4WKRA

Larp7 wrapping up the 3' hairpin of 7sk non-coding rna (302-332)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
SRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the mechanism of stabilization of the 7SK small nuclear RNA by LARP7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords La-related protein 7
total genus 40
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wkrA02
2RT3A 1WHXA 3DLLQ 4YOEA 3RW6A 3CCES 3SXLA 1RK8A 1DHMA 2G1DA 5DETA 3NS6A 2ZJQQ 2RQCA 2M8DB 2MKSA 2D9OA 2M4MA 3B4DA 3MI7X 1KD1T 2RQ4A 3NNCA 1M5VC 3THTA 2VOPA 2DH8A 2K8GA 1K8AT 2KN4A 3CC2S 2ERRA 1WF0A 2OIHA 2MZRA 3S6EA 2KM8B 1VQ7S 3MUTP 4A8XA 3ZZZA 2MZQA 1Q86T 2DO0A 1U1PA 2HGNA 2MGZB 1JJ4A 2CQCA 1N88A 4QPTA 2E44A 3Q2TC 1SJ3P 5D77A 1H2TZ 3CD6S 3P6YC 4F25A 1YITS 2OTLS 5ITHA 3MOJB 1NU4A 1X4EA 2JVOA 1H2UX 2HYIB 1CVJA 3NS5A 2OTJS 5IM0A 2BOPA 1SJ4P 1S72S 2MJNA 2X1BA 2KYXA 2DO4A 2KXFA 3G8SA 1YJ9S 1L3KA 3H2UB 1VQPS 2FC9A 2AYBA 2RU3A 1JJHA 2DGQA 2MY7A 3CCMS 4Y0FA 5GAEU 2X1GA 3VAHA 1PGZA 5GAGU 5MLCV 1VQ4S 2L08A 3UCGA 4W90B 2VONA 2DGWA 2YTCA 3S7RA 2DHSA 2CQHA 5GMKa 2DNGA 2MSSA 3IRWP 1AUDA 3FEXB 2MKJA 3DXBA 4YB1P 3UCZP 1M5KC 5LJ3Y 1N8RT 1VQNS 1FT8A 1A9NB 3RW7A 2L41A 4CIOA 1NO8A 2M52A 3LPYA 1VQKS 3ZZYA 2MGZA 2RS8A 1H2VZ 2EVZA 3P5TL 2MXYA 4TU8A 2MSTA 2X1AA 2M0GB 3CC4S 2PE8A 3G96A 3LQVA 2DHGA 2WBRA 1WWHA 2ZJPQ 3BO2A 4V19X 3I56S 4QU6A 2CPJA 2U1AA 2LEAA 1FHTA 1U1MA 1VBZA 2U2FA 3OW2R 3CMES 2FC8A 2KM8C 2LA4A 3G71S 1OWXA 1NJIT 2CQPA 1D9AA 2DGOA 1VC5A 1DZ5A 1OO0B 3R1HA 1YJNS 1VQ8S 5CA5A 2DGSA 2DNNA 1SJFA 2XS7A 2L9WA 2XSFA 3U1MA 4LIRA 5GADU 2NLWA 1HD1A 1VC0A 2E5IA 1WF1A 2KG1A 1M5OC 1WELA 2DNLA 3HHNB 1FO1A 1H6KX 1FJCA 2BZ2A 1B7FA 3ULHA 3FEYB 1WHYA 1UP1A 3TYTA 3PIOQ 2XNRA 4J5OA 3S01A 4C0OC 2OSQA 2MY8A 1G2EA 2J0SD 2KG0A 4W92B 2HVZA 2CQ4A 1K9MT 2CPXA 2CQIA 2XNQA 1QVFR 2MQLA 3CMAS 1DRZA 1U1LA 2X1FA 2CQDA 2DNZA 2DHXA 2MQPA 2N7CA 2M70A 2CPEA 4PR6A 4WFAQ 4PKDB 2NZ4A 2DNMA 2JVRA 2MZ1A 3NNHA 3TO8A 2DGXA 2M88A 4TU9A 1VQ5S 5LJ5Y 1KC8T 1WHVA 3P3DA 3G4SS 3HI9A 3UD3P 2M9KA 2JWNA 2MMYA 1WEZA 1WI8A 3B4MA 2DK2A 3CC7S 3TP2A 2D9PA 2N82B 1BY9A 2MQNA 4TLQA 4IUFA 2DH7A 3US5A 2LQ5A 2G4BA 1VBYA 4TU7A 4ERDA 2CPYA 2MQOA 4IO9Q 1HA1A 2MZTA 3EGNA 2CJKA 1X4GA 2DGTA 4LMZA 3CTRA 2AYMA 4U67Q 1HL6A 3MD3A 1DBDA 2KT5A 2KU7A 5IM0B 2CPFA 3MUVP 5GVQA 4IOCQ 2RRAA 1N54B 3SDEB 4M5DB 2LYVA 1HD0A 4P6QA 1X4BA 2AD9A 2ADCA 2MQQA 2B0GA 2DGVA 1X4AA 3VAGA 1X5OA 5HL7Q 3D2WA 1VQ9S 2DNHA 4WFNQ 2DGUA 3K0JA 2MKHA 4UY8T 3CCVS 1SXLA 2MB0B 3UD4P 5JVHQ 2F9DA 2DH9A 1WG5A 2E5HA 1W2BR 1WG4A 1VQLS 3R27A 2CPHA 2LCWA 2EK1A 4C4WA 1D8ZA 5H1SV 2QFJA 2GO9A 4RU2A 2LMIA 5BJRA 3CCRS 1PO6A 3J7YU 3CF5Q 4F02A 3CCJS 1X4CA 2KI2A 4IOAQ 2AYGA 4WCEQ 2J76E 1YJWS 1IQTA 4Z2XA 2E5JA 1FNXH 3R1LA 1X4FA 3N9UC 1VQOS 1WEYA 2DNRA 2MKKA 4F26A 1RKJA 1QVGR 1JJ2R 2KXNB 1A7GE 5LSLA 1WG1A 4QQBA 3THPA 1K73T 2DNKA 1Q82T 2MJUA 2DITA 1YHQS 2F3JA 3BO3A 3JB9k 1UAWA 2DB1A 2DNQA 1X5SA 3SDEA 1WTBA 1U6FA 2KHCA 2KRRA 2I38A 1FJ7A 1Q81T 3G9CA 2CQ0A 1KQSR 2JX2A 2XB2D 1U1RA 2DHAA 3VF0B 2LA6A 2I2YA 2XS2A 2MQMA 3MD1A 1X4DA 4ED5A 2A3JA 3H2VE 5DDPC 3Q2SC 3EGZA 3UE2A 1OPIA 1SJRA 4FXWA 2QA4S 2LKZA 2MYFA 2MKCA 1YTYA 1VBXA 2E5GA 2HGLA 2Q79A 3NNAA 5HO4A 1S79A 3CPWR 5LSOA 1ZZNA 2HZCA 2JRSA 1YI2S 3VAIA 2DIUA 5FJ4A 3EX7B 2CPDA 2CQ3A 2HGMA 3I55S 4QU7A 2PEHA 2LXUA 2RUGA 2MKIA 1FJEB 5LXYA 2RVJA 3CUNA 4WKRA 5CXTA 1R8HA 2F9JA 3V4MA 3VAKA 2DNOA 2D3OR 2FHOB 2RRBA 1ZH5A 4Y00A 3MURP 2VOOA 4BS2A 2KH9A 1YIJS 3L3CA 2KVIA 2EK6A 2DISA 5DM7Q 3U1LA 2VODA 3NMRA 4CH0S 2CPIA 1M5PC 3UCUP 1U1QA 1KOOA 2LECA 3SMZA 1UFWA 2CQ2A 4WFBQ 1WHWA 1Q7YT 2LXIA 4EGLA 1F9FA 2CQGA 2YH0A 2O3DA 3MXHP 2AYEA 3PIPQ 1X5TA 2MHNA 2N3LA 2YKAA 1VQ6S 2UP1A 2MPUA 3VAJA 2FY1A 1XN9A 2ADBA 3MUMP 2SXLA 4OZ1A 4FXVA 5DDRC 1URNA 3BO4A 1FXLA 4YUDA 1VQMS 4C7QA 1X5PA 3IWNC 1U1OA 2G0CA 5IQQA 2CQ1A 2KFYA 2CPZA 4WF9Q 5EN1A 3VAFA 2XS5A 3MDFA 3CCQS 5D78A 1OIAA 2OSRA 1X4HA 3P49B 2J0QD 4OZ0A 2J8AA 2GHPA 3CULA 3UWTA 4CH1A 1WF2A 2RNEA 1M1KT 4ZKAA 4CQ1A 1P1TA 3G8TA 2KRBA 2DIVA 3BS9A 2QEXS 2MZSA 2N3OA 3VAMA 1SJQA 1U6BA 1U1NA 1M90T 3S8SA 1U2FA 3CCLS 5DDQC 1WI6A 3VALA 4UQTA 5DM6Q 1KOHA 5IFMA 5LXRA 1UW4A 3CCUS 1P27B 1ZZFA 2YWKA 1JMTA 1X0FA 1N52B 2ZJRQ 2YH1A 2DNPA 3J7ZT 1VC6A 5GAHU 2KXHA 2MZJA 1R8PA 2M7SA 2V94A 1QM9A 4PRFA 2K3KA 1YWXA 2OJ3A 3BEGB 2DNYA 3G6ES 4WIIA 2LEBA 3CXCR 1U1KA 2RS2A 3CCSS 2M8HA 1O0PA 2FPHX 1WEXA 2CQBA 4LJMA 5CYJA 5DDOC 5JVGQ 2M2BA
chains in the Genus database with same CATH superfamily
1BD6A 2RT3A 3QT6A 1WHXA 4YOEA 1GXUA 2IJFA 3SXLA 1G7CB 1RK8A 2I6WA 4FYDA 3K59A 4PQAA 2ZJQQ 5E41A 2IIHA 3TWZA 4ZIVA 4RBTA 3PO4A 3BKFA 3B4DA 1V3ZA 5E2QA 4UQGA 5D3GA 1KD1T 4UTGA 4V1Ak 3THTA 1U0SA 5KFAA 3X1LB 1JLQA 2JSXA 1RT2A 3PRDA 1VOMA 3OFGA 4QWCA 1T11A 1RT3B 2ZH1A 1MN7A 1CJUB 2QJ3A 1WF0A 2NUUG 3GWCA 3BBCA 2IVFB 2FZKB 2KM8B 2UUCJ 3K89A 1VQ7S 3TR5A 2V8PA 4DS5A 4DL6A 1K8AT 3SSQA 4ZPWR 1FEEA 3R5CA 5L1KA 3ZZZA 1AA1B 2J7KA 2MGZB 2R7RA 2FD2A 2R7WA 2CQCA 4ZVSB 2PFDA 2B7CB 4TNOA 3OL8A 3OBIA 3DLHA 4KKOB 4USJC 1S9GB 2LLZA 1TL4A 3CDBA 4JP8A 2QA1A 2QYGA 4ETXA 4ECSA 1SJ3P 4F2SA 1SH2A 2E9RX 4I67A 3GONA 1YGYA 3CD5A 3D7SB 2DRAA 3EVOA 1KONA 5C25A 5ITHA 2WW8A 3WX8A 3H0PA 5LT5A 1HWJA 1KFDA 1NU4A 2ILYA 3ILJA 3BSCA 3MOJB 2O66A 3EZUA 4KB7A 2IHR1 1XC9A 1Y7PA 1IKVA 1TKZA 3M8PA 3OSPA 3NS5A 2W2OP 5KFIA 2HYIB 5GAGI 5IM0A 1KN6A 2V68A 3OQ2A 3VR1A 4DL4A 3J7A1 4I0WA 3V4IA 3FC9A 1T3OA 1FVSA 2HBRB 2DO4A 2KXFA 3R5JB 1NHKL 4Q7AA 4ZIWA 3EZ5A 3MCOA 4K4SA 3M1VA 5HBMA 3NMAA 3R5GA 3PACA 1GX6A 1ZAXA 3CJ4A 3SCLE 4FF1A 2Y1LB 1L3KA 4ZPBA 1NSAA 2FC9A 1QAXA 1JLBA 3BZQA 2G2OA 4MKVA 4NRUA 3C19A 3D5MA 2RU3A 2BACA 4WTOB 4IG3B 3TZZA 1RWXB 2MDAA 1OMSA 1RDRA 2CXEA 4Y0FA 2R8IA 1HPZA 4KTQA 4CYUB 4NXMF 5GAEU 2X1GA 3AY0A 1AB8A 4ZS6A 3PJWA 5F9NA 2V4QA 1PGZA 1S1TA 2K7KA 2DRBA 2BANA 4W90B 3JYTB 2DGWA 3OFHA 4UOCA 1S77D 2V8GA 1VBKA 4X65J 3MHYA 4UW2A 4KFBA 1XEZA 2DRDA 1LK7A 3FRYA 4CI0B 1S9FA 2XMVA 2RB7A 5C42B 4YB1P 3UCZP 1WKLA 3GE9A 4A8QA 1A9NB 2L41A 3ZC4A 2DKOB 2P6TA 1HW9A 5T14A 3LPYA 4BDPA 3DLGA 3KWMA 1QLNA 3GFZA 2JNJA 1G4CA 2H9ZA 1SB6A 1H2VZ 2RS8A 3NG8A 4XDDA 3UDLA 5DQIA 1P9YA 4QJVA 3I31A 4LF9J 5IQ6A 1FK9B 4ED3A 2PE8A 1F3FA 3T19A 1PAEX 2Z2YB 3LP1A 1IVZA 4V19X 4F04B 1LWEA 2ZITA 3OLAA 4NA2A 4JBCA 6FDRA 2FUG9 2O67A 2ALZA 4I2PB 4PG4A 1UWBB 1TK5A 3FK4A 3EPGA 7AT1B 2R7TA 5AT1B 5KTQA 1Q8BA 3OW2R 4DSJA 2AJQA 4A46A 2NUHA 3KUHA 4ZCLA 3TUZC 1L3UA 2VPXB 3G71S 1I94J 1CLFA 1NJIT 1OYDA 3EGVA 1DZ5A 1N0VC 4LVOP 3LWMA 4ED0A 4R0EA 1AXQA 3B8HA 3L4BC 3R1HA 1YJNS 3FBCA 2RUSA 4NX9A 3UR0A 5K14A 2AGPA 3CD7A 3MM9A 5D8HB 3KXDA 3C15B 3SCJE 2Z58B 4TQRA 3FUYA 3BGUA 5J2MB 4MJKA 4OLPA 1SVDA 1DTTB 1HI8A 2DEIA 5GADU 1HD1A 1U2RA 3QIPA 1Q79A 4PUOA 1YJUA 4C3LA 1WF1A 2KG1A 2P6SA 4HT7A 2YVSA 4ZVRB 1ACMB 2BKOA 2YQ1A 4GMKA 5EGYA 3GPAA 2IYGA 1S6PB 1IKYA 3M4XA 4P72A 1CQNA 1CULB 5D4LA 1RAOA 5FIIA 1V3SA 2H48B 2HQ3A 2WONB 3TYTA 4ED4A 5FLXY 4ENOA 1IR1A 2ZE2B 4NA3A 1R31A 1XQIA 2DCLA 1PYTA 2ZC4A 3CWJA 3SQGA 1YJVA 3FMBA 4ICLA 3VV2B 2IC3B 1I5OB 1BQNB 2CPXA 1GMWA 2AV5A 2GVDB 5AXMA 5BR8J 4XO0A 2A0FB 3NEKA 4DCOB 2FGOA 2Z2ZA 3KG1A 1FDDA 2VHGA 1QVFR 3TA0A 5B09A 1T0TV 4OJ3A 2Y3YA 3N79A 5T7LA 1KP6A 2YH1A 1DRZA 3U27A 1XR5A 3W61A 4AL5A 2CQDA 2MLXA 1B7YB 3QGIA 4CLWA 2OPPB 2B8QA 4LF8J 1PCAA 1U6ZA 2MQPA 1HNZF 1B99A 1RWWB 2WAQD 3W5YA 5A8WA 2W9CA 2HAIA 3JSMA 1E6VB 4IG0A 3ZZ0A 4U9RA 2JVRA 1QD1A 3GG0A 1SKWA 2OEJA 3TO8A 1ZPVA 4OI6A 1R89A 3CJRA 3FFIB 5CZVA 2DPIA 4NYZA 4N76A 1Q5YA 1VDHA 3C14B 2EFVA 1UVJA 4EBDA 1KC8T 2HNDB 4DDFA 2PI4A 5CABA 5BR8F 4GKKF 3R7NB 2ZH7A 1EKSA 1KDNA 3O3LA 3QAEA 4YS2A 1RXOB 1U02A 1WEZA 1YK9A 3PW2A 3B4MA 2NR0A 2VG7B 1T9YA 2VQFF 2WRMA 2VA2A 2BJ7A 4D3HA 4C0BA 3MR3A 1NJWA 4CCHA 2KVQE 1IKXA 2D9PA 4RUAA 2V2VA 1VK3A 5BYRA 2ASJA 2N82B 4DPYA 4ZVHA 4JI1J 1IWAA 3RG6A 3TUIC 5CCLA 4DR4F 1EETB 2I0XA 1XR6A 2ZZNA 3QYYA 4IUFA 2BQ3A 1NZ8A 3A8KA 3ADAC 1TKXB 3H5UA 3IG1B 4I1TA 2OUGA 2RF2B 5IT4A 2G4BA 1FE0A 4RU9A 3M8QB 4DSLA 4BC9A 2E66A 2CPYA 4DUZF 2MQOA 3ILLA 2EKYA 2V50A 1R0CB 2J9DE 4C48A 2XQCA 3BKTA 4IO9Q 2HBYB 3RAXA 3EGNA 1SCJB 1EJ7L 3HVAA 1R7IA 4USTA 2BVZA 2MEWA 2AQ4A 2CJKA 4DV0J 2VQFJ 2D41A 1O8BA 2L48A 2RQKA 3M6VA 4DR3J 4DX7A 3KLHB 3EDRB 1G3OA 2L9DA 2E1CA 3TUPA 4A8YA 1WTBA 3CTRA 4XPCA 1WOOA 1KKHA 1HL6A 2F8EX 2FTRA 2IM2A 3MD3A 4CNZA 1DBDA 5SZTA 4IOCQ 4X4RA 1L3SA 4LF6F 1RT5B 1X60A 1N54B 2B7BB 4DF4A 3C2PA 4B9UA 3K5NA 2LYVA 1NJXA 3SSRA 5ETRA 3R9LA 2HHTA 4AXIA 5KT3A 4QOTA 3WIVA 1X4BA 2HLTA 2YNFA 2AD9A 4WXWA 1REVB 3AXMA 3BH6B 3L7OA 2DGVA 2OI2A 4BLGA 1N5QA 1VCTA 5KT4A 4NWBA 1X4AA 4CLLA 3BJYA 3PRBA 3VAGA 1X5OA 3V6HA 1PBAA 3A12A 3R3TA 5HL7Q 4X4PA 1N33J 1RBOB 2MKHA 1S97A 2XULA 5B08A 3RR7A 2GMJA 1TL3B 3CCVS 4PQUA 3QIDA 4GC6A 5H9EK 2MB0B 4DV3F 4H4MB 5JVHQ 3T5KA 1X9WA 3NBPA 2AKWB 4URSA 4RW6A 4PWDA 1NDKA 1VLOA 2W2MP 2AIRB 3WHIA 4ETZA 2W9BA 2CPHA 3UN5A 1PJ7A 3PCOB 4DFMA 2W4DA 2ZOGA 2XO7A 1SQEA 4RU2A 2UVWA 4DV6F 2YNGB 3VVTA 3CCRS 3EZOA 3L95X 1PO6A 4NCGB 1FFWB 3TEGA 3J7YU 2FY8A 3GJRB 1PYOB 2BKPA 3N6MA 2KI2A 4L76A 1UCNA 1HBNB 1I51B 4WCEQ 1CJKA 3HP6A 2EKNA 1YJWS 3CGIA 2Z30B 2APOA 3R1LA 2CVIA 4ZVTB 4UF4A 1RT7A 3MEDA 2ATCB 2R4FA 3IAS9 2MKKA 1X9SA 2QTWA 2GIQA 5DG7A 2ZDPA 1NK5A 3C8YA 4CO5A 5HP1A 3NWGA 3TNVA 2E9ZA 3FBEA 4OX8A 1O6XA 1QSLA 5IT9U 1IXKA 4DR1F 2YKNB 3T1HF 3THPA 4DR5J 2NYHA 2MJUA 2HHPA 4B9MA 1YHQS 3F73A 4DU8A 3BO3A 2DB1A 3KNGA 5DRKA 5HROB 2Z4PA 4NPOA 2V8DA 2Z56B 4DX5A 1X5SA 2FLLA 2KHCA 3GB0A 1S0VA 4DQPA 1C0TA 4K4VA 4N77A 2I38A 4USWA 3PY8A 1AFIA 2LFVA 4NLSA 4C3MA 2JX2A 4DI6A 4I56A 1BQMA 3RAMA 4ANCA 2WK4A 1NRKA 3G82A 1UETA 4WU3A 5C24A 2HHHF 2PA8D 1A0OB 2HAFA 4ED5A 2HFVA 4AUKA 2C3PA 2EFOA 3PYDA 1IR2A 3DKDA 3F41A 2XZTB 1YZ7A 2EBEA 2GV1A 3FZ2A 3ENQA 3THVA 3OD2A 1U8WA 4OV6A 1JLQB 4OFZA 4B17A 1RT2B 3EDQB 1YTYA 4M5MA 2CNNB 2WVFA 2OELA 3SFUA 4J9MA 4PPDA 3OVSA 1Q1KA 4CRJA 5LSOA 1QY7A 4DSFA 1U0HA 2GVZA 2XO6A 1R3NA 4ZVPB 2DY9A 5KG5A 1NSQA 2HVIA 2C2ZB 2CPDA 1M5HA 1RHKB 1HNIB 3MECB 5ADZA 2B9XA 2HRUA 2PEHA 3Q8VA 4XDCA 4I6YA 4KHPF 1FTCA 1X7VA 1WC0A 2XLIA 3CUNA 5CXTA 1R8HA 1RWUA 3VAKA 2DNOA 1JXVA 3ZO7A 3BH7B 2EBGA 4MFBB 4ZLJA 2J6UA 3KJFB 2CFXA 1RHQB 2IMWP 1SJ1A 3LP0B 3G2XA 3A1YG 2HRTA 3TVZA 2BQUA 2VOOA 4KO0A 4Q43A 1ZM2A 3GU0A 4LIWA 4AXJA 4JI0F 3HX9A 3M9NB 1TKZB 3M8PB 1LK5A 1FFSB 4KH0B 3NGUA 4USIA 3TJ8A 2CJXB 2EK6A 4DPTA 3OJUA 3DOKB 2VODA 1TL5A 4U8YA 3K58A 3KUGA 1N5TA 4LF9F 4NCAA 3WX4A 3TANA 4IRDA 2BW7A 1RLDA 2ZZTA 4QIFA 4RPFA 4Y2KA 4ES2A 4HH0A 5HBMB 2CQ2A 3D4JA 3NGTA 4UUXA 4DN0A 3AHPA 4LRBA 1VGYA 4N5SA 4DX8H 1JLBB 3NRBA 4DHVA 1URRA 3QZ7A 3TI0A 1D1UA 4EGLA 4F50A 3KLIA 4AQYJ 3K2YA 1VLYA 1VQSA 3KFWX 4JI5F 4FS2A 1IR0A 1XIQA 2O3DA 1EQMA 4CYUA 3RRGA 1LWFB 2OD6A 4L3NA 4LSZB 1PIEA 1Q16B 4ZVGA 4U7CA 4P7TA 2UP1A 3JYTA 3JQKA 2E5LF 1VRUA 3ET6B 2ZHAA 1HHTP 3J81j 1LW2B 1SV5B 2IM1A 1HFEL 2OPSB 3DCAA 3LOUA 1XMBA 3I0SB 2ADBA 1ZAVA 4DV4J 4K4ZA 1W2IA 4CO4A 4OZLA 2QV6A 3BO4A 3RTVA 3QJPA 2LXFA 1HARA 1VI7A 1EKRA 3IWNC 4O3RA 4LBIA 5GAHI 2AJ2A 1FWKA 1SUQB 2G0CA 5IQQA 3DFEA 2V4JB 4M5LA 1O5JA 4F7VA 3W8PA 4ZLLA 3H25A 1QUVA 1SQFA 4HACB 5IV4A 1T05B 5EX3A 4NXMJ 3SSSA 2XS5A 3F44A 2V2KA 3H20A 2RKIB 3K8WA 5F8GA 4YQWA 2YQ0A 3Q8RB 1U48A 2VV5A 2BQRA 3KLEB 1FK9A 5HLFB 2DR8A 3GCXP 4JB8B 1FKOB 3AQOA 1KS2A 1WACA 4EYHB 1Q8KA 4DSKA 1LWEB 2J0QD 2UXDF 1QAYA 2RMLA 2UVRA 2J8AA 2X3DA 4JI8J 1UWBA 1XNQJ 4IFVA 4DFJA 4IRKA 2PDAA 3L9ZA 1LWXA 2VG5B 2C2DA 2B43A 1N33F 4JV5J 1J5EF 1O51A 2Z8QA 4KGVB 2NXUA 2RNEA 3PNIA 3X3UA 4DJBA 5D4NA 4ZKAA 1FD8A 1KLMB 2VKZG 1X0PA 2JZ5A 1BLUA 3OXFA 4ZPVR 1Z4UA 3GIKA 4EBEA 5K14B 3MM9B 4F2RA 4OHXA 3CE8A 3C15A 4NLQA 5EUHA 2FLNA 1UMJA 4YB5A 3M8SA 2QEXS 3DI6A 4CP5A 1FX2A 2XMAA 2XMJA 5KFXA 4A8SA 1SQGA 2ROEA 3WBZA 3S8SA 2C2KB 2WOMA 3J80U 4ZHRB 4ZN1A 4X66J 5DDQC 4UQTA 2I8EA 4OYXA 5KOXA 3C3LA 1HBOA 1KOHA 3W65A 3MM8B 5LXRA 1NH8A 4Q8FA 4DR7F 3HVWA 1CULA 4ZVEA 1JMTA 3TVYA 4LFBJ 3MF5A 1N56A 3MTJA 1X0FA 1NAQA 3FJ2A 3NGDA 5J2QA 1MROA 3BM7A 2GCFA 1M1HA 3W1YC 1TKDA 4OYPA 3MFIA 1NZAA 3F56A 1YG0A 1ZM9A 1N4LA 1BQNA 9ATCB 2K3KA 5KG2A 2R7XA 3GFXA 3HHEA 2VG6A 3MOZA 1EP4A 1OY9A 3QWUA 4ZP8A 4EI2A 5M2RA 1ZAWA 3MMAA 4C8YA 2B6AA 3QJLA 2YNHB 3UR3C 4ZP9A 1NDCA 4M5JA 1C0UA 4O44B 1TUGB 3DC2A 1HQUA 1N32J 1WEXA 2OPPA 2VL1A 4RJVA 5CYJA 3CJTA 3Q8UA 2X3GA 3Q83A 3TJAA 2AT1B 3BF4A 4IG0B 4LF4F 3QO9B 1HBMB 2V4RA 2FQQB 1LQ9A 2W2NP 4M8LA 1JJCB 3PV8A 3RW6A 4X84A 3FFIA 4DR5F 1TUVA 4BWMA 1JIHA 5C7PA 2R2RA 4TY8A 3C14A 4WYWA 2RQCA 1BUXA 2IM0A 4OIXA 2CIMA 2D9OA 2M4MA 4MKBA 2EEYA 4DCJB 3BR9A 1S0NA 3MM5A 2C42A 2G2YA 4OZ2A 4ZA1A 3NNCA 2UU9F 1M5VC 1XMOF 2QYCA 2E1PA 3V5RA 5HSPA 2VOPA 1C1CB 4C8MA 2DH8A 3DRPA 4TKTA 1RHUB 1R0AB 2HBZB 2PA3A 4C6AA 1LEOA 1NPRA 4XPEA 4X4OA 2ERRA 2OIHA 1UFKA 2E1MC 2MZRA 3S6EA 6FD1A 4P52A 3ILOA 4CLZA 3RBZA 4CLPA 1WTFA 2GNKA 1OPZA 4NI2B 4OI0A 3CB4A 2IRYA 5FDLB 5B0CA 1CC8A 1FD2A 4EUVA 1S12A 2DXDA 1EHWA 3UDCA 1N5YB 4LBHA 2H5JB 3DLEA 2CAJA 1JJ4A 3CSKA 1N88A 3H4DA 4RUCA 3A3PB 1FNMA 3B78A 3W5XA 1IBLF 4LF7J 3LW5C 4I7FA 4KHPJ 2E44A 1TTHB 4B3OA 3P6YC 4PCQA 5KFKA 1WNEA 2C2OB 4F0KA 4C98A 5L1IA 5D6GA 2JOQA 3M8WA 3NY0A 1PSDA 1KQFB 1JXLA 4ECXA 1F5CA 3ETOA 4YY3F 2C3MA 3MM7A 3OXGA 1H2UX 1RSCA 2UUTA 4QYZJ 2VFTA 4LFCJ 1UVLA 1CVJA 1NB2A 4QWAA 4CT8A 1MU2B 3PX0A 2BOPA 1SJ4P 1FRMA 4HI2A 4LSNA 1R8BA 1TK8A 1XMQF 1Q78A 3W60A 4X4QA 2VPZB 2HNYB 2H5EA 1H98A 1R8CA 1UA0A 3T9ZA 3ZZUA 3WZ0A 1UJ6A 1IBLJ 3CJ3A 3H2UB 1VQPS 3B6BA 4ZPCA 4G1QA 2I9SA 4LR7A 4JI2F 1TK0A 2GC8A 2JHEA 4FS1A 2J0WA 1R43A 1YJTA 3CEDA 3D1OA 1JJHA 2W25A 5HI7A 2EW9A 3C16A 3P45B 1MWZA 3PXGa 2ZBPA 1ZTWA 3I9ZA 4B3MJ 2YKMB 4HDHA 3LP2B 4WJBA 4QBUA 4GKJF 1YZ6A 2VZ9A 5GAGU 1VQ4S 1FF2A 3K5PA 4KT0C 3UCGA 3NLCA 1UVMA 4M94A 3Q22A 3DDNA 4JI5J 4PWDB 4DL5A 1PBUA 2DNGA 2OPQB 4DFPA 3M8RA 2RU9A 2BRKA 2HEKA 4OYIA 3QT7A 4I64A 3FEXB 2MKJA 4C11B 2XB2D 2YNGA 3H98A 3QT8A 5LJ3Y 5EWEA 2E1AA 3T5HA 3RW7A 5I3UA 2CJQA 3I0RB 4B3SF 2RSQA 5A8RA 1T8EA 2R2TA 4R8UA 1MSWD 4KYZA 5HJYA 2ZUAA 4JI7J 5LMUF 3ZZYA 2HQIA 1HBNA 3H40A 2W2QP 1L5UA 3KTQA 1P9QC 3P5TL 4Q2LA 3OR1B 4DV3J 3BN7A 4EYIB 2C28A 2Q3PA 2M0GB 4I69A 3FNNA 5K9FA 1RISA 1RT7B 4DZ6A 5GMEA 3RB6A 3CC4S 4MIAA 1HBUA 4JV0A 5EWFA 3RYLA 2ZH8A 2ZJPQ 3C6TB 4MAKA 2I1RA 1GMVA 3GG1A 5HP1B 4QU6A 1S7HA 1IM6A 1S6OA 2AX1A 2GQ2A 2P9CA 2Z2MA 3T6JA 2LDYA 4X4TA 2KZMA 3KKFA 1VBZA 1KTQA 1UFLA 4NXNJ 2P2CB 3DNCA 2QSFA 4TVAB 3OHAA 2W8LA 3W66A 1OWXA 3PW4A 2CQPA 2RDJA 1VC5A 5A8KB 4K0KJ 4WFXA 1VHIA 4J9NA 1XNQF 1VQ8S 1C0TB 1JXEA 3PHTA 2ZD1B 4ZCKA 3AD9C 4DV6J 5E3AA 3BGOP 1SJFA 4ILMA 3NGSA 2XGQA 2XSFA 2KJWA 3G86A 2OP5A 1MNEA 3OFEA 2CA9A 2L9NA 4LIRA 4Y2CA 3RJMB 3U1MA 4B02A 4CO2A 3KMSA 3BSOA 2ADCA 3U7JA 2IAJA 2E5IA 3HHDA 4ANEA 1UW9A 4ECRA 1TFWA 1ZA1B 1ZOTA 2EG1A 3HHNB 1H6KX 1J5EJ 2HS3A 2OO4A 4K59A 1FJCA 3T1HJ 1XWLA 1YLXA 2IBOA 1FRHA 2BA9A 3FEYB 4Y2AA 2Y8WA 3R2DJ 1DLOA 3PIOQ 5AJ3J 1JKHA 1CC7A 1HNVA 1PJ5A 2CNKB 2OSQA 2VH7A 2Y1RI 2MY8A 2VC0A 2UUBF 1G2EA 1RLCL 2KG0A 1ZETA 5KT6A 5DGBA 1SC4B 1FKPA 1K47A 2CQ4A 2PMWA 1BC6A 3EPIA 2EC2A 2G2ZA 1U0HB 2BEFA 5K20B 1K9MT 3RR8A 3DLKB 2GVZB 1UZHA 3M05A 4BHQA 1GX5A 3UVJB 3BV8A 2V8VA 1GXTA 2A6MA 2MQLA 1PYSB 1Z1ZA 2V2QA 4RW8B 4O3PA 2QLFB 1HNIA 2UZAA 3MECA 4URGA 5KFQA 2Q43A 1B3TA 4NMLA 2X1FA 4RW9B 3UN2A 4MIBA 1Y00A 4HEA9 2DHXA 3TAQA 1SI9A 4PR6A 1HQ2A 1PAUB 1TL1A 1WDTA 2ACMA 1KTVA 4DMZA 4PKDB 1CBKA 4U6PA 3NNHA 2XM3A 1FRIA 3VTIA 2DGXA 4F67A 3LP0A 1VQ5S 3C6UB 1NKEA 1JLEA 3PTWA 1N34J 5KG0A 1RU2A 3MEEA 1WC6A 2QG9B 4QWBA 1WHVA 2UUAF 2F5GA 4PABA 3G4SS 4V19J 3UD3P 2JWNA 1RT4B 3CJ0A 1T7PA 4F3OA 3GJSB 2UXBF 3M6XA 1TP7A 1DURA 1WI8A 2ZH4A 2W4CA 1RAJA 4NMXA 4WKYA 5CCMA 4ID8A 4U95A 4QIVA 2OLWA 2R7SA 1FTRA 4B9LA 3GZ7A 3HHLB 1YVFA 4AT1B 4YR2A 2JEFA 4P9SA 2R8JA 1BY9A 4RR5A 1F3VA 5L38A 3DM2A 3O1LA 1S7IA 2MQ8A 2B4VA 3J81U 1TV6B 1JLCA 1TQLA 2KHDA 3D1HA 3KJVB 5K8MA 4KPYA 2MLYA 3N5BA 2XG8A 3WIUA 3OT9A 2BE2B 3HT3A 2GQCA 2K1RA 2P9EA 2HFOA 3RZAA 1N6QB 5L8RC 4LF5J 2HBQB 1T03B 1KQGB 1VRUB 3ET6A 4E98A 4A48A 2OGUA 5IC4B 5F41A 3FBFA 1SKRA 1N5VA 2JEGA 4K4UA 1UEUA 4UOFA 2BE7D 3N0VA 1CQMA 3M9OB 1X4GA 2IYIA 1RHRB 2DGTA 1S57A 2XWXA 4MTPA 3P5BP 4WE1A 1BGXT 2RILA 4GO5X 4DX6A 4F8RA 1DFDA 3R6GB 2KU7A 2W7OA 4B3TJ 3HHLD 2KTQA 1GTEA 5GVQA 1Q0NA 2DY1A 4Q2MA 3GLJA 2GA7A 3NAHA 4M5DB 4C8OA 3D0IE 3HKZD 3MGJA 2HHHJ 1H74A 1NHUA 3KLEA 3GQCA 5HLFA 3HSZA 1TVRB 4DR6F 2OFHX 1X31C 2CDRB 1S6QB 4IQXA 3HK2A 5ETKA 5SUHA 4CLTA 1LWCA 1NUEA 2YWFA 4JI2J 4LR8A 2QMXA 3IRXA 1QDUB 3D2WA 1WOPA 2WCXA 4M5KA 4WFNQ 2BBEA 2DGUA 3EWGA 1KLNA 3PHEA 4C0HA 1I1GA 3EJMA 3HKWA 3Q0AA 1H7XA 2AJ0A 3FZBA 1SXLA 4AYBD 2ZHBA 4J9OA 3R2CJ 1AUSL 1KLMA 2GZOA 2E5HA 5HN0A 3J7YI 5K8NA 1WG4A 2J0XA 2EXUA 2HQCA 3PKYA 1FE4A 1ZPWX 3R27A 4N8NA 2W2PP 2HK3A 4C4WA 1AZSB 3FMWA 4NLYA 2LMIA 2VPWB 2F8HA 5BJRA 4Q5VA 1ZYQA 3MMBA 2HQFA 1S1WA 2DYAA 3MAQA 4WWSA 1X4CA 1HQEA 5DZ7A 1RHJB 4DSEA 5E7OB 1S49A 3BGRB 3MM8A 2J76E 4R0JA 3IS9B 1IQTA 2E5JA 1W26A 1D0EA 5ETNA 3NOCA 3NCQA 3LA0A 1XERA 2W9AA 1VQOS 5GAEI 2D74B 2DNRA 5J2QB 3AODA 1WC1A 1HNXF 3W2VB 1HMVB 2QMUB 1D3WA 3OR2A 4P10A 4F26A 1QVGR 2FB0A 2ZBCA 5HMZA 1P8GA 1YBTA 3IN5A 4ECUA 1A7GE 5D4PA 3ZTRA 3RB4A 5KFVA 2HHXA 3MPYA 1Q82T 4AE5A 5ETMA 1UPMB 5ETVA 4USVA 4X66F 4NL5A 1TAUA 2FGCA 3DYAB 3CMQA 1DY3A 1SH0A 3LTOA 1RKIA 3SDEA 2IDEA 2AX0A 3AD7C 1BE4A 2GJ2A 3FCWA 3LGHA 3W7BA 4EEYA 3M2RA 3LANA 1Q81T 4AL6A 2UUWA 3KK2A 3AFGA 3PYGA 4N7TA 2NXJA 4WTYA 2CRLA 2DHAA 3VF0B 3H5XA 2GJIA 1QAIA 2QL5B 2VFRA 5HVGA 2FHJD 1KNZA 4RKUC 2XS2A 5CD4A 2GGPA 4P7VA 4DV1J 4ER8A 4TY8B 2XSJA 2XMMA 1JQGA 5DDPC 3PX6A 2RE1A 1I3OB 2VQEJ 4L73A 1B64A 2QN6B 3EGZA 3UE2A 4NLPA 2LKZA 1RE1B 5E3QA 1RT1A 3MMCA 1C1CA 5DS7A 1D8YA 3NNAA 5HO4A 1AT1B 4R5PA 2B4PA 4Y2MA 3GJTB 1CJVA 2B4OA 1F2HA 2EFGA 5I3QA 3G6VA 1ZZNA 2JRSA 2NPFA 3VAIA 5IS2A 3AOBA 5FJ4A 4DPOA 1DQ9A 5IWAJ 5F8IA 3AD8C 3DGPA 4FKXA 2RD5C 2QMWA 5A6PA 2KYZA 3D68A 4GC7A 1TL7A 1FJEB 2MKIA 5J2NA 3PG9A 1CJTB 5KFDA 5F0UA 4DV1F 4J37A 2C2MB 3DDIA 3QSIA 1RA6A 2V69A 4FVMA 4J9VA 2HW3A 2KZZA 3D6FB 3V4MA 4B9NA 4I4BA 2BRLA 4F4ZA 3HD1A 2FHOB 3JXOA 3MM6B 4YN3B 1Q8LA 4PXBA 2I5JA 3MM7B 3QLHA 4J91A 4K2XA 4NLDA 4ZITA 2CZVC 2KH9A 4BS2A 1N34F 1T9WA 3QGHA 4WIQA 4FYWB 5KG4A 4DV0F 4DWIA 2CADA 3GFHA 3HCXA 1MU2A 3U1LA 5IV3A 1JWWA 1R6VA 4MK9A 1MN9A 1RTIB 1IKWB 1R8AA 3H8YA 3UFCX 3UCUP 1U1QA 1KOOA 2QE5A 4CM2A 1S1VA 4LF1A 5H9EJ 4LF6J 1U09A 3IXQA 4FF2A 2H5IB 2YKOA 3DOLB 3M2UB 3OUYB 4WFBQ 1WHWA 4FDFA 3R7BB 4DQSA 4UY8T 4G1QB 1Q7YT 1HI0P 2FVRA 2WW4A 4NOHA 1Q8IA 4K8RA 1S5ZA 1YX2A 2QZ8A 4I2QB 5CH7B 4HTIA 1WORA 2HSEB 4ZOSA 1C1BA 5EX0A 8RUCA 1J5OB 2YPYA 3LP2A 2UXBJ 1GEHA 4KBIA 5E3RA 4NLGA 1VQ6S 1NJYA 4CLUA 2B9EA 1BWEA 1SC6A 5EWGA 2Q6CA 3QPIA 1HYSA 1XN9A 4K4WA 2V5HG 3NS7B 2EPIA 2CWKA 2IDLA 2SXLA 2CNLB 3ENVA 1S99A 2W24A 5K8OA 4C8ZA 1NSKL 4FXVA 4U96A 2DVIA 1RTJA 3SFGA 1YBUA 1FXLA 3DLJA 1VQMS 4OZ5A 3AJ1A 4Y28C 5HQMA 3N6NA 3I0RA 3T9NA 3OL6A 5J2PB 4AFFA 1GMUA 2R7OA 4DL3A 1UZDA 2IJRA 3KLGA 1B70B 4FKYA 3G6XA 5EN1A 4HH1A 1TKTB 4LMZA 4LF5F 4LREA 2EFPA 5B0DA 1CS4A 1Y0HA 3GP9A 2VFUA 3R8YA 1S1XA 4CLFA 5B0AA 2WSEC 1I6JA 3UW1A 4CT9A 4X64J 3TX0A 3P49B 3JSBA 2BJ9A 1SC1B 3TZWA 1OSCA 3VVUA 2Z57B 3MAAA 4ID5A 5IZHA 2JC1A 3UWTA 2IA6A 3KK1A 1S9EB 2BJ3A 1IBKF 3OFFA 4CH1A 2IVYA 1N0UA 4WFYA 2UXCJ 4DL7A 2IMOA 3AB4B 4CQ1A 2F1FA 2B56A 2E7WA 3JQMA 3AOCA 4P71A 5A8KA 1BXNA 2FJAB 3G8TA 2NZCA 4JOUA 2ZD1A 4OZNA 5CAAA 2DIVA 2V8HA 3HT0A 1F2GA 2AJ1A 1SL0A 1ZS6A 3HDSA 2FHJA 3DRRA 2F4VF 1RT6B 1N36J 5A0YA 3KMQA 1NM2A 2GQQA 4H4KA 3BQ1A 2EFQA 1U6BA 2IJNA 2NREA 2FVCA 4JI7F 1U1NA 2PSZA 4LFAJ 3TEHB 2BYCA 2LVWA 1S0OA 2ZM6F 2UVUA 3D66A 5B7WA 3QRRA 4NZ7A 4PYAA 4R25A 3VALA 4WK1A 1DJ0A 5HMWA 5AE3A 1C4CA 3CO0P 2ASYA 1CG2A 3TAPA 2JC0A 1DQ8A 1UW4A 3DU5A 3PDNA 2PIIA 3D9BA 4YDXA 2FZGB 2YWKA 3MPWA 3OTOJ 2PT0A 2Y1JA 2ZDOA 1JKHB 1HNVB 3ZXWA 3ZFVA 4ECZA 1IBKJ 2VFVA 3QRPA 1DTQA 5I42A 3A4TA 2PMHA 1Q53A 2KXHA 3ISNC 1R8PA 2BX6A 2V94A 3AH6A 3KG4A 2NYIA 4HHHA 4KHMA 5CD4H 4DV5F 2Y8YA 4PRFA 2F8MA 3DLKA 1E6YB 3M32B 5KFYA 5DQGA 1RWNB 3ISZA 3OV7A 4ILLA 4O0NA 5CYMA 3Q89A 4DF8A 2VC1A 5KT7A 1B0VA 4DV4F 4WIIA 1U2CA 4ILRA 1JLAB 1TR0A 2J9CA 3POTA 1U1KA 3DRSA 1TAQA 4OYOA 4DPXA 4RNFA 1J2VA 3KHRA 2RS2A 3V4IB 1XNRF 4LR9A 3BPSP 4G3IA 1RJJA 2CQBA 4F4WA 4X62F 5DDOC 3V6KA 1TL1B 3FBBA 3LF0A 3P96A 3PO5A 4OI3A 1UVKA 3OTEA 3DLLQ 4FXDA 3QWPA 1JLGB 1F6TA 4M5NA 3U1NA 3Q24A 2C3OA 4TXSA 3BBBA 3C6UA 3HZGA 2G1DA 1RQ0A 3RBXA 4DV7F 4EWTA 2J8SA 3W5ZA 1C2PA 1U25A 4DR4J 3NKYA 2JFDA 4DV5J 1FCAA 2MKSA 3CIZA 4YR0A 3HFVA 3MI7X 2Z2LA 4JI8F 3RBEA 2VQEF 2FVSA 3MR6A 4JI0J 5D0EA 3GYNA 3IBFB 1ULRA 4DUZJ 1F9HA 4CO1A 2VUGA 3NGRA 4Y2IA 3GV8B 4KGZB 1KVKA 3CDAA 4PEOA 5IC6B 1HNWF 1U4BA 4KFBB 2OPRA 3HHLA 4OX7A 3I96A 5D0GA 2R2SA 5C42A 2JEIA 3MUTP 3IM8A 4FBTA 4KQZA 3DHWC 3DM2B 3NAIA 3DN9A 4ECQA 1NHVA 3HLUA 3VCDA 2MZQA 4J9LA 1NKCA 3D6HB 1Q86T 1WUUA 1YBAA 2HGNA 3P4UB 4UOGA 4XK8C 1GNKA 3QJJA 3HVTB 2J9EA 3KK3A 2JL9A 3UPFA 1Z2ZA 4LF2A 2ZKTA 1S6UA 4OYMA 4DG1A 5KFWA 2B9WA 5IWAF 3Q2TC 5D77A 4I6AA 1H2TZ 1F0XA 1NK6A 2V63A 1CPZA 1IBCB 5HQ8A 3BGFA 3HF5A 3ZZTA 2OTLS 1FERA 4CLKA 4NLXA 2UUAJ 3I82A 4W98A 2W4PA 4Y65A 3BQ0A 4I6WA 4I2PA 4IFYA 4KV8B 4MYUA 2AGOA 3BSNA 4J9RA 3LGNA 1FDAA 2O01C 1FRKA 3Q8YA 4MMOA 2C2EA 2HMIA 2R7QA 1WJ9A 2MJNA 4M5DA 1P6TA 1VIOA 3IBWA 3QFHA 5E5NA 4OX9F 3AA9A 3PYFA 3ZNUA 1YQHA 1HR0J 2NS1B 5KG1A 2XHCA 2XGPA 2V9KA 4OYZA 1RYSA 2FLPA 1YJ9S 2BM0A 5IT0A 3IA0A 3PW7A 4FBUA 5JJBA 3FGVA 5KG7A 1JX4A 2XI2A 2D1CA 2AYBA 1KSPA 5KFCA 4CLSA 1M1GA 3I9V9 5BYSA 2VPYB 4MK8A 2AJ4A 2J5AA 5THWA 5KFMA 3ENAA 4LF4J 2MY7A 3CCMS 1JK9B 2BOAA 3M6UA 3VAHA 3MWBA 2FHKA 1S6PA 1IKYB 5MLCV 2L08A 1YJRA 3TUJC 3VGVA 2WONA 4J9KA 2YKQA 2JEJA 4QPXA 2DHSA 3V6DA 2HPUA 2JLEA 4O3OA 2W7PA 1CJUA 5L1LA 1SL1A 1SH3A 4IR1A 2MSSA 5HANA 3SQGB 2RRNA 4L6V3 3IRWP 3VHQA 1HR0F 3G8SA 1M5KC 1N8RT 4E0DA 2QGFB 3MMBB 1NO8A 2ZOFA 2M52A 3EM1A 2AP6A 4RNHA 2GMLA 1VQKS 4QYRA 1Q7LB 3BGLA 3LO3A 2MGZA 4ATNA 1Y9OA 2MXYA 1HWLA 2BUNA 4TU8A 1F60B 4KKOA 5LM7E 2J6SA 4OV1A 2X51A 2IVMA 2LP4A 3QNWB 1KFSA 2W9CB 4ZJQA 4O3SA 2OAUA 3JSMB 3W2VA 4F0MA 3OTDA 3BO2A 2DR5A 5C25B 3I56S 1QJHA 3H5YA 5D0RA 4F0HA 2DR7A 1Y5NB 3TARA 2ZFHA 1FA0A 2QRRA 1GXLA 2YQ3A 1U1MA 1IKVB 2FC8A 5EDWA 2KM8C 4J7CA 1FJGF 3M8ZA 3DYAA 2CYYA 3HSJA 2DGOA 4NLTA 2GHWA 3KOAA 1OO0B 5KFBA 3IAM9 5KFTA 5H9FK 4USMA 2J7WA 2LEPA 2DGSA 2RH3A 5ETTA 2DNNA 2XHWA 3E51A 1S1UB 3M1VB 4ZVFA 2QT7A 4JYAJ 1IKXB 3D3BJ 3LH2S 3N5FA 5AXLA 4ED6A 2GIRA 3OL7A 1LXNA 2QFIA 4TN2A 5CHCB 1KR4A 1RAIB 2NLWA 4L74A 1EETA 1U7LA 2BMBA 3QMQA 2YKPA 5DLGA 1M5OC 1WELA 4IG3A 4QW8A 2X7IA 3JSYA 2BZ2A 2D3ZA 3ITHA 5LMNJ 3AB2B 3ULHA 4C8NA 1WHYA 5F9LA 1YRUA 2NPIA 1S1TB 3OL9A 1REGX 5KFGA 2HFSA 2A1BA 4J5OA 3S01A 1OJ4A 4KRWA 1RT1B 2BJEA 4C0OC 4FF4A 3MMCB 1Y10A 1IM4A 1W7WA 3IR7B 4R5PB 5AXKA 4DV2F 2HVEA 2HVZA 4W92B 4B08A 5I4MA 3ZTPA 1OS5A 2HQDA 2HNZA 1SKUB 3VGSA 2HRYA 2CQIA 1Y5IB 5KFFA 1RTDA 3BDPA 4NE9C 4YR3A 2IBKA 3DLGB 4OI2A 4YDDB 1N48A 1TELA 4WP9A 3VGTA 4K5SA 1RT5A 4RZRA 1U1LA 1RCOB 5J2NB 3AQPA 2ZC3A 2NQPA 5T41A 5HATA 2DNZA 5L1JA 2K2PA 1MG7A 2N7CA 3J7ZT 4Q0BA 4DQIA 3ZTSA 2YNFB 4F4XA 3QQCD 5J1EB 1XNRJ 3MM6A 3TZXA 4G1PA 3NCRA 2HHSA 2VASA 4JUZA 4TU9A 4X62J 2W1BA 3IWLA 2RHQB 2XC9A 4EMDA 4PXCA 2OEKA 4A4JA 1UPPA 2VDIA 1R6YA 4QWDA 5K5MA 3P3DA 1TL3A 2ABYA 3BKUA 2H4WB 3EE3A 3O6QA 4QIWD 1VQYA 5CZXA 1PG5B 2ALYB 4BC7A 1XR7A 1RTIA 2MMYA 2C2NA 3NBPB 2B5JA 4M95A 1K0TA 1FDNA 1S1VB 3ETMA 3QATA 1IJEB 4HDGA 4UZBA 1NK8A 3CC7S 3Q8PB 3M2UA 3HM9A 4ZDNA 2VIHA 3FQKA 5KFJA 5J2MA 3E3XA 1UVNA 3GSDA 4IQMA 4OMFG 1DTTA 2MQNA 4ZVOB 2ASLA 8AT1B 5DG9A 1S59A 4PUOB 2AMCB 1VRTB 4TLQA 3ZNJ1 2ZH3A 2OMLA 1VISA 3RGIA 2H51B 2DH7A 3ISND 3O5TB 3US5A 2LQ5A 4TU7A 2E29A 5B0GA 2XI3A 5FD1A 2JJ4D 1PC4A 5CYQA 2HZVA 4WPAA 3J80Y 4ZVQB 3MR5A 3PW5A 2ZE2A 1HYSB 1BQXA 2IA0A 1R27B 1KWMA 1RCXB 2KL8A 2MZTA 2ZNYA 3MAHA 3VQTA 3TZYA 1LV5A 2HLUA 4C8KA 2Q1LA 1OQ6A 3EYZA 2QA4G 4NZ0A 4IH5A 1FFGB 5U47A 2E9TA 4N8OA 1MMDA 2YKNA 3BDEA 4OI1A 3M8YA 1RGVA 5J2PA 3RU0A 2AYMA 1S4FA 4U67Q 1F9EB 2H65B 3L7PA 2C2RA 4OL8A 2WVCA 3MUVP 3GSIA 2CPFA 4WXOA 4JV5F 3GMGA 1RTDB 3QBCA 1L3VA 4LBPA 1WKJA 5D15A 5HMXA 5BXIA 1TU0B 2HIQA 3MEGA 3RUBL 3K57A 1QSSA 4Z37A 1CS4B 1CEZA 1GAOA 3NXZA 1RWMB 1HI1A 1QE1B 4ALZA 2QL7B 5E3PA 1LKZA 1BQMB 1RWOB 1H7WA 2MQQA 2B0GA 2V0NA 3MR7A 4OX9J 3CIMA 5AXNA 3CCTA 4HTJA 1D9DA 3CDEA 4ZPDA 4DPUA 1FEHA 2WB1D 4ELTA 2PN6A 2DNHA 3LAMA 4LRFA 3KK1B 1S9EA 1HWIA 4RW4A 5FLXU 1KVJA 4M5HA 4DS4A 3DRYA 4HHUA 4ZJLA 4XIUA 1QTNB 4B3RF 3W9JA 3LAKA 3UD4P 4RWXA 1WG5A 2PC6A 1RAHB 1APSA 2Y0SD 3W64A 5IOLA 1SIZA 1VQLS 1A6LA 2CG8A 2FJWA 4PWUA 3MZIA 4ELUA 2LCWA 3H2LA 5ETSA 1RT6A 5H1SV 2QFJA 2COLA 1NK0A 1F5BA 2GO9A 4OX6A 3ZZRA 1YDLA 1Y4ZB 3RAQA 4F02A 3O44A 3R97A 4P73A 5KT2A 3CCJS 3IG1A 4IOAQ 1TKXA 2QIFA 4USKA 2VBYA 2AYGA 1Q5VA 2AJFE 2CJ9A 4NYPA 2F65A 3CJ8A 3FCHA 1B0TA 1MWYA 2HQGA 2JLGA 2CDQA 1NDLA 1FNXH 5B0BA 2AEJA 2XMTA 4NEZA 3BYPA 1DTQB 3ENWA 3UQSA 4QZVB 1SL2A 3A13A 1RABB 4JI6F 2KXNB 1E6YA 4NRTA 3T3FA 1N32F 4KO0B 4EO8A 3KLHA 3IFEA 1KHVA 1J27A 2VBZA 3K17A 5CYMB 4QQBA 3TAMB 4CO3A 2R2UA 4OYAA 1KHWA 1VIXA 2F3JA 1L3TA 1S4EA 1JLAA 1RAEB 1UAWA 3AJDA 3POTB 1UEVA 3DOKA 3R5DA 4MKAA 5KG3A 2CUYA 3D3CJ 2VBWA 2NXEA 2AHOB 3PJ9A 4P2XA 3GIMA 3H42A 2JDJA 3GIJA 2KFZA 4YHHF 2E7VA 2QLWA 3JTPA 5DLFA 3IBCB 1JLGA 3OPKA 2VBXA 2WSCC 3FKBA 3M2VB 2I2YA 4ANDA 2D7SA 1RB0A 3TW0A 3H2VE 3IO1A 1N5YA 2PD1A 3PR5B 4PQUB 2UU9J 1Y5LB 2ZUGA 3Q2SC 1LWFA 4H4MA 4UOHA 1K1SA 2WSFC 4F3QA 4TQSA 1SJRA 4O0IA 4LF7F 2MYFA 5F3ZA 1RBAA 5HVFA 5HMYA 2ZH2A 3M6WA 2E5GA 2HGLA 2Q79A 5RUBA 4DLEA 1UJ5A 1VBXA 2GFFA 4HLBA 3I0SA 1NPKA 4D3GA 2OPRB 4HL9A 1RTHB 1NB7A 3BQ2A 4F4KA 4QYZK 2HHQA 2AU0A 3ELHA 3KLFA 3KHHA 3IMQJ 2DIUA 4NCGA 2BE9B 3A8JA 2OD4A 4DV2J 2FLOA 5ETLA 1OQ3A 1LFWA 4QU7A 1RHMB 1RACB 1FRJA 1FXRA 2LXUA 2RUGA 3HVTA 4HACA 3PW0A 3CJ2A 1IN0A 2RVJA 3I87A 4YB6A 1T05A 4WKRA 5GMDA 2RKIA 1KQKA 2F9JA 1M0SA 4F4AA 2N7YA 5JUMA 3PFOA 1U45A 4K0KF 1NH7A 1GH8A 4PXDA 4YP3A 4DPWA 2K06A 2AW0A 1T9UA 4OJ1A 4RNNA 3QGPA 4WU2A 2XLJA 2D3OR 3LPEA 2KT2A 4A47A 2XY6A 2KT3A 4CTAA 2FJBB 2MLZA 4QIGA 3VQSA 4DN9A 3MURP 1LXJA 4ZCMA 2BR0A 1AYEA 2BJDA 2VG5A 1XMOJ 2Y9HA 1RA7A 3QZ8A 3FEZA 5HROA 3NMRA 4CH0S 2CPIA 1M5PC 5LSRA 2HKEA 3UNYA 2LECA 2NCKL 2H1YA 4DR2J 3CJSA 3SMZA 2N4DA 2UUCF 1X8DA 2BW2A 4NASA 3GTYX 3H5SA 3KDNA 4ZLNA 2FDNA 1WDDA 2LXIA 2YX1A 3G82B 5C24B 2A10A 3HD2A 5KFUA 1FI4A 4JI1F 2CQGA 4FVCA 2A18A 3MCNA 4ZHRA 2FJXA 2YH0A 3UI3A 4MKYA 3CT9A 1GTHA 3MXHP 1HBOB 1HIYA 2D3UA 1X5TA 4ZN3A 3PIPQ 2XEXA 5LMUJ 3T5LA 2FZCB 4RBUA 2DXFA 2WB4A 3GR0A 2UXDJ 2XY5A 3VAJA 1Y3JA 3V6DB 1FRLA 3GIIA 2FY1A 2Q66A 2CWXA 4QR1A 3MUMP 1ZM3A 3OJSA 4OZ1A 4TLRA 2QLXA 5DDRC 1RBLA 1MMNA 4Q44A 1URNA 3QGGA 3JTOA 4HVZA 4DR2F 5DQHA 2A6OA 4C7QA 1X5PA 1B0PA 2LU1A 4CM0A 3W9IA 1EP4B 5D4OA 5LMNF 3MMAB 1QSYA 2CQ1A 3EXCX 2ZOMA 2P8IA 4A8WA 4WF9Q 2UV8A 1JNRB 4NXNF 2DEJA 4O44A 2G0JA 3VAFA 4AQYF 4PG7A 3V2UC 4EU0A 5MAOA 3CCQS 3A3OB 5D78A 4QR0A 2G9OA 1WD6A 2A2CA 2XYGB 2OMOA 2ZBIA 1LW0A 4L75A 2OSRA 1HBMA 3QO9A 4MFBA 4X4VA 3UN3A 1X4HA 3D0HE 2EI5A 4OZ0A 1MLAA 3EGWB 1YJ7A 2P5VA 4CLYA 5LOQA 1HNXJ 3CULA 4H54A 3TVKA 5F8LA 5E0OA 5F8MA 3SQOP 1XJWB 2XZDB 2GAHC 4O4GB 4WYLA 4NLUA 5A2QU 4B9VA 2ZHOA 3BREA 1BWVA 3N28A 3BN4A 3MM5B 4O4RA 2CG4A 3T41A 2CZ4A 3T5JA 1P1TA 2BM1A 2KKHA 4ED8A 1NDPA 3DOMB 4WZMA 1R0BG 3EMTA 3DGVA 2G1HA 2KRBA 4ZJOA 3BS9A 5KFHA 1S1UA 2VJVA 3QSYB 1XBWA 4HR2A 3BPDA 2DT9A 2N3OA 1SJQA 4RX6A 4X4NA 4J9UE 3CJKA 3KLIB 1M90T 3IGVA 3MPVA 3VZHA 4ECYA 2HFZA 1MW7A 3KYLA 3ITHB 2LU2A 4L72B 4OHYA 1NCLA 1P27B 1ZZFA 2RAQA 2GHVC 3T6BA 5K8PA 3G6YA 5C2GA 3UO0A 1N52B 2M3DA 2W01A 1LW2A 1DARA 1SV5A 2DNPA 2OPSA 1F1BB 4KAIA 4P75A 2B4UA 2MZJA 3N6LA 3SBMA 5GAHU 1VC6A 2M7SA 2HNZB 2HG4A 3RRKA 4JI6J 3TQEA 4PG6A 1YWXA 4DQRA 3BEGB 1T95A 2DNYA 2W8KA 1SUQA 2MKYA 4QWEA 3RB3A 2V4JA 2YWHA 3GFYA 2XMUA 2CJYB 3MEKA 4ED7A 3GIRA 4I68A 1ICEB 2Q6BA 4ED2A 3SV4A 3TA1A 4CDIA 4RBVA 3CCSS 1RAFB 4LSNB 1KBRA 5BYQA 2UVVA 3FDSA 4EZ6A 3WC0A 3OHBA 4LRCA 2HNYA 4RW7A 4Y6IA 2POKA 4LJMA 4EFAC 5KFNA 4W4MA 5KT5A 4Q0BB 5L9NA 5DJBA 3GV5B 4ECVA 1FNOA 3PRVA 3RBDA 4J9PA 3QAUA 4DR7J 2KJVA 1FKOA 2AEMA 5B0FA 4YHHJ 5J1EA 2RHSB 4LSLB 4N41A 2K3IA 3HULA 4DOZA 3CCES 1DHMA 1N5SA 4IFVB 5DETA 3NS6A 1GK8A 4IH6A 2M8DB 2XCAA 2QLJB 2VFSA 2XBPA 3CW2C 2YKMA 2OFGX 4JV1A 2RQ4A 1IJFB 5H9FJ 4DU7A 2VU5A 3V81B 2B5JB 2KFNA 1EAYC 4DL0C 8ATCB 3N4WA 1WKKA 5L39A 4KR0B 1Q95G 1RWPB 4BWJA 2XCPA 2FJVA 2K8GA 2ROGA 4FYYB 1TMMA 4IDKA 5CQGA 1JLFB 1HHSA 2E1RA 2KN4A 2WVBA 4M5IA 3CC2S 4A8FA 4LFCF 4TYAA 2ZWOA 3D6MB 4XAKA 3DI6B 1T3NA 1UEKA 9RUBA 1S0MA 4H4OA 2PI5A 5I3UB 4A8XA 2ZEJA 4DLGA 5J1PA 1VRTA 2AWZA 2WOMB 3CCZA 4IYQA 3OLBA 1K0VA 4QW9A 4G65A 3KJQB 4QR2A 2DO0A 3VGUA 1RTZA 4R8UB 1U1PA 4EZ9A 1FRXA 3W8GA 4K7QA 4QPTA 3HJVA 4GKKJ 3M30B 4FP9A 2J6TA 5CYQB 2OKQA 3BSAA 3CD6S 1LOUA 1MROB 4FYVB 2CNOB 4USHA 3T1YJ 4F25A 3C6TA 3NGKA 1YITS 3WQPA 4DR6J 5D0HA 1OY6A 1X4EA 2RDIA 2JVOA 2VG6B 3FCVA 3MCMA 1NK7A 3IP0A 2KDOA 2D69A 1ZM4A 2GX8A 2B6AB 2YNIB 3PJXA 2YNHA 2OTJS 3MTKA 4G1IA 5A76A 1C0UB 1RI7A 1WSVA 3Q86A 3KNAA 1WC5A 2XYHB 3D67A 1S72S 1HQUB 1QUPA 3NP5A 2X1BA 3DDKA 2A2DA 1Z2LA 2KYXA 1RADB 2FJDB 3GCWP 3FSYA 3MEGB 3D0GE 5L9XA 4YMEA 3NOGA 4GVBA 4OHVA 3SYZA 3GYXB 1QE1A 1YRXA 1XK8A 3LWLA 1K1QA 5KFOA 4K4XA 1EX8A 4J9QA 3NWRA 3ONQA 2QSWA 2DGQA 3CO9A 3UDEA 3O8WA 4WBFA 4Y34A 4RW4B 4E8UA 2H3EB 1DLOB 4F36A 1HWKA 2F63A 3B54A 1UKUA 3JTNA 5KAKA 2VONA 3R7SB 3Q8SB 2YTCA 2AEFA 4N47A 2CQHA 3DRPB 2PEBA 3D54A 3S7RA 1R0AA 5GMKa 3OSNA 3EVMA 1H0HB 1DAXA 1XMQJ 1SIWB 4ED1A 1AUDA 3PEJA 3QRQA 2HZAA 3DXBA 5HJXA 3J7Z5 3BR8A 1VQNS 4PWWA 1FT8A 4NI2A 3T1AA 4DFKA 2ZVIA 4K5RA 5ETPA 1M5SA 5FDLA 2XZWA 4LVNP 4RW8A 3UVJA 4CIOA 2B51A 1HKAA 4ECWA 3HO1A 2WVDA 1VHFA 3I6PA 2YPZA 2R9LA 2V9WA 3DLEB 3SEOA 3PVXA 1EZZB 2ZM6J 1FESA 2EVZA 1UJ4A 4G6VB 2E5LJ 4I7FB 1LFPA 2MSTA 3DMJA 3A3NB 3H7HB 1UA1A 2X1AA 4Q45A 4A8MP 4P2MA 2LQJA 3GJQB 1K44A 3JAMY 1N36F 4B3OB 2HHUA 2WVEA 3G96A 3L7UA 2DHGA 2WBRA 3LQVA 1WWHA 5EHHA 2XMWA 3SCKE 1AFJA 3H90A 3Q8QB 4DUYF 2CPJA 2U1AA 3C46A 2LEAA 1FHTA 4C9DA 4HKQA 2U2FA 2ACYA 3TAMA 5M2PA 3CMES 2CVEA 2LA4A 2N4CA 3I4PA 4GRSA 4HT5A 2C22A 2XY7A 1Q4RA 2HFNA 2IRXA 2ROPA 4WK3A 1D9AA 4ZP7A 3H59A 5KFRA 2PO4A 4PG5A 5CA5A 3IR5B 4XTTA 3EXYA 1BMQB 4IOBA 5ETQA 2XS7A 2L9WA 2QX0A 2DJWA 3ICLA 1EIYB 3M2VA 2AF6A 4ZK7M 2V2ZA 1VC0A 5M2UA 1XTZA 2CKWA 4USUA 2DNLA 4ITSA 5G0RB 1JLCB 1FO1A 2HVDA 3KJVA 3C16B 2B8PA 1G6BA 2HURA 1JNZB 3PX4A 4PPZA 1TFYA 3VWSA 1B7FA 1T94A 1RAGB 3K5OA 2K1RB 3BYRA 1UP1A 2UV8G 5DG8A 3BBFA 2RQMA 1N6QA 2XNRA 5GADI 2ZH9A 4NZ6A 2O5DA 5DZ6A 1TMJA 4C97A 2J7UA 4KE5A 2J0SD 3HFKA 2R3VA 4B9TA 1U1OA 2OPQA 1RTHA 4C11A 2J9DA 1EARA 2B9YA 2F7VA 3KLFB 3HVRA 1NMEB 1IQZA 1NNDA 2BV3A 4MYTA 2XNQA 3E01B 3VZIA 4CWBA 6AT1B 1U47A 3KHLA 5A8RB 2V6AA 3KJNB 4HI1A 3OVAA 3CMAS 3R6LB 5C2CA 2R42A 2XYPB 4LFBF 3W2WB 2UXCF 4GKJJ 3OR1A 1YRTA 2M70A 2CPEA 3IR6B 1H73A 1HNWJ 4WFAQ 3W9HA 3FRZA 1NLKL 2QL9B 4HHJA 1HBUB 1KEKA 3M9MB 1AW0A 2NZ4A 1GMWD 2DNMA 2MZ1A 4M63A 4Q8EA 2C3YA 4BCAA 4CTAB 2M88A 2FJEB 1SKSA 4B3RJ 3ILIA 3IWXA 4OYBA 1FVQA 5LL6d 1C4AA 5F3TA 2C3UA 1FX4A 5LJ5Y 1FDBA 2V34A 3HI9A 5D3GB 2ZWPA 2M9KA 4FN5A 1VK8A 1T9XA 2V67A 2KO1A 2Z0GA 2VJUA 3NCPA 4JI3F 1ROFA 3MR2A 1AROP 2DK2A 2OEMA 4ES3A 5KFPA 1YKWA 2YWEA 1ZTTA 1RT3A 2YY3A 4ZVUB 3TP2A 5JXSA 4A8KA 2K7JA 2LQ9A 4TYBA 2VF3A 1Y3KA 5L46A 3I5BA 2O1PA 3WC2A 1V5IB 1VRQC 2IAJB 4RUBA 3LGMA 4RO0A 1S1WB 3I5AA 1HQEB 1UL3A 2WHOA 1LNQA 2ZKUA 3QFWA 1WSRA 2AZ3A 2QC3A 3BGRA 1VBYA 4P2SA 1NSPA 3IS9A 2BABA 2DBBA 5E3CA 2ZZMA 4ERDA 1S9GA 4EO6A 7FDRA 2F4FA 2DTJA 3W63A 3HXMA 3U02A 4DCPB 2RJZA 1HA1A 3GYGA 4F4YA 5IT9Y 1TZ0A 3OR2B 1FKPB 2RDDA 1QTMA 3ZTOA 3L09A 1VS3A 2FIUA 2D3O1 5B0EA 3OVBA 2DHHA 3MPDA 4P2FA 4P74A 1H38A 1NBEB 4FPIA 3SIPB 1T9VA 2KT5A 5IM0B 4GO7X 2RRAA 5F8JA 3MFHA 2YWWA 4RW9A 3SDEB 3IC1A 2ZNZA 3D6TB 4X64F 1HD0A 1MWQA 2GMHA 2F40A 3M2RB 4P6QA 1B4SA 3A8EA 3T1YF 2R8HA 3OXLA 5IXUA 2XLKA 1LW0B 5I3PA 2GW8A 4WP3A 4X4UA 3TJ9A 3W62A 1EQ0A 3JAMU 1GT8A 2Y1IA 4N56A 1JLEB 3UNGC 4ELVA 1V6HA 2GGPB 4RL1A 2ASDA 1VQ9S 3KG0A 3K0JA 3MEEB 4O4GA 1HPZB 4LT6A 2H4YB 3E2EA 2ATLA 1S48A 1RT4A 4O3QA 3CJQA 2F9DA 2DH9A 1W2BR 1NK4A 4ZMMA 2BANB 3DOMA 4B3MF 4KGKA 4JV2A 2WBMA 1CSJA 2EK1A 4QIEA 2H54B 1PKUA 2LDIA 5A2QY 1D8ZA 2VKRA 1CJVB 4OYWA 3DXSX 4DZDA 1X9MA 2FVPA 4IR9A 3KDOA 2GAGC 4OLOA 2C1EB 5KG6A 4K50A 1VFJA 4UY85 4KC5A 3CJKB 1UWAA 2ZBRA 4RLEA 4BBYA 3FSIA 3CF5Q 4AL7A 1D09B 1TV6A 4O3NA 4JI4J 1G1XA 1H3DA 2PFFB 3MPUB 1I94F 1OSDA 4B9SA 1OYEA 4J9SA 2GIFA 2BE2A 2M5YA 2E7XA 4C8LA 1PJ6A 4Z2XA 3CDUA 4OQJA 4O23A 1X4FA 4U8VA 1T03A 4JYAF 4IH7A 3N9UC 3HMJG 3TQ1A 3W3SA 1WEYA 4KIAA 4M1KA 3E8OA 1UTAA 2GS8A 3LP1B 3TRGA 4DEZA 4ZLPA 7FD1A 1WC4A 1RKJA 1NK9A 2BDPA 1IUJA 4HYKA 1T9TA 3CDWA 3G87A 1JJ2R 2R8GA 4KHRA 2I5JB 3UDVA 3V6JA 3HZEA 5HK4A 5LSLA 3CNQP 4RUHA 2IY5B 1WG1A 1W25A 4ES1A 5HVHA 1K73T 2DNKA 4WE1B 2DITA 3IGNA 3JB9k 3I4HX 2XTJP 4DUYJ 2BKNA 4DL2A 2VDHA 4K2JA 2Y0BB 1IKWA 2DNQA 1PILA 4M5GA 1U6FA 3ZTQA 4DR3F 4FNHA 4OZJA 5KOWA 2KRRA 3D28A 4RW7B 3K5MA 1FJ7A 1HWUA 3G9CA 4X2BA 2CQ0A 1KQSR 2VB6A 1TVRA 3DRXA 1VJQA 3DOLA 3HSDA 1ZA2B 4MH8A 4DUTA 3IM9A 1S6QA 4KH1B 1QAJA 4OJHA 1U1RA 2FVQA 4LSLA 2LA6A 4DSIA 2DXEA 3DHXA 3G8QA 1LWCB 3QIPB 4F3MA 3PKMA 2LQBA 2MQMA 1X4DA 3IRXB 3MD1A 4DQQA 2A3JA 2HWHA 4GVLA 4Z7YA 2YX4A 4CH7A 1C1BB 1RU1A 1GQEA 3ZZPA 1J5OA 3AJ2A 3OTBA 2WZ1A 4PZVA 1SPBP 2LQ8A 4LUBA 4WZQA 4PXEA 3O2IA 1U24A 3V81A 1OPIA 2QA4S 4FXWA 1JB0C 2MKCA 2PGCA 3P8BB 1Y11A 3KLVA 3AA8A 3AT1B 3K7RA 4IDKB 1JLFA 1S79A 4KGMA 2L3MA 1UVIA 3HHKA 2DCUB 4UZCA 3CPWR 2BJ8A 1AZSA 4MIWA 2DR9A 2JH3A 1RAAB 4ICLB 5G4DA 3TOQA 2IC3A 4OJGA 2HZCA 2IPOB 5JMNA 4H4OB 2GVDA 2WTFA 1YI2S 1S76D 2UUBJ 3MCSA 4PG8A 4OI4A 1V3RA 2EFNA 3TX8A 3K5LA 1RWVB 3EX7B 3PZPA 1SC3B 2CQ3A 2IM3A 2HGMA 3PM9A 5T7LB 3KLGB 4CZCA 3I55S 4NYOA 4EK2A 3D1QA 5AJ3F 4NCBA 5LXYA 4KJIA 4LRDA 3HSGA 3M30A 2NSBA 4LQ3A 3Q23A 5A8WB 3F0NA 1S1XB 1PC5A 1GFWB 1E6VA 3JSRA 1HMVA 3PYEA 3EVWA 2RRBA 4EBCA 4AD6A 2VA3A 4E2FB 1IWGA 1NXIA 4B3SJ 2G13A 3UD5A 1ZH5A 1NEEA 1FWPA 3KUEA 3AAWB 4Y00A 3MAAB 3HFZB 4ID5B 3SI8A 2R7UA 1YIJS 3L3CA 3DU6A 2NXNA 1BHNA 2HNDA 4Z7CA 2YNIA 1P1LA 1FKAF 1MMLA 2KVIA 4OHWA 2DISA 5F8HA 5DM7Q 1RUSA 4U7UD 1KVIA 3AOAA 2RIJA 2CJAA 4IKAA 1EB0A 2IRUA 3WDOA 3BB5A 3ZZOA 4DR1J 4YB7A 1U8SA 2VG7A 2R8KA 3R5BA 2HIYA 4GVBB 2BJ1A 2EG2A 1UFWA 4JI3J 1HW8A 3KK2B 3DRRB 5A0YB 2NSCA 2DR6A 1VR6A 3J81Y 3HPOA 2HK2A 4WP8A 2HWIA 4RNOA 5HQLA 2YWGA 3PEHA 1F9FA 2G0IA 3FVYA 2HWTA 3SCIE 2XSJB 3I32A 5KFSA 2RF2A 4L3KA 2AYEA 2IFXA 2MHNA 4ZPTR 4X65F 2P9GA 4X4SA 4IRCA 2DD8S 1YSJA 2N3LA 2YKAA 3M8QA 4KY3A 5DO2A 4A8OA 2EC0A 3J7AN 1V9OA 2ILZA 3CJ5A 2KB2A 2MPUA 4ZPAA 4QCLA 1NKBA 1ITPA 5KFZA 2YX7A 4ECTA 5I42B 5DGAA 1FWLA 2AZ1A 3N01A 4Y3CA 3GILA 3RRHA 4YUDA 3TA2A 3M32A 4C3KA 1HHQA 2FYXA 4FNIA 2QLBB 4MK7A 4YEAA 2MHEA 2DPJA 3NL0A 2HS4A 3B82A 3DGPB 2CPZA 2KFYA 1IBMF 2CZ9A 2CJBA 3MMJA 3DRSB 4NA1A 5A6WA 4DXLA 1TL7B 3OTCA 3KHGA 5E33A 4B3TF 1CJTA 1VMBA 3C66A 2AGQA 3MDFA 4PAAA 1RP5A 2ZH6A 3DMJB 1U49A 3H4BA 3HHLC 4ZCIA 3LALA 4KPCA 1OIAA 4KSEB 3S1TA 3GV7B 4FF3A 3EICA 2ZH5A 1REVA 3AXKA 1RZMA 1FJGJ 4IO1A 3LUYA 1VJWA 5C5JA 3QLHB 2HS0A 2GHPA 4CNYA 3GR1A 1NJZA 1T02A 3OTOF 2HHVA 1NPPA 3CCWA 4J90A 4DBQA 3JQJA 2EWHA 4K4YA 1WF2A 3RB0A 2JFKA 2XMKA 2VICA 3SZ2A 1M1KT 2R7VA 2NXCA 2OHDA 5J1NA 4U7UK 4UT4A 4RW6B 1IBMJ 3PFEA 5F0WA 1RYRA 2W9BB 2GO8A 3DLBA 1V5VA 3OUYA 4NEYA 2MZSA 3EUNA 4CO0A 3VAMA 4FZVA 4PYDA 5AE1A 1D9FA 2OH2A 3HJFA 2MTLA 4TY9A 1U2FA 5ETOA 3CD0A 4I2QA 5F8NA 3CCLS 5G0RA 1WI6A 2FHMA 2XWYA 4C2MA 3A8IA 5DM6Q 2HVHA 4LQ9A 4RNMA 4OZ3A 1WC3A 3FSXA 3K8VA 1KRPA 2HHWA 4UUWA 1CJKB 1TUWA 5IFMA 4NLVA 4URQU 3KK3B 3CCUS 1H72C 3SV3A 4LRAA 4DG1B 4YY3J 1OY8A 1SBRA 3FQLA 2JLFA 3JS9A 4H4KC 2ZJRQ 3MEDB 1ZBTA 5KFLA 4RWWA 4JI4F 2VD3A 4DV7J 1DQAA 2HFUA 1S10A 3M7VA 1RTJB 1HLWA 1QM9A 3CVKA 4FPRA 1ELOA 4K4TA 4KGXB 2F4VJ 1WOSA 4NLRA 2BXJA 4IFYB 4KV8A 4NLWA 5HAOA 5AE2A 3E01A 2OJ3A 3G6ES 4LF8F 1HNZJ 4OHZA 5KFEA 2W7AA 2PMZD 1RWKB 2LEBA 4MT1A 3R5AA 4WFZA 3QT5A 2QO3A 2ZVSA 4YFUA 3CXCR 4LFAF 2HMIB 2B3TB 1F5AA 2M8HA 2YBVA 1TKTA 1O0PA 2FPHX 4NLOA 3W2WA 2QA2A 1FXDA 3I5CA 2YXLA 2ZBQA 4S0MA 3PR4A 2GJFA 4ZP6A 1VYAA 4FYXB 5JVGQ 2M2BA 1U26A
chains in the Genus database with same CATH topology
1BD6A 2RT3A 1WHXA 4YOEA 1GXUA 2IJFA 3SXLA 1G7CB 1RK8A 4FYDA 3K59A 4PQAA 2ZJQQ 5E41A 3PO4A 4RBTA 5E2QA 3B4DA 1V3ZA 4UQGA 5D3GA 1KD1T 3THTA 3X1LB 5KFAA 1JLQA 2JSXA 1RT2A 3PRDA 1VOMA 3OFGA 4QWCA 2ZH1A 1RT3B 1WF0A 2NUUG 3GWCA 2IVFB 2KM8B 1VQ7S 3TR5A 4DS5A 4DL6A 3SSQA 4ZPWR 1FEEA 3R5CA 5L1KA 3ZZZA 2J7KA 2MGZB 2R7RA 2FD2A 2R7WA 2CQCA 2B7CB 4TNOA 3OL8A 3OBIA 3DLHA 4KKOB 4USJC 1S9GB 2LLZA 1TL4A 3CDBA 4ECSA 2QA1A 1SJ3P 4ETXA 4F2SA 2E9RX 4I67A 1SH2A 1YGYA 3CD5A 2DRAA 1KONA 5C25A 5ITHA 2WW8A 5LT5A 1HWJA 1KFDA 1NU4A 2ILYA 3MOJB 3BSCA 2O66A 3EZUA 4KB7A 2IHR1 1XC9A 1Y7PA 1IKVA 1TKZA 3M8PA 3OSPA 3NS5A 2HYIB 5KFIA 5GAGI 5IM0A 1KN6A 3OQ2A 3VR1A 3J7A1 4DL4A 4I0WA 3V4IA 1T3OA 1FVSA 2DO4A 2KXFA 4Q7AA 3EZ5A 4K4SA 3M1VA 5HBMA 3NMAA 3SCLE 3PACA 1GX6A 1ZAXA 3CJ4A 4FF1A 1L3KA 4ZPBA 2FC9A 1QAXA 1JLBA 3BZQA 4NRUA 3D5MA 2RU3A 2BACA 4IG3B 2MDAA 1RDRA 4Y0FA 2R8IA 1HPZA 4KTQA 4NXMF 5GAEU 2X1GA 3AY0A 4ZS6A 5F9NA 3PJWA 2V4QA 1PGZA 1S1TA 2K7KA 2DRBA 2BANA 4W90B 3JYTB 2DGWA 3OFHA 4UOCA 1S77D 2V8GA 3MHYA 4UW2A 4KFBA 1XEZA 3FRYA 1LK7A 4CI0B 1S9FA 2XMVA 2RB7A 5C42B 4YB1P 3UCZP 3GE9A 4A8QA 1A9NB 2L41A 3ZC4A 2P6TA 1HW9A 5T14A 3LPYA 4BDPA 3DLGA 3KWMA 1QLNA 3GFZA 2RS8A 2H9ZA 1SB6A 1H2VZ 4XDDA 3NG8A 3UDLA 5DQIA 4QJVA 3I31A 5IQ6A 1FK9B 4ED3A 2PE8A 3T19A 3LP1A 4V19X 1LWEA 2ZITA 3OLAA 4NA2A 4JBCA 6FDRA 2FUG9 2O67A 2ALZA 4I2PB 4PG4A 1UWBB 1TK5A 3EPGA 2R7TA 5KTQA 1Q8BA 3OW2R 4DSJA 2AJQA 4A46A 2NUHA 4ZCLA 3TUZC 1L3UA 1CLFA 2VPXB 3G71S 1NJIT 1DZ5A 1N0VC 4LVOP 3LWMA 4ED0A 4R0EA 1AXQA 3B8HA 3R1HA 1YJNS 1S0MA 3C3LA 4NX9A 3UR0A 5K14A 2AGPA 3CD7A 3MM9A 5D8HB 3SCJE 4TQRA 3BGUA 5J2MB 4MJKA 4OLPA 5GADU 1DTTB 1HI8A 1HD1A 1U2RA 3QIPA 1Q79A 4PUOA 1YJUA 4C3LA 1WF1A 2KG1A 2P6SA 4HT7A 2YVSA 4GMKA 5EGYA 2IYGA 1S6PB 1IKYA 3M4XA 4YR0A 1CQNA 5D4LA 5FIIA 3TYTA 1NK4A 1V3SA 2WONB 2HQ3A 5FLXY 2ZE2B 4NA3A 1R31A 2DCLA 2ZC4A 3CWJA 3SQGA 1JWWA 1YJVA 3FMBA 4ICLA 2IC3B 1BQNB 5AXMA 2CPXA 2AV5A 4XO0A 2FGOA 3KG1A 1FDDA 1QVFR 3TA0A 5B09A 4OJ3A 3N79A 5T7LA 1DRZA 3U27A 1XR5A 4AL5A 2CQDA 3QGIA 2OPPB 1U6ZA 2MQPA 1HNZF 2WAQD 5A8WA 2W9CA 2HAIA 3JSMA 1E6VB 4IG0A 3ZZ0A 4U9RA 2JVRA 3GG0A 1SKWA 3TO8A 1ZPVA 4OI6A 1R89A 3FFIB 2DPIA 5CZVA 4NYZA 4N76A 2EFVA 1UVJA 4EBDA 1KC8T 2HNDB 4DDFA 2PI4A 5BR8F 4GKKF 2ZH7A 3QAEA 3O3LA 3PW2A 1WEZA 3B4MA 2NR0A 2VG7B 2VQFF 2VA2A 2WRMA 4D3HA 4C0BA 3MR3A 1NJWA 4CCHA 1IKXA 2D9PA 4RUAA 1VK3A 5BYRA 2ASJA 2N82B 4ZVHA 3TUIC 5CCLA 4DR4F 1EETB 2I0XA 1XR6A 2ZZNA 3QYYA 4IUFA 2BQ3A 3IG1B 1TKXB 3H5UA 4I1TA 2RF2B 5IT4A 2G4BA 1FE0A 4RU9A 3M8QB 4DSLA 4BC9A 2E66A 2CPYA 4DUZF 2MQOA 2EKYA 2J9DE 4IO9Q 3RAXA 3EGNA 3HVAA 1R7IA 2BVZA 2AQ4A 2CJKA 2D41A 1O8BA 2L48A 2RQKA 3M6VA 2E1CA 3KLHB 4LMZA 1G3OA 2L9DA 4A8YA 3CTRA 4XPCA 4CNZA 1HL6A 2F8EX 3MD3A 2FTRA 2IM2A 4LF6F 5SZTA 1DBDA 4IOCQ 4X4RA 1L3SA 1RT5B 4DF4A 1N54B 2B7BB 3C2PA 4B9UA 3K5NA 2LYVA 1NJXA 3SSRA 2HHTA 4AXIA 5KT3A 4QOTA 1X4BA 2HLTA 2YNFA 2AD9A 4WXWA 1REVB 3L7OA 2ADCA 1X9WA 2DGVA 2F4VF 1N5QA 5KT4A 4NWBA 1X4AA 3BJYA 3V6HA 3PRBA 3VAGA 1X5OA 3R3TA 5HL7Q 4X4PA 2MKHA 1S97A 2XULA 5B08A 3RR7A 2GMJA 1TL3B 3CCVS 4PQUA 3QIDA 4GC6A 2MB0B 4DV3F 4H4MB 5JVHQ 3T5KA 3NBPA 4URSA 4RW6A 4PWDA 4ETZA 2W9BA 2CPHA 4DFMA 2W4DA 2ZOGA 2XO7A 1SQEA 4RU2A 2UVWA 4DV6F 2YNGB 3CCRS 3L95X 1PO6A 4NCGB 3J7YU 3N6MA 2KI2A 1HBNB 4WCEQ 3HP6A 1YJWS 3CGIA 2APOA 3R1LA 2CVIA 1RT7A 3MEDA 2R4FA 3IAS9 2MKKA 1X9SA 2GIQA 5DG7A 2ZDPA 1NK5A 3C8YA 4CO5A 5HP1A 3NWGA 3TNVA 2E9ZA 4OX8A 1QSLA 1IXKA 4DR1F 2YKNB 3T1HF 3THPA 2MJUA 2HHPA 4B9MA 1YHQS 3F73A 3BO3A 2DB1A 3KNGA 5DRKA 5HROB 2Z4PA 4NPOA 2V8DA 1X5SA 2FLLA 2KHCA 3GB0A 1S0VA 4DQPA 1C0TA 4K4VA 4N77A 2I38A 1AFIA 3PY8A 4NLSA 4C3MA 2JX2A 4I56A 1BQMA 3RAMA 2WK4A 1NRKA 5C24A 1UETA 4WU3A 2HHHF 2PA8D 4ED5A 4AUKA 2C3PA 2EFOA 3F41A 3FZ2A 2EBEA 2GV1A 3THVA 3ENQA 1JLQB 4OFZA 4B17A 1RT2B 1YTYA 3SFUA 4J9MA 4PPDA 3OVSA 1Q1KA 5LSOA 1QY7A 4DSFA 1R3NA 5KG5A 2HVIA 2CPDA 1M5HA 1HNIB 3MECB 5ADZA 2B9XA 2HRUA 2PEHA 4XDCA 4I6YA 4KHPF 1FTCA 1X7VA 3CUNA 2XLIA 5CXTA 1R8HA 1RWUA 3VAKA 2DNOA 2EBGA 4MFBB 2J6UA 2CFXA 2IMWP 1SJ1A 3LP0B 3A1YG 2BQUA 3TVZA 2VOOA 4KO0A 4Q43A 1ZM2A 4LIWA 4AXJA 4JI0F 3HX9A 3M9NB 1TKZB 3M8PB 1LK5A 4USIA 3OJUA 2EK6A 3DOKB 2VODA 1TL5A 3K58A 1N5TA 4LF9F 4NCAA 3WX4A 3TANA 4IRDA 4QIFA 4Y2KA 4ES2A 4HH0A 5HBMB 2CQ2A 4DN0A 4UUXA 3AHPA 1VGYA 4N5SA 4DX8H 1JLBB 3NRBA 4DHVA 1URRA 3QZ7A 3TI0A 1D1UA 4EGLA 4F50A 3KLIA 3K2YA 1VLYA 1VQSA 3KFWX 4JI5F 4FS2A 1IR0A 2O3DA 3RRGA 1LWFB 2OD6A 4L3NA 1Q16B 4ZVGA 4U7CA 4P7TA 2UP1A 3JYTA 2E5LF 1VRUA 2ZHAA 1HHTP 3DCAA 1LW2B 1HFEL 1SV5B 2IM1A 2OPSB 3LOUA 1XMBA 3I0SB 2ADBA 1ZAVA 4K4ZA 1W2IA 4CO4A 4OZLA 2QV6A 3BO4A 3RTVA 3QJPA 2LXFA 1HARA 1VI7A 3IWNC 4O3RA