4WKRA

Larp7 wrapping up the 3' hairpin of 7sk non-coding rna (302-332)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
SRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords La-related protein 7
publication title Structural insight into the mechanism of stabilization of the 7SK small nuclear RNA by LARP7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 40
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wkrA02
3CPWR 1RKJA 2PEHA 2LA4A 4YOEA 2DIUA 1X4DA 3PIPQ 4UY8T 3P6YC 2I38A 3S01A 2MKJA 3Q2TC 3P49B 4IOCQ 3NNHA 1YWXA 4Y00A 1PGZA 3CTRA 3ULHA 3VAMA 3SMZA 5DDOC 2MQLA 2CQIA 2DGSA 2M9KA 5D77A 2MJUA 3RW6A 2JVRA 1HA1A 2DH9A 1ZZNA 3R27A 1VQOS 1WHVA 3MD3A 1K73T 2DHXA 3CUNA 2FPHX 2K8GA 1UAWA 3CCES 2E5HA 2GO9A 2OSQA 1S72S 3UD3P 1BY9A 2DGUA 2RQCA 4CIOA 2DNLA 2EK6A 2NLWA 3SDEA 1YIJS 4F02A 2KG0A 3MURP 3MUVP 1N8RT 2MY7A 3MDFA 1QVFR 1WG4A 1SJRA 4YB1P 1U1QA 2BOPA 2JX2A 4PR6A 1WG1A 2OIHA 2KXFA 3SDEB 1VQPS 2VODA 1X0FA 2KRRA 4WFNQ 5LXYA 4CQ1A 2LQ5A 1YJNS 2OTJS 3EGZA 3G9CA 1U1OA 2DK2A 1YJ9S 1DRZA 2F9DA 4WFAQ 2DNYA 1U1LA 1FJCA 2LXUA 2O3DA 1X5OA 3CCMS 2CQHA 3B4DA 1WHWA 2DHAA 4FXVA 5HO4A 3THTA 1L3KA 2DO0A 2X1AA 4WKRA 3UCGA 3VAKA 1SJQA 1H2TZ 1U1RA 1VBYA 1U1PA 4FXWA 2XS2A 3CMAS 2DGQA 1X4FA 1WI6A 1SJ3P 3JB9k 2CQPA 2MMYA 3S8SA 3VAJA 2F9JA 2E5GA 2MZRA 1RK8A 2KXNB 3IRWP 2CPYA 3EGNA 2DNMA 3S6EA 3CMES 2L08A 3CULA 3SXLA 2BZ2A 4A8XA 3DLLQ 1W2BR 2RQ4A 1VC6A 4LMZA 3MUMP 2KM8C 4C4WA 1YTYA 3U1MA 3N9UC 2B0GA 4QU6A 3J7YU 2MQNA 3G8TA 1A7GE 3I55S 1VQ7S 2Q79A 2CPFA 1HD0A 2MSSA 1WEYA 1KC8T 2HGNA 2VOPA 5GADU 2KM8B 2YH1A 2ZJQQ 2KG1A 2XSFA 1PO6A 1QVGR 1SXLA 2F3JA 2VONA 5JVGQ 1FJ7A 5GAEU 2CQ3A 2L41A 2V94A 4RU2A 2MZQA 1H6KX 1N52B 3D2WA 3L3CA 2MKHA 1OPIA 2FHOB 2X1FA 2MGZA 1X4GA 3HI9A 2FY1A 1P1TA 3IWNC 2CQ1A 2GHPA 3K0JA 1X4HA 2ERRA 2DNHA 5LSLA 3G4SS 5DETA 2D9PA 2KU7A 5DM7Q 2HGMA 2LYVA 3ZZZA 1O0PA 5H1SV 5JVHQ 2DNNA 2LEAA 2YWKA 4IOAQ 2E5JA 2M0GB 4WCEQ 1YITS 1FHTA 2UP1A 2YH0A 2ADBA 3CXCR 1U1KA 2SXLA 1X4AA 1KOOA 2CPHA 5GAHU 3G71S 2MQQA 2M2BA 2CQGA 1HL6A 1CVJA 2M7SA 2CQ4A 4Z2XA 2MQMA 2KYXA 1N88A 2JRSA 2HZCA 2DGWA 1JJ2R 4C7QA 3UD4P 5DDQC 3PIOQ 3LPYA 2M4MA 5DDPC 1M5VC 5DDRC 3J7ZT 2XNQA 3MI7X 4LJMA 2DGVA 2MB0B 2RUGA 2LCWA 5CYJA 1UP1A 2RU3A 2X1BA 2CQCA 3CCRS 2MJNA 2D9OA 2M70A 2RT3A 2DNZA 2HYIB 1M5KC 3CC4S 1VQ4S 4W92B 4QQBA 1KD1T 2J0QD 1OIAA 1X4CA 1URNA 2DNGA 4TU9A 2QA4S 1B7FA 4ZKAA 2DNRA 3THPA 1M90T 2ZJPQ 2RRAA 3ZZYA 1U6FA 1WF1A 3CCQS 2MHNA 1Q86T 2KFYA 4BS2A 1FT8A 1H2VZ 4QPTA 2YKAA 4J5OA 2MZSA 1M1KT 3CF5Q 2LKZA 2X1GA 2KRBA 3G6ES 2XNRA 2J0SD 2CPJA 2J76E 3TO8A 1M5PC 4OZ1A 3VF0B 3P5TL 1WHXA 2U2FA 3BO4A 3CCVS 2RS2A 2N7CA 4TLQA 1K9MT 2MKSA 1VQ5S 4CH1A 1JJ4A 3CC7S 2MZJA 3VALA 1DZ5A 2G4BA 2K3KA 2MZTA 2I2YA 2CPXA 1ZZFA 2DNKA 1VQ8S 4IO9Q 2PE8A 2E44A 2YTCA 1IQTA 1Q82T 1WF2A 2AYEA 2AD9A 1OWXA 3HHNB 2J8AA 4WFBQ 2LXIA 3G96A 3CCLS 5ITHA 1X4EA 2RVJA 1H2UX 1DBDA 2DHGA 2MSTA 2MQPA 3VAFA 3CCUS 2LEBA 1HD1A 1NO8A 2FC9A 5CA5A 3OW2R 3MUTP 1U1MA 1VQ9S 2NZ4A 3Q2SC 3R1LA 3CCSS 2LMIA 4ERDA 2DIVA 2MKCA 1WTBA 3MXHP 4PRFA 4WF9Q 2MQOA 2MGZB 2M8DB 2WBRA 1WWHA 2CPDA 5MLCV 1QM9A 2CJKA 3CCJS 2HVZA 2M8HA 3FEXB 3U1LA 3NNAA 1WEZA 1U1NA 3UCUP 1NU4A 2KI2A 2CPEA 3S7RA 1JJHA 2DHSA 3VAGA 5LJ3Y 4UQTA 3UWTA 2CPIA 1VQMS 1OO0B 1F9FA 1Q81T 5LXRA 3G8SA 1DHMA 1WG5A 3H2UB 4YUDA 2OSRA 2MPUA 2DITA 2M52A 3MD1A 1KQSR 2EK1A 1P27B 1UFWA 1N54B 3UE2A 1YI2S 2XS5A 4LIRA 5GMKa 2CQDA 2MY8A 1VQ6S 2CQ0A 1S79A 2JWNA 1YHQS 1JMTA 1UW4A 1WI8A 1FJEB 1VQKS 2AYBA 2RRBA 2CQ2A 2CPZA 2DB1A 2KHCA 2N3LA 4WIIA 3FEYB 4C0OC 2DGXA 4OZ0A 2N82B 3BO2A 3V4MA 5D78A 3VAIA 2KXHA 2RS8A 2MKIA 2QFJA 1VC0A 2U1AA 2DISA 1U2FA 3P3DA 4F25A 3NMRA 2DNOA 5GVQA 3US5A 1M5OC 2VOOA 4W90B 1FNXH 1A9NB 1KOHA 1ZH5A 4P6QA 1WHYA 2DH7A 2XB2D 1R8HA 1VQNS 2HGLA 3RW7A 5LSOA 2G0CA 2N3OA 2FC8A 2G1DA 1SJFA 1D9AA 3VAHA 3TYTA 1K8AT 2EVZA 3CD6S 2DGOA 1U6BA 1NJIT 2DNQA 2DO4A 3CC2S 5LJ5Y 4EGLA 2A3JA 2DGTA 5FJ4A 1AUDA 1FO1A 1WEXA 3B4MA 1X5TA 3DXBA 2KH9A 1VBXA 2ADCA 1R8PA 2MXYA 4U67Q 2KVIA 3BEGB 3NS6A 2XS7A 2MYFA 5IM0A 4CH0S 2AYMA 1D8ZA 2DNPA 1X5SA 2RNEA 3NNCA 1VBZA 5GAGU 1VQLS 3R1HA 1XN9A 1SJ4P 1YJWS 5CXTA 5IM0B 2OTLS 5IFMA 4Y0FA 1G2EA 2JVOA 1WF0A 1VC5A 3BS9A 3H2VE 5HL7Q 4ED5A 5EN1A 5BJRA 1Q7YT 1FXLA 1X4BA 2MKKA 2OJ3A 2KN4A 2KT5A 2ZJRQ 2AYGA 3MOJB 2QEXS 4PKDB 3UCZP 2M88A 4TU7A 2D3OR 2LECA 3TP2A 4V19X 2LA6A 3I56S 1X5PA 2DH8A 4TU8A 2E5IA 4QU7A 2MZ1A 2CQBA 3LQVA 1WELA 2L9WA 3NS5A 5DM6Q 4IUFA 4F26A 5IQQA 3EX7B 3BO3A 4M5DB
chains in the Genus database with same CATH superfamily
3MTJA 3WDOA 1T9VA 1KSPA 4FBUA 3KMQA 4NA1A 1RT2B 3T5HA 3JYTA 4OHWA 2E5LJ 1NK4A 4LF9J 5DDOC 4U8VA 1H3DA 2DGSA 1DQ8A 1DFDA 4CRJA 2V5HG 2DH9A 4Y28C 5L39A 3DM2A 2VG6B 1HLWA 3N5FA 4ZP7A 1CJTB 3R27A 1KWMA 5T14A 4ZPVR 2WB1D 3KLIA 1VDHA 3ET6B 2E9RX 4DR4J 4K5RA 2B9XA 3MM6A 4RWWA 4YB1P 1S1VA 3BYPA 4DZ6A 1DTTA 3QT5A 2VODA 4TYAA 3LOUA 4CQ1A 1YJNS 3HF5A 1O8BA 2KT3A 4ANEA 2A2DA 1N5YB 3K7RA 3D0IE 3B4DA 2Z56B 4EEYA 1DLOA 3Q89A 4ZN1A 1IKWA 2X1AA 2VQEF 4YHHF 3VAKA 1FRMA 1U1PA 3LANA 3LP2B 2PIIA 5ETOA 5HBMA 4KH1B 2I5JB 4CDIA 5DG8A 1KNZA 4FS2A 1Q5YA 1XMOF 1JLGA 4J9OA 4Q45A 2CJQA 5KG3A 4ELUA 2FVPA 5J1EB 3DDKA 1JLQB 3J7Z5 5E3QA 1V9OA 2V94A 2AKWB 2EEYA 4NX9A 4RL1A 4A8QA 5ETTA 3R6LB 3GCWP 2YX4A 4Q7AA 3FGVA 4WK3A 5I3UA 3AOBA 2MTLA 3CJKB 3EM1A 2M0GB 3T1AA 1YITS 1RAAB 2ADBA 1NK8A 2IAJB 2Y0BB 3VQSA 3PFEA 4LF5F 2YKNB 2A18A 4MYTA 1HWUA 2KYXA 1N88A 1WC0A 2RD5C 2DD8S 3MECA 4Q0BB 2PA8D 3ZTPA 1NHKL 4OZ3A 1U24A 4CM2A 4MKVA 2O66A 2M70A 4IDKB 5C2GA 3RAQA 1TELA 4QWEA 2DNGA 1B7FA 4CZCA 1S97A 3BF4A 1IM4A 2G2OA 1U8WA 2VFRA 4KHMA 4GO7X 5HQMA 3PHTA 2KKHA 4DBQA 3EE3A 4F67A 1A6LA 5LM7E 3RZAA 3PCOB 3BREA 1HHSA 3M30A 3BBCA 3ELHA 1FTRA 1YBUA 9ATCB 2XMKA 2N7CA 3OSPA 1REVB 1ZPWX 1K44A 4PXEA 1GTEA 1CQMA 1ZTWA 2E44A 3FMWA 4QR1A 1NBEB 3HVTA 2AD9A 2G2YA 4RW9A 5MAOA 3UN5A 2V2ZA 2Q1LA 3FVYA 5A8RA 3VCDA 4DI6A 2NREA 3EZUA 1KQFB 1AB8A 5CA5A 3T1HF 3FCHA 4ES1A 3KK3A 2BJ3A 2WSFC 2C28A 2F65A 4JI3J 2PGCA 2CPDA 2QLXA 2B5JA 4Q8EA 1UJ5A 3IAM9 3EDQB 4PG5A 3NNAA 3GV5B 3H25A 1NU4A 4K7QA 1RWMB 4EU0A 2RMLA 4RZRA 2DITA 2J9CA 2W1BA 3AJ2A 2XY6A 3FZBA 3AHPA 1FDAA 3SI8A 4GVBB 4X4UA 3JTNA 1U48A 4LSZB 2FVCA 3SQGB 2J8SA 2OFGX 3NAIA 5J2QA 1JXEA 1KOHA 4U7UD 2IA0A 3K89A 3C2PA 3TYTA 3OD2A 2PMHA 3QT8A 3R2DJ 1FO1A 2HBQB 3GTYX 2ADCA 2EXUA 1RWWB 2QLJB 2HQFA 3IBFB 3IN5A 2Y1LB 1VIXA 3IBWA 2R7OA 2C3UA 3QGPA 3SEOA 4JV5F 2B9WA 1NPPA 2WHOA 3KK1B 3OTOJ 4IG0B 4OX9F 2NPFA 4LF8J 1HNVB 2ZKUA 3H4DA 4HT5A 2DT9A 1XNRJ 5HJXA 4ZP6A 3AB2B 3CJRA 4TU7A 4P2MA 2XTJP 4TU8A 4PWDA 1MU2B 2YVSA 2VG7B 2MZ1A 2HVIA 1NAQA 4AXIA 4F26A 3BO3A 4V1Ak 2UUBJ 3OLBA 4YOEA 4O4GA 4ZVSB 2V2VA 4K5SA 1J5EJ 2ASJA 1YWXA 3QLHA 5EHHA 5D3GB 4G3IA 4JV1A 2MJUA 3PG9A 3JYTB 1HA1A 1HIYA 2YNIB 4QZVB 4IKAA 3OFFA 1VQOS 4DV5J 5E5NA 3H98A 3W1YC 1UPPA 3TA0A 2ALYB 3CJSA 3MURP 2AJ0A 2B3TB 2UUTA 2JX2A 4F8RA 4C48A 2ZD1A 1AROP 3A3OB 2ZHBA 1S0NA 2V50A 2V8VA 1DTTB 2DNYA 2YNFA 1FJCA 1A0OB 5D4PA 2HPUA 2JC0A 3MPUB 3BSOA 2V69A 1J5OB 3CCTA 3DKDA 4YFUA 4PWWA 3UNYA 4FYXB 1VBYA 4DOZA 2B9YA 2VBYA 2HNDA 5CZXA 1IKWB 4ZVHA 4F2SA 1RK8A 1JLAA 3IRWP 1T9XA 1D09B 1XJWB 1BWEA 3SXLA 1FE0A 1RP5A 2FZKB 4DU8A 3MM5B 5HBMB 4M5LA 2RJZA 1UWBA 2MQNA 4CLLA 1JLGB 3DCAA 1SIZA 2RIJA 4JI1F 5GADU 3GU0A 2KG1A 4FKXA 2YXLA 4WYLA 5JVGQ 2C42A 2P6TA 4NASA 4FPRA 3D2WA 2GV1A 4EBEA 1OPIA 2WVFA 3BN4A 1RWVB 2OP5A 1YBTA 4K50A 3M7VA 4OZLA 5HATA 4U95A 4TQSA 5JVHQ 5I3UB 1NK9A 1ULRA 5HROB 2VD3A 3MAQA 3CIMA 3IR7B 2M2BA 3GYGA 3DMJA 1WKLA 3CJQA 5AJ3J 1NHUA 4C7QA 5C7PA 5DDQC 5F8JA 2XNQA 4NCGB 3DRPB 5B09A 1UP1A 4QIGA 3EMTA 2D9OA 2JSXA 5E33A 3QIPB 2E1AA 2GJIA 1Q95G 1R8BA 3AQOA 5B08A 3THPA 2ZM6J 4O3QA 1WUUA 2HLTA 1JKHA 2HKEA 2D7SA 4KGZB 1FRJA 3IFEA 3QMQA 1FT8A 2E7XA 3M8PB 5CAAA 4KH0B 2HNZB 2RAQA 2CJAA 3CJ5A 3D54A 1TKDA 4KPYA 3FMBA 3IAS9 4ATNA 3DOLB 1KVIA 4ID5B 3PO5A 4B02A 1JNZB 2AMCB 2K1RA 4DCJB 2V8PA 2XLJA 2MLYA 3J80U 4ZK7M 1BQMB 5L8RC 2Q3PA 3W64A 1IKXA 3G96A 2DHGA 3HVTB 3M1VA 1PJ7A 4O3OA 4ILMA 4H4KA 4IFVA 3PDNA 2MKCA 4DV6F 2DRDA 2YWWA 4WBFA 2YWEA 4DS5A 3RB6A 1RB0A 3I4PA 1D8YA 2QFIA 2B5JB 2CPIA 2R3VA 2ASLA 2PMZD 3OL8A 4DL5A 1PBUA 3UE2A 2ZH5A 3AB4B 1YI2S 4N41A 5HN0A 2J6TA 1PAEX 2F8MA 4X84A 3CSKA 4EWTA 2J5AA 1OY8A 1UJ6A 4J9VA 4DF8A 4KKOB 3O2IA 3W2WA 3MEKA 1SL0A 4K4SA 4S0MA 5IOLA 4DV0J 4BDPA 2MKIA 1U2FA 3P3DA 4RBTA 3AD8C 4RPFA 5KFYA 3FQKA 4ED6A 4HHUA 1R0AB 3UN2A 4KAIA 2FC8A 1SJFA 1F3FA 2QA2A 4JI6J 3D0GE 3W65A 3R7SB 3KOAA 1E6YA 2OD4A 1ZETA 2MYFA 3A3NB 4DS4A 1N32J 2BRKA 1VBZA 5GAGU 3OR1A 3KJFB 4TKTA 4URSA 1S0MA 3K58A 1HNIA 4QIEA 1V3RA 4NLXA 1HQEA 2EC2A 3I0RB 3UCZP 1LV5A 2JOQA 3QRPA 1VI7A 2DH8A 1AT1B 3AD9C 2W2QP 1PC4A 4ICLB 5C5JA 3CPWR 2YPZA 2LA4A 3DLBA 2JC1A 2GFFA 1FKOA 3KJQB 4O4GB 5KFZA 3QGIA 4X4TA 2RDDA 2HWHA 3QLHB 1VHFA 4Z7YA 3C15A 3H20A 2ZNZA 2K8GA 4UTGA 1BY9A 3F44A 2VL1A 1S99A 3BSAA 1Q8BA 2FJBB 2E5LF 2BKOA 5KFNA 4LF9F 3TR5A 4WFNQ 3G9CA 1U1OA 4J90A 1F9HA 2HQ3A 2F9DA 4PG6A 4WU2A 2BMBA 2RQMA 4DR4F 2XWXA 3LGHA 4M1KA 2DO0A 2XMTA 4NI2B 2HFOA 2AIRB 3VR1A 2E5GA 4ZPCA 4ZITA 2HNDB 3PX4A 1YJRA 3DLLQ 3UW1A 4OYOA 3U1MA 1JLAB 2B0GA 2WVDA 4R0JA 3CJ3A 3M6VA 4P9SA 1MNEA 1RABB 5GMEA 2VA3A 3H8YA 2CPFA 3DI6A 3Q83A 3NL0A 1UWBB 2H5EA 2V0NA 5DZ7A 1PO6A 3PXGa 3BGOP 2MZQA 2V4JA 2Q66A 3O6QA 2PN6A 3IRXA 2MKHA 3CT9A 2BQRA 4B9TA 1OYDA 2OPSA 5LSLA 4C8MA 4IH7A 2FLNA 4EO6A 1ZPVA 2BE9B 4KGXB 2QMXA 1OJ4A 3NS7B 3WC0A 1S76D 4DSIA 2HHHJ 2E7WA 4NL5A 2ZH7A 4LR8A 3K2YA 4LF2A 1KVJA 4KHPF 4KIAA 1D1UA 3DMJB 5JJBA 2GJFA 2R7VA 2DR6A 4O23A 4USJC 5HMYA 1EP4A 1DTQB 2XMAA 3K57A 1C1CA 2FVRA 2HYIB 1M5KC 5DRKA 3LGMA 3MHYA 2CADA 3DC2A 1JLEA 1WF1A 3ZZPA 2KZMA 3EPGA 2BJ9A 4DV7J 1DAXA 1TKXA 2K2PA 4B3SJ 1JKHB 3HHLC 1M1KT 2QL9B 4U8YA 3W3SA 1B7YB 1Y7PA 3R9LA 1NNDA 2KRBA 3IGVA 2LQBA 2DTJA 3VF0B 3CCVS 5LMNJ 1U45A 2F40A 2VUGA 4M5JA 2ZFHA 1R6YA 3LPEA 4OI1A 2CJ9A 4JB8B 4MFBB 4N8NA 1FEHA 1H73A 4OI4A 4B3TJ 2AX0A 4RX6A 1LXNA 1VQSA 2D74B 4OYBA 2XQCA 3M8QA 1HQ2A 4X66J 4ELTA 4DJBA 1OSDA 4WXOA 4ERDA 2B4PA 3M1VB 2YKMA 2R8JA 3I5AA 1JB0C 5KFMA 2M8HA 1WEZA 1S77D 5AE1A 3FSXA 3W9IA 3S7RA 1JJHA 3CDWA 4QW8A 2QA4G 3J81U 3NCQA 3KLEA 2IM0A 1EB0A 2KFZA 1F3VA 3MR7A 1X0PA 4JI3F 1LK5A 4KE5A 1RAOA 2GMLA 4WWSA 3CGIA 3GG1A 1UVNA 3JQMA 3L4BC 2OHDA 1WKKA 4RNHA 1CS4A 3CDUA 4X2BA 1EARA 3HVWA 5T41A 4EFAC 3FEYB 3IMQJ 3V2UC 4TY8A 3QAUA 1JLBA 1RT5A 5D78A 3VAIA 3L7PA 2WVBA 2BYCA 3W2WB 5AXLA 1M5OC 3GIRA 4CO0A 1R6VA 1QSYA 3TWZA 4DSJA 2LQJA 2EVZA 1IKVB 4JYAJ 2NSCA 2QJ3A 4PPDA 3CC2S 3W61A 2IM3A 4UQGA 2XS7A 3RRKA 3LAKA 3WX8A 1E6YB 4HACA 2ZH8A 1VQLS 4O3NA 1SC4B 1LW2A 5FLXU 3VGVA 1KLMB 1UFKA 4H4KC 1X9MA 5KFHA 1HNIB 5KFTA 2DBBA 4OJ3A 2FIUA 5HQ8A 4OJHA 4ECWA 2L9WA 3CNQP 5EDWA 1RTZA 5ETVA 2XMJA 2QTWA 3HSDA 1Z2ZA 2IYIA 3OTOF 4LF8F 1LWCA 3Q2TC 3T3FA 2E1RA 3PYDA 1XNRF 1HBMA 1RHUB 2JH3A 3N4WA 2ZDPA 2EKYA 1TL4A 2DXDA 3MF5A 3BDPA 4CLUA 5D77A 1FKOB 2Z2LA 5KG0A 4LF7J 1TV6A 1NZAA 3B82A 3FUYA 2UUBF 4PABA 1UAWA 1TAQA 2GO9A 2DGUA 4CIOA 1J5EF 2GQ2A 1TP7A 1RI7A 3MDFA 3BSNA 2JEFA 1RTIA 1SJRA 2NXCA 4PQAA 5DG9A 1FD2A 1UW9A 3DLHA 2OIHA 1IQZA 1MWZA 5J1PA 2EG2A 1MN9A 4MKYA 4NRUA 2AV5A 1S0OA 3HMJG 3CCMS 3ENWA 2CQHA 2DHAA 1L3KA 3UCGA 3OHBA 2IDEA 1X4FA 2VJUA 4ENOA 4HEA9 1PAUB 2MZRA 3M05A 1WD6A 2OLWA 3VHQA 1SC6A 2XO6A 3N01A 2B4OA 3MUMP 2ZH2A 4MK7A 4O3RA 4B17A 4HVZA 1A7GE 1VQ7S 1HD0A 2AGQA 1GXTA 2VOPA 4ECTA 3GSDA 2RILA 3NGDA 4ILLA 3DI6B 1KFDA 2R2UA 1ZYQA 3Q0AA 4D3GA 3Q8QB 3MTKA 4WP3A 2FY1A 3UO0A 3KK2A 1HMVA 4NLTA 3FRZA 3FBBA 2CRLA 1JX4A 2LYVA 2OPSB 4K59A 8ATCB 3EXCX 2VFTA 2DRAA 2AEMA 1S9GA 5GAHU 1HL6A 1SQFA 2M7SA 3BH6B 7AT1B 2O5DA 5DDPC 4F4WA 3TZWA 3TAMB 1GMUA 5J2PB 2RUGA 1S6UA 3IGNA 5CYJA 4ZLLA 4E8UA 2E1MC 4HTJA 1VQ4S 1N36J 1Q1KA 2KTQA 3ITHA 1EX8A 2RUSA 4RUHA 4YR2A 1SL1A 4NXNJ 2QA4S 4TU9A 1FXDA 2XLIA 1C1CB 2GGPA 2ZBCA 3M6XA 1FKPA 1TK5A 1BLUA 1KKHA 1N48A 1KBRA 3D3BJ 2J0XA 1RHQB 3JS9A 4QR0A 2J6SA 2ZVIA 2RRNA 2VC0A 2ZKTA 4NEYA 2Y9HA 1TKXB 1Q53A 3N6NA 4R25A 4PCQA 4C6AA 2RS2A 1VQ5S 3CC7S 1DZ5A 3MPWA 5EGYA 2UV8G 1DQ9A 2YTCA 2AYEA 1MG7A 1NK5A 4QCLA 3RRGA 3HHNB 2EFPA 1F2HA 3KHRA 4QYZK 1I51B 5A0YA 4ZHRA 3C6UA 4KQZA 1RHJB 2VBZA 3OW2R 4Z37A 3NBPB 1HBOA 4QIWD 5KTQA 3R1LA 1JQGA 2ROEA 2GMHA 5MLCV 1SPBP 4CP5A 2DR9A 4EZ6A 2DHSA 5KFGA 2APOA 2QN6B 1P1LA 1U2RA 3MMAA 1UEKA 1KN6A 2EK1A 4TQRA 3JSRA 3UDEA 2FDNA 5DJBA 2C2OB 4C8LA 3AFGA 4CM0A 2CIMA 4ZVRB 3O8WA 1CS4B 2I8EA 1HNWJ 4CLTA 3DLEA 3HD1A 3NMRA 3ILLA 1LNQA 1JLBB 4ZP9A 3RYLA 1ZH5A 1RT5B 2H3EB 2HGLA 5LSOA 2W8LA 3EZ5A 1S9FA 3MR3A 3CD6S 2OO4A 2ZOMA 2HVHA 1FX4A 4C8ZA 3HHLD 4Y2IA 4FS1A 2OEJA 5AE3A 5FJ4A 2ROPA 3QT7A 2KH9A 3AXKA 3BN7A 2EFVA 2N4DA 1O5JA 2CVIA 4N76A 3R2CJ 3V6KA 4DV0F 3T1YJ 2UVUA 3GFHA 5A8WA 3FQLA 1SJ4P 3TI0A 2XGQA 5D8HB 1S9EA 4CLFA 4DUYJ 3V6JA 2JVOA 1VC5A 1YLXA 2HIYA 4JI6F 2OJ3A 2ZEJA 1ZM2A 5AXMA 2AZ3A 3MOJB 4PKDB 4DX7A 4DR6J 4X64J 5CABA 3FRYA 3GYXB 2Z0GA 2CJBA 4UZCA 5B0GA 2FJWA 2VBXA 5IQQA 2F4VJ 4P7TA 2XHCA 4XPCA 1FWPA 2OMOA 3TQ1A 2VU5A 3OQ2A 4MMOA 3MGJA 4J9RA 1LWCB 3KHGA 1S1TB 1HBMB 4CYUA 3HT3A 1Z1ZA 5K20B 2BW7A 1XIQA 1GTHA 3HXMA 1F1BB 5FDLA 1JIHA 4Y2MA 3GZ7A 1F5BA 3OJUA 4KV8B 4KSEB 1KEKA 4YR0A 4RW6A 5LSRA 1B99A 1P8GA 2NLWA 3SDEA 3MUVP 1N8RT 3A12A 4ANDA 3T6JA 4LRAA 1QY7A 4YS2A 2G0JA 1XR7A 1RTIB 2XMMA 1N33J 1L5UA 3D6TB 4FYDA 4HI1A 4JOUA 3D0HE 2FJEB 4ZCMA 1OYEA 5LL6d 1PJ6A 1SJQA 3MMCB 1U1RA 1UCNA 4WFYA 3IS9A 1VRUB 4DSFA 3PJWA 1RWOB 1TL3A 2ZC3A 5SUHA 2R8IA 4FF4A 3ZC4A 4NZ6A 2ZUGA 1FD8A 1NXIA 4LMZA 3IBCB 2DY1A 1NPRA 3L09A 4URGA 4ZMMA 1FCAA 2AJFE 2KM8B 4A8WA 3QO9B 2YNHB 3PEHA 5K14A 2FYXA 3TQEA 3PACA 2R7UA 5K8PA 3RUBL 1EHWA 2XO7A 4N8OA 1RWXB 1ELOA 3AA9A 3R5GA 4KRWA 5IZHA 5B0CA 3B54A 1IR2A 3CXCR 1I5OB 2DKOB 1U4BA 2VG5B 2CQ4A 1KP6A 2DEJA 3ILJA 1T94A 2DGWA 2D41A 3PIOQ 3M6WA 3MI7X 3KLGA 4LJMA 1HNXJ 1VLOA 1ZM3A 2X1BA 3I5BA 2FJXA 2X3GA 4K8RA 3D66A 4I1TA 2HHHF 4FYVB 3M2RA 1JLFA 3DLKA 2E9TA 4NE9C 2AQ4A 4LFAJ 3ZZYA 1U6FA 1JXVA 2C2EA 2GGPB 3TZZA 2DR5A 2YKAA 2XYGB 3NGKA 2XYHB 1VQYA 3UDLA 3HJVA 4GKJJ 2HK3A 2XCAA 3G6VA 5HJYA 4CT9A 4ZPTR 4DFMA 4DV4J 1RLDA 4DV7F 4B3SF 1VGYA 4ZLPA 3HVAA 3FC9A 1RTJB 2MSTA 1UL3A 4CLSA 1ZA2B 3ZTQA 5LMNF 3QGHA 3DLGA 1VQ9S 2B9EA 2B51A 4OLOA 4ZHRB 3C6UB 4PG7A 5D6GA 3FEZA 4Y2KA 2VDHA 2JDJA 4B3TF 1SV5A 5KFDA 4XK8C 4C8YA 1QJHA 2CUYA 3W5YA 4U7UK 1V6HA 4ZPAA 1IBKJ 1KQSR 4ECQA 1P27B 4CTAB 1URRA 3IM8A 3VGSA 3QPIA 4AQYJ 2X7IA 2WTFA 1S0VA 4I6YA 4A8KA 1UW4A 5KFLA 2QL7B 5L9XA 2HHWA 1BC6A 1VJWA 5CCLA 1X9WA 1G7CB 4MIBA 2CPZA 4WIIA 3PV8A 3MPDA 2JEIA 4OQJA 2B6AA 4C8OA 1E6VA 1XBWA 3OTDA 5ETNA 1S1XA 2KB2A 2N3OA 2FJDB 1D9AA 3WZ0A 5H9FK 2UUAJ 3BQ1A 1Q8LA 5LJ5Y 1X5TA 1NM2A 3RAMA 4RW7A 2LLZA 1UVKA 3B78A 2Y8WA 4RKUC 4USUA 4B08A 4NMXA 3BS9A 1LOUA 2NZCA 5IT4A 5L46A 3VZIA 1X7VA 4JYAF 3C19A 1S9EB 2WK4A 1RXOB 3OBIA 1FVQA 3K8VA 2LA6A 1H7XA 4DPTA 1WOPA 1AUSL 4AXJA 4LUBA 2DIUA 4ECRA 4HT7A 3P49B 3TZXA 2OI2A 2C3MA 3OXGA 1WDTA 4Y00A 1WC4A 4I6AA 3LF0A 2MQLA 2M9KA 2WSEC 5F8LA 4UOCA 4ITSA 4FDFA 4OI2A 4UUWA 4FBTA 3ENVA 4ZVUB 4DR5J 1MW7A 3AT1B 1S72S 4L6V3 2RQCA 1NB7A 3KMSA 2KYZA 5CHCB 3SCKE 2J9DE 2BOPA 2V8GA 3RR8A 4RNFA 3SDEB 1VQPS 3OUYA 4LF7F 5ETKA 1EETB 1X60A 2XY5A 1L3VA 2XBPA 1GQEA 5F8HA 1U8SA 2QX0A 3FK4A 2JZ5A 3KNGA 2PEBA 1RBLA 1VK3A 4PAAA 4OFZA 3OR2A 1WSVA 5DO2A 1Y5IB 2XS2A 5F8GA 2FGCA 5D0RA 3DRRA 1YRTA 3IXQA 4AE5A 1H0HB 1LW0A 5FIIA 2ATLA 1TL3B 2QC3A 2KJVA 2DHHA 1S7HA 1SH3A 5KOWA 4GO5X 2DR8A 4MIAA 2NXJA 4DL0C 4KY3A 3BM7A 3MEGA 4J7CA 1RT7B 4KBIA 2GW8A 4H54A 3VWSA 3SV4A 3PYGA 4M5NA 2YWHA 5K14B 4OHZA 2X1FA 4DR2J 4XTTA 1P1TA 4OI0A 1Z2LA 1AA1B 2QIFA 3U02A 1ZTTA 2XZWA 3QSYB 3ZZZA 4OYMA 6AT1B 1HWLA 1XTZA 2DNNA 4RW8B 5ADZA 1ACMB 2QZ8A 4WP9A 2AWZA 1X4AA 3BQ0A 2HHSA 1KOOA 1CQNA 2VPXB 4ED1A 1VFJA 2R7WA 1GMWD 2HBYB 2H48B 3CMQA 1H7WA 2R7TA 4CLZA 4LR9A 1S49A 3CVKA 2OH2A 1S1WA 1HHTP 2DNZA 4CLWA 3KLGB 5HVHA 4NA3A 2RH3A 2MLXA 2J0QD 1XMQJ 2HS3A 3UPFA 4ZKAA 2AJ2A 3MCSA 3M2RB 4B3OA 1JLFB 3DLKB 4A8FA 1R0CB 4PUOA 2PMWA 4P2FA 1H2VZ 4QPTA 4MKBA 5KT5A 5L1KA 3P5BP 3QYYA 2UXDJ 3MM7A 4LR7A 1N36F 4OZ1A 4DPYA 3RB4A 1CC8A 1EAYC 2MZJA 3VALA 4DSLA 2G4BA 5I4MA 2MZTA 4YY3J 3DXSX 3ISNC 5BR8J 5KFPA 4X4NA 1LWEB 3PZPA 3PNIA 2RVJA 4EO8A 1FDDA 1NDCA 4JI7J 5KT4A 2VBWA 4X4OA 1L3TA 3J7AN 2V8HA 3H5YA 3GFZA 1OPZA 2PA3A 1IJEB 3HSJA 4NYOA 4M5GA 2VG6A 4DSEA 2LDYA 2Z4PA 2Y1JA 2ASYA 4QR2A 5AE2A 5KG4A 2ILYA 2NXUA 3C6TA 4LIRA 1SVDA 1IVZA 3HFVA 1UMJA 1JMTA 3NWRA 4OJGA 5EX0A 2BQ3A 1VQKS 2AYBA 3PRVA 3HM9A 3C8YA 3MAHA 4Y3CA 5K8NA 2VFUA 3AODA 1HQUA 2RKIB 1UZHA 4LSLA 5IWAF 1GXLA 4ZVTB 2BA9A 4OJ1A 1VQNS 5L1LA 2B6AB 1E6VB 3C14B 3LP2A 2AX1A 4E98A 4CWBA 3TVZA 2DGTA 3DXBA 2I5JA 2HHQA 2CKWA 4ZDNA 3BEGB 2H4WB 1HNWF 2RU9A 1K0TA 2HVDA 3ZTOA 2RNEA 2QYGA 2D1CA 4G1PA 2LU2A 2OTLS 2VJVA 3EGVA 5J1EA 1HPZA 5HI7A 1Q7YT 1YJTA 2XWYA 1VOMA 1QTNB 5KFBA 1NH7A 3K5MA 5KG5A 1Z4UA 2LECA 2XMVA 4M5DA 4ETZA 4PXCA 3T1YF 5D4NA 1SUQB 2XCPA 1WELA 4A8YA 3DLJA 2PI5A 3BPSP 3GE9A 2VV5A 4DUYF 2I38A 1XC9A 4DL7A 2CDRB 3CJKA 5IV4A 3KLHB 2Z30B 4DR6F 4X64F 2GS8A 3VAMA 2CQIA 1UEVA 2CWKA 3KUEA 2YKNA 4M5MA 1BQNB 3HP6A 1PKUA 1WC6A 2F4VF 1SJ1A 5H9EK 2BR0A 2L48A 3UI3A 3S1TA 3BGUA 2C2RA 3ONQA 4IDKA 1OMSA 4NOHA 1LFWA 2WOMB 2OTJS 1T05B 3Q86A 3POTA 4B9LA 4NLSA 3OUYB 2GJ2A 3QWUA 5HO4A 4UZBA 3EWGA 1H2TZ 2DXFA 4J9NA 5EWEA 3CMAS 2FVSA 3VAJA 3R5AA 2F9JA 3OR2B 4ES3A 4YP3A 1N33F 1IBLJ 2VH7A 2L08A 1REVA 5RUBA 4A8XA 2H1YA 4ZVPB 3AA8A 3IR6B 1G1XA 4NCBA 4OZ5A 1QD1A 1RBOB 1DARA 4A8OA 4JV0A 3DRSB 5C24B 4P52A 5CYQA 1FJ7A 2L41A 2FJVA 4RNOA 4WPAA 3M2UA 3NXZA 2UVRA 3MCOA 1X4GA 3HI9A 4RO0A 4HH0A 3LALA 2EBGA 3G4SS 2VZ9A 1RTHA 4L3KA 1YJVA 2UXCJ 2BBEA 4IG3A 4UW2A 2AGOA 3Q22A 5KFKA 2YH0A 3IWLA 2NCKL 1RQ0A 2JLFA 1WDDA 1RU1A 2WZ1A 2MHEA 2M4MA 1FNMA 2KFNA 1HBNB 4WZMA 2UVVA 3ZZ0A 2HK2A 3QNWB 1VISA 1NJWA 4A8MP 4EMDA 1KD1T 4IH6A 3BQ2A 3CJ0A 3BKTA 1R3NA 3OVSA 2RRAA 2CYYA 2QLBB 8AT1B 1HNXF 1QAYA 2MHNA 3Q8SB 1LXJA 1CEZA 2CNKB 4XDDA 4PUOB 4UY85 3TANA 3W2VB 1PIEA 5BYQA 2FHJA 6FDRA 1WHXA 4NLDA 3NWGA 4LFAF 1JNRB 4WK1A 1AW0A 3KK1A 1HNVA 4TNOA 1VQ8S 4LRCA 1VS3A 1CJUB 4JP8A 4GKJF 4RNMA 2IC3B 1H2UX 4FPIA 3CD0A 4F4XA 1MU2A 1TL5A 1HD1A 1Y0HA 4RUCA 3AD7C 2FZCB 3BDEA 4UOGA 4DV4F 1KHWA 2EBEA 3HLUA 3WIUA 4DR7J 2LQ9A 5DG7A 4C3KA 2IJRA 5KFUA 2QGFB 1T03B 5D3GA 2HFNA 4LSNA 3BPDA 2YNIA 4UQTA 3UWTA 3HULA 2A1BA 1Q81T 2GCFA 2EFGA 2GZOA 4HDGA 3UFCX 3PEJA 4I2QB 1OY6A 2IBOA 2N7YA 2JEJA 9RUBA 1VQ6S 5B0EA 1B0TA 4H4OA 3C6TB 2KHCA 1IBKF 2R4FA 4Y34A 5D15A 4YR3A 4DL4A 1J5OA 1HQUB 5D0EA 5GVQA 3US5A 4AQYF 4Q2LA 1A9NB 4LSLB 3RW7A 1AZSB 1U6BA 2YBVA 3GPAA 4DQRA 1NJYA 1VRTB 1F5AA 5DLGA 4G1QA 3PJ9A 3MM5A 1R89A 1FA0A 2ZH9A 1LWFB 3DN9A 4Y0FA 3ISND 1I1GA 1X4BA 2XMUA 1YJUA 2UUAF 2VIHA 3J81Y 2C2KB 4USWA 2QEXS 1HPZB 2DEIA 1X5PA 3CJ2A 3I96A 4PYAA 4ELVA 2GO8A 3OTCA 2XI3A 2DGQA 4M5DB 2W7PA 1NEEA 1Q8KA 2PEHA 4AYBD 4HDHA 1T9WA 2MKJA 2ZZMA 3L9ZA 4IOCQ 4LRFA 2XLKA 4NCAA 1Y11A 2V4RA 4LQ3A 1RAHB 5HROA 4ED3A 4I69A 7FDRA 2P9CA 1NHVA 2B4UA 2XC9A 3GCXP 5D4OA 1XNQJ 2OSQA 1IR1A 4WXWA 5ETQA 3BJYA 2HRTA 4NCGA 3DRPA 2GAHC 2H9ZA 4DG1B 1CJKB 2KXFA 4NLPA 1HI0P 1X0FA 3QIPA 1MWQA 2DK2A 3DYAA 2C1EB 4DR5F 3ETMA 3RGIA 1GEHA 4R8UA 1MMDA 3POTB 3CJ4A 2HLUA 5J2MB 2DCUB 1RDRA 3D68A 3M8PA 5HMXA 4K2JA 3SSQA 5LMUJ 4JUZA 1D0EA 2HNZA 2F7VA 3QBCA 2QG9B 3M9NB 4OZ2A 3DOLA 1S10A 2FD2A 3GV7B 4ID5A 2KXNB 3V6DA 3EGNA 2DNMA 2OEMA 3F41A 3LA0A 2UZAA 3VVTA 1VC6A 2RQ4A 3NCRA 2F5GA 3KUGA 5A76A 2BM1A 3OFEA 2GA7A 4DR1J 5KT6A 1BQMA 2W7OA 2Q79A 2NXEA 3LWMA 2AJQA 4OHXA 4ZVOB 3OVAA 4USTA 3HJFA 1UFLA 5GAEU 3LWLA 1DURA 2QMUB 5CYQB 1TL1A 3G87A 2FHOB 3IWXA 4L76A 3GILA 4YDDB 3M2UB 2DNHA 3PW2A 2VICA 1QTMA 4WTYA 1N5TA 2HGMA 4KC5A 4ANCA 1HR0J 4LF6J 4MK8A 2LEAA 2YWKA 2E5JA 3R5BA 4WCEQ 3QJPA 1RTHB 2JLEA 2CJYB 4B3MJ 4OZJA 2SXLA 1Y5NB 4IG3B 2DR7A 2HAFA 3EXYA 2HNYB 1EQMA 4DR2F 1JK9B 2IM2A 2HFUA 2J9DA 1T0TV 1M5VC 3BBBA 2J6UA 2HQGA 4KKOA 3EYZA 1QE1B 4OHVA 3CCRS 3E8OA 5THWA 3W62A 3NGTA 5BYRA 3LTOA 3K59A 1C4AA 1I94F 1OY9A 2XYPB 1M90T 1MSWD 1R0AA 1T11A 1S6PB 4LVNP 1NJXA 5KFXA 1R31A 3BSCA 4J9QA 1VBKA 4KO0A 2HHPA 4ZVFA 2G9OA 3M8YA 1OS5A 2Y1RI 4DLGA 1GH8A 1FRHA 2J76E 1M5PC 1XMQF 2MKSA 4DUTA 4CLYA 4Y2CA 2DPJA 2JJ4D 1ZBTA 1ZZFA 3FBCA 5H9FJ 1RACB 2C2DA 2BKPA 4BC9A 3I0RA 2UXDF 3TZYA 3MEEA 1X4EA 1NJZA 1VRQC 2LEBA 3CCUS 1IWGA 1T3OA 2PO4A 4ICLA 3GIJA 4USVA 2DIVA 3WHIA 4YY3F 4Q5VA 5BR8F 2MGZB 1ZAXA 3EUNA 1U1NA 1W7WA 3AOCA 4JI7F 3JSMB 2LXFA 1XK8A 2ZHOA 4LSNB 1PG5B 2HMIB 2R7QA 3MZIA 2LP4A 2QMWA 3KHLA 1P9YA 2KHDA 1YHQS 4JI8J 2YX1A 3GFYA 1M5HA 3JSYA 5GMDA 4H4OB 2VKZG 4MJKA 1KVKA 2I9SA 4MH8A 1ZA1B 2VOOA 2NS1B 2R42A 3ISZA 3NGUA 5GAHI 5C42B 1MWYA 2AU0A 4NI2A 4R0EA 5D0GA 1AUDA 1D3WA 2IMWP 1O51A 1NKEA 1S6OA 2ZDOA 1KDNA 3SBMA 1FXRA 3EVWA 2ZZTA 3NNCA 2FHMA 5KG7A 2ZH6A 4G1QB 3D5MA 2W9BA 4UF4A 3LP1B 4P73A 3FJ2A 3H2VE 1VHIA 3QRQA 1Y00A 4IO1A 2GVZB 2ZJRQ 3E01A 1N34J 4ES2A 2PDAA 4ID8A 1B0PA 4QU7A 3TEGA 2F63A 3D67A 4RW4B 3MEDA 4O0NA 1EJ7L 1NK7A 2RDIA 2ZITA 2K7JA 2W7AA 3BGFA 1KTQA 2VPWB 2W9CB 4A4JA 3NNHA 1AFJA 2RE1A 3W63A 2ALZA 3CTRA 4DUZJ 2V67A 2AGPA 3U7JA 2E1PA 4WFXA 3M8SA 3MD3A 1NDPA 1RAFB 4WZQA 1R27B 2DHXA 5HANA 3Q8UA 1AFIA 5CYMA 3VVUA 1NKBA 2ZNYA 1CLFA 1HBUB 2IA6A 3QZ7A 3X1LB 2AEJA 1DTQA 3PR5B 3G2XA 1HWJA 3B6BA 1SH2A 3ILOA 1U1LA 2BXJA 2GAGC 5HK4A 2LXUA 1X5OA 1WHWA 4XAKA 4OX9J 3DYAB 3THTA 2OD6A 3OSNA 4R8UB 4DPXA 3MFIA 3OTBA 1FKAF 2MMYA 2DPIA 4OYPA 2AF6A 2RQKA 3SCJE 4N56A 3NKYA 4IQXA 4C4WA 5K8MA 3V6DB 5ETLA 3N9UC 3GLJA 2HSEB 4MFBA 3MM9B 4NXMJ 3G82B 2EI5A 2B7BB 1EZZB 5KT2A 4R5PA 1IBLF 4RU2A 2AZ1A 1YRXA 4UT4A 2GHPA 4TLRA 3K0JA 2ERRA 1TL1B 2QT7A 1SC1B 4QW9A 2IFXA 4IOAQ 4KJIA 2X3DA 5F8NA 4IR1A 2Z8QA 1KQKA 3HZEA 2JRSA 3KTQA 1FJGJ 5KFOA 3R6GB 5G0RB 4CCHA 1NDKA 3H4BA 2UXCF 1KTVA 2VQFJ 4ZVEA 3AH6A 1YBAA 1MMLA 3BYRA 2BQUA 4RJVA 4YB6A 1EIYB 2GHWA 4HI2A 4F50A 4EYHB 4FF1A 2AW0A 3VV2B 1IKVA 2IVMA 3FSIA 2O01C 2LKZA 2X1GA 4KO0B 1F0XA 1R7IA 2Q6BA 3PO4A 4I2PB 4I4BA 4W4MA 4NEZA 2VHGA 3HSZA 2K3KA 5JUMA 1RA6A 2CPXA 1JLCB 1KLMA 1TK0A 1HYSB 1H72C 4J9PA 1N5SA 2RF2B 2QLWA 4OYXA 4FF2A 3MEEB 3PW4A 3TUZC 1RHKB 3HSGA 2QA1A 1WWHA 3T41A 3TX0A 3KG1A 4F4ZA 3LAMA 3KLVA 1ZAVA 1REGX 1N6QB 3MCMA 3HVRA 2KI2A 2COLA 3KG4A 1RAEB 3EVMA 4NLYA 2HURA 1FDBA 1PILA 3MD1A 3ZXWA 3GSIA 4DR7F 3LGNA 3EGWB 2R8KA 1TKTB 1FTCA 4FYYB 3MOZA 1OSCA 1WI8A 3M32A 2P8IA 1VCTA 1FJEB 3RBXA 4C97A 1HI1A 2Q6CA 3MM8A 2HWTA 3FDSA 3HZGA 1FX2A 4XDCA 4E0DA 1UWAA 3HKZD 1R8CA 2V9KA 5H9EJ 1S1UB 4W98A 4LVOP 3CCWA 2G0CA 1MN7A 1CPZA 5E3AA 1K8AT 2N4CA 2W01A 1RT1B 3K5LA 3HHDA 4CO5A 4WP8A 1R8PA 3ZTRA 2MXYA 4BWJA 2JHEA 3A3PB 1PYOB 4CH0S 2VFVA 2Z57B 1IBMJ 1X5SA 1PBAA 4ZVQB 3FFIB 3TUIC 3R5DA 4QIVA 1EQ0A 4AUKA 4TYBA 1HWKA 2W9BB 2J9EA 2K7KA 1RLCL 3FCVA 5HLFA 3RB3A 3JAMY 4UUXA 3PVXA 3E01B 2E5IA 3IA0A 2UUCJ 2VA2A 2CQBA 1F6TA 4IUFA 1T8EA 4FXDA 2C2NA 3PIPQ 2B56A 3MEDB 3J7YI 3O44A 5D0HA 2BV3A 3SMZA 4EUVA 5A6WA 2WVCA 1ZZNA 4I68A 2EFQA 3T5KA 4P2SA 1UKUA 1SH0A 2GVDA 1C0UB 3TAMA 5M2UA 3BGRA 5J2PA 4DQQA 1NK6A 4NZ7A 1WG4A 1U1QA 5CYMB 3C16A 5EWGA 2IJFA 3EGZA 2FLLA 4DU7A 4I6WA 3Q8VA 4NYPA 1XNQF 4N7TA 3R7BB 4FXVA 1UEUA 4NWBA 4I64A 1QSSA 1C4CA 2HVEA 1TU0B 4ED4A 5A2QU 2Z58B 2IJNA 4DPWA 3LH2S 2BZ2A 1W25A 4C8KA 2AHOB 4URQU 4QU6A 1YVFA 1FK9B 3DHXA 3L7UA 5LMUF 3TNVA 3TVKA 1KC8T 1T02A 2NQPA 2XSFA 1SXLA 1RAIB 2CQ3A 3BR9A 3KG0A 2JFDA 1ROFA 4P71A 3D6MB 3KUHA 4KFBA 3MR6A 4FNIA 1IKYB 3NBPA 4OYWA 3L3CA 4CO1A 1BE4A 4R5PB 2IBKA 2YKOA 2ZH4A 2MDAA 4ECZA 4DR1F 1RYSA 1FDNA 4J9MA 2FLPA 3KDNA 2IRUA 2YNGB 4DR3J 4LFBJ 5EX3A 1CVJA 3IC1A 4PXBA 2F1FA 2QRRA 3EJMA 2E66A 2OPPB 3W60A 3TA1A 5F41A 2DGVA 2XEXA 1HR0F 4LF6F 3GFXA 4C8NA 5A8KA 2MJNA 4F36A 2ACMA 3R5CA 4B3MF 1QUVA 3T9ZA 4DV3J 1RBAA 4QQBA 3TEHB 4Y2AA 4UOFA 1GFWB 5HQLA 4KTQA 4XPEA 2DNRA 2XULA 1CJVB 5IT9Y 3G86A 4RUAA 5JMNA 4B9UA 4J5OA 3OV7A 1S48A 1K1QA 3KDOA 4WE1B 5F0WA 2DY9A 3EICA 1UVLA 2F8HA 1F5CA 1RE1B 2HHUA 1SIWB 2PE8A 1TMJA 4HH1A 2J8AA 2LXIA 1DJ0A 5C25A 2CDQA 2HRUA 3BZQA 1F2GA 3QAEA 3KNAA 3CCZA 2WCXA 3I5CA 1U1MA 2ZE2A 2JLGA 1QUPA 4KHPJ 2QV6A 2VDIA 3J7A1 2CXEA 1CSJA 1TTHB 3NCPA 4PWUA 1M1GA 3HD2A 1RT4A 3I9ZA 1S1TA 1C0TB 3HPOA 2CPEA 3CJTA 5LJ3Y 3VGTA 1V5IB 3PRBA 4X4VA 1DHMA 2G0IA 2OSRA 4KV8A 2M52A 1IR0A 1X9SA 1UFWA 1RTDB 5GMKa 2LQ8A 3LP0A 3UR0A 4K4UA 3CDBA 2EG1A 3MPYA 4HYKA 2WVEA 2ILZA 4DXLA 3EPIA 4ZJLA 2DB1A 3M32B 4L73A 3UQSA 4X62J 2ZZNA 3SYZA 2PSZA 3MM8B 4LREA 2W8KA 2W2PP 3AJ1A 4DV5F 1V3SA 3MMCA 4NLOA 4JI8F 3NEKA 3N6MA 1VRUA 2DJWA 4KHRA 1S4FA 3GIKA 2CZVC 2W4DA 4EGLA 3L95X 3W5ZA 3ZNJ1 3NS6A 4NLRA 3PM9A 5IM0A 3DGPB 1LKZA 3D4JA 2P5VA 1S59A 3M8ZA 4A47A 1YQHA 3RB0A 1G2EA 3MWBA 4PG8A 1WF0A 3QIDA 1ZAWA 5BJRA 1FXLA 3QO9A 2YNHA 4IFYB 5B0AA 2JEGA 5DS7A 2CG8A 3SFGA 3ICLA 2GMJA 3RU0A 3LQVA 5HLFB 5AT1B 5M2PA 2CZ9A 1IXKA 3D6FB 4ED8A 1RKJA 4AT1B 1RWNB 4L72B 4UY8T 3P6YC 3I82A 4G6VB 1KR4A 2M5YA 2I1RA 1N34F 1PGZA 2B43A 1W26A 3QGGA 3KHHA 4NRTA 1WACA 2VG5A 1FE4A 4ECVA 3PX6A 1WHVA 1K47A 3MAAB 2LVWA 4KGVB 3IO1A 2DNLA 1YIJS 5E7OB 4JBCA 4DN9A 4CO3A 4DUZF 4DV2J 2GVDB 2FTRA 4GC7A 1EKRA 3ZO7A 4GVLA 3BGRB 3BV8A 3EVOA 2LDIA 5LXYA 3C16B 3PYFA 5BXIA 1M1HA 3I6PA 3H2LA 3AJDA 5AJ3F 1U0HB 1RT3B 2L9NA 2AT1B 1HW9A 4A48A 3G8QA 1FNOA 4B3RJ 3GYNA 2ZM6F 4WFZA 4Q43A 4USHA 1RTJA 2HFVA 5CQGA 2VONA 4OIXA 3OVBA 4LT6A 5T7LA 3UVJB 4NLVA 3NLCA 4KFBB 3TJ8A 4NXMF 4LF4J 4L75A 3O5TB 5DM7Q 2BM0A 3OLAA 5F3ZA 5L9NA 2KT2A 3P8BB 2D3ZA 1QAIA 4ER8A 3PY8A 3I9V9 3VZHA 3G71S 3DM2B 1GAOA 3AOAA 4CTAA 1L3SA 3DFEA 2E29A 3KLIB 3J7ZT 1AYEA 2PT0A 4F0HA 3MM6B 5ETRA 1FWKA 1S1VB 3FCWA 5DQIA 4J9LA 3HO1A 2BW2A 3LUYA 1V5VA 5A8KB 4MKAA 1URNA 1J2VA 3H7HB 1FJGF 3GJRB 2W9AA 3GJQB 1DQAA 4GKKJ 1DLOB 2VQFF 3C66A 4OI6A 4BS2A 4DFKA 1LFPA 5IC6B 4RBVA 2R7RA 3HHLA 2FY8A 3G6ES 3F73A 2DXEA 3DRYA 2KZZA 4U9RA 4F0KA 1C1BA 1Q82T 3M4XA 1HWIA 1FEEA 3U27A 1DBDA 2MQPA 1NO8A 4I0WA 2W2MP 1K0VA 5C25B 3CCSS 5F3TA 4LBPA 1VK8A 3P45B 1N32F 3O1LA 4QWDA 2R8HA 2ZE2B 1R43A 3D3CJ 4OX8A 2CJKA 3QFWA 4ZPWR 1KLNA 4JI2J 3CDEA 3VAGA 1QDUB 1RT4B 3OT9A 2ZOGA 3UR3C 1WG5A 1NMEB 1WTFA 4A8SA 4YDXA 2C3OA 3Q8RB 3M6UA 2MY8A 3N5BA 2CQ0A 1S57A 4JV2A 2R8GA 2ROGA 4AL7A 3CIZA 3MECB 1SKUB 3H5UA 3PHEA 1QAJA 2Y1IA 2IMOA 3ZZTA 1YX2A 1EETA 4ZCLA 4NPOA 1P6TA 3LP0B 3TX8A 2NUHA 3K8WA 2MLZA 3U1NA 2DISA 4NLQA 2VKRA 4CO4A 4P6QA 2W25A 2DH7A 2XB2D 1R8HA 2R2TA 2G1DA 3HX9A 4IRKA 1HHQA 3GJSB 4DV1J 5B0BA 2A3JA 1WEXA 3KKFA 3M30B 1TR0A 1NPKA 3JQKA 2Y3YA 2AYMA 4JI0J 4NMLA 3A4TA 4XIUA 2OMLA 1Q79A 5CXTA 5IM0B 3M9MB 5IFMA 3MR2A 1UETA 2V8DA 1V3ZA 3JTPA 2V2KA 2KT5A 2V9WA 4RW9B 1RT7A 4NLWA 4V19X 5A8RB 2A6OA 1MROA 1JJCB 2HBZB 3I56S 3PKMA 4FVCA 3IP0A 1Q8IA 1IBMF 2C22A 4QOTA 5FD1A 4M63A 5KFQA 3JXOA 2XMWA 3KK3B 4DN0A 3CWJA 1X8DA 4RW8A 2CNOB 1SKRA 2WSCC 4ZPDA 1RCXB 3SFUA 1D9FA 3M2VA 3W66A 2UUCF 3OL7A 4ETXA 3G6XA 2E5HA 1W2IA 1NSQA 4OHYA 2EK6A 2MY7A 3NOCA 4K4XA 2LFVA 1LEOA 2R7XA 1M5SA 4BWMA 5KFCA 4K4YA 3QJJA 2O3DA 3R5JB 4QWAA 4X65J 4C0BA 5J2QB 4OYZA 3K5PA 4ZCIA 3GR1A 5CZVA 1B70B 2G13A 2XSJA 3MCNA 3I32A 2KM8C 2ZH1A 3J7YU 3I55S 1LWEA 1Y5LB 2NYHA 1VYAA 2BRLA 4ZCKA 1FESA 2YQ3A 2CJXB 2C3PA 2Z2ZA 1H6KX 1HI8A 3FSYA 2BJ8A 1YSJA 2K06A 4PWDB 1BUXA 4DX8H 2V34A 4L3NA 3I0SA 3ZZOA 3M8WA 3QQCD 5T7LB 1NB2A 1PC5A 3OXFA 3I87A 2KU7A 1FHTA 2UP1A 3TRGA 4EBCA 1SBRA 2CQGA 2ZOFA 2HIQA 1WJ9A 4RWXA 4GRSA 4X66F 1KS2A 5J1NA 2H51B 2YWFA 3UD4P 2EFOA 1NSKL 2H54B 2CQCA 2D69A 4MAKA 3GP9A 2RKIA 3DU5A 5CH7B 5KT7A 2ZD1B 1IJFB 4DR3F 4LFBF 1X4CA 1WSRA 2YNFB 3VQTA 1GX5A 2EKNA 3C14A 2OELA 4NLUA 1TL7A 3CO0P 4A46A 4IQMA 3CF5Q 4DV3F 1FRLA 2C2MB 2CPJA 1U0SA 4C3LA 1K9MT 3HHLB 1T9UA 4UOHA 2BE7D 3SQOP 2DNKA 3MMJA 1WF2A 1OWXA 4CLKA 1N5VA 1RISA 1IWAA 5ITHA 1FERA 3JTOA 1C1BB 2OFHX 3GONA 1SUQA 5IC4B 2VF3A 1OQ6A 4QIFA 1VJQA 1N4LA 3E51A 3V6HA 4PRFA 3TJAA 4O3PA 1FFGB 1LK7A 3KLHA 5ETMA 2VC1A 3CCJS 4QWCA 5EUHA 2K3IA 3I31A 3F0NA 2GX8A 3GG0A 1FFWB 1WORA 2XZDB 4DPUA 3MFHA 1BQNA 3PR4A 3H2UB 1AXQA 3R8YA 3NAHA 5GAEI 1N54B 1WC1A 3RAXA 4DWIA 2J7WA 5BYSA 5L1JA 4CO2A 1I6JA 3PTWA 1MMNA 2WOMA 1GMVA 3WIVA 2BE2A 1T05A 3DDNA 4OZ0A 4WIQA 1ZS6A 2N82B 1IM6A 3V4MA 4Y6IA 5F8IA 2NPIA 4HR2A 3Q8PB 4F4YA 3GR0A 2KDOA 1SC3B 4M95A 2J0WA 4RU9A 3K5NA 1TMMA 4IRDA 5B0FA 3HHEA 1VR6A 2DGOA 4JI5J 4YN3B 5SZTA 2KJWA 1NZ8A 1VBXA 2BACA 5AXKA 4X62F 4U67Q 4I56A 2DNPA 4KT0C 3Q24A 3QJLA 2MEWA 2HHVA 5E3RA 2R7SA 1XN9A 4B9VA 2C3YA 3N0VA 2K1RB 2WAQD 3DRSA 4P7VA 4ED5A 5C24A 1K1SA 4OZNA 2PI4A 1B0VA 2H5JB 1XEZA 1IKXB 2YQ1A 4C11A 1BWVA 2BEFA 1WOSA 3CEDA 2MQ8A 4ED2A 4IFVB 1NK0A 1MROB 2AP6A 1CG2A 3NG8A 2YPYA 4OLPA 2Y8YA 2HFSA 2DCLA 4RLEA 2EPIA 1U26A 2BDPA 1K73T 2BVZA 3CUNA 3BKFA 2XM3A 3M2VB 1RSCA 3KJNB 1O6XA 3E2EA 1GMWA 4F02A 3PJXA 3KXDA 1HBNA 2NXNA 2XY7A 1XMBA 5KG6A 3HKWA 3OFGA 2ZVSA 3P96A 5I3PA 3NGRA 1S12A 2ZC4A 3WX4A 5K5MA 3DOKA 3WC2A 5HP1A 2R9LA 4DV2F 4OYIA 1SJ3P 2CQPA 3W2VA 1Q7LB 4U6PA 2RSQA 1CULA 2CPYA 4QWBA 3S6EA 3CMES 3CULA 2WBMA 1NSPA 4PYDA 4NXNF 2XSJB 3OR1B 2V2QA 3QATA 1CJUA 1X31C 3AAWB 1RJJA 3RJMB 2IC3A 1N0VC 4DPOA 1HQEB 2FLOA 1SQGA 1F9EB 1RA7A 3DU6A 2L9DA 3QFHA 4ZS6A 2ATCB 4B3RF 1TFWA 3IWNC 4USMA 2ZUAA 1KHVA 5F9LA 4I7FA 1T03A 4IH5A 3BBFA 4FYWB 3I0SB 4EYIB 5HMZA 2PFFB 1NDLA 4LBIA 4OMFG 1HNZJ 3MPVA 1APSA 4I2QA 3C15B 4ALZA 2MQMA 4LQ9A 1NUEA 4LF4F 4KB7A 1ICEB 1JJ2R 3OTEA 2VFSA 3LPYA 1H38A 2CFXA 2OPRA 1ITPA 4QJVA 1L3UA 2FB0A 2RT3A 3GJTB 4J9UE 1FVSA 3D9BA 3T9NA 4U96A 2ZHAA 5E41A 4BCAA 3FBEA 4PZVA 3UDVA 2KVQE 1WKJA 3J80Y 3JSBA 3CCQS 2W24A 4F3OA 1AZSA 1Q86T 2KFYA 3R97A 1YK9A 1XR6A 1VRTA 2GIRA 2J0SD 1TL7B 2YX7A 1TUWA 3P5TL 2EFNA 3M8RA 4DQPA 1LWFA 2UU9J 2GQQA 4GKKF 1T95A 2VPZB 1RHMB 3ZZUA 5DZ6A 2OGUA 3T5JA 1RAGB 4WFBQ 3KFWX 4F3MA 1YZ7A 1N56A 3D7SB 3H90A 3CB4A 2HG4A 2FC9A 2V4JB 3A8JA 2FZGB 2BABA 3IRXB 2ZBPA 3V5RA 1FRKA 1SI9A 3MXHP 1RWKB 4F2RA 1TZ0A 1SB6A 3RG6A 1NRKA 4YEAA 3UCUP 3W8GA 3FBFA 2Z2YB 1VQMS 1F9FA 5G4DA 4M5HA 3DHWC 2IDLA 1QSLA 2JWNA 3K5OA 3HFZB 2POKA 4DG1A 3R7NB 1CJKA 2AJ1A 4JI2F 1RCOB 4DZDA 2RRBA 1UTAA 4XO0A 2CQ2A 1EP4B 5KAKA 4KYZA 5J2NA 1XR5A 2FJAB 2DGXA 4N77A 2E9ZA 2BE2B 2IIHA 2JL9A 2RS8A 4NA2A 1VC0A 2HFZA 2H4YB 5J2MA 3TUJC 1GX6A 1JLEB 3VAHA 3PFOA 4M8LA 4M5IA 5KG1A 3B4MA 1BD6A 4CH7A 1UJ4A 2J7UA 1NCLA 1CBKA 1D8ZA 2CA9A 1SKSA 2W2OP 3ENAA 3WQPA 4DV1F 5DLFA 1HFEL 3CO9A 4C3MA 2M88A 2B4VA 2QE5A 1B4SA 1NLKL 3M8QB 4JI0F 1RT6A 5DM6Q 3EX7B 4C11B 2FVQA 2WW4A 3RR7A 4ZIVA 2CNLB 5JXSA 1Q5VA 2YKMB 2QSWA 1RU2A 2I6WA 3W8PA 2O1PA 4B9SA 2V6AA 3TVYA 5KFEA 3BB5A 3HDSA 5U47A 5LOQA 3TAPA 4JI4J 4YQWA 5IWAJ 2R2RA 3T19A 4C98A 2HNYA 3KLEB 3G6YA 1G4CA 3CD7A 1UZDA 3CCES 2RHQB 3UD3P 2QO3A 1PSDA 4CNYA 4KGMA 1GXUA 2ZWPA 2IHR1 2BOAA 1QE1A 3NOGA 4FF3A 4PR6A 2Z2MA 2KRRA 3VGUA 3KWMA 3SCIE 2WRMA 4K4ZA 4TY8B 5HSPA 1HKAA 1S6PA 4EZ9A 2HS0A 4EK2A 1RWUA 2E1CA 1YG0A 3SCLE 2AEFA 1VMBA 1QLNA 4FXWA 3P4UB 3DOKB 3JB9k 4ZJOA 5HP1B 5C2CA 3NY0A 2NYIA 3GV8B 3GIMA 2W4PA 2BJ1A 2BX6A 1W2BR 1RHRB 1CULB 3ZNUA 4IR9A 4HACB 3AQPA 4X65F 3M9OB 3OHAA 4MT1A 2HRYA 1RAJA 4ZLJA 3H40A 3KYLA 1LW2B 2CZ4A 2GIQA 4F7VA 3TAQA 3PRDA 4OX7A 1WEYA 4M5KA 2IM1A 2ZBQA 1PYTA 2F3JA 3QWPA 4F3QA 2CG4A 3O3LA 3A13A 5I42A 3DGVA 3CD5A 2MGZA 5EWFA 4TVAB 3AXMA 1X4HA 3UD5A 3QT6A 3KJVA 4FKYA 4MIWA 1BGXT 4RR5A 1O0PA 2R2SA 3RBEA 4P10A 4KPCA 4HL9A 4I7FB 4ZJQA 3JSMA 4QPXA 1U1KA 2HMIA 4Y65A 2QSFA 1NH8A 4K0KJ 1TV6B 3H0PA 2HZCA 5A2QY 2CAJA 5E2QA 2OAUA 3T6BA 1KRPA 2LCWA 5KT3A 4DF4A 4Q2MA 1U7LA 1IUJA 5E0OA 1R0BG 2OPRB 2HWIA 4DL3A 3TARA 1P9QC 5C42A 3D28A 2ZJPQ 4USIA 3W5XA 5L1IA 2HS4A 4DQIA 4BC7A 2D3UA 4DDFA 2XNRA 3ENQA 1XWLA 2U2FA 1I3OB 4TLQA 3OJSA 2HW3A 1PCAA 4AFFA 3LP1A 1R8AA 5F0UA 2GVZA 4N47A 3BGLA 4D3HA 4DCOB 2IRXA 2FUG9 4ZPBA 4EBDA 3ZZRA 1GNKA 4AL6A 1TVRA 4ZOSA 4RW4A 4X4PA 3FKBA 2BANA 4J9SA 1WTBA 5ETPA 2W9CA 4IOBA 2ZWOA 2M8DB 4DFPA 3KK2B 1HMVB 2NSBA 1QM9A 3U1LA 3BR8A 5I3QA 5DGAA 1PYSB 4IYQA 1OO0B 1S9GB 5LXRA 3A8IA 2XS5A 3PW7A 4M94A 2Y0SD 4LRBA 1RZMA 4LF1A 1HBUA 4TY9A 3RBZA 3F56A 2JFKA 3A8EA 3H42A 2RDJA 4X4RA 3ITHB 2QFJA 2LEPA 4F25A 5J2NB 4W90B 5FLXY 1FNXH 1ZOTA 4CI0B 2BUNA 1TKZA 2XZTB 1FKPB 4E2FB 4LFCJ 4KGKA 3I4HX 2UXBJ 2W2NP 2J7KA 2DNQA 1S4EA 1SKWA 2XG8A 4G65A 4DSKA 2GIFA 5KG2A 4WU3A 2KVIA 2V68A 3SSSA 1UVMA 4PQUA 3MM9A 3G82A 3TW0A 3NRBA 2KN4A 1YRUA 4JI5F 3W9HA 1PJ5A 4G1IA 4WJBA 1B3TA 2D3OR 3TP2A 5KFSA 1Q4RA 3H5SA 4MYUA 5A0YB 1HBOB 2YQ0A 1RT6B 5HVFA 3QZ8A 2IPOB 1UVJA 3E3XA 1T7PA 4O44A 3CE8A 3RW6A 2JVRA 3JAMU 4YMEA 3MMAB 1GT8A 3DNCA 5G0RA 4DEZA 2VQEJ 4YHHJ 2P2CB 3V4IA 1TK8A 2KO1A 2JNJA 3HK2A 3R3TA 2HZAA 2LQ5A 2Q43A 4NZ0A 5E3PA 1YJ9S 4P2XA 1XMOJ 4DX5A 3DLEB 4B9MA 1YKWA 4USKA 4PEOA 2A0FB 1KONA 2XI2A 3S8SA 3PX0A 2RHSB 2OUGA 3C46A 2W4CA 4I2PA 4U7CA 1UA1A 3TOQA 2UV8A 4ZLNA 2WONA 2ZBIA 5A8WB 2VB6A 2IY5B 1JLCA 1HYSA 3G8TA 1Y10A 4FN5A 2MSSA 2HGNA 4CLPA 1YJ7A 5KFVA 1QVGR 2RF2A 2B7CB 1U09A 3IG1A 5IS2A 1FI4A 3D1QA 4FNHA 1S6QA 3UDCA 4F0MA 4LF5J 1U49A 2WW8A 4AL5A 4TXSA 1SQEA 5I42B 4PG4A 5DETA 5E3CA 1T9TA 2D9PA 1N6QA 5A6PA 1JXLA 4HTIA 2EC0A 1U02A 1XERA 5KFAA 1FRIA 3KJVB 1Q78A 4DX6A 4N5SA 3MMBA 4OX6A 3V81A 2CPHA 4CYUB 6FD1A 4ECUA 5FDLB 4Q44A 3RRHA 5CD4A 1TKTA 4FP9A 4RW6B 2MB0B 5B0DA 1TUVA 1Q16B 1CC7A 2RU3A 3AY0A 5ETSA 2YY3A 3LO3A 2BKNA 4QBUA 1HNZF 1UA0A 1OIAA 2OPQA 1S1UA 1HARA 1FFSB 3SV3A 2P9GA 4OI3A 2FQQB 1RT1A 2MZSA 3THVA 4V19J 5F9NA 2HEKA 3IS9B 4YB7A 4ECSA 1M0SA 4FVMA 4H4MA 3VTIA 1LQ9A 4DQSA 3BO4A 3FFIA 5DGBA 3T1HJ 4K4VA 1C2PA 2UVWA 5IT9U 2QYCA 1KQGB 3DOMA 1UPMB 4MK9A 1KFSA 2NR0A 3SZ2A 4ZIWA 1ZM9A 8RUCA 3PW0A 4F4KA 4CNZA 4PPZA 3KLFA 3H59A 3WBZA 4P72A 3RBDA 1T3NA 1T9YA 3MUTP 2L3MA 3Q2SC 2UU9F 1Y4ZB 1LWXA 2LMIA 5KFIA 1TVRB 2B8QA 2WBRA 3X3UA 4ZA1A 2BANB 1TQLA 3H5XA 4HKQA 1VLYA 1F60B 2F8EX 3NP5A 1FRXA 4OL8A 3G8SA 1I94J 3EZOA 3OPKA 1C0UA 3GMGA 4AD6A 2CQDA 2BJDA 1Y3KA 2GQCA 2A6MA 4ECYA 4HHJA 3DRXA 1YGYA 2HAIA 4L74A 4C0OC 2N3LA 1WOOA 7FD1A 2U1AA 2WB4A 4K4WA 3RTVA 3J81j 3C3LA 4JV5J 1NKCA 1RUSA 4RUBA 1WHYA 1B64A 3OL6A 4ECXA 4RNNA 1U2CA 1RADB 4LIWA 3T5LA 2HQDA 2HQCA 1NJIT 1TKZB 2ABYA 2GHVC 2OKQA 1FF2A 2PD1A 1H98A 2B8PA 2UUWA 2IVYA 1RYRA 3OXLA 5CD4H 3GIIA 2H5IB 3UNGC 3HCXA 1WC5A 3R1HA 5M2RA 1YJWS 1FK9A 2I0XA 3W9JA 4GMKA 5EN1A 1U47A 2HHTA 4OV1A 3HHKA 4PQUB 2P6SA 1U25A 1S7IA 4LRDA 1IKYA 4HHHA 1UVIA 2E7VA 3B8HA 4K2XA 4P75A 3Q8YA 1Y9OA 3HFKA 2FGOA 1NSAA 3JQJA 3DLGB 1OQ3A 2XGPA 1RT2A 2BJ7A 1X4DA 5KFRA 1Y3JA 3S01A 3ZTSA 3D6HB 5IT0A 1SV5B 1CJTA 2EW9A 2IRYA 3ULHA 2G2ZA 2YNGA 5L38A 4HLBA 5GADI 2V63A 3SSRA 3ET6A 4CT8A 2VASA 4O44B 2D3O1 2FPHX 5K9FA 2OPPA 1RGVA 2QLFB 4X4SA 2KG0A 1TFYA 4ZVGA 1QVFR 2GNKA 3N79A 4F04B 4PXDA 1WG1A 4DMZA 2P9EA 3BH7B 1N5YA 2IVFB 4C9DA 5LT5A 4JI4F 4LBHA 3V4IB 4ED7A 3CJ8A 1BMQB 5K8OA 1DRZA 4WTOB 4WFAQ 1CJVA 2PC6A 3CW2C 3PKYA 2CNNB 1S1XB 4WKRA 4C0HA 2CVEA 2G1HA 5AXNA 4TN2A 4DHVA 4WE1A 2F4FA 1WI6A 4JI1J 4J91A 3TUPA 3A8KA 5IV3A 4RW7B 4Q8FA 4F4AA 5KFJA 1YTYA 3LW5C 4DCPB 4O3SA 1JLQA 1S5ZA 4I67A 3IR5B 3ILIA 5F8MA 2A2CA 2WONB 4J9KA 2YH1A 1SL2A 2ZJQQ 3PYEA 1YZ6A 2ACYA 5CCMA 1H74A 1N52B 2IYGA 3CDAA 1GK8A 1BQXA 3GQCA 3UN3A 3IG1B 1VIOA 2CQ1A 1S6QB 1J27A 3PW5A 5H1SV 1C0TA 2IAJA 3D1OA 3ADAC 3TA2A 3GB0A 3NMAA 4DL6A 1FWLA 2HBRB 4OV6A 2MQQA 4C2MA 2NUUG 1WC3A 4Z2XA 3MMBB 4Q0BA 3L7OA 1RTDA 3V81B 5HMWA 2FHKA 4DLEA 2HHXA 5KFWA 5DDRC 1D9DA 4QYRA 2RB7A 3CC4S 4P74A 4W92B 3Q23A 2O67A 4K0KF 1TUGB 1DY3A 4RBUA 3QRRA 1N0UA 4KR0B 1Q0NA 3ETOA 1G3OA 2HQIA 4IRCA 2OPQB 1IN0A 1ZM4A 3QSIA 4K4TA 3DRRB 5B7WA 4GC6A 3DGPA 5DQGA 3TO8A 2DRBA 1RKIA 4FZVA 1LW0B 4CH1A 1MLAA 4J37A 1JJ4A 4EI2A 1HW8A 4H4MB 4DV6J 4NLGA 2I2YA 4IO9Q 1IQTA 4IFYA 1JWWA 3K17A 2CWXA 3IM9A 2OEKA 3CCLS 2AJ4A 3DOMB 1U6ZA 5KOXA 2M3DA 3HT0A 3VAFA 2V4QA 5IQ6A 1BXNA 3MEGB 3BKUA 2NZ4A 2HZVA 1YDLA 2ZH3A 3KLFB 4WF9Q 4QYZJ 2MQOA 4NYZA 4Z7CA 5GAGI 5DQHA 2HVZA 3FEXB 2C2ZB 4O4RA 1XQIA 2YKQA 2A10A 1SCJB 3NGSA 2ASDA 3OL9A 4YUDA 3MAAA 2MPUA 4DL2A 4OYAA 1EKSA 4GVBA 1WNEA 3TJ9A 1QAXA 2EWHA 4BLGA 3FZ2A 4YB5A 1S79A 3MR5A 3SIPB 4X4QA 1TAUA 1IBCB 2BJEA 3SQGA 3FNNA 4ED0A 2KL8A 2DVIA 3N28A 3DDIA 2X51A 4DFJA 1S1WB 4O0IA 3BO2A 4MTPA 2KXHA 4B9NA 2DNOA 5IXUA 2XHWA 1U0HA 4B3OB 4WYWA 3D1HA 1RT3A 3W7BA 2VPYB 2YKPA 2DO4A 2MKYA 3A1YG 2FHJD 2QL5B 4ZP8A 4WKYA 4BBYA 3MM7B 4IG0A 3OFHA 2DYAA 2ZBRA 3EDRB 5D4LA 5HL7Q 4LFCF 1RWPB 3GWCA 2MKKA 2UXBF 4ZN3A 1N5QA 2LU1A 2VG7A 5KFFA 2H65B 2AYGA 2YWGA 1G6BA 2PFDA 3N6LA 5HAOA 2GC8A 3UVJA 4ILRA 1BHNA 3NS5A 5HVGA 4BHQA 3ZFVA
chains in the Genus database with same CATH topology
1MROB 3MEDA 3MTJA 2AP6A 4P7TA 1CG2A 1NK7A 2RDIA 2ZITA 3WDOA 2K7JA 2W7AA 3BGFA 1KSPA 1KTQA 4XPCA 2VPWB 2W9CB 4FBUA 3NG8A 4A4JA 4NA1A 3KMQA 3NNHA 1AFJA 2RE1A 2OMOA 1RT2B 3TQ1A 3T5HA 3JYTA 4OLPA 4OHWA 2ALZA 3OQ2A 3CTRA 1NK4A 2AGPA 2DCLA 4MMOA 4RLEA 3MGJA 3U7JA 4J9RA 1LWCB 5DDOC 2EPIA 3KHGA 1H3DA 2DGSA 1DQ8A 1S1TB 1HBMB 1DFDA 3HT3A 1Z1ZA 2V5HG 4WFXA 2DH9A 4Y28C 5L39A 3DM2A 2VG6B 3M8SA 1GTHA 3N5FA 4ZP7A 1U26A 3HXMA 5FDLA 3R27A 1JIHA 2BDPA 4Y2MA 3MD3A 1K73T 2BVZA 3GZ7A 4WZQA 1R27B 2DHXA 5T14A 3CUNA 1F5BA 3OJUA 4ZPVR 3M2VB 4KV8B 2WB1D 4KSEB 3KLIA 1KEKA 1AFIA 2E9RX 5CYMA 4YR0A 4RW6A 5LSRA 3E2EA 1NKBA 1P8GA 4K5RA 2NLWA 2B9XA 3MM6A 3SDEA 4F02A 3MUVP 3PJXA 1N8RT 1HBNA 4RWWA 2ZNYA 4YB1P 1CLFA 1S1VA 1HBUB 3T6JA 2IA6A 3QZ7A 2XY7A 3X1LB 1DTQA 1QY7A 1XMBA 5KG6A 3HKWA 3OFGA 1DTTA 2VODA 4TYAA 3PR5B 1XR7A 1HWJA 3LOUA 4CQ1A 2ZVSA 1YJNS 3HF5A 1RTIB 1O8BA 2KT3A 1SH2A 3P96A 2XMMA 5I3PA 1L5UA 4FYDA 1U1LA 2BXJA 2A2DA 4HI1A 4JOUA 1N5YB 3D0HE 2LXUA 1X5OA 2ZC4A 2FJEB 3K7RA 3WX4A 3D0IE 3B4DA 4ZCMA 1WHWA 5K5MA 5LL6d 4EEYA 3DOKA 3WC2A 4XAKA 3DYAB 1DLOA 1IKWA 3THTA 5HP1A 2OD6A 2X1AA 2R9LA 2VQEF 4YHHF 3VAKA 3OSNA 1SJQA 3MMCB 1FRMA 1U1RA 1U1PA 4DV2F 3LANA 4R8UB 4WFYA 3IS9A 3MFIA 1VRUB 4DSFA 3PJWA 3OTBA 1SJ3P 2CQPA 2XS5A 3W2VA 1TL3A 3LP2B 2MMYA 1FKAF 1Q7LB 2DPIA 4U6PA 2ZC3A 2PIIA 5SUHA 2AF6A 2RQKA 2RSQA 5HBMA 3SCJE 2R8IA 4N56A 4FF4A 2I5JB 5DG8A 3ZC4A 2CPYA 1KNZA 4QWBA 3NKYA 4FS2A 4NZ6A 3S6EA 3CMES 4IQXA 3CULA 2ZUGA 1FD8A 1XMOF 2WBMA 4LMZA 1JLGA 4C4WA 4J9OA 5K8MA 4NXNF 3V6DB 3N9UC 4Q45A 4MFBA 2XSJB 3L09A 2CJQA 3OR1B 3MM9B 5KG3A 4URGA 4ZMMA 4ELUA 1FCAA 2EI5A 2FVPA 5J1EB 3AAWB 1RJJA 2IC3A 1N0VC 2AJFE 2B7BB 3DDKA 2KM8B 4A8WA 3QO9B 4DPOA 1HQEB 1JLQB 5KT2A 2YNHB 3J7Z5 3PEHA 2FLOA 5E3QA 4R5PA 5K14A 1V9OA 3PACA 2V94A 1IBLF 2R7UA 4RU2A 1RA7A 4NX9A 3DU6A 5K8PA 2L9DA 4ZS6A 4B3RF 1YRXA 4A8QA 2XO7A 4N8OA 1TFWA 2YX4A 3IWNC 3AA9A 1ELOA 4Q7AA 1KHVA 2GHPA 4TLRA 3K0JA 2ERRA 3FGVA 5F9LA 4WK3A 4KRWA 4I7FA 5I3UA 1T03A 4IH5A 1TL1B 3I0SB 4EYIB 2QT7A 5HMZA 4QW9A 2IFXA 3CJKB 5IZHA 5B0CA 2PFFB 4IOAQ 2M0GB 3T1AA 1YITS 4KJIA 2ADBA 3CXCR 1NK8A 5F8NA 2IAJB 4OMFG 1U4BA 4IR1A 3MPVA 3VQSA 1APSA 3PFEA 2Z8QA 4I2QA 4LF5F 2YKNB 2VG5B 2A18A 2CQ4A 4MYTA 4ALZA 1HWUA 1KQKA 2MQMA 3HZEA 2KYXA 1N88A 2JRSA 4LQ9A 3KTQA 4LF4F 5KFOA 4KB7A 1T94A 2DGWA 5G0RB 1JJ2R 4CCHA 2D41A 3OTEA 3PIOQ 2VFSA 3LPYA 2RD5C 2DD8S 1H38A 3M6WA 3MECA 3MI7X 3H4BA 4Q0BB 3KLGA 2UXCF 4LJMA 1KTVA 1ZM3A 2PA8D 4ZVEA 2CFXA 2OPRA 1U24A 2X1BA 3I5BA 3AH6A 2FJXA 2X3GA 2O66A 1YBAA 4QJVA 1L3UA 2FB0A 2M70A 2RT3A 4IDKB 4I1TA 2HHHF 3RAQA 1FVSA 1MMLA 3M2RA 3T9NA 2ZHAA 5E41A 4QWEA 2BQUA 1JLFA 2DNGA 3DLKA 4BCAA 1B7FA 4YB6A 2E9TA 4CZCA 1S97A 2AQ4A 2GHWA 3BF4A 1IM4A 4HI2A 4F50A 3J80Y 2VFRA 3ZZYA 1U6FA 4EYHB 3JSBA 4KHMA 4FF1A 3CCQS 4GO7X 2AW0A 2W24A 4F3OA 2C2EA 1IKVA 2IVMA 2GGPB 1Q86T 2KKHA 4DBQA 2KFYA 3FSIA 2O01C 2DR5A 4F67A 1A6LA 2YKAA 3RZAA 3NGKA 1XR6A 3BREA 1HHSA 1VQYA 3UDLA 1VRTA 2GIRA 2LKZA 2X1GA 3M30A 2J0SD 1FTRA 4KO0B 2XCAA 1F0XA 2YX7A 2XMKA 3P5TL 1R7IA 2EFNA 2N7CA 2Q6BA 3M8RA 3OSPA 4DQPA 1LWFA 3G6VA 3PO4A 4I2PB 1REVB 2GQQA 1ZPWX 4I4BA 4PXEA 4CT9A 1GTEA 4ZPTR 4DFMA 4GKKF 1T95A 2K3KA 2VPZB 5JUMA 1RA6A 1CQMA 2CPXA 1ZTWA 1JLCB 2E44A 3FMWA 4QR1A 4DV7F 1KLMA 3ZZUA 1TK0A 1HYSB 3HVTA 2AD9A 4B3SF 4RW9A 1VGYA 4ZLPA 3T5JA 5MAOA 4WFBQ 3HVAA 4J9PA 2Q1LA 3FVYA 3KFWX 5A8RA 1RTJB 3VCDA 4F3MA 1N5SA 2NREA 3EZUA 2MSTA 2RF2B 1UL3A 1KQFB 1N56A 2QLWA 4FF2A 3CB4A 2HG4A 2FC9A 5CA5A 5LMNF 3QGHA 2V4JB 3DLGA 1VQ9S 3MEEB 3T1HF 3PW4A 3TUZC 2BABA 3FCHA 4ES1A 2B51A 3IRXB 3KK3A 3V5RA 4OLOA 2WSFC 1FRKA 4ZHRB 3C6UB 1SI9A 4PG7A 5D6GA 2C28A 3MXHP 2QA1A 3FEZA 2PGCA 1WWHA 2CPDA 4Y2KA 2QLXA 2JDJA 2B5JA 4B3TF 4Q8EA 4F2RA 1UJ5A 1SV5A 3IAM9 3KG1A 1TZ0A 3LAMA 4F4ZA 5KFDA 1SB6A 4PG5A 3NNAA 3GV5B 3H25A 1NRKA 3KLVA 4XK8C 1ZAVA 4YEAA 1N6QB 3UCUP 3HVRA 1NU4A 2COLA 2KI2A 4C8YA 3KG4A 1QJHA 4NLYA 1FDBA 1PILA 4U7UK 1V6HA 4EU0A 1VQMS 2RMLA 1F9FA 4ZPAA 4RZRA 2DITA 3MD1A 2J9CA 1KQSR 4ECQA 1P27B 3AJ2A 3LGNA 3EGWB 3DHWC 5G4DA 4CTAB 1URRA 2XY6A 2R8KA 4DR7F 1TKTB 3QPIA 3FZBA 3AHPA 1QSLA 2WTFA 2JWNA 1FDAA 1S0VA 3SI8A 4I6YA 4A8KA 1FTCA 3K5OA 1UW4A 3MOZA 2POKA 4DG1A 1OSCA 5KFLA 4X4UA 1WI8A 3M32A 5L9XA 2HHWA 1BC6A 1FJEB 1VJWA 2AJ1A 4JI2F 5CCLA 4C97A 1HI1A 2Q6CA 2RRBA 1X9WA 1G7CB 4MIBA 4XO0A 3MM8A 2HWTA 3JTNA 2CQ2A 1EP4B 3FDSA 5KAKA 1U48A 3HZGA 2CPZA 5J2NA 4WIIA 1XR5A 4XDCA 2FJAB 2DGXA 3PV8A 2FVCA 4E0DA 3SQGB 4N77A 2E9ZA 3HKZD 2JEIA 4OQJA 2BE2B 4NA2A 2B6AA 1R8CA 2JL9A 2RS8A 1VC0A 1E6VA 2OFGX 2V9KA 5H9EJ 4C8OA 3NAIA 1XBWA 1S1UB 2HFZA 3OTDA 5J2QA 1JXEA 1S1XA 5J2MA 4LVOP 1KOHA 2KB2A 3CCWA 2G0CA 1GX6A 3TUJC 2N3OA 2FJDB 2IA0A <