAA 1I5OB 3IP0A 1N4LA 3EUNA 3KG1A 3TO8A 3OXLA 3OL9A 1NSQA 2LEAA 4YP3A 1PKUA 1P6TA 1KLMA 1R3NA 4GKJJ 1H3DA 3AOBA 1S97A 1U26A 1CBKA 3JXOA 4DV3J 2C3PA 4RW6A 1RKIA 2OKQA 3P3DA 3CULA 3H5YA 3ZTOA 3V6HA 5I4MA 1HI0P 2QRRA 3KLGA 4AXIA 1HBMA 4KHPF 4B3MF 4PQUA 3AXMA 4JI4J 2EFVA 4RLEA 3D4JA 1UZHA 4UOHA 5AXKA 2QYGA 1MN7A 3EGVA 1S59A 2OFGX 3EGWB 2MQ8A 3EMTA 1PJ7A 3MEKA 1R43A 2HS4A 4E2FB 1SH2A 1Q81T 4CO2A 2POKA 1SJRA 4XDCA 2EFPA 1HQEB 4LR7A 1IKXB 8ATCB 2JH3A 1TKDA 4OZNA 1WDDA 3OQ2A 1LFPA 2R7SA 2W4CA 2DB1A 2AHOB 4NA3A 2CWKA 2M70A 1YIJS 3NGSA 4ALZA 1NU4A 1Y11A 1V5IB 3TAMB 4IRDA 1RWMB 4ECVA 4PUOB 1RU1A 4ZPCA 2EG1A 4ZCLA 5IS2A 3AA9A 1RT6B 4GKKJ 3CMQA 1IVZA 3Q8YA 2HLUA 3SSSA 2JNJA 1BWVA 3OFHA 4DR7J 2BJ9A 3TX8A 2IC3A 2MY7A 2OP5A 3M6VA 2CQ4A 3WDOA 4HLBA 4DR2J 2HLTA 2FLPA 1NB2A 3CJKB 1WSRA 1NSPA 2CJYB 3FSIA 3M32B 3CDWA 5L39A 3NXZA 2ZDPA 2IVMA 2GO9A 2GIQA 4OV6A 5DG8A 2UUBJ 3KLHB 2DO4A 4P2MA 3I5CA 3MAQA 3GIIA 2BKPA 1EETA 3PG9A 4LBHA 2VD3A 5IT0A 5D15A 4ZP8A 2VQFJ 3NMRA 3HO1A 3LP1B 1TV6A 2FHKA 3DMJB 1X9WA 4F3QA 4DXLA 5IFMA 1CJUA 1O6XA 2AV5A 2FTRA 3GFHA 5KG0A 2L9NA 3D3BJ 4NLWA 4ATNA 5ETTA 3CJ2A 2MGZA 1FK9B 3AODA 1OQ3A 3R1HA 3I5AA 2YPZA 4OI0A 2QGFB 3R7NB 2C3OA 3MMAB 1AZSA 4GO7X 2B6AA 3TJAA 5KT4A 1WHWA 5DO2A 4QWDA 4KJIA 1X0FA 4P2FA 3W1YC 1K8AT 1TAUA 3W9JA 1F60B 1U02A 2YNIB 3EPGA 4A8FA 4PR6A 2FQQB 2Y1LB 4LSNB 4QIEA 3AFGA 1EAYC 2H4WB 4KO0A 4IOBA 1HHQA 4GO5X 4TY8A 1WC0A 2DT9A 4ANCA 4WU3A 4NLSA 5EDWA 2KHDA 3G2XA 4HYKA 1HBOB 2E1MC 2HGNA 1PYOB 3UCGA 2XMKA 2IAJB 2D41A 3H59A 5J2NA 1TP7A 4U7UD 4RW8A 4ILLA 4DU8A 2RQCA 5D78A 3CCJS 3MCMA 1NDKA 5HJYA 1WEYA 3J7Z5 2FJAB 1S6PA 4J7CA 3DYAB 3OT9A 4UW2A 4NXMF 3QIDA 2G2YA 2XSFA 1HNWF 3GZ7A 1IBCB 2AJ1A 4OYBA 2J9EA 2W01A 2XMJA 1VQSA 1O8BA 1SQGA 1K0VA 3K58A 1FWLA 1LW0B 5DRKA 3H5SA 3TQEA 2WTFA 4K4SA 1PYTA 4AQYJ 2ZJRQ 4ID5A 1S7IA 4LF1A 1MLAA 3A8KA 3VAGA 3B4DA 1I3OB 3JQMA 1JLAB 3G6ES 1DQ9A 4X4UA 4TN2A 1S1VA 1RAJA 5KFBA 1QLNA 5L9XA 3QT8A 4B9LA 1KP6A 1PILA 1TTHB 2MDAA 3TP2A 3GONA 1FD2A 2HNZA 4ENOA 4XO0A 2HZCA 4DV7F 2V50A 3W9HA 3OVAA 3R7BB 3CDUA 5HVGA 1EB0A 2GV1A 4AL5A 3PV8A 4M5LA 1IBKJ 2LU2A 2OSRA 4B3TJ 1AFJA 1M5VC 2ROEA 4O3SA 4PWUA 4LVNP 3SBMA 2FJDB 1PCAA 4BC7A 1X8DA 3VAKA 4P10A 5A8RA 1RKJA 4QPXA 1CULB 2DISA 2F63A 2KKHA 1RYRA 3G87A 2A2DA 4DMZA 1VQ4S 4Y2MA 1HWKA 1QAXA 4KBIA 3IRWP 3EXCX 1JJHA 1NH8A 5IWAJ 5HLFA 1RT7B 2W9BA 3ITHA 3BKFA 4NLYA 1FFWB 5GAHI 2R8KA 1X4FA 4TQRA 2NUHA 3KJVB 2KT5A 3KUEA 1U1NA 1G4CA 3MTKA 1VQ6S 1XIQA 4DUYJ 2ZBIA 2ILZA 2W7AA 4F4YA 5KG2A 2APOA 2O3DA 4QR2A 1X4EA 2KXHA 4J9VA 2Y8WA 1B3TA 1IJEB 3MM5A 2WOMB 2CPJA 1VJWA 5E5NA 5K8MA 4BHQA 2HQ3A 3ZFVA 1QSSA 3HHDA 1QAJA 1KQFB 2VFTA 3UDCA 3SFUA 2HFUA 1R7IA 4IKAA 1S6QB 4ZMMA 4R8UB 4RNOA 1C4CA 4C8MA 2E5JA 1UEKA 3AQOA 3HD1A 2GGPA 2YNGB 1TKZA 1SJQA 4I2QA 4BS2A 4G1IA 2P9CA 2HHQA 5KFXA 2NSCA 3M8RA 1KOHA 1WOPA 1S0MA 4OFZA 3F73A 1Z2LA 4HL9A 2IRXA 4UT4A 1VGYA 3TZXA 1N88A 1SB6A 4L76A 1T03A 2HYIB 2RF2B 2MSSA 3NAHA 4OHYA 2Z2MA 3UFCX 1PBUA 5HMZA 5MAOA 3VTIA 1C2PA 3QJJA 2G2OA 5KFGA 3M8SA 1N5VA 5HL7Q 1D8ZA 4F4XA 1JJ4A 1IXKA 3AD9C 3CCWA 3I9ZA 3TNVA 2V2KA 2DNPA 4OI4A 1AUSL 2OIHA 2OEKA 4ELTA 2XNQA 4EZ6A 3DLLQ 1F3VA 1SCJB 3EZ5A 1RAFB 3ADAC 4TU8A 1P8GA 3C2PA 2M5YA 4XK8C 2QFJA 4C8YA 3FBBA 2G9OA 1VDHA 3A8EA 4DS4A 2BZ2A 3PR4A 2JC0A 2J9DE 1FCAA 3DLBA 2ZE2B 4L73A 2YX4A 3KK2B 1S0NA 3MM6B 2HS3A 2OELA 5JMNA 4TYAA 2R8HA 2I0XA 4B3SF 3HVTB 2CKWA 1UP1A 3T9NA 5HP1A 4OHXA 3OR2A 2EFQA 2FZCB 4QU7A 4KHMA 5ETVA 1SKWA 3TRGA 5C42B 2OPPB 3EYZA 3LGHA 1S1UB 3X3UA 3KG4A 3MEEB 1TELA 2IA0A 3K17A 2C22A 4RKUC 4CCHA 3JYTB 3FCHA 1FNOA 5B0CA 4NA1A 1R27B 3QRPA 3TVKA 5CYMA 3FGVA 4OYPA 2GCFA 5IOLA 2CZ9A 4UQTA 2V2VA 1NAQA 1XBWA 1GXLA 4O4GB 2HRUA 4PYDA 1PAEX 2BE2B 4LREA 4P74A 2AMCB 3UCUP 2CYYA 2RAQA 3BN4A 3C8YA 5KFMA 1YJRA 5KFEA 3BO2A 2VA2A 3N5BA 3HI9A 2X3DA 2MQQA 2ZWPA 3TQ1A 3IA0A 3HSDA 4FYVB 1VR6A 2N7CA 4LUBA 2XCPA 5C2GA 5EGYA 2BJ3A 4RNHA 2MJUA 4RZRA 2PD1A 5B0DA 2B4PA 3TJ8A 5E0OA 3GIJA 3O8WA 4Y6IA 2HIYA 3HHKA 5IZHA 1HBNB 4NE9C 4KPYA 4K59A 4JI0J 2X7IA 2MY8A 4F2SA 4YR0A 1IR1A 4B02A 2Z0GA 4K7QA 1VRTB 1WKKA 2RDJA 4RWXA 1TFWA 1AT1B 1OSDA 1L3TA 2KG1A 1OPIA 2DH9A 4RNNA 5F8GA 4EZ9A 1UW9A 4UY8T 1IWGA 2WVFA 1UTAA 3M2RB 3SV4A 1KQSR 1E6YB 3WBZA 3DGPA 2OTLS 2ZKUA 2DHAA 3D6HB 1YDLA 2PO4A 1RTDB 4F04B 4CO1A 5CD4H 3PRDA 4TYBA 4KIAA 1ZTWA 4NLPA 1SH0A 4NA2A 3CC7S 4QZVB 3FZ2A 2HZVA 1SC1B 3A13A 2XG8A 3LAKA 4PZVA 4DR4F 2RRBA 4PG8A 1XC9A 3H42A 1SKRA 4JI1F 5K14A 3U02A 1IJFB 2OHDA 3MECB 1NJIT 3OTCA 1WC5A 3NGTA 3DRSA 4M5GA 4ELUA 1WC4A 2FZKB 4M94A 1NDPA 2B4VA 3BBFA 2AQ4A 3IM8A 2DNOA 3H90A 2VDIA 2Z8QA 1B7FA 5E41A 2UXCJ 4WP8A 5MLCV 3I0SA 1GTHA 3I4HX 2RH3A 1M1GA 2I1RA 1EX8A 2HHHF 5H9EJ 1FJ7A 2MZJA 2WONA 2IVFB 3EX7B 2KFNA 4NYPA 3BYPA 4KKOA 4U8VA 5E3AA 2DHSA 2V8GA 4R25A 4ETXA 2E5IA 3GP9A 2H3EB 1TZ0A 3I9V9 3SQGB 2AKWB 4CLKA 1AB8A 5A6WA 3IAS9 3IWXA 3V4MA 2YKNB 3DCAA 3QT7A 2FLLA 4FNHA 1XR7A 2V8DA 3MUMP 3O2IA 5E3RA 4OLOA 2N82B 2RUSA 4JBCA 2F4FA 4NRUA 3KK3A 2DRBA 5H9FJ 4EYHB 1TK8A 1HNIA 3D1OA 3HHNB 4DBQA 1BQMB 4DZDA 4NCAA 4DSLA 1DTTB 4ZPDA 1KLMB 4R0EA 1T7PA 4RW6B 4G1QA 1R8HA 1UFKA 1YJ7A 2FYXA 1TFYA 4LVOP 3HJFA 2FY1A 2XZDB 3PDNA 1RAAB 5HQMA 2CXEA 3KLGB 1FRLA 3C6UA 1XNQJ 2MQOA 1HBMB 2KFYA 5CZXA 1CPZA 2IVYA 4EWTA 1FD8A 2HNYA 3VAIA 3QJPA 2I2YA 4HHJA 5DLFA 1ZM3A 2E5GA 2P6SA 2YKOA 1BE4A 4TLRA 4KT0C 2DEIA 2KT2A 2PI4A 2NPIA 4BCAA 2MTLA 1R8BA 2MKSA 3CSKA 1VQPS 3KDOA 1CJVB 1RT2A 1X4GA 2C28A 5BYSA 4ZITA 4FYXB 2PE8A 2DY9A 4CO0A 2XMUA 4C8KA 3D1HA 5GAEU 4NL5A 4LF5J 2ZVSA 2ZBRA 3IC1A 3RG6A 2PIIA 1WORA 1K1QA 4OI6A 4FKXA 2BE7D 1UAWA 2C2MB 3HZGA 5CH7B 3P4UB 4MIWA 3OD2A 2HRTA 1NKCA 3CMES 5LXRA 5AXLA 2MLZA 2Y9HA 1JLFA 2NXNA 3K57A 3V4IA 3G96A 3R5GA 2UUWA 1KS2A 2IC3B 3GE9A 3TUIC 1NO8A 3ZZYA 1UZDA 3GQCA 3U1NA 4LF8J 1S0VA 3OTOF 1OJ4A 2KYZA 5FJ4A 1RE1B 4A8KA 5U47A 5KFDA 4YN3B 1UCNA 4OX9J 1K73T 2FIUA 3NGUA 2KXNB 1EETB 2MMYA 2QLJB 2ZH9A 3AB4B 1BMQB 1N5QA 1TV6B 1GK8A 3N9UC 1RT1A 1R8CA 4DCPB 1CJUB 1WTFA 2B9XA 3SCKE 4M5JA 4Y2AA 4YR2A 1RHKB 2MGZB 1WG5A 3H5UA 4F25A 3CEDA 1HARA 3K8WA 1GAOA 4NLOA 3UCZP 3PCOB 3TA1A 2L41A 3VAHA 1ZM4A 1AZSB 5DM7Q 1FXRA 4KGVB 2DR7A 2V0NA 1C4AA 3LANA 3ONQA 3K7RA 3G8QA 1VIXA 2ZITA 5CHCB 3PHEA 3DM2A 3KHRA 1YRXA 2COLA 2JC1A 2MHEA 5LSOA 3M9OB 3M6WA 4A8OA 4GRSA 2NPFA 2ZBCA 2GJFA 3I32A 1U0SA 4KO0B 3HFZB 4O3QA 3VZIA 3JS9A 4TY8B 2DR8A 2GFFA 4Z2XA 3IRXA 3I0RA 3A3NB 4CO4A 4RW8B 4O3PA 1RCXB 2XYHB 2QO3A 4BDPA 1S6PB 2E9RX 3I4PA 5F8NA 2CPHA 2WVEA 1BUXA 1FX2A 1NKEA 1XR5A 1XMQF 4LF7F 1PJ6A 2DEJA 1VC0A 2HAIA 1Z4UA 3OFEA 1YBUA 3QSYB 4TY9A 1S0OA 1LK7A 4DL4A 4I7FA 4LR8A 3SQOP 3BR9A 1FX4A 1N34J 2DGWA 2HFSA 1N8RT 4S0MA 1HNZF 2PI5A 4A8SA 3ZZ0A 3LOUA 3RR8A 1S1VB 2GAHC 2L08A 5KG5A 3FEZA 1TUGB 3GU0A 1H0HB 5AXNA 1Y5LB 1HHTP 2IRUA 4NMXA 3Q86A 5K9FA 1SQEA 4EK2A 1WJ9A 2XSJA 4Q7AA 4LIRA 2WBRA 1HD1A 2OSQA 3MHYA 2JOQA 5A2QY 3TA0A 2ROGA 4O4RA 2K3KA 3D2WA 5IT4A 2G4BA 1QE1B 3BREA 1YJTA 4NX9A 2E5LJ 5LMUJ 2GZOA 4IRKA 4DL7A 2H48B 1WWHA 1MWZA 5HLFB 5L1IA 4HT7A 2W9BB 3ITHB 4NPOA 3TZWA 3PJXA 2MYFA 4CT9A 2R7QA 4JV0A 1YX2A 2P2CB 4O0IA 1U7LA 1M5HA 3HHEA 1VI7A 4IDKA 4E8UA 3ENQA 2ZWOA 1G7CB 2VONA 3DOKB 5BR8J 2MJNA 1A9NB 4EMDA 3NL0A 1V3ZA 4HACB 1MW7A 4Y28C 1CJTA 4ZOSA 2R9LA 4ECRA 3F44A 1NUEA 3HHLA 3MM5B 1HI8A 1KFDA 1WEXA 3J81Y 3H7HB 1IM4A 2HFOA 3I31A 3S01A 1HMVB 3POTA 1O0PA 4ECZA 2BRKA 1WC1A 4X84A 1QY7A 4HR2A 2AYEA 2JL9A 2PEHA 4TKTA 4ICLA 1RHMB 1S48A 3GB0A 5ITHA 3FRYA 3NGKA 2QE5A 1SXLA 5ETSA 2WK4A 1TKZB 4I2QB 3MF5A 4CWBA 3EDRB 4DQRA 3CJTA 4QIGA 4ES3A 4JB8B 5B0FA 2WSCC 2OMOA 3MUTP 2W4DA 3MR2A 1O5JA 1UA0A 1GMWD 3D6FB 2N4DA 1HNXJ 1N56A 1L3SA 3ZTSA 1QVFR 2JSXA 3PKMA 1CS4A 1FJCA 1H73A 4KH0B 2ZH7A 1N36F 2EVZA 4F2RA 4ZLNA 4FXVA 1OIAA 2MKHA 3MM8A 5IXUA 1U1PA 4U95A 1U09A 1LOUA 1OPZA 2HQFA 3UD4P 3AHPA 3BEGB 2W9CA 4WZMA 4M5DA 3QQCD 1FERA 2QG9B 3PACA 3BGFA 3E01A 2UP1A 3CVKA 4JV2A 1FO1A 4TNOA 3BKTA 5GAHU 4DL0C 4KYZA 3DDKA 2ZH6A 2EI5A 2VOOA 2WBMA 3FKBA 2R8JA 1SC3B 4FN5A 4NLGA 1RU2A 2F8EX 3PYEA 4IFVA 1K47A 5AT1B 4DN0A 1IBMF 2VODA 4OHWA 3FVYA 1XN9A 3H40A 2UXDJ 3NMAA 4ZA1A 4X66F 4IR9A 5HP1B 2GIRA 3OR2B 3ET6A 4EO8A 4LFCF 2BQ3A 4QU6A 3EVOA 1JMTA 3C15A 2QMXA 2VDHA 4DX7A 1F9HA 2FLOA 3TZYA 4B9VA 4K2XA 4JV1A 3CD6S 3CCES 1LWEB 3M8YA 3W3SA 2DNQA 4C3LA 4DUTA 3GG0A 5CYMB 3U1MA 6AT1B 2ZC3A 1TVRA 2DVIA 2ZD1A 4WTOB 2VKZG 4X64F 3UNYA 5KT3A 4DV4J 1ZTTA 4M5IA 4X65F 1F2HA 2C2DA 1VQLS 2E7VA 4OLPA 3PJ9A 2GNKA 1IM6A 3OBIA 5CQGA 4Z7YA 1D3WA 4Q45A 3PHTA 3BBCA 3SSRA 3HP6A 1JNRB 4RW9A 2HMIA 3TZZA 3QRRA 3HM9A 2WSEC 3IWLA 1HHSA 1OS5A 4GKJF 2C2EA 3FFIB 1MMDA 2MB0B 3BBBA 4DV3F 2DGOA 4LRAA 3PW0A 1TK5A 1ICEB 1B99A 4CNZA 3SMZA 2WW4A 2FHJD 3HPOA 4EFAC 2RDDA 1NEEA 3ILLA 2DNGA 4DV0J 2LQ8A 1IKYA 2B9WA 4JI4F 2VC1A 1BLUA 2XNRA 2YWWA 4M5HA 1MROA 1JLGA 5EWFA 1LW2A 2F40A 4I69A 4RUBA 3DGPB 4WZQA 3T6BA 1T9XA 3DLHA 3NCQA 5KFPA 2B7BB 3VVUA 4USMA 4DOZA 1TUVA 4H4OB 3GCXP 2E29A 5A76A 2BM1A 5BJRA 1WSVA 2MQNA 2QL5B 3UVJA 1NH7A 1HW8A 1HQEA 2OPRA 4ELVA 4W90B 2QN6B 3G9CA 1QTNB 2XYPB 4C11A 1FRHA 3DGVA 3V81A 2LA6A 1NMEB 3D6TB
chains in the Genus database with same CATH topology
4EO6A 1OQ3A 2VFRA 4TQSA 3R1HA 3DLGA 1MMLA 4BWMA 4IFYA 3DRSB 1DFDA 1U48A 5DS7A 1X0PA 3I5AA 3THTA 1SH3A 4OI0A 3M9MB 3I87A 3HXMA 4ID5B 1B64A 4OZLA 2D3ZA 2C3OA 4GKKF 3CJ4A 3MMAB 4GO7X 2B6AA 2YKMA 4OZJA 4A4JA 4A8XA 3V2UC 4J9SA 2OH2A 3FFIA 5KT4A 3M4XA 2X1FA 1WHWA 3LQVA 3NNCA 3KLFA 4DV0F 1Z2ZA 2RU9A 2JEGA 4DR7F 3ULHA 4NLUA 5DO2A 2OD6A 4DUZF 4BC9A 4QWDA 4DR2F 4KJIA 3KNGA 4NYOA 5AJ3F 2CIMA 1X0FA 1S6UA 4K4TA 5LJ3Y 3K8VA 3I0SB 2C42A 3ZZZA 1K8AT 4NLQA 1TAUA 2VV5A 5J1EB 1F60B 3BZQA 1R8PA 1R0AA 1N48A 4H4KA 2Y1RI 5T41A 2EKYA 3V6DB 3H98A 5HROA 4HKQA 3CJ0A 5EWGA 2YNIB 3EPGA 4A8FA 3GV8B 1HWLA 3BJYA 1XMBA 4PR6A 3T3FA 4HDHA 5M2RA 4F26A 2HNZB 5E3CA 2FD2A 4LSNB 3FSYA 4QIEA 1UJ6A 2J6UA 2E9ZA 2WONB 4NLDA 5F8JA 2UUBF 2JFDA 2FVCA 3CJKA 2RU3A 3QZ8A 4ECWA 2ZOGA 4KO0A 1IQTA 5LXYA 4IOBA 3LAMA 3DRRA 5KT2A 4A46A 4KKOB 4KRWA 2RMLA 2WCXA 3EGNA 3DLEA 2JEJA 1SV5A 4GO5X 1GH8A 4TY8A 2DT9A 4KHRA 5B08A 4WU3A 2VQFF 4NLSA 1S10A 5EDWA 2KHDA 2Q6CA 2CQCA 3DHWC 1JLBA 3H2LA 2RNEA 2GMLA 4DL3A 1T3OA 4HYKA 1KN6A 1HBOB 3H4BA 4CT8A 2E1MC 2CJQA 2HGMA 2HGNA 3UCGA 2XMKA 3VZHA 1REVA 2IAJB 2D41A 3H59A 5J2NA 3R5DA 2BXJA 4K4YA 1TP7A 2VG5B 4RW8A 3I6PA 2OFHX 4RUCA 3T19A 4ILLA 4DSIA 1MU2A 4YDDB 4NMLA 2RQCA 5D78A 3CCJS 1L3UA 1WG1A 4FS2A 3IG1A 4A8QA 1KEKA 4WCEQ 4N76A 5A8RB 4H4OA 1WEYA 2N3OA 3J7Z5 3CO9A 3WX4A 2FJAB 1S6PA 3DYAB 3FJ2A 3OUYB 4RW7A 4UW2A 3L95X 1I94F 4NXMF 3QIDA 2HVHA 4QYRA 3MEGB 2HRYA 1X4HA 2XSFA 1HNWF 2VG6A 3GZ7A 3IGNA 5A8KB 2NQPA 2AJ1A 1S6OA 3CCTA 4QOTA 3MR3A 1IKWA 2J9EA 2XMJA 5A0YB 1G2EA 5FD1A 3GFZA 4R5PA 1VQSA 2XY7A 1B0VA 1O8BA 3NAIA 1K0VA 4ED1A 2DGXA 3N79A 3K58A 1FJGF 1Q7LB 1LW0B 1RTIA 5DRKA 2PMZD 3KK3B 1FK9A 3HVAA 1FEEA 3H5SA 1FDBA 1HNIB 4ZP9A 2YX7A 2WTFA 3HF5A 5IQQA 4K4SA 2XMMA 1HQUA 1S1TA 2PN6A 1WF2A 4ITSA 2ZJRQ 1AFIA 2RQMA 4B9MA 2F3JA 4PPDA 1C1CB 4ID5A 1HPZB 3MMAA 3IR7B 3D54A 4ZHRA 4RUHA 1UMJA 4OX8A 2OTJS 3H2VE 2IBOA 1N5YA 4C7QA 2YQ3A 4Y65A 3VAGA 3CB4A 3B4DA 3MXHP 5J2QB 1JLAB 1ZM2A 1URNA 2KZMA 1QM9A 3G6ES 2IJNA 2FVQA 1JXEA 1DQ9A 2WRMA 4X4UA 4TN2A 4C0HA 1S1VA 3MMBA 1RAJA 5KFBA 3SDEA 1QLNA 5KFAA 6FDRA 5J1EA 3MR5A 5L9XA 4UUWA 3PX0A 1RTJB 2MZ1A 3C6UB 6FD1A 4B9LA 4URGA 1BWEA 1BQXA 3BSOA 1FKOB 1PILA 2MDAA 3FMBA 3TP2A 4ES1A 5KFVA 2LXUA 2RQ4A 1FD2A 2HNZA 4XO0A 4DV7F 2HZCA 4H4MA 2DPJA 1S9EA 3LW5C 2GJIA 2VBZA 5E3QA 3OVAA 1YJUA 1LWCA 1TL1B 3G8TA 2HNYB 2ROPA 5HMXA 3MM7B 4ECXA 4W92B 2YWEA 2FLNA 3CDUA 1GXTA 1V3SA 4WFNQ 4AL5A 2GV1A 3PEJA 3B82A 3PV8A 4LSLA 4QPTA 4ZP6A 3R5CA 4ED7A 1C0TB 1H2TZ 1M0SA 2LU2A 2OSRA 4ZPVR 2VH7A 1VQKS 2QSWA 2MHNA 5L9NA 2R7XA 2YNHA 4KGKA 3ZZRA 1AFJA 3ISNC 2WW8A 2EC0A 1M5VC 1FKAF 3VR1A 2ROEA 3P96A 3N28A 1TK0A 2LVWA 4PWUA 4O3SA 2GGPB 2JLFA 4LVNP 2FJDB 2IM1A 3I96A 4RBUA 2UVUA 2VG5A 4V19J 1DLOB 4FVCA 4BC7A 2IYGA 3W2WB 1X8DA 1NHUA 2DNHA 5LSRA 2J0SD 2JHEA 5D4PA 1WEZA 2VBYA 4QQBA 4I68A 2RKIA 3VAKA 4ZVGA 4Q5VA 5A8RA 2KHCA 1RKJA 3DLKA 4QPXA 1RT2B 2FC8A 2VB6A 5IM0A 4K4XA 2DISA 2KKHA 1RYRA 1IR0A 2HVIA 3M6XA 1S77D 1PC5A 2A2DA 5DJBA 2XMTA 3K5OA 4DMZA 4IO9Q 1VQ4S 2CJBA 2CQ0A 4Y2IA 2OPQA 4Y2MA 1HWKA 1QAXA 4KBIA 3IRWP 4AQYF 2M0GB 3EXCX 3OR1B 3NS5A 1XK8A 2HIQA 1JJHA 2IMWP 3PXGa 4F3MA 5A0YA 2QA4S 1NH8A 5LT5A 5HLFA 1UWBB 1RT7B 1T03B 1YTYA 1DARA 1HBUB 2W9BA 4X62F 3ITHA 5DG7A 2CQHA 3M8QB 2JJ4D 3MMCA 3O3LA 4IOAQ 2BA9A 4NLYA 5B0EA 4MFBA 3QWPA 3UQSA 3DI6A 2ZJPQ 3PIOQ 5GAHI 4L3NA 1KQGB 4YFUA 1N32F 3MURP 1XEZA 1U1MA 2R8KA 1X4FA 4TQRA 3RR7A 2NUHA 4PXBA 5KAKA 5FIIA 5DG9A 2JVRA 4DG1B 2KT5A 3KJVB 4PQAA 1VQ7S 2HHWA 2OPSB 3BM7A 2EFOA 3PIPQ 1NK8A 1U1NA 3MTKA 1C1CA 3I82A 3NCPA 1HPZA 4ZVEA 1VQ6S 2ZBIA 1JLFB 1B0TA 4QJVA 2VQEF 2ILZA 1U47A 2W7AA 4AYBD 3LWMA 1VK8A 2KZZA 3V4IB 1G3OA 3AJ1A 1TL5A 4F4YA 4DQQA 1VLYA 2E7XA 4YY3F 5KG2A 3VQSA 3BSAA 4DR3F 4HEA9 3SFGA 1SL0A 3OXFA 3PNIA 4NYZA 2XWXA 2APOA 2O3DA 3CD5A 1Q8LA 1QSLA 4I1TA 4QR2A 3LALA 1RK8A 1BD6A 1X4EA 5GAEI 2KXHA 4U6PA 2DGTA 1L5UA 5E33A 4ED2A 4HH0A 4Q2LA 1RTJA 4O44A 1Q16B 4OZ1A 1IJEB 2I5JA 4NLXA 5G4DA 3MM5A 2ZKTA 1RDRA 2WOMB 2CPJA 3NGDA 4DV2F 3RB4A 3U27A 3VALA 4LQ9A 1VJWA 1FVQA 5E5NA 5K8MA 1IBKF 4BHQA 1CG2A 3TUJC 5D4NA 2HQ3A 3KYLA 2BW2A 3ZFVA 4WYWA 4YMEA 1QSSA 5KFOA 2HG4A 3HHDA 1QAJA 1VQMS 1QAYA 1KQFB 4F50A 2E44A 1WHYA 2GHVC 1S9GA 4K4VA 2VFTA 3UDCA 3SFUA 2EPIA 5CCMA 1BQNA 2J7KA 2M8DB 4LF9F 3KHLA 2Q43A 1V6HA 5K8PA 1R7IA 5DDRC 2YWFA 4IKAA 2HHXA 1S6QB 4ZMMA 4R8UB 4RNOA 1C4CA 4K4ZA 4C8MA 2E5JA 1S9FA 3B8HA 3AQOA 4B3OA 2YX1A 2GGPA 1RT1B 1GXUA 4J9NA 2D3OR 1VBZA 2YNGB 1DLOA 1TKZA 4X2BA 1SJQA 4I2QA 2JVOA 1HYSB 2KU7A 3NS6A 4BS2A 4G1IA 3CCSS 5IWAF 4FYDA 2P9CA 5KFTA 3QGPA 2HHQA 5KFXA 5E2QA 2C2RA 4DL5A 2NSCA 3FDSA 3M8RA 4C9DA 1KOHA 5DGBA 1S0MA 3NRBA 1VIOA 3N6LA 1TL3B 2GA7A 4OFZA 3F73A 2JLEA 3M30B 1Z2LA <