2F9JA

3.0 angstrom resolution structure of a y22m mutant of the spliceosomal protein p14 bound to a region of sf3b155
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'RLPPEVNRILMIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA branch site protein p14
publication title Crystal structure of a core spliceosomal protein interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 26
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f9jA01
2K8GA 1WELA 2DGVA 2F9JA 3NS5A 3NNCA 3SXLA 2MB0B 2HZCA 1FJ7A 2DO0A 1DZ5A 1WTBA 3NMRA 1UW4A 1YTYA 2OSRA 3MI7X 2KG0A 1WF2A 1WHXA 2DH8A 2KT5A 3MUTP 1IQTA 3CCQS 5DDPC 3CCVS 2J8AA 2MQOA 2F9DA 2XB2D 2CPZA 2YKAA 2MJNA 1O0PA 5DDOC 2DNQA 4LJMA 3J7YU 3I56S 3G96A 5LXYA 5IQQA 1JJ4A 2U2FA 3US5A 2KRBA 3SDEB 1P27B 1U1KA 2DNHA 1JJHA 2LKZA 1UAWA 3Q2SC 5LJ5Y 2RS2A 2RRAA 1HD1A 2LA4A 1N54B 2AYEA 2KU7A 5DM7Q 2J0QD 5MLCV 4YOEA 4ED5A 1ZH5A 1WG5A 3MD3A 2MGZA 3CXCR 3G4SS 2FY1A 2NLWA 3RW7A 2DNRA 2SXLA 1M90T 4TLQA 2RU3A 3G8TA 4V19X 4WIIA 4F25A 5GAEU 3G6ES 2DNOA 2ZJQQ 1VQ5S 2CQ2A 4LMZA 3VAFA 2DITA 4C0OC 1ZZNA 2N3OA 2I2YA 2CPXA 2B0GA 1X4FA 1WEZA 1FT8A 5ITHA 2E44A 5D77A 2MY8A 4OZ0A 4OZ1A 1FO1A 4CH0S 1HA1A 2MKJA 2HGMA 1SJQA 2E5IA 2VONA 2E5JA 2EVZA 2CQ3A 2GO9A 2XS5A 3CPWR 1VQLS 1Q82T 3G9CA 4EGLA 3K0JA 2MZSA 1DBDA 1FNXH 2DGWA 2MKCA 1PGZA 2CQCA 3SDEA 1X5PA 2DH7A 2M9KA 1OIAA 1YITS 3VAJA 3PIPQ 1RK8A 3UE2A 3ZZYA 2LXUA 3UD3P 1URNA 2M2BA 3CCUS 1FJEB 5GADU 3VAGA 3R1HA 2MQLA 2G4BA 2JRSA 3SMZA 4WFBQ 2ZJPQ 5D78A 2M70A 2XSFA 2DGXA 3THTA 1A7GE 1JMTA 2YH0A 1VC0A 1S72S 4ERDA 1WWHA 4ZKAA 3MUMP 3BEGB 1G2EA 1NO8A 1UP1A 2OSQA 2X1AA 1N8RT 4WCEQ 1OO0B 4FXVA 2MGZB 2K3KA 1X4DA 2DGOA 2CQ4A 4QPTA 2XNRA 1HL6A 2QEXS 3U1LA 4WFAQ 1N52B 2MZQA 4WKRA 3DLLQ 2X1FA 2DNKA 1KD1T 2CPDA 3CC7S 1VQ8S 2MKIA 3G8SA 1WHVA 1U2FA 4QU6A 1X5SA 2EK1A 2J76E 3CF5Q 1YJNS 3TP2A 2DIUA 2JVOA 2V94A 1WEXA 3U1MA 1CVJA 3S01A 2KXFA 2JWNA 2MZRA 4Z2XA 2OIHA 3S8SA 2M8HA 1D9AA 4UY8T 3VAIA 3UCZP 1DHMA 3I55S 3B4DA 3CCMS 2MYFA 5JVHQ 1H2VZ 2J0SD 2DNZA 1K73T 2DHGA 1ZZFA 1SJRA 1WEYA 2HVZA 3ZZZA 2CQHA 3UWTA 1U6FA 2CPFA 3CCSS 3MDFA 5GVQA 2DHXA 1H6KX 2N3LA 1WG4A 2AYMA 2KXNB 3VAHA 2LCWA 5GAHU 2VOOA 2X1GA 5GAGU 3P49B 2MQMA 3MD1A 2O3DA 2MKSA 2LXIA 2FC9A 5EN1A 4M5DB 5IM0A 1YWXA 4F02A 2DGTA 1VC5A 4WFNQ 1U1NA 2CJKA 2CQ1A 3CCLS 5CYJA 3MXHP 2BOPA 2LYVA 2RQ4A 2CPYA 2DB1A 4CQ1A 1DRZA 2CQ0A 2DNYA 3BO4A 4IUFA 1KOHA 4TU9A 4A8XA 2CPJA 4PRFA 2MJUA 2M4MA 3VALA 1XN9A 2KH9A 2FC8A 4IO9Q 1VQMS 3JB9k 3J7ZT 1H2TZ 5GMKa 2M0GB 1VQKS 2RQCA 3H2UB 3CC2S 2DNNA 2HGLA 1YJWS 3DXBA 4RU2A 5JVGQ 2MMYA 1BY9A 1VQ7S 3G71S 1X4BA 3CMAS 2L41A 2CQBA 3THPA 1M5OC 1WF0A 2DISA 2JVRA 4PR6A 2L08A 2MQPA 1VBYA 1WHWA 1X4EA 5DDRC 1VQOS 2PEHA 2UP1A 2KXHA 1R8HA 3NNAA 1UFWA 2M7SA 1YJ9S 4TU7A 1AUDA 3S7RA 2M88A 1U1OA 2KM8B 2KFYA 3Q2TC 1SJFA 3CTRA 2CPEA 5LXRA 1NU4A 1VQ9S 2DHSA 1SJ3P 2OTJS 2MPUA 2DGSA 1X4CA 1M5PC 3VAKA 1WHYA 1X5OA 1PO6A 3MOJB 1A9NB 1Q81T 2KN4A 2AYGA 2E5GA 1KQSR 2L9WA 1M1KT 3RW6A 2NZ4A 2HYIB 3BO3A 2JX2A 2CQGA 5IM0B 5H1SV 3UD4P 2BZ2A 3S6EA 4F26A 2MSTA 1WI6A 3CCRS 2QFJA 1FHTA 2RT3A 5LJ3Y 2XNQA 1Q7YT 4UQTA 1VBXA 2DNGA 1VC6A 2KHCA 2LA6A 2N7CA 1R8PA 1SXLA 1KOOA 3EX7B 3FEYB 3VAMA 1X0FA 3CD6S 5DDQC 2D3OR 2AD9A 1X4HA 5LSLA 4Y0FA 1N88A 2DK2A 5CXTA 1P1TA 1VQ6S 2XS7A 2CQDA 4J5OA 1L3KA 2G0CA 4YB1P 4TU8A 1U1LA 1VBZA 1VQPS 5BJRA 1U6BA 3P6YC 1QVGR 4PKDB 4LIRA 3CCES 3HI9A 2MY7A 2KG1A 1SJ4P 3LQVA 2YTCA 3B4MA 4P6QA 3MURP 3CULA 2PE8A 3EGZA 2VOPA 3IRWP 2RS8A 5HL7Q 2E5HA 3PIOQ 4W92B 2DNPA 3FEXB 2Q79A 5DM6Q 3EGNA 2DNMA 2DO4A 1B7FA 2ADCA 1X4GA 4U67Q 3L3CA 2M52A 1HD0A 2F3JA 1K8AT 1VQ4S 1VQNS 2MKHA 3P3DA 2MHNA 2XS2A 5LSOA 2DHAA 2KI2A 4IOCQ 3H2VE 1YI2S 2DGQA 2DH9A 1U1MA 1WF1A 1WG1A 5CA5A 2RVJA 2MQNA 2KYXA 2D9PA 4Y00A 3V4MA 4C4WA 2M8DB 1JJ2R 2WBRA 1FJCA 3MUVP 1D8ZA 1YHQS 1OWXA 4CH1A 1M5KC 2X1BA 2MKKA 5FJ4A 4C7QA 2LMIA 1X4AA 1NJIT 2FHOB 2MQQA 4YUDA 3BS9A 2LEAA 3ULHA 2ERRA 3NS6A 3OW2R 1U1RA 1KC8T 1S79A 2OJ3A 5DETA 3UCGA 3BO2A 2ADBA 2DNLA 1YIJS 2FPHX 1QVFR 2LECA 1U1PA 1K9MT 1W2BR 3IWNC 2CPIA 2D9OA 2LQ5A 3CCJS 2CQIA 4IOAQ 1X5TA 4W90B 3P5TL 2EK6A 1RKJA 4BS2A 1FXLA 3R27A 2G1DA 3VF0B 2RRBA 2KRRA 3CMES 2N82B 2VODA 3TYTA 5HO4A 1Q86T 2U1AA 4WF9Q 3UCUP 2MXYA 3N9UC 4QU7A 2CQPA 2MZTA 2GHPA 3HHNB 2DGUA 4FXWA 3LPYA 3NNHA 2MZ1A 1WI8A 2YH1A 2RUGA 2LEBA 1U1QA 3R1LA 2QA4S 1M5VC 2I38A 4QQBA 5IFMA 2OTLS 2ZJRQ 2KVIA 2YWKA 2HGNA 3CUNA 2AYBA 2DIVA 3TO8A 4CIOA 1QM9A 1F9FA 1OPIA 3D2WA 2A3JA 2MSSA 2RNEA 2KM8C 1H2UX 2MZJA 3CC4S 2CPHA
chains in the Genus database with same CATH superfamily
3FFIB 3UI3A 3PX0A 2DGVA 1Q4RA 5JUMA 2HZCA 4A8WA 2FVSA 3D6HB 3KNGA 2R8KA 2VG5A 5HBMB 3WX4A 3PR5B 4C11A 4UZCA 1FVQA 5LJ5Y 4IRCA 4Q5VA 2KKHA 2BQ3A 2WB1D 1ZA2B 5DZ7A 5THWA 3VGSA 4USUA 1FRKA 2CIMA 3Q8PB 3RW7A 3FFIA 4X62J 4Y2CA 1VQ5S 2ZH8A 2ACMA 3C66A 1RGVA 1RB0A 2VC1A 2ZOFA 2CPXA 1M0SA 5ITHA 5D77A 2D74B 4YFUA 2MKJA 4DWIA 4L3NA 4AYBD 2HRTA 2R8JA 3H42A 4NZ6A 3K0JA 4V19J 4JYAJ 4O3PA 4ZITA 1TL1A 3AODA 4LRDA 1NK8A 2Q66A 1XIQA 3EUNA 3M7VA 3HPOA 2W9CB 1GK8A 3LWLA 2G4BA 4YEAA 2ZJPQ 5D78A 1VC0A 1IBLF 2W7PA 4R5PA 2OSQA 1NZAA 1L3VA 1TAUA 2XZTB 3CJ8A 2D41A 4LF4J 3TAQA 4WFAQ 2ZHBA 5M2RA 4QW9A 1BWEA 4AE5A 4WKRA 5HLFA 1AXQA 1S12A 2DNKA 3I31A 3O6QA 1TKTB 1B99A 2VFSA 2RDJA 4YQWA 3J7YI 3MOZA 3DOKB 2JWNA 4NLVA 4MK8A 3BPSP 3L95X 3QGIA 3DRRB 3EPIA 5JJBA 2P5VA 2BM0A 4DZDA 2IYIA 3MD1A 2O3DA 2HQFA 3KHGA 1HPZB 1KWMA 1YRTA 3D0HE 3MPVA 3BSOA 3V4IB 3KLFB 3Q8YA 2HHTA 1T3OA 4DV5J 2RQ4A 2ZOMA 3Q83A 2DB1A 1C0TB 4K2JA 2HQDA 1TV6A 3GZ7A 3TAPA 3I5BA 1F2HA 1JLGB 1S49A 3DOLA 1D8YA 3JB9k 2YKMB 1VQKS 1EKRA 1FK9B 3QLHA 4ILMA 1YJWS 4RU2A 4X4UA 4OHYA 2BQUA 3THPA 4M8LA 3DRRA 5CYMB 1NK7A 4JI6F 4G1IA 1AT1B 4PR6A 2L08A 5EWFA 1HNWF 2IC3A 2J0XA 2YWGA 1UL3A 1X4EA 1VQOS 4J9LA 2OP5A 1XMQJ 3PFOA 2VQFF 1B0VA 4DV4F 3M2VB 1SIZA 5M2PA 1IJEB 3G87A 4X2BA 5IWAF 1IKVB 1C0TA 4QYZK 2GAGC 3C16A 1Y5NB 5J1EB 2GJ2A 4CLTA 4DV6J 4OZ2A 1JLGA 2VJUA 4Y65A 2AX0A 2QFJA 1FKAF 3I0RB 4AL5A 2JL9A 1V3ZA 2YNHB 3DU6A 5CYMA 2Z4PA 3BM7A 3WIVA 4M5NA 1LNQA 1RWOB 2KT3A 3IBFB 4HI2A 1P1TA 3M2VA 3QIDA 2W4DA 2YTCA 1A6LA 3MURP 3A3PB 2IJRA 1IKWB 4J9PA 4URSA 1HQEB 2F8EX 1FDAA 5J1EA 4USIA 1X4GA 4UOCA 3D6MB 2R8GA 4KAIA 4A4JA 4LF6F 4I2PB 6AT1B 1EB0A 1XR5A 4ZLPA 2H4YB 5CA5A 3T5HA 3SCIE 3BGRB 4C4WA 2G2OA 2YXLA 4XIUA 2R7UA 1YJTA 3BS9A 3DHWC 5DG8A 1HYSB 3BO2A 5L1KA 3RAQA 3ENWA 2VHGA 2A0FB 1IBCB 1K9MT 2LQ5A 4LBHA 1ZETA 2KRRA 1HW9A 4EBEA 3DN9A 4LT6A 4DR5F 2N7YA 4NYPA 3FCVA 4DX7A 4DG1A 1IJFB 4ZLJA 1ZBTA 2IVMA 1BMQB 3RUBL 1MMNA 1XNQJ 2ZJRQ 2OPPB 1UVMA 4OMFG 5B7WA 3GYNA 3T5JA 1RCXB 1WDDA 2AHOB 2H65B 2HVHA 2MSSA 4K7QA 1HYSA 1C4CA 1X9WA 1GFWB 3CC4S 5JVGQ 1RISA 2XHWA 2VBXA 2J6SA 4CNZA 8RUCA 4NMLA 2LDYA 2FHKA 1RTHB 1VRTA 1NM2A 2XMAA 4OJ1A 2J8AA 3A13A 3BPDA 1PJ6A 2AMCB 2CPZA 4M5IA 4J9RA 4NLRA 4BBYA 4AQYF 3HHLC 6FD1A 2ABYA 4ZP9A 5MLCV 2MGZA 2NLWA 3LUYA 2Y1IA 3UN5A 4DI6A 5KFPA 2HHSA 1TKZA 1S10A 2QLBB 1RE1B 4H54A 3VAFA 4TXSA 1N36F 4ECRA 5ETKA 1X4FA 3EZ5A 1MMLA 4MKBA 3OD2A 2X3GA 4WBFA 2VONA 1GX5A 1IKXB 3V81A 1KONA 1B0PA 2P8IA 1S7HA 1IXKA 3MTJA 3MEDA 2ZD1A 2IVFB 4FKXA 3L7UA 1GTEA 3DNCA 3BSCA 2FUG9 4O3NA 2C28A 1OYDA 1RT4B 4AL7A 1IWAA 3C2PA 4J9OA 5E3AA 3EGVA 2VB6A 1OO0B 2A2DA 5AXMA 3DLKA 1RYSA 1GTHA 4LF1A 2XWYA 3MMAB 3EE3A 4RPFA 4EFAC 2BKOA 1WHVA 2QV6A 4KFBA 1M5SA 3BKFA 5KFDA 5KG5A 2QLWA 4IDKB 3GR0A 1S9EB 3DKDA 4Z37A 5G0RB 1RT4A 4DZ6A 2CPFA 3PEJA 5KFFA 3HD1A 3H2LA 2BJ8A 3GR1A 4ZJLA 2ZE2B 4GC7A 5CYJA 2C42A 4CLZA 4F4YA 1KOHA 3GIJA 3TWZA 3CDEA 4IDKA 3VALA 2KH9A 1YJUA 1XQIA 3UQSA 1S9EA 2M0GB 3H2UB 3DM2B 2YKOA 3UNGC 2L41A 1SJ1A 4Q43A 2DTJA 1WF0A 5A6WA 4DSKA 1WHWA 4K4XA 3CJ3A 4P2SA 4NI2A 1CG2A 3HVTB 3S7RA 1U1OA 3PYDA 4GVBA 1MROB 2ZE2A 3KK2B 2D3O1 4B3TJ 5LXRA 1VQ9S 4LF8F 3MCNA 1YBTA 2BXJA 3RU0A 3F44A 2AEMA 3QYYA 2HZVA 1SC6A 1M1KT 1N4LA 3CCRS 4EO6A 2A2CA 4Q2MA 3FQKA 4JI5J 4FBUA 5LJ3Y 3NGDA 3AY0A 4KE5A 3FSYA 5SUHA 3L09A 4L72B 1U49A 4CO4A 1OSDA 2CYYA 4U8VA 3HVTA 2G0IA 2L9DA 2UV8A 2KHDA 2V9WA 4TU8A 4YB1P 4CNYA 3CCES 2E9RX 3MWBA 2H48B 4TY8B 2OPQA 2NS1B 5HL7Q 4W92B 1FTCA 3C15A 3EMTA 3QATA 3TJAA 3QT7A 3L3CA 1PYSB 5F9LA 2AGOA 3J81Y 3PKYA 4MTPA 1YRUA 4CLYA 3HHLA 1NCLA 1NSKL 5DG9A 5CZXA 3V4MA 4PQAA 1UPMB 5KG1A 2VQEJ 1YJVA 1M5KC 4OZ3A 2DVIA 2EEYA 3KJNB 4DPTA 2HHUA 4C7QA 2EW9A 1F9HA 3D0GE 4DFPA 2D3UA 1KFSA 3T1YJ 1YIJS 4DL7A 3OFEA 3IWNC 2D9OA 4ED7A 3UDCA 5BYQA 3CCJS 2PA3A 5KFSA 1QAIA 6FDRA 3T9ZA 2R7XA 4KHRA 3KHHA 2HW3A 2CADA 2VPXB 1FRLA 3QIPA 1S7IA 4M63A 5J2QB 1FEEA 3HMJG 2GHPA 4P75A 1I3OB 4FF2A 2K2PA 4ES3A 4JI2F 5KFEA 2IM0A 5HMXA 2FHJD 3K89A 2AYBA 2JLEA 1OMSA 4ICLB 2KM8C 2B4PA 4HR2A 4IG3A 2GIRA 2Y8YA 3LTOA 3FMWA 4YR0A 3POTB 4UT4A 3AA8A 3ET6A 3SCLE 2HRUA 2GC8A 4MFBA 4F4ZA 1WHXA 2DH8A 4DBQA 4JP8A 2C3YA 4ZPDA 2V34A 1J5OA 2KRBA 1NSQA 1L5UA 3KJQB 2DXDA 2ROGA 3R5JB 4JV0A 4KJIA 4ID8A 4FVCA 1LEOA 1WC3A 3CD0A 1S4FA 4NRUA 2FVRA 4K0KF 4FP9A 4BCAA 2FJEB 1YVFA 2Q6CA 2B0GA 2GIQA 1UVKA 2BOAA 4DU8A 5DQGA 4LR7A 3TI0A 1TUVA 1RAOA 2F63A 2CQ3A 3LANA 1T03A 2FVPA 2MKCA 2V6AA 3I82A 1FTRA 4RBVA 4MK9A 1FCAA 4UOGA 4RU9A 4AUKA 1YBUA 1FJEB 3KLHA 3OXGA 1RTJB 4JI3J 4XPEA 3FBEA 1YZ7A 3M9OB 1FDBA 2W7OA 4O4RA 4RW6A 4URGA 4RLEA 1WWHA 2XMKA 3BR9A 1L3TA 3FSXA 1P9QC 4FXVA 3UDLA 4ATNA 3ZTQA 3K57A 1O8BA 1IBLJ 3D7SB 2ZC3A 4OI2A 1EP4B 1JLBB 2E29A 4DX5A 3TQ1A 5KFHA 2MQ8A 1O6XA 1YJNS 3GP9A 4HT7A 2Y8WA 3VAIA 2IDLA 4H4MA 2GGPA 3M8ZA 3G8QA 2P9EA 2KT2A 4X64F 3CJTA 1JXLA 2WVBA 1CS4B 5EWGA 3DYAA 4M5DB 1CJVB 1VYAA 2OPSA 2WVFA 4HDGA 3RTVA 1WC5A 1JLBA 2R9LA 5LOQA 2PO4A 1C1BB 1FX2A 5IOLA 3QSIA 1FDNA 1U26A 5AXLA 2RQMA 4NXNF 1KLMA 3W8PA 1T9WA 1IVZA 1GMWD 3AD9C 4DPWA 1KBRA 2JVRA 1ZPVA 1SBRA 4N56A 3KG4A 1YRXA 1YJ9S 2KM8B 4C0BA 4JI6J 1S5ZA 1HNWJ 3Q2TC 1DLOB 3FVYA 4L76A 5A2QY 2OTJS 1N5YA 5HQ8A 2VQFJ 4DV4J 4ENOA 2AYGA 4ETXA 4HEA9 3HHKA 4PCQA 5IWAJ 3PTWA 5IQ6A 1LW2A 4ZVSB 5DZ6A 2Q6BA 3D68A 3HZGA 1U0SA 1KOOA 2VBYA 3EX7B 3C6TB 3J7Z5 3PRBA 3NGUA 2APOA 4PKDB 4A8FA 5E41A 5B0CA 2P9CA 3BH6B 2GVZB 1FFGB 1QE1B 3ZTRA 4X66F 1LWXA 2WVEA 3HHDA 3QMQA 2V50A 1GXLA 1S9FA 1HD0A 2VG6A 3GG0A 3LAKA 5HJXA 1SH2A 4ZDNA 4HDHA 2E9ZA 5I3PA 4U96A 1YI2S 4ED4A 5HVFA 2QYCA 3PX6A 2HBYB 4M5KA 4LF6J 1SH0A 2Y3YA 4IO1A 4I4BA 3CDAA 4NE9C 4G6VB 4BWMA 4RBUA 4FNIA 2ZBIA 4ZP8A 2ERRA 1V9OA 4PWUA 4LRCA 3AH6A 2W2QP 4NZ7A 3PW5A 3W9IA 2VPZB 3JAMY 1NJXA 1S6QB 3DOMB 1TVRA 4J7CA 2R8HA 4M95A 1N6QB 2WTFA 2BR0A 3BDEA 1RADB 3GSIA 3DHXA 4CLFA 3J80Y 3JSMB 3UCUP 1IN0A 3IXQA 4N76A 2ZBRA 2XMMA 2ZH7A 4C8LA 4DR5J 2F7VA 3R1LA 3M8QB 5F8IA 4B9VA 4OZNA 2PI5A 2VFRA 3JSBA 5D4NA 1NK4A 4C97A 3SV4A 3NOGA 2R2SA 1HBUA 3WC2A 4BHQA 4NLGA 3CCQS 5DDPC 1FRJA 4I7FB 5HVHA 1JLAB 1RT1A 4JI4J 4QW8A 2BM1A 2ZVIA 2XZWA 4NASA 4LSLB 1NLKL 1YSJA 1WD6A 2HFOA 1UAWA 4O23A 4DQSA 2RS2A 2O66A 2AGPA 2CVIA 3HF5A 2LA4A 3VCDA 1LFPA 3BYRA 4LUBA 1ZH5A 3HX9A 4AQYJ 4WXWA 2JFKA 3OUYB 5KFYA 2W25A 2HHQA 2BE7D 2IA0A 2CZ9A 3PW4A 3CJ5A 3KKFA 3WX8A 3R7SB 2DXFA 1XTZA 1TELA 2BE2B 2G2YA 3FCWA 3W60A 2HGMA 3LPEA 1N36J 2KJWA 4DLEA 5C25A 1MN7A 4HACB 4EGLA 3QO9B 3ZC4A 2XHCA 4A8KA 5D0GA 1ZTTA 3CDBA 2DH7A 2M9KA 1S6PB 1OIAA 2B4UA 3FKBA 3UE2A 2WHOA 1VK8A 1SQGA 5L9NA 2CKWA 4BDPA 1VBKA 4WP9A 1L3SA 4MIWA 4AL6A 2CDRB 1S72S 3B78A 2UUWA 3HHLD 1SUQA 1S9GA 2V63A 4ZHRA 3G82A 2BE2A 2DGOA 4X65F 1IQZA 3K7RA 1NMEB 4LSZB 1X8DA 1RHMB 2GNKA 2ZZTA 4G1QA 3TP2A 5KFTA 3QRRA 1U48A 3FJ2A 5AT1B 1JLCB 3KNAA 3MCMA 1RWUA 2HWIA 3UR3C 4FYYB 3QGHA 2DHGA 1I5OB 3UWTA 2PEBA 1U6FA 1H6KX 4EYHB 3LP1A 2JHEA 3DRXA 2HZAA 2N4DA 3X3UA 5GAEI 5BYSA 3N79A 2J6UA 1RT6A 1NHVA 3R2DJ 1N5TA 4C8KA 1DTTA 3PNIA 1ICEB 3V6DB 1RACB 2DNYA 2H5JB 4Z7YA 4PYAA 5B0DA 2DY1A 5L1IA 1JLCA 1R8BA 2VFTA 2Z8QA 4F4WA 3KK1B 3IAM9 4RNHA 2O01C 3F56A 3MM5A 2J6TA 4DS4A 5C24A 3G71S 2YWFA 4NLWA 3ELHA 5LMUJ 1B0TA 5DDRC 4PG6A 3NNAA 4TU7A 2M88A 3KMQA 2V8VA 2GW8A 2NXUA 3M8YA 2L9WA 5H1SV 4Y2MA 3K5MA 1FHTA 4UQTA 3PEHA 2LA6A 3FEYB 1K1SA 2UVRA 4ITSA 2QA2A 2Z0GA 4ZCMA 1VQPS 1U6BA 3B4MA 4ID5A 2XULA 3FBCA 2Q79A 3DGPA 4U67Q 2GQCA 3NCPA 1S6UA 1I6JA 4NPOA 4QWAA 3OFFA 5FD1A 2KFZA 4RW7B 2CZ4A 1ZYQA 1BLUA 1HI1A 2M8DB 4CYUB 1JJ2R 1OWXA 3OL8A 2NR0A 5A8KB 1S59A 2WOMB 2QLJB 1JKHB 4KYZA 1U1RA 2JDJA 4ZCKA 3TVYA 1FRIA 2HNZA 1JLEB 1P6TA 2O1PA 3EGWB 4UOHA 3L7OA 1DARA 5L8RC 4U7UK 2R7OA 3X1LB 3R6LB 1CPZA 1TK5A 3HHNB 4H4KC 5LL6d 3Q22A 1WI8A 1YBAA 4LR9A 3LH2S 2PA8D 4A8YA 4GO7X 5F8MA 3M32A 2YWKA 1KQFB 7FD1A 3HVAA 5CABA 4JI2J 2E1PA 4KO0B 5K8PA 2RNEA 4C3MA 2CG4A 3JYTB 3VZHA 2K8GA 4KGXB 1SQFA 1VQSA 3IS9B 4QR1A 4YN3B 3HVRA 4HI1A 2OELA 2C2ZB 1Y3JA 1T3NA 4EK2A 5HI7A 1W25A 3BBFA 3I56S 3O1LA 3W8GA 4ZCLA 5H9FJ 3GQCA 1P27B 1JJHA 3Q2SC 2ZVSA 2OPRB 1E6VA 4CTAB 1YZ6A 4GKKF 1WKKA 3TEHB 1R27B 3OVSA 2LDIA 1Q1KA 2OMOA 2AEJA 2F40A 3KJVB 2DRAA 1KVIA 3I9ZA 4FBTA 1H3DA 2L9NA 2GJIA 2VG7A 4DV1F 3JQKA 4C0OC 3IS9A 4K0KJ 4OZ0A 3QQCD 4O3SA 3MPWA 1QSLA 1GX6A 3GJSB 1REVA 3PHEA 3KK3A 5EX0A 3IG1B 1NXIA 3AHPA 3UD3P 4X4PA 4ANDA 4WFBQ 4RW8B 1RT2B 1R6YA 4O4GB 3MAQA 1W2IA 1JNRB 1Q7LB 2ALYB 2I5JB 3SCKE 5KFAA 3E2EA 2HLUA 2F65A 3CJQA 3M2UA 4P2XA 1KVKA 1WTFA 4C6AA 1TR0A 1RZMA 1KHVA 3HD2A 4QCLA 2O5DA 1FEHA 4PQUB 1NKBA 5KFLA 2J0WA 4IH5A 3UCZP 4DF4A 2BACA 2ZM6F 3DLEB 4FZVA 2QSFA 1Q8LA 4RW8A 3R3TA 4OJHA 1M5HA 2XMTA 4DR3F 4OJ3A 2A10A 2ZBPA 3VZIA 2W9BA 5DO2A 2V5HG 3P49B 2ZH3A 3HHEA 4H4OA 1FF2A 3RBDA 1VRUA 2E1RA 4X64J 3KUHA 2V2QA 1KR4A 4DL4A 2CXEA 4RKUC 1Y3KA 3MXHP 4NRTA 4WP3A 5KAKA 4PQUA 2CNLB 1PKUA 2YKPA 5HK4A 5E3RA 2DNNA 4ES2A 4K4WA 3MMCB 1KKHA 1YG0A 1RAFB 1VIOA 4NXNJ 3M05A 2UXCF 4CCHA 4IFVB 4PXCA 3CT9A 1N0VC 4QZVB 1Q8IA 4M5LA 1F5CA 1S1UA 2AJFE 3KLGB 5AE1A 1IWGA 4IG0A 4EYIB 5KFBA 5J2PB 4XTTA 2W1BA 4Y6IA 3GJQB 1SV5B 5MAOA 2OAUA 4OX7A 2UXBJ 3SQGA 2GVDB 1YJ7A 2MTLA 5J1NA 7AT1B 4IFYA 2DNGA 2XI3A 4C3LA 4F3OA 1WNEA 1ZAWA 1VIXA 5F8JA 1R0AB 3EVOA 3VAMA 1F5AA 1X4HA 1HBMB 1AZSB 2IDEA 4OI1A 2JLGA 5KT6A 3HI9A 4DR4F 2WW8A 4P6QA 3ILOA 2VOPA 2CZVC 2XZDB 3NMAA 5IV4A 2Z30B 4QR2A 3THVA 4DXLA 2VKZG 1EARA 4X66J 5FDLA 3DI6B 1CJTB 3R5GA 1WKLA 3EZOA 3BYPA 3BR8A 2W4PA 1BQMB 1G1XA 2AJQA 2FLPA 3NGKA 3EM1A 1NK5A 4FNHA 3R97A 4TYAA 4F67A 4ZJOA 4OIXA 4A47A 3VF0B 2RRBA 2N82B 1K1QA 5KG4A 4X4NA 2CQPA 3IWLA 2MZTA 1S1WB 1S77D 3LPYA 2YNIB 2R7TA 1HKAA 4KHMA 4P71A 4NCGB 1BHNA 3ENQA 2UVVA 2C2OB 3FZBA 3CJ2A 4ECZA 2HFVA 3UDEA 3LGHA 2E9TA 4NCAA 3GSDA 3C6UB 1G6BA 4XPCA 3DXSX 1MLAA 2VFVA 4DQRA 5IQQA 4EZ9A 3C14B 1KQKA 1IM4A 1VDHA 5AJ3F 1RAJA 4ED5A 4NZ0A 3R7NB 3FC9A 4KBIA 1RT7A 3N0VA 2COLA 3D54A 3HULA 2WONA 2I2YA 2LQBA 1T05A 1B70B 2ROPA 2BANA 2GV1A 4DSJA 4LVOP 1IKYB 1HWLA 4WFXA 4RW9A 3MPDA 3PX4A 2YNFB 2CQCA 2XMVA 2DRBA 2XGQA 1T9XA 3E3XA 5EX3A 2MQLA 3VGTA 5GMEA 2H3EB 1SQEA 4NLOA 1BE4A 2XSFA 3PYFA 4USWA 1QAJA 1VISA 1YDLA 4YMEA 5T41A 1R8AA 2DR8A 3RR7A 2K3KA 5IT0A 4Q7AA 2MZQA 3GV5B 1LWCB 2FGOA 3RBZA 2YNFA 2DHHA 4X65J 4I6AA 2ZDOA 3N6MA 3ZXWA 3CEDA 2V94A 5H9EK 5A2QU 4YS2A 4M1KA 2JEJA 2MYFA 2RU9A 3UW1A 3AAWB 3K5OA 3GB0A 1K73T 8AT1B 2MHEA 3HSGA 2OO4A 1WG4A 1FX4A 3K8VA 2AYMA 2KXNB 3FBBA 3E01B 1UMJA 2QC3A 1VR6A 2HQGA 3B6BA 3VWSA 2FC9A 2BKNA 3RAXA 3BJYA 5IM0A 4WFNQ 2XLIA 4ZPVR 4RWXA 2QA1A 4DCPB 1S1VB 2RKIB 4PG4A 2RUSA 1LWEA 3J7ZT 3AJ2A 4JI8F 2I6WA 4QBUA 4OLPA 1FKOB 4ZN1A 1W7WA 5CYQA 5ETRA 4DL6A 3CJ0A 4CO0A 1Z2LA 2XYPB 4OYPA 1NHUA 2YKNA 2FD2A 2B5JA 2YX7A 2OFHX 3MAAA 4Q0BB 1B64A 3N6LA 3D3CJ 1M5PC 2RILA 3M8PB 1S1VA 2RKIA 1NDCA 4M5GA 2GX8A 3W5ZA 3W66A 2AZ1A 1HBNB 4ZVPB 2NZ4A 1Z4UA 4ECUA 1VS3A 4OQJA 3OTEA 3G86A 5KG6A 4LSNB 2ZITA 3H25A 1RWVB 1KHWA 2KHCA 3WQPA 2AQ4A 3EXCX 1CJKA 5KG7A 1MWQA 4DX6A 4LFAF 2GMJA 4ANCA 1MNEA 1HIYA 3ZNUA 2CJBA 4OHXA 3EICA 3H5XA 1CQNA 5DJBA 4LRFA 3FRYA 4ZVOB 2HHVA 2IAJB 1JNZB 3QT6A 4J9VA 4RNOA 3IRWP 4J9MA 2ZNYA 3M8PA 3FEXB 5HMZA 1F3VA 3K8WA 3OSNA 3TANA 3C3LA 1WC6A 2OEJA 2X51A 1H73A 4DUYF 1HR0F 5ETMA 4WWSA 2I9SA 2XS2A 2B6AA 2W2MP 1EETA 2C22A 2DXEA 1RU2A 4M94A 5DLGA 4FDFA 2D9PA 2B7BB 2HFZA 1T7PA 4MYTA 1ZOTA 2HURA 3O3LA 4NX9A 3FEZA 4WFZA 1KNZA 3ULHA 3OW2R 2OJ3A 3CVKA 2XGPA 1KQGB 2IJFA 2CPIA 4I64A 1M1HA 2D1CA 2R2TA 4J91A 1TL7A 2DR7A 4PXEA 4C8MA 2B9EA 3GFHA 2AWZA 2IM2A 3N9UC 1NJZA 3IWXA 2DGUA 5BR8F 2H1YA 2QA4S 3ENAA 1TKXA 5ETLA 2UVWA 4IKAA 3UD5A 2MY8A 2MZJA 2FVQA 4BC7A 1WELA 2F9JA 3JSYA 1R0BG 1RWNB 3KG0A 1J27A 5KOXA 1DTQA 2DCUB 2KT5A 4N8NA 3QJLA 3CCVS 2QL7B 4PEOA 2YKAA 4HLBA 1U24A 3TJ8A 3IA0A 4HHUA 1NH7A 4MKAA 1RWWB 1FESA 4DL2A 2AYEA 3HVWA 1FE0A 2E1CA 1JLQB 1VJWA 3LO3A 3J81j 2DNRA 5T7LA 5KFIA 2NUHA 4DX8H 3K59A 4GKKJ 2QFIA 4K4SA 2HRYA 2Y1JA 3EJMA 3P5BP 2EG2A 2Y0BB 2ZEJA 3E8OA 4EU0A 4TYBA 5E3QA 3NBPB 4KGKA 4XK8C 2F5GA 5KFOA 3PXGa 1OQ6A 5K14B 4DV1J 3F0NA 3W2WA 5C7PA 2GO9A 4DN0A 1TL3B 2DCLA 3ZZ0A 2UUBJ 2HK2A 4QWBA 4UW2A 3KTQA 2XCPA 1SCJB 3IRXB 2VJVA 2ZH9A 5AXKA 3R1HA 3F41A 3BKUA 1PC5A 3ENVA 2P6SA 1JMTA 4DFKA 3NEKA 2JEFA 5A8RB 1WUUA 3NBPA 4P2FA 4DPOA 1NNDA 2HBQB 3A4TA 2VDIA 5K14A 2FJAB 1TL3A 3KUGA 1AYEA 5T14A 1LWFB 4CH7A 3OR1A 3M8WA 4K59A 5D15A 1RJJA 4RNMA 2OD6A 1ACMB 2EKNA 4I6WA 2JOQA 4CLPA 2CQHA 4S0MA 2PGCA 3M2RB 1XNRJ 1GT8A 5B0BA 2MEWA 1S6OA 2MQMA 5JXSA 3HKZD 2XO7A 1TMJA 4HTJA 4DR3J 2VASA 2HMIB 4B9MA 2GO8A 3UDVA 5KFJA 1SL1A 3Q86A 3QWUA 1S0OA 2CPJA 2HWTA 3TNVA 4B3RF 3DCAA 3OTDA 3DLGB 5FLXU 1VQMS 4PZVA 3O8WA 3DC2A 3MM7A 5F8NA 4EBCA 3TUJC 2K06A 3GPAA 5B0GA 3N4WA 3JQMA 2M7SA 4QPXA 2BA9A 2YPZA 5D3GA 1SJFA 3CCTA 1CQMA 1XK8A 2UXCJ 2XQCA 4PWDB 3A12A 2C3MA 3W65A 4OZJA 4XO0A 3DLGA 1NBEB 3C46A 2JX2A 1HHTP 3PHTA 2V2KA 5D0RA 1UVJA 2VIHA 2JC1A 1VGYA 5F8LA 1Q7YT 2EFPA 3DMJB 3HM9A 1Z1ZA 1FD2A 2HNDB 1T9YA 2WVDA 3LP0A 4PXDA 1WSRA 1P9YA 2BX6A 4K5SA 1VQ6S 1ZPWX 2VZ9A 2RIJA 3BBBA 3M8RA 3MMJA 2G13A 4U7CA 4U8YA 4P7VA 4UF4A 3EGZA 1RYRA 4MKVA 4FYXB 4PWDA 1W26A 4ELVA 4XDDA 1S0NA 4Q8FA 3PW0A 2FZCB 4DR4J 4WYLA 3KUEA 1DQ8A 1DQAA 4OHVA 2AT1B 3SYZA 5LSOA 1SL0A 4YR3A 3D6TB 1CJUA 1ZM3A 1XR6A 5EUHA 1FKPB 1NPPA 3VVTA 3QSYB 3A8KA 1UEUA 2F8HA 1HFEL 2MQQA 2LEAA 3PJ9A 4KKOB 3BSAA 3UCGA 1HHQA 1U1PA 1W2BR 1IBMF 1HNXF 5HBMA 4HHJA 4E98A 3CD7A 4ELUA 3DDIA 1OY9A 3T1AA 2RF2B 4FYDA 3MECB 3QT5A 2A18A 2MXYA 5LMNJ 1BQNB 4C2MA 1UETA 2QLXA 5KFRA 3IM8A 3D9BA 3MCSA 3BH7B 1M5VC 3AA9A 2R2RA 4RWWA 3PDNA 3D2WA 1U09A 2CPHA 4F2SA 3BZQA 5F8HA 3JS9A 1WTBA 3UFCX 2I1RA 2H5EA 1WF2A 4V1Ak 1EHWA 2RF2A 5F41A 2BUNA 5CHCB 1EIYB 4E2FB 2AW0A 2W9CA 2CJ9A 3H20A 2XMUA 3I0SB 2IM3A 4YB7A 2U2FA 2IYGA 2F8MA 2DPIA 2ASDA 5DM7Q 4U95A 3DRPB 3M1VB 1RHRB 4KV8B 2GIFA 3SI8A 1DJ0A 3G6ES 3TR5A 5AJ3J 2PN6A 3Q8SB 5ETTA 2XCAA 3V2UC 2VL1A 2FHJA 2QRRA 1FT8A 1TKTA 3TA0A 1JQGA 4N41A 3DOKA 2DD8S 1EAYC 2E5IA 3GG1A 4LBPA 1HNVB 2XS5A 2DGWA 3IM9A 3ILJA 1P1LA 2LQ8A 1YX2A 3W9JA 4HH0A 4Y2IA 3KDNA 3D6FB 2Z2YB 4ANEA 4ECSA 1HPZA 1LK7A 2M70A 2Z2ZA 3G6VA 4W98A 3ISNC 1NRKA 2ACYA 3V4IA 2LU2A 5L1JA 3KLFA 4ZVQB 2E5LF 2OD4A 5KG2A 3D5MA 4WCEQ 3TEGA 4ZVTB 3U27A 4P7TA 1X4DA 3PCOB 2YX4A 2XNRA 4OYXA 2YKMA 1N52B 2IM1A 4OZLA 3S1TA 1QLNA 1HNVA 2X1FA 1FK9A 3NOCA 4GO5X 2MKIA 3G8SA 4C3KA 4I2QB 3R5DA 1X5SA 4YHHF 1F6TA 4MT1A 3ZTOA 2C3PA 2ZBCA 2OUGA 1D9AA 1LW0B 3D1OA 3GFZA 2YNGB 3CCSS 2DHXA 1UKUA 1IKVA 4R0JA 2X1GA 1U0HB 5DG7A 1WC4A 3HP6A 1Q95G 3TRGA 3I0RA 4OHZA 2CPYA 3VGVA 2YNHA 4QIEA 2UVUA 3CJKB 4TU9A 2JSXA 4LF2A 1RBLA 4JYAF 4IQMA 5A8WB 5K20B 4WZMA 2GQ2A 1K0TA 2AKWB 2XLKA 1HARA 4I67A 1PJ7A 2EXUA 3FNNA 2D3ZA 4DV2F 2DISA 3T3FA 5HP1B 1IKWA 4JI8J 1HQEA 4FXDA 1Q53A 3VV2B 3QBCA 4I2PA 2AU0A 2ZKTA 1GXUA 2F4FA 3GV7B 2Y1RI 9ATCB 1LOUA 3KLIB 3BGRA 1VHFA 5A8WA 2BZ2A 3S6EA 2MSTA 2B9XA 2FGCA 4DR2J 3CJSA 1LV5A 1NKCA 2KZZA 3R5BA 1RI7A 3CCWA 5I3UB 3CD6S 1NSAA 5LSLA 5CD4H 1TTHB 5CXTA 4B3OB 4LFAJ 3IR6B 2C2KB 1GMWA 3CJRA 2W2OP 1QY7A 2PE8A 2WAQD 2RS8A 4OJGA 4DV5F 4PAAA 4Q8EA 2DO4A 2UU9F 5HATA 3TAMB 2MHNA 2FJVA 2OPPA 1V5IB 1U1MA 1WG1A 1HNIB 5L46A 3Q8UA 2EG1A 4DUYJ 1HR0J 4TQSA 1K47A 4NL5A 5HMYA 4WTOB 3A3OB 3BQ2A 4B3OA 3JTNA 1RTHA 4PPDA 1UCNA 3I87A 1KN6A 3AD8C 1UPPA 2NSBA 2CJQA 2EK6A 1YLXA 4JOUA 3TYTA 4IR9A 4P52A 3GYGA 5K5MA 2XYGB 1S0MA 5KT3A 3TZZA 2LEBA 2RMLA 3TX0A 5E3CA 4MIAA 1ZTWA 1Y5LB 2HNYB 4ZOSA 1U6ZA 3HJVA 3MR5A 5BR8J 2DIVA 3HKWA 3LF0A 4TKTA 5D0EA 2A3JA 1RLCL 1RAGB 4B9TA 1PBAA 3UVJB 1TU0B 2RHQB 4M5JA 1IKXA 4Y2AA 4DQPA 3V6JA 2ZHAA 1N5QA 4MIBA 2NZCA 3OTOF 3NP5A 1NPRA 2IVYA 1O0PA 1RWXB 3G96A 3W1YC 4ZN3A 3US5A 3LWMA 4ECQA 1T9VA 3WC0A 4ED0A 3KLVA 5M2UA 2ILYA 4YDDB 5F9NA 3OL9A 1D09B 4V19X 3MMAA 2CG8A 1KP6A 4LVNP 1IM6A 2AP6A 4ED1A 3KLEB 2M5YA 1WJ9A 5HSPA 3RBEA 4CLSA 1I51B 4FS1A 4XDCA 3FQLA 2M3DA 2E1MC 5G0RA 5EHHA 5I4MA 3NY0A 2MZSA 2ZH6A 1PGZA 2FY8A 3CSKA 2W7AA 1C1CB 3CO0P 1KVJA 4EMDA 2Q1LA 3ZZYA 2LXUA 2PDAA 1XBWA 3CW2C 1X0PA 1RA6A 1ZAVA 1XNQF 5GADU 3OL6A 5AXNA 4F04B 1S1XB 4RW4B 1RUSA 5KG0A 2L3MA 2Z2MA 1YJRA 3H4BA 3MCOA 3EVMA 1G2EA 4HTIA 1N8RT 4DN9A 3GCWP 2MLXA 1UFKA 3RZAA 4QPTA 1GEHA 2QLFB 2NXEA 5IZHA 2ZUGA 5RUBA 4ZVRB 4LIWA 2RDIA 3DM2A 3ETOA 2XI2A 3LP2B 3VR1A 4NA2A 4CI0B 1PCAA 4BLGA 4ECYA 1UA1A 2KZMA 2UV8G 5KFQA 3JQJA 5B09A 1HQUB 1S48A 1XMOF 1MROA 3KK2A 3QT8A 5B08A 4Q45A 3MEKA 5HVGA 1KLNA 4PUOB 2VOOA 1UEKA 4Y28C 3A8EA 2XSJB 1ITPA 4IH7A 1SI9A 2ASJA 4AXJA 3MMBB 3LP2A 4CQ1A 3KJFB 4K4ZA 3HO1A 4WP8A 2M4MA 4AT1B 3PR4A 3T1HJ 1PIEA 3OT9A 1KFDA 3ZFVA 3TOQA 2HGLA 2IIHA 2CNOB 4HYKA 2JH3A 3C19A 4B3RJ 1X4BA 3K2YA 1F0XA 4UOFA 4ZK7M 4GC6A 5L39A 4RUAA 1S57A 1S99A 3PJXA 3AOAA 1VBYA 4TY8A 1IR0A 5HQMA 2HFUA 1QDUB 1Q8KA 2W8KA 2WW4A 1E6YB 1TK8A 5J2NB 4F0MA 3LW5C 1SJ3P 2DGSA 2UUAF 1NKEA 3MMBA 4OLOA 2UXDF 4DV7F 1PILA 2FHMA 2OH2A 2KN4A 1KQSR 4NYOA 1TK0A 1T11A 1H72C 3RB4A 2BJEA 4JI0F 4NLYA 2GHWA 4ZLNA 1SH3A 3KYLA 1VBXA 2EFGA 4U6PA 2HQCA 1SIWB 4P74A 4WE1B 1I1GA 4KGZB 2D69A 1NHKL 2AD9A 3IR7B 4DPYA 1S1TB 1IR2A 2DRDA 4Y2KA 3ZNJ1 2XS7A 4DEZA 3TUIC 3L9ZA 3PO4A 2E7XA 5J2NA 4O0IA 5J2QA 3CULA 4KHPF 1RABB 4DR6F 2ADCA 4EZ6A 2EFOA 3M4XA 1HWUA 1VQNS 3OSPA 3GILA 4WKYA 4ICLA 2Y0SD 5ETVA 1R6VA 1H0HB 1EX8A 1S1TA 1FJCA 2HVDA 3POTA 2V2ZA 1UEVA 2FIUA 5IC4B 3H5YA 1QTNB 2BVZA 3GU0A 2P9GA 3QRPA 2FTRA 5F0WA 2YBVA 1NDLA 5F0UA 2ROEA 3I5AA 4RUCA 4IOAQ 1X5TA 5CZVA 4QWEA 3FCHA 4KGMA 2PSZA 2QT7A 3G2XA 2J8SA 5HO4A 1WC0A 1IBMJ 2QSWA 1HNXJ 2V8PA 2ZKUA 2YWWA 1QAYA 1ELOA 2BJ7A 3CMQA 2J9EA 3W63A 4B9NA 3TZYA 4J90A 3W61A 3M30B 2EC2A 3KOAA 3JTPA 4L75A 4OFZA 3NGRA 5CCLA 2FZGB 3MPUB 5ETPA 2DO0A 4F50A 1UA0A 1S4EA 1HI0P 2FJXA 2MQOA 2F9DA 1WOSA 2MJNA 1RTJA 3J7YU 1SB6A 1RTDB 2LVWA 1VCTA 1UVNA 2XMWA 2R7QA 4NOHA 1SC4B 2NQPA 5CD4A 3PV8A 3M30A 2QMXA 1WG5A 3MD3A 1QSSA 3IGVA 4KRWA 2HS3A 2NPIA 2SXLA 1DAXA 4F25A 3KWMA 1EP4A 4O3RA 1PBUA 4DMZA 4NEZA 3KXDA 2B3TB 3PM9A 4MAKA 2BW7A 4CO2A 3GE9A 1VQLS 1HWJA 1GMUA 5HQLA 4LRAA 1K0VA 2C2NA 4I6YA 1R8CA 3U02A 1R0CB 1J2VA 1URNA 1CS4A 2VG5B 1WACA 2ZDPA 4M5DA 4TY9A 1CJVA 3CWJA 3EVWA 4C11B 3HFVA 3DFEA 2VA2A 1RP5A 2YH0A 3K5LA 2J5AA 4ZKAA 1EQ0A 3BEGB 1UZDA 4J9KA 1PYOB 3QFWA 2XY5A 2R7RA 1U02A 4KSEB 5J1PA 3DLHA 1C1BA 3MR2A 2NXCA 3OTBA 3QNWB 5D8HB 4OX6A 2E5LJ 2C3OA 2JLFA 1VQ8S 2WSEC 3PO5A 4CO5A 1KRPA 2BYCA 2DIUA 3GIKA 3H0PA 3U1MA 4USMA 3H5SA 3KFWX 3S8SA 4FF4A 1RLDA 3B4DA 3AJ1A 4YHHJ 3CCMS 2DNZA 5KFNA 3GCXP 3HXMA 4DDFA 1TL1B 1DLOA 3MDFA 5KFVA 2EWHA 4FF3A 2OGUA 3PJWA 1FVSA 5IC6B 3AB2B 2H4WB 5A6PA 1WORA 2YWEA 2Y1LB 4R5PB 4QR0A 4ZIVA 3ISND 4GVLA 4PRFA 1YQHA 4ZPBA 1RTIB 3C6TA 3ZZRA 1U4BA 3P4UB 5GMKa 2AF6A 5HLFB 2HVIA 1AA1B 3IFEA 4LF9F 1KTQA 4DU7A 4JI3F 5KFCA 4DR1F 3MGJA 2XM3A 2MQPA 1RKIA 2Z2LA 2GVZA 2R7SA 1HNZF 2PFDA 1QE1A 2OI2A 4UY85 4NLTA 2YQ1A 3K58A 1QD1A 4DV2J 4K5RA 4DLGA 1RAAB 3D1HA 3CDUA 4J9NA 1TMMA 3CTRA 3QFHA 2GQQA 2MPUA 2ZZMA 3BQ1A 1A9NB 4ZVEA 4CDIA 4YY3F 1U45A 2P2CB 5B0EA 3VVUA 1RTIA 4P72A 4ZVGA 4OYOA 1RU1A 4RZRA 4TQRA 2HQIA 3EPGA 3MFHA 4DCJB 3IGNA 4ZIWA 1SKSA 3PY8A 3J7A1 2W2PP 5HANA 1TV6B 4KPCA 4BC9A 2RE1A 1V6HA 1BQXA 2B51A 3WBZA 2I8EA 3DOLB 4NMXA 3AB4B 3QLHB 1S6QA 3DOMA 1R31A 1N6QA 4FPIA 2KG1A 5K8MA 2IC3B 3JSMA 3IMQJ 3LGMA 3CDWA 5I3QA 1OJ4A 5DM6Q 3EGNA 4WK3A 3BBCA 3M8QA 2M52A 3OL7A 4ILLA 2FJWA 4HVZA 3RJMB 1Q16B 2KI2A 2UU9J 3C16B 4OV1A 3QZ7A 5KFKA 1O5JA 4A46A 2KTQA 2CA9A 3MUVP 3OFGA 4DF8A 1S76D 3GONA 2LMIA 2KJVA 2NYHA 5EGYA 1F60B 4CP5A 4RL1A 3NS6A 1S79A 1D1UA 4USHA 2BRLA 3OBIA 2VH7A 8ATCB 2DNLA 2JEIA 4I7FA 4M5HA 1JLAA 5L38A 2C2EA 3W5XA 3KHLA 2PI4A 1FXLA 4LSLA 3CMES 3QZ8A 2VODA 3KG1A 2ZHOA 3MM9B 3OUYA 3QGPA 5IFMA 3RR8A 4CIOA 4C98A 3HFZB 1NH8A 2YWHA 3FK4A 1EZZB 3AOBA 2UZAA 2DT9A 1FJ7A 4HACA 1REGX 2V4JB 4F0HA 3QO9A 4WTYA 4L74A 1N33F 1S6PA 4DSIA 1ROFA 1OS5A 3MM9A 1N5SA 2UUCF 3NCQA 3SBMA 2DNQA 4ZPCA 1MMDA 4AFFA 4CO3A 4JV1A 2E1AA 3OTOJ 2LKZA 5K8OA 1CC7A 2CVEA 3W3SA 1F2GA 2R2UA 3FZ2A 2FLNA 3G4SS 4DG1B 2FY1A 2RDDA 1UJ5A 3NGSA 1KDNA 3G8TA 1FNOA 3MEGB 2DNOA 2LP4A 3FSIA 4LMZA 3TUZC 3ILLA 2K7JA 2V4JA 4FS2A 1QSYA 3PW2A 3NS7B 3GWCA 2KB2A 3ZO7A 3K5NA 3V5RA 2P6TA 4MJKA 4UUWA 5ETSA 2E5JA 2EVZA 1T0TV 2H51B 1OQ3A 2KDOA 2XTJP 2QZ8A 3QAUA 1VRTB 3HSJA 3SV3A 1VQYA 5GMDA 3VAGA 3RRHA 2J7WA 3Q8RB 3V6HA 3MEGA 2EI5A 1RBOB 3G6XA 3ZZOA 3CE8A 2XLJA 4YDXA 1RWPB 3V6DA 2C2DA 2MGZB 3R7BB 5SZTA 2QMUB 3QRQA 2CQ4A 4LF8J 3U1LA 4J9UE 1TKZB 4PXBA 5ADZA 3KK1A 3PVXA 1LFWA 1YGYA 5A76A 1U2FA 4JI4F 5IS2A 3CF5Q 1FXRA 4DHVA 4X4RA 1CVJA 3TUPA 3MPYA 3V81B 2XBPA 4C9DA 1Q5YA 2RB7A 3MEDB 5FLXY 2ZD1B 4R8UB 3MR6A 2KL8A 5GAGU 1Q0NA 2GZOA 3GV8B 3H5UA 2B9YA 2FB0A 1DY3A 1XMOJ 3SCJE 4KB7A 1OYEA 2VA3A 4F02A 3EDRB 1QTMA 3AD7C 4FYVB 5KT7A 1UFLA 4QJVA 5C5JA 2CQ0A 3SSRA 3DLKB 3QPIA 2MJUA 4PPZA 2GJFA 1SVDA 4F3MA 2OKQA 1H2TZ 2CAJA 2RQCA 2Y9HA 2Q43A 3GIMA 3ILIA 4QWCA 3MM6B 4LBIA 1FA0A 4KFBB 1M5OC 1FRMA 5KG3A 3D4JA 4R8UA 1U25A 2WSFC 4B17A 2KXHA 3HJFA 1WOPA 2E66A 3GLJA 3BSNA 2ZUAA 4DFMA 2WBMA 1LK5A 1NU4A 3IBWA 4RW7A 3DDNA 2UUTA 4Q2LA 2XY7A 2HYIB 3RYLA 1ZM2A 2CQGA 4CYUA 2V67A 4WYWA 2UUAJ 3D28A 3RRKA 1TQLA 4DV7J 2UXDJ 3PG9A 4WJBA 1AFIA 4RR5A 2RT3A 3MM6A 2AV5A 3K5PA 5A8KA 2WOMA 1JKHA 7FDRA 4DV0F 1N5VA 3R5CA 4JI0J 1NJYA 2HIQA 4O3OA 5E33A 2BDPA 4ED6A 3SFGA 2POKA 4D3GA 3H40A 1NDKA 3HFKA 1JLEA 2VDHA 2CQDA 3T9NA 2V2VA 3RRGA 3LQVA 1MWZA 1NPKA 2PFFB 2E5HA 2HHHF 4NI2B 2DNMA 3D1QA 1B7FA 5IT9Y 4KTQA 1G7CB 4GVBB 4B9SA 2KVQE 1QUPA 2AX1A 1UVIA 3P3DA 4KHPJ 4DR6J 1WDTA 3H2VE 1XC9A 1WF1A 4KO0A 4KPYA 1CBKA 3JYTA 5KFZA 2GCFA 2VFUA 2BE9B 5LMUF 2X7IA 4B02A 4DUTA 1AUSL 2MKYA 4KY3A 5DS7A 4YUDA 2JFDA 2DY9A 1FFSB 2G2ZA 1RHQB 1YK9A 2FPHX 1WSVA 2XG8A 2V8HA 4JBCA 4LFBF 2ASLA 1RKJA 4N8OA 1ZA1B 2QGFB 2OPRA 4CTAA 1R89A 2C3UA 2OPQB 3C15B 2GFFA 1R3NA 3KJVA 2VBZA 2VBWA 1U1QA 3B8HA 4DUZF 2I38A 4P9SA 4EBDA 1BD6A 3HHLB 1OPZA 4B9UA 3GIRA 3NGTA 2IFXA 3DRYA 3H8YA 4HKQA 1U7LA 4WU2A 2MB0B 1NAQA 3IN5A 1UW4A 5I42B 5GAGI 2XY6A 4CM2A 3IG1A 1J5EF 4TLRA 4ER8A 1LKZA 2ZH5A 1HMVB 1RT2A 4O4GA 1TL4A 3QIPB 2C2RA 1O51A 2RRAA 2I5JA 4DS5A 1N54B 4YOEA 2VD3A 3EZUA 4I1TA 5E0OA 1RA7A 4N5SA 2AJ4A 4NA1A 3B82A 4U9RA 1Q5VA 2DR5A 2J7KA 2V4QA 5I42A 4ZP7A 2E44A 1Y4ZB 1I94F 4IG3B 1SJQA 4ETZA 4A8QA 4ECXA 3ZTPA 3UNYA 2A6OA 3CPWR 2JEGA 4F8RA 1Q82T 3DLEA 3ET6B 1HMVA 3NWRA 4ED3A 4MFBB 1LQ9A 5KFWA 3SSQA 1P8GA 2Q3PA 5FIIA 2V9KA 3HLUA 2M2BA 4DQQA 3AQPA 5H9EJ 3T6JA 2ZH1A 5KOWA 2JRSA 1IBKF 3BGLA 1RT3B 1J5OB 1F5BA 1HW8A 1N0UA 3PW7A 4JI1F 1NO8A 4DSLA 5DQHA 2NUUG 4HH1A 2BJ1A 4F4XA 4EUVA 3W64A 3OFHA 4H4KA 3OLBA 3MMCA 3V6KA 2EK1A 2B9WA 4UZBA 2CJYB 2NYIA 2NXJA 2JVOA 2B7CB 2FDNA 9RUBA 3S01A 5LT5A 2MZRA 1YKWA 1DHMA 4IFVA 1RT3A 1T03B 1WEYA 1XEZA 4HT5A 5GVQA 4IQXA 4ZPTR 1UWAA 4RX6A 3CGIA 3KLGA 3KLHB 5J2PA 3Q89A 3NRBA 4F4AA 1SV5A 4IRDA 4RW6B 2DGTA 2YVSA 4URQU 4X84A 4ZVHA 2GVDA 5KFGA 2GA7A 3WDOA 1R0AA 3UO0A 1CULB 2CWXA 2FC8A 4Y3CA 4KGVB 1HBMA 1URRA 4D3HA 4ZPWR 2QA4G 1AZSA 1NK0A 1Y0HA 2J9DA 3BB5A 2G9OA 2NSCA 2I0XA 4P2MA 1H38A 1B3TA 3HT3A 4EWTA 1KS2A 1R8HA 1ZAXA 3W9HA 4LF9J 1AUDA 4H4MB 2H9ZA 3OR2B 4DR1J 2GGPB 2KFYA 3AJDA 4FPRA 2HFSA 3RB0A 2DPJA 3Q24A 1HNZJ 4MYUA 3ZZTA 2DHSA 2LEPA 3MF5A 3DI6A 1CJTA 2HS0A 3DYAB 3FBFA 1BQMA 1CULA 2OPSB 4F26A 3VHQA 4YY3J 4JUZA 1UZHA 2FYXA 4ZMMA 5KFUA 3O2IA 1X0FA 4WU3A 2C1EB 4ECTA 2VC0A 4QIWD 1OSCA 4LF7F 3P96A 1H7XA 1KLMB 2EPIA 3OR2A 4FYWB 4J5OA 4OZ5A 3OHBA 1QVGR 1PJ5A 4OX8A 4DJBA 3RB6A 2HHWA 5HN0A 2E7WA 1S1WA 1S0VA 2DNPA 1FD8A 1RDRA 2YNIA 2V8DA 3T5KA 2JNJA 2MDAA 4CWBA 4NCGA 1N5YB 2Z58B 1FRHA 5L1LA 1T94A 5ETNA 2A6MA 4KIAA 2IPOB 1T95A 2MQNA 2ASYA 2W01A 5DQIA 1NDPA 2QL9B 1D8ZA 4B3MF 1YHQS 2PT0A 1LW2B 3L4BC 4CZCA 4C48A 2R8IA 2LQ9A 3C6UA 4KQZA 4LF5F 2ATCB 3P5TL 2F4VF 1T9UA 1FERA 3HT0A 3C14A 1SPBP 4B08A 2PD1A 2UXBF 1NZ8A 4A8MP 3CB4A 2LQJA 2B4OA 3K17A 3W2VB 1SKWA 2ZH2A 2DEIA 2VG6B 3SFUA 3M8SA 4QQBA 2RSQA 1AFJA 4C0HA 2F1FA 3TO8A 1QM9A 2IY5B 2HK3A 4Z7CA 3BKTA 4ED2A 1CSJA 4N7TA 1IKYA 1ULRA 2DR9A 5D4LA 1U2CA 1V5VA 5BYRA 4C8OA 3VQTA 1IQTA 1VOMA 2QO3A 3NAIA 2XB2D 1FNMA 1TVRB 1Y7PA 5F3ZA 1N33J 3W2VA 4JV5F 4NXMF 2ZNZA 4WPAA 2K7KA 2UUCJ 4YR2A 5HAOA 4RNFA 3DLBA 1MU2B 1UJ4A 1M90T 2YQ0A 1HWKA 5GAEU 2ZJQQ 1JJCB 3PYEA 1LWCA 3TA2A 2DITA 1FWPA 4Q44A 3O44A 1FO1A 3JSRA 3VQSA 4UTGA 1HQ2A 3DLJA 3DGVA 3I4PA 3ZZPA 5L9XA 1DBDA 3AFGA 4MK7A 1X5PA 1HBUB 2ILZA 3H90A 1YITS 3OXFA 1SKRA 1XWLA 3E01A 4USKA 1GNKA 2LXFA 1N34F 2HLTA 4CRJA 1MU2A 3SIPB 1RT1B 2QX0A 2RD5C 2XO6A 2QG9B 2AEFA 2DGXA 5E2QA 3R8YA 3THTA 1C4AA 5AE2A 2CDQA 4DFJA 5IV3A 2IHR1 3PYGA 2B8PA 1FWKA 4K4TA 3DLLQ 1PYTA 2J9CA 5D4OA 2CPDA 1TP7A 4LFCF 1NSPA 1BC6A 1U8SA 2Z57B 1WEXA 1FKOA 1BXNA 2B8QA 2CWKA 4IH6A 5E5NA 1BUXA 4UY8T 4ZA1A 5C25B 1MSWD 3ZZUA 1Y11A 3R9LA 1ZZFA 1SJRA 2J9DE 3R2CJ 1RTZA 1FWLA 4Q0BA 3VAHA 2W9AA 1AROP 2L48A 1HBNA 4I68A 1YWXA 1D0EA 1EKSA 4NLQA 4OYZA 4LSNA 3BDPA 1SUQB 2QIFA 1DRZA 1TUWA 1S9GB 3VTIA 4ZHRB 3BO4A 2V4RA 4ECVA 3G82B 3T6BA 1RSCA 4OX9F 4IO9Q 4IRKA 3CC2S 2ATLA 4JI7F 2OLWA 1ZM9A 3DXBA 2MMYA 1GH8A 3CMAS 5ETQA 2CQBA 2IBKA 2QL5B 4G1QB 2IAJA 1FRXA 2AIRB 3DRSB 2PEHA 2EBEA 2IA6A 3A1YG 2IBOA 4ZVFA 4TN2A 2NREA 5EWEA 5HJYA 3LP1B 5B0FA 1PO6A 3NL0A 4CO1A 1Q81T 1KSPA 2MLYA 2IJNA 3GTYX 2RH3A 1RT6B 2R4FA 1WI6A 1Z2ZA 3TARA 1DTTB 4PABA 1AB8A 1VHIA 2V0NA 2VUGA 1R8PA 3R5AA 2AJ0A 3M6VA 3LOUA 4TNOA 5DDQC 1SC3B 3DRSA 3NWGA 1Q78A 3UPFA 3MM5B 2ZC4A 4DV0J 3KDOA 5C24B 5BJRA 3NG8A 4EI2A 2ZOGA 1SJ4P 2VPWB 2EFNA 3PIOQ 3ITHB 1RT5B 3TZXA 3Q8VA 5K8NA 1FJGF 2HHHJ 2GAHC 4HL9A 3SEOA 4OI3A 2OFGX 3FGVA 2DH9A 5BXIA 3M6UA 2RVJA 4O0NA 2KYXA 4K2XA 2HQ3A 2IRYA 4O3QA 3A3NB 2K3IA 2MKKA 4DQIA 2VICA 5FJ4A 1X7VA 1X4AA 3IR5B 1NJIT 4QOTA 2ZZNA 1NUEA 4F36A 3OLAA 2J7UA 2OMLA 3T41A 1QVFR 1U2RA 1TZ0A 3H59A 2EFQA 3EDQB 1KEKA 4W90B 3OXLA 3ITHA 1N32F 1RT5A 2G1DA 5LSRA 4N47A 3UR0A 4ID5B 4LFBJ 1IUJA 2EKYA 3TQEA 3OV7A 1EQMA 1JLQA 2JZ5A 4FXWA 1TUGB 1U8WA 4R25A 2MZ1A 4DR7F 3DGPB 2YH1A 2YX1A 4OYMA 1MW7A 3DU5A 5EDWA 4K4YA 3I5CA 1TKDA 3NXZA 1RHKB 2HGNA 3BF4A 2FJDB 2IMOA 4DUZJ 1H2UX 1N56A 3Q0AA 4X4TA 3NS5A 2HVEA 4YB6A 1F9EB 2OSRA 3QJJA 4F7VA 1XJWB 3TZWA 3U1NA 2HNZB 3VGUA 3IRXA 4DPXA 1WOOA 2OEKA 2C2MB 2XMJA 3D66A 2R7VA 1J5EJ 2PMHA 3SDEB 3BV8A 2DNHA 3TW0A 1HD1A 1U47A 2KU7A 2J0QD 5A8RA 5DGAA 2ZM6J 4WIIA 3KMSA 1HI8A 2CQ2A 4KR0B 3M32B 2IRUA 4PG5A 1LWFA 1FFWB 4CH0S 1BGXT 1EJ7L 4TVAB 2PC6A 3A8IA 2CFXA 4NLDA 2QJ3A 4NLUA 4CT9A 1I94J 1FNXH 3OHAA 1UTAA 3SDEA 1OY6A 3AXMA 3NKYA 3M2RA 3VAJA 1RK8A 4DV3F 4K4UA 2V68A 3ADAC 4N77A 1A7GE 3O5TB 2HMIA 4ERDA 1PAEX 1E6VB 4FF1A 3MUMP 4OI4A 3I32A 1IBKJ 2WSCC 3BN4A 3QJPA 1QAXA 2HKEA 3MAHA 4BWJA 2VPYB 3HZEA 4QIVA 4CT8A 4JI1J 2BJDA 2VG7B 1NK9A 4UUXA 2J76E 2XEXA 2FVCA 2KXFA 4Z2XA 2OIHA 1FXDA 4HHHA 3I55S 1REVB 3GYXB 5JVHQ 3KK3B 1RBAA 3G6YA 2CNKB 1S97A 2BV3A 1RCOB 1QUVA 4JB8B 4DL0C 2LCWA 5GAHU 2MKSA 2DJWA 3NCRA 3J7AN 2EBGA 4NLXA 4GRSA 2LYVA 4XAKA 1D9DA 3DMJA 2YY3A 3BREA 3CJ4A 2HNDA 4GMKA 2UUBF 3M2UB 4CLLA 4P73A 2LU1A 5CAAA 1VQ7S 4ZS6A 5IT9U 3MTKA 3HSZA 2QE5A 4G3IA 3RAMA 1XR7A 2WZ1A 1PSDA 2UP1A 4DL3A 2HEKA 3N5FA 3ICLA 5E3PA 2LLZA 2CPEA 3GIIA 4F3QA 2HS4A 2W24A 4J37A 2WVCA 5KT5A 2W9BB 3N6NA 1UW9A 3VAKA 1WHYA 2HWHA 1CEZA 4H4OB 1FKPA 1VRUB 3UD4P 4RO0A 2E7VA 3HSDA 1N48A 5DGBA 2HFNA 5DRKA 2MLZA 4G65A 4KKOA 3H7HB 4I0WA 1JXVA 2D3OR 4NA3A 1XNRF 3M9NB 1N88A 3RB3A 4FKYA 4MMOA 3P6YC 1TFWA 2H5IB 1MG7A 3MECA 3PRVA 1UVLA 4LF7J 3BQ0A 1BQNA 3N01A 1G4CA 1HBOB 2F3JA 1K8AT 1VQ4S 4PG7A 4NWBA 4K50A 1S1UB 4ZVUB 2XC9A 2DHAA 4EEYA 4OHWA 2DGQA 4IG0B 5HMWA 4Y00A 3I4HX 1VLOA 5C42B 2BMBA 1LXNA 3BGFA 4CH1A 2R7WA 2X1BA 4DSFA 2HG4A 3SQGB 4ED8A 4WK1A 3KHRA 4GKJF 4IFYB 2FHOB 1OY8A 4J9SA 1NEEA 3R6GB 4B3MJ 4B3SF 4WZQA 3J81U 3ETMA 4LQ9A 4P10A 1LXJA 3I0SA 1VRQC 4BS2A 5CH7B 1HBOA 2BJ9A 3QGGA 4LF5J 1MN9A 3OJSA 3ZTSA 2GMHA 1T8EA 4E8UA 1DQ9A 3DRPA 3M1VA 2PIIA 4QYRA 2FZKB 2F4VJ 3BN7A 4KV8A 3NAHA 3D67A 2W8LA 1RAIB 2XWXA 3D0IE 1NB2A 4A48A 4W4MA 5C42A 5FDLB 1VJQA 3PRDA 1RWKB 2V69A 3SZ2A 2IMWP 4OI6A 3SXLA 3MFIA 3NMRA 3TVZA 5GAHI 3HK2A 4C8NA 3T5LA 2LFVA 3ISZA 3WHIA 5LXYA 4ALZA 3W5YA 2B43A 3A8JA 4C8ZA 2BQRA 4YB5A 4X62F 1C2PA 3P8BB 4KH1B 4JV5J 4KC5A 4NXMJ 4OI0A 1H98A 3I96A 3N28A 4RNNA 4YP3A 4KT0C 3CIZA 3PFEA 4I2QA 2KO1A 1ZZNA 4X4OA 2V8GA 4OZ1A 1VI7A 1HA1A 2CJXB 2B4VA 3TA1A 1K44A 1LW0A 3LGNA 5LMNF 1H7WA 2RQKA 1ZS6A 5H9FK 2N4CA 5KTQA 4L6V3 2R3VA 2YNGA 3E51A 4I69A 4C8YA 3CIMA 2VF3A 3CCUS 1U0HA 5F3TA 3OQ2A 2EFVA 1JB0C 5A0YB 1HWIA 2G1HA 4FN5A 2KFNA 3U7JA 3BGOP 1RXOB 3IO1A 2BW2A 4LF4F 2OEMA 1N34J 4NLSA 4MH8A 2HHXA 2XYHB 1UP1A 3CJKA 2RAQA 2W4CA 1RT7B 1DFDA 3LAMA 5C2GA 3PZPA 2WONB 3CC7S 3M6WA 3M6XA 1L3UA 1T05B 2BANB 1UWBB 5HP1A 1R7IA 4LFCJ 2M8HA 5A0YA 3IC1A 5LM7E 5KT2A 1H2VZ 2J0SD 1B4SA 4RW9B 2HVZA 3IAS9 3ZZZA 2YPYA 1FI4A 2N3LA 3CD5A 3MHYA 3OVBA 5EN1A 4QIGA 2ZWPA 3KLIA 1XMBA 1U1NA 5JMNA 2CJKA 4LRBA 3GFYA 4L73A 4QWDA 4IUFA 4FVMA 1TL5A 3C8YA 5IXUA 4JV2A 5I3UA 1UWBA 2ZH4A 4PYDA 1IR1A 4OX9J 1BY9A 5D4PA 1XMQF 3OTCA 4MKYA 2DKOB 3QWPA 1NK6A 4JI7J 1HHSA 2RHSB 4LREA 1UFWA 4ECWA 5D0HA 4X4QA 3W62A 4OYBA 2DBBA 3TAMA 4DV6F 1X9MA 4RUBA 1GXTA 3MOJB 2ALZA 2E5GA 1HNIA 3P45B 3MEEB 3AOCA 3JXOA 3BO3A 5IM0B 4PG8A 5D6GA 4RUHA 3WZ0A 2ZWOA 3TJ9A 3FUYA 1R43A 1VFJA 4USTA 4AXIA 2KYZA 3I6PA 1SXLA 4CLWA 1LWEB 2G0JA 4Y0FA 1RHUB 2G0CA 1VBZA 2MY7A 1NJWA 3FRZA 3OPKA 4LR8A 5CYQB 3MEEA 2HIYA 3IBCB 2YKNB 3GMGA 2B5JB 2HNYA 3MAAB 2MKHA 3MR7A 1TFYA 4IOCQ 2JC0A 1Q8BA 4EO8A 1FJGJ 3UVJA 2NPFA 5ETOA 2HAIA 3CCZA 1SC1B 1H74A 3TX8A 1KC8T 3SQOP 1CJKB 5DETA 1RAHB 1MWYA 2ADBA 4IYQA 4CLUA 2HSEB 2NCKL 1SKUB 2K1RB 1ZM4A 4NEYA 1DURA 2D7SA 1Q86T 4ZCIA 2ZBQA 4WF9Q 2CJAA 1VMBA 4QU7A 1N32J 2GMLA 1A0OB 2BEFA 4DR2F 4WFYA 2BKPA 3NNHA 1SL2A 4UQGA 2RUGA 4NYZA 4B9LA 2AJ1A 4CM0A 3JAMU 2CNNB 3EWGA 2DEJA 2KVIA 3CUNA 2B6AB 4USJC 4DR7J 1OPIA 3DDKA 3KLEA 3NLCA 1EETB 2R42A 2QMWA 3J80U 2BABA 4ZLLA 1T9TA 3MR3A 3NNCA 4M5MA 5F8GA 1DZ5A 1Y5IB 1YTYA 2K1RA 3MI7X 2KG0A 1C1CA 4OL8A 3MUTP 1KTVA 2DYAA 4O44B 5DDOC 4LJMA 1TL7B 1S1XA 4RW4A 1JJ4A 2YKQA 1U1KA 1RHJB 3B54A 5AE3A 2BBEA 4DCOB 2A1BA 2PMZD 3CO9A 4USVA 3UN3A 5IT4A 3CXCR 5KFXA 3RGIA 4PWWA 4X4VA 4TLQA 2RU3A 1X9SA 4R0EA 1FE4A 1TKXB 4J9QA 1GMVA 2N3OA 1WEZA 2JJ4D 2RJZA 1D3WA 2QYGA 4OV6A 4L3KA 4O44A 3EXYA 4E0DA 5KT4A 3G9CA 3F73A 1HQUA 4ZP6A 1DTQB 3ONQA 4K8RA 3TVKA 4RJVA 1X60A 3PIPQ 4PUOA 1JIHA 4A8OA 3Q8QB 4I56A 3SMZA 2XSJA 1G3OA 2AGQA 1JLFB 1AW0A 3FMBA 4QIFA 2HPUA 1VK3A 1PAUB 3H4DA 4DV3J 1X31C 2PMWA 2X1AA 1WC1A 4F2RA 4DPUA 3Q23A 1V3RA 5T7LB 2B56A 2FLLA 1HL6A 2QEXS 4ZPAA 3FDSA 2AJ2A 1KD1T 3OVAA 4QU6A 4CLKA 3PKMA 1BWVA 3BGUA 2YQ3A 4F0KA 5B0AA 2AZ3A 2DR6A 1RQ0A 4OYWA 1F1BB 4LQ3A 3W2WB 4NLPA 1UJ6A 5K9FA 1M1GA 4DOZA 4WXOA 1F3FA 2WK4A 1E6YA 2HHPA 3PACA 1JLFA 2RRNA 3UN2A 2WCXA 1C0UB 3GFXA 3CNQP 2LXIA 4ELTA 1Y00A 2O67A 2IRXA 1RAEB 2GS8A 4IR1A 1VC5A 1Y10A 2CQ1A 3CCLS 2BOPA 4IOBA 1FDDA 4A8XA 2HAFA 1XN9A 2CUYA 4WE1A 4K4VA 2X3DA 1PG5B 1JXEA 2FJBB 3EYZA 5DLFA 3T19A 1CC8A 1TAQA 4RBTA 1Q79A 2WRMA 1D9FA 5GADI 2WB4A 4KH0B 3OR1B 4OYAA 5KFMA 1QJHA 4B3TF 1C0UA 2VU5A 4ES1A 5U47A 3N5BA 1X4CA 4U7UD 3W7BA 3OJUA 1X5OA 3LALA 1WKJA 4JI5F 3H98A 1V3SA 3RBXA 3RW6A 2W2NP 3HCXA 4F4KA 2EC0A 1B7YB 3M9MB 2FQQB 2XNQA 1VC6A 2BRKA 2N7CA 1GAOA 3QAEA 1XERA 4A8SA 4AD6A 3MM8B 3MM7B 2DK2A 1U1LA 1L3KA 4ZJQA 5HROB 4LIRA 3HDSA 2QN6B 2H54B 3L7PA 1APSA 3GJTB 1CLFA 5D3GB 3I9V9 1Y9OA 2CRLA 3T1HF 1HLWA 4G1PA 2VQEF 1RWMB 4QYZJ 4X4SA 2WBRA 3SSSA 3MM8A 3T1YF 3WIUA 5J2MB 3LA0A 2HBRB 2NXNA 3RG6A 1JWWA 2QTWA 2OHDA 5HROA 2GHVC 2Z56B 5C2CA 1NB7A 1T02A 5G4DA 3LP0B 1JK9B 2LECA 1PC4A 4ILRA 3AT1B 4DL5A 4GKJJ 2CQIA 3AQOA 1RTDA 3R27A 4B3SJ 2U1AA 4WIQA 3AXKA 2ZFHA 5CQGA 4Y34A 4OYIA 2VKRA 2HBZB 1JX4A 4DSEA 4NCBA 5E7OB 1VLYA 2BJ3A 2VV5A 5J2MA 3MZIA 1GQEA 2OTLS 3D3BJ 5CCMA 3IP0A 1CJUB 1F9FA 3JTOA 2FLOA 3GJRB
chains in the Genus database with same CATH topology
4B9TA 2K8GA 3FFIB 3UI3A 1IKYA 1ULRA 3PX0A 2DGVA 1Q4RA 5JUMA 1IKXA 2DR9A 2HZCA 4Y2AA 4A8WA 2FVSA 4DQPA 3V6JA 1VQSA 3IS9B 4QR1A 5D4LA 2ZHAA 1N5QA 5BYRA 4C8OA 3HVRA 3VQTA 4MIBA 3KNGA 4HI1A 1IQTA 3OTOF 3NP5A 1VOMA 2QO3A 1Y3JA 3NAIA 2R8KA 2VG5A 1T3NA 2XB2D 2IVYA 1FNMA 5HBMB 5HI7A 1O0PA 3WX4A 1W25A 3I56S 1TVRB 1Y7PA 5F3ZA 3G96A 3W2VA 3PR5B 4C11A 3O1LA 4NXMF 4JV5F 3US5A 4ZCLA 5H9FJ 2ZNZA 3GQCA 2K7KA 1P27B 1FVQA 3LWMA 1JJHA 3Q2SC 5LJ5Y 4ECQA 2ZVSA 4IRCA 2OPRB 4Q5VA 1E6VA 2KKHA 3WC0A 4CTAB 2BQ3A 2WB1D 5THWA 4YR2A 4ED0A 4GKKF 4RNFA 3KLVA 5M2UA 3DLBA 1R27B 2ILYA 4YDDB 1FRKA 1MU2B 5F9NA 3OVSA 2CIMA 3Q8PB 2LDIA 1Q1KA 3RW7A 3OL9A 2OMOA 1UJ4A 2F40A 3KJVB 2DRAA 1M90T 4V19X 1KVIA 3MMAA 1HWKA 3FFIA 5GAEU 4Y2CA 3I9ZA 2ZJQQ 1VQ5S 4FBTA 1H3DA 2ZH8A 2L9NA 4LVNP 1LWCA 2GJIA 3C66A 2AP6A 1RGVA 2VC1A 2VG7A 3TA2A 2DITA 4DV1F 4C0OC 2ZOFA 2CPXA 1M0SA 3IS9A 4ED1A 4Q44A 2M5YA 3KLEB 5ITHA 3RBEA 5D77A 4OZ0A 2D74B 1FO1A 3O44A 4YFUA 4FS1A 2MKJA 4XDCA 4DWIA 3JSRA 4O3SA 3VQSA 3MPWA 3FQLA 2M3DA 3DLJA 4L3NA 4AYBD 2R8JA 2E1MC 5G0RA 1QSLA 1GX6A 1REVA 5EHHA 5I4MA 3PHEA 4NZ6A 3I4PA 3KK3A 3ZZPA 5L9XA 4V19J 3K0JA 2MZSA 2ZH6A 1DBDA 1PGZA 4O3PA 3CSKA 4MK7A 1TL1A 2W7AA 1X5PA 1C1CB 1KVJA 1HBUB 2ILZA 1NK8A 5EX0A 1YITS 3OXFA 1XWLA 3IG1B 3E01A 1SKRA 2Q1LA 1GNKA 3ZZYA 2LXUA 3AHPA 2LXFA 3UD3P 2Q66A 3EUNA 4X4PA 2PDAA 1XBWA 1N34F 2HLTA 3HPOA 1X0PA 1MU2A 1RA6A 1ZAVA 2W9CB 1XNQF 5GADU 1RT1B 3OL6A 5AXNA 2RD5C 3LWLA 2G4BA 4WFBQ 4YEAA 2ZJPQ 5D78A 4RW8B 1RT2B 1S1XB 4RW4B 2DGXA 5E2QA 1R6YA 4O4GB 3THTA 5KG0A 1VC0A 1IBLF 3MAQA 4B3OB 1W2IA 2L3MA 2Z2MA 1YJRA 1C4AA 3H4BA 1JNRB 2W7PA 1Q7LB 2I5JB 3SCKE 1G2EA 4R5PA 5AE2A 4HTIA 2CDQA 5KFAA 2OSQA 1N8RT 4DN9A 3E2EA 4DFJA 2HLUA 1NZAA 1L3VA 2IHR1 1TAUA 2D41A 3RZAA 4QPTA 3TAQA 4WFAQ 5IZHA 2ZUGA 3M2UA 5M2RA 2ZHBA 4K4TA 4QW9A 1BWEA 4AE5A 4WKRA 5HLFA 3DLLQ 1AXQA 4LIWA 1WTFA 2J9CA 2RDIA 3DM2A 2DNKA 5D4OA 2CPDA 1TP7A 4LFCF 3ETOA 1TR0A 2XI2A 1KHVA 3LP2B 3VR1A 3I31A 1BC6A 3O6QA 4QCLA 1TKTB 1U8SA 2O5DA 4NA2A 1FEHA 4CI0B 2VFSA 2RDJA 4YQWA 4PQUB 3J7YI 1NKBA 1WEXA 1FKOA 3MOZA 5KFLA 4IH6A 3DOKB 4ECYA 1UA1A 2J0WA 2JWNA 2KZMA 4IH5A 2UV8G 4NLVA 4MK8A 5E5NA 4UY8T 5KFQA 4ZA1A 5C25B 3UCZP 1MSWD 3L95X 3ZZUA 5B09A 3QGIA 4DF4A 2BACA 2ZM6F 3DLEB 4FZVA 2QSFA 1HQUB 1Q8LA 4RW8A 1ZZFA 1SJRA 2J9DE 1S48A 3R3TA 4OJHA 1XMOF 1MROA 1M5HA 3DRRB 3KK2A 2XMTA 4DR3F 3EPIA 4Q0BA 4OJ3A 5B08A 2P5VA 2A10A 5JJBA 4Q45A 3VZIA 3VAHA 2W9BA 1AROP 2BM0A 2W9AA 3MEKA 2VOOA 1KLNA 5DO2A 2V5HG 4PUOB 2IYIA 3P49B 3MD1A 2ZH3A 2O3DA 2L48A 3HHEA 4H4OA 4Y28C 1FF2A 3RBDA 3A8EA 1HBNA 3KHGA 1HPZB 4I68A 2XSJB 1VRUA 2E1RA 1YWXA 1D0EA 1YRTA 3D0HE 3MPVA 3BSOA 4IH7A 3V4IB 1KR4A 4NLQA 3KLFB 4DL4A 4RKUC 2HHTA 1T3OA 1Y3KA 1SI9A 4LSNA 2ASJA 3MXHP 3BDPA 4NRTA 2RQ4A 2ZOMA 4AXJA 2DB1A 3MMBB 3LP2A 4CQ1A 1C0TB 1SUQB 2QIFA 1DRZA 1S9GB 3VTIA 4ZHRB 3BO4A 2V4RA 4ECVA 3T6BA 4K4ZA 3HO1A 5KAKA 4OX9F 1TV6A 4PQUA 2M4MA 2YKPA 3GZ7A 3TAPA 3I5BA 3PR4A 1JLGB 4IO9Q 4IRKA 1S49A 3DOLA 1D8YA 3JB9k 1KFDA 2YKMB 1VQKS 3ZFVA 3CC2S 1FK9B 3QLHA 5E3RA 2ATLA 2OLWA 3TOQA 4JI7F 2DNNA 4ES2A 2HGLA 4ILMA 1ZM9A 1YJWS 4K4WA 3DXBA 4RU2A 2MMYA 2JH3A 3MMCB 4HYKA 4X4UA 4OHYA 1X4BA 3K2YA 3CMAS 2BQUA 1GH8A 1F0XA 2CQBA 3THPA 2IBKA 4ZK7M 4GC6A 5L39A 4M8LA 1YG0A 3DRRA 4G1QB 1S99A 5CYMB 2IAJA 3PJXA 4G1IA 4JI6F 1NK7A 1FRXA 4PR6A 2L08A 5EWFA 1HNWF 2IC3A 2J0XA 1VIOA 1VBYA 4TY8A 2YWGA 1IR0A 1UL3A 3M05A 1X4EA 1VQOS 3DRSB 2PEHA 2UXCF 4J9LA 2OP5A 2EBEA 2IA6A 3A1YG 2IBOA 2W8KA 3PFOA 4ZVFA 4CCHA 2VQFF 1E6YB 1B0VA 4IFVB 3M2VB 4PXCA 1SIZA 3CT9A 4DV4F 4TN2A 1TK8A 1N0VC 4QZVB 1Q8IA 5J2NB 5M2PA 2NREA 1IJEB 3LW5C 5EWEA 4X2BA 1F5CA 1S1UA 1SJ3P 5IWAF 3LP1B 2AJFE 2DGSA 3JYTB 1NKEA 2UUAF 3MMBA 1IKVB 4OLOA 1C0TA 5B0FA 3KLGB 5AE1A 4DV7F 1PILA 2UXDF 1PO6A 2FHMA 3NL0A 1Y5NB 2OH2A 4CO1A 2KN4A 4IG0A 4EYIB 1Q81T 1KSPA 5KFBA 1KQSR 5J2PB 5J1EB 2GJ2A 4NYOA 1TK0A 4Y6IA 1SV5B 1JLGA 3RB4A 2IJNA 2BJEA 2RH3A 5MAOA 1RT6B 4JI0F 2R4FA 2OAUA 1WI6A 1Z2ZA 4OX7A 4NLYA 2GHWA 4Y65A 2AX0A 3TARA 2QFJA 1FKAF 1DTTB 3I0RB 4AL5A 1SH3A 3SQGA 2JL9A 5J1NA 3KYLA 2V0NA 1V3ZA 2YNHB 3DU6A 4IFYA 1VBXA 2DNGA 2VUGA 2XI3A 2EFGA 4C3LA 4U6PA 4F3OA 5CYMA 1WNEA 1R8PA 1SIWB 1ZAWA 3R5AA 2Z4PA 1VIXA 3BM7A 2AJ0A 1R0AB 5F8JA 3VAMA 4WE1B 3M6VA 1I1GA 3LOUA 4TNOA 5DDQC 2AD9A 1F5AA 3IR7B 1S1TB 1X4HA 1HBMB 3DRSA 3NWGA 1Q78A 3UPFA 2KT3A 3MM5B 4HI2A 4Y2KA 1P1TA 2ZC4A 2XS7A 3M2VA 4OI1A 2JLGA 4DEZA 5C24B 3QIDA 5BJRA 3TUIC 3PO4A 2E7XA 5KT6A 3NG8A 3HI9A 2W4DA 5J2NA 2ZOGA 4O0IA 1SJ4P 2VPWB 4DR4F 2WW8A 2YTCA 4P6QA 1A6LA 3MURP 5J2QA 3CULA 1IKWB 2VOPA 2CZVC 4J9PA 2EFNA 3PIOQ 4URSA 1HQEB 4KHPF 3NMAA 4DR6F 2F8EX 1FDAA 3ITHB 5J1EA 4USIA 2ADCA 1RT5B 1X4GA 4QR2A 4EZ6A 3THVA 4UOCA