3QSIA

Nickel binding domain of nikr from helicobacter pylori disclosing partial metal occupancy
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
ESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NikR nickel-responsive regulator
publication title Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 19
structure length 80
sequence length 80
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3qsiA00
2WVEA 2WVCA 2HZAA 2BJ8A 3BKTA 2CA9A 1Q5YA 3BKUA 2F1FA 2BJ9A 2Y3YA 2CADA 3QSIA 3LGHA 3BKFA 2PC6A 1Q5VA 3OD2A 2CAJA 2FGCA 2HZVA 2BJ7A 2NZCA 2BJ1A 3PHTA 2WVDA 2WVBA 2BJ3A 2WVFA
chains in the Genus database with same CATH superfamily
1RA6A 3CCWA 3GILA 5IS2A 1RWNB 1AUSL 2WZ1A 4YS2A 4JI7J 3DHXA 4A4JA 1XBWA 5B0FA 2J6TA 2VBYA 1SJRA 1MMNA 2CNLB 4I2PB 4LFCJ 3D6HB 1B99A 4IO9Q 4YHHF 1DAXA 4DS4A 3ZZRA 3NRBA 3IR6B 5DETA 4LF2A 3TOQA 2IAJB 4LFBJ 1XNRJ 2H9ZA 3R5BA 2WB1D 1T9YA 4NLRA 2YKNA 2CQGA 3K7RA 4C0BA 1VQ5S 3ISNC 4Y00A 1UVLA 4WBFA 4R5PA 4R25A 2Y9HA 4AT1B 3SZ2A 3GMGA 3JS9A 4WFZA 4ED6A 5B7WA 3W2WA 5BR8F 1WHYA 4OZLA 4A8WA 3DOLB 3NNAA 5JVHQ 5F8JA 1HARA 3Q8PB 3LO3A 1TL7B 5HROB 3HHLC 1IKXA 2YPYA 3PW5A 3KHRA 3LALA 5K8OA 1H2TZ 4RBUA 4ZJQA 1YQHA 3R27A 3BO4A 3TAPA 3IWNC 3RBXA 3CCZA 4FS1A 3DDKA 1JLEB 4P74A 4A8KA 3H2UB 3AHPA 3SBMA 4JV2A 2UUAJ 3EE3A 1RDRA 2PI5A 2HHQA 1CS4A 2VF3A 5KG6A 1U45A 3C8YA 4P2XA 4ECVA 1RADB 3D54A 5D0HA 3UWTA 1HYSB 2GVZA 3WC0A 1SI9A 1D0EA 1YJ9S 4MIBA 2BV3A 3GFXA 3U1NA 1U1NA 3PCOB 4OL8A 4ES2A 3I6PA 3P5BP 1RKJA 4NA3A 5D0EA 1SKUB 4MIWA 1EB0A 1SJ1A 5D4OA 2VFRA 3M2RA 1S7HA 4OHZA 1RTIB 3TX8A 1FJEB 2VOOA 4LF8J 5IC6B 2HW3A 3HJFA 4C8OA 3MEEB 3UDEA 3PX6A 2IAJA 2RF2A 2WB4A 4CYUB 4Q7AA 3G8SA 3HKWA 4JP8A 3QMQA 3EGNA 3LWLA 3QT8A 3BBCA 2NZ4A 2RU9A 4Y2IA 2ATCB 2M8DB 1T0TV 2ZH2A 1LW2B 4ZHRA 4HKQA 3IS9B 2WW8A 1NRKA 2GIQA 2BQ3A 3IRWP 3H5YA 3ZZPA 2V63A 1HQ2A 4KHRA 2KI2A 2VG5B 3DOLA 2NYIA 2MQPA 1VQ4S 3PR4A 3KHLA 1PJ7A 1VQLS 4DLGA 3BQ2A 1KHWA 1Z2LA 1YZ6A 4YB1P 3CJ0A 3MMBB 5HN0A 1FFSB 4OV1A 1U0HA 2HMIA 1M5PC 4OZ2A 2EFVA 3HKZD 1WC6A 2CNOB 4CH1A 4DDFA 2YQ1A 2JVOA 5FD1A 1REVA 3SCKE 1N5QA 3C66A 3PNIA 5F0WA 3C6UA 3ZTQA 2LQ9A 2Z56B 3FCWA 3Q8SB 4ELUA 1HYSA 4FBTA 2W7OA 4ECRA 4ED0A 2WONB 3RB6A 1JKHA 2E5LJ 4DBQA 2FVCA 4EYHB 4NCGB 2X3GA 5C25B 4GO5X 3MM8A 4OYZA 1JIHA 2XLJA 3TAQA 2VV5A 1T8EA 5BR8J 4UQTA 4USJC 7FD1A 1RHMB 1HLWA 5HLFB 4B3MJ 2ZVSA 4UZCA 4LR9A 4WK1A 3K59A 4OQJA 2P2CB 1F2HA 2VQFF 2ILZA 1SL0A 3H4BA 1XR7A 3EVMA 1C0UA 4A8SA 3CMAS 3HCXA 4CYUA 1TMJA 2BJ8A 5DG9A 2Y8WA 3P3DA 3DMJA 2I5JB 3FK4A 5J2NA 4ZK7M 1RTDB 1BUXA 3A3OB 3TEHB 2RQMA 4OZ3A 1YSJA 1ZM2A 2RH3A 2GHWA 5MAOA 1K0TA 4JV0A 4PXEA 5B0BA 2CYYA 2XMJA 4RW6A 4NLSA 2FVSA 1OWXA 3PEHA 3MDFA 4DSFA 1WF0A 1U6BA 3JB9k 5A8KA 3T1YF 1E6VA 4AUKA 3POTB 1DTTA 3B8HA 4L72B 1S9EB 1XR6A 3M30A 4V19X 1UVIA 5K20B 1VJWA 1CJVB 2V4JB 3PHEA 4LF6J 3SV3A 4ICLA 1S0OA 4GKKJ 2OEKA 3QJLA 1AYEA 3C15A 3G8TA 3KLIA 4UZBA 4TY8B 3H5UA 3HF5A 2VPYB 3ICLA 1NHUA 4XO0A 3BF4A 1SBRA 2VA2A 5ETNA 1KC8T 1CG2A 5ADZA 2YKMA 3V6HA 1C1BB 1LQ9A 3BPSP 1H38A 2JHEA 2OGUA 3VHQA 2H48B 1X9MA 2OHDA 9RUBA 2BVZA 4CLLA 2FGCA 4G1QA 1B7FA 3K89A 1AUDA 2YNFA 2I38A 4MK8A 2XQCA 4DR4F 2L08A 2BZ2A 1RWMB 3IRXB 1UVMA 3SV4A 3UVJA 5A76A 2JEJA 1N52B 3P45B 3MR6A 1RTDA 2Q43A 2J0XA 1VQ8S 1FNMA 3BM7A 3G8QA 2JJ4D 4IDKA 3I82A 3KJNB 3HLUA 4RW4B 3JTNA 1T9UA 4B3SF 4M5KA 2AF6A 2KH9A 4ALZA 3MPYA 5E3QA 4ILMA 4ID8A 1OIAA 2C2EA 3TJ9A 5KG2A 3NGRA 2ZH6A 2C3PA 1YKWA 1UKUA 4PXCA 2FJBB 2HK2A 1LOUA 4RX6A 5KFFA 2VJUA 1N32J 3MFIA 2Q6CA 2I1RA 1RWVB 3LWMA 1LWFB 2CPZA 4TY8A 2F9DA 2EW9A 3QQCD 4C3KA 5HQLA 1R3NA 2HFUA 2ACMA 2UVRA 3IC1A 3R6LB 2EFNA 4J9RA 3I0SB 4WF9Q 3DGVA 3KG1A 1KWMA 1FFGB 5MLCV 2YKAA 1IM6A 1U1OA 2RQ4A 2QG9B 4NLUA 1Q7LB 4GO7X 3EGZA 1HBMA 4P7TA 3CXCR 4WZMA 2VKZG 1F3VA 4OX9F 5HVFA 2MSTA 1M90T 4LSLB 4NLQA 4NRTA 3IGNA 2V8PA 2FJVA 3V6JA 2Z8QA 3ZTRA 2XTJP 5GMDA 3QJJA 1WELA 1RU2A 5LSOA 2K1RA 4PG8A 4ZA1A 1X5OA 3HVRA 3DM2B 1MU2B 3IM9A 2HK3A 2J6UA 2JNJA 4EBEA 1S0VA 4RNHA 1WDDA 1FRJA 1VIOA 4DR5F 1PIEA 4NLOA 2KHDA 3H2VE 2V8DA 5B0DA 5AXLA 1X4AA 4J9UE 3GJQB 3K17A 3CC2S 1QAIA 1UFLA 3T6BA 5CQGA 1ICEB 1X0PA 2YQ3A 5CH7B 3F41A 1RZMA 2ZEJA 4PEOA 1CJTB 2D69A 2PA8D 4P71A 3VTIA 2JLEA 1H2UX 2HGMA 2W7PA 4FF1A 1RXOB 3GIMA 1GMUA 1U02A 1VHFA 1LWFA 2ASDA 4J9MA 4O23A 2KTQA 4LF9F 1EZZB 1KQFB 3V81B 4QIFA 5C42A 4N77A 1U0SA 4S0MA 4B3SJ 2AZ3A 2J9CA 2QA1A 2CWXA 3IAS9 3VALA 5HBMB 3VWSA 5DDQC 3QAUA 2AGPA 1RGVA 3PACA 4WKYA 2ILYA 3MR5A 2LEAA 1FRHA 1VQOS 4B9VA 3SMZA 1UFKA 4LSLA 4KQZA 3CDBA 4NZ7A 3EXYA 2YQ0A 4WP9A 1S6QA 4AXJA 2RNEA 4Y34A 3ENVA 2ZH8A 1KEKA 3FJ2A 2B3TB 4ILRA 4CNYA 3DM2A 4FKYA 5DQHA 1MU2A 3P49B 3CD6S 1WEZA 4FZVA 5THWA 2AYBA 2CQDA 4NEZA 4B3OB 3E01A 2I6WA 2HQ3A 4LUBA 2OELA 3UQSA 1FESA 1Z2ZA 2JC0A 2LA4A 1AFJA 4Q2MA 3HD1A 1YRUA 3R5JB 2WCXA 3B82A 3KNGA 4G1PA 1PILA 2W2QP 4DG1A 4YB7A 4ENOA 4AYBD 3LP1A 2QN6B 2MY7A 1YJVA 2ATLA 1UJ6A 4OYIA 3D28A 4ID5B 1DLOA 4CQ1A 3IBCB 1FXLA 2BOPA 3MXHP 1RB0A 4RW8B 4NYPA 4YDDB 1CJKB 1TKZB 1PBUA 2FVPA 4H4KC 1Y7PA 2Z30B 3UDVA 2LEBA 3Q22A 1IKVB 2XSJB 3MCNA 3HM9A 1B0PA 1RLDA 2UVUA 4DR5J 5E3PA 2DISA 2CUYA 4NLGA 3I4PA 3J7A1 1N54B 2MZSA 1N5VA 3JYTA 1TKTB 3NBPB 1FT8A 3PYEA 5KFKA 2MXYA 5ITHA 2OI2A 2CPEA 2IM3A 2EC0A 5IOLA 2E1RA 2HHVA 3FEZA 4F67A 3NNHA 2CZ9A 3BGRA 3BKFA 3KJVB 2NR0A 2PN6A 2E7XA 1WOOA 1LV5A 3SDEA 3W5ZA 5IZHA 2V8HA 2LCWA 4ZPAA 5AT1B 5KFIA 5ETMA 3DYAA 1FDBA 3DRRA 5RUBA 3M2VB 4JI0F 3W8PA 1N0VC 5KFTA 5IV3A 2ZOGA 5B08A 3OLBA 5DDRC 1J5OB 2COLA 3T5HA 2HQGA 3NEKA 4RU2A 4KO0B 4QOTA 4DZDA 3FRYA 4Y65A 4F4ZA 4WFAQ 4A8XA 2B6AB 3DU5A 2HPUA 1HNXF 4FYDA 1GXUA 4ELTA 1HHSA 3MM7B 4O3SA 1JNZB 1NSAA 4WU2A 4UTGA 3CE8A 2QJ3A 4RW8A 1REGX 1JMTA 5H9FJ 2K7JA 2XLIA 5HSPA 2GCFA 2QLWA 5AE3A 3MCSA 1Q5YA 2W2NP 2F40A 1RT2A 2XMMA 1A0OB 1F6TA 1SKWA 1S10A 2ZJQQ 1IVZA 2RB7A 2CJKA 3ET6B 2VPWB 2F8HA 1WTFA 1RT4B 3MM5B 2RRNA 4ES3A 2BR0A 3KWMA 5IT0A 1S6PB 3GR1A 1KLNA 3RG6A 3GYXB 2MQNA 5K14B 4ECYA 4YY3F 2VFTA 5KFXA 4O3QA 4I69A 4DR7F 2XCAA 2CRLA 2BEFA 4ZCKA 2GA7A 4USIA 1V5VA 4B3TF 2UXBF 4B9NA 3U02A 4NE9C 3MPVA 2CQ1A 1F60B 1W7WA 3HHNB 3GQCA 3G82A 4ETXA 3LGMA 4OZNA 5B0AA 3RYLA 5KFQA 3M2VA 3CJQA 3NGUA 1MWYA 4A47A 3OL9A 5AE2A 4JI6F 3KMSA 4I0WA 3EZOA 2MEWA 1R27B 3FFIA 1UPPA 1ZA1B 1EJ7L 2IRUA 4X4SA 2GV1A 3BGLA 4DL7A 1VQ6S 2N7CA 4QCLA 2F9JA 1YLXA 2ROGA 3J81Y 3C2PA 1IKYB 3BYPA 4URQU 3ZTPA 5KFAA 4I68A 1Z1ZA 3MURP 4X2BA 3V4IA 4CI0B 1MG7A 2CAJA 1T7PA 2XLKA 4C2MA 5DDPC 3OBIA 2LFVA 4B9LA 3HZEA 3M8RA 3M1VB 5LMNF 2DR9A 2JZ5A 3R6GB 1CC7A 2OPRB 5E33A 5EWEA 5EX0A 1D8YA 4KY3A 3IXQA 2YX4A 1YTYA 1TQLA 3ULHA 1H73A 4JI0J 2LXFA 1VLYA 3OFEA 4TN2A 1BWEA 5KT2A 3N0VA 1S6PA 5KFGA 1S1TA 1RWKB 1VGYA 3BDPA 3W2VB 1H2VZ 1OSCA 2XS2A 4AE5A 4DR6J 1QVGR 4LVOP 2XWXA 1B3TA 2KZMA 1HHTP 1ZOTA 2UV8G 3D68A 1NJYA 3CF5Q 4WXWA 1V3SA 1HBUB 5KFYA 2ZC3A 1FRMA 1ZPVA 1KONA 3AXKA 3FRZA 4QR1A 3GZ7A 4LVNP 2HVHA 5CD4H 3BSOA 3D3BJ 4FKXA 4DN9A 4ED1A 4DPYA 2DH7A 1NZ8A 3DGPA 2XCPA 3IWXA 2FHMA 1JLBA 2MB0B 2B9XA 4AL5A 5HMXA 3VAFA 1RWOB 1UWAA 4FNHA 4J91A 3SEOA 4TYAA 2ZBPA 3AXMA 4LF4J 3EX7B 4DFPA 1GX5A 3VQSA 1LWXA 2DHAA 1YVFA 3KYLA 2AHOB 4NZ6A 1Q5VA 1S1UB 1WI6A 2WOMB 4HT7A 4P52A 2DXEA 3QFWA 4B3TJ 1GAOA 2UXBJ 1N5SA 2HBRB 5AXNA 2BKPA 2HHXA 4PQUA 3O8WA 2W01A 2E5HA 2HVZA 1TELA 3JAMY 1Y10A 3THVA 2D9OA 1RHKB 3R1HA 2J0WA 5BXIA 5KAKA 3RJMB 5AE1A 3PM9A 1VJQA 3I5AA 1LW0A 3EVOA 3N6MA 3T19A 1SH0A 2OTLS 4KGMA 5D78A 2UUWA 5GAEU 2FZGB 2GQ2A 2QMWA 4JI4F 4YB5A 1HMVA 4U7UD 2V9KA 2Q6BA 2IM2A 4A8QA 1NCLA 2H3EB 1UCNA 3UE2A 3GCWP 1HIYA 2GGPA 1XERA 2F4FA 3GPAA 1RP5A 1HBUA 2CIMA 2F4VF 2AYGA 1NKCA 4JYAJ 1JX4A 4CO1A 3RRHA 4CO2A 3KFWX 1OYEA 3D6TB 4OX6A 1MW7A 5KFLA 4Q5VA 1SXLA 1M0SA 3MF5A 3C14B 2EC2A 5D3GA 5HO4A 1FNOA 4RNNA 2QO3A 5LMNJ 2O66A 2JWNA 5L39A 4LSNB 2RMLA 2LU1A 3DKDA 1RT1A 3GFHA 5C7PA 1FEHA 1JLAB 1J2VA 1YITS 6AT1B 3OUYA 3D0IE 1UAWA 1GEHA 1G2EA 4CLYA 4U7CA 1S79A 4LFAJ 3S7RA 3LPEA 1NPRA 3OJUA 3EGVA 1HWKA 4UT4A 1GQEA 4YR3A 3R5AA 3IP0A 2J9DA 3V5RA 2IM1A 3UPFA 3T1HF 5A6WA 2WOMA 4TU8A 3GP9A 3BO3A 2AX1A 2V50A 1WG4A 2RDDA 3PVXA 1TUGB 4C6AA 2MKKA 4USTA 1WOPA 4A8FA 3V6KA 4AXIA 2DR8A 3NCQA 1VBXA 2OUGA 4DU8A 4JI1F 1A9NB 2FC9A 3ILJA 4WP3A 4YEAA 4EMDA 3CT9A 1MSWD 4BCAA 2GJ2A 3H98A 2KKHA 3BGFA 1Y3KA 2AX0A 2PGCA 2MGZA 2GIFA 3EGWB 2KYXA 2HQCA 4J9NA 5KFVA 2RAQA 3KNAA 2DGWA 4IKAA 2HG4A 4DPWA 2DNHA 3UN5A 2QT7A 1ULRA 3I9V9 3AJ2A 1YI2S 4HVZA 2AEJA 3QJPA 3C6TB 4C3LA 4DUZJ 2VFUA 3JSMB 3MEGA 1TR0A 4DUYF 3LP2B 4GKJJ 1H74A 3FCVA 3OFHA 1UETA 4HHHA 1ZZFA 2B8QA 2HBQB 3QAEA 1NJIT 3MOJB 3D0GE 1P6TA 2YNHB 3SQGA 2VKRA 3DDIA 4MKVA 5A8WA 3CGIA 4NEYA 1HBNA 2ZNYA 3SI8A 4C7QA 4JI4J 2WTFA 2CZVC 2Y8YA 1R8CA 3PX4A 3MOZA 4LRAA 3ONQA 3L4BC 4HACB 2AEMA 2F4VJ 1U6ZA 3D1OA 1RT7B 2BACA 2HGNA 2Z2MA 3HXMA 4DR1F 1TUVA 3NL0A 2HURA 4ZCLA 3M8QB 3MAAA 2R7SA 2UUCJ 2HEKA 1FF2A 1I6JA 2R2SA 2CDRB 3P5TL 4KFBB 1IJFB 3QYYA 3TAMB 4Z2XA 4DS5A 1U1MA 3HVTA 3BEGB 3OQ2A 1R8BA 1HQEB 1WTBA 3RR7A 5ETSA 3NY0A 5KT4A 1VQYA 4NLPA 4XIUA 1FX4A 4C11A 4L75A 2RHQB 5F8IA 4C8NA 1N5TA 1DTQB 3PO5A 3T1HJ 1SUQA 3OL7A 3QSYB 2CPYA 3PY8A 4BC7A 3C6TA 3VVUA 4C0OC 1T03B 1ZPWX 1URRA 2GS8A 3HMJG 1S1XA 4I7FA 2HHHF 3CJ8A 1BQMA 1UW9A 4QIVA 2CG8A 3QGGA 2YNGA 3VV2B 5IQQA 1UEUA 4L6V3 4PWDA 3KLHB 3FBCA 3P6YC 4EFAC 2DGXA 1VOMA 2YNHA 2J76E 3QRQA 1T9TA 1L3VA 3DOKA 2HSEB 4BWMA 4EZ9A 2HVIA 1CQNA 4UUWA 3TVZA 5F8MA 4H4MA 1FCAA 1S4FA 4LREA 4KV8B 4PKDB 2HRUA 1BHNA 1PJ6A 3ZTSA 3A1YG 3W60A 1Y4ZB 1RYSA 4QIWD 1GXTA 2XMUA 3M8PB 1V6HA 2CQHA 2W2OP 1CULB 1N88A 2ASJA 2P5VA 1IWGA 4UOHA 1H72C 4DV7F 4RUAA 4X64F 3OVSA 1SIWB 4RBTA 1RTZA 2XNQA 5JXSA 2B9EA 1JJHA 3MUMP 1OY6A 3T5LA 2H1YA 1VRTB 3QIPA 1TVRA 3KUHA 4USKA 1HQEA 1AROP 1F5AA 3NS6A 4IH6A 3ZNJ1 4FDFA 1VS3A 4ER8A 4HL9A 2VG6A 1VC5A 1EKSA 4YUDA 4ZLJA 2IYIA 4K4SA 4NXMJ 4KYZA 5SUHA 3QGIA 2XS7A 2OH2A 4WIIA 1KOOA 3F0NA 2GJIA 2FGOA 1H98A 4ITSA 3EXCX 2FZKB 2JH3A 3LW5C 1TKXA 3MFHA 1BD6A 2IFXA 1XN9A 3MPDA 2VONA 2W4CA 3WZ0A 4DR1J 2LKZA 4HI1A 1RU1A 2KT2A 4P2MA 4ZVPB 4AD6A 1RCXB 1ZH5A 5KOWA 3HZGA 2CNKB 4PUOB 3W5XA 3EMTA 2QA4S 1IBKF 2X1AA 3BQ1A 4ECTA 5LT5A 3BDEA 2AGQA 3H59A 3RTVA 4Q8FA 1X5TA 1MN9A 3NG8A 2KVQE 4P2SA 1RTHA 3CCRS 2IBKA 2DRBA 2FLLA 1WI8A 4NL5A 2V0NA 4LF1A 5HI7A 4EU0A 3QT7A 3E2EA 1B0VA 3HFVA 3A4TA 1QLNA 2QFIA 3FQKA 2ASYA 2HWIA 4CH7A 2WSEC 3QWPA 1HD1A 3HVAA 4ZMMA 4WTOB 4QW9A 1U8SA 1S4EA 4NZ0A 2X7IA 2VC0A 2VBWA 2A2DA 1KFDA 3CDUA 1N6QA 4F36A 4MIAA 3H5SA 1CULA 1QAYA 3RR8A 3GV5B 1ZM4A 5IC4B 4XK8C 2HHHJ 3IR5B 5ETPA 1YIJS 3PIOQ 4IG3A 5D15A 4GC6A 4WZQA 3VGTA 2QLJB 2LLZA 5C24A 4YR2A 4Q0BB 2RILA 2C2ZB 2CKWA 1SL2A 2G0JA 3TRGA 1MWZA 3L7PA 3N79A 4KHMA 1VI7A 1RACB 4R8UA 1S57A 5F9LA 1HNIA 5KT7A 1A6LA 1KTVA 2UXDF 3QZ7A 4CTAB 1IJEB 4IFVB 1UJ5A 1TKDA 5KT5A 1HBOA 4OLOA 4YMEA 3N5BA 4IRKA 2V34A 1K44A 2KHCA 1OY9A 3I96A 4DV7J 4X64J 3JTOA 2KZZA 1F5BA 4PG5A 4G3IA 1YGYA 3KLFB 1YK9A 3BN4A 2B9WA 1WC3A 1QE1A 2FHJA 3DRSB 1FTCA 3LP0B 4RPFA 2OSQA 1M5HA 1SV5B 2QA4G 5A6PA 3LAMA 4EO6A 1QSYA 1JLFB 1HNVB 3L3CA 3TUJC 5C5JA 1HPZA 3PJWA 4M5NA 1C0TA 4Y2KA 3HHLB 4NLVA 2NCKL 3GIJA 1TV6A 3K5OA 2LVWA 2QA2A 3HDSA 1XNQJ 1VDHA 2H51B 5CA5A 2QGFB 4Z7YA 3SCIE 2JC1A 1IBKJ 2G2OA 1RWWB 3A3NB 3DCAA 2HFVA 3VAGA 1X4GA 3IBWA 2DR5A 3MR7A 3NMRA 1MROA 3BH7B 4ECQA 1SC4B 5HK4A 4UY8T 3DOMB 4RJVA 1VRUA 2JOQA 1KSPA 5IM0B 4EZ6A 4DX5A 1WUUA 1MNEA 2J8AA 4OYWA 1ZM3A 3CNQP 1NM2A 2DEJA 4P10A 3KK2A 4UOFA 2BABA 5CYQB 3NGKA 3RGIA 3QLHB 3M8ZA 5D77A 1QTMA 2VDHA 2FZCB 2IM0A 2PO4A 4DV4F 4M63A 3R7BB 3TZXA 2AV5A 2BW7A 1EQ0A 3OR2A 2L48A 2HAIA 4MFBA 1BY9A 1SQEA 5G0RA 4JI5F 1AZSB 3MM6B 3M9OB 2HWHA 4OHWA 1TL3A 4RR5A 2JEGA 4P2FA 3MZIA 2BKOA 1VC6A 2PEHA 4F2RA 3PW2A 2BANB 3JSYA 4FBUA 1AFIA 1UWBB 5F8LA 3R2CJ 1JLFA 1HNVA 3CJ2A 3HHEA 3IAM9 4OI2A 3I31A 3MUTP 1R6VA 3HHLA 3IG1B 4DF4A 2RE1A 1YG0A 1RT3A 2AJ2A 3QGHA 4AL6A 3M6VA 3K5PA 3DNCA 3T9NA 1FJGJ 2G13A 3EWGA 4FF3A 3R1LA 2A18A 3Q8QB 4WFBQ 3EZ5A 4LIRA 4IO1A 4MT1A 4ZPDA 1M5KC 3CJSA 3JQMA 1LWCA 1SJFA 3J81U 3W9JA 1GMWA 1BLUA 5K8MA 4JI3J 3MECB 1FK9B 2W24A 3O1LA 1LFPA 2YTCA 4MKYA 1V3RA 3SYZA 2UUBJ 3PJ9A 3TNVA 1Y5NB 2PMWA 2UV8A 3H0PA 2IYGA 1Y3JA 3UW1A 4ZLLA 4DQSA 3GONA 4DCPB 1RHQB 1RWUA 2GQCA 2BE2B 2EFGA 4WTYA 2B5JA 2IIHA 3Q2SC 3ENWA 1R7IA 2QIFA 3NLCA 4FYWB 1MWQA 3ITHB 3A3PB 5I42A 3CJ3A 4CZCA 3DLJA 2E1PA 4K4TA 2G4BA 4TQRA 4J9OA 2RQCA 5B09A 2YNIB 2E1MC 1NK5A 2HNDB 3BB5A 4DV5F 1Q8KA 2OD6A 4NYZA 5GADU 3ADAC 3I55S 2BOAA 2DNZA 4J7CA 1ZAXA 1R6YA 1UVJA 5BYSA 2XMWA 1X31C 2OMLA 3Q89A 1RUSA 2BX6A 2EWHA 4QJVA 2M4MA 2WSFC 5M2UA 2ZVIA 4QWDA 3FBBA 5LMUF 4JI8F 3DI6A 2XI3A 2WAQD 4F25A 1R0AB 3BH6B 3A13A 3ELHA 1HR0F 3S6EA 4X4UA 5A8RB 4DV4J 1UJ4A 5KOXA 2EFPA 4PG4A 3UI3A 2PIIA 1FXRA 1XMBA 2AU0A 2RVJA 2JEFA 5DJBA 4JI5J 1ZAVA 2YWKA 3CTRA 1FKAF 2P9EA 1G4CA 3T3FA 4OI3A 5JVGQ 1HQUA 5DGBA 3KLEA 5HP1A 2HIQA 4LFCF 1JJCB 2KFYA 2YY3A 2IDEA 3BGOP 2HQIA 4EO8A 2R4FA 2HBYB 1NSQA 1N56A 2AQ4A 2IMOA 4LFBF 4O4GA 1X5SA 4XDCA 1DHMA 1FRIA 2ZC4A 2UVVA 2MKSA 3W5YA 3PW4A 5CYMA 3JAMU 2VIHA 3NNCA 5E3CA 3U1MA 4ZVHA 2VDIA 2Y1LB 1N4LA 1QY7A 2HNZB 5GAEI 4IG0B 3CMQA 4DSLA 1M1HA 3ZZOA 1KOHA 1R43A 3GJTB 1YBUA 3LQVA 2W8KA 2IDLA 2K7KA 3I5BA 4TY9A 3GR0A 2JX2A 3BV8A 2Y1IA 4Q43A 3F73A 4JOUA 2D3O1 2HFNA 1U47A 3FSYA 5IXUA 1U7LA 1SJ3P 2FHOB 3B54A 2UUAF 4QPTA 5LSLA 1KN6A 3KK1B 2VG7B 1W26A 3C3LA 2XG8A 5H1SV 4L3NA 3VGVA 3NCPA 2B4PA 1NMEB 4L74A 3LA0A 4HHUA 1SIZA 2Y1RI 1X8DA 1FVQA 4LR8A 3ILOA 1UP1A 2N7YA 1H0HB 3HHDA 3TX0A 3KK3B 3QRPA 5HJXA 4B3RF 1K9MT 3P96A 3JSBA 4CRJA 5T7LB 4F0MA 3I5CA 1R8HA 3M8WA 4IFYB 4WK3A 3N01A 2B4UA 2J8SA 1AB8A 3K5MA 3CIMA 1TL1A 1XJWB 5LMUJ 2KG1A 2R7VA 2D74B 2VZ9A 2ZE2A 1HR0J 4BC9A 3RRKA 1U2FA 4RW7B 1T94A 1XMOJ 1YX2A 1NKEA 3TP2A 4NWBA 4EUVA 2XMKA 1O0PA 3VF0B 1NSPA 4UOGA 3J7Z5 5F0UA 3RUBL 5EDWA 2HZVA 2BQRA 2KT3A 3CCES 1OYDA 2FPHX 3CCQS 1NHKL 1DARA 4X62J 2FY8A 3CO9A 2F8MA 1FHTA 5A0YB 2C3YA 1VQ9S 3L7UA 3HO1A 1PO6A 5I4MA 3GWCA 2ASLA 2YBVA 2VG7A 2YWGA 2DGTA 3N9UC 2DXDA 5BYRA 2V6AA 2E5LF 2AP6A 3H90A 1YWXA 3RB4A 1P1TA 3BSAA 1WC4A 2QX0A 2C2KB 2YH0A 2OPSB 4EYIB 4O3RA 4WFXA 4B3MF 5A2QY 3MGJA 3KK3A 3E3XA 4FPRA 4DV6F 4NI2A 2W9CA 2D3OR 3CSKA 1XWLA 2VUGA 1FDNA 3DU6A 2WRMA 4CT8A 2KO1A 1BQNB 2YWWA 1B64A 2BM1A 3P4UB 3PFEA 2OP5A 1YJTA 1S1WB 1AXQA 4ILLA 2H4WB 4RWWA 3W64A 2DNYA 2BJ9A 2I8EA 2A1BA 2FD2A 2MPUA 3TUIC 4IH5A 2WHOA 1NXIA 2LQJA 2J7UA 1YBAA 1UFWA 5F3TA 2GHVC 3C16B 5ETLA 1EAYC 2OPPB 1G3OA 4ED5A 1FE0A 4K4XA 3I0RB 2HKEA 1JK9B 5KFSA 1U26A 1OJ4A 3GU0A 2QMUB 2OEJA 4K59A 4I2PA 4EK2A 4TU7A 2VH7A 1HI1A 4AFFA 4B3RJ 4C4WA 3U1LA 1BE4A 2CJBA 2MTLA 2U2FA 1NPKA 1JQGA 4NMLA 3VAJA 4KJIA 3DLKB 5KFHA 5CABA 1QSSA 3KG4A 2KM8C 3A8JA 1U1RA 4LF6F 1VQNS 3K8WA 5ETTA 2VICA 3PG9A 3SFGA 1FRLA 4GKKF 4X4OA 2MQ8A 1FDAA 4NYOA 5LJ5Y 2KYZA 4N47A 5K9FA 3O5TB 1L3KA 4J9SA 2F63A 1PKUA 2AGOA 1TL7A 5HROA 2RSQA 3PZPA 2OD4A 1ELOA 1NSKL 3DXBA 4JBCA 5E5NA 1IR1A 1NDLA 1RLCL 4FVMA 1J27A 3GSDA 4KGZB 1JLEA 4P72A 2GVDB 2OEMA 3HVWA 3VAIA 2J6SA 2A6MA 1XIQA 5C2GA 2ZWPA 2OJ3A 3NS7B 4URSA 4BDPA 3OW2R 2CJYB 4UF4A 4OI4A 4WXOA 4DL2A 1FJCA 1JLQB 5KFPA 3CJTA 5BYQA 1YBTA 4K8RA 1NHVA 4M8LA 4M5DB 3FSXA 3QSIA 1EETB 3V6DB 1TZ0A 2GIRA 1TL4A 1D9AA 4HT5A 4U96A 2D1CA 5JMNA 2RUGA 1RTIA 2YVSA 3PIPQ 3NCRA 3WBZA 3ETMA 2VJVA 4DV6J 2ERRA 4OZJA 3MEEA 3AQPA 4ED8A 5EGYA 3DLKA 1WD6A 2CJAA 2LXIA 1R0BG 3PFOA 1NJWA 1N32F 2R9LA 3LAKA 4RZRA 1FJ7A 1KKHA 2KXNB 3HK2A 1Q8BA 2H5JB 3MCMA 4M95A 1LW2A 4C9DA 4K2XA 4GVLA 3QT5A 1NEEA 3IS9A 2VL1A 1D9FA 2BKNA 4WJBA 5L1KA 1SH2A 2XMTA 4ZITA 4H4KA 2MYFA 4RLEA 1ZBTA 2Z2YB 4IRCA 3G71S 2VG5A 3W63A 3VAMA 2JFDA 4AL7A 2WBRA 1OPZA 3Q8VA 3Q23A 1AA1B 1RSCA 5JUMA 3CJKB 2YKPA 5D4PA 5J2MB 2E29A 3KLGB 3MMBA 4EI2A 1QAXA 4E2FB 2LU2A 5CYJA 3OTOF 2QE5A 3BQ0A 2WVFA 4HH1A 4ZN3A 1TAQA 2J7WA 2LYVA 4OLPA 4M5MA 2Z58B 2C2DA 4H4OB 4CM0A 2DB1A 3R7NB 1UPMB 3TI0A 4FYVB 3K57A 4DWIA 2KU7A 2WONA 3UN3A 4F8RA 2CJQA 1ZZNA 4U6PA 4NCGA 4HDGA 1WOSA 3R5GA 5C25A 1EETA 3AJ1A 3QO9B 3O3LA 2ZBIA 4B17A 1GMVA 4FYYB 1U1LA 3MCOA 2CG4A 2LDYA 4DPXA 5HLFA 2DR7A 3MM9B 3PRBA 4OZ1A 2M70A 4ZPWR 4V19J 1UA1A 5KFCA 1RJJA 2GX8A 1S97A 4ZLPA 3G6VA 2KFNA 3W65A 4DXLA 2UXCJ 1S7IA 1YHQS 3AD7C 3OTBA 4KKOB 2DHGA 2R7TA 2I5JA 2QV6A 2FJXA 1DY3A 1YRTA 1S59A 1K0VA 4WIQA 1UA0A 3VQTA 1DFDA 3LF0A 2FJAB 4KAIA 5GAHI 1F1BB 2R8GA 2MLZA 2ZHOA 5DG8A 3GG0A 2G9OA 3CJKA 4DCOB 5J2MA 2BMBA 2FHJD 4YDXA 4DZ6A 3B4DA 3POTA 1RAHB 1PBAA 1HNZJ 4PAAA 4A8MP 1S9EA 1RT5B 3CUNA 2MKYA 3FZ2A 1NDPA 5EHHA 1CJVA 2CWKA 2V4JA 2OO4A 1VK3A 1TFWA 3NP5A 4O3NA 4Y2AA 1PYTA 3NOCA 4OI0A 1FWKA 2DNGA 4TU9A 2R7WA 4ZVSB 2E44A 1KQGB 4HTIA 3K5LA 2EVZA 3E51A 3G6YA 1WKKA 1L3SA 4A46A 2MJNA 5E41A 1C1BA 1UZHA 3AD9C 3C46A 4X4RA 1HHQA 3FZBA 1Y9OA 3MD1A 1U48A 1GNKA 4FF2A 3FEXB 3OXFA 1X7VA 3S01A 2H65B 2IC3B 2VQEJ 2HYIB 2YWHA 5J2PB 2AJQA 3OTOJ 3T9ZA 3GFZA 1T11A 4ZLNA 4KKOA 3TA1A 3IRXA 2W8LA 2QL5B 3IO1A 1MMDA 3KJFB 1URNA 1XK8A 1FEEA 1Q4RA 2PT0A 3AB2B 1PAEX 3EPIA 1FA0A 2CQCA 1RT6B 2B4OA 2DPJA 4RW4A 5HL7Q 3D9BA 1H6KX 2XBPA 1PCAA 4XAKA 3D1HA 4NCAA 1X5PA 3CD7A 3ISND 5KFUA 3D1QA 3RAQA 3CCLS 4KPCA 5IWAJ 2Y0SD 1SL1A 3DRPB 3ENQA 1T05B 1WSRA 5D0GA 1S5ZA 2D3ZA 4RW9B 5IFMA 2R8HA 2G2ZA 2NXUA 3PW0A 3CULA 2BDPA 3CJ4A 1JB0C 3UO0A 1G6BA 1UMJA 4N56A 3SSRA 1M1GA 1LK5A 2EG1A 1JXVA 2FUG9 2AYEA 3KOAA 1E6YB 1UVNA 3I0SA 4QWEA 2R2TA 4URGA 3KG0A 2DGOA 4TKTA 1UEKA 4OV6A 5IT4A 1TU0B 1YRXA 2Q79A 2IVYA 2R8IA 1C1CB 3H4DA 5EWGA 2RD5C 1JLGB 1I51B 4OZ5A 2JEIA 5J2PA 3A8EA 2DHSA 1GMWD 1D9DA 1GK8A 4K5RA 5FLXU 4B9SA 2J9DE 5DZ6A 4XPCA 4WE1B 4TLRA 5FDLB 5KFZA 1J5EF 2HVDA 3ZZ0A 1BMQB 2CVEA 3Q8YA 3IM8A 4F02A 3OJSA 1KD1T 4R0EA 3MEKA 5D6GA 5JJBA 1U6FA 2E1AA 2ZKUA 3HSGA 2GMLA 5H9EK 5GADI 2HS4A 1NU4A 2BM0A 3UDCA 1LWEB 4GVBB 1HW9A 1YJ7A 5J1NA 2YX1A 4UUXA 1HA1A 2GW8A 1Q78A 2GAGC 2BW2A 4IOCQ 3PV8A 2XYPB 5E2QA 1Q7YT 2ZH5A 1LNQA 4I2QB 3MEDB 3MMAB 1CJTA 4PCQA 4WYLA 1VISA 1FDDA 3MMCB 4PWUA 2HHUA 1BWVA 3CMES 4NXNF 2ZWOA 4J9KA 4DL0C 2AT1B 1IBLJ 4WKRA 3QGPA 4LRDA 1YJUA 3PHTA 4MTPA 3J7YU 2ZH3A 2X1BA 3MHYA 2AD9A 2GMJA 4PG7A 5DM7Q 4EGLA 1OS5A 5KFEA 1WNEA 3V81A 2ZM6J 4CLTA 1E6YA 4MJKA 1ZTTA 4DU7A 2R8KA 2B4VA 2N3OA 2AJ1A 4Y2MA 1RBAA 4K4ZA 4Y2CA 4W90B 2DT9A 1T9WA 2MQOA 3WC2A 1KLMB 5D8HB 3UD4P 2OFHX 2V2VA 5HBMA 2DGUA 4HH0A 1WSVA 4PWWA 1X4BA 2V8VA 5HMZA 2VB6A 4QIGA 2RHSB 2JFKA 3G2XA 3H42A 1B7YB 3A8IA 4DI6A 4DFKA 1Y0HA 3R5DA 2ZHAA 1N8RT 1IN0A 4F50A 2YKNB 1U1PA 4ZJOA 3GJRB 2O01C 3QNWB 2ZZNA 2L3MA 4K4YA 3TJ8A 5H9EJ 4WFYA 5KFMA 3NKYA 1HWUA 5BJRA 1VIXA 3W2WB 3M6XA 4B3OA 2QFJA 4DX8H 3AODA 1JJ2R 2MLYA 3TVKA 1X4EA 2XSFA 1X4HA 2CPIA 4A8OA 4C8LA 3D0HE 2BQUA 2M52A 1IKXB 2NSBA 2Q3PA 4I2QA 3CCUS 2CPJA 2FLNA 2P6SA 3UCUP 4DR6F 2YWEA 4ZOSA 4LIWA 3PXGa 4ZVUB 3SFUA 2DHHA 3TQEA 2BE9B 4ID5A 5U47A 3QZ8A 2V67A 1NDKA 3Q0AA 3OSPA 1UW4A 1TP7A 4C8YA 3K8VA 3PEJA 1CS4B 2LQ8A 1CJKA 1TKZA 1J5EJ 2NS1B 2DBBA 2GVZB 3D4JA 4I67A 1EIYB 4DPUA 1T9VA 1UL3A 4QWBA 1L3TA 4BWJA 4J9PA 2RU3A 4KPYA 2HWTA 3CCTA 1IKVA 2XSJA 2QL9B 3SSSA 1Y00A 2PMHA 3U27A 1CBKA 2HHPA 3NAHA 1W2BR 4ZP8A 3M2RB 2XHWA 1S49A 4KHPF 3G96A 1TKTA 1KLMA 4CLWA 3NBPA 1KP6A 4LF4F 4DR2J 3OVBA 1EX8A 2W7AA 3MWBA 2RF2B 4ZVQB 3VGUA 1T9XA 3UNYA 4NXNJ 3KJVA 1FNXH 3BREA 2QMXA 3RW7A 3QATA 4ZHRB 4QYZK 1Z4UA 1YJRA 2K3IA 4NLWA 5HAOA 2VODA 2PI4A 2XY7A 3W3SA 1WF2A 5B0CA 3FKBA 1XTZA 4J90A 1GXLA 2DRDA 1J5OA 2DPIA 4YP3A 3ZFVA 1SC6A 2OFGX 3DHWC 4KO0A 1YDLA 5DG7A 4DL4A 2GMHA 4XTTA 2HIYA 4X4NA 2B6AA 1U0HB 2HMIB 5KT6A 1RKIA 1Q8LA 2FQQB 5HJYA 5ETRA 3A8KA 3GFYA 2MZJA 4RUBA 5IT9Y 3MM7A 3GIKA 1REVB 4JYAF 5EX3A 3OD2A 3C6UB 2F7VA 1DZ5A 2NXJA 4O4RA 2WVDA 3R7SB 1QJHA 4Y6IA 2VPZB 1VBKA 1JKHB 4N76A 3Q83A 2R2UA 3AFGA 1K1QA 2OAUA 3FMBA 2J0SD 4K0KF 4KH1B 3MM8B 2ZOMA 3ET6A 4LFAF 4O0NA 4DR3F 1RT4A 2ZBRA 3MM5A 3CWJA 3VAKA 2Y3YA 4HLBA 5A2QU 3TJAA 4O3OA 1XEZA 4PG6A 3FUYA 1C0UB 5F8HA 5K14A 2HRYA 8RUCA 4CLFA 1SKRA 4QR2A 4QPXA 5J1EB 3GTYX 2DCUB 3MAQA 4QYZJ 3DMJB 4KSEB 3BBBA 4LRBA 1IUJA 5J2NB 4ZKAA 2M3DA 2W4DA 2M5YA 2KXHA 1Q82T 5CXTA 1DURA 4G6VB 4ZP9A 1CLFA 4F3QA 2ZHBA 2R7QA 3AT1B 1TMMA 4RW6B 2CQ2A 2HVEA 2Z2LA 4JV1A 1D1UA 4CO3A 4G65A 3CD0A 3RW6A 4ECZA 5A8KB 4I6YA 4KHPJ 4DQQA 1E6VB 2QLBB 1NBEB 4YHHJ 4NLYA 1IKYA 2XZWA 1QM9A 2Z4PA 1DTTB 3CC7S 1ACMB 2VBZA 2CA9A 4OIXA 4XPEA 1H7WA 1Q79A 4F4WA 1WORA 1PSDA 3M30B 2ROPA 1FWLA 9ATCB 4HYKA 4DUZF 4U8YA 2R7XA 3M1VA 4ICLB 3L95X 1RQ0A 5IV4A 4P7VA 4FXWA 4OJ1A 4MYTA 4GKJF 2OPRA 3C15B 3N4WA 2O1PA 3KLIB 1IWAA 2FHKA 2XYHB 3MD3A 2V2KA 2BJ7A 3AA9A 5LXRA 3MPUB 4CLUA 4ZDNA 2EPIA 4GC7A 2YKMB 2V4RA 1JXLA 4DJBA 1CC8A 4N5SA 2CQPA 5HMYA 1AT1B 2FVRA 1X4CA 3W2VA 2V8GA 1O51A 4G1QB 2YNFB 3RU0A 1NZAA 5J1EA 2G1DA 4NMXA 1M1KT 4F26A 3UVJB 1Y11A 2ZBQA 2IRXA 3C19A 2UUCF 4DLEA 4C0HA 2DD8S 2E7WA 1HI8A 4IDKB 3VGSA 4J9LA 2EKYA 1F2GA 1P8GA 4K0KJ 3UN2A 2NQPA 3M4XA 1CJUB 1RHUB 4IRDA 3T6JA 4X66F 5B0GA 2JLGA 1PYSB 2H5IB 2OPQB 4DR3J 2DCLA 3Q8UA 4J9VA 5M2PA 1N0UA 2R42A 2DGSA 2C2RA 1U25A 4ZPBA 4U95A 1G1XA 4DV0F 5F8NA 3EJMA 5LXYA 2QZ8A 3BGUA 5EN1A 1U1KA 4K4WA 1S1UA 2HHWA 3LGNA 1LXNA 3UD3P 1HI0P 3Q8RB 4IOBA 2MQQA 1SC1B 1DQ9A 1WHVA 1FFWB 2W25A 4W98A 2RS2A 1OMSA 2DJWA 3HPOA 2E9ZA 4P75A 2EXUA 3FDSA 2F5GA 2IY5B 2CPDA 2FLPA 3KXDA 4K5SA 1K8AT 2B43A 1WKJA 2C1EB 1QTNB 3WQPA 3TANA 3KHHA 4P9SA 3ZNUA 2GQQA 2BXJA 2Q1LA 1XC9A 5FIIA 4Y0FA 1HBMB 1S6UA 4DEZA 2QRRA 2ZBCA 3QRRA 1V3ZA 4ZCIA 3CD5A 3FC9A 2E9TA 2U1AA 2ZZTA 2G1HA 3ENAA 4PRFA 2K1RB 2ZNZA 2DY9A 3C14A 3HJVA 1ROFA 2LMIA 4LSNA 4NX9A 3EVWA 1M5OC 2OIHA 1JLAA 1RAEB 3G4SS 4LBHA 1CJUA 5CD4A 4E0DA 5K8PA 2ZJRQ 2OPQA 2M8HA 2VFSA 1SPBP 2ROEA 4ZP6A 2H54B 1KVIA 4O0IA 1S9GB 2L9DA 4W4MA 4DSEA 2XI2A 2LXUA 5AXMA 2DTJA 4OMFG 4WP8A 3AY0A 4YN3B 1HNWF 2IMWP 4TVAB 3RZAA 1Q53A 2VQFJ 1O8BA 5KT3A 3A12A 4G1IA 4WCEQ 4B08A 4NXMF 1RTJB 4KH0B 3N5FA 4M94A 2NUHA 1HWJA 3OT9A 3PJXA 2FYXA 4ZVTB 4KGKA 1D3WA 3TQ1A 3CC4S 2GC8A 4RKUC 2UZAA 4TNOA 4L3KA 4Z37A 3P8BB 2RJZA 4B9UA 4O3PA 2BJ1A 4OYXA 2DVIA 3X3UA 3HI9A 5C42B 2VA3A 1A7GE 1PGZA 1H7XA 4X66J 4DUTA 3T1YJ 4YR0A 1JJ4A 2Q66A 3ZZYA 3BR8A 3MTJA 4E8UA 4DV0J 4KB7A 2G2YA 1RAIB 1B4SA 1S6QB 1HD0A 2BJ3A 4I64A 1ITPA 3JSMA 1PAUB 4TLQA 2LA6A 5KG1A 3EPGA 3LP2A 4OZ0A 5DRKA 3NWRA 4FVCA 4CLSA 3E01B 4MAKA 3UR0A 3V4MA 4QZVB 2EG2A 3J80Y 1DQAA 1WEXA 4C8ZA 3CCVS 4DQIA 3IGVA 4Q2LA 1IM4A 3RRGA 1S9GA 1SJQA 2E5IA 1MN7A 4DG1B 1DBDA 3GG1A 4ED3A 2AZ1A 1KQKA 2MHNA 1DJ0A 5CCLA 2HFZA 3TZYA 2IA6A 1NH8A 3LP1B 2OTJS 1RTJA 1DLOB 3G6ES 4ZVFA 4OHXA 8AT1B 4QWCA 4DR4J 3UD5A 1BQXA 3AAWB 2IA0A 4PQAA 4HACA 2R7OA 4I1TA 2NLWA 1RT7A 1F9FA 3Q86A 1F9HA 3M8QA 2RRAA 4QQBA 2AKWB 4CDIA 1U49A 4ANDA 2EEYA 4KFBA 3TAMA 2HHTA 4ZIVA 3F56A 1PJ5A 4LRFA 1KR4A 2AIRB 3LGHA 2VBXA 3JYTB 2B9YA 3VAHA 1VC0A 5I3PA 3BBFA 5M2RA 1IQZA 3DRYA 2ZJPQ 4FPIA 2QLXA 3DC2A 4E98A 1HNWJ 2BJDA 4K4UA 1VFJA 2M2BA 2ZH9A 1KQSR 2X1FA 3BGRB 5T41A 1DTQA 3SDEB 1KTQA 2C28A 4IYQA 1FI4A 2K3KA 5F9NA 1T03A 2O67A 1I94F 2M7SA 1RABB 1RBLA 3IFEA 3PYGA 4IUFA 4RNMA 2ZH4A 3DYAB 3EICA 3DRRB 1EHWA 2EBEA 1KVKA 3M9NB 2DKOB 2HRTA 4U9RA 1XNQF 2ALYB 3KLHA 4YOEA 2OMOA 2GZOA 4PZVA 4DPOA 2KRBA 2X3DA 3M05A 2KT5A 1SQGA 3W1YC 4WWSA 5J2QB 4CO4A 2VU5A 4KV8A 4OX9J 5D4LA 1S99A 2RDIA 1KNZA 2QSWA 2NUUG 4B02A 2DXFA 5CZVA 3HSDA 2BRKA 4EBDA 2GAHC 3M8PA 5H9FK 1RT2B 4KTQA 1QUPA 1K1SA 3TW0A 3NXZA 1IKWB 1UVKA 2WK4A 1S12A 4DFMA 4M5HA 4DHVA 1QAJA 3HT3A 3BPDA 4J37A 5LJ3Y 5HQ8A 2LQBA 4YB6A 4V1Ak 2V4QA 2JDJA 3TZWA 1VRTA 4X4VA 2DNOA 3RBDA 2C3OA 5KTQA 4OX8A 5C2CA 4XDDA 4BLGA 3KTQA 3RBEA 1VYAA 1NAQA 1VQPS 2MMYA 3FBFA 4FXDA 2B7BB 1LEOA 1RK8A 2G0CA 3H40A 3CEDA 3J7YI 4NA2A 2CZ4A 1XR5A 2K06A 1IR0A 3DLGB 2ZITA 2FIUA 2BE7D 2H4YB 3G82B 1VQMS 1JNRB 3KDNA 4A48A 3IBFB 2M9KA 1K73T 1TL5A 1N36F 2X1GA 5E0OA 3OXGA 1FJGF 2EBGA 3CDAA 4PUOA 3G87A 4LF9J 3PW7A 3BJYA 4HI2A 1R0CB 4LRCA 3FFIB 4RNFA 1FERA 1IR2A 4M5IA 4BBYA 4LF5F 4HEA9 1X9WA 3U7JA 4DFJA 5J2QA 2J5AA 2MHEA 3NWGA 4DV3F 4B9TA 2LEPA 4TXSA 4JI3F 3V4IB 3LTOA 1VQKS 1N33F 3B6BA 4M5LA 2BUNA 1Q8IA 5GAHU 3MAHA 3J7AN 1S48A 3W9IA 3MUVP 1TTHB 4F2SA 2AYMA 3TR5A 2UUBF 3K5NA 4DV1F 3VZIA 1I94J 1Y5IB 2CJ9A 3AQOA 4CP5A 3AOAA 2JLFA 1IKWA 4EEYA 3PO4A 3KLVA 2BRLA 3DXSX 2ADBA 4L73A 1XQIA 2DH8A 1NO8A 4PPZA 4DQRA 3LOUA 4Q0BA 2G0IA 1S1TB 2QEXS 3W8GA 3PDNA 2JVRA 1I3OB 4RL1A 3OL8A 4LBIA 1UZDA 1GTHA 1GTEA 4OJ3A 2DY1A 2F8EX 3W62A 3DLGA 5DDOC 2HFOA 2NXCA 2XGPA 2YWFA 4OI6A 1I5OB 5HMWA 3PX0A 4CTAA 2C3UA 3GSIA 4IFVA 3LH2S 1FD8A 1RHJB 2IPOB 3DGPB 2DNKA 2BJEA 1QSLA 4QU6A 4O44B 5DZ7A 1F0XA 4BS2A 4D3HA 1JLBB 1U8WA 2LECA 2KM8B 4F4XA 3SQOP 3KLFA 1VMBA 3UFCX 3WIVA 2AJFE 3CW2C 2W2MP 4F3OA 4RUHA 3DRSA 4K2JA 5E3AA 3LP0A 3ZZUA 3NS5A 2W1BA 4RWXA 4PABA 3HP6A 4U8VA 1SV5A 2KG0A 2DGQA 4UQGA 2DNNA 2L41A 3BZQA 1R89A 5KFRA 4C98A 1BGXT 2MY8A 3GE9A 4PQUB 1DRZA 2ADCA 1VBYA 2CQ0A 4M1KA 4OHVA 4CNZA 2ZH7A 2DNRA 4IQMA 3I4HX 1T95A 3MR3A 1N36J 4F0HA 5IQ6A 1LW0B 3W66A 1V5IB 1TK8A 4M5JA 3H2LA 2BA9A 2VFVA 3T5JA 3JQJA 2CDQA 3PKMA 4N8NA 4LF5J 2KRRA 4ECWA 5I3QA 2A10A 3DLEB 4HTJA 2MQLA 1HMVB 2EK6A 5DLFA 3M6WA 1HNXJ 3DLLQ 1CSJA 1WG1A 2GGPB 1KBRA 2CVIA 4Y3CA 4DV3J 1RAJA 3DOMA 2P6TA 5IT9U 2VC1A 5IM0A 1N33J 3DRXA 2QSFA 4QR0A 5FLXY 1MLAA 5T14A 3OXLA 5D3GB 2FJDB 4BHQA 2EK1A 4Q8EA 4N8OA 4KE5A 4DV1J 1UEVA 1FX2A 1RT1B 1CPZA 3MMJA 4WU3A 5CYQA 1L5UA 1FRKA 3QLHA 3W61A 1SQFA 1FKPB 5SZTA 2L9NA 4O44A 3OUYB 1EP4B 2BBEA 5GAGU 3TZZA 3OHAA 2E1CA 3AH6A 5KFNA 1AZSA 3TA0A 3MM6A 4C97A 2XY6A 3BYRA 2CPFA 3EUNA 3ISZA 5F3ZA 1M5SA 2ZUGA 4YY3J 4IR1A 3HT0A 4K4VA 3E8OA 1OPIA 3FSIA 4DR7J 1MMLA 2BANA 6FDRA 1UWBA 4OJHA 2PFFB 1HWIA 1K47A 2NXEA 1IQTA 3CJ5A 4LQ9A 2HQDA 2IHR1 2D9PA 3DN9A 2HHSA 4J9QA 5K5MA 2PD1A 5I3UB 1PYOB 3IG1A 4ATNA 4UY85 3TEGA 2CPHA 4NRUA 2GHPA 1NK8A 2UP1A 2C2OB 4HR2A 1P27B 1T3OA 3CJRA 5L9NA 3AOBA 2AJ0A 4JI6J 1VLOA 1XMOF 1OSDA 4FYXB 4HHJA 2MSSA 5E7OB 4F4AA 2MGZB 2ABYA 3DLEA 1T02A 2XNRA 2R7RA 2A0FB 2C2MB 1NUEA 3GLJA 1Q86T 4HDHA 3BO2A 2LP4A 3IMQJ 3ZZZA 1TUWA 3MECA 1WEYA 4RNOA 5KG3A 1FK9A 1WWHA 4QW8A 4Z7CA 4X62F 3B4MA 1HKAA 3MEGB 3V2UC 2MZ1A 4OFZA 2DIVA 4MH8A 2CJXB 4ZS6A 4D3GA 3GYGA 1KDNA 3CB4A 1FKPA 2YPZA 5ETVA 1C4CA 1EP4A 3WX8A 2W4PA 1X60A 2BE2A 4F04B 4QU7A 3KKFA 2QLFB 3DLBA 3SQGB 4ZPVR 1F9EB 2J7KA 2J9EA 2PA3A 3MTKA 5D0RA 1VCTA 3ITHA 5A8WB 4RU9A 3LUYA 1NK7A 5AJ3F 1HBNB 2F65A 3T1AA 4DV2F 1NH7A 1VQ7S 1OY8A 1R8PA 2KB2A 3THPA 3OVAA 2YNIA 2HNDA 4U7UK 3EDQB 3BN7A 1X0FA 3HD2A 1M5VC 4ANCA 3D6FB 5I3UA 1HFEL 4ED4A 3EDRB 3MAAB 2O5DA 4ZN1A 4CO0A 5L46A 3R5CA 2YKQA 4USMA 3QPIA 2FTRA 2R2RA 1R0AA 2IBOA 2R7UA 5A8RA 2RKIB 4IQXA 5F8GA 5L1LA 3HVTB 1FWPA 2PC6A 1RYRA 2YXLA 5CAAA 4MKBA 5D4NA 1B70B 3EZUA 4OX7A 5AXKA 3K0JA 1T3NA 4I6AA 2NPFA 2PMZD 4P73A 2HLTA 3KJQB 4C11B 4KT0C 5CHCB 2MKCA 3R8YA 1ZETA 1ZAWA 3UDLA 1SUQB 2DK2A 4PYAA 4IH7A 2V94A 3KUEA 2IVFB 4LQ3A 2POKA 5L9XA 2HFSA 2W9BB 1P1LA 1S1XB 4I7FB 1TAUA 1BQMB 2DGVA 4LR7A 1VQSA 2HAFA 2YNGB 5J1PA 2XZDB 3BR9A 3NOGA 2D7SA 1U09A 3ZC4A 4PWDB 3HFKA 1N34F 3TA2A 3D3CJ 3CDWA 2AJ4A 2HNZA 4IG0A 3DOKB 5HQMA 1ZM9A 4Q45A 4J5OA 4H4MB 2E5GA 3ZXWA 5KFBA 3T41A 3W9HA 1YJWS 4KBIA 3I32A 3L9ZA 5KG5A 4K7QA 2DHXA 5EWFA 2A6OA 2ZH1A 6FD1A 1PG5B 1RA7A 2MDAA 1U4BA 3R9LA 4ED2A 2DR6A 2CQ3A 1WHWA 2B0GA 5HVGA 1SH3A 4MMOA 4ZIWA 2YX7A 1NLKL 2PE8A 2DNPA 3O2IA 2RKIA 3KK1A 2N3LA 1WC5A 2R8JA 1IXKA 1IBMF 3WX4A 2DEIA 3NMAA 1JWWA 2MZTA 3MR2A 4FNIA 2NZCA 3QIPB 1TVRB 1O6XA 3GV8B 2CNNB 4Y28C 4PXBA 1OQ6A 1NJXA 3BKTA 4WPAA 2VG6B 2OKQA 5AJ3J 2ZFHA 2V2ZA 4DV2J 3OPKA 3UR3C 4X65F 4X4PA 1LXJA 1S76D 3BSNA 1TKXB 4R0JA 4CLZA 5T7LA 2W9BA 2V69A 4IFYA 2IRYA 2P9GA 4QWAA 4ANEA 4JUZA 2I2YA 1U2CA 2C22A 4USVA 4QBUA 4JI1J 2FJWA 2P9CA 2E5JA 3O6QA 4AQYF 1N48A 3DLHA 5KFJA 2KVIA 2Z0GA 4RW7A 1BC6A 3R3TA 2GO8A 4DOZA 4F0KA 4FP9A 1RTHB 1RHRB 1ZS6A 2VD3A 5LM7E 1P9YA 5GVQA 3D2WA 1XMQF 2Z2ZA 2MJUA 1FTRA 4C8MA 4DX6A 3K2YA 2CPXA 1EKRA 3FMWA 3US5A 4NLTA 4KGXB 2FY1A 1YZ7A 1G7CB 2HQFA 4ECSA 1OQ3A 1FD2A 4F4KA 2A2CA 2PEBA 1N5YB 5DLGA 1N6QB 3ETOA 2RIJA 3CCJS 2H5EA 2LDIA 2JL9A 5A0YA 4DUYJ 2HZCA 3CDEA 3OSNA 1JLCB 3L09A 2ZOFA 5DS7A 2XEXA 3ZTOA 4IG3B 1C4AA 2C2NA 5C24B 3CCMS 3J80U 1N34J 1HW8A 5DM6Q 4USHA 2N82B 5KG4A 1HL6A 1GT8A 2FJEB 3S8SA 3M6UA 3KDOA 2F1FA 1NNDA 3OL6A 2OPSA 1WKLA 3K58A 4DL6A 4LSZB 2ZDOA 3I56S 3D6MB 3QIDA 3WDOA 4LF7F 4ERDA 4R8UB 5LSRA 3DDNA 1HNIB 2FVQA 3HSZA 1ZYQA 2XB2D 1BQNA 4NCBA 2UXCF 2HNYB 1HBOB 3FGVA 1S1WA 1WACA 3NGDA 2DH9A 3M7VA 2Y0BB 3TWZA 4OYBA 4OI1A 2VPXB 3IWLA 1TK0A 3SCJE 3HX9A 4FXVA 2ZKTA 1IBMJ 2NREA 5EUHA 2BYCA 4CIOA 3RBZA 4I56A 3H20A 1KRPA 2X51A 4ZP7A 1QE1B 3C16A 1QUVA 2OPPA 3VZHA 1SCJB 1NB7A 1X9SA 5KFDA 3I0RA 2VASA 3KMQA 3PKYA 2QTWA 4X65J 1QVFR 1CEZA 3LANA 1N5YA 1O5JA 3VVTA 2DO0A 3OR1B 1HPZB 2CXEA 1C0TB 4YQWA 3RAXA 4F7VA 1HNZF 3IA0A 1RWXB 3JSRA 3D67A 3OHBA 4PR6A 1TV6B 1JLCA 3UCGA 2KXFA 2B51A 1V9OA 1RBOB 4IOAQ 3RB0A 2GNKA 1RI7A 3FEYB 1S9FA 2XWYA 3MI7X 4F4YA 4N7TA 3G86A 4CWBA 1YJNS 2KJWA 4LJMA 1Y5LB 4ECUA 4AQYJ 2DIUA 3AOCA 1WJ9A 4DF8A 2WVCA 1VHIA 2I9SA 4LBPA 4DSJA 4C8KA 2V9WA 1XMQJ 3HSJA 3PTWA 1MROB 3GV7B 4L76A 2MKJA 4C48A 3D66A 3SSQA 1VRUB 3BS9A 3H5XA 4FS2A 2IJFA 2CQ4A 3Q2TC 2A3JA 2VQEF 4ES1A 1TFYA 4W92B 3OFFA 3KK2B 2HNYA 4EBCA 2GVDA 3GB0A 2XC9A 1SVDA 4ZVEA 3WIUA 1FE4A 2RDJA 3CO0P 2XZTB 2NXNA 1U1QA 5HATA 3OR2B 5ETKA 2PFDA 1FVSA 4MFBB 3KHGA 2ZD1B 5G0RB 1JLQA 5GMKa 1B0TA 3WHIA 3TUZC 3S1TA 4M5DA 1PC4A 1TL3B 4DMZA 4PYDA 2DO4A 3JQKA 3V6DA 2AEFA 2YH1A 2N4CA 1X4FA 3J81j 3HFZB 3L7OA 1PC5A 3PRVA 2RUSA 3PR5B 1FO1A 3FQLA 2DRAA 4LF7J 4JI2F 3OR1A 5IWAF 4JB8B 2CQIA 1SJ4P 3CIZA 7AT1B 1APSA 2XULA 2RRBA 4MYUA 3SCLE 1W25A 1RT3B 1SKSA 2XGQA 2C42A 1R31A 1UTAA 2HS3A 2EFQA 1OO0B 4YFUA 4MK9A 3B78A 4X4TA 3O44A 4ZPCA 4C3MA 2CFXA 2UVWA 2MKIA 3W7BA 4I6WA 4PPDA 3MPWA 1LWCB 5CCMA 4A8YA 1DQ8A 5ETOA 4LT6A 3N6NA 2RS8A 3EM1A 4DN0A 3KUGA 3KLGA 2I0XA 1SB6A 2FB0A 1RISA 2HS0A 5ETQA 1S1VB 4OYPA 1ZA2B 4MKAA 4IR9A 2PSZA 2P8IA 2V5HG 3M2UB 5KFWA 4KR0B 3QT6A 4ZPTR 8ATCB 3H8YA 5GMEA 4TQSA 3BKUA 1KVJA 1U24A 3OTDA 1D8ZA 1KFSA 5KG7A 1U2RA 4H4OA 3IN5A 4DQPA 2B5JB 2ZD1A 4X4QA 3FBEA 2GFFA 2WVBA 1JXEA 2AMCB 4QIEA 4UW2A 5I42B 2MZQA 4ZVGA 2R3VA 1C2PA 3OTCA 4KGVB 4P6QA 5KG0A 3QO9A 2GO9A 3PRDA 4Q44A 3CPWR 4OJGA 1R8AA 3H7HB 2XM3A 2N4DA 4I4BA 4DPTA 1FKOB 2E9RX 2E66A 1KS2A 1RAAB 3NGTA 4JV5F 3MM9A 3TO8A 1KHVA 1QDUB 3LPYA 4OYAA 1FRXA 3JTPA 1QD1A 4FN5A 3GCXP 2B56A 2KN4A 2CQBA 2UXDJ 4OYOA 2IJRA 1NB2A 2VOPA 1RWPB 4DL5A 2ZDPA 1S72S 1IBLF 2WSCC 3DI6B 2M0GB 3ILLA 1WC1A 3AJDA 5LOQA 3FNNA 2FDNA 4ZVRB 4LMZA 1LFWA 1RCOB 4WYWA 2ACYA 3DFEA 2QL7B 3N6LA 5L8RC 1NK0A 1X4DA 3SIPB 2ZM6F 2ZZMA 4KIAA 1NK4A 1HQUB 2IVMA 3KLEB 5HP1B 2XY5A 3M32B 3HULA 1NK6A 2EKNA 3H25A 2UU9F 2KJVA 4PXDA 2MKHA 1WDTA 4GRSA 5DGAA 3CCSS 7FDRA 1S1VA 4JI2J 3GYNA 4O4GB 2GJFA 3X1LB 2LQ5A 1F3FA 3M2UA 4USWA 2NYHA 4DSIA 1GX6A 3AB4B 3R97A 1RT5A 3G9CA 2QC3A 2QYCA 2W9AA 1S6OA 3TVYA 5CYMB 3M9MB 3OLAA 4KC5A 3TYTA 1I1GA 3HHLD 5F41A 2V2QA 4GMKA 4NLDA 1S77D 3PYFA 2WVEA 2C3MA 2VHGA 1Q81T 1Q95G 5G4DA 4DL3A 3OFGA 2B7CB 4DX7A 1D09B 3RAMA 2XO6A 2APOA 1FKOA 4FF4A 2FC8A 3UNGC 2ZUAA 4U67Q 4CO5A 2HBZB 1CQMA 3OTEA 3PYDA 1RAGB 4CLPA 3G6XA 2M88A 1LKZA 3GJSB 2IC3A 5LL6d 4CM2A 5KFOA 4CCHA 3ILIA 1VK8A 1GFWB 1NJZA 5GAGI 2HZAA 4ECXA 4NOHA 3I87A 1NDCA 1L3UA 3EYZA 4B9MA 3SXLA 4K50A 1Q1KA 3J7ZT 2HLUA 3RB3A 2MZRA 2L9WA 2XO7A 2E7VA 1FXDA 5L38A 4CH0S 1RT6A 2WBMA 2IJNA 1W2IA 2K8GA 2EFOA 4JI7F 1TK5A 3FVYA 4NLXA 4N41A 3QFHA 3NGSA 2D41A 2O3DA 4QYRA 1S0NA 4RO0A 1EQMA 4NASA 1HWLA 2NPIA 1WG5A 3M32A 1IBCB 4TYBA 2WW4A 3AA8A 2J0QD 3ZZTA 3UCZP 2W2PP 4JV5J 4DR2F 2Y1JA 2RQKA 1XNRF 3NAIA 5B0EA 2XHCA 2FLOA 3DRPA 1T05A 2EI5A 1P9QC 3N28A 5FJ4A 2DNMA 4X84A 3VCDA 5HVHA 4NA1A 1TL1B 4RW9A 1WHXA 3GIIA 3TARA 2XS5A 4DCJB 2DNQA 2OLWA 3GIRA 1H3DA 2D3UA 2ZE2B 4DSKA 1Q0NA 3D7SB 2UUTA 3VR1A 4RUCA 5DQGA 3M8YA 3I9ZA 2ALZA 1EARA 4CLKA 4CT9A 2QYGA 2K2PA 2Z57B 2DITA 4ZJLA 1NKBA 1S0MA 1VBZA 2B8PA 1VR6A 4H54A 1C1CA 3ZO7A 2UU9J 2AWZA 3AD8C 1WC0A 1JLGA 2KFZA 4ELVA 4RBVA 5K8NA 2DNLA 4UOCA 2OSRA 3R2DJ 1NPPA 1SC3B 3CVKA 4M5GA 4WE1A 5FDLA 5HANA 3QBCA 2MQMA 5DQIA 3OV7A 4EWTA 3D5MA 2F3JA 4ED7A 3BSCA 3M8SA 1ZTWA 5CZXA 3JXOA 3FCHA 5L1JA 4R5PB 2KDOA 4OYMA 3QWUA 3TUPA 2XYGB 3Q24A 2XMAA 4NPOA 1RAOA 1LWEA 1Q16B 4GVBA 4ZCMA 2NSCA 4MK7A 5DO2A 4WFNQ 4LF8F 4DV5J 2DYAA 5E3RA 1GH8A 1LK7A 2YKOA 4NI2B 2W9CB 4OHYA 3MEDA 3MMAA 4ETZA 2XMVA 3HHKA 4ZVOB 1VRQC 1AW0A 3MMCA 4KRWA 2SXLA 2HGLA 4USUA 2JSXA 4F3MA 3IR7B 1NK9A 1F5CA 1BXNA 2CADA 5L1IA 4JI8J 2PDAA 1RE1B 3T5KA 1RAFB 2KL8A 2RT3A 2V68A 2MLXA 2JRSA 2AW0A 1WF1A 3F44A 1CVJA 3THTA
chains in the Genus database with same CATH topology
2WVEA 2WVCA 2HZAA 2BJ8A 3BKTA 2CA9A 1Q5YA 3BKUA 2F1FA 2BJ9A 2Y3YA 2CADA 3QSIA 3LGHA 3BKFA 2PC6A 1Q5VA 3OD2A 2CAJA 2FGCA 2HZVA 2BJ7A 2NZCA 2BJ1A 3PHTA 2WVDA 2WVBA 2BJ3A 2WVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVE A;  2WVC A;  2HZA A;  2BJ8 A;  3BKT A;  2CA9 A;  1Q5Y A;  3BKU A;  2F1F A;  2BJ9 A;  2Y3Y A;  2CAD A;  3QSI A;  3LGH A;  3BKF A;  2PC6 A;  1Q5V A;  3OD2 A;  2CAJ A;  2FGC A;  2HZV A;  2BJ7 A;  2NZC A;  2BJ1 A;  3PHT A;  2WVD A;  2WVB A;  2BJ3 A;  2WVF A; 
#chains in the Genus database with same CATH topology
 1RA6 A;  3CCW A;  3GIL A;  5IS2 A;  1RWN B;  1AUS L;  2WZ1 A;  4YS2 A;  4JI7 J;  3DHX A;  4A4J A;  1XBW A;  5B0F A;  2J6T A;  2VBY A;  1SJR A;  1MMN A;  2CNL B;  4I2P B;  4LFC J;  3D6H B;  1B99 A;  4IO9 Q;  4YHH F;  1DAX A;  4DS4 A;  3ZZR A;  3NRB A;  3IR6 B;  5DET A;  4LF2 A;  3TOQ A;  2IAJ B;  4LFB J;  1XNR J;  2H9Z A;  3R5B A;  2WB1 D;  1T9Y A;  4NLR A;  2YKN A;  2CQG A;  3K7R A;  4C0B A;  1VQ5 S;  3ISN C;  4Y00 A;  1UVL A;  4WBF A;  4R5P A;  4R25 A;  2Y9H A;  4AT1 B;  3SZ2 A;  3GMG A;  3JS9 A;  4WFZ A;  4ED6 A;  5B7W A;  3W2W A;  5BR8 F;  1WHY A;  4OZL A;  4A8W A;  3DOL B;  3NNA A;  5JVH Q;  5F8J A;  1HAR A;  3Q8P B;  3LO3 A;  1TL7 B;  5HRO B;  3HHL C;  1IKX A;  2YPY A;  3PW5 A;  3KHR A;  3LAL A;  5K8O A;  1H2T Z;  4RBU A;  4ZJQ A;  1YQH A;  3R27 A;  3BO4 A;  3TAP A;  3IWN C;  3RBX A;  3CCZ A;  4FS1 A;  3DDK A;  1JLE B;  4P74 A;  4A8K A;  3H2U B;  3AHP A;  3SBM A;  4JV2 A;  2UUA J;  3EE3 A;  1RDR A;  2PI5 A;  2HHQ A;  1CS4 A;  2VF3 A;  5KG6 A;  1U45 A;  3C8Y A;  4P2X A;  4ECV A;  1RAD B;  3D54 A;  5D0H A;  3UWT A;  1HYS B;  2GVZ A;  3WC0 A;  1SI9 A;  1D0E A;  1YJ9 S;  4MIB A;  2BV3 A;  3GFX A;  3U1N A;  1U1N A;  3PCO B;  4OL8 A;  4ES2 A;  3I6P A;  3P5B P;  1RKJ A;  4NA3 A;  5D0E A;  1SKU B;  4MIW A;  1EB0 A;  1SJ1 A;  5D4O A;  2VFR A;  3M2R A;  1S7H A;  4OHZ A;  1RTI B;  3TX8 A;  1FJE B;  2VOO A;  4LF8 J;  5IC6 B;  2HW3 A;  3HJF A;  4C8O A;  3MEE B;  3UDE A;  3PX6 A;  2IAJ A;  2RF2 A;  2WB4 A;  4CYU B;  4Q7A A;  3G8S A;  3HKW A;  4JP8 A;  3QMQ A;  3EGN A;  3LWL A;  3QT8 A;  3BBC A;  2NZ4 A;  2RU9 A;  4Y2I A;  2ATC B;  2M8D B;  1T0T V;  2ZH2 A;  1LW2 B;  4ZHR A;  4HKQ A;  3IS9 B;  2WW8 A;  1NRK A;  2GIQ A;  2BQ3 A;  3IRW P;  3H5Y A;  3ZZP A;  2V63 A;  1HQ2 A;  4KHR A;  2KI2 A;  2VG5 B;  3DOL A;  2NYI A;  2MQP A;  1VQ4 S;  3PR4 A;  3KHL A;  1PJ7 A;  1VQL S;  4DLG A;  3BQ2 A;  1KHW A;  1Z2L A;  1YZ6 A;  4YB1 P;  3CJ0 A;  3MMB B;  5HN0 A;  1FFS B;  4OV1 A;  1U0H A;  2HMI A;  1M5P C;  4OZ2 A;  2EFV A;  3HKZ D;  1WC6 A;  2CNO B;  4CH1 A;  4DDF A;  2YQ1 A;  2JVO A;  5FD1 A;  1REV A;  3SCK E;  1N5Q A;  3C66 A;  3PNI A;  5F0W A;  3C6U A;  3ZTQ A;  2LQ9 A;  2Z56 B;  3FCW A;  3Q8S B;  4ELU A;  1HYS A;  4FBT A;  2W7O A;  4ECR A;  4ED0 A;  2WON B;  3RB6 A;  1JKH A;  2E5L J;  4DBQ A;  2FVC A;  4EYH B;  4NCG B;  2X3G A;  5C25 B;  4GO5 X;  3MM8 A;  4OYZ A;  1JIH A;  2XLJ A;  3TAQ A;  2VV5 A;  1T8E A;  5BR8 J;  4UQT A;  4USJ C;  7FD1 A;  1RHM B;  1HLW A;  5HLF B;  4B3M J;  2ZVS A;  4UZC A;  4LR9 A;  4WK1 A;  3K59 A;  4OQJ A;  2P2C B;  1F2H A;  2VQF F;  2ILZ A;  1SL0 A;  3H4B A;  1XR7 A;  3EVM A;  1C0U A;  4A8S A;  3CMA S;  3HCX A;  4CYU A;  1TMJ A;  2BJ8 A;  5DG9 A;  2Y8W A;  3P3D A;  3DMJ A;  2I5J B;  3FK4 A;  5J2N A;  4ZK7 M;  1RTD B;  1BUX A;  3A3O B;  3TEH B;  2RQM A;  4OZ3 A;  1YSJ A;  1ZM2 A;  2RH3 A;  2GHW A;  5MAO A;  1K0T A;  4JV0 A;  4PXE A;  5B0B A;  2CYY A;  2XMJ A;  4RW6 A;  4NLS A;  2FVS A;  1OWX A;  3PEH A;  3MDF A;  4DSF A;  1WF0 A;  1U6B A;  3JB9 k;  5A8K A;  3T1Y F;  1E6V A;  4AUK A;  3POT B;  1DTT A;  3B8H A;  4L72 B;  1S9E B;  1XR6 A;  3M30 A;  4V19 X;  1UVI A;  5K20 B;  1VJW A;  1CJV B;  2V4J B;  3PHE A;  4LF6 J;  3SV3 A;  4ICL A;  1S0O A;  4GKK J;  2OEK A;  3QJL A;  1AYE A;  3C15 A;  3G8T A;  3KLI A;  4UZB A;  4TY8 B;  3H5U A;  3HF5 A;  2VPY B;  3ICL A;  1NHU A;  4XO0 A;  3BF4 A;  1SBR A;  2VA2 A;  5ETN A;  1KC8 T;  1CG2 A;  5ADZ A;  2YKM A;  3V6H A;  1C1B B;  1LQ9 A;  3BPS P;  1H38 A;  2JHE A;  2OGU A;  3VHQ A;  2H48 B;  1X9M A;  2OHD A;  9RUB A;  2BVZ A;  4CLL A;  2FGC A;  4G1Q A;  1B7F A;  3K89 A;  1AUD A;  2YNF A;  2I38 A;  4MK8 A;  2XQC A;  4DR4 F;  2L08 A;  2BZ2 A;  1RWM B;  3IRX B;  1UVM A;  3SV4 A;  3UVJ A;  5A76 A;  2JEJ A;  1N52 B;  3P45 B;  3MR6 A;  1RTD A;  2Q43 A;  2J0X A;  1VQ8 S;  1FNM A;  3BM7 A;  3G8Q A;  2JJ4 D;  4IDK A;  3I82 A;  3KJN B;  3HLU A;  4RW4 B;  3JTN A;  1T9U A;  4B3S F;  4M5K A;  2AF6 A;  2KH9 A;  4ALZ A;  3MPY A;  5E3Q A;  4ILM A;  4ID8 A;  1OIA A;  2C2E A;  3TJ9 A;  5KG2 A;  3NGR A;  2ZH6 A;  2C3P A;  1YKW A;  1UKU A;  4PXC A;  2FJB B;  2HK2 A;  1LOU A;  4RX6 A;  5KFF A;  2VJU A;  1N32 J;  3MFI A;  2Q6C A;  2I1R A;  1RWV B;  3LWM A;  1LWF B;  2CPZ A;  4TY8 A;  2F9D A;  2EW9 A;  3QQC D;  4C3K A;  5HQL A;  1R3N A;  2HFU A;  2ACM A;  2UVR A;  3IC1 A;  3R6L B;  2EFN A;  4J9R A;  3I0S B;  4WF9 Q;  3DGV A;  3KG1 A;  1KWM A;  1FFG B;  5MLC V;  2YKA A;  1IM6 A;  1U1O A;  2RQ4 A;  2QG9 B;  4NLU A;  1Q7L B;  4GO7 X;  3EGZ A;  1HBM A;  4P7T A;  3CXC R;  4WZM A;  2VKZ G;  1F3V A;  4OX9 F;  5HVF A;  2MST A;  1M90 T;  4LSL B;  4NLQ A;  4NRT A;  3IGN A;  2V8P A;  2FJV A;  3V6J A;  2Z8Q A;  3ZTR A;  2XTJ P;  5GMD A;  3QJJ A;  1WEL A;  1RU2 A;  5LSO A;  2K1R A;  4PG8 A;  4ZA1 A;  1X5O A;  3HVR A;  3DM2 B;  1MU2 B;  3IM9 A;  2HK3 A;  2J6U A;  2JNJ A;  4EBE A;  1S0V A;  4RNH A;  1WDD A;  1FRJ A;  1VIO A;  4DR5 F;  1PIE A;  4NLO A;  2KHD A;  3H2V E;  2V8D A;  5B0D A;  5AXL A;  1X4A A;  4J9U E;  3GJQ B;  3K17 A;  3CC2 S;  1QAI A;  1UFL A;  3T6B A;  5CQG A;  1ICE B;  1X0P A;  2YQ3 A;  5CH7 B;  3F41 A;  1RZM A;  2ZEJ A;  4PEO A;  1CJT B;  2D69 A;  2PA8 D;  4P71 A;  3VTI A;  2JLE A;  1H2U X;  2HGM A;  2W7P A;  4FF1 A;  1RXO B;  3GIM A;  1GMU A;  1U02 A;  1VHF A;  1LWF A;  2ASD A;  4J9M A;  4O23 A;  2KTQ A;  4LF9 F;  1EZZ B;  1KQF B;  3V81 B;  4QIF A;  5C42 A;  4N77 A;  1U0S A;  4S0M A;  4B3S J;  2AZ3 A;  2J9C A;  2QA1 A;  2CWX A;  3IAS 9;  3VAL A;  5HBM B;  3VWS A;  5DDQ C;  3QAU A;  2AGP A;  1RGV A;  3PAC A;  4WKY A;  2ILY A;  3MR5 A;  2LEA A;  1FRH A;  1VQO S;  4B9V A;  3SMZ A;  1UFK A;  4LSL A;  4KQZ A;  3CDB A;  4NZ7 A;  3EXY A;  2YQ0 A;  4WP9 A;  1S6Q A;  4AXJ A;  2RNE A;  4Y34 A;  3ENV A;  2ZH8 A;  1KEK A;  3FJ2 A;  2B3T B;  4ILR A;  4CNY A;  3DM2 A;  4FKY A;  5DQH A;  1MU2 A;  3P49 B;  3CD6 S;  1WEZ A;  4FZV A;  5THW A;  2AYB A;  2CQD A;  4NEZ A;  4B3O B;  3E01 A;  2I6W A;  2HQ3 A;  4LUB A;  2OEL A;  3UQS A;  1FES A;  1Z2Z A;  2JC0 A;  2LA4 A;  1AFJ A;  4Q2M A;  3HD1 A;  1YRU A;  3R5J B;  2WCX A;  3B82 A;  3KNG A;  4G1P A;  1PIL A;  2W2Q P;  4DG1 A;  4YB7 A;  4ENO A;  4AYB D;  3LP1 A;  2QN6 B;  2MY7 A;  1YJV A;  2ATL A;  1UJ6 A;  4OYI A;  3D28 A;  4ID5 B;  1DLO A;  4CQ1 A;  3IBC B;  1FXL A;  2BOP A;  3MXH P;  1RB0 A;  4RW8 B;  4NYP A;  4YDD B;  1CJK B;  1TKZ B;  1PBU A;  2FVP A;  4H4K C;  1Y7P A;  2Z30 B;  3UDV A;  2LEB A;  3Q22 A;  1IKV B;  2XSJ B;  3MCN A;  3HM9 A;  1B0P A;  1RLD A;  2UVU A;  4DR5 J;  5E3P A;  2DIS A;  2CUY A;  4NLG A;  3I4P A;  3J7A 1;  1N54 B;  2MZS A;  1N5V A;  3JYT A;  1TKT B;  3NBP B;  1FT8 A;  3PYE A;  5KFK A;  2MXY A;  5ITH A;  2OI2 A;  2CPE A;  2IM3 A;  2EC0 A;  5IOL A;  2E1R A;  2HHV A;  3FEZ A;  4F67 A;  3NNH A;  2CZ9 A;  3BGR A;  3BKF A;  3KJV B;  2NR0 A;  2PN6 A;  2E7X A;  1WOO A;  1LV5 A;  3SDE A;  3W5Z A;  5IZH A;  2V8H A;  2LCW A;  4ZPA A;  5AT1 B;  5KFI A;  5ETM A;  3DYA A;  1FDB A;  3DRR A;  5RUB A;  3M2V B;  4JI0 F;  3W8P A;  1N0V C;  5KFT A;  5IV3 A;  2ZOG A;  5B08 A;  3OLB A;  5DDR C;  1J5O B;  2COL A;  3T5H A;  2HQG A;  3NEK A;  4RU2 A;  4KO0 B;  4QOT A;  4DZD A;  3FRY A;  4Y65 A;  4F4Z A;  4WFA Q;  4A8X A;  2B6A B;  3DU5 A;  2HPU A;  1HNX F;  4FYD A;  1GXU A;  4ELT A;  1HHS A;  3MM7 B;  4O3S A;  1JNZ B;  1NSA A;  4WU2 A;  4UTG A;  3CE8 A;  2QJ3 A;  4RW8 A;  1REG X;  1JMT A;  5H9F J;  2K7J A;  2XLI A;  5HSP A;  2GCF A;  2QLW A;  5AE3 A;  3MCS A;  1Q5Y A;  2W2N P;  2F40 A;  1RT2 A;  2XMM A;  1A0O B;  1F6T A;  1SKW A;  1S10 A;  2ZJQ Q;  1IVZ A;  2RB7 A;  2CJK A;  3ET6 B;  2VPW B;  2F8H A;  1WTF A;  1RT4 B;  3MM5 B;  2RRN A;  4ES3 A;  2BR0 A;  3KWM A;  5IT0 A;  1S6P B;  3GR1 A;  1KLN A;  3RG6 A;  3GYX B;  2MQN A;  5K14 B;  4ECY A;  4YY3 F;  2VFT A;  5KFX A;  4O3Q A;  4I69 A;  4DR7 F;  2XCA A;  2CRL A;  2BEF A;  4ZCK A;  2GA7 A;  4USI A;  1V5V A;  4B3T F;  2UXB F;  4B9N A;  3U02 A;  4NE9 C;  3MPV A;  2CQ1 A;  1F60 B;  1W7W A;  3HHN B;  3GQC A;  3G82 A;  4ETX A;  3LGM A;  4OZN A;  5B0A A;  3RYL A;  5KFQ A;  3M2V A;  3CJQ A;  3NGU A;  1MWY A;  4A47 A;  3OL9 A;  5AE2 A;  4JI6 F;  3KMS A;  4I0W A;  3EZO A;  2MEW A;  1R27 B;  3FFI A;  1UPP A;  1ZA1 B;  1EJ7 L;  2IRU A;  4X4S A;  2GV1 A;  3BGL A;  4DL7 A;  1VQ6 S;  2N7C A;  4QCL A;  2F9J A;  1YLX A;  2ROG A;  3J81 Y;  3C2P A;  1IKY B;  3BYP A;  4URQ U;  3ZTP A;  5KFA A;  4I68 A;  1Z1Z A;  3MUR P;  4X2B A;  3V4I A;  4CI0 B;  1MG7 A;  2CAJ A;  1T7P A;  2XLK A;  4C2M A;  5DDP C;  3OBI A;  2LFV A;  4B9L A;  3HZE A;  3M8R A;  3M1V B;  5LMN F;  2DR9 A;  2JZ5 A;  3R6G B;  1CC7 A;  2OPR B;  5E33 A;  5EWE A;  5EX0 A;  1D8Y A;  4KY3 A;  3IXQ A;  2YX4 A;  1YTY A;  1TQL A;  3ULH A;  1H73 A;  4JI0 J;  2LXF A;  1VLY A;  3OFE A;  4TN2 A;  1BWE A;  5KT2 A;  3N0V A;  1S6P A;  5KFG A;  1S1T A;  1RWK B;  1VGY A;  3BDP A;  3W2V B;  1H2V Z;  1OSC A;  2XS2 A;  4AE5 A;  4DR6 J;  1QVG R;  4LVO P;  2XWX A;  1B3T A;  2KZM A;  1HHT P;  1ZOT A;  2UV8 G;  3D68 A;  1NJY A;  3CF5 Q;  4WXW A;  1V3S A;  1HBU B;  5KFY A;  2ZC3 A;  1FRM A;  1ZPV A;  1KON A;  3AXK A;  3FRZ A;  4QR1 A;  3GZ7 A;  4LVN P;  2HVH A;  5CD4 H;  3BSO A;  3D3B J;  4FKX A;  4DN9 A;  4ED1 A;  4DPY A;  2DH7 A;  1NZ8 A;  3DGP A;  2XCP A;  3IWX A;  2FHM A;  1JLB A;  2MB0 B;  2B9X A;  4AL5 A;  5HMX A;  3VAF A;  1RWO B;  1UWA A;  4FNH A;  4J91 A;  3SEO A;  4TYA A;  2ZBP A;  3AXM A;  4LF4 J;  3EX7 B;  4DFP A;  1GX5 A;  3VQS A;  1LWX A;  2DHA A;  1YVF A;  3KYL A;  2AHO B;  4NZ6 A;  1Q5V A;  1S1U B;  1WI6 A;  2WOM B;  4HT7 A;  4P52 A;  2DXE A;  3QFW A;  4B3T J;  1GAO A;  2UXB J;  1N5S A;  2HBR B;  5AXN A;  2BKP A;  2HHX A;  4PQU A;  3O8W A;  2W01 A;  2E5H A;  2HVZ A;  1TEL A;  3JAM Y;  1Y10 A;  3THV A;  2D9O A;  1RHK B;  3R1H A;  2J0W A;  5BXI A;  5KAK A;  3RJM B;  5AE1 A;  3PM9 A;  1VJQ A;  3I5A A;  1LW0 A;  3EVO A;  3N6M A;  3T19 A;  1SH0 A;  2OTL S;  4KGM A;  5D78 A;  2UUW A;  5GAE U;  2FZG B;  2GQ2 A;  2QMW A;  4JI4 F;  4YB5 A;  1HMV A;  4U7U D;  2V9K A;  2Q6B A;  2IM2 A;  4A8Q A;  1NCL A;  2H3E B;  1UCN A;  3UE2 A;  3GCW P;  1HIY A;  2GGP A;  1XER A;  2F4F A;  3GPA A;  1RP5 A;  1HBU A;  2CIM A;  2F4V F;  2AYG A;  1NKC A;  4JYA J;  1JX4 A;  4CO1 A;  3RRH A;  4CO2 A;  3KFW X;  1OYE A;  3D6T B;  4OX6 A;  1MW7 A;  5KFL A;  4Q5V A;  1SXL A;  1M0S A;  3MF5 A;  3C14 B;  2EC2 A;  5D3G A;  5HO4 A;  1FNO A;  4RNN A;  2QO3 A;  5LMN J;  2O66 A;  2JWN A;  5L39 A;  4LSN B;  2RML A;  2LU1 A;  3DKD A;  1RT1 A;  3GFH A;  5C7P A;  1FEH A;  1JLA B;  1J2V A;  1YIT S;  6AT1 B;  3OUY A;  3D0I E;  1UAW A;  1GEH A;  1G2E A;  4CLY A;  4U7C A;  1S79 A;  4LFA J;  3S7R A;  3LPE A;  1NPR A;  3OJU A;  3EGV A;  1HWK A;  4UT4 A;  1GQE A;  4YR3 A;  3R5A A;  3IP0 A;  2J9D A;  3V5R A;  2IM1 A;  3UPF A;  3T1H F;  5A6W A;  2WOM A;  4TU8 A;  3GP9 A;  3BO3 A;  2AX1 A;  2V50 A;  1WG4 A;  2RDD A;  3PVX A;  1TUG B;  4C6A A;  2MKK A;  4UST A;  1WOP A;  4A8F A;  3V6K A;  4AXI A;  2DR8 A;  3NCQ A;  1VBX A;  2OUG A;  4DU8 A;  4JI1 F;  1A9N B;  2FC9 A;  3ILJ A;  4WP3 A;  4YEA A;  4EMD A;  3CT9 A;  1MSW D;  4BCA A;  2GJ2 A;  3H98 A;  2KKH A;  3BGF A;  1Y3K A;  2AX0 A;  2PGC A;  2MGZ A;  2GIF A;  3EGW B;  2KYX A;  2HQC A;  4J9N A;  5KFV A;  2RAQ A;  3KNA A;  2DGW A;  4IKA A;  2HG4 A;  4DPW A;  2DNH A;  3UN5 A;  2QT7 A;  1ULR A;  3I9V 9;  3AJ2 A;  1YI2 S;  4HVZ A;  2AEJ A;  3QJP A;  3C6T B;  4C3L A;  4DUZ J;  2VFU A;  3JSM B;  3MEG A;  1TR0 A;  4DUY F;  3LP2 B;  4GKJ J;  1H74 A;  3FCV A;  3OFH A;  1UET A;  4HHH A;  1ZZF A;  2B8Q A;  2HBQ B;  3QAE A;  1NJI T;  3MOJ B;  3D0G E;  1P6T A;  2YNH B;  3SQG A;  2VKR A;  3DDI A;  4MKV A;  5A8W A;  3CGI A;  4NEY A;  1HBN A;  2ZNY A;  3SI8 A;  4C7Q A;  4JI4 J;  2WTF A;  2CZV C;  2Y8Y A;  1R8C A;  3PX4 A;  3MOZ A;  4LRA A;  3ONQ A;  3L4B C;  4HAC B;  2AEM A;  2F4V J;  1U6Z A;  3D1O A;  1RT7 B;  2BAC A;  2HGN A;  2Z2M A;  3HXM A;  4DR1 F;  1TUV A;  3NL0 A;  2HUR A;  4ZCL A;  3M8Q B;  3MAA A;  2R7S A;  2UUC J;  2HEK A;  1FF2 A;  1I6J A;  2R2S A;  2CDR B;  3P5T L;  4KFB B;  1IJF B;  3QYY A;  3TAM B;  4Z2X A;  4DS5 A;  1U1M A;  3HVT A;  3BEG B;  3OQ2 A;  1R8B A;  1HQE B;  1WTB A;  3RR7 A;  5ETS A;  3NY0 A;  5KT4 A;  1VQY A;  4NLP A;  4XIU A;  1FX4 A;  4C11 A;  4L75 A;  2RHQ B;  5F8I A;  4C8N A;  1N5T A;  1DTQ B;  3PO5 A;  3T1H J;  1SUQ A;  3OL7 A;  3QSY B;  2CPY A;  3PY8 A;  4BC7 A;  3C6T A;  3VVU A;  4C0O C;  1T03 B;  1ZPW X;  1URR A;  2GS8 A;  3HMJ G;  1S1X A;  4I7F A;  2HHH F;  3CJ8 A;  1BQM A;  1UW9 A;  4QIV A;  2CG8 A;  3QGG A;  2YNG A;  3VV2 B;  5IQQ A;  1UEU A;  4L6V 3;  4PWD A;  3KLH B;  3FBC A;  3P6Y C;  4EFA C;  2DGX A;  1VOM A;  2YNH A;  2J76 E;  3QRQ A;  1T9T A;  1L3V A;  3DOK A;  2HSE B;  4BWM A;  4EZ9 A;  2HVI A;  1CQN A;  4UUW A;  3TVZ A;  5F8M A;  4H4M A;  1FCA A;  1S4F A;  4LRE A;  4KV8 B;  4PKD B;  2HRU A;  1BHN A;  1PJ6 A;  3ZTS A;  3A1Y G;  3W60 A;  1Y4Z B;  1RYS A;  4QIW D;  1GXT A;  2XMU A;  3M8P B;  1V6H A;  2CQH A;  2W2O P;  1CUL B;  1N88 A;  2ASJ A;  2P5V A;  1IWG A;  4UOH A;  1H72 C;  4DV7 F;  4RUA A;  4X64 F;  3OVS A;  1SIW B;  4RBT A;  1RTZ A;  2XNQ A;  5JXS A;  2B9E A;  1JJH A;  3MUM P;  1OY6 A;  3T5L A;  2H1Y A;  1VRT B;  3QIP A;  1TVR A;  3KUH A;  4USK A;  1HQE A;  1ARO P;  1F5A A;  3NS6 A;  4IH6 A;  3ZNJ 1;  4FDF A;  1VS3 A;  4ER8 A;  4HL9 A;  2VG6 A;  1VC5 A;  1EKS A;  4YUD A;  4ZLJ A;  2IYI A;  4K4S A;  4NXM J;  4KYZ A;  5SUH A;  3QGI A;  2XS7 A;  2OH2 A;  4WII A;  1KOO A;  3F0N A;  2GJI A;  2FGO A;  1H98 A;  4ITS A;  3EXC X;  2FZK B;  2JH3 A;  3LW5 C;  1TKX A;  3MFH A;  1BD6 A;  2IFX A;  1XN9 A;  3MPD A;  2VON A;  2W4C A;  3WZ0 A;  4DR1 J;  2LKZ A;  4HI1 A;  1RU1 A;  2KT2 A;  4P2M A;  4ZVP B;  4AD6 A;  1RCX B;  1ZH5 A;  5KOW A;  3HZG A;  2CNK B;  4PUO B;  3W5X A;  3EMT A;  2QA4 S;  1IBK F;  2X1A A;  3BQ1 A;  4ECT A;  5LT5 A;  3BDE A;  2AGQ A;  3H59 A;  3RTV A;  4Q8F A;  1X5T A;  1MN9 A;  3NG8 A;  2KVQ E;  4P2S A;  1RTH A;  3CCR S;  2IBK A;  2DRB A;  2FLL A;  1WI8 A;  4NL5 A;  2V0N A;  4LF1 A;  5HI7 A;  4EU0 A;  3QT7 A;  3E2E A;  1B0V A;  3HFV A;  3A4T A;  1QLN A;  2QFI A;  3FQK A;  2ASY A;  2HWI A;  4CH7 A;  2WSE C;  3QWP A;  1HD1 A;  3HVA A;  4ZMM A;  4WTO B;  4QW9 A;  1U8S A;  1S4E A;  4NZ0 A;  2X7I A;  2VC0 A;  2VBW A;  2A2D A;  1KFD A;  3CDU A;  1N6Q A;  4F36 A;  4MIA A;  3H5S A;  1CUL A;  1QAY A;  3RR8 A;  3GV5 B;  1ZM4 A;  5IC4 B;  4XK8 C;  2HHH J;  3IR5 B;  5ETP A;  1YIJ S;  3PIO Q;  4IG3 A;  5D15 A;  4GC6 A;  4WZQ A;  3VGT A;  2QLJ B;  2LLZ A;  5C24 A;  4YR2 A;  4Q0B B;  2RIL A;  2C2Z B;  2CKW A;  1SL2 A;  2G0J A;  3TRG A;  1MWZ A;  3L7P A;  3N79 A;  4KHM A;  1VI7 A;  1RAC B;  4R8U A;  1S57 A;  5F9L A;  1HNI A;  5KT7 A;  1A6L A;  1KTV A;  2UXD F;  3QZ7 A;  4CTA B;  1IJE B;  4IFV B;  1UJ5 A;  1TKD A;  5KT5 A;  1HBO A;  4OLO A;  4YME A;  3N5B A;  4IRK A;  2V34 A;  1K44 A;  2KHC A;  1OY9 A;  3I96 A;  4DV7 J;  4X64 J;  3JTO A;  2KZZ A;  1F5B A;  4PG5 A;  4G3I A;  1YGY A;  3KLF B;  1YK9 A;  3BN4 A;  2B9W A;  1WC3 A;  1QE1 A;  2FHJ A;  3DRS B;  1FTC A;  3LP0 B;  4RPF A;  2OSQ A;  1M5H A;  1SV5 B;  2QA4 G;  5A6P A;  3LAM A;  4EO6 A;  1QSY A;  1JLF B;  1HNV B;  3L3C A;  3TUJ C;  5C5J A;  1HPZ A;  3PJW A;  4M5N A;  1C0T A;  4Y2K A;  3HHL B;  4NLV A;  2NCK L;  3GIJ A;  1TV6 A;  3K5O A;  2LVW A;  2QA2 A;  3HDS A;  1XNQ J;  1VDH A;  2H51 B;  5CA5 A;  2QGF B;  4Z7Y A;  3SCI E;  2JC1 A;  1IBK J;  2G2O A;  1RWW B;  3A3N B;  3DCA A;  2HFV A;  3VAG A;  1X4G A;  3IBW A;  2DR5 A;  3MR7 A;  3NMR A;  1MRO A;  3BH7 B;  4ECQ A;  1SC4 B;  5HK4 A;  4UY8 T;  3DOM B;  4RJV A;  1VRU A;  2JOQ A;  1KSP A;  5IM0 B;  4EZ6 A;  4DX5 A;  1WUU A;  1MNE A;  2J8A A;  4OYW A;  1ZM3 A;  3CNQ P;  1NM2 A;  2DEJ A;  4P10 A;  3KK2 A;  4UOF A;  2BAB A;  5CYQ B;  3NGK A;  3RGI A;  3QLH B;  3M8Z A;  5D77 A;  1QTM A;  2VDH A;  2FZC B;  2IM0 A;  2PO4 A;  4DV4 F;  4M63 A;  3R7B B;  3TZX A;  2AV5 A;  2BW7 A;  1EQ0 A;  3OR2 A;  2L48 A;  2HAI A;  4MFB A;  1BY9 A;  1SQE A;  5G0R A;  4JI5 F;  1AZS B;  3MM6 B;  3M9O B;  2HWH A;  4OHW A;  1TL3 A;  4RR5 A;  2JEG A;  4P2F A;  3MZI A;  2BKO A;  1VC6 A;  2PEH A;  4F2R A;  3PW2 A;  2BAN B;  3JSY A;  4FBU A;  1AFI A;  1UWB B;  5F8L A;  3R2C J;  1JLF A;  1HNV A;  3CJ2 A;  3HHE A;  3IAM 9;  4OI2 A;  3I31 A;  3MUT P;  1R6V A;  3HHL A;  3IG1 B;  4DF4 A;  2RE1 A;  1YG0 A;  1RT3 A;  2AJ2 A;  3QGH A;  4AL6 A;  3M6V A;  3K5P A;  3DNC A;  3T9N A;  1FJG J;  2G13 A;  3EWG A;  4FF3 A;  3R1L A;  2A18 A;  3Q8Q B;  4WFB Q;  3EZ5 A;  4LIR A;  4IO1 A;  4MT1 A;  4ZPD A;  1M5K C;  3CJS A;  3JQM A;  1LWC A;  1SJF A;  3J81 U;  3W9J A;  1GMW A;  1BLU A;  5K8M A;  4JI3 J;  3MEC B;  1FK9 B;  2W24 A;  3O1L A;  1LFP A;  2YTC A;  4MKY A;  1V3R A;  3SYZ A;  2UUB J;  3PJ9 A;  3TNV A;  1Y5N B;  2PMW A;  2UV8 A;  3H0P A;  2IYG A;  1Y3J A;  3UW1 A;  4ZLL A;  4DQS A;  3GON A;  4DCP B;  1RHQ B;  1RWU A;  2GQC A;  2BE2 B;  2EFG A;  4WTY A;  2B5J A;  2IIH A;  3Q2S C;  3ENW A;  1R7I A;  2QIF A;  3NLC A;  4FYW B;  1MWQ A;  3ITH B;  3A3P B;  5I42 A;  3CJ3 A;  4CZC A;  3DLJ A;  2E1P A;  4K4T A;  2G4B A;  4TQR A;  4J9O A;  2RQC A;  5B09 A;  2YNI B;  2E1M C;  1NK5 A;  2HND B;  3BB5 A;  4DV5 F;  1Q8K A;  2OD6 A;  4NYZ A;  5GAD U;  3ADA C;  3I55 S;  2BOA A;  2DNZ A;  4J7C A;  1ZAX A;  1R6Y A;  1UVJ A;  5BYS A;  2XMW A;  1X31 C;  2OML A;  3Q89 A;  1RUS A;  2BX6 A;  2EWH A;  4QJV A;  2M4M A;  2WSF C;  5M2U A;  2ZVI A;  4QWD A;  3FBB A;  5LMU F;  4JI8 F;  3DI6 A;  2XI3 A;  2WAQ D;  4F25 A;  1R0A B;  3BH6 B;  3A13 A;  3ELH A;  1HR0 F;  3S6E A;  4X4U A;  5A8R B;  4DV4 J;  1UJ4 A;  5KOX A;  2EFP A;  4PG4 A;  3UI3 A;  2PII A;  1FXR A;  1XMB A;  2AU0 A;  2RVJ A;  2JEF A;  5DJB A;  4JI5 J;  1ZAV A;  2YWK A;  3CTR A;  1FKA F;  2P9E A;  1G4C A;  3T3F A;  4OI3 A;  5JVG Q;  1HQU A;  5DGB A;  3KLE A;  5HP1 A;  2HIQ A;  4LFC F;  1JJC B;  2KFY A;  2YY3 A;  2IDE A;  3BGO P;  2HQI A;  4EO8 A;  2R4F A;  2HBY B;  1NSQ A;  1N56 A;  2AQ4 A;  2IMO A;  4LFB F;  4O4G A;  1X5S A;  4XDC A;  1DHM A;  1FRI A;  2ZC4 A;  2UVV A;  2MKS A;  3W5Y A;  3PW4 A;  5CYM A;  3JAM U;  2VIH A;  3NNC A;  5E3C A;  3U1M A;  4ZVH A;  2VDI A;  2Y1L B;  1N4L A;  1QY7 A;  2HNZ B;  5GAE I;  4IG0 B;  3CMQ A;  4DSL A;  1M1H A;  3ZZO A;  1KOH A;  1R43 A;  3GJT B;  1YBU A;  3LQV A;  2W8K A;  2IDL A;  2K7K A;  3I5B A;  4TY9 A;  3GR0 A;  2JX2 A;  3BV8 A;  2Y1I A;  4Q43 A;  3F73 A;  4JOU A;  2D3O 1;  2HFN A;  1U47 A;  3FSY A;  5IXU A;  1U7L A;  1SJ3 P;  2FHO B;  3B54 A;  2UUA F;  4QPT A;  5LSL A;  1KN6 A;  3KK1 B;  2VG7 B;  1W26 A;  3C3L A;  2XG8 A;  5H1S V;  4L3N A;  3VGV A;  3NCP A;  2B4P A;  1NME B;  4L74 A;  3LA0 A;  4HHU A;  1SIZ A;  2Y1R I;  1X8D A;  1FVQ A;  4LR8 A;  3ILO A;  1UP1 A;  2N7Y A;  1H0H B;  3HHD A;  3TX0 A;  3KK3 B;  3QRP A;  5HJX A;  4B3R F;  1K9M T;  3P96 A;  3JSB A;  4CRJ A;  5T7L B;  4F0M A;  3I5C A;  1R8H A;  3M8W A;  4IFY B;  4WK3 A;  3N01 A;  2B4U A;  2J8S A;  1AB8 A;  3K5M A;  3CIM A;  1TL1 A;  1XJW B;  5LMU J;  2KG1 A;  2R7V A;  2D74 B;  2VZ9 A;  2ZE2 A;  1HR0 J;  4BC9 A;  3RRK A;  1U2F A;  4RW7 B;  1T94 A;  1XMO J;  1YX2 A;  1NKE A;  3TP2 A;  4NWB A;  4EUV A;  2XMK A;  1O0P A;  3VF0 B;  1NSP A;  4UOG A;  3J7Z 5;  5F0U A;  3RUB L;  5EDW A;  2HZV A;  2BQR A;  2KT3 A;  3CCE S;  1OYD A;  2FPH X;  3CCQ S;  1NHK L;  1DAR A;  4X62 J;  2FY8 A;  3CO9 A;  2F8M A;  1FHT A;  5A0Y B;  2C3Y A;  1VQ9 S;  3L7U A;  3HO1 A;  1PO6 A;  5I4M A;  3GWC A;  2ASL A;  2YBV A;  2VG7 A;  2YWG A;  2DGT A;  3N9U C;  2DXD A;  5BYR A;  2V6A A;  2E5L F;  2AP6 A;  3H90 A;  1YWX A;  3RB4 A;  1P1T A;  3BSA A;  1WC4 A;  2QX0 A;  2C2K B;  2YH0 A;  2OPS B;  4EYI B;  4O3R A;  4WFX A;  4B3M F;  5A2Q Y;  3MGJ A;  3KK3 A;  3E3X A;  4FPR A;  4DV6 F;  4NI2 A;  2W9C A;  2D3O R;  3CSK A;  1XWL A;  2VUG A;  1FDN A;  3DU6 A;  2WRM A;  4CT8 A;  2KO1 A;  1BQN B;  2YWW A;  1B64 A;  2BM1 A;  3P4U B;  3PFE A;  2OP5 A;  1YJT A;  1S1W B;  1AXQ A;  4ILL A;  2H4W B;  4RWW A;  3W64 A;  2DNY A;  2BJ9 A;  2I8E A;  2A1B A;  2FD2 A;  2MPU A;  3TUI C;  4IH5 A;  2WHO A;  1NXI A;  2LQJ A;  2J7U A;  1YBA A;  1UFW A;  5F3T A;  2GHV C;  3C16 B;  5ETL A;  1EAY C;  2OPP B;  1G3O A;  4ED5 A;  1FE0 A;  4K4X A;  3I0R B;  2HKE A;  1JK9 B;  5KFS A;  1U26 A;  1OJ4 A;  3GU0 A;  2QMU B;  2OEJ A;  4K59 A;  4I2P A;  4EK2 A;  4TU7 A;  2VH7 A;  1HI1 A;  4AFF A;  4B3R J;  4C4W A;  3U1L A;  1BE4 A;  2CJB A;  2MTL A;  2U2F A;  1NPK A;  1JQG A;  4NML A;  3VAJ A;  4KJI A;  3DLK B;  5KFH A;  5CAB A;  1QSS A;  3KG4 A;  2KM8 C;  3A8J A;  1U1R A;  4LF6 F;  1VQN S;  3K8W A;  5ETT A;  2VIC A;  3PG9 A;  3SFG A;  1FRL A;  4GKK F;  4X4O A;  2MQ8 A;  1FDA A;  4NYO A;  5LJ5 Y;  2KYZ A;  4N47 A;  5K9F A;  3O5T B;  1L3K A;  4J9S A;  2F63 A;  1PKU A;  2AGO A;  1TL7 A;  5HRO A;  2RSQ A;  3PZP A;  2OD4 A;  1ELO A;  1NSK L;  3DXB A;  4JBC A;  5E5N A;  1IR1 A;  1NDL A;  1RLC L;  4FVM A;  1J27 A;  3GSD A;  4KGZ B;  1JLE A;  4P72 A;  2GVD B;  2OEM A;  3HVW A;  3VAI A;  2J6S A;  2A6M A;  1XIQ A;  5C2G A;  2ZWP A;  2OJ3 A;  3NS7 B;  4URS A;  4BDP A;  3OW2 R;  2CJY B;  4UF4 A;  4OI4 A;  4WXO A;  4DL2 A;  1FJC A;  1JLQ B;  5KFP A;  3CJT A;  5BYQ A;  1YBT A;  4K8R A;  1NHV A;  4M8L A;  4M5D B;  3FSX A;  3QSI A;  1EET B;  3V6D B;  1TZ0 A;  2GIR A;  1TL4 A;  1D9A A;  4HT5 A;  4U96 A;  2D1C A;  5JMN A;  2RUG A;  1RTI A;  2YVS A;  3PIP Q;  3NCR A;  3WBZ A;  3ETM A;  2VJV A;  4DV6 J;  2ERR A;  4OZJ A;  3MEE A;  3AQP A;  4ED8 A;  5EGY A;  3DLK A;  1WD6 A;  2CJA A;  2LXI A;  1R0B G;  3PFO A;  1NJW A;  1N32 F;  2R9L A;  3LAK A;  4RZR A;  1FJ7 A;  1KKH A;  2KXN B;  3HK2 A;  1Q8B A;  2H5J B;  3MCM A;  4M95 A;  1LW2 A;  4C9D A;  4K2X A;  4GVL A;  3QT5 A;  1NEE A;  3IS9 A;  2VL1 A;  1D9F A;  2BKN A;  4WJB A;  5L1K A;  1SH2 A;  2XMT A;  4ZIT A;  4H4K A;  2MYF A;  4RLE A;  1ZBT A;  2Z2Y B;  4IRC A;  3G71 S;  2VG5 A;  3W63 A;  3VAM A;  2JFD A;  4AL7 A;  2WBR A;  1OPZ A;  3Q8V A;  3Q23 A;  1AA1 B;  1RSC A;  5JUM A;  3CJK B;  2YKP A;  5D4P A;  5J2M B;  2E29 A;  3KLG B;  3MMB A;  4EI2 A;  1QAX A;  4E2F B;  2LU2 A;  5CYJ A;  3OTO F;  2QE5 A;  3BQ0 A;  2WVF A;  4HH1 A;  4ZN3 A;  1TAQ A;  2J7W A;  2LYV A;  4OLP A;  4M5M A;  2Z58 B;  2C2D A;  4H4O B;  4CM0 A;  2DB1 A;  3R7N B;  1UPM B;  3TI0 A;  4FYV B;  3K57 A;  4DWI A;  2KU7 A;  2WON A;  3UN3 A;  4F8R A;  2CJQ A;  1ZZN A;  4U6P A;  4NCG A;  4HDG A;  1WOS A;  3R5G A;  5C25 A;  1EET A;  3AJ1 A;  3QO9 B;  3O3L A;  2ZBI A;  4B17 A;  1GMV A;  4FYY B;  1U1L A;  3MCO A;  2CG4 A;  2LDY A;  4DPX A;  5HLF A;  2DR7 A;  3MM9 B;  3PRB A;  4OZ1 A;  2M70 A;  4ZPW R;  4V19 J;  1UA1 A;  5KFC A;  1RJJ A;  2GX8 A;  1S97 A;  4ZLP A;  3G6V A;  2KFN A;  3W65 A;  4DXL A;  2UXC J;  1S7I A;  1YHQ S;  3AD7 C;  3OTB A;  4KKO B;  2DHG A;  2R7T A;  2I5J A;  2QV6 A;  2FJX A;  1DY3 A;  1YRT A;  1S59 A;  1K0V A;  4WIQ A;  1UA0 A;  3VQT A;  1DFD A;  3LF0 A;  2FJA B;  4KAI A;  5GAH I;  1F1B B;  2R8G A;  2MLZ A;  2ZHO A;  5DG8 A;  3GG0 A;  2G9O A;  3CJK A;  4DCO B;  5J2M A;  2BMB A;  2FHJ D;  4YDX A;  4DZ6 A;  3B4D A;  3POT A;  1RAH B;  1PBA A;  1HNZ J;  4PAA A;  4A8M P;  1S9E A;  1RT5 B;  3CUN A;  2MKY A;  3FZ2 A;  1NDP A;  5EHH A;  1CJV A;  2CWK A;  2V4J A;  2OO4 A;  1VK3 A;  1TFW A;  3NP5 A;  4O3N A;  4Y2A A;  1PYT A;  3NOC A;  4OI0 A;  1FWK A;  2DNG A;  4TU9 A;  2R7W A;  4ZVS B;  2E44 A;  1KQG B;  4HTI A;  3K5L A;  2EVZ A;  3E51 A;  3G6Y A;  1WKK A;  1L3S A;  4A46 A;  2MJN A;  5E41 A;  1C1B A;  1UZH A;  3AD9 C;  3C46 A;  4X4R A;  1HHQ A;  3FZB A;  1Y9O A;  3MD1 A;  1U48 A;  1GNK A;  4FF2 A;  3FEX B;  3OXF A;  1X7V A;  3S01 A;  2H65 B;  2IC3 B;  2VQE J;  2HYI B;  2YWH A;  5J2P B;  2AJQ A;  3OTO J;  3T9Z A;  3GFZ A;  1T11 A;  4ZLN A;  4KKO A;  3TA1 A;  3IRX A;  2W8L A;  2QL5 B;  3IO1 A;  1MMD A;  3KJF B;  1URN A;  1XK8 A;  1FEE A;  1Q4R A;  2PT0 A;  3AB2 B;  1PAE X;  3EPI A;  1FA0 A;  2CQC A;  1RT6 B;  2B4O A;  2DPJ A;  4RW4 A;  5HL7 Q;  3D9B A;  1H6K X;  2XBP A;  1PCA A;  4XAK A;  3D1H A;  4NCA A;  1X5P A;  3CD7 A;  3ISN D;  5KFU A;  3D1Q A;  3RAQ A;  3CCL S;  4KPC A;  5IWA J;  2Y0S D;  1SL1 A;  3DRP B;  3ENQ A;  1T05 B;  1WSR A;  5D0G A;  1S5Z A;  2D3Z A;  4RW9 B;  5IFM A;  2R8H A;  2G2Z A;  2NXU A;  3PW0 A;  3CUL A;  2BDP A;  3CJ4 A;  1JB0 C;  3UO0 A;  1G6B A;  1UMJ A;  4N56 A;  3SSR A;  1M1G A;  1LK5 A;  2EG1 A;  1JXV A;  2FUG 9;  2AYE A;  3KOA A;  1E6Y B;  1UVN A;  3I0S A;  4QWE A;  2R2T A;  4URG A;  3KG0 A;  2DGO A;  4TKT A;  1UEK A;  4OV6 A;  5IT4 A;  1TU0 B;  1YRX A;  2Q79 A;  2IVY A;  2R8I A;  1C1C B;  3H4D A;  5EWG A;  2RD5 C;  1JLG B;  1I51 B;  4OZ5 A;  2JEI A;  5J2P A;  3A8E A;  2DHS A;  1GMW D;  1D9D A;  1GK8 A;  4K5R A;  5FLX U;  4B9S A;  2J9D E;  5DZ6 A;  4XPC A;  4WE1 B;  4TLR A;  5FDL B;  5KFZ A;  1J5E F;  2HVD A;  3ZZ0 A;  1BMQ B;  2CVE A;  3Q8Y A;  3IM8 A;  4F02 A;  3OJS A;  1KD1 T;  4R0E A;  3MEK A;  5D6G A;  5JJB A;  1U6F A;  2E1A A;  2ZKU A;  3HSG A;  2GML A;  5H9E K;  5GAD I;  2HS4 A;  1NU4 A;  2BM0 A;  3UDC A;  1LWE B;  4GVB B;  1HW9 A;  1YJ7 A;  5J1N A;  2YX1 A;  4UUX A;  1HA1 A;  2GW8 A;  1Q78 A;  2GAG C;  2BW2 A;  4IOC Q;  3PV8 A;  2XYP B;  5E2Q A;  1Q7Y T;  2ZH5 A;  1LNQ A;  4I2Q B;  3MED B;  3MMA B;  1CJT A;  4PCQ A;  4WYL A;  1VIS A;  1FDD A;  3MMC B;  4PWU A;  2HHU A;  1BWV A;  3CME S;  4NXN F;  2ZWO A;  4J9K A;  4DL0 C;  2AT1 B;  1IBL J;  4WKR A;  3QGP A;  4LRD A;  1YJU A;  3PHT A;  4MTP A;  3J7Y U;  2ZH3 A;  2X1B A;  3MHY A;  2AD9 A;  2GMJ A;  4PG7 A;  5DM7 Q;  4EGL A;  1OS5 A;  5KFE A;  1WNE A;  3V81 A;  2ZM6 J;  4CLT A;  1E6Y A;  4MJK A;  1ZTT A;  4DU7 A;  2R8K A;  2B4V A;  2N3O A;  2AJ1 A;  4Y2M A;  1RBA A;  4K4Z A;  4Y2C A;  4W90 B;  2DT9 A;  1T9W A;  2MQO A;  3WC2 A;  1KLM B;  5D8H B;  3UD4 P;  2OFH X;  2V2V A;  5HBM A;  2DGU A;  4HH0 A;  1WSV A;  4PWW A;  1X4B A;  2V8V A;  5HMZ A;  2VB6 A;  4QIG A;  2RHS B;  2JFK A;  3G2X A;  3H42 A;  1B7Y B;  3A8I A;  4DI6 A;  4DFK A;  1Y0H A;  3R5D A;  2ZHA A;  1N8R T;  1IN0 A;  4F50 A;  2YKN B;  1U1P A;  4ZJO A;  3GJR B;  2O01 C;  3QNW B;  2ZZN A;  2L3M A;  4K4Y A;  3TJ8 A;  5H9E J;  4WFY A;  5KFM A;  3NKY A;  1HWU A;  5BJR A;  1VIX A;  3W2W B;  3M6X A;  4B3O A;  2QFJ A;  4DX8 H;  3AOD A;  1JJ2 R;  2MLY A;  3TVK A;  1X4E A;  2XSF A;  1X4H A;  2CPI A;  4A8O A;  4C8L A;  3D0H E;  2BQU A;  2M52 A;  1IKX B;  2NSB A;  2Q3P A;  4I2Q A;  3CCU S;  2CPJ A;  2FLN A;  2P6S A;  3UCU P;  4DR6 F;  2YWE A;  4ZOS A;  4LIW A;  3PXG a;  4ZVU B;  3SFU A;  2DHH A;  3TQE A;  2BE9 B;  4ID5 A;  5U47 A;  3QZ8 A;  2V67 A;  1NDK A;  3Q0A A;  3OSP A;  1UW4 A;  1TP7 A;  4C8Y A;  3K8V A;  3PEJ A;  1CS4 B;  2LQ8 A;  1CJK A;  1TKZ A;  1J5E J;  2NS1 B;  2DBB A;  2GVZ B;  3D4J A;  4I67 A;  1EIY B;  4DPU A;  1T9V A;  1UL3 A;  4QWB A;  1L3T A;  4BWJ A;  4J9P A;  2RU3 A;  4KPY A;  2HWT A;  3CCT A;  1IKV A;  2XSJ A;  2QL9 B;  3SSS A;  1Y00 A;  2PMH A;  3U27 A;  1CBK A;  2HHP A;  3NAH A;  1W2B R;  4ZP8 A;  3M2R B;  2XHW A;  1S49 A;  4KHP F;  3G96 A;  1TKT A;  1KLM A;  4CLW A;  3NBP A;  1KP6 A;  4LF4 F;  4DR2 J;  3OVB A;  1EX8 A;  2W7A A;  3MWB A;  2RF2 B;  4ZVQ B;  3VGU A;  1T9X A;  3UNY A;  4NXN J;  3KJV A;  1FNX H;  3BRE A;  2QMX A;  3RW7 A;  3QAT A;  4ZHR B;  4QYZ K;  1Z4U A;  1YJR A;  2K3I A;  4NLW A;  5HAO A;  2VOD A;  2PI4 A;  2XY7 A;  3W3S A;  1WF2 A;  5B0C A;  3FKB A;  1XTZ A;  4J90 A;  1GXL A;  2DRD A;  1J5O A;  2DPI A;  4YP3 A;  3ZFV A;  1SC6 A;  2OFG X;  3DHW C;  4KO0 A;  1YDL A;  5DG7 A;  4DL4 A;  2GMH A;  4XTT A;  2HIY A;  4X4N A;  2B6A A;  1U0H B;  2HMI B;  5KT6 A;  1RKI A;  1Q8L A;  2FQQ B;  5HJY A;  5ETR A;  3A8K A;  3GFY A;  2MZJ A;  4RUB A;  5IT9 Y;  3MM7 A;  3GIK A;  1REV B;  4JYA F;  5EX3 A;  3OD2 A;  3C6U B;  2F7V A;  1DZ5 A;  2NXJ A;  4O4R A;  2WVD A;  3R7S B;  1QJH A;  4Y6I A;  2VPZ B;  1VBK A;  1JKH B;  4N76 A;  3Q83 A;  2R2U A;  3AFG A;  1K1Q A;  2OAU A;  3FMB A;  2J0S D;  4K0K F;  4KH1 B;  3MM8 B;  2ZOM A;  3ET6 A;  4LFA F;  4O0N A;  4DR3 F;  1RT4 A;  2ZBR A;  3MM5 A;  3CWJ A;  3VAK A;  2Y3Y A;  4HLB A;  5A2Q U;  3TJA A;  4O3O A;  1XEZ A;  4PG6 A;  3FUY A;  1C0U B;  5F8H A;  5K14 A;  2HRY A;  8RUC A;  4CLF A;  1SKR A;  4QR2 A;  4QPX A;  5J1E B;  3GTY X;  2DCU B;  3MAQ A;  4QYZ J;  3DMJ B;  4KSE B;  3BBB A;  4LRB A;  1IUJ A;  5J2N B;  4ZKA A;  2M3D A;  2W4D A;  2M5Y A;  2KXH A;  1Q82 T;  5CXT A;  1DUR A;  4G6V B;  4ZP9 A;  1CLF A;  4F3Q A;  2ZHB A;  2R7Q A;  3AT1 B;  1TMM A;  4RW6 B;  2CQ2 A;  2HVE A;  2Z2L A;  4JV1 A;  1D1U A;  4CO3 A;  4G65 A;  3CD0 A;  3RW6 A;  4ECZ A;  5A8K B;  4I6Y A;  4KHP J;  4DQQ A;  1E6V B;  2QLB B;  1NBE B;  4YHH J;  4NLY A;  1IKY A;  2XZW A;  1QM9 A;  2Z4P A;  1DTT B;  3CC7 S;  1ACM B;  2VBZ A;  2CA9 A;  4OIX A;  4XPE A;  1H7W A;  1Q79 A;  4F4W A;  1WOR A;  1PSD A;  3M30 B;  2ROP A;  1FWL A;  9ATC B;  4HYK A;  4DUZ F;  4U8Y A;  2R7X A;  3M1V A;  4ICL B;  3L95 X;  1RQ0 A;  5IV4 A;  4P7V A;  4FXW A;  4OJ1 A;  4MYT A;  4GKJ F;  2OPR A;  3C15 B;  3N4W A;  2O1P A;  3KLI B;  1IWA A;  2FHK A;  2XYH B;  3MD3 A;  2V2K A;  2BJ7 A;  3AA9 A;  5LXR A;  3MPU B;  4CLU A;  4ZDN A;  2EPI A;  4GC7 A;  2YKM B;  2V4R A;  1JXL A;  4DJB A;  1CC8 A;  4N5S A;  2CQP A;  5HMY A;  1AT1 B;  2FVR A;  1X4C A;  3W2V A;  2V8G A;  1O51 A;  4G1Q B;  2YNF B;  3RU0 A;  1NZA A;  5J1E A;  2G1D A;  4NMX A;  1M1K T;  4F26 A;  3UVJ B;  1Y11 A;  2ZBQ A;  2IRX A;  3C19 A;  2UUC F;  4DLE A;  4C0H A;  2DD8 S;  2E7W A;  1HI8 A;  4IDK B;  3VGS A;  4J9L A;  2EKY A;  1F2G A;  1P8G A;  4K0K J;  3UN2 A;  2NQP A;  3M4X A;  1CJU B;  1RHU B;  4IRD A;  3T6J A;  4X66 F;  5B0G A;  2JLG A;  1PYS B;  2H5I B;  2OPQ B;  4DR3 J;  2DCL A;  3Q8U A;  4J9V A;  5M2P A;  1N0U A;  2R42 A;  2DGS A;  2C2R A;  1U25 A;  4ZPB A;  4U95 A;  1G1X A;  4DV0 F;  5F8N A;  3EJM A;  5LXY A;  2QZ8 A;  3BGU A;  5EN1 A;  1U1K A;  4K4W A;  1S1U A;  2HHW A;  3LGN A;  1LXN A;  3UD3 P;  1HI0 P;  3Q8R B;  4IOB A;  2MQQ A;  1SC1 B;  1DQ9 A;  1WHV A;  1FFW B;  2W25 A;  4W98 A;  2RS2 A;  1OMS A;  2DJW A;  3HPO A;  2E9Z A;  4P75 A;  2EXU A;  3FDS A;  2F5G A;  2IY5 B;  2CPD A;  2FLP A;  3KXD A;  4K5S A;  1K8A T;  2B43 A;  1WKJ A;  2C1E B;  1QTN B;  3WQP A;  3TAN A;  3KHH A;  4P9S A;  3ZNU A;  2GQQ A;  2BXJ A;  2Q1L A;  1XC9 A;  5FII A;  4Y0F A;  1HBM B;  1S6U A;  4DEZ A;  2QRR A;  2ZBC A;  3QRR A;  1V3Z A;  4ZCI A;  3CD5 A;  3FC9 A;  2E9T A;  2U1A A;  2ZZT A;  2G1H A;  3ENA A;  4PRF A;  2K1R B;  2ZNZ A;  2DY9 A;  3C14 A;  3HJV A;  1ROF A;  2LMI A;  4LSN A;  4NX9 A;  3EVW A;  1M5O C;  2OIH A;  1JLA A;  1RAE B;  3G4S S;  4LBH A;  1CJU A;  5CD4 A;  4E0D A;  5K8P A;  2ZJR Q;  2OPQ A;  2M8H A;  2VFS A;  1SPB P;  2ROE A;  4ZP6 A;  2H54 B;  1KVI A;  4O0I A;  1S9G B;  2L9D A;  4W4M A;  4DSE A;  2XI2 A;  2LXU A;  5AXM A;  2DTJ A;  4OMF G;  4WP8 A;  3AY0 A;  4YN3 B;  1HNW F;  2IMW P;  4TVA B;  3RZA A;  1Q53 A;  2VQF J;  1O8B A;  5KT3 A;  3A12 A;  4G1I A;  4WCE Q;  4B08 A;  4NXM F;  1RTJ B;  4KH0 B;  3N5F A;  4M94 A;  2NUH A;  1HWJ A;  3OT9 A;  3PJX A;  2FYX A;  4ZVT B;  4KGK A;  1D3W A;  3TQ1 A;  3CC4 S;  2GC8 A;  4RKU C;  2UZA A;  4TNO A;  4L3K A;  4Z37 A;  3P8B B;  2RJZ A;  4B9U A;  4O3P A;  2BJ1 A;  4OYX A;  2DVI A;  3X3U A;  3HI9 A;  5C42 B;  2VA3 A;  1A7G E;  1PGZ A;  1H7X A;  4X66 J;  4DUT A;  3T1Y J;  4YR0 A;  1JJ4 A;  2Q66 A;  3ZZY A;  3BR8 A;  3MTJ A;  4E8U A;  4DV0 J;  4KB7 A;  2G2Y A;  1RAI B;  1B4S A;  1S6Q B;  1HD0 A;  2BJ3 A;  4I64 A;  1ITP A;  3JSM A;  1PAU B;  4TLQ A;  2LA6 A;  5KG1 A;  3EPG A;  3LP2 A;  4OZ0 A;  5DRK A;  3NWR A;  4FVC A;  4CLS A;  3E01 B;  4MAK A;  3UR0 A;  3V4M A;  4QZV B;  2EG2 A;  3J80 Y;  1DQA A;  1WEX A;  4C8Z A;  3CCV S;  4DQI A;  3IGV A;  4Q2L A;  1IM4 A;  3RRG A;  1S9G A;  1SJQ A;  2E5I A;  1MN7 A;  4DG1 B;  1DBD A;  3GG1 A;  4ED3 A;  2AZ1 A;  1KQK A;  2MHN A;  1DJ0 A;  5CCL A;  2HFZ A;  3TZY A;  2IA6 A;  1NH8 A;  3LP1 B;  2OTJ S;  1RTJ A;  1DLO B;  3G6E S;  4ZVF A;  4OHX A;  8AT1 B;  4QWC A;  4DR4 J;  3UD5 A;  1BQX A;  3AAW B;  2IA0 A;  4PQA A;  4HAC A;  2R7O A;  4I1T A;  2NLW A;  1RT7 A;  1F9F A;  3Q86 A;  1F9H A;  3M8Q A;  2RRA A;  4QQB A;  2AKW B;  4CDI A;  1U49 A;  4AND A;  2EEY A;  4KFB A;  3TAM A;  2HHT A;  4ZIV A;  3F56 A;  1PJ5 A;  4LRF A;  1KR4 A;  2AIR B;  3LGH A;  2VBX A;  3JYT B;  2B9Y A;  3VAH A;  1VC0 A;  5I3P A;  3BBF A;  5M2R A;  1IQZ A;  3DRY A;  2ZJP Q;  4FPI A;  2QLX A;  3DC2 A;  4E98 A;  1HNW J;  2BJD A;  4K4U A;  1VFJ A;  2M2B A;  2ZH9 A;  1KQS R;  2X1F A;  3BGR B;  5T41 A;  1DTQ A;  3SDE B;  1KTQ A;  2C28 A;  4IYQ A;  1FI4 A;  2K3K A;  5F9N A;  1T03 A;  2O67 A;  1I94 F;  2M7S A;  1RAB B;  1RBL A;  3IFE A;  3PYG A;  4IUF A;  4RNM A;  2ZH4 A;  3DYA B;  3EIC A;  3DRR B;  1EHW A;  2EBE A;  1KVK A;  3M9N B;  2DKO B;  2HRT A;  4U9R A;  1XNQ F;  2ALY B;  3KLH A;  4YOE A;  2OMO A;  2GZO A;  4PZV A;  4DPO A;  2KRB A;  2X3D A;  3M05 A;  2KT5 A;  1SQG A;  3W1Y C;  4WWS A;  5J2Q B;  4CO4 A;  2VU5 A;  4KV8 A;  4OX9 J;  5D4L A;  1S99 A;  2RDI A;  1KNZ A;  2QSW A;  2NUU G;  4B02 A;  2DXF A;  5CZV A;  3HSD A;  2BRK A;  4EBD A;  2GAH C;  3M8P A;  5H9F K;  1RT2 B;  4KTQ A;  1QUP A;  1K1S A;  3TW0 A;  3NXZ A;  1IKW B;  1UVK A;  2WK4 A;  1S12 A;  4DFM A;  4M5H A;  4DHV A;  1QAJ A;  3HT3 A;  3BPD A;  4J37 A;  5LJ3 Y;  5HQ8 A;  2LQB A;  4YB6 A;  4V1A k;  2V4Q A;  2JDJ A;  3TZW A;  1VRT A;  4X4V A;  2DNO A;  3RBD A;  2C3O A;  5KTQ A;  4OX8 A;  5C2C A;  4XDD A;  4BLG A;  3KTQ A;  3RBE A;  1VYA A;  1NAQ A;  1VQP S;  2MMY A;  3FBF A;  4FXD A;  2B7B B;  1LEO A;  1RK8 A;  2G0C A;  3H40 A;  3CED A;  3J7Y I;  4NA2 A;  2CZ4 A;  1XR5 A;  2K06 A;  1IR0 A;  3DLG B;  2ZIT A;  2FIU A;  2BE7 D;  2H4Y B;  3G82 B;  1VQM S;  1JNR B;  3KDN A;  4A48 A;  3IBF B;  2M9K A;  1K73 T;  1TL5 A;  1N36 F;  2X1G A;  5E0O A;  3OXG A;  1FJG F;  2EBG A;  3CDA A;  4PUO A;  3G87 A;  4LF9 J;  3PW7 A;  3BJY A;  4HI2 A;  1R0C B;  4LRC A;  3FFI B;  4RNF A;  1FER A;  1IR2 A;  4M5I A;  4BBY A;  4LF5 F;  4HEA 9;  1X9W A;  3U7J A;  4DFJ A;  5J2Q A;  2J5A A;  2MHE A;  3NWG A;  4DV3 F;  4B9T A;  2LEP A;  4TXS A;  4JI3 F;  3V4I B;  3LTO A;  1VQK S;  1N33 F;  3B6B A;  4M5L A;  2BUN A;  1Q8I A;  5GAH U;  3MAH A;  3J7A N;  1S48 A;  3W9I A;  3MUV P;  1TTH B;  4F2S A;  2AYM A;  3TR5 A;  2UUB F;  3K5N A;  4DV1 F;  3VZI A;  1I94 J;  1Y5I B;  2CJ9 A;  3AQO A;  4CP5 A;  3AOA A;  2JLF A;  1IKW A;  4EEY A;  3PO4 A;  3KLV A;  2BRL A;  3DXS X;  2ADB A;  4L73 A;  1XQI A;  2DH8 A;  1NO8 A;  4PPZ A;  4DQR A;  3LOU A;  4Q0B A;  2G0I A;  1S1T B;  2QEX S;  3W8G A;  3PDN A;  2JVR A;  1I3O B;  4RL1 A;  3OL8 A;  4LBI A;  1UZD A;  1GTH A;  1GTE A;  4OJ3 A;  2DY1 A;  2F8E X;  3W62 A;  3DLG A;  5DDO C;  2HFO A;  2NXC A;  2XGP A;  2YWF A;  4OI6 A;  1I5O B;  5HMW A;  3PX0 A;  4CTA A;  2C3U A;  3GSI A;  4IFV A;  3LH2 S;  1FD8 A;  1RHJ B;  2IPO B;  3DGP B;  2DNK A;  2BJE A;  1QSL A;  4QU6 A;  4O44 B;  5DZ7 A;  1F0X A;  4BS2 A;  4D3H A;  1JLB B;  1U8W A;  2LEC A;  2KM8 B;  4F4X A;  3SQO P;  3KLF A;  1VMB A;  3UFC X;  3WIV A;  2AJF E;  3CW2 C;  2W2M P;  4F3O A;  4RUH A;  3DRS A;  4K2J A;  5E3A A;  3LP0 A;  3ZZU A;  3NS5 A;  2W1B A;  4RWX A;  4PAB A;  3HP6 A;  4U8V A;  1SV5 A;  2KG0 A;  2DGQ A;  4UQG A;  2DNN A;  2L41 A;  3BZQ A;  1R89 A;  5KFR A;  4C98 A;  1BGX T;  2MY8 A;  3GE9 A;  4PQU B;  1DRZ A;  2ADC A;  1VBY A;  2CQ0 A;  4M1K A;  4OHV A;  4CNZ A;  2ZH7 A;  2DNR A;  4IQM A;  3I4H X;  1T95 A;  3MR3 A;  1N36 J;  4F0H A;  5IQ6 A;  1LW0 B;  3W66 A;  1V5I B;  1TK8 A;  4M5J A;  3H2L A;  2BA9 A;  2VFV A;  3T5J A;  3JQJ A;  2CDQ A;  3PKM A;  4N8N A;  4LF5 J;  2KRR A;  4ECW A;  5I3Q A;  2A10 A;  3DLE B;  4HTJ A;  2MQL A;  1HMV B;  2EK6 A;  5DLF A;  3M6W A;  1HNX J;  3DLL Q;  1CSJ A;  1WG1 A;  2GGP B;  1KBR A;  2CVI A;  4Y3C A;  4DV3 J;  1RAJ A;  3DOM A;  2P6T A;  5IT9 U;  2VC1 A;  5IM0 A;  1N33 J;  3DRX A;  2QSF A;  4QR0 A;  5FLX Y;  1MLA A;  5T14 A;  3OXL A;  5D3G B;  2FJD B;  4BHQ A;  2EK1 A;  4Q8E A;  4N8O A;  4KE5 A;  4DV1 J;  1UEV A;  1FX2 A;  1RT1 B;  1CPZ A;  3MMJ A;  4WU3 A;  5CYQ A;  1L5U A;  1FRK A;  3QLH A;  3W61 A;  1SQF A;  1FKP B;  5SZT A;  2L9N A;  4O44 A;  3OUY B;  1EP4 B;  2BBE A;  5GAG U;  3TZZ A;  3OHA A;  2E1C A;  3AH6 A;  5KFN A;  1AZS A;  3TA0 A;  3MM6 A;  4C97 A;  2XY6 A;  3BYR A;  2CPF A;  3EUN A;  3ISZ A;  5F3Z A;  1M5S A;  2ZUG A;  4YY3 J;  4IR1 A;  3HT0 A;  4K4V A;  3E8O A;  1OPI A;  3FSI A;  4DR7 J;  1MML A;  2BAN A;  6FDR A;  1UWB A;  4OJH A;  2PFF B;  1HWI A;  1K47 A;  2NXE A;  1IQT A;  3CJ5 A;  4LQ9 A;  2HQD A;  2IHR 1;  2D9P A;  3DN9 A;  2HHS A;  4J9Q A;  5K5M A;  2PD1 A;  5I3U B;  1PYO B;  3IG1 A;  4ATN A;  4UY8 5;  3TEG A;  2CPH A;  4NRU A;  2GHP A;  1NK8 A;  2UP1 A;  2C2O B;  4HR2 A;  1P27 B;  1T3O A;  3CJR A;  5L9N A;  3AOB A;  2AJ0 A;  4JI6 J;  1VLO A;  1XMO F;  1OSD A;  4FYX B;  4HHJ A;  2MSS A;  5E7O B;  4F4A A;  2MGZ B;  2ABY A;  3DLE A;  1T02 A;  2XNR A;  2R7R A;  2A0F B;  2C2M B;  1NUE A;  3GLJ A;  1Q86 T;  4HDH A;  3BO2 A;  2LP4 A;  3IMQ J;  3ZZZ A;  1TUW A;  3MEC A;  1WEY A;  4RNO A;  5KG3 A;  1FK9 A;  1WWH A;  4QW8 A;  4Z7C A;  4X62 F;  3B4M A;  1HKA A;  3MEG B;  3V2U C;  2MZ1 A;  4OFZ A;  2DIV A;  4MH8 A;  2CJX B;  4ZS6 A;  4D3G A;  3GYG A;  1KDN A;  3CB4 A;  1FKP A;  2YPZ A;  5ETV A;  1C4C A;  1EP4 A;  3WX8 A;  2W4P A;  1X60 A;  2BE2 A;  4F04 B;  4QU7 A;  3KKF A;  2QLF B;  3DLB A;  3SQG B;  4ZPV R;  1F9E B;  2J7K A;  2J9E A;  2PA3 A;  3MTK A;  5D0R A;  1VCT A;  3ITH A;  5A8W B;  4RU9 A;  3LUY A;  1NK7 A;  5AJ3 F;  1HBN B;  2F65 A;  3T1A A;  4DV2 F;  1NH7 A;  1VQ7 S;  1OY8 A;  1R8P A;  2KB2 A;  3THP A;  3OVA A;  2YNI A;  2HND A;  4U7U K;  3EDQ B;  3BN7 A;  1X0F A;  3HD2 A;  1M5V C;  4ANC A;  3D6F B;  5I3U A;  1HFE L;  4ED4 A;  3EDR B;  3MAA B;  2O5D A;  4ZN1 A;  4CO0 A;  5L46 A;  3R5C A;  2YKQ A;  4USM A;  3QPI A;  2FTR A;  2R2R A;  1R0A A;  2IBO A;  2R7U A;  5A8R A;  2RKI B;  4IQX A;  5F8G A;  5L1L A;  3HVT B;  1FWP A;  2PC6 A;  1RYR A;  2YXL A;  5CAA A;  4MKB A;  5D4N A;  1B70 B;  3EZU A;  4OX7 A;  5AXK A;  3K0J A;  1T3N A;  4I6A A;  2NPF A;  2PMZ D;  4P73 A;  2HLT A;  3KJQ B;  4C11 B;  4KT0 C;  5CHC B;  2MKC A;  3R8Y A;  1ZET A;  1ZAW A;  3UDL A;  1SUQ B;  2DK2 A;  4PYA A;  4IH7 A;  2V94 A;  3KUE A;  2IVF B;  4LQ3 A;  2POK A;  5L9X A;  2HFS A;  2W9B B;  1P1L A;  1S1X B;  4I7F B;  1TAU A;  1BQM B;  2DGV A;  4LR7 A;  1VQS A;  2HAF A;  2YNG B;  5J1P A;  2XZD B;  3BR9 A;  3NOG A;  2D7S A;  1U09 A;  3ZC4 A;  4PWD B;  3HFK A;  1N34 F;  3TA2 A;  3D3C J;  3CDW A;  2AJ4 A;  2HNZ A;  4IG0 A;  3DOK B;  5HQM A;  1ZM9 A;  4Q45 A;  4J5O A;  4H4M B;  2E5G A;  3ZXW A;  5KFB A;  3T41 A;  3W9H A;  1YJW S;  4KBI A;  3I32 A;  3L9Z A;  5KG5 A;  4K7Q A;  2DHX A;  5EWF A;  2A6O A;  2ZH1 A;  6FD1 A;  1PG5 B;  1RA7 A;  2MDA A;  1U4B A;  3R9L A;  4ED2 A;  2DR6 A;  2CQ3 A;  1WHW A;  2B0G A;  5HVG A;  1SH3 A;  4MMO A;  4ZIW A;  2YX7 A;  1NLK L;  2PE8 A;  2DNP A;  3O2I A;  2RKI A;  3KK1 A;  2N3L A;  1WC5 A;  2R8J A;  1IXK A;  1IBM F;  3WX4 A;  2DEI A;  3NMA A;  1JWW A;  2MZT A;  3MR2 A;  4FNI A;  2NZC A;  3QIP B;  1TVR B;  1O6X A;  3GV8 B;  2CNN B;  4Y28 C;  4PXB A;  1OQ6 A;  1NJX A;  3BKT A;  4WPA A;  2VG6 B;  2OKQ A;  5AJ3 J;  2ZFH A;  2V2Z A;  4DV2 J;  3OPK A;  3UR3 C;  4X65 F;  4X4P A;  1LXJ A;  1S76 D;  3BSN A;  1TKX B;  4R0J A;  4CLZ A;  5T7L A;  2W9B A;  2V69 A;  4IFY A;  2IRY A;  2P9G A;  4QWA A;  4ANE A;  4JUZ A;  2I2Y A;  1U2C A;  2C22 A;  4USV A;  4QBU A;  4JI1 J;  2FJW A;  2P9C A;  2E5J A;  3O6Q A;  4AQY F;  1N48 A;  3DLH A;  5KFJ A;  2KVI A;  2Z0G A;  4RW7 A;  1BC6 A;  3R3T A;  2GO8 A;  4DOZ A;  4F0K A;  4FP9 A;  1RTH B;  1RHR B;  1ZS6 A;  2VD3 A;  5LM7 E;  1P9Y A;  5GVQ A;  3D2W A;  1XMQ F;  2Z2Z A;  2MJU A;  1FTR A;  4C8M A;  4DX6 A;  3K2Y A;  2CPX A;  1EKR A;  3FMW A;  3US5 A;  4NLT A;  4KGX B;  2FY1 A;  1YZ7 A;  1G7C B;  2HQF A;  4ECS A;  1OQ3 A;  1FD2 A;  4F4K A;  2A2C A;  2PEB A;  1N5Y B;  5DLG A;  1N6Q B;  3ETO A;  2RIJ A;  3CCJ S;  2H5E A;  2LDI A;  2JL9 A;  5A0Y A;  4DUY J;  2HZC A;  3CDE A;  3OSN A;  1JLC B;  3L09 A;  2ZOF A;  5DS7 A;  2XEX A;  3ZTO A;  4IG3 B;  1C4A A;  2C2N A;  5C24 B;  3CCM S;  3J80 U;  1N34 J;  1HW8 A;  5DM6 Q;  4USH A;  2N82 B;  5KG4 A;  1HL6 A;  1GT8 A;  2FJE B;  3S8S A;  3M6U A;  3KDO A;  2F1F A;  1NND A;  3OL6 A;  2OPS A;  1WKL A;  3K58 A;  4DL6 A;  4LSZ B;  2ZDO A;  3I56 S;  3D6M B;  3QID A;  3WDO A;  4LF7 F;  4ERD A;  4R8U B;  5LSR A;  3DDN A;  1HNI B;  2FVQ A;  3HSZ A;  1ZYQ A;  2XB2 D;  1BQN A;  4NCB A;  2UXC F;  2HNY B;  1HBO B;  3FGV A;  1S1W A;  1WAC A;  3NGD A;  2DH9 A;  3M7V A;  2Y0B B;  3TWZ A;  4OYB A;  4OI1 A;  2VPX B;  3IWL A;  1TK0 A;  3SCJ E;  3HX9 A;  4FXV A;  2ZKT A;  1IBM J;  2NRE A;  5EUH A;  2BYC A;  4CIO A;  3RBZ A;  4I56 A;  3H20 A;  1KRP A;  2X51 A;  4ZP7 A;  1QE1 B;  3C16 A;  1QUV A;  2OPP A;  3VZH A;  1SCJ B;  1NB7 A;  1X9S A;  5KFD A;  3I0R A;  2VAS A;  3KMQ A;  3PKY A;  2QTW A;  4X65 J;  1QVF R;  1CEZ A;  3LAN A;  1N5Y A;  1O5J A;  3VVT A;  2DO0 A;  3OR1 B;  1HPZ B;  2CXE A;  1C0T B;  4YQW A;  3RAX A;  4F7V A;  1HNZ F;  3IA0 A;  1RWX B;  3JSR A;  3D67 A;  3OHB A;  4PR6 A;  1TV6 B;  1JLC A;  3UCG A;  2KXF A;  2B51 A;  1V9O A;  1RBO B;  4IOA Q;  3RB0 A;  2GNK A;  1RI7 A;  3FEY B;  1S9F A;  2XWY A;  3MI7 X;  4F4Y A;  4N7T A;  3G86 A;  4CWB A;  1YJN S;  2KJW A;  4LJM A;  1Y5L B;  4ECU A;  4AQY J;  2DIU A;  3AOC A;  1WJ9 A;  4DF8 A;  2WVC A;  1VHI A;  2I9S A;  4LBP A;  4DSJ A;  4C8K A;  2V9W A;  1XMQ J;  3HSJ A;  3PTW A;  1MRO B;  3GV7 B;  4L76 A;  2MKJ A;  4C48 A;  3D66 A;  3SSQ A;  1VRU B;  3BS9 A;  3H5X A;  4FS2 A;  2IJF A;  2CQ4 A;  3Q2T C;  2A3J A;  2VQE F;  4ES1 A;  1TFY A;  4W92 B;  3OFF A;  3KK2 B;  2HNY A;  4EBC A;  2GVD A;  3GB0 A;  2XC9 A;  1SVD A;  4ZVE A;  3WIU A;  1FE4 A;  2RDJ A;  3CO0 P;  2XZT B;  2NXN A;  1U1Q A;  5HAT A;  3OR2 B;  5ETK A;  2PFD A;  1FVS A;  4MFB B;  3KHG A;  2ZD1 B;  5G0R B;  1JLQ A;  5GMK a;  1B0T A;  3WHI A;  3TUZ C;  3S1T A;  4M5D A;  1PC4 A;  1TL3 B;  4DMZ A;  4PYD A;  2DO4 A;  3JQK A;  3V6D A;  2AEF A;  2YH1 A;  2N4C A;  1X4F A;  3J81 j;  3HFZ B;  3L7O A;  1PC5 A;  3PRV A;  2RUS A;  3PR5 B;  1FO1 A;  3FQL A;  2DRA A;  4LF7 J;  4JI2 F;  3OR1 A;  5IWA F;  4JB8 B;  2CQI A;  1SJ4 P;  3CIZ A;  7AT1 B;  1APS A;  2XUL A;  2RRB A;  4MYU A;  3SCL E;  1W25 A;  1RT3 B;  1SKS A;  2XGQ A;  2C42 A;  1R31 A;  1UTA A;  2HS3 A;  2EFQ A;  1OO0 B;  4YFU A;  4MK9 A;  3B78 A;  4X4T A;  3O44 A;  4ZPC A;  4C3M A;  2CFX A;  2UVW A;  2MKI A;  3W7B A;  4I6W A;  4PPD A;  3MPW A;  1LWC B;  5CCM A;  4A8Y A;  1DQ8 A;  5ETO A;  4LT6 A;  3N6N A;  2RS8 A;  3EM1 A;  4DN0 A;  3KUG A;  3KLG A;  2I0X A;  1SB6 A;  2FB0 A;  1RIS A;  2HS0 A;  5ETQ A;  1S1V B;  4OYP A;  1ZA2 B;  4MKA A;  4IR9 A;  2PSZ A;  2P8I A;  2V5H G;  3M2U B;  5KFW A;  4KR0 B;  3QT6 A;  4ZPT R;  8ATC B;  3H8Y A;  5GME A;  4TQS A;  3BKU A;  1KVJ A;  1U24 A;  3OTD A;  1D8Z A;  1KFS A;  5KG7 A;  1U2R A;  4H4O A;  3IN5 A;  4DQP A;  2B5J B;  2ZD1 A;  4X4Q A;  3FBE A;  2GFF A;  2WVB A;  1JXE A;  2AMC B;  4QIE A;  4UW2 A;  5I42 B;  2MZQ A;  4ZVG A;  2R3V A;  1C2P A;  3OTC A;  4KGV B;  4P6Q A;  5KG0 A;  3QO9 A;  2GO9 A;  3PRD A;  4Q44 A;  3CPW R;  4OJG A;  1R8A A;  3H7H B;  2XM3 A;  2N4D A;  4I4B A;  4DPT A;  1FKO B;  2E9R X;  2E66 A;  1KS2 A;  1RAA B;  3NGT A;  4JV5 F;  3MM9 A;  3TO8 A;  1KHV A;  1QDU B;  3LPY A;  4OYA A;  1FRX A;  3JTP A;  1QD1 A;  4FN5 A;  3GCX P;  2B56 A;  2KN4 A;  2CQB A;  2UXD J;  4OYO A;  2IJR A;  1NB2 A;  2VOP A;  1RWP B;  4DL5 A;  2ZDP A;  1S72 S;  1IBL F;  2WSC C;  3DI6 B;  2M0G B;  3ILL A;  1WC1 A;  3AJD A;  5LOQ A;  3FNN A;  2FDN A;  4ZVR B;  4LMZ A;  1LFW A;  1RCO B;  4WYW A;  2ACY A;  3DFE A;  2QL7 B;  3N6L A;  5L8R C;  1NK0 A;  1X4D A;  3SIP B;  2ZM6 F;  2ZZM A;  4KIA A;  1NK4 A;  1HQU B;  2IVM A;  3KLE B;  5HP1 B;  2XY5 A;  3M32 B;  3HUL A;  1NK6 A;  2EKN A;  3H25 A;  2UU9 F;  2KJV A;  4PXD A;  2MKH A;  1WDT A;  4GRS A;  5DGA A;  3CCS S;  7FDR A;  1S1V A;  4JI2 J;  3GYN A;  4O4G B;  2GJF A;  3X1L B;  2LQ5 A;  1F3F A;  3M2U A;  4USW A;  2NYH A;  4DSI A;  1GX6 A;  3AB4 B;  3R97 A;  1RT5 A;  3G9C A;  2QC3 A;  2QYC A;  2W9A A;  1S6O A;  3TVY A;  5CYM B;  3M9M B;  3OLA A;  4KC5 A;  3TYT A;  1I1G A;  3HHL D;  5F41 A;  2V2Q A;  4GMK A;  4NLD A;  1S77 D;  3PYF A;  2WVE A;  2C3M A;  2VHG A;  1Q81 T;  1Q95 G;  5G4D A;  4DL3 A;  3OFG A;  2B7C B;  4DX7 A;  1D09 B;  3RAM A;  2XO6 A;  2APO A;  1FKO A;  4FF4 A;  2FC8 A;  3UNG C;  2ZUA A;  4U67 Q;  4CO5 A;  2HBZ B;  1CQM A;  3OTE A;  3PYD A;  1RAG B;  4CLP A;  3G6X A;  2M88 A;  1LKZ A;  3GJS B;  2IC3 A;  5LL6 d;  4CM2 A;  5KFO A;  4CCH A;  3ILI A;  1VK8 A;  1GFW B;  1NJZ A;  5GAG I;  2HZA A;  4ECX A;  4NOH A;  3I87 A;  1NDC A;  1L3U A;  3EYZ A;  4B9M A;  3SXL A;  4K50 A;  1Q1K A;  3J7Z T;  2HLU A;  3RB3 A;  2MZR A;  2L9W A;  2XO7 A;  2E7V A;  1FXD A;  5L38 A;  4CH0 S;  1RT6 A;  2WBM A;  2IJN A;  1W2I A;  2K8G A;  2EFO A;  4JI7 F;  1TK5 A;  3FVY A;  4NLX A;  4N41 A;  3QFH A;  3NGS A;  2D41 A;  2O3D A;  4QYR A;  1S0N A;  4RO0 A;  1EQM A;  4NAS A;  1HWL A;  2NPI A;  1WG5 A;  3M32 A;  1IBC B;  4TYB A;  2WW4 A;  3AA8 A;  2J0Q D;  3ZZT A;  3UCZ P;  2W2P P;  4JV5 J;  4DR2 F;  2Y1J A;  2RQK A;  1XNR F;  3NAI A;  5B0E A;  2XHC A;  2FLO A;  3DRP A;  1T05 A;  2EI5 A;  1P9Q C;  3N28 A;  5FJ4 A;  2DNM A;  4X84 A;  3VCD A;  5HVH A;  4NA1 A;  1TL1 B;  4RW9 A;  1WHX A;  3GII A;  3TAR A;  2XS5 A;  4DCJ B;  2DNQ A;  2OLW A;  3GIR A;  1H3D A;  2D3U A;  2ZE2 B;  4DSK A;  1Q0N A;  3D7S B;  2UUT A;  3VR1 A;  4RUC A;  5DQG A;  3M8Y A;  3I9Z A;  2ALZ A;  1EAR A;  4CLK A;  4CT9 A;  2QYG A;  2K2P A;  2Z57 B;  2DIT A;  4ZJL A;  1NKB A;  1S0M A;  1VBZ A;  2B8P A;  1VR6 A;  4H54 A;  1C1C A;  3ZO7 A;  2UU9 J;  2AWZ A;  3AD8 C;  1WC0 A;  1JLG A;  2KFZ A;  4ELV A;  4RBV A;  5K8N A;  2DNL A;  4UOC A;  2OSR A;  3R2D J;  1NPP A;  1SC3 B;  3CVK A;  4M5G A;  4WE1 A;  5FDL A;  5HAN A;  3QBC A;  2MQM A;  5DQI A;  3OV7 A;  4EWT A;  3D5M A;  2F3J A;  4ED7 A;  3BSC A;  3M8S A;  1ZTW A;  5CZX A;  3JXO A;  3FCH A;  5L1J A;  4R5P B;  2KDO A;  4OYM A;  3QWU A;  3TUP A;  2XYG B;  3Q24 A;  2XMA A;  4NPO A;  1RAO A;  1LWE A;  1Q16 B;  4GVB A;  4ZCM A;  2NSC A;  4MK7 A;  5DO2 A;  4WFN Q;  4LF8 F;  4DV5 J;  2DYA A;  5E3R A;  1GH8 A;  1LK7 A;  2YKO A;  4NI2 B;  2W9C B;  4OHY A;  3MED A;  3MMA A;  4ETZ A;  2XMV A;  3HHK A;  4ZVO B;  1VRQ C;  1AW0 A;  3MMC A;  4KRW A;  2SXL A;  2HGL A;  4USU A;  2JSX A;  4F3M A;  3IR7 B;  1NK9 A;  1F5C A;  1BXN A;  2CAD A;  5L1I A;  4JI8 J;  2PDA A;  1RE1 B;  3T5K A;  1RAF B;  2KL8 A;  2RT3 A;  2V68 A;  2MLX A;  2JRS A;  2AW0 A;  1WF1 A;  3F44 A;  1CVJ A;  3THT A; 
#chains in the Genus database with same CATH homology
 2WVE A;  2WVC A;  2HZA A;  2BJ8 A;  3BKT A;  2CA9 A;  1Q5Y A;  3BKU A;  2F1F A;  2BJ9 A;  2Y3Y A;  2CAD A;  3QSI A;  3LGH A;  3BKF A;  2PC6 A;  1Q5V A;  3OD2 A;  2CAJ A;  2FGC A;  2HZV A;  2BJ7 A;  2NZC A;  2BJ1 A;  3PHT A;  2WVD A;  2WVB A;  2BJ3 A;  2WVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...