3DOMB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 2
total genus 17
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3domB00
3DOMB 3DGPB 2JNJA 1YDLA
chains in the Genus database with same CATH superfamily
2CPIA 1PJ7A 1REVA 3CD7A 3IRXB 3C6UA 1JKHB 5GAGI 1TTHB 1N0UA 3MTKA 3UFCX 2LEPA 2Z2YB 3OJUA 1MMNA 4BWJA 4TN2A 1YBTA 3MUVP 1VS3A 4AUKA 4QWDA 3HPOA 3G71S 4ECXA 2RDIA 3H25A 3EDRB 4A8KA 3LP0A 2CJ9A 3EXCX 1M5SA 2W25A 3DRSB 4G6VB 1S0OA 1HWLA 1RA6A 2AF6A 2GVDA 2QJ3A 1M1GA 4DQQA 1PGZA 4OZ0A 3HFVA 1Y7PA 2FVRA 2OLWA 1S0NA 3TZZA 1TR0A 4WWSA 2AGOA 2MY8A 3RU0A 4J91A 5CH7B 2AEJA 5KFIA 2P2CB 2B9XA 5AE3A 2HBYB 1HARA 4D3GA 1FNOA 1KS2A 1D8ZA 1SJRA 4G1QA 1RGVA 4JI8F 4CNZA 3AODA 4QYZK 3PYFA 2H5IB 3IBWA 4TYAA 2GQ2A 4YQWA 2ZZMA 2VBXA 3D1HA 4EUVA 4F50A 1FRXA 1IM6A 2AZ3A 3L95X 2QFIA 3MXHP 3MUTP 2G1HA 1TQLA 2K7JA 2AJ4A 1NSQA 1RB0A 3SSRA 1N6QA 1FJEB 4NXNF 2LA4A 1ZAXA 1PG5B 4IOAQ 1TU0B 3DLLQ 4NCAA 9RUBA 3NNAA 2XS5A 5HROA 1ZPVA 4ZVGA 4TU9A 1XNQJ 1DRZA 2KTQA 1I3OB 4ZIWA 3M05A 3M1VB 1HFEL 5ETVA 2ZE2B 2VG7B 5IS2A 1PJ5A 2VG6B 5KFWA 4C8OA 2LYVA 3DRRB 3ZTQA 2M9KA 1F3FA 1R0AA 2JC1A 5AT1B 2FJDB 1X4AA 3ITHA 5J1NA 2ZH7A 3D6HB 3UN3A 3SV3A 4FBUA 1XN9A 3CB4A 3GFXA 5CD4H 1FNMA 4FF4A 3SI8A 5KT7A 1KEKA 4GKKJ 2HWTA 3E3XA 3H2UB 4Q8EA 4V19J 3HD1A 3QPIA 4M8LA 4NLGA 5F0WA 1KQFB 1U2CA 4JUZA 3KK2A 2H65B 2VA2A 4DBQA 3PR4A 5J2PB 2HQCA 2JL9A 2BACA 1CJKB 4XIUA 2W2MP 4PG7A 3FBEA 3IBCB 5A76A 1RWKB 2BM0A 1ZOTA 2HRUA 3HKZD 4M5DA 2BANB 2KKHA 3A4TA 1TVRB 3UR0A 5DM6Q 1WSRA 2JEFA 3ZO7A 4OYBA 2QYCA 1MN9A 1TAQA 3DOMA 2BE2A 2MLZA 3C15B 3MM9A 1U6BA 1BY9A 4N8NA 4EBCA 3KLFB 2CNLB 2V68A 2UXDF 1KHWA 3T1YJ 2FQQB 1RHMB 3AD8C 3NG8A 1YITS 3H5SA 3OVSA 4Q43A 4HEA9 1S72S 2EC2A 1M0SA 1OY6A 3EMTA 2ZWOA 1H98A 1PAEX 4AD6A 2CJYB 4C8MA 3VR1A 3CTRA 3I5AA 2E7XA 3MPUB 5IT9Y 3EZ5A 2KJWA 2NXEA 3W62A 2E1PA 2AQ4A 5C7PA 4B9MA 2QL9B 3DOLB 3IWXA 4EU0A 4UZCA 3CC4S 2C2NA 1U1QA 1H7XA 1NO8A 4WTOB 3RW6A 2XO7A 5K8PA 1U49A 1S7HA 2A2CA 1WC4A 2MTLA 2GGPA 4KKOA 4M5JA 1U47A 5F9NA 1TAUA 2W4PA 2C3OA 5KT2A 1AT1B 2XY7A 1XR5A 4QW8A 2HIYA 2ZH9A 1QVGR 2FVQA 1FRLA 5C25B 2YY3A 3A8IA 3BS9A 4B3MF 1U6FA 2XMUA 3QAEA 4ZVEA 2W7PA 4B9UA 1JXEA 3ELHA 4NASA 3I4PA 1EP4A 2DITA 2KXNB 5D0EA 4QWBA 3AA8A 1NK0A 5LMNF 4UQTA 3R27A 3BGLA 5KG6A 1BC6A 4KHMA 5E41A 1DLOB 1JNRB 1R8BA 4B3OB 4I2QB 2KFNA 1NPRA 1Q5VA 2HRTA 3FGVA 1SQGA 1KOOA 4ES3A 2XMMA 3DRRA 1Z1ZA 5KFFA 3A1YG 3VVTA 5IV3A 2QSFA 2WVBA 2Z56B 3TO8A 4DR6J 1YJVA 3SXLA 1S1WA 2RD5C 4HHHA 2PGCA 3UN5A 1RT6B 1WHYA 1GK8A 2IIHA 3WX4A 3K2YA 1MWQA 5H9FK 2Y0BB 3CC2S 4CLUA 3DOKB 3F44A 4DSFA 3OVBA 4ZJOA 2NSCA 4NE9C 4ZS6A 3R6LB 2POKA 3N5BA 5L9NA 3G96A 1KKHA 2J5AA 4QIVA 2RS8A 5A8KA 1JJ2R 4JI1F 3BQ0A 3C2PA 1ZM4A 4PUOB 3NOGA 3FEXB 2A10A 4HT5A 1N5TA 2QMXA 5DDQC 1FJ7A 1C0TB 1Q1KA 2P6TA 3KLEA 3KUGA 3OTBA 4BHQA 2AT1B 3TJAA 1FVQA 3ITHB 3GLJA 2BBEA 3SQGA 5KFGA 5SUHA 2CPJA 5EWFA 2R2TA 1HBNA 1GX6A 5KFXA 1VDHA 4WK1A 2FJWA 3KK3B 4QWCA 4K4YA 1FX2A 2HWHA 3NRBA 1BQXA 4PZVA 3TQEA 4RNOA 3IR6B 1VMBA 2F5GA 4KY3A 4DV1F 3DNCA 3UW1A 1KC8T 1UEUA 1HIYA 3IBFB 4TLQA 2XZWA 3HVWA 1NZAA 3M8QB 3G6YA 3K5NA 3K17A 2WTFA 3BSNA 2OPSA 3H4BA 3CJKA 3DOLA 4X4UA 5I42A 1BQMB 2CJBA 4PAAA 1N56A 1BMQB 1X4DA 2ALYB 4JI4J 5KFYA 3RBXA 3KLFA 4NCGB 2J6TA 3GQCA 2ZM6J 2LECA 2JH3A 2ZBCA 3NEKA 2RQCA 3SFGA 3NAIA 1H0HB 1ZM3A 4UOGA 2DXEA 3EGZA 4ID8A 5F8LA 3ENWA 1UVIA 4L75A 1BWVA 3KHLA 3FJ2A 4A8QA 3DHWC 4B3SJ 3HX9A 2BW7A 1F9EB 1FKOA 4N5SA 5J2NB 2OIHA 2BUNA 2E44A 5EGYA 5J1PA 5KFPA 4UY8T 3N4WA 4E8UA 1LK5A 1FEHA 2E66A 3MM8A 1NHUA 3G8TA 1FTCA 2B43A 2DY1A 1KOHA 1JIHA 2RKIA 3DXBA 1SXLA 3EE3A 2A1BA 2BJDA 4M5NA 2FB0A 2IAJB 4URQU 2V2VA 5B0CA 5HSPA 3GV8B 1X0PA 2HIQA 3BF4A 3PIPQ 3C6TA 3RAXA 1OYDA 3HZGA 5GMKa 1SJQA 1YI2S 5KFHA 2XMJA 2FC9A 4W92B 3D28A 1SL0A 1IR2A 2C2DA 1WACA 2F63A 4G65A 1RYSA 4NLWA 5CQGA 2ILYA 2V8HA 1OSDA 3M30B 5I3UB 3KJVB 1VQ5S 4TKTA 1DTTA 1PC5A 5ETSA 3RG6A 4TXSA 3OL7A 1SL1A 2XB2D 2KFYA 2X3GA 3IMQJ 4L74A 1JJ4A 4JV5F 2XMTA 4QR0A 4IH7A 4H4OA 2BXJA 3CW2C 1PCAA 2CQIA 1RT2A 1SI9A 5IC6B 4RUHA 1QSLA 4QU7A 3G82B 3D9BA 3KJFB 1LV5A 2CQ2A 5FIIA 2VPZB 3MMCA 4C11A 3GIRA 4U95A 5F8MA 3J81Y 2IVMA 3NWGA 4NEZA 1P9YA 4J37A 4J9PA 1T94A 5SZTA 2I8EA 1NB2A 4EGLA 3KJQB 4DQIA 2HLTA 1YJNS 1CC8A 2P5VA 2LQ8A 3MM7A 1RAGB 2F9JA 2GZOA 3PEJA 4Q0BA 4Z2XA 3M9OB 2RF2B 1H2UX 1GTEA 2I5JA 2R2RA 1U1NA 2DNKA 2WRMA 5LT5A 2W9CA 4GKKF 1I51B 4P73A 5LSLA 1TUVA 2IHR1 2MPUA 4UTGA 1OWXA 3JTOA 5IV4A 3H90A 3R1HA 4DSLA 1HBUA 4LSNA 2DK2A 4CLTA 4CH7A 3E2EA 2N4CA 2XMVA 3HHLB 3LALA 3GP9A 2QLWA 3RB4A 1CJKA 4L76A 1WDDA 2WVEA 4DJBA 3OBIA 4WCEQ 4CLSA 3FCHA 5D4NA 2BYCA 4N47A 2DD8S 3HO1A 3RW7A 2O66A 2KXHA 1RK8A 4EFAC 1GXUA 2F1FA 4ILMA 1Y5LB 3W1YC 3ZFVA 1BQMA 4X4OA 3V6JA 1NB7A 4K0KF 1WORA 2QO3A 2E1AA 2BJ3A 3GIIA 5KG7A 3MFHA 3NMRA 3BH7B 4WZMA 4ZP7A 2JVRA 1CULB 1T03A 2RU9A 1VQ4S 1NSKL 4RO0A 2MDAA 3N01A 1D9DA 4AL7A 1B0PA 2B51A 4P7VA 3SDEA 2RDJA 2OTJS 3I87A 4WYWA 4H4KC 2YX4A 4EO6A 2E5LJ 1WDTA 3CJ5A 2MYFA 2QA4S 4I64A 4DR4F 4DL2A 2H5EA 3L9ZA 1RTJA 4I2PA 1H74A 2ZNYA 3CCTA 3CIZA 4ZIVA 2MQOA 1E6VB 4LFAJ 5HO4A 4GKJF 1IKVB 4C7QA 3AOAA 4LBPA 4A8YA 4L3KA 6AT1B 4K0KJ 4OV1A 1FRJA 3MEGB 2LCWA 5J1EB 4DSJA 4Z7YA 1QE1B 3T6JA 2FVCA 3GYGA 4P52A 1IKYA 1XMQJ 2BVZA 3LPYA 4PWDA 2R7QA 3QFWA 4DV6J 5E3PA 2FJVA 4FPRA 3NLCA 1ZAWA 2VD3A 1KN6A 2MZJA 2CVIA 2JVOA 2IC3B 4OZNA 1LWCB 1B64A 4KGVB 1JLCA 1S9EB 2VC0A 5ADZA 4DR3F 1RT5A 2FZKB 1HNIB 3CCZA 3JTPA 4C48A 1X60A 2A6OA 3WC2A 3B4DA 2J7UA 4MH8A 1JLQA 2PA8D 3MMBA 3CXCR 2RHSB 4I2QA 3HLUA 4P2XA 4JI0F 3QT7A 4HACB 2W1BA 1F1BB 2C2ZB 2YNIB 3PCOB 3TP2A 1SJ3P 3KOAA 1VC0A 4X4QA 4USMA 4B9TA 4ZN3A 3DYAB 3P5TL 5A2QU 2M3DA 4DXLA 1S1WB 3JQKA 3MI7X 4X66F 5F8IA 3T5JA 1C1CA 3HF5A 3DMJA 5HMYA 1U7LA 2W01A 1S1TA 1F60B 5D77A 4CLYA 1EAYC 2V8VA 3V6DB 5IOLA 4ECWA 2OEKA 4NYPA 1VRUB 1XNRJ 1FVSA 1VRTA 1YLXA 2K1RB 4RUBA 5GADU 4ED6A 2FVPA 1KFSA 4A47A 3K5OA 1YHQS 2FGOA 2HVZA 3M2VA 4WYLA 3OL8A 3IR5B 1HI8A 2FZCB 2ROGA 2LMIA 3JB9k 2XULA 4CM2A 3VAMA 1HD1A 1S6OA 4Q45A 2APOA 2KT2A 1SJ1A 1WC0A 4L72B 4WU3A 4ZVUB 3M9MB 2OFHX 2XC9A 4KBIA 2I5JB 4U96A 2HQIA 5DJBA 1YJWS 4OV6A 4B08A 4CI0B 3H98A 4AQYJ 2OGUA 3HK2A 4CIOA 2ZOGA 4NLVA 2ZHAA 3QNWB 3U02A 2XNQA 5DQGA 2UUBJ 5D15A 1GMVA 2HBRB 3NS7B 3NGUA 1R8CA 4ANDA 3OTOJ 1CJUA 4DV4J 1FXRA 4OHVA 3MAHA 2G2ZA 3QAUA 3UCGA 1ZA2B 1F9FA 1N52B 1UWAA 1RABB 1Y5IB 2YH0A 3MM5B 4KSEB 4CTAA 1UP1A 2I1RA 3Q8UA 1FJCA 3ENQA 4RX6A 2QFJA 3SSSA 1RT7A 1T8EA 3MTJA 2BRLA 5F8HA 2DGSA 2WONA 1VQ9S 3IXQA 1T9UA 5C24A 3O2IA 4X62J 4ZPVR 3C3LA 4EK2A 3ADAC 4NLTA 4OYZA 1Q7LB 3BGUA 3KG1A 3CCWA 4FKYA 4TY8B 3R6GB 1Q8IA 1S59A 1SV5A 3AH6A 2NREA 4QU6A 4LF1A 2CPDA 4O3PA 2JWNA 1T02A 3PHTA 4F4KA 1NXIA 2QC3A 1T9XA 2VPXB 3B78A 2VBYA 3C19A 3T41A 2DEIA 1FX4A 1UA1A 2KVQE 3NGKA 1T9WA 1MU2B 4ZN1A 4J90A 2Y8YA 1TL7B 3D3CJ 2NPFA 1GMWD 3T1AA 2GAGC 3FC9A 3DLGA 2EI5A 3DFEA 3UDVA 4DU7A 5RUBA 1JLGB 3KLGB 4DS5A 2FLOA 2AYBA 1T7PA 2DPIA 2HRYA 1F5AA 1IN0A 2QLXA 3OW2R 2IJFA 5CABA 2XWXA 3IWNC 1UJ4A 1F6TA 4CLFA 2KZMA 2G0CA 2Z30B 3MURP 4EBDA 3ETMA 4MT1A 2B5JB 1RSCA 2Y8WA 1JLAB 1HL6A 3FSIA 3VAKA 1ZPWX 2LFVA 2KL8A 2MQLA 2N7YA 1FRIA 2AYEA 2VUGA 2ZOMA 3L7PA 4FVMA 2W7AA 4RL1A 1RBLA 2DH8A 2MQMA 1H38A 4UOHA 5K8MA 2XI3A 3CMES 4OI0A 4EWTA 2WSFC 4F7VA 2DIVA 2JC0A 2ZE2A 3DN9A 2E5HA 3ONQA 3GR1A 4HHUA 4PKDB 1LW2B 1HWKA 3OXFA 2NXJA 3G6XA 5HP1A 4JI8J 2KFZA 3QZ8A 4F8RA 3N6NA 1RT1A 2R8IA 3KMQA 4D3HA 3ZZRA 3PR5B 4OX7A 4B9VA 5ETRA 4IRKA 4USTA 1GXTA 4Y28C 2N82B 3CDEA 4LSLB 1HWJA 2PD1A 2QMUB 4JYAJ 2B4OA 2GJ2A 2G2YA 3A3NB 3R97A 3WX8A 4LQ9A 3HXMA 3KHRA 4F2SA 1NCLA 3SBMA 5A8WB 2YWFA 2L48A 4O4GA 3ZZTA 4GMKA 3MR5A 4FS1A 2BQRA 5E7OB 1W2BR 2CPFA 1YSJA 2JDJA 1XEZA 2KVIA 1BD6A 3M2VB 3MM7B 4QIEA 3CWJA 3Q8YA 3O6QA 4Q7AA 4PG8A 2DRBA 2ZZNA 3A12A 4OX6A 3Q2SC 4QCLA 2GVZB 3HVTA 3PW7A 4CH1A 1NBEB 4IR1A 4ZVRB 3BV8A 1WG5A 3CSKA 5C24B 5KG2A 1WELA 4MKVA 3S1TA 3FMWA 3GG0A 1XMQF 1JLFA 1S1UB 4NXMF 2J0SD 1CJVA 2XYPB 2ZUAA 4R5PB 2KG0A 2MKIA 1SV5B 2XO6A 3ZNUA 2HNYB 4X4PA 2QSWA 3ET6A 1EQ0A 2VJVA 1D9AA 1X0FA 2XHWA 3DLEA 3VGUA 3QBCA 1SIWB 1S5ZA 2XSJB 1WJ9A 1U2RA 3NAHA 3GV7B 4CLKA 3MM5A 5KT6A 3T9ZA 3IG1B 1U1PA 3AB2B 4XPCA 2CZVC 4F4ZA 4YUDA 2HWIA 3V6HA 2W7OA 2FYXA 1IJEB 1H72C 1FWLA 2GGPB 4LR7A 5G0RB 3US5A 2J9DE 3VGVA 3KLGA 1OSCA 4MK9A 1HNXF 2IA6A 4CO0A 5CYMA 3H5UA 2AX0A 3NMAA 4FXDA 3MPDA 2ZVSA 2L3MA 3MECA 4OI1A 2E7VA 4IO1A 1GH8A 5CZVA 3L7OA 4DPUA 3I32A 3BQ1A 2EFNA 3T1YF 3SV4A 2ASJA 3CNQP 2Y3YA 1N5VA 2BKNA 1L3VA 1HI1A 3KXDA 4HL9A 4ED3A 2ZHBA 1NDCA 2DPJA 1N33J 2YWKA 3KDOA 4UUXA 1LW2A 4DV6F 2I9SA 3TJ9A 5HMZA 3P5BP 2R2UA 5HP1B 2W2OP 1U1RA 3GIMA 1SJ4P 3D54A 1S77D 4QBUA 1RE1B 3PJWA 1XERA 4Y34A 3GV5B 1EKSA 2VHGA 2EK1A 2FVSA 1RHKB 3I9ZA 1FI4A 2VC1A 4JI7F 2KN4A 3HZEA 2RDDA 1LWFB 2BJ1A 3M8WA 4FNIA 2W2QP 2GQCA 2BKPA 3CDWA 3PEHA 5GAHI 3N9UC 4GKJJ 1U0HB 3KHGA 1P27B 1ROFA 4DR5J 3I0RA 1G6BA 3JYTA 1WKJA 3HCXA 5EX3A 4PWUA 2WBRA 2MQ8A 4KQZA 2IVYA 3RJMB 4USIA 4OL8A 4USVA 4J9OA 7FD1A 2BX6A 2H51B 3QT5A 2RAQA 3BPSP 3M8ZA 5DLFA 2B8QA 1N0VC 3KLIA 3GJSB 2R9LA 2YNGA 2ZITA 3GPAA 2B6AA 2E29A 3MPVA 5HQ8A 3IA0A 3DOMB 4K50A 3FZ2A 1U4BA 4DMZA 4WF9Q 2BE9B 5B08A 5J2QA 1VQ8S 1HHSA 1EJ7L 1UZHA 2K1RA 4ZCLA 1FRMA 1N8RT 3JSMB 1UETA 1KSPA 1BLUA 1RBOB 3BSAA 2V4JB 3D0HE 4EO8A 2C3YA 1HW8A 2EG1A 5EHHA 2KG1A 4W4MA 2XG8A 4IOCQ 5KG3A 4ECVA 1HYSB 1VRQC 3RRKA 3OQ2A 4DPYA 2BW2A 3CJKB 1F0XA 1T0TV 2E5IA 3AOCA 4F2RA 4TU8A 4KGZB 1IKVA 2Z0GA 4DV1J 3BSOA 1RP5A 1HR0F 2YTCA 4I0WA 4P75A 2QLJB 5LMUF 3PJXA 2FLPA 3H42A 1N5YA 2E9ZA 2HVEA 2DR9A 1RTHA 3LANA 4Y2IA 3AFGA 4M5GA 4DX5A 4C9DA 4OHYA 4WU2A 1Q81T 4I69A 5EN1A 4P72A 2R7TA 2A3JA 3M8SA 3TUIC 2HQ3A 4RW9B 1MMLA 2RQ4A 3P3DA 3V4MA 1TKDA 3BBCA 3LUYA 4OX9J 2QG9B 3GG1A 4KFBB 2DVIA 3JSBA 5K14A 3TUPA 2RH3A 2IBOA 2P8IA 1WNEA 5M2PA 2ADBA 3G8SA 1IKWA 2HHSA 4WPAA 3H20A 1UPMB 4X66J 1UVLA 4WBFA 3UCZP 1QE1A 2AJ2A 2F3JA 2KU7A 4O3SA 4FDFA 2UXDJ 3J80U 2GHWA 4PUOA 3PRVA 3PIOQ 2ZBQA 3POTA 2OPRA 1QUPA 1ZZNA 4P10A 2V6AA 2XZDB 3RBDA 2QA4G 2B7CB 2WB1D 1QM9A 2ZUGA 3BGRA 3GYXB 4KAIA 5I3QA 3H0PA 4JI5J 3GCWP 1Q5YA 3QLHA 4O44A 1GAOA 1S9EA 3B8HA 4LVNP 2HNDB 5ETTA 4BC9A 1GNKA 1W26A 2IYGA 1X9WA 1U0HA 1UEVA 2XY6A 1MU2A 1TK8A 3PFEA 5DETA 2MXYA 1K0VA 2GJIA 1MW7A 1URRA 4K2XA 3UD3P 3MOJB 1XIQA 5HJYA 1RISA 3SSQA 4PQUA 3M6WA 3F41A 2CQ1A 2XI2A 4Y65A 1EIYB 1D09B 2HFZA 5F41A 3OL9A 2RJZA 4AT1B 4RU2A 2YNGB 5I42B 4IKAA 3LQVA 1D3WA 3G82A 2X1GA 2KRRA 4ED4A 1LWFA 4ZJLA 3VGSA 2GFFA 2FHMA 1VOMA 4DPOA 1KLMA 3X1LB 3D0IE 3R5JB 1S12A 1S1XB 2ASLA 1HPZB 1VJWA 2XYGB 1OO0B 1DQ8A 2VIHA 4DV2F 2HFVA 2H54B 4HI2A 3CF5Q 3AXMA 2FTRA 4U9RA 4LFBF 4B17A 3LWMA 2LQBA 3PACA 4DI6A 3HI9A 4URGA 1UL3A 2VQFJ 4UF4A 4JV5J 3HDSA 1J5EF 3MD1A 2FD2A 1UW9A 3EZUA 2VZ9A 2EXUA 4U8VA 3HSZA 2MKKA 5B0GA 4Z37A 3EGWB 2ZH5A 5KT4A 1EARA 4CO2A 1CPZA 1RT7B 3MF5A 5L8RC 2V2QA 3U27A 1O6XA 1OPIA 2ROEA 1AFIA 1FWKA 1XMOJ 5ETPA 1ZS6A 1QSYA 1HKAA 2IM0A 3E01B 3L7UA 3DLHA 4LF9F 2C42A 4X2BA 1APSA 2OHDA 3UDCA 3C6TB 1U8WA 2P9CA 4A8OA 4F3QA 4ZITA 4P6QA 3VAJA 4G3IA 4RW9A 2JFKA 2MZTA 4O0NA 2QLFB 3T5KA 1O51A 3OXLA 1OQ3A 1HHQA 1U48A 3D6MB 2VB6A 4ZK7M 4J9SA 2FJAB 1RT4A 3NS6A 2R8JA 2WVCA 3R8YA 2B4PA 4ED0A 2IRYA 2ZJQQ 1SKRA 1B4SA 5IM0B 4ZVOB 1EB0A 2OMLA 2YQ3A 5I3UA 3THPA 3AXKA 2K3KA 2VL1A 3M8YA 3IP0A 1RDRA 1RTHB 3BDEA 2HNZB 4M5MA 2DNZA 5KFBA 5B7WA 4R5PA 4MYTA 2J6UA 4JI1J 1AW0A 4OZLA 4YOEA 1U1OA 3C14B 3VWSA 2XSJA 4QOTA 1GTHA 5CD4A 2GHPA 1BWEA 3PJ9A 2G9OA 1VIOA 3R5GA 2MKJA 2MEWA 4S0MA 3LAKA 3ICLA 5D0GA 3VF0B 5DGAA 1RWPB 4USKA 2ZM6F 3D6TB 2VA3A 5D3GA 2ZC4A 5HL7Q 4LF9J 5C42A 4ZPDA 2Z57B 4DUZF 1RJJA 4R0JA 2CZ9A 4DL4A 3M30A 4N41A 3V81A 2AKWB 2GV1A 2DXDA 1PYOB 2M70A 1WF2A 2DNOA 2XEXA 4ZP9A 1MWYA 1TKTB 2AJ1A 4NLUA 1IBKF 3L4BC 3QJLA 4DSIA 1NDPA 1OMSA 4PG6A 3BB5A 2VQFF 2XYHB 2VKRA 2OH2A 1R3NA 3D5MA 4NI2A 1RWXB 1YBAA 5T41A 1JQGA 1YDLA 3MEEA 5G4DA 4C8NA 1K47A 1UAWA 2JOQA 4IFVB 3DDIA 4F26A 2MKSA 1TUWA 3NNCA 3D68A 5IT0A 3K59A 1EHWA 3QQCD 1L3SA 1RU1A 3UO0A 1RLCL 2HGMA 2WHOA 3PYDA 2CPHA 1XR7A 4ZVSB 3W2WA 1HLWA 4DFKA 1SKSA 5JJBA 2ZWPA 1RT1B 3W9IA 2ZNZA 1URNA 1NJZA 1IKXA 1VCTA 3LH2S 2RU3A 4OFZA 2GVZA 4X4SA 4ECYA 1ZM9A 4ED7A 4AL6A 2YNFA 1JMTA 2HFNA 4NZ0A 1N5QA 2DTJA 4YHHJ 1IXKA 5DDOC 4ILLA 2DISA 4K59A 2BQUA 4TNOA 3PW0A 4ZPAA 3CO0P 3HVAA 2CPYA 3EZOA 1R27B 1PAUB 2KHDA 5LOQA 3T9NA 3Q22A 2IYIA 3DLEB 3HMJG 4IG0A 3TW0A 3HP6A 1UKUA 2K7KA 1REVB 3OXGA 2LVWA 4NLPA 1HQEB 4FZVA 2PIIA 4X4RA 4GC7A 2M2BA 4FP9A 3LPEA 3M9NB 3PKMA 3T3FA 2CYYA 3SFUA 4NLDA 4DCOB 1IQTA 2UXBF 3DM2B 5HVHA 1SVDA 4WXWA 3V4IA 3DLKB 4CO1A 3U1LA 2D9OA 2J7WA 3MEKA 3M6UA 4HLBA 4ZVPB 4DR7F 1FESA 3VTIA 4OHXA 4RW8A 2YKQA 1T3OA 2HHPA 2RHQB 4JI3J 5E3AA 1SH0A 1YKWA 3TZXA 2RVJA 3KNAA 4JOUA 1FO1A 1Q8LA 2G13A 1RWWB 2OSQA 3DGVA 4Q2MA 2ASYA 2WAQD 1JXVA 2IM1A 2BJ7A 1PBUA 3MAAA 4PPZA 4C8KA 4O3NA 2ZH8A 4YR3A 2G1DA 2BEFA 3PVXA 3SYZA 4ANCA 3G86A 1MN7A 4DV5F 2VFRA 1NHVA 1KR4A 3VAFA 3A8JA 2FHOB 2OO4A 4RKUC 3JSRA 3DMJB 3FVYA 4ID5A 4O4RA 3RB3A 4JYAF 1FWPA 4IOBA 1HWIA 1WTBA 2EW9A 5C42B 1SCJB 4FS2A 5K20B 3BPDA 3HHKA 1S6PB 3H8YA 5BXIA 4HACA 2MJNA 2HVHA 1EZZB 3BKFA 3L09A 3CDAA 1JX4A 1NKEA 1NH7A 2JSXA 2PEBA 1U26A 3CJ4A 3DU5A 3FSYA 3MR7A 5KFJA 1RT2B 1VBXA 1R8AA 4DL7A 5D0RA 4PXCA 1YRTA 3PX4A 1S97A 4LF2A 2OTLS 2PN6A 2UUCF 3ISZA 2YNFB 4CO4A 1QAXA 1RYRA 4PG5A 3ZTRA 2GO9A 4F25A 3KK3A 3QT6A 4PEOA 1ZETA 1CLFA 1LQ9A 1C1BB 2XGPA 1CS4B 3CE8A 1PILA 4XTTA 2K06A 4DL6A 1WEZA 5LXYA 4DX7A 4ZA1A 2UVUA 1SKUB 3K5MA 4M5DB 4K7QA 1U6ZA 3OFEA 2RSQA 4RBTA 2NZ4A 4NX9A 4F02A 3RB0A 4USUA 1K1SA 2MKYA 3NGSA 1BXNA 1AUDA 1QAIA 2UUWA 1AUSL 1EKRA 3TJ8A 1KVKA 1PC4A 4N56A 1HQEA 2AWZA 4JP8A 4MIWA 2MKCA 5THWA 3S7RA 2Y1IA 3PW5A 3HJFA 1RCOB 4AL5A 3DRYA 1X5SA 4DX6A 1Y5NB 3BKTA 2IJRA 2WONB 1YTYA 4IFYA 3W60A 3KLHA 5AXKA 5EWGA 1IVZA 2R7RA 3B82A 4Q2LA 3JSMA 2Y1JA 4RU9A 2VODA 1VQLS 5KG1A 4ANEA 1Q16B 2VICA 4Y00A 2LLZA 3EXYA 2CJXB 3UDLA 1FRHA 2ZDOA 2AGPA 5HATA 5D6GA 2CQ0A 3PX6A 4K4TA 4OZ2A 2UVVA 1SC3B 2EFPA 4EZ6A 2MZSA 1YJ7A 7FDRA 4ZDNA 4CLPA 4YY3F 2PE8A 1MG7A 4FF3A 2WVDA 1RTDA 5GAGU 2BRKA 4QWAA 1LFWA 3BN4A 5A8RA 3CO9A 4RW4A 4A46A 4DF8A 1XC9A 1HNVB 3W2VB 1K8AT 2J0QD 1L5UA 6FDRA 2IAJA 3WBZA 2H9ZA 1PIEA 1QLNA 2EVZA 2CWXA 2L9NA 1GT8A 1RTJB 4X65F 3WIUA 1HWUA 1NM2A 2PFDA 1IBCB 3VQSA 3DI6A 3I9V9 1NK7A 3E8OA 2JNJA 2W8LA 1H7WA 1FERA 4AQYF 1YJRA 4OZ1A 2UXCJ 1NK9A 3FDSA 4NYZA 2HHTA 5L38A 2JRSA 4I67A 2F40A 5B0EA 1TL7A 5ETKA 3PKYA 1R31A 5BR8J 3RRGA 1IJFB 3FCWA 5DG7A 2PA3A 4DL5A 3GU0A 4H54A 3G87A 4MK7A 1V9OA 2JLFA 2VKZG 5CXTA 3CDUA 4FF2A 1TP7A 1D8YA 1PO6A 4DCPB 1N36F 4RJVA 5HQMA 4OLPA 2X1FA 4OYXA 2G4BA 1NEEA 4GVBB 1RTIA 2HFUA 2VDHA 2YVSA 5IFMA 1IBMF 1HQUA 1X4EA 4DR2F 4Z7CA 2XTJP 1K9MT 1G4CA 3MGJA 5GVQA 3ZTOA 4ES1A 3H40A 3QRRA 3MCNA 5F3TA 1OY9A 2GJFA 2RNEA 2KI2A 2X1BA 3IGVA 1LW0A 2JX2A 3GSDA 3MMAA 4HTIA 2D3UA 1AA1B 3I0SA 2BANA 3TVZA 2A6MA 2ACYA 3TA1A 3PO4A 3HHDA 2KYZA 3CMAS 2ZJRQ 2B56A 4DR1F 5F8GA 3FFIA 2ATCB 2ZBPA 3BEGB 3KJNB 1U1KA 4LIRA 4JI7J 3AAWB 3P45B 1RAHB 2WCXA 3SCIE 5KFTA 3CGIA 3ZTSA 1JLFB 4DX8H 2UUAF 1UFKA 1YGYA 2QE5A 3BM7A 1YQHA 3M8PB 4LRFA 1Z2ZA 2BZ2A 3ZZUA 3QGGA 3R3TA 4X64F 4NPOA 4O0IA 2O67A 1TKZB 4QQBA 4CDIA 4J5OA 2CAJA 4WP3A 5BR8F 1VQMS 1QJHA 5L39A 1FKPB 1EQMA 1JLBB 2CQHA 5H9EJ 2C2KB 1R6VA 4DUTA 2W9BA 1F9HA 1WHVA 3TA0A 2BJEA 5J1EA 5T7LA 3H59A 1QUVA 5G0RA 3UWTA 2EWHA 1KFDA 4Y2KA 3TOQA 4J9RA 2HSEB 5F9LA 3OUYA 3TUZC 2NS1B 5A6WA 3HHNB 3B4MA 2RRNA 2FJXA 1TV6B 4ED5A 2VH7A 5JUMA 3TARA 2GHVC 3I55S 1RAFB 4MMOA 4C8ZA 1GMUA 1JLQB 2Q43A 3MMBB 3OFFA 2AJQA 1S6QA 1RT3B 3K58A 5KFVA 5J2MA 3TNVA 7AT1B 1QY7A 4G1QB 3MD3A 1WF1A 2YPYA 4OJGA 3DLKA 3I82A 4HI1A 1ZTTA 4DQRA 2GCFA 4RUCA 1G1XA 4R8UA 5HROB 3HVRA 4MIAA 1AZSB 4OYIA 2V2KA 4DFJA 2PI4A 3KUEA 2W4DA 3PYGA 4EBEA 4LFCJ 1NJYA 3CDBA 2UU9F 4MK8A 2MLXA 4GVLA 1WWHA 4IFVA 2HK2A 3KMSA 1RAEB 3CD6S 2R7VA 1I5OB 4ETXA 4XPEA 2M88A 2H5JB 3A3OB 5MAOA 3T1HJ 4NLXA 1U09A 1XNQF 1H2VZ 2HVDA 4HDHA 2IPOB 5KG0A 4M95A 2DKOB 2YNIA 1TL3A 2YX1A 3MFIA 4IO9Q 1U24A 3Q8QB 1I6JA 2NPIA 1IUJA 4NLYA 2K3IA 2OFGX 1MNEA 2O5DA 2NZCA 2L9DA 1YIJS 5CA5A 5B0DA 5M2RA 1KHVA 4ID5B 5E33A 4Y3CA 2CNNB 3N79A 4EYHB 1K0TA 3RYLA 4J9UE 1CC7A 1S1TB 2DO4A 4A8XA 4CLZA 4WIQA 3W9JA 2HHHF 4KO0B 4HTJA 1X4BA 3UE2A 1WC6A 1XMOF 2CG8A 2ZD1A 3MAQA 1N32F 5IT9U 1Q7YT 4MKBA 3M2RB 4YB5A 4IG0B 5C2CA 3W64A 3ILIA 5T14A 1YX2A 1O5JA 2YKPA 4RZRA 4U8YA 2PC6A 5DG9A 3IAM9 3K5PA 1ELOA 4DLEA 4MAKA 2JHEA 3A3PB 2LU2A 2HBQB 2KT3A 4ILRA 2YNHA 4DR2J 5KFRA 4CNYA 2RQKA 5BYQA 4FBTA 3DRPB 3HHEA 2LDYA 1JKHA 4KGXB 1YVFA 4YN3B 3JS9A 1Q53A 2F4FA 1HBUB 3U1NA 5AE1A 4QYRA 4WE1A 4QZVB 3OTOF 2DGVA 3DM2A 2K8GA 4PRFA 3H5YA 2BMBA 2ZH1A 2JFDA 2NXUA 3NCRA 4JBCA 1ZZFA 4DSEA 4HH0A 4DN9A 2D3OR 1CJUB 1E6YA 1VJQA 2QMWA 3LAMA 3O1LA 3R5CA 4F3MA 1ACMB 5BJRA 1ZYQA 4DUYF 2Y9HA 1GX5A 4ICLB 3GSIA 2PMHA 1LXJA 1VBKA 2ZKTA 3H2VE 3NXZA 5LM7E 3ZTPA 4DR5F 5LSOA 2GA7A 3KLVA 1RTZA 2ZHOA 2CQ4A 4NCBA 1FHTA 5K8NA 4IR9A 1GEHA 1HNZJ 1RADB 5JVHQ 3OUYB 2VFVA 2C2MB 4RUAA 1QD1A 2GMLA 2C3MA 5DO2A 1VQNS 1AZSA 1SPBP 1NLKL 4ZVQB 3NP5A 2R4FA 1DURA 2DRDA 2H4WB 4B3RF 3F56A 1U2FA 4ZLNA 4RNMA 3OHAA 3BGOP 3MR3A 2ADCA 2MQNA 1R6YA 3HJVA 1PYSB 3Q8VA 1FXLA 2E5GA 2YX7A 3BBFA 1BHNA 1S6QB 4HYKA 4N8OA 3OFHA 2IMOA 2LU1A 3DDNA 4LBIA 5D4OA 5J2PA 2ZEJA 2C22A 2UV8G 2RRAA 3KYLA 4X4NA 3IN5A 3FZBA 3D1QA 1PJ6A 3MR2A 4LR9A 4B3TJ 1FTRA 4F3OA 4OHWA 1WF0A 2H3EB 2W24A 4Q5VA 2BJ9A 2DGOA 2BE2B 3MM9B 2GIRA 4KGMA 1UPPA 3UDEA 3O3LA 1UCNA 4AXIA 1NRKA 4ZPWR 5AXNA 3EJMA 3T5HA 2OKQA 4DN0A 2QA2A 4RLEA 1N4LA 4PG4A 2J8SA 4DFPA 1NJXA 1Y3JA 1VR6A 4ZP8A 2WOMA 2J0WA 4HHJA 2NUHA 3FQKA 5HMWA 5M2UA 1Q8KA 3MEDB 4NLSA 3DKDA 3Q8SB 3PTWA 3DYAA 2IM2A 3ZNJ1 3QGPA 1S48A 2RB7A 4JI2J 2CIMA 2LXUA 2IM3A 3M7VA 2PI5A 3PRBA 1TVRA 1WHXA 5E2QA 2IRUA 1RTIB 1WC5A 4BCAA 5GAEU 1M5HA 3D66A 4QJVA 3TQ1A 3CT9A 1HQUB 2DHAA 3K57A 3C8YA 3OR2A 5E0OA 2ILZA 1KLMB 1KLNA 1IBKJ 4XAKA 1VQYA 1F5CA 1VRTB 3E01A 5DQHA 1CJVB 2VFSA 2ZD1B 4TYBA 3W3SA 3W9HA 3HFZB 2ABYA 3J7YI 3JAMU 4USWA 4DEZA 5ITHA 1X5TA 2XLIA 1W2IA 3GFYA 3AB4B 1F5BA 3GYNA 4RW7A 3SCJE 1Y10A 1HD0A 2A0FB 2HURA 3R1LA 2C2EA 5FJ4A 1FNXH 5BYSA 3DRPA 2HMIB 2HKEA 4FYDA 4OYOA 4J9VA 5DS7A 4WE1B 2B4VA 2XSFA 3DLBA 4Q8FA 1VQSA 1TL1B 3EPIA 2MZRA 3K8VA 2IMWP 4PWDB 1UEKA 1FDAA 5E3RA 1T3NA 2RIJA 3DRSA 2UXCF 2CJAA 4HDGA 4J7CA 3NBPA 3ET6B 1RI7A 3CJ2A 3PG9A 3RAMA 3AQPA 3N28A 1OJ4A 2ZH6A 4PCQA 2ASDA 2GIFA 3VQTA 1S10A 1KNZA 3LP2B 1RT6A 1KTQA 2QL5B 4GO7X 3C6UB 5B0FA 4OJHA 4PR6A 3FBCA 1RTDB 1BGXT 4FYWB 1TK5A 3OR1B 1A9NB 1X4GA 2FJBB 3L3CA 2NUUG 4ITSA 2CKWA 3CJTA 2QYGA 2RRBA 2EFGA 3CD5A 3EVWA 2QA1A 3C14A 3UD4P 2GVDB 2YWHA 2C3UA 2C1EB 2D7SA 1TMMA 1RCXB 2RQMA 2YKMA 3MM6A 4OQJA 2QRRA 5A2QY 4NZ6A 4USJC 1PKUA 2XLJA 3CCES 1TFYA 2HYIB 2HGNA 1XK8A 2V8GA 2VFUA 2D3O1 1RWVB 3BR9A 4V1Ak 1YJTA 1YZ7A 1NPKA 5KFAA 4CP5A 2MQPA 3JYTB 4CQ1A 2DR6A 3RAQA 4DG1A 2BOPA 3J81j 1FT8A 4KIAA 4P74A 4KR0B 4WXOA 4LF8F 2F8MA 4CRJA 1YRXA 4DV2J 3I0SB 2WW4A 1R0AB 1N48A 1A0OB 1V3SA 3PM9A 1BQNA 4Y6IA 5IWAJ 2FLLA 2V0NA 1IKXB 2QIFA 1TKXB 5H1SV 1WTFA 3FNNA 3M2UB 4OZ3A 3THTA 3ULHA 3UVJA 3VZIA 2LDIA 2DH9A 5KFDA 4OYWA 1OIAA 3MMCB 4C11B 1RAOA 3Q8RB 4RBVA 4UUWA 5L1LA 3K8WA 1FFWB 4AE5A 3MWBA 4NLOA 1G3OA 2DGXA 4OZ5A 2R8HA 3OSPA 5FLXU 1SIZA 3H5XA 3W61A 2LEAA 4PWWA 3M8PA 3PXGa 1TL3B 1ZH5A 1U02A 1Y11A 2HHUA 2YXLA 1TL5A 1H2TZ 4I6WA 1ITPA 4NL5A 4H4OB 2EK6A 2B9YA 2GIQA 4CT8A 2ALZA 3GR0A 3HSJA 4XK8C 3IRXA 3H2LA 1XR6A 2D74B 2FZGB 2Q1LA 3TAMA 4LFCF 3THVA 1C1BA 4KJIA 3KUHA 2H48B 3OLBA 3TVYA 1MMDA 3AJ2A 4QIWD 1FKAF 2V67A 5HAOA 4LMZA 4TY8A 4R0EA 4A8FA 3TX8A 3QT8A 4ZPCA 4ZOSA 1TKZA 4NA2A 1V5VA 1FE0A 4TU7A 1AXQA 2L9WA 5H9EK 4DR6F 4DL0C 1VISA 2R8GA 5A6PA 3PDNA 1FK9A 2XHCA 3CCJS 1QTNB 3JTNA 1RKJA 4LF5J 1Y3KA 4ES2A 3I56S 1ZM2A 2D1CA 3Q83A 4M5IA 2HFOA 4CTAB 2I2YA 4HVZA 1KQGB 1M1HA 1V6HA 2HS4A 2AMCB 2U2FA 3LO3A 4OX9F 5J2NA 1HQ2A 4RNFA 4U67Q 2HMIA 1W7WA 5C2GA 2QZ8A 1S1UA 9ATCB 4DSKA 4MIBA 5HMXA 5KFMA 2QGFB 1OPZA 1NU4A 1T95A 5ETNA 4FXWA 4OJ1A 3TANA 1CSJA 4P2SA 1M5PC 2OUGA 3J7YU 1IBMJ 1OY8A 4C6AA 4ICLA 3NOCA 3QO9A 1XQIA 2OPPA 2EFQA 3GE9A 4LRAA 4Y2MA 1WOOA 2VG5B 3SMZA 3U7JA 2KM8B 2RUGA 1HR0J 2CDRB 4MKYA 1JNZB 1VLYA 2F8EX 1NPPA 2BOAA 3X3UA 2VV5A 1F3VA 2D69A 4OYPA 1KQKA 2RE1A 8RUCA 3LW5C 2DNRA 3I5CA 2FUG9 4TY9A 4WP8A 4TLRA 2I0XA 4PXEA 2E5JA 2M8HA 3EDQB 1NKCA 3J81U 2Q6BA 2B9WA 2OD6A 2YWWA 3NCQA 5LL6d 4FKXA 2V94A 5C25A 1TKXA 3QMQA 1RWUA 1S57A 2GC8A 2FIUA 2LXFA 2HHVA 3BR8A 4Y2CA 2HNDA 2LXIA 3EICA 4X65J 3CCMS 4EZ9A 1Q4RA 2A2DA 5IZHA 1JLAA 3QATA 4PPDA 2K2PA 4I6YA 1CEZA 2M0GB 1IR1A 1IR0A 2CG4A 2C3PA 3V81B 1L3TA 2XM3A 1XWLA 4CWBA 3DGPB 3D67A 1C0TA 2CDQA 2GNKA 1WI8A 4B3RJ 4KPYA 3KKFA 2VPYB 3PX0A 3AJ1A 4K2JA 4KHPJ 1GMWA 2I38A 3PY8A 4M94A 2ZBRA 4N76A 4ZLJA 4LBHA 1Y0HA 2V69A 3OFGA 4MJKA 2W9CB 2B0GA 5ETQA 3R9LA 4A48A 3I0RB 3LP1A 1CULA 1RHQB 3Q23A 1WKLA 2XBPA 3BO3A 1T03B 4F04B 4ER8A 3MOZA 4CH0S 1CS4A 2B8PA 2LKZA 4F67A 1NDKA 2X3DA 3QIPB 2COLA 2FHKA 4K5SA 1VLOA 2J9EA 4RWWA 1NMEB 1JLEA 4YEAA 1JXLA 1N33F 1TZ0A 3JXOA 2DB1A 4H4MB 4I7FB 5EUHA 1NK5A 2QLBB 2V4QA 1RT4B 3UI3A 1D9FA 1RQ0A 2QEXS 3ZZZA 4NEYA 3MZIA 3KHHA 4K8RA 3KK1B 3FRZA 1LEOA 4FNHA 2DBBA 1RAAB 3EVMA 3G6ES 4DR1J 4IFYB 3KLHB 4E98A 1RZMA 3FQLA 3LGMA 1HMVB 1TK0A 1XNRF 4K4UA 4LRCA 2V4JA 2DT9A 4ZHRA 1YG0A 4CLWA 3MECB 3W8PA 4U7CA 3VAIA 4DLGA 2HHXA 2JEGA 1S1VB 4R25A 2PT0A 3M8QA 2XMWA 4HT7A 4LJMA 5HJXA 3GONA 1VK8A 1C0UA 3N6LA 1EP4B 1B0TA 2X51A 4M5HA 4LF7J 1N88A 4NMXA 2AV5A 3IG1A 5CYQB 2W4CA 5HN0A 4JV1A 3V4IB 4CM0A 5DRKA 3PZPA 3PW4A 1GXLA 1J27A 2MZQA 4KHRA 4BLGA 4N7TA 4B3OA 4LF6F 1YJUA 1QDUB 3FRYA 1IKYB 4OI2A 1YJ9S 1VBYA 3R5DA 2BDPA 1DTQA 1H6KX 2VFTA 3N6MA 3RBZA 5DG8A 1Y4ZB 4UW2A 2XS2A 1REGX 1A7GE 5MLCV 3K5LA 4HKQA 4OJ3A 2ZOFA 1WOSA 5AXLA 1KQSR 2NR0A 4QYZJ 4JI2F 2V50A 2V34A 4DV4F 3SCKE 3CD0A 3D7SB 3CJ8A 2CPZA 3DDKA 4WFBQ 3PYEA 2UP1A 1G7CB 2J6SA 2HQGA 1U25A 4YDXA 4RBUA 2CNOB 3V2UC 3KJVA 4B3TF 1R0CB 2WOMB 3GMGA 1JLGA 3Q86A 3EGNA 4M5LA 4IRDA 2N3OA 2FDNA 1X5OA 3DU6A 4DV7J 4DV0J 3G9CA 1UJ6A 3FEZA 1LW0B 3MMAB 2XZTB 1Z4UA 4HR2A 5DZ7A 5A0YB 4USHA 3QRPA 3P6YC 3CCLS 2QX0A 4O3RA 2DHHA 2R3VA 2J76E 2YPZA 1D1UA 2VBZA 5KOWA 3WC0A 3WDOA 2Q3PA 3ENVA 5FDLB 2DR5A 1UVKA 1U45A 2XMKA 3IM8A 2VJUA 1FF2A 5F8JA 2ZZTA 3GIKA 1VI7A 3G4SS 3TRGA 2UUCJ 4OI3A 2Y1RI 2W8KA 1SUQA 3BO4A 2LP4A 5CCMA 3VZHA 1N34F 1N32J 4C0BA 4X4VA 3DLGB 4LR8A 4PQUB 3S01A 1DTTB 4DV3F 1BE4A 2HQFA 2MSSA 4OI6A 4ZVFA 3ZZ0A 1JJHA 1NK8A 1KWMA 3D6FB 5KFNA 4WK3A 1FEEA 1CJTB 1UWBA 2DHSA 3LWLA 4IUFA 3Q8PB 2RF2A 4NRTA 1XBWA 3C16A 5ETLA 2GAHC 2ZH2A 2VBWA 5GAHU 1WOPA 2XGQA 4RW6A 3B54A 3PNIA 4CT9A 1S1XA 2HZCA 1TFWA 3HULA 4BWMA 1XTZA 2MHEA 3M4XA 4ECRA 3T5LA 2OJ3A 3AQOA 4NCGA 4FYVB 3KK2B 2DNNA 2MLYA 4DV7F 3T1HF 3D0GE 1NSAA 2WK4A 4KV8B 2C2RA 3NS5A 4WKYA 5HVFA 1IQZA 1S1VA 2RT3A 1FJGJ 4PXDA 2XCAA 1HBOB 1CQMA 5HI7A 2J8AA 4RW8B 4H4MA 4I7FA 5L1JA 3RRHA 5K14B 4ELVA 2Z58B 1S0VA 4WZQA 3QFHA 8ATCB 4YS2A 1IKWB 5EDWA 4V19X 3MR6A 2IBKA 2Z2ZA 2CQ3A 3OR1A 3EUNA 4B02A 3LF0A 3KG4A 1UVNA 4DR7J 1RAIB 2HK3A 4QPXA 1LXNA 1FRKA 1XMBA 2LQ9A 3OD2A 1X8DA 4HH1A 4X84A 2OSRA 3BGRB 5KG4A 4Q44A 1SBRA 4DFMA 3BBBA 1VQKS 5KTQA 4I2PB 2DNMA 3QLHB 4O44B 2HHHJ 4LF7F 3HKWA 4IDKB 3TEHB 1P6TA 2B5JA 2CFXA 4C0HA 2OD4A 2N7CA 2L41A 3CVKA 1N6QB 4ZPBA 5HVGA 4YFUA 4ELTA 2DIUA 2KXFA 1RA7A 1PSDA 4QIGA 1S9GA 2L08A 1S76D 4E2FB 2DYAA 5JMNA 4C8LA 2HNZA 2AZ1A 3G6VA 2OELA 4A8SA 1VC5A 3AY0A 3SZ2A 1PBAA 1OYEA 3RZAA 2OPPB 3IGNA 2MY7A 4ZP6A 1RT5B 3T19A 3M32B 3UVJB 4DDFA 4C3LA 3MPYA 4I56A 2MZ1A 2W2NP 2G0IA 2CWKA 4NA1A 5KFZA 2MMYA 3GFHA 5KFOA 5D3GB 1KRPA 5CHCB 2RS2A 3W7BA 2V8DA 3W63A 3NCPA 3P4UB 1T05A 3ENAA 1HNWF 2AW0A 1BUXA 3BSCA 2M7SA 1DLOA 4KT0C 4N77A 2BM1A 4KH1B 5A8WA 5GADI 4UY85 4DG1B 2FGCA 1SQEA 3E51A 1DARA 3KDNA 3NWRA 4C98A 4TVAB 1X7VA 4NWBA 4DPXA 3KLEB 1X5PA 1FDNA 1J5OB 2OP5A 2AYGA 1S99A 4B3SF 4K4VA 2ACMA 2XNRA 2PEHA 1JLCB 2ROPA 4ZPTR 3R7NB 4ED1A 1P9QC 5FDLA 1RWNB 2VQEF 3J7AN 1N34J 2NLWA 4F4AA 2IJNA 3CPWR 1FXDA 3BKUA 5DQIA 3FK4A 2BE7D 2H1YA 3RBEA 1SQFA 4NA3A 1HW9A 2GW8A 2OPQA 3F73A 2E7WA 2YWGA 8AT1B 3MEDA 3SEOA 2AYMA 2VOOA 2R7UA 4F36A 3QRQA 4JI4F 5KOXA 3BH6B 3ZZYA 4NLRA 4JV0A 3OJSA 2NQPA 3NL0A 2HS0A 3V5RA 1LOUA 1U1MA 5AJ3F 1Y9OA 4DPWA 1FA0A 4DV5J 2DNYA 3FBFA 1CJTA 1NNDA 1UWBB 2RILA 2WB4A 4OLOA 4OZJA 2E1MC 4UQGA 1HYSA 3GFZA 5I4MA 4J9KA 1O8BA 3I96A 3J7Z5 4LF4J 2UXBJ 2W9AA 4NMLA 4OMFG 2RUSA 3KG0A 3HFKA 4WFXA 2ZFHA 4ZLPA 3FEYB 5ETOA 2WSCC 4RNNA 3CUNA 2KHCA 2QTWA 3PRDA 3SDEB 2Z8QA 2F4VF 2UUAJ 1FE4A 3CJ3A 5IT4A 3C46A 2V63A 4DS4A 2BJ8A 3I4HX 2XMAA 3WHIA 2B7BB 1VQ7S 4JV2A 1FKOB 2DY9A 1MROB 4MFBA 4AFFA 6FD1A 5LSRA 2LEBA 4F4XA 1MSWD 5KFUA 3FMBA 1S0MA 5KT3A 2Z2MA 1GQEA 1HA1A 3FKBA 2HLUA 2QV6A 3MHYA 3MEGA 1IM4A 4Y2AA 4DU8A 4KH0B 3OVAA 3BYRA 4P9SA 4DF4A 3MDFA 4GO5X 1QTMA 1B99A 1NUEA 3GJTB 3RR8A 1WKKA 4LRDA 3UD5A 3JQJA 5IWAF 2IC3A 2N3LA 4KFBA 3HHLC 4IDKA 1HNIA 4C3MA 3OV7A 2H4YB 2J0XA 3S6EA 4U6PA 2HPUA 1IBLJ 2BABA 2GX8A 2EFOA 1K73T 4OYAA 4CCHA 3FSXA 2IFXA 2YQ0A 2B3TB 2DGUA 4YB1P 3A8EA 3MCSA 3TZWA 2PDAA 3GWCA 3IFEA 3PHEA 3W2WB 5F3ZA 1UVJA 1J5OA 3KLIB 2WSEC 4G1IA 3GTYX 4JB8B 2W2PP 2XQCA 4P2MA 2IY5B 4C0OC 2F9DA 2FHJA 4YR0A 4DOZA 3HD2A 4M63A 4FYXB 4GVBA 4YHHF 3ILJA 4ECSA 4L73A 1L3UA 3C66A 3MEEB 3A8KA 2PO4A 2DGWA 1T05B 2BKOA 2IVFB 3BO2A 3QSIA 2J9DA 2AGQA 2P9EA 3IM9A 3DRXA 3KFWX 3M1VA 5HLFA 1JLEB 1RXOB 2KDOA 2YKOA 4C3KA 2V8PA 2FPHX 3O44A 2N4DA 4F4YA 4IG3A 2A18A 1JLBA 1WG4A 2YH1A 4PABA 1I94F 3DCAA 4LF5F 3HT0A 2Q6CA 4K4SA 4OI4A 5CZXA 4C4WA 2V9KA 1HPZA 3DXSX 2OMOA 1NK6A 4LSNB 1SL2A 4WFZA 1HMVA 1XJWB 4JI5F 1WUUA 1WEYA 1IWAA 4NYOA 4DQPA 1V3RA 4ED8A 2LA6A 1SH2A 4L3NA 1ICEB 1NHKL 2NYHA 1T9TA 3NBPB 3HSDA 3ZXWA 2XCPA 2X1AA 2GQQA 2F7VA 1Q95G 4E0DA 3IS9A 2HAIA 5E3QA 2EKYA 1IWGA 3LGNA 2J9CA 2HBZB 2OI2A 3KNGA 3HVTB 3LGHA 4RW7B 4EMDA 2E1CA 3C15A 1KVJA 2CNKB 2W9BB 3TAPA 3O5TB 1HBMA 2IDEA 1S6UA 3U1MA 1QAJA 5T7LB 2MGZA 1M1KT 1M5VC 3T6BA 3TUJC 4MKAA 5LMNJ 4JI3F 2RMLA 1DQAA 4DPTA 2D9PA 4L6V3 1S7IA 3TWZA 4ZHRB 3CEDA 5DDPC 2DNQA 1DZ5A 2D41A 3GB0A 1Q82T 2ZH4A 2YQ1A 4FXVA 3M8RA 3UN2A 3D4JA 1NSPA 2R2SA 4K4XA 5HK4A 4MFBB 3ISND 2EC0A 3P96A 4LQ3A 3QGHA 2LQJA 4QW9A 5IM0A 1NH8A 4DV3J 4EYIB 1B3TA 4RW4B 2CADA 3UR3C 1SC4B 4QR2A 3TYTA 4EEYA 1DQ9A 4RPFA 2JZ5A 4KKOB 4ECUA 3AD7C 1WC1A 4WFNQ 2KRBA 1TMJA 2E1RA 4KHPF 1NJIT 4W90B 4YMEA 1BQNB 4R8UB 1FDBA 2GMHA 2OAUA 4ZVTB 1JWWA 2O01C 1C4AA 4CLLA 5DM7Q 4LF6J 3PO5A 2KT5A 5F8NA 4KB7A 5BYRA 4J9QA 5IC4B 5B0BA 1NK4A 5JXSA 4WFAQ 2NXCA 4GRSA 3FCVA 4M5KA 4WP9A 1R0BG 1KD1T 2GS8A 3J80Y 4YR2A 3R7BB 3EX7B 5CAAA 1WI6A 3M6VA 2DHXA 4DHVA 5EWEA 1M5OC 2EBEA 3GJQB 2UUBF 3UCUP 4KC5A 1RHRB 4CYUA 2KO1A 4OIXA 5CYMB 4FPIA 1OS5A 2NCKL 2Q79A 1O0PA 4P71A 1TKTA 3EPGA 2CVEA 4UOCA 5A0YA 4DL3A 2GO8A 4GC6A 2VDIA 4ECQA 2VQEJ 3R2CJ 4Q0BB 1C1CB 5E5NA 4F4WA 4A8MP 3M2UA 1HBNB 3V6DA 5HBMB 1VQ6S 2YKNB 4KTQA 1C4CA 4M1KA 4QWEA 2V9WA 1B7FA 1JJCB 1U8SA 1UA0A 2G0JA 1FD8A 4ERDA 1RHJB 1LWEB 2DH7A 3BREA 2GMJA 4ZMMA 2CQGA 3EVOA 3BQ2A 1VQOS 4J9MA 3FUYA 3GILA 3IS9B 2OPSB 3MCMA 3W5YA 2R7XA 3Q0AA 1RU2A 4KYZA 1FK9B 3GZ7A 5JVGQ 1YK9A 3P49B 2O1PA 1CG2A 1N54B 4ATNA 1GFWB 2CQBA 1ZTWA 3G8QA 4IH6A 4KRWA 4XDDA 3CJRA 1DHMA 2JLEA 4LF4F 1X4HA 2HG4A 2VF3A 1FDDA 1WG1A 4KE5A 2ZDPA 1WHWA 2KZZA 4NLQA 3CJSA 3RGIA 1VRUA 3QGIA 4FYYB 3TEGA 3I31A 2CUYA 2B9EA 4QR1A 4I6AA 2IDLA 2J7KA 4XO0A 1E6YB 4NXNJ 2WVFA 4YB6A 3ZZPA 1U0SA 3TR5A 1UVMA 4B9LA 3CMQA 1S79A 3DLJA 1B7YB 1E6VA 1HHTP 4C97A 2ZBIA 1V3ZA 4K5RA 3S8SA 2EBGA 3WQPA 1S9GB 4YP3A 3KK1A 1VQPS 5K8OA 1VGYA 3W8GA 5KFEA 1DAXA 5LXRA 2Y0SD 3VHQA 3VVUA 2DCUB 2FC8A 3Q89A 1UFWA 1RACB 5LMUJ 3W2VA 5CCLA 1B70B 1TV6A 2CZ4A 4ECTA 4ED2A 3MCOA 2EFVA 4ZVHA 1EX8A 5U47A 3CC7S 3VGTA 4F0HA 3EYZA 2CRLA 5KAKA 1P1TA 3R5AA 1U1LA 1MROA 1PYTA 1UFLA 3BGFA 1X31C 4NI2B 2VG5A 3AHPA 1DY3A 3MPWA 4WJBA 4F0MA 3Q2TC 5CYQA 2JEIA 2XS7A 4P7TA 3NY0A 1Q78A 5D4PA 4K4ZA 1H73A 1EETA 5KFLA 1R89A 1T9YA 1N5YB 3BYPA 1M90T 2HQDA 4IH5A 2CPEA 2OPRB 4H4KA 4RWXA 5EX0A 3VCDA 5LJ3Y 5DDRC 3BN7A 4LF8J 3R5BA 4PQAA 2VASA 1LNQA 4WIIA 1SC1B 4JI6J 3PW2A 2WW8A 4PYDA 1NKBA 1WSVA 3NGRA 1FFGB 4TQSA 2YKNA 3GIJA 1IBLF 1YRUA 5D78A 4DQSA 4FF1A 5AE2A 1G2EA 5IQ6A 2DGQA 3ETOA 2B4UA 4QPTA 4B9SA 1VFJA 5AJ3J 1X4CA 2OEMA 3V6KA 2DR8A 2R7OA 4LSZB 2I6WA 2AU0A 4UZBA 1S4FA 1HNZF 2QT7A 2VG7A 5J2QB 2UV8A 2AJFE 3IRWP 3HT3A 4ECZA 1UJ5A 5CYJA 2M8DB 1RBAA 2ZKUA 5LJ5Y 3UQSA 2ZVIA 4LRBA 1ULRA 2NYIA 3LA0A 2F4VJ 2DCLA 4FVCA 5KG5A 5L1IA 1I1GA 1CVJA 3ZZOA 1ZAVA 2E9RX 3F0NA 3OR2B 4ZKAA 1NJWA 3B6BA 1FCAA 1L3KA 3Q24A 3MUMP 1TL1A 2XWYA 3AD9C 3BZQA 4ALZA 2AEFA 2R42A 1A6LA 1RWMB 3TX0A 1FJGF 4BDPA 1LWEA 2FHJD 2C2OB 2MKHA 5DZ6A 5F0UA 2DHGA 1AYEA 5H9FJ 5IQQA 3NGDA 5KT5A 4IYQA 5D8HB 2XLKA 1FKPA 2HAFA 4XDCA 5IXUA 4NZ7A 2AEMA 3SIPB 4ZCIA 4RW6B 3LP2A 3AT1B 4O3QA 3ZC4A 3VAHA 1FFSB 1YZ6A 1RT3A 2AD9A 1Q8BA 1J5EJ 5DLGA 4LSLA 4MYUA 2XY5A 4IQXA 2VOPA 1VIXA 1H3DA 4UOFA 2EEYA 2CQPA 4IQMA 1F2GA 1DTQB 1ZA1B 2RKIB 2HS3A 1KVIA 2G2OA 1R7IA 3H4DA 1I94J 2ATLA 1NDLA 1HNXJ 2PFFB 1NAQA 2AX1A 3MM6B 3PV8A 1CBKA 3IR7B 4EI2A 5HQLA 1C0UB 2CJQA 1YWXA 4KGKA 3CJ0A 1HBMB 5DGBA 1Q79A 4U7UD 2HEKA 4QIFA 1KTVA 4Y0FA 4NXMJ 3D3BJ 1KBRA 5FD1A 2MGZB 4LFBJ 2ZJPQ 4BBYA 3SQOP 1S4EA 5J2MB 1RWOB 2FLNA 1R43A 2BA9A 1DFDA 1CQNA 1V5IB 2LQ5A 3FBBA 3MMJA 1X9MA 3BDPA 3UPFA 2VG6A 3OTDA 2CQDA 2DNHA 2HNYA 2HZAA 2VU5A 3HHLD 3OHBA 2E9TA 1K1QA 3QJJA 1MLAA 2UZAA 2HHQA 5KFKA 1HI0P 4IRCA 4C8YA 5D0HA 2Q66A 3IAS9 4WFYA 4ENOA 4DCJB 4PXBA 5L1KA 2M5YA 2YKMB 4OX8A 4YB7A 2R7WA 2UU9J 3K7RA 1SB6A 2HW3A 2KH9A 1AB8A 1UTAA 3OT9A 1SUQB 3DOKA 4KO0A 1VHFA 5B09A 2CJKA 5A8RB 3CCRS 1EETB 3ILLA 2CA9A 2MB0B 5A8KB 2WZ1A 3TVKA 1S6PA 5KFCA 2R8KA 2C28A 1VC6A 1KDNA 3N5FA 1R8HA 3R2DJ 2AJ0A 2DGTA 1OQ6A 1Z2LA 3EWGA 4MTPA 4RR5A 1LFPA 4IG3B 1NZ8A 3W5ZA 3M32A 3OL6A 2PMWA 2P6SA 1LWCA 2YWEA 3C16B 3TAQA 3J7ZT 2JLGA 2HFSA 1WD6A 3SQGB 2YNHB 4TQRA 2VPWB 4ZLLA 3DI6B 4LIWA 2F65A 5K9FA 1QSSA 1W25A 3WZ0A 2JEJA 2KJVA 5ETMA 1LK7A 5D4LA 1R8PA 2WBMA 2YKAA 4A4JA 3KTQA 3QYYA 4YDDB 1YBUA 4CYUB 2HHWA 3N0VA 3OSNA 4KV8A 4WKRA 3DGPA 1VYAA 3HHLA 2HZVA 4UT4A 3TI0A 4O4GB 3OLAA 4DWIA 3J7A1 1KP6A 4DZ6A 5HANA 3M2RA 3NGTA 1SJFA 3HSGA 3AJDA 2DO0A 4LREA 4C2MA 2HGLA 3DHXA 3VV2B 3H7HB 3OTCA 2IA0A 3SCLE 5L46A 2VONA 1LKZA 3FFIB 2DNGA 5HBMA 3JQMA 2V2ZA 3QWUA 4OYMA 3TZYA 1VHIA 4BS2A 5KFSA 4BC7A 3TAMB 4OHZA 4DR3J 3DC2A 3TA2A 2P9GA 1HNWJ 1S49A 3CCVS 3W5XA 3LP0B 4DUYJ 2PSZA 2BQ3A 2YBVA 4I4BA 2PMZD 4CZCA 3K0JA 3O8WA 3NNHA 3CULA 2FY1A 2AHOB 3CCUS 2UVRA 2DJWA 5AXMA 1M5KC 3KWMA 3PFOA 3QSYB 1HBOA 1Y00A 2QL7B 1SKWA 1RAJA 4NRUA 5FLXY 2KB2A 2B6AB 1K44A 1TL4A 3QIDA 4U7UK 3CCSS 1SH3A 4LUBA 1N5SA 4X4TA 1TUGB 2DNPA 3IWLA 1WC3A 3LOUA 3MM8B 3VALA 4J9NA 3G2XA 2Z2LA 3IC1A 3RUBL 3RR7A 1VK3A 2DRAA 1HNVA 4NOHA 5L9XA 1RHUB 3QWPA 2E5LF 3A13A 4I1TA 2MHNA 3HM9A 4DR4J 1UMJA 5E3CA 3RB6A 3LTOA 3NKYA 2HVIA 3ISNC 2QN6B 2M52A 3CCQS 3QO9B 3EM1A 5GMEA 2NXNA 3R7SB 2FY8A 1T11A 2DXFA 2IRXA 3QZ7A 4B3MJ 2SXLA 1JB0C 4JI0J 2MSTA 1JK9B 4RNHA 4X64J 1DBDA 2CPXA 4ETZA 2ERRA 1Q0NA 3GJRB 2BR0A 4ZCKA 5GMDA 4PYAA 1TELA 3EGVA 1N36J 3I5BA 2DR7A 1B0VA 3P8BB 4O3OA 2AP6A 2KYXA 2Y1LB 2UUTA 1P8GA 2ZH3A 4DV0F 5C5JA 2Z4PA 2MJUA 4I68A 4K4WA 2X7IA 4AYBD 4LVOP 4DUZJ 1S9FA 5I3PA 1RUSA 3M6XA 4KPCA 5KFQA 4J9LA 2R7SA 2KM8C 4W98A 2DEJA 3UNGC 1QVFR 4AXJA 2AIRB 3CJQA 1J2VA 1VBZA 4ZCMA 3LP1B 1P1LA 2D3ZA 2EPIA 2OPQB 3IO1A 2JJ4D 4URSA 3W65A 1X4FA 2M4MA 1ZBTA 2U1AA 4WTYA 4LFAF 1RKIA 5K5MA 4F0KA 2ZC3A 3MAAB 2V5HG 3AA9A 3OTEA 4CO5A 3QJPA 5B0AA 3POTB 3UNYA 1UZDA 2EKNA 4CO3A 3I6PA 1C2PA 2V4RA 4ELUA 1MWZA 2NSBA 2CQCA 2UVWA 2OEJA 3AOBA 1AROP 1AFJA 1KONA 4YY3J 3RTVA 3D2WA 2O3DA 4O23A 1D0EA 2CXEA 3CIMA 2EG2A 3WIVA 2MQQA 3JSYA 4X62F 2BV3A 2F8HA 1UW4A 4G1PA 3VAGA 3W66A 3D1OA 4ZJQA 2DNLA 2FJEB 1F2HA 1T9VA 3K89A 1RLDA 3GCXP 3BJYA 1FD2A 3ILOA 4P2FA 3JAMY 5HLFB 1X9SA 1QAYA 4DZDA 1DJ0A 4A8WA 1LWXA 3QIPA 4B9NA 4JI6F 4FN5A 1WEXA 3OPKA 4LT6A 1SC6A 1Q86T 5GAEI
chains in the Genus database with same CATH topology
3DOMB 3DGPB 2JNJA 1YDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOM B;  3DGP B;  2JNJ A;  1YDL A; 
#chains in the Genus database with same CATH topology
 2CPI A;  1PJ7 A;  1REV A;  3CD7 A;  3IRX B;  3C6U A;  1JKH B;  5GAG I;  1TTH B;  1N0U A;  3MTK A;  3UFC X;  2LEP A;  2Z2Y B;  3OJU A;  1MMN A;  4BWJ A;  4TN2 A;  1YBT A;  3MUV P;  1VS3 A;  4AUK A;  4QWD A;  3HPO A;  3G71 S;  4ECX A;  2RDI A;  3H25 A;  3EDR B;  4A8K A;  3LP0 A;  2CJ9 A;  3EXC X;  1M5S A;  2W25 A;  3DRS B;  4G6V B;  1S0O A;  1HWL A;  1RA6 A;  2AF6 A;  2GVD A;  2QJ3 A;  1M1G A;  4DQQ A;  1PGZ A;  4OZ0 A;  3HFV A;  1Y7P A;  2FVR A;  2OLW A;  1S0N A;  3TZZ A;  1TR0 A;  4WWS A;  2AGO A;  2MY8 A;  3RU0 A;  4J91 A;  5CH7 B;  2AEJ A;  5KFI A;  2P2C B;  2B9X A;  5AE3 A;  2HBY B;  1HAR A;  4D3G A;  1FNO A;  1KS2 A;  1D8Z A;  1SJR A;  4G1Q A;  1RGV A;  4JI8 F;  4CNZ A;  3AOD A;  4QYZ K;  3PYF A;  2H5I B;  3IBW A;  4TYA A;  2GQ2 A;  4YQW A;  2ZZM A;  2VBX A;  3D1H A;  4EUV A;  4F50 A;  1FRX A;  1IM6 A;  2AZ3 A;  3L95 X;  2QFI A;  3MXH P;  3MUT P;  2G1H A;  1TQL A;  2K7J A;  2AJ4 A;  1NSQ A;  1RB0 A;  3SSR A;  1N6Q A;  1FJE B;  4NXN F;  2LA4 A;  1ZAX A;  1PG5 B;  4IOA Q;  1TU0 B;  3DLL Q;  4NCA A;  9RUB A;  3NNA A;  2XS5 A;  5HRO A;  1ZPV A;  4ZVG A;  4TU9 A;  1XNQ J;  1DRZ A;  2KTQ A;  1I3O B;  4ZIW A;  3M05 A;  3M1V B;  1HFE L;  5ETV A;  2ZE2 B;  2VG7 B;  5IS2 A;  1PJ5 A;  2VG6 B;  5KFW A;  4C8O A;  2LYV A;  3DRR B;  3ZTQ A;  2M9K A;  1F3F A;  1R0A A;  2JC1 A;  5AT1 B;  2FJD B;  1X4A A;  3ITH A;  5J1N A;  2ZH7 A;  3D6H B;  3UN3 A;  3SV3 A;  4FBU A;  1XN9 A;  3CB4 A;  3GFX A;  5CD4 H;  1FNM A;  4FF4 A;  3SI8 A;  5KT7 A;  1KEK A;  4GKK J;  2HWT A;  3E3X A;  3H2U B;  4Q8E A;  4V19 J;  3HD1 A;  3QPI A;  4M8L A;  4NLG A;  5F0W A;  1KQF B;  1U2C A;  4JUZ A;  3KK2 A;  2H65 B;  2VA2 A;  4DBQ A;  3PR4 A;  5J2P B;  2HQC A;  2JL9 A;  2BAC A;  1CJK B;  4XIU A;  2W2M P;  4PG7 A;  3FBE A;  3IBC B;  5A76 A;  1RWK B;  2BM0 A;  1ZOT A;  2HRU A;  3HKZ D;  4M5D A;  2BAN B;  2KKH A;  3A4T A;  1TVR B;  3UR0 A;  5DM6 Q;  1WSR A;  2JEF A;  3ZO7 A;  4OYB A;  2QYC A;  1MN9 A;  1TAQ A;  3DOM A;  2BE2 A;  2MLZ A;  3C15 B;  3MM9 A;  1U6B A;  1BY9 A;  4N8N A;  4EBC A;  3KLF B;  2CNL B;  2V68 A;  2UXD F;  1KHW A;  3T1Y J;  2FQQ B;  1RHM B;  3AD8 C;  3NG8 A;  1YIT S;  3H5S A;  3OVS A;  4Q43 A;  4HEA 9;  1S72 S;  2EC2 A;  1M0S A;  1OY6 A;  3EMT A;  2ZWO A;  1H98 A;  1PAE X;  4AD6 A;  2CJY B;  4C8M A;  3VR1 A;  3CTR A;  3I5A A;  2E7X A;  3MPU B;  5IT9 Y;  3EZ5 A;  2KJW A;  2NXE A;  3W62 A;  2E1P A;  2AQ4 A;  5C7P A;  4B9M A;  2QL9 B;  3DOL B;  3IWX A;  4EU0 A;  4UZC A;  3CC4 S;  2C2N A;  1U1Q A;  1H7X A;  1NO8 A;  4WTO B;  3RW6 A;  2XO7 A;  5K8P A;  1U49 A;  1S7H A;  2A2C A;  1WC4 A;  2MTL A;  2GGP A;  4KKO A;  4M5J A;  1U47 A;  5F9N A;  1TAU A;  2W4P A;  2C3O A;  5KT2 A;  1AT1 B;  2XY7 A;  1XR5 A;  4QW8 A;  2HIY A;  2ZH9 A;  1QVG R;  2FVQ A;  1FRL A;  5C25 B;  2YY3 A;  3A8I A;  3BS9 A;  4B3M F;  1U6F A;  2XMU A;  3QAE A;  4ZVE A;  2W7P A;  4B9U A;  1JXE A;  3ELH A;  4NAS A;  3I4P A;  1EP4 A;  2DIT A;  2KXN B;  5D0E A;  4QWB A;  3AA8 A;  1NK0 A;  5LMN F;  4UQT A;  3R27 A;  3BGL A;  5KG6 A;  1BC6 A;  4KHM A;  5E41 A;  1DLO B;  1JNR B;  1R8B A;  4B3O B;  4I2Q B;  2KFN A;  1NPR A;  1Q5V A;  2HRT A;  3FGV A;  1SQG A;  1KOO A;  4ES3 A;  2XMM A;  3DRR A;  1Z1Z A;  5KFF A;  3A1Y G;  3VVT A;  5IV3 A;  2QSF A;  2WVB A;  2Z56 B;  3TO8 A;  4DR6 J;  1YJV A;  3SXL A;  1S1W A;  2RD5 C;  4HHH A;  2PGC A;  3UN5 A;  1RT6 B;  1WHY A;  1GK8 A;  2IIH A;  3WX4 A;  3K2Y A;  1MWQ A;  5H9F K;  2Y0B B;  3CC2 S;  4CLU A;  3DOK B;  3F44 A;  4DSF A;  3OVB A;  4ZJO A;  2NSC A;  4NE9 C;  4ZS6 A;  3R6L B;  2POK A;  3N5B A;  5L9N A;  3G96 A;  1KKH A;  2J5A A;  4QIV A;  2RS8 A;  5A8K A;  1JJ2 R;  4JI1 F;  3BQ0 A;  3C2P A;  1ZM4 A;  4PUO B;  3NOG A;  3FEX B;  2A10 A;  4HT5 A;  1N5T A;  2QMX A;  5DDQ C;  1FJ7 A;  1C0T B;  1Q1K A;  2P6T A;  3KLE A;  3KUG A;  3OTB A;  4BHQ A;  2AT1 B;  3TJA A;  1FVQ A;  3ITH B;  3GLJ A;  2BBE A;  3SQG A;  5KFG A;  5SUH A;  2CPJ A;  5EWF A;  2R2T A;  1HBN A;  1GX6 A;  5KFX A;  1VDH A;  4WK1 A;  2FJW A;  3KK3 B;  4QWC A;  4K4Y A;  1FX2 A;  2HWH A;  3NRB A;  1BQX A;  4PZV A;  3TQE A;  4RNO A;  3IR6 B;  1VMB A;  2F5G A;  4KY3 A;  4DV1 F;  3DNC A;  3UW1 A;  1KC8 T;  1UEU A;  1HIY A;  3IBF B;  4TLQ A;  2XZW A;  3HVW A;  1NZA A;  3M8Q B;  3G6Y A;  3K5N A;  3K17 A;  2WTF A;  3BSN A;  2OPS A;  3H4B A;  3CJK A;  3DOL A;  4X4U A;  5I42 A;  1BQM B;  2CJB A;  4PAA A;  1N56 A;  1BMQ B;  1X4D A;  2ALY B;  4JI4 J;  5KFY A;  3RBX A;  3KLF A;  4NCG B;  2J6T A;  3GQC A;  2ZM6 J;  2LEC A;  2JH3 A;  2ZBC A;  3NEK A;  2RQC A;  3SFG A;  3NAI A;  1H0H B;  1ZM3 A;  4UOG A;  2DXE A;  3EGZ A;  4ID8 A;  5F8L A;  3ENW A;  1UVI A;  4L75 A;  1BWV A;  3KHL A;  3FJ2 A;  4A8Q A;  3DHW C;  4B3S J;  3HX9 A;  2BW7 A;  1F9E B;  1FKO A;  4N5S A;  5J2N B;  2OIH A;  2BUN A;  2E44 A;  5EGY A;  5J1P A;  5KFP A;  4UY8 T;  3N4W A;  4E8U A;  1LK5 A;  1FEH A;  2E66 A;  3MM8 A;  1NHU A;  3G8T A;  1FTC A;  2B43 A;  2DY1 A;  1KOH A;  1JIH A;  2RKI A;  3DXB A;  1SXL A;  3EE3 A;  2A1B A;  2BJD A;  4M5N A;  2FB0 A;  2IAJ B;  4URQ U;  2V2V A;  5B0C A;  5HSP A;  3GV8 B;  1X0P A;  2HIQ A;  3BF4 A;  3PIP Q;  3C6T A;  3RAX A;  1OYD A;  3HZG A;  5GMK a;  1SJQ A;  1YI2 S;  5KFH A;  2XMJ A;  2FC9 A;  4W92 B;  3D28 A;  1SL0 A;  1IR2 A;  2C2D A;  1WAC A;  2F63 A;  4G65 A;  1RYS A;  4NLW A;  5CQG A;  2ILY A;  2V8H A;  1OSD A;  3M30 B;  5I3U B;  3KJV B;  1VQ5 S;  4TKT A;  1DTT A;  1PC5 A;  5ETS A;  3RG6 A;  4TXS A;  3OL7 A;  1SL1 A;  2XB2 D;  2KFY A;  2X3G A;  3IMQ J;  4L74 A;  1JJ4 A;  4JV5 F;  2XMT A;  4QR0 A;  4IH7 A;  4H4O A;  2BXJ A;  3CW2 C;  1PCA A;  2CQI A;  1RT2 A;  1SI9 A;  5IC6 B;  4RUH A;  1QSL A;  4QU7 A;  3G82 B;  3D9B A;  3KJF B;  1LV5 A;  2CQ2 A;  5FII A;  2VPZ B;  3MMC A;  4C11 A;  3GIR A;  4U95 A;  5F8M A;  3J81 Y;  2IVM A;  3NWG A;  4NEZ A;  1P9Y A;  4J37 A;  4J9P A;  1T94 A;  5SZT A;  2I8E A;  1NB2 A;  4EGL A;  3KJQ B;  4DQI A;  2HLT A;  1YJN S;  1CC8 A;  2P5V A;  2LQ8 A;  3MM7 A;  1RAG B;  2F9J A;  2GZO A;  3PEJ A;  4Q0B A;  4Z2X A;  3M9O B;  2RF2 B;  1H2U X;  1GTE A;  2I5J A;  2R2R A;  1U1N A;  2DNK A;  2WRM A;  5LT5 A;  2W9C A;  4GKK F;  1I51 B;  4P73 A;  5LSL A;  1TUV A;  2IHR 1;  2MPU A;  4UTG A;  1OWX A;  3JTO A;  5IV4 A;  3H90 A;  3R1H A;  4DSL A;  1HBU A;  4LSN A;  2DK2 A;  4CLT A;  4CH7 A;  3E2E A;  2N4C A;  2XMV A;  3HHL B;  3LAL A;  3GP9 A;  2QLW A;  3RB4 A;  1CJK A;  4L76 A;  1WDD A;  2WVE A;  4DJB A;  3OBI A;  4WCE Q;  4CLS A;  3FCH A;  5D4N A;  2BYC A;  4N47 A;  2DD8 S;  3HO1 A;  3RW7 A;  2O66 A;  2KXH A;  1RK8 A;  4EFA C;  1GXU A;  2F1F A;  4ILM A;  1Y5L B;  3W1Y C;  3ZFV A;  1BQM A;  4X4O A;  3V6J A;  1NB7 A;  4K0K F;  1WOR A;  2QO3 A;  2E1A A;  2BJ3 A;  3GII A;  5KG7 A;  3MFH A;  3NMR A;  3BH7 B;  4WZM A;  4ZP7 A;  2JVR A;  1CUL B;  1T03 A;  2RU9 A;  1VQ4 S;  1NSK L;  4RO0 A;  2MDA A;  3N01 A;  1D9D A;  4AL7 A;  1B0P A;  2B51 A;  4P7V A;  3SDE A;  2RDJ A;  2OTJ S;  3I87 A;  4WYW A;  4H4K C;  2YX4 A;  4EO6 A;  2E5L J;  1WDT A;  3CJ5 A;  2MYF A;  2QA4 S;  4I64 A;  4DR4 F;  4DL2 A;  2H5E A;  3L9Z A;  1RTJ A;  4I2P A;  1H74 A;  2ZNY A;  3CCT A;  3CIZ A;  4ZIV A;  2MQO A;  1E6V B;  4LFA J;  5HO4 A;  4GKJ F;  1IKV B;  4C7Q A;  3AOA A;  4LBP A;  4A8Y A;  4L3K A;  6AT1 B;  4K0K J;  4OV1 A;  1FRJ A;  3MEG B;  2LCW A;  5J1E B;  4DSJ A;  4Z7Y A;  1QE1 B;  3T6J A;  2FVC A;  3GYG A;  4P52 A;  1IKY A;  1XMQ J;  2BVZ A;  3LPY A;  4PWD A;  2R7Q A;  3QFW A;  4DV6 J;  5E3P A;  2FJV A;  4FPR A;  3NLC A;  1ZAW A;  2VD3 A;  1KN6 A;  2MZJ A;  2CVI A;  2JVO A;  2IC3 B;  4OZN A;  1LWC B;  1B64 A;  4KGV B;  1JLC A;  1S9E B;  2VC0 A;  5ADZ A;  4DR3 F;  1RT5 A;  2FZK B;  1HNI B;  3CCZ A;  3JTP A;  4C48 A;  1X60 A;  2A6O A;  3WC2 A;  3B4D A;  2J7U A;  4MH8 A;  1JLQ A;  2PA8 D;  3MMB A;  3CXC R;  2RHS B;  4I2Q A;  3HLU A;  4P2X A;  4JI0 F;  3QT7 A;  4HAC B;  2W1B A;  1F1B B;  2C2Z B;  2YNI B;  3PCO B;  3TP2 A;  1SJ3 P;  3KOA A;  1VC0 A;  4X4Q A;  4USM A;  4B9T A;  4ZN3 A;  3DYA B;  3P5T L;  5A2Q U;  2M3D A;  4DXL A;  1S1W B;  3JQK A;  3MI7 X;  4X66 F;  5F8I A;  3T5J A;  1C1C A;  3HF5 A;  3DMJ A;  5HMY A;  1U7L A;  2W01 A;  1S1T A;  1F60 B;  5D77 A;  4CLY A;  1EAY C;  2V8V A;  3V6D B;  5IOL A;  4ECW A;  2OEK A;  4NYP A;  1VRU B;  1XNR J;  1FVS A;  1VRT A;  1YLX A;  2K1R B;  4RUB A;  5GAD U;  4ED6 A;  2FVP A;  1KFS A;  4A47 A;  3K5O A;  1YHQ S;  2FGO A;  2HVZ A;  3M2V A;  4WYL A;  3OL8 A;  3IR5 B;  1HI8 A;  2FZC B;  2ROG A;  2LMI A;  3JB9 k;  2XUL A;  4CM2 A;  3VAM A;  1HD1 A;  1S6O A;  4Q45 A;  2APO A;  2KT2 A;  1SJ1 A;  1WC0 A;  4L72 B;  4WU3 A;  4ZVU B;  3M9M B;  2OFH X;  2XC9 A;  4KBI A;  2I5J B;  4U96 A;  2HQI A;  5DJB A;  1YJW S;  4OV6 A;  4B08 A;  4CI0 B;  3H98 A;  4AQY J;  2OGU A;  3HK2 A;  4CIO A;  2ZOG A;  4NLV A;  2ZHA A;  3QNW B;  3U02 A;  2XNQ A;  5DQG A;  2UUB J;  5D15 A;  1GMV A;  2HBR B;  3NS7 B;  3NGU A;  1R8C A;  4AND A;  3OTO J;  1CJU A;  4DV4 J;  1FXR A;  4OHV A;  3MAH A;  2G2Z A;  3QAU A;  3UCG A;  1ZA2 B;  1F9F A;  1N52 B;  1UWA A;  1RAB B;  1Y5I B;  2YH0 A;  3MM5 B;  4KSE B;  4CTA A;  1UP1 A;  2I1R A;  3Q8U A;  1FJC A;  3ENQ A;  4RX6 A;  2QFJ A;  3SSS A;  1RT7 A;  1T8E A;  3MTJ A;  2BRL A;  5F8H A;  2DGS A;  2WON A;  1VQ9 S;  3IXQ A;  1T9U A;  5C24 A;  3O2I A;  4X62 J;  4ZPV R;  3C3L A;  4EK2 A;  3ADA C;  4NLT A;  4OYZ A;  1Q7L B;  3BGU A;  3KG1 A;  3CCW A;  4FKY A;  4TY8 B;  3R6G B;  1Q8I A;  1S59 A;  1SV5 A;  3AH6 A;  2NRE A;  4QU6 A;  4LF1 A;  2CPD A;  4O3P A;  2JWN A;  1T02 A;  3PHT A;  4F4K A;  1NXI A;  2QC3 A;  1T9X A;  2VPX B;  3B78 A;  2VBY A;  3C19 A;  3T41 A;  2DEI A;  1FX4 A;  1UA1 A;  2KVQ E;  3NGK A;  1T9W A;  1MU2 B;  4ZN1 A;  4J90 A;  2Y8Y A;  1TL7 B;  3D3C J;  2NPF A;  1GMW D;  3T1A A;  2GAG C;  3FC9 A;  3DLG A;  2EI5 A;  3DFE A;  3UDV A;  4DU7 A;  5RUB A;  1JLG B;  3KLG B;  4DS5 A;  2FLO A;  2AYB A;  1T7P A;  2DPI A;  2HRY A;  1F5A A;  1IN0 A;  2QLX A;  3OW2 R;  2IJF A;  5CAB A;  2XWX A;  3IWN C;  1UJ4 A;  1F6T A;  4CLF A;  2KZM A;  2G0C A;  2Z30 B;  3MUR P;  4EBD A;  3ETM A;  4MT1 A;  2B5J B;  1RSC A;  2Y8W A;  1JLA B;  1HL6 A;  3FSI A;  3VAK A;  1ZPW X;  2LFV A;  2KL8 A;  2MQL A;  2N7Y A;  1FRI A;  2AYE A;  2VUG A;  2ZOM A;  3L7P A;  4FVM A;  2W7A A;  4RL1 A;  1RBL A;  2DH8 A;  2MQM A;  1H38 A;  4UOH A;  5K8M A;  2XI3 A;  3CME S;  4OI0 A;  4EWT A;  2WSF C;  4F7V A;  2DIV A;  2JC0 A;  2ZE2 A;  3DN9 A;  2E5H A;  3ONQ A;  3GR1 A;  4HHU A;  4PKD B;  1LW2 B;  1HWK A;  3OXF A;  2NXJ A;  3G6X A;  5HP1 A;  4JI8 J;  2KFZ A;  3QZ8 A;  4F8R A;  3N6N A;  1RT1 A;  2R8I A;  3KMQ A;  4D3H A;  3ZZR A;  3PR5 B;  4OX7 A;  4B9V A;  5ETR A;  4IRK A;  4UST A;  1GXT A;  4Y28 C;  2N82 B;  3CDE A;  4LSL B;  1HWJ A;  2PD1 A;  2QMU B;  4JYA J;  2B4O A;  2GJ2 A;  2G2Y A;  3A3N B;  3R97 A;  3WX8 A;  4LQ9 A;  3HXM A;  3KHR A;  4F2S A;  1NCL A;  3SBM A;  5A8W B;  2YWF A;  2L48 A;  4O4G A;  3ZZT A;  4GMK A;  3MR5 A;  4FS1 A;  2BQR A;  5E7O B;  1W2B R;  2CPF A;  1YSJ A;  2JDJ A;  1XEZ A;  2KVI A;  1BD6 A;  3M2V B;  3MM7 B;  4QIE A;  3CWJ A;  3Q8Y A;  3O6Q A;  4Q7A A;  4PG8 A;  2DRB A;  2ZZN A;  3A12 A;  4OX6 A;  3Q2S C;  4QCL A;  2GVZ B;  3HVT A;  3PW7 A;  4CH1 A;  1NBE B;  4IR1 A;  4ZVR B;  3BV8 A;  1WG5 A;  3CSK A;  5C24 B;  5KG2 A;  1WEL A;  4MKV A;  3S1T A;  3FMW A;  3GG0 A;  1XMQ F;  1JLF A;  1S1U B;  4NXM F;  2J0S D;  1CJV A;  2XYP B;  2ZUA A;  4R5P B;  2KG0 A;  2MKI A;  1SV5 B;  2XO6 A;  3ZNU A;  2HNY B;  4X4P A;  2QSW A;  3ET6 A;  1EQ0 A;  2VJV A;  1D9A A;  1X0F A;  2XHW A;  3DLE A;  3VGU A;  3QBC A;  1SIW B;  1S5Z A;  2XSJ B;  1WJ9 A;  1U2R A;  3NAH A;  3GV7 B;  4CLK A;  3MM5 A;  5KT6 A;  3T9Z A;  3IG1 B;  1U1P A;  3AB2 B;  4XPC A;  2CZV C;  4F4Z A;  4YUD A;  2HWI A;  3V6H A;  2W7O A;  2FYX A;  1IJE B;  1H72 C;  1FWL A;  2GGP B;  4LR7 A;  5G0R B;  3US5 A;  2J9D E;  3VGV A;  3KLG A;  1OSC A;  4MK9 A;  1HNX F;  2IA6 A;  4CO0 A;  5CYM A;  3H5U A;  2AX0 A;  3NMA A;  4FXD A;  3MPD A;  2ZVS A;  2L3M A;  3MEC A;  4OI1 A;  2E7V A;  4IO1 A;  1GH8 A;  5CZV A;  3L7O A;  4DPU A;  3I32 A;  3BQ1 A;  2EFN A;  3T1Y F;  3SV4 A;  2ASJ A;  3CNQ P;  2Y3Y A;  1N5V A;  2BKN A;  1L3V A;  1HI1 A;  3KXD A;  4HL9 A;  4ED3 A;  2ZHB A;  1NDC A;  2DPJ A;  1N33 J;  2YWK A;  3KDO A;  4UUX A;  1LW2 A;  4DV6 F;  2I9S A;  3TJ9 A;  5HMZ A;  3P5B P;  2R2U A;  5HP1 B;  2W2O P;  1U1R A;  3GIM A;  1SJ4 P;  3D54 A;  1S77 D;  4QBU A;  1RE1 B;  3PJW A;  1XER A;  4Y34 A;  3GV5 B;  1EKS A;  2VHG A;  2EK1 A;  2FVS A;  1RHK B;  3I9Z A;  1FI4 A;  2VC1 A;  4JI7 F;  2KN4 A;  3HZE A;  2RDD A;  1LWF B;  2BJ1 A;  3M8W A;  4FNI A;  2W2Q P;  2GQC A;  2BKP A;  3CDW A;  3PEH A;  5GAH I;  3N9U C;  4GKJ J;  1U0H B;  3KHG A;  1P27 B;  1ROF A;  4DR5 J;  3I0R A;  1G6B A;  3JYT A;  1WKJ A;  3HCX A;  5EX3 A;  4PWU A;  2WBR A;  2MQ8 A;  4KQZ A;  2IVY A;  3RJM B;  4USI A;  4OL8 A;  4USV A;  4J9O A;  7FD1 A;  2BX6 A;  2H51 B;  3QT5 A;  2RAQ A;  3BPS P;  3M8Z A;  5DLF A;  2B8Q A;  1N0V C;  3KLI A;  3GJS B;  2R9L A;  2YNG A;  2ZIT A;  3GPA A;  2B6A A;  2E29 A;  3MPV A;  5HQ8 A;  3IA0 A;  3DOM B;  4K50 A;  3FZ2 A;  1U4B A;  4DMZ A;  4WF9 Q;  2BE9 B;  5B08 A;  5J2Q A;  1VQ8 S;  1HHS A;  1EJ7 L;  1UZH A;  2K1R A;  4ZCL A;  1FRM A;  1N8R T;  3JSM B;  1UET A;  1KSP A;  1BLU A;  1RBO B;  3BSA A;  2V4J B;  3D0H E;  4EO8 A;  2C3Y A;  1HW8 A;  2EG1 A;  5EHH A;  2KG1 A;  4W4M A;  2XG8 A;  4IOC Q;  5KG3 A;  4ECV A;  1HYS B;  1VRQ C;  3RRK A;  3OQ2 A;  4DPY A;  2BW2 A;  3CJK B;  1F0X A;  1T0T V;  2E5I A;  3AOC A;  4F2R A;  4TU8 A;  4KGZ B;  1IKV A;  2Z0G A;  4DV1 J;  3BSO A;  1RP5 A;  1HR0 F;  2YTC A;  4I0W A;  4P75 A;  2QLJ B;  5LMU F;  3PJX A;  2FLP A;  3H42 A;  1N5Y A;  2E9Z A;  2HVE A;  2DR9 A;  1RTH A;  3LAN A;  4Y2I A;  3AFG A;  4M5G A;  4DX5 A;  4C9D A;  4OHY A;  4WU2 A;  1Q81 T;  4I69 A;  5EN1 A;  4P72 A;  2R7T A;  2A3J A;  3M8S A;  3TUI C;  2HQ3 A;  4RW9 B;  1MML A;  2RQ4 A;  3P3D A;  3V4M A;  1TKD A;  3BBC A;  3LUY A;  4OX9 J;  2QG9 B;  3GG1 A;  4KFB B;  2DVI A;  3JSB A;  5K14 A;  3TUP A;  2RH3 A;  2IBO A;  2P8I A;  1WNE A;  5M2P A;  2ADB A;  3G8S A;  1IKW A;  2HHS A;  4WPA A;  3H20 A;  1UPM B;  4X66 J;  1UVL A;  4WBF A;  3UCZ P;  1QE1 A;  2AJ2 A;  2F3J A;  2KU7 A;  4O3S A;  4FDF A;  2UXD J;  3J80 U;  2GHW A;  4PUO A;  3PRV A;  3PIO Q;  2ZBQ A;  3POT A;  2OPR A;  1QUP A;  1ZZN A;  4P10 A;  2V6A A;  2XZD B;  3RBD A;  2QA4 G;  2B7C B;  2WB1 D;  1QM9 A;  2ZUG A;  3BGR A;  3GYX B;  4KAI A;  5I3Q A;  3H0P A;  4JI5 J;  3GCW P;  1Q5Y A;  3QLH A;  4O44 A;  1GAO A;  1S9E A;  3B8H A;  4LVN P;  2HND B;  5ETT A;  4BC9 A;  1GNK A;  1W26 A;  2IYG A;  1X9W A;  1U0H A;  1UEV A;  2XY6 A;  1MU2 A;  1TK8 A;  3PFE A;  5DET A;  2MXY A;  1K0V A;  2GJI A;  1MW7 A;  1URR A;  4K2X A;  3UD3 P;  3MOJ B;  1XIQ A;  5HJY A;  1RIS A;  3SSQ A;  4PQU A;  3M6W A;  3F41 A;  2CQ1 A;  2XI2 A;  4Y65 A;  1EIY B;  1D09 B;  2HFZ A;  5F41 A;  3OL9 A;  2RJZ A;  4AT1 B;  4RU2 A;  2YNG B;  5I42 B;  4IKA A;  3LQV A;  1D3W A;  3G82 A;  2X1G A;  2KRR A;  4ED4 A;  1LWF A;  4ZJL A;  3VGS A;  2GFF A;  2FHM A;  1VOM A;  4DPO A;  1KLM A;  3X1L B;  3D0I E;  3R5J B;  1S12 A;  1S1X B;  2ASL A;  1HPZ B;  1VJW A;  2XYG B;  1OO0 B;  1DQ8 A;  2VIH A;  4DV2 F;  2HFV A;  2H54 B;  4HI2 A;  3CF5 Q;  3AXM A;  2FTR A;  4U9R A;  4LFB F;  4B17 A;  3LWM A;  2LQB A;  3PAC A;  4DI6 A;  3HI9 A;  4URG A;  1UL3 A;  2VQF J;  4UF4 A;  4JV5 J;  3HDS A;  1J5E F;  3MD1 A;  2FD2 A;  1UW9 A;  3EZU A;  2VZ9 A;  2EXU A;  4U8V A;  3HSZ A;  2MKK A;  5B0G A;  4Z37 A;  3EGW B;  2ZH5 A;  5KT4 A;  1EAR A;  4CO2 A;  1CPZ A;  1RT7 B;  3MF5 A;  5L8R C;  2V2Q A;  3U27 A;  1O6X A;  1OPI A;  2ROE A;  1AFI A;  1FWK A;  1XMO J;  5ETP A;  1ZS6 A;  1QSY A;  1HKA A;  2IM0 A;  3E01 B;  3L7U A;  3DLH A;  4LF9 F;  2C42 A;  4X2B A;  1APS A;  2OHD A;  3UDC A;  3C6T B;  1U8W A;  2P9C A;  4A8O A;  4F3Q A;  4ZIT A;  4P6Q A;  3VAJ A;  4G3I A;  4RW9 A;  2JFK A;  2MZT A;  4O0N A;  2QLF B;  3T5K A;  1O51 A;  3OXL A;  1OQ3 A;  1HHQ A;  1U48 A;  3D6M B;  2VB6 A;  4ZK7 M;  4J9S A;  2FJA B;  1RT4 A;  3NS6 A;  2R8J A;  2WVC A;  3R8Y A;  2B4P A;  4ED0 A;  2IRY A;  2ZJQ Q;  1SKR A;  1B4S A;  5IM0 B;  4ZVO B;  1EB0 A;  2OML A;  2YQ3 A;  5I3U A;  3THP A;  3AXK A;  2K3K A;  2VL1 A;  3M8Y A;  3IP0 A;  1RDR A;  1RTH B;  3BDE A;  2HNZ B;  4M5M A;  2DNZ A;  5KFB A;  5B7W A;  4R5P A;  4MYT A;  2J6U A;  4JI1 J;  1AW0 A;  4OZL A;  4YOE A;  1U1O A;  3C14 B;  3VWS A;  2XSJ A;  4QOT A;  1GTH A;  5CD4 A;  2GHP A;  1BWE A;  3PJ9 A;  2G9O A;  1VIO A;  3R5G A;  2MKJ A;  2MEW A;  4S0M A;  3LAK A;  3ICL A;  5D0G A;  3VF0 B;  5DGA A;  1RWP B;  4USK A;  2ZM6 F;  3D6T B;  2VA3 A;  5D3G A;  2ZC4 A;  5HL7 Q;  4LF9 J;  5C42 A;  4ZPD A;  2Z57 B;  4DUZ F;  1RJJ A;  4R0J A;  2CZ9 A;  4DL4 A;  3M30 A;  4N41 A;  3V81 A;  2AKW B;  2GV1 A;  2DXD A;  1PYO B;  2M70 A;  1WF2 A;  2DNO A;  2XEX A;  4ZP9 A;  1MWY A;  1TKT B;  2AJ1 A;  4NLU A;  1IBK F;  3L4B C;  3QJL A;  4DSI A;  1NDP A;  1OMS A;  4PG6 A;  3BB5 A;  2VQF F;  2XYH B;  2VKR A;  2OH2 A;  1R3N A;  3D5M A;  4NI2 A;  1RWX B;  1YBA A;  5T41 A;  1JQG A;  1YDL A;  3MEE A;  5G4D A;  4C8N A;  1K47 A;  1UAW A;  2JOQ A;  4IFV B;  3DDI A;  4F26 A;  2MKS A;  1TUW A;  3NNC A;  3D68 A;  5IT0 A;  3K59 A;  1EHW A;  3QQC D;  1L3S A;  1RU1 A;  3UO0 A;  1RLC L;  2HGM A;  2WHO A;  3PYD A;  2CPH A;  1XR7 A;  4ZVS B;  3W2W A;  1HLW A;  4DFK A;  1SKS A;  5JJB A;  2ZWP A;  1RT1 B;  3W9I A;  2ZNZ A;  1URN A;  1NJZ A;  1IKX A;  1VCT A;  3LH2 S;  2RU3 A;  4OFZ A;  2GVZ A;  4X4S A;  4ECY A;  1ZM9 A;  4ED7 A;  4AL6 A;  2YNF A;  1JMT A;  2HFN A;  4NZ0 A;  1N5Q A;  2DTJ A;  4YHH J;  1IXK A;  5DDO C;  4ILL A;  2DIS A;  4K59 A;  2BQU A;  4TNO A;  3PW0 A;  4ZPA A;  3CO0 P;  3HVA A;  2CPY A;  3EZO A;  1R27 B;  1PAU B;  2KHD A;  5LOQ A;  3T9N A;  3Q22 A;  2IYI A;  3DLE B;  3HMJ G;  4IG0 A;  3TW0 A;  3HP6 A;  1UKU A;  2K7K A;  1REV B;  3OXG A;  2LVW A;  4NLP A;  1HQE B;  4FZV A;  2PII A;  4X4R A;  4GC7 A;  2M2B A;  4FP9 A;  3LPE A;  3M9N B;  3PKM A;  3T3F A;  2CYY A;  3SFU A;  4NLD A;  4DCO B;  1IQT A;  2UXB F;  3DM2 B;  5HVH A;  1SVD A;  4WXW A;  3V4I A;  3DLK B;  4CO1 A;  3U1L A;  2D9O A;  2J7W A;  3MEK A;  3M6U A;  4HLB A;  4ZVP B;  4DR7 F;  1FES A;  3VTI A;  4OHX A;  4RW8 A;  2YKQ A;  1T3O A;  2HHP A;  2RHQ B;  4JI3 J;  5E3A A;  1SH0 A;  1YKW A;  3TZX A;  2RVJ A;  3KNA A;  4JOU A;  1FO1 A;  1Q8L A;  2G13 A;  1RWW B;  2OSQ A;  3DGV A;  4Q2M A;  2ASY A;  2WAQ D;  1JXV A;  2IM1 A;  2BJ7 A;  1PBU A;  3MAA A;  4PPZ A;  4C8K A;  4O3N A;  2ZH8 A;  4YR3 A;  2G1D A;  2BEF A;  3PVX A;  3SYZ A;  4ANC A;  3G86 A;  1MN7 A;  4DV5 F;  2VFR A;  1NHV A;  1KR4 A;  3VAF A;  3A8J A;  2FHO B;  2OO4 A;  4RKU C;  3JSR A;  3DMJ B;  3FVY A;  4ID5 A;  4O4R A;  3RB3 A;  4JYA F;  1FWP A;  4IOB A;  1HWI A;  1WTB A;  2EW9 A;  5C42 B;  1SCJ B;  4FS2 A;  5K20 B;  3BPD A;  3HHK A;  1S6P B;  3H8Y A;  5BXI A;  4HAC A;  2MJN A;  2HVH A;  1EZZ B;  3BKF A;  3L09 A;  3CDA A;  1JX4 A;  1NKE A;  1NH7 A;  2JSX A;  2PEB A;  1U26 A;  3CJ4 A;  3DU5 A;  3FSY A;  3MR7 A;  5KFJ A;  1RT2 B;  1VBX A;  1R8A A;  4DL7 A;  5D0R A;  4PXC A;  1YRT A;  3PX4 A;  1S97 A;  4LF2 A;  2OTL S;  2PN6 A;  2UUC F;  3ISZ A;  2YNF B;  4CO4 A;  1QAX A;  1RYR A;  4PG5 A;  3ZTR A;  2GO9 A;  4F25 A;  3KK3 A;  3QT6 A;  4PEO A;  1ZET A;  1CLF A;  1LQ9 A;  1C1B B;  2XGP A;  1CS4 B;  3CE8 A;  1PIL A;  4XTT A;  2K06 A;  4DL6 A;  1WEZ A;  5LXY A;  4DX7 A;  4ZA1 A;  2UVU A;  1SKU B;  3K5M A;  4M5D B;  4K7Q A;  1U6Z A;  3OFE A;  2RSQ A;  4RBT A;  2NZ4 A;  4NX9 A;  4F02 A;  3RB0 A;  4USU A;  1K1S A;  2MKY A;  3NGS A;  1BXN A;  1AUD A;  1QAI A;  2UUW A;  1AUS L;  1EKR A;  3TJ8 A;  1KVK A;  1PC4 A;  4N56 A;  1HQE A;  2AWZ A;  4JP8 A;  4MIW A;  2MKC A;  5THW A;  3S7R A;  2Y1I A;  3PW5 A;  3HJF A;  1RCO B;  4AL5 A;  3DRY A;  1X5S A;  4DX6 A;  1Y5N B;  3BKT A;  2IJR A;  2WON B;  1YTY A;  4IFY A;  3W60 A;  3KLH A;  5AXK A;  5EWG A;  1IVZ A;  2R7R A;  3B82 A;  4Q2L A;  3JSM A;  2Y1J A;  4RU9 A;  2VOD A;  1VQL S;  5KG1 A;  4ANE A;  1Q16 B;  2VIC A;  4Y00 A;  2LLZ A;  3EXY A;  2CJX B;  3UDL A;  1FRH A;  2ZDO A;  2AGP A;  5HAT A;  5D6G A;  2CQ0 A;  3PX6 A;  4K4T A;  4OZ2 A;  2UVV A;  1SC3 B;  2EFP A;  4EZ6 A;  2MZS A;  1YJ7 A;  7FDR A;  4ZDN A;  4CLP A;  4YY3 F;  2PE8 A;  1MG7 A;  4FF3 A;  2WVD A;  1RTD A;  5GAG U;  2BRK A;  4QWA A;  1LFW A;  3BN4 A;  5A8R A;  3CO9 A;  4RW4 A;  4A46 A;  4DF8 A;  1XC9 A;  1HNV B;  3W2V B;  1K8A T;  2J0Q D;  1L5U A;  6FDR A;  2IAJ A;  3WBZ A;  2H9Z A;  1PIE A;  1QLN A;  2EVZ A;  2CWX A;  2L9N A;  1GT8 A;  1RTJ B;  4X65 F;  3WIU A;  1HWU A;  1NM2 A;  2PFD A;  1IBC B;  3VQS A;  3DI6 A;  3I9V 9;  1NK7 A;  3E8O A;  2JNJ A;  2W8L A;  1H7W A;  1FER A;  4AQY F;  1YJR A;  4OZ1 A;  2UXC J;  1NK9 A;  3FDS A;  4NYZ A;  2HHT A;  5L38 A;  2JRS A;  4I67 A;  2F40 A;  5B0E A;  1TL7 A;  5ETK A;  3PKY A;  1R31 A;  5BR8 J;  3RRG A;  1IJF B;  3FCW A;  5DG7 A;  2PA3 A;  4DL5 A;  3GU0 A;  4H54 A;  3G87 A;  4MK7 A;  1V9O A;  2JLF A;  2VKZ G;  5CXT A;  3CDU A;  4FF2 A;  1TP7 A;  1D8Y A;  1PO6 A;  4DCP B;  1N36 F;  4RJV A;  5HQM A;  4OLP A;  2X1F A;  4OYX A;  2G4B A;  1NEE A;  4GVB B;  1RTI A;  2HFU A;  2VDH A;  2YVS A;  5IFM A;  1IBM F;  1HQU A;  1X4E A;  4DR2 F;  4Z7C A;  2XTJ P;  1K9M T;  1G4C A;  3MGJ A;  5GVQ A;  3ZTO A;  4ES1 A;  3H40 A;  3QRR A;  3MCN A;  5F3T A;  1OY9 A;  2GJF A;  2RNE A;  2KI2 A;  2X1B A;  3IGV A;  1LW0 A;  2JX2 A;  3GSD A;  3MMA A;  4HTI A;  2D3U A;  1AA1 B;  3I0S A;  2BAN A;  3TVZ A;  2A6M A;  2ACY A;  3TA1 A;  3PO4 A;  3HHD A;  2KYZ A;  3CMA S;  2ZJR Q;  2B56 A;  4DR1 F;  5F8G A;  3FFI A;  2ATC B;  2ZBP A;  3BEG B;  3KJN B;  1U1K A;  4LIR A;  4JI7 J;  3AAW B;  3P45 B;  1RAH B;  2WCX A;  3SCI E;  5KFT A;  3CGI A;  3ZTS A;  1JLF B;  4DX8 H;  2UUA F;  1UFK A;  1YGY A;  2QE5 A;  3BM7 A;  1YQH A;  3M8P B;  4LRF A;  1Z2Z A;  2BZ2 A;  3ZZU A;  3QGG A;  3R3T A;  4X64 F;  4NPO A;  4O0I A;  2O67 A;  1TKZ B;  4QQB A;  4CDI A;  4J5O A;  2CAJ A;  4WP3 A;  5BR8 F;  1VQM S;  1QJH A;  5L39 A;  1FKP B;  1EQM A;  1JLB B;  2CQH A;  5H9E J;  2C2K B;  1R6V A;  4DUT A;  2W9B A;  1F9H A;  1WHV A;  3TA0 A;  2BJE A;  5J1E A;  5T7L A;  3H59 A;  1QUV A;  5G0R A;  3UWT A;  2EWH A;  1KFD A;  4Y2K A;  3TOQ A;  4J9R A;  2HSE B;  5F9L A;  3OUY A;  3TUZ C;  2NS1 B;  5A6W A;  3HHN B;  3B4M A;  2RRN A;  2FJX A;  1TV6 B;  4ED5 A;  2VH7 A;  5JUM A;  3TAR A;  2GHV C;  3I55 S;  1RAF B;  4MMO A;  4C8Z A;  1GMU A;  1JLQ B;  2Q43 A;  3MMB B;  3OFF A;  2AJQ A;  1S6Q A;  1RT3 B;  3K58 A;  5KFV A;  5J2M A;  3TNV A;  7AT1 B;  1QY7 A;  4G1Q B;  3MD3 A;  1WF1 A;  2YPY A;  4OJG A;  3DLK A;  3I82 A;  4HI1 A;  1ZTT A;  4DQR A;  2GCF A;  4RUC A;  1G1X A;  4R8U A;  5HRO B;  3HVR A;  4MIA A;  1AZS B;  4OYI A;  2V2K A;  4DFJ A;  2PI4 A;  3KUE A;  2W4D A;  3PYG A;  4EBE A;  4LFC J;  1NJY A;  3CDB A;  2UU9 F;  4MK8 A;  2MLX A;  4GVL A;  1WWH A;  4IFV A;  2HK2 A;  3KMS A;  1RAE B;  3CD6 S;  2R7V A;  1I5O B;  4ETX A;  4XPE A;  2M88 A;  2H5J B;  3A3O B;  5MAO A;  3T1H J;  4NLX A;  1U09 A;  1XNQ F;  1H2V Z;  2HVD A;  4HDH A;  2IPO B;  5KG0 A;  4M95 A;  2DKO B;  2YNI A;  1TL3 A;  2YX1 A;  3MFI A;  4IO9 Q;  1U24 A;  3Q8Q B;  1I6J A;  2NPI A;  1IUJ A;  4NLY A;  2K3I A;  2OFG X;  1MNE A;  2O5D A;  2NZC A;  2L9D A;  1YIJ S;  5CA5 A;  5B0D A;  5M2R A;  1KHV A;  4ID5 B;  5E33 A;  4Y3C A;  2CNN B;  3N79 A;  4EYH B;  1K0T A;  3RYL A;  4J9U E;  1CC7 A;  1S1T B;  2DO4 A;  4A8X A;  4CLZ A;  4WIQ A;  3W9J A;  2HHH F;  4KO0 B;  4HTJ A;  1X4B A;  3UE2 A;  1WC6 A;  1XMO F;  2CG8 A;  2ZD1 A;  3MAQ A;  1N32 F;  5IT9 U;  1Q7Y T;  4MKB A;  3M2R B;  4YB5 A;  4IG0 B;  5C2C A;  3W64 A;  3ILI A;  5T14 A;  1YX2 A;  1O5J A;  2YKP A;  4RZR A;  4U8Y A;  2PC6 A;  5DG9 A;  3IAM 9;  3K5P A;  1ELO A;  4DLE A;  4MAK A;  2JHE A;  3A3P B;  2LU2 A;  2HBQ B;  2KT3 A;  4ILR A;  2YNH A;  4DR2 J;  5KFR A;  4CNY A;  2RQK A;  5BYQ A;  4FBT A;  3DRP B;  3HHE A;  2LDY A;  1JKH A;  4KGX B;  1YVF A;  4YN3 B;  3JS9 A;  1Q53 A;  2F4F A;  1HBU B;  3U1N A;  5AE1 A;  4QYR A;  4WE1 A;  4QZV B;  3OTO F;  2DGV A;  3DM2 A;  2K8G A;  4PRF A;  3H5Y A;  2BMB A;  2ZH1 A;  2JFD A;  2NXU A;  3NCR A;  4JBC A;  1ZZF A;  4DSE A;  4HH0 A;  4DN9 A;  2D3O R;  1CJU B;  1E6Y A;  1VJQ A;  2QMW A;  3LAM A;  3O1L A;  3R5C A;  4F3M A;  1ACM B;  5BJR A;  1ZYQ A;  4DUY F;  2Y9H A;  1GX5 A;  4ICL B;  3GSI A;  2PMH A;  1LXJ A;  1VBK A;  2ZKT A;  3H2V E;  3NXZ A;  5LM7 E;  3ZTP A;  4DR5 F;  5LSO A;  2GA7 A;  3KLV A;  1RTZ A;  2ZHO A;  2CQ4 A;  4NCB A;  1FHT A;  5K8N A;  4IR9 A;  1GEH A;  1HNZ J;  1RAD B;  5JVH Q;  3OUY B;  2VFV A;  2C2M B;  4RUA A;  1QD1 A;  2GML A;  2C3M A;  5DO2 A;  1VQN S;  1AZS A;  1SPB P;  1NLK L;  4ZVQ B;  3NP5 A;  2R4F A;  1DUR A;  2DRD A;  2H4W B;  4B3R F;  3F56 A;  1U2F A;  4ZLN A;  4RNM A;  3OHA A;  3BGO P;  3MR3 A;  2ADC A;  2MQN A;  1R6Y A;  3HJV A;  1PYS B;  3Q8V A;  1FXL A;  2E5G A;  2YX7 A;  3BBF A;  1BHN A;  1S6Q B;  4HYK A;  4N8O A;  3OFH A;  2IMO A;  2LU1 A;  3DDN A;  4LBI A;  5D4O A;  5J2P A;  2ZEJ A;  2C22 A;  2UV8 G;  2RRA A;  3KYL A;  4X4N A;  3IN5 A;  3FZB A;  3D1Q A;  1PJ6 A;  3MR2 A;  4LR9 A;  4B3T J;  1FTR A;  4F3O A;  4OHW A;  1WF0 A;  2H3E B;  2W24 A;  4Q5V A;  2BJ9 A;  2DGO A;  2BE2 B;  3MM9 B;  2GIR A;  4KGM A;  1UPP A;  3UDE A;  3O3L A;  1UCN A;  4AXI A;  1NRK A;  4ZPW R;  5AXN A;  3EJM A;  3T5H A;  2OKQ A;  4DN0 A;  2QA2 A;  4RLE A;  1N4L A;  4PG4 A;  2J8S A;  4DFP A;  1NJX A;  1Y3J A;  1VR6 A;  4ZP8 A;  2WOM A;  2J0W A;  4HHJ A;  2NUH A;  3FQK A;  5HMW A;  5M2U A;  1Q8K A;  3MED B;  4NLS A;  3DKD A;  3Q8S B;  3PTW A;  3DYA A;  2IM2 A;  3ZNJ 1;  3QGP A;  1S48 A;  2RB7 A;  4JI2 J;  2CIM A;  2LXU A;  2IM3 A;  3M7V A;  2PI5 A;  3PRB A;  1TVR A;  1WHX A;  5E2Q A;  2IRU A;  1RTI B;  1WC5 A;  4BCA A;  5GAE U;  1M5H A;  3D66 A;  4QJV A;  3TQ1 A;  3CT9 A;  1HQU B;  2DHA A;  3K57 A;  3C8Y A;  3OR2 A;  5E0O A;  2ILZ A;  1KLM B;  1KLN A;  1IBK J;  4XAK A;  1VQY A;  1F5C A;  1VRT B;  3E01 A;  5DQH A;  1CJV B;  2VFS A;  2ZD1 B;  4TYB A;  3W3S A;  3W9H A;  3HFZ B;  2ABY A;  3J7Y I;  3JAM U;  4USW A;  4DEZ A;  5ITH A;  1X5T A;  2XLI A;  1W2I A;  3GFY A;  3AB4 B;  1F5B A;  3GYN A;  4RW7 A;  3SCJ E;  1Y10 A;  1HD0 A;  2A0F B;  2HUR A;  3R1L A;  2C2E A;  5FJ4 A;  1FNX H;  5BYS A;  3DRP A;  2HMI B;  2HKE A;  4FYD A;  4OYO A;  4J9V A;  5DS7 A;  4WE1 B;  2B4V A;  2XSF A;  3DLB A;  4Q8F A;  1VQS A;  1TL1 B;  3EPI A;  2MZR A;  3K8V A;  2IMW P;  4PWD B;  1UEK A;  1FDA A;  5E3R A;  1T3N A;  2RIJ A;  3DRS A;  2UXC F;  2CJA A;  4HDG A;  4J7C A;  3NBP A;  3ET6 B;  1RI7 A;  3CJ2 A;  3PG9 A;  3RAM A;  3AQP A;  3N28 A;  1OJ4 A;  2ZH6 A;  4PCQ A;  2ASD A;  2GIF A;  3VQT A;  1S10 A;  1KNZ A;  3LP2 B;  1RT6 A;  1KTQ A;  2QL5 B;  4GO7 X;  3C6U B;  5B0F A;  4OJH A;  4PR6 A;  3FBC A;  1RTD B;  1BGX T;  4FYW B;  1TK5 A;  3OR1 B;  1A9N B;  1X4G A;  2FJB B;  3L3C A;  2NUU G;  4ITS A;  2CKW A;  3CJT A;  2QYG A;  2RRB A;  2EFG A;  3CD5 A;  3EVW A;  2QA1 A;  3C14 A;  3UD4 P;  2GVD B;  2YWH A;  2C3U A;  2C1E B;  2D7S A;  1TMM A;  1RCX B;  2RQM A;  2YKM A;  3MM6 A;  4OQJ A;  2QRR A;  5A2Q Y;  4NZ6 A;  4USJ C;  1PKU A;  2XLJ A;  3CCE S;  1TFY A;  2HYI B;  2HGN A;  1XK8 A;  2V8G A;  2VFU A;  2D3O 1;  1RWV B;  3BR9 A;  4V1A k;  1YJT A;  1YZ7 A;  1NPK A;  5KFA A;  4CP5 A;  2MQP A;  3JYT B;  4CQ1 A;  2DR6 A;  3RAQ A;  4DG1 A;  2BOP A;  3J81 j;  1FT8 A;  4KIA A;  4P74 A;  4KR0 B;  4WXO A;  4LF8 F;  2F8M A;  4CRJ A;  1YRX A;  4DV2 J;  3I0S B;  2WW4 A;  1R0A B;  1N48 A;  1A0O B;  1V3S A;  3PM9 A;  1BQN A;  4Y6I A;  5IWA J;  2FLL A;  2V0N A;  1IKX B;  2QIF A;  1TKX B;  5H1S V;  1WTF A;  3FNN A;  3M2U B;  4OZ3 A;  3THT A;  3ULH A;  3UVJ A;  3VZI A;  2LDI A;  2DH9 A;  5KFD A;  4OYW A;  1OIA A;  3MMC B;  4C11 B;  1RAO A;  3Q8R B;  4RBV A;  4UUW A;  5L1L A;  3K8W A;  1FFW B;  4AE5 A;  3MWB A;  4NLO A;  1G3O A;  2DGX A;  4OZ5 A;  2R8H A;  3OSP A;  5FLX U;  1SIZ A;  3H5X A;  3W61 A;  2LEA A;  4PWW A;  3M8P A;  3PXG a;  1TL3 B;  1ZH5 A;  1U02 A;  1Y11 A;  2HHU A;  2YXL A;  1TL5 A;  1H2T Z;  4I6W A;  1ITP A;  4NL5 A;  4H4O B;  2EK6 A;  2B9Y A;  2GIQ A;  4CT8 A;  2ALZ A;  3GR0 A;  3HSJ A;  4XK8 C;  3IRX A;  3H2L A;  1XR6 A;  2D74 B;  2FZG B;  2Q1L A;  3TAM A;  4LFC F;  3THV A;  1C1B A;  4KJI A;  3KUH A;  2H48 B;  3OLB A;  3TVY A;  1MMD A;  3AJ2 A;  4QIW D;  1FKA F;  2V67 A;  5HAO A;  4LMZ A;  4TY8 A;  4R0E A;  4A8F A;  3TX8 A;  3QT8 A;  4ZPC A;  4ZOS A;  1TKZ A;  4NA2 A;  1V5V A;  1FE0 A;  4TU7 A;  1AXQ A;  2L9W A;  5H9E K;  4DR6 F;  4DL0 C;  1VIS A;  2R8G A;  5A6P A;  3PDN A;  1FK9 A;  2XHC A;  3CCJ S;  1QTN B;  3JTN A;  1RKJ A;  4LF5 J;  1Y3K A;  4ES2 A;  3I56 S;  1ZM2 A;  2D1C A;  3Q83 A;  4M5I A;  2HFO A;  4CTA B;  2I2Y A;  4HVZ A;  1KQG B;  1M1H A;  1V6H A;  2HS4 A;  2AMC B;  2U2F A;  3LO3 A;  4OX9 F;  5J2N A;  1HQ2 A;  4RNF A;  4U67 Q;  2HMI A;  1W7W A;  5C2G A;  2QZ8 A;  1S1U A;  9ATC B;  4DSK A;  4MIB A;  5HMX A;  5KFM A;  2QGF B;  1OPZ A;  1NU4 A;  1T95 A;  5ETN A;  4FXW A;  4OJ1 A;  3TAN A;  1CSJ A;  4P2S A;  1M5P C;  2OUG A;  3J7Y U;  1IBM J;  1OY8 A;  4C6A A;  4ICL A;  3NOC A;  3QO9 A;  1XQI A;  2OPP A;  2EFQ A;  3GE9 A;  4LRA A;  4Y2M A;  1WOO A;  2VG5 B;  3SMZ A;  3U7J A;  2KM8 B;  2RUG A;  1HR0 J;  2CDR B;  4MKY A;  1JNZ B;  1VLY A;  2F8E X;  1NPP A;  2BOA A;  3X3U A;  2VV5 A;  1F3V A;  2D69 A;  4OYP A;  1KQK A;  2RE1 A;  8RUC A;  3LW5 C;  2DNR A;  3I5C A;  2FUG 9;  4TY9 A;  4WP8 A;  4TLR A;  2I0X A;  4PXE A;  2E5J A;  2M8H A;  3EDQ B;  1NKC A;  3J81 U;  2Q6B A;  2B9W A;  2OD6 A;  2YWW A;  3NCQ A;  5LL6 d;  4FKX A;  2V94 A;  5C25 A;  1TKX A;  3QMQ A;  1RWU A;  1S57 A;  2GC8 A;  2FIU A;  2LXF A;  2HHV A;  3BR8 A;  4Y2C A;  2HND A;  2LXI A;  3EIC A;  4X65 J;  3CCM S;  4EZ9 A;  1Q4R A;  2A2D A;  5IZH A;  1JLA A;  3QAT A;  4PPD A;  2K2P A;  4I6Y A;  1CEZ A;  2M0G B;  1IR1 A;  1IR0 A;  2CG4 A;  2C3P A;  3V81 B;  1L3T A;  2XM3 A;  1XWL A;  4CWB A;  3DGP B;  3D67 A;  1C0T A;  2CDQ A;  2GNK A;  1WI8 A;  4B3R J;  4KPY A;  3KKF A;  2VPY B;  3PX0 A;  3AJ1 A;  4K2J A;  4KHP J;  1GMW A;  2I38 A;  3PY8 A;  4M94 A;  2ZBR A;  4N76 A;  4ZLJ A;  4LBH A;  1Y0H A;  2V69 A;  3OFG A;  4MJK A;  2W9C B;  2B0G A;  5ETQ A;  3R9L A;  4A48 A;  3I0R B;  3LP1 A;  1CUL A;  1RHQ B;  3Q23 A;  1WKL A;  2XBP A;  3BO3 A;  1T03 B;  4F04 B;  4ER8 A;  3MOZ A;  4CH0 S;  1CS4 A;  2B8P A;  2LKZ A;  4F67 A;  1NDK A;  2X3D A;  3QIP B;  2COL A;  2FHK A;  4K5S A;  1VLO A;  2J9E A;  4RWW A;  1NME B;  1JLE A;  4YEA A;  1JXL A;  1N33 F;  1TZ0 A;  3JXO A;  2DB1 A;  4H4M B;  4I7F B;  5EUH A;  1NK5 A;  2QLB B;  2V4Q A;  1RT4 B;  3UI3 A;  1D9F A;  1RQ0 A;  2QEX S;  3ZZZ A;  4NEY A;  3MZI A;  3KHH A;  4K8R A;  3KK1 B;  3FRZ A;  1LEO A;  4FNH A;  2DBB A;  1RAA B;  3EVM A;  3G6E S;  4DR1 J;  4IFY B;  3KLH B;  4E98 A;  1RZM A;  3FQL A;  3LGM A;  1HMV B;  1TK0 A;  1XNR F;  4K4U A;  4LRC A;  2V4J A;  2DT9 A;  4ZHR A;  1YG0 A;  4CLW A;  3MEC B;  3W8P A;  4U7C A;  3VAI A;  4DLG A;  2HHX A;  2JEG A;  1S1V B;  4R25 A;  2PT0 A;  3M8Q A;  2XMW A;  4HT7 A;  4LJM A;  5HJX A;  3GON A;  1VK8 A;  1C0U A;  3N6L A;  1EP4 B;  1B0T A;  2X51 A;  4M5H A;  4LF7 J;  1N88 A;  4NMX A;  2AV5 A;  3IG1 A;  5CYQ B;  2W4C A;  5HN0 A;  4JV1 A;  3V4I B;  4CM0 A;  5DRK A;  3PZP A;  3PW4 A;  1GXL A;  1J27 A;  2MZQ A;  4KHR A;  4BLG A;  4N7T A;  4B3O A;  4LF6 F;  1YJU A;  1QDU B;  3FRY A;  1IKY B;  4OI2 A;  1YJ9 S;  1VBY A;  3R5D A;  2BDP A;  1DTQ A;  1H6K X;  2VFT A;  3N6M A;  3RBZ A;  5DG8 A;  1Y4Z B;  4UW2 A;  2XS2 A;  1REG X;  1A7G E;  5MLC V;  3K5L A;  4HKQ A;  4OJ3 A;  2ZOF A;  1WOS A;  5AXL A;  1KQS R;  2NR0 A;  4QYZ J;  4JI2 F;  2V50 A;  2V34 A;  4DV4 F;  3SCK E;  3CD0 A;  3D7S B;  3CJ8 A;  2CPZ A;  3DDK A;  4WFB Q;  3PYE A;  2UP1 A;  1G7C B;  2J6S A;  2HQG A;  1U25 A;  4YDX A;  4RBU A;  2CNO B;  3V2U C;  3KJV A;  4B3T F;  1R0C B;  2WOM B;  3GMG A;  1JLG A;  3Q86 A;  3EGN A;  4M5L A;  4IRD A;  2N3O A;  2FDN A;  1X5O A;  3DU6 A;  4DV7 J;  4DV0 J;  3G9C A;  1UJ6 A;  3FEZ A;  1LW0 B;  3MMA B;  2XZT B;  1Z4U A;  4HR2 A;  5DZ7 A;  5A0Y B;  4USH A;  3QRP A;  3P6Y C;  3CCL S;  2QX0 A;  4O3R A;  2DHH A;  2R3V A;  2J76 E;  2YPZ A;  1D1U A;  2VBZ A;  5KOW A;  3WC0 A;  3WDO A;  2Q3P A;  3ENV A;  5FDL B;  2DR5 A;  1UVK A;  1U45 A;  2XMK A;  3IM8 A;  2VJU A;  1FF2 A;  5F8J A;  2ZZT A;  3GIK A;  1VI7 A;  3G4S S;  3TRG A;  2UUC J;  4OI3 A;  2Y1R I;  2W8K A;  1SUQ A;  3BO4 A;  2LP4 A;  5CCM A;  3VZH A;  1N34 F;  1N32 J;  4C0B A;  4X4V A;  3DLG B;  4LR8 A;  4PQU B;  3S01 A;  1DTT B;  4DV3 F;  1BE4 A;  2HQF A;  2MSS A;  4OI6 A;  4ZVF A;  3ZZ0 A;  1JJH A;  1NK8 A;  1KWM A;  3D6F B;  5KFN A;  4WK3 A;  1FEE A;  1CJT B;  1UWB A;  2DHS A;  3LWL A;  4IUF A;  3Q8P B;  2RF2 A;  4NRT A;  1XBW A;  3C16 A;  5ETL A;  2GAH C;  2ZH2 A;  2VBW A;  5GAH U;  1WOP A;  2XGQ A;  4RW6 A;  3B54 A;  3PNI A;  4CT9 A;  1S1X A;  2HZC A;  1TFW A;  3HUL A;  4BWM A;  1XTZ A;  2MHE A;  3M4X A;  4ECR A;  3T5L A;  2OJ3 A;  3AQO A;  4NCG A;  4FYV B;  3KK2 B;  2DNN A;  2MLY A;  4DV7 F;  3T1H F;  3D0G E;  1NSA A;  2WK4 A;  4KV8 B;  2C2R A;  3NS5 A;  4WKY A;  5HVF A;  1IQZ A;  1S1V A;  2RT3 A;  1FJG J;  4PXD A;  2XCA A;  1HBO B;  1CQM A;  5HI7 A;  2J8A A;  4RW8 B;  4H4M A;  4I7F A;  5L1J A;  3RRH A;  5K14 B;  4ELV A;  2Z58 B;  1S0V A;  4WZQ A;  3QFH A;  8ATC B;  4YS2 A;  1IKW B;  5EDW A;  4V19 X;  3MR6 A;  2IBK A;  2Z2Z A;  2CQ3 A;  3OR1 A;  3EUN A;  4B02 A;  3LF0 A;  3KG4 A;  1UVN A;  4DR7 J;  1RAI B;  2HK3 A;  4QPX A;  1LXN A;  1FRK A;  1XMB A;  2LQ9 A;  3OD2 A;  1X8D A;  4HH1 A;  4X84 A;  2OSR A;  3BGR B;  5KG4 A;  4Q44 A;  1SBR A;  4DFM A;  3BBB A;  1VQK S;  5KTQ A;  4I2P B;  2DNM A;  3QLH B;  4O44 B;  2HHH J;  4LF7 F;  3HKW A;  4IDK B;  3TEH B;  1P6T A;  2B5J A;  2CFX A;  4C0H A;  2OD4 A;  2N7C A;  2L41 A;  3CVK A;  1N6Q B;  4ZPB A;  5HVG A;  4YFU A;  4ELT A;  2DIU A;  2KXF A;  1RA7 A;  1PSD A;  4QIG A;  1S9G A;  2L08 A;  1S76 D;  4E2F B;  2DYA A;  5JMN A;  4C8L A;  2HNZ A;  2AZ1 A;  3G6V A;  2OEL A;  4A8S A;  1VC5 A;  3AY0 A;  3SZ2 A;  1PBA A;  1OYE A;  3RZA A;  2OPP B;  3IGN A;  2MY7 A;  4ZP6 A;  1RT5 B;  3T19 A;  3M32 B;  3UVJ B;  4DDF A;  4C3L A;  3MPY A;  4I56 A;  2MZ1 A;  2W2N P;  2G0I A;  2CWK A;  4NA1 A;  5KFZ A;  2MMY A;  3GFH A;  5KFO A;  5D3G B;  1KRP A;  5CHC B;  2RS2 A;  3W7B A;  2V8D A;  3W63 A;  3NCP A;  3P4U B;  1T05 A;  3ENA A;  1HNW F;  2AW0 A;  1BUX A;  3BSC A;  2M7S A;  1DLO A;  4KT0 C;  4N77 A;  2BM1 A;  4KH1 B;  5A8W A;  5GAD I;  4UY8 5;  4DG1 B;  2FGC A;  1SQE A;  3E51 A;  1DAR A;  3KDN A;  3NWR A;  4C98 A;  4TVA B;  1X7V A;  4NWB A;  4DPX A;  3KLE B;  1X5P A;  1FDN A;  1J5O B;  2OP5 A;  2AYG A;  1S99 A;  4B3S F;  4K4V A;  2ACM A;  2XNR A;  2PEH A;  1JLC B;  2ROP A;  4ZPT R;  3R7N B;  4ED1 A;  1P9Q C;  5FDL A;  1RWN B;  2VQE F;  3J7A N;  1N34 J;  2NLW A;  4F4A A;  2IJN A;  3CPW R;  1FXD A;  3BKU A;  5DQI A;  3FK4 A;  2BE7 D;  2H1Y A;  3RBE A;  1SQF A;  4NA3 A;  1HW9 A;  2GW8 A;  2OPQ A;  3F73 A;  2E7W A;  2YWG A;  8AT1 B;  3MED A;  3SEO A;  2AYM A;  2VOO A;  2R7U A;  4F36 A;  3QRQ A;  4JI4 F;  5KOX A;  3BH6 B;  3ZZY A;  4NLR A;  4JV0 A;  3OJS A;  2NQP A;  3NL0 A;  2HS0 A;  3V5R A;  1LOU A;  1U1M A;  5AJ3 F;  1Y9O A;  4DPW A;  1FA0 A;  4DV5 J;  2DNY A;  3FBF A;  1CJT A;  1NND A;  1UWB B;  2RIL A;  2WB4 A;  4OLO A;  4OZJ A;  2E1M C;  4UQG A;  1HYS A;  3GFZ A;  5I4M A;  4J9K A;  1O8B A;  3I96 A;  3J7Z 5;  4LF4 J;  2UXB J;  2W9A A;  4NML A;  4OMF G;  2RUS A;  3KG0 A;  3HFK A;  4WFX A;  2ZFH A;  4ZLP A;  3FEY B;  5ETO A;  2WSC C;  4RNN A;  3CUN A;  2KHC A;  2QTW A;  3PRD A;  3SDE B;  2Z8Q A;  2F4V F;  2UUA J;  1FE4 A;  3CJ3 A;  5IT4 A;  3C46 A;  2V63 A;  4DS4 A;  2BJ8 A;  3I4H X;  2XMA A;  3WHI A;  2B7B B;  1VQ7 S;  4JV2 A;  1FKO B;  2DY9 A;  1MRO B;  4MFB A;  4AFF A;  6FD1 A;  5LSR A;  2LEB A;  4F4X A;  1MSW D;  5KFU A;  3FMB A;  1S0M A;  5KT3 A;  2Z2M A;  1GQE A;  1HA1 A;  3FKB A;  2HLU A;  2QV6 A;  3MHY A;  3MEG A;  1IM4 A;  4Y2A A;  4DU8 A;  4KH0 B;  3OVA A;  3BYR A;  4P9S A;  4DF4 A;  3MDF A;  4GO5 X;  1QTM A;  1B99 A;  1NUE A;  3GJT B;  3RR8 A;  1WKK A;  4LRD A;  3UD5 A;  3JQJ A;  5IWA F;  2IC3 A;  2N3L A;  4KFB A;  3HHL C;  4IDK A;  1HNI A;  4C3M A;  3OV7 A;  2H4Y B;  2J0X A;  3S6E A;  4U6P A;  2HPU A;  1IBL J;  2BAB A;  2GX8 A;  2EFO A;  1K73 T;  4OYA A;  4CCH A;  3FSX A;  2IFX A;  2YQ0 A;  2B3T B;  2DGU A;  4YB1 P;  3A8E A;  3MCS A;  3TZW A;  2PDA A;  3GWC A;  3IFE A;  3PHE A;  3W2W B;  5F3Z A;  1UVJ A;  1J5O A;  3KLI B;  2WSE C;  4G1I A;  3GTY X;  4JB8 B;  2W2P P;  2XQC A;  4P2M A;  2IY5 B;  4C0O C;  2F9D A;  2FHJ A;  4YR0 A;  4DOZ A;  3HD2 A;  4M63 A;  4FYX B;  4GVB A;  4YHH F;  3ILJ A;  4ECS A;  4L73 A;  1L3U A;  3C66 A;  3MEE B;  3A8K A;  2PO4 A;  2DGW A;  1T05 B;  2BKO A;  2IVF B;  3BO2 A;  3QSI A;  2J9D A;  2AGQ A;  2P9E A;  3IM9 A;  3DRX A;  3KFW X;  3M1V A;  5HLF A;  1JLE B;  1RXO B;  2KDO A;  2YKO A;  4C3K A;  2V8P A;  2FPH X;  3O44 A;  2N4D A;  4F4Y A;  4IG3 A;  2A18 A;  1JLB A;  1WG4 A;  2YH1 A;  4PAB A;  1I94 F;  3DCA A;  4LF5 F;  3HT0 A;  2Q6C A;  4K4S A;  4OI4 A;  5CZX A;  4C4W A;  2V9K A;  1HPZ A;  3DXS X;  2OMO A;  1NK6 A;  4LSN B;  1SL2 A;  4WFZ A;  1HMV A;  1XJW B;  4JI5 F;  1WUU A;  1WEY A;  1IWA A;  4NYO A;  4DQP A;  1V3R A;  4ED8 A;  2LA6 A;  1SH2 A;  4L3N A;  1ICE B;  1NHK L;  2NYH A;  1T9T A;  3NBP B;  3HSD A;  3ZXW A;  2XCP A;  2X1A A;  2GQQ A;  2F7V A;  1Q95 G;  4E0D A;  3IS9 A;  2HAI A;  5E3Q A;  2EKY A;  1IWG A;  3LGN A;  2J9C A;  2HBZ B;  2OI2 A;  3KNG A;  3HVT B;  3LGH A;  4RW7 B;  4EMD A;  2E1C A;  3C15 A;  1KVJ A;  2CNK B;  2W9B B;  3TAP A;  3O5T B;  1HBM A;  2IDE A;  1S6U A;  3U1M A;  1QAJ A;  5T7L B;  2MGZ A;  1M1K T;  1M5V C;  3T6B A;  3TUJ C;  4MKA A;  5LMN J;  4JI3 F;  2RML A;  1DQA A;  4DPT A;  2D9P A;  4L6V 3;  1S7I A;  3TWZ A;  4ZHR B;  3CED A;  5DDP C;  2DNQ A;  1DZ5 A;  2D41 A;  3GB0 A;  1Q82 T;  2ZH4 A;  2YQ1 A;  4FXV A;  3M8R A;  3UN2 A;  3D4J A;  1NSP A;  2R2S A;  4K4X A;  5HK4 A;  4MFB B;  3ISN D;  2EC0 A;  3P96 A;  4LQ3 A;  3QGH A;  2LQJ A;  4QW9 A;  5IM0 A;  1NH8 A;  4DV3 J;  4EYI B;  1B3T A;  4RW4 B;  2CAD A;  3UR3 C;  1SC4 B;  4QR2 A;  3TYT A;  4EEY A;  1DQ9 A;  4RPF A;  2JZ5 A;  4KKO B;  4ECU A;  3AD7 C;  1WC1 A;  4WFN Q;  2KRB A;  1TMJ A;  2E1R A;  4KHP F;  1NJI T;  4W90 B;  4YME A;  1BQN B;  4R8U B;  1FDB A;  2GMH A;  2OAU A;  4ZVT B;  1JWW A;  2O01 C;  1C4A A;  4CLL A;  5DM7 Q;  4LF6 J;  3PO5 A;  2KT5 A;  5F8N A;  4KB7 A;  5BYR A;  4J9Q A;  5IC4 B;  5B0B A;  1NK4 A;  5JXS A;  4WFA Q;  2NXC A;  4GRS A;  3FCV A;  4M5K A;  4WP9 A;  1R0B G;  1KD1 T;  2GS8 A;  3J80 Y;  4YR2 A;  3R7B B;  3EX7 B;  5CAA A;  1WI6 A;  3M6V A;  2DHX A;  4DHV A;  5EWE A;  1M5O C;  2EBE A;  3GJQ B;  2UUB F;  3UCU P;  4KC5 A;  1RHR B;  4CYU A;  2KO1 A;  4OIX A;  5CYM B;  4FPI A;  1OS5 A;  2NCK L;  2Q79 A;  1O0P A;  4P71 A;  1TKT A;  3EPG A;  2CVE A;  4UOC A;  5A0Y A;  4DL3 A;  2GO8 A;  4GC6 A;  2VDI A;  4ECQ A;  2VQE J;  3R2C J;  4Q0B B;  1C1C B;  5E5N A;  4F4W A;  4A8M P;  3M2U A;  1HBN B;  3V6D A;  5HBM B;  1VQ6 S;  2YKN B;  4KTQ A;  1C4C A;  4M1K A;  4QWE A;  2V9W A;  1B7F A;  1JJC B;  1U8S A;  1UA0 A;  2G0J A;  1FD8 A;  4ERD A;  1RHJ B;  1LWE B;  2DH7 A;  3BRE A;  2GMJ A;  4ZMM A;  2CQG A;  3EVO A;  3BQ2 A;  1VQO S;  4J9M A;  3FUY A;  3GIL A;  3IS9 B;  2OPS B;  3MCM A;  3W5Y A;  2R7X A;  3Q0A A;  1RU2 A;  4KYZ A;  1FK9 B;  3GZ7 A;  5JVG Q;  1YK9 A;  3P49 B;  2O1P A;  1CG2 A;  1N54 B;  4ATN A;  1GFW B;  2CQB A;  1ZTW A;  3G8Q A;  4IH6 A;  4KRW A;  4XDD A;  3CJR A;  1DHM A;  2JLE A;  4LF4 F;  1X4H A;  2HG4 A;  2VF3 A;  1FDD A;  1WG1 A;  4KE5 A;  2ZDP A;  1WHW A;  2KZZ A;  4NLQ A;  3CJS A;  3RGI A;  1VRU A;  3QGI A;  4FYY B;  3TEG A;  3I31 A;  2CUY A;  2B9E A;  4QR1 A;  4I6A A;  2IDL A;  2J7K A;  4XO0 A;  1E6Y B;  4NXN J;  2WVF A;  4YB6 A;  3ZZP A;  1U0S A;  3TR5 A;  1UVM A;  4B9L A;  3CMQ A;  1S79 A;  3DLJ A;  1B7Y B;  1E6V A;  1HHT P;  4C97 A;  2ZBI A;  1V3Z A;  4K5R A;  3S8S A;  2EBG A;  3WQP A;  1S9G B;  4YP3 A;  3KK1 A;  1VQP S;  5K8O A;  1VGY A;  3W8G A;  5KFE A;  1DAX A;  5LXR A;  2Y0S D;  3VHQ A;  3VVU A;  2DCU B;  2FC8 A;  3Q89 A;  1UFW A;  1RAC B;  5LMU J;  3W2V A;  5CCL A;  1B70 B;  1TV6 A;  2CZ4 A;  4ECT A;  4ED2 A;  3MCO A;  2EFV A;  4ZVH A;  1EX8 A;  5U47 A;  3CC7 S;  3VGT A;  4F0H A;  3EYZ A;  2CRL A;  5KAK A;  1P1T A;  3R5A A;  1U1L A;  1MRO A;  1PYT A;  1UFL A;  3BGF A;  1X31 C;  4NI2 B;  2VG5 A;  3AHP A;  1DY3 A;  3MPW A;  4WJB A;  4F0M A;  3Q2T C;  5CYQ A;  2JEI A;  2XS7 A;  4P7T A;  3NY0 A;  1Q78 A;  5D4P A;  4K4Z A;  1H73 A;  1EET A;  5KFL A;  1R89 A;  1T9Y A;  1N5Y B;  3BYP A;  1M90 T;  2HQD A;  4IH5 A;  2CPE A;  2OPR B;  4H4K A;  4RWX A;  5EX0 A;  3VCD A;  5LJ3 Y;  5DDR C;  3BN7 A;  4LF8 J;  3R5B A;  4PQA A;  2VAS A;  1LNQ A;  4WII A;  1SC1 B;  4JI6 J;  3PW2 A;  2WW8 A;  4PYD A;  1NKB A;  1WSV A;  3NGR A;  1FFG B;  4TQS A;  2YKN A;  3GIJ A;  1IBL F;  1YRU A;  5D78 A;  4DQS A;  4FF1 A;  5AE2 A;  1G2E A;  5IQ6 A;  2DGQ A;  3ETO A;  2B4U A;  4QPT A;  4B9S A;  1VFJ A;  5AJ3 J;  1X4C A;  2OEM A;  3V6K A;  2DR8 A;  2R7O A;  4LSZ B;  2I6W A;  2AU0 A;  4UZB A;  1S4F A;  1HNZ F;  2QT7 A;  2VG7 A;  5J2Q B;  2UV8 A;  2AJF E;  3IRW P;  3HT3 A;  4ECZ A;  1UJ5 A;  5CYJ A;  2M8D B;  1RBA A;  2ZKU A;  5LJ5 Y;  3UQS A;  2ZVI A;  4LRB A;  1ULR A;  2NYI A;  3LA0 A;  2F4V J;  2DCL A;  4FVC A;  5KG5 A;  5L1I A;  1I1G A;  1CVJ A;  3ZZO A;  1ZAV A;  2E9R X;  3F0N A;  3OR2 B;  4ZKA A;  1NJW A;  3B6B A;  1FCA A;  1L3K A;  3Q24 A;  3MUM P;  1TL1 A;  2XWY A;  3AD9 C;  3BZQ A;  4ALZ A;  2AEF A;  2R42 A;  1A6L A;  1RWM B;  3TX0 A;  1FJG F;  4BDP A;  1LWE A;  2FHJ D;  2C2O B;  2MKH A;  5DZ6 A;  5F0U A;  2DHG A;  1AYE A;  5H9F J;  5IQQ A;  3NGD A;  5KT5 A;  4IYQ A;  5D8H B;  2XLK A;  1FKP A;  2HAF A;  4XDC A;  5IXU A;  4NZ7 A;  2AEM A;  3SIP B;  4ZCI A;  4RW6 B;  3LP2 A;  3AT1 B;  4O3Q A;  3ZC4 A;  3VAH A;  1FFS B;  1YZ6 A;  1RT3 A;  2AD9 A;  1Q8B A;  1J5E J;  5DLG A;  4LSL A;  4MYU A;  2XY5 A;  4IQX A;  2VOP A;  1VIX A;  1H3D A;  4UOF A;  2EEY A;  2CQP A;  4IQM A;  1F2G A;  1DTQ B;  1ZA1 B;  2RKI B;  2HS3 A;  1KVI A;  2G2O A;  1R7I A;  3H4D A;  1I94 J;  2ATL A;  1NDL A;  1HNX J;  2PFF B;  1NAQ A;  2AX1 A;  3MM6 B;  3PV8 A;  1CBK A;  3IR7 B;  4EI2 A;  5HQL A;  1C0U B;  2CJQ A;  1YWX A;  4KGK A;  3CJ0 A;  1HBM B;  5DGB A;  1Q79 A;  4U7U D;  2HEK A;  4QIF A;  1KTV A;  4Y0F A;  4NXM J;  3D3B J;  1KBR A;  5FD1 A;  2MGZ B;  4LFB J;  2ZJP Q;  4BBY A;  3SQO P;  1S4E A;  5J2M B;  1RWO B;  2FLN A;  1R43 A;  2BA9 A;  1DFD A;  1CQN A;  1V5I B;  2LQ5 A;  3FBB A;  3MMJ A;  1X9M A;  3BDP A;  3UPF A;  2VG6 A;  3OTD A;  2CQD A;  2DNH A;  2HNY A;  2HZA A;  2VU5 A;  3HHL D;  3OHB A;  2E9T A;  1K1Q A;  3QJJ A;  1MLA A;  2UZA A;  2HHQ A;  5KFK A;  1HI0 P;  4IRC A;  4C8Y A;  5D0H A;  2Q66 A;  3IAS 9;  4WFY A;  4ENO A;  4DCJ B;  4PXB A;  5L1K A;  2M5Y A;  2YKM B;  4OX8 A;  4YB7 A;  2R7W A;  2UU9 J;  3K7R A;  1SB6 A;  2HW3 A;  2KH9 A;  1AB8 A;  1UTA A;  3OT9 A;  1SUQ B;  3DOK A;  4KO0 A;  1VHF A;  5B09 A;  2CJK A;  5A8R B;  3CCR S;  1EET B;  3ILL A;  2CA9 A;  2MB0 B;  5A8K B;  2WZ1 A;  3TVK A;  1S6P A;  5KFC A;  2R8K A;  2C28 A;  1VC6 A;  1KDN A;  3N5F A;  1R8H A;  3R2D J;  2AJ0 A;  2DGT A;  1OQ6 A;  1Z2L A;  3EWG A;  4MTP A;  4RR5 A;  1LFP A;  4IG3 B;  1NZ8 A;  3W5Z A;  3M32 A;  3OL6 A;  2PMW A;  2P6S A;  1LWC A;  2YWE A;  3C16 B;  3TAQ A;  3J7Z T;  2JLG A;  2HFS A;  1WD6 A;  3SQG B;  2YNH B;  4TQR A;  2VPW B;  4ZLL A;  3DI6 B;  4LIW A;  2F65 A;  5K9F A;  1QSS A;  1W25 A;  3WZ0 A;  2JEJ A;  2KJV A;  5ETM A;  1LK7 A;  5D4L A;  1R8P A;  2WBM A;  2YKA A;  4A4J A;  3KTQ A;  3QYY A;  4YDD B;  1YBU A;  4CYU B;  2HHW A;  3N0V A;  3OSN A;  4KV8 A;  4WKR A;  3DGP A;  1VYA A;  3HHL A;  2HZV A;  4UT4 A;  3TI0 A;  4O4G B;  3OLA A;  4DWI A;  3J7A 1;  1KP6 A;  4DZ6 A;  5HAN A;  3M2R A;  3NGT A;  1SJF A;  3HSG A;  3AJD A;  2DO0 A;  4LRE A;  4C2M A;  2HGL A;  3DHX A;  3VV2 B;  3H7H B;  3OTC A;  2IA0 A;  3SCL E;  5L46 A;  2VON A;  1LKZ A;  3FFI B;  2DNG A;  5HBM A;  3JQM A;  2V2Z A;  3QWU A;  4OYM A;  3TZY A;  1VHI A;  4BS2 A;  5KFS A;  4BC7 A;  3TAM B;  4OHZ A;  4DR3 J;  3DC2 A;  3TA2 A;  2P9G A;  1HNW J;  1S49 A;  3CCV S;  3W5X A;  3LP0 B;  4DUY J;  2PSZ A;  2BQ3 A;  2YBV A;  4I4B A;  2PMZ D;  4CZC A;  3K0J A;  3O8W A;  3NNH A;  3CUL A;  2FY1 A;  2AHO B;  3CCU S;  2UVR A;  2DJW A;  5AXM A;  1M5K C;  3KWM A;  3PFO A;  3QSY B;  1HBO A;  1Y00 A;  2QL7 B;  1SKW A;  1RAJ A;  4NRU A;  5FLX Y;  2KB2 A;  2B6A B;  1K44 A;  1TL4 A;  3QID A;  4U7U K;  3CCS S;  1SH3 A;  4LUB A;  1N5S A;  4X4T A;  1TUG B;  2DNP A;  3IWL A;  1WC3 A;  3LOU A;  3MM8 B;  3VAL A;  4J9N A;  3G2X A;  2Z2L A;  3IC1 A;  3RUB L;  3RR7 A;  1VK3 A;  2DRA A;  1HNV A;  4NOH A;  5L9X A;  1RHU B;  3QWP A;  2E5L F;  3A13 A;  4I1T A;  2MHN A;  3HM9 A;  4DR4 J;  1UMJ A;  5E3C A;  3RB6 A;  3LTO A;  3NKY A;  2HVI A;  3ISN C;  2QN6 B;  2M52 A;  3CCQ S;  3QO9 B;  3EM1 A;  5GME A;  2NXN A;  3R7S B;  2FY8 A;  1T11 A;  2DXF A;  2IRX A;  3QZ7 A;  4B3M J;  2SXL A;  1JB0 C;  4JI0 J;  2MST A;  1JK9 B;  4RNH A;  4X64 J;  1DBD A;  2CPX A;  4ETZ A;  2ERR A;  1Q0N A;  3GJR B;  2BR0 A;  4ZCK A;  5GMD A;  4PYA A;  1TEL A;  3EGV A;  1N36 J;  3I5B A;  2DR7 A;  1B0V A;  3P8B B;  4O3O A;  2AP6 A;  2KYX A;  2Y1L B;  2UUT A;  1P8G A;  2ZH3 A;  4DV0 F;  5C5J A;  2Z4P A;  2MJU A;  4I68 A;  4K4W A;  2X7I A;  4AYB D;  4LVO P;  4DUZ J;  1S9F A;  5I3P A;  1RUS A;  3M6X A;  4KPC A;  5KFQ A;  4J9L A;  2R7S A;  2KM8 C;  4W98 A;  2DEJ A;  3UNG C;  1QVF R;  4AXJ A;  2AIR B;  3CJQ A;  1J2V A;  1VBZ A;  4ZCM A;  3LP1 B;  1P1L A;  2D3Z A;  2EPI A;  2OPQ B;  3IO1 A;  2JJ4 D;  4URS A;  3W65 A;  1X4F A;  2M4M A;  1ZBT A;  2U1A A;  4WTY A;  4LFA F;  1RKI A;  5K5M A;  4F0K A;  2ZC3 A;  3MAA B;  2V5H G;  3AA9 A;  3OTE A;  4CO5 A;  3QJP A;  5B0A A;  3POT B;  3UNY A;  1UZD A;  2EKN A;  4CO3 A;  3I6P A;  1C2P A;  2V4R A;  4ELU A;  1MWZ A;  2NSB A;  2CQC A;  2UVW A;  2OEJ A;  3AOB A;  1ARO P;  1AFJ A;  1KON A;  4YY3 J;  3RTV A;  3D2W A;  2O3D A;  4O23 A;  1D0E A;  2CXE A;  3CIM A;  2EG2 A;  3WIV A;  2MQQ A;  3JSY A;  4X62 F;  2BV3 A;  2F8H A;  1UW4 A;  4G1P A;  3VAG A;  3W66 A;  3D1O A;  4ZJQ A;  2DNL A;  2FJE B;  1F2H A;  1T9V A;  3K89 A;  1RLD A;  3GCX P;  3BJY A;  1FD2 A;  3ILO A;  4P2F A;  3JAM Y;  5HLF B;  1X9S A;  1QAY A;  4DZD A;  1DJ0 A;  4A8W A;  1LWX A;  3QIP A;  4B9N A;  4JI6 F;  4FN5 A;  1WEX A;  3OPK A;  4LT6 A;  1SC6 A;  1Q86 T;  5GAE I; 
#chains in the Genus database with same CATH homology
 3DOM B;  3DGP B;  2JNJ A;  1YDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...