5J2PB

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and a second efda-mp at the n-(pre-translocation) site
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
425
structure length
400
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
total genus 110
structure length 400
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2pB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pB03
3KLEA 1IKYA 1RT4A 4M95A 3N6LA 3ITHB 3QZ7A 5DG8A 1IKWA 2ZKUA 1REVA 3DM2B 4OL8A 4PUOB 3OSPA 1HARA 3QO9A 2IAJA 2AQ4A 3IS9B 3HVWA 1HMVB 3UDLA 3CJ3A 4LQ9A 3KK2B 1VRTB 3DMJA 2R2RA 4ZP6A 3C6TA 1REVB 3DM2A 4R5PB 4PUOA 5KFAA 3MF5A 4EEYA 3QGHA 1S6QB 3QIPB 1IKYB 4RZRA 3PW2A 4IR9A 3KOAA 3G6XA 3BR9A 1C0UB 2XGPA 4RNOA 2AGPA 4YR0A 3C6TB 3IS9A 1FKOB 3DRSB 4Q0BA 5J2MA 3D5MA 3PZPA 4KFBA 2R2SA 3ICLA 1RT6A 3UPFA 1T94A 1NNDA 4WYLA 3VQSA 4K4TA 5C25A 4KO0B 2XWYA 3JYTA 1D0EA 5EWFA 4NCGA 5DGAA 4IH7A 3CVKA 5KFIA 5EWGA 3GQCA 2E9TA 2HAIA 3DLEB 4WE1B 3I5AA 4QWEA 3OHAA 2ZD1B 4O3RA 1S0OA 3QLHB 5KT3A 3LP2A 1S9FA 1TV6B 4EYIB 4PQUB 4KFBB 1RT3B 5F8NA 4U6PA 4ED8A 1S9GB 5KT7A 4DL6A 4KO0A 2J6UA 4DEZA 2HNDB 2O5DA 4EO6A 5KT5A 2XI3A 1LWFA 1SUQB 5F8GA 1HNIA 2WHOA 4RW4A 4KB7A 4Y34A 3OL8A 4ED0A 2IC3A 2IM2A 3HHKA 3DRPA 4TN2A 2XCPA 1RT3A 3IRXB 2RF2B 1S48A 1JX4A 4WFZA 5HLFB 3OLBA 4ZPDA 4QWCA 4RW4B 5JXSA 1MMLA 3Q8SB 2V9WA 4NLGA 5J2QA 4NRTA 5KFJA 5KT2A 1SV5A 5CYQB 1RTHA 2UVWA 5KFSA 4Q43A 5FDLB 3JSMA 4R8UA 1N4LA 3MFIA 3CJ2A 3IRXA 2R2UA 4IFYB 4RU9A 3RAXA 3E01B 4ED6A 5CYQA 2JEGA 1RT4B 3ITHA 3GIIA 4J9OA 3JSMB 4R8UB 2D7SA 1BQNB 4DL4A 1UWBB 1SV5B 3BREA 3CJ5A 1RYSA 1BQMA 3E01A 2CKWA 3T5LA 2B6AA 3OHBA 3Q8QB 4YR2A 4LSNA 2BANB 3QLHA 4G3IA 3LP2B 4ZPBA 4TY8A 1RDRA 4ZP7A 5KFGA 3KMSA 3MR5A 1S1WB 3QYYA 4ECWA 2I5JA 3LAKA 1T03A 2W9AA 2JLEA 4GC7A 1N56A 3PJWA 4O3PA 4TQSA 2BQ3A 1RTDB 4MK9A 3GILA 1LW0A 2F8EX 4TY8B 5K14B 3FDSA 2VA2A 1RT6B 2BE2B 2W7OA 1T03B 4Q45A 1D1UA 2XI2A 5KFVA 2XGQA 3NKYA 1RA7A 4WYWA 3PW0A 2YKNA 2BQUA 2WONB 1LWEA 4NLTA 1S4FA 4QWDA 3T5HA 3BQ2A 1DTTB 5J2QB 4IH5A 2HMIB 2BQRA 1FKPB 3MFHA 2V0NA 1S49A 3GIKA 3T1AA 2B5JB 2C2RA 3KNAA 1GX6A 5KT4A 4RNHA 1N48A 2WB4A 3HKWA 4DG1B 4Y3CA 1K1QA 2AGOA 4IRCA 2J6TA 2XCAA 5DQHA 5KFLA 1VRUB 2FJXA 2QV6A 3MTKA 4K4UA 1Z4UA 1TVRA 5KG6A 5HROA 3D28A 2YNFA 1J5OB 2B5JA 2AGQA 4LSNB 3DRRA 2QE5A 3OL7A 4EBEA 3FRZA 1RT2B 4IFVA 5KG2A 2UVRA 4EYHB 5EUHA 5C5JA 1JLFB 1VRUA 5C42A 2I1RA 1LW2A 1C0TB 5J2NA 2ILZA 3CDWA 3GYNA 3V4IA 5L1KA 3BQ1A 4H54A 2IJNA 4QPXA 2YNFB 1J5OA 4HKQA 3I5BA 4YP3A 2BRLA 4ECZA 3PW4A 3FFIB 2AX0A 2OPPB 4PWDB 4ZPAA 4ZHRA 4YMEA 4I2PA 3Q8PB 1ZETA 1TKXA 3KK1A 3KHRA 1LWCA 3V81A 3RB0A 4K50A 5KG1A 4K4YA 4MK7A 2ASDA 5C42B 3H5XA 1RT7A 3TAMA 2FJWA 1DTTA 3GV5B 4ED2A 2HNYB 3NGDA 3DYAB 1YVFA 2WCXA 3G86A 5KFYA 4K4XA 2VG5A 2WOMA 4I2PB 1TQLA 5F9NA 2FLPA 2DPJA 1JLBA 2GIRA 3C6UA 1HQEB 5KFFA 4FS2A 4ECUA 2EC0A 5J1EB 3SFUA 4ECYA 1HNVB 1JLBB 4NLUA 5KFZA 4JV2A 2W7PA 4IDKA 3CJ4A 2HWHA 4ZVHA 2E9RX 3DDKA 3I0SB 4ECQA 3N6NA 1QE1B 1S1TA 3H59A 1KHWA 3MEDB 5HP1B 1RTJA 2WK4A 2V4QA 3H5YA 4MIBA 2R8IA 3KLFB 1IKVB 3I0SA 4IKAA 4DG1A 2XC9A 4RW7A 1OS5A 4F50A 1DTQB 2W8KA 3FFIA 2YNIA 4I2QA 1K1SA 2VA3A 3MEGA 4G1QB 3KHLA 2C28A 3OL9A 1RA6A 1RTJB 4RNMA 1TKZB 4O3NA 4NLYA 3PVXA 1HYSA 4IFVB 1MU2A 3QZ8A 3EPGA 2UUWA 4LSLA 1HMVA 2YNIB 4I2QB 5KFUA 2VG5B 1HQUA 2RDJA 2OPRA 3CO9A 4KSEB 4WE1A 5DQGA 3MR3A 3G6VA 2ZE2A 5L1LA 5F8JA 4R5PA 4KKOB 4YQWA 4XO0A 4TYBA 4Y2AA 1R0AB 1HQEA 5I3UB 3RB4A 4EBDA 1ZTTA 3IG1A 2YNHB 4MKAA 2AWZA 4IG0B 5KFOA 2FVCA 4J9NA 3G6YA 2ATLA 1W25A 4KKOA 4TLRA 3DOKA 2BRKA 4RUCA 4ECRA 4K4ZA 4H4MA 3MR6A 2IM3A 3KLHB 4NLVA 4ED3A 3SFGA 3DLGA 4IG0A 1EP4A 4RW9A 4DL2A 1JLGA 1R0AA 3JYTB 5KFCA 1S0MA 4NCGB 3V6JA 2D41A 5F9LA 2W9BB 1RT5A 3IGVA 5DLGA 4O4GA 4K4SA 4RW8B 3DOLB 4PQUA 1S1XB 1S97A 4I7FA 3PHEA 3KLVA 3PW7A 1KHVA 1IKWB 2OPQA 4O44B 2W9BA 4MFBA 1HNVA 4KV8B 5CYMA 3KK3A 1GX5A 2JC1A 5KFTA 1JXLA 1TP7A 4ZVFA 4NLXA 5KFNA 3BSNA 1S6QA 3QIPA 4U7CA 2OPQB 1JLEA 2YNGA 4O44A 2HNZB 2OPSA 3KLIA 4EO8A 2IBKA 3TVKA 3MECA 3NBPA 4TY9A 4K4VA 5I42A 1TKTA 3IN5A 1IKVA 2RKIA 5D3GB 3V6KA 3Q8RB 1JLEB 1KLMB 2YNGB 2HNZA 2FVSA 1NHVA 2ILYA 4MK8A 3NL0A 3KLEB 5C25B 4RW6A 4KBIA 4HYKA 3MEEA 3KK2A 1JLAA 3QO9B 4F4XA 1IKXB 4QWBA 3MECB 3NMAA 4QW9A 4J9QA 1FK9A 5I42B 1S9EA 2ASLA 4F4YA 4ICLA 2BE2A 4ED1A 3T5JA 1JLAB 4NLDA 1JLQB 4RW6B 2HNDA 1C1CB 1JLCB 1S9GA 5L9XA 4F4WA 1N6QB 1IKXA 4NZ0A 1JKHB 4RW8A 3BJYA 3DRPB 1S9EB 3GV7B 2VG6B 2VG7A 3H4BA 4J9KA 1HNIB 4TYAA 3DLEA 4ECSA 4J9LA 4URGA 4O4RA 3UR0A 2IMWP 1RTDA 5F8IA 5KG5A 2DPIA 5DG7A 5KFRA 3KLHA 1TL3B 1IM4A 2YKMA 2ALZA 3KLGA 4RW9B 1EP4B 3KLIB 2YKNB 1QAIA 1I6JA 4MIAA 4X2BA 2VG6A 4QW8A 3DI6A 5FDLA 1LWFB 4Q8EA 4O4GB 3FSIA 4NLQA 1TL3A 4NLPA 3V6DA 4ECVA 1KLMA 4MH8A 4WZQA 5EDWA 2W8LA 5C24A 3LP1A 1T05B 2R8JA 1S1XA 1XR5A 4I7FB 2R2TA 3KMQA 3ISND 1S1VB 3SI8A 4KV8A 4WFYA 2RF2A 4XPEA 1XR6A 4WXOA 2BANA 5DQIA 1FK9B 4WZMA 3LP1B 1T05A 2B6AB 4Y2CA 3BGRB 3M8PB 4ECTA 1DLOA 3PJXA 4ECXA 3V6DB 3M8QB 5KT6A 1JLQA 5C24B 1SH3A 1RTHB 4URSA 5L1JA 1RT1A 2JC0A 3KJVB 2RKIB 5D3GA 2CJQA 5T14A 3BQ0A 3CIZA 5DGBA 4IFYA 3CDEA 3DLKB 5KFPA 4IG3B 5K14A 2B43A 4NLWA 4GC6A 1C0UA 3LP0A 3RB6A 1RT1B 1S0NA 4Q8FA 4XPCA 1JLFA 5F8HA 3E51A 3H98A 3V4IB 1N5YB 3DLKA 4Q44A 4NLSA 3I5CA 3FQLA 4ICLB 3LP0B 2YKMB 1RAJA 2OPPA 3KLGB 4NLOA 4ZHRB 2JEFA 4IG3A 4ID5A 4K4WA 4KHRA 3PW5A 2IM1A 1C1CA 1JLCA 3DI6B 1N5YA 4KHMA 3N6MA 3OSNA 3H40A 1N6QA 5KFDA 2ZD1A 3PR4A 1RYRA 5KFEA 5F8MA 2VG7B 4B3OA 4ZPCA 2WOMB 4TXSA 1HPZB 1C2PA 4ID5B 2UVUA 1NHUA 2WONA 3KLFA 5DLFA 4IRDA 4MKBA 1TVRB 4M94A 2GC8A 4JV0A 4F4ZA 1S10A 4FBTA 4RW7B 4FBUA 3M8QA 5F8LA 1BQNA 2RDIA 4IH6A 1UWBA 3M9MB 1LW2B 2IM0A 3V6HA 5HLFA 1RTIA 3TQ1A 4RNFA 3QGIA 4LQ3A 4DL5A 5HBMA 2FVQA 1MU2B 1RTIB 5KG0A 1S1TB 2AX1A 5HROB 3MEDA 5HP1A 3OL6A 4NLRA 2C2DA 4J9RA 1LW0B 3CWJA 3BGRA 3M8PA 5KFMA 1DLOB 3LALA 4J9MA 5HBMB 2WRMA 2IJFA 1RT2A 3H5SA 2HNYA 1BQMB 5KG4A 1S6PB 3BSCA 3KJVA 2JEIA 4URQU 3C6UB 3M9OB 1C0TA 4ZVEA 3GIJA 1HYSB 2HMIA 3BSOA 4J9PA 4O3SA 1TKXB 1S1WA 4KAIA 3UQSA 2I5JB 1S6PA 2C22A 3FQKA 4B3OB 4O3OA 3RAQA 5KG7A 3I0RA 1HPZA 1RT5B 1QUVA 1TL1B 3DOLA 3LANA 5KFHA 4WXWA 1RT7B 3TAMB 1U09A 5I3UA 2HWIA 4JV1A 3CJ0A 2UUTA 4RUAA 1LWEB 4MFBB 4TQRA 5CYMB 1TL1A 1QE1A 3DOKB 3I0RB 4O3QA 1DTQA 3T19A 4J9SA 3H5UA 3DRRB 2R8GA 5J1EA 3ISNC 1S1UA 4IQXA 1FKPA 2OPSB 3QGGA 4ZP9A 5DG9A 5J2PA 4WFXA 3NAHA 3MR2A 4ZVGA 2C2EA 1TKTB 2IA6A 1EETB 3KHHA 2R8KA 1T3NA 5KFXA 1S1UB 4R0EA 5EWEA 2BR0A 4JUZA 1SH0A 4IDKB 2W9CB 4PWDA 4H4OA 3RBDA 2OPRB 5KFQA 5KFWA 1WNEA 3IGNA 2FLLA 4LSLB 4EBCA 4DL3A 1EETA 4NRUA 2ZE2B 3EPIA 4IOBA 3PR5B 2FVRA 2D3ZA 4KE5A 2FVPA 2W9CA 1SH2A 3NBPB 1VRTA 3DMJB 2YNHA 3MEGB 4G1QA 1ZTWA 5J2NB 3OLAA 3KHGA 4RNNA 4FS1A 4DL7A 5L1IA 2JEJA 4QWAA 3H4DA 3RB3A 1TKZA 2FJVA 1C1BB 3MEEB 4IR1A 2D3UA 1JIHA 3KK1B 1LWCB 3V81B 5KG3A 2R8HA 2E9ZA 1FKOA 3DRSA 4Q0BB 5J2MB 3NAIA 1HQUB 2J6SA 2ASJA 4IRKA 1SUQA 3IG1B 3RBEA 2UVVA 2IC3B 3DYAA 4ZP8A 3KK3B 3T5KA 1C1BA 2GIQA 2FLNA 3HVAA 5J2PB 3CDUA 2V4RA 3QIDA 3HVTA 4ZMMA 3M9NB 2WTFA 4ED7A 3DLGB 1JKHA 3H2LA 4NYZA 1TV6A 2AU0A 4H4MB 1CSJA 2IAJB 3LAMA 5JUMA 3GIMA 5KFKA 1QAJA 2OH2A 4H4OB 3BSAA 3EZUA 4YR3A 3HVTB 1S1VA 3GV8B 1JLGB 5KFBA 1XR7A
chains in the Genus database with same CATH superfamily
1YJWS 2N82B 4M95A 2OD6A 5H1SV 1FX4A 2ZKUA 3DM2B 3HHDA 2DNKA 4WKRA 3OTOF 2HKEA 2IAJA 1YRTA 5K5MA 4K2XA 3CJ3A 4Y2MA 3UDLA 3WIVA 1VRTB 1NDKA 2KI2A 2LFVA 2DXDA 3N79A 3OFHA 2MQOA 4B9VA 4A8KA 3KUEA 4PAAA 4PUOA 1FRJA 3G4SS 3WDOA 2E7WA 4EEYA 4DQIA 4RZRA 4IR9A 1RWMB 3PW2A 3N4WA 5F0WA 1C0UB 2MYFA 4CNZA 4RNOA 1WF1A 1PYTA 2LCWA 5J2MA 1TL4A 3D5MA 3DFEA 1CPZA 3LF0A 1CVJA 2GZOA 1NUEA 2D69A 3IR6B 3EMTA 1FJ7A 1CJTB 3OT9A 3TA1A 5F3ZA 1NNDA 3VQSA 4OZ5A 4OZNA 3IFEA 4USUA 1U7LA 3VGVA 4K4TA 1TKDA 2XWYA 2UV8G 5DGAA 2MKYA 5BYQA 4IH7A 5EWGA 2KDOA 5M2PA 2HAIA 3TQEA 2VASA 5IT9U 4WE1B 2CPHA 2JSXA 3I5AA 4JI5J 3CMQA 2BV3A 1EIYB 3NNAA 4Q2MA 4CO5A 5KT3A 1S9FA 1ZZNA 1BD6A 1FD8A 2HSEB 3GSIA 2NS1B 2HK3A 1WEZA 4U6PA 1VBZA 5KT7A 1YX2A 4UZCA 1NSKL 3SQGA 1RAAB 3OVSA 5GAGU 1RK8A 4Z37A 4M5GA 1CJKB 1AYEA 2GMHA 1SUQB 4DN9A 2I0XA 5F8GA 4RW4A 4Y34A 2CXEA 1M1KT 2IC3A 2J0WA 2XCPA 4WP9A 2ZUGA 4TN2A 5B0AA 3IRXB 2ZJRQ 1WG1A 4WFZA 3RZAA 4LMZA 3PX0A 4MYUA 1Q8LA 1X0FA 2CNKB 2EC2A 1MMLA 2FJAB 5KFJA 4CTAB 1MG7A 3O8WA 2VV5A 2FJBB 2WSEC 1ZM3A 1X9WA 5FDLB 3THVA 4NCAA 3JS9A 2HBZB 1FRXA 2HQDA 1FWLA 3ZXWA 1U48A 3IRXA 2R2UA 2XWXA 3CDBA 3GIRA 4IFYB 2CA9A 5CYQA 2QEXS 3NEKA 1UVKA 3PACA 2Z2LA 3ITHA 1HBMA 2G2ZA 2M0GB 3C14B 3K5OA 3GIIA 2XS2A 4R8UB 4A8FA 3P49B 2VF3A 1BQNB 4DL4A 4X62J 2AD9A 1RAFB 1X4GA 4WFBQ 3OFFA 4C8KA 1RYSA 2HS3A 2CKWA 1WSVA 2OEJA 4IO1A 5D0RA 2B6AA 2K3KA 2ZZTA 3Q83A 3SSRA 5HQ8A 3OHBA 2E44A 3BH6B 2H5JB 3DDNA 3G8QA 4LSNA 2BANB 4LFBF 2RUGA 1WUUA 4TY8A 4DPTA 3GFHA 3AXKA 2ADCA 1I51B 3LAKA 1T03A 1HNZJ 4JI7F 4I6AA 2Z56B 5LMUF 2IDEA 1SC4B 2E7XA 4M63A 2BQ3A 1ZAXA 3GLJA 1RWOB 2F8EX 2BJ8A 4UOHA 4OLPA 4LVNP 1RT6B 2BE2B 2HQCA 2PA3A 3G82B 1D1UA 1CS4B 4USVA 2XI2A 1OYDA 4Z7YA 4Q45A 2FYXA 2XGQA 3H7HB 4J91A 4WYWA 2NXEA 1HD1A 2E7VA 3S6EA 3D66A 4WJBA 1Y0HA 2Q66A 4FPIA 2A2CA 3HSZA 1S4FA 1X7VA 4OYOA 4CLWA 4CO3A 3DLBA 2AW0A 2QSWA 3A8IA 1VC0A 2BQRA 5J2QB 1YSJA 4BS2A 3M32A 2Z0GA 1FX2A 4X64J 4DR6F 1VOMA 4DV7J 2ZVSA 1UVIA 1S49A 2DGTA 2K1RA 2KHCA 3LTOA 2F7VA 4K59A 2LEAA 1H2TZ 2RSQA 2XMTA 3HKWA 5AXLA 2XLIA 1IBMF 2AGOA 1W2IA 2ZBQA 3CCRS 2J6TA 1VRUB 1LK5A 3MTKA 1SI9A 4DX8H 1HWIA 3U1MA 1U49A 2KFNA 2R42A 3D28A 4LFCJ 3FSYA 3PFOA 3QMQA 1KOOA 2DGOA 2QE5A 5ETSA 3FRZA 1B3TA 2FGCA 1K0VA 4V1Ak 4IFVA 3HT3A 5KG2A 4NEYA 2R7WA 2RAQA 1Q53A 2EWHA 2E1CA 1VRUA 5C42A 2CYYA 3CGIA 3D1QA 1QTNB 3RU0A 3ZZOA 5L1KA 3DN9A 3I5BA 3KG4A 2KKHA 4HACA 2BRLA 2EW9A 3GFYA 2RJZA 4NYOA 1XTZA 2YQ0A 5T7LA 3KK1A 1NB2A 3V81A 1FDNA 2V8GA 5E3QA 2CVIA 1Q86T 1R43A 4K50A 4K4YA 4MK7A 1L3UA 1HL6A 3AA9A 4DR6J 1BGXT 3AD9C 4P2MA 4DF4A 2HNYB 4CH0S 2G0IA 3NGDA 3DYAB 1OWXA 1VLYA 2C3UA 2WCXA 3DHWC 4HTJA 5KFYA 3I31A 5IFMA 1L3VA 2WOMA 1ROFA 1TZ0A 4LIWA 1I5OB 5F9NA 4TU7A 3TUJC 3A3OB 4GMKA 3UCGA 5CD4A 2BJ7A 4CI0B 1EQ0A 2WBRA 3OJSA 5LMNF 3R2DJ 3T1HF 1G2EA 3CJKA 2HHHJ 3FMWA 4ECUA 1D9FA 2ZBRA 3KUGA 4USKA 1X4BA 2WAQD 2AEJA 5A2QU 2GVDA 1MNEA 3HFKA 2KXNB 4NLUA 1AFJA 4JV2A 1URRA 2J76E 4USTA 5E7OB 4IDKA 3CJ4A 2W7PA 3UD3P 3ENAA 3S01A 4QBUA 3DDKA 3GCXP 2FD2A 3HHLA 4KR0B 1NJIT 2NR0A 1VHFA 2WW8A 1UFLA 1QE1B 2D9PA 2G0JA 2DYAA 1ELOA 4ZIWA 2WK4A 2XSJA 2PFFB 2UXBJ 2D1CA 1IKVB 4LBPA 6FDRA 4YY3J 5GAEI 2HRTA 2ROGA 1OS5A 3FRYA 4OIXA 5CXTA 3UO0A 1SJ1A 4FYYB 1HHSA 4L74A 2FDNA 2VA3A 2DISA 4H4KC 2OEMA 2IYGA 4QR2A 3KHLA 1NZAA 3MURP 3M6VA 1Y5LB 4DWIA 1F2HA 4O3NA 3CCJS 3ELHA 1HYSA 3MM8B 2KG0A 3EPGA 2AP6A 1M1GA 4AFFA 4I2QB 1KFDA 1H0HB 2F4FA 1OY8A 3DDIA 3ENQA 1VC5A 1NK0A 4DS5A 1E6VB 1RWKB 3W9JA 3K17A 2NXNA 1PAUB 4XO0A 2SXLA 5DS7A 1R0AB 3TUIC 2FJEB 3T1HJ 1ZTTA 3IG1A 4U8VA 4X4PA 1XMQJ 1U4BA 5KFOA 1X9SA 1RAEB 2FVCA 4J9NA 4LRBA 4KKOA 3MWBA 4DV1F 4H4MA 4USJC 3HKZD 3R5CA 4NLVA 3GYXB 1HLWA 1IN0A 3QQCD 5IT4A 3OJUA 4IG0A 4KGVB 2VKZG 4DSJA 3JYTB 2FJDB 2D74B 5JVHQ 2JL9A 4OZ2A 2ALYB 4KH0B 3AAWB 3CEDA 2AZ3A 4OI0A 5B0CA 4M5KA 4MJKA 3PY8A 4UY8T 1KHVA 2OPQA 1WC4A 4C11B 1MN9A 2HS0A 3HXMA 2HIYA 1JXLA 3A8KA 4LJMA 5ETOA 4ZITA 1S6QA 3QIPA 3GJTB 4D3GA 4DI6A 2IYIA 2W2PP 5ETVA 4DL0C 4PKDB 4CLSA 3DC2A 2E5IA 2PD1A 2QMUB 3R97A 4OHXA 3D3BJ 3VGSA 3NBPA 2GMJA 1YJNS 1TKTA 3IN5A 2XSFA 4KPCA 3V6KA 1H72C 5GAHU 1EKSA 1VBYA 1UVLA 2ZNYA 4NI2A 1QAYA 1IR2A 2KHDA 3DOMA 3FZ2A 1GK8A 5B0EA 3M2VA 3BS9A 4JBCA 4ZLPA 3IA0A 2HRYA 4RBUA 3OBIA 1QVGR 3BDPA 3PO5A 1S9EA 3K5NA 5B09A 1HBNB 3CCVS 1JLQB 2DKOB 4N8NA 2M8DB 2I9SA 1P27B 3FEZA 2DNQA 1F5CA 2RQMA 1S9GA 3B6BA 3N5BA 1N6QB 4YHHJ 1JKHB 1I3OB 1TUWA 4RW8A 1GXLA 1F5AA 1CQNA 1S9EB 1R27B 2CPZA 2EVZA 2VG6B 3I96A 1FJGJ 5E3AA 1HNIB 2ZJPQ 4PQAA 4TYAA 4V19J 3TP2A 3JXOA 1N33J 2MSSA 3P3DA 1YGYA 2HGNA 1V9OA 4UOGA 2KXFA 4YB1P 3PXGa 3P5BP 2VU5A 4CM2A 3KLGA 4RW9B 1JJHA 2E1MC 1QAIA 2VG6A 5JMNA 4JI5F 4I6YA 2KM8C 1H3DA 1LWFB 1GXTA 2EBGA 5E5NA 3T41A 1TL3A 1MWQA 4NLPA 3IBFB 3SQGB 3ZTSA 2EFOA 5A8RB 4KPYA 3SCLE 5C24A 1T05B 1FWKA 1WDDA 4B9NA 1S1XA 4FXDA 2HGMA 3QT5A 5G4DA 1S1VB 4Q2LA 4JI4J 3NP5A 4CM0A 2RF2A 4XPEA 1XR6A 2ZWPA 4YS2A 2XLKA 1FK9B 2GX8A 2AJQA 1IR1A 2B4UA 2B6AB 2MZRA 3M8PB 1LNQA 2W2NP 3M2RA 3R3TA 4KHMA 5ITHA 2GO8A 4ECXA 2FC8A 4M5NA 5KT6A 2VJUA 4CTAA 1BMQB 5C24B 1DAXA 1RWUA 1GNKA 1SH3A 3BPSP 1H38A 2P9CA 1AW0A 3J7Z5 4IYQA 1XMBA 2H1YA 3CIZA 2UXBF 1CLFA 4DV2J 2CQCA 4ZCKA 5KFPA 2X1AA 4KGXB 5D15A 1C0UA 2JDJA 4P2FA 1RT1B 3PNIA 3IMQJ 4TKTA 4DHVA 1NJYA 4M5JA 4YUDA 3I6PA 5F8HA 2QO3A 3F41A 1OYEA 3DLKA 2B7BB 2GVZA 3K0JA 3N9UC 3PTWA 3LP0B 4PPDA 1VISA 1RAJA 1OPZA 4NLOA 4MT1A 5F0UA 5GAGI 1U6BA 4IG3A 3M8ZA 3PW5A 2IM1A 1JLCA 5GMKa 4CO0A 2FGOA 2RB7A 1FWPA 3ZZ0A 1RBLA 2QMWA 3MOZA 3HHLC 4A8MP 2DIUA 3D6FB 3PR4A 4QU6A 1KEKA 4I4BA 2OIHA 1P8GA 1GMWA 3M8SA 4N76A 3TZWA 2LU2A 1NXIA 5IXUA 4LF7F 1HWLA 1Q8BA 1SQGA 3G2XA 5DLFA 4IRDA 4X4SA 1TVRB 2XG8A 4RW7B 2CNNB 4JI1J 2BOAA 1X4EA 2CPJA 1S99A 2F8HA 4ZVQB 5DDQC 1RHQB 3V6HA 1NB7A 4ELUA 3TJAA 4C3MA 3JSYA 3W9IA 4DR5J 3MMAA 2B4OA 4FKYA 5A8WB 3MI7X 3K59A 2R3VA 1AA1B 2L9NA 4N56A 3GG0A 4AYBD 1S1TB 4YY3F 2G4BA 5HP1A 3OL6A 2IRUA 2OMOA 2Y0BB 4J9RA 2UUBF 5IWAF 4HDGA 2PIIA 3CWJA 1DRZA 3SSQA 1DLOB 3GONA 7AT1B 3LALA 5ETMA 3TUZC 1NHKL 3RR7A 5HBMB 2WRMA 2DXEA 1JQGA 2G0CA 1F9FA 2HHWA 2HNYA 3W62A 3ENWA 5KG4A 4LRFA 1S6PB 7FDRA 2CZVC 2OUGA 1NJXA 3OV7A 1SQEA 3RRGA 3W65A 4C8MA 2HMIA 5CQGA 1LWXA 3OFGA 1JJCB 3CD5A 3UQSA 2C22A 2QL9B 2FZGB 4QYRA 1UWAA 5B0GA 3G96A 4O3OA 4RU2A 2XM3A 3MTJA 2HPUA 1HPZA 5KG7A 4LUBA 1E6YB 1QUVA 2GO9A 3QBCA 2LU1A 1VBXA 2X7IA 2U2FA 4C97A 4WXWA 2KN4A 5KFHA 3J81Y 3KFWX 1XMOF 3KDOA 3R5BA 1H74A 2HWIA 2CJ9A 1NAQA 2QLXA 3CJ0A 3EXYA 2NSCA 1F3FA 4M5DA 2VBZA 4TQRA 1TL1A 2B4PA 3G8SA 3DOKB 2IDLA 4O3QA 1DTQA 1YLXA 4PABA 5LSRA 3O6QA 3DRRB 2R8GA 3GQCA 5J1EA 1VI7A 1S1UA 1FXRA 4IQXA 1WC0A 2OPSB 3AHPA 3JQKA 2OKQA 2RDDA 4FNHA 3CJKB 2J0SD 1SQFA 2UU9J 5J2PA 2C2EA 1OQ3A 4ZVGA 1Q16B 1RE1B 3BF4A 3DXSX 3POTA 4DUYF 1U26A 2VPYB 4Q7AA 4EI2A 2RU9A 2R8KA 5EWEA 1FTCA 1U6FA 2MSTA 4IDKB 4PG8A 1U47A 4B9SA 3MOJB 1IWAA 3M8WA 1UZHA 4I64A 1SKUB 5KFWA 5KFQA 1R31A 1Q7YT 2FLLA 1IWGA 3BYRA 4X84A 3TA0A 2NREA 2R7VA 1IQZA 1FD2A 1PJ6A 2P9EA 8ATCB 2DVIA 3C3LA 3KTQA 3POTB 5HJYA 2B4VA 2WVCA 1CJTA 4NRUA 3NY0A 4DDFA 4OYAA 4F2SA 2I6WA 2FVRA 2O66A 1RBAA 1SH2A 2W9CA 3DLJA 3C66A 3NBPB 3N0VA 2YX1A 3DMJB 4CO4A 1DZ5A 4DL7A 1VJQA 3PKMA 4P9SA 4YHHF 2JEJA 5JJBA 1HR0F 2FY1A 3TEHB 2FZCB 1FA0A 1LXJA 1TKZA 5IQQA 1QAXA 4A4JA 1I94F 3LGHA 3P6YC 4PCQA 5BXIA 3KK1B 3RBZA 3V81B 2HQFA 2UP1A 3NNHA 2CQ3A 4U9RA 2R8HA 3GJRB 3QJPA 3FZBA 1FKOA 3DRSA 3W2WA 5J2MB 1IVZA 4RWXA 2J6SA 4F25A 1CJKA 1F0XA 2ASJA 4IRKA 4FXVA 1FJCA 1T9VA 5H9FJ 1NU4A 4EK2A 1DQAA 3D1OA 3DYAA 4ZP8A 3KK3B 4F3OA 4G1IA 3T5KA 2YKPA 2GIQA 2FLNA 3CDUA 2QFIA 3BBFA 4OX6A 1JWWA 3QIDA 3PIPQ 3BGLA 3N5FA 4HH0A 4AL6A 4ED7A 3EM1A 1TK5A 3DLGB 2AHOB 4JB8B 1YBUA 4EU0A 3LAMA 3HDSA 3V5RA 2JRSA 5U47A 3BBCA 3HVTB 3IAM9 3KJQB 2KO1A 2IVFB 5LT5A 5KFBA 3G9CA 3L4BC 3ZZYA 3SYZA 3KLEA 3M30B 1RT4A 4X62F 2C2KB 1X5TA 3QZ7A 1SKRA 5DG8A 3DLHA 3DLLQ 4PUOB 1HW8A 4C3KA 3QO9A 4CP5A 2NYIA 1APSA 2F4VJ 1HMVB 3MPUB 4IQMA 1UA0A 3KK2B 1WOOA 4QQBA 2OAUA 3EUNA 2EK6A 2DHSA 2ATCB 2CQ4A 1GT8A 2XYHB 3UCUP 2R2RA 3NWRA 3QWPA 4ZP6A 3C6TA 3DM2A 3D3CJ 4R5PB 1HBOA 5C2GA 3MF5A 3CNQP 3LWLA 1S6QB 3QIPB 3VR1A 2CWXA 2HFNA 3DXBA 4WBFA 4CT8A 4JOUA 3M8RA 3VAKA 1SJRA 3OW2R 4YR0A 2NUHA 3IS9A 2J9DE 2V8VA 5L46A 4Q0BA 1QY7A 2UUAJ 4X4UA 3IWXA 2JVRA 3PZPA 3ICLA 1TMMA 1RT6A 1PBAA 2XMWA 3G82A 3K5MA 4R0JA 2ZH4A 5C25A 4CLTA 4KO0B 5EWFA 3T3FA 1D0EA 3IRWP 3HJVA 3IO1A 2VC0A 1HWKA 3CJQA 1VHIA 4J5OA 4NA1A 3DLEB 2RHQB 3RUBL 4CLLA 4ZCMA 4QWEA 2IFXA 3C15A 2ZD1B 2E5GA 2Y8YA 3QRRA 3A8EA 3CPWR 2VH7A 3CJRA 4KFBB 1LK7A 4CRJA 4ZJQA 2C2OB 4ED8A 2FZKB 1B0VA 3MD1A 3GJSB 4KO0A 1JNRB 4DEZA 2J6UA 3JAMY 4EO6A 1S5ZA 2LYVA 5KT5A 3VAHA 2HZCA 2OP5A 2XI3A 1LWFA 2GHPA 2ZOMA 1XNRF 2ZM6F 5I4MA 2WHOA 4F3MA 1NLKL 1T3OA 4KB7A 2VODA 2IM2A 2MJUA 4RBVA 4JI2F 2AJ1A 2NSBA 4KYZA 3RYLA 6AT1B 1LFWA 4AE5A 4L73A 3CDAA 4WK1A 1JX4A 4X4QA 4IUFA 2NQPA 2MZSA 2I8EA 1VYAA 4ZPDA 3PFEA 4QWCA 3LPYA 3Q8SB 2FHJA 2V9WA 4NLGA 1YJVA 4HR2A 2HVDA 3BM7A 4NRTA 4OJHA 2W4CA 5IM0B 2DR9A 3K89A 4DCOB 1N33F 1FF2A 3D2WA 2QN6B 2QA2A 4R8UA 2YKAA 3BKUA 4DUTA 2R9LA 4IOAQ 2XQCA 1NEEA 2HQ3A 3QT6A 3BPDA 1B70B 2HK2A 4RU9A 2BKPA 2K7KA 4DR1J 4ED6A 1N5SA 4DSLA 3T6JA 2NPIA 4J9OA 2APOA 2P9GA 1XBWA 1R8BA 4EGLA 3OTEA 3HD2A 5A8RA 3PV8A 2DJWA 3L7UA 3MPDA 3EJMA 5T7LB 1TU0B 5K8PA 1BQMA 4DV3J 1S12A 3GG1A 5K8OA 5CABA 1FERA 1X4DA 3GWCA 3JSRA 1PGZA 1U6ZA 3ZNJ1 1FDBA 5KFGA 3KMSA 2LXIA 4DCJB 1F3VA 1N56A 4HVZA 4TQSA 3FCVA 4QIGA 2O3DA 1LW0A 1Z1ZA 2YBVA 2VKRA 2AIRB 5K14B 4TY8B 3PX6A 1T03B 4ZS6A 5IZHA 3WHIA 5KFVA 2HG4A 3SSSA 3QJLA 3IP0A 2BQUA 3PW0A 2YKNA 1VQ7S 4FF1A 2WONB 1RLCL 4L3NA 2ZH2A 4NLTA 4DV2F 2HVHA 3T5HA 4P71A 3MCSA 2HMIB 2RQ4A 5D78A 3ZZTA 1U1QA 1X0PA 4AQYJ 3F56A 4NXMJ 3KDNA 3T1AA 3PKYA 1GX6A 1SIZA 4ILMA 4DG1B 2Z8QA 3O5TB 4OX8A 2Q79A 3SMZA 2OTLS 5DQHA 2VBYA 3CCTA 4EUVA 1U24A 2LLZA 2DHHA 5GMEA 2QV6A 3WBZA 3O2IA 4DV3F 4BDPA 2ZFHA 4E2FB 2CQPA 3ILIA 1URNA 2B5JA 2AGQA 2CPIA 1ZS6A 3CMES 1Q82T 4WWSA 2YPYA 5ETPA 5CZXA 3RW7A 4DLGA 4JI6F 4I67A 4LF7J 4OYWA 4EYHB 1VJWA 4G6VB 2J0XA 1I1GA 5C5JA 1JLFB 2KT3A 2I1RA 3ET6B 3V4MA 1C0TB 2W2QP 4BLGA 2FUG9 5A76A 1QJHA 4H54A 2ZUAA 4YP3A 4W92B 4ECZA 4LQ3A 2F1FA 2AX0A 2OPPB 3AQOA 3TOQA 4CLYA 3Q8PB 4I2PA 3KG1A 2XLJA 1WI8A 4QU7A 2RQCA 3KHRA 3RB0A 1RISA 2VFRA 1RHKB 5KG1A 4DR7J 4K7QA 4B9TA 1DHMA 2X3GA 4USHA 5L9NA 1RT7A 3TAMA 2FJWA 2UUCJ 2GW8A 1WF0A 4JI2J 4KGMA 4FXWA 4ED2A 4N41A 4NXMF 2GCFA 1CJUB 1ZM2A 2XHCA 3VAGA 2OI2A 4DU7A 4QYZK 4ZN3A 5ETKA 1S7IA 2MZTA 3R7NB 1ZYQA 3VWSA 4JI0J 3BKTA 1EX8A 1Q78A 4Y28C 1X4HA 4FP9A 4I68A 4FS2A 2KRBA 4EMDA 2MJNA 3SFUA 4ECYA 2CUYA 4FF4A 4ED5A 4ANCA 2MTLA 2I2YA 4XIUA 2DIVA 3I4PA 5A6WA 1TAQA 2RMLA 2FHOB 4ZVHA 3JTOA 4CLKA 1PC4A 1RABB 2WVFA 3GZ7A 3PHTA 4JV5J 2IIHA 4C48A 5LXYA 2LQJA 3H59A 2NZCA 1F6TA 3MEDB 2BE7D 5HQLA 2HZVA 3TARA 5GMDA 2Y9HA 3AA8A 5HN0A 1NDLA 4DUZF 4FVMA 1XQIA 3PIOQ 1FNXH 4F50A 2W8KA 2BOPA 2YNIA 5DDRC 3EZ5A 2YXLA 3HULA 1H2VZ 4KT0C 1B0PA 1Z2ZA 5M2RA 5HJXA 4BBYA 1SKSA 1RA6A 2RHSB 1RTJB 1KBRA 3MCOA 1M5VC 4DR4F 4F26A 1BWEA 1N54B 3LGNA 1TL5A 1Y11A 2RRNA 3GPAA 2NXCA 4M5MA 4MKVA 3LGMA 5FD1A 1RB0A 4IFVB 3QZ8A 2UUWA 2W25A 1HMVA 2YNIB 5KFUA 4Y2KA 3NGRA 1NZ8A 2PDAA 3VQTA 3G6VA 1ZBTA 1FFWB 1QD1A 2ZE2A 1YBAA 4LFAJ 4CQ1A 1XN9A 2G2OA 4C4WA 1QVFR 4Y2AA 5A0YA 2CQGA 3J80U 5HVHA 1SB6A 2PEHA 2RU3A 4OV1A 1V5VA 4IG0B 1WKJA 2AWZA 2CJAA 1A0OB 3G6YA 3HCXA 2ATLA 1W25A 4RUCA 1LEOA 4ECRA 4DZ6A 2IM3A 2YWEA 1YRUA 1WORA 1FDAA 1RCOB 4DSKA 4OI4A 2G1HA 3DLGA 3CIMA 4CO2A 4LF9F 1QDUB 1K9MT 4RW9A 2EXUA 2LMIA 2DNYA 3EGVA 3HF5A 4USWA 4CT9A 5HANA 3G71S 4NCGB 3EX7B 4YEAA 2HHVA 4HEA9 2LP4A 1CBKA 1R8AA 5CD4H 3CCLS 1H73A 2DCUB 4PQUA 2OFHX 1S1XB 1S97A 3HT0A 1IKWB 4A8XA 2W9BA 1VGYA 4KV8B 4X66F 2JC1A 3TWZA 2CJBA 4UQTA 3GYGA 2EFNA 5KFNA 4ZVFA 1N32F 2CJXB 2WSFC 3UD5A 4GKKF 1VIXA 2DNGA 3QT8A 2OPQB 4LF1A 4CLFA 1UFWA 3I55S 2ZDPA 1R6YA 4HHHA 3TVKA 5FLXY 4PRFA 4K4VA 2A1BA 2L9WA 1RHMB 3F44A 2MHEA 1NHVA 2MB0B 2HNZA 1JXEA 4LFAF 2CQDA 2FTRA 3HZGA 2C2NA 2IPOB 3MEEA 1NJZA 1YJ7A 3B82A 1VQPS 1JLAA 3J7AN 2V2VA 1PIEA 2N3OA 1D9AA 4WCEQ 3JB9k 3NMAA 4J9QA 3TZYA 1FK9A 1LQ9A 2ADBA 5CZVA 4WKYA 2HQIA 3Q2TC 1Q95G 1UZDA 1KTVA 5DGBA 1DY3A 4ICLA 2BE2A 5C7PA 5LXRA 4ED1A 3EGZA 3R7SB 1X31C 2KH9A 4ANDA 1S59A 2R7QA 5AJ3J 4X64F 2HNDA 4DX7A 1JLCB 2LA4A 4DV7F 1CJVA 1WWHA 4DSIA 3OVBA 4FYDA 1E6VA 1PSDA 1PYSB 4F4WA 4JV5F 1KQGB 5AXNA 3QSYB 3GTYX 3RAMA 3BYPA 1WC6A 2DNOA 4ZIVA 3JTNA 4J9KA 3H4BA 2CRLA 4C8OA 5HVFA 3GCWP 3D0IE 4J9LA 3EXCX 4URGA 1R7IA 3P8BB 4QIFA 2PMZD 1R3NA 1TL7A 1UPMB 5THWA 3UR0A 2AMCB 4OYIA 5F8IA 2D3OR 2DPIA 5KFRA 3KLHA 4Y00A 2O1PA 4DOZA 2ALZA 4X4NA 3S1TA 3CD6S 2YKNB 4MIAA 1I6JA 4DX6A 4B9MA 1S77D 3WX4A 4RPFA 4B02A 4XAKA 4WP3A 3V2UC 4DLEA 2R7XA 4O4GB 1YRXA 3TEGA 5LL6d 3JQMA 2FHJD 2UZAA 1KLMA 3BGFA 3M1VA 3DOMB 1HNWF 5EDWA 5HMWA 2R2TA 2YX4A 1OO0B 2BABA 4OYZA 4WFYA 4E8UA 4WXOA 4RKUC 4ES2A 1SJ3P 1B0TA 4WZMA 1T05A 1M5SA 3D54A 4RUHA 5J1NA 1DLOA 3PJXA 4OZ0A 4OJGA 4W4MA 4BCAA 1NDPA 2DNZA 1REGX 4U7UK 4OI2A 3MM9B 3DGPA 2QT7A 3R5JB 5L1JA 2DR7A 1RT1A 2CQIA 3SQOP 3HI9A 2QL7B 5T14A 4C0HA 4JI6J 5BR8F 3DLKB 2EFPA 2WZ1A 5K14A 4MMOA 3MM5B 2F4VF 2NPFA 3RB6A 3J80Y 2CZ4A 4JI3J 4FYVB 2CPDA 3ZZUA 4CYUB 4Q8FA 3L09A 2HRUA 3E51A 3QATA 4DN0A 5ETTA 2AYMA 2YY3A 3FSXA 3JTPA 3M6XA 2ZVIA 3Q8VA 4ZK7M 1VS3A 1WSRA 2YKMB 2BYCA 2OPPA 1H2UX 1SC1B 4ZHRB 2Y1RI 4HLBA 5D0HA 3SIPB 1WI6A 4K4WA 3I56S 1U1LA 2MQ8A 4ZLNA 1VIOA 3NGKA 4PZVA 2HHPA 2LDIA 4PEOA 2C3PA 1R0BG 1KP6A 2K2PA 1RYRA 3EWGA 4O0IA 2GA7A 5F3TA 1VQSA 3FEYB 2VIHA 2VG7B 1FVSA 3QJJA 4P74A 1YJRA 3D67A 4B3OA 1N0VC 4JI0F 2VC1A 4QYZJ 4ZPVR 1C2PA 1YITS 1NHUA 2WONA 3IWNC 1DFDA 3HLUA 3OTDA 2R7UA 1K47A 3K5PA 4UOCA 1ZM9A 4FBUA 4PG7A 3G8TA 2HVEA 3QGIA 3A1YG 1M5OC 1ZAWA 3FK4A 2BM0A 5BYRA 3LQVA 3UE2A 2FVQA 2J7KA 2Z30B 4DV6F 3S8SA 2B7CB 4FF2A 2C42A 1WD6A 2KB2A 2WVEA 2ZC4A 4LRDA 5HROB 3MEDA 4WU2A 1UJ5A 3W5YA 2YVSA 1N36F 1NCLA 3WC2A 2AZ1A 4L75A 1U0SA 2HLUA 3OUYA 2M88A 3HZEA 3HO1A 1CC7A 3M8PA 2K06A 5KFMA 5D0EA 1RCXB 1YK9A 1YTYA 1MN7A 2RRAA 2IJFA 1XJWB 3FGVA 3BGUA 3D4JA 4X4OA 4DSFA 3QPIA 3C6UB 2DHAA 3M9OB 1C0TA 2QG9B 3BSOA 1U2RA 2ZKTA 4J9PA 4A8YA 1WHWA 1AUSL 2BEFA 2PGCA 3L7OA 3TYTA 5GADU 4AXIA 5LMUJ 2YKQA 1RT5B 2GS8A 4L76A 1NK5A 1HNWJ 1TL1B 2DGSA 1AB8A 3DGVA 3BR8A 3GE9A 8AT1B 4X65J 2XYGB 1RT7B 3TAMB 4ED0A 2XBPA 3MUTP 3NNCA 1KRPA 1BUXA 1SIWB 2UUTA 2JNJA 4RUAA 2HFUA 4MFBB 1X4CA 2VBXA 3A12A 4OI1A 3A8JA 2EEYA 3I0RB 3T19A 3PEHA 3EVMA 1K44A 2J9EA 3ISNC 1D3WA 4DQPA 1UVJA 3QGGA 2K3IA 1XNQJ 3R27A 1FESA 3ZTRA 2UV8A 3FMBA 3OTBA 4ZVUB 5BJRA 3MR2A 1TR0A 1WTFA 1WEYA 1TKTB 1N36J 1EETB 1RQ0A 3HX9A 2MQMA 1RWPB 2NXUA 3SDEA 1T3NA 1S1UB 4K5RA 3VV2B 4R0EA 2BR0A 1VQLS 2J7WA 5HO4A 2PE8A 1JNZB 2XS7A 4AUKA 1BLUA 2AV5A 1KDNA 1SL2A 1HR0J 1WNEA 4DPYA 3W9HA 4EBCA 2JJ4D 1KSPA 1PAEX 1B4SA 1KS2A 3TX0A 4ED4A 5DM6Q 1KTQA 1L3SA 2CPEA 2ZE2B 5GAEU 3R6LB 2QL5B 1NM2A 2QLBB 3NGSA 2GNKA 4IOBA 3HP6A 3OR1A 2KFZA 1WC3A 4OJ1A 1RHJB 2MKSA 3OLAA 2GJFA 3KHGA 2J5AA 3THPA 5L1IA 1RSCA 2W4PA 4B3MJ 2HBYB 3SXLA 4C0OC 3RB3A 2O67A 2FJVA 1C1BB 3MEEB 2H4WB 2D3UA 2K8GA 3NRBA 4OZLA 3BN4A 5E3CA 4A47A 4QOTA 3UW1A 4Q0BB 3NAIA 1HQUB 2DRAA 1DJ0A 1S6UA 4F0MA 2VFSA 3RBEA 3IG1B 1D8ZA 3C16B 4I0WA 2CDQA 2IVYA 5CHCB 2Q3PA 1YJTA 2CQBA 1X5PA 2DEJA 2OD4A 1GXUA 3HVAA 5E0OA 3RBXA 3NG8A 4DJBA 3A13A 4RO0A 3PRDA 4YB5A 4ZMMA 1IUJA 2WTFA 3M9NB 1FJEB 4HHUA 4ELVA 4NYZA 3MAQA 4PG5A 5EX3A 2IAJB 2IRYA 1SXLA 3HFZB 4H4OB 1ZAVA 4YR3A 5JVGQ 1T95A 1G3OA 3BEGB 1AZSA 3B4MA 1N8RT 3W5ZA 4B3RF 4NA3A 1N5QA 4P10A 5LJ3Y 2Q6CA 1NMEB 4NYPA 4B3TJ 1HARA 4WTOB 2AQ4A 1B64A 1IR0A 1ZZFA 2Q1LA 3HVWA 4JP8A 3PRVA 3DMJA 2O01C 3M30A 4CLZA 2D3O1 3SCKE 4NZ6A 2MGZA 1AZSB 1REVB 5KFAA 3BH7B 4ANEA 4LREA 1NKBA 3KOAA 4CWBA 3BR9A 4X66J 1HHTP 1UPPA 3PDNA 4AL5A 1K73T 2AGPA 3C6TB 4LT6A 1FKOB 3DRSB 2AYEA 1L3TA 1RAGB 3P45B 3MM6A 2MKIA 1R8PA 1SPBP 1U1OA 1T94A 2QA1A 4WYLA 5KOXA 2J9DA 5F41A 3EZOA 4OYXA 3B54A 2QZ8A 3UI3A 1YBTA 3JYTA 2DO0A 2F3JA 3HVRA 4DFMA 3CVKA 3PYFA 5KFIA 4RL1A 5A6PA 4YDDB 4W90B 3OHAA 3EGNA 4QPTA 1WC5A 1S0OA 2XMUA 3NS6A 4LF6J 3LP2A 2AJ2A 4OYBA 2E5HA 2C1EB 3MM6B 5M2UA 4J9VA 3NCQA 2MLZA 1S9GB 1S72S 4YN3B 4DL6A 3NOGA 1I94J 2KXHA 2HNDB 3NGTA 1JJ2R 1KLNA 5E33A 4DV1J 1J27A 3CE8A 5AJ3F 1WKLA 1HNIA 1Q79A 1Y3KA 1WC1A 3Q89A 4LIRA 1T9YA 3HHKA 3DRPA 4OFZA 1GMWD 4TNOA 3OL8A 2RF2B 1N52B 5L39A 3EYZA 1GQEA 2VPXB 3OLBA 3A4TA 2XTJP 1EB0A 4ZCLA 3D6MB 5JXSA 4GRSA 2F40A 3MXHP 1EQMA 3PJ9A 5KT2A 2RIJA 2FHMA 1VMBA 1RTHA 2MLYA 5KFSA 4Q43A 3D0HE 3JSMA 1KR4A 1N4LA 4QJVA 3MFIA 2DNRA 3CJ2A 2F63A 3HSDA 3HHLD 1ZOTA 2N7YA 1F60B 1TTHB 3CCQS 3RAXA 1RT4B 1H98A 1FFGB 2Z2ZA 4HL9A 3LOUA 4E0DA 3BO3A 2D7SA 2QSFA 2YWGA 4PR6A 1SL1A 1UWBB 2V94A 2Z2YB 5MLCV 1RUSA 3CJ5A 4RBTA 3QRPA 3E01A 2HIQA 4UUXA 3P5TL 1J5EF 1A9NB 1WOSA 2NUUG 4YR2A 3OQ2A 1FEEA 1T0TV 3QLHA 1MWYA 4Y2IA 2VICA 4ZPBA 1W7WA 4G3IA 1RDRA 4NA2A 3M6UA 4ZP7A 2YWHA 5D4OA 1OY6A 2I5JA 2W9AA 4GC7A 3AQPA 3PJWA 2X1FA 1VFJA 1IBKJ 2HHQA 2ZJQQ 1RI7A 1FRHA 2HQGA 2KVQE 1RTDB 2WBMA 2ZZMA 4GKJJ 2DNLA 3OUYB 3FCWA 4EWTA 3AOBA 4L6V3 2HWTA 3UVJA 3VVTA 1Y5IB 3KUHA 3HMJG 3NKYA 2ZH5A 1RA7A 2C3MA 5AE3A 3SZ2A 3MM5A 2CNLB 1LWEA 3SBMA 5EHHA 2Y1LB 1RACB 2GVZB 2KL8A 2MDAA 1UCNA 2L9DA 2XZWA 3I82A 3UN3A 4QWDA 4DR2J 1OIAA 4GVBB 3BQ2A 5CAAA 4MKYA 1DTTB 2BE9B 1DARA 2BJDA 1FKPB 3QGPA 2QIFA 3MFHA 2V0NA 3MR7A 2LXFA 2MZJA 4D3HA 2YPZA 4K2JA 5LOQA 2EFGA 1Y5NB 4DFJA 3KNAA 2GAHC 5KT4A 1KKHA 2A3JA 4RNHA 2R4FA 3TAQA 1N48A 4B3SF 4QR0A 4OYPA 2ROEA 1K1QA 2OFGX 4Y3CA 2KT2A 3RJMB 2RQKA 3VHQA 1UFKA 5B7WA 5IWAJ 2CAJA 1QM9A 5KFLA 1CC8A 2QJ3A 4CO1A 1OSDA 1Z4UA 3Q86A 1XK8A 2EKYA 1TVRA 1C4AA 1M5HA 1O51A 2KT5A 3MM7A 5IOLA 5HROA 2HVIA 4LFBJ 2YNFA 1J5OB 4Y0FA 4DS4A 3HPOA 1UL3A 3VZIA 2NCKL 3OL7A 4EBEA 3RRKA 2DGQA 2GGPB 4FZVA 2VFUA 1YZ6A 1IBKF 4GO7X 2UVRA 4TU9A 1NBEB 5LSOA 2V5HG 3HD1A 1KC8T 1LW2A 5J2NA 3CDWA 3GYNA 2L3MA 4NEZA 3HHEA 4NZ7A 4R25A 1G1XA 4K0KF 4QPXA 2YNFB 1J5OA 4HKQA 1U0HB 2H9ZA 3FJ2A 1V5IB 4ZVTB 5HATA 3PW4A 5AXMA 4IO9Q 1R8HA 4P75A 2BMBA 1TKXA 5DDPC 3CT9A 3QWUA 1LWCA 2COLA 1CJUA 4CIOA 1NK8A 3MMCB 2OELA 3QRQA 2XS5A 2AYBA 5C42B 1OY9A 2BKNA 2CQ1A 1BWVA 2RRBA 1J2VA 1MLAA 2W2OP 5A8KB 3OR2A 4J9UE 2LQ9A 3GR1A 2OJ3A 4LSZB 1YVFA 3U7JA 5RUBA 1KN6A 1B7YB 2M52A 2VG5A 1TQLA 4B3SJ 1RAHB 4QIVA 3H0PA 2VOOA 4ZOSA 3H20A 4DUYJ 2DY9A 3C6UA 1VK3A 1NSPA 2U1AA 4WU3A 1HQEB 1X4FA 3IWLA 1U2CA 1HWJA 3JSBA 5KFFA 1SJQA 1UVNA 4DPOA 3FC9A 3ZTQA 1HNVB 2M9KA 2VB6A 1JLBB 2DTJA 3ETOA 4OI3A 2N7CA 3M8YA 5KFZA 3R5DA 1Y7PA 1PJ5A 2YWWA 2AJ4A 2E9RX 4DZDA 4PG6A 3I0SB 1FO1A 2LQ5A 1VC6A 3N6NA 5K8MA 1S1TA 3H5YA 5HP1B 2V4QA 2VJVA 3QAEA 4N47A 1IBLF 3X1LB 2JWNA 3KXDA 3CCES 2PSZA 4JV1A 3LO3A 4DG1A 4FF3A 2KVIA 1YG0A 4HH1A 3FFIA 4I2QA 1K1SA 1KWMA 1VRQC 2ZOGA 2R7OA 1KQKA 1M5PC 3MEGA 4G1QB 1EKRA 3F0NA 3NMRA 2GAGC 2H51B 4KH1B 1BE4A 2A2DA 3MUVP 3NCPA 2DITA 1FRKA 1P9YA 1TKZB 1DBDA 2GJIA 1BXNA 2DR6A 4NLYA 4XK8C 5CH7B 4CLPA 1G4CA 5EX0A 1MU2A 1WHVA 4LF6F 4LSLA 1EAYC 3C8YA 3IM9A 1ZA1B 2AT1B 2PFDA 1UKUA 2CIMA 2P6SA 3PYDA 5CCLA 1ZA2B 4N77A 2J8AA 2EFVA 1YI2S 4KSEB 5DQGA 1FRLA 4PXEA 3DU5A 2J7UA 3MR3A 2HAFA 2M7SA 4YQWA 3SV3A 1PBUA 5B0BA 3G6ES 4C8YA 5I3UB 3RB4A 2EG1A 2DBBA 2YNHB 4MKAA 4LBHA 4HT7A 4P2SA 3WQPA 1VR6A 2OSRA 4X4TA 1UVMA 3DOKA 4PWWA 3MR6A 3KLHB 5B08A 1HI8A 4GO5X 3TUPA 1EP4A 1HD0A 1Q4RA 1JLGA 2G13A 1R0AA 4O0NA 2QMXA 5KFCA 3V6JA 3EVWA 2D41A 5F9LA 3TZZA 1RT5A 3IGVA 2W9BB 3H90A 4O4GA 2MQPA 3CUNA 2C2ZB 2VUGA 1CG2A 4FNIA 3CULA 1FJGF 4MIWA 3PW7A 3A3NB 2H4YB 1XMOJ 4O44B 4MFBA 2X51A 1GX5A 1UETA 1B7FA 3AD7C 3LPEA 9RUBA 2DH8A 5D4NA 2XZDB 1Q5YA 3ONQA 1FEHA 3BSNA 1BY9A 3O44A 5D4LA 2P6TA 3NS7B 4DPXA 4U7CA 3CD0A 2MGZB 2YNGA 2HNZB 1QLNA 1N88A 2F8MA 1OSCA 2XO7A 5K20B 3TZXA 3GMGA 2CDRB 2HURA 4QIEA 3IBWA 5FLXU 4DX5A 5D3GB 5SUHA 4F7VA 2KTQA 1MROA 1JLEB 1KLMB 2JLFA 2MY8A 3ILJA 3NL0A 4MK8A 3Q0AA 1U1RA 5C25B 4RW6A 2PN6A 4KBIA 3AFGA 9ATCB 2MXYA 4HYKA 3KK2A 1TK0A 1V3ZA 3PYEA 4A48A 1T7PA 3OXFA 4E98A 1WELA 3D68A 4QWBA 2DD8S 2POKA 1C4CA 3K8VA 2DNPA 1AT1B 1HKAA 1O6XA 1U02A 3U27A 2H5EA 4B3TF 3ZTOA 1JLAB 1GMVA 2DGWA 4NLDA 3TANA 4N5SA 1SC3B 3AB4B 3PRBA 4RW6B 1OQ6A 1KONA 3DGPB 3CXCR 2DB1A 3HM9A 1N34J 2CZ9A 4DR2F 2Z4PA 3QSIA 5L9XA 3UDEA 4DBQA 4JI8J 1ZPVA 4NZ0A 4P6QA 4OQJA 4TLQA 2VG7A 2DNNA 3M4XA 1CJVB 3DLEA 4ECSA 3E8OA 2IMWP 2IVMA 1RTDA 1GH8A 3F73A 2XYPB 2ZHAA 3W8GA 3Q22A 3EICA 3C16A 2N4DA 1IM4A 2YKMA 2V9KA 1UA1A 2V8HA 3KLIB 2Z2MA 2KU7A 4LF9J 4LR8A 3DI6A 2YQ3A 2ZBCA 4ZN1A 5FDLA 3ZZRA 2KZZA 4Q8EA 5DZ6A 2OO4A 4NLQA 4MH8A 3TO8A 1Q5VA 2EK1A 4WZQA 2XHWA 1WKKA 2HVZA 3LP1A 5BYSA 2W8LA 4F8RA 1YWXA 3VZHA 4I7FB 3KMQA 4OHVA 4DR3F 1BC6A 2HZAA 3RRHA 2I38A 4KV8A 1UP1A 2VPWB 1TUGB 5DQIA 2BBEA 3K7RA 1LOUA 2ZHBA 4JYAJ 5H9EK 2BJ1A 4XDDA 2ZH3A 3VAJA 1UJ4A 3MGJA 1GAOA 2MZQA 1U1NA 2YWKA 4LFCF 1T9XA 3CB4A 3CTRA 1N0UA 1RTHB 3GJQB 3CJTA 4URSA 4B3RJ 2JC0A 3FKBA 2RKIB 2CJQA 2FPHX 2VD3A 3TAPA 3BQ0A 2V4JB 2UU9F 1ULRA 2ZBIA 4IFYA 3BN7A 3CDEA 3NWGA 4MAKA 3QAUA 4N8OA 5K8NA 2XNRA 4IG3B 2B43A 4OZ3A 2ZDOA 5G0RA 4GC6A 3MDFA 1TUVA 3KJFB 4OV6A 4C6AA 1X8DA 1S0NA 3L9ZA 4AQYF 2C3OA 3T1YJ 2BM1A 3H98A 4ZJOA 3T6BA 1N5YB 4NLSA 2DEIA 3FQLA 3ILOA 4ICLB 4NASA 4OZJA 3TRGA 4JI4F 3VVUA 2A0FB 1LV5A 2M4MA 3DHXA 1R89A 4F4KA 3CCZA 2VHGA 3J81j 2JEFA 4ID5A 2HFSA 4KHRA 1C1CA 5AXKA 1VQ9S 1T9WA 2QYGA 3KKFA 3TJ9A 3B8HA 2ZZNA 3BDEA 1FE0A 3MCNA 5KFDA 4KGZB 3H40A 4DPWA 2DT9A 2DR8A 2DR5A 5KFEA 1S6OA 1WOPA 4ES1A 2DHXA 1YJ9S 1R6VA 1PILA 1S76D 4ILRA 2WOMB 1EZZB 4XDCA 5AT1B 5GVQA 4ID5B 5I3QA 4NE9C 2J0QD 2NZ4A 3KLFA 3SCJE 1TAUA 2W7AA 3Q8UA 4MKBA 3IBCB 4AL7A 4FBTA 2ZH6A 2Y3YA 2DGUA 3HSGA 4DR4J 4ZVSB 3M8QA 2B51A 2DXFA 2F5GA 2RDIA 2LDYA 4IH6A 3SCIE 5F8LA 4WF9Q 2IM0A 2Y1IA 3R1HA 1DQ8A 3IAS9 3VAMA 4RNFA 3TQ1A 2M8HA 1KVIA 4W98A 4EFAC 2G2YA 2XMJA 3AH6A 4P2XA 5HBMA 4LBIA 4B17A 1PYOB 3VF0B 1F9EB 4KY3A 2PI5A 2WVBA 3WC0A 2YKOA 1RTIB 1IBLJ 2GV1A 3K2YA 5KG0A 1N34F 2AX1A 4CYUA 2HHXA 1KQFB 5CA5A 1IM6A 3NGUA 1NH8A 4HI2A 2C2DA 5LJ5Y 1RAOA 3EDRB 1LW0B 4P7TA 2B8PA 2BVZA 2C2MB 5DZ7A 3BGRA 4OJ3A 3H25A 3IXQA 2XMKA 3UFCX 2B0GA 5AE2A 2CNOB 3H5SA 4AXJA 4TU8A 2IMOA 4KJIA 4ZA1A 4NMXA 3KJVA 2FQQB 4URQU 1Y00A 3UCZP 3GIJA 1FRMA 3CW2C 1HYSB 2EPIA 3QFWA 2RT3A 4QZVB 4S0MA 4ZPTR 4DV5F 3ENVA 2VQEJ 2I5JB 2KYXA 4HACB 4B3OB 1RLDA 1HQ2A 1FVQA 3RAQA 3HHNB 1YQHA 5J1PA 4NPOA 3UNGC 5ADZA 4JI3F 1GMUA 2V68A 1F1BB 2EI5A 3HJFA 3QFHA 1XMQF 2K7JA 3DOLA 2DO4A 1XERA 1VQMS 1HFEL 1U09A 2MKHA 4NCBA 5I3UA 1X4AA 3CSKA 3LW5C 2V2KA 1U2FA 1LWEB 2MPUA 3J7YI 5E41A 5CYMB 4ILLA 1QE1A 3ADAC 2AF6A 2PC6A 2WW4A 2AYGA 1XEZA 3P4UB 4DR5F 3H5UA 1NK7A 4B9UA 2UXDF 2LKZA 2RVJA 1FKPA 2GJ2A 4LRAA 2UXCJ 2CVEA 4WFXA 3LUYA 3CD7A 1FT8A 3W66A 4H4KA 2ZHOA 1VCTA 4F36A 2IA6A 3KHHA 1FHTA 1NPRA 2LEPA 2MLXA 3I9ZA 3ILLA 4B9LA 4JUZA 1SH0A 1UEVA 2R7TA 2F65A 2W9CB 4PWDA 1H6KX 4H4OA 3Q2SC 2J9CA 2OPRB 2QLFB 1VBKA 3CMAS 4F02A 3IGNA 4LF8F 4LSLB 4LF4F 1U8WA 5D8HB 3U1LA 5A0YB 1RTZA 3KG0A 1X60A 4DR7F 1SC6A 3EPIA 4ER8A 1RHUB 4ENOA 2BUNA 2D3ZA 3CJ8A 4KE5A 1P1LA 1RWVB 4UOFA 2ZH9A 4IOCQ 1IXKA 1XWLA 1VRTA 2YNHA 3MEGB 4G1QA 1ZTWA 5J2NB 3H8YA 1OPIA 1T9TA 3BZQA 4QWAA 4ZJLA 3GFZA 4M8LA 4Q5VA 1F9HA 4IR1A 4M5IA 2CJYB 1LWCB 1WJ9A 5KG3A 2E9ZA 1NH7A 2MKKA 5LMNJ 3AJDA 4J90A 2RUSA 2V8PA 2IA0A 1N32J 1SUQA 2B9YA 3RGIA 4BWJA 1VQ5S 2NLWA 2IC3B 1IJFB 1T11A 3D7SB 1YJUA 5DO2A 3ETMA 2ASYA 2VFVA 3UR3C 5HVGA 5GADI 4DQQA 5KAKA 1TFYA 3MPYA 2KZMA 1MW7A 4GVLA 1JKHA 4NMLA 5MAOA 4BWMA 3BGOP 3C19A 4H4MB 1CSJA 1S7HA 2JH3A 4BC9A 3CCWA 5KFKA 2FLPA 1GTEA 3BSAA 2JLGA 5ETNA 3EZUA 4ZPWR 4X65F 2HFOA 2KJVA 2QLJB 1JLGB 4FYXB 3M05A 1XR7A 1Q1KA 2JHEA 2MZ1A 4XTTA 4V19X 1UAWA 1IKYA 3LA0A 3N6LA 3ITHB 1HBMB 4C8ZA 3DNCA 1MROB 1IKWA 1V3SA 1REVA 3H2UB 4OL8A 4PXCA 3OSPA 3MZIA 1HI0P 4JYAF 4N7TA 4KQZA 4KHPJ 3IS9B 4F67A 2VDIA 4LQ9A 4UTGA 2CQ2A 1F2GA 1HBUA 1QTMA 4FVCA 2PA8D 3TNVA 5B0DA 2KJWA 3ZZPA 2VOPA 1RBOB 1NDCA 3QGHA 4FDFA 1IKYB 1RXOB 2V69A 3G6XA 1VK8A 1HBNA 1UTAA 4OX9F 4RR5A 2XGPA 2E1RA 1VQOS 2DHGA 3NS5A 1N5VA 4Y65A 4DR1F 1W26A 3E3XA 1GFWB 1JB0C 4OHZA 4WFNQ 1HBUB 4KFBA 3MD3A 2R2SA 4UT4A 5E3RA 1D8YA 3UPFA 4WK3A 2YQ1A 2BW2A 1YZ7A 1CULB 2B56A 4CH7A 3KNGA 4NCGA 4F3QA 1VQYA 1K0TA 1FFSB 2E9TA 1WHYA 3R2CJ 5T41A 4ETXA 1KFSA 1T9UA 4P72A 5HMZA 2E5LJ 4O3RA 4GKJF 3QLHB 1BHNA 3W7BA 1TV6B 1Q0NA 3D6HB 4PQUB 4EYIB 1RT3B 1RU1A 5F8NA 3R9LA 3W1YC 3T1YF 2XB2D 4ES3A 1S57A 1U1KA 3OD2A 3M2UA 1CULA 3M1VB 4FKXA 1IBCB 2O5DA 3O3LA 3OPKA 4I69A 3U1NA 2FC9A 2A6MA 2XY5A 1VQ4S 4JI1F 4I1TA 3Q8YA 3CC4S 3RG6A 3TVYA 4U96A 1CQMA 1PKUA 1RT3A 1S48A 2IBOA 1JMTA 1H7XA 2ZEJA 4WIQA 4UQGA 5HLFB 5D0GA 4KHPF 4M1KA 5KTQA 5IS2A 3Q23A 1A6LA 1WHXA 1T02A 2FIUA 2AJ0A 4RW4B 2X1BA 3KJNB 3M2UB 5J2QA 1VDHA 3M32B 1SV5A 5CYQB 1V3RA 1WF2A 2GQQA 3MM9A 5D77A 3JAMU 4U67Q 4KC5A 2UVWA 1CEZA 5FJ4A 4WPAA 5AE1A 4K0KJ 5SZTA 2CPFA 2HEKA 2UUBJ 3E01B 1NPKA 3ZC4A 2JEGA 1OMSA 4YB7A 4C0BA 4FN5A 1FNMA 3LH2S 3SEOA 3UNYA 3JSMB 3ZTPA 5HK4A 2GIFA 3T9NA 1SV5B 3BREA 2IRXA 4ZLLA 1M1HA 2ZH7A 1RAIB 3Q8QB 2R7SA 3CJSA 3PEJA 3PM9A 3ZZZA 2H3EB 4MTPA 3LP2B 2VPZB 4OZ1A 3UDVA 4CH1A 4ECWA 4DUZJ 4RUBA 3W63A 3MR5A 1S1WB 3QYYA 5LM7E 5CYJA 2HW3A 3UVJB 5HL7Q 2JLEA 1CS4A 2HLTA 4O3PA 2FB0A 2HBRB 4MK9A 4U8YA 4DV0J 2E5JA 2NXJA 3GILA 1VLOA 2ZM6J 3UD4P 2HHHF 3FDSA 2VA2A 2W7OA 2M70A 4DU8A 1P9QC 3B4DA 4J37A 2PEBA 2H48B 4LR7A 2EFQA 2OEKA 8RUCA 4RWWA 4YB6A 4HTIA 3SV4A 4LF2A 1VQNS 4DV5J 4QR1A 2KRRA 4IH5A 4ZVPB 5A8KA 2W1BA 3K57A 2CJKA 3W2VB 3CC7S 1QSLA 4Y6IA 1NSQA 4C7QA 5HQMA 2V8DA 3TW0A 2QRRA 2HHSA 3GIKA 4JI8F 1NO8A 2B5JB 2WVDA 1ZM4A 3H2VE 1WG5A 2FLOA 3S7RA 4AT1B 3R6GB 3L3CA 2WB4A 2A18A 4OI6A 4A8QA 4ZVRB 4UF4A 2WB1D 1DQ9A 2VQFJ 3GR0A 2XCAA 2HHUA 2J8SA 2DGXA 4LRCA 3W2VA 2FJXA 5A8WA 4K4UA 1RWWB 1Y4ZB 1EARA 2ZOFA 3X3UA 3N01A 4LF4J 5KG6A 1S79A 2LQ8A 1UEUA 4DV4F 3VGTA 2G9OA 1RKJA 4LSNB 3DRRA 2PO4A 3AB2B 1PG5B 4DXLA 1RT2B 2IHR1 2C2RA 4CCHA 4U95A 3OVAA 3MM7B 3AJ2A 3AOCA 3MCMA 4KTQA 1FNOA 3B78A 5EUHA 3FBBA 2ILZA 3AT1B 3V4IA 3BQ1A 2P2CB 3AJ1A 2IJNA 3BKFA 1UMJA 1U8SA 3FFIB 2E29A 3MMAB 4PWDB 4ZPAA 4ZHRA 4YMEA 2ZBPA 1ZETA 3FVYA 3US5A 2DRBA 2BX6A 4GKKJ 2BJEA 2ASDA 2JOQA 4ATNA 3T5LA 1NKEA 3H5XA 4EZ6A 4DQSA 1QUPA 4A8OA 1U45A 1DTTA 1U25A 3GV5B 4NXNF 3J7A1 1RADB 1SBRA 2FY8A 2GFFA 5G0RB 4X4RA 1HNXF 3G86A 3DKDA 2DK2A 2CPYA 5FIIA 4K4XA 4I2PB 2JX2A 2X1GA 2MHNA 2XNQA 4O23A 2LEBA 2DPJA 2OHDA 1JLBA 2GIRA 1O8BA 1Q8KA 3GU0A 3WZ0A 1KQSR 2HS4A 2KFYA 1GEHA 3JQJA 3W5XA 2PI4A 3IR7B 2BJ9A 2EC0A 5J1EB 1O5JA 3MMBB 4PXDA 4PPZA 2R7RA 1PCAA 4USIA 3W2WB 3R8YA 2F9DA 5LSLA 4CLUA 2YH1A 3PYGA 2HWHA 1Y3JA 2CADA 2N4CA 2QC3A 3M7VA 4ERDA 4ZVOB 1AUDA 4UW2A 2FHKA 3GB0A 4ECQA 1QSSA 1FE4A 4FPRA 1FTRA 2R8IA 1KHWA 1V6HA 2Z57B 1RTJA 1RZMA 4M5DB 1VQ8S 4MIBA 3KLFB 1HIYA 3CCSS 4MYTA 3I0SA 4IKAA 1HNXJ 2XC9A 4RW7A 4UUWA 3R5AA 1Z2LA 1NRKA 5DJBA 1DTQB 2PT0A 2XMVA 3ULHA 2JVOA 3UN5A 3VAFA 3W3SA 2M5YA 4DF8A 3RTVA 2XY6A 2C28A 3MM8A 3IC1A 3OL9A 1KVJA 3RW6A 3HFVA 4ID8A 4RJVA 2UUAF 1WG4A 2BZ2A 3BB5A 4NXNJ 4RNMA 1ZH5A 3I9V9 3PVXA 2NYHA 3BBBA 5E3PA 5C2CA 3NOCA 1SKWA 2GGPA 4LF5F 5EN1A 4OLOA 2HBQB 2W4DA 2VDHA 1NK6A 2CFXA 5HAOA 2VG5B 2RS8A 1HQUA 2V63A 2OPRA 3CO9A 2RDJA 3VALA 3G87A 2DRDA 4F0HA 4WE1A 1RWNB 4ZLJA 2E5LF 5L1LA 4ITSA 2JZ5A 5F8JA 4R5PA 4KKOB 1HBOB 3TI0A 4NL5A 4TYBA 1XC9A 1M0SA 1HQEA 4DFPA 4OMFG 4EBDA 3TA2A 1MMDA 4LF8J 2DGVA 3VTIA 2ZNZA 3ZNUA 3W8PA 3J7YU 1VQKS 3PG9A 2IJRA 4TLRA 2BRKA 3DCAA 4K4ZA 2GQCA 4QCLA 1FDDA 2Y8WA 2XMMA 4ED3A 3SFGA 2V50A 4PG4A 1SCJB 2DNHA 3GP9A 4F04B 2YH0A 4DL2A 1LXNA 1S0MA 3EDQB 1X5OA 3MAAB 1R8CA 2ZC3A 2AEFA 1E6YA 2B9EA 2H54B 4C11A 4NWBA 5DLGA 2XO6A 2HGLA 1XNQF 4K4SA 4RW8B 1U1MA 3DOLB 1JK9B 1OJ4A 1WEXA 2E1AA 4P7VA 3NLCA 4I7FA 3PHEA 2M3DA 2MKJA 3KLVA 1HNVA 2Y0SD 5CYMA 3KK3A 3RR8A 5KFTA 1B99A 2HFVA 2YWFA 4DMZA 1K8AT 3W61A 1TP7A 2MY7A 4NLXA 3VGUA 1ZPWX 4DCPB 3J81U 4G65A 3M2RB 1FCAA 1D09B 2BACA 3C14A 4O44A 1JLEA 5ETQA 4EO8A 4NI2B 2OPSA 3KLIA 3FBCA 2IBKA 4LF5J 4K8RA 3D1HA 2BW7A 3MECA 2MEWA 2RNEA 3IM8A 2ROPA 3E2EA 2ZWOA 4TY9A 2UUCF 5I42A 5GAHI 1IKVA 2RKIA 2UXDJ 3Q8RB 3QT7A 4PYAA 2YNGB 2ILYA 2FVSA 1RU2A 1ACMB 3UWTA 4ELTA 4UY85 3KLEB 1FRIA 5HMXA 1JJ4A 2UXCF 2V6AA 3HSJA 3MEKA 3QO9B 1KD1T 2P5VA 6FD1A 1IKXB 4F4XA 3MECB 1O0PA 4QW9A 4KRWA 2VONA 1MSWD 2Z58B 5I42B 2ASLA 3OXGA 1Y9OA 2OLWA 2QA4S 2OMLA 4F4YA 3C15B 3T5JA 2L41A 2CQ0A 2GHVC 5I3PA 3UN2A 5IT0A 3U02A 1C1CB 2YX7A 4HI1A 1UEKA 1UW9A 3M6WA 4BHQA 1LFPA 3FNNA 1IKXA 4GVBA 3TVZA 3AXMA 2DH7A 3BJYA 1YIJS 3PO4A 3I4HX 2GMLA 3DRPB 1FXLA 1RJJA 3OFEA 3GV7B 1P6TA 4X4VA 3GFXA 5KOWA 4O4RA 5D6GA 4LVOP 4WP8A 5KG5A 1U1PA 4OHWA 4OX7A 5DG7A 3MPVA 4C8LA 4DFKA 1TL3B 4RLEA 5IV4A 4L3KA 1QSYA 1EP4B 1UJ6A 4X2BA 4QW8A 2PMWA 4USMA 3DU6A 2XEXA 3VAIA 1AXQA 3A3PB 4Z7CA 2RS2A 2A6OA 3GSDA 3FSIA 2QTWA 4ECVA 1TL7B 3V6DA 2ERRA 1SJ4P 1J5EJ 3T9ZA 2JFKA 4F2RA 3EVOA 2R8JA 2MQNA 1XR5A 1MMNA 2QLWA 1BQXA 2RE1A 4HHJA 4KGKA 2BDPA 3ISND 3SI8A 4OHYA 3FEXB 3UDCA 4LR9A 2BANA 3FBEA 4ZKAA 1NK4A 3LP1B 4Y2CA 2AJFE 3NCRA 3BGRB 3LWMA 4ECTA 1VQ6S 1U0HA 4CDIA 3V6DB 2V4JA 3EE3A 3M8QB 4Z2XA 1JLQA 5IC6B 1F5BA 1M5KC 2IY5B 3EGWB 2RH3A 4EZ9A 3L95X 2OSQA 1WACA 3KJVB 5D3GA 2H5IB 3I32A 4NX9A 1M90T 5DRKA 3MPWA 1NKCA 4P73A 4DV6J 4C9DA 5H9FK 4NLWA 2CG4A 4G1PA 4C2MA 2EG2A 2LA6A 3M2VB 4PXBA 3LP0A 1W2BR 3DRXA 2HHTA 4OYMA 4U7UD 4XPCA 1JLFA 4I6WA 3C2PA 5CCMA 4HDHA 5IT9Y 3V4IB 5IQ6A 3D0GE 4Q44A 3BO4A 3I5CA 3CC2S 3ZFVA 1SJFA 2RD5C 3K5LA 3KLGB 1GTHA 3J7ZT 1IBMJ 2VFTA 5L38A 4PYDA 2BXJA 1AROP 2C3YA 3DI6B 1L3KA 1N5YA 1LKZA 1X5SA 1S4EA 2GVDB 3N28A 3N6MA 2P8IA 5E2QA 4C8NA 3W64A 1N6QA 3OSNA 2DH9A 2ZD1A 1HA1A 1ITPA 1YHQS 2E66A 1TFWA 3KWMA 4TVAB 3DRYA 2L48A 3VCDA 5F8MA 3I87A 2VL1A 2GHWA 2ZH1A 2B8QA 2XZTB 4ZPCA 5A2QY 4TXSA 1Y10A 1MWZA 1HPZB 2UVUA 2Q6BA 4DSEA 4WTYA 3BO2A 4M94A 2GC8A 1R0CB 4JV0A 4F4ZA 1S10A 3CCUS 4YOEA 3K8WA 3MMJA 1BQNA 3M9MB 1UWBA 1HHQA 1LW2B 2H65B 3TX8A 5HLFA 1RTIA 3CO0P 5DETA 5HI7A 2MKCA 1Q7LB 2N3LA 3AODA 3QNWB 1NSAA 4DL5A 3R7BB 1L5UA 4RX6A 5BR8J 2D9OA 1MU2B 2BA9A 2G1DA 5K9FA 3AY0A 1KNZA 2JFDA 1FI4A 3PCOB 4FYWB 2OGUA 4NLRA 3HK2A 4F0KA 4DR3J 1NJWA 4F4AA 2VQFF 3CF5Q 2ABYA 2AKWB 2HFZA 2AEMA 2LQBA 2VBWA 3BV8A 3H42A 1UW4A 4M5LA 4P52A 3K58A 2QFJA 4J9MA 2EKNA 1RT2A 3AD8C 2WSCC 1BQMB 3THTA 5DDOC 2V34A 3BSCA 1XIQA 3P96A 4DV4J 3L7PA 3R1LA 4A8SA 2JEIA 1RWXB 1HWUA 2MMYA 3ET6A 3FBFA 1S0VA 4ZVEA 2EBEA 4O3SA 4A8WA 1TKXB 5ETLA 2RILA 1S1WA 2LVWA 2QX0A 4KAIA 1S6PA 4UZBA 2E1PA 3FQKA 1WTBA 1NK9A 3FUYA 3KYLA 2K1RB 4K5SA 3I0RA 4ZDNA 1PC5A 2QA4G 5HMYA 4DQRA 1A7GE 1SVDA 1RKIA 4HT5A 1HW9A 3D6TB 3OR2B 5IV3A 3LANA 2ACYA 4ALZA 3IR5B 4B3MF 2OTJS 1EJ7L 2DNMA 2V2ZA 2XSJB 1RGVA 2KG1A 2QGFB 4DV0F 1HI1A 4C3LA 2B9XA 5HSPA 1X9MA 2CPXA 3WX8A 2DY1A 1G7CB 4J9SA 4I56A 5L8RC 1IJEB 2XULA 3ISZA 5DM7Q 3MHYA 4QIWD 3OXLA 7FD1A 2MQLA 4ZP9A 4J7CA 5DG9A 3TR5A 3NXZA 1ICEB 4C98A 4YFUA 3CCMS 3MAAA 3NAHA 4WFAQ 2ACMA 2CWKA 3MMBA 3AOAA 3D9BA 2Q43A 3HHLB 2BKOA 1RP5A 5KFXA 3TJ8A 3ZO7A 4OX9J 2LXUA 1TELA 5D4PA 2A10A 3RBDA 2GQ2A 1Q8IA 1YKWA 4A46A 5ETRA 2MQQA 3MUMP 1TK8A 2BJ3A 3MMCA 4L72B 3PX4A 2V67A 4NOHA 3WIUA 4DL3A 1EETA 3SDEB 4IRCA 2QYCA 2W24A 2B3TB 3OTOJ 3PR5B 1KOHA 2XMAA 2FVPA 2LECA 4CZCA 1RHRB 3MAHA 1N5TA 2W01A 3W60A 4BC7A 4RNNA 4FS1A 1AFIA 2HYIB 3H4DA 5H9EJ 3C46A 2Y1JA 4DPUA 1PJ7A 1G6BA 1P1TA 1JIHA 4WIIA 5IM0A 2XY7A 1PO6A 2W2MP 1FKAF 3O1LA 3OTCA 3OR1B 1XNRJ 2VZ9A 5B0FA 1D9DA 4B08A 3FCHA 4PWUA 1Q81T 4CNYA 2CQHA 2ZH8A 2UVVA 1TMJA 1H7WA 2CG8A 3R5GA 1C1BA 2B9WA 4KIAA 4YDXA 5J2PB 2ZITA 5EGYA 1SL0A 2VQEF 1HNZF 4ZCIA 2V4RA 2V2QA 3HVTA 4JI7J 1NPPA 2F9JA 2PMHA 3H2LA 4ETZA 1DURA 1TV6A 2AU0A 1EHWA 2L08A 4M5HA 1YDLA 2M2BA 5JUMA 2KM8B 3GIMA 1QAJA 2DCLA 4AD6A 1T8EA 1JXVA 1KVKA 1WDTA 2X3DA 2KYZA 2YTCA 3GV8B 1S1VA 2OH2A 1FXDA 1IQTA 3Q24A 5IC4B
chains in the Genus database with same CATH topology
1YJWS 2N82B 4M95A 2OD6A 5H1SV 2ZKUA 3DM2B 3HHDA 2DNKA 4WKRA 3OTOF 2IAJA 1YRTA 5K5MA 4K2XA 3CJ3A 4Y2MA 3UDLA 1VRTB 3N79A 2KI2A 3OFHA 2MQOA 4A8KA 3G4SS 4PUOA 1FRJA 4EEYA 3WDOA 2E7WA 4DQIA 4RZRA 4IR9A 3PW2A 3N4WA 5F0WA 1C0UB 2MYFA 4CNZA 4RNOA 1WF1A 2LCWA 5J2MA 1TL4A 3D5MA 3DFEA 1CPZA 3LF0A 1CVJA 3IR6B 1FJ7A 3TA1A 5F3ZA 1NNDA 3VQSA 4OZ5A 4OZNA 3IFEA 4K4TA 1U7LA 1TKDA 2XWYA 2UV8G 5DGAA 5BYQA 4IH7A 5EWGA 2KDOA 5M2PA 2HAIA 2VASA 4WE1B 2CPHA 2JSXA 3I5AA 3NNAA 2BV3A 4Q2MA 4CO5A 5KT3A 1S9FA 1ZZNA 1BD6A 1FD8A 2NS1B 1VBZA 1WEZA 4U6PA 5KT7A 3SQGA 3OVSA 5GAGU 1RK8A 4Z37A 4DN9A 2GMHA 1SUQB 5F8GA 2I0XA 4RW4A 4Y34A 1M1KT 2IC3A 2J0WA 2XCPA 2ZUGA 4TN2A 5B0AA 3IRXB 1WG1A 4WFZA 3RZAA 4LMZA 3PX0A 4MYUA 1Q8LA 1X0FA 1MMLA 2FJAB 5KFJA 4CTAB 3O8WA 2VV5A 2FJBB 2WSEC 1ZM3A 5FDLB 3THVA 4NCAA 1FRXA 1U48A 3IRXA 2R2UA 2XWXA 3CDBA 4IFYB 5CYQA 2QEXS 1UVKA 3PACA 2Z2LA 3ITHA 1HBMA 2M0GB 3GIIA 3K5OA 2XS2A 4R8UB 4A8FA 3P49B 1BQNB 4DL4A 2AD9A 1X4GA 4WFBQ 3OFFA 4C8KA 1RYSA 2HS3A 2CKWA 4IO1A 3T5LA 2B6AA 2K3KA 5HQ8A 3SSRA 3OHBA 2E44A 3DDNA 4LFBF 3G8QA 4LSNA 2BANB 2RUGA 4TY8A 3GFHA 2ADCA 3LAKA 1T03A 4JI7F 4I6AA 5LMUF 2E7XA 4M63A 2BQ3A 1ZAXA 2F8EX 4OLPA 4LVNP 1RT6B 2BE2B 2PA3A 4Q45A 1D1UA 2XI2A 2XGQA 4WYWA 1HD1A 3S6EA 4WJBA 1Y0HA 2A2CA 1S4FA 1X7VA 4CO3A 3DLBA 2AW0A 2QSWA 1VC0A 2ZZNA 2BQRA 5J2QB 1YSJA 3M32A 2Z0GA 4DR6F 1VOMA 2ZVSA 1UVIA 1S49A 2DGTA 2K1RA 2KHCA 2F7VA 4K59A 2LEAA 1H2TZ 2RSQA 2XMTA 3HKWA 5AXLA 2XLIA 1IBMF 2AGOA 1W2IA 3CCRS 2J6TA 1VRUB 1LK5A 3MTKA 1SI9A 4DX8H 1HWIA 3U1MA 1U49A 2KFNA 3D28A 3FSYA 3PFOA 3QMQA 1KOOA 2DGOA 2QE5A 3FRZA 1K0VA 2FGCA 4IFVA 3HT3A 5KG2A 2R7WA 1Q53A 2EWHA 2E1CA 1VRUA 5C42A 2CYYA 3CGIA 3D1QA 3RU0A 3ZZOA 5L1KA 3DN9A 3I5BA 3KG4A 2KKHA 2BRLA 2EW9A 3GFYA 2RJZA 4NYOA 1XTZA 5T7LA 3KK1A 2V8GA 3V81A 1FDNA 5E3QA 1Q86T 2CVIA 1R43A 4K50A 4K4YA 4MK7A 1L3UA 1HL6A