3EXYA

Crystal structure of the 2[4fe-4s] ferredoxin v13g variant from allochromatium vinosum
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
ALMITDECINCDGCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYERITGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the protein and solvent contributions to the reduction potentials of [4Fe-4S]2+/+ clusters: crystal structures of the Allochromatium vinosum ferredoxin variants C57A and V13G and the homologous Escherichia coli ferredoxin.
pubmed doi rcsb
source organism Allochromatium vinosum
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3exyA00
2Y0SD 1FDBA 1Q16B 5FD1A 4YDDB 3OR1A 1KEKA 3MM7B 1FRIA 4XDCA 1FRKA 1Y4ZB 1B0PA 1FERA 1FF2A 4Y28C 5BYQA 1F2GA 2ZVSA 1JB0C 4AYBD 2PA8D 4XDDA 5CH7B 2C3PA 1RGVA 3MM9A 1SJ1A 2WB1D 1FDNA 5BYRA 3MM5B 2V4JA 3OR2A 4OMFG 1FEHA 1PC4A 1XERA 3MM8B 2IVFB 2FJEB 1FTCA 1SIZA 1Y5IB 2WSCC 5L8RC 4CI0B 2C3YA 6FD1A 2VPWB 3MMBA 2PMZD 2WSEC 1H0HB 1C4CA 1G6BA 1GT8A 1BD6A 2VPZB 1GTHA 3IR5B 1F5BA 3MM6B 1FDAA 4DHVA 2FD2A 4OV1A 1B0VA 2V4JB 3EXYA 3MM7A 3MM5A 3OR2B 2XSJB 2FGOA 4RKUC 3MM9B 1DURA 3MMBB 6FDRA 1C4AA 1BC6A 1FDDA 1R27B 1IR0A 2FJDB 1FRXA 3MMAB 4XK8C 1KQFB 1SIWB 1HFEL 3IR7B 1FRLA 7FD1A 1FXDA 1BWEA 3MM8A 2C3MA 5BYSA 2VKRA 7FDRA 1BQXA 1FRJA 3PNIA 3EUNA 3MMCA 2FJBB 5E7OB 2C3OA 1Y5LB 2FJAB 1G3OA 5CHCB 1FCAA 4ID8A 1H98A 1D3WA 2PDAA 2XSJA 2Z8QA 1B0TA 4KT0C 3MMAA 3OR1B 1PC5A 1VJWA 1GTEA 2VPYB 1GAOA 1JNZB 2GMJA 1H7XA 2V2KA 1H7WA 2WAQD 2FDNA 2VPXB 2C3UA 4L6V3 1CLFA 1IQZA 2O01C 1DFDA 1FRMA 1FD2A 2C42A 1Y5NB 3C8YA 1A6LA 3IR6B 1ROFA 1BLUA 1FRHA 2UZAA 1F5CA 3EGWB 1FXRA 2GMHA 3MMCB 3HKZD 3MM6A 1DAXA 1WTFA 2WSFC 1AXQA 3LW5C 1JNRB 3GYXB 1KQGB 1K0TA
chains in the Genus database with same CATH superfamily
2MEWA 3FZ2A 1RHUB 1ZA1B 3IRXA 1T9UA 2BZ2A 1R8BA 1XTZA 3KNAA 1WD6A 1WHVA 3QSYB 1YTYA 4LSLA 5D15A 4XPCA 3M8SA 2UXBF 3F44A 3MD1A 4IFVB 2XHWA 2GAHC 3HD1A 4NL5A 1U8WA 3GFHA 3OL9A 4X65F 2B8PA 1WF0A 1SC3B 2OJ3A 2XMWA 2VL1A 2ZH8A 1FJ7A 2AZ1A 4DV3J 4X4UA 3MCMA 3NMRA 1U0HB 1TL7A 2IBOA 2X1GA 4R8UB 3OPKA 5A6PA 2BYCA 2WB1D 1S49A 3PDNA 4JV5F 1VLOA 4IG0B 1HYSA 2V8VA 2HNZA 3VZIA 4A4JA 3GLJA 1QY7A 3MEGA 4DG1A 1Y5IB 2F40A 3VVUA 2XB2D 2M70A 4NI2A 3V4IB 2C2RA 1HNWF 1OJ4A 1U24A 2M52A 5K8MA 1S57A 2YNFA 2VPZB 4DX5A 1CG2A 1DBDA 2N3LA 2VG6A 5L38A 2XY7A 4W4MA 3I56S 1TKXA 4X64F 3FUYA 4OV1A 4ECQA 1EQMA 3OR2B 2CNNB 2IPOB 1JLEA 1NSPA 2W2NP 4ED3A 3RZAA 1GX6A 1APSA 4F0MA 1NPPA 1RHJB 1TL7B 1Y0HA 4UUXA 5DLGA 2B9EA 1VBXA 3J80U 2CZ4A 5LMNJ 3R1HA 3B4MA 3UNYA 4OHVA 4B3MF 2FUG9 4USMA 2L08A 4J37A 1F60B 2HFSA 4M63A 3C66A 4DPYA 2XMAA 2JLFA 1HKAA 1JIHA 1GFWB 4RUBA 1DZ5A 1TL3B 3W8PA 2BDPA 2GMLA 4E2FB 4W90B 1FTRA 4RW7A 2V8HA 1UL3A 4CLLA 3UWTA 2OUGA 3NBPA 5KFOA 1JLBB 1O8BA 2VG7A 2K1RA 1HHTP 4YB6A 5FLXU 4CNYA 2AD9A 5BYSA 3MCOA 4ECXA 4LFBF 1URRA 4DZDA 1VQ4S 3W9JA 3BBFA 3PNIA 3EUNA 1RK8A 1UAWA 3PW2A 1TK5A 4JV0A 4DWIA 4JBCA 2WOMB 1WKLA 1WUUA 4J9SA 2AYGA 4V1Ak 2YH1A 1K1QA 2CG4A 3RAMA 4DR1F 4HI1A 4FVMA 2R7XA 2AMCB 1JWWA 1FJCA 4ZVPB 4ED1A 3PHEA 3HX9A 4F4ZA 3RW7A 1ZOTA 2VOOA 1C1CB 5K5MA 1VQ7S 2WVEA 1V3ZA 2ZHOA 1RT5A 4KH0B 4Q44A 3UD3P 1PC5A 1YJTA 2CXEA 2IMOA 1VRQC 2DHSA 2EKNA 4RW6A 4JI3J 3I0SB 2VJVA 3PV8A 4YOEA 2BQUA 1KNZA 3ZZ0A 2G1DA 2DRBA 5IS2A 2DHHA 2MJNA 3GR0A 2MKCA 1UWBB 4QPXA 2NR0A 1KONA 3AY0A 3MECA 4H4MA 2OKQA 1A6LA 1NO8A 2EBEA 2LKZA 4UZBA 1NKBA 4K4VA 5T7LB 1MMDA 2LYVA 2M9KA 3R5DA 4Z37A 2NXJA 2AGOA 2VFUA 3OXGA 3CC7S 1NHKL 1Y11A 3AD7C 3GFZA 2OPPA 2FVSA 4OI6A 2RJZA 1V5VA 5GMDA 2PMHA 3IMQJ 3FBEA 3Q8RB 1PCAA 4WCEQ 1YJVA 2KRRA 1AXQA 1TVRB 2V34A 3VQSA 3GCXP 3B6BA 1TUGB 5B09A 3OHAA 1LQ9A 3PRDA 4J9NA 3WQPA 3PO5A 5LSRA 1B99A 2EPIA 4DV4F 1FHTA 2FLNA 3ZZTA 1RHRB 1Y3KA 1KFSA 2VDIA 3KLIA 2WW8A 3UO0A 4OYOA 2ADBA 3IG1A 4IKAA 2UU9J 2EFPA 2FTRA 2VUGA 2AYEA 2V6AA 3DLKA 3IAS9 3MEEB 4B02A 3A8KA 3HI9A 3THPA 2UXCJ 2M88A 2W7OA 1M5KC 2JL9A 3QRPA 3MTJA 2ZJPQ 2G2ZA 4A8MP 1R3NA 1ZTWA 1HBMB 3GIIA 1RGVA 1YJRA 3MDFA 4P74A 2HHHF 4B3RJ 2CDRB 3IO1A 1UJ4A 1LV5A 2QLFB 2DGTA 4DI6A 4DV0F 4OMFG 2J6UA 2HVDA 2XMVA 2BKOA 2N4DA 2EEYA 4LF1A 2GAGC 3CJQA 1U26A 5KFCA 3OL6A 4DV1F 2QN6B 3T5LA 1NK6A 5ITHA 5D0GA 4RUCA 2EWHA 4I64A 4MK8A 1D9DA 4FF4A 1H0HB 1KS2A 1C4CA 4IO1A 4JP8A 2UXCF 1BD6A 2UV8A 5GADI 4G3IA 2HS4A 4QIVA 3QSIA 2LA4A 1R6YA 3M05A 1IR1A 1IBMJ 1RTDA 1JMTA 5CAAA 2C2NA 1VYAA 5I3UA 2FGOA 3RJMB 4G1QB 2HMIB 5G4DA 5HN0A 4GKJF 3T6BA 4G1PA 3DOKB 1T05B 1FJGJ 1C2PA 1RT4A 2ABYA 4NLDA 2QO3A 3ISND 3T9NA 3CCTA 2RQMA 3KLFA 2VICA 4QWEA 2BOPA 1P9YA 2CPFA 3M2VB 4Q2LA 3OUYA 3DRSB 1IBKJ 1DJ0A 3DMJA 4ETZA 2X3GA 4KRWA 4JOUA 1JLBA 4WTYA 5L1JA 2VQEF 2DR7A 1R0BG 2VFVA 2GW8A 2LDIA 2XWYA 2ZE2B 1NK7A 1JJ4A 1XBWA 5H9FJ 1VRUA 3GQCA 4MMOA 2GS8A 3TZZA 3DM2A 2XZDB 1S97A 1XR7A 1Y10A 4BHQA 5KFHA 4FN5A 2VB6A 4ECVA 1G3OA 1UA0A 1T03A 3BPSP 2CQ2A 4J9KA 5F41A 3CD6S 2ZH2A 2DD8S 1H98A 4C98A 3OVSA 2EC2A 2MDAA 2ALZA 3EICA 2FGCA 2OPRA 3WIUA 4EZ6A 1W2IA 2CJQA 2P9CA 2V2QA 4EZ9A 1HNXF 4FXDA 1TU0B 2ATCB 1AZSB 4KAIA 3KMSA 1EETB 1V9OA 1WDDA 3VAFA 2D7SA 2A6MA 1CULB 4OJ3A 2KXFA 3R2CJ 3U1MA 3CD0A 3N9UC 4NLOA 4XAKA 3CWJA 4CO5A 1WC6A 3ILIA 1H7WA 1A0OB 5KFNA 1S0OA 4LF5F 5E2QA 4F7VA 4OZ2A 2DRAA 5FJ4A 4WP9A 3CCUS 3DM2B 5F3ZA 2L3MA 3BGOP 4HHHA 2M2BA 1U1KA 3MR2A 4NA1A 3BGFA 4C11A 4M5LA 1X4GA 5KFYA 2O1PA 2BR0A 3J81j 4ZPBA 3NCPA 3QGHA 3HHNB 1NRKA 2DISA 3R8YA 3WBZA 3AOBA 2Z2LA 4WXWA 1ZAXA 2DNLA 1P8GA 2QA4S 2RT3A 3P5TL 2YPZA 1WHYA 4X4NA 3MM6A 1F3FA 4FXVA 1DAXA 1UVMA 2AWZA 4N5SA 4DLGA 2KFNA 3LF0A 2YNGB 1ZM4A 3A8JA 1WC5A 4BDPA 3IRXB 2A18A 2ZZNA 2Y0SD 1Q16B 3IWNC 3GG0A 4QYRA 1V5IB 1RKIA 2QIFA 4XDCA 2XNRA 3VF0B 1IWAA 4HH0A 4E98A 2W2MP 4YY3J 5BYQA 2AIRB 2RB7A 1KQSR 4ER8A 4U7UD 2PA3A 3HT3A 2DIUA 1SKWA 4DR7F 3AB2B 1AFIA 2H51B 3MZIA 3CEDA 5FLXY 2DH8A 4Q0BA 2FHOB 2KN4A 1FX2A 4DV3F 3V6DA 1HD1A 1FESA 1CJUB 4KGKA 1R8AA 3H5YA 4QBUA 3DLBA 2F8MA 4O23A 1BE4A 3VHQA 5LOQA 4F3OA 2VONA 4QU7A 5HROB 1E6YA 2VH7A 3F56A 2IVFB 3D9BA 2WSCC 3VV2B 4UY8T 1HI8A 4DR3F 1U47A 3DLJA 4ILRA 2YKNB 1LK7A 4O0NA 5I42A 1VQLS 1O6XA 2HYIB 2V2VA 3C16A 3EPIA 2HHXA 1D09B 3W62A 1GNKA 2XHCA 2G1HA 4P73A 5A8KB 4YR0A 3NXZA 3S1TA 2KH9A 4DF8A 1M5HA 3IG1B 3W5XA 2XMMA 4GVBB 2V9WA 3UCGA 2UXBJ 1B0VA 2J8AA 3DLGB 5KFVA 1QLNA 3GG1A 3G87A 4QW9A 3NCQA 2XSJB 4ILLA 1JJHA 4ZCLA 4ZVQB 3KK2B 4P2SA 4K2JA 1RT7A 3HHLD 1FKPA 2DH7A 5G0RA 2B9YA 1CJTB 2CFXA 4WK1A 4DZ6A 3MPVA 2QEXS 3SSSA 3HCXA 2BQ3A 1AZSA 2Q66A 1RTHB 2LLZA 3BREA 3Q8UA 3SYZA 2DNYA 4LREA 3ZTOA 3KLEA 2VV5A 3WX8A 4O3RA 1TL4A 4EU0A 2B3TB 5C5JA 1HFEL 4CYUA 2K8GA 4BC9A 3LP1B 4U9RA 3QT5A 4ZPAA 1UVIA 3MEDA 2YWEA 2JLGA 2AV5A 1RA7A 2V2ZA 2X51A 4NXNJ 2E9RX 2AF6A 2EXUA 2FIUA 3FRYA 2C3MA 4DS5A 1JLGB 2GVZB 3BF4A 2QRRA 5CCLA 3H0PA 2F9DA 2LEBA 3EVOA 3OQ2A 2W7AA 4DOZA 5A8KA 5HBMB 4HTIA 3G6VA 4R5PA 1S9EB 2DNGA 3C2PA 3LPYA 2XGPA 3IS9B 2IDLA 2OEMA 3CO9A 3RR8A 1IXKA 4QIWD 5HJXA 3K5PA 3GIRA 2ZE2A 2WONA 3HULA 3L9ZA 4GMKA 2EBGA 2PSZA 2KHDA 4ID5A 4ZK7M 2F65A 4NLTA 3DMJB 3HVRA 5J1PA 1U1PA 1K9MT 2HIYA 3DU6A 1HQEA 2PMWA 4AL6A 1HD0A 3DLEB 4RNMA 3D3CJ 1CJUA 1JK9B 4MFBB 4QIFA 4RW8B 5J1EA 1NAQA 2YWFA 5M2UA 5DDPC 3V6DB 3FK4A 4USWA 1NEEA 2EVZA 2NUUG 1JNZB 2B43A 2EFGA 2QZ8A 4M5JA 3M9OB 1U1LA 4DR6F 3EGVA 4I6YA 2R7TA 4LQ9A 4WFYA 5D4LA 4DR3J 2FDNA 4K4TA 4Y00A 3AOAA 4URQU 1IKXA 2EI5A 5DDRC 2R7WA 2NXNA 3EZOA 5HANA 3QGIA 1RZMA 1C0TB 4H4KA 4PQUA 3KFWX 4DUTA 3H7HB 3IR6B 1PYSB 4L75A 5B0BA 1TKDA 1FRHA 1H72C 2XYHB 4Y3CA 4B3OB 2CVEA 4IRDA 2DY9A 5C42B 2XS5A 3WIVA 3G82A 3JSRA 2JHEA 4PRFA 1VBKA 2ZFHA 4MKAA 3CT9A 3BM7A 3LOUA 1MNEA 4YR3A 3C15B 1HMVB 2FLOA 1MU2B 2V4QA 2LA6A 3PX4A 3HHLC 1T9WA 5B0DA 4ZN3A 4LSNB 1FK9A 1JNRB 5M2PA 2Y1LB 1X9WA 3DLLQ 2W1BA 3PO4A 2L48A 4AXJA 1ZA2B 3SQGA 2A2CA 1KQKA 5HJYA 4LFCJ 1NUEA 1NZAA 4A46A 3EZ5A 1VDHA 1FRIA 2JOQA 2CA9A 3SCJE 4X66F 2QG9B 2GHVC 1AFJA 4C8KA 1TELA 4G6VB 4E0DA 2H1YA 1MN7A 1PIEA 2NS1B 3KLIB 4ECYA 3L7UA 2GNKA 3BSNA 4KHMA 3CMES 1O0PA 5A8RA 4PUOA 1TKZB 2LQJA 2ZWOA 3H5UA 3HVWA 4IDKA 4NI2B 5DM7Q 4J9OA 4AE5A 3GR1A 3Q83A 4CO0A 2N7YA 5HP1B 2YTCA 3KJVB 3QFWA 1RT1B 2AZ3A 4RX6A 5L9NA 2BABA 3QIPA 4LQ3A 1RSCA 4NZ6A 2I6WA 2V50A 1T9XA 2ZBIA 1NKCA 2PMZD 2GJIA 4B3TF 4J9LA 2VODA 2HBRB 4C8NA 4TQRA 2VBZA 4HKQA 1TMMA 1BWVA 2DNZA 2DO4A 2RF2B 4M5GA 3G8QA 1KLNA 4QU6A 1HW9A 5F8GA 1NJXA 2AW0A 2M0GB 4M5HA 1RAHB 2GFFA 2VHGA 3GPAA 1M5VC 2E7XA 2VASA 5HQLA 3I0SA 2AU0A 3NNCA 4M94A 3C16B 2R2UA 1UKUA 1Q1KA 3FNNA 3N0VA 4J5OA 1T9YA 4PABA 3TYTA 5A8RB 2R4FA 3DRSA 4OHWA 4AQYJ 1CJKA 4PUOB 3RW6A 3A3NB 2MMYA 2VIHA 3D0GE 3NGKA 4U7UK 2HSEB 4A48A 2J7UA 4RNOA 3QT7A 3R5CA 3KLFB 5DDOC 4J9MA 5HROA 1UPPA 1N5YB 1WG1A 2OD6A 4K0KJ 9ATCB 4C97A 2LXFA 2KZZA 4EYHB 5D77A 4IRCA 4HT7A 3MPWA 4NCAA 1IR2A 3R7BB 4NCBA 1EP4A 3CJSA 2WVFA 2MZTA 1LXJA 3BQ1A 2BVZA 2B51A 1LWEB 1HNVB 2QSFA 2A2DA 3HLUA 5L1IA 1SL1A 4DR7J 2OEJA 3JXOA 3C14B 4ECUA 1DTQA 2DEIA 2ZUAA 1LW2B 1FKOB 4HVZA 2CPYA 4C0HA 1CJVA 4RUAA 4RNHA 5JVGQ 4F4KA 2W9BA 1P9QC 1F5AA 4WYWA 1GXLA 3GMGA 4G1IA 3U27A 1D3WA 4JV2A 1JLCB 2Z8QA 1PG5B 3T1AA 2CYYA 1TL1A 1RU1A 5I4MA 2BANA 3NS6A 1UFKA 3CCRS 2LQBA 1WHXA 5KFEA 4C8LA 4JI6J 2R7SA 2KM8C 1UVLA 2BE2A 4QWAA 3T5JA 4WFAQ 1H7XA 1CC7A 3V6HA 4DR2J 3UCUP 5HVGA 2XCAA 1S6PB 5D3GB 2Y1IA 2MLZA 1XMOJ 1N88A 1HR0J 3DRXA 1TFYA 2J6TA 4OI0A 3H5XA 1CEZA 3CJ5A 2IM2A 2IDEA 3D6HB 2ZBCA 2WONB 4USHA 1KTVA 4IOCQ 4ECTA 2RVJA 1QM9A 1N8RT 1I3OB 1RUSA 1YX2A 2HLUA 1S9EA 3R97A 3TRGA 4KSEB 4JI0J 3NY0A 4KQZA 2K3KA 3TA0A 4LF8J 3Q86A 3UPFA 3GJTB 4CLUA 2UU9F 1NJYA 2VZ9A 2BJ7A 1XN9A 1S7HA 3HVTB 4BLGA 5IT9Y 4B9LA 4WWSA 3J81Y 4NXNF 1RYRA 2BJEA 4DJBA 2C2EA 2DR8A 1VK3A 2OFHX 3MAAA 2JDJA 4HLBA 4UW2A 2CQ1A 2YXLA 3IP0A 3MM7B 1NJZA 1OO0B 5CYQB 4DFMA 2QL7B 3G6ES 2UUTA 2R42A 2KTQA 4DPXA 1SV5B 1S48A 3EJMA 3GILA 1U6BA 4JI2J 4RL1A 1FJEB 3PRVA 4L73A 4P10A 4IOAQ 4ZVRB 2R7UA 1VLYA 2AT1B 1T7PA 2QTWA 4F2RA 1JLQB 1RLCL 3BDEA 4BWJA 3G8TA 2F8HA 2QE5A 4ES2A 3N6NA 1RB0A 3N5FA 4K0KF 3C6UA 3W8GA 4HL9A 3T1YJ 3ZFVA 1S6QA 4JI3F 1BHNA 1SIZA 1IN0A 1RJJA 4L76A 4KV8B 2Z2MA 5J2NB 1UEUA 1HA1A 3CULA 2ZJRQ 4WIIA 2ZC3A 1RWKB 1G6BA 4USJC 1RHMB 2FLLA 2C22A 3HKWA 3ILOA 1AB8A 4OJGA 3IR5B 4PCQA 3FCHA 3JAMU 1LEOA 3EDQB 5L9XA 3QIDA 5GVQA 1TKTB 3SEOA 4NPOA 2WVCA 3KJQB 4UOGA 3QJLA 1EQ0A 2CQCA 2K1RB 3WC0A 3ZZZA 4ETXA 3H40A 4BS2A 3MUMP 4B3TJ 1OYEA 4I67A 4X2BA 1M90T 3J7YI 3MMBB 1TQLA 2CJBA 4I68A 2HZCA 2ZH4A 5AT1B 2Z0GA 2CPDA 5LXYA 3W63A 3MAQA 4QIGA 1HI1A 1QTNB 4F4XA 3QO9B 3HMJG 3CXCR 1D1UA 2KYXA 4DN9A 4OYIA 3O6QA 4DV4J 1V3RA 3A8IA 4LF8F 5AJ3J 7FD1A 3I9ZA 1UVKA 2LQ5A 3OJUA 1LKZA 3FEXB 1X8DA 2W4CA 2OTLS 3KOAA 3KLGA 1TKXB 5LMUF 1WORA 2EKYA 2GIFA 3CCES 1N6QB 1BQXA 3CCQS 4U7CA 1ZETA 2EFNA 2PE8A 3EVMA 4K7QA 1Q5VA 2RS8A 4Y2CA 4XPEA 4UTGA 4QCLA 4PG8A 2MQLA 3ISNC 2LU1A 1HNZF 4OZ1A 3IC1A 2XMTA 4GO7X 2ZH1A 3BO3A 3C46A 2BRKA 3R5BA 4LR9A 3W2VB 4TQSA 5GAEI 3PHTA 2ATLA 3X1LB 5D0HA 3P6YC 1KD1T 3AD8C 4C11B 5DJBA 1RTJA 1MW7A 1F2HA 3OR1B 2QC3A 1MROA 4PEOA 2CQBA 2IC3A 1U0HA 2MHNA 3GB0A 3H98A 1SJ4P 4DQPA 2B5JB 3ZXWA 4RW4A 2P9GA 3CJ8A 7AT1B 2FHMA 4RPFA 3EPGA 2O5DA 4HHJA 2ZJQQ 3A12A 3QLHB 3KK1A 1NZ8A 3J81U 4OZ3A 2EFQA 1RDRA 1SJRA 2MLXA 2C2DA 4WK3A 1IQZA 2NSCA 5AE1A 2ZH9A 3G86A 3M6XA 5CABA 2XCPA 3BGUA 3KG0A 4KGXB 4XTTA 3TJAA 4DCJB 1FWKA 3A13A 3L7OA 1OQ3A 1T3NA 2UVVA 4KGZB 4HDGA 1ROFA 4O4RA 5IWAF 2GGPA 2KDOA 3HSZA 4FBUA 2W2PP 1NMEB 3BBCA 1R8HA 2LQ9A 4QOTA 3FSIA 2MKSA 5BR8J 3ET6A 4ZLLA 1FXRA 3T1YF 1CPZA 3C6TB 3HKZD 4CO3A 1JX4A 3C3LA 3NLCA 4CH7A 1X5OA 4CM2A 2ASDA 4LMZA 1NDKA 2QSWA 2MQQA 2UUCJ 4F4WA 3M8ZA 1ZM3A 3KYLA 1MSWD 3ELHA 1YK9A 2E7VA 1UWAA 3CD7A 1F1BB 2CPXA 3HDSA 4FYVB 2ZBPA 4I6AA 1KOHA 4USTA 1MROB 3R6LB 5KT3A 3Q23A 3OR1A 2ZEJA 3U7JA 5CD4H 4J9QA 3BKUA 2HFOA 4ELTA 1UP1A 1Q86T 3VAIA 4UF4A 3ZZRA 1B0PA 1MU2A 3DHWC 1S1XB 4MH8A 2GA7A 2JFDA 4OV6A 3GJRB 4YY3F 3W2WB 1EARA 4TYAA 3G96A 5KFIA 4A47A 3T1HF 3RAXA 2KB2A 3FJ2A 3F41A 1O5JA 1T9TA 2P8IA 2RE1A 4P52A 4NLWA 1TK0A 1PGZA 1UZDA 4ZVHA 5LMNF 2HQIA 3CJTA 1X7VA 4B3OA 3AQPA 2QA1A 4ZPDA 4G1QA 4ECWA 3CCJS 5HO4A 1K73T 1N0VC 2VF3A 2JEFA 5J2MB 2HWTA 1RQ0A 4LIWA 4RU9A 3MFIA 1FWPA 3AB4B 3T5HA 3LTOA 2XS7A 3MM8B 1PC4A 4IO9Q 4Q5VA 3ET6B 5BXIA 2KFZA 3JQKA 2RU3A 2OIHA 4B9SA 1U1QA 4ZN1A 4TN2A 2IA0A 2HWHA 3EWGA 4L72B 4X84A 3GYGA 3MPUB 3ZTQA 4P7TA 1MWZA 2I0XA 3CW2C 1SC1B 5KT2A 1SL0A 1NJIT 4ZPVR 3TA1A 4OZ5A 5KG0A 4CDIA 1N54B 1JLEB 1SBRA 3DLEA 3KK3A 2V4RA 2YKMB 2FVCA 3VGSA 3EXYA 1TL5A 4C0OC 2G0JA 2X1FA 2D9OA 4UT4A 5GAEU 5EX0A 3VVTA 5EN1A 3E3XA 5BR8F 2UVWA 2CNKB 3ZTSA 2HLTA 2QV6A 3R5JB 1E6VA 2G2OA 2HRYA 2ROPA 4WFXA 5E5NA 5FDLA 3TVKA 1IJFB 2W01A 3BO4A 4B9MA 3G9CA 3CIMA 1K0VA 2D41A 1BMQB 4Q8EA 1GK8A 2DGSA 3KNGA 3N6LA 4KPCA 2BEFA 1DQAA 1FFSB 2H54B 3H5SA 4XIUA 4B3SF 3LAKA 2C28A 2R7VA 2JX2A 4FPIA 4FYYB 4NLYA 4P75A 1IR0A 5KTQA 1S9FA 3CJKB 2UP1A 1HYSB 1WSVA 2V8DA 1FA0A 4LR7A 4YP3A 4X4QA 4C6AA 4X4TA 3GYNA 4I7FA 2RIJA 3BB5A 1CVJA 2HVIA 1QAYA 3J7A1 1H2TZ 1X4DA 1YBAA 2L9WA 1U02A 2NQPA 3M2UB 4GKKJ 2MZQA 3CF5Q 5DZ7A 3TZYA 8AT1B 4U67Q 4I6WA 1RAGB 2Q6BA 5E3RA 3ENVA 3KLHA 1FNMA 3G4SS 5KG3A 2I8EA 2V94A 5EWEA 2IY5B 2C2OB 3JSBA 4USIA 2DNQA 4WKYA 2KG0A 2VOPA 3T6JA 1JLFA 3P5BP 3BYPA 4EWTA 1S12A 2MHEA 1WEYA 3TAPA 4U8YA 3HO1A 3H42A 2W4PA 4Q2MA 3ZZYA 3PW5A 5F8LA 2FY1A 1JKHB 3NGUA 1CQMA 4K8RA 4DUZF 1U2RA 1EHWA 1VJWA 3CDAA 2HW3A 3BV8A 3J7ZT 3QGPA 2VDHA 2GMJA 3OFEA 2MJUA 4RW6B 2CPZA 2ZH3A 2WK4A 5J2QB 2RQCA 5SUHA 4RWXA 1M5PC 2BX6A 2AP6A 1YIJS 2E1CA 1RWOB 3VAMA 4F2SA 1C1CA 1WI8A 2MLYA 1Q8IA 3ETOA 1PBUA 5ADZA 1KBRA 3PJWA 5I3PA 1JJ2R 1S99A 1E6VB 2AEFA 1NDCA 1XR5A 3FKBA 5FDLB 3G6XA 4K4YA 2FZCB 1GQEA 4M5DB 4QYZJ 4WJBA 1RT6A 5F8JA 2JC1A 3K5MA 3NAHA 1RACB 1WI6A 2V63A 1IVZA 2NUHA 3B78A 3GFXA 3GJQB 2JEGA 1UETA 5KT4A 2QA4G 3D6MB 2MKHA 1SVDA 1KDNA 1S1VA 1Z4UA 1WOOA 4Y34A 4YB7A 3OTOF 5J2PA 4TU8A 2RILA 1K0TA 1HW8A 3IBFB 5KT5A 3PM9A 3AXKA 4J9VA 5EX3A 4J7CA 1BQMA 5E3AA 3BN7A 2EFOA 4N77A 5EGYA 1GMWA 3H2UB 3E2EA 1UJ5A 1Y4ZB 2LCWA 4F4YA 1RT3B 8ATCB 3PKYA 1U1OA 1IKYA 1YVFA 2XTJP 3VGUA 1VQ6S 2HEKA 4AYBD 1BGXT 2FC8A 3M9MB 1V6HA 3BKFA 3BO2A 1YWXA 4NLXA 2XG8A 4NMLA 1QAXA 1YRXA 1SQEA 2HK2A 4LIRA 4LRAA 1KP6A 9RUBA 3K0JA 4IOBA 5DS7A 4X4PA 1EIYB 2XC9A 2CQ0A 2DIVA 5ETVA 3CC4S 1IM6A 2Q1LA 3OR2A 4NCGA 4TY8A 2CPHA 5DG7A 1NJWA 1NXIA 3H59A 3TW0A 2JFKA 2XY5A 5KFXA 1TFWA 4PWDB 5KFMA 3QWUA 4F3MA 1NKEA 1HNWJ 4KBIA 4ZCKA 3V4IA 1Q8KA 5K20B 3SCKE 3PG9A 2ZNZA 2FJXA 1KHVA 2FZKB 3FMBA 4HTJA 5LL6d 4ED4A 3D2WA 2HNZB 2K06A 4DHVA 2YQ3A 2KXHA 3PYDA 1PJ5A 1RTZA 1XQIA 2RNEA 4DPTA 3QRRA 2D9PA 3QPIA 4RKUC 2NZ4A 4WFNQ 2N3OA 5D4PA 3UFCX 1DURA 2Q3PA 1NK8A 3H4DA 3D28A 1VC5A 2J9DE 5K8OA 3KHHA 4IG3A 5GMKa 3AODA 3N28A 1BC6A 1NB2A 3Q8QB 3RTVA 2WRMA 4P7VA 1YJ9S 2LEAA 4Y6IA 2XSFA 3FBBA 3JTOA 4WE1A 1PAUB 3LP0A 2J8SA 4LSLB 1QE1A 3IXQA 1QUPA 5B08A 2M3DA 3ZC4A 2JEJA 3P45B 2NYIA 5IM0B 2DCLA 3TAMB 2IM3A 2B5JA 5CZXA 5A2QU 2Y9HA 2F63A 2W9BB 1OSDA 4R0EA 4ELVA 3LP2B 4LBPA 3FFIA 3CMAS 2B7BB 2NREA 2XZTB 1TV6B 5DO2A 3AXMA 2MQMA 1FFWB 2O67A 4NEZA 1FRJA 3HZEA 3MMCA 2QYCA 3PYGA 3RBZA 1G7CB 3OLBA 4J9PA 4DL5A 5HLFA 3J7AN 3W5YA 4DQIA 4QJVA 1TKZA 1RLDA 4O3QA 1EKSA 4ID8A 5E33A 4YHHF 4EEYA 4JUZA 2ZZMA 1OS5A 2E66A 3QJJA 4KH1B 2G4BA 5K14A 3M6VA 2ZH5A 1WNEA 1B7FA 3T5KA 2HWIA 3DN9A 1LNQA 3NG8A 4RNFA 1ZH5A 2GGPB 1JXEA 3K5OA 4LSNA 1HBOA 4OFZA 3V4MA 3WX4A 4HACB 2WW4A 4I4BA 3KTQA 4KKOA 4J90A 3R7NB 4JV5J 1O51A 3MAHA 3OVAA 3V6KA 3FFIB 1J2VA 1FD2A 3B8HA 4QPTA 5C42A 2GIRA 2NZCA 5KFPA 1VS3A 1KTQA 2JSXA 4HDHA 4LBIA 1N32J 3NMAA 1HBMA 1FI4A 2CPIA 4RW4B 1X4HA 5HMXA 3K5LA 2KKHA 2NCKL 1NK4A 4Z7CA 1SH3A 1SJQA 3TQEA 1WHWA 2E44A 2DH9A 3MR6A 1GXUA 1WACA 3H2VE 5C24A 5EWFA 1S76D 3HFVA 2G0CA 2AKWB 3GWCA 4ZPTR 4BC7A 5MAOA 4ED5A 4LF6J 2AJ4A 2OPSA 3HHKA 4GKJJ 4PWWA 4OX8A 3K17A 3FBFA 1VQKS 1FJGF 5FD1A 3UW1A 4YQWA 4NZ0A 4E8UA 2W7PA 4Q0BB 3TVYA 1S59A 3PW0A 3PR5B 2HNDB 2B0GA 3C6UB 2VU5A 4LRCA 3KDOA 4OYPA 3UDEA 3CJ0A 1TTHB 5KG1A 4BCAA 1RCOB 3GIKA 4JI7F 5B0EA 2AYMA 2W2QP 2V9KA 1SXLA 3UCZP 1UEKA 2D3ZA 4PQAA 1S0VA 4FXWA 1BUXA 3I5BA 4I0WA 3SXLA 1OYDA 4O0IA 3KKFA 4TY9A 2RH3A 4NCGB 4TY8B 4D3GA 2CJXB 3JQJA 5A8WB 4ZCMA 2UVUA 2HGLA 4LVOP 2YKPA 2YKOA 3MMJA 4OJ1A 4CM0A 5F8IA 3NOCA 1S0NA 1MG7A 5F0WA 2KVIA 3OVBA 2GX8A 4MYUA 3H4BA 2B4VA 3LGMA 1J27A 5H9EJ 3MMBA 4DUYF 2I1RA 2POKA 2WSEC 2YKQA 3M32B 3TAQA 4HH1A 3Q8VA 1NU4A 3DU5A 1YQHA 3FDSA 3I5AA 1MMLA 2LDYA 2GVDA 1PSDA 3AT1B 4Z7YA 3CIZA 4CCHA 4LF9J 2GO8A 4DQRA 3PFEA 3RYLA 4JI5J 1WWHA 2J7KA 4DR2F 4H4OB 1KR4A 2HFZA 2HQCA 5G0RB 2XULA 3QNWB 3AJDA 1LFWA 4PG7A 5KFLA 4Y2MA 2GZOA 3X3UA 2KG1A 1S1VB 4I1TA 4USUA 4F3QA 1S1WB 2EG2A 2PGCA 4HR2A 3K5NA 2E5HA 2IHR1 3H2LA 4MFBA 1FD8A 3DCAA 4RW8A 3CDWA 2A6OA 1L3UA 4CLWA 1VQMS 3JYTB 1S6PA 3PJXA 2IRYA 3W66A 2HIQA 5HAOA 3OFHA 3QBCA 2VG7B 4M5DA 1FNOA 5D4NA 2RKIA 5I42B 4A8WA 1VIXA 2RDDA 2NPFA 4CLYA 1VIOA 4PZVA 4K4SA 2DGVA 4MYTA 1TL3A 4FPRA 5A2QY 1HQ2A 1FVQA 1IKWB 2SXLA 1H73A 1YJNS 2DJWA 2I2YA 1VC0A 2O3DA 1HIYA 2R9LA 1Q7YT 3CSKA 4ZVTB 1TUVA 5K8PA 2IJNA 2QJ3A 5D0EA 1Y5LB 5IXUA 5THWA 1BY9A 3AJ1A 3TUPA 1WELA 3I0RB 4X65J 1LW2A 1CSJA 2KJVA 3TR5A 3ILJA 3LA0A 1AYEA 3HVTA 3AQOA 3VCDA 3AOCA 3E01A 4IQXA 5DG9A 1UEVA 3KWMA 2OTJS 1RAAB 5KFJA 5T41A 2HQ3A 5F8NA 1CJTA 4DL0C 4DSIA 4YHHJ 1K47A 4LUBA 2BOAA 2CG8A 4HI2A 5IQ6A 1KVIA 1UJ6A 2QL9B 4KB7A 5GAHU 3MF5A 4X4RA 4JI7J 1QJHA 1RWPB 2N7CA 2Z4PA 3EXCX 1HLWA 1CJKB 1RWMB 1VI7A 2OMLA 3CJ2A 1DFDA 4LF9F 1N48A 2WVDA 3DOMA 2BW7A 4K2XA 2P2CB 3D54A 4CO1A 2UZAA 2MPUA 2KYZA 2YWWA 5C24B 2JLEA 4WYLA 4NWBA 5C2CA 1OY8A 2CJKA 4Z2XA 1HBUB 2KI2A 5HK4A 2C2MB 4PKDB 3TUIC 4YFUA 2U2FA 2HGNA 2E1RA 2F4VJ 5DLFA 3D0IE 3TARA 4FP9A 3LUYA 4NLVA 2DTJA 4EGLA 1CJVB 5KFUA 4YDDB 4YS2A 5DQGA 2YPYA 1S77D 1FKOA 4QYZK 2RU9A 3QIPB 2ACMA 1YKWA 4WTOB 3G6YA 3TVZA 3KK3B 1FERA 1UW9A 2HVEA 2ZOGA 3C14A 3NGRA 1Y3JA 3JTNA 2ZVSA 5JXSA 3HXMA 1AW0A 1XNQJ 1CS4B 1NM2A 3ENAA 1WC0A 2H4YB 2IFXA 3D6FB 3IA0A 4IDKB 5CH7B 4M5NA 2M4MA 4WP3A 5KFAA 1LWXA 4N8NA 4KGMA 3OTEA 3BKTA 1SL2A 3DC2A 4MKBA 4O3SA 3GSDA 2MZ1A 1RAFB 1FDNA 1X5PA 2E5GA 5BYRA 4C48A 2XLKA 1GMWD 2VFRA 3LGNA 3LQVA 3EZUA 4EO6A 2FJEB 4DCOB 5L8RC 2DHGA 1RWUA 2CWKA 2MY7A 1RP5A 2XNQA 3SQGB 4DR5J 4UQTA 3VTIA 2LMIA 3M6UA 3ZTPA 5JUMA 2ZM6F 1GT8A 1X4CA 1ZS6A 5HSPA 3JYTA 3WC2A 4DV7J 1R43A 2IRUA 1HARA 1RWNB 5AXLA 3Q8YA 4DEZA 2FD2A 5ETNA 1REVA 2V4JB 5U47A 4OZJA 2R7OA 3CCMS 3SCLE 1YHQS 1NH8A 2VA2A 4RW9B 3TP2A 3LWLA 4C0BA 1N4LA 4HT5A 2HMIA 1F9EB 3EE3A 3OXFA 4RJVA 4IUFA 4DR6J 3J7Z5 5HMZA 2DKOB 4NMXA 2VQEJ 4IR1A 4DFJA 3LP0B 1EETA 1CS4A 3PW7A 5D4OA 1NK9A 3C6TA 4CQ1A 4L3NA 5IT0A 3K7RA 2Y1RI 3AAWB 4DMZA 3A4TA 3MUVP 4TU7A 2CZVC 2HVZA 1IUJA 1X60A 2CQHA 2DXDA 2OO4A 3GCWP 4ZLNA 2OMOA 1SB6A 2W25A 4N7TA 3CJ3A 4PYAA 4ZPCA 4F4AA 2I5JA 3FVYA 3OBIA 1Q7LB 1MLAA 4RBUA 4JYAF 2W9AA 1HQEB 3TJ8A 2DT9A 4FF3A 3HVAA 2BA9A 1J5EJ 1YBTA 4GVLA 2ZHBA 4NEYA 1LWFA 4ANDA 4CRJA 2RDIA 2AX1A 2GV1A 4I2QB 1FE4A 4UOHA 5KOXA 3SQOP 4HYKA 1RTIB 2LXUA 2V69A 2YNHB 1VQ5S 2R7RA 1H6KX 1DLOB 3IS9A 4P2MA 3CDEA 3ISZA 2PI4A 1X5SA 4I2QA 4M8LA 1YGYA 2DGOA 2BQRA 3SDEB 5C25B 3LAMA 3DLKB 3MEEA 2RRBA 2Z2ZA 3D7SB 3IM8A 5E41A 3IM9A 3DFEA 2DXFA 4M95A 2YNIA 1JLGA 3BYRA 4BBYA 1HMVA 5E3CA 1K1SA 2CJYB 2LFVA 2MXYA 3H90A 3BSOA 2UUAJ 1RAIB 3DLHA 1RXOB 4CT9A 3OJSA 2ZOFA 4F0HA 1F9FA 1YRTA 3M8QB 4KFBB 2QLXA 3ZZUA 2OPSB 3PIPQ 2WCXA 1DTTA 3THTA 1N32F 1IKYB 5IWAJ 1ULRA 2ZDPA 3MHYA 3W3SA 4L6V3 4KIAA 2BW2A 3SMZA 5IV3A 2O01C 2CWXA 2KU7A 1ELOA 1Y5NB 3HD2A 3IAM9 5HVHA 5GAGI 2IM0A 4OI2A 4QWCA 3TEGA 1X4EA 2ASYA 4TVAB 5CZVA 2PFFB 2Z58B 1FEEA 3OTOJ 1GMVA 2RRNA 2HPUA 3O8WA 2FVQA 1F5CA 2E9TA 1Q0NA 3BBBA 4ZP8A 2CQPA 2IAJB 3RRKA 3KLVA 3NNAA 1YLXA 1S79A 4CLFA 2D1CA 3LW5C 1WG4A 3MD3A 4PG4A 3R2DJ 4ZITA 1Y7PA 4NYPA 2NSBA 3FSXA 3MCSA 1OQ6A 4GRSA 3GIMA 4OHYA 3FRZA 3PTWA 3UN2A 1RT5B 1KEKA 2QX0A 2R8HA 1MN9A 4OX9J 3UNGC 5L1KA 5KFGA 1RBLA 2MZSA 2FVPA 4NRUA 3RG6A 2VBXA 2W24A 5IV4A 2J0QD 1JB0C 1VMBA 2C2KB 3DRPA 5KT6A 2DNNA 1OIAA 3BQ0A 2MQNA 4JYAJ 1L5UA 1JLAB 2E5IA 1UFLA 3BGLA 1PYTA 2AGQA 5ETOA 2GQCA 1Q8BA 2CIMA 3MM9A 1J5OB 4JI4F 3LP1A 1SJ1A 4K59A 1NSQA 2CNOB 2FHJA 1B4SA 1I51B 4C3MA 1ZZNA 4FNIA 2MB0B 3OFGA 1TP7A 3M30B 5IC6B 3LP2A 3GV7B 1VQOS 2OPPB 1IBLJ 3KUHA 4F67A 5E3QA 4MK9A 4UOCA 3TAMA 2JNJA 3KK2A 2RQ4A 1HBUA 3NCRA 1GTHA 3MECB 2RD5C 4X4VA 3O5TB 1RWWB 1FDAA 5CXTA 2CRLA 4WZQA 3O1LA 3D1HA 4GVBA 4ZPWR 5MLCV 1LFPA 1SQGA 1QTMA 3MAAB 4K4WA 2HS3A 2BE7D 2YQ0A 3HHEA 2W8KA 3CC2S 2Q43A 3K8VA 4FYWB 5KFQA 2JVOA 2Y8WA 2DNPA 3QZ7A 2NXCA 2YKNA 4NRTA 4R25A 2CQDA 2LVWA 1XMOF 3JTPA 3CJKA 4ELUA 2MTLA 2UUCF 1VCTA 3POTB 1UCNA 4C3KA 1RCXB 3FQKA 4OIXA 2PD1A 1HL6A 4I2PB 5ETKA 3R27A 5B0GA 5GADU 2AEJA 3IWLA 4TKTA 4Y2AA 4FBTA 1XMQF 4B3MJ 1S6OA 3N79A 1UW4A 4PWDA 2DR5A 3MEGB 4DG1B 2W9CA 1DQ8A 4ERDA 4L3KA 2YKMA 3E01B 2HFNA 2IA6A 2FYXA 3DI6B 2KO1A 2MZJA 2FJBB 2VKZG 3OTBA 4K5SA 5IOLA 2C3OA 4ZJLA 4ECZA 2HG4A 1NB7A 1VQ8S 1M1KT 3I0RA 2BE2B 5HQMA 2KVQE 2G9OA 3L4BC 1ZPVA 1CC8A 4RW7B 3V6JA 2BANB 1R0CB 3SCIE 1RT3A 3ILLA 4IFVA 2MZRA 1KN6A 4KGVB 2KT3A 3O44A 2VD3A 1OY9A 1IKWA 1JJCB 3ETMA 1RE1B 3PEHA 4QR2A 5LJ3Y 1L3VA 2GHWA 4AD6A 4FZVA 4MTPA 5KFZA 4DR1J 4C8OA 4HACA 3M1VB 2DNHA 1GAOA 2GHPA 4I56A 3TI0A 2WBRA 1GEHA 2HFUA 3CJRA 2BKNA 3W2WA 3I55S 1S1UB 2B6AA 3CDBA 3M2VA 3OUYB 2M8DB 4ALZA 1XMQJ 3SI8A 1EB0A 2ZD1A 4JI0F 4ZP7A 2HBQB 3V5RA 2PT0A 5HQ8A 3RB3A 1HR0F 2FLPA 1RT4B 1VHFA 4JB8B 3R1LA 3T41A 3HJVA 4O44A 1Q4RA 5CD4A 5KG5A 1QSYA 1LW0B 3SSQA 4K4XA 3OHBA 1N5TA 2WBMA 1B7YB 1HQUB 2VG5B 4JV1A 2U1AA 1N5QA 3S8SA 3PX0A 1WEXA 1SUQB 2D69A 4IG0A 2VA3A 3FGVA 3JB9k 4DPUA 2DHAA 2FHJD 3KXDA 1WEZA 5ETPA 2WVBA 1I5OB 5M2RA 2ZH6A 4DLEA 4U96A 3NKYA 4MIWA 3S6EA 2E1AA 8RUCA 2ZM6J 5L46A 3EYZA 1YJWS 2XWXA 1Q82T 4FYDA 1N33F 1U48A 3A3PB 4LFBJ 1JKHA 2MY8A 3KJNB 5IC4B 5AE3A 2FY8A 3SZ2A 3EMTA 4N8OA 4JI1F 1WOPA 2Y8YA 1QE1B 1SH2A 4RBVA 3THVA 3MR7A 5K8NA 4ANEA 4DL3A 1S4EA 1SKRA 2XS2A 3Q2SC 2ILZA 2GQ2A 4CLPA 3VALA 1RAEB 4A8QA 2CAJA 3ITHB 4ZVSB 3W65A 1HBNA 4ZMMA 2KXNB 5DGAA 1W25A 3PYFA 5ETRA 4CLZA 3UD4P 3VGVA 2AJFE 4A8KA 1DQ9A 1KC8T 5KFSA 4F50A 2OH2A 2QLJB 1RYSA 4UY85 3BGRB 3TOQA 2HNYB 3DYAA 5BJRA 2MQPA 3OXLA 1FTCA 4JI1J 1RISA 5LXRA 3RBXA 3PYEA 3V81B 2JZ5A 1JLAA 1P27B 3D4JA 1S1TB 3DRYA 3P4UB 3JSMA 3BR8A 3JQMA 4NZ7A 1TR0A 3MUTP 2LECA 2APOA 2DPJA 1KVJA 4O44B 2OD4A 1F5BA 3D68A 3TX8A 2A3JA 5I3UB 2AGPA 4EBCA 3Q2TC 1KRPA 1S5ZA 4G65A 2E7WA 1VFJA 2NLWA 1SJFA 3MM5A 3W60A 3IRWP 1S1UA 2B9XA 1M5SA 1BXNA 2WHOA 5T7LA 4WZMA 1WF2A 4DCPB 1LOUA 3HZGA 1FK9B 1MWQA 2IM1A 1VC6A 2HZVA 1ZM9A 5K9FA 2DNKA 1SCJB 3FCVA 1M5OC 4ZIWA 2BJ3A 4S0MA 3AA9A 2DGXA 2QMXA 1QAJA 3BH7B 4ZLJA 3BQ2A 3M8RA 1BQMB 4ZVFA 4N41A 2YWGA 4FKYA 4MAKA 2BE9B 3ADAC 2DCUB 1BWEA 1U2CA 1P6TA 2ZH7A 3QFHA 1NK0A 3VAGA 1C0TA 4OJHA 4CTAA 1VK8A 2FC9A 2GQQA 3MM8A 2CQ3A 2VKRA 3P8BB 2R2TA 3T1HJ 3DI6A 4DFPA 1J5EF 3TA2A 2HK3A 1MWYA 1VGYA 4A8XA 2A0FB 2XMKA 5DQIA 4MKVA 1S1TA 1DTTB 1GMUA 4ENOA 1YZ7A 4CWBA 2AJQA 3M8QA 3QGGA 3PR4A 3VAHA 3RRHA 5J2NA 3VQTA 3I9V9 2OPQA 4FF2A 2GIQA 1X4BA 1D8YA 4WFZA 1RHKB 2NXUA 2ROEA 4ITSA 4P2FA 3SFUA 2J0XA 2JVRA 1U6ZA 1HPZA 3SDEA 4ID5B 4OYBA 2FJWA 4WU3A 2CJ9A 3W9IA 2GVDB 3FSYA 4Y0FA 3D0HE 4YB1P 1IBCB 2BUNA 3UDCA 5GAHI 1B64A 2MSSA 4DQSA 1TK8A 3M32A 4P9SA 4F36A 5HL7Q 1ICEB 5B0FA 1N36J 5HBMA 3B54A 4AFFA 1NNDA 5A76A 3KG1A 1HNXJ 1PKUA 2B7CB 4B9TA 1UWBA 1PJ6A 2ZZTA 3DXBA 4LR8A 3Q22A 1EAYC 4DV5F 4LF7J 4IG3B 2ZKUA 3MCNA 1N34F 2XO6A 2MYFA 2MKKA 3QZ8A 3EDRB 1YSJA 3PW4A 3L09A 4KO0B 4PXBA 3TANA 4LF4J 1W26A 3SBMA 5D6GA 2DITA 3GV8B 4J91A 4ZA1A 1HHQA 1CBKA 5F0UA 1SUQA 3CCWA 4ZVOB 1VRTB 1X0PA 2IYIA 3VGTA 4V19X 2J7WA 1IM4A 1FFGB 1N5VA 2NYHA 1HQUA 2VG5A 4X62F 2YNFB 1VQPS 2KFYA 1QDUB 1X31C 5IQQA 4KTQA 2G13A 1LW0A 4NA2A 2O66A 4OZ0A 2XGQA 3QT8A 1HNZJ 4KPYA 1KQGB 3QJPA 1FT8A 1N36F 4RW9A 1N33J 3DOLB 1RKJA 2VQFJ 4CLSA 1NPKA 1RT2A 3ZZPA 3DLGA 1RWVB 2EW9A 2OSQA 4O4GB 2ZD1B 3G8SA 2Z30B 4Y28C 2N4CA 4FS1A 2CPEA 3OLAA 2EG1A 3OTCA 3GIJA 5AXMA 4R8UA 2Q6CA 1AA1B 1X4FA 1YZ6A 3DGPA 4NASA 4CTAB 5AXNA 2R2SA 3BR9A 2HHHJ 4NYOA 4P72A 2R8IA 1XIQA 1YITS 5LJ5Y 4C8YA 4EUVA 2Q79A 5JJBA 4KYZA 4WBFA 2OP5A 2ZVIA 4H54A 4QZVB 1QVGR 4PPZA 5LMUJ 1U0SA 2FJVA 5SZTA 1HHSA 3LALA 5CCMA 3KLGB 4TYBA 4WXOA 1Z2ZA 2RMLA 4CLTA 5KT7A 1R31A 2V5HG 4KHRA 6FD1A 5HI7A 1JQGA 2YX4A 3E51A 2M7SA 2EK1A 1U09A 5KOWA 4F04B 3FMWA 1WF1A 4TNOA 5A6WA 1WJ9A 2XLIA 2L9DA 3GSIA 4OI4A 2Y3YA 4LFAF 3BZQA 3JAMY 1HNVA 4W92B 1HNIB 2HHPA 4Y2IA 4AT1B 3M9NB 2R8KA 4LF4F 1IQTA 2XYGB 1ZPWX 1R8PA 3C19A 4UOFA 2CNLB 1MMNA 3WHIA 4CO4A 6FDRA 1N34J 4KFBA 1YI2S 2ZHAA 2P6TA 2D3O1 1ZYQA 5ETTA 3DGPB 1GXTA 3U1LA 3GONA 5KG2A 2PC6A 5DM6Q 1FDDA 1R27B 2DNOA 4IH6A 3RGIA 3HSDA 5E3PA 1LK5A 1FRXA 5I3QA 3G71S 4DFKA 1FXLA 3HPOA 4ZS6A 3M4XA 4LBHA 1FXDA 1RU2A 1TZ0A 2EK6A 2DRDA 1UPMB 1VHIA 3GFYA 3HSGA 4M5IA 3ITHA 4TU9A 1KLMB 2BMBA 2YY3A 4YN3B 2ZWPA 3DNCA 1N52B 1Q53A 4PAAA 4X4OA 2J9EA 3CCSS 1IBKF 4DV5J 4WE1B 4LF7F 4GKKF 2HVHA 1WOSA 2X1AA 4DR4F 5EDWA 3G2XA 5E7OB 4DPOA 2UXDJ 4Q7AA 3PXGa 2FJAB 4KJIA 3AD9C 2XZWA 4EFAC 2AQ4A 3BN4A 5HP1A 4NA3A 4ECSA 1FCAA 1CULA 1SH0A 2VFSA 4IH7A 3UR3C 2HHTA 4K4UA 2DEJA 3CGIA 2MQOA 2BKPA 3OW2R 1L3SA 2AX0A 3A3OB 2CADA 3MOJB 5H9FK 1X0FA 4F8RA 1M0SA 4KT0C 3KJVA 3HFKA 3M2UA 2OI2A 5CYQA 2R2RA 1NDPA 4DL6A 4OYWA 2ERRA 5DRKA 1REGX 4QW8A 1U1NA 4ZDNA 2HHQA 1GTEA 2IJFA 3NOGA 4O3NA 3OTDA 4I7FB 3TO8A 3CCVS 1KFDA 3I6PA 5D0RA 1XWLA 4PR6A 3TEHB 1L3TA 1H2VZ 2EC0A 5CYJA 3KHLA 4DSEA 2XI2A 2DPIA 4K4ZA 1PBAA 1HPZB 3M6WA 3PX6A 3NEKA 1N5SA 1QSSA 1OPZA 3TZXA 2QLWA 5F9NA 2QMWA 1N5YA 1S9GA 2Y0BB 3HHLA 2FZGB 1TAQA 2OPQB 1XC9A 2MSTA 4ILMA 4LRBA 1U8SA 4OX7A 2VJUA 1KHWA 5CYMB 4MIAA 2WZ1A 1HWJA 4GC6A 3EGWB 4NLUA 3C15A 1NK5A 4L74A 2R3VA 4OX9F 4DU7A 3G82B 2H3EB 3PJ9A 4H4KC 1WTFA 4ZIVA 1UZHA 2J5AA 3SV4A 4DV2J 4ES3A 4DDFA 2Y1JA 1PO6A 3PRBA 3OV7A 2KHCA 2XEXA 5J2PB 1OMSA 5KG7A 5B7WA 4A8YA 3M8PA 1FRKA 3MWBA 4ZJOA 4ED2A 3OL8A 2HFVA 3SFGA 2V68A 3D66A 3DRRB 4DXLA 2IJRA 3VAJA 2CKWA 3QATA 4LSZB 3WDOA 1JXVA 2DY1A 4QWBA 2ZNYA 1NH7A 2C3PA 2VQFF 4RBTA 4LJMA 4HEA9 3TQ1A 2HHVA 2PEHA 1SC4B 3W64A 2ZBQA 3VZHA 3MM5B 1T02A 2CQ4A 2P6SA 2LP4A 3POTA 4PXCA 2GJFA 5C2GA 1EP4B 4AQYF 1YDLA 2C3YA 3DDNA 2VPWB 4JI8J 3O2IA 3IWXA 4USKA 3UQSA 1RBOB 2ADCA 3KMQA 2HHWA 5H1SV 3KJFB 1S7IA 4DV6F 4D3HA 2IYGA 4ZVGA 4LFAJ 5L39A 3UR0A 1P1LA 1QD1A 3PIOQ 2D3OR 1FVSA 2QFIA 2BJ1A 3BGRA 1LXNA 2H48B 3NS7B 4KC5A 1U1MA 1S10A 2UUBF 1JLFB 1DHMA 2E1PA 2RUGA 2XMJA 2H5IB 2ZBRA 5D8HB 4OZNA 4B9UA 3R5AA 2IRXA 1ZZFA 2G2YA 1TVRA 3UDVA 3KG4A 3KLHB 2UXDF 2YWKA 4ZCIA 4DV2F 2VFTA 4N76A 2HAIA 2HZAA 1FX4A 1QAIA 3QLHA 4C9DA 3MMAB 1DY3A 1KQFB 1WKKA 2VC0A 4LF6F 2QLBB 4AL5A 1FRLA 2LXIA 4MKYA 2VBWA 5JMNA 4DSLA 3US5A 4H4MB 5L1LA 4AL7A 4OYAA 1UVJA 3MEKA 4ZOSA 3I96A 2YX1A 3FZBA 3M2RB 2B9WA 1X9SA 1VQNS 3DGVA 1T11A 4F02A 3KUGA 2P5VA 3A1YG 2X7IA 4URGA 2QA2A 4JI4J 3UN3A 4LT6A 1UFWA 3B4DA 3EVWA 5CHCB 1ITPA 4ZVEA 4DUZJ 2UUWA 3CNQP 2OSRA 3NRBA 3CTRA 4O3OA 3L95X 2HQFA 1HNIA 5GAGU 4C3LA 4X66J 3Q8PB 4CH1A 4Q8FA 3MPDA 5IZHA 1K44A 3AHPA 1NDLA 1VJQA 3BS9A 4ATNA 5KFKA 3HK2A 3CCZA 2JJ4D 3M8WA 3L3CA 1WKJA 2YH0A 4DL4A 2DXEA 3LPEA 3M1VA 2A10A 2VPXB 3D3BJ 4IYQA 3TJ9A 4NLSA 1GH8A 2F9JA 3ZZOA 4CZCA 3BDPA 1CLFA 1SKUB 5DQHA 3EGNA 4IH5A 5F8MA 1S6UA 1Q78A 3NBPB 2OHDA 1T3OA 1LWCA 3UD5A 5J2MA 2EFVA 4DF4A 3NNHA 2W4DA 3MURP 2YWHA 1NSKL 3M7VA 2IBKA 1BLUA 2YNGA 3K8WA 3MPYA 5IM0A 3FEZA 5B0AA 1LWCB 3GJSB 3LGHA 4DX6A 2MGZB 2HHUA 5EUHA 3F0NA 3EX7B 2XLJA 2GMHA 1DTQB 2F5GA 3V2UC 3DXSX 2V67A 4LRDA 4MJKA 3T9ZA 4Q45A 1EX8A 5LSOA 1DARA 3GE9A 4B3SJ 2CJAA 3MXHP 1KVKA 1UMJA 5C25A 3CPWR 3Q24A 1HWUA 2MKIA 3GYXB 2UVRA 3JS9A 3NAIA 3DOLA 2GO9A 2XYPB 1YG0A 4EO8A 1RTIA 2YNHA 4C2MA 1R8CA 3BH6B 4K50A 4I2PA 3TWZA 5IT9U 1KWMA 3EGZA 1LWFB 4WF9Q 4MIBA 2B4UA 1VRTA 3CVKA 2DYAA 2HNDA 1H38A 1TMJA 2MQ8A 3PCOB 5H9EK 4DBQA 1SQFA 4DL7A 3Q0AA 5JVHQ 4KO0A 3W1YC 4PXDA 4GO5X 5C7PA 4LF2A 4EI2A 2OAUA 1T95A 5DZ6A 3SIPB 1WSRA 2C1EB 2X1BA 4N56A 2OPRB 2XO7A 1S4FA 2AJ0A 1FE0A 2DGUA 4OLOA 3OFFA 1FEHA 2ZITA 3KHRA 3TNVA 2AYBA 3R5GA 4IFYB 3KK1B 3MR3A 2B56A 2OEKA 2J9DA 5ETQA 4EK2A 2MGZA 2D74B 1R6VA 2ZKTA 4DUYJ 1S0MA 2FHKA 2E9ZA 5KG6A 1OWXA 2F3JA 3RB4A 2IC3B 2XM3A 2XBPA 4DV1J 4DR4J 3KLEB 3IFEA 1RTHA 2M8HA 1W2BR 1RT1A 2COLA 3AA8A 4PG6A 2F1FA 1WDTA 3A8EA 3UVJB 3K89A 4N47A 1QVFR 4FYXB 2ZOMA 3W2VA 3FEYB 3MM9B 1J5OA 1KSPA 1HBOB 2K3IA 5EHHA 4J9RA 4LFCF 3LH2S 1X5TA 2RAQA 1I94F 1XK8A 4YMEA 1X4AA 3PZPA 2F8EX 3E8OA 4X64J 2RS2A 3J80Y 2WB4A 2KM8B 1VQYA 3DRPB 3VWSA 3N5BA 3ZNJ1 1U45A 5K14B 4PG5A 2A1BA 2QL5B 3W61A 1C1BA 2AJ2A 4B9VA 3IR7B 4RUHA 3GV5B 2VBYA 2PO4A 3ENWA 2BJDA 1G4CA 4PWUA 3EM1A 4XO0A 3H25A 2YKAA 1WC4A 2Z2YB 2XI3A 2LEPA 2IVMA 4ED8A 3DDIA 1ZAWA 1D9AA 1F0XA 3BEGB 1TL1B 4A8FA 2HBZB 4M5KA 4TXSA 4URSA 3MR5A 4DSJA 2IVYA 3QO9A 2RRAA 1OPIA 3D67A 1XEZA 2E1MC 2I9SA 1TV6A 4DS4A 3CMQA 1U1RA 1D0EA 5A0YB 4EYIB 1RADB 2FVRA 1WTBA 3TUJC 3P96A 4BWMA 3RUBL 2KT2A 3M8YA 4WP8A 4K5RA 2W2OP 1R89A 1NLKL 2E5LJ 2NXEA 3R3TA 1U6FA 5KFTA 4A8OA 4U95A 4UZCA 2W8LA 5A8WA 1SC6A 3LO3A 3MMAA 1BQNB 4CLKA 2CVIA 3RBDA 2HHSA 2PFDA 5CQGA 3J7YU 1H74A 3NWRA 4CP5A 2DGQA 4IRKA 4HHUA 3N4WA 1XNRJ 3FC9A 2R8GA 4MK7A 2YVSA 4NOHA 4CIOA 2JWNA 2V2KA 3RB0A 3AJ2A 1C1BB 3NWGA 4RWWA 5F3TA 3ULHA 4EMDA 5KG4A 2JC0A 3HFZB 3CJ4A 4ZKAA 4ZHRB 2DVIA 2UUAF 3HJFA 3CCLS 2C3UA 3MGJA 4P6QA 3U02A 4DQQA 1YJ7A 1V3SA 2YNIB 4ED0A 1L3KA 2C42A 4ZHRA 5CYMA 3BPDA 2ZC4A 3BSCA 4ED7A 3MOZA 2LU2A 2HBYB 2DK2A 3LANA 4FS2A 4LF5J 4KHPF 2AHOB 3QWPA 1HBNB 3FCWA 3H8YA 3HHLB 3NL0A 2PN6A 4AXIA 3I32A 1VBZA 1SV5A 4V19J 1IJEB 1T0TV 4DV7F 1IBLF 1RAOA 2OELA 3RR7A 2GCFA 2HS0A 4B08A 2H4WB 2GVZA 2K7KA 2WSFC 4FDFA 4YEAA 4ANCA 2ACYA 3I87A 4OHZA 3AFGA 1ZM2A 2E29A 1N0UA 2I5JB 3MEDB 4OL8A 1FDBA 1U49A 2X3DA 3CE8A 5D78A 4YR2A 3K58A 1T94A 4FNHA 5A0YA 1PJ7A 1Q79A 1N56A 2IIHA 3DRRA 2DR9A 2XMUA 4FF1A 3HSJA 2XQCA 4YDXA 3KUEA 3ENQA 1AROP 1A7GE 2BBEA 2BM0A 2K2PA 1R0AB 2BRLA 4NLGA 3K2YA 3QMQA 5LT5A 2PA8D 4KR0B 3OL7A 1T03B 4O3PA 5HMWA 1RWXB 3CO0P 3OT9A 1ACMB 2RKIB 5DDQC 3T3FA 2B8QA 3RRGA 5HVFA 3CUNA 2CQIA 3DKDA 4C4WA 2AJ1A 3KDNA 4OI3A 1REVB 2V4JA 3N01A 3PFOA 2QT7A 2J6SA 1KLMA 2M5YA 2B6AB 1EKRA 2BM1A 2HRUA 4CI0B 2DO0A 5EWGA 4P71A 3D6TB 1IWGA 4YB5A 2R8JA 4FKXA 4DR5F 1C0UB 1U2FA 3ICLA 1M1GA 3CB4A 2N82B 2E5JA 5GMEA 4ECRA 3IGNA 4OHXA 4H4OA 3UVJA 1S1XA 5CA5A 2DR6A 3D1QA 3MTKA 1I6JA 3TX0A 4I69A 1EZZB 3IBCB 2HURA 1URNA 1RHQB 5F9LA 1VR6A 1U7LA 4RO0A 1T05A 5J2QA 4WIQA 2YBVA 2DHXA 1D8ZA 4QR1A 4CNZA 3W5ZA 3R9LA 1C4AA 1WG5A 3AH6A 2DB1A 2FQQB 4IFYA 2DNRA 1SI9A 2OGUA 5HMYA 3OSNA 2RUSA 1UTAA 4QQBA 4DX7A 4XK8C 3S01A 3K59A 3D5MA 4DU8A 1SIWB 1I1GA 1T9VA 4QR0A 4KY3A 2UV8G 1LWEA 2W9CB 1B3TA 5T14A 3D1OA 3RB6A 5KFWA 1S72S 4NXMF 4OZLA 1U4BA 1YJUA 4ED6A 1P1TA 5B0CA 3UN5A 1K8AT 2YQ1A 2V8PA 1NPRA 2OFGX 2KRBA 2CPJA 4DV0J 4DX8H 3MFHA 1AUDA 1Q5YA 7FDRA 2Z57B 1Y9OA 2P9EA 4F25A 2BJ8A 2F7VA 3HP6A 1VBYA 4RNNA 3I82A 2J0SD 1KKHA 3CDUA 5KAKA 3GP9A 5HATA 4JI5F 1Z1ZA 3BSAA 4OLPA 1FKAF 1YRUA 4R5PB 3DOMB 2H9ZA 4C8ZA 4ES1A 5F8HA 3IGVA 2HGMA 1H3DA 3M2RA 1TAUA 3FBCA 3OSPA 1RT2B 3KHGA 3DHXA 2RF2A 3ZNUA 4WPAA 2VPYB 2J76E 3IN5A 2JRSA 1FNXH 2DNMA 2FPHX 2PEBA 1PILA 1NHVA 4CYUB 2WAQD 2V8GA 1Q95G 4WU2A 6AT1B 4DL2A 1QSLA 5DG8A 3M30A 1N6QA 2G0IA 3PACA 4F0KA 2AEMA 5LM7E 1FRMA 4KKOB 1QUVA 1I94J 4ZVUB 5DETA 2ASJA 1OSCA 4J9UE 3R7SB 4A8SA 4CT8A 1Q81T 4JI8F 4DSKA 4TLRA 4Q43A 1ZTTA 3RU0A 4OYXA 3UDLA 3HT0A 3OD2A 4FVCA 4UQGA 5AE2A 3NP5A 1RA6A 3ZO7A 1UA1A 1ZBTA 2Z56B 3GU0A 4ZLPA 4DSFA 2BXJA 1VQSA 3VAKA 1UVNA 1M1HA 2KT5A 2BV3A 1AT1B 1SPBP 3RAQA 3I5CA 3RBEA 5DGBA 2PI5A 4M1KA 1NSAA 2CQGA 5E0OA 2WTFA 5HLFB 1E6YB 3NS5A 4P2XA 4EBDA 4PYDA 1IBMF 1TKTA 1FF2A 3GZ7A 3QT6A 1XMBA 3QAEA 2IAJA 2RHQB 1TUWA 1VISA 2I38A 3S7RA 3PEJA 4QWDA 1D9FA 3H20A 2GJ2A 3Q89A 2NPIA 4LVNP 4O4GA 1C0UA 1S1WA 3QYYA 4X4SA 3GTYX 4XDDA 3W9HA 4C7QA 3DOKA 4OYMA 4RR5A 4Y2KA 2ROGA 1HI0P 1JXLA 3TUZC 4U6PA 1S6QB 5KFDA 3F73A 1PYOB 2B4OA 4PQUB 4TLQA 1F3VA 4CO2A 1RBAA 3PKMA 1RTDB 2ASLA 2DBBA 2ALYB 2HQGA 3M8PB 1XERA 4NLQA 4DV6J 1JLQA 2R7QA 2MKYA 1IKXB 2QYGA 4IR9A 2D3UA 3UI3A 2IMWP 4F26A 1G2EA 4NXMJ 2RHSB 3BJYA 4B3RF 1Y00A 4WFBQ 3Q8SB 5KFFA 1NBEB 2H5JB 2MKJA 4W98A 4RLEA 2QFJA 1X9MA 2XY6A 2E5LF 2YX7A 4M5MA 4JI6F 1G1XA 4ICLA 1R0AA 5J1EB 3I4PA 3MM6B 1A9NB 2OLWA 2RQKA 4LRFA 1WC1A 1F2GA 5ETLA 4WKRA 1EJ7L 3SV3A 3MM7A 2K7JA 1XJWB 4NYZA 3L7PA 1RI7A 2KZMA 3HM9A 1NHUA 1Q8LA 5ETMA 4JI2F 1DLOA 2LQ8A 4ZJQA 1FWLA 2RSQA 2ZDOA 4OYZA 2V0NA 2KJWA 5ETSA 5IFMA 4X62J 1SKSA 1NCLA 2CZ9A 1U25A 3W7BA 4NLPA 3VR1A 3O3LA 1HWIA 1SJ3P 3B82A 4IQMA 1RTJB 2PIIA 1AUSL 2VG6B 2FJDB 4YUDA 3NGTA 4UUWA 3N6MA 4U8VA 3JSMB 2FB0A 2L41A 5KFRA 1H2UX 2HQDA 1GX5A 2HRTA 3QQCD 5KFBA 3V81A 1DRZA 4NE9C 2L9NA 4ZP9A 3NGSA 5FIIA 4USVA 4C8MA 3U1NA 3NGDA 1F6TA 3I4HX 2H65B 2JEIA 5RUBA 3K57A 1XR6A 2ILYA 1Z2LA 2BJ9A 5D3GA 3T19A 1B70B 4MT1A 4CH0S 4ICLB 2CDQA 4RZRA 2C2ZB 2VC1A 3TZWA 2RDJA 1KOOA 4KHPJ 3JSYA 4NX9A 1FKPB 4B17A 3LWMA 1RT7B 4QIEA 2GC8A 5AXKA 1YBUA 1XNQF 1PAEX 2PDAA 1FO1A 3QAUA 2XSJA 1B0TA 1BQNA 1W7WA 4OI1A 5J1NA 3I31A 2HAFA 1T8EA 3HF5A 1RABB 1VRUB 2ZUGA 1RAJA 3P3DA 1JLCA 4B9NA 2QGFB 2CUYA 4DPWA 3ONQA 4KE5A 1ZAVA 2H5EA 1RT6B 3R6GB 1XNRF 2F4FA 1IKVB 5AJ3F 3MI7X 2JH3A 2QMUB 1F9HA 4PPDA 4EBEA 3QRQA 1S9GB 4NLRA 4R0JA 2B4PA 4RU2A 1VQ9S 3WZ0A 3ZTRA 2DGWA 1CQNA 1WC3A 4AUKA 3C8YA 3FQLA 1HWKA 1HWLA 4GC7A 2KL8A 3UE2A 4ZP6A 2UUBJ 4PXEA 1R7IA 2WOMA 2F4VF 2HKEA 4KV8A 4Y65A 3PVXA 2J0WA 4OX6A 2J9CA 3MMCB 3P49B 4OQJA 3DDKA 2HNYA 3CD5A 3DYAB 2BACA 3HHDA 3PY8A 3IBWA 5IT4A 3SSRA 1IKVA 5LSLA 4DN0A 1OY6A 1VOMA
chains in the Genus database with same CATH topology
3FZ2A 3IRXA 2BZ2A 1R8BA 1XTZA 3KNAA 1WD6A 1WHVA 1YTYA 2UXBF 4LSLA 4XPCA 3M8SA 3F44A 3MD1A 4IFVB 2XHWA 4NL5A 3GFHA 3OL9A 4X65F 1WF0A 2OJ3A 2XMWA 2VL1A 2ZH8A 1FJ7A 4X4UA 3NMRA 2IBOA 2X1GA 4R8UB 3OPKA 5A6PA 2BYCA 2WB1D 1S49A 3PDNA 4JV5F 4IG0B 1HYSA 2V8VA 2HNZA 3VZIA 4A4JA 1QY7A 3MEGA 4DG1A 1Y5IB 2F40A 2XB2D 2M70A 3V4IB 2C2RA 1HNWF 1U24A 2M52A 5K8MA 2YNFA 2VPZB 1CG2A 1DBDA 2N3LA 2VG6A 5L38A 2XY7A 3I56S 1TKXA 4X64F 4OV1A 4ECQA 3OR2B 1JLEA 4ED3A 3RZAA 1GX6A 1APSA 1Y0HA 4UUXA 5DLGA 1VBXA 2CZ4A 3R1HA 3B4MA 4B3MF 4OHVA 2FUG9 2L08A 4J37A 1F60B 4M63A 3C66A 2JLFA 1JIHA 2BDPA 1DZ5A 1TL3B 4W90B 2GMLA 1FTRA 4RW7A 2V8HA 1UL3A 3UWTA 5KFOA 3NBPA 1HHTP 1O8BA 1JLBB 2VG7A 2K1RA 1JWWA 4YB6A 4CNYA 2AD9A 5BYSA 4ECXA 1URRA 1VQ4S 3PNIA 3EUNA 1RK8A 1UAWA 3PW2A 1TK5A 4JV0A 4DWIA 4JBCA 2WOMB 4J9SA 2AYGA 1K1QA 2CG4A 3RAMA 4DR1F 4HI1A 4FVMA 2R7XA 1FJCA 4ED1A 3PHEA 3HX9A 4F4ZA 3RW7A 1ZOTA 2VOOA 1C1CB 5K5MA 1VQ7S 1V3ZA 2ZHOA 1RT5A 4Q44A 3UD3P 1PC5A 1YJTA 2IMOA 2DHSA 4RW6A 4YOEA 3I0SB 3PV8A 2BQUA 1KNZA 3ZZ0A 2G1DA 2DRBA 5IS2A 2MJNA 3GR0A 2MKCA 1UWBB 4QPXA 2NR0A 1KONA 3AY0A 3MECA 4H4MA 2OKQA 1A6LA 1NO8A 2EBEA 2LKZA 4K4VA 1NKBA 5T7LB 1MMDA 2LYVA 2M9KA 3R5DA 4Z37A 2AGOA 2VFUA 3OXGA 3CC7S 3GFZA 2OPPA 2FVSA 4OI6A 2RJZA 2PMHA 3Q8RB 4WCEQ 1YJVA 2KRRA 1AXQA 1TVRB 3VQSA 5B09A 3OHAA 4I67A 1LQ9A 3PRDA 4J9NA 3PO5A 5LSRA 2EPIA 4DV4F 1FHTA 2FLNA 3ZZTA 1Y3KA 1KFSA 3KLIA 2WW8A 2ADBA 3IG1A 4IKAA 2EFPA 2FTRA 2VUGA 2AYEA 3DLKA 3IAS9 3MEEB 4B02A 3HI9A 3THPA 2M88A 2W7OA 1M5KC 2JL9A 3MTJA 2ZJPQ 4A8MP 1R3NA 1ZTWA 1HBMB 3GIIA 1RGVA 1YJRA 3MDFA 2HHHF 3IO1A 1UJ4A 1LV5A 2DGTA 4DV0F 4OMFG 2J6UA 2XMVA 2N4DA 3OL6A 3T5LA 2JEIA 5KFCA 1U26A 4DV1F 1NK6A 5ITHA 4RUCA 2EWHA 4I64A 4MK8A 1D9DA 4FF4A 1H0HB 1KS2A 1C4CA 4IO1A 2UXCF 1BD6A 2UV8A 5GADI 4G3IA 2HS4A 4QIVA 2LA4A 1R6YA 3M05A 1RTDA 1JMTA 5I3UA 2FGOA 4G1QB 2HMIB 5G4DA 5HN0A 4GKJF 3T6BA 4G1PA 3DOKB 1T05B 1C2PA 1RT4A 2ABYA 4NLDA 2QO3A 3ISND 3T9NA 3CCTA 2RQMA 3KLFA 4QWEA 2BOPA 2CPFA 3M2VB 4Q2LA 3OUYA 3DRSB 1DJ0A 3DMJA 4ETZA 2X3GA 4KRWA 4JOUA 1JLBA 4WTYA 5L1JA 2VQEF 2DR7A 2VFVA 2GW8A 2LDIA 2XWYA 2ZE2B 1NK7A 1JJ4A 1XBWA 5H9FJ 1VRUA 3GQCA 4MMOA 3DM2A 1S97A 1XR7A 4BHQA 5KFHA 4FN5A 2VB6A 4ECVA 1G3OA 1UA0A 1T03A 2CQ2A 4J9KA 5F41A 3CD6S 2ZH2A 2DD8S 1H98A 4C98A 3OVSA 2MDAA 2ALZA 2FGCA 2OPRA 4EZ6A 1W2IA 2CJQA 2P9CA 4EZ9A 1HNXF 4FXDA 4KAIA 3KMSA 1EETB 1V9OA 3VAFA 2D7SA 4OJ3A 2KXFA 3U1MA 3CD0A 3N9UC 4NLOA 4XAKA 3CWJA 4CO5A 1H7WA 5KFNA 1S0OA 4LF5F 5FJ4A 5E2QA 2DRAA 3CCUS 3DM2B 5F3ZA 2L3MA 1U1KA 2M2BA 3MR2A 4NA1A 3BGFA 4C11A 1X4GA 5KFYA 2O1PA 2BR0A 4ZPBA 3NCPA 3QGHA 3HHNB 1NRKA 2DISA 3WBZA 2Z2LA 4WXWA 1ZAXA 2DNLA 1P8GA 2QA4S 2RT3A 3P5TL 4X4NA 1WHYA 3MM6A 4FXVA 1DAXA 1UVMA 2AWZA 4N5SA 4DLGA 2KFNA 3LF0A 2YNGB 1ZM4A 4BDPA 2ZZNA 3IRXB 2A18A 2Y0SD 1Q16B 3IWNC 3GG0A 4QYRA 1RKIA 2QIFA 4XDCA 3VF0B 4HH0A 4E98A 5BYQA 1KQSR 2RB7A 2PA3A 3HT3A 2DIUA 4DR7F 3AB2B 1AFIA 3MZIA 3CEDA 5FLXY 2DH8A 2FHOB 2KN4A 4DV3F 3V6DA 1HD1A 1FESA 4KGKA 1R8AA 3H5YA 4QBUA 3DLBA 2F8MA 4O23A 4F3OA 2VONA 4QU7A 5HROB 1E6YA 2VH7A 3F56A 2IVFB 2WSCC 4UY8T 1HI8A 4DR3F 3DLJA 4ILRA 2YKNB 1LK7A 5I42A 1VQLS 2HYIB 3EPIA 2HHXA 5A8KB 1GNKA 4YR0A 3S1TA 2KH9A 4DF8A 1M5HA 3IG1B 2XMMA 2V9WA 3UCGA 1B0VA 2J8AA 3DLGB 5KFVA 3GG1A 4QW9A 3NCQA 2XSJB 4ILLA 1JJHA 4ZCLA 3KK2B 4P2SA 1RT7A 3HHLD 1FKPA 2DH7A 5G0RA 2B9YA 2CFXA 3DLLQ 4WK1A 3MPVA 2QEXS 3SSSA 2BQ3A 1RTHB 2LLZA 3BREA 3SYZA 2DNYA 3KLEA 2VV5A 4O3RA 1TL4A 4EU0A 2B3TB 5C5JA 1HFEL 2K8GA 4BC9A 3LP1B 4U9RA 4ZPAA 1UVIA 3MEDA 2YWEA 2JLGA 2AV5A 1RA7A 2E9RX 2X51A 2AF6A 2FIUA 3FRYA 2C3MA 4DS5A 1JLGB 3BF4A 2QRRA 5CCLA 2F9DA 2LEBA 5HBMB 3OQ2A 2W7AA 4DOZA 5A8KA 3G6VA 4HTIA 4R5PA 1S9EB 2DNGA 3C2PA 3LPYA 2XGPA 3IS9B 3CO9A 3RR8A 1IXKA 4QIWD 3K5PA 2ZE2A 2WONA 4GMKA 2EBGA 2PSZA 2KHDA 4ID5A 4ZK7M 1K9MT 4NLTA 3DMJB 3HVRA 5J1PA 1U1PA 3DU6A 1HQEA 4AL6A 1HD0A 3DLEB 4RNMA 4Q0BA 1JK9B 4QIFA 4MFBB 4RW8B 5J1EA 1NAQA 2YWFA 5M2UA 5DDPC 3V6DB 1SKWA 2NUUG 1NEEA 2EVZA 1JNZB 2B43A 2EFGA 2QZ8A 3M9OB 1U1LA 2E5LF 4DR6F 4I6YA 2R7TA 4LQ9A 4WFYA 5D4LA 2FDNA 4K4TA 4Y00A 4URQU 1IKXA 2EI5A 5DDRC 2R7WA 3QGIA 1C0TB 4H4KA 4PQUA 3KFWX 3IR6B 1TKDA 5B0BA 1FRHA 4B3OB 4Y3CA 2CVEA 4IRDA 5C42B 2XS5A 3JSRA 2JHEA 4PRFA 4MKAA 2ZFHA 3CT9A 3BM7A 3LOUA 1MNEA 4YR3A 1HMVB 2FLOA 1MU2B 2V4QA 2LA6A 3PX4A 3HHLC 5B0DA 4LSNB 1FK9A 1JNRB 5M2PA 1X9WA 3PO4A 2L48A 4AXJA 3SQGA 2A2CA 1KQKA 1NZAA 4A46A 3EZ5A 1FRIA 2JOQA 3SCJE 4X66F 2GHVC 1AFJA 4C8KA 4G6VB 4E0DA 4ECYA 2NS1B 3KLIB 3BSNA 2GNKA 3CMES 4KHMA 1O0PA 5A8RA 4PUOA 1TKZB 2LQJA 3H5UA 3HVWA 5DM7Q 4IDKA 4J9OA 4AE5A 3GR1A 4CO0A 2N7YA 5HP1B 2YTCA 3KJVB 5L9NA 1RT1B 4RX6A 4LQ3A 2BABA 3QIPA 4NZ6A 1NKCA 2ZBIA 2PMZD 2GJIA 4B3TF 4J9LA 2VODA 4C8NA 4TQRA 2VBZA 4HKQA 2DNZA 2RF2B 2DO4A 1KLNA 3G8QA 1HW9A 5F8GA 1NJXA 2AW0A 2M0GB 2GFFA 1M5VC 2E7XA 2VASA 2AU0A 3I0SA 3NNCA 4M94A 2R2UA 1UKUA 1Q1KA 3FNNA 3N0VA 4J5OA 3TYTA 5A8RB 2R4FA 3DRSA 4OHWA 4PUOB 3RW6A 2MMYA 3D0GE 3NGKA 4U7UK 4A48A 4RNOA 2J7UA 3KLFB 3R5CA 4J9MA 5HROA 5DDOC 1WG1A 2OD6A 4C97A 2LXFA 2KZZA 4EYHB 5D77A 4IRCA 4HT7A 3MPWA 4NCAA 4NCBA 1EP4A 2MZTA 1LXJA 3BQ1A 1LWEB 2B51A 1HNVB 2BVZA 2QSFA 2A2DA 3HLUA 5L1IA 1SL1A 4ECUA 1DTQA 1LW2B 1FKOB 4HVZA 2CPYA 4C0HA 4RUAA 4F4KA 4RNHA 5JVGQ 2W9BA 1P9QC 1F5AA 4WYWA 1GXLA 3GMGA 4G1IA 3U27A 1D3WA 4JV2A 1JLCB 2Z8QA 3T1AA 2CYYA 1TL1A 5I4MA 2BANA 3NS6A 3CCRS 2LQBA 1WHXA 5KFEA 4C8LA 2R7SA 2KM8C 1UVLA 2BE2A 4QWAA 3T5JA 4WFAQ 1H7XA 1CC7A 3V6HA 3UCUP 2XCAA 1S6PB 5D3GB 2Y1IA 1N88A 3DRXA 1TFYA 2J6TA 4OI0A 3H5XA 1CEZA 3CJ5A 2IM2A 2ZBCA 2WONB 4USHA 1KTVA 4IOCQ 4ECTA 2RVJA 1QM9A 1N8RT 2HLUA 1S9EA 3TRGA 4UY85 4KSEB 3TA0A 4KQZA 2K3KA 3UPFA 2UU9F 1NJYA 2VZ9A 1XN9A 1S7HA 3HVTB 5IT9Y 4B9LA 3J81Y 4NXNF 1RYRA 2BJEA 4DJBA 2C2EA 2DR8A 1VK3A 2OFHX 2JDJA 4HLBA 4UW2A 2CQ1A 3MM7B 1NJZA 1OO0B 5CYQB 4DFMA 3G6ES 2UUTA 1SV5B 1S48A 3GILA 1U6BA 1FJEB 2R7UA 4IOAQ 1VLYA 1T7PA 4F2RA 1JLQB 3BDEA 4BWJA 3G8TA 2F8HA 2QE5A 4ES2A 3N6NA 3N5FA 4K0KF 3C6UA 4HL9A 3ZFVA 1S6QA 4JI3F 1SIZA 1IN0A 1RJJA 4KV8B 2Z2MA 5J2NB 1UEUA 1HA1A 3CULA 2ZJRQ 4WIIA 2ZC3A 1G6BA 4USJC 2FLLA 2C22A 3HKWA 4OJGA 3IR5B 4PCQA 3FCHA 5L9XA 3SEOA 3QIDA 5GVQA 1TKTB 4NPOA 3QJLA 2CQCA 2K1RB 3WC0A 3ZZZA 4ETXA 3H40A 4BS2A 3MUMP 4X2BA 1M90T 3J7YI 3MMBB 1TQLA 2CJBA 4I68A 2HZCA 2ZH4A 2Z0GA 2CPDA 5LXYA 3MAQA 4QIGA 1HI1A 4F4XA 3QO9B 3HMJG 3CXCR 1D1UA 2KYXA 4DN9A 3O6QA 1V3RA 4LF8F 7FD1A 3I9ZA 1UVKA 2LQ5A 3OJUA 1LKZA 3FEXB 1X8DA 2W4CA 2OTLS 3KOAA 3KLGA 1TKXB 5LMUF 2EKYA 1N6QB 3CCES 1BQXA 3CCQS 4U7CA 1ZETA 2EFNA 2PE8A 4Y2CA 4XPEA 2RS8A 4QCLA 4PG8A 2MQLA 3ISNC 2LU1A 1HNZF 4OZ1A 3IC1A 2XMTA 4GO7X 2ZH1A 3BO3A 3C46A 2BRKA 3R5BA 3W2VB 2ATLA 4TQSA 5GAEI 3X1LB 3P6YC 1KD1T 4C11B 5DJBA 1RTJA 1MW7A 3OR1B 1MROA 2CQBA 2IC3A 2MHNA 3GB0A 3H98A 1SJ4P 4DQPA 2B5JB 4RW4A 2P9GA 2FHMA 3EPGA 2O5DA 4HHJA 2ZJQQ 3KK1A 3QLHB 2EFQA 1RDRA 1SJRA 2C2DA 4WK3A 1IQZA 2NSCA 5AE1A 2ZH9A 3G86A 3M6XA 2XCPA 3BGUA 3KG0A 1QLNA 2UVVA 3L7OA 1OQ3A 1T3NA 5IWAF 4HDGA 1ROFA 4O4RA 2GGPA 2KDOA 4FBUA 4QOTA 1R8HA 2LQ9A 3FSIA 2MKSA 3T1YF 1FXRA 1CPZA 3C6TB 3HKZD 4CO3A 1JX4A 3C3LA 3NLCA 4CH7A 1X5OA 2ASDA 4LMZA 2QSWA 2MQQA 4F4WA 1ZM3A 3KYLA 1MSWD 3M9MB 3CD7A 2PI4A 2CPXA 3HDSA 4I6AA 1KOHA 3Q23A 1MROB 1S0NA 5KT3A 4J9QA 3OR1A 3U7JA 5CD4H 2HFOA 4ELTA 1UP1A 1Q86T 3VAIA 3ZZRA 1B0PA 1MU2A 3DHWC 1S1XB 4MH8A 2GA7A 2JFDA 4YY3F 3G96A 3T1HF 3W2WB 4TYAA 3RAXA 1XMQF 5KFIA 4A47A 2KB2A 3FJ2A 3F41A 1O5JA 2RE1A 4NLWA 1TK0A 1PGZA 4ZVHA 2HQIA 4B3OA 1X7VA 3AQPA 2QA1A 4ZPDA 4G1QA 4ECWA 3CCJS 5HO4A 1K73T 1N0VC 2JEFA 4K4SA 5J2MB 2HWTA 1RQ0A 4LIWA 4RU9A 3MFIA 3T5HA 3AB4B 1U49A 2XS7A 3MM8B 1PC4A 4IO9Q 4Q5VA 2KFZA 2RU3A 2OIHA 4B9SA 1U1QA