3QSIA

Nickel binding domain of nikr from helicobacter pylori disclosing partial metal occupancy
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
ESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords NikR nickel-responsive regulator
publication title Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 19
structure length 80
sequence length 80
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3qsiA00
2F1FA 2BJ7A 3LGHA 2BJ3A 2HZAA 2FGCA 2Y3YA 2WVFA 2WVEA 2NZCA 1Q5VA 1Q5YA 3PHTA 2WVCA 3OD2A 2CAJA 2BJ8A 3BKUA 2WVDA 2CA9A 2CADA 3QSIA 2WVBA 2BJ1A 2BJ9A 2HZVA 2PC6A 3BKFA 3BKTA
chains in the Genus database with same CATH superfamily
2RDJA 4FXVA 1NK7A 2RRNA 4MKYA 4KFBA 2BBEA 3DGVA 2EC0A 3F41A 2DRAA 1RT2A 3M2RB 1N88A 1FDAA 3ILIA 2UXCF 3E51A 1FKPA 1U2CA 2EK6A 4DV5J 3AD9C 1M1KT 2CQHA 5JVGQ 1R7IA 3OSPA 1TR0A 1JXVA 2DHGA 1M5KC 4TU9A 3KJVB 3VALA 3FQKA 1E6YA 4UZBA 4DR4F 2EFQA 4HACB 2XY5A 3IWLA 4P2FA 4DV1J 1LOUA 1M5HA 2MKIA 4ZVEA 4Y2IA 2ABYA 2D3OR 5CD4A 3CJ3A 3ILLA 3UW1A 3ZTPA 2ROPA 2ZJQQ 1HNWF 3NL0A 4K59A 2F40A 4R8UB 2BJ9A 3QQCD 2V0NA 3UN5A 4O23A 3OR1B 5B09A 2K8GA 3EZOA 3CE8A 3WC0A 5JMNA 2FTRA 3H2VE 4JB8B 4B9VA 1XWLA 2D7SA 4BC9A 4DLGA 1RDRA 4X62F 3GIKA 2J7WA 1QAYA 4B9LA 1S7HA 2F8EX 2HVIA 4PWUA 4KO0A 3IG1B 3OVAA 3SFGA 1XNRF 2XWXA 1EB0A 1YJUA 2WONB 1PCAA 1FRLA 3MR3A 3QO9B 1IKXA 2ASLA 1FKOB 1PBAA 4DV2F 2KFZA 2FVRA 4NMXA 3TVYA 3BSOA 4U96A 4BBYA 4OZ1A 4N41A 1JMTA 5HQMA 3R5JB 4I7FB 1NSKL 2QA1A 4KQZA 4PCQA 3UWTA 3I0SA 3GILA 4HEA9 3SBMA 2L9DA 2ZZMA 2JVRA 3KDOA 3DU5A 1GEHA 3CF5Q 1KTVA 2M3DA 1PILA 4GRSA 3MPVA 2CPXA 2BJ3A 4USJC 3SDEB 1Y00A 2GIRA 1TUVA 4M5KA 2KZMA 4OHYA 1LEOA 2HNYB 3MM9A 4D3HA 3FRZA 1C4CA 2DIVA 2IDLA 4NI2A 3OLAA 1UA1A 4USKA 5HBMB 1RTHA 3T1HF 4C8KA 4I69A 3TX0A 1HR0F 1QSLA 1HQEA 1EQ0A 1UZHA 3GCWP 3HJVA 1UFWA 2NQPA 1NB2A 1VQMS 5HATA 2AGPA 2ZJPQ 1B4SA 2ALYB 2ZVSA 5CCLA 2GVDB 4DS5A 3SXLA 1NJZA 3TAPA 3JAMY 1X4EA 2QSFA 5KFBA 2GIFA 4R5PB 2VG6A 2Q79A 3MUTP 1PJ5A 4NCGB 2RF2A 2UVRA 3CC7S 2XGQA 1QD1A 1UCNA 3G86A 2XG8A 2W2PP 2I6WA 2K3IA 5KT5A 3KK3B 1APSA 1DURA 5GAGU 3A13A 4E2FB 2B4PA 1JIHA 5DRKA 3BV8A 5AT1B 3H4BA 4I6WA 5F8GA 3MHYA 2Y0SD 3MEDB 4USWA 4WP8A 4USMA 3FNNA 1S1TA 4LQ3A 3C8YA 4RWWA 1F0XA 1X0FA 1K1SA 3UDVA 1EZZB 2E9ZA 2ROGA 1S10A 1RHMB 2VBZA 2N4CA 3ITHB 3PX4A 2C2KB 3PO5A 4N77A 1FK9A 4O3OA 1TK5A 4RBUA 1SH2A 1S79A 4XK8C 2V94A 4Q5VA 3EPIA 5EN1A 2G13A 5EGYA 3EVMA 3W61A 2EVZA 3K2YA 5CABA 3W2WA 4PR6A 1OJ4A 4HI1A 4Q7AA 1SV5B 3KLHB 1U0SA 2ZZTA 1FX4A 4YDDB 1ICEB 1KOOA 4I4BA 4EMDA 3CDBA 4ED0A 1H7XA 1HBNB 4N8OA 4PEOA 4ECRA 2OEKA 1JLEA 5F8HA 5L9XA 3V4IB 3UCGA 4WFAQ 2OPRA 3E2EA 4KV8B 2MKHA 3SIPB 3D0IE 3CSKA 4LT6A 1L3UA 2KXFA 4OFZA 2LLZA 2Z2ZA 3P8BB 1GX5A 1EP4B 4UZCA 3W63A 1BQNB 1U1MA 3MAHA 2WW4A 1VQ4S 1JLQA 3W9IA 1VQKS 1OY8A 2LVWA 3OUYA 1IKVA 2DXEA 1X4BA 2ZH8A 4AFFA 3TR5A 5E3AA 3PYGA 1LW2A 1HQUA 3GR1A 2DGXA 2XS7A 5MAOA 2DK2A 3AODA 4C0BA 2R7WA 3MDFA 4Z2XA 2N4DA 4C2MA 5E7OB 4QPXA 1PJ7A 4K4YA 3DOKA 1ZAWA 4A8SA 2BV3A 4DR3F 4KH0B 2RU9A 2OO4A 3H2UB 3KUEA 3OFFA 4L74A 1FFGB 1RAJA 2HFZA 2EG2A 2YKMA 3M6WA 1O6XA 2D3ZA 4DV4F 2HLTA 2HZAA 2FC8A 2N82B 1HWKA 3BBCA 3Q86A 3DM2B 2UUAF 2ZM6F 3EGVA 3A12A 2YKQA 2JZ5A 2DY1A 2LQ5A 3W9JA 2ERRA 3AAWB 4LJMA 3MM8A 4RLEA 5LMUJ 1H38A 3M30B 3D6HB 2VDIA 2DD8S 2PE8A 5A8RA 1TAQA 3MEEA 3BQ2A 2CPFA 1RISA 2M8DB 3UVJB 5DO2A 5ETRA 3JTOA 1SJ3P 1Q1KA 2EPIA 2VICA 3CB4A 3M8QB 3W64A 2ZE2A 2XHWA 2CJXB 1PGZA 4WIIA 1UZDA 4OZ0A 4DR2J 1N36J 4A47A 1HHTP 3DU6A 2NPFA 4KPCA 1VR6A 3F56A 2MLXA 3NGRA 3MAAA 4CYUA 4PKDB 2W4PA 4OX7A 3MCMA 2OD4A 4IOCQ 2R7RA 3VAIA 1C0UA 4CO3A 2XYGB 4DQSA 2AX0A 2D1CA 2DRBA 2QA4S 1QAXA 2HHWA 1FESA 3UCZP 3KK1B 2FZKB 2GHPA 1JNRB 2E29A 3BQ0A 2ZBPA 4B3MF 3DRRB 2OMLA 2OUGA 3THTA 2B43A 3GCXP 1UVJA 4Q44A 2WOMA 4BCAA 2WVFA 2X1AA 1OMSA 1UW9A 3MPDA 4CWBA 3D4JA 4JI0F 3DGPA 2KFYA 1RHUB 2GGPB 4JI6F 1A6LA 3M05A 4KHMA 3OW2R 2KKHA 3BGRB 4LR8A 5HI7A 2EG1A 1Q82T 3JSMA 3J7YI 4KJIA 1LK5A 1V5IB 2BQRA 3R2CJ 1S57A 3K5OA 3WZ0A 2W24A 5L8RC 1V3ZA 3TVKA 3NP5A 5F41A 2YNIB 2H4WB 1VQOS 1EJ7L 1HNZF 2PT0A 4I2PB 1SJ1A 1RA6A 2KXHA 2LXIA 1VQYA 1HYSA 4NXMJ 2VASA 1LWFA 4UOHA 3FZBA 4NLUA 4B3RF 1MROA 3QPIA 4C98A 2J6TA 3OR2B 1HBUA 4ZPWR 1QY7A 3CCES 4OHVA 1TMMA 4MYTA 4GVBB 5DLGA 1SJRA 2CDQA 4YY3F 1ZTTA 5LT5A 1SH0A 1X5PA 5IT9Y 2KG1A 3DLLQ 2FY8A 3LP0B 3V6JA 1BY9A 4DOZA 3HDSA 3Q8QB 3LUYA 3IGVA 1C1BB 3OD2A 1XC9A 1N5TA 2G1HA 2VFTA 1VQLS 4O3RA 1XMOF 4BLGA 2OPPA 4ZJQA 3KLEA 4C9DA 3EWGA 4KGKA 2DPJA 1OYEA 2DGOA 3ULHA 2KU7A 1RT4A 2AWZA 5T41A 4PXDA 4LF7J 1AT1B 1S6QA 1X9MA 2DH7A 3D3BJ 3PM9A 1VQ9S 5KG0A 3PVXA 2BE2A 4OZNA 1CJTB 3IBWA 3NWGA 3EGWB 3UNGC 1KLMA 3DLKB 4E8UA 3C3LA 3J7ZT 1F9EB 1T0TV 5HL7Q 1JLFB 1EQMA 3PYFA 1OS5A 1VC6A 3R7NB 3J81Y 2E5IA 2BJEA 2GS8A 2HS4A 5LL6d 4OI6A 4AL5A 2DPIA 1L3SA 1Y5IB 1UWBA 5KT7A 2FIUA 3OSNA 4HI2A 3KLFB 4C48A 4M1KA 3KKFA 4J9RA 2GNKA 4QIVA 4G1QB 4LR9A 3SFUA 3BYRA 4K2JA 2YKPA 2QJ3A 2D74B 3Q2TC 4KH1B 3ISNC 5KFPA 3FCWA 4ZPAA 2E44A 2PGCA 4DL7A 1CEZA 1DTTA 2HVHA 1U25A 2MSSA 2NYHA 4JI1J 3QLHA 2YNHA 4WP3A 2KVIA 4NLGA 2A6MA 2H5EA 5L38A 1XERA 4ZPVR 2K7JA 4CLYA 3FSIA 1REVA 2RNEA 3MWBA 2OAUA 3ENAA 2CJYB 4DR6J 3NGTA 2DNYA 1LW0B 1YWXA 3WBZA 4KBIA 1RYSA 2DCUB 3ZZOA 4N56A 3CD7A 2DBBA 4OYAA 3FCHA 1VHIA 2EBEA 4O3QA 1EETB 5GMDA 3TAMB 1HW8A 2DEIA 1YZ6A 4LF4F 1T8EA 4DR1F 2I9SA 4K7QA 2RT3A 3I96A 5HSPA 2DR5A 2C2OB 4P10A 4KAIA 4IOAQ 2A3JA 3M8PB 2BKNA 1DLOA 4OZJA 1URRA 4X66F 4MK7A 4LFAF 1TKTA 5HROA 2MDAA 3HO1A 4KY3A 4B3OB 4DQRA 2OGUA 4M5MA 1WHWA 2M52A 3ADAC 2W7OA 1SL1A 2HG4A 2HPUA 4DL3A 2RQMA 1GK8A 4NLXA 4WFXA 3R5BA 2FHKA 4IH6A 5GMKa 2NPIA 4DG1A 4O4RA 1RT1A 4URQU 1JKHA 3LGHA 1RU2A 3GQCA 1YI2S 1CLFA 2K3KA 4HDHA 2Z8QA 1RTIB 3AT1B 2P9EA 1RCOB 3MUVP 2HQDA 1B0TA 1X4HA 1YQHA 4NCAA 3GONA 3PRBA 4DN0A 3CJKB 2AEMA 3VF0B 1I3OB 4I2QB 2DGTA 2DO4A 5CZXA 3AHPA 3NAIA 4K0KJ 2HFOA 2RQ4A 1WC1A 3GU0A 3P6YC 4RW4A 2XLIA 5CYMB 4EZ6A 2CQIA 4JI7F 1PYOB 4QBUA 2GAHC 5CHCB 4ZS6A 4TLRA 4AL6A 2GA7A 4RW6B 5CD4H 3TJAA 3MMCB 5C7PA 2VQFJ 5ADZA 2POKA 3VZHA 2HAIA 3RYLA 1R0AA 1IKYB 1NSAA 2IMOA 4KE5A 3ZFVA 2G2YA 4MT1A 3QGIA 4JI8J 1U1LA 4H4OA 2UUTA 1QDUB 3T6BA 3CD0A 3JTNA 2GW8A 1N33J 1N32J 3RG6A 2XMUA 1UA0A 3OVSA 4M5DA 4CH0S 2C28A 1RKJA 3V2UC 1L3VA 4MK8A 2KTQA 1F2GA 3P96A 1ZZFA 4Z7YA 5B0DA 3PJWA 1L3TA 4FKYA 4DV6J 1V9OA 1KC8T 3DRSA 2JWNA 1VQPS 3HHNB 5H1SV 1V6HA 2J9CA 3X3UA 5DQGA 1ZS6A 1DQAA 4YB5A 3TJ9A 3GE9A 3X1LB 4F25A 1BC6A 4L76A 4OYOA 4IQXA 2XWYA 5CAAA 2LQ8A 1YRTA 1LFPA 1DBDA 4K4SA 3IR6B 1VIXA 2FC9A 3KLVA 1N6QA 2E7WA 4J9UE 2DB1A 3PW0A 1U1NA 2G9OA 1RXOB 3RB6A 4B3TF 2CWKA 1WC6A 3JQKA 5M2PA 5HO4A 2FJVA 4RJVA 4NLSA 3CGIA 3H90A 1S7IA 1ZAVA 3HXMA 4LRAA 2HQGA 1L5UA 4KGZB 4AL7A 2RAQA 2JEIA 1RTZA 2F7VA 1RT2B 2XMKA 2WTFA 4PWDA 4DL2A 2CQPA 1SQGA 2C3PA 2W9CA 3ISZA 4ZVFA 3HVTA 3EE3A 4KKOA 3QRQA 1B99A 2B7CB 2I5JA 1M5VC 5L39A 3P45B 1NPPA 2CJKA 1RUSA 4U6PA 5E3QA 1KQFB 4BHQA 2DR9A 3H20A 1X5SA 4UOFA 4DEZA 1JX4A 3BREA 2X51A 1E6YB 4PG7A 3N01A 3PHTA 3NRBA 2VJUA 2MQQA 2GFFA 3H42A 1WG4A 1KVKA 4CLKA 2FJXA 4L3KA 3MI7X 3I4HX 4DU8A 2BQ3A 4X4SA 1N5YA 2M70A 2C2DA 5I42A 1FJCA 2AYGA 2E7VA 1Q8IA 2WZ1A 1U4BA 1R0CB 3MF5A 5HLFA 4LUBA 2V5HG 4CLWA 2QL9B 2Z57B 4RNHA 2YKNB 1U45A 1SVDA 2UVVA 2HNZA 3BS9A 1CVJA 4ECYA 5G4DA 4ZP6A 3GIIA 1UFLA 3H2LA 2HNDA 5HVFA 4J9MA 4KO0B 4FBTA 2A10A 4QU7A 4ECWA 2FDNA 1U1KA 1NPKA 3OTOF 2CQBA 5A8KA 2QA4G 1Q53A 4P2MA 2PEBA 4RU9A 1IKXB 4WWSA 2W7AA 3P3DA 1VJQA 3R5CA 5ETQA 2Z2LA 3Q0AA 1X8DA 2HK3A 1RBOB 2BANA 2H5JB 2E66A 4CI0B 2DHAA 4H4MA 1HHSA 4CO0A 1YRXA 4K2XA 3AXMA 3N28A 2XMTA 1RAEB 1FDNA 3RW6A 2GO9A 1S49A 3ZZPA 4EZ9A 3I0SB 3FEZA 4XO0A 3HFVA 1ZM2A 2D3O1 2HAFA 3EXYA 4WKYA 4ES3A 3DXBA 2KM8C 1VBYA 3RRGA 4IG3A 1VBZA 2KL8A 3R5DA 3AOCA 3DRPB 3TRGA 5DS7A 3S1TA 2AEFA 1HNVA 1JWWA 3M8WA 2RQKA 3A4TA 1RHRB 5LMNF 2ZBCA 3MM9B 2DRDA 3QAEA 4NI2B 2PEHA 5IQQA 2VG5B 1RTHB 1Q8LA 4O0NA 4NXNJ 4RW9B 4CO2A 2FGOA 5F9LA 2IVFB 1N54B 3DI6B 1HA1A 2XQCA 5IOLA 1HQEB 3QFHA 4CLLA 3WX8A 2G0IA 2ZEJA 4NLYA 4PQAA 1FDBA 2A6OA 6AT1B 4F4AA 4CP5A 4EO6A 3AJ1A 1JLBA 3P49B 1SC4B 2Q43A 2J0SD 3W8GA 4YB7A 4DFKA 4YN3B 1N56A 2OH2A 1TZ0A 4RNFA 3A8EA 4OX9J 2MY7A 3T9NA 3NNCA 1I5OB 3JAMU 5AE3A 1NAQA 1NPRA 3IRWP 2LECA 1JXEA 3TP2A 5D0GA 4P52A 5DLFA 2O66A 2HS0A 1H74A 1Y10A 2WK4A 4CDIA 5KFUA 2MHEA 3AD8C 3UI3A 1VK3A 1HARA 3W9HA 1B7FA 2DO0A 3EUNA 1F5AA 2BKOA 2RF2B 4CLFA 1IBMF 1TP7A 1XK8A 3FC9A 3RR8A 1U6ZA 4IR9A 3MOZA 5IWAF 3IS9A 1J5OA 2EEYA 2LQBA 2V8GA 1C0TA 1UTAA 4OZ3A 4DSJA 1GXLA 4K4XA 3OV7A 4HT7A 2J0WA 2JLFA 4CLSA 1G7CB 3JQMA 2KRRA 1WSRA 4ZP7A 2RB7A 3NCRA 4Y2AA 2MKYA 1FWPA 3JQJA 1EKSA 3CC2S 1N34F 1I6JA 5I3UA 4R8UA 1P1LA 5F8NA 2VFRA 2ZHBA 2ZDOA 1OY9A 4Z37A 3MM7B 2NZ4A 3RAMA 2DNZA 5DDRC 2CJ9A 2OJ3A 4JI4F 1SXLA 3RB4A 1NUEA 1TTHB 2R7OA 4OJ3A 5KFHA 2IHR1 3HHKA 4AD6A 1IR0A 3N4WA 1ELOA 1R8CA 3Q8SB 2X1BA 3W2WB 2F8HA 2P6SA 5F9NA 3KFWX 4J9PA 2IBOA 3OL9A 3JYTA 2PIIA 3QO9A 2J6UA 4G3IA 2ZWOA 4X4OA 3GIRA 2CJAA 4AQYF 2BJ7A 4ED6A 1JLEB 3BF4A 1S6UA 4I7FA 2HWTA 2DNPA 3VAKA 2YX7A 4OYXA 2B3TB 2CQ4A 1OQ6A 1S99A 2OPRB 5BYSA 2VONA 1M1GA 2PD1A 1RAAB 3FBFA 3EMTA 2DNLA 2HQ3A 3U02A 1HMVB 1YLXA 1FJEB 1B0VA 1JLQB 3OUYB 2LA6A 1IKVB 3AJDA 3MMJA 3AQOA 1RHKB 3DC2A 3NS6A 3BKFA 1U7LA 3JXOA 2L41A 2HNYA 4DF8A 1W2BR 3HSGA 2ZD1A 3IBCB 3H98A 1DQ8A 1GT8A 2FGCA 6FDRA 3IAS9 3CCTA 1JJHA 1UVLA 3VV2B 2CPYA 4F4YA 3DOKB 1WEYA 2JFKA 2MTLA 3L7UA 4IH7A 1HBMB 2EBGA 3C16A 2EFOA 3MEKA 5IM0A 3ZO7A 1DY3A 2C2RA 4B9MA 3DRYA 1IN0A 3BR8A 4TNOA 2KHCA 2AP6A 3MURP 4L72B 2VDHA 3OTEA 3W3SA 4A46A 4HTIA 4OJ1A 4R5PA 4ETZA 5E5NA 3ZTOA 1KNZA 3ETMA 4PZVA 3B54A 2IJNA 1BUXA 1NSPA 3ZTSA 3MM8B 3Q8VA 3WX4A 2L9WA 3KK3A 5D78A 2YBVA 3M1VB 3PKYA 1U24A 5A8RB 1Z2ZA 5H9EK 3MEEB 3HVRA 2M88A 3G6XA 2CZ9A 4DFJA 1NKEA 3I56S 4ECQA 2ASDA 2ZE2B 2DNHA 4XAKA 3MD1A 4RNNA 3SMZA 2Q66A 1GMWD 1QVFR 1W26A 1FJGJ 3FMWA 1SJFA 1WF0A 4EYHB 3MAAB 4DHVA 2CQ3A 2AMCB 2BEFA 3CJ5A 2F9DA 2BM0A 4CYUB 3CD5A 4F0MA 4B02A 4EBCA 2D69A 4KHPF 3QGPA 5GAGI 3BSAA 1C0UB 2MKSA 3TNVA 4RWXA 2WAQD 3AB2B 2CKWA 3QWPA 4ZVOB 2D3UA 2DXFA 1LNQA 3Q8YA 2Y1IA 4FF3A 1ZPWX 4K4TA 1HIYA 4YR3A 3D6TB 3ENQA 1RT3A 4JOUA 3TAQA 1FRMA 1FWKA 5LM7E 4CRJA 2ZBRA 2MXYA 4AXIA 2D9PA 1Q81T 3BKUA 4DWIA 1EKRA 1IR1A 2WOMB 3OJUA 3QJPA 4XPCA 1GX6A 5KFWA 4UY8T 1AXQA 3TA1A 2DH8A 2HVDA 3JSMB 4EBDA 4CLTA 3V4IA 2DGSA 1YSJA 4GKJF 3BH6B 2BJ1A 1S1WA 2MZRA 4KV8A 1KSPA 4IO1A 5G0RA 3K5PA 4LFCF 1F9HA 4C11A 2KYXA 3H5XA 2UXCJ 5BR8F 4UT4A 3M6UA 4M95A 1EP4A 3D66A 1NH8A 1BQNA 5KFEA 1HYSB 2FZGB 1LWFB 1G2EA 1ZM4A 5D4OA 1X4AA 5KFDA 2RRAA 4Q8FA 5E2QA 3BGLA 2MPUA 4K5SA 1MROB 2MLYA 5E3PA 1GTEA 3MEGA 4DR4J 1WHYA 1NK6A 3MCNA 3ISND 2XYPB 5ETKA 3HHLD 3CNQP 3K8WA 5IC6B 3C6TA 5EWFA 1YIJS 2V2KA 4ED5A 4IDKA 4I56A 1HNWJ 5IT9U 2VA2A 5MLCV 1J27A 4EUVA 5RUBA 4ECVA 2XM3A 3TUPA 4I68A 1GFWB 2OPPB 3OL8A 3KLEB 4DUYF 2UUBF 2F9JA 4DSKA 4NX9A 2CQGA 2FVQA 3VQSA 2L9NA 2JRSA 1RT4B 2GJFA 1H2UX 4X62J 1S6QB 5KFAA 2BE2B 2CQ0A 1H98A 1R31A 2UXDF 3CJ0A 2DJWA 1N48A 2KJWA 2QEXS 3V6HA 1XNRJ 2DXDA 1KLMB 4RUCA 2N7CA 4QYZK 3H5SA 3LWMA 2FUG9 2J0QD 4ED7A 1N8RT 3M30A 3J81U 4DV2J 2OTJS 4ZVPB 3HKZD 1WOPA 4EU0A 3W2VA 1W2IA 5HJXA 3SEOA 1T11A 1UEKA 2W1BA 2WBRA 2NREA 1DARA 4QW8A 5J1EA 3K5MA 1ZYQA 3VZIA 2Y9HA 4YDXA 3JB9k 1MLAA 2R4FA 2NUHA 2P5VA 3BBBA 1AYEA 1NDPA 4NLTA 4QW9A 5FJ4A 4FS1A 3NGSA 4ZVUB 1HI0P 4IFVA 2YXLA 4LIWA 2VC1A 1DTTB 3QT7A 1RWWB 3MPWA 2ZKTA 1UAWA 4ZPTR 2JC1A 1XTZA 5I4MA 4QWBA 1TL1A 4Z7CA 1FO1A 3T1HJ 1MU2A 1HR0J 1REVB 3FZ2A 4ZCMA 2A2DA 2QL7B 3G6ES 2GMHA 3N9UC 4WFBQ 1XBWA 1R8HA 3RGIA 5L9NA 3M6VA 1NZ8A 2DHHA 1UJ6A 3RR7A 2GGPA 2HHHF 1SBRA 2ZNZA 3BGRA 2APOA 2B9XA 3L7OA 5IS2A 2EFVA 1FFSB 2OD6A 3D68A 1FF2A 1MWQA 1IUJA 2V4QA 1T9TA 2CPDA 2E5JA 5HJYA 1BWEA 3OVBA 1JJ2R 2W2QP 2YY3A 3NY0A 4I2PA 4LSLB 1VJWA 5A8WA 1QSSA 1Y4ZB 4NL5A 1U6BA 3W8PA 3QSIA 4OHZA 4CLPA 1DLOB 3VTIA 4G65A 3SSQA 4B08A 4NA1A 5E3RA 1CG2A 2MJNA 2WB1D 3K58A 2BKPA 4NCBA 5HROB 4DCOB 2R9LA 2KH9A 1UETA 2B4OA 3A8KA 2JEJA 2CJBA 4U9RA 3RU0A 4YR0A 1Z4UA 1FNXH 2PFDA 3RAQA 2JEGA 3THPA 2X1GA 2JHEA 2Y3YA 4C8YA 2MQ8A 2VG7A 4DG1B 2UXBF 4PPDA 1WDTA 3H8YA 1JKHB 4FS2A 4O3PA 4OYIA 1REGX 2AZ3A 1VBXA 2R7VA 3IN5A 4WIQA 1S1UA 1IBKJ 4YQWA 2CFXA 5HMWA 2ILZA 4Y2MA 1C1BA 2YWGA 3G6YA 2LKZA 3A1YG 2R2RA 1RT6A 1FXRA 4WKRA 2XNQA 2F65A 3FGVA 1UPMB 2P9GA 5F8LA 4YHHF 5E41A 4D3GA 2OI2A 2B8QA 1RLCL 2EFPA 1CJTA 5J2NA 3IC1A 4FN5A 5L1KA 3A3PB 3NLCA 4RW4B 2YX1A 2KT5A 2WRMA 1XR6A 2EC2A 3BO4A 4OZ5A 1RB0A 3DDKA 2E9TA 5EHHA 1B7YB 2NSBA 1T03A 4C4WA 3IGNA 3T6JA 1JNZB 3L3CA 3C2PA 4X4NA 3G8QA 5E3CA 3KLFA 1YBAA 1D9AA 3E01A 4KGMA 1R0AB 4HH0A 3MR5A 4G1QA 2VPXB 5M2RA 3HVWA 1D8ZA 2LA4A 3CCLS 3LAKA 1MMDA 3HM9A 3NBPA 2ZHAA 4TYAA 5LJ5Y 1VK8A 4IH5A 4J9OA 3BDPA 5JUMA 4L3NA 4M5DB 4U7UD 3PKMA 2HBRB 2HBQB 4TY9A 2BE7D 4TQSA 4UUXA 4CNYA 3R1HA 4LF6F 5EUHA 1WEXA 4DX8H 4ZA1A 1I94J 1CBKA 1QE1A 4F04B 4JUZA 3W1YC 4K4ZA 2CIMA 3DRSB 1LW0A 1LFWA 4ENOA 4A8FA 1NHKL 3CCJS 1S0NA 4ATNA 4RPFA 2C42A 4FYWB 5LXYA 4DR3J 2V63A 1S9EB 2IA0A 1RAHB 3CT9A 4FPIA 2VPZB 2AV5A 1S76D 5LJ3Y 3Q24A 1HHQA 9RUBA 3UPFA 1ZA1B 4DV4J 1FFWB 4OI0A 1N6QB 3DLJA 1R3NA 2OKQA 4ZVSB 3HT3A 2UUAJ 3FEYB 2ZM6J 2C2NA 1XMQF 1SIZA 4K50A 2AZ1A 2PN6A 3NNHA 3CCMS 2NS1B 1RHJB 5LMUF 4NE9C 2RS8A 2OEMA 1H2VZ 4ZDNA 1QTMA 4FVMA 1HI8A 2G2OA 3HCXA 2MJUA 5DJBA 4ZJOA 2HMIA 3DLEA 4ZLLA 4B3OA 2BABA 1RGVA 2VQEF 3QNWB 1OO0B 5DGBA 4FXDA 2RHSB 2PSZA 1WWHA 2HBYB 4PWDB 4C97A 2BVZA 3IR5B 4CLZA 3RBEA 1RBLA 5K8OA 3C6UA 2XLKA 3H5UA 3HVTB 2E5LF 3NCPA 4KKOB 4PWWA 2CQCA 2I5JB 4DQPA 4ZMMA 4EBEA 2ZH2A 4C8MA 1T9WA 1RE1B 3HFKA 4CIOA 2ZKUA 1WDDA 3H25A 1GH8A 1X4FA 3ZTRA 4QU6A 3GG1A 3TOQA 4ZPCA 4G6VB 5EX3A 2QN6B 1R0BG 4JV5F 1YBUA 1N5YB 4ID5A 4TY8A 4B3MJ 2IYIA 4HLBA 2YNFA 5I42B 1MWYA 2MLZA 3RUBL 2O5DA 3GJTB 2W4DA 3CEDA 3CJSA 2AKWB 1LWEB 3EVOA 4HHHA 2D9OA 2V2VA 2YQ0A 5HLFB 3ZZUA 5KFTA 4JI0J 3OQ2A 3AY0A 2KRBA 3O6QA 3D6MB 5BYRA 2IC3A 1M5SA 4JI6J 1FEEA 4ECTA 3FJ2A 1NJWA 2QMUB 4NASA 3J80U 2HNDB 3FFIA 3DLHA 3I5BA 3E3XA 1FNMA 5KFXA 3L7PA 1HNZJ 2A0FB 4GMKA 4ED8A 4GO5X 2QMWA 5A8KB 5C24A 2NXUA 4P6QA 2AT1B 3VAMA 2QLXA 3U1LA 5E0OA 3S8SA 1Q78A 2DGUA 4WU2A 3GLJA 3ZZZA 5BYQA 4U7CA 2BANB 4H4MB 2UV8A 3NEKA 1QUPA 4ED2A 3ZXWA 3KUHA 2XI2A 2CWXA 5F8JA 3MR6A 4F3MA 1SJQA 2JVOA 4YY3J 3FRYA 5C42A 1U26A 3CCRS 4LR7A 1TK0A 2H65B 4V1Ak 1RABB 4ED4A 1HNVB 3GPAA 2RILA 2GQ2A 3WHIA 1XMOJ 2FZCB 1P27B 3GMGA 2V8DA 1VLOA 1U1QA 2P8IA 5KFVA 1T9XA 5KG4A 4FVCA 4AUKA 4ZLNA 2XSJA 5DG9A 4UOGA 5K14A 1VS3A 1VC5A 3OTDA 1TK8A 1JLBB 5IQ6A 4V19X 2VHGA 2KFNA 2YQ1A 5ETOA 4JI3F 1TV6A 5B0EA 3C46A 1YRUA 4ZPBA 3SQGB 2HWIA 3EGZA 4WP9A 2HKEA 3CDEA 4N8NA 3KNGA 2KZZA 4YUDA 4CM0A 2HRUA 3K59A 3SCIE 3R2DJ 3CC4S 1GTHA 1KOHA 1FXLA 2QG9B 2RSQA 4PG5A 5J2MA 3E8OA 3DLBA 1EHWA 2A2CA 2W8KA 4ZVTB 2XGPA 4ZLPA 3UCUP 2CPHA 1WC4A 2NUUG 3LPYA 2RMLA 3VAGA 3IS9B 1ZZNA 2IRUA 1J5OB 2LXFA 1C0TB 5DQIA 2ASJA 2AGQA 3QYYA 1ZM3A 3I87A 2EI5A 3M9MB 4DR7F 2HYIB 1XQIA 4MIWA 3ENWA 2HHTA 1HKAA 2V67A 5I3QA 4IOBA 4N7TA 1SC6A 3CJ8A 1BWVA 3BBFA 4JV0A 4TVAB 3O44A 5HK4A 2W7PA 1U49A 3CCVS 1FRKA 1NO8A 3D0GE 1FJ7A 4X2BA 1NRKA 5I3UB 1VQ6S 2YPYA 4X65F 3EVWA 3VGUA 4N5SA 1V3RA 2VUGA 2MQMA 2RJZA 2DGQA 2YKNA 3QT5A 2Z58B 3VVUA 1GQEA 5DZ7A 1KDNA 2Z4PA 3M8ZA 1AZSA 2KJVA 4LF4J 1IWAA 3FDSA 4DR1J 1WC5A 2VBYA 1NHVA 4BC7A 1TVRA 4LBPA 2WB4A 3M2UB 3S7RA 3JYTB 4KIAA 4X66J 3H59A 3FKBA 2HHQA 3UO0A 3CJ2A 1S4EA 3CUNA 1E6VA 3GWCA 3HK2A 3M9NB 4NZ7A 2UU9F 4USTA 5FIIA 4Y00A 3KUGA 5KG6A 4OLOA 4UW2A 3THVA 2J6SA 2DYAA 2IY5B 3HLUA 2DY9A 3UDEA 2R8JA 4UOCA 1ROFA 8RUCA 2GX8A 3DRPA 1TUGB 2F5GA 4CH1A 5GAHU 2RHQB 1JXLA 2H5IB 4NRUA 2M2BA 2VFUA 2PMWA 3VAJA 4M94A 1UP1A 3BSNA 5LOQA 1PSDA 1U1PA 1CJKA 2VG5A 2ZD1B 1PAEX 2ZH5A 4RW9A 5HMZA 2XNRA 2Y1JA 1OPZA 2QO3A 3DI6A 1RCXB 4C8OA 1WI8A 2XO6A 2XB2D 1FTCA 1WF1A 5H9FJ 2CA9A 2CADA 1KHWA 3DFEA 3GJRB 3GP9A 2HRTA 1P1TA 1OQ3A 3C16B 4OI2A 3N79A 5IM0B 4JI7J 4H4KA 3W5ZA 4DL6A 4C8NA 2RD5C 2FB0A 3SV4A 2CXEA 2RQCA 3QIPA 1NK8A 2K1RA 4EK2A 2VB6A 2UV8G 4W90B 1ZOTA 4ZP8A 2OPQA 4DPYA 3TEHB 4A48A 2YKAA 1N33F 4ZCKA 3BGOP 1DAXA 3R7SB 2IM3A 3EICA 3HI9A 4Y28C 4FNHA 1Y3JA 1RAGB 4WXWA 4C8ZA 2HHSA 2HGNA 1LKZA 4A8YA 4PXEA 2B8PA 1XR5A 4OJHA 4LREA 2F4VF 4ECZA 2H51B 3TUJC 1VMBA 2C1EB 4M5HA 1PYTA 4B9NA 4JI2F 2KO1A 2RH3A 3GIMA 1KQGB 2FLLA 2YH1A 4W92B 1PKUA 3QFWA 3QT6A 3MM7A 4X84A 2NCKL 4E0DA 1K1QA 2I38A 2FJAB 1D9FA 4QWCA 3MTJA 4ZK7M 3UDCA 3C15A 2YNGA 4LF5F 3GZ7A 4NEYA 3UDLA 1U48A 5D0RA 4HHUA 4NRTA 2JJ4D 2FVSA 3FMBA 3CCSS 2ZFHA 1RT3B 1J5EF 1ACMB 1UEVA 3A8IA 4B3TJ 1UPPA 3R6GB 2MZ1A 4XPEA 3CCQS 3G2XA 3TZYA 3DCAA 3JS9A 2C2EA 3QMQA 3J81j 1H72C 1HNXF 1RKIA 5KFFA 2GO8A 5IXUA 3FVYA 1S1WB 5G0RB 3SSSA 4C11B 2BOAA 3CIMA 5DETA 3PJXA 1MW7A 2BUNA 3KMSA 1HMVA 2W25A 9ATCB 4F4KA 2Z30B 3DN9A 2ZH9A 2M4MA 2FLOA 1URNA 1FVSA 2QLWA 2VOPA 1TELA 1Q79A 2A1BA 4EFAC 3MEGB 1CS4A 1GXTA 2HFVA 2EK1A 4EGLA 4F4WA 5T14A 4RNMA 4NPOA 3D9BA 3FEXB 1ULRA 4WTOB 1S6PA 3N5FA 1FERA 3C6TB 2RUSA 4KGVB 3P4UB 1PC4A 1BD6A 4DL5A 4IDKB 5KOXA 2YWFA 3BPDA 2H4YB 3MCOA 4DBQA 3GYXB 1WC3A 1SH3A 1FHTA 3TYTA 3GR0A 1HBMA 4RU2A 4Y65A 1X5TA 1AW0A 2ZH7A 3HF5A 1DFDA 3HVAA 3I0RB 4LVOP 4I1TA 3CD6S 3ETOA 4RW8A 2K7KA 5DG7A 4KPYA 4J90A 2UUCF 1SPBP 4MKAA 4USUA 3HD1A 3OTOJ 3C66A 1VOMA 4WE1A 2ACMA 1S1VA 4Q2LA 4C8LA 2DITA 3KJFB 2R7XA 4DV3F 2XMJA 4J7CA 4FF1A 4FYDA 3M1VA 1WUUA 1VRUB 2CNLB 3IBFB 2AD9A 3W2VB 2CDRB 4NZ0A 3G82A 4CLUA 1S5ZA 4OIXA 5J1EB 3RRKA 3I9ZA 1IBCB 5KFCA 3I6PA 4ZVHA 4DV7F 1YJ9S 2MHNA 2IVMA 2FJWA 2HHPA 3F0NA 1U1RA 3AB4B 1UVMA 5CQGA 5T7LA 4OYZA 3BO2A 3DDNA 4IFVB 5D4NA 2ROEA 4X4VA 5A0YA 3DOLA 3HD2A 5EWEA 4P72A 2FJDB 3PW5A 5LMNJ 4KHRA 3NS5A 4CCHA 1U8SA 4OQJA 2XC9A 1VQ8S 1LWCA 1TL1B 4J9LA 2NXCA 1MU2B 1FXDA 1XR7A 2HFNA 1Q95G 2YWKA 2QZ8A 3PXGa 2XBPA 1VQNS 1GNKA 1KN6A 3OHAA 2O67A 2OTLS 3PYEA 3TVZA 2HIQA 1NDKA 3VCDA 5KT2A 1OPIA 3MM6A 2F63A 3CULA 3RBDA 1MWZA 3KLGA 4ANCA 2R2UA 4QIEA 2K06A 1NU4A 2QA2A 1VRQC 5HP1A 2MZQA 3FBBA 2JLGA 2XS2A 3KLIA 4F3OA 2DNQA 3PW7A 3PW2A 1Y0HA 5A8WB 2R7QA 4DUTA 1IBMJ 3IFEA 4YP3A 5IWAJ 2K2PA 3I31A 4RBVA 2AJ2A 4ES1A 3HPOA 4ZKAA 2B5JA 3B4DA 3S01A 1SKSA 3I5AA 4WU3A 1QAIA 3ZZ0A 1NDLA 3PR4A 1T95A 4RL1A 1KRPA 3LPEA 1RWVB 4UUWA 2QFIA 2VG7B 1N34J 3OL7A 3OFHA 2VA3A 3IXQA 1S1UB 3RAXA 2BACA 4DPXA 3ENVA 1PC5A 4WZMA 4NLQA 1RT6B 3OHBA 1RJJA 1M5PC 2Q6BA 4JI4J 4TXSA 2ATCB 3R9LA 3MR7A 2FHOB 3TA0A 4F2RA 2QFJA 1B64A 1IM6A 3I82A 1Y11A 5J2NB 3TARA 1K9MT 3R1LA 3KHGA 2C3OA 3PCOB 3PHEA 1RT5A 3PG9A 2HK2A 3LO3A 2XTJP 1KR4A 1LXJA 1S0MA 3PX6A 2EKNA 3W7BA 2QIFA 4AQYJ 2DVIA 2XY7A 1T03B 3TUZC 1SKWA 2G0JA 2E7XA 4RUAA 3VR1A 5A6WA 1B70B 3E01B 5KG1A 3J7A1 2E9RX 3MAQA 3MFHA 4OV1A 4PUOA 4EYIB 3MMAB 1NJYA 2XMAA 2SXLA 4MFBB 2NYIA 4RZRA 3BZQA 3NBPB 1GAOA 2I1RA 2E1RA 1RA7A 4B9SA 3F44A 2QLFB 2O1PA 1JQGA 1YJVA 2FQQB 2R42A 1TL7A 1H6KX 1YHQS 3UN2A 5BJRA 4NZ6A 2DISA 3EJMA 1NSQA 2JNJA 5L46A 4YFUA 1QE1B 2BJDA 1XN9A 2CPJA 2NZCA 3OLBA 4JI5F 1M5OC 2WVCA 1NHUA 2U1AA 1TMJA 1K0TA 3T5KA 2X1FA 1JJ4A 3RZAA 2QYGA 2IM1A 3MM5A 1UL3A 2JOQA 1FX2A 4DN9A 3DDIA 2LYVA 2ZITA 2HW3A 2MKKA 5CXTA 2Q3PA 3UE2A 1TL3A 3ZZTA 1OIAA 4LF8J 4LSLA 4C0OC 4IRKA 4RKUC 3R6LB 1VHFA 4RW7B 3D1HA 3B78A 3H5YA 1Q8BA 2CAJA 2HMIB 2IJRA 3DLEB 4GVLA 1V3SA 3KTQA 4HR2A 1WTBA 2IVYA 5EDWA 4F26A 2BOPA 1RTDB 4LRDA 3CXCR 2BQUA 5D0EA 1QJHA 2HHUA 2YWEA 2ZVIA 4MKVA 3C6UB 1T9VA 5F0UA 3F73A 1YX2A 3PY8A 2MQNA 1Q4RA 5AXLA 2A18A 4N47A 1SQEA 1VISA 3SYZA 1YZ7A 3CW2C 1Z1ZA 1BLUA 2BJ8A 2AEJA 5KT6A 3V6KA 2QSWA 1N5SA 2LXUA 4ZVQB 2CJQA 3SI8A 4DR5F 1W25A 1HLWA 1KBRA 1ZAXA 4LIRA 1KQKA 1TFWA 2W4CA 1MNEA 3PO4A 2XMMA 2DNMA 4DX6A 2CZ4A 2B4UA 5A2QY 1IBLF 4NLVA 4IG0A 1S4FA 2VU5A 4ID5B 4TY8B 2YNFB 1HI1A 1VLYA 1RHQB 5KFIA 2FPHX 4DSLA 2WW8A 1FD2A 2MSTA 3A3NB 2XS5A 3FBCA 1D1UA 2CUYA 2V6AA 2VFSA 4HL9A 4ILRA 2N7YA 5LSLA 2IC3B 2FYXA 2COLA 3CJRA 5CYJA 1WELA 2Q1LA 1VYAA 3FFIB 4GKJJ 4I64A 4B17A 4LFCJ 4WF9Q 2QLJB 2BMBA 5BR8J 3GIJA 2LQ9A 1QSYA 1VIOA 3KNAA 3POTA 5C24B 2W8LA 1TAUA 3KDNA 2OPSA 3UN3A 3U7JA 3IP0A 2ZBIA 4K4WA 4CT8A 3CPWR 3M2VA 3I9V9 5D0HA 6FD1A 4X4UA 5LXRA 4K4UA 4LRFA 4NEZA 3OFGA 3Q8UA 4HTJA 2R2SA 1G1XA 5GMEA 4Q0BA 4WJBA 3PX0A 3H40A 1JB0C 5C42B 3ILJA 1CQNA 5F3TA 1S9EA 1F6TA 3I4PA 2H3EB 4CM2A 2YH0A 5J2PA 3LQVA 3LW5C 4DUYJ 2Y1RI 2UUBJ 3AOBA 3HJFA 1LV5A 4RNOA 2AW0A 2HURA 2R8HA 4DZDA 2B9WA 2XSJB 4ID8A 3C14B 3RBXA 4IKAA 2HGMA 2UXDJ 2KT3A 1JLGA 1KEKA 1I1GA 4PG4A 5K14B 3LP1A 2FY1A 1U47A 4P2SA 2GJIA 3I32A 4KGXB 1JLAA 4FXWA 2AJ0A 1NEEA 1FT8A 4ZOSA 3SQOP 1TV6B 2DNOA 4ZLJA 2GJ2A 4ERDA 3KYLA 4OLPA 2D41A 1WD6A 1ZH5A 3TX8A 4FDFA 5B0CA 3QGHA 3GB0A 5J2QA 1H73A 4LSNA 4DCJB 2KYZA 3OL6A 5J2MB 4QQBA 4A8QA 1QAJA 3AA8A 4LF9F 1LWXA 4X4RA 1M90T 4G1PA 2V2ZA 4LVNP 1H2TZ 2AHOB 4OI3A 4J9SA 3PIOQ 1WACA 3DKDA 3N5BA 4P73A 4JV2A 1S1XA 4F7VA 4FYXB 2X3GA 3K7RA 4QWEA 2DR8A 1Q7LB 2Y8WA 3WQPA 2DGWA 1IJFB 2MZSA 4F36A 1LWEA 4DPTA 1R27B 4B3SF 1NCLA 1U02A 2J8SA 1X4DA 1YKWA 4CQ1A 2LQJA 5I3PA 5A6PA 2HHHJ 1YVFA 3K5NA 4ELTA 4DV0F 5AXMA 3BDEA 1AROP 5B08A 1H3DA 2R8GA 1AZSB 5BXIA 2E1MC 2MEWA 3VAFA 2JSXA 3AOAA 1TVRB 1F3VA 3Q83A 1S12A 1GMWA 5EWGA 4MH8A 3UQSA 1IR2A 4LFBF 3BGFA 3Q22A 3KHRA 1TL5A 2CG4A 1NH7A 1ZM9A 5CCMA 5FDLB 2HS3A 4M5NA 5ETMA 5FLXY 1E6VB 3EZUA 2V2QA 1XNQJ 1TFYA 5F8MA 4ITSA 2YKOA 2IM0A 3TQ1A 1SL2A 4ICLA 1KVJA 4YS2A 2U2FA 4UQGA 1IBKF 2X7IA 2XSFA 3G96A 3W62A 2UXBJ 3BYPA 4TN2A 4ER8A 3Q23A 4DU7A 4E98A 4V19J 8ATCB 3GJSB 3ZTQA 3N0VA 5HVHA 2ZC4A 2RS2A 3ONQA 3QGGA 2UZAA 2H54B 2GQQA 2MY8A 4QIWD 1CJKB 2VKZG 1P6TA 4P75A 3NOGA 1P9QC 2HFUA 4YHHJ 3GFYA 3GYGA 2Z2YB 2JEFA 2I2YA 5FD1A 3W5XA 2G1DA 3AJ2A 4OYBA 1Q8KA 4Y34A 4QIFA 2IIHA 5K8PA 3GFZA 1T05B 2QE5A 3NCQA 1L3KA 3GFXA 2VV5A 4IFYA 3SQGA 5HMXA 3J7Z5 2W2NP 3QIPB 4IUFA 4YEAA 3PNIA 2K1RB 3NXZA 2H48B 2P2CB 4A8KA 5LSRA 1SCJB 2M8HA 3HHLA 3EZ5A 2OPQB 2HVZA 1EX8A 1N5VA 5DDOC 4CTAA 4DUZF 2BE9B 3M6XA 5K9FA 3TZWA 4RX6A 4J91A 1RYRA 1T9UA 3IMQJ 3QRPA 1S97A 2KDOA 2VL1A 4QZVB 3M8RA 2XCPA 4A8WA 1A0OB 3DOMA 3Q8PB 5AJ3F 1NZAA 2DTJA 3D0HE 1I94F 1NK4A 2LDYA 1WG5A 1RLDA 4LF6J 4DSFA 3BSCA 2PDAA 2ZUGA 5JJBA 4KSEB 1PAUB 5KFQA 2Z56B 2BRKA 2B9YA 4F0KA 2CVEA 3KG0A 2M9KA 3PRDA 2OLWA 1ZPVA 3C15B 2RU3A 2YNGB 2C3UA 4DCPB 3ZZYA 4HYKA 3US5A 4X64J 3R3TA 1HWIA 2FHMA 3ZC4A 2GMLA 3PEJA 1YBTA 1XMQJ 4X4PA 3M2UA 1CULA 2RDDA 4DSIA 2V34A 1JLCB 1CPZA 3QJLA 2EWHA 3GTYX 2AJ1A 3W66A 2OIHA 1HQ2A 4F0HA 2R8IA 1EIYB 2OFHX 3V81A 4WCEQ 1NK9A 3MECA 3KJQB 1HPZA 2VQEJ 2OSQA 3BEGB 2WSFC 1WKJA 3VWSA 4IQMA 5U47A 1N0UA 2NR0A 3QSYB 2J9DA 3MPYA 1YJNS 4GKKF 1YJ7A 2E5LJ 1T94A 1KONA 2GVZA 4ZJLA 2V9WA 4DS4A 1GMUA 3PJ9A 4LSZB 2W2MP 3ICLA 1KQSR 3UR3C 3W60A 1C2PA 4MMOA 4URSA 3V6DA 2MMYA 2PC6A 4EO8A 3T41A 4O4GA 1CS4B 4U67Q 2DH9A 2X3DA 3K17A 1S59A 4C3KA 4I6AA 3OT9A 1QLNA 4ZIVA 1S6PB 1TQLA 1DQ9A 5B0AA 4JV5J 4YR2A 3CVKA 5SZTA 3EX7B 3HX9A 2YX4A 4ZHRB 3RRHA 1HWUA 2DIUA 1MMNA 5GAHI 2OFGX 2BM1A 3OXFA 2NXJA 5KFNA 3K8VA 3OBIA 1G4CA 1S9FA 4URGA 1BMQB 3AFGA 4FNIA 3O5TB 3D28A 2WVBA 3S6EA 4RW8B 3CDAA 1AUSL 3V4MA 3CDUA 3QAUA 3VVTA 3NOCA 3RTVA 4WE1B 4M8LA 3L9ZA 5K8NA 1S1VB 4W4MA 4XTTA 2IM2A 3NMRA 4ZP9A 1SIWB 1X7VA 4P9SA 1OY6A 5AXKA 1QVGR 1RTJA 2VC0A 2FVPA 4JYAF 5F8IA 1RWMB 2LFVA 3D3CJ 5D77A 1VRTA 5KFKA 3G82B 3T1YF 1FRXA 1U09A 4G1IA 4OYWA 3T1AA 2VJVA 4USVA 3G8TA 3BGUA 4PG6A 2R2TA 1QUVA 2N3LA 5T7LB 2WSCC 1U1OA 5HAOA 5DGAA 4ZVGA 4IRDA 5A0YB 3DOLB 3VGVA 3IRXA 2WVEA 5KFYA 2LDIA 2HSEB 1LWCB 2XMWA 2IDEA 3QATA 2JLEA 2H9ZA 1WC0A 4I0WA 3U1NA 1KLNA 4PPZA 3DYAA 3M9OB 3BN7A 5J1PA 4MAKA 2B9EA 1K73T 4CO4A 1FA0A 2CYYA 4MJKA 1UFKA 4WYLA 1UW4A 2ZWPA 2M7SA 4USIA 4O3SA 5KAKA 1SC1B 3M7VA 1OWXA 4JI3J 1RAFB 3MM6B 3B6BA 1VDHA 2PI5A 4ANDA 3KLGB 3KOAA 4FBUA 2IAJA 3K0JA 4DV5F 2ZC3A 1X31C 2XY6A 2XYHB 5HP1B 5GAEU 5B0BA 3KLIB 1UVKA 2XCAA 3SV3A 3HSJA 4Q8EA 4AYBD 1I51B 3QIDA 3HHLC 3KG1A 2QMXA 4NWBA 1R8PA 3JSBA 5D4LA 2BDPA 5K5MA 3UR0A 8AT1B 4DV1F 2DR6A 1K44A 2CG8A 4DR7J 1VBKA 4P2XA 2B5JB 3NNAA 2AJFE 3PRVA 5HQLA 2HZVA 3IAM9 2JX2A 3HHEA 1KFSA 4I67A 3H7HB 3U1MA 1WHVA 2IBKA 2V4RA 1FI4A 1K8AT 2B4VA 2E1AA 4X65J 1Z2LA 2MZTA 4BS2A 1HBOA 4CNZA 5KFSA 3W65A 3I0RA 3LF0A 5CYQA 4WFNQ 1RU1A 1VC0A 2FJEB 4GC7A 1T3OA 2W9BA 1IQTA 2EXUA 2Z0GA 1BQMA 2HFSA 3TWZA 2XZWA 4O44B 2V8PA 1B0PA 1RT5B 3PACA 1C1CA 1DJ0A 3HT0A 4TQRA 2NXNA 3DNCA 5HMYA 1FWLA 1JK9B 2C3MA 1PIEA 1VRUA 3FCVA 2MGZA 3EDQB 3MUMP 3PIPQ 2E5GA 2ZOGA 4OI1A 2AX1A 4QJVA 5K8MA 5DDPC 2UU9J 2GCFA 5AXNA 3O8WA 3BPSP 3PFEA 1S0VA 1F1BB 1TKXA 1JJCB 3QZ7A 4P7TA 4PUOB 2UVUA 5DZ6A 2YVSA 3MCSA 3TQEA 2ZOFA 2C2MB 2IMWP 1ZBTA 3A8JA 1YJTA 4J9KA 4TYBA 4F3QA 1TL7B 5C25B 5EX0A 4NOHA 3NGDA 2AF6A 3UD5A 4WPAA 5GADU 3BM7A 2VIHA 3ET6A 4DJBA 4U8YA 3JSRA 2VKRA 2GHVC 2F8MA 1S9GB 4OHWA 1X60A 2O01C 2WVDA 4IRCA 3M8SA 3DLGB 4WXOA 3LP2A 5J1NA 2HHXA 4C0HA 3CO9A 1Y5NB 3MM5B 4NLPA 4FP9A 1C4AA 3BR9A 1LK7A 1R6YA 1TL3B 4WK3A 4RO0A 3LALA 3PDNA 4DFMA 3L09A 2MKCA 3KK2A 1WEZA 3R27A 3PZPA 5L1JA 2AU0A 1KTQA 2BXJA 2B6AA 1HL6A 1R8AA 3V5RA 4QR0A 1T9YA 4NMLA 1XIQA 1Q7YT 4RR5A 3HKWA 2V9KA 4K8RA 1RWOB 1RT7A 1DHMA 3D2WA 2F4VJ 4R25A 2ALZA 4PQUB 3M8YA 3SCKE 4JI2J 5KFRA 1RWNB 1K0VA 4DZ6A 4S0MA 4ETXA 5H9EJ 2BYCA 1TKZA 4CZCA 4EEYA 1N52B 3A3OB 3CCWA 1HWJA 3JSYA 3KXDA 2O3DA 1FDDA 1Q86T 2FD2A 3L95X 5DM6Q 3R8YA 1RADB 3T3FA 1MN9A 1SUQA 2RIJA 1CJVA 1S77D 3NG8A 2NSCA 4LF5J 1IKWA 5L1LA 5A2QU 4EI2A 1YITS 4IG0B 4HVZA 2B7BB 4X4TA 2AYBA 3NS7B 3G87A 4QOTA 1J5EJ 1G6BA 4KR0B 3CMQA 2V4JB 4ECUA 1FKAF 1RAIB 2QX0A 2GHWA 1SQFA 2IRXA 2QTWA 4HHJA 1WF2A 3T5HA 1FVQA 4KFBB 3HSDA 1Q5YA 2UUWA 2R3VA 1XJWB 3EGNA 2AYEA 4ILMA 3GV7B 4YB1P 2JH3A 2GQCA 1HNXJ 2J9EA 2BW2A 4DDFA 3BB5A 1FKPB 5ETNA 3M4XA 2VPYB 3SSRA 4QR1A 3MMAA 2BW7A 1P9YA 4PYDA 5KFGA 3GSDA 2DNNA 4MFBA 2DHXA 3POTB 3DXSX 3I5CA 2DGVA 1ZTWA 1RWKB 4ILLA 2ZZNA 2OPSB 1BQXA 5DG8A 1MN7A 4FYYB 4KYZA 3WIVA 2ADCA 4ZCIA 1BXNA 2ACYA 5D3GA 3M2VB 1UEUA 2B0GA 2F3JA 3MMBA 2I8EA 1U0HA 3N6LA 1X5OA 3R5GA 1HFEL 4PRFA 5KG2A 4Q0BB 3AH6A 4QCLA 1AFIA 3B82A 3O3LA 3B8HA 3GFHA 3CCUS 2LU2A 1DTQA 1SL0A 3M32A 4OL8A 2DEJA 2OP5A 2ZJRQ 3UD3P 4Q2MA 5J2PB 1O0PA 3OPKA 5AE2A 2GV1A 2PFFB 1PYSB 3LAMA 3J80Y 1S48A 1WOSA 4IR1A 2HWHA 2IPOB 2GMJA 4F8RA 1P8GA 4CH7A 4FPRA 2CVIA 4NYZA 2I0XA 2AQ4A 3HP6A 4WK1A 1AB8A 1JLGB 1HNIA 1CJUA 1GXUA 3PFOA 2UUCJ 2FVCA 3LP1B 2JL9A 2YWHA 4RW7A 4NYPA 3IO1A 5CH7B 5IV3A 1YGYA 1JLAB 2UVWA 1H0HB 4OHXA 4DV3J 2OHDA 2W9AA 5K20B 1U2RA 1RTDA 5HN0A 2CQ1A 4DR2F 1N36F 2KT2A 4QYZJ 4KT0C 3KHLA 3T5JA 1FE4A 2OMOA 4MK9A 4HH1A 2HHVA 5J2QB 4LSNB 3PYDA 4DV7J 2B51A 4J9NA 3LWLA 4QIGA 4PG8A 4DX5A 2V8HA 4DL4A 3UFCX 1WOOA 2RDIA 2RKIA 2XLJA 3GSIA 2MQOA 4M5JA 3CMAS 3PEHA 2DHSA 4M63A 1RWPB 3DMJA 1S1XB 3NMAA 4ALZA 3FUYA 2LCWA 4FKXA 1Q16B 2DKOB 1OSDA 2AYMA 2CNOB 4ED3A 1UKUA 3TEGA 1KD1T 1R6VA 2CPEA 2F1FA 3CO0P 4UQTA 5CZVA 4HT5A 4NYOA 1Y7PA 3HMJG 1Q0NA 2R7TA 2PMZD 3M2RA 1RI7A 3EPGA 3D5MA 2VG6B 4AXJA 2MKJA 3NGUA 1KKHA 2HZCA 2IRYA 5F0WA 4UY85 2MZJA 4NXMF 3PR5B 1ITPA 3CWJA 4OX8A 2VPWB 1GMVA 5D8HB 4U7UK 3VHQA 3KJVA 5KTQA 3QJJA 2BX6A 4HACA 4B3RJ 5FLXU 3SZ2A 1PG5B 3RBZA 2JDJA 2LEBA 3IA0A 2F4FA 1D09B 2BZ2A 3FK4A 1S1TB 4ZIWA 2M5YA 4ICLB 3ZZRA 3ZNUA 2KHDA 4BWMA 2QC3A 3BJYA 5IFMA 3OR1A 5E33A 2MQLA 3LGNA 4YOEA 2HBZB 3KJNB 5D6GA 2NLWA 1FK9B 2LEPA 1N4LA 4U95A 5IV4A 2FLNA 4U8VA 3MPUB 2JC0A 4JP8A 3MZIA 4LF7F 4A8XA 2ZNYA 2HQIA 1TL4A 3IWNC 4PAAA 2YQ3A 3IG1A 4A4JA 3WC2A 2WONA 3AA9A 3C14A 4Y2CA 2LP4A 5LSOA 4CT9A 1FKOA 3C19A 2ZDPA 4P74A 2OSRA 4ZN1A 3CJTA 2EW9A 1WHXA 4MKBA 3K57A 4RBTA 3G9CA 2EFGA 2UP1A 4IFYB 5JVHQ 1R89A 2JFDA 5B7WA 3CIZA 2MYFA 2AJ4A 3HULA 2VF3A 2RUGA 2DR7A 3HHLB 1SB6A 2CRLA 1T02A 4ELVA 4DFPA 2J9DE 5ETTA 5ETLA 4CTAB 1NM2A 3SDEA 4XIUA 1HW9A 2RE1A 2RRBA 4BDPA 4JI1F 3HZEA 3CMES 1R8BA 1WORA 1ZA2B 3AD7C 1LW2B 1HQUB 3MOJB 5HBMA 3QRRA 1S6OA 5ITHA 3DOMB 2LU1A 4KB7A 4DXLA 2NXEA 4A8OA 3HZGA 4DR6F 1QTNB 1A9NB 1VQSA 4OI4A 3BQ1A 3SCLE 3BN4A 4F4XA 2E1CA 2Y0BB 4NLWA 2GVDA 4NLDA 4QR2A 4JI5J 3AXKA 5B0GA 1D9DA 2XHCA 1NLKL 3CTRA 2C2ZB 2YKMB 1RBAA 3GJQB 1NDCA 4Y6IA 2RVJA 2FHJA 1EAYC 5C2CA 4F67A 1VGYA 4LF8F 1RWXB 2BA9A 2WBMA 5KFLA 1RWUA 4NCGA 3MXHP 1XEZA 4F02A 4QYRA 2J0XA 1NJIT 2GAGC 3TJ8A 4LRCA 4AE5A 3LTOA 1H7WA 1CULB 1WKKA 1XMBA 3SCJE 3N6NA 5FDLA 2G0CA 2ZHOA 4WFYA 4LFAJ 3TZXA 2CZVC 1FD8A 1ZETA 2VBWA 3TUIC 3V81B 3MECB 3T5LA 1HPZB 3MEDA 2J7KA 5IT0A 4F4ZA 2VD3A 1M0SA 3IR7B 1YDLA 2HVEA 3GV8B 3OXLA 3NWRA 1YJWS 2CNKB 3KMQA 4O0IA 2GVZB 3ITHA 1SKRA 2PA3A 5GVQA 1X0PA 3VGSA 4ZITA 1TUWA 2XULA 1O5JA 1PJ6A 1M1HA 2N3OA 1AFJA 2PA8D 5KG5A 2G4BA 3V6DB 7FD1A 4K0KF 5M2UA 3J7YU 2IJFA 4O4GB 4DR5J 4M5LA 1F5BA 4Y0FA 3I55S 4FF4A 2VH7A 1IBLJ 3MTKA 1SV5A 4AT1B 3KLHA 2IYGA 5ETSA 2DT9A 2HQCA 1K47A 3DGPB 1HBNA 1SI9A 1T05A 3HHDA 1FEHA 2VQFF 4X4QA 2V68A 1KP6A 4DI6A 2BR0A 1X9WA 4ZN3A 1U8WA 2L3MA 2KN4A 2G2ZA 4IO9Q 4P71A 3K5LA 1VQ7S 2PMHA 3GG0A 4JI8F 5IZHA 3UNYA 4FYVB 4PXBA 3RJMB 4CO1A 1MSWD 4DL0C 1N32F 1NJXA 4J37A 4FF2A 4LQ9A 3VQTA 2AIRB 4GC6A 1HBUB 1RTJB 1BE4A 3OXGA 2CPZA 5KFMA 4PABA 4I6YA 1VRTB 4DV6F 3QZ8A 2DCLA 4PYAA 3VAHA 4A8MP 1Y5LB 4B9UA 1PO6A 4OZLA 2HGLA 1RAOA 2ZH1A 3LGMA 4L75A 2J76E 3PTWA 3GV5B 4M5IA 2ZH4A 3GYNA 3QWUA 3RW7A 3IRXB 2CQ2A 3O1LA 4B9TA 1WJ9A 4M5GA 3D54A 3DM2A 3BH7B 2M0GB 4WYWA 2XMVA 2ZH3A 3KWMA 3DYAB 4DPUA 4IYQA 4F2SA 5KOWA 1NK5A 1PBUA 2PO4A 1U2FA 1JLCA 4LF1A 3KG4A 1SC3B 3QT8A 1KFDA 2CNNB 3WDOA 1CC7A 4KRWA 3UVJA 4Q45A 1UWBB 3D6FB 1S72S 1R43A 3M8QA 1BHNA 4LRBA 4C3LA 2IAJB 1Q5VA 2R7SA 3CCZA 3MR2A 1F5CA 1IXKA 3TANA 1TKDA 2E1PA 1YK9A 3T9ZA 3ILOA 2QL5B 3NKYA 1DZ5A 4W98A 5DM7Q 4TLQA 2W01A 1X4CA 4L6V3 3Q2SC 2FLPA 4CO5A 4LF9J 2DNGA 4GO7X 4WFZA 2DNKA 3R5AA 2Z2MA 3QLHB 5KT4A 5A76A 2YNHB 4ANEA 3LH2S 1RQ0A 2ZBQA 3KK1A 4BWJA 2H1YA 4RUBA 3G8SA 2LEAA 1SJ4P 1QM9A 2XEXA 2Y8YA 3B4MA 4NLOA 3DRRA 2YTCA 3LANA 2XZDB 2MB0B 3OJSA 3LA0A 4ZHRA 3ELHA 3EYZA 1F2HA 4ELUA 2VODA 2KVQE 1W7WA 2C22A 2VOOA 4R0JA 4B3SJ 3Q8RB 2HEKA 2PI4A 1HBOB 4KTQA 2QLBB 4NLRA 2HLUA 3FBEA 3G4SS 4DV0J 5CYQB 4HDGA 3CJ4A 2VFVA 2YNIA 1VFJA 3P5BP 4ECSA 2W9BB 4Q43A 4J5OA 1FTRA 1BQMB 1X9SA 2QGFB 3H0PA 3T19A 5C2GA 2J5AA 1C1CB 4LFBJ 1MMLA 2ILYA 1TKTB 4QWDA 1RACB 3WIUA 1XNQF 2QV6A 1Y3KA 3OR2A 2EFNA 4L73A 1CC8A 4Y2KA 1MG7A 2MGZB 1NNDA 5D15A 2FHJD 1G3OA 2KM8B 1X4GA 4C6AA 1V5VA 3J7AN 1UWAA 4MYUA 4GVBA 5KFZA 5D4PA 4ZCLA 2R7UA 2ATLA 5ETPA 1RK8A 1TKXB 4EWTA 4OYPA 1RT1B 3MFIA 3EM1A 3LP0A 5THWA 3TI0A 4JBCA 4DMZA 7FDRA 5HQ8A 1IJEB 1S0OA 3IM9A 2QYCA 2WHOA 2AJQA 4KC5A 2HIYA 4OV6A 4LBIA 4LBHA 1KHVA 1F60B 4NXNF 3UD4P 3W5YA 3R97A 3N6MA 1LQ9A 3BKTA 1T3NA 2ZUAA 4ED1A 3TW0A 3H4DA 2BRLA 2J8AA 3ET6B 3DLKA 4OYMA 1NK0A 1FRHA 1JLFA 3D7SB 5JXSA 3Q89A 4USHA 1HD1A 2E5HA 3LP2B 3ZNJ1 4OX9F 3HSZA 2QT7A 3RB3A 4R0EA 3JTPA 3VGTA 3PV8A 1UMJA 5C5JA 4H4KC 1NBEB 2P6TA 3R7BB 2MQPA 2OEJA 1KS2A 3K89A 3DRXA 4C7QA 4H4OB 3D1QA 1NB7A 2HQFA 3KK2B 4ECXA 4DUZJ 3O2IA 4UF4A 3OFEA 2B6AB 1D8YA 3IWXA 2Q6CA 3DHXA 5KFOA 2V8VA 4UTGA 1NKCA 5KG7A 2GZOA 1DRZA 1RT7B 5AJ3J 1SKUB 5GAEI 4LMZA 4DSEA 5DDQC 4NA3A 1TKZB 1IVZA 2QRRA 4P7VA 3NAHA 4J9QA 1CQMA 4H54A 1RZMA 2VZ9A 2FJBB 4N76A 1YTYA 1RSCA 1IM4A 3HFZB 1EETA 3TAMA 2R8KA 2YWWA 5KFJA 2V50A 4XDCA 1KWMA 4X64F 3G71S 1SUQB 1CJVB 4DPWA 1IKWB 4F50A 4MIBA 2KXNB 1VQ5S 4DX7A 3M8PA 1WKLA 2P9CA 1J2VA 4O44A 4MIAA 2L48A 2GC8A 2HRYA 3LOUA 3CJQA 4HKQA 2OELA 4WBFA 2VBXA 1BGXT 5DQHA 1WG1A 4OZ2A 1AUDA 1YG0A 1FE0A 2W2OP 5F3ZA 3NGKA 1UVNA 4MTPA 4RUHA 2LMIA 4ES2A 2W9CB 1HD0A 1T7PA 1WTFA 5IT4A 1AA1B 1EARA 4ZPDA 4DF4A 3TA2A 2CQDA 5HVGA 4DPOA 2WSEC 2EKYA 4GKKJ 2C3YA 1RTIA 2ASYA 3PW4A 4K5RA 5L1IA 3FQLA 4DLEA 1OSCA 1D3WA 5H9FK 3CJKA 1O51A 4I2QA 1FCAA 5C25A 2B56A 3D67A 4DQQA 1NKBA 4C3MA 4YMEA 3DHWC 3KHHA 3FSXA 2L08A 1UVIA 5D3GB 5IC4B 4TKTA 5ETVA 1N0VC 3MMBB 3QBCA 1U0HB 1VCTA 3D1OA 1F9FA 1FRIA 4WTYA 5CYMA 3MD3A 1IWGA 1WNEA 4QPTA 4DQIA 1S9GA 2WCXA 1B3TA 3DLGA 4RW6A 1WSVA 3MMCA 4TU8A 4LF2A 1DTQB 2XO7A 3M32B 2HNZB 5B0FA 3U27A 3G6VA 1OYDA 2IA6A 2XI3A 1WI6A 5CA5A 3MGJA 1TU0B 2DNRA 4XDDA 1IKYA 4JV1A 1LXNA 1A7GE 5GADI 2ADBA 3OTBA 2KB2A 3TZZA 1HNIB 1CJUB 2GIQA 7AT1B 4ZVRB 4YB6A 3TO8A 1UJ4A 2IFXA 1O8BA 2J7UA 1YJRA 4OMFG 3CDWA 5HANA 2CPIA 3L4BC 4JYAJ 1KVIA 4O3NA 2KG0A 3OTCA 3RB0A 5KG3A 4PQUA 3EXCX 1NMEB 3T1YJ 2AGOA 1Y9OA 3BO3A 3AQPA 2Y1LB 1FJGF 1HWLA 4TU7A 4IG3B 4WZQA 1NXIA 4FZVA 5SUHA 1CSJA 5KT3A 2ZOMA 2XZTB 2YPZA 1N5QA 4OJGA 1IQZA 4Y3CA 1FNOA 2RKIB 4KHPJ 4QWAA 2V69A 1F3FA 2ZH6A 4OX6A 3EDRB 3FSYA 4PXCA 4NA2A 1FRJA 3DMJB 3P5TL 1U6FA 4K4VA 4J9VA 1D0EA 1UJ5A 5AE1A 1RP5A 1VI7A 2V4JA 3IM8A 2KI2A
chains in the Genus database with same CATH topology
2F1FA 2BJ7A 3LGHA 2BJ3A 2HZAA 2FGCA 2Y3YA 2WVFA 2WVEA 2NZCA 1Q5VA 1Q5YA 3PHTA 2WVCA 3OD2A 2CAJA 2BJ8A 3BKUA 2WVDA 2CA9A 2CADA 3QSIA 2WVBA 2BJ1A 2BJ9A 2HZVA 2PC6A 3BKFA 3BKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1F A;  2BJ7 A;  3LGH A;  2BJ3 A;  2HZA A;  2FGC A;  2Y3Y A;  2WVF A;  2WVE A;  2NZC A;  1Q5V A;  1Q5Y A;  3PHT A;  2WVC A;  3OD2 A;  2CAJ A;  2BJ8 A;  3BKU A;  2WVD A;  2CA9 A;  2CAD A;  3QSI A;  2WVB A;  2BJ1 A;  2BJ9 A;  2HZV A;  2PC6 A;  3BKF A;  3BKT A; 
#chains in the Genus database with same CATH topology
 2RDJ A;  4FXV A;  1NK7 A;  2RRN A;  4MKY A;  4KFB A;  2BBE A;  3DGV A;  2EC0 A;  3F41 A;  2DRA A;  1RT2 A;  3M2R B;  1N88 A;  1FDA A;  3ILI A;  2UXC F;  3E51 A;  1FKP A;  1U2C A;  2EK6 A;  4DV5 J;  3AD9 C;  1M1K T;  2CQH A;  5JVG Q;  1R7I A;  3OSP A;  1TR0 A;  1JXV A;  2DHG A;  1M5K C;  4TU9 A;  3KJV B;  3VAL A;  3FQK A;  1E6Y A;  4UZB A;  4DR4 F;  2EFQ A;  4HAC B;  2XY5 A;  3IWL A;  4P2F A;  4DV1 J;  1LOU A;  1M5H A;  2MKI A;  4ZVE A;  4Y2I A;  2ABY A;  2D3O R;  5CD4 A;  3CJ3 A;  3ILL A;  3UW1 A;  3ZTP A;  2ROP A;  2ZJQ Q;  1HNW F;  3NL0 A;  4K59 A;  2F40 A;  4R8U B;  2BJ9 A;  3QQC D;  2V0N A;  3UN5 A;  4O23 A;  3OR1 B;  5B09 A;  2K8G A;  3EZO A;  3CE8 A;  3WC0 A;  5JMN A;  2FTR A;  3H2V E;  4JB8 B;  4B9V A;  1XWL A;  2D7S A;  4BC9 A;  4DLG A;  1RDR A;  4X62 F;  3GIK A;  2J7W A;  1QAY A;  4B9L A;  1S7H A;  2F8E X;  2HVI A;  4PWU A;  4KO0 A;  3IG1 B;  3OVA A;  3SFG A;  1XNR F;  2XWX A;  1EB0 A;  1YJU A;  2WON B;  1PCA A;  1FRL A;  3MR3 A;  3QO9 B;  1IKX A;  2ASL A;  1FKO B;  1PBA A;  4DV2 F;  2KFZ A;  2FVR A;  4NMX A;  3TVY A;  3BSO A;  4U96 A;  4BBY A;  4OZ1 A;  4N41 A;  1JMT A;  5HQM A;  3R5J B;  4I7F B;  1NSK L;  2QA1 A;  4KQZ A;  4PCQ A;  3UWT A;  3I0S A;  3GIL A;  4HEA 9;  3SBM A;  2L9D A;  2ZZM A;  2JVR A;  3KDO A;  3DU5 A;  1GEH A;  3CF5 Q;  1KTV A;  2M3D A;  1PIL A;  4GRS A;  3MPV A;  2CPX A;  2BJ3 A;  4USJ C;  3SDE B;  1Y00 A;  2GIR A;  1TUV A;  4M5K A;  2KZM A;  4OHY A;  1LEO A;  2HNY B;  3MM9 A;  4D3H A;  3FRZ A;  1C4C A;  2DIV A;  2IDL A;  4NI2 A;  3OLA A;  1UA1 A;  4USK A;  5HBM B;  1RTH A;  3T1H F;  4C8K A;  4I69 A;  3TX0 A;  1HR0 F;  1QSL A;  1HQE A;  1EQ0 A;  1UZH A;  3GCW P;  3HJV A;  1UFW A;  2NQP A;  1NB2 A;  1VQM S;  5HAT A;  2AGP A;  2ZJP Q;  1B4S A;  2ALY B;  2ZVS A;  5CCL A;  2GVD B;  4DS5 A;  3SXL A;  1NJZ A;  3TAP A;  3JAM Y;  1X4E A;  2QSF A;  5KFB A;  2GIF A;  4R5P B;  2VG6 A;  2Q79 A;  3MUT P;  1PJ5 A;  4NCG B;  2RF2 A;  2UVR A;  3CC7 S;  2XGQ A;  1QD1 A;  1UCN A;  3G86 A;  2XG8 A;  2W2P P;  2I6W A;  2K3I A;  5KT5 A;  3KK3 B;  1APS A;  1DUR A;  5GAG U;  3A13 A;  4E2F B;  2B4P A;  1JIH A;  5DRK A;  3BV8 A;  5AT1 B;  3H4B A;  4I6W A;  5F8G A;  3MHY A;  2Y0S D;  3MED B;  4USW A;  4WP8 A;  4USM A;  3FNN A;  1S1T A;  4LQ3 A;  3C8Y A;  4RWW A;  1F0X A;  1X0F A;  1K1S A;  3UDV A;  1EZZ B;  2E9Z A;  2ROG A;  1S10 A;  1RHM B;  2VBZ A;  2N4C A;  3ITH B;  3PX4 A;  2C2K B;  3PO5 A;  4N77 A;  1FK9 A;  4O3O A;  1TK5 A;  4RBU A;  1SH2 A;  1S79 A;  4XK8 C;  2V94 A;  4Q5V A;  3EPI A;  5EN1 A;  2G13 A;  5EGY A;  3EVM A;  3W61 A;  2EVZ A;  3K2Y A;  5CAB A;  3W2W A;  4PR6 A;  1OJ4 A;  4HI1 A;  4Q7A A;  1SV5 B;  3KLH B;  1U0S A;  2ZZT A;  1FX4 A;  4YDD B;  1ICE B;  1KOO A;  4I4B A;  4EMD A;  3CDB A;  4ED0 A;  1H7X A;  1HBN B;  4N8O A;  4PEO A;  4ECR A;  2OEK A;  1JLE A;  5F8H A;  5L9X A;  3V4I B;  3UCG A;  4WFA Q;  2OPR A;  3E2E A;  4KV8 B;  2MKH A;  3SIP B;  3D0I E;  3CSK A;  4LT6 A;  1L3U A;  2KXF A;  4OFZ A;  2LLZ A;  2Z2Z A;  3P8B B;  1GX5 A;  1EP4 B;  4UZC A;  3W63 A;  1BQN B;  1U1M A;  3MAH A;  2WW4 A;  1VQ4 S;  1JLQ A;  3W9I A;  1VQK S;  1OY8 A;  2LVW A;  3OUY A;  1IKV A;  2DXE A;  1X4B A;  2ZH8 A;  4AFF A;  3TR5 A;  5E3A A;  3PYG A;  1LW2 A;  1HQU A;  3GR1 A;  2DGX A;  2XS7 A;  5MAO A;  2DK2 A;  3AOD A;  4C0B A;  2R7W A;  3MDF A;  4Z2X A;  2N4D A;  4C2M A;  5E7O B;  4QPX A;  1PJ7 A;  4K4Y A;  3DOK A;  1ZAW A;  4A8S A;  2BV3 A;  4DR3 F;  4KH0 B;  2RU9 A;  2OO4 A;  3H2U B;  3KUE A;  3OFF A;  4L74 A;  1FFG B;  1RAJ A;  2HFZ A;  2EG2 A;  2YKM A;  3M6W A;  1O6X A;  2D3Z A;  4DV4 F;  2HLT A;  2HZA A;  2FC8 A;  2N82 B;  1HWK A;  3BBC A;  3Q86 A;  3DM2 B;  2UUA F;  2ZM6 F;  3EGV A;  3A12 A;  2YKQ A;  2JZ5 A;  2DY1 A;  2LQ5 A;  3W9J A;  2ERR A;  3AAW B;  4LJM A;  3MM8 A;  4RLE A;  5LMU J;  1H38 A;  3M30 B;  3D6H B;  2VDI A;  2DD8 S;  2PE8 A;  5A8R A;  1TAQ A;  3MEE A;  3BQ2 A;  2CPF A;  1RIS A;  2M8D B;  3UVJ B;  5DO2 A;  5ETR A;  3JTO A;  1SJ3 P;  1Q1K A;  2EPI A;  2VIC A;  3CB4 A;  3M8Q B;  3W64 A;  2ZE2 A;  2XHW A;  2CJX B;  1PGZ A;  4WII A;  1UZD A;  4OZ0 A;  4DR2 J;  1N36 J;  4A47 A;  1HHT P;  3DU6 A;  2NPF A;  4KPC A;  1VR6 A;  3F56 A;  2MLX A;  3NGR A;  3MAA A;  4CYU A;  4PKD B;  2W4P A;  4OX7 A;  3MCM A;  2OD4 A;  4IOC Q;  2R7R A;  3VAI A;  1C0U A;  4CO3 A;  2XYG B;  4DQS A;  2AX0 A;  2D1C A;  2DRB A;  2QA4 S;  1QAX A;  2HHW A;  1FES A;  3UCZ P;  3KK1 B;  2FZK B;  2GHP A;  1JNR B;  2E29 A;  3BQ0 A;  2ZBP A;  4B3M F;  3DRR B;  2OML A;  2OUG A;  3THT A;  2B43 A;  3GCX P;  1UVJ A;  4Q44 A;  2WOM A;  4BCA A;  2WVF A;  2X1A A;  1OMS A;  1UW9 A;  3MPD A;  4CWB A;  3D4J A;  4JI0 F;  3DGP A;  2KFY A;  1RHU B;  2GGP B;  4JI6 F;  1A6L A;  3M05 A;  4KHM A;  3OW2 R;  2KKH A;  3BGR B;  4LR8 A;  5HI7 A;  2EG1 A;  1Q82 T;  3JSM A;  3J7Y I;  4KJI A;  1LK5 A;  1V5I B;  2BQR A;  3R2C J;  1S57 A;  3K5O A;  3WZ0 A;  2W24 A;  5L8R C;  1V3Z A;  3TVK A;  3NP5 A;  5F41 A;  2YNI B;  2H4W B;  1VQO S;  1EJ7 L;  1HNZ F;  2PT0 A;  4I2P B;  1SJ1 A;  1RA6 A;  2KXH A;  2LXI A;  1VQY A;  1HYS A;  4NXM J;  2VAS A;  1LWF A;  4UOH A;  3FZB A;  4NLU A;  4B3R F;  1MRO A;  3QPI A;  4C98 A;  2J6T A;  3OR2 B;  1HBU A;  4ZPW R;  1QY7 A;  3CCE S;  4OHV A;  1TMM A;  4MYT A;  4GVB B;  5DLG A;  1SJR A;  2CDQ A;  4YY3 F;  1ZTT A;  5LT5 A;  1SH0 A;  1X5P A;  5IT9 Y;  2KG1 A;  3DLL Q;  2FY8 A;  3LP0 B;  3V6J A;  1BY9 A;  4DOZ A;  3HDS A;  3Q8Q B;  3LUY A;  3IGV A;  1C1B B;  3OD2 A;  1XC9 A;  1N5T A;  2G1H A;  2VFT A;  1VQL S;  4O3R A;  1XMO F;  4BLG A;  2OPP A;  4ZJQ A;  3KLE A;  4C9D A;  3EWG A;  4KGK A;  2DPJ A;  1OYE A;  2DGO A;  3ULH A;  2KU7 A;  1RT4 A;  2AWZ A;  5T41 A;  4PXD A;  4LF7 J;  1AT1 B;  1S6Q A;  1X9M A;  2DH7 A;  3D3B J;  3PM9 A;  1VQ9 S;  5KG0 A;  3PVX A;  2BE2 A;  4OZN A;  1CJT B;  3IBW A;  3NWG A;  3EGW B;  3UNG C;  1KLM A;  3DLK B;  4E8U A;  3C3L A;  3J7Z T;  1F9E B;  1T0T V;  5HL7 Q;  1JLF B;  1EQM A;  3PYF A;  1OS5 A;  1VC6 A;  3R7N B;  3J81 Y;  2E5I A;  2BJE A;  2GS8 A;  2HS4 A;  5LL6 d;  4OI6 A;  4AL5 A;  2DPI A;  1L3S A;  1Y5I B;  1UWB A;  5KT7 A;  2FIU A;  3OSN A;  4HI2 A;  3KLF B;  4C48 A;  4M1K A;  3KKF A;  4J9R A;  2GNK A;  4QIV A;  4G1Q B;  4LR9 A;  3SFU A;  3BYR A;  4K2J A;  2YKP A;  2QJ3 A;  2D74 B;  3Q2T C;  4KH1 B;  3ISN C;  5KFP A;  3FCW A;  4ZPA A;  2E44 A;  2PGC A;  4DL7 A;  1CEZ A;  1DTT A;  2HVH A;  1U25 A;  2MSS A;  2NYH A;  4JI1 J;  3QLH A;  2YNH A;  4WP3 A;  2KVI A;  4NLG A;  2A6M A;  2H5E A;  5L38 A;  1XER A;  4ZPV R;  2K7J A;  4CLY A;  3FSI A;  1REV A;  2RNE A;  3MWB A;  2OAU A;  3ENA A;  2CJY B;  4DR6 J;  3NGT A;  2DNY A;  1LW0 B;  1YWX A;  3WBZ A;  4KBI A;  1RYS A;  2DCU B;  3ZZO A;  4N56 A;  3CD7 A;  2DBB A;  4OYA A;  3FCH A;  1VHI A;  2EBE A;  4O3Q A;  1EET B;  5GMD A;  3TAM B;  1HW8 A;  2DEI A;  1YZ6 A;  4LF4 F;  1T8E A;  4DR1 F;  2I9S A;  4K7Q A;  2RT3 A;  3I96 A;  5HSP A;  2DR5 A;  2C2O B;  4P10 A;  4KAI A;  4IOA Q;  2A3J A;  3M8P B;  2BKN A;  1DLO A;  4OZJ A;  1URR A;  4X66 F;  4MK7 A;  4LFA F;  1TKT A;  5HRO A;  2MDA A;  3HO1 A;  4KY3 A;  4B3O B;  4DQR A;  2OGU A;  4M5M A;  1WHW A;  2M52 A;  3ADA C;  2W7O A;  1SL1 A;  2HG4 A;  2HPU A;  4DL3 A;  2RQM A;  1GK8 A;  4NLX A;  4WFX A;  3R5B A;  2FHK A;  4IH6 A;  5GMK a;  2NPI A;  4DG1 A;  4O4R A;  1RT1 A;  4URQ U;  1JKH A;  3LGH A;  1RU2 A;  3GQC A;  1YI2 S;  1CLF A;  2K3K A;  4HDH A;  2Z8Q A;  1RTI B;  3AT1 B;  2P9E A;  1RCO B;  3MUV P;  2HQD A;  1B0T A;  1X4H A;  1YQH A;  4NCA A;  3GON A;  3PRB A;  4DN0 A;  3CJK B;  2AEM A;  3VF0 B;  1I3O B;  4I2Q B;  2DGT A;  2DO4 A;  5CZX A;  3AHP A;  3NAI A;  4K0K J;  2HFO A;  2RQ4 A;  1WC1 A;  3GU0 A;  3P6Y C;  4RW4 A;  2XLI A;  5CYM B;  4EZ6 A;  2CQI A;  4JI7 F;  1PYO B;  4QBU A;  2GAH C;  5CHC B;  4ZS6 A;  4TLR A;  4AL6 A;  2GA7 A;  4RW6 B;  5CD4 H;  3TJA A;  3MMC B;  5C7P A;  2VQF J;  5ADZ A;  2POK A;  3VZH A;  2HAI A;  3RYL A;  1R0A A;  1IKY B;  1NSA A;  2IMO A;  4KE5 A;  3ZFV A;  2G2Y A;  4MT1 A;  3QGI A;  4JI8 J;  1U1L A;  4H4O A;  2UUT A;  1QDU B;  3T6B A;  3CD0 A;  3JTN A;  2GW8 A;  1N33 J;  1N32 J;  3RG6 A;  2XMU A;  1UA0 A;  3OVS A;  4M5D A;  4CH0 S;  2C28 A;  1RKJ A;  3V2U C;  1L3V A;  4MK8 A;  2KTQ A;  1F2G A;  3P96 A;  1ZZF A;  4Z7Y A;  5B0D A;  3PJW A;  1L3T A;  4FKY A;  4DV6 J;  1V9O A;  1KC8 T;  3DRS A;  2JWN A;  1VQP S;  3HHN B;  5H1S V;  1V6H A;  2J9C A;  3X3U A;  5DQG A;  1ZS6 A;  1DQA A;  4YB5 A;  3TJ9 A;  3GE9 A;  3X1L B;  4F25 A;  1BC6 A;  4L76 A;  4OYO A;  4IQX A;  2XWY A;  5CAA A;  2LQ8 A;  1YRT A;  1LFP A;  1DBD A;  4K4S A;  3IR6 B;  1VIX A;  2FC9 A;  3KLV A;  1N6Q A;  2E7W A;  4J9U E;  2DB1 A;  3PW0 A;  1U1N A;  2G9O A;  1RXO B;  3RB6 A;  4B3T F;  2CWK A;  1WC6 A;  3JQK A;  5M2P A;  5HO4 A;  2FJV A;  4RJV A;  4NLS A;  3CGI A;  3H90 A;  1S7I A;  1ZAV A;  3HXM A;  4LRA A;  2HQG A;  1L5U A;  4KGZ B;  4AL7 A;  2RAQ A;  2JEI A;  1RTZ A;  2F7V A;  1RT2 B;  2XMK A;  2WTF A;  4PWD A;  4DL2 A;  2CQP A;  1SQG A;  2C3P A;  2W9C A;  3ISZ A;  4ZVF A;  3HVT A;  3EE3 A;  4KKO A;  3QRQ A;  1B99 A;  2B7C B;  2I5J A;  1M5V C;  5L39 A;  3P45 B;  1NPP A;  2CJK A;  1RUS A;  4U6P A;  5E3Q A;  1KQF B;  4BHQ A;  2DR9 A;  3H20 A;  1X5S A;  4UOF A;  4DEZ A;  1JX4 A;  3BRE A;  2X51 A;  1E6Y B;  4PG7 A;  3N01 A;  3PHT A;  3NRB A;  2VJU A;  2MQQ A;  2GFF A;  3H42 A;  1WG4 A;  1KVK A;  4CLK A;  2FJX A;  4L3K A;  3MI7 X;  3I4H X;  4DU8 A;  2BQ3 A;  4X4S A;  1N5Y A;  2M70 A;  2C2D A;  5I42 A;  1FJC A;  2AYG A;  2E7V A;  1Q8I A;  2WZ1 A;  1U4B A;  1R0C B;  3MF5 A;  5HLF A;  4LUB A;  2V5H G;  4CLW A;  2QL9 B;  2Z57 B;  4RNH A;  2YKN B;  1U45 A;  1SVD A;  2UVV A;  2HNZ A;  3BS9 A;  1CVJ A;  4ECY A;  5G4D A;  4ZP6 A;  3GII A;  1UFL A;  3H2L A;  2HND A;  5HVF A;  4J9M A;  4KO0 B;  4FBT A;  2A10 A;  4QU7 A;  4ECW A;  2FDN A;  1U1K A;  1NPK A;  3OTO F;  2CQB A;  5A8K A;  2QA4 G;  1Q53 A;  4P2M A;  2PEB A;  4RU9 A;  1IKX B;  4WWS A;  2W7A A;  3P3D A;  1VJQ A;  3R5C A;  5ETQ A;  2Z2L A;  3Q0A A;  1X8D A;  2HK3 A;  1RBO B;  2BAN A;  2H5J B;  2E66 A;  4CI0 B;  2DHA A;  4H4M A;  1HHS A;  4CO0 A;  1YRX A;  4K2X A;  3AXM A;  3N28 A;  2XMT A;  1RAE B;  1FDN A;  3RW6 A;  2GO9 A;  1S49 A;  3ZZP A;  4EZ9 A;  3I0S B;  3FEZ A;  4XO0 A;  3HFV A;  1ZM2 A;  2D3O 1;  2HAF A;  3EXY A;  4WKY A;  4ES3 A;  3DXB A;  2KM8 C;  1VBY A;  3RRG A;  4IG3 A;  1VBZ A;  2KL8 A;  3R5D A;  3AOC A;  3DRP B;  3TRG A;  5DS7 A;  3S1T A;  2AEF A;  1HNV A;  1JWW A;  3M8W A;  2RQK A;  3A4T A;  1RHR B;  5LMN F;  2ZBC A;  3MM9 B;  2DRD A;  3QAE A;  4NI2 B;  2PEH A;  5IQQ A;  2VG5 B;  1RTH B;  1Q8L A;  4O0N A;  4NXN J;  4RW9 B;  4CO2 A;  2FGO A;  5F9L A;  2IVF B;  1N54 B;  3DI6 B;  1HA1 A;  2XQC A;  5IOL A;  1HQE B;  3QFH A;  4CLL A;  3WX8 A;  2G0I A;  2ZEJ A;  4NLY A;  4PQA A;  1FDB A;  2A6O A;  6AT1 B;  4F4A A;  4CP5 A;  4EO6 A;  3AJ1 A;  1JLB A;  3P49 B;  1SC4 B;  2Q43 A;  2J0S D;  3W8G A;  4YB7 A;  4DFK A;  4YN3 B;  1N56 A;  2OH2 A;  1TZ0 A;  4RNF A;  3A8E A;  4OX9 J;  2MY7 A;  3T9N A;  3NNC A;  1I5O B;  3JAM U;  5AE3 A;  1NAQ A;  1NPR A;  3IRW P;  2LEC A;  1JXE A;  3TP2 A;  5D0G A;  4P52 A;  5DLF A;  2O66 A;  2HS0 A;  1H74 A;  1Y10 A;  2WK4 A;  4CDI A;  5KFU A;  2MHE A;  3AD8 C;  3UI3 A;  1VK3 A;  1HAR A;  3W9H A;  1B7F A;  2DO0 A;  3EUN A;  1F5A A;  2BKO A;  2RF2 B;  4CLF A;  1IBM F;  1TP7 A;  1XK8 A;  3FC9 A;  3RR8 A;  1U6Z A;  4IR9 A;  3MOZ A;  5IWA F;  3IS9 A;  1J5O A;  2EEY A;  2LQB A;  2V8G A;  1C0T A;  1UTA A;  4OZ3 A;  4DSJ A;  1GXL A;  4K4X A;  3OV7 A;  4HT7 A;  2J0W A;  2JLF A;  4CLS A;  1G7C B;  3JQM A;  2KRR A;  1WSR A;  4ZP7 A;  2RB7 A;  3NCR A;  4Y2A A;  2MKY A;  1FWP A;  3JQJ A;  1EKS A;  3CC2 S;  1N34 F;  1I6J A;  5I3U A;  4R8U A;  1P1L A;  5F8N A;  2VFR A;  2ZHB A;  2ZDO A;  1OY9 A;  4Z37 A;  3MM7 B;  2NZ4 A;  3RAM A;  2DNZ A;  5DDR C;  2CJ9 A;  2OJ3 A;  4JI4 F;  1SXL A;  3RB4 A;  1NUE A;  1TTH B;  2R7O A;  4OJ3 A;  5KFH A;  2IHR 1;  3HHK A;  4AD6 A;  1IR0 A;  3N4W A;  1ELO A;  1R8C A;  3Q8S B;  2X1B A;  3W2W B;  2F8H A;  2P6S A;  5F9N A;  3KFW X;  4J9P A;  2IBO A;  3OL9 A;  3JYT A;  2PII A;  3QO9 A;  2J6U A;  4G3I A;  2ZWO A;  4X4O A;  3GIR A;  2CJA A;  4AQY F;  2BJ7 A;  4ED6 A;  1JLE B;  3BF4 A;  1S6U A;  4I7F A;  2HWT A;  2DNP A;  3VAK A;  2YX7 A;  4OYX A;  2B3T B;  2CQ4 A;  1OQ6 A;  1S99 A;  2OPR B;  5BYS A;  2VON A;  1M1G A;  2PD1 A;  1RAA B;  3FBF A;  3EMT A;  2DNL A;  2HQ3 A;  3U02 A;  1HMV B;  1YLX A;  1FJE B;  1B0V A;  1JLQ B;  3OUY B;  2LA6 A;  1IKV B;  3AJD A;  3MMJ A;  3AQO A;  1RHK B;  3DC2 A;  3NS6 A;  3BKF A;  1U7L A;  3JXO A;  2L41 A;  2HNY A;  4DF8 A;  1W2B R;  3HSG A;  2ZD1 A;  3IBC B;  3H98 A;  1DQ8 A;  1GT8 A;  2FGC A;  6FDR A;  3IAS 9;  3CCT A;  1JJH A;  1UVL A;  3VV2 B;  2CPY A;  4F4Y A;  3DOK B;  1WEY A;  2JFK A;  2MTL A;  3L7U A;  4IH7 A;  1HBM B;  2EBG A;  3C16 A;  2EFO A;  3MEK A;  5IM0 A;  3ZO7 A;  1DY3 A;  2C2R A;  4B9M A;  3DRY A;  1IN0 A;  3BR8 A;  4TNO A;  2KHC A;  2AP6 A;  3MUR P;  4L72 B;  2VDH A;  3OTE A;  3W3S A;  4A46 A;  4HTI A;  4OJ1 A;  4R5P A;  4ETZ A;  5E5N A;  3ZTO A;  1KNZ A;  3ETM A;  4PZV A;  3B54 A;  2IJN A;  1BUX A;  1NSP A;  3ZTS A;  3MM8 B;  3Q8V A;  3WX4 A;  2L9W A;  3KK3 A;  5D78 A;  2YBV A;  3M1V B;  3PKY A;  1U24 A;  5A8R B;  1Z2Z A;  5H9E K;  3MEE B;  3HVR A;  2M88 A;  3G6X A;  2CZ9 A;  4DFJ A;  1NKE A;  3I56 S;  4ECQ A;  2ASD A;  2ZE2 B;  2DNH A;  4XAK A;  3MD1 A;  4RNN A;  3SMZ A;  2Q66 A;  1GMW D;  1QVF R;  1W26 A;  1FJG J;  3FMW A;  1SJF A;  1WF0 A;  4EYH B;  3MAA B;  4DHV A;  2CQ3 A;  2AMC B;  2BEF A;  3CJ5 A;  2F9D A;  2BM0 A;  4CYU B;  3CD5 A;  4F0M A;  4B02 A;  4EBC A;  2D69 A;  4KHP F;  3QGP A;  5GAG I;  3BSA A;  1C0U B;  2MKS A;  3TNV A;  4RWX A;  2WAQ D;  3AB2 B;  2CKW A;  3QWP A;  4ZVO B;  2D3U A;  2DXF A;  1LNQ A;  3Q8Y A;  2Y1I A;  4FF3 A;  1ZPW X;  4K4T A;  1HIY A;  4YR3 A;  3D6T B;  3ENQ A;  1RT3 A;  4JOU A;  3TAQ A;  1FRM A;  1FWK A;  5LM7 E;  4CRJ A;  2ZBR A;  2MXY A;  4AXI A;  2D9P A;  1Q81 T;  3BKU A;  4DWI A;  1EKR A;  1IR1 A;  2WOM B;  3OJU A;  3QJP A;  4XPC A;  1GX6 A;  5KFW A;  4UY8 T;  1AXQ A;  3TA1 A;  2DH8 A;  2HVD A;  3JSM B;  4EBD A;  4CLT A;  3V4I A;  2DGS A;  1YSJ A;  4GKJ F;  3BH6 B;  2BJ1 A;  1S1W A;  2MZR A;  4KV8 A;  1KSP A;  4IO1 A;  5G0R A;  3K5P A;  4LFC F;  1F9H A;  4C11 A;  2KYX A;  3H5X A;  2UXC J;  5BR8 F;  4UT4 A;  3M6U A;  4M95 A;  1EP4 A;  3D66 A;  1NH8 A;  1BQN A;  5KFE A;  1HYS B;  2FZG B;  1LWF B;  1G2E A;  1ZM4 A;  5D4O A;  1X4A A;  5KFD A;  2RRA A;  4Q8F A;  5E2Q A;  3BGL A;  2MPU A;  4K5S A;  1MRO B;  2MLY A;  5E3P A;  1GTE A;  3MEG A;  4DR4 J;  1WHY A;  1NK6 A;  3MCN A;  3ISN D;  2XYP B;  5ETK A;  3HHL D;  3CNQ P;  3K8W A;  5IC6 B;  3C6T A;  5EWF A;  1YIJ S;  2V2K A;  4ED5 A;  4IDK A;  4I56 A;  1HNW J;  5IT9 U;  2VA2 A;  5MLC V;  1J27 A;  4EUV A;  5RUB A;  4ECV A;  2XM3 A;  3TUP A;  4I68 A;  1GFW B;  2OPP B;  3OL8 A;  3KLE B;  4DUY F;  2UUB F;  2F9J A;  4DSK A;  4NX9 A;  2CQG A;  2FVQ A;  3VQS A;  2L9N A;  2JRS A;  1RT4 B;  2GJF A;  1H2U X;  4X62 J;  1S6Q B;  5KFA A;  2BE2 B;  2CQ0 A;  1H98 A;  1R31 A;  2UXD F;  3CJ0 A;  2DJW A;  1N48 A;  2KJW A;  2QEX S;  3V6H A;  1XNR J;  2DXD A;  1KLM B;  4RUC A;  2N7C A;  4QYZ K;  3H5S A;  3LWM A;  2FUG 9;  2J0Q D;  4ED7 A;  1N8R T;  3M30 A;  3J81 U;  4DV2 J;  2OTJ S;  4ZVP B;  3HKZ D;  1WOP A;  4EU0 A;  3W2V A;  1W2I A;  5HJX A;  3SEO A;  1T11 A;  1UEK A;  2W1B A;  2WBR A;  2NRE A;  1DAR A;  4QW8 A;  5J1E A;  3K5M A;  1ZYQ A;  3VZI A;  2Y9H A;  4YDX A;  3JB9 k;  1MLA A;  2R4F A;  2NUH A;  2P5V A;  3BBB A;  1AYE A;  1NDP A;  4NLT A;  4QW9 A;  5FJ4 A;  4FS1 A;  3NGS A;  4ZVU B;  1HI0 P;  4IFV A;  2YXL A;  4LIW A;  2VC1 A;  1DTT B;  3QT7 A;  1RWW B;  3MPW A;  2ZKT A;  1UAW A;  4ZPT R;  2JC1 A;  1XTZ A;  5I4M A;  4QWB A;  1TL1 A;  4Z7C A;  1FO1 A;  3T1H J;  1MU2 A;  1HR0 J;  1REV B;  3FZ2 A;  4ZCM A;  2A2D A;  2QL7 B;  3G6E S;  2GMH A;  3N9U C;  4WFB Q;  1XBW A;  1R8H A;  3RGI A;  5L9N A;  3M6V A;  1NZ8 A;  2DHH A;  1UJ6 A;  3RR7 A;  2GGP A;  2HHH F;  1SBR A;  2ZNZ A;  3BGR A;  2APO A;  2B9X A;  3L7O A;  5IS2 A;  2EFV A;  1FFS B;  2OD6 A;  3D68 A;  1FF2 A;  1MWQ A;  1IUJ A;  2V4Q A;  1T9T A;  2CPD A;  2E5J A;  5HJY A;  1BWE A;  3OVB A;  1JJ2 R;  2W2Q P;  2YY3 A;  3NY0 A;  4I2P A;  4LSL B;  1VJW A;  5A8W A;  1QSS A;  1Y4Z B;  4NL5 A;  1U6B A;  3W8P A;  3QSI A;  4OHZ A;  4CLP A;  1DLO B;  3VTI A;  4G65 A;  3SSQ A;  4B08 A;  4NA1 A;  5E3R A;  1CG2 A;  2MJN A;  2WB1 D;  3K58 A;  2BKP A;  4NCB A;  5HRO B;  4DCO B;  2R9L A;  2KH9 A;  1UET A;  2B4O A;  3A8K A;  2JEJ A;  2CJB A;  4U9R A;  3RU0 A;  4YR0 A;  1Z4U A;  1FNX H;  2PFD A;  3RAQ A;  2JEG A;  3THP A;  2X1G A;  2JHE A;  2Y3Y A;  4C8Y A;  2MQ8 A;  2VG7 A;  4DG1 B;  2UXB F;  4PPD A;  1WDT A;  3H8Y A;  1JKH B;  4FS2 A;  4O3P A;  4OYI A;  1REG X;  2AZ3 A;  1VBX A;  2R7V A;  3IN5 A;  4WIQ A;  1S1U A;  1IBK J;  4YQW A;  2CFX A;  5HMW A;  2ILZ A;  4Y2M A;  1C1B A;  2YWG A;  3G6Y A;  2LKZ A;  3A1Y G;  2R2R A;  1RT6 A;  1FXR A;  4WKR A;  2XNQ A;  2F65 A;  3FGV A;  1UPM B;  2P9G A;  5F8L A;  4YHH F;  5E41 A;  4D3G A;  2OI2 A;  2B8Q A;  1RLC L;  2EFP A;  1CJT A;  5J2N A;  3IC1 A;  4FN5 A;  5L1K A;  3A3P B;  3NLC A;  4RW4 B;  2YX1 A;  2KT5 A;  2WRM A;  1XR6 A;  2EC2 A;  3BO4 A;  4OZ5 A;  1RB0 A;  3DDK A;  2E9T A;  5EHH A;  1B7Y B;  2NSB A;  1T03 A;  4C4W A;  3IGN A;  3T6J A;  1JNZ B;  3L3C A;  3C2P A;  4X4N A;  3G8Q A;  5E3C A;  3KLF A;  1YBA A;  1D9A A;  3E01 A;  4KGM A;  1R0A B;  4HH0 A;  3MR5 A;  4G1Q A;  2VPX B;  5M2R A;  3HVW A;  1D8Z A;  2LA4 A;  3CCL S;  3LAK A;  1MMD A;  3HM9 A;  3NBP A;  2ZHA A;  4TYA A;  5LJ5 Y;  1VK8 A;  4IH5 A;  4J9O A;  3BDP A;  5JUM A;  4L3N A;  4M5D B;  4U7U D;  3PKM A;  2HBR B;  2HBQ B;  4TY9 A;  2BE7 D;  4TQS A;  4UUX A;  4CNY A;  3R1H A;  4LF6 F;  5EUH A;  1WEX A;  4DX8 H;  4ZA1 A;  1I94 J;  1CBK A;  1QE1 A;  4F04 B;  4JUZ A;  3W1Y C;  4K4Z A;  2CIM A;  3DRS B;  1LW0 A;  1LFW A;  4ENO A;  4A8F A;  1NHK L;  3CCJ S;  1S0N A;  4ATN A;  4RPF A;  2C42 A;  4FYW B;  5LXY A;  4DR3 J;  2V63 A;  1S9E B;  2IA0 A;  1RAH B;  3CT9 A;  4FPI A;  2VPZ B;  2AV5 A;  1S76 D;  5LJ3 Y;  3Q24 A;  1HHQ A;  9RUB A;  3UPF A;  1ZA1 B;  4DV4 J;  1FFW B;  4OI0 A;  1N6Q B;  3DLJ A;  1R3N A;  2OKQ A;  4ZVS B;  3HT3 A;  2UUA J;  3FEY B;  2ZM6 J;  2C2N A;  1XMQ F;  1SIZ A;  4K50 A;  2AZ1 A;  2PN6 A;  3NNH A;  3CCM S;  2NS1 B;  1RHJ B;  5LMU F;  4NE9 C;  2RS8 A;  2OEM A;  1H2V Z;  4ZDN A;  1QTM A;  4FVM A;  1HI8 A;  2G2O A;  3HCX A;  2MJU A;  5DJB A;  4ZJO A;  2HMI A;  3DLE A;  4ZLL A;  4B3O A;  2BAB A;  1RGV A;  2VQE F;  3QNW B;  1OO0 B;  5DGB A;  4FXD A;  2RHS B;  2PSZ A;  1WWH A;  2HBY B;  4PWD B;  4C97 A;  2BVZ A;  3IR5 B;  4CLZ A;  3RBE A;  1RBL A;  5K8O A;  3C6U A;  2XLK A;  3H5U A;  3HVT B;  2E5L F;  3NCP A;  4KKO B;  4PWW A;  2CQC A;  2I5J B;  4DQP A;  4ZMM A;  4EBE A;  2ZH2 A;  4C8M A;  1T9W A;  1RE1 B;  3HFK A;  4CIO A;  2ZKU A;  1WDD A;  3H25 A;  1GH8 A;  1X4F A;  3ZTR A;  4QU6 A;  3GG1 A;  3TOQ A;  4ZPC A;  4G6V B;  5EX3 A;  2QN6 B;  1R0B G;  4JV5 F;  1YBU A;  1N5Y B;  4ID5 A;  4TY8 A;  4B3M J;  2IYI A;  4HLB A;  2YNF A;  5I42 B;  1MWY A;  2MLZ A;  3RUB L;  2O5D A;  3GJT B;  2W4D A;  3CED A;  3CJS A;  2AKW B;  1LWE B;  3EVO A;  4HHH A;  2D9O A;  2V2V A;  2YQ0 A;  5HLF B;  3ZZU A;  5KFT A;  4JI0 J;  3OQ2 A;  3AY0 A;  2KRB A;  3O6Q A;  3D6M B;  5BYR A;  2IC3 A;  1M5S A;  4JI6 J;  1FEE A;  4ECT A;  3FJ2 A;  1NJW A;  2QMU B;  4NAS A;  3J80 U;  2HND B;  3FFI A;  3DLH A;  3I5B A;  3E3X A;  1FNM A;  5KFX A;  3L7P A;  1HNZ J;  2A0F B;  4GMK A;  4ED8 A;  4GO5 X;  2QMW A;  5A8K B;  5C24 A;  2NXU A;  4P6Q A;  2AT1 B;  3VAM A;  2QLX A;  3U1L A;  5E0O A;  3S8S A;  1Q78 A;  2DGU A;  4WU2 A;  3GLJ A;  3ZZZ A;  5BYQ A;  4U7C A;  2BAN B;  4H4M B;  2UV8 A;  3NEK A;  1QUP A;  4ED2 A;  3ZXW A;  3KUH A;  2XI2 A;  2CWX A;  5F8J A;  3MR6 A;  4F3M A;  1SJQ A;  2JVO A;  4YY3 J;  3FRY A;  5C42 A;  1U26 A;  3CCR S;  4LR7 A;  1TK0 A;  2H65 B;  4V1A k;  1RAB B;  4ED4 A;  1HNV B;  3GPA A;  2RIL A;  2GQ2 A;  3WHI A;  1XMO J;  2FZC B;  1P27 B;  3GMG A;  2V8D A;  1VLO A;  1U1Q A;  2P8I A;  5KFV A;  1T9X A;  5KG4 A;  4FVC A;  4AUK A;  4ZLN A;  2XSJ A;  5DG9 A;  4UOG A;  5K14 A;  1VS3 A;  1VC5 A;  3OTD A;  1TK8 A;  1JLB B;  5IQ6 A;  4V19 X;  2VHG A;  2KFN A;  2YQ1 A;  5ETO A;  4JI3 F;  1TV6 A;  5B0E A;  3C46 A;  1YRU A;  4ZPB A;  3SQG B;  2HWI A;  3EGZ A;  4WP9 A;  2HKE A;  3CDE A;  4N8N A;  3KNG A;  2KZZ A;  4YUD A;  4CM0 A;  2HRU A;  3K59 A;  3SCI E;  3R2D J;  3CC4 S;  1GTH A;  1KOH A;  1FXL A;  2QG9 B;  2RSQ A;  4PG5 A;  5J2M A;  3E8O A;  3DLB A;  1EHW A;  2A2C A;  2W8K A;  4ZVT B;  2XGP A;  4ZLP A;  3UCU P;  2CPH A;  1WC4 A;  2NUU G;  3LPY A;  2RML A;  3VAG A;  3IS9 B;  1ZZN A;  2IRU A;  1J5O B;  2LXF A;  1C0T B;  5DQI A;  2ASJ A;  2AGQ A;  3QYY A;  1ZM3 A;  3I87 A;  2EI5 A;  3M9M B;  4DR7 F;  2HYI B;  1XQI A;  4MIW A;  3ENW A;  2HHT A;  1HKA A;  2V67 A;  5I3Q A;  4IOB A;  4N7T A;  1SC6 A;  3CJ8 A;  1BWV A;  3BBF A;  4JV0 A;  4TVA B;  3O44 A;  5HK4 A;  2W7P A;  1U49 A;  3CCV S;  1FRK A;  1NO8 A;  3D0G E;  1FJ7 A;  4X2B A;  1NRK A;  5I3U B;  1VQ6 S;  2YPY A;  4X65 F;  3EVW A;  3VGU A;  4N5S A;  1V3R A;  2VUG A;  2MQM A;  2RJZ A;  2DGQ A;  2YKN A;  3QT5 A;  2Z58 B;  3VVU A;  1GQE A;  5DZ7 A;  1KDN A;  2Z4P A;  3M8Z A;  1AZS A;  2KJV A;  4LF4 J;  1IWA A;  3FDS A;  4DR1 J;  1WC5 A;  2VBY A;  1NHV A;  4BC7 A;  1TVR A;  4LBP A;  2WB4 A;  3M2U B;  3S7R A;  3JYT B;  4KIA A;  4X66 J;  3H59 A;  3FKB A;  2HHQ A;  3UO0 A;  3CJ2 A;  1S4E A;  3CUN A;  1E6V A;  3GWC A;  3HK2 A;  3M9N B;  4NZ7 A;  2UU9 F;  4UST A;  5FII A;  4Y00 A;  3KUG A;  5KG6 A;  4OLO A;  4UW2 A;  3THV A;  2J6S A;  2DYA A;  2IY5 B;  3HLU A;  2DY9 A;  3UDE A;  2R8J A;  4UOC A;  1ROF A;  8RUC A;  2GX8 A;  3DRP A;  1TUG B;  2F5G A;  4CH1 A;  5GAH U;  2RHQ B;  1JXL A;  2H5I B;  4NRU A;  2M2B A;  2VFU A;  2PMW A;  3VAJ A;  4M94 A;  1UP1 A;  3BSN A;  5LOQ A;  1PSD A;  1U1P A;  1CJK A;  2VG5 A;  2ZD1 B;  1PAE X;  2ZH5 A;  4RW9 A;  5HMZ A;  2XNR A;  2Y1J A;  1OPZ A;  2QO3 A;  3DI6 A;  1RCX B;  4C8O A;  1WI8 A;  2XO6 A;  2XB2 D;  1FTC A;  1WF1 A;  5H9F J;  2CA9 A;  2CAD A;  1KHW A;  3DFE A;  3GJR B;  3GP9 A;  2HRT A;  1P1T A;  1OQ3 A;  3C16 B;  4OI2 A;  3N79 A;  5IM0 B;  4JI7 J;  4H4K A;  3W5Z A;  4DL6 A;  4C8N A;  2RD5 C;  2FB0 A;  3SV4 A;  2CXE A;  2RQC A;  3QIP A;  1NK8 A;  2K1R A;  4EK2 A;  2VB6 A;  2UV8 G;  4W90 B;  1ZOT A;  4ZP8 A;  2OPQ A;  4DPY A;  3TEH B;  4A48 A;  2YKA A;  1N33 F;  4ZCK A;  3BGO P;  1DAX A;  3R7S B;  2IM3 A;  3EIC A;  3HI9 A;  4Y28 C;  4FNH A;  1Y3J A;  1RAG B;  4WXW A;  4C8Z A;  2HHS A;  2HGN A;  1LKZ A;  4A8Y A;  4PXE A;  2B8P A;  1XR5 A;  4OJH A;  4LRE A;  2F4V F;  4ECZ A;  2H51 B;  3TUJ C;  1VMB A;  2C1E B;  4M5H A;  1PYT A;  4B9N A;  4JI2 F;  2KO1 A;  2RH3 A;  3GIM A;  1KQG B;  2FLL A;  2YH1 A;  4W92 B;  1PKU A;  3QFW A;  3QT6 A;  3MM7 A;  4X84 A;  2NCK L;  4E0D A;  1K1Q A;  2I38 A;  2FJA B;  1D9F A;  4QWC A;  3MTJ A;  4ZK7 M;  3UDC A;  3C15 A;  2YNG A;  4LF5 F;  3GZ7 A;  4NEY A;  3UDL A;  1U48 A;  5D0R A;  4HHU A;  4NRT A;  2JJ4 D;  2FVS A;  3FMB A;  3CCS S;  2ZFH A;  1RT3 B;  1J5E F;  1ACM B;  1UEV A;  3A8I A;  4B3T J;  1UPP A;  3R6G B;  2MZ1 A;  4XPE A;  3CCQ S;  3G2X A;  3TZY A;  3DCA A;  3JS9 A;  2C2E A;  3QMQ A;  3J81 j;  1H72 C;  1HNX F;  1RKI A;  5KFF A;  2GO8 A;  5IXU A;  3FVY A;  1S1W B;  5G0R B;  3SSS A;  4C11 B;  2BOA A;  3CIM A;  5DET A;  3PJX A;  1MW7 A;  2BUN A;  3KMS A;  1HMV A;  2W25 A;  9ATC B;  4F4K A;  2Z30 B;  3DN9 A;  2ZH9 A;  2M4M A;  2FLO A;  1URN A;  1FVS A;  2QLW A;  2VOP A;  1TEL A;  1Q79 A;  2A1B A;  4EFA C;  3MEG B;  1CS4 A;  1GXT A;  2HFV A;  2EK1 A;  4EGL A;  4F4W A;  5T14 A;  4RNM A;  4NPO A;  3D9B A;  3FEX B;  1ULR A;  4WTO B;  1S6P A;  3N5F A;  1FER A;  3C6T B;  2RUS A;  4KGV B;  3P4U B;  1PC4 A;  1BD6 A;  4DL5 A;  4IDK B;  5KOX A;  2YWF A;  3BPD A;  2H4Y B;  3MCO A;  4DBQ A;  3GYX B;  1WC3 A;  1SH3 A;  1FHT A;  3TYT A;  3GR0 A;  1HBM A;  4RU2 A;  4Y65 A;  1X5T A;  1AW0 A;  2ZH7 A;  3HF5 A;  1DFD A;  3HVA A;  3I0R B;  4LVO P;  4I1T A;  3CD6 S;  3ETO A;  4RW8 A;  2K7K A;  5DG7 A;  4KPY A;  4J90 A;  2UUC F;  1SPB P;  4MKA A;  4USU A;  3HD1 A;  3OTO J;  3C66 A;  1VOM A;  4WE1 A;  2ACM A;  1S1V A;  4Q2L A;  4C8L A;  2DIT A;  3KJF B;  2R7X A;  4DV3 F;  2XMJ A;  4J7C A;  4FF1 A;  4FYD A;  3M1V A;  1WUU A;  1VRU B;  2CNL B;  3IBF B;  2AD9 A;  3W2V B;  2CDR B;  4NZ0 A;  3G82 A;  4CLU A;  1S5Z A;  4OIX A;  5J1E B;  3RRK A;  3I9Z A;  1IBC B;  5KFC A;  3I6P A;  4ZVH A;  4DV7 F;  1YJ9 S;  2MHN A;  2IVM A;  2FJW A;  2HHP A;  3F0N A;  1U1R A;  3AB4 B;  1UVM A;  5CQG A;  5T7L A;  4OYZ A;  3BO2 A;  3DDN A;  4IFV B;  5D4N A;  2ROE A;  4X4V A;  5A0Y A;  3DOL A;  3HD2 A;  5EWE A;  4P72 A;  2FJD B;  3PW5 A;  5LMN J;  4KHR A;  3NS5 A;  4CCH A;  1U8S A;  4OQJ A;  2XC9 A;  1VQ8 S;  1LWC A;  1TL1 B;  4J9L A;  2NXC A;  1MU2 B;  1FXD A;  1XR7 A;  2HFN A;  1Q95 G;  2YWK A;  2QZ8 A;  3PXG a;  2XBP A;  1VQN S;  1GNK A;  1KN6 A;  3OHA A;  2O67 A;  2OTL S;  3PYE A;  3TVZ A;  2HIQ A;  1NDK A;  3VCD A;  5KT2 A;  1OPI A;  3MM6 A;  2F63 A;  3CUL A;  3RBD A;  1MWZ A;  3KLG A;  4ANC A;  2R2U A;  4QIE A;  2K06 A;  1NU4 A;  2QA2 A;  1VRQ C;  5HP1 A;  2MZQ A;  3FBB A;  2JLG A;  2XS2 A;  3KLI A;  4F3O A;  2DNQ A;  3PW7 A;  3PW2 A;  1Y0H A;  5A8W B;  2R7Q A;  4DUT A;  1IBM J;  3IFE A;  4YP3 A;  5IWA J;  2K2P A;  3I31 A;  4RBV A;  2AJ2 A;  4ES1 A;  3HPO A;  4ZKA A;  2B5J A;  3B4D A;  3S01 A;  1SKS A;  3I5A A;  4WU3 A;  1QAI A;  3ZZ0 A;  1NDL A;  3PR4 A;  1T95 A;  4RL1 A;  1KRP A;  3LPE A;  1RWV B;  4UUW A;  2QFI A;  2VG7 B;  1N34 J;  3OL7 A;  3OFH A;  2VA3 A;  3IXQ A;  1S1U B;  3RAX A;  2BAC A;  4DPX A;  3ENV A;  1PC5 A;  4WZM A;  4NLQ A;  1RT6 B;  3OHB A;  1RJJ A;  1M5P C;  2Q6B A;  4JI4 J;  4TXS A;  2ATC B;  3R9L A;  3MR7 A;  2FHO B;  3TA0 A;  4F2R A;  2QFJ A;  1B64 A;  1IM6 A;  3I82 A;  1Y11 A;  5J2N B;  3TAR A;  1K9M T;  3R1L A;  3KHG A;  2C3O A;  3PCO B;  3PHE A;  1RT5 A;  3PG9 A;  2HK2 A;  3LO3 A;  2XTJ P;  1KR4 A;  1LXJ A;  1S0M A;  3PX6 A;  2EKN A;  3W7B A;  2QIF A;  4AQY J;  2DVI A;  2XY7 A;  1T03 B;  3TUZ C;  1SKW A;  2G0J A;  2E7X A;  4RUA A;  3VR1 A;  5A6W A;  1B70 B;  3E01 B;  5KG1 A;  3J7A 1;  2E9R X;  3MAQ A;  3MFH A;  4OV1 A;  4PUO A;  4EYI B;  3MMA B;  1NJY A;  2XMA A;  2SXL A;  4MFB B;  2NYI A;  4RZR A;  3BZQ A;  3NBP B;  1GAO A;  2I1R A;  2E1R A;  1RA7 A;  4B9S A;  3F44 A;  2QLF B;  2O1P A;  1JQG A;  1YJV A;  2FQQ B;  2R42 A;  1TL7 A;  1H6K X;  1YHQ S;  3UN2 A;  5BJR A;  4NZ6 A;  2DIS A;  3EJM A;  1NSQ A;  2JNJ A;  5L46 A;  4YFU A;  1QE1 B;  2BJD A;  1XN9 A;  2CPJ A;  2NZC A;  3OLB A;  4JI5 F;  1M5O C;  2WVC A;  1NHU A;  2U1A A;  1TMJ A;  1K0T A;  3T5K A;  2X1F A;  1JJ4 A;  3RZA A;  2QYG A;  2IM1 A;  3MM5 A;  1UL3 A;  2JOQ A;  1FX2 A;  4DN9 A;  3DDI A;  2LYV A;  2ZIT A;  2HW3 A;  2MKK A;  5CXT A;  2Q3P A;  3UE2 A;  1TL3 A;  3ZZT A;  1OIA A;  4LF8 J;  4LSL A;  4C0O C;  4IRK A;  4RKU C;  3R6L B;  1VHF A;  4RW7 B;  3D1H A;  3B78 A;  3H5Y A;  1Q8B A;  2CAJ A;  2HMI B;  2IJR A;  3DLE B;  4GVL A;  1V3S A;  3KTQ A;  4HR2 A;  1WTB A;  2IVY A;  5EDW A;  4F26 A;  2BOP A;  1RTD B;  4LRD A;  3CXC R;  2BQU A;  5D0E A;  1QJH A;  2HHU A;  2YWE A;  2ZVI A;  4MKV A;  3C6U B;  1T9V A;  5F0U A;  3F73 A;  1YX2 A;  3PY8 A;  2MQN A;  1Q4R A;  5AXL A;  2A18 A;  4N47 A;  1SQE A;  1VIS A;  3SYZ A;  1YZ7 A;  3CW2 C;  1Z1Z A;  1BLU A;  2BJ8 A;  2AEJ A;  5KT6 A;  3V6K A;  2QSW A;  1N5S A;  2LXU A;  4ZVQ B;  2CJQ A;  3SI8 A;  4DR5 F;  1W25 A;  1HLW A;  1KBR A;  1ZAX A;  4LIR A;  1KQK A;  1TFW A;  2W4C A;  1MNE A;  3PO4 A;  2XMM A;  2DNM A;  4DX6 A;  2CZ4 A;  2B4U A;  5A2Q Y;  1IBL F;  4NLV A;  4IG0 A;  1S4F A;  2VU5 A;  4ID5 B;  4TY8 B;  2YNF B;  1HI1 A;  1VLY A;  1RHQ B;  5KFI A;  2FPH X;  4DSL A;  2WW8 A;  1FD2 A;  2MST A;  3A3N B;  2XS5 A;  3FBC A;  1D1U A;  2CUY A;  2V6A A;  2VFS A;  4HL9 A;  4ILR A;  2N7Y A;  5LSL A;  2IC3 B;  2FYX A;  2COL A;  3CJR A;  5CYJ A;  1WEL A;  2Q1L A;  1VYA A;  3FFI B;  4GKJ J;  4I64 A;  4B17 A;  4LFC J;  4WF9 Q;  2QLJ B;  2BMB A;  5BR8 J;  3GIJ A;  2LQ9 A;  1QSY A;  1VIO A;  3KNA A;  3POT A;  5C24 B;  2W8L A;  1TAU A;  3KDN A;  2OPS A;  3UN3 A;  3U7J A;  3IP0 A;  2ZBI A;  4K4W A;  4CT8 A;  3CPW R;  3M2V A;  3I9V 9;  5D0H A;  6FD1 A;  4X4U A;  5LXR A;  4K4U A;  4LRF A;  4NEZ A;  3OFG A;  3Q8U A;  4HTJ A;  2R2S A;  1G1X A;  5GME A;  4Q0B A;  4WJB A;  3PX0 A;  3H40 A;  1JB0 C;  5C42 B;  3ILJ A;  1CQN A;  5F3T A;  1S9E A;  1F6T A;  3I4P A;  2H3E B;  4CM2 A;  2YH0 A;  5J2P A;  3LQV A;  3LW5 C;  4DUY J;  2Y1R I;  2UUB J;  3AOB A;  3HJF A;  1LV5 A;  4RNO A;  2AW0 A;  2HUR A;  2R8H A;  4DZD A;  2B9W A;  2XSJ B;  4ID8 A;  3C14 B;  3RBX A;  4IKA A;  2HGM A;  2UXD J;  2KT3 A;  1JLG A;  1KEK A;  1I1G A;  4PG4 A;  5K14 B;  3LP1 A;  2FY1 A;  1U47 A;  4P2S A;  2GJI A;  3I32 A;  4KGX B;  1JLA A;  4FXW A;  2AJ0 A;  1NEE A;  1FT8 A;  4ZOS A;  3SQO P;  1TV6 B;  2DNO A;  4ZLJ A;  2GJ2 A;  4ERD A;  3KYL A;  4OLP A;  2D41 A;  1WD6 A;  1ZH5 A;  3TX8 A;  4FDF A;  5B0C A;  3QGH A;  3GB0 A;  5J2Q A;  1H73 A;  4LSN A;  4DCJ B;  2KYZ A;  3OL6 A;  5J2M B;  4QQB A;  4A8Q A;  1QAJ A;  3AA8 A;  4LF9 F;  1LWX A;  4X4R A;  1M90 T;  4G1P A;  2V2Z A;  4LVN P;  1H2T Z;  2AHO B;  4OI3 A;  4J9S A;  3PIO Q;  1WAC A;  3DKD A;  3N5B A;  4P73 A;  4JV2 A;  1S1X A;  4F7V A;  4FYX B;  2X3G A;  3K7R A;  4QWE A;  2DR8 A;  1Q7L B;  2Y8W A;  3WQP A;  2DGW A;  1IJF B;  2MZS A;  4F36 A;  1LWE A;  4DPT A;  1R27 B;  4B3S F;  1NCL A;  1U02 A;  2J8S A;  1X4D A;  1YKW A;  4CQ1 A;  2LQJ A;  5I3P A;  5A6P A;  2HHH J;  1YVF A;  3K5N A;  4ELT A;  4DV0 F;  5AXM A;  3BDE A;  1ARO P;  5B08 A;  1H3D A;  2R8G A;  1AZS B;  5BXI A;  2E1M C;  2MEW A;  3VAF A;  2JSX A;  3AOA A;  1TVR B;  1F3V A;  3Q83 A;  1S12 A;  1GMW A;  5EWG A;  4MH8 A;  3UQS A;  1IR2 A;  4LFB F;  3BGF A;  3Q22 A;  3KHR A;  1TL5 A;  2CG4 A;  1NH7 A;  1ZM9 A;  5CCM A;  5FDL B;  2HS3 A;  4M5N A;  5ETM A;  5FLX Y;  1E6V B;  3EZU A;  2V2Q A;  1XNQ J;  1TFY A;  5F8M A;  4ITS A;  2YKO A;  2IM0 A;  3TQ1 A;  1SL2 A;  4ICL A;  1KVJ A;  4YS2 A;  2U2F A;  4UQG A;  1IBK F;  2X7I A;  2XSF A;  3G96 A;  3W62 A;  2UXB J;  3BYP A;  4TN2 A;  4ER8 A;  3Q23 A;  4DU7 A;  4E98 A;  4V19 J;  8ATC B;  3GJS B;  3ZTQ A;  3N0V A;  5HVH A;  2ZC4 A;  2RS2 A;  3ONQ A;  3QGG A;  2UZA A;  2H54 B;  2GQQ A;  2MY8 A;  4QIW D;  1CJK B;  2VKZ G;  1P6T A;  4P75 A;  3NOG A;  1P9Q C;  2HFU A;  4YHH J;  3GFY A;  3GYG A;  2Z2Y B;  2JEF A;  2I2Y A;  5FD1 A;  3W5X A;  2G1D A;  3AJ2 A;  4OYB A;  1Q8K A;  4Y34 A;  4QIF A;  2IIH A;  5K8P A;  3GFZ A;  1T05 B;  2QE5 A;  3NCQ A;  1L3K A;  3GFX A;  2VV5 A;  4IFY A;  3SQG A;  5HMX A;  3J7Z 5;  2W2N P;  3QIP B;  4IUF A;  4YEA A;  3PNI A;  2K1R B;  3NXZ A;  2H48 B;  2P2C B;  4A8K A;  5LSR A;  1SCJ B;  2M8H A;  3HHL A;  3EZ5 A;  2OPQ B;  2HVZ A;  1EX8 A;  1N5V A;  5DDO C;  4CTA A;  4DUZ F;  2BE9 B;  3M6X A;  5K9F A;  3TZW A;  4RX6 A;  4J91 A;  1RYR A;  1T9U A;  3IMQ J;  3QRP A;  1S97 A;  2KDO A;  2VL1 A;  4QZV B;  3M8R A;  2XCP A;  4A8W A;  1A0O B;  3DOM A;  3Q8P B;  5AJ3 F;  1NZA A;  2DTJ A;  3D0H E;  1I94 F;  1NK4 A;  2LDY A;  1WG5 A;  1RLD A;  4LF6 J;  4DSF A;  3BSC A;  2PDA A;  2ZUG A;  5JJB A;  4KSE B;  1PAU B;  5KFQ A;  2Z56 B;  2BRK A;  2B9Y A;  4F0K A;  2CVE A;  3KG0 A;  2M9K A;  3PRD A;  2OLW A;  1ZPV A;  3C15 B;  2RU3 A;  2YNG B;  2C3U A;  4DCP B;  3ZZY A;  4HYK A;  3US5 A;  4X64 J;  3R3T A;  1HWI A;  2FHM A;  3ZC4 A;  2GML A;  3PEJ A;  1YBT A;  1XMQ J;  4X4P A;  3M2U A;  1CUL A;  2RDD A;  4DSI A;  2V34 A;  1JLC B;  1CPZ A;  3QJL A;  2EWH A;  3GTY X;  2AJ1 A;  3W66 A;  2OIH A;  1HQ2 A;  4F0H A;  2R8I A;  1EIY B;  2OFH X;  3V81 A;  4WCE Q;  1NK9 A;  3MEC A;  3KJQ B;  1HPZ A;  2VQE J;  2OSQ A;  3BEG B;  2WSF C;  1WKJ A;  3VWS A;  4IQM A;  5U47 A;  1N0U A;  2NR0 A;  3QSY B;  2J9D A;  3MPY A;  1YJN S;  4GKK F;  1YJ7 A;  2E5L J;  1T94 A;  1KON A;  2GVZ A;  4ZJL A;  2V9W A;  4DS4 A;  1GMU A;  3PJ9 A;  4LSZ B;  2W2M P;  3ICL A;  1KQS R;  3UR3 C;  3W60 A;  1C2P A;  4MMO A;  4URS A;  3V6D A;  2MMY A;  2PC6 A;  4EO8 A;  3T41 A;  4O4G A;  1CS4 B;  4U67 Q;  2DH9 A;  2X3D A;  3K17 A;  1S59 A;  4C3K A;  4I6A A;  3OT9 A;  1QLN A;  4ZIV A;  1S6P B;  1TQL A;  1DQ9 A;  5B0A A;  4JV5 J;  4YR2 A;  3CVK A;  5SZT A;  3EX7 B;  3HX9 A;  2YX4 A;  4ZHR B;  3RRH A;  1HWU A;  2DIU A;  1MMN A;  5GAH I;  2OFG X;  2BM1 A;  3OXF A;  2NXJ A;  5KFN A;  3K8V A;  3OBI A;  1G4C A;  1S9F A;  4URG A;  1BMQ B;  3AFG A;  4FNI A;  3O5T B;  3D28 A;  2WVB A;  3S6E A;  4RW8 B;  3CDA A;  1AUS L;  3V4M A;  3CDU A;  3QAU A;  3VVT A;  3NOC A;  3RTV A;  4WE1 B;  4M8L A;  3L9Z A;  5K8N A;  1S1V B;  4W4M A;  4XTT A;  2IM2 A;  3NMR A;  4ZP9 A;  1SIW B;  1X7V A;  4P9S A;  1OY6 A;  5AXK A;  1QVG R;  1RTJ A;  2VC0 A;  2FVP A;  4JYA F;  5F8I A;  1RWM B;  2LFV A;  3D3C J;  5D77 A;  1VRT A;  5KFK A;  3G82 B;  3T1Y F;  1FRX A;  1U09 A;  4G1I A;  4OYW A;  3T1A A;  2VJV A;  4USV A;  3G8T A;  3BGU A;  4PG6 A;  2R2T A;  1QUV A;  2N3L A;  5T7L B;  2WSC C;  1U1O A;  5HAO A;  5DGA A;  4ZVG A;  4IRD A;  5A0Y B;  3DOL B;  3VGV A;  3IRX A;  2WVE A;  5KFY A;  2LDI A;  2HSE B;  1LWC B;  2XMW A;  2IDE A;  3QAT A;  2JLE A;  2H9Z A;  1WC0 A;  4I0W A;  3U1N A;  1KLN A;  4PPZ A;  3DYA A;  3M9O B;  3BN7 A;  5J1P A;  4MAK A;  2B9E A;  1K73 T;  4CO4 A;  1FA0 A;  2CYY A;  4MJK A;  1UFK A;  4WYL A;  1UW4 A;  2ZWP A;  2M7S A;  4USI A;  4O3S A;  5KAK A;  1SC1 B;  3M7V A;  1OWX A;  4JI3 J;  1RAF B;  3MM6 B;  3B6B A;  1VDH A;  2PI5 A;  4AND A;  3KLG B;  3KOA A;  4FBU A;  2IAJ A;  3K0J A;  4DV5 F;  2ZC3 A;  1X31 C;  2XY6 A;  2XYH B;  5HP1 B;  5GAE U;  5B0B A;  3KLI B;  1UVK A;  2XCA A;  3SV3 A;  3HSJ A;  4Q8E A;  4AYB D;  1I51 B;  3QID A;  3HHL C;  3KG1 A;  2QMX A;  4NWB A;  1R8P A;  3JSB A;  5D4L A;  2BDP A;  5K5M A;  3UR0 A;  8AT1 B;  4DV1 F;  2DR6 A;  1K44 A;  2CG8 A;  4DR7 J;  1VBK A;  4P2X A;  2B5J B;  3NNA A;  2AJF E;  3PRV A;  5HQL A;  2HZV A;  3IAM 9;  2JX2 A;  3HHE A;  1KFS A;  4I67 A;  3H7H B;  3U1M A;  1WHV A;  2IBK A;  2V4R A;  1FI4 A;  1K8A T;  2B4V A;  2E1A A;  4X65 J;  1Z2L A;  2MZT A;  4BS2 A;  1HBO A;  4CNZ A;  5KFS A;  3W65 A;  3I0R A;  3LF0 A;  5CYQ A;  4WFN Q;  1RU1 A;  1VC0 A;  2FJE B;  4GC7 A;  1T3O A;  2W9B A;  1IQT A;  2EXU A;  2Z0G A;  1BQM A;  2HFS A;  3TWZ A;  2XZW A;  4O44 B;  2V8P A;  1B0P A;  1RT5 B;  3PAC A;  1C1C A;  1DJ0 A;  3HT0 A;  4TQR A;  2NXN A;  3DNC A;  5HMY A;  1FWL A;  1JK9 B;  2C3M A;  1PIE A;  1VRU A;  3FCV A;  2MGZ A;  3EDQ B;  3MUM P;  3PIP Q;  2E5G A;  2ZOG A;  4OI1 A;  2AX1 A;  4QJV A;  5K8M A;  5DDP C;  2UU9 J;  2GCF A;  5AXN A;  3O8W A;  3BPS P;  3PFE A;  1S0V A;  1F1B B;  1TKX A;  1JJC B;  3QZ7 A;  4P7T A;  4PUO B;  2UVU A;  5DZ6 A;  2YVS A;  3MCS A;  3TQE A;  2ZOF A;  2C2M B;  2IMW P;  1ZBT A;  3A8J A;  1YJT A;  4J9K A;  4TYB A;  4F3Q A;  1TL7 B;  5C25 B;  5EX0 A;  4NOH A;  3NGD A;  2AF6 A;  3UD5 A;  4WPA A;  5GAD U;  3BM7 A;  2VIH A;  3ET6 A;  4DJB A;  4U8Y A;  3JSR A;  2VKR A;  2GHV C;  2F8M A;  1S9G B;  4OHW A;  1X60 A;  2O01 C;  2WVD A;  4IRC A;  3M8S A;  3DLG B;  4WXO A;  3LP2 A;  5J1N A;  2HHX A;  4C0H A;  3CO9 A;  1Y5N B;  3MM5 B;  4NLP A;  4FP9 A;  1C4A A;  3BR9 A;  1LK7 A;  1R6Y A;  1TL3 B;  4WK3 A;  4RO0 A;  3LAL A;  3PDN A;  4DFM A;  3L09 A;  2MKC A;  3KK2 A;  1WEZ A;  3R27 A;  3PZP A;  5L1J A;  2AU0 A;  1KTQ A;  2BXJ A;  2B6A A;  1HL6 A;  1R8A A;  3V5R A;  4QR0 A;  1T9Y A;  4NML A;  1XIQ A;  1Q7Y T;  4RR5 A;  3HKW A;  2V9K A;  4K8R A;  1RWO B;  1RT7 A;  1DHM A;  3D2W A;  2F4V J;  4R25 A;  2ALZ A;  4PQU B;  3M8Y A;  3SCK E;  4JI2 J;  5KFR A;  1RWN B;  1K0V A;  4DZ6 A;  4S0M A;  4ETX A;  5H9E J;  2BYC A;  1TKZ A;  4CZC A;  4EEY A;  1N52 B;  3A3O B;  3CCW A;  1HWJ A;  3JSY A;  3KXD A;  2O3D A;  1FDD A;  1Q86 T;  2FD2 A;  3L95 X;  5DM6 Q;  3R8Y A;  1RAD B;  3T3F A;  1MN9 A;  1SUQ A;  2RIJ A;  1CJV A;  1S77 D;  3NG8 A;  2NSC A;  4LF5 J;  1IKW A;  5L1L A;  5A2Q U;  4EI2 A;  1YIT S;  4IG0 B;  4HVZ A;  2B7B B;  4X4T A;  2AYB A;  3NS7 B;  3G87 A;  4QOT A;  1J5E J;  1G6B A;  4KR0 B;  3CMQ A;  2V4J B;  4ECU A;  1FKA F;  1RAI B;  2QX0 A;  2GHW A;  1SQF A;  2IRX A;  2QTW A;  4HHJ A;  1WF2 A;  3T5H A;  1FVQ A;  4KFB B;  3HSD A;  1Q5Y A;  2UUW A;  2R3V A;  1XJW B;  3EGN A;  2AYE A;  4ILM A;  3GV7 B;  4YB1 P;  2JH3 A;  2GQC A;  1HNX J;  2J9E A;  2BW2 A;  4DDF A;  3BB5 A;  1FKP B;  5ETN A;  3M4X A;  2VPY B;  3SSR A;  4QR1 A;  3MMA A;  2BW7 A;  1P9Y A;  4PYD A;  5KFG A;  3GSD A;  2DNN A;  4MFB A;  2DHX A;  3POT B;  3DXS X;  3I5C A;  2DGV A;  1ZTW A;  1RWK B;  4ILL A;  2ZZN A;  2OPS B;  1BQX A;  5DG8 A;  1MN7 A;  4FYY B;  4KYZ A;  3WIV A;  2ADC A;  4ZCI A;  1BXN A;  2ACY A;  5D3G A;  3M2V B;  1UEU A;  2B0G A;  2F3J A;  3MMB A;  2I8E A;  1U0H A;  3N6L A;  1X5O A;  3R5G A;  1HFE L;  4PRF A;  5KG2 A;  4Q0B B;  3AH6 A;  4QCL A;  1AFI A;  3B82 A;  3O3L A;  3B8H A;  3GFH A;  3CCU S;  2LU2 A;  1DTQ A;  1SL0 A;  3M32 A;  4OL8 A;  2DEJ A;  2OP5 A;  2ZJR Q;  3UD3 P;  4Q2M A;  5J2P B;  1O0P A;  3OPK A;  5AE2 A;  2GV1 A;  2PFF B;  1PYS B;  3LAM A;  3J80 Y;  1S48 A;  1WOS A;  4IR1 A;  2HWH A;  2IPO B;  2GMJ A;  4F8R A;  1P8G A;  4CH7 A;  4FPR A;  2CVI A;  4NYZ A;  2I0X A;  2AQ4 A;  3HP6 A;  4WK1 A;  1AB8 A;  1JLG B;  1HNI A;  1CJU A;  1GXU A;  3PFO A;  2UUC J;  2FVC A;  3LP1 B;  2JL9 A;  2YWH A;  4RW7 A;  4NYP A;  3IO1 A;  5CH7 B;  5IV3 A;  1YGY A;  1JLA B;  2UVW A;  1H0H B;  4OHX A;  4DV3 J;  2OHD A;  2W9A A;  5K20 B;  1U2R A;  1RTD A;  5HN0 A;  2CQ1 A;  4DR2 F;  1N36 F;  2KT2 A;  4QYZ J;  4KT0 C;  3KHL A;  3T5J A;  1FE4 A;  2OMO A;  4MK9 A;  4HH1 A;  2HHV A;  5J2Q B;  4LSN B;  3PYD A;  4DV7 J;  2B51 A;  4J9N A;  3LWL A;  4QIG A;  4PG8 A;  4DX5 A;  2V8H A;  4DL4 A;  3UFC X;  1WOO A;  2RDI A;  2RKI A;  2XLJ A;  3GSI A;  2MQO A;  4M5J A;  3CMA S;  3PEH A;  2DHS A;  4M63 A;  1RWP B;  3DMJ A;  1S1X B;  3NMA A;  4ALZ A;  3FUY A;  2LCW A;  4FKX A;  1Q16 B;  2DKO B;  1OSD A;  2AYM A;  2CNO B;  4ED3 A;  1UKU A;  3TEG A;  1KD1 T;  1R6V A;  2CPE A;  2F1F A;  3CO0 P;  4UQT A;  5CZV A;  4HT5 A;  4NYO A;  1Y7P A;  3HMJ G;  1Q0N A;  2R7T A;  2PMZ D;  3M2R A;  1RI7 A;  3EPG A;  3D5M A;  2VG6 B;  4AXJ A;  2MKJ A;  3NGU A;  1KKH A;  2HZC A;  2IRY A;  5F0W A;  4UY8 5;  2MZJ A;  4NXM F;  3PR5 B;  1ITP A;  3CWJ A;  4OX8 A;  2VPW B;  1GMV A;  5D8H B;  4U7U K;  3VHQ A;  3KJV A;  5KTQ A;  3QJJ A;  2BX6 A;  4HAC A;  4B3R J;  5FLX U;  3SZ2 A;  1PG5 B;  3RBZ A;  2JDJ A;  2LEB A;  3IA0 A;  2F4F A;  1D09 B;  2BZ2 A;  3FK4 A;  1S1T B;  4ZIW A;  2M5Y A;  4ICL B;  3ZZR A;  3ZNU A;  2KHD A;  4BWM A;  2QC3 A;  3BJY A;  5IFM A;  3OR1 A;  5E33 A;  2MQL A;  3LGN A;  4YOE A;  2HBZ B;  3KJN B;  5D6G A;  2NLW A;  1FK9 B;  2LEP A;  1N4L A;  4U95 A;  5IV4 A;  2FLN A;  4U8V A;  3MPU B;  2JC0 A;  4JP8 A;  3MZI A;  4LF7 F;  4A8X A;  2ZNY A;  2HQI A;  1TL4 A;  3IWN C;  4PAA A;  2YQ3 A;  3IG1 A;  4A4J A;  3WC2 A;  2WON A;  3AA9 A;  3C14 A;  4Y2C A;  2LP4 A;  5LSO A;  4CT9 A;  1FKO A;  3C19 A;  2ZDP A;  4P74 A;  2OSR A;  4ZN1 A;  3CJT A;  2EW9 A;  1WHX A;  4MKB A;  3K57 A;  4RBT A;  3G9C A;  2EFG A;  2UP1 A;  4IFY B;  5JVH Q;  1R89 A;  2JFD A;  5B7W A;  3CIZ A;  2MYF A;  2AJ4 A;  3HUL A;  2VF3 A;  2RUG A;  2DR7 A;  3HHL B;  1SB6 A;  2CRL A;  1T02 A;  4ELV A;  4DFP A;  2J9D E;  5ETT A;  5ETL A;  4CTA B;  1NM2 A;  3SDE A;  4XIU A;  1HW9 A;  2RE1 A;  2RRB A;  4BDP A;  4JI1 F;  3HZE A;  3CME S;  1R8B A;  1WOR A;  1ZA2 B;  3AD7 C;  1LW2 B;  1HQU B;  3MOJ B;  5HBM A;  3QRR A;  1S6O A;  5ITH A;  3DOM B;  2LU1 A;  4KB7 A;  4DXL A;  2NXE A;  4A8O A;  3HZG A;  4DR6 F;  1QTN B;  1A9N B;  1VQS A;  4OI4 A;  3BQ1 A;  3SCL E;  3BN4 A;  4F4X A;  2E1C A;  2Y0B B;  4NLW A;  2GVD A;  4NLD A;  4QR2 A;  4JI5 J;  3AXK A;  5B0G A;  1D9D A;  2XHC A;  1NLK L;  3CTR A;  2C2Z B;  2YKM B;  1RBA A;  3GJQ B;  1NDC A;  4Y6I A;  2RVJ A;  2FHJ A;  1EAY C;  5C2C A;  4F67 A;  1VGY A;  4LF8 F;  1RWX B;  2BA9 A;  2WBM A;  5KFL A;  1RWU A;  4NCG A;  3MXH P;  1XEZ A;  4F02 A;  4QYR A;  2J0X A;  1NJI T;  2GAG C;  3TJ8 A;  4LRC A;  4AE5 A;  3LTO A;  1H7W A;  1CUL B;  1WKK A;  1XMB A;  3SCJ E;  3N6N A;  5FDL A;  2G0C A;  2ZHO A;  4WFY A;  4LFA J;  3TZX A;  2CZV C;  1FD8 A;  1ZET A;  2VBW A;  3TUI C;  3V81 B;  3MEC B;  3T5L A;  1HPZ B;  3MED A;  2J7K A;  5IT0 A;  4F4Z A;  2VD3 A;  1M0S A;  3IR7 B;  1YDL A;  2HVE A;  3GV8 B;  3OXL A;  3NWR A;  1YJW S;  2CNK B;  3KMQ A;  4O0I A;  2GVZ B;  3ITH A;  1SKR A;  2PA3 A;  5GVQ A;  1X0P A;  3VGS A;  4ZIT A;  1TUW A;  2XUL A;  1O5J A;  1PJ6 A;  1M1H A;  2N3O A;  1AFJ A;  2PA8 D;  5KG5 A;  2G4B A;  3V6D B;  7FD1 A;  4K0K F;  5M2U A;  3J7Y U;  2IJF A;  4O4G B;  4DR5 J;  4M5L A;  1F5B A;  4Y0F A;  3I55 S;  4FF4 A;  2VH7 A;  1IBL J;  3MTK A;  1SV5 A;  4AT1 B;  3KLH A;  2IYG A;  5ETS A;  2DT9 A;  2HQC A;  1K47 A;  3DGP B;  1HBN A;  1SI9 A;  1T05 A;  3HHD A;  1FEH A;  2VQF F;  4X4Q A;  2V68 A;  1KP6 A;  4DI6 A;  2BR0 A;  1X9W A;  4ZN3 A;  1U8W A;  2L3M A;  2KN4 A;  2G2Z A;  4IO9 Q;  4P71 A;  3K5L A;  1VQ7 S;  2PMH A;  3GG0 A;  4JI8 F;  5IZH A;  3UNY A;  4FYV B;  4PXB A;  3RJM B;  4CO1 A;  1MSW D;  4DL0 C;  1N32 F;  1NJX A;  4J37 A;  4FF2 A;  4LQ9 A;  3VQT A;  2AIR B;  4GC6 A;  1HBU B;  1RTJ B;  1BE4 A;  3OXG A;  2CPZ A;  5KFM A;  4PAB A;  4I6Y A;  1VRT B;  4DV6 F;  3QZ8 A;  2DCL A;  4PYA A;  3VAH A;  4A8M P;  1Y5L B;  4B9U A;  1PO6 A;  4OZL A;  2HGL A;  1RAO A;  2ZH1 A;  3LGM A;  4L75 A;  2J76 E;  3PTW A;  3GV5 B;  4M5I A;  2ZH4 A;  3GYN A;  3QWU A;  3RW7 A;  3IRX B;  2CQ2 A;  3O1L A;  4B9T A;  1WJ9 A;  4M5G A;  3D54 A;  3DM2 A;  3BH7 B;  2M0G B;  4WYW A;  2XMV A;  2ZH3 A;  3KWM A;  3DYA B;  4DPU A;  4IYQ A;  4F2S A;  5KOW A;  1NK5 A;  1PBU A;  2PO4 A;  1U2F A;  1JLC A;  4LF1 A;  3KG4 A;  1SC3 B;  3QT8 A;  1KFD A;  2CNN B;  3WDO A;  1CC7 A;  4KRW A;  3UVJ A;  4Q45 A;  1UWB B;  3D6F B;  1S72 S;  1R43 A;  3M8Q A;  1BHN A;  4LRB A;  4C3L A;  2IAJ B;  1Q5V A;  2R7S A;  3CCZ A;  3MR2 A;  1F5C A;  1IXK A;  3TAN A;  1TKD A;  2E1P A;  1YK9 A;  3T9Z A;  3ILO A;  2QL5 B;  3NKY A;  1DZ5 A;  4W98 A;  5DM7 Q;  4TLQ A;  2W01 A;  1X4C A;  4L6V 3;  3Q2S C;  2FLP A;  4CO5 A;  4LF9 J;  2DNG A;  4GO7 X;  4WFZ A;  2DNK A;  3R5A A;  2Z2M A;  3QLH B;  5KT4 A;  5A76 A;  2YNH B;  4ANE A;  3LH2 S;  1RQ0 A;  2ZBQ A;  3KK1 A;  4BWJ A;  2H1Y A;  4RUB A;  3G8S A;  2LEA A;  1SJ4 P;  1QM9 A;  2XEX A;  2Y8Y A;  3B4M A;  4NLO A;  3DRR A;  2YTC A;  3LAN A;  2XZD B;  2MB0 B;  3OJS A;  3LA0 A;  4ZHR A;  3ELH A;  3EYZ A;  1F2H A;  4ELU A;  2VOD A;  2KVQ E;  1W7W A;  2C22 A;  2VOO A;  4R0J A;  4B3S J;  3Q8R B;  2HEK A;  2PI4 A;  1HBO B;  4KTQ A;  2QLB B;  4NLR A;  2HLU A;  3FBE A;  3G4S S;  4DV0 J;  5CYQ B;  4HDG A;  3CJ4 A;  2VFV A;  2YNI A;  1VFJ A;  3P5B P;  4ECS A;  2W9B B;  4Q43 A;  4J5O A;  1FTR A;  1BQM B;  1X9S A;  2QGF B;  3H0P A;  3T19 A;  5C2G A;  2J5A A;  1C1C B;  4LFB J;  1MML A;  2ILY A;  1TKT B;  4QWD A;  1RAC B;  3WIU A;  1XNQ F;  2QV6 A;  1Y3K A;  3OR2 A;  2EFN A;  4L73 A;  1CC8 A;  4Y2K A;  1MG7 A;  2MGZ B;  1NND A;  5D15 A;  2FHJ D;  1G3O A;  2KM8 B;  1X4G A;  4C6A A;  1V5V A;  3J7A N;  1UWA A;  4MYU A;  4GVB A;  5KFZ A;  5D4P A;  4ZCL A;  2R7U A;  2ATL A;  5ETP A;  1RK8 A;  1TKX B;  4EWT A;  4OYP A;  1RT1 B;  3MFI A;  3EM1 A;  3LP0 A;  5THW A;  3TI0 A;  4JBC A;  4DMZ A;  7FDR A;  5HQ8 A;  1IJE B;  1S0O A;  3IM9 A;  2QYC A;  2WHO A;  2AJQ A;  4KC5 A;  2HIY A;  4OV6 A;  4LBI A;  4LBH A;  1KHV A;  1F60 B;  4NXN F;  3UD4 P;  3W5Y A;  3R97 A;  3N6M A;  1LQ9 A;  3BKT A;  1T3N A;  2ZUA A;  4ED1 A;  3TW0 A;  3H4D A;  2BRL A;  2J8A A;  3ET6 B;  3DLK A;  4OYM A;  1NK0 A;  1FRH A;  1JLF A;  3D7S B;  5JXS A;  3Q89 A;  4USH A;  1HD1 A;  2E5H A;  3LP2 B;  3ZNJ 1;  4OX9 F;  3HSZ A;  2QT7 A;  3RB3 A;  4R0E A;  3JTP A;  3VGT A;  3PV8 A;  1UMJ A;  5C5J A;  4H4K C;  1NBE B;  2P6T A;  3R7B B;  2MQP A;  2OEJ A;  1KS2 A;  3K89 A;  3DRX A;  4C7Q A;  4H4O B;  3D1Q A;  1NB7 A;  2HQF A;  3KK2 B;  4ECX A;  4DUZ J;  3O2I A;  4UF4 A;  3OFE A;  2B6A B;  1D8Y A;  3IWX A;  2Q6C A;  3DHX A;  5KFO A;  2V8V A;  4UTG A;  1NKC A;  5KG7 A;  2GZO A;  1DRZ A;  1RT7 B;  5AJ3 J;  1SKU B;  5GAE I;  4LMZ A;  4DSE A;  5DDQ C;  4NA3 A;  1TKZ B;  1IVZ A;  2QRR A;  4P7V A;  3NAH A;  4J9Q A;  1CQM A;  4H54 A;  1RZM A;  2VZ9 A;  2FJB B;  4N76 A;  1YTY A;  1RSC A;  1IM4 A;  3HFZ B;  1EET A;  3TAM A;  2R8K A;  2YWW A;  5KFJ A;  2V50 A;  4XDC A;  1KWM A;  4X64 F;  3G71 S;  1SUQ B;  1CJV B;  4DPW A;  1IKW B;  4F50 A;  4MIB A;  2KXN B;  1VQ5 S;  4DX7 A;  3M8P A;  1WKL A;  2P9C A;  1J2V A;  4O44 A;  4MIA A;  2L48 A;  2GC8 A;  2HRY A;  3LOU A;  3CJQ A;  4HKQ A;  2OEL A;  4WBF A;  2VBX A;  1BGX T;  5DQH A;  1WG1 A;  4OZ2 A;  1AUD A;  1YG0 A;  1FE0 A;  2W2O P;  5F3Z A;  3NGK A;  1UVN A;  4MTP A;  4RUH A;  2LMI A;  4ES2 A;  2W9C B;  1HD0 A;  1T7P A;  1WTF A;  5IT4 A;  1AA1 B;  1EAR A;  4ZPD A;  4DF4 A;  3TA2 A;  2CQD A;  5HVG A;  4DPO A;  2WSE C;  2EKY A;  4GKK J;  2C3Y A;  1RTI A;  2ASY A;  3PW4 A;  4K5R A;  5L1I A;  3FQL A;  4DLE A;  1OSC A;  1D3W A;  5H9F K;  3CJK A;  1O51 A;  4I2Q A;  1FCA A;  5C25 A;  2B56 A;  3D67 A;  4DQQ A;  1NKB A;  4C3M A;  4YME A;  3DHW C;  3KHH A;  3FSX A;  2L08 A;  1UVI A;  5D3G B;  5IC4 B;  4TKT A;  5ETV A;  1N0V C;  3MMB B;  3QBC A;  1U0H B;  1VCT A;  3D1O A;  1F9F A;  1FRI A;  4WTY A;  5CYM A;  3MD3 A;  1IWG A;  1WNE A;  4QPT A;  4DQI A;  1S9G A;  2WCX A;  1B3T A;  3DLG A;  4RW6 A;  1WSV A;  3MMC A;  4TU8 A;  4LF2 A;  1DTQ B;  2XO7 A;  3M32 B;  2HNZ B;  5B0F A;  3U27 A;  3G6V A;  1OYD A;  2IA6 A;  2XI3 A;  1WI6 A;  5CA5 A;  3MGJ A;  1TU0 B;  2DNR A;  4XDD A;  1IKY A;  4JV1 A;  1LXN A;  1A7G E;  5GAD I;  2ADB A;  3OTB A;  2KB2 A;  3TZZ A;  1HNI B;  1CJU B;  2GIQ A;  7AT1 B;  4ZVR B;  4YB6 A;  3TO8 A;  1UJ4 A;  2IFX A;  1O8B A;  2J7U A;  1YJR A;  4OMF G;  3CDW A;  5HAN A;  2CPI A;  3L4B C;  4JYA J;  1KVI A;  4O3N A;  2KG0 A;  3OTC A;  3RB0 A;  5KG3 A;  4PQU A;  3EXC X;  1NME B;  3T1Y J;  2AGO A;  1Y9O A;  3BO3 A;  3AQP A;  2Y1L B;  1FJG F;  1HWL A;  4TU7 A;  4IG3 B;  4WZQ A;  1NXI A;  4FZV A;  5SUH A;  1CSJ A;  5KT3 A;  2ZOM A;  2XZT B;  2YPZ A;  1N5Q A;  4OJG A;  1IQZ A;  4Y3C A;  1FNO A;  2RKI B;  4KHP J;  4QWA A;  2V69 A;  1F3F A;  2ZH6 A;  4OX6 A;  3EDR B;  3FSY A;  4PXC A;  4NA2 A;  1FRJ A;  3DMJ B;  3P5T L;  1U6F A;  4K4V A;  4J9V A;  1D0E A;  1UJ5 A;  5AE1 A;  1RP5 A;  1VI7 A;  2V4J A;  3IM8 A;  2KI2 A; 
#chains in the Genus database with same CATH homology
 2F1F A;  2BJ7 A;  3LGH A;  2BJ3 A;  2HZA A;  2FGC A;  2Y3Y A;  2WVF A;  2WVE A;  2NZC A;  1Q5V A;  1Q5Y A;  3PHT A;  2WVC A;  3OD2 A;  2CAJ A;  2BJ8 A;  3BKU A;  2WVD A;  2CA9 A;  2CAD A;  3QSI A;  2WVB A;  2BJ1 A;  2BJ9 A;  2HZV A;  2PC6 A;  3BKF A;  3BKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...