3DOMB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
b'ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 17
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3domB00
2JNJA 3DGPB 3DOMB 1YDLA
chains in the Genus database with same CATH superfamily
3BKUA 2FZGB 3SCJE 1KP6A 5AE3A 5HJXA 2DXEA 1T9UA 4LFCJ 5KT6A 2G0IA 2HIYA 3QYYA 1XERA 3L7PA 5AXNA 1U26A 1UJ4A 2HS3A 2X1AA 2GQCA 4RW4B 3CDUA 2ILZA 3WX8A 4N47A 2XY7A 4U9RA 3POTA 4J9MA 4DR5F 4RPFA 3TQEA 2GIFA 3AXMA 2I0XA 2OEKA 2NREA 4PYAA 3SCLE 2ZBQA 2YPYA 2IY5B 4ZVRB 2IBOA 1SH3A 2E5LJ 4DPTA 2HQ3A 2VJUA 3Q8QB 3J7A1 4O3QA 3F44A 4J37A 4DDFA 1F0XA 4W92B 4TQSA 2RDDA 2GFFA 4DV4F 4K8RA 4FPIA 3F41A 1DBDA 1SKSA 4K5RA 2FJDB 4AUKA 2MPUA 3BPSP 1RE1B 3PIOQ 3JQJA 2E1MC 2ZBCA 3T1AA 1N88A 1A7GE 2YX7A 3K7RA 3JS9A 4JV2A 4M5HA 4D3GA 2I1RA 4DG1B 3UFCX 1T9TA 2DHAA 3N6LA 4DBQA 2YQ3A 3H20A 2BJ8A 3MWBA 4EWTA 1YIJS 5DLFA 4WU2A 2V50A 1X4FA 3Q24A 5KFKA 4FYWB 1D8YA 1HWUA 3HM9A 3CTRA 3CULA 1W2BR 1T0TV 3KHGA 4DR3J 4I2PB 1YRUA 5MLCV 2W24A 4X4PA 4QWEA 5KFFA 1RYRA 1KVJA 4RL1A 1ZS6A 3FBCA 4RLEA 2GC8A 4KPYA 4ZLJA 4KHRA 1PC5A 4TY9A 2AEJA 4PABA 4WFYA 5GAHU 2O3DA 5JUMA 1CS4A 3M8WA 1M0SA 2XZTB 2DNLA 1H2VZ 3A8EA 1VQLS 1HR0F 4TYBA 5EGYA 2EFVA 2MLYA 4H4MA 1U6BA 1PC4A 2EFOA 2JEFA 5GMDA 2AWZA 5D3GA 2OEJA 1IKXB 2DGXA 1U25A 3QZ8A 2ERRA 1N56A 4AE5A 5J2PB 1QJHA 2PC6A 3C15A 3EZ5A 4DL6A 3S7RA 4CZCA 4B9MA 4ZCKA 2CZ9A 4OQJA 3UDLA 4DV0J 2BQUA 3CCVS 3IGVA 2RIJA 4OI2A 3BBFA 2WONA 2W2NP 3TJ8A 1B99A 2YWKA 3EZOA 1IBMF 2OMLA 1RGVA 1IXKA 5ETRA 1Q95G 4HI2A 3P8BB 3DC2A 1MROB 5E5NA 3HVWA 3LUYA 2IC3A 1NHKL 4CLTA 3HT0A 1P9YA 2DY1A 4DV5F 4QR0A 1JLAA 4V19X 2D3ZA 4MKBA 2AD9A 1TKTA 2FQQB 4NYPA 4B9LA 4EZ9A 1JKHB 3G8QA 2GNKA 2ASJA 1IKWB 1AFJA 5M2PA 1N5QA 1Q5VA 3V6DA 8RUCA 4JI1J 5F9LA 4CLYA 4JYAJ 4NL5A 2N3LA 4FF3A 1IKYB 3DGVA 5ETLA 1RT4A 2LEAA 2Z2YB 1YLXA 2YWGA 4LF1A 1SCJB 1AZSB 2IYGA 2XCAA 3EGNA 1LFWA 4KKOB 1VBZA 3PCOB 2ILYA 1Y9OA 2Z56B 3FEYB 2VV5A 3RUBL 2MLZA 2D1CA 1S1XA 2HNZB 3WX4A 4ECUA 1LW0A 1S6QA 2IRUA 5E33A 4WBFA 2CRLA 2QX0A 4DQSA 1RWUA 2RKIA 2FHOB 5KTQA 1T05B 3GIJA 3KUEA 2ZDOA 4J9PA 5I3UA 2Y0BB 4H4KC 2KVIA 1OPZA 1R7IA 3JAMU 5GAGI 1ZOTA 3I0SB 1ZAXA 4ZP6A 1ZA2B 3NGSA 4IFVB 2VBWA 2GVDA 1T94A 2ZKUA 1SL1A 3LP0A 1CBKA 1T03A 3R7BB 4ZCIA 1HNIB 1RTIB 2E66A 2KXNB 4ZP7A 1VQ4S 1F5AA 1NLKL 1X5PA 2DYAA 5IC4B 1VHIA 4A46A 3ZZ0A 1GX5A 2ZBRA 3P96A 2IM1A 1S10A 1Q16B 3BYRA 1N48A 5ETNA 1B0VA 2HK2A 4F4XA 3DLGA 4B9NA 4NASA 4OLPA 1G3OA 4WTYA 3HF5A 2CUYA 2VC0A 2YKAA 3B82A 4AD6A 1FVSA 3KJQB 1X9MA 2ATLA 2QMXA 1YDLA 2D3UA 3G96A 1YZ7A 1M1GA 1K1SA 3ZXWA 1T9VA 2CQGA 1LW2B 5DQHA 3J7Z5 1YRXA 1CULA 3BREA 2V8GA 2DR8A 5H9EK 3D28A 4CO2A 1UEVA 1YRTA 2XYGB 2R2RA 3K58A 5LJ5Y 2VUGA 3QPIA 5CA5A 1U8SA 3NY0A 3EXYA 2NXUA 1JMTA 4Y2CA 2KG0A 1RT2B 4CNYA 1HNWJ 1YBUA 2B9XA 1K0VA 3W9IA 5AXLA 2NYIA 3PRDA 2N7YA 4DV6F 5L9XA 2NXJA 3JXOA 1C0TA 4AL5A 4DCJB 3D0HE 4X4VA 1NRKA 1LK7A 2QSWA 1KONA 1WC4A 5D78A 2Z8QA 1CC7A 3VQSA 2KYXA 4ZITA 3NCPA 3MUVP 4DOZA 3W65A 3HT3A 4GC6A 3K17A 4DL0C 4G1PA 2ZJRQ 4QQBA 2H4WB 3BSOA 1X4EA 5BJRA 3BKTA 5E0OA 3MPYA 4CCHA 4TXSA 2ZH1A 4GC7A 1SUQA 1Y5NB 2UUWA 4U67Q 4CO3A 5DG8A 2RH3A 1T95A 2R7SA 2AEFA 1NPKA 4CM0A 4F4WA 4L73A 1MG7A 1S97A 1NXIA 4RW9B 3TUPA 1OPIA 4Q0BB 4PQAA 4ZPWR 1FK9B 1K44A 1SKRA 3TOQA 3LF0A 5E41A 3NL0A 3HHLC 2X51A 5C42A 3C16A 4LFBJ 1SC4B 4J91A 3SV3A 5IQ6A 3SQOP 1PO6A 1WJ9A 4IOBA 5A8RA 2HGMA 1CJKB 4KFBA 4L3KA 4J9NA 3ZZRA 3EWGA 2DGSA 2GMHA 2OPSB 3DU5A 4B3SF 5ETOA 5J2MB 4TQRA 1NH8A 3MEEB 4DHVA 2IM2A 2QSFA 3BB5A 2A10A 4RNOA 5ETTA 3TAMA 1HI8A 1ICEB 5HBMA 2DB1A 3GV8B 3UD3P 1KTQA 3M8QA 1TVRA 4JI2F 2WSFC 1RT5B 5H9FJ 2VFVA 1MLAA 4FKYA 3GFXA 2BOAA 2Q79A 3FCHA 3NP5A 4C97A 3OXLA 2Z2ZA 1RWPB 2IIHA 1VI7A 2HGLA 2LP4A 2WVDA 4B17A 3M8ZA 3LAMA 3FBBA 3GFYA 1FRKA 1HQUA 1KQKA 2NR0A 1JXVA 3EPIA 3C46A 3PFEA 1D9DA 1TR0A 2ZZMA 4G6VB 3H40A 4DPYA 4J90A 4YR3A 1S1TB 5DDRC 4AL7A 3ILIA 3BQ0A 5D0HA 2ADBA 2HWHA 2D9PA 3IWXA 2DO0A 1SL0A 2KM8B 2OPRB 3CUNA 4CNZA 1XJWB 3ZZZA 1R6VA 2V6AA 3D6MB 5HO4A 4CQ1A 2XB2D 1DY3A 4R8UA 2NPIA 2GGPB 3CDEA 1OJ4A 3IG1A 3O8WA 2UUCF 1EKRA 4A48A 3A3NB 8ATCB 3MD1A 5HMXA 3ET6B 2X7IA 4Z37A 2XMKA 1Q82T 4WF9Q 4F0KA 4QYZJ 3FFIB 1WKJA 2ZZTA 1RKJA 1SBRA 5KG1A 3SFGA 1X5OA 4M5DB 1I6JA 1FKAF 7FDRA 2UU9F 1Q7LB 2CIMA 1WI8A 3ZO7A 2ZVSA 3HFKA 4CLLA 5DG9A 2EFPA 1N5VA 4DX7A 4KHPJ 4QYZK 1F3FA 2EKYA 2W7OA 5IWAJ 4BC7A 2Y8YA 3HHLD 3M8YA 3LGHA 9RUBA 3PW2A 2C2NA 2PEHA 5EX0A 3IO1A 2Q66A 3I9V9 3MECB 3E3XA 1UWBA 3T5HA 3FQLA 3DMJA 1P9QC 1R8PA 3M9MB 1HBNA 3AT1B 4OYAA 2ASDA 3E51A 3KLEA 1BXNA 2C1EB 2UXBJ 3IM8A 2ZJPQ 4WZMA 1FKPB 4EEYA 2UUAJ 5IOLA 4OYOA 2R2UA 1SJFA 4UY8T 4CH1A 1BUXA 1U02A 3HHLA 1K47A 1FERA 3RG6A 4DR2J 2LA4A 4CDIA 2RRNA 2VG7A 2B56A 2DH7A 2AGOA 3OTOF 3G82A 4CP5A 3RBDA 2COLA 1JLQB 3ILJA 2G2YA 2ZH8A 5KFIA 1PYTA 2B5JA 1JJCB 1W25A 3TWZA 3MM9B 4LBHA 3AD8C 1JWWA 1Q4RA 4JP8A 2O67A 2VQEJ 2QLXA 1VISA 2ZNYA 2DK2A 4CYUA 1IBLJ 1P6TA 3OSNA 3RBEA 2MJUA 2IM0A 2FPHX 5I42A 3EYZA 2MJNA 4ANCA 2VD3A 2G4BA 3TA0A 1DJ0A 3TUZC 1E6YA 2ZC3A 1FCAA 4LR8A 4HDGA 5F8LA 4I56A 1PG5B 2XMUA 1NU4A 4EFAC 1U1LA 4WKRA 3D9BA 4ZJQA 4WK1A 5FLXY 3T5KA 4GKKF 4OV6A 2H54B 2CPZA 3IS9B 1GXTA 1QD1A 2QIFA 4N7TA 1V6HA 1MU2B 1B64A 5KG4A 3MM6B 4C9DA 5DLGA 3CDAA 2QA4S 4LSLA 4B9VA 1D09B 2HVIA 3JSYA 2KFYA 1KFSA 4P7VA 4NLVA 3PYEA 4O44B 2V2KA 3TW0A 4H4OB 4TLRA 3M6UA 5B08A 2CPFA 2YQ1A 2HG4A 3I0RB 2F63A 4AL6A 4RW4A 2V5HG 1KRPA 2MY7A 1MMNA 2ZD1A 4JI8F 1M5HA 3OTCA 3UN5A 2CJYB 3OUYB 1G6BA 2QMWA 5KFYA 1IR1A 2IYIA 1OQ3A 3V4IB 3BF4A 3AXKA 2PA8D 1VK3A 5HL7Q 3PX0A 2LU2A 4G1QB 2UXCF 4RWWA 2R7RA 5IFMA 1V5IB 1F5BA 4JI0J 2DGOA 3DDKA 4A8OA 2KL8A 2BR0A 3RB6A 4LF5F 2J7UA 5ITHA 4C2MA 2I5JB 2VDIA 3PW5A 1DURA 1F1BB 1VQOS 3AAWB 3HPOA 1TTHB 1X5TA 2BUNA 2LFVA 4J9UE 1F6TA 4FXWA 5EWGA 4IQMA 3H5YA 1MN7A 4U8YA 4U7UK 2VOPA 4EU0A 1JK9B 2XQCA 4GO7X 2DT9A 4ITSA 3ZZTA 2OELA 1XNQF 1HNXJ 4K5SA 3TZYA 3MR6A 3LTOA 2B9YA 2ZM6J 3PYGA 4N5SA 1EB0A 5CZXA 5KFPA 1KR4A 3ZZOA 2CJBA 4NCGA 4RBVA 2FGOA 5DETA 2KFZA 4C0HA 4RNNA 4Y0FA 3CMQA 3P49B 5LSRA 5IM0A 1RHRB 3M2RA 4F25A 3BO4A 4MK7A 2CQ1A 4X64J 2K3IA 4PWUA 2V4QA 3K8VA 5HMWA 3MD3A 4KGZB 3MOZA 2YX1A 3IP0A 5B0GA 5ETSA 1UCNA 2DGWA 1M5SA 3A4TA 1S0OA 2W01A 1V3RA 4DL3A 2QLWA 2JLGA 2JLFA 4A4JA 2YNHA 2HQCA 1X4HA 3VAHA 2K1RB 1D1UA 1Q78A 2QYGA 1NNDA 1F5CA 4DR1F 3QFHA 4WXOA 1WDDA 2QLFB 4QU7A 2CZ4A 2WW4A 2GJFA 2HVZA 3ITHB 1N32F 3N6MA 4NMXA 1MW7A 1S4EA 3I5BA 4NWBA 4IKAA 3GTYX 1DAXA 5CXTA 1VRUB 1R0AB 2HQIA 1HD1A 2FZCB 2P6SA 5J2PA 2W2PP 2MLXA 2QZ8A 3CD5A 3TX0A 1L3UA 3TP2A 4MFBB 4LF4J 1PBAA 3CO0P 1U47A 1HBUA 5THWA 1T11A 3N6NA 3T6BA 3NG8A 2F4FA 4ZP8A 3MMCB 3GJRB 1NAQA 4NCBA 1RWXB 5C25B 3O1LA 2HNDB 2DNYA 4EUVA 1RWMB 3JTNA 5J2NA 1REVA 3L95X 2P5VA 2CQ3A 1U49A 1U6ZA 4BWJA 1ZM2A 1WG1A 4BCAA 1N5YB 5A0YA 5D4PA 2HLUA 1QE1B 1EETB 2OEMA 5LMUF 3RYLA 5EX3A 4OZ0A 3KJVA 3OVAA 3FRYA 4YDXA 1IKWA 2RF2B 3KJNB 2BW2A 3ENQA 4KH1B 3PO4A 5AJ3J 2LQ5A 2XHWA 2B9WA 3TAQA 4TLQA 1MMDA 3HVAA 1RDRA 1OO0B 1IKYA 2Z2LA 2RVJA 5M2RA 2CQ0A 4UOFA 2YKNA 4JI6J 1PJ5A 3HHKA 3LA0A 4P2FA 1GMUA 3PV8A 1IWAA 1R6YA 4YS2A 1S6OA 1Q79A 2HS0A 4J9KA 3CMAS 4A8SA 2B43A 3U7JA 3QLHA 4PUOB 2LCWA 2HNZA 3W8PA 2EG1A 4OI6A 5HROB 4DS4A 1UETA 3P4UB 2EFNA 2PI4A 1T05A 4FYVB 3OR2A 3UNYA 2DGQA 2QL9B 4KQZA 4OHYA 4IFVA 4WXWA 1F2HA 4ZVTB 2M0GB 3GYGA 2N7CA 2PDAA 1H3DA 5LM7E 1O8BA 1YK9A 1AROP 1GMVA 2OH2A 3FMWA 2V68A 1RI7A 1X31C 4ECRA 4KHMA 2QL7B 4DPWA 2GVZA 4DSLA 4I1TA 1VRTB 4CLWA 1EZZB 4C8ZA 1S9EB 1Y11A 3PY8A 4I6AA 3GIKA 3NNHA 3GILA 1RTJA 4KGXB 1HPZB 4K2XA 3V6KA 2EWHA 1XNRF 2XZDB 2KM8C 1GMWD 2BM0A 5J1EB 2MQPA 2XO6A 1WUUA 3Q86A 1VQ7S 3AJ1A 4HHUA 1LW2A 2YNIA 4Y2KA 4HDHA 3W7BA 1VRQC 4F7VA 1SB6A 1NH7A 1U1MA 4I69A 4JI4J 4EI2A 2HRTA 4Q8EA 4DX6A 4J9RA 4Q2LA 4OYPA 3MR7A 1Q8BA 2W9BA 3CC2S 2DKOB 3B4MA 3GB0A 2R8KA 1UVNA 2UP1A 5J1PA 1UJ5A 1GMWA 2ZOMA 2Q1LA 1SV5B 2VIHA 3ENAA 3RB4A 3GSIA 4F0MA 1JLFB 5KFBA 2QA4G 5AE1A 1X4AA 4Z7YA 1RJJA 3QFWA 3J7YU 3MGJA 3T19A 5EUHA 4ZVGA 1UL3A 4DR5J 5KFNA 3R2DJ 2JFKA 3CJKB 3AODA 4F67A 1P1LA 3UVJB 3HD2A 4LT6A 1Y5IB 2QEXS 3ZZYA 5L1KA 2P9GA 2BRLA 3B54A 4AXJA 1D3WA 1Q5YA 2QV6A 5DO2A 3JSBA 3V81B 1FNXH 3A1YG 4KBIA 4ZDNA 3LP1B 2IM3A 4WFNQ 1URRA 1I51B 2ZNZA 2KG1A 4DV4J 3D6FB 3IM9A 2OMOA 3D4JA 2OPQB 2CPYA 2YKMB 1YSJA 4DSFA 1PCAA 2UVUA 4Q0BA 4LBIA 1OY9A 2R7QA 1RU1A 1X5SA 4X66F 4RX6A 1RAJA 5A8WA 2FJXA 1N54B 3DM2A 2BZ2A 5K14B 2VICA 2HURA 1CJKA 3KMSA 5EHHA 1AT1B 3QGHA 2OPSA 1IBKF 2M70A 3OLBA 2WVEA 1DARA 2PFDA 4R5PA 3IR6B 2ROEA 3VVUA 4AYBD 4UOHA 2FHKA 1ZYQA 2I6WA 1TL5A 1R0CB 3T5LA 2JH3A 4LRCA 4B08A 3KHHA 2DRDA 1FEEA 4FN5A 4LRAA 3ZNJ1 4DV7F 2F4VF 1RT5A 1TL3A 2A2CA 2WBMA 3W61A 4IFYB 2J0QD 1PKUA 2Z4PA 4LF8F 2K06A 3O6QA 1RTDB 3W5YA 2OPPB 4EZ6A 4OL8A 4AXIA 2DJWA 3JQMA 1WHWA 1HR0J 1WDTA 2FJWA 2X1BA 2DGTA 2DNRA 3TZXA 5IZHA 2A2DA 3CCES 5AE2A 3MCSA 1S1TA 2U2FA 3CJ2A 4K4WA 4K4VA 2UVRA 3BGFA 2XEXA 3I55S 1NK9A 2OPRA 2XLJA 4QIEA 2J9CA 3RW7A 1RT3B 4HACA 5ETKA 3UR3C 4MK8A 2HNYB 5KFLA 1X9SA 2ZUAA 2LDYA 3FSIA 4LMZA 5DQGA 1FJCA 1WTBA 4F50A 1RBLA 1IBMJ 4YMEA 5AXKA 2H1YA 1WOOA 3ET6A 1U0SA 2C2EA 3OD2A 3AY0A 3G71S 2R7TA 4DV5J 3GLJA 4LBPA 4A8YA 4B3OB 3AJ2A 2IPOB 2DHSA 2IAJB 2KJVA 3FFIA 3IR7B 5CYMA 4NYZA 2BE2B 4ANEA 4M5DA 2OO4A 3S01A 5KAKA 4OFZA 2OSRA 3C14B 4YB6A 1X7VA 2CQIA 2CG8A 2GHPA 2K2PA 2IMOA 2XMTA 3JQKA 2J8SA 1ZETA 3BV8A 4PZVA 4LF6F 1SJ3P 3A12A 4LSNB 3FEXB 3OFFA 4L6V3 3L3CA 5CYQA 2WB1D 3LP2B 3CF5Q 4IH7A 3KG1A 3QIPB 4NCAA 4ECQA 4UF4A 1C1CA 1URNA 2V8VA 2BQRA 1W26A 2OJ3A 5A2QU 3OLAA 2GJIA 5KFQA 1RHQB 3CC4S 3MEDA 4KTQA 2B9EA 4B3RF 2EC0A 4JV0A 4RNFA 4QIVA 2E29A 1NJXA 3KK2B 4WFZA 3T6JA 3N5FA 3OL8A 3SSRA 5B0DA 4WZQA 3P3DA 1UW9A 3HVTB 1WHVA 2VA2A 3FJ2A 1FFWB 5D77A 2WVBA 2HFZA 3TNVA 1HWLA 4C48A 1F9HA 1JLCB 3IWNC 4GVBB 4Y00A 3Q8VA 3GZ7A 3DOLA 5KFSA 1HBMA 4J9QA 3EGZA 1FD2A 4MT1A 5T41A 1S0NA 2BM1A 1Q1KA 5KOXA 3HX9A 4DV2F 3DLBA 3QAUA 2ZEJA 1FXDA 4OZ2A 2FHJD 2W7AA 5L8RC 2HZVA 2JX2A 1EAYC 3NAHA 3ADAC 4USHA 1HNVB 4YOEA 4NLPA 5HVGA 2CWXA 2HBQB 2V2QA 1RAGB 2FVCA 5CCLA 1MU2A 4DV1F 2R4FA 3MM6A 3MAHA 4DV6J 4EK2A 4KIAA 2O5DA 1I5OB 1XMQF 4LRFA 3IRXB 1FJGF 2AJFE 1YJVA 2NZCA 2F9JA 3CCUS 3A3PB 2JEJA 2GAHC 2QFIA 4LJMA 5FLXU 2NZ4A 4CIOA 4RNMA 3HHEA 3Q8YA 5BR8F 3OXFA 4I2QB 1XEZA 3KK3B 2EW9A 4O44A 2FHJA 4RJVA 3W2VB 2OTLS 1U1KA 3EMTA 2BDPA 4H4OA 2V4RA 2FD2A 1U48A 4C3MA 1RXOB 3G2XA 1O51A 2Y1IA 5HLFA 3G6YA 3VAKA 2C2OB 2HZAA 3K2YA 3I82A 4CI0B 3V4IA 2R2TA 4WJBA 1GTHA 3LO3A 4F3QA 1RWKB 2MMYA 4G1QA 3DI6A 4URSA 4F3MA 2DNOA 1SQFA 5CCMA 1Q7YT 4FBTA 3H5XA 1FRXA 4ZVSB 2JZ5A 3QBCA 2DBBA 2ZKTA 3AB2B 2I5JA 1NK5A 3C6UB 3H59A 2WK4A 2VQFF 3P5TL 2J7WA 1SQGA 2K7JA 2OFHX 3GG0A 2AYMA 4LREA 3BO2A 2PFFB 3T1YF 2B8QA 4ZJLA 1FXLA 2C3MA 4B3SJ 4USKA 3AHPA 1IUJA 2XO7A 3DXBA 4IYQA 4X2BA 4CRJA 3PDNA 4R0EA 5K8OA 3UR0A 1IWGA 4DEZA 1WF1A 2YPZA 5L46A 1HHTP 2QL5B 1BQMB 2BABA 1LEOA 2MGZB 4E2FB 4ZK7M 4JI2J 3H4BA 3IFEA 3SDEB 3KK1A 3OJUA 3C2PA 3RJMB 3TEHB 1JJHA 5KOWA 2EXUA 2VPXB 3HK2A 4FVMA 4JV1A 1VBYA 1ZZFA 3QJPA 2LXUA 2BA9A 4ZHRB 4DPXA 4USJC 1NDLA 2K1RA 3NBPB 3MMAA 2UUBF 2PEBA 2YKOA 2A3JA 2F5GA 2RILA 2UVWA 1OY6A 3MR5A 4KV8B 2WHOA 3ITHA 1BC6A 2AF6A 1K73T 2FVRA 3T3FA 3MPDA 2OSQA 2KU7A 3HVRA 1S7HA 5GMEA 3HFZB 1R0AA 1LOUA 1RUSA 3OFEA 2FYXA 3K89A 1AW0A 1S57A 3OL9A 4F26A 5GAGU 2YH1A 3H25A 1LXNA 2DEIA 1RABB 1OYDA 3PR4A 2EBEA 2Y3YA 4MFBA 3NCRA 1HBOB 3VZHA 2D9OA 4DFPA 2BJ1A 2UUCJ 3AQPA 4C8LA 3WIVA 1GXUA 3D1OA 3MMCA 3CIZA 2BV3A 5C25A 2HNDA 2RSQA 1NK8A 5JVGQ 2CDRB 1QSSA 2M88A 3M6XA 3QT6A 4NI2B 1NBEB 1XR5A 3BM7A 4Y6IA 1EQMA 1ZPVA 3GMGA 1S1WB 2E7WA 2KH9A 4DX8H 1N5YA 1FE4A 2UU9J 2DISA 1QE1A 4UOCA 1YQHA 1HHSA 2KHDA 4HYKA 1P1TA 3J7YI 5HAOA 4W90B 3MCNA 5F8IA 4USMA 1TQLA 1LWEB 3QO9B 3DOKB 3LAKA 4CH0S 4K50A 4DV3F 3FBEA 4P71A 5K20B 1LXJA 1I1GA 1FT8A 2VKRA 1ULRA 1VS3A 2HHTA 4DUZF 3DKDA 2V94A 1FRMA 1TK8A 3AQOA 5CHCB 4RU2A 4ATNA 3Q83A 5IT9U 2RQKA 3CW2C 5DDPC 5HROA 4LRDA 1RCXB 3HHDA 4JOUA 3IWLA 5HN0A 4NA1A 2G2ZA 2VG5B 2ZH4A 4N8OA 1RT6B 4CH7A 3S1TA 3N01A 1CEZA 1UTAA 3X3UA 4RUHA 4C8NA 3FSYA 4QIFA 3VR1A 4LR7A 5KG5A 2XMVA 4JV5F 1TKDA 4ZMMA 1NPPA 1RWOB 2IVFB 3BN4A 4I6YA 2B7CB 1UA0A 3DLKB 5KFDA 1IBCB 1RT1B 2BACA 1LWCB 2HSEB 4OX7A 5U47A 4OHZA 3UDCA 4IQXA 4TU8A 2J6SA 1LWXA 2B7BB 5F8MA 3OQ2A 2BMBA 2W2MP 4ELUA 2BE9B 1M90T 4HHHA 5J1NA 3M32A 2RRBA 4F36A 1UAWA 2M9KA 4GKKJ 1WACA 1QUPA 2HKEA 1FDDA 1WG5A 1T3OA 3DXSX 5C2GA 2DIVA 1RCOB 5LL6d 3HDSA 3R5DA 2NUHA 3OTBA 4EBDA 2JRSA 3TA2A 1Z4UA 4OJ3A 2WCXA 3NKYA 3RB3A 4OYXA 1TL7A 4EBCA 3PHTA 2QMUB 4KGMA 3FQKA 4KE5A 2YWWA 1FDNA 1XIQA 2OUGA 2FLNA 2KXFA 3BR8A 4KYZA 2F8EX 1SV5A 3W64A 3KG4A 3CJ4A 3PJ9A 1S0MA 2F9DA 3M30B 4Z2XA 4I68A 1V9OA 2AYEA 1FI4A 4NLUA 1LWFB 2G2OA 3PHEA 1BD6A 2RS8A 1LNQA 3JSMB 4WKYA 2G0CA 4JI8J 2FJEB 3CJKA 2K8GA 3DGPB 4OZ1A 3QT5A 2CAJA 1RAOA 2B51A 2MZ1A 1JLEA 4DS5A 3UVJA 1BGXT 2NXCA 1N36F 3CCRS 1ZM3A 1U1OA 3MCMA 2Y1RI 2DRAA 2UXCJ 5A76A 2IA6A 1JXLA 1ZAWA 5LMNF 4LF5J 3LP1A 3GPAA 4CLKA 4WE1B 2BKPA 1TUWA 1UKUA 2D74B 4ER8A 4DQPA 3Q23A 3NGRA 1OS5A 3O5TB 4KT0C 3W8GA 3QJJA 2DR9A 1XNQJ 1P27B 3DYAB 4C0BA 5E3RA 4IDKA 3AD9C 4A8MP 3NS6A 2VDHA 4BC9A 5K14A 2FJAB 2M7SA 2MZTA 2PMZD 2JJ4D 2YNFB 5JXSA 3AJDA 2BX6A 2V4JB 2LXIA 3MEKA 1WORA 3Q0AA 4RW7B 2V8PA 4XK8C 2FZKB 2XC9A 1GEHA 1S1UA 2ROPA 1LK5A 3HJFA 4OV1A 2A0FB 4HVZA 4WIIA 3GV7B 2XTJP 5FJ4A 2B6AA 1PGZA 3R7SB 1WSRA 3UWTA 4DLGA 3GU0A 4NEYA 4E98A 1NK6A 2ASLA 2AP6A 4A8FA 4E8UA 1GTEA 1HL6A 3VF0B 1KS2A 4OX9F 3GV5B 3Q2SC 5F8NA 4IH5A 4UOGA 2R8GA 4DR1J 1RTDA 3BKFA 1H2UX 4IH6A 5J2QB 2OPPA 4DR7F 5L38A 2KJWA 1D8ZA 2KT3A 1N5TA 1N32J 2CVEA 2XMMA 1TV6A 3M2UB 1PSDA 2KRBA 2L41A 3NAIA 3ONQA 2IJNA 1GK8A 4LRBA 4LF7F 1WG4A 3TR5A 3POTB 2MXYA 2VHGA 1NSKL 1KOOA 4NLSA 5LSLA 3DLHA 5G0RA 1X60A 2HMIA 4BHQA 4KAIA 1HW8A 4U6PA 4NZ0A 2OD4A 1M1HA 2HNYA 3KTQA 2MZJA 2XWYA 3BQ2A 4YFUA 3MM8B 4OMFG 2IBKA 4W98A 2RMLA 3QZ7A 3M05A 1IR2A 2LXFA 4DQIA 2Z57B 1KNZA 3QGGA 3L9ZA 4J9VA 1J2VA 1SVDA 4S0MA 3M1VB 2KKHA 1M5OC 5KFGA 5LMUJ 1BQNB 1JNZB 3AFGA 4DMZA 2KI2A 5HSPA 3IBFB 5KG7A 4Q8FA 3ZFVA 3ILOA 4NA2A 1NEEA 4UQGA 1RAAB 5DRKA 4QWAA 2EFGA 2PIIA 1YJ9S 2D7SA 2DVIA 1RAEB 1XBWA 4JBCA 2DPIA 3C14A 4ES3A 2VKZG 3GSDA 5HQ8A 1HMVA 2XYPB 2FC9A 4I64A 3M8RA 2E44A 4TY8A 5F3ZA 3O2IA 3KLVA 3MHYA 1SI9A 5KT3A 3V2UC 5IC6B 2MSSA 1SKWA 4FF1A 3T9NA 4LSNA 2PGCA 4G3IA 3R9LA 3LP2A 2QA1A 4P2XA 3D67A 4FPRA 1KDNA 4DU7A 3QIPA 4YR0A 5EN1A 1AB8A 3GJSB 4DUTA 2JHEA 3V4MA 1TELA 4K59A 5D3GB 1KC8T 3EVMA 4L72B 4RBUA 3D7SB 2CJXB 4M8LA 2LA6A 1W7WA 5A6WA 4HLBA 2N82B 2PI5A 5GAEU 4Q44A 2W8KA 1HFEL 3C15B 4L74A 3KK2A 2M4MA 2YVSA 3KHRA 1Z2LA 4KY3A 3MFIA 5B0EA 2XS2A 4RW6B 4WYLA 1KTVA 1VIXA 1CJTB 4ECXA 3IGNA 1VK8A 2JLEA 3HVTA 3PVXA 5KG6A 4PWWA 2BQ3A 1ZBTA 2EG2A 3JTPA 2DEJA 2YKQA 1JLCA 4GVBA 3HZEA 1XNRJ 5DZ6A 1JNRB 2L9WA 1HNZF 4WP3A 2RQ4A 3ICLA 1RT7A 2AGPA 3FZBA 1CQMA 4P2MA 4MKYA 2HVHA 1PBUA 2RT3A 1YJ7A 3DOMB 1JLAB 3CCSS 1VQ5S 2HFOA 4HL9A 3HD1A 4U7CA 2MKHA 5T14A 3DU6A 3DN9A 3W63A 3T1HF 3MTKA 2ZHBA 3PW0A 2LQBA 4DUYF 1RT4B 3SBMA 3CPWR 1U1RA 1BMQB 1FNOA 4B02A 5GADI 4K0KF 1S99A 3LWLA 1TFYA 1NK0A 3W2WB 3HI9A 4B3MF 3NWRA 2FGCA 3KK3A 3W2VA 3IAM9 1VYAA 4HT5A 1S1XB 1PAUB 1LW0B 1S6QB 1RTZA 2EVZA 3B6BA 5HATA 5HQMA 4Y28C 2AJQA 1YI2S 1N33F 4QZVB 5B0AA 2OLWA 2RKIB 3BJYA 3CJSA 3TUIC 3SEOA 5FDLB 3M9OB 2MKCA 5D15A 4A8QA 2E5HA 3ELHA 4PXCA 2CADA 2GVDB 3LP0B 1VQNS 1T03B 4FS2A 3N0VA 5DDOC 1CJUB 3IA0A 1J5OB 3AOCA 3AOBA 3H2LA 2XHCA 2MQOA 2CQCA 1DQ8A 3C6UA 3AA9A 4PPDA 4CO4A 1TK5A 2ZC4A 2LDIA 1FNMA 2YNGA 2IRYA 1ZTTA 3KOAA 4X66J 3R27A 4PG8A 3DLGB 2MKIA 2H65B 3ZTSA 2VBXA 1QY7A 3DCAA 3MURP 3UD4P 2EPIA 5C5JA 4FVCA 4TYAA 4YP3A 2FTRA 3MEGA 3K5NA 1IBKJ 1D0EA 4KO0A 1E6VA 3EX7B 2PN6A 1WF0A 2VC1A 1R43A 3K8WA 3NGDA 6FD1A 3R1LA 5HMZA 3CC7S 4OYZA 2MZRA 3WHIA 4DV7J 3X1LB 1TL1B 5DG7A 3M8SA 2F4VJ 1S5ZA 4U8VA 4YB1P 1RQ0A 4LF8J 2ZVIA 2L08A 1UEKA 3BDEA 1X4GA 3DRSB 5A8KA 3PO5A 2WRMA 4USWA 3BH7B 1OSCA 4YHHF 4IO1A 4IOCQ 4KR0B 4OHWA 1YKWA 4KV8A 3DRYA 1SJ4P 4ILLA 2ZFHA 3MFHA 4ZVHA 2CNNB 3B78A 3UI3A 3M2VB 3K0JA 1QSYA 3FCWA 4K4YA 2XS7A 4F04B 3LGMA 3EDRB 1SUQB 2J6UA 1NO8A 3BYPA 4NLRA 2NUUG 3BSAA 2KDOA 5AXMA 1HBOA 3QRRA 1S9GA 1CPZA 1TMMA 1P8GA 1BWEA 1VGYA 2C2KB 1RWWB 1IJFB 3KLIA 2H5JB 3UDEA 4HH0A 3D3CJ 4ID8A 2B4OA 3WQPA 2HPUA 4NI2A 4PRFA 2HAIA 4I7FA 2DNZA 4H4KA 5A8RB 3BO3A 1S1WA 4KFBB 1XR7A 3GQCA 4O4RA 2NSBA 1AXQA 2Y8WA 3J80Y 3RAQA 3KYLA 4ALZA 3RBXA 2J6TA 2XMAA 3C6TA 3Q22A 1S0VA 4C11A 4MAKA 4FF2A 3NNAA 3R5CA 3PW4A 3TAMB 1OMSA 3SSQA 1Y3KA 3HO1A 4P72A 4IG0B 2JNJA 2NSCA 3UCUP 1LWEA 3QO9A 3M8QB 5H9FK 3DOKA 1U0HB 4JI3F 2H9ZA 3SXLA 2DHHA 3M8PB 4P6QA 4X84A 4LF6J 4DR6F 4AFFA 3ULHA 4QOTA 2C3YA 3KKFA 2C22A 2AGQA 3CJ5A 4C8KA 4DN9A 1UZHA 3JYTB 3VWSA 2C28A 2CQ2A 3M9NB 5KT5A 4ZLLA 1KN6A 3H0PA 3K57A 1HQUB 4XDCA 3FSXA 2F8HA 4Y2MA 2ZJQQ 4B3TF 4P75A 3MAAB 3BGLA 3UO0A 2M3DA 2HHQA 2VG5A 4B3RJ 2G1DA 4AT1B 3K5MA 1H7XA 1Z2ZA 4LVOP 4F4ZA 4NXNF 1XMBA 2NPFA 3RU0A 3PACA 4J5OA 2F7VA 1D9FA 2IA0A 2DNKA 3H4DA 2CFXA 2XY6A 2KN4A 1TKZB 1SC3B 4LVNP 4MJKA 3IRWP 3OFHA 4R8UB 4X65F 2AT1B 2XBPA 4K4TA 2AKWB 2BBEA 3DLKA 1FDAA 5D4LA 3R7NB 1RT1A 4F02A 2C2MB 4WP8A 3D1HA 3K5LA 3SMZA 4GKJF 3A13A 2VBYA 4OHVA 3PEJA 4QIWD 3MM7A 3DLLQ 4WFBQ 4DV2J 4ILMA 2ZBPA 4URGA 3CD0A 4BLGA 3HJVA 4GVLA 4DLEA 4U95A 1U1PA 4QW9A 2E5GA 1FWPA 4DR4F 1DLOA 4OYMA 1FTCA 5A2QY 4OI1A 2JVOA 4PG6A 2V67A 1V5VA 5BYSA 4DV1J 4PWDB 5F8GA 4K4ZA 2KXHA 3GCXP 2CPDA 3CSKA 1XMQJ 4F4AA 5D0EA 5KG0A 1FJGJ 3BSCA 4YY3F 3QNWB 4XPCA 3VZIA 4ILRA 2XLIA 5BR8J 2XMJA 1UWBB 2R42A 4ZJOA 2SXLA 1UVKA 5E2QA 5IV3A 5KFHA 2QJ3A 4JI5F 1EX8A 3M30A 3NRBA 5C2CA 5F8HA 3UDVA 4MIWA 3CCMS 4PG7A 1LWFA 1HBNB 2XG8A 4DX5A 3TJ9A 3JSMA 2E7XA 3F73A 1O5JA 5F9NA 1TAQA 1SIWB 2RRAA 3C66A 2H51B 1TP7A 3TZZA 2U1AA 1R0BG 3HLUA 3EVOA 4C8MA 1WTFA 1L5UA 2VG7B 4HKQA 4ECSA 3G82B 4KPCA 4OI0A 2W9CA 4UY85 3BPDA 1NKCA 2B5JB 2PO4A 1IM4A 1FA0A 1DTQB 1SXLA 2R7VA 1TL4A 4ZCLA 3H8YA 2VQFJ 3KG0A 2PMWA 4FXVA 2D69A 3MMBA 4PCQA 3TRGA 2CNKB 2E1CA 4RUAA 3PX4A 1UEUA 2DXFA 4TNOA 4CYUB 2DH8A 2FY8A 1JJ4A 1VBKA 2L9NA 5F3TA 3PYDA 1XWLA 2D3O1 4LFAF 3DYAA 2RU3A 1KFDA 1SH2A 3R6GB 3T1YJ 3NMAA 3GR0A 1F9FA 1N34F 3E8OA 2MQMA 2C2DA 1L3TA 4BS2A 1KBRA 4NMLA 3PXGa 5ETVA 2LQ8A 3BGRA 2V4JA 4ED8A 5GVQA 4DF4A 3IBWA 4X4OA 4FZVA 2RQCA 2LECA 1GXLA 2W9AA 4R0JA 4ECVA 3D3BJ 2PE8A 2DXDA 1O6XA 5IXUA 1DRZA 3R97A 1NSAA 2GA7A 1S6PB 4KC5A 1A6LA 1M5PC 1YBAA 4ZPDA 2WZ1A 5K8MA 4ERDA 1FHTA 2UUBJ 1FFGB 4O3RA 5J2QA 1KQGB 5GAEI 2BVZA 4ZVEA 2R8JA 2DNHA 4ED0A 1Q0NA 2UVVA 4DPUA 2YH0A 4TU7A 1N4LA 2R9LA 1U8WA 3M2UA 4NLOA 1G1XA 1VMBA 3ISNC 4XDDA 2ZD1B 4NXMF 2ZHOA 2OP5A 4H54A 3TQ1A 3GCWP 4ZOSA 3MUMP 4PG4A 2B4UA 1S76D 1NJYA 1MWQA 4QW8A 5DQIA 3SZ2A 2M5YA 4DL2A 3J81j 4WK3A 1YJWS 4YR2A 3MM8A 3D68A 3H42A 1QM9A 4BBYA 3RGIA 4DG1A 3FCVA 3EICA 1WC1A 2ZH3A 3UN3A 1S79A 2UZAA 4M1KA 3PEHA 4ED4A 2QLJB 1N0VC 3M1VA 3V6JA 4IRKA 1FD8A 1EHWA 5KG3A 4I2PA 3W9HA 2MYFA 3BBCA 4RKUC 1CLFA 1BQNA 3SCIE 4NCGB 1RHMB 1AFIA 4ELVA 2AQ4A 4UT4A 5IM0B 1SH0A 3M2RB 2JFDA 4ED7A 2PA3A 2HHSA 4NRTA 3ETOA 1QTNB 5MAOA 1Q8LA 1IVZA 4DV3J 2JL9A 1NSQA 2BE7D 4K4SA 3KNAA 2OD6A 1XMOF 4DUZJ 1I94F 2RUSA 2HBYB 1FKOB 2J8AA 2XMWA 4CTAB 4O0IA 2EFQA 4EO8A 1FTRA 2J9EA 2YNHB 1IKXA 2JWNA 1Q86T 3FMBA 2YTCA 3E2EA 2HYIB 2VFTA 2Q6CA 4LIWA 4OZNA 1RACB 2E1AA 2MHEA 2V63A 3DLJA 4IO9Q 4ZVQB 2AZ3A 2VODA 3GIRA 4ZVFA 3GJTB 4OZ5A 4I0WA 4DL5A 2I9SA 4ZPBA 1X9WA 1QDUB 2AJ2A 4JV5J 2VZ9A 3D0IE 3BDPA 4CT8A 4UQTA 1S1VB 4Q43A 4MH8A 3PRVA 1AUSL 5IV4A 1HBUB 4RW6A 4USIA 2OTJS 2Z2MA 4EO6A 1CJTA 1MROA 3KUGA 5CZVA 3ISND 2CQPA 2CPHA 1ZAVA 3MCOA 4IOAQ 1HWIA 3TARA 2IMWP 1LKZA 5KFRA 1RKIA 1JKHA 3CWJA 1S12A 4HHJA 1MMLA 2WBRA 4ZIWA 5J2NB 4J7CA 1REVB 2MSTA 1VLOA 1VQKS 2ACMA 5IT9Y 1O0PA 5F0WA 2DRBA 2W7PA 1RZMA 5DDQC 1S77D 1OIAA 2BANB 3LOUA 5A0YB 3G86A 1H7WA 4F4KA 3DOMA 2AEMA 4PEOA 2I2YA 4FYDA 3PG9A 3VQTA 1AZSA 4ZA1A 3BN7A 5D6GA 3KJVB 1S4FA 2VU5A 4KKOA 1HQEB 1EARA 1KQSR 2I8EA 3KHLA 4J9SA 4OIXA 4B9TA 5SUHA 4HTJA 2YKNB 2VB6A 1WEXA 4YUDA 1FRLA 4U7UD 4ZLPA 1R8BA 3W2WA 2IDEA 1VQYA 1YJNS 1KSPA 1VOMA 4HH1A 3F56A 1QVFR 4NEZA 2H48B 4ED6A 1RP5A 3I0SA 2GMLA 4F4YA 3QLHB 3QIDA 1Y10A 3MR3A 2P9EA 1HNIA 1RTIA 2ZH7A 2QT7A 4PAAA 3VAGA 1NZAA 3RAXA 2B0GA 4HTIA 1N36J 1QTMA 5LJ3Y 1KWMA 1Q8IA 4NE9C 4DSJA 5I4MA 2RE1A 5FDLA 4EMDA 4IRDA 3LW5C 2CYYA 3OR2B 1T7PA 4X4TA 5LMNJ 4X62F 1KHVA 2KHCA 3HXMA 3D66A 2FJBB 1SKUB 3L7OA 1NUEA 1UZDA 2IJFA 1CJUA 1PJ7A 1TUGB 3M7VA 1NDKA 2HHWA 1J5OA 2ZH5A 3J7ZT 3MPWA 3A3OB 4J9LA 2HBZB 3P5BP 1FX2A 2WSEC 2GVZB 1M5VC 4OI4A 2W4PA 2Q43A 1Q53A 2RHQB 4M95A 3HULA 4L75A 5IT4A 1RWNB 3ENVA 2GMJA 2ALYB 2M2BA 4FNHA 4XO0A 3OT9A 3DRRB 5L1JA 3GWCA 1RTJB 5H9EJ 2CDQA 1X4CA 4DFJA 4DZDA 4NLDA 1FRIA 2XNRA 2FC8A 4QBUA 1UMJA 1RT2A 4Y34A 4ZVPB 4ANDA 1KD1T 5T7LB 2XSJB 2YNIB 1GAOA 4OJGA 1NSPA 2UV8A 2L9DA 3VVTA 1TL1A 4HT7A 3ZTQA 3SIPB 1IKVB 2V8HA 4RU9A 1J5EF 2KYZA 4B9UA 4KSEB 1UPMB 2RDJA 2FDNA 3EE3A 4O0NA 2W9BB 4OX9J 2DNQA 3QJLA 7AT1B 3NGTA 3LPEA 4MIAA 2GIQA 3DRSA 2HW3A 4Y3CA 4DR7J 1T8EA 2LU1A 2EEYA 1UJ6A 4ID5B 1H72C 3NOGA 1DHMA 4A8KA 1RAIB 4XIUA 3QATA 1XK8A 4Q2MA 1NHVA 1ZA1B 3OR1B 2C42A 3PJXA 4LF7J 2BEFA 3D6HB 4A8WA 2A18A 5HANA 2AHOB 1PYOB 4DL7A 3QSIA 1KEKA 5K9FA 3M2VA 1R31A 1YX2A 4RW9A 2XM3A 1H2TZ 3Q89A 1KQFB 1FK9A 2MZQA 3N9UC 3HSDA 5E3CA 3ZTPA 4ZPAA 2HVDA 2XNQA 5CYJA 1PJ6A 3W60A 4ZP9A 1IQZA 4ECYA 1VLYA 3CO9A 1ZPWX 3GYXB 3PM9A 2CKWA 3W5XA 4I67A 1SC6A 2H5EA 5KFZA 2GW8A 2JC0A 1RTHB 2GHVC 4RBTA 2VPWB 5J2MA 3OHBA 4NLQA 2PMHA 2HIQA 3MEEA 5IS2A 5A8WB 3DM2B 4MMOA 2K7KA 4MK9A 2ACYA 1YJRA 3CJRA 1YBTA 3GFZA 2CZVC 1KVKA 3EVWA 4GMKA 4TN2A 3B8HA 3MUTP 1FWLA 2R7OA 4CLPA 1CJVB 2QE5A 4DF8A 3GIMA 4R5PB 2VF3A 4P2SA 2YY3A 2IRXA 4U96A 4ES2A 4FNIA 3ZZPA 3KLFB 2CJ9A 5SZTA 5HQLA 1ZTWA 1FDBA 3HZGA 2JVRA 1RLCL 2OGUA 3UCGA 3LWMA 1VR6A 2GCFA 4IG0A 1UPPA 4ZN3A 3SI8A 2G9OA 1NDPA 3A8JA 3UNGC 1U0HA 2CJAA 3ZC4A 4Y65A 1TL3B 5CAAA 3M8PA 4DN0A 2RS2A 1NM2A 3J80U 4DQRA 3LGNA 2RNEA 2CPEA 1A0OB 1RB0A 1YHQS 4CLUA 6FDRA 4ICLB 3H90A 2DCLA 2XULA 3JYTA 3WC0A 3U1LA 5DGAA 5DM7Q 4XTTA 2GX8A 3H5UA 3OL6A 2MQ8A 4YDDB 4A8XA 3R2CJ 4RNHA 3UQSA 3U02A 1JIHA 4UUXA 2DR6A 4N76A 1NJZA 1BLUA 3MI7X 2EC2A 2GHWA 3MAAA 3BZQA 2GGPA 3VCDA 1NCLA 3H2VE 1MSWD 4RW8B 2VG6B 1K8AT 4AQYF 4HACB 1WD6A 4ETXA 1PIEA 1B70B 2R8IA 1EKSA 1TKZA 3KDNA 4CLSA 4ED2A 3CDWA 2M8DB 3IBCB 3L7UA 4P9SA 3FBFA 5H1SV 1T9WA 1S48A 5HVHA 2DNNA 2CNLB 3IAS9 3VALA 1R27B 1HNZJ 2DD8S 5C7PA 2DH9A 5HK4A 1XN9A 1GX6A 3ETMA 3OVSA 4NZ6A 2MZSA 2PD1A 3JB9k 2C3OA 3EPGA 1JLBB 2M52A 5AT1B 1WC6A 5DZ7A 1N0UA 5HMYA 3D5MA 5CYMB 2ZITA 4CO0A 3O44A 4JI7F 1VQ6S 2HZCA 1TZ0A 5CD4H 2JSXA 3MECA 3R1HA 4Y2IA 1VJWA 1ITPA 3HSGA 3T1HJ 2QFJA 2LEPA 4ZN1A 1B3TA 4DUYJ 4PWDA 2XCPA 2BJ3A 2KTQA 2HHXA 4K0KJ 2X3GA 2FVPA 1RAFB 1FKPA 4C98A 2UXDF 3DLEB 4B3MJ 4CM2A 3Q8UA 4L76A 4W4MA 5RUBA 4GO5X 1HKAA 4WU3A 3HHNB 2E7VA 2E1RA 2F65A 1FJ7A 2DGVA 1JB0C 3ZNUA 3NXZA 5CYQB 3ENWA 1JLQA 2DR5A 1N33J 4LQ9A 4NZ7A 2Y0SD 1HYSB 4DCPB 4JUZA 4K4UA 1C1CB 3KJFB 2B8PA 3FKBA 1SL2A 3MDFA 4D3HA 3MM9A 5BYQA 3MZIA 4MIBA 3NNCA 1QUVA 1JXEA 3FUYA 3M6WA 4M5JA 3I5AA 3MEDB 3SV4A 2MEWA 3W66A 2HFSA 4X4RA 3G6VA 4OZJA 2BKOA 3U1NA 4QCLA 2XLKA 1DTQA 1G4CA 2HFVA 3D2WA 3GG1A 2R7XA 3FEZA 2GZOA 2BYCA 1RLDA 1YVFA 4M63A 3KNGA 3CVKA 1B4SA 3WIUA 3DOLB 1FO1A 3IS9A 2NQPA 1HBMB 5D0GA 5EWFA 3I4PA 3BGOP 4K4XA 4HR2A 1NMEB 3G8TA 3I9ZA 1B0PA 2R2SA 2A6MA 4HEA9 5I3QA 3EGWB 3US5A 3R5AA 3CJTA 2GQQA 2NCKL 1S7IA 4URQU 5GAHI 4NLYA 3MAQA 3LALA 1YJTA 1NJIT 4ZIVA 1UFLA 1RWVB 4DWIA 2QGFB 3KXDA 2AJ4A 1MWYA 2UV8G 2ROGA 4CO1A 3CEDA 1H74A 1EP4B 4USUA 5HP1B 2QO3A 3TZWA 3SQGB 2AMCB 3I0RA 1S6PA 2O01C 3MM5B 2NXNA 4QWDA 5HI7A 1WNEA 1YG0A 2XZWA 1M5KC 2JEIA 3MMJA 4ZCMA 4C3KA 4YHHJ 2VA3A 3OUYA 2KT5A 5B0CA 3HFVA 1WOSA 3RBZA 3LQVA 5L9NA 1APSA 1VC0A 2QG9B 2WSCC 2HGNA 2HHVA 1GFWB 1DQAA 4HI1A 3NOCA 1UVJA 1QLNA 2HHHF 3RRKA 2YKPA 1AYEA 5HLFB 1F60B 2P8IA 2G13A 1RK8A 2G1HA 2E9ZA 1SJRA 2CJQA 3MPVA 2B3TB 5ETQA 3DI6B 2PSZA 4MKAA 2X1GA 1S9FA 1YTYA 2YX4A 3UPFA 3NMRA 3R6LB 3CD7A 4OJ1A 4FYXB 5IT0A 4FXDA 1U7LA 1HA1A 1FXRA 3RB0A 3QAEA 3OTEA 1WC0A 3VAMA 3QWUA 1GT8A 3W3SA 4N41A 2A1BA 4ZVUB 4ENOA 3PIPQ 6AT1B 4NLXA 1UW4A 1F9EB 2W4DA 2FB0A 3FVYA 1T9XA 4LQ3A 2E9RX 3E01B 2ZWOA 4FBUA 5E3QA 4LF9F 2FUG9 1VQMS 3PKMA 3W5ZA 1S49A 4C0OC 1Q81T 1GNKA 2BW7A 3VGTA 1REGX 1UVLA 1YITS 3GIIA 3R5BA 3AOAA 3DRPB 4OX6A 4KGVB 2VOOA 2KT2A 3AD7C 4ELTA 2YWEA 2Y1JA 1UVIA 4ED3A 1HD0A 3TVYA 4JI3J 3KK1B 1WWHA 2Y9HA 4LFCF 3SSSA 4DPOA 2ZOGA 2YBVA 4DR6J 5ETMA 3KFWX 1SPBP 1SQEA 2O66A 4WTOB 4O3NA 2VPZB 2DY9A 3FK4A 1FF2A 1FKOA 1PILA 4KRWA 1MNEA 4CTAA 4FS1A 4Q5VA 1VRUA 5GADU 4YN3B 4IG3B 3MMAB 4B3TJ 3V5RA 2CXEA 4NLWA 5LOQA 1YZ6A 2AYBA 4X4NA 3IMQJ 3EZUA 1OSDA 2F40A 4LIRA 1VC5A 2E5LF 2RDIA 1OYEA 4NXNJ 2AJ1A 3GJQB 1PAEX 2HHPA 3CCZA 1T3NA 4UTGA 3TAPA 3D1QA 2VFSA 3BBBA 2FLLA 1C1BB 1WSVA 3IR5B 4X65J 4PKDB 5D0RA 2C2RA 3BS9A 1WHXA 2CA9A 1U6FA 4P52A 4X4UA 2Z0GA 1S1VA 2HWTA 1WF2A 4PXDA 2NLWA 1U4BA 5KFTA 2ALZA 1N6QB 4QR2A 1ROFA 2X3DA 2J5AA 5KFAA 1NKEA 1S6UA 4GKJJ 1EETA 4DXLA 3UCZP 4Y2AA 2ZBIA 1FEHA 2IVYA 4QWBA 3T9ZA 3I6PA 5D4NA 2XY5A 1HIYA 2RF2A 5KFEA 1NZ8A 2YWHA 4N8NA 2QTWA 1JLGB 3RAMA 2K3KA 3P45B 1QAJA 4NPOA 5G4DA 3HSZA 4DR4J 2BANA 3PJWA 1FRJA 4OZLA 1FWKA 1NHUA 4DR3F 4C4WA 3Q8RB 4O4GB 3DDIA 4I6WA 1HQEA 4IR1A 2BJ9A 1FX4A 2HRUA 1H38A 4YY3J 2CQDA 4PUOA 2IFXA 2EBGA 1VDHA 1KVIA 4LR9A 3K5PA 1Q8KA 5A6PA 2RQMA 5KFXA 4QU6A 4JI5J 4WCEQ 1X4DA 3OTOJ 2ZH9A 3EXCX 3I5CA 3S8SA 2EK6A 2Z58B 3QT7A 3I31A 3PFOA 4QJVA 3C3LA 2W2QP 3G9CA 2CNOB 5CQGA 3Q2TC 3KUHA 1VRTA 3L4BC 4DV0F 1S9EA 2B4VA 1VBXA 1UVMA 4ETZA 3U27A 2W8LA 1CG2A 3CDBA 2ZWPA 4BWMA 1IN0A 1AUDA 3QWPA 3EUNA 2R7UA 1HPZA 2P2CB 1RA7A 4B9SA 3HP6A 4G65A 5JMNA 3FNNA 1TMJA 4F8RA 3BH6B 5J1EA 4LFAJ 2LQJA 2QLBB 5KT2A 3J81Y 4QIGA 1UWAA 3RRHA 1N34J 1U09A 2W2OP 3DRRA 4LF2A 4M5KA 4BDPA 1RBOB 2DIUA 4Q45A 2DPJA 1U1QA 4E0DA 3CGIA 1Y7PA 4DU8A 3M32B 4KGKA 4JI1F 2OFGX 4JYAF 2JDJA 5DGBA 3C19A 4MYUA 4QYRA 3VTIA 1KKHA 3DDNA 2ZDPA 3KLHB 3VAFA 5T7LA 1CQNA 5DJBA 2XSJA 4C8OA 3THTA 3BQ1A 2Y1LB 3SFUA 3KLGB 3BR9A 1ZM4A 4DL4A 4NX9A 1JLFA 1K1QA 3WZ0A 1IKVA 1OWXA 1HHQA 4YQWA 1TU0B 1DTTB 2ZE2B 1TL7B 4USTA 5C24B 3W1YC 2AX0A 3TANA 5LSOA 1XR6A 1BY9A 1JX4A 5K8NA 3M6VA 2L48A 2VFUA 4OYWA 3UD5A 5E7OB 4DI6A 3KMQA 4ID5A 1QSLA 1LFPA 3ILLA 2XGPA 1TAUA 3CNQP 5DM6Q 9ATCB 4TKTA 3TA1A 2V69A 3OR1A 3V81A 4FYYB 1UP1A 1WKKA 1WOPA 2FVQA 3HCXA 3OHAA 4NXMJ 1KLMB 2QC3A 2BJEA 3S6EA 1TKXB 1JLEB 3QGIA 1L3SA 2PT0A 3HSJA 2CPIA 2HFNA 2OPQA 3ZZUA 2YKMA 3M4XA 5KFOA 2NXEA 3IN5A 4PQUB 2X1FA 2IDLA 1YWXA 1X0FA 1WEYA 4ZPVR 3OBIA 4ZPCA 1GH8A 3HKWA 5KT7A 1C0UB 2IJRA 5D4OA 3PYFA 1WELA 1LV5A 2DHXA 1PYSB 3OSPA 3CT9A 4V19J 1F2GA 5EWEA 1RTHA 2WOMB 3KDOA 3PNIA 2CQBA 2GQ2A 2DNPA 1RHJB 4IDKB 3SCKE 5JJBA 2MDAA 3DRXA 3G8SA 3TX8A 2DO4A 1U2CA 3BGUA 4F0HA 3RR7A 2CQHA 1T9YA 4P73A 2LYVA 2WAQD 4RZRA 1X4BA 2HQGA 1DZ5A 4IFYA 4DSIA 2MKYA 2AV5A 2R3VA 1CJVA 3WC2A 1HNWF 1S1UB 3EDQB 3KLFA 2E5JA 3PRBA 3PTWA 5B09A 3CCWA 1RAHB 2B6AB 3GR1A 1EJ7L 1XMOJ 1UFWA 1NJWA 1RISA 3BEGB 1I94J 2ASYA 2LVWA 2L3MA 1J27A 1B7YB 2WB4A 3NS5A 4IR9A 3CCQS 3OFGA 1N52B 4J9OA 5JVHQ 1FJEB 2ADCA 4ICLA 4OLOA 1X0PA 4FDFA 2APOA 4IUFA 1RT3A 1TV6B 2XS5A 1YJUA 3GONA 4NYOA 2RHSB 2CVIA 2I38A 1IR0A 2AYGA 3NWGA 5LXRA 1Y3JA 3AH6A 1FE0A 4ES1A 3OJSA 1UA1A 3MXHP 5G0RB 1KOHA 2P9CA 2HMIB 4PYDA 5HVFA 4RW8A 3BSNA 3O3LA 2BXJA 2VG6A 5B0FA 4YEAA 1YGYA 4NA3A 2OAUA 3MR2A 5CD4A 2Q6BA 2D3OR 5K5MA 1A9NB 4FF4A 4LUBA 4B3OA 3N5BA 1RYSA 4GRSA 4IRCA 4LFBF 2IAJA 3P6YC 1HLWA 3KWMA 4M5LA 4CLZA 5M2UA 2BE2A 1OQ6A 1N5SA 3V6HA 3VGSA 2OI2A 4USVA 1VIOA 2AW0A 3D0GE 2ZUGA 2DCUB 3CCTA 4F2SA 3RRGA 3GP9A 2AZ1A 4YB7A 4M5MA 1TK0A 1JLBA 1VQ8S 4C8YA 3MF5A 4R25A 1SJ1A 3RZAA 3QRQA 5KG2A 2AIRB 3DNCA 1H6KX 4MYTA 1KLNA 2LMIA 3SYZA 2F8MA 4PR6A 1CSJA 2EKNA 1SC1B 1CS4B 1H98A 1EQ0A 5KFUA 2DR7A 4NOHA 1C2PA 4EBEA 2UUTA 3N28A 1ZZNA 2H3EB 1HMVB 4Q7AA 4WFAQ 2GO9A 1U2RA 3DLEA 4TY8B 1R8CA 2IHR1 3THVA 2MTLA 4H4MB 1M1KT 4P74A 4P10A 1UFKA 2CQ4A 3I87A 2BRKA 4G1IA 3VHQA 2HWIA 3H2UB 3FGVA 2V2VA 2XWXA 1NK4A 2C3UA 1HYSA 1MN9A 2HQDA 2H4YB 2XYHB 4WPAA 4DSEA 1RU2A 3NGKA 2CG4A 3R5GA 3FRZA 4KH0B 2J9DA 2ATCB 4X62J 2C2ZB 2IVMA 1B7FA 4C3LA 3OTDA 2WONB 1NK7A 4NLGA 2QYCA 3R3TA 1VQPS 2VONA 2W25A 2P6TA 5KFCA 4CT9A 1NPRA 2C3PA 3U1MA 5KFMA 3ZTOA 2A6OA 1H0HB 2MQQA 1S72S 2IC3B 3PX6A 4N77A 1WC3A 4FP9A 2DTJA 3TI0A 1VQSA 4M94A 3CE8A 1TKTB 4PXBA 2DHGA 1BQXA 4OI3A 3V6DB 3OVBA 1HNVA 3MPUB 3OW2R 1I3OB 1RT7B 2RB7A 1R3NA 4O3OA 2HQFA 2KB2A 4KHPF 2V9KA 1AA1B 1QAYA 5IWAF 4RUCA 3J7AN 1SIZA 3IRXA 3MOJB 4M5GA 4PG5A 2KO1A 3TJAA 5IQQA 1J5EJ 3JAMY 2MKJA 1B0TA 4I2QA 3FZ2A 3H7HB 1NDCA 1EP4A 5HP1A 3SQGA 3K59A 1RBAA 3A8IA 4DSKA 2RUGA 2RU9A 8AT1B 3MM5A 3H5SA 2VJVA 1U1NA 2UXBF 1NB2A 3IXQA 1RA6A 2CWKA 1ZM9A 5B7WA 2UUAF 5I3UB 3B4DA 1FRHA 1K0TA 3DHWC 1IM6A 2VPYB 2E9TA 3PW7A 5FD1A 4ECZA 4DR2F 2MB0B 2HS4A 1VHFA 1NB7A 1OY8A 4CWBA 2HVEA 1TUVA 5ADZA 1HARA 5KFJA 3LPYA 5F41A 2YXLA 1WC5A 2J7KA 5LXYA 1DFDA 3DHXA 4UW2A 4QWCA 2VQEF 1QAIA 1X8DA 4OZ3A 2FIUA 1IBLF 2VASA 2BJ7A 2G0JA 3OV7A 1WHYA 2VH7A 4FKXA 4M5IA 4NLTA 4QPTA 3CB4A 5GMKa 2KFNA 1V3ZA 4UZCA 1K9MT 1TFWA 5DS7A 4A47A 4C7QA 1HQ2A 3CJQA 1KHWA 2YNGB 4EYIB 1N8RT 2DITA 2DNGA 2OHDA 4O23A 1WI6A 1CULB 2YWFA 4DQQA 2KRRA 3GFHA 1BQMA 3E01A 2MGZA 3SDEA 4NRUA 3MEGB 2BOPA 2HAFA 1VJQA 4KO0B 1E6VB 4KB7A 2V34A 1C4AA 2MQNA 1IQTA 2CPJA 3EGVA 3MTJA 1MWZA 2J0XA 4MTPA 4I4BA 3DRPA 2DNMA 2VBZA 5FIIA 1C0TB 4ZHRA 3T5JA 1HW9A 3NBPA 3D6TB 1R8AA 2OIHA 3FDSA 3L09A 2MKSA 3G6ES 3Q8SB 5KFWA 1Y00A 4WWSA 4RUBA 1U45A 2ABYA 4TU9A 4ECWA 5LT5A 3OXGA 1BE4A 5A8KB 3PR5B 3NLCA 3RR8A 3R8YA 1BHNA 1RSCA 4OYIA 3A8KA 5E3PA 4IG3A 1ACMB 5B0BA 1FFSB 3TVZA 3PZPA 2D41A 4CO5A 1HWJA 4WP9A 3IC1A 3TEGA 5CABA 4DFMA 4N56A 4JI0F 1D9AA 3TYTA 5HJYA 2HK3A 4F3OA 2R8HA 4AQYJ 3CD6S 2ZHAA 5I3PA 1FVQA 1CVJA 2CJKA 3LANA 1C1BA 4UUWA 3WBZA 3ZTRA 5C42B 2Z30B 3C16B 1N6QA 2KVQE 3QQCD 1R8HA 1S9GB 2FLPA 3UW1A 3UN2A 2QN6B 1HNXF 2WTFA 5BYRA 2GO8A 2BKNA 2J0SD 3I4HX 2ZM6F 3H98A 3THPA 3KLIB 3C8YA 4V1Ak 3T41A 4DFKA 2M8HA 3CXCR 3W62A 3QGPA 2W1BA 1FESA 5HBMB 1JLGA 4I7FB 3CIMA 2V0NA 2EI5A 2J0WA 2N4CA 2ZH6A 4JI7J 4RWXA 1TVRB 4X64F 4ED5A 3N79A 4O3PA 7FD1A 4F2RA 2GAGC 2RD5C 3G87A 1Y0HA 3LH2S 1SJQA 3I56S 3C6TB 4O4GA 3CJ3A 1RHKB 4C11B 2XGQA 3TUJC 3TO8A 4JB8B 4ZKAA 1GQEA 2GIRA 1G7CB 3VAIA 1VFJA 2HRYA 2UXDJ 3JTOA 2JC1A 1EIYB 4OHXA 3G4SS 4CLFA 2CPXA 2AJ0A 4Z7CA 5K8PA 4WIQA 2F1FA 1RT6A 2F3JA 4MKVA 2E1PA 4ZVOB 4QPXA 1VQ9S 2YQ0A 3FC9A 4WYWA 3I32A 2WVCA 1Y4ZB 1CC8A 3CJ8A 1RHUB 1NKBA 3OPKA 4KJIA 2LKZA 2XSFA 2FY1A 3GE9A 4ZLNA 1WEZA 3QT8A 5E3AA 3VAJA 4P7TA 3G6XA 4ZPTR 3IG1B 4LF4F 2ZZNA 2H5IB 5CH7B 1LWCA 3CMES 3NGUA 2EK1A 2OKQA 2GJ2A 3K5OA 4OYBA 1W2IA 1JQGA 5ETPA 4RO0A 3N4WA 1HWKA 1DQ9A 3AB4B 2HLTA 1V3SA 1VCTA 1BWVA 3OL7A 4C6AA 3MM7B 4M5NA 2AX1A 2N4DA 4EGLA 1VC6A 1L3KA 5L39A 5L1LA 3QMQA 4XPEA 5AJ3F 2FJVA 5L1IA 1RADB 1DLOB 4EYHB 2MHNA 3KLHA 2VL1A 2KZZA 1Z1ZA 4XAKA 2GV1A 3J81U 4JI6F 2FHMA 2HEKA 3WDOA 3KLGA 3ISZA 5EDWA 1HI0P 3DMJB 2GS8A 2V2ZA 2O1PA 2MKKA 1LQ9A 3RTVA 3QSYB 3JSRA 1IJEB 3RW6A 1DTTA 2ZE2A 3DFEA 1ZH5A 3KLEB 5F8JA 2MY8A 5C24A 2XI2A 3D54A 3HKZD 2JOQA 1QVGR 3Q8PB 3DGPA 5D8HB 2QA2A 4DZ6A 2HHUA 1WKLA 4PXEA 2NYHA 3HHLB 2FLOA 1F3VA 5F0UA 3NEKA 3W9JA 4ZS6A 4K7QA 4QR1A 3CCLS 2HHHJ 4ED1A 2E5IA 1U2FA 3PKYA 1KLMA 4OJHA 4WE1A 4LSZB 1G2EA 1TKXA 1HI1A 2V9WA 4TVAB 2ZH2A 5KT4A 2J76E 4X4SA 4PPZA 4PQUA 1S59A 4X4QA 1U24A 2QRRA 2LQ9A 5I42B 2W9CB 3EJMA 1ELOA 1XTZA 3VV2B 2KZMA 1C4CA 3CJ0A 2VFRA 2WW8A 2XI3A 1R89A 3UE2A 3NCQA 4DJBA 2BJDA 3CCJS 2WVFA 3EM1A 4DCOB 1C0UA 2V8DA 2RAQA 3AA8A 3HMJG 2RJZA 2HBRB 2J9DE 2W4CA 1E6YB 3MMBB 4L3NA 2R7WA 3QRPA 4ECTA 2Q3PA 2YNFA 2LLZA 1T02A 4WFXA 4OX8A 4UZBA 1QAXA 2WOMA 2MQLA 4RW7A 3F0NA 4K2JA 2ZOFA 3I96A 5BXIA 3TVKA 4LF9J 3VGUA 2LEBA 5KFVA 4O3SA 3NS7B 1H73A 3R5JB 2NS1B 2N3OA 4YB5A 3VGVA 2JEGA 1XQIA 4RR5A 2DGUA 2POKA 2B4PA 4JI4F 1Y5LB 2HFUA 3BGRB 3GYNA 2AU0A 1JJ2R 1L3VA 4LSLB 1XC9A 2FVSA
chains in the Genus database with same CATH topology
2JNJA 3DGPB 3DOMB 1YDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNJ A;  3DGP B;  3DOM B;  1YDL A; 
#chains in the Genus database with same CATH topology
 3BKU A;  2FZG B;  3SCJ E;  1KP6 A;  5AE3 A;  5HJX A;  2DXE A;  1T9U A;  4LFC J;  5KT6 A;  2G0I A;  2HIY A;  3QYY A;  1XER A;  3L7P A;  5AXN A;  1U26 A;  1UJ4 A;  2HS3 A;  2X1A A;  2GQC A;  4RW4 B;  3CDU A;  2ILZ A;  3WX8 A;  4N47 A;  2XY7 A;  4U9R A;  3POT A;  4J9M A;  4DR5 F;  4RPF A;  3TQE A;  2GIF A;  3AXM A;  2I0X A;  2OEK A;  2NRE A;  4PYA A;  3SCL E;  2ZBQ A;  2YPY A;  2IY5 B;  4ZVR B;  2IBO A;  1SH3 A;  2E5L J;  4DPT A;  2HQ3 A;  2VJU A;  3Q8Q B;  3J7A 1;  4O3Q A;  3F44 A;  4J37 A;  4DDF A;  1F0X A;  4W92 B;  4TQS A;  2RDD A;  2GFF A;  4DV4 F;  4K8R A;  4FPI A;  3F41 A;  1DBD A;  1SKS A;  4K5R A;  2FJD B;  4AUK A;  2MPU A;  3BPS P;  1RE1 B;  3PIO Q;  3JQJ A;  2E1M C;  2ZBC A;  3T1A A;  1N88 A;  1A7G E;  2YX7 A;  3K7R A;  3JS9 A;  4JV2 A;  4M5H A;  4D3G A;  2I1R A;  4DG1 B;  3UFC X;  1T9T A;  2DHA A;  3N6L A;  4DBQ A;  2YQ3 A;  3H20 A;  2BJ8 A;  3MWB A;  4EWT A;  1YIJ S;  5DLF A;  4WU2 A;  2V50 A;  1X4F A;  3Q24 A;  5KFK A;  4FYW B;  1D8Y A;  1HWU A;  3HM9 A;  3CTR A;  3CUL A;  1W2B R;  1T0T V;  3KHG A;  4DR3 J;  4I2P B;  1YRU A;  5MLC V;  2W24 A;  4X4P A;  4QWE A;  5KFF A;  1RYR A;  1KVJ A;  4RL1 A;  1ZS6 A;  3FBC A;  4RLE A;  2GC8 A;  4KPY A;  4ZLJ A;  4KHR A;  1PC5 A;  4TY9 A;  2AEJ A;  4PAB A;  4WFY A;  5GAH U;  2O3D A;  5JUM A;  1CS4 A;  3M8W A;  1M0S A;  2XZT B;  2DNL A;  1H2V Z;  3A8E A;  1VQL S;  1HR0 F;  4TYB A;  5EGY A;  2EFV A;  2MLY A;  4H4M A;  1U6B A;  1PC4 A;  2EFO A;  2JEF A;  5GMD A;  2AWZ A;  5D3G A;  2OEJ A;  1IKX B;  2DGX A;  1U25 A;  3QZ8 A;  2ERR A;  1N56 A;  4AE5 A;  5J2P B;  1QJH A;  2PC6 A;  3C15 A;  3EZ5 A;  4DL6 A;  3S7R A;  4CZC A;  4B9M A;  4ZCK A;  2CZ9 A;  4OQJ A;  3UDL A;  4DV0 J;  2BQU A;  3CCV S;  3IGV A;  2RIJ A;  4OI2 A;  3BBF A;  2WON A;  2W2N P;  3TJ8 A;  1B99 A;  2YWK A;  3EZO A;  1IBM F;  2OML A;  1RGV A;  1IXK A;  5ETR A;  1Q95 G;  4HI2 A;  3P8B B;  3DC2 A;  1MRO B;  5E5N A;  3HVW A;  3LUY A;  2IC3 A;  1NHK L;  4CLT A;  3HT0 A;  1P9Y A;  2DY1 A;  4DV5 F;  4QR0 A;  1JLA A;  4V19 X;  2D3Z A;  4MKB A;  2AD9 A;  1TKT A;  2FQQ B;  4NYP A;  4B9L A;  4EZ9 A;  1JKH B;  3G8Q A;  2GNK A;  2ASJ A;  1IKW B;  1AFJ A;  5M2P A;  1N5Q A;  1Q5V A;  3V6D A;  8RUC A;  4JI1 J;  5F9L A;  4CLY A;  4JYA J;  4NL5 A;  2N3L A;  4FF3 A;  1IKY B;  3DGV A;  5ETL A;  1RT4 A;  2LEA A;  2Z2Y B;  1YLX A;  2YWG A;  4LF1 A;  1SCJ B;  1AZS B;  2IYG A;  2XCA A;  3EGN A;  1LFW A;  4KKO B;  1VBZ A;  3PCO B;  2ILY A;  1Y9O A;  2Z56 B;  3FEY B;  2VV5 A;  3RUB L;  2MLZ A;  2D1C A;  1S1X A;  2HNZ B;  3WX4 A;  4ECU A;  1LW0 A;  1S6Q A;  2IRU A;  5E33 A;  4WBF A;  2CRL A;  2QX0 A;  4DQS A;  1RWU A;  2RKI A;  2FHO B;  5KTQ A;  1T05 B;  3GIJ A;  3KUE A;  2ZDO A;  4J9P A;  5I3U A;  2Y0B B;  4H4K C;  2KVI A;  1OPZ A;  1R7I A;  3JAM U;  5GAG I;  1ZOT A;  3I0S B;  1ZAX A;  4ZP6 A;  1ZA2 B;  3NGS A;  4IFV B;  2VBW A;  2GVD A;  1T94 A;  2ZKU A;  1SL1 A;  3LP0 A;  1CBK A;  1T03 A;  3R7B B;  4ZCI A;  1HNI B;  1RTI B;  2E66 A;  2KXN B;  4ZP7 A;  1VQ4 S;  1F5A A;  1NLK L;  1X5P A;  2DYA A;  5IC4 B;  1VHI A;  4A46 A;  3ZZ0 A;  1GX5 A;  2ZBR A;  3P96 A;  2IM1 A;  1S10 A;  1Q16 B;  3BYR A;  1N48 A;  5ETN A;  1B0V A;  2HK2 A;  4F4X A;  3DLG A;  4B9N A;  4NAS A;  4OLP A;  1G3O A;  4WTY A;  3HF5 A;  2CUY A;  2VC0 A;  2YKA A;  3B82 A;  4AD6 A;  1FVS A;  3KJQ B;  1X9M A;  2ATL A;  2QMX A;  1YDL A;  2D3U A;  3G96 A;  1YZ7 A;  1M1G A;  1K1S A;  3ZXW A;  1T9V A;  2CQG A;  1LW2 B;  5DQH A;  3J7Z 5;  1YRX A;  1CUL A;  3BRE A;  2V8G A;  2DR8 A;  5H9E K;  3D28 A;  4CO2 A;  1UEV A;  1YRT A;  2XYG B;  2R2R A;  3K58 A;  5LJ5 Y;  2VUG A;  3QPI A;  5CA5 A;  1U8S A;  3NY0 A;  3EXY A;  2NXU A;  1JMT A;  4Y2C A;  2KG0 A;  1RT2 B;  4CNY A;  1HNW J;  1YBU A;  2B9X A;  1K0V A;  3W9I A;  5AXL A;  2NYI A;  3PRD A;  2N7Y A;  4DV6 F;  5L9X A;  2NXJ A;  3JXO A;  1C0T A;  4AL5 A;  4DCJ B;  3D0H E;  4X4V A;  1NRK A;  1LK7 A;  2QSW A;  1KON A;  1WC4 A;  5D78 A;  2Z8Q A;  1CC7 A;  3VQS A;  2KYX A;  4ZIT A;  3NCP A;  3MUV P;  4DOZ A;  3W65 A;  3HT3 A;  4GC6 A;  3K17 A;  4DL0 C;  4G1P A;  2ZJR Q;  4QQB A;  2H4W B;  3BSO A;  1X4E A;  5BJR A;  3BKT A;  5E0O A;  3MPY A;  4CCH A;  4TXS A;  2ZH1 A;  4GC7 A;  1SUQ A;  1Y5N B;  2UUW A;  4U67 Q;  4CO3 A;  5DG8 A;  2RH3 A;  1T95 A;  2R7S A;  2AEF A;  1NPK A;  4CM0 A;  4F4W A;  4L73 A;  1MG7 A;  1S97 A;  1NXI A;  4RW9 B;  3TUP A;  1OPI A;  4Q0B B;  4PQA A;  4ZPW R;  1FK9 B;  1K44 A;  1SKR A;  3TOQ A;  3LF0 A;  5E41 A;  3NL0 A;  3HHL C;  2X51 A;  5C42 A;  3C16 A;  4LFB J;  1SC4 B;  4J91 A;  3SV3 A;  5IQ6 A;  3SQO P;  1PO6 A;  1WJ9 A;  4IOB A;  5A8R A;  2HGM A;  1CJK B;  4KFB A;  4L3K A;  4J9N A;  3ZZR A;  3EWG A;  2DGS A;  2GMH A;  2OPS B;  3DU5 A;  4B3S F;  5ETO A;  5J2M B;  4TQR A;  1NH8 A;  3MEE B;  4DHV A;  2IM2 A;  2QSF A;  3BB5 A;  2A10 A;  4RNO A;  5ETT A;  3TAM A;  1HI8 A;  1ICE B;  5HBM A;  2DB1 A;  3GV8 B;  3UD3 P;  1KTQ A;  3M8Q A;  1TVR A;  4JI2 F;  2WSF C;  1RT5 B;  5H9F J;  2VFV A;  1MLA A;  4FKY A;  3GFX A;  2BOA A;  2Q79 A;  3FCH A;  3NP5 A;  4C97 A;  3OXL A;  2Z2Z A;  1RWP B;  2IIH A;  1VI7 A;  2HGL A;  2LP4 A;  2WVD A;  4B17 A;  3M8Z A;  3LAM A;  3FBB A;  3GFY A;  1FRK A;  1HQU A;  1KQK A;  2NR0 A;  1JXV A;  3EPI A;  3C46 A;  3PFE A;  1D9D A;  1TR0 A;  2ZZM A;  4G6V B;  3H40 A;  4DPY A;  4J90 A;  4YR3 A;  1S1T B;  5DDR C;  4AL7 A;  3ILI A;  3BQ0 A;  5D0H A;  2ADB A;  2HWH A;  2D9P A;  3IWX A;  2DO0 A;  1SL0 A;  2KM8 B;  2OPR B;  3CUN A;  4CNZ A;  1XJW B;  3ZZZ A;  1R6V A;  2V6A A;  3D6M B;  5HO4 A;  4CQ1 A;  2XB2 D;  1DY3 A;  4R8U A;  2NPI A;  2GGP B;  3CDE A;  1OJ4 A;  3IG1 A;  3O8W A;  2UUC F;  1EKR A;  4A48 A;  3A3N B;  8ATC B;  3MD1 A;  5HMX A;  3ET6 B;  2X7I A;  4Z37 A;  2XMK A;  1Q82 T;  4WF9 Q;  4F0K A;  4QYZ J;  3FFI B;  1WKJ A;  2ZZT A;  1RKJ A;  1SBR A;  5KG1 A;  3SFG A;  1X5O A;  4M5D B;  1I6J A;  1FKA F;  7FDR A;  2UU9 F;  1Q7L B;  2CIM A;  1WI8 A;  3ZO7 A;  2ZVS A;  3HFK A;  4CLL A;  5DG9 A;  2EFP A;  1N5V A;  4DX7 A;  4KHP J;  4QYZ K;  1F3F A;  2EKY A;  2W7O A;  5IWA J;  4BC7 A;  2Y8Y A;  3HHL D;  3M8Y A;  3LGH A;  9RUB A;  3PW2 A;  2C2N A;  2PEH A;  5EX0 A;  3IO1 A;  2Q66 A;  3I9V 9;  3MEC B;  3E3X A;  1UWB A;  3T5H A;  3FQL A;  3DMJ A;  1P9Q C;  1R8P A;  3M9M B;  1HBN A;  3AT1 B;  4OYA A;  2ASD A;  3E51 A;  3KLE A;  1BXN A;  2C1E B;  2UXB J;  3IM8 A;  2ZJP Q;  4WZM A;  1FKP B;  4EEY A;  2UUA J;  5IOL A;  4OYO A;  2R2U A;  1SJF A;  4UY8 T;  4CH1 A;  1BUX A;  1U02 A;  3HHL A;  1K47 A;  1FER A;  3RG6 A;  4DR2 J;  2LA4 A;  4CDI A;  2RRN A;  2VG7 A;  2B56 A;  2DH7 A;  2AGO A;  3OTO F;  3G82 A;  4CP5 A;  3RBD A;  2COL A;  1JLQ B;  3ILJ A;  2G2Y A;  2ZH8 A;  5KFI A;  1PYT A;  2B5J A;  1JJC B;  1W25 A;  3TWZ A;  3MM9 B;  4LBH A;  3AD8 C;  1JWW A;  1Q4R A;  4JP8 A;  2O67 A;  2VQE J;  2QLX A;  1VIS A;  2ZNY A;  2DK2 A;  4CYU A;  1IBL J;  1P6T A;  3OSN A;  3RBE A;  2MJU A;  2IM0 A;  2FPH X;  5I42 A;  3EYZ A;  2MJN A;  4ANC A;  2VD3 A;  2G4B A;  3TA0 A;  1DJ0 A;  3TUZ C;  1E6Y A;  2ZC3 A;  1FCA A;  4LR8 A;  4HDG A;  5F8L A;  4I56 A;  1PG5 B;  2XMU A;  1NU4 A;  4EFA C;  1U1L A;  4WKR A;  3D9B A;  4ZJQ A;  4WK1 A;  5FLX Y;  3T5K A;  4GKK F;  4OV6 A;  2H54 B;  2CPZ A;  3IS9 B;  1GXT A;  1QD1 A;  2QIF A;  4N7T A;  1V6H A;  1MU2 B;  1B64 A;  5KG4 A;  3MM6 B;  4C9D A;  5DLG A;  3CDA A;  2QA4 S;  4LSL A;  4B9V A;  1D09 B;  2HVI A;  3JSY A;  2KFY A;  1KFS A;  4P7V A;  4NLV A;  3PYE A;  4O44 B;  2V2K A;  3TW0 A;  4H4O B;  4TLR A;  3M6U A;  5B08 A;  2CPF A;  2YQ1 A;  2HG4 A;  3I0R B;  2F63 A;  4AL6 A;  4RW4 A;  2V5H G;  1KRP A;  2MY7 A;  1MMN A;  2ZD1 A;  4JI8 F;  1M5H A;  3OTC A;  3UN5 A;  2CJY B;  3OUY B;  1G6B A;  2QMW A;  5KFY A;  1IR1 A;  2IYI A;  1OQ3 A;  3V4I B;  3BF4 A;  3AXK A;  2PA8 D;  1VK3 A;  5HL7 Q;  3PX0 A;  2LU2 A;  4G1Q B;  2UXC F;  4RWW A;  2R7R A;  5IFM A;  1V5I B;  1F5B A;  4JI0 J;  2DGO A;  3DDK A;  4A8O A;  2KL8 A;  2BR0 A;  3RB6 A;  4LF5 F;  2J7U A;  5ITH A;  4C2M A;  2I5J B;  2VDI A;  3PW5 A;  1DUR A;  1F1B B;  1VQO S;  3AAW B;  3HPO A;  1TTH B;  1X5T A;  2BUN A;  2LFV A;  4J9U E;  1F6T A;  4FXW A;  5EWG A;  4IQM A;  3H5Y A;  1MN7 A;  4U8Y A;  4U7U K;  2VOP A;  4EU0 A;  1JK9 B;  2XQC A;  4GO7 X;  2DT9 A;  4ITS A;  3ZZT A;  2OEL A;  1XNQ F;  1HNX J;  4K5S A;  3TZY A;  3MR6 A;  3LTO A;  2B9Y A;  2ZM6 J;  3PYG A;  4N5S A;  1EB0 A;  5CZX A;  5KFP A;  1KR4 A;  3ZZO A;  2CJB A;  4NCG A;  4RBV A;  2FGO A;  5DET A;  2KFZ A;  4C0H A;  4RNN A;  4Y0F A;  3CMQ A;  3P49 B;  5LSR A;  5IM0 A;  1RHR B;  3M2R A;  4F25 A;  3BO4 A;  4MK7 A;  2CQ1 A;  4X64 J;  2K3I A;  4PWU A;  2V4Q A;  3K8V A;  5HMW A;  3MD3 A;  4KGZ B;  3MOZ A;  2YX1 A;  3IP0 A;  5B0G A;  5ETS A;  1UCN A;  2DGW A;  1M5S A;  3A4T A;  1S0O A;  2W01 A;  1V3R A;  4DL3 A;  2QLW A;  2JLG A;  2JLF A;  4A4J A;  2YNH A;  2HQC A;  1X4H A;  3VAH A;  2K1R B;  1D1U A;  1Q78 A;  2QYG A;  1NND A;  1F5C A;  4DR1 F;  3QFH A;  4WXO A;  1WDD A;  2QLF B;  4QU7 A;  2CZ4 A;  2WW4 A;  2GJF A;  2HVZ A;  3ITH B;  1N32 F;  3N6M A;  4NMX A;  1MW7 A;  1S4E A;  3I5B A;  4NWB A;  4IKA A;  3GTY X;  1DAX A;  5CXT A;  1VRU B;  1R0A B;  2HQI A;  1HD1 A;  2FZC B;  2P6S A;  5J2P A;  2W2P P;  2MLX A;  2QZ8 A;  3CD5 A;  3TX0 A;  1L3U A;  3TP2 A;  4MFB B;  4LF4 J;  1PBA A;  3CO0 P;  1U47 A;  1HBU A;  5THW A;  1T11 A;  3N6N A;  3T6B A;  3NG8 A;  2F4F A;  4ZP8 A;  3MMC B;  3GJR B;  1NAQ A;  4NCB A;  1RWX B;  5C25 B;  3O1L A;  2HND B;  2DNY A;  4EUV A;  1RWM B;  3JTN A;  5J2N A;  1REV A;  3L95 X;  2P5V A;  2CQ3 A;  1U49 A;  1U6Z A;  4BWJ A;  1ZM2 A;  1WG1 A;  4BCA A;  1N5Y B;  5A0Y A;  5D4P A;  2HLU A;  1QE1 B;  1EET B;  2OEM A;  5LMU F;  3RYL A;  5EX3 A;  4OZ0 A;  3KJV A;  3OVA A;  3FRY A;  4YDX A;  1IKW A;  2RF2 B;  3KJN B;  2BW2 A;  3ENQ A;  4KH1 B;  3PO4 A;  5AJ3 J;  2LQ5 A;  2XHW A;  2B9W A;  3TAQ A;  4TLQ A;  1MMD A;  3HVA A;  1RDR A;  1OO0 B;  1IKY A;  2Z2L A;  2RVJ A;  5M2R A;  2CQ0 A;  4UOF A;  2YKN A;  4JI6 J;  1PJ5 A;  3HHK A;  3LA0 A;  4P2F A;  1GMU A;  3PV8 A;  1IWA A;  1R6Y A;  4YS2 A;  1S6O A;  1Q79 A;  2HS0 A;  4J9K A;  3CMA S;  4A8S A;  2B43 A;  3U7J A;  3QLH A;  4PUO B;  2LCW A;  2HNZ A;  3W8P A;  2EG1 A;  4OI6 A;  5HRO B;  4DS4 A;  1UET A;  3P4U B;  2EFN A;  2PI4 A;  1T05 A;  4FYV B;  3OR2 A;  3UNY A;  2DGQ A;  2QL9 B;  4KQZ A;  4OHY A;  4IFV A;  4WXW A;  1F2H A;  4ZVT B;  2M0G B;  3GYG A;  2N7C A;  2PDA A;  1H3D A;  5LM7 E;  1O8B A;  1YK9 A;  1ARO P;  1GMV A;  2OH2 A;  3FMW A;  2V68 A;  1RI7 A;  1X31 C;  4ECR A;  4KHM A;  2QL7 B;  4DPW A;  2GVZ A;  4DSL A;  4I1T A;  1VRT B;  4CLW A;  1EZZ B;  4C8Z A;  1S9E B;  1Y11 A;  3PY8 A;  4I6A A;  3GIK A;  3NNH A;  3GIL A;  1RTJ A;  4KGX B;  1HPZ B;  4K2X A;  3V6K A;  2EWH A;  1XNR F;  2XZD B;  2KM8 C;  1GMW D;  2BM0 A;  5J1E B;  2MQP A;  2XO6 A;  1WUU A;  3Q86 A;  1VQ7 S;  3AJ1 A;  4HHU A;  1LW2 A;  2YNI A;  4Y2K A;  4HDH A;  3W7B A;  1VRQ C;  4F7V A;  1SB6 A;  1NH7 A;  1U1M A;  4I69 A;  4JI4 J;  4EI2 A;  2HRT A;  4Q8E A;  4DX6 A;  4J9R A;  4Q2L A;  4OYP A;  3MR7 A;  1Q8B A;  2W9B A;  3CC2 S;  2DKO B;  3B4M A;  3GB0 A;  2R8K A;  1UVN A;  2UP1 A;  5J1P A;  1UJ5 A;  1GMW A;  2ZOM A;  2Q1L A;  1SV5 B;  2VIH A;  3ENA A;  3RB4 A;  3GSI A;  4F0M A;  1JLF B;  5KFB A;  2QA4 G;  5AE1 A;  1X4A A;  4Z7Y A;  1RJJ A;  3QFW A;  3J7Y U;  3MGJ A;  3T19 A;  5EUH A;  4ZVG A;  1UL3 A;  4DR5 J;  5KFN A;  3R2D J;  2JFK A;  3CJK B;  3AOD A;  4F67 A;  1P1L A;  3UVJ B;  3HD2 A;  4LT6 A;  1Y5I B;  2QEX S;  3ZZY A;  5L1K A;  2P9G A;  2BRL A;  3B54 A;  4AXJ A;  1D3W A;  1Q5Y A;  2QV6 A;  5DO2 A;  3JSB A;  3V81 B;  1FNX H;  3A1Y G;  4KBI A;  4ZDN A;  3LP1 B;  2IM3 A;  4WFN Q;  1URR A;  1I51 B;  2ZNZ A;  2KG1 A;  4DV4 J;  3D6F B;  3IM9 A;  2OMO A;  3D4J A;  2OPQ B;  2CPY A;  2YKM B;  1YSJ A;  4DSF A;  1PCA A;  2UVU A;  4Q0B A;  4LBI A;  1OY9 A;  2R7Q A;  1RU1 A;  1X5S A;  4X66 F;  4RX6 A;  1RAJ A;  5A8W A;  2FJX A;  1N54 B;  3DM2 A;  2BZ2 A;  5K14 B;  2VIC A;  2HUR A;  1CJK A;  3KMS A;  5EHH A;  1AT1 B;  3QGH A;  2OPS A;  1IBK F;  2M70 A;  3OLB A;  2WVE A;  1DAR A;  2PFD A;  4R5P A;  3IR6 B;  2ROE A;  3VVU A;  4AYB D;  4UOH A;  2FHK A;  1ZYQ A;  2I6W A;  1TL5 A;  1R0C B;  3T5L A;  2JH3 A;  4LRC A;  4B08 A;  3KHH A;  2DRD A;  1FEE A;  4FN5 A;  4LRA A;  3ZNJ 1;  4DV7 F;  2F4V F;  1RT5 A;  1TL3 A;  2A2C A;  2WBM A;  3W61 A;  4IFY B;  2J0Q D;  1PKU A;  2Z4P A;  4LF8 F;  2K06 A;  3O6Q A;  1RTD B;  3W5Y A;  2OPP B;  4EZ6 A;  4OL8 A;  4AXI A;  2DJW A;  3JQM A;  1WHW A;  1HR0 J;  1WDT A;  2FJW A;  2X1B A;  2DGT A;  2DNR A;  3TZX A;  5IZH A;  2A2D A;  3CCE S;  5AE2 A;  3MCS A;  1S1T A;  2U2F A;  3CJ2 A;  4K4W A;  4K4V A;  2UVR A;  3BGF A;  2XEX A;  3I55 S;  1NK9 A;  2OPR A;  2XLJ A;  4QIE A;  2J9C A;  3RW7 A;  1RT3 B;  4HAC A;  5ETK A;  3UR3 C;  4MK8 A;  2HNY B;  5KFL A;  1X9S A;  2ZUA A;  2LDY A;  3FSI A;  4LMZ A;  5DQG A;  1FJC A;  1WTB A;  4F50 A;  1RBL A;  1IBM J;  4YME A;  5AXK A;  2H1Y A;  1WOO A;  3ET6 A;  1U0S A;  2C2E A;  3OD2 A;  3AY0 A;  3G71 S;  2R7T A;  4DV5 J;  3GLJ A;  4LBP A;  4A8Y A;  4B3O B;  3AJ2 A;  2IPO B;  2DHS A;  2IAJ B;  2KJV A;  3FFI A;  3IR7 B;  5CYM A;  4NYZ A;  2BE2 B;  4ANE A;  4M5D A;  2OO4 A;  3S01 A;  5KAK A;  4OFZ A;  2OSR A;  3C14 B;  4YB6 A;  1X7V A;  2CQI A;  2CG8 A;  2GHP A;  2K2P A;  2IMO A;  2XMT A;  3JQK A;  2J8S A;  1ZET A;  3BV8 A;  4PZV A;  4LF6 F;  1SJ3 P;  3A12 A;  4LSN B;  3FEX B;  3OFF A;  4L6V 3;  3L3C A;  5CYQ A;  2WB1 D;  3LP2 B;  3CF5 Q;  4IH7 A;  3KG1 A;  3QIP B;  4NCA A;  4ECQ A;  4UF4 A;  1C1C A;  1URN A;  2V8V A;  2BQR A;  1W26 A;  2OJ3 A;  5A2Q U;  3OLA A;  2GJI A;  5KFQ A;  1RHQ B;  3CC4 S;  3MED A;  4KTQ A;  2B9E A;  4B3R F;  2EC0 A;  4JV0 A;  4RNF A;  4QIV A;  2E29 A;  1NJX A;  3KK2 B;  4WFZ A;  3T6J A;  3N5F A;  3OL8 A;  3SSR A;  5B0D A;  4WZQ A;  3P3D A;  1UW9 A;  3HVT B;  1WHV A;  2VA2 A;  3FJ2 A;  1FFW B;  5D77 A;  2WVB A;  2HFZ A;  3TNV A;  1HWL A;  4C48 A;  1F9H A;  1JLC B;  3IWN C;  4GVB B;  4Y00 A;  3Q8V A;  3GZ7 A;  3DOL A;  5KFS A;  1HBM A;  4J9Q A;  3EGZ A;  1FD2 A;  4MT1 A;  5T41 A;  1S0N A;  2BM1 A;  1Q1K A;  5KOX A;  3HX9 A;  4DV2 F;  3DLB A;  3QAU A;  2ZEJ A;  1FXD A;  4OZ2 A;  2FHJ D;  2W7A A;  5L8R C;  2HZV A;  2JX2 A;  1EAY C;  3NAH A;  3ADA C;  4USH A;  1HNV B;  4YOE A;  4NLP A;  5HVG A;  2CWX A;  2HBQ B;  2V2Q A;  1RAG B;  2FVC A;  5CCL A;  1MU2 A;  4DV1 F;  2R4F A;  3MM6 A;  3MAH A;  4DV6 J;  4EK2 A;  4KIA A;  2O5D A;  1I5O B;  1XMQ F;  4LRF A;  3IRX B;  1FJG F;  2AJF E;  1YJV A;  2NZC A;  2F9J A;  3CCU S;  3A3P B;  2JEJ A;  2GAH C;  2QFI A;  4LJM A;  5FLX U;  2NZ4 A;  4CIO A;  4RNM A;  3HHE A;  3Q8Y A;  5BR8 F;  3OXF A;  4I2Q B;  1XEZ A;  3KK3 B;  2EW9 A;  4O44 A;  2FHJ A;  4RJV A;  3W2V B;  2OTL S;  1U1K A;  3EMT A;  2BDP A;  4H4O A;  2V4R A;  2FD2 A;  1U48 A;  4C3M A;  1RXO B;  3G2X A;  1O51 A;  2Y1I A;  5HLF A;  3G6Y A;  3VAK A;  2C2O B;  2HZA A;  3K2Y A;  3I82 A;  4CI0 B;  3V4I A;  2R2T A;  4WJB A;  1GTH A;  3LO3 A;  4F3Q A;  1RWK B;  2MMY A;  4G1Q A;  3DI6 A;  4URS A;  4F3M A;  2DNO A;  1SQF A;  5CCM A;  1Q7Y T;  4FBT A;  3H5X A;  1FRX A;  4ZVS B;  2JZ5 A;  3QBC A;  2DBB A;  2ZKT A;  3AB2 B;  2I5J A;  1NK5 A;  3C6U B;  3H59 A;  2WK4 A;  2VQF F;  3P5T L;  2J7W A;  1SQG A;  2K7J A;  2OFH X;  3GG0 A;  2AYM A;  4LRE A;  3BO2 A;  2PFF B;  3T1Y F;  2B8Q A;  4ZJL A;  1FXL A;  2C3M A;  4B3S J;  4USK A;  3AHP A;  1IUJ A;  2XO7 A;  3DXB A;  4IYQ A;  4X2B A;  4CRJ A;  3PDN A;  4R0E A;  5K8O A;  3UR0 A;  1IWG A;  4DEZ A;  1WF1 A;  2YPZ A;  5L46 A;  1HHT P;  2QL5 B;  1BQM B;  2BAB A;  1LEO A;  2MGZ B;  4E2F B;  4ZK7 M;  4JI2 J;  3H4B A;  3IFE A;  3SDE B;  3KK1 A;  3OJU A;  3C2P A;  3RJM B;  3TEH B;  1JJH A;  5KOW A;  2EXU A;  2VPX B;  3HK2 A;  4FVM A;  4JV1 A;  1VBY A;  1ZZF A;  3QJP A;  2LXU A;  2BA9 A;  4ZHR B;  4DPX A;  4USJ C;  1NDL A;  2K1R A;  3NBP B;  3MMA A;  2UUB F;  2PEB A;  2YKO A;  2A3J A;  2F5G A;  2RIL A;  2UVW A;  1OY6 A;  3MR5 A;  4KV8 B;  2WHO A;  3ITH A;  1BC6 A;  2AF6 A;  1K73 T;  2FVR A;  3T3F A;  3MPD A;  2OSQ A;  2KU7 A;  3HVR A;  1S7H A;  5GME A;  3HFZ B;  1R0A A;  1LOU A;  1RUS A;  3OFE A;  2FYX A;  3K89 A;  1AW0 A;  1S57 A;  3OL9 A;  4F26 A;  5GAG U;  2YH1 A;  3H25 A;  1LXN A;  2DEI A;  1RAB B;  1OYD A;  3PR4 A;  2EBE A;  2Y3Y A;  4MFB A;  3NCR A;  1HBO B;  3VZH A;  2D9O A;  4DFP A;  2BJ1 A;  2UUC J;  3AQP A;  4C8L A;  3WIV A;  1GXU A;  3D1O A;  3MMC A;  3CIZ A;  2BV3 A;  5C25 A;  2HND A;  2RSQ A;  1NK8 A;  5JVG Q;  2CDR B;  1QSS A;  2M88 A;  3M6X A;  3QT6 A;  4NI2 B;  1NBE B;  1XR5 A;  3BM7 A;  4Y6I A;  1EQM A;  1ZPV A;  3GMG A;  1S1W B;  2E7W A;  2KH9 A;  4DX8 H;  1N5Y A;  1FE4 A;  2UU9 J;  2DIS A;  1QE1 A;  4UOC A;  1YQH A;  1HHS A;  2KHD A;  4HYK A;  1P1T A;  3J7Y I;  5HAO A;  4W90 B;  3MCN A;  5F8I A;  4USM A;  1TQL A;  1LWE B;  3QO9 B;  3DOK B;  3LAK A;  4CH0 S;  4K50 A;  4DV3 F;  3FBE A;  4P71 A;  5K20 B;  1LXJ A;  1I1G A;  1FT8 A;  2VKR A;  1ULR A;  1VS3 A;  2HHT A;  4DUZ F;  3DKD A;  2V94 A;  1FRM A;  1TK8 A;  3AQO A;  5CHC B;  4RU2 A;  4ATN A;  3Q83 A;  5IT9 U;  2RQK A;  3CW2 C;  5DDP C;  5HRO A;  4LRD A;  1RCX B;  3HHD A;  4JOU A;  3IWL A;  5HN0 A;  4NA1 A;  2G2Z A;  2VG5 B;  2ZH4 A;  4N8O A;  1RT6 B;  4CH7 A;  3S1T A;  3N01 A;  1CEZ A;  1UTA A;  3X3U A;  4RUH A;  4C8N A;  3FSY A;  4QIF A;  3VR1 A;  4LR7 A;  5KG5 A;  2XMV A;  4JV5 F;  1TKD A;  4ZMM A;  1NPP A;  1RWO B;  2IVF B;  3BN4 A;  4I6Y A;  2B7C B;  1UA0 A;  3DLK B;  5KFD A;  1IBC B;  1RT1 B;  2BAC A;  1LWC B;  2HSE B;  4OX7 A;  5U47 A;  4OHZ A;  3UDC A;  4IQX A;  4TU8 A;  2J6S A;  1LWX A;  2B7B B;  5F8M A;  3OQ2 A;  2BMB A;  2W2M P;  4ELU A;  2BE9 B;  1M90 T;  4HHH A;  5J1N A;  3M32 A;  2RRB A;  4F36 A;  1UAW A;  2M9K A;  4GKK J;  1WAC A;  1QUP A;  2HKE A;  1FDD A;  1WG5 A;  1T3O A;  3DXS X;  5C2G A;  2DIV A;  1RCO B;  5LL6 d;  3HDS A;  3R5D A;  2NUH A;  3OTB A;  4EBD A;  2JRS A;  3TA2 A;  1Z4U A;  4OJ3 A;  2WCX A;  3NKY A;  3RB3 A;  4OYX A;  1TL7 A;  4EBC A;  3PHT A;  2QMU B;  4KGM A;  3FQK A;  4KE5 A;  2YWW A;  1FDN A;  1XIQ A;  2OUG A;  2FLN A;  2KXF A;  3BR8 A;  4KYZ A;  2F8E X;  1SV5 A;  3W64 A;  3KG4 A;  3CJ4 A;  3PJ9 A;  1S0M A;  2F9D A;  3M30 B;  4Z2X A;  4I68 A;  1V9O A;  2AYE A;  1FI4 A;  4NLU A;  1LWF B;  2G2O A;  3PHE A;  1BD6 A;  2RS8 A;  1LNQ A;  3JSM B;  4WKY A;  2G0C A;  4JI8 J;  2FJE B;  3CJK A;  2K8G A;  3DGP B;  4OZ1 A;  3QT5 A;  2CAJ A;  1RAO A;  2B51 A;  2MZ1 A;  1JLE A;  4DS5 A;  3UVJ A;  1BGX T;  2NXC A;  1N36 F;  3CCR S;  1ZM3 A;  1U1O A;  3MCM A;  2Y1R I;  2DRA A;  2UXC J;  5A76 A;  2IA6 A;  1JXL A;  1ZAW A;  5LMN F;  4LF5 J;  3LP1 A;  3GPA A;  4CLK A;  4WE1 B;  2BKP A;  1TUW A;  1UKU A;  2D74 B;  4ER8 A;  4DQP A;  3Q23 A;  3NGR A;  1OS5 A;  3O5T B;  4KT0 C;  3W8G A;  3QJJ A;  2DR9 A;  1XNQ J;  1P27 B;  3DYA B;  4C0B A;  5E3R A;  4IDK A;  3AD9 C;  4A8M P;  3NS6 A;  2VDH A;  4BC9 A;  5K14 A;  2FJA B;  2M7S A;  2MZT A;  2PMZ D;  2JJ4 D;  2YNF B;  5JXS A;  3AJD A;  2BX6 A;  2V4J B;  2LXI A;  3MEK A;  1WOR A;  3Q0A A;  4RW7 B;  2V8P A;  4XK8 C;  2FZK B;  2XC9 A;  1GEH A;  1S1U A;  2ROP A;  1LK5 A;  3HJF A;  4OV1 A;  2A0F B;  4HVZ A;  4WII A;  3GV7 B;  2XTJ P;  5FJ4 A;  2B6A A;  1PGZ A;  3R7S B;  1WSR A;  3UWT A;  4DLG A;  3GU0 A;  4NEY A;  4E98 A;  1NK6 A;  2ASL A;  2AP6 A;  4A8F A;  4E8U A;  1GTE A;  1HL6 A;  3VF0 B;  1KS2 A;  4OX9 F;  3GV5 B;  3Q2S C;  5F8N A;  4IH5 A;  4UOG A;  2R8G A;  4DR1 J;  1RTD A;  3BKF A;  1H2U X;  4IH6 A;  5J2Q B;  2OPP A;  4DR7 F;  5L38 A;  2KJW A;  1D8Z A;  2KT3 A;  1N5T A;  1N32 J;  2CVE A;  2XMM A;  1TV6 A;  3M2U B;  1PSD A;  2KRB A;  2L41 A;  3NAI A;  3ONQ A;  2IJN A;  1GK8 A;  4LRB A;  4LF7 F;  1WG4 A;  3TR5 A;  3POT B;  2MXY A;  2VHG A;  1NSK L;  1KOO A;  4NLS A;  5LSL A;  3DLH A;  5G0R A;  1X60 A;  2HMI A;  4BHQ A;  4KAI A;  1HW8 A;  4U6P A;  4NZ0 A;  2OD4 A;  1M1H A;  2HNY A;  3KTQ A;  2MZJ A;  2XWY A;  3BQ2 A;  4YFU A;  3MM8 B;  4OMF G;  2IBK A;  4W98 A;  2RML A;  3QZ7 A;  3M05 A;  1IR2 A;  2LXF A;  4DQI A;  2Z57 B;  1KNZ A;  3QGG A;  3L9Z A;  4J9V A;  1J2V A;  1SVD A;  4S0M A;  3M1V B;  2KKH A;  1M5O C;  5KFG A;  5LMU J;  1BQN B;  1JNZ B;  3AFG A;  4DMZ A;  2KI2 A;  5HSP A;  3IBF B;  5KG7 A;  4Q8F A;  3ZFV A;  3ILO A;  4NA2 A;  1NEE A;  4UQG A;  1RAA B;  5DRK A;  4QWA A;  2EFG A;  2PII A;  1YJ9 S;  2D7S A;  2DVI A;  1RAE B;  1XBW A;  4JBC A;  2DPI A;  3C14 A;  4ES3 A;  2VKZ G;  3GSD A;  5HQ8 A;  1HMV A;  2XYP B;  2FC9 A;  4I64 A;  3M8R A;  2E44 A;  4TY8 A;  5F3Z A;  3O2I A;  3KLV A;  3MHY A;  1SI9 A;  5KT3 A;  3V2U C;  5IC6 B;  2MSS A;  1SKW A;  4FF1 A;  3T9N A;  4LSN A;  2PGC A;  4G3I A;  3R9L A;  3LP2 A;  2QA1 A;  4P2X A;  3D67 A;  4FPR A;  1KDN A;  4DU7 A;  3QIP A;  4YR0 A;  5EN1 A;  1AB8 A;  3GJS B;  4DUT A;  2JHE A;  3V4M A;  1TEL A;  4K59 A;  5D3G B;  1KC8 T;  3EVM A;  4L72 B;  4RBU A;  3D7S B;  2CJX B;  4M8L A;  2LA6 A;  1W7W A;  5A6W A;  4HLB A;  2N82 B;  2PI5 A;  5GAE U;  4Q44 A;  2W8K A;  1HFE L;  3C15 B;  4L74 A;  3KK2 A;  2M4M A;  2YVS A;  3KHR A;  1Z2L A;  4KY3 A;  3MFI A;  5B0E A;  2XS2 A;  4RW6 B;  4WYL A;  1KTV A;  1VIX A;  1CJT B;  4ECX A;  3IGN A;  1VK8 A;  2JLE A;  3HVT A;  3PVX A;  5KG6 A;  4PWW A;  2BQ3 A;  1ZBT A;  2EG2 A;  3JTP A;  2DEJ A;  2YKQ A;  1JLC A;  4GVB A;  3HZE A;  1XNR J;  5DZ6 A;  1JNR B;  2L9W A;  1HNZ F;  4WP3 A;  2RQ4 A;  3ICL A;  1RT7 A;  2AGP A;  3FZB A;  1CQM A;  4P2M A;  4MKY A;  2HVH A;  1PBU A;  2RT3 A;  1YJ7 A;  3DOM B;  1JLA B;  3CCS S;  1VQ5 S;  2HFO A;  4HL9 A;  3HD1 A;  4U7C A;  2MKH A;  5T14 A;  3DU6 A;  3DN9 A;  3W63 A;  3T1H F;  3MTK A;  2ZHB A;  3PW0 A;  2LQB A;  4DUY F;  1RT4 B;  3SBM A;  3CPW R;  1U1R A;  1BMQ B;  1FNO A;  4B02 A;  5GAD I;  4K0K F;  1S99 A;  3LWL A;  1TFY A;  1NK0 A;  3W2W B;  3HI9 A;  4B3M F;  3NWR A;  2FGC A;  3KK3 A;  3W2V A;  3IAM 9;  1VYA A;  4HT5 A;  1S1X B;  1PAU B;  1LW0 B;  1S6Q B;  1RTZ A;  2EVZ A;  3B6B A;  5HAT A;  5HQM A;  4Y28 C;  2AJQ A;  1YI2 S;  1N33 F;  4QZV B;  5B0A A;  2OLW A;  2RKI B;  3BJY A;  3CJS A;  3TUI C;  3SEO A;  5FDL B;  3M9O B;  2MKC A;  5D15 A;  4A8Q A;  2E5H A;  3ELH A;  4PXC A;  2CAD A;  2GVD B;  3LP0 B;  1VQN S;  1T03 B;  4FS2 A;  3N0V A;  5DDO C;  1CJU B;  3IA0 A;  1J5O B;  3AOC A;  3AOB A;  3H2L A;  2XHC A;  2MQO A;  2CQC A;  1DQ8 A;  3C6U A;  3AA9 A;  4PPD A;  4CO4 A;  1TK5 A;  2ZC4 A;  2LDI A;  1FNM A;  2YNG A;  2IRY A;  1ZTT A;  3KOA A;  4X66 J;  3R27 A;  4PG8 A;  3DLG B;  2MKI A;  2H65 B;  3ZTS A;  2VBX A;  1QY7 A;  3DCA A;  3MUR P;  3UD4 P;  2EPI A;  5C5J A;  4FVC A;  4TYA A;  4YP3 A;  2FTR A;  3MEG A;  3K5N A;  1IBK J;  1D0E A;  4KO0 A;  1E6V A;  3EX7 B;  2PN6 A;  1WF0 A;  2VC1 A;  1R43 A;  3K8W A;  3NGD A;  6FD1 A;  3R1L A;  5HMZ A;  3CC7 S;  4OYZ A;  2MZR A;  3WHI A;  4DV7 J;  3X1L B;  1TL1 B;  5DG7 A;  3M8S A;  2F4V J;  1S5Z A;  4U8V A;  4YB1 P;  1RQ0 A;  4LF8 J;  2ZVI A;  2L08 A;  1UEK A;  3BDE A;  1X4G A;  3DRS B;  5A8K A;  3PO5 A;  2WRM A;  4USW A;  3BH7 B;  1OSC A;  4YHH F;  4IO1 A;  4IOC Q;  4KR0 B;  4OHW A;  1YKW A;  4KV8 A;  3DRY A;  1SJ4 P;  4ILL A;  2ZFH A;  3MFH A;  4ZVH A;  2CNN B;  3B78 A;  3UI3 A;  3M2V B;  3K0J A;  1QSY A;  3FCW A;  4K4Y A;  2XS7 A;  4F04 B;  3LGM A;  3EDR B;  1SUQ B;  2J6U A;  1NO8 A;  3BYP A;  4NLR A;  2NUU G;  3BSA A;  2KDO A;  5AXM A;  1HBO A;  3QRR A;  1S9G A;  1CPZ A;  1TMM A;  1P8G A;  1BWE A;  1VGY A;  2C2K B;  1RWW B;  1IJF B;  3KLI A;  2H5J B;  3UDE A;  4HH0 A;  3D3C J;  4ID8 A;  2B4O A;  3WQP A;  2HPU A;  4NI2 A;  4PRF A;  2HAI A;  4I7F A;  2DNZ A;  4H4K A;  5A8R B;  3BO3 A;  1S1W A;  4KFB B;  1XR7 A;  3GQC A;  4O4R A;  2NSB A;  1AXQ A;  2Y8W A;  3J80 Y;  3RAQ A;  3KYL A;  4ALZ A;  3RBX A;  2J6T A;  2XMA A;  3C6T A;  3Q22 A;  1S0V A;  4C11 A;  4MAK A;  4FF2 A;  3NNA A;  3R5C A;  3PW4 A;  3TAM B;  1OMS A;  3SSQ A;  1Y3K A;  3HO1 A;  4P72 A;  4IG0 B;  2JNJ A;  2NSC A;  3UCU P;  1LWE A;  3QO9 A;  3M8Q B;  5H9F K;  3DOK A;  1U0H B;  4JI3 F;  2H9Z A;  3SXL A;  2DHH A;  3M8P B;  4P6Q A;  4X84 A;  4LF6 J;  4DR6 F;  4AFF A;  3ULH A;  4QOT A;  2C3Y A;  3KKF A;  2C22 A;  2AGQ A;  3CJ5 A;  4C8K A;  4DN9 A;  1UZH A;  3JYT B;  3VWS A;  2C28 A;  2CQ2 A;  3M9N B;  5KT5 A;  4ZLL A;  1KN6 A;  3H0P A;  3K57 A;  1HQU B;  4XDC A;  3FSX A;  2F8H A;  4Y2M A;  2ZJQ Q;  4B3T F;  4P75 A;  3MAA B;  3BGL A;  3UO0 A;  2M3D A;  2HHQ A;  2VG5 A;  4B3R J;  2G1D A;  4AT1 B;  3K5M A;  1H7X A;  1Z2Z A;  4LVO P;  4F4Z A;  4NXN F;  1XMB A;  2NPF A;  3RU0 A;  3PAC A;  4J5O A;  2F7V A;  1D9F A;  2IA0 A;  2DNK A;  3H4D A;  2CFX A;  2XY6 A;  2KN4 A;  1TKZ B;  1SC3 B;  4LVN P;  4MJK A;  3IRW P;  3OFH A;  4R8U B;  4X65 F;  2AT1 B;  2XBP A;  4K4T A;  2AKW B;  2BBE A;  3DLK A;  1FDA A;  5D4L A;  3R7N B;  1RT1 A;  4F02 A;  2C2M B;  4WP8 A;  3D1H A;  3K5L A;  3SMZ A;  4GKJ F;  3A13 A;  2VBY A;  4OHV A;  3PEJ A;  4QIW D;  3MM7 A;  3DLL Q;  4WFB Q;  4DV2 J;  4ILM A;  2ZBP A;  4URG A;  3CD0 A;  4BLG A;  3HJV A;  4GVL A;  4DLE A;  4U95 A;  1U1P A;  4QW9 A;  2E5G A;  1FWP A;  4DR4 F;  1DLO A;  4OYM A;  1FTC A;  5A2Q Y;  4OI1 A;  2JVO A;  4PG6 A;  2V67 A;  1V5V A;  5BYS A;  4DV1 J;  4PWD B;  5F8G A;  4K4Z A;  2KXH A;  3GCX P;  2CPD A;  3CSK A;  1XMQ J;  4F4A A;  5D0E A;  5KG0 A;  1FJG J;  3BSC A;  4YY3 F;  3QNW B;  4XPC A;  3VZI A;  4ILR A;  2XLI A;  5BR8 J;  2XMJ A;  1UWB B;  2R42 A;  4ZJO A;  2SXL A;  1UVK A;  5E2Q A;  5IV3 A;  5KFH A;  2QJ3 A;  4JI5 F;  1EX8 A;  3M30 A;  3NRB A;  5C2C A;  5F8H A;  3UDV A;  4MIW A;  3CCM S;  4PG7 A;  1LWF A;  1HBN B;  2XG8 A;  4DX5 A;  3TJ9 A;  3JSM A;  2E7X A;  3F73 A;  1O5J A;  5F9N A;  1TAQ A;  1SIW B;  2RRA A;  3C66 A;  2H51 B;  1TP7 A;  3TZZ A;  2U1A A;  1R0B G;  3HLU A;  3EVO A;  4C8M A;  1WTF A;  1L5U A;  2VG7 B;  4HKQ A;  4ECS A;  3G82 B;  4KPC A;  4OI0 A;  2W9C A;  4UY8 5;  3BPD A;  1NKC A;  2B5J B;  2PO4 A;  1IM4 A;  1FA0 A;  1DTQ B;  1SXL A;  2R7V A;  1TL4 A;  4ZCL A;  3H8Y A;  2VQF J;  3KG0 A;  2PMW A;  4FXV A;  2D69 A;  3MMB A;  4PCQ A;  3TRG A;  2CNK B;  2E1C A;  4RUA A;  3PX4 A;  1UEU A;  2DXF A;  4TNO A;  4CYU B;  2DH8 A;  2FY8 A;  1JJ4 A;  1VBK A;  2L9N A;  5F3T A;  3PYD A;  1XWL A;  2D3O 1;  4LFA F;  3DYA A;  2RU3 A;  1KFD A;  1SH2 A;  3R6G B;  3T1Y J;  3NMA A;  3GR0 A;  1F9F A;  1N34 F;  3E8O A;  2MQM A;  2C2D A;  1L3T A;  4BS2 A;  1KBR A;  4NML A;  3PXG a;  5ETV A;  2LQ8 A;  3BGR A;  2V4J A;  4ED8 A;  5GVQ A;  4DF4 A;  3IBW A;  4X4O A;  4FZV A;  2RQC A;  2LEC A;  1GXL A;  2W9A A;  4R0J A;  4ECV A;  3D3B J;  2PE8 A;  2DXD A;  1O6X A;  5IXU A;  1DRZ A;  3R97 A;  1NSA A;  2GA7 A;  1S6P B;  4KC5 A;  1A6L A;  1M5P C;  1YBA A;  4ZPD A;  2WZ1 A;  5K8M A;  4ERD A;  1FHT A;  2UUB J;  1FFG B;  4O3R A;  5J2Q A;  1KQG B;  5GAE I;  2BVZ A;  4ZVE A;  2R8J A;  2DNH A;  4ED0 A;  1Q0N A;  2UVV A;  4DPU A;  2YH0 A;  4TU7 A;  1N4L A;  2R9L A;  1U8W A;  3M2U A;  4NLO A;  1G1X A;  1VMB A;  3ISN C;  4XDD A;  2ZD1 B;  4NXM F;  2ZHO A;  2OP5 A;  4H54 A;  3TQ1 A;  3GCW P;  4ZOS A;  3MUM P;  4PG4 A;  2B4U A;  1S76 D;  1NJY A;  1MWQ A;  4QW8 A;  5DQI A;  3SZ2 A;  2M5Y A;  4DL2 A;  3J81 j;  4WK3 A;  1YJW S;  4YR2 A;  3MM8 A;  3D68 A;  3H42 A;  1QM9 A;  4BBY A;  3RGI A;  4DG1 A;  3FCV A;  3EIC A;  1WC1 A;  2ZH3 A;  3UN3 A;  1S79 A;  2UZA A;  4M1K A;  3PEH A;  4ED4 A;  2QLJ B;  1N0V C;  3M1V A;  3V6J A;  4IRK A;  1FD8 A;  1EHW A;  5KG3 A;  4I2P A;  3W9H A;  2MYF A;  3BBC A;  4RKU C;  1CLF A;  1BQN A;  3SCI E;  4NCG B;  1RHM B;  1AFI A;  4ELV A;  2AQ4 A;  4UT4 A;  5IM0 B;  1SH0 A;  3M2R B;  2JFD A;  4ED7 A;  2PA3 A;  2HHS A;  4NRT A;  3ETO A;  1QTN B;  5MAO A;  1Q8L A;  1IVZ A;  4DV3 J;  2JL9 A;  1NSQ A;  2BE7 D;  4K4S A;  3KNA A;  2OD6 A;  1XMO F;  4DUZ J;  1I94 F;  2RUS A;  2HBY B;  1FKO B;  2J8A A;  2XMW A;  4CTA B;  4O0I A;  2EFQ A;  4EO8 A;  1FTR A;  2J9E A;  2YNH B;  1IKX A;  2JWN A;  1Q86 T;  3FMB A;  2YTC A;  3E2E A;  2HYI B;  2VFT A;  2Q6C A;  4LIW A;  4OZN A;  1RAC B;  2E1A A;  2MHE A;  2V63 A;  3DLJ A;  4IO9 Q;  4ZVQ B;  2AZ3 A;  2VOD A;  3GIR A;  4ZVF A;  3GJT B;  4OZ5 A;  4I0W A;  4DL5 A;  2I9S A;  4ZPB A;  1X9W A;  1QDU B;  2AJ2 A;  4JV5 J;  2VZ9 A;  3D0I E;  3BDP A;  4CT8 A;  4UQT A;  1S1V B;  4Q43 A;  4MH8 A;  3PRV A;  1AUS L;  5IV4 A;  1HBU B;  4RW6 A;  4USI A;  2OTJ S;  2Z2M A;  4EO6 A;  1CJT A;  1MRO A;  3KUG A;  5CZV A;  3ISN D;  2CQP A;  2CPH A;  1ZAV A;  3MCO A;  4IOA Q;  1HWI A;  3TAR A;  2IMW P;  1LKZ A;  5KFR A;  1RKI A;  1JKH A;  3CWJ A;  1S12 A;  4HHJ A;  1MML A;  2WBR A;  4ZIW A;  5J2N B;  4J7C A;  1REV B;  2MST A;  1VLO A;  1VQK S;  2ACM A;  5IT9 Y;  1O0P A;  5F0W A;  2DRB A;  2W7P A;  1RZM A;  5DDQ C;  1S77 D;  1OIA A;  2BAN B;  3LOU A;  5A0Y B;  3G86 A;  1H7W A;  4F4K A;  3DOM A;  2AEM A;  4PEO A;  2I2Y A;  4FYD A;  3PG9 A;  3VQT A;  1AZS A;  4ZA1 A;  3BN7 A;  5D6G A;  3KJV B;  1S4F A;  2VU5 A;  4KKO A;  1HQE B;  1EAR A;  1KQS R;  2I8E A;  3KHL A;  4J9S A;  4OIX A;  4B9T A;  5SUH A;  4HTJ A;  2YKN B;  2VB6 A;  1WEX A;  4YUD A;  1FRL A;  4U7U D;  4ZLP A;  1R8B A;  3W2W A;  2IDE A;  1VQY A;  1YJN S;  1KSP A;  1VOM A;  4HH1 A;  3F56 A;  1QVF R;  4NEZ A;  2H48 B;  4ED6 A;  1RP5 A;  3I0S A;  2GML A;  4F4Y A;  3QLH B;  3QID A;  1Y10 A;  3MR3 A;  2P9E A;  1HNI A;  1RTI A;  2ZH7 A;  2QT7 A;  4PAA A;  3VAG A;  1NZA A;  3RAX A;  2B0G A;  4HTI A;  1N36 J;  1QTM A;  5LJ3 Y;  1KWM A;  1Q8I A;  4NE9 C;  4DSJ A;  5I4M A;  2RE1 A;  5FDL A;  4EMD A;  4IRD A;  3LW5 C;  2CYY A;  3OR2 B;  1T7P A;  4X4T A;  5LMN J;  4X62 F;  1KHV A;  2KHC A;  3HXM A;  3D66 A;  2FJB B;  1SKU B;  3L7O A;  1NUE A;  1UZD A;  2IJF A;  1CJU A;  1PJ7 A;  1TUG B;  3M7V A;  1NDK A;  2HHW A;  1J5O A;  2ZH5 A;  3J7Z T;  3MPW A;  3A3O B;  4J9L A;  2HBZ B;  3P5B P;  1FX2 A;  2WSE C;  2GVZ B;  1M5V C;  4OI4 A;  2W4P A;  2Q43 A;  1Q53 A;  2RHQ B;  4M95 A;  3HUL A;  4L75 A;  5IT4 A;  1RWN B;  3ENV A;  2GMJ A;  2ALY B;  2M2B A;  4FNH A;  4XO0 A;  3OT9 A;  3DRR B;  5L1J A;  3GWC A;  1RTJ B;  5H9E J;  2CDQ A;  1X4C A;  4DFJ A;  4DZD A;  4NLD A;  1FRI A;  2XNR A;  2FC8 A;  4QBU A;  1UMJ A;  1RT2 A;  4Y34 A;  4ZVP B;  4AND A;  1KD1 T;  5T7L B;  2XSJ B;  2YNI B;  1GAO A;  4OJG A;  1NSP A;  2UV8 A;  2L9D A;  3VVT A;  1TL1 A;  4HT7 A;  3ZTQ A;  3SIP B;  1IKV B;  2V8H A;  4RU9 A;  1J5E F;  2KYZ A;  4B9U A;  4KSE B;  1UPM B;  2RDJ A;  2FDN A;  3EE3 A;  4O0N A;  2W9B B;  4OX9 J;  2DNQ A;  3QJL A;  7AT1 B;  3NGT A;  3LPE A;  4MIA A;  2GIQ A;  3DRS A;  2HW3 A;  4Y3C A;  4DR7 J;  1T8E A;  2LU1 A;  2EEY A;  1UJ6 A;  4ID5 B;  1H72 C;  3NOG A;  1DHM A;  4A8K A;  1RAI B;  4XIU A;  3QAT A;  1XK8 A;  4Q2M A;  1NHV A;  1ZA1 B;  3OR1 B;  2C42 A;  3PJX A;  4LF7 J;  2BEF A;  3D6H B;  4A8W A;  2A18 A;  5HAN A;  2AHO B;  1PYO B;  4DL7 A;  3QSI A;  1KEK A;  5K9F A;  3M2V A;  1R31 A;  1YX2 A;  4RW9 A;  2XM3 A;  1H2T Z;  3Q89 A;  1KQF B;  1FK9 A;  2MZQ A;  3N9U C;  3HSD A;  5E3C A;  3ZTP A;  4ZPA A;  2HVD A;  2XNQ A;  5CYJ A;  1PJ6 A;  3W60 A;  4ZP9 A;  1IQZ A;  4ECY A;  1VLY A;  3CO9 A;  1ZPW X;  3GYX B;  3PM9 A;  2CKW A;  3W5X A;  4I67 A;  1SC6 A;  2H5E A;  5KFZ A;  2GW8 A;  2JC0 A;  1RTH B;  2GHV C;  4RBT A;  2VPW B;  5J2M A;  3OHB A;  4NLQ A;  2PMH A;  2HIQ A;  3MEE A;  5IS2 A;  5A8W B;  3DM2 B;  4MMO A;  2K7K A;  4MK9 A;  2ACY A;  1YJR A;  3CJR A;  1YBT A;  3GFZ A;  2CZV C;  1KVK A;  3EVW A;  4GMK A;  4TN2 A;  3B8H A;  3MUT P;  1FWL A;  2R7O A;  4CLP A;  1CJV B;  2QE5 A;  4DF8 A;  3GIM A;  4R5P B;  2VF3 A;  4P2S A;  2YY3 A;  2IRX A;  4U96 A;  4ES2 A;  4FNI A;  3ZZP A;  3KLF B;  2CJ9 A;  5SZT A;  5HQL A;  1ZTW A;  1FDB A;  3HZG A;  2JVR A;  1RLC L;  2OGU A;  3UCG A;  3LWM A;  1VR6 A;  2GCF A;  4IG0 A;  1UPP A;  4ZN3 A;  3SI8 A;  2G9O A;  1NDP A;  3A8J A;  3UNG C;  1U0H A;  2CJA A;  3ZC4 A;  4Y65 A;  1TL3 B;  5CAA A;  3M8P A;  4DN0 A;  2RS2 A;  1NM2 A;  3J80 U;  4DQR A;  3LGN A;  2RNE A;  2CPE A;  1A0O B;  1RB0 A;  1YHQ S;  4CLU A;  6FDR A;  4ICL B;  3H90 A;  2DCL A;  2XUL A;  3JYT A;  3WC0 A;  3U1L A;  5DGA A;  5DM7 Q;  4XTT A;  2GX8 A;  3H5U A;  3OL6 A;  2MQ8 A;  4YDD B;  4A8X A;  3R2C J;  4RNH A;  3UQS A;  3U02 A;  1JIH A;  4UUX A;  2DR6 A;  4N76 A;  1NJZ A;  1BLU A;  3MI7 X;  2EC2 A;  2GHW A;  3MAA A;  3BZQ A;  2GGP A;  3VCD A;  1NCL A;  3H2V E;  1MSW D;  4RW8 B;  2VG6 B;  1K8A T;  4AQY F;  4HAC B;  1WD6 A;  4ETX A;  1PIE A;  1B70 B;  2R8I A;  1EKS A;  1TKZ A;  3KDN A;  4CLS A;  4ED2 A;  3CDW A;  2M8D B;  3IBC B;  3L7U A;  4P9S A;  3FBF A;  5H1S V;  1T9W A;  1S48 A;  5HVH A;  2DNN A;  2CNL B;  3IAS 9;  3VAL A;  1R27 B;  1HNZ J;  2DD8 S;  5C7P A;  2DH9 A;  5HK4 A;  1XN9 A;  1GX6 A;  3ETM A;  3OVS A;  4NZ6 A;  2MZS A;  2PD1 A;  3JB9 k;  2C3O A;  3EPG A;  1JLB B;  2M52 A;  5AT1 B;  1WC6 A;  5DZ7 A;  1N0U A;  5HMY A;  3D5M A;  5CYM B;  2ZIT A;  4CO0 A;  3O44 A;  4JI7 F;  1VQ6 S;  2HZC A;  1TZ0 A;  5CD4 H;  2JSX A;  3MEC A;  3R1H A;  4Y2I A;  1VJW A;  1ITP A;  3HSG A;  3T1H J;  2QFJ A;  2LEP A;  4ZN1 A;  1B3T A;  4DUY J;  4PWD A;  2XCP A;  2BJ3 A;  2KTQ A;  2HHX A;  4K0K J;  2X3G A;  2FVP A;  1RAF B;  1FKP A;  4C98 A;  2UXD F;  3DLE B;  4B3M J;  4CM2 A;  3Q8U A;  4L76 A;  4W4M A;  5RUB A;  4GO5 X;  1HKA A;  4WU3 A;  3HHN B;  2E7V A;  2E1R A;  2F65 A;  1FJ7 A;  2DGV A;  1JB0 C;  3ZNU A;  3NXZ A;  5CYQ B;  3ENW A;  1JLQ A;  2DR5 A;  1N33 J;  4LQ9 A;  4NZ7 A;  2Y0S D;  1HYS B;  4DCP B;  4JUZ A;  4K4U A;  1C1C B;  3KJF B;  2B8P A;  3FKB A;  1SL2 A;  3MDF A;  4D3H A;  3MM9 A;  5BYQ A;  3MZI A;  4MIB A;  3NNC A;  1QUV A;  1JXE A;  3FUY A;  3M6W A;  4M5J A;  3I5A A;  3MED B;  3SV4 A;  2MEW A;  3W66 A;  2HFS A;  4X4R A;  3G6V A;  4OZJ A;  2BKO A;  3U1N A;  4QCL A;  2XLK A;  1DTQ A;  1G4C A;  2HFV A;  3D2W A;  3GG1 A;  2R7X A;  3FEZ A;  2GZO A;  2BYC A;  1RLD A;  1YVF A;  4M63 A;  3KNG A;  3CVK A;  1B4S A;  3WIU A;  3DOL B;  1FO1 A;  3IS9 A;  2NQP A;  1HBM B;  5D0G A;  5EWF A;  3I4P A;  3BGO P;  4K4X A;  4HR2 A;  1NME B;  3G8T A;  3I9Z A;  1B0P A;  2R2S A;  2A6M A;  4HEA 9;  5I3Q A;  3EGW B;  3US5 A;  3R5A A;  3CJT A;  2GQQ A;  2NCK L;  1S7I A;  4URQ U;  5GAH I;  4NLY A;  3MAQ A;  3LAL A;  1YJT A;  1NJI T;  4ZIV A;  1UFL A;  1RWV B;  4DWI A;  2QGF B;  3KXD A;  2AJ4 A;  1MWY A;  2UV8 G;  2ROG A;  4CO1 A;  3CED A;  1H74 A;  1EP4 B;  4USU A;  5HP1 B;  2QO3 A;  3TZW A;  3SQG B;  2AMC B;  3I0R A;  1S6P A;  2O01 C;  3MM5 B;  2NXN A;  4QWD A;  5HI7 A;  1WNE A;  1YG0 A;  2XZW A;  1M5K C;  2JEI A;  3MMJ A;  4ZCM A;  4C3K A;  4YHH J;  2VA3 A;  3OUY A;  2KT5 A;  5B0C A;  3HFV A;  1WOS A;  3RBZ A;  3LQV A;  5L9N A;  1APS A;  1VC0 A;  2QG9 B;  2WSC C;  2HGN A;  2HHV A;  1GFW B;  1DQA A;  4HI1 A;  3NOC A;  1UVJ A;  1QLN A;  2HHH F;  3RRK A;  2YKP A;  1AYE A;  5HLF B;  1F60 B;  2P8I A;  2G13 A;  1RK8 A;  2G1H A;  2E9Z A;  1SJR A;  2CJQ A;  3MPV A;  2B3T B;  5ETQ A;  3DI6 B;  2PSZ A;  4MKA A;  2X1G A;  1S9F A;  1YTY A;  2YX4 A;  3UPF A;  3NMR A;  3R6L B;  3CD7 A;  4OJ1 A;  4FYX B;  5IT0 A;  4FXD A;  1U7L A;  1HA1 A;  1FXR A;  3RB0 A;  3QAE A;  3OTE A;  1WC0 A;  3VAM A;  3QWU A;  1GT8 A;  3W3S A;  4N41 A;  2A1B A;  4ZVU B;  4ENO A;  3PIP Q;  6AT1 B;  4NLX A;  1UW4 A;  1F9E B;  2W4D A;  2FB0 A;  3FVY A;  1T9X A;  4LQ3 A;  2E9R X;  3E01 B;  2ZWO A;  4FBU A;  5E3Q A;  4LF9 F;  2FUG 9;  1VQM S;  3PKM A;  3W5Z A;  1S49 A;  4C0O C;  1Q81 T;  1GNK A;  2BW7 A;  3VGT A;  1REG X;  1UVL A;  1YIT S;  3GII A;  3R5B A;  3AOA A;  3DRP B;  4OX6 A;  4KGV B;  2VOO A;  2KT2 A;  3AD7 C;  4ELT A;  2YWE A;  2Y1J A;  1UVI A;  4ED3 A;  1HD0 A;  3TVY A;  4JI3 J;  3KK1 B;  1WWH A;  2Y9H A;  4LFC F;  3SSS A;  4DPO A;  2ZOG A;  2YBV A;  4DR6 J;  5ETM A;  3KFW X;  1SPB P;  1SQE A;  2O66 A;  4WTO B;  4O3N A;  2VPZ B;  2DY9 A;  3FK4 A;  1FF2 A;  1FKO A;  1PIL A;  4KRW A;  1MNE A;  4CTA A;  4FS1 A;  4Q5V A;  1VRU A;  5GAD U;  4YN3 B;  4IG3 B;  3MMA B;  4B3T J;  3V5R A;  2CXE A;  4NLW A;  5LOQ A;  1YZ6 A;  2AYB A;  4X4N A;  3IMQ J;  3EZU A;  1OSD A;  2F40 A;  4LIR A;  1VC5 A;  2E5L F;  2RDI A;  1OYE A;  4NXN J;  2AJ1 A;  3GJQ B;  1PAE X;  2HHP A;  3CCZ A;  1T3N A;  4UTG A;  3TAP A;  3D1Q A;  2VFS A;  3BBB A;  2FLL A;  1C1B B;  1WSV A;  3IR5 B;  4X65 J;  4PKD B;  5D0R A;  2C2R A;  3BS9 A;  1WHX A;  2CA9 A;  1U6F A;  4P52 A;  4X4U A;  2Z0G A;  1S1V A;  2HWT A;  1WF2 A;  4PXD A;  2NLW A;  1U4B A;  5KFT A;  2ALZ A;  1N6Q B;  4QR2 A;  1ROF A;  2X3D A;  2J5A A;  5KFA A;  1NKE A;  1S6U A;  4GKJ J;  1EET A;  4DXL A;  3UCZ P;  4Y2A A;  2ZBI A;  1FEH A;  2IVY A;  4QWB A;  3T9Z A;  3I6P A;  5D4N A;  2XY5 A;  1HIY A;  2RF2 A;  5KFE A;  1NZ8 A;  2YWH A;  4N8N A;  2QTW A;  1JLG B;  3RAM A;  2K3K A;  3P45 B;  1QAJ A;  4NPO A;  5G4D A;  3HSZ A;  4DR4 J;  2BAN A;  3PJW A;  1FRJ A;  4OZL A;  1FWK A;  1NHU A;  4DR3 F;  4C4W A;  3Q8R B;  4O4G B;  3DDI A;  4I6W A;  1HQE A;  4IR1 A;  2BJ9 A;  1FX4 A;  2HRU A;  1H38 A;  4YY3 J;  2CQD A;  4PUO A;  2IFX A;  2EBG A;  1VDH A;  1KVI A;  4LR9 A;  3K5P A;  1Q8K A;  5A6P A;  2RQM A;  5KFX A;  4QU6 A;  4JI5 J;  4WCE Q;  1X4D A;  3OTO J;  2ZH9 A;  3EXC X;  3I5C A;  3S8S A;  2EK6 A;  2Z58 B;  3QT7 A;  3I31 A;  3PFO A;  4QJV A;  3C3L A;  2W2Q P;  3G9C A;  2CNO B;  5CQG A;  3Q2T C;  3KUH A;  1VRT A;  3L4B C;  4DV0 F;  1S9E A;  2B4V A;  1VBX A;  1UVM A;  4ETZ A;  3U27 A;  2W8L A;  1CG2 A;  3CDB A;  2ZWP A;  4BWM A;  1IN0 A;  1AUD A;  3QWP A;  3EUN A;  2R7U A;  1HPZ A;  2P2C B;  1RA7 A;  4B9S A;  3HP6 A;  4G65 A;  5JMN A;  3FNN A;  1TMJ A;  4F8R A;  3BH6 B;  5J1E A;  4LFA J;  2LQJ A;  2QLB B;  5KT2 A;  3J81 Y;  4QIG A;  1UWA A;  3RRH A;  1N34 J;  1U09 A;  2W2O P;  3DRR A;  4LF2 A;  4M5K A;  4BDP A;  1RBO B;  2DIU A;  4Q45 A;  2DPJ A;  1U1Q A;  4E0D A;  3CGI A;  1Y7P A;  4DU8 A;  3M32 B;  4KGK A;  4JI1 F;  2OFG X;  4JYA F;  2JDJ A;  5DGB A;  3C19 A;  4MYU A;  4QYR A;  3VTI A;  1KKH A;  3DDN A;  2ZDP A;  3KLH B;  3VAF A;  5T7L A;  1CQN A;  5DJB A;  2XSJ A;  4C8O A;  3THT A;  3BQ1 A;  2Y1L B;  3SFU A;  3KLG B;  3BR9 A;  1ZM4 A;  4DL4 A;  4NX9 A;  1JLF A;  1K1Q A;  3WZ0 A;  1IKV A;  1OWX A;  1HHQ A;  4YQW A;  1TU0 B;  1DTT B;  2ZE2 B;  1TL7 B;  4UST A;  5C24 B;  3W1Y C;  2AX0 A;  3TAN A;  5LSO A;  1XR6 A;  1BY9 A;  1JX4 A;  5K8N A;  3M6V A;  2L48 A;  2VFU A;  4OYW A;  3UD5 A;  5E7O B;  4DI6 A;  3KMQ A;  4ID5 A;  1QSL A;  1LFP A;  3ILL A;  2XGP A;  1TAU A;  3CNQ P;  5DM6 Q;  9ATC B;  4TKT A;  3TA1 A;  2V69 A;  3OR1 A;  3V81 A;  4FYY B;  1UP1 A;  1WKK A;  1WOP A;  2FVQ A;  3HCX A;  3OHA A;  4NXM J;  1KLM B;  2QC3 A;  2BJE A;  3S6E A;  1TKX B;  1JLE B;  3QGI A;  1L3S A;  2PT0 A;  3HSJ A;  2CPI A;  2HFN A;  2OPQ A;  3ZZU A;  2YKM A;  3M4X A;  5KFO A;  2NXE A;  3IN5 A;  4PQU B;  2X1F A;  2IDL A;  1YWX A;  1X0F A;  1WEY A;  4ZPV R;  3OBI A;  4ZPC A;  1GH8 A;  3HKW A;  5KT7 A;  1C0U B;  2IJR A;  5D4O A;  3PYF A;  1WEL A;  1LV5 A;  2DHX A;  1PYS B;  3OSP A;  3CT9 A;  4V19 J;  1F2G A;  5EWE A;  1RTH A;  2WOM B;  3KDO A;  3PNI A;  2CQB A;  2GQ2 A;  2DNP A;  1RHJ B;  4IDK B;  3SCK E;  5JJB A;  2MDA A;  3DRX A;  3G8S A;  3TX8 A;  2DO4 A;  1U2C A;  3BGU A;  4F0H A;  3RR7 A;  2CQH A;  1T9Y A;  4P73 A;  2LYV A;  2WAQ D;  4RZR A;  1X4B A;  2HQG A;  1DZ5 A;  4IFY A;  4DSI A;  2MKY A;  2AV5 A;  2R3V A;  1CJV A;  3WC2 A;  1HNW F;  1S1U B;  3EDQ B;  3KLF A;  2E5J A;  3PRB A;  3PTW A;  5B09 A;  3CCW A;  1RAH B;  2B6A B;  3GR1 A;  1EJ7 L;  1XMO J;  1UFW A;  1NJW A;  1RIS A;  3BEG B;  1I94 J;  2ASY A;  2LVW A;  2L3M A;  1J27 A;  1B7Y B;  2WB4 A;  3NS5 A;  4IR9 A;  3CCQ S;  3OFG A;  1N52 B;  4J9O A;  5JVH Q;  1FJE B;  2ADC A;  4ICL A;  4OLO A;  1X0P A;  4FDF A;  2APO A;  4IUF A;  1RT3 A;  1TV6 B;  2XS5 A;  1YJU A;  3GON A;  4NYO A;  2RHS B;  2CVI A;  2I38 A;  1IR0 A;  2AYG A;  3NWG A;  5LXR A;  1Y3J A;  3AH6 A;  1FE0 A;  4ES1 A;  3OJS A;  1UA1 A;  3MXH P;  5G0R B;  1KOH A;  2P9C A;  2HMI B;  4PYD A;  5HVF A;  4RW8 A;  3BSN A;  3O3L A;  2BXJ A;  2VG6 A;  5B0F A;  4YEA A;  1YGY A;  4NA3 A;  2OAU A;  3MR2 A;  5CD4 A;  2Q6B A;  2D3O R;  5K5M A;  1A9N B;  4FF4 A;  4LUB A;  4B3O A;  3N5B A;  1RYS A;  4GRS A;  4IRC A;  4LFB F;  2IAJ A;  3P6Y C;  1HLW A;  3KWM A;  4M5L A;  4CLZ A;  5M2U A;  2BE2 A;  1OQ6 A;  1N5S A;  3V6H A;  3VGS A;  2OI2 A;  4USV A;  1VIO A;  2AW0 A;  3D0G E;  2ZUG A;  2DCU B;  3CCT A;  4F2S A;  3RRG A;  3GP9 A;  2AZ1 A;  4YB7 A;  4M5M A;  1TK0 A;  1JLB A;  1VQ8 S;  4C8Y A;  3MF5 A;  4R25 A;  1SJ1 A;  3RZA A;  3QRQ A;  5KG2 A;  2AIR B;  3DNC A;  1H6K X;  4MYT A;  1KLN A;  2LMI A;  3SYZ A;  2F8M A;  4PR6 A;  1CSJ A;  2EKN A;  1SC1 B;  1CS4 B;  1H98 A;  1EQ0 A;  5KFU A;  2DR7 A;  4NOH A;  1C2P A;  4EBE A;  2UUT A;  3N28 A;  1ZZN A;  2H3E B;  1HMV B;  4Q7A A;  4WFA Q;  2GO9 A;  1U2R A;  3DLE A;  4TY8 B;  1R8C A;  2IHR 1;  3THV A;  2MTL A;  4H4M B;  1M1K T;  4P74 A;  4P10 A;  1UFK A;  2CQ4 A;  3I87 A;  2BRK A;  4G1I A;  3VHQ A;  2HWI A;  3H2U B;  3FGV A;  2V2V A;  2XWX A;  1NK4 A;  2C3U A;  1HYS A;  1MN9 A;  2HQD A;  2H4Y B;  2XYH B;  4WPA A;  4DSE A;  1RU2 A;  3NGK A;  2CG4 A;  3R5G A;  3FRZ A;  4KH0 B;  2J9D A;  2ATC B;  4X62 J;  2C2Z B;  2IVM A;  1B7F A;  4C3L A;  3OTD A;  2WON B;  1NK7 A;  4NLG A;  2QYC A;  3R3T A;  1VQP S;  2VON A;  2W25 A;  2P6T A;  5KFC A;  4CT9 A;  1NPR A;  2C3P A;  3U1M A;  5KFM A;  3ZTO A;  2A6O A;  1H0H B;  2MQQ A;  1S72 S;  2IC3 B;  3PX6 A;  4N77 A;  1WC3 A;  4FP9 A;  2DTJ A;  3TI0 A;  1VQS A;  4M94 A;  3CE8 A;  1TKT B;  4PXB A;  2DHG A;  1BQX A;  4OI3 A;  3V6D B;  3OVB A;  1HNV A;  3MPU B;  3OW2 R;  1I3O B;  1RT7 B;  2RB7 A;  1R3N A;  4O3O A;  2HQF A;  2KB2 A;  4KHP F;  2V9K A;  1AA1 B;  1QAY A;  5IWA F;  4RUC A;  3J7A N;  1SIZ A;  3IRX A;  3MOJ B;  4M5G A;  4PG5 A;  2KO1 A;  3TJA A;  5IQQ A;  1J5E J;  3JAM Y;  2MKJ A;  1B0T A;  4I2Q A;  3FZ2 A;  3H7H B;  1NDC A;  1EP4 A;  5HP1 A;  3SQG A;  3K59 A;  1RBA A;  3A8I A;  4DSK A;  2RUG A;  2RU9 A;  8AT1 B;  3MM5 A;  3H5S A;  2VJV A;  1U1N A;  2UXB F;  1NB2 A;  3IXQ A;  1RA6 A;  2CWK A;  1ZM9 A;  5B7W A;  2UUA F;  5I3U B;  3B4D A;  1FRH A;  1K0T A;  3DHW C;  1IM6 A;  2VPY B;  2E9T A;  3PW7 A;  5FD1 A;  4ECZ A;  4DR2 F;  2MB0 B;  2HS4 A;  1VHF A;  1NB7 A;  1OY8 A;  4CWB A;  2HVE A;  1TUV A;  5ADZ A;  1HAR A;  5KFJ A;  3LPY A;  5F41 A;  2YXL A;  1WC5 A;  2J7K A;  5LXY A;  1DFD A;  3DHX A;  4UW2 A;  4QWC A;  2VQE F;  1QAI A;  1X8D A;  4OZ3 A;  2FIU A;  1IBL F;  2VAS A;  2BJ7 A;  2G0J A;  3OV7 A;  1WHY A;  2VH7 A;  4FKX A;  4M5I A;  4NLT A;  4QPT A;  3CB4 A;  5GMK a;  2KFN A;  1V3Z A;  4UZC A;  1K9M T;  1TFW A;  5DS7 A;  4A47 A;  4C7Q A;  1HQ2 A;  3CJQ A;  1KHW A;  2YNG B;  4EYI B;  1N8R T;  2DIT A;  2DNG A;  2OHD A;  4O23 A;  1WI6 A;  1CUL B;  2YWF A;  4DQQ A;  2KRR A;  3GFH A;  1BQM A;  3E01 A;  2MGZ A;  3SDE A;  4NRU A;  3MEG B;  2BOP A;  2HAF A;  1VJQ A;  4KO0 B;  1E6V B;  4KB7 A;  2V34 A;  1C4A A;  2MQN A;  1IQT A;  2CPJ A;  3EGV A;  3MTJ A;  1MWZ A;  2J0X A;  4MTP A;  4I4B A;  3DRP A;  2DNM A;  2VBZ A;  5FII A;  1C0T B;  4ZHR A;  3T5J A;  1HW9 A;  3NBP A;  3D6T B;  1R8A A;  2OIH A;  3FDS A;  3L09 A;  2MKS A;  3G6E S;  3Q8S B;  5KFW A;  1Y00 A;  4WWS A;  4RUB A;  1U45 A;  2ABY A;  4TU9 A;  4ECW A;  5LT5 A;  3OXG A;  1BE4 A;  5A8K B;  3PR5 B;  3NLC A;  3RR8 A;  3R8Y A;  1BHN A;  1RSC A;  4OYI A;  3A8K A;  5E3P A;  4IG3 A;  1ACM B;  5B0B A;  1FFS B;  3TVZ A;  3PZP A;  2D41 A;  4CO5 A;  1HWJ A;  4WP9 A;  3IC1 A;  3TEG A;  5CAB A;  4DFM A;  4N56 A;  4JI0 F;  1D9A A;  3TYT A;  5HJY A;  2HK3 A;  4F3O A;  2R8H A;  4AQY J;  3CD6 S;  2ZHA A;  5I3P A;  1FVQ A;  1CVJ A;  2CJK A;  3LAN A;  1C1B A;  4UUW A;  3WBZ A;  3ZTR A;  5C42 B;  2Z30 B;  3C16 B;  1N6Q A;  2KVQ E;  3QQC D;  1R8H A;  1S9G B;  2FLP A;  3UW1 A;  3UN2 A;  2QN6 B;  1HNX F;  2WTF A;  5BYR A;  2GO8 A;  2BKN A;  2J0S D;  3I4H X;  2ZM6 F;  3H98 A;  3THP A;  3KLI B;  3C8Y A;  4V1A k;  3T41 A;  4DFK A;  2M8H A;  3CXC R;  3W62 A;  3QGP A;  2W1B A;  1FES A;  5HBM B;  1JLG A;  4I7F B;  3CIM A;  2V0N A;  2EI5 A;  2J0W A;  2N4C A;  2ZH6 A;  4JI7 J;  4RWX A;  1TVR B;  4X64 F;  4ED5 A;  3N79 A;  4O3P A;  7FD1 A;  4F2R A;  2GAG C;  2RD5 C;  3G87 A;  1Y0H A;  3LH2 S;  1SJQ A;  3I56 S;  3C6T B;  4O4G A;  3CJ3 A;  1RHK B;  4C11 B;  2XGQ A;  3TUJ C;  3TO8 A;  4JB8 B;  4ZKA A;  1GQE A;  2GIR A;  1G7C B;  3VAI A;  1VFJ A;  2HRY A;  2UXD J;  3JTO A;  2JC1 A;  1EIY B;  4OHX A;  3G4S S;  4CLF A;  2CPX A;  2AJ0 A;  4Z7C A;  5K8P A;  4WIQ A;  2F1F A;  1RT6 A;  2F3J A;  4MKV A;  2E1P A;  4ZVO B;  4QPX A;  1VQ9 S;  2YQ0 A;  3FC9 A;  4WYW A;  3I32 A;  2WVC A;  1Y4Z B;  1CC8 A;  3CJ8 A;  1RHU B;  1NKB A;  3OPK A;  4KJI A;  2LKZ A;  2XSF A;  2FY1 A;  3GE9 A;  4ZLN A;  1WEZ A;  3QT8 A;  5E3A A;  3VAJ A;  4P7T A;  3G6X A;  4ZPT R;  3IG1 B;  4LF4 F;  2ZZN A;  2H5I B;  5CH7 B;  1LWC A;  3CME S;  3NGU A;  2EK1 A;  2OKQ A;  2GJ2 A;  3K5O A;  4OYB A;  1W2I A;  1JQG A;  5ETP A;  4RO0 A;  3N4W A;  1HWK A;  1DQ9 A;  3AB4 B;  2HLT A;  1V3S A;  1VCT A;  1BWV A;  3OL7 A;  4C6A A;  3MM7 B;  4M5N A;  2AX1 A;  2N4D A;  4EGL A;  1VC6 A;  1L3K A;  5L39 A;  5L1L A;  3QMQ A;  4XPE A;  5AJ3 F;  2FJV A;  5L1I A;  1RAD B;  1DLO B;  4EYH B;  2MHN A;  3KLH A;  2VL1 A;  2KZZ A;  1Z1Z A;  4XAK A;  2GV1 A;  3J81 U;  4JI6 F;  2FHM A;  2HEK A;  3WDO A;  3KLG A;  3ISZ A;  5EDW A;  1HI0 P;  3DMJ B;  2GS8 A;  2V2Z A;  2O1P A;  2MKK A;  1LQ9 A;  3RTV A;  3QSY B;  3JSR A;  1IJE B;  3RW6 A;  1DTT A;  2ZE2 A;  3DFE A;  1ZH5 A;  3KLE B;  5F8J A;  2MY8 A;  5C24 A;  2XI2 A;  3D54 A;  3HKZ D;  2JOQ A;  1QVG R;  3Q8P B;  3DGP A;  5D8H B;  2QA2 A;  4DZ6 A;  2HHU A;  1WKL A;  4PXE A;  2NYH A;  3HHL B;  2FLO A;  1F3V A;  5F0U A;  3NEK A;  3W9J A;  4ZS6 A;  4K7Q A;  4QR1 A;  3CCL S;  2HHH J;  4ED1 A;  2E5I A;  1U2F A;  3PKY A;  1KLM A;  4OJH A;  4WE1 A;  4LSZ B;  1G2E A;  1TKX A;  1HI1 A;  2V9W A;  4TVA B;  2ZH2 A;  5KT4 A;  2J76 E;  4X4S A;  4PPZ A;  4PQU A;  1S59 A;  4X4Q A;  1U24 A;  2QRR A;  2LQ9 A;  5I42 B;  2W9C B;  3EJM A;  1ELO A;  1XTZ A;  3VV2 B;  2KZM A;  1C4C A;  3CJ0 A;  2VFR A;  2WW8 A;  2XI3 A;  1R89 A;  3UE2 A;  3NCQ A;  4DJB A;  2BJD A;  3CCJ S;  2WVF A;  3EM1 A;  4DCO B;  1C0U A;  2V8D A;  2RAQ A;  3AA8 A;  3HMJ G;  2RJZ A;  2HBR B;  2J9D E;  2W4C A;  1E6Y B;  3MMB B;  4L3N A;  2R7W A;  3QRP A;  4ECT A;  2Q3P A;  2YNF A;  2LLZ A;  1T02 A;  4WFX A;  4OX8 A;  4UZB A;  1QAX A;  2WOM A;  2MQL A;  4RW7 A;  3F0N A;  4K2J A;  2ZOF A;  3I96 A;  5BXI A;  3TVK A;  4LF9 J;  3VGU A;  2LEB A;  5KFV A;  4O3S A;  3NS7 B;  1H73 A;  3R5J B;  2NS1 B;  2N3O A;  4YB5 A;  3VGV A;  2JEG A;  1XQI A;  4RR5 A;  2DGU A;  2POK A;  2B4P A;  4JI4 F;  1Y5L B;  2HFU A;  3BGR B;  3GYN A;  2AU0 A;  1JJ2 R;  1L3V A;  4LSL B;  1XC9 A;  2FVS A; 
#chains in the Genus database with same CATH homology
 2JNJ A;  3DGP B;  3DOM B;  1YDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...