2F9JA

3.0 angstrom resolution structure of a y22m mutant of the spliceosomal protein p14 bound to a region of sf3b155
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
RLPPEVNRILMIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA branch site protein p14
publication title Crystal structure of a core spliceosomal protein interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 26
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f9jA01
4RU2A 2CPEA 1M1KT 3NNCA 1WG1A 2DO4A 3MDFA 3U1MA 1CVJA 3CMAS 3UE2A 4V19X 1OWXA 2F3JA 3J7ZT 3MUTP 2XNRA 2KI2A 3CMES 5DDQC 2MB0B 4UQTA 1Q86T 4ERDA 2FC8A 2CQDA 2KFYA 3H2UB 2EVZA 3P6YC 2DNRA 2RU3A 1ZZNA 3CD6S 5H1SV 3OW2R 2MHNA 3I55S 4WCEQ 1U1OA 2WBRA 3SXLA 1WG5A 2B0GA 1G2EA 4TU8A 1U2FA 3IWNC 2YWKA 2XSFA 2D3OR 2DNGA 4TLQA 1U1PA 1URNA 2MKJA 1HD1A 3VAGA 2F9JA 4ZKAA 1K73T 3G6ES 2GO9A 2JRSA 3US5A 3G8SA 2J76E 3EX7B 1UW4A 2Q79A 4IO9Q 2L9WA 3CCSS 1QVFR 1A9NB 2E5JA 2DGUA 1HL6A 3UWTA 1VC0A 4Z2XA 1X5TA 3IRWP 1YJ9S 2MQPA 1X4BA 2MQLA 1D9AA 3SDEB 1M5VC 1DRZA 2MQNA 1RK8A 2PEHA 5GVQA 1W2BR 2KN4A 1P27B 2DHSA 1FT8A 3B4MA 4OZ0A 2FC9A 5DDOC 1YJWS 4FXWA 4C7QA 1RKJA 3MOJB 1WF0A 1QM9A 1HA1A 2LCWA 2CQ1A 5FJ4A 1BY9A 2MKHA 2MMYA 2MQOA 2XNQA 2QFJA 1KOOA 2AYEA 4F25A 2GHPA 3CUNA 1WTBA 1VQ5S 2MSSA 1P1TA 5ITHA 4CQ1A 2QEXS 4WKRA 3FEYB 3TYTA 2M70A 2I38A 4FXVA 2MY8A 2ADBA 1WF1A 2CPYA 4LMZA 2X1FA 2CPFA 2OSRA 2RT3A 5CXTA 1SXLA 2M0GB 3HHNB 1H2TZ 3CCLS 2U2FA 2E44A 3TP2A 2MJUA 3MUVP 1VQMS 3CCMS 3G4SS 2UP1A 2NZ4A 1WHVA 1U1RA 1YI2S 1VQLS 2OTJS 2DNQA 3DXBA 3NMRA 2L08A 4QU7A 4WFBQ 2ZJPQ 2CQ0A 2D9OA 1FJEB 5IQQA 1U6BA 3CXCR 5LXYA 2M8HA 2MZRA 2KXHA 5MLCV 2E5IA 4WIIA 1WI8A 2DK2A 2FPHX 4C4WA 2F9DA 5GADU 4YUDA 2KXFA 2DHXA 2KM8B 3THPA 1WWHA 1H2UX 2KG1A 3P49B 1UFWA 3MURP 2DGQA 3LPYA 5D77A 4OZ1A 1VQPS 1M90T 2G0CA 1DBDA 2BZ2A 2MKKA 3MUMP 2HGLA 3BO2A 1FNXH 3G9CA 2LYVA 2CQIA 2M8DB 5LJ3Y 3R1HA 1YJNS 4WFNQ 3UD4P 3Q2TC 2DIUA 2DH9A 2NLWA 5LJ5Y 2FY1A 3R27A 2DNMA 2XS2A 2XS5A 1ZH5A 3G8TA 2M52A 2XB2D 2K8GA 2AYBA 2DB1A 3J7YU 1WEXA 4BS2A 3VF0B 2YKAA 3SDEA 2HGMA 3ZZYA 1YHQS 1IQTA 3Q2SC 1WG4A 3NS5A 2DNZA 5D78A 2RQCA 3MD1A 1FJCA 3EGNA 1WHWA 1KOHA 3BEGB 3SMZA 2N3LA 3G71S 3CTRA 2M9KA 1UAWA 5GAGU 3VAIA 2LXIA 2J0QD 2A3JA 2YH1A 1SJFA 4IOCQ 1X4FA 4QPTA 1X4AA 2LMIA 1N88A 1WHXA 2I2YA 1X4DA 1N52B 1N54B 2DHGA 3K0JA 2DGWA 1A7GE 2N7CA 1JJ4A 4PRFA 1HD0A 2KM8C 4F26A 2JWNA 3HI9A 3VAMA 4Y00A 1DHMA 2D9PA 5LXRA 3MI7X 1SJRA 1YWXA 2OTLS 2DH7A 5EN1A 1R8HA 2DIVA 2HVZA 1NU4A 1ZZFA 1VQ9S 2DISA 4Y0FA 1JJ2R 2KRRA 2PE8A 2DNLA 3D2WA 3CCES 1Q7YT 3CCVS 5IM0B 1X4GA 2CJKA 4LJMA 3UD3P 2VODA 2MXYA 1VC6A 2KH9A 2ZJRQ 4CH0S 2KXNB 4PKDB 2RRAA 2LEBA 1FO1A 5GMKa 2CQGA 2RRBA 1VBXA 4J5OA 2V94A 5DETA 2LECA 5CYJA 2MZ1A 1VQ7S 5HL7Q 2MKCA 2VONA 2DGTA 3VAJA 4YOEA 2JVRA 5LSOA 1YTYA 3CCQS 4A8XA 3THTA 2MGZB 2DH8A 1Q81T 2AD9A 5LSLA 2DNKA 4PR6A 2ADCA 2AYMA 1R8PA 1YIJS 2DNOA 2E5GA 1X4CA 4QQBA 2BOPA 1VC5A 2M7SA 4F02A 2CQCA 5JVGQ 2DO0A 1SJ4P 2OSQA 2DGVA 3NNHA 1U1NA 2DNYA 2KU7A 5HO4A 3FEXB 3BS9A 4UY8T 2MZJA 1AUDA 5GAHU 1KC8T 2CPHA 3UCGA 2J8AA 1KQSR 1X4HA 2CPDA 1M5KC 4IOAQ 3U1LA 4C0OC 5BJRA 2RNEA 1NJIT 3S7RA 3S01A 3I56S 2DNNA 2MPUA 3P3DA 5DDRC 2MZQA 1S79A 2CPJA 2KHCA 1O0PA 1FHTA 2KVIA 3V4MA 2DNHA 4TU7A 2LA6A 1DZ5A 5IM0A 3CF5Q 5DDPC 2LEAA 2MJNA 2RS2A 3S6EA 2MZSA 4P6QA 5IFMA 2DGXA 3EGZA 1PO6A 1VBZA 1JMTA 3DLLQ 4LIRA 2EK6A 1B7FA 4TU9A 4U67Q 1X0FA 3P5TL 1SJ3P 1H6KX 1OPIA 3ZZZA 2KYXA 1VQ8S 3UCUP 2LQ5A 2DNPA 2DHAA 4YB1P 3R1LA 1L3KA 3N9UC 3CC7S 5CA5A 1PGZA 1VQ4S 1H2VZ 2X1BA 2CQBA 2XS7A 1SJQA 1X5PA 1VQOS 1U1KA 1M5OC 2MYFA 2ERRA 1F9FA 3BO3A 2MGZA 3RW7A 5DM6Q 2CPZA 3CC2S 2DGSA 3G96A 1YITS 2DITA 2MZTA 4W92B 2M2BA 1WI6A 5DM7Q 2AYGA 2RVJA 2M88A 2CQPA 2EK1A 1X5SA 1VBYA 1FXLA 2HZCA 2OIHA 1WEYA 2L41A 4CIOA 1N8RT 3VAKA 2YTCA 1KD1T 1VQNS 4EGLA 2LA4A 1S72S 3NS6A 2MKIA 4IUFA 3H2VE 3JB9k 5JVHQ 1X5OA 2G4BA 1FJ7A 2CPIA 1OO0B 2FHOB 3CCJS 2KG0A 2ZJQQ 2VOOA 1VQ6S 1WEZA 2KT5A 1WHYA 4WF9Q 5GAEU 3MXHP 1NO8A 3MD3A 3LQVA 1JJHA 3PIOQ 3VAFA 2RQ4A 3L3CA 1UP1A 3PIPQ 1X4EA 3UCZP 2MKSA 4W90B 2CPXA 1U1LA 1U1MA 2JX2A 1U6FA 2YH0A 2O3DA 4QU6A 3NNAA 2OJ3A 1WF2A 3BO4A 4M5DB 3VALA 2KRBA 3CULA 1VQKS 2MSTA 2J0SD 1D8ZA 2X1AA 2U1AA 2HYIB 2MQQA 1K8AT 2N82B 2HGNA 2CQ2A 1U1QA 2RUGA 1Q82T 3TO8A 2N3OA 2CQ3A 3CC4S 4WFAQ 3RW6A 3S8SA 1WELA 2K3KA 2CQHA 3CCUS 1K9MT 3B4DA 1XN9A 2CQ4A 1M5PC 3CCRS 2RS8A 1QVGR 2MQMA 2DGOA 3ULHA 2LXUA 3VAHA 1OIAA 2MY7A 2QA4S 2SXLA 2E5HA 2M4MA 4CH1A 2JVOA 2LKZA 2G1DA 4ED5A 2X1GA 3CPWR 2VOPA
chains in the Genus database with same CATH superfamily
5KFVA 4H4OB 4K2JA 3ITHB 3MECA 2FGCA 5KFXA 3MUTP 3CW2C 4CLTA 3DYAB 3N79A 3K5MA 3LALA 3OV7A 4OI3A 3UO0A 1S1XA 3BR8A 3OD2A 1FESA 3HDSA 3PJXA 2QSFA 1SKRA 4OJHA 4R8UA 4UT4A 1M5HA 4TLQA 1D8YA 1HBMB 2HQIA 3A12A 4MKBA 1HFEL 2VBYA 3US5A 2W2NP 2JEJA 1PBUA 4AQYJ 3KLEA 1IBLJ 1D9AA 2UXBF 2J8SA 2C22A 5GVQA 1NK8A 1RWXB 3MOJB 2F7VA 1HA1A 2K7KA 1BY9A 3OQ2A 2FHJD 3K5LA 3ZXWA 2QEXS 2I5JA 1RI7A 3G8QA 4P2MA 4XK8C 4IH6A 5A6PA 2DNQA 4ECWA 4F04B 2ZJPQ 1WC1A 4OI1A 3NCQA 5IV3A 2W4PA 2KXHA 2FPHX 3NGTA 3HSJA 1RAGB 3IAS9 1JXVA 1C1BA 3IMQJ 2EPIA 4ED8A 4F4ZA 3CDBA 2EKYA 3AB2B 1J5EF 2HGLA 4WFNQ 4BDPA 3SQGB 1T9YA 5LJ5Y 3LGHA 4IRKA 5D6GA 3ZZUA 1WEXA 1RU1A 3OVSA 1HNZF 4DZ6A 1KTQA 3EPIA 1FFSB 2DXDA 1FJCA 1J5OA 3W63A 1RXOB 4PXBA 4LFBJ 4YEAA 5D0EA 4ZVSB 4WBFA 3I87A 2PMZD 1Q5VA 4UF4A 2L9NA 3DKDA 5SZTA 2AP6A 4DZDA 1NPRA 3UN5A 1HHSA 2XYHB 5KFBA 4Q0BA 3CDEA 2M3DA 1ZAVA 3AA8A 5DG9A 2UXDF 1S9EA 4ILRA 4DCJB 3ENAA 3VWSA 4ECXA 3KJNB 3OUYA 2C3MA 1U02A 5DLGA 2FHKA 2FJDB 2UUAF 4P75A 1S6PB 3QGGA 2V94A 2R2RA 3N5BA 2PMHA 5KFLA 3NGKA 5ETLA 5LSOA 4LIWA 1YTYA 5LMUJ 2VUGA 2ZHBA 2OAUA 1G4CA 3GTYX 2DH8A 3HVWA 2Q66A 4I2QB 1EARA 1UTAA 2BOPA 1CJVA 3N01A 5KT7A 1SJ4P 2HBRB 2DGVA 2Q43A 3C6UB 3SEOA 1U1NA 1S1TA 2RB7A 3FEXB 4ZHRA 2E1CA 1U26A 1HWJA 4YMEA 3M9OB 1AZSB 1TKZA 5AXMA 5HN0A 5E41A 2BX6A 4NA3A 3S7RA 1FCAA 2EBGA 2H5IB 2KHCA 3V4MA 3FBEA 3HHLA 5KOWA 8ATCB 3DDNA 1JMTA 3R5BA 4I7FB 1X0FA 2FD2A 1OPIA 4QR0A 4FF4A 2N4CA 3GU0A 2GVZA 1VQ4S 4X4UA 4DQRA 2XY5A 3SSRA 4HL9A 2B9XA 3D1QA 2AYGA 2M88A 5AJ3J 2GGPB 2OIHA 2L41A 3H5XA 1KD1T 1XIQA 2BANB 3DDIA 2LA4A 4EGLA 4DU7A 3CO0P 2VOOA 1RWNB 4IH7A 1FKOB 1IUJA 2HFOA 1WOPA 1PAUB 1SI9A 4CTAA 3EPGA 4RLEA 3C8YA 4JBCA 4LFCF 4P10A 1UETA 1TV6B 4RW8A 3DOLB 5CYQB 2HQ3A 2BE7D 4WXOA 2NXJA 2R7VA 4RNMA 4F50A 3FBBA 3Q0AA 3I4HX 3OR2B 5I3UB 2FJXA 3I31A 3Q22A 4R0JA 4QIGA 1U0SA 4OQJA 2PC6A 2LKZA 3CNQP 4RPFA 1FD2A 2H4WB 3KUEA 1RT5B 2VASA 1MU2B 4ECYA 1KLMA 2ZM6F 3CMAS 4KV8B 2N7YA 3H8YA 1RHQB 4C3KA 2WVDA 2XNRA 1U47A 3H7HB 1HR0J 3FCVA 1LK7A 3OHBA 1Q86T 1HKAA 4FYVB 3W9IA 4C0BA 2XCPA 1X31C 1RTIB 4QYZJ 4DL5A 1S10A 4ZK7M 4FF3A 2XULA 1FKPA 4DV6J 3M30B 4DV1F 4M5DA 4NOHA 7FDRA 3TX0A 1YLXA 1HD1A 1Q5YA 1YZ6A 3TI0A 4B3SJ 4OJ1A 4C3MA 3UWTA 2WBMA 4LF4F 1YJ9S 1HNXJ 3FK4A 2W9BB 3KOAA 4YP3A 3RBEA 4UUWA 3GIKA 3R8YA 2QO3A 2VD3A 2P6TA 3F41A 4YY3J 2ZBPA 2LDIA 2CPYA 3MMJA 1KLNA 3QWPA 1K47A 3OR1A 3SV3A 3NBPB 3NKYA 4DR4J 1HNIA 5HVFA 3CCMS 4M5IA 2QA4G 1R7IA 1JNRB 1XR6A 1EETB 3B8HA 5F0UA 4J9VA 4AXIA 3H5SA 4RW6B 2R2UA 2GX8A 5MLCV 5HI7A 2D7SA 1PC4A 2C3OA 5J2PA 3EMTA 3GONA 3H4DA 3JQMA 4IOBA 2KG1A 3V2UC 4Y2KA 2V2ZA 1SUQA 2C3YA 1N4LA 1FNXH 3KHHA 5EUHA 3M32A 1VIXA 3UD4P 3IR7B 2NLWA 1KN6A 3J7YU 1Q8KA 2YKAA 4HVZA 1TL7A 3TX8A 2J0WA 3G6VA 3KDOA 1K0VA 1JLGA 2NXNA 3MM9B 4PUOA 4RWWA 2CJQA 5JJBA 3VZIA 4ZN3A 1Q8IA 2AZ3A 2N7CA 3KJFB 3MPUB 3M8ZA 2YQ3A 2Y0SD 1IBLF 2QZ8A 2OEKA 3IP0A 3TRGA 1W2IA 1U0HA 4D3GA 1W7WA 4KFBB 3TVZA 3FEZA 3U1NA 1VC6A 2J9DA 3KG0A 5GMKa 1T3OA 3JAMU 2F65A 1IR2A 1RT1A 3NG8A 5A8RB 5CYMA 2ILZA 2R7WA 2BOAA 1FRIA 3CCZA 4MTPA 2Z0GA 4J91A 1HMVA 2ADCA 4ZJOA 4UW2A 5L1JA 3FFIA 2I0XA 3TWZA 3KNAA 2DNYA 1QSLA 3DOKA 3J80U 1KC8T 4ID5B 2Y1LB 4CLWA 3ZTQA 1H0HB 4WKYA 4LFBF 3S01A 1MN9A 2VH7A 3KWMA 1FHTA 5IWAF 2ZH1A 2LEAA 3R7SB 1A6LA 4LT6A 4X4SA 3DLLQ 2HS4A 4F0HA 2QMWA 4IR1A 3OFHA 3BKUA 3P5TL 2C2NA 4OIXA 1E6YB 1LW0A 4CO0A 3JXOA 5ETQA 3GYNA 2EC0A 4P2XA 4Y28C 1NDKA 2ZUAA 4RJVA 2D74B 1RA7A 4ZLLA 3VAKA 1JLAA 3NLCA 1S72S 2RF2A 4UOFA 4KKOB 3VGTA 4FVMA 4KRWA 2HFNA 5F8NA 2ZOFA 2KT5A 2GA7A 2V4JA 4Q7AA 4WF9Q 1NZAA 3PIOQ 3F0NA 1JNZB 4B9MA 4DPXA 2KKHA 2MKSA 2CPXA 4DPTA 4P9SA 2V2KA 3HD2A 4X64J 4N41A 1W25A 3TARA 1JX4A 3NNAA 2OELA 3FBFA 3MEDB 4J9SA 4FDFA 1TAUA 3BM7A 4RNNA 1Q82T 3IGVA 3CC4S 2YKMB 1HYSA 4M94A 1RT4A 4NLXA 1QVGR 2DGOA 1QDUB 3VAHA 2FJAB 4PAAA 3FZBA 1SH0A 4U95A 2GMJA 1U45A 2V8PA 4C11B 1FVQA 2ZH2A 4LREA 1DAXA 3RRHA 4CZCA 3CJRA 3W2VA 3P5BP 4TY9A 2W2PP 3NWRA 3SCLE 2DVIA 3OSPA 5C42A 4ERDA 1RTJB 1RYRA 2AJ1A 3WZ0A 4J9QA 2EVZA 3PXGa 3CD6S 5H1SV 4OV1A 3IR6B 5DS7A 2ABYA 4ZPDA 3PRBA 1V9OA 5AJ3F 1S0OA 3VVTA 2KVQE 2ZITA 2D3OR 1U1PA 2GHVC 4UY85 3A3OB 3M2VA 1BQMB 4K59A 2GO9A 3EX7B 2Q79A 3OHAA 3KYLA 4ZMMA 4M5NA 1DURA 2AWZA 3T5LA 1T7PA 1FT8A 3H5UA 3W5YA 3N4WA 1TQLA 3AXKA 3H98A 1KOOA 2AYEA 2J7KA 4ETZA 1VQ5S 5ITHA 2Y1JA 4GC6A 2UVWA 4H4KA 1O8BA 2WSFC 1PAEX 2PI5A 3CO9A 2W7PA 2PGCA 3GJRB 5LT5A 2YWHA 1S1WB 2YNHA 3K5OA 3TJAA 5KFOA 1M5SA 1C4CA 3CJ5A 3OTDA 3SQOP 4OYAA 3D0IE 3HPOA 4ZLPA 5D77A 1YDLA 3TA1A 4ZPVR 1TMJA 2CKWA 5KT3A 3X1LB 4MIAA 1CULA 3G9CA 3TVKA 2XO6A 1WORA 4ED6A 1B70B 2DEJA 1PJ7A 3F56A 2IDEA 3HFVA 1Y4ZB 3RB4A 1LEOA 2HPUA 2R7RA 1NDLA 3F73A 2NSBA 3BBBA 1QSYA 3T1HF 5KFIA 1NB2A 3IWLA 4P73A 4G6VB 4DV6F 5T7LB 4N56A 2FJWA 3T5JA 3TEGA 4IFVB 1VIOA 4B3SF 3MZIA 2HHTA 3HLUA 1A7GE 1TUGB 4JV5F 4F26A 1HNXF 2V68A 2AX1A 2I1RA 2HHSA 4OI6A 4NMLA 2OTLS 3MGJA 3K57A 1XR7A 4LF6J 3L7UA 3IBFB 3DLEA 4OZ3A 5A0YA 4K4WA 3D2WA 4K4ZA 5KAKA 3MECB 1IXKA 4DR4F 3ZZRA 4DS4A 2LLZA 4QYZK 4MKAA 2QL5B 2VONA 3DU5A 1FX2A 3P96A 2NQPA 4YR0A 4BBYA 3A8KA 1RHJB 3THTA 5KG0A 5IOLA 1OS5A 3BQ2A 2B4VA 2O67A 5HVGA 3NEKA 1X4CA 2AU0A 3MF5A 2WB4A 1RWMB 2XY6A 2ZKUA 5AXNA 1RCXB 2FLOA 4P2SA 1FRKA 3HHLC 3N0VA 4C0OC 2UUCJ 5ETOA 2F5GA 2CPJA 3QPIA 3DU6A 2I5JB 3CF5Q 3EM1A 3FQLA 4LQ9A 2G2ZA 4ZJQA 1H98A 5D4OA 3P45B 4ELVA 1FNOA 2DHAA 1L3KA 1PGZA 1RWPB 4CT8A 1KSPA 2QX0A 5IZHA 4DX5A 4DR5J 1E6VA 3GV8B 1RAIB 4JI3F 2J6UA 3I5AA 4MK8A 3G96A 5F3ZA 2CQPA 4XIUA 1JWWA 5F9LA 4CIOA 4PZVA 3HVRA 2W7OA 3AFGA 4M63A 2CPIA 2X7IA 2KFZA 1TFWA 4M5KA 1J5OB 4Q5VA 2NR0A 2DR9A 1FXDA 4ZOSA 1Q78A 2JEGA 2P9EA 3O6QA 2AZ1A 3D54A 3GJTB 2HWHA 1NK9A 4JI2J 3N6LA 1AXQA 3Q8UA 3CULA 3GPAA 1RHMB 3I9V9 4PQAA 2XGPA 3D7SB 4BWMA 2IRXA 3C6TB 4CLZA 4WU2A 3HO1A 3ONQA 2XQCA 1NSAA 5H9EK 1OIAA 2ZD1A 2GMLA 2UUBF 2JVOA 4ED5A 2X1GA 5KFEA 1VCTA 4CO4A 4K4VA 3W62A 4K4UA 1OWXA 1NH7A 2HMIA 2AV5A 4Y2CA 3Q23A 2GQ2A 3FNNA 5GMDA 3Q8PB 2KYZA 3EDRB 3I55S 3R9LA 2C3UA 2QT7A 1TK8A 1U2FA 3GFHA 3AT1B 3HD1A 4QW8A 1JLCA 4ZHRB 1C1CA 2VICA 3BPSP 1TKZB 1IKWA 2PDAA 5K14A 2QTWA 1YJWS 2WVBA 1WF0A 1NPPA 2B43A 2MKHA 1OY8A 2VG7B 4MYUA 1XMQF 4AT1B 2GHPA 4OZJA 2CADA 3EVMA 3I9ZA 1O5JA 1S99A 2NUUG 1YRTA 1R8CA 1R31A 1Q0NA 5DG7A 3R97A 3G82A 3UR3C 3FKBA 4U7UD 3FQKA 1RTHB 2GVZB 2GAGC 3TA0A 1VQLS 2L08A 1PYTA 3KNGA 2CQ0A 1RDRA 3IA0A 3C66A 3RBXA 5KFGA 4GKKF 4QR1A 1S6QB 2CVIA 5U47A 3DRPB 5KOXA 3SBMA 1WD6A 4X4VA 3LWLA 2IM3A 1NHVA 3LPYA 3CJ3A 5B7WA 2AEMA 1KQGB 2BACA 2RKIA 2XB2D 3KK1A 2RIJA 3NS7B 3GFZA 3ZZYA 2D3O1 1QUPA 4RBVA 3KLHA 4JV2A 3NS5A 4KO0A 5D78A 2RQCA 3QRRA 3KLIB 4I4BA 2XLJA 1WHWA 3AAWB 4CTAB 2LXIA 3E3XA 1EIYB 3EGVA 2UZAA 3I96A 4IOCQ 2YKNB 3WHIA 1FNMA 4JI4J 1UWAA 2IM0A 4B9LA 4I67A 2E9ZA 5KG3A 4HDGA 2DH7A 4KC5A 2ZZNA 2LQ9A 4ER8A 2ZEJA 2DISA 3D1OA 3MEEA 3VQTA 1HI8A 2E1RA 4CT9A 3MR2A 1KLMB 1Y7PA 2BKNA 1J2VA 2VODA 3UD3P 2V67A 3AD9C 4NYOA 2KXNB 2BE2A 2KL8A 4HT5A 4Q2LA 3EYZA 2J9EA 5CYJA 2H54B 1N6QB 4NLRA 4ZITA 4YOEA 2IBKA 3M2RA 2VJVA 2QLBB 3HXMA 3MHYA 3QGPA 1GX6A 1R8PA 3WC0A 4DX6A 1N32J 3DLGA 3R5DA 3OXGA 2PIIA 5J2NA 5C2GA 4DSJA 2EFGA 2MZJA 1WKJA 4HT7A 3BH7B 5DLFA 3BJYA 5BJRA 2D3ZA 2MPUA 4JI6F 2UU9J 2DNHA 2OFHX 2XHCA 1TK0A 2NUHA 4NI2A 1BQNA 4EYHB 4ZIVA 2JOQA 3S6EA 2MZSA 7AT1B 1HNIB 4OZ2A 1SQEA 1N33F 2WVEA 2VBWA 3W5XA 3LTOA 2FHMA 3G2XA 8RUCA 1I94J 1KDNA 1MNEA 2CG4A 2OPQA 1N5VA 4TKTA 2ERRA 5J2PB 4KPCA 3BO3A 1FVSA 4LF6F 3FGVA 3WIUA 4PWDA 1RISA 2EK1A 3KHGA 1UEUA 4CM0A 3M32B 4ELTA 3A8JA 4ETXA 5HLFA 4IUFA 3GIRA 4QPXA 3CJKB 2ZJQQ 3MM8A 4XAKA 4K8RA 1WHYA 4Q2MA 1JLGB 2YNFA 4R25A 4LBHA 3ISNC 1BMQB 1X4EA 4ES3A 1U1MA 1U6FA 1R6VA 4FBTA 4KTQA 2OJ3A 1WF2A 5HJXA 1R8AA 4QIFA 4ALZA 2VG6A 1K8AT 3PZPA 4NEYA 3B82A 2HNDA 3TUZC 2KJVA 2CQHA 1OJ4A 2UUCF 1KEKA 4DU8A 1GK8A 4M95A 2FTRA 2SXLA 3RUBL 3OFEA 1YK9A 3NNCA 1WG1A 3PG9A 1JKHA 2ATLA 4F2SA 5D8HB 3AQPA 1NAQA 4DF8A 1SC6A 3NP5A 1UEKA 1RT1B 2VQFJ 5DZ6A 3H2UB 3VR1A 4RUAA 3DNCA 3QIDA 1RABB 2GAHC 3TUJC 2QC3A 3QAUA 2UVVA 4LR9A 4OHYA 5HANA 3TQ1A 3DFEA 2BXJA 1ZTTA 4I6WA 2ILYA 4DR6J 2HW3A 1K73T 3QWUA 4WE1A 3O8WA 1A9NB 3DOKB 2L9WA 3E01A 1CS4A 2B6AA 1LKZA 4RO0A 3PJWA 3BGFA 2GZOA 1X4BA 3M8QA 5F41A 2FLPA 3BZQA 3AJDA 4H4KC 4FS2A 5D0HA 4J9UE 3HP6A 4JI2F 2CFXA 1L3TA 4OHWA 1ZAXA 2BEFA 5KFCA 1PJ5A 3UDCA 1SXLA 3AHPA 1VQMS 2BUNA 1LW2A 3DLKB 3W60A 4WZMA 1IN0A 1RWUA 2A1BA 2L48A 1F2GA 1FJEB 2V8GA 4B3TJ 5KT4A 1RT7B 3Q86A 4C4WA 1CJUA 1OY6A 1BQXA 3L9ZA 2DRAA 3RAXA 2KXFA 2KM8B 1NJWA 1MWZA 2RAQA 3HJFA 2CJXB 1HBMA 4C2MA 2EW9A 1SL2A 2DR6A 2K8GA 2V4JB 1TL1A 3PYGA 4QWBA 3ZZ0A 3IM8A 4I0WA 4X4PA 1CC8A 1IWGA 2FLNA 5B0BA 1KOHA 1U7LA 3BEGB 1H73A 3CTRA 1IM4A 2ROGA 2V2VA 1A0OB 4M5MA 5K9FA 4QCLA 5L1KA 1R0AB 4A4JA 1N52B 1TELA 4DUYJ 2UUWA 3K0JA 4OI2A 3HF5A 4DR1J 1HYSB 1DHMA 3MI7X 1WDDA 2VDIA 1RT4B 2KTQA 3C19A 4LF7J 3TQEA 3RBZA 1ZZFA 1VLYA 2YX7A 3RB6A 4K2XA 1S48A 1GQEA 1X4GA 2XMTA 3SQGA 3JQJA 2XCAA 1FX4A 1RKIA 4HH0A 4B9UA 4FP9A 5C42B 2JFDA 2Q6CA 3D4JA 4NLWA 1VQ7S 2GS8A 2LDYA 2HNYB 2IVFB 1C2PA 1JXLA 1WC5A 5AXKA 5LSLA 2XG8A 4J37A 5IV4A 2O66A 2C2KB 3M2VB 2H65B 4DV7F 1BUXA 5JVGQ 5EX0A 3NNHA 1B0PA 3AODA 1RADB 5L9NA 3V4IB 3U1LA 1UVLA 1JLEB 4OYBA 2PFFB 3AXMA 5DDRC 2ROEA 2Y9HA 2BW2A 4IKAA 2PD1A 1I1GA 1DZ5A 1NHUA 2W9CA 4NXNJ 1S6OA 1PO6A 1R0CB 4JI4F 4OX7A 2FHJA 4C8MA 1S6PA 4V1Ak 1JXEA 2CZ9A 2DNPA 2YNHB 1F5CA 5CD4H 1AFJA 1QTMA 2HHVA 4CO2A 1WKLA 2ZH3A 3O2IA 2HS3A 4ECVA 2OMLA 4FNHA 2DD8S 2E1MC 1VBYA 2JHEA 2JEIA 4KQZA 4OHXA 1CULB 1HQ2A 2R2TA 3WC2A 3C6UA 1VJWA 1RTZA 4KJIA 4ZVQB 1VRTB 4NXMJ 1LOUA 2BE9B 1WEZA 2HHQA 2JZ5A 3TNVA 3GG1A 4Z7CA 3VAFA 1EHWA 2FDNA 1ZPWX 2QL7B 1U1LA 3RZAA 2VFTA 2KZMA 1LFPA 4QU6A 3W61A 3CT9A 3R2CJ 4LF5J 2EI5A 2J0SD 1D8ZA 1HARA 1BWEA 2Z4PA 3CIMA 2N82B 1B0TA 4J9MA 4HDHA 4OMFG 3W8GA 2FJVA 1NNDA 3ULHA 3K8WA 2UU9F 2DR8A 2GGPA 1X9MA 2J7UA 2FUG9 2Y1IA 5J1EB 2QE5A 4E0DA 1PJ6A 4WP9A 3DCAA 2B8PA 2IYIA 1FKOA 2B56A 4JP8A 5F0WA 3DRRA 4AL7A 2DYAA 1ZZNA 2E9RX 2YXLA 1FRLA 3OW2R 4X2BA 2ZBRA 3DMJA 2WBRA 3HFKA 1F1BB 2B0GA 3DOLA 2MKJA 3FBCA 2QMUB 3K7RA 2LU2A 5CYQA 3PX0A 1D9DA 3G8SA 1T8EA 3CCSS 3TZXA 4I1TA 1HL6A 1KNZA 1VC0A 3QIPB 1RTDA 2H4YB 2MQ8A 3OR2A 3FRZA 2ZUGA 3SDEB 2PSZA 3I5BA 3OT9A 2B7CB 5DDOC 1KKHA 3NAHA 2ASJA 2MSSA 3IS9A 1RT5A 2HSEB 4Y3CA 1X60A 2OSRA 3V6HA 2M0GB 1WHVA 4N8OA 3GE9A 1E6VB 1KS2A 1XWLA 3HMJG 1RTIA 1DQ9A 1SH2A 4DI6A 3I0SB 2B5JB 4UOHA 1JLBB 3M30A 3HKZD 4PQUB 2DTJA 5FDLB 3WDOA 1MMNA 1CC7A 4NRUA 2HHXA 5ETRA 2ACMA 4Y2AA 4FYYB 1PBAA 4DHVA 5F8JA 2M52A 3CCTA 2GO8A 2VQFF 4OX9J 1SKWA 2W9BA 4CWBA 3VZHA 2VKRA 5E0OA 3MD1A 3OVAA 4OV6A 4WYLA 3SMZA 2EWHA 3CD7A 3G71S 2M9KA 1UZDA 3FMBA 3W64A 5KFTA 3NBPA 4DR6F 1N88A 4N7TA 1TU0B 1FWPA 2OKQA 1X4DA 4FKYA 2BJEA 1YRUA 2OUGA 1KBRA 4DR7F 2ZD1B 1OMSA 1P6TA 2BKPA 3GZ7A 3ILLA 4Y0FA 2JEFA 2A10A 2ZBCA 2R8KA 4FYXB 1FERA 2HMIB 1PYOB 4OYWA 3QSIA 4USJC 3RR8A 5DZ7A 1GH8A 1VBXA 1S1VA 1LV5A 5CH7B 4EZ9A 5F8GA 3T5KA 5E3RA 4P7TA 4B3TF 2W4DA 1WKKA 4PG6A 4U8YA 3MM9A 1Q81T 1ZOTA 2DNKA 2UXCJ 4IRDA 1HNWJ 3MFHA 3JTPA 1UA0A 1VC5A 4F02A 3GLJA 1VQSA 3DGVA 1RAHB 4OHVA 2HK3A 1N34F 2JH3A 2CPDA 5K14B 3CDUA 2VBZA 3VVUA 1X9WA 4LSZB 2CNKB 2IHR1 3PX6A 3ENQA 3LANA 1J5EJ 4KFBA 3MFIA 2RS2A 1L3SA 2C2RA 3TVYA 3G82B 3GYGA 1YJ7A 4DUYF 3ENVA 5M2RA 1F5BA 3ZZZA 3NGUA 1VQ8S 1S7HA 2WW8A 5THWA 3GIIA 2LQ5A 2ZWPA 3EZ5A 4NASA 2XS7A 3M8PB 2RU9A 4LF7F 1NK7A 1T0TV 1NZ8A 4W92B 1IBCB 1WI6A 4NLSA 5D0RA 1CQMA 2HZCA 2ZE2B 3OL9A 3WQPA 2JLEA 2JDJA 3NS6A 3LP0A 5C25B 4ID5A 3KLHB 3TUIC 4H4MB 4ES2A 3CJ0A 1NO8A 3DN9A 4DPWA 4Q43A 2UXDJ 3LF0A 2BQUA 1BHNA 5GMEA 1Y3JA 3D68A 1RCOB 2KRBA 1YGYA 1JJCB 1E6YA 2LFVA 1CBKA 1FFWB 4DS5A 2ZVIA 2RUGA 2QL9B 2FIUA 3W9JA 4KY3A 4JB8B 2MEWA 1M5PC 1DLOB 1UW9A 3Q89A 2X3DA 1REVB 3MEEB 1FJGF 4B08A 1S4FA 3U1MA 1CVJA 2BE2B 4LRBA 2HVHA 3IBCB 2FGOA 4ILMA 1NHKL 1Z1ZA 3J81j 1Q8BA 4NZ7A 2AJ0A 4I68A 3M2RB 3P6YC 4F2RA 2NPFA 3NOGA 3KLGA 2APOA 2FVRA 1EKSA 2ZH5A 2V5HG 1IKVA 1XMBA 1U1OA 1ZPVA 1G1XA 1WUUA 4E2FB 2DNGA 1URNA 4WFYA 3ET6B 3VAGA 1DQAA 4KHPF 3MEDA 3PR4A 3MMBA 1QVFR 1NCLA 2VKZG 1FRMA 2XMAA 2HHUA 4BWJA 4Z2XA 1S6UA 1IKYA 2MQLA 4JV1A 3QRPA 3D1HA 1U25A 3N5FA 3UNGC 4B3RF 4R5PA 5HP1A 3HZEA 1MMLA 3V6DA 1BQNB 2CYYA 2F40A 4CP5A 4DN9A 1T9TA 2E7WA 4JV0A 4RW7B 4LFAF 4LF5F 1GX5A 2CPFA 4F67A 2U2FA 3TP2A 2MJUA 3DI6B 3G4SS 2RE1A 3GMGA 3HHDA 1RTJA 4XPCA 4WK3A 1Z4UA 4ANCA 1WI8A 2DK2A 3QO9A 3PVXA 4YUDA 3POTA 2DHXA 4QYRA 3THPA 3TAQA 2YWWA 1UFWA 3MURP 4MT1A 4MIWA 1SB6A 5GAEI 4URSA 5HLFB 3H20A 1RAEB 2HG4A 1BQMA 3BO2A 2LYVA 3PY8A 5FIIA 1Y5NB 2YWEA 1FD8A 2WONB 1BC6A 1YHQS 3RRKA 4TLRA 2O01C 1S9GB 3IO1A 2G2YA 1C4AA 2VV5A 1FRJA 1RAOA 2GJ2A 4CLUA 1WC3A 5A2QY 2CDRB 3UN2A 3PTWA 3BGUA 1UL3A 1NKCA 2VG6B 1IVZA 2BJ7A 2HNDB 1JIHA 3IAM9 4NLQA 2JWNA 2HK2A 3VAMA 4JI5J 3WIVA 3KKFA 4N76A 4MJKA 4F0MA 3AQOA 4YS2A 4DV1J 1RT2A 1VQ9S 2AJQA 1QAJA 3U02A 3OSNA 2HHWA 1VS3A 2A2DA 1AW0A 2GCFA 2OPSB 2H9ZA 1AUSL 2OFGX 2XHWA 4F0KA 4I69A 4LF9J 1HBOA 4HKQA 3MAQA 2P6SA 5T7LA 2DNOA 3PRDA 1YG0A 4IFVA 3I4PA 3OBIA 1CS4B 2B6AB 2I9SA 1H7WA 3WBZA 3DM2B 4OX9F 5CD4A 3M8QB 4FN5A 3W7BA 2VIHA 4NLTA 4L3NA 5EDWA 1XJWB 4NCBA 2K06A 3IXQA 2IJRA 4DSEA 1OQ6A 1HWKA 2ZH4A 2RQKA 3D66A 5JMNA 4BHQA 3PW5A 4KPYA 1RAAB 1VBZA 3H40A 3BPDA 4TU9A 1LW2B 2RUSA 2W1BA 4HLBA 1VRUB 3T1AA 2J9DE 1CJUB 1YBTA 1T05B 4G1QA 3OTCA 4FYWB 4HHJA 3AD8C 2BA9A 4QIVA 2M2BA 1EKRA 2RVJA 2ATCB 2FZCB 3TZWA 1N0UA 1XNRF 1R27B 1N8RT 4L74A 2XMVA 2YTCA 1VBKA 1TL1B 4ZCKA 1UWBB 2C2EA 3BSOA 3FUYA 4Y65A 4OFZA 2CNOB 4LVOP 4E8UA 1O6XA 1U09A 1JJHA 5HROA 4HTJA 5FLXY 3L3CA 2UXCF 1HNWF 1N5QA 3L95X 3D6MB 2XI2A 4J7CA 3Q83A 1GXTA 3GB0A 1UJ4A 2X1AA 4BC7A 2IC3B 4D3HA 3A4TA 5A76A 4MK9A 3MM5A 5AE2A 1F60B 1XN9A 2LQBA 5RUBA 3IG1A 2QA4S 5DJBA 4DSKA 3L09A 4ELUA 2C28A 3HT3A 1FFGB 4B3MJ 5DDQC 4UQTA 3BGLA 3QFWA 2VF3A 4P74A 4ED2A 2V6AA 1WOSA 3S1TA 5IWAJ 1K1SA 3QT7A 3HJVA 4XPEA 1RQ0A 3GR1A 4HH1A 2HBQB 1G2EA 2YWKA 1DJ0A 1T3NA 1KQKA 2XC9A 3WX8A 1NJZA 1KVIA 3GSDA 3T9ZA 5ADZA 1KRPA 2PO4A 2QMXA 2ZWOA 1C0TB 5BYRA 3C6TA 3UR0A 4ECRA 1M5VC 2JC0A 3FCHA 3EVOA 2IAJA 2NS1B 4C7QA 2NXCA 4B17A 4KYZA 1WACA 4J9OA 2XEXA 1P1TA 1YSJA 2W9CB 4ZPBA 2NPIA 2ADBA 1RJJA 2EC2A 2CNLB 2E44A 4A8SA 3KG4A 3O44A 5HSPA 2BJ1A 1GAOA 3RR7A 1FXRA 2W24A 4RW4B 3AOBA 2WK4A 1UFKA 2YNGA 1CSJA 1T94A 3OPKA 4JI1F 3M6XA 3LW5C 1PG5B 5AE1A 1URRA 1P9YA 2IIHA 4WJBA 2GQCA 2WOMA 4NA2A 3VF0B 4CRJA 2C3PA 4EI2A 2V4QA 4U6PA 2ZHAA 1KQFB 4ZVPB 3D0HE 1H7XA 2VG7A 2FVSA 2DHHA 4YN3B 2NREA 1OYDA 4JUZA 5B09A 4LBIA 1LWCB 2VPWB 5I42A 1SJFA 2HBZB 3GR0A 4Y6IA 3A3PB 1LWXA 1RTHA 1NBEB 1XBWA 3MEGB 4DCPB 1KFSA 2E9TA 1Q4RA 1CJTA 3RU0A 4L73A 5G4DA 1S6QA 1UVKA 3DRPA 1SJRA 1CJKA 3M2UA 4WWSA 3Q8VA 5EN1A 3IC1A 1XMOF 2IA6A 5K20B 2RHQB 3RRGA 5IM0B 4PXEA 3MMAB 3PYFA 5BR8F 2KH9A 3KK3A 4PG4A 4ZCIA 1KONA 3SYZA 2VQEF 1QY7A 2UVRA 2Z2YB 3DRRB 3F44A 1TFYA 3KLIA 3FRYA 3CCQS 2JSXA 4A8XA 3DMJB 2K7JA 4HHUA 2E5GA 2NXEA 1R8BA 2YKNA 4QQBA 3BGRB 2R8GA 2VBXA 4FF2A 2KU7A 2F63A 4UY8T 1RTDB 2ZZTA 5J2QA 2DXEA 4NCGA 2VPZB 2F8HA 4EMDA 2QJ3A 4PPZA 1XTZA 1KR4A 1TKTB 3CVKA 1GMWA 4PYAA 3C15A 3I82A 4J9KA 3IS9B 2LA6A 1SVDA 1ZBTA 4EO6A 4ECUA 4E98A 3V6JA 1ZTWA 5DGAA 2EK6A 3KLVA 3KLFA 4NLOA 2GVDA 4LF8J 1KWMA 3MPVA 1N6QA 3IR5B 4JI5F 1H2VZ 3ZNUA 4ILLA 1X5PA 1VQOS 3T1HJ 2Z58B 4EBCA 2QYCA 4C8YA 1IKXB 1YITS 2MZTA 1X5SA 2COLA 3CCWA 2XBPA 3UVJA 2DRDA 3MPWA 1RWVB 4JV5J 4UQGA 4WFZA 3MR6A 4ED1A 4GKJJ 4ZPTR 3UNYA 2BRLA 4LF9F 3Q8YA 2KZZA 2ZBIA 3BYRA 1FRHA 2R7XA 5C24A 1NSPA 3D6TB 1KVJA 2ZBQA 1RA6A 2N4DA 4FS1A 4ZVEA 2JX2A 2YH0A 3VCDA 2VL1A 1QD1A 2MSTA 1UVIA 4J90A 2CJYB 3ZFVA 2V0NA 1U1QA 2IA0A 5KFMA 5D4NA 3S8SA 1U6ZA 4Q45A 4JI7J 2YWFA 1I5OB 4DEZA 3W65A 2LQ8A 2M4MA 2G1DA 3A8IA 4C8KA 3MOZA 3CPWR 3PKYA 1BXNA 4URQU 4TYAA 3PNIA 3ZTOA 4PYDA 3MCMA 4KGZB 3CJKA 2CAJA 1EQMA 1S1VB 1S1UB 2Y1RI 2DEIA 1NSQA 4GVLA 2BJ3A 2H51B 2ZH8A 3PYDA 4X66J 1QAYA 2OP5A 4Q44A 4LQ3A 2VA2A 3H42A 4AD6A 3DLHA 3CJQA 1UW4A 1CPZA 3QYYA 4QW9A 1S49A 4QWEA 4JI3J 4WIQA 2W01A 2MQNA 3PEHA 4FXWA 1R89A 1VOMA 4RNFA 5FJ4A 3C2PA 1AB8A 3JSMA 5H9EJ 4B9VA 1NSKL 4RU9A 2XZDB 4UUXA 4F4AA 3GWCA 4PPDA 4DV5J 3HHNB 1H2TZ 3M9MB 2HRYA 4NZ0A 3NMRA 3NMAA 4LR8A 4PXDA 3M7VA 5IQQA 2M8HA 3UW1A 2GC8A 4YB5A 1TL4A 4NYZA 2OMOA 1B3TA 4O3OA 5F8LA 2YQ0A 3KXDA 1VQPS 1M90T 2L9DA 3MAAB 5B0FA 3T6BA 5LJ3Y 3LP0B 5AXLA 2ZH9A 2GMHA 4HYKA 2XS2A 1M1HA 2LQJA 4B3MF 4KHMA 3RGIA 3L4BC 2HRTA 2GJFA 3RBDA 4DOZA 3T5HA 2UUBJ 1L3VA 3DRYA 1VJQA 1QTNB 4KB7A 4C8LA 2RMLA 5L46A 3CDWA 3PM9A 1TP7A 4DDFA 3THVA 2J6SA 4JI0J 3DLKA 5D0GA 4LSLA 5HQLA 1HD0A 1UJ6A 2P9CA 5LXRA 2E5LJ 1RT7A 2CZVC 4L76A 2OHDA 2DY1A 4TYBA 1HQUA 4XTTA 1NU4A 2AIRB 3M1VB 1V5VA 4K4XA 4KGKA 1SL1A 4PWUA 4CNZA 1Q7YT 1HBUB 2PA8D 3RJMB 3CCVS 4P72A 3PW0A 1T11A 5L8RC 2GJIA 5CZXA 3MM7B 4HHHA 2YKQA 2NZCA 3J7A1 1KP6A 1XR5A 1XERA 3KLGB 3K58A 1UPMB 4ZPCA 1XMQJ 1IKVB 2BRKA 4NMXA 2BQ3A 1DTTB 1W26A 2HWTA 3CJTA 3CE8A 1R0AA 3MMBB 3DGPA 2B9EA 4ZVOB 3EXCX 5HO4A 1FDAA 1NB7A 1SJ1A 4GKKJ 3HK2A 1IKYB 1OQ3A 3FMWA 3Q8QB 3K8VA 4R5PB 5HP1B 3C46A 1FK9B 3EDQB 3V6DB 3CWJA 4PG8A 4G1IA 2KVIA 4ZN1A 4F3MA 4K5RA 2MJNA 2A6OA 1V3ZA 2DGXA 3GIJA 3EGZA 4WP8A 1OSCA 2QN6B 3QFHA 3W3SA 3AOCA 3H2LA 1Z2ZA 1T9UA 1SC4B 3D6HB 2HNYA 4LSNB 2AJ2A 2UVUA 2VG5B 3QO9B 3LH2S 3POTB 1U8WA 2CPZA 2DGSA 4GVBA 2EFNA 1O51A 1WC4A 3FZ2A 3J7YI 1IQZA 4DSLA 4LR7A 4TQRA 1ZETA 1HI1A 2ZDPA 1N5TA 3JB9k 3JS9A 2NYHA 3HHKA 3V4IA 4KR0B 4IQMA 3ZTSA 1LXJA 4EBDA 3TA2A 1JLEA 1HWLA 5JUMA 1UMJA 5KFSA 2LVWA 3V81B 1JQGA 4DFPA 3UCZP 2FJEB 2WHOA 4ZIWA 2AEJA 3HHEA 3H4BA 4WXWA 1BLUA 1BE4A 3T1YJ 4ZLNA 2W9AA 1SCJB 2IYGA 1TMMA 2F8EX 3LP1B 2Z8QA 3EZOA 1NPKA 2VZ9A 3CCUS 3MM6B 1RT2B 1LNQA 4CYUB 3A13A 1IBKJ 4DSFA 4IFYA 3SI8A 3QMQA 2DO4A 3JSYA 3I5CA 3UE2A 4NCAA 2Q6BA 4WTOB 1RZMA 4V19X 1LFWA 1VRTA 5KFHA 1QAXA 1D1UA 4LF8F 1Z2LA 4Z37A 3RG6A 2MB0B 2CNNB 1HQEA 4DF4A 4O4GB 4OI4A 3SZ2A 1UJ5A 4JI6J 1HBOB 3FCWA 3IN5A 3EWGA 2EFQA 4KH1B 1RP5A 1VK8A 1HW8A 1N33J 3HULA 2NYIA 2A0FB 3G6ES 4J9PA 2V9WA 4DX8H 3GIMA 2E5JA 2DGUA 3J81Y 1WDTA 4GKJF 2MQPA 3QQCD 1H38A 2ROPA 4O3SA 3V5RA 2LCWA 1FE0A 1Y0HA 1OYEA 2ACYA 3BF4A 1WTBA 1ZA1B 5AE3A 4DL6A 4WKRA 4GC7A 3FEYB 3MR5A 3FSYA 1WF1A 1UFLA 3NGDA 5J1EA 4XO0A 3CSKA 4C8OA 5KTQA 1F2HA 5KT2A 1N48A 1RBLA 3PRVA 1U6BA 5LXYA 3MWBA 3PEJA 3I6PA 4U9RA 5IXUA 4JI7F 4G1QB 2C2ZB 3OTOJ 4IG3B 1WWHA 3EVWA 4AYBD 2DCLA 2DGQA 5D3GB 1ULRA 3AY0A 4DQSA 1DBDA 3OFFA 1Y10A 2C1EB 1FI4A 1UVMA 3RAMA 3Q8RB 1ELOA 2HQDA 2BW7A 4OZ5A 2DPIA 2CVEA 3QIPA 2AYBA 3SDEA 2ALYB 5KT6A 1Q16B 2WVCA 4UOGA 5HROB 3O5TB 4XDDA 4WYWA 1HW9A 3DRXA 4X66F 1MWYA 4ZA1A 5HMWA 2UV8G 2J0QD 5J1NA 4FPIA 4FPRA 2QLFB 4F36A 2DT9A 1IBMJ 1Y9OA 4C6AA 2PT0A 3M8RA 2B4OA 2Q3PA 3D28A 3H25A 3MM5B 1VHFA 4DV3F 5T41A 2RDDA 4JI8J 3I0SA 4M8LA 3UFCX 2B5JA 5A8KB 1JLBA 3IG1B 5T14A 4PQUA 2ZH6A 2YVSA 1HHTP 2KDOA 5FDLA 2MLXA 2K2PA 3W9HA 4LJMA 4KAIA 1AFIA 1Y5IB 4KGXB 4DV5F 2HHPA 4MK7A 2E1PA 4RZRA 4PKDB 1S77D 4K0KJ 5HVHA 4F8RA 1X0PA 2XWYA 3H59A 4J5OA 2E29A 4QIEA 3FSIA 5HQ8A 3HKWA 1T03A 1Y5LB 5CAAA 3BKTA 4CLYA 2ZNYA 3LWMA 2XMKA 2AQ4A 2HQGA 2AGQA 3OVBA 3RYLA 2KB2A 4IR9A 7FD1A 3T3FA 1GTEA 4QIWD 3C14B 1HHQA 4RUBA 1F6TA 1X4HA 2IAJB 3NL0A 1TL5A 3MCOA 1N5SA 2XMJA 3PW4A 3GFXA 2X3GA 4P7VA 2M5YA 1FDDA 2W2QP 3JSRA 4OX6A 2XO7A 2JJ4D 4IQXA 1S4EA 3MMCB 1ZM4A 1B7FA 3BV8A 4JI0F 3KTQA 2R7TA 4GO5X 4IDKB 1F3VA 3FJ2A 1S59A 3H5YA 5CA5A 3GV7B 2HFSA 2E5LF 2IM2A 1Q95G 5B0GA 5GAHI 2Z30B 2O5DA 3RW7A 3CC2S 2IDLA 2YNGB 2FZGB 2MDAA 1GMWD 3RB0A 1X5OA 4F4YA 2YKOA 4KE5A 3JTOA 4A8WA 1HBNA 3CCJS 2WOMB 2DPJA 5KFDA 1MLAA 1GEHA 2AX0A 2PMWA 2RILA 2OD6A 4RUCA 4KBIA 4W90B 1QUVA 3R7BB 5I42B 1RT3A 5DGBA 3KMQA 3A8EA 3KK2A 2FY8A 4F7VA 4ZCLA 1ZAWA 2XSJA 2HYIB 4ICLB 1CJTB 1K0TA 5C2CA 4WFAQ 3M8PA 1CJKB 3SFGA 3M2UB 2EG1A 4FVCA 2FVPA 1TUVA 3PHEA 2ZE2A 4DV7J 2VOPA 4RU2A 1V3SA 2AEFA 2R7QA 4QWCA 1JK9B 1X8DA 3MDFA 1EP4B 3KK3B 2B8QA 5A6WA 2C2OB 2YQ1A 4NYPA 3GJQB 5C25A 1N36J 4S0MA 4H4MA 4ZDNA 2F4VJ 1VDHA 3BSNA 2MHNA 3CJ4A 2CRLA 3LAKA 5CZVA 3ZO7A 3KUGA 3IWNC 4J9RA 4NLYA 3QBCA 2ZZMA 3W2WA 1H74A 2A6MA 1T9WA 1XEZA 4IO9Q 2VA3A 1RGVA 5SUHA 5J2QB 5KFZA 4NCGB 3QAEA 5KT5A 4FBUA 5EHHA 4FF1A 3JTNA 3I0RA 2KN4A 1YJVA 1DLOA 2DCUB 3GJSB 4DLGA 5HMZA 2FC9A 3ENWA 3C15B 1REVA 1JLQB 4TXSA 2FLLA 3BN7A 4LMZA 1YJUA 4DV4F 1WC6A 3KLFB 2GVDB 1Y00A 1IWAA 3T1YF 3R6GB 1U1RA 2JC1A 4DR3J 1ITPA 2YNIB 1RSCA 3NXZA 3CDAA 4ECQA 2YX4A 4C9DA 2E5IA 4WIIA 4F3OA 2IM1A 3DHXA 1K1QA 3HVTB 4OLPA 4ENOA 2HVEA 3R5JB 1IBKF 4I64A 1R43A 3UVJB 4OX8A 1SH3A 2JLFA 3BBCA 4P71A 1TKDA 3ET6A 1DFDA 4ECTA 1U48A 4EEYA 4ZP8A 1YJNS 3QJJA 5BXIA 4IH5A 2K1RB 2DB1A 1OSDA 1S0NA 2DR7A 3Q2SC 2CZ4A 1MROA 5C24B 2HRUA 3TEHB 4ED4A 4RW7A 2ASYA 4FZVA 1TZ0A 1N0VC 2MLYA 3C16B 1X4AA 3DI6A 5B0DA 3ICLA 1T02A 2ZHOA 5MAOA 5L1LA 4OZLA 4O3PA 3ZZTA 4N8NA 1YJRA 1I51B 2KM8C 1QE1B 2HVDA 1RWKB 2D9PA 3QRQA 1F3FA 2J5AA 4IG0A 5A8WB 2ASDA 3SIPB 2XYPB 3EZUA 1JJ2R 1PSDA 2R7SA 5G0RA 4CH7A 4TQSA 4QOTA 5DQHA 4YDDB 1AA1B 1RLCL 2ZJRQ 2RRAA 2WONA 4F3QA 1GNKA 2I8EA 3VV2B 3EICA 4CLFA 1S9GA 2QA1A 3MPDA 1J27A 3OTOF 2O1PA 2DY9A 2EFVA 1YZ7A 3UDLA 2RDJA 2P2CB 3HZGA 2G9OA 4YB6A 4EFAC 4X62J 5IT9U 4YQWA 4MFBA 3PW7A 2DO0A 3R6LB 4DN0A 5HK4A 1DQ8A 4N5SA 2MLZA 2WSEC 2AJ4A 4A8OA 3L7OA 1TKXA 4BC9A 3M8YA 1S79A 1DTQB 3JSMB 3UQSA 2D3UA 5L9XA 4HACA 4TU7A 4EZ6A 4ANDA 2RH3A 5K8MA 5DDPC 3DDKA 1SL0A 3K17A 1B99A 1IBMF 2VC0A 1MSWD 2OPSA 1FRXA 3UD5A 3D5MA 1SJ3P 3KJVA 2BQRA 4NEZA 4C8ZA 3TANA 4AQYF 4JI8F 3CGIA 4IRCA 1SC3B 1U1KA 3OL7A 2KHDA 4ECSA 4O3RA 2DITA 9RUBA 5B0EA 2CJAA 1FXLA 1JLFB 1WSVA 5ETSA 2OPPA 2AF6A 4MMOA 3DM2A 4K0KF 5D15A 2R9LA 5LOQA 2XZWA 3AA9A 1RAJA 2W4CA 2E7VA 4DR7J 3TZYA 5F8IA 3QJLA 2R4FA 3O3LA 3LUYA 1GMVA 5F9NA 3FVYA 4KSEB 4DFKA 3G6YA 2W2MP 1FA0A 3BO4A 4OLOA 4L6V3 3HCXA 1IJEB 1F9EB 4PXCA 4CO5A 4LSLB 1TAQA 4Q8EA 1VRUA 5L39A 3OFGA 3BH6B 1HQUB 1T05A 4ZVRB 4DMZA 5EGYA 3U7JA 3BR9A 4MYTA 4GO7X 2FB0A 2EFPA 1RHUB 2XI3A 4OZNA 4DX7A 4ID8A 5EWFA 5IT9Y 5DQGA 3OL6A 1UWBA 3KDNA 1N34J 2Y0BB 2WCXA 4W4MA 3QLHA 1C0UA 2DR5A 2OD4A 2DNRA 2RU3A 3NRBA 4KGVB 3DRSB 2R2SA 3T6JA 2V8HA 4L75A 3SXLA 1LWFB 3DOMB 4TU8A 4WP3A 5F8HA 2XSFA 2HNZB 2HHHJ 3DGPB 3AD7C 3BDPA 2P5VA 2IC3A 1YKWA 2Y3YA 4LF1A 3LP2A 2RSQA 3GCWP 3R5AA 5KG6A 3BQ1A 4I2PB 2W25A 4AL5A 1RK8A 3GP9A 1P27B 4OZ0A 2B7BB 2EBEA 5KFFA 5LMUF 3SSQA 4MH8A 3QNWB 1VK3A 4F25A 4O3NA 1P9QC 2I38A 3ZC4A 1SIZA 5CXTA 2AHOB 2BMBA 1H72C 4AXJA 4QU7A 2XY7A 4K7QA 2MZRA 3JAMY 1LWEB 2UV8A 4YHHJ 4GVBB 1KHVA 1FDNA 3BQ0A 1NUEA 3PYEA 2I6WA 1TVRB 5LSRA 1LXNA 3ISZA 1NJXA 2M8DB 4HI1A 2DIUA 2FY1A 2XS5A 2XLKA 3QZ7A 4PG7A 1N36F 4O44A 1C0TA 5K5MA 2XGQA 3ILOA 2F4VF 2H3EB 3VGSA 1U2CA 1HIYA 1WG4A 3J80Y 2DXFA 3EGNA 2Y8WA 3IRXB 4LRAA 1FJGJ 3BSCA 1MMDA 2ZOMA 1NK4A 4CLKA 3VAIA 3E8OA 2MHEA 5IS2A 1B4SA 3QJPA 2YH1A 3OJSA 4X65J 1WHXA 4ES1A 2XYGB 2OH2A 2CA9A 1N54B 1F5AA 4OYOA 3LO3A 4DG1B 4J9NA 3ELHA 4FNIA 5E3AA 4RW4A 2ZNZA 1YWXA 4ZVTB 5CQGA 1PC5A 3GCXP 1N56A 4B9TA 4B02A 5HATA 4IFYB 2POKA 3HX9A 4A8KA 1GXLA 1XC9A 2WZ1A 4KHPJ 1LQ9A 1NK6A 4I6YA 2CJKA 2MXYA 5GAGI 4DR3F 1HQEB 1RT6B 4ECZA 1IJFB 4B3RJ 3JYTB 2R8HA 2EG2A 4URGA 2B4PA 4U96A 2MGZB 1LWCA 4LFAJ 1YBAA 1HPZB 4ZPAA 5F3TA 4C98A 5B08A 1X9SA 2H5EA 3MEGA 2XMWA 1OPZA 2G13A 1AUDA 5GAHU 4FYDA 4OYZA 3IGNA 1V5IB 2OGUA 1HR0F 1EAYC 3FSXA 1NJIT 3VHQA 1L3UA 3I56S 5LM7E 3BB5A 1O0PA 4USHA 1HNVB 1NXIA 1D9FA 2HLUA 1S7IA 5IM0A 1NK5A 3MMAA 3QT5A 4P6QA 2QGFB 3QSYB 4HEA9 1RBAA 4WFXA 3CJSA 4LIRA 2Y8YA 1H6KX 4OJ3A 2IPOB 2CJ9A 3N9UC 3CC7S 3CJ2A 2YWGA 2G0IA 1SPBP 1M0SA 5E5NA 2Z2LA 5J2MA 4TNOA 2QA2A 4KIAA 3BGRA 4YY3F 1ZS6A 1FTCA 2CWXA 3IBWA 1OO0B 2KG0A 1PKUA 2GIRA 2CUYA 4Z7YA 3MXHP 5LMNJ 1TKTA 1V6HA 1S1XB 1RHRB 1UPPA 5ETMA 3HSGA 4K50A 4R8UB 4RKUC 5KFKA 4X62F 1U4BA 3QZ8A 4G3IA 3LGNA 3A3NB 4ZVFA 3KLEB 4Q8FA 2G1HA 2YY3A 3PFOA 2HZAA 1IKXA 2HIQA 2RS8A 2LXUA 2JL9A 2C2DA 5E7OB 4JOUA 2CPEA 3M6VA 3EGWB 2WRMA 5JXSA 1RBOB 4EWTA 3M05A 1U24A 2JFKA 2F3JA 5HAOA 4RR5A 4WPAA 2ZC3A 1ACMB 3AJ1A 1UZHA 2KFYA 1NKBA 2GIQA 3HFZB 4DPUA 1T03B 4F4KA 3GSIA 3SSSA 4ZS6A 3UN3A 3CJ8A 2V69A 4WCEQ 4L72B 1C1BB 3CIZA 4B3OA 1WOOA 3NY0A 4JYAJ 4LRCA 2F9JA 5CABA 2PN6A 5EX3A 1WC0A 2OLWA 3MTKA 3HHLD 4V19J 2ZVSA 4EUVA 4KH0B 3D67A 2AW0A 3B4MA 3K5NA 3KFWX 1EJ7L 5FD1A 1D09B 2XLIA 3JSBA 2MQOA 2QFJA 1XNRJ 4DUTA 2M70A 5CCMA 4FXVA 3EUNA 4EK2A 3LOUA 4DQQA 5IT4A 2ASLA 2NZ4A 1S1UA 1AROP 2AT1B 2OTJS 2IY5B 4WFBQ 5IC6B 4Q0BB 3CB4A 4BCAA 1S97A 2VFVA 5HQMA 5D4PA 2F9DA 3D6FB 2D1CA 3ETOA 1QJHA 1S9EB 2G0CA 4RBUA 2BZ2A 2MKKA 2W8KA 2CQIA 4A8YA 3Q2TC 2W2OP 1HBNB 2QLJB 3OUYB 5J1PA 1EZZB 4DUZJ 1TUWA 3MTJA 1SV5A 1ZH5A 3HSZA 3ZZPA 4A8MP 2B51A 1NLKL 2FYXA 1UAWA 1RT3B 1QSSA 3KK2B 2HHHF 5GADI 4QPTA 1CJVB 3GG0A 2XSJB 3V6KA 4DCOB 3G6XA 1S1TB 2FQQB 1JJ4A 3T19A 4F4XA 3CD5A 4QJVA 3LAMA 2VJUA 1XQIA 3KHRA 2YPZA 4NLGA 4ZP9A 1VI7A 5L1IA 3B54A 3D3BJ 2DIVA 2GIFA 3UDEA 1HWIA 2KRRA 2DNLA 3HHLB 3M6WA 3MAAA 2R7OA 4RW9A 1HLWA 4X64F 4CH0S 8AT1B 2LEBA 2HAIA 2HQCA 2FVQA 3TJ9A 2RRBA 4DSIA 5DETA 4CLLA 5HL7Q 3VAJA 1SBRA 4YHHF 3R3TA 2IMOA 2D69A 2AD9A 1HI0P 2Z2ZA 4PR6A 4RBTA 2ZDOA 4RX6A 3W2WB 1ZM9A 2IJNA 4C48A 5DO2A 2OSQA 5L38A 5KFWA 4DV0J 1RUSA 3BS9A 2NSCA 3K5PA 4XDCA 1S76D 2IRUA 1T9XA 4ED7A 4YR2A 1KQSR 3I0RB 2V8DA 1WSRA 3GV5B 1PILA 1K44A 4IOAQ 3TAMA 2YPYA 1TL3A 5IT0A 2HBYB 3M1VA 5IC4B 5A2QU 3BSAA 5AT1B 1UVJA 4C3LA 4JI1J 1HBUA 4G1PA 3ADAC 3K59A 5IFMA 1EQ0A 2QRRA 4X65F 4RW8B 2H1YA 4USKA 1TTHB 3MM7A 3CD0A 2Z56B 3HSDA 2VHGA 5HMXA 3UCUP 4C0HA 4RUHA 3UPFA 3R1LA 1FWKA 2CQBA 4X4TA 3TR5A 1R3NA 2FZKB 5E33A 2GHWA 2PA3A 4PWWA 5HBMA 1DTTA 4AUKA 4U7UK 4ZVUB 3B78A 5DM7Q 2RQMA 4LUBA 3EXYA 1VQNS 2IVYA 6FD1A 2MKIA 1FJ7A 3M4XA 4L3KA 2GV1A 2G2OA 2L3MA 4USUA 5E3PA 1VQ6S 3D9BA 4A46A 2HWIA 1MROB 1XMOJ 1FK9A 3LQVA 3B6BA 2RQ4A 4TY8A 4QR2A 1UP1A 1VGYA 1FKPB 3T41A 2RRNA 3PV8A 2HIYA 4CO1A 1Q8LA 5BR8J 2IMWP 2LXFA 4UTGA 1XNQJ 1APSA 4M5DB 1SC1B 4NE9C 2VQEJ 1VQKS 4AL6A 3ILIA 2HAFA 5KG5A 4LSNA 2CQ3A 3RW6A 2VG5A 1WELA 2GQQA 2K3KA 2RJZA 4NPOA 4UOCA 4IG0B 1DY3A 1FF2A 3CCRS 4RNOA 4ZPWR 1FEHA 4CH1A 3H90A 2Q1LA 5G0RB 4NLDA 1JB0C 4M5LA 3X3UA 1M1KT 3DHWC 5KFAA 5CHCB 4A8FA 3OR1B 4MIBA 4DJBA 3J7ZT 5E3CA 4P52A 2GW8A 4M1KA 9ATCB 4RWXA 2A18A 5KFQA 2NXUA 1T95A 3BREA 3I32A 5KFUA 3V81A 1UKUA 3RTVA 3DLJA 2X51A 4X4OA 3H0PA 5B0AA 1SUQB 4MFBB 3QATA 1S0VA 2V2QA 4AFFA 2PFDA 1YVFA 4O23A 1VYAA 3J7AN 2J76E 2HKEA 1RYSA 3LP1A 1X5TA 2RD5C 3A1YG 1DRZA 5LMNF 3VTIA 3MM6A 1TKXB 5FLXU 1TL7B 2YBVA 2KT3A 1RKJA 1RLDA 1QM9A 4CYUA 4A8QA 5KG2A 2XNQA 4HACB 5ETNA 2OPRA 4PUOB 3IM9A 2IJFA 4UZCA 4I56A 1NH8A 3KJVB 3M8WA 4O4GA 2KT2A 5K8PA 2BKOA 1N5YA 3BKFA 2HEKA 5HMYA 3VGVA 2P9GA 4USMA 1FTRA 5M2UA 2W7AA 1IM6A 3EJMA 4OZ1A 1U0HB 2OPPB 2ZC4A 3NGSA 1GT8A 3MUMP 1R6YA 3R1HA 3ZTRA 3NAIA 4CDIA 1VRQC 3AOAA 4DQIA 2DNZA 5H9FJ 4W98A 4NWBA 1G7CB 2F1FA 5CYMB 4DR5F 3ISND 2UUTA 2BABA 3PHTA 2N3LA 5GAGU 1HMVB 2WAQD 1D3WA 4JYAF 4NZ6A 4LVNP 3FFIB 2LMIA 2VFSA 1WNEA 5DRKA 1D0EA 2I2YA 2V50A 2QG9B 2OEJA 2DHGA 1UVNA 4PRFA 2V9KA 4U8VA 1RE1B 2WSCC 3VGUA 1NDPA 4IG3A 2IVMA 3P4UB 3MCSA 4DBQA 3AB4B 1CLFA 3OLBA 4AE5A 1GXUA 5D3GA 1SQFA 1HWUA 1I3OB 2HQFA 4NLPA 1NMEB 4H4OA 5ETKA 2V8VA 3ITHA 2AGOA 3R7NB 1FO1A 2CQGA 2IRYA 3QLHB 2H5JB 1C0UB 4X4RA 1LW0B 2QLWA 3DYAA 2AGPA 2AMCB 2JVRA 3O1LA 2AKWB 2QFIA 3TAPA 4EBEA 4DQPA 1ROFA 4DL2A 4B9NA 1YIJS 1GMUA 3QT8A 2M7SA 1MG7A 1WTFA 1JLAB 1F0XA 2E7XA 4IO1A 2RF2B 4DUZF 3LP2B 5K8NA 1M5KC 5A8KA 1IR0A 4FKXA 1Q79A 2DNNA 3T9NA 4USTA 4DWIA 2PI4A 1Q53A 2VC1A 1XK8A 2KO1A 1VISA 1WJ9A 3TUPA 4K4TA 4U67Q 4EYIB 4A48A 2KYXA 1Q1KA 3QGHA 3FDSA 2HURA 1SJQA 3P8BB 4Y2IA 1UA1A 1F9FA 3FC9A 3SFUA 4F4WA 3ZTPA 4MKVA 2BJ9A 6AT1B 1WEYA 4ZP6A 4ZP7A 1NJYA 4EU0A 3IWXA 3N6MA 3TZZA 4DR2J 5CCLA 2C2MB 2HFVA 4K4SA 3W5ZA 5JVHQ 4OYXA 4O44B 3C14A 2FHOB 4USWA 2VFUA 3W2VB 3W1YC 4USVA 1VQYA 3K89A 5K8OA 4IYQA 3M9NB 2YX1A 2D41A 3PIPQ 2HFZA 5D4LA 2XMMA 3MMCA 4FXDA 4O0IA 4DV0F 4IDKA 4LF2A 4NX9A 1SKUB 3LPEA 1EB0A 2N3OA 3OJUA 2BM0A 1MN7A 2CQ4A 4G65A 4DL3A 5DG8A 4N47A 3EE3A 4M5GA 1PIEA 2BV3A 6FDRA 1GTHA 2VU5A 4C97A 4KT0C 2C42A 4QWDA 2CXEA 2VB6A 2CQDA 4OJGA 3TJ8A 1SIWB 2DJWA 1U49A 1CQNA 1NM2A 2ZH7A 3PFEA 1SKSA 1F9HA 4I2QA 5ETPA 1WG5A 1MWQA 4O0NA 4DV2J 2F4FA 4ICLA 1SQGA 2VDHA 3IRWP 3MR3A 2PEHA 3R5GA 1AZSA 1W2BR 2DHSA 3ZNJ1 3MPYA 4YR3A 4CI0B 4PG5A 2MMYA 2R8JA 4LBPA 3CUNA 4MKYA 3J7Z5 4P2FA 3UI3A 2K3IA 4N77A 1EP4A 1XNQF 2ZOGA 2RT3A 1I6JA 4ITSA 1N32F 3BDEA 2WTFA 3TOQA 2H48B 4WU3A 4I7FA 3DXBA 4PCQA 2NCKL 3CXCR 1T9VA 5KFPA 2DRBA 1FDBA 5I3PA 5J2MB 5GADU 1Y11A 3SCJE 2FVCA 3P49B 3DLEB 3C3LA 5A0YB 2E1AA 5E2QA 2HLTA 2QIFA 3CEDA 4BLGA 2BANA 2DNMA 5ETVA 3NGRA 3G8TA 1RWOB 4BS2A 2HGMA 4U7CA 1IQTA 1I94F 2J0XA 1ZYQA 3RB3A 4DL7A 3E2EA 3MEKA 2HVIA 1JLQA 1YRXA 5KFNA 4OL8A 1LK5A 3LA0A 1TR0A 1B7YB 3OTEA 2BR0A 4CLSA 4OI0A 2A3JA 1CEZA 2QSWA 2JLGA 3HVAA 2WB1D 1FEEA 1GFWB 5KFYA 1TV6A 3OXFA 2YNIA 5I3QA 2DGWA 1OY9A 5HJYA 4NL5A 4M5JA 2LEPA 3HI9A 2V4RA 2P8IA 1BGXT 3HVTA 5I3UA 5C7PA 2PE8A 1P8GA 3PR5B 4C8NA 2BJ8A 5LL6d 1MU2A 1AT1B 2Z2MA 4K5SA 2K1RA 1YBUA 4KV8A 4OYPA 1UCNA 1YQHA 5IQ6A 4Y34A 2W8LA 3N6NA 3PJ9A 4TN2A 2LECA 2MZ1A 3PX4A 3OXLA 2OEMA 4RNHA 4B3OB 1G6BA 4HTIA 3C16A 2CQCA 1X7VA 3PO5A 2A2CA 3NWGA 1QE1A 2G0JA 4KHRA 3UCGA 1FKAF 3SCKE 5A8WA 2RNEA 3P3DA 2B9WA 2GNKA 5KFRA 4EO8A 4CCHA 4ZCMA 1YJTA 2KJWA 2VFRA 2R8IA 4ZJLA 4WTYA 1QLNA 4RL1A 2VPYB 2Z57B 1G3OA 2IBOA 1EETA 3JQKA 1V3RA 3MAHA 2X1BA 2MYFA 4RW6A 3ETMA 1EX8A 2RDIA 2J6TA 5DM6Q 3AJ2A 4I6AA 3PCOB 1CG2A 4OYIA 2B3TB 4QZVB 5KG7A 2BM1A 4ZVGA 2G4BA 1SV5B 3PO4A 5H9FK 4DV3J 1VLOA 2IFXA 4DXLA 4J9LA 3IFEA 3NOCA 5GAEU 4X84A 3VQSA 2UXBJ 3GYXB 3MD3A 1DTQA 5ETTA 1R0BG 3GILA 1KFDA 2BJDA 4R0EA 2HZVA 4USIA 2O3DA 1FE4A 4ED0A 3VALA 1RACB 1KTVA 3CMQA 1VHIA 1ZA2B 3GFYA 4Y2MA 2U1AA 1JLCB 2MQQA 3R2DJ 1C1CB 2CQ2A 1MW7A 3TO8A 1P1LA 1S0MA 1UEVA 5KFJA 3ILJA 3B4DA 1IKWB 3G87A 2EKNA 4CO3A 2MY7A 2MKYA 4DFJA 3WX4A 3N28A 1RU2A 1NK0A 1JLFA 3AH6A 5EWGA 4WZQA 4RW9B 1YX2A 3MR7A 5KG4A 2DKOB 2KI2A 3CMES 4YB7A 4MAKA 2FC8A 1HNZJ 3OLAA 2HS0A 4K4YA 3SV4A 4DR1F 1B0VA 5A8RA 3PW2A 2V63A 4NLUA 2JNJA 4DR2F 2EXUA 4QBUA 4ZKAA 2J9CA 2PEBA 2JRSA 2XTJP 2BBEA 4X4QA 2XMUA 2RKIB 3KK1B 1ZM3A 3W8PA 3TAMB 3D3CJ 1TL3B 5BYSA 4M5HA 4KO0B 2QYGA 2CQ1A 4CQ1A 3TYTA 3KHLA 2CIMA 2MY8A 3BN4A 4PABA 1KHWA 2X1FA 2R7UA 2R3VA 2BVZA 3CCLS 4ZVHA 3MUVP 3NCRA 2UP1A 2UUAJ 1YI2S 1PCAA 2D9OA 3HT0A 1Q7LB 4O4RA 3DRSA 1IR1A 5HBMB 1LWFA 1H2UX 3DOMA 2WVFA 4CM2A 3UDVA 3DC2A 3LGMA 3MCNA 2ZFHA 4WK1A 2HNZA 2EEYA 1RB0A 4DFMA 3D0GE 2B9YA 4NXNF 3M8SA 2DH9A 3R27A 4KKOA 3M6UA 2HFUA 4KGMA 4PEOA 3U27A 4YFUA 4GRSA 2B4UA 2F8MA 2ALZA 3KMSA 4I2PA 4DL0C 3Q8SB 2YKPA 4CLPA 2ZKTA 2MTLA 4TY8B 1DARA 4A47A 3SCIE 4B9SA 3NCPA 1TK5A 4DV2F 1ICEB 3GQCA 1X4FA 3DLGB 3J81U 1VR6A 5E3QA 2QLXA 2DBBA 5J2NB 4DPYA 3L7PA 3QGIA 1PYSB 4NRTA 4NXMF 4Y00A 4HI2A 1S9FA 1LWEA 4ED3A 2AJFE 4NA1A 1KVKA 2YKMA 1S12A 1M1GA 1R8HA 2HVZA 5I4MA 1NEEA 1RAFB 3PACA 5KG1A 3CCES 3G86A 1TVRA 4NI2B 4C11A 2XM3A 1NDCA 3KG1A 1VFJA 3TW0A 4O3QA 1S57A 1RHKB 4LRDA 3PKMA 2LU1A 2MKCA 2DGTA 3BGOP 4CNYA 3IRXA 2OPQB 3RAQA 2J7WA 1U8SA 3HM9A 1BD6A 1U2RA 2XZTB 4PWDB 3BYPA 2BDPA 2AYMA 4X4NA 4LFCJ 4DV4J 1NRKA 4DPOA 2LP4A 4TVAB 1VMBA 4ATNA 1S5ZA 3R5CA 1L5UA 3Q24A 3BBFA 4DG1A 1FWLA 2CPHA 1RWWB 1QAIA 5M2PA 2J8AA 2KFNA 3MM8B 2R42A 2YNFB 2CWKA 2MZQA 4QWAA 2OPRB 4NLVA 3ZZOA 2ZM6J 4ANEA 4DL4A 3K2YA 3OTBA 2E66A 1RT6A 1N5YB 4YB1P 3JYTA 1M5OC 2RHSB 3W66A 1S1WA 2BYCA 3QT6A 4DLEA 4OHZA 2MGZA 2VPXB 1NKEA 2WW4A 4ZLJA 2XWXA 5EWEA 4GMKA 5C5JA 1HPZA 2OO4A 1AYEA 1JKHB 3H2VE 3DXSX 2CG8A 3KUHA 1Y3KA 5B0CA 2FJBB 4LF4J 3PDNA 1H3DA 2V34A 5BYQA 1REGX 2CJBA 2CDQA 2GFFA 1HNVA 4H54A 3DLBA 2QV6A 4LRFA 2EFOA 2OI2A 3KJQB 4WE1B 5F8MA 4HR2A 1B64A 2HGNA 3E01B 5DQIA 3E51A 1BWVA 1ZM2A 1K9MT 3OL8A 4YDXA 2MQMA 4OYMA 4UZBA 2E5HA
chains in the Genus database with same CATH topology
2CPEA 3M6VA 3EGWB 1WG1A 2WRMA 3NNCA 1JKHA 4URQU 5KFVA 4H4OB 2ATLA 4F2SA 5D8HB 3AQPA 4TYAA 3PNIA 5JXSA 4EWTA 3ITHB 1NAQA 3M05A 1U24A 2JFKA 1SC6A 4DF8A 3MECA 3NP5A 2F3JA 2FGCA 3CJKA 5KFXA 3MUTP 2ZC3A 3AJ1A 1S1VB 1S1UB 2Y1RI 3DYAB 3N79A 3K5MA 1RT1B 3LALA 3OV7A 3H2UB 4OI3A 2KFYA 3VR1A 1NKBA 2GIQA 4RUAA 1S1XA 3DNCA 3QIDA 3BR8A 1T03B 4F4KA 1FESA 3TUJC 3SSSA 3HDSA 2ZH8A 4ZS6A 3QAUA 2UVVA 3PJXA 1QAYA 2QSFA 2OP5A 1SKRA 4Q44A 4OJHA 4WCEQ 4R8UA 4L72B 1M5HA 4LQ3A 4OHYA 2VA2A 3TQ1A 1C1BB 3CIZA 4B3OA 3DFEA 2BXJA 4TLQA 3DLHA 1ZTTA 2F9JA 2ILYA 4I6WA 2HW3A 1K73T 3QWUA 4WE1A 1D8YA 1HBMB 2HQIA 3O8WA 4MKBA 1HFEL 2VBYA 3US5A 1A9NB 1UW4A 3DOKB 1CPZA 2L9WA 3QYYA 2JEJA 2PN6A 5EX3A 3E01A 2B6AA 2OLWA 4QW9A 1LKZA 1S49A 4QWEA 3KLEA 3MTKA 3HHLD 3BGFA 3PJWA 4V19J 2ZVSA 4EUVA 1X4BA 1D9AA 2UXBF 3M8QA 2C22A 2MQNA 5F41A 2FLPA 5GVQA 1NK8A 2AW0A 3PEHA 3B4MA 3K5NA 3MOJB 3KFWX 2F7VA 4FXWA 3BZQA 1HA1A 1R89A 1VOMA 4H4KC 4RNFA 4FS2A 2K7KA 5FD1A 2XLIA 5FJ4A 1BY9A 3JSBA 2MQOA 3OQ2A 2FHJD 3C2PA 2QFJA 3K5LA 3JSMA 5H9EJ 2QEXS 3HP6A 4JI2F 2CFXA 1L3TA 2M70A 5CCMA 4FXVA 4OHWA 4B9VA 1ZAXA 2I5JA 3EUNA 4RU9A 4UUXA 5KFCA 1RI7A 3GWCA 3UDCA 3G8QA 4PPDA 1SXLA 3HHNB 3AHPA 1H2TZ 3LOUA 1VQMS 4DQQA 3M9MB 5IT4A 2ASLA 2NZ4A 1S1UA 2HRYA 4XK8C 4NZ0A 4IH6A 2BUNA 1LW2A 5A6PA 3DLKB 1AROP 2OTJS 2DNQA 4ECWA 3NMRA 4WZMA 1IN0A 1RWUA 4WFBQ 2ZJPQ 3NMAA 2A1BA 2L48A 4PXDA 4OI1A 1FJEB 5IQQA 1F2GA 3NCQA 4Q0BB 2M8HA 3CB4A 2V8GA 2W4PA 4BCAA 1S97A 2KXHA 3UW1A 2GC8A 1RT7B 4YB5A 5KT4A 2VFVA 1TL4A 2FPHX 4C4WA 4NYZA 5D4PA 2F9DA 1BQXA 2DRAA 2OMOA 3IAS9 3RAXA 2KXFA 2KM8B 2D1CA 1C1BA 4O3OA 1NJWA 3ETOA 2EPIA 5F8LA 1MWZA 4ED8A 1QJHA 4F4ZA 1VQPS 1M90T 3CDBA 1S9EB 2EKYA 2G0CA 3HJFA 3AB2B 2L9DA 2BZ2A 4RBUA 2MKKA 1J5EF 2HGLA 2W8KA 1HBMA 5B0FA 3T6BA 2CQIA 4A8YA 5LJ3Y 3LP0B 4WFNQ 3Q2TC 5AXLA 3SQGB 1HBNB 4C2MA 2EW9A 5J1PA 3OUYB 2ZH9A 4BDPA 5LJ5Y 1SL2A 2GMHA 3MTJA 4HYKA 2XS2A 1SV5A 4IRKA 2LQJA 4B3MF 1ZH5A 4KHMA 3ZZPA 2K8GA 2V4JB 1TL1A 5D6GA 3ZZUA 1WEXA 4QWBA 3OVSA 1HNZF 1KTQA 3EPIA 4A8MP 3ZZ0A 2B51A 3RBDA 1FJCA 1J5OA 4PXBA 4DOZA 3T5HA 4I0WA 4X4PA 1CC8A 1L3VA 2FLNA 3DRYA 5B0BA 1KOHA 1U7LA 3BEGB 4YEAA 3CTRA 1IM4A 1UAWA 2ROGA 1RT3B 3I87A 1QSSA 4KB7A 4C8LA 2RMLA 3KK2B 3CDWA 2PMZD 3PM9A 2HHHF 1TP7A 2L9NA 5K9FA 4DDFA 5GADI 4QPTA 4QCLA 5SZTA 3THVA 2J6SA 2AP6A 3GG0A 2XSJB 5L1KA 3V6KA 1R0AB 4A4JA 1N52B 3DLKA 3G6XA 2UUWA 1HHSA 1S1TB 3K0JA 1JJ4A 3T19A 4LSLA 4F4XA 3CD5A 4OI2A 1HD0A 3HF5A 3LAMA 4QJVA 5KFBA 1UJ6A 1HYSB 4Q0BA 1DHMA 2P9CA 5LXRA 3KHRA 1RT7A 3MI7X 2CZVC 1RT4B 4NLGA 3CDEA 4ZP9A 2KTQA 1VI7A 5L1IA 4TYBA 1HQUA 2M3DA 1ZAVA 2DIVA 1NU4A 1ZZFA 1VLYA 3M1VB 1HWIA 4K4XA 2KRRA 4KGKA 1SL1A 4PWUA 3AA8A 5DG9A 2DNLA 3HHLB 2UXDF 1S9EA 2YX7A 4CNZA 3RB6A 3M6WA 4ILRA 1Q7YT 1HBUB 2PA8D 4K2XA 3CCVS 3VWSA 1S48A 1GQEA 1X4GA 4ECXA 3PW0A 2R7OA 2XMTA 5L8RC 3SQGA 3OUYA 4RW9A 2C3MA 2GJIA 4X64F 5DLGA 2XCAA 2FHKA 4CH0S 1RKIA 4HH0A 5CZXA 2HAIA 2LEBA 2FJDB 2UUAF 2FVQA 4B9UA 1S6PB 4FP9A 3MM7B 5C42B 2RRBA 3QGGA 4DSIA 2YKQA 2V94A 2JFDA 3N5BA 2PMHA 2Q6CA 4NLWA 5DETA 2R2RA 1VQ7S 3J7A1 5HL7Q 5KFLA 3NGKA 1XR5A 1XERA 3KLGB 3VAJA 2LDYA 5LSOA 3K58A 1SBRA 2HNYB 4LIWA 1YTYA 4YHHF 2VUGA 4ZPCA 2IVFB 3R3TA 2ZHBA 2OAUA 1IKVB 2BRKA 1C2PA 2BQ3A 2IMOA 1JXLA 2DH8A 3HVWA 5AXKA 2AD9A 1HI0P 4I2QB 5LSLA 2XG8A 1DTTB 4J37A 2HWTA 2Q66A 4PR6A 4RBTA 2O66A 2BOPA 2ZDOA 3M2VB 4RX6A 3W2WB 1ZM9A 3N01A 4DV7F 2IJNA 3CE8A 5JVGQ 5KT7A 5DO2A 3MMBB 3DGPA 5EX0A 1R0AA 2OSQA 1SJ4P 2DGVA 2Q43A 3C6UB 3SEOA 5L38A 1U1NA 3NNHA 1S1TA 3EXCX 5KFWA 5HO4A 2RB7A 1B0PA 1FDAA 3FEXB 1NB7A 4ZHRA 1SJ1A 3BS9A 2NSCA 3K5PA 2E1CA 4XDCA 1U26A 1S76D 3HK2A 2IRUA 4ED7A 1HWJA 1IKYB 4YR2A 1KQSR 5L9NA 4YMEA 3I0RB 3M9OB 2V8DA 1OQ3A 3V4IB 4IOAQ 3GV5B 1PILA 3FMWA 3U1LA 1TKZA 3TAMA 3Q8QB 5AXMA 5HN0A 1UVLA 1TL3A 5E41A 5IT0A 3K8VA 4NA3A 3S7RA 4R5PB 5HP1B 3C46A 1FK9B 1JLEB 3V6DB 2PFFB 5DDRC 2ROEA 3M1VA 1FCAA 2EBGA 3CWJA 2KHCA 2BW2A 4IKAA 4PG8A 4G1IA 2KVIA 2PD1A 3V4MA 3BSAA 3HHLA 1UVJA 4C3LA 5KOWA 1HBUA 1I1GA 1DZ5A 4F3MA 4G1PA 1NHUA 4K5RA 2MJNA 2W9CA 3K59A 1S6OA 1V3ZA 5IFMA 2DGXA 3GIJA 3DDNA 1PO6A 3EGZA 1JMTA 2QRRA 4X65F 4JI4F 1OSCA 4RW8B 4OX7A 2FHJA 3R5BA 4C8MA 4I7FB 1X0FA 1S6PA 2FD2A 3MM7A 3W3SA 1OPIA 3CD0A 4QR0A 4FF4A 2N4CA 1JXEA 3H2LA 5HMXA 3UCUP 2DNPA 4C0HA 1Z2ZA 4RUHA 3UPFA 2YNHB 3R1LA 1F5CA 1VQ4S 2HNYA 5CD4H 2CQBA 4LSNB 4X4TA 3TR5A 4X4UA 1QTMA 1AFJA 4DQRA 1R3NA 2UVUA 2VG5B 2HHVA 5E33A 2GHWA 4CO2A 3QO9B 2PA3A 3LH2S 2ZH3A 3O2IA 2XY5A 3SSRA 3POTB 2HS3A 2CPZA 4ECVA 5HBMA 1DTTA 2DGSA 4AUKA 2EFNA 2OMLA 4U7UK 1O51A 3B78A 3FZ2A 4FNHA 4HL9A 2B9XA 3D1QA 2DD8S 2E1MC 5DM7Q 2M88A 2RQMA 3J7YI 2AYGA 1IQZA 1VBYA 4DSLA 2JHEA 2GGPB 4LUBA 2JEIA 2OIHA 4KQZA 4TQRA 2L41A