3EXYA

Crystal structure of the 2[4fe-4s] ferredoxin v13g variant from allochromatium vinosum
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
ALMITDECINCDGCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYERITGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title Insight into the protein and solvent contributions to the reduction potentials of [4Fe-4S]2+/+ clusters: crystal structures of the Allochromatium vinosum ferredoxin variants C57A and V13G and the homologous Escherichia coli ferredoxin.
pubmed doi rcsb
source organism Allochromatium vinosum
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3exyA00
3MMBA 1F5CA 3MM6B 5CH7B 1BQXA 2C3OA 2GMHA 1XERA 1KQFB 3MMCB 3MM8A 4XDDA 1IQZA 1SJ1A 2C3UA 7FD1A 1PC5A 1JB0C 3GYXB 2FDNA 2WB1D 1R27B 2PA8D 1D3WA 2V2KA 3OR2B 1RGVA 1WTFA 1BC6A 5L8RC 1FRKA 1PC4A 1FDDA 1H0HB 2FJBB 4OV1A 2FJAB 2Z8QA 2C3PA 2XSJA 1KQGB 3MM7A 3OR1B 3IR7B 6FDRA 4RKUC 3MMAB 1G3OA 2VKRA 2O01C 1FRIA 1GTHA 1H7WA 1SIWB 2FD2A 2V4JB 4OMFG 1FEHA 3EUNA 2WSEC 4Y28C 1FXDA 3LW5C 3EGWB 2WAQD 1A6LA 3MM9B 3MM5B 1FTCA 5BYRA 1BLUA 1F5BA 1Y5LB 1ROFA 3MMBB 1FDBA 6FD1A 3MM6A 4ID8A 3OR1A 4L6V3 1K0TA 1F2GA 1DURA 3IR6B 1GT8A 2GMJA 5CHCB 1FRMA 3MMCA 5BYQA 2FJDB 2ZVSA 3EXYA 2C3YA 2V4JA 4XDCA 1C4CA 1FRHA 3C8YA 1FDAA 2VPZB 3OR2A 2WSFC 1B0PA 2Y0SD 1JNRB 2VPWB 3MM9A 1BWEA 2VPYB 4DHVA 2IVFB 1B0TA 1HFEL 1Q16B 4YDDB 1GAOA 5FD1A 1C4AA 2XSJB 1B0VA 1Y5NB 1Y5IB 1VJWA 2C3MA 3MM7B 4CI0B 4AYBD 3MMAA 1IR0A 7FDRA 1FRXA 3MM8B 1FCAA 1FD2A 2UZAA 1DAXA 1BD6A 2WSCC 1JNZB 1SIZA 4KT0C 5BYSA 5E7OB 1GTEA 1G6BA 2FJEB 2C42A 3HKZD 1AXQA 1FRJA 1H7XA 1DFDA 2FGOA 4XK8C 3MM5A 1FXRA 2VPXB 1FRLA 2PMZD 1FERA 1H98A 1FDNA 1CLFA 2PDAA 1KEKA 3IR5B 1Y4ZB 3PNIA 1FF2A
chains in the Genus database with same CATH superfamily
1YJ7A 3WQPA 3DRRB 2IMWP 2YQ3A 2VIHA 5A76A 3GIKA 1MSWD 3DLGB 2ABYA 3CCRS 2ACYA 1WSVA 3GV7B 4ZDNA 4LUBA 1Q79A 4MT1A 2RQMA 4F4WA 5M2PA 1H7WA 4DSKA 3W9IA 1L3UA 3PYEA 3EUNA 1QY7A 4LF4J 2BKPA 1FXDA 3DOLB 1VQPS 4R25A 1RE1B 4M1KA 4DPXA 3K59A 3K7RA 3MPDA 1S72S 1UVNA 1S1WB 4Y2KA 1VQNS 3FBFA 3LGMA 1C4CA 4HT5A 5A8WA 1S0MA 3E3XA 4QWCA 4RW6A 2EK6A 2RMLA 1K44A 1N5YA 4RUHA 5FD1A 1RTDB 3M8PA 2QA1A 4ZVPB 3Q22A 4DV2F 4KR0B 2DXDA 2A2CA 2FQQB 4RUCA 3J80Y 3POTA 2UUAJ 2ZBRA 3EVOA 4MKVA 3Q89A 3GFYA 2A3JA 2E5LF 1UW9A 1S4EA 1RT1B 1VK3A 1EP4B 1HWJA 5DO2A 5KFIA 4NOHA 2IMOA 3S7RA 3BH7B 4DUZF 3WC2A 1HR0J 3AOBA 3NGTA 5KFYA 2ZJPQ 2XLKA 1AFJA 3NNAA 2A2DA 3AODA 2KO1A 4NLVA 3KJVA 4B9UA 3UD4P 5AE3A 4LF7F 3CDEA 5BR8J 1S9FA 3AA9A 2AYEA 1JQGA 2QGFB 2N7YA 3JYTA 2MEWA 4J9OA 2RQKA 5IC6B 3PACA 4HTIA 2F4VJ 1GT8A 1ZPWX 4WU3A 2R2UA 4LF1A 5DM7Q 5H9FJ 1FVQA 1SH0A 3HO1A 3QAUA 1TUGB 2M88A 2IVFB 5KOXA 3F44A 3MFHA 1T3OA 2IYGA 2EPIA 5AXNA 2QLJB 1LXJA 2H5JB 5KAKA 3OT9A 5IXUA 2XMJA 1S9EA 1VQ4S 1E6VB 3KLHA 1BQNA 1R6YA 4N47A 2C2DA 2FIUA 3JQMA 3EDRB 1BY9A 2W1BA 3R5BA 3VGTA 4JI1F 1CC8A 1D9AA 1WOOA 2D3ZA 4K8RA 3FBCA 3NRBA 4DZDA 5LXYA 4IG0A 3IWXA 5HMZA 3DHWC 1IVZA 1PYTA 4J91A 2AF6A 3I5BA 2KL8A 3MI7X 2CWXA 3O8WA 3M8SA 4DCOB 2K3KA 2W7AA 2BACA 3MAAA 4DDFA 1RDRA 1RLCL 4MKYA 2NCKL 4ECYA 1TTHB 5DRKA 1WTBA 4Q5VA 3VALA 4X66J 3ZFVA 2VJVA 1SBRA 5JVHQ 1LK5A 2AEJA 4DV0J 2ZH8A 3CW2C 3PRBA 2ZD1B 2Y1JA 2D74B 3HVWA 4X62J 2G0CA 2Q3PA 1PAEX 3MHYA 4CTAB 4OX8A 1UJ4A 1NM2A 3LP2A 4USHA 7FDRA 1WD6A 2L9WA 1URRA 1NHKL 4Q8EA 1NK5A 4HYKA 3W8PA 2HHUA 4PQAA 1ZPVA 4WIIA 1K0VA 1VQKS 3UR0A 3CPWR 5I42B 3CJ3A 3OBIA 2OTJS 2UVWA 3PW7A 4B3RJ 1N0UA 4HLBA 4R0JA 4FPIA 3VR1A 4U95A 5A8KB 4A4JA 4M5NA 4YHHF 1DHMA 4OX9F 1CULA 3U1MA 4IG3A 5IFMA 2GIQA 1CS4A 2MKCA 1AW0A 1XMQJ 2QE5A 4I6WA 1WHVA 1U26A 4IOCQ 1IBMF 2E9TA 3EGVA 4YP3A 4RNNA 1N5VA 1FJEB 4DR3F 3V6KA 2FLOA 5E2QA 1MMNA 3O3LA 1YJRA 4P6QA 5DS7A 5HMXA 1NH8A 3JSYA 3HVAA 1HFEL 3PZPA 3MEGB 4X4UA 2BBEA 3FEYB 2DEJA 5J2QA 5ETSA 5T41A 2FVRA 3UFCX 3ISNC 1RT3B 1YRTA 2J9DE 2J9DA 2B5JA 1GMWA 2YWKA 2HQGA 3OV7A 2EWHA 2HFZA 3W2VA 2HFUA 3CJKA 4EU0A 3HK2A 3QIPB 1FDDA 3GIIA 1F1BB 1HNZJ 3OTEA 3AA8A 3FSXA 5IWAJ 4MYTA 4OHZA 4Q7AA 4W90B 5KFZA 3WZ0A 4J9NA 3L7OA 1EARA 1JXLA 2PI5A 1EQMA 1TQLA 1KVIA 5H9EK 5J1EB 5CYJA 4QIFA 3IG1A 5DQGA 2UUCF 1NMEB 4BC9A 4NWBA 1CC7A 3QFHA 1SJ4P 5DLGA 3UDVA 4W92B 4HACA 2VC1A 3GJTB 5K8NA 3RRKA 3TARA 3BYRA 3QLHA 2YH1A 1TK5A 2HLUA 4CO3A 1OJ4A 1F5AA 4RBVA 3V2UC 4DR7F 3TRGA 1S6PA 4DPOA 1FD2A 4USUA 1XBWA 2H4WB 4JP8A 1CJUB 4J9UE 1FE0A 3V6JA 3RR7A 5HBMA 3I5CA 4DR5J 1CLFA 2FYXA 4Z7YA 4R0EA 2FZKB 4Y0FA 3M9NB 3QWUA 1VIOA 2HQCA 3M8QB 3GYXB 4OI2A 1IWGA 2RAQA 2M70A 1NO8A 2JJ4D 5CZVA 3US5A 2AYGA 4B9MA 2IA6A 1HQEB 1UW4A 2XGQA 4RKUC 4CLPA 3M2UA 3M9MB 2FPHX 1Q82T 1M5OC 3NL0A 2OP5A 4XPCA 2HPUA 1N33F 5ETQA 5LJ3Y 3CD5A 1NSQA 4B9VA 3IBCB 4L72B 5CXTA 4MAKA 3OSPA 2E44A 3D6HB 3OLAA 5HROB 4J9SA 4ED6A 3DLBA 1F60B 1S0VA 4C97A 1Q8IA 3ENAA 4YDDB 4A8XA 3DLJA 5DZ6A 2ZZNA 1T8EA 2CIMA 1T94A 4RX6A 2LECA 1KDNA 1H2UX 2PC6A 1NDKA 4QIEA 4UQGA 2C2ZB 2UXDJ 4ZPDA 3HD1A 4DS5A 4WFYA 1R0AB 4JI7F 3Q83A 3T1HJ 2RILA 4WCEQ 2B9EA 4C11B 1DY3A 2XS7A 2VBZA 3B6BA 1Y7PA 3MEKA 5JMNA 2JSXA 3N6MA 1ZZNA 3C3LA 4OI0A 2PEBA 1XNQF 4OZ1A 3M9OB 5F9NA 5CYMA 1VJQA 4JV2A 5EHHA 4DFPA 1U1KA 1U45A 2BZ2A 2W24A 4JI2F 3ZZPA 2DR7A 4KGMA 5IT9U 1KVJA 2J6UA 1QM9A 5AXMA 4Q0BA 1MNEA 4JV5J 2NZ4A 2RRAA 2G2ZA 5DG7A 5ITHA 4MYUA 5IM0A 3CO0P 2W8LA 3TZWA 2J0SD 3CF5Q 4BWMA 5LMNF 3GCXP 4B17A 2H51B 4HHUA 3BKTA 3PCOB 3ENQA 2C2OB 3ADAC 3OVBA 4NYZA 3MPWA 1X5OA 4DS4A 3LTOA 4FNIA 4FF2A 1QAXA 2CPEA 1JJCB 2XB2D 3I9ZA 4RUBA 3QZ8A 1EQ0A 1JLEB 3B8HA 2A1BA 2V2VA 3MM8A 4OI4A 5G0RB 2XY6A 2CWKA 4AQYF 2MGZA 2CAJA 1ZS6A 2EC2A 1YBUA 2HGLA 1O5JA 1RAIB 5T7LA 2OGUA 2VV5A 2YNIB 2CJAA 2KXHA 1NRKA 4WZQA 3MZIA 4LF8F 1U0HA 2DRBA 1RBAA 4JYAF 3DRYA 4CO2A 4DN9A 3GYNA 2JC0A 4M94A 2XWYA 2BRLA 2W8KA 4D3GA 1C1BA 1Q5YA 1RUSA 4UY8T 1V3RA 3OR2A 4FYYB 4DFKA 3G82B 4PAAA 1T05B 1TKDA 1B0TA 1T3NA 1NJZA 4NLUA 1YRXA 2M52A 2ACMA 1U24A 4GVLA 4H4OA 2OFGX 1BD6A 3QGGA 1KTQA 3FNNA 1GTEA 1G6BA 1KVKA 1CJKA 4J9QA 2XNRA 4WBFA 3J80U 3KOAA 3TR5A 2L48A 3NMAA 3GR0A 3Q2TC 4M5HA 2Y9HA 4IRCA 3O1LA 1NB7A 4V19X 3M7VA 2XHWA 4OQJA 3M4XA 2ASLA 8RUCA 4BC7A 2R7SA 2Y1IA 4JBCA 2Q6CA 2BA9A 4DSLA 4IDKB 3AJ1A 5ETMA 1OS5A 2X7IA 5A8RB 3QGPA 3QMQA 2HNYA 1PIEA 1NK0A 1M5PC 4B3SJ 4ICLB 3V4IA 4I0WA 4LREA 4WWSA 2ZZTA 2XNQA 2VDIA 1WELA 2MXYA 4KY3A 4CLSA 5A2QY 2ZOGA 2K7KA 2DXFA 5LM7E 4F3OA 2MQMA 2GS8A 1VRTB 1ACMB 1PAUB 5E7OB 3M1VB 3MAHA 1U1OA 4KHPF 2UUBF 1UCNA 1DTQA 4WP9A 3P96A 3Q2SC 1TK8A 2B43A 3AFGA 2N4DA 1S6OA 3OHAA 2XLJA 1BC6A 1SQEA 2WZ1A 2DH8A 2RIJA 4YY3F 2B9YA 3MEEB 1T7PA 3GCWP 4NEZA 5D3GA 2G0JA 1KOHA 4AT1B 1I6JA 2ZH9A 3P5BP 2ZM6F 4NZ6A 5KFPA 2XTJP 4HL9A 4O44B 3NWRA 4QIVA 2DGTA 1G1XA 2BJDA 2XHCA 5HQ8A 5CHCB 4L73A 5K8MA 3G6ES 1KFDA 2MLXA 2L9NA 2JRSA 4AUKA 2PI4A 3RBZA 1CJVA 4DR2J 1OSDA 2W2NP 3T1YF 3J7YI 7AT1B 3VAFA 3M32B 4DR6F 4EBDA 3AD8C 4UY85 3I0RA 2GAGC 5KFHA 2HK2A 3NAHA 4XIUA 3DGVA 3Q8VA 1LW0A 1YRUA 4ZPWR 4DV4J 4B9SA 3GONA 5IOLA 1NJYA 4ZVGA 1IJEB 1JWWA 1NJWA 3BO4A 5KG6A 4GKKJ 2GCFA 3DGPA 1D1UA 2DGWA 2VBYA 1RT6B 5A0YB 4E8UA 4ANEA 2UV8G 1XNRF 4ZIWA 4EI2A 2FJAB 1JXEA 3BBBA 1N54B 2KFYA 2Z4PA 3I96A 2YNFB 3CCUS 1Q95G 1NBEB 4M5DA 4U7UD 2WHOA 2CNKB 2YQ0A 4ZCMA 4NXMF 1T03B 4CP5A 2BX6A 4ID8A 2IJNA 3NGUA 1F2GA 5DLFA 3KYLA 4LF6F 3OXLA 2OI2A 1U1PA 3NKYA 4EWTA 3W60A 1MG7A 4WYLA 4K0KF 1N6QA 1S6UA 4OJHA 3SCLE 4PG7A 1X4DA 4ZJOA 1FRJA 2FC8A 3PXGa 2RRNA 3Q8RB 4MK7A 2PMZD 2VH7A 3PR4A 3CE8A 3MOJB 2RUSA 4FPRA 3MFIA 2F65A 2FLLA 5IC4B 4KKOB 4ZVTB 1WC1A 4NCGB 2IAJA 5L9XA 2VJUA 3JSMA 2R7RA 1VC5A 3DKDA 5C24A 2FZGB 1ZM9A 4JI4J 2ZHBA 3AOCA 3D0IE 3KJQB 1FRIA 1R8HA 1IKYA 5IZHA 1MWQA 3M8RA 2AWZA 4OYIA 4WF9Q 3C15A 4Q43A 5C2GA 4QBUA 1WSRA 1ROFA 3EVMA 2QFIA 3PX4A 3KHHA 5KT4A 3FEZA 1UVKA 4EZ6A 4LF5J 3FK4A 1JKHA 2V8VA 4F25A 3AT1B 4EO6A 1JLQB 2YKAA 3QRQA 4QJVA 5KT3A 1VJWA 2CPYA 5JUMA 3KDNA 4QIWD 4JUZA 5HJXA 1EIYB 2X51A 3V6HA 2DGUA 3K57A 1NSKL 3RBDA 1DBDA 3A8EA 3IWLA 2E1AA 5GAEI 2MZ1A 3B4MA 5ETVA 1YTYA 1BQMB 2WVBA 3PYDA 3KMSA 1N4LA 4JI3F 2BE2A 2L08A 5IV3A 1SQFA 4JI5J 2N7CA 3BGRB 2J0WA 2R7UA 3TI0A 1GK8A 3G87A 4DV3F 2D41A 2VG5A 3JS9A 2BOAA 3GFHA 2JEIA 2QC3A 3SQOP 3AB2B 4BDPA 3W65A 4Y2IA 2V4JB 5A6WA 4DQRA 1GMUA 1CQMA 2GVDB 2GZOA 1RACB 3TAMB 3WX4A 3NNCA 4AE5A 4L3NA 2UVVA 1Q78A 2K06A 4LVNP 4OYZA 1SXLA 2JFDA 4FYXB 1VBKA 1U49A 3QBCA 2OH2A 1SV5A 1ZAVA 2ZDPA 3FZ2A 2GJIA 4TYBA 5U47A 4FXVA 2R9LA 3R27A 3DU5A 1M1KT 3EM1A 1UJ5A 2ZC4A 5IS2A 2A6MA 3Q8UA 1DQ8A 3KK2A 5J2MA 5L8RC 2LQ9A 5HATA 3K0JA 3MR5A 1G4CA 4DV7J 1IBLJ 2KFZA 3ZTPA 2OEJA 3R5CA 2HQIA 4CO0A 1X5TA 3K5LA 2HFSA 3DMJB 3GV5B 4USVA 1FD8A 2BRKA 3MM9B 1I3OB 3HJVA 5L39A 1UAWA 2MZSA 2ATCB 1AFIA 4EUVA 1Y10A 1KHWA 2KT5A 2KHCA 5KFVA 3SSQA 1ELOA 4WP8A 1RCOB 1S57A 3AOAA 2FY1A 4I68A 4LFAF 5DDPC 3TNVA 4KTQA 2B7BB 3HSDA 3IRWP 3H4BA 3CEDA 2LFVA 3QIDA 3EYZA 2DIUA 2LEBA 2ZDOA 5L46A 1LWCA 3H20A 1VRUA 4F0KA 3AJDA 4DQSA 1YX2A 1WOPA 4RR5A 1TUWA 1RABB 2QA2A 3Q8PB 1RTJB 4P10A 3MCSA 2BJ1A 2W2QP 2QSWA 1QTMA 4EMDA 4DL0C 2J7WA 4KHRA 1PO6A 1ZAWA 2B8QA 3DLKA 4NXNF 3I87A 3OUYA 2P8IA 2ZH3A 1S10A 2XY5A 5HL7Q 4MKAA 4PYAA 4HH1A 4RW6B 4CO4A 4PUOB 4DV2J 3M8PB 2FHJD 4RW4A 4DSFA 5EN1A 2E1CA 1B99A 1HNIB 3D3CJ 3POTB 4HVZA 1BWEA 2IC3A 5GAEU 4OYOA 3ISND 1RT4A 4IFYB 3H25A 4I7FB 2ZJRQ 2RE1A 3EXCX 4G6VB 4DUZJ 1SJFA 3UR3C 1FKPA 2ZITA 2CPDA 2L3MA 4ZN1A 4TNOA 3LWLA 1YG0A 2IRUA 2KYXA 5KFJA 4ANCA 4TN2A 4DZ6A 4I2QB 4LF7J 4YS2A 3K5NA 4F02A 5SZTA 3IGNA 3NCRA 3JYTB 2WONA 2KM8B 5KT7A 4NMLA 3PO5A 1FVSA 1HHTP 2L9DA 3DDIA 3D1QA 5IQ6A 1JJ2R 2CG4A 1PBUA 1R8CA 3GU0A 4U96A 2ZE2A 1UVLA 2HHHJ 4WPAA 2HMIA 1EHWA 3OFGA 1NJXA 2LDYA 4KQZA 1HNXF 1ZTWA 3KLHB 2I6WA 4WKRA 1UFWA 4J7CA 3CJ0A 1XWLA 4MFBA 4LRAA 3I4PA 1B0PA 2DB1A 2OMLA 1YBAA 4YDXA 4JI1J 2NYIA 1Q16B 5KFAA 3FFIA 4ZVUB 3HVTA 5A2QU 4OYXA 4TQRA 1BE4A 1RJJA 4IG0B 5L9NA 3PFEA 1HYSB 3R97A 5F3ZA 3AJ2A 1T95A 2CQGA 4Q45A 4FP9A 1M5KC 3F56A 3H7HB 4Z2XA 2YPZA 4O0NA 3RW7A 2R7QA 4NLTA 1MROA 3DOMA 3DCAA 1IR2A 1UPMB 1R31A 3MR7A 3ENWA 4IFVA 3D2WA 4EBEA 4MTPA 3FRYA 1VR6A 4A8SA 2RHSB 1RTHA 1Y00A 1W26A 3BGUA 4PWDB 1Z4UA 1B4SA 2ZJQQ 1U1QA 2CZ9A 1D8YA 2KZMA 3KKFA 1D9DA 3MM6A 3OR1A 1LNQA 1DURA 1KWMA 5KFBA 3MMCA 3CDWA 1O51A 1C1CB 4Y2CA 4U9RA 2R3VA 2ILZA 2HBQB 4Q8FA 1P1LA 2DXEA 4ID5A 4DUTA 4ED7A 2G2OA 3TA1A 1NK6A 1AROP 3DM2A 3I82A 2VQFF 2M2BA 1VQ9S 2Z2MA 4YHHJ 4OX9J 2FJVA 3ET6B 1U1LA 5D0HA 4USKA 4IG3B 4U8VA 2P5VA 2M3DA 3W5XA 5DDOC 1IBMJ 5CCLA 3CCVS 3GILA 1SC6A 1HNVA 4RU2A 3ULHA 1FJGF 4BCAA 4DR3J 2CQ2A 2H5IB 4ELUA 3NGDA 2WSEC 3T9ZA 4FYDA 4B08A 2CNLB 5F8MA 4MJKA 1EETA 2F1FA 1N34F 1D8ZA 2LQ5A 2XZWA 4C0OC 2HEKA 4L6V3 2L41A 1FE4A 4ETXA 3QGHA 2MQOA 3SV3A 1TKTA 2R4FA 3B82A 5J2QB 1X5SA 3LO3A 2RKIB 1S1VA 2XLIA 1Y5NB 1UL3A 1TL7B 1S12A 3ZTSA 4U6PA 4H4MA 3CMES 3JXOA 3V6DA 1RYSA 4LSNA 3LANA 3R9LA 3CJKB 1NDPA 2YWGA 4QW8A 1TV6B 2H48B 3D68A 4WK1A 4M5GA 4EEYA 2JVRA 4DR1F 4B9TA 2RH3A 3R6LB 2OPRB 5A6PA 3K8VA 3GLJA 3VZIA 5GMDA 2EFGA 2B56A 2C3PA 1X31C 5DGAA 1S99A 4NI2B 2EFOA 3VZHA 1H73A 3TX8A 5B08A 3JAMY 5T14A 4HACB 1KKHA 2I5JA 4MK9A 3VGSA 4YB1P 1FKOB 5D77A 1S6PB 2OAUA 1H2TZ 3VV2B 5AE1A 3IAS9 1F9FA 3O2IA 4ZPBA 5HBMB 1NPPA 1Q81T 4YOEA 2HHTA 2VASA 4ER8A 2AGQA 2N4CA 4W4MA 3IS9B 3RBXA 2WCXA 1RWKB 3H40A 2YX7A 1HW9A 3TP2A 5M2RA 4FS1A 1ITPA 4GRSA 2MZQA 1Y4ZB 2MHNA 4ECVA 4NPOA 1DLOB 3M2UB 1JLGB 4IKAA 2XYGB 4DL3A 1JLBA 1SKRA 3LGHA 4GC6A 1N33J 2ROPA 2XMWA 2YKNB 3GB0A 1OO0B 1NB2A 2NPFA 2BANA 3DRXA 4P71A 2VG7A 4AL6A 4KFBB 5FLXY 2ADBA 3OW2R 2NPIA 2WB4A 2MTLA 3MMBB 4P72A 4F4KA 2NR0A 3SMZA 1K1QA 4Z7CA 2DRAA 2BM1A 2XC9A 2Z2LA 4LT6A 3BGFA 4DL2A 1IKXB 2HFOA 4JI7J 3FCWA 4KV8A 5GMKa 1REVA 3DRSA 4WTYA 5KFGA 3VAKA 1IBKF 1V3SA 3P3DA 2V8GA 3MF5A 1FNXH 4B3OA 3KTQA 4NYOA 4F8RA 4DF8A 3KLEA 4JI8J 4TU8A 2LYVA 3W1YC 2WOMA 3KLGB 3L7UA 2CG8A 2E29A 3HSJA 4P2XA 4X4OA 1R27B 3D1HA 2GX8A 4CCHA 2XZDB 1UWBA 3PKYA 3I32A 1Z2LA 2HHSA 2BJEA 2CQDA 2XSJA 5B0GA 4E0DA 2VFSA 5HVFA 2JNJA 2A0FB 2MQPA 2KT3A 3M6XA 4DQIA 5F8HA 5LMNJ 3KLIA 3PEJA 3R3TA 4ETZA 3N79A 3QQCD 3BKUA 2AYMA 2X1AA 3NP5A 1VQ6S 4FXWA 2VPZB 4XPEA 2PN6A 3RUBL 4NLDA 2N82B 3DDNA 3SSSA 1WHWA 3PM9A 3W9JA 1X4FA 2VG6B 4PG4A 2VQEJ 5KFOA 1YGYA 2XMTA 1RQ0A 3C2PA 3HSGA 3DOKA 1RHMB 3MM8B 2BUNA 2UZAA 1SC4B 2MGZB 2VOOA 5BYSA 2DK2A 3QO9A 1U1NA 3NS5A 1JLAA 3R5DA 2BQ3A 5J2NA 5KFCA 1SI9A 1F5CA 2QYGA 1UPPA 2YXLA 3ZZZA 1JJ4A 2IRXA 3D1OA 2DD8S 4LF8J 4JYAJ 3R5AA 1U0HB 4KGZB 4Y2AA 1DTTA 4TQSA 2HFNA 1RWVB 4K4WA 2F8EX 2DR9A 3PW2A 1LK7A 4OV1A 2HQ3A 2OIHA 3N9UC 4GVBB 1GQEA 1F9EB 2NUUG 1C1BB 4L74A 3AAWB 1HMVA 3ITHB 1BWVA 3V81B 2C2RA 3ONQA 4DQQA 1NK8A 4ZPVR 2GIRA 3LALA 2CQBA 4CRJA 3PW4A 2BE9B 1EAYC 2XMUA 1WEXA 2UUWA 5B0FA 4WTOB 2VODA 5D0EA 2DH7A 2P2CB 2N3OA 3HULA 2ROEA 2NLWA 3V4MA 1S0OA 1YSJA 2WVEA 2CJQA 4DLGA 3EZUA 4HI2A 2K1RB 2C22A 1CJTA 2JEGA 2W25A 4CNZA 2YVSA 4B9LA 4NYPA 2ERRA 1HD1A 4N5SA 1J5OB 1FJCA 3CJ4A 5F8GA 1VYAA 1XMOF 3R1HA 2M7SA 3N5BA 3R5GA 3R2DJ 4PKDB 2GNKA 2OUGA 1QVGR 4IR9A 2J0XA 5L1LA 2NXEA 2GO8A 3CGIA 3PX6A 2O01C 4ZOSA 3HCXA 4YR0A 1PKUA 3C14A 5C25A 3T9NA 4ZMMA 1PYOB 4Y28C 3MM5B 3VAJA 2DJWA 2MQLA 1BLUA 4OZJA 4U8YA 1TKXB 1FA0A 2V4RA 3FQLA 4ZHRA 3GSDA 4KHPJ 3KLVA 1KN6A 2UUBJ 2B0GA 4DG1A 5D6GA 3PTWA 3G6XA 2QLXA 1RK8A 3J7Z5 2EC0A 1B3TA 1WHXA 1DTQB 4RW8B 2QSFA 2W01A 3BQ1A 4ZA1A 4K2XA 3B78A 3JTPA 5DG9A 1DZ5A 2FGOA 1L3VA 2YX1A 3N0VA 4G65A 2YX4A 4YY3J 2X3DA 1TUVA 3Q24A 2Q6BA 1J5EF 1NSAA 1TR0A 3OTCA 5D3GB 3OXGA 5D4LA 1VLOA 4WFZA 2ZM6J 3CDAA 5E33A 2AYBA 3H5YA 1QSSA 1WTFA 2IDEA 1F3FA 4YEAA 2H4YB 2WVDA 1VGYA 1C0TA 3B4DA 3S8SA 2IRYA 4ZP7A 2YWHA 3PEHA 3FGVA 1T11A 3KDOA 1S97A 3DLLQ 2H65B 1F5BA 2P9EA 3T1YJ 2FHOB 5LSLA 3K17A 3IR6B 3NGSA 3DRRA 3IA0A 3ZZUA 4F7VA 1XTZA 4DR6J 3DLEB 2X1FA 4J37A 4S0MA 1SH2A 2E5HA 3UD3P 5B7WA 1RAJA 3PW0A 1LW0B 2GQ2A 5KFQA 1X4GA 1HBOB 3PHEA 1A0OB 1WC0A 3PHTA 3UWTA 4X65F 2KG1A 2V8DA 5EDWA 2YNGA 1S6QA 4P7VA 3DGPB 5EWEA 3DOLA 4IRDA 2BEFA 1Y9OA 3MTKA 1IJFB 1X5PA 3IN5A 4K4SA 2WK4A 2YWWA 4IOBA 1S1WA 4PG5A 2DGQA 4USIA 4IQMA 1CSJA 3D28A 4NXMJ 1XN9A 2AGPA 2M0GB 3IBFB 4IRKA 2RDJA 2XI2A 2I38A 1UFLA 5LOQA 5ETNA 1Q53A 2V9KA 4LF6J 1ZM4A 3D6TB 1I5OB 2F7VA 3GJQB 2LP4A 3HP6A 4QWBA 3H42A 1RLDA 2BW2A 2HSEB 3UDLA 2Y0BB 1FDBA 3VAIA 1EP4A 4C8NA 4K0KJ 5HQLA 3D5MA 2ZVSA 1N6QB 3SZ2A 2XG8A 1TL1B 4ZVRB 3I55S 1S1XB 3L9ZA 2QZ8A 3CWJA 2FVQA 2JEJA 2AZ3A 3OLBA 2MPUA 3BH6B 3CJTA 1RT7A 2Y3YA 1SKSA 2W9CA 2B9WA 2CQIA 4OI1A 3NWGA 3ZZYA 2FC9A 1T9TA 2E5JA 3X1LB 2IAJB 3LF0A 1VLYA 4K4YA 4TKTA 2GJFA 1UTAA 5E41A 4HT7A 2YKMB 2IFXA 3D6FB 3TW0A 3BGOP 3C15B 2HZCA 4C0HA 3M05A 2XCAA 4O3SA 5LXRA 3PYFA 4LFBF 5K14B 3L95X 4NA3A 1E6VA 4K7QA 3F0NA 3SDEB 2AV5A 1RAAB 5AJ3F 3RGIA 4F67A 4LQ3A 2J6SA 1XK8A 2E7VA 3JAMU 1K73T 1V5IB 4YFUA 5I3QA 3ZZRA 1XC9A 3GV8B 2D7SA 5BYQA 1RBOB 2EKYA 4NRTA 3OTBA 4ELVA 1GXLA 2VPWB 4X4NA 2GW8A 4ILLA 1OSCA 4F36A 5JJBA 5FJ4A 1L3KA 2KKHA 2VBXA 4JI3J 2VU5A 2A18A 4F4YA 1RTZA 2W4CA 2JLFA 2OFHX 4DV3J 3G71S 2WVFA 4NMXA 2MJNA 3HJFA 3ZO7A 3UVJB 2OO4A 3C6TA 2JHEA 4DV0F 3LA0A 4J9VA 3CCQS 3GIRA 2X1GA 4YR3A 5HMWA 2JEFA 2HHXA 4LIWA 3A3NB 4CTAA 2JH3A 5KFSA 4ED2A 2HS3A 1DQAA 2PSZA 3FBEA 5E5NA 2AJ0A 2IJFA 3DDKA 5FLXU 5I42A 4EZ9A 2IY5B 4N41A 1S1TB 5F8LA 1JX4A 4DL6A 1SV5B 4B3RF 3NAIA 3IBWA 4CLZA 3KG1A 2VF3A 4PXCA 4Y34A 4LSLB 2E9ZA 5GADU 2IA0A 5GAGU 1HQUB 4PCQA 3QJPA 5H9FK 3TZYA 5J2MB 1FERA 4M5MA 5RUBA 1WDDA 1TL3A 3IR5B 2BJ7A 3K2YA 3OJSA 2HHVA 1XR5A 4C9DA 3O5TB 5FDLB 1GFWB 3MD1A 2J0QD 1HPZB 2DNRA 4IQXA 1SKUB 2IVMA 1P27B 4RW9B 3UNYA 1UZDA 2QV6A 4K59A 4NCBA 3WX8A 4K4VA 1RWXB 2HQDA 3PRVA 3UN2A 4WZMA 1AA1B 3MEGA 3J7A1 2BV3A 3H2UB 3F41A 1TP7A 3LP1A 3BN7A 1RT3A 1FTCA 2YWEA 3H2LA 1NPKA 4RJVA 2O66A 4LFAJ 1HHQA 1RAFB 1V6HA 2FGCA 2F8MA 3LP0B 1R8AA 4NLSA 4B3TJ 1X4CA 2V8PA 5DGBA 1VRUB 3CCLS 5E3QA 3TUZC 1FT8A 1HHSA 1FK9A 2VFUA 3GPAA 3GFZA 4CLFA 3MEDB 5LSRA 1SIZA 1VQ8S 5KG0A 2DNKA 4ECZA 1JXVA 3HKWA 1UETA 5MAOA 1UVIA 2QRRA 2VBWA 1Q8KA 1YWXA 4NXNJ 3DLKB 2CQHA 2B4UA 2XY7A 2C3UA 5F41A 2XO7A 4V1Ak 1N36J 4ZIVA 3CCES 1YZ6A 2DTJA 4XTTA 1TKZB 2P9GA 1KLMB 5DDRC 5JVGQ 3QJJA 2AJ2A 2KG0A 2ZEJA 2YKPA 3HHKA 3BS9A 2CVIA 3TX0A 3H4DA 3FC9A 1YQHA 3CB4A 4OMFG 4DUYF 1EZZB 3LW5C 6AT1B 1SJ3P 2V63A 1JLCA 1RHQB 5L1IA 3TJ9A 4DFMA 4A8YA 2H1YA 1B64A 4ZCLA 2MQ8A 3OTOF 1GH8A 1FKPB 2XWXA 1BHNA 2CVEA 1QSLA 2OSQA 5DG8A 3IM9A 5KG2A 1IR0A 1NH7A 2NXCA 4KT0C 1WACA 1YBTA 1A7GE 1RWWB 3J7AN 5J1PA 1LWFB 4QIGA 2HK3A 2PGCA 5HP1A 2KVQE 5FIIA 5HROA 5HLFA 1APSA 3MUTP 2AJ4A 5GAHU 2QLBB 2HMIB 2UXBF 3B54A 2LDIA 1Q86T 1WHYA 1FNOA 2VKZG 1NPRA 4WU2A 4NLGA 2NSBA 3HI9A 4QYRA 2B6AA 1Q8BA 4M63A 4NL5A 3WC0A 2XMVA 1MU2B 1R0AA 5KFLA 4CO5A 4JV1A 2VHGA 3T3FA 1YHQS 4C11A 4ANDA 3RG6A 3R2CJ 3G9CA 2ZZMA 3NS7B 4I56A 3W64A 1Q7LB 1X4BA 4PXDA 1TFWA 1MROB 3DOMB 4I6AA 5SUHA 2C42A 4OLPA 4H4KC 5E3RA 3PV8A 4IFVB 2C2NA 5DJBA 4TYAA 2FLNA 1YVFA 3HD2A 5HVHA 1RGVA 2DR6A 2YWFA 2YTCA 3RJMB 2CXEA 1ZM2A 4QQBA 2RU9A 2HNDB 1QVFR 2DR5A 2HHWA 3OR1B 2XYHB 3EGZA 2BQUA 5CD4A 3VF0B 4YMEA 3IRXA 1F9HA 3VGVA 1KHVA 3ZC4A 4IH7A 3KNGA 2IBOA 1IUJA 5ETTA 4NASA 2DNQA 2EK1A 2Z58B 4ID5B 4A8FA 1S1UB 5G0RA 1NKCA 2LQBA 1CVJA 4ERDA 2RUGA 3ILOA 2R7TA 2VQFJ 2V94A 2PFFB 4M5JA 3EJMA 1HBUA 1Y3JA 3J81j 1YJNS 3L09A 4ZN3A 4LIRA 1RTIB 2WVCA 1VIXA 1RAHB 5HQMA 1JJHA 3RB3A 3GE9A 4K50A 1P9QC 2YNHA 1WOSA 2ZKUA 2NREA 1FJGJ 3TO8A 2ZWPA 2ATLA 3H59A 3MAQA 2B8PA 1L3TA 5I4MA 1S79A 1JB0C 3K5MA 2IJRA 4P7TA 3G82A 1T05A 2MKYA 1JMTA 3R7NB 4YUDA 4GKJF 4I2PB 2DHHA 3UN5A 4OJ3A 4P52A 3FBBA 2P9CA 1GEHA 2B4OA 4TY8B 2D9OA 5F8JA 2RJZA 2I8EA 2IPOB 3BDEA 3KUEA 4DV5F 1PSDA 1K0TA 4O3QA 2FHJA 2V69A 2RS8A 4WFXA 1FWKA 2OPPA 4LSNB 1NUEA 2C2KB 4C8MA 4NZ0A 3DLHA 1W7WA 3LOUA 1REGX 3DHXA 4DR1J 1YIJS 1VC0A 1P6TA 1YDLA 3KUHA 4IDKA 2G9OA 3BPDA 3KK3A 2BQRA 4ES3A 2JX2A 1HBMA 4D3HA 2MY7A 4DI6A 2GQCA 4ICLA 3HHLB 1SUQA 2KVIA 1ZA2B 1KD1T 3C16A 5IV4A 2CPZA 3QNWB 3OD2A 1IR1A 1VQ7S 3CJSA 2VA3A 1SIWB 4CM0A 2CZ4A 4FF4A 4LQ9A 2BMBA 4QZVB 3VAMA 3QYYA 2CJXB 2OMOA 5K8OA 4AL7A 4PABA 2V68A 4DR4F 2WBRA 4ECSA 2CJ9A 4OIXA 1KS2A 3UW1A 4PQUB 4ZLJA 2WSFC 1FFGB 2ZBPA 1OY8A 2EXUA 2GVZA 3GG1A 3BSNA 3H5UA 3CC2S 1NKBA 2JLGA 4UUXA 5KFEA 5EWFA 4OHYA 4QW9A 1FCAA 1RWPB 4FKXA 2ZUGA 4O44A 4RO0A 1XR6A 1WKKA 4DL7A 5J1NA 3T19A 3DYAB 4QU6A 5B0CA 4LR8A 2NQPA 2QLFB 3F73A 4AL5A 2CNOB 3KMQA 4RNMA 4BWJA 5LMUF 2NYHA 1EX8A 3OQ2A 5J2PB 4DPYA 1MMLA 3M2RB 3FUYA 4WKYA 5ADZA 1NLKL 1TAQA 1AYEA 3OVSA 1L3SA 3EGWB 3QATA 3S6EA 3T41A 3G96A 3HFKA 3P45B 3MECB 3KHRA 4KV8B 4MMOA 4ZPCA 5KTQA 1IBKJ 4PEOA 5IQQA 1RHJB 4OYWA 3CC7S 3RAXA 4IH5A 5A0YA 2GGPB 4QYZJ 2DNNA 1ZOTA 3H2VE 2YNFA 2DKOB 3MCNA 2EFPA 2KZZA 1RT5A 1VQLS 2WSCC 3QWPA 4C3KA 2ZH7A 1RA6A 2VPXB 1T03A 4Z37A 1FDNA 1UWBB 4P73A 3DRPB 4LF2A 1AZSA 2IM2A 2AX0A 4X84A 1XERA 3RZAA 1UFKA 3W63A 4ZCKA 3ZNJ1 5CQGA 1S0NA 4ED1A 2Z2YB 3UI3A 1FTRA 3KLIB 3W8GA 3AY0A 2CJYB 4RZRA 3EPIA 4YR2A 3DC2A 3D3BJ 1U09A 5CYQA 3EWGA 2O5DA 4OZ3A 5B0BA 3FCVA 2GMJA 1QDUB 3W2WB 1IKVA 2QTWA 1FEEA 4WE1A 4KKOA 4NCGA 4A8OA 1PJ5A 4ED4A 1JLAB 2OPQA 2BJ8A 5J2NB 2WRMA 2AQ4A 1OY9A 2NXJA 4RNOA 2MKKA 1DTTB 1IXKA 5ETPA 4L75A 2HZAA 1FF2A 1UJ6A 3IXQA 4JOUA 3SQGB 1TMJA 4EGLA 1HMVB 3R1LA 1WWHA 3DU6A 2KT2A 5EWGA 4ZITA 3E01A 2NUHA 4OZLA 4IUFA 3MMAB 4IO1A 3R6GB 1FEHA 1X60A 3NBPA 4ATNA 3T1AA 3PJWA 8ATCB 5KFRA 1LFPA 2R8JA 3GIJA 1X9MA 3DN9A 1BQMA 4LMZA 1VOMA 4ZP6A 4ZP9A 1VQYA 1F6TA 1WEYA 4JI5F 3Q8QB 4RW7B 1SL2A 2AEMA 3HXMA 1S77D 1IKWA 3OVAA 3N6NA 1SJQA 1XMOJ 3QSYB 4DJBA 3FCHA 3GTYX 4RPFA 5KFMA 1VISA 1M1GA 2M5YA 2ZBIA 1IM4A 2IIHA 2RHQB 2GMHA 3PO4A 3EGNA 2IM3A 1N5TA 3MWBA 5C25B 3MR6A 2VICA 1KC8T 4RUAA 3M8WA 1WC3A 2XEXA 3GG0A 4M8LA 4ALZA 4DX7A 3DI6A 4KSEB 2B3TB 1OWXA 4ZHRB 3CCWA 3GR1A 2R2SA 3DXSX 4M95A 4RU9A 2MYFA 3BR8A 1NK7A 3QT5A 1QUPA 1V3ZA 4YB5A 3QAEA 1H6KX 4CYUA 5KG7A 4A8MP 3PG9A 1FDAA 4M5KA 4UUWA 1HIYA 1HNWF 2SXLA 4PXBA 2MDAA 1J5EJ 1FFSB 4AXIA 4LRBA 4BLGA 3A8JA 1RAEB 4F4XA 4P2FA 3DMJA 4P2SA 2MKSA 2IYIA 1T9UA 1H98A 3NOGA 2ZH4A 4MIAA 1VBZA 1S5ZA 1C0TB 4OI6A 2XM3A 2JOQA 2NXNA 7FD1A 3HVRA 1Q7YT 3M2VA 1KONA 1N5SA 3RRGA 3EICA 5LJ5Y 4ZVSB 1S59A 4RL1A 4OL8A 3W7BA 3VVUA 1VQOS 2RVJA 4HDGA 3BQ0A 1OQ6A 2VFVA 2KDOA 1SKWA 4L76A 3CJ5A 4YQWA 3LGNA 3CD0A 2KU7A 2AT1B 2DR8A 3GJSB 2E7XA 2DH9A 1OYEA 5F8IA 2QN6B 1O8BA 2DRDA 4X65J 4C8ZA 4FNHA 4LRCA 2BXJA 2V6AA 3NXZA 1RTJA 3A3OB 2YNGB 2OPSA 1S6QB 1PJ6A 2XSFA 1E6YA 2KM8C 3OSNA 3UD5A 4KJIA 3FDSA 3THPA 3I56S 1N48A 2B7CB 2B9XA 1R89A 4OJGA 1TZ0A 3MM7B 4G1PA 1CG2A 4JI0J 4PWUA 3G8TA 3ZXWA 2W2OP 4M5LA 3DNCA 2G13A 2BM0A 2ZHAA 3ENVA 5KT5A 3D0GE 4PUOA 2RF2A 5K8PA 5L38A 3HSZA 3MXHP 2DVIA 5B09A 1SJ1A 4J9KA 1U02A 2HGNA 1HNIA 3OL6A 2DBBA 2LEPA 2HLTA 3LPYA 2LXIA 2LQ8A 4IFYA 2CQ1A 4NA2A 3TVYA 5KG5A 1KQGB 3L3CA 3ZTQA 4I7FA 1D9FA 3CUNA 2F8HA 4DV6F 3FJ2A 3TYTA 1N56A 3I0SA 3H90A 4O3NA 2Y1LB 3QSIA 1I94F 4DPUA 1LWEA 2XI3A 4NA1A 1RT7B 2W9CB 1GX6A 1DQ9A 1F2HA 3C19A 4I2QA 3HHLD 1RADB 3E51A 5C5JA 3BPSP 2ZNYA 2CRLA 1UVJA 2E1MC 1JIHA 2KJWA 2UU9F 1AT1B 4FF3A 2R2TA 3UQSA 2CKWA 2DNYA 2W9BB 4XO0A 4QPXA 3H8YA 1X4EA 1RAOA 5I3UB 2FVCA 2ZH5A 2QL9B 2QX0A 4AD6A 1QUVA 1QD1A 4CO1A 2GQQA 2HHHF 2ZOFA 2ZH6A 4LFBJ 2APOA 2HKEA 2YPYA 4R5PB 4CT9A 9RUBA 3TZXA 3VTIA 3MURP 1D3WA 5AJ3J 3SIPB 1WDTA 5ETKA 1QE1A 4DPWA 1LV5A 2C2MB 1PGZA 3J7YU 3L7PA 4F0HA 1OY6A 2GIFA 3EVWA 3FVYA 2IM0A 2J7UA 1SQGA 1NK4A 1HYSA 3ZZTA 2OD4A 2OHDA 3TAPA 1A6LA 1TVRA 4DSJA 2KRRA 4FVMA 1K47A 2ZOMA 3MGJA 1HQ2A 4YB7A 5DDQC 5E0OA 4UOHA 2BOPA 1RWUA 2AZ1A 3U7JA 2BE7D 1YJTA 4C8OA 3GWCA 4KO0A 5DQIA 1NDCA 2C3MA 5KG4A 1WF0A 2CPXA 3QGIA 3C6TB 4JI6F 1JNZB 1FJ7A 4CM2A 4PWDA 5DM6Q 3RRHA 2DISA 4PR6A 2O3DA 3OFHA 4OYAA 1GXTA 3EPGA 2ALYB 3ZZOA 1C1CA 2PA8D 2F3JA 3D66A 5C42A 4CH1A 1PC4A 4PZVA 1CEZA 4HTJA 4A8KA 1YJUA 2LU2A 3H5XA 3NOCA 1X4HA 4I67A 2CDRB 4DCPB 1NEEA 3HFVA 4LBPA 2XS5A 3ET6A 3OXFA 3JSRA 2OKQA 1KP6A 2JZ5A 3C66A 5D4OA 3OJUA 3PFOA 4O0IA 3PX0A 5IT4A 4WK3A 2A10A 5L1KA 1WG5A 4DU7A 1FO1A 1YJWS 1AUDA 3KLFA 1TL3B 4DSIA 3AXKA 1C4AA 4UTGA 5KFWA 2VD3A 4DMZA 5CCMA 1W25A 3K5OA 5F0WA 5KG3A 1VCTA 3K89A 2LVWA 3CJRA 1AXQA 1U2FA 1CBKA 3LQVA 1S48A 2HIYA 4NLPA 3PW5A 2ZFHA 2HRTA 5HANA 2FDNA 3THTA 5A8WB 3CDUA 4E2FB 4CLTA 1KRPA 3KWMA 3LP1B 2LU1A 2RKIA 2CZVC 3OFEA 1N5YB 1VRQC 3IAM9 2MSTA 4FN5A 1UKUA 2Z30B 1RU2A 1TL7A 1HI8A 4GO5X 3CMQA 3HLUA 4FZVA 1ULRA 2GV1A 1RHUB 1AUSL 3CULA 1A9NB 4KB7A 2XMKA 2E5LJ 4QU7A 3GQCA 1MWZA 3W62A 1TV6A 4G1IA 1HWLA 1FK9B 1U2RA 2HGMA 2OPRA 4PWWA 2DHSA 1RZMA 3FKBA 3SXLA 4DL5A 3KK1A 4R8UA 3LAKA 4HHJA 4NI2A 4FYWB 3KJVB 5CD4H 1JLFA 1X4AA 2UXCF 1DFDA 4LFCF 2OSRA 2W2PP 1S49A 1FKOA 2OEMA 1RU1A 2I9SA 1YKWA 1TAUA 2MZJA 2LMIA 4DV1F 5G4DA 4DUYJ 4IYQA 4QWEA 2XS2A 2EI5A 1FRKA 4CH0S 4C48A 3TAQA 1JLCB 1H0HB 1S9EB 6FDRA 5E3PA 1OQ3A 3IS9A 4TXSA 3BGLA 3OTOJ 1SPBP 1BQNB 3TUIC 4PG8A 1QSYA 4WFAQ 1QJHA 3AB4B 1Q4RA 3RR8A 4I64A 1WC6A 3KJNB 3OL7A 1Y5LB 1RB0A 4OZ2A 1DLOA 4OX7A 1ZETA 1JLGA 1M5HA 3W9HA 3O6QA 3H0PA 3IGVA 1JNRB 2MLZA 3CVKA 2PIIA 1WKJA 4H54A 2R2RA 1O6XA 2YKNA 2WTFA 2RT3A 3SBMA 5ETLA 3UO0A 5HP1B 3MAAB 1RBLA 1JK9B 4KFBA 5HLFB 3BSAA 4A48A 2FJEB 4F2RA 1MW7A 1R43A 5KT6A 5F3TA 2UXBJ 3MMBA 3G6YA 3Q86A 2VFTA 2CPHA 3GMGA 2MHEA 1U1RA 1J2VA 2B6AB 4LSZB 4NLOA 4HR2A 3A8IA 2QO3A 2EBGA 5H9EJ 4EYIB 1IKXA 3V5RA 3S1TA 4C7QA 3M8YA 1ZYQA 2XZTB 1PJ7A 3LP2B 2J7KA 2MKIA 4A47A 1SC3B 1U8WA 4JI8F 3G6VA 2COLA 3KLGA 2BVZA 2CJKA 4IO9Q 4E98A 3EXYA 3C8YA 5HMYA 2ZNZA 1C0UA 1WORA 4ECRA 3UDEA 2HURA 3CCZA 1CULB 3N6LA 4TLQA 4PG6A 4DU8A 4OV6A 3RB6A 1CS4B 3SEOA 1I1GA 4OYBA 4J5OA 3T5HA 4CIOA 2ALZA 4X64F 5CH7B 4ITSA 2KRBA 4OYPA 3JQJA 1J27A 2CQ4A 2J9CA 3G4SS 3QRPA 4CLKA 2WB1D 4ZVHA 5AE2A 3BJYA 3FQKA 3IRXB 5HI7A 2ZBCA 2EW9A 4O3OA 3N01A 5KOWA 2VG6A 2QLWA 4O3RA 2VQEF 3CCMS 3PY8A 2AW0A 4NLXA 4QR2A 4Y3CA 2K3IA 1YITS 3K5PA 2HRYA 3ICLA 4UQTA 2LA4A 5E3AA 3NNHA 4TU9A 2AJQA 3MPYA 5KG1A 1HBUB 1PYSB 2LLZA 4LR7A 1TL4A 2B5JB 3IWNC 2MQQA 4XDCA 1YK9A 4ZKAA 2RNEA 4OHXA 3W2VB 3D6MB 2D1CA 1IN0A 4FDFA 5THWA 1Z2ZA 4KBIA 3U27A 3DFEA 2YNHB 3PIOQ 1UEVA 4NX9A 3M30A 1YJVA 1RAGB 4GVBA 3GZ7A 2V50A 4KHMA 2Q66A 3ITHA 3V81A 3I4HX 2LQJA 1FRLA 1TK0A 1VDHA 3IG1B 2UUCJ 3AXMA 3UDCA 4GKJJ 2JLEA 2QT7A 9ATCB 5IT0A 4ED5A 2HNZA 5EGYA 3SCIE 2KN4A 4ILRA 3QLHB 3IFEA 2G1HA 4DR7J 5HJYA 1EKRA 2Z8QA 4DV5J 2V5HG 1XJWB 4OYMA 5HSPA 2K1RA 2OPPB 4ZK7M 1T9YA 5B0DA 2GHWA 4QOTA 2WAQD 2E5GA 3HDSA 1J5OA 1M5SA 2R8GA 4EFAC 4M5IA 1KSPA 1QAJA 1MLAA 4N7TA 4HHHA 1HARA 3WBZA 4LF9F 2H5EA 2GA7A 2RDIA 4X4RA 1RT2A 3KK3B 2QFJA 1SJRA 1U6BA 1HL6A 2QMUB 1HBMB 1R8BA 1P8GA 2BKOA 3H5SA 1SUQB 2XMAA 5F8NA 3C16B 5CABA 2HYIB 2FVSA 4UOCA 3MM5A 1X9WA 1PBAA 3NEKA 2PFDA 2IVYA 2FJWA 1TKXA 3VAHA 1Y11A 1EJ7L 2BW7A 4FBTA 5L1JA 2JFKA 3MCMA 2LCWA 4F4AA 1ZH5A 2C2EA 2V2QA 4ZVEA 2HAFA 1RI7A 4DR4J 4RW8A 1WI6A 2EBEA 2P6TA 3C6UA 1UA0A 1WF2A 3MOZA 4G3IA 2OLWA 3UNGC 1KQSR 4X4TA 2FJXA 2DYAA 2FUG9 4UOGA 1UEUA 2GVZB 3QJLA 1BMQB 1MMDA 4G1QA 3RU0A 4URQU 2W2MP 3TJ8A 2B51A 4I69A 1WKLA 4OLOA 3ILLA 2CYYA 4DHVA 2DHAA 4C3LA 1XNQJ 1NHVA 4C0BA 1Y5IB 2E66A 2R7XA 1HW8A 5CYMB 2BR0A 4TLRA 3Q23A 4LBIA 4FS2A 3QZ7A 4P75A 4RNHA 2YBVA 4JI2J 5LMUJ 4A8WA 4L3KA 4XAKA 3CCTA 1H3DA 4ZLLA 4DWIA 4Q0BB 3TEHB 2XO6A 5D78A 3DLEA 2CQ3A 4C8YA 1WC4A 3BBCA 5IM0B 2W4DA 3ZNUA 1Y3KA 3J7ZT 1HBOA 2ZUAA 4C8KA 4B3MF 5B0AA 1T0TV 3MMJA 2HVDA 3VQSA 3EZ5A 2DHXA 1UVMA 1KLNA 1WEZA 4O4GA 4AQYJ 1RT5B 5D15A 4Q44A 1ICEB 2HVEA 5T7LB 3TANA 1IQTA 1AZSB 4NEYA 3LWMA 2LXUA 1VS3A 1SC1B 3Q8YA 3KUGA 2GJ2A 2HS0A 2R7WA 4J9MA 2GMLA 2H3EB 4ES1A 4ZCIA 4J90A 3SI8A 4KGVB 2C3OA 1LFWA 1DRZA 4I6YA 5KT2A 1WG1A 1TL1A 1RYRA 3OR2B 4ZLPA 1S1XA 4LRDA 2HVHA 5CYQB 4F04B 1TL5A 4K5RA 1HBNA 2ZWOA 1G3OA 2DGVA 4QWDA 4H4OB 2VDHA 3RAMA 1IKVB 4WE1B 2U1AA 1F0XA 4DX5A 2M8HA 2BYCA 1CJKB 3TQ1A 2OPQB 2F9JA 4RBUA 3I5AA 4OZ5A 4ECQA 4TVAB 4O23A 1FRHA 1W2IA 1R8PA 2YKMA 2YH0A 3TUJC 5EX0A 3HZEA 2ZVIA 2IBKA 3N5FA 2G1DA 1MN9A 5K14A 4HI1A 3CO9A 4N8OA 3SDEA 4OX6A 4CLUA 2Y8WA 4HKQA 2D9PA 4CNYA 3HKZD 2MMYA 2H54B 3W66A 3QT7A 3E01B 3CJQA 1NK9A 4PXEA 4KYZA 2HNYB 4LBHA 1NCLA 1NHUA 2MB0B 4N77A 2UUTA 3AD7C 4DSEA 3V4IB 3MCOA 1RXOB 5E3CA 2Z57B 3NBPB 2MKJA 1S9GA 4I1TA 5LSOA 1NDLA 5K20B 4KPYA 3CD6S 3HT0A 1U47A 2FVPA 2QL5B 5D0RA 2MLYA 3M6UA 1M0SA 1IKWB 4ECTA 4F2SA 3SFGA 4NE9C 3UVJA 2HFVA 1H72C 1FNMA 5D4PA 3JB9k 3FMBA 2KYZA 3R8YA 3MD3A 2BABA 3ETMA 4YN3B 3TA2A 3I9V9 2H9ZA 2DY1A 5HAOA 4WXOA 4F50A 3IM8A 4K4ZA 1YZ7A 3WIVA 3VCDA 3A12A 1GAOA 4OZNA 1FRXA 2IHR1 5M2UA 1U1MA 3CJ2A 3KG4A 1YI2S 3GIMA 1N32F 2DPIA 4URGA 4OHVA 1LEOA 3UE2A 1EKSA 2V4QA 3ILJA 1LW2A 3DI6B 3E2EA 3SYZA 3PIPQ 1PCAA 2JVOA 1S1TA 1L5UA 2QMWA 1BXNA 2BJ9A 3GSIA 1CJVB 3CSKA 2Q1LA 4LSLA 4CYUB 1KNZA 3BSOA 2AJFE 1HQUA 3I0RB 3DLGA 4GO7X 2HW3A 1HNWJ 2HBZB 2UVRA 1RISA 3TEGA 3M8ZA 3MTJA 4DCJB 1S7HA 2JL9A 2MQNA 5FDLA 2VOPA 3NGKA 2YKOA 3BO2A 3UCZP 3CJ8A 5KFXA 4TU7A 1HPZA 1D09B 3UPFA 4RW9A 4LF4F 1XNRJ 3P49B 4RNFA 4QR1A 2I1RA 4LR9A 3AH6A 4WYWA 3P6YC 2HS4A 4M5DB 2K8GA 4RWWA 2Q79A 3M2VB 3OTDA 4NCAA 2CPJA 3BREA 2C28A 1FXRA 1KEKA 5K5MA 3KNAA 1RTDA 1GMWD 2BKNA 4NRUA 2RD5C 2VA2A 1T9WA 3LP0A 2B4VA 5BXIA 4B3TF 1OPZA 5K9FA 2D3UA 2UUAF 3HFZB 2OEKA 3CTRA 1RT1A 3PVXA 2PMWA 3NY0A 3FRZA 2IM1A 1GTHA 2GHVC 2DCUB 4WP3A 3P5TL 2OPSB 1YJ9S 3D4JA 3MEDA 3HHEA 1E6YB 1HR0F 3W3SA 4Y6IA 1GMVA 3TVKA 3HT3A 4X4SA 3ZZ0A 1U2CA 4C98A 5KFUA 3P4UB 5HVGA 1S7IA 1IWAA 5BR8F 1N36F 2PD1A 1TKZA 3ISZA 3N4WA 3JSMB 1KLMA 2HHQA 4HDHA 4DBQA 4J9RA 3CCJS 2RF2B 5C24B 3TWZA 2F4VF 1N8RT 1G7CB 3UCUP 1IKYB 3M6VA 1ZTTA 2QL7B 1RP5A 2VB6A 1PG5B 1VMBA 2G4BA 1S76D 4Y2MA 3PJ9A 1V5VA 3LUYA 2G0IA 1BQXA 1FWLA 4EO8A 4DV6J 2QG9B 1KFSA 4K5SA 2LA6A 3HPOA 4ZPTR 1JKHB 1I94J 2AIRB 2HBRB 2MZTA 3I0SB 1URNA 2M4MA 5KFFA 1LWEB 1ZAXA 2KH9A 1X0PA 4OI3A 1UP1A 2VKRA 3CC4S 2E5IA 2MKHA 2HRUA 1NNDA 1SCJB 3CNQP 1HWKA 2UU9J 3BB5A 1LWFA 2XQCA 3BEGB 2QA4S 3CT9A 5C7PA 3C46A 4KH1B 1B70B 2EFQA 2BE2B 1B7YB 2ASYA 1UWAA 4URSA 4P9SA 2PO4A 4KRWA 5DQHA 2EG1A 2Y0SD 5CAAA 1NSPA 2VONA 1LKZA 2VG5B 2KJVA 2CA9A 1RWMB 1QLNA 4X66F 2J6TA 4UF4A 4KPCA 2HHPA 3TOQA 2HVIA 4GMKA 2HG4A 3R5JB 1RWNB 1WI8A 1LXNA 4BHQA 2ZD1A 4F0MA 1HI0P 2KI2A 4Q2LA 4Q2MA 4X62F 1QE1B 1MU2A 4CLYA 5H1SV 4DOZA 1WG4A 4UZCA 1K1SA 3PKMA 2ZKTA 4B9NA 1ZZFA 2A6OA 4U7CA 3U1LA 1TVRB 3J81Y 1Q5VA 2EKNA 5D0GA 2FJBB 3IP0A 2RDDA 4KE5A 3FEXB 1XIQA 5HO4A 4RLEA 3D0HE 2HWIA 2XCPA 4DX8H 3ZTOA 4C3MA 3PRDA 4F3QA 3TQEA 4UOFA 5KFDA 5A8KA 1MN7A 4KO0B 1VQMS 5GMEA 1FX2A 1N52B 3NCPA 4JI6J 1XMQF 4MKBA 3KK2B 2DT9A 5KFNA 2DGOA 4GC7A 2LXFA 1AB8A 2POKA 2HNDA 3PDNA 4MIBA 1S4FA 5DZ7A 2F63A 1FFWB 1DAXA 3LAMA 2DNMA 1RKIA 4DEZA 2CPIA 2CJBA 1ZBTA 1ZM3A 3CXCR 3JSBA 5C42B 3KHGA 1WNEA 1Q8LA 2JDJA 4ZVOB 2GAHC 2OD6A 2X1BA 4TY9A 4ECUA 1S1UA 4NLYA 2V2KA 3G86A 4AXJA 1G2EA 2W7OA 2P6SA 3R7SB 3T5LA 4DFJA 2QIFA 2ZHOA 3MR3A 2Y1RI 1RTIA 3CD7A 2EEYA 2RS2A 2UP1A 1LWCB 2GHPA 4C4WA 3QIPA 3KLFB 2PEHA 3EMTA 2K7JA 2ASJA 1HNZF 3HHLC 5IWAF 2DO0A 4WFBQ 3KJFB 3WDOA 1LWXA 4DLEA 3RB0A 1HA1A 4J9PA 2VPYB 5J1EA 2E1RA 2EVZA 2RSQA 4UT4A 1GX5A 4NLWA 1N0VC 4BS2A 2ZH2A 4DN0A 4I2PA 4CI0B 3OUYB 5EUHA 3A1YG 2GFFA 3BV8A 4ZVFA 4A46A 1YLXA 4TY8A 2CFXA 4WJBA 4X4QA 2FZCB 3TVZA 1NXIA 1VQSA 1Y0HA 4C6AA 4CQ1A 2V9WA 4RW4B 4C8LA 1R0BG 2CPFA 4K4UA 5AXLA 1M90T 1CJUA 1VI7A 2VUGA 2EFNA 2GO9A 2R8KA 2IC3B 3HMJG 1Q0NA 2ZC3A 4OJ1A 4WXWA 4DR5F 2FB0A 4WFNQ 1RT4B 3SFUA 2WW8A 5JXSA 2FY8A 3TJAA 4DF4A 2FD2A 3M8QA 1OIAA 2QEXS 3SV4A 2E1PA 2DNHA 3KK1B 4R8UB 2OJ3A 4P2MA 1KTVA 4MK8A 4USJC 1GXUA 1HQEA 3NMRA 2Z56B 2J76E 2PE8A 1KBRA 3IMQJ 2FJDB 2LEAA 1JLFB 2UXCJ 3AD9C 3HHLA 3RB4A 4LFCJ 3CMAS 4QCLA 1X8DA 4WIQA 2WONB 3NG8A 4EBCA 2Q43A 3E8OA 4CT8A 3HHDA 4DV1J 3PJXA 4AFFA 1HWIA 1VHIA 1KOOA 2R42A 2ZE2B 3ILIA 4LRFA 3GJRB 5LL6d 1HNXJ 1F3VA 1SB6A 3L4BC 2PMHA 1H74A 2BDPA 2D3OR 2W4PA 2KTQA 4PQUA 1UMJA 1RHRB 4MFBB 2PT0A 4CH7A 2UXDF 3TUPA 1W2BR 1HKAA 2DITA 4LVOP 2M8DB 1P9YA 4OHWA 3FFIB 4F4ZA 3HVTB 3T1HF 1D0EA 3BSCA 2J5AA 4ED0A 1U25A 2GC8A 2PA3A 1RWOB 2KFNA 5EX3A 3DYAA 4KC5A 1NU4A 4RBTA 5KFTA 4O4RA 2YY3A 3VHQA 3HX9A 2HWHA 2J8SA 1VQ5S 3OHBA 1B0VA 5J2PA 2R8IA 3BBFA 1LQ9A 3U02A 3M2RA 4JV5F 4ZJQA 5AXKA 2V67A 1TFYA 1RTHB 4PPDA 2WBMA 3TZZA 3ELHA 1OMSA 4DXLA 4MH8A 3CIMA 4CLLA 3MECA 3MM6B 2LKZA 2F40A 3MMCB 2KHDA 4ED8A 2QMXA 2RB7A 3FSYA 1K9MT 1WC5A 3G2XA 5GVQA 2GGPA 4N8NA 3BN4A 4CDIA 1JLEA 2DGSA 1SL0A 1DARA 1RA7A 3NGRA 2W9AA 5CA5A 3QT8A 2DNOA 3DM2B 2MZRA 4CLWA 3KG0A 1C0UB 2HIQA 5BYRA 3DRPA 2YNIA 3X3UA 3O44A 3EX7B 1FKAF 2R8HA 4USMA 4KH0B 2ZBQA 1HI1A 2V0NA 4USWA 3PR5B 3MDFA 3N28A 1M1HA 4JV0A 1QTNB 4FXDA 3JTNA 3W5ZA 4X64J 4H4KA 1HNVB 2KXFA 2NZCA 1FX4A 2XGPA 3A8KA 1NJIT 4P74A 2RRBA 3OL8A 4X4VA 1IM6A 3HF5A 3RW6A 4K4TA 5BJRA 3SSRA 3PYGA 1N34J 1VFJA 4XK8C 2ILYA 1EETB 2E9RX 3NCQA 2Z2ZA 1U48A 4LJMA 3W2WA 2CDQA 4KGXB 1UZHA 1PC5A 1TKTB 3SCJE 1Q1KA 1S1VB 1V9OA 3Q0AA 2AU0A 4O3PA 4A8QA 2DO4A 2CQPA 2J8AA 3D9BA 8AT1B 4DL4A 5AT1B 5D8HB 4H4MB 5LT5A 2DHGA 3V6DB 1UEKA 3KFWX 2K2PA 4USTA 2MSSA 1Z1ZA 3K58A 2HAIA 3VWSA 3SQGA 3M30B 3EE3A 3JTOA 4J9LA 4ZLNA 4CWBA 3IO1A 3RTVA 3MPUB 1T9XA 1FXLA 3BF4A 5A8RA 3HZGA 4MIWA 1TU0B 1CPZA 3MMAA 2DGXA 1TELA 4B3SF 2HNZB 2CUYA 3HM9A 2I5JB 3KXDA 4QYZK 1SVDA 2MY8A 2QA4G 2N3LA 1VBXA 4K2JA 2J9EA 1VHFA 4FBUA 1VRTA 4FF1A 3P8BB 1U7LA 5C2CA 3M6WA 3G8QA 2RU3A 4RW7A 3M1VA 4FYVB 4ILMA 2M9KA 1SH3A 2DY9A 3WHIA 2FHKA 3H98A 2Y8YA 4FVCA 4NLQA 2KB2A 5ETRA 3AHPA 4IH6A 1XQIA 3DXBA 1KQKA 4LF9J 2RQCA 1MWYA 2AD9A 3OPKA 2AP6A 1RT2B 3GYGA 2OELA 3W5YA 3ETOA 3GFXA 3MEEA 1HD0A 3GP9A 1X9SA 2F4FA 3QT6A 1FHTA 3QPIA 2FHMA 1JLBB 3BQ2A 4ENOA 1NZAA 3MUMP 2I2YA 2E7WA 3T6JA 3VVTA 2MJUA 3EZOA 1WUUA 2XYPB 1X0FA 2BANB 2VG7B 1R3NA 4PRFA 3BO3A 4ZVQB 3D67A 3QFWA 4DX6A 2V8HA 3D7SB 1NKEA 1H7XA 2HBYB 4B02A 2QYCA 3NLCA 1WF1A 3ZTRA 4DR2F 3WIUA 3OL9A 3C6UB 2EG2A 3M32A 4X4PA 2ADCA 3EDQB 3BR9A 1B7FA 4OFZA 4C2MA 4BBYA 4ECWA 5MLCV 4QWAA 2JC1A 4G1QB 1R0CB 2DCLA 3I31A 4DV4F 1REVB 2CNNB 3DRSB 4QR0A 5D4NA 1U6ZA 2OTLS 3J81U 1PILA 4KIAA 3T5KA 4GKKF 1R6VA 2C1EB 5KFKA 4B3OB 1N88A 3I6PA 1RT6A 2R7VA 2UV8A 4NLRA 1U6FA 3KLEB 2VFRA 4KAIA 1O0PA 3W61A 6FD1A 3OFFA 2WOMB 4HEA9 2R7OA 4ZP8A 3BYPA 4Y65A 3CIZA 2NSCA 5CZXA 2FLPA 3CDBA 5DETA 3BKFA 2XSJB 1OPIA 3A4TA 1QAYA 4ELTA 3QRRA 4IOAQ 5F0UA 2XMMA 3HHNB 1RHKB 2AEFA 2PDAA 2UVUA 2I0XA 1KQFB 4B3MJ 3U1NA 1P1TA 2CADA 3LPEA 2Z0GA 2KXNB 4QPTA 1H38A 2NS1B 4ZPAA 1DJ0A 3MM7A 4NZ7A 4N76A 3DOKB 5GADI 2U2FA 4O4GB 5GAGI 4JI0F 2YQ1A 3G8SA 4HH0A 2AX1A 2F5GA 2AJ1A 1VK8A 3QO9B 4UW2A 2ASDA 2BJ3A 2XBPA 4ES2A 4X2BA 1U8SA 1UA1A 4U67Q 1FI4A 4JI4F 3MR2A 2D3O1 1WJ9A 4Y00A 2DNLA 4EYHB 2F9DA 4V19J 1RCXB 2V2ZA 1RSCA 3IC1A 3VAGA 2AMCB 2V34A 3TA0A 2EFVA 1BGXT 1M5VC 3KHLA 4RWXA 3THVA 1LOUA 4U7UK 3VQTA 2O67A 4CZCA 2FTRA 2ROGA 4LF5F 3FZBA 1JLQA 4N56A 2DNGA 1HBNB 2DNPA 1IQZA 3VGUA 4ZJLA 2X3GA 2W7PA 3S01A 3MPVA 2DIVA 3MUVP 3FSIA 2W9BA 3FMWA 4DQPA 4IR1A 3IR7B 1U4BA 3BGRA 2RQ4A 1CJTB 4I4BA 5HK4A 5I3UA 4KGKA 4W98A 3A3PB 1HLWA 1RKJA 4ECXA 4R5PA 2CQ0A 1ZA1B 1FRMA 1SL1A 4DPTA 2V4JA 1GNKA 2VL1A 2DEIA 1NAQA 3Q8SB 1T02A 2O1PA 2VZ9A 2GVDA 2XULA 2DPJA 3CCSS 1IBCB 3TAMA 1X7VA 3BM7A 1N5QA 1H2VZ 3BDPA 3C14B 3A13A 3SCKE 5HN0A 1VC6A 5ETOA 4ED3A 2QJ3A 1S9GB 3UN3A 4EK2A 4K4XA 4XDDA 4PYDA 2AHOB 3K8WA 3RYLA 4YB6A 4JB8B 1XR7A 1OYDA 4DG1B 2AKWB 3RBEA 1EB0A 2CQCA 2D69A 2AGOA 2WW4A 2ZH1A 2NXUA 1K8AT 1KR4A 4ZS6A 1NZ8A 1I51B 1QAIA 4F3MA 2JWNA 5IT9Y 3AQOA 3T6BA 1CQNA 3JQKA 2IDLA 2VC0A 1FESA 5B0EA 4OZ0A 1T9VA 4DV7F 1IBLF 2HQFA 2G2YA 1XEZA 2C3YA 2YKQA 1R7IA 1N32J 2HVZA 3MM9A 5GAHI 3R7BB 4PPZA 2HZVA 3T5JA 3AQPA 1HWUA 1LW2B 2DNZA 4AYBD 1U0SA 2HWTA 5I3PA 4F26A 3LH2S 4UZBA 2B4PA 4FKYA 3D54A 3UCGA 3RAQA 1VBYA 1C2PA 3BZQA 1BUXA 1TMMA 5F9LA 3NS6A 3PNIA 1XMBA 1FWPA
chains in the Genus database with same CATH topology
4ZCIA 3SI8A 2JX2A 4Z2XA 2C3OA 1HBMA 1LFWA 3DRRB 2IMWP 4D3HA 2MY7A 1DRZA 4I6YA 2GQCA 2YQ3A 5KT2A 4ICLA 3GIKA 3HHLB 1SUQA 1WG1A 2KVIA 1TL1A 1MSWD 1RYRA 3RW7A 2R7QA 3DLGB 4NLTA 3OR2B 1MROA 1S1XA 3DOMA 3DCAA 4ZLPA 1KD1T 2HVHA 2ABYA 5CYQB 1R31A 3CCRS 2ACYA 3ENWA 4IFVA 3GV7B 4ZDNA 2CPZA 1TL5A 4LUBA 3D2WA 1Q79A 4EBEA 4K5RA 2RQMA 4MTPA 3FRYA 4F4WA 1HBNA 5M2PA 1G3OA 4A8SA 1VQ7S 2DGVA 4QWDA 4H4OB 1H7WA 3RAMA 4DSKA 2VA3A 1SIWB 1IKVB 1L3UA 1RTHA 1Y00A 2CZ4A 3EUNA 1QY7A 2U1AA 3BGUA 4WE1B 4FF4A 1F0XA 1FXDA 3DOLB 4PWDB 1Z4UA 2M8HA 1VQPS 2BYCA 4LQ9A 2ZJQQ 4QZVB 1U1QA 3VAMA 4R25A 3TQ1A 1D8YA 3QYYA 2KZMA 2OPQB 2F9JA 2OMOA 5K8OA 3KKFA 4M1KA 4AL7A 3K59A 1D9DA 3MM6A 3K7RA 4RBUA 4DR4F 1S72S 3OR1A 1UVNA 2WBRA 4ECSA 1DURA 1S1WB 2CJ9A 4OIXA 5KFBA 3MMCA 4Y2KA 1KS2A 3I5AA 1VQNS 3CDWA 4OZ5A 4ECQA 1O51A 1C1CB 3UW1A 3LGMA 4O23A 1C4CA 1FRHA 4PQUB 1W2IA 4HT5A 1R8PA 5A8WA 2YKMA 2WSFC 4Y2CA 1S0MA 3E3XA 4U9RA 4QWCA 2ILZA 4RW6A 2YH0A 2EK6A 3GG1A 3TUJC 3BSNA 2RMLA 4Q8FA 1N5YA 3H5UA 4RUHA 3CC2S 1NKBA 1P1LA 5EX0A 2JLGA 3HZEA 5FD1A 2IBKA 3N5FA 4UUXA 5KFEA 2G1DA 5EWFA 3M8PA 5K14A 1RTDB 2QA1A 4ID5A 4OHYA 4HI1A 3Q22A 4DV2F 4ED7A 3CO9A 3TA1A 4QW9A 1FCAA 1NK6A 4N8OA 3SDEA 4KR0B 4OX6A 4HKQA 1AROP 2A2CA 4RUCA 3DM2A 2D9PA 2ZUGA 3J80Y 3POTA 4O44A 3I82A 4CNYA 2VQFF 3HKZD 2M2BA 2MMYA 1VQ9S 2Z2MA 1XR6A 4DL7A 5J1NA 3T19A 3GFYA 2A3JA 2E5LF 3DYAB 1RT1B 1VK3A 3E01B 4QU6A 1EP4B 5B0CA 2FJVA 1NK9A 4PXEA 1HWJA 2HNYB 1U1LA 2NQPA 1NHUA 4IG3B 2MB0B 4N77A 2UUTA 2P5VA 4DSEA 3V4IB 5DO2A 2M3DA 5KFIA 3F73A 4NOHA 2IMOA 3S7RA 4AL5A 4DUZF 5E3CA 3NBPB 3WC2A 2MKJA 5DDOC 3KMQA 1S9GA 4RNMA 5CCLA 5KFYA 4BWJA 3CCVS 4I1TA 5LMUF 5LSOA 2ZJPQ 2XLKA 1AFJA 3OQ2A 3GILA 3NNAA 1SC6A 5J2PB 2A2DA 2KO1A 1HNVA 4NLVA 4RU2A 3ULHA 1MMLA 1FJGF 3M2RB 4BCAA 4KPYA 3CD6S 3KJVA 4B9UA 3UD4P 4WKYA 5AE3A 1U47A 5ADZA 2FVPA 2CQ2A 4ELUA 1TAQA 3CDEA 3NGDA 4LF7F 1S9FA 3OVSA 2WSEC 3AA9A 1L3SA 2AYEA 3T9ZA 4FYDA 2N7YA 3EGWB 4B08A 3M6UA 1M0SA 1IKWB 5F8MA 3JYTA 4MJKA 1EETA 2F1FA 3S6EA 4ECTA 1N34F 4J9OA 4F2SA 2RQKA 3G96A 3SFGA 1D8ZA 2LQ5A 2XZWA 3HFKA 3MECB 3KHRA 1FNMA 4C0OC 3PACA 4KV8B 4HTIA 4MMOA 5D4PA 4L6V3 4ZPCA 2L41A 1FE4A 1GT8A 3JB9k 1ZPWX 3FMBA 4WU3A 2KYZA 4ETXA 3QGHA 2MQOA 5KTQA 3SV3A 5IQQA 3MD3A 2R2UA 1TKTA 2BABA 2R4FA 3B82A 5H9FJ 1FVQA 5J2QB 3RAXA 1SH0A 1X5SA 5DM7Q 3QAUA 4IH5A 3TA2A 3CC7S 3I9V9 3LO3A 3HO1A 2RKIB 2H9ZA 5A0YA 1S1VA 2GGPB 2XLIA 4WXOA 2M88A 2IVFB 4F50A 4QYZJ 5KOXA 3F44A 3MFHA 4K4ZA 1T3OA 3VCDA 2IYGA 2DNNA 1GAOA 4OZNA 2EPIA 1Y5NB 1ZOTA 5AXNA 3H2VE 1LXJA 5KAKA 1UL3A 5IXUA 2YNFA 2XMJA 1S9EA 1VQ4S 1FRXA 2IHR1 1E6VB 5M2UA 1U1MA 3KLHA 1BQNA 1R6YA 4N47A 2EFPA 2C2DA 2KZZA 4U6PA 2FIUA 1RT5A 1VQLS 2WSCC 4H4MA 3CJ2A 3CMES 3KG4A 3QWPA 4C3KA 2ZH7A 1YI2S 3V6DA 1BY9A 1RA6A 3GIMA 1RYSA 1N32F 3R5BA 4LSNA 3LANA 3CJKB 2VPXB 1T03A 2DPIA 4Z37A 2YWGA 1FDNA 4QW8A 1UWBB 4URGA 4JI1F 1TV6B 1CC8A 3DRPB 4OHVA 1D9AA 4WK1A 3UE2A 2V4QA 2D3ZA 1LW2A 2IM2A 3DI6B 3E2EA 4EEYA 2AX0A 4X84A 3SYZA 1XERA 3RZAA 3NRBA 3PIPQ 2JVRA 4DR1F 4B9TA 2RH3A 5LXYA 2OPRB 4IG0A 3IWXA 5HMZA 5A6PA 3DHWC 4ZCKA 2JVOA 1S1TA 1L5UA 2QMWA 5CQGA 3K8VA 3VZIA 2AF6A 3I5BA 3CSKA 1S0NA 2EFGA 2B56A 3MI7X 4ED1A 2C3PA 2Q1LA 4LSLA 3UI3A 1FTRA 3KLIB 3O8WA 3M8SA 5DGAA 1S99A 2EFOA 2K3KA 3VZHA 2W7AA 3AY0A 3TX8A 1KNZA 2BACA 3BSOA 2AJFE 4DDFA 1RDRA 4RZRA 1HQUA 3EPIA 4YR2A 3I0RB 5B08A 3JAMY 3DC2A 5T14A 4MKYA 3DLGA 4GO7X 4ECYA 2HW3A 1U09A 5CYQA 2I5JA 5DRKA 1WTBA 4Q5VA 2UVRA 4MK9A 1RISA 3VALA 2O5DA 3MTJA 3ZFVA 5B0BA 4YB1P 1S7HA 1FKOB 2JL9A 5D77A 2GMJA 2MQNA 5FDLA 1S6PB 1SBRA 3W2WB 5JVHQ 2VOPA 3NGKA 1LK5A 2YKOA 3BO2A 2OAUA 3UCZP 1IKVA 1H2TZ 5KFXA 4TU7A 1HPZA 3UPFA 1FEEA 4WE1A 4KKOA 2ZH8A 3PRBA 4NCGA 2ZD1B 5AE1A 4RW9A 4A8OA 4LF4F 2Y1JA 3IAS9 2D74B 1F9FA 3O2IA 4ZPBA 3P49B 5HBMB 4RNFA 1JLAB 4QR1A 2OPQA 3HVWA 2I1RA 1Q81T 4YOEA 2HHTA 2G0CA 2VASA 3AH6A 2Q3PA 5J2NB 4WYWA 3MHYA 2WRMA 4CTAB 4OX8A 2AGQA 3P6YC 2AQ4A 1UJ4A 2HS4A 2N4CA 3IS9B 3LP2A 4USHA 7FDRA 1WD6A 2L9WA 1URRA 2WCXA 4M5DB 2K8GA 4RNOA 3H40A 4Q8EA 2YX7A 1NK5A 4RWWA 2MKKA 1DTTB 2Q79A 3M2VB 4HYKA 3OTDA 4NCAA 1IXKA 1HW9A 2CPJA 2HHUA 3BREA 2C28A 3TP2A 5M2RA 1FXRA 4PQAA 4FS1A 2MZQA 1ZPVA 4WIIA 1K0VA 1VQKS 1KEKA 1Y4ZB 2MHNA 5K5MA 3UR0A 1FF2A 3CPWR 3KNAA 1UJ6A 1RTDA 4NRUA 5I42B 4ECVA 3IXQA 3CJ3A 4NPOA 2RD5C 3OBIA 4JOUA 3SQGB 2VA2A 2OTJS 1DLOB 3M2UB 3LP0A 1JLGB 4EGLA 2B4VA 2UVWA 4IKAA 1HMVB 3PW7A 3R1LA 4DL3A 1WWHA 4B3TF 1JLBA 1SKRA 1OPZA 4GC6A 1N0UA 2D3UA 4HLBA 5K9FA 2UUAF 2ROPA 3DU6A 2KT2A 5EWGA 2XMWA 4R0JA 2YKNB 3GB0A 3VR1A 5A8KB 3CTRA 1RT1A 4A4JA 3E01A 3PVXA 1OO0B 2NUHA 4YHHF 1DHMA 4OZLA 2NPFA 4OX9F 3FRZA 2BANA 2IM1A 3DRXA 3U1MA 3MMAB 4IUFA 2VG7A 1GTHA 4IG3A 4IO1A 2GHVC 2DCUB 5IFMA 4AL6A 3P5TL 2GIQA 2OPSB 2MKCA 1AW0A 1FEHA 1YJ9S 3MEDA 4KFBB 5FLXY 3HHEA 1E6YB 2QE5A 3NBPA 4I6WA 4ATNA 3T1AA 3PJWA 1WHVA 2ADBA 1HR0F 3W3SA 3OW2R 1U26A 5KFRA 4Y6IA 1LFPA 2NPIA 4IOCQ 1IBMF 2R8JA 2E9TA 3GIJA 2WB4A 1X9MA 3TVKA 3HT3A 3DN9A 4YP3A 3MMBB 1BQMA 4F4KA 2NR0A 4LMZA 4RNNA 3SMZA 4X4SA 1VOMA 4ZP6A 4ZP9A 3ZZ0A 1VQYA 1K1QA 1N5VA 1FJEB 4DR3F 3V6KA 1WEYA 4C98A 2DRAA 4JI5F 2BM1A 5KFUA 2XC9A 3Q8QB 2FLOA 5E2QA 4RW7B 1SL2A 1MMNA 2Z2LA 5BR8F 3O3LA 1YJRA 3HXMA 4LT6A 4P6QA 1S77D 1N36F 1IKWA 5DS7A 2PD1A 5HMXA 1NH8A 3JSYA 3BGFA 4DL2A 1TKZA 3OVAA 3HVAA 3ISZA 1HFEL 1IKXB 2HFOA 3N4WA 3N6NA 1KLMA 3JSMB 3PZPA 2HHQA 4HDHA 4DBQA 4J9RA 4KV8A 1SJQA 5GMKa 1REVA 3DRSA 3CCJS 3MEGB 2RF2B 5C24B 4DJBA 2F4VF 1N8RT 4WTYA 3FCHA 1G7CB 3UCUP 4X4UA 5KFGA 1IKYB 3M6VA 3VAKA 1IBKF 1V3SA 3P3DA 2BBEA 2V8GA 3FEYB 5KFMA 3MF5A 1ZTTA 5J2QA 1FNXH 1RP5A 2VB6A 4B3OA 5T41A 3KTQA 2FVRA 4B3OB 3UFCX 3ISNC 4NYOA 1VMBA 4DF8A 4F8RA 1RT3B 2G4BA 1S76D 2M5YA 2ZBIA 4Y2MA 1IM4A 3KLEA 4TU8A 2LYVA 1YRTA 3LUYA 2J9DE 2J9DA 2WOMA 2B5JA 1BQXA 3KLGB 2GMHA 2YWKA 3OV7A 3PO4A 3EGNA 2EWHA 2HFZA 4EO8A 2E29A 2IM3A 1KFSA 4K5SA 4X4OA 1N5TA 3MWBA 1R27B 5C25B 2LA6A 3MR6A 3W2VA 3HPOA 3D1HA 4ZPTR 1JKHB 4RUAA 2GX8A 1KC8T 2XEXA 3CJKA 2MZTA 3I0SB 4EU0A 4CCHA 2M4MA 1URNA 1UWBA 3GG0A 5KFFA 3HK2A 3PKYA 3I32A 1Z2LA 3QIPB 2HHSA 1FDDA 4M8LA 3GIIA 1LWEB 2BJEA 2CQDA 4ALZA 1ZAXA 2XSJA 3OTEA 3AA8A 1X0PA 3DI6A 3FSXA 5B0GA 2KH9A 4OI3A 1UP1A 4KSEB 4E0DA 2B3TB 2VFSA 2VKRA 3CC4S 1OWXA 4MYTA 4ZHRB 2E5IA 3CCWA 4OHZA 2MKHA 2HRUA 4Q7AA 1NNDA 2MQPA 4W90B 5KFZA 3WZ0A 4J9NA 3L7OA 3GR1A 2KT3A 1JXLA 2R2SA 3DXSX 2PI5A 1TQLA 4RU9A 4M95A 1HWKA 1KVIA 5J1EB 3BB5A 3M6XA 4DQIA 5CYJA 1LWFA 4QIFA 5F8HA 2MYFA 3IG1A 3BEGB 3BR8A 5DQGA 1NK7A 2QA4S 1QUPA 1V3ZA 2UUCF 3CT9A 3KLIA 4YB5A 3PEJA 3C46A 3R3TA 4ETZA 3QAEA 2EFQA 1H6KX 3N79A 4BC9A 2BE2B 4NWBA 2ASYA 1CC7A 1SJ4P 5DLGA 5KG7A 4URSA 2AYMA 2X1AA 4W92B 3NP5A 4A8MP 2PO4A 4KRWA 2VC1A 1FDAA 4FXWA 5DQHA 5K8NA 4UUWA 1VQ6S 3RRKA 2VPZB 4XPEA 2PN6A 4NLDA 2EG1A 2Y0SD 2N82B 3DDNA 3TARA 1HNWF 3QLHA 2YH1A 2VONA 1LKZA 2VG5B 1TK5A 3SSSA 1WHWA 3PM9A 2KJVA 2HLUA 4CO3A 1QLNA 2SXLA 1F5AA 4RBVA 4PXBA 2MDAA 1X4FA 3V2UC 4X66F 2J6TA 2VG6B 4DR7F 4PG4A 3TRGA 5KFOA 1YGYA 2XMTA 4AXIA 1S6PA 1RQ0A 2HHPA 3C2PA 4DPOA 3TOQA 3DOKA 3MM8B 2HVIA 1FD2A 4GMKA 1XBWA 2BUNA 2UZAA 2HG4A 4F4XA 1WI8A 2MGZB 2VOOA 5BYSA 1LXNA 3DMJA 2ZD1A 4P2SA 4BHQA 1HI0P 1FE0A 2DK2A 2IYIA 2MKSA 3V6JA 2KI2A 3QO9A 1U1NA 4Q2LA 3RR7A 5HBMA 3I5CA 3NS5A 1JLAA 3R5DA 1H98A 4Q2MA 1CLFA 2ZH4A 2BQ3A 4MIAA 5KFCA 5J2NA 4X62F 1QE1B 1MU2A 5H1SV 1VBZA 1C0TB 1SI9A 1F5CA 4DOZA 4OI6A 1WG4A 3ZZZA 4R0EA 1JJ4A 1K1SA 2JOQA 2IRXA 3D1OA 4Y0FA 2DD8S 3M9NB 3PKMA 3QWUA 1VIOA 2ZKTA 4B9NA 1ZZFA 3R5AA 7FD1A 3M8QB 3HVRA 4Y2AA 3GYXB 4OI2A 1DTTA 1Q7YT 3M2VA 1KONA 4TQSA 1N5SA 2M70A 3RRGA 4U7CA 2HFNA 1NO8A 5LJ5Y 3U1LA 2JJ4D 1TVRB 4K4WA 2F8EX 2DR9A 4OL8A 5CZVA 3W7BA 3J81Y 3US5A 3PW2A 1VQOS 2AYGA 4B9MA