2F9JA

3.0 angstrom resolution structure of a y22m mutant of the spliceosomal protein p14 bound to a region of sf3b155
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
RLPPEVNRILMIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA branch site protein p14
publication title Crystal structure of a core spliceosomal protein interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 26
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f9jA01
1X4GA 1X4HA 1WF0A 2CJKA 1D8ZA 3G9CA 4FXVA 3HI9A 3VAHA 3P6YC 3UWTA 2MQNA 3CCSS 2CPZA 3I56S 2X1GA 2MKHA 2VOPA 1U1PA 1SXLA 2MB0B 3K0JA 3VAJA 3FEYB 4CH1A 1X4BA 3CCUS 3VAMA 1UFWA 1R8HA 3NNHA 3VALA 1P1TA 1U6FA 2VONA 1ZH5A 2KVIA 1SJFA 2D9PA 1S72S 3MURP 2AYGA 1WEXA 3BO3A 1Q86T 1HA1A 4U67Q 2XS2A 3CPWR 2DNKA 1H6KX 2SXLA 2MJNA 3RW7A 3UCUP 3JB9k 2DH9A 2D3OR 2DNNA 2LECA 4WFBQ 1K73T 3P49B 1HL6A 4WKRA 3THTA 3TP2A 2OJ3A 4TU9A 3DXBA 1NJIT 2MMYA 3CC7S 1WF2A 1YJNS 2YH0A 2FHOB 2CQCA 2CPEA 4F26A 1UAWA 1YIJS 2DHXA 2CQ1A 5GAEU 2M2BA 4OZ0A 2DGTA 5HO4A 1R8PA 1WEYA 2MY7A 2DK2A 2J76E 2CQGA 1N52B 5DM7Q 1H2VZ 1WELA 2ZJQQ 2G0CA 2J8AA 4F02A 5JVGQ 1IQTA 3CD6S 2HGMA 4YB1P 2KFYA 2DGQA 3SMZA 1M5KC 4TU7A 3CCRS 2RQCA 4QU7A 2MKIA 2DNRA 1B7FA 2KYXA 4WFNQ 2ADBA 2JRSA 2KXFA 2AYBA 2CQBA 1N8RT 2DGWA 2HZCA 2MKSA 2MGZA 5IM0A 1DRZA 2OIHA 1DHMA 2DNOA 2VOOA 4P6QA 1WTBA 2HYIB 4WFAQ 1P27B 3J7ZT 5GAHU 1Q7YT 2CPIA 2EVZA 2O3DA 4RU2A 2LA6A 3CMAS 1KC8T 2MY8A 1VBYA 2U1AA 2MJUA 3OW2R 2CPJA 3R1HA 2DGOA 2LQ5A 3J7YU 3PIOQ 3SXLA 1FXLA 5BJRA 3ZZZA 2KRRA 1N54B 3IWNC 3DLLQ 2L9WA 3BO2A 1PO6A 1CVJA 2MHNA 4W92B 2RS8A 1X4EA 1WF1A 3MOJB 3NMRA 1U2FA 2X1AA 2LEBA 1FJ7A 1U1OA 2RUGA 2MQOA 1AUDA 2J0SD 1X4FA 2DHSA 2KT5A 1U1KA 3MUMP 5IFMA 2MQQA 4LJMA 2YKAA 3BS9A 2MQMA 2AYMA 3G71S 1M1KT 1VQ8S 2CPDA 1HD1A 2WBRA 5GAGU 1G2EA 3NS6A 2AYEA 2ZJRQ 2DNHA 1SJ4P 1QM9A 5DDPC 3UCGA 3MXHP 3CC2S 2DGSA 2YTCA 1WG4A 3P3DA 4QQBA 1JMTA 3CXCR 2G4BA 2DGXA 2RQ4A 2KXNB 5ITHA 2CQ0A 2KRBA 4PRFA 2K3KA 2NZ4A 2ZJPQ 3LPYA 5EN1A 5H1SV 2J0QD 2KU7A 4CH0S 2V94A 5HL7Q 4IOCQ 3UCZP 3VAIA 3EGNA 2RRAA 1WHWA 2CPXA 2EK1A 1FJCA 2U2FA 3IRWP 2X1FA 4A8XA 2M8HA 1DZ5A 2DHGA 4Y00A 1FJEB 2BZ2A 2XSFA 2DH8A 5GVQA 5JVHQ 3CUNA 5FJ4A 2M9KA 3US5A 3VAKA 2LEAA 3U1LA 1URNA 2KI2A 1W2BR 4WIIA 2JVOA 2KXHA 2N82B 4C0OC 2N7CA 1SJRA 1UW4A 2DNMA 5DDRC 3V4MA 3CCQS 1YHQS 2DNYA 4Y0FA 1X4CA 2NLWA 4YUDA 2MPUA 4Z2XA 3UD4P 2JWNA 3NNCA 4IOAQ 1OPIA 3HHNB 5GMKa 3CF5Q 1VQNS 2MGZB 2MKJA 2RS2A 1DBDA 5IM0B 2MSTA 2CQIA 3BO4A 5LJ5Y 4IUFA 2CQ2A 2E44A 1JJ2R 2CPFA 2HVZA 1KOOA 2CQ4A 1F9FA 2DGUA 1OIAA 4IO9Q 2PEHA 1Q82T 2MZTA 2KH9A 2CPHA 4TU8A 1K9MT 2DB1A 1KOHA 3SDEA 3TYTA 1NU4A 3S8SA 1VQ5S 1H2TZ 2GHPA 4UY8T 4PKDB 2FY1A 5IQQA 1YI2S 2XS5A 1VQPS 2KG1A 2MZRA 2DNZA 2A3JA 5LSLA 2M4MA 2FC8A 2YH1A 1YITS 3FEXB 2M52A 2KM8B 3VF0B 3I55S 3EGZA 1YJWS 1X4DA 3VAGA 3B4MA 2G1DA 1X5TA 4F25A 4V19X 2MZSA 2M88A 3H2VE 1HD0A 3L3CA 1QVGR 1WHYA 3H2UB 3RW6A 4UQTA 2RVJA 3UD3P 5LXRA 5GADU 1X5SA 3S6EA 1K8AT 2MSSA 1VQOS 3R1LA 2DNQA 3MD1A 1YTYA 2CQDA 5DDQC 2RT3A 1FT8A 1VBZA 3P5TL 1WHVA 4FXWA 2GO9A 2M7SA 2M8DB 1UP1A 4QPTA 3G8TA 2Q79A 2L08A 1VQMS 2MQLA 2DNPA 2LMIA 1NO8A 2MXYA 1U1LA 2N3OA 2FC9A 2E5IA 4ZKAA 3G6ES 1U1MA 2XB2D 2MKCA 1H2UX 1BY9A 1VQKS 1WHXA 1KD1T 3G4SS 3LQVA 2L41A 2AD9A 2MZQA 2N3LA 3S7RA 5LSOA 1U1NA 2JVRA 3Q2SC 5DDOC 1S79A 2D9OA 2F9JA 4C4WA 2E5GA 1A9NB 2CQHA 1U6BA 1X5OA 2RRBA 1RK8A 3EX7B 1M5PC 1WG5A 1SJ3P 3R27A 1X0FA 2DO0A 1M5OC 3NS5A 2KN4A 2YWKA 2OSRA 2OTLS 2LKZA 1WEZA 4OZ1A 4TLQA 2LCWA 3ZZYA 1L3KA 2ADCA 1N88A 2FPHX 4WF9Q 2E5HA 2LYVA 2CQ3A 3MI7X 2KG0A 2B0GA 2MKKA 1VQ7S 1Q81T 1FHTA 2DIUA 2KM8C 3UE2A 2EK6A 4CIOA 1XN9A 3D2WA 4ERDA 4YOEA 2KHCA 3PIPQ 5LJ3Y 3G8SA 3MUTP 3MUVP 4CQ1A 2I2YA 2QFJA 2ERRA 1WI8A 4LIRA 2MQPA 2MYFA 4J5OA 3B4DA 1OO0B 2DGVA 2DH7A 1VC5A 1X5PA 3TO8A 2MZJA 2F9DA 2E5JA 4C7QA 3S01A 2UP1A 1VQ6S 2HGNA 2RNEA 2OTJS 2XNRA 1VQ4S 1SJQA 3SDEB 2MZ1A 1ZZNA 4ED5A 2X1BA 5CA5A 5CXTA 3CTRA 3CMES 1X4AA 2DHAA 3MD3A 3CULA 2M70A 3VAFA 5D77A 1U1QA 2DNGA 5DM6Q 3CCMS 2BOPA 2XNQA 2XS7A 1FO1A 2JX2A 5MLCV 1RKJA 2DIVA 3NNAA 2PE8A 1WG1A 3G96A 1O0PA 1JJHA 1VBXA 3CC4S 4M5DB 2HGLA 2VODA 2QEXS 5LXYA 2LXUA 1VQ9S 2LA4A 4LMZA 1YJ9S 4QU6A 3BEGB 1YWXA 2DISA 3MDFA 3CCVS 3Q2TC 4PR6A 4WCEQ 4BS2A 5DETA 2LXIA 3CCJS 3THPA 1OWXA 3U1MA 3ULHA 2DO4A 1WWHA 1JJ4A 2K8GA 1WI6A 1D9AA 3CCLS 5D78A 1ZZFA 3CCES 1VC6A 2M0GB 2OSQA 1M5VC 5CYJA 1VC0A 1VQLS 3N9UC 1M90T 2DNLA 2RU3A 2I38A 1KQSR 4W90B 2CQPA 1FNXH 4EGLA 2F3JA 2DITA 1PGZA 2QA4S 1U1RA 2CPYA 1A7GE 1QVFR
chains in the Genus database with same CATH superfamily
2G2YA 1IBKF 3E01B 4FXDA 2E7VA 1IKXA 2BBEA 2HFNA 2MB0B 1HPZA 4KRWA 1U4BA 3VAJA 1X4BA 3VV2B 2VG6A 1O5JA 3MURP 3HHEA 2VH7A 4WZQA 4PQAA 4IH5A 3DOKB 3DXBA 3AXMA 2ZC4A 3MEDB 4FZVA 2ILYA 2K7JA 3FDSA 4RUHA 3SQGA 2DGTA 5HO4A 2GIRA 4NYOA 4GO5X 1EX8A 2ABYA 2UVUA 3J7YI 4CLYA 1OMSA 2ZBCA 3QMQA 2E9ZA 4RWWA 1T9VA 5B0DA 2BQUA 2HZCA 4LVOP 1NK7A 3MAAA 1Q7YT 3HKWA 3FJ2A 3JSRA 4PWUA 4JI7F 3DC2A 2WSEC 1Y5IB 2B9WA 3R1HA 4IFVA 5SZTA 3T1HJ 1RTDA 4QYRA 4OZNA 4ZVRB 4RU9A 1NEEA 1U2FA 2X1AA 3BV8A 1N4LA 2B9EA 3DYAB 2XCAA 1JKHA 3MM6A 3TUPA 1UA0A 5T7LB 1M1KT 5C25A 1TUVA 2GMHA 3CO0P 4UOFA 2YTCA 4QQBA 4WYLA 1JK9B 4JV2A 1VS3A 3IP0A 3MM5A 4CM2A 4WFXA 4K0KJ 2QYGA 2HNZA 2ZH3A 2EK1A 3PW4A 1UVIA 4ZN3A 3TR5A 2AWZA 1DTQB 3MMJA 2Q66A 1FX2A 4XO0A 1JLEB 4NCGA 1D9FA 3RU0A 1WDTA 2R7SA 2JVOA 5ETKA 2N82B 1V3ZA 2AKWB 2VJUA 4M5JA 4RLEA 1C2PA 2K3IA 5DDRC 3CEDA 4X4NA 4IR1A 4TYBA 1RHKB 3MWBA 1NK8A 2MSTA 1X9WA 4ID5A 3HMJG 2HKEA 1FK9B 2WW4A 3H5YA 2J6SA 1T3NA 4WZMA 1S6PB 3TI0A 3RR7A 1RBOB 1C1BB 2YX1A 2DRBA 4JI8F 4C98A 2MZRA 4RUAA 3M2VB 5JUMA 4OYPA 2CZVC 2VDHA 5BR8J 5A6WA 3VF0B 3R6GB 1S9GA 4A48A 2QFIA 3OXLA 3JAMU 3D67A 2MDAA 2VBYA 5K8OA 4X62J 5EX3A 4CM0A 2RT3A 3DLHA 2JH3A 4FXWA 5H9FK 1DQAA 3MFHA 1TL5A 2GO8A 2WB4A 1NO8A 1U1LA 3TRGA 3Q8YA 1Q4RA 3ZNUA 1SV5A 2N3LA 3QSYB 1CJUB 1NK9A 2GHVC 4RWXA 5KAKA 2K2PA 1S99A 3I6PA 5A76A 2ZBRA 1CJTA 4WYWA 2WONA 1Y3JA 1WG5A 2GAHC 8AT1B 3J81j 4DS5A 2KN4A 2OTLS 4TLQA 1NUEA 1RT1B 5EHHA 1N88A 2UXBJ 4RJVA 4QR1A 4EFAC 5D4LA 1RACB 2HQFA 2A6MA 1UJ6A 5JMNA 2OLWA 2BE9B 3HO1A 4M5KA 2IVMA 1IXKA 4EBDA 1XMBA 3MECA 1RHMB 2GA7A 2EKYA 1Y4ZB 4F50A 2L48A 2CYYA 2XNRA 2CNLB 3SCLE 2VD3A 5I3UA 1MROB 4F4AA 3U27A 2RHSB 5CA5A 2R2RA 5D3GA 3VGUA 4K5SA 4PG6A 3K57A 3H20A 3JQKA 1G6BA 2BOPA 4QJVA 1RXOB 3CD5A 2K1RA 3LANA 3AD7C 2HQIA 1O0PA 2D3UA 3CC4S 2GVZB 3PO5A 3W61A 2OKQA 4ECRA 4NLSA 5CD4A 2QZ8A 3T5LA 2H4WB 2WVDA 4ILLA 4BS2A 2YNIB 2ZEJA 2V2VA 1WI6A 2FVPA 3CCLS 4YP3A 1VQLS 5KFQA 1XK8A 4IFYB 1EQ0A 1E6VA 1X4HA 4KFBA 4KPCA 1T9XA 1LWEB 4B3SJ 1XEZA 1FXRA 2GJFA 1C4AA 2GS8A 1DTTB 3MEKA 3A12A 1J5EJ 1VK8A 4YN3B 3D6TB 2AYGA 4OI3A 3HULA 4IG3A 4R8UA 4KQZA 4LBPA 5E5NA 4ED1A 4YR2A 5J2MA 4GVBB 3M6XA 1K73T 2ZH1A 3TP2A 2NR0A 1QSYA 4DQPA 1KS2A 4OV6A 2XY6A 3EMTA 4DX6A 1ACMB 1Q78A 2YQ0A 3VR1A 1RZMA 1GEHA 1YIJS 3QWPA 2LLZA 4NZ0A 2GQQA 1F5AA 3RRGA 4N76A 1VHIA 1TVRA 4E0DA 3P96A 3CD6S 3T6BA 1RKIA 1RT4B 3DOMA 4OV1A 2Z30B 5GADI 3OL8A 2LXFA 3TAPA 4JP8A 2HPUA 4WFAQ 2AQ4A 2PDAA 5CCLA 2FLLA 2U1AA 2R7QA 4MKYA 1HQEA 3K5OA 3PIOQ 2F40A 4LF6F 4RW7B 1NZAA 3KK2A 3W1YC 3HLUA 1X4EA 4B9TA 2XMJA 2A10A 1WF1A 4DFKA 2VFRA 1UMJA 2A2CA 3KG4A 5F0WA 5AJ3F 3KUEA 4OZ2A 3BS9A 2ASDA 1IR1A 4I7FA 5C42B 4EO6A 4X4TA 2C2DA 3KWMA 1EKSA 4N41A 3SCKE 3CMQA 1GXTA 1N36F 1YJVA 5KFAA 4WU3A 2RD5C 2XY7A 4ANDA 4KJIA 3O2IA 1R7IA 2RH3A 4OZ3A 3IRWP 1AT1B 1KFSA 2KZZA 1S57A 2LU1A 1F9HA 4QW8A 4OJHA 3JSBA 1REVB 3DGPA 1ZM3A 2DNMA 4RW6A 2IYIA 1MN7A 2EFNA 3NNCA 3DCAA 4JYAF 4X65J 1HI8A 5LJ5Y 2BE7D 1DARA 3T5HA 2YKMA 3TW0A 1JJ2R 4NRTA 1Q82T 4LR9A 4ECQA 3HKZD 2GHPA 4YR3A 2XI2A 1V9OA 1HW8A 3GJQB 3LP0B 4OLPA 4ECUA 5KOXA 1FWLA 1SQGA 3NXZA 3BDEA 3V6DB 2B4PA 1VFJA 2HNDA 4KV8B 2XGQA 1HD0A 2BM1A 1QVGR 4I67A 3GYGA 2C1EB 3UD3P 2RF2B 3BYPA 1TMJA 3FCWA 3HHDA 5B0BA 2Y1JA 3OXGA 1R8BA 2Q79A 1GTEA 5IT4A 1SIZA 2Z2ZA 3OQ2A 2UUWA 4ZKAA 4WJBA 3R2DJ 2L3MA 4FBTA 3KOAA 1WSRA 2O5DA 2CNNB 4P2SA 3S7RA 5LSOA 3QIPA 2W01A 1NPRA 4RNMA 1HBOA 1RK8A 3OVSA 1GMVA 3BR8A 4HACA 5EUHA 1M1GA 4LVNP 4U6PA 3E51A 3FNNA 1WOSA 1SBRA 1S7HA 4LBIA 1TR0A 4F3QA 5DQHA 1EZZB 1F2HA 5KFIA 3NOCA 1K44A 4DZDA 4NZ6A 5KFFA 1RTJB 3ZZ0A 2MZ1A 2HHVA 1OY9A 2YY3A 3V2UC 2MLYA 3LUYA 3CJTA 3MD3A 4ZP9A 2DNGA 1FJGJ 1OY8A 1RADB 1KTQA 4FBUA 1X60A 4F0HA 1UVNA 3JXOA 4ES3A 2XYPB 1RKJA 4K4XA 2H3EB 4NXNF 5C24A 1VRTA 1NSQA 1F5BA 1YJ7A 5KG5A 2DTJA 4DPXA 2V34A 3AY0A 3NGUA 5HSPA 2LXIA 1AA1B 1UKUA 3BQ1A 1JJ4A 2YX7A 3CCTA 4RW8B 1CEZA 5HANA 3OR1B 4HTIA 4DZ6A 4LF7J 1PGZA 4F67A 3CWJA 1MWQA 1M1HA 3S1TA 1TU0B 3BF4A 3Q0AA 3CVKA 5KG1A 4CH1A 2IJRA 2R7UA 2OEMA 1JLGB 5LOQA 1RU1A 2BOAA 1CBKA 2DH9A 4RX6A 4DQSA 1Y3KA 2OJ3A 4LF5F 2V67A 1YJNS 1UTAA 5KG4A 3AB4B 3MEGB 2JSXA 3D4JA 1U8SA 3FSYA 3V5RA 4NRUA 4OZ0A 3M32A 4XDCA 3A13A 4ZJOA 4B3TF 4DV2J 2HURA 2VG7B 2XO6A 4QWCA 2EBGA 2BACA 1VJQA 2CJXB 2JRSA 1NZ8A 2B9XA 2F7VA 5KFKA 1WTBA 2ALZA 4UF4A 1GH8A 3CJ5A 3O8WA 2DGOA 2AMCB 4LRFA 4ZP6A 5IWAJ 1CVJA 1FTCA 4A4JA 3DRRA 2RHQB 5JJBA 3EZ5A 3LOUA 1SQFA 2HLTA 2W7AA 1PAEX 2WZ1A 2E1AA 3NBPB 2HIYA 3I0SB 3OR2B 3OFGA 2X3DA 1RT2A 3H0PA 3GYNA 3VHQA 2WVFA 3QAEA 3UCGA 2PEBA 5HROA 4DUZF 4B3RF 2KXNB 4J90A 1TMMA 1NB2A 2IY5B 3KJFB 3HHLD 2P9GA 1BE4A 2H5EA 1S0OA 2D3O1 1HNWJ 4DV3F 1YVFA 4GO7X 4H4OA 5E3CA 4A8XA 3KHLA 3Q89A 1RCXB 1WKJA 2OGUA 1U45A 3G82B 3MR7A 3WDOA 4M1KA 3U1LA 2VDIA 5LSRA 4USUA 1SJRA 4FYYB 3M8RA 2HQ3A 1X4CA 2QGFB 4OLOA 3ZZRA 2DCLA 3NAIA 2EG2A 3QWUA 2CQ2A 1FRHA 2FJEB 3ZTRA 4X66J 5KT6A 4DV5F 1CJVA 4XDDA 2KFNA 1IKVB 2DB1A 1FI4A 2POKA 2HRUA 4MYUA 1X31C 5IOLA 3VAGA 1Y5NB 5G0RB 1SKUB 4GC6A 5KFVA 2CFXA 2I0XA 4WK3A 1R89A 2YWWA 3S6EA 2MSSA 3FGVA 4KGZB 2QA4G 2ZH9A 4K5RA 4NPOA 1LW2B 1FX4A 5F8NA 2VV5A 1S9EA 4A8MP 2QL5B 2MKCA 2UU9J 1HI1A 4LF8J 1U2CA 2R7VA 3CDUA 4XAKA 2GIFA 3GB0A 2WVCA 2P9CA 1FRXA 3OTOJ 2E5LF 1I5OB 2YWGA 3E01A 3F41A 4CCHA 2HMIB 3AH6A 3WC2A 4DN0A 4ZPBA 4NCBA 2LCWA 4KE5A 1R6VA 4B3OB 2V8DA 3EGWB 1PILA 1K1QA 4DL0C 4MMOA 5GMDA 2W25A 3DOKA 4DR4J 1N34F 2YNFB 5GAHI 3HJVA 2P9EA 5AXKA 2V4QA 2MYFA 3MEDA 2FQQB 2UXCJ 4P74A 4LFAF 3PYFA 3MPUB 2VZ9A 3J81Y 2ZHOA 4PYDA 2PMHA 5F9NA 4J9VA 1T0TV 2J9DA 3CTRA 4V19J 1S1WA 2UUAJ 3Q8VA 4OYOA 4KY3A 1F2GA 1RWUA 2EWHA 5D77A 4OYMA 1U1QA 3PNIA 3KDOA 3NG8A 3QZ7A 2BW7A 1N5VA 3A3NB 2HSEB 1B64A 5A0YB 3R5DA 2HZVA 2V0NA 4FPRA 1E6YA 2AJQA 2WTFA 4QU6A 3AA9A 3BEGB 5HJYA 4C11B 3JYTB 3F73A 4WXWA 4C48A 1UL3A 1ZAVA 2CVIA 3QO9B 2RU3A 3O6QA 3W2VB 3DYAA 4URQU 3H7HB 2XSJB 5T7LA 3PW0A 2IDEA 4L72B 2WVEA 2F4VF 4WTYA 3VAMA 1UFWA 1S0MA 3OL7A 3VALA 1EB0A 1SJFA 3BO3A 5B0CA 3UCUP 3K5NA 4ED6A 5E2QA 1U8WA 1T94A 4USJC 4EZ6A 3BBCA 4DV1J 1OYEA 2AIRB 2XHCA 3OL9A 1IN0A 1KTVA 1DTQA 1R8PA 3UDCA 1JLEA 4CTAB 3CIZA 2H51B 1HW9A 1I51B 2OI2A 3BKTA 4DLGA 3DDIA 2KXFA 3MTKA 2AYBA 1KQGB 3HD1A 4K2JA 1N33J 2DNOA 1FK9A 1S6PA 4M63A 2O3DA 1YSJA 3QFHA 1IBKJ 3MZIA 1C1BA 3OW2R 4TXSA 4DSFA 3M2VA 3J7YU 5L8RC 3SXLA 1FXLA 1DFDA 3DLLQ 2IYGA 2L9WA 4DG1B 2RSQA 1JNZB 2F8HA 2W4PA 2Q1LA 4B3MJ 2Z56B 5D0EA 3MOJB 5L46A 1RAGB 5IFMA 4ZOSA 4DFJA 3M9OB 2AYMA 4LT6A 3AD8C 2YKNB 1FDAA 2ZNZA 3DNCA 1PC4A 3KK3B 3PX6A 1FWKA 3M6WA 3PKMA 1QM9A 4C8MA 3KUGA 3D3CJ 3NWGA 2CQ0A 1CJUA 5DQIA 3V81B 1IBLJ 2BJ1A 1C4CA 4K4UA 4KKOB 4LF9F 3VZIA 2YX4A 4OI4A 3BSOA 1S1TB 1U24A 3CT9A 1RT1A 1RWWB 1H7XA 2XYHB 4NXMF 3RBDA 4NI2B 2VASA 5U47A 1RCOB 1RTZA 1W2BR 5B08A 4ILRA 1ELOA 4KC5A 3CDBA 2ZBQA 3U02A 1Q95G 2MPUA 2FJBB 3GR0A 2H1YA 3PJWA 3M9NB 5HJXA 4BCAA 1H73A 4FYWB 4BC7A 5B0GA 3IS9B 4B9NA 3S8SA 3PFEA 1VQ5S 2HHWA 1MROA 4I2QB 1VQPS 4KHMA 3W62A 2VHGA 2HHSA 1FWPA 2GFFA 3C14B 1UFLA 2DVIA 3HT3A 2M88A 1XERA 2IFXA 2D41A 2IM1A 5ETRA 1FDBA 2GVZA 1NDPA 1LKZA 1RAJA 3M7VA 5BYQA 2M7SA 1X9SA 3G8TA 2I8EA 1HNXF 2YNIA 4LR7A 3AQPA 1RLCL 5E41A 1H2UX 4PAAA 4HDHA 2B8PA 3MFIA 4X4QA 3T9NA 3Q2SC 4IFYA 1HR0F 4USHA 2J6UA 3MF5A 1LWEA 2XLKA 3R27A 2DY9A 3NS5A 4PG7A 2QV6A 1DTTA 1L3KA 2LYVA 5GMEA 3KTQA 2QIFA 4FKYA 3TNVA 3ENAA 3HZEA 4RW4B 1FHTA 2IMWP 5HMWA 2B43A 4JI8J 2P2CB 4F3OA 1V3RA 4GVBA 2XZWA 3MCNA 3MUVP 4HI1A 1OO0B 3CGIA 3M6UA 2F9DA 1JIHA 1U02A 2B4VA 1EHWA 2RNEA 5HI7A 1VQ4S 3ENQA 3D9BA 4K0KF 4PUOB 4DV7J 1OQ6A 3EM1A 3D54A 4USTA 1RT4A 3UI3A 4U7CA 4AXJA 4PPZA 4B08A 1L3TA 5IT9Y 4Y2MA 3BGRB 3SFGA 1JB0C 1RT6B 2EI5A 2DR8A 2BABA 3MMAB 4LMZA 5LT5A 4ZVQB 4J9PA 3NS7B 3W3SA 4ED7A 1B7YB 1L3SA 1CC8A 2DO4A 2NXJA 1VJWA 4DHVA 1KLNA 4RW7A 4X84A 3DOLB 5IC6B 4JI0F 5D78A 3CCES 1VC6A 4O4RA 4CLFA 3PX0A 1U1RA 1WF0A 1GT8A 1IJEB 3ZTSA 5C42A 4CP5A 3FCVA 4X64F 3LTOA 2PSZA 1IR2A 1ZH5A 2GQCA 1AB8A 1NKCA 4MIWA 1NAQA 2HG4A 3M8QB 1GMUA 1F0XA 2AT1B 2M2BA 2CG8A 3WIUA 4HT5A 1NSAA 3ILJA 4J9SA 4MAKA 1H2VZ 1N5QA 3BPSP 3QFWA 4PG4A 1REVA 2B3TB 3CCWA 2QA2A 2VUGA 1B7FA 2FLNA 2BJ8A 3AOBA 4DL5A 1P27B 1AW0A 4WFZA 3M8YA 3I82A 3NCRA 2LA6A 4WKYA 4CYUB 1YJTA 5ETOA 2W8KA 2W8LA 3LP0A 2BE2B 4WIQA 3GYXB 4Q2MA 3DLBA 4Y2KA 1YKWA 1EETB 3HM9A 2A2DA 2W2PP 3V6DA 1SH2A 4KV8A 3H59A 1GX5A 1MSWD 3Q86A 1JKHB 2YKAA 3ZZOA 2RF2A 5B0EA 1T95A 2CPDA 1EAYC 4A8WA 3WX8A 2WBRA 2ZBIA 1G2EA 1EJ7L 4YDDB 1SJ4P 3W5XA 3EVWA 2FHMA 3CC2S 2DGXA 2ZBPA 5KFHA 5DJBA 2MKYA 3AA8A 3QT5A 5KFOA 4RKUC 3GZ7A 1LW0B 1H72C 1CPZA 2F63A 2OPPB 4FN5A 4YR0A 3VAIA 2OD6A 3HX9A 3P4UB 5JVHQ 3O1LA 1CULB 5KG0A 2FJXA 1HNZJ 5L38A 1FFGB 1PYTA 2NCKL 2Z4PA 3FRYA 4IRCA 2IJFA 4CLZA 4I56A 4LF6J 2CRLA 1FA0A 1YDLA 3DHWC 4IQMA 2AGOA 2W1BA 1PG5B 4YFUA 1KOOA 1F9FA 4IO9Q 1S97A 4TU8A 5AJ3J 1RTJA 3NGDA 4A8SA 2ZZMA 4MKBA 5IQQA 2YQ1A 3QGIA 4QR0A 2FC8A 2Z58B 2LVWA 1Y11A 1YJWS 5EX0A 1SVDA 3HP6A 4X4PA 1ZTTA 4QWEA 4X4VA 1WKKA 1K8AT 1VQOS 3GG1A 2DCUB 3QGHA 1SCJB 2D69A 3FZ2A 2EC0A 1ROFA 1T7PA 4N7TA 3G4SS 1W7WA 4RW8A 4RUCA 3K2YA 4LRAA 3HVRA 3N6MA 3MM7B 3OR1A 4JI4F 1IJFB 1IKYB 4ZCLA 3OL6A 1UW9A 1IVZA 2RRBA 4CT8A 3PJ9A 4HL9A 2OP5A 2DO0A 2AEMA 3MHYA 4JYAJ 2LQ8A 2XMAA 5F8MA 4Q5VA 4YMEA 2COLA 3ZZYA 1VQYA 2JHEA 1F5CA 4WU2A 2IPOB 1JLGA 2FZCB 5CHCB 4FYVB 4ID8A 3D66A 3K89A 3PR4A 3EZUA 2QFJA 1S49A 1GXLA 1S1XB 3HFKA 2CVEA 3MEGA 3JTPA 4NLWA 5HVHA 4OX7A 3C16B 1X9MA 2HGNA 3ET6B 2C3OA 5DQGA 2ALYB 2XCPA 3DRXA 4DSIA 4F4XA 5ETQA 1ZZNA 4QZVB 3M6VA 2VG7A 1F3FA 4KHPF 5D0GA 3G87A 1LWFB 1VDHA 5HQ8A 3RGIA 2RB7A 1TZ0A 2QMUB 2ILZA 3OFFA 4A8FA 4DU7A 4D3HA 4ZN1A 3G96A 1CS4B 3K17A 2KDOA 3TVYA 2OPRB 5A8RB 1YWXA 1T9TA 4O3SA 5CAAA 3NKYA 3R7NB 1YJRA 3EDQB 1BQNB 1ICEB 4ZPVR 1JLAB 1RTHA 3NOGA 2EFVA 2RDIA 2Y9HA 4P2XA 1QVFR 3NBPA 4C8KA 3I0SA 3MAQA 1UZDA 3OR2A 3QPIA 1U1PA 3DRYA 4X4RA 5DGBA 5F8GA 1D09B 5FLXY 3L7OA 3VGVA 4OQJA 1UJ5A 2XS2A 2FJDB 2XLJA 1HMVB 1H6KX 3M4XA 2MJNA 1SKWA 3JB9k 5F8JA 3UQSA 2MTLA 5F9LA 2B4UA 4HDGA 4ANEA 3FBBA 2HVIA 4C9DA 5M2PA 3R9LA 4FDFA 1T02A 3OBIA 3OHBA 3BYRA 1KNZA 2KTQA 3TQ1A 3G82A 2IM2A 1JXVA 2DRDA 3GJRB 3DOMB 3CCRS 2RQCA 2ZH5A 2HS0A 3PW7A 2ADBA 2DGWA 1BMQB 4R5PB 2VOOA 3O44A 1RTIB 1UPPA 4HVZA 1IKVA 5K14B 4DN9A 3CJ2A 4J7CA 3TUJC 3BSAA 4HTJA 4LIWA 2NYHA 2RAQA 2RJZA 4RPFA 5EWFA 2E7XA 5DG7A 1VLYA 2P6TA 5G0RA 2RS8A 2GIQA 2IRXA 1QLNA 4TLRA 3V6JA 4ZVUB 2RUGA 5LL6d 4J9KA 3H8YA 1FRJA 1RHRB 1YK9A 3QGGA 4LF5J 1YZ7A 2KJWA 4TY8B 2GAGC 1HD1A 1FJGF 4LRBA 5B0AA 2PMZD 2FJVA 3P3DA 2RIJA 4KH0B 3HXMA 2BV3A 2G4BA 3MOZA 2Z0GA 4KGKA 4B3TJ 4X4OA 4V1Ak 2HHTA 1KR4A 2CNKB 4ER8A 4GRSA 3I9V9 2HMIA 1F1BB 1QUPA 2ZM6F 2ZUAA 1MMLA 4B3OA 5HATA 5KFRA 3T9ZA 1TKDA 3QYYA 4WIIA 4M94A 5DZ6A 2NPFA 1R27B 3MPDA 5K8PA 2XMTA 5DGAA 1YHQS 2GNKA 2YNFA 2DNYA 4Y0FA 3EVMA 3LA0A 3PTWA 2J7KA 4YUDA 4Z2XA 4IOAQ 4UTGA 4CZCA 5EWEA 5GMKa 2GVDB 3B82A 2VA2A 4Z7YA 3SSQA 1PCAA 1RHQB 4ELUA 1D9DA 4UY8T 2DXEA 3QT7A 3HSZA 1APSA 5CCMA 9ATCB 2M52A 3W2WB 2F1FA 3I55S 3D3BJ 2HNDB 3ILLA 2MZSA 4B3RJ 2YPYA 3H2UB 2XI3A 5A0YA 4J9LA 1JWWA 3BSNA 2VA3A 2ZHBA 2W2MP 5DDQC 3BSCA 2GJIA 5D0RA 4DV3J 2ZVIA 1S77D 2DR7A 4C11A 2MQLA 3JYTA 3PW2A 1DJ0A 3HT0A 3IM9A 2XMMA 4O4GB 4UOCA 3G6ES 1WDDA 4FS2A 4C8ZA 4H54A 3FUYA 3QO9A 2Y8YA 3W2VA 1HBOB 4ECSA 4R0JA 2XSJA 3HSJA 4DX7A 3FMBA 1LV5A 4NLXA 2PO4A 3I4HX 3M8WA 1U47A 1VI7A 2ADCA 2FPHX 2E5HA 4DV5J 2QTWA 4WBFA 2KG0A 5AE3A 4K4SA 3M2UB 2G1HA 3JAMY 3BKFA 1Q81T 1SQEA 1B4SA 4NLGA 3KNGA 3ETMA 3FMWA 1V5IB 3KJQB 2QJ3A 1WSVA 3R7BB 4E8UA 2ERRA 1KVJA 4J5OA 4GC7A 2OPSB 3AB2B 4RL1A 2B8QA 4DV6J 2BKPA 4CTAA 1IWGA 4WWSA 3CMES 1HNWF 3W9IA 1U0SA 1HARA 3QT8A 5DM6Q 3KHGA 2HVEA 4XK8C 2ZITA 3CB4A 3Q8QB 2E5LJ 2R8IA 4NWBA 3WQPA 4B17A 2XGPA 2PT0A 4M5HA 2L9NA 2RILA 4ZCIA 4K4YA 2CAJA 3U1MA 2O01C 3UR3C 4DG1A 2C2RA 1ZZFA 5A2QU 2I38A 2VPYB 2CWXA 3AFGA 4O44B 2CPYA 3RYLA 4ZPAA 1D8ZA 4UY85 3HI9A 4M8LA 2YKNA 1SXLA 3KK3A 1FRMA 4LFAJ 1S1UB 6AT1B 4TNOA 2KZMA 3CPWR 2UV8A 5HAOA 4NEZA 3ZZTA 3I5AA 1UPMB 1TTHB 3V81A 3GTYX 1RI7A 1UWBB 1HBNB 3CC7S 3GV7B 4KKOA 2V2ZA 2YWHA 3RAMA 1S1TA 5L1KA 4Q45A 4PZVA 3ETOA 1FEHA 1UETA 2J76E 3ZTOA 2CQGA 4NI2A 1JXLA 1VISA 4CNZA 1WELA 1N5YB 4MT1A 2HGMA 4PWWA 4WPAA 1R6YA 2BVZA 1MN9A 2C3PA 3ZTPA 2HYIB 3K59A 3IAS9 3J7ZT 3DHXA 4O3OA 1U49A 1RWOB 4EYHB 2EVZA 4NLPA 3IS9A 4OHWA 4DXLA 2ZWOA 3UNYA 2UUTA 5GAGI 2MJUA 2GJ2A 4F2RA 3BH7B 5HMZA 3W64A 1PBAA 4DV4F 1FKPB 4DR7F 3FK4A 4ED4A 4B9VA 3C14A 2V9WA 1G3OA 4W92B 4QIFA 2EW9A 4C3LA 2N4CA 3MUMP 4ZPCA 2G0JA 4ZVEA 3QIDA 1TP7A 3A8KA 1SC3B 3CO9A 4NLTA 4DX5A 2DGSA 1L3VA 3OTDA 4KTQA 4KGXB 4C8LA 1SKRA 1NHUA 2KU7A 5HVGA 1RYRA 3TA2A 2V94A 4FNHA 4DL3A 1TKTA 3G2XA 3GFXA 2RDJA 3T41A 4AE5A 2PA8D 2E1PA 2J5AA 1NLKL 2HAFA 2VL1A 4DCOB 4F4WA 2VC1A 4RW4A 3VAKA 4QWDA 4DBQA 2B5JB 3A3PB 4HT7A 5IQ6A 5IC4B 1XMOF 1KVIA 2XZDB 1NK4A 1OSDA 4CLUA 1RE1B 2H5IB 1SIWB 2CPHA 2YVSA 2UXDF 4KHRA 1K9MT 5KFBA 1NU4A 1H2TZ 2FY1A 2XWYA 4PUOA 2A3JA 5J1PA 4OIXA 2R8JA 1YITS 3MCOA 3POTB 2UZAA 3TOQA 4DV1F 1B70B 3EGZA 3R5BA 2EEYA 5KOWA 3DDKA 1WOPA 2W24A 3SSSA 2EFGA 3AXKA 4I64A 3FSIA 4Q7AA 3BGRA 4I4BA 3GJTB 5D8HB 1RT6A 1BQMB 3K8WA 3MMAA 1OPZA 1TL1B 4LF9J 3JSYA 2F4FA 4NYZA 3GFYA 2K7KA 1N33F 4FPIA 4BWMA 1PJ5A 2H9ZA 3DOLA 3LQVA 1C0TB 4NXMJ 2ZOFA 3J7Z5 2MZQA 2J0WA 2JVRA 1YG0A 4F7VA 2H5JB 3TA1A 4DR6J 1M5PC 3EPIA 4B3MF 2WCXA 2A6OA 3OPKA 1J2VA 2ZD1B 1XN9A 2RE1A 3JTOA 3LW5C 3M8QA 4FP9A 3PIPQ 3MUTP 1TL7B 4I69A 1VBKA 3NEKA 3UD5A 5RUBA 3DRPB 4QCLA 2MZJA 3WX4A 1VQ6S 3G6YA 1P8GA 2DXDA 4ED5A 1S1WB 1NJWA 1IBLF 1Q8LA 3TZZA 2DHAA 1T9WA 1DQ9A 1HNXJ 3VAFA 1LOUA 1H74A 1EP4B 3VQSA 2ACMA 2HWIA 4P2MA 4AL6A 2Z57B 3EE3A 1RWXB 2ROPA 1E6YB 2ZH8A 1HR0J 3KLHB 4ZS6A 3D6HB 4CYUA 4MYTA 2BKNA 5AXLA 3RG6A 5LMUJ 4PR6A 5B09A 1WC6A 1OWXA 4AQYJ 2BE2A 1TK5A 4Y34A 1EETA 1TK8A 1JNRB 4NLYA 3TANA 1CJKB 3PRVA 2V2KA 3DLGB 4KB7A 4DL6A 1Q8BA 4ZITA 2DBBA 1NNDA 1OJ4A 2VONA 3KHRA 3QRRA 1IWAA 1FKAF 2D3OR 3GPAA 3P49B 4NLDA 3THTA 4WKRA 1LW0A 2Q3PA 2OPPA 1Q53A 2AZ1A 4FF1A 1UVKA 2CQCA 1UJ4A 1PKUA 5CYQB 5CQGA 3BGUA 1RABB 1M5HA 2MY7A 1Y10A 3PM9A 1CULA 4IG0B 2KFYA 1WUUA 3B78A 1YJUA 2VC0A 4BC9A 4JI0J 4PABA 2OIHA 3WC0A 4P6QA 4JI6J 3KG1A 3G8QA 1V6HA 4RU2A 3OJUA 3AOAA 2Q43A 4CH7A 2HIQA 4LF4F 2LQ5A 4E2FB 4X64J 2KRRA 1XJWB 5KFDA 1HQUB 4BWJA 3NMRA 1WC4A 4YB5A 5ADZA 2LEBA 3FRZA 1KN6A 1U1KA 4DV7F 5ETSA 2J7WA 4B9SA 3TUZC 2QX0A 5DLGA 4KT0C 3C15B 3TAMB 4TQSA 5ITHA 3IR5B 3C66A 3MM7A 4C8NA 1RBLA 1IKYA 4DOZA 3QJLA 4IOCQ 4WP3A 1SC6A 3UCZP 2LP4A 1KEKA 4I68A 4Y00A 5E33A 2M5YA 4NOHA 3MMCB 1HLWA 3JS9A 1URNA 4OZ5A 1HHQA 3SSRA 1QTMA 3QRPA 3CCQS 2NPIA 2BX6A 3H25A 3GCXP 4P10A 1OPIA 2JNJA 1VHFA 3MPYA 3L9ZA 2JEGA 1S1XA 3HSDA 1XTZA 2OPQB 3C16A 2DGUA 3ET6A 2R3VA 2PFDA 1RT3B 2WBMA 3RB0A 3M8PB 2ZOGA 3BPDA 5IT0A 2V8PA 3B4MA 1LWFA 3QATA 4HYKA 3CJKB 4FNIA 3W60A 2FZGB 4RO0A 1CS4A 2OPRA 3OLBA 2D7SA 3R1LA 3A4TA 2OAUA 1WACA 5A8RA 3H42A 1BQNA 4TY9A 2CIMA 1GQEA 3KLEB 2X3GA 1JLAA 3CDAA 3B8HA 4ZPTR 3LP2B 4XIUA 3F56A 2ZWPA 4GKJF 1NDCA 2FHJD 4DLEA 2GC8A 3GFZA 2F9JA 1A9NB 4C6AA 1IQZA 5THWA 1X5OA 1UVMA 1U0HB 4K8RA 4P75A 2AX0A 4TYAA 4OZ1A 1ZM2A 5D4OA 1Y7PA 3ADAC 1VQ7S 4DCJB 2W9BB 2E1MC 3SZ2A 2E9RX 3MEEB 4N8NA 2B7CB 1HMVA 1NB7A 4ED8A 2KHCA 3RBEA 5LJ3Y 3G8SA 4ICLB 4LFBJ 2BM0A 1GMWA 3H98A 3IGNA 1YBUA 1VC5A 1X5PA 4UQGA 4R0EA 1S6OA 2E5JA 3H90A 3S01A 1UEVA 2UP1A 2NZCA 2OTJS 1ZM4A 2HBQB 3DDNA 4USMA 1S6QB 4CLWA 1MNEA 2VB6A 4EUVA 1NJZA 2I6WA 2M70A 3GCWP 4DUYF 2XNQA 4C8YA 4R5PA 2JX2A 1RTIA 4JI4J 1MWZA 4HHHA 1HNZF 4I0WA 5J2QB 4OMFG 2BQ3A 1OQ3A 1FDDA 1RA7A 5K14A 3IN5A 1BQXA 2IRUA 5ETMA 4WCEQ 1MWYA 4ZVPB 3HHLB 5FDLB 1UZHA 1M5VC 2OSQA 4IKAA 3D68A 3GIKA 4LFCF 1FKOB 3NWRA 3RRKA 3E8OA 4ZLPA 3HSGA 4ECWA 3G9CA 3P6YC 4Q43A 3CCSS 3IMQJ 1LQ9A 4NYPA 4TY8A 2VOPA 4DR1F 1N0UA 2D74B 2Q6BA 2BJDA 3CCUS 4IRDA 4CO4A 3NNHA 3JQJA 1K1SA 4LREA 1FE0A 2DNKA 2JFKA 2SXLA 2YNGB 3H5UA 4PEOA 2AEJA 4KHPJ 2CJQA 1QY7A 2ACYA 4J9QA 2YH0A 2FHOB 3A3OB 1NJYA 3RBXA 5KFZA 2DHXA 2P8IA 2YKPA 2A18A 2C2EA 5KFEA 2R7OA 1PJ6A 4OYZA 4C8OA 3BB5A 1X0PA 2J8AA 4F02A 3G86A 4DQQA 1IQTA 2AJ1A 3SMZA 2HHXA 1QE1B 5AXNA 4QU7A 5IV4A 1XR7A 2KYXA 4IH7A 3DLKB 3L09A 2GVDA 2YBVA 3QT6A 4H4MB 5G4DA 2NREA 5HMYA 3NCPA 3BN4A 2NQPA 2AJ2A 3IR6B 4OJ3A 1XR6A 3HFZB 3PRDA 2PIIA 2Y0SD 3AOCA 4UOHA 3W2WA 4ZVFA 3UDVA 3VZHA 5IV3A 2MQOA 4BDPA 2KT5A 4C97A 1JXEA 2A1BA 2WHOA 2E1RA 2ZZNA 3M8SA 3PJXA 1YRUA 4UUWA 1QAJA 2XULA 3RRHA 2DNHA 1S59A 4MIBA 4M5LA 4O4GA 1JMTA 3CXCR 1ZTWA 1VK3A 2YNHB 4EZ9A 4CH0S 3IFEA 1KHVA 5BYSA 1WHWA 3CJ3A 3PVXA 1XQIA 1DZ5A 2MQ8A 4CO1A 4I2PB 1TFWA 5FJ4A 3TEGA 3M2UA 2C28A 5FIIA 1F6TA 3FVYA 2JJ4D 1RWMB 2HVHA 1D8YA 3LWMA 3MMBB 1QUVA 3W7BA 1ZBTA 1U48A 2OPSA 2HVZA 1NH7A 2CQ4A 2MZTA 3OVBA 2W7OA 4Y28C 4M5NA 3QSIA 4ES2A 1U26A 4N47A 2W9AA 1L5UA 1K0TA 4DR3F 1T03B 2DPJA 4W98A 3D7SB 1AZSB 1SL2A 4LQ3A 5KFPA 4EBCA 3RW6A 2IVYA 2V63A 3GONA 1YTYA 2CQDA 5J2NB 1WHVA 1UP1A 1WNEA 1RT5B 4DF8A 2ZM6J 5KFUA 2CZ9A 1TUGB 4CWBA 2N4DA 1WHXA 2GX8A 1CSJA 1L3UA 3GJSB 5DRKA 1TAQA 4O44A 2E5GA 4O3QA 2LQ9A 3N4WA 4ZK7M 2KVQE 1Q79A 1FCAA 3RB6A 3EPGA 3OHAA 3IG1B 1S1UA 2R7XA 4I6WA 3LALA 3QLHB 2FUG9 1GX6A 2O66A 3UE2A 4RR5A 3KLIB 1P9QC 4G1QB 1NHKL 4QIGA 2APOA 4ZP7A 4PYAA 2I2YA 1WI8A 1UWBA 1HBNA 5HMXA 2DH7A 1P9YA 3TO8A 1IM6A 3BGFA 2ZZTA 4ZLNA 5L1IA 2ASJA 2G13A 3SDEB 2VG5B 1RAFB 3GILA 2PMWA 3TAQA 4C0HA 1N5YA 1X4AA 4B9LA 4NCAA 2HS4A 4Q0BB 4NLQA 2CDRB 3T1YF 2ZFHA 2WAQD 2UVRA 3HVTB 2FDNA 2BW2A 1VBXA 2OEJA 3NGKA 2LXUA 3B54A 1URRA 3W9JA 1K0VA 2DISA 3NCQA 2CKWA 4EWTA 3NGTA 1FKPA 3ULHA 1RTHB 2J6TA 5A6PA 2V50A 1I94J 4QR2A 2OO4A 4YB6A 2V69A 1RB0A 2OELA 4ZJQA 4BBYA 1ULRA 1A7GE 5E3RA 2RQMA 1N48A 2CJKA 2LQBA 4L3NA 2ZE2B 2PD1A 2IBKA 1ZPVA 4L74A 4LRCA 2B51A 2EFPA 1WORA 3PYEA 3KKFA 4U67Q 1R8CA 2QSFA 3SYZA 1IKWB 2JEFA 4MFBB 3ISZA 2DNNA 4ZVSB 2AW0A 4C0BA 2DY1A 3M8ZA 3W65A 2V9KA 2C2KB 1N52B 2B5JA 2FIUA 2NSCA 3I4PA 5AE2A 1WJ9A 3IBFB 1LWCA 1VRUB 4CT9A 3M05A 3RB3A 3A8IA 1U2RA 2P6SA 2FGCA 4FS1A 4ZVGA 2LEPA 1R43A 2HRYA 1XC9A 2H4YB 1EKRA 2R7WA 3A1YG 2MY8A 2JEJA 3OLAA 3ICLA 2HBRB 1HI0P 5IXUA 4QOTA 5KTQA 3TUIC 1N54B 3POTA 3TEHB 4YY3F 3PRBA 1GXUA 2IJNA 1N6QB 4L75A 3JTNA 4DV6F 1KQKA 2Y1IA 2LDYA 4NLRA 5KFWA 1PC5A 4IR9A 1YX2A 3NGSA 4RBUA 1UVLA 2AZ3A 2DT9A 3WHIA 4DL7A 1BQMA 3CD0A 4KSEB 1RDRA 5J2PB 2EPIA 1TL1A 5GAGU 2AYEA 2ZJRQ 5EWGA 5DDPC 1H7WA 2PN6A 3G6XA 4FF3A 1RAAB 2AX1A 3T5JA 5E3QA 1C0TA 2NS1B 2MLZA 1XNQF 3UN5A 4PXBA 4A8YA 3DU6A 4DPTA 2ZKTA 3MGJA 4OYIA 2E9TA 1P1LA 2ZC3A 3NRBA 3EGNA 1UVJA 1FJCA 1JLFB 2M8HA 1FJEB 2BZ2A 2XSFA 5GVQA 1SJ1A 4DV0J 2IMOA 2M9KA 4ECYA 4EK2A 2BJ3A 2LQJA 4FKXA 2DR5A 2QRRA 2ZD1A 4C0OC 3V4MA 1TL7A 3CNQP 4DV4J 1HBMB 3MR3A 2WB1D 4DR7J 4DPOA 3DRPA 2C2NA 3AJ2A 3FBEA 5KFLA 2C3MA 3MCMA 1NKEA 3ZC4A 3VTIA 4JV0A 3I0RB 2JLEA 1KOHA 5M2RA 1YRTA 2FYXA 3BDPA 2JDJA 3FBFA 2KM8B 4K59A 4GVLA 1EP4A 3P8BB 4F25A 4L76A 2W4DA 2FY8A 5A8WB 4YEAA 2KHDA 2NXCA 1X5SA 1QD1A 3MD1A 3KLHA 3GFHA 3IWLA 3UR0A 2QLBB 3KLGB 4ZIWA 5KG3A 5ETNA 2IC3A 3CW2C 4OYXA 4JB8B 4RUBA 3ISND 4H4KA 4IQXA 4ZJLA 4F8RA 3ZNJ1 5DDOC 1S79A 1CJKA 3TZWA 1TFYA 2CQHA 3DLGA 3UN2A 1EQMA 1XMOJ 3TVZA 5E0OA 5IZHA 2AJFE 3HJFA 2HQCA 2GQ2A 3C6UB 2UXDJ 2QSWA 5E3AA 1SPBP 2JOQA 3FSXA 3O3LA 4WK1A 3D2WA 2B9YA 2RDDA 5K20B 4ED3A 4ED0A 2IAJB 2EG1A 4J37A 4JUZA 5L9XA 7FDRA 1N32F 1I1GA 5CYQA 2BUNA 4Y3CA 3TJAA 1M0SA 3PDNA 2VQEF 2WSFC 2QA1A 4IG0A 3R97A 2AEFA 1W2IA 3RAXA 2XEXA 3C19A 2VKZG 2HFOA 3NP5A 2DYAA 4Z7CA 2B4OA 1FERA 4MH8A 2XS7A 1FO1A 2XLIA 1S76D 3NNAA 1WG1A 2DR6A 1LXJA 3M2RB 1BWVA 1TUWA 2UVVA 2EFQA 3AD9C 3LWLA 5LXYA 3D6MB 1YLXA 2LA4A 4NLOA 3J80U 2CADA 4RW9B 1KHWA 4U9RA 3P45B 1Q5VA 2FGOA 3BGOP 3IRXA 4ZA1A 1HQUA 3OVAA 2BJ9A 2IM3A 3UWTA 3I56S 3BBBA 3W9HA 1FFWB 1KKHA 3WZ0A 3C15A 4P2FA 1P1TA 1U6FA 3LF0A 2HEKA 3TAMA 2QG9B 3ZZUA 3R3TA 3LGNA 1CC7A 1S1VA 3DXSX 3AJDA 4MKVA 5C2CA 2FVSA 2C22A 4TU9A 2F65A 4Y2IA 2ZHAA 4XTTA 1C1CB 1CQNA 2FD2A 3QQCD 5J1NA 2CQ1A 4LSZB 3KMSA 3NLCA 1V3SA 3MMCA 3Q83A 4NLUA 1S48A 5DM7Q 2G0CA 2EC2A 3PHEA 4DR6F 3DGVA 2J8SA 2DNRA 3OD2A 2FB0A 1TAUA 1PAUB 3ZZPA 3BQ0A 3DKDA 3JSMB 2OPQA 3N6NA 4Y2CA 2I5JB 3BREA 4A8KA 1UCNA 5CABA 4HI2A 4OFZA 2IVFB 1KC8T 1RT3A 1VBYA 2HFSA 2EFOA 3M8PA 2N7YA 3TX0A 3LAKA 1Y00A 3Q24A 4ZCKA 4CLKA 1PO6A 4LQ9A 4MK9A 1S0NA 1UEKA 2BA9A 1AXQA 1DQ8A 1JLQB 4ETZA 3CJKA 4HH1A 4IDKB 1X4FA 4QWAA 1PYSB 2C3YA 3I5BA 4WXOA 3H40A 2DXFA 2R4FA 3P5BP 4NX9A 3OFEA 2AV5A 1VR6A 4IRKA 2V4JB 4ANCA 5F8LA 3NS6A 1ZA1B 3KLEA 3T3FA 1BWEA 1AROP 4Q8FA 3N0VA 2RQ4A 2R2TA 3LP2A 4F3MA 4OX8A 4M5GA 1VLOA 3LPYA 2UUBF 4EU0A 1TKTB 4P73A 2QLXA 7AT1B 2XG8A 4CO3A 3IR7B 1CLFA 3K5PA 5LMUF 2R9LA 1U0HA 1GNKA 4NZ7A 4AQYF 2U2FA 2J7UA 3V6KA 3HPOA 3H5XA 3QNWB 1N0VC 2Y8WA 2Y3YA 2QMWA 2W9BA 3MEEA 2VBWA 1S12A 1TL3B 1W25A 4LF4J 1NK5A 3J7A1 1UW4A 3R5CA 1TK0A 4ICLA 3N79A 2W7PA 3UD4P 4OI1A 2JWNA 3CF5Q 5IM0B 3NAHA 2R2UA 4NMXA 3V6HA 2XO7A 5KFTA 4UT4A 1MU2B 1OIAA 1WC1A 2R8GA 4RNFA 4DSKA 1AFJA 2B6AB 3PXGa 1TKXB 2VFVA 3RB4A 4X2BA 2CJ9A 1GTHA 4KPYA 4J9OA 2KG1A 2YH1A 1S6QA 2H65B 3N5FA 1M5SA 1JLCB 4DEZA 4V19X 4JI1F 2V4RA 4K4VA 3NGRA 5J2QA 4PWDB 2DEJA 2DNQA 2PI4A 3DRSB 3M30B 3U7JA 5K5MA 3LPEA 1X7VA 1VQMS 2LMIA 4Q8EA 2MXYA 3HHLA 1VQKS 5FDLA 2RQKA 4JI6F 4XPEA 4YHHF 3EZOA 1FKOA 3KXDA 5LMNJ 4Y2AA 1RISA 2PGCA 4P7VA 4F0MA 1NRKA 3QJPA 1X0FA 1T8EA 3L4BC 4USKA 3Q8RB 3KYLA 1FTRA 3DMJB 2X7IA 4DFPA 4UZCA 3CSKA 2YNGA 1H98A 3QAUA 3UVJB 3ELHA 2CG4A 2ZNYA 1UWAA 5CZVA 4I1TA 2BR0A 1SH0A 3D0GE 1H0HB 4NA3A 5KFYA 2FVRA 1N56A 4NMLA 4BHQA 4DQRA 5A8KB 4JOUA 2J9EA 4LSNB 2RUSA 1QE1A 4CLTA 1BHNA 1VQSA 3L95X 3I31A 3EYZA 2QLFB 3PFOA 4PQUB 1SUQA 3DLKA 2MEWA 4H4MA 1V5VA 2QL7B 4GKJJ 1R8AA 1S4FA 5HQMA 3BZQA 1FFSB 5D4NA 1AUSL 2XWXA 4DR2F 3KK1B 2EKNA 1QDUB 2BKOA 1HBUB 3CCVS 3Q2TC 3IM8A 5DETA 3A8EA 2FVCA 3KLFA 2K8GA 2R2SA 3R8YA 3VVTA 5CYJA 1HNVB 4MK7A 3N9UC 4M5MA 4GKKF 3CJRA 4W90B 2BMBA 2F3JA 4DSLA 2QA4S 3QRQA 2MQNA 4U7UD 3DLJA 1J5OB 4JBCA 1DLOB 3K0JA 2JEIA 4J9NA 4USIA 1FE4A 4HHUA 4Z37A 4MKAA 1S7IA 3GLJA 1WEXA 1Q86T 3CE8A 4ES1A 2YNHA 4DJBA 2LECA 3D5MA 4DR5F 4PG8A 3PHTA 1D3WA 5KFJA 1MLAA 2HK3A 1RAIB 1WF2A 4DUYJ 2QYCA 3V4IA 4ZP8A 2Z2MA 3ISNC 1H38A 4I2PA 3GV8B 1T05B 5A2QY 1WEYA 4JI2F 4U8YA 1HHTP 2ZJQQ 4RBVA 4AL7A 1M5KC 2KFZA 2V8GA 1HWJA 5KFMA 3BM7A 2NXEA 3MMBA 1KBRA 1BXNA 4WFNQ 1RWVB 5D4PA 2W2OP 5I3QA 2H48B 4LFCJ 4ZMMA 4FF2A 3U1NA 4EMDA 4LFBF 2CPJA 3OJSA 4K2XA 1B0VA 4DR1J 5BJRA 5BYRA 4OI2A 2Q6CA 3GE9A 4OX9F 2VICA 2E1CA 5T14A 3L7UA 3MM9B 1T03A 1AZSA 3KG0A 5D15A 1RP5A 2JC0A 5KG2A 4MIAA 1VIOA 1WD6A 2DHSA 3L7PA 5L1LA 2HBZB 2MQQA 4LJMA 5J2NA 1MG7A 2NXNA 3DM2B 1RT5A 4TN2A 2DHHA 2AJ4A 5IS2A 2QL9B 4FVCA 1B0PA 2ZDPA 2K3KA 2RU9A 3GIJA 4JV5J 3I32A 9RUBA 5HL7Q 1N5TA 4OI6A 4L6V3 2X1FA 2DHGA 3D28A 1KSPA 3CUNA 3ENVA 3IG1A 3ZTQA 1SC4B 1TV6B 3QLHA 2LEAA 1KFDA 3H5SA 4AXIA 4ZVHA 3KLIA 5F3ZA 2N7CA 4G1QA 1BGXT 4DL4A 5I42B 1EIYB 2XZTB 3GMGA 2RS2A 2MKJA 1DBDA 3Q8PB 3QZ8A 2DKOB 3BKUA 2E44A 5I3PA 3OT9A 2HVDA 4KIAA 6FD1A 5ETPA 2HK2A 5F8HA 4DQIA 3SDEA 2VG5A 3T1AA 4ZLJA 3DFEA 4OZJA 1RA6A 2V6AA 3I87A 3W5ZA 3FEXB 3D0IE 4LBHA 3H2LA 4Q0BA 2ZDOA 5L39A 1QAIA 2BQRA 1ZYQA 1VYAA 2VF3A 2E7WA 1RGVA 3M1VB 3HVTA 4UQTA 3BBFA 2IDLA 2WRMA 3H4DA 1U09A 4F2SA 4AL5A 3RJMB 2A0FB 4OZLA 4FVMA 1VBZA 2G2OA 2FVQA 1JQGA 3RBZA 2XB2D 4DCPB 4JI5J 2D9OA 1A0OB 3OUYB 4OHXA 2ZE2A 2ZOMA 2OEKA 4DF4A 1SL1A 2YWKA 1GFWB 4K4WA 1WEZA 3W5YA 4ZPWR 3PG9A 1REGX 3MPWA 1KP6A 4WE1B 1IKWA 4MFBA 4KO0B 3TZXA 3GP9A 1WC0A 1NDLA 3AODA 2MQPA 5KT4A 4DR3J 2DGVA 1TKZB 1R0AB 4B9MA 1HFEL 3FFIB 3HK2A 4U95A 1KDNA 3PX4A 3HCXA 1B0TA 2OFHX 2VPWB 4F04B 1VRUA 4ZLLA 3CCMS 3K5LA 4CLSA 2O67A 4L3KA 1I6JA 3GQCA 2DIVA 3TX8A 3EVOA 5HVFA 3QJJA 2QLJB 2QEXS 2IM0A 2AGQA 1VQ9S 2QMXA 1XMQF 1Y0HA 1RSCA 4QWBA 4EI2A 4PXDA 2JFDA 2K06A 1D9AA 3LO3A 2M0GB 1HWIA 1N6QA 1KWMA 2WSCC 2YWEA 1NPKA 2C2OB 2OD4A 1X4GA 1U6ZA 4NLVA 1T11A 4FXVA 4ED2A 2L9DA 4OHVA 1WC5A 2MKHA 5J2PA 4M5IA 1HWLA 3ONQA 1MMNA 2KVIA 3PEJA 1S5ZA 1NKBA 1JLBB 1C0UB 3VGSA 4ELVA 4G1PA 1TL4A 3VWSA 1Q16B 1FEEA 3KNAA 4EEYA 4L73A 2RMLA 2GGPB 1JLFA 3T1YJ 2CPEA 4F26A 3TZYA 1I3OB 4U96A 1UAWA 4QYZJ 3CIMA 4G6VB 5GAEU 1FDNA 5D0HA 5I4MA 2DK2A 2DEIA 3HHKA 1FD8A 4URGA 2JLFA 4H4KC 1KVKA 5HBMB 2PC6A 2ATCB 1VMBA 4K7QA 4A46A 1HBMA 4DI6A 3K58A 1MMDA 4KBIA 2CQBA 3DLEB 1DRZA 2HHHJ 2J0XA 1IBMJ 1DHMA 4G3IA 3RZAA 3J7AN 1ZAXA 1PIEA 2F8EX 3WBZA 4TQRA 2RRNA 1RBAA 3I0RA 1GK8A 3CMAS 5K8NA 3C8YA 4YS2A 2W9CB 3GWCA 3CDWA 1IBCB 2GCFA 4OYAA 1BC6A 2R8HA 5HP1B 2CJAA 4NASA 5A8WA 1HQ2A 1QSSA 3MM8B 4DWIA 2MQMA 4ZIVA 2OH2A 1T9YA 2QO3A 4CO2A 3ITHB 3KLGA 2JL9A 3N28A 1HYSB 2FJAB 4N77A 5CYMB 1KLMB 5H9EK 1B3TA 2CUYA 2XQCA 5DO2A 4OX6A 4HR2A 3LP1B 3A8JA 1J27A 3BGLA 5H1SV 2J0QD 5KFCA 3EDRB 2AU0A 1QSLA 4I6YA 1UA1A 3UFCX 4AUKA 3UPFA 1I94F 3X1LB 3CJ8A 1XNRF 2ZH6A 2XBPA 4QIEA 3C6UA 3DN9A 4N5SA 2C2MB 4R25A 1Q1KA 2VU5A 4G65A 1Z2ZA 5L1JA 5AT1B 2V8VA 4JI3F 2AF6A 2ASLA 2E29A 4UW2A 3FC9A 2BANB 3ENWA 4YY3J 2MGZB 1MW7A 3BO4A 2IAJA 2VQFF 1HKAA 4ZCMA 2KH9A 3AHPA 2CA9A 3OSPA 1NBEB 3PV8A 3ILOA 1RJJA 2M4MA 4KYZA 4F4KA 3LGMA 4X4UA 1X4DA 3WIVA 4ZVTB 3KLVA 2UUCF 5MAOA 3IXQA 1XNQJ 3M2RA 4U7UK 3DI6B 5KFSA 2GO9A 4QPTA 4RW9A 2ATLA 2DNPA 3EUNA 2HHPA 2E5IA 1WKLA 1U1MA 4Q2LA 3R6LB 1S9FA 4ENOA 1VRQC 3AT1B 5C7PA 5SUHA 2WOMB 2BRLA 4C4WA 4G1IA 4JV1A 1YGYA 3EX7B 1LEOA 2ROEA 4LSLB 1Q5YA 4LR8A 3GR1A 3TJ8A 1RWNB 3IA0A 5E7OB 2F8MA 3KUHA 3QGPA 1KONA 2KB2A 4C3MA 4JI7J 2ROGA 5HLFB 5FD1A 2Z8QA 2JLGA 4CQ1A 1C1CA 2QC3A 1G1XA 4PG5A 1FESA 3RAQA 2OMOA 2HNYB 1RHJB 3FCHA 2HWHA 2X1BA 5H9FJ 3CULA 1NXIA 3B6BA 2KKHA 2BXJA 4ZHRB 4DV0F 5EGYA 4QIWD 3JSMA 4DFMA 3R5JB 2I5JA 3EXCX 4M5DB 3PKYA 1FNMA 4OI0A 4NE9C 8ATCB 2NXUA 4AT1B 3OV7A 4F0KA 1KRPA 2C2ZB 2XTJP 1SL0A 4CDIA 1JLQA 2DNLA 3I96A 4IDKA 1XR5A 2CQPA 4WP8A 4QW9A 4EGLA 2DITA 2CZ4A 2LDIA 3BJYA 4ZDNA 1NPPA 2X1GA 1HNIB 3N01A 4FYDA 2V4JA 2DR9A 2YXLA 3FEYB 4CO5A 3T1HF 3VGTA 1HWKA 1N32J 3JQMA 4S0MA 5B0FA 2D9PA 2VQEJ 1HA1A 4IYQA 3KFWX 3RW7A 5C5JA 5KT5A 1ZAWA 5J1EB 4ETXA 4WFBQ 3UDEA 4M95A 3SEOA 5HN0A 3KJVB 1VOMA 2HBYB 4RNHA 1T3OA 2W2QP 1TL3A 2RKIB 4AFFA 1LWCB 3HHLC 3R5AA 1RHUB 3BH6B 5KT7A 5IM0A 6FDRA 2Z2LA 3OTBA 1BUXA 2XMKA 4HHJA 2KJVA 1MU2A 5M2UA 2CPIA 3BQ2A 2B6AA 2FJWA 1TKXA 2QLWA 2GMLA 3D6FB 3SBMA 1XIQA 4UZBA 1OSCA 1LK5A 1D0EA 2O1PA 3AJ1A 2HQGA 2KT2A 2G9OA 2MHNA 1JLCA 3FBCA 1RT7B 5KFGA 3IWXA 3SV4A 4LUBA 5KT3A 2BEFA 3VVUA 3C6TB 4PWDA 1IKXB 3Q8UA 4KH1B 3DRSA 3M30A 1HPZB 2DPIA 4O3PA 5BXIA 5BR8F 2VG6B 3GIIA 1WG4A 1RWKB 3IGVA 1B99A 2NZ4A 2KYZA 4X62F 3KJNB 3MR2A 2MHEA 3LH2S 2RRAA 2CPXA 3EICA 3UW1A 2R42A 4BLGA 3OTEA 3TA0A 3SQGB 4DDFA 2VPZB 4ZVOB 5AXMA 2J9DE 3DMJA 2FHKA 2BJ7A 2ZKUA 2KI2A 5K9FA 4ECZA 4K50A 1FXDA 3UVJA 2GHWA 2W2NP 3FQLA 1NM2A 2IA6A 2NLWA 2AHOB 1VQNS 4P52A 4IUFA 2VJVA 1RAOA 3HDSA 2NSBA 2UXBF 3MAAB 2CDQA 5A8KA 4LSNA 2DNZA 2YWFA 4IFVB 1N5SA 4CI0B 5HQLA 1LNQA 1RTDB 1RWPB 4PQUA 1X5TA 3HD2A 4A47A 3L3CA 3Q23A 4YDXA 1S4EA 1LFWA 3KHHA 5GADU 3MM6B 2UUBJ 2IHR1 1YRXA 1O8BA 5C25B 3KK1A 2M8DB 2IC3B 1GAOA 1HBUA 2L08A 2HS3A 1R0CB 2FC9A 2FZKB 1QTNB 1BY9A 3SV3A 5F3TA 4O3NA 2D1CA 1HNVA 3C46A 3J81U 4CNYA 1U1NA 3MM5B 2CNOB 4W4MA 4NA2A 4B9UA 2YPZA 2HNZB 4O0NA 1KQFB 1J5OA 4O23A 5DS7A 1Q0NA 1DLOA 2VFUA 5DZ7A 2HWTA 2OSRA 3SCIE 5CD4H 4WF9Q 3GIMA 4OJGA 2CQ3A 2B0GA 5ETLA 4NCGB 4NEYA 4WTOB 1HHSA 2DIUA 1IM4A 5E3PA 3OSNA 2EK6A 4F36A 1AFIA 4ERDA 1Y5LB 4EO8A 2R7RA 4DPUA 1FRIA 4B3SF 4OYBA 5F0UA 4RZRA 4ID5B 4JI1J 4C7QA 1J5EF 4P7TA 2HLUA 1T05A 1NDKA 1SH3A 4DMZA 1SJQA 1Y9OA 3PACA 2XHWA 1HIYA 3UN3A 3SI8A 1FF2A 3N6LA 1S9GB 3UO0A 2HAIA 2JC1A 4OJ1A 2PFFB 5MLCV 4YHHJ 1CQMA 2PE8A 1N36J 3Q22A 2HGLA 2CWKA 2FLPA 2B7BB 4AYBD 1IR0A 3ILIA 4PXCA 2DD8S 5DG9A 3MPVA 1Z1ZA 1NH8A 3CCJS 3THPA 2QT7A 1RAHB 1WWHA 4U8VA 1NJXA 3IRXB 1PBUA 3MM9A 4DSJA 1SV5B 1KQSR 2GZOA 1FNXH 2XMUA 4J9RA 4CRJA 1CJTB 2WONB 3MCSA 3DM2A 3NMAA 3HVAA 4HLBA 3W63A 5K8MA 5AE1A 2NYIA 3SQOP 2LU2A 4NL5A 2UVWA 1S1VB 3CCZA 1BD6A 3PZPA 2JZ5A 4URSA 1HL6A 1NJIT 2MMYA 3VQTA 4RNNA 1FRKA 1S10A 4Q44A 1ZA2B 3MECB 4TVAB 2V68A 4RNOA 3GG0A 3AQOA 4ITSA 2PA3A 5LMNF 1TV6A 2HHQA 2XMWA 5C2GA 5I3UB 5JVGQ 4N8OA 3IBWA 2DGQA 4DR2J 5D3GB 4TU7A 2MKIA 5I42A 2IRYA 4ECTA 1PYOB 2K1RB 1R0BG 3C2PA 4ALZA 2VFSA 3TARA 4GKKJ 2XY5A 5ETTA 3GSIA 4DU8A 2XMVA 2YKQA 2BJEA 4HEA9 4IO1A 3ZZZA 2F5GA 2NUHA 3IWNC 3OFHA 4X65F 3T19A 3THVA 3SFUA 1AUDA 3M1VA 2J0SD 1X8DA 1E6VB 4KFBB 4P71A 4DR5J 4ATNA 1F9EB 3G71S 1VQ8S 3G6VA 2I9SA 2HW3A 4FF4A 3MXHP 1F60B 2Z2YB 1AYEA 2IBOA 1UEUA 4JI2J 1BLUA 3IBCB 2W4CA 4IG3B 4R8UB 4PRFA 3R2CJ 1R31A 5EN1A 5J2MB 2BDPA 3OUYA 4EBEA 4KGVB 1PSDA 2CJBA 2DH8A 2I1RA 1K47A 2G2ZA 1TVRB 2VFTA 2ZUGA 1YQHA 4WE1A 4NXNJ 2HQDA 2KXHA 3OTCA 4NA1A 4KO0A 2J9CA 4F4YA 4ECXA 3GSDA 4OX9J 4QIVA 3R5GA 2D3ZA 1TKZA 2FTRA 1R0AA 3PCOB 1LFPA 2WVBA 2AJ0A 4USWA 2CPFA 4DPYA 3HVWA 1ZS6A 4D3GA 3FFIA 3KMQA 4E98A 2R7TA 5L9NA 4PKDB 1CG2A 4MK8A 3NY0A 4HH0A 5LSLA 1HQEB 5LM7E 3F44A 2XYGB 1WTFA 4DUTA 3KK2B 2G1DA 3EXYA 3VCDA 4A8OA 1SI9A 3D1HA 2R8KA 2RVJA 2ZH4A 5LXRA 3KDNA 1ZOTA 1JX4A 2H54B 1PJ7A 3PR5B 2GW8A 4DX8H 4I7FB 1FT8A 3P5TL 3AAWB 2QN6B 1VIXA 1LW2A 1VCTA 3T6JA 1U25A 2L41A 1EARA 4XPCA 2CJYB 3PO4A 1DY3A 2C42A 2MLXA 2HFVA 1U7LA 2G0IA 1UFKA 1Q8KA 5JXSA 4IH6A 4DSEA 4I6AA 1S0VA 1M5OC 3F0NA 3MTJA 2HFUA 4Y65A 2OHDA 4DPWA 3MI7X 5IT9U 4CO0A 4WFYA 3K5MA 1OYDA 1JLBA 2KM8C 3TJ9A 1C0UA 3FKBA 4LF7F 3DGPB 5F41A 4CIOA 3K8VA 1WC3A 4RW6B 4PCQA 3HZGA 4GMKA 4LIRA 2OFGX 2IIHA 3X3UA 3B4DA 5KG6A 2GGPA 5HK4A 3SIPB 5CZXA 1LK7A 2YKMB 1NSPA 5B7WA 2AGPA 4WP9A 1FD2A 4DL2A 4JV5F 5CXTA 5HBMA 2PI5A 1WOOA 1SUQB 1D1UA 3NL0A 4J91A 1XBWA 3DLEA 2ZH2A 1TELA 1NK6A 4DUZJ 3HF5A 1RLDA 1DAXA 2BRKA 1NK0A 4DV2F 3OXFA 1HWUA 1YJ9S 2LFVA 4QPXA 3MDFA 3KLFB 2W9CA 4OHYA 4MJKA 3GU0A 2WK4A 5HP1A 1M90T 1Z2LA 3QIPB 1FVSA 2Y0BB 4USVA 3MM8A 3GV5B 3VAHA 4MTPA 2CPZA 1YBTA 4HACB 3W8PA 1FNOA 4KR0B 3ITHA 1ZPWX 2Y1RI 1HYSA 1R8HA 1RUSA 4ELTA 5IWAF 3O5TB 5CYMA 3CJSA 1KLMA 1S72S 4J9MA 2HZAA 1SC1B 4Y6IA 4OYWA 3LP1A 3RR8A 3EGVA 3J80Y 3FQKA 3V4IB 4F4ZA 1R3NA 2DRAA 4LF2A 2B56A 3EWGA 3Q8SB 5T41A 2OMLA 4JI5F 3LGHA 1XWLA 3MR5A 3FEZA 3E2EA 4YB1P 3K7RA 1FRLA 1XMQJ 1Q7LB 5KT2A 3SCJE 2XC9A 2V2QA 1RU2A 2BANA 3E3XA 1N8RT 2MKSA 3MAHA 2MGZA 3FZBA 2HFZA 1G7CB 5GAHU 3PYDA 4N56A 5C24B 3D0HE 3ZFVA 1VRTB 4CLLA 1ITPA 4IOBA 4O3RA 4O0IA 1H3DA 1OS5A 5KG7A 3PY8A 2UV8G 5H9EJ 3T5KA 3BO2A 3CJQA 3GIRA 1T9UA 3DU5A 1W26A 4X66F 4KAIA 1FJ7A 2C3UA 1U1OA 4PXEA 4ZPDA 4P9SA 1F3VA 1O51A 2QE5A 3DI6A 4PPDA 1N34J 3TWZA 4X4SA 3BN7A 1FVQA 1ZM9A 5ETVA 2M3DA 4OHZA 1G4CA 4EYIB 1RAEB 4UOGA 2KRBA 4C2MA 2ZJPQ 4OL8A 1SKSA 2WOMA 3M9MB 1P6TA 1VGYA 3N5BA 3LAMA 3BR9A 4A8QA 4LSLA 3D1QA 2GMJA 3IO1A 3TVKA 2VPXB 2HRTA 3PW5A 3M32B 2CXEA 3US5A 2VIHA 2UU9F 4LF8F 2KO1A 3IAM9 2FLOA 3PYGA 4TKTA 3OTOF 2EBEA 1O6XA 3RUBL 5KFXA 5HLFA 2IA0A 3HHNB 2CQIA 3RTVA 1Q8IA 4QBUA 1GMWD 1NHVA 3H4BA 2PEHA 2HNYA 3TYTA 4FYXB 1QAYA 1YI2S 3I5CA 3C3LA 2XS5A 3I9ZA 2X51A 5KFNA 5EDWA 4DR4F 4I2QA 4RBTA 1NMEB 1DURA 2F4VJ 3UDLA 4ILMA 3IC1A 1Z4UA 4ZHRA 4K4ZA 3DRRB 2UXCF 4LRDA 3H2VE 1WHYA 2V5HG 2BYCA 2Y1LB 2YKOA 2HHUA 3D1OA 3ZXWA 4M5DA 4AD6A 4UUXA 3R7SB 4B02A 1RT2B 5F8IA 2UUAF 2HHHF 2N3OA 1XNRJ 1YBAA 2NUUG 1IBMF 1NSKL 5HROB 1QJHA 1KD1T 2AD9A 3CDEA 3HFVA 1YZ6A 1TQLA 1RYSA 4DS4A 3CJ0A 3TQEA 4JI3J 4J9UE 1U6BA 5GAEI 1SJ3P 3PEHA 3W8GA 1HNIA 4H4OB 1LXNA 2DJWA 3W66A 2LKZA 2VQFJ 4YB7A 1LWXA 4CLPA 2MKKA 1QAXA 2WW8A 3MR6A 1IUJA 1SB6A 3EJMA 2XM3A 4YOEA 2ASYA 5J1EA 4K4TA 2GV1A 1ZETA 7FD1A 2V8HA 2ZVSA 5D6GA 3CJ4A 1S6UA 2UUCJ 1CJVB 4ECVA 3KJVA 3QBCA 2AP6A 1RQ0A 4LF1A 2KT3A 2RKIA 2VKRA 2ZH7A 2OUGA 8RUCA 4QYZK 5FLXU 5DG8A 2E66A 4KGMA 2P5VA 1JJHA 1A6LA 4YQWA 4P72A 2VODA 2VBXA 2EXUA 1OY6A 5CH7B 4HKQA 1NCLA 2VBZA 1JJCB 5DLFA 1S9EB 2FHJA 3UNGC 2YQ3A 1VC0A 3CD7A 1RT7A 2KL8A 3ZO7A 4C3KA 3C6TA
chains in the Genus database with same CATH topology
2OD4A 1X4GA 1IBKF 1U6ZA 1WF0A 4NLVA 3G9CA 3E01B 4FXVA 4ED2A 3P6YC 1GT8A 4Q43A 2L9DA 4OHVA 1IJEB 3CCSS 4FXDA 1IKXA 2MKHA 1LQ9A 2BBEA 5J2PA 4NYPA 4TY8A 5C42A 2HFNA 4DR1F 1HPZA 4KRWA 2MB0B 1N0UA 2D74B 1U4BA 4X64F 1HWLA 2Q6BA 3ONQA 3VAJA 2PSZA 1X4BA 2BJDA 1MMNA 4CO4A 3CCUS 4IRDA 3NNHA 2VG6A 1ZH5A 2KVIA 2GQCA 3PEJA 1K1SA 1O5JA 3MURP 3HHEA 1NKBA 1NKCA 4MIWA 1FE0A 1JLBB 1C0UB 1NAQA 2DNKA 2JFKA 4ELVA 4G1PA 2VH7A 2HG4A 4PQAA 4WZQA 2SXLA 2YNGB 3H5UA 1TL4A 3M8QB 4IH5A 3DOKB 3VWSA 1Q16B 2CJQA 1FEEA 1QY7A 3KNAA 4EEYA 3DXBA 2RMLA 2ZC4A 2ACYA 4J9QA 2YH0A 2GGPB 3MEDB 4FZVA 1F0XA 1JLFA 2FHOB 2ILYA 1NJYA 2CPEA 4F26A 2K7JA 5KFZA 1UAWA 4QYZJ 3CIMA 2DHXA 3FDSA 4G6VB 4RUHA 2YKPA 3SQGA 5GAEU 2M2BA 2A18A 2DGTA 2C2EA 1FDNA 5KFEA 5HO4A 2R7OA 2GIRA 4HT5A 5I4MA 2DK2A 4NYOA 4GO5X 3HHKA 2ABYA 1FD8A 4J9SA 2UVUA 4MAKA 4C8OA 1H2VZ 1N5QA 3J7YI 3BB5A 1X0PA 2J8AA 4F02A 3G86A 4URGA 4PG4A 1REVA 2B3TB 4DQQA 2JLFA 1IQTA 4H4KC 2AJ1A 3SMZA 5HBMB 1QE1B 2PC6A 2HHXA 5AXNA 2ZBCA 4QU7A 1VMBA 3CCWA 3QMQA 2QA2A 4A46A 2E9ZA 2VUGA 1B7FA 1HBMA 1XR7A 2KYXA 4RWWA 5B0DA 3K58A 4IH7A 1MMDA 4KBIA 2BQUA 2FLNA 3DLKB 2CQBA 3L09A 3DLEB 2HZCA 1DRZA 2J0XA 4DL5A 1DHMA 4LVOP 4G3IA 4H4MB 3RZAA 1P27B 1NK7A 5G4DA 1AW0A 1ZAXA 1Q7YT 2NREA 3HKWA 2F8EX 3FJ2A 5HMYA 3WBZA 3NCPA 4WFZA 4TQRA 3BN4A 2RRNA 3JSRA 2NQPA 3I0RA 4PWUA 3I82A 3NCRA 4JI7F 2LA6A 3CMAS 3IR6B 4OJ3A 4WKYA 5K8NA 3DC2A 1YJTA 1Y5IB 2WSEC 2B9WA 2W8KA 3C8YA 3R1HA 4IFVA 2W8LA 1XR6A 3PRDA 5SZTA 2W9CB 2PIIA 3LP0A 3GWCA 2BE2B 2Y0SD 3CDWA 3W2WA 3GYXB 2GCFA 4Q2MA 3DLBA 4Y2KA 1RTDA 1EETB 4ZVFA 3VZHA 4QYRA 3HM9A 4OZNA 2A2DA 1BC6A 2R8HA 4RU9A 1NEEA 3V6DA 1SH2A 1U2FA 4KV8A 2X1AA 5HP1B 3H59A 1GX5A 2CJAA 1MSWD 2MQOA 1JKHB 5A8WA 4BDPA 2KT5A 4C97A 1N4LA 1JXEA 1QSSA 3DYAB 2XCAA 1JKHA 3MM6A 2YKAA 3MM8B 2A1BA 2WHOA 3ZZOA 1UA0A 4DWIA 2RF2A 2E1RA 2MQMA 5B0EA 2ZZNA 5T7LB 2OH2A 1T95A 1M1KT 5C25A 2CPDA 3M8SA 3PJXA 2QO3A 1YRUA 3ITHB 4CO2A 4UUWA 2JL9A 3KLGA 4A8WA 1TUVA 1QAJA 2WBRA 2GMHA 2ZBIA 1G2EA 2XULA 4YDDB 3RRHA 3N28A 2DNHA 1SJ4P 4MIBA 1HYSB 4O4GA 2FJAB 2FHMA 4N77A 5CYMB 3CC2S 2YTCA 1KLMB 4QQBA 1JMTA 3CXCR 2DGXA 4WYLA 5KFHA 1JK9B 5DJBA 1ZTWA 5DO2A 4JV2A 1VK3A 4OX6A 1VS3A 3AA8A 3LP1B 3MM5A 2YNHB 4WFXA 3BGLA 5H1SV 4EZ9A 2J0QD 5KFCA 4CH0S 5KFOA 4RKUC 3GZ7A 2AU0A 1LW0B 1CPZA 2HNZA 2ZH3A 1QSLA 2OPPB 4FN5A 4YR0A 3VAIA 4I6YA 3IFEA 1KHVA 5BYSA 1WHWA 1UA1A 2EK1A 3UFCX 4AUKA 3CJ3A 3PW4A 2OD6A 3PVXA 3UPFA 1I94F 1DZ5A 1UVIA 3X1LB 3TR5A 3HX9A 1XNRF 5JVHQ 2AWZA 2ZH6A 4CO1A 1DTQB 4I2PB 2XBPA 1TFWA 5FJ4A 3O1LA 3MMJA 2Q66A 4XO0A 4QIEA 1JLEB 3C6UA 3M2UA 3DN9A 4NCGA 5KG0A 4N5SA 2C28A 1D9FA 3RU0A 4R25A 5L38A 2FJXA 1Q1KA 5FIIA 2Z4PA 3FRYA 4IRCA 2R7SA 2JVOA 3FVYA 2JJ4D 2N82B 1V3ZA 1Z2ZA 4RLEA 2IJFA 5DDRC 1C2PA 2K3IA 5L1JA 2HVHA 2V8VA 1D8YA 4JI3F 2AF6A 3LWMA 2ASLA 2E29A 3CEDA 1QUVA 3MMBB 4UW2A 4I56A 3W7BA 4IR1A 4X4NA 2BANB 2CRLA 3ENWA 1FA0A 1ZBTA 4TYBA 3MWBA 1NK8A 2MGZB 3DHWC 2MSTA 1MW7A 3BO4A 2IAJA 4IQMA 1X9WA 4ID5A 3HMJG 2AGOA 1U48A 2VQFF 1FK9B 4YFUA 2OPSA 3H5YA 2HVZA 1KOOA 1T3NA 1NH7A 2CQ4A 1S6PB 1F9FA 2J6SA 4WZMA 3TI0A 4IO9Q 4ZCMA 2MZTA 2KH9A 3OVBA 1S97A 4TU8A 3RR7A 3AHPA 1RTJA 2W7OA 3NGDA 1C1BB 2YX1A 3OSPA 4Y28C 4A8SA 4MKBA 5IQQA 2ZZMA 3QGIA 4QR0A 4ES2A 2DRBA 4JI8F 4C98A 3PV8A 2MZRA 4RUAA 3M2VB 5JUMA 1RJJA 2M4MA 1U26A 2FC8A 2CZVC 2LVWA 5A6WA 4N47A 4F4KA 3LGMA 2W9AA 3VF0B 1L5UA 4X4UA 1K0TA 1YJWS 1X4DA 4DR3F 1T03B 2DPJA 1S9GA 5EX0A 4A48A 3KLVA 3HP6A 1SL2A 2UUCF 4LQ3A 3OXLA 5KFPA 4EBCA 3RW6A 5MAOA 4X4PA 2MDAA 3IXQA 1ZTTA 4QWEA 2IVYA 2VBYA 3M2RA 4U7UK 5K8OA 4X4VA 1K8AT 5EX3A 1VQOS 3GG1A 1YTYA 2CQDA 2DCUB 2RT3A 3DI6B 3DLHA 2JH3A 5J2NB 5KFSA 1WHVA 4FXWA 2GO9A 3QGHA 1UP1A 4QPTA 1DQAA 4RW9A 2ATLA 3MFHA 1TL5A 1WNEA 1RT5B 4DF8A 5KFUA 2DNPA 3FZ2A 2GO8A 2WB4A 1NO8A 3EUNA 1U1LA 2HHPA 2E5IA 1U1MA 2N4DA 2EC0A 1ROFA 4Q2LA 1T7PA 3TRGA 1WHXA 2GX8A 1S9FA 3G4SS 1CSJA 4RW8A 4RUCA 1Q4RA 3K2YA 1L3UA 3HVRA 1SV5A 2N3LA 3N6MA 3MM7B 3OR1A 4JI4F 5DRKA 1TAQA 1IJFB 1NK9A 2GHVC 1IKYB 4RWXA 2WOMB 4O44A 2K2PA 4ZCLA 1S99A 3I6PA 5SUHA 2BRLA 5KAKA 4C4WA 2E5GA 3OL6A 4G1IA 4O3QA 4JV1A 1YGYA 2LQ9A 2RRBA 4WYWA 3N4WA 4ZK7M 2WONA 1Y3JA 4CT8A 3EX7B 4HL9A 1WG5A 2OP5A 2ROEA 4LSLB 1Q79A 2DO0A 3MHYA 4DS5A 2KN4A 1FCAA 5F8MA 3RB6A 2OTLS 4Q5VA 3EPGA 4YMEA 4TLQA 2COLA 1RT1B 1VQYA 3ZZYA 5EHHA 3OHAA 1N88A 3GR1A 2JHEA 3IG1B 1F5CA 4QR1A 1S1UA 4WU2A 2R7XA 4I6WA 4EFAC 5D4LA 3IA0A 5E7OB 1JLGA 2F8MA 3LALA 3QLHB 1GX6A 2FUG9 5CHCB 1UJ6A 2O66A 3QGPA 2OLWA 3UE2A 1KONA 2KB2A 4C3MA 3HO1A 3KLIB 1P9QC 2ROGA 4G1QB 4ID8A 5HLFB 5FD1A 4QIGA 3PR4A 2Z8QA 2JLGA 2APOA 4ZP7A 4CQ1A 2I2YA 3EZUA 2QFJA 1WI8A 1UWBA 1HBNA 1C1CA 1S49A 2IVMA 5HMXA 1GXLA 1G1XA 2DH7A 1S1XB 3HFKA 2CVEA