2M70A

Structural determination of the citrus sinensis poly(a)-binding protein cspabp1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
155
structure length
155
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMGSDLEDMKKRLKEIEEEAGALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNIPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Poly(A)-binding protein 1
publication title Structural determination of the Citrus sinensis Poly(A)-Binding Protein CsPABP1
rcsb
source organism Citrus sinensis
total genus 24
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m70A01
1YITS 4QQBA 2DGWA 3S01A 4Y00A 4YB1P 2AYEA 1X4FA 1WHWA 2CPEA 2DHXA 2DHSA 2G4BA 5CYJA 3U1MA 1JMTA 2RQ4A 3JB9k 1H2UX 4ZKAA 2MXYA 2KM8C 2RQCA 2LYVA 1K8AT 4OZ0A 2KG1A 3G9CA 2E5IA 2MKKA 4TU7A 2MGZA 2HZCA 1P1TA 1K9MT 2D9PA 2LA6A 3CCES 1S72S 1R8PA 1U1RA 2XS2A 2L9WA 1VC5A 1WF2A 1U1OA 5H1SV 1ZH5A 2MZJA 3FEYB 4C7QA 2M88A 2KYXA 3MURP 1R8HA 1YIJS 4WCEQ 4PR6A 2F3JA 5JVGQ 2CQ4A 1VC0A 1WHXA 2KXFA 1UW4A 4IOCQ 1SJQA 3SMZA 2DNQA 4F25A 2RRAA 2DGTA 1WG5A 2DGXA 2ERRA 2RT3A 2CPIA 5EN1A 2BZ2A 4TU8A 1DZ5A 2M8DB 3LQVA 2VONA 2DNKA 3CCVS 2CQPA 3MD3A 2DGOA 3VF0B 1Q82T 2PEHA 3OW2R 3UD4P 2YTCA 2M70A 1VQ9S 1X5PA 2D9OA 2K3KA 3DXBA 2LEAA 1HA1A 2CQ3A 3S8SA 1VQMS 2LA4A 4C0OC 1VQ6S 2MY7A 1VC6A 1KOHA 5DM7Q 5DETA 3G8SA 4YOEA 2KG0A 2MQLA 2VOOA 1U2FA 2J0SD 5IFMA 4EGLA 2CQHA 3VAFA 2DNHA 4PRFA 1DRZA 3CCJS 3CMAS 2KHCA 1X4DA 3S6EA 1VQ8S 2M52A 3MOJB 3I56S 3CTRA 2G0CA 1U6BA 3B4DA 3PIPQ 2K8GA 2DIVA 3UE2A 2KRRA 4IOAQ 2DNPA 3B4MA 2J76E 5FJ4A 1DHMA 1SJ3P 1VBXA 3P5TL 2F9DA 3R27A 1X5SA 4M5DB 1UP1A 1H2TZ 5IM0A 1YTYA 2DH9A 5DDQC 2OSQA 1BY9A 2E44A 2DO0A 2DGVA 3US5A 2XS7A 2VODA 1OWXA 2GO9A 1WF1A 3THTA 1P27B 3SDEB 3MD1A 4WIIA 5IM0B 2CQDA 2XB2D 2ADBA 2CPJA 2MHNA 2DHGA 2CJKA 2CPZA 4LMZA 1FT8A 4QU7A 5LJ5Y 4PKDB 2J0QD 3CD6S 2KFYA 1M90T 2LXUA 1D8ZA 4C4WA 3H2VE 2M0GB 2MJNA 2A3JA 2LCWA 3CCQS 4LIRA 1YHQS 4W90B 2DNMA 3Q2SC 3CUNA 2DNNA 2MQOA 2E5HA 3CC4S 4BS2A 1VQOS 2N82B 3HI9A 1U1QA 2MKHA 1SJFA 2I38A 4V19X 5CXTA 2X1BA 4U67Q 3RW7A 5LXRA 3VAKA 3EGZA 1U1KA 4RU2A 3P49B 2CPFA 3VAIA 3NNCA 5HO4A 3TP2A 2DNRA 3N9UC 3G6ES 3P3DA 3CMES 1HD0A 1N88A 2ADCA 2OTJS 3CPWR 2MZ1A 3UCZP 1YJNS 3G4SS 3LPYA 1H6KX 3MDFA 1UFWA 2EK6A 2CQIA 2NLWA 3G96A 4OZ1A 2LMIA 2OIHA 2MY8A 2RRBA 3NNAA 1X5OA 4UQTA 1M5OC 1VQNS 3H2UB 1X4HA 3EGNA 3FEXB 3ZZYA 4F26A 1L3KA 4Y0FA 2E5JA 1FXLA 1QVGR 5BJRA 2MQMA 2MQQA 5GAGU 2DISA 2DNYA 5ITHA 3BO2A 4TLQA 2OTLS 4TU9A 1UAWA 2N3OA 2KH9A 1M5VC 2QFJA 3NNHA 2DH7A 3Q2TC 1WEZA 3S7RA 3UCGA 1KC8T 1WHVA 2DH8A 2JVOA 3BO3A 1A9NB 5MLCV 1Q86T 1X4CA 2QA4S 1FNXH 4IO9Q 2YH1A 2FY1A 2AYMA 2DK2A 2J8AA 5LSLA 4WFBQ 1RKJA 1YJWS 5DDRC 1HD1A 5D78A 3CCRS 1HL6A 3UCUP 3UD3P 2KXHA 2KI2A 4FXWA 3BEGB 3MI7X 1F9FA 1U6FA 2PE8A 3I55S 3VAGA 2RU3A 2UP1A 2EVZA 1JJ4A 1WHYA 2WBRA 5D77A 2MQPA 4WFNQ 3NS5A 2N7CA 2RUGA 2KVIA 1B7FA 4WF9Q 2MMYA 1OPIA 3K0JA 3SXLA 2M9KA 2CPDA 2BOPA 1WI8A 2M4MA 4CH1A 4LJMA 1XN9A 3SDEA 2JRSA 1U1LA 3R1HA 1OO0B 5GADU 1X4BA 2RNEA 1PGZA 5CA5A 2AYGA 1DBDA 5HL7Q 1ZZFA 1WEXA 2KT5A 2YWKA 3VAJA 1FJ7A 2X1GA 1W2BR 2M2BA 5GAEU 2NZ4A 2XSFA 3CCSS 4CQ1A 1QM9A 3ZZZA 3VAMA 2QEXS 3G71S 1QVFR 2DGUA 2XNRA 2RVJA 1S79A 2HGMA 2AYBA 1K73T 2DO4A 1U1MA 4Z2XA 2MQNA 1VQ4S 2MKSA 1O0PA 5LSOA 3J7ZT 1OIAA 1WG4A 2JVRA 1PO6A 2V94A 2KXNB 3R1LA 1G2EA 1IQTA 2MKCA 1YJ9S 4W92B 2CQGA 2B0GA 1JJ2R 2VOPA 2M8HA 1FO1A 2DNGA 3BO4A 2FC8A 2LECA 1KQSR 1WELA 4J5OA 1WTBA 3MUVP 2CQ2A 1WWHA 1KOOA 2YKAA 3G8TA 2F9JA 3CF5Q 1M5KC 2O3DA 5GVQA 1X4EA 3NMRA 1FHTA 1M5PC 4CIOA 2MKIA 2Q79A 2SXLA 3CC2S 5DM6Q 4WFAQ 2DIUA 1SJ4P 3BS9A 2CPHA 3MUMP 3CCMS 2U2FA 3CXCR 2ZJPQ 1YWXA 4ERDA 2YH0A 3HHNB 3TYTA 1WF0A 1H2VZ 2DGSA 2L41A 2X1AA 2FHOB 1KD1T 2CQBA 2MGZB 4ED5A 4P6QA 3TO8A 1YI2S 1NO8A 2MSSA 4YUDA 2XS5A 2CQ1A 2HGNA 1X4GA 2CPYA 2X1FA 4CH0S 1N54B 2JWNA 3P6YC 2MZQA 2FPHX 5IQQA 1ZZNA 4QPTA 2FC9A 1URNA 2LEBA 2GHPA 3PIOQ 5JVHQ 3DLLQ 1Q7YT 3IRWP 2OSRA 3ULHA 2ZJQQ 2M7SA 2KM8B 1M1KT 1FJEB 1VQKS 5GMKa 2RS2A 2AD9A 2MB0B 1VQPS 2N3LA 2DHAA 3VAHA 2G1DA 4UY8T 3MXHP 2DITA 2OJ3A 1SXLA 2L08A 4A8XA 4F02A 4QU6A 2KU7A 4FXVA 1NU4A 3EX7B 2U1AA 1FJCA 3U1LA 2MYFA 5LJ3Y 2HYIB 1D9AA 3L3CA 2MJUA 3CC7S 2XNQA 1N8RT 2DNOA 2LQ5A 3V4MA 5DDOC 1VQLS 2DNZA 3RW6A 1WEYA 2E5GA 3UWTA 5DDPC 1JJHA 3NS6A 1VBZA 2DGQA 1WI6A 2KRBA 3MUTP 3VALA 3D2WA 1RK8A 2CPXA 1SJRA 2MPUA 1U1PA 1N52B 2JX2A 3CULA 1X4AA 2MKJA 5GAHU 2EK1A 1CVJA 4WKRA 2CQ0A 1WG1A 2KN4A 3THPA 2RS8A 1U1NA 1AUDA 2HVZA 3CCLS 2CQCA 4IUFA 2DNLA 1Q81T 2MZRA 1A7GE 2ZJRQ 1VQ7S 1NJIT 3IWNC 2LKZA 2I2YA 2D3OR 3J7YU 2MZTA 2DB1A 2HGLA 1X0FA 1VQ5S 2LXIA 1VBYA 3CCUS 2MSTA 2MZSA 1X5TA 5LXYA
chains in the Genus database with same CATH superfamily
3LOUA 5CZVA 5J2QA 1X4FA 2KL8A 1BGXT 1T8EA 2UXCF 4AQYF 1X9MA 2J0XA 3DLKB 1FK9B 3ZZUA 1FRIA 5IQ6A 4OZ0A 4ZLJA 3PXGa 1WC3A 2CZVC 4NZ0A 3LW5C 4X66F 5KFBA 2IHR1 3HM9A 5D4NA 3OL7A 1YG0A 2L9WA 4X65J 1S0MA 4TYAA 5L9NA 1L5UA 1R8HA 3E51A 5KFHA 3SSRA 4LQ3A 3RU0A 3MM5B 2CQ4A 2DEIA 3L9ZA 2B8QA 3TVZA 3NOGA 4DS5A 2YX7A 5IOLA 2BEFA 4DV1J 3JTNA 4ECUA 3QSIA 3OR2B 3NMAA 4WYWA 5IT9U 1VQYA 4BBYA 3I5CA 4Q45A 4DSJA 5F8JA 1NPPA 5AJ3J 1RWOB 2M52A 4A4JA 2ZM6F 3TARA 3M8PB 1FNMA 2DIVA 1KFDA 1G7CB 3PR4A 3P4UB 4P74A 4RBUA 3UDEA 1T03B 4GC7A 1KBRA 4Y2CA 1W25A 4M5DB 5IM0A 4J9UE 3DM2B 1VMBA 3VHQA 2BJ9A 1FI4A 5J2MA 3ITHB 1XMBA 4QBUA 4WIIA 2G1HA 3I9ZA 3DGPA 2IFXA 1TKZB 2VJVA 4LMZA 4QU7A 1TK8A 2BE2B 1UZDA 2M0GB 2MJNA 5L9XA 3IXQA 5D6GA 3RR8A 3BN4A 2QN6B 4RNOA 2ALYB 3RW7A 3H90A 3VAKA 3FMBA 1B0TA 3OTOJ 3JQJA 1NBEB 1EP4A 1IBLJ 2EFPA 3TX0A 3ILJA 4EO6A 3UCZP 4DS4A 4X4UA 3V6HA 1AFJA 4CO2A 4ZPTR 1KVJA 1SIWB 1PKUA 4EZ6A 4P7TA 5A0YB 3KG4A 5BJRA 1NK0A 3JSMA 2DD8S 4FKXA 2RE1A 3LP1B 3Q2TC 3BBFA 1KC8T 1GMUA 4NLQA 3BGLA 1ZM2A 5K14A 2YWHA 1XTZA 4YB5A 4IRKA 2J8AA 3D6HB 4X4VA 4OX9J 1OMSA 2VPYB 3MI7X 2R2UA 4ZPWR 2VFTA 2C2OB 3ZTSA 2BACA 4ED0A 3W2VA 2ZH1A 4U8VA 4RWXA 4LT6A 5DRKA 2B6AB 2MHEA 2XEXA 4GKKF 1X4BA 3KLIB 3R2DJ 1DBDA 3WBZA 1Y00A 5FDLB 5HN0A 3JSYA 3VAJA 1HNWJ 1LQ9A 4FYYB 3ZZZA 2W4CA 2H3EB 4X62F 2HGMA 4I64A 5C25B 2FVQA 5RUBA 2XY7A 1P9YA 2YKNA 4AXJA 2B4PA 1NDCA 1S1UA 3W2WA 1SUQA 5HBMB 3IM8A 1K1QA 3O44A 3CW2C 2YQ0A 1K0TA 1F60B 2DIUA 3JXOA 2BJ1A 1UJ6A 1VIXA 3OXGA 4J37A 4P6QA 3UR3C 2GVDA 2ALZA 2GC8A 1X4GA 2VG6A 3GONA 4P75A 2JWNA 4W98A 2HRYA 5KG0A 2ZH4A 1UW9A 2I6WA 2LEBA 2VICA 3V81B 5JMNA 4LF8F 3A8IA 3BPSP 4DXLA 2ZHAA 1MROA 1RT1A 3RBEA 1FF2A 2OKQA 2BJ7A 2FD2A 1N33J 1JLBA 2ZDOA 5I3PA 2MJUA 3OSPA 4WXOA 4QYZK 2Y1LB 3TOQA 5H9EK 3UWTA 3FUYA 4PG6A 2XLIA 5KT5A 2DGQA 3FRZA 1B0PA 4L74A 1HHQA 4FYXB 5B0AA 2OEJA 2MKJA 4RWWA 4Q0BB 2CJAA 3FCVA 1AUDA 5I42A 2VQFJ 1HYSA 2DNLA 3L7UA 2I2YA 2H54B 1SB6A 2HGLA 3KJVB 1VQ5S 1IUJA 2XMAA 1V3SA 3CVKA 2IA0A 1NSAA 1WHWA 2OD6A 1NKEA 5CYJA 3UN2A 4DV6F 2MXYA 1VR6A 2HG4A 3PO4A 3GYXB 4USVA 1IR0A 1P1TA 4F4ZA 1BXNA 2D9PA 2B8PA 2IBKA 4I69A 4YN3B 1MN9A 4KBIA 4M5LA 2XS2A 4USJC 1S99A 1VC5A 1FDDA 2OMLA 1CSJA 2BOAA 3PV8A 4ZPCA 1QAYA 2J7WA 2YXLA 3MCNA 1O5JA 4E0DA 3VVUA 2CJYB 5EN1A 1R31A 1BD6A 3W9HA 3M05A 4OX7A 3D3CJ 1DQ8A 2CQ3A 1T0TV 2LA4A 4JI5F 4O0IA 5SUHA 4DN0A 2DNHA 2PA3A 1RAIB 4PCQA 5JUMA 3GR0A 3QFWA 4WE1B 3EZOA 1UFLA 4ECZA 5FJ4A 4ZIVA 3MM9A 4N8OA 4ILRA 1TFYA 2NXUA 2PC6A 1LKZA 1YZ6A 3BKTA 4LF9J 5EX3A 3KHLA 3GFHA 3T9NA 2CDQA 3MFIA 1AZSB 1P27B 3RRGA 4UZCA 1RTZA 5IM0B 1CJUA 1NM2A 3M9OB 2KFYA 4J9NA 1JX4A 1M90T 1GT8A 2G0IA 3D7SB 3H2VE 4LFBJ 1PCAA 1ITPA 2YNIA 2OHDA 3NG8A 2DNNA 3BQ1A 1N6QA 2CUYA 3H42A 5BXIA 3QGPA 4IFVA 2PD1A 3I0RA 2BM1A 1S97A 1WC0A 3OLAA 1PAUB 4NRUA 3LPYA 1EP4B 4Y2MA 5F0UA 4LREA 2V6AA 4L3KA 4M5MA 1I1GA 2AJQA 3RAQA 4L76A 3DMJB 4FYVB 5CZXA 9RUBA 2LP4A 1WSVA 4CO0A 2GS8A 2COLA 2V8PA 4WTOB 4FZVA 1ELOA 3N5BA 2JVOA 4OIXA 2VF3A 3HJVA 4J9PA 4A8QA 2VJUA 2HHQA 1S48A 3DLGB 2HNZB 1FNXH 1RT7B 1WD6A 4NLPA 3MR2A 4R25A 2FYXA 2APOA 3UCUP 3HK2A 3DFEA 2NPFA 3IBWA 1DLOA 4PPZA 3OL6A 4GO5X 3CDAA 5AE1A 4WFNQ 2MMYA 4PG5A 3FFIA 3IGVA 3CMQA 2CPDA 1KR4A 4NYZA 3IN5A 2XG8A 1NDLA 2JRSA 1U1LA 1OO0B 5ETRA 4CM0A 3RRKA 1U0HA 3NY0A 4NYPA 2AIRB 4K4XA 1E6YA 2YWFA 2J9DE 4F8RA 4NEYA 3KJFB 5A6WA 1QM9A 3C16A 3J81U 3OVAA 2H1YA 4FXDA 1RTHB 3TI0A 4EMDA 3FCWA 2Z2LA 4E8UA 1NXIA 1HMVB 1LW2B 2VV5A 1RKIA 5ETQA 4YDDB 3KNGA 2AJ1A 1RAJA 2WSCC 3TWZA 1KQSR 4N41A 2FJEB 3W2WB 2HHVA 1SUQB 3V6KA 1R6VA 1FX4A 3CC2S 3R5BA 1F5CA 2RF2A 3CCMS 1T05A 1IKVA 5B0BA 4CTAB 1YWXA 1JJCB 1H2VZ 5ADZA 3TO8A 2HHSA 3Q24A 3J7AN 1KSPA 3CWJA 3H25A 4ZPAA 1YJ7A 2BANA 4ZA1A 3DLLQ 4ECWA 3QLHB 1MMNA 1S1XA 2C2ZB 4BLGA 3DOMA 3GJTB 5KFNA 3OHAA 1MROB 2OPQB 5LSRA 3IAM9 2ZD1A 3D28A 3ZTPA 1VQLS 3R7SB 1WEYA 1TUGB 1RA6A 2AZ1A 3BPDA 1BQNA 4JI3J 4PAAA 2W4DA 3H59A 4WFZA 2BQRA 3OJSA 2RRNA 2XLJA 4ZVOB 2E1RA 3KLFA 2RS8A 1HWKA 4NLRA 3AOCA 1S5ZA 3ILLA 1NSPA 1S1TB 4KO0B 1X0FA 4C0BA 3DN9A 3G6YA 3T6BA 1BQMB 4CNZA 2KB2A 1X5TA 3BH6B 1RTJA 1C4AA 2CNNB 4LFCF 1Y5LB 5KFGA 1UVJA 2QIFA 1IQZA 5AE2A 1U8WA 1H2UX 4NLSA 2IC3A 3P96A 4C11A 3G9CA 2MQ8A 1NMEB 4G6VB 1QD1A 1RT4A 5BYSA 1NK7A 2YWGA 4ZLPA 4BC7A 2M88A 5KFDA 1ROFA 4ATNA 4I2PB 1NAQA 2KXFA 2DT9A 2HHXA 1UW4A 1LOUA 2QGFB 3OR1A 1S1VA 3Q89A 3GTYX 2YWWA 2VONA 2DGOA 2PEHA 4TNOA 2KHDA 4CLPA 3RTVA 1KOHA 2YNFA 5DETA 2AX0A 4X65F 4PRFA 5D0EA 3RRHA 5JJBA 1U8SA 2EFNA 3PJWA 3V6DA 3L95X 5EX0A 3QGHA 3J7Z5 3K59A 1IKWA 1TU0B 4B02A 2ZBQA 4UF4A 4JB8B 1U25A 4X4RA 3OUYA 4QW9A 1VBXA 4N8NA 1RB0A 5ETLA 1RTIA 2FJAB 4DV1F 1IBKJ 3N6LA 1SC3B 2DGVA 1NDPA 2QE5A 1OWXA 1CULA 1X9SA 2NYHA 2CQDA 4LRDA 1FWKA 3IS9A 2IVFB 5AJ3F 2LXUA 3DLJA 3VV2B 4JI2J 1BQXA 4I0WA 2N82B 3MM7A 3WDOA 5CXTA 2X1BA 4GVLA 2DHHA 3D4JA 4UOCA 3WHIA 2J7KA 3N9UC 4KAIA 2C3OA 1F9HA 3QWUA 3EPIA 4ZN3A 4ZP7A 1Q8LA 2F8HA 4LF4J 2NLWA 4P10A 1RABB 3GJSB 1GXTA 1CPZA 2ACMA 2WVCA 4F4YA 4F26A 2KJVA 1QE1A 3MPYA 4MAKA 1QAIA 1E6VB 3CJKB 4B3TJ 2E1MC 2HWHA 4C3LA 3OVBA 1B70B 4K59A 5DLGA 2PI4A 3DI6A 2VB6A 4KT0C 5KT2A 3OTOF 3MOZA 3QT6A 2HS3A 1IBLF 4B3OB 4ZITA 3D5MA 5DDRC 3FVYA 1EIYB 4FKYA 2PE8A 2UP1A 3IP0A 3PFOA 4J9MA 5CAAA 2ZVIA 2XWXA 7AT1B 5C7PA 1ZM3A 4EEYA 2ZHOA 4K5RA 1Q5VA 1H74A 1ZPVA 2CAJA 3FFIB 2V2VA 2L3MA 5IV3A 1VK8A 3PX0A 4OX9F 2CADA 1QVFR 4DR6J 3M32A 3AD9C 2MQNA 1O0PA 2ZWOA 3J7ZT 3H8YA 4WWSA 3UNYA 2WSFC 4QZVB 2V94A 2KXNB 3I6PA 3K17A 2Y1IA 3WX8A 2CNLB 1LWEA 3UW1A 4K4UA 1WOOA 1TUVA 2F63A 2F65A 1WTBA 4FBTA 4DL3A 2W2OP 1R7IA 3I5AA 1HNWF 1JIHA 4K2JA 4GKJJ 2LU2A 3NEKA 3LAKA 2JL9A 5M2PA 2DRDA 4Q44A 2O01C 4MK7A 2CQ1A 1NZ8A 4TN2A 2FPHX 1SJ1A 5T41A 1V6HA 2OSRA 1FJEB 4OJ1A 2MB0B 2N3LA 2ASDA 3MXHP 2MLXA 3FBBA 5B08A 1RT5A 2GMLA 1FJCA 5I3QA 3AH6A 3L3CA 4FS1A 3GG0A 3I87A 3F0NA 3NS6A 3A3OB 3ENQA 2ZH3A 2Y1RI 3QQCD 2JX2A 3KNAA 3O6QA 2IMOA 2ZE2B 4OI2A 5GAHU 2XSJA 1F1BB 3A8EA 4K4VA 2MEWA 2CG8A 4RZRA 2D3OR 1N33F 3KLFB 2ZITA 5T14A 4AL6A 4P2MA 3ZZTA 1TL3B 1G1XA 4Q2LA 4I67A 3Q8PB 5A76A 1F2GA 4ZLLA 5F8HA 4GVBA 3K57A 4ZKAA 3R97A 1FX2A 2Q1LA 1RTJB 4DJBA 2RAQA 3C6UB 4ZDNA 1XNRJ 4ZVHA 3TA2A 1R8PA 2VQFF 3DLEB 3LUYA 1SKWA 2W9CA 2PEBA 3Q0AA 3C14B 2B4UA 1V3ZA 2QMWA 2DNQA 1QUVA 4PG7A 6FD1A 4LR7A 1N34J 2K7KA 4RBVA 4CT8A 2RKIA 3OW2R 5KT7A 1X5PA 2E5LJ 1B0VA 4ED6A 1VQMS 3OFGA 3G82A 3NCQA 3D6FB 1Q7LB 2HBZB 1JLEB 2ZH9A 2W8LA 4QCLA 3M2VA 1ZTTA 1S0VA 3CTRA 4PWDB 2YNFB 5KFUA 1I6JA 4OYXA 4FPIA 1S0OA 1KWMA 3LGHA 3TX8A 4DU7A 2Y0BB 2AX1A 2GFFA 1YTYA 1O8BA 1UJ5A 2K1RB 2RQMA 3PDNA 2OELA 2ROGA 4PKDB 3DRPA 5L1LA 3TR5A 2W7OA 1YJVA 2CKWA 1OJ4A 3MMAB 2QV6A 2ZOFA 5I3UB 4LR8A 3D1QA 4Y6IA 3CC4S 5HMXA 2WVEA 1VQOS 1NHUA 3HVTA 1RXOB 2HFOA 3Q83A 1FEEA 1WKJA 1JNZB 3MM8A 4LF9F 3MM7B 3P3DA 3DU5A 2FTRA 3KTQA 1UFWA 4OV1A 4RU9A 3KJQB 3GIKA 2CZ9A 4UQTA 3H2UB 1TUWA 3NCRA 3ZC4A 4LSNA 5ETKA 4OMFG 2OD4A 4LFBF 5GAGU 2GIRA 2CNKB 4L3NA 5JXSA 4MK9A 1ZYQA 2E9ZA 2WOMB 3IRXA 1QE1B 3D0GE 3IG1B 3LP0B 1S6QB 2WB1D 2GX8A 4H54A 4DSLA 2DK2A 3N6MA 3KYLA 3QT7A 2R7UA 2FLNA 5HAOA 4HHHA 5HROB 2EVZA 1JK9B 2R7XA 5D77A 2O66A 2V69A 3PR5B 1MMLA 1HIYA 2HK2A 4H4MA 2QO3A 2M4MA 2R7WA 1TMMA 4KHMA 3EE3A 3TZXA 1VRTB 3VGVA 1FJ7A 1RAEB 4JUZA 1U1MA 1VQ4S 3T6JA 2EEYA 3BDPA 1NCLA 2J0WA 5IT0A 1G2EA 1U48A 1TKDA 4QYZJ 2CQGA 4NMXA 1YJUA 2DCUB 2BW7A 1NUEA 5CH7B 2VA2A 1G4CA 2YKAA 3CF5Q 2AEFA 3OXLA 1HNIB 4CIOA 4FPRA 4ZVRB 1IBMJ 3KK3B 4K4WA 2GAGC 1S12A 1UPPA 1WNEA 2EW9A 3DKDA 3HSGA 4G3IA 2MGZB 5CYQB 1YI2S 3ICLA 4TXSA 1CQMA 1IKXA 4KTQA 1FA0A 4CDIA 1TL7B 2ROEA 2ZH8A 5KFAA 1IWGA 1QUPA 3W63A 5GMDA 1VK3A 3QO9B 2PMZD 2XMTA 2ZZTA 1FKPA 1KQGB 1YZ7A 2L08A 1G6BA 4A8XA 4NLTA 2EC0A 5CYMB 4K0KJ 2FB0A 2MYFA 2ZUGA 4WJBA 1N8RT 4DZ6A 1M1HA 2YX1A 2DNZA 3RW6A 4IYQA 4C48A 1ZA1B 4F4XA 4NI2B 4DPUA 3D2WA 1RK8A 4ZVQB 2HZVA 3NBPA 3DDIA 3EXCX 1HNVB 3W64A 5HVGA 1R0CB 2DPJA 2ZH5A 1WG1A 3V4IB 3CNQP 5DLFA 4ZVUB 3MMJA 1A7GE 5E33A 3NOCA 3R8YA 1IJEB 4MTPA 3I31A 3R5CA 1ACMB 1JLAB 1YVFA 4YB1P 5C42B 2DHSA 1I5OB 3HVWA 3U1MA 3OJUA 1LK5A 4TY8A 1QY7A 4JI3F 2Y3YA 2HBRB 2ZC3A 1FFGB 4F4KA 2BKPA 4OQJA 5KFKA 3W8GA 3QAUA 3CCES 3MAAB 2NXJA 4DPOA 4KB7A 1FCAA 2HRTA 1QDUB 1NPKA 3LANA 4LF2A 2RRAA 2R3VA 2AJFE 4HT5A 3DXSX 3O5TB 5CABA 5AT1B 2ZEJA 2M8DB 3DOLB 4Q7AA 1SBRA 5C24A 3M8SA 2DJWA 2B9YA 2K3KA 3GJRB 2QA1A 4CWBA 3IR5B 4J9OA 3GQCA 4OI0A 3CJ5A 3B6BA 2KG0A 5AE3A 2J0SD 4EGLA 3MZIA 2DR5A 2CJBA 1SV5B 4LFAJ 2R7OA 3W9JA 2UVWA 4ZN1A 3Q8YA 3PIPQ 2CIMA 4DFJA 1HW8A 3NP5A 1YQHA 3SQGB 2GVZB 3KG1A 4UOHA 1REVB 2QL7B 1YJRA 3MMCB 4RUBA 4ZCIA 2LQBA 3OXFA 3ZXWA 3KLEB 3SBMA 5L1JA 1Q8KA 2XB2D 2HFUA 3D67A 3S1TA 3BBCA 1AT1B 2QMXA 4IRCA 1YX2A 4OYPA 2LCWA 4DF8A 2DNMA 2QLJB 2ZUAA 3DRPB 4OLPA 3W5YA 1OY8A 3NGTA 4M5GA 3EGZA 1U1KA 3CJRA 3UVJB 4TQRA 3CGIA 1IBKF 1FKAF 1RISA 3G4SS 2FGCA 2XYPB 2MY8A 4DLEA 3PW5A 4NE9C 4NRTA 1EKRA 4DMZA 3ETOA 3K5LA 1SH2A 2QX0A 2QRRA 1S6PA 3EGNA 4KGVB 8ATCB 5M2RA 4O3OA 4JI2F 2XYHB 4LSNB 4K2XA 4OZLA 4DDFA 5G4DA 4I2QA 2DH8A 4N47A 3LGMA 3A8JA 2IM0A 3IRXB 2ZH2A 4DL2A 3UN5A 5M2UA 4NLVA 1HL6A 3B54A 4LF4F 2KI2A 3T1YJ 1PC5A 1DQAA 3PCOB 4I6AA 2G2ZA 2G2OA 1HBUA 3ET6A 2C3YA 3AD7C 1N48A 4B3TF 2Z0GA 2LDYA 1WI8A 5IT4A 4CH1A 4TLRA 5GADU 3HKWA 3E2EA 2P8IA 1SH3A 5K8PA 4DQRA 1LWFA 4NEZA 2NUHA 4HH0A 5D4OA 3HHEA 1U2RA 4MH8A 3G71S 5HMZA 2RVJA 1S79A 2DO4A 3HZGA 4Z2XA 1HBMA 5HJXA 1Y5NB 1PG5B 4HDGA 2IVYA 4CYUB 5B0FA 2DPIA 1WG4A 3BGRB 1VBKA 2C2RA 1RADB 3HULA 4UUWA 1Q8IA 1CQNA 2V2ZA 3M8RA 4ES1A 2X7IA 4B9MA 3DRSB 3MMBB 1KOOA 1FHTA 3GV5B 2I5JB 3C19A 3RB0A 2ZZMA 1RE1B 1HPZA 3KDOA 2UUBJ 4DR6F 3BSOA 2L41A 3H5XA 4MFBA 1T3NA 4M5HA 4ENOA 2HQCA 4IOBA 3FSYA 2E29A 3AT1B 1DARA 3CCWA 5F8NA 3JSBA 1URNA 5JVHQ 4PG8A 2YNGB 1TL1A 3N4WA 2I0XA 2KM8B 1H73A 3HX9A 3CDUA 1Q79A 1WDTA 2DITA 4AL5A 2WONA 3UD5A 5G0RA 1X8DA 4KKOB 4WBFA 5E3CA 3BF4A 3JQKA 3QPIA 4ANDA 4Q43A 4ECTA 3MEEB 3GWCA 2QLFB 1NPRA 4OI4A 4K4SA 3MR3A 1TMJA 4HACA 2FQQB 3CDBA 2OO4A 3T5KA 5HMWA 1JKHA 2HVEA 3QAEA 2CWXA 3N01A 5L39A 3H40A 4HHJA 5KFMA 1VBYA 3NGSA 4ED8A 2W9AA 1T3OA 4QQBA 1KLMB 4Y00A 2P2CB 3P5BP 2RQ4A 1VDHA 5J2NB 2BBEA 3KK2B 1GX6A 3PW2A 2C2DA 1S59A 2KKHA 4EBDA 5KOXA 2Y0SD 4NX9A 1HLWA 3BYRA 3WC0A 4DN9A 4PQUA 1SJQA 3QIPA 3H20A 4JYAJ 2W7PA 3R9LA 2BZ2A 5IC4B 4B9LA 4ZVSB 4I56A 1PYTA 1EAYC 1BHNA 1OY6A 1XNRF 2JEJA 3Q8RB 4FNIA 4FYWB 2VBYA 2B7BB 4HDHA 3OFFA 1DTQB 3OFHA 5DM7Q 1MW7A 4OYBA 2KHCA 1X4DA 4H4OB 2EG1A 2R9LA 1C0TA 1PIEA 2HQFA 4IOAQ 2J76E 2V8GA 4FDFA 5A8KA 4R5PA 1N34F 4ICLA 3KMQA 2A2DA 1D1UA 5HANA 2CXEA 2W2MP 4O3RA 3CD0A 5KG7A 1UP1A 2EFGA 3IM9A 1KTVA 2E5LF 4XDCA 2BE9B 4LRAA 5E0OA 1D3WA 3SDEB 1FT8A 1RBLA 1PBUA 3C66A 2F40A 2A3JA 4U7CA 2BABA 4OZJA 4ZOSA 3AXKA 4ALZA 2B3TB 4BS2A 4DPXA 4DCOB 2NYIA 2XHCA 3P49B 3CB4A 4MIWA 2YKQA 3TP2A 2DNRA 2IAJB 4LRCA 1KRPA 2YX4A 5HP1A 1YJTA 1HD0A 4JBCA 3QRPA 2BA9A 2ZHBA 4QWBA 4CM2A 2V4JA 5ETNA 2J6UA 3D54A 1VQNS 1FXRA 1HARA 1A6LA 3DC2A 3ZNJ1 2E5JA 1CS4B 3ZZPA 1FXLA 4RW8B 2JFDA 3VVTA 5ITHA 4C3MA 4X64J 1WHVA 2NSBA 4OHVA 4XDDA 1DQ9A 4DSKA 2R4FA 1XWLA 2W25A 4DV0J 1SVDA 2YH1A 4EBEA 1HHSA 3UR0A 3ENVA 1F5AA 5D4PA 4F7VA 2HMIB 1D09B 1VCTA 2Z8QA 3G6XA 4ZP9A 2BYCA 3IFEA 2UV8G 3PM9A 3UQSA 2Y1JA 2K3IA 4EYHB 1RBOB 1RWKB 2Q43A 2C28A 1IVZA 3W8PA 1FVQA 2YKMB 4JI7J 2ABYA 1SL0A 2Y8WA 5DO2A 1RHJB 1PGZA 5CA5A 4WYLA 2O67A 4RW9A 1NSQA 4C97A 4ELVA 2IM2A 3GJQB 1J2VA 2RJZA 2JHEA 2HLTA 5DS7A 5F8GA 3EWGA 1S9FA 2QSFA 3FJ2A 2W01A 1HBMB 3MEDA 1YJ9S 4W92B 4IDKA 3BGOP 3HHLC 2QA4G 3BM7A 1JLGA 2BVZA 5GVQA 1B99A 4IR9A 1FD8A 1R0AA 2OMOA 2KZZA 3NWRA 4X4OA 1NK4A 4USUA 3JS9A 3HHKA 4RNMA 3NGUA 5CQGA 2H9ZA 4MKAA 1WF0A 4URSA 3HHLA 1HPZB 1UL3A 4DFPA 2PFFB 2XMUA 1YBAA 2EBGA 4M63A 1HQEB 1U0SA 2E7XA 1N5VA 2NXNA 3D0IE 2D7SA 4C8NA 3TUZC 2EC2A 1CJTB 4MKVA 4UOGA 3FRYA 1Q7YT 2QLXA 1RWWB 4OLOA 1ZM9A 3BQ0A 3IBFB 1RTDB 3QRRA 1D0EA 1IBMF 2OPRA 2L48A 2QC3A 3OPKA 1J27A 3CC7S 1S1WB 4CO5A 1ZM4A 4XK8C 5DDOC 4DX8H 1P9QC 4WFXA 2OUGA 2Z57B 3LH2S 4MJKA 1JLFA 3DHXA 3FGVA 2Z2YB 1RT2A 1N52B 3UI3A 5AXNA 2C2MB 1NHVA 1EJ7L 2EWHA 2GHVC 5E3RA 4CP5A 4K0KF 2OEMA 2AYEA 3M2RA 4DHVA 3U27A 1S7IA 4PXDA 1ICEB 3GSIA 1X7VA 1XR7A 5BYRA 8RUCA 2MKKA 3C6TA 1RZMA 2AEMA 1F9EB 2XO6A 1U1OA 5EUHA 2DXEA 3CO0P 2NCKL 3MEGA 3EXYA 1EHWA 3HT0A 1X31C 3MM6B 5EWEA 2EBEA 1WG5A 4HR2A 1CJKA 5KFQA 3SFUA 2KZMA 4WU2A 4OZ5A 5A6PA 5D15A 4G1PA 5GMEA 1RHUB 4C0OC 4OZ2A 4KV8A 3CMAS 2XGPA 2L9NA 5HLFA 3MOJB 3WIVA 2FVRA 1LNQA 2VUGA 1N5YA 4Q8FA 1S4EA 2E66A 3K58A 2OPSB 4DR3J 1DHMA 4QJVA 1SJ3P 3EDRB 2AP6A 2KTQA 5DDQC 5A8KB 2ZDPA 2LDIA 1IM4A 1QTNB 3ZFVA 2DRAA 3QFHA 4DV7J 2CPJA 2DR6A 2HFZA 1B4SA 3M1VA 4NZ6A 1L3VA 3GIMA 4LFAF 3G8QA 4J9LA 1Y3JA 4O44B 4ED1A 9ATCB 1UWBA 1VRUB 3AOAA 2LLZA 5HMYA 2RQKA 3PHTA 1F6TA 2W7AA 4M1KA 3T5JA 5ETTA 3VAIA 4DZDA 3E01A 1ZPWX 2JH3A 2BM0A 4ETZA 3CPWR 1TR0A 1VS3A 1HWJA 3MDFA 4KRWA 3BREA 3I96A 3UNGC 2KDOA 2BE7D 2YNHB 4JOUA 2V4JB 4ID5A 4ZP6A 4DSEA 1M5VC 2QFJA 2VG5B 4YMEA 5LMUJ 2NXEA 1NEEA 4PZVA 2C3PA 1FDBA 4NCGB 1L3UA 3T5LA 4WFBQ 1YJWS 2YKOA 2ILZA 2I1RA 5HSPA 4J90A 4FXWA 5FD1A 3DOKA 1ZOTA 3IWXA 5KFSA 2MQPA 4P9SA 1KDNA 2C2KB 3QGIA 4L75A 4QWEA 2HS0A 2RNEA 4YP3A 2IRUA 2XMJA 2QFIA 3UO0A 2XBPA 4ZJQA 2A0FB 2KT5A 2A6MA 4LBIA 4RW7A 4JI1J 2OGUA 1K73T 4DUZJ 2RHSB 3T1YF 5LSOA 4YB7A 3SV3A 3DRRA 1OIAA 2JVRA 1U47A 2Q6CA 3DYAA 2CJ9A 1J5EJ 1IKYA 3RG6A 4ED2A 2P9GA 1T9VA 5CD4H 4ILMA 2ZKTA 1SL2A 4FF1A 1RSCA 1FDNA 2XZTB 5EWGA 5DM6Q 2P6SA 3MUMP 2H5IB 2E7VA 5SZTA 4DV4J 1WC1A 2WCXA 4E98A 4OHWA 2X1AA 2FHOB 4ED5A 1BE4A 2X1FA 3CJ4A 5L46A 4JI6J 3P6YC 2W2QP 4LSZB 5IQQA 5J1EB 1ZZNA 2YVSA 4QPTA 4MKBA 3FCHA 4EBCA 1MN7A 3GMGA 1B64A 1Z2LA 3TAMB 2VL1A 4Y34A 2CVIA 2KU7A 4X4PA 1JLCB 5GAHI 1RYSA 2UUBF 2YBVA 3EM1A 2NQPA 2UVVA 3JAMY 1LW0B 2OPRB 3V4MA 4OYOA 4QIWD 2E5GA 5DDPC 2L9DA 2KRBA 3VALA 1JXLA 4RW4B 5HQMA 4CZCA 4IFYB 3K89A 2B9EA 4LQ9A 2IDEA 4DPTA 4CLUA 1IBCB 1J5OA 4WP9A 4KY3A 4CO1A 2LXIA 3NRBA 2RUSA 4X84A 1Z2ZA 4MIAA 3MPWA 4L72B 2KT3A 4R0EA 3CD5A 1CEZA 2B5JB 2OFGX 1FRMA 3PACA 1S72S 1GXUA 3CJ3A 2KFNA 1MU2B 2V2KA 1WJ9A 3LWLA 2KFZA 1W7WA 2XMVA 4WTYA 2QLWA 3BSCA 4DR5J 2CJQA 1TVRA 2V50A 1NJWA 1LWCA 3H4BA 2IJRA 2AT1B 2CPIA 3H5SA 4WPAA 4OYWA 1DZ5A 3IO1A 3M2UA 2XTJP 3SQOP 2HHTA 1LFWA 3PW0A 3QZ8A 1NJYA 3QBCA 4A8KA 3UFCX 1U4BA 4XPCA 2EFQA 1KKHA 1SC4B 3SI8A 3VAFA 2CNOB 5B0DA 2DTJA 4LSLB 1C0UA 2PMHA 5T7LB 2GGPA 1HI0P 1RT3B 2VKZG 3MECA 1AFIA 4JYAF 1KEKA 3D66A 2VG7A 4UTGA 1K47A 3PYDA 1X5SA 3OFEA 1FFSB 1KFSA 3QZ7A 3RR7A 1H2TZ 4DQPA 2HNYA 1KS2A 2HKEA 2HW3A 3VGSA 1Y10A 4USTA 3LP2A 1P1LA 3THTA 2AZ3A 2HWTA 1RHKB 1CJVB 4FVMA 2JDJA 4QIEA 1D8ZA 2XO7A 4HTJA 4B3MJ 4ZCKA 2FLPA 1TKTA 4RLEA 5D3GB 4ZP8A 3KK1A 5DQIA 5B0GA 4RW6A 5E3AA 4NASA 3A3PB 5GAGI 3AQPA 3HFKA 2BKOA 4AFFA 2QL5B 2AEJA 3GYNA 2LMIA 5KFCA 4UY85 4I7FA 4NA2A 2EFOA 3N6NA 5K5MA 3VZHA 5DJBA 5KG2A 1UVKA 3BO3A 4ID5B 5MLCV 4C8YA 3W60A 3LAMA 5A8RA 4LR9A 2GJFA 2AYMA 1IR1A 1HD1A 4ZHRB 4DV5J 4FF3A 3CCRS 1HBOA 1NB7A 4IKAA 1H0HB 3JTPA 3UPFA 4FVCA 5F3TA 1HFEL 4JV0A 3C15B 3KUHA 5KFTA 2XC9A 2JEIA 2C22A 2XQCA 3EUNA 4RO0A 3KG0A 2FVPA 4J9QA 2E9TA 2QYCA 4LBPA 2M9KA 1PC4A 2HNDA 3MAQA 4X64F 2XYGB 4LJMA 5MAOA 1TKXB 4DG1B 5DZ6A 4DFKA 3POTA 1BLUA 2JC1A 4DV0F 3MPDA 4G1QA 1OSCA 2W9BB 1T9TA 4A8YA 3PTWA 4NLWA 2HEKA 3U1NA 4ZVPB 3VCDA 1N0UA 2FLOA 3HCXA 4XTTA 2HFNA 1RT6B 2PN6A 2PO4A 3TJ9A 3AA8A 4OZ3A 2D69A 4JI7F 3OV7A 1M5KC 4KGMA 5ETPA 1X4EA 3NMRA 5J2QB 2MKIA 1IJFB 2Q79A 3CIMA 3F56A 2Z2ZA 2YQ3A 1K1SA 3PRDA 2B56A 1O51A 4LRBA 1C1CA 1NNDA 2CQBA 1D8YA 3OBIA 4R8UA 5J2PA 2PT0A 4O4GA 1S9EA 1AYEA 2D1CA 5A2QY 5U47A 1L3SA 3BR8A 1C1BA 3T9ZA 4M94A 4UY8T 3J80Y 2ZH7A 4F02A 2K06A 3CCZA 4NLYA 4EO8A 1NU4A 2H5JB 1TTHB 3WC2A 4EFAC 2DNOA 2LQ5A 1TV6A 5KFZA 3VQTA 4JV5J 1JJHA 4IRDA 5I4MA 4O4RA 1VBZA 3ILIA 3HF5A 1U1PA 2JSXA 1HBNA 3CEDA 4IUFA 3AB4B 3PEJA 2FHMA 4CCHA 4K4YA 3M30A 3KLGA 1S77D 5LXYA 1J5OB 4F4AA 2BDPA 3KWMA 2DGWA 5J2MB 2DHXA 1YK9A 3H7HB 2R7SA 2ZBPA 3DGPB 4ELTA 1FDAA 4KJIA 2FGOA 3HVRA 1K8AT 3I32A 1EETA 1M0SA 5HI7A 1T95A 1IR2A 3KLHA 2F4VJ 3I0SA 3GYGA 4OJGA 5EDWA 1K9MT 1AUSL 1OYEA 5F9NA 3ZTOA 2IIHA 2CRLA 2IBOA 3PX6A 3HT3A 1ZH5A 1K0VA 2HVHA 1JLQA 2LEPA 4P2SA 3PW7A 3JSRA 1TL5A 2UU9J 4PWUA 3Q8VA 2JLFA 3KHRA 1HWLA 3HFZB 1F3VA 3N79A 3QYYA 2CQPA 2QZ8A 3MD3A 3JSMB 1SC6A 3UD4P 2EKYA 1MWYA 4KR0B 3M2UB 4IG0A 2MY7A 4RNHA 3G8SA 4YOEA 1NK8A 5K14B 2LQ8A 1FKOA 1RWUA 2Z58B 5HVHA 1X60A 2K8GA 1U09A 2KRRA 3HKZD 3B4MA 4KFBA 4DUYJ 1VISA 5KAKA 4I1TA 3W2VB 3GV8B 2OSQA 3F41A 3RB3A 3QRQA 2BKNA 2C3MA 3FSXA 3DLKA 1FK9A 3F73A 3H2LA 1BC6A 4NXNJ 3CCQS 4QIVA 3CUNA 3H98A 4DV2J 4DR3F 1SJFA 2EPIA 2E1CA 4U67Q 1RJJA 2YKNB 2UV8A 4DUTA 3KK1B 1UEUA 2R7VA 1R27B 1S1UB 3MM5A 3N5FA 3MGJA 2CQIA 4M5JA 4DSIA 4CLFA 4J9SA 4LF7J 4DV7F 1X5OA 1C4CA 1DJ0A 2N7YA 4YQWA 1X4HA 3BBBA 2KH9A 3OR2A 1FWPA 1R43A 2GVDB 2VG6B 4DWIA 1ULRA 5LSLA 4NA3A 3M8PA 2XY6A 4C9DA 3UD3P 3SSQA 5GADI 1JXVA 3DNCA 1T03A 1REGX 4XO0A 2YQ1A 3H0PA 2Q3PA 1WHYA 3AJ2A 1RT1B 2VDHA 4KSEB 4M5DA 3DM2A 3QJLA 3K0JA 2H5EA 5C2GA 3H5YA 3ITHA 1LWXA 4Z7CA 1JLBB 2YKPA 5LMUF 3V5RA 2WW8A 1TKZA 3F44A 4KPCA 1PJ7A 2FLLA 2BE2A 2WVDA 2YWKA 3W62A 4CLSA 1H7WA 1F2HA 2H51B 5AXKA 2NZ4A 3POTB 1HNXJ 2BJDA 3GFZA 3A12A 3RBDA 4EI2A 3M8YA 4EWTA 3R1LA 1PJ5A 4HI2A 2FY8A 5I42B 1HYSB 1IQTA 4DL4A 4OHYA 2OPPA 2IM1A 3GG1A 3MUVP 2FJDB 1APSA 2XULA 5A0YA 4ANCA 1KONA 2X3DA 4JI1F 3RJMB 3LP1A 2MLYA 4DUZF 4JI4J 2DGSA 1I3OB 2XHWA 2CPYA 3NCPA 1S10A 5LMNJ 1J5EF 2XI3A 1U02A 4R8UB 4PQAA 2B9XA 2M7SA 3BYPA 3GIJA 1SC1B 2RMLA 2Y9HA 2OFHX 4C2MA 2GA7A 1TZ0A 2J5AA 2J8SA 2VPWB 3EVOA 4CRJA 4DL5A 2CFXA 4CT9A 2P5VA 2B6AA 4DV4F 4NXMJ 3KLIA 3C8YA 4HL9A 5FDLA 3BGUA 4JI6F 5C25A 3T1HJ 4F4WA 2QG9B 2HVZA 4D3GA 3LWMA 3TZZA 4K50A 2MDAA 4DOZA 3MM9B 4F2SA 2WB4A 5HBMA 2VC0A 2BX6A 1HQ2A 2F8EX 5KT4A 3KHGA 4N5SA 4A48A 1CLFA 1CJUB 4CO3A 3QSYB 4DL0C 3IMQJ 2YNIB 1YRXA 4J9KA 1N6QB 1WC6A 4IFVB 3I0RB 3GIIA 3QMQA 3V81A 3WIUA 3M6XA 4B9SA 1SIZA 2GO8A 4P72A 3SMZA 2QL9B 2ASJA 2DGXA 3OD2A 6FDRA 2R8GA 2EXUA 2WBMA 3NAIA 5K9FA 3VF0B 2P9CA 4IH6A 2YTCA 1UVIA 4OHXA 2VZ9A 3C3LA 1KP6A 2NUUG 2R7QA 3TA0A 2V8VA 1VQ8S 4IG0B 3NGRA 3VZIA 4DR5F 3AFGA 4N56A 4Q0BA 4C8ZA 2HS4A 4F0MA 4IR1A 3ENAA 1DLOB 2G13A 3MF5A 3KJVA 2IA6A 2F9DA 3VQSA 4L6V3 2PA8D 2G2YA 5KFRA 1FJGJ 3OQ2A 4J9RA 1URRA 3H4DA 2Q66A 4YR0A 1ZAVA 1WF1A 3O3LA 5DG9A 2B43A 2CA9A 1U0HB 2EFVA 1SKSA 5IXUA 1C2PA 4J9VA 1E6YB 4B9UA 1YHQS 1SH0A 3C16B 1KNZA 5F0WA 4D3HA 3HI9A 2I38A 3PHEA 2QTWA 3W61A 3FEZA 4K7QA 3HHDA 2Q6BA 2FHJA 3W66A 5FLXY 3G96A 3ADAC 1D9DA 3HSDA 2OIHA 2D41A 5IWAJ 2DEJA 2R8JA 4B3MF 2MQMA 1H38A 2V5HG 2N3OA 2RF2B 3M9MB 3X1LB 1T05B 2DH7A 1IKVB 4ETXA 5C5JA 1A9NB 3T19A 1RKJA 5D78A 4WE1A 3M6VA 2BANB 3TZWA 3R7BB 3NLCA 3BJYA 4CLLA 2EKNA 2BRLA 5KFXA 1S1XB 2FVSA 5F8MA 3DOMB 1GTHA 3TANA 4N77A 3CT9A 4YR2A 3GFXA 1AZSA 2ZD1B 5KG5A 4I68A 1KLNA 1BQNB 4DV5F 3PRVA 2N4DA 3FC9A 2AKWB 3RBZA 1RAAB 1RU1A 1EQMA 3HFVA 1EX8A 4FN5A 5KG3A 3QJPA 3A3NB 3I9V9 2KJWA 4KHRA 1NK9A 1CBKA 4CLTA 4ZLNA 1M5PC 2OPPB 4H4KC 3DMJA 5KG4A 3LA0A 4KE5A 3BS9A 4PWWA 3EVMA 3R6GB 2GMHA 2IC3B 4C11B 2LU1A 3KLVA 3TA1A 3DLGA 2HNZA 1RT4B 1GMWA 1RT7A 4H4KA 4CNYA 1FD2A 5KTQA 1TL4A 3HHLD 2ZJQQ 4DCJB 4O3NA 4DR1J 3BN7A 3OR1B 5HK4A 4F04B 1S1VB 4FXVA 1RCOB 2U1AA 3TUIC 2HYIB 2RDIA 3R3TA 4OV6A 4ANEA 3LF0A 1QSYA 4P7VA 2E1AA 3TJ8A 2AGQA 2GJ2A 1RTHA 1NRKA 5IV4A 2F8MA 5BR8J 3CULA 1I94J 1XQIA 1S76D 2RSQA 1RP5A 3V6DB 1K44A 3QT5A 1HMVA 1LW2A 1S57A 1IKWB 3CCLS 3VR1A 2UUAJ 3OUYB 2LKZA 1RTIB 2BJ8A 1XERA 2RU9A 1GXLA 1PAEX 5DQGA 4I6YA 2D74B 4JV5F 1GFWB 4DR4J 1CULB 1IWAA 1OQ6A 3IS9B 4CTAA 4AD6A 2QYGA 2UUWA 1VHFA 2HURA 2H48B 3OTBA 3FZ2A 5F41A 4OI3A 1U1RA 4QR1A 5H1SV 3TRGA 1VJWA 4YHHJ 2V8DA 3QLHA 1KQKA 3ISNC 1ZBTA 2GIFA 5ETVA 1WHXA 4C3KA 4DU8A 2JC0A 2DYAA 4TU8A 3AA9A 3HVAA 2OPQA 2X3GA 3CDEA 3HPOA 2F4VF 1VQ9S 2GQCA 1FE4A 1MLAA 3DXBA 2AGPA 2LEAA 3OVSA 2WVFA 3P45B 2A2CA 3BR9A 3DI6B 1V3RA 4USKA 1DRZA 3S6EA 3R6LB 4ECVA 2G0CA 2HK3A 2XZDB 1U6BA 2R42A 2UU9F 1V5VA 1MNEA 4IQMA 4KQZA 1S1TA 4KO0A 1UEVA 4DR7J 1BQMA 3GB0A 4CLYA 1RWPB 2DH9A 2DO0A 1VLYA 1XNQJ 4DL7A 2FJBB 5LJ5Y 4ZIWA 4C4WA 3LTOA 2HVDA 4KC5A 1UJ4A 1FFWB 1HI1A 4O23A 1GX5A 3CJSA 2E5HA 3M32B 4A47A 1KVIA 5DGBA 4DUYF 5H9EJ 1RBAA 5K8MA 4RU2A 2D3O1 4PXBA 2VBWA 3ILOA 2DR7A 4EUVA 4I2PA 1N88A 2VC1A 2OTJS 1LWEB 3QJJA 1H6KX 2EK6A 2JZ5A 4OZ1A 4P73A 2FZGB 2UUCJ 4U7UD 3RAMA 3FBCA 1HI8A 3AJDA 4NXNF 1BWEA 2C42A 3I5BA 2UZAA 3CDWA 1EZZB 1HR0J 4DV2F 5KFVA 4AT1B 3MCOA 2R2TA 1S0NA 2NSCA 4WZMA 1S9GA 1FTRA 2FY1A 3R5JB 4M95A 2UVRA 1F9FA 4LF7F 3I55S 1IN0A 4ZVGA 4CLZA 2JLGA 2AJ4A 3OT9A 3T1AA 4ZCMA 3THVA 4ES3A 2UUTA 4RL1A 1RT5B 3EYZA 3L7OA 3D0HE 4NZ7A 4ITSA 4B9NA 3R1HA 2HHUA 4EK2A 1WEXA 3PYGA 2JEFA 2X1GA 1W2BR 2LFVA 2XSFA 2GIQA 4TVAB 2PDAA 3NGKA 3UN3A 2XNRA 2DGUA 4B9VA 1TQLA 1QAJA 4C8OA 3K8VA 4PPDA 4Y28C 2XSJB 4CH7A 2Z56B 3HXMA 2K2PA 3T5HA 1RHMB 2VOPA 5H9FK 1YRTA 4RJVA 1T9YA 5D0HA 1CG2A 3V6JA 5HVFA 1N32J 4KH0B 4GVBB 4WFAQ 1E6VA 3CJKA 1RAOA 3DDNA 2U2FA 1HNXF 4HKQA 4ERDA 4URQU 3HHNB 1KD1T 1QLNA 1WORA 2XS5A 1N54B 3O1LA 4B3OA 2BW2A 2W9CB 1FERA 2XGQA 4LF1A 5GMKa 3CJ2A 2WVBA 3GV7B 2G1DA 2WSEC 2VHGA 1VI7A 4LVOP 4QYRA 6AT1B 2RKIB 1D9AA 4JI4F 1WACA 2XNQA 2VH7A 2HPUA 3G82B 4G65A 1F3FA 5LMNF 4XIUA 1WI6A 3Q8UA 3FQLA 2YPYA 1Q5YA 3SV4A 3M2VB 5KT3A 1X9WA 4KYZA 1GK8A 1XK8A 1MSWD 1VQ7S 1NJIT 3IWNC 2PMWA 1HQUA 2ATLA 3Q86A 5B09A 4NXMF 5E2QA 4M8LA 3WQPA 5DG7A 2HFVA 2CPEA 1MWZA 3TQ1A 2WTFA 4DX6A 3JAMU 3AXMA 3GZ7A 3SCLE 4HVZA 2JEGA 2V68A 2W2NP 3T1HF 2VASA 2ACYA 2ZWPA 5E41A 3HVTB 2ASYA 2FZCB 2CDRB 3MM8B 1N4LA 3MURP 4PR6A 3T41A 4G1IA 4ED7A 4NL5A 4IOCQ 2ERRA 4QIGA 3U02A 1FE0A 1VOMA 2LQJA 1GH8A 5KFIA 2HHHJ 5KFLA 1EQ0A 2QA2A 3ZZRA 4FBUA 1SQFA 2C2NA 1VC6A 4PXEA 2MQLA 1RLCL 3CCJS 5IZHA 2VA3A 1NSKL 2ZE2A 3O8WA 3E8OA 1PILA 1XIQA 4NLXA 1H98A 4LF5J 1SKRA 2AQ4A 3MHYA 1P6TA 3ONQA 1AA1B 1RQ0A 3ELHA 3P5TL 1RACB 3IGNA 3R27A 1Y5IB 2E44A 1TL3A 4H4MB 4BCAA 4NWBA 2OEKA 1N56A 3NS7B 3KMSA 3PVXA 2GMJA 1NH8A 4ZVTB 2HFSA 3C6UA 4HEA9 1R8CA 4W90B 3RB4A 3TNVA 1NZAA 4FNHA 3CIZA 1V5IB 2ZBRA 3DLEA 1VJQA 5LXRA 1T11A 2NR0A 3D3BJ 3G6VA 3GLJA 3C14A 3RUBL 3ZTRA 3G6ES 2LQ9A 1KVKA 2FZKB 1FJGF 5B7WA 1RUSA 5CHCB 3LPEA 3DLBA 2ASLA 1XBWA 2RHQB 4Y0FA 3R7NB 3LGNA 1D9FA 2VD3A 2DISA 2VKRA 1UAWA 2V0NA 4HTIA 2V9KA 3MPUB 3W5XA 5KT6A 3NNHA 1B3TA 3S7RA 3M8ZA 1JLEA 3FK4A 1Q86T 4NLUA 1X4CA 2FDNA 1NJZA 2J7UA 2N4CA 2GCFA 3MCMA 1IKXB 4PWDA 5L38A 2G0JA 2IM3A 1S9GB 3ZNUA 5F3ZA 1WOPA 1ZS6A 1PYOB 2PSZA 2A18A 4AL7A 5IWAF 1MG7A 4Z37A 1N36J 1G3OA 1FKPB 1XMQJ 2F4FA 2K1RA 2BOPA 5EGYA 3AD8C 1VQSA 4KGKA 1XN9A 1RLDA 4WK3A 1XMOJ 4QR2A 1U7LA 3Q23A 2AYGA 5LOQA 2BRKA 3BZQA 4GO7X 3MR5A 5GAEU 3MMAA 3CCSS 4CQ1A 5I3UA 3VAMA 2GQQA 3NBPB 2MKSA 1UKUA 1GAOA 2XLKA 3MR7A 1KQFB 1EKSA 4OHZA 5KFEA 2GJIA 3ISZA 3EZUA 5K8NA 5HJYA 2FC8A 2D3UA 2HVIA 1WWHA 4NLOA 2F9JA 2Z2MA 2O3DA 1I51B 1QAXA 4A8FA 1RWVB 2SXLA 2W4PA 1KTQA 4TY8B 2AGOA 4TYBA 1OYDA 2WOMA 3IG1A 5KG6A 3LP0A 3BH7B 3TYTA 3BKFA 4C6AA 1S6QA 1MMDA 3EGVA 2JFKA 4KGZB 4HLBA 4LF6J 2V34A 5HROA 2FHKA 1HNZJ 2NREA 2DHAA 4GMKA 1RI7A 4UUXA 3EPGA 4QU6A 4YB6A 3EICA 2HQDA 5LL6d 2DXDA 4O3SA 3GR1A 4DQIA 4JI0J 5C24B 5A8WA 4IH5A 3QIDA 4ZPVR 3FKBA 1VRTA 2HSEB 1RHQB 5HATA 4LIWA 3JTOA 4UOFA 4OJ3A 2OP5A 3TZYA 3KFWX 4FS2A 3SIPB 4WKRA 2CQ0A 4U96A 4DR1F 5D4LA 2CQCA 4K5SA 4YY3J 1Q81T 2MZRA 2FIUA 4U95A 3SCJE 1GQEA 5A2QU 3J7YU 1VGYA 2DB1A 4ZJLA 5KFFA 2MZSA 1ZA2B 3K5OA 5DGAA 5AXMA 3S01A 4ZVEA 1HNIA 1GEHA 1HQUB 3J80U 3IA0A 1NK6A 5IT9Y 3KK3A 1JNRB 2KYZA 3IBCB 2VU5A 2LYVA 5BR8F 1I94F 4K4TA 2H4WB 2MGZA 2R7RA 2HZCA 3KJNB 5CYQA 3TEHB 1R89A 1TL7A 2UUAF 1WF2A 4L73A 3AHPA 3FEYB 2VPZB 1UETA 1Q4RA 4LVNP 3IAS9 4IG3A 1Q16B 2F3JA 3QO9A 2HIYA 8AT1B 1VC0A 4DR4F 2HWIA 3MEKA 4F36A 4B3RJ 5FIIA 4USHA 5CYMA 4MMOA 1S6PB 2DNKA 1GNKA 1NK5A 4ZJOA 2M70A 1WOSA 1P8GA 4DSFA 4OFZA 1VFJA 3HSJA 5D0RA 4U9RA 4I2QB 2I8EA 4NI2A 2CQHA 1QJHA 1HNVA 4YHHF 1RWMB 1VIOA 1SCJB 4NA1A 2IMWP 4IH7A 3V4IA 1UCNA 3PJ9A 1FWLA 2VQEJ 2MKYA 3AB2B 2V67A 1HBUB 3ET6B 1BY9A 1JLAA 1Z4UA 1Q1KA 1YBUA 5C42A 4ED3A 4WXWA 2VODA 1R8BA 3VTIA 1U24A 2ADBA 4B08A 2DCLA 4HT7A 4OI1A 1LWFB 7FDRA 3LO3A 1AB8A 4OYZA 1ZETA 1UVMA 3OLBA 2HAFA 5F8LA 3MAAA 1U1QA 2MKHA 1ZAXA 1UVNA 3D68A 3MWBA 4LUBA 5D8HB 5LT5A 2EI5A 4DR7F 3NNCA 4KHPJ 2OH2A 5KFYA 2QLBB 4DL6A 4RUAA 5BYQA 4J7CA 3CMES 4USIA 2R2SA 2K7JA 3BV8A 2FJWA 2O5DA 3M7VA 2ZNZA 1XNQF 2RRBA 3QGGA 4NMLA 4YEAA 2H4YB 3FBFA 2WW4A 1QVGR 4DCPB 3DOLA 2W8KA 4AYBD 2B9WA 4TU9A 3E3XA 4DQSA 3J81j 2R2RA 5CD4A 2A6OA 4MFBB 1SKUB 3NGDA 1SV5A 3BSAA 3GCXP 2YY3A 3WX4A 1UWAA 3RB6A 2R8HA 4DR2J 1TL1B 1U6FA 3G86A 3SQGA 2GVZA 4UZBA 2UUCF 5L1IA 3OHBA 1REVA 4ZCLA 1TAQA 2N7CA 3MMCA 2XM3A 4WF9Q 1FRKA 2WONB 2GW8A 3TQEA 1HR0F 5G0RB 3KLEA 2IDLA 3NWGA 4U6PA 3ENWA 2GZOA 3PYEA 3GCWP 2HQ3A 1XC9A 4QIFA 2F5GA 1U49A 1QTMA 4HACB 4NPOA 4PABA 4JI8J 4XPEA 1JXEA 4BC9A 3IWLA 1FRHA 2MLZA 4DLGA 3UVJA 1JKHB 2CJXB 4N76A 4HYKA 2DY9A 2M3DA 2CWKA 2M8HA 3W9IA 3BO4A 2LECA 1WELA 3SSSA 1FEHA 4EU0A 7FD1A 4X4TA 1HW9A 4U8YA 2RDJA 3M6WA 2ZC4A 3PNIA 2NPIA 2KVQE 1FRXA 2WRMA 1GTEA 2XMKA 2YH0A 3SEOA 3M4XA 4FP9A 1AXQA 5HQ8A 3PG9A 1NO8A 1TK0A 4WIQA 4DPWA 4DPYA 3NAHA 3SYZA 1YKWA 2GHPA 2CYYA 2J9DA 2ZOGA 2AHOB 3IC1A 1LV5A 4PQUB 3VAHA 1N32F 3QIPB 1WC4A 1ZTWA 3AQOA 4DV3J 3PX4A 4R0JA 1UEKA 4ZPDA 1V9OA 3C46A 3HDSA 1F5BA 2BQUA 1FRJA 3M8WA 2VFUA 2DXFA 1Y9OA 2W1BA 3MUTP 5A8WB 2IJNA 4QWDA 3D9BA 1C0TB 4CYUA 3AY0A 3KKFA 3BGRA 3L4BC 3UDCA 4ECSA 3R5GA 1YBTA 4R5PB 2XMMA 2EG2A 4ICLB 4X4QA 2P9EA 1T7PA 1JWWA 2MZTA 3H5UA 4OJHA 3CCUS 4Y3CA 1OSDA 3DRSA 5IC6B 4NLGA 3MMBA 3CO9A 2VBZA 2R8IA 1YITS 2PGCA 3GIRA 2I5JA 5J1NA 2C3UA 4WP3A 2KM8C 4AUKA 2RQCA 2FVCA 2E5IA 4ID8A 4X4NA 4DFMA 2QT7A 2UXBJ 5IS2A 2LA6A 1FRLA 1RYRA 5E3PA 1LEOA 2B4OA 4QWCA 3DGVA 2AJ0A 2YNGA 5L8RC 4ECRA 1YIJS 1DTTA 5HP1B 2A10A 2UXDJ 1H3DA 4WZQA 4HH1A 1QSLA 3MAHA 4K4ZA 4F25A 3W1YC 2DGTA 2JNJA 2JLEA 2RT3A 4URGA 4IG3B 1WKLA 3FDSA 4KKOA 3LQVA 1CC8A 2ZH6A 4C8LA 2M5YA 1PBAA 1SL1A 4MKYA 3MEEA 2B4VA 2C1EB 2RDDA 4RNNA 2VOOA 4ED4A 5IFMA 4IQXA 4A8WA 2W24A 4TQSA 2J9CA 3J7A1 1N0VC 5DQHA 4Q2MA 2VFVA 3PEHA 2HHHF 5KFPA 4XAKA 1KLMA 2XZWA 1FVSA 2MHNA 2DHGA 2CPZA 4A8OA 1S49A 5J2NA 2DKOB 3PFEA 3CD6S 4YS2A 1T9UA 4A8MP 4RW9B 4MK8A 3TAPA 4YDXA 2FUG9 4LIRA 3KK2A 1Y7PA 2BR0A 3MR6A 2MQOA 4LF5F 2FJVA 2BJ3A 4V19X 1SQEA 2ILYA 1IM6A 5HO4A 3FMWA 4HI1A 4V1Ak 2J9EA 3MEDB 3EDQB 4IDKB 1YJNS 3DCAA 4P2XA 2J6SA 1F0XA 3SCKE 1T94A 1TELA 1YRUA 1M5OC 1JLGB 2J6TA 3Q22A 3D1HA 1R0AB 2VPXB 2MQQA 2POKA 1KHVA 1UZHA 4TKTA 3OTCA 2FHJD 1WEZA 4M5NA 1DTQA 3J81Y 2IY5B 3GU0A 3HHLB 1DY3A 2CG4A 3CSKA 1WKKA 5H9FJ 2XCAA 5K8OA 4DI6A 2QA4S 4H4OA 4IO9Q 5AXLA 4UQGA 3MTKA 3TJAA 2I9SA 2KXHA 2IJFA 4OI6A 3KUGA 3R2CJ 1JJ4A 3Q8QB 2WBRA 3SCIE 1YGYA 1B7FA 4C98A 1YSJA 5FLXU 3L09A 3GILA 3CJQA 1QSSA 5EHHA 1UA1A 3SDEA 5E3QA 2XWYA 3WZ0A 1Y3KA 3K5PA 3NXZA 3B8HA 1SQGA 1JLFB 4Y2AA 2XI2A 4B3SJ 1W26A 2QEXS 1RT2B 4NCAA 3PZPA 1NJXA 1UMJA 2IAJA 3TEGA 1Q53A 1N36F 2MKCA 1XMQF 1FO1A 4AE5A 3KUEA 4ECYA 2BV3A 5CCMA 2CQ2A 1TAUA 1PYSB 3TUPA 1XMOF 3FNNA 1EARA 1CS4A 3M2RB 4RW8A 3U7JA 1OY9A 4B9TA 1RAGB 3W5ZA 2IVMA 1NH7A 4RR5A 1U26A 3NKYA 3C6TB 1WUUA 1B7YB 4YUDA 4USWA 4Y65A 4NOHA 1T9XA 3RYLA 1JB0C 2MZQA 1N5TA 1RAHB 1YLXA 2V4QA 3PIOQ 4RBTA 2HMIA 3KHHA 3MEGB 3OSNA 3ULHA 5D0GA 1XJWB 3UDVA 4M5KA 1GMWD 1CJKB 2OJ3A 3AJ1A 4C8KA 2RILA 1UTAA 3EX7B 2R8KA 3U1LA 1S7HA 2YKMA 2ZNYA 2KT2A 4QR0A 5B0CA 3AAWB 5KFJA 2UXCJ 1HWIA 4AQYJ 5B0EA 4KV8B 4PYDA 2MPUA 4LF6F 5HLFB 3T3FA 2ATCB 3GFYA 3ZTQA 1HNZF 4MYUA 4RUCA 4IO1A 4X66J 2KN4A 1N5YB 3THPA 1LXNA 4Q8EA 1NLKL 3PKMA 2ZOMA 3K2YA 3BGFA 1AW0A 2CVEA 2MSTA 4JI0F 1R0BG 1OQ3A 1XEZA 5ETSA 4ECQA 3PYFA 4CLWA 1JMTA 1EB0A 3M1VB 2Z4PA 1VHIA 1LK7A 3AOBA 2PFDA 1KN6A 1HQEA 1S6OA 1UWBB 3N28A 4YY3F 3CCTA 4YR3A 1CJTA 2AW0A 2P6TA 4NCBA 3E01B 1Z1ZA 2ZM6J 4ILLA 4Z7YA 4OYAA 1RTDA 1BWVA 5JVGQ 4RPFA 1CC7A 2ZBIA 1DTTB 3HMJG 3W65A 5F8IA 1RGVA 3EMTA 1Q82T 1S1WA 2QMUB 1WTFA 4GKJF 3R5AA 2D9OA 1Y4ZB 2B7CB 2V9WA 1U2FA 4X4SA 2GHWA 4NYOA 1U2CA 1MWQA 3I56S 3JQMA 4O3QA 3UE2A 3FBEA 3ISND 3A1YG 3DOKB 4WP8A 4RKUC 4FYDA 4B3RF 2KO1A 4O3PA 4E2FB 1YDLA 3N0VA 1WC5A 1H72C 3US5A 2GQ2A 2GO9A 3HLUA 4ZMMA 3HD2A 3EVWA 3GP9A 4PXCA 2IYIA 2CJKA 4UT4A 2J0QD 3M9NB 2DVIA 2OLWA 4RW7B 3OTDA 3M8QA 4PEOA 4AXIA 4P52A 3PJXA 2Y8YA 4MIBA 1PSDA 3K8WA 2HIQA 3Q8SB 3DRRB 2VQEF 4EYIB 1O6XA 1Q78A 3ZZOA 2IRYA 3G87A 4I6WA 2V4RA 4GC6A 1N5SA 1OPZA 2X51A 3PRBA 4F2RA 3MM6A 2ADCA 3DYAB 2MZ1A 1IKYB 3VWSA 1W2IA 5EWFA 3VGUA 1LFPA 4CLKA 4F3MA 3CJTA 3FEXB 1L3KA 3A13A 1M5SA 1BMQB 2B51A 5HQLA 4GKKJ 3EGWB 1DURA 1NDKA 2VIHA 1N5QA 4DX5A 3DHWC 4FF4A 4KHPF 2XY5A 3A8KA 4X62J 2UVUA 2QSWA 2OPSA 4QPXA 1UFKA 2RU3A 3MCSA 3M6UA 3NL0A 1FNOA 3NS5A 2BXJA 2RUGA 2KVIA 2WHOA 2AF6A 2CZ4A 2HLUA 2HZAA 3JYTA 3DLHA 3I4PA 4N7TA 3B82A 1VLOA 4O0NA 2ZFHA 1ZZFA 2C2EA 2DRBA 4WFYA 3D6MB 1DAXA 1WSRA 4O44A 2PI5A 3R5DA 3BB5A 1VRUA 4DR2F 1SI9A 2AWZA 3TVYA 4ES2A 3KOAA 2RH3A 2V2QA 4RUHA 5THWA 1FESA 3IR7B 1HHTP 4JV1A 2F7VA 2B0GA 2F1FA 3TUJC 2DNGA 4S0MA 3ZO7A 4J5OA 4LF8J 2IRXA 2YNHA 2VBXA 3HZEA 1M1GA 4LRFA 1AROP 3D6TB 4FF2A 3W7BA 2VG5A 5J1PA 2NS1B 2ZJPQ 4JI8F 1X0PA 3P8BB 2QJ3A 1T9WA 4NCGA 2MSSA 2HGNA 4EZ9A 1U6ZA 3KDNA 1FTCA 4DBQA 4CH0S 3C2PA 2DY1A 2R7TA 3DRXA 5F9LA 3ETMA 3AODA 2GAHC 3PW4A 3IRWP 1TVRB 4PUOA 1VQKS 1LWCB 2AD9A 1VQPS 3BQ2A 3UDLA 4ECXA 3SZ2A 3EJMA 1Y11A 4Q5VA 2YPZA 1RA7A 3QT8A 3HSZA 1RU2A 3O2IA 1XR5A 3HO1A 4MYTA 4DV6J 4BWJA 3FSIA 2CPXA 4BWMA 2GNKA 2HBYB 1NKCA 1X4AA 1ZAWA 1C0UB 3GSDA 2DBBA 4QW8A 1CVJA 2GGPB 4KGXB 2W2PP 2HBQB 3MECB 2OAUA 2VG7B 2ZJRQ 4DV3F 1Q0NA 1WDDA 2WK4A 4B17A 2BJEA 2HNYB 3IR6B 4F67A 3QWPA 3LP2B 4F0HA 2G4BA 2ZBCA 3JB9k 1TK5A 1A0OB 2KG1A 2HRUA 3FQKA 4TU7A 1TKTB 2RIJA 4JI5J 4RW6B 4TY9A 2BMBA 4JV2A 4CO4A 1RCXB 3RZAA 5J1EA 2MZJA 4C7QA 2KYXA 4OYIA 4WCEQ 4UW2A 1UA0A 3TAMA 1RHRB 4Y2IA 4ZPBA 4RNFA 2ZKUA 3BDEA 2HAIA 3RGIA 2NXCA 1JLCA 3VGTA 1IXKA 4I7FB 4C8MA 1KHWA 3CCVS 5CCLA 1RWNB 1UPMB 1LW0A 1HA1A 3S8SA 2UXBF 1VQ6S 4GRSA 3DRYA 2FJXA 1Y0HA 3G2XA 4RW4A 2DR9A 3MPVA 3OL9A 5A8RB 4P71A 2HQGA 4IFYA 1PJ6A 2VFRA 3B4DA 3K5MA 2AMCB 2UXDF 1HBOB 2DNPA 4X2BA 3CJ8A 2AU0A 1L3TA 3QNWB 4ER8A 3QATA 3PO5A 3PKYA 4F3OA 3MFHA 3BSNA 5LM7E 4WK1A 3A4TA 2HNDB 2XS7A 2HHWA 4WKYA 1Q95G 3DU6A 2V8HA 3MD1A 2NZCA 1T02A 4G1QB 4NLDA 2V63A 2B5JA 4DF4A 3PY8A 5KG1A 3MTJA 3Q2SC 3LALA 1Q8BA 3GE9A 2DR8A 2BQ3A 1MU2A 4F0KA 3M8QB 2CPFA 1FXDA 2O1PA 3OTEA 3TW0A 4F50A 2BUNA 3RBXA 1R3NA 3GPAA 4OL8A 4W4MA 3I4HX 3NNAA 5DG8A 1R8AA 3D1OA 3TAQA 3ZZYA 3I82A 2WAQD 3SFGA 2H65B 2LVWA 2DNYA 3BO2A 4TLQA 2OTLS 2XMWA 3K5NA 4RX6A 3UCGA 2Z30B 2RB7A 2JJ4D 1C1CB 4OYMA 4LSLA 4F3QA 1DFDA 5L1KA 1VRQC 4MT1A 5J2PB 5KOWA 4O4GB 2MTLA 5T7LA 1RT3A 1S9EB 3BEGB 3VAGA 2E1PA 5DZ7A 5GAEI 4JP8A 1C1BB 4ZVFA 1OPIA 2AV5A 4M5IA 3SXLA 4ZS6A 2YWEA 2GV1A 2JOQA 5E5NA 3FZBA 2ZZNA 2LXFA 1TP7A 4QWAA 4DX7A 1CJVA 4OX8A 4Y2KA 1TV6B 5HL7Q 1RDRA 5E7OB 3EZ5A 1HKAA 1LXJA 3JYTB 5ETMA 2M2BA 3CE8A 1S6UA 4USMA 4KPYA 3HJFA 2ZVSA 5D3GA 4ZK7M 3DDKA 3RAXA 2AYBA 3W3SA 4HHUA 5KFWA 4I4BA 1RWXB 4K8RA 4PG4A 4P2FA 1HBNB 4DEZA 1PO6A 2E9RX 3KXDA 4DQQA 4ELUA 2XCPA 1BUXA 1JJ2R 1OS5A 3CJ0A 3M30B 4OZNA 1RAFB 3KLGB 3B78A 3G8TA 4YFUA 1U45A 2AJ2A 4CI0B 1JQGA 3CD7A 4KIAA 1SJ4P 2CPHA 4B3SF 3L7PA 1H7XA 3CXCR 1EETB 4PYAA 3KLHB 3I0SB 2HQIA 1NB2A 4OX6A 5C2CA 4ZHRA 5KFOA 4KH1B 2FC9A 1VYAA 4LBHA 3HP6A 2OI2A 3K7RA 3C15A 5K20B 1M1KT 1JLQB 2VFSA 2RS2A 4A8SA 1S4FA 1TFWA 2ROPA 1R6YA 1SXLA 2VDIA 2G9OA 4PUOB 1NHKL 4A46A 4J91A 1TKXA 4DG1A 5LJ3Y 2HHPA 4BDPA 4QOTA 2E7WA 4V19J 2PIIA 3HD1A 2WZ1A 5ETOA 4LFCJ 2IYGA 3J7YI 3TVKA 2W9BA 2A1BA 1XR6A 2D3ZA 1SJRA 4WU3A 3ZZ0A 1FKOB 1HWUA 1NKBA 2EK1A 1RT6A 1SPBP 1U1NA 1GMVA 3V2UC 4BHQA 4KFBB 2RD5C 1UVLA 4C0HA 3BKUA 4U7UK 2IPOB 1M5HA 3OL8A 3X3UA
chains in the Genus database with same CATH topology
1YVFA 5DGAA 2BDPA 3LOUA 3KWMA 2DGWA 5CZVA 1HNIA 4ZVEA 5AXMA 3S01A 5C42B 4YB1P 1HQUB 5J2QA 3IA0A 5J2MB 1NK6A 1X4FA 2DHXA 2DHSA 1BGXT 3HVWA 1T8EA 2R7SA 3U1MA 2UXCF 3OJUA 1LK5A 5IT9Y 3KK3A 4TY8A 4AQYF 1QY7A 4ELTA 1X9MA 4JI3F 2J0XA 1JNRB 2KYZA 3DLKB 1FK9B 3ZZUA 1FRIA 1FDAA 4KJIA 2FGOA 5IQ6A 3HVRA 2ZC3A 2LYVA 1K8AT 4OZ0A 3I32A 1EETA 3PXGa 5BR8F 1M0SA 5HI7A 1I94F 4F4KA 1T95A 4K4TA 3KLHA 3I0SA 2MGZA 4OQJA 2R7RA 2HZCA 5CYQA 5KFKA 2CZVC 4NZ0A 3LW5C 4X66F 4OJGA 5KFBA 5EDWA 1K9MT 2IHR1 3QAUA 3HM9A 3CCES 5D4NA 3OL7A 5F9NA 1R89A 2CRLA 1YG0A 2L9WA 2UUAF 1WF2A 2IBOA 4DPOA 3PX6A 1S0MA 3HT3A 1ZH5A 3AHPA 3FEYB 4TYAA 5L9NA 2VPZB 1L5UA 1UETA 4KB7A 1FCAA 1K0VA 1Q4RA 1R8HA 3E51A 5KFHA 4LVNP 3IAS9 3SSRA 4LQ3A 2HVHA 3RU0A 1JLQA 4IG3A 1Q16B 2LEPA 4P2SA 3MM5B 2F3JA 3PW7A 3QO9A 2CQ4A 3JSRA 1VC0A 1TL5A 3TVZA 3LANA 2RRAA 4DR4F 2AJFE 4HT5A 4PWUA 2JLFA 3DXSX 2HWIA 4DS5A 3MEKA 3KHRA 3O5TB 2YX7A 5FIIA 1HWLA 4USHA 5CYMA 4MMOA 2M8DB 1S6PB 3N79A 2DNKA 1GNKA 3QYYA 2CQPA 2QZ8A 3MD3A 3DOLB 4Q7AA 1SBRA 3JSMB 1SC6A 3UD4P 5C24A 2EKYA 3M8SA 1NK5A 2M70A 2DJWA 1MWYA 4KR0B 3JTNA 2B9YA 1P8GA 4DSFA 2K3KA 4OFZA 4ECUA 3OR2B 3NMAA 1VFJA 4WYWA 2QA1A 1VQYA 3M2UB 4IG0A 3IR5B 4J9OA 4U9RA 3GQCA 2MY7A 4BBYA 3I5CA 4RNHA 4Q45A 3CJ5A 4I2QB 4DSJA 4OI0A 5F8JA 3G8SA 4YOEA 2KG0A 2I8EA 5AE3A 2J0SD 4EGLA 2CQHA 1QJHA 3MZIA 1NK8A 2DR5A 2CJBA 5K14B 1SV5B 1FKOA 1RWUA 1HNVA 4YHHF 2M52A 2R7OA 4A4JA 2ZM6F 1VIOA 2UVWA 4NA1A 2IMWP 3TARA 4IH7A 3M8PB 3PIPQ 2CIMA 1FNMA 2K8GA 3V4IA 2DIVA 1KFDA 1U09A 4DFJA 2KRRA 1G7CB 3HKZD 1HW8A 3PR4A 3B4MA 3NP5A 4RBUA 1YQHA 1T03B 4KFBA 3SQGB 3KG1A 4GC7A 5KAKA 3PW5A 1REVB 4Y2CA 3AB2B 4I1TA 3W2VB 1W25A 3GV8B 1YJRA 4M5DB 3MMCB 1HBUB 5IM0A 2OSQA 1BY9A 3DM2B 1VMBA 3F41A 1JLAA 1Z4UA 1Q1KA 4ZCIA 3RB3A 5C42A 2LQBA 4ED3A 5J2MA 4WXWA 3OXFA 3ITHB 2VODA 1R8BA 3KLEB 1XMBA 2C3MA 3VTIA 5L1JA 4QBUA 4WIIA 1U24A 3DGPA 3I9ZA 2XB2D 2ADBA 3S1TA 2IFXA 3FSXA 2QMXA 1FK9A 1TKZB 2DCLA 3DLKA 4B08A 4IRCA 4LMZA 4QU7A 1TK8A 3F73A 3H2LA 1BC6A 2BE2B 4HT7A 2M0GB 2MJNA 5L9XA 4OI1A 1LWFB 2LCWA 3CCQS 3IXQA 4DF8A 5D6GA 3RR8A 2DNMA 3LO3A 7FDRA 4QIVA 3CUNA 3H98A 1ZETA 1UVMA 3DRPB 3OLBA 3BN4A 5F8LA 4DR3F 4OLPA 1U1QA 2MKHA 1SJFA 1ZAXA 4RNOA 1UVNA 2EPIA 2E1CA 4U67Q 3MWBA 3RW7A 4LUBA 5D8HB 1RJJA 3VAKA 3EGZA 5LT5A 1U1KA 2EI5A 3FMBA 1B0TA 4DR7F 3NNCA 2YKNB 2OH2A 2UV8A 5KFYA 4TQRA 1EP4A 3KK1B 2EFPA 1UEUA 4RUAA 4DL6A 5BYQA 2R7VA 3CGIA 1R27B 1S1UB 3CMES 1IBKF 3MM5A 4USIA 3N5FA 2R2SA 1FKAF 4EO6A 1RISA 3UCZP 2K7JA 3G4SS 4DS4A 2FJWA 4X4UA 3MGJA 2O5DA 2FGCA 2CQIA 3V6HA 4DSIA 1AFJA 2ZNZA 4CO2A 4ZPTR 4J9SA 1XNQF 1KVJA 4DV7F 2MY8A 2RRBA 3QGGA 4NRTA 1X5OA 1C4CA 4NMLA 4DLEA 1SIWB 4DMZA 3ETOA 4YEAA 3K5LA 4EZ6A 1SH2A 4P7TA 1DJ0A 5A0YB 2N7YA 4YQWA 1X4HA 1S6PA 2QRRA 3EGNA 3KG4A 5M2RA 1QVGR 5BJRA 4F2RA 3DOLA 1NK0A 3JSMA 2DD8S 4AYBD 2W8KA 2B9WA 2RE1A 4O3OA 4TU9A 3E3XA 4JI2F 2KH9A 3OR2A 4DQSA 3LP1B 2R2RA 3Q2TC 4LSNB 1KC8T 4K2XA 4OZLA 4DDFA 5G4DA 4I2QA 2DH8A 4NLQA 3BGLA 4MFBB 4N47A 1R43A 1ZM2A 3NGDA 3LGMA 5K14A 2YWHA 1SV5A 3BSAA 2VG6B 4DWIA 1ULRA 1XTZA 2IM0A 3IRXB 4YB5A 2ZH2A 2YY3A 5LSLA 4DL2A 2J8AA 4IRKA 4NA3A 3M8PA 3WX4A 5M2UA 2XY6A 4NLVA 4C9DA 4X4VA 1HL6A 3RB6A 3UD3P 3SSQA 4LF4F 2R8HA 5GADI 2KI2A 2VPYB 3DNCA 1T03A 3MI7X 2R2UA 2R7WA 4XO0A 1TL1B 1PC5A 1U6FA 3G86A 4ZPWR 2VFTA 3SQGA 1DQAA 4I6AA 2Q3PA 2UUCF 5L1IA 1WHYA 3AJ2A 1REVA 3OHBA 4ZCLA 1TAQA 2BACA 1RT1B 4ED0A 3W2VA 2N7CA 4KSEB 4M5DA 2ZH1A 3MMCA 1HBUA 4WF9Q 1FRKA 4RWXA 2WONB 3DM2A 3QJLA 2C3YA 4LT6A 5DRKA 1N48A 4B3TF 3K0JA 2GW8A 2Z0GA 2B6AB 2H5EA 2LDYA 3H5YA 1WI8A 3ITHA 5G0RB 5IT4A 1HR0F 3KLEA 4CH1A 2MHEA 1JLBB 3NWGA 2YKPA 4TLRA 4U6PA 3ENWA 5LMUF 2XEXA 4GKKF 3V5RA 5GADU 2WW8A 1X4BA 1TKZA 3HKWA 3KLIB 2HQ3A 3F44A 1XC9A 2FLLA 3E2EA 1SH3A 1DBDA 2BE2A 3WBZA 4QIFA 5K8PA 1Y00A 5FDLB 4DQRA 1LWFA 1U49A 2YWKA 3JSYA 5HN0A 3VAJA 1LQ9A 1QTMA 1H7WA 2NUHA 2NZ4A 5AXKA 4HH0A 5D4OA 3ZZZA 2W4CA 3HHEA 3POTB 4NPOA 1U2RA 4MH8A 3G71S 2BJDA 5HMZA 2RVJA 1S79A 4X62F 2HGMA 3GFZA 2DO4A 3HZGA 1JXEA 4I64A 1HBMA 4Z2XA 4BC9A 5C25B 4XPEA 1Y5NB 3IWLA 3RBDA 2FVQA 4HDGA 2IVYA 1FRHA 5B0FA 2DPIA 2XY7A 1WG4A 3BGRB 2YKNA 4EWTA 4DLGA 1JKHB 4AXJA 3R1LA 4HI2A 2B4PA 5I42B 2C2RA 4N76A 4HYKA 1HYSB 1S1UA 1IQTA 4UUWA 1Q8IA 1CQNA 4DL4A 3W2WA 2M3DA 2M8HA 1SUQA 5HBMB 4ES1A 2OPPA 3M8RA 3BO4A 4OHYA 2IM1A 2LECA 1WELA 3GG1A 3SSSA 3MUVP 4B9MA 1FEHA 2FJDB 3DRSB 4EU0A 1K1QA 3MMBB 1KOOA 7FD1A 4X4TA 3O44A 1APSA 2XULA 5A0YA 1HW9A 2RDJA 1FHTA 3GV5B 1K0TA 3M6WA 1F60B 2I5JB 2ZC4A 3RB0A 3PNIA 2ZZMA 1KONA 1HPZA 2NPIA 2DIUA 4JI1F 1FRXA 3LP1A 2WRMA 1GTEA 4DR6F 2XMKA 1UJ6A 2YH0A 4DUZF 3BSOA 3SEOA 3M4XA 1VIXA 3OXGA 4FP9A 2DGSA 1AXQA 2L41A 5HQ8A 3H5XA 4MFBA 4J37A 1T3NA 2XHWA 4P6QA 3UR3C 2ALZA 1NO8A 2GC8A 1X4GA