3DOMB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
b'ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 17
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3domB00
3DOMB 2JNJA 3DGPB 1YDLA
chains in the Genus database with same CATH superfamily
2LP4A 2YNGB 1U1LA 3DLEA 3M32B 4P9SA 4HI1A 4MYTA 2MGZB 2QJ3A 4XAKA 2SXLA 1KHWA 1TUWA 3K5LA 3HHLC 4CO3A 4AL6A 2CIMA 2B9EA 5A8RA 1GX6A 1N5YA 1VQ4S 2GZOA 1S6QA 1Z2ZA 2MGZA 4Y2AA 5IZHA 2BVZA 4Z37A 4MK7A 2RMLA 2Z57B 2KJVA 1HNXJ 1FWKA 4NYPA 1NDLA 2DNQA 3UDEA 1RT6B 5HK4A 2ILYA 2FY1A 3UCUP 1LQ9A 3CMQA 1IM6A 3R5BA 1DLOA 3WIVA 5KG4A 3PVXA 2YNIB 2JEJA 2WCXA 3SQGB 4I0WA 3GIKA 1HNZF 4OHZA 1FEHA 4WYLA 3OBIA 2OPRA 1HI8A 4FNIA 4NPOA 4WFXA 1T9UA 3KG0A 1P6TA 4NE9C 3UWTA 3PACA 2YNIA 3M1VA 5GADU 1NK4A 3MEDA 2MEWA 3CCQS 2AKWB 2VOOA 1Q4RA 4JI6F 1TL4A 5KFBA 2QFIA 5H9EJ 2PEBA 1VRQC 1U47A 2CADA 1VBKA 2CPXA 1S1TA 4C4WA 3BGFA 3CE8A 1RT3B 2DBBA 2OMLA 4V1Ak 2R8IA 1M5OC 2DNHA 5HATA 2DGVA 2PMZD 5CYJA 2MHEA 4PWDA 4CO4A 2UUBJ 2OP5A 1T9WA 1SJFA 4ZHRA 2G0IA 2V8PA 3TO8A 2ZUGA 3K8WA 3RG6A 3E01A 4YFUA 5E3RA 2BV3A 2E7XA 2V68A 2WSCC 3LOUA 2HPUA 3KHGA 5CXTA 2GS8A 3EYZA 4OYBA 1FVSA 3FEZA 4MIAA 4C97A 2CQ4A 3A4TA 4DSKA 1U48A 1V3RA 3UCZP 2COLA 3KLEA 1U6BA 1IR0A 3PR5B 4A8QA 1RTZA 4EGLA 1CJUA 1G1XA 3R5CA 5F3TA 3W5XA 2LVWA 2RQKA 3PKMA 4B9LA 4H54A 2IBOA 4R0JA 2KVQE 4N8OA 2XQCA 1LV5A 1K0TA 3PYGA 1VBZA 4JP8A 5D8HB 2W24A 3TAQA 5EWGA 2YKAA 4M5HA 5L9XA 2W2QP 4CM0A 4A8WA 1YBTA 5GAHI 3J7YI 2HGNA 2UXDJ 3T1YF 4OFZA 2UXDF 1EKSA 4CLZA 5LSOA 1GX5A 1U24A 4V19J 2R7WA 2K1RB 4OV6A 1UKUA 4G1QA 4P2FA 4ANDA 2AV5A 5I3PA 2W7PA 3NS7B 2CWXA 4RW8A 4DSJA 2VICA 1RGVA 1JIHA 3MMCA 2HFOA 1TV6B 2K1RA 5KT5A 4OZ0A 4IR9A 2DHAA 2GFFA 3EDQB 3PW2A 2Z2YB 5CQGA 1FDDA 3HMJG 5HANA 2W7OA 4IUFA 5ETTA 1TV6A 2CPYA 1KDNA 1RWOB 4GVBA 1JMTA 2IRYA 1I94J 2VZ9A 3G96A 2HVZA 2QLBB 3LH2S 2B56A 3O8WA 3FQKA 2FC8A 1XMQJ 1AFIA 5HJXA 5AXKA 1XMQF 4ZLLA 3E2EA 3U1LA 1IBCB 3TA1A 5KFPA 2M3DA 1NZ8A 3J80U 2BZ2A 5AXMA 2O66A 3QZ7A 3ZC4A 2NQPA 1MG7A 4F7VA 4YN3B 2LQBA 1X0FA 4RJVA 2R2RA 1Y4ZB 5HLFA 3BYRA 4ZITA 2FDNA 1RKIA 2ZE2B 3MFIA 3CJ3A 1KEKA 3DGPB 1NKCA 4ECZA 3V4IB 3Q8SB 2VFSA 1PBAA 2F1FA 2ZE2A 3TZWA 1U0SA 3VV2B 5ETLA 4PWUA 3I9V9 1YJWS 3ILLA 2NUUG 4H4OB 1KS2A 1LEOA 2I8EA 4TXSA 4F36A 4B3SF 5FJ4A 3CJ0A 4PQAA 2RIJA 3T5KA 2EWHA 4NI2B 5I3UA 1K9MT 2R2SA 3HHEA 3MR6A 2W8KA 1U7LA 2BJ7A 2CA9A 2OPSA 1VQNS 4TY8B 1M5PC 2L08A 5L8RC 1SJQA 3KMQA 3BQ0A 2XMUA 3VAMA 2QE5A 2HSEB 4LQ9A 4TY8A 2IVMA 5E2QA 2XSFA 4WTOB 1BWEA 3ZZUA 4NA1A 2GAHC 4F04B 5L9NA 5HN0A 2YNFB 1P8GA 4QYZK 2BOPA 4OI1A 5KG1A 3D68A 1JLGA 2HS3A 2JZ5A 3AFGA 4ZOSA 1RCOB 2DR9A 5IQQA 4B3OB 4X4UA 1J27A 3HVAA 2YNFA 2FIUA 5G0RB 2E9TA 2CUYA 1D9FA 1CPZA 3RUBL 2E1PA 1FXRA 3AQPA 5T14A 4B3OA 1KQFB 3KDOA 4QOTA 4CLTA 2R7VA 4CLSA 3HCXA 1RUSA 1V9OA 3NS5A 4DCPB 4L75A 3DYAB 4YHHJ 3R7NB 4OHVA 4DL3A 2C2KB 3BGRA 3HPOA 1NJXA 2HHQA 2DNNA 4Q0BA 4LIWA 2ADBA 2IJNA 3V6KA 3QYYA 3DYAA 3AJ2A 4JV0A 3CDWA 3OT9A 1SBRA 3W7BA 2EC2A 3ZNUA 4U9RA 2QA4S 2QYGA 3HJVA 4ED6A 1Q5VA 3H40A 4USHA 1A7GE 4OYXA 4O3PA 2DNRA 1SUQB 1RWNB 2I2YA 3CSKA 2HGLA 1TK5A 5H9EK 2VDHA 5IS2A 2X1AA 4IFYA 1FWPA 4O44B 1SUQA 2NYHA 3J81Y 3PO5A 5KOXA 5F8GA 3KMSA 4IH6A 4DCOB 1RYSA 3M8WA 4DR1J 4K5SA 3KUEA 4CRJA 1SB6A 3O44A 1Z4UA 2R9LA 1S4EA 2P2CB 3DOLA 3L7OA 2CQBA 3NRBA 3E51A 4ZKAA 4DV0F 2V2QA 3ETOA 2QN6B 4ECVA 3MAQA 1OJ4A 3IN5A 2ZC4A 2FGOA 1TKXA 2UVWA 4Q45A 4UY85 1X4GA 3W2WB 1WF2A 1RHKB 1C4CA 5M2RA 2HZAA 1HYSA 3A1YG 2H54B 2KKHA 4IKAA 1TP7A 2QX0A 1FCAA 4WU2A 3CEDA 3DN9A 1YITS 2BE2A 3PJ9A 4KRWA 5B0BA 1MSWD 2PEHA 1F0XA 4DR7J 5HQ8A 7FD1A 2N4CA 1YX2A 2VBYA 1HPZA 4FF3A 1L3VA 4K4UA 1OSCA 3T3FA 1S6PA 4DL2A 1C0TA 3JQKA 3G82B 4RBVA 1H7WA 4J91A 2Y9HA 5H9FJ 4OZ2A 3DOKA 2GGPB 4PUOA 5J1PA 1MU2A 4E8UA 1X31C 1RT5B 1SKRA 3C2PA 2XC9A 4LSNB 2DK2A 2ZHBA 5D3GA 2IFXA 3K57A 2GGPA 1JLEB 3OUYA 4PXDA 4K4VA 1CJTA 4ZPWR 2E5JA 1VS3A 3ISZA 4RNHA 1IBKJ 3Q2TC 2RILA 4LSNA 1IBKF 3FGVA 4RUCA 3LALA 1NHKL 4LR7A 1RLDA 2QL5B 4TN2A 2QEXS 2BJ9A 1DURA 2BXJA 2WVEA 3VF0B 2VUGA 4O3OA 1TL1B 4QZVB 1DBDA 1H74A 2UV8G 3NAIA 2MDAA 3CC7S 1UWBA 3S8SA 3DM2B 3THPA 1Y11A 2F5GA 2I9SA 1NM2A 2MQOA 4IRCA 1SV5B 2BW2A 4ZCIA 3LGNA 3T1AA 4HDGA 1H72C 1W7WA 3F44A 3ZZZA 5ETVA 1IKWB 3DRSA 4ILMA 2ZOFA 3CT9A 3M9NB 2ERRA 1HA1A 2OJ3A 3AJDA 4WFAQ 2R4FA 2N7YA 3T6JA 2NPFA 2ZITA 4KHPJ 3D7SB 4PR6A 2UUCF 4KHPF 2MSTA 1SQFA 1QY7A 4Y0FA 2HBZB 3W64A 2M9KA 3W1YC 3LP2B 1FXLA 1VFJA 1UJ4A 3I4PA 2QA2A 4LSLB 5C25A 4DQRA 2HHWA 2RUSA 2O01C 2AW0A 4LSLA 2DGOA 3FKBA 3OXLA 1OY8A 1MWQA 4ELUA 3M8ZA 1GH8A 3JAMU 1X4BA 1E6VB 2C28A 1T05B 4DV2J 5K8OA 4DX5A 1ELOA 3KJVA 1H38A 2J9EA 1E6VA 1M5KC 3GV7B 1XNRJ 4D3GA 2J8AA 2KN4A 1PGZA 3QRPA 2PDAA 4QR0A 3I0SB 4NLWA 1RBAA 4NCBA 2MKCA 5DETA 1QLNA 2CQHA 1Q8LA 2UV8A 4YR3A 2OSQA 5D0GA 4WE1A 4LT6A 3NCQA 4RR5A 2EEYA 2XZTB 4IOAQ 2DNYA 5C2GA 1H2VZ 3HHNB 2KRBA 1UEUA 2A1BA 4ZS6A 3UNYA 3TZZA 1CS4A 1AT1B 3QRQA 4P52A 2XWXA 4O0NA 3C8YA 2DNGA 3MGJA 4PG5A 5BYRA 4LVNP 4DSIA 4HVZA 1IKVA 4USTA 1WI8A 2MLZA 4TU9A 1GMWA 3AY0A 2RRAA 3UN3A 4LF1A 3W2VA 4KSEB 3B4DA 3D6HB 1U2CA 5JVHQ 2W4CA 3SCLE 2JL9A 3ILOA 4W92B 2CPIA 5IM0B 4F4XA 2DPIA 1RBLA 3MWBA 1NEEA 2OTLS 1RAAB 3MPYA 2VG6B 2MMYA 2VBZA 1YJUA 3CJRA 2WW8A 1FERA 5DM6Q 4A48A 5KOWA 4WFBQ 2AYGA 3PW5A 1TTHB 2ZNYA 3ETMA 2HQIA 2BKOA 2IMWP 3HP6A 3AJ1A 1ICEB 2BX6A 3VR1A 4KFBB 3J7Z5 2LXFA 2WVCA 1TVRA 2CVEA 4UOHA 3TEHB 2LLZA 2O67A 4OV1A 1N5TA 1NKEA 2FJEB 4J9LA 1QE1B 2FJAB 2F7VA 2FHJD 4Q8FA 2IMOA 3R9LA 1NJIT 1IUJA 3VGVA 4JYAJ 4J9MA 2FHKA 3G9CA 4MKBA 4OYPA 3K5PA 5E7OB 2O5DA 4Y28C 4Q5VA 1S97A 4M95A 2GMLA 5L38A 1N5QA 3DMJA 3H2LA 5LL6d 3NGRA 1RHJB 2CPDA 5KFIA 3Q8YA 4OZLA 2MJNA 3C14B 1RCXB 5LMUF 2DNKA 4O23A 5F8HA 2JLFA 1YTYA 3GQCA 1TELA 3SZ2A 4NLRA 3DHWC 3N6MA 4CNZA 5GMKa 3C14A 2KO1A 2XMVA 4U6PA 4RO0A 2YQ1A 3HO1A 4ZP8A 1HI1A 1TL3A 5J1EA 5M2UA 4X62J 3MOJB 2IHR1 1Y5LB 4KPYA 4P6QA 4JUZA 4X62F 2MHNA 1NAQA 4G3IA 4DR5J 2YNHB 5B0GA 2FD2A 5CCLA 4IG3A 3Q22A 1SC6A 2A6OA 1H2TZ 2BJDA 1WUUA 2QMUB 3IAS9 3A3OB 4ID8A 1J5EF 4C11A 3G86A 1RWWB 2Z4PA 3EGWB 4BLGA 3F73A 4DI6A 3FEYB 3DXSX 3PW0A 3KLIA 2UZAA 5D0HA 1F5CA 1P1LA 4U7UK 1U4BA 1Q79A 1Q1KA 4RBTA 1NZAA 5A0YB 3VAJA 3R5AA 2HHPA 2FVSA 2ZZNA 1SC1B 4UTGA 4QWCA 3CCVS 1WHYA 4QPTA 1S1UB 4ES1A 3KLFB 5A0YA 2VD3A 1MMNA 3PV8A 1BQXA 1LWFA 1G6BA 3NNAA 1IBMJ 1VHFA 1U1OA 1K44A 1IBMF 1NSAA 3KLFA 4QW8A 1RHQB 4DPXA 3H42A 2XM3A 1M1KT 2OELA 2CPFA 4LF2A 2XZDB 1XEZA 3W65A 2DHGA 3TA0A 4ECXA 1IBLJ 4C0HA 5KFSA 3F41A 5CZXA 1NK6A 5I42A 4ZVOB 1FDBA 4M5GA 1F9HA 4IFVA 3ILJA 3US5A 4DV1J 3KK2B 1RTJB 3M8RA 1S6UA 3Q8VA 1X0PA 2X7IA 2AJ0A 2ZVIA 2W8LA 2IYGA 4QR1A 3QIDA 1SJ1A 3MTJA 4ZPAA 2PN6A 4FF2A 3KK2A 4MIWA 1QDUB 3RAXA 2ZH9A 2OUGA 1S1XA 4TKTA 5I4MA 3TUJC 3CCTA 1VQSA 3JB9k 3S6EA 3BREA 1RHRB 3VGTA 4LVOP 3R5DA 5CABA 1FTRA 4UY8T 4EYIB 1X4DA 3LP0B 2HRTA 4NCAA 3J7A1 4KYZA 3VALA 4N56A 2QYCA 3SDEB 3MEGA 1L3TA 3PR4A 2AGOA 1KWMA 1NJZA 2B5JB 3H5UA 1T03A 2ZJPQ 3TVYA 2H9ZA 1BXNA 3SDEA 4IG0B 1DQ9A 5HVFA 2BANA 2JWNA 4LR9A 3CD6S 1TKDA 4RW4B 4E0DA 3I5AA 2ZBQA 3TQ1A 1QTMA 4CH0S 2XS7A 4B9NA 2DH8A 1LK7A 1JJ2R 1SKSA 1RACB 1MROA 3EUNA 5KFZA 4RW4A 1CG2A 2IVYA 2V67A 1VJWA 2UUWA 2CPEA 1FJ7A 4WTYA 1URNA 1VQPS 3GJSB 3Q8QB 1DRZA 2HVIA 4PABA 4ZN1A 3AODA 2EFGA 4C8NA 3GE9A 3TAMA 2AJ2A 3K0JA 2VG5B 4RNMA 3IRWP 2HNDA 1KFDA 4I6WA 2GHPA 3C6UA 2GVZA 5T7LB 2HMIB 1RWPB 3TJ8A 2XYPB 1RISA 2W9CB 1F2GA 2GVDB 3WIUA 1Q82T 7FDRA 1BLUA 3J80Y 4A8FA 1VR6A 1CULA 4FKYA 3PO4A 2RHSB 2R3VA 4LF6J 3HZEA 2GVDA 1JB0C 5LOQA 2M52A 4A8XA 2ZKTA 4GO7X 3KNAA 3VAHA 3G8SA 3T1HF 3ELHA 2J0WA 1UTAA 2CPHA 3H25A 4UOCA 3DI6A 3NEKA 2UP1A 4LFAJ 3CC2S 4LFAF 2BRKA 1EX8A 3TJ9A 2ZH2A 2RB7A 4OYIA 3FBFA 2QV6A 3G71S 2FZKB 1HBMB 2VC1A 2DNPA 4DR3J 3VAKA 1WI6A 4Y6IA 4BDPA 1SVDA 2ZH6A 2XGQA 2V94A 1VQ5S 3HKZD 4BWMA 2HK3A 3ONQA 2F9JA 5E3QA 2EFVA 2A10A 1AROP 1JJHA 3FCHA 4O3RA 4JBCA 3AA9A 3JYTA 3TX0A 5DG7A 4WJBA 3MPDA 3IM8A 4N8NA 2HGMA 3JQMA 1KN6A 1O6XA 2VBWA 2E9ZA 3MM7B 4DPYA 1APSA 2LKZA 1S9FA 1EP4B 3HF5A 1RAJA 3CCLS 4EZ6A 4GMKA 3M30B 2ZHAA 4OZJA 4TY9A 3BDPA 4H4MB 4CCHA 4YY3J 1RK8A 3HHLB 2EK1A 4YY3F 1U0HA 2AZ3A 2K7JA 4ERDA 1V5VA 1T3NA 1NH8A 1VDHA 4P10A 4BC9A 2QMWA 1T94A 3V2UC 1N56A 4P71A 1REVB 3IAM9 2HWTA 4O4RA 4M5DA 5KFQA 2M5YA 4U96A 3D1OA 1WWHA 3QJJA 2V5HG 1RI7A 4FN5A 1X9SA 3OQ2A 2AEJA 3QWPA 5FD1A 1S9GA 2WVFA 3HT0A 3DNCA 2HS0A 2K2PA 1HR0J 2NZ4A 1JLCB 2FLLA 3BEGB 4BHQA 4DQPA 2RDDA 1FRLA 1S1WA 4E98A 2AU0A 4UQTA 1FDAA 4MTPA 4N7TA 4P75A 4R0EA 1VCTA 5D15A 4ZIWA 1K1QA 1SIWB 2J7WA 3T6BA 3TEGA 2W9AA 5KFVA 1SL1A 2XI3A 3MR5A 1RT1A 4DS5A 2Y1LB 1NHUA 3RAMA 4PCQA 1R6YA 3G6YA 3AH6A 4WP3A 3VGUA 4WYWA 5EN1A 1FRHA 1V3SA 2RE1A 1PSDA 3V81A 3HK2A 2LQJA 4YB6A 2W2OP 3HVTB 2I5JA 3RW6A 3EM1A 1B3TA 2W25A 2VDIA 3WQPA 1CLFA 4P2XA 5IWAF 3HVTA 3I55S 3DRYA 5HQLA 3QT6A 4F2SA 4JI8J 1T0TV 5HO4A 4JI8F 3JS9A 1FKPB 3EPIA 1VRTB 2J0XA 3IBFB 2KT3A 1DAXA 2WAQD 4FS2A 2PI5A 4ZJQA 2AGPA 1X8DA 4F25A 3POTB 5BYQA 1Y7PA 4B08A 5KTQA 1S6OA 5K14B 4UOGA 2QLWA 3MMAB 1S99A 2OHDA 4ZP7A 1TQLA 2BACA 2VQFJ 1KOOA 3J7AN 3H2VE 2RRNA 4CT8A 3MTKA 4CLYA 5SZTA 4LRAA 4DLGA 3QATA 4PXBA 2E1RA 1GXUA 2CQ1A 4XDDA 2DNOA 3R1LA 5KFWA 4JV1A 4LSZB 3QIPB 4NA2A 1FA0A 1C0UA 1SJ3P 1UA0A 4EMDA 2EK6A 1S0VA 2DO4A 3FCWA 4FVMA 3CCWA 4G1IA 5E5NA 5A8KB 3P45B 4PG8A 3V6DB 5HMZA 3SV3A 5EUHA 3PW7A 4KKOA 4LREA 4ZVEA 2QL9B 3G6XA 4ZVHA 1N5SA 4DU7A 3TUZC 4BWJA 3D0GE 2QZ8A 3DDKA 4XDCA 3T9NA 2FHOB 4PEOA 2ZWPA 1K0VA 3B78A 3MURP 2CJXB 1VQ6S 1O51A 5DG8A 1TL7A 3CCRS 4YDDB 4WIQA 3NOCA 4LR8A 4HLBA 2BJ3A 4F3OA 4WZQA 2BE7D 3GP9A 3AB2B 2RNEA 3C16B 1ZM9A 3Q89A 5HSPA 4LBIA 3W9JA 3JAMY 5C42B 1UETA 3OL9A 1ZS6A 3FUYA 3JXOA 2GX8A 3EPGA 1CQNA 3H4BA 3UQSA 1NK0A 4PYAA 5J2QB 3HSGA 2J9DE 2ZH7A 3MD3A 2PSZA 5C42A 1NU4A 3I4HX 2ZNZA 4QPXA 1ROFA 1FESA 2GA7A 2IJRA 1VK3A 4DG1B 1NDCA 4N5SA 4K4SA 3AHPA 3HX9A 1HWLA 1B0PA 2CNKB 2QO3A 2J76E 2OPQB 1NSPA 1Q8BA 2BOAA 2W9BB 5DDRC 3O1LA 1LNQA 2H3EB 4TYBA 4DG1A 4J9RA 3FQLA 3NXZA 2HKEA 4TLQA 3EWGA 3N0VA 2KB2A 4K8RA 5D4LA 3BGUA 4V19X 2HW3A 5F41A 1UVJA 1FE0A 3TA2A 1B4SA 3OTOJ 1MMDA 5GAEI 2PE8A 2W7AA 4ILLA 3OTOF 4ELVA 3NNHA 3H5XA 3FBEA 5HVGA 4ZCKA 3PRBA 2XLKA 4YB7A 1LKZA 3OL8A 1I51B 3GYGA 5LMNJ 4LF4F 3EICA 2AYBA 1F2HA 3RBXA 5MLCV 1NXIA 1U6FA 2IAJB 3GFHA 3PYFA 2MQPA 3DLKA 3HKWA 4RZRA 4BBYA 2YWGA 2IRXA 1LW0B 4B9UA 4ANCA 2DB1A 1XMBA 1FI4A 3NBPB 2F40A 2MJUA 1YG0A 2MKIA 2VFRA 2U1AA 4X65J 2KXNB 2WSFC 4PXCA 2CZ4A 3RB3A 1LW0A 4OI2A 3NBPA 1X9WA 1Q8KA 5C24B 1FK9B 2LU2A 4IOBA 1JJCB 3D66A 3VVUA 2DGQA 2OFGX 1V5IB 2P9CA 5T41A 4DUZJ 3H2UB 2V2ZA 5C24A 2VQEJ 1LXNA 2C3YA 2VQEF 2XMTA 4AD6A 2BJEA 1R8CA 1HKAA 3U1MA 3VQTA 2DEJA 3DRPB 4DPTA 2XHCA 2MKYA 4OIXA 1HQ2A 1WG5A 4ICLB 1N0UA 1U1RA 2XEXA 2X3DA 2WHOA 3BKTA 4WZMA 1HBNB 2HQDA 1N36J 1EJ7L 2NREA 3M05A 1YWXA 4Q2MA 2B3TB 4ICLA 2MQQA 5EWFA 3SSQA 4YDXA 4OYZA 1M1GA 1FFGB 1HBNA 2B4UA 1UEVA 4X64J 2KM8B 3IGVA 1DTQB 4DPOA 1HBOA 1IKXB 1AW0A 1TFYA 3FFIB 4JI5F 4KIAA 1F3FA 4ECYA 3K5MA 4KV8A 5D0EA 1DTTA 2CQ2A 5F8IA 4OYAA 4ECRA 3EXYA 4TQSA 4MAKA 5U47A 4JI1J 1EAYC 4OYWA 1VBXA 4USVA 4JI1F 3KHHA 5E41A 4YB5A 5HROB 1CQMA 2HQCA 2XSJB 4K4TA 1I6JA 4F4ZA 2D3OR 2EXUA 1VJQA 4X4TA 1BMQB 5KFDA 1YK9A 2AQ4A 3CJKB 2XSJA 6FD1A 2AT1B 1QAIA 1NSQA 4DFPA 5HP1B 1VQMS 1UP1A 3OTEA 4DX6A 4ES3A 3HVWA 4UT4A 3BO4A 3OJSA 1GTEA 3M8SA 4URSA 2MZTA 4MFBB 2XNRA 1C1BB 3QJPA 1ZM4A 3ZZYA 3DXBA 2XS2A 1GMWD 2DEIA 2PO4A 2HHVA 2RS8A 3GYNA 3F0NA 2WBMA 1S7IA 2K06A 4I2QB 3OFHA 1GFWB 4RW7B 3SSRA 3EVWA 3PX4A 3MUTP 4PAAA 1RYRA 5HMXA 1ZYQA 4JV5J 3SYZA 1SJ4P 1HNVB 4I2QA 4XPCA 1BQMA 4DUYF 1ZBTA 5G4DA 2KHDA 5KG0A 2XYGB 3TWZA 1X4FA 2FY8A 2OMOA 3DU5A 2QSFA 1Q0NA 1YQHA 2EPIA 2PIIA 1HHTP 4IH7A 4PG7A 3TOQA 5ADZA 4DR2J 1RT4B 3HM9A 2W2MP 4DR4J 3FRZA 1JLQB 4DR4F 9ATCB 4J9PA 4ID5A 2HG4A 2HNZB 5D0RA 3IG1B 3Q8RB 2YKNB 1F60B 1HWKA 1F1BB 5M2PA 2DR6A 1N34F 4KGXB 1VLOA 2R8HA 2EFOA 3LPYA 1J5OB 1MNEA 1ITPA 3LAKA 1YVFA 4ZK7M 2KH9A 4KTQA 1PAEX 2ZH1A 3BB5A 1U8SA 2KYXA 1FJGF 4R5PA 1RTDA 3QT5A 2J7UA 3CULA 2C2OB 4ZLJA 2DCUB 2KL8A 2FZCB 3HSZA 2IM2A 3CIZA 1EIYB 4M5IA 4I7FB 4LIRA 3Q8PB 2G2YA 3FZBA 2NXUA 3VAIA 3ITHB 1T3OA 1WSRA 5KG3A 3TX8A 2H5EA 1LWEB 1BC6A 3BGOP 2ACYA 4DV6J 3BSNA 2HNYA 4QIWD 3MMBB 5FDLB 4CLKA 1TK0A 1R8AA 1EQMA 1S1VA 3HI9A 4UUXA 4LF5F 5D6GA 3M8QB 3OR2A 2H5JB 2VV5A 3IRXB 2ZD1A 1QSYA 1RAOA 1UVLA 3H90A 2HWIA 4GVLA 4B3TJ 2JC0A 3MAAA 3J81j 2MZRA 3K2YA 4K59A 2BABA 3B4MA 3MM8A 1ZAXA 4KT0C 2GMJA 2CXEA 3UPFA 3PX0A 4NLSA 3RB4A 2Z2ZA 5L1KA 3R7SB 1YJNS 3VAGA 3CCJS 5KFMA 2QRRA 2R2TA 1KSPA 3KJNB 3X3UA 1PYTA 2WBRA 5DZ6A 1EB0A 4WPAA 1WHWA 5LXYA 4ECSA 3CPWR 3CDBA 2B4OA 1FX2A 4ZVPB 1D9DA 4QU7A 4JI0F 1DQ8A 3EZOA 3WBZA 4LBHA 2DGWA 2OEKA 4DV4F 4F0KA 4AL7A 1S7HA 2H4YB 3NLCA 2ASJA 3CDUA 5DDOC 4ZCMA 1LK5A 4ED2A 1UFLA 2D9PA 3DFEA 5IV4A 3QLHA 4IO9Q 1XR7A 3V4MA 5DLFA 3BYPA 2YWHA 4WF9Q 3SIPB 1XQIA 1M5SA 2W2PP 3W60A 2FC9A 3R27A 2RQCA 5J2MB 5GADI 4OQJA 5HBMA 2HIQA 2EC0A 3KTQA 4XO0A 5J2MA 3MUVP 1UJ6A 2B4VA 2Y8YA 4ZVSB 2WB1D 1RT2B 4NWBA 2CPZA 2I6WA 4BC7A 3M2VB 1ZH5A 2VF3A 2ZOMA 4K4ZA 5A2QY 4HACB 5LJ3Y 4FKXA 1T95A 3HSJA 1KC8T 2VODA 1HQEB 3GSDA 2RQ4A 2FZGB 4BS2A 4CTAA 3M2VA 3D1HA 3MM5B 1CVJA 2D69A 2H48B 4X66J 3T9ZA 1OY9A 4X66F 5F9NA 4CH1A 2XO6A 3GCWP 1MW7A 2F65A 3JTOA 2YKPA 1D8ZA 2CPJA 2OLWA 3IM9A 4O0IA 3KLHB 2XMKA 1WNEA 4O3QA 2WOMB 1YZ7A 4NCGA 5EX3A 4OLPA 3GJTB 3BPDA 2EFPA 3PRDA 3IS9B 3UVJA 1PBUA 3KYLA 2ASYA 5E0OA 1QAXA 2C3UA 4FZVA 2AEMA 3N6LA 1AFJA 2CQGA 4A8SA 1H98A 1M5HA 3VZIA 1KLNA 3L09A 3MPUB 3ZTRA 3CUNA 4F0MA 2EG2A 1ZA2B 1R0AB 2X1FA 1RKJA 3ADAC 1FNOA 3UDVA 5BR8J 1U25A 2V69A 1OSDA 4ENOA 3W62A 4NXNF 1J2VA 5ETKA 5B0AA 1A9NB 4OZ5A 4QR2A 4C2MA 5J2PA 2LECA 2OH2A 3EZ5A 2WVBA 3NS6A 4IDKA 3GFZA 1PKUA 4LBPA 1GQEA 2YNGA 3D3CJ 4B17A 3M32A 2BRLA 2UUAJ 3RTVA 3IFEA 3I5CA 1SKWA 3EDRB 3LPEA 3R5JB 5KT6A 1IJEB 4Q43A 3R1HA 3C6TB 2NS1B 2HFZA 4KO0B 4R25A 1NK9A 5K8PA 4DN9A 2PFFB 1HNXF 1F5BA 4KR0B 4JI7J 1QSSA 2KDOA 4JI7F 3MR2A 3DU6A 2PMHA 1XR6A 2H5IB 3GG0A 1RT6A 1JLAB 4XK8C 1IJFB 1SXLA 4C8MA 3SQGA 2RAQA 2B7BB 4F4YA 3B8HA 1N33J 1HWIA 3IR5B 2WZ1A 3CW2C 8ATCB 3PW4A 1SL0A 4TVAB 3D0IE 5IOLA 3F56A 2XMJA 5AE2A 4E2FB 3CD0A 1GNKA 3TANA 1V3ZA 4MJKA 4OI4A 3AXMA 2F8EX 3CJ8A 3MECB 3X1LB 1WC0A 4DL0C 3FVYA 2RJZA 3I31A 3HD1A 2D3O1 1T8EA 3BGLA 1RT3A 1ZETA 2LA4A 1W26A 2UUBF 4KQZA 3ILIA 2ZKUA 4PYDA 2ZHOA 3FEXB 3EGVA 1TAUA 2FVPA 2QGFB 8AT1B 5CYQB 4J9KA 1ZA1B 4C98A 4M8LA 1GT8A 2JH3A 4MH8A 3FNNA 2OPPB 3ZO7A 3PEJA 2VBXA 1WKJA 2B8PA 3LANA 2GMHA 2HFVA 1MWYA 2DGUA 2OPPA 5IC6B 5EHHA 2HHUA 4NLXA 3W61A 1MWZA 3IWXA 5A6WA 2MSSA 2R8KA 3ZTQA 3UD3P 1RTIB 4ATNA 1KRPA 3NGDA 2F4FA 5LT5A 5DLGA 2WTFA 5KT4A 4B3MJ 3BM7A 4B3MF 3WC2A 5CYMB 1VQ7S 3NGKA 3ENVA 2ILZA 3LWLA 3BN7A 4P72A 4RUBA 3RRHA 3CVKA 1S4FA 1OPIA 3EE3A 2AYEA 3JTNA 4ZPBA 2DD8S 3GIIA 2DVIA 1UFWA 1VQKS 2CKWA 3I6PA 1OPZA 4X4SA 1JK9B 1KVKA 4I1TA 1B70B 4WIIA 2JLGA 3SBMA 3ZXWA 4AUKA 2JFDA 4FPRA 1HWUA 2XY7A 3M2RB 3OFEA 2F63A 2YH0A 3MM9B 3DRRB 2MXYA 1GEHA 4K4WA 3IBWA 3KUGA 4OMFG 3CC4S 3M2RA 3H5SA 1I94F 5DQGA 3N28A 3OV7A 2BQUA 1U45A 4NLYA 2AYMA 3QO9B 1R8PA 2A6MA 2HBYB 5C2CA 5ITHA 1LXJA 2DHSA 3M9OB 2VASA 3MCNA 4Q44A 2XWYA 1NB7A 1F6TA 1GK8A 3BBBA 3GILA 2DISA 1MN9A 4YEAA 1UZDA 4I67A 1QAJA 4KHMA 4P7TA 2KXFA 4J9UE 1VQYA 5BXIA 3ENQA 5LM7E 3DGPA 2E5GA 1WHVA 1YIJS 3MEEB 3V4IA 3GONA 3RJMB 3NNCA 2B6AB 2LXIA 1TUGB 1RWMB 1KQSR 5D77A 2CZ9A 4H4OA 4TQRA 4FYYB 3A13A 4CZCA 4WFZA 3MPVA 4UUWA 2D9OA 4USMA 2F9DA 1UVNA 4NI2A 2HHHJ 4ED4A 4C48A 1NUEA 1IN0A 3CCUS 2ZUAA 5D78A 2MLYA 3M6VA 2EFNA 5HMYA 3VZHA 2AJFE 4MK8A 5J2NB 5E3PA 3A8JA 4HKQA 2HVDA 3AA8A 4FF1A 4B9VA 2FJDB 3IA0A 3U1NA 1DHMA 2F8HA 4J9VA 2R8GA 1HMVB 3L3CA 2J9DA 3K7RA 3EZUA 2G0JA 4F3MA 3R6GB 2LEBA 4C3LA 3CMES 2BM1A 1H7XA 1KR4A 1B99A 2LQ9A 5G0RA 2LCWA 2JEGA 4OLOA 1F3VA 3BH7B 2CYYA 1GMUA 1S72S 3HD2A 3CJSA 1WC5A 3M8PB 4YHHF 2DITA 3D6MB 2GJ2A 2PMWA 2JHEA 2KI2A 1O0PA 3KFWX 3TW0A 2HAIA 4EWTA 2L9WA 2H65B 1TKZB 2KJWA 5F9LA 4QIFA 1RT7B 3CNQP 2QG9B 2CZVC 2QA4G 4HHUA 2Q43A 1RHMB 4X84A 1B64A 1HI0P 2CNOB 4QIEA 4HT7A 3J81U 3JSBA 5B0EA 1L5UA 2F8MA 1YBUA 3BDEA 4LFBJ 1AUSL 2MYFA 2HQ3A 1NLKL 4LFBF 3KHRA 3BH6B 2CG4A 4P73A 4YMEA 1WACA 1HQUB 4O44A 4DSLA 3OTCA 2VPXB 1B0TA 1PYSB 2R8JA 4DR1F 4AFFA 4KGKA 3ISNC 2NUHA 1H3DA 5DDPC 4PWWA 2XYHB 2Q6CA 3R6LB 4A8OA 2CQIA 5GMEA 3GV5B 5KFTA 3FSYA 2GW8A 4I68A 4UF4A 1G7CB 4EK2A 1SH3A 3ZTPA 2ZBIA 5KFFA 1S0NA 4JI3J 2ATCB 4JI3F 4CLUA 3W63A 5K8MA 4C7QA 2DTJA 2XO7A 1R31A 5KAKA 1VOMA 2RSQA 5LSLA 1AYEA 3NCRA 2AHOB 3UD5A 3GCXP 1Q7LB 3W2WA 3GU0A 4JI2J 1ZM2A 2HLTA 2I1RA 4EBDA 4DR7F 4NLOA 4JI2F 4HDHA 1S79A 1N6QB 1CEZA 4ZVGA 5KFKA 1WC4A 1JQGA 4WCEQ 2HHXA 2HZCA 2VPWB 3R5GA 1WELA 1RU2A 2DCLA 2ZZTA 3G82A 2OKQA 2FLNA 5E3CA 1K8AT 1Y3JA 4DV5J 1NK8A 1BE4A 1RT5A 2B9XA 4MIBA 4DV5F 2VJVA 1JKHB 4DEZA 3ET6B 5B09A 2IC3B 2RUGA 3E3XA 3PKYA 1JLEA 1H73A 2X1GA 3OR1B 4MKYA 3KXDA 2PD1A 1BUXA 1UJ5A 4DPUA 2DO0A 3AD9C 3OTBA 4FXWA 5GAGU 1SC4B 5ETNA 4O4GB 4NASA 4CI0B 1Y10A 1TL1A 5KT7A 2UXBJ 2KT2A 4G1PA 2AD9A 3DOMB 2UXBF 4OJHA 3QAUA 3S7RA 2J8SA 4O4GA 3TQEA 3V6HA 4P2MA 2YKMB 3DM2A 4KE5A 5CD4A 2JFKA 2D41A 2MY7A 3U7JA 2PGCA 3Q86A 1SV5A 4OX7A 5FLXU 1LW2B 3W9HA 1ZZFA 1VGYA 2B7CB 1NPRA 4W4MA 1JJ4A 4AT1B 1IKWA 4U7CA 3QGPA 3PX6A 1ZZNA 4MYUA 3RYLA 2B51A 2FHJA 2Y3YA 1LW2A 3CTRA 2PA8D 2YXLA 4DHVA 4R8UB 2FQQB 1WF0A 5THWA 3LP1B 2OTJS 4XPEA 4KPCA 3N4WA 4FPIA 4NLGA 4R8UA 1WC1A 1VC6A 1P9QC 1KKHA 2VKZG 1DZ5A 3LP2A 3ENWA 2JEFA 3MCSA 1C4AA 1OQ3A 5ETOA 5C5JA 2WONB 4AQYJ 3ENAA 3OVBA 2XCAA 2Q6BA 4ZPVR 2QT7A 1N32J 4NRTA 3GPAA 4DV2F 1N32F 2E5HA 4NMXA 5IC4B 2LYVA 4LRBA 3LAMA 2VA3A 3IXQA 2AJ1A 1BQNB 4A47A 1T05A 1XNRF 1DJ0A 3EXCX 1RU1A 2ZBRA 5KG5A 1H6KX 4WBFA 2P6TA 3FZ2A 4DQSA 1NB2A 2X3GA 3LUYA 2QLJB 3I0SA 2ZWOA 2DXDA 5F0WA 4WXWA 5JMNA 4URGA 4UW2A 2KG1A 4KHRA 4U8VA 1D9AA 1S48A 3MM6B 1Q7YT 3DLGB 1X9MA 3TR5A 1R3NA 3MCOA 3WDOA 4CM2A 3DKDA 5IFMA 3EVMA 2ZM6J 1WOSA 3HJFA 3I82A 2Y0BB 3N5FA 4KBIA 3HHDA 3LA0A 4O3NA 1QUPA 1NPPA 2MKHA 2YY3A 1T9YA 2QLFB 1OWXA 4YUDA 3B54A 2XGPA 2V8VA 3DLJA 3FMWA 5CH7B 4LJMA 2VFVA 4QIGA 2VA2A 2IDLA 3GR0A 1TFWA 5HI7A 1RABB 5JUMA 1SQGA 3C15B 2XY6A 3GFYA 1GXLA 4LRFA 5KFYA 4OZ3A 2KU7A 3QBCA 5HJYA 1IXKA 4P7VA 3GR1A 1C2PA 4QWEA 4DFMA 1W25A 3PYEA 3OXGA 4OHYA 1FJEB 2XULA 5IM0A 2ZDOA 3JTPA 4OZ1A 2KG0A 4S0MA 1X5OA 4OI3A 1HNIB 1W2IA 2VG6A 4AE5A 2J6UA 2JOQA 3H4DA 4N77A 1X5TA 3U27A 1WKLA 5MAOA 1F9EB 2KYZA 1GAOA 3FJ2A 1IQTA 2LQ5A 1AZSB 3O6QA 3MR7A 3W66A 3AB4B 3WX4A 4M5JA 3HLUA 1QM9A 4ZVUB 1YJ7A 1RHUB 4WP8A 4KFBA 2JX2A 1AZSA 2YWFA 1FRIA 3BBFA 1KTQA 4GKJJ 2C3OA 2F4VJ 1JLFB 4BCAA 3K58A 4GKJF 2F4VF 4DBQA 1VIOA 3ZTSA 1SKUB 4P74A 4J9SA 4JYAF 1WJ9A 3N5BA 3OL7A 6FDRA 2APOA 1QE1A 3BQ2A 2DXEA 3OHBA 4HTIA 3OVAA 2QTWA 1YHQS 3PIPQ 3T19A 3M6UA 4NYOA 3HSDA 1G3OA 1UVKA 3DLEB 2ASLA 2GNKA 4DOZA 4O3SA 2WSEC 3RZAA 3M6WA 4UQGA 4HT5A 1NJWA 4G65A 4DMZA 3AD8C 1VHIA 4XIUA 5A8RB 1RXOB 1N5YB 2DHHA 1IWGA 1HL6A 1S6QB 5J1NA 2D7SA 1LWCB 1PC5A 5K9FA 3PEHA 1LFWA 2GJFA 4ZA1A 1NPKA 5DG9A 1LWCA 2LQ8A 3DDNA 2R7RA 2G0CA 1DLOB 2RVJA 2MB0B 1ZPWX 4F67A 3FBCA 2BBEA 4PPDA 1NBEB 1SJRA 2YQ0A 3M2UB 3C46A 2IRUA 4ECWA 2RKIB 2OPRB 4DR5F 2M2BA 1K73T 2IA6A 5DQIA 3KOAA 1HNZJ 2YQ3A 3M1VB 3M2UA 2A3JA 4DSEA 2RKIA 3MEDB 3PJXA 2YNHA 9RUBA 3T5JA 4FXVA 2J5AA 4K7QA 3SMZA 1PG5B 1TMMA 2XMWA 4DZDA 2RH3A 5IV3A 2HIYA 4I69A 1RE1B 3A8KA 1S1TB 4JI6J 2KFZA 3I5BA 1VBYA 4QIVA 3LF0A 4IH5A 5EWEA 1BY9A 4PWDB 1I3OB 4FP9A 8RUCA 3I87A 2CNNB 3BSCA 5E3AA 4RPFA 3KK1B 4ZHRB 4RW6B 1S1UA 2MQNA 1IWAA 3E01B 3NOGA 3TI0A 4N41A 4ED7A 3KK1A 5ETRA 3OSPA 3P4UB 5L1LA 4RW6A 3HFVA 4RX6A 4NYZA 3P5BP 1IBLF 4DL4A 1O5JA 4K5RA 1WOOA 3MZIA 3KLEB 4MT1A 3DHXA 4DV1F 1CJUB 1Y5NB 1A0OB 1HW9A 1EKRA 2M8DB 1EHWA 2PC6A 3BR8A 2HRUA 1RTJA 4C8YA 4IYQA 4RUHA 2MKJA 1XJWB 1OY6A 5IT4A 3FRYA 4KH1B 3B82A 1ZM3A 1X4AA 1QD1A 1QJHA 3QRRA 3VAFA 4H4KC 4K2JA 3GIMA 3RBDA 3PXGa 4Y00A 2MKSA 1SIZA 2AGQA 2G9OA 2B4PA 2ZBPA 5SUHA 1EQ0A 1IR2A 3CO0P 4WKRA 3T1YJ 3NMRA 3LP0A 4G1QB 3TJAA 2BM0A 4RW8B 2YWKA 3FDSA 3MMCB 1V6HA 2Z2MA 5IQ6A 2G2OA 1S77D 2B5JA 4N47A 1RB0A 2VPZB 1HWJA 2PA3A 2FJWA 1JLBB 4IG0A 2DXFA 4GVBB 3S1TA 4OI0A 3RU0A 4NLDA 4Q2LA 1KFSA 5DS7A 3NGUA 2C2RA 1JLBA 1Q78A 2R7QA 3QNWB 3NGSA 3EJMA 3LTOA 1NDKA 5DJBA 4ECQA 3DLBA 3D6FB 1PJ6A 1CJKB 3CXCR 1XWLA 3QMQA 3KHLA 2JJ4D 2B9WA 1ACMB 4ZPCA 2QLXA 3KKFA 2V8GA 2K8GA 4WKYA 5HLFB 4ZPDA 2DRAA 5KFUA 1CJKA 3ZFVA 3BKFA 2FJBB 3QSIA 2HYIB 2VG5A 2R7XA 1XMOJ 1N52B 1N88A 1XMOF 5T7LA 2HMIA 1UMJA 5DZ7A 4DU8A 1N54B 4W98A 2W9CA 3BO2A 1M0SA 2NZCA 4LF6F 4C8OA 1FKOB 4DUTA 2CWKA 5CA5A 1MN7A 2W2NP 4CYUB 2E9RX 2P8IA 5I3UB 2D3UA 3BF4A 4RU9A 4AL5A 2OPSB 3CJ4A 4B3SJ 4HR2A 2CDQA 1FKOA 5LSRA 4C0BA 4QWBA 2BJ8A 4CYUA 3A3PB 2V2VA 1D8YA 2BW7A 2ZVSA 4ECUA 4FDFA 1X4EA 4KJIA 2BMBA 3BV8A 4P2SA 4LF9J 4J37A 2R7UA 4HEA9 2DY9A 1Z1ZA 4LF9F 1T11A 1X5PA 1CC7A 1UW4A 1XTZA 3R97A 4DQIA 1URRA 1DY3A 4DR3F 3OJUA 4EU0A 3RRKA 1G4CA 2AF6A 1JLGB 4CO0A 2JRSA 2OEMA 3VVTA 1LOUA 4DS4A 4OYMA 1HBMA 1WSVA 3RBEA 1K47A 4KGMA 1AUDA 4ZIVA 4ECTA 1S0OA 3NWRA 4LFCJ 4CDIA 3FCVA 4LFCF 5B7WA 2DYAA 1YJ9S 1WOPA 1AB8A 1NMEB 1XK8A 4ZVTB 2V8DA 4YS2A 1RAHB 1EZZB 2HK2A 1YGYA 5GAHU 3J7YU 3IMQJ 4WK3A 3BGRB 5H1SV 4J9OA 3CGIA 2RS2A 3KDNA 2YKQA 3BR9A 4Q0BB 2V2KA 2N4DA 1M5VC 2Y0SD 4F8RA 1OQ6A 1S5ZA 1VQOS 4ITSA 3MM7A 2PI4A 3EGZA 4OZNA 3G4SS 3PZPA 3CCZA 1EP4A 2QC3A 4USJC 5D4OA 3NWGA 4KC5A 1D09B 2M7SA 3M30A 3T5HA 2IA0A 4H4MA 2C2MB 1FF2A 4M5NA 3HHLA 3FSXA 4PKDB 1VC5A 1U2FA 4IFYB 1L3UA 1TAQA 3R2DJ 2DKOB 4IQXA 2IJFA 2V9KA 4NRUA 2VIHA 4YR0A 1UEKA 1U49A 2AIRB 2P6SA 2V4JB 5DO2A 4KY3A 3H8YA 3K59A 1REVA 5IT9U 4CQ1A 3HT3A 3GIRA 4J7CA 3DOLB 2WB4A 3QGGA 2V4JA 2BUNA 4NA3A 1D0EA 3MUMP 2E5LJ 4GO5X 2HAFA 2GCFA 3B6BA 4RNOA 2DGTA 2E5LF 1Q81T 4A46A 1YZ6A 1HR0F 3P49B 2CNLB 4NLUA 2XY5A 3Q23A 4OHWA 2J6SA 2CQCA 2YKOA 3RBZA 4DV0J 4RNFA 2Y8WA 3L7PA 4DF4A 2UVUA 1YJTA 1WORA 1TKXB 4FF4A 2Y1JA 1GTHA 5IT0A 1JLCA 4I64A 1KBRA 1HYSB 1SH0A 3FK4A 5DRKA 1IVZA 2CJQA 5DQHA 1VK8A 3J7ZT 2BE2B 2LFVA 1FKAF 2KM8C 2LDYA 2OFHX 5F3ZA 3VCDA 2FTRA 4U95A 1HPZB 2A2DA 2DH7A 3Q83A 2HS4A 1S6PB 2ALYB 4X4OA 1C0TB 4F4AA 4Y2IA 3D1QA 1OYEA 2VL1A 4FYXB 4DZ6A 3UCGA 2V4RA 3DOKB 4PUOB 1MU2B 5K8NA 1YLXA 2OD6A 5D3GB 2HWHA 2V0NA 1X7VA 3OUYB 2HZVA 3PCOB 1CJTB 3SCKE 2R2UA 2UVVA 3K17A 2LDIA 3DCAA 3TAPA 3UN5A 3R2CJ 1FRMA 2NYIA 4DL7A 1NDPA 3JSMB 3T41A 3BQ1A 2NCKL 1QAYA 1OYDA 1QVGR 3GJQB 1Y5IB 2GHVC 2HQGA 3MR3A 3JSMA 4DSFA 3JQJA 1FKPA 3CWJA 1VRTA 1UWBB 5JVGQ 1BGXT 4H4KA 2DGSA 4Q8EA 3MD1A 5KFRA 4IR1A 2ATLA 3S01A 2VC0A 4KH0B 2IY5B 3POTA 2VQFF 2N82B 2J0SD 3DRSB 5K14A 3MMAA 2GJIA 1PO6A 4AXIA 4UZBA 2CJKA 3C3LA 1DARA 3M4XA 4L3NA 3SV4A 1YRTA 1FNXH 3EVOA 3WC0A 1Y0HA 1WEXA 4OJ3A 5AE1A 1XNQJ 3QIPA 2UUCJ 4X2BA 1XNQF 2DHXA 2Q79A 5C25B 5FLXY 2XS5A 3GMGA 3HXMA 2IVFB 3O2IA 2FVCA 2HVEA 4CLWA 2YTCA 1TL5A 5A8KA 5B0FA 4ELTA 1HW8A 1RJJA 2POKA 3RB0A 2IDEA 3V6DA 3M9MB 5ETSA 2H1YA 4F26A 2W1BA 2IM3A 3JSRA 2UVRA 2BDPA 4WK1A 4J5OA 3KJVB 4Y2CA 1VYAA 4RKUC 4OHXA 1U26A 2NXCA 1OO0B 2B43A 1YJVA 3OPKA 3H59A 2ZH4A 3OFFA 4JB8B 3QZ8A 5I3QA 1ZAVA 1Y00A 1ULRA 1U6ZA 5KFLA 2C1EB 4Y2KA 2V50A 1KVIA 4I56A 3C16A 2DT9A 1OIAA 2KFNA 6AT1B 4WE1B 1PCAA 1Q5YA 1SH2A 1ZTWA 2EFQA 2XBPA 5A6PA 5J2QA 3N79A 2DIUA 1N8RT 2BQRA 4DL5A 5DM7Q 1CS4B 4F02A 2E44A 2CFXA 4ZPTR 5L1IA 3M6XA 2Y1IA 3D9BA 2OPQA 1IKVB 2W9BA 3OW2R 3IP0A 4YR2A 3D3BJ 4DWIA 1B0VA 1U8WA 2K7KA 2EKYA 1REGX 2HQFA 5E33A 1SPBP 4PG4A 3W2VB 5KFHA 3K5NA 1Y9OA 1CC8A 4USIA 1BD6A 3C19A 4NZ0A 3EGNA 1PILA 1KONA 3ZTOA 4PZVA 1SQEA 3NY0A 4M5KA 4RBUA 5LMNF 2GAGC 2DRDA 4D3HA 4C6AA 4M5LA 2DGXA 1KD1T 3PFEA 5D4PA 1ZPVA 3V6JA 2AMCB 4PPZA 2QSWA 1Q95G 3TUIC 2A2CA 4ER8A 2BA9A 2IAJA 5HVHA 4K4YA 2GIRA 2KT5A 2D3ZA 1U1MA 3WX8A 4FBUA 3CDAA 3LGHA 1TVRB 4NLTA 4ZMMA 1N4LA 1FXDA 2YPZA 4X65F 3RAQA 2Z2LA 4F2RA 5HMWA 1FD2A 1B7FA 3AXKA 4OI6A 3ZZ0A 3SQOP 3FBBA 1NK5A 4WFNQ 2Z8QA 5K20B 3P5TL 3NGTA 4DUZF 2P9GA 1FK9A 3VWSA 4Y3CA 5RUBA 3MOZA 2N7CA 5KFOA 2XZWA 3DMJB 1R7IA 2RD5C 2BYCA 3I32A 4TNOA 3AOBA 1R89A 2WVDA 2DJWA 5KG6A 3DRPA 4A8MP 4U7UD 2CAJA 1D1UA 4OJ1A 2RQMA 1N36F 5LMUJ 4KGVB 4YOEA 3R3TA 3H20A 4ED0A 4FYWB 5H9FK 3I9ZA 1TL3B 3DC2A 5J1EB 2XMMA 4ZJLA 4RWWA 1X5SA 3HHKA 2RDJA 4X64F 5DGBA 1FWLA 3I56S 1FVQA 3G8TA 1TZ0A 3PM9A 5AXNA 1U02A 4DQQA 4ZJOA 2E7VA 2ZOGA 2AZ1A 4CLPA 1DTQA 4IG3B 1IKXA 5KFEA 1WG1A 3FFIA 3OHAA 1TU0B 2M70A 1IQZA 1FDNA 4C0OC 4C11B 4QJVA 4RU2A 4FBTA 3MMJA 2XHWA 3SSSA 1PAUB 1N5VA 2G1HA 1O8BA 2YVSA 4DCJB 2L48A 2C2NA 2MQLA 5HAOA 4DLEA 1J5EJ 1U1NA 4WP9A 3KLIB 4K0KJ 4K0KF 1WC3A 5HROA 2EI5A 1L3SA 2W01A 4C8ZA 4RUAA 3N01A 1UVMA 1R0CB 3CJKA 3QSYB 5HP1A 4NEYA 4IRDA 1NO8A 3UO0A 3WZ0A 1YBAA 3BBCA 4ZVRB 1LWFB 1HNWJ 1HNWF 3LO3A 2K3IA 1HLWA 4MFBA 1C1BA 3NKYA 1Q8IA 3T5LA 5F8NA 2AEFA 2H4WB 2DR5A 3MI7X 1U09A 3Q0AA 4B9SA 3NAHA 2V8HA 4JV5F 1KTVA 4M5MA 2CRLA 4NX9A 5I42B 1XBWA 1DQAA 4B9MA 4RW7A 1X4HA 2Q3PA 4IFVB 2XB2D 3G6VA 1UPPA 1KP6A 3ZZPA 3D5MA 1HNVA 3PG9A 4WU3A 4FVCA 3CJ5A 2NXJA 4C9DA 1EARA 1JNRB 2Z30B 3Q2SC 4DR2F 2FB0A 1S1XB 3W5YA 2G1DA 2LEPA 3QFHA 3I0RB 3NP5A 3R7BB 5CHCB 2GHWA 4DFKA 1RT4A 1JLQA 2DNZA 2EVZA 3FC9A 4DFJA 3I0RA 3KLVA 2HNZA 4ETZA 4ZN3A 3IG1A 2C3PA 2YKNA 3HZGA 2R7OA 1NKBA 5F8LA 3MEGB 5BYSA 4CP5A 4B3RJ 2JNJA 4B3RF 3VTIA 1TR0A 3ICLA 1T03B 4Y34A 1XN9A 2M88A 2RHQB 4EBCA 2DIVA 1J5OA 2BANB 2VOPA 1HHSA 2UUTA 3ISND 1JX4A 2HVHA 4QW9A 3D54A 2ADCA 1ZAWA 1VMBA 4C8LA 4F50A 1Q53A 3H7HB 2F3JA 3KJFB 2V9WA 2LU1A 1U1PA 2M4MA 1TMJA 1MROB 3R8YA 1S57A 3TARA 2GQQA 2O3DA 2X1BA 2MQ8A 4I7FA 1QUVA 4LF8J 4Q7AA 1WDTA 3BPSP 1HIYA 2NSCA 3ITHA 4DV6F 4LF8F 2YX7A 3TAMB 1HFEL 1P1TA 1W2BR 3THVA 5KT3A 2HNDB 4A8YA 1LWEA 3C6UB 2GVZB 1WF1A 2MKKA 2XNQA 3MMBA 5FDLA 1X60A 4XTTA 3P8BB 1RADB 2FYXA 4OX8A 1WTBA 2ZZMA 1PJ7A 5KG7A 2BKNA 4M1KA 4ILRA 1RWXB 4ZP6A 1VQ8S 3TZXA 4B3TF 1CULB 3M8QA 5F0UA 3IRXA 2LEAA 3Q8UA 4K2XA 3GB0A 5ETMA 3L9ZA 3LGMA 5LXRA 4DX7A 3HDSA 1GMVA 4HI2A 1T02A 1FRXA 3TP2A 1NSKL 3G6ES 1VLYA 3A8EA 3DGVA 5KG2A 2ROPA 3LW5C 3QPIA 2C42A 4FYDA 2ABYA 3DI6B 4MK9A 1JNZB 3T1HJ 1WC6A 1NHVA 1JXVA 2G2ZA 1HD0A 4KGZB 4TLRA 1WDDA 2OGUA 3GFXA 3VGSA 3BKUA 4USUA 4EZ9A 3K5OA 2J9CA 1I1GA 3QT8A 2VH7A 4LMZA 2HRYA 3MFHA 3FSIA 1P27B 5L46A 4FS1A 2HFSA 1KOHA 2LMIA 3SEOA 3MPWA 2RRBA 1R6VA 3OVSA 3EMTA 2KTQA 4WFYA 3JYTB 4J9QA 3K8VA 2AJ4A 3UFCX 3TVZA 4QWAA 1S76D 1KVJA 4EUVA 2LXUA 3QAEA 2CQDA 3BS9A 4I6YA 3GLJA 1IM4A 3N9UC 1T9XA 3M7VA 1FFSB 2LA6A 5CCMA 5A2QU 2OEJA 4FYVB 1S59A 1UW9A 2KHCA 3CB4A 4CT9A 2HEKA 4J9NA 5ETPA 2V6AA 1RAIB 2AP6A 1Y3KA 1MLAA 1VQLS 3UR3C 1U0HB 1NNDA 4DPWA 1RT2A 3PYDA 5GMDA 2E1MC 4HACA 4EBEA 1U2RA 1UL3A 3RR7A 3HFZB 1HQEA 3OD2A 1VC0A 1UAWA 2FJXA 3MM5A 2ZJQQ 4M5DB 2IBKA 1N48A 3GV8B 5A8WB 2P9EA 2O1PA 3PIOQ 2QIFA 5HQMA 4DL6A 2JSXA 2YH1A 2QL7B 2MTLA 4OYOA 4Z7YA 2HHSA 5A8WA 1S9GB 2DR8A 5DGAA 3AOAA 3KLHA 2JVRA 4UOFA 3D0HE 4L73A 4IOCQ 1PJ5A 1RLCL 2CVIA 2WOMA 5GVQA 4OJGA 3D28A 2ROEA 4QWDA 1BHNA 3IS9A 2XCPA 4L72B 1UA1A 1YRUA 5IT9Y 5B0CA 1S1WB 4QCLA 3CO9A 4F4WA 1T9TA 4ED3A 3AT1B 2I38A 2DY1A 1FRJA 2C3MA 1H0HB 2JC1A 3RGIA 4HL9A 3SCIE 3TZYA 4DR6J 2IPOB 4K4XA 3G8QA 3W3SA 5BR8F 4DR6F 3P96A 4DXLA 1HBUB 1G2EA 1UPMB 4PQUB 1RT1B 2HBRB 1KQGB 1R0AA 3CCSS 1AXQA 2OO4A 3HFKA 3P3DA 4B02A 2WW4A 4YB1P 1HBUA 2KZZA 2UUAF 4PQUA 1RQ0A 1NCLA 1OS5A 2BR0A 3V81B 4WXOA 2I5JB 3Q24A 3FMBA 4L3KA 1YRXA 3GWCA 2C2DA 1SI9A 3MXHP 3C6TA 2ZDPA 1UCNA 2NXEA 4KO0A 3BZQA 1JWWA 3KUHA 3KJQB 2V63A 5EGYA 4HHJA 1RDRA 4U67Q 3W9IA 2IYIA 4L76A 2KZMA 3QGIA 5IWAJ 1CJVB 2JLEA 1JLAA 1R27B 4ZVQB 2V34A 2ROGA 1N33F 1S0MA 4IRKA 4QQBA 3BJYA 2ZFHA 3CF5Q 1CJVA 4PG6A 1KHVA 5KFGA 4X4NA 4K50A 4USKA 3GIJA 2AX0A 3UNGC 2HHTA 3E8OA 2KXHA 2EW9A 2IIHA 4RWXA 1QTNB 1S9EB 1XR5A 3C66A 4HH0A 2MZQA 3TNVA 2FLOA 7AT1B 3I96A 2MZSA 3MECA 1S9EA 3RRGA 2EG1A 2ZC3A 1M90T 1BWVA 1WEYA 3PY8A 3K89A 3ZZRA 1C0UB 2L41A 2GO9A 4MKVA 1PC4A 3CIMA 1QSLA 1K1SA 2E1AA 5CYQA 1M1HA 2Y1RI 3CJ2A 2PT0A 2Z0GA 3HHLD 4JOUA 2KVIA 3A3NB 5B08A 2RU9A 1S49A 4KKOB 4DJBA 2CJYB 1TUVA 1YKWA 2CG8A 3OTDA 1VISA 2XLIA 2ACMA 3PTWA 4OL8A 1VRUB 1VI7A 2W4PA 1RTIA 2A0FB 3PRVA 1TL7B 3PJWA 4CLLA 4RLEA 5KFJA 2AWZA 3IBCB 3DRXA 4LF7J 2ZBCA 3KG1A 1VRUA 4X4QA 3PHTA 4LF7F 5CYMA 2FJVA 3UDLA 3L7UA 3RB6A 5KFNA 2BQ3A 1X4CA 2MY8A 1KNZA 4A4JA 3W8PA 4QYRA 1AA1B 1R8HA 4ED8A 1CBKA 3DLHA 2R7TA 5AJ3J 5AJ3F 4HH1A 2DH9A 2RT3A 4CLFA 1T7PA 2GQCA 1UWAA 1WHXA 5B0DA 4C8KA 2YBVA 3MM9A 5JXSA 3DRRA 2A18A 2UXCJ 1F9FA 3QGHA 4KB7A 2UXCF 3UN2A 2NSBA 3H98A 3CMAS 5AXLA 1IKYB 2MZ1A 2FHMA 3IO1A 3QWUA 4ZDNA 1NJYA 2YWEA 2NXNA 3QO9A 2GQ2A 4RW9B 1RAFB 1FJCA 2GIFA 1IKYA 3OL6A 4I4BA 4ETXA 4CWBA 2FLPA 1E6YB 5HL7Q 5AE3A 1YI2S 4RW9A 2BJ1A 2K3KA 3QT7A 4AXJA 3NCPA 4LF4J 1UFKA 1SL2A 1E6YA 1RA7A 3MDFA 1ZOTA 3DLKB 3GZ7A 3JSYA 2GV1A 3QJLA 1H2UX 2E1CA 4IO1A 1RWKB 4L74A 1GXTA 2Q1LA 3PDNA 2Z56B 5CAAA 2XG8A 2XI2A 2KFYA 3MEEA 1LWXA 5BJRA 1Z2LA 3BN4A 3TUPA 2B6AA 3DDIA 4EO8A 2I0XA 1FEEA 2R42A 3TVKA 5JJBA 1RA6A 3CJTA 4X4VA 2OSRA 2HHHF 3BSOA 2H51B 2ASDA 2CDRB 1NK7A 3RW7A 5L1JA 4OX9J 3IR6B 4EYHB 4OX9F 4LRCA 2ZJRQ 1OMSA 3D4JA 4GKKJ 4HYKA 3A8IA 5J2NA 5FIIA 4GKKF 3VHQA 4PRFA 3KNGA 4NEZA 2G13A 2WRMA 3HULA 1KQKA 4CO5A 1FFWB 5IXUA 4NXMJ 1HMVA 2DRBA 1HARA 2ZEJA 3UR0A 4NXMF 1XC9A 3MAHA 4DF8A 1FHTA 3NG8A 3D6TB 2HURA 2GIQA 1Q16B 2MLXA 2D74B 3UI3A 1R43A 2R7SA 4OX6A 3VQSA 4GC6A 4L6V3 1HBOB 1PYOB 3M8PA 1FRKA 1NH7A 2E66A 2YX4A 2GC8A 3IGNA 5GAGI 1XERA 4AYBD 2EBEA 4KV8B 2OI2A 1RAGB 1DTTB 2BEFA 3KK3B 1JXEA 3L4BC 2ALZA 4LRDA 4JI5J 5F8MA 4ES2A 2W4DA 1TKZA 3H5YA 2E5IA 4NLQA 3KLGB 1RT7A 3GSIA 3SCJE 4NLVA 4HTJA 1WTFA 3OFGA 3KK3A 1S10A 3CCES 3U02A 3GJRB 3THTA 2IM1A 3KLGA 4EEYA 3EX7B 2RF2B 2VFUA 3G2XA 2NPIA 1U1QA 3SFGA 2P5VA 1SCJB 2VONA 2J7KA 4KAIA 2RF2A 4EFAC 4GC7A 2DR7A 5GAEU 2OAUA 3OLBA 2B8QA 4Y65A 2KRRA 1HQUA 1FTCA 4TYAA 5F8JA 2FUG9 4ED5A 2QMXA 4NOHA 2CJBA 2HFUA 2B0GA 4LQ3A 4URQU 2VPYB 5ETQA 5C7PA 2Z58B 1WEZA 4A8KA 4C3KA 2VHGA 2L9NA 1WG4A 1HD1A 3ZNJ1 4YP3A 1I5OB 4UZCA 3O3LA 3AAWB 1BQMB 1RWUA 4M63A 4NLPA 2EKNA 2DNMA 2VFTA 2N3OA 3ZZTA 4DUYJ 1CSJA 2U2FA 3V5RA 1R0BG 4RNNA 2PFDA 4QU6A 4X4PA 2NLWA 4Z7CA 4ID5B 3SXLA 1N6QA 2CJAA 3P6YC 4G6VB 4ANEA 2XLJA 1VQ9S 1PIEA 4CO2A 2RDIA 4USWA 1A6LA 3OSNA 5L39A 3NL0A 4Z2XA 2MQMA 1C1CB 4ZCLA 3W5ZA 1N34J 1IR1A 5CD4H 1UVIA 4F0HA 5K5MA 1C1CA 3GTYX 3D2WA 2JVOA 1JKHA 1L3KA 3ET6A 2FVRA 4R5PB 2J0QD 1RTDB 2IC3A 4MMOA 4Y2MA 4ALZA 5AT1B 2BE9B 4B9TA 3OR1A 5KFXA 1R8BA 2M0GB 1LFPA 1FJGJ 4C3MA 5EX0A 3ULHA 1B7YB 1JXLA 1FE4A 2FPHX 1RBOB 4ZVFA 4NZ6A 2HFNA 1WD6A 2M8HA 2ZH8A 2L3MA 2FGCA 1MMLA 4CIOA 3N6NA 3TYTA 3HVRA 3LQVA 4I2PB 5LJ5Y 4NL5A 4FXDA 5D4NA 4DV3J 2HNYB 3DOMA 4DV3F 4JI4J 2J6TA 4I2PA 3LWMA 4JI4F 3G87A 2YKMA 1F5AA 1S1VB 2C2EA 1FT8A 1WKKA 3CD5A 2YWWA 2AX1A 2MZJA 3OR2B 2QA1A 2ZD1B 4DX8H 5KFCA 3IC1A 4YQWA 2AJQA 4WWSA 4LF5J 3MAAB 4PXEA 4M94A 2ZH3A 1RWVB 3IR7B 4FNHA 3WHIA 4DDFA 1NRKA 1TKTB 5A76A 3LP1A 3MM8B 2CJ9A 2ZH5A 2B9YA 3PHEA 3O5TB 4AQYF 1TKTA 1DFDA 1YSJA 2V4QA 2WONA 2QFJA 2NR0A 4F4KA 2C22A 2FVQA 3ZZOA 3H0PA 3UE2A 1RAEB 1U1KA 4ZLPA 1UZHA 3MF5A 3RR8A 2XTJP 4NMLA 4GRSA 4JV2A 1BQNA 3QQCD 2VG7B 3UD4P 5DDQC 2N3LA 4JI0J 2WK4A 2BKPA 3AOCA 4MKAA 1Q86T 4DV4J 2L9DA 2X51A 3PNIA 2IM0A 1RTHB 1QVFR 2VG7A 1RP5A 3QLHB 3KG4A 4ZLNA 3DLLQ 5CZVA 3BO3A 2JEIA 1KLMB 1VIXA 2HLUA 1FNMA 3UW1A 1RTHA 3MEKA 1YJRA 2EBGA 4RL1A 3MM6A 2JDJA 2ZM6F 2OD4A 1KLMA 4EI2A 3DLGA 1RSCA 3BSAA 3D67A 2DNLA 5HBMB 4HHHA 2DPJA 1XIQA 3MCMA 4N76A 1FX4A 2XMAA 3CCMS 4J90A 4I6AA 4IQMA 4DV7J 3NMAA 2Q66A 4DV7F 3OXFA 2CQPA 1SC3B 3PFOA 4CTAB 3QFWA 1EETB 3C15A 3OLAA 3CJQA 3W8GA 3KWMA 1P9YA 2VJUA 2VB6A 4EO6A 4W90B 1EETA 4NZ7A 4DN0A 5EDWA 2GO8A 2MPUA 5KFAA 2OIHA 2C2ZB 4ZP9A 4QBUA 1HNIA 2CQ3A 4NCGB 2VKRA 3GG1A 3UVJB 3IWNC 2E29A 3SI8A 3AD7C 3GYXB 4X4RA 1YDLA 1HHQA 2HBQB 3M8YA 4CNYA 4F3QA 1T9VA 1ZTTA 1TK8A 3CD7A 1FD8A 4ED1A 1RZMA 4TU7A 4TU8A 4LUBA 2E7WA 1JLFA 5KT2A 3CDEA 2RU3A 2YX1A 1N0VC 3UDCA 2CQ0A 2VU5A 2G4BA 1D3WA 4CO1A 3AQOA 1S12A 3IWLA 3TRGA 3L95X 4CH7A 4QYZJ 2UU9J 5J2PB 2D1CA 4U8YA 3A12A 2UU9F 4IDKB 2YPYA 1FO1A 3MHYA 3SFUA 4NXNJ
chains in the Genus database with same CATH topology
3DOMB 2JNJA 3DGPB 1YDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOM B;  2JNJ A;  3DGP B;  1YDL A; 
#chains in the Genus database with same CATH topology
 2LP4 A;  2YNG B;  1U1L A;  3DLE A;  3M32 B;  4P9S A;  4HI1 A;  4MYT A;  2MGZ B;  2QJ3 A;  4XAK A;  2SXL A;  1KHW A;  1TUW A;  3K5L A;  3HHL C;  4CO3 A;  4AL6 A;  2CIM A;  2B9E A;  5A8R A;  1GX6 A;  1N5Y A;  1VQ4 S;  2GZO A;  1S6Q A;  1Z2Z A;  2MGZ A;  4Y2A A;  5IZH A;  2BVZ A;  4Z37 A;  4MK7 A;  2RML A;  2Z57 B;  2KJV A;  1HNX J;  1FWK A;  4NYP A;  1NDL A;  2DNQ A;  3UDE A;  1RT6 B;  5HK4 A;  2ILY A;  2FY1 A;  3UCU P;  1LQ9 A;  3CMQ A;  1IM6 A;  3R5B A;  1DLO A;  3WIV A;  5KG4 A;  3PVX A;  2YNI B;  2JEJ A;  2WCX A;  3SQG B;  4I0W A;  3GIK A;  1HNZ F;  4OHZ A;  1FEH A;  4WYL A;  3OBI A;  2OPR A;  1HI8 A;  4FNI A;  4NPO A;  4WFX A;  1T9U A;  3KG0 A;  1P6T A;  4NE9 C;  3UWT A;  3PAC A;  2YNI A;  3M1V A;  5GAD U;  1NK4 A;  3MED A;  2MEW A;  3CCQ S;  2AKW B;  2VOO A;  1Q4R A;  4JI6 F;  1TL4 A;  5KFB A;  2QFI A;  5H9E J;  2PEB A;  1VRQ C;  1U47 A;  2CAD A;  1VBK A;  2CPX A;  1S1T A;  4C4W A;  3BGF A;  3CE8 A;  1RT3 B;  2DBB A;  2OML A;  4V1A k;  2R8I A;  1M5O C;  2DNH A;  5HAT A;  2DGV A;  2PMZ D;  5CYJ A;  2MHE A;  4PWD A;  4CO4 A;  2UUB J;  2OP5 A;  1T9W A;  1SJF A;  4ZHR A;  2G0I A;  2V8P A;  3TO8 A;  2ZUG A;  3K8W A;  3RG6 A;  3E01 A;  4YFU A;  5E3R A;  2BV3 A;  2E7X A;  2V68 A;  2WSC C;  3LOU A;  2HPU A;  3KHG A;  5CXT A;  2GS8 A;  3EYZ A;  4OYB A;  1FVS A;  3FEZ A;  4MIA A;  4C97 A;  2CQ4 A;  3A4T A;  4DSK A;  1U48 A;  1V3R A;  3UCZ P;  2COL A;  3KLE A;  1U6B A;  1IR0 A;  3PR5 B;  4A8Q A;  1RTZ A;  4EGL A;  1CJU A;  1G1X A;  3R5C A;  5F3T A;  3W5X A;  2LVW A;  2RQK A;  3PKM A;  4B9L A;  4H54 A;  2IBO A;  4R0J A;  2KVQ E;  4N8O A;  2XQC A;  1LV5 A;  1K0T A;  3PYG A;  1VBZ A;  4JP8 A;  5D8H B;  2W24 A;  3TAQ A;  5EWG A;  2YKA A;  4M5H A;  5L9X A;  2W2Q P;  4CM0 A;  4A8W A;  1YBT A;  5GAH I;  3J7Y I;  2HGN A;  2UXD J;  3T1Y F;  4OFZ A;  2UXD F;  1EKS A;  4CLZ A;  5LSO A;  1GX5 A;  1U24 A;  4V19 J;  2R7W A;  2K1R B;  4OV6 A;  1UKU A;  4G1Q A;  4P2F A;  4AND A;  2AV5 A;  5I3P A;  2W7P A;  3NS7 B;  2CWX A;  4RW8 A;  4DSJ A;  2VIC A;  1RGV A;  1JIH A;  3MMC A;  2HFO A;  1TV6 B;  2K1R A;  5KT5 A;  4OZ0 A;  4IR9 A;  2DHA A;  2GFF A;  3EDQ B;  3PW2 A;  2Z2Y B;  5CQG A;  1FDD A;  3HMJ G;  5HAN A;  2W7O A;  4IUF A;  5ETT A;  1TV6 A;  2CPY A;  1KDN A;  1RWO B;  4GVB A;  1JMT A;  2IRY A;  1I94 J;  2VZ9 A;  3G96 A;  2HVZ A;  2QLB B;  3LH2 S;  2B56 A;  3O8W A;  3FQK A;  2FC8 A;  1XMQ J;  1AFI A;  5HJX A;  5AXK A;  1XMQ F;  4ZLL A;  3E2E A;  3U1L A;  1IBC B;  3TA1 A;  5KFP A;  2M3D A;  1NZ8 A;  3J80 U;  2BZ2 A;  5AXM A;  2O66 A;  3QZ7 A;  3ZC4 A;  2NQP A;  1MG7 A;  4F7V A;  4YN3 B;  2LQB A;  1X0F A;  4RJV A;  2R2R A;  1Y4Z B;  5HLF A;  3BYR A;  4ZIT A;  2FDN A;  1RKI A;  2ZE2 B;  3MFI A;  3CJ3 A;  1KEK A;  3DGP B;  1NKC A;  4ECZ A;  3V4I B;  3Q8S B;  2VFS A;  1PBA A;  2F1F A;  2ZE2 A;  3TZW A;  1U0S A;  3VV2 B;  5ETL A;  4PWU A;  3I9V 9;  1YJW S;  3ILL A;  2NUU G;  4H4O B;  1KS2 A;  1LEO A;  2I8E A;  4TXS A;  4F36 A;  4B3S F;  5FJ4 A;  3CJ0 A;  4PQA A;  2RIJ A;  3T5K A;  2EWH A;  4NI2 B;  5I3U A;  1K9M T;  2R2S A;  3HHE A;  3MR6 A;  2W8K A;  1U7L A;  2BJ7 A;  2CA9 A;  2OPS A;  1VQN S;  4TY8 B;  1M5P C;  2L08 A;  5L8R C;  1SJQ A;  3KMQ A;  3BQ0 A;  2XMU A;  3VAM A;  2QE5 A;  2HSE B;  4LQ9 A;  4TY8 A;  2IVM A;  5E2Q A;  2XSF A;  4WTO B;  1BWE A;  3ZZU A;  4NA1 A;  2GAH C;  4F04 B;  5L9N A;  5HN0 A;  2YNF B;  1P8G A;  4QYZ K;  2BOP A;  4OI1 A;  5KG1 A;  3D68 A;  1JLG A;  2HS3 A;  2JZ5 A;  3AFG A;  4ZOS A;  1RCO B;  2DR9 A;  5IQQ A;  4B3O B;  4X4U A;  1J27 A;  3HVA A;  2YNF A;  2FIU A;  5G0R B;  2E9T A;  2CUY A;  1D9F A;  1CPZ A;  3RUB L;  2E1P A;  1FXR A;  3AQP A;  5T14 A;  4B3O A;  1KQF B;  3KDO A;  4QOT A;  4CLT A;  2R7V A;  4CLS A;  3HCX A;  1RUS A;  1V9O A;  3NS5 A;  4DCP B;  4L75 A;  3DYA B;  4YHH J;  3R7N B;  4OHV A;  4DL3 A;  2C2K B;  3BGR A;  3HPO A;  1NJX A;  2HHQ A;  2DNN A;  4Q0B A;  4LIW A;  2ADB A;  2IJN A;  3V6K A;  3QYY A;  3DYA A;  3AJ2 A;  4JV0 A;  3CDW A;  3OT9 A;  1SBR A;  3W7B A;  2EC2 A;  3ZNU A;  4U9R A;  2QA4 S;  2QYG A;  3HJV A;  4ED6 A;  1Q5V A;  3H40 A;  4USH A;  1A7G E;  4OYX A;  4O3P A;  2DNR A;  1SUQ B;  1RWN B;  2I2Y A;  3CSK A;  2HGL A;  1TK5 A;  5H9E K;  2VDH A;  5IS2 A;  2X1A A;  4IFY A;  1FWP A;  4O44 B;  1SUQ A;  2NYH A;  3J81 Y;  3PO5 A;  5KOX A;  5F8G A;  3KMS A;  4IH6 A;  4DCO B;  1RYS A;  3M8W A;  4DR1 J;  4K5S A;  3KUE A;  4CRJ A;  1SB6 A;  3O44 A;  1Z4U A;  2R9L A;  1S4E A;  2P2C B;  3DOL A;  3L7O A;  2CQB A;  3NRB A;  3E51 A;  4ZKA A;  4DV0 F;  2V2Q A;  3ETO A;  2QN6 B;  4ECV A;  3MAQ A;  1OJ4 A;  3IN5 A;  2ZC4 A;  2FGO A;  1TKX A;  2UVW A;  4Q45 A;  4UY8 5;  1X4G A;  3W2W B;  1WF2 A;  1RHK B;  1C4C A;  5M2R A;  2HZA A;  1HYS A;  3A1Y G;  2H54 B;  2KKH A;  4IKA A;  1TP7 A;  2QX0 A;  1FCA A;  4WU2 A;  3CED A;  3DN9 A;  1YIT S;  2BE2 A;  3PJ9 A;  4KRW A;  5B0B A;  1MSW D;  2PEH A;  1F0X A;  4DR7 J;  5HQ8 A;  7FD1 A;  2N4C A;  1YX2 A;  2VBY A;  1HPZ A;  4FF3 A;  1L3V A;  4K4U A;  1OSC A;  3T3F A;  1S6P A;  4DL2 A;  1C0T A;  3JQK A;  3G82 B;  4RBV A;  1H7W A;  4J91 A;  2Y9H A;  5H9F J;  4OZ2 A;  3DOK A;  2GGP B;  4PUO A;  5J1P A;  1MU2 A;  4E8U A;  1X31 C;  1RT5 B;  1SKR A;  3C2P A;  2XC9 A;  4LSN B;  2DK2 A;  2ZHB A;  5D3G A;  2IFX A;  3K57 A;  2GGP A;  1JLE B;  3OUY A;  4PXD A;  4K4V A;  1CJT A;  4ZPW R;  2E5J A;  1VS3 A;  3ISZ A;  4RNH A;  1IBK J;  3Q2T C;  2RIL A;  4LSN A;  1IBK F;  3FGV A;  4RUC A;  3LAL A;  1NHK L;  4LR7 A;  1RLD A;  2QL5 B;  4TN2 A;  2QEX S;  2BJ9 A;  1DUR A;  2BXJ A;  2WVE A;  3VF0 B;  2VUG A;  4O3O A;  1TL1 B;  4QZV B;  1DBD A;  1H74 A;  2UV8 G;  3NAI A;  2MDA A;  3CC7 S;  1UWB A;  3S8S A;  3DM2 B;  3THP A;  1Y11 A;  2F5G A;  2I9S A;  1NM2 A;  2MQO A;  4IRC A;  1SV5 B;  2BW2 A;  4ZCI A;  3LGN A;  3T1A A;  4HDG A;  1H72 C;  1W7W A;  3F44 A;  3ZZZ A;  5ETV A;  1IKW B;  3DRS A;  4ILM A;  2ZOF A;  3CT9 A;  3M9N B;  2ERR A;  1HA1 A;  2OJ3 A;  3AJD A;  4WFA Q;  2R4F A;  2N7Y A;  3T6J A;  2NPF A;  2ZIT A;  4KHP J;  3D7S B;  4PR6 A;  2UUC F;  4KHP F;  2MST A;  1SQF A;  1QY7 A;  4Y0F A;  2HBZ B;  3W64 A;  2M9K A;  3W1Y C;  3LP2 B;  1FXL A;  1VFJ A;  1UJ4 A;  3I4P A;  2QA2 A;  4LSL B;  5C25 A;  4DQR A;  2HHW A;  2RUS A;  2O01 C;  2AW0 A;  4LSL A;  2DGO A;  3FKB A;  3OXL A;  1OY8 A;  1MWQ A;  4ELU A;  3M8Z A;  1GH8 A;  3JAM U;  1X4B A;  1E6V B;  2C28 A;  1T05 B;  4DV2 J;  5K8O A;  4DX5 A;  1ELO A;  3KJV A;  1H38 A;  2J9E A;  1E6V A;  1M5K C;  3GV7 B;  1XNR J;  4D3G A;  2J8A A;  2KN4 A;  1PGZ A;  3QRP A;  2PDA A;  4QR0 A;  3I0S B;  4NLW A;  1RBA A;  4NCB A;  2MKC A;  5DET A;  1QLN A;  2CQH A;  1Q8L A;  2UV8 A;  4YR3 A;  2OSQ A;  5D0G A;  4WE1 A;  4LT6 A;  3NCQ A;  4RR5 A;  2EEY A;  2XZT B;  4IOA Q;  2DNY A;  5C2G A;  1H2V Z;  3HHN B;  2KRB A;  1UEU A;  2A1B A;  4ZS6 A;  3UNY A;  3TZZ A;  1CS4 A;  1AT1 B;  3QRQ A;  4P52 A;  2XWX A;  4O0N A;  3C8Y A;  2DNG A;  3MGJ A;  4PG5 A;  5BYR A;  4LVN P;  4DSI A;  4HVZ A;  1IKV A;  4UST A;  1WI8 A;  2MLZ A;  4TU9 A;  1GMW A;  3AY0 A;  2RRA A;  3UN3 A;  4LF1 A;  3W2V A;  4KSE B;  3B4D A;  3D6H B;  1U2C A;  5JVH Q;  2W4C A;  3SCL E;  2JL9 A;  3ILO A;  4W92 B;  2CPI A;  5IM0 B;  4F4X A;  2DPI A;  1RBL A;  3MWB A;  1NEE A;  2OTL S;  1RAA B;  3MPY A;  2VG6 B;  2MMY A;  2VBZ A;  1YJU A;  3CJR A;  2WW8 A;  1FER A;  5DM6 Q;  4A48 A;  5KOW A;  4WFB Q;  2AYG A;  3PW5 A;  1TTH B;  2ZNY A;  3ETM A;  2HQI A;  2BKO A;  2IMW P;  3HP6 A;  3AJ1 A;  1ICE B;  2BX6 A;  3VR1 A;  4KFB B;  3J7Z 5;  2LXF A;  2WVC A;  1TVR A;  2CVE A;  4UOH A;  3TEH B;  2LLZ A;  2O67 A;  4OV1 A;  1N5T A;  1NKE A;  2FJE B;  4J9L A;  1QE1 B;  2FJA B;  2F7V A;  2FHJ D;  4Q8F A;  2IMO A;  3R9L A;  1NJI T;  1IUJ A;  3VGV A;  4JYA J;  4J9M A;  2FHK A;  3G9C A;  4MKB A;  4OYP A;  3K5P A;  5E7O B;  2O5D A;  4Y28 C;  4Q5V A;  1S97 A;  4M95 A;  2GML A;  5L38 A;  1N5Q A;  3DMJ A;  3H2L A;  5LL6 d;  3NGR A;  1RHJ B;  2CPD A;  5KFI A;  3Q8Y A;  4OZL A;  2MJN A;  3C14 B;  1RCX B;  5LMU F;  2DNK A;  4O23 A;  5F8H A;  2JLF A;  1YTY A;  3GQC A;  1TEL A;  3SZ2 A;  4NLR A;  3DHW C;  3N6M A;  4CNZ A;  5GMK a;  3C14 A;  2KO1 A;  2XMV A;  4U6P A;  4RO0 A;  2YQ1 A;  3HO1 A;  4ZP8 A;  1HI1 A;  1TL3 A;  5J1E A;  5M2U A;  4X62 J;  3MOJ B;  2IHR 1;  1Y5L B;  4KPY A;  4P6Q A;  4JUZ A;  4X62 F;  2MHN A;  1NAQ A;  4G3I A;  4DR5 J;  2YNH B;  5B0G A;  2FD2 A;  5CCL A;  4IG3 A;  3Q22 A;  1SC6 A;  2A6O A;  1H2T Z;  2BJD A;  1WUU A;  2QMU B;  3IAS 9;  3A3O B;  4ID8 A;  1J5E F;  4C11 A;  3G86 A;  1RWW B;  2Z4P A;  3EGW B;  4BLG A;  3F73 A;  4DI6 A;  3FEY B;  3DXS X;  3PW0 A;  3KLI A;  2UZA A;  5D0H A;  1F5C A;  1P1L A;  4U7U K;  1U4B A;  1Q79 A;  1Q1K A;  4RBT A;  1NZA A;  5A0Y B;  3VAJ A;  3R5A A;  2HHP A;  2FVS A;  2ZZN A;  1SC1 B;  4UTG A;  4QWC A;  3CCV S;  1WHY A;  4QPT A;  1S1U B;  4ES1 A;  3KLF B;  5A0Y A;  2VD3 A;  1MMN A;  3PV8 A;  1BQX A;  1LWF A;  1G6B A;  3NNA A;  1IBM J;  1VHF A;  1U1O A;  1K44 A;  1IBM F;  1NSA A;  3KLF A;  4QW8 A;  1RHQ B;  4DPX A;  3H42 A;  2XM3 A;  1M1K T;  2OEL A;  2CPF A;  4LF2 A;  2XZD B;  1XEZ A;  3W65 A;  2DHG A;  3TA0 A;  4ECX A;  1IBL J;  4C0H A;  5KFS A;  3F41 A;  5CZX A;  1NK6 A;  5I42 A;  4ZVO B;  1FDB A;  4M5G A;  1F9H A;  4IFV A;  3ILJ A;  3US5 A;  4DV1 J;  3KK2 B;  1RTJ B;  3M8R A;  1S6U A;  3Q8V A;  1X0P A;  2X7I A;  2AJ0 A;  2ZVI A;  2W8L A;  2IYG A;  4QR1 A;  3QID A;  1SJ1 A;  3MTJ A;  4ZPA A;  2PN6 A;  4FF2 A;  3KK2 A;  4MIW A;  1QDU B;  3RAX A;  2ZH9 A;  2OUG A;  1S1X A;  4TKT A;  5I4M A;  3TUJ C;  3CCT A;  1VQS A;  3JB9 k;  3S6E A;  3BRE A;  1RHR B;  3VGT A;  4LVO P;  3R5D A;  5CAB A;  1FTR A;  4UY8 T;  4EYI B;  1X4D A;  3LP0 B;  2HRT A;  4NCA A;  3J7A 1;  4KYZ A;  3VAL A;  4N56 A;  2QYC A;  3SDE B;  3MEG A;  1L3T A;  3PR4 A;  2AGO A;  1KWM A;  1NJZ A;  2B5J B;  3H5U A;  1T03 A;  2ZJP Q;  3TVY A;  2H9Z A;  1BXN A;  3SDE A;  4IG0 B;  1DQ9 A;  5HVF A;  2BAN A;  2JWN A;  4LR9 A;  3CD6 S;  1TKD A;  4RW4 B;  4E0D A;  3I5A A;  2ZBQ A;  3TQ1 A;  1QTM A;  4CH0 S;  2XS7 A;  4B9N A;  2DH8 A;  1LK7 A;  1JJ2 R;  1SKS A;  1RAC B;  1MRO A;  3EUN A;  5KFZ A;  4RW4 A;  1CG2 A;  2IVY A;  2V67 A;  1VJW A;  2UUW A;  2CPE A;  1FJ7 A;  4WTY A;  1URN A;  1VQP S;  3GJS B;  3Q8Q B;  1DRZ A;  2HVI A;  4PAB A;  4ZN1 A;  3AOD A;  2EFG A;  4C8N A;  3GE9 A;  3TAM A;  2AJ2 A;  3K0J A;  2VG5 B;  4RNM A;  3IRW P;  2HND A;  1KFD A;  4I6W A;  2GHP A;  3C6U A;  2GVZ A;  5T7L B;  2HMI B;  1RWP B;  3TJ8 A;  2XYP B;  1RIS A;  2W9C B;  1F2G A;  2GVD B;  3WIU A;  1Q82 T;  7FDR A;  1BLU A;  3J80 Y;  4A8F A;  1VR6 A;  1CUL A;  4FKY A;  3PO4 A;  2RHS B;  2R3V A;  4LF6 J;  3HZE A;  2GVD A;  1JB0 C;  5LOQ A;  2M52 A;  4A8X A;  2ZKT A;  4GO7 X;  3KNA A;  3VAH A;  3G8S A;  3T1H F;  3ELH A;  2J0W A;  1UTA A;  2CPH A;  3H25 A;  4UOC A;  3DI6 A;  3NEK A;  2UP1 A;  4LFA J;  3CC2 S;  4LFA F;  2BRK A;  1EX8 A;  3TJ9 A;  2ZH2 A;  2RB7 A;  4OYI A;  3FBF A;  2QV6 A;  3G71 S;  2FZK B;  1HBM B;  2VC1 A;  2DNP A;  4DR3 J;  3VAK A;  1WI6 A;  4Y6I A;  4BDP A;  1SVD A;  2ZH6 A;  2XGQ A;  2V94 A;  1VQ5 S;  3HKZ D;  4BWM A;  2HK3 A;  3ONQ A;  2F9J A;  5E3Q A;  2EFV A;  2A10 A;  1ARO P;  1JJH A;  3FCH A;  4O3R A;  4JBC A;  3AA9 A;  3JYT A;  3TX0 A;  5DG7 A;  4WJB A;  3MPD A;  3IM8 A;  4N8N A;  2HGM A;  3JQM A;  1KN6 A;  1O6X A;  2VBW A;  2E9Z A;  3MM7 B;  4DPY A;  1APS A;  2LKZ A;  1S9F A;  1EP4 B;  3HF5 A;  1RAJ A;  3CCL S;  4EZ6 A;  4GMK A;  3M30 B;  2ZHA A;  4OZJ A;  4TY9 A;  3BDP A;  4H4M B;  4CCH A;  4YY3 J;  1RK8 A;  3HHL B;  2EK1 A;  4YY3 F;  1U0H A;  2AZ3 A;  2K7J A;  4ERD A;  1V5V A;  1T3N A;  1NH8 A;  1VDH A;  4P10 A;  4BC9 A;  2QMW A;  1T94 A;  3V2U C;  1N56 A;  4P71 A;  1REV B;  3IAM 9;  2HWT A;  4O4R A;  4M5D A;  5KFQ A;  2M5Y A;  4U96 A;  3D1O A;  1WWH A;  3QJJ A;  2V5H G;  1RI7 A;  4FN5 A;  1X9S A;  3OQ2 A;  2AEJ A;  3QWP A;  5FD1 A;  1S9G A;  2WVF A;  3HT0 A;  3DNC A;  2HS0 A;  2K2P A;  1HR0 J;  2NZ4 A;  1JLC B;  2FLL A;  3BEG B;  4BHQ A;  4DQP A;  2RDD A;  1FRL A;  1S1W A;  4E98 A;  2AU0 A;  4UQT A;  1FDA A;  4MTP A;  4N7T A;  4P75 A;  4R0E A;  1VCT A;  5D15 A;  4ZIW A;  1K1Q A;  1SIW B;  2J7W A;  3T6B A;  3TEG A;  2W9A A;  5KFV A;  1SL1 A;  2XI3 A;  3MR5 A;  1RT1 A;  4DS5 A;  2Y1L B;  1NHU A;  3RAM A;  4PCQ A;  1R6Y A;  3G6Y A;  3AH6 A;  4WP3 A;  3VGU A;  4WYW A;  5EN1 A;  1FRH A;  1V3S A;  2RE1 A;  1PSD A;  3V81 A;  3HK2 A;  2LQJ A;  4YB6 A;  2W2O P;  3HVT B;  2I5J A;  3RW6 A;  3EM1 A;  1B3T A;  2W25 A;  2VDI A;  3WQP A;  1CLF A;  4P2X A;  5IWA F;  3HVT A;  3I55 S;  3DRY A;  5HQL A;  3QT6 A;  4F2S A;  4JI8 J;  1T0T V;  5HO4 A;  4JI8 F;  3JS9 A;  1FKP B;  3EPI A;  1VRT B;  2J0X A;  3IBF B;  2KT3 A;  1DAX A;  2WAQ D;  4FS2 A;  2PI5 A;  4ZJQ A;  2AGP A;  1X8D A;  4F25 A;  3POT B;  5BYQ A;  1Y7P A;  4B08 A;  5KTQ A;  1S6O A;  5K14 B;  4UOG A;  2QLW A;  3MMA B;  1S99 A;  2OHD A;  4ZP7 A;  1TQL A;  2BAC A;  2VQF J;  1KOO A;  3J7A N;  3H2V E;  2RRN A;  4CT8 A;  3MTK A;  4CLY A;  5SZT A;  4LRA A;  4DLG A;  3QAT A;  4PXB A;  2E1R A;  1GXU A;  2CQ1 A;  4XDD A;  2DNO A;  3R1L A;  5KFW A;  4JV1 A;  4LSZ B;  3QIP B;  4NA2 A;  1FA0 A;  1C0U A;  1SJ3 P;  1UA0 A;  4EMD A;  2EK6 A;  1S0V A;  2DO4 A;  3FCW A;  4FVM A;  3CCW A;  4G1I A;  5E5N A;  5A8K B;  3P45 B;  4PG8 A;  3V6D B;  5HMZ A;  3SV3 A;  5EUH A;  3PW7 A;  4KKO A;  4LRE A;  4ZVE A;  2QL9 B;  3G6X A;  4ZVH A;  1N5S A;  4DU7 A;  3TUZ C;  4BWJ A;  3D0G E;  2QZ8 A;  3DDK A;  4XDC A;  3T9N A;  2FHO B;  4PEO A;  2ZWP A;  1K0V A;  3B78 A;  3MUR P;  2CJX B;  1VQ6 S;  1O51 A;  5DG8 A;  1TL7 A;  3CCR S;  4YDD B;  4WIQ A;  3NOC A;  4LR8 A;  4HLB A;  2BJ3 A;  4F3O A;  4WZQ A;  2BE7 D;  3GP9 A;  3AB2 B;  2RNE A;  3C16 B;  1ZM9 A;  3Q89 A;  5HSP A;  4LBI A;  3W9J A;  3JAM Y;  5C42 B;  1UET A;  3OL9 A;  1ZS6 A;  3FUY A;  3JXO A;  2GX8 A;  3EPG A;  1CQN A;  3H4B A;  3UQS A;  1NK0 A;  4PYA A;  5J2Q B;  3HSG A;  2J9D E;  2ZH7 A;  3MD3 A;  2PSZ A;  5C42 A;  1NU4 A;  3I4H X;  2ZNZ A;  4QPX A;  1ROF A;  1FES A;  2GA7 A;  2IJR A;  1VK3 A;  4DG1 B;  1NDC A;  4N5S A;  4K4S A;  3AHP A;  3HX9 A;  1HWL A;  1B0P A;  2CNK B;  2QO3 A;  2J76 E;  2OPQ B;  1NSP A;  1Q8B A;  2BOA A;  2W9B B;  5DDR C;  3O1L A;  1LNQ A;  2H3E B;  4TYB A;  4DG1 A;  4J9R A;  3FQL A;  3NXZ A;  2HKE A;  4TLQ A;  3EWG A;  3N0V A;  2KB2 A;  4K8R A;  5D4L A;  3BGU A;  4V19 X;  2HW3 A;  5F41 A;  1UVJ A;  1FE0 A;  3TA2 A;  1B4S A;  3OTO J;  1MMD A;  5GAE I;  2PE8 A;  2W7A A;  4ILL A;  3OTO F;  4ELV A;  3NNH A;  3H5X A;  3FBE A;  5HVG A;  4ZCK A;  3PRB A;  2XLK A;  4YB7 A;  1LKZ A;  3OL8 A;  1I51 B;  3GYG A;  5LMN J;  4LF4 F;  3EIC A;  2AYB A;  1F2H A;  3RBX A;  5MLC V;  1NXI A;  1U6F A;  2IAJ B;  3GFH A;  3PYF A;  2MQP A;  3DLK A;  3HKW A;  4RZR A;  4BBY A;  2YWG A;  2IRX A;  1LW0 B;  4B9U A;  4ANC A;  2DB1 A;  1XMB A;  1FI4 A;  3NBP B;  2F40 A;  2MJU A;  1YG0 A;  2MKI A;  2VFR A;  2U1A A;  4X65 J;  2KXN B;  2WSF C;  4PXC A;  2CZ4 A;  3RB3 A;  1LW0 A;  4OI2 A;  3NBP A;  1X9W A;  1Q8K A;  5C24 B;  1FK9 B;  2LU2 A;  4IOB A;  1JJC B;  3D66 A;  3VVU A;  2DGQ A;  2OFG X;  1V5I B;  2P9C A;  5T41 A;  4DUZ J;  3H2U B;  2V2Z A;  5C24 A;  2VQE J;  1LXN A;  2C3Y A;  2VQE F;  2XMT A;  4AD6 A;  2BJE A;  1R8C A;  1HKA A;  3U1M A;  3VQT A;  2DEJ A;  3DRP B;  4DPT A;  2XHC A;  2MKY A;  4OIX A;  1HQ2 A;  1WG5 A;  4ICL B;  1N0U A;  1U1R A;  2XEX A;  2X3D A;  2WHO A;  3BKT A;  4WZM A;  1HBN B;  2HQD A;  1N36 J;  1EJ7 L;  2NRE A;  3M05 A;  1YWX A;  4Q2M A;  2B3T B;  4ICL A;  2MQQ A;  5EWF A;  3SSQ A;  4YDX A;  4OYZ A;  1M1G A;  1FFG B;  1HBN A;  2B4U A;  1UEV A;  4X64 J;  2KM8 B;  3IGV A;  1DTQ B;  4DPO A;  1HBO A;  1IKX B;  1AW0 A;  1TFY A;  3FFI B;  4JI5 F;  4KIA A;  1F3F A;  4ECY A;  3K5M A;  4KV8 A;  5D0E A;  1DTT A;  2CQ2 A;  5F8I A;  4OYA A;  4ECR A;  3EXY A;  4TQS A;  4MAK A;  5U47 A;  4JI1 J;  1EAY C;  4OYW A;  1VBX A;  4USV A;  4JI1 F;  3KHH A;  5E41 A;  4YB5 A;  5HRO B;  1CQM A;  2HQC A;  2XSJ B;  4K4T A;  1I6J A;  4F4Z A;  2D3O R;  2EXU A;  1VJQ A;  4X4T A;  1BMQ B;  5KFD A;  1YK9 A;  2AQ4 A;  3CJK B;  2XSJ A;  6FD1 A;  2AT1 B;  1QAI A;  1NSQ A;  4DFP A;  5HP1 B;  1VQM S;  1UP1 A;  3OTE A;  4DX6 A;  4ES3 A;  3HVW A;  4UT4 A;  3BO4 A;  3OJS A;  1GTE A;  3M8S A;  4URS A;  2MZT A;  4MFB B;  2XNR A;  1C1B B;  3QJP A;  1ZM4 A;  3ZZY A;  3DXB A;  2XS2 A;  1GMW D;  2DEI A;  2PO4 A;  2HHV A;  2RS8 A;  3GYN A;  3F0N A;  2WBM A;  1S7I A;  2K06 A;  4I2Q B;  3OFH A;  1GFW B;  4RW7 B;  3SSR A;  3EVW A;  3PX4 A;  3MUT P;  4PAA A;  1RYR A;  5HMX A;  1ZYQ A;  4JV5 J;  3SYZ A;  1SJ4 P;  1HNV B;  4I2Q A;  4XPC A;  1BQM A;  4DUY F;  1ZBT A;  5G4D A;  2KHD A;  5KG0 A;  2XYG B;  3TWZ A;  1X4F A;  2FY8 A;  2OMO A;  3DU5 A;  2QSF A;  1Q0N A;  1YQH A;  2EPI A;  2PII A;  1HHT P;  4IH7 A;  4PG7 A;  3TOQ A;  5ADZ A;  4DR2 J;  1RT4 B;  3HM9 A;  2W2M P;  4DR4 J;  3FRZ A;  1JLQ B;  4DR4 F;  9ATC B;  4J9P A;  4ID5 A;  2HG4 A;  2HNZ B;  5D0R A;  3IG1 B;  3Q8R B;  2YKN B;  1F60 B;  1HWK A;  1F1B B;  5M2P A;  2DR6 A;  1N34 F;  4KGX B;  1VLO A;  2R8H A;  2EFO A;  3LPY A;  1J5O B;  1MNE A;  1ITP A;  3LAK A;  1YVF A;  4ZK7 M;  2KH9 A;  4KTQ A;  1PAE X;  2ZH1 A;  3BB5 A;  1U8S A;  2KYX A;  1FJG F;  4R5P A;  1RTD A;  3QT5 A;  2J7U A;  3CUL A;  2C2O B;  4ZLJ A;  2DCU B;  2KL8 A;  2FZC B;  3HSZ A;  2IM2 A;  3CIZ A;  1EIY B;  4M5I A;  4I7F B;  4LIR A;  3Q8P B;  2G2Y A;  3FZB A;  2NXU A;  3VAI A;  3ITH B;  1T3O A;  1WSR A;  5KG3 A;  3TX8 A;  2H5E A;  1LWE B;  1BC6 A;  3BGO P;  2ACY A;  4DV6 J;  3BSN A;  2HNY A;  4QIW D;  3MMB B;  5FDL B;  4CLK A;  1TK0 A;  1R8A A;  1EQM A;  1S1V A;  3HI9 A;  4UUX A;  4LF5 F;  5D6G A;  3M8Q B;  3OR2 A;  2H5J B;  2VV5 A;  3IRX B;  2ZD1 A;  1QSY A;  1RAO A;  1UVL A;  3H90 A;  2HWI A;  4GVL A;  4B3T J;  2JC0 A;  3MAA A;  3J81 j;  2MZR A;  3K2Y A;  4K59 A;  2BAB A;  3B4M A;  3MM8 A;  1ZAX A;  4KT0 C;  2GMJ A;  2CXE A;  3UPF A;  3PX0 A;  4NLS A;  3RB4 A;  2Z2Z A;  5L1K A;  3R7S B;  1YJN S;  3VAG A;  3CCJ S;  5KFM A;  2QRR A;  2R2T A;  1KSP A;  3KJN B;  3X3U A;  1PYT A;  2WBR A;  5DZ6 A;  1EB0 A;  4WPA A;  1WHW A;  5LXY A;  4ECS A;  3CPW R;  3CDB A;  2B4O A;  1FX2 A;  4ZVP B;  1D9D A;  4QU7 A;  4JI0 F;  1DQ8 A;  3EZO A;  3WBZ A;  4LBH A;  2DGW A;  2OEK A;  4DV4 F;  4F0K A;  4AL7 A;  1S7H A;  2H4Y B;  3NLC A;  2ASJ A;  3CDU A;  5DDO C;  4ZCM A;  1LK5 A;  4ED2 A;  1UFL A;  2D9P A;  3DFE A;  5IV4 A;  3QLH A;  4IO9 Q;  1XR7 A;  3V4M A;  5DLF A;  3BYP A;  2YWH A;  4WF9 Q;  3SIP B;  1XQI A;  1M5S A;  2W2P P;  3W60 A;  2FC9 A;  3R27 A;  2RQC A;  5J2M B;  5GAD I;  4OQJ A;  5HBM A;  2HIQ A;  2EC0 A;  3KTQ A;  4XO0 A;  5J2M A;  3MUV P;  1UJ6 A;  2B4V A;  2Y8Y A;  4ZVS B;  2WB1 D;  1RT2 B;  4NWB A;  2CPZ A;  2I6W A;  4BC7 A;  3M2V B;  1ZH5 A;  2VF3 A;  2ZOM A;  4K4Z A;  5A2Q Y;  4HAC B;  5LJ3 Y;  4FKX A;  1T95 A;  3HSJ A;  1KC8 T;  2VOD A;  1HQE B;  3GSD A;  2RQ4 A;  2FZG B;  4BS2 A;  4CTA A;  3M2V A;  3D1H A;  3MM5 B;  1CVJ A;  2D69 A;  2H48 B;  4X66 J;  3T9Z A;  1OY9 A;  4X66 F;  5F9N A;  4CH1 A;  2XO6 A;  3GCW P;  1MW7 A;  2F65 A;  3JTO A;  2YKP A;  1D8Z A;  2CPJ A;  2OLW A;  3IM9 A;  4O0I A;  3KLH B;  2XMK A;  1WNE A;  4O3Q A;  2WOM B;  1YZ7 A;  4NCG A;  5EX3 A;  4OLP A;  3GJT B;  3BPD A;  2EFP A;  3PRD A;  3IS9 B;  3UVJ A;  1PBU A;  3KYL A;  2ASY A;  5E0O A;  1QAX A;  2C3U A;  4FZV A;  2AEM A;  3N6L A;  1AFJ A;  2CQG A;  4A8S A;  1H98 A;  1M5H A;  3VZI A;  1KLN A;  3L09 A;  3MPU B;  3ZTR A;  3CUN A;  4F0M A;  2EG2 A;  1ZA2 B;  1R0A B;  2X1F A;  1RKJ A;  3ADA C;  1FNO A;  3UDV A;  5BR8 J;  1U25 A;  2V69 A;  1OSD A;  4ENO A;  3W62 A;  4NXN F;  1J2V A;  5ETK A;  5B0A A;  1A9N B;  4OZ5 A;  4QR2 A;  4C2M A;  5J2P A;  2LEC A;  2OH2 A;  3EZ5 A;  2WVB A;  3NS6 A;  4IDK A;  3GFZ A;  1PKU A;  4LBP A;  1GQE A;  2YNG A;  3D3C J;  4B17 A;  3M32 A;  2BRL A;  2UUA J;  3RTV A;  3IFE A;  3I5C A;  1SKW A;  3EDR B;  3LPE A;  3R5J B;  5KT6 A;  1IJE B;  4Q43 A;  3R1H A;  3C6T B;  2NS1 B;  2HFZ A;  4KO0 B;  4R25 A;  1NK9 A;  5K8P A;  4DN9 A;  2PFF B;  1HNX F;  1F5B A;  4KR0 B;  4JI7 J;  1QSS A;  2KDO A;  4JI7 F;  3MR2 A;  3DU6 A;  2PMH A;  1XR6 A;  2H5I B;  3GG0 A;  1RT6 A;  1JLA B;  4XK8 C;  1IJF B;  1SXL A;  4C8M A;  3SQG A;  2RAQ A;  2B7B B;  4F4Y A;  3B8H A;  1N33 J;  1HWI A;  3IR5 B;  2WZ1 A;  3CW2 C;  8ATC B;  3PW4 A;  1SL0 A;  4TVA B;  3D0I E;  5IOL A;  3F56 A;  2XMJ A;  5AE2 A;  4E2F B;  3CD0 A;  1GNK A;  3TAN A;  1V3Z A;  4MJK A;  4OI4 A;  3AXM A;  2F8E X;  3CJ8 A;  3MEC B;  3X1L B;  1WC0 A;  4DL0 C;  3FVY A;  2RJZ A;  3I31 A;  3HD1 A;  2D3O 1;  1T8E A;  3BGL A;  1RT3 A;  1ZET A;  2LA4 A;  1W26 A;  2UUB F;  4KQZ A;  3ILI A;  2ZKU A;  4PYD A;  2ZHO A;  3FEX B;  3EGV A;  1TAU A;  2FVP A;  2QGF B;  8AT1 B;  5CYQ B;  4J9K A;  1ZA1 B;  4C98 A;  4M8L A;  1GT8 A;  2JH3 A;  4MH8 A;  3FNN A;  2OPP B;  3ZO7 A;  3PEJ A;  2VBX A;  1WKJ A;  2B8P A;  3LAN A;  2GMH A;  2HFV A;  1MWY A;  2DGU A;  2OPP A;  5IC6 B;  5EHH A;  2HHU A;  4NLX A;  3W61 A;  1MWZ A;  3IWX A;  5A6W A;  2MSS A;  2R8K A;  3ZTQ A;  3UD3 P;  1RTI B;  4ATN A;  1KRP A;  3NGD A;  2F4F A;  5LT5 A;  5DLG A;  2WTF A;  5KT4 A;  4B3M J;  3BM7 A;  4B3M F;  3WC2 A;  5CYM B;  1VQ7 S;  3NGK A;  3ENV A;  2ILZ A;  3LWL A;  3BN7 A;  4P72 A;  4RUB A;  3RRH A;  3CVK A;  1S4F A;  1OPI A;  3EE3 A;  2AYE A;  3JTN A;  4ZPB A;  2DD8 S;  3GII A;  2DVI A;  1UFW A;  1VQK S;  2CKW A;  3I6P A;  1OPZ A;  4X4S A;  1JK9 B;  1KVK A;  4I1T A;  1B70 B;  4WII A;  2JLG A;  3SBM A;  3ZXW A;  4AUK A;  2JFD A;  4FPR A;  1HWU A;  2XY7 A;  3M2R B;  3OFE A;  2F63 A;  2YH0 A;  3MM9 B;  3DRR B;  2MXY A;  1GEH A;  4K4W A;  3IBW A;  3KUG A;  4OMF G;  3CC4 S;  3M2R A;  3H5S A;  1I94 F;  5DQG A;  3N28 A;  3OV7 A;  2BQU A;  1U45 A;  4NLY A;  2AYM A;  3QO9 B;  1R8P A;  2A6M A;  2HBY B;  5C2C A;  5ITH A;  1LXJ A;  2DHS A;  3M9O B;  2VAS A;  3MCN A;  4Q44 A;  2XWY A;  1NB7 A;  1F6T A;  1GK8 A;  3BBB A;  3GIL A;  2DIS A;  1MN9 A;  4YEA A;  1UZD A;  4I67 A;  1QAJ A;  4KHM A;  4P7T A;  2KXF A;  4J9U E;  1VQY A;  5BXI A;  3ENQ A;  5LM7 E;  3DGP A;  2E5G A;  1WHV A;  1YIJ S;  3MEE B;  3V4I A;  3GON A;  3RJM B;  3NNC A;  2B6A B;  2LXI A;  1TUG B;  1RWM B;  1KQS R;  5D77 A;  2CZ9 A;  4H4O A;  4TQR A;  4FYY B;  3A13 A;  4CZC A;  4WFZ A;  3MPV A;  4UUW A;  2D9O A;  4USM A;  2F9D A;  1UVN A;  4NI2 A;  2HHH J;  4ED4 A;  4C48 A;  1NUE A;  1IN0 A;  3CCU S;  2ZUA A;  5D78 A;  2MLY A;  3M6V A;  2EFN A;  5HMY A;  3VZH A;  2AJF E;  4MK8 A;  5J2N B;  5E3P A;  3A8J A;  4HKQ A;  2HVD A;  3AA8 A;  4FF1 A;  4B9V A;  2FJD B;  3IA0 A;  3U1N A;  1DHM A;  2F8H A;  4J9V A;  2R8G A;  1HMV B;  3L3C A;  2J9D A;  3K7R A;  3EZU A;  2G0J A;  4F3M A;  3R6G B;  2LEB A;  4C3L A;  3CME S;  2BM1 A;  1H7X A;  1KR4 A;  1B99 A;  2LQ9 A;  5G0R A;  2LCW A;  2JEG A;  4OLO A;  1F3V A;  3BH7 B;  2CYY A;  1GMU A;  1S72 S;  3HD2 A;  3CJS A;  1WC5 A;  3M8P B;  4YHH F;  2DIT A;  3D6M B;  2GJ2 A;  2PMW A;  2JHE A;  2KI2 A;  1O0P A;  3KFW X;  3TW0 A;  2HAI A;  4EWT A;  2L9W A;  2H65 B;  1TKZ B;  2KJW A;  5F9L A;  4QIF A;  1RT7 B;  3CNQ P;  2QG9 B;  2CZV C;  2QA4 G;  4HHU A;  2Q43 A;  1RHM B;  4X84 A;  1B64 A;  1HI0 P;  2CNO B;  4QIE A;  4HT7 A;  3J81 U;  3JSB A;  5B0E A;  1L5U A;  2F8M A;  1YBU A;  3BDE A;  4LFB J;  1AUS L;  2MYF A;  2HQ3 A;  1NLK L;  4LFB F;  3KHR A;  3BH6 B;  2CG4 A;  4P73 A;  4YME A;  1WAC A;  1HQU B;  4O44 A;  4DSL A;  3OTC A;  2VPX B;  1B0T A;  1PYS B;  2R8J A;  4DR1 F;  4AFF A;  4KGK A;  3ISN C;  2NUH A;  1H3D A;  5DDP C;  4PWW A;  2XYH B;  2Q6C A;  3R6L B;  4A8O A;  2CQI A;  5GME A;  3GV5 B;  5KFT A;  3FSY A;  2GW8 A;  4I68 A;  4UF4 A;  1G7C B;  4EK2 A;  1SH3 A;  3ZTP A;  2ZBI A;  5KFF A;  1S0N A;  4JI3 J;  2ATC B;  4JI3 F;  4CLU A;  3W63 A;  5K8M A;  4C7Q A;  2DTJ A;  2XO7 A;  1R31 A;  5KAK A;  1VOM A;  2RSQ A;  5LSL A;  1AYE A;  3NCR A;  2AHO B;  3UD5 A;  3GCX P;  1Q7L B;  3W2W A;  3GU0 A;  4JI2 J;  1ZM2 A;  2HLT A;  2I1R A;  4EBD A;  4DR7 F;  4NLO A;  4JI2 F;  4HDH A;  1S79 A;  1N6Q B;  1CEZ A;  4ZVG A;  5KFK A;  1WC4 A;  1JQG A;  4WCE Q;  2HHX A;  2HZC A;  2VPW B;  3R5G A;  1WEL A;  1RU2 A;  2DCL A;  2ZZT A;  3G82 A;  2OKQ A;  2FLN A;  5E3C A;  1K8A T;  1Y3J A;  4DV5 J;  1NK8 A;  1BE4 A;  1RT5 A;  2B9X A;  4MIB A;  4DV5 F;  2VJV A;  1JKH B;  4DEZ A;  3ET6 B;  5B09 A;  2IC3 B;  2RUG A;  3E3X A;  3PKY A;  1JLE A;  1H73 A;  2X1G A;  3OR1 B;  4MKY A;  3KXD A;  2PD1 A;  1BUX A;  1UJ5 A;  4DPU A;  2DO0 A;  3AD9 C;  3OTB A;  4FXW A;  5GAG U;  1SC4 B;  5ETN A;  4O4G B;  4NAS A;  4CI0 B;  1Y10 A;  1TL1 A;  5KT7 A;  2UXB J;  2KT2 A;  4G1P A;  2AD9 A;  3DOM B;  2UXB F;  4OJH A;  3QAU A;  3S7R A;  2J8S A;  4O4G A;  3TQE A;  3V6H A;  4P2M A;  2YKM B;  3DM2 A;  4KE5 A;  5CD4 A;  2JFK A;  2D41 A;  2MY7 A;  3U7J A;  2PGC A;  3Q86 A;  1SV5 A;  4OX7 A;  5FLX U;  1LW2 B;  3W9H A;  1ZZF A;  1VGY A;  2B7C B;  1NPR A;  4W4M A;  1JJ4 A;  4AT1 B;  1IKW A;  4U7C A;  3QGP A;  3PX6 A;  1ZZN A;  4MYU A;  3RYL A;  2B51 A;  2FHJ A;  2Y3Y A;  1LW2 A;  3CTR A;  2PA8 D;  2YXL A;  4DHV A;  4R8U B;  2FQQ B;  1WF0 A;  5THW A;  3LP1 B;  2OTJ S;  4XPE A;  4KPC A;  3N4W A;  4FPI A;  4NLG A;  4R8U A;  1WC1 A;  1VC6 A;  1P9Q C;  1KKH A;  2VKZ G;  1DZ5 A;  3LP2 A;  3ENW A;  2JEF A;  3MCS A;  1C4A A;  1OQ3 A;  5ETO A;  5C5J A;  2WON B;  4AQY J;  3ENA A;  3OVB A;  2XCA A;  2Q6B A;  4ZPV R;  2QT7 A;  1N32 J;  4NRT A;  3GPA A;  4DV2 F;  1N32 F;  2E5H A;  4NMX A;  5IC4 B;  2LYV A;  4LRB A;  3LAM A;  2VA3 A;  3IXQ A;  2AJ1 A;  1BQN B;  4A47 A;  1T05 A;  1XNR F;  1DJ0 A;  3EXC X;  1RU1 A;  2ZBR A;  5KG5 A;  1H6K X;  4WBF A;  2P6T A;  3FZ2 A;  4DQS A;  1NB2 A;  2X3G A;  3LUY A;  2QLJ B;  3I0S A;  2ZWO A;  2DXD A;  5F0W A;  4WXW A;  5JMN A;  4URG A;  4UW2 A;  2KG1 A;  4KHR A;  4U8V A;  1D9A A;  1S48 A;  3MM6 B;  1Q7Y T;  3DLG B;  1X9M A;  3TR5 A;  1R3N A;  3MCO A;  3WDO A;  4CM2 A;  3DKD A;  5IFM A;  3EVM A;  2ZM6 J;  1WOS A;  3HJF A;  3I82 A;  2Y0B B;  3N5F A;  4KBI A;  3HHD A;  3LA0 A;  4O3N A;  1QUP A;  1NPP A;  2MKH A;  2YY3 A;  1T9Y A;  2QLF B;  1OWX A;  4YUD A;  3B54 A;  2XGP A;  2V8V A;  3DLJ A;  3FMW A;  5CH7 B;  4LJM A;  2VFV A;  4QIG A;  2VA2 A;  2IDL A;  3GR0 A;  1TFW A;  5HI7 A;  1RAB B;  5JUM A;  1SQG A;  3C15 B;  2XY6 A;  3GFY A;  1GXL A;  4LRF A;  5KFY A;  4OZ3 A;  2KU7 A;  3QBC A;  5HJY A;  1IXK A;  4P7V A;  3GR1 A;  1C2P A;  4QWE A;  4DFM A;  1W25 A;  3PYE A;  3OXG A;  4OHY A;  1FJE B;  2XUL A;  5IM0 A;  2ZDO A;  3JTP A;  4OZ1 A;  2KG0 A;  4S0M A;  1X5O A;  4OI3 A;  1HNI B;  1W2I A;  2VG6 A;  4AE5 A;  2J6U A;  2JOQ A;  3H4D A;  4N77 A;  1X5T A;  3U27 A;  1WKL A;  5MAO A;  1F9E B;  2KYZ A;  1GAO A;  3FJ2 A;  1IQT A;  2LQ5 A;  1AZS B;  3O6Q A;  3MR7 A;  3W66 A;  3AB4 B;  3WX4 A;  4M5J A;  3HLU A;  1QM9 A;  4ZVU B;  1YJ7 A;  1RHU B;  4WP8 A;  4KFB A;  2JX2 A;  1AZS A;  2YWF A;  1FRI A;  3BBF A;  1KTQ A;  4GKJ J;  2C3O A;  2F4V J;  1JLF B;  4BCA A;  3K58 A;  4GKJ F;  2F4V F;  4DBQ A;  1VIO A;  3ZTS A;  1SKU B;  4P74 A;  4J9S A;  4JYA F;  1WJ9 A;  3N5B A;  3OL7 A;  6FDR A;  2APO A;  1QE1 A;  3BQ2 A;  2DXE A;  3OHB A;  4HTI A;  3OVA A;  2QTW A;  1YHQ S;  3PIP Q;  3T19 A;  3M6U A;  4NYO A;  3HSD A;  1G3O A;  1UVK A;  3DLE B;  2ASL A;  2GNK A;  4DOZ A;  4O3S A;  2WSE C;  3RZA A;  3M6W A;  4UQG A;  4HT5 A;  1NJW A;  4G65 A;  4DMZ A;  3AD8 C;  1VHI A;  4XIU A;  5A8R B;  1RXO B;  1N5Y B;  2DHH A;  1IWG A;  1HL6 A;  1S6Q B;  5J1N A;  2D7S A;  1LWC B;  1PC5 A;  5K9F A;  3PEH A;  1LFW A;  2GJF A;  4ZA1 A;  1NPK A;  5DG9 A;  1LWC A;  2LQ8 A;  3DDN A;  2R7R A;  2G0C A;  1DLO B;  2RVJ A;  2MB0 B;  1ZPW X;  4F67 A;  3FBC A;  2BBE A;  4PPD A;  1NBE B;  1SJR A;  2YQ0 A;  3M2U B;  3C46 A;  2IRU A;  4ECW A;  2RKI B;  2OPR B;  4DR5 F;  2M2B A;  1K73 T;  2IA6 A;  5DQI A;  3KOA A;  1HNZ J;  2YQ3 A;  3M1V B;  3M2U A;  2A3J A;  4DSE A;  2RKI A;  3MED B;  3PJX A;  2YNH A;  9RUB A;  3T5J A;  4FXV A;  2J5A A;  4K7Q A;  3SMZ A;  1PG5 B;  1TMM A;  2XMW A;  4DZD A;  2RH3 A;  5IV3 A;  2HIY A;  4I69 A;  1RE1 B;  3A8K A;  1S1T B;  4JI6 J;  2KFZ A;  3I5B A;  1VBY A;  4QIV A;  3LF0 A;  4IH5 A;  5EWE A;  1BY9 A;  4PWD B;  1I3O B;  4FP9 A;  8RUC A;  3I87 A;  2CNN B;  3BSC A;  5E3A A;  4RPF A;  3KK1 B;  4ZHR B;  4RW6 B;  1S1U A;  2MQN A;  1IWA A;  3E01 B;  3NOG A;  3TI0 A;  4N41 A;  4ED7 A;  3KK1 A;  5ETR A;  3OSP A;  3P4U B;  5L1L A;  4RW6 A;  3HFV A;  4RX6 A;  4NYZ A;  3P5B P;  1IBL F;  4DL4 A;  1O5J A;  4K5R A;  1WOO A;  3MZI A;  3KLE B;  4MT1 A;  3DHX A;  4DV1 F;  1CJU B;  1Y5N B;  1A0O B;  1HW9 A;  1EKR A;  2M8D B;  1EHW A;  2PC6 A;  3BR8 A;  2HRU A;  1RTJ A;  4C8Y A;  4IYQ A;  4RUH A;  2MKJ A;  1XJW B;  1OY6 A;  5IT4 A;  3FRY A;  4KH1 B;  3B82 A;  1ZM3 A;  1X4A A;  1QD1 A;  1QJH A;  3QRR A;  3VAF A;  4H4K C;  4K2J A;  3GIM A;  3RBD A;  3PXG a;  4Y00 A;  2MKS A;  1SIZ A;  2AGQ A;  2G9O A;  2B4P A;  2ZBP A;  5SUH A;  1EQ0 A;  1IR2 A;  3CO0 P;  4WKR A;  3T1Y J;  3NMR A;  3LP0 A;  4G1Q B;  3TJA A;  2BM0 A;  4RW8 B;  2YWK A;  3FDS A;  3MMC B;  1V6H A;  2Z2M A;  5IQ6 A;  2G2O A;  1S77 D;  2B5J A;  4N47 A;  1RB0 A;  2VPZ B;  1HWJ A;  2PA3 A;  2FJW A;  1JLB B;  4IG0 A;  2DXF A;  4GVB B;  3S1T A;  4OI0 A;  3RU0 A;  4NLD A;  4Q2L A;  1KFS A;  5DS7 A;  3NGU A;  2C2R A;  1JLB A;  1Q78 A;  2R7Q A;  3QNW B;  3NGS A;  3EJM A;  3LTO A;  1NDK A;  5DJB A;  4ECQ A;  3DLB A;  3D6F B;  1PJ6 A;  1CJK B;  3CXC R;  1XWL A;  3QMQ A;  3KHL A;  2JJ4 D;  2B9W A;  1ACM B;  4ZPC A;  2QLX A;  3KKF A;  2V8G A;  2K8G A;  4WKY A;  5HLF B;  4ZPD A;  2DRA A;  5KFU A;  1CJK A;  3ZFV A;  3BKF A;  2FJB B;  3QSI A;  2HYI B;  2VG5 A;  2R7X A;  1XMO J;  1N52 B;  1N88 A;  1XMO F;  5T7L A;  2HMI A;  1UMJ A;  5DZ7 A;  4DU8 A;  1N54 B;  4W98 A;  2W9C A;  3BO2 A;  1M0S A;  2NZC A;  4LF6 F;  4C8O A;  1FKO B;  4DUT A;  2CWK A;  5CA5 A;  1MN7 A;  2W2N P;  4CYU B;  2E9R X;  2P8I A;  5I3U B;  2D3U A;  3BF4 A;  4RU9 A;  4AL5 A;  2OPS B;  3CJ4 A;  4B3S J;  4HR2 A;  2CDQ A;  1FKO A;  5LSR A;  4C0B A;  4QWB A;  2BJ8 A;  4CYU A;  3A3P B;  2V2V A;  1D8Y A;  2BW7 A;  2ZVS A;  4ECU A;  4FDF A;  1X4E A;  4KJI A;  2BMB A;  3BV8 A;  4P2S A;  4LF9 J;  4J37 A;  2R7U A;  4HEA 9;  2DY9 A;  1Z1Z A;  4LF9 F;  1T11 A;  1X5P A;  1CC7 A;  1UW4 A;  1XTZ A;  3R97 A;  4DQI A;  1URR A;  1DY3 A;  4DR3 F;  3OJU A;  4EU0 A;  3RRK A;  1G4C A;  2AF6 A;  1JLG B;  4CO0 A;  2JRS A;  2OEM A;  3VVT A;  1LOU A;  4DS4 A;  4OYM A;  1HBM A;  1WSV A;  3RBE A;  1K47 A;  4KGM A;  1AUD A;  4ZIV A;  4ECT A;  1S0O A;  3NWR A;  4LFC J;  4CDI A;  3FCV A;  4LFC F;  5B7W A;  2DYA A;  1YJ9 S;  1WOP A;  1AB8 A;  1NME B;  1XK8 A;  4ZVT B;  2V8D A;  4YS2 A;  1RAH B;  1EZZ B;  2HK2 A;  1YGY A;  5GAH U;  3J7Y U;  3IMQ J;  4WK3 A;  3BGR B;  5H1S V;  4J9O A;  3CGI A;  2RS2 A;  3KDN A;  2YKQ A;  3BR9 A;  4Q0B B;  2V2K A;  2N4D A;  1M5V C;  2Y0S D;  4F8R A;  1OQ6 A;  1S5Z A;  1VQO S;  4ITS A;  3MM7 A;  2PI4 A;  3EGZ A;  4OZN A;  3G4S S;  3PZP A;  3CCZ A;  1EP4 A;  2QC3 A;  4USJ C;  5D4O A;  3NWG A;  4KC5 A;  1D09 B;  2M7S A;  3M30 A;  3T5H A;  2IA0 A;  4H4M A;  2C2M B;  1FF2 A;  4M5N A;  3HHL A;  3FSX A;  4PKD B;  1VC5 A;  1U2F A;  4IFY B;  1L3U A;  1TAQ A;  3R2D J;  2DKO B;  4IQX A;  2IJF A;  2V9K A;  4NRU A;  2VIH A;  4YR0 A;  1UEK A;  1U49 A;  2AIR B;  2P6S A;  2V4J B;  5DO2 A;  4KY3 A;  3H8Y A;  3K59 A;  1REV A;  5IT9 U;  4CQ1 A;  3HT3 A;  3GIR A;  4J7C A;  3DOL B;  2WB4 A;  3QGG A;  2V4J A;  2BUN A;  4NA3 A;  1D0E A;  3MUM P;  2E5L J;  4GO5 X;  2HAF A;  2GCF A;  3B6B A;  4RNO A;  2DGT A;  2E5L F;  1Q81 T;  4A46 A;  1YZ6 A;  1HR0 F;  3P49 B;  2CNL B;  4NLU A;  2XY5 A;  3Q23 A;  4OHW A;  2J6S A;  2CQC A;  2YKO A;  3RBZ A;  4DV0 J;  4RNF A;  2Y8W A;  3L7P A;  4DF4 A;  2UVU A;  1YJT A;  1WOR A;  1TKX B;  4FF4 A;  2Y1J A;  1GTH A;  5IT0 A;  1JLC A;  4I64 A;  1KBR A;  1HYS B;  1SH0 A;  3FK4 A;  5DRK A;  1IVZ A;  2CJQ A;  5DQH A;  1VK8 A;  3J7Z T;  2BE2 B;  2LFV A;  1FKA F;  2KM8 C;  2LDY A;  2OFH X;  5F3Z A;  3VCD A;  2FTR A;  4U95 A;  1HPZ B;  2A2D A;  2DH7 A;  3Q83 A;  2HS4 A;  1S6P B;  2ALY B;  4X4O A;  1C0T B;  4F4A A;  4Y2I A;  3D1Q A;  1OYE A;  2VL1 A;  4FYX B;  4DZ6 A;  3UCG A;  2V4R A;  3DOK B;  4PUO B;  1MU2 B;  5K8N A;  1YLX A;  2OD6 A;  5D3G B;  2HWH A;  2V0N A;  1X7V A;  3OUY B;  2HZV A;  3PCO B;  1CJT B;  3SCK E;  2R2U A;  2UVV A;  3K17 A;  2LDI A;  3DCA A;  3TAP A;  3UN5 A;  3R2C J;  1FRM A;  2NYI A;  4DL7 A;  1NDP A;  3JSM B;  3T41 A;  3BQ1 A;  2NCK L;  1QAY A;  1OYD A;  1QVG R;  3GJQ B;  1Y5I B;  2GHV C;  2HQG A;  3MR3 A;  3JSM A;  4DSF A;  3JQJ A;  1FKP A;  3CWJ A;  1VRT A;  1UWB B;  5JVG Q;  1BGX T;  4H4K A;  2DGS A;  4Q8E A;  3MD1 A;  5KFR A;  4IR1 A;  2ATL A;  3S01 A;  2VC0 A;  4KH0 B;  2IY5 B;  3POT A;  2VQF F;  2N82 B;  2J0S D;  3DRS B;  5K14 A;  3MMA A;  2GJI A;  1PO6 A;  4AXI A;  4UZB A;  2CJK A;  3C3L A;  1DAR A;  3M4X A;  4L3N A;  3SV4 A;  1YRT A;  1FNX H;  3EVO A;  3WC0 A;  1Y0H A;  1WEX A;  4OJ3 A;  5AE1 A;  1XNQ J;  3QIP A;  2UUC J;  4X2B A;  1XNQ F;  2DHX A;  2Q79 A;  5C25 B;  5FLX Y;  2XS5 A;  3GMG A;  3HXM A;  2IVF B;  3O2I A;  2FVC A;  2HVE A;  4CLW A;  2YTC A;  1TL5 A;  5A8K A;  5B0F A;  4ELT A;  1HW8 A;  1RJJ A;  2POK A;  3RB0 A;  2IDE A;  3V6D A;  3M9M B;  5ETS A;  2H1Y A;  4F26 A;  2W1B A;  2IM3 A;  3JSR A;  2UVR A;  2BDP A;  4WK1 A;  4J5O A;  3KJV B;  4Y2C A;  1VYA A;  4RKU C;  4OHX A;  1U26 A;  2NXC A;  1OO0 B;  2B43 A;  1YJV A;  3OPK A;  3H59 A;  2ZH4 A;  3OFF A;  4JB8 B;  3QZ8 A;  5I3Q A;  1ZAV A;  1Y00 A;  1ULR A;  1U6Z A;  5KFL A;  2C1E B;  4Y2K A;  2V50 A;  1KVI A;  4I56 A;  3C16 A;  2DT9 A;  1OIA A;  2KFN A;  6AT1 B;  4WE1 B;  1PCA A;  1Q5Y A;  1SH2 A;  1ZTW A;  2EFQ A;  2XBP A;  5A6P A;  5J2Q A;  3N79 A;  2DIU A;  1N8R T;  2BQR A;  4DL5 A;  5DM7 Q;  1CS4 B;  4F02 A;  2E44 A;  2CFX A;  4ZPT R;  5L1I A;  3M6X A;  2Y1I A;  3D9B A;  2OPQ A;  1IKV B;  2W9B A;  3OW2 R;  3IP0 A;  4YR2 A;  3D3B J;  4DWI A;  1B0V A;  1U8W A;  2K7K A;  2EKY A;  1REG X;  2HQF A;  5E33 A;  1SPB P;  4PG4 A;  3W2V B;  5KFH A;  3K5N A;  1Y9O A;  1CC8 A;  4USI A;  1BD6 A;  3C19 A;  4NZ0 A;  3EGN A;  1PIL A;  1KON A;  3ZTO A;  4PZV A;  1SQE A;  3NY0 A;  4M5K A;  4RBU A;  5LMN F;  2GAG C;  2DRD A;  4D3H A;  4C6A A;  4M5L A;  2DGX A;  1KD1 T;  3PFE A;  5D4P A;  1ZPV A;  3V6J A;  2AMC B;  4PPZ A;  2QSW A;  1Q95 G;  3TUI C;  2A2C A;  4ER8 A;  2BA9 A;  2IAJ A;  5HVH A;  4K4Y A;  2GIR A;  2KT5 A;  2D3Z A;  1U1M A;  3WX8 A;  4FBU A;  3CDA A;  3LGH A;  1TVR B;  4NLT A;  4ZMM A;  1N4L A;  1FXD A;  2YPZ A;  4X65 F;  3RAQ A;  2Z2L A;  4F2R A;  5HMW A;  1FD2 A;  1B7F A;  3AXK A;  4OI6 A;  3ZZ0 A;  3SQO P;  3FBB A;  1NK5 A;  4WFN Q;  2Z8Q A;  5K20 B;  3P5T L;  3NGT A;  4DUZ F;  2P9G A;  1FK9 A;  3VWS A;  4Y3C A;  5RUB A;  3MOZ A;  2N7C A;  5KFO A;  2XZW A;  3DMJ B;  1R7I A;  2RD5 C;  2BYC A;  3I32 A;  4TNO A;  3AOB A;  1R89 A;  2WVD A;  2DJW A;  5KG6 A;  3DRP A;  4A8M P;  4U7U D;  2CAJ A;  1D1U A;  4OJ1 A;  2RQM A;  1N36 F;  5LMU J;  4KGV B;  4YOE A;  3R3T A;  3H20 A;  4ED0 A;  4FYW B;  5H9F K;  3I9Z A;  1TL3 B;  3DC2 A;  5J1E B;  2XMM A;  4ZJL A;  4RWW A;  1X5S A;  3HHK A;  2RDJ A;  4X64 F;  5DGB A;  1FWL A;  3I56 S;  1FVQ A;  3G8T A;  1TZ0 A;  3PM9 A;  5AXN A;  1U02 A;  4DQQ A;  4ZJO A;  2E7V A;  2ZOG A;  2AZ1 A;  4CLP A;  1DTQ A;  4IG3 B;  1IKX A;  5KFE A;  1WG1 A;  3FFI A;  3OHA A;  1TU0 B;  2M70 A;  1IQZ A;  1FDN A;  4C0O C;  4C11 B;  4QJV A;  4RU2 A;  4FBT A;  3MMJ A;  2XHW A;  3SSS A;  1PAU B;  1N5V A;  2G1H A;  1O8B A;  2YVS A;  4DCJ B;  2L48 A;  2C2N A;  2MQL A;  5HAO A;  4DLE A;  1J5E J;  1U1N A;  4WP9 A;  3KLI B;  4K0K J;  4K0K F;  1WC3 A;  5HRO A;  2EI5 A;  1L3S A;  2W01 A;  4C8Z A;  4RUA A;  3N01 A;  1UVM A;  1R0C B;  3CJK A;  3QSY B;  5HP1 A;  4NEY A;  4IRD A;  1NO8 A;  3UO0 A;  3WZ0 A;  1YBA A;  3BBC A;  4ZVR B;  1LWF B;  1HNW J;  1HNW F;  3LO3 A;  2K3I A;  1HLW A;  4MFB A;  1C1B A;  3NKY A;  1Q8I A;  3T5L A;  5F8N A;  2AEF A;  2H4W B;  2DR5 A;  3MI7 X;  1U09 A;  3Q0A A;  4B9S A;  3NAH A;  2V8H A;  4JV5 F;  1KTV A;  4M5M A;  2CRL A;  4NX9 A;  5I42 B;  1XBW A;  1DQA A;  4B9M A;  4RW7 A;  1X4H A;  2Q3P A;  4IFV B;  2XB2 D;  3G6V A;  1UPP A;  1KP6 A;  3ZZP A;  3D5M A;  1HNV A;  3PG9 A;  4WU3 A;  4FVC A;  3CJ5 A;  2NXJ A;  4C9D A;  1EAR A;  1JNR B;  2Z30 B;  3Q2S C;  4DR2 F;  2FB0 A;  1S1X B;  3W5Y A;  2G1D A;  2LEP A;  3QFH A;  3I0R B;  3NP5 A;  3R7B B;  5CHC B;  2GHW A;  4DFK A;  1RT4 A;  1JLQ A;  2DNZ A;  2EVZ A;  3FC9 A;  4DFJ A;  3I0R A;  3KLV A;  2HNZ A;  4ETZ A;  4ZN3 A;  3IG1 A;  2C3P A;  2YKN A;  3HZG A;  2R7O A;  1NKB A;  5F8L A;  3MEG B;  5BYS A;  4CP5 A;  4B3R J;  2JNJ A;  4B3R F;  3VTI A;  1TR0 A;  3ICL A;  1T03 B;  4Y34 A;  1XN9 A;  2M88 A;  2RHQ B;  4EBC A;  2DIV A;  1J5O A;  2BAN B;  2VOP A;  1HHS A;  2UUT A;  3ISN D;  1JX4 A;  2HVH A;  4QW9 A;  3D54 A;  2ADC A;  1ZAW A;  1VMB A;  4C8L A;  4F50 A;  1Q53 A;  3H7H B;  2F3J A;  3KJF B;  2V9W A;  2LU1 A;  1U1P A;  2M4M A;  1TMJ A;  1MRO B;  3R8Y A;  1S57 A;  3TAR A;  2GQQ A;  2O3D A;  2X1B A;  2MQ8 A;  4I7F A;  1QUV A;  4LF8 J;  4Q7A A;  1WDT A;  3BPS P;  1HIY A;  2NSC A;  3ITH A;  4DV6 F;  4LF8 F;  2YX7 A;  3TAM B;  1HFE L;  1P1T A;  1W2B R;  3THV A;  5KT3 A;  2HND B;  4A8Y A;  1LWE A;  3C6U B;  2GVZ B;  1WF1 A;  2MKK A;  2XNQ A;  3MMB A;  5FDL A;  1X60 A;  4XTT A;  3P8B B;  1RAD B;  2FYX A;  4OX8 A;  1WTB A;  2ZZM A;  1PJ7 A;  5KG7 A;  2BKN A;  4M1K A;  4ILR A;  1RWX B;  4ZP6 A;  1VQ8 S;  3TZX A;  4B3T F;  1CUL B;  3M8Q A;  5F0U A;  3IRX A;  2LEA A;  3Q8U A;  4K2X A;  3GB0 A;  5ETM A;  3L9Z A;  3LGM A;  5LXR A;  4DX7 A;  3HDS A;  1GMV A;  4HI2 A;  1T02 A;  1FRX A;  3TP2 A;  1NSK L;  3G6E S;  1VLY A;  3A8E A;  3DGV A;  5KG2 A;  2ROP A;  3LW5 C;  3QPI A;  2C42 A;  4FYD A;  2ABY A;  3DI6 B;  4MK9 A;  1JNZ B;  3T1H J;  1WC6 A;  1NHV A;  1JXV A;  2G2Z A;  1HD0 A;  4KGZ B;  4TLR A;  1WDD A;  2OGU A;  3GFX A;  3VGS A;  3BKU A;  4USU A;  4EZ9 A;  3K5O A;  2J9C A;  1I1G A;  3QT8 A;  2VH7 A;  4LMZ A;  2HRY A;  3MFH A;  3FSI A;  1P27 B;  5L46 A;  4FS1 A;  2HFS A;  1KOH A;  2LMI A;  3SEO A;  3MPW A;  2RRB A;  1R6V A;  3OVS A;  3EMT A;  2KTQ A;  4WFY A;  3JYT B;  4J9Q A;  3K8V A;  2AJ4 A;  3UFC X;  3TVZ A;  4QWA A;  1S76 D;  1KVJ A;  4EUV A;  2LXU A;  3QAE A;  2CQD A;  3BS9 A;  4I6Y A;  3GLJ A;  1IM4 A;  3N9U C;  1T9X A;  3M7V A;  1FFS B;  2LA6 A;  5CCM A;  5A2Q U;  2OEJ A;  4FYV B;  1S59 A;  1UW9 A;  2KHC A;  3CB4 A;  4CT9 A;  2HEK A;  4J9N A;  5ETP A;  2V6A A;  1RAI B;  2AP6 A;  1Y3K A;  1MLA A;  1VQL S;  3UR3 C;  1U0H B;  1NND A;  4DPW A;  1RT2 A;  3PYD A;  5GMD A;  2E1M C;  4HAC A;  4EBE A;  1U2R A;  1UL3 A;  3RR7 A;  3HFZ B;  1HQE A;  3OD2 A;  1VC0 A;  1UAW A;  2FJX A;  3MM5 A;  2ZJQ Q;  4M5D B;  2IBK A;  1N48 A;  3GV8 B;  5A8W B;  2P9E A;  2O1P A;  3PIO Q;  2QIF A;  5HQM A;  4DL6 A;  2JSX A;  2YH1 A;  2QL7 B;  2MTL A;  4OYO A;  4Z7Y A;  2HHS A;  5A8W A;  1S9G B;  2DR8 A;  5DGA A;  3AOA A;  3KLH A;  2JVR A;  4UOF A;  3D0H E;  4L73 A;  4IOC Q;  1PJ5 A;  1RLC L;  2CVI A;  2WOM A;  5GVQ A;  4OJG A;  3D28 A;  2ROE A;  4QWD A;  1BHN A;  3IS9 A;  2XCP A;  4L72 B;  1UA1 A;  1YRU A;  5IT9 Y;  5B0C A;  1S1W B;  4QCL A;  3CO9 A;  4F4W A;  1T9T A;  4ED3 A;  3AT1 B;  2I38 A;  2DY1 A;  1FRJ A;  2C3M A;  1H0H B;  2JC1 A;  3RGI A;  4HL9 A;  3SCI E;  3TZY A;  4DR6 J;  2IPO B;  4K4X A;  3G8Q A;  3W3S A;  5BR8 F;  4DR6 F;  3P96 A;  4DXL A;  1HBU B;  1G2E A;  1UPM B;  4PQU B;  1RT1 B;  2HBR B;  1KQG B;  1R0A A;  3CCS S;  1AXQ A;  2OO4 A;  3HFK A;  3P3D A;  4B02 A;  2WW4 A;  4YB1 P;  1HBU A;  2KZZ A;  2UUA F;  4PQU A;  1RQ0 A;  1NCL A;  1OS5 A;  2BR0 A;  3V81 B;  4WXO A;  2I5J B;  3Q24 A;  3FMB A;  4L3K A;  1YRX A;  3GWC A;  2C2D A;  1SI9 A;  3MXH P;  3C6T A;  2ZDP A;  1UCN A;  2NXE A;  4KO0 A;  3BZQ A;  1JWW A;  3KUH A;  3KJQ B;  2V63 A;  5EGY A;  4HHJ A;  1RDR A;  4U67 Q;  3W9I A;  2IYI A;  4L76 A;  2KZM A;  3QGI A;  5IWA J;  1CJV B;  2JLE A;  1JLA A;  1R27 B;  4ZVQ B;  2V34 A;  2ROG A;  1N33 F;  1S0M A;  4IRK A;  4QQB A;  3BJY A;  2ZFH A;  3CF5 Q;  1CJV A;  4PG6 A;  1KHV A;  5KFG A;  4X4N A;  4K50 A;  4USK A;  3GIJ A;  2AX0 A;  3UNG C;  2HHT A;  3E8O A;  2KXH A;  2EW9 A;  2IIH A;  4RWX A;  1QTN B;  1S9E B;  1XR5 A;  3C66 A;  4HH0 A;  2MZQ A;  3TNV A;  2FLO A;  7AT1 B;  3I96 A;  2MZS A;  3MEC A;  1S9E A;  3RRG A;  2EG1 A;  2ZC3 A;  1M90 T;  1BWV A;  1WEY A;  3PY8 A;  3K89 A;  3ZZR A;  1C0U B;  2L41 A;  2GO9 A;  4MKV A;  1PC4 A;  3CIM A;  1QSL A;  1K1S A;  2E1A A;  5CYQ A;  1M1H A;  2Y1R I;  3CJ2 A;  2PT0 A;  2Z0G A;  3HHL D;  4JOU A;  2KVI A;  3A3N B;  5B08 A;  2RU9 A;  1S49 A;  4KKO B;  4DJB A;  2CJY B;  1TUV A;  1YKW A;  2CG8 A;  3OTD A;  1VIS A;  2XLI A;  2ACM A;  3PTW A;  4OL8 A;  1VRU B;  1VI7 A;  2W4P A;  1RTI A;  2A0F B;  3PRV A;  1TL7 B;  3PJW A;  4CLL A;  4RLE A;  5KFJ A;  2AWZ A;  3IBC B;  3DRX A;  4LF7 J;  2ZBC A;  3KG1 A;  1VRU A;  4X4Q A;  3PHT A;  4LF7 F;  5CYM A;  2FJV A;  3UDL A;  3L7U A;  3RB6 A;  5KFN A;  2BQ3 A;  1X4C A;  2MY8 A;  1KNZ A;  4A4J A;  3W8P A;  4QYR A;  1AA1 B;  1R8H A;  4ED8 A;  1CBK A;  3DLH A;  2R7T A;  5AJ3 J;  5AJ3 F;  4HH1 A;  2DH9 A;  2RT3 A;  4CLF A;  1T7P A;  2GQC A;  1UWA A;  1WHX A;  5B0D A;  4C8K A;  2YBV A;  3MM9 A;  5JXS A;  3DRR A;  2A18 A;  2UXC J;  1F9F A;  3QGH A;  4KB7 A;  2UXC F;  3UN2 A;  2NSB A;  3H98 A;  3CMA S;  5AXL A;  1IKY B;  2MZ1 A;  2FHM A;  3IO1 A;  3QWU A;  4ZDN A;  1NJY A;  2YWE A;  2NXN A;  3QO9 A;  2GQ2 A;  4RW9 B;  1RAF B;  1FJC A;  2GIF A;  1IKY A;  3OL6 A;  4I4B A;  4ETX A;  4CWB A;  2FLP A;  1E6Y B;  5HL7 Q;  5AE3 A;  1YI2 S;  4RW9 A;  2BJ1 A;  2K3K A;  3QT7 A;  4AXJ A;  3NCP A;  4LF4 J;  1UFK A;  1SL2 A;  1E6Y A;  1RA7 A;  3MDF A;  1ZOT A;  3DLK B;  3GZ7 A;  3JSY A;  2GV1 A;  3QJL A;  1H2U X;  2E1C A;  4IO1 A;  1RWK B;  4L74 A;  1GXT A;  2Q1L A;  3PDN A;  2Z56 B;  5CAA A;  2XG8 A;  2XI2 A;  2KFY A;  3MEE A;  1LWX A;  5BJR A;  1Z2L A;  3BN4 A;  3TUP A;  2B6A A;  3DDI A;  4EO8 A;  2I0X A;  1FEE A;  2R42 A;  3TVK A;  5JJB A;  1RA6 A;  3CJT A;  4X4V A;  2OSR A;  2HHH F;  3BSO A;  2H51 B;  2ASD A;  2CDR B;  1NK7 A;  3RW7 A;  5L1J A;  4OX9 J;  3IR6 B;  4EYH B;  4OX9 F;  4LRC A;  2ZJR Q;  1OMS A;  3D4J A;  4GKK J;  4HYK A;  3A8I A;  5J2N A;  5FII A;  4GKK F;  3VHQ A;  4PRF A;  3KNG A;  4NEZ A;  2G13 A;  2WRM A;  3HUL A;  1KQK A;  4CO5 A;  1FFW B;  5IXU A;  4NXM J;  1HMV A;  2DRB A;  1HAR A;  2ZEJ A;  3UR0 A;  4NXM F;  1XC9 A;  3MAH A;  4DF8 A;  1FHT A;  3NG8 A;  3D6T B;  2HUR A;  2GIQ A;  1Q16 B;  2MLX A;  2D74 B;  3UI3 A;  1R43 A;  2R7S A;  4OX6 A;  3VQS A;  4GC6 A;  4L6V 3;  1HBO B;  1PYO B;  3M8P A;  1FRK A;  1NH7 A;  2E66 A;  2YX4 A;  2GC8 A;  3IGN A;  5GAG I;  1XER A;  4AYB D;  2EBE A;  4KV8 B;  2OI2 A;  1RAG B;  1DTT B;  2BEF A;  3KK3 B;  1JXE A;  3L4B C;  2ALZ A;  4LRD A;  4JI5 J;  5F8M A;  4ES2 A;  2W4D A;  1TKZ A;  3H5Y A;  2E5I A;  4NLQ A;  3KLG B;  1RT7 A;  3GSI A;  3SCJ E;  4NLV A;  4HTJ A;  1WTF A;  3OFG A;  3KK3 A;  1S10 A;  3CCE S;  3U02 A;  3GJR B;  3THT A;  2IM1 A;  3KLG A;  4EEY A;  3EX7 B;  2RF2 B;  2VFU A;  3G2X A;  2NPI A;  1U1Q A;  3SFG A;  2P5V A;  1SCJ B;  2VON A;  2J7K A;  4KAI A;  2RF2 A;  4EFA C;  4GC7 A;  2DR7 A;  5GAE U;  2OAU A;  3OLB A;  2B8Q A;  4Y65 A;  2KRR A;  1HQU A;  1FTC A;  4TYA A;  5F8J A;  2FUG 9;  4ED5 A;  2QMX A;  4NOH A;  2CJB A;  2HFU A;  2B0G A;  4LQ3 A;  4URQ U;  2VPY B;  5ETQ A;  5C7P A;  2Z58 B;  1WEZ A;  4A8K A;  4C3K A;  2VHG A;  2L9N A;  1WG4 A;  1HD1 A;  3ZNJ 1;  4YP3 A;  1I5O B;  4UZC A;  3O3L A;  3AAW B;  1BQM B;  1RWU A;  4M63 A;  4NLP A;  2EKN A;  2DNM A;  2VFT A;  2N3O A;  3ZZT A;  4DUY J;  1CSJ A;  2U2F A;  3V5R A;  1R0B G;  4RNN A;  2PFD A;  4QU6 A;  4X4P A;  2NLW A;  4Z7C A;  4ID5 B;  3SXL A;  1N6Q A;  2CJA A;  3P6Y C;  4G6V B;  4ANE A;  2XLJ A;  1VQ9 S;  1PIE A;  4CO2 A;  2RDI A;  4USW A;  1A6L A;  3OSN A;  5L39 A;  3NL0 A;  4Z2X A;  2MQM A;  1C1C B;  4ZCL A;  3W5Z A;  1N34 J;  1IR1 A;  5CD4 H;  1UVI A;  4F0H A;  5K5M A;  1C1C A;  3GTY X;  3D2W A;  2JVO A;  1JKH A;  1L3K A;  3ET6 A;  2FVR A;  4R5P B;  2J0Q D;  1RTD B;  2IC3 A;  4MMO A;  4Y2M A;  4ALZ A;  5AT1 B;  2BE9 B;  4B9T A;  3OR1 A;  5KFX A;  1R8B A;  2M0G B;  1LFP A;  1FJG J;  4C3M A;  5EX0 A;  3ULH A;  1B7Y B;  1JXL A;  1FE4 A;  2FPH X;  1RBO B;  4ZVF A;  4NZ6 A;  2HFN A;  1WD6 A;  2M8H A;  2ZH8 A;  2L3M A;  2FGC A;  1MML A;  4CIO A;  3N6N A;  3TYT A;  3HVR A;  3LQV A;  4I2P B;  5LJ5 Y;  4NL5 A;  4FXD A;  5D4N A;  4DV3 J;  2HNY B;  3DOM A;  4DV3 F;  4JI4 J;  2J6T A;  4I2P A;  3LWM A;  4JI4 F;  3G87 A;  2YKM A;  1F5A A;  1S1V B;  2C2E A;  1FT8 A;  1WKK A;  3CD5 A;  2YWW A;  2AX1 A;  2MZJ A;  3OR2 B;  2QA1 A;  2ZD1 B;  4DX8 H;  5KFC A;  3IC1 A;  4YQW A;  2AJQ A;  4WWS A;  4LF5 J;  3MAA B;  4PXE A;  4M94 A;  2ZH3 A;  1RWV B;  3IR7 B;  4FNH A;  3WHI A;  4DDF A;  1NRK A;  1TKT B;  5A76 A;  3LP1 A;  3MM8 B;  2CJ9 A;  2ZH5 A;  2B9Y A;  3PHE A;  3O5T B;  4AQY F;  1TKT A;  1DFD A;  1YSJ A;  2V4Q A;  2WON A;  2QFJ A;  2NR0 A;  4F4K A;  2C22 A;  2FVQ A;  3ZZO A;  3H0P A;  3UE2 A;  1RAE B;  1U1K A;  4ZLP A;  1UZH A;  3MF5 A;  3RR8 A;  2XTJ P;  4NML A;  4GRS A;  4JV2 A;  1BQN A;  3QQC D;  2VG7 B;  3UD4 P;  5DDQ C;  2N3L A;  4JI0 J;  2WK4 A;  2BKP A;  3AOC A;  4MKA A;  1Q86 T;  4DV4 J;  2L9D A;  2X51 A;  3PNI A;  2IM0 A;  1RTH B;  1QVF R;  2VG7 A;  1RP5 A;  3QLH B;  3KG4 A;  4ZLN A;  3DLL Q;  5CZV A;  3BO3 A;  2JEI A;  1KLM B;  1VIX A;  2HLU A;  1FNM A;  3UW1 A;  1RTH A;  3MEK A;  1YJR A;  2EBG A;  4RL1 A;  3MM6 A;  2JDJ A;  2ZM6 F;  2OD4 A;  1KLM A;  4EI2 A;  3DLG A;  1RSC A;  3BSA A;  3D67 A;  2DNL A;  5HBM B;  4HHH A;  2DPJ A;  1XIQ A;  3MCM A;  4N76 A;  1FX4 A;  2XMA A;  3CCM S;  4J90 A;  4I6A A;  4IQM A;  4DV7 J;  3NMA A;  2Q66 A;  4DV7 F;  3OXF A;  2CQP A;  1SC3 B;  3PFO A;  4CTA B;  3QFW A;  1EET B;  3C15 A;  3OLA A;  3CJQ A;  3W8G A;  3KWM A;  1P9Y A;  2VJU A;  2VB6 A;  4EO6 A;  4W90 B;  1EET A;  4NZ7 A;  4DN0 A;  5EDW A;  2GO8 A;  2MPU A;  5KFA A;  2OIH A;  2C2Z B;  4ZP9 A;  4QBU A;  1HNI A;  2CQ3 A;  4NCG B;  2VKR A;  3GG1 A;  3UVJ B;  3IWN C;  2E29 A;  3SI8 A;  3AD7 C;  3GYX B;  4X4R A;  1YDL A;  1HHQ A;  2HBQ B;  3M8Y A;  4CNY A;  4F3Q A;  1T9V A;  1ZTT A;  1TK8 A;  3CD7 A;  1FD8 A;  4ED1 A;  1RZM A;  4TU7 A;  4TU8 A;  4LUB A;  2E7W A;  1JLF A;  5KT2 A;  3CDE A;  2RU3 A;  2YX1 A;  1N0V C;  3UDC A;  2CQ0 A;  2VU5 A;  2G4B A;  1D3W A;  4CO1 A;  3AQO A;  1S12 A;  3IWL A;  3TRG A;  3L95 X;  4CH7 A;  4QYZ J;  2UU9 J;  5J2P B;  2D1C A;  4U8Y A;  3A12 A;  2UU9 F;  4IDK B;  2YPY A;  1FO1 A;  3MHY A;  3SFU A;  4NXN J; 
#chains in the Genus database with same CATH homology
 3DOM B;  2JNJ A;  3DGP B;  1YDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...