4WKRA

Larp7 wrapping up the 3' hairpin of 7sk non-coding rna (302-332)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
b'SRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords La-related protein 7
molecule tags Rna binding protein
source organism Homo sapiens
publication title Structural insight into the mechanism of stabilization of the 7SK small nuclear RNA by LARP7.
pubmed doi rcsb
total genus 40
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wkrA02
2HGNA 3R1LA 4W92B 2N3OA 5LJ5Y 2MKHA 1WHVA 3H2VE 3BO4A 1M5VC 2DHGA 2ZJPQ 3TYTA 4RU2A 3CC4S 3PIOQ 2RRAA 2J0QD 2OIHA 1G2EA 2E5JA 1SJ3P 4TU9A 1VQOS 1U1KA 4WFNQ 4QQBA 2XS7A 2M2BA 2E5HA 1UP1A 1HD1A 2MZTA 3SXLA 1WG5A 1H6KX 4WKRA 2KHCA 4A8XA 1U1LA 2M4MA 5IQQA 1K9MT 1X4EA 2HVZA 2CQ1A 2MQLA 3P6YC 2CPYA 5GADU 2CQ0A 1NJIT 1QVGR 3UCGA 4FXWA 4Y0FA 2OJ3A 1PGZA 3TP2A 3CTRA 1IQTA 3VAJA 1U6FA 2N7CA 4OZ0A 3G9CA 1FT8A 5DDPC 3HHNB 1DRZA 3MDFA 4PKDB 2ERRA 5DETA 2LKZA 2RRBA 1VQ4S 1DBDA 2DGQA 2X1GA 1WF2A 3MUVP 2KG1A 1QM9A 2L08A 3MURP 4F26A 3THPA 2L41A 2RT3A 3CXCR 3UCZP 1VC5A 1JJ4A 2X1AA 3VAIA 2B0GA 2M70A 1X5OA 3P3DA 2J0SD 2RQ4A 2MQNA 1WEZA 2MQMA 3UD3P 4IO9Q 3MOJB 2VODA 2DGVA 5CXTA 1VQPS 2CQCA 3VAHA 1X4FA 4UQTA 2DIVA 1M5KC 1S79A 2MZRA 1SJQA 2LCWA 1JMTA 4FXVA 2MKKA 2JVOA 3VAGA 3FEXB 3S6EA 1OO0B 2M52A 4C7QA 1PO6A 1VQ9S 2LYVA 4YUDA 3CC7S 2OSQA 1NO8A 2FHOB 1SJFA 1AUDA 2M9KA 5D78A 3CCLS 2DHAA 2FC8A 1U1PA 1CVJA 2FC9A 2N3LA 3HI9A 4TU7A 2CPDA 2NZ4A 3U1LA 2DISA 1VQKS 5IM0B 5GAEU 2JVRA 3CCRS 2KFYA 3B4MA 3VAFA 2EK6A 3P5TL 1M5PC 3U1MA 3IWNC 3S01A 4WFBQ 3NNHA 3G6ES 2DGTA 4WIIA 2VOOA 2ZJRQ 1N8RT 3CUNA 2D9OA 3CCJS 1Q86T 1X4GA 1K8AT 3FEYB 1UAWA 4EGLA 5DDQC 2AYEA 1A7GE 2KT5A 2DGXA 5LSOA 2LA6A 5FJ4A 2DGSA 4Y00A 1UFWA 1WG4A 2RUGA 2CPJA 2I38A 2MKCA 2MQQA 2CJKA 5ITHA 4Z2XA 2KXFA 2J8AA 3Q2SC 3R1HA 3P49B 1DHMA 2G0CA 2MPUA 3MXHP 4PR6A 4F02A 4P6QA 2DO4A 2MSTA 1S72S 1R8HA 2D3OR 1VBZA 2MY7A 2DNHA 4TLQA 4CQ1A 1WI6A 2YKAA 1B7FA 2RS8A 3THTA 2J76E 5DM6Q 2YTCA 3G8TA 5LXYA 3CD6S 5HO4A 3CCES 2EVZA 1HL6A 2CQGA 3J7ZT 3NNCA 2RNEA 2DGOA 2M8HA 4J5OA 2ADCA 4C0OC 2VONA 4C4WA 1WF0A 1X0FA 5DDRC 3CCQS 5D77A 3BO3A 2KM8C 1FJEB 3L3CA 2MQPA 1VQNS 1UW4A 4YB1P 3MD3A 3I55S 1P1TA 3B4DA 5H1SV 4QPTA 5IM0A 1OWXA 1SJ4P 3ZZZA 2CQBA 1X4DA 2KG0A 2MGZA 1F9FA 2MZSA 2JX2A 5HL7Q 1WHXA 2CQ4A 2LEAA 2CQIA 2CQ2A 1FO1A 2KH9A 4YOEA 2OTLS 2RU3A 1URNA 1U1MA 2KXHA 2MMYA 1XN9A 1DZ5A 1KC8T 2ZJQQ 4WF9Q 2WBRA 4ED5A 1M1KT 1U1QA 3CCSS 1Q81T 3MD1A 3US5A 2M0GB 2DH9A 1KOHA 5CYJA 5CA5A 3ZZYA 1D8ZA 1H2VZ 3BEGB 2MKIA 1Q7YT 1ZZNA 3MUTP 5GAGU 2VOPA 1WTBA 1P27B 1X4AA 1X4BA 2DO0A 3CCMS 1D9AA 4OZ1A 4ZKAA 1BY9A 1VQLS 2CQPA 1X5TA 1K73T 1VQ5S 3NMRA 3EX7B 2CPEA 1YIJS 4TU8A 2BOPA 2RS2A 2UP1A 1JJHA 3CULA 2DH7A 2F3JA 2QFJA 2QA4S 3VAKA 2LEBA 1N52B 2MSSA 2FY1A 3S8SA 4IOAQ 2KRRA 1FHTA 3R27A 4BS2A 4F25A 2DITA 1VC0A 2MJNA 1N88A 2LA4A 3BO2A 5LSLA 3VAMA 2E5GA 2MY8A 2RVJA 2MZQA 3CF5Q 2CQHA 2DGUA 2MKSA 3CC2S 3CCVS 3SMZA 2XSFA 1QVFR 2MQOA 2LMIA 1VBXA 3K0JA 2G4BA 2LXUA 2U2FA 2DNMA 2I2YA 3RW7A 3IRWP 1OIAA 2CQ3A 2DNZA 1WI8A 3NS6A 5GAHU 4CH1A 3G4SS 2F9JA 2AD9A 4W90B 2MJUA 3V4MA 2GHPA 2KI2A 1WWHA 3UE2A 3UCUP 2G1DA 2XB2D 2K3KA 1FNXH 3LPYA 4CH0S 4PRFA 2M8DB 3JB9k 5EN1A 3H2UB 2DNGA 5LJ3Y 2CPXA 5DM7Q 4M5DB 4U67Q 1W2BR 2GO9A 2X1BA 1U6BA 1WF1A 2XNQA 2YH0A 2HGMA 2DNNA 2MZJA 3VF0B 1YTYA 1WG1A 2ADBA 2PEHA 1FJCA 2BZ2A 2NLWA 2LECA 3G71S 2KVIA 2EK1A 2PE8A 2AYGA 3MI7X 2D9PA 2MYFA 2OTJS 2DB1A 4V19X 2CPIA 3SDEB 2AYMA 3G8SA 1VQ7S 2F9DA 4IOCQ 2XNRA 3J7YU 2YH1A 2HZCA 5DDOC 1YHQS 2DH8A 1KQSR 2N82B 1VQ8S 1HD0A 3EGZA 3TO8A 1U1NA 1KOOA 2O3DA 3PIPQ 3D2WA 1O0PA 3EGNA 4IUFA 3RW6A 2U1AA 2XS5A 3CMES 5BJRA 2KM8B 1YI2S 1WEXA 4LIRA 3G96A 3I56S 5GVQA 2RQCA 3MUMP 3OW2R 2DNPA 2X1FA 4QU6A 2KU7A 1WHYA 5GMKa 3VALA 2KRBA 2MHNA 1U1OA 1YITS 1ZH5A 3UWTA 5MLCV 1VBYA 2DNQA 2MGZB 2CPHA 1YJWS 1FJ7A 2CQDA 5IFMA 1KD1T 3DXBA 3DLLQ 2YWKA 2JWNA 2DHSA 3N9UC 4QU7A 4UY8T 1RKJA 2V94A 3NNAA 4LJMA 1JJ2R 3NS5A 1FXLA 1Q82T 1RK8A 2OSRA 1VQ6S 2DNOA 1ZZFA 1HA1A 1SXLA 5LXRA 4ERDA 4WFAQ 2MKJA 2E44A 4CIOA 5JVGQ 1SJRA 2HYIB 2DK2A 1YWXA 2LXIA 3CCUS 2Q79A 2CPFA 2CPZA 3ULHA 1M5OC 1WEYA 1N54B 1WHWA 1H2UX 2M7SA 5JVHQ 2DNLA 1OPIA 2DNRA 1X4HA 3S7RA 2DIUA 1VC6A 1VQMS 2A3JA 3Q2TC 1X5PA 2DNYA 2QEXS 1YJ9S 3CMAS 1X4CA 1YJNS 2K8GA 1R8PA 2FPHX 2XS2A 2DGWA 2E5IA 1U2FA 2HGLA 4WCEQ 2MXYA 3CPWR 3LQVA 3SDEA 1H2TZ 3UD4P 2KYXA 1L3KA 1A9NB 1X5SA 1M90T 2KN4A 2KXNB 1WELA 2SXLA 2MZ1A 2JRSA 2L9WA 2M88A 2AYBA 1U1RA 1NU4A 2LQ5A 2MB0B 2DNKA 4LMZA 3BS9A 2DHXA
chains in the Genus database with same CATH superfamily
2HGNA 2B5JA 2E1RA 2ZWOA 2MKHA 4A47A 2XO7A 4LR8A 3BZQA 3KHGA 4DL7A 4OI4A 3W9IA 1Q8LA 4ZLLA 1TTHB 3QT6A 3BO4A 2DCLA 4RU9A 1NK5A 1T9TA 1JLAA 1NHKL 1JK9B 2DHGA 2PEBA 2B3TB 2I6WA 3QT5A 4WXOA 3TYTA 3QRPA 4EU0A 4WYWA 1IWGA 4Y2AA 5D4NA 4J7CA 1TR0A 2OIHA 3EXYA 1BQXA 4TU9A 5A6PA 3HFZB 1QAIA 2FVQA 3UVJA 1R6VA 2VG6A 4PWWA 2Y0BB 1YBUA 3DOLA 2VA3A 2OPQA 1U1KA 5A0YB 4WFNQ 5J2NA 4JI7J 2XS7A 1RADB 3FQLA 2E5HA 3MEDA 4KGXB 2QIFA 1UP1A 1HD1A 3C6TB 2QL5B 2YVSA 1WOPA 1TKXA 3N4WA 2I5JB 5I3PA 3F73A 2Z56B 4ECWA 3OR1A 5C5JA 1SUQB 4IQMA 1XJWB 4NLWA 2ZVSA 3WBZA 3NS7B 4NLRA 2HHQA 2A10A 2L3MA 2M4MA 1K9MT 3GIMA 4LQ3A 2CZ4A 3PFEA 2BBEA 2FHJD 3PHEA 4ECYA 1VFJA 3N6NA 4WWSA 3D1QA 1AZSA 2GJIA 2EFPA 1QVGR 2V34A 4JV0A 1NCLA 3AQPA 9RUBA 5LL6d 5HROA 1JJCB 2L9NA 2XWYA 4R0JA 2FLNA 2VIHA 3DKDA 4M5GA 1VJQA 3TP2A 3EM1A 3I9ZA 4CLLA 3TZXA 3POTB 4QWCA 1TKDA 2R7XA 1LOUA 2N7CA 5E5NA 4PABA 1NJWA 1FT8A 3TJ8A 5JJBA 1C0UA 2VL1A 3SCIE 1FJGF 4DLEA 3AXKA 3WDOA 3DOLB 1Z2ZA 3GCWP 3MWBA 1NDCA 5DETA 4X4PA 1LWXA 3IR6B 1HYSB 1RISA 2QRRA 4NA1A 1ZS6A 2MKYA 3WX4A 1X9WA 3EVOA 3FFIA 3MUVP 2GCFA 4I7FA 2AV5A 4PWUA 2L08A 3MURP 2IA6A 2K1RB 1S99A 4QR2A 3CXCR 4P2SA 4DFJA 4ZCLA 3PYFA 4JBCA 4OYWA 3OVSA 1TUWA 2YNFB 3Q8VA 4DL5A 2B6AA 4C11B 2V9WA 1X60A 1NPPA 3QIPA 2A0FB 4DQQA 3E51A 4F50A 1WEZA 5D3GB 3SV3A 2E5LJ 2UXCJ 4ANEA 3JYTA 1T05B 3Q83A 4DSIA 2J7WA 1S0MA 2DGVA 2EC0A 3CJTA 2FHJA 2C2NA 1G6BA 4B3OA 2ZHBA 3A8IA 1FX2A 4PUOB 2OEKA 1M5KC 1YRUA 2OFGX 3M8QB 1YZ6A 3DDKA 3FK4A 1JMTA 4CLUA 1OSCA 3S6EA 5AE2A 5B7WA 1FD8A 1WC1A 1W2IA 3VGSA 3J7A1 1LFWA 1Y0HA 5A76A 2QGFB 4DR7J 3TAMA 3AH6A 1Q0NA 2V63A 4MT1A 1K47A 1EB0A 2KJWA 2Q6CA 3BBCA 4P10A 5JXSA 4X4RA 1NO8A 2FHOB 5HP1B 4P7VA 3GYNA 4CM0A 1AUDA 4P2MA 2XYGB 2IDEA 3R5BA 4X84A 5DZ6A 4YDDB 4I67A 2IA0A 2DHAA 3CCLS 4DV5J 3QQCD 1RJJA 4ZPDA 2H1YA 2WONA 1FFSB 2OELA 2R3VA 3OQ2A 2UXBF 2C42A 4DS5A 4YY3F 3PO4A 2LEPA 3MHYA 4KPCA 3DI6B 4DZDA 5DG8A 3MR3A 2N3LA 2AEMA 2EFVA 1J5OB 2CPDA 3TZWA 4AYBD 1IBLJ 3U1LA 1TKTB 3ZNJ1 1S1VB 2NZ4A 1U6ZA 2BE2B 3DNCA 1VS3A 2ATCB 4CH7A 1FESA 4RNMA 4MFBA 1MW7A 2HHPA 4WK3A 2HK2A 3IWNC 5AXKA 3S01A 2RKIB 1EETA 4ZVUB 1RKIA 5C2CA 2AZ3A 2ROGA 1VK8A 4C0HA 1NSKL 1FEEA 5D4OA 4ZP7A 3DLGB 5ETLA 5A8RA 3HJVA 4EFAC 4V19J 2GVZB 1RWWB 4Y65A 2JLEA 4CLZA 1UL3A 3CCJS 3BBBA 2ZEJA 3OTBA 2WOMA 2AZ1A 1UAWA 2G0IA 2FVCA 3D54A 1NUEA 4GO5X 4XTTA 4F0HA 2RF2B 4C2MA 3BDPA 3BR9A 2YQ3A 3HHKA 2JLGA 2AYEA 3W60A 2QT7A 3Q86A 4HYKA 3PW2A 4XDCA 2DGXA 5LSOA 1UETA 1VRTA 4OHYA 4KKOB 1KQFB 2Y1RI 2V68A 3E01B 5DO2A 2FVSA 4PPDA 6FD1A 4M5JA 4IR9A 5GAHI 5ETRA 1S9EA 3EPGA 2I38A 3MPWA 4NLQA 3DGVA 4LF5J 3LANA 4EZ6A 3RU0A 1QDUB 5ITHA 5DGAA 4Z2XA 1B64A 2XZWA 3NCRA 4U9RA 1Q4RA 3QJLA 3R1HA 3HKWA 3I4PA 1GXTA 3RRHA 3H7HB 1IBLF 1WNEA 3EVMA 2HFZA 2C2EA 4J9QA 2MSTA 3DLJA 3M8ZA 4ZPAA 3V4IB 4JI8J 1PYOB 3RBDA 1UFKA 1NKBA 2XI3A 2AT1B 2DNHA 3AD8C 3D7SB 3BJYA 4JYAF 4NCGB 3V2UC 1DTTB 1BQNA 1M5HA 3FKBA 3HXMA 2ZH4A 2BQUA 4WU3A 4LFAJ 1CULA 4RPFA 3OUYB 3KHHA 1GMUA 2VJUA 1JQGA 1XQIA 1N5YB 2FJXA 3D0IE 4EO6A 1C0TA 1RAEB 1HI1A 4RW6B 3R7SB 3CD6S 1I3OB 4LF1A 2VH7A 4P2XA 3HT0A 4PXCA 3CCES 3RTVA 2D69A 2PA3A 2VPZB 4OHVA 4O4RA 3ZZRA 4CNYA 5J2QB 5F3ZA 2W25A 1GX5A 2RILA 2JL9A 3KDNA 2RNEA 4Y34A 2YKMB 3J7ZT 5RUBA 3PW0A 1SQGA 2M8HA 4EZ9A 4NZ6A 3RAQA 4OYPA 1FK9A 3OJSA 1O51A 3D3CJ 5KFZA 2IJNA 4PYDA 4F3OA 3ZXWA 5KFRA 2BJDA 3NEKA 5A6WA 4ICLB 4CO4A 1MMDA 3R7NB 3L3CA 1UW4A 3N28A 4BWMA 1VQNS 4YB1P 2Z2ZA 3J81j 4I2QA 4NYPA 3HMJG 3I55S 1P1TA 3C16B 4B9VA 5H1SV 4G1QB 2CVIA 9ATCB 4JI0J 1B4SA 1OWXA 3WC0A 4CTAA 2BUNA 2ZUGA 1X4DA 1T11A 2V2KA 1UTAA 1CPZA 2YNGB 3W3SA 2KG0A 4DV3J 1S1TB 3VQSA 2ZH3A 3JQMA 3I5BA 4Q44A 4K50A 2HIQA 1U25A 3C3LA 1P9YA 3J80U 2CQ4A 2F7VA 2VC0A 3D9BA 4IDKA 3N0VA 3C14B 2ZHOA 1IKVA 4O4GB 6FDRA 2KTQA 1XN9A 2QJ3A 5HROB 1RABB 3UDLA 2ALZA 1U0HA 3OPKA 3TAPA 2VPXB 4ED0A 4WU2A 5LMNF 1U45A 1QE1B 1IR0A 4YN3B 4NWBA 3R3TA 3DM2A 2WBRA 4RW9A 4FPIA 4OYZA 2I0XA 2DY1A 1BQMA 1YZ7A 3GJSB 4K59A 2W9BA 4ED5A 1U1QA 4NLXA 4OJGA 2HRUA 5KFXA 3UN5A 1Q81T 4IH7A 1P6TA 3CDEA 3US5A 4ED6A 2M0GB 2DH9A 2V6AA 2AIRB 4J9RA 1FVSA 3CE8A 1G1XA 2OPRA 4ZP6A 2BX6A 4OX8A 1RAAB 1D8ZA 1H2VZ 3BEGB 4HI1A 2B9YA 3VGUA 2MKIA 3HM9A 1SL1A 3MUTP 3T5KA 3BSOA 3D28A 1WTBA 3RR8A 1P27B 1VDHA 2PSZA 2ASLA 4JI3J 1LW2A 3MTJA 1HPZA 4ECZA 1HYSA 1D9AA 1DAXA 1ZTTA 4DQRA 4IFYB 3KG0A 4RWWA 2WBMA 5M2PA 3T1YJ 3C2PA 2OGUA 2XY5A 1UA0A 3QRQA 1UZDA 3OL6A 4ZLPA 1UW9A 3H0PA 4RW7B 2BOPA 3SCKE 4QW8A 3H5YA 2CFXA 3KXDA 3JAMY 3DOKA 4UUXA 3AJ2A 4ECRA 3QPIA 3TNVA 2QA4S 4DV0J 1NK8A 1RT4B 4TN2A 1N52B 4MKBA 4OQJA 4JI2F 4CNZA 3PW5A 3A12A 4GC6A 1RTDA 1ZAVA 2DITA 2MJNA 3JTPA 2BM1A 3K5OA 3W2VA 3NOGA 3BO2A 4TQRA 3UNYA 1F2GA 2E5GA 3QGIA 4FF3A 2CZVC 2C2DA 2DCUB 2OEMA 3H25A 3O5TB 3U02A 2G0JA 1XMBA 3CF5Q 3HHLC 4DV7F 3CSKA 5KFKA 2HNZA 2VASA 3PYDA 3R8YA 4USKA 5A8KB 2DRBA 4OI0A 2LMIA 1NKCA 2QLWA 4ID5A 2F63A 5BYRA 4U7UK 4DFMA 3CDBA 2ZD1A 3BGOP 3GIKA 1QSSA 3M8SA 5AE1A 1VJWA 4HH1A 3OTEA 3EWGA 4KR0B 1AB8A 1ZM3A 3E2EA 2DNMA 3IGVA 1IJEB 1FXRA 3MPUB 3C66A 4MJKA 2CQ3A 3NS6A 3RW7A 3UDEA 4DN0A 4W4MA 4I7FB 3TZZA 3I96A 5HSPA 4J90A 1B70B 2OPQB 2P5VA 2VKRA 2KI2A 2BOAA 5KG7A 5F41A 2JFKA 1XNQF 1N36J 3W9HA 3W61A 4HLBA 1RGVA 2PT0A 4IH5A 4DLGA 3OT9A 5I3UB 2HIYA 4KHMA 2IRUA 3LPYA 3W5YA 4CH0S 4K4XA 2M8DB 2LLZA 2DD8S 2HPUA 3HSZA 3W7BA 5EWGA 5HAOA 5EN1A 2GGPB 2OLWA 2RIJA 1PBAA 4YB5A 5KFMA 5LJ3Y 4M5DB 4M5HA 2N4DA 4OZ2A 2GO9A 3H42A 3TRGA 2KT2A 4F3QA 4XO0A 2PFDA 3EZUA 3LP2B 2YH0A 1NK9A 2DNNA 3IAM9 2MZJA 2XSJB 4MK8A 1DURA 3DGPB 1VRQC 3VF0B 5CAAA 1TL3B 4KV8B 5IT9Y 1CJKB 4X65F 2V4JB 4Q8FA 2PFFB 4DR1J 4ETZA 2BVZA 2YY3A 2DKOB 3NBPA 3G71S 4HHJA 1R89A 1WC3A 4IG0A 4M94A 4Q8EA 1BQNB 5IT0A 4N56A 1S49A 2D9PA 2NPFA 1E6VB 2MYFA 2POKA 2VZ9A 2VKZG 4DR2F 2E7WA 4USWA 5HJXA 5GAEI 2KFNA 1VQ7S 2AYMA 5K14A 2F9DA 4ZVGA 5A0YA 1KLMA 2VFVA 4IOCQ 4FNIA 4KT0C 2HAFA 4DJBA 2YH1A 1U47A 2EWHA 3ZZUA 4ED1A 3BS9A 1ITPA 2G13A 1VQ8S 5C25A 1HD0A 1S1TA 3M4XA 3RRKA 1QD1A 3FC9A 4QIEA 4NCBA 1OS5A 2QL9B 5E41A 4RL1A 4K0KF 4CLWA 4TKTA 1KVKA 3X3UA 2OO4A 4Q2LA 2CNNB 1S4FA 4WTYA 3UQSA 3MAHA 1FKOB 4F0KA 1FWLA 1MWYA 1RTIB 2HBYB 2XULA 3MM7B 5HMXA 1S4EA 3RW6A 2U1AA 1JKHB 2XS5A 2B7BB 4DR1F 4A4JA 2XGQA 3Q23A 4NA3A 4NXMF 2KM8B 2GVDA 2BJ7A 2HFVA 1WEXA 4CI0B 5DGBA 4FF4A 4OI3A 1NRKA 5AE3A 2DPJA 1FTRA 2HNDA 3JAMU 2DVIA 1UEKA 4LIRA 1EARA 3DCAA 3G96A 3KLHA 4MFBB 1IBKJ 2WCXA 5FLXU 3C46A 2IVYA 2YX7A 3ETOA 5J1NA 2DNPA 1KVIA 4NX9A 2E5LF 2KJVA 3TX8A 3KK3A 4QU6A 1EKRA 3V4IA 2V67A 1HR0J 1D1UA 1SPBP 2KRBA 2Z30B 3JSBA 1ZH5A 3SIPB 3UWTA 5MLCV 1S7HA 3DRXA 3MEGA 5G4DA 4B02A 4DBQA 1VBYA 2YPYA 3M30A 1JX4A 4K4VA 2MGZB 5KT4A 1QAXA 2CQDA 3K17A 4WFYA 1BWVA 3SQGB 3V6JA 1B0TA 4EK2A 5HBMB 5IZHA 5BYSA 4FYVB 1YSJA 2YWKA 4HT7A 1KD1T 2IC3B 2K3IA 2BV3A 4NXNF 2VBYA 2QYCA 3N9UC 4DPYA 2K06A 2F4VF 3BB5A 2FTRA 2RDDA 1HNIB 1H7WA 2V9KA 3QGHA 4RNOA 4HTJA 1RWMB 1JJ2R 2RU9A 4G1PA 3H2LA 4O3NA 4OX9F 3PJWA 2OH2A 1Q82T 1RK8A 2WK4A 4CO5A 1MU2B 5L38A 4RWXA 2UUAF 4P71A 1HA1A 3HZEA 1SXLA 4CM2A 2RMLA 1JJ4A 3DLEA 2HQCA 2F65A 5HANA 3VTIA 4ERDA 2MKJA 2AP6A 1NAQA 3MM8B 1N33J 2FZKB 2W1BA 5KFVA 5JVGQ 4C3MA 1JIHA 4L75A 1YWXA 3OTOJ 2Q79A 4GVBB 1TV6B 2PC6A 4USMA 1RAIB 1IJFB 2CPFA 1BC6A 4X62J 4URQU 3ULHA 2DRDA 5HJYA 1DLOB 1TMMA 1DJ0A 2HFOA 1C0TB 2Z8QA 3ILIA 4Y3CA 2Z4PA 4ZN3A 4WE1A 3K8VA 1OPIA 1SH0A 4I6WA 2DNRA 1CEZA 2DIUA 2J6UA 2W2PP 3DRYA 3ZTQA 4CLSA 5CHCB 1FDAA 2JH3A 2IC3A 2WONB 2GFFA 4F67A 4TYBA 7FD1A 4EYIB 1H38A 1LW0B 1X4CA 4DV2F 1J5OA 3QYYA 3SQGA 3FCWA 1ZYQA 2H54B 1RZMA 2FLPA 5IT9U 1LEOA 5F3TA 2YKNB 1A0OB 3H59A 5T14A 4B9TA 2CDRB 5L8RC 3PX0A 4WTOB 2OPPA 1Z2LA 1SVDA 4NLPA 1B0PA 1MMNA 1C4CA 3MM9A 3V6DA 3PRDA 2VBWA 4HKQA 5ETOA 3SDEA 5CYQA 1YJTA 4KB7A 3TUPA 2FHMA 2MTLA 2ROPA 5E3QA 1Q5YA 1RT2B 1X5SA 3ZTOA 5B0DA 4KKOA 3OTDA 1HLWA 4OHWA 4ZPTR 3RBZA 4EMDA 2ZHAA 1WELA 3MEEB 2DHHA 2IM3A 4NZ7A 2MZ1A 4YB7A 2Y8YA 2L9WA 4GKJJ 1RT6A 2EBGA 4UOGA 1YRTA 5M2RA 4ILLA 3F41A 3M7VA 1HNWJ 4ATNA 1NK7A 5BR8F 3W2VB 1Y5NB 3IS9A 2C28A 2B9WA 3CJ8A 3CJ3A 1XMOJ 2G2OA 4USUA 4ZJQA 3R1LA 3VHQA 1R6YA 1F9HA 3MR6A 1WHVA 3FZ2A 1JNZB 1Q53A 2B6AB 2WSEC 2VC1A 4YQWA 1QAJA 2ZJPQ 2QL7B 4K5RA 3H4DA 2EI5A 5KFLA 3CIZA 2K1RA 3DLKB 3CC4S 5KG0A 3B6BA 3PIOQ 4RUBA 1KQGB 3AQOA 4JV5F 1G2EA 2E5JA 3CO9A 5CH7B 3BR8A 3H5UA 4Q0BA 1T9UA 2OHDA 3P5BP 2CXEA 3FBFA 4JI0F 3HJFA 1QUPA 3GONA 3GR0A 2AGPA 4LSNA 2P9EA 4RW4B 3KLIA 8RUCA 1FDNA 2KHDA 2EKYA 3POTA 4X4OA 1I5OB 1RI7A 2B5JB 3OSPA 3G8QA 3BKFA 4N7TA 2HNZB 3HO1A 2QV6A 2AJ0A 2KHCA 2ZD1B 5J2MA 4KO0B 4DUZF 2QLJB 1H0HB 2PI4A 4KHPJ 3IA0A 1CC7A 1NKEA 3A3NB 1BE4A 1X4EA 2HVZA 2V69A 2FUG9 2MQLA 4ZVOB 4WXWA 4A8QA 2GQCA 2G2ZA 5AXLA 3P6YC 5F9LA 2W8LA 4QW9A 3NAIA 1WACA 3LP2A 2CQ0A 2XCPA 3RR7A 2HFSA 3HULA 3ZTSA 4BLGA 3HFVA 2WB4A 1NSAA 4FXWA 2D7SA 3D4JA 4OL8A 1NDLA 5J2NB 1KHVA 3C14A 3DOKB 5K8OA 1RHMB 1S6UA 1RAHB 4Z7YA 3C6UB 4DV1F 1NK6A 4U7UD 5F8JA 1RAFB 4OZ0A 3KMSA 4DR4J 4LSNB 2CADA 2CAJA 1P1LA 3AD7C 5DDPC 3HHNB 3M8YA 2FJBB 4NCAA 3MDFA 4PCQA 3TW0A 1LW0A 4PG8A 5E3AA 2LKZA 4P52A 4Q0BB 1P8GA 3FBEA 5DG9A 2PDAA 2IMOA 1WF2A 1RA6A 1ZPWX 3R2CJ 3GSIA 5DG7A 3L7OA 4H4MB 3HD2A 4O44B 3THPA 4F26A 4X65J 4P9SA 4AFFA 3UCZP 2OPRB 4RUCA 1OYEA 1HNXJ 2X1AA 3QGGA 1JLBA 1Q95G 3P3DA 1X5OA 2GAHC 2VF3A 3CJKA 1YBTA 3K5NA 3MMAB 1Q5VA 1XNRJ 1Y7PA 1LWFA 3UD3P 4IO9Q 2VODA 2CIMA 1VMBA 2J7UA 2ZC4A 4P75A 3SYZA 1SQEA 2CQCA 5B0EA 4KGZB 4KJIA 3BPDA 4UQTA 2DIVA 2EFNA 1S79A 4OX6A 2NCKL 3HFKA 4J9PA 3QLHB 1EP4A 3VAGA 2JVOA 3MPVA 3IM9A 1S97A 2M52A 3AHPA 1DQ8A 2MLXA 4O0NA 1S9FA 1U0HB 4GKKJ 3D68A 1S1WA 2HRTA 3UFCX 2IJFA 1EAYC 2Q3PA 4UT4A 4LFBF 2YNHA 5KFQA 2F8HA 2NYIA 1NJZA 1HQ2A 1HQEB 1HNVB 1LQ9A 1R3NA 2FY8A 2M9KA 2VG5B 3D6MB 2YNGA 2YX4A 4UUWA 2FDNA 2FC8A 4J9UE 1KN6A 2ZBQA 4RX6A 3OFGA 3SQOP 2FC9A 3LP0A 4NMLA 3UW1A 2C2KB 3DYAA 4Q45A 2XY7A 1E6YA 3HHEA 2Z0GA 2EG1A 1RYRA 3TJ9A 1EQMA 4B3SJ 4LRCA 2YWHA 4DHVA 2BQ3A 3HI9A 3W5ZA 2ZBIA 4Q7AA 4RW8B 3SI8A 3UPFA 4P7TA 1RB0A 1U2RA 2BJ3A 2W01A 2RRNA 5F8GA 1N5QA 1FKPB 2WSCC 3B4MA 3BN4A 3P5TL 3CCRS 4I69A 4USHA 2R2TA 3VAFA 3BYPA 1FXDA 3IWLA 4WE1B 3Q22A 3H4BA 5ETNA 2CWXA 3NNHA 3M9OB 2V4RA 3IS9B 2ZJRQ 1FERA 4KTQA 2E1CA 2DEIA 3DRPA 3IR5B 1DFDA 2PD1A 1RWUA 1S1XB 3FEYB 1CJTB 3HVWA 4M5NA 1MU2A 2L9DA 1DQ9A 1REVA 1SI9A 3CCWA 4DSFA 1U0SA 4PUOA 1FRIA 1UWBB 3BM7A 2I8EA 1A7GE 1CULB 4UZCA 3TVZA 5DLFA 2LA6A 4HDGA 5GMEA 4A8YA 1TUGB 2HMIA 4KHPF 1S1VA 4KH0B 1HMVA 3A13A 4RW6A 2DGSA 5FJ4A 3U27A 3NGRA 1ZBTA 1TK8A 2MKCA 3NOCA 3CCTA 3D66A 2EFGA 5IC6B 1QLNA 3FRZA 2KXFA 5C25B 2R8HA 3TANA 2V2ZA 3M30B 4DUYJ 2R7VA 3AXMA 2D3UA 2G0CA 4DCJB 4AXIA 1P9QC 1Y5LB 1WKJA 4PR6A 1WORA 2ZBCA 2IYIA 2BKPA 1RWKB 2PIIA 4ZVRB 2D3OR 1K0VA 1GXLA 2MY7A 2JZ5A 4TLQA 1OQ3A 5HATA 4K4WA 1WI6A 2LQ9A 4DN9A 1ZTWA 3THTA 2WTFA 2RHSB 3BSAA 4LSZB 4ZLNA 2LQBA 3B82A 3LPEA 2NUUG 5F0UA 5K8PA 2HNDB 3KLVA 1FJGJ 3G8TA 3AFGA 4NI2A 3Q0AA 4B9NA 4NXNJ 3FMWA 3CD5A 1N56A 1QAYA 1VISA 3QSYB 4C8LA 1U8SA 2QE5A 2YKOA 2HQGA 2EVZA 2HS4A 4K4SA 3P8BB 1JXEA 3EYZA 4M8LA 2IM0A 1RT5B 4L72B 2G2YA 1CJTA 3GG0A 1GEHA 3T5HA 4V1Ak 1HNWF 3I32A 4M63A 2ADCA 1GTEA 4C0OC 1L5UA 4C8KA 2VONA 4GMKA 3D6TB 4LVOP 5D77A 3BO3A 4J9LA 2KM8C 3L95X 4LIWA 2MQPA 1JKHA 2D3O1 3M6UA 2QYGA 2L48A 3D3BJ 4K8RA 3T1HF 3KJFB 2CJYB 2IBKA 2MLZA 2W9CA 4A46A 4KH1B 4JI6F 3JTOA 5HBMA 2EBEA 3SFUA 4DV6J 2HWTA 1HNVA 3HVTB 5DJBA 1XEZA 2VFSA 5FDLA 1UWAA 1R8CA 1S1UB 3K57A 1X9MA 1F9FA 2DEJA 1JLQA 4LF6F 2VOPA 4X4UA 1XNQJ 4YFUA 3R97A 2FD2A 2LEAA 4PWDB 1T3OA 2CQ2A 2ASDA 5K14B 2GC8A 3GR1A 2RU3A 4TQSA 3KK3B 2AEJA 2KXHA 3TWZA 5IT4A 1URNA 5KFOA 2R2SA 4MIBA 2B4VA 2E66A 3RGIA 4FVMA 1WC5A 5CYMA 4IRDA 2OFHX 5J1EB 3CDUA 2X3GA 1LWFB 4KAIA 4DPXA 1FWKA 3M1VA 1IBMF 3FRYA 4UW2A 2C1EB 4H4OB 3CCSS 4KPYA 3QIPB 4OZJA 1Y10A 2DT9A 1R8AA 4ZCKA 3DRPB 5KG4A 4TVAB 3W64A 1KOHA 3D1OA 3QATA 1L3UA 3C19A 4M5LA 5KT5A 1GMWD 3FDSA 1TKXB 5KFSA 4PPZA 4PZVA 1NJYA 3I5AA 2Q43A 4DCOB 2UVUA 3PYEA 4ER8A 4WZQA 3VQTA 1XIQA 1ZZNA 5GAGU 4OJ3A 3MM7A 3T6BA 1FEHA 4OZNA 1YGYA 4F8RA 2DXFA 1G3OA 5LMUJ 1WC0A 1YBAA 3DRSB 3FBBA 4I4BA 4NE9C 4OI2A 2XMKA 1BY9A 3EE3A 3PYGA 4ZKAA 2VJVA 1M5SA 2WVFA 2QA1A 1BLUA 3MAAA 4PAAA 4ZLJA 3J81Y 1K73T 4NASA 1TL1B 3DDIA 4TYAA 1VQ5S 1T9WA 3GE9A 1CJVA 2RS2A 3GYXB 3LP0B 2ZZMA 3A3OB 3M32A 4ID8A 3OXFA 3CULA 2QFJA 4B9MA 2HBZB 3EZOA 4WK1A 5I42B 1TFWA 2Y8WA 4LRBA 5GADI 2FY1A 4F36A 4B17A 1RU2A 2XHWA 3R27A 1RTZA 3MM5A 4F25A 1VC0A 4MKAA 1OSDA 2VDIA 1BXNA 2E9RX 3W62A 3FUYA 3EXCX 2RQMA 3VAMA 2J0WA 4ECSA 2IVMA 1H98A 2BANB 2QTWA 2BE7D 2CQHA 2MKSA 3CC2S 1HWUA 4X64F 2IY5B 3DLBA 5E3RA 2I5JA 1UJ4A 2BANA 2B8QA 3LAKA 2UZAA 3GWCA 2C2MB 3UDCA 3MOZA 2NSBA 1S59A 4DV7J 5KT6A 1IKVB 1XK8A 4DMZA 5KFJA 1NK0A 3K0JA 5EHHA 3QAEA 1B3TA 2G4BA 4GKJF 2LXUA 4QIGA 2UUTA 5KFYA 2DR8A 2NR0A 4JOUA 2I2YA 4IH6A 1VI7A 2DNZA 2PO4A 3NWGA 3KLIB 1MN7A 5GAHU 4CH1A 1CJVB 1R31A 4DL2A 2F9JA 2QMUB 2YWFA 3V6HA 2I9SA 5BYQA 2F40A 3CIMA 2FJDB 3KG1A 1WTFA 3V4MA 1AW0A 4CO3A 1TMJA 1HPZB 3GIRA 1Z1ZA 2CJBA 1IWAA 3VZIA 2GJFA 3N01A 4ED4A 3E8OA 4B3SF 1Q1KA 4K2XA 1Y00A 4F2RA 4PRFA 1XR5A 3C6UA 2LQJA 3JTNA 4B3TF 1SC1B 4MIAA 3H2UB 1VGYA 2IDLA 2CPXA 1SB6A 3NGUA 3H90A 3PHTA 3QO9A 3R7BB 1W2BR 1S10A 2Z2LA 4ILMA 3SFGA 1JXLA 2KVQE 3IR7B 3ZFVA 3H8YA 5KG3A 3NCPA 2HGMA 1HNZF 1YTYA 2AX0A 3V81A 5J1EA 1HNZJ 4FZVA 4M95A 1FJCA 2KB2A 3LGHA 2BZ2A 1G7CB 5HMWA 2UXDJ 1RT2A 2FGCA 4CT8A 3I5CA 3BH6B 2NLWA 3WIVA 4C0BA 5IC4B 2ZH1A 2R8JA 1N33F 4FKXA 2VPYB 1XERA 2XCAA 1KWMA 2AYGA 3V6DB 2JJ4D 3MI7X 1TQLA 1WOOA 1FRXA 4MH8A 4IYQA 1NNDA 3LF0A 3HDSA 4JB8B 1HI0P 4V19X 1RHRB 2GQ2A 2HLUA 4ZCIA 2XNRA 3M2UB 1GX6A 3R6GB 3J7YU 5J2PB 1PG5B 3GFYA 4OZLA 1RCOB 2P9GA 3FCVA 3I0RB 5DDOC 2DH8A 3TUIC 2N82B 1YHQS 1SIZA 1HBMA 4G1QA 4UOHA 2V2VA 3NMAA 1QTMA 3IRWP 1FI4A 1NDPA 3PJ9A 4F4ZA 1T8EA 4ES3A 1U1NA 1GMWA 3WHIA 2X7IA 1FF2A 2H5EA 2KL8A 4FKYA 2UXBJ 4L76A 1DLOA 2FYXA 1EX8A 5K20B 4EI2A 5FIIA 5F8MA 1VRTB 3D2WA 2R7OA 3T6JA 1W25A 3FJ2A 4GVBA 4AL7A 3MMCB 2UVWA 2YQ0A 5AXNA 3KJQB 4LFBJ 2MQ8A 2QA2A 2XEXA 5IXUA 4E2FB 3K5LA 2LU1A 3ZO7A 2YXLA 3PRVA 3H20A 4ETXA 1YI2S 1H73A 3MCOA 3QNWB 3WIUA 3DLGA 5H9EK 2CKWA 3M2VB 2MDAA 4NLYA 3D67A 5T41A 4K2JA 1BQMB 3AB2B 3CVKA 3NAHA 4H4KC 3W9JA 4ECUA 4LF4F 2FZGB 5A2QY 3ADAC 3I31A 3TVYA 4CO1A 2IYGA 2F1FA 3MUMP 3OW2R 3J7AN 3M8WA 5D15A 3ZTPA 4F7VA 1X8DA 1T9VA 3HHLA 1FFGB 1YK9A 3MCNA 4QR0A 4J91A 1S6PA 3MFIA 3T5JA 1RACB 4C3LA 2ABYA 1HNIA 3VALA 1S6QB 2K7KA 4PYAA 2J9CA 3LGMA 3LWMA 4FBTA 1E6YB 2MHNA 4U95A 1YITS 1RLCL 3GJRB 2QA4G 2WRMA 4B3MF 3O44A 2KDOA 2Z57B 5J2PA 1YJWS 2WAQD 1GT8A 1L3SA 3DFEA 2QC3A 1X9SA 3NRBA 3PRBA 5IFMA 2QLBB 2ZH6A 2DHSA 1HMVB 4QWBA 1E6VA 3MR2A 4NLGA 1WC6A 2GHVC 2H3EB 3KLEA 1S7IA 3GTYX 4ZOSA 1RKJA 4B9LA 4QU7A 1ICEB 4YS2A 1XBWA 3UO0A 4FDFA 2O66A 2OSRA 1VQ6S 1UVLA 4LF8J 1MN9A 4AL5A 1Q8KA 2HBRB 3ILJA 2VICA 2HWHA 4JP8A 2FVPA 4B9UA 1V5VA 3MECA 3CJQA 2E44A 3D1HA 2BW2A 4OIXA 4CIOA 4LF9J 3BGRB 1HWLA 1MLAA 3BGRA 2XGPA 4USTA 3PW4A 1EETB 3GU0A 3CCUS 2Y3YA 4E0DA 2HVEA 3LA0A 3KNGA 2CDQA 5HQMA 1M5OC 1TKTA 2ZNYA 4NI2B 3CT9A 1O8BA 4J9VA 2ZM6J 2CNOB 4GO7X 1RT7A 1VLYA 2JDJA 1HWJA 3LOUA 4I1TA 3S7RA 2W4PA 1PAEX 2JC0A 4LSLB 2B9EA 5D0HA 4FF2A 4CO2A 2F4VJ 1H74A 4Q43A 2XBPA 4I0WA 3GV7B 1MWZA 3LP1B 5I4MA 3LGNA 1S0OA 1YJ7A 3RBXA 2FLOA 3NL0A 2RHQB 1R8PA 4DX7A 3GILA 2FPHX 2E5IA 3GZ7A 4RNNA 1U2FA 4OZ5A 4M5MA 2ZFHA 2GS8A 4WCEQ 3AB4B 3AY0A 1FX4A 4FS1A 2MXYA 1U2CA 1KLMB 2KZZA 3UD5A 4TLRA 3LQVA 1SCJB 3UD4P 3K5PA 2E7XA 3O2IA 1U48A 1YDLA 3IRXA 5JMNA 4DU8A 1TAUA 2G1HA 2HZAA 2ZVIA 3BKTA 4KBIA 1RQ0A 2N7YA 3H5SA 2N4CA 2GW8A 3GYGA 3I87A 4WPAA 3NLCA 1UVNA 5KG2A 5EX0A 2HHWA 5F8NA 2M88A 1SV5A 2AYBA 1RWPB 1VK3A 2GNKA 5KFGA 2MB0B 3KUEA 1HHSA 4LF4J 4USJC 2GVZA 3GIIA 1XMOF 2ZE2A 4K5SA 4B08A 2HEKA 4W92B 2OAUA 1PJ5A 4DG1A 2N3OA 2E9ZA 3H2VE 4Q2MA 1T3NA 1FKPA 1NZAA 2IRXA 1MROB 4USIA 4QYZJ 2ZNZA 5HI7A 2QG9B 3E3XA 1UA1A 3NGTA 4GRSA 2AGQA 2A1BA 1Q16B 1RLDA 4RU2A 4H4MA 4O44A 5ETPA 2APOA 1T9XA 4CLPA 3KNAA 5D8HB 2GX8A 3NGSA 4OLOA 2XI2A 3O3LA 1XMQJ 1NJXA 3TA0A 2J0QD 1EQ0A 3KLFA 2HG4A 2K2PA 2OD6A 1JLEB 3J7YI 2WW8A 5CQGA 3KK2B 3X1LB 4QYZK 4DQPA 3CWJA 5ETKA 3H40A 1R8BA 3W8GA 3RRGA 3EGWB 2FQQB 1VLOA 3T9NA 4LF7J 1IVZA 3IG1B 4OJHA 4ID5B 3W63A 4K4YA 4LF5F 1H6KX 4FNHA 1S77D 3BGUA 1QTNB 3PDNA 4WKRA 2B56A 5EGYA 4KY3A 1FDDA 2GQQA 4A8XA 2XZDB 4ECXA 3OBIA 1LKZA 1GH8A 2HKEA 4PXBA 2XMTA 1YLXA 3SEOA 2VQEJ 1RCXB 4NLVA 5HLFB 1WJ9A 3MPDA 4KFBA 2CPYA 4QOTA 4DR5J 4BDPA 4ED7A 3HCXA 1T9YA 1N4LA 2YKQA 3DM2B 4RW9B 5GADU 4ZVEA 2O1PA 1ZPVA 3MEEA 5HQLA 3JYTB 1T0TV 3J81U 3PW7A 2C22A 1TKZA 3OR2A 4L3KA 4ZA1A 3UCGA 4BC7A 4ZN1A 1XC9A 3EMTA 3PEHA 5AJ3J 4O4GA 4Y0FA 4IFVB 4IKAA 3ZZTA 5C7PA 2XO6A 1PGZA 2OJ3A 2UU9J 3CTRA 4L73A 1IQTA 3VAJA 5C24B 4QIVA 1GFWB 1U6FA 4G3IA 5LM7E 2YKPA 4ZIVA 1DY3A 4ANCA 1Y11A 2WHOA 3NGDA 3JQKA 4K4TA 2RJZA 3UR3C 4QIWD 4DX5A 1FA0A 4KGKA 2CJXB 2HRYA 3UVJB 3ZZPA 2H5IB 2HQ3A 3OFFA 1PJ7A 2DGQA 1BMQB 5AXMA 2KG1A 1YRXA 2KO1A 1RHJB 5K5MA 5CABA 2O5DA 1PBUA 2GZOA 2L41A 3AJ1A 4NYZA 3EUNA 1IBCB 1LWEA 3OXGA 1H72C 2PGCA 4WP8A 2J0SD 4WBFA 4KSEB 2HZVA 1KNZA 1TKZB 3OR2B 3J80Y 4FVCA 1VHFA 1KSPA 3QT7A 4NYOA 3MOJB 4FYYB 4FYDA 2R7QA 4U8VA 5LSRA 4C8OA 1IBKF 2DY9A 3VAHA 1QE1A 2BMBA 3AOBA 1X4FA 4KGVB 1OY6A 1IUJA 2VFRA 1SKSA 2KZMA 3GSDA 2VHGA 1U49A 2AWZA 4J9OA 2BQRA 4KO0A 2RH3A 1NH8A 3ONQA 4MKYA 4FXVA 5CYQB 4FXDA 3ICLA 1OO0B 1DTQB 4C7QA 1KP6A 1V3RA 4B3TJ 2P2CB 3PX4A 5J1PA 4LF2A 3TEHB 3NP5A 2F8EX 3KJVB 1KONA 3CC7S 2OSQA 2HSEB 3Q8QB 2H9ZA 4EUVA 1HWKA 1UKUA 2V8GA 3ITHB 4J9SA 2Y1IA 1SJFA 1DQAA 1C1BB 2B9XA 2BM0A 2C3MA 1AFJA 2VG6B 2V8DA 3ISZA 5F8IA 1CVJA 3EGVA 1UEUA 2UV8A 4DQIA 4HEA9 1JLQB 2MEWA 2QN6B 4R5PA 3PXGa 3BSNA 1HBUB 1S6QA 1M1GA 1U7LA 1HBOB 2LP4A 3DMJA 1K1QA 1JNRB 1VHIA 4JV2A 2ZDOA 2XM3A 1G4CA 2R2RA 4CTAB 2NZCA 2DISA 1OMSA 4KIAA 5E33A 1NXIA 1NSQA 2PMZD 2JVRA 5IV4A 5GAEU 2KFYA 1IXKA 1SJ1A 1T95A 5F8HA 1NSPA 4CWBA 3Q89A 1TL4A 3U1MA 1CC8A 2XMAA 5KG5A 2W9AA 2UU9F 3AA9A 3PR5B 2PI5A 3M8PA 5KOXA 4C97A 2DGTA 4RUHA 3THVA 2VOOA 2ZE2B 2M5YA 1XR6A 2ASYA 1N8RT 5J2QA 3A1YG 1JLCB 1JLCA 3FSYA 1WKLA 1WOSA 2BA9A 1X4GA 4ZPBA 3TR5A 3UN2A 5LMNJ 4FPRA 2AGOA 1Q86T 2E9TA 3GFZA 4RO0A 3MGJA 1RP5A 2YKMA 3QZ8A 4MTPA 5E0OA 5DDQC 1W7WA 3GG1A 1SKUB 2KT5A 4R8UB 4O3PA 2JC1A 4MKVA 3VGTA 5KFPA 1V9OA 2J9EA 3BKUA 5D0RA 4CLKA 1N6QB 1LK5A 4Y00A 3M2RB 1WG4A 1HNXF 2A6MA 2W4DA 2CPJA 2EFOA 2DR9A 1XNRF 3P45B 2V8PA 2YWWA 2MQQA 4F0MA 2V5HG 3RUBL 5DQIA 2DRAA 1C2PA 2HWIA 2J8AA 3L09A 4L74A 1DHMA 3R5GA 4KC5A 4C6AA 2HHUA 2MPUA 1GXUA 3D0HE 3MXHP 1ELOA 3ENVA 3RYLA 3VWSA 4YMEA 5KT3A 3BYRA 4CLTA 1FWPA 3M8RA 2DO4A 2JFDA 5E7OB 1R8HA 2YNHB 4DR4F 4DDFA 5HVGA 1JLGB 3LO3A 2HHSA 2CNKB 3CGIA 4RJVA 1X31C 2YKAA 2YWGA 2IAJB 4WIQA 4DF4A 2ZZTA 3GFXA 4KQZA 4HACB 1OYDA 4I6AA 4JI3F 2UVRA 3M8QA 5LXYA 2QO3A 4F4YA 4ELUA 2VG7A 1KQKA 2BW7A 2QLFB 3CEDA 4OHZA 5HO4A 5KAKA 5BR8J 4DS4A 2ILZA 1TL3A 4KV8A 3OXLA 3NNCA 4E8UA 2DGOA 4K4UA 1WC4A 5ETTA 4DR3J 5IQ6A 1FD2A 2HQFA 4J5OA 1S9GA 3CJKB 4C8NA 5ETMA 4C4WA 3QO9B 1WF0A 4C11A 3CW2C 4ZP9A 5DDRC 1PKUA 3GLJA 3CCQS 3L9ZA 3BQ0A 1CS4B 3U1NA 1I94F 4LF7F 2V50A 1FRMA 4RW8A 2RD5C 4JI2J 1N32J 3PKMA 1I1GA 3MMCA 3DMJB 5CCMA 2I1RA 2RAQA 3DI6A 2HLTA 3MD3A 4Q5VA 2ZOFA 3MMBB 4RBTA 3KLEB 3W2WA 3NY0A 4HTIA 3SZ2A 4YR3A 3Q8UA 3AJDA 4ZVQB 1KFSA 3MF5A 1XMQF 4Z7CA 2V2QA 4DR6J 2MGZA 1LXNA 1UJ5A 4DV0F 1S1WB 2HHHJ 5HL7Q 3W1YC 4PEOA 1WHXA 1RTHA 2PA8D 2ZDPA 3OL7A 3T1HJ 2CQIA 3Q24A 2VBXA 1OJ4A 3MEKA 1FO1A 4RLEA 5IOLA 4YOEA 3TX0A 2ZH2A 1U1MA 1SC4B 2MMYA 3DC2A 1DZ5A 1S76D 4NEYA 4J9KA 1KTVA 3CJ5A 4HDHA 4OFZA 4XDDA 2ZM6F 2BXJA 3QWPA 2ZJQQ 4WF9Q 3ENWA 3NBPB 1BHNA 4AD6A 5G0RA 4ES2A 3HSGA 3LAMA 5CZXA 1M1KT 2RF2A 6AT1B 4NLUA 3CD0A 1VOMA 4LRDA 4AUKA 4ALZA 4YP3A 4X2BA 4KGMA 1JLFA 1KBRA 1LV5A 3NWRA 4IRCA 3L4BC 4NZ0A 3GJTB 2ILYA 3GMGA 3G6YA 1RAOA 5CYJA 1W26A 2UUAJ 4BWJA 1UPMB 4X4SA 1OQ6A 4UOCA 4ZPWR 3G82B 4ZVFA 1D0EA 3ZZYA 2RKIA 1K1SA 2WSFC 3CB4A 3L7PA 3PZPA 4LF8F 3W8PA 4O0IA 4RW4A 1NH7A 1X4AA 1X4BA 1HHQA 1T94A 2QLXA 5KFCA 2GAGC 5THWA 3TOQA 1RT1A 4OZ1A 3OSNA 5ADZA 4DV5F 1JXVA 2J9DE 5A8WA 3NGKA 1X5TA 1C0UB 2FLLA 3OVAA 3IC1A 3NMRA 2CPEA 1YIJS 2B51A 4K7QA 4JI1F 4TU8A 4A8SA 2H65B 4DUYF 5C24A 7FDRA 4DR7F 1M0SA 3C15B 3LH2S 4C48A 2XG8A 2Y1LB 2XMJA 3VAKA 4DSKA 2NXEA 4F4KA 4IQXA 2HHTA 3ET6A 3S8SA 4IOAQ 3KUHA 2KRRA 2VDHA 2CA9A 1RBOB 3IM8A 4UOFA 4DV2J 3IP0A 2VQFJ 1FFWB 3FZBA 1N88A 4ZIWA 5DLGA 4YDXA 3VV2B 1OY8A 2XWXA 2MLYA 3IAS9 3MZIA 4O3QA 3RB3A 3OL9A 1X0FA 2VUGA 4ZP8A 4AL6A 5H9FJ 2R7SA 2NXUA 2RVJA 2V8VA 2MZQA 3G87A 2DGUA 3TI0A 2VB6A 3DGPA 4FYWB 1IR1A 3SMZA 4EBDA 1YJVA 2Z2YB 5F0WA 2PMHA 3I9V9 1Q8BA 4CZCA 3OTOF 2MQOA 1KKHA 3NKYA 1UFLA 3ZNUA 4C98A 1QSLA 1CBKA 2GHWA 3BV8A 5DRKA 4AXJA 2GIQA 2DR5A 1F2HA 4DSLA 4X66J 3MM5B 4RBUA 3WQPA 2U2FA 4L3NA 3RJMB 1OIAA 1IM6A 3KFWX 1WI8A 4UZBA 3KLFB 3G4SS 1I6JA 3KTQA 4QWDA 1ZM2A 5K8MA 2MJUA 4KHRA 1NHVA 2J0XA 4DL6A 5SZTA 4PG4A 3CCZA 3IBWA 4IFYA 4J37A 4OYBA 3UE2A 3WC2A 2HS3A 4U8YA 3P4UB 4NLSA 1N48A 2XB2D 2K3KA 3CDAA 1OY9A 4I2QB 5T7LB 4YHHJ 1FE0A 3MAAB 1CQMA 4OYXA 4DEZA 2QFIA 2WVCA 1HI8A 2AKWB 4JI6J 1S48A 3JB9k 4F4AA 1S6OA 2CWKA 3N5FA 3VGVA 1MG7A 4U67Q 5MAOA 3GV8B 2W2MP 3T5LA 2Q1LA 2BJ9A 1U6BA 1WF1A 1FCAA 1PYTA 1V3SA 1YJRA 3N6LA 2XLJA 4U6PA 1WG1A 3FGVA 4OYAA 2UXDF 4X4NA 4JUZA 4DFPA 2FJVA 3PKYA 3R9LA 2AEFA 4KYZA 4OX7A 4ELTA 2B43A 1SH2A 1V3ZA 3FVYA 2RUSA 5D6GA 3BQ1A 3EVWA 5L1IA 2QX0A 3GCXP 2KYZA 3SSSA 4DPWA 1BUXA 2QZ8A 1FRHA 2HNYB 3HVAA 4RBVA 4O3RA 3G2XA 8AT1B 3MEDB 4QJVA 3JQJA 3ILLA 3EZ5A 3SDEB 1IN0A 5FLXY 2EEYA 3G8SA 2KT3A 1Z4UA 3UR0A 1GQEA 3A4TA 4UF4A 4HL9A 5ETSA 1KQSR 2B4PA 4ECQA 4RW7A 3KDOA 5B0FA 2B8PA 2JOQA 1U8WA 1MMLA 1LNQA 1YJUA 3H98A 3Q8YA 2DR6A 4I56A 3TO8A 4XPEA 3WZ0A 1R0AB 4ZJOA 1KOOA 1IKXB 1FDBA 2HS0A 5KFTA 2XYPB 3HHLB 3M6WA 3OFHA 4X4QA 2O3DA 2XLKA 4DR2J 3PIPQ 3W65A 1O0PA 1HKAA 2BE9B 2VBZA 3JSMB 3BPSP 3BQ2A 4IUFA 8ATCB 4IRKA 2BKNA 2BR0A 2EPIA 5DZ7A 3W66A 4RR5A 1SKWA 5L1JA 1RT5A 1VQYA 2V8HA 3PM9A 5JUMA 3QRRA 1JWWA 3LALA 3DLEB 5BJRA 1TUVA 1N34F 4RNHA 1LWCA 3AA8A 3OVBA 5LOQA 2B4OA 2NPIA 1IKYA 2HQIA 4BHQA 2W2NP 4BCAA 3HT3A 2FGOA 1AT1B 5GVQA 2ZH8A 4WFXA 3OLBA 2RQCA 5HK4A 2AJFE 4NCGA 5EWEA 1Q79A 1SL0A 5KFHA 1IQZA 4CLYA 5CZVA 4YR0A 2JSXA 3IRXB 2J6SA 2FB0A 4ZITA 4NPOA 3EDRB 3PX6A 3H5XA 3OHAA 3PR4A 3AODA 4PQUB 4TY9A 2AJQA 4O23A 4ZVSB 1VRUB 3JXOA 3KLGA 4IR1A 5D4PA 4N77A 2R7RA 1DTTA 2IMWP 3K7RA 2HW3A 5KT2A 4LR7A 3QWUA 4LUBA 1S57A 1U02A 4C8ZA 2DNQA 1N0UA 4M5KA 3QZ7A 1CG2A 1XWLA 1RYSA 1VRUA 1FJ7A 3AAWB 1TL7B 1WDDA 2ASJA 4J9MA 2P6TA 4JI7F 1WKKA 4Y28C 4YEAA 3ZTRA 5ETVA 2JEFA 1D3WA 3MTKA 1PJ6A 3ETMA 4RNFA 2DJWA 1Q78A 3NNAA 3LTOA 2R2UA 3NS5A 1FXLA 2J9DA 1RUSA 2CJ9A 1UEVA 2IM2A 5SUHA 1YVFA 4WYLA 2V4QA 3E01A 2IIHA 3KOAA 2DNOA 5IV3A 1ZZFA 2RDIA 5LXRA 1U4BA 1Y9OA 3I0SA 1OPZA 2GA7A 2ZKUA 4OYIA 4WFAQ 1FKAF 2BACA 3IO1A 4RZRA 1IKYB 1RHUB 2DXEA 1SJRA 3T19A 2EKNA 2HYIB 1NB2A 1HFEL 2DK2A 4DI6A 2LXIA 3MMJA 4NL5A 3MMAA 2AX1A 4QBUA 4IO1A 1WD6A 2P6SA 1VR6A 4LBPA 2BDPA 4LFAF 4JI5J 2A2CA 2C3YA 1WEYA 3R5JB 5L9NA 2IFXA 3IMQJ 1VCTA 1H2UX 2M7SA 3TA2A 2WVEA 5JVHQ 1J5EJ 1F3VA 1X4HA 5A2QU 1VC6A 4R0EA 1LXJA 1VQMS 2A3JA 1KR4A 1GAOA 3FFIB 1EZZB 2BE2A 2QEXS 1WSVA 5EDWA 3CJ4A 2OD4A 2GMLA 3BH7B 2YBVA 3CMAS 1GNKA 1NBEB 1TL7A 1HBOA 2K8GA 4O3SA 4LBHA 1HQEA 3A8KA 3QAUA 1RSCA 2F5GA 2AJ4A 3BSCA 2PMWA 1RBAA 2X3DA 3ISNC 1RAGB 5B08A 5M2UA 5IWAJ 3K8WA 3MEGB 2GMHA 3GQCA 4ZPVR 3K5MA 1HWIA 3A8JA 1TVRB 2HGLA 3F0NA 4FN5A 3MM6B 1RDRA 2GIFA 3CPWR 3TUZC 3AOAA 4CDIA 2R8KA 3ITHA 1H2TZ 2ZOMA 1L3KA 4A8WA 1Y3JA 4IG3B 2CZ9A 1M90T 1I94J 4DXLA 2R7WA 2KN4A 4B3OB 1PSDA 1CJKA 1Y3KA 2DBBA 3HP6A 4Y2IA 2Z58B 3RB6A 5GAGI 1RT3B 3PFOA 4ITSA 1I51B 1U1RA 2HVHA 1B0VA 2YWEA 4PG7A 5F9NA 2ZWPA 2ZH7A 2GVDB 5CCLA 5KFDA 3HVRA 2ZBRA 2A6OA 2Y9HA 4B3RJ 1B99A 1N5VA 1JLBB 1F5AA 4LMZA 3IWXA 4OZ3A 2PN6A 4NMXA 2XMVA 4PXDA 3TQEA 1F5BA 5LJ5Y 5D3GA 3CJ0A 1N5TA 5KFFA 1M5VC 1LWEB 1T02A 2GGPA 1MWQA 3IBCB 4HHHA 4B9SA 1TK0A 1PC5A 3G86A 3ZC4A 1L3TA 1DARA 5I3UA 3OTCA 1V6HA 1TL5A 2RRAA 4R5PB 4JI4J 1IKWB 1SJ3P 2B4UA 1R0CB 1RU1A 4A8MP 4NLTA 1VQOS 4LFCJ 5C42A 1YQHA 3MCSA 4YR2A 1SL2A 3RAMA 4QQBA 1VIXA 4U96A 5HP1A 4G65A 2M2BA 2NQPA 2VA2A 1F9EB 1KDNA 2BABA 1RTJB 3OD2A 3HLUA 2JEGA 5BXIA 3OHBA 2MZTA 5E3CA 3TAMB 1N0VC 1WG5A 1SQFA 3SXLA 3MFHA 4M5IA 3WX8A 3HD1A 3M6XA 4A8OA 4CRJA 4IFVA 3QJJA 1F6TA 1U1LA 3DU5A 1EHWA 2UXCF 1UJ6A 3IXQA 1TP7A 5IQQA 3DLHA 1AZSB 1TU0B 2CQ1A 3KHLA 7AT1B 2Q6BA 1UZHA 3QIDA 5L1KA 1F5CA 1RT6B 4OYOA 3LW5C 2XC9A 3CJ2A 3CDWA 3AT1B 5HLFA 1KS2A 3ZZOA 1T03A 1NJIT 1H3DA 4N5SA 1KFDA 1NDKA 4LF9F 1TK5A 1D9DA 3QFWA 4ILRA 3VR1A 2NUHA 3BDEA 3T41A 5D0GA 2ZH9A 4HT5A 4ZMMA 2Q66A 2EFQA 3C6TA 5H9EJ 1NLKL 1RTDB 4K0KJ 4JYAJ 3G9CA 5T7LA 2UVVA 2DPIA 4UY85 1AYEA 5KFBA 1DRZA 3B78A 1HQUB 2HHVA 3O6QA 4CYUB 4PKDB 2ERRA 5C42B 1R43A 3HPOA 3N5BA 3QSIA 2RRBA 1IR2A 4MAKA 3HSDA 2HQDA 1VQ4S 1NZ8A 3O8WA 1DBDA 2X1GA 3VVTA 5KFIA 1TL1A 4DL0C 3L7UA 3SCLE 1QM9A 3CJRA 2J8SA 4DL4A 4DPOA 4YB6A 2LDIA 1VC5A 1RT7B 2RT3A 4AT1B 4DG1B 4U7CA 4DOZA 3R5AA 1HW9A 1NPRA 1XTZA 1RT1B 2CVEA 2ZBPA 3G82A 4LT6A 2UUBJ 3GP9A 2B0GA 3VAIA 2M70A 1M1HA 3C8YA 1FK9B 3TVKA 2RQ4A 1N5SA 4ES1A 3P96A 1T03B 3PNIA 2MQNA 4EWTA 5KFNA 2MQMA 4Y2KA 3DOMB 5KFWA 1H7XA 3TQ1A 2BJEA 3N79A 3TEGA 1RT3A 2GO8A 5CXTA 2E1MC 3KK1A 1VQPS 3J7Z5 2XLIA 2OPSB 3S1TA 5U47A 1KLNA 1T7PA 3HK2A 4URSA 2EG2A 2H48B 4O3OA 2MZRA 3TUJC 5HVFA 1SJQA 2LCWA 3PJXA 4DL3A 1SUQA 3ILOA 2MKKA 3T3FA 2W24A 1J2VA 2MHEA 3FEXB 3K2YA 4IDKB 2EC2A 1PO6A 4FYXB 3QMQA 1NHUA 3HHLD 1VQ9S 2IRYA 1RWXB 2LYVA 4YUDA 5EWFA 3ET6B 4DQSA 1JLGA 4P2FA 5EX3A 4NA2A 2NSCA 1D8YA 2RE1A 1C1CA 3Q8RB 4R25A 2OPPB 5D78A 3C15A 1TVRA 1U1PA 3RZAA 2W9CB 4LSLA 5L39A 2HURA 4F04B 1RE1B 2FZCB 4ZVHA 4X4TA 4A48A 4UQGA 1S0NA 1FNMA 2EXUA 4PQAA 2ACMA 3VZHA 3LP1A 2GJ2A 4AQYJ 3RB4A 1S9EB 3K89A 4TU7A 3RG6A 1CS4A 1SKRA 1JLAB 4FS2A 1HBNA 2ZOGA 2E1PA 1MROA 3F56A 5IM0B 2P8IA 3OLAA 4NXMJ 2EK6A 2R4FA 4DV1J 1S9GB 2YX1A 3TAQA 1M5PC 3FMBA 4WFBQ 3TJAA 4RUAA 1ZM9A 1IBMJ 2XMUA 3G6ES 1B7YB 4WIIA 3DHWC 1SBRA 2IBOA 3M6VA 3DN9A 2LXFA 3IGNA 2O67A 3MM8A 1LWCB 3LWLA 2R9LA 3CUNA 4DF8A 1T05A 2D9OA 3DRRB 1JLFB 4N8NA 2H4WB 1K8AT 4LF6J 4C9DA 3A3PB 2OKQA 4WKYA 2KKHA 4MK7A 2HVIA 4EGLA 3FSIA 3CD7A 4XPCA 4Y6IA 1SV5B 1Y4ZB 3NG8A 4LRFA 4QWAA 2FJWA 3V6KA 1N34J 1WDTA 3JSMA 1O5JA 2XMMA 2FVRA 2ACYA 1RTIA 4PG5A 2BJ8A 2GMJA 3RB0A 1NB7A 2LDYA 1FVQA 4ED8A 1UFWA 2RUGA 3BBFA 4P73A 3KWMA 2YPZA 3TA1A 1UPPA 2CJKA 3QJPA 1BD6A 3Q2SC 4H4KA 3KHRA 4MK9A 3RAXA 1N36F 5CD4A 2XYHB 3P49B 1XR7A 1S5ZA 4AQYF 4USVA 2XQCA 1ZM4A 4F02A 4P6QA 4QZVB 4D3HA 4FF1A 1S72S 4N47A 4J9NA 4OI6A 4OLPA 1VBZA 3MPYA 5AT1B 4DPTA 2KFZA 4W98A 4ZJLA 3T1AA 4CQ1A 4R8UA 2RS8A 3IN5A 2J76E 2ZKTA 5DM6Q 4WFZA 2YTCA 2J7KA 1S6PB 1WUUA 2G9OA 3OJUA 5L1LA 1R0BG 3ZZ0A 5C2GA 2LECA 3FNNA 4DV4F 4Y2MA 4ZCMA 1KRPA 3HHDA 2COLA 4DPUA 3DRRA 2JEIA 1TFYA 2BJ1A 1R7IA 5B0GA 2AMCB 3FCHA 1HL6A 2BRKA 1UWBA 2CQGA 4NOHA 3GV5B 1RWOB 1U24A 4D3GA 1REVB 1ZA1B 3DOMA 1S0VA 1FTCA 3AOCA 3MECB 4ED3A 1Q8IA 2DTJA 1C4AA 1YX2A 4DFKA 2EW9A 2X51A 3AD9C 3M05A 1FJEB 2ZZNA 4EBCA 4DV3F 4DSJA 1CJUB 4HHUA 3KUGA 1GTHA 2DXDA 4NRTA 2C2OB 3EJMA 4N76A 2IAJA 3JSYA 3B4DA 2AHOB 1UVJA 1FKOA 1HBNB 4G1IA 4QPTA 4QYRA 5IM0A 1ZETA 2LVWA 1SJ4P 3PO5A 3ZZZA 2CQBA 2WZ1A 4G6VB 2C2ZB 4DR6F 3ENAA 2VG5A 3KYLA 1FE4A 1HQUA 1R0AA 3OFEA 2W4CA 3GB0A 2MZSA 5E2QA 2HAIA 2JX2A 3DYAB 1APSA 3MCMA 2D1CA 4DX8H 4ELVA 1K0TA 2IPOB 3QBCA 1PYSB 3QGPA 3TZYA 2KH9A 2OTLS 3SSQA 1D9FA 1ZA2B 4F4WA 5D4LA 3JSRA 1AA1B 2QMWA 3T9ZA 1N6QA 3D6HB 5E3PA 2V4JA 3UNGC 1KC8T 4OHXA 3CMQA 5A8KA 3KK1B 4A8FA 1CSJA 1KVJA 1NM2A 3QT8A 4DR3F 2AU0A 1BWEA 4I6YA 4K4ZA 5KT7A 2XZTB 4ZDNA 3RBEA 3M2VA 1RWNB 3SBMA 4IOBA 5DQHA 2UV8G 4ZHRA 4DSEA 3MD1A 4QIFA 1F1BB 3FSXA 3F44A 2AF6A 4F2SA 2R8IA 1PCAA 3BGFA 1BGXT 3M8PB 1UVIA 1PAUB 5CA5A 4I68A 2R7UA 1HIYA 2F4FA 2FJEB 5GMDA 1KEKA 2W8KA 1R27B 2WB1D 4DV4J 1Q7YT 4JV1A 4DUZJ 5L9XA 2DO0A 3CCMS 4C8MA 2Z2MA 1SH3A 4XK8C 1QSYA 2HVDA 2VQFF 3D6FB 4FP9A 1VQLS 3V5RA 4JI8F 2W7OA 3A8EA 3CO0P 2CQPA 5KFAA 4CYUA 2W7AA 4QR1A 2HHHF 1SC3B 1IKWA 1CQNA 3UN3A 2DYAA 2WVDA 3ELHA 4TY8B 1HBMB 3NCQA 4TY8A 3Q8SB 2UP1A 3K59A 4OJ1A 5A8WB 1JJHA 1L3VA 4GC7A 2BKOA 1C1BA 2CYYA 2J5AA 2DH7A 2F3JA 4MMOA 1QY7A 4DUTA 2K7JA 1J5EF 4PXEA 2LEBA 2E29A 4NRUA 1F0XA 4LBIA 2MSSA 4KE5A 3OV7A 3KJVA 5H9FK 3HF5A 2XHCA 4ZPCA 1FHTA 2HNYA 3I6PA 2A18A 4BS2A 3FQKA 2CNLB 1HARA 3U7JA 1SC6A 1ULRA 2LA4A 1D09B 4MYTA 2C3UA 2V0NA 3SCJE 5K8NA 5LSLA 2AJ1A 4OV6A 4ZHRB 5DQGA 2NXNA 3Q8PB 2MY8A 3CCVS 4URGA 2BYCA 2LFVA 3DDNA 3V81B 2HBQB 3B8HA 4QPXA 2XSFA 4CO0A 4KFBB 2GV1A 1URRA 4OI1A 3ISND 1QVFR 2OP5A 3N6MA 4NLDA 5KFEA 4X4VA 3GJQB 1HW8A 3IG1A 1FNOA 2JHEA 4IG3A 5I3QA 4M5DA 2CJQA 5FD1A 1VBXA 1RT4A 3LUYA 2CG4A 4LRAA 1AXQA 1JB0C 3EICA 1AFIA 1RTHB 4P74A 3K58A 3QFHA 2WW4A 1RTJA 2E1AA 3O1LA 1S1UA 4ANDA 5IS2A 3R5DA 2AD9A 4W90B 1K44A 2P9CA 3M32B 3PEJA 2LQ8A 3DLKA 4TXSA 4WJBA 1J27A 5HMYA 2VV5A 3EX7B 2GHPA 3MAQA 1WWHA 3CNQP 4BBYA 2ZH5A 1EJ7L 4P72A 5D0EA 3PV8A 1LW2B 2B7CB 3BGLA 3CJSA 2G1DA 4DU7A 5HVHA 3UCUP 3PY8A 4F3MA 1FNXH 1UCNA 4DZ6A 4B3MJ 5LT5A 4C8YA 5L46A 1ZAXA 2VU5A 1RHKB 2DNGA 1MNEA 2RB7A 4EYHB 1SIWB 1ZAWA 4GKKF 2O01C 5DM7Q 1RA7A 1REGX 2NS1B 2C3OA 4CLFA 1TV6A 3KG4A 3KMQA 3SSRA 1TZ0A 2X1BA 4H4OA 4H54A 4WP3A 4WZMA 2XNQA 4NLOA 1NPKA 1F3FA 1ACMB 2ADBA 2PEHA 1VIOA 5HQ8A 4DWIA 5KFUA 2R8GA 5ETQA 4OV1A 3W5XA 2JNJA 2OTJS 4CP5A 3FBCA 5G0RB 1N5YA 3G6VA 4UTGA 2VFUA 5CYMB 1Q7LB 1UVKA 3MM9B 2KVIA 4MIWA 2EK1A 2PE8A 2IM1A 2ZUAA 3MM6A 1KHWA 1WSRA 2Y0SD 4ZS6A 3PVXA 2YKNA 2RSQA 3HKZD 3UI3A 5HMZA 1NEEA 2DB1A 3SV4A 1RWVB 2C2RA 3PG9A 5I42A 2UUBF 2CPIA 4CCHA 4OX9J 3HVTA 5FDLB 3KKFA 4PWDA 4XIUA 3IFEA 2HZCA 1F60B 1JLEA 2D3ZA 3KK2A 4NEZA 2UUWA 4DX6A 5LMUF 3C16A 5AJ3F 2NXCA 3BF4A 3EGZA 4FBUA 5B09A 2YNIB 5HN0A 1NK4A 2XMWA 4ICLA 5KTQA 3BREA 3DRSA 3W2WB 4OMFG 4CT9A 4F4XA 4DR5F 2QSFA 1U26A 3DU6A 3VCDA 3EGNA 4MYUA 1CJUA 2VPWB 3GFHA 5KG1A 4ECTA 4EEYA 2HK3A 4ZK7M 1S1XA 2W9BB 2AQ4A 3CMES 5F8LA 1LK7A 2W7PA 1PILA 2VQEF 4QCLA 2LU2A 2Y1JA 3M1VB 1VBKA 1IM4A 4ENOA 1AUSL 4S0MA 2OEJA 2M3DA 4HACA 3I56S 2OMOA 3I82A 4GVLA 4I2PB 4RKUC 2JLFA 2HFNA 3FEZA 1LFPA 3R6LB 5B0BA 4YHHF 1U09A 1IKXA 2R7TA 3B54A 2ATLA 2W2OP 2X1FA 2KU7A 1WHYA 3PACA 5GMKa 3OUYA 4DV6F 4EBEA 4WP9A 1AROP 2F8MA 1U1OA 5EUHA 5K9FA 5B0CA 1MSWD 2WVBA 2J6TA 2FIUA 2OI2A 2CPHA 3KLGB 2XTJP 1YG0A 3M2UA 1RXOB 1V5IB 3R5CA 2QSWA 1FRLA 4HI2A 4LREA 3DXBA 4YY3J 4X66F 3DLLQ 1ROFA 2JWNA 3DHXA 4JI1J 4E98A 3ENQA 2OUGA 3IBFB 2HMIB 1UVMA 4LR9A 4UY8T 4JI5F 2GIRA 3MMBA 4OYMA 2V94A 1YKWA 3PCOB 4IG0B 4LJMA 3KLHB 1EIYB 2UUCF 4TNOA 5B0AA 2QMXA 1S12A 4PQUA 4Z37A 2CRLA 4C3KA 2C3PA 2NXJA 1KTQA 4Y2CA 2E7VA 4ZVTB 2YQ1A 1VQSA 4HH0A 4HVZA 2CUYA 1PC4A 1TELA 4BC9A 4X64J 4A8KA 4B3RF 4LQ9A 1UMJA 1CLFA 2JEJA 2IJRA 3BN7A 4M1KA 4EO8A 2VFTA 2WOMB 3I0SB 2H51B 1RBLA 1A6LA 2VD3A 5KOWA 1Y5IB 3R2DJ 2RDJA 2CPZA 1GMVA 2VG7B 1GK8A 2IHR1 3HSJA 1N54B 4JV5J 2IVFB 1B7FA 3DXSX 1RAJA 1WHWA 4N8OA 4DCPB 2XY6A 1X7VA 2DNLA 1TAQA 2D41A 2YNIA 3MR7A 4LFCF 1EKSA 3OL8A 3Q2TC 1X5PA 2DNYA 4N41A 5CD4H 5KG6A 2W2QP 3I0RA 1YJ9S 1VYAA 3M9MB 3D0GE 1QJHA 2FJAB 3GIJA 2D74B 4LVNP 1YJNS 1HR0F 2HHXA 1RHQB 3T1YF 2CG8A 1HBUA 5IWAF 1FRJA 2XS2A 2DGWA 3HX9A 3KJNB 2NYHA 1NMEB 3JS9A 3M9NB 4L6V3 2RQKA 2H4YB 2FHKA 3VVUA 3HZGA 2DR7A 3GPAA 4AE5A 3EDQB 2NREA 1C1CB 2CJAA 2OMLA 4JI4F 3QLHA 1HHTP 2KYXA 1A9NB 3M2RA 4KRWA 4HR2A 4QWEA 2A2DA 1QUVA 3PTWA 1X0PA 2H5JB 2ROEA 2KXNB 2AW0A 1FRKA 2SXLA 4I2PA 3MR5A 4ECVA 4PG6A 3TARA 1DTQA 2JRSA 1VQKS 1N32F 1EP4B 5DS7A 3EPIA 2ALYB 4X62F 1ZOTA 1NU4A 1O6XA 2LQ5A 2BEFA 2ZITA 4ZVPB 2ZC3A 3UDVA 3I4HX 4ED2A 2BRLA 2OPSA 4I64A 2UUCJ 2HFUA 3NXZA 2AJ2A 1PIEA 2DNKA 5J2MB 3D5MA 2R42A 4XAKA 5A8RB 2XSJA 3OR1B 3G6XA 2YNFA 2DHXA
chains in the Genus database with same CATH topology
2HGNA 2B5JA 2E1RA 2MKHA 4A47A 2XO7A 3BZQA 3KHGA 4DL7A 4OI4A 1Q8LA 3BO4A 2DCLA 4RU9A 1NK5A 1JLAA 2DHGA 1JK9B 2B3TB 4WXOA 3TYTA 4EU0A 4WYWA 5D4NA 4Y2AA 1TR0A 2OIHA 3EXYA 1BQXA 4TU9A 1QAIA 2FVQA 2VG6A 2VA3A 3DOLA 2OPQA 1U1KA 5A0YB 4WFNQ 5J2NA 2XS7A 3FQLA 2E5HA 3MEDA 2QIFA 1UP1A 1HD1A 3C6TB 2YVSA 1TKXA 3N4WA 2I5JB 5I3PA 3F73A 4ECWA 3OR1A 5C5JA 1SUQB 4IQMA 4NLWA 3WBZA 2ZVSA 2HHQA 4NLRA 2A10A 2L3MA 2M4MA 1K9MT 3GIMA 4LQ3A 2CZ4A 3PFEA 2BBEA 2FHJD 3PHEA 4ECYA 1VFJA 3N6NA 3D1QA 2GJIA 2EFPA 1QVGR 4JV0A 3AQPA 5LL6d 5HROA 4R0JA 2L9NA 2XWYA 2FLNA 3TP2A 3I9ZA 4QWCA 3POTB 1TKDA 2R7XA 1LOUA 2N7CA 5E5NA 1NJWA 1FT8A 5JJBA 1FJGF 1C0UA 2VL1A 3SCIE 3WDOA 3DOLB 1Z2ZA 3MWBA 5DETA 4X4PA 3IR6B 1HYSB 1RISA 2QRRA 4NA1A 3WX4A 1X9WA 3FFIA 3MUVP 2GCFA 4I7FA 2AV5A 4PWUA 2L08A 3MURP 2IA6A 2K1RB 1S99A 4QR2A 3CXCR 4P2SA 3UCZP 4ZCLA 4JBCA 3OVSA 2YNFB 4DL5A 2B6AA 4C11B 2V9WA 3QIPA 4DQQA 3E51A 4F50A 1WEZA 5D3GB 3SV3A 3JYTA 1T05B 4DSIA 2J7WA 1S0MA 2DGVA 2EC0A 2FHJA 1G6BA 4B3OA 2ZHBA 4PUOB 1M5KC 1YRUA 2OFGX 3M8QB 3DDKA 1JMTA 1OSCA 3S6EA 5AE2A 5B7WA 1FD8A 1W2IA 3J7A1 1LFWA 1Y0HA 3TAMA 3AH6A 4AE5A 4B3MF 4X4RA 1F2GA 2KJWA 2Q6CA 5JXSA 1NO8A 2FHOB 5HP1B 4P7VA 3GYNA 1AUDA 4YDDB 3R5BA 4X84A 4I67A 2IA0A 2DHAA 3CCLS 1RJJA 4ZPDA 2WONA 3OQ2A 2C42A 4DS5A 4YY3F 3PO4A 3MHYA 3DI6B 5DG8A 3MR3A 2N3LA 2EFVA 1J5OB 2CPDA 4AYBD 2NZ4A 3U1LA 1TKTB 1S1VB 1U6ZA 2BE2B 3DNCA 1VS3A 4CH7A 1FESA 4RNMA 4MFBA 1MW7A 2HHPA 4WK3A 3IWNC 5AXKA 3S01A 2RKIB 1EETA 1RKIA 2ROGA 1VK8A 4C0HA 4ZP7A 1FEEA 5D4OA 4EFAC 3DLGB 5A8RA 4DLEA 4V19J 4Y65A 2JLEA 1UL3A 3CCJS 3OTBA 2WOMA 1UAWA 2FVCA 3D54A 4GO5X 4C2MA 3BDPA 2RF2B 3BR9A 2YQ3A 3HHKA 2JLGA 2AYEA 2QT7A 4HYKA 3PW2A 4XDCA 2DGXA 5LSOA 1UETA 1VRTA 4OHYA 4KKOB 1KQFB 2Y1RI 3E01B 5DO2A 2FVSA 4PPDA 6FD1A 4IR9A 4X4NA 5GAHI 1S9EA 3EPGA 2I38A 3MPWA 4NLQA 3LANA 4EZ6A 3RU0A 5ITHA 5DGAA 4Z2XA 1B64A 2XZWA 3NCRA 4U9RA 1Q4RA 3QJLA 3R1HA 3HKWA 3I4PA 1GXTA 3RRHA 1IBLF 1WNEA 2HFZA 2C2EA 4J9QA 2MSTA 3DLJA 4ZPAA 3V4IB 1NKBA 2XI3A 2DNHA 3BJYA 4JYAF 4NCGB 3V2UC 1DTTB 1BQNA 1M5HA 1L3TA 3HXMA 2ZH4A 1B7FA 4WU3A 3KHHA 3OUYB 2FJXA 1N5YB 3D0IE 4EO6A 1C0TA 1HI1A 4RW6B 3CD6S 2VH7A 3CCES 4PXCA 3RTVA 2PA3A 2VPZB 4OHVA 3ZZRA 4O4RA 4CNYA 5J2QB 5F3ZA 2W25A 1GX5A 2RILA 2JL9A 4Y34A 2RNEA 3J7ZT 2YKMB 3PW0A 2M8HA 4EZ9A 4NZ6A 3RAQA 1FK9A 3OJSA 1O51A 4F3OA 5KFZA 2IJNA 5KFRA 2BJDA 5A6WA 4CO4A 4ICLB 3L3CA 1MMDA 1VQNS 1UW4A 3N28A 4BWMA 4YB1P 4I2QA 4NYPA 3HMJG 3I55S 1P1TA 4B9VA 5H1SV 4G1QB 2CVIA 3WC0A 1OWXA 4CTAA 2BUNA 2ZUGA 1X4DA 2V2KA 1CPZA 2YNGB 2KG0A 1S1TB 3VQSA 2ZH3A 3I5BA 4Q44A 4K50A 2HIQA 1U25A 3C3LA 2CQ4A 2F7VA 2VC0A 4IDKA 3N0VA 2ZHOA 1IKVA 4O4GB 6FDRA 2KTQA 1XN9A 5HROB 3UDLA 2ALZA 3OPKA 3TAPA 2VPXB 4ED0A 4WU2A 5LMNF 1U45A 1QE1B 1IR0A 4NWBA 3R3TA 3DM2A 2WBRA 4RW9A 2I0XA 1BQMA 4K59A 4ED5A 1U1QA 4NLXA 4OJGA 2HRUA 5KFXA 1Q81T 4IH7A 1P6TA 3CDEA 3US5A 4ED6A 2M0GB 2DH9A 4J9RA 1FVSA 3CE8A 1G1XA 2OPRA 4ZP6A 4OX8A 1D8ZA 1H2VZ 3BEGB 4HI1A 2B9YA 2MKIA 3HM9A 1SL1A 3MUTP 3T5KA 3BSOA 3D28A 1WTBA 3RR8A 1P27B 2PSZA 2VOPA 2ASLA 1LW2A 3MTJA 1HPZA 4ECZA 1HYSA 1D9AA 1DAXA 1ZTTA 4DQRA 4IFYB 3KG0A 4RWWA 2WBMA 5M2PA 3C2PA 2XY5A 3OL6A 4ZLPA 4RW7B 2BOPA 3SCKE 4QW8A 3H5YA 2CFXA 3JAMY 3DOKA 4UUXA 3AJ2A 4ECRA 3QPIA 3TNVA 2QA4S 1NK8A 1RT4B 4TN2A 1N52B 4MKBA 4OQJA 4JI2F 4CNZA 3PW5A 1RTDA 4GC6A 1ZAVA 2DITA 2MJNA 3JTPA 2BM1A 3K5OA 3W2VA 3BO2A 4TQRA 2E5GA 3QGIA 4FF3A 2CZVC 2C2DA 2DCUB 3H25A 3O5TB 3U02A 1XMBA 3CF5Q 3HHLC 4DV7F 3CSKA 5KFKA 2HNZA 2VASA 5A8KB 2DRBA 4OI0A 2LMIA 1NKCA 2QLWA 4ID5A 5BYRA 4U7UK 4DFMA 3CDBA 2ZD1A 3GIKA 1QSSA 3M8SA 5AE1A 1VJWA 4HH1A 3OTEA 4KR0B 1ZM3A 3E2EA 2DNMA 3IGVA 1IJEB 1FXRA 4MJKA 3C66A 3RW7A 2CQ3A 3NS6A 4DN0A 5L39A 3IRWP 4B3SF 4I7FB 3I96A 2OPQB 2P5VA 2VKRA 2KI2A 5KG7A 5F41A 2JFKA 1XNQF 4HLBA 1RGVA 2PT0A 4IH5A 4DLGA 5I3UB 4KHMA 2IRUA 3LPYA 4CH0S 4K4XA 2M8DB 2LLZA 2DD8S 2HPUA 3W7BA 5EWGA 5EN1A 2OLWA 2GGPB 2RIJA 4YB5A 5KFMA 5LJ3Y 4M5DB 2N4DA 2GO9A 3TRGA 2KT2A 4F3QA 4XO0A 3EZUA 3LP2B 2YH0A 2DNNA 3IAM9 2MZJA 2XSJB 4MK8A 1DURA 3VF0B 1NK9A 4FYDA 5IT9Y 1TL3B 4KV8B 4X65F 2V4JB 4Q8FA 2PFFB 4ETZA 2BVZA 2YY3A 3NBPA 3G71S 4HHJA 1R89A 4IG0A 4M94A 4Q8EA 1BQNB 5IT0A 4N56A 1S49A 2D9PA 2NPFA 1E6VB 2MYFA 2POKA 2VZ9A 2VKZG 4DR2F 2E7WA 5GAEI 1VQ7S 2AYMA 5K14A 2F9DA 4ZVGA 5A0YA 1KLMA 2VFVA 4IOCQ 4FNIA 4KT0C 4DJBA 2YH1A 1U47A 2EWHA 3ZZUA 4ED1A 2G13A 1VQ8S 5C25A 1HD0A 1S1TA 3M4XA 3RRKA 4QIEA 4NCBA 1OS5A 4K0KF 5E41A 4TKTA 3X3UA 2OO4A 4Q2LA 1S4FA 4WTYA 3UQSA 3MAHA 1FKOB 1MWYA 1RTIB 2XULA 3MM7B 5HMXA 3RW6A 2U1AA 1JKHB 2XS5A 2B7BB 4DR1F 4A4JA 2XGQA 3Q23A 4NA3A 2KM8B 1WEXA 4CI0B 5DGBA 4OI3A 1NRKA 5AE3A 2DPJA 1FTRA 2HNDA 2DVIA 4LIRA 3G96A 3DCAA