2F9JA

3.0 angstrom resolution structure of a y22m mutant of the spliceosomal protein p14 bound to a region of sf3b155
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
RLPPEVNRILMIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a core spliceosomal protein interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA branch site protein p14
total genus 26
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f9jA01
2X1AA 4QQBA 3EX7B 3ZZYA 1WF0A 2KRRA 5CXTA 2CPJA 2FPHX 1WHXA 1YJ9S 1JMTA 1OIAA 2MZ1A 3NS5A 1VQOS 1ZZNA 2ERRA 1AUDA 1VQ9S 3Q2TC 1WI6A 2PEHA 2GO9A 1M5KC 1F9FA 5BJRA 5IFMA 1X4DA 4LJMA 2MQLA 1OWXA 2F9DA 4IO9Q 3MD1A 3G4SS 1VQ6S 2G1DA 2G0CA 2RRBA 3CMAS 2DGWA 1FXLA 2DO4A 1H6KX 3R1LA 1HD1A 1VQ5S 4CH0S 2GHPA 5LSOA 5DM7Q 3FEYB 1P27B 2M7SA 2MY7A 1YWXA 2DHGA 2MZQA 2PE8A 1X5TA 5IM0B 1VQLS 2FHOB 2CPZA 2VODA 3CC2S 1N88A 2M9KA 2CQDA 4BS2A 3I56S 1KQSR 2RS2A 2MKIA 1SXLA 2M8HA 2DO0A 1D9AA 4TU7A 1U1PA 3BEGB 1WI8A 4YOEA 4FXWA 1R8HA 4UQTA 2RS8A 3RW6A 1WHVA 4WFNQ 2ZJRQ 4RU2A 2YKAA 3CCVS 3CCSS 1U6FA 3P3DA 4TU8A 3CCES 2CQ1A 3G8TA 2QA4S 2KN4A 1FJEB 2AYGA 1WG5A 3BS9A 4WIIA 2BOPA 4EGLA 1SJQA 2N82B 1X4CA 5LJ5Y 3VAIA 2KG0A 2CQ3A 3CULA 2I2YA 4FXVA 3VAHA 2MHNA 3RW7A 1KOOA 2DIVA 3PIOQ 3CCJS 2MY8A 2ZJPQ 1R8PA 3HI9A 3ZZZA 5DM6Q 1K9MT 1PGZA 1UAWA 4WFBQ 3DLLQ 2CQCA 3CC7S 1X4EA 1Q7YT 2D9PA 1Q86T 4Y0FA 1S72S 2QEXS 3UCZP 2XNQA 5D77A 2MJUA 2XS5A 4YUDA 5GMKa 2RQ4A 1FHTA 1QVFR 5JVGQ 1NU4A 2DNGA 3NNAA 2CQ2A 1W2BR 1SJRA 3P6YC 2N3LA 1WEXA 1VQ8S 2DNNA 1QM9A 2L41A 2KM8B 2MZRA 2KHCA 3D2WA 1YITS 1M5PC 1X5SA 4QU6A 4C0OC 2CPYA 3S01A 2KT5A 3SDEA 2JRSA 2YH1A 1U1NA 2MZTA 3Q2SC 1JJHA 2LXUA 2X1GA 3OW2R 1U6BA 1U1OA 1NJIT 4TU9A 3S7RA 5LXYA 5DDRC 4M5DB 1WEZA 1VBYA 1X5PA 5LXRA 3PIPQ 2O3DA 4ZKAA 4CIOA 3NMRA 1H2TZ 2D3OR 2G4BA 4F02A 1S79A 1OO0B 2E44A 2DISA 3NS6A 2CQ0A 2LXIA 3EGZA 1H2VZ 3NNHA 3MXHP 5GAEU 3CC4S 2KYXA 2B0GA 2J8AA 4ERDA 2DNPA 2XSFA 3CCQS 2E5IA 2NZ4A 2MPUA 2M4MA 1X0FA 1H2UX 1A9NB 3EGNA 2MQNA 1X4HA 3CMES 2MSSA 1WELA 1B7FA 1VC6A 1JJ2R 3MDFA 4J5OA 1FJ7A 2DGVA 1K73T 2DITA 2ADCA 2DH8A 2DNQA 3BO2A 2E5JA 1UFWA 2RU3A 3MD3A 4PR6A 2AYEA 3CD6S 2F3JA 2DGOA 3S6EA 2MKSA 2KFYA 1U1RA 3P5TL 2U1AA 3V4MA 2K8GA 2J76E 2AYBA 2YTCA 1VBXA 1PO6A 2MQQA 2DNHA 1VQKS 1UW4A 1O0PA 2DNZA 2MXYA 3MUTP 1VQMS 2SXLA 2CQPA 3MUMP 2DGTA 1VC5A 2JVOA 4OZ0A 2L08A 3UD3P 2KXFA 3G96A 1WF2A 2E5GA 2KH9A 2AD9A 2D9OA 2M70A 1VQ7S 4U67Q 2E5HA 3JB9k 2MKHA 4W90B 4QPTA 1K8AT 2M8DB 3BO4A 2DK2A 2NLWA 3FEXB 3LPYA 5DDOC 2RNEA 2MB0B 1FT8A 2JWNA 3CCRS 2VOOA 3UCGA 3NNCA 3J7ZT 2EVZA 2DHSA 2CPXA 2DH9A 2F9JA 2MQMA 5LJ3Y 1YI2S 2MMYA 1DHMA 5HL7Q 2A3JA 1M90T 2KXHA 4A8XA 1WWHA 3US5A 2EK1A 2M2BA 4CH1A 1WG4A 2DIUA 2LA4A 2DNMA 1WHYA 2VONA 2I38A 1URNA 1DRZA 2CJKA 4WKRA 2LYVA 2WBRA 1VC0A 4IUFA 1FO1A 2MZSA 3LQVA 1Q82T 4Y00A 2QFJA 2EK6A 1KOHA 3S8SA 1WTBA 3J7YU 1WEYA 2KI2A 4PKDB 2HZCA 2AYMA 1QVGR 2X1FA 2LEAA 2J0QD 3MUVP 1X5OA 2U2FA 1HD0A 1U1KA 1BY9A 3G71S 1U2FA 3VF0B 2HYIB 2CPHA 3UWTA 3G6ES 2DNLA 2XNRA 2N3OA 4QU7A 2LQ5A 2LECA 3UCUP 2DNRA 3H2VE 2XS2A 2OTJS 1WG1A 4TLQA 3L3CA 3TYTA 4C7QA 2MQPA 1Q81T 2RT3A 5CA5A 2DNYA 1UP1A 1WHWA 5IM0A 5GAHU 1DZ5A 4IOAQ 2OIHA 1M1KT 5FJ4A 3B4DA 2FC8A 2N7CA 1CVJA 4F25A 2RVJA 2XS7A 4LMZA 2MYFA 5HO4A 3MOJB 1N52B 3DXBA 2KRBA 1RK8A 5GVQA 4P6QA 2MQOA 3CCLS 1KD1T 1L3KA 1ZH5A 2KG1A 2MGZA 5GADU 4OZ1A 3CXCR 4Z2XA 3VAGA 2J0SD 2CQHA 2JVRA 4CQ1A 3H2UB 3SMZA 3TP2A 4YB1P 2MKJA 2RUGA 2FC9A 2HGLA 2YH0A 1M5OC 4WF9Q 2CQIA 2CPEA 1M5VC 3UE2A 3R1HA 1JJ4A 2DH7A 3G8SA 1IQTA 2BZ2A 3I55S 2DB1A 3HHNB 1P1TA 2KXNB 3CPWR 3TO8A 5GAGU 1VQ4S 3U1MA 1HA1A 1VBZA 2DGXA 1YHQS 1DBDA 5ITHA 1YJNS 2Q79A 1XN9A 2RRAA 2VOPA 2CPDA 1X4FA 5LSLA 2X1BA 1FJCA 1YIJS 3BO3A 5MLCV 2JX2A 3UD4P 1KC8T 1A7GE 1RKJA 4LIRA 2OSRA 3G9CA 2LA6A 1VQPS 4WFAQ 2OJ3A 4V19X 2MGZB 4WCEQ 3IRWP 3VAFA 2LEBA 1YJWS 3CTRA 5EN1A 3IWNC 4IOCQ 3VAJA 1NO8A 2KM8C 2L9WA 2M88A 2UP1A 4PRFA 2DHAA 2ADBA 5JVHQ 1SJFA 1X4BA 3THPA 3P49B 1N54B 2ZJQQ 2K3KA 2DNKA 3R27A 2DHXA 5DDPC 5DETA 3MURP 1U1LA 4ED5A 1VQNS 1U1MA 2LCWA 2V94A 2LKZA 1WF1A 5DDQC 5D78A 2MSTA 3VAKA 2DGUA 1OPIA 2HGNA 2DNOA 2OTLS 3CCUS 5H1SV 3B4MA 4W92B 2MKCA 3ULHA 3SXLA 1G2EA 3N9UC 2M52A 2M0GB 3SDEB 2RQCA 2DGSA 5IQQA 2KU7A 2CPFA 1FNXH 3CF5Q 1ZZFA 1HL6A 2CQBA 3THTA 2HGMA 3CCMS 3CUNA 1U1QA 2DGQA 2CQ4A 1SJ4P 2MJNA 1N8RT 4C4WA 1YTYA 4UY8T 2OSQA 2YWKA 2HVZA 2KVIA 3MI7X 1D8ZA 3VALA 2CQGA 3VAMA 2FY1A 1SJ3P 2LMIA 2XB2D 1X4AA 2MZJA 2MKKA 3U1LA 4F26A 3K0JA 2CPIA 5CYJA 1X4GA
chains in the Genus database with same CATH superfamily
1CJUA 2X1AA 4IRDA 3WQPA 4XAKA 3H98A 1YK9A 2DCLA 3OHAA 1WF0A 3GIKA 5LMNF 2FPHX 1WHXA 1VDHA 3DOMA 4OI4A 5FLXY 2HNYA 3MEGA 1RT6A 3NS5A 3HK2A 2ACMA 1ZZNA 4KHMA 4ES2A 2ABYA 2XCAA 3WC0A 2ERRA 1VQ9S 1VGYA 1WI6A 4ZVHA 2Q43A 1S1WB 1V5IB 2GO9A 1EX8A 2J6SA 2C2NA 4QCLA 3LGMA 3KUEA 2QYCA 2D7SA 3CEDA 4MK9A 5BJRA 3UN3A 3NGDA 3QJJA 1TL4A 4JYAJ 3GLJA 3LWLA 4XPEA 2F9DA 1S5ZA 3MD1A 4M5HA 1YRXA 2XO6A 2FJVA 4UTGA 2OPSA 1IBKJ 4P10A 4HYKA 2LDYA 3DGPA 1J2VA 2NYIA 2NCKL 3R1LA 3TW0A 5D4PA 4CYUB 4CH0S 4GKJJ 1EB0A 1SH0A 2F7VA 1KFDA 4FVMA 4JI4J 2RMLA 3J81j 1MWQA 1NK8A 1FE4A 1OSCA 3QO9B 1OQ6A 1U02A 1FDDA 2VFTA 3QGIA 2HHHF 2M7SA 3VGVA 5D4LA 2H5IB 2MY7A 1H74A 1HWKA 1YWXA 1DQ8A 1S4FA 1VK3A 2JLEA 3DN9A 1VCTA 1JKHB 1VQLS 2FHOB 2CPZA 2XC9A 2APOA 3AOBA 4DXLA 2R8HA 2RDJA 4LF5F 1TKZB 2J6TA 3POTA 3RBXA 1RT2B 1XR7A 3I56S 4F3QA 4JI2J 3TQ1A 2V9WA 1GT8A 4ILLA 3TI0A 1FDNA 3K2YA 5KG5A 1KQSR 3SBMA 4ED2A 1HIYA 4JI6J 2IRUA 3IR5B 3IXQA 2DO0A 3C6UB 4PPDA 4TU7A 1U1PA 1WI8A 1QDUB 2C2KB 3OR1A 4FXWA 5JMNA 3KDNA 4NLOA 5EUHA 4LBHA 1JIHA 1Q8IA 2JL9A 4PG8A 5FDLA 4CM0A 5HVHA 4B3OA 1B4SA 3N5BA 3A8JA 4P7VA 5F0UA 4WFNQ 1RE1B 2ZJRQ 4ER8A 4HDGA 2AZ1A 1NDPA 1SI9A 1OSDA 2ASYA 2HG4A 3HHEA 3I4HX 3KKFA 3Q8VA 4HDHA 1JLCB 4O4GA 5HBMA 4B3OB 2CQ1A 3G8TA 3MR3A 2MQ8A 4I6WA 2G0IA 5DO2A 2B4VA 4J91A 2N82B 4CRJA 2R9LA 3M8ZA 1CS4B 4EO8A 3BGLA 3N6NA 1R0AB 1P9QC 2L48A 3A13A 3BGUA 4UQGA 1WORA 1EQ0A 2BJDA 3TEGA 3VAHA 3QIPB 2ADCA 2QA1A 2XHCA 4LF1A 4WJBA 3PIOQ 3NOGA 3OTOF 3O8WA 2K1RB 3M2VB 1R8PA 2VC1A 4PG6A 1WC0A 3CJ2A 1Y4ZB 4LRDA 2V2VA 3DYAB 5DZ7A 5LL6d 4BWJA 5DM6Q 1K9MT 4L74A 4NE9C 4DR6F 1TVRB 3F56A 3ILOA 3TJAA 1UJ5A 5HSPA 1PAEX 2BJ7A 4UOGA 2K2PA 3PYEA 4C3MA 1VJQA 4M5DA 3OSPA 1VQYA 3EJMA 4LF9J 4I64A 2W1BA 5DG9A 2CQCA 5C7PA 1WJ9A 1X4EA 2ZNYA 2UV8A 1WSRA 4DSEA 1Q7YT 2YWHA 4DWIA 3BN7A 5B0CA 1UA1A 2XULA 3WC2A 4CO1A 4Y0FA 2QEXS 4OHVA 4RW7A 1S6QB 2B3TB 4NLWA 4JV1A 4WFZA 2WHOA 5GMKa 5KG2A 4JI1J 9ATCB 2VG7A 2YQ3A 2ZKUA 2KO1A 1GXTA 4AXJA 1FE0A 2BQ3A 4DV2F 1YG0A 2IJFA 4XIUA 4X4NA 1ZTTA 2WBMA 3JTNA 4M8LA 1LFWA 2KB2A 5H9FJ 4ECZA 1MLAA 3GFZA 1EARA 1ZPWX 2DNNA 1WC4A 3QT6A 1JXEA 2J7UA 1F5BA 3IRXA 2HHHJ 4FPIA 4M5MA 3EM1A 4DLEA 5E3CA 4EBDA 1S6OA 1FRJA 2IJRA 2Y3YA 4G65A 3VTIA 3DLEA 1IBMJ 3DC2A 1X9SA 1FKOB 1WC5A 1J5EJ 4OYXA 1P6TA 3DM2B 4MAKA 5CD4H 3QZ7A 3CCTA 4J90A 5AXKA 5T7LB 5KFGA 1M5PC 3GV7B 3TOQA 2Z2ZA 3G82B 1N5SA 2KT2A 1RADB 2KT5A 3BN4A 1RAAB 5DQHA 4ED4A 3MM8A 2MHEA 3HZEA 2BQUA 4RBVA 2WAQD 2PGCA 2JHEA 3V4IB 1ZOTA 3DRSA 2XMUA 1HNVB 4TU9A 5LXYA 4KV8B 3W5YA 3KMSA 2UUBF 1U4BA 1WEZA 4R8UB 3OJUA 3U02A 1X5PA 1YJVA 3CDEA 1OYDA 1S0MA 2YQ1A 2IYIA 1VRTA 3BDEA 3IR6B 4KY3A 5F9NA 4GC7A 1H0HB 5FDLB 3CD7A 4C6AA 5EWFA 3NMRA 4KKOA 1NUEA 2NXJA 2RQMA 2EI5A 3V5RA 3CJ4A 3MEDB 1XWLA 1ZM2A 2LXIA 3DLKB 4IDKA 2K7KA 4DCOB 5DLFA 5D4NA 2VHGA 2W9BB 2CIMA 1BQMB 2XGQA 3CC4S 4GVBB 6FD1A 3D5MA 2B5JB 3HHDA 4K5RA 4ERDA 4LF9F 4X62F 2DNPA 2W7AA 4DV4J 2GHWA 5HMYA 2VFSA 3CCQS 2JEFA 3HPOA 3LP2B 3HX9A 1HBMA 1RBOB 2MPUA 2XGPA 5HROA 1U2CA 2OH2A 3DLBA 2MQNA 1X4HA 2V8GA 2YX7A 2VIHA 4DR6J 1BWVA 1CJTA 3ZXWA 4DV7F 1BD6A 2PMZD 2ZH8A 2QLXA 5E5NA 2I8EA 2DPJA 1NHVA 1F3FA 3PX6A 1WELA 4DSFA 1HI0P 2YNFA 2X1FA 4AT1B 5IT9U 3NY0A 4DL3A 1U47A 2VPZB 3GFHA 3RJMB 4X65J 4ED8A 1UVNA 3QBCA 3LA0A 4Y2AA 5F8HA 4DV3J 3D6FB 2X7IA 2F40A 3NCPA 3Q83A 4J5OA 5EX0A 3C6UA 4ANEA 4IR9A 1HYSB 3PXGa 3MAAA 2XBPA 4OYWA 3KK1A 4J9LA 1AZSB 4ELTA 1RTJA 5A2QU 3W65A 4QIFA 3KLVA 2HZVA 1VRUA 4KV8A 1TELA 2GO8A 3NXZA 3N0VA 3W63A 4ANDA 3T1HJ 4AQYJ 1J5EF 2E5JA 1IR1A 2BA9A 4RL1A 5JXSA 2YQ0A 4EMDA 1S97A 3LH2S 1RHJB 1RT1B 3HJVA 2CDQA 5L46A 2VG7B 1Y7PA 4X4PA 2HHWA 2BOAA 1LV5A 1SJ1A 2AYEA 3IN5A 3PY8A 2IC3A 4FNIA 4QJVA 2KFYA 3W2VB 1MU2B 2K8GA 3FCWA 1TQLA 4HHJA 1VBXA 3NBPA 3QFHA 3QO9A 4DV0F 4DR5J 1HI8A 3CGIA 5AXMA 4ZIWA 5KFXA 1IBMF 2MXYA 1FF2A 4I0WA 2EBEA 2ZHOA 1IQZA 5IWAF 4AL5A 1KVJA 2IM1A 4QWAA 2AGOA 2HIYA 2HK2A 1SQEA 4U8YA 4M95A 2HLTA 3D6HB 4LRAA 1TKDA 2UUAF 2MLZA 2R8KA 3FBCA 3H5UA 2L08A 3LUYA 2CJAA 3UD3P 1NSQA 2CZ4A 2QGFB 1LK5A 2GVDB 5IV3A 3EYZA 1U0HA 3TZYA 5THWA 5L1IA 5F41A 3G8QA 4MT1A 5LM7E 3VV2B 4CDIA 2GVZB 3HVAA 2IBKA 4IQXA 5C25A 4OI3A 2D9OA 3A12A 2M70A 3TJ9A 1VQ7S 1L5UA 4NLYA 3ILIA 4ECSA 2HMIB 4W90B 3J80U 3RB0A 1M1GA 1K8AT 1IWAA 4USMA 1ZETA 3ILLA 2MLYA 3FSIA 5B0BA 1VMBA 4X4QA 2XMJA 3LPYA 2UUTA 4O4GB 3I9ZA 1CC7A 2N4CA 2PA8D 4NLUA 2R7RA 3DRRA 2HHPA 2W25A 4H4KA 2ZM6F 4NRTA 1URNA 3NAHA 4Y2KA 2LP4A 3M8SA 2VOOA 4IG3B 3NNCA 5RUBA 2EVZA 4NCAA 3HHLC 3J7Z5 4F3OA 2DH9A 2VQFF 1PBUA 3MMJA 3KLIB 2MMYA 4UUWA 4NWBA 4DX6A 5ETVA 4X65F 1X9MA 1APSA 3UFCX 3PYGA 4EU0A 4I2PB 4ZP9A 3ZFVA 3M8YA 3TUJC 1NB2A 1G3OA 2EK1A 3U27A 4A8XA 2H3EB 3H40A 4HI2A 4LREA 3HSDA 2GS8A 3FMWA 3SFGA 5KFIA 3IS9A 2DY9A 4WKRA 3OFFA 2LYVA 2WVDA 3QIDA 3OTOJ 4NXMJ 3OVSA 3NKYA 4RKUC 4Y00A 3JQMA 2Q1LA 4I1TA 3CW2C 2EK6A 1YJTA 3I5AA 4USVA 3J7YU 1N34J 5A6WA 1GNKA 1TTHB 1ZA2B 2HZCA 3GR0A 4LSNB 1OMSA 2BM1A 1S1UB 4N77A 3WZ0A 3CCZA 3KJVB 3KHLA 2ZH2A 3T6JA 3PO4A 2YX1A 3DRRB 4QW9A 1UFKA 2H5EA 1HD0A 4USHA 1L3UA 2G2YA 3CDWA 2LQ8A 2V6AA 2ZBCA 3M8PA 3Q8SB 3GIIA 4B3RJ 2LQJA 2BJ1A 1RHMB 2RHQB 1VISA 2C3MA 2ROPA 4ZVEA 5EWEA 4OI1A 5ETOA 3UWTA 2HYIB 1LXNA 3R5AA 4GC6A 1HKAA 2KJVA 2N3OA 1YDLA 4QU7A 2AP6A 4K5SA 2XYPB 1RCOB 4YN3B 2UUAJ 4IYQA 2Z2MA 3AT1B 4I2PA 3H2VE 2KT3A 3W8GA 4DPUA 3MECA 4YR2A 1S0NA 3GYGA 1RWXB 4IDKB 5HMXA 1RWMB 2XS2A 4TN2A 7AT1B 2C3OA 2NPFA 3TYTA 1S1TA 3ZZTA 2OPRA 3BKTA 3UPFA 2RT3A 4RNOA 1DLOA 4F3MA 2VFUA 5CA5A 1XK8A 4JI4F 3K5OA 1UP1A 1WHWA 5IM0A 5J2NA 1YSJA 4DCJB 4A8SA 1FRLA 1V6HA 5ETLA 4A4JA 5SZTA 1M1KT 1GFWB 4JV5F 2PMWA 1NBEB 2F4FA 2N7CA 1RA7A 5JUMA 5J2QA 1TKXA 1CVJA 1UZHA 1CEZA 3NOCA 4JUZA 1T8EA 2XSJA 3I0SB 4GVLA 5F8IA 1CJKA 2BKPA 4UY85 2B7CB 2CWKA 2PDAA 1KD1T 4GRSA 2EFOA 2I9SA 3R5GA 3CCLS 4DL4A 3DLGB 3HKZD 3T9NA 5K20B 4N41A 4OX9J 2AU0A 1IJEB 2PN6A 3FBEA 4DZDA 2OO4A 4AFFA 1JLAB 4MIWA 3BJYA 1BGXT 2CRLA 4P71A 3MCMA 5EX3A 2J0SD 2AMCB 1NSPA 1FRXA 2MTLA 2JVRA 3VCDA 4ED7A 3QPIA 1NHUA 4WXWA 4O0NA 5HVFA 3ONQA 3SMZA 3TA2A 3KHHA 2OHDA 3AJ1A 2OUGA 3N4WA 5BR8F 3R5DA 4B17A 3M9NB 1T9VA 2HNDA 4WF9Q 5CAAA 1K1SA 2CQIA 2CPEA 2B6AA 1UVMA 3J7YI 4D3GA 1JJ4A 3PW0A 1FKPA 2B56A 2AKWB 3DLJA 1GTEA 3C66A 4FF2A 2QMUB 3I4PA 2NXUA 1P1TA 3NBPB 3DU5A 3HKWA 2HHXA 1H72C 1RU1A 2ZBQA 4X4UA 1IKWA 3TR5A 1KLMB 1DLOB 3QMQA 2DRBA 4RNHA 1YHQS 3TX0A 4ED6A 2PO4A 4ZVRB 3R7BB 3KUHA 4LF4J 3ISND 2ZH7A 3NG8A 2W9BA 2RAQA 2GJIA 2HQDA 2C2RA 1YJNS 4ED1A 3K5MA 3C14A 4ZP6A 1UMJA 2XO7A 3TWZA 2ZHBA 3W61A 2EG2A 2RRAA 1KLNA 2VOPA 2YKMA 1TKZA 3O3LA 2ZITA 3AOCA 4E8UA 4KFBA 5AE2A 2BE2B 4RUBA 3BDPA 1CJVA 1B7YB 4ZVFA 3IM9A 1A7GE 1WD6A 2VJVA 4XDCA 2OSRA 1X9WA 4DV0J 1VQPS 1N5YB 1X7VA 3K57A 3BGRB 3RR7A 1R3NA 4IQMA 4KFBB 1R0BG 5U47A 3A3PB 3CTRA 3WIVA 4WCEQ 3VAFA 4IOCQ 4DR3J 1NK4A 3IWNC 1HW9A 2HQIA 2IM2A 4OV1A 4CLLA 5KFPA 1NO8A 3VAJA 2W24A 2M88A 4PRFA 2JEIA 2EFVA 5JVHQ 2AZ3A 3NS7B 2B9EA 4FYYB 1IM6A 2BMBA 3I96A 1FJGF 4F36A 1TV6A 4KGXB 7FD1A 4A8QA 2XY5A 1NDLA 1S9EB 1ZAXA 4F50A 4Q2LA 1VIXA 1AYEA 4OX8A 2P9GA 4YS2A 1TR0A 3BF4A 5J2MB 5DDPC 3MURP 4ZPBA 4OX9F 3UR0A 4PYAA 3V6HA 1D09B 1SIWB 2F1FA 4N47A 1BXNA 1RP5A 2RB7A 3EMTA 4I7FA 5CYMA 3R2CJ 1NXIA 1Y00A 1KNZA 2EFQA 5DDQC 1VBKA 2VF3A 1W25A 2ZUGA 4KYZA 4C8MA 2DT9A 3FSYA 3HT3A 1OY8A 2QMWA 3TANA 3CCUS 4UZCA 3EZ5A 1I94F 4HT7A 4DEZA 4W92B 4U6PA 2MKCA 2XTJP 2CVEA 3ULHA 3T9ZA 1HHTP 2VDHA 1LKZA 4ZPVR 1X31C 3FDSA 1V9OA 3GE9A 2M52A 4R8UA 5KFKA 2YKPA 2WOMB 3T5LA 3C6TB 1D9FA 2WONB 3ILJA 4TY8A 1IKYB 4GKKF 1O5JA 3E8OA 3CD5A 2G2ZA 3BBCA 4C2MA 3G6XA 3V6JA 4O3NA 1N0VC 4RNMA 1FNXH 3JQJA 3QGPA 1U2RA 4FVCA 1U6BA 2DEIA 1HL6A 2CQBA 1YJRA 2HGMA 2HAIA 3THTA 4DBQA 5K8OA 1Q5VA 2ZH6A 2P9EA 5KG1A 3CUNA 1M5HA 1XJWB 2AJ2A 4CT8A 4LF4F 2B4OA 1AZSA 2QTWA 4NMLA 1WC3A 1N36J 3B8HA 3NGSA 1E6VB 3I31A 1XERA 2M3DA 4CLTA 5LMNJ 1YTYA 2VPYB 1HPZA 2RE1A 4PQAA 3MI7X 3SCKE 5HJYA 3BREA 5D0EA 3TAPA 4U95A 3Q22A 1ZM4A 2PD1A 1DURA 3LP1B 3VAMA 3I6PA 6FDRA 3M8QA 4CLZA 3MM6A 4FP9A 3MEEB 2FD2A 1HI1A 3D3CJ 3RRKA 4RUHA 5IZHA 5KFJA 4LFAF 1SV5A 3U1LA 3K0JA 1HWJA 1X4GA 2J7KA 5MAOA 4JV2A 3EX7B 1RT6B 1YZ7A 5C5JA 3ZZYA 3H5YA 3QZ8A 4DSJA 4QWDA 2DR8A 1PKUA 5AXLA 3MFHA 3O1LA 4PUOA 4QIWD 4Y2CA 1VRUB 2MZ1A 1QSSA 1S99A 1XC9A 5KFYA 2Y1RI 2I1RA 4IG0B 2ZZNA 4DR7J 4HHUA 2AV5A 3OR1B 1X60A 2JOQA 1GTHA 3R9LA 4X66J 4CLSA 5HQ8A 4ECWA 1AUDA 2ZFHA 2VBZA 1CPZA 1NPRA 1PSDA 1XMBA 4KGMA 5IS2A 1LOUA 4RU9A 4DV6F 2FHJD 4ECYA 2BKNA 2AGQA 5AXNA 4M94A 1UL3A 3B54A 1SBRA 2MQLA 2Z56B 5AJ3J 1RZMA 5LMUJ 3E01B 4IO9Q 4JI3J 1I94J 5EGYA 1RWKB 2YNHB 4USUA 4I6YA 3CMAS 1XIQA 2QA2A 4Q45A 1U09A 3GJSB 5BXIA 3K58A 1RYRA 1TU0B 3LAKA 4ZHRA 2FVPA 4UOFA 5BYRA 1FRIA 1R6YA 2WRMA 2BBEA 2VBXA 2FLLA 2BUNA 2B5JA 3VZIA 1PJ5A 2NPIA 2GZOA 1SUQB 3O44A 2K7JA 3G86A 1C2PA 1Q78A 1S1XA 1HNXJ 3I0SA 1WACA 4DFJA 3OV7A 2ZBPA 2HFNA 3D54A 4UF4A 2W9CA 2Z0GA 1SUQA 3QRQA 1X5TA 4QWBA 5IM0B 1TVRA 2Y8WA 3N5FA 4ZMMA 1T9YA 1N88A 2O01C 5A8WA 2J9EA 1CULA 3PHTA 4ID8A 2M9KA 1DARA 2BE2A 2OMOA 2CQDA 3RAQA 1NJYA 2V67A 2RS2A 2FGOA 1AA1B 3OUYB 2GVZA 1SC3B 3GFXA 2FJBB 4LRFA 1DTQB 1D9AA 1GH8A 2LQ9A 3IO1A 4ZPWR 1N6QA 1NPKA 4J9OA 1WNEA 4ETXA 4WTOB 1Y5IB 2Z2LA 2RS8A 1JLAA 3PDNA 4ED3A 1F1BB 4C48A 3KLIA 3KOAA 3AXMA 4OZNA 4EI2A 3UDLA 4NYOA 3CCSS 1B64A 5A6PA 1RT3A 3BV8A 1VHFA 3KLFB 2AYGA 3J7AN 2FHKA 4ZK7M 1C1BA 3NCRA 3BS9A 1XMOF 5E3PA 4DSLA 2K06A 4OX6A 3IC1A 2KG0A 1RGVA 2CQ3A 2NS1B 1N0UA 3IA0A 2YKQA 2Z2YB 3VVTA 3WX8A 4BHQA 1S1TB 4URGA 3M2VA 1RTZA 4FXVA 3TUZC 1HLWA 3MR6A 2XY7A 1TFYA 2RF2B 3MM7B 3ZC4A 1S9GB 2HBRB 3CCWA 2Y1JA 4WIQA 1Q7LB 4FPRA 3RW7A 1KOOA 1HMVB 2HFVA 4KO0A 5B0GA 2R2SA 3CCJS 2MY8A 3LPEA 3PZPA 2ZOFA 2EFPA 4USWA 4J9UE 1J27A 2XI2A 1L3SA 1T3NA 5KT5A 1JXLA 2O67A 4O3RA 4CLPA 1P1LA 4OHWA 2GMLA 4PABA 3GCXP 2GIQA 1QE1A 1UAWA 3N79A 5FD1A 2UZAA 3NGUA 5DGAA 1ZAWA 2ZVSA 3ZZ0A 3IAS9 4HACA 3DLLQ 1NM2A 3CC7S 1S1UA 2D9PA 3G6YA 3GYNA 1HQEB 4TYBA 3N6MA 3Q8RB 2XNQA 5D77A 3NGRA 4ETZA 4DQQA 2MJUA 3CIMA 2W4PA 3PR4A 4KGKA 3KK2B 5DS7A 3FFIB 1QVFR 2QLFB 3SFUA 1NU4A 1S0VA 3NNAA 4K7QA 1RUSA 1Q53A 1V3ZA 1N5TA 1RWVB 2B9WA 3BQ0A 3HZGA 4KT0C 5C2CA 1FKOA 4KSEB 1QM9A 2CA9A 5KFSA 2FZKB 2D3ZA 3AOAA 4F2RA 2KM8B 1RSCA 3OFHA 1BQXA 4RW9B 2MZRA 3FJ2A 4P73A 2E1CA 4K4SA 3ET6A 2KHCA 2V8PA 3R97A 3AB2B 2V0NA 1UTAA 2GX8A 2KZZA 2YNFB 1IR2A 1Z2ZA 2ZWPA 2L3MA 2BE7D 3D1OA 2ZE2A 1DTTB 1UETA 3SDEA 2YH1A 2OELA 1U1NA 1F5AA 4F4AA 5I3UA 4PWDA 2OP5A 3OW2R 2UVRA 1W7WA 4B9NA 2XEXA 2RILA 3MM8B 3PJXA 3S7RA 3A8EA 4USIA 2DEJA 2WOMA 4OL8A 1Q8KA 5M2UA 1C1CB 5F8MA 4DUZJ 2J8SA 4WFXA 2XI3A 4ZKAA 1Z4UA 4CIOA 3RAMA 2G4BA 1WDTA 4ZVTB 3Q86A 3J81U 1IUJA 1OO0B 2E44A 2A6OA 3NS6A 1D0EA 2B9YA 2QL5B 2C1EB 3BSAA 3QQCD 2WSEC 3MXHP 4HHHA 5DJBA 5L38A 3SCLE 5HATA 1AFIA 2H54B 3H90A 2LXFA 4QOTA 5ETRA 2CYYA 2B9XA 2CDRB 1CJTB 2NZ4A 2UU9J 3KG0A 5HAOA 2IFXA 1T05A 2M4MA 3C19A 1H2UX 1T3OA 2YWGA 1A9NB 2FVCA 2XLIA 4JI5F 1ZPVA 4I6AA 1T05B 3EXYA 1S1VB 2VPXB 3ENWA 1QAYA 3W2WA 4PEOA 3TNVA 3VGSA 4BC9A 1PJ7A 2VQEJ 2VKZG 3A3NB 4EYHB 1IKVA 1W26A 2HFOA 3DI6A 3W66A 5K8MA 3HMJG 2XLJA 3H25A 2OD6A 2VA2A 2OMLA 3MR2A 5A76A 1QUPA 4F4WA 1SQGA 4ECTA 2A18A 1Q0NA 2E5LF 1B99A 4B02A 1E6VA 4DX8H 3DOMB 1N4LA 1HPZB 3OL9A 4DQRA 1RWWB 3KNGA 3TAMA 5KG4A 5HK4A 4OZLA 1LNQA 1UVKA 2QG9B 3I5CA 3MM9A 5IXUA 4OFZA 4Y65A 4ELUA 2WB4A 1V5VA 2B4PA 4NCGA 2B8QA 2AEJA 3MOZA 5K5MA 1KQKA 4D3HA 4Q8FA 1JLBB 2F3JA 3GYXB 2W2MP 3L7UA 3LP2A 4ID5B 2MKSA 2OI2A 4LT6A 4ZVPB 3S6EA 3LOUA 5HROB 2J76E 1PIEA 2PC6A 3FCVA 3IM8A 4X64J 1FRKA 5KT3A 1PO6A 4X4VA 3IBCB 4NMXA 1QY7A 2E1RA 1WUUA 4WU2A 1JLBA 4YB5A 2B4UA 1O0PA 5KG7A 1MROB 3P4UB 2FJWA 2JSXA 2G1HA 1FWLA 4JI8F 4ZN1A 5E3RA 1VC5A 3NLCA 5KT4A 2B7BB 1T95A 4B9UA 4IR1A 3MHYA 3NL0A 1B3TA 4B9MA 3MPWA 1ZA1B 2JEJA 4FF1A 2FVSA 2B8PA 1RAHB 2QIFA 2C3UA 3O6QA 4NPOA 4QIGA 3DCAA 3HLUA 4DPOA 2WZ1A 2HHTA 2Z30B 1HW8A 4DU8A 2E5GA 3UDCA 4RLEA 2AD9A 5HI7A 3W2WB 4OJGA 3JB9k 1RLDA 1NKBA 2H4WB 4URQU 2M8DB 3DGVA 1HNVA 3BO4A 4ECXA 3K8WA 1UJ6A 2HK3A 2DJWA 2NLWA 3FEXB 3MZIA 4ES1A 1IM4A 4IKAA 4ICLB 1LW0B 3E3XA 4NXMF 1S6QA 3TVKA 2MB0B 1FT8A 1AXQA 4H54A 2FQQB 4PXCA 1E6YA 3CB4A 2JFKA 4WYLA 1KKHA 3D4JA 4JI5J 3UCGA 3J7ZT 3MEEA 2CVIA 5KG0A 2AJ4A 2RQKA 3FKBA 2F9JA 2O1PA 3MFIA 3BBBA 1T7PA 3P96A 1XNRJ 3Q8PB 1DHMA 3IWXA 1TL3B 4OV6A 5HL7Q 2A3JA 3V81A 2QYGA 2IJNA 3HVTA 4FF3A 2IBOA 2M2BA 3GILA 1RXOB 4DR3F 2DIUA 2LA4A 3D0GE 2DNMA 3M6VA 3TA0A 3PYFA 4DN9A 4K4XA 2FLPA 3UI3A 3D66A 4CLUA 1YGYA 5K8PA 1T94A 2Y1LB 2CJKA 1JK9B 2R2TA 1VC0A 4IUFA 1FO1A 2HHUA 1CS4A 3LP0B 1F6TA 3C16A 1PJ6A 3LQVA 2WVCA 3OTEA 4GO7X 4NASA 1FVSA 3R5BA 3T41A 1Q82T 2QFJA 3TA1A 4ZS6A 1AFJA 2FY8A 4RW8A 4A8KA 1TL1B 3JSMB 4PKDB 5D8HB 3EICA 3MPVA 4W98A 4JV0A 3C6TA 1QVGR 3B82A 3ZTPA 2LEAA 3ETOA 5SUHA 4ECVA 3TAQA 1CJKB 2CG8A 2U2FA 4P7TA 3K59A 2KYZA 4LF7J 4NYZA 4Y6IA 2EW9A 1BY9A 4C8LA 2XWXA 1U2FA 4LSNA 1HR0F 2Q3PA 3M05A 3VF0B 4G1PA 2WVFA 3G6ES 1T9UA 3GPAA 1SIZA 4DR4J 2JJ4D 2HHSA 1RBAA 3IBWA 1HBNB 3KUGA 4B9VA 1B0PA 2POKA 3F41A 1S9FA 5HVGA 1Y5NB 3HSZA 3V6KA 4P52A 1QTMA 4CP5A 4HKQA 1NK9A 2XHWA 5E41A 2YXLA 3PCOB 1S9GA 3FFIA 4WK3A 4F4KA 4IOAQ 3MMAB 4DU7A 1YJ7A 5GAHU 3DHWC 1AROP 2JFDA 1R89A 3HDSA 3R2DJ 4JV5J 4MTPA 1FA0A 4DQPA 2R7VA 2GA7A 3B4DA 3GP9A 1HARA 2FC8A 3IG1B 4NOHA 3GIRA 3TZZA 4Q8EA 4F25A 2Y8YA 1CQNA 1VYAA 2QO3A 3UVJB 1JLGA 2OKQA 3KJVA 4LMZA 2WSCC 1WKKA 3LALA 2HLUA 4PXDA 1X0PA 3DXBA 5KG6A 3I5BA 4DR2J 4HTIA 1PAUB 3QFWA 4RW4B 1JLGB 4FZVA 4Q43A 4DV7J 2V2QA 2VDIA 4ZLPA 3LWMA 3JSYA 2MGZA 2KG1A 3DYAA 3GG0A 3KMQA 4OZ1A 4CTAA 3K8VA 3HCXA 3R8YA 3OVAA 5E33A 5D15A 3CXCR 2ZHAA 2VICA 3VAGA 4JOUA 4P2MA 3D67A 4XK8C 4HL9A 1CBKA 4FN5A 2OFHX 2OPPA 2A1BA 4ZPDA 3KG4A 1LWEB 1YKWA 1MN7A 2Z57B 4CQ1A 5KT7A 4B3SF 4HTJA 1K0VA 4MK7A 4N8NA 4CLYA 2R2RA 2RDIA 3HSJA 5H9EJ 1LWXA 2LFVA 4XDDA 1LFPA 4Q2MA 2BJ8A 4F4XA 2J0XA 1M5OC 3UE2A 1SH3A 2B43A 1LW2B 3CIZA 2HS3A 4KRWA 3JYTA 1XMOJ 4C8KA 5G4DA 4KH1B 1TKTA 1JLCA 2CUYA 5DZ6A 3I55S 2DB1A 3UN5A 2KXNB 1FKPB 4FYXB 1Q16B 3OPKA 1VQ4S 1U45A 1HA1A 2E5LJ 1TUWA 5J2NB 4B3TJ 5HANA 5ITHA 4TNOA 4ZVSB 2I6WA 3EE3A 4ZDNA 1QE1B 9RUBA 4DDFA 1ZM9A 1H73A 2FJEB 5DQIA 5K9FA 3OL8A 1BE4A 1XN9A 2KDOA 1MNEA 4K4YA 1U25A 2CPDA 4LSLA 5J1PA 1UPPA 2UXBJ 2X1BA 2W4DA 1LWEA 5KFOA 5MLCV 4DX5A 1Y3JA 2V4JA 3BO3A 5A0YB 2W2NP 2FLOA 3MAAB 4ZCMA 3KK1B 1KTVA 2LA6A 3JYTB 3NAIA 4LFCJ 3G9CA 2MGZB 3M6WA 1UVJA 1RT4B 2LEBA 5B08A 2GGPB 2V8VA 3NRBA 1OS5A 3I32A 4ZPCA 4NA1A 4CTAB 1UVLA 2R7WA 3CWJA 2KM8C 3EVWA 2A10A 3KLHB 3KDOA 2BJ9A 2W2PP 3GSIA 1XEZA 1JLEA 1X4BA 3HULA 5IV4A 4ELVA 3DOKB 3TJ8A 5B0FA 1RWOB 1SC4B 3EPIA 3L9ZA 4LUBA 2ZJQQ 3QRRA 2BRKA 3R27A 3GV8B 2PT0A 4RW9A 5DETA 3OFGA 1WOOA 2JZ5A 2IYGA 1KWMA 3CSKA 1BQNB 4KAIA 3OTDA 4ZP7A 1Y5LB 4FYDA 1BHNA 3DNCA 2LVWA 1CSJA 1HQ2A 3RZAA 1RAIB 4H4MB 1FX4A 5I42B 1KONA 1K0TA 3QT5A 2MSTA 5C42B 3MMBB 3OVBA 1BUXA 3A1YG 3BPDA 3FUYA 1L3VA 1JKHA 2HNZA 4U96A 4EYIB 3ZZOA 1N32F 4CLKA 3GIMA 3CT9A 1G2EA 4RW6A 3J80Y 3N9UC 1JQGA 1RTIB 3OXFA 5IOLA 5DGBA 1NEEA 2BJEA 1KEKA 2QC3A 4IOBA 1SKUB 1FD8A 4IG0A 3S1TA 4DQIA 2COLA 2R3VA 2RQCA 2V2KA 1ICEB 4K4ZA 1YZ6A 2ZZMA 2FIUA 5IQQA 2CPFA 2HFSA 5CABA 1FXRA 3V4IA 3T1YJ 4LFAJ 2IA6A 1FKAF 3GG1A 1RT1A 1ZZFA 1MWYA 4PG5A 2VG6A 1R7IA 2FUG9 4LF2A 1YLXA 3BGFA 2NQPA 2QMXA 2YNHA 4YR0A 1HNWF 3HFVA 2AHOB 1K44A 1ULRA 4GVBA 5B0EA 3ZZUA 3AY0A 1VFJA 1RACB 3D7SB 3LP1A 4UY8T 2HVZA 1S7HA 3IMQJ 2J7WA 3MM6B 1NK7A 2HWIA 1TK5A 4P75A 1D8ZA 4B3MF 3M8WA 3SEOA 1VQSA 4USTA 3D0HE 4K2XA 4NI2B 2Q66A 4K59A 3OQ2A 4ZN3A 4LF7F 2XMWA 4B3TF 1N5QA 2QZ8A 4MFBA 2CFXA 4BLGA 1IJFB 1X4AA 4DL0C 2P2CB 3TRGA 2YNGA 1UWBA 2MZJA 4PPZA 4WKYA 5I42A 1RJJA 2BW2A 2CPIA 2GQQA 3ETMA 5GAGI 2QLBB 3PFEA 5CHCB 5ETNA 2VH7A 3L95X 4C8NA 4UZBA 2V4QA 4LVOP 2Z4PA 4QR2A 3ZZRA 4C3LA 3OTBA 4KHPJ 4J9RA 3QAEA 4YR3A 2CPJA 4AL6A 3PEJA 2AGPA 2PFFB 4OYPA 2R7QA 1XNQF 1N33J 2OPQB 1NJXA 3EDQB 4UT4A 1FD2A 1U0HB 3MWBA 4R25A 4M5LA 1GMVA 3RG6A 3HO1A 1R43A 4Q0BA 2HHVA 2PEHA 5GADI 3PRBA 1HYSA 2NSBA 4DG1A 2E1AA 1HQUA 4IH7A 1F9FA 1C0UA 2FDNA 2K3IA 1MW7A 1J5OB 1EIYB 1Y0HA 1X4DA 1YQHA 3I0RB 4Y3CA 1OWXA 2J9CA 3IBFB 1RAGB 1GXLA 1HQUB 3SV4A 1SL1A 1FNMA 4DR2F 4WWSA 3T5JA 3CJ3A 2G0CA 5DRKA 2ASJA 1MROA 4OLOA 3TARA 2AX1A 1FXLA 1OQ3A 2DO4A 1H6KX 2HZAA 2HVEA 1CQMA 3H20A 4F4ZA 3OSNA 2DD8S 4HI1A 1R0AA 2IAJB 1HNIA 3MF5A 2GHPA 5LSOA 4RUCA 3BQ2A 2ZNZA 4NXNF 1EAYC 4X4TA 3F0NA 2XMKA 3OD2A 5HLFA 1FI4A 3K5LA 4K0KJ 4CO0A 1IBCB 4A8MP 1U48A 2CNKB 2YKNB 2R4FA 3KLEA 4C97A 4DLGA 2DHGA 2MZQA 3JTOA 3NCQA 2PE8A 2ZD1A 3ITHB 3M2RA 4FNHA 3C46A 3VQSA 1JB0C 1EETA 2HS0A 2JH3A 2WSFC 3T6BA 4DV2J 2JC0A 2WW8A 2YKOA 4OYBA 2YNIB 1FFSB 1I5OB 2K1RA 1F0XA 4TQRA 4KIAA 1SXLA 1VLOA 1FVQA 2NXEA 1WTFA 2HBQB 1RT7A 4ZVQB 2F4VJ 3MCOA 4YOEA 5KFBA 1U24A 3H8YA 4EK2A 1R8HA 3UNYA 4FS1A 1UEUA 2QN6B 3RW6A 2VUGA 3SYZA 3LO3A 4A8FA 1WHVA 4IO1A 2ZC4A 2GAGC 2FZCB 5ETPA 1LW0A 1WC6A 4M5NA 4AL7A 1RTHB 3BM7A 3HFZB 1U6FA 1IBLF 4C8YA 5IT4A 4J9VA 1SCJB 1KSPA 3D68A 1NHKL 2V8DA 4YMEA 4KPYA 2QA4S 2KN4A 1IVZA 2VQEF 1WG5A 3PW4A 5C2GA 3PO5A 4EGLA 1SJQA 4KGZB 4NCBA 4DV3F 4J7CA 4O0IA 2IDEA 1IKXB 1FRHA 1X4CA 2BV3A 4LRCA 1TKXB 2B6AB 3UDEA 3OXLA 3DDKA 5LJ5Y 3HXMA 3UVJA 4CZCA 3VAIA 1I6JA 1XR6A 3LAMA 3IGNA 3OXGA 3M9MB 3PW7A 3QRPA 3B78A 1HNXF 4JBCA 2GW8A 4ATNA 1TAUA 1JLFB 2HBYB 1ZAVA 4ALZA 1BC6A 2DIVA 2VBWA 1WKLA 2ZJPQ 3UR3C 5IC4B 3ZZZA 2O66A 4OYZA 1KQFB 3CULA 1SC6A 4Q7AA 1PGZA 2J9DA 5GAEI 4LF8F 4M1KA 1HMVA 2GVDA 4H4KC 4K8RA 1JNRB 1NSAA 2QT7A 4PCQA 3CJKB 2IY5B 3PR5B 2DR7A 1S7IA 4NL5A 3FC9A 4CM2A 4LQ3A 2UVUA 4Y28C 5ETSA 2R7TA 5HBMB 2C2EA 1REGX 2CNOB 2QLJB 2HEKA 3BQ1A 1DQAA 1H3DA 1S72S 1C1BB 4HACB 4ZLNA 5BYSA 1ELOA 4NA3A 3SCIE 1HQEA 4YUDA 4O3PA 2RQ4A 4G6VB 2MEWA 1FHTA 2GGPA 1KVKA 3I0RA 5BYQA 4USJC 5JVGQ 2EXUA 4ZJOA 2DNGA 1YRUA 5KOWA 3T5HA 2CQ2A 3FQLA 3R7SB 4DPYA 2ZKTA 1W2BR 4JI2F 2RH3A 2VFVA 3TVZA 2FHJA 5F0WA 5K14A 5H9EK 1R31A 4Z7CA 3MECB 2HRYA 1WEXA 2QLWA 4RPFA 3QLHA 3VR1A 1VQ8S 1MSWD 1UW9A 2JEGA 1IWGA 3BYPA 1RI7A 4C8OA 3DMJB 3QLHB 3CJQA 4ILMA 3R7NB 4IH5A 2FJDB 5KOXA 4G1QA 3HF5A 3VQTA 1VOMA 3D2WA 1IKWB 1NZ8A 2RDDA 3CO9A 5A8KA 5IC6B 1YITS 1I3OB 1X5SA 4FDFA 5J1NA 4C0OC 1RQ0A 4DV5J 2GQCA 2CPYA 3AH6A 5DLGA 4DSIA 3PX0A 3M32B 2JRSA 2XMAA 3NP5A 1SB6A 2RSQA 2C42A 5CYQA 2MZTA 4DCPB 1JJHA 2LXUA 2W01A 2X1GA 1R8AA 1V3RA 3AA8A 4NA2A 5L8RC 2R2UA 1MN9A 1C0TB 3LGNA 4PG7A 1N48A 5EDWA 4PG4A 3DFEA 1OY9A 1LW2A 4MIBA 1N6QB 1VBYA 3N01A 2YVSA 1HBUB 1CC8A 4OJ1A 5D0HA 2O3DA 4DV6J 3ZNJ1 3T3FA 3OT9A 1A6LA 2HWHA 4QZVB 1RDRA 4F0MA 5I4MA 4Q5VA 1HNWJ 3RUBL 4B08A 1HBUA 2DISA 1KHWA 1QLNA 3AB4B 3BR9A 4L6V3 1T0TV 3EGZA 3EGVA 1H2VZ 4MK8A 3CNQP 3THVA 1DJ0A 4QIEA 3RBZA 1FNOA 1YJUA 4OX7A 4RWXA 5GAEU 4ECUA 1Q5YA 3ELHA 3BZQA 2PEBA 3CJ5A 2HFUA 3GU0A 2XSFA 1VJWA 2YPZA 3KK3A 2ASLA 1S1XB 3AD7C 2E9ZA 1Z1ZA 2E5IA 4K4WA 2E7WA 4TXSA 1FERA 4JI7J 1Q79A 1X0FA 3AHPA 4LFBF 1RTIA 3EVOA 4QPXA 2F8HA 2C2DA 1WC1A 2VB6A 3ET6B 1A0OB 4XO0A 3CMES 4LF8J 4KR0B 2KFNA 4G1QB 5KFHA 2ZH4A 3KXDA 1G7CB 1Q95G 2ILZA 3UD5A 2GIFA 3FSXA 3CDUA 4DN0A 1S10A 5B0AA 3RRGA 1SV5B 3G82A 2HMIA 5FLXU 1RWPB 1NH8A 3OUYA 2IA0A 2HHQA 3MDFA 1Y9OA 2VC0A 3MR5A 1T03A 2CZ9A 2R7SA 5F8GA 2DXDA 2VD3A 2KHDA 2ROGA 2MKYA 2Q6BA 2Y0SD 4CO5A 5B09A 2PI4A 5L1KA 1FJ7A 4A8OA 1RHUB 3X3UA 4BCAA 1GX6A 2CJBA 4O23A 1HBNA 4OZJA 4YB6A 3TX8A 2C3YA 3W7BA 4MIAA 3BH6B 2RU3A 3MD3A 4MKYA 4ZIVA 4LR7A 1JLEB 3Q8YA 2EG1A 1FK9A 3KHRA 3H5XA 4PR6A 1AW0A 2FHMA 3CD6S 4NLSA 2DGOA 1MWZA 1K47A 2V63A 3GONA 3K5PA 4P74A 4WE1A 3P5TL 3V4MA 1U1RA 3C15B 1BWEA 5J1EB 2YTCA 1E6YB 2GCFA 2C3PA 3HT0A 5J2MA 1KQGB 2QX0A 1VLYA 3NEKA 4N8OA 2H4YB 5KFFA 1UW4A 2OGUA 2DNZA 3TUIC 3MUTP 3CCMS 1VQMS 1D8YA 3V81B 2CQPA 1PG5B 5JJBA 3EGWB 1PCAA 1F9EB 2PA3A 1NDCA 1JLQB 3MM5A 4U9RA 3C16B 4YDXA 4ZP8A 4KO0B 1EHWA 1AB8A 4UW2A 4B9TA 3PX4A 2RHSB 5E3AA 3DM2A 2CAJA 3SSQA 1JX4A 2YNGB 4OZ0A 4ZCIA 1U26A 5HMZA 1G1XA 2QSWA 1HFEL 2BRLA 3IGVA 1FDAA 2N4DA 4KH0B 4OJHA 3LW5C 3RGIA 3G96A 3C3LA 4I68A 5F8NA 1WF2A 2KH9A 2D41A 2MLXA 2R8GA 4DFMA 2E66A 5CCMA 4CWBA 2HKEA 4HVZA 1XR5A 1RHRB 5CZXA 3KNAA 1FTCA 4JI8J 2DK2A 1LEOA 2C2OB 2VFRA 4X62J 3T19A 3GJRB 2GAHC 4IFVA 4AE5A 3EUNA 3OTCA 1FEEA 4URSA 4I4BA 3E51A 2IC3B 5DDOC 3RB4A 4OYOA 1MU2A 2JWNA 3AJDA 2XYGB 3GJTB 3NWRA 1S77D 3AQOA 4JI3F 4ICLA 4EBCA 3QJPA 1TL5A 3ENQA 2DHSA 1NLKL 1MG7A 3FNNA 4RZRA 4B3MJ 4KHPF 3FZBA 2DHHA 4NCGB 5D6GA 3P8BB 4B3RF 2OD4A 1YVFA 4R0EA 3ZTOA 2BDPA 1HWUA 1PYTA 1VR6A 2VJUA 2HPUA 4DV1J 1SL2A 3OJSA 2KJWA 2WW4A 3US5A 4K4VA 3GCWP 4CH1A 5DG7A 4C11B 3LANA 3A8IA 4YP3A 1TL3A 1O6XA 4BDPA 1PC5A 1S59A 3BH7B 1W2IA 2C2ZB 3ZNUA 4C0HA 2DYAA 4DPTA 1D3WA 3CJ0A 3JS9A 2WBRA 4B9SA 3U7JA 4KC5A 4WP8A 1O51A 2DVIA 4X2BA 1FX2A 3DXSX 2GQ2A 3I9V9 2AX0A 2R7UA 4ITSA 2YKNA 3M32A 3M7VA 1L3TA 1WTBA 1S1VA 1WEYA 2D69A 2KI2A 2HRUA 3GB0A 2QSFA 4ENOA 4LRBA 5AE3A 2UUCF 3M4XA 1RLCL 8RUCA 1IKYA 2KKHA 4J37A 1PC4A 1X5OA 1YBUA 4JI6F 1S6PB 1NNDA 3MUVP 1NAQA 2V2ZA 4O44A 4PWUA 2DTJA 2AEFA 4NYPA 4F8RA 2DR6A 4DMZA 5L9NA 4M63A 4MH8A 4K0KF 4NZ0A 3ADAC 4KTQA 4A48A 2QA4G 2DNLA 2W2OP 4K2JA 3TAMB 4CYUA 4DV5F 2XNRA 5GMEA 2B51A 4C0BA 5KFDA 1J5OA 1GX5A 1TK8A 2VQFJ 1XBWA 2ZC3A 3QT7A 3UCUP 1SC1B 3DRPB 2OTJS 1C4AA 1WG1A 4TLQA 3L7PA 3QT8A 3L3CA 3V6DB 4CH7A 3CJ8A 4C7QA 3JAMY 3SI8A 3W9HA 1Q81T 2HS4A 2DNYA 3QIPA 2E1PA 2GV1A 4KB7A 4E0DA 4TKTA 2IVMA 1FWPA 1TAQA 2ROEA 2OIHA 8ATCB 3L7OA 3KG1A 5GAHI 1FESA 1TL1A 3AFGA 3JSMA 3LF0A 2ZH9A 3RB6A 2RVJA 4LVNP 4R5PB 3QSIA 3DLGA 3VVUA 5ETMA 2XS7A 1S6UA 5KAKA 2WB1D 2DBBA 1GEHA 4FKXA 2V4RA 1F3VA 1P9YA 4HR2A 2KRBA 1RK8A 5GVQA 4P6QA 4DHVA 3ISNC 5E2QA 1RT7B 1M5KC 3LTOA 4QIVA 1ZH5A 3D6MB 3BGRA 2E29A 3N6LA 5GADU 4DUYF 2ZVIA 2ZWOA 1RHKB 2G13A 3PJWA 4A47A 3UN2A 3RR8A 2FTRA 3HVRA 2F5GA 2RU9A 4OI2A 2V34A 3C2PA 3R5CA 2Y0BB 2BXJA 2FYXA 4N5SA 1UVIA 3H2UB 2UVVA 2BM0A 4NLVA 1S48A 2XLKA 2FC9A 2HGLA 2YH0A 1WSVA 2OPPB 3SCJE 2AJFE 3TZWA 4DL5A 4RW7B 5G0RB 4LBIA 5C24A 2ZH3A 5J1EA 2JLFA 3PJ9A 2BZ2A 3AD9C 2RUSA 3SQOP 1IQTA 4PZVA 1XNQJ 2E7XA 2XZDB 2XZTB 4YY3J 2FVRA 1O8BA 4QYRA 3EZOA 2RD5C 4CO4A 3RRHA 2IIHA 1UCNA 2CXEA 3U1MA 1FTRA 1VBZA 3UNGC 1WKJA 1U7LA 3DLKA 1EP4A 2XYHB 4MYUA 2KZMA 1XMQJ 2Q6CA 3HFKA 1QAJA 1PILA 2HVHA 4CLFA 1ZBTA 4QWCA 4PQUA 3IG1A 2HFZA 4QYZK 3FCHA 4OYMA 5A0YA 1V3SA 2Z8QA 2DR5A 4DSKA 4FF4A 1LK7A 3MMBA 4CNYA 3QNWB 1RAOA 2EEYA 3WIUA 2LLZA 2ATLA 1FJCA 1YIJS 2BEFA 4NRUA 3UD4P 1OPZA 1KC8T 4A8YA 2LDIA 3SIPB 1WOSA 3BYRA 4QBUA 4LSLB 5KG3A 4WFAQ 2PMHA 4V19X 2HVIA 5HP1A 1YJWS 1S6PA 2VG6B 5EN1A 1S1WA 1JWWA 1QJHA 3MEKA 3QAUA 3C8YA 4PWDB 1TV6B 2L9WA 2AJQA 2DHAA 4QR0A 4L3KA 3CMQA 4MMOA 3Q89A 3QGHA 2F8EX 1SJFA 2HRTA 2N7YA 4KE5A 3THPA 5CD4A 4BC7A 2ALYB 5KFEA 3P49B 1N36F 4GMKA 1TUGB 2NUUG 2VG5A 1T11A 4KBIA 2BYCA 3O2IA 1N54B 4U7CA 4J9PA 2DNKA 1RWNB 2LU2A 2A0FB 3KK3B 1U1LA 4DUTA 4ED5A 3KLGA 1S76D 1VQNS 3ZTQA 3FMBA 3WX4A 4C98A 4F4YA 2LCWA 2OPRB 2V94A 3EZUA 1U1MA 3CD0A 5A8KB 2LKZA 3AQPA 3HVWA 1BLUA 3HHKA 1R8BA 4OMFG 3VAKA 2DGUA 3IS9B 3R6LB 2FJXA 1RAEB 2HGNA 3BSOA 3QJLA 2DNOA 1NDKA 3DHXA 2VBYA 1QSLA 3RAXA 4AYBD 4JI0F 3RU0A 3P45B 4P9SA 3RYLA 4F67A 1M1HA 4RNFA 4V19J 1N32J 3D1QA 3POTB 3SXLA 3OBIA 2YNIA 1RCXB 3MCNA 3GIJA 3W9IA 3ZO7A 4Q44A 1GAOA 1QTNB 2BQRA 4YHHJ 3SDEB 2I5JB 4LR8A 2DGSA 2PI5A 3JQKA 1TZ0A 4HH1A 2JLGA 2F63A 3BPSP 3OHBA 4H4OB 2HVDA 5D3GB 1KRPA 2EKNA 3PVXA 2I5JA 1HR0J 1KVIA 1B0TA 1YX2A 2CQ4A 2NXCA 2V68A 3BB5A 1SJ4P 1RTHA 3GJQB 4NZ7A 1NCLA 2R8IA 3J7A1 5IT0A 2OPSB 2R42A 1TP7A 5LT5A 1G4CA 5EHHA 3PRVA 1N56A 2L9NA 4OLPA 4DQSA 2OSQA 2YWKA 1RAJA 2BJ3A 3PEHA 4WU3A 2KVIA 2P6TA 3W5XA 4EWTA 4YY3F 4K4TA 1G6BA 2W8KA 3VALA 2VKRA 2CQGA 3FBBA 3PG9A 5KFAA 5K14B 5L1JA 3OL6A 1R27B 2IPOB 2FY1A 3PNIA 1SJ3P 3CJSA 3EWGA 1X8DA 2I0XA 2CNLB 2NXNA 2W2QP 5KFNA 5EWGA 3WDOA 3PW5A 2XB2D 2A6MA 5KFLA 3UDVA 1EP4B 2MKKA 1RKIA 4F26A 2XSJB 4E98A 3HSGA 3HJFA 1EETB 3DU6A 5CYJA 1IN0A 4L72B 2UXCF 2WVEA 4CO3A 4QQBA 3D3BJ 3TUPA 4DI6A 2OPQA 5D0RA 4LF5J 3ZTSA 1NZAA 4RUAA 2KRRA 5CCLA 4AXIA 5CXTA 4EZ6A 4JYAF 1CJUB 4TQSA 2AJ0A 2AWZA 3KJQB 2QV6A 1JMTA 1OIAA 4ES3A 5HJXA 3H4DA 1YJ9S 3X1LB 2R7XA 1VQOS 3LP0A 5IT9Y 1KN6A 3AXKA 4CCHA 2HIQA 2RJZA 1GXUA 3Q24A 4U7UD 2FVQA 1NK0A 2IMWP 1NRKA 3K89A 2ZDOA 5HP1B 1EQMA 3Q2TC 3E01A 3DOLA 4ZCLA 4DV4F 1CLFA 4NXNJ 1F5CA 5IFMA 3EXCX 2E1MC 1RTJB 2HQCA 3NGKA 4LJMA 4IFYA 2RKIA 4P2FA 4MKVA 4OYIA 4PWWA 3TVYA 3KK2A 4QYZJ 2G9OA 1H7WA 3DRPA 1I1GA 1KTQA 3M2UB 2H65B 4KKOB 3G4SS 2Y1IA 2G1DA 5F9LA 1NB7A 1VQ6S 2RRBA 2DGWA 1F2HA 3H5SA 4LSZB 3SQGA 1IKXA 1UA0A 1AUSL 1Y11A 1HD1A 2HBZB 4YDDB 1VQ5S 1TL7A 3JAMU 1RABB 5CYMB 3TZXA 1EKRA 3EDRB 4QWEA 2CKWA 2FB0A 5DQGA 3KLEB 4C8ZA 3FGVA 4KQZA 5DM7Q 2ZUAA 3AODA 3FEYB 1LQ9A 4NLGA 2DY1A 1P27B 4ZHRB 2DRAA 1HNIB 4DL7A 1ROFA 2F8MA 1HBMB 4DF4A 1ZYQA 4FBUA 4JI0J 2AIRB 2P6SA 4LF6F 3MAHA 1TMJA 4ZPAA 3KFWX 4YQWA 4DFKA 2VODA 4EO6A 3CC2S 2H48B 3I82A 2VV5A 5B0DA 4OHZA 1SKWA 4YHHF 3IR7B 4HEA9 4OHXA 4BS2A 1KDNA 4WBFA 3E2EA 3CDBA 2NR0A 3PW2A 1N33F 4C9DA 2HW3A 1C0UB 4G1IA 2MKIA 1PBAA 1CULB 1NH7A 2GJFA 3MTJA 4X66F 2M8HA 2XMTA 3PRDA 4N76A 1NSKL 2HNYB 3MEGB 1UJ4A 4P2XA 4S0MA 1NKCA 4RW4A 4LFCF 3BEGB 4HH0A 2CJQA 3OL7A 4A8WA 3T1HF 4UQTA 4TLRA 2VL1A 4Y34A 5B7WA 5AJ3F 4LFBJ 3CJRA 4O44B 3PM9A 4RU2A 4DR4F 2YKAA 3H0PA 1GK8A 4FYWB 4NZ6A 5A8RB 3K5NA 3R5JB 4NEYA 5A2QY 3CCVS 1IBLJ 1LWCA 2GC8A 3P3DA 1RTDB 2V8HA 2UXBF 4Z37A 2D3UA 2EPIA 3BGOP 4ZLJA 4TU8A 3CCES 3Q23A 3QSYB 1FJEB 2R8JA 4WIIA 2EWHA 3RTVA 2BOPA 1T9TA 1NMEB 4ID5A 1XQIA 1U0SA 2YX4A 3AAWB 3G2XA 3M30B 4LR9A 2QRRA 3HD2A 1TL7B 1RB0A 1RHQB 4MFBB 4MJKA 3OFEA 3FEZA 1DY3A 2X3GA 4X84A 4DUZF 2I2YA 2UXDF 1BMQB 2KTQA 2DPIA 4C11A 4EFAC 2MHNA 4NLRA 4O3QA 5ETKA 1LXJA 2E9RX 2OEKA 1R6VA 3HI9A 3HHLA 2ZM6J 1CJVB 1T9WA 2H5JB 4JB8B 4OHYA 2V4JB 1URRA 4K50A 2OAUA 3M1VB 2YWWA 1IKVB 4PUOB 1TMMA 2ALZA 4WFBQ 4ZA1A 4WTYA 4KPCA 1ZS6A 2WCXA 1Q86T 4B9LA 1UPMB 2F4VF 2LQBA 3BKUA 1YRTA 1VS3A 4M5JA 4LIWA 4EZ9A 3L4BC 3UCZP 4DS5A 2PFDA 4Y2MA 5KT6A 2H1YA 2XS5A 1SKRA 2BW7A 4P2SA 1QAXA 2NZCA 3K17A 2LEPA 3KLHA 3AD8C 3IRXB 1SJRA 3M8RA 4NI2A 5J2PA 2Y9HA 3P6YC 4RR5A 3DDIA 2N3LA 1Q8LA 3A3OB 3A8KA 4Y2IA 5E3QA 2L41A 1SPBP 3HM9A 5KFZA 3BSCA 5KFUA 4FXDA 2M5YA 3M30A 1KHVA 4USKA 3VHQA 2A2CA 1BQNA 4ANCA 2G2OA 1WOPA 3ISZA 5CZVA 2F65A 3BBFA 5E0OA 4J9KA 4DR1F 4WXOA 1DAXA 4QU6A 2IMOA 4R5PA 3UQSA 1VI7A 2DKOB 3GQCA 3S01A 1N34F 4YB7A 1Q4RA 5A8WB 1EJ7L 4MKBA 2CADA 2P8IA 4TY8B 3ZTRA 1C0TA 2QJ3A 3VWSA 3EPGA 4RJVA 4DJBA 4X64F 1EZZB 2VU5A 3Q2SC 4H4OA 2QL7B 5M2RA 2GJ2A 2XCPA 1DTTA 5D3GA 2ACYA 1DFDA 1U1OA 4JP8A 4L75A 3JSBA 1SQFA 4TYAA 4RW6B 1NJIT 1M0SA 4P72A 4M5DB 4BBYA 5DDRC 2UUWA 1OJ4A 1S49A 1T9XA 2MDAA 3P5BP 3OLAA 4CT9A 5LXRA 4O3SA 2AEMA 1N5VA 3D0IE 4NX9A 3L09A 4OQJA 4IFYB 5J2PB 3PIPQ 5ADZA 4JI7F 2UXCJ 3W1YC 2GHVC 4WYWA 3M2UA 1H2TZ 2XG8A 2WK4A 3PTWA 5KFWA 2D3OR 1XTZA 2H9ZA 4F02A 1S79A 2V69A 2EFNA 3VGUA 1F9HA 2CQ0A 3DRYA 3IFEA 2WTFA 2JDJA 4J9MA 2YY3A 3IP0A 1NJWA 3NNHA 5HQMA 3D28A 2KYXA 1HNZF 2B0GA 5CH7B 1S9EA 2J8AA 3FQKA 2UUCJ 4KHRA 5KTQA 2KL8A 2UVWA 3WHIA 2UXDJ 3FK4A 4L73A 3KLGB 4W4MA 4WE1B 4E2FB 1MMLA 5F3ZA 5DG8A 2Z58B 3MTKA 3J81Y 3C15A 2CJXB 1IXKA 5J2QB 3EGNA 3IAM9 3PFOA 5CYQB 5BR8J 1S12A 4QW8A 4K4UA 1QAIA 4F7VA 4F0HA 2LU1A 3G87A 4PXBA 1Q1KA 3FVYA 4PAAA 2MSSA 2GMHA 3W8PA 1B7FA 1VC6A 2QFIA 2HNZB 1JJ2R 2X3DA 1OY6A 2AF6A 3QGGA 1XNRF 4NLQA 1RU2A 2XWYA 4GKKJ 3OLBA 4MYTA 2C2MB 4DL6A 6AT1B 4Q0BB 1SL0A 1DTQA 2H51B 3GSDA 3LGHA 3QATA 3T1YF 4DZ6A 2DGVA 2CWXA 3BKFA 1UZDA 1K73T 2IDLA 2DITA 2AJ1A 2AW0A 4WP9A 5F3TA 3UW1A 2DH8A 2DNQA 3H59A 4M5GA 2XMMA 3BO2A 3DRXA 4LF6J 5K8NA 3I87A 1KR4A 4ZOSA 3RB3A 1RT5A 1UFWA 2IM0A 4DS4A 2IVFB 4QR1A 3DOKA 3B6BA 4PYDA 2HURA 1HBOB 2D1CA 2X51A 3MMCA 4L3NA 2O5DA 4ED0A 2U1AA 2AYBA 3W3SA 2KVQE 1UWBB 2ZOMA 4FBTA 2AT1B 3ZZPA 2QL9B 4IH6A 4YFUA 4WZQA 4ZITA 4DR5F 2MQQA 2DNHA 2GFFA 1VQKS 4V1Ak 2RIJA 1REVB 2SXLA 1B70B 3K7RA 3MUMP 3M9OB 3DGPB 1WDDA 2DGTA 3GFYA 1EKSA 4NLTA 4NLPA 2WONA 3U1NA 2JVOA 3DI6B 2XMVA 4TVAB 1U6ZA 1Z2LA 4RBTA 4A46A 5KT2A 4DPXA 5C25B 2J9DE 2ZEJA 1IBKF 1JLQA 2HWTA 2KXFA 5D0GA 1RAFB 3SV3A 2G0JA 3QWPA 2KFZA 2W9AA 2IHR1 1Y10A 2BACA 3GMGA 1IR0A 4U67Q 2E5HA 5I3UB 2MKHA 3M8PB 2VA3A 4WZMA 4ZVGA 2E9TA 4QPTA 2HSEB 4DPWA 3GV5B 3MCSA 2UU9F 1FXDA 3JSRA 4IG3A 2CJ9A 1HBOA 3MMCB 4LBPA 2HAFA 2OEMA 2RNEA 4F04B 1GQEA 1NJZA 4Z7YA 1U8WA 1VRQC 4ZVOB 2XZWA 1RT3B 3GZ7A 3W9JA 5KFQA 3CCRS 3VGTA 5L39A 1HHQA 1Y3KA 2FZGB 4RBUA 4EEYA 2CPXA 2ZOGA 1RT5B 1UEKA 1AT1B 2MQMA 2RKIB 5LJ3Y 4TY9A 1YI2S 2ASDA 3MMAA 3N28A 4MKAA 3W64A 4AUKA 2CNNB 5A8RA 4EBEA 3TEHB 4ECRA 4X4RA 1BQMA 4DV1F 2KXHA 1M90T 4CO2A 1N5YA 5KFVA 1FCAA 1WWHA 2P9CA 2UUBJ 2P5VA 1WG4A 2J0WA 3M8QB 4AD6A 1ITPA 4FKYA 1WHYA 2VONA 2I38A 1LWFB 2BANB 4I69A 1DRZA 5F8JA 2W4CA 3ENAA 5T41A 2EBGA 1JNZB 4RO0A 3H4BA 2MZSA 2DR9A 3SZ2A 1KOHA 3S8SA 2QE5A 2WVBA 4BWMA 3OR2B 2VASA 4WP3A 2ZD1B 2OFGX 3ITHA 1ZTWA 3PKMA 2NUHA 4EUVA 2AYMA 3PKYA 2PIIA 2BVZA 4DFPA 3DRSB 1H7XA 5CQGA 3VZHA 2J0QD 4RW8B 1SH2A 2EKYA 2HQ3A 3H7HB 1PYSB 3HHLD 1U1KA 2FJAB 1R0CB 3MPUB 1YBAA 1FEHA 1RBLA 5I3PA 3G71S 3CJKA 4J9SA 4F2SA 2D74B 1MMDA 1LWCB 4F0KA 2L9DA 1RTDA 2CPHA 3JTPA 1OYEA 1TUVA 4IFVB 3EVMA 2BX6A 4OZ2A 3V6DA 1JXVA 2LQ5A 2LECA 3GTYX 5GMDA 3Q8QB 5E7OB 2XQCA 2IVYA 3GWCA 2DNRA 3GR1A 2VPWB 3HVTB 4U7UK 4DUYJ 4ZJLA 3RBEA 1U49A 3CJTA 2UV8G 3M6UA 2EC0A 1VHIA 3M6XA 1M5SA 2MQPA 2YWFA 3NWGA 3KHGA 1B0VA 3CO0P 4M5IA 3UO0A 5LOQA 2W9CB 1FWKA 1RA6A 3M2RB 1DZ5A 4IRCA 5KFCA 2OLWA 4I2QB 5I3QA 3G6VA 5FJ4A 4XPCA 5HQLA 4X4SA 4FS2A 3MM5B 2E7VA 2A2DA 5HLFB 3JXOA 4AQYF 2OEJA 1KBRA 3KTQA 1UEVA 4ZLLA 2HQGA 2MYFA 5HN0A 5HO4A 3BSNA 2AQ4A 1D9DA 1N52B 1KLMA 4I56A 5LMUF 3MOJB 3IWLA 4M5KA 2DXFA 2MQOA 4XTTA 3DMJA 5KFTA 2FGCA 1L3KA 2YWEA 5ETQA 4J9NA 3ICLA 5HMWA 3R6GB 3KJFB 3OR2A 2XY6A 4O3OA 4Z2XA 8AT1B 1RISA 3M1VA 5ETTA 1QD1A 2W7OA 4I67A 2CZVC 2GNKA 4C3KA 3D9BA 5IWAJ 3NMAA 2CQHA 2GIRA 2HNDB 4WFYA 1HWLA 2ILYA 4CLWA 3TP2A 4YB1P 2ATCB 2JC1A 5H9FK 1H98A 3MR7A 2MKJA 2V5HG 2ZH1A 4OYAA 2RUGA 4N56A 3O5TB 1FJGJ 1M5VC 2BKOA 4NLXA 3T1AA 2RRNA 3R1HA 1SVDA 1KP6A 1S0OA 2DH7A 3D6TB 4I7FB 2HQFA 3A4TA 3W2VA 3G8SA 2ZDPA 1H38A 1T02A 4OIXA 3MPYA 3HHNB 3KYLA 1FDBA 3HD1A 3CPWR 2PSZA 5G0RA 2IAJA 3TO8A 5GAGU 3F73A 4L76A 3FZ2A 2NSCA 4ZJQA 5M2PA 5T7LA 4ZCKA 2DGXA 2GMJA 3TQEA 1DBDA 1YBTA 1XMQF 3AA9A 4I2QA 4R0JA 1FFWB 2ZE2B 4HLBA 3QWUA 2C28A 2Q79A 4YEAA 2EC2A 3CE8A 1PYOB 2ZH5A 3RBDA 4KGVB 4RWWA 4KJIA 1RYSA 4J9QA 1D1UA 3R3TA 1X4FA 3FRYA 3HHLB 5LSLA 1RT4A 4DF8A 4PQUB 2W8LA 1K1QA 3W62A 3MPDA 3DLHA 3W60A 2JX2A 5T14A 1VK8A 2ZZTA 4LIRA 1RKJA 1DQ9A 2YPYA 1C1CA 2ZBIA 2OJ3A 1VRTB 3AJ2A 1RWUA 4CNZA 3IRWP 2JNJA 2FLNA 2V9KA 3DOLB 1MMNA 3SSRA 1UFLA 4FYVB 3ENVA 1SKSA 4OI6A 2VZ9A 2UP1A 2ADBA 5L9XA 1VIOA 5C24B 1ZM3A 4RX6A 7FDRA 1NK5A 4LQ9A 5FIIA 4GO5X 4O4RA 2C22A 2ZBRA 5IQ6A 4DR1J 4WPAA 2DXEA 2NREA 4ZPTR 5AT1B 2K3KA 4ILRA 5KFMA 3WBZA 2DHXA 3KLFA 3DLEB 1GMWD 2R7OA 2EFGA 4OZ5A 1NPPA 3MEDA 3PACA 1TKTB 2BE9B 4IRKA 5L1LA 1QUVA 1WF1A 3H42A 2DCUB 1F60B 3CVKA 5D78A 1T03B 2YKMB 1LWFA 2BABA 2BANA 1OPIA 2YBVA 2OTLS 1I51B 4H4MA 3KJNB 5H1SV 1Q8BA 1ACMB 1QSYA 3B4MA 2IRXA 5LSRA 2XM3A 1FRMA 4WK1A 3MAQA 5AE1A 4CI0B 4JI1F 4DX7A 3H2LA 4DOZA 2V50A 1RT2A 2CJYB 1HHSA 3C14B 5F8LA 3CDAA 3Q0AA 1NKEA 4G3IA 1KS2A 1UWAA 3V2UC 3SSSA 1UKUA 4HT5A 4GKJF 2M0GB 3HP6A 4UOCA 1FFGB 4X4OA 4DL2A 1F2GA 2D3O1 3PHEA 4DR7F 3MGJA 2KU7A 4ECQA 4ZVUB 1HNZJ 3PYDA 3CF5Q 3MM9B 2VG5B 2IM3A 3D1HA 5KFRA 1U1QA 4NEZA 1S57A 4RNNA 1FK9B 2W7PA 2DGQA 4NLDA 3KWMA 3T5KA 1NK6A 1HWIA 2MJNA 1JJCB 2BR0A 3SQGB 3FRZA 2NYHA 3NGTA 1N8RT 3DDNA 2J6UA 4C4WA 3W5ZA 4DG1B 2DRDA 1P8GA 3FBFA 5C42A 2CG4A 3Q8UA 3BR8A 1R8CA 4OI0A 1TFWA 2IRYA 1U8SA 1GMWA 1CG2A 1GMUA 2LMIA 4UOHA 5D4OA 3QYYA 4U8VA 3PV8A 2RF2A 3DKDA 3MM7A 4N7TA 1TK0A 2J5AA 1JLFA 4B3SJ 4OZ3A 1S4EA 1KFSA 1C4CA 3F44A 4PXEA 4UUXA 4OJ3A 1REVA
chains in the Genus database with same CATH topology
2X1AA 4IRDA 4XAKA 3H98A 2DCLA 3OHAA 1WF0A 3GIKA 5LMNF 2FPHX 1WHXA 3DOMA 4OI4A 5FLXY 2HNYA 3MEGA 1RT6A 3NS5A 3HK2A 1ZZNA 4KHMA 4ES2A 2ABYA 2XCAA 3WC0A 2ERRA 1VQ9S 1VGYA 1WI6A 4ZVHA 2Q43A 1S1WB 2GO9A 2J6SA 4QCLA 3LGMA 2QYCA 2D7SA 3CEDA 4MK9A 5BJRA 3NGDA 3QJJA 1TL4A 3LWLA 4XPEA 2F9DA 3MD1A 1YRXA 2FJVA 2OPSA 4HYKA 2LDYA 3DGPA 1J2VA 2NYIA 3R1LA 3TW0A 5D4PA 4CH0S 1SH0A 2F7VA 1KFDA 4FVMA 2RMLA 1NK8A 1FE4A 1OSCA 3QO9B 1OQ6A 1FDDA 2VFTA 3QGIA 2HHHF 2M7SA 5D4LA 2MY7A 1HWKA 1YWXA 1DQ8A 1S4FA 1VK3A 2JLEA 3DN9A 1JKHB 1VQLS 2FHOB 2CPZA 2XC9A 2APOA 2RDJA 2R8HA 4LF5F 1TKZB 2J6TA 3POTA 1RT2B 1XR7A 3I56S 4F3QA 3TQ1A 2V9WA 1GT8A 4ILLA 3TI0A 1FDNA 3K2YA 5KG5A 1KQSR 4ED2A 2IRUA 3IR5B 3IXQA 2DO0A 3C6UB 4PPDA 4TU7A 1U1PA 1WI8A 3OR1A 4FXWA 1NK6A 4NLOA 5EUHA 4PG8A 4NXNF 1JIHA 1Q8IA 2JL9A 5FDLA 4B3OA 3N5BA 4P7VA 5F0UA 4WFNQ 2ZJRQ 4HDGA 1SI9A 1OSDA 2ASYA 2HG4A 3HHEA 3I4HX 3KKFA 4HDHA 4O4GA 1JLCB 5HBMA 4B3OB 2CQ1A 3G8TA 3MR3A 4I6WA 5DO2A 2B4VA 2N82B 2R9LA 4EO8A 3BGLA 3N6NA 1R0AB 1P9QC 2L48A 3BGUA 4UQGA 2BJDA 3VAHA 3QIPB 2QA1A 4WJBA 3PIOQ 3OTOF 3O8WA 2K1RB 3M2VB 1R8PA 2VC1A 4PG6A 5LL6d 3CJ2A 1Y4ZB 4BWJA 5DM6Q 3DYAB 1K9MT 4DR6F 1TVRB 3F56A 1UJ5A 2K2PA 4C3MA 4M5DA 3OSPA 1VQYA 4I64A 5DG9A 2CQCA 4DSEA 1X4EA 2ZNYA 2UV8A 1Q7YT 2YWHA 4DWIA 3BN7A 5B0CA 1UA1A 2XULA 3WC2A 4CO1A 4Y0FA 2QEXS 4OHVA 4RW7A 1S6QB 2B3TB 4NLWA 4JV1A 4WFZA 2WHOA 5GMKa 5KG2A 2VG7A 2YQ3A 2ZKUA 2KO1A 1GXTA 4AXJA 1FE0A 2BQ3A 4DV2F 1YG0A 2IJFA 4XIUA 4X4NA 1ZTTA 2WBMA 3JTNA 4M8LA 1LFWA 2KB2A 5H9FJ 4ECZA 3GFZA 1ZPWX 2DNNA 1JXEA 2J7UA 1F5BA 3IRXA 4DLEA 5E3CA 4EBDA 1S6OA 1FRJA 3VTIA 3DLEA 3DC2A 1X9SA 1FKOB 5CD4H 1P6TA 3DM2B 4MAKA 3QZ7A 3CCTA 5AXKA 5KFGA 5T7LB 1M5PC 3GV7B 3TOQA 1N5SA 2KT2A 2KT5A 3BN4A 5DQHA 3MM8A 2MHEA 3HZEA 2BQUA 4RBVA 2WAQD 2PGCA 2JHEA 3V4IB 1ZOTA 3DRSA 2XMUA 1HNVB 4TU9A 5LXYA 4KV8B 3KMSA 2UUBF 1U4BA 1WEZA 4R8UB 3OJUA 3U02A 1X5PA 1YJVA 3CDEA 1S0MA 1N5YA 2IYIA 1VRTA 3BDEA 3IR6B 5F9NA 4GC7A 1H0HB 5FDLB 3CD7A 5EWFA 3NMRA 4KKOA 2RQMA 3V5RA 2EI5A 3CJ4A 3MEDB 1XWLA 1ZM2A 2LXIA 3DLKB 4IDKA 2K7KA 5DLFA 5D4NA 3CC4S 2W9BB 2CIMA 1BQMB 2XGQA 6FD1A 3D5MA 2B5JB 3HHDA 4K5RA 4ERDA 4LF9F 4X62F 2DNPA 2W7AA 2GHWA 5HMYA 2VFSA 3CCQS 2JEFA 3HPOA 3LP2B 3HX9A 1HBMA 2MPUA 2XGPA 5HROA 2OH2A 3DLBA 2MQNA 1X4HA 2V8GA 2YX7A 4DV7F 1BD6A 2PMZD 2ZH8A 2QLXA 5E5NA 2I8EA 2DPJA 1NHVA 3PX6A 1WELA 4DSFA 1HI0P 2YNFA 4DL3A 1U47A 2VPZB 3GFHA 4ED8A 1UVNA 4Y2AA 5F8HA 3NCPA 2F40A 4J5OA 5EX0A 1HYSB 3C6UA 4IR9A 3PXGa 3KK1A 2XBPA 4J9LA 4ELTA 1RTJA 4QIFA 3KLVA 1VRUA 4KV8A 2GO8A 3N0VA 1J5EF 2E5JA 2BA9A 5JXSA 1S97A 3LH2S 1RT1B 2CDQA 4X4PA 2VG7B 1Y7PA 2HHWA 1LV5A 1SJ1A 2AYEA 3IN5A 3PY8A 2IC3A 4FNIA 4QJVA 2KFYA 3W2VB 1MU2B 2K8GA 1TQLA 4HHJA 1VBXA 3NBPA 3QO9A 4DV0F 1HI8A 3CGIA 5AXMA 1IBMF 5KFXA 2MXYA 1FF2A 4I0WA 2EBEA 2ZHOA 1IQZA 5IWAF 4AL5A 1KVJA 2IM1A 4QWAA 2AGOA 1SQEA 4M95A 2HLTA 2UUAF 1TKDA 2R8KA 3LUYA 3H5UA 2L08A 2CJAA 3UD3P 2CZ4A 1LK5A 3EYZA 5L1IA 5THWA 5F41A 3G8QA 2IBKA 3HVAA 4IQXA 5C25A 4OI3A 2D9OA 1L5UA 2M70A 1VQ7S 4NLYA 4ECSA 2HMIB 4W90B 3RB0A 1K8AT 1ZETA 3FSIA 5B0BA 1VMBA 4X4QA 2XMJA 3LPYA 2UUTA 4O4GB 3I9ZA 1CC7A 2N4CA 2PA8D 4NLUA 2R7RA 3DRRA 2HHPA 2W25A 4H4KA 2ZM6F 4NRTA 3NAHA 4Y2KA 3M8SA 2VOOA 4IG3B 3NNCA 2EVZA 4NCAA 3HHLC 3J7Z5 4F3OA 2DH9A 2VQFF 3MMJA 3KLIB 2MMYA 4UUWA 4NWBA 4X65F 1X9MA 3UFCX 4EU0A 4I2PB 4ZP9A 3ZFVA 3TUJC 4A8XA 2EK1A 1G3OA 3U27A 3H40A 4HI2A 3SFGA 3FMWA 5KFIA 3IS9A 4WKRA 3OFFA 2LYVA 3QIDA 3OVSA 3NKYA 4RKUC 4Y00A 2Q1LA 4I1TA 2EK6A 1YJTA 3I5AA 3J7YU 5A6WA 1GNKA 3GR0A 4N77A 2HZCA 2WTFA 4LSNB 2BM1A 3WZ0A 1S1UB 3KJVB 3KHLA 3CCZA 2ZH2A 1SKRA 3PO4A 3T6JA 2YX1A 3DRRB 4QW9A 2H5EA 1HD0A 4USHA 1L3UA 3CDWA 3M8PA 3GIIA 2ZBCA 3Q8SB 2LQJA 2C3MA 2ROPA 4ZVEA 2HYIB 5EWEA 4OI1A 3UWTA 1LXNA 3R5AA 4GC6A 2KJVA 2N3OA 4QU7A 2AP6A 4K5SA 4IYQA 2Z2MA 4I2PA 4YR2A 3H2VE 2KT3A 3MECA 1S0NA 2XS2A 4IDKB 5HMXA 1BWEA 4TN2A 2C3OA 2NPFA 3TYTA 1S1TA 3ZZTA 2OPRA 3UPFA 2RT3A 4RNOA 1DLOA 4F3MA 2VFUA 5CA5A 1XK8A 4JI4F 3K5OA 1UP1A 1WHWA 5IM0A 5J2NA 1YSJA 4A8SA 1FRLA 1V6HA 4A4JA 5SZTA 4JV5F 1M1KT 2N7CA 1RA7A 5JUMA 5J2QA 1TKXA 1CVJA 1CEZA 4JUZA 1T8EA 2XSJA 3I0SB 5F8IA 4UY85 2B7CB 2PDAA 1KD1T 2EFOA 2I9SA 3CCLS 4DL4A 3DLGB 3HKZD 3T9NA 4N41A 2AU0A 1IJEB 2PN6A 2OO4A 4AFFA 1JLAB 4MIWA 3BJYA 1BGXT 2CRLA 5EX3A 2J0SD 1FRXA 2JVRA 3VCDA 4ED7A 3QPIA 1NHUA 4WXWA 3ONQA 3SMZA 3TA2A 3KHHA 3AJ1A 3N4WA 5BR8F 3R5DA 4B17A 3M9NB 2HNDA 4WF9Q 1K1SA 2CQIA 2CPEA 2B6AA 1UVMA 3J7YI 4D3GA 1JJ4A 3PW0A 1FKPA 2B56A 3DLJA 1GTEA 3C66A 4FF2A 3I4PA 2NXUA 1P1TA 3NBPB 3DU5A 3HKWA 2HHXA 4X4UA 1IKWA 3TR5A 1KLMB 1DLOB 3QMQA 2DRBA 4RNHA 1YHQS 4ED6A 2PO4A 3ISND 2ZH7A 3NG8A 2W9BA 2C2RA 2GJIA 1YJNS 4ED1A 3K5MA 4ZP6A <