5J2PB

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and a second efda-mp at the n-(pre-translocation) site
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
425
structure length
400
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
total genus 110
structure length 400
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2pB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pB03
3LP2A 1TL3B 4O4RA 4TY8B 1DTTA 4I2QB 2YNFB 2WCXA 4URSA 2R8GA 3DMJA 3FSIA 1C2PA 3MR6A 2FLLA 3KHRA 4Q45A 3N6LA 5KFOA 5K14A 4ECTA 4ED7A 1RTDA 3QLHB 3VQSA 4K4SA 3DLKA 1S6PA 3MTKA 2OPSA 3BREA 5KG4A 1YVFA 2ILZA 3M8PB 4XPEA 4KKOA 3KLEB 2W7OA 2DPIA 1SV5B 3BGRA 4H4OA 4KFBB 3KK3B 4ZVEA 2BQRA 1S1WA 4IRDA 2IJFA 4IDKA 3CJ5A 3KLFA 2HNYB 2OPPA 3DRPB 2R2UA 3GIJA 3DOKB 1S1UB 3C6TA 4DL4A 2JEFA 3IRXA 4KB7A 4TYBA 4PQUB 3E01A 4ZVFA 3Q8RB 2AGPA 1MMLA 4IH5A 2C22A 1DLOA 4ED2A 4JV2A 5I3UA 4IFVB 3NAHA 3G6XA 5F8MA 1T94A 1QAIA 3DLGB 5KFUA 1T03B 1RTJB 1S9EA 5I42A 4WE1A 1GX6A 2R8IA 5CYMA 2W9BB 4ICLA 4O4GB 1HQEA 4QWDA 2E9RX 3IS9B 1S6QA 4IFYB 3BQ0A 1RA6A 3ISND 3GIIA 1JLFB 1TKTA 2AX1A 5KFEA 3BSNA 4DL5A 1TVRB 5D3GB 4NLSA 1C1BB 4NCGB 4JUZA 4URQU 4NRUA 3LP1A 2I1RA 2B5JB 5HLFA 3KHGA 5J1EA 3I5CA 3V6KA 3OHAA 4IRKA 5KFBA 3KK1B 4OL8A 4KV8A 2D7SA 4RW6A 3CJ3A 5KFTA 5DGAA 2JEIA 2HWHA 3I0RB 4R8UA 4F4WA 2R8KA 2YKMA 5KFKA 5KFIA 1XR5A 4K4WA 1BQMB 2J6SA 2E9ZA 1JIHA 3KJVB 5J2MB 5KFJA 4ECZA 3SI8A 1QAJA 3NAIA 4URGA 3MR2A 3EPIA 1IKVB 1N4LA 2RDIA 1QUVA 1IKWA 3MF5A 4QWBA 5F8NA 1TV6A 1CSJA 4IH6A 1WNEA 2V0NA 3QO9A 3H40A 1RTIB 4LQ3A 2HNZA 2WOMB 3JYTA 3CDWA 4ZMMA 3H2LA 3QIPB 1HMVB 1VRTB 1RT7B 1JLEA 4O3OA 1C0TB 3I5AA 5HP1A 5KG5A 2W8KA 3OL6A 3RB6A 1LWCA 5C24A 3IN5A 4FBUA 1TKXB 2YNIB 1VRUA 3T5JA 4KAIA 1S1TA 2BANB 1FKOB 4RW8A 2QE5A 5FDLB 3DI6A 4MFBA 3KLIA 3H5XA 2R8HA 2IMWP 1D1UA 5KG1A 3DOLB 4RU9A 2JEJA 1N6QB 3QGGA 3H98A 3GIMA 2FLNA 4DL6A 1DTQB 4LSNA 2RKIB 4RW9B 4KO0A 4PWDB 3TAMA 2ZE2B 3EPGA 3PW0A 3MEGA 2J6TA 1RT3B 1JLAA 3JSMA 1JLBA 4J9NA 4RUAA 2UVVA 1T05B 4EYIB 3KLGA 3V6DA 4IQXA 4R5PB 4U6PA 4J9KA 1IKYB 4NYZA 3HVTA 4J9RA 3SFGA 1HYSA 1TKZA 5L1KA 4ID5B 2IA6A 4M95A 3MEEA 3MFHA 1S10A 2HAIA 4FS1A 3MR3A 5F8IA 1JLGA 3FRZA 4K4TA 3M9NB 3LP0B 4EBCA 4ZVHA 2VG7B 4ECYA 4NLYA 3NGDA 2JC0A 4TLRA 4O3QA 1RT4A 2HMIA 3PR4A 4Q0BB 4RW7A 3G86A 4WFXA 3RBDA 3G6VA 2IM3A 4EO6A 3ISNC 2BQUA 2JLEA 3Q8PB 4NRTA 4PUOB 1SUQA 1LWEB 2I5JA 2OPRA 2R2TA 4WZQA 1XR6A 4KHMA 1RYRA 5C5JA 3V81A 3DRSB 2VG6B 1NHVA 2R2RA 3BSAA 3UQSA 4I7FA 3OLAA 4WFYA 5DLGA 5KFLA 5DLFA 5DQGA 3PR5B 3MECA 4B3OA 3CO9A 2O5DA 3QGIA 2XI2A 3OL7A 3BSCA 2XI3A 1LW2A 3CJ4A 3CJ2A 2IAJA 3CVKA 1RTHA 4Y3CA 3DLEB 4XO0A 1RTDB 3UDLA 4I2PB 2ATLA 1HPZB 3FQLA 2FVRA 2RF2B 1C0UB 1BQNB 2YNHA 1IKXB 4J9PA 4IRCA 4H4OB 1NHUA 1SH2A 3ITHA 4NZ0A 4YQWA 3DRRB 2AU0A 4KSEB 4Q44A 1S48A 5KFNA 4WFZA 3KHHA 1HNVA 2ZD1A 1Z4UA 4LSLB 3IRXB 3M8QA 3BR9A 5KG6A 1S9GB 1HARA 1S1XA 5DG7A 3NBPA 2ALZA 1EP4A 1DLOB 5HROA 5F8LA 2FVPA 5C25A 1N5YA 5DQHA 2C2RA 3V4IA 1D0EA 1J5OB 4Y2AA 2AQ4A 4K4XA 4IG3A 2XC9A 4EEYA 2UVWA 5F8GA 3MEDA 4ED8A 1LW0B 5C42A 4K50A 2YKNA 5EWEA 4ZP8A 1C1CB 3N6NA 4ICLB 1TL3A 1S9FA 4TY8A 4DEZA 4EYHB 2YNFA 4EBDA 1S0OA 2UVUA 4FS2A 1S49A 3HHKA 3QLHA 5J1EB 4F4XA 3FFIA 4HKQA 3GV8B 4F4ZA 1TL1B 3KLEA 3FDSA 3PVXA 1SV5A 4KFBA 4H4MB 4RW4B 3KK3A 3GYNA 4MKBA 1REVA 5DGBA 4IH7A 2XWYA 3LAKA 4K4UA 4MKAA 1EETB 4IOBA 5KFFA 2HNYA 3DRPA 3MFIA 3M9OB 3DOKA 1S1UA 4YMEA 2W9CB 4PQUA 3QZ8A 3LALA 1S97A 1N48A 4YR0A 4G1QB 3TVKA 2HNDB 2VA3A 4Q8EA 2BE2B 4IFVA 2D41A 4WYWA 4MK7A 5J2NB 3GV7B 3RBEA 1IKWB 4MK8A 3KMSA 4LQ9A 3DLGA 4NLQA 3RAQA 3RAXA 2DPJA 1T03A 4IKAA 3SFUA 3KK2A 1JLCB 2HNZB 4GC6A 3IGNA 1RTJA 5EWGA 2WONB 2D3UA 2IJNA 2W9BA 4ECUA 4O4GA 3IS9A 4IFYA 3DYAB 4ED3A 5CYQB 5J2QB 5HP1B 2BRKA 1JLFA 3T5LA 4TQRA 1S1VB 1LWCB 1TVRA 5D3GA 2ASDA 3G6YA 1C1BA 1VRUB 2OPQB 1TP7A 4ECQA 1JX4A 1RT6B 4HYKA 2B5JA 3IG1B 5KFGA 1RT1A 5HBMB 2GC8A 5L1LA 4O3PA 3KK1A 2C2DA 4Q8FA 1HQUB 5KG7A 3T1AA 2GIRA 4NLPA 4LSNB 3PW4A 3I0RA 3CJ0A 4MIBA 4XPCA 3PJWA 2WTFA 3RB4A 4RZRA 1ZETA 4Y34A 3PJXA 3RB0A 1BQMA 3I0SB 4DG1B 2ASJA 2CJQA 2BQ3A 1MU2B 3OLBA 1TKZB 3KJVA 5J2MA 5KFZA 3HVAA 4YP3A 3OSPA 2AGQA 3KOAA 4YR2A 1HNIB 4K4YA 1RT5B 3FQKA 3QGHA 3PHEA 5KG2A 5L1JA 4QW9A 2V4QA 4O44B 4ZHRB 1RTIA 4MIAA 3OL9A 3GV5B 1UWBB 2B6AB 1RA7A 4QWEA 1QE1B 3NMAA 1KLMB 3QIPA 4RNMA 1HMVA 1RT7A 4KE5A 4U7CA 4RW7B 1S0MA 1C0TA 4TN2A 4JV0A 2IC3B 1FK9B 4ZP7A 5KG0A 1TKXA 4DL7A 2VG5B 2YNIA 2BANA 3DDKA 1FKOA 2FJWA 5J2PB 5FDLA 1R0AB 1JLQB 3KLHB 1FKPB 1K1SA 5JUMA 3DOLA 2YNGB 2ILYA 2FJVA 1KHVA 1DTQA 2RKIA 5KT2A 2IM2A 4RW9A 3KNAA 4PWDA 1RT2B 2UUTA 4J9QA 1RT3A 3I5BA 5KFHA 5F9LA 3PZPA 2XGPA 3DM2B 3LAMA 1T05A 3LP2B 5L1IA 4R5PA 1IKYA 1DTTB 4NLWA 1JKHA 2W7PA 4ID5A 4KHRA 4ED0A 4IR1A 3DMJB 3C6UA 2F8EX 1OS5A 3T19A 2C2EA 1JXLA 3CDUA 4J9OA 1LWFA 5K14B 4QWAA 4J9LA 4F4YA 4WZMA 2VG7A 3DLKB 1S6PB 2C28A 2OPSB 5KFRA 4O3RA 4Q0BA 4KKOB 4RNOA 4NLXA 3BGRB 2UVRA 2VA2A 4Q43A 1S1WB 4ZPBA 3OL8A 3NKYA 1RAJA 4IDKB 3KLFB 2OPPB 5C25B 4TY9A 4K4VA 3V4IB 3C6TB 2XCAA 2W9AA 3PW7A 1GX5A 4ED6A 4PUOA 4IG3B 3QIDA 4MK9A 4IG0A 4RUCA 3E01B 2GIQA 1LWEA 4YR3A 4WYLA 3T5HA 1I6JA 5F8HA 5C42B 1KHWA 5I3UB 1SH3A 5EUHA 3DRSA 2VG6A 4NLDA 3V6HA 5L9XA 2D3ZA 3T5KA 5DG8A 3ICLA 3EZUA 5KFMA 3GIKA 4JV1A 1S9EB 5KFVA 5I42B 4WE1B 5CYMB 5DQIA 1K1QA 1HQEB 3BQ1A 3Q8QB 1S6QB 3DLEA 4I2QA 2W8LA 4I2PA 1NNDA 2FJXA 4O3NA 1TKTB 1HPZA 1W25A 2ZKUA 3FFIB 5F8JA 2RF2A 1C0UA 1BQNA 4K4ZA 1IKXA 4WXWA 4M94A 2AWZA 4ZPAA 3LP1B 2FVQA 2FLPA 5HLFB 4R0EA 4QWCA 1REVB 2B43A 4DL3A 3KMQA 5KFSA 3DRRA 3PW2A 2WB4A 5KFWA 1TQLA 3NL0A 3M8PA 4KV8B 4ECSA 4RW6B 4LSLA 2XGQA 2AGOA 1S9GA 4IR9A 2OH2A 4O3SA 2JC1A 5KFYA 4R8UB 2YKMB 1ZTWA 4ZP6A 3GQCA 1J5OA 4NLRA 3BQ2A 4EBEA 2V4RA 5KT4A 3H4BA 5EDWA 2WRMA 3KK2B 1LW0A 3CWJA 1C1CA 1XR7A 4NLUA 3CDEA 1TV6B 4ECVA 3QO9B 4KBIA 2BRLA 3H5UA 3JYTB 5JXSA 4QW8A 5KT6A 5T14A 1ZTTA 1JLEB 4TYAA 1SH0A 1RT1B 4NLOA 5C24B 5KFQA 2IBKA 4NCGA 1TL1A 5KFCA 1S1TB 3GILA 1T3NA 4RW8B 4H4MA 4RW4A 4NLGA 3DI6B 4MFBB 3KLIB 4ECRA 4ZPCA 1EETA 2EC0A 2W9CA 2XCPA 4KO0B 4G1QA 3TAMB 4ECXA 2HNDA 3MEGB 2FVSA 2BE2A 3JSMB 1JLAB 1JLBB 3D28A 5J2NA 1IM4A 1RYSA 3KLGB 3V6DB 2R8JA 5KFPA 3BJYA 3HVTB 2CKWA 4NLTA 1HYSB 3UR0A 1JLCA 3TQ1A 4MH8A 4ZP9A 3MEEB 5DG9A 3PW5A 2WONA 4ECWA 1IKVA 4ZVGA 4Y2CA 4J9SA 1JLGB 2WK4A 3DYAA 1S4FA 4QPXA 5CYQA 5J2QA 2E9TA 2UUWA 1S1VA 5EWFA 5KFAA 3OSNA 2WOMA 2WHOA 2QV6A 2OPQA 3Q8SB 1RT4B 2HMIB 2AX0A 1VRTA 3MR5A 1RT6A 3D5MA 3IG1A 3QZ7A 5HBMA 1U09A 3H5YA 4GC7A 3H59A 4ED1A 1HQUA 1N56A 4J9MA 4H54A 1SUQB 2ASLA 2I5JB 2OPRB 4RNHA 3RB3A 5KT3A 5KT7A 3V81B 1N6QA 3M9MB 4DG1A 3I0SA 2IM1A 2IM0A 4X2BA 3N6MA 1MU2A 4I7FB 1JKHB 5F9NA 2ZE2A 4EO8A 3C6UB 3MECB 4B3OB 4F50A 3CIZA 1HNIA 3HKWA 5KFXA 1RT5A 1RDRA 1LW2B 1LWFB 2IAJB 4WXOA 1RTHB 3OHBA 3HVWA 4FBTA 4O44A 4ZHRA 3V6JA 3UPFA 5KFDA 4RNNA 1UWBA 2B6AA 1QE1A 1KLMA 3E51A 2YNHB 5KT5A 4DL2A 4ZPDA 3LP0A 3ITHB 2HWIA 2IC3A 1FK9A 3H5SA 3IGVA 2VG5A 4RNFA 3KLVA 2RDJA 1HNVB 2ZD1B 4TXSA 4TQSA 3M8QB 3KHLA 3BSOA 5J2PA 1R0AA 4IG0B 1S1XB 3NBPB 1JLQA 3KLHA 1FKPA 1EP4B 5HROB 2J6UA 2JEGA 3LANA 5KG3A 3H4DA 2YNGA 1N5YB 2V9WA 2BR0A 3QYYA 1S0NA 2R2SA 4NLVA 4G3IA 3MEDB 1RT2A 2YKNB 3DM2A 2FVCA
chains in the Genus database with same CATH superfamily
2HZVA 1KDNA 1RQ0A 3Q86A 3MR6A 1NSQA 3WC2A 4ANEA 1U0SA 2OPSA 3V2UC 2ILZA 3M8PB 3KLEB 2HVHA 2BQRA 3KK3B 3KJNB 1KQGB 4DR2F 2OPPA 4JV2A 4LF9F 2MDAA 4DF8A 5E41A 2Q66A 2KXHA 2W2PP 3I5CA 4CT9A 2F40A 4OL8A 3VGSA 2PMZD 2R7RA 4HEA9 3R1LA 4OI6A 3MF5A 1Y11A 3G96A 1GT8A 1VRTB 3US5A 1JLEA 2K3KA 3I5AA 3L7UA 3DGVA 1LWCA 4RW8A 2J0XA 4USHA 3L7PA 1BQXA 2RKIB 3THPA 1JLAA 1B7YB 4R5PB 1SQFA 4J9RA 3SFGA 1HNWF 1S10A 4FS1A 4K7QA 2DNQA 3TEGA 3NGDA 4KHPJ 4P2MA 4O3QA 4RW7A 4EO6A 1GMVA 4J7CA 4PXDA 2R2TA 5C5JA 3SV3A 5EHHA 3OL7A 2LU2A 2O5DA 5KAKA 4DV1F 2RF2B 5IT9U 3NP5A 4NXNF 5A0YA 5KG6A 4CO3A 3V4IA 3DN9A 4B3SJ 1F2GA 2JFKA 2YKNA 2P6TA 4ZP8A 1HIYA 5SUHA 4RX6A 5IT9Y 4QIVA 3K5NA 1CC8A 4LRAA 3R8YA 2WSFC 4FS2A 2LXFA 4A8KA 1WF2A 4HKQA 3KLEA 3KK3A 3K2YA 2HW3A 4LF6J 2RE1A 3HPOA 2XZWA 1FRHA 4KY3A 3TP2A 1R8BA 4X64J 4IKAA 3SFUA 4GC6A 5LM7E 4BDPA 3R9LA 1S57A 4Z7CA 1T95A 3QNWB 2RIJA 1SBRA 4C3KA 1U1QA 3GG1A 1WC1A 2DNLA 1WOPA 4O3PA 3PW4A 1FF2A 2BJ3A 2JDJA 1KEKA 1N54B 2AGQA 1XWLA 3NWRA 4F3QA 4J5OA 4QW9A 1Y00A 3N4WA 3NMAA 1WHVA 1OQ6A 4U7CA 1LEOA 1VQ7S 1KQFB 2VKZG 3BDPA 4FNHA 4ATNA 3PEHA 3KLHB 2KTQA 1K1SA 2BX6A 2RKIA 3PRDA 2BDPA 4R5PA 2QZ8A 3TX8A 1Q81T 4F26A 1DZ5A 2LP4A 3OXGA 2YH1A 2R3VA 1ZAXA 2BA9A 3L3CA 4YHHJ 2EG2A 3NKYA 2FY1A 1RAJA 2KH9A 4TY9A 3C6TB 2XCAA 1F5AA 5K5MA 3T5HA 3MM5B 5F8HA 1H3DA 1KHWA 5HK4A 3ADAC 3NOCA 5KFVA 1HQEB 2C2OB 2NR0A 4F7VA 4FYDA 2ZH3A 2RF2A 4QWCA 1IQZA 1IR0A 2P9GA 2IDLA 3ET6B 4EUVA 3CD0A 1WEYA 3K5LA 1T0TV 5KT4A 2VQFJ 1QM9A 3CDEA 4KBIA 3FCHA 1HI0P 4Y0FA 2DHHA 1XMQJ 1RU1A 3BBFA 1WD6A 3IRWP 4NCGA 5BYQA 2ZJPQ 2HGNA 3SCJE 3GR1A 2Z56B 2EC0A 4L6V3 4ZS6A 3ZTSA 2V68A 2CWXA 1JLBB 4C8LA 4DSIA 1HWLA 2F5GA 4F02A 1K47A 2RMLA 4ZLLA 1SI9A 1WDDA 2FHMA 3QZ7A 1Q4RA 4NEYA 4RUBA 4GVLA 1DARA 3M9MB 4OX8A 3TUPA 3G9CA 2RRAA 1LW2B 1UKUA 4CLFA 4NASA 3W5XA 4FBTA 5D4NA 4M63A 4ES3A 2G0CA 2LEPA 8RUCA 3W7BA 4JB8B 3HM9A 2ZD1B 2R4FA 3BN4A 3KLHA 1QD1A 1Y10A 3AQOA 2ROPA 2J0WA 1YKWA 1U26A 2C2KB 1NK8A 2R8GA 5U47A 1BC6A 1QTMA 2JLFA 2J8SA 2HQCA 4UW2A 3CJ5A 1FJ7A 2HZAA 3C6TA 5GMEA 4ZVFA 3MM5A 2C22A 1X9MA 1WI8A 1T03B 2KL8A 2GHWA 2ERRA 4O4GB 1HQEA 4X4NA 2B9WA 5CA5A 3GIIA 3VAFA 5KFEA 5D3GB 2AJFE 3UR3C 5GAHU 2BABA 1FDAA 1YK9A 4P7VA 4ILRA 4DV1J 3JSRA 5L9NA 3V4MA 2HFZA 2HS0A 3A8KA 5B0GA 1JIHA 2RAQA 3G4SS 3EPIA 5F8NA 4QWBA 2C3YA 1XERA 1KN6A 3EYZA 2F7VA 3OL6A 3RB6A 4DLEA 3ZZPA 3RJMB 1RBAA 1K44A 2DTJA 1RTZA 2QTWA 4I4BA 1XMOF 4OMFG 4MYUA 5AXNA 2A18A 5H9EJ 2E1MC 4ID8A 1JLBA 4EYIB 3N9UC 4ID5B 1XIQA 4PXCA 2PGCA 3TA2A 4K4TA 2ZBIA 1V3RA 2KFYA 1SC3B 3G6VA 4LBIA 2BQUA 3Q8PB 2ZZTA 2IRXA 5A76A 2J0SD 1HHTP 3BSCA 1LW2A 3S6EA 4DJBA 4UZBA 1RB0A 2M8DB 3LPEA 2BVZA 1IM6A 4KSEB 1S48A 3R5JB 3D2WA 2ZD1A 1M5SA 2ALZA 1NBEB 2EFQA 1KD1T 4J9UE 4DV7J 1U48A 1WHXA 4X4RA 4X4VA 1PIEA 5D15A 3CC2S 3GYNA 2ATCB 4MKBA 2NXEA 2DNMA 2V5HG 2DGVA 2R7SA 5KOWA 4PWUA 1F5BA 1T03A 2DYAA 4JI4J 4DV5J 2BKPA 1IXKA 2MQQA 4O4GA 2VODA 3EGNA 3QGPA 3T5LA 5D3GA 3AAWB 1KQKA 1TP7A 5DDPC 1JX4A 4LIWA 4IQMA 2OO4A 2B7CB 3D4JA 4QYRA 1VQLS 1D3WA 4C9DA 3FQKA 2AMCB 5K8MA 1UPMB 3RR8A 3MPYA 3N79A 1RWUA 1U4BA 1HHQA 5ETQA 1CG2A 4C2MA 2DKOB 5B09A 3SDEB 2ILYA 4ES2A 3A8EA 4NXMJ 1YDLA 1OYDA 3ZTOA 4DQSA 4ID5A 4ED0A 1SC6A 3PIPQ 4ZCKA 4FF1A 2CQ4A 3D7SB 1TUWA 1YBAA 4ZPBA 2EFNA 1FRKA 3QFHA 2JLGA 4ZN1A 3PDNA 2DNPA 4KGVB 2YX1A 3D66A 1PKUA 2IVMA 3KG1A 1BLUA 3ICLA 4DV0J 3OXFA 1B99A 1SIZA 4O3NA 3RW7A 3GCWP 1NZAA 4R0EA 1EQMA 1X7VA 4JI0J 2IPOB 1KFSA 2WB4A 1TKDA 5KFWA 4KV8B 2XGQA 2L9NA 2YKMB 1ZTWA 2V4JB 2ZFHA 5ETSA 2CJAA 4DQQA 3CNQP 3PYDA 4DUZJ 3JYTB 1UVMA 2E7XA 4RKUC 5DDQC 4DSLA 1EKRA 4Y2MA 4CQ1A 3BPSP 3QSIA 3VV2B 2WVCA 3TAMB 3MEGB 2FVSA 5D6GA 1KOHA 2V8PA 2Z8QA 4J9SA 1JQGA 1S4FA 3W1YC 4OLOA 1VBZA 4ED1A 1SUQB 2M88A 2OPRB 3ZTRA 1N32F 3W2WA 3V81B 4ILMA 1N6QA 2XMVA 3UDEA 3MECB 3RTVA 3HKWA 2CJXB 3V6JA 5KFDA 2PDAA 5KT5A 1RLCL 2UXDJ 2AT1B 3MCNA 5AE3A 2ZHBA 3SDEA 1AW0A 3DXBA 3CMES 4YS2A 4ZVTB 2XSJB 2CDQA 1KQSR 1BY9A 1ZBTA 3QJJA 4OV6A 1N52B 4BC9A 1C2PA 1RXOB 1TMJA 1G3OA 2DR8A 1FRLA 3JSYA 5DDOC 3LTOA 2DXFA 1SJQA 3AQPA 3HFZB 2R2UA 1FCAA 4ED2A 4TLQA 1RLDA 4KGZB 3GJQB 1GX6A 4QWDA 3BQ0A 3DKDA 2AEFA 1IBMF 1VOMA 1X4EA 1FRXA 5HATA 1NSAA 4KV8A 2D7SA 4QJVA 2OI2A 1VBXA 2QYGA 2YQ3A 2YKMA 2V4JA 1S5ZA 2EPIA 3HO1A 3I82A 2RQ4A 3KJVB 2LVWA 1IKVB 4O0IA 2HSEB 3UO0A 2LQ8A 3BYPA 3JYTA 1SC4B 2OFHX 5KG5A 1H73A 3IN5A 4B9TA 2YNIB 1EKSA 2XMAA 3EXYA 4DSEA 3S1TA 1LK5A 1SL0A 3TAMA 3NNHA 3MEGA 2UVVA 1U1RA 4X65F 5B0CA 1IKYB 4Y6IA 2W2NP 2RSQA 1FJGF 3F44A 1H38A 3M9NB 3CCES 3IP0A 2DXEA 4CLTA 4TLRA 2OKQA 2R7WA 5M2RA 1YLXA 1R6YA 1UEVA 4OZ2A 4CO4A 4OHYA 1SUQA 2OPRA 3V81A 4OI1A 4DFMA 1GQEA 1JNZB 5ETNA 2ZM6J 1LWXA 4LF8F 2QYCA 1YQHA 3MECA 2XI2A 4Y3CA 3DLEB 4I2PB 2FJDB 3GJTB 4U96A 2Z0GA 2HBZB 1YITS 4H4OB 2G9OA 3NNAA 1S4EA 4O0NA 2KVQE 3IRXB 5LMNJ 3BO2A 4ILLA 4LFAJ 1NMEB 2HQFA 3BPDA 4K4XA 1S7IA 2UVWA 2UU9F 4W4MA 3W9HA 4I6YA 2MJUA 4ZITA 1RI7A 2JFDA 3I31A 4JI7J 3CF5Q 2KG1A 4RW4B 1RBLA 2MKYA 1EETB 2PMHA 1DFDA 3M30B 5J2NB 3R1HA 2DPJA 5CHCB 2RS8A 2O66A 3AT1B 1IR1A 2ZEJA 2XYPB 1S1VB 1GMUA 3U7JA 4AL5A 2CQBA 1IJEB 2D3O1 3TWZA 3MPWA 1AZSA 5E33A 1W26A 2JWNA 1TKZB 3KJVA 5KFZA 2AW0A 3QGHA 2LECA 1GH8A 2JHEA 5H9FJ 4DMZA 4OHVA 2B6AB 1OJ4A 4LMZA 2I8EA 5I4MA 5KG0A 4LF7F 2YNIA 2YPYA 4LF5J 1CQMA 4N76A 3AOAA 1AT1B 4DS5A 2FJVA 5T7LB 2GQ2A 2XMMA 1FRIA 4N8OA 4DR4J 1IKYA 1JKHA 3PX0A 3BDEA 2RU9A 2KI2A 3I87A 2KN4A 4F4YA 2VA2A 3OPKA 2HRYA 3MUTP 5GAHI 1Q7YT 2EK1A 5I3UB 2K7KA 2M52A 4EU0A 3DGPB 4N47A 1R89A 2MZTA 3OR1A 4DCJB 4OX6A 3WIUA 2F65A 3DLEA 1N32J 4I2PA 1TKTB 1W25A 3FFIB 3TJ9A 2DK2A 1NO8A 3MMCB 4R8UB 1OMSA 2M70A 5B08A 1K73T 3SIPB 1NJYA 5HSPA 4GRSA 2QLXA 3D6FB 3IBFB 4X4TA 4RW4A 1OSCA 3DI6B 4CTAA 4Q5VA 2O67A 1EETA 3LGHA 1U1PA 4TNOA 3D28A 5J2NA 1FWPA 4DLGA 3FNNA 3ENVA 4NLTA 1HYSB 2DNZA 3TQ1A 1NDCA 3PW5A 1GTHA 1ZM2A 4ECWA 4PG6A 5HQ8A 2HHXA 1O6XA 2UUWA 1S1VA 4DFJA 2LCWA 1RAIB 2FJAB 3Q8SB 1X4BA 3H59A 4OLPA 5D4OA 4DR7F 1IBMJ 3VGVA 2BV3A 2ZOGA 4NPOA 1X60A 4I67A 4NCAA 2B6AA 5D0GA 3OUYB 2FDNA 4GO5X 4IG0B 5LT5A 3CGIA 4QIFA 4DQRA 4L76A 1IBKJ 4TU7A 2VFTA 1BE4A 2AYGA 2FGOA 2VPZB 1FA0A 2IYIA 1S59A 2P5VA 1D8YA 1OSDA 1UETA 3FCVA 4QOTA 4K4SA 1P9YA 1HNXF 3THVA 3HSDA 2VPWB 3DU6A 4KB7A 3UD5A 1MWZA 1NEEA 5I3UA 2LLZA 3DGPA 4QU6A 3FMWA 1ULRA 2VFSA 1NZ8A 3MPVA 3VAGA 1GMWA 1TKTA 1YJ7A 4URQU 1DURA 2XNRA 4G1IA 2DO4A 4R8UA 2EKNA 2NXNA 2BOAA 1BQMB 2K1RB 4OYAA 4I1TA 4FNIA 4P71A 4PAAA 4OYIA 3CCLS 5F0WA 4P74A 5CAAA 4WBFA 4G6VB 4DU7A 4FBUA 4XTTA 2RQMA 1TMMA 4DR3J 4CLZA 2XY5A 4YB6A 3DI6A 1Q95G 2IVFB 4LSNA 4RW9B 3EPGA 3FGVA 3TVZA 1JK9B 2Z2LA 1HYSA 1FTRA 3T41A 1ZAWA 3TUJC 2HEKA 4AL6A 4NLYA 4CLWA 2IRYA 3EDRB 3CCWA 1TK0A 4ALZA 3D3CJ 3E3XA 2RHQB 1RYRA 1S72S 1X4CA 4DOZA 3ISZA 3PR5B 1WG5A 1ZM3A 4FKYA 3UDLA 2I2YA 1WKKA 3UN3A 2JSXA 3SV4A 2OGUA 2MQOA 1Z2LA 4OYPA 2L41A 4DUTA 3QJLA 4LSLB 5BYRA 5C25A 2LEAA 1Q5YA 2FC9A 3SZ2A 4B17A 5EX3A 4L75A 2K8GA 4EBDA 5J1NA 1IBLJ 3FBBA 1SL1A 3PVXA 4HT5A 1SC1B 2B9XA 4YMEA 2LXIA 3I56S 5M2PA 4DFPA 3TZXA 3KK2A 2RVJA 1U47A 2A10A 2Y1RI 2VQEJ 2BOPA 1HQ2A 2B4VA 1P8GA 4HYKA 5KFGA 4JI3F 1Y5NB 2GC8A 1LOUA 3VTIA 2R7TA 4DQIA 4RZRA 3H0PA 4Y34A 1BQMA 2K1RA 1SJ1A 1RT5B 1KOOA 3GV5B 4QWEA 3QRQA 4WTOB 4JV0A 3QMQA 4DV6F 4M5MA 3MMAB 2PI4A 4KYZA 3EGWB 1LV5A 1O51A 3B8HA 2DO0A 4RW9A 3O6QA 2D9PA 2W7PA 4OJHA 3KYLA 3R5GA 5K14B 5HJYA 3DLKB 1WC4A 4NA1A 2CVIA 4HH0A 1SPBP 4HHJA 2JZ5A 5IC6B 1GEHA 4K4VA 2YKPA 3D3BJ 1JJ2R 4TVAB 3E01B 4WYLA 2AJ2A 4RL1A 3ZZZA 3ILLA 3BM7A 5KFMA 2W4DA 1S9EB 1RZMA 1PBUA 5DQIA 3P49B 2CRLA 1R7IA 1FKAF 2H4WB 4X62F 3OR2B 4OV1A 2UUCJ 1TAUA 4LSLA 5HANA 1S12A 2JC1A 3GQCA 3SBMA 4NLRA 4K8RA 1UFKA 4D3GA 4LFBF 1HBMB 1XK8A 4RBTA 4ZVSB 3K5MA 3QO9B 1V6HA 3MM8A 4QW8A 1KFDA 5T14A 4RR5A 3SSSA 4YB7A 2OEMA 3W5ZA 2B0GA 1ACMB 3W62A 1YIJS 3TA0A 4MH8A 4EZ6A 4Y2CA 4DX5A 3MR5A 2DNNA 2B3TB 3R27A 2BYCA 1VQYA 1CEZA 4FP9A 4BLGA 1NDKA 5E2QA 3SCKE 2AEMA 3VWSA 1VGYA 4N41A 3GYGA 2ZE2A 5LMUJ 4OZLA 5A8KB 1RT5A 1RDRA 4H4KA 3OHBA 1I51B 4QIEA 3M6VA 2X1BA 1HW8A 3I9ZA 3H5SA 1YJTA 3OTDA 5D4PA 3DXSX 1C4AA 3KLVA 3JAMU 2ZNZA 3MMAA 3OFEA 4TQSA 3BSOA 1S1XB 3UNYA 4LIRA 4DSKA 3LANA 5KG3A 3GCXP 5CABA 2D74B 4AYBD 4RJVA 2QIFA 1N5TA 4WF9Q 1FTCA 4ENOA 5IT4A 5L39A 2EWHA 5K14A 2DY1A 3O44A 3DLKA 2B8PA 3JB9k 2CQ2A 4E2FB 2E5JA 3E8OA 4IRDA 1WORA 1I94F 1UW9A 3E01A 2IYGA 2LDYA 4GKJJ 4YY3J 3K5OA 1PYTA 1S9EA 3VAMA 5HO4A 1QUPA 2E9RX 2VFRA 2QLJB 3HSZA 4NLSA 2X51A 3PNIA 4HT7A 3KHGA 3VAJA 5KFBA 2QMXA 2BW2A 1H98A 3OBIA 3FSXA 2DNOA 4OI0A 1VQ5S 3U27A 1X4GA 3QO9A 4LQ3A 4C8ZA 5HI7A 4XIUA 5HP1A 2CJKA 2BM1A 2YWWA 4X4OA 1ZYQA 2V8GA 2R8HA 2IMWP 3ZXWA 4B3MF 1FNOA 1HBOA 2FQQB 1T02A 2GA7A 1ZM9A 1G2EA 2N82B 3LOUA 2IA6A 3CO0P 4C8NA 1UZHA 2GVZB 2GW8A 1FNMA 2WSEC 2PE8A 4YDDB 3BGLA 4W98A 3R7BB 2CPZA 2GO9A 2IM3A 1FEHA 2PFDA 4X4PA 1HL6A 2GQQA 3I4PA 2G0JA 3PCOB 4PUOB 2L9WA 5DLGA 5A8KA 4A8MP 5HQMA 2NS1B 1NK5A 1CJVB 3ZTPA 2O1PA 4PZVA 1XNQJ 3L09A 4ZLJA 2BW7A 1NHUA 2HZCA 3RZAA 1Z4UA 4OIXA 1NKCA 2CFXA 3BR9A 1S1XA 4H4KC 5DG7A 4DF4A 2MKSA 4DSFA 1J5OB 4DV6J 2FLOA 4K50A 1YZ6A 1HWUA 3QRPA 1T9WA 5HJXA 1CS4B 3TJ8A 3PHTA 2EXUA 1FDBA 4KH0B 2UVUA 1NJWA 3JTPA 5EX0A 1WHWA 1YRTA 2BJ9A 4KPYA 1AXQA 4FXDA 2U2FA 2RJZA 1REGX 4G1QB 2BE2B 4DBQA 1S7HA 4LQ9A 1UCNA 3RW6A 2HNZB 2BJ8A 4ANDA 4PCQA 3DYAB 1MW7A 1RT1A 1KVJA 2FHOB 2GGPB 4DV2F 1RWOB 5B0FA 3PJWA 2CJQA 4X62J 1MU2B 2VBZA 3R2CJ 3OXLA 3IC1A 2PC6A 2V4QA 4IOCQ 4IO1A 2YY3A 4CLUA 2VL1A 4DL7A 2ZH4A 4NX9A 1R0AB 3HHEA 4C8OA 2CA9A 2J9EA 2YNGB 3ZZOA 1QSYA 4A8SA 5KT2A 1R8AA 3O5TB 4ETZA 1HD1A 3UNGC 1N34J 2CNOB 3R7SB 3BKFA 1NH8A 1OS5A 2C2EA 3NEKA 2GVZA 3NOGA 5DJBA 2QLBB 2EFPA 4A8QA 1S6PB 1RJJA 2XEXA 3KUGA 3HLUA 2ACYA 4PUOA 4IG3B 2OIHA 2GIQA 4USTA 1QAYA 5EUHA 2UP1A 2MZ1A 3J81U 1VFJA 1CJVA 2DIUA 5HVGA 2ZKUA 3M32B 1Q53A 4WXWA 4M94A 2CPIA 2OMLA 2B43A 3PW2A 2APOA 5C2CA 4WKRA 1J5OA 1VJQA 2BJ1A 1WKJA 4HI2A 3DU5A 5IC4B 5DDRC 5DM7Q 5KT6A 4B08A 4NLOA 2IBKA 2GMLA 1V5IB 2KYZA 3M6WA 2H51B 5B0DA 4G1QA 2ROGA 1NCLA 2BE2A 3N01A 2V63A 4DQPA 3DYAA 2ZUAA 1HWJA 3EWGA 1J5EF 2FHKA 2BKOA 3Q22A 3CJQA 1U6FA 3AXKA 2A3JA 4DV3J 2OHDA 5GAGU 2CPEA 2UXBJ 1MU2A 2RS2A 4F50A 4DN0A 7FD1A 4WXOA 3HVWA 1S76D 2GX8A 1X5SA 2KT5A 2Q43A 3KXDA 1WJ9A 2COLA 3HVRA 3LP0A 1VHIA 3Q0AA 2XBPA 4TXSA 2HHPA 1R0AA 3HP6A 1WELA 4USIA 2YNGA 1SQEA 3PEJA 1TL3B 2HS3A 3AA9A 1S6PA 3BREA 1YVFA 3TW0A 4R0JA 4ZPVR 1U24A 3OTEA 3MDFA 4F3MA 3MUVP 3M6XA 2DNHA 4DR5F 1X0FA 2X3GA 2MKJA 4OYXA 1QAIA 2QLFB 4ZVUB 2EKYA 2GIFA 4ICLA 4IFYB 3BSNA 2KJWA 1TVRB 3M32A 2MPUA 5J1EA 4IRKA 3OHAA 4LF4J 4ZIVA 1H0HB 1L3SA 1GAOA 2DHXA 3W9JA 3HDSA 1J2VA 2J6SA 3KUEA 5J2MB 3GG0A 4Q2LA 4KGKA 2PFFB 3WQPA 3CC7S 2WOMB 3A12A 3HT3A 3ZNUA 3TUIC 5LOQA 2DVIA 3NS7B 3PXGa 3DOLB 3P4UB 2XY6A 3M8RA 2CG8A 1DTQB 4DL6A 3C15B 4OYMA 3DHXA 4RUAA 1T05B 4BWJA 1F3FA 2GV1A 4RLEA 4B9VA 1TL7B 2VZ9A 1BUXA 2JOQA 4LRDA 3H2UB 4F67A 2M9KA 3BSAA 5CCLA 3WZ0A 4UUXA 2XMJA 1M5VC 1F9FA 3D1QA 4YEAA 3NGUA 1X31C 1FI4A 2YWFA 1GMWD 3DHWC 1D9DA 1VI7A 1FDNA 1S9GB 4QIGA 2AEJA 2F4FA 2C2RA 4BHQA 4Y2AA 2ZBRA 4JV5F 1UTAA 1TL3A 3BH7B 3PKYA 3GLJA 2J8AA 4EYHB 3OVAA 3WX8A 3HHKA 3GV8B 1RU2A 2CZ9A 1DHMA 5LSOA 3U1MA 4IOBA 2UXCF 3AOBA 4B9LA 1RHJB 2KM8B 1YWXA 1XBWA 4MK8A 3KMSA 3AB4B 4UY8T 2QFIA 4CO0A 4E8UA 3CCZA 2YWGA 3J7YI 4IFYA 2BRKA 3T1YJ 3IMQJ 1TVRA 5ETMA 1VRUB 1P6TA 1LXNA 1NK9A 2ZVSA 3D54A 5HBMB 2XHCA 3A8IA 4Q8FA 3PIOQ 1NK4A 4MIBA 3J80U 3PJXA 5J2MA 4YR2A 5D0HA 1HNIB 2ZDPA 5HMXA 5L1JA 4O44B 2OD6A 1PCAA 1TTHB 4FF3A 1QE1B 1KLMB 2OD4A 1S0MA 3K5PA 3B4DA 3B82A 2YKOA 3HULA 3DOLA 3MPUB 1DTQA 3C15A 2DY9A 1T05A 2Z2YB 4OX9J 1LWFA 1T9UA 1TL7A 4DR1J 3PFEA 2MQ8A 3UW1A 2ZC4A 3M2UB 3RGIA 3MM9B 4EFAC 4AL7A 2QRRA 1NK0A 1A7GE 3MD3A 5I42B 5F3ZA 1FESA 1X4HA 3AJ2A 4I2QA 2FJXA 2DH7A 1FXRA 4DL3A 3PTWA 1HD0A 1Q8KA 3NL0A 5H1SV 1S9GA 2JH3A 1E6YB 3CJ8A 3BQ2A 1FFGB 1UJ4A 1NDPA 1TV6B 3UDVA 4TYAA 4YB1P 5C24B 3GILA 2UV8A 2MY7A 3QFWA 2CJYB 4NEZA 4NMLA 4ZPTR 3IA0A 3E2EA 5KFPA 1G4CA 5E3RA 3CSKA 3LF0A 3WIVA 3M1VB 2QL5B 2HMIB 1H7WA 2W4CA 1DRZA 2VBXA 5HBMA 4OZ0A 4EGLA 5D77A 1N56A 5F0UA 4QR0A 3ZZ0A 2NPIA 2GFFA 4FPIA 5F9NA 4EO8A 2W7AA 1HNIA 3RBZA 2V8DA 2V8HA 4O44A 2H4YB 1QE1A 3CB4A 3K8VA 1KLMA 4MJKA 3ETOA 2XQCA 3TARA 1E6VA 1EP4B 1MROB 3BKTA 3MD1A 2BJ7A 3AY0A 4K2XA 4USWA 2WCXA 2MHNA 1R8HA 5C7PA 4KFBB 3MAQA 3M2UA 4CLSA 2HNYB 2NYIA 4DL4A 2UUBJ 1D9FA 3MM9A 2UUAJ 1M5PC 3BEGB 3HD2A 5I42A 2AYBA 1X5PA 1CPZA 4DL5A 2VC0A 1C1BB 3VALA 4F0MA 3QBCA 1UW4A 2I1RA 1M1KT 5G4DA 3KK1B 5AE1A 1P1LA 5DGAA 3UD4P 4I64A 1E6YA 1XR5A 4FYYB 1K0VA 4DXLA 3BGOP 4KHPF 2Z58B 3PRVA 4ECZA 2YBVA 5HVFA 1YX2A 1XNRJ 1TV6A 3H40A 1PYOB 5DRKA 3VQTA 4P2FA 3P5TL 3T6BA 2DT9A 5C24A 2LQ5A 5BR8F 3Q2TC 3T5JA 4GO7X 3SYZA 4FF4A 3M05A 5KG1A 2C42A 4ZCMA 1W7WA 5CCMA 2FLNA 1M1GA 1HI1A 2J6TA 2LEBA 3M2VB 1WSRA 4WIIA 2QSFA 2V9KA 5F3TA 4B3SF 2HHWA 2JC0A 3HCXA 2HMIA 1JNRB 2KM8C 3ISNC 1ELOA 3R6GB 2YXLA 1TFWA 4EI2A 2XS7A 4WU3A 1XTZA 2VG6B 1EZZB 4OHWA 2GO8A 1UEUA 4CT8A 1KRPA 3R5BA 4LF6F 1QY7A 3CJ4A 3KNGA 2Y8WA 4TU9A 3U1NA 1FEEA 2KHDA 3PKMA 1V9OA 1B70B 3MWBA 3KHHA 4JI5J 1Q5VA 3W61A 1EP4A 2FVPA 1MROA 1NKEA 1WSVA 4NOHA 2AQ4A 2PO4A 2PEHA 2J7UA 4DX8H 4I6WA 5CZXA 3QATA 4U9RA 1X5TA 2XNQA 1LFWA 1UJ6A 4KFBA 4A8XA 4PWWA 2B51A 1PO6A 4MKAA 2HNYA 2IY5B 2CAJA 4M5GA 3LALA 1PILA 4Q8EA 4WYWA 9ATCB 3TA1A 1YJWS 5J2QB 1VBYA 1Y5LB 1LWCB 4PXEA 1C1BA 2KT3A 5HMZA 3KK1A 2GIRA 4N7TA 4I6AA 1YGYA 4PXBA 4F2RA 4DG1B 4YHHF 3OSPA 3NXZA 3HK2A 2XG8A 3HVAA 1U45A 4JI6J 2K2PA 1RHMB 1K8AT 1IVZA 3KWMA 4RW7B 4X4UA 1YJUA 1MN9A 3S8SA 2FJWA 2IJRA 2VBWA 3C8YA 5JUMA 2IM2A 2G2ZA 3KNAA 5KFHA 1UWAA 3W8PA 3M2VA 3NWGA 1KKHA 1UA0A 2HHHF 3C6UA 2E1AA 4QWAA 2VQFF 4DSJA 3C46A 4RNOA 4C6AA 3OL8A 2YX7A 3KLFB 3V4IB 3FEZA 1GX5A 3QIDA 3RUBL 4DX7A 3Q89A 1XMQF 2KFNA 1TL4A 2RD5C 1SH3A 3S01A 2VG6A 1R0BG 3G8SA 4JV1A 1RHRB 5B0BA 5K9FA 2W8LA 2CQCA 2HVIA 5I3QA 2FLPA 1CJKB 2POKA 1TQLA 4AQYJ 2JX2A 4HHHA 5E3PA 3QQCD 2VV5A 4DPWA 2R7VA 3HXMA 4MKYA 3D6HB 5IS2A 5ITHA 5ETRA 1T3NA 3GJRB 2CPFA 1FVQA 3VVUA 2Z30B 4FXWA 1ROFA 3PYGA 2KG0A 4MYTA 1DQ9A 3NLCA 2DHSA 1F2HA 2AYMA 2ZJQQ 4CO5A 5J2QA 2Y1JA 2K7JA 2WHOA 3D67A 3ZNJ1 4F8RA 4UF4A 4J9MA 1CC7A 2HBRB 1NH7A 1OYEA 4AT1B 2IMOA 2NYHA 1WACA 4DG1A 2IM1A 2IM0A 3O1LA 1VR6A 4ZN3A 2BE7D 2DXDA 2YWEA 4P2XA 1S77D 1HNVB 3M8QB 1YJNS 5HROB 3OFGA 4Z37A 1HR0J 2AV5A 3AJDA 4OZNA 2PA3A 4NLVA 5A8RB 5BR8J 4LVNP 4S0MA 1U6BA 2YNFB 1HKAA 2BUNA 3VQSA 1JMTA 5KG4A 5DZ6A 4FYWB 2BBEA 3H7HB 1U8SA 3KLFA 2HAFA 4TYBA 2MHEA 4BBYA 1DLOA 2F4VJ 2NSBA 4WKYA 3JQJA 3DLGB 2LYVA 4PG4A 3PX6A 3G2XA 4ZVQB 1ZH5A 3OT9A 4NCGB 2J7KA 1CJKA 3V6KA 3KJQB 4KR0B 3DOMB 1YSJA 2B4UA 1P27B 3FZ2A 3DDNA 3MR2A 1N4LA 2EC2A 5ETLA 3TVYA 3IR6B 2QG9B 3K8WA 1YBTA 4NMXA 1FKOB 5D78A 1NK6A 1S0VA 3H5XA 2L3MA 4PRFA 5DO2A 4PWDB 3NCPA 1PG5B 4WIQA 1SIWB 2DNGA 2Q6BA 4M5KA 2W2MP 2OSRA 5L8RC 3RRKA 1UVIA 1BMQB 2HFVA 4DV7F 2Q1LA 2B9EA 3VAKA 3TRGA 2QJ3A 4QU7A 2YX4A 1B3TA 4OYOA 4JP8A 3FSYA 1UZDA 5ETTA 1XR6A 2YH0A 3SQOP 3WBZA 1J27A 4WFYA 4DI6A 4ZLPA 4WFBQ 3JSBA 1WEZA 2DRAA 2AP6A 1U1KA 5JVGQ 2HLUA 3ENWA 4JI4F 1HNVA 4DV5F 3M8WA 3M8QA 4P72A 5HROA 5GVQA 4TKTA 2KVIA 2E7VA 3Q8YA 5A8RA 5F8GA 1RABB 1C1CB 3N6NA 2CPXA 2YNFA 2IRUA 1FJCA 1V3ZA 1GXUA 1WC5A 2HHHJ 4G1PA 3LAKA 4K4UA 3OJUA 3QT6A 4DCPB 4QCLA 2GHVC 3CT9A 4XAKA 3K58A 4JBCA 4DL0C 4R25A 2CQHA 4C48A 2M5YA 3DLGA 1JLCB 3H8YA 3IGNA 3G8TA 4NXMF 1U1MA 4NCBA 1QAXA 1UEKA 3H42A 2O3DA 4C0OC 1IQTA 2K06A 3DOMA 5KG7A 4NLPA 2C2NA 2GJ2A 2VF3A 3X3UA 3EZ5A 1Q8LA 3I0SB 4RBVA 2E44A 3FMBA 2A2CA 4USMA 3TJAA 1HNZF 1RKJA 3IXQA 5CD4A 4DV0F 1FKOA 3TAPA 5E3AA 3CJRA 2BEFA 1PYSB 4PWDA 3PZPA 2XGPA 4JI0F 1AYEA 4IR1A 2EFGA 3ETMA 4PYAA 4J9LA 1FRMA 2HVDA 3RRHA 4O3RA 2DH8A 4U7UK 1S1WB 4DUZF 6FD1A 4RUCA 4ANCA 1I6JA 2GAGC 1VQ9S 1HA1A 3Q23A 4GKKJ 1VQKS 1B0TA 2I38A 3ILJA 3BQ1A 1S6QB 3MCMA 1C4CA 1VCTA 4UOFA 1RGVA 2PA8D 3CDBA 4ZP6A 2MLZA 1GFWB 1R6VA 1C1CA 2LQJA 1SB6A 2H54B 1FD2A 2DBBA 4WJBA 4ZDNA 1NSPA 2KXFA 2QSWA 4ZLNA 3G6ES 4FYXB 2AF6A 2VJUA 1KWMA 1U25A 3BGUA 1VQ6S 1IM4A 4UUWA 4W92B 2UXDF 3HVTB 3EZOA 1JLCA 3MEEB 5IWAJ 4A8OA 3GP9A 1RWXB 2AX0A 1U09A 1QTNB 4NZ7A 3RRGA 1CVJA 1OIAA 3I0SA 3CE8A 2WSCC 3IWLA 3CIZA 5KFXA 3AD8C 4JI1F 2YNHB 5IT0A 4PR6A 2ADBA 1RWNB 2XHWA 2WB1D 1S0NA 1VHFA 3IBWA 2FVCA 5JVHQ 1AUSL 1DAXA 3FSIA 3FUYA 4Q45A 2B7BB 4C98A 2XS2A 4M5IA 2YTCA 4U7UD 3NRBA 1M90T 1S1WA 2VDIA 1Q86T 3DRPB 2JEFA 4I68A 3QWPA 3K89A 2OAUA 3EJMA 2KZZA 2EBGA 3FJ2A 1UFWA 2A2DA 1S6QA 2BJEA 3ISND 3G82A 3MGJA 3GPAA 4O23A 3GSDA 2LXUA 1RACB 3IWNC 4NRUA 2B5JB 4ELUA 2B4OA 2JEIA 4F4WA 2HRTA 5KFKA 4XDCA 3C16B 1SVDA 3M6UA 2RDDA 4DN9A 2RDIA 2FGCA 2V0NA 7AT1B 4DV4J 2MSSA 1B0PA 4ZMMA 2LKZA 4I69A 2ZM6F 1N5QA 3H25A 4QYZJ 3FEYB 1TK8A 1SKSA 3W2WB 1N6QB 3H98A 2PD1A 2ASYA 4CWBA 3HJVA 3BF4A 4NYZA 3HVTA 5LMNF 3MEEA 5CH7B 4LFAF 2R7OA 1URNA 1QJHA 2XO7A 4Q0BB 5GAEU 4WFXA 1VQNS 3UN5A 4P2SA 4NRTA 4PABA 2XMWA 1NB2A 2QA4S 2ADCA 4JI7F 4F2SA 3D1HA 2DRBA 5DLFA 3CJ2A 3BS9A 2AJ0A 3IAS9 3KG4A 3FQLA 2YNHA 3GFZA 2EG1A 5KFNA 4K0KF 1WTBA 3CJTA 1HARA 4AUKA 1HNZJ 4KRWA 4B9UA 1L3KA 5C42A 4YOEA 2F3JA 3MCOA 1NXIA 2HQGA 4IYQA 4X4QA 2WBMA 1UA1A 1FD8A 4LFCF 5K8OA 1QSSA 5DGBA 1A0OB 1REVA 3DRPA 4M5NA 1S97A 3QZ8A 2CPYA 3TVKA 4DR6J 2DR7A 3EVOA 4PQAA 1H6KX 4LF5F 4QR2A 2GS8A 2GJFA 5ETVA 2B5JA 3IG1B 4DHVA 4DR4F 5L1LA 2FUG9 3C16A 4FVMA 5F41A 4ZJQA 2V2QA 1P1TA 3PG9A 4K4YA 2EI5A 3SSQA 3R7NB 5L38A 2Q79A 2RHSB 4RNMA 1NJIT 2RQCA 5LL6d 1FK9B 3JTNA 5IM0A 1Q8IA 2H1YA 2J9CA 5DZ7A 5L1IA 1RBOB 2F8EX 2QEXS 3LA0A 1KTVA 3X1LB 4WZMA 2A0FB 2C3PA 3HMJG 2XSFA 3FEXB 3PO4A 3MM7B 4Q0BA 3BGRB 4HTJA 1N33F 2BKNA 4JI8J 1RAAB 1RCXB 4MK9A 4NWBA 1OPZA 3R5CA 2HQ3A 3KFWX 4LREA 1KTQA 1X9WA 4WE1B 4N5SA 1NNDA 1K0TA 4M1KA 2VHGA 5HLFB 2EFVA 1H2TZ 3TR5A 2NSCA 4JI1J 2NLWA 2YPZA 1RADB 3CWJA 4BC7A 1UL3A 1T9XA 4ECVA 2BRLA 2ZWPA 1N5SA 1Y3KA 2WAQD 3TO8A 5KFQA 3C66A 4P75A 4UT4A 3ELHA 1YRUA 1S1TB 1AZSB 3BB5A 3K7RA 3J81j 1VC5A 2VONA 1CJUB 1Z2ZA 4HDHA 4CIOA 2RNEA 4QPXA 4ITSA 1IBKF 3HT0A 2GZOA 2GVDB 2XZTB 3IG1A 4JOUA 3SCIE 3OD2A 3ZO7A 2XZDB 3F41A 1Q0NA 1AUDA 2I5JB 5KT3A 1NK7A 3MMBB 3N6MA 1JKHB 2ZITA 4OZJA 2W2QP 2M8HA 3W8GA 3OFFA 4DL2A 4FDFA 3HHLB 1TK5A 1FK9A 1OY6A 5LXRA 2RDJA 4V1Ak 1TU0B 3H4DA 2F1FA 2GNKA 3EVWA 3OR1B 5E3CA 2E5LF 4OHXA 2XB2D 2CPDA 2GHPA 4NYOA 3D68A 2E7WA 1ZPVA 3L4BC 1RTDA 1X9SA 3L7OA 4XPEA 1G7CB 3MM7A 3BGRA 3B78A 3EXCX 2IJFA 3GIJA 2LFVA 2IIHA 1CLFA 5T41A 4DR3F 1AFIA 4WE1A 2W9BB 2V34A 3JXOA 2VPYB 5HLFA 5KTQA 4LBPA 4CTAB 4FZVA 1VMBA 2MZRA 2JNJA 3VAHA 2DR5A 1SXLA 4K4WA 3RU0A 4K0KJ 1JXVA 2W25A 2JRSA 1TZ0A 1IKWA 2R7XA 1KSPA 1PJ5A 1DQAA 3GWCA 4WP3A 1S1TA 1K9MT 2G2YA 4UQGA 3WC0A 3IBCB 2NQPA 2C3UA 4LFCJ 4B9MA 1CJUA 3BBCA 1RT3B 4J9NA 1X5OA 2DGXA 2J0QD 3FRZA 3CD6S 3G8QA 2GVDA 3U02A 2I5JA 1HFEL 1U02A 3NS6A 1IBLF 4DUYJ 5H9FK 3MMBA 3N5BA 4XK8C 1PC4A 1VBKA 1BQNB 1VQSA 3HHLA 4YQWA 4Q44A 4WFZA 3VCDA 1PAEX 2HFSA 2VQEF 5SZTA 2ZJRQ 1JJ4A 5DQHA 2X3DA 4HR2A 4MMOA 5EWEA 3TAQA 5D4LA 3EICA 2KB2A 2PSZA 2CQIA 1U1NA 8ATCB 4J90A 4F4ZA 3FVYA 1U49A 2DR6A 7FDRA 4PPDA 2OELA 3M9OB 3MFIA 4CDIA 2E29A 2IA0A 2HHTA 1YJRA 3RBEA 2P6SA 1FXLA 2DHAA 3MR7A 1N33J 2D3UA 2F9JA 2IJNA 2W9BA 4ECUA 2HBQB 3IFEA 4TQRA 3G6YA 3UDCA 3IM9A 4LSNB 1RK8A 3D0IE 2G13A 4V19X 3CJ0A 1O8BA 2DHGA 3JQKA 2BQ3A 4AD6A 3HFKA 2DJWA 1SL2A 1XQIA 1SJRA 2IC3B 1PJ6A 1GNKA 1R8CA 2YKQA 3GE9A 2DIVA 3P5BP 3AD9C 3UCUP 2CPJA 3CMQA 1X8DA 4DPUA 1D9AA 1RT3A 5F9LA 3QAUA 1FXDA 2UUCF 1GTEA 3BN7A 2ZZNA 1XC9A 3THTA 3DMJB 1JXLA 2CNNB 2JVRA 3GFHA 2M7SA 1VQOS 5GADU 3FBCA 2DGSA 2C28A 2VU5A 1VQPS 4NZ6A 1L3VA 5C25B 2HFUA 2J9DA 4ED5A 2W4PA 1VIXA 1KP6A 3LW5C 3V6HA 2P9EA 2RT3A 5DG8A 4JI2J 5FJ4A 1RSCA 1FERA 2FHJA 2MMYA 5F8JA 4IO9Q 1BQNA 2NPFA 4K4ZA 3M8SA 2MZQA 1VK3A 3K17A 5IV4A 2FY8A 3M8PA 3LWMA 2MZJA 2XTJP 3TZWA 1FDDA 2FC8A 2J9DE 4EBEA 2QMUB 3KK2B 2NXUA 3HHLC 3T1HJ 1N88A 2OP5A 2E5LJ 3GU0A 2DGWA 5LMUF 2HLTA 2D69A 5KFCA 4X66J 3UN2A 4YUDA 2XCPA 4X84A 1WDTA 5GAEI 3V6DB 3BJYA 4PG8A 4D3HA 5DG9A 2WK4A 2E9TA 2E5GA 1VRTA 1V3SA 2FIUA 5A8WB 3D5MA 4GC7A 1IJFB 4RO0A 2MKKA 3UI3A 5AJ3J 1SCJB 1WF0A 2ZH6A 2GJIA 2H5JB 4B9NA 4GKJF 2B9YA 4YY3F 2IC3A 2AJ4A 3H90A 3NBPB 1X4AA 3K0JA 1FO1A 1H74A 2VJVA 2XMUA 1S6OA 4O4RA 2FJEB 3DMJA 1FVSA 3N6LA 1RKIA 1Z1ZA 2B56A 3I55S 2AKWB 4B3RJ 2XS5A 4LR7A 1A6LA 1SV5B 1EQ0A 4ZVEA 3HSGA 2H5EA 3DOKB 4PQUB 2H3EB 4JYAJ 4CP5A 1T94A 1VC0A 1UP1A 3MM8B 3BO3A 1T3OA 1W2BR 2AX1A 4JUZA 1Y4ZB 4CNYA 5HN0A 1UVJA 3MHYA 1NKBA 3CJ3A 3FCWA 1TFYA 4LF1A 1NB7A 2E9ZA 2DGQA 3K59A 1G1XA 3CMAS 2YKAA 1CSJA 4DR2J 2CZVC 1RTIB 4OFZA 5LJ3Y 3H2LA 1RT7B 2HVZA 2ZC3A 4C97A 2W8KA 4CH7A 2CADA 3AJ1A 2VASA 4LF9J 4KAIA 2V2KA 3KG0A 3F73A 3GONA 3OQ2A 3QGGA 1XNQF 2ZE2B 4CCHA 3V6DA 5L1KA 3R6LB 3CJSA 4ECYA 1HBNB 2C3MA 5A8WA 2HK2A 3CUNA 2Q6CA 3MM6B 2HBYB 2C1EB 2CDRB 4F0KA 3OLAA 2MXYA 4K2JA 4IOAQ 3CO9A 3OFHA 4DU8A 2RUGA 1NPPA 3K57A 4NZ0A 3MCSA 2KU7A 3BGFA 1HNWJ 3NBPA 1X4FA 1UAWA 2E1RA 5ADZA 3N28A 1JJCB 1MMNA 1YHQS 3IO1A 1S9FA 2HG4A 4CO2A 4ZCIA 1TUGB 2OLWA 2UZAA 5I3PA 1SV5A 2E66A 4UOGA 2XWYA 2MGZB 2J7WA 5EGYA 3DOKA 2W9CB 2F8HA 1OQ3A 4PQUA 3MUMP 3ET6A 4M5DB 4AXJA 4NXNJ 2Y3YA 1F9HA 3PY8A 4AXIA 5HP1B 4Y2KA 3KTQA 1ZZFA 4F04B 2CIMA 1N34F 2C2DA 1HQUB 1HBOB 2WTFA 2KXNB 1ZETA 1QVGR 2XY7A 4KIAA 5KG2A 1RTIA 3OL9A 5LSRA 3CCMS 1RT7A 1RISA 2VFVA 5J2PB 1FKPB 3J7YU 1KHVA 3HZEA 1QVFR 5CXTA 3I5BA 3DLJA 3DM2B 3LAMA 2VFUA 3FRYA 1RWPB 1DTTB 1Y5IB 2P2CB 2MZSA 5KFRA 2HWTA 1HBNA 3Q8UA 4OJGA 1SQGA 4Q43A 3O3LA 1R0CB 4IDKB 3MM6A 3L9ZA 2W9AA 4RUHA 1FRJA 4C8MA 4EWTA 4MIWA 1PAUB 1LQ9A 2Q3PA 2G4BA 3JAMY 2LMIA 2P8IA 5A2QU 3I6PA 4J37A 1SKUB 4ZA1A 2OEKA 2RH3A 4M8LA 4QPTA 3GJSB 2VB6A 2U1AA 2RU3A 5A2QY 4KJIA 1NJXA 2OTJS 2MY8A 3SCLE 3EDQB 3ONQA 5JXSA 1MWQA 4CI0B 4DV3F 2EVZA 1RT1B 1RAGB 2UXBF 4YFUA 2JL9A 1U8WA 2E5IA 3MXHP 2VH7A 4Y65A 2MGZA 4ZPCA 2W9CA 3DRYA 3W64A 3CULA 4KO0B 2XMKA 4KH1B 4M5DA 1RYSA 4WTYA 1WC0A 3I96A 2XYGB 4ZVGA 2W24A 4DPTA 4A46A 1N0UA 2KYXA 1HQUA 2ZH9A 4ES1A 2CQDA 1KC8T 1NUEA 4B3OB 1L3TA 3T9ZA 2PN6A 4G65A 3QT7A 2J5AA 3W65A 1N5VA 3D6TB 2F63A 3IGVA 3C2PA 1FHTA 2PIIA 5J2PA 5EN1A 2Y9HA 1FKPA 4LRBA 3Q83A 2Y1IA 3DM2A 5E7OB 3IM8A 3QT5A 3MTJA 4AE5A 1DTTA 4LF4F 2CPHA 3RYLA 4URSA 1KVKA 1VISA 2H65B 2XULA 4Z2XA 1TL5A 3MTKA 1WTFA 4A8FA 4HLBA 4F36A 3NCQA 4IDKA 2NCKL 4LVOP 3NG8A 4OZ5A 4ZJLA 4RBUA 2AGPA 1ZS6A 4IFVB 1MMDA 3NAHA 3G6XA 2W1BA 2CJ9A 1OPIA 3LUYA 1F5CA 2ZOMA 3W9IA 4DS4A 1UVNA 4LRFA 1WKLA 4Q2MA 4RWWA 5CQGA 2N3LA 3CCQS 3T9NA 3ZZUA 2BJDA 5KFIA 1BWEA 5IQQA 4ETXA 2WVFA 5KFJA 3NAIA 4ER8A 2PT0A 1ICEB 2C2ZB 1L5UA 3QIPB 1C0TB 4LUBA 1IWAA 4C0BA 2BANB 4BWMA 1ITPA 3HFVA 5GADI 2JEJA 4OYBA 4KO0A 2N4CA 1F0XA 4YDXA 4PYDA 2DNKA 4U6PA 4J9KA 3MFHA 1DJ0A 3CCSS 3LP0B 2MB0B 3VR1A 3OV7A 2DITA 2QL9B 2WVBA 3EX7B 2N7YA 3MAHA 2JLEA 4LT6A 3TI0A 3QAEA 3DRSB 2R2RA 3WX4A 3UQSA 5DQGA 4B3OA 2HYIB 1FFWB 1WOOA 4XO0A 2HIYA 1XMOJ 3ZC4A 3LGNA 3HHDA 3ZFVA 1RP5A 4IRCA 2H48B 3ZZRA 1EAYC 3WDOA 3GIRA 1NJZA 2ZOFA 1D0EA 3T1YF 1NPRA 2XC9A 3PRBA 3DLHA 3CDAA 1YTYA 4ICLB 4A8YA 1R43A 2K3IA 1OY9A 4OX7A 4DPYA 4PG5A 5J1EB 2ZKTA 1XJWB 3FDSA 4WK3A 3J81Y 3CW2C 1M1HA 2LU1A 4AFFA 1X0PA 4DX6A 1BHNA 2VA3A 2D41A 4IFVA 3DLBA 3GV7B 3P96A 2I0XA 5ETOA 5EWGA 2CQ1A 3AA8A 5CYQB 3QWUA 2ASDA 2HGMA 3UCZP 2VIHA 4EZ9A 1F1BB 4OX9F 4QIWD 2N4DA 1PJ7A 4DR1F 1FE4A 4RU2A 3OLBA 2D1CA 2FJBB 2NZ4A 1APSA 1Y9OA 1RA7A 2CZ4A 3QIPA 2XM3A 1U1OA 1C0TA 3B4MA 4ZP7A 4F4AA 3Q8VA 3UCGA 2BANA 3HHLD 1O5JA 1JLQB 3M8ZA 4UZCA 3FBEA 3CTRA 2OJ3A 4J9QA 3JQMA 3LP2B 4F25A 2GMJA 1EX8A 1LFPA 2OTLS 3TQEA 1MSWD 1JJHA 1Y3JA 2I6WA 3A13A 2MLXA 3A3PB 2A1BA 3O8WA 5MLCV 3DRSA 5L9XA 3FBFA 4OI4A 4LSZB 1N0VC 2XSJA 3GIKA 3EZUA 2GQCA 3P3DA 5CYMB 1URRA 3Q8QB 3F56A 3PJ9A 2FZCB 2MQNA 2FVQA 2B4PA 4M5JA 4ECSA 4O3SA 3WHIA 2BZ2A 4U8YA 3H4BA 2HRUA 3H5UA 1ZTTA 3GYXB 4NLGA 3R2DJ 3BV8A 3KLIB 4NYPA 2VOPA 1GXTA 3R97A 3KKFA 1B64A 4MKVA 2NUHA 1UVKA 4YN3B 2YVSA 3UE2A 1Q7LB 2CKWA 3D6MB 2IBOA 2Y8YA 3UR0A 1GK8A 1IKVA 1R31A 2RILA 5CYQA 2QV6A 5LXYA 1H7XA 3AOCA 1FFSB 3FC9A 2BM0A 5KT7A 5ETKA 3NGKA 3CEDA 1LWFB 3GR0A 2UUBF 4K59A 2UUAF 4QBUA 2NZCA 2OFGX 1FWLA 2FHJD 4CLLA 3HHNB 2DEJA 6FDRA 3KHLA 1JLQA 5D8HB 1VQ8S 2ZBQA 3QT8A 4G3IA 2M4MA 4OJ1A 5J1PA 3LP2A 4I2QB 1F6TA 5BXIA 1TAQA 2HS4A 2FLLA 1S99A 1WG1A 4WU2A 1T7PA 2QX0A 1VLOA 4DDFA 2DPIA 4H4OA 1XNRF 2SXLA 1S1UB 3IRXA 2VKRA 1MMLA 1KR4A 1RWWB 2V2VA 4HL9A 2AZ3A 3V5RA 5CYMA 1RA6A 3GMGA 1UFLA 2R7QA 2HURA 3HI9A 3VGUA 3SEOA 4MT1A 2R8KA 2QGFB 2MEWA 2LA4A 3M30A 3GZ7A 1NHKL 3OTCA 2GCFA 4IH6A 4FPRA 3TNVA 2LQBA 1HMVB 4O3OA 4N56A 3SXLA 3KLIA 4BCAA 3GIMA 2HQIA 2QL7B 1BWVA 4JI5F 1TKZA 4LBHA 1ZPWX 1Y0HA 5F8IA 2VG7B 2BXJA 3J80Y 1VJWA 1E6VB 3PR4A 3AD7C 3RBDA 3SSRA 2W01A 1U6ZA 2MQMA 2HHQA 4UOHA 1HW9A 1HI8A 5T7LA 5DM6Q 3QPIA 3EGVA 1Q16B 1RCOB 1L3UA 2HQDA 1KS2A 2LQ9A 3I32A 2FVRA 2G1DA 3HJFA 3DRXA 2AU0A 4X65J 1FJGJ 2CQ3A 4C0HA 5F8LA 1BGXT 1NPKA 1R3NA 2MJNA 1MLAA 3RBXA 4A47A 3FFIA 4JI6F 4LF8J 4H4MB 4IH7A 2H9ZA 3BBBA 3MMCA 1S1UA 4B02A 2IDEA 4P9SA 4A48A 2D3OR 4MK7A 2QC3A 2WVDA 1YJVA 1Q1KA 3PYEA 3BH6B 2D9OA 2Z4PA 3CJKB 2UU9J 1RT6B 5CYJA 4KT0C 4P73A 4KC5A 2HIQA 4MIAA 2YQ0A 1HMVA 4E98A 4IUFA 2VG5B 3DDKA 1LNQA 3DFEA 4CLKA 2XLJA 2RQKA 1CULB 1U0HB 4AQYF 1IUJA 3CDUA 4TU8A 3J7A1 2VG7A 2C3OA 3G71S 3VVTA 4P52A 4P6QA 3OUYA 3QJPA 1RAOA 3FZBA 4YR3A 4IG0A 1U2RA 2DH9A 2YWKA 4WCEQ 2QT7A 1I3OB 4LF7J 2LDIA 3GB0A 4M5LA 4WFAQ 2IHR1 2GAHC 3ZTQA 4ZPAA 2DEIA 4RW6B 5IFMA 2BMBA 4GVBB 3F0NA 1XR7A 2NXJA 1EJ7L 3ENQA 2F9DA 1H2VZ 4C8KA 2F8MA 2JVOA 4H4MA 4MFBB 2KHCA 4NA2A 4ECRA 3KUHA 5HMYA 4HVZA 1ZM4A 4DZ6A 2HFOA 4L72B 3KLGB 1BD6A 1W2IA 3H2VE 5IV3A 1I1GA 1OY8A 3TUZC 4HH1A 4PEOA 2WW8A 1HR0F 2HGLA 1R27B 1RWMB 6AT1B 3OSNA 3CJKA 1RT6A 3POTB 4U67Q 3S7RA 3CXCR 2VPXB 2ASLA 2NREA 1VIOA 4Y2IA 4WWSA 5AXKA 3EMTA 2CVEA 3C6UB 2AYEA 3EUNA 2OSQA 3E51A 1RAHB 2F4VF 3J7AN 3HD1A 2CJBA 3AODA 1DBDA 1AROP 2VG5A 3D9BA 1N5YB 1PBAA 5LSLA 3UWTA 1N36F 1S6UA 1CULA 3VHQA 1U0HA 4DR7J 4K5RA 4EK2A 1IBCB 5KFOA 3DLLQ 3QLHB 3CCJS 2V50A 5IQ6A 2RUSA 3J7ZT 2UV8G 2V67A 3MZIA 1VRQC 4I0WA 4IH5A 4C7QA 1KNZA 2XWXA 2R8IA 3IS9B 4GMKA 3UD3P 2X1AA 3L95X 2FZGB 4ZVPB 1T9VA 1FWKA 1Q8BA 4CLPA 2RB7A 1KVIA 1SJ3P 3TANA 4RW6A 3I0RB 2WW4A 4OI3A 2Z2MA 1CJTB 3GFYA 1FT8A 2M0GB 2HVEA 4GVBA 4XDDA 1WC6A 1HNXJ 4L3KA 2DCLA 3SI8A 1U2FA 1QUVA 2V6AA 2MLYA 2FPHX 2QMWA 1Q78A 2WBRA 2X7IA 1CQNA 3DC2A 5FDLB 1WUUA 4MFBA 3ENAA 3KLGA 3RR7A 4M95A 4EBCA 1B0VA 2GMHA 5K20B 2KRBA 3OVSA 3POTA 2AIRB 4L74A 5LJ5Y 1SJ4P 5L46A 1LWEB 4KHMA 1NHVA 1HWKA 2NUUG 1PGZA 4L3NA 1B4SA 2R7UA 2ATLA 1HPZB 1LK7A 3VF0B 1IKXB 5B7WA 4UOCA 3W5YA 3SMZA 3EE3A 1HWIA 4Z7YA 3CCUS 1DLOB 5GMKa 3OW2R 1N5YA 1NM2A 2QA1A 1T9TA 4N77A 1QDUB 2CG4A 3CPWR 1BXNA 3H20A 5HQLA 1JB0C 3QLHA 2DD8S 2ZHOA 4F4XA 5B0EA 1MG7A 1O0PA 2MYFA 1FJEB 3OR2A 4CLYA 2EFOA 4ZVOB 3KDNA 1H2UX 1HBMA 3HX9A 2PI5A 3IS9A 1YRXA 1HHSA 2NXCA 5JMNA 3MURP 2OPQB 4ECQA 4B3TF 4UY85 4RWXA 1F9EB 4FYVB 3W63A 3I0RA 1CJTA 2HKEA 2IVYA 4PPZA 2VOOA 1FX2A 3IAM9 5AXMA 2ZBPA 2DGOA 5ETPA 4FN5A 3KJFB 4KE5A 3A3NB 4ELTA 3QRRA 4TN2A 3NNCA 4GKKF 3G87A 5FDLA 2ZBCA 3VZHA 3VAIA 4USKA 5HVHA 4JI3J 5HMWA 4J9OA 1RAFB 1NAQA 1RHQB 4WFNQ 4OI2A 5GMDA 4KKOB 4NLXA 2UVRA 2H5IB 3NCRA 1T11A 3PW7A 1JXEA 4P10A 1VLYA 1LWEA 1Y7PA 1NSKL 5M2UA 1MNEA 1K1QA 4FKXA 5FLXU 1HPZA 2ZH7A 1IKXA 2FYXA 3KMQA 2HK3A 4Y28C 2RRBA 4F0HA 4IR9A 1ZZNA 2CXEA 5KFYA 2ZH2A 3ULHA 5IWAF 3Q24A 5E0OA 2V4RA 1VDHA 2X1FA 2ZNYA 5FLXY 3OVBA 3ILIA 4C3LA 2V94A 2V2ZA 5BYSA 3UFCX 1SH0A 1MN7A 1N36J 2VBYA 4KQZA 4DZDA 1YG0A 4A4JA 4EMDA 3BZQA 2DISA 9RUBA 4ECXA 3JSMB 2Z57B 4MTPA 2R8JA 1AB8A 4PKDB 2MQPA 4U95A 4ZP9A 3HKZD 1Q82T 4ZJOA 4OYZA 4CZCA 3ILOA 5KFAA 4LFBJ 2OPQA 1RT4B 5IOLA 3H5YA 1S79A 4C4WA 2V69A 3CCVS 2Y0SD 3OTBA 4RNHA 2VD3A 3A8JA 4PG7A 4I7FB 4ZVRB 2C2MB 1RTHB 1EIYB 2Z2ZA 2DNRA 3UPFA 1YJ9S 4ZPDA 4RNFA 1N8RT 2HPUA 2MKHA 2JEGA 3W3SA 2BR0A 2HHSA 1T8EA 3QYYA 1PSDA 2MKCA 3C14B 3HZGA 1WWHA 4TY8B 4ELVA 1QSLA 3M8YA 5RUBA 1RHUB 3KHRA 3B54A 4ED7A 3PFOA 2Y0BB 2OUGA 4OJ3A 3P8BB 1AA1B 4KKOA 4NI2B 5FD1A 4DV4F 5DETA 1M5OC 3EM1A 4WK1A 3C3LA 5KFUA 3D0GE 2MSTA 5AXLA 2XMTA 4QR1A 1CS4A 1JLFB 1RWVB 2VDHA 4NL5A 1F3VA 2OEJA 1OO0B 2E1CA 1RUSA 5KFTA 2HWHA 1M0SA 3N0VA 2CQ0A 3BYRA 3IWXA 3AH6A 1QAJA 3I4HX 3M2RB 3RAMA 1VC6A 2N3OA 2HNZA 1I94J 4FVCA 3DCAA 3CDWA 4OHZA 1Q79A 3DNCA 2MTLA 3PO5A 2QLWA 4RU9A 2GGPA 2XYHB 3T3FA 2DCUB 2YQ1A 3VGTA 3JSMA 3BKUA 2OMOA 2EK6A 3VZIA 3RG6A 1VQ4S 4IQXA 1IR2A 2HAIA 3T6JA 1ZA1B 3NS5A 4C8YA 1VS3A 1RT4A 1UJ5A 3G86A 1WC3A 5E3QA 3NGTA 4B3TJ 3MOZA 1TR0A 5IXUA 1VQMS 3Q2SC 4I7FA 5KFLA 3LO3A 1IWGA 3CVKA 1RTHA 2G1HA 1JWWA 4B3MJ 3HF5A 4DR6F 4J9PA 1SH2A 3MAAB 2V8VA 3P6YC 2G2OA 1SKWA 2FTRA 2KZMA 4IG3A 2QA4G 4EEYA 4HHUA 2AHOB 2E5HA 3C14A 3TZZA 4TY8A 3G82B 3J7Z5 1S0OA 4C3MA 4I56A 2PEBA 2EEYA 3MI7X 2B8QA 4USVA 4NI2A 1LXJA 3EGZA 1M5HA 3AFGA 5MAOA 3LWLA 3DDIA 2XLKA 4NLQA 2W2OP 2AJQA 3QSYB 2ZZMA 4YB5A 2WONB 5AT1B 2KT2A 4WP8A 1JLFA 3SQGB 1B7FA 2QA2A 4CYUB 3AHPA 3AB2B 3MEKA 4ZOSA 4KGMA 3IR5B 2A6OA 4XPCA 3RB4A 3M7VA 3ZZTA 4DPXA 4F3OA 2ASJA 3R3TA 2CQPA 3M2RA 4JI8F 2E1PA 4ZHRB 1UWBB 1NU4A 5FIIA 3BO4A 1KONA 1HLWA 1NRKA 5K8NA 4KHRA 4BS2A 4CO1A 4CH1A 4DV2J 2YWHA 3T19A 1CBKA 4LR8A 3P45B 2JJ4D 5H9EK 3UVJB 4Y00A 2R42A 4ZKAA 3TYTA 2L08A 2KDOA 5C42B 1X4DA 4V19J 4HACB 3MMJA 4NLDA 4E0DA 3T5KA 1IN0A 4C11B 4WPAA 3A1YG 5D0EA 4LRCA 3LP1B 4K5SA 1REVB 3MAAA 5KFSA 2FZKB 3AXMA 2AGOA 4USJC 2OH2A 1ZOTA 2M3DA 2P9CA 5EDWA 2QN6B 2WRMA 1F60B 2CWKA 4MAKA 4NLUA 4ERDA 2DGTA 4QZVB 3CCRS 3FK4A 2L48A 4WP9A 3LH2S 1EARA 4ZPWR 3MOJB 2ZH1A 1UVLA 1G6BA 1WG4A 2WONA 1JLGB 3SQGA 5DS7A 3OJSA 5EWFA 5IM0B 5KOXA 2WOMA 4OZ1A 4QQBA 3TEHB 4CYUA 4P7TA 1NDLA 2ZWOA 1UPPA 4M5HA 1XMBA 2VICA 2DGUA 5THWA 3W60A 3RB3A 1EB0A 3PACA 2CNKB 4X2BA 3D1OA 1U2CA 3TOQA 2FD2A 1LKZA 3TZYA 1VK8A 2IAJB 4ZHRA 3FKBA 4RNNA 1UWBA 4QYZK 4HDGA 3ITHB 2HWIA 2G0IA 2ZVIA 3PM9A 2M2BA 1PC5A 2J6UA 4CM0A 2V9WA 1A9NB 2KRRA 1TELA 2CQGA 3IR7B 2R2SA 3MEDB 1J5EJ 5CZVA 1I5OB 2ALYB 4ECTA 2QFJA 3I9V9 2W7OA 4U8VA 3UVJA 1GXLA 2XLIA 5G0RB 3CD5A 2BE9B 3Q8RB 1RWKB 4HACA 5F8MA 2KFZA 1RTJB 1U1LA 3W2VB 4C11A 2KJVA 3LP1A 3GTYX 4F4KA 5IZHA 3A3OB 4DPOA 2I9SA 3PX4A 2ACMA 1R8PA 4URGA 4CM2A 2ZUGA 1WNEA 3LQVA 3OTOF 4DUYF 4DR5J 3O2IA 1TKXB 1VRUA 3KDOA 2AD9A 2QE5A 3CIMA 4UQTA 1D1UA 4OQJA 2IFXA 2A6MA 2X1GA 4CH0S 4DFKA 3PW0A 4HTIA 4LF2A 4DWIA 3MR3A 1JLGA 4ZVHA 4HI1A 1EHWA 2BACA 2PMWA 3HSJA 3GSIA 4WZQA 2EW9A 1WF1A 1AFJA 3M4XA 2DNYA 3QGIA 2XI3A 1QLNA 2ABYA 2IAJA 4NA3A 1RTDB 5CD4H 1C0UB 2R9LA 4LR9A 1RHKB 3CC4S 1YZ7A 3ITHA 1MWYA 2HHVA 3DRRB 2ZHAA 3B6BA 1U7LA 3NGSA 5A6PA 4FF2A 4W90B 5AE2A 3W66A 3MEDA 4ED8A 2L9DA 1LW0B 3NY0A 1V5VA 3LPYA 2VC1A 4DEZA 3CD7A 5B0AA 1S49A 4X4SA 2WVEA 1ZAVA 3JTOA 1TL1B 4KTQA 2N7CA 1M5KC 3GFXA 5KFFA 1WOSA 5G0RA 1N48A 4YR0A 2HNDB 2AJ1A 4FXVA 1IKWB 3RAQA 3RAXA 5K8PA 1OWXA 4RPFA 1RTJA 2XO6A 1KLNA 4CRJA 4ED3A 3W2VA 3PYFA 4B9SA 2DR9A 4JV5J 1FX4A 3NMRA 3T1AA 2HHUA 4CNZA 1D09B 5D0RA 1TUVA 1HBUB 3RB0A 1YI2S 2FB0A 4YP3A 3KOAA 4OYWA 4ED4A 3PHEA 3BR8A 2UXCJ 2AZ1A 3LGMA 3M1VA 1TKXA 4Q7AA 4JI2F 2Y1LB 4L73A 2MQLA 1P9QC 1RT2B 2UUTA 4NE9C 1DY3A 2ZH8A 4NLWA 2CUYA 2OPSB 3T1HF 4X64F 2OPPB 4ED6A 1ZA2B 5BJRA 4ZCLA 1YBUA 2D3ZA 1DQ8A 4X66F 2CNLB 1H72C 4N8NA 1C0UA 2AWZA 3DRRA 2J76E 1XEZA 5HAOA 1SKRA 3R5DA 2RRNA 1FE0A 3PV8A 3R5AA 3CCTA 1LW0A 3A4TA 1FNXH 1WHYA 3NGRA 2HFNA 5AJ3F 1JLEB 5GAGI 2KO1A 3N5FA 1TL1A 4RW8B 2VUGA 4J9VA 4KGXB 2ROEA 5E5NA 3MPDA 2HNDA 5HL7Q 1JLAB 4UTGA 1D8ZA 2MKIA 5JJBA 2DB1A 4DCOB 2WZ1A 1NLKL 2KKHA 8AT1B 2ZDOA 2LA6A 1VYAA 5A6WA 1XN9A 3EVMA 4ZIWA 4KPCA 3ZZYA 2DRDA 1RE1B 4H54A 4OZ3A 1UMJA 4B3RF 1HBUA 3D0HE 1WI6A 2O01C 4J91A 2ZH5A 3C19A 4USUA 4LJMA 3U1LA 1WEXA 4JYAF 5C2GA 1SJFA 1RAEB 3TX0A 1KBRA 2EBEA 5A0YB 3OTOJ 3JS9A 1T9YA 4A8WA 2QO3A 2CYYA 4ZK7M 1RT2A 2YKNB
chains in the Genus database with same CATH topology
5J1PA 3LP2A 5IT4A 5JVHQ 5L39A 2EWHA 4I2QB 1DAXA 1RQ0A 1TAQA 3FSIA 2HS4A 3MR6A 2FLLA 4Q45A 3WC2A 1S99A 5K14A 2B7BB 4C98A 2XS2A 3O44A 3DLKA 1WG1A 4WU2A 2OPSA 2YTCA 3JB9k 1T7PA 3V2UC 2CQ2A 2ILZA 3M8PB 3NRBA 4DDFA 3KLEB 2DPIA 2E5JA 4H4OA 3KK3B 3E8OA 2BQRA 1M90T 1KQGB 2HVHA 1S1WA 4IRDA 1XNRF 4DR2F 1Q86T 2OPPA 3DRPB 2SXLA 1I94F 1S1UB 2JEFA 4I68A 3IRXA 3E01A 2IYGA 2VKRA 1MMLA 2LDYA 3QWPA 4JV2A 2OAUA 2KZZA 1KR4A 4HL9A 4LF9F 2EBGA 3FJ2A 3K5OA 3V5RA 2MDAA 1S9EA 1UFWA 3VAMA 5HO4A 5CYMA 1QUPA 2A2DA 2E9RX 1S6QA 2BJEA 1RA6A 3GMGA 3ISND 4DF8A 5E41A 2VFRA 3MGJA 4NLSA 2Q66A 4O23A 3GSDA 2LXUA 2KXHA 2X51A 3PNIA 3IWNC 4NRUA 2B5JB 4HT7A 3KHGA 3VAJA 4ELUA 1UFLA 3I5CA 4CT9A 5KFBA 2B4OA 2F40A 4OL8A 2R7QA 3HI9A 2JEIA 3SEOA 2QMXA 2BW2A 4F4WA 2R8KA 1H98A 5KFKA 4XDCA 2PMZD 3OBIA 3FSXA 3M6UA 4HEA9 2LA4A 3M30A 2R7RA 2DNOA 4DN9A 1VQ5S 4OI0A 3GZ7A 3R1LA 4OI6A 3U27A 2RDIA 3MF5A 3OTCA 2GCFA 2FGCA 4IH6A 1X4GA 2V0NA 4FPRA 3QO9A 3TNVA 3G96A 4LQ3A 2MSSA 1B0PA 1GT8A 4ZMMA 4C8ZA 5HI7A 2LKZA 2LQBA 1HMVB 1VRTB 3US5A 4XIUA 1JLEA 4O3OA 2K3KA 3I5AA 5HP1A 4N56A 2CJKA 1LWCA 4I69A 2ZM6F 2BM1A 1N5QA 4X4OA 3H25A 4RW8A 4QYZJ 3SXLA 2J0XA 1ZYQA 3KLIA 3FEYB 2V8GA 4USHA 2R8HA 1TK8A 2IMWP 3Q23A 1SKSA 4BCAA 3L7PA 3W2WB 4B3MF 1N6QB 1FNOA 1HBOA 2PD1A 1T02A 2HQIA 2ASYA 3H98A 1BQXA 3GIMA 2RKIB 3THPA 2GA7A 1ZM9A 1JLAA 1G2EA 3BF4A 2N82B 4R5PB 3LOUA 4NYZA 3HVTA 4J9RA 4JI5F 3SFGA 1TKZA 5LMNF 2IA6A 1HNWF 4C8NA 3MEEA 5CH7B 1S10A 4LFAF 1ZPWX 2R7OA 1Y0HA 4FS1A 1URNA 5F8IA 1QJHA 2GW8A 2XO7A 1FNMA 2DNQA 2VG7B 2WSEC 2BXJA 3J80Y 3NGDA 1VJWA 1E6VB 2PE8A 4O3QA 4YDDB 3PR4A 4Q0BB 3BGLA 4RW7A 2CPZA 5GAEU 4WFXA 3RBDA 2GO9A 2IM3A 1FEHA 3SSRA 4EO6A 4X4PA 1HL6A 1VQNS 4P2SA 2GQQA 3I4PA 4NRTA 4PUOB 1U6ZA 4PXDA 2MQMA 2L9WA 2HHQA 2R2TA 2XMWA 2QA4S 1HW9A 1HI8A 5C5JA 3SV3A 2ADCA 4JI7F 4F2SA 5T7LA 5EHHA 5DM6Q 3D1HA 3QPIA 2DRBA