4WKRA

Larp7 wrapping up the 3' hairpin of 7sk non-coding rna (302-332)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
SRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords La-related protein 7
publication title Structural insight into the mechanism of stabilization of the 7SK small nuclear RNA by LARP7.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wkrA02
2DNRA 1VQ9S 2DH7A 2I2YA 1U1MA 1WHYA 3HHNB 2DGOA 2E44A 2L08A 2DNLA 1YJ9S 3CD6S 1DZ5A 3P5TL 1M5OC 2CPFA 2DNGA 4QU6A 3CC2S 1K9MT 4PR6A 1NU4A 1H6KX 2HVZA 1IQTA 2MQMA 4PRFA 1HD0A 2Q79A 2MSSA 1QM9A 4YB1P 1HA1A 2JRSA 3S7RA 2MZQA 3MXHP 3UWTA 2DNOA 4LIRA 5LSLA 1YWXA 2GO9A 2KRBA 3CC7S 1K8AT 1N88A 2ADBA 4P6QA 2MKJA 2JWNA 3DXBA 1X5OA 2MGZA 1N8RT 3CC4S 4YUDA 4CH1A 2PE8A 3S8SA 2MY8A 1JJ4A 1WF2A 2J0SD 2X1FA 3EGZA 1KOOA 3MUVP 1YHQS 2RVJA 3VAMA 3MURP 4EGLA 2VOPA 2CPDA 2KI2A 3MOJB 2LQ5A 2M52A 2N7CA 3JB9k 2EVZA 3UCZP 4J5OA 2GHPA 3S01A 2FC8A 3BO3A 2N3OA 2MGZB 3CCLS 2KH9A 5IFMA 3CCSS 2OIHA 2LEAA 1A9NB 3THPA 4ZKAA 2DNKA 5ITHA 2I38A 2CQ0A 1H2VZ 2DISA 5DDPC 3P3DA 1H2UX 1KD1T 1X4GA 1FNXH 2XS2A 2DNHA 3N9UC 2L9WA 3R1HA 2AYEA 2KT5A 1VQPS 5CYJA 2DNMA 4PKDB 1VC5A 1PGZA 2K3KA 2CQDA 2DH8A 1X4FA 3CCJS 5BJRA 3BO4A 2DIVA 2HGMA 5GAGU 2MZJA 1OWXA 1WEYA 1VQOS 1F9FA 1R8PA 5DDRC 2YKAA 2U2FA 2D9OA 2RS2A 2QEXS 2DITA 1U2FA 2OSQA 1SJFA 2LA6A 5IM0A 2N82B 2JVOA 4Y0FA 2KFYA 2OTLS 4TU7A 4IOAQ 2M2BA 1WTBA 3I56S 2X1BA 5GMKa 2CQ2A 2ADCA 4F26A 1KQSR 2LCWA 1Q82T 3IWNC 1VBYA 1VQNS 3IRWP 5JVHQ 2CPEA 2MKKA 4CH0S 3VAJA 5IM0B 1YITS 5HL7Q 3CULA 1X4EA 1WF0A 1VQKS 5DM7Q 2RRBA 3B4DA 3CCVS 1VQLS 2XSFA 2MMYA 1WI6A 2LYVA 2EK6A 2M70A 2LKZA 2LMIA 2MKCA 2KRRA 1D9AA 1OO0B 4FXVA 4M5DB 1X4AA 2CQBA 2CQ4A 1X0FA 4WFAQ 1FJ7A 3US5A 2DIUA 2SXLA 2D3OR 1CVJA 2MJUA 3NNAA 1QVFR 5IQQA 2VODA 5CXTA 2M88A 1S72S 1SJ3P 2HZCA 3J7ZT 3TP2A 2KYXA 4F25A 1YJWS 2MJNA 3CCES 2KXNB 1SJRA 4CIOA 2B0GA 2HGLA 1U1NA 5LXYA 2A3JA 2CPIA 2MB0B 3FEXB 2J8AA 2MQLA 2ZJRQ 2KHCA 1SJ4P 2MZTA 1KC8T 3EGNA 4RU2A 1G2EA 4W90B 3PIOQ 3U1MA 1Q81T 1U1RA 4IO9Q 5DM6Q 3SDEA 1OPIA 2K8GA 1S79A 4IOCQ 2CQHA 1L3KA 3BEGB 2M4MA 3CXCR 1JJ2R 1O0PA 2DB1A 2MYFA 2MQPA 2FHOB 5GAEU 2MY7A 3R27A 3OW2R 5DDOC 3EX7B 2M8DB 2FPHX 2DGSA 1U6BA 4Z2XA 5DDQC 1U1KA 5D78A 1WEZA 3Q2SC 3SDEB 1YI2S 3G71S 2RQ4A 1UAWA 2DNNA 2YWKA 1NJIT 5DETA 2E5HA 1VC6A 1VQ8S 1AUDA 1Q86T 3CTRA 1RK8A 3G8SA 1YJNS 1XN9A 4QPTA 3H2UB 2MQNA 3ZZZA 4ERDA 4WCEQ 1H2TZ 4C7QA 3CCQS 5GAHU 4WKRA 2AYGA 2F9JA 5H1SV 1K73T 3RW6A 1U1PA 1U1OA 1DBDA 2DNZA 2MZSA 3NS5A 5LXRA 2CJKA 1UFWA 2OSRA 1DHMA 2LXIA 4Y00A 2RU3A 1Q7YT 2XNRA 2CPYA 2DHXA 2KM8B 3FEYB 2KXFA 2AYMA 3CUNA 5JVGQ 2AYBA 2XS7A 3MUMP 3UCGA 1WELA 2DHSA 3B4MA 2DNPA 3H2VE 3G4SS 3VAFA 1FT8A 2XNQA 2M9KA 3MD1A 3VF0B 2MHNA 1OIAA 2V94A 3UD3P 2RNEA 4OZ0A 1WHVA 2QFJA 2G1DA 4OZ1A 2YH1A 2O3DA 3BO2A 3CCUS 2RUGA 4TU8A 4WFBQ 1ZH5A 3MDFA 1WG4A 2E5IA 3L3CA 1X4CA 2KVIA 5GVQA 2DGQA 3MD3A 2M8HA 2JVRA 3G96A 2HGNA 1VQ6S 1N54B 2MKSA 3CCRS 2FY1A 2KG0A 1BY9A 4UY8T 4FXWA 1U1LA 2F9DA 2CPJA 1X4HA 3P6YC 2YTCA 2KXHA 1VBXA 3ULHA 4LMZA 3NNHA 3P49B 1FHTA 2MQOA 2RS8A 1M1KT 4QQBA 1U6FA 3MI7X 2OJ3A 2N3LA 3D2WA 4U67Q 3TO8A 2DGVA 1WF1A 2CQGA 2VONA 3LQVA 2U1AA 2KU7A 1VQ4S 2LXUA 2OTJS 2D9PA 4WFNQ 2AD9A 2CPXA 2CQCA 2JX2A 2DNYA 2DGUA 2YH0A 1X4BA 3CF5Q 4F02A 3VAIA 2CQIA 1U1QA 1SJQA 5LSOA 1B7FA 2MXYA 1X5PA 2DO4A 5CA5A 3NMRA 2BZ2A 2CQ3A 3THTA 1WI8A 2J76E 3G9CA 3G8TA 1FXLA 1VC0A 1JMTA 3Q2TC 1ZZNA 2ZJPQ 3VAHA 3VALA 1RKJA 2MSTA 1JJHA 1R8HA 4W92B 3CMES 1KOHA 3K0JA 1P27B 3CMAS 2RQCA 4LJMA 1WEXA 1VQ7S 2DK2A 2FC9A 1WG1A 4YOEA 4BS2A 1M5VC 4V19X 2DHAA 2DGWA 3G6ES 3DLLQ 2CPHA 3TYTA 2HYIB 1HD1A 3SXLA 2MKIA 3CCMS 2XS5A 4UQTA 2PEHA 1SXLA 1WG5A 2L41A 1X4DA 3CPWR 2MPUA 4IUFA 5HO4A 2MZ1A 1M5KC 3VAGA 5EN1A 2LECA 2M7SA 2LA4A 1VQ5S 2F3JA 2CPZA 2KN4A 2BOPA 1A7GE 2DO0A 3VAKA 2LEBA 1DRZA 1HL6A 2KM8C 2DNQA 3HI9A 1N52B 2ERRA 2VOOA 4C0OC 3U1LA 5FJ4A 1YTYA 1URNA 3NS6A 2CQ1A 5LJ3Y 1PO6A 3LPYA 2ZJQQ 2DH9A 4ED5A 3ZZYA 2DGXA 1UP1A 1WHWA 3J7YU 2RRAA 1FJEB 1P1TA 1WHXA 1WWHA 3I55S 2MKHA 1VQMS 2J0QD 4TLQA 3S6EA 3UCUP 4WIIA 2DHGA 2XB2D 3MUTP 2WBRA 2NZ4A 1UW4A 1D8ZA 1X5SA 1ZZFA 4TU9A 1NO8A 2CQPA 3PIPQ 2G0CA 4WF9Q 2UP1A 1FO1A 5LJ5Y 2X1AA 1YIJS 2KG1A 1M90T 2RT3A 3R1LA 3V4MA 1W2BR 2M0GB 1M5PC 4A8XA 1QVGR 5D77A 2NLWA 4QU7A 2G4BA 2EK1A 3RW7A 2MQQA 3SMZA 3UD4P 5MLCV 5GADU 2E5JA 2MZRA 1FJCA 2DGTA 2X1GA 3BS9A 4C4WA 1VBZA 3NNCA 1X5TA 3UE2A 4CQ1A 2QA4S 2E5GA
chains in the Genus database with same CATH superfamily
4LF4J 3CGIA 2DH7A 4ID8A 4GVBB 3W64A 1D3WA 1HBNA 3R6GB 2L9NA 2CPFA 1M5OC 2DNGA 5K14A 1WC3A 4PR6A 3K59A 3KK3B 3ZTQA 3PRBA 5KG2A 2MSSA 2K2PA 2HS4A 3W62A 3UW1A 4LIRA 2VPXB 3OVAA 2HRYA 1Q95G 3R9LA 4A46A 3K5MA 4LUBA 4ECWA 3TA2A 2BA9A 4F4WA 4DR7F 4PQUB 3T1YJ 4UOGA 2PMZD 4MMOA 2OGUA 2BACA 2V2QA 1FXDA 3MCMA 1QUVA 3MR6A 1X4GA 4F0HA 1TKZA 3KNGA 4DX8H 2BQUA 2JLGA 3FCVA 2HMIB 1BQNB 2GVZB 4DUZJ 4DPYA 3HM9A 3ZFVA 1NBEB 2YKAA 3DRRA 5F3TA 2YQ0A 5L8RC 2JVOA 1SH0A 1RYRA 4TN2A 2I5JA 2ZH6A 2HLTA 2ADCA 4GKKF 3PDNA 3FEZA 1OYEA 1WDTA 2LEPA 4NMXA 4O23A 2E5LJ 3MEDB 2ZNYA 3J81Y 1URRA 3RJMB 1S1XA 4CO2A 3QPIA 4GRSA 3IR6B 4LF5F 2BQ3A 3IBFB 1TKXB 4EWTA 2G9OA 3RB4A 1A0OB 2ABYA 1KFSA 1QVFR 1LW0B 4P2MA 1XK8A 2HFVA 2FJXA 2XGPA 3ETOA 3M2RB 3DLEB 2D3UA 2IRUA 3I31A 3AA9A 3SBMA 1HQUB 4KFBA 3I6PA 5EWEA 4MKVA 3ENQA 3PYGA 1FWLA 3C8YA 1SQEA 4PAAA 4Q45A 4MTPA 3U1MA 4IO9Q 2L3MA 3HVAA 1G7CB 4JI8J 4NLSA 4OYAA 4NXNF 5DDQC 5D78A 2WVBA 1WEZA 1SCJB 1HNIA 4JI1J 3FC9A 3BQ2A 4YDDB 3H8YA 3D0HE 4ZVQB 5KTQA 4PG5A 2MQ8A 5KT2A 2GVDA 3J81j 2RAQA 2HSEB 5LXRA 4JI0J 1DHMA 3Q8YA 3V4IA 4N7TA 3CCWA 4R0JA 5D8HB 3NGDA 1F5BA 3PX0A 2Y9HA 4QWBA 2AJFE 5JMNA 4ETXA 4O3RA 4TU8A 4WFBQ 2AEFA 4AXIA 5CAAA 1VQ6S 1QTMA 3T5JA 2F63A 2YTCA 2KXHA 3M8SA 1PG5B 5IOLA 4CM2A 2OJ3A 5EUHA 4ZPWR 2EWHA 8RUCA 4U67Q 3IP0A 4HI2A 1T3NA 2HWTA 2JX2A 3TX8A 1F1BB 5J2NB 4F02A 3GP9A 2W9AA 5E3QA 4X4NA 2XO7A 2BW7A 1NB2A 2YPZA 3IS9A 1VC0A 1E6VB 2D69A 2HBRB 5M2RA 1PJ6A 4WTYA 3FBBA 3KHHA 1UVJA 1R8HA 1KOHA 3QAUA 4GMKA 4RBUA 3MFIA 3UDCA 4NRUA 3UNYA 2FC9A 1FRLA 2B4OA 2WB4A 5KFJA 1RADB 2NR0A 2E1AA 2QG9B 2WZ1A 1D1UA 3V81B 3M8ZA 3DLGB 1FJGF 4ZP6A 4HACA 5CABA 1RA7A 1M5KC 3VAGA 5H9EJ 2RKIA 2CPZA 3T1AA 1HL6A 2KM8C 4X4VA 2V9KA 1VQSA 1URNA 4NLXA 5B0BA 5HBMA 2DH9A 4LF6F 3VQTA 1JKHA 1J5EJ 3UCUP 2ZWOA 2E1RA 4WIQA 4EYIB 5EGYA 3KUEA 4RW9A 1RBOB 2P5VA 1RTHB 1X5SA 2XY6A 2XYGB 4CO3A 3D6MB 4OZ2A 2B8PA 4ATNA 3RW7A 4NLVA 2WB1D 3RB3A 4DV1F 2CZ4A 1YBAA 2QTWA 4K2JA 4OI1A 1VBZA 1RTDA 2ZE2B 2OEKA 1X60A 4DX7A 4C3MA 3I0RB 4CM0A 2RU9A 2IIHA 3ZTPA 3P5TL 3FMBA 2VG6B 3SZ2A 4LBIA 2HVZA 1BE4A 4Q8FA 3G6VA 2QGFB 2F4VJ 3UWTA 4FS2A 1K8AT 3IAM9 4V1Ak 4P6QA 2JWNA 1N8RT 2PE8A 1WF2A 2X1FA 4KO0B 1NK6A 2JEJA 3D1QA 3TQEA 2DD8S 1TU0B 2IRYA 2WK4A 3G82B 1CQMA 1Q8KA 3FSYA 1UPPA 2OIHA 1P9YA 2HS3A 3DU6A 5DDPC 1S76D 1KD1T 1NXIA 2KT5A 4DV3F 3ZZ0A 3IM9A 3KLIA 2HURA 1FWPA 2DITA 4I2PB 3F73A 1HNVB 1VOMA 4N8NA 2YNIB 4HHHA 2V8DA 1HI1A 4F04B 2RRBA 2OD6A 1GAOA 1SL0A 4KHPJ 1YG0A 2CJAA 1N48A 2RHQB 2FJEB 4K4SA 1QAYA 4FYXB 5HVGA 2XYHB 2W8LA 2AGOA 1QSLA 2R2SA 2MJUA 3DLJA 1CC7A 2IAJA 5IQQA 2WONB 4KIAA 1WUUA 4D3HA 2VV5A 2ZOMA 4Q0BA 1FFGB 5HQMA 4E0DA 1SJRA 2XLIA 1DTQA 4DPXA 3PR4A 3V6HA 4ZIWA 3W5YA 3DRPA 1YJVA 4FS1A 1SL2A 4WKYA 1JLGB 1BLUA 5EX3A 5D15A 2ALZA 3L95X 1O0PA 3EX7B 5HJXA 2OEJA 2GFFA 3X3UA 1SJ1A 3HK2A 1LK5A 1YI2S 1JJCB 1KONA 2Z2MA 3H4DA 5I42B 1AB8A 3CTRA 3KTQA 1U2CA 1R0AA 3NP5A 2UXBF 4WP3A 2F9JA 4EEYA 2A2DA 2EC0A 1CLFA 2PSZA 2KXFA 3KWMA 3UI3A 1PYTA 3TOQA 4ECRA 1L3TA 3SQGB 5M2PA 2XZTB 3R6LB 2ZH4A 3BGOP 4UOCA 1WG4A 3L3CA 5GVQA 5KAKA 2DRDA 5LT5A 3Q8UA 4HYKA 1X0PA 2K7JA 1AZSA 3LGMA 1DAXA 4DPWA 2ZH8A 4NA2A 1VBXA 1R27B 4K4WA 1UPMB 4UUWA 3A4TA 3I4PA 1F6TA 3TZXA 1VLOA 4IYQA 3TAPA 5T7LB 2B9YA 3RAXA 5B0DA 4F0MA 4LF7J 2JEGA 2CQCA 3J7AN 2DGUA 3NLCA 2IVYA 4YN3B 4UOFA 4I6YA 2CQ3A 3CIMA 4MFBA 4RNOA 2OMLA 4RW4A 1C1BA 2YQ3A 2Y8YA 2E66A 3OFHA 2YKNB 3CO0P 2C3YA 4FBTA 5IT9U 3MPDA 2CWXA 4WYLA 2BR0A 3CMQA 2W7PA 4C11B 1WTFA 3KDNA 3TEHB 3HFVA 2MKIA 3CCMS 1EKSA 3QIDA 3Q8QB 3MTJA 2C2MB 5KFFA 3OFEA 1S9FA 4CCHA 1UWAA 4Q2MA 1VDHA 4JB8B 4MK9A 1TP7A 4YMEA 1S6PB 3AQOA 1YZ6A 5KFTA 4HVZA 2IC3A 4PG8A 5A2QU 2RF2B 5MAOA 4PABA 4TQRA 3GG1A 2IHR1 3CDWA 2EW9A 1ZPWX 4J9LA 3GYNA 3QZ7A 4X2BA 2WBRA 5E33A 2FHKA 1Q8LA 3DRSA 3N79A 2X51A 2C2DA 3MR3A 1IXKA 2UUCJ 3NNCA 3DGPA 1JLBB 2DNRA 3LGNA 4NEYA 4FYWB 3TI0A 3MAAA 5F8HA 2L08A 5ETPA 4KPYA 1NJYA 4YY3J 4TY9A 4HDHA 4AFFA 4DSIA 2Q79A 2VU5A 1EETB 1HPZA 1TQLA 2FHJD 2IBOA 1YRXA 2DNOA 2XSJA 2KRBA 1HWIA 3BKTA 3EVWA 4WXWA 3W60A 2MGZA 3D67A 2MLXA 4K50A 5D0EA 1FTRA 5AE2A 2KJWA 3M05A 4R8UA 3JS9A 3LH2S 5K8PA 2C28A 4P52A 2IVMA 3FVYA 5L39A 2DISA 2WRMA 1N5TA 5D4LA 3NWRA 2QN6B 3OTEA 4QOTA 2UXCJ 3C46A 1V3RA 5BJRA 4QYZJ 2XMKA 3QNWB 5KT5A 3LPEA 4P9SA 1JX4A 1XTZA 2ZC4A 4ED7A 4R5PA 3AODA 5I4MA 2H4WB 4ZPVR 4IFVB 3GJTB 1OJ4A 4OYOA 1S12A 2K3IA 2LCWA 1N56A 1UFLA 3ENWA 5KFVA 4JI7F 3LP0A 2L9DA 4BDPA 2RB7A 3MR2A 3SEOA 2KRRA 3H90A 4O0NA 4FF4A 5LL6d 3LP1B 5A8RB 1GT8A 5K8NA 1FJ7A 3US5A 1TR0A 2CADA 4ER8A 2RH3A 4KKOA 5CXTA 4ID5A 3MF5A 3S1TA 1S72S 1ZM4A 3KLGB 1FERA 1XMOJ 4ZPAA 3P45B 4OHYA 3BSNA 2ZJRQ 3GIKA 2F1FA 1SJ4P 1BQXA 2HFNA 4DR5F 1T9XA 1GXTA 2HHPA 3HDSA 1RHJB 3J80Y 3CXCR 1T9VA 1UEUA 1JLAA 2GC8A 3KDOA 4TYAA 3BGRA 4ZVTB 3PR5B 4Z2XA 1YGYA 3OR1B 2RUSA 3DNCA 5FD1A 2AX1A 2JEFA 3SSRA 4C8LA 1TL7A 4JI5F 1OQ3A 2HRTA 2AZ3A 3PX6A 2XWYA 3CCQS 1ZM9A 5GAHU 1R3NA 1RKIA 3TEGA 2VA3A 4QW9A 5J2PB 3IXQA 2LXIA 2XNRA 4EMDA 3PW0A 4FF2A 3TX0A 4DR1F 4NXMF 2A18A 4KRWA 4CI0B 2DNPA 2BQRA 4ZPBA 1L3SA 3PJXA 1N5VA 3C6UA 2GGPB 4CZCA 3A8EA 3H20A 1IKYB 1IKXB 1NKCA 2HVDA 3H59A 3M7VA 4X64F 2RILA 2AP6A 1U1LA 3GSIA 3Q22A 4RW8B 3P49B 5K20B 1HBUB 3MI7X 2XG8A 4Z7YA 3FK4A 4BCAA 4OI2A 1N34J 4JV5F 1VRQC 2QLFB 5CYMB 2CPXA 2ZUAA 3T1HF 1X4BA 3JYTB 4J91A 1H73A 1RU2A 3WZ0A 4ZN3A 2ATLA 3DM2A 2Z58B 3DGVA 1NH8A 3UVJB 5KT7A 3CJKA 3H5YA 1EHWA 2R7SA 3KK1A 2VICA 3CCZA 5IWAF 1S9EA 3G8TA 1PCAA 5HQ8A 2Q43A 2R8IA 1KSPA 2W9BB 1P27B 1ZAWA 3ENAA 4LF9F 3A12A 3GWCA 1X8DA 2HAFA 3NMAA 4X65F 2W8KA 4AQYF 3OD2A 3I0SA 2HHQA 2B7CB 1C0UB 2F7VA 4QIWD 2F8HA 1AUSL 4TYBA 2GQQA 1YQHA 3ZO7A 1HI0P 2B9EA 4QW8A 3R5BA 4OJHA 2AKWB 2I9SA 3I87A 2NXCA 2DO0A 1HBOA 2D7SA 4NZ0A 3ZZTA 1H7XA 1R6VA 2JLEA 1QSSA 3WHIA 4U7UD 2K1RA 3WIVA 2GX8A 3R5CA 3J7YU 4DLEA 3I5BA 1U4BA 4HTJA 3I9ZA 3PJWA 3LAKA 1KTQA 4A8XA 3ITHB 4GVBA 4DCJB 4RLEA 2W4DA 2MQQA 3RRHA 4ECQA 1N32F 4I64A 2WHOA 4QJVA 3KK3A 4FVMA 3UE2A 4K5SA 2E5GA 1VQ9S 4WK3A 3CD6S 2ZDOA 2IM0A 2B43A 1NU4A 2C3OA 2HHXA 1SQGA 4ALZA 4A8WA 2V8HA 3OVBA 1FE4A 3GIMA 2MZQA 1WC6A 4PQUA 2ZH1A 4C6AA 3H42A 5KT4A 3VCDA 4ZIVA 1T03B 1RYSA 2GIFA 3BB5A 7FDRA 3FRZA 4NLOA 3GQCA 1VGYA 3GONA 2GHPA 4P2XA 3MECB 2VJVA 3MM5B 3M1VB 3CJ8A 2E9TA 3IGVA 2HMIA 1YJ7A 1BQNA 2GVZA 3CD7A 1SKWA 2VH7A 1IKWB 3VHQA 2VPZB 4LSNB 3UN5A 1JXVA 5KFGA 2XLJA 1S48A 3EPGA 2ZH7A 3BBBA 2F8EX 1UA1A 2U2FA 1KFDA 1K1SA 5K8MA 3C6TB 1B70B 5CQGA 3MEDA 1U8SA 4DV6F 2HHHF 3I56S 3MFHA 1SQFA 3M8PB 5L9XA 1H72C 3EE3A 5C25B 1UZDA 1TKXA 4OQJA 3R7NB 2FJWA 1N33F 2EBEA 1LW0A 3BPSP 1RWNB 1LWCB 2QLXA 5KFSA 1PBAA 2LMIA 3M2RA 3DLEA 1YJRA 2BMBA 1UZHA 4YR2A 5CZXA 2EFPA 1HQUA 5DZ6A 2M88A 3DOKB 6AT1B 4J9OA 1SJ3P 3TP2A 4C8ZA 5CCMA 3CT9A 5F8JA 2CPIA 4DR6J 2ROGA 2V34A 4K4TA 3TUPA 3F56A 1KC8T 3OJUA 1U25A 5KFAA 4Y34A 1PYSB 2AX0A 5HP1B 1CJVB 3IM8A 2J8SA 1P9QC 2FHOB 4DUYJ 2R8KA 1L5UA 4FP9A 1UL3A 1O6XA 4LR8A 2ZH3A 2H5IB 4CH7A 1GMWD 2DNNA 1FDNA 4QBUA 2OPPB 1R43A 3HVWA 1WOSA 5D0RA 1SI9A 4C8MA 3VZIA 1CSJA 3FZ2A 4Y6IA 4G1IA 3ET6B 2HVHA 2HQFA 3EM1A 3L7UA 3D66A 1K73T 1V6HA 2VKRA 3NS5A 2X7IA 4BHQA 2UUAF 2BEFA 4M5LA 4A8SA 3D3BJ 1Q7LB 1Y00A 2IYIA 2B56A 3UO0A 1C4AA 4XK8C 3VF0B 1UVKA 2QLWA 3WC2A 1HNXF 1ACMB 4DJBA 3MDFA 1DLOB 1WDDA 3IBWA 1RWKB 1T8EA 3CCRS 3CE8A 4URGA 4LF2A 2F9DA 2GS8A 1S57A 3LAMA 5J2NA 2YVSA 4QR2A 5AXMA 2VDHA 2DGVA 1D09B 2ZVIA 5F9LA 1O51A 2G2OA 1E6VA 3NS7B 2Y1LB 4DR7J 5D0HA 3MAHA 1RISA 3HX9A 2WTFA 1UTAA 1RLDA 3TJAA 4DV2J 1YBUA 2ZJPQ 3MAQA 5DGBA 2WVDA 2ZBCA 3V81A 2HWIA 2IA0A 3CMAS 3DDNA 2GW8A 4NOHA 2BM1A 2R8GA 1CJKB 3DLGA 4HH1A 3OT9A 2OAUA 4F8RA 4ILRA 2DR7A 3QAEA 3EJMA 1T3OA 2YQ1A 3MOZA 3LF0A 3MPYA 3ICLA 2RHSB 3CPWR 5LMUF 1MMLA 4FPIA 1L3VA 2LECA 1RT1B 3JTOA 3U1NA 3MCSA 4GKKJ 4IQMA 4WYWA 5A2QY 1DRZA 1LXNA 2V63A 2VOOA 1RTHA 5L1IA 3KJQB 2DGXA 3PYFA 4ZCKA 1WHXA 1JQGA 1YLXA 4OX9F 4XIUA 5A8WB 1NHUA 4ECSA 2G0CA 2R9LA 4ES1A 2ZE2A 4NLRA 1M90T 3V4MA 5A8KB 3H5SA 3I0RA 3D0GE 4ZP8A 3L09A 2DGTA 2VG6A 5HJYA 2RD5C 1T7PA 4CTAB 3T9ZA 2E1MC 1SV5B 3HSJA 4GC6A 3R5GA 4HI1A 2P9EA 1H6KX 3RBXA 1IQTA 1GEHA 3K5PA 4KO0A 4NXNJ 2BABA 4MH8A 3G82A 4JUZA 2ADBA 5EHHA 3DXBA 2QC3A 1RT2B 3T6JA 4YP3A 2H51B 1D9FA 5HN0A 2HNDB 5IFMA 1RABB 2AJ4A 3M8YA 4JYAF 1A9NB 4C3LA 3QT6A 5ITHA 1RDRA 3LANA 2CQ0A 1H2VZ 1R0BG 4PYDA 2OPRB 3UPFA 2BE7D 3GSDA 2XEXA 2DNMA 1PGZA 4I2PA 3SYZA 1HNVA 2MZJA 3PXGa 1VQOS 1F9FA 2YNIA 1SH2A 1KR4A 1BQMB 3QGHA 2AF6A 5F8LA 1SC4B 2W2PP 3CCTA 2VUGA 4Y0FA 2FLPA 3OV7A 2KTQA 1HHSA 1ZAVA 4NLYA 5F3ZA 3IWNC 4OHZA 3D6HB 4DCPB 4CH0S 2B3TB 3CCVS 5AE1A 2MMYA 2WONA 4LSLB 2C2EA 3FNNA 2MKCA 1BMQB 3GG0A 1TVRB 4YS2A 2IJFA 3FCHA 4JI6J 3PW5A 1J27A 4OX8A 2ACYA 1BC6A 3AT1B 2G2ZA 1PAEX 1JLGA 1B0VA 1YDLA 1NJXA 4ZPDA 5H9EK 3PACA 2VBXA 2DEJA 1PC4A 1I51B 1IR1A 3E8OA 4LFAJ 1RE1B 1EZZB 5B0AA 3HF5A 1OPIA 2IRXA 2K8GA 1VI7A 5I42A 5B0FA 5FDLB 3DYAB 3JTPA 2HIQA 1RAIB 4H4OB 4DV7F 3BQ1A 2A6OA 2D1CA 1HARA 3T19A 2Y0BB 1Q86T 2QV6A 4NRTA 3C66A 1NDLA 2W2OP 4WCEQ 1S1VB 4C7QA 5L1JA 5DJBA 3NKYA 4YFUA 5C42B 5HROB 3SQGA 1YBTA 3VR1A 1UFWA 2DHXA 3FEYB 4DX5A 3MUMP 2DHSA 2XNQA 3AOAA 4UQGA 4ELVA 1NJWA 2R42A 2VDIA 1AFIA 1WHVA 4LRBA 4JP8A 4PXDA 4I67A 3PW4A 1IBCB 1AW0A 4TKTA 4LVNP 4PXCA 5T7LA 2UV8A 2I6WA 1VRUB 1S10A 4FXDA 2XMUA 4MT1A 3QRQA 3X1LB 1AXQA 2DJWA 3TNVA 3OL7A 2FGCA 4AXJA 4O3SA 2XGQA 4Y65A 4CO0A 3LQVA 5BR8J 1QLNA 4LRDA 5BYQA 1RI7A 3W2WB 5C24B 4WFNQ 3TARA 3SV3A 1EIYB 2YH0A 4J90A 2YKNA 2MXYA 3NMRA 2RDIA 3W9HA 3KUGA 2PC6A 8ATCB 1VMBA 2ZHAA 1RJJA 4C11A 3H5UA 2V0NA 4B9MA 4W92B 5KG3A 3HT0A 3OFFA 3FJ2A 5J2MB 2JEIA 1JLQB 3K17A 1IR0A 4RUBA 2DHAA 3QATA 1V5VA 1U48A 3MPWA 4ELUA 2VD3A 4R0EA 3HSZA 1SXLA 4K4YA 4DR2J 1S6PA 1ZETA 3MM8B 4EUVA 3NGRA 2RF2A 4OI0A 3DN9A 5HMZA 5DG8A 1A7GE 3VAKA 5DGAA 1NKEA 1TUWA 1NM2A 2IMWP 2QO3A 2J6TA 3JQKA 4TXSA 1U0HB 2W01A 3NS6A 4OX7A 2HWHA 1PAUB 4NCAA 4DG1B 2BANB 3VVTA 1FJEB 4LFCF 3WC0A 4AL7A 2R7RA 4BC9A 3BV8A 2WOMB 1UETA 3N5BA 3AHPA 1YKWA 3TRGA 1T9UA 3HMJG 1JLBA 1SKUB 5A0YB 3QQCD 1RHQB 3G86A 1B3TA 4QU7A 4MK7A 1ZM3A 4C0BA 2WVCA 1TTHB 1B4SA 3BS9A 3EZOA 4LBPA 1RTZA 3TVKA 4K59A 1EETA 3LO3A 3HZGA 4DR4F 3CC2S 1HBMB 1FD8A 5LMNJ 4ZVGA 2MQMA 2HBYB 3MM6B 3FSXA 4USKA 1VJWA 4PG7A 5F0WA 2CG8A 4XDDA 3CWJA 2MKJA 3OFGA 1REGX 3I82A 2GAHC 4CLUA 3EGZA 1RTJB 4B9SA 2RVJA 2FJBB 3EWGA 3MURP 1RAHB 4OLOA 1T0TV 2UU9F 4JI4F 3FSIA 5KFHA 1XWLA 3E01B 2ZBIA 2AEJA 4KC5A 1UVIA 3OTDA 2ZUGA 2VL1A 3SQOP 1O5JA 2OKQA 4USVA 3Q23A 4IFVA 2P9CA 2V8VA 4LF8F 2ZHOA 4OI4A 1TK5A 2D9OA 4RNFA 2ZBQA 2R7XA 5GMKa 2KL8A 5T41A 3OXFA 9ATCB 1Q82T 3UR0A 3LP1A 1NPPA 5A8RA 1M0SA 3BN4A 2FLLA 1VQLS 3TA0A 1L3UA 3PO4A 4N77A 4M5DB 3QFWA 1OYDA 4HTIA 4DR3F 3O1LA 1Z2ZA 1GNKA 2SXLA 1V9OA 3BN7A 5KG6A 2W1BA 4ZJOA 2QRRA 2DT9A 2ZZMA 2XMVA 1SKRA 2XHCA 4QPXA 5KFUA 3AOCA 2E7VA 2MZTA 5IT4A 3OR1A 2YKPA 2LFVA 2HNYB 4FKYA 3QZ8A 3MCNA 4X84A 4ED0A 2HFZA 3R27A 3M8RA 4A47A 5ETTA 3BREA 2ZH9A 3OL8A 3Q86A 5J2PA 4X4TA 4P74A 4CLYA 1FCAA 4YHHJ 2MQNA 2KT3A 5CCLA 5C5JA 1DBDA 4NCGB 2GGPA 1LW2B 1PJ5A 5KFPA 4FF1A 1IKYA 2BW2A 1IKXA 1WELA 3CJ0A 2FZGB 2EFVA 2MHNA 4WFYA 4ES3A 2RNEA 1RT7B 3TJ9A 2O3DA 1MU2B 3CDUA 1NCLA 4RW8A 5GMDA 1ICEB 3QRRA 1HBUA 3MD3A 2M8HA 3GJSB 5CYMA 3ZNUA 2XC9A 4N56A 2MQOA 3JYTA 2HQDA 2R2RA 1R31A 4WBFA 3TUZC 3UVJA 1S1UB 1Q8IA 4USMA 4DHVA 2WVFA 4ZVFA 1R0CB 4F67A 4ED8A 1KWMA 3DXSX 2W9BA 4UZCA 4LF4F 2VG7B 1HYSB 5J2QB 3LGHA 1NK5A 3RGIA 1JMTA 4QYZK 4ENOA 1D0EA 1PYOB 3K0JA 1V3SA 3W1YC 2RQCA 1C0UA 1G4CA 1WG1A 2CUYA 3QT8A 3AXMA 4TY8B 4DSLA 4J9PA 4ELTA 4CRJA 1XR5A 4ZVEA 4LR7A 4ZCLA 4USUA 1VK3A 1RCXB 4UQTA 4NI2B 4YB6A 2FHJA 1CJTB 1HMVB 4IUFA 5E0OA 4L76A 5CHCB 5EN1A 4HKQA 2M7SA 1VQ5S 2BOPA 3PO5A 2ZC3A 2M5YA 1S4FA 3W8PA 3EDQB 2C2OB 1TL1B 4KT0C 2GIQA 3IR5B 3LPYA 1B99A 3ZZYA 1XJWB 2RRAA 5KT6A 2OD4A 3ITHA 2MKHA 3K57A 4DUZF 3S6EA 3MM9B 1RT5B 1APSA 6FDRA 4U9RA 2CQPA 3OTOF 4OHVA 4CO4A 5LJ5Y 3POTB 5ETNA 5D77A 2NLWA 3W9IA 5L1KA 3RR8A 2EKYA 1H3DA 2ZNZA 3RRGA 3HKWA 3GV5B 5HLFB 1HR0J 3BR8A 2E5LF 1WHYA 1BHNA 1SB6A 1VJQA 3M6VA 2E1PA 4NCBA 3L4BC 1T03A 2KJVA 4ZJLA 2ZH5A 4CLWA 5KFOA 4OZLA 4WE1B 4CLSA 2GO9A 4KGMA 2ZITA 3UDLA 3MECA 3MM5A 3M1VA 4CO1A 1KOOA 4DL4A 2VOPA 2I1RA 2M52A 2N7CA 1IKWA 3QO9B 5E7OB 2V4RA 4LSNA 4OHWA 2H5EA 4ICLB 4EO6A 3I32A 4F50A 3NGSA 4NXMJ 2VBYA 2QMUB 4JI8F 1NKBA 3L7OA 3QGPA 3DU5A 3C6TA 2AMCB 2DR6A 4MKYA 2HGMA 2R7TA 4JI1F 2J7UA 3QWUA 3M8PA 1EX8A 2ILZA 2QX0A 5C25A 1EB0A 5KOWA 1QUPA 3EVOA 2KFYA 3V6DB 1LWCA 4JI3J 4IG0B 4JI0F 3T9NA 4ANDA 2V5HG 4OHXA 1TZ0A 4ZPTR 4QR0A 2NUHA 2CPEA 3CULA 5IM0B 4UUXA 1U8WA 1GMUA 3SCLE 5DM7Q 2OPQB 4ZDNA 2IJNA 2EK6A 2V8GA 4X4UA 2ILYA 3DOKA 1OY6A 1SC1B 3BPDA 1X4AA 2CQ4A 2J6SA 2XZDB 2CYYA 5B0EA 4JBCA 4A8MP 2OFGX 2XULA 3N0VA 4HDGA 1TKDA 5HP1A 3D1HA 4KB7A 1CJVA 3SSQA 2F4FA 1U1NA 4DOZA 2MB0B 2MQLA 2KHCA 1WC1A 4C9DA 1N36F 4O0IA 4ECYA 3CEDA 1Q81T 3OL6A 4B9LA 5DM6Q 5B0CA 2YNFB 1S79A 2MQPA 4RX6A 2UZAA 2OPPA 1H7WA 3UD5A 4DFPA 3OL9A 4OJGA 3EZUA 2Z30B 3J7YI 2LU1A 3ET6A 1NNDA 3FZBA 2YWKA 5D4PA 4DU7A 4OZ3A 4ZLPA 3RBEA 2BJ3A 1G1XA 1HHTP 3M6UA 4HHUA 2AYGA 5C2CA 3CJ3A 4FYDA 2CJKA 3CUNA 3BYPA 2AYBA 1DLOA 3SI8A 3UCGA 2FVQA 3K89A 1BWEA 1N32J 4DS5A 3PKYA 1CULB 2YX1A 2QFJA 1YSJA 4K4XA 1RHKB 1ZH5A 1REVB 2MKSA 1DFDA 1J5EF 3OR2B 1X4HA 3SCKE 4NLUA 3SIPB 3AOBA 2RS8A 5IZHA 1B0TA 3W66A 1FWKA 3MEKA 2B4VA 3TO8A 1AFJA 3PJ9A 1RT4B 4DQRA 2MHEA 4QYRA 4Y2IA 3VAIA 4QWAA 4KGXB 1B7FA 1FXRA 4ED2A 4WU3A 1CJKA 1RAGB 3G9CA 2CZVC 2N4DA 4YB7A 2DHHA 4NA1A 2GZOA 2GHWA 2IFXA 3JSYA 4GO5X 3WIUA 4DEZA 3A8KA 4LJMA 2AHOB 3UN2A 2MEWA 4X4SA 3NCQA 2FIUA 2CKWA 4DFMA 2GQ2A 1RT1A 1FK9B 3PX4A 2IY5B 2NQPA 2PEHA 3TVZA 5HATA 3TUIC 4DV6J 2J7WA 2F3JA 1TV6B 1JXEA 3MZIA 2BRKA 3I96A 3GJQB 2QT7A 5A8WA 7AT1B 3PW2A 5KFMA 3TW0A 1RWWB 5FLXU 3KOAA 3NGKA 2AU0A 5A8KA 1R89A 3AD8C 1VYAA 3SFGA 4F4AA 2RE1A 1WOPA 5KG0A 4CTAA 4FN5A 2V4JB 1SV5A 4DQQA 2GHVC 4IH5A 3IAS9 5GADU 2R7OA 1ZPVA 1FJCA 4ZA1A 5IC6B 1VFJA 4KHMA 4KYZA 4DL6A 1MN7A 5F9NA 3BGLA 4KHPF 1NZAA 4JV0A 4IKAA 1UKUA 4DV4J 1RT2A 4FYVB 2B4PA 2HK2A 3MXHP 2EFNA 4K7QA 3ONQA 1XNRJ 3GFHA 2R2UA 1H98A 2HNDA 4DX6A 2FVRA 2HBQB 1S1TB 2QLBB 2JC0A 1N0UA 2OPRA 3C19A 2I0XA 4ZP9A 1S0VA 4ED6A 1ZS6A 4DV5F 2HFSA 3BM7A 4XTTA 2LEAA 4ZKAA 2DNKA 1B7YB 3JSBA 1DQ8A 2BE2B 2NPFA 1QAXA 5KFBA 1BQMA 3R1HA 2C3MA 1I1GA 3LALA 1U6ZA 2VFVA 2GQCA 1AROP 3CCJS 1FKAF 4F0KA 1H0HB 1TL3B 2BM0A 1OY8A 3CD5A 1XC9A 2C1EB 2CVIA 1U2FA 3MHYA 3BJYA 4WP9A 4IOAQ 2M2BA 1GMWA 4LSLA 2VZ9A 2QJ3A 2VBZA 1KQSR 5CYQB 4DWIA 1VBYA 2GMLA 5AT1B 3FBEA 1KQKA 1TVRA 1JK9B 1PJ7A 4C8OA 5BYSA 5ETRA 3ZC4A 1F0XA 4Y2MA 2Z2YB 4OL8A 3A13A 4I69A 4NLWA 2IM1A 2AT1B 4LBHA 2YBVA 3JXOA 2VODA 1FRJA 1RTDB 3PHEA 1GTEA 3GPAA 3NAIA 1NEEA 1NHVA 3BYRA 4CLFA 2HFUA 2PIIA 4EYHB 2D41A 3DLHA 5FDLA 3DYAA 1M1GA 4LF7F 2Y1JA 3QWPA 2P9GA 3EGNA 4RU2A 4FYYB 3PIOQ 1U1RA 4H4OA 3MMCB 2IPOB 2KFNA 4O3NA 4K0KF 3Q24A 3JTNA 5G0RB 1XNQJ 4K4VA 3MR7A 3HHDA 1F2GA 3AJ2A 4B17A 1VCTA 1I5OB 1S1VA 3SDEB 5C42A 5HROA 1JLEB 1JXLA 3G6YA 4NYPA 3EGWB 3P5BP 1BD6A 2DKOB 4IG3B 1S6UA 2DXFA 3QJLA 2C2RA 4OZ5A 3ZZZA 1H2TZ 2Y0SD 1VRTB 2DNZA 2RU3A 2DYAA 4IDKB 2CPYA 3CIZA 2R7QA 3PG9A 3IN5A 5JVGQ 3H2VE 1F60B 4NLQA 1N6QB 2AWZA 1VISA 3PKMA 1OIAA 2DRAA 1VRUA 4OZ1A 2WW8A 2YH1A 3BO2A 4X4PA 5H9FJ 2V9WA 3JQMA 3BR9A 4DPUA 2DGQA 4ZVOB 5F8IA 1KQFB 3G96A 2V50A 1CQNA 2FY1A 3J81U 5G4DA 3W2WA 5C24A 3ULHA 4OV1A 1NB7A 4LT6A 2EFGA 1YRUA 3N5FA 1KEKA 1KLMB 3GB0A 1X7VA 3Q83A 1SJQA 3GV7B 4RPFA 1FRIA 4TQSA 1WI8A 4ECTA 5J2MA 1JLQA 4JYAJ 2KZMA 1S99A 5D4NA 1Y9OA 2WSEC 1Q16B 4PXEA 4B9UA 1CS4B 4B3OB 1RTIB 3AA8A 3PNIA 2B9WA 5D3GB 3AD7C 3U7JA 5KFWA 3C3LA 2W7AA 3M9NB 4KQZA 3MM8A 4PWDB 2C3UA 4RU9A 2POKA 5AXNA 2YX4A 3DLLQ 3TYTA 3HFZB 2ZM6F 2C22A 1X4DA 4ZVHA 1U0HA 4PWWA 3QFHA 4DG1A 2BANA 5HK4A 2YKOA 1T05B 5J1PA 4EFAC 4B3MF 1RBAA 5B09A 4IRDA 1PILA 2WOMA 1KS2A 4HHJA 4ED5A 2UXCF 5A0YA 4JI2J 1TMMA 2XHWA 2C2NA 4ECZA 2HZVA 4UT4A 2DHGA 2YKMB 2KDOA 4OZJA 4TU9A 3PIPQ 4B9TA 2G13A 4HL9A 3KG0A 3H2LA 2OHDA 5DRKA 3UD4P 1WACA 2H1YA 1HNZJ 1EP4B 2O01C 2FJVA 1X5TA 3MM6A 2GJFA 4EZ9A 4N41A 3R5JB 3F0NA 1NRKA 3F41A 5DQHA 1W25A 1HD0A 1RTJA 1LWFB 2LXFA 4DV7J 2CWKA 3D28A 1HNWJ 4WTOB 3E01A 2MY8A 3DFEA 3HLUA 1Y5IB 3RBDA 1CC8A 1XMOF 3GFZA 2XWXA 1RHUB 2N3OA 5ADZA 4RUAA 2B6AB 4L75A 1U02A 3BQ0A 1U0SA 5IC4B 2GJ2A 1H2UX 2WBMA 5ETVA 1NDKA 1PKUA 5IXUA 3N9UC 2JZ5A 2L9WA 3R97A 1VQPS 1U2RA 3CD0A 2BKPA 1X4FA 1BGXT 1Y5NB 3OUYB 3NGTA 2MDAA 3QGGA 4RWXA 3KJFB 1FEHA 1TK8A 2QEXS 1MMDA 2CVEA 3IRXB 2O66A 2OSQA 3VQSA 1EQMA 2LA6A 4IFYB 2JC1A 1X9MA 3WQPA 1JLFB 1QDUB 3CJ4A 4F4ZA 4DSFA 4C8KA 4M5DA 1GK8A 2QL9B 3VAJA 4DXLA 4DUTA 2LYVA 5T14A 1XQIA 3ELHA 4Q44A 3OTBA 1F3FA 4WFAQ 1NLKL 2G0JA 5AJ3J 4DPOA 4O44B 4OYZA 5RUBA 4B3RJ 3H4BA 2HZCA 2FLOA 2HNYA 4ZLNA 4FF3A 2HGLA 1N34F 3NRBA 1XEZA 3EXCX 5B0GA 4Y2CA 4RBVA 1OQ6A 4DV0J 3CJQA 1S9GB 3EICA 4F2SA 3DLKB 2GA7A 1MN9A 4KJIA 3KHLA 1N0VC 1NHKL 4OZNA 2E5HA 4NCGA 1AUDA 1LW2A 3H2UB 4Q5VA 4UOHA 3NOGA 3VGUA 1NSAA 3LWMA 2QIFA 1RT7A 2GIRA 2OSRA 2PI4A 1KTVA 1MU2A 4C48A 8AT1B 2XS7A 4J9NA 3B4MA 3VAFA 4M94A 1RGVA 2V94A 1CPZA 4OZ0A 1JLCB 3WBZA 1UEKA 2O5DA 3MEEB 1I3OB 2E5IA 4DFJA 2Y1IA 2HGNA 4NEZA 1S1UA 2KG0A 6FD1A 4ZVRB 4DL3A 2QMXA 1CBKA 2IA6A 4MKBA 2CXEA 2KU7A 2P8IA 2VG7A 1HYSA 4B02A 5J2QA 4EK2A 4A8KA 1I94F 4MIBA 3VV2B 4OYXA 4ETZA 5GMEA 4DFKA 4E2FB 4NLTA 4JI4J 1R8AA 3KHRA 5CA5A 2DY9A 2BZ2A 1D8YA 3ILJA 2KFZA 4OYBA 1NMEB 2J76E 1HFEL 3QT7A 2JLFA 1WC4A 1WORA 4TY8A 1FXLA 2LQBA 3Q2TC 4RWWA 1ZZNA 3VALA 3GFXA 1RKJA 1C1CB 3CW2C 3R8YA 3RTVA 4NI2A 3QIPB 3H7HB 2J9EA 3PYDA 1CJTA 2FZCB 1HMVA 1LWXA 3CO9A 3DOLB 4NZ7A 4DI6A 4LF8J 4X66J 3SXLA 1HD1A 4P75A 2VC1A 1X9WA 2FVSA 1HIYA 3AAWB 3HJFA 4EU0A 1TL1A 4DDFA 2QA2A 4I2QB 2FDNA 1TFWA 2QZ8A 3A8IA 4DU8A 3MM9A 2FJAB 1RT5A 3U1LA 5J1NA 1GX5A 2ZD1B 1EARA 3POTA 2OPSB 2R4FA 2QL7B 3NXZA 4OMFG 2APOA 2YWEA 4C2MA 1UW4A 3NL0A 5LM7E 3CSKA 4WF9Q 4QIFA 5HLFA 1M5PC 4CLTA 2VB6A 1QVGR 1TAQA 7FD1A 3SMZA 3GE9A 3H0PA 2X1GA 1DTTB 2ALYB 3D54A 3MWBA 2NXEA 3LTOA 5F8NA 4NLPA 3KK2B 2ASDA 3BDPA 1IJFB 2J0WA 4WE1A 1V3ZA 2XM3A 4P10A 1FKPB 4RBTA 2VHGA 4I7FB 1LV5A 1Y0HA 2B4UA 2FZKB 2VJUA 2VC0A 4PRFA 4ECUA 4X62F 3ETMA 3T5HA 1NK0A 1VHIA 1WC5A 4KGZB 3NY0A 2FB0A 4DL5A 3QO9A 3K58A 3CVKA 4GO7X 4DSEA 1JJ4A 4ICLA 4G1QB 1YHQS 1U09A 2KI2A 4IR9A 3MOJB 1RAEB 2J7KA 4IQXA 2DPJA 4LRFA 5HMWA 3PY8A 2LQ8A 1ZOTA 3V6JA 4HT5A 2XYPB 1HWLA 3P3DA 3MM7B 3AQPA 2DNHA 2E7WA 4DUYF 4ZLLA 1FNOA 4YR0A 2AYEA 2AV5A 3QLHB 2K3KA 9RUBA 2RQMA 3V6DA 3GJRB 4U96A 2DIVA 2PEBA 1JNZB 4JV2A 2KHDA 1WEYA 4IG0A 3RU0A 5DDRC 2RS2A 1R7IA 2OH2A 1SJFA 5IM0A 3GIJA 2V6AA 2CJQA 3TAMB 4UF4A 4TU7A 3ZZPA 5KFDA 2OPQA 1RAOA 4J9SA 1LWEB 2CQ2A 3DI6B 4OJ1A 5KOXA 4H4KC 2BJ7A 5U47A 2V2ZA 4L3KA 2BJEA 3UFCX 2CZ9A 3HULA 4LSZB 3B4DA 3C15B 5EDWA 1G3OA 3NCPA 3B6BA 3K8WA 4XAKA 2C42A 3JSRA 1ITPA 1ULRA 3MCOA 4GKJJ 4ECVA 5KFYA 1MSWD 4P2FA 1AYEA 5ETOA 2DIUA 1MWZA 4WJBA 1R8CA 1UWBB 4C8YA 1C0TB 3R2CJ 2B51A 5JJBA 5E41A 4XPEA 2KYXA 1YJWS 2D3ZA 3CCES 1WSVA 3GTYX 2YNFA 4KV8B 4W98A 3A8JA 5LXYA 1QTNB 2A3JA 3FBFA 5KFIA 2P2CB 3DHWC 2NXUA 4W90B 3NCRA 3E3XA 3BEGB 2M4MA 2AJQA 4IRCA 4G1PA 1QAIA 4J9UE 2M8DB 1PSDA 2BUNA 3F44A 4DV2F 4R25A 2OEMA 1S7IA 2YXLA 3HHKA 2RSQA 4FZVA 1CG2A 1GMVA 3GU0A 2CJ9A 1U1OA 2Q66A 1CULA 3OTOJ 4K2XA 2HPUA 2BXJA 3M8QB 4CP5A 3M6XA 4YQWA 3FQLA 3L7PA 2HIYA 1PBUA 1VR6A 1REVA 3G6XA 3OR2A 2G1DA 2GMHA 2HNZB 3JAMU 1CJUB 3R5AA 3KG4A 4MAKA 4F3MA 4RW7B 1RT4A 4E98A 4WFZA 3NBPB 3NOCA 3W65A 3H40A 1U6FA 2DXEA 3TANA 1VIOA 2U1AA 1YK9A 4HT7A 2F40A 3OHBA 3FCWA 5AXLA 3P96A 5CD4H 5C7PA 5KG7A 4IO1A 4DMZA 3AJDA 4D3GA 4B3SF 2VFUA 1WJ9A 2COLA 2VQFJ 2Z8QA 2DVIA 1FK9A 1XIQA 2HVEA 3CMES 1F9EB 2HAIA 2LDIA 3J80U 2XQCA 1VQ7S 2PMHA 2DK2A 2AZ1A 1S49A 1IBMJ 2AW0A 3RAQA 2CPHA 4U7UK 1MROB 1TV6A 1KLNA 3ILOA 2YWWA 4L6V3 2LA4A 2CNKB 4CDIA 2YKQA 1DARA 3Q8VA 2R8HA 3VVUA 1N52B 2ERRA 4PPDA 2LDYA 3HHLC 1S6OA 4DSKA 5KFRA 2V4JA 1WHWA 1HQEB 4C0HA 1Q79A 4M5JA 1T11A 4ZJQA 1ELOA 3MUTP 1ZZFA 2KG1A 3N6NA 3O5TB 3MMAB 4GVLA 4NYOA 2Z57B 5A6PA 3EVMA 3E51A 3Q8SB 4YEAA 4OV6A 3FBCA 5DS7A 2UXDJ 4B3TJ 1N36J 4L74A 2AGQA 1YJ9S 4O3QA 1TUVA 4AL5A 4I6WA 4QU6A 2JNJA 3BBCA 2EPIA 2KYZA 1FD2A 4I0WA 1QM9A 3ADAC 1S1TA 1HA1A 2JRSA 2EFQA 5LSLA 2WCXA 1YWXA 4JI6F 1UFKA 4MK8A 2YWGA 2H3EB 2MTLA 5F8GA 1X5OA 1DQ9A 1YX2A 2BVZA 4MJKA 5JXSA 1QJHA 3MUVP 4JOUA 3KLVA 5LOQA 2LQ5A 2YWFA 2XTJP 4C3KA 2BE2A 3UCZP 4K4ZA 2B7BB 3CCLS 3ISND 4LFAF 1KN6A 3HD2A 4OIXA 2XMTA 1RSCA 4C98A 1P8GA 4QIEA 3KYLA 1TL3A 1Y5LB 4LQ9A 5A76A 3P4UB 2HVIA 2B8QA 4U95A 4PKDB 4O3OA 3BO4A 1GTHA 3QGIA 1NPRA 1OWXA 5CYQA 2ZFHA 2HZAA 3W5ZA 3ZTSA 2CG4A 4AUKA 3LUYA 3D4JA 4DL2A 3W3SA 2EEYA 3CJSA 5DZ7A 1XMQF 1AA1B 4PUOB 2LKZA 4HR2A 1Q78A 1WNEA 3IA0A 4WK1A 1OO0B 1C4CA 1TMJA 3HFKA 4XDCA 1XR6A 3P8BB 1U7LA 3VTIA 4F25A 4A8FA 3D1OA 3MMCA 4KY3A 2B0GA 2HQ3A 5IT0A 2YWHA 5BR8F 2PFDA 2J8AA 5G0RA 4PG4A 4MYTA 2CDRB 3SDEA 5IT9Y 1IUJA 1JLEA 1ZYQA 3D5MA 5GAEU 3OW2R 4IG3A 2DGSA 4CLZA 1FX4A 2IDEA 5IV4A 4J9QA 1Q4RA 2YNGB 5FIIA 3UQSA 1TK0A 2CJYB 1K44A 2GV1A 2J0XA 4AE5A 1UAWA 5DETA 1VRTA 2C2KB 1ZTWA 1HLWA 4IDKA 3C16B 2HHVA 4LFBF 1XN9A 1EQ0A 1N6QA 3HD1A 2Z0GA 5AE3A 4FBUA 5GADI 4DR2F 1Q7YT 3NG8A 4EBDA 1KBRA 2Q3PA 3CNQP 4ANCA 4ZHRB 1P1LA 5F41A 3UR3C 5HQLA 1FRXA 4I56A 1V5IB 2JH3A 3HPOA 3MR5A 5DLFA 2RUGA 4LF5J 4WZMA 2WSCC 3TWZA 2N7YA 4KAIA 1YJTA 3W5XA 2DR9A 5F8MA 1KLMA 4AT1B 4J7CA 1SC3B 1DQAA 4NX9A 2FHMA 3GYGA 1PC5A 3D2WA 2Q6BA 1E6YB 1N5YB 2W2QP 1TKTB 5E3PA 3ZTRA 2DNYA 1CS4A 2W24A 2Y8WA 4B3OA 4NLGA 1RTIA 1VK8A 2NREA 3M4XA 2CA9A 5D3GA 3THTA 4DV5J 2RIJA 2OO4A 4USHA 3IWLA 3EMTA 3W61A 4PWDA 2Z2LA 5LMNF 2MSTA 1B64A 1LKZA 2HK3A 2Y1RI 1RWPB 3AXKA 1UJ4A 4DPTA 3VGSA 2UUBF 3PZPA 2FD2A 2DGWA 4F4XA 2JHEA 1LQ9A 2XY7A 1T05A 2XS5A 4G65A 3D3CJ 4ZVSB 5A6WA 4RJVA 3C2PA 2MLYA 3R3TA 3TZWA 2HRUA 3HI9A 4QR1A 2YKMA 4CLLA 4ECXA 2ACMA 3IG1B 2CQ1A 4JV1A 3EYZA 4NE9C 1PO6A 2ZJQQ 1FF2A 3ZZRA 1VQMS 2FYXA 3DMJB 2B5JB 1EP4A 3UDEA 1RA6A 4FNIA 2X1AA 1RUSA 2E1CA 2XI3A 3M8WA 3JSMB 1W2BR 2M0GB 4U7CA 2DRBA 2E5JA 2UUTA 5I3UB 5IQ6A 3G2XA 3QYYA 2V8PA 2NSCA 3DDKA 2NPIA 4QZVB 1LWFA 1KDNA 4H54A 3UNGC 4ZK7M 5BXIA 4IH7A 3MPVA 4DQSA 4K0KJ 1K0TA 4AL6A 2YNHB 3DOMB 3GCXP 2VPWB 4YB1P 3UN3A 4CLPA 4RL1A 2XMAA 3VWSA 3AFGA 3NWGA 2D3O1 1XBWA 4M63A 3S8SA 3N6LA 1UA0A 3DHXA 2B6AA 5E3CA 5F0UA 2PT0A 3O44A 1FJGJ 4J5OA 2VQEF 3S01A 4O4GB 2FC8A 2RQKA 3THPA 4M5KA 5H9FK 1F9HA 3OUYA 4NMLA 1RU1A 2VG5B 1J5OB 3WX8A 1S6QB 4QWDA 2HS0A 3IR7B 3OVSA 3IRXA 3KHGA 4LF6J 4Z7CA 4NL5A 3VGVA 2XBPA 3GILA 4HH0A 1KQGB 3MMBB 5GAGU 4IFYA 3FMWA 2WW4A 1JLFA 2W2NP 4YHHF 2UVVA 3M2UB 1Y10A 1FA0A 4LRCA 3RYLA 5M2UA 4Q2LA 4KTQA 1JWWA 2X1BA 2C2ZB 4DV1J 1MWQA 2XLKA 2W9CB 3OHAA 1M5HA 1VQNS 3I4HX 1VQKS 4O44A 4X4QA 2F65A 4A8YA 2W2MP 1RAJA 1X0FA 2NXNA 2IYGA 1JB0C 3KLFB 1RACB 2QFIA 4CT9A 1MG7A 1KVKA 2JJ4D 2XMWA 4PCQA 4NWBA 4N8OA 3BGUA 1LNQA 3J7ZT 2AJ0A 4KH1B 1HWKA 3PHTA 4PEOA 1IBLF 2D74B 1S9GA 1S77D 3N01A 2UVWA 5I3QA 1A6LA 3DLKA 1Q1KA 2ZM6J 4WXOA 3HHLD 4MYUA 3Q89A 4U8YA 4ILMA 3CJRA 4OYWA 1JJ2R 4Y28C 5DDOC 4NASA 1S97A 4B3MJ 1SH3A 4PG6A 2A1BA 4DV3J 2CIMA 2BJ8A 4M8LA 2BJ1A 2XCAA 4LF1A 5L9NA 4HLBA 2ZZTA 2E9RX 2N4CA 3PTWA 4USWA 3K5LA 4J9MA 2VKZG 4OYPA 3R7BB 1JLCA 2V67A 2KZZA 3MEEA 2CDQA 3TAQA 4E8UA 2NUUG 3MD1A 3JAMY 3HVRA 2XZWA 2A10A 3OQ2A 2ROPA 4CLKA 1TELA 5ETLA 4FXWA 4H4MB 3HSGA 2J9DE 5THWA 1UVMA 2N3LA 2EC2A 2KB2A 2LXUA 2ZOGA 3V5RA 2FVCA 4RNHA 2AD9A 3FGVA 4CYUB 4RNNA 1C1CA 2DO4A 2FUG9 4U6PA 1HR0F 3QIPA 3SFUA 3ENVA 4M5NA 4ITSA 1S0MA 4B9VA 2EG2A 3DOLA 3MMJA 2NCKL 5HVFA 1JJHA 2XMMA 1H38A 3HKZD 3ZXWA 1RWUA 4EO8A 2UXBJ 3G6ES 4A8QA 4I2QA 1WD6A 1WG5A 4X4OA 5HVHA 3HZEA 2MPUA 1UVNA 2ZD1A 4I1TA 1Z1ZA 5D0GA 2OELA 2OPSA 1RAFB 4QIVA 1BUXA 4EZ6A 1T9WA 2H48B 3C14B 5FJ4A 1QAJA 3HCXA 3GLJA 1FVSA 3GIIA 1WWHA 2LVWA 1Q8BA 2BKOA 2MKYA 2XB2D 3LA0A 2NZ4A 1DTTA 1RT6B 1UMJA 3KK2A 5EX0A 1K0VA 4WP8A 1FKPA 3QT5A 5KFEA 3B8HA 1SUQB 4JI3F 2MZRA 4I7FA 2MLZA 4Z37A 3TA1A 4FNHA 3M6WA 4BWMA 2FVPA 5K9FA 2I2YA 3GZ7A 1ZA2B 4NA3A 3KLGA 2WAQD 1DZ5A 3Q8PB 2AIRB 3FFIB 1K9MT 4EBEA 4F3OA 4G1QA 3ZZUA 5CZVA 2HQIA 3OTCA 3S7RA 4K8RA 2DTJA 2W7OA 2QA1A 1MMNA 2GMJA 3BSAA 1N88A 1EKRA 3VGTA 3M32B 2W25A 3B54A 5DO2A 2CFXA 2UV8G 3JB9k 2ZHBA 3MM7A 4CNYA 2I8EA 1RXOB 1S1WB 3LP2B 5KFQA 1IKVB 3SV4A 3QLHA 2G0IA 3J7A1 1SC6A 1NZ8A 2WSFC 4B9NA 1LXJA 4DN0A 2ZWPA 3KLHB 1U24A 2X3DA 4Q43A 1VC5A 2RJZA 1UW9A 3RB6A 1IBKF 2DH8A 3TAMA 5EWFA 2J9CA 1LWEA 3DI6A 3HO1A 1T9TA 4RW6B 3KKFA 2Q1LA 1T95A 1QE1B 3D6FB 5KG5A 3HHLB 3PEHA 2UUWA 2R7VA 1Z4UA 5DG7A 3C15A 1FKOB 3GFYA 1QY7A 5E3AA 1KNZA 3KLEB 5EWGA 2QLJB 1I94J 2R8JA 1FRMA 4KSEB 2XSFA 3OXLA 2ZEJA 1FDBA 4DSJA 2OI2A 2V68A 1UWBA 1C0TA 4G3IA 3KMQA 4USTA 1D9AA 4A8OA 1Q5VA 4UW2A 4KV8A 1UJ5A 4QIGA 4FPRA 4EBCA 2BX6A 2CNLB 2BJDA 3BDEA 1N5QA 2DXDA 2OFHX 2MJNA 4HEA9 2K06A 4ED3A 2DY1A 4NLDA 2M3DA 3MPUB 5J1EB 2EKNA 2R7WA 3N28A 1W26A 4P72A 1SVDA 3V6KA 2V69A 2J6UA 3QRPA 5DLGA 2NZCA 1FFSB 4P7VA 3W2VB 4EI2A 1VC6A 3M8QA 3G8SA 4ZVPB 3DLBA 4ERDA 2ZVSA 3KNAA 3T1YF 2A6MA 2PD1A 4X4RA 4OYMA 2DPIA 1JIHA 3KJNB 3M30B 4Y00A 2AJ1A 2BE9B 2HNZA 1CJUA 2KM8B 2QE5A 4M95A 4LQ3A 2Q6CA 4JI7J 1VQYA 4RW7A 2PMWA 3UD3P 2ZH2A 3MEGB 4ZITA 3NBPA 3HP6A 3OXGA 1XMBA 1X4CA 3TZZA 2XY5A 1EJ7L 4OFZA 4X62J 3NNHA 2VFRA 1FHTA 4DZDA 1M1KT 2WVEA 1NPKA 1S7HA 3K2YA 4I68A 2VONA 2CQGA 1RLCL 2YX7A 5KFLA 1AT1B 4DR5J 2VF3A 3CF5Q 2A0FB 2FLNA 3IWXA 1SIWB 1FX2A 4M1KA 1FTCA 2P6TA 3PV8A 1HW9A 4USJC 3RG6A 2QSWA 4U8VA 4DV4F 1MROA 3A3NB 3J7Z5 5GAHI 2B9XA 4YOEA 4V19X 4JI5J 1XNRF 1FRKA 2XMJA 2UVRA 4WFXA 2L41A 3KJVB 2PFFB 4DR1J 2KN4A 1S59A 1HQEA 2LEBA 5HAOA 1O8BA 1S0OA 4M5GA 1GFWB 4NYZA 5E5NA 1RWXB 3WX4A 3FUYA 4KGVB 1RWMB 1NK4A 3MMAA 4X64J 3EDRB 3M2VB 2OLWA 2BJ9A 1D8ZA 2G2YA 2UP1A 2YPYA 5KFKA 2AGPA 1X31C 3NGUA 5ETQA 1W2IA 3HVTB 2EK1A 4JV5J 1RT3B 2G1HA 2BRLA 2OUGA 3T1HJ 4KHRA 4C4WA 3RAMA 4M5IA 4KGKA 4J9VA 2BYCA 3A1YG 5IWAJ 3TJ8A 3PYEA 1HI8A 3N4WA 1UVLA 1FESA 4ZVUB 1CEZA 4LF9J 2LP4A 4CO5A 4X65J 1HBNB 1OMSA 4AQYJ 4A4JA 5K14B 4YUDA 4CH1A 3BSCA 1G6BA 2HHUA 1NK9A 5JUMA 1FFWB 3VAMA 4EGLA 1S5ZA 1Y11A 5ETSA 2VPYB 3CCSS 3EGVA 4OI3A 1M5SA 4RNMA 2IMOA 3B78A 2QYCA 1RB0A 4Y3CA 2HQGA 5KG1A 3BH7B 3O8WA 2H4YB 2BV3A 4RO0A 4RUCA 1XNQF 1YZ7A 5CYJA 2CQDA 3GMGA 3R2DJ 3W9JA 1WKJA 3OJSA 4J37A 3OSNA 3QSIA 1QD1A 1TKZB 4DQPA 1U45A 3FRYA 1Y7PA 4FKXA 2N82B 2R2TA 2IVFB 4Q8EA 2PA3A 4PUOA 4DF8A 2V2VA 2VFSA 4TNOA 4F4KA 2EI5A 1VLYA 3DRRB 2DR8A 2OP5A 2W4CA 5JVHQ 1FDAA 2MKKA 1YITS 5HL7Q 5KFNA 5ETMA 2I5JB 3PM9A 2PI5A 1WI6A 2ROEA 3EXYA 4B3SJ 5K5MA 1Z2LA 3V2UC 3T5LA 4N5SA 4ZCIA 2D3OR 1S1XB 3PEJA 3PFOA 1FE0A 3HXMA 3LWLA 2KXNB 1FDDA 4Y2KA 2IDLA 1IWAA 3SSSA 2KKHA 5B08A 4ZPCA 4K5RA 2H54B 3CJ5A 3IFEA 3W8GA 2YNGA 2VA2A 3HT3A 1KHVA 4KFBB 4IOCQ 2W4PA 1EAYC 3C16A 3AH6A 2Z2ZA 3D9BA 1U6BA 1U1KA 2F4VF 1Y3KA 3Q2SC 2FQQB 3TUJC 3IGNA 2FGOA 1LFWA 4J9KA 4ILLA 2HEKA 1VQ8S 1RK8A 1YJNS 4WU2A 2NS1B 5KFXA 4K4UA 4ZHRA 4WKRA 1X9SA 5H1SV 3RW6A 2HHHJ 1HNIB 2PA8D 3OLBA 2NYHA 2JDJA 2P6SA 1FT8A 3DC2A 2ASJA 3DRXA 2GVDB 3M9MB 1N33J 2JSXA 1ROFA 1WC0A 4A48A 1FNMA 5B7WA 4TLRA 1T9YA 1K47A 2ASYA 4S0MA 1MLAA 4USIA 3CCUS 2HHWA 3V4IB 2NXJA 2KVIA 3D68A 4CNZA 4DN9A 1E6YA 1N54B 1BY9A 1F3VA 1H74A 4JI2F 4UY8T 1N5YA 2CPJA 4FDFA 1TKTA 1R8BA 3RB0A 4QQBA 3OBIA 4W4MA 3CDEA 1VQ4S 1HW8A 2VASA 4F2RA 3ISZA 4M5HA 2EBGA 2PDAA 3I9V9 1TL4A 1HNZF 3GYXB 3AY0A 1RCOB 3GV8B 1X5PA 1IQZA 4BLGA 4MKAA 3TZYA 5DG9A 2XI2A 5BYRA 1FVQA 4FVCA 3BF4A 3VAHA 2OMOA 4PQAA 3CDBA 2DCLA 5L38A 4QCLA 4CT8A 3IS9B 4MIAA 1T02A 1MNEA 5HSPA 1HNWF 3WDOA 2CJBA 2ZOFA 3R7SB 3ZTOA 4KR0B 1R6YA 3PW7A 2UUAJ 3IG1A 5HO4A 3K5OA 3AB2B 5SZTA 3U02A 3TVYA 4YB5A 2KT2A 2DNQA 1LFPA 3DMJA 2B5JA 1IM6A 1HNXJ 1DJ0A 4HACB 2VFTA 4DLGA 1XMQJ 2RKIB 1UP1A 1GXUA 3JSMA 3HHEA 1P1TA 4ZLJA 1RQ0A 2FTRA 1KVIA 2GCFA 4G6VB 5I3UA 2JL9A 3BSOA 1BWVA 4N47A 5HBMB 2V4QA 4ES2A 1JKHB 3RBZA 2G4BA 3CDAA 4ZCMA 1N4LA 1NUEA 4I6AA 1TL5A 2RMLA 3A3PB 5MLCV 3FKBA 2E9ZA 2RDJA 4RW9B 2ZDPA 2HQCA 2YNHA 2QA4S 3DOMA 1U1MA 5GAEI 2CJXB 2DNLA 4DL0C 3QMQA 3FQKA 2VBWA 3K7RA 2LLZA 4AD6A 5AJ3F 3VZHA 1RBLA 1LOUA 4V19J 3CC7S 4O4GA 4B3RF 4YDXA 4N76A 3CC4S 2J0SD 1ZA1B 4LFBJ 2CPDA 1OSCA 5ETKA 2KO1A 5LMUJ 2EVZA 2VG5A 3A3OB 1P6TA 1J5OA 3BO3A 1J2VA 1S6QA 1Y4ZB 2YY3A 3MMBA 3DKDA 3H98A 4DV0F 1GH8A 2GJIA 1NSQA 3DCAA 2CNNB 1S4EA 3M2UA 2LQJA 2AQ4A 4OLPA 1UEVA 1VIXA 4OX9J 4DQIA 1R8PA 4F4YA 1NAQA 2ZBRA 2W9CA 3W7BA 2BBEA 2GO8A 1ZM2A 5HMXA 3T3FA 1OSDA 3RR7A 3KLIB 1I6JA 1RHMB 2ATCB 4KH0B 4F26A 1VS3A 3IRWP 1RP5A 1X4EA 2QA4G 3KLFA 4AYBD 2ZKTA 4ED4A 4ZS6A 4PXBA 1TAUA 4IR1A 4FXVA 1NJZA 1ZTTA 3O3LA 1ZBTA 3HJVA 3NNAA 2QSFA 2LQ9A 3THVA 4MIWA 3DRYA 2UUCF 4CIOA 1IN0A 2J9DA 2EG1A 2UUBJ 4P2SA 1IJEB 1GX6A 2HHTA 3UDVA 4ZN1A 2IAJB 3I5CA 4F3QA 3FEXB 2K7KA 1WKLA 3O6QA 2H9ZA 1G2EA 4Q0BB 5L46A 1WOOA 2Z4PA 3Q8RB 2CQHA 1DTQB 2DEIA 2MYFA 4YY3F 1GXLA 2FPHX 5HMYA 3DRPB 4LREA 1VBKA 3PRDA 2F8MA 3B82A 2QYGA 5AXKA 1Q0NA 2RQ4A 3BBFA 1NJIT 2LU2A 1KKHA 3IO1A 3AB4B 4NPOA 4QPTA 3N6MA 1TFYA 1ZAXA 4IH6A 4L3NA 4X66F 1RAAB 1NK7A 4KBIA 1N5SA 2O1PA 1IWGA 3T5KA 3DDIA 3R5DA 1F2HA 3H5XA 1R0AB 3O2IA 2JFDA 2M9KA 2DR5A 3KFWX 3BKFA 4H4KA 3NEKA 4H4MA 1KHWA 1UCNA 5IV3A 3CB4A 4P7TA 2JVRA 3Q0AA 5LSRA 2RDDA 3OLAA 2PO4A 1XERA 3P6YC 1NSPA 3RZAA 4CYUA 1WKKA 4IOBA 3I5AA 2IM3A 1RHRB 1HBMA 1AZSB 3D7SB 1WF1A 3QJPA 2FY8A 1D9DA 2D9PA 2H5JB 1S0NA 1LK7A 2CQIA 5LSOA 2VQEJ 3QBCA 3QSYB 2CAJA 1IVZA 3OSPA 2PGCA 2VIHA 1WSRA 2X3GA 5GAGI 4BC7A 4WZQA 4MFBB 4OI6A 4BS2A 1M5VC 1MW7A 4RW4B 1QSYA 1C1BB 4YR3A 2V2KA 1FI4A 4ANEA 2PN6A 4C97A 3C14A 5D4OA 4URSA 1SL1A 1LEOA 2IBKA 2MZ1A 4LR9A 3T6BA 4ZOSA 3EZ5A 3KMSA 1IM4A 1YVFA 2O67A 4IRKA 2HLUA 1YTYA 4CWBA 1FEEA 1RT6A 4DS4A 3K5NA 3I55S 4TLQA 4WIIA 4GC7A 4DZ6A 1SUQA 4RR5A 1DY3A 2IC3B 3GR0A 1NO8A 4KPCA 1FO1A 2RT3A 1YRTA 5KG4A 4RZRA 4OJ3A 5L1LA 5KFCA 3FFIA 1IBLJ 2H65B 3EUNA 4LIWA 4CQ1A 2Z56B 2NSBA 3DRSB 4WPAA 3HHNB 2DGOA 2E44A 2FJDB 2A2CA 3K8VA 3M32A 3BGFA 3L9ZA 4UY85 2BKNA 4QWEA 3DGPB 4L73A 4GKJF 3W63A 4Y2AA 3MAAB 2RRNA 3CJTA 3U27A 3IBCB 1S1WA 3SCIE 4F7VA 1RWVB 1DURA 3LP2A 1IKVA 2GNKA 2L48A 4QWCA 5IS2A 2HG4A 2HKEA 1HPZB 2XSJB 3BZQA 2EXUA 4UZBA 2MGZB 3KLHA 2KH9A 4NZ6A 4OX6A 3CJ2A 2BDPA 2I38A 4XO0A 4O4RA 4R8UB 2XO6A 1FNXH 2XS2A 2IM2A 3G8QA 3GIRA 4Q7AA 4RW6A 1XR7A 4LFCJ 1QE1A 1NDCA 2IJRA 3HHLA 1BXNA 1NSKL 5K8OA 1FKOA 2HFOA 1RZMA 1IR2A 2Y3YA 1SIZA 2HBZB 4RUHA 5DQIA 3KLEA 3OPKA 3G87A 2OTLS 1WTBA 4BWJA 1NDPA 3PCOB 4F36A 3RUBL 3ISNC 4L72B 4R5PB 1WF0A 1HWUA 1OY9A 2DBBA 4DR4J 3MTKA 2M70A 2CQBA 3H25A 3LW5C 2HW3A 3PVXA 3LP0B 1RWOB 4I4BA 2UVUA 1CVJA 5DQGA 1KVJA 5J1EA 2BOAA 4DCOB 3ZZOA 4RKUC 3BKUA 5E2QA 3PRVA 3KUHA 5CH7B 3HSDA 4LVOP 2UU9J 4KKOB 2AEMA 4ID5B 5E3RA 2C3PA 1GQEA 1OPZA 3AD9C 4PPZA 1U49A 2NYIA 4B08A 1L3KA 2DB1A 1F5AA 2QL5B 1KRPA 4UTGA 3W2VA 3AJ1A 2MY7A 1YJUA 5HI7A 3M9OB 4PWUA 1SBRA 2VQFF 4ZP7A 5I3PA 1U47A 5HANA 4TVAB 1SKSA 3G71S 1K1QA 3M30A 1NH7A 1NK8A 1JLAB 3LOUA 1IBMF 3BGRB 1C2PA 1TUGB 4P71A 1U1PA 4P73A 2E29A 1B0PA 4ZMMA 3MEGA 2MZSA 1KP6A 4O3PA 1TL7B 2AYMA 1Q53A 3JQJA 3G4SS 4J9RA 3TR5A 5FLXY 3D0IE 2R7UA 1MWYA 5KFZA 1SPBP 2ZBPA 2CNOB 4DBQA 4DR3J 3IC1A 5SUHA 3C6UB 1FRHA 1T94A 4C8NA 4LMZA 3BH6B 2R3VA 4PZVA 1Y3JA 3RRKA 5D6GA 2ZKUA 3ZNJ1 1PIEA 2OTJS 2JFKA 4XPCA 4OYIA 1F5CA 3GCWP 2ASLA 3SCJE 1U1QA 4BBYA 2AJ2A 2UXDF 4ED1A 1HKAA 5CD4A 3ILLA 4B3TF 2HHSA 5KT3A 1JNRB 1UJ6A 1M1HA 1HHQA 3E2EA 3DM2B 1U26A 3CJKB 2XCPA 1WEXA 3FDSA 3KK1B 3KJVA 2J5AA 1Q5YA 2DCUB 1IBKJ 1S9EB 4DR6F 2F5GA 1OS5A 2HYIB 2CRLA 3ILIA 5C2GA 3PFEA 4LRAA 3I0SB 2ZZNA 4DF4A 4C0OC 3M2VA 4WWSA 5LJ3Y 4URQU 3TQ1A 3NAHA 4PYAA 4DL7A 1HBOB 3HVTA 3IMQJ 2J0QD 1RT3A 3KG1A 1HQ2A 1VHFA 3D6TB 2JOQA 2K1RB 1YIJS 3R1LA 1HWJA 3T41A 2QMWA 2E7XA 2EFOA 3EPIA 4M5MA 3MGJA 4KE5A 3KXDA 3QJJA 3GR1A 2GAGC 2KVQE 1W7WA
chains in the Genus database with same CATH topology
3MM6A 2FVPA 5K9FA 3CGIA 2DH7A 2I2YA 3GZ7A 4ID8A 4NA3A 3KLGA 4EZ9A 4N41A 1D3WA 2WAQD 1HBNA 4GC6A 1DZ5A 2L9NA 2CPFA 3Q8PB 2DNGA 1M5OC 3FFIB 1NRKA 3F41A 4HI1A 5K14A 1K9MT 4PR6A 2P9EA 4EBEA 3K59A 3KK3B 1H6KX 5DQHA 4F3OA 1IQTA 3PRBA 5KG2A 4G1QA 1W25A 1HD0A 1RTJA 1LWFB 2MSSA 3K5PA 4KO0A 5CZVA 3ZZUA 2K2PA 2HS4A 2LXFA 2HQIA 2BABA 3OTCA 4MH8A 3S7RA 2DTJA 2W7OA 2QA1A 1MMNA 2GMJA 3BSAA 3UW1A 4LIRA 2VPXB 3OVAA 4JUZA 1N88A 2HRYA 3D28A 2ADBA 5EHHA 3DXBA 3M32B 4A46A 2W25A 3K5MA 3E01A 4LUBA 5DO2A 2MY8A 2CFXA 1RT2B 3T6JA 3DFEA 3HLUA 4ECWA 1Y5IB 3RBDA 4YP3A 3TA2A 1CC8A 1XMOF 2BA9A 4F4WA 4DR7F 2UV8G 3JB9k 4PQUB 2ZHBA 3MM7A 1D9FA 3GFZA 4CNYA 2XWXA 2I8EA 1S1WB 2PMZD 2N3OA 5ADZA 5HN0A 2HNDB 5IFMA 3LP2B 5KFQA 2AJ4A 1IKVB 4RUAA 3SV4A 4JYAF 2B6AB 3QLHA 1A9NB 3BQ0A 4MMOA 4C3LA 2BACA 5ITHA 1RDRA 3LANA 1FXDA 2CQ0A 3J7A1 1H2VZ 1SC6A 2GJ2A 1H2UX 2WBMA 2WSFC 1QUVA 2OPRB 3UPFA 3MR6A 1X4GA 4B9NA 1LXJA 1TKZA 4DN0A 3GSDA 5IXUA 3N9UC 3KLHB 2JZ5A 2L9WA 2XEXA 1U24A 3KNGA 4DX8H 1VQPS 2BQUA 2DNMA 4Q43A 1VC5A 1PGZA 2RJZA 2JLGA 3RB6A 1IBKF 2DH8A 1U2RA 4I2PA 3CD0A 3SYZA 1X4FA 3TAMA 1HNVA 2HMIB 5EWFA 1BGXT 1BQNB 2J9CA 2MZJA 3PXGa 1Y5NB 3OUYB 2MDAA 1VQOS 1LWEA 3DI6A 3QGGA 4RWXA 1F9FA 3HM9A 2YNIA 3ZFVA 3HO1A 1SH2A 1KR4A 1FEHA 2YKAA 3DRRA 4RW6B 1BQMB 3QGHA 2AF6A 5F8LA 3KKFA 1TK8A 2QEXS 1MMDA 2CVEA 2Q1LA 2O66A 1T95A 2OSQA 3IRXB 5F3TA 3CCTA 2LA6A 1QE1B 2VUGA 3VQSA 5L8RC 2JVOA 4Y0FA 2FLPA 1SH0A 5KG5A 1RYRA 3HHLB 3PEHA 2UUWA 3OV7A 1Z4UA 4IFYB 4TN2A 2KTQA 2R7VA 2I5JA 5DG7A 1HHSA 2ZH6A 2JC1A 1X9MA 1ZAVA 2HLTA 2ADCA 1FKOB 4GKKF 3PDNA 4NLYA 3GFYA 1QY7A 1JLFB 5E3AA 3CJ4A 1KNZA 5F3ZA 3IWNC 4OHZA 3KLEB 4F4ZA 4M5DA 4DSFA 4C8KA 3FEZA 2LEPA 4CH0S 3VAJA 2B3TB 5EWGA 4O23A 3MEDB 2ZNYA 3J81Y 2R8JA 1FRMA 1URRA 4KSEB 3CCVS 5AE1A 1S1XA 2XSFA 2MMYA 2LYVA 2WONA 3OXLA 4LSLB 4CO2A 1FDBA 3QPIA 4DSJA 2C2EA 3FNNA 1UWBA 5T14A 1C0TA 2MKCA 3IR6B 4G3IA 3KMQA 4LF5F 1D9AA 2BQ3A 4Q44A 4A8OA 3GG0A 1TKXB 4EWTA 2G9OA 4UW2A 1TVRB 3OTBA 4KV8A 1UJ5A 4WFAQ 3RB4A 2ABYA 2IJFA 4QIGA 1KFSA 4DPOA 3FCHA 4FPRA 4O44B 1QVFR 1LW0B 4EBCA 1XK8A 2FJXA 2BJDA 3BDEA 2XGPA 1N5QA 3ETOA 3PW5A 3H4BA 3M2RB 4OX8A 2ACYA 2HZCA 3DLEB 2D3UA 2IRUA 2OFHX 2FLOA 2MJNA 1BC6A 3I31A 2HNYA 1JLGA 4HEA9 3AA9A 1HQUB 1B0VA 4KFBA 4FF3A 3I6PA 5EWEA 2HGLA 1N34F 3ENQA 1NJXA 4ZPDA 3NRBA 4ED3A 3PACA 2VBXA 4NLDA 2M3DA 5J1EB 1PC4A 3C8YA 1XEZA 3E8OA 1SQEA 4Q45A 3EXCX 4MTPA 3U1MA 4IO9Q 2R7WA 5B0GA 3N28A 2L3MA 5B0AA 3HF5A 1OPIA 2IRXA 4Y2CA 2K8GA 3HVAA 1VI7A 4RBVA 1OQ6A 3V6KA 1G7CB 5I42A 5B0FA 1S9GB 5FDLB 3DYAB 3JTPA 4NLSA 2HIQA 4F2SA 4NXNF 3DLKB 5DDQC 2GA7A 4H4OB 4DV7F 5D78A 3KHLA 4KJIA 2J6UA 1WEZA 3BQ1A 1N0VC 5DLGA 1HNIA 2D1CA 4OZNA 4P7VA 2E5HA 3BQ2A 1HARA 4NCGA 3W2VB 1VC6A 1AUDA 4YDDB 3T19A 1Q86T 3H8YA 3M8QA 1LW2A 3D0HE 3G8SA 2QV6A 5KTQA 4PG5A 4NRTA 3C66A 3DLBA 3H2UB 4Q5VA 4ERDA 4WCEQ 1S1VB 2ZVSA 4C7QA 5KT2A 3T1YF 3KNAA 2PD1A 5L1JA 4X4RA 5DJBA 3NKYA 3LWMA 2DPIA 4YFUA 5C42B 5HROB 1JIHA 3M30B 2QIFA 3SQGA 1RT7A 3VR1A 2GIRA 5LXRA 1UFWA 2OSRA 1DHMA 1KTVA 4Y00A 2AJ1A 1MU2A 2HNZA 2PI4A 2DHXA 2KM8B 3FEYB 2QE5A 4M95A 2XS7A 4LQ3A 3V4IA 3MUMP 4J9NA 2Q6CA 2DHSA 3CCWA 3B4MA 3VAFA 4M94A 2XNQA 1VQYA 4R0JA 4UQGA 4ELVA 5D8HB 3NGDA 1NJWA 1F5BA 4RW7A 1RGVA 2V94A 3UD3P 3PX0A 1CPZA 4OZ0A 1AFIA 2ZH2A 3MEGB 1WHVA 1JLCB 2AJFE 4QWBA 4PXDA 4I67A 3NBPA 4ETXA 3HP6A 3PW4A 4O3RA 4TU8A 3WBZA 4WFBQ 2O5DA 3MEEB 3OXGA 1XMBA 2E5IA 1AW0A 1X4CA 4TKTA 4DFJA 4AXIA 4LVNP 2Y1IA 4PXCA 2HGNA 1VQ6S 1S1UA 2KG0A 5T7LA 6FD1A 2UV8A 2XY5A 1VRUB 1S10A 4FXDA 2XMUA 1QTMA 3T5JA 4DL3A 2YTCA 3X1LB 2KXHA 4OFZA 1AXQA 3M8SA 2DJWA 3NNHA 2VFRA 1FHTA 3TNVA 3OL7A 2FGCA 2QMXA 1M1KT 1S7HA 4AXJA 4O3SA 2OJ3A 5EUHA 4ZPWR 2EWHA 3K2YA 4I68A 4MKBA 2IA6A 2XGQA 4U67Q 4Y65A 4CO0A 2VONA 2CQGA 3LQVA 4HI2A 2KU7A 1QLNA 2VG7A 5KFLA 2YX7A 1HYSA 1T3NA 5BYQA 4B02A 1RI7A 5J2QA 3W2WB 5C24B 4WFNQ 3TARA 2HWTA 2JX2A 4A8KA 3SV3A 1I94F 2YH0A 3TX8A 4MIBA 5J2NB 3CF5Q 4F02A 2YKNA 4ETZA 2W9AA 2FLNA 3IWXA 4DFKA 1SIWB 4NLTA 2MXYA 1R8AA 3KHRA 5E3QA 4X4NA 5CA5A 3NMRA 4M1KA 1FTCA 2BZ2A 1D8YA 2KFZA 2XO7A 2J76E 2P6TA 2RDIA 1HFEL 3PV8A 1HW9A 2PC6A 3IS9A 2JLFA 4USJC 4TY8A 1VMBA 2ZHAA 1FXLA 2LQBA 1VC0A 1RJJA 1E6VB 3Q2TC 4RWWA 5M2RA 1ZZNA 2QSWA 4C11A 4WTYA 4DV4F 3H5UA 3KHHA 3VALA 2V0NA 3GFXA 1RKJA 4B9MA 1UVJA 4W92B 1MROA 1C1CB 1R8HA 1KOHA 3QAUA 4GMKA 4RBUA 5KG3A 3RTVA 3OFFA 3MFIA 3FJ2A 3UDCA 4NRUA 3J7Z5 5J2MB 3QIPB 5GAHI 2JEIA 1JLQB 2FC9A 2J9EA 1FRLA 2B9XA 2B4OA 4YOEA 2WB4A 1IR0A 1HMVA 4V19X 2DHAA 5KFJA 3CO9A 1XNRF 1FRKA 2NR0A 1U48A 2E1AA 3MPWA 2XMJA 4ELUA 3DOLB 4NZ7A 1D1UA 2VD3A 4R0EA 3V81B 1HD1A 3SXLA 2UVRA 1SXLA 4WFXA 4K4YA 2L41A 1S6PA 2VC1A 3DLGB 1X9WA 2FVSA 3KJVB 1ZETA