1EX8A

Crystal structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with hp4a, the two-substrate-mimicking inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
publication title Bisubstrate analogue inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase: synthesis and biochemical and crystallographic studies.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1ex8A00
3HSDA 1EQMA 5ETTA 3KUGA 3HCXA 3UDVA 5ETVA 3MCMA 4M5GA 1RTZA 1TMJA 4M5KA 4M5JA 3HSGA 4PZVA 4CRJA 4M5MA 4F7VA 1HQ2A 1KBRA 3QBCA 5ETMA 3IP0A 3UD5A 1G4CA 1EQ0A 2F63A 4M5NA 1IM6A 1DY3A 1F9HA 3KUHA 4M5LA 3HD2A 3HT0A 3ILIA 3KUEA 3HSZA 4M5HA 5ETPA 5ETKA 5ETNA 1RU2A 5ETOA 3HD1A 3ILOA 4CYUA 4CYUB 3MCOA 3MCNA 1RB0A 4M5IA 2F65A 2CG8A 5ETQA 1Q0NA 1RU1A 2BMBA 1RAOA 1HKAA 3HSJA 1TMMA 3ILJA 5ETLA 5ETRA 3ILLA 4CWBA 1EX8A 2QX0A 3UDEA 4AD6A 1CBKA 5ETSA
chains in the Genus database with same CATH superfamily
3LALA 1BQMA 4X62J 1XR7A 4L72B 1NDPA 2DD8S 3R7BB 1CJTA 1XNRJ 1HMVA 2DGQA 3ENQA 1QSLA 1N6QA 2CJXB 4WU3A 3GG1A 1FD8A 2IRXA 3MM7B 4U95A 3NKYA 3CC7S 3CJ0A 4JI0J 3TUZC 1AT1B 1FESA 3UD4P 2XMWA 2NREA 2RF2B 1HQEA 1VLOA 4I6AA 3MEKA 2DRAA 3IFEA 3KJVA 2J7UA 5J2PA 1FXRA 2VG5B 4ECWA 1F1BB 4N56A 3DLBA 4OQJA 4TLQA 2HNZA 4P52A 4Q0BB 2ERRA 1FDDA 3CULA 3LP0A 1QAIA 1S1UB 2KHDA 2AYGA 2J7WA 2I9SA 3D67A 1AB8A 2Q79A 5GAEU 3QIPB 4OZ0A 1ZZNA 4YDXA 3LP2A 1RT7B 4F4ZA 1N48A 1TL7B 3HHLB 2GX8A 1LKZA 3IS9B 3N28A 1HBOB 2H1YA 5THWA 3QLHA 3SV4A 3J7ZT 1SVDA 2B0GA 3DGPA 3EZUA 2D1CA 3NS7B 4P7VA 3K89A 3CMES 4MJKA 3UDVA 4WFAQ 5ETVA 2UXCJ 4JOUA 4ZP6A 2K1RA 3CGIA 1NKCA 2KRRA 3UCUP 4DR1F 3IR5B 1PGZA 3BQ1A 4GO5X 2GHWA 4RW9B 4MKBA 4BS2A 4DR7J 1EQMA 3ONQA 2CJ9A 1TV6A 2WOMA 1WTBA 4ZPDA 4F4WA 1JJ4A 4JI4J 1RYRA 2CJAA 2MQPA 1M0SA 3IR6B 3Q8PB 3QGGA 2XS5A 1R8HA 5LMUJ 3OR1A 2DNOA 2B5JB 3IRWP 5DG7A 5A8KB 1FFGB 4OYWA 3HVRA 2O01C 2G1HA 5DDOC 3BB5A 1TKXB 3UO0A 4DV0F 4OI0A 3VCDA 1KVKA 2CG8A 1S0OA 2MDAA 3PJWA 1HIYA 1NDLA 3DCAA 5C42B 2QMUB 2CZVC 4A8WA 1RTDB 3M30A 3TAQA 1M5OC 4QYZJ 4DR3J 2V50A 3WBZA 2KDOA 4NEYA 2F9DA 3MEGB 5CYJA 2MQMA 3M2VB 2NQPA 3AQPA 1DLOA 5KG3A 1C0UA 3A8IA 3LH2S 1M5VC 2B7BB 1TK8A 4ZPAA 4Q2MA 4C98A 1NKEA 4RU2A 3D2WA 2J0XA 1F5AA 3GCXP 2O67A 3DRPB 2NR0A 2Z58B 3IG1B 5F9NA 3NWGA 2RKIA 3ZZRA 1RQ0A 1HNWF 3WHIA 5KG6A 4FF4A 1NMEB 3N0VA 2B9YA 3H8YA 2V8DA 2GJ2A 5C25B 4LF8F 1Y5NB 1F9FA 2XEXA 2Q6BA 3UD3P 3MMCB 1TUGB 4OX9J 2MY7A 4AXJA 1UVNA 1RT4B 2BW2A 3OLAA 1UA1A 3R5AA 3PRBA 1V5IB 5L1IA 2OD4A 3E51A 1WOPA 4RBUA 2DY1A 2GVZA 2QL9B 4ECSA 1OJ4A 1RT6B 4EU0A 5KFBA 4WKYA 1BHNA 4R8UA 4O3PA 3L7UA 4ZVOB 1RTIB 2IAJA 2IM1A 3R27A 2QJ3A 2IVYA 1U45A 3PKMA 3GV8B 3PG9A 1FNOA 1UFKA 2P6SA 3MR6A 5K8PA 2GVDA 4XPEA 4MK9A 4QWBA 1RB0A 2ZBQA 4QIFA 5AXNA 2W2OP 4RUCA 2DNLA 2C3YA 3KNAA 2NCKL 1X5SA 4UQTA 1VRTB 3UFCX 3PJXA 2ASDA 3EPGA 2HW3A 1KFDA 1YGYA 5DGAA 3Q8YA 5E33A 2CPYA 3V6DB 4H4OA 2KZMA 4YY3F 1TL1B 3N4WA 2DGXA 5HN0A 4NMXA 2GQ2A 3V81A 2ZD1B 4LMZA 2C2RA 2F9JA 4M5LA 2ADCA 2Z0GA 5F8JA 2COLA 4UOCA 3P3DA 4OI1A 1CG2A 4Y2CA 2IVMA 2MJUA 4WYWA 2GGPA 1SKRA 3GV7B 3OD2A 4QPXA 4AL5A 4TNOA 1JKHB 1RTHB 3CC4S 1YJUA 3ZTPA 3EXYA 2CVIA 3RB3A 1QVGR 1IBLJ 3TWZA 2YTCA 1U49A 2RDIA 2J9DE 1MSWD 1VC5A 1N36J 1N32J 3ISNC 4EK2A 1FKOA 4A46A 2DNYA 4HVZA 3VAJA 4K4VA 5SUHA 4NWBA 4ECUA 4IG0A 2I5JA 3HHLD 3DMJB 1U1OA 5AXLA 2K06A 4ZDNA 1RACB 1X7VA 1Y10A 3HT0A 5C24B 2Q6CA 4RBVA 2A6MA 2YWWA 3GJTB 2ZBPA 1RHMB 1WHVA 2B6AA 2BEFA 2F8HA 2ZBIA 3TJAA 3OSNA 4YS2A 3CJ2A 4P2FA 5D4NA 1WD6A 2QSWA 2DH7A 4JBCA 4UY8T 5CD4H 2C3UA 5C2GA 1LWCB 1FRJA 3M2RA 2QMWA 4ZVFA 1F60B 1UVMA 3HKZD 1YJTA 4USHA 2Z2LA 1LW0A 1RI7A 4NLSA 3DOMB 4DX7A 2Z8QA 5L39A 2E7VA 2UVWA 4KY3A 2EWHA 3D6MB 3VV2B 1T3NA 5CCMA 4B9UA 3TZZA 2DO0A 3VVUA 3L95X 3UN5A 1BWEA 2PMWA 3Q2SC 2UXBF 1RE1B 2XCPA 1FFSB 2ACYA 1VQ7S 1JLGB 2W7OA 2QLXA 1RUSA 3Q22A 5CAAA 2BE2A 2VPWB 5HBMB 3BM7A 4QWAA 5L8RC 5C7PA 2OMOA 1NCLA 2V2VA 5HVGA 1SIZA 3UNGC 1KQSR 2G13A 3HT3A 3QGPA 3BEGB 4YHHF 2PI5A 1TTHB 1KQGB 5DLGA 5HQLA 1BQMB 4Y3CA 1LNQA 4LRFA 1S10A 4TU8A 2HSEB 4Z37A 2DHAA 4F04B 2MKJA 1FCAA 1QDUB 1CJTB 7AT1B 1HMVB 4ZJLA 2HQ3A 1N6QB 1UVLA 1XR5A 4HDGA 2MZQA 1UVJA 2BMBA 1XWLA 4RX6A 2JC0A 2CWXA 4EUVA 1K44A 3W2VA 3RAXA 2QN6B 1HQEB 4OHXA 4M1KA 4C0BA 2ZH6A 1JJHA 4QQBA 3KJVB 1VFJA 3H0PA 3O1LA 5J2PB 4QWDA 3OFGA 3DI6A 2ROPA 4F7VA 3KJFB 4DX5A 1JX4A 2HRYA 4CO0A 4PWUA 2XHWA 3VQSA 3LP0B 1VQLS 3KMSA 1YX2A 2MLZA 3LW5C 2B8QA 4JI3J 2CQDA 5E3RA 4KRWA 2XQCA 1XNQF 2LDYA 3F41A 1G4CA 3LP2B 2XYPB 1M5SA 1ZPVA 4CLWA 2AQ4A 4DQRA 2D3O1 3QLHB 2N3OA 4ZN3A 1YJ9S 3TOQA 3CD6S 1VQ9S 1XR6A 3DGPB 2HVEA 3K5PA 2CRLA 4DV5F 2QX0A 2VL1A 3TNVA 4ZVHA 1M1GA 2K1RB 1X0PA 1PO6A 1I1GA 1B4SA 4FPRA 2C2EA 4I6YA 1CULA 2NYHA 1VR6A 4RWXA 2I1RA 4I67A 1UVKA 5B09A 2W7PA 1Y7PA 3MPUB 4G6VB 1PAEX 3SBMA 1HHQA 3GFXA 3D3CJ 1C1BA 1TV6B 2MKCA 4M5MA 2WOMB 4LSZB 1HLWA 5HVHA 3JSMA 2AGQA 2W8LA 3CDBA 4DZ6A 4F0KA 1EJ7L 3M9OB 4B3SF 2QO3A 3LOUA 2KFNA 2AF6A 3B6BA 4OJ1A 5J2QA 2XO6A 2JLGA 3OR1B 4V19J 3I4HX 1O0PA 4NXNF 4OMFG 1YJNS 2MKHA 1JLBA 4IH6A 1RU1A 1FRIA 2AJ0A 3EVMA 3D1QA 1SQGA 3OL8A 4ZJOA 1R0BG 4DR2F 3D28A 1SH0A 1FJGF 1Z1ZA 3Q89A 3ENAA 5IV3A 3MM5A 1Q78A 3PW4A 2DYAA 3G6ES 3NP5A 5AT1B 4FNIA 2HHHJ 5GMEA 1FX4A 3M30B 2HK3A 3VZHA 2DK2A 4CO3A 3Q86A 4NLYA 2Q66A 3QWUA 4JV2A 3NCPA 5ETRA 3SI8A 1E6YA 1QTMA 1DLOB 3G87A 2DBBA 1C0UB 4WWSA 2HG4A 4JI1F 4MAKA 1QTNB 1TL4A 1WF1A 5J2MA 3AJ2A 4OZ5A 2RKIB 4PR6A 1HWJA 1TKTA 6FD1A 2Y1IA 3D6FB 2YQ1A 2XNQA 1XMOF 4USIA 2BRLA 4NZ6A 4ZCLA 4KO0A 5HP1A 2R2TA 3SMZA 5DDPC 3HDSA 2QSFA 1WSVA 2A18A 1YDLA 3ZFVA 1OYDA 1NDKA 5KG0A 2GQCA 3AA8A 5EWGA 1ROFA 4DV4F 3AXMA 3FEZA 4N8NA 1JLQA 3MPYA 1U0HA 2KHCA 3OSPA 4CP5A 1DTQA 2CJBA 4RW8A 2GVZB 4DV2J 3F0NA 1X60A 2DNKA 4QWEA 5EDWA 1JLFA 4B3OA 4R8UB 3ICLA 4DU7A 5JXSA 2IAJB 2W4CA 2YKOA 4OYAA 5B7WA 1Y3JA 4AE5A 4RR5A 5DQIA 3I9ZA 1S4FA 4HTJA 1SJQA 4Q8FA 1CPZA 2J9CA 1WC1A 3CE8A 3FVYA 3QT6A 3BO3A 2IY5B 4GKKJ 4NLXA 3H5SA 2A6OA 1TR0A 5KT2A 3T1YF 4DR6J 2FJAB 2R2UA 2UUBF 4CLYA 3CMAS 3PDNA 4H4OB 3FBEA 1C1CA 4KC5A 1Q16B 3FSYA 3V81B 3MXHP 4JI8J 3DC2A 1AZSB 3BV8A 3KUEA 4OYXA 2IRYA 5F8LA 2ROEA 3QZ7A 5LL6d 4QYRA 4DL3A 3W64A 5LM7E 2MHNA 2KVQE 3KHRA 3V6JA 4NLVA 3R5GA 2EG2A 2J6TA 2GGPB 3EE3A 1RA7A 1FXLA 2XMKA 1HWUA 2DCUB 2NXEA 2F4VF 2V4RA 1U0SA 2Z56B 4NLQA 1GTHA 4CO2A 2MKSA 3IP0A 3P5BP 1QD1A 4Q8EA 2C42A 3QGIA 3NOGA 1CVJA 4LF9F 1G7CB 3T1HJ 4MIWA 4KYZA 4LF5J 5HMWA 3GJQB 1NPKA 5HVFA 4KPYA 1SQFA 1ZETA 1H7XA 3BZQA 1G2EA 4KGKA 1FNMA 2ZC4A 3IM8A 4IG0B 2I5JB 1S1VA 1URNA 3RBZA 5ETMA 4HH1A 3PX0A 2YXLA 1VQ6S 1P9YA 2RHQB 3G71S 2ZWPA 5J1PA 1RBOB 4B9VA 2PN6A 4OX7A 2B8PA 5D8HB 2B6AB 1UVIA 3THPA 5D4PA 4XIUA 4KFBA 5CZXA 3R6LB 2OPSA 2VQFJ 3BF4A 1N88A 2QC3A 3FQLA 4FYDA 2KT5A 3NGTA 3OFHA 3UWTA 4LF6F 1UFLA 4CDIA 4CLFA 3M2RB 5D4OA 3ZZTA 3J7A1 1UWBA 1LW0B 5CHCB 3FCWA 5T7LA 2JSXA 2WSFC 2IFXA 4HYKA 4MTPA 4ZA1A 2VB6A 1RU2A 1TKDA 4WK3A 3PYEA 5A8WA 2W2PP 2W24A 2ZOFA 2RDJA 3OL6A 1RHKB 2BE2B 2F4FA 4WFZA 3N6LA 2DNGA 1HQUA 4F50A 1VHIA 5A76A 4OJGA 4C7QA 4Y0FA 4ZOSA 1U2CA 2JJ4D 1FRXA 4IG3A 4BHQA 4X62F 4Y2MA 2IMOA 2ATCB 1XNRF 1PG5B 1DARA 1S0VA 1GAOA 3OQ2A 5LJ5Y 5CYQA 2CIMA 2VG7A 3X1LB 1X4FA 1KC8T 2BQRA 3AB2B 3QJPA 2W4DA 4JI0F 4N76A 2D69A 3W2VB 2CUYA 2EKNA 2VKRA 1XERA 3GFYA 4DS4A 2QRRA 4IR1A 4F3OA 1H7WA 3B82A 3EDRB 2HRUA 5DG8A 3HF5A 3T6BA 4UQGA 2R7VA 4V1Ak 2ZH2A 1YRUA 3GFHA 5IWAJ 3JB9k 4AFFA 3DI6B 3RBXA 2GHVC 4OL8A 1FX2A 3Q24A 4X4PA 2BV3A 3W8PA 1IQZA 3W7BA 2QEXS 5DM6Q 1S72S 2RUGA 3PYGA 4YR0A 3DFEA 3D3BJ 3AJ1A 5KFCA 1FDBA 3EZ5A 2ZITA 1KHWA 3KTQA 3TVZA 3K8WA 3LANA 3KKFA 4ETXA 1WOOA 2PO4A 1X5PA 4F0MA 2JLFA 2VDHA 3ZZZA 2MJNA 1T02A 4LF4J 4F4YA 1NSQA 1OY6A 2KM8B 4L3NA 2FLNA 3OVAA 3L7PA 5HMXA 1IKWA 5KFTA 1PSDA 2HS3A 2UXCF 1HKAA 3OLBA 3GB0A 3HHEA 2HBZB 3FEYB 5B0FA 4EYHB 4FDFA 1O8BA 1R8PA 3MZIA 2UVUA 1RP5A 1R3NA 1VLYA 5B0CA 5KOWA 2YKNA 2PIIA 3QMQA 1CULB 4JV0A 4B02A 2OP5A 4LFCJ 4DR7F 2GHPA 3JS9A 2KG1A 2E5LJ 1C1BB 1NPPA 1UL3A 3IR7B 4JI4F 1R43A 1VQ8S 3R8YA 1DBDA 1L3TA 2CQCA 2CQ1A 2G0JA 3W5ZA 4IQMA 3PYFA 2QLBB 3S1TA 5AXMA 1X4CA 3GYNA 5J2QB 4F02A 1QE1A 1JLBB 3T9NA 3LWMA 3NXZA 3K0JA 3BR9A 4DSEA 2KM8C 4CNZA 3KLFA 4WXWA 4Q2LA 4IFYA 3C66A 1PYOB 2FVCA 1GEHA 5ETKA 3MM5B 2CQ0A 1SV5A 2M88A 2HAFA 1O6XA 1QLNA 4EMDA 1NK9A 1P27B 4LSNA 1JK9B 4DLEA 5KFOA 3RRHA 3O6QA 1KD1T 4DR3F 3QQCD 5DDQC 4ELVA 2VA3A 3M6UA 1HNXF 1H73A 3DLGA 1XK8A 4ED3A 4GVBA 4DEZA 1E6YB 5B0BA 1OSCA 3WC0A 4YFUA 2AV5A 3HZEA 1D0EA 5FLXU 3G4SS 5ETNA 4PABA 2P8IA 3CJKA 3AA9A 1TKTB 3PM9A 1NXIA 1QAXA 3GMGA 3OL7A 5JJBA 4KO0B 5DJBA 3BDEA 1RWNB 5HP1B 1M90T 1MN7A 2GS8A 1KNZA 5HATA 3CTRA 4ERDA 2UUAJ 5IT9U 1R6VA 2KYZA 1RSCA 4C8LA 2R2RA 1D9AA 2L9WA 1RWPB 2IYGA 1RGVA 1JLQB 1U0HB 4ECVA 4NYPA 3I0RB 4OZLA 3VGTA 3T5JA 2C2OB 4HT5A 2LQJA 4RW8B 5HMZA 1Q82T 3RTVA 3JAMU 5MLCV 3CJ3A 1JLFB 2OUGA 5ETPA 2JH3A 2V68A 1S0NA 4OHVA 2HVIA 3EYZA 1S48A 5BYSA 2BJEA 3OVBA 2RD5C 4MFBA 1N34J 2W2NP 4PWWA 1LEOA 1ZA2B 1V3RA 4R25A 1FK9A 1KLMA 2Q43A 3V5RA 5FD1A 2YBVA 3BSNA 1KOOA 3OXFA 5GADU 3UN2A 2KXNB 2LXUA 1CSJA 1RJJA 1C1CB 4DMZA 3Q83A 1U02A 1A7GE 1TAUA 2UUCF 2XI2A 1LWXA 4C9DA 1HNIA 3D6TB 5A6PA 2DTJA 5ETOA 3A8KA 2HLTA 1HA1A 5AE3A 3A4TA 2XM3A 1SCJB 3DDKA 2YNIA 3T5HA 1WC5A 4MK8A 3MM8A 1ULRA 1UTAA 4RBTA 1H3DA 1T9VA 1DURA 2ZH9A 3N6NA 1T8EA 3B54A 2XULA 2BQ3A 5I3UA 3T5KA 4QU7A 1RTJA 4IRDA 2FTRA 3HSDA 3V2UC 2XYGB 1IBLF 3W3SA 1R7IA 2XLJA 5CD4A 2AYMA 1UCNA 1RAFB 2BE7D 4GO7X 2AX0A 3OR2A 4FP9A 4B3MJ 5H9EJ 4O3OA 1U48A 3OHAA 1N32F 4ED1A 1KP6A 1NUEA 2W1BA 1BMQB 1GK8A 4O0IA 2X1GA 5D0RA 2NS1B 5JUMA 2Z4PA 2J6UA 2ACMA 2EEYA 1PYTA 3ZZPA 3ZNJ1 1S1VB 4NYOA 3CCTA 5A2QY 4TY9A 1YJRA 4O4GA 1L3VA 2AW0A 2HPUA 4I1TA 1VK3A 4G1PA 2YWHA 4I4BA 4L76A 2ZBCA 4G1IA 1SXLA 3DRRB 3GP9A 2I2YA 3NGKA 4IUFA 4PQUA 1TL3A 3H2UB 1RT3A 3CT9A 1WG5A 1TAQA 2OPSB 2AJQA 2E9RX 3OPKA 2E1CA 4QU6A 2HAIA 4GRSA 2CADA 2BX6A 2NXJA 4W4MA 1UWBB 4ES1A 1Q81T 1O51A 3AOBA 1SJ1A 3DRYA 3KLGA 5T7LB 2ZVIA 5A8RA 4DUYJ 3MWBA 2BM0A 4LF1A 1M1KT 1LWEA 4KV8A 2O66A 3AH6A 3IRXA 4MMOA 2HHTA 1VS3A 4ES2A 5A8WB 3GSIA 2POKA 3GPAA 3JSBA 5D77A 4G1QA 1NK7A 1RABB 1Q5YA 1HQUB 4WFBQ 2M4MA 5IV4A 3MM6A 5CH7B 1C4AA 3HD2A 1NSPA 2RT3A 1VMBA 4IG3B 2VPXB 2XC9A 2XGPA 3ILLA 1BUXA 3NRBA 2NSBA 3CD7A 4WXOA 4K50A 4JI2F 2MKIA 3VAFA 2LQ5A 5CYQB 2AJ4A 4ILRA 2ZJQQ 2VG7B 5KFRA 5KFSA 2GIRA 1JB0C 2LXIA 4W92B 8ATCB 2QFJA 4I6WA 3I5CA 5J2NA 3LQVA 1KOHA 2PGCA 1TL5A 2J7KA 2MQQA 3M9MB 4DPXA 1VBXA 4DQIA 3KOAA 1HR0J 1U6BA 3MECA 2FHJD 5BXIA 5CXTA 1M1HA 1GQEA 3SV3A 1URRA 3M6XA 2HHSA 1ZH5A 5L9XA 3H2VE 4TU9A 2AYEA 4DL7A 3I5BA 4JI3F 1MWQA 2XWYA 3L9ZA 3FFIB 2VFRA 1V9OA 4K5RA 2HNYA 2HVHA 3BSAA 1R8AA 1UKUA 4NCAA 3UR3C 5LOQA 1RAEB 2V0NA 1OPZA 1VQ4S 2RMLA 2JC1A 3HVAA 3KHGA 2Y8YA 4DSFA 1RLDA 2M0GB 2QA4G 4I2PA 2CDQA 1HNZJ 1GNKA 1WF2A 1IKWB 4M5IA 1X0FA 2WB4A 1JJ2R 3CC2S 1Q86T 1TELA 2FZGB 3AFGA 2QA4S 5G0RA 2ZKTA 3AD7C 1G1XA 2YKNB 3CB4A 1PJ5A 4ZJQA 1DHMA 3PXGa 2XBPA 2HRTA 2HFZA 4ITSA 3PHTA 2UV8A 6FDRA 3HFKA 3RW7A 1NO8A 1PJ7A 4LREA 4DFJA 5BR8J 3B78A 2AZ3A 2DNRA 9ATCB 3MCNA 4Z7YA 2DPIA 5HJYA 2CPFA 2A2CA 2ILZA 4P2MA 5KG4A 1FT8A 2BOAA 2KVIA 2UUTA 3IWXA 2IJRA 2PFFB 3NAHA 3CO9A 5JVHQ 2QYCA 5AXKA 2MGZA 1OQ6A 1T9WA 2VHGA 1QE1B 2GAHC 4U8VA 1Q8LA 4DX8H 1P8GA 5EWEA 3CF5Q 3SEOA 5D0EA 2DPJA 1Q8KA 1APSA 3CW2C 4ZITA 2ZHAA 3KLFB 2BJ7A 4IFYB 1U1QA 5E0OA 3MHYA 3ITHA 1SV5B 2VG5A 4LSNB 2CZ9A 2OFHX 2M52A 1F5BA 4DPWA 3Q8RB 4DBQA 3MEDA 4P75A 1WC0A 3DLGB 3TUPA 3PO4A 1B99A 4QZVB 4GVBB 4JI6J 3ZZYA 1RHUB 4FXWA 4AQYJ 2E5HA 1N8RT 1S6PA 4TQRA 5E3AA 2AIRB 1D9DA 2X7IA 1RZMA 3H2LA 1CS4A 2MMYA 3CJKB 3M8SA 2KJWA 1VIOA 4NA1A 1T0TV 4ZIWA 3U1LA 2B56A 2QTWA 2CQ3A 3W65A 2GA7A 2RU9A 1X4AA 4ID8A 1R89A 4RW4A 4DSIA 3ELHA 3RRKA 2HWIA 4RNFA 2Z30B 1RWMB 4BWMA 1S9GA 1HWLA 2MKKA 3EGZA 2MQLA 4DQQA 3VR1A 4D3GA 2VFUA 2L9DA 1RAHB 1UW9A 1V3SA 3AT1B 4W90B 2IJNA 2HFSA 4X65J 2V9KA 4DV2F 3KK1B 1WC4A 2JEFA 3HHKA 4ECYA 4RL1A 5D3GA 4E98A 4Z7CA 1X5TA 3EJMA 1HI8A 1MMNA 2KI2A 4CH0S 2IBKA 3MR2A 4K0KJ 4JYAJ 3FZBA 4TYBA 4NLPA 1DQAA 4XAKA 4F26A 1FTCA 2BABA 1H0HB 1UJ5A 3NS5A 2MSSA 1LW2A 3TR5A 2VC1A 3F56A 1FK9B 1Y00A 2HFUA 3H40A 1KLMB 2AU0A 5A8KA 4C8KA 4DR6F 1R31A 4LRBA 1O5JA 4IO1A 3SCLE 2IDEA 1B0TA 2LYVA 3U1MA 2XY5A 5KFLA 1YRTA 4QJVA 1UJ6A 5LXRA 1UJ4A 2HGNA 2NLWA 4PUOA 4U7UD 5A0YA 3AJDA 5KG1A 4JI8F 1U1NA 2RQMA 5HAOA 4I56A 2A1BA 1MROA 1XMBA 1HNIB 2ROGA 4XTTA 2HZAA 4ZVEA 3HHNB 1HW9A 1H98A 3NBPA 3HULA 3N79A 3MM8B 2CNOB 2ZE2A 3BQ2A 4J9LA 4C3LA 1F5CA 1FTRA 4LUBA 4UW2A 3AQOA 1RTJB 3OFEA 5LMNJ 2DRBA 1XEZA 2F40A 3RBDA 2GZOA 4AD6A 4B9MA 4CLZA 2MB0B 2GMLA 3V6KA 1U1PA 1FF2A 5C25A 3I82A 1S6OA 3T1HF 3K8VA 3TO8A 1IBKJ 4N47A 1B7FA 4LF5F 4DV1J 3FRYA 2K2PA 3OR2B 4OI3A 2J5AA 4FBTA 3CD0A 2IYIA 5HI7A 5IT4A 1LXJA 2PE8A 3D66A 1NJZA 1RXOB 5K9FA 2DNPA 2E1PA 2KXFA 1SUQA 1S12A 2ADBA 1OIAA 1YVFA 3QGHA 4DUZF 3O3LA 4WJBA 2ZZMA 4O4GB 1UZDA 1X9MA 2FJBB 1F3VA 4C8ZA 1I3OB 1GMWA 3K2YA 2CKWA 2UU9F 4K8RA 4PYAA 3T41A 3X3UA 3KHHA 4PQUB 1TL3B 5F8GA 2OPQA 2XNRA 1VI7A 2LU2A 4NCBA 1RT3B 5DQGA 4DI6A 2DVIA 2FJVA 2ZFHA 4DCPB 2HIYA 2EBGA 1VRTA 2BOPA 2YPYA 3VHQA 3DXSX 1DRZA 2DIVA 4PG7A 1RAJA 2X3DA 3CDAA 3SSQA 5E3CA 3EWGA 4MK7A 1RA6A 4B9NA 3KLGB 4WYLA 3ZZUA 3D7SB 2OSRA 5A8RB 4O3RA 4IH5A 1KS2A 4LBPA 1LWEB 4KV8B 2F63A 1DY3A 3CJTA 3IRXB 3HSZA 3UR0A 1UETA 3JTPA 4DL2A 1VHFA 5IQ6A 3TZXA 2LMIA 4G1QB 4HEA9 2ABYA 1E6VA 1SC1B 2DEJA 4J5OA 2MQNA 3MM6B 2HHQA 3KLHA 3B4DA 2GW8A 1YJVA 2AJFE 2FPHX 3KLVA 2RIJA 3DHWC 2IA6A 1SIWB 3PRVA 2J9EA 4ZN1A 4LT6A 2NPIA 1WEZA 1RT5A 2X1BA 4KGZB 3PNIA 1VJWA 1WWHA 1EKSA 2V2ZA 5J2NB 3GYXB 3NS6A 2EFPA 3O2IA 3M6VA 1GXLA 4USTA 1ZAWA 4K4WA 1GX5A 3DLEA 2WW4A 2GC8A 5IWAF 2HK2A 1FVSA 4NLTA 4ILMA 4ZPBA 4B17A 4ZLLA 3MECB 5F3ZA 2F7VA 4QW9A 3ULHA 2PA8D 4YEAA 1JWWA 3CIMA 3MR3A 2R9LA 2DGWA 3FBBA 5DLFA 4ETZA 1KEKA 4QR0A 2FY8A 1JIHA 1DZ5A 1TFYA 4CQ1A 2FQQB 2FJDB 1HBNA 1F2HA 2BE9B 3IBCB 2EC2A 1SPBP 4QIVA 1RWKB 4LF4F 2HVDA 4N5SA 3BGRB 4DFMA 4I2PB 4KSEB 1WEXA 1Q53A 1REGX 5HMYA 3BYRA 4CLTA 2R7QA 5G0RB 2EFNA 3Q0AA 3PFOA 1FRHA 2WVDA 1UPPA 4LRCA 3KUHA 4LRDA 1NB2A 4DN0A 3TJ9A 2VPYB 4J9KA 1RCXB 3MEEB 2ZH7A 2OEKA 1JLGA 4Y65A 1YZ7A 2E5LF 3HPOA 3EZOA 2CQ4A 2WHOA 2ZHBA 4KGXB 2MTLA 1GXUA 1KSPA 4H4MA 1RHJB 4RUAA 4U9RA 5B0EA 5H9FJ 4OZJA 4HHUA 1J2VA 2B3TB 4AUKA 5GAGI 4PXBA 4ZCIA 2G9OA 1U6ZA 5BYRA 4FF1A 1U7LA 4YB1P 2MPUA 4LR8A 2YNGA 4MKYA 3KNGA 2LVWA 4NA3A 1IM6A 4S0MA 2W2QP 3GIRA 3GSDA 2MGZB 3IWNC 2HNDA 1X9WA 1S99A 1OWXA 4N7TA 2AGPA 3BQ0A 4DV0J 1WC6A 4CH7A 2R4FA 2R7WA 2H48B 1FKAF 3E8OA 2NZ4A 2MHEA 4FNHA 3NG8A 1AUDA 3ITHB 2OTLS 2LFVA 2NZCA 5D0GA 4RNHA 2HQDA 4WU2A 5EHHA 1NB7A 4H4KA 3GZ7A 2MZTA 5F0UA 1BLUA 3DRSA 3QRRA 3S01A 2OFGX 4MH8A 4ED0A 2CJKA 4JV5J 1S9EA 3MEDB 2P9GA 2EBEA 2XO7A 1IJFB 4FF3A 3QJLA 3G8QA 1SJRA 1S6PB 4TKTA 3QAUA 4EI2A 1CS4B 2PEHA 1C4CA 2YQ0A 2R42A 1VQOS 2GCFA 5ETTA 1YTYA 3MAAA 4ED4A 4G65A 1WG4A 1RT1A 3CCVS 1IKVA 5BYQA 3TI0A 2UUAF 4RW4B 4YP3A 3BJYA 4FXVA 4F0HA 3G96A 3IN5A 1S9GB 3HLUA 1VQKS 5F3TA 3NGDA 3QO9A 1W2BR 1UEKA 4ZLJA 3NNAA 3PFEA 5F0WA 2PI4A 5IT0A 3T6JA 3MR7A 4QOTA 4C2MA 3MMAA 4PEOA 5D3GB 4EO8A 2LEBA 4OI2A 2DB1A 2CQIA 1NHUA 5CYMA 1BE4A 4A8OA 4KT0C 1ZPWX 3BPDA 1RAGB 3MUTP 4DR4J 5ETSA 4C8YA 4KIAA 1N5TA 2YH0A 2AYBA 4OYIA 2P9EA 2OEMA 3DLHA 1LW2B 1NEEA 4K4TA 1DTTA 2CQPA 3UN3A 2MZJA 2L41A 2AP6A 4BC9A 1H2VZ 2OLWA 1ZOTA 1TMJA 4FS1A 5C2CA 2O1PA 5KG2A 1FDAA 1HBMA 2XLIA 1PCAA 2XMAA 4CIOA 3ETOA 4DV6J 5E3PA 1HHSA 4LFBJ 2O3DA 2LECA 1BXNA 2VU5A 4PUOB 5A0YB 3NNCA 4TN2A 3UW1A 4WP3A 1L5UA 2B43A 2G0CA 4DL6A 1MROB 4V19X 3MPDA 4DSKA 1B7YB 1LK5A 2QIFA 2VASA 3NBPB 3QFWA 4PYDA 3HCXA 2QE5A 3CCQS 3EX7B 1S0MA 4DCOB 4D3HA 2ZE2B 1SJ4P 5HJXA 1T9XA 5I4MA 4RZRA 3BKUA 2Y9HA 4PXEA 3J81U 4USMA 4MKAA 2U2FA 3PVXA 3F73A 3MR5A 3A3PB 1ZM4A 5KG7A 3F44A 4ZVTB 3FSXA 3CVKA 3FMWA 3LGNA 1SC6A 1HYSA 1K0VA 1NJIT 1IJEB 2IHR1 4CLPA 3CCJS 2V6AA 5GAGU 3CSKA 4IOBA 1FFWB 2AMCB 3M8PA 5D78A 3D0HE 1SUQB 5ITHA 5KFQA 3BGOP 3A8JA 1IQTA 4CT8A 3H5YA 3R7NB 3WC2A 3A1YG 4KJIA 1F9HA 4QIGA 2DJWA 3GIMA 5EN1A 2DIUA 4ED5A 1Y5IB 1NKBA 2KT3A 4ZVRB 3CO0P 5KTQA 4B3RF 2H4YB 2AHOB 4WZMA 3KHLA 4ID5A 2OPQB 3J7YI 1RISA 1S7IA 1YLXA 2CFXA 2VFTA 2BW7A 3G8TA 1V6HA 4TVAB 4OHZA 3BN7A 3PW0A 4YB7A 2N82B 3LPYA 4OJ3A 3H4DA 2HGMA 4ZVGA 1Y4ZB 1NK5A 1UEUA 1T94A 2M70A 1HBUA 2MZ1A 2G2ZA 2FVRA 7FDRA 3AY0A 1N5YA 1AZSA 5EX0A 4X66F 1CJUA 4TYAA 3PCOB 1SL1A 4N41A 2X51A 3BH6B 1E6VB 4KHPJ 1VK8A 2CPDA 2WVEA 3WDOA 4R5PA 2RNEA 3KLHB 3VAKA 5EGYA 4WE1A 1T7PA 1AFJA 3MAHA 2LKZA 5D6GA 3M8YA 3EGVA 2ZNZA 2XHCA 1RWWB 1IKXA 2LEPA 4R0EA 4K4SA 3OTDA 2IM3A 4Q45A 3PACA 3BO2A 1RT5B 5GAHI 4NYZA 4Q5VA 1BQNA 1WJ9A 2FIUA 3E01A 4K4ZA 4NLDA 1RKJA 1QAJA 4N8OA 2PMZD 3DLEB 1HR0F 3W2WA 2QGFB 2RQ4A 3NOCA 4IH7A 4OZ3A 2LA6A 1PYSB 3VGVA 2J9DA 1ZM3A 3CJSA 4KBIA 1N5QA 4ZS6A 2I6WA 4XPCA 4KTQA 1L3UA 4QYZK 1CJVB 3CPWR 1KBRA 1PKUA 4P71A 5KFAA 2VA2A 2V8PA 1HBNB 2E1AA 4A8QA 4A8SA 4LFAF 5F8NA 1UPMB 3O44A 4FVCA 2BQUA 4IKAA 1HNZF 4RPFA 1NU4A 1RT2A 1YHQS 5F8IA 2C2ZB 4Y2KA 3C8YA 2JVOA 1TK5A 3OUYB 5B0GA 1KRPA 1AROP 3BO4A 2JLEA 4Y2IA 1VYAA 2NXCA 4RUBA 4ER8A 3DYAA 2YKQA 4ZP9A 5M2PA 2IC3A 4FPIA 5IC6B 3ET6A 3CCLS 4PG8A 3TA1A 1N54B 3EGNA 3NMAA 2M8DB 5KFDA 2HHWA 1U1MA 2XMUA 3HFZB 2PSZA 3D0GE 4DXLA 4C0OC 1IVZA 3WZ0A 2ZH4A 3NEKA 5LJ3Y 1JLEA 3MMBA 4H4MB 5BR8F 3W9IA 3TANA 1R0AA 2E9TA 3BH7B 3FBCA 4FYXB 3ZC4A 1IUJA 2WZ1A 4WK1A 4LR7A 2V8GA 3C15B 2GO8A 1B3TA 2FLLA 2KFYA 3CJ5A 4TXSA 2YNGB 4DUTA 4HACA 1PC4A 3BBBA 3K57A 1ELOA 2HNDB 3BGUA 4F25A 1QJHA 4NXMJ 4HDHA 2WCXA 2RUSA 3FC9A 2Z2MA 3HO1A 4IO9Q 3NMRA 1U2FA 2C3OA 1KLNA 4PCQA 3N01A 1JLCA 3BPSP 3GQCA 3C14A 1H6KX 4ICLA 2UV8G 5E5NA 1WHXA 3J80U 3K5MA 1U26A 2GMJA 4EGLA 3IMQJ 4DLGA 1KVJA 4AYBD 3V6HA 2B4VA 3DRSB 2E5GA 2C2DA 1S9EB 4JI6F 4TLRA 3H98A 4J9MA 4OV6A 4AQYF 1SH2A 3MCMA 1EP4A 4WPAA 4BCAA 3K5LA 4A8KA 2BR0A 2WAQD 2PFDA 1NH8A 2MZSA 3RU0A 2EW9A 4EEYA 2I38A 4UOHA 4RWWA 1IR0A 1L3KA 3MAAB 1EETA 1Y9OA 1RT1B 4FYYB 1VC0A 4OI6A 1LFPA 4NPOA 1IKVB 2FVPA 4MYTA 3MTJA 4A48A 1B64A 4LF7F 1KKHA 1EKRA 1IBCB 2D41A 2MQOA 3R2CJ 4M8LA 4UF4A 1J5OA 2CQ2A 1GMWD 3QO9B 2B4PA 3L7OA 4QCLA 2A2DA 3ZTOA 2D3UA 2DXEA 4NZ0A 4H4KC 4DS5A 3PW7A 4IDKA 3M4XA 5FLXY 3VALA 1OO0B 1VRUA 1NHVA 2Y1LB 2GIFA 2JDJA 3HSGA 1FJCA 3MMAB 1Z2LA 3DDNA 1NM2A 2MQ8A 2EK1A 1NNDA 2DR7A 5CYMB 4K0KF 1F2GA 4LF2A 1RYSA 4PAAA 3CCMS 3QT5A 5J1NA 2L48A 1SQEA 1I94F 5IT9Y 3ISND 3D4JA 2W9AA 4CYUA 1DTTB 5F9LA 2KO1A 4P74A 1NHKL 2A10A 2B9EA 3W5XA 5KOXA 5AJ3F 4KB7A 1S79A 1HBMB 4PPZA 2N3LA 2RS8A 1SKUB 2ZZNA 4LIWA 3RJMB 3JAMY 2DKOB 5KT7A 4KGVB 3C16A 4OI4A 3H90A 4ZHRA 1S59A 3W60A 2LXFA 3SYZA 5T41A 2HLUA 2ZKUA 4ZPCA 2XCAA 3TJ8A 2M7SA 2QLFB 4P9SA 2EG1A 2HIQA 2F4VJ 4NLRA 1N33F 1MMDA 4RNMA 2PC6A 3OVSA 4UZCA 2YNHA 1CC7A 3NLCA 2HYIB 3OL9A 5LMNF 2WVFA 1T05A 4ED2A 2LQ9A 1VQNS 4ATNA 2XZTB 2OKQA 3JXOA 3OTOJ 2J0SD 3CDWA 4IYQA 4A8YA 2Y1JA 1IBMF 3JQMA 4YMEA 3KLIA 3HD1A 5L9NA 1S6QA 4OX6A 4ZLPA 1HYSB 4ZMMA 2ZEJA 2OELA 2DR6A 2KH9A 4EZ9A 1KTQA 1S49A 2GMHA 2ZH5A 2CWKA 3M8PB 3PX4A 4P73A 4JI5F 1WEYA 3I0RA 4DF8A 1MWZA 2FJWA 2GFFA 2W25A 1L3SA 3C46A 1S1XA 3IGNA 1W7WA 2V2KA 1FKPA 1OSDA 3R5DA 1S5ZA 1HFEL 1LFWA 3I6PA 4DV7F 1H2UX 4Z2XA 2DHHA 2KYXA 3LO3A 3W9JA 1BD6A 4PG5A 1KQKA 4FKXA 3QRQA 2E66A 2OI2A 4ID5B 3MD3A 3L09A 1YBAA 4YR2A 1OS5A 3UDLA 2CYYA 5L1LA 2XMJA 2ZUGA 1U8SA 3W9HA 1VGYA 3OBIA 3EGWB 3CJQA 4ELTA 1HBUB 4RU9A 1R27B 1XMQJ 5D15A 3IWLA 1N5YB 4CI0B 4ANEA 2RDDA 1CJUB 5KFJA 4HR2A 2V8HA 3PJ9A 5A6WA 5HK4A 4DSLA 3UDEA 3RGIA 2CJQA 2XS2A 2G0IA 1CLFA 1CC8A 2HFNA 5GVQA 3VGSA 2M8HA 4R5PB 1QAYA 2XG8A 2FZKB 3GE9A 3W63A 1ACMB 4WE1B 4LR9A 1UWAA 4PG4A 2W7AA 2ASYA 3EXCX 4WTYA 1XBWA 4NX9A 3KWMA 2VKZG 2N7YA 1IM4A 2IMWP 2BKNA 1IKXB 3LPEA 4C3KA 1VQSA 1OPIA 3D0IE 2EI5A 2IDLA 3TAMA 2VODA 3CCES 2JRSA 1BQNB 4CWBA 2VFSA 1P6TA 3GIJA 3E01B 2H5IB 2HWTA 4Q44A 3M1VA 3HXMA 3CUNA 4X64J 3CDEA 3W2WB 2ZDOA 3ZZ0A 3ILJA 1FE0A 3QYYA 4W98A 4HH0A 3QRPA 2R7RA 3KXDA 2EFOA 5IQQA 5E41A 2R8KA 1W2IA 3G2XA 4UUWA 2DHSA 4OHWA 1B70B 4TQSA 2V5HG 5KFGA 1OY8A 3TQEA 1X9SA 2Z2ZA 1YI2S 4RUHA 2AD9A 3AODA 2HQCA 3DRRA 1CQNA 4I7FB 2HGLA 3VF0B 1X4HA 4DL5A 1HI1A 3QIDA 1KONA 4CM0A 4LVOP 2R3VA 3KG1A 3LP1A 1NZAA 2DO4A 2OIHA 2ZBRA 4PG6A 2GV1A 3TW0A 3MTKA 1RT2B 1RBAA 2ILYA 1SI9A 5KFNA 2FJEB 4FN5A 3R3TA 5KT4A 2QA1A 3I96A 1QSYA 3JSRA 1RADB 3DNCA 3DYAB 2Q1LA 4UT4A 2AKWB 5KT3A 2IC3B 1TK0A 2DNNA 3ET6B 3KFWX 5H1SV 3CWJA 1YBTA 3PY8A 1RAIB 3TZWA 3TVKA 2ZWOA 1JLEB 3MMBB 5IXUA 2FVSA 3HHLC 4F8RA 3P96A 1R0AB 3QATA 2GIQA 1NK0A 3MPWA 2HHXA 5K8NA 4B08A 1FJEB 2ASLA 3ZZOA 2YX4A 1S97A 2Y8WA 4XO0A 3HM9A 3BKTA 2FLPA 4URQU 1IWGA 3QAEA 4HACB 1K0TA 1N56A 3PYDA 1ZTTA 2YKMA 4RKUC 3HFVA 3KDNA 4DL0C 1RAAB 2B9WA 1GX6A 2AJ1A 1FA0A 1BY9A 1S1TB 1JLCB 3NL0A 3C14B 4CLLA 3CNQP 2DGUA 4ICLB 4PQAA 3U27A 1HNXJ 1BGXT 1D1UA 2A3JA 3A3NB 4JV5F 4B9SA 1GXTA 1XC9A 3GIIA 4MYUA 4TY8A 3OXGA 1LXNA 2I8EA 3GONA 2XTJP 4ED7A 3BSCA 1H72C 3QPIA 3OJUA 1QUPA 4NMLA 3FFIA 3GU0A 1EP4B 3FUYA 3TX8A 3R7SB 1YSJA 4IQXA 4LSLA 1QVFR 2VFVA 4OHYA 1NK8A 2H3EB 2ALYB 2FZCB 2IA0A 1S77D 1EETB 3AOCA 2E5JA 4ECXA 3CIZA 4J9OA 2VBXA 2EFQA 5HQMA 3D1OA 4N77A 4PXDA 1J5OB 2B4UA 3DM2A 4EYIB 4WBFA 1PBAA 1X4BA 1GTEA 2BJ8A 4IDKB 5KFYA 3MUVP 1S4EA 3RW6A 1VRUB 2EFGA 1IXKA 1X4EA 3NGSA 3ZO7A 2YX7A 3I87A 4F4AA 3DDIA 4YB5A 4X4QA 3CD5A 3FRZA 4DR4F 3MOZA 1JLAA 4CTAA 1ITPA 3KUGA 5LMUF 2VQEJ 1PILA 4ZVUB 2OPRA 1UEVA 2KRBA 2VBYA 4CYUB 5K5MA 2E7WA 1KQFB 2V9WA 4NEZA 3HJFA 2BM1A 2VOOA 2OTJS 3MDFA 4DV6F 1QSSA 4LFBF 2UUCJ 4I0WA 1VQMS 2CPHA 4UOFA 1KR4A 1RAOA 3V4MA 1PC5A 1U09A 3C16B 4B3TJ 4ZHRB 4ZVQB 3DOKA 3OJSA 3PO5A 1U47A 3UPFA 5K8MA 3NCRA 1VBKA 2HKEA 1T3OA 2AGOA 1M5HA 3BGFA 4DPOA 3TP2A 1Q7LB 1U8WA 2V34A 2DISA 2XYHB 2YNHB 3GCWP 2JL9A 2F8EX 4K7QA 3P6YC 3GYGA 2CDRB 2RS2A 1T05B 4J9VA 2RE1A 4ECRA 3PX6A 5BJRA 3GR0A 3D54A 2LU1A 2SXLA 4ILLA 1FHTA 2J76E 2FHKA 2QG9B 2YPZA 1Q5VA 3VGUA 3P49B 3M8ZA 3MCSA 2VDIA 2OEJA 2XGQA 3KLIB 4OX9F 2C3PA 1FRMA 1S6QB 4K59A 2RSQA 4KAIA 4KHRA 5MAOA 5K14A 3R9LA 3T5LA 1A9NB 2BKPA 1K9MT 4C11A 4Q43A 4C3MA 2P5VA 2YNFA 4OLPA 4USVA 4ECQA 5F8MA 1NPRA 1JXVA 1S57A 4M5DA 3QT7A 5M2UA 2RB7A 4CM2A 3KK1A 3SZ2A 5L46A 3IM9A 3FNNA 2B4OA 2Y1RI 4J9SA 1P1TA 1S1XB 1F3FA 3PRDA 2CAJA 1T11A 3H4BA 1FKPB 2V2QA 1WOSA 2QL7B 2XI3A 1WKJA 2GJFA 3UCZP 4J9PA 1JXEA 4DU8A 4U96A 3KJNB 4JI7J 3LTOA 2J8AA 1Y0HA 2C3MA 1Q1KA 5DG9A 4NCGA 2G2OA 5DZ6A 2XY6A 1D8ZA 5U47A 5KT5A 3BGLA 2EVZA 1Q79A 4OYZA 3SQOP 1AW0A 5D4LA 2BZ2A 2E1MC 3OTCA 4ZIVA 2R7XA 3SQGA 3C19A 2CQHA 4USJC 2QYGA 3ILIA 4M5HA 3PW5A 2Q3PA 1SL2A 5FJ4A 4HI1A 1H2TZ 2BJ3A 4WIQA 2RQCA 1VCTA 1Y3KA 3MM9A 5L1JA 1VQ5S 2E9ZA 1SL0A 2ZC3A 2K3KA 1QUVA 3PW2A 1I51B 5KFMA 1ZTWA 4NI2A 3LF0A 4KHPF 4ECTA 2JFKA 1CQMA 1FERA 1GFWB 2Y0SD 2XZWA 2DHGA 3C6UA 3H5XA 4Y28C 1VQPS 1R0CB 4JI2J 3KK2A 3PEHA 2VV5A 4CH1A 1VISA 2VZ9A 1GMUA 5KFXA 2IM0A 3H7HB 2F3JA 4I64A 4F4XA 1TFWA 4WFNQ 5CA5A 4BBYA 3TAMB 4NZ7A 4PXCA 4NLUA 4HKQA 1N36F 4UTGA 1I5OB 2OD6A 3GWCA 4DV3J 4C8NA 1MU2A 3MMJA 2HNZB 3NWRA 3M1VB 4KQZA 4HL9A 3QSIA 3GLJA 1OYEA 4A8FA 1TKZA 4WFYA 4CRJA 1EZZB 4GKJJ 3I9V9 4CLSA 3AAWB 2BANA 4XK8C 2F1FA 2FD2A 3I0SA 2UP1A 3N6MA 2WVBA 1VQYA 5KFIA 2UZAA 1FEEA 2XMTA 3THTA 2KG0A 1OMSA 4F2SA 1Z4UA 4DJBA 2UVRA 4ZPWR 4WP9A 1RBLA 3VTIA 5IM0A 1TVRA 4FVMA 2V67A 1TUWA 1W25A 4TU7A 3LP1B 1VDHA 2H4WB 4GMKA 4QBUA 3UD5A 3EMTA 3B4MA 5KFZA 1VC6A 2KKHA 1FNXH 4ZVPB 2AX1A 5J1EA 2J0WA 4ANCA 2FYXA 1MG7A 3QSYB 3MOJB 3RB0A 2RHSB 1B0VA 1TP7A 3PIPQ 2V69A 3Q23A 5KFEA 2B9XA 1K8AT 2VBZA 2EFVA 2AJ2A 4LQ3A 3K7RA 2V4QA 4HLBA 4I68A 4KH1B 3LUYA 3TUIC 3TA2A 3CJ4A 2DGOA 2HHUA 1UP1A 5L38A 2APOA 4IR9A 3EUNA 1NJXA 2WONA 2J8SA 4G3IA 1LQ9A 2ZUAA 4O3QA 1RK8A 3M05A 1SC3B 4DF4A 4GVLA 4NXMF 2IJFA 3AD9C 2YKMB 1HNVA 1JQGA 2YQ3A 2C28A 1U1RA 3QNWB 2NSCA 2CA9A 5IS2A 4NLGA 1F0XA 3H42A 2EPIA 2NUUG 1WKLA 3VZIA 4ZK7M 2K3IA 1ZM9A 4DFPA 3PHEA 4WFXA 4BWJA 3TAPA 5HLFA 4QW8A 3IAM9 4M5JA 3HVTA 2BJDA 2PD1A 2HEKA 2LEAA 2FHJA 4TY8B 4I69A 3BYPA 3DN9A 2OAUA 3SDEA 3KDOA 2W8KA 1S7HA 2CXEA 4Y00A 4LSLB 2VH7A 2JVRA 1WTFA 1P9QC 1NK6A 4DDFA 3DGVA 1PJ6A 3DKDA 4ED6A 3W1YC 1GH8A 1Q8BA 3BGRA 2JHEA 3MFHA 3DOLA 4QPTA 3EPIA 4U7UK 4WP8A 3TUJC 1RHQB 3KLEA 4X4NA 2ZOMA 2DHXA 1CBKA 5LT5A 1EIYB 3DM2B 1WF0A 2MLXA 2F8MA 3DXBA 4P7TA 5KFWA 2H51B 3MF5A 3MEEA 5H9EK 1J27A 1SC4B 2QLJB 3ADAC 3ENVA 2ZOGA 5ADZA 4KH0B 2GVDB 5RUBA 4I2QA 3ZXWA 2DCLA 4EO6A 2LDIA 1WELA 3BSOA 1PBUA 1JLAB 4CTAB 4DSJA 3UVJA 2UXDJ 1WKKA 1RKIA 4DX6A 5B0AA 3FSIA 2VOPA 3TZYA 1C0TA 2OPRB 1MLAA 1P1LA 3Q8VA 4AT1B 1S1WA 3G6VA 4LVNP 4O4RA 3RAMA 3NAIA 4ELUA 3MUMP 3MGJA 1HARA 2UUWA 2YWEA 4DPUA 1AUSL 2ZM6J 2HHHF 3UI3A 2KT2A 4UUXA 2RH3A 4ALZA 2W9BA 4C4WA 2HVZA 3AB4B 4R0JA 3CCSS 2JX2A 3DOKB 4X4RA 2VICA 3M9NB 1CJKA 4YDDB 4O0NA 3TARA 4P10A 2HURA 4ZCKA 3THVA 1EX8A 3N5BA 1K1SA 2KJVA 3ZTQA 1F9EB 2P6TA 5AE1A 3LAKA 5T14A 2R8HA 1R8CA 1F6TA 3OTOF 4K4XA 2ZH3A 4A8XA 4OIXA 2QMXA 3FCHA 3HX9A 4OYMA 1X5OA 4DHVA 2D9OA 2R8JA 1A6LA 2IIHA 3G6YA 2M5YA 3T9ZA 1RWXB 2FGOA 5IOLA 1FKOB 4DPTA 1Y11A 3LA0A 4F36A 2VPZB 3AOAA 2RAQA 5K14B 3QFHA 5HL7Q 2QL5B 4C11B 2XSJA 4MT1A 2YNFB 5F8HA 4DZDA 5LXYA 4DUZJ 4M5DB 2VG6A 2LCWA 1XJWB 2DT9A 2RILA 3M8WA 2O5DA 4CO1A 2XY7A 3RG6A 1TQLA 2UU9J 1D8YA 1QM9A 2XSFA 5E3QA 2EC0A 3GV5B 3J81Y 2FLOA 2DGTA 1V3ZA 3LGHA 3C2PA 1ZAXA 4DR5J 3OW2R 4NCGB 1EHWA 2HZCA 1H74A 1G6BA 4GKKF 4URGA 2RRNA 4WTOB 4X84A 3CJ8A 1J5EJ 3QT8A 3G82A 3SQGB 3A13A 1MWYA 1M5PC 4K5SA 2C2MB 2YX1A 1XMQF 3RR8A 2QT7A 1NH7A 4C8MA 2BJ1A 3MM9B 4RW7A 5I3QA 2R2SA 3QBCA 4A47A 4LJMA 3WX4A 1IWAA 4NI2B 2OMLA 4C97A 2DGVA 1AA1B 4X4OA 1HQ2A 3C6UB 1JXLA 2B7CB 4DQSA 1U1KA 2AEFA 4K4YA 3GIKA 3KK2B 2HBYB 1YWXA 4MIAA 1SKWA 2JFDA 3Q2TC 2R7UA 1X4GA 3SCJE 4F2RA 1C2PA 4ANDA 5HANA 1ICEB 1XN9A 4DL4A 4M63A 1AYEA 1FWPA 3DLKA 1Q95G 1WDDA 2LLZA 3D68A 3PR5B 2OPPA 1MNEA 1MU2B 4L74A 1KDNA 2P9CA 2XZDB 2DR8A 4DG1A 4X64F 5JVGQ 3HI9A 3FCVA 5GADI 4M95A 4E2FB 4U7CA 2DRDA 3CCZA 2EXUA 2MY8A 3FJ2A 2W9CA 1YKWA 1FD2A 4IOCQ 4OJHA 3K5NA 2XWXA 1TKZB 3FKBA 4ZP8A 2LA4A 1MW7A 1Z2ZA 4NE9C 3QZ8A 4HTIA 2BANB 2Y3YA 3LWLA 3I0SB 2EK6A 3GFZA 4UZBA 1DAXA 3PTWA 4PZVA 2VQFF 5KG5A 5KFUA 3GJRB 5IM0B 2R7TA 3M7VA 1TVRB 4XDDA 1MN9A 1Q0NA 3CMQA 4L6V3 1SBRA 2IM2A 2NXUA 3IO1A 2D3OR 4USUA 2E1RA 5F41A 2JEJA 3OFFA 4C48A 3IBWA 2PA3A 1QY7A 5J1EB 2H65B 3IA0A 3R5CA 3IXQA 1NAQA 3WIUA 3JSMB 2VF3A 1IR2A 5IC4B 2W01A 2OH2A 1H38A 1KTVA 1FRKA 2CPIA 4X4SA 2BA9A 3AD8C 4F3QA 2PMHA 3FQKA 1RTZA 4GC6A 4EZ6A 2WB1D 2YY3A 2MEWA 3FZ2A 3AXKA 5EWFA 2L9NA 3OT9A 3SFGA 2V4JA 3VWSA 4Q7AA 2HQIA 2V94A 4EBEA 1U2RA 2NXNA 1MMLA 3VVTA 2WONB 2D9PA 2XMMA 2U1AA 4CNYA 4J90A 1HNVB 5DS7A 2YWGA 2LQBA 5C5JA 2F65A 2VC0A 2NPFA 3BS9A 3ETMA 4OZNA 5DO2A 3L4BC 3JSYA 1VJQA 1WDTA 2QLWA 2FY1A 2C22A 1HL6A 2KFZA 1IKYA 4J91A 3ILOA 1WACA 3P4UB 2VJUA 2R7SA 2WW8A 5GMDA 4YR3A 5HLFB 4M5GA 1Q4RA 3T1AA 4F67A 3HVTB 2B51A 2YWKA 3HHDA 3WQPA 5KFVA 1KN6A 3MFIA 5J2MB 3SDEB 2GNKA 3G6XA 4Y6IA 1CJVA 1RCOB 3A8EA 3TEGA 2VONA 3HVWA 3MPVA 3PEJA 5HO4A 1TUVA 1GMVA 3W5YA 4DN9A 1YRXA 5CQGA 4DFKA 2ZJRQ 2WBRA 2GJIA 3K17A 3J80Y 4M94A 3DOLB 1NDCA 3KLEB 4ES3A 4OYPA 4ENOA 5E7OB 4USKA 4DR1J 3OUYA 2WTFA 1UZHA 3I56S 2HQGA 4ZVSB 1DTQB 2J0QD 2MKYA 3MURP 4LFCF 4L3KA 4MIBA 3TYTA 4LIRA 4B3OB 1YZ6A 5I3PA 3KJQB 4O44A 1XQIA 5GMKa 2I0XA 1EB0A 3D5MA 2ZJPQ 3NGRA 4FZVA 4OX8A 5E2QA 4WKRA 4I2QB 4WIIA 3C15A 1FJ7A 2VQEF 3IC1A 3UVJB 5LSLA 3M6WA 2ZHOA 3M32A 1C0TB 1RWOB 3IGVA 2Y0BB 4RLEA 4DOZA 2HHPA 1S1WB 1NRKA 3S8SA 3R5JB 4NOHA 3RYLA 3M8RA 2AWZA 3LGMA 6AT1B 2JOQA 2RRBA 4E8UA 3UE2A 1DQ9A 1FXDA 3NNHA 1S9FA 2JEGA 3DU5A 4KKOA 3CDUA 2BKOA 3BN4A 1OQ3A 4B3TF 3IAS9 5HROA 1NLKL 3HSJA 3SXLA 2W9BB 4F4KA 4F3MA 4OV1A 4RO0A 4URSA 3CXCR 1SKSA 2OGUA 1S6UA 4CZCA 4QWCA 1CJKB 5B0DA 2CQBA 2D74B 4IRKA 4IRCA 1HPZA 3T3FA 4J9RA 1TMMA 3J7Z5 2WK4A 3I4PA 5KFFA 2OJ3A 1HNWJ 2M2BA 1SH3A 2VUGA 3CCWA 3FBFA 1WUUA 4LF8J 4L73A 1LOUA 3CEDA 1NSKL 4QIEA 3PR4A 1WHYA 2DITA 1PAUB 3BBFA 4J37A 4E0DA 3RB6A 1VRQC 3MAQA 1YITS 3E3XA 5CABA 3NCQA 1T9TA 1RHRB 4UOGA 4X2BA 4IFVA 4A4JA 3GG0A 3R1HA 2KL8A 2QV6A 2FDNA 5L1KA 4K2JA 3V4IA 4L75A 2XSJB 3DU6A 4ZCMA 2IPOB 1BWVA 2VG6B 1T95A 5LSOA 1AFIA 3PKYA 3ISZA 1T03A 1YQHA 3O5TB 1ZBTA 5DM7Q 2HMIA 1NJWA 3G9CA 4J9QA 3KG4A 1IN0A 3L3CA 2HS4A 4K4UA 4B3RJ 3EM1A 4JI7F 1WC3A 4Y2AA 1PIEA 4KFBB 5I42A 1U24A 1U4BA 3SCIE 1N34F 2FHOB 3W61A 3J7AN 5SZTA 1Q8IA 2VBWA 1LV5A 1IR1A 2HFOA 5D0HA 3S7RA 2QA2A 5DETA 2WBMA 4YY3J 3I31A 3G82B 3VAMA 4FKYA 3DHXA 4OYOA 1U1LA 2R8GA 3OXLA 3EDQB 3W66A 3D6HB 4X66J 1A0OB 4NLOA 1B0PA 4NRUA 4RW7B 1EARA 4CCHA 3UNYA 2MLYA 1XIQA 3Q8QB 3HK2A 1OY9A 4PRFA 1YBUA 4O23A 4YN3B 3HJVA 4RNNA 1VBYA 1EAYC 3UDCA 2X3GA 4BLGA 1LWFA 2CPZA 3KK3A 3M2UA 2N4CA 1FO1A 2ALZA 1WI6A 4RW6A 2CVEA 3RR7A 2LQ8A 1ZAVA 5H9FK 2H9ZA 4PWDA 1YJWS 5JMNA 1REVA 3U7JA 1UW4A 3FMBA 4B3MF 3DLKB 3A3OB 4DV3F 2HZVA 2KXHA 2YH1A 1RLCL 3QWPA 1X31C 2OPPB 2BUNA 4M5KA 4EWTA 4NRTA 5IFMA 4A8MP 4DG1B 3KG0A 2MXYA 3I55S 4J7CA 4B9LA 3EICA 2ZDPA 2FB0A 2ZVSA 1K47A 3D9BA 3M8QA 1VIXA 2D3ZA 1Y5LB 5FDLA 3SSSA 4FF2A 2W9CB 2KZZA 3CJRA 2HS0A 4GKJF 3ZTSA 3G8SA 1ZS6A 2PDAA 3POTA 2G1DA 2BDPA 3RAQA 1SJ3P 2YKAA 1NSAA 2G4BA 3DRXA 1ZZFA 2CNNB 1UAWA 4ZP7A 4LFAJ 4P72A 3C6TA 1NZ8A 4H54A 3JQJA 2V8VA 3JTOA 1FVQA 3TA0A 1JNZB 3AHPA 3BDPA 4EBDA 2BYCA 4O3SA 2R7OA 2H5JB 2FC8A 2GAGC 5B08A 3NGUA 2E44A 2FGCA 2DNQA 3MCOA 2YVSA 5ETQA 1HWKA 2UXBJ 4DUYF 4USWA 1CEZA 1XTZA 1KVIA 3JYTA 2CJYB 4C6AA 3RB4A 2V63A 1HWIA 4M5NA 3SIPB 2D7SA 2ASJA 1U6FA 3CCRS 2DXFA 2KTQA 3FDSA 1RWVB 4QR2A 1KWMA 4KE5A 3WIVA 3FK4A 4BC7A 2LP4A 1U25A 4YHHJ 4U8YA 1LK7A 4NASA 4JB8B 2V4JB 4OLOA 2ZZTA 2MSTA 4WF9Q 3H20A 4U6PA 4JV1A 1BC6A 3E2EA 3EVOA 4ED8A 3LAMA 3MM7A 3DLLQ 1WSRA 1NK4A 4KR0B 4P6QA 4X4TA 2BXJA 3HMJG 2FHMA 1FWLA 2RF2A 4WCEQ 3VAHA 1X8DA 3GILA 3JQKA 3SSRA 3QJJA 3TRGA 1FRLA 1DJ0A 3TX0A 1YG0A 4Q0BA 3FEXB 1IKYB 3DLJA 4YQWA 1RDRA 1S1UA 1Q7YT 2FVQA 3QIPA 1D9FA 5FIIA 2L08A 3U1NA 1RT7A 1TL7A 2JNJA 2JZ5A 3HHLA 1XNQJ 1WI8A 2A0FB 5DRKA 3IS9A 2AZ1A 5M2RA 1HBOA 4AXIA 1K73T 1FE4A 4UY85 2ZH8A 4KHMA 2K7KA 1V5VA 3U02A 3P5TL 4I7FA 1NBEB 4J9UE 2HBQB 4KPCA 4JUZA 3K59A 2WRMA 3RRGA 2H54B 2CPJA 3O8WA 3Q8UA 5DQHA 2M9KA 4RJVA 5KT6A 1FI4A 3OHBA 4LF7J 1GT8A 7FD1A 5AE2A 4DV5J 1YJ7A 2M3DA 3KMQA 4ZPTR 2BVZA 2C2NA 4NLWA 4CO5A 2RVJA 4OZ2A 2DNHA 2WSCC 4RW9A 2CPXA 1YK9A 2Z57B 4QIWD 1RWUA 2DH9A 3OTBA 2K8GA 2N7CA 2RJZA 3EVWA 4AL6A 2E7XA 2X1AA 5EUHA 4O44B 1W26A 1HD0A 4B3SJ 4DQPA 4MFBB 3GTYX 4QR1A 2P2CB 3ZNUA 5IZHA 3JTNA 5DGBA 3R1LA 2B5JA 1I94J 2HBRB 2UXDF 1R6YA 4NXNJ 4LBHA 3PZPA 2BJ9A 4FS2A 1N52B 5K20B 4DPYA 2DR9A 2AT1B 3M32B 2HHVA 3C3LA 5AJ3J 1TKXA 3TVYA 4DR2J 2BACA 1G3OA 1SB6A 1WNEA 1FJGJ 3UCGA 1HW8A 1SJFA 1JMTA 4P2SA 2BRKA 5C42A 1JJCB 1S1TA 5CZVA 2C2KB 1NJYA 1RTDA 4C0HA 2R8IA 2ZM6F 2DR5A 4AL7A 5CCLA 2XMVA 2UVVA 4DCJB 3Q8SB 4KKOB 3MEGA 4LQ9A 4ZLNA 3SCKE 2OSQA 5HROB 4OZ1A 3RZAA 3M2VA 1KHVA 2HQFA 2YNIB 3G86A 4PKDB 5LSRA 2Z2YB 5KFKA 3J7YU 1S76D 5K8OA 2QZ8A 1N33J 4EFAC 1UA0A 3R5BA 1FEHA 1R8BA 2W4PA 3DRPA 4O3NA 1HPZB 2CPEA 3IG1A 5I3UB 4JI1J 4J9NA 3BR8A 2DXDA 4K2XA 8RUCA 2W2MP 4NA2A 1XMOJ 1DQ8A 3H25A 5HSPA 4LRAA 2FUG9 1IBMJ 1FWKA 3D1HA 1WORA 3VAIA 3T19A 3MMCA 3OV7A 1WHWA 3B8HA 4EBCA 3HP6A 3CCUS 1K1QA 5KFPA 4HHJA 1DFDA 1RT4A 2OHDA 1FDNA 2JEIA 3HKWA 4DV4J 2XS7A 2NUHA 2H5EA 4CLUA 2YKPA 2G2YA 4IFVB 2MZRA 4MKVA 4U67Q 4JI5J 1BQXA 2KU7A 3UQSA 3V4IB 1UMJA 1RT6A 4OFZA 3SFUA 4NL5A 2DNMA 4B9TA 4X65F 3P45B 4FYWB 1T03B 2ZNYA 4DWIA 2FC9A 4HI2A 1RTIA 2IVFB 4DV7J 5G4DA 4X4UA 2HMIB 1D3WA 4KGMA 2XB2D 2J6SA 4WZQA 3R6GB 1JNRB 5GAHU 4XDCA 1VOMA 1HHTP 1M5KC 2X1FA 2DEIA 1N5VA 4ECZA 8AT1B 5I42B 4JYAF 1HI0P 4DR5F 1T9YA 2CQGA 2VD3A 4LBIA 2K7JA 5GAEI 3T1YJ 2DNZA 3V6DA 2IBOA 2UUBJ 1TL1A 1ZYQA 1J5EF 5ETLA 2KB2A 2BBEA 2DH8A 2KN4A 1N0UA 2ZH1A 2ZD1A 3R97A 4OYBA 3RUBL 4YB6A 3K58A 1HD1A 3N5FA 2RRAA 1KFSA 2PT0A 2CNKB 5HQ8A 1TZ0A 2FJXA 3VQTA 4Y34A 1UFWA 2VIHA 4HHHA 2E5IA 1JKHA 1RTHA 5A2QU 4ZKAA 4BDPA 4ZPVR 3J81j 1WG1A 1LWFB 3KK3B 3M2UB 1VBZA 3H59A 1YIJS 1AXQA 3PIOQ 3H5UA 4CLKA 4RW6B 2GQQA 4LF9J 3MI7X 4P2XA 3VAGA 2C1EB 4JP8A 1IBKF 4PWDB 1TU0B 1EQ0A 2IRUA 1REVB 4DV1F 4GC7A 9RUBA 3A12A 3ENWA 3W8GA 3N9UC 5KAKA 2N4DA 2PEBA 3MD1A 2AEJA 3DMJA 2RU3A 2ATLA 3US5A 4FBUA 3FGVA 5C24A 1N0VC 2RQKA 3M8QB 5FDLB 2E29A 3RBEA 2CNLB 3HZGA 2HNYB 3POTB 4C8OA 2OO4A 3R2DJ 2DGSA 3OTEA 2DY9A 2JWNA 4IOAQ 1D09B 3C6TB 3NY0A 1LWCA 4RNOA 3IBFB 2VJVA 2XLKA 4HT7A 4YOEA 4LF6J 2EKYA 1ZM2A 2WVCA 2NYIA 3P8BB 4CO4A 3K5OA 4CT9A 2HWHA 1X4DA 3DOMA 3BBCA 3BKFA 2MYFA 2GO9A 3GJSB 1T9UA 3WX8A 4YUDA 4PPDA 1N5SA 2L3MA 3ZTRA 3GR1A 1N4LA 4X4VA 3TEHB 2QFIA 2CG4A 3JYTB 2AEMA 2HFVA 2CZ4A 3TQ1A 4FYVB 5EX3A 5HBMA 3KYLA 3W62A 2YWFA 3PV8A 4FXDA 3I32A 3S6EA 2F5GA 1ZA1B 3BREA 3I5AA 5DZ7A 1I6JA 2WSEC 5DDRC 5KFHA
chains in the Genus database with same CATH topology
3HSDA 1EQMA 5ETTA 3KUGA 3HCXA 3UDVA 5ETVA 3MCMA 4M5GA 1RTZA 1TMJA 4M5KA 4M5JA 3HSGA 4PZVA 4CRJA 4M5MA 4F7VA 1HQ2A 1KBRA 3QBCA 5ETMA 3IP0A 3UD5A 1G4CA 1EQ0A 2F63A 4M5NA 1IM6A 1DY3A 1F9HA 3KUHA 4M5LA 3HD2A 3HT0A 3ILIA 3KUEA 3HSZA 4M5HA 5ETPA 5ETKA 5ETNA 1RU2A 5ETOA 3HD1A 3ILOA 4CYUA 4CYUB 3MCOA 3MCNA 1RB0A 4M5IA 2F65A 2CG8A 5ETQA 1Q0NA 1RU1A 2BMBA 1RAOA 1HKAA 3HSJA 1TMMA 3ILJA 5ETLA 5ETRA 3ILLA 4CWBA 1EX8A 2QX0A 3UDEA 4AD6A 1CBKA 5ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSD A;  1EQM A;  5ETT A;  3KUG A;  3HCX A;  3UDV A;  5ETV A;  3MCM A;  4M5G A;  1RTZ A;  1TMJ A;  4M5K A;  4M5J A;  3HSG A;  4PZV A;  4CRJ A;  4M5M A;  4F7V A;  1HQ2 A;  1KBR A;  3QBC A;  5ETM A;  3IP0 A;  3UD5 A;  1G4C A;  1EQ0 A;  2F63 A;  4M5N A;  1IM6 A;  1DY3 A;  1F9H A;  3KUH A;  4M5L A;  3HD2 A;  3HT0 A;  3ILI A;  3KUE A;  3HSZ A;  4M5H A;  5ETP A;  5ETK A;  5ETN A;  1RU2 A;  5ETO A;  3HD1 A;  3ILO A;  4CYU A;  4CYU B;  3MCO A;  3MCN A;  1RB0 A;  4M5I A;  2F65 A;  2CG8 A;  5ETQ A;  1Q0N A;  1RU1 A;  2BMB A;  1RAO A;  1HKA A;  3HSJ A;  1TMM A;  3ILJ A;  5ETL A;  5ETR A;  3ILL A;  4CWB A;  1EX8 A;  2QX0 A;  3UDE A;  4AD6 A;  1CBK A;  5ETS A; 
#chains in the Genus database with same CATH topology
 3LAL A;  1BQM A;  4X62 J;  1XR7 A;  4L72 B;  1NDP A;  2DD8 S;  3R7B B;  1CJT A;  1XNR J;  1HMV A;  2DGQ A;  3ENQ A;  1QSL A;  1N6Q A;  2CJX B;  4WU3 A;  3GG1 A;  1FD8 A;  2IRX A;  3MM7 B;  4U95 A;  3NKY A;  3CC7 S;  3CJ0 A;  4JI0 J;  3TUZ C;  1AT1 B;  1FES A;  3UD4 P;  2XMW A;  2NRE A;  2RF2 B;  1HQE A;  1VLO A;  4I6A A;  3MEK A;  2DRA A;  3IFE A;  3KJV A;  2J7U A;  5J2P A;  1FXR A;  2VG5 B;  4ECW A;  1F1B B;  4N56 A;  3DLB A;  4OQJ A;  4TLQ A;  2HNZ A;  4P52 A;  4Q0B B;  2ERR A;  1FDD A;  3CUL A;  3LP0 A;  1QAI A;  1S1U B;  2KHD A;  2AYG A;  2J7W A;  2I9S A;  3D67 A;  1AB8 A;  2Q79 A;  5GAE U;  3QIP B;  4OZ0 A;  1ZZN A;  4YDX A;  3LP2 A;  1RT7 B;  4F4Z A;  1N48 A;  1TL7 B;  3HHL B;  2GX8 A;  1LKZ A;  3IS9 B;  3N28 A;  1HBO B;  2H1Y A;  5THW A;  3QLH A;  3SV4 A;  3J7Z T;  1SVD A;  2B0G A;  3DGP A;  3EZU A;  2D1C A;  3NS7 B;  4P7V A;  3K89 A;  3CME S;  4MJK A;  3UDV A;  4WFA Q;  5ETV A;  2UXC J;  4JOU A;  4ZP6 A;  2K1R A;  3CGI A;  1NKC A;  2KRR A;  3UCU P;  4DR1 F;  3IR5 B;  1PGZ A;  3BQ1 A;  4GO5 X;  2GHW A;  4RW9 B;  4MKB A;  4BS2 A;  4DR7 J;  1EQM A;  3ONQ A;  2CJ9 A;  1TV6 A;  2WOM A;  1WTB A;  4ZPD A;  4F4W A;  1JJ4 A;  4JI4 J;  1RYR A;  2CJA A;  2MQP A;  1M0S A;  3IR6 B;  3Q8P B;  3QGG A;  2XS5 A;  1R8H A;  5LMU J;  3OR1 A;  2DNO A;  2B5J B;  3IRW P;  5DG7 A;  5A8K B;  1FFG B;  4OYW A;  3HVR A;  2O01 C;  2G1H A;  5DDO C;  3BB5 A;  1TKX B;  3UO0 A;  4DV0 F;  4OI0 A;  3VCD A;  1KVK A;  2CG8 A;  1S0O A;  2MDA A;  3PJW A;  1HIY A;  1NDL A;  3DCA A;  5C42 B;  2QMU B;  2CZV C;  4A8W A;  1RTD B;  3M30 A;  3TAQ A;  1M5O C;  4QYZ J;  4DR3 J;  2V50 A;  3WBZ A;  2KDO A;  4NEY A;  2F9D A;  3MEG B;  5CYJ A;  2MQM A;  3M2V B;  2NQP A;  3AQP A;  1DLO A;  5KG3 A;  1C0U A;  3A8I A;  3LH2 S;  1M5V C;  2B7B B;  1TK8 A;  4ZPA A;  4Q2M A;  4C98 A;  1NKE A;  4RU2 A;  3D2W A;  2J0X A;  1F5A A;  3GCX P;  2O67 A;  3DRP B;  2NR0 A;  2Z58 B;  3IG1 B;  5F9N A;  3NWG A;  2RKI A;  3ZZR A;  1RQ0 A;  1HNW F;  3WHI A;  5KG6 A;  4FF4 A;  1NME B;  3N0V A;  2B9Y A;  3H8Y A;  2V8D A;  2GJ2 A;  5C25 B;  4LF8 F;  1Y5N B;  1F9F A;  2XEX A;  2Q6B A;  3UD3 P;  3MMC B;  1TUG B;  4OX9 J;  2MY7 A;  4AXJ A;  1UVN A;  1RT4 B;  2BW2 A;  3OLA A;  1UA1 A;  3R5A A;  3PRB A;  1V5I B;  5L1I A;  2OD4 A;  3E51 A;  1WOP A;  4RBU A;  2DY1 A;  2GVZ A;  2QL9 B;  4ECS A;  1OJ4 A;  1RT6 B;  4EU0 A;  5KFB A;  4WKY A;  1BHN A;  4R8U A;  4O3P A;  3L7U A;  4ZVO B;  1RTI B;  2IAJ A;  2IM1 A;  3R27 A;  2QJ3 A;  2IVY A;  1U45 A;  3PKM A;  3GV8 B;  3PG9 A;  1FNO A;  1UFK A;  2P6S A;  3MR6 A;  5K8P A;  2GVD A;  4XPE A;  4MK9 A;  4QWB A;  1RB0 A;  2ZBQ A;  4QIF A;  5AXN A;  2W2O P;  4RUC A;  2DNL A;  2C3Y A;  3KNA A;  2NCK L;  1X5S A;  4UQT A;  1VRT B;  3UFC X;  3PJX A;  2ASD A;  3EPG A;  2HW3 A;  1KFD A;  1YGY A;  5DGA A;  3Q8Y A;  5E33 A;  2CPY A;  3V6D B;  4H4O A;  2KZM A;  4YY3 F;  1TL1 B;  3N4W A;  2DGX A;  5HN0 A;  4NMX A;  2GQ2 A;  3V81 A;  2ZD1 B;  4LMZ A;  2C2R A;  2F9J A;  4M5L A;  2ADC A;  2Z0G A;  5F8J A;  2COL A;  4UOC A;  3P3D A;  4OI1 A;  1CG2 A;  4Y2C A;  2IVM A;  2MJU A;  4WYW A;  2GGP A;  1SKR A;  3GV7 B;  3OD2 A;  4QPX A;  4AL5 A;  4TNO A;  1JKH B;  1RTH B;  3CC4 S;  1YJU A;  3ZTP A;  3EXY A;  2CVI A;  3RB3 A;  1QVG R;  1IBL J;  3TWZ A;  2YTC A;  1U49 A;  2RDI A;  2J9D E;  1MSW D;  1VC5 A;  1N36 J;  1N32 J;  3ISN C;  4EK2 A;  1FKO A;  4A46 A;  2DNY A;  4HVZ A;  3VAJ A;  4K4V A;  5SUH A;  4NWB A;  4ECU A;  4IG0 A;  2I5J A;  3HHL D;  3DMJ B;  1U1O A;  5AXL A;  2K06 A;  4ZDN A;  1RAC B;  1X7V A;  1Y10 A;  3HT0 A;  5C24 B;  2Q6C A;  4RBV A;  2A6M A;  2YWW A;  3GJT B;  2ZBP A;  1RHM B;  1WHV A;  2B6A A;  2BEF A;  2F8H A;  2ZBI A;  3TJA A;  3OSN A;  4YS2 A;  3CJ2 A;  4P2F A;  5D4N A;  1WD6 A;  2QSW A;  2DH7 A;  4JBC A;  4UY8 T;  5CD4 H;  2C3U A;  5C2G A;  1LWC B;  1FRJ A;  3M2R A;  2QMW A;  4ZVF A;  1F60 B;  1UVM A;  3HKZ D;  1YJT A;  4USH A;  2Z2L A;  1LW0 A;  1RI7 A;  4NLS A;  3DOM B;  4DX7 A;  2Z8Q A;  5L39 A;  2E7V A;  2UVW A;  4KY3 A;  2EWH A;  3D6M B;  3VV2 B;  1T3N A;  5CCM A;  4B9U A;  3TZZ A;  2DO0 A;  3VVU A;  3L95 X;  3UN5 A;  1BWE A;  2PMW A;  3Q2S C;  2UXB F;  1RE1 B;  2XCP A;  1FFS B;  2ACY A;  1VQ7 S;  1JLG B;  2W7O A;  2QLX A;  1RUS A;  3Q22 A;  5CAA A;  2BE2 A;  2VPW B;  5HBM B;  3BM7 A;  4QWA A;  5L8R C;  5C7P A;  2OMO A;  1NCL A;  2V2V A;  5HVG A;  1SIZ A;  3UNG C;  1KQS R;  2G13 A;  3HT3 A;  3QGP A;  3BEG B;  4YHH F;  2PI5 A;  1TTH B;  1KQG B;  5DLG A;  5HQL A;  1BQM B;  4Y3C A;  1LNQ A;  4LRF A;  1S10 A;  4TU8 A;  2HSE B;  4Z37 A;  2DHA A;  4F04 B;  2MKJ A;  1FCA A;  1QDU B;  1CJT B;  7AT1 B;  1HMV B;  4ZJL A;  2HQ3 A;  1N6Q B;  1UVL A;  1XR5 A;  4HDG A;  2MZQ A;  1UVJ A;  2BMB A;  1XWL A;  4RX6 A;  2JC0 A;  2CWX A;  4EUV A;  1K44 A;  3W2V A;  3RAX A;  2QN6 B;  1HQE B;  4OHX A;  4M1K A;  4C0B A;  2ZH6 A;  1JJH A;  4QQB A;  3KJV B;  1VFJ A;  3H0P A;  3O1L A;  5J2P B;  4QWD A;  3OFG A;  3DI6 A;  2ROP A;  4F7V A;  3KJF B;  4DX5 A;  1JX4 A;  2HRY A;  4CO0 A;  4PWU A;  2XHW A;  3VQS A;  3LP0 B;  1VQL S;  3KMS A;  1YX2 A;  2MLZ A;  3LW5 C;  2B8Q A;  4JI3 J;  2CQD A;  5E3R A;  4KRW A;  2XQC A;  1XNQ F;  2LDY A;  3F41 A;  1G4C A;  3LP2 B;  2XYP B;  1M5S A;  1ZPV A;  4CLW A;  2AQ4 A;  4DQR A;  2D3O 1;  3QLH B;  2N3O A;  4ZN3 A;  1YJ9 S;  3TOQ A;  3CD6 S;  1VQ9 S;  1XR6 A;  3DGP B;  2HVE A;  3K5P A;  2CRL A;  4DV5 F;  2QX0 A;  2VL1 A;  3TNV A;  4ZVH A;  1M1G A;  2K1R B;  1X0P A;  1PO6 A;  1I1G A;  1B4S A;  4FPR A;  2C2E A;  4I6Y A;  1CUL A;  2NYH A;  1VR6 A;  4RWX A;  2I1R A;  4I67 A;  1UVK A;  5B09 A;  2W7P A;  1Y7P A;  3MPU B;  4G6V B;  1PAE X;  3SBM A;  1HHQ A;  3GFX A;  3D3C J;  1C1B A;  1TV6 B;  2MKC A;  4M5M A;  2WOM B;  4LSZ B;  1HLW A;  5HVH A;  3JSM A;  2AGQ A;  2W8L A;  3CDB A;  4DZ6 A;  4F0K A;  1EJ7 L;  3M9O B;  4B3S F;  2QO3 A;  3LOU A;  2KFN A;  2AF6 A;  3B6B A;  4OJ1 A;  5J2Q A;  2XO6 A;  2JLG A;  3OR1 B;  4V19 J;  3I4H X;  1O0P A;  4NXN F;  4OMF G;  1YJN S;  2MKH A;  1JLB A;  4IH6 A;  1RU1 A;  1FRI A;  2AJ0 A;  3EVM A;  3D1Q A;  1SQG A;  3OL8 A;  4ZJO A;  1R0B G;  4DR2 F;  3D28 A;  1SH0 A;  1FJG F;  1Z1Z A;  3Q89 A;  3ENA A;  5IV3 A;  3MM5 A;  1Q78 A;  3PW4 A;  2DYA A;  3G6E S;  3NP5 A;  5AT1 B;  4FNI A;  2HHH J;  5GME A;  1FX4 A;  3M30 B;  2HK3 A;  3VZH A;  2DK2 A;  4CO3 A;  3Q86 A;  4NLY A;  2Q66 A;  3QWU A;  4JV2 A;  3NCP A;  5ETR A;  3SI8 A;  1E6Y A;  1QTM A;  1DLO B;  3G87 A;  2DBB A;  1C0U B;  4WWS A;  2HG4 A;  4JI1 F;  4MAK A;  1QTN B;  1TL4 A;  1WF1 A;  5J2M A;  3AJ2 A;  4OZ5 A;  2RKI B;  4PR6 A;  1HWJ A;  1TKT A;  6FD1 A;  2Y1I A;  3D6F B;  2YQ1 A;  2XNQ A;  1XMO F;  4USI A;  2BRL A;  4NZ6 A;  4ZCL A;  4KO0 A;  5HP1 A;  2R2T A;  3SMZ A;  5DDP C;  3HDS A;  2QSF A;  1WSV A;  2A18 A;  1YDL A;  3ZFV A;  1OYD A;  1NDK A;  5KG0 A;  2GQC A;  3AA8 A;  5EWG A;  1ROF A;  4DV4 F;  3AXM A;  3FEZ A;  4N8N A;  1JLQ A;  3MPY A;  1U0H A;  2KHC A;  3OSP A;  4CP5 A;  1DTQ A;  2CJB A;  4RW8 A;  2GVZ B;  4DV2 J;  3F0N A;  1X60 A;  2DNK A;  4QWE A;  5EDW A;  1JLF A;  4B3O A;  4R8U B;  3ICL A;  4DU7 A;  5JXS A;  2IAJ B;  2W4C A;  2YKO A;  4OYA A;  5B7W A;  1Y3J A;  4AE5 A;  4RR5 A;  5DQI A;  3I9Z A;  1S4F A;  4HTJ A;  1SJQ A;  4Q8F A;  1CPZ A;  2J9C A;  1WC1 A;  3CE8 A;  3FVY A;  3QT6 A;  3BO3 A;  2IY5 B;  4GKK J;  4NLX A;  3H5S A;  2A6O A;  1TR0 A;  5KT2 A;  3T1Y F;  4DR6 J;  2FJA B;  2R2U A;  2UUB F;  4CLY A;  3CMA S;  3PDN A;  4H4O B;  3FBE A;  1C1C A;  4KC5 A;  1Q16 B;  3FSY A;  3V81 B;  3MXH P;  4JI8 J;  3DC2 A;  1AZS B;  3BV8 A;  3KUE A;  4OYX A;  2IRY A;  5F8L A;  2ROE A;  3QZ7 A;  5LL6 d;  4QYR A;  4DL3 A;  3W64 A;  5LM7 E;  2MHN A;  2KVQ E;  3KHR A;  3V6J A;  4NLV A;  3R5G A;  2EG2 A;  2J6T A;  2GGP B;  3EE3 A;  1RA7 A;  1FXL A;  2XMK A;  1HWU A;  2DCU B;  2NXE A;  2F4V F;  2V4R A;  1U0S A;  2Z56 B;  4NLQ A;  1GTH A;  4CO2 A;  2MKS A;  3IP0 A;  3P5B P;  1QD1 A;  4Q8E A;  2C42 A;  3QGI A;  3NOG A;  1CVJ A;  4LF9 F;  1G7C B;  3T1H J;  4MIW A;  4KYZ A;  4LF5 J;  5HMW A;  3GJQ B;  1NPK A;  5HVF A;  4KPY A;  1SQF A;  1ZET A;  1H7X A;  3BZQ A;  1G2E A;  4KGK A;  1FNM A;  2ZC4 A;  3IM8 A;  4IG0 B;  2I5J B;  1S1V A;  1URN A;  3RBZ A;  5ETM A;  4HH1 A;  3PX0 A;  2YXL A;  1VQ6 S;  1P9Y A;  2RHQ B;  3G71 S;  2ZWP A;  5J1P A;  1RBO B;  4B9V A;  2PN6 A;  4OX7 A;  2B8P A;  5D8H B;  2B6A B;  1UVI A;  3THP A;  5D4P A;  4XIU A;  4KFB A;  5CZX A;  3R6L B;  2OPS A;  2VQF J;  3BF4 A;  1N88 A;  2QC3 A;  3FQL A;  4FYD A;  2KT5 A;  3NGT A;  3OFH A;  3UWT A;  4LF6 F;  1UFL A;  4CDI A;  4CLF A;  3M2R B;  5D4O A;  3ZZT A;  3J7A 1;  1UWB A;  1LW0 B;  5CHC B;  3FCW A;  5T7L A;  2JSX A;  2WSF C;  2IFX A;  4HYK A;  4MTP A;  4ZA1 A;  2VB6 A;  1RU2 A;  1TKD A;  4WK3 A;  3PYE A;  5A8W A;  2W2P P;  2W24 A;  2ZOF A;  2RDJ A;  3OL6 A;  1RHK B;  2BE2 B;  2F4F A;  4WFZ A;  3N6L A;  2DNG A;  1HQU A;  4F50 A;  1VHI A;  5A76 A;  4OJG A;  4C7Q A;  4Y0F A;  4ZOS A;  1U2C A;  2JJ4 D;  1FRX A;  4IG3 A;  4BHQ A;  4X62 F;  4Y2M A;  2IMO A;  2ATC B;  1XNR F;  1PG5 B;  1DAR A;  1S0V A;  1GAO A;  3OQ2 A;  5LJ5 Y;  5CYQ A;  2CIM A;  2VG7 A;  3X1L B;  1X4F A;  1KC8 T;  2BQR A;  3AB2 B;  3QJP A;  2W4D A;  4JI0 F;  4N76 A;  2D69 A;  3W2V B;  2CUY A;  2EKN A;  2VKR A;  1XER A;  3GFY A;  4DS4 A;  2QRR A;  4IR1 A;  4F3O A;  1H7W A;  3B82 A;  3EDR B;  2HRU A;  5DG8 A;  3HF5 A;  3T6B A;  4UQG A;  2R7V A;  4V1A k;  2ZH2 A;  1YRU A;  3GFH A;  5IWA J;  3JB9 k;  4AFF A;  3DI6 B;  3RBX A;  2GHV C;  4OL8 A;  1FX2 A;  3Q24 A;  4X4P A;  2BV3 A;  3W8P A;  1IQZ A;  3W7B A;  2QEX S;  5DM6 Q;  1S72 S;  2RUG A;  3PYG A;  4YR0 A;  3DFE A;  3D3B J;  3AJ1 A;  5KFC A;  1FDB A;  3EZ5 A;  2ZIT A;  1KHW A;  3KTQ A;  3TVZ A;  3K8W A;  3LAN A;  3KKF A;  4ETX A;  1WOO A;  2PO4 A;  1X5P A;  4F0M A;  2JLF A;  2VDH A;  3ZZZ A;  2MJN A;  1T02 A;  4LF4 J;  4F4Y A;  1NSQ A;  1OY6 A;  2KM8 B;  4L3N A;  2FLN A;  3OVA A;  3L7P A;  5HMX A;  1IKW A;  5KFT A;  1PSD A;  2HS3 A;  2UXC F;  1HKA A;  3OLB A;  3GB0 A;  3HHE A;  2HBZ B;  3FEY B;  5B0F A;  4EYH B;  4FDF A;  1O8B A;  1R8P A;  3MZI A;  2UVU A;  1RP5 A;  1R3N A;  1VLY A;  5B0C A;  5KOW A;  2YKN A;  2PII A;  3QMQ A;  1CUL B;  4JV0 A;  4B02 A;  2OP5 A;  4LFC J;  4DR7 F;  2GHP A;  3JS9 A;  2KG1 A;  2E5L J;  1C1B B;  1NPP A;  1UL3 A;  3IR7 B;  4JI4 F;  1R43 A;  1VQ8 S;  3R8Y A;  1DBD A;  1L3T A;  2CQC A;  2CQ1 A;  2G0J A;  3W5Z A;  4IQM A;  3PYF A;  2QLB B;  3S1T A;  5AXM A;  1X4C A;  3GYN A;  5J2Q B;  4F02 A;  1QE1 A;  1JLB B;  3T9N A;  3LWM A;  3NXZ A;  3K0J A;  3BR9 A;  4DSE A;  2KM8 C;  4CNZ A;  3KLF A;  4WXW A;  4Q2L A;  4IFY A;  3C66 A;  1PYO B;  2FVC A;  1GEH A;  5ETK A;  3MM5 B;  2CQ0 A;  1SV5 A;  2M88 A;  2HAF A;  1O6X A;  1QLN A;  4EMD A;  1NK9 A;  1P27 B;  4LSN A;  1JK9 B;  4DLE A;  5KFO A;  3RRH A;  3O6Q A;  1KD1 T;  4DR3 F;  3QQC D;  5DDQ C;  4ELV A;  2VA3 A;  3M6U A;  1HNX F;  1H73 A;  3DLG A;  1XK8 A;  4ED3 A;  4GVB A;  4DEZ A;  1E6Y B;  5B0B A;  1OSC A;  3WC0 A;  4YFU A;  2AV5 A;  3HZE A;  1D0E A;  5FLX U;  3G4S S;  5ETN A;  4PAB A;  2P8I A;  3CJK A;  3AA9 A;  1TKT B;  3PM9 A;  1NXI A;  1QAX A;  3GMG A;  3OL7 A;  5JJB A;  4KO0 B;  5DJB A;  3BDE A;  1RWN B;  5HP1 B;  1M90 T;  1MN7 A;  2GS8 A;  1KNZ A;  5HAT A;  3CTR A;  4ERD A;  2UUA J;  5IT9 U;  1R6V A;  2KYZ A;  1RSC A;  4C8L A;  2R2R A;  1D9A A;  2L9W A;  1RWP B;  2IYG A;  1RGV A;  1JLQ B;  1U0H B;  4ECV A;  4NYP A;  3I0R B;  4OZL A;  3VGT A;  3T5J A;  2C2O B;  4HT5 A;  2LQJ A;  4RW8 B;  5HMZ A;  1Q82 T;  3RTV A;  3JAM U;  5MLC V;  3CJ3 A;  1JLF B;  2OUG A;  5ETP A;  2JH3 A;  2V68 A;  1S0N A;  4OHV A;  2HVI A;  3EYZ A;  1S48 A;  5BYS A;  2BJE A;  3OVB A;  2RD5 C;  4MFB A;  1N34 J;  2W2N P;  4PWW A;  1LEO A;  1ZA2 B;  1V3R A;  4R25 A;  1FK9 A;  1KLM A;  2Q43 A;  3V5R A;  5FD1 A;  2YBV A;  3BSN A;  1KOO A;  3OXF A;  5GAD U;  3UN2 A;  2KXN B;  2LXU A;  1CSJ A;  1RJJ A;  1C1C B;  4DMZ A;  3Q83 A;  1U02 A;  1A7G E;  1TAU A;  2UUC F;  2XI2 A;  1LWX A;  4C9D A;  1HNI A;  3D6T B;  5A6P A;  2DTJ A;  5ETO A;  3A8K A;  2HLT A;  1HA1 A;  5AE3 A;  3A4T A;  2XM3 A;  1SCJ B;  3DDK A;  2YNI A;  3T5H A;  1WC5 A;  4MK8 A;  3MM8 A;  1ULR A;  1UTA A;  4RBT A;  1H3D A;  1T9V A;  1DUR A;  2ZH9 A;  3N6N A;  1T8E A;  3B54 A;  2XUL A;  2BQ3 A;  5I3U A;  3T5K A;  4QU7 A;  1RTJ A;  4IRD A;  2FTR A;  3HSD A;  3V2U C;  2XYG B;  1IBL F;  3W3S A;  1R7I A;  2XLJ A;  5CD4 A;  2AYM A;  1UCN A;  1RAF B;  2BE7 D;  4GO7 X;  2AX0 A;  3OR2 A;  4FP9 A;  4B3M J;  5H9E J;  4O3O A;  1U48 A;  3OHA A;  1N32 F;  4ED1 A;  1KP6 A;  1NUE A;  2W1B A;  1BMQ B;  1GK8 A;  4O0I A;  2X1G A;  5D0R A;  2NS1 B;  5JUM A;  2Z4P A;  2J6U A;  2ACM A;  2EEY A;  1PYT A;  3ZZP A;  3ZNJ 1;  1S1V B;  4NYO A;  3CCT A;  5A2Q Y;  4TY9 A;  1YJR A;  4O4G A;  1L3V A;  2AW0 A;  2HPU A;  4I1T A;  1VK3 A;  4G1P A;  2YWH A;  4I4B A;  4L76 A;  2ZBC A;  4G1I A;  1SXL A;  3DRR B;  3GP9 A;  2I2Y A;  3NGK A;  4IUF A;  4PQU A;  1TL3 A;  3H2U B;  1RT3 A;  3CT9 A;  1WG5 A;  1TAQ A;  2OPS B;  2AJQ A;  2E9R X;  3OPK A;  2E1C A;  4QU6 A;  2HAI A;  4GRS A;  2CAD A;  2BX6 A;  2NXJ A;  4W4M A;  1UWB B;  4ES1 A;  1Q81 T;  1O51 A;  3AOB A;  1SJ1 A;  3DRY A;  3KLG A;  5T7L B;  2ZVI A;  5A8R A;  4DUY J;  3MWB A;  2BM0 A;  4LF1 A;  1M1K T;  1LWE A;  4KV8 A;  2O66 A;  3AH6 A;  3IRX A;  4MMO A;  2HHT A;  1VS3 A;  4ES2 A;  5A8W B;  3GSI A;  2POK A;  3GPA A;  3JSB A;  5D77 A;  4G1Q A;  1NK7 A;  1RAB B;  1Q5Y A;  1HQU B;  4WFB Q;  2M4M A;  5IV4 A;  3MM6 A;  5CH7 B;  1C4A A;  3HD2 A;  1NSP A;  2RT3 A;  1VMB A;  4IG3 B;  2VPX B;  2XC9 A;  2XGP A;  3ILL A;  1BUX A;  3NRB A;  2NSB A;  3CD7 A;  4WXO A;  4K50 A;  4JI2 F;  2MKI A;  3VAF A;  2LQ5 A;  5CYQ B;  2AJ4 A;  4ILR A;  2ZJQ Q;  2VG7 B;  5KFR A;  5KFS A;  2GIR A;  1JB0 C;  2LXI A;  4W92 B;  8ATC B;  2QFJ A;  4I6W A;  3I5C A;  5J2N A;  3LQV A;  1KOH A;  2PGC A;  1TL5 A;  2J7K A;  2MQQ A;  3M9M B;  4DPX A;  1VBX A;  4DQI A;  3KOA A;  1HR0 J;  1U6B A;  3MEC A;  2FHJ D;  5BXI A;  5CXT A;  1M1H A;  1GQE A;  3SV3 A;  1URR A;  3M6X A;  2HHS A;  1ZH5 A;  5L9X A;  3H2V E;  4TU9 A;  2AYE A;  4DL7 A;  3I5B A;  4JI3 F;  1MWQ A;  2XWY A;  3L9Z A;  3FFI B;  2VFR A;  1V9O A;  4K5R A;  2HNY A;  2HVH A;  3BSA A;  1R8A A;  1UKU A;  4NCA A;  3UR3 C;  5LOQ A;  1RAE B;  2V0N A;  1OPZ A;  1VQ4 S;  2RML A;  2JC1 A;  3HVA A;  3KHG A;  2Y8Y A;  4DSF A;  1RLD A;  2M0G B;  2QA4 G;  4I2P A;  2CDQ A;  1HNZ J;  1GNK A;  1WF2 A;  1IKW B;  4M5I A;  1X0F A;  2WB4 A;  1JJ2 R;  3CC2 S;  1Q86 T;  1TEL A;  2FZG B;  3AFG A;  2QA4 S;  5G0R A;  2ZKT A;  3AD7 C;  1G1X A;  2YKN B;  3CB4 A;  1PJ5 A;  4ZJQ A;  1DHM A;  3PXG a;  2XBP A;  2HRT A;  2HFZ A;  4ITS A;  3PHT A;  2UV8 A;  6FDR A;  3HFK A;  3RW7 A;  1NO8 A;  1PJ7 A;  4LRE A;  4DFJ A;  5BR8 J;  3B78 A;  2AZ3 A;  2DNR A;  9ATC B;  3MCN A;  4Z7Y A;  2DPI A;  5HJY A;  2CPF A;  2A2C A;  2ILZ A;  4P2M A;  5KG4 A;  1FT8 A;  2BOA A;  2KVI A;  2UUT A;  3IWX A;  2IJR A;  2PFF B;  3NAH A;  3CO9 A;  5JVH Q;  2QYC A;  5AXK A;  2MGZ A;  1OQ6 A;  1T9W A;  2VHG A;  1QE1 B;  2GAH C;  4U8V A;  1Q8L A;  4DX8 H;  1P8G A;  5EWE A;  3CF5 Q;  3SEO A;  5D0E A;  2DPJ A;  1Q8K A;  1APS A;  3CW2 C;  4ZIT A;  2ZHA A;  3KLF B;  2BJ7 A;  4IFY B;  1U1Q A;  5E0O A;  3MHY A;  3ITH A;  1SV5 B;  2VG5 A;  4LSN B;  2CZ9 A;  2OFH X;  2M52 A;  1F5B A;  4DPW A;  3Q8R B;  4DBQ A;  3MED A;  4P75 A;  1WC0 A;  3DLG B;  3TUP A;  3PO4 A;  1B99 A;  4QZV B;  4GVB B;  4JI6 J;  3ZZY A;  1RHU B;  4FXW A;  4AQY J;  2E5H A;  1N8R T;  1S6P A;  4TQR A;  5E3A A;  2AIR B;  1D9D A;  2X7I A;  1RZM A;  3H2L A;  1CS4 A;  2MMY A;  3CJK B;  3M8S A;  2KJW A;  1VIO A;  4NA1 A;  1T0T V;  4ZIW A;  3U1L A;  2B56 A;  2QTW A;  2CQ3 A;  3W65 A;  2GA7 A;  2RU9 A;  1X4A A;  4ID8 A;  1R89 A;  4RW4 A;  4DSI A;  3ELH A;  3RRK A;  2HWI A;  4RNF A;  2Z30 B;  1RWM B;  4BWM A;  1S9G A;  1HWL A;  2MKK A;  3EGZ A;  2MQL A;  4DQQ A;  3VR1 A;  4D3G A;  2VFU A;  2L9D A;  1RAH B;  1UW9 A;  1V3S A;  3AT1 B;  4W90 B;  2IJN A;  2HFS A;  4X65 J;  2V9K A;  4DV2 F;  3KK1 B;  1WC4 A;  2JEF A;  3HHK A;  4ECY A;  4RL1 A;  5D3G A;  4E98 A;  4Z7C A;  1X5T A;  3EJM A;  1HI8 A;  1MMN A;  2KI2 A;  4CH0 S;  2IBK A;  3MR2 A;  4K0K J;  4JYA J;  3FZB A;  4TYB A;  4NLP A;  1DQA A;  4XAK A;  4F26 A;  1FTC A;  2BAB A;  1H0H B;  1UJ5 A;  3NS5 A;  2MSS A;  1LW2 A;  3TR5 A;  2VC1 A;  3F56 A;  1FK9 B;  1Y00 A;  2HFU A;  3H40 A;  1KLM B;  2AU0 A;  5A8K A;  4C8K A;  4DR6 F;  1R31 A;  4LRB A;  1O5J A;  4IO1 A;  3SCL E;  2IDE A;  1B0T A;  2LYV A;  3U1M A;  2XY5 A;  5KFL A;  1YRT A;  4QJV A;  1UJ6 A;  5LXR A;  1UJ4 A;  2HGN A;  2NLW A;  4PUO A;  4U7U D;  5A0Y A;  3AJD A;  5KG1 A;  4JI8 F;  1U1N A;  2RQM A;  5HAO A;  4I56 A;  2A1B A;  1MRO A;  1XMB A;  1HNI B;  2ROG A;  4XTT A;  2HZA A;  4ZVE A;  3HHN B;  1HW9 A;  1H98 A;  3NBP A;  3HUL A;  3N79 A;  3MM8 B;  2CNO B;  2ZE2 A;  3BQ2 A;  4J9L A;  4C3L A;  1F5C A;  1FTR A;  4LUB A;  4UW2 A;  3AQO A;  1RTJ B;  3OFE A;  5LMN J;  2DRB A;  1XEZ A;  2F40 A;  3RBD A;  2GZO A;  4AD6 A;  4B9M A;  4CLZ A;  2MB0 B;  2GML A;  3V6K A;  1U1P A;  1FF2 A;  5C25 A;  3I82 A;  1S6O A;  3T1H F;  3K8V A;  3TO8 A;  1IBK J;  4N47 A;  1B7F A;  4LF5 F;  4DV1 J;  3FRY A;  2K2P A;  3OR2 B;  4OI3 A;  2J5A A;  4FBT A;  3CD0 A;  2IYI A;  5HI7 A;  5IT4 A;  1LXJ A;  2PE8 A;  3D66 A;  1NJZ A;  1RXO B;  5K9F A;  2DNP A;  2E1P A;  2KXF A;  1SUQ A;  1S12 A;  2ADB A;  1OIA A;  1YVF A;  3QGH A;  4DUZ F;  3O3L A;  4WJB A;  2ZZM A;  4O4G B;  1UZD A;  1X9M A;  2FJB B;  1F3V A;  4C8Z A;  1I3O B;  1GMW A;  3K2Y A;  2CKW A;  2UU9 F;  4K8R A;  4PYA A;  3T41 A;  3X3U A;  3KHH A;  4PQU B;  1TL3 B;  5F8G A;  2OPQ A;  2XNR A;  1VI7 A;  2LU2 A;  4NCB A;  1RT3 B;  5DQG A;  4DI6 A;  2DVI A;  2FJV A;  2ZFH A;  4DCP B;  2HIY A;  2EBG A;  1VRT A;  2BOP A;  2YPY A;  3VHQ A;  3DXS X;  1DRZ A;  2DIV A;  4PG7 A;  1RAJ A;  2X3D A;  3CDA A;  3SSQ A;  5E3C A;  3EWG A;  4MK7 A;  1RA6 A;  4B9N A;  3KLG B;  4WYL A;  3ZZU A;  3D7S B;  2OSR A;  5A8R B;  4O3R A;  4IH5 A;  1KS2 A;  4LBP A;  1LWE B;  4KV8 B;  2F63 A;  1DY3 A;  3CJT A;  3IRX B;  3HSZ A;  3UR0 A;  1UET A;  3JTP A;  4DL2 A;  1VHF A;  5IQ6 A;  3TZX A;  2LMI A;  4G1Q B;  4HEA 9;  2ABY A;  1E6V A;  1SC1 B;  2DEJ A;  4J5O A;  2MQN A;  3MM6 B;  2HHQ A;  3KLH A;  3B4D A;  2GW8 A;  1YJV A;  2AJF E;  2FPH X;  3KLV A;  2RIJ A;  3DHW C;  2IA6 A;  1SIW B;  3PRV A;  2J9E A;  4ZN1 A;  4LT6 A;  2NPI A;  1WEZ A;  1RT5 A;  2X1B A;  4KGZ B;  3PNI A;  1VJW A;  1WWH A;  1EKS A;  2V2Z A;  5J2N B;  3GYX B;  3NS6 A;  2EFP A;  3O2I A;  3M6V A;  1GXL A;  4UST A;  1ZAW A;  4K4W A;  1GX5 A;  3DLE A;  2WW4 A;  2GC8 A;  5IWA F;  2HK2 A;  1FVS A;  4NLT A;  4ILM A;  4ZPB A;  4B17 A;  4ZLL A;  3MEC B;  5F3Z A;  2F7V A;  4QW9 A;  3ULH A;  2PA8 D;  4YEA A;  1JWW A;  3CIM A;  3MR3 A;  2R9L A;  2DGW A;  3FBB A;  5DLF A;  4ETZ A;  1KEK A;  4QR0 A;  2FY8 A;  1JIH A;  1DZ5 A;  1TFY A;  4CQ1 A;  2FQQ B;  2FJD B;  1HBN A;  1F2H A;  2BE9 B;  3IBC B;  2EC2 A;  1SPB P;  4QIV A;  1RWK B;  4LF4 F;  2HVD A;  4N5S A;  3BGR B;  4DFM A;  4I2P B;  4KSE B;  1WEX A;  1Q53 A;  1REG X;  5HMY A;  3BYR A;  4CLT A;  2R7Q A;  5G0R B;  2EFN A;  3Q0A A;  3PFO A;  1FRH A;  2WVD A;  1UPP A;  4LRC A;  3KUH A;  4LRD A;  1NB2 A;  4DN0 A;  3TJ9 A;  2VPY B;  4J9K A;  1RCX B;  3MEE B;  2ZH7 A;  2OEK A;  1JLG A;  4Y65 A;  1YZ7 A;  2E5L F;  3HPO A;  3EZO A;  2CQ4 A;  2WHO A;  2ZHB A;  4KGX B;  2MTL A;  1GXU A;  1KSP A;  4H4M A;  1RHJ B;  4RUA A;  4U9R A;  5B0E A;  5H9F J;  4OZJ A;  4HHU A;  1J2V A;  2B3T B;  4AUK A;  5GAG I;  4PXB A;  4ZCI A;  2G9O A;  1U6Z A;  5BYR A;  4FF1 A;  1U7L A;  4YB1 P;  2MPU A;  4LR8 A;  2YNG A;  4MKY A;  3KNG A;  2LVW A;  4NA3 A;  1IM6 A;  4S0M A;  2W2Q P;  3GIR A;  3GSD A;  2MGZ B;  3IWN C;  2HND A;  1X9W A;  1S99 A;  1OWX A;  4N7T A;  2AGP A;  3BQ0 A;  4DV0 J;  1WC6 A;  4CH7 A;  2R4F A;  2R7W A;  2H48 B;  1FKA F;  3E8O A;  2NZ4 A;  2MHE A;  4FNH A;  3NG8 A;  1AUD A;  3ITH B;  2OTL S;  2LFV A;  2NZC A;  5D0G A;  4RNH A;  2HQD A;  4WU2 A;  5EHH A;  1NB7 A;  4H4K A;  3GZ7 A;  2MZT A;  5F0U A;  1BLU A;  3DRS A;  3QRR A;  3S01 A;  2OFG X;  4MH8 A;  4ED0 A;  2CJK A;  4JV5 J;  1S9E A;  3MED B;  2P9G A;  2EBE A;  2XO7 A;  1IJF B;  4FF3 A;  3QJL A;  3G8Q A;  1SJR A;  1S6P B;  4TKT A;  3QAU A;  4EI2 A;  1CS4 B;  2PEH A;  1C4C A;  2YQ0 A;  2R42 A;  1VQO S;  2GCF A;  5ETT A;  1YTY A;  3MAA A;  4ED4 A;  4G65 A;  1WG4 A;  1RT1 A;  3CCV S;  1IKV A;  5BYQ A;  3TI0 A;  2UUA F;  4RW4 B;  4YP3 A;  3BJY A;  4FXV A;  4F0H A;  3G96 A;  3IN5 A;  1S9G B;  3HLU A;  1VQK S;  5F3T A;  3NGD A;  3QO9 A;  1W2B R;  1UEK A;  4ZLJ A;  3NNA A;  3PFE A;  5F0W A;  2PI4 A;  5IT0 A;  3T6J A;  3MR7 A;  4QOT A;  4C2M A;  3MMA A;  4PEO A;  5D3G B;  4EO8 A;  2LEB A;  4OI2 A;  2DB1 A;  2CQI A;  1NHU A;  5CYM A;  1BE4 A;  4A8O A;  4KT0 C;  1ZPW X;  3BPD A;  1RAG B;  3MUT P;  4DR4 J;  5ETS A;  4C8Y A;  4KIA A;  1N5T A;  2YH0 A;  2AYB A;  4OYI A;  2P9E A;  2OEM A;  3DLH A;  1LW2 B;  1NEE A;  4K4T A;  1DTT A;  2CQP A;  3UN3 A;  2MZJ A;  2L41 A;  2AP6 A;  4BC9 A;  1H2V Z;  2OLW A;  1ZOT A;  1TMJ A;  4FS1 A;  5C2C A;  2O1P A;  5KG2 A;  1FDA A;  1HBM A;  2XLI A;  1PCA A;  2XMA A;  4CIO A;  3ETO A;  4DV6 J;  5E3P A;  1HHS A;  4LFB J;  2O3D A;  2LEC A;  1BXN A;  2VU5 A;  4PUO B;  5A0Y B;  3NNC A;  4TN2 A;  3UW1 A;  4WP3 A;  1L5U A;  2B43 A;  2G0C A;  4DL6 A;  1MRO B;  4V19 X;  3MPD A;  4DSK A;  1B7Y B;  1LK5 A;  2QIF A;  2VAS A;  3NBP B;  3QFW A;  4PYD A;  3HCX A;  2QE5 A;  3CCQ S;  3EX7 B;  1S0M A;  4DCO B;  4D3H A;  2ZE2 B;  1SJ4 P;  5HJX A;  1T9X A;  5I4M A;  4RZR A;  3BKU A;  2Y9H A;  4PXE A;  3J81 U;  4USM A;  4MKA A;  2U2F A;  3PVX A;  3F73 A;  3MR5 A;  3A3P B;  1ZM4 A;  5KG7 A;  3F44 A;  4ZVT B;  3FSX A;  3CVK A;  3FMW A;  3LGN A;  1SC6 A;  1HYS A;  1K0V A;  1NJI T;  1IJE B;  2IHR 1;  4CLP A;  3CCJ S;  2V6A A;  5GAG U;  3CSK A;  4IOB A;  1FFW B;  2AMC B;  3M8P A;  5D78 A;  3D0H E;  1SUQ B;  5ITH A;  5KFQ A;  3BGO P;  3A8J A;  1IQT A;  4CT8 A;  3H5Y A;  3R7N B;  3WC2 A;  3A1Y G;  4KJI A;  1F9H A;  4QIG A;  2DJW A;  3GIM A;  5EN1 A;  2DIU A;  4ED5 A;  1Y5I B;  1NKB A;  2KT3 A;  4ZVR B;  3CO0 P;  5KTQ A;  4B3R F;  2H4Y B;  2AHO B;  4WZM A;  3KHL A;  4ID5 A;  2OPQ B;  3J7Y I;  1RIS A;  1S7I A;  1YLX A;  2CFX A;  2VFT A;  2BW7 A;  3G8T A;  1V6H A;  4TVA B;  4OHZ A;  3BN7 A;  3PW0 A;  4YB7 A;  2N82 B;  3LPY A;  4OJ3 A;  3H4D A;  2HGM A;  4ZVG A;  1Y4Z B;  1NK5 A;  1UEU A;  1T94 A;  2M70 A;  1HBU A;  2MZ1 A;  2G2Z A;  2FVR A;  7FDR A;  3AY0 A;  1N5Y A;  1AZS A;  5EX0 A;  4X66 F;  1CJU A;  4TYA A;  3PCO B;  1SL1 A;  4N41 A;  2X51 A;  3BH6 B;  1E6V B;  4KHP J;  1VK8 A;  2CPD A;  2WVE A;  3WDO A;  4R5P A;  2RNE A;  3KLH B;  3VAK A;  5EGY A;  4WE1 A;  1T7P A;  1AFJ A;  3MAH A;  2LKZ A;  5D6G A;  3M8Y A;  3EGV A;  2ZNZ A;  2XHC A;  1RWW B;  1IKX A;  2LEP A;  4R0E A;  4K4S A;  3OTD A;  2IM3 A;  4Q45 A;  3PAC A;  3BO2 A;  1RT5 B;  5GAH I;  4NYZ A;  4Q5V A;  1BQN A;  1WJ9 A;  2FIU A;  3E01 A;  4K4Z A;  4NLD A;  1RKJ A;  1QAJ A;  4N8O A;  2PMZ D;  3DLE B;  1HR0 F;  3W2W A;  2QGF B;  2RQ4 A;  3NOC A;  4IH7 A;  4OZ3 A;  2LA6 A;  1PYS B;  3VGV A;  2J9D A;  1ZM3 A;  3CJS A;  4KBI A;  1N5Q A;  4ZS6 A;  2I6W A;  4XPC A;  4KTQ A;  1L3U A;  4QYZ K;  1CJV B;  3CPW R;  1KBR A;  1PKU A;  4P71 A;  5KFA A;  2VA2 A;  2V8P A;  1HBN B;  2E1A A;  4A8Q A;  4A8S A;  4LFA F;  5F8N A;  1UPM B;  3O44 A;  4FVC A;  2BQU A;  4IKA A;  1HNZ F;  4RPF A;  1NU4 A;  1RT2 A;  1YHQ S;  5F8I A;  2C2Z B;  4Y2K A;  3C8Y A;  2JVO A;  1TK5 A;  3OUY B;  5B0G A;  1KRP A;  1ARO P;  3BO4 A;  2JLE A;  4Y2I A;  1VYA A;  2NXC A;  4RUB A;  4ER8 A;  3DYA A;  2YKQ A;  4ZP9 A;  5M2P A;  2IC3 A;  4FPI A;  5IC6 B;  3ET6 A;  3CCL S;  4PG8 A;  3TA1 A;  1N54 B;  3EGN A;  3NMA A;  2M8D B;  5KFD A;  2HHW A;  1U1M A;  2XMU A;  3HFZ B;  2PSZ A;  3D0G E;  4DXL A;  4C0O C;  1IVZ A;  3WZ0 A;  2ZH4 A;  3NEK A;  5LJ3 Y;  1JLE A;  3MMB A;  4H4M B;  5BR8 F;  3W9I A;  3TAN A;  1R0A A;  2E9T A;  3BH7 B;  3FBC A;  4FYX B;  3ZC4 A;  1IUJ A;  2WZ1 A;  4WK1 A;  4LR7 A;  2V8G A;  3C15 B;  2GO8 A;  1B3T A;  2FLL A;  2KFY A;  3CJ5 A;  4TXS A;  2YNG B;  4DUT A;  4HAC A;  1PC4 A;  3BBB A;  3K57 A;  1ELO A;  2HND B;  3BGU A;  4F25 A;  1QJH A;  4NXM J;  4HDH A;  2WCX A;  2RUS A;  3FC9 A;  2Z2M A;  3HO1 A;  4IO9 Q;  3NMR A;  1U2F A;  2C3O A;  1KLN A;  4PCQ A;  3N01 A;  1JLC A;  3BPS P;  3GQC A;  3C14 A;  1H6K X;  4ICL A;  2UV8 G;  5E5N A;  1WHX A;  3J80 U;  3K5M A;  1U26 A;  2GMJ A;  4EGL A;  3IMQ J;  4DLG A;  1KVJ A;  4AYB D;  3V6H A;  2B4V A;  3DRS B;  2E5G A;  2C2D A;  1S9E B;  4JI6 F;  4TLR A;  3H98 A;  4J9M A;  4OV6 A;  4AQY F;  1SH2 A;  3MCM A;  1EP4 A;  4WPA A;  4BCA A;  3K5L A;  4A8K A;  2BR0 A;  2WAQ D;  2PFD A;  1NH8 A;  2MZS A;  3RU0 A;  2EW9 A;  4EEY A;  2I38 A;  4UOH A;  4RWW A;  1IR0 A;  1L3K A;  3MAA B;  1EET A;  1Y9O A;  1RT1 B;  4FYY B;  1VC0 A;  4OI6 A;  1LFP A;  4NPO A;  1IKV B;  2FVP A;  4MYT A;  3MTJ A;  4A48 A;  1B64 A;  4LF7 F;  1KKH A;  1EKR A;  1IBC B;  2D41 A;  2MQO A;  3R2C J;  4M8L A;  4UF4 A;  1J5O A;  2CQ2 A;  1GMW D;  3QO9 B;  2B4P A;  3L7O A;  4QCL A;  2A2D A;  3ZTO A;  2D3U A;  2DXE A;  4NZ0 A;  4H4K C;  4DS5 A;  3PW7 A;  4IDK A;  3M4X A;  5FLX Y;  3VAL A;  1OO0 B;  1VRU A;  1NHV A;  2Y1L B;  2GIF A;  2JDJ A;  3HSG A;  1FJC A;  3MMA B;  1Z2L A;  3DDN A;  1NM2 A;  2MQ8 A;  2EK1 A;  1NND A;  2DR7 A;  5CYM B;  4K0K F;  1F2G A;  4LF2 A;  1RYS A;  4PAA A;  3CCM S;  3QT5 A;  5J1N A;  2L48 A;  1SQE A;  1I94 F;  5IT9 Y;  3ISN D;  3D4J A;  2W9A A;  4CYU A;  1DTT B;  5F9L A;  2KO1 A;  4P74 A;  1NHK L;  2A10 A;  2B9E A;  3W5X A;  5KOX A;  5AJ3 F;  4KB7 A;  1S79 A;  1HBM B;  4PPZ A;  2N3L A;  2RS8 A;  1SKU B;  2ZZN A;  4LIW A;  3RJM B;  3JAM Y;  2DKO B;  5KT7 A;  4KGV B;  3C16 A;  4OI4 A;  3H90 A;  4ZHR A;  1S59 A;  3W60 A;  2LXF A;  3SYZ A;  5T41 A;  2HLU A;  2ZKU A;  4ZPC A;  2XCA A;  3TJ8 A;  2M7S A;  2QLF B;  4P9S A;  2EG1 A;  2HIQ A;  2F4V J;  4NLR A;  1N33 F;  1MMD A;  4RNM A;  2PC6 A;  3OVS A;  4UZC A;  2YNH A;  1CC7 A;  3NLC A;  2HYI B;  3OL9 A;  5LMN F;  2WVF A;  1T05 A;  4ED2 A;  2LQ9 A;  1VQN S;  4ATN A;  2XZT B;  2OKQ A;  3JXO A;  3OTO J;  2J0S D;  3CDW A;  4IYQ A;  4A8Y A;  2Y1J A;  1IBM F;  3JQM A;  4YME A;  3KLI A;  3HD1 A;  5L9N A;  1S6Q A;  4OX6 A;  4ZLP A;  1HYS B;  4ZMM A;  2ZEJ A;  2OEL A;  2DR6 A;  2KH9 A;  4EZ9 A;  1KTQ A;  1S49 A;  2GMH A;  2ZH5 A;  2CWK A;  3M8P B;  3PX4 A;  4P73 A;  4JI5 F;  1WEY A;  3I0R A;  4DF8 A;  1MWZ A;  2FJW A;  2GFF A;  2W25 A;  1L3S A;  3C46 A;  1S1X A;  3IGN A;  1W7W A;  2V2K A;  1FKP A;  1OSD A;  3R5D A;  1S5Z A;  1HFE L;  1LFW A;  3I6P A;  4DV7 F;  1H2U X;  4Z2X A;  2DHH A;  2KYX A;  3LO3 A;  3W9J A;  1BD6 A;  4PG5 A;  1KQK A;  4FKX A;  3QRQ A;  2E66 A;  2OI2 A;  4ID5 B;  3MD3 A;  3L09 A;  1YBA A;  4YR2 A;  1OS5 A;  3UDL A;  2CYY A;  5L1L A;  2XMJ A;  2ZUG A;  1U8S A;  3W9H A;  1VGY A;  3OBI A;  3EGW B;  3CJQ A;  4ELT A;  1HBU B;  4RU9 A;  1R27 B;  1XMQ J;  5D15 A;  3IWL A;  1N5Y B;  4CI0 B;  4ANE A;  2RDD A;  1CJU B;  5KFJ A;  4HR2 A;  2V8H A;  3PJ9 A;  5A6W A;  5HK4 A;  4DSL A;  3UDE A;  3RGI A;  2CJQ A;  2XS2 A;  2G0I A;  1CLF A;  1CC8 A;  2HFN A;  5GVQ A;  3VGS A;  2M8H A;  4R5P B;  1QAY A;  2XG8 A;  2FZK B;  3GE9 A;  3W63 A;  1ACM B;  4WE1 B;  4LR9 A;  1UWA A;  4PG4 A;  2W7A A;  2ASY A;  3EXC X;  4WTY A;  1XBW A;  4NX9 A;  3KWM A;  2VKZ G;  2N7Y A;  1IM4 A;  2IMW P;  2BKN A;  1IKX B;  3LPE A;  4C3K A;  1VQS A;  1OPI A;  3D0I E;  2EI5 A;  2IDL A;  3TAM A;  2VOD A;  3CCE S;  2JRS A;  1BQN B;  4CWB A;  2VFS A;  1P6T A;  3GIJ A;  3E01 B;  2H5I B;  2HWT A;  4Q44 A;  3M1V A;  3HXM A;  3CUN A;  4X64 J;  3CDE A;  3W2W B;  2ZDO A;  3ZZ0 A;  3ILJ A;  1FE0 A;  3QYY A;  4W98 A;  4HH0 A;  3QRP A;  2R7R A;  3KXD A;  2EFO A;  5IQQ A;  5E41 A;  2R8K A;  1W2I A;  3G2X A;  4UUW A;  2DHS A;  4OHW A;  1B70 B;  4TQS A;  2V5H G;  5KFG A;  1OY8 A;  3TQE A;  1X9S A;  2Z2Z A;  1YI2 S;  4RUH A;  2AD9 A;  3AOD A;  2HQC A;  3DRR A;  1CQN A;  4I7F B;  2HGL A;  3VF0 B;  1X4H A;  4DL5 A;  1HI1 A;  3QID A;  1KON A;  4CM0 A;  4LVO P;  2R3V A;  3KG1 A;  3LP1 A;  1NZA A;  2DO4 A;  2OIH A;  2ZBR A;  4PG6 A;  2GV1 A;  3TW0 A;  3MTK A;  1RT2 B;  1RBA A;  2ILY A;  1SI9 A;  5KFN A;  2FJE B;  4FN5 A;  3R3T A;  5KT4 A;  2QA1 A;  3I96 A;  1QSY A;  3JSR A;  1RAD B;  3DNC A;  3DYA B;  2Q1L A;  4UT4 A;  2AKW B;  5KT3 A;  2IC3 B;  1TK0 A;  2DNN A;  3ET6 B;  3KFW X;  5H1S V;  3CWJ A;  1YBT A;  3PY8 A;  1RAI B;  3TZW A;  3TVK A;  2ZWO A;  1JLE B;  3MMB B;  5IXU A;  2FVS A;  3HHL C;  4F8R A;  3P96 A;  1R0A B;  3QAT A;  2GIQ A;  1NK0 A;  3MPW A;  2HHX A;  5K8N A;  4B08 A;  1FJE B;  2ASL A;  3ZZO A;  2YX4 A;  1S97 A;  2Y8W A;  4XO0 A;  3HM9 A;  3BKT A;  2FLP A;  4URQ U;  1IWG A;  3QAE A;  4HAC B;  1K0T A;  1N56 A;  3PYD A;  1ZTT A;  2YKM A;  4RKU C;  3HFV A;  3KDN A;  4DL0 C;  1RAA B;  2B9W A;  1GX6 A;  2AJ1 A;  1FA0 A;  1BY9 A;  1S1T B;  1JLC B;  3NL0 A;  3C14 B;  4CLL A;  3CNQ P;  2DGU A;  4ICL B;  4PQA A;  3U27 A;  1HNX J;  1BGX T;  1D1U A;  2A3J A;  3A3N B;  4JV5 F;  4B9S A;  1GXT A;  1XC9 A;  3GII A;  4MYU A;  4TY8 A;  3OXG A;  1LXN A;  2I8E A;  3GON A;  2XTJ P;  4ED7 A;  3BSC A;  1H72 C;  3QPI A;  3OJU A;  1QUP A;  4NML A;  3FFI A;  3GU0 A;  1EP4 B;  3FUY A;  3TX8 A;  3R7S B;  1YSJ A;  4IQX A;  4LSL A;  1QVF R;  2VFV A;  4OHY A;  1NK8 A;  2H3E B;  2ALY B;  2FZC B;  2IA0 A;  1S77 D;  1EET B;  3AOC A;  2E5J A;  4ECX A;  3CIZ A;  4J9O A;  2VBX A;  2EFQ A;  5HQM A;  3D1O A;  4N77 A;  4PXD A;  1J5O B;  2B4U A;  3DM2 A;  4EYI B;  4WBF A;  1PBA A;  1X4B A;  1GTE A;  2BJ8 A;  4IDK B;  5KFY A;  3MUV P;  1S4E A;  3RW6 A;  1VRU B;  2EFG A;  1IXK A;  1X4E A;  3NGS A;  3ZO7 A;  2YX7 A;  3I87 A;  4F4A A;  3DDI A;  4YB5 A;  4X4Q A;  3CD5 A;  3FRZ A;  4DR4 F;  3MOZ A;  1JLA A;  4CTA A;  1ITP A;  3KUG A;  5LMU F;  2VQE J;  1PIL A;  4ZVU B;  2OPR A;  1UEV A;  2KRB A;  2VBY A;  4CYU B;  5K5M A;  2E7W A;  1KQF B;  2V9W A;  4NEZ A;  3HJF A;  2BM1 A;  2VOO A;  2OTJ S;  3MDF A;  4DV6 F;  1QSS A;  4LFB F;  2UUC J;  4I0W A;  1VQM S;  2CPH A;  4UOF A;  1KR4 A;  1RAO A;  3V4M A;  1PC5 A;  1U09 A;  3C16 B;  4B3T J;  4ZHR B;  4ZVQ B;  3DOK A;  3OJS A;  3PO5 A;  1U47 A;  3UPF A;  5K8M A;  3NCR A;  1VBK A;  2HKE A;  1T3O A;  2AGO A;  1M5H A;  3BGF A;  4DPO A;  3TP2 A;  1Q7L B;  1U8W A;  2V34 A;  2DIS A;  2XYH B;  2YNH B;  3GCW P;  2JL9 A;  2F8E X;  4K7Q A;  3P6Y C;  3GYG A;  2CDR B;  2RS2 A;  1T05 B;  4J9V A;  2RE1 A;  4ECR A;  3PX6 A;  5BJR A;  3GR0 A;  3D54 A;  2LU1 A;  2SXL A;  4ILL A;  1FHT A;  2J76 E;  2FHK A;  2QG9 B;  2YPZ A;  1Q5V A;  3VGU A;  3P49 B;  3M8Z A;  3MCS A;  2VDI A;  2OEJ A;  2XGQ A;  3KLI B;  4OX9 F;  2C3P A;  1FRM A;  1S6Q B;  4K59 A;  2RSQ A;  4KAI A;  4KHR A;  5MAO A;  5K14 A;  3R9L A;  3T5L A;  1A9N B;  2BKP A;  1K9M T;  4C11 A;  4Q43 A;  4C3M A;  2P5V A;  2YNF A;  4OLP A;  4USV A;  4ECQ A;  5F8M A;  1NPR A;  1JXV A;  1S57 A;  4M5D A;  3QT7 A;  5M2U A;  2RB7 A;  4CM2 A;  3KK1 A;  3SZ2 A;  5L46 A;  3IM9 A;  3FNN A;  2B4O A;  2Y1R I;  4J9S A;  1P1T A;  1S1X B;  1F3F A;  3PRD A;  2CAJ A;  1T11 A;  3H4B A;  1FKP B;  2V2Q A;  1WOS A;  2QL7 B;  2XI3 A;  1WKJ A;  2GJF A;  3UCZ P;  4J9P A;  1JXE A;  4DU8 A;  4U96 A;  3KJN B;  4JI7 J;  3LTO A;  2J8A A;  1Y0H A;  2C3M A;  1Q1K A;  5DG9 A;  4NCG A;  2G2O A;  5DZ6 A;  2XY6 A;  1D8Z A;  5U47 A;  5KT5 A;  3BGL A;  2EVZ A;  1Q79 A;  4OYZ A;  3SQO P;  1AW0 A;  5D4L A;  2BZ2 A;  2E1M C;  3OTC A;  4ZIV A;  2R7X A;  3SQG A;  3C19 A;  2CQH A;  4USJ C;  2QYG A;  3ILI A;  4M5H A;  3PW5 A;  2Q3P A;  1SL2 A;  5FJ4 A;  4HI1 A;  1H2T Z;  2BJ3 A;  4WIQ A;  2RQC A;  1VCT A;  1Y3K A;  3MM9 A;  5L1J A;  1VQ5 S;  2E9Z A;  1SL0 A;  2ZC3 A;  2K3K A;  1QUV A;  3PW2 A;  1I51 B;  5KFM A;  1ZTW A;  4NI2 A;  3LF0 A;  4KHP F;  4ECT A;  2JFK A;  1CQM A;  1FER A;  1GFW B;  2Y0S D;  2XZW A;  2DHG A;  3C6U A;  3H5X A;  4Y28 C;  1VQP S;  1R0C B;  4JI2 J;  3KK2 A;  3PEH A;  2VV5 A;  4CH1 A;  1VIS A;  2VZ9 A;  1GMU A;  5KFX A;  2IM0 A;  3H7H B;  2F3J A;  4I64 A;  4F4X A;  1TFW A;  4WFN Q;  5CA5 A;  4BBY A;  3TAM B;  4NZ7 A;  4PXC A;  4NLU A;  4HKQ A;  1N36 F;  4UTG A;  1I5O B;  2OD6 A;  3GWC A;  4DV3 J;  4C8N A;  1MU2 A;  3MMJ A;  2HNZ B;  3NWR A;  3M1V B;  4KQZ A;  4HL9 A;  3QSI A;  3GLJ A;  1OYE A;  4A8F A;  1TKZ A;  4WFY A;  4CRJ A;  1EZZ B;  4GKJ J;  3I9V 9;  4CLS A;  3AAW B;  2BAN A;  4XK8 C;  2F1F A;  2FD2 A;  3I0S A;  2UP1 A;  3N6M A;  2WVB A;  1VQY A;  5KFI A;  2UZA A;  1FEE A;  2XMT A;  3THT A;  2KG0 A;  1OMS A;  4F2S A;  1Z4U A;  4DJB A;  2UVR A;  4ZPW R;  4WP9 A;  1RBL A;  3VTI A;  5IM0 A;  1TVR A;  4FVM A;  2V67 A;  1TUW A;  1W25 A;  4TU7 A;  3LP1 B;  1VDH A;  2H4W B;  4GMK A;  4QBU A;  3UD5 A;  3EMT A;  3B4M A;  5KFZ A;  1VC6 A;  2KKH A;  1FNX H;  4ZVP B;  2AX1 A;  5J1E A;  2J0W A;  4ANC A;  2FYX A;  1MG7 A;  3QSY B;  3MOJ B;  3RB0 A;  2RHS B;  1B0V A;  1TP7 A;  3PIP Q;  2V69 A;  3Q23 A;  5KFE A;  2B9X A;  1K8A T;  2VBZ A;  2EFV A;  2AJ2 A;  4LQ3 A;  3K7R A;  2V4Q A;  4HLB A;  4I68 A;  4KH1 B;  3LUY A;  3TUI C;  3TA2 A;  3CJ4 A;  2DGO A;  2HHU A;  1UP1 A;  5L38 A;  2APO A;  4IR9 A;  3EUN A;  1NJX A;  2WON A;  2J8S A;  4G3I A;  1LQ9 A;  2ZUA A;  4O3Q A;  1RK8 A;  3M05 A;  1SC3 B;  4DF4 A;  4GVL A;  4NXM F;  2IJF A;  3AD9 C;  2YKM B;  1HNV A;  1JQG A;  2YQ3 A;  2C28 A;  1U1R A;  3QNW B;  2NSC A;  2CA9 A;  5IS2 A;  4NLG A;  1F0X A;  3H42 A;  2EPI A;  2NUU G;  1WKL A;  3VZI A;  4ZK7 M;  2K3I A;  1ZM9 A;  4DFP A;  3PHE A;  4WFX A;  4BWJ A;  3TAP A;  5HLF A;  4QW8 A;  3IAM 9;  4M5J A;  3HVT A;  2BJD A;  2PD1 A;  2HEK A;  2LEA A;  2FHJ A;  4TY8 B;  4I69 A;  3BYP A;  3DN9 A;  2OAU A;  3SDE A;  3KDO A;  2W8K A;  1S7H A;  2CXE A;  4Y00 A;  4LSL B;  2VH7 A;  2JVR A;  1WTF A;  1P9Q C;  1NK6 A;  4DDF A;  3DGV A;  1PJ6 A;  3DKD A;  4ED6 A;  3W1Y C;  1GH8 A;  1Q8B A;  3BGR A;  2JHE A;  3MFH A;  3DOL A;  4QPT A;  3EPI A;  4U7U K;  4WP8 A;  3TUJ C;  1RHQ B;  3KLE A;  4X4N A;  2ZOM A;  2DHX A;  1CBK A;  5LT5 A;  1EIY B;  3DM2 B;  1WF0 A;  2MLX A;  2F8M A;  3DXB A;  4P7T A;  5KFW A;  2H51 B;  3MF5 A;  3MEE A;  5H9E K;  1J27 A;  1SC4 B;  2QLJ B;  3ADA C;  3ENV A;  2ZOG A;  5ADZ A;  4KH0 B;  2GVD B;  5RUB A;  4I2Q A;  3ZXW A;  2DCL A;  4EO6 A;  2LDI A;  1WEL A;  3BSO A;  1PBU A;  1JLA B;  4CTA B;  4DSJ A;  3UVJ A;  2UXD J;  1WKK A;  1RKI A;  4DX6 A;  5B0A A;  3FSI A;  2VOP A;  3TZY A;  1C0T A;  2OPR B;  1MLA A;  1P1L A;  3Q8V A;  4AT1 B;  1S1W A;  3G6V A;  4LVN P;  4O4R A;  3RAM A;  3NAI A;  4ELU A;  3MUM P;  3MGJ A;  1HAR A;  2UUW A;  2YWE A;  4DPU A;  1AUS L;  2ZM6 J;  2HHH F;  3UI3 A;  2KT2 A;  4UUX A;  2RH3 A;  4ALZ A;  2W9B A;  4C4W A;  2HVZ A;  3AB4 B;  4R0J A;  3CCS S;  2JX2 A;  3DOK B;  4X4R A;  2VIC A;  3M9N B;  1CJK A;  4YDD B;  4O0N A;  3TAR A;  4P10 A;  2HUR A;  4ZCK A;  3THV A;  1EX8 A;  3N5B A;  1K1S A;  2KJV A;  3ZTQ A;  1F9E B;  2P6T A;  5AE1 A;  3LAK A;  5T14 A;  2R8H A;  1R8C A;  1F6T A;  3OTO F;  4K4X A;  2ZH3 A;  4A8X A;  4OIX A;  2QMX A;  3FCH A;  3HX9 A;  4OYM A;  1X5O A;  4DHV A;  2D9O A;  2R8J A;  1A6L A;  2IIH A;  3G6Y A;  2M5Y A;  3T9Z A;  1RWX B;  2FGO A;  5IOL A;  1FKO B;  4DPT A;  1Y11 A;  3LA0 A;  4F36 A;  2VPZ B;  3AOA A;  2RAQ A;  5K14 B;  3QFH A;  5HL7 Q;  2QL5 B;  4C11 B;  2XSJ A;  4MT1 A;  2YNF B;  5F8H A;  4DZD A;  5LXY A;  4DUZ J;  4M5D B;  2VG6 A;  2LCW A;  1XJW B;  2DT9 A;  2RIL A;  3M8W A;  2O5D A;  4CO1 A;  2XY7 A;  3RG6 A;  1TQL A;  2UU9 J;  1D8Y A;  1QM9 A;  2XSF A;  5E3Q A;  2EC0 A;  3GV5 B;  3J81 Y;  2FLO A;  2DGT A;  1V3Z A;  3LGH A;  3C2P A;  1ZAX A;  4DR5 J;  3OW2 R;  4NCG B;  1EHW A;  2HZC A;  1H74 A;  1G6B A;  4GKK F;  4URG A;  2RRN A;  4WTO B;  4X84 A;  3CJ8 A;  1J5E J;  3QT8 A;  3G82 A;  3SQG B;  3A13 A;  1MWY A;  1M5P C;  4K5S A;  2C2M B;  2YX1 A;  1XMQ F;  3RR8 A;  2QT7 A;  1NH7 A;  4C8M A;  2BJ1 A;  3MM9 B;  4RW7 A;  5I3Q A;  2R2S A;  3QBC A;  4A47 A;  4LJM A;  3WX4 A;  1IWA A;  4NI2 B;  2OML A;  4C97 A;  2DGV A;  1AA1 B;  4X4O A;  1HQ2 A;  3C6U B;  1JXL A;  2B7C B;  4DQS A;  1U1K A;  2AEF A;  4K4Y A;  3GIK A;  3KK2 B;  2HBY B;  1YWX A;  4MIA A;  1SKW A;  2JFD A;  3Q2T C;  2R7U A;  1X4G A;  3SCJ E;  4F2R A;  1C2P A;  4AND A;  5HAN A;  1ICE B;  1XN9 A;  4DL4 A;  4M63 A;  1AYE A;  1FWP A;  3DLK A;  1Q95 G;  1WDD A;  2LLZ A;  3D68 A;  3PR5 B;  2OPP A;  1MNE A;  1MU2 B;  4L74 A;  1KDN A;  2P9C A;  2XZD B;  2DR8 A;  4DG1 A;  4X64 F;  5JVG Q;  3HI9 A;  3FCV A;  5GAD I;  4M95 A;  4E2F B;  4U7C A;  2DRD A;  3CCZ A;  2EXU A;  2MY8 A;  3FJ2 A;  2W9C A;  1YKW A;  1FD2 A;  4IOC Q;  4OJH A;  3K5N A;  2XWX A;  1TKZ B;  3FKB A;  4ZP8 A;  2LA4 A;  1MW7 A;  1Z2Z A;  4NE9 C;  3QZ8 A;  4HTI A;  2BAN B;  2Y3Y A;  3LWL A;  3I0S B;  2EK6 A;  3GFZ A;  4UZB A;  1DAX A;  3PTW A;  4PZV A;  2VQF F;  5KG5 A;  5KFU A;  3GJR B;  5IM0 B;  2R7T A;  3M7V A;  1TVR B;  4XDD A;  1MN9 A;  1Q0N A;  3CMQ A;  4L6V 3;  1SBR A;  2IM2 A;  2NXU A;  3IO1 A;  2D3O R;  4USU A;  2E1R A;  5F41 A;  2JEJ A;  3OFF A;  4C48 A;  3IBW A;  2PA3 A;  1QY7 A;  5J1E B;  2H65 B;  3IA0 A;  3R5C A;  3IXQ A;  1NAQ A;  3WIU A;  3JSM B;  2VF3 A;  1IR2 A;  5IC4 B;  2W01 A;  2OH2 A;  1H38 A;  1KTV A;  1FRK A;  2CPI A;  4X4S A;  2BA9 A;  3AD8 C;  4F3Q A;  2PMH A;  3FQK A;  1RTZ A;  4GC6 A;  4EZ6 A;  2WB1 D;  2YY3 A;  2MEW A;  3FZ2 A;  3AXK A;  5EWF A;  2L9N A;  3OT9 A;  3SFG A;  2V4J A;  3VWS A;  4Q7A A;  2HQI A;  2V94 A;  4EBE A;  1U2R A;  2NXN A;  1MML A;  3VVT A;  2WON B;  2D9P A;  2XMM A;  2U1A A;  4CNY A;  4J90 A;  1HNV B;  5DS7 A;  2YWG A;  2LQB A;  5C5J A;  2F65 A;  2VC0 A;  2NPF A;  3BS9 A;  3ETM A;  4OZN A;  5DO2 A;  3L4B C;  3JSY A;  1VJQ A;  1WDT A;  2QLW A;  2FY1 A;  2C22 A;  1HL6 A;  2KFZ A;  1IKY A;  4J91 A;  3ILO A;  1WAC A;  3P4U B;  2VJU A;  2R7S A;  2WW8 A;  5GMD A;  4YR3 A;  5HLF B;  4M5G A;  1Q4R A;  3T1A A;  4F67 A;  3HVT B;  2B51 A;  2YWK A;  3HHD A;  3WQP A;  5KFV A;  1KN6 A;  3MFI A;  5J2M B;  3SDE B;  2GNK A;  3G6X A;  4Y6I A;  1CJV A;  1RCO B;  3A8E A;  3TEG A;  2VON A;  3HVW A;  3MPV A;  3PEJ A;  5HO4 A;  1TUV A;  1GMV A;  3W5Y A;  4DN9 A;  1YRX A;  5CQG A;  4DFK A;  2ZJR Q;  2WBR A;  2GJI A;  3K17 A;  3J80 Y;  4M94 A;  3DOL B;  1NDC A;  3KLE B;  4ES3 A;  4OYP A;  4ENO A;  5E7O B;  4USK A;  4DR1 J;  3OUY A;  2WTF A;  1UZH A;  3I56 S;  2HQG A;  4ZVS B;  1DTQ B;  2J0Q D;  2MKY A;  3MUR P;  4LFC F;  4L3K A;  4MIB A;  3TYT A;  4LIR A;  4B3O B;  1YZ6 A;  5I3P A;  3KJQ B;  4O44 A;  1XQI A;  5GMK a;  2I0X A;  1EB0 A;  3D5M A;  2ZJP Q;  3NGR A;  4FZV A;  4OX8 A;  5E2Q A;  4WKR A;  4I2Q B;  4WII A;  3C15 A;  1FJ7 A;  2VQE F;  3IC1 A;  3UVJ B;  5LSL A;  3M6W A;  2ZHO A;  3M32 A;  1C0T B;  1RWO B;  3IGV A;  2Y0B B;  4RLE A;  4DOZ A;  2HHP A;  1S1W B;  1NRK A;  3S8S A;  3R5J B;  4NOH A;  3RYL A;  3M8R A;  2AWZ A;  3LGM A;  6AT1 B;  2JOQ A;  2RRB A;  4E8U A;  3UE2 A;  1DQ9 A;  1FXD A;  3NNH A;  1S9F A;  2JEG A;  3DU5 A;  4KKO A;  3CDU A;  2BKO A;  3BN4 A;  1OQ3 A;  4B3T F;  3IAS 9;  5HRO A;  1NLK L;  3HSJ A;  3SXL A;  2W9B B;  4F4K A;  4F3M A;  4OV1 A;  4RO0 A;  4URS A;  3CXC R;  1SKS A;  2OGU A;  1S6U A;  4CZC A;  4QWC A;  1CJK B;  5B0D A;  2CQB A;  2D74 B;  4IRK A;  4IRC A;  1HPZ A;  3T3F A;  4J9R A;  1TMM A;  3J7Z 5;  2WK4 A;  3I4P A;  5KFF A;  2OJ3 A;  1HNW J;  2M2B A;  1SH3 A;  2VUG A;  3CCW A;  3FBF A;  1WUU A;  4LF8 J;  4L73 A;  1LOU A;  3CED A;  1NSK L;  4QIE A;  3PR4 A;  1WHY A;  2DIT A;  1PAU B;  3BBF A;  4J37 A;  4E0D A;  3RB6 A;  1VRQ C;  3MAQ A;  1YIT S;  3E3X A;  5CAB A;  3NCQ A;  1T9T A;  1RHR B;  4UOG A;  4X2B A;  4IFV A;  4A4J A;  3GG0 A;  3R1H A;  2KL8 A;  2QV6 A;  2FDN A;  5L1K A;  4K2J A;  3V4I A;  4L75 A;  2XSJ B;  3DU6 A;  4ZCM A;  2IPO B;  1BWV A;  2VG6 B;  1T95 A;  5LSO A;  1AFI A;  3PKY A;  3ISZ A;  1T03 A;  1YQH A;  3O5T B;  1ZBT A;  5DM7 Q;  2HMI A;  1NJW A;  3G9C A;  4J9Q A;  3KG4 A;  1IN0 A;  3L3C A;  2HS4 A;  4K4U A;  4B3R J;  3EM1 A;  4JI7 F;  1WC3 A;  4Y2A A;  1PIE A;  4KFB B;  5I42 A;  1U24 A;  1U4B A;  3SCI E;  1N34 F;  2FHO B;  3W61 A;  3J7A N;  5SZT A;  1Q8I A;  2VBW A;  1LV5 A;  1IR1 A;  2HFO A;  5D0H A;  3S7R A;  2QA2 A;  5DET A;  2WBM A;  4YY3 J;  3I31 A;  3G82 B;  3VAM A;  4FKY A;  3DHX A;  4OYO A;  1U1L A;  2R8G A;  3OXL A;  3EDQ B;  3W66 A;  3D6H B;  4X66 J;  1A0O B;  4NLO A;  1B0P A;  4NRU A;  4RW7 B;  1EAR A;  4CCH A;  3UNY A;  2MLY A;  1XIQ A;  3Q8Q B;  3HK2 A;  1OY9 A;  4PRF A;  1YBU A;  4O23 A;  4YN3 B;  3HJV A;  4RNN A;  1VBY A;  1EAY C;  3UDC A;  2X3G A;  4BLG A;  1LWF A;  2CPZ A;  3KK3 A;  3M2U A;  2N4C A;  1FO1 A;  2ALZ A;  1WI6 A;  4RW6 A;  2CVE A;  3RR7 A;  2LQ8 A;  1ZAV A;  5H9F K;  2H9Z A;  4PWD A;  1YJW S;  5JMN A;  1REV A;  3U7J A;  1UW4 A;  3FMB A;  4B3M F;  3DLK B;  3A3O B;  4DV3 F;  2HZV A;  2KXH A;  2YH1 A;  1RLC L;  3QWP A;  1X31 C;  2OPP B;  2BUN A;  4M5K A;  4EWT A;  4NRT A;  5IFM A;  4A8M P;  4DG1 B;  3KG0 A;  2MXY A;  3I55 S;  4J7C A;  4B9L A;  3EIC A;  2ZDP A;  2FB0 A;  2ZVS A;  1K47 A;  3D9B A;  3M8Q A;  1VIX A;  2D3Z A;  1Y5L B;  5FDL A;  3SSS A;  4FF2 A;  2W9C B;  2KZZ A;  3CJR A;  2HS0 A;  4GKJ F;  3ZTS A;  3G8S A;  1ZS6 A;  2PDA A;  3POT A;  2G1D A;  2BDP A;  3RAQ A;  1SJ3 P;  2YKA A;  1NSA A;  2G4B A;  3DRX A;  1ZZF A;  2CNN B;  1UAW A;  4ZP7 A;  4LFA J;  4P72 A;  3C6T A;  1NZ8 A;  4H54 A;  3JQJ A;  2V8V A;  3JTO A;  1FVQ A;  3TA0 A;  1JNZ B;  3AHP A;  3BDP A;  4EBD A;  2BYC A;  4O3S A;  2R7O A;  2H5J B;  2FC8 A;  2GAG C;  5B08 A;  3NGU A;  2E44 A;  2FGC A;  2DNQ A;  3MCO A;  2YVS A;  5ETQ A;  1HWK A;  2UXB J;  4DUY F;  4USW A;  1CEZ A;  1XTZ A;  1KVI A;  3JYT A;  2CJY B;  4C6A A;  3RB4 A;  2V63 A;  1HWI A;  4M5N A;  3SIP B;  2D7S A;  2ASJ A;  1U6F A;  3CCR S;  2DXF A;  2KTQ A;  3FDS A;  1RWV B;  4QR2 A;  1KWM A;  4KE5 A;  3WIV A;  3FK4 A;  4BC7 A;  2LP4 A;  1U25 A;  4YHH J;  4U8Y A;  1LK7 A;  4NAS A;  4JB8 B;  2V4J B;  4OLO A;  2ZZT A;  2MST A;  4WF9 Q;  3H20 A;  4U6P A;  4JV1 A;  1BC6 A;  3E2E A;  3EVO A;  4ED8 A;  3LAM A;  3MM7 A;  3DLL Q;  1WSR A;  1NK4 A;  4KR0 B;  4P6Q A;  4X4T A;  2BXJ A;  3HMJ G;  2FHM A;  1FWL A;  2RF2 A;  4WCE Q;  3VAH A;  1X8D A;  3GIL A;  3JQK A;  3SSR A;  3QJJ A;  3TRG A;  1FRL A;  1DJ0 A;  3TX0 A;  1YG0 A;  4Q0B A;  3FEX B;  1IKY B;  3DLJ A;  4YQW A;  1RDR A;  1S1U A;  1Q7Y T;  2FVQ A;  3QIP A;  1D9F A;  5FII A;  2L08 A;  3U1N A;  1RT7 A;  1TL7 A;  2JNJ A;  2JZ5 A;  3HHL A;  1XNQ J;  1WI8 A;  2A0F B;  5DRK A;  3IS9 A;  2AZ1 A;  5M2R A;  1HBO A;  4AXI A;  1K73 T;  1FE4 A;  4UY8 5;  2ZH8 A;  4KHM A;  2K7K A;  1V5V A;  3U02 A;  3P5T L;  4I7F A;  1NBE B;  4J9U E;  2HBQ B;  4KPC A;  4JUZ A;  3K59 A;  2WRM A;  3RRG A;  2H54 B;  2CPJ A;  3O8W A;  3Q8U A;  5DQH A;  2M9K A;  4RJV A;  5KT6 A;  1FI4 A;  3OHB A;  4LF7 J;  1GT8 A;  7FD1 A;  5AE2 A;  4DV5 J;  1YJ7 A;  2M3D A;  3KMQ A;  4ZPT R;  2BVZ A;  2C2N A;  4NLW A;  4CO5 A;  2RVJ A;  4OZ2 A;  2DNH A;  2WSC C;  4RW9 A;  2CPX A;  1YK9 A;  2Z57 B;  4QIW D;  1RWU A;  2DH9 A;  3OTB A;  2K8G A;  2N7C A;  2RJZ A;  3EVW A;  4AL6 A;  2E7X A;  2X1A A;  5EUH A;  4O44 B;  1W26 A;  1HD0 A;  4B3S J;  4DQP A;  4MFB B;  3GTY X;  4QR1 A;  2P2C B;  3ZNU A;  5IZH A;  3JTN A;  5DGB A;  3R1L A;  2B5J A;  1I94 J;  2HBR B;  2UXD F;  1R6Y A;  4NXN J;  4LBH A;  3PZP A;  2BJ9 A;  4FS2 A;  1N52 B;  5K20 B;  4DPY A;  2DR9 A;  2AT1 B;  3M32 B;  2HHV A;  3C3L A;  5AJ3 J;  1TKX A;  3TVY A;  4DR2 J;  2BAC A;  1G3O A;  1SB6 A;  1WNE A;  1FJG J;  3UCG A;  1HW8 A;  1SJF A;  1JMT A;  4P2S A;  2BRK A;  5C42 A;  1JJC B;  1S1T A;  5CZV A;  2C2K B;  1NJY A;  1RTD A;  4C0H A;  2R8I A;  2ZM6 F;  2DR5 A;  4AL7 A;  5CCL A;  2XMV A;  2UVV A;  4DCJ B;  3Q8S B;  4KKO B;  3MEG A;  4LQ9 A;  4ZLN A;  3SCK E;  2OSQ A;  5HRO B;  4OZ1 A;  3RZA A;  3M2V A;  1KHV A;  2HQF A;  2YNI B;  3G86 A;  4PKD B;  5LSR A;  2Z2Y B;  5KFK A;  3J7Y U;  1S76 D;  5K8O A;  2QZ8 A;  1N33 J;  4EFA C;  1UA0 A;  3R5B A;  1FEH A;  1R8B A;  2W4P A;  3DRP A;  4O3N A;  1HPZ B;  2CPE A;  3IG1 A;  5I3U B;  4JI1 J;  4J9N A;  3BR8 A;  2DXD A;  4K2X A;  8RUC A;  2W2M P;  4NA2 A;  1XMO J;  1DQ8 A;  3H25 A;  5HSP A;  4LRA A;  2FUG 9;  1IBM J;  1FWK A;  3D1H A;  1WOR A;  3VAI A;  3T19 A;  3MMC A;  3OV7 A;  1WHW A;  3B8H A;  4EBC A;  3HP6 A;  3CCU S;  1K1Q A;  5KFP A;  4HHJ A;  1DFD A;  1RT4 A;  2OHD A;  1FDN A;  2JEI A;  3HKW A;  4DV4 J;  2XS7 A;  2NUH A;  2H5E A;  4CLU A;  2YKP A;  2G2Y A;  4IFV B;  2MZR A;  4MKV A;  4U67 Q;  4JI5 J;  1BQX A;  2KU7 A;  3UQS A;  3V4I B;  1UMJ A;  1RT6 A;  4OFZ A;  3SFU A;  4NL5 A;  2DNM A;  4B9T A;  4X65 F;  3P45 B;  4FYW B;  1T03 B;  2ZNY A;  4DWI A;  2FC9 A;  4HI2 A;  1RTI A;  2IVF B;  4DV7 J;  5G4D A;  4X4U A;  2HMI B;  1D3W A;  4KGM A;  2XB2 D;  2J6S A;  4WZQ A;  3R6G B;  1JNR B;  5GAH U;  4XDC A;  1VOM A;  1HHT P;  1M5K C;  2X1F A;  2DEI A;  1N5V A;  4ECZ A;  8AT1 B;  5I42 B;  4JYA F;  1HI0 P;  4DR5 F;  1T9Y A;  2CQG A;  2VD3 A;  4LBI A;  2K7J A;  5GAE I;  3T1Y J;  2DNZ A;  3V6D A;  2IBO A;  2UUB J;  1TL1 A;  1ZYQ A;  1J5E F;  5ETL A;  2KB2 A;  2BBE A;  2DH8 A;  2KN4 A;  1N0U A;  2ZH1 A;  2ZD1 A;  3R97 A;  4OYB A;  3RUB L;  4YB6 A;  3K58 A;  1HD1 A;  3N5F A;  2RRA A;  1KFS A;  2PT0 A;  2CNK B;  5HQ8 A;  1TZ0 A;  2FJX A;  3VQT A;  4Y34 A;  1UFW A;  2VIH A;  4HHH A;  2E5I A;  1JKH A;  1RTH A;  5A2Q U;  4ZKA A;  4BDP A;  4ZPV R;  3J81 j;  1WG1 A;  1LWF B;  3KK3 B;  3M2U B;  1VBZ A;  3H59 A;  1YIJ S;  1AXQ A;  3PIO Q;  3H5U A;  4CLK A;  4RW6 B;  2GQQ A;  4LF9 J;  3MI7 X;  4P2X A;  3VAG A;  2C1E B;  4JP8 A;  1IBK F;  4PWD B;  1TU0 B;  1EQ0 A;  2IRU A;  1REV B;  4DV1 F;  4GC7 A;  9RUB A;  3A12 A;  3ENW A;  3W8G A;  3N9U C;  5KAK A;  2N4D A;  2PEB A;  3MD1 A;  2AEJ A;  3DMJ A;  2RU3 A;  2ATL A;  3US5 A;  4FBU A;  3FGV A;  5C24 A;  1N0V C;  2RQK A;  3M8Q B;  5FDL B;  2E29 A;  3RBE A;  2CNL B;  3HZG A;  2HNY B;  3POT B;  4C8O A;  2OO4 A;  3R2D J;  2DGS A;  3OTE A;  2DY9 A;  2JWN A;  4IOA Q;  1D09 B;  3C6T B;  3NY0 A;  1LWC A;  4RNO A;  3IBF B;  2VJV A;  2XLK A;  4HT7 A;  4YOE A;  4LF6 J;  2EKY A;  1ZM2 A;  2WVC A;  2NYI A;  3P8B B;  4CO4 A;  3K5O A;  4CT9 A;  2HWH A;  1X4D A;  3DOM A;  3BBC A;  3BKF A;  2MYF A;  2GO9 A;  3GJS B;  1T9U A;  3WX8 A;  4YUD A;  4PPD A;  1N5S A;  2L3M A;  3ZTR A;  3GR1 A;  1N4L A;  4X4V A;  3TEH B;  2QFI A;  2CG4 A;  3JYT B;  2AEM A;  2HFV A;  2CZ4 A;  3TQ1 A;  4FYV B;  5EX3 A;  5HBM A;  3KYL A;  3W62 A;  2YWF A;  3PV8 A;  4FXD A;  3I32 A;  3S6E A;  2F5G A;  1ZA1 B;  3BRE A;  3I5A A;  5DZ7 A;  1I6J A;  2WSE C;  5DDR C;  5KFH A; 
#chains in the Genus database with same CATH homology
 3HSD A;  1EQM A;  5ETT A;  3KUG A;  3HCX A;  3UDV A;  5ETV A;  3MCM A;  4M5G A;  1RTZ A;  1TMJ A;  4M5K A;  4M5J A;  3HSG A;  4PZV A;  4CRJ A;  4M5M A;  4F7V A;  1HQ2 A;  1KBR A;  3QBC A;  5ETM A;  3IP0 A;  3UD5 A;  1G4C A;  1EQ0 A;  2F63 A;  4M5N A;  1IM6 A;  1DY3 A;  1F9H A;  3KUH A;  4M5L A;  3HD2 A;  3HT0 A;  3ILI A;  3KUE A;  3HSZ A;  4M5H A;  5ETP A;  5ETK A;  5ETN A;  1RU2 A;  5ETO A;  3HD1 A;  3ILO A;  4CYU A;  4CYU B;  3MCO A;  3MCN A;  1RB0 A;  4M5I A;  2F65 A;  2CG8 A;  5ETQ A;  1Q0N A;  1RU1 A;  2BMB A;  1RAO A;  1HKA A;  3HSJ A;  1TMM A;  3ILJ A;  5ETL A;  5ETR A;  3ILL A;  4CWB A;  1EX8 A;  2QX0 A;  3UDE A;  4AD6 A;  1CBK A;  5ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...