1EX8A

Crystal structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with hp4a, the two-substrate-mimicking inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate analogue inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase: synthesis and biochemical and crystallographic studies.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1ex8A00
4M5HA 5ETPA 3UDEA 1EX8A 1G4CA 3KUEA 4M5GA 3QBCA 3HSGA 4M5LA 4CRJA 1RTZA 1HQ2A 2F65A 5ETKA 2F63A 3HSZA 3HSJA 3MCOA 5ETQA 4CYUB 3UD5A 5ETTA 3MCNA 4M5KA 2BMBA 1HKAA 1TMJA 5ETNA 5ETVA 3KUHA 1RAOA 4CWBA 4PZVA 3HD1A 2CG8A 3ILLA 1F9HA 1RU2A 5ETSA 5ETOA 1KBRA 1DY3A 1EQMA 3ILOA 1RU1A 5ETLA 3UDVA 4M5IA 3HCXA 1EQ0A 3KUGA 3MCMA 4F7VA 3HSDA 5ETMA 3IP0A 1IM6A 4M5JA 1Q0NA 4CYUA 5ETRA 3HD2A 3ILIA 1TMMA 2QX0A 4M5MA 4M5NA 4AD6A 3ILJA 1RB0A 1CBKA 3HT0A
chains in the Genus database with same CATH superfamily
2VBXA 5A6WA 1R7IA 1R8BA 2DR5A 2DNZA 3OTOF 3MR2A 1IBMF 3ENQA 3FSYA 2HAFA 3P96A 3SQGA 4UF4A 4USMA 2BOAA 4OHXA 1Y10A 2V9KA 1NRKA 3CDUA 3RTVA 1BWEA 3T1HJ 2BJ7A 4USJC 1U02A 2W9AA 2EVZA 2B5JA 3BZQA 2C2NA 1FNXH 1E6VB 1S1XA 3D1HA 1REVA 4KKOA 1X0FA 1NZ8A 3DOMA 4ZJOA 4RUAA 1FVSA 5D6GA 1WI6A 2ZJRQ 4C0BA 1C0TA 3EPIA 2HMIA 5K14A 1XJWB 2G2ZA 3VVUA 1QTMA 1JXEA 2IM0A 3Q83A 4WXWA 2EXUA 3W5ZA 3BF4A 4Y65A 5KOWA 2XWXA 5JVHQ 3L09A 3ADAC 1VISA 4ECWA 1S1TB 1CJTA 2ZH8A 1W7WA 4IQMA 6FDRA 2ZJQQ 3DRYA 2DBBA 3DI6A 3TJ9A 4A8FA 1HWJA 1KVKA 1PG5B 1Y0HA 1SV5A 1J27A 2ZDPA 4HHJA 4IO9Q 3PJWA 3OV7A 2YX1A 4IFYB 2DEJA 1LKZA 1L3SA 3PKMA 2CQ1A 3AXMA 3D2WA 1REGX 1B7YB 3TA2A 1WHWA 2XG8A 2ZHOA 3OQ2A 5ETNA 4YY3F 4YFUA 1S10A 4K0KJ 3TUIC 2QSWA 3HVTB 2V5HG 3ELHA 1S79A 1XR5A 3MMCA 3C6TA 2BW7A 4UOCA 3FEZA 3B82A 4X66J 4ZIWA 4NPOA 4WPAA 3I87A 5A8RA 2E1MC 3MTKA 1URRA 3MPYA 3EVOA 2B4VA 1WG5A 4DUZF 4M5JA 1MSWD 2RKIA 4QWCA 2XY5A 3KK1B 3C6UB 2Y1JA 2ZE2A 4CP5A 2XZWA 1RDRA 2JVRA 2O3DA 3LWMA 2PMHA 2PO4A 5A8WB 3UDLA 2X3DA 4FP9A 2Y1IA 4HT7A 4WFNQ 1DRZA 4OYAA 3TJAA 1LEOA 1XN9A 3ITHB 2MLXA 4OLPA 2UXCJ 3GMGA 4DZDA 1N5QA 1P27B 2V2KA 3S8SA 2JL9A 4C8OA 1URNA 1EP4A 4K4UA 2PMWA 2HIYA 4O23A 1NUEA 2PI5A 4F4YA 1HKAA 1KWMA 1KN6A 2XCAA 1SL0A 2LQ5A 3THPA 3MM7B 3HD1A 4GVBA 3HJFA 2FLLA 4C8ZA 2M8HA 3Q8QB 2DR9A 2Q6CA 3LOUA 4CLPA 2YX4A 4LFBF 1VBKA 4NYOA 2VG7B 3EDQB 1O0PA 4K59A 4X84A 4XTTA 1U24A 2DR8A 4JI6J 2BANA 2ACMA 2D69A 3RYLA 3ZTSA 3TA1A 3ET6A 4ZLNA 5L9NA 5T14A 3RB4A 2JLGA 3BGOP 4LF2A 5C25B 3NCPA 4OI3A 4FVCA 2B0GA 3TEHB 3TI0A 1LQ9A 3SCJE 3GR0A 2ZJPQ 4DPTA 3RB6A 2OO4A 4LF9J 2AKWB 1HWLA 1YLXA 3US5A 5JUMA 2XC9A 4LQ3A 4P6QA 4RO0A 3LWLA 1N54B 3DGPA 1LW0A 3T5LA 2ZUGA 3DXSX 4XAKA 1PYSB 1S77D 1QAYA 3CJ0A 1FXRA 5E3CA 3M30A 5C42A 4Y0FA 1DLOA 3QO9B 5D0GA 2IFXA 5EX0A 2MGZA 1NJXA 3NLCA 1RT6A 5E0OA 3UDVA 5E3PA 1KR4A 2R2TA 4LIWA 4V1Ak 1WHXA 1S7HA 1P6TA 4DPOA 4FVMA 1VLYA 3EMTA 4FNHA 1S1UB 4LF7F 1S1WB 1FX2A 2J7KA 3NWGA 2JLFA 1C0UA 3RRKA 1QSLA 2QC3A 2UP1A 3V81A 2W7OA 2OPRA 1EX8A 3FNNA 1TKTA 4Q2MA 1SQEA 3GYGA 3TEGA 2OUGA 3W61A 4M94A 3G9CA 4LSNB 3R9LA 3D66A 2IRXA 1RAEB 4NMXA 4P72A 3KMSA 4ES2A 2VBWA 3GIRA 1IKXA 1M0SA 2IRUA 1OQ6A 1RT5B 4H4MA 1UVJA 2E5JA 2KYXA 3OR2A 5ETVA 1UMJA 5GMEA 4USKA 3KTQA 4E0DA 2NS1B 4I68A 4K5RA 4M63A 2HHSA 2FD2A 5DZ7A 2O66A 3PW2A 1MMDA 4K0KF 2HQCA 2A18A 4G65A 3LGNA 3MEGB 2E9TA 1BE4A 2K7JA 2FJDB 2UU9F 3V6DB 1HHSA 2HVDA 2KO1A 2R7OA 1TL7A 2OEMA 2DK2A 3EZOA 2EFGA 4O3QA 1C4AA 1RISA 1GEHA 3CJQA 4FNIA 4TY8A 2FJXA 3I4HX 4DQPA 1C1BB 2M4MA 3VHQA 3KLFA 1CJUA 4NLWA 5KT3A 1AUDA 2CKWA 2O01C 2WZ1A 4PABA 4RW7B 3KDOA 3BH6B 2YKMA 4PQUA 3EZUA 2L08A 1N4LA 2Y8YA 1FCAA 3G6YA 2R4FA 2H5IB 4R5PA 1FRMA 2GC8A 4OX7A 2XLIA 2SXLA 1S6PA 3KUHA 4OHZA 4NXMJ 3GG0A 3IWLA 4NCGA 4DFPA 3WHIA 2V6AA 3QIDA 2MZSA 2YNIA 3IGVA 1C4CA 3WQPA 3ENVA 4A47A 4DPWA 4NYPA 1YQHA 1T11A 2JHEA 4ZLLA 1VRQC 5GMKa 2AIRB 2J9EA 3GIMA 1DAXA 3Q24A 1UEUA 3AJDA 4OX8A 5A0YB 1YZ7A 4S0MA 4RZRA 2N82B 1UCNA 2XGPA 1YG0A 1ELOA 3AODA 2GMHA 5FD1A 2BRLA 3HFVA 4DL5A 2ZH2A 1APSA 5KFQA 3CCES 1LOUA 1HBOA 1YJRA 3PACA 4WXOA 1WC3A 4WK3A 4QCLA 3H5SA 2YNFA 3OFHA 2CPXA 4QWEA 2RJZA 4OYWA 4XIUA 5LMNF 4NCBA 4L75A 5DGAA 1RT3A 4YHHF 3TVZA 3MCSA 4FYYB 1YGYA 3IFEA 4CLFA 3CCLS 2EBGA 3Q8YA 3AA9A 3V4MA 2PA3A 3CCJS 2YNGA 2CG8A 2Q1LA 3DLEB 1EB0A 2DHHA 1LNQA 3BKTA 3UE2A 4J9SA 3T5JA 4CNZA 4JI5F 1KVIA 3PFEA 4CM2A 4HTIA 4A46A 3CDAA 4ZHRA 2UUBF 3I32A 2XS2A 2LXUA 3K57A 2VFSA 1IJEB 5LXYA 2YQ0A 3AA8A 2J9DE 2XMWA 2CDRB 3F41A 3W65A 3L9ZA 4HH0A 3GP9A 1HNXJ 3DRPA 1RWUA 2CPFA 1FDDA 3AOBA 2P9CA 3FUYA 4LF7J 5LXRA 2BJ9A 4AXIA 3HK2A 5F0UA 4A8WA 3V4IB 2E1PA 1NB2A 1Q8BA 3FSXA 2J7WA 4ECYA 3PYFA 4A8OA 1NK8A 3C3LA 2HHQA 2AX0A 4IKAA 5HL7Q 1SC1B 1HMVB 1SPBP 3ZFVA 4O3OA 4DG1B 5BR8J 2BE9B 2C2ZB 2RRBA 1WHVA 3N6LA 5HMWA 3CEDA 4X62F 4IH5A 1VRTB 2A10A 2ILYA 1C0TB 2BJEA 2L3MA 2NYIA 4O4RA 1KQGB 3M8ZA 2LMIA 5B0DA 1YRUA 1NO8A 5FDLB 5IZHA 5AJ3J 2ZBPA 2RUSA 3E3XA 1QY7A 1OYEA 3FVYA 1A9NB 2XZDB 1CJTB 4LF8F 1NZAA 1UVKA 4MK9A 1IUJA 5BXIA 1Y5NB 4QPTA 2G1DA 3JTPA 2QLFB 2AYEA 2ADBA 4G1PA 4M5DB 1WOSA 1BQMB 3AD9C 3MTJA 3NGRA 3TZZA 1WTBA 3H90A 5L8RC 1RTDA 1GTEA 4DSIA 1WWHA 1H72C 1IBLF 2PD1A 3M8PA 2LVWA 2XB2D 4LVOP 1AT1B 4EBDA 2J0QD 2MPUA 2NSBA 4DV0J 3ISNC 3MEKA 1EAYC 4HDHA 4JP8A 1KONA 4FXWA 2BW2A 2V4JA 2IA6A 3C6UA 1YJ7A 3R7SB 2V69A 3OFEA 2OKQA 4Y34A 2DGVA 4K4YA 4NXNJ 3S1TA 1VK8A 3ZZTA 1RCXB 2FJVA 2QSFA 1L3VA 4KJIA 3A3PB 1TL1A 2L48A 3MEEB 2GMLA 4ID5B 4DR2F 1M5KC 5SZTA 3J7YI 4DR6J 1C1CA 2F65A 3M2VB 3RGIA 3UN2A 1G2EA 4LREA 1X7VA 4IG0B 1SKRA 2DGUA 2AWZA 3ISND 2VZ9A 2VC1A 4R8UB 3QZ8A 2V9WA 2XS5A 3P49B 1JNZB 1ZOTA 3MCNA 2LXIA 4QIEA 4OX9J 1Q4RA 3OR1A 4NLRA 1RHJB 2FHKA 2ABYA 1V5VA 4GVBB 3CVKA 4TU7A 3BQ0A 5HLFA 3M9NB 5D77A 3TX0A 2DCUB 1PSDA 1RTHB 3GPAA 3C15A 4I2PA 1FJEB 5GVQA 3TQ1A 2XYGB 3PIPQ 1AFJA 3J80U 3L95X 4D3GA 3BO2A 1HI0P 3JAMY 3TVKA 1U2FA 1T05B 2XYHB 1QSSA 2BQRA 1PCAA 2HEKA 4Q44A 1TKXA 1IJFB 1UJ6A 2E5GA 3I5CA 1NSKL 1FK9A 3HT0A 4HEA9 5KFXA 2HFSA 1NNDA 1GMUA 4MIAA 5T41A 1M1HA 1TUVA 3UDCA 1TTHB 5HMZA 1Y9OA 2W9BA 4ZDNA 2ZBCA 1FKOA 4RUCA 3DFEA 1UEVA 4C97A 4LJMA 2R8IA 1RWXB 2VG5B 1HNIB 3DHXA 5EX3A 1WC5A 2B3TB 4CLYA 5M2PA 3C8YA 4U7UD 1X4CA 3IS9B 4F3MA 1WTFA 3CCWA 5E7OB 1XC9A 1T3OA 4Y2KA 2F1FA 2DGWA 4IRDA 4IRCA 2ZH6A 1WC4A 3JS9A 2F7VA 4BHQA 4CT9A 5DM6Q 2OMOA 4TU8A 1HIYA 3HF5A 3FFIB 4ZPWR 1C2PA 4NI2B 3OUYB 5J2PA 2BJ1A 4OL8A 1RLCL 5GMDA 2LEPA 5AJ3F 3DMJB 2HNZB 4WZQA 4QOTA 1VYAA 4ZVRB 2E1CA 1WOPA 1PKUA 2RE1A 5B0FA 2HFZA 4ED2A 1FWPA 3BREA 1VQMS 3AD8C 2VONA 4OHYA 2Q43A 4TLRA 4IFVB 4ED0A 4CO2A 1CQMA 5LSLA 1UA1A 1HA1A 4NOHA 3UVJA 4QYZJ 3DLKA 4ZPAA 1IKVB 1AROP 1K0TA 1JXVA 1R6YA 2HQDA 2WRMA 3BDPA 1T9WA 2NZCA 3QFHA 3KHGA 3LUYA 4PUOA 2CADA 2YVSA 4NLPA 2MQLA 4CLKA 3L7UA 2BOPA 3RB3A 2IMWP 4L3KA 4USIA 1JNRB 2LXFA 3JXOA 2HHWA 1JX4A 1GXLA 1VHFA 4U95A 1HBUA 1IKWB 2BJDA 1JLEA 2HURA 2E44A 2MQNA 1QUPA 4NA3A 4OZLA 2ZH4A 3V6DA 1L5UA 2NQPA 2YKAA 4PG6A 1YJTA 2R7SA 4M1KA 2WVFA 2Y1RI 4TVAB 5KFUA 2GCFA 3K17A 3NGKA 4ZVEA 4ZA1A 2NR0A 1EKSA 1C1BA 4LFAF 2QYGA 1GMWA 4M5GA 2AQ4A 1PYOB 3D9BA 2R7UA 5H9FJ 2V8VA 4OZ0A 1N5SA 3CD6S 4MTPA 5AXMA 3KJVB 1N6QA 1EJ7L 2VQEF 2C2DA 2AHOB 4KFBB 3TA0A 4AYBD 4AQYF 4MIWA 1HW9A 3A1YG 2OD4A 3QIPB 2QZ8A 1XIQA 2ZWOA 5DQIA 3J81U 2HQFA 3H8YA 2NPIA 1U25A 3MAAA 4KO0A 2E5HA 2CAJA 3PXGa 3W2WA 3QRPA 3ILOA 4UZCA 1X5PA 3THVA 3GYNA 5F41A 2AU0A 4DXLA 2YKNB 3G8TA 4B3MF 1RT4B 2QA2A 2AJ2A 1QAXA 3NP5A 3IN5A 1H6KX 2K2PA 2KB2A 1NCLA 1Q78A 3QATA 1ICEB 2MLZA 3MMJA 3QT8A 2A6MA 3CJ8A 4KH1B 4X64J 3N4WA 1CULB 1RHUB 4UUXA 3KDNA 1Q82T 3NAIA 3L4BC 3CJKB 3R8YA 3LP1B 4CO5A 5DQGA 1FJGF 2HHPA 2H65B 3PO5A 1SH2A 5IM0A 3TW0A 3CCSS 4LF6F 1YZ6A 3OFFA 1VQSA 1CJKA 1ROFA 1D1UA 1TVRB 3MMBA 2Z56B 5HAOA 4MKVA 3PRDA 4HDGA 2QN6B 2C2KB 2ROPA 3ENWA 1WG4A 2ZKUA 3G86A 1N34J 1FDAA 1LFWA 2E1AA 4QR1A 3ZZOA 2G9OA 3DM2A 2ATCB 1I5OB 3CD0A 4P9SA 1HBNB 3IM9A 2PA8D 3KJNB 3MGJA 3Q8UA 3A3NB 1U4BA 3T5KA 2ZD1B 1YVFA 4QYRA 3Q8RB 3U7JA 1FFGB 2JZ5A 4TKTA 1YJ9S 2ZOGA 3MEDB 5I3UB 4Q0BB 1VQ6S 2R42A 5CH7B 5F8JA 4Q8FA 3PKYA 3HXMA 3D3BJ 4JI1F 2FDNA 4KPCA 1RTIA 2WVBA 1KQSR 4L74A 4O4GA 1SJRA 4DG1A 2FYXA 3IMQJ 3DKDA 3GIKA 1G3OA 5U47A 3N6MA 2VB6A 4X4TA 2YPZA 5ETSA 4Z7CA 4RR5A 2CPYA 4Q5VA 5EHHA 2A0FB 2HQIA 3BSAA 3OPKA 4JI7F 3HHLC 3E01B 3GSIA 1HNVB 3RBZA 1WC0A 5LJ3Y 4YB5A 3QWPA 2VF3A 1BQXA 1SUQB 2VJUA 1ZH5A 1ZAVA 4KV8A 1SKSA 2DXFA 5D4PA 3UDEA 4JI3F 4RWXA 5DRKA 5L1KA 1RYSA 3MXHP 4DR1F 1V3SA 3UFCX 3O8WA 1B0VA 2D3OR 1NK7A 2PI4A 1R31A 2BKPA 2G0IA 2FHJA 2KT5A 2XEXA 3LALA 4EBEA 3GJQB 3KK2B 4DUYJ 3BKFA 5THWA 4XDCA 4WKYA 3OTBA 2UXDJ 4RUHA 4Q43A 2H5JB 4ELTA 1TKZB 1UW4A 4BC7A 4CQ1A 5F9LA 1V9OA 2OPPB 3EVWA 3L7OA 4NLDA 3M4XA 4NLOA 4H54A 3UQSA 4CLTA 1X5SA 3KHRA 3POTB 2OSQA 2Y1LB 1JLFB 4U7CA 3TX8A 4FF2A 2QX0A 5J1EB 3OVSA 1M90T 1Q5YA 3NL0A 4F02A 5KFTA 3MPWA 5KG6A 1X4HA 4M5HA 1GH8A 2EFVA 3R5GA 2VFTA 2EK1A 3X1LB 4HACB 1MU2A 2OEKA 2MKJA 3Q23A 4RNFA 3PJXA 3CDEA 3KWMA 4ENOA 1I94J 3GE9A 1KLMB 4TLQA 4FS1A 2YH1A 2YXLA 2JLEA 1FRLA 3DYAB 7AT1B 2YWEA 8AT1B 2DIUA 4EUVA 1NB7A 4A48A 2IC3A 4X4SA 5J2MA 4BDPA 2VOPA 3FMWA 4NZ7A 3I0RA 3I5AA 3KHHA 1UVMA 4JV0A 1HBMB 2CNNB 4B9TA 3QT5A 3OVAA 4R0EA 2HBQB 2V2VA 4PXEA 1R89A 1U0HB 3DOKA 2IRYA 3BYPA 3KUGA 3N6NA 3QZ7A 1T9UA 2CIMA 4ZVGA 4QQBA 4D3HA 5BYSA 2B8QA 4DL2A 2NCKL 3VQSA 2YBVA 4GMKA 4ED1A 4OI6A 1T3NA 2CQIA 5DDOC 4CZCA 3UWTA 1RK8A 1R0BG 1Q16B 1UFLA 4FF4A 2JDJA 3MZIA 1IKYA 4QWDA 1KDNA 2B43A 3H20A 3W9JA 3H25A 4WBFA 1LW2B 3DXBA 2FQQB 5HQLA 4ZN3A 1BMQB 3R3TA 3TP2A 2BE7D 4WJBA 2BX6A 4Y28C 9ATCB 4X65J 1HNIA 3IWXA 3PTWA 2I2YA 1DTTA 3M2UB 1TELA 4MKYA 3PEHA 1QVFR 2CXEA 4X4RA 3R5AA 2MZJA 2ZVSA 4C3KA 2Q6BA 2BM1A 1XTZA 3WZ0A 1RWNB 1AZSB 3PX0A 4EFAC 2XI3A 1U1NA 3DLBA 1K0VA 2CFXA 2G0CA 2H4YB 1DHMA 1UJ4A 2YNHA 4M5IA 3TAMB 3G82B 3HHLB 5HBMB 5IT4A 2MZTA 4DJBA 3BO3A 1U2CA 2AW0A 2Y0SD 2QL7B 3PW5A 1XQIA 4JI7J 3LP2B 1B0PA 1RA7A 2MZRA 5HMXA 2GQ2A 5HVGA 2MKKA 4QR2A 4K50A 2I6WA 4DL3A 3BSCA 1FERA 1ZPWX 4QWAA 3EXCX 4ZCMA 3M8QA 2GJFA 5MAOA 3BGRA 2E7WA 2CPDA 2RSQA 1T02A 3CC2S 3EJMA 1VQOS 2QA1A 2XLKA 4KHPJ 2L9WA 5T7LB 3CO9A 4HH1A 3IR6B 4EK2A 1W26A 2B7BB 3F73A 1TR0A 3FGVA 4MFBA 1ZM9A 4EU0A 3TNVA 3SI8A 1UW9A 2VDIA 5JVGQ 1FDNA 2FZKB 3AY0A 3ILLA 1S6OA 2GIQA 3CCUS 4J9PA 4FPIA 2FPHX 1UJ5A 1VQ4S 2VBZA 4CTAB 3PR4A 3G8SA 1NH8A 2ZITA 5KFFA 4K5SA 4L76A 4RL1A 4CYUA 4Y2CA 3GFZA 3MM9A 4RW8A 2HYIB 1OMSA 3AQPA 4OYMA 1XNRF 4X4VA 1TV6B 3LAKA 5AE1A 5KFHA 4WFXA 2MKHA 4LSZB 4P75A 2B4OA 5EUHA 5IQQA 5HO4A 4YY3J 3MAQA 4DSFA 1NK4A 1JXLA 1VI7A 4JV5F 2HHVA 3PG9A 3MURP 1SB6A 2XULA 3TJ8A 4AL5A 2KZZA 5FLXY 1HI1A 3DCAA 3DRXA 3VGUA 4WFBQ 3B54A 1FA0A 5CXTA 2VH7A 4G1QB 3RBXA 2I38A 2K1RB 2A6OA 4P7TA 4DLGA 1G1XA 4DUZJ 1JJ2R 5J2NA 1VFJA 3G6VA 3MAAB 4H4OA 3KK3A 3CMES 4I56A 3DU5A 3BPSP 1S12A 3JQKA 2MKYA 2ZDOA 1FRKA 2PIIA 1QD1A 5DM7Q 4ZK7M 3K5MA 1XMBA 3M05A 2N7YA 2XQCA 4LF5J 5LL6d 3H5YA 2HGLA 2UUCJ 3VV2B 1JLCA 3VZIA 2QV6A 2UXCF 4Z2XA 2KTQA 1VQ8S 2C3OA 3A8IA 2WVCA 2KRBA 8RUCA 4W90B 4HR2A 4UTGA 5HMYA 3U1NA 2W4CA 3BN4A 1RACB 2VFRA 3MECA 5D15A 3FCVA 4CO1A 3MR6A 4FF3A 1UTAA 2LFVA 5ETKA 1WOOA 2Z30B 2OPSB 2WOMA 3KXDA 3RAXA 2E66A 5I42A 1RHRB 1LWFB 6AT1B 1TVRA 2ASYA 3CJ5A 3BEGB 3MMBB 2J0XA 3P3DA 4ICLA 4KH0B 4ZPBA 4N47A 3W64A 4C11B 5J1PA 3E51A 3V6JA 3FBEA 2R8KA 3EGZA 1V3RA 4P7VA 2HGMA 2GVZA 3UW1A 1MG7A 3HSDA 1F5AA 1QE1A 1AB8A 2YQ3A 4PYAA 1P1LA 4DF4A 2YWKA 3MOJB 2OI2A 2G2YA 1D8YA 2H3EB 2HNYA 2J0SD 1F5CA 4ZLJA 4EO6A 3D6FB 2VFUA 3M32B 4C3LA 2UUAF 1UWBA 2ZFHA 3H7HB 1RABB 3QNWB 2JFKA 2JJ4D 3PJ9A 3TWZA 1L3TA 1JIHA 1TUWA 3HVAA 1RI7A 1RZMA 4I6AA 3ZTRA 3ISZA 4QWBA 2DNRA 3V6KA 5I4MA 5KG3A 3TAPA 4ZCLA 4OJ1A 3QQCD 4NLXA 3EGVA 4QBUA 4AFFA 3HFKA 4PRFA 2AJ0A 2J9CA 1IQZA 5CHCB 4N56A 4X4NA 4KTQA 1N5TA 5HN0A 2IM1A 3LP0A 3HHEA 5ETOA 3AHPA 5C7PA 2M70A 2JWNA 1XK8A 3NG8A 2RDJA 4LBIA 4PEOA 2E9ZA 1T7PA 4J9VA 2J0WA 2CPZA 3BKUA 1BD6A 3O1LA 4BLGA 1LWXA 3OL6A 2EKNA 2XMKA 1UP1A 3J7YU 1REVB 3BV8A 3HPOA 1NK9A 3VVTA 1KC8T 3GV5B 1J5OA 4Y00A 4ED6A 4FXDA 4JI2J 3TUPA 3OHAA 1H2UX 2X51A 3R1HA 2U2FA 4KGMA 2F63A 2V2QA 2W2QP 5D3GB 2K7KA 2YTCA 3E8OA 3FZ2A 3LPEA 3Q2SC 1RHKB 3NGDA 2VOOA 5K8NA 4MJKA 2PMZD 3I0SB 3BQ2A 2UVVA 1FNOA 1HWKA 3FMBA 3QGHA 3MM6B 1DBDA 4JI0J 2AEJA 2QG9B 3ZZPA 1R0CB 2IJRA 1YBUA 4DU8A 1FFWB 3K58A 2R2RA 4CCHA 2XMTA 2IAJB 1KOHA 1ZAXA 3POTA 3K8VA 1GK8A 2B6AA 4ZVQB 2B9WA 2XLJA 3CUNA 3VAFA 1UKUA 2P6TA 4C0HA 2RF2B 3DRRB 3UNGC 5DJBA 3M9OB 2GVDB 7FD1A 2CZ9A 2QFJA 3H98A 4LRCA 3GLJA 2X1AA 4DV4F 3ZTPA 5IT0A 2C2OB 1N56A 1JKHA 4Q45A 3K2YA 3D4JA 1I51B 5L1IA 3EDRB 2BZ2A 2DISA 3PYDA 3SQGB 4ETZA 1SH3A 4X66F 1SJ3P 1K1QA 2J6TA 1LWEB 5KG4A 1LWCA 2JEJA 3G6ES 4ELVA 4V19J 1A0OB 1FX4A 1HHQA 1TU0B 2W9CB 4QW8A 5EWGA 2ILZA 5KFSA 3WX8A 4USWA 3V6HA 1DZ5A 4ZP8A 3P6YC 2DXEA 2BE2B 3LGMA 4DR3F 1VC6A 4F3OA 3R2DJ 3P5TL 5GADU 1KBRA 1RKIA 3BR9A 3CDWA 3ITHA 2AZ3A 1W25A 4OI4A 2YKOA 3O44A 4TYAA 2GGPB 4W98A 4DPYA 4DR4F 1N32F 4WCEQ 1D09B 1Q0NA 1SL2A 2V2ZA 2KFZA 4Q7AA 3I55S 2G13A 5D0EA 4AE5A 3U1MA 4MKAA 4B9UA 2YPYA 2C28A 4UQGA 2DR7A 1ZM2A 2AP6A 1N33F 4YDDB 4AUKA 1CLFA 2DY1A 4A8XA 2JRSA 3KLVA 1FTRA 4ITSA 4JI5J 4I7FB 3N01A 4F36A 3ET6B 1XBWA 4B9MA 2DRAA 4ZPCA 3OLBA 5DLFA 2J76E 5C25A 2XMMA 5C42B 2IBKA 3MMCB 1NJYA 2AGPA 4LFCJ 1U09A 2ATLA 2LQ8A 3HHDA 3EE3A 2YNHB 4DEZA 4Z37A 5DG8A 3G82A 3HHLA 3T9ZA 3OTEA 1VIXA 1X4FA 3JSYA 2D3UA 4NZ0A 2JEIA 4FBUA 4MYTA 2N7CA 4HHUA 1KQKA 8ATCB 3NWRA 3CCQS 1DARA 1Y5LB 3RG6A 2BBEA 4F4ZA 1JB0C 2HZCA 3HD2A 4FYVB 2L41A 4DSJA 1S9GB 2NUUG 3UCUP 1E6YA 3HVWA 2UZAA 1OYDA 1RT7B 2CYYA 2CVIA 2NXCA 3D67A 4DV5F 1OY9A 2DGXA 2DXDA 1FRJA 2IJFA 2RMLA 3C14B 5L9XA 2XCPA 3TAQA 1FT8A 1T95A 4FXVA 1N8RT 1JQGA 1IBKJ 2RQKA 4HKQA 4LMZA 4NL5A 5CA5A 1D0EA 3K5LA 1JWWA 4TQRA 1RSCA 1C0UB 2OHDA 2CWXA 1P1TA 4I6YA 4CNYA 3V81B 3EXYA 1LK7A 2VU5A 1RA6A 4P2FA 4KQZA 3ZNUA 5JXSA 2E9RX 3QMQA 4LSNA 3BS9A 2VG7A 2H48B 3FEYB 4DDFA 2KFYA 4LBPA 3SSQA 2GHPA 2C3PA 2MHNA 3SSSA 4LFAJ 3GONA 1TMMA 4DFKA 1SJFA 3KNAA 4AD6A 5CCLA 2QMXA 1Y5IB 4USVA 1CPZA 3FBFA 1L3UA 4RLEA 4EWTA 3QT7A 2M88A 2FJEB 6FD1A 4EYHB 5KFZA 2ZH3A 5D4NA 5A2QY 2LEBA 4DV0F 4RX6A 1RADB 4QPXA 1X9MA 2JEGA 5KFPA 1NJIT 1TQLA 1TL7B 3BBBA 3LGHA 4H4OB 4OYIA 3MFIA 5H9EK 2OPQB 4OYZA 1OY8A 2MGZB 3M6UA 1RU2A 4ZVUB 1R8PA 2DT9A 2R7XA 1R0AA 1S57A 1T03B 1TL5A 4JI4J 4DR6F 2KM8C 1U6FA 3GU0A 4J9NA 4WE1A 4RW6A 3SV4A 1OPIA 1OWXA 4QIVA 4TN2A 3SCLE 1VJWA 2OPRB 3EM1A 3UD3P 5HJYA 1FXLA 4LRFA 2QTWA 1E6VA 4L73A 1GAOA 4GC6A 1YRTA 2PDAA 2G1HA 1WEYA 2GO8A 1VDHA 3J80Y 1FI4A 1VIOA 2XMVA 2HZVA 1YJUA 2D7SA 2HMIB 1VMBA 1QJHA 2Y3YA 2CQ4A 2HRTA 3OR2B 4ZN1A 4GKKF 3BGUA 5HROB 4DX8H 3J7AN 1RBLA 1RWWB 1NK0A 1R8CA 2HFNA 1XEZA 1RHMB 3DNCA 3T41A 4QIGA 3JYTA 2MY8A 2IBOA 4P52A 3BM7A 3ICLA 5LOQA 3Q8PB 3DI6B 1WJ9A 2E5LF 3DHWC 4PYDA 2C3UA 1SKWA 4PCQA 4FBTA 2RT3A 4A8MP 1FJCA 2KG0A 1CC7A 4FS2A 1RHQB 2VPXB 3ILIA 1SH0A 5IXUA 3MUMP 4ECXA 1CEZA 2AJ1A 1U0SA 4ZPVR 2VKRA 2WW8A 3OXLA 4KAIA 2BACA 5ETPA 5G0RA 3D0GE 4ED3A 3TARA 2NZ4A 1CS4A 1X4GA 2GJ2A 5A8RB 1KS2A 2W1BA 4B02A 3MCOA 4G6VB 1MN9A 3MI7X 4GO5X 2NLWA 4CO4A 1SC4B 2YWFA 2JSXA 2AMCB 4DV3J 2CDQA 4DX6A 5J2QA 1KRPA 3HLUA 5SUHA 2DCLA 1SJ4P 2YNIB 1WUUA 3VAMA 1TKDA 2CJKA 4A4JA 1DY3A 3GJTB 2CG4A 5ITHA 3CIMA 1U49A 4PAAA 4DZ6A 2DH8A 1NKBA 2MQOA 2AZ1A 4J9OA 1OY6A 1R6VA 5AXKA 1J2VA 5B0EA 2FVQA 1P8GA 1U1PA 1NPRA 4NEZA 4EGLA 3MM8B 3RZAA 4AXJA 4DSKA 1YKWA 2FLOA 5A8KB 1X4BA 2XNRA 4HT5A 2H9ZA 5IQ6A 2IPOB 2PN6A 2J8AA 2Z2ZA 1A6LA 1SC6A 4X62J 5BR8F 3BSOA 3VAHA 3FEXB 2ZH9A 2B4UA 4O3RA 4Q2LA 3ZZZA 3MPVA 4U8YA 3FKBA 2FC8A 2IJNA 2O67A 3O2IA 4OJGA 1Q53A 2FB0A 2N3LA 1WF1A 1QTNB 5H9EJ 2DH9A 3WC2A 4LFBJ 3J7ZT 5CYQA 1RAAB 3PW4A 2D9PA 3NS7B 3WX4A 3KMQA 1N52B 3Q86A 2ZHBA 2FTRA 1N48A 1PILA 4P10A 4EO8A 1P9YA 4Y2IA 4ZP7A 2R7TA 1EQ0A 1D9FA 1RP5A 1S48A 3VCDA 3IP0A 5EDWA 1PBAA 1K8AT 2H51B 1TFWA 3DRPB 4ZCKA 2DRBA 2ERRA 1B0TA 3R97A 5F3ZA 1KLNA 3ZTOA 3KUEA 1IBLJ 3T3FA 5E3AA 4OYOA 3V4IA 1NJWA 3KLGB 1WKKA 4O44A 4ED5A 1IR1A 2K3KA 1BQNB 4QW9A 2WBRA 1HQEB 1ZA1B 4K2JA 1SCJB 2CQ0A 2NXJA 2BE2A 2D1CA 1EARA 2J8SA 1RTJA 2R3VA 3MD1A 3SEOA 2GV1A 1AFIA 2KVIA 1VRTA 4NXNF 3SQOP 1C1CB 1RGVA 2H1YA 2ZBIA 3NCRA 3OSNA 4F67A 2FVSA 1K1SA 2MKSA 4B3OB 3HMJG 1NDPA 2MXYA 2VD3A 3HHLD 2DGQA 4WTOB 2ZH5A 4QIFA 2VG6B 3RW7A 3PZPA 2X1FA 4UOGA 4YB6A 4H4MB 3EVMA 5BJRA 2X3GA 2VPYB 3W66A 4ANCA 3C16A 2FJWA 1VQKS 4B08A 1U1KA 2DNOA 3DGVA 2K06A 2ZBRA 2YQ1A 1TZ0A 4I2PB 1WSVA 2RVJA 4OV6A 3FSIA 2FLNA 2FIUA 3CJ3A 1HQUA 1JJHA 2MDAA 4I7FA 4OHVA 2V8HA 3ZC4A 4KB7A 2RD5C 4PPZA 3OXGA 2MB0B 2LA4A 2CJYB 2RDIA 1WDDA 2IA0A 3Q2TC 1FKPA 3IAS9 1U45A 2EK6A 1ZAWA 2VC0A 2KJVA 1BC6A 1QDUB 2YKQA 4OI2A 3I9V9 2XMAA 3M1VA 3OTCA 4JYAJ 1MLAA 3D5MA 2HK3A 5DDRC 2UXBJ 1HARA 2PSZA 1M5HA 2CVEA 2M8DB 4DCPB 5HATA 4F04B 4OYBA 2DHAA 2M7SA 3A8KA 5KFLA 1S9GA 3KOAA 1DQ9A 3W60A 3D28A 1BY9A 3M8WA 3DLJA 2DGOA 3Q0AA 1ZS6A 1UVIA 1S1VB 3C14A 4QJVA 5F8MA 2E5IA 1F6TA 4C98A 4ZVPB 3JSMA 1FKAF 3AXKA 3QPIA 4K4SA 3FFIA 4LF4J 1VRUB 3R5BA 5HANA 2ZUAA 4K4TA 1UA0A 1VQNS 1OSDA 4PG8A 3CXCR 3G96A 5G4DA 4NEYA 5DGBA 1JJ4A 3MD3A 4N77A 5HP1A 4F4WA 5IT9Y 4WYWA 3AJ1A 3FJ2A 4OZ2A 4DV1J 2R8JA 2FGCA 3RBEA 3KG4A 1BXNA 2DGTA 2YKPA 3AAWB 3FCHA 3A8JA 4H4KC 2ZM6F 4DR1J 3CC7S 5KOXA 3B8HA 2EG1A 3M8SA 1TKXB 3IXQA 1FK9B 1LK5A 1MW7A 4P71A 4C8NA 1BLUA 3PDNA 2WVEA 2HRYA 4YQWA 2ASLA 2YNGB 2FVCA 5AT1B 4RNOA 2DVIA 2ZVIA 3HO1A 1FKOB 4I67A 5CYMA 1IKWA 4C8KA 1MNEA 3GFHA 1FRIA 3IBWA 2VG5A 2HKEA 4NZ6A 4ZHRB 5CCMA 1KOOA 2B51A 2MQ8A 1ZBTA 2QLJB 3KLIA 3PRBA 1SC3B 2HIQA 4NXMF 2CJ9A 3HT3A 3HKWA 4Q8EA 2QGFB 5IC4B 2FHMA 2U1AA 4X4QA 2DD8S 1K47A 2VA2A 4LUBA 3IC1A 5B7WA 3ETMA 4QIWD 3HI9A 4RPFA 1T03A 1EQMA 3MFHA 2XI2A 1AW0A 1SIWB 5HQ8A 4OX6A 3UD4P 1RE1B 5ETMA 2R7QA 5J2PB 2F4VJ 1G6BA 3LF0A 2IYGA 2H54B 2J5AA 4NI2A 4DBQA 3P45B 4WE1B 2WB1D 3OUYA 5B0AA 1WG1A 3DMJA 5KFIA 2VQEJ 3QJJA 4X65F 5KFDA 2EKYA 3C19A 4KO0B 1XNQJ 4X4UA 2GQCA 2K8GA 2UV8A 3QT6A 4J90A 2LDIA 4RBUA 3OL8A 1SQGA 4CT8A 4J9RA 3R7NB 1S0NA 3CIZA 5C5JA 2LA6A 1XR6A 3CDBA 2F5GA 2KHDA 3FK4A 2CQPA 4MK7A 3UVJB 3J81Y 1W2IA 4ER8A 4ERDA 2HHUA 2DNHA 4DUTA 4JOUA 1DTQB 2QL5B 4DSEA 4DFMA 2A1BA 1SJ1A 3JYTB 4F25A 3THTA 3EX7B 2ZBQA 3CJRA 4DR5J 2QMWA 3HCXA 3LP1A 3JQMA 1NK5A 1Q79A 1T9YA 3A3OB 4TU9A 4ZJQA 1BQMA 2XNQA 3MPUB 1CJVA 1R3NA 1EKRA 5M2RA 1FJGJ 1HNXF 2WHOA 2BABA 1PJ5A 2QT7A 1TL3A 4KRWA 4PXBA 3MR7A 4BCAA 1U48A 2OTLS 4DR7F 4B17A 2DB1A 5LM7E 2F9DA 3Q8VA 3IRWP 1RTZA 3TQEA 2I1RA 3C2PA 1MMLA 4OI1A 1P9QC 5L1JA 4KFBA 1FFSB 1RJJA 2V50A 1QVGR 4AL7A 4GKJF 4GC7A 2CQDA 3CF5Q 3ONQA 1G7CB 3DC2A 3H2LA 4F0MA 1NDKA 4LF4F 4KIAA 4QU6A 3D6TB 4YEAA 3ZXWA 4LRDA 3JSBA 4KGKA 2B9YA 4E8UA 2MKIA 4XPEA 4C8MA 2WAQD 3JQJA 2BYCA 3M2VA 1RT4A 1WF2A 4MKBA 5B08A 3M2RA 1RTIB 3G6XA 4O4GB 4N41A 1KVJA 5KG1A 4O0NA 2ASJA 4WWSA 3GSDA 5LMUF 4ELUA 1NM2A 3GYXB 4DV6J 2OEJA 3GFXA 4OI0A 3CJKA 1F9EB 3DU6A 1S9EB 4NLQA 4UQTA 5KG7A 1YTYA 2VA3A 2KFNA 4ZOSA 2GFFA 1HNZF 2HPUA 4LSLB 1U1QA 4DSLA 1WD6A 2COLA 4NCAA 1U26A 2UVUA 2KYZA 1JLAA 2W2MP 5KT4A 2AD9A 3RJMB 2MHEA 2FY1A 3QWUA 2FC9A 4UY8T 2P8IA 4PZVA 4C3MA 3S7RA 4NE9C 4DLEA 4UY85 1EZZB 3KFWX 3UN5A 1NHUA 2ZC3A 2MEWA 5H1SV 4J9LA 1DQAA 1Q1KA 2HG4A 1V3ZA 2DJWA 4UW2A 3NGUA 3W3SA 2QA4G 1KTQA 1QUVA 1RAIB 2N4DA 3FQKA 3QYYA 3JAMU 3KLEB 4C9DA 1RT1A 3H0PA 3Q22A 2C2RA 2RIJA 4DQQA 3K5PA 4O3PA 2OPPA 5IV4A 4P2XA 1KHWA 4ETXA 5GAHI 3F56A 1MROA 5BYQA 3VALA 1HQEA 2KKHA 2MZQA 1YRXA 2VDHA 4TXSA 3BGLA 4KBIA 4C48A 5ETTA 4UT4A 5KFJA 2BR0A 1H73A 5D78A 4CI0B 5D8HB 4RU2A 2GHVC 3PEJA 1KTVA 2L9NA 2M2BA 3I56S 4DPXA 2F9JA 4F4XA 4ANEA 1XMOJ 3J81j 3TZWA 3SCIE 4WFAQ 3E2EA 4B3OA 2GA7A 4FYWB 2V63A 4I64A 4KGVB 4ED8A 1XMQJ 3NS6A 4MIBA 3GB0A 1NHKL 2CNKB 2DPJA 1NSAA 2QFIA 3NNAA 1GMWD 2BA9A 2W2NP 2LCWA 1I94F 2IC3B 1UETA 1F60B 1SUQA 3B78A 4W4MA 2B5JB 2KRRA 4F50A 3WIVA 5HK4A 1S1XB 3EZ5A 4HTJA 3DOMB 3DRSA 3RUBL 1JLBB 2F8HA 4BC9A 1K9MT 3PHEA 1VK3A 2CZ4A 3SDEA 4BWJA 2YWGA 4OYXA 2GJIA 1HBUB 4TY9A 4HLBA 1UZDA 4HI2A 5CQGA 5FIIA 5CAAA 4UZBA 5L1LA 1IKYB 2D41A 1S7IA 4ILMA 4OQJA 4CM0A 1KSPA 4LRBA 1F9HA 1FDBA 2VJVA 1CQNA 1U47A 2Q3PA 4DV7J 1J5EF 1B64A 5KFYA 4IDKB 2V8GA 1NPPA 2Z57B 1DTTB 3M2UA 1RAJA 3VGVA 2ZNYA 2NPFA 1KD1T 4U96A 4K7QA 1NSQA 5HLFB 1XNQF 3PV8A 1H38A 4J9MA 3VAKA 2BKNA 3QLHA 1HLWA 4CLLA 3V5RA 3I31A 3W2WB 3JSMB 5LMUJ 4RNNA 2RKIB 3BPDA 3KK1A 2NXEA 2ROEA 2W01A 1ZM4A 3UD5A 4DWIA 5C24B 4LVNP 1NU4A 1VOMA 4B9SA 1JLQA 2P9GA 3NXZA 1IQTA 4JI8F 3HJVA 2DRDA 1RT2B 3KLHA 5F9NA 3HZGA 4V19X 4ECSA 3MDFA 2G0JA 1S76D 3KJQB 4EEYA 1U1MA 1CULA 1SXLA 1H2TZ 2X1GA 4MMOA 1EP4B 1UWAA 4B3RJ 3HHKA 1NSPA 3CD5A 2RHQB 3RAMA 3MPDA 4RWWA 5IM0B 1LFPA 1AXQA 2CQBA 4M5MA 1FWLA 4OMFG 2D3ZA 1NXIA 1OO0B 5E33A 1NH7A 3F44A 2HK2A 3D6MB 4FN5A 2R8GA 9RUBA 1UFKA 4OZNA 5EN1A 1SIZA 1X9WA 1TUGB 3TOQA 2KJWA 2B9XA 2VV5A 1JJCB 2C2MB 3D0IE 3KLIB 3NGSA 3AFGA 4CYUB 4F3QA 4PQAA 5KFNA 1Q8LA 5CD4H 2Q66A 1MN7A 5KFBA 4NASA 3DM2B 1H74A 5B0BA 2DGSA 4ZKAA 2B4PA 4ZP6A 3QRRA 1VJQA 4LBHA 1Q7LB 1PAUB 4NRUA 1Q5VA 4DV4J 2VQFJ 4W92B 3H5UA 2W25A 3DGPB 3CCTA 3Q89A 4Q0BA 2JC0A 1EETA 5GAGU 3ULHA 3WIUA 2KM8B 3W9IA 4I4BA 3U27A 4DR2J 4DX5A 4X64F 2HNDA 1VQ7S 4XK8C 3K7RA 3QO9A 4USHA 1RCOB 2AGQA 3G2XA 2AJFE 2WK4A 4I2QB 4PG5A 3AD7C 2ZHAA 2KZMA 3N79A 2HVHA 5T7LA 4CLUA 3R7BB 1HHTP 5CZXA 4F2RA 1JLCB 2WSFC 4LF5F 1UVLA 1N32J 2CRLA 1S1WA 4CIOA 3VGTA 2UUCF 3GV7B 2LECA 1YI2S 4RNHA 2FJAB 2EFOA 3DDNA 2R9LA 3BB5A 4L6V3 3W2VA 2ZH7A 4DV2J 4FF1A 4GVLA 1N0UA 1U8SA 5K8PA 4DQRA 4C8LA 2Y8WA 3IM8A 2M3DA 4MH8A 1IKXB 1IM6A 2OTJS 1EHWA 1YDLA 3MM9B 4G1IA 1J5EJ 5ETRA 1YIJS 2P6SA 2HBZB 4U8VA 3ILJA 1X8DA 1HI8A 2E7VA 2I9SA 2CJXB 3D1OA 3EGNA 2F8EX 1FTCA 1S1TA 3I96A 3OTDA 2KH9A 3AT1B 2ZH1A 1K73T 4HL9A 4U9RA 2MKCA 3R27A 1T9VA 3VAGA 3PYGA 5LMNJ 1UPMB 3RW6A 2J7UA 5J2NB 1HFEL 1Z4UA 3AOCA 3PCOB 4YHHJ 4B3TJ 3BO4A 3FDSA 1AUSL 4EI2A 5J1EA 3CPWR 3CWJA 1FD2A 3HVTA 1IBMJ 2QO3A 4N8NA 2V94A 4RW7A 2QMUB 2ROGA 4HACA 5KFVA 4IG3B 3T1HF 1NK6A 4PWDB 5CZVA 1PIEA 2QIFA 1YHQS 2HHXA 1O6XA 2DNPA 1SQFA 5D4OA 2XZTB 3LTOA 1D9AA 4R5PB 1FXDA 3VR1A 2F8MA 4IRKA 3RR8A 1OIAA 1GNKA 1ULRA 2LKZA 4ILRA 2ZWPA 4B3RF 4JI3J 4UOHA 4N76A 1UEKA 1WKJA 1H98A 1AA1B 2QJ3A 1RBAA 2WONA 4DHVA 1S49A 2FLPA 1HBMA 3H4BA 3OT9A 4JV1A 3HP6A 1PYTA 3S6EA 1L3KA 3T19A 1MMNA 2W2OP 4DCOB 4YR3A 3AH6A 2KXNB 1IXKA 2DO4A 4HI1A 2V4QA 1F3VA 1VCTA 2O5DA 4JB8B 2B7CB 4ICLB 2CA9A 2OD6A 4M5KA 2IDEA 3PYEA 3JB9k 2WSCC 1PC5A 3OFGA 4B9VA 3NNHA 2NREA 3OL9A 3SFUA 2DHXA 4C7QA 3MF5A 3BN7A 4WF9Q 1WORA 1Q86T 4JI2F 4DCJB 3C66A 4K4ZA 2NSCA 1SV5B 3EGWB 5D0HA 2AYGA 3I82A 1VQ5S 2VQFF 3RR7A 1PO6A 5JMNA 2HNYB 5HVFA 4J9UE 1RAHB 1S4EA 4ES1A 1M5OC 1RT1B 4NA2A 2MSSA 2QLXA 3CTRA 2CPHA 3OJSA 1W2BR 1VC0A 3DLEA 4IOAQ 2HVIA 1UWBB 3TR5A 2QA4S 4LF8J 2IAJA 3C6TB 1MROB 3OBIA 4I6WA 4JI0F 1NAQA 2YH0A 4ZVFA 3T1YF 2KDOA 1HR0J 2RF2A 2HGNA 3UCZP 2RU9A 1NEEA 5F8GA 5DG9A 3T5HA 2XMJA 1A7GE 1XERA 3QAUA 4EZ6A 3FCWA 5L39A 2PT0A 2XGQA 2VPZB 2ZE2B 2IMOA 3LP0B 2G2OA 3SXLA 1UZHA 5IS2A 3GV8B 3PW7A 1RT6B 3I4PA 2MMYA 3CO0P 1H7WA 4DOZA 5GAEU 4PWUA 1TK5A 1M5VC 2IVFB 1DURA 2LU2A 4KE5A 3G8QA 4I69A 1HMVA 4F4AA 4OZJA 5GADI 1VHIA 3P5BP 4MFBB 2RQMA 2CPIA 5KFRA 4ZIVA 5B0CA 3OL7A 1LXNA 2R2UA 1SL1A 2XS7A 3SDEB 2M5YA 2DYAA 4TYBA 1JMTA 2RHSB 1KFDA 1X4AA 2MJNA 3N0VA 3IRXB 1Y4ZB 3K59A 4C4WA 4CLWA 1QM9A 2EPIA 1Y11A 3ETOA 3PM9A 5F8LA 2BRKA 1PJ7A 1VLOA 2HWTA 2RDDA 3I0SA 2W7PA 3RRHA 5HJXA 2HS0A 1KNZA 4OX9F 5K5MA 3CCVS 3RRGA 5D4LA 5I3QA 3BBFA 3EWGA 5KAKA 2IY5B 2RS2A 3CB4A 1F2GA 1DFDA 4MK8A 4UOFA 4IDKA 2PEBA 2FZCB 4OZ5A 3HZEA 4ZITA 1JLGB 2DHSA 2D3O1 2HHHF 1N33J 1RTDB 3ZZRA 4L72B 3VQTA 3VAIA 4P2SA 3LH2S 5D0RA 2J6SA 1LW0B 5EWEA 4ECRA 4CO0A 4KPYA 2VL1A 1R8HA 2WSEC 2DTJA 2I5JB 3M6XA 4FKYA 5KFAA 1TFYA 2ZZMA 4K4VA 2ZKTA 3SMZA 3M30B 4WP9A 3KK3B 2VIHA 4DL4A 1VGYA 1WF0A 4NX9A 4OJHA 3ZTQA 4CDIA 4WZMA 5KG0A 5DS7A 3KLFB 3DOLB 2KN4A 1F2HA 2POKA 3OD2A 4PG7A 5A76A 2AYMA 4HYKA 1ZTWA 2M0GB 3OW2R 1Q81T 1VQLS 2XWYA 3DN9A 1MWZA 2FVPA 4GRSA 2QRRA 1ZZNA 4IR9A 1TMJA 4WYLA 4K4WA 2QEXS 1TL1B 3MEEA 4ID5A 2DIVA 4U6PA 3OTOJ 1S6PB 2FHOB 2RB7A 3CW2C 3TO8A 3MR5A 3R5JB 3TANA 2UVWA 1OS5A 1HW8A 3MECB 2CQCA 4OZ3A 2VICA 1M5PC 5KT7A 1BUXA 2XSJA 2QYCA 4ZMMA 1YSJA 1B99A 3PRVA 1XNRJ 3CMQA 3OR1B 1S72S 1X0PA 2FZGB 5FJ4A 1I6JA 1GX6A 1RT5A 2I0XA 3H40A 4J9QA 1X9SA 1VQ9S 2W24A 4YR2A 2B56A 2ZC4A 1RTHA 2XMUA 3SSRA 4Y3CA 4RW9A 2LU1A 2HVZA 1S5ZA 4KR0B 4OV1A 1HBOB 1H3DA 4YOEA 2E7XA 2B9EA 1GMVA 2FY8A 2UU9J 3QJPA 3IG1B 1NPKA 3MEGA 4IH6A 3RU0A 4DMZA 3OHBA 1T0TV 2DNNA 3A13A 2APOA 4WP8A 5B0GA 2EC2A 3H4DA 1B3TA 5DDPC 1F5BA 1F1BB 4KGZB 2GHWA 2CPJA 4F0KA 2RUGA 3I6PA 1RWOB 3M8RA 1WNEA 4O3SA 2OAUA 2W9BB 1EETB 2Q79A 4I0WA 3SBMA 4DN9A 1YBAA 4KGXB 4WFYA 3JSRA 4B9LA 2YKMB 4U7UK 4PQUB 2HNDB 1TAUA 2XY7A 4BS2A 1HYSB 4NLUA 2XYPB 1CBKA 4RKUC 3OLAA 2GS8A 3JTOA 5HQMA 2GIRA 4NYZA 2C22A 4ECVA 5KFMA 1RUSA 3GZ7A 5KFOA 4RBTA 2FVRA 4DS5A 3UO0A 1WSRA 2FUG9 2XHWA 3D6HB 1RLDA 5A0YA 3W9HA 1IM4A 4WU2A 1KFSA 3LANA 3WC0A 2NUHA 1WC6A 3NGTA 1Y3JA 2V4RA 2EC0A 3T9NA 3W2VB 5KFKA 2ZNZA 4BBYA 2Y0BB 2AEMA 4M8LA 3UR0A 3CCZA 3ZZYA 1K44A 3R5CA 3LW5C 3CJ2A 4IFVA 4KHRA 1PJ6A 2GMJA 1RWVB 3GCXP 3P8BB 3QGPA 2MZ1A 3SV3A 1RWPB 2HW3A 2HLTA 3NEKA 3DDKA 3AOAA 5FDLA 1TP7A 1V6HA 5GAHU 2PC6A 3W5XA 2HHHJ 4B3MJ 3K5NA 4C2MA 5CYJA 1AYEA 4A8QA 1HL6A 3FZBA 2AEFA 3NBPA 2KXFA 2LDYA 2UUBJ 3MM6A 5LT5A 4Y6IA 1ZA2B 2MQMA 2OP5A 4JI6F 1S9FA 2EI5A 4LQ9A 1RYRA 3MWBA 4M5DA 4U67Q 4JYAF 2JH3A 2B6AB 3GG1A 3PW0A 2E5LJ 2MTLA 2W4PA 1RAGB 3PR5B 3CC4S 3DRRA 3BJYA 4F2SA 2VFVA 2GVDA 5K20B 1RAOA 1S99A 2PEHA 4CWBA 2KVQE 1U8WA 4LF9F 5G0RB 5KG5A 4YR0A 1R0AB 3N9UC 4USUA 1JKHB 2A3JA 2F40A 1BWVA 1HPZA 2BVZA 4IO1A 4IG3A 4LIRA 2JC1A 4R0JA 2LYVA 3A12A 1GTHA 1LWEA 3QIPA 2W9CA 4YB7A 5KFWA 3CCMS 3BQ1A 1CVJA 4J7CA 1PAEX 3VTIA 1QSYA 2WONB 2AV5A 3MOZA 5A6PA 1Z2ZA 2J9DA 2HFUA 1VQYA 3B4MA 2DEIA 2KHCA 1Y3KA 3QFWA 3R6LB 7FDRA 4YP3A 4DQIA 4F26A 1UFWA 4DFJA 1FVQA 1HNWJ 1S6UA 2V8DA 1I1GA 2Z2MA 4X4PA 1TL4A 2DH7A 1TAQA 3ZZ0A 4IG0A 5HROA 1YWXA 1GQEA 3OSPA 2WCXA 4JI1J 3IR5B 1UVNA 2HFOA 2BMBA 2WW4A 2XSFA 4R25A 4ZVOB 5A8KA 3OVBA 3FRZA 3W7BA 2CQ2A 4WIQA 2HRUA 1GFWB 1QAIA 5KFCA 2Z4PA 4JV2A 3TRGA 4QU7A 3I5BA 1KEKA 5IFMA 5E3QA 4J37A 1KQFB 3DLGA 4RBVA 4L3NA 4ZJLA 3Q8SB 1IN0A 1B7FA 4Y2AA 2ZZTA 5CYQB 1CJKB 1U2RA 3TVYA 2KT3A 2M52A 2Z2LA 1T05A 1PGZA 3UI3A 3EPGA 2RAQA 2V34A 2Z8QA 3M8PB 1N5YB 3NKYA 4PR6A 3RBDA 2OMLA 1U1RA 4FDFA 2V4JB 1Q7YT 1NBEB 4RW4B 4CH7A 3G4SS 2F4VF 3W62A 4DR3J 2C3YA 1D3WA 1NDCA 2ZD1A 1YJVA 5FLXU 3BSNA 1E6YB 2CNOB 4ZPDA 3T6JA 1X4DA 2UV8G 1RT7A 3W8PA 1H7XA 1CSJA 1Q8IA 1WC1A 1IWAA 3G87A 2UXDF 3HHNB 2CNLB 2HSEB 5KT6A 1X60A 3NRBA 4IH7A 4O3NA 4NLVA 3FC9A 4DL6A 3MM8A 2Z58B 3K5OA 1RTJB 4HHHA 2A2CA 4ZVSB 4R8UA 1S59A 2BV3A 4PXDA 1UL3A 4DQSA 4OLOA 1MWQA 4PXCA 1FESA 2EWHA 1WACA 2CJBA 1GXTA 5L46A 3D3CJ 3PX6A 2YX7A 3K8WA 4M5LA 3J7A1 1M5SA 4E98A 5HVHA 2ADCA 1OPZA 3M6WA 1FRHA 2E1RA 2V8PA 3C15B 3E01A 3IRXA 3S01A 4YUDA 1HNVA 2BUNA 4MT1A 5E2QA 5IWAF 5IT9U 1ITPA 2EFPA 3BH7B 1Z2LA 2RU3A 1IR0A 2HAIA 2IM2A 2ACYA 3C16B 3DLKB 1GX5A 1WI8A 3CULA 4LFCF 5GAGI 3LQVA 1IR2A 2Z0GA 4P2MA 1I3OB 4RNMA 4PUOB 1VR6A 1PBUA 1FEHA 1Y7PA 1JLGA 4ID8A 2G4BA 3KK2A 1ZPVA 2BM0A 1T9XA 3AQOA 2I5JA 2H5EA 2W7AA 1FKPB 3B6BA 3NMRA 4X2BA 3IS9A 4MAKA 4NLYA 4C0OC 5CABA 4DV5J 1O8BA 3QSYB 3KLGA 3L3CA 2IDLA 3V2UC 3DOLA 1HQ2A 2GAHC 2HQGA 5HI7A 3KJFB 2H4WB 2JNJA 2UXBF 2XBPA 1N6QB 1HNWF 4OYPA 3UN3A 4DS4A 2KT2A 4IOBA 4PWWA 1RQ0A 3D7SB 1BGXT 1OSCA 3MAHA 4ZCIA 1RXOB 2RNEA 4RW6B 4LR9A 4CLZA 1VBZA 2HNZA 4ZVHA 1IWGA 3ENAA 3MMAA 5K8MA 1MU2B 3NS5A 2WVDA 3K89A 1NHVA 2YY3A 3I9ZA 2MYFA 2XSJB 4DV6F 1HD1A 3K0JA 3HDSA 3MUVP 1VRUA 3UPFA 3DYAA 4K4XA 3PVXA 2OFHX 4NLSA 5C2CA 1QLNA 4LF1A 2IVYA 5KT5A 1HNZJ 1IKVA 1O5JA 3MM5A 2KU7A 4YN3B 2CWKA 1YITS 2DNKA 2LQ9A 4RW9B 1NLKL 2EFNA 1S4FA 1HQUB 1U0HA 3DOKB 4ZP9A 3IG1A 4KC5A 2X1BA 2UUTA 3F0NA 1N0VC 3HSJA 4DV1F 3D0HE 1JLEB 3AB2B 5DETA 5LSOA 2XO7A 2HVEA 3KNGA 1SVDA 2BXJA 3CGIA 2ZM6J 3NAHA 3NCQA 3LA0A 5EGYA 3C46A 3KHLA 1LW2A 1FE4A 2AX1A 4NRTA 5IV3A 4EYIB 4H4KA 1NMEB 3BR8A 2R7RA 2IHR1 3PNIA 1CS4B 4WK1A 1WHYA 2EG2A 2XTJP 3KJVA 4CH0S 2NXNA 1Z1ZA 1T94A 1S0VA 2BQ3A 1HYSA 4PPDA 3TZXA 4ECUA 4WIIA 3PO4A 4FPRA 4M5NA 4J5OA 5J2QB 1HBNA 3BDEA 1S1VA 2GZOA 3MHYA 4ES3A 4IOCQ 2C2EA 5K9FA 2DITA 2YWHA 2BDPA 2A2DA 1WKLA 4E2FB 4KYZA 1FWKA 5CD4A 4TQSA 1KP6A 1XMOF 3H2VE 1NJZA 3MEDA 5I3UA 4B3SJ 1U1OA 1S0OA 5AE3A 1IBCB 4OHWA 3A8EA 2YKNA 3ZZUA 2MLYA 5KT2A 5IWAJ 4YB1P 4ECTA 4K2XA 1UAWA 3M8QB 3HULA 5HP1B 3PIOQ 1YJNS 4CLSA 5ETLA 2MJUA 4LRAA 2AJQA 3GIJA 3H42A 4M95A 4ZS6A 2IYIA 5MLCV 1S6QA 3EICA 4N5SA 2LLZA 3VGSA 2DO0A 4A8KA 2WBMA 3M6VA 1F0XA 1DTQA 3CJ4A 5AXLA 2GW8A 4IQXA 2PFFB 3NBPB 1WELA 3CT9A 3W5YA 2W4DA 2CQ3A 1QAJA 4KV8B 2OFGX 4LR8A 3QBCA 3N28A 5CYMB 3U1LA 5F3TA 1N34F 4RUBA 1FHTA 3D68A 3LO3A 2R7WA 4DR5F 4UUWA 2GIFA 4WFZA 2DNGA 2ZEJA 1ACMB 2VBYA 4DV3F 5F8NA 1YBTA 2CJAA 3PY8A 2HS3A 4FZVA 1NDLA 3M7VA 4NLTA 4JUZA 5DLGA 2MQPA 4LR7A 2CZVC 4AL6A 1KHVA 2K3IA 3IAM9 2MQQA 3GILA 4OFZA 2CQGA 2OLWA 3CD7A 2PGCA 2P2CB 3A4TA 1HPZB 2DY9A 3DDIA 1XWLA 2ALZA 1RWMB 3VF0B 2UVRA 3GWCA 3MCMA 1X31C 4G1QA 4KT0C 4O44B 4F0HA 4XPCA 2K1RA 1SBRA 2DNLA 3BGFA 2Y9HA 4OJ3A 1BQNA 2EW9A 3KYLA 2RRAA 3UR3C 1D9DA 1B4SA 4ALZA 4GKJJ 3D1QA 4JV5J 1IVZA 3NMAA 2DKOB 3SIPB 1XR7A 2GAGC 3W1YC 3M9MB 2OELA 3QGIA 4YDXA 4JI8J 1DJ0A 2F3JA 2L9DA 2VKZG 3X3UA 3LAMA 3M2RB 1LXJA 5ETQA 2W8LA 5H9FK 5KFGA 4QR0A 2VG6A 5LSRA 5L38A 1LV5A 1FJ7A 2RH3A 5J2MB 1TK0A 5DG7A 2YWWA 3G71S 4KKOB 1S9EA 2AGOA 2NYHA 2O1PA 2BEFA 4HVZA 4MYUA 4NMLA 4WTYA 4GO7X 4CO3A 2AT1B 2OPSA 2WOMB 3DLGB 1CJVB 3MUTP 5K14B 3HVRA 4J9KA 4DUYF 3R2CJ 2EFQA 3U02A 4QYZK 2BJ3A 1JLAB 2BJ8A 2KI2A 1TL3B 2XHCA 3KKFA 1TK8A 1M1KT 5KTQA 4J91A 1T8EA 2N4CA 3AJ2A 3H5XA 3BYRA 3L7PA 3IA0A 3M1VB 4BWMA 2ZZNA 1TKZA 4KHMA 2D74B 3QRQA 1X5OA 2VUGA 3B4DA 3TZYA 3PX4A 4ED4A 1VQPS 1S97A 2V67A 1HWIA 4IFYA 4RW4A 3W8GA 2FGOA 3IR7B 5E3RA 3O5TB 1YJWS 3VWSA 1VBYA 2OH2A 1JLFA 4B3SF 5K8OA 1Y00A 1N5YA 3M32A 4ZPTR 2C1EB 1VBXA 2DPIA 1CC8A 1RU1A 2HBRB 4AQYJ 1ZTTA 1ZYQA 1FEEA 1R43A 4P73A 1FF2A 4ECQA 3TAMA 1KLMA 1YK9A 3O6QA 3HFZB 1RKJA 1RWKB 3HX9A 2MSTA 2B8PA 3LP2A 3NOCA 5C2GA 2RRNA 1RB0A 1M1GA 1FO1A 3AB4B 4RJVA 5A8WA 3I0RB 3GR1A 4OZ1A 1PC4A 1ZM3A 4B9NA 1FD8A 5ADZA 3BGRB 4G3IA 3H59A 2HQ3A 4DV2F 4QZVB 2XM3A 2IVMA 4ZVTB 1XMQF 1FRXA 1NKCA 1X4EA 1H2VZ 2XY6A 2RQCA 2OGUA 2C3MA 2AJ4A 3BBCA 4WP3A 2GX8A 3GTYX 3DRSB 4ANDA 4DU7A 3RAQA 1J5OB 2OIHA 2FHJD 3MM7A 3LPYA 5F0WA 2C42A 2LP4A 4USTA 2HBYB 3PFOA 2KG1A 2F4FA 4YMEA 4LF6J 3DLLQ 4P74A 1O51A 3IBFB 4CTAA 4EZ9A 4DR4J 3N5FA 3T6BA 2BANB 2AF6A 2KL8A 4Y2MA 1TV6A 3GIIA 2ZOFA 2QE5A 4CRJA 5I3PA 3HSGA 1FNMA 1AZSA 3R5DA 3CCRS 2QLBB 4ATNA 2VODA 4X4OA 2P9EA 1GXUA 4DV7F 2RS8A 2DNYA 5HBMA 3W63A 5HSPA 4F8RA 2EEYA 4YS2A 2WTFA 3IGNA 3DLHA 2Z2YB 2N3OA 3MMAB 4KSEB 1HWUA 2LQJA 2R2SA 2QLWA 4A8SA 1DLOB 4IYQA 2R7VA 3HKZD 3EUNA 3IO1A 4KHPF 2IIHA 3GQCA 1B70B 1H0HB 1LWCB 2CUYA 4TNOA 3TYTA 4WKRA 5BYRA 2VASA 1F3FA 5E5NA 5C24A 1HD0A 1R27B 4FKXA 4KY3A 5LJ5Y 1N36F 3ZNJ1 3CNQP 2EBEA 1RBOB 5DO2A 2PFDA 3MM5B 4LT6A 1WEXA 2HWHA 4DN0A 3H2UB 4A8YA 1S1UA 3KG1A 5F8HA 3IBCB 1RT2A 3KLHB 5IC6B 1JLBA 2JVOA 1G4CA 2CJQA 2GQQA 2UUWA 2DNQA 4Z7YA 2GNKA 1D8ZA 1N88A 2GGPA 1TKTB 2DR6A 3FRYA 1ZETA 1NKEA 3IWNC 2M9KA 1KKHA 1YX2A 1RAFB 3GCWP 1Q8KA 1IBKF 2IM3A 4XO0A 4NLGA 2W2PP 3CSKA 2P5VA 2D9OA 3OXFA 3T1AA 4URGA 1N5VA 1R8AA 4N7TA 1LWFA 2I8EA 2E29A 4RW8B 4ECZA 3JTNA 1Q95G 2ALYB 4PWDA 3QGGA 4WU3A 4C11A 2QL9B 2DNMA 1WDTA 1JK9B 4AT1B 1SKUB 4C8YA 3R1LA 4CH1A 2GO9A 4FYDA 4DL7A 2W8KA 1T9TA 1EIYB 4IR1A 3CE8A 5M2UA 5EWFA 1MWYA 3FBBA 3M8YA 1QE1B 3CMAS 3T1YJ 3SFGA 1HR0F 4DL0C 4ZLPA 1V5IB 1OJ4A 2V0NA 3GJRB 2BQUA 3QLHB 4ILLA 1VC5A 2HHTA 5AXNA 3SYZA 3SCKE 4PG4A 3ZO7A 5DDQC 1OQ3A 1ZZFA 2DHGA 2KXHA 4TY8B 5KFEA 3VAJA 4C6AA 3FQLA 2LQBA 1CJUB 3HSZA 5F8IA 3D54A 3EYZA 3MR3A 3NNCA 4XDDA 2X7IA 5J1NA 1FE0A 1JLQB 5JJBA 3HM9A 3TUZC 4NWBA 3WDOA 4O0IA 2HFVA 2JX2A 4I2QA 3TUJC 5A2QU 4DI6A 2CQHA 5DQHA 5KG2A 3J7Z5 2VPWB 4EMDA 4NCGB 3RB0A 5B09A 1VS3A 2VHGA 2FJBB 3QAEA 3O3LA 1U6ZA 3SZ2A 4F7VA 2MY7A 1S6QB 4JBCA 4LSLA 4JI4F 3QJLA 4OIXA 3WBZA 1U1LA 2ZOMA 5I42B 4DR7J 1DQ8A 2RQ4A 2NXUA 3QSIA 3N5BA 2PE8A 2BKOA 1X5TA 4EBCA 2R8HA 4URSA 4DPUA 4ED7A 2ASDA 4IUFA 1BHNA 2RILA 3GJSB 4N8OA 4RU9A 4K8RA 2YNFB 3KG0A 5AE2A 5RUBA 2CPEA 2GVZB 4I1TA 2WB4A 4F4KA 5D3GA 2V68A 3GFYA 2J6UA 1RT3B 1F9FA 3CJSA 2OSRA 3CJTA 1CG2A 2UUAJ 1U7LA 2JOQA 1U6BA 4GKKJ 5DZ6A 4FYXB 1S0MA 3KLEA 4PKDB 1UPPA 4NA1A 1WEZA 2OJ3A 3UCGA 3OJUA 1SI9A 3P4UB 5IOLA 5GAEI 4DX7A 2JFDA 3NOGA 3FBCA 5E41A 3PHTA 2XO6A 4DF8A 3R6GB 1GT8A 2HZAA 3VZHA 3NY0A 2LEAA 2HLUA 2AYBA 2OPQA 1N36J 2HS4A 3UNYA 2JEFA 4URQU 1SJQA 4B3TF 2HWIA
chains in the Genus database with same CATH topology
4M5HA 5ETPA 3UDEA 1EX8A 1G4CA 3KUEA 4M5GA 3QBCA 3HSGA 4M5LA 4CRJA 1RTZA 1HQ2A 2F65A 5ETKA 2F63A 3HSZA 3HSJA 3MCOA 5ETQA 4CYUB 3UD5A 5ETTA 3MCNA 4M5KA 2BMBA 1HKAA 1TMJA 5ETNA 5ETVA 3KUHA 1RAOA 4CWBA 4PZVA 3HD1A 2CG8A 3ILLA 1F9HA 1RU2A 5ETSA 5ETOA 1KBRA 1DY3A 1EQMA 3ILOA 1RU1A 5ETLA 3UDVA 4M5IA 3HCXA 1EQ0A 3KUGA 3MCMA 4F7VA 3HSDA 5ETMA 3IP0A 1IM6A 4M5JA 1Q0NA 4CYUA 5ETRA 3HD2A 3ILIA 1TMMA 2QX0A 4M5MA 4M5NA 4AD6A 3ILJA 1RB0A 1CBKA 3HT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M5H A;  5ETP A;  3UDE A;  1EX8 A;  1G4C A;  3KUE A;  4M5G A;  3QBC A;  3HSG A;  4M5L A;  4CRJ A;  1RTZ A;  1HQ2 A;  2F65 A;  5ETK A;  2F63 A;  3HSZ A;  3HSJ A;  3MCO A;  5ETQ A;  4CYU B;  3UD5 A;  5ETT A;  3MCN A;  4M5K A;  2BMB A;  1HKA A;  1TMJ A;  5ETN A;  5ETV A;  3KUH A;  1RAO A;  4CWB A;  4PZV A;  3HD1 A;  2CG8 A;  3ILL A;  1F9H A;  1RU2 A;  5ETS A;  5ETO A;  1KBR A;  1DY3 A;  1EQM A;  3ILO A;  1RU1 A;  5ETL A;  3UDV A;  4M5I A;  3HCX A;  1EQ0 A;  3KUG A;  3MCM A;  4F7V A;  3HSD A;  5ETM A;  3IP0 A;  1IM6 A;  4M5J A;  1Q0N A;  4CYU A;  5ETR A;  3HD2 A;  3ILI A;  1TMM A;  2QX0 A;  4M5M A;  4M5N A;  4AD6 A;  3ILJ A;  1RB0 A;  1CBK A;  3HT0 A; 
#chains in the Genus database with same CATH topology
 2VBX A;  5A6W A;  1R7I A;  1R8B A;  2DR5 A;  2DNZ A;  3OTO F;  3MR2 A;  1IBM F;  3ENQ A;  3FSY A;  2HAF A;  3P96 A;  3SQG A;  4UF4 A;  4USM A;  2BOA A;  4OHX A;  1Y10 A;  2V9K A;  1NRK A;  3CDU A;  3RTV A;  1BWE A;  3T1H J;  2BJ7 A;  4USJ C;  1U02 A;  2W9A A;  2EVZ A;  2B5J A;  3BZQ A;  2C2N A;  1FNX H;  1E6V B;  1S1X A;  3D1H A;  1REV A;  4KKO A;  1X0F A;  1NZ8 A;  3DOM A;  4ZJO A;  4RUA A;  1FVS A;  5D6G A;  1WI6 A;  2ZJR Q;  4C0B A;  1C0T A;  3EPI A;  2HMI A;  5K14 A;  1XJW B;  2G2Z A;  3VVU A;  1QTM A;  1JXE A;  2IM0 A;  3Q83 A;  4WXW A;  2EXU A;  3W5Z A;  3BF4 A;  4Y65 A;  5KOW A;  2XWX A;  5JVH Q;  3L09 A;  3ADA C;  1VIS A;  4ECW A;  1S1T B;  1CJT A;  2ZH8 A;  1W7W A;  4IQM A;  6FDR A;  2ZJQ Q;  3DRY A;  2DBB A;  3DI6 A;  3TJ9 A;  4A8F A;  1HWJ A;  1KVK A;  1PG5 B;  1Y0H A;  1SV5 A;  1J27 A;  2ZDP A;  4HHJ A;  4IO9 Q;  3PJW A;  3OV7 A;  2YX1 A;  4IFY B;  2DEJ A;  1LKZ A;  1L3S A;  3PKM A;  2CQ1 A;  3AXM A;  3D2W A;  1REG X;  1B7Y B;  3TA2 A;  1WHW A;  2XG8 A;  2ZHO A;  3OQ2 A;  5ETN A;  4YY3 F;  4YFU A;  1S10 A;  4K0K J;  3TUI C;  2QSW A;  3HVT B;  2V5H G;  3ELH A;  1S79 A;  1XR5 A;  3MMC A;  3C6T A;  2BW7 A;  4UOC A;  3FEZ A;  3B82 A;  4X66 J;  4ZIW A;  4NPO A;  4WPA A;  3I87 A;  5A8R A;  2E1M C;  3MTK A;  1URR A;  3MPY A;  3EVO A;  2B4V A;  1WG5 A;  4DUZ F;  4M5J A;  1MSW D;  2RKI A;  4QWC A;  2XY5 A;  3KK1 B;  3C6U B;  2Y1J A;  2ZE2 A;  4CP5 A;  2XZW A;  1RDR A;  2JVR A;  2O3D A;  3LWM A;  2PMH A;  2PO4 A;  5A8W B;  3UDL A;  2X3D A;  4FP9 A;  2Y1I A;  4HT7 A;  4WFN Q;  1DRZ A;  4OYA A;  3TJA A;  1LEO A;  1XN9 A;  3ITH B;  2MLX A;  4OLP A;  2UXC J;  3GMG A;  4DZD A;  1N5Q A;  1P27 B;  2V2K A;  3S8S A;  2JL9 A;  4C8O A;  1URN A;  1EP4 A;  4K4U A;  2PMW A;  2HIY A;  4O23 A;  1NUE A;  2PI5 A;  4F4Y A;  1HKA A;  1KWM A;  1KN6 A;  2XCA A;  1SL0 A;  2LQ5 A;  3THP A;  3MM7 B;  3HD1 A;  4GVB A;  3HJF A;  2FLL A;  4C8Z A;  2M8H A;  3Q8Q B;  2DR9 A;  2Q6C A;  3LOU A;  4CLP A;  2YX4 A;  4LFB F;  1VBK A;  4NYO A;  2VG7 B;  3EDQ B;  1O0P A;  4K59 A;  4X84 A;  4XTT A;  1U24 A;  2DR8 A;  4JI6 J;  2BAN A;  2ACM A;  2D69 A;  3RYL A;  3ZTS A;  3TA1 A;  3ET6 A;  4ZLN A;  5L9N A;  5T14 A;  3RB4 A;  2JLG A;  3BGO P;  4LF2 A;  5C25 B;  3NCP A;  4OI3 A;  4FVC A;  2B0G A;  3TEH B;  3TI0 A;  1LQ9 A;  3SCJ E;  3GR0 A;  2ZJP Q;  4DPT A;  3RB6 A;  2OO4 A;  4LF9 J;  2AKW B;  1HWL A;  1YLX A;  3US5 A;  5JUM A;  2XC9 A;  4LQ3 A;  4P6Q A;  4RO0 A;  3LWL A;  1N54 B;  3DGP A;  1LW0 A;  3T5L A;  2ZUG A;  3DXS X;  4XAK A;  1PYS B;  1S77 D;  1QAY A;  3CJ0 A;  1FXR A;  5E3C A;  3M30 A;  5C42 A;  4Y0F A;  1DLO A;  3QO9 B;  5D0G A;  2IFX A;  5EX0 A;  2MGZ A;  1NJX A;  3NLC A;  1RT6 A;  5E0O A;  3UDV A;  5E3P A;  1KR4 A;  2R2T A;  4LIW A;  4V1A k;  1WHX A;  1S7H A;  1P6T A;  4DPO A;  4FVM A;  1VLY A;  3EMT A;  4FNH A;  1S1U B;  4LF7 F;  1S1W B;  1FX2 A;  2J7K A;  3NWG A;  2JLF A;  1C0U A;  3RRK A;  1QSL A;  2QC3 A;  2UP1 A;  3V81 A;  2W7O A;  2OPR A;  1EX8 A;  3FNN A;  1TKT A;  4Q2M A;  1SQE A;  3GYG A;  3TEG A;  2OUG A;  3W61 A;  4M94 A;  3G9C A;  4LSN B;  3R9L A;  3D66 A;  2IRX A;  1RAE B;  4NMX A;  4P72 A;  3KMS A;  4ES2 A;  2VBW A;  3GIR A;  1IKX A;  1M0S A;  2IRU A;  1OQ6 A;  1RT5 B;  4H4M A;  1UVJ A;  2E5J A;  2KYX A;  3OR2 A;  5ETV A;  1UMJ A;  5GME A;  4USK A;  3KTQ A;  4E0D A;  2NS1 B;  4I68 A;  4K5R A;  4M63 A;  2HHS A;  2FD2 A;  5DZ7 A;  2O66 A;  3PW2 A;  1MMD A;  4K0K F;  2HQC A;  2A18 A;  4G65 A;  3LGN A;  3MEG B;  2E9T A;  1BE4 A;  2K7J A;  2FJD B;  2UU9 F;  3V6D B;  1HHS A;  2HVD A;  2KO1 A;  2R7O A;  1TL7 A;  2OEM A;  2DK2 A;  3EZO A;  2EFG A;  4O3Q A;  1C4A A;  1RIS A;  1GEH A;  3CJQ A;  4FNI A;  4TY8 A;  2FJX A;  3I4H X;  4DQP A;  1C1B B;  2M4M A;  3VHQ A;  3KLF A;  1CJU A;  4NLW A;  5KT3 A;  1AUD A;  2CKW A;  2O01 C;  2WZ1 A;  4PAB A;  4RW7 B;  3KDO A;  3BH6 B;  2YKM A;  4PQU A;  3EZU A;  2L08 A;  1N4L A;  2Y8Y A;  1FCA A;  3G6Y A;  2R4F A;  2H5I B;  4R5P A;  1FRM A;  2GC8 A;  4OX7 A;  2XLI A;  2SXL A;  1S6P A;  3KUH A;  4OHZ A;  4NXM J;  3GG0 A;  3IWL A;  4NCG A;  4DFP A;  3WHI A;  2V6A A;  3QID A;  2MZS A;  2YNI A;  3IGV A;  1C4C A;  3WQP A;  3ENV A;  4A47 A;  4DPW A;  4NYP A;  1YQH A;  1T11 A;  2JHE A;  4ZLL A;  1VRQ C;  5GMK a;  2AIR B;  2J9E A;  3GIM A;  1DAX A;  3Q24 A;  1UEU A;  3AJD A;  4OX8 A;  5A0Y B;  1YZ7 A;  4S0M A;  4RZR A;  2N82 B;  1UCN A;  2XGP A;  1YG0 A;  1ELO A;  3AOD A;  2GMH A;  5FD1 A;  2BRL A;  3HFV A;  4DL5 A;  2ZH2 A;  1APS A;  5KFQ A;  3CCE S;  1LOU A;  1HBO A;  1YJR A;  3PAC A;  4WXO A;  1WC3 A;  4WK3 A;  4QCL A;  3H5S A;  2YNF A;  3OFH A;  2CPX A;  4QWE A;  2RJZ A;  4OYW A;  4XIU A;  5LMN F;  4NCB A;  4L75 A;  5DGA A;  1RT3 A;  4YHH F;  3TVZ A;  3MCS A;  4FYY B;  1YGY A;  3IFE A;  4CLF A;  3CCL S;  2EBG A;  3Q8Y A;  3AA9 A;  3V4M A;  2PA3 A;  3CCJ S;  2YNG A;  2CG8 A;  2Q1L A;  3DLE B;  1EB0 A;  2DHH A;  1LNQ A;  3BKT A;  3UE2 A;  4J9S A;  3T5J A;  4CNZ A;  4JI5 F;  1KVI A;  3PFE A;  4CM2 A;  4HTI A;  4A46 A;  3CDA A;  4ZHR A;  2UUB F;  3I32 A;  2XS2 A;  2LXU A;  3K57 A;  2VFS A;  1IJE B;  5LXY A;  2YQ0 A;  3AA8 A;  2J9D E;  2XMW A;  2CDR B;  3F41 A;  3W65 A;  3L9Z A;  4HH0 A;  3GP9 A;  1HNX J;  3DRP A;  1RWU A;  2CPF A;  1FDD A;  3AOB A;  2P9C A;  3FUY A;  4LF7 J;  5LXR A;  2BJ9 A;  4AXI A;  3HK2 A;  5F0U A;  4A8W A;  3V4I B;  2E1P A;  1NB2 A;  1Q8B A;  3FSX A;  2J7W A;  4ECY A;  3PYF A;  4A8O A;  1NK8 A;  3C3L A;  2HHQ A;  2AX0 A;  4IKA A;  5HL7 Q;  1SC1 B;  1HMV B;  1SPB P;  3ZFV A;  4O3O A;  4DG1 B;  5BR8 J;  2BE9 B;  2C2Z B;  2RRB A;  1WHV A;  3N6L A;  5HMW A;  3CED A;  4X62 F;  4IH5 A;  1VRT B;  2A10 A;  2ILY A;  1C0T B;  2BJE A;  2L3M A;  2NYI A;  4O4R A;  1KQG B;  3M8Z A;  2LMI A;  5B0D A;  1YRU A;  1NO8 A;  5FDL B;  5IZH A;  5AJ3 J;  2ZBP A;  2RUS A;  3E3X A;  1QY7 A;  1OYE A;  3FVY A;  1A9N B;  2XZD B;  1CJT B;  4LF8 F;  1NZA A;  1UVK A;  4MK9 A;  1IUJ A;  5BXI A;  1Y5N B;  4QPT A;  2G1D A;  3JTP A;  2QLF B;  2AYE A;  2ADB A;  4G1P A;  4M5D B;  1WOS A;  1BQM B;  3AD9 C;  3MTJ A;  3NGR A;  3TZZ A;  1WTB A;  3H90 A;  5L8R C;  1RTD A;  1GTE A;  4DSI A;  1WWH A;  1H72 C;  1IBL F;  2PD1 A;  3M8P A;  2LVW A;  2XB2 D;  4LVO P;  1AT1 B;  4EBD A;  2J0Q D;  2MPU A;  2NSB A;  4DV0 J;  3ISN C;  3MEK A;  1EAY C;  4HDH A;  4JP8 A;  1KON A;  4FXW A;  2BW2 A;  2V4J A;  2IA6 A;  3C6U A;  1YJ7 A;  3R7S B;  2V69 A;  3OFE A;  2OKQ A;  4Y34 A;  2DGV A;  4K4Y A;  4NXN J;  3S1T A;  1VK8 A;  3ZZT A;  1RCX B;  2FJV A;  2QSF A;  1L3V A;  4KJI A;  3A3P B;  1TL1 A;  2L48 A;  3MEE B;  2GML A;  4ID5 B;  4DR2 F;  1M5K C;  5SZT A;  3J7Y I;  4DR6 J;  1C1C A;  2F65 A;  3M2V B;  3RGI A;  3UN2 A;  1G2E A;  4LRE A;  1X7V A;  4IG0 B;  1SKR A;  2DGU A;  2AWZ A;  3ISN D;  2VZ9 A;  2VC1 A;  4R8U B;  3QZ8 A;  2V9W A;  2XS5 A;  3P49 B;  1JNZ B;  1ZOT A;  3MCN A;  2LXI A;  4QIE A;  4OX9 J;  1Q4R A;  3OR1 A;  4NLR A;  1RHJ B;  2FHK A;  2ABY A;  1V5V A;  4GVB B;  3CVK A;  4TU7 A;  3BQ0 A;  5HLF A;  3M9N B;  5D77 A;  3TX0 A;  2DCU B;  1PSD A;  1RTH B;  3GPA A;  3C15 A;  4I2P A;  1FJE B;  5GVQ A;  3TQ1 A;  2XYG B;  3PIP Q;  1AFJ A;  3J80 U;  3L95 X;  4D3G A;  3BO2 A;  1HI0 P;  3JAM Y;  3TVK A;  1U2F A;  1T05 B;  2XYH B;  1QSS A;  2BQR A;  1PCA A;  2HEK A;  4Q44 A;  1TKX A;  1IJF B;  1UJ6 A;  2E5G A;  3I5C A;  1NSK L;  1FK9 A;  3HT0 A;  4HEA 9;  5KFX A;  2HFS A;  1NND A;  1GMU A;  4MIA A;  5T41 A;  1M1H A;  1TUV A;  3UDC A;  1TTH B;  5HMZ A;  1Y9O A;  2W9B A;  4ZDN A;  2ZBC A;  1FKO A;  4RUC A;  3DFE A;  1UEV A;  4C97 A;  4LJM A;  2R8I A;  1RWX B;  2VG5 B;  1HNI B;  3DHX A;  5EX3 A;  1WC5 A;  2B3T B;  4CLY A;  5M2P A;  3C8Y A;  4U7U D;  1X4C A;  3IS9 B;  4F3M A;  1WTF A;  3CCW A;  5E7O B;  1XC9 A;  1T3O A;  4Y2K A;  2F1F A;  2DGW A;  4IRD A;  4IRC A;  2ZH6 A;  1WC4 A;  3JS9 A;  2F7V A;  4BHQ A;  4CT9 A;  5DM6 Q;  2OMO A;  4TU8 A;  1HIY A;  3HF5 A;  3FFI B;  4ZPW R;  1C2P A;  4NI2 B;  3OUY B;  5J2P A;  2BJ1 A;  4OL8 A;  1RLC L;  5GMD A;  2LEP A;  5AJ3 F;  3DMJ B;  2HNZ B;  4WZQ A;  4QOT A;  1VYA A;  4ZVR B;  2E1C A;  1WOP A;  1PKU A;  2RE1 A;  5B0F A;  2HFZ A;  4ED2 A;  1FWP A;  3BRE A;  1VQM S;  3AD8 C;  2VON A;  4OHY A;  2Q43 A;  4TLR A;  4IFV B;  4ED0 A;  4CO2 A;  1CQM A;  5LSL A;  1UA1 A;  1HA1 A;  4NOH A;  3UVJ A;  4QYZ J;  3DLK A;  4ZPA A;  1IKV B;  1ARO P;  1K0T A;  1JXV A;  1R6Y A;  2HQD A;  2WRM A;  3BDP A;  1T9W A;  2NZC A;  3QFH A;  3KHG A;  3LUY A;  4PUO A;  2CAD A;  2YVS A;  4NLP A;  2MQL A;  4CLK A;  3L7U A;  2BOP A;  3RB3 A;  2IMW P;  4L3K A;  4USI A;  1JNR B;  2LXF A;  3JXO A;  2HHW A;  1JX4 A;  1GXL A;  1VHF A;  4U95 A;  1HBU A;  1IKW B;  2BJD A;  1JLE A;  2HUR A;  2E44 A;  2MQN A;  1QUP A;  4NA3 A;  4OZL A;  2ZH4 A;  3V6D A;  1L5U A;  2NQP A;  2YKA A;  4PG6 A;  1YJT A;  2R7S A;  4M1K A;  2WVF A;  2Y1R I;  4TVA B;  5KFU A;  2GCF A;  3K17 A;  3NGK A;  4ZVE A;  4ZA1 A;  2NR0 A;  1EKS A;  1C1B A;  4LFA F;  2QYG A;  1GMW A;  4M5G A;  2AQ4 A;  1PYO B;  3D9B A;  2R7U A;  5H9F J;  2V8V A;  4OZ0 A;  1N5S A;  3CD6 S;  4MTP A;  5AXM A;  3KJV B;  1N6Q A;  1EJ7 L;  2VQE F;  2C2D A;  2AHO B;  4KFB B;  3TA0 A;  4AYB D;  4AQY F;  4MIW A;  1HW9 A;  3A1Y G;  2OD4 A;  3QIP B;  2QZ8 A;  1XIQ A;  2ZWO A;  5DQI A;  3J81 U;  2HQF A;  3H8Y A;  2NPI A;  1U25 A;  3MAA A;  4KO0 A;  2E5H A;  2CAJ A;  3PXG a;  3W2W A;  3QRP A;  3ILO A;  4UZC A;  1X5P A;  3THV A;  3GYN A;  5F41 A;  2AU0 A;  4DXL A;  2YKN B;  3G8T A;  4B3M F;  1RT4 B;  2QA2 A;  2AJ2 A;  1QAX A;  3NP5 A;  3IN5 A;  1H6K X;  2K2P A;  2KB2 A;  1NCL A;  1Q78 A;  3QAT A;  1ICE B;  2MLZ A;  3MMJ A;  3QT8 A;  2A6M A;  3CJ8 A;  4KH1 B;  4X64 J;  3N4W A;  1CUL B;  1RHU B;  4UUX A;  3KDN A;  1Q82 T;  3NAI A;  3L4B C;  3CJK B;  3R8Y A;  3LP1 B;  4CO5 A;  5DQG A;  1FJG F;  2HHP A;  2H65 B;  3PO5 A;  1SH2 A;  5IM0 A;  3TW0 A;  3CCS S;  4LF6 F;  1YZ6 A;  3OFF A;  1VQS A;  1CJK A;  1ROF A;  1D1U A;  1TVR B;  3MMB A;  2Z56 B;  5HAO A;  4MKV A;  3PRD A;  4HDG A;  2QN6 B;  2C2K B;  2ROP A;  3ENW A;  1WG4 A;  2ZKU A;  3G86 A;  1N34 J;  1FDA A;  1LFW A;  2E1A A;  4QR1 A;  3ZZO A;  2G9O A;  3DM2 A;  2ATC B;  1I5O B;  3CD0 A;  4P9S A;  1HBN B;  3IM9 A;  2PA8 D;  3KJN B;  3MGJ A;  3Q8U A;  3A3N B;  1U4B A;  3T5K A;  2ZD1 B;  1YVF A;  4QYR A;  3Q8R B;  3U7J A;  1FFG B;  2JZ5 A;  4TKT A;  1YJ9 S;  2ZOG A;  3MED B;  5I3U B;  4Q0B B;  1VQ6 S;  2R42 A;  5CH7 B;  5F8J A;  4Q8F A;  3PKY A;  3HXM A;  3D3B J;  4JI1 F;  2FDN A;  4KPC A;  1RTI A;  2WVB A;  1KQS R;  4L74 A;  4O4G A;  1SJR A;  4DG1 A;  2FYX A;  3IMQ J;  3DKD A;  3GIK A;  1G3O A;  5U47 A;  3N6M A;  2VB6 A;  4X4T A;  2YPZ A;  5ETS A;  4Z7C A;  4RR5 A;  2CPY A;  4Q5V A;  5EHH A;  2A0F B;  2HQI A;  3BSA A;  3OPK A;  4JI7 F;  3HHL C;  3E01 B;  3GSI A;  1HNV B;  3RBZ A;  1WC0 A;  5LJ3 Y;  4YB5 A;  3QWP A;  2VF3 A;  1BQX A;  1SUQ B;  2VJU A;  1ZH5 A;  1ZAV A;  4KV8 A;  1SKS A;  2DXF A;  5D4P A;  3UDE A;  4JI3 F;  4RWX A;  5DRK A;  5L1K A;  1RYS A;  3MXH P;  4DR1 F;  1V3S A;  3UFC X;  3O8W A;  1B0V A;  2D3O R;  1NK7 A;  2PI4 A;  1R31 A;  2BKP A;  2G0I A;  2FHJ A;  2KT5 A;  2XEX A;  3LAL A;  4EBE A;  3GJQ B;  3KK2 B;  4DUY J;  3BKF A;  5THW A;  4XDC A;  4WKY A;  3OTB A;  2UXD J;  4RUH A;  4Q43 A;  2H5J B;  4ELT A;  1TKZ B;  1UW4 A;  4BC7 A;  4CQ1 A;  5F9L A;  1V9O A;  2OPP B;  3EVW A;  3L7O A;  4NLD A;  3M4X A;  4NLO A;  4H54 A;  3UQS A;  4CLT A;  1X5S A;  3KHR A;  3POT B;  2OSQ A;  2Y1L B;  1JLF B;  4U7C A;  3TX8 A;  4FF2 A;  2QX0 A;  5J1E B;  3OVS A;  1M90 T;  1Q5Y A;  3NL0 A;  4F02 A;  5KFT A;  3MPW A;  5KG6 A;  1X4H A;  4M5H A;  1GH8 A;  2EFV A;  3R5G A;  2VFT A;  2EK1 A;  3X1L B;  4HAC B;  1MU2 A;  2OEK A;  2MKJ A;  3Q23 A;  4RNF A;  3PJX A;  3CDE A;  3KWM A;  4ENO A;  1I94 J;  3GE9 A;  1KLM B;  4TLQ A;  4FS1 A;  2YH1 A;  2YXL A;  2JLE A;  1FRL A;  3DYA B;  7AT1 B;  2YWE A;  8AT1 B;  2DIU A;  4EUV A;  1NB7 A;  4A48 A;  2IC3 A;  4X4S A;  5J2M A;  4BDP A;  2VOP A;  3FMW A;  4NZ7 A;  3I0R A;  3I5A A;  3KHH A;  1UVM A;  4JV0 A;  1HBM B;  2CNN B;  4B9T A;  3QT5 A;  3OVA A;  4R0E A;  2HBQ B;  2V2V A;  4PXE A;  1R89 A;  1U0H B;  3DOK A;  2IRY A;  3BYP A;  3KUG A;  3N6N A;  3QZ7 A;  1T9U A;  2CIM A;  4ZVG A;  4QQB A;  4D3H A;  5BYS A;  2B8Q A;  4DL2 A;  2NCK L;  3VQS A;  2YBV A;  4GMK A;  4ED1 A;  4OI6 A;  1T3N A;  2CQI A;  5DDO C;  4CZC A;  3UWT A;  1RK8 A;  1R0B G;  1Q16 B;  1UFL A;  4FF4 A;  2JDJ A;  3MZI A;  1IKY A;  4QWD A;  1KDN A;  2B43 A;  3H20 A;  3W9J A;  3H25 A;  4WBF A;  1LW2 B;  3DXB A;  2FQQ B;  5HQL A;  4ZN3 A;  1BMQ B;  3R3T A;  3TP2 A;  2BE7 D;  4WJB A;  2BX6 A;  4Y28 C;  9ATC B;  4X65 J;  1HNI A;  3IWX A;  3PTW A;  2I2Y A;  1DTT A;  3M2U B;  1TEL A;  4MKY A;  3PEH A;  1QVF R;  2CXE A;  4X4R A;  3R5A A;  2MZJ A;  2ZVS A;  4C3K A;  2Q6B A;  2BM1 A;  1XTZ A;  3WZ0 A;  1RWN B;  1AZS B;  3PX0 A;  4EFA C;  2XI3 A;  1U1N A;  3DLB A;  1K0V A;  2CFX A;  2G0C A;  2H4Y B;  1DHM A;  1UJ4 A;  2YNH A;  4M5I A;  3TAM B;  3G82 B;  3HHL B;  5HBM B;  5IT4 A;  2MZT A;  4DJB A;  3BO3 A;  1U2C A;  2AW0 A;  2Y0S D;  2QL7 B;  3PW5 A;  1XQI A;  4JI7 J;  3LP2 B;  1B0P A;  1RA7 A;  2MZR A;  5HMX A;  2GQ2 A;  5HVG A;  2MKK A;  4QR2 A;  4K50 A;  2I6W A;  4DL3 A;  3BSC A;  1FER A;  1ZPW X;  4QWA A;  3EXC X;  4ZCM A;  3M8Q A;  2GJF A;  5MAO A;  3BGR A;  2E7W A;  2CPD A;  2RSQ A;  1T02 A;  3CC2 S;  3EJM A;  1VQO S;  2QA1 A;  2XLK A;  4KHP J;  2L9W A;  5T7L B;  3CO9 A;  4HH1 A;  3IR6 B;  4EK2 A;  1W26 A;  2B7B B;  3F73 A;  1TR0 A;  3FGV A;  4MFB A;  1ZM9 A;  4EU0 A;  3TNV A;  3SI8 A;  1UW9 A;  2VDI A;  5JVG Q;  1FDN A;  2FZK B;  3AY0 A;  3ILL A;  1S6O A;  2GIQ A;  3CCU S;  4J9P A;  4FPI A;  2FPH X;  1UJ5 A;  1VQ4 S;  2VBZ A;  4CTA B;  3PR4 A;  3G8S A;  1NH8 A;  2ZIT A;  5KFF A;  4K5S A;  4L76 A;  4RL1 A;  4CYU A;  4Y2C A;  3GFZ A;  3MM9 A;  4RW8 A;  2HYI B;  1OMS A;  3AQP A;  4OYM A;  1XNR F;  4X4V A;  1TV6 B;  3LAK A;  5AE1 A;  5KFH A;  4WFX A;  2MKH A;  4LSZ B;  4P75 A;  2B4O A;  5EUH A;  5IQQ A;  5HO4 A;  4YY3 J;  3MAQ A;  4DSF A;  1NK4 A;  1JXL A;  1VI7 A;  4JV5 F;  2HHV A;  3PG9 A;  3MUR P;  1SB6 A;  2XUL A;  3TJ8 A;  4AL5 A;  2KZZ A;  5FLX Y;  1HI1 A;  3DCA A;  3DRX A;  3VGU A;  4WFB Q;  3B54 A;  1FA0 A;  5CXT A;  2VH7 A;  4G1Q B;  3RBX A;  2I38 A;  2K1R B;  2A6O A;  4P7T A;  4DLG A;  1G1X A;  4DUZ J;  1JJ2 R;  5J2N A;  1VFJ A;  3G6V A;  3MAA B;  4H4O A;  3KK3 A;  3CME S;  4I56 A;  3DU5 A;  3BPS P;  1S12 A;  3JQK A;  2MKY A;  2ZDO A;  1FRK A;  2PII A;  1QD1 A;  5DM7 Q;  4ZK7 M;  3K5M A;  1XMB A;  3M05 A;  2N7Y A;  2XQC A;  4LF5 J;  5LL6 d;  3H5Y A;  2HGL A;  2UUC J;  3VV2 B;  1JLC A;  3VZI A;  2QV6 A;  2UXC F;  4Z2X A;  2KTQ A;  1VQ8 S;  2C3O A;  3A8I A;  2WVC A;  2KRB A;  8RUC A;  4W90 B;  4HR2 A;  4UTG A;  5HMY A;  3U1N A;  2W4C A;  3BN4 A;  1RAC B;  2VFR A;  3MEC A;  5D15 A;  3FCV A;  4CO1 A;  3MR6 A;  4FF3 A;  1UTA A;  2LFV A;  5ETK A;  1WOO A;  2Z30 B;  2OPS B;  2WOM A;  3KXD A;  3RAX A;  2E66 A;  5I42 A;  1RHR B;  1LWF B;  6AT1 B;  1TVR A;  2ASY A;  3CJ5 A;  3BEG B;  3MMB B;  2J0X A;  3P3D A;  4ICL A;  4KH0 B;  4ZPB A;  4N47 A;  3W64 A;  4C11 B;  5J1P A;  3E51 A;  3V6J A;  3FBE A;  2R8K A;  3EGZ A;  1V3R A;  4P7V A;  2HGM A;  2GVZ A;  3UW1 A;  1MG7 A;  3HSD A;  1F5A A;  1QE1 A;  1AB8 A;  2YQ3 A;  4PYA A;  1P1L A;  4DF4 A;  2YWK A;  3MOJ B;  2OI2 A;  2G2Y A;  1D8Y A;  2H3E B;  2HNY A;  2J0S D;  1F5C A;  4ZLJ A;  4EO6 A;  3D6F B;  2VFU A;  3M32 B;  4C3L A;  2UUA F;  1UWB A;  2ZFH A;  3H7H B;  1RAB B;  3QNW B;  2JFK A;  2JJ4 D;  3PJ9 A;  3TWZ A;  1L3T A;  1JIH A;  1TUW A;  3HVA A;  1RI7 A;  1RZM A;  4I6A A;  3ZTR A;  3ISZ A;  4QWB A;  2DNR A;  3V6K A;  5I4M A;  5KG3 A;  3TAP A;  4ZCL A;  4OJ1 A;  3QQC D;  4NLX A;  3EGV A;  4QBU A;  4AFF A;  3HFK A;  4PRF A;  2AJ0 A;  2J9C A;  1IQZ A;  5CHC B;  4N56 A;  4X4N A;  4KTQ A;  1N5T A;  5HN0 A;  2IM1 A;  3LP0 A;  3HHE A;  5ETO A;  3AHP A;  5C7P A;  2M70 A;  2JWN A;  1XK8 A;  3NG8 A;  2RDJ A;  4LBI A;  4PEO A;  2E9Z A;  1T7P A;  4J9V A;  2J0W A;  2CPZ A;  3BKU A;  1BD6 A;  3O1L A;  4BLG A;  1LWX A;  3OL6 A;  2EKN A;  2XMK A;  1UP1 A;  3J7Y U;  1REV B;  3BV8 A;  3HPO A;  1NK9 A;  3VVT A;  1KC8 T;  3GV5 B;  1J5O A;  4Y00 A;  4ED6 A;  4FXD A;  4JI2 J;  3TUP A;  3OHA A;  1H2U X;  2X51 A;  3R1H A;  2U2F A;  4KGM A;  2F63 A;  2V2Q A;  2W2Q P;  5D3G B;  2K7K A;  2YTC A;  3E8O A;  3FZ2 A;  3LPE A;  3Q2S C;  1RHK B;  3NGD A;  2VOO A;  5K8N A;  4MJK A;  2PMZ D;  3I0S B;  3BQ2 A;  2UVV A;  1FNO A;  1HWK A;  3FMB A;  3QGH A;  3MM6 B;  1DBD A;  4JI0 J;  2AEJ A;  2QG9 B;  3ZZP A;  1R0C B;  2IJR A;  1YBU A;  4DU8 A;  1FFW B;  3K58 A;  2R2R A;  4CCH A;  2XMT A;  2IAJ B;  1KOH A;  1ZAX A;  3POT A;  3K8V A;  1GK8 A;  2B6A A;  4ZVQ B;  2B9W A;  2XLJ A;  3CUN A;  3VAF A;  1UKU A;  2P6T A;  4C0H A;  2RF2 B;  3DRR B;  3UNG C;  5DJB A;  3M9O B;  2GVD B;  7FD1 A;  2CZ9 A;  2QFJ A;  3H98 A;  4LRC A;  3GLJ A;  2X1A A;  4DV4 F;  3ZTP A;  5IT0 A;  2C2O B;  1N56 A;  1JKH A;  4Q45 A;  3K2Y A;  3D4J A;  1I51 B;  5L1I A;  3EDR B;  2BZ2 A;  2DIS A;  3PYD A;  3SQG B;  4ETZ A;  1SH3 A;  4X66 F;  1SJ3 P;  1K1Q A;  2J6T A;  1LWE B;  5KG4 A;  1LWC A;  2JEJ A;  3G6E S;  4ELV A;  4V19 J;  1A0O B;  1FX4 A;  1HHQ A;  1TU0 B;  2W9C B;  4QW8 A;  5EWG A;  2ILZ A;  5KFS A;  3WX8 A;  4USW A;  3V6H A;  1DZ5 A;  4ZP8 A;  3P6Y C;  2DXE A;  2BE2 B;  3LGM A;  4DR3 F;  1VC6 A;  4F3O A;  3R2D J;  3P5T L;  5GAD U;  1KBR A;  1RKI A;  3BR9 A;  3CDW A;  3ITH A;  2AZ3 A;  1W25 A;  4OI4 A;  2YKO A;  3O44 A;  4TYA A;  2GGP B;  4W98 A;  4DPY A;  4DR4 F;  1N32 F;  4WCE Q;  1D09 B;  1Q0N A;  1SL2 A;  2V2Z A;  2KFZ A;  4Q7A A;  3I55 S;  2G13 A;  5D0E A;  4AE5 A;  3U1M A;  4MKA A;  4B9U A;  2YPY A;  2C28 A;  4UQG A;  2DR7 A;  1ZM2 A;  2AP6 A;  1N33 F;  4YDD B;  4AUK A;  1CLF A;  2DY1 A;  4A8X A;  2JRS A;  3KLV A;  1FTR A;  4ITS A;  4JI5 J;  4I7F B;  3N01 A;  4F36 A;  3ET6 B;  1XBW A;  4B9M A;  2DRA A;  4ZPC A;  3OLB A;  5DLF A;  2J76 E;  5C25 A;  2XMM A;  5C42 B;  2IBK A;  3MMC B;  1NJY A;  2AGP A;  4LFC J;  1U09 A;  2ATL A;  2LQ8 A;  3HHD A;  3EE3 A;  2YNH B;  4DEZ A;  4Z37 A;  5DG8 A;  3G82 A;  3HHL A;  3T9Z A;  3OTE A;  1VIX A;  1X4F A;  3JSY A;  2D3U A;  4NZ0 A;  2JEI A;  4FBU A;  4MYT A;  2N7C A;  4HHU A;  1KQK A;  8ATC B;  3NWR A;  3CCQ S;  1DAR A;  1Y5L B;  3RG6 A;  2BBE A;  4F4Z A;  1JB0 C;  2HZC A;  3HD2 A;  4FYV B;  2L41 A;  4DSJ A;  1S9G B;  2NUU G;  3UCU P;  1E6Y A;  3HVW A;  2UZA A;  1OYD A;  1RT7 B;  2CYY A;  2CVI A;  2NXC A;  3D67 A;  4DV5 F;  1OY9 A;  2DGX A;  2DXD A;  1FRJ A;  2IJF A;  2RML A;  3C14 B;  5L9X A;  2XCP A;  3TAQ A;  1FT8 A;  1T95 A;  4FXV A;  1N8R T;  1JQG A;  1IBK J;  2RQK A;  4HKQ A;  4LMZ A;  4NL5 A;  5CA5 A;  1D0E A;  3K5L A;  1JWW A;  4TQR A;  1RSC A;  1C0U B;  2OHD A;  2CWX A;  1P1T A;  4I6Y A;  4CNY A;  3V81 B;  3EXY A;  1LK7 A;  2VU5 A;  1RA6 A;  4P2F A;  4KQZ A;  3ZNU A;  5JXS A;  2E9R X;  3QMQ A;  4LSN A;  3BS9 A;  2VG7 A;  2H48 B;  3FEY B;  4DDF A;  2KFY A;  4LBP A;  3SSQ A;  2GHP A;  2C3P A;  2MHN A;  3SSS A;  4LFA J;  3GON A;  1TMM A;  4DFK A;  1SJF A;  3KNA A;  4AD6 A;  5CCL A;  2QMX A;  1Y5I B;  4USV A;  1CPZ A;  3FBF A;  1L3U A;  4RLE A;  4EWT A;  3QT7 A;  2M88 A;  2FJE B;  6FD1 A;  4EYH B;  5KFZ A;  2ZH3 A;  5D4N A;  5A2Q Y;  2LEB A;  4DV0 F;  4RX6 A;  1RAD B;  4QPX A;  1X9M A;  2JEG A;  5KFP A;  1NJI T;  1TQL A;  1TL7 B;  3BBB A;  3LGH A;  4H4O B;  4OYI A;  3MFI A;  5H9E K;  2OPQ B;  4OYZ A;  1OY8 A;  2MGZ B;  3M6U A;  1RU2 A;  4ZVU B;  1R8P A;  2DT9 A;  2R7X A;  1R0A A;  1S57 A;  1T03 B;  1TL5 A;  4JI4 J;  4DR6 F;  2KM8 C;  1U6F A;  3GU0 A;  4J9N A;  4WE1 A;  4RW6 A;  3SV4 A;  1OPI A;  1OWX A;  4QIV A;  4TN2 A;  3SCL E;  1VJW A;  2OPR B;  3EM1 A;  3UD3 P;  5HJY A;  1FXL A;  4LRF A;  2QTW A;  1E6V A;  4L73 A;  1GAO A;  4GC6 A;  1YRT A;  2PDA A;  2G1H A;  1WEY A;  2GO8 A;  1VDH A;  3J80 Y;  1FI4 A;  1VIO A;  2XMV A;  2HZV A;  1YJU A;  2D7S A;  2HMI B;  1VMB A;  1QJH A;  2Y3Y A;  2CQ4 A;  2HRT A;  3OR2 B;  4ZN1 A;  4GKK F;  3BGU A;  5HRO B;  4DX8 H;  3J7A N;  1RBL A;  1RWW B;  1NK0 A;  1R8C A;  2HFN A;  1XEZ A;  1RHM B;  3DNC A;  3T41 A;  4QIG A;  3JYT A;  2MY8 A;  2IBO A;  4P52 A;  3BM7 A;  3ICL A;  5LOQ A;  3Q8P B;  3DI6 B;  1WJ9 A;  2E5L F;  3DHW C;  4PYD A;  2C3U A;  1SKW A;  4PCQ A;  4FBT A;  2RT3 A;  4A8M P;  1FJC A;  2KG0 A;  1CC7 A;  4FS2 A;  1RHQ B;  2VPX B;  3ILI A;  1SH0 A;  5IXU A;  3MUM P;  4ECX A;  1CEZ A;  2AJ1 A;  1U0S A;  4ZPV R;  2VKR A;  2WW8 A;  3OXL A;  4KAI A;  2BAC A;  5ETP A;  5G0R A;  3D0G E;  4ED3 A;  3TAR A;  2NZ4 A;  1CS4 A;  1X4G A;  2GJ2 A;  5A8R B;  1KS2 A;  2W1B A;  4B02 A;  3MCO A;  4G6V B;  1MN9 A;  3MI7 X;  4GO5 X;  2NLW A;  4CO4 A;  1SC4 B;  2YWF A;  2JSX A;  2AMC B;  4DV3 J;  2CDQ A;  4DX6 A;  5J2Q A;  1KRP A;  3HLU A;  5SUH A;  2DCL A;  1SJ4 P;  2YNI B;  1WUU A;  3VAM A;  1TKD A;  2CJK A;  4A4J A;  1DY3 A;  3GJT B;  2CG4 A;  5ITH A;  3CIM A;  1U49 A;  4PAA A;  4DZ6 A;  2DH8 A;  1NKB A;  2MQO A;  2AZ1 A;  4J9O A;  1OY6 A;  1R6V A;  5AXK A;  1J2V A;  5B0E A;  2FVQ A;  1P8G A;  1U1P A;  1NPR A;  4NEZ A;  4EGL A;  3MM8 B;  3RZA A;  4AXJ A;  4DSK A;  1YKW A;  2FLO A;  5A8K B;  1X4B A;  2XNR A;  4HT5 A;  2H9Z A;  5IQ6 A;  2IPO B;  2PN6 A;  2J8A A;  2Z2Z A;  1A6L A;  1SC6 A;  4X62 J;  5BR8 F;  3BSO A;  3VAH A;  3FEX B;  2ZH9 A;  2B4U A;  4O3R A;  4Q2L A;  3ZZZ A;  3MPV A;  4U8Y A;  3FKB A;  2FC8 A;  2IJN A;  2O67 A;  3O2I A;  4OJG A;  1Q53 A;  2FB0 A;  2N3L A;  1WF1 A;  1QTN B;  5H9E J;  2DH9 A;  3WC2 A;  4LFB J;  3J7Z T;  5CYQ A;  1RAA B;  3PW4 A;  2D9P A;  3NS7 B;  3WX4 A;  3KMQ A;  1N52 B;  3Q86 A;  2ZHB A;  2FTR A;  1N48 A;  1PIL A;  4P10 A;  4EO8 A;  1P9Y A;  4Y2I A;  4ZP7 A;  2R7T A;  1EQ0 A;  1D9F A;  1RP5 A;  1S48 A;  3VCD A;  3IP0 A;  5EDW A;  1PBA A;  1K8A T;  2H51 B;  1TFW A;  3DRP B;  4ZCK A;  2DRB A;  2ERR A;  1B0T A;  3R97 A;  5F3Z A;  1KLN A;  3ZTO A;  3KUE A;  1IBL J;  3T3F A;  5E3A A;  4OYO A;  3V4I A;  1NJW A;  3KLG B;  1WKK A;  4O44 A;  4ED5 A;  1IR1 A;  2K3K A;  1BQN B;  4QW9 A;  2WBR A;  1HQE B;  1ZA1 B;  4K2J A;  1SCJ B;  2CQ0 A;  2NXJ A;  2BE2 A;  2D1C A;  1EAR A;  2J8S A;  1RTJ A;  2R3V A;  3MD1 A;  3SEO A;  2GV1 A;  1AFI A;  2KVI A;  1VRT A;  4NXN F;  3SQO P;  1C1C B;  1RGV A;  2H1Y A;  2ZBI A;  3NCR A;  3OSN A;  4F67 A;  2FVS A;  1K1S A;  2MKS A;  4B3O B;  3HMJ G;  1NDP A;  2MXY A;  2VD3 A;  3HHL D;  2DGQ A;  4WTO B;  2ZH5 A;  4QIF A;  2VG6 B;  3RW7 A;  3PZP A;  2X1F A;  4UOG A;  4YB6 A;  4H4M B;  3EVM A;  5BJR A;  2X3G A;  2VPY B;  3W66 A;  4ANC A;  3C16 A;  2FJW A;  1VQK S;  4B08 A;  1U1K A;  2DNO A;  3DGV A;  2K06 A;  2ZBR A;  2YQ1 A;  1TZ0 A;  4I2P B;  1WSV A;  2RVJ A;  4OV6 A;  3FSI A;  2FLN A;  2FIU A;  3CJ3 A;  1HQU A;  1JJH A;  2MDA A;  4I7F A;  4OHV A;  2V8H A;  3ZC4 A;  4KB7 A;  2RD5 C;  4PPZ A;  3OXG A;  2MB0 B;  2LA4 A;  2CJY B;  2RDI A;  1WDD A;  2IA0 A;  3Q2T C;  1FKP A;  3IAS 9;  1U45 A;  2EK6 A;  1ZAW A;  2VC0 A;  2KJV A;  1BC6 A;  1QDU B;  2YKQ A;  4OI2 A;  3I9V 9;  2XMA A;  3M1V A;  3OTC A;  4JYA J;  1MLA A;  3D5M A;  2HK3 A;  5DDR C;  2UXB J;  1HAR A;  2PSZ A;  1M5H A;  2CVE A;  2M8D B;  4DCP B;  5HAT A;  4F04 B;  4OYB A;  2DHA A;  2M7S A;  3A8K A;  5KFL A;  1S9G A;  3KOA A;  1DQ9 A;  3W60 A;  3D28 A;  1BY9 A;  3M8W A;  3DLJ A;  2DGO A;  3Q0A A;  1ZS6 A;  1UVI A;  1S1V B;  3C14 A;  4QJV A;  5F8M A;  2E5I A;  1F6T A;  4C98 A;  4ZVP B;  3JSM A;  1FKA F;  3AXK A;  3QPI A;  4K4S A;  3FFI A;  4LF4 J;  1VRU B;  3R5B A;  5HAN A;  2ZUA A;  4K4T A;  1UA0 A;  1VQN S;  1OSD A;  4PG8 A;  3CXC R;  3G96 A;  5G4D A;  4NEY A;  5DGB A;  1JJ4 A;  3MD3 A;  4N77 A;  5HP1 A;  4F4W A;  5IT9 Y;  4WYW A;  3AJ1 A;  3FJ2 A;  4OZ2 A;  4DV1 J;  2R8J A;  2FGC A;  3RBE A;  3KG4 A;  1BXN A;  2DGT A;  2YKP A;  3AAW B;  3FCH A;  3A8J A;  4H4K C;  2ZM6 F;  4DR1 J;  3CC7 S;  5KOX A;  3B8H A;  2EG1 A;  3M8S A;  1TKX B;  3IXQ A;  1FK9 B;  1LK5 A;  1MW7 A;  4P71 A;  4C8N A;  1BLU A;  3PDN A;  2WVE A;  2HRY A;  4YQW A;  2ASL A;  2YNG B;  2FVC A;  5AT1 B;  4RNO A;  2DVI A;  2ZVI A;  3HO1 A;  1FKO B;  4I67 A;  5CYM A;  1IKW A;  4C8K A;  1MNE A;  3GFH A;  1FRI A;  3IBW A;  2VG5 A;  2HKE A;  4NZ6 A;  4ZHR B;  5CCM A;  1KOO A;  2B51 A;  2MQ8 A;  1ZBT A;  2QLJ B;  3KLI A;  3PRB A;  1SC3 B;  2HIQ A;  4NXM F;  2CJ9 A;  3HT3 A;  3HKW A;  4Q8E A;  2QGF B;  5IC4 B;  2FHM A;  2U1A A;  4X4Q A;  2DD8 S;  1K47 A;  2VA2 A;  4LUB A;  3IC1 A;  5B7W A;  3ETM A;  4QIW D;  3HI9 A;  4RPF A;  1T03 A;  1EQM A;  3MFH A;  2XI2 A;  1AW0 A;  1SIW B;  5HQ8 A;  4OX6 A;  3UD4 P;  1RE1 B;  5ETM A;  2R7Q A;  5J2P B;  2F4V J;  1G6B A;  3LF0 A;  2IYG A;  2H54 B;  2J5A A;  4NI2 A;  4DBQ A;  3P45 B;  4WE1 B;  2WB1 D;  3OUY A;  5B0A A;  1WG1 A;  3DMJ A;  5KFI A;  2VQE J;  3QJJ A;  4X65 F;  5KFD A;  2EKY A;  3C19 A;  4KO0 B;  1XNQ J;  4X4U A;  2GQC A;  2K8G A;  2UV8 A;  3QT6 A;  4J90 A;  2LDI A;  4RBU A;  3OL8 A;  1SQG A;  4CT8 A;  4J9R A;  3R7N B;  1S0N A;  3CIZ A;  5C5J A;  2LA6 A;  1XR6 A;  3CDB A;  2F5G A;  2KHD A;  3FK4 A;  2CQP A;  4MK7 A;  3UVJ B;  3J81 Y;  1W2I A;  4ER8 A;  4ERD A;  2HHU A;  2DNH A;  4DUT A;  4JOU A;  1DTQ B;  2QL5 B;  4DSE A;  4DFM A;  2A1B A;  1SJ1 A;  3JYT B;  4F25 A;  3THT A;  3EX7 B;  2ZBQ A;  3CJR A;  4DR5 J;  2QMW A;  3HCX A;  3LP1 A;  3JQM A;  1NK5 A;  1Q79 A;  1T9Y A;  3A3O B;  4TU9 A;  4ZJQ A;  1BQM A;  2XNQ A;  3MPU B;  1CJV A;  1R3N A;  1EKR A;  5M2R A;  1FJG J;  1HNX F;  2WHO A;  2BAB A;  1PJ5 A;  2QT7 A;  1TL3 A;  4KRW A;  4PXB A;  3MR7 A;  4BCA A;  1U48 A;  2OTL S;  4DR7 F;  4B17 A;  2DB1 A;  5LM7 E;  2F9D A;  3Q8V A;  3IRW P;  1RTZ A;  3TQE A;  2I1R A;  3C2P A;  1MML A;  4OI1 A;  1P9Q C;  5L1J A;  4KFB A;  1FFS B;  1RJJ A;  2V50 A;  1QVG R;  4AL7 A;  4GKJ F;  4GC7 A;  2CQD A;  3CF5 Q;  3ONQ A;  1G7C B;  3DC2 A;  3H2L A;  4F0M A;  1NDK A;  4LF4 F;  4KIA A;  4QU6 A;  3D6T B;  4YEA A;  3ZXW A;  4LRD A;  3JSB A;  4KGK A;  2B9Y A;  4E8U A;  2MKI A;  4XPE A;  4C8M A;  2WAQ D;  3JQJ A;  2BYC A;  3M2V A;  1RT4 A;  1WF2 A;  4MKB A;  5B08 A;  3M2R A;  1RTI B;  3G6X A;  4O4G B;  4N41 A;  1KVJ A;  5KG1 A;  4O0N A;  2ASJ A;  4WWS A;  3GSD A;  5LMU F;  4ELU A;  1NM2 A;  3GYX B;  4DV6 J;  2OEJ A;  3GFX A;  4OI0 A;  3CJK A;  1F9E B;  3DU6 A;  1S9E B;  4NLQ A;  4UQT A;  5KG7 A;  1YTY A;  2VA3 A;  2KFN A;  4ZOS A;  2GFF A;  1HNZ F;  2HPU A;  4LSL B;  1U1Q A;  4DSL A;  1WD6 A;  2COL A;  4NCA A;  1U26 A;  2UVU A;  2KYZ A;  1JLA A;  2W2M P;  5KT4 A;  2AD9 A;  3RJM B;  2MHE A;  2FY1 A;  3QWU A;  2FC9 A;  4UY8 T;  2P8I A;  4PZV A;  4C3M A;  3S7R A;  4NE9 C;  4DLE A;  4UY8 5;  1EZZ B;  3KFW X;  3UN5 A;  1NHU A;  2ZC3 A;  2MEW A;  5H1S V;  4J9L A;  1DQA A;  1Q1K A;  2HG4 A;  1V3Z A;  2DJW A;  4UW2 A;  3NGU A;  3W3S A;  2QA4 G;  1KTQ A;  1QUV A;  1RAI B;  2N4D A;  3FQK A;  3QYY A;  3JAM U;  3KLE B;  4C9D A;  1RT1 A;  3H0P A;  3Q22 A;  2C2R A;  2RIJ A;  4DQQ A;  3K5P A;  4O3P A;  2OPP A;  5IV4 A;  4P2X A;  1KHW A;  4ETX A;  5GAH I;  3F56 A;  1MRO A;  5BYQ A;  3VAL A;  1HQE A;  2KKH A;  2MZQ A;  1YRX A;  2VDH A;  4TXS A;  3BGL A;  4KBI A;  4C48 A;  5ETT A;  4UT4 A;  5KFJ A;  2BR0 A;  1H73 A;  5D78 A;  4CI0 B;  5D8H B;  4RU2 A;  2GHV C;  3PEJ A;  1KTV A;  2L9N A;  2M2B A;  3I56 S;  4DPX A;  2F9J A;  4F4X A;  4ANE A;  1XMO J;  3J81 j;  3TZW A;  3SCI E;  4WFA Q;  3E2E A;  4B3O A;  2GA7 A;  4FYW B;  2V63 A;  4I64 A;  4KGV B;  4ED8 A;  1XMQ J;  3NS6 A;  4MIB A;  3GB0 A;  1NHK L;  2CNK B;  2DPJ A;  1NSA A;  2QFI A;  3NNA A;  1GMW D;  2BA9 A;  2W2N P;  2LCW A;  1I94 F;  2IC3 B;  1UET A;  1F60 B;  1SUQ A;  3B78 A;  4W4M A;  2B5J B;  2KRR A;  4F50 A;  3WIV A;  5HK4 A;  1S1X B;  3EZ5 A;  4HTJ A;  3DOM B;  3DRS A;  3RUB L;  1JLB B;  2F8H A;  4BC9 A;  1K9M T;  3PHE A;  1VK3 A;  2CZ4 A;  3SDE A;  4BWJ A;  2YWG A;  4OYX A;  2GJI A;  1HBU B;  4TY9 A;  4HLB A;  1UZD A;  4HI2 A;  5CQG A;  5FII A;  5CAA A;  4UZB A;  5L1L A;  1IKY B;  2D41 A;  1S7I A;  4ILM A;  4OQJ A;  4CM0 A;  1KSP A;  4LRB A;  1F9H A;  1FDB A;  2VJV A;  1CQN A;  1U47 A;  2Q3P A;  4DV7 J;  1J5E F;  1B64 A;  5KFY A;  4IDK B;  2V8G A;  1NPP A;  2Z57 B;  1DTT B;  3M2U A;  1RAJ A;  3VGV A;  2ZNY A;  2NPF A;  1KD1 T;  4U96 A;  4K7Q A;  1NSQ A;  5HLF B;  1XNQ F;  3PV8 A;  1H38 A;  4J9M A;  3VAK A;  2BKN A;  3QLH A;  1HLW A;  4CLL A;  3V5R A;  3I31 A;  3W2W B;  3JSM B;  5LMU J;  4RNN A;  2RKI B;  3BPD A;  3KK1 A;  2NXE A;  2ROE A;  2W01 A;  1ZM4 A;  3UD5 A;  4DWI A;  5C24 B;  4LVN P;  1NU4 A;  1VOM A;  4B9S A;  1JLQ A;  2P9G A;  3NXZ A;  1IQT A;  4JI8 F;  3HJV A;  2DRD A;  1RT2 B;  3KLH A;  5F9N A;  3HZG A;  4V19 X;  4ECS A;  3MDF A;  2G0J A;  1S76 D;  3KJQ B;  4EEY A;  1U1M A;  1CUL A;  1SXL A;  1H2T Z;  2X1G A;  4MMO A;  1EP4 B;  1UWA A;  4B3R J;  3HHK A;  1NSP A;  3CD5 A;  2RHQ B;  3RAM A;  3MPD A;  4RWW A;  5IM0 B;  1LFP A;  1AXQ A;  2CQB A;  4M5M A;  1FWL A;  4OMF G;  2D3Z A;  1NXI A;  1OO0 B;  5E33 A;  1NH7 A;  3F44 A;  2HK2 A;  3D6M B;  4FN5 A;  2R8G A;  9RUB A;  1UFK A;  4OZN A;  5EN1 A;  1SIZ A;  1X9W A;  1TUG B;  3TOQ A;  2KJW A;  2B9X A;  2VV5 A;  1JJC B;  2C2M B;  3D0I E;  3KLI B;  3NGS A;  3AFG A;  4CYU B;  4F3Q A;  4PQA A;  5KFN A;  1Q8L A;  5CD4 H;  2Q66 A;  1MN7 A;  5KFB A;  4NAS A;  3DM2 B;  1H74 A;  5B0B A;  2DGS A;  4ZKA A;  2B4P A;  4ZP6 A;  3QRR A;  1VJQ A;  4LBH A;  1Q7L B;  1PAU B;  4NRU A;  1Q5V A;  4DV4 J;  2VQF J;  4W92 B;  3H5U A;  2W25 A;  3DGP B;  3CCT A;  3Q89 A;  4Q0B A;  2JC0 A;  1EET A;  5GAG U;  3ULH A;  3WIU A;  2KM8 B;  3W9I A;  4I4B A;  3U27 A;  4DR2 J;  4DX5 A;  4X64 F;  2HND A;  1VQ7 S;  4XK8 C;  3K7R A;  3QO9 A;  4USH A;  1RCO B;  2AGQ A;  3G2X A;  2AJF E;  2WK4 A;  4I2Q B;  4PG5 A;  3AD7 C;  2ZHA A;  2KZM A;  3N79 A;  2HVH A;  5T7L A;  4CLU A;  3R7B B;  1HHT P;  5CZX A;  4F2R A;  1JLC B;  2WSF C;  4LF5 F;  1UVL A;  1N32 J;  2CRL A;  1S1W A;  4CIO A;  3VGT A;  2UUC F;  3GV7 B;  2LEC A;  1YI2 S;  4RNH A;  2FJA B;  2EFO A;  3DDN A;  2R9L A;  3BB5 A;  4L6V 3;  3W2V A;  2ZH7 A;  4DV2 J;  4FF1 A;  4GVL A;  1N0U A;  1U8S A;  5K8P A;  4DQR A;  4C8L A;  2Y8W A;  3IM8 A;  2M3D A;  4MH8 A;  1IKX B;  1IM6 A;  2OTJ S;  1EHW A;  1YDL A;  3MM9 B;  4G1I A;  1J5E J;  5ETR A;  1YIJ S;  2P6S A;  2HBZ B;  4U8V A;  3ILJ A;  1X8D A;  1HI8 A;  2E7V A;  2I9S A;  2CJX B;  3D1O A;  3EGN A;  2F8E X;  1FTC A;  1S1T A;  3I96 A;  3OTD A;  2KH9 A;  3AT1 B;  2ZH1 A;  1K73 T;  4HL9 A;  4U9R A;  2MKC A;  3R27 A;  1T9V A;  3VAG A;  3PYG A;  5LMN J;  1UPM B;  3RW6 A;  2J7U A;  5J2N B;  1HFE L;  1Z4U A;  3AOC A;  3PCO B;  4YHH J;  4B3T J;  3BO4 A;  3FDS A;  1AUS L;  4EI2 A;  5J1E A;  3CPW R;  3CWJ A;  1FD2 A;  3HVT A;  1IBM J;  2QO3 A;  4N8N A;  2V94 A;  4RW7 A;  2QMU B;  2ROG A;  4HAC A;  5KFV A;  4IG3 B;  3T1H F;  1NK6 A;  4PWD B;  5CZV A;  1PIE A;  2QIF A;  1YHQ S;  2HHX A;  1O6X A;  2DNP A;  1SQF A;  5D4O A;  2XZT B;  3LTO A;  1D9A A;  4R5P B;  1FXD A;  3VR1 A;  2F8M A;  4IRK A;  3RR8 A;  1OIA A;  1GNK A;  1ULR A;  2LKZ A;  4ILR A;  2ZWP A;  4B3R F;  4JI3 J;  4UOH A;  4N76 A;  1UEK A;  1WKJ A;  1H98 A;  1AA1 B;  2QJ3 A;  1RBA A;  2WON A;  4DHV A;  1S49 A;  2FLP A;  1HBM A;  3H4B A;  3OT9 A;  4JV1 A;  3HP6 A;  1PYT A;  3S6E A;  1L3K A;  3T19 A;  1MMN A;  2W2O P;  4DCO B;  4YR3 A;  3AH6 A;  2KXN B;  1IXK A;  2DO4 A;  4HI1 A;  2V4Q A;  1F3V A;  1VCT A;  2O5D A;  4JB8 B;  2B7C B;  4ICL B;  2CA9 A;  2OD6 A;  4M5K A;  2IDE A;  3PYE A;  3JB9 k;  2WSC C;  1PC5 A;  3OFG A;  4B9V A;  3NNH A;  2NRE A;  3OL9 A;  3SFU A;  2DHX A;  4C7Q A;  3MF5 A;  3BN7 A;  4WF9 Q;  1WOR A;  1Q86 T;  4JI2 F;  4DCJ B;  3C66 A;  4K4Z A;  2NSC A;  1SV5 B;  3EGW B;  5D0H A;  2AYG A;  3I82 A;  1VQ5 S;  2VQF F;  3RR7 A;  1PO6 A;  5JMN A;  2HNY B;  5HVF A;  4J9U E;  1RAH B;  1S4E A;  4ES1 A;  1M5O C;  1RT1 B;  4NA2 A;  2MSS A;  2QLX A;  3CTR A;  2CPH A;  3OJS A;  1W2B R;  1VC0 A;  3DLE A;  4IOA Q;  2HVI A;  1UWB B;  3TR5 A;  2QA4 S;  4LF8 J;  2IAJ A;  3C6T B;  1MRO B;  3OBI A;  4I6W A;  4JI0 F;  1NAQ A;  2YH0 A;  4ZVF A;  3T1Y F;  2KDO A;  1HR0 J;  2RF2 A;  2HGN A;  3UCZ P;  2RU9 A;  1NEE A;  5F8G A;  5DG9 A;  3T5H A;  2XMJ A;  1A7G E;  1XER A;  3QAU A;  4EZ6 A;  3FCW A;  5L39 A;  2PT0 A;  2XGQ A;  2VPZ B;  2ZE2 B;  2IMO A;  3LP0 B;  2G2O A;  3SXL A;  1UZH A;  5IS2 A;  3GV8 B;  3PW7 A;  1RT6 B;  3I4P A;  2MMY A;  3CO0 P;  1H7W A;  4DOZ A;  5GAE U;  4PWU A;  1TK5 A;  1M5V C;  2IVF B;  1DUR A;  2LU2 A;  4KE5 A;  3G8Q A;  4I69 A;  1HMV A;  4F4A A;  4OZJ A;  5GAD I;  1VHI A;  3P5B P;  4MFB B;  2RQM A;  2CPI A;  5KFR A;  4ZIV A;  5B0C A;  3OL7 A;  1LXN A;  2R2U A;  1SL1 A;  2XS7 A;  3SDE B;  2M5Y A;  2DYA A;  4TYB A;  1JMT A;  2RHS B;  1KFD A;  1X4A A;  2MJN A;  3N0V A;  3IRX B;  1Y4Z B;  3K59 A;  4C4W A;  4CLW A;  1QM9 A;  2EPI A;  1Y11 A;  3ETO A;  3PM9 A;  5F8L A;  2BRK A;  1PJ7 A;  1VLO A;  2HWT A;  2RDD A;  3I0S A;  2W7P A;  3RRH A;  5HJX A;  2HS0 A;  1KNZ A;  4OX9 F;  5K5M A;  3CCV S;  3RRG A;  5D4L A;  5I3Q A;  3BBF A;  3EWG A;  5KAK A;  2IY5 B;  2RS2 A;  3CB4 A;  1F2G A;  1DFD A;  4MK8 A;  4UOF A;  4IDK A;  2PEB A;  2FZC B;  4OZ5 A;  3HZE A;  4ZIT A;  1JLG B;  2DHS A;  2D3O 1;  2HHH F;  1N33 J;  1RTD B;  3ZZR A;  4L72 B;  3VQT A;  3VAI A;  4P2S A;  3LH2 S;  5D0R A;  2J6S A;  1LW0 B;  5EWE A;  4ECR A;  4CO0 A;  4KPY A;  2VL1 A;  1R8H A;  2WSE C;  2DTJ A;  2I5J B;  3M6X A;  4FKY A;  5KFA A;  1TFY A;  2ZZM A;  4K4V A;  2ZKT A;  3SMZ A;  3M30 B;  4WP9 A;  3KK3 B;  2VIH A;  4DL4 A;  1VGY A;  1WF0 A;  4NX9 A;  4OJH A;  3ZTQ A;  4CDI A;  4WZM A;  5KG0 A;  5DS7 A;  3KLF B;  3DOL B;  2KN4 A;  1F2H A;  2POK A;  3OD2 A;  4PG7 A;  5A76 A;  2AYM A;  4HYK A;  1ZTW A;  2M0G B;  3OW2 R;  1Q81 T;  1VQL S;  2XWY A;  3DN9 A;  1MWZ A;  2FVP A;  4GRS A;  2QRR A;  1ZZN A;  4IR9 A;  1TMJ A;  4WYL A;  4K4W A;  2QEX S;  1TL1 B;  3MEE A;  4ID5 A;  2DIV A;  4U6P A;  3OTO J;  1S6P B;  2FHO B;  2RB7 A;  3CW2 C;  3TO8 A;  3MR5 A;  3R5J B;  3TAN A;  2UVW A;  1OS5 A;  1HW8 A;  3MEC B;  2CQC A;  4OZ3 A;  2VIC A;  1M5P C;  5KT7 A;  1BUX A;  2XSJ A;  2QYC A;  4ZMM A;  1YSJ A;  1B99 A;  3PRV A;  1XNR J;  3CMQ A;  3OR1 B;  1S72 S;  1X0P A;  2FZG B;  5FJ4 A;  1I6J A;  1GX6 A;  1RT5 A;  2I0X A;  3H40 A;  4J9Q A;  1X9S A;  1VQ9 S;  2W24 A;  4YR2 A;  2B56 A;  2ZC4 A;  1RTH A;  2XMU A;  3SSR A;  4Y3C A;  4RW9 A;  2LU1 A;  2HVZ A;  1S5Z A;  4KR0 B;  4OV1 A;  1HBO B;  1H3D A;  4YOE A;  2E7X A;  2B9E A;  1GMV A;  2FY8 A;  2UU9 J;  3QJP A;  3IG1 B;  1NPK A;  3MEG A;  4IH6 A;  3RU0 A;  4DMZ A;  3OHB A;  1T0T V;  2DNN A;  3A13 A;  2APO A;  4WP8 A;  5B0G A;  2EC2 A;  3H4D A;  1B3T A;  5DDP C;  1F5B A;  1F1B B;  4KGZ B;  2GHW A;  2CPJ A;  4F0K A;  2RUG A;  3I6P A;  1RWO B;  3M8R A;  1WNE A;  4O3S A;  2OAU A;  2W9B B;  1EET B;  2Q79 A;  4I0W A;  3SBM A;  4DN9 A;  1YBA A;  4KGX B;  4WFY A;  3JSR A;  4B9L A;  2YKM B;  4U7U K;  4PQU B;  2HND B;  1TAU A;  2XY7 A;  4BS2 A;  1HYS B;  4NLU A;  2XYP B;  1CBK A;  4RKU C;  3OLA A;  2GS8 A;  3JTO A;  5HQM A;  2GIR A;  4NYZ A;  2C22 A;  4ECV A;  5KFM A;  1RUS A;  3GZ7 A;  5KFO A;  4RBT A;  2FVR A;  4DS5 A;  3UO0 A;  1WSR A;  2FUG 9;  2XHW A;  3D6H B;  1RLD A;  5A0Y A;  3W9H A;  1IM4 A;  4WU2 A;  1KFS A;  3LAN A;  3WC0 A;  2NUH A;  1WC6 A;  3NGT A;  1Y3J A;  2V4R A;  2EC0 A;  3T9N A;  3W2V B;  5KFK A;  2ZNZ A;  4BBY A;  2Y0B B;  2AEM A;  4M8L A;  3UR0 A;  3CCZ A;  3ZZY A;  1K44 A;  3R5C A;  3LW5 C;  3CJ2 A;  4IFV A;  4KHR A;  1PJ6 A;  2GMJ A;  1RWV B;  3GCX P;  3P8B B;  3QGP A;  2MZ1 A;  3SV3 A;  1RWP B;  2HW3 A;  2HLT A;  3NEK A;  3DDK A;  3AOA A;  5FDL A;  1TP7 A;  1V6H A;  5GAH U;  2PC6 A;  3W5X A;  2HHH J;  4B3M J;  3K5N A;  4C2M A;  5CYJ A;  1AYE A;  4A8Q A;  1HL6 A;  3FZB A;  2AEF A;  3NBP A;  2KXF A;  2LDY A;  2UUB J;  3MM6 A;  5LT5 A;  4Y6I A;  1ZA2 B;  2MQM A;  2OP5 A;  4JI6 F;  1S9F A;  2EI5 A;  4LQ9 A;  1RYR A;  3MWB A;  4M5D A;  4U67 Q;  4JYA F;  2JH3 A;  2B6A B;  3GG1 A;  3PW0 A;  2E5L J;  2MTL A;  2W4P A;  1RAG B;  3PR5 B;  3CC4 S;  3DRR A;  3BJY A;  4F2S A;  2VFV A;  2GVD A;  5K20 B;  1RAO A;  1S99 A;  2PEH A;  4CWB A;  2KVQ E;  1U8W A;  4LF9 F;  5G0R B;  5KG5 A;  4YR0 A;  1R0A B;  3N9U C;  4USU A;  1JKH B;  2A3J A;  2F40 A;  1BWV A;  1HPZ A;  2BVZ A;  4IO1 A;  4IG3 A;  4LIR A;  2JC1 A;  4R0J A;  2LYV A;  3A12 A;  1GTH A;  1LWE A;  3QIP A;  2W9C A;  4YB7 A;  5KFW A;  3CCM S;  3BQ1 A;  1CVJ A;  4J7C A;  1PAE X;  3VTI A;  1QSY A;  2WON B;  2AV5 A;  3MOZ A;  5A6P A;  1Z2Z A;  2J9D A;  2HFU A;  1VQY A;  3B4M A;  2DEI A;  2KHC A;  1Y3K A;  3QFW A;  3R6L B;  7FDR A;  4YP3 A;  4DQI A;  4F26 A;  1UFW A;  4DFJ A;  1FVQ A;  1HNW J;  1S6U A;  2V8D A;  1I1G A;  2Z2M A;  4X4P A;  1TL4 A;  2DH7 A;  1TAQ A;  3ZZ0 A;  4IG0 A;  5HRO A;  1YWX A;  1GQE A;  3OSP A;  2WCX A;  4JI1 J;  3IR5 B;  1UVN A;  2HFO A;  2BMB A;  2WW4 A;  2XSF A;  4R25 A;  4ZVO B;  5A8K A;  3OVB A;  3FRZ A;  3W7B A;  2CQ2 A;  4WIQ A;  2HRU A;  1GFW B;  1QAI A;  5KFC A;  2Z4P A;  4JV2 A;  3TRG A;  4QU7 A;  3I5B A;  1KEK A;  5IFM A;  5E3Q A;  4J37 A;  1KQF B;  3DLG A;  4RBV A;  4L3N A;  4ZJL A;  3Q8S B;  1IN0 A;  1B7F A;  4Y2A A;  2ZZT A;  5CYQ B;  1CJK B;  1U2R A;  3TVY A;  2KT3 A;  2M52 A;  2Z2L A;  1T05 A;  1PGZ A;  3UI3 A;  3EPG A;  2RAQ A;  2V34 A;  2Z8Q A;  3M8P B;  1N5Y B;  3NKY A;  4PR6 A;  3RBD A;  2OML A;  1U1R A;  4FDF A;  2V4J B;  1Q7Y T;  1NBE B;  4RW4 B;  4CH7 A;  3G4S S;  2F4V F;  3W62 A;  4DR3 J;  2C3Y A;  1D3W A;  1NDC A;  2ZD1 A;  1YJV A;  5FLX U;  3BSN A;  1E6Y B;  2CNO B;  4ZPD A;  3T6J A;  1X4D A;  2UV8 G;  1RT7 A;  3W8P A;  1H7X A;  1CSJ A;  1Q8I A;  1WC1 A;  1IWA A;  3G87 A;  2UXD F;  3HHN B;  2CNL B;  2HSE B;  5KT6 A;  1X60 A;  3NRB A;  4IH7 A;  4O3N A;  4NLV A;  3FC9 A;  4DL6 A;  3MM8 A;  2Z58 B;  3K5O A;  1RTJ B;  4HHH A;  2A2C A;  4ZVS B;  4R8U A;  1S59 A;  2BV3 A;  4PXD A;  1UL3 A;  4DQS A;  4OLO A;  1MWQ A;  4PXC A;  1FES A;  2EWH A;  1WAC A;  2CJB A;  1GXT A;  5L46 A;  3D3C J;  3PX6 A;  2YX7 A;  3K8W A;  4M5L A;  3J7A 1;  1M5S A;  4E98 A;  5HVH A;  2ADC A;  1OPZ A;  3M6W A;  1FRH A;  2E1R A;  2V8P A;  3C15 B;  3E01 A;  3IRX A;  3S01 A;  4YUD A;  1HNV A;  2BUN A;  4MT1 A;  5E2Q A;  5IWA F;  5IT9 U;  1ITP A;  2EFP A;  3BH7 B;  1Z2L A;  2RU3 A;  1IR0 A;  2HAI A;  2IM2 A;  2ACY A;  3C16 B;  3DLK B;  1GX5 A;  1WI8 A;  3CUL A;  4LFC F;  5GAG I;  3LQV A;  1IR2 A;  2Z0G A;  4P2M A;  1I3O B;  4RNM A;  4PUO B;  1VR6 A;  1PBU A;  1FEH A;  1Y7P A;  1JLG A;  4ID8 A;  2G4B A;  3KK2 A;  1ZPV A;  2BM0 A;  1T9X A;  3AQO A;  2I5J A;  2H5E A;  2W7A A;  1FKP B;  3B6B A;  3NMR A;  4X2B A;  3IS9 A;  4MAK A;  4NLY A;  4C0O C;  5CAB A;  4DV5 J;  1O8B A;  3QSY B;  3KLG A;  3L3C A;  2IDL A;  3V2U C;  3DOL A;  1HQ2 A;  2GAH C;  2HQG A;  5HI7 A;  3KJF B;  2H4W B;  2JNJ A;  2UXB F;  2XBP A;  1N6Q B;  1HNW F;  4OYP A;  3UN3 A;  4DS4 A;  2KT2 A;  4IOB A;  4PWW A;  1RQ0 A;  3D7S B;  1BGX T;  1OSC A;  3MAH A;  4ZCI A;  1RXO B;  2RNE A;  4RW6 B;  4LR9 A;  4CLZ A;  1VBZ A;  2HNZ A;  4ZVH A;  1IWG A;  3ENA A;  3MMA A;  5K8M A;  1MU2 B;  3NS5 A;  2WVD A;  3K89 A;  1NHV A;  2YY3 A;  3I9Z A;  2MYF A;  2XSJ B;  4DV6 F;  1HD1 A;  3K0J A;  3HDS A;  3MUV P;  1VRU A;  3UPF A;  3DYA A;  4K4X A;  3PVX A;  2OFH X;  4NLS A;  5C2C A;  1QLN A;  4LF1 A;  2IVY A;  5KT5 A;  1HNZ J;  1IKV A;  1O5J A;  3MM5 A;  2KU7 A;  4YN3 B;  2CWK A;  1YIT S;  2DNK A;  2LQ9 A;  4RW9 B;  1NLK L;  2EFN A;  1S4F A;  1HQU B;  1U0H A;  3DOK B;  4ZP9 A;  3IG1 A;  4KC5 A;  2X1B A;  2UUT A;  3F0N A;  1N0V C;  3HSJ A;  4DV1 F;  3D0H E;  1JLE B;  3AB2 B;  5DET A;  5LSO A;  2XO7 A;  2HVE A;  3KNG A;  1SVD A;  2BXJ A;  3CGI A;  2ZM6 J;  3NAH A;  3NCQ A;  3LA0 A;  5EGY A;  3C46 A;  3KHL A;  1LW2 A;  1FE4 A;  2AX1 A;  4NRT A;  5IV3 A;  4EYI B;  4H4K A;  1NME B;  3BR8 A;  2R7R A;  2IHR 1;  3PNI A;  1CS4 B;  4WK1 A;  1WHY A;  2EG2 A;  2XTJ P;  3KJV A;  4CH0 S;  2NXN A;  1Z1Z A;  1T94 A;  1S0V A;  2BQ3 A;  1HYS A;  4PPD A;  3TZX A;  4ECU A;  4WII A;  3PO4 A;  4FPR A;  4M5N A;  4J5O A;  5J2Q B;  1HBN A;  3BDE A;  1S1V A;  2GZO A;  3MHY A;  4ES3 A;  4IOC Q;  2C2E A;  5K9F A;  2DIT A;  2YWH A;  2BDP A;  2A2D A;  1WKL A;  4E2F B;  4KYZ A;  1FWK A;  5CD4 A;  4TQS A;  1KP6 A;  1XMO F;  3H2V E;  1NJZ A;  3MED A;  5I3U A;  4B3S J;  1U1O A;  1S0O A;  5AE3 A;  1IBC B;  4OHW A;  3A8E A;  2YKN A;  3ZZU A;  2MLY A;  5KT2 A;  5IWA J;  4YB1 P;  4ECT A;  4K2X A;  1UAW A;  3M8Q B;  3HUL A;  5HP1 B;  3PIO Q;  1YJN S;  4CLS A;  5ETL A;  2MJU A;  4LRA A;  2AJQ A;  3GIJ A;  3H42 A;  4M95 A;  4ZS6 A;  2IYI A;  5MLC V;  1S6Q A;  3EIC A;  4N5S A;  2LLZ A;  3VGS A;  2DO0 A;  4A8K A;  2WBM A;  3M6V A;  1F0X A;  1DTQ A;  3CJ4 A;  5AXL A;  2GW8 A;  4IQX A;  2PFF B;  3NBP B;  1WEL A;  3CT9 A;  3W5Y A;  2W4D A;  2CQ3 A;  1QAJ A;  4KV8 B;  2OFG X;  4LR8 A;  3QBC A;  3N28 A;  5CYM B;  3U1L A;  5F3T A;  1N34 F;  4RUB A;  1FHT A;  3D68 A;  3LO3 A;  2R7W A;  4DR5 F;  4UUW A;  2GIF A;  4WFZ A;  2DNG A;  2ZEJ A;  1ACM B;  2VBY A;  4DV3 F;  5F8N A;  1YBT A;  2CJA A;  3PY8 A;  2HS3 A;  4FZV A;  1NDL A;  3M7V A;  4NLT A;  4JUZ A;  5DLG A;  2MQP A;  4LR7 A;  2CZV C;  4AL6 A;  1KHV A;  2K3I A;  3IAM 9;  2MQQ A;  3GIL A;  4OFZ A;  2CQG A;  2OLW A;  3CD7 A;  2PGC A;  2P2C B;  3A4T A;  1HPZ B;  2DY9 A;  3DDI A;  1XWL A;  2ALZ A;  1RWM B;  3VF0 B;  2UVR A;  3GWC A;  3MCM A;  1X31 C;  4G1Q A;  4KT0 C;  4O44 B;  4F0H A;  4XPC A;  2K1R A;  1SBR A;  2DNL A;  3BGF A;  2Y9H A;  4OJ3 A;  1BQN A;  2EW9 A;  3KYL A;  2RRA A;  3UR3 C;  1D9D A;  1B4S A;  4ALZ A;  4GKJ J;  3D1Q A;  4JV5 J;  1IVZ A;  3NMA A;  2DKO B;  3SIP B;  1XR7 A;  2GAG C;  3W1Y C;  3M9M B;  2OEL A;  3QGI A;  4YDX A;  4JI8 J;  1DJ0 A;  2F3J A;  2L9D A;  2VKZ G;  3X3U A;  3LAM A;  3M2R B;  1LXJ A;  5ETQ A;  2W8L A;  5H9F K;  5KFG A;  4QR0 A;  2VG6 A;  5LSR A;  5L38 A;  1LV5 A;  1FJ7 A;  2RH3 A;  5J2M B;  1TK0 A;  5DG7 A;  2YWW A;  3G71 S;  4KKO B;  1S9E A;  2AGO A;  2NYH A;  2O1P A;  2BEF A;  4HVZ A;  4MYU A;  4NML A;  4WTY A;  4GO7 X;  4CO3 A;  2AT1 B;  2OPS A;  2WOM B;  3DLG B;  1CJV B;  3MUT P;  5K14 B;  3HVR A;  4J9K A;  4DUY F;  3R2C J;  2EFQ A;  3U02 A;  4QYZ K;  2BJ3 A;  1JLA B;  2BJ8 A;  2KI2 A;  1TL3 B;  2XHC A;  3KKF A;  1TK8 A;  1M1K T;  5KTQ A;  4J91 A;  1T8E A;  2N4C A;  3AJ2 A;  3H5X A;  3BYR A;  3L7P A;  3IA0 A;  3M1V B;  4BWM A;  2ZZN A;  1TKZ A;  4KHM A;  2D74 B;  3QRQ A;  1X5O A;  2VUG A;  3B4D A;  3TZY A;  3PX4 A;  4ED4 A;  1VQP S;  1S97 A;  2V67 A;  1HWI A;  4IFY A;  4RW4 A;  3W8G A;  2FGO A;  3IR7 B;  5E3R A;  3O5T B;  1YJW S;  3VWS A;  1VBY A;  2OH2 A;  1JLF A;  4B3S F;  5K8O A;  1Y00 A;  1N5Y A;  3M32 A;  4ZPT R;  2C1E B;  1VBX A;  2DPI A;  1CC8 A;  1RU1 A;  2HBR B;  4AQY J;  1ZTT A;  1ZYQ A;  1FEE A;  1R43 A;  4P73 A;  1FF2 A;  4ECQ A;  3TAM A;  1KLM A;  1YK9 A;  3O6Q A;  3HFZ B;  1RKJ A;  1RWK B;  3HX9 A;  2MST A;  2B8P A;  3LP2 A;  3NOC A;  5C2G A;  2RRN A;  1RB0 A;  1M1G A;  1FO1 A;  3AB4 B;  4RJV A;  5A8W A;  3I0R B;  3GR1 A;  4OZ1 A;  1PC4 A;  1ZM3 A;  4B9N A;  1FD8 A;  5ADZ A;  3BGR B;  4G3I A;  3H59 A;  2HQ3 A;  4DV2 F;  4QZV B;  2XM3 A;  2IVM A;  4ZVT B;  1XMQ F;  1FRX A;  1NKC A;  1X4E A;  1H2V Z;  2XY6 A;  2RQC A;  2OGU A;  2C3M A;  2AJ4 A;  3BBC A;  4WP3 A;  2GX8 A;  3GTY X;  3DRS B;  4AND A;  4DU7 A;  3RAQ A;  1J5O B;  2OIH A;  2FHJ D;  3MM7 A;  3LPY A;  5F0W A;  2C42 A;  2LP4 A;  4UST A;  2HBY B;  3PFO A;  2KG1 A;  2F4F A;  4YME A;  4LF6 J;  3DLL Q;  4P74 A;  1O51 A;  3IBF B;  4CTA A;  4EZ9 A;  4DR4 J;  3N5F A;  3T6B A;  2BAN B;  2AF6 A;  2KL8 A;  4Y2M A;  1TV6 A;  3GII A;  2ZOF A;  2QE5 A;  4CRJ A;  5I3P A;  3HSG A;  1FNM A;  1AZS A;  3R5D A;  3CCR S;  2QLB B;  4ATN A;  2VOD A;  4X4O A;  2P9E A;  1GXU A;  4DV7 F;  2RS8 A;  2DNY A;  5HBM A;  3W63 A;  5HSP A;  4F8R A;  2EEY A;  4YS2 A;  2WTF A;  3IGN A;  3DLH A;  2Z2Y B;  2N3O A;  3MMA B;  4KSE B;  1HWU A;  2LQJ A;  2R2S A;  2QLW A;  4A8S A;  1DLO B;  4IYQ A;  2R7V A;  3HKZ D;  3EUN A;  3IO1 A;  4KHP F;  2IIH A;  3GQC A;  1B70 B;  1H0H B;  1LWC B;  2CUY A;  4TNO A;  3TYT A;  4WKR A;  5BYR A;  2VAS A;  1F3F A;  5E5N A;  5C24 A;  1HD0 A;  1R27 B;  4FKX A;  4KY3 A;  5LJ5 Y;  1N36 F;  3ZNJ 1;  3CNQ P;  2EBE A;  1RBO B;  5DO2 A;  2PFD A;  3MM5 B;  4LT6 A;  1WEX A;  2HWH A;  4DN0 A;  3H2U B;  4A8Y A;  1S1U A;  3KG1 A;  5F8H A;  3IBC B;  1RT2 A;  3KLH B;  5IC6 B;  1JLB A;  2JVO A;  1G4C A;  2CJQ A;  2GQQ A;  2UUW A;  2DNQ A;  4Z7Y A;  2GNK A;  1D8Z A;  1N88 A;  2GGP A;  1TKT B;  2DR6 A;  3FRY A;  1ZET A;  1NKE A;  3IWN C;  2M9K A;  1KKH A;  1YX2 A;  1RAF B;  3GCW P;  1Q8K A;  1IBK F;  2IM3 A;  4XO0 A;  4NLG A;  2W2P P;  3CSK A;  2P5V A;  2D9O A;  3OXF A;  3T1A A;  4URG A;  1N5V A;  1R8A A;  4N7T A;  1LWF A;  2I8E A;  2E29 A;  4RW8 B;  4ECZ A;  3JTN A;  1Q95 G;  2ALY B;  4PWD A;  3QGG A;  4WU3 A;  4C11 A;  2QL9 B;  2DNM A;  1WDT A;  1JK9 B;  4AT1 B;  1SKU B;  4C8Y A;  3R1L A;  4CH1 A;  2GO9 A;  4FYD A;  4DL7 A;  2W8K A;  1T9T A;  1EIY B;  4IR1 A;  3CE8 A;  5M2U A;  5EWF A;  1MWY A;  3FBB A;  3M8Y A;  1QE1 B;  3CMA S;  3T1Y J;  3SFG A;  1HR0 F;  4DL0 C;  4ZLP A;  1V5I B;  1OJ4 A;  2V0N A;  3GJR B;  2BQU A;  3QLH B;  4ILL A;  1VC5 A;  2HHT A;  5AXN A;  3SYZ A;  3SCK E;  4PG4 A;  3ZO7 A;  5DDQ C;  1OQ3 A;  1ZZF A;  2DHG A;  2KXH A;  4TY8 B;  5KFE A;  3VAJ A;  4C6A A;  3FQL A;  2LQB A;  1CJU B;  3HSZ A;  5F8I A;  3D54 A;  3EYZ A;  3MR3 A;  3NNC A;  4XDD A;  2X7I A;  5J1N A;  1FE0 A;  1JLQ B;  5JJB A;  3HM9 A;  3TUZ C;  4NWB A;  3WDO A;  4O0I A;  2HFV A;  2JX2 A;  4I2Q A;  3TUJ C;  5A2Q U;  4DI6 A;  2CQH A;  5DQH A;  5KG2 A;  3J7Z 5;  2VPW B;  4EMD A;  4NCG B;  3RB0 A;  5B09 A;  1VS3 A;  2VHG A;  2FJB B;  3QAE A;  3O3L A;  1U6Z A;  3SZ2 A;  4F7V A;  2MY7 A;  1S6Q B;  4JBC A;  4LSL A;  4JI4 F;  3QJL A;  4OIX A;  3WBZ A;  1U1L A;  2ZOM A;  5I42 B;  4DR7 J;  1DQ8 A;  2RQ4 A;  2NXU A;  3QSI A;  3N5B A;  2PE8 A;  2BKO A;  1X5T A;  4EBC A;  2R8H A;  4URS A;  4DPU A;  4ED7 A;  2ASD A;  4IUF A;  1BHN A;  2RIL A;  3GJS B;  4N8O A;  4RU9 A;  4K8R A;  2YNF B;  3KG0 A;  5AE2 A;  5RUB A;  2CPE A;  2GVZ B;  4I1T A;  2WB4 A;  4F4K A;  5D3G A;  2V68 A;  3GFY A;  2J6U A;  1RT3 B;  1F9F A;  3CJS A;  2OSR A;  3CJT A;  1CG2 A;  2UUA J;  1U7L A;  2JOQ A;  1U6B A;  4GKK J;  5DZ6 A;  4FYX B;  1S0M A;  3KLE A;  4PKD B;  1UPP A;  4NA1 A;  1WEZ A;  2OJ3 A;  3UCG A;  3OJU A;  1SI9 A;  3P4U B;  5IOL A;  5GAE I;  4DX7 A;  2JFD A;  3NOG A;  3FBC A;  5E41 A;  3PHT A;  2XO6 A;  4DF8 A;  3R6G B;  1GT8 A;  2HZA A;  3VZH A;  3NY0 A;  2LEA A;  2HLU A;  2AYB A;  2OPQ A;  1N36 J;  2HS4 A;  3UNY A;  2JEF A;  4URQ U;  1SJQ A;  4B3T F;  2HWI A; 
#chains in the Genus database with same CATH homology
 4M5H A;  5ETP A;  3UDE A;  1EX8 A;  1G4C A;  3KUE A;  4M5G A;  3QBC A;  3HSG A;  4M5L A;  4CRJ A;  1RTZ A;  1HQ2 A;  2F65 A;  5ETK A;  2F63 A;  3HSZ A;  3HSJ A;  3MCO A;  5ETQ A;  4CYU B;  3UD5 A;  5ETT A;  3MCN A;  4M5K A;  2BMB A;  1HKA A;  1TMJ A;  5ETN A;  5ETV A;  3KUH A;  1RAO A;  4CWB A;  4PZV A;  3HD1 A;  2CG8 A;  3ILL A;  1F9H A;  1RU2 A;  5ETS A;  5ETO A;  1KBR A;  1DY3 A;  1EQM A;  3ILO A;  1RU1 A;  5ETL A;  3UDV A;  4M5I A;  3HCX A;  1EQ0 A;  3KUG A;  3MCM A;  4F7V A;  3HSD A;  5ETM A;  3IP0 A;  1IM6 A;  4M5J A;  1Q0N A;  4CYU A;  5ETR A;  3HD2 A;  3ILI A;  1TMM A;  2QX0 A;  4M5M A;  4M5N A;  4AD6 A;  3ILJ A;  1RB0 A;  1CBK A;  3HT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...