3MUTP

Crystal structure of the g20a/c92u mutant c-di-gmp riboswith bound to c-di-gmp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical determinants of ligand binding by the c-di-GMP riboswitch .
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mutP00
1DZ5A 2DGTA 3BS9A 2CQCA 1ZZFA 1WF0A 2MZSA 1KOOA 3Q2TC 1PGZA 1VQ5S 2VOPA 1X4DA 4CH1A 2DNNA 2HVZA 4WFAQ 3IRWP 4A8XA 2D9PA 2RUGA 3NS6A 3UCGA 3MD1A 3CMES 4C4WA 2DNQA 4IOCQ 1H2TZ 2LXUA 1FJ7A 4RU2A 3J7YU 3ZZYA 2G0CA 3S6EA 2LECA 2RS2A 3S7RA 2DNPA 2MGZB 3IWNC 2LEBA 2F9DA 4PRFA 2CPXA 1OWXA 2QEXS 4J5OA 3U1MA 2ADBA 4YB1P 2CQPA 2EK6A 2KT5A 4F26A 3R1HA 2DNYA 2OTJS 3I55S 2K3KA 2DHAA 2XNRA 2MY7A 4FXWA 1U2FA 2J8AA 4BS2A 2DHSA 1DHMA 4LJMA 4Z2XA 2EK1A 2DGWA 2GHPA 5LXYA 1JMTA 3BO4A 1HA1A 2CQDA 2FC9A 3CCLS 1WG4A 2M2BA 1YJ9S 2OIHA 1FNXH 4Y0FA 2DO0A 1KD1T 2LEAA 1X4CA 3G8TA 3G71S 2CQ1A 2M8HA 2KHCA 2YTCA 4IOAQ 2MZ1A 2F3JA 2CQ4A 3H2UB 1SJ3P 5ITHA 1WHVA 3S01A 2D9OA 3G6ES 1VBYA 2MKJA 2DGQA 2A3JA 3JB9k 2CPIA 3B4MA 1U1RA 1R8PA 1VC6A 3VALA 5IQQA 1VQ7S 2ADCA 3SXLA 2DNKA 2X1AA 2DH8A 3CC4S 5DDRC 2RNEA 2V94A 3B4DA 2CPFA 1M1KT 2M7SA 2VOOA 4M5DB 5DDPC 2XSFA 5LSOA 2HYIB 3NMRA 3VAJA 3K0JA 3MD3A 3MURP 1L3KA 4U67Q 3CCVS 2DHXA 2XNQA 2DNZA 2JVRA 2Q79A 3NNCA 2LA4A 1HL6A 3BEGB 5LXRA 3FEYB 3SDEA 4UY8T 4PKDB 4IUFA 1WEZA 5IM0B 2LA6A 4TU8A 3P6YC 4ERDA 2KH9A 2RQCA 2F9JA 1UFWA 3CCMS 1N8RT 3CCJS 2DNRA 3CCQS 1KC8T 2ZJPQ 2KM8C 3CCSS 2RVJA 1PO6A 2CPHA 3NNHA 3HHNB 3G8SA 5CYJA 4WFNQ 4TU9A 1ZH5A 2YH0A 3CTRA 2LKZA 2MZJA 3PIOQ 3G9CA 1WI6A 5GMKa 4LMZA 2PE8A 1U6FA 1IQTA 1FXLA 1WF1A 3CCES 2HZCA 3CD6S 2DNOA 2DGVA 1K9MT 3G96A 2WBRA 2ZJRQ 3DLLQ 2MQLA 1WEXA 1U1OA 3THPA 1X4AA 1FJEB 1M5PC 1JJ2R 3UE2A 2CPJA 2KI2A 2N3OA 2CQIA 3P3DA 5MLCV 5LSLA 2BZ2A 2L08A 2RT3A 1D8ZA 2CQ2A 2FPHX 5JVGQ 1YHQS 1DBDA 1WWHA 5FJ4A 1WF2A 5CA5A 1X4BA 3P5TL 2J76E 5D77A 2KXHA 3CF5Q 1VQ4S 4V19X 2DHGA 1X4EA 3L3CA 4WKRA 2YH1A 2SXLA 2J0SD 3U1LA 1U1MA 2X1GA 5DDQC 2OSRA 2RS8A 1N88A 2KFYA 1K8AT 3H2VE 2N3LA 2X1BA 4QQBA 4YOEA 1YIJS 2RRAA 1VQNS 1Q81T 3SMZA 2AYBA 5EN1A 4WCEQ 1HD0A 2MYFA 2RQ4A 3MUTP 4QU7A 1VC5A 4TLQA 2DO4A 3CCRS 2LCWA 2M70A 4CQ1A 2RRBA 1SXLA 1FT8A 2LQ5A 1X4FA 2YKAA 1VQ6S 1FHTA 2MQNA 2E5GA 1Q86T 3DXBA 2MHNA 1R8HA 2UP1A 1YI2S 2I2YA 3EGNA 1KQSR 1G2EA 5GADU 1P1TA 3BO3A 1YITS 1U1LA 2E44A 4Y00A 2MKHA 2KN4A 3FEXB 2M8DB 3BO2A 2DNLA 2K8GA 2U2FA 1B7FA 2KG0A 3SDEB 2AYEA 2JX2A 2KG1A 4TU7A 5GAHU 3R1LA 2G1DA 1WG1A 3N9UC 2KVIA 2ZJQQ 2DISA 2CPYA 1W2BR 5BJRA 1H2UX 1X4HA 3P49B 2KRBA 1UP1A 2XS2A 3EGZA 2L9WA 3J7ZT 1VQOS 2D3OR 1SJFA 1JJ4A 1SJQA 1WHXA 1NJIT 3S8SA 4W92B 2MZTA 3CC2S 2MY8A 2KYXA 2U1AA 2MMYA 4P6QA 1YTYA 2CQGA 2B0GA 2E5HA 3MOJB 1A9NB 4C7QA 3MI7X 1VBZA 2I38A 1X5OA 2J0QD 3I56S 1O0PA 1U6BA 5D78A 4QU6A 1YWXA 3UCZP 2CQ3A 2DH9A 2M0GB 3UD4P 2MQQA 1URNA 2VODA 3CXCR 3CC7S 2KXNB 3MUVP 2M9KA 1S72S 3RW6A 1A7GE 2CQ0A 2DITA 2MJUA 4WFBQ 3ULHA 2G4BA 1SJ4P 2CQHA 3TO8A 4OZ0A 2MKKA 2DH7A 1U1PA 2FHOB 2XS7A 2CPZA 1XN9A 4ED5A 2CQBA 3MDFA 1HD1A 2HGMA 1K73T 5DDOC 2MJNA 1S79A 1YJNS 3D2WA 2MQMA 2KM8B 5JVHQ 3TP2A 2NLWA 1OO0B 1VQPS 2KRRA 1NU4A 2MSSA 1QVGR 1RK8A 1VQKS 3THTA 2OSQA 2MSTA 3VAHA 3LQVA 1M5KC 3Q2SC 1H2VZ 2XB2D 2FC8A 1WHYA 2O3DA 3HI9A 1VQLS 4ZKAA 1FJCA 3VAIA 3V4MA 1CVJA 2MKIA 4CIOA 1QVFR 2DK2A 3ZZZA 2CPEA 3VAFA 2JWNA 5LJ5Y 1U1QA 1X5SA 2E5JA 1M5OC 3CULA 1UW4A 2ERRA 2QA4S 4PR6A 1UAWA 2LXIA 2M4MA 3R27A 3VAGA 2DGUA 1N52B 1X4GA 3US5A 2RU3A 3MXHP 2KU7A 2MB0B 2DNGA 2NZ4A 5LJ3Y 2LYVA 2MGZA 2N82B 2DNHA 2X1FA 4IO9Q 2DGXA 1N54B 1RKJA 4LIRA 1BY9A 2GO9A 2JVOA 2EVZA 1VC0A 3PIPQ 1FO1A 2MQPA 2YWKA 1VBXA 2MKSA 4CH0S 2MZRA 2DGOA 4F25A 2CJKA 4YUDA 2QFJA 2LMIA 1X0FA 2M88A 1M5VC 1D9AA 1X5TA 3RW7A 1WTBA 3NS5A 3VAKA 5H1SV 2L41A 4QPTA 5GVQA 2AD9A 2M52A 2DIVA 2MPUA 4F02A 1YJWS 5DM7Q 2HGLA 4WIIA 1WHWA 1U1KA 3G4SS 1WEYA 4EGLA 1NO8A 1VQMS 3CMAS 2JRSA 1KOHA 4W90B 5DETA 5CXTA 5DM6Q 2AYGA 4UQTA 3UCUP 3TYTA 5GAGU 1ZZNA 1SJRA 2DGSA 1AUDA 2MZQA 1Q82T 3VF0B 1VQ9S 4C0OC 1U1NA 1P27B 2FY1A 3NNAA 5HO4A 1DRZA 2OTLS 2VONA 3OW2R 3LPYA 2BOPA 2N7CA 1M90T 3EX7B 3UD3P 2DNMA 1F9FA 1WG5A 1X5PA 1H6KX 2HGNA 2AYMA 4OZ1A 1WI8A 2MQOA 2MXYA 3UWTA 3MUMP 1VQ8S 1WELA 2OJ3A 2DIUA 3CPWR 2KXFA 3CCUS 5IFMA 2XS5A 2CPDA 2PEHA 2DB1A 1OPIA 4WF9Q 2MKCA 1Q7YT 2E5IA 4FXVA 5HL7Q 3VAMA 1OIAA 1QM9A 5IM0A 5GAEU 3CUNA 1JJHA
chains in the Genus database with same CATH superfamily
4RUAA 1NH7A 2MLYA 5B09A 4WP8A 2NSCA 2O1PA 3NOGA 3CJRA 2FLNA 4WFAQ 3C8YA 2MGZB 5J1PA 1E6YB 2OPRB 4L74A 2RMLA 2IMWP 5AE2A 1U2FA 1DHMA 3C6UB 3O1LA 1L5UA 3W3SA 4NASA 2YKNA 1BQMB 3CCLS 2M2BA 3DLKB 4MK9A 4PAAA 4KKOB 1IKXB 1S97A 2ZNYA 3M6XA 2BJEA 4DS5A 4N41A 2ZDOA 2L48A 1UJ5A 3DDNA 2UUBJ 1KHVA 1VC6A 3QWPA 2MEWA 4DLEA 1P1LA 2J5AA 2CPFA 1HHQA 5K8MA 5DDPC 1PAUB 1F5AA 2XSFA 3GYGA 3PM9A 5HP1A 2DD8S 1KONA 2XNQA 4U7UD 2V2VA 2BE7D 3IGVA 1HNIB 1RU2A 4PKDB 1FRKA 1YKWA 1RHKB 4F0MA 2B6AB 3CCJS 1QSLA 2ZJPQ 5KG6A 2FLLA 4LF6J 1ZH5A 4A8OA 2DVIA 1UL3A 3D0IE 4AD6A 4ANDA 1JNZB 3HFVA 4WTYA 3UDLA 1HW8A 2IDLA 3KNGA 2ZKTA 3KUGA 3KLFB 4O4RA 2XMWA 5KOWA 4RO0A 5D4NA 3KLGA 2MQLA 3AFGA 3DOKB 2XMMA 5L1KA 1D9DA 2NYHA 2CPJA 4N8NA 3P3DA 1DTTB 4OX7A 1DBDA 5D4LA 1RAEB 4MH8A 4K4ZA 2H5EA 2ACYA 2YVSA 3A8JA 3OTOF 1JLAB 1S6QA 1NSAA 4YY3F 1C1BB 4X64F 1Q81T 3SMZA 5C24A 2WVBA 5M2UA 4HLBA 4EO8A 2DEJA 5GAEI 1X60A 2YKAA 3T1HF 2BDPA 3BSOA 3V6HA 3MEGB 1IVZA 4DR5J 3JAMY 3EGNA 5GADU 2Z4PA 1U1LA 3OFFA 3BO2A 1S49A 2KG0A 2ZVSA 4OZLA 3OHAA 3R1LA 3N9UC 1TKTA 1U48A 4YDXA 4LF4F 3IP0A 2BJ9A 3LAMA 4QYZJ 3UNGC 4O44B 4DV7J 4W98A 2JLFA 2MY8A 4OHWA 2U1AA 1YSJA 2E5HA 5D0HA 3X3UA 4DUYF 2Z2ZA 2MTLA 2XM3A 2XZTB 1DQ8A 3PNIA 4ETXA 1IJFB 3TZWA 5ADZA 3SV4A 3H42A 4PYDA 1WC1A 1SJ4P 4J7CA 2MDAA 2YWHA 2DH7A 4Q8EA 4ED6A 2HQIA 1K73T 1RYRA 2HVIA 2K1RA 4K5RA 2KHDA 2KM8B 4DPWA 5JVHQ 3LPEA 1SQEA 2QC3A 3BKUA 3DMJB 2XB2D 5B0GA 1HBNB 3DOLA 5BR8J 2BACA 1LV5A 2B8PA 4FKYA 3IBWA 1JLFB 2CPEA 1F5BA 5LJ5Y 4OQJA 1DLOA 5HVFA 5C7PA 5FDLB 4LVNP 3MCNA 1SC4B 4WXWA 2HNYA 1X4GA 2FY8A 2IVFB 2XSJB 4DG1A 3DGVA 1ZYQA 5IS2A 5LJ3Y 4IO9Q 5AXNA 3H90A 1RKJA 1RT7B 1AZSA 1AA1B 3UVJB 2EEYA 2F1FA 1SKRA 1HBUB 1BQXA 4I56A 2CJKA 3HFZB 2RHQB 5DO2A 3FSXA 5KFYA 1PJ7A 4KTQA 2VPWB 3LP0B 3UNYA 2UXBJ 2C1EB 1JLEB 3OTDA 1YJWS 5F0UA 2HGLA 5AE3A 5KFIA 2UUCJ 1RHMB 3MR7A 2C28A 3BQ1A 4ZK7M 3V6KA 3VF0B 4C0OC 4JI2J 5IV4A 4DV3J 2E9ZA 1RKIA 1FRMA 4X4TA 1H6KX 3ENWA 2BEFA 3KUEA 2O5DA 4XPEA 2ZZMA 4K0KF 3K57A 1UWBB 2QYCA 4DZ6A 5HVHA 4RW4A 4CM0A 1OIAA 1HNVB 3MM7B 1NK0A 1WF0A 3CB4A 2C42A 1OS5A 2XTJP 2UUTA 3KLIA 2P9CA 2EKNA 2H1YA 3L95X 3NGRA 3M2VA 2PI5A 1T7PA 2VA3A 2AWZA 1OY9A 2CVEA 3K8VA 3IM9A 1XERA 1TL4A 3M2UA 2GHPA 3Q24A 2APOA 3W7BA 1KLMB 2VQEF 2OIHA 4DV2F 4CM2A 2ZUGA 4K5SA 4F0KA 2CJ9A 2V8GA 4DX7A 3J81U 1J5OB 1FI4A 1S0MA 2DXEA 3ZC4A 5IT4A 3QZ7A 4DSLA 4CLTA 1WKJA 2B9WA 3KK3A 3DFEA 5KOXA 3T5KA 2EW9A 2DNKA 3HPOA 3B4DA 2EC0A 4PXBA 2ZVIA 1UEVA 1T05A 2NUHA 1ACMB 3CCVS 3F0NA 2DNZA 3OSPA 1S1XA 4LFCJ 4LR7A 2E66A 4HHJA 3UR3C 1AB8A 1UFWA 3FBEA 1MMLA 3D3CJ 3RGIA 5KFFA 4DN0A 3EE3A 1TAUA 4LMZA 1RAHB 3D0HE 3BGFA 3SBMA 1RBAA 1PYSB 3HHLB 4YR3A 1EETB 1UPPA 4IRDA 3M7VA 3SZ2A 3AH6A 1JLCA 4NWBA 3V6DB 2COLA 2LU1A 4PWUA 5ETOA 2G2OA 2XO6A 2XQCA 4JB8B 1T3NA 2OLWA 4V19X 1C0TB 1I94F 2J0SD 3TEHB 5K14A 3L4BC 4XIUA 1N88A 4GC7A 1IKVA 2F8EX 4HH1A 2RRAA 3A3NB 4G1QA 2QT7A 5HVGA 2HVHA 2MYFA 1RADB 1MU2A 1NXIA 1MSWD 2HS4A 2FJVA 2HLTA 4K59A 3FSIA 1QAYA 4HL9A 4K4TA 3OV7A 1RAGB 4OZ3A 3EJMA 3NKYA 3MECB 4MIBA 2PMHA 3TRGA 1RWXB 2K8GA 3HK2A 3SDEB 3BSNA 5C25B 1LQ9A 4LF1A 4JI1F 1U6ZA 4XTTA 2CYYA 2GZOA 2B7CB 2OKQA 2CPYA 3TARA 1ZAXA 4KPYA 1VQYA 3M6WA 4W92B 1RAAB 1JB0C 2D41A 1XK8A 4J91A 3PJ9A 4KGMA 3MM6B 1PJ6A 3V6JA 1HBMB 3HHLC 1SC1B 5HN0A 1LWFB 4EZ6A 1GTHA 3ULHA 4ES1A 4P73A 4A8KA 2GIRA 1P8GA 2V8VA 2B9XA 3DYAB 4K4WA 3NBPA 2BQUA 2NLWA 3M4XA 2DRDA 4B3TJ 1SL0A 2ASDA 4K4VA 1MLAA 2ZH6A 4NMLA 1BE4A 2A1BA 4UOFA 2MKIA 2JZ5A 2AT1B 4KAIA 5CD4H 3DM2A 2QA4S 2DGUA 4KQZA 4X62J 3PX0A 2V0NA 1FEEA 4DV1J 2RDJA 1FVSA 4O3NA 1S6PB 3BF4A 2X1FA 2ILZA 1VRTA 4DL0C 2CIMA 3GG1A 1YZ7A 2NSBA 3TA1A 3NRBA 3HJFA 3POTA 1IM6A 1X5TA 1FA0A 4QYRA 3M32B 1TELA 4H4MB 4ALZA 4ECXA 2AD9A 4LFBJ 3EDQB 4LQ3A 2OUGA 2NQPA 3MMCB 1WHWA 4LF2A 5DQHA 4CLYA 4ZCLA 2IRYA 3UCUP 4RBVA 2O66A 2LVWA 3ENAA 3QGGA 1U1NA 5GMDA 3BQ2A 2BOPA 4Q0BA 4RZRA 4TYAA 1RUSA 4HHUA 1WI8A 4ZHRA 3E8OA 1U2RA 2OD4A 3CPWR 2G0JA 4R5PB 3HKZD 2AHOB 4ZP7A 3CNQP 3S1TA 3JYTB 1JJHA 1HNXJ 3IWNC 4MAKA 4DR2J 2MZSA 3PHTA 4LSLA 3UO0A 1O8BA 4CYUA 1N5SA 4C11B 3BQ0A 4GO7X 1Q1KA 2NUUG 2VUGA 1C4CA 4RU2A 4USKA 2BE2A 1R8BA 3ZZYA 1I1GA 1CBKA 1W2IA 4F2SA 1VRUA 4DCOB 3OTEA 4USJC 4UT4A 2DNYA 3GP9A 5F8GA 2PDAA 3AODA 3MMBA 2EK1A 1WSVA 1FFSB 5J1EB 1XNRJ 1TL1B 3PYFA 3N6NA 2FJDB 3W60A 5AXLA 2ZH7A 1X4CA 3QWUA 5CYMA 3T1AA 2ZH4A 4CNZA 1HARA 3ILOA 1IXKA 4K4XA 1Q0NA 3N28A 1IBKF 5D6GA 1CQMA 3SXLA 3PHEA 3TUJC 4JV5J 3TUZC 5FLXU 3PRVA 2YNGB 3VR1A 1N0VC 1NK4A 2LFVA 2F65A 5EWGA 5LT5A 3RU0A 3MURP 4U67Q 3EM1A 4NZ0A 1FRLA 1U0HB 2CNLB 4ZJOA 4BWJA 1JLQB 3CDEA 1UVIA 3QQCD 2BR0A 1NB7A 3KDNA 2QGFB 5HQ8A 4TU9A 2YH0A 4ZS6A 3CJSA 1K47A 2K06A 5DQIA 2AQ4A 1WF1A 3I0RA 1PILA 2OPSB 4B9LA 2VBYA 2BANA 1HWJA 4RW9B 2UV8A 3C19A 4PG6A 5GAGI 2CQIA 5CA5A 3ITHB 1REGX 2FVPA 4QIFA 1U24A 4X4NA 2FQQB 2HPUA 1P6TA 1G4CA 3H2VE 1Y3JA 4Y65A 4QQBA 2GHWA 3SEOA 1H7WA 1VIXA 3ZTOA 2LCWA 2M70A 5B0DA 1VJWA 2F8HA 2MQNA 3PYEA 1Q86T 4IG0A 4DV0J 3HFKA 1ELOA 1GX5A 3QRQA 4F2RA 4AT1B 3T9NA 2IVMA 3FEXB 4CLSA 4NLXA 5B0FA 2PMZD 2CRLA 1RWOB 4J90A 2ASJA 3M2RB 2R7WA 2JX2A 1UJ6A 3LALA 2VB6A 2XLJA 3N5BA 9ATCB 3QT6A 3QJLA 4R0EA 1U25A 4AXJA 2EFVA 4LREA 3UN3A 2B9YA 2UVWA 1IJEB 4AUKA 2CUYA 2H4WB 2Y3YA 1YTYA 1TKDA 4C3MA 1YWXA 1U0SA 3I9V9 2B7BB 3UD4P 4JP8A 4JYAJ 2C2KB 5KFHA 3SQOP 3J80U 1HWUA 2XGPA 3IG1A 4X4QA 1D09B 4J9RA 2MJNA 4ES2A 3MFIA 3WIVA 2QFIA 2KRRA 3VGTA 4EYHB 1P9YA 3VAIA 1RCXB 3D4JA 1CVJA 1S12A 2VPZB 4RW8A 1U1QA 1VCTA 4J9OA 2RJZA 2HWTA 4IDKB 4G1PA 4FPIA 5AJ3F 2LYVA 4FYYB 2VIHA 3NP5A 4C3KA 1VI7A 5HMYA 3TJ9A 5I42B 4YMEA 3QZ8A 3FMWA 1IM4A 3KHHA 3RJMB 1HQEA 4MJKA 3V4IA 4PPDA 3PEJA 1VBXA 5A0YB 2WONB 5DQGA 1D9AA 4Y2KA 1QY7A 3K5MA 3H25A 3DCAA 2RHSB 5KFZA 1B0VA 3W2VB 1R7IA 2ZOMA 4FVMA 1NO8A 1B99A 3CE8A 2KL8A 2J9EA 5ETSA 1OY8A 4Q2MA 3W9IA 2W4DA 3DRPB 3PKYA 1X5PA 2HHQA 2AYMA 4YQWA 1PYTA 4TNOA 4IR9A 3DDKA 7FDRA 1OYEA 3CCUS 2M3DA 4RW7A 1R27B 2EFQA 2D3ZA 4I7FA 1NDLA 5E41A 3G2XA 2J7UA 1JLBB 1S6QB 2F4FA 3CIMA 2FVQA 4CO4A 2UUBF 1GXUA 4CH1A 2FJXA 2BX6A 2P9EA 2ZDPA 3UCGA 3W65A 1OPZA 5KG5A 3MR3A 4O3PA 3C15B 2F9DA 4DPTA 2ADBA 4YB1P 2GCFA 5F9NA 3CDWA 5L1JA 3LGNA 1FXRA 1YJUA 1RACB 1JIHA 4LJMA 3AJ2A 4ECZA 4P7VA 3W64A 4QJVA 3W5XA 2V8PA 1NJWA 2XYGB 3BO4A 2GVZA 1NB2A 2H51B 4DUZJ 4LF6F 1KHWA 1REVB 4NEYA 3NGUA 1TUWA 3KKFA 2IDEA 1K0TA 3VVTA 1C4AA 2XMTA 1SJ3P 4OYWA 3G6ES 2EKYA 4Z7YA 4ZPWR 4P75A 1ZM9A 3B4MA 4PG8A 2W2MP 4DQPA 2JEIA 3LAKA 1CSJA 3NGKA 2X1AA 3CIZA 2VG7A 4Q2LA 3HZGA 1M1KT 4M5DB 1S6UA 3NMRA 3DRRA 4F8RA 3OFHA 4OYAA 1W7WA 2F4VJ 4UY8T 1CJVB 4PPZA 1PBUA 2B4VA 4KO0B 1PC4A 1EQ0A 4QW8A 2RQCA 3MCOA 1IWAA 1TKXB 3NWRA 3CCMS 4JI6J 2EFOA 2P5VA 1N0UA 1S9GB 4WFNQ 3D9BA 1GXLA 4CO0A 2OP5A 4USTA 2C22A 4DR5F 3K5LA 2HZCA 4N47A 2ABYA 4Y2CA 2V8DA 2W8LA 1FX4A 2OD6A 2PA3A 4KE5A 4ICLB 4X65J 3KNAA 1JWWA 2FPHX 3M8PB 1YHQS 5FJ4A 1V5IB 3OPKA 3QJJA 1AZSB 4X84A 5D77A 3D7SB 3HHLD 5DRKA 3L3CA 5I4MA 1N5YB 5JUMA 4DV7F 4J9UE 1CJUA 2VPXB 1VQNS 1FDDA 1HPZB 3RAXA 1U8WA 1VC5A 2FDNA 2HQDA 4O23A 3SSSA 3SV3A 1XMQJ 3QGHA 1IKYB 4OHXA 4KIAA 3PY8A 5A8WB 2KFNA 3TUPA 3CJ8A 1NK9A 4ZP8A 4J9MA 1G2EA 3MMAB 2DR9A 2VBZA 2KYZA 3EZ5A 4RR5A 2M8DB 4M5HA 5I3QA 4AL5A 4ZMMA 1FRXA 5BR8F 1C1CA 3PX4A 3GPAA 4BHQA 1H2UX 3OR1A 4KSEB 4F0HA 5EHHA 3R7BB 2D3OR 1F3FA 3ZZ0A 1TV6A 4OHYA 1Q8BA 5HBMB 1QAJA 3MAHA 3ONQA 1O0PA 4NRTA 5C5JA 2ZBPA 3KYLA 2BKOA 1URNA 3CXCR 4FZVA 3MM8B 4QWDA 4OI2A 2MJUA 1F1BB 3TVZA 4ATNA 4ZVRB 2LQ8A 3EMTA 2FVRA 4Q45A 3NXZA 4F36A 3JSYA 2ROGA 5GMEA 4C48A 3QRRA 2UXBF 3THTA 5D0GA 3LOUA 2FHJA 2PA8D 5ETQA 4P7TA 3IRXA 2DCUB 2FTRA 3HT3A 1N34J 3U1NA 5BYRA 2UUCF 1RT6A 4P9SA 3HI9A 1FKOA 1T9TA 2EC2A 4M94A 3G8QA 1HBOA 3DC2A 2ZBCA 3IS9B 1FTRA 2XC9A 4JI2F 2QMUB 4K2XA 5KFJA 1SV5B 4DV3F 3LA0A 4HR2A 2RU3A 5U47A 4F4AA 2W9CA 4OI4A 2AX0A 1U26A 4LF5J 2CG4A 4AQYJ 5E3PA 2GO9A 3RB3A 2GQQA 1T05B 4JOUA 1AROP 2GMLA 1S1WB 5KFMA 2KT3A 3ZZUA 5E3RA 3H5YA 3EDRB 4QPTA 5GVQA 1SH3A 4WIIA 3T6BA 1Y5NB 4C3LA 4EGLA 1ZOTA 3OHBA 4NLDA 2HVEA 3RYLA 1S0NA 4C8YA 3DLEA 3MF5A 4ZVUB 2VJVA 2MXYA 1NKEA 1WACA 1RLDA 3KG0A 2AZ3A 2GIFA 1OPIA 2MKCA 1KEKA 2EBEA 3GWCA 4DF8A 1QM9A 4PXEA 5ETNA 5K14B 2CQCA 1IKVB 2XLIA 1X4DA 4C8KA 4LF9J 3GFHA 4K50A 3SCIE 1W25A 1J2VA 3CJQA 2UUAJ 2G0CA 2LEBA 3FFIA 4B9MA 2F5GA 4RL1A 1RCOB 2DHAA 4LFCF 3H0PA 1JKHB 2Y1RI 4IG3A 5IT9U 2JLGA 3W2WB 3I6PA 1S10A 4ZPTR 3MM9A 2V2QA 2R2TA 2XULA 2MLXA 1EZZB 3TNVA 2LEAA 1N4LA 2F3JA 3OVBA 3HVTB 3S01A 4PG7A 4ED0A 2HZVA 3OVSA 2G0IA 1KTVA 5EDWA 3E01B 2HRTA 1FNOA 1P9QC 3O5TB 4PG4A 2MQ8A 3BZQA 1QE1A 4JV0A 3L7UA 3M05A 4IUFA 3K8WA 3P6YC 1MWZA 4ERDA 1NHKL 3NBPB 2PI4A 4U95A 2RVJA 3FK4A 3G8SA 5CYJA 3CTRA 1Q16B 3QAUA 3GB0A 2R42A 2C2OB 1FE4A 2VFRA 1QD1A 2DNOA 5CD4A 2PO4A 4G65A 2ZH9A 4UOGA 2RD5C 3ZNUA 1X4AA 3GIJA 5HLFB 2HQGA 3PR4A 1VIOA 4KBIA 4RBUA 4OIXA 2R9LA 5G0RA 3CJ0A 3HO1A 1VQ4S 4GKKJ 1TVRA 4RKUC 1GNKA 3V81A 3R5GA 2SXLA 2HHHJ 3ETMA 3CDAA 3AXMA 2VFUA 2N3LA 2CJBA 2ZD1A 3TZXA 3MUTP 2IBOA 4BCAA 4C6AA 3MEDB 5DGBA 2V4JB 3D6TB 4LBIA 3DXBA 2HSEB 1R8HA 2CJXB 3EGVA 3GFYA 5RUBA 4UZCA 4A8QA 1CEZA 4JI3J 4Y2IA 2D74B 2R3VA 4B3TF 4Q0BB 4ZLNA 2G13A 3DRYA 3OR2A 4OJGA 3KK2A 5GAHU 3CO9A 4MIWA 4GVBB 3WC0A 4PWDB 4ZITA 3VZHA 2KRBA 3BDPA 1FTCA 3BH6B 4RNHA 1RU1A 4OJHA 3UN2A 2HQ3A 4ID5B 1TK5A 1RI7A 4X62F 3KMSA 4G1IA 4DV1F 3NCRA 4WBFA 1BQNA 4QU6A 2DH9A 4PUOA 2BE2B 2GJ2A 3L7PA 1DTQB 5B0EA 2CQ0A 3HX9A 2L3MA 2OPPA 1ZM4A 1Y3KA 2HGMA 2MQMA 1RTDA 2UXDJ 3LTOA 4LFBF 2OSQA 1L3UA 3VV2B 4JV1A 3J81Y 1WORA 3ISZA 4BDPA 1VQLS 1DQAA 4FF1A 4IH7A 4DV5J 3LP1A 4N8OA 2E5JA 1M5OC 3CULA 1TL7B 4PQUA 4KC5A 4CLUA 4EBCA 2A6MA 4CH7A 3BJYA 1PIEA 2NZ4A 3AA8A 3MEEB 1RT4B 1N54B 1R8CA 4OYBA 1WC6A 4NZ7A 2CNOB 5LOQA 3SCLE 1RXOB 4RWWA 1JXEA 1XQIA 3NAHA 1CPZA 5A8KB 4YUDA 1HNXF 2M88A 4DR2F 2HLUA 5KFKA 1GX6A 3C6TB 3MFHA 3T3FA 1U1KA 3B82A 2YBVA 3G82A 1S7HA 1GH8A 5F8JA 3NCQA 2AZ1A 2CJYB 1N36J 1Y00A 2IM2A 4CTAB 3GJQB 4M5JA 2IIHA 3FDSA 3I0RB 2G2YA 2XWYA 3JQMA 3CO0P 4HACA 1WD6A 1XNRF 3MMJA 5JMNA 4Y2MA 4FP9A 1JXLA 4CO5A 3OL9A 3RB0A 2OI2A 2HNZB 3H40A 3NAIA 5L38A 1VYAA 2GJIA 2VG5A 3VQSA 2ZC3A 2DGTA 3QLHA 1ZAWA 3FNNA 3PYGA 1CG2A 1GAOA 1FE0A 1FF2A 2RUGA 3NS6A 3MD1A 1KQGB 5EX0A 1N32J 2Q1LA 2HBRB 1IN0A 4QWAA 4JV5F 4ED4A 4E2FB 4AYBD 3S6EA 2RS2A 2JC1A 1C0UA 2QEXS 4R8UA 3BPDA 3MR6A 1FKPA 2OTJS 2JC0A 4TVAB 1SPBP 3KTQA 2E1PA 2V50A 4I2PA 3KXDA 3G8TA 3PTWA 6FD1A 4Z37A 3H2UB 1OQ3A 4DR6J 2IC3B 5J2MB 2DGQA 1CULA 1Q5YA 1OYDA 3VALA 3DLJA 2NREA 2E9RX 1S9FA 1HW9A 3ZTQA 2Y1JA 2AGPA 4RW6A 1NJZA 2I1RA 4WWSA 2QA1A 3LWLA 4HI2A 4P2SA 1HYSA 1HL6A 5EWFA 2VU5A 1RTZA 2UVVA 3KWMA 3D6FB 2Z8QA 5IT0A 1Z2ZA 2XCAA 1PO6A 2YQ3A 3VWSA 4OHVA 5LMNJ 5C42A 4CLLA 4DV0F 2XZDB 4OJ3A 3MAAA 3HDSA 4RW8B 4PZVA 4NYOA 2VDIA 3RBEA 3G6XA 2IM0A 1AXQA 4D3GA 5HMZA 2RSQA 4FNIA 3PRBA 2JNJA 5EGYA 4DU8A 4TLRA 1T9VA 2BZ2A 2RT3A 2HFUA 1RT2B 2EXUA 2CNKB 3WQPA 4ED2A 2LEPA 1NSQA 2QSWA 3SQGB 2IJNA 2ZBRA 1UMJA 2IAJB 4UY85 4YOEA 1Y11A 4WK1A 3TAMA 4HH0A 5CYQA 2FYXA 4IFVB 1YVFA 3GSDA 2RRNA 2W8KA 4JYAF 3OJSA 3TA0A 1S76D 2I5JA 1BUXA 4NLRA 1F9EB 1LW0A 2HRYA 1ZA2B 2VICA 2C2EA 2JHEA 3MPUB 3MTJA 5ETMA 3CSKA 1U49A 4CWBA 5F0WA 4X4VA 5IWAJ 5H9EK 1RTIB 4NCAA 1G6BA 2CWXA 3AQPA 2HMIB 3OJUA 2V68A 3KLVA 3OXFA 6AT1B 2W9AA 1UVJA 2XGQA 2HBQB 4LRCA 4I6YA 3CEDA 2NXJA 4OL8A 1NLKL 1K44A 1NZAA 1IBMJ 1X9MA 4URQU 3PYDA 2MKKA 2F7VA 1HI8A 3MDFA 5KFSA 3GIMA 2FLPA 2IPOB 3JSRA 4EMDA 1FD2A 2RF2A 1RT5A 3Q23A 1EB0A 3JQKA 4NLQA 2QJ3A 3OTBA 3IAM9 2FHJD 4ZVEA 2DKOB 4ER8A 2WVEA 2NZCA 3DHXA 3NG8A 2ATLA 3LGHA 4A8YA 3TAQA 2YY3A 3R7SB 1M0SA 1LFWA 3M1VA 1MW7A 1U47A 1NK7A 4KHMA 2RB7A 4YB6A 1LWEA 1NKBA 1AYEA 1RWUA 2V2KA 4FKXA 2HK2A 2FJWA 3UDVA 4WE1A 4EFAC 1HWIA 1D9FA 3H20A 1FK9A 1XR7A 1S59A 1IUJA 1KP6A 2G9OA 5KFBA 1HMVA 1YRXA 3J81j 2OH2A 5M2PA 1V6HA 3UQSA 2EG1A 3SCJE 2Y0BB 4NYPA 4F02A 1VQMS 1RTJB 4M5MA 1CJKB 2MHEA 3ET6B 5B7WA 3M30B 4BLGA 3KDOA 2DGSA 4MYUA 2BRKA 3NNAA 4UZBA 3P4UB 1FRHA 1M90T 1GMUA 3F41A 4BC7A 3I5BA 1HQUB 4AL7A 4DUZF 2C3UA 2FVCA 2PEHA 4MKBA 1KDNA 2DR6A 4B9VA 2WRMA 5E3AA 5L46A 5GAEU 4ECVA 3CUNA 2R2SA 1DZ5A 1ZZFA 1EKRA 2X7IA 3KJFB 1CJUB 4A4JA 3TEGA 3CJKA 1LWCA 4C4WA 1S5ZA 1KBRA 2YKMB 4B17A 1RHJB 5B0AA 3RRHA 4Q5VA 4Q8FA 2VBXA 3H5SA 2YNIB 2DNPA 1OWXA 2J0XA 2W2NP 2HWHA 4FPRA 1RT3B 2F4VF 2V63A 3THVA 1Y10A 1WDTA 4L3KA 3GG0A 4JI6F 2WTFA 3MM5B 2NYIA 3FEZA 1NPPA 1S1TB 3C46A 3PG9A 1MROB 1SC3B 3Q8YA 2RDIA 4UOCA 4ZVSB 3KFWX 3QIPA 4QWEA 5AE1A 2GGPA 4OJ1A 3CD0A 3GIIA 2R7TA 1SVDA 2R7OA 2KHCA 1IR0A 2CQ4A 4YP3A 5DLGA 2BQ3A 1O6XA 4DPUA 2DXFA 4X66J 1RT1A 4X65F 5HQMA 4FDFA 3J80Y 1XMOJ 2M7SA 2VOOA 3KJQB 1MN7A 4OLOA 3PVXA 3I0SA 1RAOA 2QN6B 3IWXA 3NNCA 4ECQA 2LA4A 3HMJG 3CDUA 1PG5B 4TU8A 2AW0A 4JI8J 1Z2LA 3IR7B 4M5NA 3M8YA 3QT5A 1M5SA 2Z30B 5F3TA 4LSNB 4ECRA 4FYVB 4GVLA 2YNFA 3KG1A 1XMQF 2D69A 3GLJA 4TY8B 3PEHA 4NL5A 4DL3A 1IWGA 5KFPA 2HNDB 1VK3A 3M8SA 3THPA 3KLEA 3JTPA 1BMQB 1SCJB 1Z4UA 2KI2A 3Q8UA 4J9VA 4IFYA 5IQ6A 1E6VA 1WWHA 3AJDA 5KT4A 3AOCA 4CLZA 3IN5A 4LBPA 2OPQB 1SUQB 2OSRA 2WSCC 3M9NB 3OL8A 5EN1A 3X1LB 5KT7A 3DOMB 1H38A 2XMUA 1FT8A 5I3UB 4ANCA 3TX0A 4WU2A 1UJ4A 1FWPA 2ZH8A 5KG4A 4MFBB 4ECSA 4WFXA 3J7YI 2VKZG 3EZOA 4O3RA 1N34F 1KN6A 2G1DA 4P2XA 4ZVFA 2DISA 2LLZA 2A18A 5BJRA 5LSRA 2RIJA 1CC7A 4KFBB 1N6QA 3TW0A 5DG7A 3S8SA 3D1OA 2CVIA 2RILA 3UCZP 4LF5F 2ILYA 4NLWA 4FVCA 4AQYF 4ZLLA 3DRSA 3KK1A 2DR5A 4PXDA 5H9EJ 2FIUA 3I96A 3A1YG 1UA1A 2YNHB 5DDOC 1YJNS 4GC6A 3QO9A 4K8RA 4KGKA 3A12A 1VQKS 4DR3J 2HZAA 4ZA1A 5DZ7A 1NSPA 2FGOA 2WB1D 1NH8A 4RUCA 5KFCA 2GMJA 2J6UA 1UAWA 1JLGB 1N52B 2MB0B 1UW9A 2R8IA 3GYXB 2MGZA 4A8FA 2OGUA 3EXYA 1E6YA 2OPRA 2DGXA 3PIPQ 1T9XA 2MQPA 2MKSA 2IA0A 2EBGA 2MZRA 1NHUA 1X0FA 3C6UA 4DFJA 4LF9F 2CAJA 3DLKA 2QG9B 2XYHB 2W9BB 3RBDA 2MPUA 4KKOA 1IKXA 1LW2B 2J7KA 2JOQA 2UUAF 5CXTA 5DM6Q 4NOHA 1QDUB 3TJ8A 1VQ9S 1H3DA 2FY1A 4DMZA 1ZTWA 1WOOA 5KG7A 1PCAA 3T1YJ 3D5MA 3MUMP 4ANEA 4H4OB 1ZM3A 1YZ6A 5IFMA 3KG4A 2WVDA 3PW7A 1S4FA 3CVKA 2FJEB 1HNIA 4X4RA 5HL7Q 3MEKA 1XMBA 2YQ1A 4CO3A 2B6AA 2VOPA 2HVZA 3D28A 5FIIA 3FRZA 5HAOA 2D9PA 4HTJA 1FJ7A 2VH7A 1F3VA 4QR0A 2J9CA 5E3QA 3G6YA 3HSJA 4EI2A 3KLFA 3HP6A 2VZ9A 2CQPA 3DOKA 3I32A 5IC4B 5CZXA 2DY9A 2I0XA 3ZNJ1 1QSYA 1DTTA 2XHWA 5CZVA 5ETLA 1XWLA 2FGCA 1HA1A 3ZTPA 2DRAA 1JLAA 4XAKA 2C3PA 3P8BB 2CPIA 2DTJA 4ZVOB 3HHKA 4FBTA 2VG6B 1BQNB 1CJTB 3R5CA 5IQQA 1TU0B 1XC9A 3DI6A 2BUNA 1I51B 1CS4A 1HNZJ 3EXCX 4CZCA 4GKKF 5L1LA 2HHHF 2FZKB 4ZPCA 2BABA 3GJSB 3K89A 1XTZA 4ZIWA 3T6JA 1VRQC 5D0EA 4J9LA 1UETA 1YBUA 3JSMB 3HHNB 1KTQA 3HT0A 1T9WA 2I9SA 2BKNA 2MZJA 3PIOQ 4O44A 2DY1A 4DR7J 4NCGB 2GO8A 1IQTA 2A0FB 1GMWD 4ZP9A 3RRKA 4JI3F 3CCWA 4LF8J 4H4KC 2OEJA 3I87A 2ZOGA 2PD1A 1UVLA 3CT9A 5J2PB 1X4BA 4DL4A 3HSDA 4ZPDA 4CP5A 2BMBA 3CF5Q 4ELVA 3QAEA 2GA7A 4ZVQB 4DPXA 4HDHA 4CRJA 3DGPB 4F04B 3DMJA 4JI4J 3FQKA 1HBNA 5G4DA 3H4DA 4FS2A 2GW8A 4J9KA 4TLQA 2D3O1 1CLFA 4C8MA 1JLFA 1NK6A 2FB0A 2R7QA 2BXJA 3BSAA 2MHNA 5L8RC 1TL3A 3M8QA 5FDLA 2QL7B 3M6UA 2R7UA 2Y1LB 2GQ2A 2XSJA 4F4YA 3AXKA 1IBLJ 5T7LB 1L3TA 2UXDF 3P5BP 4NEZA 4R25A 1RWMB 2H5JB 3P96A 1RT7A 3LF0A 3MR2A 3UVJA 5L9XA 1HBUA 2Z2MA 3AQOA 3B6BA 1PAEX 3SFUA 1TUGB 2UV8G 2XS2A 4DV5F 4LIWA 4ZPBA 3FCVA 3QT7A 2B5JB 1ZTTA 2MZTA 1JLEA 3MI7X 1FWKA 2OMLA 4WYLA 2OFGX 1ITPA 5JJBA 4L75A 2ATCB 4R8UB 4U6PA 2XS7A 2L9DA 2AJ4A 3MPDA 3MCMA 3TP2A 1NU4A 5KFGA 3UI3A 1UWBA 3VAHA 2GFFA 2R7XA 4KT0C 3CCZA 3QATA 3AD9C 4HT5A 1FJCA 4OZ2A 4CIOA 2H3EB 3MM7A 3GCWP 1N36F 3FBBA 2VV5A 3GJRB 4USHA 4OI6A 1L3SA 2IA6A 3R27A 4J9SA 1FDNA 1N5VA 1F2HA 1FFWB 2DNGA 3WC2A 4B9SA 1PSDA 5EWEA 1BY9A 2JVOA 2CDRB 3PACA 3SI8A 4IH6A 3Q8QB 2P8IA 2YXLA 3RW7A 2R2RA 3MWBA 3TQ1A 1Q53A 1KLMA 1YJVA 4B3RJ 1LNQA 1R6VA 1N32F 2XZWA 3A8EA 1WEYA 4GMKA 2VL1A 1J5OA 4HI1A 5BYSA 4K7QA 4ZJLA 1UWAA 5GAGU 3ISNC 4QIVA 1S9EB 3MAAB 2Y8WA 1OQ6A 5KFLA 1TAQA 3ELHA 5J2QA 5A76A 3R5AA 2DPJA 2XCPA 2DCLA 2OTLS 4CLWA 2DNMA 1WG5A 2HGNA 2JLEA 2C2ZB 2OEMA 3OVAA 2R7VA 3JXOA 5KG0A 3KLHB 4WF9Q 1UPMB 4M5IA 1F9HA 3U27A 1WDDA 1WC0A 1N56A 4DR6F 1KOOA 2FJBB 3EVWA 1RTHB 3JS9A 3DLGA 1B70B 1LKZA 5ETKA 5CYQB 1S77D 4LVOP 4FBUA 2IMOA 4L73A 4F26A 5HROB 3HHLA 3PO5A 1EETA 5DLFA 3V6DA 2IRUA 3EYZA 1QLNA 4K4YA 1NSKL 5E0OA 2W25A 4A48A 3EZUA 1C0TA 3WHIA 1VMBA 3A3PB 1WJ9A 1RWKB 2HHXA 5LMNF 1Y7PA 1RZMA 3ZXWA 2NR0A 1VLOA 2ZZNA 2J7WA 2O67A 3VZIA 3EWGA 4DQIA 1PYOB 3AT1B 4IOBA 2IYIA 2RNEA 1S1VB 4NCBA 1RP5A 4LRAA 3VAJA 3MD3A 4TXSA 1L3KA 5J2NB 3MECA 4OZ5A 3GSIA 2JVRA 3SDEA 3CDBA 5C25A 2BJ1A 2CXEA 2RF2B 5IM0B 3CMQA 3NNHA 1SIWB 1VR6A 2VF3A 1A0OB 1X9WA 4DFPA 2HEKA 4UF4A 3C66A 1H74A 3JQJA 1X0PA 2B51A 2BJ7A 1TTHB 2V69A 3QGPA 2NXNA 3E51A 3G96A 4F4XA 1WEXA 3M1VB 1EARA 2KB2A 4P74A 1HBMA 4V1Ak 2GVDB 2B4OA 5IWAF 1R89A 1QTNB 1RJJA 3GE9A 1LWFA 2CQ2A 5JVGQ 3OUYB 2RDDA 4WE1B 3KJVB 3AOBA 5D4OA 3A4TA 4S0MA 3AA9A 2KO1A 3DYAA 2R8JA 3MPYA 1HQ2A 4CDIA 3QNWB 2RQ4A 3R6LB 4K2JA 5A8RB 2RRBA 3AD7C 4JV2A 4F3QA 1WC5A 2UVRA 1IBMF 4NI2B 2I2YA 2N7YA 1D0EA 1H0HB 3QRPA 1S6PA 4NA2A 4AE5A 3DLBA 2B4PA 3GQCA 2ALYB 2HQCA 2LQJA 3BYRA 3BV8A 5IC6B 4MK7A 4E98A 3NGSA 4YR2A 3AJ1A 3P49B 2AJ2A 2X3DA 1TMMA 3LW5C 3TAPA 3GFZA 3M32A 5C2CA 1NJIT 4H4MA 2YKOA 2KT2A 5MAOA 4ZCKA 4A46A 2CQGA 1YLXA 2IM1A 4NLOA 1JNRB 4UOHA 1RQ0A 2IVYA 2M0GB 5KFRA 2VODA 1SKUB 3TANA 1UEUA 3RW6A 1IKWB 1RSCA 2ZE2B 3WIUA 4I2QB 4ZVPB 2HVDA 5D3GA 3HULA 3BB5A 4FYWB 3UFCX 4ELTA 1VK8A 1RAIB 2WZ1A 2JDJA 4R5PA 2CA9A 1H2VZ 2WBMA 3FRYA 5CHCB 3D6HB 2VD3A 1WHYA 2IM3A 3CJ3A 2HHSA 2O3DA 3JYTA 2D3UA 2CFXA 4OI3A 1YRUA 4Y34A 3VAFA 4C11A 3OTCA 2M4MA 1EAYC 1RWNB 4MT1A 4NMXA 2E7VA 4QBUA 3OL7A 5JXSA 2V9KA 4QYZK 2JH3A 3CJ2A 4C8ZA 2EFNA 1EX8A 3HVRA 2YWKA 4C98A 4O4GB 1XNQJ 4CH0S 3I0SB 4B9TA 2E1AA 4ZVHA 4P10A 1YX2A 3ILJA 5J1EA 3O6QA 4PCQA 3NGTA 1TL1A 1UTAA 1KVJA 4ECTA 3R3TA 3DLHA 2AIRB 3B8HA 4B08A 3CD5A 4A8SA 4MKAA 3TYTA 1MMNA 1DARA 4YR0A 2XHCA 3C16B 1P27B 2WOMA 3HJVA 4KPCA 4IRKA 1UZDA 1KQFB 4JI5J 1TZ0A 2OAUA 1HI1A 1R0AB 2OJ3A 1S0VA 3IR5B 5CAAA 1OSCA 2DXDA 4WZMA 1NK5A 3TZYA 1U0HA 4L3NA 4C97A 3SSRA 2BKPA 1JLQA 4I4BA 1NZ8A 5HANA 1B4SA 2V4QA 2YKQA 1WC4A 1MNEA 4X66F 4RNOA 3BREA 2ZHAA 1XMOF 3IGNA 4F4KA 2JFDA 2VC1A 3S7RA 4A8WA 1R3NA 2CPXA 4YEAA 4LRFA 3UD5A 2QZ8A 3U1MA 2OPSA 3FC9A 4ED8A 3R5DA 1B3TA 3IBFB 4QIGA 4RW9A 4EK2A 4EU0A 3TOQA 4FXWA 1H7XA 3JTNA 2WHOA 4DX6A 2AEFA 2BM0A 4JI8F 2JJ4D 5F8HA 1O5JA 2H5IB 3CGIA 5LL6d 1KKHA 3ITHA 4DQSA 1S1UA 4I1TA 4FS1A 4IKAA 1UCNA 4B3OA 2W1BA 4ELUA 4IOAQ 3FMBA 3T5HA 3TWZA 2J8SA 4DV4J 1NAQA 2HIQA 1D1UA 4YN3B 1H72C 2AP6A 2WAQD 4M5LA 3KK1B 2DR7A 3PW2A 2L9NA 1T03B 3I5AA 1RHRB 2NPIA 2RQKA 2DR8A 2W4PA 3M2RA 3MGJA 1XBWA 1U45A 2ZWOA 1ZPVA 1ZBTA 5KG2A 1RBLA 3N4WA 2CPHA 4YS2A 4UTGA 4DOZA 1VHIA 2FHMA 1QUPA 1KVKA 1F2GA 4DEZA 2EPIA 2CZVC 2ZWPA 1K9MT 2VHGA 4C2MA 4Y2AA 4USMA 4KRWA 3W62A 1Q4RA 2AJQA 2YKNB 4WP3A 4AFFA 2YH1A 4NXNJ 2XBPA 3HXMA 2YX7A 2RS8A 3N6LA 1K8AT 2W4CA 2JFKA 4OI0A 4MKYA 1GQEA 3TJAA 2V8HA 2JEJA 3O8WA 4B3SJ 2DO4A 4RBTA 2LQ5A 1ICEB 1JQGA 1X4FA 4WXOA 2QLWA 1X9SA 4WZQA 3B78A 3IMQJ 4LBHA 2BJ8A 4IDKA 5HP1B 4GRSA 3C3LA 2DNLA 5I42A 4Q7AA 4LR8A 4L76A 1TK8A 4DR3F 4ILRA 5A6PA 1WG1A 2XG8A 1VBKA 3I4PA 5A0YA 1MWYA 2WONA 5HJXA 4ZVGA 1UP1A 1UVKA 1KSPA 1HWLA 1WHXA 4RNNA 2LQ9A 3UN5A 1RABB 3N6MA 1K0VA 4TYBA 1IQZA 1M1GA 1A9NB 4C7QA 3W2VA 3QSIA 3KLGB 3TQEA 3A13A 1S7IA 2AKWB 5DGAA 2RU9A 3CC7S 4DF4A 2QL5B 1S72S 1UKUA 2Q66A 5F41A 4DX8H 2CJAA 2BW7A 3ISND 3DRPA 3BDEA 1SIZA 4ED5A 4ECUA 1SQFA 1NJXA 3T19A 4DU7A 3NCPA 2ZH3A 2ROEA 2BJDA 5C24B 2RQMA 1UVNA 5IOLA 3FGVA 3TI0A 1JLBA 3WX4A 2YWGA 2AMCB 4H54A 3U7JA 4K4SA 3MXHP 5IV3A 3T1YF 2I8EA 3C15A 3DI6B 3KHLA 1CS4B 3HF5A 4Y28C 3GMGA 3SIPB 4ED7A 3OL6A 1HIYA 3Q0AA 2VASA 1TKTB 4NLVA 4EEYA 7AT1B 2QFJA 5KFEA 2NXUA 1WTBA 3VAKA 1BLUA 1OMSA 1REVA 1BC6A 3BGUA 1S6OA 3G4SS 2JRSA 3K5OA 3OXLA 4NLPA 4NLTA 3WBZA 4QWBA 1SJRA 5E5NA 4B02A 2B4UA 4XPCA 1HI0P 3E2EA 4DL7A 2VONA 2P6SA 2GQCA 3ENVA 4M5DA 2K1RB 4I6WA 3UWTA 2VPYB 2DIUA 4DSIA 3LP2A 2W2PP 2YX4A 4DSFA 3C2PA 1FWLA 2P9GA 3VHQA 4M95A 3DOLB 2H4YB 1CJVA 3BGOP 2C3OA 3M8WA 3RRGA 4KO0A 3DHWC 2AGQA 1NDCA 3PFEA 3Q2TC 2J0WA 1TKXA 2OELA 1DLOB 3PZPA 1S9GA 4MK8A 3W61A 2HNYB 1RB0A 4I69A 1H2TZ 2LXUA 3HCXA 4DG1B 1SKWA 1HNZF 1C2PA 5H9FK 2D7SA 5KG3A 2Z58B 1F5CA 1TL3B 3M8QB 2AEJA 3IA0A 3R1HA 4ENOA 8RUCA 2K3KA 4JBCA 2X51A 2MY7A 4ICLA 1J5EJ 4AL6A 2WW4A 3AY0A 1RHQB 3M8PA 3UDCA 5LXYA 3UPFA 2C3YA 4U8VA 2ZM6J 4IYQA 5D8HB 1HLWA 3G6VA 1HFEL 4Y0FA 3W5YA 1N5YA 5KFDA 5ETPA 2B9EA 3BH7B 2M8HA 4DR7F 4F4WA 4ZPVR 5DJBA 1HPZA 4C0BA 2UUWA 4LF8F 1I3OB 1NDKA 2CWKA 1IKYA 3CC4S 5A8WA 2WB4A 5HJYA 2EFGA 3K0JA 3MMAA 2Z56B 1O51A 4EUVA 2XYPB 6FDRA 2Q79A 5HQLA 1BGXT 1T02A 3TVKA 1TKZA 3BEGB 4NYZA 5F3ZA 4RW4B 4DUTA 3RUBL 1ZPWX 2FJAB 3IWLA 2HK3A 4JI4F 1SL1A 2HQFA 2H9ZA 1U09A 2KM8C 3KLIB 2V6AA 3M6VA 2F63A 4Q43A 3G9CA 1T9YA 1FRIA 3UDEA 2PE8A 3M2VB 4OYMA 5HBMA 1FXLA 2AEMA 4CLPA 3NLCA 1BHNA 2WBRA 3DLLQ 2RKIA 1NEEA 2HRUA 8ATCB 1G1XA 1U1OA 1IBLF 5KFAA 2BV3A 4P2FA 1FJEB 2W24A 3NS7B 2Q6BA 1PBAA 3D3BJ 4R0JA 2N3OA 1RGVA 2JEFA 1KWMA 2VA2A 3HD2A 3M2UB 3MM8A 3CJ4A 3P5TL 4ZLJA 1G7CB 1RHUB 5HATA 1JXVA 4HHHA 3BGLA 1GT8A 2HAIA 1BD6A 1S0OA 4DL6A 4CI0B 1Q79A 3BKTA 4DI6A 2RE1A 2BYCA 5K9FA 3KK3B 3K2YA 1EP4A 1AW0A 1SXLA 3ICLA 3IS9A 2E5GA 2IFXA 3ZZPA 4ZVTB 3ILLA 4LSZB 3VVUA 4RJVA 2WVFA 1SV5A 1YI2S 2N4CA 4JI7J 2YPZA 3EVOA 1U4BA 5J2QB 1S1XB 1YJTA 4Y6IA 3NOCA 3F44A 2EI5A 2WW8A 4NLUA 1S1WA 1W2BR 5D15A 4OLPA 4F4ZA 1X4HA 2VFVA 1NK8A 1BWEA 2L9WA 1VQOS 1SJQA 1T3OA 2UXCJ 1WUUA 4P6QA 3ZFVA 2I38A 1SJ1A 4YFUA 3DLGB 4NRUA 3OFEA 5E3CA 2DEIA 4PQAA 3IBCB 4RNMA 2KXNB 1Y9OA 1LWXA 1JLCB 1URRA 3V5RA 3BYPA 4QR2A 2CQBA 4QZVB 2KDOA 2BE9B 3GILA 4JI0J 4Q44A 4B3RF 3LQVA 2E5LJ 2PN6A 4G1QB 1MU2B 1YQHA 3FKBA 4QIEA 3VQTA 1QVFR 2RH3A 4DX5A 3FVYA 2F40A 5E33A 3MR5A 3MCSA 1V5VA 4XK8C 4DCJB 2UU9J 5K8OA 2KKHA 1CC8A 4GO5X 3PKMA 3WZ0A 4DR4J 4HTIA 2V67A 2XMVA 1R0CB 1QUVA 1VGYA 1JKHA 3HHDA 5KFXA 1RDRA 4QCLA 2Z2LA 3W2WA 2ALZA 3DRXA 3MPWA 4AXIA 2Q3PA 3IFEA 4G6VB 4P71A 4W90B 4ZLPA 2Q6CA 4J9PA 3HVTA 2E7XA 1DRZA 4QWCA 3HVWA 3E01A 3Q8SB 4OYZA 3A3OB 1KR4A 3D68A 5F8NA 2YWWA 1ZS6A 5GADI 2RAQA 2ASLA 4RU9A 5F8IA 1M1HA 3VAMA 5K20B 3BS9A 1NCLA 4CNYA 4OHZA 2DNNA 2IBKA 3W63A 3DM2B 5EX3A 2ZITA 1DJ0A 3CMES 1ULRA 2B56A 5AXMA 1TUVA 2LECA 1WOSA 4X4UA 5SZTA 3J7Z5 3R5JB 2QA2A 1VRTB 3F56A 4B3MJ 4WP9A 3K59A 1HNWJ 1HHSA 4X4SA 5HLFA 2J8AA 4BS2A 3POTB 4Z2XA 3BN4A 3H5XA 5ETRA 2A2DA 1JMTA 1RWVB 5DG8A 1YJ9S 3IO1A 1FNXH 3I82A 5A6WA 2QSFA 3RAMA 1FRJA 2E1MC 2CQ1A 4QIWD 5E2QA 4URGA 5H9FJ 3AHPA 2BQRA 1VBYA 5C2GA 2A3JA 2XMKA 5T41A 4FXDA 3MEDA 2RUSA 2V4JA 1VHFA 3FSYA 1RE1B 4RPFA 4ZHRB 5LSOA 2HS3A 1WNEA 1ZETA 2VKRA 1F0XA 3BBCA 5D3GB 3Q86A 4I6AA 4DSKA 3D6MB 4WFZA 4GVBA 3W9HA 4LSLB 1N33J 1RA7A 2V34A 4PWDA 2DBBA 3H98A 3DNCA 4CYUB 4UUXA 2LKZA 2J6SA 4U9RA 2W7AA 2I6WA 4ID5A 2YPYA 3CD6S 1VRUB 3J7A1 1AFIA 3OSNA 4NE9C 4DJBA 3UE2A 2J9DA 2DHHA 4XDDA 3MMBB 2C2MB 2C2DA 2HFOA 1DTQA 2C2RA 1WF2A 3K7RA 1V9OA 1NPKA 1EHWA 1NM2A 1KLNA 2X1GA 1EKSA 3PX6A 5CYMB 2KFYA 5J1NA 1EQMA 3OFGA 2BA9A 3QGIA 1HD0A 1Q95G 4QU7A 4I67A 4YB7A 5B0CA 4OZJA 1VQ6S 3R8YA 1TL7A 3E3XA 3BPSP 5KFVA 2IYGA 3GR0A 1H98A 1P1TA 2WOMB 1YITS 2KN4A 2WSFC 3MEEA 1H73A 2AJFE 1RT4A 2AYEA 1OJ4A 3DXSX 3VCDA 2KVIA 2GS8A 2XEXA 5A8KA 1NUEA 1Q8LA 1PC5A 2IHR1 1YG0A 3C6TA 4IH5A 4NLGA 1Q7LB 2B0GA 3K17A 2E29A 4XO0A 4XDCA 1U6BA 2BANB 3PW4A 2W7OA 2QLFB 1TK0A 1JX4A 4CTAA 2M9KA 4FYXB 2GC8A 3P45B 4G3IA 3V2UC 4UUWA 1XNQF 4ES3A 4ILLA 1XN9A 1TR0A 1RYSA 1YDLA 4PWWA 4DBQA 1VQPS 3C14A 1QVGR 1VISA 2OMOA 3Q2SC 2ACMA 2HNZA 2KFZA 1VS3A 3FUYA 1S1UB 2DK2A 3LWMA 4MYTA 5AXKA 1A6LA 2JWNA 4B3OB 1QSSA 4IG0B 4V19J 2ERRA 1LOUA 2LXIA 1YK9A 4ITSA 3US5A 3I4HX 4B9UA 4JI5F 5L39A 4ECWA 4ED3A 4TQRA 1SL2A 4DSJA 2N82B 2DNHA 3ZO7A 2HW3A 5K5MA 1VC0A 1FJGJ 3O44A 2XI2A 3BGRA 4RWXA 4L6V3 4DSEA 4FF3A 3G86A 1R31A 3OBIA 4LQ9A 2FUG9 5H1SV 2ZHOA 2ZH5A 1PKUA 1N5QA 4DFKA 1RAFB 1M5HA 3OLAA 3HSZA 2Z0GA 4WK3A 3AB4B 3CMAS 4PABA 4O3OA 1RISA 5KAKA 2KZZA 2IC3A 5J2MA 4CO2A 1FKAF 3L09A 3IG1B 3M8RA 3EX7B 4OZ1A 2MQOA 5HI7A 2R8GA 1VQ8S 4KGVB 2HFVA 3FJ2A 4U96A 3ZZOA 1YJRA 2A2CA 2CPDA 4ZIVA 4ZPAA 4DPOA 2HHWA 2XMAA 2N4DA 3BM7A 4P72A 1UVMA 2G1HA 1GMWA 2QV6A 4I64A 2HBZB 4DV4F 3QT8A 2W2OP 3J7YU 2OO4A 5KFQA 3RTVA 2EK6A 4USWA 3EVMA 4UQGA 4OX9J 3K5PA 1HQEB 3V4IB 3QFHA 1RA6A 1XJWB 3D54A 1YBTA 2BVZA 4TQSA 1RT2A 2DGWA 2XY7A 4F67A 2CQDA 2PC6A 5F8LA 1KS2A 3IXQA 3SQGA 3R9LA 2IAJA 1FVQA 5I3PA 1DFDA 1WHVA 2KJVA 4IFVA 2E9TA 1R8PA 4NLYA 1FESA 1Q78A 1Y5LB 4RW7B 4NXNF 2ZNZA 4I7FB 5LXRA 3FQLA 1WEZA 3EICA 4KHPJ 2D1CA 1N48A 2Y8YA 1NDPA 1RTIA 2KH9A 3SCKE 2GAGC 4B3SF 5A2QU 4CCHA 1SC6A 2GHVC 4ZCIA 5LMUJ 3OQ2A 3PDNA 2HMIA 4J9QA 1YGYA 3TA2A 1U6FA 3A8KA 2R7RA 3BSCA 2M5YA 2ZJRQ 3PJWA 3W5ZA 4FYDA 2GVZB 1EJ7L 1KFDA 3GIRA 1U1MA 2NS1B 3GIKA 3O2IA 1VDHA 1TP7A 4KGZB 4F3MA 4B9NA 4NLSA 2YWEA 5FLXY 3CCRS 4CQ1A 3R5BA 3VTIA 3GZ7A 3MOZA 1NPRA 3IR6B 3NWGA 1FDAA 3R6GB 2VG7B 2FZGB 1HR0J 3BR8A 3I5CA 4RNFA 2CADA 1DY3A 3DRRB 5K8NA 2U2FA 5KTQA 5CABA 4C9DA 4NPOA 3LP2B 3MPVA 3QPIA 3G87A 2ZJQQ 2MLZA 3HVAA 1Y4ZB 1HWKA 1X31C 4EZ9A 5FD1A 8AT1B 4IQXA 2ZOFA 4OX8A 1VBZA 3I56S 3GCXP 1RTJA 1QAIA 1CJKA 2ZHBA 3ET6A 2MQQA 3M30A 1A7GE 2QMXA 3KMQA 4OZ0A 3Q8PB 1U1PA 4YHHJ 4DR1J 3IAS9 1HD1A 1S79A 1MG7A 1HQUA 3HD1A 1RK8A 1Q8KA 4QW9A 3AD8C 1APSA 3MZIA 3ZZZA 4DFMA 3GFXA 1X5SA 2GX8A 3ZTRA 2YKMA 3D66A 2YNIA 4Z7CA 2ZBIA 4PYAA 4LIRA 1Y0HA 1RT3A 3OT9A 4OMFG 2B43A 2DGOA 1JK9B 1C1CB 2KVQE 3OR1B 1TKZB 4U7CA 3MM5A 1TV6B 1S1TA 2KTQA 1MROA 2DIVA 2CNNB 5IXUA 4MKVA 4Y3CA 4WYWA 4UQTA 2ZZTA 4OI1A 1B0PA 1DURA 4DV6J 3DU6A 2RKIB 1J5EF 3OW2R 2ZKUA 4DQRA 3JAMU 2LXFA 4LFAJ 2ZM6F 5CQGA 2R7SA 1MWQA 2BW2A 3IRXB 2DB1A 1Q7YT 3KJNB 3CJTA 4FXVA 1RT6B 1FKOB 2VQFJ 4KV8A 4N7TA 3CCTA 4LF7J 5HK4A 5THWA 2WK4A 1HBOB 2J9DE 4I68A 1FX2A 2PIIA 3PR5B 3M9MB 4LSNA 3IRWP 1R6YA 2CDQA 1G3OA 4M5GA 1EP4B 4TY8A 3R97A 1NKCA 9RUBA 2W9CB 2HURA 1IR1A 3GR1A 4NXMJ 4PRFA 4OV6A 5E7OB 3GV8B 4J5OA 2HNDA 3CJ5A 3SFGA 1B64A 3GJTB 4GKJJ 1WC3A 2IJFA 2DHSA 3BBFA 4M1KA 4DL5A 4RX6A 2FC9A 1WG4A 1TL5A 2R8KA 2OPQA 4CLFA 1NMEB 1VOMA 2DO0A 4WPAA 3TR5A 4LUBA 1SUQA 4LR9A 4M63A 3PW5A 2GMHA 4BWMA 1R0BG 4LRBA 1MMDA 1W26A 5ITHA 2D9OA 3DOMA 3FZBA 3U02A 4E8UA 2Y0SD 2VJUA 5I3UA 3GV7B 1R43A 2K2PA 4J37A 2AGOA 1VQ7S 3DLEB 3GU0A 5DDRC 1LXJA 2V94A 4IRCA 4F7VA 3GYNA 2HYIB 1TQLA 4MFBA 1QAXA 2QL9B 2H65B 2LA6A 3H7HB 1AUSL 2F9JA 3Q89A 3CD7A 1KC8T 1ZAVA 4A8MP 2VC0A 5HSPA 3D1HA 4KFBA 1T0TV 3OD2A 4ZCMA 3RB4A 4JI7F 3FFIB 3CCES 2AX1A 4DQQA 2DGVA 4WKYA 1Z1ZA 4IO1A 4CT8A 3ZTSA 4HDGA 4RUBA 4EYIB 5CH7B 2BJ3A 5DG9A 1LK5A 1UFKA 3B54A 1M5PC 5M2RA 4ECYA 4IG3B 5MLCV 5LSLA 2XY6A 1D8ZA 5KFWA 1BXNA 2YWFA 3EPGA 3MM9B 4NA1A 3T5JA 2YNHA 1S57A 1X4EA 4WKRA 1KQKA 3U1LA 5DDQC 2UXCF 2ASYA 2X1BA 1YIJS 4KGXB 5KT3A 1MN9A 2ZH2A 1T11A 1FD8A 3GV5B 2KJWA 4EBDA 1JLGA 4TY9A 5DS7A 3TVYA 1VFJA 1KQSR 3M8ZA 1QE1B 3BO3A 2E44A 1FXDA 4Y00A 3AAWB 3UW1A 3D1QA 1KFSA 2UVUA 1B7FA 1LFPA 1T95A 4JI0F 2QO3A 1BQMA 4TU7A 2E5LF 1B7YB 1V3ZA 4QOTA 3W1YC 5KG1A 1Q5VA 2QRRA 4ZP6A 4ZN3A 1SJFA 1JJ4A 3OTOJ 3PO4A 4YB5A 3R7NB 2W9BA 2PFDA 4YY3J 2KYXA 3J7AN 2FZCB 4X64J 2ZEJA 2UU9F 3ILIA 2BM1A 1X5OA 5EUHA 3AB2B 1LW2A 4DR4F 1XR5A 3BN7A 3T1HJ 3HSGA 3LANA 3Q8VA 3QBCA 2DITA 4WTOB 3TO8A 5G0RB 2FHOB 2MKYA 1TVRB 5LM7E 3K5NA 3V81B 4MTPA 2OFHX 1ZA1B 2R8HA 1CQNA 1D8YA 4H4OA 2FHKA 1N5TA 2MSSA 3H2LA 4I0WA 2CJQA 2ZD1B 3QYYA 3V4MA 4DZDA 5K8PA 1GK8A 2AJ0A 1PJ5A 4LF4J 3HKWA 2POKA 3EUNA 1UW4A 3A8IA 2HHVA 2DJWA 2KU7A 2K7JA 4DUYJ 2CZ4A 5B0BA 4H4KA 1HHTP 3OLBA 1VQSA 3OR2B 1OSDA 3KK2B 3W8GA 2HS0A 1C1BA 4E0DA 4WJBA 2HIYA 3NS5A 2L41A 2G2ZA 3KHRA 2M52A 5IZHA 2NCKL 1TMJA 1FFGB 1L3VA 2HAFA 2HBYB 2Z2YB 3MEGA 4O0NA 1TFWA 4PUOB 2W2QP 4C8NA 4QPXA 2MZQA 5BXIA 4B3MF 3T9ZA 1HNWF 3L7OA 4BBYA 3BR9A 2YX1A 3QSYB 4M5KA 2H48B 2VG6A 1CJTA 2OPPB 4DLGA 3UD3P 1RTDB 4ILMA 2KXFA 5D0RA 5SUHA 3EPIA 4K4UA 1SBRA 3H8YA 2LP4A 4J9NA 1KNZA 3LP1B 4MIAA 3JSMA 2A6OA 4PQUB 4IOCQ 3KHGA 2E1CA 1J27A 3N5FA 3HM9A 2A10A 5F9LA 2WSEC 4D3HA 4NCGA 1AFJA 2ZH1A 3I55S 2XNRA 2AV5A 5J2PA 1S48A 1I5OB 1N33F 3QJPA 4K0KJ 3ZZRA 2NPFA 4ZN1A 2P2CB 2K7KA 1KD1T 1FNMA 3F73A 3G82B 2XWXA 4N5SA 3DGPA 2QLBB 3PJXA 4OYIA 3MTKA 2DPIA 2E7WA 3T5LA 3HHEA 2ZC4A 3JB9k 3DKDA 4OFZA 3RBZA 4EO6A 2PT0A 4BC9A 2X3GA 4HACB 2QMWA 2ADCA 2DH8A 4F3OA 1LK7A 1UFLA 2HFSA 1UA0A 1KRPA 1FEHA 4EWTA 4HYKA 5T7LA 1T9UA 5ETTA 2WCXA 3FEYB 1RWPB 4MMOA 2VG5B 3QLHB 3LP0A 2GV1A 2B8QA 3C14B 2QLJB 3CCQS 2GJFA 2QYGA 3T41A 2VQEJ 4DV2J 5KT2A 5GMKa 4ID8A 2B5JA 1C0UB 3KOAA 1FKPB 5IT9Y 3NGDA 5L9NA 3Q83A 4ZJQA 2L08A 5AT1B 3JTOA 1FDBA 2IRXA 2KXHA 2ROPA 4LT6A 2DHGA 4NX9A 3UR0A 2GIQA 3BGRB 1HNVA 4I2PB 2NXCA 5DZ6A 1CULB 1FHTA 2C3MA 1YJ7A 4OYXA 3PV8A 4RW6B 1HYSB 2MKHA 2DT9A 4N77A 3H5UA 2XI3A 4LRDA 3JSBA 3K58A 4DHVA 4C8LA 4L72B 4EBEA 3LGMA 4ZDNA 2H54B 3D67A 1I94J 3EGZA 4DCPB 1X7VA 5C42B 2ZFHA 1IBCB 4W4MA 2NXEA 3N79A 2MMYA 1F60B 2IJRA 3MOJB 2LDYA 5KFUA 2J0QD 4HKQA 4FF4A 5D78A 5F8MA 1VJQA 4X4OA 5CCMA 1S9EA 1FJGF 5HMXA 3D0GE 1WTFA 4WFBQ 3TZZA 2HG4A 2QTWA 3TX8A 3HLUA 5CCLA 4TN2A 1K1QA 1U2CA 2F8MA 3WDOA 1OO0B 3SYZA 2MSTA 1M5KC 3KLHA 4JI1J 3VGVA 3TAMB 2V4RA 4ZKAA 4O3QA 4CLKA 1R8AA 4O3SA 3DU5A 3KUHA 3O3LA 2I5JB 1RTHA 3QMQA 2FD2A 2VFTA 1LW0B 2XY5A 1UEKA 2Y9HA 2LQBA 5KFNA 4OYPA 4NZ6A 1SH0A 4U8YA 2YQ0A 1FO1A 5HROA 1NHVA 1OY6A 4PXCA 4RUHA 3L9ZA 1RLCL 1WKKA 4F25A 3BBBA 1KVIA 1V3RA 3ZZTA 1U8SA 5HMWA 3GTYX 4PG5A 1XR6A 5DM7Q 1EIYB 5L1IA 3QIDA 1LXNA 3NL0A 2JEGA 2AF6A 3TUIC 1KOHA 3R2CJ 3PW0A 1ZZNA 2PSZA 2P6TA 4OX9F 5HO4A 2GAHC 1HKAA 2PMWA 1X8DA 2PGCA 4IQMA 3LPYA 2N7CA 1S1VA 4KJIA 1RT5B 1WELA 3IM8A 3VGSA 2V2ZA 3PXGa 3MAQA 5J2NA 2XS5A 2IY5B 3N0VA 2DYAA 3SSQA 2E5IA 3EGWB 5IM0A 2V9WA 5ETVA 1FERA 5GAHI 2R2UA 1PGZA 1VQ5S 1F6TA 2K3IA 1GEHA 4TKTA 3W66A 4A8XA 5KT5A 4DPYA 2DNQA 2Q43A 4F50A 3MM6A 2J6TA 3PFOA 2XLKA 1LWEB 2HFZA 2EWHA 4OX6A 3FCHA 5KFOA 4HEA9 4FF2A 2KT5A 4N76A 3ETOA 5B08A 4DWIA 1FK9B 4N56A 4DDFA 4KHPF 2GVDA 4O0IA 3NMAA 1JJCB 1HMVB 1WKLA 2QIFA 1LEOA 3OUYA 2VBWA 3KJVA 3FZ2A 3RG6A 2C2NA 2QA4G 2AJ1A 3QFWA 4DXLA 2W7PA 5LMUF 4QR1A 3G71S 3WX8A 3OXGA 1BWVA 2YTCA 4KH0B 2MZ1A 2JSXA 1WOPA 2MKJA 2XMJA 5A8RA 1U1RA 3W8PA 4USIA 2WVCA 4OV1A 2QE5A 1DAXA 4NI2A 2HHUA 2CG8A 2DHXA 2EG2A 2Y1IA 1GFWB 4USVA 1SI9A 1NJYA 2W01A 1N8RT 2DNRA 3MMCA 1ZM2A 3N01A 4P2MA 3CCSS 3CJKB 1LWCB 1S99A 3W9JA 1WI6A 3I31A 1NBEB 3R2DJ 1XEZA 1HR0F 1U02A 4KYZA 3I9ZA 2HFNA 4KY3A 2PFFB 3LH2S 1JJ2R 2R4FA 3VGUA 3H59A 3GONA 1IBKJ 4PEOA 4X2BA 4A47A 1SB6A 1IKWA 2J76E 2ZE2A 4I2QA 1IR2A 2AU0A 2OHDA 3PRDA 3RR7A 2QLXA 4KR0B 3FCWA 2FLOA 3QIPB 1D3WA 2GGPB 3ENQA 2AYBA 2BRLA 4WCEQ 3FBCA 2JL9A 1SH2A 2HWIA 4OZNA 2HHTA 3FBFA 1RT1B 4FNHA 3M9OB 4DN9A 2BOAA 1V3SA 4FN5A 2UP1A 1RAJA 4HVZA 4YHHF 4DR1F 2VDHA 3Q8RB 2Z57B 4WFYA 2FVSA 4UW2A 4WU3A 1UZHA 3RR8A 1RBOB 4URSA 2KG1A 1I6JA 2HHPA 4O4GA 4M8LA 3BKFA 2V5HG 2YNFB 3J7ZT 4KV8B 1U7LA 2DRBA 1Q8IA 1T8EA 4USUA 2GNKA 3CC2S 4IR1A 1GXTA 3RZAA 1WSRA 5KT6A 3Q22A 3NY0A 4ED1A 7FD1A 1Y5IB 2CQ3A 3KLEB 2YNGA 1DQ9A 3MUVP 2OEKA 3C16A 3HZEA 1GMVA 1S4EA 4IFYB 4DS4A 1QJHA 1E6VB 2G4BA 4WIQA 2CQHA 2UZAA 2E1RA 4C8OA 2CPZA 5D4PA 1ROFA 3D2WA 1R0AA 1B0TA 4P52A 3NEKA 4X4PA 1QTMA 2FC8A 4DL2A 3LO3A 1YRTA 3ADAC 1SKSA 1GTEA 2B3TB 4JUZA 4CO1A 3RBXA 4ETZA 2ZBQA 4DV6F 4PR6A 3DDIA 2CZ9A 2QX0A 4OYOA 2BBEA 3VAGA 4YDDB 3RAQA 1NRKA 2EFPA 4LFAF 3IC1A 4HT7A 2EVZA 3LUYA 1RWWB 4KB7A 5BYQA 3AOAA 1AT1B 2VQFF 4RLEA 4ZOSA 1TFYA 4LF7F 2LMIA 3PCOB 1T94A 1M5VC 2O01C 1N6QB 5A2QY 4U7UK 4KHRA 2KZMA 2LU2A 1K1SA 2ZUAA 2HKEA 3H4BA 4NXMF 5DETA 2AYGA 1FCAA 1SQGA 3DRSB 1AUDA 1Q82T 3RB6A 4GKJF 4C0HA 4NA3A 1VLYA 1NNDA 5KFTA 2XO7A 2LDIA 2VFSA 3CW2C 1F9FA 4KH1B 5AJ3J 2CKWA 5T14A 3QO9B 3MHYA 1YBAA 4CT9A 2YKPA 1T03A 2PEBA 3DN9A 3CWJA 1XIQA
chains in the Genus database with same CATH topology
4RUAA 5K14B 1NH7A 2CQCA 5B09A 1N56A 4DR6F 1KOOA 1IKVB 2NSCA 2XLIA 2O1PA 2FJBB 1X4DA 2FLNA 4C8KA 1RTHB 2QV6A 4WFAQ 4I64A 3DLGA 3C8YA 3GFHA 1LKZA 4DV4F 5CYQB 2UXCF 4K50A 3SCIE 1S77D 1W25A 1J2VA 3J7YU 2OO4A 4LVOP 2G0CA 5KFQA 2MGZB 2LEBA 5J1PA 3FFIA 1E6YB 4FBUA 2IMOA 3RTVA 2OPRB 4B9MA 2EK6A 4UQGA 4F26A 5HROB 3HHLA 3K5PA 1HQEB 3PO5A 2DHAA 3V4IB 4LFCF 1EETA 2RMLA 1RA6A 2IMWP 5AE2A 1JKHB 2Y1RI 3D54A 4IG3A 1U2FA 2BVZA 1DHMA 3C6UB 5DLFA 3O1LA 4TQSA 3V6DA 1L5UA 2IRUA 3W3SA 1RT2A 2DGWA 2JLGA 2XY7A 3W2WB 4F67A 3EYZA 3I6PA 1QLNA 2YKNA 1S10A 4ZPTR 2CQDA 3MM9A 1BQMB 3CCLS 4K4YA 2M2BA 2R2TA 5E0OA 2W25A 3DLKB 4MK9A 4A48A 3EZUA 1C0TA 2PC6A 2XULA 5F8LA 1VMBA 3TNVA 1KS2A 2HHXA 5LMNF 1Y7PA 3IXQA 4KKOB 2NR0A 1IKXB 2LEAA 1S97A 2ZNYA 3SQGA 3M6XA 2ZZNA 2J7WA 2IAJA 2O67A 1N4LA 3VZIA 1FVQA 2BJEA 5I3PA 4DS5A 2F3JA 1DFDA 3OVBA 4N41A 2ZDOA 3HVTB 1WHVA 2L48A 3S01A 1UJ5A 4PG7A 3DDNA 2KJVA 4ED0A 3OVSA 4IFVA 2E9TA 1KHVA 1R8PA 1VC6A 3QWPA 4DQIA 1KTVA 5EDWA 4DLEA 3E01B 1P1LA 4IOBA 4NLYA 2IYIA 2J5AA 2RNEA 1S1VB 4NCBA 2CPFA 1FESA 1Q78A 5K8MA 1RP5A 5DDPC 1F5AA 2XSFA 1FNOA 1P9QC 3O5TB 4PG4A 1Y5LB 3PM9A 4RW7B 3VAJA 2DD8S 1QE1A 1L3KA 3BZQA 3MD3A 4TXSA 5J2NB 4JV0A 4NXNF 1KONA 3MECA 4OZ5A 2XNQA 2JVRA 3IGVA 2ZNZA 4I7FB 5LXRA 3FQLA 3M05A 3CDBA 3SDEA 1HNIB 4PKDB 5C25A 1WEZA 4IUFA 3K8WA 5IM0B 2RF2B 3P6YC 1FRKA 1MWZA 4ERDA 2D1CA 1N48A 3NBPB 1RTIA 2PI4A 2KH9A 3SCKE 2B6AB 3CCJS 4B3SF 1QSLA 2ZJPQ 2RVJA 5KG6A 2FLLA 4CCHA 3NNHA 1SIWB 3G8SA 5CYJA 1SC6A 1ZH5A 4A8OA 2GHVC 3CTRA 2DVIA 1UL3A 3D0IE 1Q16B 3QAUA 4ZCIA 1X9WA 1JNZB 3GB0A 4DFPA 3OQ2A 4WTYA 3UDLA 1HW8A 3KNGA 3C66A 2ZKTA 3PDNA 2HMIA 4J9QA 1YGYA 3TA2A 1U6FA 1FE4A 1X0PA 2VFRA 3KLFB 2R7RA 2B51A 4O4RA 3BSCA 2XMWA 2DNOA 3QGPA 2M5YA 5KOWA 3E51A 5D4NA 3KLGA 2PO4A 3G96A 2ZH9A 2MQLA 2ZJRQ 1WEXA 4F4XA 2RD5C 3M1VB 1X4AA 3DOKB 2XMMA 5L1KA 2KB2A 3PJWA 1D9DA 1HBMA 2CPJA 3GIJA 4N8NA 5HLFB 2B4OA 5IWAF 3P3DA 1R89A 3PR4A 1RJJA 3GE9A 1LWFA 2CQ2A 1DTTB 1VIOA 4KBIA 4OX7A 4RBUA 5JVGQ 1DBDA 5D4LA 4FYDA 4OIXA 2R9LA 3OUYB 5G0RA 3CJ0A 4WE1B 3HO1A 3KJVB 1VQ4S 5D4OA 1KFDA 1TVRA 4MH8A 4RKUC 3AA9A 1GNKA 3V81A 4K4ZA 2H5EA 2SXLA 2KO1A 3DYAA 1U1MA 2ACYA 2YVSA 2NS1B 3OTOF 3CDAA 3GIKA 1JLAB 1S6QA 2R8JA 3MPYA 3O2IA 2VFUA 2N3LA 1C1BB 4YY3F 1TP7A 4X64F 2CJBA 1Q81T 3SMZA 2ZD1A 5C24A 5M2UA 4HLBA 4F3MA 2RQ4A 3MUTP 2IBOA 4BCAA 4EO8A 4B9NA 4NLSA 2YWEA 5A8RB 5FLXY 3MEDB 3CCRS 4CQ1A 5GAEI 2RRBA 3R5BA 3VTIA 3GZ7A 5DGBA 2V4JB 2YKAA 3MOZA 3T1HF 2BDPA 4JV2A 3IR6B 3NWGA 1FDAA 3BSOA 3MEGB 3V6HA 4F3QA 3DXBA 2VG7B 1R8HA 3BR8A 2UVRA 3GFYA 3I5CA 4RNFA 1IBMF 3JAMY 2I2YA 3EGNA 4A8QA 2N7YA 5GADU 3DRRB 1CEZA 2Z4PA 1U1LA 3OFFA 4Y2IA 2D74B 1D0EA 1H0HB 3BO2A 5K8NA 2U2FA 1S6PA 1S49A 2KG0A 4B3TF 4Q0BB 2ZVSA 4NA2A 5KTQA 4OZLA 4AE5A 3OHAA 2G13A 3DLBA 3DRYA 3OR2A 4OJGA 4C9DA 3KK2A 2B4PA 5GAHU 4NPOA 3GQCA 3LP2B 3MPVA 3CO9A 3QPIA 3R1LA 3N9UC 4MIWA 2LQJA 2ZJQQ 3WC0A 4MK7A 4PWDB 1TKTA 4E98A 3HVAA 1Y4ZB 1HWKA 4YR2A 1U48A 4YDXA 3AJ1A 3P49B 3VZHA 2KRBA 4LF4F 4EZ9A 3BDPA 3LAMA 3LW5C 3TAPA 4QYZJ 3GFZA 1FTCA 3M32A 3UNGC 4RNHA 5FD1A 4O44B 4OJHA 1NJIT 4H4MA 2YKOA 2HQ3A 2KT2A 2JLFA 4ID5B 2MY8A 4OHWA 5MAOA 2U1AA 4IQXA 4ZCKA 4A46A 1YSJA 1TK5A 2CQGA 2ZOFA 2E5HA 4OX8A 1RI7A 4X62F 1VBZA 3X3UA 2IM1A 3KMSA 4G1IA 4NLOA 4DUYF 4DV1F 3I56S 1JNRB 3NCRA 1BQNA 4QU6A 2DH9A 1RQ0A 1RTJA 1QAIA 2IVYA 2M0GB 2ZHBA 1DQ8A 4PUOA 5KFRA 2MQQA 3M30A 3PNIA 2VODA 4ETXA 1IJFB 3TANA 2BE2B 2GJ2A 3L7PA 5ADZA 1UEUA 3SV4A 3RW6A 1DTQB 5B0EA 1A7GE 2CQ0A 2QMXA 3HX9A 3KMQA 1IKWB 1SJ4P 2L3MA 2MDAA 2YWHA 4OZ0A 3Q8PB 2OPPA 2DH7A 1ZM4A 2ZE2B 1U1PA 4I2QB 4Q8EA 1Y3KA 4ED6A 3IAS9 1HD1A 5D3GA 2HGMA 3BB5A 2HQIA 1K73T 1RYRA 2HVIA 2K1RA 1S79A 3UFCX 4ELTA 4K5RA 2KHDA 2MQMA 1RTDA 1VK8A 2KM8B 5JVHQ 1HQUA 2JDJA 1SQEA 4R5PA 1RK8A 4LFBF 2OSQA 1L3UA 4QW9A 3DMJB 1H2VZ 5B0GA 2XB2D 2WBMA 3FRYA 5CHCB 4JV1A 3J81Y 2VD3A 1HBNB 1WHYA 2IM3A 3CJ3A 3DOLA 2HHSA 3ISZA 4BDPA 2BACA 2O3DA 3JYTA 1VQLS 1DQAA 1LV5A 2D3UA 1APSA 4FF1A 4IH7A 3MZIA 2CFXA 3IBWA 4OI3A 1JLFB 1YRUA 3ZZZA 3LP1A 4Y34A 2CPEA 1F5BA 4N8OA 3VAFA 3GFXA 5LJ5Y 4DFMA 1X5SA 4OQJA 2GX8A 2E5JA 1DLOA 1M5OC 3CULA 5FDLB 3OTCA 4LVNP 4C11A 2M4MA 4PQUA 4WXWA 2HNYA 4KC5A 2YKMA 1X4GA 2IVFB 4EBCA 2XSJB 4QBUA 4CH7A 3OL7A 4DG1A 3BJYA 1ZYQA 2NZ4A 5IS2A 5JXSA 2V9KA 2YNIA 3AA8A 3MEEB 5LJ3Y 2JH3A 1RT4B 4IO9Q 5AXNA 2ZBIA 3CJ2A 1N54B 2EFNA 1R8CA 1RKJA 4C8ZA 4LIRA 1RT7B 1Y0HA 1SKRA 2F1FA 3HVRA 1RT3A 1HBUB 4NZ7A 1BQXA 2YWKA 3SCLE 4O4GB 4C98A 4OMFG 4I56A 4RWWA 1JXEA 4CH0S 3I0SB 3NAHA 2B43A 4B9TA 2DGOA 1JK9B 1CPZA 5A8KB 2CJKA 1C1CB 2E1AA 4ZVHA 4YUDA 1HNXF 2M88A 3OR1B 1TKZB 4DR2F 5J1EA 5DO2A 3O6QA 4U7CA 3MM5A 4PCQA 1TL1A 3FSXA 5KFYA 1KVJA 1TV6B 4ECTA 2HLUA 3R3TA 4KTQA 1S1TA 2VPWB