3QSIA

Nickel binding domain of nikr from helicobacter pylori disclosing partial metal occupancy
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
ESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NikR nickel-responsive regulator
publication title Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 19
structure length 80
sequence length 80
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3qsiA00
2BJ8A 3QSIA 2HZVA 3BKFA 3PHTA 3BKUA 2FGCA 2CAJA 2WVBA 2BJ9A 1Q5VA 2Y3YA 2BJ3A 2NZCA 2CA9A 3BKTA 2BJ7A 2CADA 2WVDA 1Q5YA 2BJ1A 3LGHA 2PC6A 2WVCA 3OD2A 2HZAA 2F1FA 2WVEA 2WVFA
chains in the Genus database with same CATH superfamily
3PY8A 2XBPA 1XR7A 4WZQA 4P10A 2E5LJ 2QA4S 1WTFA 2GIQA 2ADCA 4PG6A 3AOBA 1YTYA 4IKAA 1M1GA 1RTDA 1I5OB 4DR7J 3H90A 3NGTA 1NSQA 3RAXA 1T05A 3OFHA 5KT6A 1FKOA 2DXEA 2FTRA 1VQMS 3BN7A 2HHXA 2DH8A 3J81j 4C8YA 1SJRA 4KJIA 5GMEA 1RI7A 2PN6A 1S4FA 1NDPA 2PDAA 1MROB 4DPTA 4ZA1A 3M6UA 1S1UB 2YXLA 1IUJA 1BQNB 2AZ3A 4QIGA 2MY7A 3A8IA 2R7XA 1OY8A 1CS4B 2FHJD 4CO4A 4OLOA 1S6PB 1EQMA 2OH2A 2ZBQA 3ETOA 3M05A 4CO2A 1U25A 2NLWA 1MWYA 1S49A 2K06A 2C2OB 1IBLJ 2EFNA 1QDUB 1HD1A 5KFCA 4UQGA 4OZJA 4EEYA 1EB0A 4WK3A 3B78A 4RBTA 3U7JA 4USJC 1BC6A 4JI1F 5CABA 4NYZA 3W65A 2J0QD 5E5NA 1HBOB 4QU7A 4RU9A 3TRGA 3R6GB 3G8TA 4F4WA 2ZBCA 2AEJA 4F50A 2SXLA 2GJ2A 1T9WA 2K2PA 1QVFR 3RBXA 2GS8A 2CNKB 1NZ8A 5B08A 4XTTA 4ZDNA 2HFNA 2KVQE 3CJKB 2OMLA 1S1XA 3AOAA 4IRDA 4ETZA 4DR2F 3HI9A 3EE3A 3W60A 2OD4A 1WC3A 4DR4F 4O3PA 3QBCA 2FVQA 4I64A 3J7YU 2DJWA 1RTHA 2BE7D 1P8GA 4RBVA 1M5HA 4C7QA 4OX8A 4RNHA 4F36A 3QQCD 1C2PA 4QYZK 3IRXA 3DRSB 5B0GA 4WFYA 1JLGA 1FO1A 5KFJA 1C1CB 1FHTA 3I4HX 4LUBA 4HR2A 1DBDA 4UOCA 3HT3A 2VKRA 1U2CA 1B70B 1KD1T 4ENOA 3SQOP 4P2SA 3ZTRA 2A10A 1UW4A 2NXNA 3EGZA 2IHR1 2HBRB 3I56S 2VDHA 1VLYA 2HEKA 2VC0A 2L9NA 4I7FA 3D6HB 4HTIA 2QLFB 4AT1B 1FE0A 4F4YA 2YY3A 3PG9A 3DRPA 1VHFA 2XYHB 4U7CA 2AGPA 3QT5A 3LTOA 2AJ1A 5D4PA 2JOQA 4FXWA 1OY9A 4JV1A 5HMXA 3I0SA 3QYYA 2HFSA 4FS1A 4GC7A 4FYDA 2IBKA 3M9NB 4K4YA 3OBIA 2MZJA 1TUVA 2DHHA 3CCQS 3O2IA 3QNWB 4RNNA 2CQPA 4LFBF 4IG0A 5L1IA 3MECB 1TP7A 2NXUA 3W7BA 4NLWA 3R27A 2YX7A 3LPYA 2FHMA 1N5YB 1N33J 1TKTA 1AXQA 2HRTA 3EVOA 4LF8J 4OX7A 1KHVA 1NSPA 4TVAB 3QRPA 1N5SA 1Q86T 4M5HA 4EI2A 3BO2A 2HAFA 3GIKA 3JB9k 2ZHBA 3PKMA 1DTQB 4B3TJ 2B5JA 1C1BA 4TU8A 5LXYA 4F67A 3ISNC 3QIPB 5EN1A 8AT1B 4OYZA 3HPOA 3H8YA 2WBMA 2CG8A 4ES2A 4ZHRA 2W7PA 3NNAA 1U0HB 2HZVA 1FVQA 3R7NB 4X84A 4C0HA 3MD3A 2UV8G 1TMJA 3VHQA 4URSA 1UJ4A 3GYGA 1P9YA 3FEZA 2HQDA 1HQUB 2OPQA 2D41A 2ZH1A 4HT5A 1LWFB 5KG5A 2H5IB 2M0GB 3NWGA 2IBOA 2GJIA 2W01A 1V6HA 1FX2A 1YZ6A 4I67A 1C0UA 1S97A 2BDPA 3AXKA 3UVJB 4PUOA 1HBMB 2RUSA 4I69A 2XI2A 2V8VA 2J6UA 5IS2A 4DX7A 4C0OC 1SC4B 4LF9F 1CBKA 2HQGA 3U27A 2BJ1A 3QATA 2RDJA 1NKBA 4IH6A 1VOMA 5ETNA 2NCKL 2EG1A 1GXLA 3ILOA 2XHWA 2XZTB 4WJBA 2QX0A 5A76A 3JQMA 3TZYA 3X1LB 4Y2KA 1BQMB 4N8NA 3MAQA 3X3UA 1OS5A 3UDEA 4W90B 1UL3A 2WB1D 1B0TA 1QD1A 4OZ2A 3PEJA 4C3MA 1OY6A 3TAMA 3M8PB 3OJUA 3TARA 5AT1B 3M4XA 3C46A 1VRUA 3A8KA 4R5PB 5H9EK 1KQGB 2Y1RI 1K0VA 2CKWA 2BOAA 1RT2B 5CYQA 5L38A 4N56A 3UFCX 2DHSA 2CZ9A 2XULA 3WX8A 1IQZA 3D66A 3Q23A 3LPEA 4YOEA 4RBUA 5DS7A 3FZBA 2HFUA 3EPGA 4RWXA 5C2GA 5T41A 1HNZJ 3C14A 1RT3A 5M2UA 4ED1A 4ZITA 4DUYJ 3LAMA 4Q7AA 2RNEA 4IH5A 3POTB 3HHNB 3OVSA 2XS5A 4J90A 1BGXT 4U8YA 1HA1A 2Z2YB 3NBPB 4P2FA 1HL6A 2J9CA 1AROP 2HG4A 1G4CA 1R27B 5CZVA 2C2KB 3GV7B 1VBXA 2IC3A 3JTNA 4USTA 3R7SB 2K8GA 3BPDA 1RB0A 3DMJA 4WF9Q 3BV8A 4RJVA 3P3DA 1PJ7A 4DL3A 1SV5A 2H51B 3HD2A 3IC1A 1NDLA 4XPEA 4GKKF 1U0SA 4PQUA 4H4OB 5LMUJ 3R5BA 2KU7A 2HQIA 4G65A 4DOZA 1R7IA 2DNZA 2R8JA 1FWPA 4IRKA 5K14B 3QLHA 2QLXA 3THPA 3I9V9 2VG7B 3OR1B 4DU7A 2HHHF 2KHCA 1S1VA 1IBLF 5LOQA 2ADBA 3S6EA 2D3OR 4IFVA 1FRMA 1KWMA 3GZ7A 2HHUA 3MAHA 1CJVA 2EC2A 2QL5B 4LF4J 1S0OA 1RZMA 2LA6A 3I82A 2XHCA 4A8FA 4A46A 3N9UC 1D9FA 3EICA 3W2WA 2FJEB 4ATNA 1E6VA 3K89A 3JSMB 2XSJA 1T8EA 4OI1A 2ZHAA 2VQFJ 2CA9A 2JNJA 1SH2A 3DM2A 1JJHA 5KFOA 5EUHA 2V34A 2YKQA 4LR9A 2P6TA 1FF2A 3RW7A 4A8MP 2DGSA 2BKOA 4QZVB 1XNRJ 1RACB 2D74B 2QE5A 1FXRA 5DDPC 3ITHB 2JLGA 3TEGA 1UJ5A 1WEYA 3SSRA 2H54B 4PWWA 4KPYA 3QRRA 3D3BJ 4TY9A 1LOUA 4F0KA 4AE5A 2QYGA 4IO1A 5IFMA 2C42A 2HLTA 1WC5A 2CDQA 3SQGA 3CCLS 4A8XA 4HH0A 2RT3A 4BC9A 2CPDA 1QE1B 4MKYA 4DBQA 4UF4A 1TV6A 3PYDA 2HLUA 2J6TA 4ECZA 3KLEA 2RHQB 2YPYA 3CIZA 5I3QA 5GAEU 3GSIA 1RHJB 2QL7B 3AD7C 2VC1A 2XS2A 3OSPA 2CADA 3OLAA 3VWSA 3TZWA 3PO5A 4RUHA 4YMEA 3KLFA 3PHEA 1HYSB 3CO9A 3KTQA 2QEXS 1XJWB 2HVIA 4ED4A 1VQYA 3N28A 2VA3A 2VJUA 4O3QA 2HVZA 3MD1A 4OX9F 3OHAA 3R9LA 4JV2A 3Q8RB 1PAUB 1VC0A 4K4XA 1RU2A 3H2VE 1TAUA 3KLVA 1ZPVA 4ECXA 4KY3A 4ED0A 2HMIA 1RAEB 1TK5A 3P96A 5AJ3F 3TZXA 3Q24A 2VB6A 4LF2A 3B4MA 3KFWX 1S99A 3T41A 3M2VB 3NWRA 1ZS6A 2W9BA 3SYZA 2AYMA 4FXVA 4DFPA 3F44A 1UFWA 3QO9A 3HHLC 3DNCA 5KT2A 2EEYA 2D3ZA 4CP5A 2MQMA 1AUSL 3Q89A 4XDCA 5CHCB 2LQ5A 2PEHA 1FX4A 1YGYA 5IT9U 3GFXA 1N33F 2H1YA 2FJDB 1HNWJ 2NUHA 3B6BA 4RW8A 4Q43A 3OUYB 1QAIA 2J76E 3V6JA 4V1Ak 5L9NA 2H5JB 2BJEA 4HI1A 3BSOA 2PIIA 2OSRA 4KAIA 4EFAC 2QA2A 3VF0B 4NWBA 4TYAA 5I42A 5BYRA 1YI2S 3D4JA 3R5JB 2H5EA 2OFHX 4X2BA 2GVDA 2WHOA 1Y4ZB 3IRWP 3BJYA 3TR5A 1DTTB 1N8RT 2QA4G 4OYPA 3JS9A 3KG0A 3V6DB 4PWUA 4FF2A 4GO7X 2H3EB 4AYBD 4NA1A 3TAPA 2X51A 4DFKA 1N0UA 1T95A 5FLXU 4KFBB 5FLXY 1HBUB 2VG5A 4JI7F 4JI2F 3MR6A 3QIDA 3ENWA 2RQKA 4AXJA 3I31A 3D1HA 1EETB 3UDVA 2GIFA 4OHZA 1FJEB 1SJQA 5CCLA 3QWPA 4CYUA 5KG1A 4QR0A 4L76A 4TYBA 4M5GA 1SH3A 4J9KA 3MUMP 3UNGC 4O44A 3T1AA 3KG1A 4B3OB 4Q8FA 3OR2A 3ZO7A 2CDRB 5C42B 1YVFA 1UVJA 1VGYA 4DL5A 3RGIA 1VCTA 1R8BA 3E01A 3CWJA 2XMVA 1Q53A 2RU9A 1LNQA 2XWYA 1GAOA 2B7CB 4CO1A 4DUZF 2M52A 2F1FA 3W3SA 2QC3A 2AEFA 1GX6A 4I6WA 1HHTP 2YQ1A 4DSJA 5A6PA 4LQ9A 2E9ZA 5AXKA 5A8RA 4PPDA 1NDCA 1MROA 4U8VA 1YIJS 2Z58B 3HD1A 1ZTWA 1WKJA 4S0MA 1KP6A 2ZJQQ 4QPXA 5DZ7A 1GT8A 4DV5J 2QMWA 3RAMA 1SQGA 4RR5A 4MAKA 3KLIB 4K0KF 2GVZB 3ZXWA 3K17A 2HHTA 5LMNJ 2FVPA 1S6PA 3BDEA 4DLGA 2DR6A 5JVHQ 1VR6A 3ZZZA 2IFXA 4LSZB 2HYIB 5D0HA 2BKNA 3UD3P 4AFFA 4XO0A 5D78A 2Q66A 1VC6A 4C11B 2WZ1A 1WEXA 2AW0A 3QGHA 2XGPA 4JI8J 1HNZF 4ED2A 3RYLA 3UNYA 3MEKA 1N48A 4FDFA 4DUYF 2DNPA 3HHLA 3SZ2A 1Y3JA 1Y5NB 1VHIA 4JI3J 3H25A 3H5YA 4OZ3A 4KO0A 4OV1A 1RTJA 3K0JA 1FDDA 4DG1A 3HVTB 1JK9B 3P49B 4I4BA 5D4OA 1F2GA 3HULA 4ZVFA 2GA7A 3BSNA 2K3KA 3G82A 1H2TZ 3RR8A 1I94J 3IO1A 3W61A 3H20A 2V63A 3G86A 5KFMA 2XI3A 2R2UA 3GQCA 5LMUF 1BWEA 2XCPA 1VQPS 1NZAA 2F3JA 3SV4A 1X4FA 3IGVA 1S6OA 2RJZA 2WAQD 4ETXA 5KTQA 3PW5A 2DR7A 1T03A 3MF5A 1X4GA 3M30B 5C25B 2A2DA 3DYAA 4RLEA 3IM8A 3DRSA 2G4BA 1FK9B 4QIWD 3CVKA 4O23A 2OPRB 3GG1A 1OSDA 1U1NA 5LM7E 1GMUA 4FKYA 3IGNA 3KHLA 4ECTA 3EXCX 4ZOSA 5CH7B 1FERA 2ZOMA 4E8UA 1C4AA 3Q8SB 1R3NA 4CLFA 2B8PA 4OI4A 3M32B 1PYSB 2JEIA 2R9LA 3TUPA 3D9BA 5KFVA 1XNRF 4NRUA 2RVJA 5GAGI 4ZIVA 2NSBA 1UTAA 3M8SA 4DF8A 3KJFB 3MM5A 1S6UA 3Q22A 2B9YA 2DITA 2IRYA 2OUGA 2E5JA 4IG3B 2HS4A 1RDRA 4JI4F 1QJHA 4DFJA 3VTIA 4NZ6A 3H0PA 2IDEA 2ZKTA 3GCWP 3MECA 2BJ9A 4JI5F 3SDEB 2DNRA 5BJRA 4TQSA 2VJVA 2AGQA 3NCPA 3NMRA 2DNGA 3PRBA 2MQOA 2B8QA 4CLZA 5JMNA 4DSIA 1U1QA 1JJ2R 3V81B 4ZVHA 2IYGA 2OJ3A 3CC7S 1IKWB 3SCLE 5M2PA 4EK2A 3HZGA 2QGFB 2LFVA 4ZLJA 1X4HA 5T7LB 2CZ4A 1N0VC 2Z30B 1DTQA 4FNIA 1J2VA 5LJ3Y 1P6TA 1PC5A 4X4OA 2R2SA 3M8WA 4Y34A 5B0AA 2A2CA 4CI0B 1QUPA 3MPUB 2RS8A 4CCHA 5ITHA 1JIHA 1RKIA 2XYGB 2FY8A 2IM3A 4P52A 1YDLA 3FC9A 1S76D 1X4AA 4J9UE 1HQUA 3IR7B 1GFWB 1Q5VA 2NZ4A 1LWFA 4CRJA 4M1KA 3KDOA 2CNLB 3J80U 4JUZA 3J80Y 1D8ZA 3N5BA 2J8SA 1YHQS 1R6YA 2ZDPA 2ATLA 7FDRA 3G71S 4LMZA 3UVJA 3ZTOA 3M2RA 1HBMA 4KTQA 1VK8A 1M90T 3TAQA 3LF0A 4FS2A 2GCFA 3QJLA 2HIYA 3HHKA 1PAEX 3TUIC 4G6VB 3PFOA 1NKEA 2NZCA 3HHDA 2DBBA 2F63A 2ZHOA 3DRRA 4WK1A 2BXJA 3D6FB 2M9KA 4EWTA 1WEZA 2WSEC 3KJVA 1RT4B 2LDIA 1BQMA 4USKA 1JQGA 3W8PA 4YHHF 4KE5A 3KOAA 2R8GA 1RA6A 3MAAB 2R8KA 4NLTA 4QBUA 2UUBJ 2MDAA 4R5PA 5F8IA 3O6QA 5LSOA 2GQQA 3MFIA 3DLKA 4QIFA 2DCUB 1Y0HA 1VRTB 4C6AA 2VONA 1MLAA 4DR6J 4ZPVR 1DLOB 1B4SA 1VQ5S 2WSFC 1UWAA 2R42A 1IXKA 3LO3A 1HIYA 4UUWA 5G4DA 2O67A 2YWHA 2ZNZA 3POTA 4PCQA 1QY7A 2FGOA 1RWUA 1FJGJ 5J1PA 1OQ3A 1ICEB 3NBPA 3IG1B 1HQ2A 2N7YA 3HFZB 2ZH4A 1NK5A 2BMBA 4QYRA 4LSLB 2X3DA 4WIQA 4NE9C 3AJ2A 3H59A 4IO9Q 3K5OA 1RAHB 5C24A 3D3CJ 4IFYB 2AX1A 5A2QY 1UEVA 4FYWB 3FFIB 3AA9A 5IV4A 2KZMA 5JXSA 3BR9A 5HQMA 4EO6A 4QU6A 4ELVA 4DV7J 5LMNF 1LWXA 3FDSA 3J81Y 3AODA 4Y3CA 2B56A 2ZBIA 1ULRA 2LDYA 3GSDA 2VG7A 4KGKA 4MYTA 4YY3F 4JB8B 1HMVB 4HHJA 1BMQB 4ZMMA 1KDNA 2I5JA 1WOOA 3LGMA 4JI8F 1R89A 4C8NA 4UQTA 4UW2A 3QJPA 3DLEB 4ZLNA 1EIYB 2VODA 1RHQB 3I0RB 3JSMA 4UOHA 4X4TA 5DGBA 1UVLA 3RRHA 3PFEA 4K59A 2ZZNA 2VOPA 2CPXA 1Q81T 1WC4A 3ZZUA 1MWQA 3DU6A 1R31A 1OMSA 2FJBB 3UO0A 2QLJB 4ZPBA 2VICA 2YH0A 1I94F 3CIMA 2N7CA 4Q0BB 4ZLPA 5KFFA 5M2RA 4D3GA 1CJTB 3C15B 2NSCA 2EK6A 2JJ4D 4F0MA 1RAJA 5K20B 1YBUA 5KFKA 5HL7Q 3DRYA 5KFPA 2KFZA 1NUEA 2ROGA 3MCSA 3K5NA 3OTCA 3KXDA 1K73T 3MHYA 4DDFA 3CC4S 1RWXB 1YZ7A 2BRLA 2OTJS 2OPPA 1RT7A 2YQ3A 1RBLA 2DH7A 2JLEA 2A1BA 2EC0A 4WP3A 5AE1A 4ID8A 1RT6B 2XMKA 2BACA 1A0OB 5HROA 2Z2ZA 2DEJA 3DGPB 4A8SA 2D3O1 3JSRA 2LMIA 3W9IA 4OJ1A 4MIWA 1ZTTA 3KK1B 5D0EA 1JKHB 5IM0A 3Q8UA 2GNKA 1WNEA 3HO1A 1F5AA 5KOXA 1B3TA 3N01A 1SIWB 3UCGA 5CA5A 4KR0B 3M9OB 1SUQB 3K5MA 3MEGB 2RRAA 5KG7A 1X60A 1YWXA 4DV3F 2C2MB 4PKDB 5EWEA 5I3PA 3BGLA 3T1HF 2CPIA 1X5PA 4NLVA 3C16B 3VCDA 5L39A 3MMCB 4F4AA 4JV5J 1QLNA 2B4VA 2AP6A 1F6TA 2W4DA 3IN5A 1TKXB 3W2VB 4KHPF 2DVIA 1WHVA 3QT7A 3US5A 2QRRA 2A0FB 4WFZA 3FKBA 2GZOA 2KJWA 1TL7A 2BJ3A 1ZAVA 1UFKA 3CJRA 3C6UB 3KJNB 4KT0C 4TKTA 5E3CA 2QLWA 1T9TA 3RTVA 3RUBL 3I87A 2BV3A 2HRYA 2E1MC 5ETMA 3CE8A 2PO4A 1F3FA 1U1KA 3K57A 3K2YA 3NS6A 1JLAA 3NG8A 4IOBA 1Q95G 1UWBB 1YJVA 5E2QA 3TEHB 1SVDA 1S9EA 1N88A 2F8EX 3W9HA 5D0RA 1IM4A 3DN9A 4PXBA 4V19J 3GIRA 1N34F 4ED7A 3IWLA 5DLGA 2MKSA 3CJSA 5LXRA 1GX5A 1BE4A 1DTTA 3FVYA 4ZVEA 2VKZG 5HJYA 3T1YF 2QIFA 2BE9B 1MU2B 1CC7A 5SUHA 2XTJP 3O5TB 1RA7A 4OJGA 1W25A 2CPEA 2X7IA 4L73A 3M8QA 1NB7A 1B0PA 1JLBB 1RLDA 3WIUA 1HNXJ 4IYQA 2KN4A 2UUAJ 5HO4A 1U6ZA 4LR8A 1WDTA 1D9DA 1H2UX 4K4SA 1NRKA 3R8YA 1HD0A 1UVIA 1XTZA 2DNQA 2UVWA 1S4EA 1GNKA 1NK9A 1V3SA 2RAQA 3VGUA 1Q8LA 3DGVA 1UETA 2CJAA 2YVSA 5D77A 4WPAA 1T11A 2IVFB 4ECUA 1HPZA 2CNOB 2MPUA 4LFCF 2KO1A 1GEHA 1FTCA 1DZ5A 2YBVA 1CJKB 1K1QA 2XMJA 5BR8J 1CPZA 1RWPB 2DHAA 2EKYA 2GHVC 1SQFA 4DSFA 3OD2A 1N32J 3RBDA 2YKMB 3BQ2A 4AQYJ 3NRBA 2VDIA 4OI6A 4BBYA 2WW8A 3HFKA 1JNZB 2ZH7A 2DNKA 3PEHA 1T94A 4F02A 4OJ3A 2OEMA 2IY5B 2MZQA 2CJ9A 4ER8A 1YJUA 4DR1J 1M5SA 4HTJA 4DU8A 1FI4A 2B0GA 2FUG9 1UA1A 3RBEA 4NX9A 5J2PB 4WIIA 2UUBF 1FRLA 2DNYA 2GO8A 1D8YA 2EFGA 1YLXA 2UXBF 1TL5A 2QZ8A 2OMOA 2YKPA 2KG1A 4LREA 2ASJA 2KFNA 3SSQA 4DR6F 2VASA 2JFDA 5IT0A 4X64J 4GKJJ 3OHBA 3D0HE 2YNFA 4CIOA 4C11A 3PIOQ 2HGMA 2HNZB 2HZCA 4JYAJ 2UVUA 1JLEA 2DR8A 3MDFA 2H48B 1C0TB 3GV8B 3W9JA 4LVOP 3LWLA 3Q8YA 3Q83A 3FSIA 4GMKA 3OFFA 3ZC4A 4TU9A 1FJGF 4YP3A 2HNYB 1Q5YA 2C22A 2M88A 2V8HA 2PA3A 3WC2A 3G2XA 4AXIA 2HNDA 2RF2B 3MUTP 1B99A 4OZ1A 3I4PA 3AHPA 4EBEA 2OP5A 4Y6IA 3UQSA 1YJRA 3TUZC 2RQ4A 1UMJA 5KFTA 2XNQA 4EZ6A 2GJFA 4DV7F 3PX0A 4Y00A 4Q8EA 4KKOA 4RW6B 1P1LA 2J9DA 2GMLA 2QFJA 1QUVA 3M9MB 3M30A 1OYEA 3NOGA 4L74A 3W63A 3DC2A 2V2ZA 1OJ4A 2P8IA 1HW9A 4Q5VA 1FK9A 1HNIB 3WDOA 4ZCLA 2XLIA 4MH8A 1URRA 3C6TB 4RW9B 3MFHA 2PC6A 2FHJA 4AUKA 5CYMA 4DPUA 2ZC3A 2LEPA 3GG0A 3MM6B 1S1TB 2ZH3A 1N56A 3L95X 4RWWA 4WYLA 2XMUA 2ATCB 3KHRA 2RRBA 3M32A 4R8UA 1FNOA 2Z2MA 3DOLB 4L6V3 4OYAA 1YRUA 3L4BC 1Y5LB 2G2OA 2KTQA 3MZIA 5K8PA 1XBWA 2HK3A 2VFUA 3CXCR 2Z57B 5E41A 4ZVGA 1Y9OA 4MIBA 1KQFB 2UU9J 3PJWA 2W2QP 4KH1B 2RE1A 4RNOA 1NHVA 1JLCA 4ZPCA 3CCUS 3GJSB 3OLBA 4J9MA 2YNGB 2OD6A 3KK2B 3I32A 4NXNJ 2VPZB 3QPIA 1WOSA 2B6AA 1PJ5A 1NHUA 1TTHB 3MM7B 1DJ0A 1NJZA 2QLBB 1JX4A 3R97A 1CJUB 1HQEB 3VGSA 3GU0A 2K7JA 2W2NP 4FF1A 1S12A 3RW6A 5AXMA 5J2NB 4CWBA 3V81A 3FCVA 4ED8A 1NSAA 1WWHA 4ZIWA 1IKWA 3J7Z5 2LEBA 4LFAJ 1HLWA 1D0EA 4ED5A 1S9GA 1GTEA 5HQ8A 1FT8A 2RMLA 5EWFA 3ZZPA 2UUTA 2V69A 2DR5A 2YKNB 3CDUA 4O3NA 2OELA 1FD2A 3BBCA 5RUBA 3T6JA 3TI0A 1DRZA 2J6SA 4DV1F 2KRBA 4B9VA 3OPKA 4DS4A 1PGZA 1GQEA 2VHGA 3BGRA 3OFEA 2IJNA 2CQGA 4CLUA 1WSRA 2O1PA 1NO8A 1QM9A 2YKOA 1QTMA 5DZ6A 2CQDA 3GFHA 2ZBRA 3FQLA 2V67A 4LT6A 2FLNA 4N47A 4DL7A 3TA0A 3O1LA 4B3MJ 4MK9A 3M8RA 3HM9A 3CDAA 2ZD1B 4HACA 5EX3A 2VQEJ 4J5OA 4Q45A 4ZN3A 3IWXA 3UE2A 2A6MA 1SJ3P 3NGKA 5SZTA 5DETA 4EMDA 2OI2A 1K9MT 2OHDA 1X9SA 3NOCA 4ECRA 4LF6J 3ETMA 1F60B 2Y1LB 2AEMA 1SC3B 1WORA 3EPIA 1RT4A 3BN4A 3WQPA 1NEEA 1U26A 1YJ9S 3PNIA 5KG4A 4MK7A 3DI6A 3TVZA 1PBAA 3CD0A 1JLFB 4QIEA 4Y2CA 3TX8A 4ZP9A 1HNXF 3H98A 3MAAA 3D1OA 2HZAA 3ENVA 2XG8A 2UUAF 3M7VA 5HMZA 3CMAS 2L08A 4DF4A 2GX8A 1K8AT 3N6LA 2AMCB 1PYTA 1BWVA 1F1BB 1IBKJ 3WIVA 2M7SA 3GIJA 2B7BB 5I3UA 1N5TA 1TK8A 1DLOA 2V2KA 1HI1A 2UV8A 2XLJA 2V4JA 2IM2A 1BQXA 2QSFA 4A8OA 4I2QA 2XQCA 3PVXA 1EP4B 4O4RA 2QO3A 5BR8F 3BQ1A 3IWNC 2DY9A 5HAOA 4QOTA 1VLOA 4FF4A 2FGCA 3T5KA 4G1IA 3JAMY 3NGUA 1T3OA 3CCSS 5D0GA 3AXMA 2W7OA 4M5JA 2XM3A 4USVA 3IG1A 2WK4A 1LK7A 1TL4A 5IXUA 1NK7A 2VBWA 3M2UB 4O3OA 4Z2XA 1N32F 3TP2A 2Q43A 4KHMA 1U49A 4DMZA 4G1QB 4AQYF 4UT4A 1CEZA 4MMOA 2F7VA 1YBTA 2BYCA 1OYDA 1NPPA 3DLHA 3DFEA 1VDHA 1XMOJ 3GIMA 2M8DB 3EZUA 5FDLB 4A48A 2R2RA 2XMTA 1PKUA 5KFGA 2MZSA 2MKKA 1GH8A 1X5TA 4ZVUB 3G96A 3VZHA 3CJ8A 4ZPAA 2UUCJ 2BE2A 4J9LA 1V5VA 3S7RA 4GKJF 3MCNA 3Q2SC 1XNQJ 4EBDA 2VOOA 4F3QA 4JYAF 1IJEB 2RDIA 4I2PB 4J37A 5ADZA 4DX6A 4OHXA 3P5BP 3IXQA 1WHXA 1WELA 3DLEA 2W7AA 1CG2A 4N8OA 2IM0A 4F4KA 4DN0A 1OPZA 3Q0AA 3CCJS 3IM9A 3MEEB 1X7VA 3TANA 1IQTA 2R7OA 4HT7A 4ZVTB 4ZVOB 3W5YA 1Y3KA 2NUUG 2ZH5A 4YB7A 2OPSA 4Q0BA 3ZTPA 2B4PA 1U8SA 3EXYA 2Q3PA 4WXWA 3W5ZA 1RWKB 4OJHA 3C15A 2JVOA 1TKDA 1N36F 3OJSA 2CVIA 5J1EA 4N77A 2DGWA 3NGRA 2XC9A 1OQ6A 3MM8A 3H5SA 5MLCV 3WBZA 3ZZRA 1OWXA 1JLQB 4EYHB 1TUWA 3DLBA 4PYAA 4P2MA 2O5DA 3CDEA 2BUNA 4OI0A 3TWZA 2IAJB 2E5HA 1X4CA 1QAXA 2Y3YA 2BQRA 4UZBA 4IH7A 4MFBA 2E5IA 1GXUA 2FHKA 4F2RA 1FFWB 1YJNS 1X8DA 1HWUA 5DGAA 1RT1A 2NXCA 2XCAA 3MI7X 2J8AA 1RT6A 3KMSA 2HPUA 2NXEA 1UKUA 4P7TA 2BZ2A 4HVZA 3HT0A 1FKOB 1FJ7A 1ZZFA 3S01A 5GAHI 3R5DA 1QSSA 1XMBA 4YFUA 4FKXA 4B9UA 1DFDA 2L48A 2M2BA 1I6JA 5LJ5Y 3V4IA 5MAOA 2HQCA 1SUQA 2CG4A 2JEJA 1F5CA 5ETVA 2DEIA 3GCXP 1FJCA 3D1QA 3RB4A 4WFNQ 1W7WA 3TO8A 3OW2R 1TUGB 3QFHA 3OSNA 4OL8A 3MMCA 2MKHA 4NA3A 2KKHA 2CQ4A 2QMUB 3D6MB 5HK4A 3W2VA 2CPJA 2MSTA 3H4DA 3I96A 4ZCMA 3QSIA 4MIAA 1FD8A 3UN2A 1U1RA 3V5RA 2YWEA 1A7GE 5FJ4A 5HANA 3L7UA 2B9WA 1D9AA 4DV6F 1B0VA 3HVWA 5EWGA 4I1TA 4N76A 4NLUA 4CT9A 4X4SA 4B17A 1H38A 3FBBA 3IMQJ 4RUAA 1U1MA 3KMQA 4LBIA 2DGXA 4LFAF 2HQFA 1UWBA 1ZA1B 2YH1A 3BH6B 4DCJB 3LW5C 1RTIB 1WG4A 4JI0F 3V2UC 3MUVP 3CTRA 4USMA 3MR5A 4FPRA 2UXCF 1RABB 3MEDB 4WE1A 4C48A 2H4YB 4QYZJ 4O4GA 4N5SA 5J2QB 4I6AA 3BPSP 4BDPA 1VBZA 3CCRS 2WVEA 4CM2A 4HDGA 3DLGA 5DRKA 4KGMA 5IQQA 1R0AA 1RTHB 4DPYA 3IFEA 3H5UA 3A3OB 3TJ8A 1CULA 4N7TA 2B4UA 2VUGA 3DOMA 1JLGB 2HWIA 1LWCA 1LWEB 2BJDA 3HJVA 4ZVPB 4P2XA 3PZPA 1KTQA 5F8HA 2W8LA 4AL5A 4OYXA 2HWTA 1VJQA 4MKVA 4B3MF 2ACYA 2FLLA 1WG1A 3KK3B 1AZSA 4P9SA 3VQSA 3RBZA 3ZZ0A 5U47A 4P6QA 1CLFA 5K8MA 4CT8A 2GIRA 3UD4P 5EHHA 1SC1B 2XMAA 1F3VA 4I7FB 2HBZB 2X3GA 3GJRB 4LF6F 3VZIA 1T02A 2LP4A 2W8KA 9ATCB 2XO6A 3P45B 4GVBA 2F4FA 1S10A 2E1PA 2AJ2A 2YNIA 4MYUA 2DR9A 2UXDJ 4EZ9A 3U1LA 5J2MA 3MTKA 3G6ES 5L1JA 4X62J 2OIHA 1ZPWX 3FBCA 4IG0B 2MMYA 2LU1A 2AQ4A 1B64A 4UZCA 5KFWA 2B3TB 2RIJA 3NNHA 3T5HA 3N6MA 4NXMJ 4NCGB 3CD7A 4D3HA 2ZH8A 1TKTB 5IOLA 1SL1A 4DZ6A 1U1PA 3PX4A 2F5GA 3ET6B 5BYSA 3G8QA 1D1UA 4DL4A 3MGJA 1NH8A 4ES1A 4OLPA 3CC2S 2MQNA 4DQSA 3BGFA 3CJ2A 1J27A 3PW0A 1RU1A 3TQEA 1T0TV 1TFWA 2B5JB 4QJVA 1C1BB 2V8PA 1S79A 1H0HB 4ZVSB 4J9QA 3BF4A 2HNYA 4U67Q 4Q2MA 4XPCA 4QW9A 4DR5F 2FZCB 2AD9A 2WVCA 1KSPA 4ZHRB 4OZ0A 2WSCC 2JVRA 5CXTA 4WTYA 2JLFA 2RF2A 1S48A 1LW0A 2CFXA 5HVHA 4X66J 2AV5A 1XMOF 3TOQA 3CO0P 5JUMA 4CO3A 3A8JA 3MMBA 3HXMA 2VFTA 4FXDA 4JI6J 1KOOA 4CLPA 1V9OA 4KSEB 2ZVSA 5HQLA 1MMDA 4RW6A 3UWTA 4UY85 2G0IA 3NS5A 2UUCF 2KVIA 4KGVB 4LIWA 1C0UB 1A6LA 3F41A 1SKSA 3U02A 4PUOB 2WCXA 4OYIA 1Q7LB 2C1EB 4HHUA 2WVDA 1HNIA 5B0FA 1NK8A 3PR4A 3KWMA 1RT5A 3C6TA 2LQ9A 1MW7A 4YB6A 2X1BA 3PM9A 2NQPA 1G7CB 2G13A 2Q6BA 5DO2A 1ACMB 4P7VA 5H9EJ 1VQ6S 1O51A 3H2UB 1RP5A 4YUDA 4ID5B 3C66A 1ELOA 1CC8A 2E5LF 3L7PA 5IV3A 3FQKA 3DOLA 3KLGB 1T7PA 1BLUA 3AOCA 2X1GA 1H7XA 3ZNJ1 2WBRA 2WB4A 3JTOA 1L3KA 4C8KA 4DR7F 3EUNA 2RH3A 4ITSA 1JXEA 3R1HA 1VRUB 1IKYA 4IUFA 1VRQC 2Y0BB 3N0VA 3B82A 2BX6A 4YR0A 2NYHA 2QYCA 3EX7B 2V4RA 3K5PA 1SKWA 2GHPA 2VIHA 3LALA 1YJWS 3KK2A 3CT9A 1W2BR 2OO4A 2HHPA 2ALZA 5KFIA 2MQQA 2FZKB 2XS7A 3C14B 4DSLA 4LBPA 5AE3A 1M0SA 3MM7A 1DURA 2EVZA 2FLOA 2YX1A 5LSLA 2FDNA 1HQEA 2AWZA 1HW8A 2DNOA 4DJBA 1O0PA 2VBYA 2YX4A 8RUCA 1O5JA 4JI1J 2N4DA 2KT3A 4Q2LA 5F8MA 4NLGA 4M95A 2VBXA 3SXLA 2N4CA 4NCAA 2EWHA 4J7CA 4TQRA 2RKIA 5H1SV 2DO0A 3U1MA 4TLQA 5B09A 1Q79A 1KQKA 3DMJB 2YNHA 2MKIA 2XGQA 3GE9A 1SV5B 3BBBA 1N52B 3KUEA 1TL1A 2FY1A 4NASA 1IWAA 3LH2S 3SIPB 4DR2J 3RG6A 4N41A 4PQUB 4NLXA 4DX5A 3IR6B 2KL8A 4ZN1A 2HFVA 2KJVA 3MMJA 4RW7A 3K5LA 2Z56B 4A8WA 5FIIA 4X4PA 5GADI 1RAIB 4I0WA 4OI2A 1S1VB 4KYZA 1Y11A 3E51A 4ECYA 2MB0B 3QZ7A 2XEXA 2C2RA 1CJVB 2BKPA 3TJAA 2Y1JA 3GTYX 2CJXB 3IBFB 5JJBA 1YJ7A 2A18A 3QJJA 3SFGA 4HI2A 2DHXA 3W1YC 5KFDA 1WOPA 1MWZA 4K2JA 2XMWA 1SQEA 3NY0A 4LBHA 4M5DA 4F25A 5HMYA 1QVGR 2ZD1A 3FMWA 2W4PA 5GMKa 1WF2A 4OQJA 3SSSA 1VMBA 2W9CA 4RW4B 1WDDA 2KB2A 1S1WB 2BM0A 2V8GA 3HP6A 1W26A 4TY8A 3CDBA 4PXEA 2XY7A 4F04B 3LP0B 2W4CA 3W62A 4C8MA 1Q1KA 4FBTA 3MOJB 4GC6A 2R8HA 4LR7A 1GMWD 1XMQJ 3HKZD 2LQBA 1JLFA 4DR3J 2HHQA 2ASYA 2MHNA 4BLGA 3SQGB 4A4JA 5KFYA 5CYJA 3OTBA 5F9LA 4L72B 3D54A 5A8KA 2J9EA 1FA0A 1WF0A 1TV6B 1FRKA 1TL3A 2MJUA 4KB7A 1KLMA 1X4EA 2BQUA 3VGVA 4NCBA 2E1RA 2KYZA 2ZDOA 2BM1A 3GFYA 2C28A 3T9NA 5KFXA 2FVRA 4CLLA 3KHGA 2ZOFA 2LLZA 3AA8A 4ICLA 2WTFA 3CUNA 2BW2A 1U8WA 3KLFB 2IJRA 2FD2A 3ELHA 2MKCA 2AJQA 2LA4A 3AQPA 3IS9A 1BY9A 5B0EA 2KI2A 1M5VC 1S6QA 1TFYA 3NL0A 2GAHC 4WP8A 5IT9Y 2BANA 3ZZYA 3HVAA 3GONA 3GJQB 5KFQA 3W64A 1M5KC 5DG7A 4LF8F 4NI2A 1SKRA 2MJNA 2CWXA 1NXIA 4MKAA 1EQ0A 3BSCA 3TQ1A 2JWNA 3L09A 2MQLA 2KYXA 3IA0A 5E3PA 4B3TF 2OLWA 5FDLA 3M1VA 1RSCA 5CD4A 2UXDF 2PMWA 2DHGA 4K8RA 4X62F 2R7SA 4B3RJ 1IKXB 3NP5A 5A8WA 2P5VA 4DCOB 2ZBPA 4NL5A 3NKYA 2RUGA 2NR0A 3VV2B 2BR0A 2GW8A 2MKJA 1AW0A 5JVGQ 4PG8A 4RW8B 4DUTA 2DGUA 3MMAB 2MGZA 4Y2AA 4U7UK 2J7KA 2ZWPA 3K8WA 5A0YB 4YDXA 1JXLA 3BB5A 4UOGA 4LRCA 1EKRA 1UW9A 1WKLA 1VBYA 3H5XA 1LW2A 2MQPA 2LCWA 3P8BB 2COLA 1NJIT 5HMWA 1DQ9A 4L3KA 4B9TA 2IRXA 4B02A 4HL9A 4O0NA 1KVKA 4XK8C 1VJWA 4A8YA 1ROFA 2QA1A 1OPIA 1Y7PA 1U24A 2DKOB 1GMVA 4JI6F 1NM2A 3QT6A 1FKAF 1X4DA 3WC0A 5HBMB 1H2VZ 5DDQC 4LRFA 2Z4PA 2DRBA 4A8KA 2XMMA 1RLCL 1S1UA 4B3SJ 2H9ZA 1BQNA 2ABYA 3Q86A 2OSQA 1L3SA 4GO5X 4O44B 4NEZA 3PYFA 4ANEA 3OR2B 3BEGB 2ZEJA 3B8HA 4RNFA 1IBCB 1WG5A 1CS4A 1ITPA 3E01B 2ZVIA 4ZVQB 4E2FB 1ZAXA 3QGPA 4G3IA 5DM6Q 2MEWA 4ANDA 5F3TA 1LXJA 1MG7A 1FKPB 2VH7A 2ASLA 5GADU 1NCLA 2ACMA 5A8RB 1IKVB 3RB3A 2PFDA 2WVBA 4KPCA 1S0NA 1U4BA 1VQNS 1S72S 4X4NA 2IJFA 1G2EA 3D67A 3B4DA 3UD5A 4ED6A 3QT8A 1EARA 5KFRA 3L9ZA 4GKKJ 4QWCA 1HBOA 5B0BA 3PCOB 2BVZA 2N3OA 4CZCA 4UTGA 3MR7A 4KH0B 2ILYA 2AJFE 1RWVB 1W2IA 4ZS6A 1S0MA 1RCXB 4QR1A 4B9SA 4KV8B 2BRKA 4ILRA 2ZFHA 4WBFA 4ZJOA 2PFFB 2K3IA 3CCES 2HHHJ 2CVEA 1WHYA 1F9HA 3CJKA 2MTLA 1S7IA 4EU0A 5KT3A 2EK1A 3J7A1 1VIOA 5FD1A 3MPYA 2RHSB 3GIIA 1FDBA 4YR3A 4J9SA 3M6VA 1WD6A 1TAQA 3HHLB 2YQ0A 2BJ8A 4DN9A 3FEYB 4LRAA 1YG0A 4ZPTR 1QTNB 5CCMA 2VA2A 2CWKA 1LK5A 5F8LA 4KO0B 2IMWP 2D7SA 3QGIA 1RTJB 2I0XA 1Q8BA 2KXFA 4DG1B 4RUCA 3GP9A 2XY5A 2B9EA 3OL9A 1NPKA 2EFQA 1SJ4P 3MCOA 1QAJA 1N54B 3G82B 3N5FA 2DGVA 1T3NA 4LF4F 2W24A 1DQAA 1C1CA 4CQ1A 1RTIA 3RR7A 2M8HA 1RADB 3MEDA 3LP2B 2WRMA 2VZ9A 4MT1A 3KNGA 3LQVA 5GMDA 5J2QA 2VQFF 3OTOJ 2HGLA 4IOAQ 3BGOP 3UR0A 2LKZA 3J7ZT 3H4BA 5KFUA 3NEKA 3S1TA 1KFDA 3AD8C 1T03B 4TXSA 4WCEQ 2VPWB 1TU0B 4DEZA 1CSJA 2LQJA 1KVJA 1K44A 1IJFB 3DYAB 3ILIA 5THWA 1Q0NA 3UW1A 3HJFA 1LWEA 1S7HA 3OTEA 1PSDA 1URNA 2L9DA 1F5BA 3V6HA 4ECWA 1NLKL 3VGTA 3F56A 4NLDA 1EHWA 4IQXA 3VAIA 1IBMJ 2VPYB 3KK3A 1NK0A 4L3NA 1VISA 2QMXA 4ZJLA 2GHWA 1PC4A 1O8BA 1Y5IB 2EW9A 4P75A 2XO7A 1AT1B 5DLFA 3TUJC 4C2MA 2FC9A 1NJWA 5KFLA 1N5YA 4OX9J 2ZOGA 5AXLA 3CSKA 2I9SA 1PILA 3KUGA 3MM5B 3GYXB 2KT5A 5F8GA 5ETOA 2MZRA 5L46A 1UPPA 1XMQF 2JH3A 1U1LA 4DR3F 1EX8A 1EJ7L 1V3RA 5AJ3J 3F73A 5EDWA 4MKBA 2JC1A 2RB7A 3QIPA 5HN0A 1MN7A 2H4WB 3EMTA 4NMLA 2C2ZB 2U2FA 2V50A 4KGZB 2OEJA 3QAEA 1RK8A 1UFLA 4NCGA 3CCTA 1U0HA 4PG5A 2LXIA 2BA9A 2F40A 1UVNA 4IR1A 3ET6A 4WFXA 1NSKL 1RKJA 2FJXA 4PAAA 4F4ZA 4X65J 3CJ4A 1ZM2A 3SCJE 3MPWA 5KFNA 1NHKL 1RXOB 4JP8A 2R7QA 1HNWF 3VAGA 2R7WA 3DDIA 4BC7A 3TJ9A 3FNNA 5GAEI 1LV5A 1JWWA 2ALYB 2GV1A 2WOMB 4Z7YA 2IVYA 3GILA 4RZRA 1VQ4S 2AYEA 3GV5B 3H2LA 1Q8IA 3FCHA 2KRRA 2A6OA 3ULHA 2XZDB 2HBYB 5D3GB 4JI7J 4JI2J 1REVB 2CQIA 4B3RF 2WW4A 4QIVA 1AFIA 3G87A 4LF5J 4P73A 1UZDA 1N6QB 1KC8T 3SV3A 2FZGB 2FHOB 2R2TA 2ROEA 3FRYA 4JOUA 4LRBA 3HHEA 5C5JA 3BO4A 1RHUB 3I5CA 1REGX 3M2RB 2V68A 3M8PA 3PACA 2IA0A 2MYFA 2AHOB 2E5GA 4CH7A 1B7YB 2QV6A 7FD1A 2HHSA 4EYIB 5IC4B 3A8EA 2FQQB 3HSDA 1RT2A 5IC6B 2ERRA 4DUZJ 2FJVA 3DXSX 1X5OA 2CQ1A 3DRRB 4FP9A 3HFVA 3KJVB 4NLRA 2OEKA 3VQTA 4ID5A 2KH9A 3QGGA 3NAHA 1F0XA 4X4VA 4IDKB 3KLGA 2DTJA 1PIEA 1HR0J 2D69A 2R7UA 1FVSA 1RHRB 2J7UA 4OHWA 1R8PA 1Z2LA 3RRGA 4QR2A 4K0KJ 3IAS9 3G8SA 4HKQA 5T14A 2CQCA 3KG4A 2AGOA 3DLKB 1XC9A 2Y0SD 4M5LA 4K4VA 2HRUA 4B3SF 2PI4A 4U96A 3S8SA 4WXOA 2HVHA 3UDLA 3QWUA 4DV5F 2JRSA 4OZNA 2KM8B 2KXNB 4ECQA 1SIZA 4H4OA 1WUUA 3OTDA 4FYVB 1OO0B 4C3KA 1Q7YT 1C4CA 1KQSR 1GTHA 4RKUC 2Y1IA 5K14A 4OYMA 1FXDA 3CEDA 3T5LA 3CPWR 1TQLA 2R4FA 4ZJQA 5DG8A 3OR1A 2CUYA 2MQ8A 1H3DA 2EPIA 4A47A 3W66A 3E8OA 3DOKB 1RWWB 2GAGC 5GAGU 2J0XA 1EZZB 5C24B 1VI7A 4JI3F 3HK2A 4HYKA 1X0PA 4W4MA 3NLCA 2ZNYA 4ZK7M 1D3WA 1YX2A 4OYOA 2PI5A 2V94A 2VFVA 2HVEA 1U09A 5C2CA 2F65A 2EKNA 1UVKA 4HEA9 3ISZA 1ZM3A 3Q8VA 4MJKA 2I5JB 2FYXA 1S5ZA 2JX2A 4AD6A 3W8GA 2E1AA 2IVMA 1KEKA 1JB0C 2KXHA 3ITHA 2CJBA 3PJ9A 1JXVA 3B54A 2PEBA 2LECA 1I3OB 2P9CA 5ETSA 1N4LA 2W2OP 1KNZA 3I5AA 3FGVA 2L3MA 1VQ9S 2DPJA 2W1BA 3MR2A 1FRJA 4DV0J 1FEEA 4WKYA 3CCWA 4IRCA 5J1NA 3AB4B 1ZH5A 1U02A 3PJXA 3FSXA 1QE1A 4CLWA 4O3RA 4RW4A 5E33A 3DHWC 4PABA 2YWFA 1S1WA 2M4MA 2AYGA 2Z2LA 2ZUAA 2CNNB 2IPOB 4DPWA 3LP0A 2HW3A 1WF1A 3OVAA 2FB0A 5ETKA 4CLTA 3OTOF 4OYBA 2E66A 3D6TB 1NU4A 4M5NA 1K47A 4J9NA 1HYSA 2O3DA 4JI4J 4DQIA 1VFJA 2KDOA 3LAKA 2OPPB 1TR0A 1RT7B 3A3PB 2XNRA 3D0GE 5BXIA 4JI5J 3TA1A 3DCAA 3O3LA 3DKDA 1R6VA 2G0JA 4H54A 4C3LA 1LKZA 2YPZA 5HROB 1HNVB 1IBMF 3EVMA 4CH1A 2E7WA 4CDIA 1SXLA 2VPXB 1YQHA 2R7VA 3TYTA 3DXBA 3J7AN 3M2VA 1KFSA 2DRDA 5IM0B 3M6XA 5F0UA 3R2DJ 4R25A 4DLEA 1KOHA 2PT0A 3HLUA 5D15A 4LSNB 2EBGA 3F0NA 4Z37A 1K0TA 2HS0A 3OUYA 3LOUA 3ZFVA 2HBQB 4PWDB 2JL9A 3IP0A 2B9XA 2AT1B 3VAMA 3MOZA 1SJ1A 2FJWA 5HLFB 1PO6A 3CD6S 2Y8YA 6FDRA 1SC6A 5HP1B 2Q6CA 5EGYA 5HVFA 4QWAA 3NAIA 1IKXA 1X9MA 2K1RB 2W2PP 3K7RA 3CJQA 1TL7B 3KYLA 3VAKA 2V9WA 4QCLA 3V6DA 5E3QA 5F8NA 3GMGA 2VG6B 1M5OC 2E29A 3EYZA 3MMAA 1JLAB 2ILZA 2X1AA 1TELA 4KFBA 1SH0A 1HBUA 1VS3A 4X65F 3DDKA 1EETA 2HWHA 2HAIA 5A0YA 4C8LA 2CQ2A 1S9EB 3BO3A 3V6KA 2MY8A 4F26A 2RILA 3LA0A 2DNNA 3EJMA 4CM0A 2YWGA 5I4MA 5IQ6A 2RQCA 2J0SD 4B3OA 2HURA 2Z8QA 2OTLS 1V5IB 1TMMA 5C42A 4YHHJ 3D28A 5DQGA 3M8QB 4Y65A 4PG4A 3LUYA 1XN9A 2E9TA 1FNMA 1VK3A 2ZM6J 3SBMA 2DYAA 3H40A 3E2EA 1IN0A 3N6NA 2RU3A 2GGPB 5HBMA 2DXDA 4LF5F 5KT4A 4B9MA 1YK9A 1JMTA 4WYWA 4CNYA 2NS1B 4ZP7A 4FBUA 4K7QA 4E0DA 1UJ6A 4NOHA 1WC6A 1ZYQA 1EAYC 3H42A 1HPZB 3GR0A 2RD5C 1IR1A 2PD1A 3TVKA 2DT9A 4ELTA 2B43A 3KLIA 2GVZA 3PRVA 2CIMA 1RQ0A 2BW7A 1ZZNA 4USWA 2Q1LA 4NLOA 1RWOB 2X1FA 4UY8T 1MNEA 5HI7A 4L75A 2DIVA 1FKPA 3VVTA 2APOA 4ZCIA 1IKVA 2DY1A 5AE2A 1WC1A 1HR0F 5KFSA 1KN6A 1IVZA 1UEKA 3GJTB 4WTOB 1HWKA 1NJXA 2DPIA 9RUBA 3NCQA 3EVWA 2DO4A 4J9VA 3SCKE 4NPOA 4C97A 1WTBA 4NLSA 2ZH9A 2W2MP 3CMQA 1RBAA 3HVTA 4ECSA 2ZWOA 4USUA 4PPZA 2CAJA 3P6YC 4NLQA 4KV8A 5ETTA 4LJMA 3UDCA 4YY3J 2J5AA 1U6BA 4QW8A 3AH6A 2EG2A 2YNFB 3C19A 3M6WA 1JLEB 4DV4J 1WKKA 3ZZTA 3TZZA 3LWMA 3CW2C 2EFVA 1XQIA 2EXUA 3OV7A 4GRSA 4J9PA 5E7OB 3CGIA 4J91A 1FEHA 1Q16B 2VD3A 2WONB 5C25A 4FVMA 4B9NA 4CH0S 3DRXA 4Z7CA 4U7UD 4Y28C 2P9GA 2R7RA 3ISND 3AB2B 2HNDB 1GXTA 4ES3A 1U7LA 5KT5A 1FRHA 2OPRA 2CXEA 1VQSA 2I2YA 1U2RA 3LP2A 1RYRA 4P74A 3NXZA 2ZH6A 3IBCB 5D4LA 4QWBA 5DQHA 4KKOB 1Y10A 1VIXA 3UN5A 1RAGB 4RPFA 4ZKAA 1I1GA 3SMZA 4LVNP 1GK8A 5KFHA 1HWJA 5IT4A 3BKFA 1U47A 4K4UA 3KDNA 1LEOA 4LF1A 3BREA 1LFWA 3ENQA 2DK2A 2I6WA 4QWDA 1QSLA 1L3UA 2VBZA 4FF3A 2ZKUA 2QJ3A 1F9FA 2IMOA 4WKRA 4PXCA 2ZZTA 1FTRA 4IG3A 1ZBTA 1PCAA 3BZQA 3R7BB 5CYMB 4DV0F 5D6GA 3AJDA 4H4MB 1SL0A 2F4VJ 4CO5A 2Y9HA 4AL6A 4R8UB 3KHHA 3HVRA 1SL2A 3SDEA 3PDNA 4KGXB 1TVRB 2CYYA 3PO4A 3CJTA 2F9JA 3OL7A 2V5HG 5HVGA 4FYXB 4DV3J 4I68A 4ECVA 4FYYB 1UZHA 2JC0A 3T1HJ 1JLCB 1E6YB 3OXLA 1NPRA 3KLHB 3CCVS 2CPFA 2CQHA 1XEZA 5L8RC 5T7LA 4YDDB 4O0IA 3KKFA 1HARA 4KHPJ 4C9DA 2B6AB 2FC8A 2EBEA 3HZEA 2KM8C 5F41A 3AY0A 1VBKA 4WWSA 4DV2J 5E3AA 2DB1A 4LF7J 4CLYA 3GPAA 3R1LA 2ZE2B 3DLLQ 4CLKA 4U6PA 1NK4A 1T9YA 3UCUP 4JV5F 3NNCA 3TA2A 3A13A 3L7OA 4U9RA 3T19A 1HI8A 1VQKS 4ALZA 1KLNA 1HKAA 1S9GB 3A12A 2XWXA 1L3TA 2XB2D 3RAQA 3ZNUA 3HSZA 1L3VA 2U1AA 1N34J 3G9CA 3CNQP 4C0BA 1P1TA 4U95A 4NLYA 4J9RA 4BCAA 3G4SS 4K5SA 3T1YJ 2EFOA 2R3VA 1NB2A 2WOMA 3BBFA 2UVVA 4OHYA 5ETPA 3WHIA 1NK6A 2VU5A 1KHWA 2G1HA 4LIRA 3RJMB 3BGRB 2V2QA 4DS5A 5D3GA 1REVA 4KRWA 2AYBA 4ZP6A 4HLBA 3LGHA 1N6QA 5KFEA 5KFAA 2G0CA 3OXFA 2UUWA 3PW7A 3QMQA 2VFSA 4V19X 5H9FJ 4M8LA 1X4BA 3K8VA 1WI8A 3GLJA 2PE8A 4LFCJ 2MLYA 1IR0A 3R5AA 3IAM9 1FFGB 4HACB 5C7PA 5E3RA 2LQ8A 2JEFA 5B0CA 4B9LA 4ZPDA 3MCMA 4R0EA 1KBRA 2IDLA 2O01C 4YB1P 1UPMB 3MPVA 1VRTA 2CZVC 2EI5A 3MURP 1J5OB 5CQGA 5EX0A 3ONQA 2BEFA 3MXHP 4M94A 1VQLS 2V9KA 4CTAB 2XLKA 1IR2A 3EGNA 2IYIA 4IDKA 2KZZA 1LQ9A 3DI6B 1KR4A 2KFYA 1UEUA 3R6LB 2G2ZA 4OMFG 2ZITA 1SI9A 1NH7A 2JDJA 3OXGA 2ZM6F 1SBRA 1DAXA 2ZJPQ 3T6BA 1RWNB 1RCOB 5G0RB 2AJ0A 4C8OA 5BYQA 4CO0A 2B4OA 4DQRA 2C2EA 2UXBJ 3D5MA 3NGDA 3PIPQ 4LSLA 2J7WA 2MLZA 2DGTA 1BHNA 1J5EJ 2OAUA 5I3UB 1VC5A 3JYTB 3PRDA 1PJ6A 4IFYA 3RB0A 1O6XA 3FFIA 2C3OA 4DR1F 2V4JB 1FDAA 3M8ZA 3JSYA 4HHHA 2P6SA 4I2QB 1RHKB 3BQ0A 2DNHA 3AAWB 2YTCA 1DY3A 4DFMA 5KFBA 4NYOA 1R0BG 4BHQA 3CCMS 1H73A 2UVRA 3U1NA 4RX6A 2AKWB 4X4UA 2ROPA 2XYPB 2A3JA 1HMVA 4X64F 3TNVA 3DOKA 4KHRA 5F3ZA 4NZ7A 2HFZA 2L9WA 1OIAA 2QT7A 3EDQB 4EUVA 4RNMA 3CMES 5A2QU 1HBNB 4OZLA 3EM1A 3BKUA 3PV8A 1H6KX 2AZ1A 3I0RA 4EBCA 4A8QA 1S9FA 1SB6A 3AQOA 5B7WA 2CQ3A 4JV0A 2DD8S 3JXOA 1NMEB 4X4QA 1XK8A 2YWKA 3MM9B 1XR6A 1UAWA 3G6XA 3J81U 2AU0A 3M8YA 3CJ0A 2MZTA 2BE2B 3DU5A 3ICLA 1N5QA 1NJYA 5KG3A 1SJFA 3NGSA 3A3NB 3P5TL 4KQZA 5IWAJ 3EWGA 4F4XA 3HHLD 1MMLA 1VQ8S 1CJTA 2OKQA 5HATA 3BYRA 1K1SA 1YBAA 1VQ7S 1BXNA 4DV4F 4WU2A 1FDNA 4KC5A 4F7VA 8ATCB 5K5MA 1HWIA 4IR9A 4F3OA 1TKZB 1KTVA 5LT5A 3LP1B 5KG6A 3K59A 2R7TA 1Z1ZA 4TLRA 4ZVRB 1RAAB 3EZOA 3OL6A 4TNOA 1CQNA 1F9EB 2PMZD 3E3XA 3RB6A 2OPSB 3CJ3A 2HHVA 3AJ1A 3C2PA 1RTDB 5HJXA 2W25A 2LYVA 3HF5A 4FPIA 1AB8A 2QSWA 1NNDA 3N4WA 2PSZA 5LL6d 3DGPA 1T05B 2CJYB 4Y2MA 3EGWB 2CRLA 5J1EB 5D8HB 1YRXA 1VQOS 4C8ZA 3O8WA 3MM8B 4F0HA 4M5MA 3KK1A 2ASDA 1JKHA 1XR5A 3ENAA 2D9OA 7AT1B 5ETQA 4F8RA 3TX0A 1HHSA 1RYSA 2AJ4A 4DL2A 4MFBB 2NPFA 2E9RX 2P9EA 4OX6A 3T9ZA 1RGVA 3MEGA 4DHVA 2DIUA 3BR8A 2UU9F 5IZHA 1RAOA 1RT1B 3EZ5A 2PMHA 4DX8H 3C16A 2F8HA 1RJJA 2KT2A 1HNVA 1U48A 3A4TA 4NXNF 3D7SB 1V3ZA 1TKXA 4OZ5A 2F4VF 4ZCKA 2IM1A 4C4WA 5K8OA 4TU7A 2HHWA 3EGVA 3C6UA 1LXNA 3V4IB 1FESA 2HIQA 1MSWD 1L5UA 3ILJA 4LSNA 4URQU 2J0WA 4YB5A 2ZJRQ 4PWDA 5ETRA 4DV1J 3GFZA 4OHVA 4DL0C 3FZ2A 5HLFA 3L3CA 2K7KA 3GB0A 1P9QC 1KS2A 5HP1A 3NS7B 1S1XB 1UP1A 4IQMA 2C2DA 1KKHA 3Q8QB 4P72A 5DDOC 2K1RA 4DV2F 2NPIA 5F9NA 2M3DA 4LF7F 2EFPA 3DLJA 4AL7A 1MU2A 2GFFA 4W98A 3PW2A 1S57A 3UR3C 2GMHA 3GWCA 2CQBA 1JLBA 1KVIA 2VG6A 3FK4A 1GMWA 3VALA 2DNMA 2QG9B 3MWBA 1G6BA 2CPHA 3KJQB 4ILMA 4KBIA 3IRXB 1H74A 3I9ZA 6AT1B 2C3PA 2N82B 3ZTQA 2D9PA 2IA6A 2ZZMA 2DH9A 5DM7Q 4WE1B 2P2CB 4O4GB 4WFAQ 1FE4A 2FPHX 4M5KA 3FEXB 1BD6A 3AT1B 1ZAWA 1CJKA 3DLGB 1KONA 2VQEF 4FNHA 1R0AB 2E7XA 1PBUA 4QWEA 1OSCA 3VVUA 3OVBA 1X5SA 4NYPA 3P4UB 1DARA 2D1CA 3PHTA 1CULB 2ZUGA 1ZM4A 3DRPB 3D0IE 3FUYA 2QFIA 4ERDA 2GGPA 3DOMB 2YKMA 1LWCB 3SCIE 2CPYA 3JSBA 3A1YG 1Z4UA 3I0SB 3PW4A 1HWLA 5KG2A 4DI6A 4EO8A 4OI3A 1SKUB 3KUHA 1LFPA 4YN3B 2L41A 3CJ5A 1AZSB 1RWMB 2Z0GA 2JFKA 3WX4A 5J2PA 2IRUA 1FFSB 4I56A 4OYWA 3JTPA 2JSXA 1FWKA 2QN6B 5DQIA 3I5BA 1T9VA 4I6YA 4ANCA 1AUDA 4USHA 3OQ2A 4FN5A 3GR1A 1ZETA 1NBEB 1IBKF 4PQAA 4NMXA 5K9FA 1ZM9A 1TK0A 4IOCQ 4ZPWR 3BH7B 1XERA 2HNZA 1BUXA 3BM7A 4PEOA 1U1OA 1C0TA 3I55S 1JJ4A 4GVBB 3RU0A 4WZMA 4K5RA 4NZ0A 3FSYA 1YRTA 2YNIB 1IWGA 5J2MB 2DNLA 2HFOA 1QSYA 5HSPA 1U2FA 1SPBP 3PYEA 1DHMA 1WJ9A 2CJKA 4F2SA 4K4TA 1G1XA 1J5EF 4CLSA 4DPXA 4DL6A 2QL9B 2LEAA 4NA2A 3FBFA 4CNZA 3SI8A 2I1RA 1WACA 3C3LA 1R8CA 1MMNA 2HQ3A 4LRDA 2OPQB 4DWIA 1T9UA 3OT9A 5L1LA 1FWLA 5ETLA 1AA1B 4YQWA 3KNAA 4FZVA 5F0WA 4BWMA 4NEYA 5GAHU 2O66A 3UN3A 4BS2A 3HMJG 2RQMA 2WONA 2JZ5A 2MZ1A 4UOFA 1M1KT 4ELUA 4WU3A 2MSSA 1XNQF 3FRZA 3T5JA 2HSEB 2RSQA 3PTWA 4LQ3A 2LXUA 3ZZOA 1LW0B 4DPOA 4X4RA 1FCAA 3PYGA 2CPZA 1CQMA 4DXLA 1RAFB 3ILLA 4RW9A 1X9WA 3MMBB 4RUBA 1N36J 4K4WA 1FRIA 2Q79A 3MM6A 1S1TA 1S77D 2KG0A 2HKEA 5CD4H 2JEGA 1WHWA 2J9DE 1AFJA 5CAAA 1Q82T 3BS9A 5IWAF 3TAMB 1HHQA 5CZXA 3TVYA 3LANA 2FVCA 1WSVA 3HX9A 5DG9A 3G6VA 4GVLA 1KRPA 4Y0FA 3W5XA 5CYQB 1RT5B 4NLPA 2NYIA 3FBEA 2DCLA 3H7HB 3QRQA 2YNGA 3T3FA 2R8IA 3UCZP 4H4MA 3JQJA 2ZH2A 1R8AA 4K2XA 2PA8D 3G6YA 1RT3B 1YITS 4J9OA 4OFZA 5KG0A 2C2NA 4EGLA 1CJUA 2DXFA 1TVRA 2V4QA 4PG7A 5D4NA 3JQKA 2BOPA 2GO9A 3PX6A 1IM6A 2OGUA 1XWLA 2CQ0A 5J2NA 5KAKA 3QZ8A 5A6WA 1IKYB 4G1PA 2GQ2A 2NREA 1E6YA 3ADAC 2IC3B 3KLHA 3CB4A 2D3UA 3BGUA 2F9DA 2V6AA 4URGA 4PRFA 2RRNA 1N5VA 5F8JA 4WFBQ 1RBOB 1YKWA 2V2VA 4C98A 4DQQA 3FCWA 4XAKA 2WVFA 1YSJA 2I8EA 4HH1A 4B08A 3QFWA 1Q4RA 1HFEL 4R0JA 2YKNA 1PYOB 3WZ0A 4PZVA 4DR4J 2ZE2A 4TN2A 2FVSA 1F2HA 1NKCA 3K58A 2MXYA 4DV6J 3PXGa 3O44A 2RS2A 3QLHB 1NDKA 4YR2A 1M5PC 3R5GA 2BBEA 3DDNA 4K50A 2MKYA 4IFVB 1Z2ZA 3ZTSA 2RKIB 4Y2IA 3GYNA 3D68A 2LXFA 3SEOA 1H72C 3TW0A 2YNHB 4JI0J 4W92B 2UXCJ 3W2WB 3EDRB 1XIQA 2CJQA 1FRXA 1TL1B 4HDHA 1E6VB 4H4KC 2XSJB 2HK2A 4JBCA 2MHEA 4ZP8A 2M5YA 1S59A 2XY6A 2LVWA 4RU2A 1CVJA 3IBWA 3R2CJ 1RE1B 4P71A 3CDWA 3VAJA 3DM2B 1DQ8A 4RW7B 2GC8A 1RTZA 1HI0P 2C3MA 3N79A 4DSKA 4F3MA 5B0DA 3MR3A 1Q78A 2ZC4A 1R43A 1S0VA 3CULA 3NCRA 2FLPA 1UCNA 1WI6A 2DGOA 3MTJA 2HVDA 5LSRA 3LGNA 3AD9C 3OL8A 3D2WA 2Y8WA 4PXDA 3OFGA 3V4MA 2V0NA 2VF3A 1U45A 4DZDA 3I6PA 3Q8PB 4XDDA 6FD1A 5KFZA 2RDDA 4MTPA 4NRTA 1EKSA 4M5DB 1FXLA 2W9AA 2VL1A 3BDPA 4YS2A 2DGQA 4LFBJ 2W9CB 2N3LA 3C8YA 5KT7A 1RUSA 2AX0A 3KLEB 5H9FK 4ZLLA 3AFGA 3HKWA 2AIRB 4TY8B 1J5OA 2BQ3A 5L1KA 3PKYA 2BABA 4CTAA 2IIHA 2KHDA 1QAYA 3J7YI 2GQCA 1M1HA 2M70A 4OIXA 1EP4A 2G9OA 3HSGA 3SFUA 4DCPB 3BSAA 1B7FA 1APSA 1AYEA 3Q2TC 2VFRA 1JJCB 3MPDA 5G0RA 1T9XA 1UVMA 3M2UA 3R5CA 5A8KB 2JHEA 4ED3A 1X31C 4RO0A 1X0FA 4G1QA 4QQBA 1JNRB 1ZA2B 2E44A 1FNXH 1TL3B 2XZWA 2G2YA 3HCXA 4WP9A 3QAUA 1UA0A 2YWWA 1KLMB 2HMIB 3CCZA 3VAHA 2G1DA 3JYTA 2B51A 2DISA 3HDSA 1D09B 1MN9A 3BYPA 4O3SA 2NXJA 2V8DA 2F8MA 2QTWA 2FJAB 4QPTA 4YEAA 3R3TA 4ICLB 4M63A 2LU2A 3UI3A 4RL1A 2PGCA 2W9BB 4DSEA 2MLXA 4XIUA 3QO9B 3JAMU 2VV5A 3PR5B 2E1CA 3VR1A 3THVA 3FMBA 4NXMF 3IS9B 5AXNA 4PYDA 1S6QB 3QSYB 3CD5A 2GMJA 2BANB 1R8HA 2C3UA 3UPFA 1H98A 3NMAA 4DR5J 1R0CB 4NI2B 3FJ2A 1RISA 5DDRC 4E98A 4I2PA 4BWJA 2I38A 2POKA 2H65B 4LF9J 2HS3A 2C3YA 1HBNA 5I42B 3RZAA 2UZAA 4K4ZA 5DJBA 3M1VB 1RHMB 5KOWA 1Y00A 5L9XA 1Q8KA 2UP1A 4H4KA 2GVDB 3THTA 3VAFA 4Q44A 2OFGX 4USIA 3MEEA 4MK8A 1A9NB 2AF6A 3MM9A 3RRKA 5A8WB 2YKAA 3IR5B 4M5IA 4PR6A 5K8NA 1YJTA 1PG5B 1G3OA 1I51B 1P27B 1VYAA 2FIUA 4KIAA 2E7VA 4X66F 1ZOTA 2XSFA 5GVQA 2MGZB 3BKTA 4FVCA 3CF5Q 2DRAA 4ILLA 4DQPA 2VG5B 1NAQA 1SCJB 3DHXA 1U6FA 4OV6A 3HSJA 1TKZA 3LP1A 2HGNA 5E0OA 4CYUB 1TZ0A 1JLQA 1H7WA 2BJ7A 2IAJA 4UUXA 1LW2B 1WC0A
chains in the Genus database with same CATH topology
2BJ8A 3QSIA 2HZVA 3BKFA 3PHTA 3BKUA 2FGCA 2CAJA 2WVBA 2BJ9A 1Q5VA 2Y3YA 2BJ3A 2NZCA 2CA9A 3BKTA 2BJ7A 2CADA 2WVDA 1Q5YA 2BJ1A 3LGHA 2PC6A 2WVCA 3OD2A 2HZAA 2F1FA 2WVEA 2WVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ8 A;  3QSI A;  2HZV A;  3BKF A;  3PHT A;  3BKU A;  2FGC A;  2CAJ A;  2WVB A;  2BJ9 A;  1Q5V A;  2Y3Y A;  2BJ3 A;  2NZC A;  2CA9 A;  3BKT A;  2BJ7 A;  2CAD A;  2WVD A;  1Q5Y A;  2BJ1 A;  3LGH A;  2PC6 A;  2WVC A;  3OD2 A;  2HZA A;  2F1F A;  2WVE A;  2WVF A; 
#chains in the Genus database with same CATH topology
 3PY8 A;  2XBP A;  1XR7 A;  4WZQ A;  4P10 A;  2E5L J;  2QA4 S;  1WTF A;  2GIQ A;  2ADC A;  4PG6 A;  3AOB A;  1YTY A;  4IKA A;  1M1G A;  1RTD A;  1I5O B;  4DR7 J;  3H90 A;  3NGT A;  1NSQ A;  3RAX A;  1T05 A;  3OFH A;  5KT6 A;  1FKO A;  2DXE A;  2FTR A;  1VQM S;  3BN7 A;  2HHX A;  2DH8 A;  3J81 j;  4C8Y A;  1SJR A;  4KJI A;  5GME A;  1RI7 A;  2PN6 A;  1S4F A;  1NDP A;  2PDA A;  1MRO B;  4DPT A;  4ZA1 A;  3M6U A;  1S1U B;  2YXL A;  1IUJ A;  1BQN B;  2AZ3 A;  4QIG A;  2MY7 A;  3A8I A;  2R7X A;  1OY8 A;  1CS4 B;  2FHJ D;  4CO4 A;  4OLO A;  1S6P B;  1EQM A;  2OH2 A;  2ZBQ A;  3ETO A;  3M05 A;  4CO2 A;  1U25 A;  2NLW A;  1MWY A;  1S49 A;  2K06 A;  2C2O B;  1IBL J;  2EFN A;  1QDU B;  1HD1 A;  5KFC A;  4UQG A;  4OZJ A;  4EEY A;  1EB0 A;  4WK3 A;  3B78 A;  4RBT A;  3U7J A;  4USJ C;  1BC6 A;  4JI1 F;  5CAB A;  4NYZ A;  3W65 A;  2J0Q D;  5E5N A;  1HBO B;  4QU7 A;  4RU9 A;  3TRG A;  3R6G B;  3G8T A;  4F4W A;  2ZBC A;  2AEJ A;  4F50 A;  2SXL A;  2GJ2 A;  1T9W A;  2K2P A;  1QVF R;  3RBX A;  2GS8 A;  2CNK B;  1NZ8 A;  5B08 A;  4XTT A;  4ZDN A;  2HFN A;  2KVQ E;  3CJK B;  2OML A;  1S1X A;  3AOA A;  4IRD A;  4ETZ A;  4DR2 F;  3HI9 A;  3EE3 A;  3W60 A;  2OD4 A;  1WC3 A;  4DR4 F;  4O3P A;  3QBC A;  2FVQ A;  4I64 A;  3J7Y U;  2DJW A;  1RTH A;  2BE7 D;  1P8G A;  4RBV A;  1M5H A;  4C7Q A;  4OX8 A;  4RNH A;  4F36 A;  3QQC D;  1C2P A;  4QYZ K;  3IRX A;  3DRS B;  5B0G A;  4WFY A;  1JLG A;  1FO1 A;  5KFJ A;  1C1C B;  1FHT A;  3I4H X;  4LUB A;  4HR2 A;  1DBD A;  4UOC A;  3HT3 A;  2VKR A;  1U2C A;  1B70 B;  1KD1 T;  4ENO A;  3SQO P;  4P2S A;  3ZTR A;  2A10 A;  1UW4 A;  2NXN A;  3EGZ A;  2IHR 1;  2HBR B;  3I56 S;  2VDH A;  1VLY A;  2HEK A;  2VC0 A;  2L9N A;  4I7F A;  3D6H B;  4HTI A;  2QLF B;  4AT1 B;  1FE0 A;  4F4Y A;  2YY3 A;  3PG9 A;  3DRP A;  1VHF A;  2XYH B;  4U7C A;  2AGP A;  3QT5 A;  3LTO A;  2AJ1 A;  5D4P A;  2JOQ A;  4FXW A;  1OY9 A;  4JV1 A;  5HMX A;  3I0S A;  3QYY A;  2HFS A;  4FS1 A;  4GC7 A;  4FYD A;  2IBK A;  3M9N B;  4K4Y A;  3OBI A;  2MZJ A;  1TUV A;  2DHH A;  3CCQ S;  3O2I A;  3QNW B;  4RNN A;  2CQP A;  4LFB F;  4IG0 A;  5L1I A;  3MEC B;  1TP7 A;  2NXU A;  3W7B A;  4NLW A;  3R27 A;  2YX7 A;  3LPY A;  2FHM A;  1N5Y B;  1N33 J;  1TKT A;  1AXQ A;  2HRT A;  3EVO A;  4LF8 J;  4OX7 A;  1KHV A;  1NSP A;  4TVA B;  3QRP A;  1N5S A;  1Q86 T;  4M5H A;  4EI2 A;  3BO2 A;  2HAF A;  3GIK A;  3JB9 k;  2ZHB A;  3PKM A;  1DTQ B;  4B3T J;  2B5J A;  1C1B A;  4TU8 A;  5LXY A;  4F67 A;  3ISN C;  3QIP B;  5EN1 A;  8AT1 B;  4OYZ A;  3HPO A;  3H8Y A;  2WBM A;  2CG8 A;  4ES2 A;  4ZHR A;  2W7P A;  3NNA A;  1U0H B;  2HZV A;  1FVQ A;  3R7N B;  4X84 A;  4C0H A;  3MD3 A;  2UV8 G;  1TMJ A;  3VHQ A;  4URS A;  1UJ4 A;  3GYG A;  1P9Y A;  3FEZ A;  2HQD A;  1HQU B;  2OPQ A;  2D41 A;  2ZH1 A;  4HT5 A;  1LWF B;  5KG5 A;  2H5I B;  2M0G B;  3NWG A;  2IBO A;  2GJI A;  2W01 A;  1V6H A;  1FX2 A;  1YZ6 A;  4I67 A;  1C0U A;  1S97 A;  2BDP A;  3AXK A;  3UVJ B;  4PUO A;  1HBM B;  2RUS A;  4I69 A;  2XI2 A;  2V8V A;  2J6U A;  5IS2 A;  4DX7 A;  4C0O C;  1SC4 B;  4LF9 F;  1CBK A;  2HQG A;  3U27 A;  2BJ1 A;  3QAT A;  2RDJ A;  1NKB A;  4IH6 A;  1VOM A;  5ETN A;  2NCK L;  2EG1 A;  1GXL A;  3ILO A;  2XHW A;  2XZT B;  4WJB A;  2QX0 A;  5A76 A;  3JQM A;  3TZY A;  3X1L B;  4Y2K A;  1BQM B;  4N8N A;  3MAQ A;  3X3U A;  1OS5 A;  3UDE A;  4W90 B;  1UL3 A;  2WB1 D;  1B0T A;  1QD1 A;  4OZ2 A;  3PEJ A;  4C3M A;  1OY6 A;  3TAM A;  3M8P B;  3OJU A;  3TAR A;  5AT1 B;  3M4X A;  3C46 A;  1VRU A;  3A8K A;  4R5P B;  5H9E K;  1KQG B;  2Y1R I;  1K0V A;  2CKW A;  2BOA A;  1RT2 B;  5CYQ A;  5L38 A;  4N56 A;  3UFC X;  2DHS A;  2CZ9 A;  2XUL A;  3WX8 A;  1IQZ A;  3D66 A;  3Q23 A;  3LPE A;  4YOE A;  4RBU A;  5DS7 A;  3FZB A;  2HFU A;  3EPG A;  4RWX A;  5C2G A;  5T41 A;  1HNZ J;  3C14 A;  1RT3 A;  5M2U A;  4ED1 A;  4ZIT A;  4DUY J;  3LAM A;  4Q7A A;  2RNE A;  4IH5 A;  3POT B;  3HHN B;  3OVS A;  2XS5 A;  4J90 A;  1BGX T;  4U8Y A;  1HA1 A;  2Z2Y B;  3NBP B;  4P2F A;  1HL6 A;  2J9C A;  1ARO P;  2HG4 A;  1G4C A;  1R27 B;  5CZV A;  2C2K B;  3GV7 B;  1VBX A;  2IC3 A;  3JTN A;  4UST A;  3R7S B;  2K8G A;  3BPD A;  1RB0 A;  3DMJ A;  4WF9 Q;  3BV8 A;  4RJV A;  3P3D A;  1PJ7 A;  4DL3 A;  1SV5 A;  2H51 B;  3HD2 A;  3IC1 A;  1NDL A;  4XPE A;  4GKK F;  1U0S A;  4PQU A;  4H4O B;  5LMU J;  3R5B A;  2KU7 A;  2HQI A;  4G65 A;  4DOZ A;  1R7I A;  2DNZ A;  2R8J A;  1FWP A;  4IRK A;  5K14 B;  3QLH A;  2QLX A;  3THP A;  3I9V 9;  2VG7 B;  3OR1 B;  4DU7 A;  2HHH F;  2KHC A;  1S1V A;  1IBL F;  5LOQ A;  2ADB A;  3S6E A;  2D3O R;  4IFV A;  1FRM A;  1KWM A;  3GZ7 A;  2HHU A;  3MAH A;  1CJV A;  2EC2 A;  2QL5 B;  4LF4 J;  1S0O A;  1RZM A;  2LA6 A;  3I82 A;  2XHC A;  4A8F A;  4A46 A;  3N9U C;  1D9F A;  3EIC A;  3W2W A;  2FJE B;  4ATN A;  1E6V A;  3K89 A;  3JSM B;  2XSJ A;  1T8E A;  4OI1 A;  2ZHA A;  2VQF J;  2CA9 A;  2JNJ A;  1SH2 A;  3DM2 A;  1JJH A;  5KFO A;  5EUH A;  2V34 A;  2YKQ A;  4LR9 A;  2P6T A;  1FF2 A;  3RW7 A;  4A8M P;  2DGS A;  2BKO A;  4QZV B;  1XNR J;  1RAC B;  2D74 B;  2QE5 A;  1FXR A;  5DDP C;  3ITH B;  2JLG A;  3TEG A;  1UJ5 A;  1WEY A;  3SSR A;  2H54 B;  4PWW A;  4KPY A;  3QRR A;  3D3B J;  4TY9 A;  1LOU A;  4F0K A;  4AE5 A;  2QYG A;  4IO1 A;  5IFM A;  2C42 A;  2HLT A;  1WC5 A;  2CDQ A;  3SQG A;  3CCL S;  4A8X A;  4HH0 A;  2RT3 A;  4BC9 A;  2CPD A;  1QE1 B;  4MKY A;  4DBQ A;  4UF4 A;  1TV6 A;  3PYD A;  2HLU A;  2J6T A;  4ECZ A;  3KLE A;  2RHQ B;  2YPY A;  3CIZ A;  5I3Q A;  5GAE U;  3GSI A;  1RHJ B;  2QL7 B;  3AD7 C;  2VC1 A;  2XS2 A;  3OSP A;  2CAD A;  3OLA A;  3VWS A;  3TZW A;  3PO5 A;  4RUH A;  4YME A;  3KLF A;  3PHE A;  1HYS B;  3CO9 A;  3KTQ A;  2QEX S;  1XJW B;  2HVI A;  4ED4 A;  1VQY A;  3N28 A;  2VA3 A;  2VJU A;  4O3Q A;  2HVZ A;  3MD1 A;  4OX9 F;  3OHA A;  3R9L A;  4JV2 A;  3Q8R B;  1PAU B;  1VC0 A;  4K4X A;  1RU2 A;  3H2V E;  1TAU A;  3KLV A;  1ZPV A;  4ECX A;  4KY3 A;  4ED0 A;  2HMI A;  1RAE B;  1TK5 A;  3P96 A;  5AJ3 F;  3TZX A;  3Q24 A;  2VB6 A;  4LF2 A;  3B4M A;  3KFW X;  1S99 A;  3T41 A;  3M2V B;  3NWR A;  1ZS6 A;  2W9B A;  3SYZ A;  2AYM A;  4FXV A;  4DFP A;  3F44 A;  1UFW A;  3QO9 A;  3HHL C;  3DNC A;  5KT2 A;  2EEY A;  2D3Z A;  4CP5 A;  2MQM A;  1AUS L;  3Q89 A;  4XDC A;  5CHC B;  2LQ5 A;  2PEH A;  1FX4 A;  1YGY A;  5IT9 U;  3GFX A;  1N33 F;  2H1Y A;  2FJD B;  1HNW J;  2NUH A;  3B6B A;  4RW8 A;  4Q43 A;  3OUY B;  1QAI A;  2J76 E;  3V6J A;  4V1A k;  5L9N A;  2H5J B;  2BJE A;  4HI1 A;  3BSO A;  2PII A;  2OSR A;  4KAI A;  4EFA C;  2QA2 A;  3VF0 B;  4NWB A;  4TYA A;  5I42 A;  5BYR A;  1YI2 S;  3D4J A;  3R5J B;  2H5E A;  2OFH X;  4X2B A;  2GVD A;  2WHO A;  1Y4Z B;  3IRW P;  3BJY A;  3TR5 A;  1DTT B;  1N8R T;  2QA4 G;  4OYP A;  3JS9 A;  3KG0 A;  3V6D B;  4PWU A;  4FF2 A;  4GO7 X;  2H3E B;  4AYB D;  4NA1 A;  3TAP A;  2X51 A;  4DFK A;  1N0U A;  1T95 A;  5FLX U;  4KFB B;  5FLX Y;  1HBU B;  2VG5 A;  4JI7 F;  4JI2 F;  3MR6 A;  3QID A;  3ENW A;  2RQK A;  4AXJ A;  3I31 A;  3D1H A;  1EET B;  3UDV A;  2GIF A;  4OHZ A;  1FJE B;  1SJQ A;  5CCL A;  3QWP A;  4CYU A;  5KG1 A;  4QR0 A;  4L76 A;  4TYB A;  4M5G A;  1SH3 A;  4J9K A;  3MUM P;  3UNG C;  4O44 A;  3T1A A;  3KG1 A;  4B3O B;  4Q8F A;  3OR2 A;  3ZO7 A;  2CDR B;  5C42 B;  1YVF A;  1UVJ A;  1VGY A;  4DL5 A;  3RGI A;  1VCT A;  1R8B A;  3E01 A;  3CWJ A;  2XMV A;  1Q53 A;  2RU9 A;  1LNQ A;  2XWY A;  1GAO A;  2B7C B;  4CO1 A;  4DUZ F;  2M52 A;  2F1F A;  3W3S A;  2QC3 A;  2AEF A;  1GX6 A;  4I6W A;  1HHT P;  2YQ1 A;  4DSJ A;  5A6P A;  4LQ9 A;  2E9Z A;  5AXK A;  5A8R A;  4PPD A;  1NDC A;  1MRO A;  4U8V A;  1YIJ S;  2Z58 B;  3HD1 A;  1ZTW A;  1WKJ A;  4S0M A;  1KP6 A;  2ZJQ Q;  4QPX A;  5DZ7 A;  1GT8 A;  4DV5 J;  2QMW A;  3RAM A;  1SQG A;  4RR5 A;  4MAK A;  3KLI B;  4K0K F;  2GVZ B;  3ZXW A;  3K17 A;  2HHT A;  5LMN J;  2FVP A;  1S6P A;  3BDE A;  4DLG A;  2DR6 A;  5JVH Q;  1VR6 A;  3ZZZ A;  2IFX A;  4LSZ B;  2HYI B;  5D0H A;  2BKN A;  3UD3 P;  4AFF A;  4XO0 A;  5D78 A;  2Q66 A;  1VC6 A;  4C11 B;  2WZ1 A;  1WEX A;  2AW0 A;  3QGH A;  2XGP A;  4JI8 J;  1HNZ F;  4ED2 A;  3RYL A;  3UNY A;  3MEK A;  1N48 A;  4FDF A;  4DUY F;  2DNP A;  3HHL A;  3SZ2 A;  1Y3J A;  1Y5N B;  1VHI A;  4JI3 J;  3H25 A;  3H5Y A;  4OZ3 A;  4KO0 A;  4OV1 A;  1RTJ A;  3K0J A;  1FDD A;  4DG1 A;  3HVT B;  1JK9 B;  3P49 B;  4I4B A;  5D4O A;  1F2G A;  3HUL A;  4ZVF A;  2GA7 A;  3BSN A;  2K3K A;  3G82 A;  1H2T Z;  3RR8 A;  1I94 J;  3IO1 A;  3W61 A;  3H20 A;  2V63 A;  3G86 A;  5KFM A;  2XI3 A;  2R2U A;  3GQC A;  5LMU F;  1BWE A;  2XCP A;  1VQP S;  1NZA A;  2F3J A;  3SV4 A;  1X4F A;  3IGV A;  1S6O A;  2RJZ A;  2WAQ D;  4ETX A;  5KTQ A;  3PW5 A;  2DR7 A;  1T03 A;  3MF5 A;  1X4G A;  3M30 B;  5C25 B;  2A2D A;  3DYA A;  4RLE A;  3IM8 A;  3DRS A;  2G4B A;  1FK9 B;  4QIW D;  3CVK A;  4O23 A;  2OPR B;  3GG1 A;  1OSD A;  1U1N A;  5LM7 E;  1GMU A;  4FKY A;  3IGN A;  3KHL A;  4ECT A;  3EXC X;  4ZOS A;  5CH7 B;  1FER A;  2ZOM A;  4E8U A;  1C4A A;  3Q8S B;  1R3N A;  4CLF A;  2B8P A;  4OI4 A;  3M32 B;  1PYS B;  2JEI A;  2R9L A;  3TUP A;  3D9B A;  5KFV A;  1XNR F;  4NRU A;  2RVJ A;  5GAG I;  4ZIV A;  2NSB A;  1UTA A;  3M8S A;  4DF8 A;  3KJF B;  3MM5 A;  1S6U A;  3Q22 A;  2B9Y A;  2DIT A;  2IRY A;  2OUG A;  2E5J A;  4IG3 B;  2HS4 A;  1RDR A;  4JI4 F;  1QJH A;  4DFJ A;  3VTI A;  4NZ6 A;  3H0P A;  2IDE A;  2ZKT A;  3GCW P;  3MEC A;  2BJ9 A;  4JI5 F;  3SDE B;  2DNR A;  5BJR A;  4TQS A;  2VJV A;  2AGQ A;  3NCP A;  3NMR A;  2DNG A;  3PRB A;  2MQO A;  2B8Q A;  4CLZ A;  5JMN A;  4DSI A;  1U1Q A;  1JJ2 R;  3V81 B;  4ZVH A;  2IYG A;  2OJ3 A;  3CC7 S;  1IKW B;  3SCL E;  5M2P A;  4EK2 A;  3HZG A;  2QGF B;  2LFV A;  4ZLJ A;  1X4H A;  5T7L B;  2CZ4 A;  1N0V C;  2Z30 B;  1DTQ A;  4FNI A;  1J2V A;  5LJ3 Y;  1P6T A;  1PC5 A;  4X4O A;  2R2S A;  3M8W A;  4Y34 A;  5B0A A;  2A2C A;  4CI0 B;  1QUP A;  3MPU B;  2RS8 A;  4CCH A;  5ITH A;  1JIH A;  1RKI A;  2XYG B;  2FY8 A;  2IM3 A;  4P52 A;  1YDL A;  3FC9 A;  1S76 D;  1X4A A;  4J9U E;  1HQU A;  3IR7 B;  1GFW B;  1Q5V A;  2NZ4 A;  1LWF A;  4CRJ A;  4M1K A;  3KDO A;  2CNL B;  3J80 U;  4JUZ A;  3J80 Y;  1D8Z A;  3N5B A;  2J8S A;  1YHQ S;  1R6Y A;  2ZDP A;  2ATL A;  7FDR A;  3G71 S;  4LMZ A;  3UVJ A;  3ZTO A;  3M2R A;  1HBM A;  4KTQ A;  1VK8 A;  1M90 T;  3TAQ A;  3LF0 A;  4FS2 A;  2GCF A;  3QJL A;  2HIY A;  3HHK A;  1PAE X;  3TUI C;  4G6V B;  3PFO A;  1NKE A;  2NZC A;  3HHD A;  2DBB A;  2F63 A;  2ZHO A;  3DRR A;  4WK1 A;  2BXJ A;  3D6F B;  2M9K A;  4EWT A;  1WEZ A;  2WSE C;  3KJV A;  1RT4 B;  2LDI A;  1BQM A;  4USK A;  1JQG A;  3W8P A;  4YHH F;  4KE5 A;  3KOA A;  2R8G A;  1RA6 A;  3MAA B;  2R8K A;  4NLT A;  4QBU A;  2UUB J;  2MDA A;  4R5P A;  5F8I A;  3O6Q A;  5LSO A;  2GQQ A;  3MFI A;  3DLK A;  4QIF A;  2DCU B;  1Y0H A;  1VRT B;  4C6A A;  2VON A;  1MLA A;  4DR6 J;  4ZPV R;  1DLO B;  1B4S A;  1VQ5 S;  2WSF C;  1UWA A;  2R42 A;  1IXK A;  3LO3 A;  1HIY A;  4UUW A;  5G4D A;  2O67 A;  2YWH A;  2ZNZ A;  3POT A;  4PCQ A;  1QY7 A;  2FGO A;  1RWU A;  1FJG J;  5J1P A;  1OQ3 A;  1ICE B;  3NBP A;  3IG1 B;  1HQ2 A;  2N7Y A;  3HFZ B;  2ZH4 A;  1NK5 A;  2BMB A;  4QYR A;  4LSL B;  2X3D A;  4WIQ A;  4NE9 C;  3AJ2 A;  3H59 A;  4IO9 Q;  3K5O A;  1RAH B;  5C24 A;  3D3C J;  4IFY B;  2AX1 A;  5A2Q Y;  1UEV A;  4FYW B;  3FFI B;  3AA9 A;  5IV4 A;  2KZM A;  5JXS A;  3BR9 A;  5HQM A;  4EO6 A;  4QU6 A;  4ELV A;  4DV7 J;  5LMN F;  1LWX A;  3FDS A;  3J81 Y;  3AOD A;  4Y3C A;  2B56 A;  2ZBI A;  1ULR A;  2LDY A;  3GSD A;  2VG7 A;  4KGK A;  4MYT A;  4YY3 F;  4JB8 B;  1HMV B;  4HHJ A;  1BMQ B;  4ZMM A;  1KDN A;  2I5J A;  1WOO A;  3LGM A;  4JI8 F;  1R89 A;  4C8N A;  4UQT A;  4UW2 A;  3QJP A;  3DLE B;  4ZLN A;  1EIY B;  2VOD A;  1RHQ B;  3I0R B;  3JSM A;  4UOH A;  4X4T A;  5DGB A;  1UVL A;  3RRH A;  3PFE A;  4K59 A;  2ZZN A;  2VOP A;  2CPX A;  1Q81 T;  1WC4 A;  3ZZU A;  1MWQ A;  3DU6 A;  1R31 A;  1OMS A;  2FJB B;  3UO0 A;  2QLJ B;  4ZPB A;  2VIC A;  2YH0 A;  1I94 F;  3CIM A;  2N7C A;  4Q0B B;  4ZLP A;  5KFF A;  5M2R A;  4D3G A;  1CJT B;  3C15 B;  2NSC A;  2EK6 A;  2JJ4 D;  4F0M A;  1RAJ A;  5K20 B;  1YBU A;  5KFK A;  5HL7 Q;  3DRY A;  5KFP A;  2KFZ A;  1NUE A;  2ROG A;  3MCS A;  3K5N A;  3OTC A;  3KXD A;  1K73 T;  3MHY A;  4DDF A;  3CC4 S;  1RWX B;  1YZ7 A;  2BRL A;  2OTJ S;  2OPP A;  1RT7 A;  2YQ3 A;  1RBL A;  2DH7 A;  2JLE A;  2A1B A;  2EC0 A;  4WP3 A;  5AE1 A;  4ID8 A;  1RT6 B;  2XMK A;  2BAC A;  1A0O B;  5HRO A;  2Z2Z A;  2DEJ A;  3DGP B;  4A8S A;  2D3O 1;  3JSR A;  2LMI A;  3W9I A;  4OJ1 A;  4MIW A;  1ZTT A;  3KK1 B;  5D0E A;  1JKH B;  5IM0 A;  3Q8U A;  2GNK A;  1WNE A;  3HO1 A;  1F5A A;  5KOX A;  1B3T A;  3N01 A;  1SIW B;  3UCG A;  5CA5 A;  4KR0 B;  3M9O B;  1SUQ B;  3K5M A;  3MEG B;  2RRA A;  5KG7 A;  1X60 A;  1YWX A;  4DV3 F;  2C2M B;  4PKD B;  5EWE A;  5I3P A;  3BGL A;  3T1H F;  2CPI A;  1X5P A;  4NLV A;  3C16 B;  3VCD A;  5L39 A;  3MMC B;  4F4A A;  4JV5 J;  1QLN A;  2B4V A;  2AP6 A;  1F6T A;  2W4D A;  3IN5 A;  1TKX B;  3W2V B;  4KHP F;  2DVI A;  1WHV A;  3QT7 A;  3US5 A;  2QRR A;  2A0F B;  4WFZ A;  3FKB A;  2GZO A;  2KJW A;  1TL7 A;  2BJ3 A;  1ZAV A;  1UFK A;  3CJR A;  3C6U B;  3KJN B;  4KT0 C;  4TKT A;  5E3C A;  2QLW A;  1T9T A;  3RTV A;  3RUB L;  3I87 A;  2BV3 A;  2HRY A;  2E1M C;  5ETM A;  3CE8 A;  2PO4 A;  1F3F A;  1U1K A;  3K57 A;  3K2Y A;  3NS6 A;  1JLA A;  3NG8 A;  4IOB A;  1Q95 G;  1UWB B;  1YJV A;  5E2Q A;  3TEH B;  1SVD A;  1S9E A;  1N88 A;  2F8E X;  3W9H A;  5D0R A;  1IM4 A;  3DN9 A;  4PXB A;  4V19 J;  3GIR A;  1N34 F;  4ED7 A;  3IWL A;  5DLG A;  2MKS A;  3CJS A;  5LXR A;  1GX5 A;  1BE4 A;  1DTT A;  3FVY A;  4ZVE A;  2VKZ G;  5HJY A;  3T1Y F;  2QIF A;  2BE9 B;  1MU2 B;  1CC7 A;  5SUH A;  2XTJ P;  3O5T B;  1RA7 A;  4OJG A;  1W25 A;  2CPE A;  2X7I A;  4L73 A;  3M8Q A;  1NB7 A;  1B0P A;  1JLB B;  1RLD A;  3WIU A;  1HNX J;  4IYQ A;  2KN4 A;  2UUA J;  5HO4 A;  1U6Z A;  4LR8 A;  1WDT A;  1D9D A;  1H2U X;  4K4S A;  1NRK A;  3R8Y A;  1HD0 A;  1UVI A;  1XTZ A;  2DNQ A;  2UVW A;  1S4E A;  1GNK A;  1NK9 A;  1V3S A;  2RAQ A;  3VGU A;  1Q8L A;  3DGV A;  1UET A;  2CJA A;  2YVS A;  5D77 A;  4WPA A;  1T11 A;  2IVF B;  4ECU A;  1HPZ A;  2CNO B;  2MPU A;  4LFC F;  2KO1 A;  1GEH A;  1FTC A;  1DZ5 A;  2YBV A;  1CJK B;  1K1Q A;  2XMJ A;  5BR8 J;  1CPZ A;  1RWP B;  2DHA A;  2EKY A;  2GHV C;  1SQF A;  4DSF A;  3OD2 A;  1N32 J;  3RBD A;  2YKM B;  3BQ2 A;  4AQY J;  3NRB A;  2VDI A;  4OI6 A;  4BBY A;  2WW8 A;  3HFK A;  1JNZ B;  2ZH7 A;  2DNK A;  3PEH A;  1T94 A;  4F02 A;  4OJ3 A;  2OEM A;  2IY5 B;  2MZQ A;  2CJ9 A;  4ER8 A;  1YJU A;  4DR1 J;  1M5S A;  4HTJ A;  4DU8 A;  1FI4 A;  2B0G A;  2FUG 9;  1UA1 A;  3RBE A;  4NX9 A;  5J2P B;  4WII A;  2UUB F;  1FRL A;  2DNY A;  2GO8 A;  1D8Y A;  2EFG A;  1YLX A;  2UXB F;  1TL5 A;  2QZ8 A;  2OMO A;  2YKP A;  2KG1 A;  4LRE A;  2ASJ A;  2KFN A;  3SSQ A;  4DR6 F;  2VAS A;  2JFD A;  5IT0 A;  4X64 J;  4GKJ J;  3OHB A;  3D0H E;  2YNF A;  4CIO A;  4C11 A;  3PIO Q;  2HGM A;  2HNZ B;  2HZC A;  4JYA J;  2UVU A;  1JLE A;  2DR8 A;  3MDF A;  2H48 B;  1C0T B;  3GV8 B;  3W9J A;  4LVO P;  3LWL A;  3Q8Y A;  3Q83 A;  3FSI A;  4GMK A;  3OFF A;  3ZC4 A;  4TU9 A;  1FJG F;  4YP3 A;  2HNY B;  1Q5Y A;  2C22 A;  2M88 A;  2V8H A;  2PA3 A;  3WC2 A;  3G2X A;  4AXI A;  2HND A;  2RF2 B;  3MUT P;  1B99 A;  4OZ1 A;  3I4P A;  3AHP A;  4EBE A;  2OP5 A;  4Y6I A;  3UQS A;  1YJR A;  3TUZ C;  2RQ4 A;  1UMJ A;  5KFT A;  2XNQ A;  4EZ6 A;  2GJF A;  4DV7 F;  3PX0 A;  4Y00 A;  4Q8E A;  4KKO A;  4RW6 B;  1P1L A;  2J9D A;  2GML A;  2QFJ A;  1QUV A;  3M9M B;  3M30 A;  1OYE A;  3NOG A;  4L74 A;  3W63 A;  3DC2 A;  2V2Z A;  1OJ4 A;  2P8I A;  1HW9 A;  4Q5V A;  1FK9 A;  1HNI B;  3WDO A;  4ZCL A;  2XLI A;  4MH8 A;  1URR A;  3C6T B;  4RW9 B;  3MFH A;  2PC6 A;  2FHJ A;  4AUK A;  5CYM A;  4DPU A;  2ZC3 A;  2LEP A;  3GG0 A;  3MM6 B;  1S1T B;  2ZH3 A;  1N56 A;  3L95 X;  4RWW A;  4WYL A;  2XMU A;  2ATC B;  3KHR A;  2RRB A;  3M32 A;  4R8U A;  1FNO A;  2Z2M A;  3DOL B;  4L6V 3;  4OYA A;  1YRU A;  3L4B C;  1Y5L B;  2G2O A;  2KTQ A;  3MZI A;  5K8P A;  1XBW A;  2HK3 A;  2VFU A;  3CXC R;  2Z57 B;  5E41 A;  4ZVG A;  1Y9O A;  4MIB A;  1KQF B;  2UU9 J;  3PJW A;  2W2Q P;  4KH1 B;  2RE1 A;  4RNO A;  1NHV A;  1JLC A;  4ZPC A;  3CCU S;  3GJS B;  3OLB A;  4J9M A;  2YNG B;  2OD6 A;  3KK2 B;  3I32 A;  4NXN J;  2VPZ B;  3QPI A;  1WOS A;  2B6A A;  1PJ5 A;  1NHU A;  1TTH B;  3MM7 B;  1DJ0 A;  1NJZ A;  2QLB B;  1JX4 A;  3R97 A;  1CJU B;  1HQE B;  3VGS A;  3GU0 A;  2K7J A;  2W2N P;  4FF1 A;  1S12 A;  3RW6 A;  5AXM A;  5J2N B;  4CWB A;  3V81 A;  3FCV A;  4ED8 A;  1NSA A;  1WWH A;  4ZIW A;  1IKW A;  3J7Z 5;  2LEB A;  4LFA J;  1HLW A;  1D0E A;  4ED5 A;  1S9G A;  1GTE A;  5HQ8 A;  1FT8 A;  2RML A;  5EWF A;  3ZZP A;  2UUT A;  2V69 A;  2DR5 A;  2YKN B;  3CDU A;  4O3N A;  2OEL A;  1FD2 A;  3BBC A;  5RUB A;  3T6J A;  3TI0 A;  1DRZ A;  2J6S A;  4DV1 F;  2KRB A;  4B9V A;  3OPK A;  4DS4 A;  1PGZ A;  1GQE A;  2VHG A;  3BGR A;  3OFE A;  2IJN A;  2CQG A;  4CLU A;  1WSR A;  2O1P A;  1NO8 A;  1QM9 A;  2YKO A;  1QTM A;  5DZ6 A;  2CQD A;  3GFH A;  2ZBR A;  3FQL A;  2V67 A;  4LT6 A;  2FLN A;  4N47 A;  4DL7 A;  3TA0 A;  3O1L A;  4B3M J;  4MK9 A;  3M8R A;  3HM9 A;  3CDA A;  2ZD1 B;  4HAC A;  5EX3 A;  2VQE J;  4J5O A;  4Q45 A;  4ZN3 A;  3IWX A;  3UE2 A;  2A6M A;  1SJ3 P;  3NGK A;  5SZT A;  5DET A;  4EMD A;  2OI2 A;  1K9M T;  2OHD A;  1X9S A;  3NOC A;  4ECR A;  4LF6 J;  3ETM A;  1F60 B;  2Y1L B;  2AEM A;  1SC3 B;  1WOR A;  3EPI A;  1RT4 A;  3BN4 A;  3WQP A;  1NEE A;  1U26 A;  1YJ9 S;  3PNI A;  5KG4 A;  4MK7 A;  3DI6 A;  3TVZ A;  1PBA A;  3CD0 A;  1JLF B;  4QIE A;  4Y2C A;  3TX8 A;  4ZP9 A;  1HNX F;  3H98 A;  3MAA A;  3D1O A;  2HZA A;  3ENV A;  2XG8 A;  2UUA F;  3M7V A;  5HMZ A;  3CMA S;  2L08 A;  4DF4 A;  2GX8 A;  1K8A T;  3N6L A;  2AMC B;  1PYT A;  1BWV A;  1F1B B;  1IBK J;  3WIV A;  2M7S A;  3GIJ A;  2B7B B;  5I3U A;  1N5T A;  1TK8 A;  1DLO A;  2V2K A;  1HI1 A;  2UV8 A;  2XLJ A;  2V4J A;  2IM2 A;  1BQX A;  2QSF A;  4A8O A;  4I2Q A;  2XQC A;  3PVX A;  1EP4 B;  4O4R A;  2QO3 A;  5BR8 F;  3BQ1 A;  3IWN C;  2DY9 A;  5HAO A;  4QOT A;  1VLO A;  4FF4 A;  2FGC A;  3T5K A;  4G1I A;  3JAM Y;  3NGU A;  1T3O A;  3CCS S;  5D0G A;  3AXM A;  2W7O A;  4M5J A;  2XM3 A;  4USV A;  3IG1 A;  2WK4 A;  1LK7 A;  1TL4 A;  5IXU A;  1NK7 A;  2VBW A;  3M2U B;  4O3O A;  4Z2X A;  1N32 F;  3TP2 A;  2Q43 A;  4KHM A;  1U49 A;  4DMZ A;  4G1Q B;  4AQY F;  4UT4 A;  1CEZ A;  4MMO A;  2F7V A;  1YBT A;  2BYC A;  1OYD A;  1NPP A;  3DLH A;  3DFE A;  1VDH A;  1XMO J;  3GIM A;  2M8D B;  3EZU A;  5FDL B;  4A48 A;  2R2R A;  2XMT A;  1PKU A;  5KFG A;  2MZS A;  2MKK A;  1GH8 A;  1X5T A;  4ZVU B;  3G96 A;  3VZH A;  3CJ8 A;  4ZPA A;  2UUC J;  2BE2 A;  4J9L A;  1V5V A;  3S7R A;  4GKJ F;  3MCN A;  3Q2S C;  1XNQ J;  4EBD A;  2VOO A;  4F3Q A;  4JYA F;  1IJE B;  2RDI A;  4I2P B;  4J37 A;  5ADZ A;  4DX6 A;  4OHX A;  3P5B P;  3IXQ A;  1WHX A;  1WEL A;  3DLE A;  2W7A A;  1CG2 A;  4N8O A;  2IM0 A;  4F4K A;  4DN0 A;  1OPZ A;  3Q0A A;  3CCJ S;  3IM9 A;  3MEE B;  1X7V A;  3TAN A;  1IQT A;  2R7O A;  4HT7 A;  4ZVT B;  4ZVO B;  3W5Y A;  1Y3K A;  2NUU G;  2ZH5 A;  4YB7 A;  2OPS A;  4Q0B A;  3ZTP A;  2B4P A;  1U8S A;  3EXY A;  2Q3P A;  4WXW A;  3W5Z A;  1RWK B;  4OJH A;  3C15 A;  2JVO A;  1TKD A;  1N36 F;  3OJS A;  2CVI A;  5J1E A;  4N77 A;  2DGW A;  3NGR A;  2XC9 A;  1OQ6 A;  3MM8 A;  3H5S A;  5MLC V;  3WBZ A;  3ZZR A;  1OWX A;  1JLQ B;  4EYH B;  1TUW A;  3DLB A;  4PYA A;  4P2M A;  2O5D A;  3CDE A;  2BUN A;  4OI0 A;  3TWZ A;  2IAJ B;  2E5H A;  1X4C A;  1QAX A;  2Y3Y A;  2BQR A;  4UZB A;  4IH7 A;  4MFB A;  2E5I A;  1GXU A;  2FHK A;  4F2R A;  1FFW B;  1YJN S;  1X8D A;  1HWU A;  5DGA A;  1RT1 A;  2NXC A;  2XCA A;  3MI7 X;  2J8A A;  1RT6 A;  3KMS A;  2HPU A;  2NXE A;  1UKU A;  4P7T A;  2BZ2 A;  4HVZ A;  3HT0 A;  1FKO B;  1FJ7 A;  1ZZF A;  3S01 A;  5GAH I;  3R5D A;  1QSS A;  1XMB A;  4YFU A;  4FKX A;  4B9U A;  1DFD A;  2L48 A;  2M2B A;  1I6J A;  5LJ5 Y;  3V4I A;  5MAO A;  2HQC A;  1SUQ A;  2CG4 A;  2JEJ A;  1F5C A;  5ETV A;  2DEI A;  3GCX P;  1FJC A;  3D1Q A;  3RB4 A;  4WFN Q;  1W7W A;  3TO8 A;  3OW2 R;  1TUG B;  3QFH A;  3OSN A;  4OL8 A;  3MMC A;  2MKH A;  4NA3 A;  2KKH A;  2CQ4 A;  2QMU B;  3D6M B;  5HK4 A;  3W2V A;  2CPJ A;  2MST A;  3H4D A;  3I96 A;  4ZCM A;  3QSI A;  4MIA A;  1FD8 A;  3UN2 A;  1U1R A;  3V5R A;  2YWE A;  1A7G E;  5FJ4 A;  5HAN A;  3L7U A;  2B9W A;  1D9A A;  4DV6 F;  1B0V A;  3HVW A;  5EWG A;  4I1T A;  4N76 A;  4NLU A;  4CT9 A;  4X4S A;  4B17 A;  1H38 A;  3FBB A;  3IMQ J;  4RUA A;  1U1M A;  3KMQ A;  4LBI A;  2DGX A;  4LFA F;  2HQF A;  1UWB A;  1ZA1 B;  2YH1 A;  3BH6 B;  4DCJ B;  3LW5 C;  1RTI B;  1WG4 A;  4JI0 F;  3V2U C;  3MUV P;  3CTR A;  4USM A;  3MR5 A;  4FPR A;  2UXC F;  1RAB B;  3MED B;  4WE1 A;  4C48 A;  2H4Y B;  4QYZ J;  4O4G A;  4N5S A;  5J2Q B;  4I6A A;  3BPS P;  4BDP A;  1VBZ A;  3CCR S;  2WVE A;  4CM2 A;  4HDG A;  3DLG A;  5DRK A;  4KGM A;  5IQQ A;  1R0A A;  1RTH B;  4DPY A;  3IFE A;  3H5U A;  3A3O B;  3TJ8 A;  1CUL A;  4N7T A;  2B4U A;  2VUG A;  3DOM A;  1JLG B;  2HWI A;  1LWC A;  1LWE B;  2BJD A;  3HJV A;  4ZVP B;  4P2X A;  3PZP A;  1KTQ A;  5F8H A;  2W8L A;  4AL5 A;  4OYX A;  2HWT A;  1VJQ A;  4MKV A;  4B3M F;  2ACY A;  2FLL A;  1WG1 A;  3KK3 B;  1AZS A;  4P9S A;  3VQS A;  3RBZ A;  3ZZ0 A;  5U47 A;  4P6Q A;  1CLF A;  5K8M A;  4CT8 A;  2GIR A;  3UD4 P;  5EHH A;  1SC1 B;  2XMA A;  1F3V A;  4I7F B;  2HBZ B;  2X3G A;  3GJR B;  4LF6 F;  3VZI A;  1T02 A;  2LP4 A;  2W8K A;  9ATC B;  2XO6 A;  3P45 B;  4GVB A;  2F4F A;  1S10 A;  2E1P A;  2AJ2 A;  2YNI A;  4MYU A;  2DR9 A;  2UXD J;  4EZ9 A;  3U1L A;  5J2M A;  3MTK A;  3G6E S;  5L1J A;  4X62 J;  2OIH A;  1ZPW X;  3FBC A;  4IG0 B;  2MMY A;  2LU1 A;  2AQ4 A;  1B64 A;  4UZC A;  5KFW A;  2B3T B;  2RIJ A;  3NNH A;  3T5H A;  3N6M A;  4NXM J;  4NCG B;  3CD7 A;  4D3H A;  2ZH8 A;  1TKT B;  5IOL A;  1SL1 A;  4DZ6 A;  1U1P A;  3PX4 A;  2F5G A;  3ET6 B;  5BYS A;  3G8Q A;  1D1U A;  4DL4 A;  3MGJ A;  1NH8 A;  4ES1 A;  4OLP A;  3CC2 S;  2MQN A;  4DQS A;  3BGF A;  3CJ2 A;  1J27 A;  3PW0 A;  1RU1 A;  3TQE A;  1T0T V;  1TFW A;  2B5J B;  4QJV A;  1C1B B;  2V8P A;  1S79 A;  1H0H B;  4ZVS B;  4J9Q A;  3BF4 A;  2HNY A;  4U67 Q;  4Q2M A;  4XPC A;  4QW9 A;  4DR5 F;  2FZC B;  2AD9 A;  2WVC A;  1KSP A;  4ZHR B;  4OZ0 A;  2WSC C;  2JVR A;  5CXT A;  4WTY A;  2JLF A;  2RF2 A;  1S48 A;  1LW0 A;  2CFX A;  5HVH A;  4X66 J;  2AV5 A;  1XMO F;  3TOQ A;  3CO0 P;  5JUM A;  4CO3 A;  3A8J A;  3MMB A;  3HXM A;  2VFT A;  4FXD A;  4JI6 J;  1KOO A;  4CLP A;  1V9O A;  4KSE B;  2ZVS A;  5HQL A;  1MMD A;  4RW6 A;  3UWT A;  4UY8 5;  2G0I A;  3NS5 A;  2UUC F;  2KVI A;  4KGV B;  4LIW A;  1C0U B;  1A6L A;  3F41 A;  1SKS A;  3U02 A;  4PUO B;  2WCX A;  4OYI A;  1Q7L B;  2C1E B;  4HHU A;  2WVD A;  1HNI A;  5B0F A;  1NK8 A;  3PR4 A;  3KWM A;  1RT5 A;  3C6T A;  2LQ9 A;  1MW7 A;  4YB6 A;  2X1B A;  3PM9 A;  2NQP A;  1G7C B;  2G13 A;  2Q6B A;  5DO2 A;  1ACM B;  4P7V A;  5H9E J;  1VQ6 S;  1O51 A;  3H2U B;  1RP5 A;  4YUD A;  4ID5 B;  3C66 A;  1ELO A;  1CC8 A;  2E5L F;  3L7P A;  5IV3 A;  3FQK A;  3DOL A;  3KLG B;  1T7P A;  1BLU A;  3AOC A;  2X1G A;  1H7X A;  3ZNJ 1;  2WBR A;  2WB4 A;  3JTO A;  1L3K A;  4C8K A;  4DR7 F;  3EUN A;  2RH3 A;  4ITS A;  1JXE A;  3R1H A;  1VRU B;  1IKY A;  4IUF A;  1VRQ C;  2Y0B B;  3N0V A;  3B82 A;  2BX6 A;  4YR0 A;  2NYH A;  2QYC A;  3EX7 B;  2V4R A;  3K5P A;  1SKW A;  2GHP A;  2VIH A;  3LAL A;  1YJW S;  3KK2 A;  3CT9 A;  1W2B R;  2OO4 A;  2HHP A;  2ALZ A;  5KFI A;  2MQQ A;  2FZK B;  2XS7 A;  3C14 B;  4DSL A;  4LBP A;  5AE3 A;  1M0S A;  3MM7 A;  1DUR A;  2EVZ A;  2FLO A;  2YX1 A;  5LSL A;  2FDN A;  1HQE A;  2AWZ A;  1HW8 A;  2DNO A;  4DJB A;  1O0P A;  2VBY A;  2YX4 A;  8RUC A;  1O5J A;  4JI1 J;  2N4D A;  2KT3 A;  4Q2L A;  5F8M A;  4NLG A;  4M95 A;  2VBX A;  3SXL A;  2N4C A;  4NCA A;  2EWH A;  4J7C A;  4TQR A;  2RKI A;  5H1S V;  2DO0 A;  3U1M A;  4TLQ A;  5B09 A;  1Q79 A;  1KQK A;  3DMJ B;  2YNH A;  2MKI A;  2XGQ A;  3GE9 A;  1SV5 B;  3BBB A;  1N52 B;  3KUE A;  1TL1 A;  2FY1 A;  4NAS A;  1IWA A;  3LH2 S;  3SIP B;  4DR2 J;  3RG6 A;  4N41 A;  4PQU B;  4NLX A;  4DX5 A;  3IR6 B;  2KL8 A;  4ZN1 A;  2HFV A;  2KJV A;  3MMJ A;  4RW7 A;  3K5L A;  2Z56 B;  4A8W A;  5FII A;  4X4P A;  5GAD I;  1RAI B;  4I0W A;  4OI2 A;  1S1V B;  4KYZ A;  1Y11 A;  3E51 A;  4ECY A;  2MB0 B;  3QZ7 A;  2XEX A;  2C2R A;  1CJV B;  2BKP A;  3TJA A;  2Y1J A;  3GTY X;  2CJX B;  3IBF B;  5JJB A;  1YJ7 A;  2A18 A;  3QJJ A;  3SFG A;  4HI2 A;  2DHX A;  3W1Y C;  5KFD A;  1WOP A;  1MWZ A;  4K2J A;  2XMW A;  1SQE A;  3NY0 A;  4LBH A;  4M5D A;  4F25 A;  5HMY A;  1QVG R;  2ZD1 A;  3FMW A;  2W4P A;  5GMK a;  1WF2 A;  4OQJ A;  3SSS A;  1VMB A;  2W9C A;  4RW4 B;  1WDD A;  2KB2 A;  1S1W B;  2BM0 A;  2V8G A;  3HP6 A;  1W26 A;  4TY8 A;  3CDB A;  4PXE A;  2XY7 A;  4F04 B;  3LP0 B;  2W4C A;  3W62 A;  4C8M A;  1Q1K A;  4FBT A;  3MOJ B;  4GC6 A;  2R8H A;  4LR7 A;  1GMW D;  1XMQ J;  3HKZ D;  2LQB A;  1JLF A;  4DR3 J;  2HHQ A;  2ASY A;  2MHN A;  4BLG A;  3SQG B;  4A4J A;  5KFY A;  5CYJ A;  3OTB A;  5F9L A;  4L72 B;  3D54 A;  5A8K A;  2J9E A;  1FA0 A;  1WF0 A;  1TV6 B;  1FRK A;  1TL3 A;  2MJU A;  4KB7 A;  1KLM A;  1X4E A;  2BQU A;  3VGV A;  4NCB A;  2E1R A;  2KYZ A;  2ZDO A;  2BM1 A;  3GFY A;  2C28 A;  3T9N A;  5KFX A;  2FVR A;  4CLL A;  3KHG A;  2ZOF A;  2LLZ A;  3AA8 A;  4ICL A;  2WTF A;  3CUN A;  2BW2 A;  1U8W A;  3KLF B;  2IJR A;  2FD2 A;  3ELH A;  2MKC A;  2AJQ A;  2LA4 A;  3AQP A;  3IS9 A;  1BY9 A;  5B0E A;  2KI2 A;  1M5V C;  1S6Q A;  1TFY A;  3NL0 A;  2GAH C;  4WP8 A;  5IT9 Y;  2BAN A;  3ZZY A;  3HVA A;  3GON A;  3GJQ B;  5KFQ A;  3W64 A;  1M5K C;  5DG7 A;  4LF8 F;  4NI2 A;  1SKR A;  2MJN A;  2CWX A;  1NXI A;  4MKA A;  1EQ0 A;  3BSC A;  3TQ1 A;  2JWN A;  3L09 A;  2MQL A;  2KYX A;  3IA0 A;  5E3P A;  4B3T F;  2OLW A;  5FDL A;  3M1V A;  1RSC A;  5CD4 A;  2UXD F;  2PMW A;  2DHG A;  4K8R A;  4X62 F;  2R7S A;  4B3R J;  1IKX B;  3NP5 A;  5A8W A;  2P5V A;  4DCO B;  2ZBP A;  4NL5 A;  3NKY A;  2RUG A;  2NR0 A;  3VV2 B;  2BR0 A;  2GW8 A;  2MKJ A;  1AW0 A;  5JVG Q;  4PG8 A;  4RW8 B;  4DUT A;  2DGU A;  3MMA B;  2MGZ A;  4Y2A A;  4U7U K;  2J7K A;  2ZWP A;  3K8W A;  5A0Y B;  4YDX A;  1JXL A;  3BB5 A;  4UOG A;  4LRC A;  1EKR A;  1UW9 A;  1WKL A;  1VBY A;  3H5X A;  1LW2 A;  2MQP A;  2LCW A;  3P8B B;  2COL A;  1NJI T;  5HMW A;  1DQ9 A;  4L3K A;  4B9T A;  2IRX A;  4B02 A;  4HL9 A;  4O0N A;  1KVK A;  4XK8 C;  1VJW A;  4A8Y A;  1ROF A;  2QA1 A;  1OPI A;  1Y7P A;  1U24 A;  2DKO B;  1GMV A;  4JI6 F;  1NM2 A;  3QT6 A;  1FKA F;  1X4D A;  3WC0 A;  5HBM B;  1H2V Z;  5DDQ C;  4LRF A;  2Z4P A;  2DRB A;  4A8K A;  2XMM A;  1RLC L;  1S1U A;  4B3S J;  2H9Z A;  1BQN A;  2ABY A;  3Q86 A;  2OSQ A;  1L3S A;  4GO5 X;  4O44 B;  4NEZ A;  3PYF A;  4ANE A;  3OR2 B;  3BEG B;  2ZEJ A;  3B8H A;  4RNF A;  1IBC B;  1WG5 A;  1CS4 A;  1ITP A;  3E01 B;  2ZVI A;  4ZVQ B;  4E2F B;  1ZAX A;  3QGP A;  4G3I A;  5DM6 Q;  2MEW A;  4AND A;  5F3T A;  1LXJ A;  1MG7 A;  1FKP B;  2VH7 A;  2ASL A;  5GAD U;  1NCL A;  2ACM A;  5A8R B;  1IKV B;  3RB3 A;  2PFD A;  2WVB A;  4KPC A;  1S0N A;  1U4B A;  1VQN S;  1S72 S;  4X4N A;  2IJF A;  1G2E A;  3D67 A;  3B4D A;  3UD5 A;  4ED6 A;  3QT8 A;  1EAR A;  5KFR A;  3L9Z A;  4GKK J;  4QWC A;  1HBO A;  5B0B A;  3PCO B;  2BVZ A;  2N3O A;  4CZC A;  4UTG A;  3MR7 A;  4KH0 B;  2ILY A;  2AJF E;  1RWV B;  1W2I A;  4ZS6 A;  1S0M A;  1RCX B;  4QR1 A;  4B9S A;  4KV8 B;  2BRK A;  4ILR A;  2ZFH A;  4WBF A;  4ZJO A;  2PFF B;  2K3I A;  3CCE S;  2HHH J;  2CVE A;  1WHY A;  1F9H A;  3CJK A;  2MTL A;  1S7I A;  4EU0 A;  5KT3 A;  2EK1 A;  3J7A 1;  1VIO A;  5FD1 A;  3MPY A;  2RHS B;  3GII A;  1FDB A;  4YR3 A;  4J9S A;  3M6V A;  1WD6 A;  1TAQ A;  3HHL B;  2YQ0 A;  2BJ8 A;  4DN9 A;  3FEY B;  4LRA A;  1YG0 A;  4ZPT R;  1QTN B;  5CCM A;  2VA2 A;  2CWK A;  1LK5 A;  5F8L A;  4KO0 B;  2IMW P;  2D7S A;  3QGI A;  1RTJ B;  2I0X A;  1Q8B A;  2KXF A;  4DG1 B;  4RUC A;  3GP9 A;  2XY5 A;  2B9E A;  3OL9 A;  1NPK A;  2EFQ A;  1SJ4 P;  3MCO A;  1QAJ A;  1N54 B;  3G82 B;  3N5F A;  2DGV A;  1T3N A;  4LF4 F;  2W24 A;  1DQA A;  1C1C A;  4CQ1 A;  1RTI A;  3RR7 A;  2M8H A;  1RAD B;  3MED A;  3LP2 B;  2WRM A;  2VZ9 A;  4MT1 A;  3KNG A;  3LQV A;  5GMD A;  5J2Q A;  2VQF F;  3OTO J;  2HGL A;  4IOA Q;  3BGO P;  3UR0 A;  2LKZ A;  3J7Z T;  3H4B A;  5KFU A;  3NEK A;  3S1T A;  1KFD A;  3AD8 C;  1T03 B;  4TXS A;  4WCE Q;  2VPW B;  1TU0 B;  4DEZ A;  1CSJ A;  2LQJ A;  1KVJ A;  1K44 A;  1IJF B;  3DYA B;  3ILI A;  5THW A;  1Q0N A;  3UW1 A;  3HJF A;  1LWE A;  1S7H A;  3OTE A;  1PSD A;  1URN A;  2L9D A;  1F5B A;  3V6H A;  4ECW A;  1NLK L;  3VGT A;  3F56 A;  4NLD A;  1EHW A;  4IQX A;  3VAI A;  1IBM J;  2VPY B;  3KK3 A;  1NK0 A;  4L3N A;  1VIS A;  2QMX A;  4ZJL A;  2GHW A;  1PC4 A;  1O8B A;  1Y5I B;  2EW9 A;  4P75 A;  2XO7 A;  1AT1 B;  5DLF A;  3TUJ C;  4C2M A;  2FC9 A;  1NJW A;  5KFL A;  1N5Y A;  4OX9 J;  2ZOG A;  5AXL A;  3CSK A;  2I9S A;  1PIL A;  3KUG A;  3MM5 B;  3GYX B;  2KT5 A;  5F8G A;  5ETO A;  2MZR A;  5L46 A;  1UPP A;  1XMQ F;  2JH3 A;  1U1L A;  4DR3 F;  1EX8 A;  1EJ7 L;  1V3R A;  5AJ3 J;  3F73 A;  5EDW A;  4MKB A;  2JC1 A;  2RB7 A;  3QIP A;  5HN0 A;  1MN7 A;  2H4W B;  3EMT A;  4NML A;  2C2Z B;  2U2F A;  2V50 A;  4KGZ B;  2OEJ A;  3QAE A;  1RK8 A;  1UFL A;  4NCG A;  3CCT A;  1U0H A;  4PG5 A;  2LXI A;  2BA9 A;  2F40 A;  1UVN A;  4IR1 A;  3ET6 A;  4WFX A;  1NSK L;  1RKJ A;  2FJX A;  4PAA A;  4F4Z A;  4X65 J;  3CJ4 A;  1ZM2 A;  3SCJ E;  3MPW A;  5KFN A;  1NHK L;  1RXO B;  4JP8 A;  2R7Q A;  1HNW F;  3VAG A;  2R7W A;  3DDI A;  4BC7 A;  3TJ9 A;  3FNN A;  5GAE I;  1LV5 A;  1JWW A;  2ALY B;  2GV1 A;  2WOM B;  4Z7Y A;  2IVY A;  3GIL A;  4RZR A;  1VQ4 S;  2AYE A;  3GV5 B;  3H2L A;  1Q8I A;  3FCH A;  2KRR A;  2A6O A;  3ULH A;  2XZD B;  2HBY B;  5D3G B;  4JI7 J;  4JI2 J;  1REV B;  2CQI A;  4B3R F;  2WW4 A;  4QIV A;  1AFI A;  3G87 A;  4LF5 J;  4P73 A;  1UZD A;  1N6Q B;  1KC8 T;  3SV3 A;  2FZG B;  2FHO B;  2R2T A;  2ROE A;  3FRY A;  4JOU A;  4LRB A;  3HHE A;  5C5J A;  3BO4 A;  1RHU B;  3I5C A;  1REG X;  3M2R B;  2V68 A;  3M8P A;  3PAC A;  2IA0 A;  2MYF A;  2AHO B;  2E5G A;  4CH7 A;  1B7Y B;  2QV6 A;  7FD1 A;  2HHS A;  4EYI B;  5IC4 B;  3A8E A;  2FQQ B;  3HSD A;  1RT2 A;  5IC6 B;  2ERR A;  4DUZ J;  2FJV A;  3DXS X;  1X5O A;  2CQ1 A;  3DRR B;  4FP9 A;  3HFV A;  3KJV B;  4NLR A;  2OEK A;  3VQT A;  4ID5 A;  2KH9 A;  3QGG A;  3NAH A;  1F0X A;  4X4V A;  4IDK B;  3KLG A;  2DTJ A;  1PIE A;  1HR0 J;  2D69 A;  2R7U A;  1FVS A;  1RHR B;  2J7U A;  4OHW A;  1R8P A;  1Z2L A;  3RRG A;  4QR2 A;  4K0K J;  3IAS 9;  3G8S A;  4HKQ A;  5T14 A;  2CQC A;  3KG4 A;  2AGO A;  3DLK B;  1XC9 A;  2Y0S D;  4M5L A;  4K4V A;  2HRU A;  4B3S F;  2PI4 A;  4U96 A;  3S8S A;  4WXO A;  2HVH A;  3UDL A;  3QWU A;  4DV5 F;  2JRS A;  4OZN A;  2KM8 B;  2KXN B;  4ECQ A;  1SIZ A;  4H4O A;  1WUU A;  3OTD A;  4FYV B;  1OO0 B;  4C3K A;  1Q7Y T;  1C4C A;  1KQS R;  1GTH A;  4RKU C;  2Y1I A;  5K14 A;  4OYM A;  1FXD A;  3CED A;  3T5L A;  3CPW R;  1TQL A;  2R4F A;  4ZJQ A;  5DG8 A;  3OR1 A;  2CUY A;  2MQ8 A;  1H3D A;  2EPI A;  4A47 A;  3W66 A;  3E8O A;  3DOK B;  1RWW B;  2GAG C;  5GAG U;  2J0X A;  1EZZ B;  5C24 B;  1VI7 A;  4JI3 F;  3HK2 A;  4HYK A;  1X0P A;  4W4M A;  3NLC A;  2ZNY A;  4ZK7 M;  1D3W A;  1YX2 A;  4OYO A;  2PI5 A;  2V94 A;  2VFV A;  2HVE A;  1U09 A;  5C2C A;  2F65 A;  2EKN A;  1UVK A;  4HEA 9;  3ISZ A;  1ZM3 A;  3Q8V A;  4MJK A;  2I5J B;  2FYX A;  1S5Z A;  2JX2 A;  4AD6 A;  3W8G A;  2E1A A;  2IVM A;  1KEK A;  1JB0 C;  2KXH A;  3ITH A;  2CJB A;  3PJ9 A;  1JXV A;  3B54 A;  2PEB A;  2LEC A;  1I3O B;  2P9C A;  5ETS A;  1N4L A;  2W2O P;  1KNZ A;  3I5A A;  3FGV A;  2L3M A;  1VQ9 S;  2DPJ A;  2W1B A;  3MR2 A;  1FRJ A;  4DV0 J;  1FEE A;  4WKY A;  3CCW A;  4IRC A;  5J1N A;  3AB4 B;  1ZH5 A;  1U02 A;  3PJX A;  3FSX A;  1QE1 A;  4CLW A;  4O3R A;  4RW4 A;  5E33 A;  3DHW C;  4PAB A;  2YWF A;  1S1W A;  2M4M A;  2AYG A;  2Z2L A;  2ZUA A;  2CNN B;  2IPO B;  4DPW A;  3LP0 A;  2HW3 A;  1WF1 A;  3OVA A;  2FB0 A;  5ETK A;  4CLT A;  3OTO F;  4OYB A;  2E66 A;  3D6T B;  1NU4 A;  4M5N A;  1K47 A;  4J9N A;  1HYS A;  2O3D A;  4JI4 J;  4DQI A;  1VFJ A;  2KDO A;  3LAK A;  2OPP B;  1TR0 A;  1RT7 B;  3A3P B;  2XNR A;  3D0G E;  5BXI A;  4JI5 J;  3TA1 A;  3DCA A;  3O3L A;  3DKD A;  1R6V A;  2G0J A;  4H54 A;  4C3L A;  1LKZ A;  2YPZ A;  5HRO B;  1HNV B;  1IBM F;  3EVM A;  4CH1 A;  2E7W A;  4CDI A;  1SXL A;  2VPX B;  1YQH A;  2R7V A;  3TYT A;  3DXB A;  3J7A N;  3M2V A;  1KFS A;  2DRD A;  5IM0 B;  3M6X A;  5F0U A;  3R2D J;  4R25 A;  4DLE A;  1KOH A;  2PT0 A;  3HLU A;  5D15 A;  4LSN B;  2EBG A;  3F0N A;  4Z37 A;  1K0T A;  2HS0 A;  3OUY A;  3LOU A;  3ZFV A;  2HBQ B;  4PWD B;  2JL9 A;  3IP0 A;  2B9X A;  2AT1 B;  3VAM A;  3MOZ A;  1SJ1 A;  2FJW A;  5HLF B;  1PO6 A;  3CD6 S;  2Y8Y A;  6FDR A;  1SC6 A;  5HP1 B;  2Q6C A;  5EGY A;  5HVF A;  4QWA A;  3NAI A;  1IKX A;  1X9M A;  2K1R B;  2W2P P;  3K7R A;  3CJQ A;  1TL7 B;  3KYL A;  3VAK A;  2V9W A;  4QCL A;  3V6D A;  5E3Q A;  5F8N A;  3GMG A;  2VG6 B;  1M5O C;  2E29 A;  3EYZ A;  3MMA A;  1JLA B;  2ILZ A;  2X1A A;  1TEL A;  4KFB A;  1SH0 A;  1HBU A;  1VS3 A;  4X65 F;  3DDK A;  1EET A;  2HWH A;  2HAI A;  5A0Y A;  4C8L A;  2CQ2 A;  1S9E B;  3BO3 A;  3V6K A;  2MY8 A;  4F26 A;  2RIL A;  3LA0 A;  2DNN A;  3EJM A;  4CM0 A;  2YWG A;  5I4M A;  5IQ6 A;  2RQC A;  2J0S D;  4B3O A;  2HUR A;  2Z8Q A;  2OTL S;  1V5I B;  1TMM A;  5C42 A;  4YHH J;  3D28 A;  5DQG A;  3M8Q B;  4Y65 A;  4PG4 A;  3LUY A;  1XN9 A;  2E9T A;  1FNM A;  1VK3 A;  2ZM6 J;  3SBM A;  2DYA A;  3H40 A;  3E2E A;  1IN0 A;  3N6N A;  2RU3 A;  2GGP B;  5HBM A;  2DXD A;  4LF5 F;  5KT4 A;  4B9M A;  1YK9 A;  1JMT A;  4WYW A;  4CNY A;  2NS1 B;  4ZP7 A;  4FBU A;  4K7Q A;  4E0D A;  1UJ6 A;  4NOH A;  1WC6 A;  1ZYQ A;  1EAY C;  3H42 A;  1HPZ B;  3GR0 A;  2RD5 C;  1IR1 A;  2PD1 A;  3TVK A;  2DT9 A;  4ELT A;  2B43 A;  3KLI A;  2GVZ A;  3PRV A;  2CIM A;  1RQ0 A;  2BW7 A;  1ZZN A;  4USW A;  2Q1L A;  4NLO A;  1RWO B;  2X1F A;  4UY8 T;  1MNE A;  5HI7 A;  4L75 A;  2DIV A;  1FKP A;  3VVT A;  2APO A;  4ZCI A;  1IKV A;  2DY1 A;  5AE2 A;  1WC1 A;  1HR0 F;  5KFS A;  1KN6 A;  1IVZ A;  1UEK A;  3GJT B;  4WTO B;  1HWK A;  1NJX A;  2DPI A;  9RUB A;  3NCQ A;  3EVW A;  2DO4 A;  4J9V A;  3SCK E;  4NPO A;  4C97 A;  1WTB A;  4NLS A;  2ZH9 A;  2W2M P;  3CMQ A;  1RBA A;  3HVT A;  4ECS A;  2ZWO A;  4USU A;  4PPZ A;  2CAJ A;  3P6Y C;  4NLQ A;  4KV8 A;  5ETT A;  4LJM A;  3UDC A;  4YY3 J;  2J5A A;  1U6B A;  4QW8 A;  3AH6 A;  2EG2 A;  2YNF B;  3C19 A;  3M6W A;  1JLE B;  4DV4 J;  1WKK A;  3ZZT A;  3TZZ A;  3LWM A;  3CW2 C;  2EFV A;  1XQI A;  2EXU A;  3OV7 A;  4GRS A;  4J9P A;  5E7O B;  3CGI A;  4J91 A;  1FEH A;  1Q16 B;  2VD3 A;  2WON B;  5C25 A;  4FVM A;  4B9N A;  4CH0 S;  3DRX A;  4Z7C A;  4U7U D;  4Y28 C;  2P9G A;  2R7R A;  3ISN D;  3AB2 B;  2HND B;  1GXT A;  4ES3 A;  1U7L A;  5KT5 A;  1FRH A;  2OPR A;  2CXE A;  1VQS A;  2I2Y A;  1U2R A;  3LP2 A;  1RYR A;  4P74 A;  3NXZ A;  2ZH6 A;  3IBC B;  5D4L A;  4QWB A;  5DQH A;  4KKO B;  1Y10 A;  1VIX A;  3UN5 A;  1RAG B;  4RPF A;  4ZKA A;  1I1G A;  3SMZ A;  4LVN P;  1GK8 A;  5KFH A;  1HWJ A;  5IT4 A;  3BKF A;  1U47 A;  4K4U A;  3KDN A;  1LEO A;  4LF1 A;  3BRE A;  1LFW A;  3ENQ A;  2DK2 A;  2I6W A;  4QWD A;  1QSL A;  1L3U A;  2VBZ A;  4FF3 A;  2ZKU A;  2QJ3 A;  1F9F A;  2IMO A;  4WKR A;  4PXC A;  2ZZT A;  1FTR A;  4IG3 A;  1ZBT A;  1PCA A;  3BZQ A;  3R7B B;  5CYM B;  4DV0 F;  5D6G A;  3AJD A;  4H4M B;  1SL0 A;  2F4V J;  4CO5 A;  2Y9H A;  4AL6 A;  4R8U B;  3KHH A;  3HVR A;  1SL2 A;  3SDE A;  3PDN A;  4KGX B;  1TVR B;  2CYY A;  3PO4 A;  3CJT A;  2F9J A;  3OL7 A;  2V5H G;  5HVG A;  4FYX B;  4DV3 J;  4I68 A;  4ECV A;  4FYY B;  1UZH A;  2JC0 A;  3T1H J;  1JLC B;  1E6Y B;  3OXL A;  1NPR A;  3KLH B;  3CCV S;  2CPF A;  2CQH A;  1XEZ A;  5L8R C;  5T7L A;  4YDD B;  4O0I A;  3KKF A;  1HAR A;  4KHP J;  4C9D A;  2B6A B;  2FC8 A;  2EBE A;  3HZE A;  2KM8 C;  5F41 A;  3AY0 A;  1VBK A;  4WWS A;  4DV2 J;  5E3A A;  2DB1 A;  4LF7 J;  4CLY A;  3GPA A;  3R1L A;  2ZE2 B;  3DLL Q;  4CLK A;  4U6P A;  1NK4 A;  1T9Y A;  3UCU P;  4JV5 F;  3NNC A;  3TA2 A;  3A13 A;  3L7O A;  4U9R A;  3T19 A;  1HI8 A;  1VQK S;  4ALZ A;  1KLN A;  1HKA A;  1S9G B;  3A12 A;  2XWX A;  1L3T A;  2XB2 D;  3RAQ A;  3ZNU A;  3HSZ A;  1L3V A;  2U1A A;  1N34 J;  3G9C A;  3CNQ P;  4C0B A;  1P1T A;  4U95 A;  4NLY A;  4J9R A;  4BCA A;  3G4S S;  4K5S A;  3T1Y J;  2EFO A;  2R3V A;  1NB2 A;  2WOM A;  3BBF A;  2UVV A;  4OHY A;  5ETP A;  3WHI A;  1NK6 A;  2VU5 A;  1KHW A;  2G1H A;  4LIR A;  3RJM B;  3BGR B;  2V2Q A;  4DS5 A;  5D3G A;  1REV A;  4KRW A;  2AYB A;  4ZP6 A;  4HLB A;  3LGH A;  1N6Q A;  5KFE A;  5KFA A;  2G0C A;  3OXF A;  2UUW A;  3PW7 A;  3QMQ A;  2VFS A;  4V19 X;  5H9F J;  4M8L A;  1X4B A;  3K8V A;  1WI8 A;  3GLJ A;  2PE8 A;  4LFC J;  2MLY A;  1IR0 A;  3R5A A;  3IAM 9;  1FFG B;  4HAC B;  5C7P A;  5E3R A;  2LQ8 A;  2JEF A;  5B0C A;  4B9L A;  4ZPD A;  3MCM A;  4R0E A;  1KBR A;  2IDL A;  2O01 C;  4YB1 P;  1UPM B;  3MPV A;  1VRT A;  2CZV C;  2EI5 A;  3MUR P;  1J5O B;  5CQG A;  5EX0 A;  3ONQ A;  2BEF A;  3MXH P;  4M94 A;  1VQL S;  2V9K A;  4CTA B;  2XLK A;  1IR2 A;  3EGN A;  2IYI A;  4IDK A;  2KZZ A;  1LQ9 A;  3DI6 B;  1KR4 A;  2KFY A;  1UEU A;  3R6L B;  2G2Z A;  4OMF G;  2ZIT A;  1SI9 A;  1NH7 A;  2JDJ A;  3OXG A;  2ZM6 F;  1SBR A;  1DAX A;  2ZJP Q;  3T6B A;  1RWN B;  1RCO B;  5G0R B;  2AJ0 A;  4C8O A;  5BYQ A;  4CO0 A;  2B4O A;  4DQR A;  2C2E A;  2UXB J;  3D5M A;  3NGD A;  3PIP Q;  4LSL A;  2J7W A;  2MLZ A;  2DGT A;  1BHN A;  1J5E J;  2OAU A;  5I3U B;  1VC5 A;  3JYT B;  3PRD A;  1PJ6 A;  4IFY A;  3RB0 A;  1O6X A;  3FFI A;  2C3O A;  4DR1 F;  2V4J B;  1FDA A;  3M8Z A;  3JSY A;  4HHH A;  2P6S A;  4I2Q B;  1RHK B;  3BQ0 A;  2DNH A;  3AAW B;  2YTC A;  1DY3 A;  4DFM A;  5KFB A;  4NYO A;  1R0B G;  4BHQ A;  3CCM S;  1H73 A;  2UVR A;  3U1N A;  4RX6 A;  2AKW B;  4X4U A;  2ROP A;  2XYP B;  2A3J A;  1HMV A;  4X64 F;  3TNV A;  3DOK A;  4KHR A;  5F3Z A;  4NZ7 A;  2HFZ A;  2L9W A;  1OIA A;  2QT7 A;  3EDQ B;  4EUV A;  4RNM A;  3CME S;  5A2Q U;  1HBN B;  4OZL A;  3EM1 A;  3BKU A;  3PV8 A;  1H6K X;  2AZ1 A;  3I0R A;  4EBC A;  4A8Q A;  1S9F A;  1SB6 A;  3AQO A;  5B7W A;  2CQ3 A;  4JV0 A;  2DD8 S;  3JXO A;  1NME B;  4X4Q A;  1XK8 A;  2YWK A;  3MM9 B;  1XR6 A;  1UAW A;  3G6X A;  3J81 U;  2AU0 A;  3M8Y A;  3CJ0 A;  2MZT A;  2BE2 B;  3DU5 A;  3ICL A;  1N5Q A;  1NJY A;  5KG3 A;  1SJF A;  3NGS A;  3A3N B;  3P5T L;  4KQZ A;  5IWA J;  3EWG A;  4F4X A;  3HHL D;  1MML A;  1VQ8 S;  1CJT A;  2OKQ A;  5HAT A;  3BYR A;  1K1S A;  1YBA A;  1VQ7 S;  1BXN A;  4DV4 F;  4WU2 A;  1FDN A;  4KC5 A;  4F7V A;  8ATC B;  5K5M A;  1HWI A;  4IR9 A;  4F3O A;  1TKZ B;  1KTV A;  5LT5 A;  3LP1 B;  5KG6 A;  3K59 A;  2R7T A;  1Z1Z A;  4TLR A;  4ZVR B;  1RAA B;  3EZO A;  3OL6 A;  4TNO A;  1CQN A;  1F9E B;  2PMZ D;  3E3X A;  3RB6 A;  2OPS B;  3CJ3 A;  2HHV A;  3AJ1 A;  3C2P A;  1RTD B;  5HJX A;  2W25 A;  2LYV A;  3HF5 A;  4FPI A;  1AB8 A;  2QSW A;  1NND A;  3N4W A;  2PSZ A;  5LL6 d;  3DGP A;  1T05 B;  2CJY B;  4Y2M A;  3EGW B;  2CRL A;  5J1E B;  5D8H B;  1YRX A;  1VQO S;  4C8Z A;  3O8W A;  3MM8 B;  4F0H A;  4M5M A;  3KK1 A;  2ASD A;  1JKH A;  1XR5 A;  3ENA A;  2D9O A;  7AT1 B;  5ETQ A;  4F8R A;  3TX0 A;  1HHS A;  1RYS A;  2AJ4 A;  4DL2 A;  4MFB B;  2NPF A;  2E9R X;  2P9E A;  4OX6 A;  3T9Z A;  1RGV A;  3MEG A;  4DHV A;  2DIU A;  3BR8 A;  2UU9 F;  5IZH A;  1RAO A;  1RT1 B;  3EZ5 A;  2PMH A;  4DX8 H;  3C16 A;  2F8H A;  1RJJ A;  2KT2 A;  1HNV A;  1U48 A;  3A4T A;  4NXN F;  3D7S B;  1V3Z A;  1TKX A;  4OZ5 A;  2F4V F;  4ZCK A;  2IM1 A;  4C4W A;  5K8O A;  4TU7 A;  2HHW A;  3EGV A;  3C6U A;  1LXN A;  3V4I B;  1FES A;  2HIQ A;  1MSW D;  1L5U A;  3ILJ A;  4LSN A;  4URQ U;  2J0W A;  4YB5 A;  2ZJR Q;  4PWD A;  5ETR A;  4DV1 J;  3GFZ A;  4OHV A;  4DL0 C;  3FZ2 A;  5HLF A;  3L3C A;  2K7K A;  3GB0 A;  1P9Q C;  1KS2 A;  5HP1 A;  3NS7 B;  1S1X B;  1UP1 A;  4IQM A;  2C2D A;  1KKH A;  3Q8Q B;  4P72 A;  5DDO C;  2K1R A;  4DV2 F;  2NPI A;  5F9N A;  2M3D A;  4LF7 F;  2EFP A;  3DLJ A;  4AL7 A;  1MU2 A;  2GFF A;  4W98 A;  3PW2 A;  1S57 A;  3UR3 C;  2GMH A;  3GWC A;  2CQB A;  1JLB A;  1KVI A;  2VG6 A;  3FK4 A;  1GMW A;  3VAL A;  2DNM A;  2QG9 B;  3MWB A;  1G6B A;  2CPH A;  3KJQ B;  4ILM A;  4KBI A;  3IRX B;  1H74 A;  3I9Z A;  6AT1 B;  2C3P A;  2N82 B;  3ZTQ A;  2D9P A;  2IA6 A;  2ZZM A;  2DH9 A;  5DM7 Q;  4WE1 B;  2P2C B;  4O4G B;  4WFA Q;  1FE4 A;  2FPH X;  4M5K A;  3FEX B;  1BD6 A;  3AT1 B;  1ZAW A;  1CJK A;  3DLG B;  1KON A;  2VQE F;  4FNH A;  1R0A B;  2E7X A;  1PBU A;  4QWE A;  1OSC A;  3VVU A;  3OVB A;  1X5S A;  4NYP A;  3P4U B;  1DAR A;  2D1C A;  3PHT A;  1CUL B;  2ZUG A;  1ZM4 A;  3DRP B;  3D0I E;  3FUY A;  2QFI A;  4ERD A;  2GGP A;  3DOM B;  2YKM A;  1LWC B;  3SCI E;  2CPY A;  3JSB A;  3A1Y G;  1Z4U A;  3I0S B;  3PW4 A;  1HWL A;  5KG2 A;  4DI6 A;  4EO8 A;  4OI3 A;  1SKU B;  3KUH A;  1LFP A;  4YN3 B;  2L41 A;  3CJ5 A;  1AZS B;  1RWM B;  2Z0G A;  2JFK A;  3WX4 A;  5J2P A;  2IRU A;  1FFS B;  4I56 A;  4OYW A;  3JTP A;  2JSX A;  1FWK A;  2QN6 B;  5DQI A;  3I5B A;  1T9V A;  4I6Y A;  4ANC A;  1AUD A;  4USH A;  3OQ2 A;  4FN5 A;  3GR1 A;  1ZET A;  1NBE B;  1IBK F;  4PQA A;  4NMX A;  5K9F A;  1ZM9 A;  1TK0 A;  4IOC Q;  4ZPW R;  3BH7 B;  1XER A;  2HNZ A;  1BUX A;  3BM7 A;  4PEO A;  1U1O A;  1C0T A;  3I55 S;  1JJ4 A;  4GVB B;  3RU0 A;  4WZM A;  4K5R A;  4NZ0 A;  3FSY A;  1YRT A;  2YNI B;  1IWG A;  5J2M B;  2DNL A;  2HFO A;  1QSY A;  5HSP A;  1U2F A;  1SPB P;  3PYE A;  1DHM A;  1WJ9 A;  2CJK A;  4F2S A;  4K4T A;  1G1X A;  1J5E F;  4CLS A;  4DPX A;  4DL6 A;  2QL9 B;  2LEA A;  4NA2 A;  3FBF A;  4CNZ A;  3SI8 A;  2I1R A;  1WAC A;  3C3L A;  1R8C A;  1MMN A;  2HQ3 A;  4LRD A;  2OPQ B;  4DWI A;  1T9U A;  3OT9 A;  5L1L A;  1FWL A;  5ETL A;  1AA1 B;  4YQW A;  3KNA A;  4FZV A;  5F0W A;  4BWM A;  4NEY A;  5GAH U;  2O66 A;  3UN3 A;  4BS2 A;  3HMJ G;  2RQM A;  2WON A;  2JZ5 A;  2MZ1 A;  4UOF A;  1M1K T;  4ELU A;  4WU3 A;  2MSS A;  1XNQ F;  3FRZ A;  3T5J A;  2HSE B;  2RSQ A;  3PTW A;  4LQ3 A;  2LXU A;  3ZZO A;  1LW0 B;  4DPO A;  4X4R A;  1FCA A;  3PYG A;  2CPZ A;  1CQM A;  4DXL A;  1RAF B;  3ILL A;  4RW9 A;  1X9W A;  3MMB B;  4RUB A;  1N36 J;  4K4W A;  1FRI A;  2Q79 A;  3MM6 A;  1S1T A;  1S77 D;  2KG0 A;  2HKE A;  5CD4 H;  2JEG A;  1WHW A;  2J9D E;  1AFJ A;  5CAA A;  1Q82 T;  3BS9 A;  5IWA F;  3TAM B;  1HHQ A;  5CZX A;  3TVY A;  3LAN A;  2FVC A;  1WSV A;  3HX9 A;  5DG9 A;  3G6V A;  4GVL A;  1KRP A;  4Y0F A;  3W5X A;  5CYQ B;  1RT5 B;  4NLP A;  2NYI A;  3FBE A;  2DCL A;  3H7H B;  3QRQ A;  2YNG A;  3T3F A;  2R8I A;  3UCZ P;  4H4M A;  3JQJ A;  2ZH2 A;  1R8A A;  4K2X A;  2PA8 D;  3G6Y A;  1RT3 B;  1YIT S;  4J9O A;  4OFZ A;  5KG0 A;  2C2N A;  4EGL A;  1CJU A;  2DXF A;  1TVR A;  2V4Q A;  4PG7 A;  5D4N A;  3JQK A;  2BOP A;  2GO9 A;  3PX6 A;  1IM6 A;  2OGU A;  1XWL A;  2CQ0 A;  5J2N A;  5KAK A;  3QZ8 A;  5A6W A;  1IKY B;  4G1P A;  2GQ2 A;  2NRE A;  1E6Y A;  3ADA C;  2IC3 B;  3KLH A;  3CB4 A;  2D3U A;  3BGU A;  2F9D A;  2V6A A;  4URG A;  4PRF A;  2RRN A;  1N5V A;  5F8J A;  4WFB Q;  1RBO B;  1YKW A;  2V2V A;  4C98 A;  4DQQ A;  3FCW A;  4XAK A;  2WVF A;  1YSJ A;  2I8E A;  4HH1 A;  4B08 A;  3QFW A;  1Q4R A;  1HFE L;  4R0J A;  2YKN A;  1PYO B;  3WZ0 A;  4PZV A;  4DR4 J;  2ZE2 A;  4TN2 A;  2FVS A;  1F2H A;  1NKC A;  3K58 A;  2MXY A;  4DV6 J;  3PXG a;  3O44 A;  2RS2 A;  3QLH B;  1NDK A;  4YR2 A;  1M5P C;  3R5G A;  2BBE A;  3DDN A;  4K50 A;  2MKY A;  4IFV B;  1Z2Z A;  3ZTS A;  2RKI B;  4Y2I A;  3GYN A;  3D68 A;  2LXF A;  3SEO A;  1H72 C;  3TW0 A;  2YNH B;  4JI0 J;  4W92 B;  2UXC J;  3W2W B;  3EDR B;  1XIQ A;  2CJQ A;  1FRX A;  1TL1 B;  4HDH A;  1E6V B;  4H4K C;  2XSJ B;  2HK2 A;  4JBC A;  2MHE A;  4ZP8 A;  2M5Y A;  1S59 A;  2XY6 A;  2LVW A;  4RU2 A;  1CVJ A;  3IBW A;  3R2C J;  1RE1 B;  4P71 A;  3CDW A;  3VAJ A;  3DM2 B;  1DQ8 A;  4RW7 B;  2GC8 A;  1RTZ A;  1HI0 P;  2C3M A;  3N79 A;  4DSK A;  4F3M A;  5B0D A;  3MR3 A;  1Q78 A;  2ZC4 A;  1R43 A;  1S0V A;  3CUL A;  3NCR A;  2FLP A;  1UCN A;  1WI6 A;  2DGO A;  3MTJ A;  2HVD A;  5LSR A;  3LGN A;  3AD9 C;  3OL8 A;  3D2W A;  2Y8W A;  4PXD A;  3OFG A;  3V4M A;  2V0N A;  2VF3 A;  1U45 A;  4DZD A;  3I6P A;  3Q8P B;  4XDD A;  6FD1 A;  5KFZ A;  2RDD A;  4MTP A;  4NRT A;  1EKS A;  4M5D B;  1FXL A;  2W9A A;  2VL1 A;  3BDP A;  4YS2 A;  2DGQ A;  4LFB J;  2W9C B;  2N3L A;  3C8Y A;  5KT7 A;  1RUS A;  2AX0 A;  3KLE B;  5H9F K;  4ZLL A;  3AFG A;  3HKW A;  2AIR B;  4TY8 B;  1J5O A;  2BQ3 A;  5L1K A;  3PKY A;  2BAB A;  4CTA A;  2IIH A;  2KHD A;  1QAY A;  3J7Y I;  2GQC A;  1M1H A;  2M70 A;  4OIX A;  1EP4 A;  2G9O A;  3HSG A;  3SFU A;  4DCP B;  3BSA A;  1B7F A;  1APS A;  1AYE A;  3Q2T C;  2VFR A;  1JJC B;  3MPD A;  5G0R A;  1T9X A;  1UVM A;  3M2U A;  3R5C A;  5A8K B;  2JHE A;  4ED3 A;  1X31 C;  4RO0 A;  1X0F A;  4G1Q A;  4QQB A;  1JNR B;  1ZA2 B;  2E44 A;  1FNX H;  1TL3 B;  2XZW A;  2G2Y A;  3HCX A;  4WP9 A;  3QAU A;  1UA0 A;  2YWW A;  1KLM B;  2HMI B;  3CCZ A;  3VAH A;  2G1D A;  3JYT A;  2B51 A;  2DIS A;  3HDS A;  1D09 B;  1MN9 A;  3BYP A;  4O3S A;  2NXJ A;  2V8D A;  2F8M A;  2QTW A;  2FJA B;  4QPT A;  4YEA A;  3R3T A;  4ICL B;  4M63 A;  2LU2 A;  3UI3 A;  4RL1 A;  2PGC A;  2W9B B;  4DSE A;  2MLX A;  4XIU A;  3QO9 B;  3JAM U;  2VV5 A;  3PR5 B;  2E1C A;  3VR1 A;  3THV A;  3FMB A;  4NXM F;  3IS9 B;  5AXN A;  4PYD A;  1S6Q B;  3QSY B;  3CD5 A;  2GMJ A;  2BAN B;  1R8H A;  2C3U A;  3UPF A;  1H98 A;  3NMA A;  4DR5 J;  1R0C B;  4NI2 B;  3FJ2 A;  1RIS A;  5DDR C;  4E98 A;  4I2P A;  4BWJ A;  2I38 A;  2POK A;  2H65 B;  4LF9 J;  2HS3 A;  2C3Y A;  1HBN A;  5I42 B;  3RZA A;  2UZA A;  4K4Z A;  5DJB A;  3M1V B;  1RHM B;  5KOW A;  1Y00 A;  5L9X A;  1Q8K A;  2UP1 A;  4H4K A;  2GVD B;  3THT A;  3VAF A;  4Q44 A;  2OFG X;  4USI A;  3MEE A;  4MK8 A;  1A9N B;  2AF6 A;  3MM9 A;  3RRK A;  5A8W B;  2YKA A;  3IR5 B;  4M5I A;  4PR6 A;  5K8N A;  1YJT A;  1PG5 B;  1G3O A;  1I51 B;  1P27 B;  1VYA A;  2FIU A;  4KIA A;  2E7V A;  4X66 F;  1ZOT A;  2XSF A;  5GVQ A;  2MGZ B;  3BKT A;  4FVC A;  3CF5 Q;  2DRA A;  4ILL A;  4DQP A;  2VG5 B;  1NAQ A;  1SCJ B;  3DHX A;  1U6F A;  4OV6 A;  3HSJ A;  1TKZ A;  3LP1 A;  2HGN A;  5E0O A;  4CYU B;  1TZ0 A;  1JLQ A;  1H7W A;  2BJ7 A;  2IAJ A;  4UUX A;  1LW2 B;  1WC0 A; 
#chains in the Genus database with same CATH homology
 2BJ8 A;  3QSI A;  2HZV A;  3BKF A;  3PHT A;  3BKU A;  2FGC A;  2CAJ A;  2WVB A;  2BJ9 A;  1Q5V A;  2Y3Y A;  2BJ3 A;  2NZC A;  2CA9 A;  3BKT A;  2BJ7 A;  2CAD A;  2WVD A;  1Q5Y A;  2BJ1 A;  3LGH A;  2PC6 A;  2WVC A;  3OD2 A;  2HZA A;  2F1F A;  2WVE A;  2WVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...