4WKRA

Larp7 wrapping up the 3' hairpin of 7sk non-coding rna (302-332)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
SRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the mechanism of stabilization of the 7SK small nuclear RNA by LARP7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords La-related protein 7
total genus 40
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wkrA02
1H2UX 2LEBA 1U6BA 2CQ2A 2X1FA 2M9KA 5LSOA 1YITS 2F3JA 3UCGA 3CF5Q 3BO4A 1Q7YT 3RW7A 3JB9k 2X1BA 2KHCA 3BO2A 2VOOA 1VQLS 1KQSR 3THTA 2MQQA 2KVIA 2E5GA 3CCMS 2XS7A 2MQOA 2HGNA 2AYMA 1UAWA 4YB1P 1WG4A 1X5SA 3NNAA 1DHMA 1VBZA 3MOJB 4M5DB 2LA6A 2CQ4A 1VQ4S 2X1AA 3CCVS 1VC0A 1NO8A 1O0PA 3MD1A 1WI8A 2SXLA 2AYBA 2CQHA 3CTRA 1M5KC 3VAJA 4WIIA 2KM8B 2D9PA 2VONA 1DRZA 2CPEA 4W92B 2DNYA 3U1MA 1H2TZ 2DNMA 3S01A 2KRBA 2RRBA 2V94A 2A3JA 5GAGU 2PE8A 1VQOS 2DGUA 3NMRA 1HA1A 2M7SA 1U1NA 3HHNB 2UP1A 2MYFA 2M8DB 5JVGQ 1JMTA 1WI6A 4IO9Q 2XNRA 1U1QA 3R1LA 1N52B 1M5PC 3CULA 2D3OR 2KI2A 3HI9A 2K3KA 1ZZFA 3FEXB 5GVQA 2KXFA 2CQ1A 5CA5A 2ERRA 2YTCA 2MY7A 2RT3A 1QM9A 1SJFA 5MLCV 1K9MT 5DETA 3EGNA 3VAKA 5D78A 1X5OA 5GAHU 2VODA 1W2BR 4TU9A 4IOCQ 1SJQA 2KT5A 2OTJS 5IFMA 1FHTA 1KC8T 1FJCA 2DITA 2MSTA 2MJUA 5JVHQ 1D9AA 1BY9A 3UD4P 2CQIA 1YIJS 1VQ7S 2LXIA 4WCEQ 3U1LA 3MDFA 3CC4S 2G4BA 2YWKA 3BO3A 4WFNQ 4OZ0A 5GADU 1N54B 1X0FA 2OTLS 1PO6A 3G4SS 2E5JA 2NZ4A 2OJ3A 4WFBQ 2MZTA 3CCUS 5CXTA 3G71S 1RK8A 4P6QA 5LJ5Y 2ADCA 3VAFA 1WWHA 1VQ9S 2KYXA 5LXYA 2MSSA 1VC5A 2YKAA 2D9OA 3V4MA 2DNNA 4QU7A 2VOPA 1X5PA 2BZ2A 5ITHA 1SJ3P 2FC8A 1WG1A 1YWXA 4WF9Q 4QPTA 3R1HA 2DNLA 4TU7A 3VF0B 3CCJS 1SJRA 4LJMA 1VBYA 1A7GE 3H2VE 4WFAQ 1OWXA 4U67Q 2LMIA 5H1SV 1VQ5S 4IUFA 2L41A 2L9WA 1YJNS 1UP1A 2Q79A 2MKKA 1NJIT 2DNKA 2I38A 2CPJA 2JX2A 1WELA 4F26A 3J7YU 3DXBA 1X4AA 2G1DA 2DGVA 2DIVA 2YH0A 2KG0A 3VAMA 3MUTP 3MUVP 1FO1A 3Q2TC 4PR6A 4BS2A 4IOAQ 2NLWA 2FHOB 4J5OA 5DM6Q 3S7RA 2X1GA 2ZJRQ 3UD3P 2EVZA 1DBDA 1WF0A 2U2FA 2CPIA 4FXVA 2DGOA 1S72S 3P6YC 1KOOA 2N3OA 3PIOQ 1ZH5A 1VQKS 3CCLS 1D8ZA 1F9FA 1U6FA 2GO9A 3ZZZA 3CCSS 1WHXA 1R8PA 2YH1A 1N8RT 2RQ4A 3UCZP 5FJ4A 4EGLA 2LA4A 2WBRA 1Q86T 1OIAA 2DNPA 2ZJPQ 5GAEU 3ZZYA 3CCRS 2I2YA 2MQMA 2J0SD 1FJEB 3PIPQ 2RNEA 1HD1A 5D77A 3NNHA 2MGZA 4ERDA 2L08A 2KRRA 2QFJA 2MMYA 2MJNA 3NS5A 4UQTA 4TU8A 2KG1A 3VAIA 3EX7B 2RRAA 1CVJA 1QVFR 3EGZA 2KN4A 2MY8A 1H6KX 3ULHA 2AYGA 2CQCA 3B4MA 1SJ4P 2DO0A 2M0GB 1WHVA 3CMAS 1U1MA 5EN1A 3B4DA 3D2WA 3CXCR 1WEYA 1X4HA 2KU7A 1U1KA 3L3CA 2DH7A 1K73T 2LCWA 1U1LA 2DHSA 2PEHA 3MD3A 3CPWR 5IQQA 2JRSA 2KH9A 1YJ9S 5HL7Q 5BJRA 2HZCA 2MZSA 2DGSA 4F25A 2BOPA 2OIHA 3LQVA 3CUNA 1Q82T 1UFWA 1X4FA 4Z2XA 3BEGB 1M1KT 1HL6A 2DGWA 2CPZA 5DM7Q 2ZJQQ 3MI7X 3RW6A 2MKHA 3IRWP 1RKJA 1DZ5A 4C0OC 5IM0B 2HYIB 2KM8C 2JWNA 2K8GA 5DDQC 3SDEB 1L3KA 2EK6A 4Y0FA 2DGQA 3G6ES 4QU6A 2MHNA 1X4DA 1VQMS 2AD9A 2RUGA 2KXNB 3OW2R 2CQDA 3VAGA 2DGTA 2MQLA 1M90T 2MKJA 2RQCA 1A9NB 3G96A 2RS2A 2J76E 1VQ6S 4F02A 1WEXA 2MPUA 2DHXA 2FY1A 5CYJA 1X5TA 1K8AT 2OSQA 2N82B 1AUDA 4ED5A 2MKSA 1WHYA 2CQ0A 2LYVA 3J7ZT 1U2FA 3S6EA 2B0GA 3R27A 1Q81T 2O3DA 2OSRA 2DO4A 2N3LA 1VC6A 3SMZA 2J0QD 1KD1T 2DNRA 1WG5A 2QEXS 2XS5A 2KFYA 4QQBA 1FT8A 4YUDA 3CC7S 3P49B 1YJWS 2DNZA 4CH1A 4V19X 2DNGA 1X4BA 2RS8A 3MUMP 2DNHA 1OPIA 1FNXH 2CPYA 3I55S 2JVOA 3CC2S 1ZZNA 2M8HA 2DH8A 1WEZA 2DH9A 2LECA 1FJ7A 5LXRA 2M52A 4CQ1A 3K0JA 2U1AA 3TYTA 3G8TA 2M70A 5HO4A 2XNQA 2MXYA 1VQNS 2CQGA 2FPHX 2MZRA 5LSLA 3NNCA 2MQPA 1VQPS 1WF2A 2CPHA 3TO8A 2MKCA 1NU4A 2EK1A 2HGLA 2KXHA 2XS2A 1YTYA 2XB2D 2RU3A 3P3DA 3THPA 2MZ1A 2DK2A 2CQPA 2F9DA 3SXLA 1XN9A 1YI2S 2DHGA 2MZQA 4A8XA 2CQBA 3US5A 3VALA 1P27B 2CPXA 2E5IA 2M88A 2CPDA 1KOHA 2MGZB 3IWNC 2LKZA 3BS9A 3UE2A 1JJ4A 1M5OC 2M2BA 2DNOA 2F9JA 1R8HA 1PGZA 5DDRC 1M5VC 1G2EA 1WTBA 4RU2A 1X4EA 1WHWA 4W90B 1S79A 3FEYB 2CQ3A 2LXUA 3I56S 3UWTA 3CCES 1N88A 1UW4A 4LMZA 2JVRA 3UCUP 2E44A 2G0CA 3DLLQ 2CJKA 2LQ5A 1B7FA 3P5TL 3MXHP 3G9CA 3LPYA 4PRFA 1P1TA 3NS6A 1YHQS 2N7CA 1JJHA 3N9UC 2M4MA 2GHPA 2XSFA 3Q2SC 4C4WA 4ZKAA 2QA4S 2DB1A 1QVGR 1FXLA 2DGXA 3H2UB 1X4GA 2E5HA 1URNA 4C7QA 1U1OA 3S8SA 4UY8T 4CH0S 2AYEA 2DNQA 4Y00A 4PKDB 1OO0B 2J8AA 3G8SA 5IM0A 2DIUA 2DISA 1VBXA 2LEAA 2MZJA 4FXWA 3CMES 3SDEA 2HVZA 2FC9A 2ADBA 4YOEA 2MQNA 5LJ3Y 3VAHA 1VQ8S 1HD0A 2DHAA 3CCQS 2RVJA 4LIRA 4TLQA 2MKIA 1IQTA 3MURP 3TP2A 1U1RA 4WKRA 1X4CA 5GMKa 1U1PA 5DDOC 5DDPC 4CIOA 1JJ2R 1H2VZ 1WF1A 4OZ1A 1SXLA 2HGMA 3CD6S 2CPFA 2MB0B
chains in the Genus database with same CATH superfamily
2ZH2A 4KGZB 1JLGB 3TARA 3AQOA 3PDNA 4OZ3A 2XMAA 1U6BA 2V9WA 2KYZA 2CG8A 1NJZA 2X1FA 4NYOA 3GIIA 2G9OA 2OFHX 3CF5Q 3R97A 2E5LJ 4NLGA 2J0WA 4DR4J 1XTZA 3CD0A 4NEZA 2B9XA 2W2NP 3DFEA 4QOTA 3CJKB 1RT6B 2BJ8A 2QLBB 3H8YA 3RW7A 3JB9k 1RHQB 1S6PB 2NUHA 3BN7A 3ZZRA 4RW7A 1S9EB 4OJGA 1HLWA 1RTDB 2HS4A 1KQSR 2MQQA 1F60B 2E5GA 2XI2A 1FE0A 1VQSA 3HJVA 1NRKA 1HBMB 3HKWA 3IR6B 1SV5B 2FZKB 4A4JA 1WG4A 1X5SA 3IBCB 4DR7J 4ZIWA 2LA6A 3M6VA 1HWJA 2VB6A 3VCDA 3MAQA 1VQ4S 4KO0A 2BABA 1R31A 3LAMA 3R7NB 1C1CA 1VC0A 4NLDA 3H5SA 2R9LA 1XMOF 4ED3A 3C66A 3H90A 4UOFA 2ZZMA 3MD1A 1WI8A 3JTNA 4NZ6A 4H4OB 1RAIB 4DSKA 1T94A 1TVRB 2V2ZA 5DG8A 3QJLA 4QYZJ 1RTHA 2CWXA 1IKYA 1HIYA 3KDNA 4M5GA 1M5KC 1HBUB 4OJ3A 2VONA 4ZDNA 4RW6B 4EO8A 1PYTA 1RBLA 1HI0P 3N28A 2C42A 3M8QA 4OYPA 2F4VF 3GONA 3E3XA 1GQEA 4BWMA 3IAM9 2KRBA 4EBEA 2ZH3A 2PMHA 4DBQA 5IC4B 2VBZA 1SQGA 3CCWA 4CTAA 2A3JA 3K5LA 1HHTP 2RKIB 3N0VA 2Q1LA 2QFIA 4PXEA 4OZ5A 4FZVA 4J9UE 4URQU 4LFBF 2M7SA 2QL5B 1LK7A 2JHEA 3M32B 3HHNB 1BLUA 4CDIA 2C2DA 1UPPA 4K8RA 2M8DB 4B9LA 4ECRA 1LQ9A 1TL1B 3I9ZA 4MKBA 1TL7A 1RQ0A 3WIUA 2C2KB 1RZMA 4TY8A 1CJUB 3CW2C 2KI2A 2YKPA 1IM4A 2J9DE 2O66A 3GB0A 3AD7C 4B3MJ 3CMQA 5F8IA 2AGPA 4GKKJ 1WC6A 5GVQA 1OY6A 4LRAA 2XI3A 4QIGA 2KXFA 4OYMA 4XDDA 5HMYA 1NJYA 4CZCA 2NYIA 5F9LA 2ERRA 3MM5B 1VLYA 3ET6B 4K4VA 1FERA 1VLOA 1FESA 1QM9A 4DSFA 2BR0A 1T02A 3MPVA 4YP3A 5MLCV 2W25A 2Y1IA 4RKUC 1SJFA 2EC0A 2ATCB 3GCWP 3G6YA 1U45A 2BW7A 3SSSA 2H5IB 1W2BR 2WB4A 3EPGA 4IKAA 3OR1A 1UJ6A 2OTJS 3RB4A 1H98A 2IVMA 4C0BA 5H9EJ 1FHTA 2GVDA 3WHIA 1NPRA 1OQ3A 4PUOA 2XZDB 3A8JA 3I87A 3BH6B 5SUHA 2CVIA 4U95A 3MCNA 2AJ2A 1BY9A 3NGKA 3UD4P 2A0FB 5D0RA 1W25A 3VTIA 1N4LA 1TMJA 2KZZA 2HAFA 3MDFA 3NCQA 5KFVA 3HM9A 1CULA 3Q86A 3HDSA 3MMCB 3QZ8A 4QR0A 5DQHA 4LF1A 2CUYA 1R7IA 1WSRA 3OLBA 3FGVA 3LP1A 3FMBA 4OZ0A 1XMQJ 1N54B 1X0FA 4CM0A 4O3RA 2VG6B 3O5TB 2E5JA 4O0NA 4DV3J 3QT8A 1NDCA 4GO7X 3QSYB 5D0GA 2NZ4A 4OV1A 1EARA 4YHHF 4P6QA 1SKSA 4TNOA 3U02A 1YGYA 1ICEB 5HBMA 1Z2ZA 3K17A 4WFYA 4E8UA 3HHKA 4DL4A 1WWHA 4NCGA 1VQ9S 5AE1A 3LGHA 4KJIA 4L3NA 2QLJB 4B17A 5LXYA 4R5PA 4KKOB 5DO2A 3GV5B 1VISA 3TANA 1X7VA 4I4BA 2HHVA 2OD6A 1Y5NB 3V4MA 1NKBA 3IWXA 1Q8IA 3J7Z5 1UKUA 4EMDA 1SKRA 1SJ3P 2IRXA 5HSPA 4OYIA 1S59A 4PQUB 1AFIA 3X3UA 4WF9Q 4DR1J 2HURA 1N48A 3KJNB 3PW4A 1TUGB 4O44B 4ALZA 4OX7A 3GG1A 1RWNB 2QO3A 2XMMA 1TTHB 3TZZA 2FJAB 3R1HA 3DN9A 4LSLB 4ID5A 4DX8H 1H38A 4G1QA 3AD8C 2VFTA 3CCJS 1NCLA 1RWXB 2OPRA 4LJMA 2VA3A 4WK1A 3EYZA 1A7GE 4FYXB 4ZVQB 4DX6A 4WFAQ 4DV2J 3GSIA 5SZTA 3G2XA 1OWXA 3NGRA 1IBLF 2PD1A 4KGXB 3JS9A 3JQJA 2I6WA 2LMIA 1LW2B 4KHMA 1VQ5S 3T6BA 4C3MA 3Q24A 1R8BA 2L9WA 1YJNS 1UP1A 1PSDA 2Q79A 2I5JA 2CPJA 2HS0A 3CJTA 4NLYA 2IIHA 2B4UA 1HFEL 3BSCA 4F26A 1JLGA 2EEYA 3DXBA 4CO1A 2RIJA 2R2UA 2ZH6A 2YPYA 5LSRA 4FN5A 2G1DA 4IO1A 3J81j 3MEDB 1JLQA 3VAMA 1UEKA 1B4SA 4LVOP 2NPFA 3H98A 1FO1A 4OZNA 2RDJA 3HFVA 2VUGA 1I94J 3MF5A 4PR6A 4KSEB 2PMWA 1S0NA 2YNHB 2HK2A 4M94A 3UN3A 1TK8A 5DM6Q 3S7RA 5KFDA 2XLJA 3NGDA 3L7PA 2PT0A 1NZAA 4PYDA 1DBDA 3GV8B 1YG0A 4AT1B 2VDIA 1FE4A 4LQ9A 4E2FB 1XIQA 3GILA 2W9BB 2R7WA 4DSEA 1S1VB 1QAIA 4U8VA 4DV4F 2V4JA 3DRSA 2D7SA 3QAUA 3PKYA 2HVIA 3PIOQ 1U6ZA 3FSIA 4ZA1A 1VQKS 3EICA 1RAEB 3UDCA 4D3HA 2VA2A 2QLFB 1K0VA 2GAHC 1NH7A 2XSJB 4H4OA 4URGA 4ELUA 1NHUA 1SQFA 1LXJA 1VI7A 4NI2B 2YH1A 3UCZP 4JV1A 3ZZPA 1RTZA 4X62F 3QRPA 1RT4B 1RAFB 5FJ4A 1HBUA 1OIAA 1RHUB 1Y7PA 5J1EB 1U24A 1S10A 2AZ1A 3DM2A 3ZZYA 3Q8PB 4JI5F 4DFKA 3DNCA 3NWGA 3PEHA 1WNEA 5B7WA 3C16A 4ZPCA 2C3YA 2IRUA 3SI8A 5D0HA 1FJEB 4FS1A 1T9YA 1OPZA 4RWWA 3NNHA 2V2KA 3FSYA 1T3NA 4F50A 4DN0A 1SKUB 1MNEA 2KRRA 3MCSA 4FPRA 1U26A 5ETRA 2MJNA 3NS5A 2XCAA 1EQ0A 1WDDA 4I56A 1S76D 1HWKA 2WBMA 4I64A 1FXRA 3MM8A 4UQTA 2OEMA 4UZCA 5IC6B 3T19A 2AJ4A 3SQOP 5H9FJ 4F0HA 4TU8A 4NLOA 3KK2A 1L3VA 3EX7B 1AZSB 1CVJA 1F6TA 3KLEB 1JLCB 2WK4A 4TY8B 1JJCB 3UN2A 4DZ6A 4DR6F 3DGPB 1XNRJ 3DLGB 3Q0AA 2NR0A 2LP4A 1C1BB 2JLFA 3TA2A 3B4DA 2DR6A 2WVBA 4FNIA 4J9LA 2GQQA 3T1HJ 2XWXA 4TQSA 1X4HA 2DR8A 1TKXB 2EG1A 3IM8A 3UVJA 4DMZA 1B0VA 2W2QP 5KFYA 4X4VA 4ANEA 2DH7A 2AW0A 4MKVA 2WONB 3GE9A 4L76A 1GEHA 1K73T 4OX8A 1NXIA 1UZDA 5KG5A 2FZCB 4ED6A 2KZMA 4USWA 3A4TA 3D1OA 5BJRA 1F2GA 3D1QA 3I5BA 2VD3A 3F56A 3H5UA 4J9KA 2A10A 4P74A 2OIHA 3EM1A 3CUNA 1QSSA 1F5AA 1UFWA 1X4FA 3F0NA 5KG3A 1T05B 5ETLA 4ZVRB 3WZ0A 4ES2A 3KMSA 3GCXP 5BYSA 4DX7A 1JLBB 3PV8A 2HMIB 5BXIA 3GYNA 4DN9A 1N5SA 3IRWP 1RKJA 2NREA 3TJ9A 4C9DA 1NK9A 4NLWA 1CJTB 3DRXA 4JI6F 1DTQA 2JWNA 3BDEA 2YX4A 3QGIA 2YKQA 4DR2J 3PRVA 1QDUB 1S0VA 5H9EK 1U0HA 4QIEA 4AQYF 1NKCA 2FHJD 3OD2A 3N5FA 2IJFA 3LTOA 5E3QA 2XC9A 1ACMB 3G6ES 4HH0A 3DOMB 1VHFA 2MHNA 3CJRA 3LW5C 2MLYA 5D0EA 3W64A 4GVLA 5EGYA 3OW2R 1VQMS 2AD9A 1B99A 4X84A 4AUKA 4QR2A 1UWBA 5IS2A 3VAGA 2MKJA 2JSXA 3ENVA 2ZBPA 5A8RA 1A9NB 3G96A 5HMXA 1YLXA 2YNFB 3RAMA 3DDIA 1FRHA 4KKOA 1YVFA 2CJAA 2IRYA 4WE1A 4ECVA 1HQUB 3EMTA 3OT9A 3K2YA 2DHXA 4PXCA 2FY1A 1HPZB 2H54B 1ROFA 2PFDA 1ZM2A 4RL1A 6AT1B 4KRWA 2N82B 4HYKA 4EZ9A 1AUDA 1KVIA 3QNWB 1N34J 1BQMB 2ZFHA 2A6OA 2CG4A 2CWKA 2OPQB 1VOMA 2YNGB 3A12A 4G65A 4NLSA 4N56A 1RU2A 2CQ0A 2R2RA 3V4IB 2AEJA 1IBKJ 1U2FA 3W60A 2HZVA 1V9OA 4OHZA 4ANDA 3BSOA 1N56A 4CT9A 4DV5F 2B9YA 2O3DA 2OSRA 5C24A 3MOZA 2B4PA 3UD5A 1JXEA 4ZOSA 4QR1A 3TX0A 5L38A 3H5YA 1VC6A 3E8OA 3HD2A 1KD1T 4KAIA 3IN5A 2RB7A 3PW5A 1WG5A 4IDKA 3QO9B 5J2QA 2FVQA 1QJHA 3SCLE 2L48A 1HQ2A 4BC9A 2XS5A 2AJQA 2KFYA 1HW9A 1RHMB 2R2SA 2OPSB 1WD6A 1FT8A 4OQJA 5HJYA 4YUDA 1GFWB 1YJWS 2DNZA 3KYLA 2GNKA 2RS8A 4PWDB 2DNHA 4IQXA 2B7BB 4OZJA 1FNXH 1HNVB 2N4CA 2Y0BB 2UVRA 1VR6A 1F1BB 3PRBA 4OX6A 1PJ5A 3NS7B 2ZH8A 3CC2S 3ZNJ1 4FBTA 2M8HA 4LR7A 2F40A 2KJWA 5HROB 4NL5A 2J6UA 4K0KJ 1HNIA 1VQYA 3D0HE 2YWHA 4OV6A 4NPOA 1RTJA 5HAOA 5LXRA 2ZH1A 2M52A 2K2PA 3C15A 1KWMA 2XZWA 5IWAF 4ECSA 4LFCJ 4YB6A 3KJQB 1IKYB 4WK3A 1OY9A 3K0JA 2HHHF 4JV5F 3A13A 3TQ1A 1IJFB 3Q22A 3P5BP 2JDJA 1RAAB 2EPIA 1KQKA 5LT5A 1VQPS 1WF2A 1M1GA 2CPHA 3PTWA 4I0WA 1XQIA 3QIPA 5F0WA 4XAKA 4X64J 1QAJA 2XS2A 4IR1A 5ETOA 3JYTA 5K14A 3THPA 4CO4A 2DK2A 4NA3A 2P9CA 5DJBA 4DSLA 2Z0GA 2ZM6J 4RW4B 4EBDA 2KKHA 5KG1A 3MPWA 1ZOTA 2AJFE 3Q23A 1DJ0A 1YZ7A 1TL1A 3FBFA 1N32F 2KVQE 2HHPA 3C16B 1FNOA 2CPDA 1XMQF 4JYAJ 3BB5A 2LKZA 3AOBA 5KT7A 4C6AA 2C22A 3C46A 3PY8A 1LKZA 4JI0J 4Y2AA 1VBKA 1M5OC 2M2BA 2MLXA 2DNOA 3R5JB 4KTQA 2F9JA 3IP0A 3PX4A 4LF8F 1PC5A 3K5MA 1SH0A 1JKHA 1G2EA 5KT5A 1WTBA 1DQ8A 2GVZB 4YFUA 3G6XA 3THVA 3IS9B 4ZPBA 5BR8J 1LW0A 4BWJA 3W7BA 3AHPA 4DG1B 1W26A 1UW4A 5I3UA 1V6HA 1CJKB 1UWAA 1C1BA 1QD1A 3GG0A 4L3KA 1HBNA 1R6YA 2ZH4A 3V4IA 1QTMA 2FLPA 2KJVA 5KFXA 3C6UB 1LWCB 1N0VC 2CJKA 2LQ5A 3MAAB 1I51B 3P5TL 4P10A 4MAKA 4OLOA 4OL8A 1IBMJ 5DZ6A 1TK0A 1I3OB 3HHDA 3MCMA 4K4ZA 4JI2J 3UDEA 5K8PA 4PRFA 4WXOA 5B0EA 4ZCLA 4DZDA 4ZPAA 1NM2A 2NSBA 3FCVA 1D09B 2HYIB 2DR9A 1JJHA 1SUQA 3LUYA 1KRPA 3OTBA 1QLNA 3MZIA 4C4WA 3LF0A 2DB1A 1FKOA 3DOKB 3H2UB 3KMQA 1JB0C 1FRXA 1LWFB 1J5EJ 3FCHA 1RHKB 3N79A 3SCJE 2IBKA 4A48A 2V2VA 3KKFA 3NEKA 4UY8T 3IG1A 4JV0A 5T7LA 3H42A 1N33F 3O3LA 3CO9A 4J9RA 2DXEA 4U9RA 5ETKA 5EWEA 2HNYB 1VRUB 4NCGB 5KFTA 5DZ7A 1SH3A 2R7TA 3M6UA 3NRBA 3R5CA 4R5PB 3SYZA 1CS4A 4K4WA 4DR3J 1I94F 3E01B 2LEAA 3CMES 1GAOA 1XWLA 3FBBA 2FC9A 4KIAA 1FWKA 4H4MB 2K1RB 5B0AA 3KLGB 1M5HA 4YOEA 1HR0J 2IDEA 2RMLA 3MAHA 3OV7A 1VQ8S 1HD0A 2DHAA 1K44A 4LSNB 2I8EA 4O23A 3AH6A 4TLQA 5ETNA 4IYQA 4NLRA 4OYOA 1DFDA 3H4DA 1WC0A 3G86A 4LSLA 3IBFB 5GMKa 4WE1B 3OR2A 5EHHA 3M9OB 2UVWA 4CLPA 4LF7J 4NCAA 2BKPA 1AB8A 2AQ4A 1JJ2R 1TV6B 5A8WB 2Y9HA 1R3NA 4KH0B 4IOBA 4X4OA 3K5OA 1Q8KA 2CNKB 2IHR1 3I9V9 3HLUA 2YWWA 1BQMA 3IGNA 4OI1A 2XCPA 3D3BJ 3FRYA 3QATA 4ZPVR 2IM1A 4MJKA 1MU2B 4M5LA 1H2UX 2LEBA 2EBGA 1RCXB 1OYDA 3QJPA 1QUPA 5LSOA 1YITS 1JXVA 4NE9C 2UXDJ 3NAIA 4USHA 3TJAA 4TQRA 2NXNA 2JEJA 1QSYA 4QPXA 1SPBP 4U6PA 2X1BA 2KHCA 4IDKB 3TW0A 5J2QB 1R0AB 2V0NA 3AXMA 4GC6A 2I1RA 4FYVB 3BO2A 4C97A 2VOOA 2XS7A 2KVIA 3PW0A 3L95X 5DQIA 1VJQA 2XMVA 4NX9A 4ED0A 2UUBF 1UAWA 5FDLB 5B0BA 4CCHA 4ZLLA 2OAUA 4UOGA 3NNAA 2NUUG 2W9BA 4PWDA 4M5DB 2ZWOA 4K5RA 1S1VA 1SCJB 1QE1A 3KLFB 3TA1A 2DT9A 3NLCA 4ICLB 2X1AA 3VQSA 4X4UA 1O0PA 4YEAA 1RWUA 2OI2A 2VKRA 3KG4A 2KL8A 3N4WA 4IQMA 2QYGA 4P75A 1IR2A 5J1NA 3AA9A 4X66J 2ZC3A 4ZLNA 2K7JA 4LRCA 2XYGB 2DVIA 2LQ9A 2SXLA 1N0UA 2LU2A 1RAOA 1LNQA 3GR1A 1GT8A 3HZEA 2VASA 3ZTQA 2OH2A 3VAJA 1F3FA 4KPCA 3JAMY 4R8UB 4WIIA 2KM8B 2B7CB 3DDNA 4C8LA 4PABA 1DRZA 2CPEA 1PG5B 2BUNA 4KHRA 4LIWA 2H5JB 3DM2B 3QZ7A 4HHJA 2RJZA 3U1MA 3W66A 1PCAA 4DR5F 1D0EA 1U48A 5M2PA 3TJ8A 2RRBA 2ZE2A 4OLPA 2BACA 3RYLA 5DGBA 2QGFB 1EB0A 1NK5A 4DOZA 2HHUA 1Q5YA 5LOQA 3J7A1 2DGUA 3PW2A 2CFXA 3FFIA 1F9EB 2COLA 4QBUA 5CD4H 1HA1A 2RH3A 5F0UA 2GZOA 4DPXA 2ROEA 1FD2A 1LWEB 1RI7A 2NYHA 2W7AA 2OUGA 1AZSA 4MK9A 1LWXA 1OY8A 1RT3B 3I0RA 4DV6F 1PAUB 4J9QA 3R1LA 1N52B 3I82A 2CJYB 3CULA 1MSWD 1NK7A 4ANCA 3BGOP 3DGPA 2CNLB 3M1VB 1RYRA 2WTFA 1ZZFA 1R6VA 5E3CA 3QJJA 2VC0A 3TZYA 3PX6A 1Q7LB 3PO4A 1FX4A 3CJSA 1UCNA 2VIHA 2I9SA 2CJBA 1NEEA 5FIIA 1CQNA 4HHHA 2XO6A 2E9RX 3SCIE 2B8PA 3M9NB 4KGMA 4O3OA 3U7JA 1E6VB 1FRJA 3NY0A 4ZMMA 2JNJA 3MECB 1FRMA 3N6NA 3MPUB 4NEYA 4QIWD 5DETA 1K9MT 4HACB 1FA0A 4DV3F 1YJUA 3MEEA 2HVHA 1X5OA 2R8KA 3BSNA 5A76A 4RUAA 1YDLA 1SJQA 2KT5A 4YHHJ 4F67A 2BRLA 3Q83A 4OI4A 3MM6A 4WXWA 1FJCA 2VQEJ 1LWCA 2P9GA 2J7KA 2MJUA 1HQEB 3Q89A 3ILOA 3MR2A 4XTTA 1GXTA 3TEGA 2ZBIA 1JLBA 2HMIA 2CQIA 1ZS6A 1TFYA 4B3TF 4WCEQ 1GMUA 3TI0A 3CC4S 4DCOB 2G4BA 1DTQB 4P52A 1YKWA 2HNDB 1TQLA 3LP2B 3M7VA 2EFVA 3CEDA 4BHQA 5KT4A 3OVAA 4XK8C 1N5QA 5HANA 4X2BA 2OTLS 1G6BA 1GMWA 3B54A 4CO5A 3RR8A 3PJXA 2HFOA 4ECZA 2E1RA 4AFFA 4WFBQ 3G87A 3Q8YA 3PYEA 4IG0B 3DOMA 3LWMA 3WDOA 2IC3B 2GIFA 2MZTA 4K2JA 5CXTA 3G71S 4B3OB 5D4PA 5L1LA 4LF5F 4KY3A 2HNZA 3M2VB 3O2IA 1FXDA 4RW8B 2B6AB 2MDAA 2HNYA 4WFXA 4USUA 4ZVEA 4CH7A 2UUTA 4XO0A 5E0OA 3UQSA 3T5KA 2FJWA 3K5NA 1S49A 4FKXA 4M1KA 4J9PA 1J5OA 4FBUA 2HWHA 1CS4B 1WC5A 4H54A 1VC5A 1FCAA 4KH1B 3W5ZA 5KFHA 3CJ4A 1NDLA 1W2IA 2ROGA 4O4RA 3Q8SB 1X5PA 4NA2A 2VC1A 1IWGA 4H4MA 2K1RA 4MK8A 5ITHA 3KLGA 2RF2A 1HNXF 2H9ZA 2LU1A 3LGNA 5IWAJ 2OPQA 3BJYA 2JZ5A 4C8ZA 3ZZ0A 1ZTWA 4JOUA 4EI2A 2VF3A 1V3SA 2BV3A 4M8LA 5LMNJ 4TU7A 3ZFVA 4EWTA 5C24B 3VQTA 2UUCJ 1TKTA 4N8NA 3R2CJ 4Q44A 1VBYA 2YNIB 3H2VE 2CJ9A 2HQFA 4WYWA 3BV8A 5J1PA 1UA0A 3MM7B 1FJGF 2IA6A 1T9UA 2IBOA 1YJRA 2L9DA 4RBVA 5F8LA 4U67Q 1WKKA 1Z2LA 2PO4A 3HF5A 5KFQA 1T9XA 4FF1A 3FBCA 5E7OB 1TP7A 2C3MA 4I2QA 2L41A 4USMA 1NJIT 1KHWA 2I38A 3DC2A 2JX2A 3DDKA 5HI7A 2DRDA 2R4FA 3KLHA 4A8FA 1B7YB 1HW8A 1RADB 2V6AA 2BQRA 4EK2A 2DIVA 4AYBD 3GJRB 5EUHA 1XK8A 5KOXA 1BHNA 4HL9A 1HNVA 1GNKA 3MUVP 2ALZA 1U49A 4JYAF 1PC4A 4OJHA 7FDRA 4JI7J 4BS2A 1S6PA 1ZA1B 2BX6A 4RW7B 3KJVB 3BYRA 4DX5A 2X1GA 2MKYA 2WSEC 2ZDPA 1OMSA 3BBFA 3POTB 4I6AA 4E0DA 3UD3P 2EVZA 4HTIA 2JEIA 3HD1A 2Z57B 3TX8A 3FDSA 3JSYA 2GJIA 4I7FA 1N36F 3HPOA 4B08A 1UA1A 3H5XA 3P6YC 5BR8F 3QSIA 2OD4A 2UU9J 2Z8QA 4ICLA 4R25A 5G0RA 4DLEA 1ZH5A 2IAJB 5LMUJ 3QIPB 1ZPWX 4OI6A 2DXFA 3JYTB 1F9FA 3MEGB 3H25A 3CCSS 2BQUA 3Q8RB 4YB7A 2Q6BA 3OTCA 4FVMA 2GMLA 1R8PA 3T9NA 3UNYA 1FX2A 4DV1F 5M2RA 4R8UA 2ZWPA 4G1IA 4WP3A 1YX2A 1C4AA 4J90A 2Z58B 4RWXA 6FDRA 3FQLA 5C42A 4Q5VA 2ZJPQ 1XERA 3T1HF 2H4YB 1B64A 3VZIA 3DLEB 4JB8B 3A3OB 2EC2A 4DF4A 2J0SD 1RT2B 3KK1A 4BC7A 2XTJP 1HI8A 3N5BA 2RNEA 3IWLA 1S0MA 2UXCJ 2MGZA 1TMMA 3BGLA 2J6SA 4ERDA 4HDGA 2RHQB 4O3PA 1PKUA 4Q7AA 3TVZA 1HHSA 2IJRA 3PR4A 3SV3A 2FVRA 4UY85 3DXSX 4K4XA 4DQQA 4Q8FA 1YSJA 3BGFA 3UN5A 4F4YA 2JEFA 1EJ7L 1RWMB 1N33J 1BWEA 3HT0A 2KG1A 4DV7J 3CJ3A 3I31A 1PILA 4W98A 4DFPA 4B3RJ 2HBYB 1YJTA 3AOCA 2VFRA 5I3PA 2XYPB 2Q6CA 3H0PA 4NOHA 3MR3A 4ZVOB 1KLMB 3ULHA 2B9WA 2CQCA 3QMQA 3J80Y 1SJ4P 2DO0A 4IH5A 2RRNA 5EX3A 5L39A 1U1MA 3HZGA 3TZXA 3HSDA 1Q95G 1WEYA 2KU7A 3C6UA 4A47A 1RGVA 3PJWA 3VZHA 2W2MP 2QSFA 1WC1A 3L3CA 1U1KA 4C11B 3J7YI 4Q0BA 5HMZA 1KVKA 3BQ2A 4WWSA 2LCWA 4K4UA 1E6VA 2DHSA 3MD3A 1WKLA 4ECYA 5IQQA 4LR9A 2R42A 2HW3A 1HHQA 1OQ6A 5HL7Q 2HLUA 2C2ZB 4F4AA 3A3PB 5T14A 2HZCA 2MZSA 3ITHA 1QTNB 4M5HA 3D5MA 4YY3J 4K4TA 1RBAA 1L5UA 3RRHA 2C2MB 4ZVGA 2H5EA 3M05A 4PWUA 4N47A 1Q82T 1VRTA 2V34A 3KHHA 4UOHA 4A8SA 2Z2YB 5D4LA 4J7CA 4NRUA 2P6TA 4DPOA 5CCLA 2N7YA 4HTJA 1M1KT 3TNVA 2DGWA 3W62A 1HQEA 1U2RA 4HI1A 3JSMB 3EVWA 4NMLA 3MI7X 1JNZB 5DM7Q 1NK0A 5HP1B 4IR9A 4J9SA 4LF9J 5T7LB 3PFEA 4RNNA 2RQMA 2MKHA 3W9IA 1DZ5A 1HNZJ 1UTAA 2ACMA 1CULB 2ZNZA 5KT6A 1RBOB 4OX9J 3NOGA 3GPAA 5DS7A 2M5YA 4J91A 1L3TA 1IBKF 2BDPA 1CSJA 2A2CA 2OEKA 3HX9A 2VG6A 1IUJA 3AB4B 3R6LB 4HI2A 1L3KA 2CRLA 3A8EA 3WBZA 1IN0A 1NSAA 3PHEA 7AT1B 3BKFA 5HBMB 4ECQA 3NMAA 2WVEA 1X4DA 5IT0A 1S1TA 4ZP8A 4LSNA 1RAHB 3AJ2A 2IA0A 1SB6A 4CO3A 1P9QC 1S1XB 3M8SA 2H3EB 1JK9B 4F0KA 2FUG9 2RS2A 3RBZA 1KTVA 2VFVA 4UOCA 3R7SB 1WEXA 2MPUA 3NOCA 3R3TA 1TELA 4DV0J 3IWNC 5E3RA 4P71A 3K5PA 2QMWA 1SL2A 2OSQA 2NSCA 2WRMA 1FNMA 3EGVA 2R8IA 3QWUA 4ED5A 3A8IA 4CYUA 3TZWA 2W9CA 2R7RA 1NK4A 1U47A 2YBVA 3ILIA 1WHYA 4IG3A 2W7OA 1UPMB 3DHWC 1MROB 1UW9A 4S0MA 5KFUA 8RUCA 4J9NA 4U7UD 1MU2A 2YQ3A 1H7WA 2OP5A 4ID5B 4NYPA 1NBEB 5KFNA 2BQ3A 4GRSA 2FGCA 4K0KF 2N3LA 3BR9A 3H59A 4U7UK 2R7XA 4WIQA 4CLLA 4MFBB 3SIPB 2ZBQA 5HLFB 4EFAC 2QA4G 2GIQA 5HQMA 3FZ2A 3DYAB 4DUTA 4P73A 4DHVA 1K47A 5HJXA 3HHLC 2Q66A 3R8YA 3KLHB 2IVFB 2OMOA 1V3ZA 2QSWA 3IO1A 3VGTA 3K57A 1RA7A 2DCLA 4FYWB 3PFOA 1D9DA 1AUSL 2XO7A 2VPYB 3HVWA 1X4BA 4OYZA 4PYAA 3MUMP 3RG6A 4DV6J 4M5DA 5KG6A 4Z7YA 5GMEA 3VGUA 1T03A 1U0SA 5D8HB 2B56A 3I55S 2Q43A 3H4BA 4ECXA 4DPTA 1KKHA 4USTA 1C1CB 3FZBA 2Z2ZA 4ITSA 4DL2A 5AT1B 1WEZA 2GHVC 3QAEA 3GJQB 2LECA 5J2MA 2V8PA 3L7UA 3OL8A 3DLBA 4NA1A 3LO3A 1N32J 3J81U 4X4TA 4UTGA 2EWHA 5HQLA 4CLZA 3KLVA 4ELTA 4HT5A 4FXDA 5K5MA 4I7FB 2DPIA 2M70A 1VQNS 1SBRA 2CQGA 1BMQB 2FPHX 4JI0F 4B3SJ 4DJBA 5KTQA 4CLWA 2ZOMA 1XR6A 1OJ4A 2HAIA 2L9NA 2IAJA 2MKCA 4JI3J 2HGLA 4KBIA 4FYYB 3M8WA 4MMOA 3SDEB 4CTAB 3P3DA 2RU3A 2F9DA 3DLKB 1H0HB 1XN9A 1Q86T 1YI2S 2DHGA 3IM9A 3SCKE 4USVA 2W9AA 5JJBA 1NPKA 3VALA 2V8GA 3CJ8A 3ETOA 2BRKA 1PJ6A 1WACA 2EFGA 4YDDB 2CPXA 1MG7A 4OI0A 1TL7B 1HWIA 1X31C 1WC3A 3WC0A 1KHVA 3AA8A 2DEIA 4EUVA 1KOHA 3BPSP 3M1VA 3DMJA 4ES3A 2HFVA 1QUVA 1RISA 2FY8A 3QBCA 3QFWA 3TEHB 3A8KA 4KT0C 4A8MP 3PW7A 4JI2F 1S5ZA 1N6QB 5JMNA 4GKJF 5HVGA 5B08A 2ZKUA 3MM5A 3QFHA 3KK2B 2YKNA 2VU5A 5DDRC 4P7VA 2BEFA 4C48A 5FLXY 1QSLA 1GMWD 3MECA 4ZP7A 4RU2A 3KK3B 1UVJA 4W90B 3CDUA 1Y9OA 1KLMA 2QX0A 2JC0A 3I56S 1N88A 1NDKA 3CIMA 3N6LA 3WX4A 5F9NA 1W7WA 1GTEA 5ETQA 3UCUP 2UUAJ 3P4UB 5M2UA 1TKXA 1F5CA 4ZN1A 1KN6A 1Q79A 2DHHA 2G1HA 2GV1A 2AJ0A 1C2PA 3AXKA 1RAGB 2GIRA 2FHJA 1YK9A 3M30A 2ASLA 2XHWA 4NXNJ 2CZVC 2F4FA 1HYSA 2HFNA 1TUVA 1YHQS 2WB1D 3DRPB 4F3MA 4LVNP 4ZVHA 1YBUA 3MMCA 2N7CA 1RLCL 5IXUA 2M4MA 2GHPA 4LBPA 4PZVA 1SJ1A 2HPUA 3ZTRA 3OJUA 2QA4S 1QVGR 4A8WA 3LH2S 4KE5A 4IFVA 1FKPA 1URNA 4O0IA 1S6UA 2BKNA 3WX8A 1U1OA 1U4BA 1MN9A 3EXYA 5K8MA 4I2PA 2XGQA 2IC3A 1JLAB 1HNWJ 4CH0S 4B3OA 2DNQA 4LF4J 4Y00A 2LLZA 2Y1LB 3HULA 4O3NA 3ONQA 3UDLA 3SEOA 2C2EA 4PKDB 2HHTA 1UVKA 2P8IA 2Y1JA 2EI5A 2OHDA 5IM0A 1YBAA 3PVXA 5CHCB 3M8ZA 1B0PA 2DIUA 4PQAA 1IKVA 4KFBB 3M6XA 1BXNA 1VBXA 2HBZB 2MZJA 3M8PA 1U0HB 1CLFA 5KFKA 3V6KA 1FTRA 2BE2A 2PSZA 4ZK7M 2JC1A 2AP6A 4XDCA 5LJ3Y 2DEJA 3BGUA 3HK2A 3TUJC 2D69A 2GQ2A 3GTYX 3MFHA 3VAHA 4O3SA 3PACA 2VL1A 3C14B 2W4DA 3GLJA 2W1BA 4QZVB 4AE5A 5KFWA 3I96A 3L9ZA 1EAYC 2GMJA 3OFFA 3CCQS 2UXDF 1Y0HA 2DTJA 1S1XA 4ZP6A 3AOAA 1U1PA 3EZ5A 1PJ7A 2OPRB 2C28A 3B8HA 4CIOA 1H2VZ 4NLUA 4OMFG 4BDPA 1B0TA 4CO0A 3ZZTA 2D74B 3EE3A 3W2VB 1FFSB 2GC8A 4K2XA 3BZQA 1FFWB 2VKZG 3CD6S 3CWJA 4DLGA 2WVCA 4DPYA 2YNGA 3I4HX 3AJ1A 3MMJA 3OXGA 2I5JB 4DCPB 1Q1KA 2ZH5A 2PDAA 1NAQA 3VAFA 4RNHA 5B0CA 2CYYA 3LGMA 5EN1A 3OUYB 2M9KA 3BN4A 3MEDA 5KG2A 3B6BA 1T9WA 4K50A 1S6QB 4WZMA 4UZBA 3BO4A 4C3KA 4I68A 1Q7YT 2G2ZA 2ZC4A 4ZLJA 1YRXA 2BYCA 2PA8D 5L8RC 3JAMU 2AMCB 1X0PA 2B8QA 3B82A 1H74A 3UR0A 3TQEA 4JBCA 1NK6A 4HVZA 3MMAA 2Z4PA 2ZVSA 1OS5A 3H2LA 1LK5A 5E3PA 1EQMA 4Q43A 3CCMS 2MQOA 2HGNA 4FS2A 4JI8F 1B3TA 3EZUA 2KFZA 4RX6A 2X3GA 1IBCB 3R5BA 3V2UC 3CT9A 2QV6A 2AYMA 4YB1P 3VVTA 3ZZUA 2D1CA 1AROP 3R5GA 1TUWA 3ENAA 1VBZA 2E66A 5F3TA 1BE4A 2CQ4A 1Q8LA 2GO8A 4LFBJ 3TRGA 2IM3A 4FDFA 1NO8A 2GQCA 4RBUA 2XULA 3SQGB 2QT7A 3MMBB 2IDLA 4OYWA 4JI1J 1WOPA 4L73A 2LVWA 4UQGA 3T5LA 5CYQA 5KFIA 3KHGA 4YB5A 5IZHA 3WC2A 3CTRA 2FLOA 4RNOA 2EXUA 1E6YB 1RUSA 2D9PA 3TUZC 4B3MF 2UVUA 3OVSA 3BQ1A 1ULRA 2IMOA 2K3IA 2DNYA 1H2TZ 2FLNA 1TL3A 1EKSA 2DNMA 3KK1B 3CJQA 4DUZF 1BGXT 3PXGa 3D54A 1YRTA 1A6LA 3HHLD 5D4OA 1ZM4A 2Z2LA 3NBPA 4DI6A 4F3OA 2PE8A 1IR0A 2YWFA 2XMWA 1VQOS 2HHSA 2HHWA 1V5IB 1NSQA 3RRKA 3I5CA 1FDNA 5CABA 4GC7A 3NMRA 5GADI 4LF9F 4EYHB 2PI5A 1ZBTA 1FEEA 3SV4A 2UP1A 3DU6A 2VPWB 2NXUA 4QWDA 2MYFA 1H73A 1NK8A 2VPZB 3L7OA 2HK3A 3C3LA 4IO9Q 2DRAA 1TKZA 1S48A 4CLSA 3LPEA 2HQIA 1NHKL 1S7IA 2ASYA 2VQEF 5FLXU 2D3OR 1S9FA 1M5PC 1UZHA 4FF4A 4BLGA 3X1LB 2O5DA 1M1HA 2K3KA 3BH7B 3PG9A 2UV8A 3FEXB 3L4BC 4RPFA 2A6MA 3IGVA 1RT5A 1RWOB 1RSCA 1Y5LB 4H4KA 3KOAA 2CQ1A 3M2RB 4DL3A 5CA5A 4PG4A 2MY7A 2P9EA 2WONA 3AODA 1S1UA 3KG0A 4DEZA 4OJ1A 1JXLA 2BJ1A 1FWLA 3ELHA 3SBMA 3EGNA 5D78A 2V4QA 4OHXA 1K1SA 1TR0A 3FK4A 5GAHU 3V6DA 2F8MA 3K8VA 3KWMA 4DCJB 2JFDA 4ZCMA 4TU9A 2VODA 4IOCQ 2CA9A 2JOQA 2G13A 2HWTA 2VBYA 3KDOA 4KGKA 5IFMA 4LF5J 3N01A 3NAHA 5IT4A 1VDHA 5BYRA 2LXFA 4E98A 5C25A 3IA0A 1H7XA 2BXJA 2DITA 2MSTA 1UFKA 4Q2MA 3KNAA 2OPPB 3IR7B 4RW9B 3RBXA 3RZAA 4F2RA 1YIJS 4HHUA 3MFIA 1HYSB 2HRYA 1IR1A 3U1LA 1VK8A 2YKOA 4QJVA 4CLUA 3JTOA 4B9VA 4OYXA 2WHOA 2E7VA 2B5JA 1JLFA 2P2CB 4DR1F 2QMXA 1S9GA 3A3NB 3UPFA 3BO3A 4AL7A 4WFNQ 2WVFA 3PEJA 2RD5C 4LBHA 3R5DA 5KT3A 5GADU 3G4SS 2WOMA 5LMNF 3CD5A 4C3LA 2WW4A 2IY5B 2VG7A 4FPIA 2BANB 4D3GA 2ZHAA 1HWLA 2NQPA 4EEYA 1S1TB 2DKOB 4N8OA 3A1YG 1RK8A 2AEFA 5HMWA 4HEA9 5LJ5Y 3BQ0A 1IBLJ 2FHKA 5KG4A 1GH8A 4QW8A 3L09A 2ZH7A 3MPYA 4G6VB 1P8GA 3VWSA 2VG5A 1FDBA 2HFSA 3W2WA 4X4RA 4ZPDA 2FJVA 2MSSA 5D4NA 2YKAA 1HQUA 2DNNA 2VOPA 2D3O1 4FF3A 5MAOA 3PKMA 3BF4A 1IJEB 3ZTSA 1L3UA 2DR7A 3CD7A 3W8PA 2FC8A 1WG1A 2CKWA 3KXDA 1YWXA 1XJWB 1Q53A 4MT1A 4QPTA 5C5JA 1FRIA 3ENQA 2W4PA 2V8HA 3IFEA 1KSPA 4IG3B 3IRXA 4OI2A 1MROA 1IKWB 2KT3A 2CJQA 2LQBA 2CJXB 3QGGA 3TVYA 3MHYA 2W2PP 2XHCA 4F7VA 2GA7A 4JI7F 4JV5J 2UV8G 3NCRA 2HHQA 3VF0B 3T9ZA 2F5GA 2C3PA 2FHMA 2HWIA 2C3OA 4B3SF 2BJDA 1PIEA 1R8AA 5EWFA 3VGVA 2XY6A 1TV6A 2LDYA 5A8WA 4X64F 3OSNA 5CCMA 4B9MA 3UW1A 6FD1A 3QO9A 1LFWA 2QC3A 4IUFA 5L9XA 2R2TA 4GMKA 4PG5A 1K0TA 2MKKA 3DYAA 2V67A 1WOSA 1O8BA 3VVUA 4NWBA 3PHTA 4ILLA 1C0TB 1CC8A 5DLFA 1SH2A 4ILMA 5LMUF 2XQCA 1X4AA 3QIDA 1MN7A 1Q5VA 4FKYA 3OUYA 3SSQA 3HVRA 3QYYA 1S6QA 2KG0A 1T8EA 2Y1RI 3BBCA 1YRUA 2H65B 2XMUA 3BGRA 3MUTP 3FBEA 3Q2TC 4Z37A 4DV1J 4G3IA 1BC6A 2F8EX 1DARA 2NPIA 4IOAQ 2NLWA 2ZBRA 5ETTA 4ZVFA 5F8JA 1ZETA 3V81B 2ZJRQ 2FQQB 3BPDA 4C8OA 3C15B 4N76A 2E1AA 3QGPA 2HLTA 2U2FA 4O4GA 2D3ZA 3QPIA 3CDEA 4C8MA 1RA6A 1ZAWA 4FF2A 2PIIA 5KFFA 3DLHA 3O44A 2DGOA 2J7WA 2KB2A 3D67A 8ATCB 2N3OA 1C4CA 3OL6A 1S72S 4M5NA 3KLFA 1ZYQA 3GP9A 1SIWB 2AX0A 2Z56B 2V63A 3DRYA 2PN6A 4IH7A 4KO0B 3I5AA 4USJC 4J9VA 4CT8A 3CCLS 2VJVA 4DQIA 3EZOA 5CH7B 1VS3A 3RBEA 1D8ZA 3CJ0A 4MH8A 2QTWA 3NWRA 2GO9A 5KFZA 3ZZZA 1S97A 4B3RF 1WHXA 4I1TA 5CYQB 1TVRA 1DURA 2QLXA 3G82A 4DL5A 2JJ4D 1N8RT 2YY3A 1RDRA 2RQ4A 3WIVA 2O01C 1XNRF 2BM0A 2LA4A 1E6YA 2WBRA 1QAYA 2ZEJA 2G0IA 3MR7A 3QLHA 4EGLA 3GV7B 2APOA 2B51A 2RHSB 4TLRA 3D66A 4C8KA 5GAEU 2I2YA 2MQMA 2ZKTA 2E5LF 1TL3B 2ZD1A 2B4VA 2H48B 5A0YB 3P45B 3PIPQ 2DCUB 5D77A 2ZUAA 2ZE2B 3OXFA 3BYPA 2RSQA 2EKYA 3AJDA 3DMJB 3CB4A 3NBPB 2L08A 1EKRA 1N6QA 2QFJA 1NUEA 1SL0A 3OPKA 1REGX 2I0XA 2IYGA 3IMQJ 2FJXA 1HNWF 5KFCA 4MYUA 2LQJA 4PCQA 4JV2A 3HT3A 2OLWA 1TAQA 1JKHB 2RRAA 1QVFR 4OYAA 2J8SA 5F8MA 2DPJA 4LF6J 2GVZA 4C98A 2KN4A 2HIYA 3I0RB 4RUBA 5E33A 4M5IA 2Y8WA 3QRQA 3D68A 4DUYJ 2QG9B 4B9UA 1CJUA 2AYGA 2XZTB 3B4MA 3DLJA 5ETMA 1QY7A 1S1WB 5I3UB 3DOLA 1S7HA 5C25B 3D2WA 1HBNB 2OGUA 1XC9A 3TUPA 1HR0F 3KLIA 1HNZF 5GAEI 2EG2A 1NPPA 3VHQA 1M0SA 3CNQP 5EX0A 2V2QA 3CSKA 1KQFB 3ET6A 3PNIA 1FEHA 1MW7A 2FVCA 1PYSB 2PEHA 1Y3JA 2E1PA 1FVQA 5AE2A 2JRSA 2KH9A 1YJ9S 4LREA 3RRGA 2J0XA 3MR6A 3DCAA 5KFOA 1XNQF 3DRPA 2DGSA 1PBAA 5D3GA 1ZM9A 3AY0A 4HH1A 2WAQD 2BJ9A 3ICLA 2GJFA 4F25A 3HVTB 2BOPA 5E41A 1RWPB 3MM6B 3FVYA 1FK9A 2JH3A 4B9TA 3DI6A 1RT7B 1FKPB 2HRUA 3BEGB 4IFYA 4CRJA 4PUOB 1HL6A 4ZPWR 1YJ7A 1CC7A 2AGOA 1JLAA 3RR7A 1RT1A 2EBEA 2NS1B 3U1NA 2R7SA 2BM1A 3D3CJ 1VRUA 5I3QA 1YBTA 4C0OC 5IM0B 4K4YA 2KM8C 5DLGA 2G2YA 3OHAA 1HWUA 3E51A 3GIKA 3TOQA 2P6SA 4I6YA 2ZVIA 1X9MA 2C3UA 3LP1B 2K8GA 2FYXA 1ZAXA 2QJ3A 4NLVA 1F5BA 2WOMB 2J9EA 2BE2B 3HSJA 3C8YA 2EK6A 3T41A 2VG7B 1RWWB 2DGQA 4I69A 2OEJA 4QU6A 3KFWX 1HMVB 3EGWB 2RUGA 2KXNB 4KHPF 2CQDA 3CGIA 2DGTA 1GXLA 2MQLA 3ISNC 4RLEA 3ZNUA 1M90T 1RLDA 3W8GA 5THWA 2XBPA 2FDNA 4B9NA 4OYBA 2RILA 5H9FK 1VQ6S 1S4EA 1I6JA 3IXQA 1O6XA 3FMWA 4F02A 2FZGB 3KUEA 3OR2B 5HK4A 1EETA 9ATCB 2XGPA 3NP5A 5KG7A 2UUWA 1SC6A 2HS3A 5CQGA 1X5TA 3GJSB 1CEZA 5KFPA 4PQUA 4JI4F 2X3DA 1VCTA 2MKSA 1KR4A 3OTEA 1VFJA 2J5AA 4TYBA 1HKAA 2LYVA 1GMVA 5GAGI 3ZZOA 1G1XA 3FC9A 3S6EA 2B0GA 3R27A 4LF2A 2AF6A 1Q81T 2QL9B 2HFZA 3D9BA 4EO6A 1AXQA 5KFJA 5D15A 1WSVA 3CE8A 1U02A 2J0QD 5J2PB 2WZ1A 2DNRA 5LL6d 4WP9A 4MTPA 1R0AA 3T5JA 1GXUA 3QT5A 1Y4ZB 5I42B 2W4CA 3OL7A 3F44A 1SC3B 4DQRA 4QQBA 3BDPA 3EPIA 4ZPTR 2XNRA 3CC7S 1SV5A 4CH1A 3PM9A 4U96A 3M6WA 1RWVB 2WW8A 3QWPA 2DNGA 3R6GB 4URSA 1X60A 5FDLA 4EBCA 4DPUA 2B9EA 2EFOA 1OPIA 2FGOA 3PJ9A 2VFSA 4ZS6A 4O3QA 5ETVA 1BQXA 2JVOA 3LOUA 2BBEA 2RU9A 4OFZA 2VJUA 2XY5A 3UI3A 1S12A 3SQGA 1RTIB 1VGYA 2DH8A 2DH9A 3FJ2A 3MMBA 3KJVA 1FJ7A 1VHIA 1WTFA 4L6V3 4YDXA 4CQ1A 5DGAA 2J9CA 3B78A 3HCXA 4ILRA 1JX4A 4ZVSB 2IMWP 2YWEA 4PPDA 3BSAA 3PRDA 2U1AA 3PCOB 4O4GB 1T11A 2VHGA 3LP0A 3TVKA 3CCZA 5HO4A 2MXYA 4V19J 4RW6A 3VV2B 1UMJA 5LSLA 3RB6A 4GKJJ 4Y3CA 4YR0A 4A46A 2XWYA 5KFAA 2MQPA 3DRSB 3HFZB 4DV2F 4LBIA 4ECWA 2BMBA 1TK5A 2AJ1A 3M9MB 1RHRB 1H72C 2KXHA 3HSZA 2DRBA 1NJWA 2XB2D 1MWZA 2IM2A 2XSJA 3MR5A 2MZ1A 4WP8A 2CQPA 4ZJOA 3SXLA 3LAKA 3H7HB 2AEMA 3CDWA 4ZP9A 2UXBF 2GS8A 3D1HA 2HQCA 2DR5A 1RT4A 1WJ9A 2RE1A 3QLHB 4B3TJ 3FKBA 1XMBA 5J1EA 1SC1B 3OSPA 5C42B 3OL9A 1U8WA 5B0FA 3PZPA 1P27B 3DLEA 1FDAA 5F8GA 2JEGA 2GHWA 4LFCF 5K8OA 2ZD1B 5A0YA 2Z30B 4NXMJ 2E5IA 2HHHJ 2YKMA 2OO4A 3HVAA 2G0JA 5JXSA 3DU5A 4CLFA 4ETXA 1KEKA 2MGZB 3OTOJ 4AL6A 4Y28C 2GGPA 3M2UA 3V6HA 2R8JA 2R3VA 3PYDA 3M8YA 3UE2A 2MTLA 2F63A 2MLZA 4B9SA 1RT5B 4V19X 2GJ2A 2K7KA 1V5VA 3UNGC 3MM8B 5A2QU 1G7CB 2ZUGA 4P7TA 2IM0A 5KFEA 4DR4F 4KYZA 1X4EA 1WHWA 2AHOB 3FUYA 1S79A 2CQ3A 3MEEB 4HDHA 4K59A 2ASJA 3W3SA 1FD8A 3V6DB 3UWTA 4PG8A 1P1LA 2KDOA 3K89A 2ZZTA 3NCPA 4CI0B 3CCES 3OR1B 3DOLB 1AYEA 2NCKL 5AE3A 2E44A 3IC1A 3SSRA 4CNZA 1B7FA 3MXHP 4WJBA 5F8HA 1HBOB 2XMJA 1L3SA 2QIFA 3LPYA 2E1CA 3KHRA 2NZCA 3GYGA 5E2QA 4QYRA 1VK3A 3ITHB 4F4WA 4JI4J 1MMDA 4NLQA 5DG7A 3QGHA 2YPZA 3N9UC 3HVTA 2CDRB 2BKOA 2GMHA 2P5VA 2XSFA 4ZKAA 1Y5IB 2DGXA 2E5HA 4LFAF 1RT7A 2V9KA 3OFHA 4IFYB 4DDFA 4C7QA 1MMNA 1ZTTA 3S8SA 1I5OB 4IG0A 4IRCA 2O67A 5HP1A 3C6TA 9RUBA 4RW8A 1OO0B 2AIRB 2GAGC 4QWCA 3ILLA 3G8SA 2VG5B 1NB7A 2C1EB 2QZ8A 3IBWA 4P2FA 4NMXA 4DFJA 2PA3A 4DR6J 2DISA 3NGSA 4ES1A 3CJ5A 4FXWA 1NSKL 2JL9A 4RR5A 1DTTA 3I32A 2CNNB 3SDEA 2FB0A 2F1FA 2HVZA 5KFLA 3VR1A 3RB0A 4YR2A 2BVZA 2G2OA 1J2VA 1F0XA 1F2HA 2MQNA 2RF2B 4F4KA 1D3WA 3CDBA 1SIZA 3IRXB 3ZTPA 2BW2A 1Q0NA 3D0IE 2OKQA 2A1BA 1UWBB 2ADCA 3CCTA 3MURP 3TP2A 2MHEA 5JUMA 2WVDA 2VQFF 2VPXB 4WKRA 2CZ4A 5HQ8A 1X4CA 3V6JA 1J5EF 3CIZA 2YNIA 2ZOFA 3D6TB 4J37A 1GTHA 4HLBA 4MKAA 1KLNA 1EP4A 3M8RA 3NGTA 4Y65A 2FJEB 4JI8J 3D0GE 2GFFA 1SXLA 2IVYA 1GK8A 2VH7A 2ACYA 4OZ1A 4ZCIA 5K8NA 4CLKA 2V4RA 3DKDA 5IOLA 2Z2MA 5CYMB 2W9CB 4C0HA 5E3AA 4BCAA 7FD1A 4DR3F 1CPZA 2AZ3A 2HG4A 1YQHA 3MPDA 1ZA2B 3P8BB 2ILYA 4KV8B 4UT4A 1C0TA 3QQCD 2CQ2A 1EIYB 2C2RA 4TVAB 3RTVA 4P9SA 4X66F 2F3JA 3KG1A 3UCGA 1JLQB 4JI6J 3BGRB 4UUWA 5U47A 4UF4A 1JNRB 1R0CB 2EFQA 2FJBB 2LFVA 3JQMA 1LOUA 1N5YA 2XMTA 2F7VA 3MTJA 1TAUA 3R5AA 1OYEA 2FIUA 5F41A 4J9MA 5RUBA 4ED8A 2W2OP 2DY1A 3UFCX 2VBWA 5I42A 3POTA 1VQLS 3THTA 4LF7F 2OPSA 3I0SB 1G4CA 2W01A 3HFKA 4HR2A 4DUZJ 3T1YF 2HRTA 3FEZA 3EUNA 3EJMA 1DHMA 3VGSA 3HMJG 1UJ5A 3MOJB 3R9LA 1T03B 4BBYA 1NMEB 2Y0SD 2AX1A 5G0RB 3CCVS 2DD8S 1RTIA 1KONA 5J2MB 4FVCA 4QWEA 3HHLA 4X4QA 1TL5A 3GIRA 4A8YA 3KTQA 1RTJB 1N34F 3NGUA 1X8DA 4F4ZA 4OZLA 1VRQC 2CQHA 3FCWA 4RBTA 1UL3A 4ZIVA 2AYBA 4LMZA 1VMBA 4OI3A 3MM9B 3ZXWA 4OHWA 2H51B 3LP0B 1XBWA 2GW8A 3W5YA 4W92B 4NZ7A 1XNQJ 3CO0P 5IV4A 2NXJA 1JLEB 1G3OA 3GFZA 3HP6A 3S01A 4EYIB 1ZPVA 4UUXA 1Y10A 2UUBJ 4X65J 1FI4A 2V94A 4EZ6A 2GX8A 1O5JA 5GAGU 4NLTA 1TU0B 3NKYA 2HVDA 3G6VA 2XLKA 4PAAA 2ZZNA 4C8NA 2QRRA 1KDNA 1U1NA 2FVPA 5AXLA 4N7TA 1NZ8A 3AB2B 3AFGA 2ZBCA 3IR5B 3WQPA 1DAXA 3KHLA 2AGQA 1XMOJ 3R7BB 5JVGQ 1JMTA 2QMUB 3KLEA 1WI6A 1RAJA 2ZOGA 3FQKA 1V3RA 1Y00A 1R27B 3GZ7A 4NYZA 1U1QA 1KP6A 4G1PA 4Y2KA 4DL7A 4Z7CA 3Q8UA 2E7WA 4NASA 2ZHBA 4QCLA 3HI9A 1AFJA 2GGPB 2YX1A 1IKXB 3M2UB 3BREA 1VIXA 2KHDA 3QT7A 4OIXA 3EVMA 3KLIB 4ENOA 5C2CA 2EFNA 3UVJB 1SL1A 3ZO7A 4AD6A 4WKYA 4Q0BB 2YTCA 3W61A 1S57A 1FRKA 1TL4A 2RT3A 3EVOA 3MCOA 4RUCA 3TA0A 1Y11A 1FJGJ 1VJWA 1CJVB 3AQPA 1MWYA 3U27A 3KK3A 1D1UA 2X51A 3KUHA 3VAKA 4N77A 3IS9A 1NKEA 2E7XA 3ISND 5IV3A 1CJKA 4U7CA 4M95A 4X4NA 3LWLA 1REVB 4RU9A 3MGJA 5CZVA 1VRTB 1ZM3A 2FD2A 3MWBA 1WDTA 1KC8T 1FK9B 3LALA 4NCBA 1T95A 1RABB 1T9TA 3K7RA 3MAAA 1NDPA 3BM7A 3Q8VA 5LM7E 4GKKF 5HVFA 5JVHQ 1RT1B 1D9AA 2PMZD 2ZM6F 2B43A 1VQ7S 2LXIA 2FJDB 4H4KC 4WBFA 3S1TA 2QE5A 4XPCA 1RXOB 1CJTA 2YWKA 4KC5A 4WTOB 1N5TA 1RHJB 4X4PA 1SUQB 3EDRB 4Y2CA 4X4SA 2CZ9A 3J7AN 2EFPA 3DRRA 4I67A 4PWWA 3FRZA 3TUIC 1PO6A 3PX0A 2OJ3A 3GU0A 1LWFA 5G4DA 4CNYA 1U25A 2IPOB 4RO0A 1LV5A 1S77D 1HARA 4DPWA 1AW0A 4PEOA 4ED4A 4YS2A 1RYSA 3CCUS 1FFGB 2MEWA 2R8GA 2GCFA 3DGVA 3TAMA 4F8RA 3TR5A 5A8RB 2IFXA 4XPEA 5E5NA 4QW9A 2KYXA 3T1AA 1UVMA 4LSZB 3I6PA 4FNHA 4YN3B 1XR7A 2D9OA 4QU7A 3M8PB 3N6MA 1KS2A 4PXDA 5L1KA 4QIVA 2W8LA 1UVLA 5DG9A 4DU8A 2R7VA 1C0UA 2BZ2A 2HBQB 2PFFB 4HT7A 4IH6A 5EWGA 5AXMA 2OELA 3UO0A 3NXZA 4MYTA 5GMDA 3P49B 4NZ0A 1U7LA 2HHXA 1RB0A 3C14A 4MIWA 4V1Ak 4TXSA 4JUZA 1F3VA 1X9SA 4GO5X 1IBMF 3OQ2A 3ZC4A 1SI9A 2BOAA 2DNLA 2HKEA 3W9HA 4N41A 1BQNA 1APSA 1NSPA 2RDIA 3T5HA 1D9FA 1SJRA 3EDQB 4WTYA 4LUBA 2MQ8A 4R0JA 4ED7A 5J2PA 1S0OA 3OHBA 4DSIA 2RUSA 4F2SA 4MFBA 5H1SV 5HLFA 2LDIA 2HVEA 5CYMA 1TZ0A 2BJ3A 4GVBA 2DNKA 1DLOB 2JLEA 4KR0B 1WELA 4N5SA 4CLTA 1FRLA 5B0DA 3J7YU 4QWBA 2Y8YA 4DQSA 1UVNA 4TYAA 1S4FA 2ABYA 2DGVA 3JXOA 2EW9A 1DQ9A 4NXMF 2RDDA 2YH0A 4DS5A 1IQZA 3FNNA 3RJMB 4M63A 5C7PA 4LRBA 4ID8A 3CJKA 3IAS9 4ZCKA 3JSRA 1QAXA 1XR5A 5D6GA 1N5YB 5ETPA 2KFNA 3SFUA 4F4XA 2FHOB 2J9DA 3MMAB 4J5OA 5HROA 1S9EA 2R8HA 1HNIB 4R0EA 4F0MA 5J2NB 5AJ3J 1KNZA 4PG6A 5KOWA 4M5KA 1FKAF 4P2MA 2BE7D 1H3DA 1HBMA 1WF0A 2CXEA 2IJNA 4J9OA 3KNGA 1T9VA 1UETA 2CPIA 4FXVA 2YVSA 2FLLA 1T0TV 2VV5A 4Y34A 1LEOA 1KOOA 4LR8A 4Q8EA 1QE1B 2B4OA 3JTPA 5AXNA 4CWBA 4Y2MA 3OXLA 3J81Y 1KBRA 1LXNA 1RU1A 2UUAF 1JWWA 1Q4RA 2V8VA 1U6FA 5K14B 4LF6F 3DLKA 3Q8QB 1KTQA 4MK7A 1EZZB 4B02A 3HXMA 1WC4A 1RTHB 3ZTOA 3F73A 4DUYF 4C8YA 4CLYA 3OFEA 1Q16B 2R7QA 3I4PA 4RW4A 4ZJQA 1ITPA 4TKTA 4WPAA 2XG8A 5AXKA 3GIMA 2DNPA 5IT9Y 5F3ZA 3GFXA 2ZNYA 3CCRS 3DHXA 1JLEA 3MEKA 4ZHRA 4ED1A 1R8CA 3F41A 1HD1A 1BWVA 2R7OA 1T3OA 2YKMB 2C2OB 8AT1B 1ZAVA 4TN2A 1BUXA 4USKA 4DFMA 5B09A 2AT1B 2V68A 3W65A 4CO2A 3BBBA 2MMYA 2XEXA 2UU9F 4OHYA 2Q3PA 4DV4J 1KFDA 2OFGX 4L74A 1RE1B 2EKNA 1Q8BA 2QL7B 4C2MA 4JI3F 5KAKA 1LWEA 4DWIA 3VAIA 2YKNB 5ETSA 3C2PA 2HQDA 2PC6A 1VIOA 2YWGA 4PXBA 3OJSA 4MKYA 1RT3A 3EGZA 3OFGA 4DR7F 2MY8A 3LA0A 1H6KX 4Y6IA 1LW0B 1U8SA 1TFWA 3AD9C 3CJ2A 1PAEX 1KQGB 1Z1ZA 2M0GB 1WHVA 3OTDA 4RJVA 2VBXA 4DG1A 2FTRA 2YQ1A 3CMAS 1IKXA 1CG2A 1U2CA 5L9NA 3OVBA 3CXCR 4ECTA 1KFSA 4AL5A 2D3UA 3GSDA 1RJJA 1IXKA 2V5HG 1S1UB 2HQ3A 1U1LA 4JI1F 1NH8A 4ETZA 4LQ3A 1HBOA 2E1MC 3M30B 3CPWR 4HACA 4KGVB 2F4VJ 2K06A 3CVKA 2PEBA 3GYXB 4DV7F 4KHPJ 2YQ0A 2ZH9A 2XM3A 4DR5J 1REVA 3LQVA 5A8KA 2CADA 2Y3YA 2GVDB 2QN6B 2WSCC 1FKOB 3DOKA 3JQKA 3ETMA 1CQMA 3OBIA 1WUUA 2E29A 4IFVB 5KFGA 2O1PA 4Z2XA 5CAAA 5I4MA 2A18A 2AKWB 4A8OA 1NB2A 2CPZA 3PYFA 4RW9A 4W4MA 3T6JA 1IWAA 4I2PB 2ZJQQ 3IG1B 3D6FB 3ILJA 1NHVA 4DV0F 3C6TB 2OMLA 3GMGA 3ADAC 4Y2IA 1FF2A 2XY7A 3RW6A 1AA1B 1R0BG 5KT2A 1URRA 2NXEA 4NRTA 4RNMA 2W7PA 2B5JB 1JLFB 2DJWA 4P72A 2HNDA 2V69A 3LP2A 4EU0A 4DSJA 1IKVB 2RAQA 4KFBA 1DY3A 2AWZA 3E01A 3K59A 2LQ8A 1DTTB 4DXLA 5DDQC 3QRRA 5IT9U 2ROPA 2V50A 2ATLA 3SFGA 1D8YA 4ZLPA 1RWKB 2X7IA 4M5JA 4ZITA 4Y0FA 2YX7A 2AU0A 1CBKA 4YY3F 3HSGA 3ISZA 4F36A 2VICA 4YR3A 2ILZA 1N5VA 1WOOA 3TAMB 1NJXA 5BYQA 2B6AA 2W8KA 3P96A 2LEPA 3AAWB 2RQCA 2CIMA 1ELOA 3W2WB 2J76E 4LRDA 3KUGA 3H20A 3K58A 2WSFC 4ELVA 1EP4B 1P9YA 2BJEA 5K20B 3HKZD 4CP5A 4MIAA 2RQKA 5CYJA 3D6MB 4ECUA 3W2VA 3D4JA 1K8AT 2R7UA 5CZXA 3HJFA 4OX9F 4O44A 4IRDA 4DR2F 5C2GA 3J7ZT 2N4DA 2E9ZA 1AT1B 3OLAA 1JQGA 4AQYJ 4KV8A 1VYAA 4ATNA 2C2NA 2VZ9A 5IQ6A 3W1YC 4G1QB 2HSEB 2DO4A 4DL0C 2VDHA 1TKTB 1FDDA 4CM2A 2F65A 3SMZA 4ZN3A 3RUBL 4Q45A 5GAHI 5F8NA 1NNDA 4X65F 3GQCA 2CDQA 1RT6A 4LT6A 1SKWA 1GX5A 4RUHA 2XLIA 1A0OB 4M5MA 3GIJA 2ZHOA 2QEXS 1XEZA 4RNFA 4DS4A 3R2DJ 1DLOA 1RTDA 4Q2LA 2POKA 4A8KA 3EWGA 3I0SA 2ALYB 5KFBA 3LANA 1RCOB 1Z4UA 2B3TB 1UEUA 2QA2A 3D7SB 4ZVUB 3HO1A 1FTCA 1Q78A 2D41A 2CPYA 4KQZA 1DQAA 1HI1A 1UFLA 4FP9A 2KT2A 4AXIA 5KFMA 4WU3A 5T41A 1LFPA 2UXBJ 3GFYA 4DV5J 2V8DA 3D6HB 1ZZNA 3PR5B 3TAPA 3NL0A 2YNHA 5K9FA 3HHLB 2J7UA 2NXCA 5J2NA 2CVEA 1B70B 3V81A 4DF8A 1MMLA 1X9WA 3GR0A 3BR8A 3JSBA 2KO1A 3QT6A 3TAQA 3MM9A 3TYTA 3ENWA 3OTOF 3CDAA 3G8TA 3E2EA 2XNQA 4ER8A 1K1QA 1UEVA 2MZRA 2UUCF 1KVJA 3M8QB 1P6TA 5A2QY 2V4JB 3O1LA 4TY9A 2XMKA 2ASDA 3NNCA 3KJFB 1SC4B 3TO8A 1NU4A 2EK1A 4FYDA 4WZQA 4F3QA 4PPZA 1YTYA 3MEGA 5KFSA 1UVIA 2H1YA 2RKIA 1RP5A 3FFIB 3G82B 2MZQA 1JIHA 4NI2A 4A8XA 3M32A 1WORA 2CQBA 4NLPA 3US5A 3SZ2A 4ED2A 3W63A 1TKDA 1FVSA 5ADZA 4XIUA 2UXCF 1TKZB 4NLXA 4OHVA 4USIA 4WU2A 4ZHRB 2J6TA 1RT2A 1T7PA 2DXDA 2M88A 5A6PA 5KFRA 1UJ4A 2H4WB 4K5SA 3NG8A 3BS9A 2BA9A 3G8QA 4NXNF 3J80U 1HNXJ 2WCXA 1OSDA 1JJ4A 5HN0A 4U8YA 3M2RA 3RGIA 4PG7A 2L3MA 1R8HA 1PGZA 5L1IA 2PI4A 4KPYA 3RB3A 3W5XA 2IYIA 1M5VC 2DYAA 3BKUA 3H40A 1CJVA 3RAXA 1JLCA 1R43A 4I6WA 4JP8A 1N36J 3AT1B 3O6QA 3FEYB 3K8WA 4OZ2A 4LFAJ 1PBUA 1S6OA 2LXUA 2JLGA 2F8HA 3DLGA 4A8QA 1S1WA 4LF4F 3TWZA 2JVRA 1PYOB 5HATA 2G0CA 3DLLQ 2PGCA 1J27A 1BD6A 2QA1A 4C11A 2OPPA 1S99A 2BE9B 5L1JA 4L75A 3O8WA 4F04B 4X62J 3T3FA 3G9CA 5L46A 1EX8A 3PYGA 3UR3C 3GJTB 1P1TA 3PO5A 3EXCX 3NS6A 2JFKA 4JI5J 5D3GB 1WKJA 4LF8J 1SQEA 3RBDA 1S9GB 3BKTA 2FVSA 1FWPA 2UVVA 1R89A 4QWAA 5HVHA 5DQGA 5A8KB 3Q2SC 4DL6A 4YQWA 3MTKA 3DRRB 2M3DA 1FXLA 1X4GA 3DI6B 4K7QA 3GFHA 4UW2A 2VQFJ 1T05A 4DQPA 5FD1A 1O51A 2QYCA 3JSMA 2BANA 2QLWA 4QIFA 2UZAA 1RACB 1Y3KA 2ZDOA 2AYEA 4WFZA 1SVDA 2AV5A 2HNZB 3M2VA 3W9JA 3FSXA 2HBRB 2YXLA 4P2SA 4MIBA 1RKIA 1GX6A 2J8AA 2XYHB 2ZITA 4P2XA 1J5OB 1MLAA 3C19A 5B0GA 2HEKA 3M4XA 4LRFA 5A6WA 2HIQA 2CNOB 3V5RA 1C0UB 4YMEA 2ADBA 3HHEA 1EHWA 5KG0A 5AJ3F 2DY9A 1MWQA 1HMVA 1NLKL 2W24A 2HQGA 2CAJA 2A2DA 4IRKA 1IQTA 2RVJA 1IKWA 3D28A 4LIRA 4RZRA 2MKIA 4QYZK 5CD4A 1U1RA 3RAQA 1BQNB 4ZVTB 2YNFA 4K4SA 2KTQA 5DDOC 2VFUA 5DRKA 1IM6A 4ZVPB 4L72B 3GWCA 2HFUA 4WYLA 1I1GA 1EETB 1OSCA 1U09A 1YJVA 2BJ7A 5DDPC 1M5SA 3MM7A 1IVZA 1WF1A 4ZJLA 1HPZA 5EDWA 2E9TA 1YZ6A 4DU7A 2DBBA 3T1YJ 2HGMA 1LW2A 2HZAA 4AXJA 4CYUB 1F9HA 4HKQA 3UDVA 4I2QB 4GVBB 3RU0A 4KB7A 2CPFA 2MB0B
chains in the Genus database with same CATH topology
2ZH2A 1JLGB 3TARA 3AQOA 3PDNA 1U6BA 2V9WA 2KYZA 1NJZA 2X1FA 4NYOA 3GIIA 2G9OA 2OFHX 3CF5Q 4NLGA 2J0WA 1XTZA 3CD0A 3CJKB 2B9XA 3DFEA 3RW7A 4QOTA 4MKYA 1RT6B 3H8YA 3JB9k 1S6PB 2NUHA 3BN7A 3ZZRA 4RW7A 1S9EB 4OJGA 1RTDB 2HS4A 1KQSR 2MQQA 1F60B 2E5GA 2XI2A 1FE0A 1VQSA 1NRKA 1HBMB 3HKWA 3IR6B 1SV5B 4A4JA 1WG4A 1X5SA 2LA6A 3M6VA 1HWJA 2VB6A 3VCDA 3MAQA 1VQ4S 4KO0A 2BABA 1R31A 3LAMA 1VC0A 1C1CA 4NLDA 3H5SA 2R9LA 1XMOF 4ED3A 3C66A 2ZZMA 3MD1A 1WI8A 3JTNA 4NZ6A 4H4OB 4DSKA 1T94A 1TVRB 5DG8A 3QJLA 4QYZJ 1RTHA 1M5KC 1IKYA 1HBUB 4OJ3A 2VONA 4ZDNA 4RW6B 4EO8A 1HI0P 2F4VF 3N28A 2C42A 3M8QA 3E3XA 1GQEA 4BWMA 3IAM9 2KRBA 4EBEA 2ZH3A 2PMHA 4DBQA 2VBZA 3CCWA 4CTAA 2A3JA 3K5LA 1HHTP 2RKIB 3N0VA 2Q1LA 4OZ5A 4FZVA 4URQU 4LFBF 2M7SA 1LK7A 2JHEA 3M32B 3HHNB 1BLUA 2C2DA 2M8DB 4B9LA 4ECRA 1LQ9A 1TL1B 3I9ZA 4MKBA 1RQ0A 4TY8A 2KI2A 2YKPA 1IM4A 2J9DE 2O66A 3GB0A 5F8IA 2AGPA 5GVQA 2XI3A 4QIGA 2KXFA 4XDDA 1NJYA 5HMYA 4CZCA 2NYIA 5F9LA 2ERRA 3MM5B 1VLYA 4K4VA 1FERA 1FESA 1QM9A 4DSFA 2BR0A 1T02A 3MPVA 4YP3A 5MLCV 2W25A 2Y1IA 4RKUC 1SJFA 3G6YA 1U45A 3SSSA 1W2BR 2WB4A 3EPGA 4IKAA 3OR1A 1UJ6A 2OTJS 3RB4A 1H98A 2IVMA 4C0BA 5H9EJ 1FHTA 1OQ3A 4PUOA 3I87A 5SUHA 2CVIA 3NGKA 1BY9A 3UD4P 3VTIA 1N4LA 1W25A 2KZZA 3MDFA 3NCQA 5KFVA 3HM9A 3HDSA 3MMCB 3QZ8A 4QR0A 5DQHA 1R7IA 3OLBA 3FGVA 3LP1A 3FMBA 4OZ0A 1N54B 1X0FA 4O3RA 2VG6B 3O5TB 2E5JA 2NZ4A 4GO7X 4OV1A 4YHHF 1SKSA 4P6QA 4TNOA 3U02A 1YGYA 4DL4A 5HBMA 1Z2ZA 4E8UA 4WFYA 2ADCA 3HHKA 1WWHA 4NCGA 1VQ9S 5AE1A 4KJIA 4L3NA 4B17A 5LXYA 4R5PA 4KKOB 5DO2A 3GV5B 3TANA 1X7VA 4I4BA 2HHVA 2OD6A 1Y5NB 3V4MA 1NKBA 3IWXA 1Q8IA 3J7Z5 1UKUA 1SKRA 1SJ3P 2IRXA 1AFIA 4PQUB 3X3UA 4WF9Q 1N48A 3PW4A 4O44B 4ALZA 4OX7A 3GG1A 2QO3A 2XMMA 2FJAB 3R1HA 3DN9A 4LSLB 4ID5A 4DX8H 1H38A 4G1QA 2VFTA 3CCJS 2OPRA 4LJMA 2VA3A 4WK1A 3EYZA 1A7GE 4WFAQ 5SZTA 1OWXA 1IBLF 2PD1A 2LMIA 1LW2B 4KHMA 1VQ5S 3T6BA 4C3MA 3Q24A 1R8BA 2L9WA 1YJNS 1UP1A 1PSDA 2Q79A 2I5JA 2CPJA 2HS0A 4NLYA 3BSCA 2B4UA 1HFEL 4F26A 1JLGA 4CO1A 3DXBA 2RIJA 2R2UA 2ZH6A 5LSRA 4FN5A 2G1DA 4IO1A 3MEDB 1JLQA 3VAMA 4LVOP 2NPFA 3H98A 1FO1A 4OZNA 2RDJA 2VUGA 3MF5A 4PR6A 4KSEB 1S0NA 2YNHB 4M94A 1TK8A 5DM6Q 3S7RA 5KFDA 2XLJA 3NGDA 3L7PA 2PT0A 1NZAA 1DBDA 3GV8B 1YG0A 1FE4A 4LQ9A 3GILA 2W9BB 2R7WA 4DSEA 1S1VB 1QAIA 4DV4F 2V4JA 3DRSA 2D7SA 3QAUA 3PKYA 2HVIA 3PIOQ 1U6ZA 3FSIA 4ZA1A 1VQKS 3UDCA 4D3HA 2VA2A 1K0VA 1NH7A 2XSJB 4H4OA 4URGA 4ELUA 1NHUA 2YH1A 1LXJA 1VI7A 4JV1A 3UCZP 3ZZPA 4X62F 5FJ4A 1RT4B 1HBUA 1OIAA 1Y7PA 5J1EB 1U24A 1S10A 3DM2A 3ZZYA 3Q8PB 4JI5F 4DFKA 3DNCA 3NWGA 3PEHA 1WNEA 5B7WA 3SI8A 4ZPCA 2C3YA 2IRUA 1FJEB 4FS1A 4RWWA 1OPZA 3NNHA 2V2KA 3FSYA 4F50A 4DN0A 1MNEA 2KRRA 3MCSA 4FPRA 1U26A 2MJNA 3NS5A 2XCAA 4I56A 1S76D 1HWKA 2WBMA 4I64A 1FXRA 3MM8A 4UQTA 3T19A 4A47A 4TU8A 4JI1F 2AJ4A 5H9FJ 1L3VA 4NLOA 3KK2A 3EX7B 1CVJA 3KLEB 1JLCB 2WK4A 4TY8B 4DR6F 3DLGB 3Q0AA 2NR0A 1C1BB 2JLFA 3B4DA 4FNIA 4J9LA 2GQQA 2DR8A 2XWXA 4TQSA 1X4HA 1TKXB 2EG1A 4DMZA 1B0VA 5KFYA 4X4VA 2DH7A 2AW0A 2WONB 3GE9A 1K73T 4OX8A 5KG5A 4ED6A 2KZMA 3D1OA 5BJRA 1F2GA 3D1QA 3I5BA 2VD3A 3F56A 3H5UA 4J9KA 2A10A 2OIHA 3CUNA 1QSSA 1F5AA 1UFWA 1X4FA 5KG3A 1T05B 3WZ0A 4ES2A 3KMSA 5BYSA 3PV8A 1JLBB 2HMIB 3GYNA 4DN9A 1N5SA 3IRWP 1RKJA 2NREA 4C9DA 1NK9A 4NLWA 3DRXA 4JI6F 1DTQA 2JWNA 3BDEA 2YX4A 3QGIA 2YKQA 1S0VA 4QIEA 4AQYF 1NKCA 2FHJD 3N5FA 2IJFA 5E3QA 4FBUA 2XC9A 3G6ES 4HH0A 3LW5C 1VHFA 2MHNA 3OSPA 5EGYA 1VQMS 3OW2R 2AD9A 4X84A 4AUKA 4QR2A 1UWBA 5IS2A 3VAGA 2MKJA 2JSXA 3ENVA 5A8RA 1A9NB 3G96A 5HMXA 3RAMA 2YNFB 1FRHA 4KKOA 1YVFA 2CJAA 2IRYA 4WE1A 4ECVA 1HQUB 3K2YA 2DHXA 4PXCA 2FY1A 1HPZB 1ROFA 1ZM2A 2N82B 4KRWA 4HYKA 1KVIA 1AUDA 1BQMB 2ZFHA 2CG4A 4NLSA 2OPQB 1VOMA 2YNGB 4N56A 2R2RA 3V4IB 2CQ0A 1U2FA 1V9OA 4OHZA 3BSOA 1N56A 4CT9A 4DV5F 2B9YA 2O3DA 2OSRA 5C24A 3MOZA 2B4PA 1JXEA 4ZOSA 4QR1A 5L38A 3H5YA 1VC6A 3E8OA 1KD1T 4KAIA 3IN5A 2RB7A 3PW5A 1WG5A 4IDKA 3QO9B 5J2QA 2FVQA 1QJHA 3SCLE 2L48A 4BC9A 2XS5A 2AJQA 2KFYA 1HW9A 2R2SA 2OPSB 1WD6A 1FT8A 4OQJA 4YUDA 1YJWS 2DNZA 3KYLA 2RS8A 2GNKA 4PWDB 2DNHA 4IQXA 2B7BB 4OZJA 1FNXH 2N4CA 1HNVB 2UVRA 3PRBA 4OX6A 3CC2S 2ZH8A 4FBTA 2M8HA 5HROB 2F40A 2KJWA 2J6UA 4NL5A 1HNIA 1VQYA 3D0HE 2YWHA 2ZH1A 4NPOA 1RTJA 5LXRA 4ECSA 2EC0A 2M52A 2K2PA 5IWAF 2XZWA 4YB6A 1IKYB 4WK3A 3K0JA 2HHHF 4JV5F 3TQ1A 1IJFB 3Q22A 2JDJA 2EPIA 5LT5A 1KQKA 1VQPS 1WF2A 2CPHA 4I0WA 3QIPA 5F0WA 4XAKA 1QAJA 2XS2A 4IR1A 3JYTA 5K14A 3THPA 4CO4A 2DK2A 4NA3A 2P9CA 5DJBA 4DSLA 2Z0GA 4EBDA 4RW4B 2KKHA 5KG1A 3MPWA 1ZOTA 2AJFE 3Q23A 1DJ0A 1TL1A 1N32F 2HHPA 1FNOA 2CPDA 1XMQF 3BB5A 2LKZA 5KT7A 2C22A 3C46A 3PY8A 1LKZA 4Y2AA 1M5OC 2M2BA 4KTQA 2DNOA 2F9JA 3PX4A 4LF8F 1PC5A