3DOMB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3domB00
3DOMB 1YDLA 2JNJA 3DGPB
chains in the Genus database with same CATH superfamily
1YIJS 2RQCA 4DFKA 2F9JA 3T9NA 3H5YA 1WOPA 2I6WA 3MWBA 2P9CA 2B6AA 3M8RA 2HRUA 3N79A 4N56A 4ZOSA 2XULA 5JUMA 1HNVA 2IA0A 2OPPB 3EUNA 3QAUA 4JUZA 2GHPA 1H38A 3KLFB 4TY8B 1ZM3A 2CADA 1VQ9S 4FXWA 3C8YA 2DGQA 2NXNA 1PJ6A 3H90A 3JQMA 1G3OA 3IS9A 3FC9A 4PQUB 3EVMA 2HIYA 1TL1B 4CLTA 1XK8A 3QGIA 4OHZA 3ULHA 4ZVQB 4CM2A 3NNAA 1S57A 4QWDA 2UUAJ 5GMDA 4J7CA 1FTRA 4CO0A 4KGVB 3PX0A 3LO3A 4CZCA 1S5ZA 5CYQA 2L9NA 3UQSA 2ABYA 3VCDA 5T7LB 1WJ9A 3ETOA 4DX6A 1N0UA 5DDRC 1TTHB 2LQ8A 1HQEA 5FIIA 3JYTA 2XZDB 3K17A 3AODA 2G0IA 2WVBA 3FQLA 2DH8A 1EETB 2CYYA 1S48A 1U45A 2MQLA 4B9UA 3QRPA 4MIBA 2P9GA 3BF4A 1UW4A 2HNZA 4EFAC 3M9OB 4MKYA 4QWEA 1CVJA 1JLFA 4RNFA 5GAGI 2LQJA 3DFEA 3T1YF 4ZP8A 3NBPB 2H1YA 1X9WA 1XMBA 4ZCKA 4WE1A 4W92B 2RRBA 4MYUA 4E2FB 4DR5F 1RAOA 3FCWA 4RUBA 3HHLC 3M8ZA 5EWEA 1P6TA 3EM1A 2MQNA 3ICLA 4O4GB 2FGCA 1NJIT 5F8MA 2WSCC 4GO7X 4EZ9A 2YWWA 1J5EJ 2DNLA 2DEIA 2QSWA 2HBRB 4KGMA 1S9FA 4I64A 3U27A 1FRJA 3R97A 1NDCA 3BM7A 4IRCA 3VGTA 3HHLA 4I0WA 2FVQA 3A3NB 3B8HA 2AGPA 3N6MA 3KK1B 3CTRA 2DK2A 1URRA 3J81U 1ZM9A 1X4EA 3UFCX 3W61A 3BV8A 2YWGA 1VYAA 2Z58B 4K7QA 2HQFA 2HHHF 3R2DJ 3MTJA 3MM8A 2W7AA 1X4BA 2CQHA 1I51B 2CG8A 4D3HA 4LIWA 2HURA 2ZBRA 3V81B 2VOPA 1I1GA 1YBTA 4NI2B 3KFWX 4DUYF 2FZCB 2HQDA 5KT4A 3I4PA 5IT0A 4DV7F 3GLJA 1N54B 3DM2A 4YR0A 3NOGA 4DUZJ 4X4SA 2HHUA 3OJUA 3AB2B 4M5DB 3C6TA 2QMUB 3SDEA 2EC2A 3K8WA 2V4QA 1K1QA 4IFVA 2FY1A 3EGNA 3J7ZT 1GXLA 2XG8A 4ZVHA 2W4DA 5BR8J 1VLYA 3UDVA 2BUNA 4L73A 2L9DA 4KPYA 3D6HB 1IBLJ 2ASLA 3QRQA 2VQFJ 2V4JB 4YY3F 1YLXA 2PI4A 3G6VA 4F02A 4DV5F 5AE3A 2D3UA 1RAGB 1IKVA 1BQXA 1RWVB 3OHBA 3AOCA 4LSNB 1RTIB 4LF5J 5B0DA 3L7PA 2IY5B 4XIUA 4LF2A 2YVSA 2C42A 1FDDA 1QJHA 3LAMA 3IAM9 4M1KA 3TUJC 3AFGA 4HACA 4R8UB 2ZBCA 1CLFA 1SBRA 2RSQA 1NH8A 3BBFA 4X4TA 4NLXA 5A8RB 3OHAA 2VPWB 2YNFA 3PX4A 3EPGA 5DGBA 2WW8A 4N5SA 4DS4A 2W1BA 3DLEB 3L09A 2I1RA 3QFHA 2P8IA 3MPWA 3H5UA 1SH2A 1IR1A 1WF2A 3DRSB 1Q8BA 5GAHI 2J8SA 4LVOP 4UOFA 4DR1F 2QN6B 3FK4A 4LJMA 1NK5A 4LF4F 2E7VA 1YI2S 1NB7A 1W26A 3M2VA 4TU9A 4OX6A 4URQU 1QY7A 2KI2A 4FF1A 4FKYA 1HBOB 4AL7A 1PBUA 3DGPB 2RDDA 3R3TA 1JK9B 4ZIVA 3US5A 4FYWB 3F56A 3I9V9 3NCRA 3R6GB 2VKZG 3QIPB 3IGVA 3R1HA 4CLFA 2V2KA 1NSAA 1TVRB 3BSOA 3FNNA 5KG4A 3UW1A 3DU6A 4L76A 2FB0A 3A1YG 2HVZA 2ZJQQ 4USIA 2M5YA 5KFKA 3M7VA 5GAGU 5K20B 3MEKA 5F8IA 5E3AA 1U49A 3D1OA 4DUTA 4LRCA 3PYEA 1JXVA 2VG6B 4P10A 4G3IA 4K4UA 3TEGA 3MECA 1KNZA 1GTHA 1U2FA 3OV7A 1M1HA 1PSDA 2RIJA 2F5GA 3N6NA 4WIQA 3IAS9 2PI5A 2ZH1A 2AJ0A 5LMUJ 1R6YA 4RBUA 4B9NA 4W98A 1KOOA 5IXUA 4O44B 4URGA 2W9BB 3DRPA 2Y3YA 2YBVA 1BGXT 5BJRA 2BM0A 3JSRA 4FF2A 3W9IA 2MEWA 2EFVA 4ZLJA 3Q8VA 4LF6J 1Q8IA 1T9TA 1WC1A 3R27A 1Y5IB 1FRKA 4Z2XA 4EYHB 4KYZA 3VALA 3CULA 1WC0A 5CXTA 2QTWA 4ATNA 1KWMA 1PO6A 1W2IA 4HI1A 4YR2A 1JLGA 2WB4A 4F4ZA 1U6FA 1S0NA 3BO2A 2LVWA 2XY6A 3PW2A 4DV1J 2DO4A 1BE4A 4X4QA 1JLCB 2XI3A 3LP0A 2BE7D 1KFSA 4ZN1A 4F4WA 4ID5A 1CJVA 1U24A 2V8PA 5C2CA 4LRDA 3KKFA 2B4UA 4LF9J 4MT1A 1XR6A 5KFMA 3NGKA 1X9SA 4NZ6A 4G1PA 3CJKB 3KLIA 4HTJA 3M2UA 1Q81T 2R2UA 2YNIA 4PPDA 5D78A 5A8WB 4HLBA 3MXHP 4O0NA 1B7YB 2HK2A 3KK2B 3PRVA 2YH1A 2AJ4A 2WRMA 2O5DA 3KJQB 4FNHA 2MKCA 4RW7B 5JMNA 2E9TA 1V5IB 1MROB 1JXLA 5L1KA 2BRKA 2G0JA 4U67Q 4BDPA 2APOA 2HLUA 2KRRA 2A2CA 1Q86T 4I6WA 3MR6A 4CIOA 3HXMA 3A4TA 2GMHA 3GYGA 2PD1A 3WX8A 1RGVA 2KDOA 2OTJS 2Z2LA 1WEZA 3IBWA 3LQVA 4IFYA 2C2ZB 2EKYA 4ZHRA 3N0VA 2CPYA 1D8ZA 1S1UB 4KHPF 4FP9A 1BLUA 3IRXA 3UI3A 4NA1A 3Q86A 4KTQA 3SQOP 1WG4A 2KJWA 5HQLA 1VBZA 2X1FA 4JI5F 3ZTOA 1YJTA 2G1HA 4JYAJ 2YQ1A 5I42B 2LXUA 2ZD1A 3SFUA 1S1WA 4RL1A 1XTZA 2VIHA 1R7IA 4IRKA 3H4DA 2B9YA 2MZ1A 2BX6A 3D6TB 2KKHA 1TR0A 4QIWD 1Z4UA 3DLGA 4JI8F 4UTGA 3AOAA 3LP2B 3MAAA 2W9AA 3QRRA 2RRNA 4A8OA 5HMWA 3LW5C 2B7BB 5E3PA 1K0VA 1S1XB 2M8HA 1UWAA 1QTNB 4ANEA 3BO3A 5KT5A 2XCAA 4NEZA 5LMNF 3GQCA 2RB7A 1QAJA 1RTJA 2FHMA 3M8SA 2AIRB 4U6PA 3P49B 4N77A 3T5HA 3GSDA 4D3GA 1FESA 2M4MA 3W8GA 2N3LA 3V6DB 3UVJB 2R8JA 1R3NA 3D6FB 2XQCA 5ETKA 3K59A 4M63A 4F2RA 1HNWF 4K2XA 1GXUA 4F0MA 4K50A 4X4PA 2ZNYA 3V6KA 2AT1B 4DN0A 5KT6A 3W60A 4O4RA 2J9DA 2RHQB 1SPBP 2CAJA 3DLKB 4O3NA 2HHXA 2ZVSA 1Q7YT 1AZSB 1TV6B 5LJ5Y 1S6UA 4L75A 3AJDA 3IWNC 3G4SS 2R9LA 2ZM6F 4J9UE 2YH0A 4BS2A 3HPOA 3CCMS 3JXOA 4IRDA 2FJVA 2HFVA 2F1FA 2OUGA 4LFAF 1TL3A 3CNQP 2FJXA 1B0PA 5D0EA 1B3TA 1RT4B 2FLPA 1L3KA 1WHWA 2P6TA 4OZ0A 3IR6B 1IR2A 2ZEJA 4NLYA 4UY85 1CQNA 3BS9A 2WONB 3C14B 5A0YB 1AA1B 3CPWR 1R89A 2XLJA 1SIWB 1AB8A 1KQKA 4H4MB 4KE5A 1T9UA 5T41A 2ZHBA 3RR7A 1KN6A 2OPPA 1ZM4A 4DV3F 1RLCL 5E3QA 2DT9A 3KLFA 4TY8A 3A13A 1N4LA 4WP3A 3RBDA 1UVJA 5CZXA 1AYEA 1HARA 3J81j 4PQUA 2F3JA 1VRTB 1TL1A 1UTAA 3CE8A 4TVAB 4HDGA 4YFUA 1RSCA 4A46A 4ZLNA 2NQPA 2MPUA 4LF7F 4KQZA 9RUBA 2UUTA 5KFWA 5F8JA 2XTJP 5GMKa 2Y0BB 1VQ5S 4WFBQ 2GIRA 4PXDA 2VJUA 1T95A 1YZ7A 3ZTQA 1BQNB 3EE3A 4ED1A 5T7LA 4H4KC 3RBXA 5J2MB 1TKZB 2CQCA 2R7SA 1NCLA 1EETA 3IR7B 5AT1B 2ASJA 1I94J 1TL5A 1NK7A 3MGJA 3QT7A 2V8VA 2JZ5A 4PG7A 3ZC4A 3T1YJ 4K5RA 1JXEA 1MLAA 3NY0A 4K4TA 4NLSA 4DHVA 3RB0A 4H4KA 2V67A 4WYLA 4OX9F 3NBPA 4WF9Q 3RYLA 1QVFR 2DEJA 3CCWA 3OT9A 2CPIA 3GV7B 4ED6A 1TKTB 2DB1A 4HDHA 1R0BG 4PPZA 1UFWA 4O4GA 4QYRA 1X5TA 3MOZA 3QGHA 1C1BA 1TELA 5H9FK 1OMSA 2VG5B 3TZZA 2A6MA 5GAEI 5BYSA 4DEZA 1SL1A 2WB1D 4C4WA 1B7FA 1ZS6A 3IO1A 3QSIA 3PJWA 1AXQA 3OTDA 3NMAA 1S0MA 4TU7A 2YKPA 1FDAA 2AWZA 4O3RA 2GVDB 1NZAA 2HFUA 3KHLA 2HFSA 5HROB 4NMLA 2M8DB 2HHHJ 1EX8A 3D66A 1FF2A 2EC0A 4LBHA 2MQ8A 1E6VB 2IBOA 3W5YA 5F3ZA 1M1KT 5LSLA 2IRYA 3ZXWA 3GJSB 3CJ8A 1M1GA 5KFAA 3THPA 5ETOA 1TKDA 5KFOA 2PGCA 2HMIB 1N5TA 1IWGA 4DUYJ 5AJ3J 3TX0A 3V81A 2R2RA 4NI2A 2DPIA 4ZS6A 2QA1A 3PW7A 3GP9A 4HR2A 1VRQC 3V2UC 2IHR1 1DY3A 2HZVA 2ZITA 1T9VA 5KG2A 1RWKB 1CEZA 4JV1A 5KG6A 1BHNA 4FVMA 5DDQC 4M5DA 1PKUA 4OZLA 2XHWA 5HI7A 4EK2A 2DVIA 2KZMA 3D0HE 2X1GA 1F3VA 1GMUA 1Q16B 3W1YC 3HK2A 2GQQA 2M3DA 2VDHA 5CQGA 4YY3J 3DDIA 4DV5J 2LA4A 2ACYA 2J76E 2V4JA 4R0JA 3MUTP 3KTQA 2NUHA 4KRWA 4FYVB 3CC7S 4N8OA 3HM9A 4WK3A 1SKSA 3KJVB 2KHDA 4LSNA 2CQIA 3K0JA 2HNDB 2ZHOA 1RTIA 1VC5A 2E29A 1KLMB 4ZVEA 2OEMA 4OJHA 2G0CA 3E51A 1H6KX 4DCPB 1KS2A 1QUPA 2XMTA 1TAUA 4R8UA 4NCGB 2DISA 4WZMA 2DD8S 3W2WB 4XO0A 1NBEB 4X84A 5A8RA 3VVUA 2LMIA 1JLBB 1MNEA 3DHXA 5KFLA 4RWWA 7AT1B 3DLEA 5DZ7A 1UVIA 4USHA 5FLXU 1N34F 4NRUA 3HF5A 1Q4RA 3DU5A 2HHWA 4CYUB 3DRSA 3AJ1A 2VOOA 2VPXB 1B64A 2HQGA 2KHCA 3KDNA 1HIYA 2GIFA 1TMJA 1FJGF 2XCPA 2FHOB 4PABA 4Q2MA 1HBOA 3DGPA 1NXIA 2BV3A 5KAKA 1N8RT 4HL9A 3M8QB 4PWWA 1K1SA 1QSLA 3CJQA 1NPRA 3DRXA 3QIPA 2KO1A 1SCJB 3S01A 1TVRA 1WKLA 2MQQA 2DHHA 2HVEA 4TKTA 2GA7A 4MIAA 2V2QA 2IRXA 4ZPCA 3CD6S 3HO1A 1DLOB 4GRSA 5D0RA 4UZCA 4FYDA 2VG6A 3PG9A 3OR2B 4B9LA 1HI1A 3D7SB 1QD1A 3CCSS 3GCWP 5CH7B 2JLGA 5BXIA 2B51A 2VH7A 1MMLA 5EN1A 4MH8A 4X4RA 2ERRA 3DMJB 2KFYA 3ZO7A 1OY9A 2E5IA 3THTA 2IM0A 4IDKB 4QR0A 2IJRA 1NSPA 1IJEB 4F0KA 2KG0A 5J2NA 1U2RA 4O44A 2R8KA 1AW0A 1P8GA 3W64A 4NLWA 1WHVA 2W9BA 5GAEU 2MZTA 4YUDA 2QG9B 3IA0A 5K8NA 3UR0A 2C3OA 4F3MA 2J8AA 4EI2A 3JQJA 2AKWB 2VFVA 3GSIA 3B4DA 3T1HJ 4DR7J 1FDNA 2RU9A 2XY7A 3DLJA 2E5GA 1MMDA 3BBBA 2V94A 1N33F 2ROGA 5EUHA 4I6AA 2OI2A 1H7WA 4CWBA 4C6AA 5J1NA 5HBMB 2ATLA 2MXYA 4MIWA 4FNIA 4O23A 5HK4A 1JLCA 2UXCF 3U1LA 3CJ3A 4W90B 2VBYA 2OAUA 3I4HX 4QU6A 3GFXA 5H1SV 4LQ3A 1YRXA 1KKHA 1H2TZ 4RR5A 2WAQD 3MPDA 1QAYA 3H20A 1VDHA 2R8IA 3LP1B 2GAGC 2Z8QA 3DYAB 1Q1KA 1BWVA 2HVIA 4ZCIA 1HLWA 2DNQA 3CJKA 4F04B 3ZTSA 5L9NA 5DG9A 3TI0A 5ETSA 5A8WA 2HHQA 3AD7C 4Y2CA 2HBYB 1IXKA 3VAIA 4YMEA 3E01B 2MB0B 3DOMB 1RT5B 3KG1A 1VQ8S 3KK2A 1VBYA 1WC4A 2YPZA 1Y3JA 5I3QA 2EBEA 4RW7A 1KHVA 4NA3A 4CO5A 1QUVA 1ZTWA 1MROA 3GPAA 3PRDA 2EG1A 2RDIA 5ETLA 1TAQA 1VLOA 3Q2SC 3M1VB 3QPIA 2FVPA 3AT1B 2JC1A 2MZSA 1EARA 2DO0A 2F4VF 2KZZA 2VONA 1KR4A 1VISA 3HZGA 3BO4A 1GK8A 3OVAA 4JV5F 2ILYA 3MAHA 4L3KA 2DNOA 4GKJF 1B99A 4ED5A 3JQKA 1S1UA 4NLQA 2AHOB 3R2CJ 4NASA 2D3ZA 4YB7A 3CJ5A 3ETMA 2BYCA 1U8WA 5LT5A 4H4OB 1WI6A 3GIIA 4P7VA 4ZJLA 1SXLA 2YPYA 4EUVA 2XBPA 4RUHA 2XYHB 1FKAF 1PG5B 2H51B 4KO0B 4ZITA 2XMWA 2HFOA 1NH7A 1OJ4A 3MMBB 4K0KF 4BCAA 2FHKA 3CT9A 3KOAA 4TY9A 5LMNJ 1WG1A 3CGIA 2QJ3A 1S1XA 1Q79A 1YJUA 5D4PA 1ZAWA 2VA3A 2LQBA 4J9NA 4JV0A 1P1TA 3OBIA 5HATA 4PQAA 1F2GA 3IWXA 2HWHA 1U4BA 1UKUA 2XHCA 2BOAA 3IN5A 1U1MA 4PYDA 1XBWA 1WTFA 1HWLA 2VL1A 2XMAA 3TVZA 3V5RA 5KFZA 2VFSA 2X1AA 3UCZP 3V6DA 3UVJA 3VWSA 2ZH5A 2BBEA 3L7UA 2GS8A 4R5PB 2IA6A 1R8AA 4DMZA 2ZOFA 3N6LA 2JRSA 3JS9A 3I0RA 4NZ0A 3ZZOA 4FZVA 3QLHB 2QA2A 1G4CA 2XO7A 3GILA 4LFCJ 2VQEF 3DLKA 1R0CB 1AZSA 1TV6A 1N5QA 3D1HA 3HCXA 2HFZA 1DQ8A 5EX0A 1VQPS 2R2TA 4J9OA 4Z37A 2ZM6J 4Q8FA 4HH1A 4JI4J 4ZIWA 5K8MA 4U9RA 3D5MA 4EGLA 1HFEL 3BR9A 2YWHA 2HEKA 3D68A 2BANB 3IXQA 4OX7A 1RHJB 3CCUS 4DU8A 3FJ2A 1RCOB 3R5AA 1ZBTA 5EGYA 4ECVA 1NK0A 3GCXP 1RT4A 4WFYA 3ISNC 3O6QA 5HMXA 2ZC4A 2J5AA 4J9LA 1FXDA 5LJ3Y 2EBGA 4UQGA 2WONA 3C14A 5A0YA 1UWBB 4Q43A 2CPFA 2ZBIA 4H4MA 9ATCB 2W9CB 1HNXF 4ZP6A 5LXRA 4QYZJ 2L48A 4GC6A 4ECQA 2C2KB 1JIHA 2MTLA 3C3LA 3HZEA 1JLAB 4ZVTB 5MAOA 1VGYA 1DTTB 4CH7A 1IBMF 4OYXA 2V5HG 4P7TA 4LF7J 1VRTA 3NWGA 2HKEA 5E7OB 3J7YI 4JI3F 3V4IB 3KYLA 1NJZA 1C0TB 4V1Ak 1XQIA 3EXCX 4RBTA 3DHWC 1RK8A 3MR2A 2AV5A 3D6MB 4ILMA 3VAKA 4BWMA 2XEXA 1LK5A 1BQNA 5A76A 3QIDA 2HWIA 4IO9Q 3I0SB 3UPFA 2FLNA 2E1RA 2DXFA 5L46A 4G1IA 5J2MA 2RJZA 1TKZA 3KK3B 1CBKA 5AXKA 1FI4A 2POKA 1WG5A 1S1TB 2NSBA 2OHDA 3AOBA 5DDPC 4DR4F 1K47A 4O3QA 1WNEA 5A2QU 4TU8A 4OX8A 2DNHA 4OX9J 2EFGA 4DV2J 3FFIB 1LOUA 2RE1A 3KHGA 4NRTA 4DBQA 1LWCB 2JEJA 3VGSA 5B0BA 4KR0B 1UVMA 1UJ6A 4AYBD 1Q5YA 3UDLA 2J6TA 2VV5A 3UN3A 7FDRA 2WVDA 2BJ1A 4FKXA 2Z2ZA 2VC1A 4O3SA 1TKTA 4DSKA 3RW7A 4AXIA 4C8OA 2EK1A 3D28A 5AXMA 1VIOA 3NOCA 2ACMA 4X62J 3TA0A 4ELUA 3J7A1 4RBVA 3CDWA 2VG5A 2WOMB 2CWKA 1V6HA 3MI7X 1N32F 5EWGA 4USWA 4F50A 1X60A 1R0AB 1PYOB 2ZBQA 2GVDA 3DRYA 3Q89A 3DRRB 1ICEB 4MKVA 5HROA 5DG7A 1WELA 2M88A 1F9EB 1E6VA 1M90T 5HSPA 1A7GE 3JTNA 4I6YA 2JDJA 2DHXA 1X4HA 2DGOA 2AYEA 3SEOA 1F3FA 4JI7F 3A8EA 3CJ4A 2A3JA 2HMIA 1SC1B 2ALYB 3DC2A 1VR6A 2NXCA 4TQSA 2DGWA 1LNQA 5KG3A 3BKFA 2YQ3A 3BR8A 2YKNB 5J1EB 1DTQB 4M5MA 1RAFB 2ZBPA 3KNAA 2EFOA 4NA2A 2NSCA 2UP1A 5D0GA 1SQEA 3DOKB 3M30B 1HI8A 2OPRB 2WBRA 1VQNS 2KVQE 4WXWA 2HW3A 2DR9A 1NDKA 5KFYA 1F60B 3TEHB 1M0SA 2YWFA 1FNOA 1FERA 1RE1B 1VJWA 1RHMB 3PY8A 1L3TA 4B3RF 2HQIA 2LDYA 1PCAA 4X4UA 4F3OA 2DGSA 3NS5A 2MQPA 2B4OA 2FIUA 1HMVB 3PZPA 4OZ5A 3KJVA 3M8WA 3UCUP 2HNDA 1LK7A 2GAHC 1UPMB 2PEBA 1KLMA 1O8BA 4QPXA 3W66A 4PWUA 3M8YA 3P6YC 4ETXA 4C9DA 4NCGA 3KUEA 3W2WA 2J9EA 4CLSA 3NP5A 3TQEA 1JLBA 1WSVA 2D3OR 2VHGA 3SCIE 5B0EA 1FX4A 2JLFA 3WZ0A 1N34J 4PR6A 5KOXA 2FVRA 1ROFA 4EMDA 5GADI 3TAQA 2I2YA 1RACB 4OFZA 3GR0A 1S49A 2MKSA 1U02A 3U1NA 1YQHA 2D69A 3OR1B 4M5JA 4HT7A 2HRTA 3J7YU 1E6YB 4CYUA 1S0VA 3RGIA 3UN5A 2N7CA 1Z2LA 1NNDA 4OYPA 5KG7A 2UUCF 4DJBA 4WFAQ 2Q43A 3QQCD 3THVA 2JJ4D 3AXMA 5B08A 3M6XA 4AD6A 1RJJA 3CDUA 3LOUA 3F73A 2A1BA 4DV4J 3R5JB 3DXSX 3NGUA 3OL7A 2Y8WA 1D09B 1HR0F 3M8QA 1GMWD 2NXJA 4X4VA 3LGNA 2DYAA 4MMOA 2E9ZA 2AU0A 5SZTA 4QBUA 3HD2A 5F9LA 2WVCA 1DLOA 5T14A 2BJDA 4RPFA 4WKYA 1JQGA 1O6XA 2CG4A 3J7Z5 3OR2A 3KLHB 3MM5B 2GJ2A 4HVZA 4B9SA 1HBUB 3CCZA 4KKOB 3MEDB 2B5JB 3DMJA 1ZH5A 2UVVA 4I56A 4IDKA 1X5SA 1LQ9A 3TJ8A 2BE9B 3G96A 3R8YA 2AJ2A 2AZ3A 1FX2A 3TA2A 3ILLA 4ZJQA 2A18A 1CPZA 1T94A 4OMFG 1UJ5A 3NL0A 3R7NB 2MQOA 3EMTA 2COLA 2EFNA 2K8GA 3N5BA 4I1TA 2IMOA 1R8CA 3HVTB 8ATCB 4DR6F 3UE2A 3O1LA 1KVKA 1MWYA 4NMXA 3H40A 3BSNA 4ZVSB 4U7CA 3CO0P 3ILJA 5IT9Y 2DIVA 1T0TV 2RUGA 2EXUA 2QLJB 2JH3A 1S7IA 1N56A 3FSXA 3OD2A 1QE1B 5DZ6A 4A48A 3RB6A 2UUBF 1RHQB 4KIAA 4RO0A 3OTCA 1CQMA 1HWJA 3CCJS 3KLGB 4CNYA 5HBMA 2FQQB 4BHQA 2LP4A 3VVTA 2OGUA 5F3TA 4CLKA 1PYSB 3R9LA 2RH3A 3AAWB 1S72S 2VFUA 2YKOA 5DQGA 2VJVA 4NEYA 4Y2AA 3SQGB 3CSKA 2EW9A 4ZP7A 4ENOA 4ZPAA 1HQUB 1W2BR 3AJ2A 1RTHB 3TP2A 4FYXB 3LP1A 5CYJA 3KHRA 4J9PA 4NLRA 3JSYA 4C3LA 4KY3A 5EX3A 1VQ7S 4OLOA 3HX9A 3R5CA 3HSZA 4LIRA 4UUWA 3PW0A 4TXSA 4NWBA 3TJ9A 1VMBA 2ROPA 2FC9A 3E01A 3DOMA 1RT5A 3FEZA 1D8YA 5SUHA 3P5BP 2R2SA 4ICLB 3SFGA 4Y2KA 1FKPB 4ETZA 1D9FA 1WHXA 3PEJA 4R25A 2BQ3A 1Q82T 5CD4A 5L8RC 3M2RB 2F4VJ 2D41A 3M1VA 4I2QB 1ZPWX 3F41A 4QWCA 3MFIA 1X31C 4GVLA 5HMYA 1HBMB 1T3OA 1DBDA 2V68A 4NLUA 3MCOA 2BJEA 4LBPA 1CC8A 2QFIA 2QLXA 4MK7A 3I5BA 3MOJB 4YHHF 3FBFA 2R42A 5D6GA 4P2MA 5KFPA 3CEDA 2J0WA 4H4OA 2V8GA 2R7QA 2CIMA 5AXLA 2N82B 2OKQA 2E7XA 4FF4A 3G86A 4YEAA 2OH2A 5IT4A 4K0KJ 2OMOA 4CP5A 1RHUB 4NLGA 2GMLA 2OMLA 3QGGA 4K4YA 4KO0A 2IAJB 2JHEA 2YX4A 4OYOA 3MMBA 3VQSA 1HD0A 3OTOF 5KFVA 4ECTA 4M5IA 3PW4A 2ZKUA 2YKAA 3AY0A 2HZCA 3BN7A 3FVYA 4AXJA 1FVQA 1FWLA 2I8EA 4DV6F 5JXSA 2LYVA 3AH6A 5C24B 1QSYA 4DSFA 1S6PB 2YNHB 3HHLD 1C4AA 1N52B 4C11B 4WTYA 2HHTA 4LT6A 2P2CB 1FDBA 8AT1B 1F5BA 1JLQA 3HVWA 5IM0B 1ITPA 5BYQA 1RYSA 2L08A 3N28A 1YBUA 2CQBA 2OELA 5L1JA 2UVUA 4R5PA 1RLDA 1XC9A 3QLHA 3NS6A 1X4AA 1FFWB 5KFQA 3BBCA 4GKKF 4HKQA 3C6UB 1S6OA 1BMQB 2PMZD 2H3EB 2JEFA 4DWIA 2J7UA 3TARA 5ETTA 1FRIA 2BJ3A 1WC6A 1GAOA 1YJ9S 2FZGB 1KTVA 3MURP 2FJBB 2BANA 5M2PA 3KUGA 1X4DA 4X66F 3DOLB 3ZNJ1 3G8SA 4OI2A 4DR3J 3DDNA 2IC3B 3EJMA 3ZTPA 4KHMA 1GX6A 2V0NA 2RDJA 1M5SA 1P9YA 1XIQA 2AEJA 4NCAA 4WP8A 2CQGA 3SV3A 2F65A 1H2VZ 1VS3A 3RJMB 3BGRB 1R31A 1LKZA 1IJFB 2KH9A 1UWBA 1NU4A 2YX1A 4CLZA 2P6SA 1GMVA 2RNEA 4A8QA 2W9CA 4W4MA 4DL2A 3GE9A 2W2PP 1IBMJ 1VQ6S 3HVRA 2PFFB 1F5AA 1JLAA 3GZ7A 2OD6A 5M2RA 1JMTA 1RKJA 1DTTA 1XJWB 3RTVA 2OJ3A 2B9XA 1NEEA 4S0MA 4B08A 3G82B 4HH0A 4F67A 4JI3J 2FHJA 2ZH7A 3WC0A 3SYZA 2HSEB 3NXZA 1CJKB 3FUYA 3UNGC 4C0BA 4A8SA 5H9EJ 3V4IA 2HPUA 1C0TA 2AJFE 3CCTA 2K06A 4A8FA 4HT5A 4U8VA 2QIFA 1JB0C 1KTQA 1BUXA 1N36F 2KXHA 4USVA 3I0SA 2JEGA 3PACA 1JLEB 1RQ0A 4LSLB 4DR4J 1SIZA 3CJTA 2G9OA 4KSEB 3KK3A 4FS1A 3MPUB 3K5OA 1S1TA 2Q66A 2DIUA 4ED2A 3OTEA 3HHNB 1XNQF 2G13A 1O51A 2OPSB 3EVWA 2PO4A 3NS7B 3VAHA 1RT6B 4M5LA 4USJC 1U1PA 4ZVPB 4NLVA 2GNKA 3W5XA 1RA6A 4HYKA 1D1UA 4JI0F 4K4SA 1KQFB 3FFIA 4WJBA 1LWCA 2J0SD 4DPYA 2CNOB 4RKUC 2QYGA 2QC3A 2NZ4A 3K5PA 4JI2F 2AYMA 2DTJA 5GMEA 4LFBJ 2BE2B 2W4PA 1U1KA 2CPDA 3D2WA 5HLFB 4DG1B 3CJ2A 4M5NA 5K5MA 4OIXA 3U02A 5L1LA 3W7BA 2LLZA 1BD6A 1KDNA 1KLNA 2DCUB 4CO1A 1N32J 1SJ4P 1NHVA 2WOMA 1SJRA 4DV0F 4LF1A 5I3PA 1MN9A 3BJYA 2MDAA 4RW8B 4X64J 2PDAA 3BYRA 1R0AA 1KD1T 2QA4G 1HYSA 1IM4A 5A6PA 1XNRJ 2VUGA 3LGHA 3LALA 1NPKA 3DRRA 1OS5A 1FRLA 4DLGA 2BMBA 5KFUA 1RTDB 3CD7A 4JI7J 4MKBA 3BGOP 1Q95G 3ENWA 2XS7A 1UEVA 2W24A 3N4WA 1L3SA 5FDLB 4ED0A 2W8LA 3H42A 4P73A 2B3TB 5B0GA 2C2RA 4L3NA 3UO0A 3S6EA 1JJHA 4JI1F 5KFIA 1U1LA 3Q23A 1DURA 2YKNA 2JFDA 1HNZJ 3O44A 5J1EA 1DTQA 5KFXA 3ZZZA 3BDEA 3OXFA 4H54A 4DZDA 1HBNB 1MWQA 1UFKA 3FZBA 4PXBA 1VHFA 3M30A 4OYIA 1AT1B 1R8PA 3HT0A 2DR6A 2M0GB 4DSEA 3T5JA 2BR0A 2ZH3A 3C15B 4Y3CA 3TUZC 1H98A 3SCKE 1S4EA 2F7VA 4PUOB 3GIMA 5HVFA 1EJ7L 2M7SA 4FXVA 3VF0B 1SJFA 5CYMB 3I32A 2Z2YB 2HYIB 4A8XA 1VQ4S 2Q1LA 4UOGA 1HMVA 2OFGX 1M5HA 3E2EA 2UUAF 1A0OB 4ZPBA 2WBMA 2N3OA 1ZAVA 3N01A 4DXLA 3CIMA 4L6V3 4WFZA 1OPIA 3SCJE 4OYWA 1HKAA 3WHIA 2A0FB 3QMQA 1S59A 2VODA 2HNZB 4XPCA 1S77D 2DJWA 2YKMB 1YZ6A 1RADB 4J5OA 3OR1A 4ZVRB 3HD1A 4B3OB 1E6YA 2OSQA 3ILIA 4FF3A 1G1XA 3TA1A 4JBCA 2Z2MA 4UQTA 4AUKA 2AJ1A 3OQ2A 1VIXA 1T05B 2VF3A 2BJ8A 5K14B 2KFZA 2DR8A 1TMMA 3TW0A 3GR1A 2CNNB 4BC7A 2BKOA 4MK8A 2J0QD 3NWRA 2CQPA 4NZ7A 1DHMA 2CQ4A 1KOHA 2ZH8A 3J80Y 4Y00A 1RBAA 2AP6A 2VBXA 3GV8B 3SCLE 1RKIA 2GVZB 3MFHA 4BWJA 3I55S 3KWMA 4M94A 2E5LJ 2LFVA 4FBUA 4K8RA 3Q22A 4DL5A 2V2ZA 1Y0HA 1YWXA 2HG4A 2F9DA 4OHXA 3RU0A 2XZTB 3MM5A 1YJRA 1IKXB 1X5PA 4K5SA 4ZKAA 3M6WA 1NO8A 1D9AA 2OEKA 3MM8B 1GX5A 3MEDA 2B5JA 3HP6A 4L72B 3EZ5A 1Q0NA 4QIEA 1S0OA 2HGNA 2N4CA 1FK9B 1DRZA 4OLPA 1WACA 4KBIA 1TQLA 1SL2A 3LWLA 1M5PC 3DN9A 2KYZA 4UOCA 1J27A 1UVKA 2C22A 3ILOA 4KV8B 5G4DA 4EO8A 1H7XA 2MY8A 3HVTA 1KONA 1AUSL 3CWJA 4IOBA 2FLOA 3QJPA 3M6VA 4C0OC 3MCMA 1APSA 2HQ3A 3QT6A 4DUZF 1NJYA 5DETA 3GIJA 4EBEA 1FJEB 2C2OB 1FFGB 3BGLA 4AFFA 4TQRA 2BEFA 1PYTA 1VK8A 1IKWA 2BVZA 1QE1A 5BR8F 1ZZFA 1J5OB 3KLGA 5J2QB 4RNHA 1IKVB 1B0VA 3KNGA 2Z56B 2V4RA 3NNHA 3FBEA 4AQYF 2FTRA 4KH1B 1YJWS 5KFFA 3SQGA 2Q3PA 4B02A 4KHRA 2DR7A 1S1VA 2HS3A 2ILZA 3OVSA 4LF5F 1PAEX 3HDSA 1HQUA 4P72A 1RTHA 2DHSA 3HULA 4GO5X 4ZDNA 1IQTA 3NCQA 1IBCB 1YKWA 1FD8A 3R7BB 4WK1A 1RT1A 3CD5A 2XI2A 3NGRA 4NYPA 1YX2A 2Y8YA 2GQ2A 1XR5A 1GEHA 3JTOA 2H4YB 4ICLA 1KHWA 1P9QC 1FKPA 3UD5A 3MTKA 4ZA1A 4EWTA 2W8KA 3RB4A 1C4CA 3M2RA 4N7TA 1NZ8A 4DF4A 4C98A 4EEYA 4I2QA 2BJ7A 3TVYA 2G4BA 1YJVA 5KG5A 2ZOGA 1HBMA 1MW7A 1O5JA 2LA6A 3VZIA 2NXEA 3NCPA 2HQCA 1C2PA 1QTMA 4ZCLA 1U25A 1I3OB 2CQDA 2HFNA 5HP1B 5AXNA 1PAUB 2W01A 4DSLA 5DGAA 2QSFA 2DBBA 1NDLA 4RW9B 2PMHA 2AF6A 2JSXA 2JLEA 4HI2A 3CF5Q 4U7UD 2Z0GA 4OYMA 1F1BB 3OTOJ 2HIQA 1XMQF 1CC7A 3LTOA 2IAJA 2XS2A 3M9MB 3TVKA 4DV6J 7FD1A 1ZTTA 2CJQA 3A8IA 2YTCA 2W7OA 1IR0A 2NUUG 3LUYA 3PRBA 2CJAA 5LM7E 5C24A 1S6PA 3P3DA 3FGVA 2YNHA 5LMUF 4ZVFA 1F9HA 4C11A 2AX0A 4JOUA 3RAMA 5F0WA 1Q78A 3QO9B 4UT4A 5F8LA 1KC8T 4Y65A 2CNLB 3OXGA 1Y11A 3CMAS 5IM0A 2HAIA 1Y7PA 5E0OA 5KFNA 4ES2A 5GAHU 3GYNA 3PJ9A 1KP6A 2WW4A 3PEHA 1VC6A 4GKKJ 2H5JB 2XLKA 2YQ0A 2XMKA 2RHSB 4MTPA 4ALZA 2X3GA 4WFNQ 1LXNA 3C6UA 1TL4A 3IG1B 3OSPA 1LFPA 4OHVA 4ZCMA 2A6OA 3VTIA 2VFRA 1VRUB 3OFFA 2KL8A 2B8PA 1UA0A 4EBDA 1RP5A 4X66J 1M5OC 2BOPA 2HBQB 5IWAF 1YRUA 2C3UA 4OJ3A 2QE5A 3RAXA 2QGFB 3DOLA 2ZUGA 3Q8SB 2IC3A 3LA0A 5CCLA 4OJGA 4Y0FA 5L38A 4LF9F 1NRKA 1HHSA 3BGRA 2C3MA 4QJVA 2HWTA 4DR2J 3CMQA 3FRZA 2DNKA 2Y1JA 5HJYA 2RRAA 4NX9A 1N5VA 3K5LA 1NJXA 4IR1A 3CDAA 3PDNA 3IFEA 4P71A 1C0UB 1ACMB 1PJ7A 3TANA 4A8WA 2DNYA 2O3DA 3W8PA 3OVBA 3R6LB 4USMA 1D3WA 3ZZTA 3HMJG 1Q8KA 2MHNA 3JSBA 1YHQS 3GONA 3G82A 2VBZA 2QL7B 4Q45A 4LR8A 1CJKA 2F8HA 1JX4A 5EWFA 1PILA 1V5VA 2DPJA 2XMUA 2AGOA 4IG0B 4CM0A 1X9MA 2CVEA 1Z2ZA 1PIEA 1OSCA 4C97A 1MG7A 2VD3A 1BY9A 2UZAA 3FSYA 2DITA 2IFXA 4ED3A 4Q5VA 1UJ4A 4QYZK 4JYAF 1JLEA 2Q79A 4LSLA 4DL7A 2D1CA 4JI6F 2IVFB 3HHEA 2FGOA 2G2YA 4DPUA 4ES1A 5IC4B 4LRFA 3T19A 4B9MA 3SXLA 3L7OA 5CD4H 4B3SF 3Q8RB 3OFEA 1RT6A 4PKDB 4CT8A 1HWIA 1LWEB 1U1OA 2KM8B 1UZHA 3W9JA 2CZ9A 3CO9A 2YNGB 4C2MA 1NPPA 1RWNB 4C8NA 3JSMB 2FLLA 1S76D 2AJQA 1NB2A 3PXGa 1U1QA 2M9KA 1SKRA 4ZVGA 5HLFA 4DG1A 1FKOB 1VQOS 3ZTRA 4BLGA 1H0HB 4A8YA 4G1QB 3RBZA 8RUCA 3IGNA 2RILA 3KG4A 2E66A 2R3VA 4WP9A 1Y00A 2W2OP 2GX8A 4RW8A 2JNJA 2CKWA 5DDOC 4OHWA 1MU2B 1T03B 3Q2TC 5C25B 4ZPDA 2R4FA 4ECXA 5AE1A 2Y1LB 4KGZB 2MJUA 2EK6A 4DR5J 2C2NA 1YRTA 1FRMA 5DS7A 1RTDA 1VJQA 1YG0A 1RT7B 3BH7B 3RRKA 2OD4A 3KLEB 3KLVA 5FDLA 1CULB 4DLEA 2VPYB 2DXEA 1SJ1A 1RYRA 1SKUB 2ADBA 3OFHA 4HTIA 2ZZTA 3M32B 5DM7Q 4K4VA 4ZN3A 2K3KA 2XY5A 1CSJA 3MEGB 1D0EA 3MMAB 4USKA 1RCXB 1HBNA 3BDPA 4KFBB 1UAWA 2DGVA 2XWYA 3KK1A 4L74A 4Y6IA 2R7TA 3WIUA 3CCVS 2XNRA 3EGWB 3UN2A 4OZ3A 4C8YA 1EIYB 2IDEA 3C15A 4DFJA 5IOLA 2MLZA 4LRBA 1FE4A 2CXEA 1EKSA 4PUOA 5B0FA 1HA1A 5CYMA 2J6SA 2DY9A 1H74A 2V69A 4KPCA 2Y9HA 3PKYA 4DX8H 2HZAA 5LSOA 3KMSA 3HI9A 4OV1A 5DLGA 4DV7J 4CCHA 3RRGA 5FJ4A 2F63A 3DCAA 2FVSA 3RRHA 4ZMMA 2DR5A 3FCHA 3MHYA 3FQKA 3MPVA 4J9VA 1N5YB 2FD2A 1Q8LA 4XK8C 2HVDA 5DJBA 2YWKA 2L9WA 2E1AA 1OO0B 1WWHA 1MMNA 2CUYA 2K7KA 4O0IA 1UA1A 4OI6A 5IV3A 2YKMA 5B0AA 4PRFA 5KFBA 1I94F 5THWA 4F7VA 2ZH6A 4C8LA 4IO1A 4CLLA 4B3OA 4ILRA 2UXBF 4IYQA 2PC6A 4UW2A 1NSQA 3J81Y 4MAKA 4LR9A 1FT8A 2B8QA 2MSSA 4K4XA 3X3UA 5M2UA 3TWZA 1GTEA 3GG0A 1T05A 3PFOA 3LWMA 5K14A 3BSAA 4ELTA 5J1PA 2J6UA 2BQUA 3NAHA 4E8UA 4RW6B 1C1BB 1SL0A 1S6QB 1DJ0A 2MGZB 1UETA 5HAOA 1GT8A 1JNZB 3G6ES 3TUPA 2CPHA 4DR1J 1WC5A 1IUJA 2GVZA 2X1BA 3O5TB 1RU1A 1Q7LB 3G2XA 4LF4J 2KRBA 2BDPA 3K2YA 3QATA 4BC9A 2ZWPA 1FWPA 3TZYA 4IQMA 2BM1A 3HKZD 1U0HB 1IKXA 1RT2B 3MM9B 3S7RA 2NZCA 4EYIB 1LWXA 5L9XA 1KQSR 3RG6A 4YDXA 1FCAA 1FK9A 1F9FA 2R7XA 3HFKA 2V6AA 4Z7YA 5D8HB 5AJ3F 2XB2D 3VGUA 1XWLA 1N0VC 2VFTA 4I7FB 3TOQA 3WQPA 2BQRA 2BKPA 2HRYA 4KV8A 2R7WA 2XSJB 1UFLA 3IMQJ 3TYTA 4TNOA 4C8ZA 1IKYB 3H8YA 1NK6A 3RAQA 3SIPB 1XEZA 3EDRB 4RWXA 4U8YA 4Y2MA 2HAFA 4A4JA 3H7HB 3G8TA 2ZJPQ 3VHQA 5I4MA 3E3XA 3W62A 4IG3B 2K1RB 1QSSA 2VB6A 2FJDB 3GWCA 1XMOF 3EWGA 1J5OA 4AQYJ 1RU2A 2IMWP 3BPSP 5J2QA 2ZDOA 3PM9A 5L1IA 2YX7A 1DARA 2L3MA 5KFGA 1A6LA 5KT3A 1NM2A 2U1AA 3CDEA 3ISND 1OWXA 2HHSA 2DNZA 3GTYX 4URSA 3MEEB 2KT3A 3OW2R 4EU0A 2BXJA 3CDBA 2R7UA 2CVIA 4B17A 2WSEC 2DGXA 4CDIA 3AHPA 4FS2A 3VQTA 2H48B 1WTBA 3EDQB 3BREA 2W4CA 3HLUA 2K3IA 2QYCA 3H0PA 4DPOA 2PN6A 1LW0B 3DLHA 1OYEA 1LFWA 1ELOA 4QZVB 3M9NB 5F8NA 3P45B 6FD1A 1X4GA 3PO4A 1TZ0A 4LQ9A 2C28A 3PIPQ 1RWMB 3UD4P 4XDCA 2VU5A 2W25A 2BACA 3ZZUA 4UOHA 2HHVA 3OLAA 2XC9A 2MSTA 5HP1A 4A47A 2VC0A 3MR5A 2XGQA 4RW9A 1XMQJ 2D7SA 4NXNF 1V9OA 4ZPTR 1ZAXA 3BYPA 3RUBL 4WTOB 2DNRA 4ECUA 2QRRA 2OSRA 1REVB 3QBCA 3N9UC 1TK8A 1LW2B 2LXFA 5F41A 3K89A 2MY7A 3CJ0A 4PG6A 2IM3A 3OPKA 4PG4A 4KHPJ 3G71S 1SC6A 1SUQB 4Y34A 2BRLA 3UNYA 4YP3A 2XM3A 4DSJA 4JI5J 5J2NB 1HNIB 1VBKA 3PFEA 3LPYA 1H2UX 2PFDA 3K58A 2Q6CA 2ROEA 5KFJA 3QO9A 3AQPA 1TFWA 3PYGA 2KG1A 1NKCA 2XWXA 3EX7B 3JAMY 1QAIA 2E5JA 5I42A 3HJVA 3R7SB 3R5DA 5B0CA 1UPPA 2E9RX 2QFJA 4ILLA 3OXLA 4JI8J 3HFVA 3HJFA 5C42B 1MN7A 3GB0A 1JNRB 3NKYA 4EO6A 3S1TA 1HHTP 1AFJA 4HHUA 3T1HF 3IBFB 4UUXA 4OZJA 4NE9C 1ZM2A 4DR7F 4DL3A 3ET6B 4TN2A 4DL0C 3LP2A 2ZFHA 2WZ1A 3IG1A 1YGYA 4IH6A 3V4MA 4Q7AA 4LR7A 3QJJA 4OJ1A 2F4FA 3TJAA 5IWAJ 3B4MA 1Z1ZA 1VRUA 2B43A 1BWEA 4NYOA 4O3OA 4TLRA 3HSDA 3WBZA 5E3RA 2XGPA 3KXDA 4AE5A 2J0XA 2QX0A 3JAMU 2W2MP 1HNWJ 2DHGA 1S10A 3MDFA 5HMZA 2ZHAA 2P5VA 1MWZA 2DKOB 4V19X 1WORA 1FJ7A 1A9NB 1H73A 4PAAA 4AT1B 2IM1A 3I6PA 1F2HA 4CT9A 4DS5A 2UV8A 1NKEA 3EYZA 4ZLLA 6FDRA 3P5TL 3OJSA 1C0UA 4B9VA 2CPZA 4LFAJ 4J37A 2DCLA 2PT0A 1GQEA 5KFSA 5KT7A 3OTBA 1EB0A 1NUEA 4MK9A 4OYAA 3I56S 3TUIC 4N41A 5DO2A 4N8NA 2H65B 1IBKF 1W7WA 2LQ5A 4YDDB 5D4LA 4OV6A 1UL3A 1SV5B 2HK3A 2EVZA 4CNZA 1YTYA 1C1CB 4ZVOB 2UU9F 2LECA 4CLWA 2VG7B 5CCMA 4IG0A 5LXYA 3A3PB 5C2GA 3OLBA 4RNMA 1DQAA 4DV3J 2CJBA 2CQ3A 3CCQS 1S99A 4XTTA 3RZAA 4QWAA 1CS4B 2KM8C 1U0SA 4JI6J 2PEHA 5DQHA 2R7RA 3BGFA 3TQ1A 1NAQA 4E98A 1T11A 3B82A 1VCTA 2KT2A 1NK4A 1F5CA 4LVNP 2IDLA 3Q8QB 4B3SJ 3SZ2A 5ADZA 1FVSA 4HHJA 3MCSA 2H5IB 3H25A 1NHKL 3MCNA 3CUNA 2VA2A 2IYIA 1LWEA 2E1CA 3T5KA 2LXIA 3A3OB 5H9EK 2CFXA 1SB6A 2P9EA 4FXDA 4DOZA 2EKNA 4DQPA 3KMQA 2XZWA 1J2VA 3EZUA 2YNGA 3JSMA 3B54A 1R27B 3KG0A 2MMYA 4CH1A 2KJVA 3V6HA 2NR0A 3D3CJ 2KXNB 1FKOA 1DZ5A 2ATCB 4ES3A 4NXMF 4CQ1A 4PXEA 3I0RB 4G1QA 3B6BA 1S12A 1FEEA 4RU9A 1RAJA 2I38A 4P2FA 1WF1A 1U1RA 5IS2A 4LFCF 4K59A 1SH3A 3L3CA 1MU2A 4RUCA 1T03A 1GNKA 5C25A 1SC3B 2KU7A 2MYFA 4NLTA 4B3TF 3C66A 2B9EA 3PV8A 1TFYA 4NOHA 4JI4F 4FN5A 2IPOB 3TZXA 2QA4S 1Q5VA 1RZMA 1QM9A 1KQGB 1RT7A 2AEFA 3KLEA 2AX1A 2DRBA 1KSPA 3TAPA 1CULA 5D3GB 2QL9B 5KFEA 1AROP 4ZVUB 1VK3A 2FUG9 2B4VA 1SQFA 3U1MA 2GC8A 4OI1A 3IBCB 4ZP9A 3M32A 1W25A 4RLEA 4DF8A 1RAIB 1LWFB 1F0XA 4OI0A 1S7HA 3MEGA 3NNCA 3HT3A 4OZ2A 2HGLA 4YS2A 3MMAA 2WTFA 3D54A 3NEKA 2ZKTA 1U2CA 4ECZA 3PR4A 4KFBA 4K4ZA 3MM7B 1CJUB 2FY8A 1B4SA 5IZHA 3IWLA 1BC6A 4TYAA 2CDQA 2DNMA 1N6QB 2DHAA 2R8GA 1KVIA 4QPTA 1X5OA 2ZDPA 3NGDA 3H59A 2ZZMA 3MAQA 2ZH9A 2ADCA 4K4WA 5F8GA 1RWOB 2YKQA 1P27B 2GMJA 3D3BJ 4RUAA 4CTAB 2DRAA 2F8MA 5C5JA 2CJXB 3A8KA 2AYBA 3ZZ0A 5EDWA 2V8DA 2CZ4A 2B0GA 3F44A 3C16B 2SXLA 3O8WA 4DFMA 4CLYA 1TK0A 1FEHA 2QT7A 1N5YA 2GHWA 4IR9A 3O2IA 3ITHB 3G6XA 3GFZA 1IN0A 3QZ7A 4WYWA 2IYGA 2LU1A 2Y1RI 4U95A 1X0FA 2ZOMA 4C3MA 4LBIA 2JOQA 1RT3B 5HL7Q 2EWHA 1YBAA 2RAQA 3DKDA 3FKBA 3GG1A 2UXBJ 4P6QA 5DRKA 3OSNA 3G9CA 1KEKA 4MYTA 1LXJA 2GGPB 4DV2F 3GJTB 2Z4PA 2D3O1 5FD1A 4J91A 2GZOA 3M8PB 1RWWB 3QWUA 3DGVA 1FRXA 3H2VE 1TKXB 4QW8A 1K73T 2XO6A 4QCLA 1R8HA 3D1QA 1K9MT 2CPJA 5E41A 1CJTB 4RW6A 2GFFA 1S6QA 4F0HA 3KDOA 3ONQA 4IOAQ 3WC2A 2MGZA 3MR7A 4X62F 2CJYB 3FZ2A 2X7IA 4OYZA 1H72C 1YK9A 2PIIA 5CHCB 1SJQA 2R8HA 4USUA 3KHHA 2IBKA 1D9DA 3VAFA 2NCKL 2OP5A 5KFHA 4J90A 3BB5A 1NDPA 1VI7A 2QMWA 1FJGJ 2AD9A 1ZETA 2ZC3A 1U0HA 4MJKA 4FYYB 1RUSA 2CQ1A 3VZHA 2MLXA 1RT2A 4FDFA 3MM9A 4J9MA 3AD8C 1PBAA 3UDCA 2Q6BA 1UEKA 3L4BC 4JV2A 1NK8A 3HVAA 2QL5B 2J9DE 3IR5B 4WU3A 3CCLS 1UP1A 2CPEA 2ALZA 2YY3A 2EEYA 1CG2A 2UUWA 3GFYA 2X51A 2G1DA 3NGSA 2XYPB 2CQ0A 4I7FA 2V50A 2EFPA 3PTWA 2XSJA 1VBXA 1VOMA 2WVFA 1ZA1B 1IKYA 4DCJB 3V6JA 1HPZB 2FJEB 1M5KC 2CA9A 3AXKA 1SC4B 4X65F 4Q0BB 3OL8A 1XMOJ 3WDOA 2IRUA 4CLUA 4M5KA 3GYXB 4IG3A 2K1RA 1SVDA 5FLXY 4DZ6A 2JEIA 2A2DA 2O01C 3QAEA 4MFBB 3VAJA 4RJVA 1JKHB 4Y28C 2MZRA 1WDTA 2IVYA 4NLDA 2DGTA 4XPEA 1N33J 4ID8A 1S9EB 4IH7A 3MEEA 4KGXB 2FHJD 3FMBA 1U47A 5HANA 3MZIA 4ZJOA 2HLTA 2Y0SD 1MSWD 3DNCA 3BGUA 4C0HA 1TUWA 4OZ1A 2QLBB 1VC0A 1RI7A 1NLKL 2ZH2A 2UXCJ 1OY8A 4RX6A 4NYZA 2XLIA 4DL4A 4EBCA 4QOTA 1LW0A 1T9YA 5ETRA 2O67A 3D67A 1RAEB 3AA9A 2J9CA 1TL7B 2FVCA 3MMCB 3NMRA 3T9ZA 3BZQA 4PEOA 1BXNA 3POTB 3CJRA 4AL6A 3NAIA 3DYAA 2D9OA 3DDKA 5IT9U 5E5NA 2IJNA 3E8OA 2A10A 1PC5A 4MKAA 4DV4F 1AUDA 2FC8A 2AGQA 4KC5A 3SV4A 4NXNJ 1RWUA 2PSZA 3FMWA 4I69A 3A8JA 1AFIA 4ZK7M 2RKIB 5HQ8A 3RB3A 3TRGA 3K8VA 4F4XA 1REVA 2YXLA 1LEOA 5F9NA 1LW2A 4PXCA 5G0RB 4YN3B 4RNOA 4JV5J 2E1PA 4Z7CA 4B9TA 2V8HA 4GKJJ 1ZPVA 3BKTA 2LQ9A 1FA0A 3MD3A 4GVBB 4QIGA 3W63A 1SUQA 2ZE2B 3CB4A 2GV1A 2RQ4A 3BPDA 4M95A 2WSFC 1KRPA 3MM6B 1NHUA 1HNIA 3LH2S 1ZA2B 1Q53A 2PE8A 5I3UB 4NLOA 2IJFA 2BW7A 5GADU 3SBMA 3GFHA 4KAIA 3ELHA 2AEMA 1RISA 2GJIA 2MKJA 1S9GB 1U1NA 1FTCA 2V63A 3TAMB 1UCNA 5C42A 3C19A 1L5UA 1SH0A 3HHKA 1U8SA 4N47A 4YB1P 2MZJA 1QDUB 4F4AA 3KJNB 3W2VB 2I0XA 3ET6A 3VAGA 4ED8A 3QYYA 1EZZB 4CO3A 1G2EA 2W2NP 3P8BB 5LSRA 3NRBA 1N5SA 4QIVA 2JL9A 4RZRA 2RVJA 4OI3A 3GJQB 4FVCA 5KG0A 4LUBA 4KB7A 2NYIA 4QQBA 3AQOA 3IM9A 3HSGA 1Y10A 2WK4A 5GVQA 1GXTA 3T3FA 2MJNA 1QLNA 5DLFA 2VQEJ 5KFRA 3JB9k 1DAXA 3MUMP 4ED4A 3QWPA 2E7WA 3Q0AA 1BQMB 1JJ4A 2RQKA 3CW2C 1WOSA 5J2PB 1OIAA 3DI6B 1FHTA 2QO3A 2GW8A 4ED7A 2XNQA 4WBFA 3B78A 4DSIA 2YWEA 1YDLA 3H4BA 2DXDA 1IBKJ 1RAHB 3SMZA 2OIHA 5LOQA 2VASA 3PIOQ 6AT1B 1SI9A 1U6BA 2UU9J 5D4NA 2OFHX 1FJCA 3GU0A 3LGMA 3OUYB 1PGZA 3H5XA 1SV5A 1C1CA 2HNYB 2C3PA 1HI0P 3K5NA 2VG7A 3FCVA 4LF8F 2CZVC 1IVZA 2IVMA 1T3NA 3BQ2A 4YB6A 1HNXJ 2GQCA 5KT2A 4DQSA 1HWKA 3NG8A 4O3PA 5A8KB 2KN4A 4CH0S 4CI0B 5D0HA 4G6VB 1CS4A 3Q83A 2IM2A 4PG8A 4BBYA 2V9KA 4I2PB 2DNNA 4DL6A 5IV4A 1K44A 2PMWA 1RHRB 2NS1B 4YOEA 2K2PA 2JVOA 5IFMA 1WEXA 1HHQA 3S8SA 1ZYQA 1OY6A 2H54B 1IQZA 4CO4A 1T8EA 3PR5B 4PWDB 2KXFA 4J9SA 4DDFA 3H5SA 4UY8T 1TUGB 3K5MA 3UWTA 1Y5NB 2CJ9A 2ZZNA 2I5JB 1JLQB 1EHWA 3TZWA 1FXRA 4NXMJ 5D4OA 4ECWA 2B4PA 2WHOA 5KFCA 5CABA 3ZNUA 4ERDA 1WKJA 2ASDA 4UZBA 5ETPA 4J9RA 3AB4B 1KVJA 1UZDA 4ZLPA 3W9HA 5EHHA 4B3TJ 2BA9A 2GO9A 1OYDA 5L39A 3PHTA 2WVEA 3HFZB 4F2SA 2OPQB 4ECSA 1U26A 1IM6A 2LCWA 4TLQA 2LEBA 4IUFA 4DI6A 4B3MF 1PJ5A 4DPWA 4F26A 1U7LA 4UF4A 2J7WA 4V19J 4CO2A 3UR3C 5D3GA 4DQRA 1VQMS 3FBBA 3H98A 5K9FA 5F8HA 5KTQA 4LMZA 4DR3F 5MLCV 3T6BA 3BH6B 1RTZA 2FJAB 1RBOB 1U6ZA 2JFKA 2UXDF 1R43A 3WIVA 1KFDA 1NMEB 2RF2B 4QR1A 1RBLA 1LWFA 3DXBA 4RW4B 3W5ZA 2FPHX 2G2OA 1KBRA 4QIFA 4I68A 3Q8UA 2M2BA 4IKAA 3SSSA 5C7PA 4WFXA 2GCFA 3IRWP 1UVLA 3MM7A 4DFPA 4ECYA 1B70B 1CJUA 5CAAA 3PX6A 2IIHA 5E3CA 1FO1A 3P4UB 2VBWA 4NL5A 4K2JA 2N4DA 4RU2A 5U47A 2FJWA 2BKNA 1ZOTA 1N6QA 5A2QY 3T1AA 2EPIA 2NPFA 3LANA 3GV5B 3QT5A 1EP4B 3K7RA 5IC6B 2RD5C 1REGX 3CD0A 1EKRA 1T9XA 3DLLQ 2BABA 1XERA 2XSFA 3N5FA 2U2FA 4DU7A 1WF0A 5CA5A 4GC7A 2B6AB 5KFDA 4J9QA 3D4JA 4CTAA 1HNVB 1GH8A 3QT8A 1QVGR 3C16A 4P2SA 4ZPWR 3WX4A 3DOKA 1HD1A 1V3RA 2OPRA 2QMXA 1SJ3P 3ITHA 1XN9A 1YJNS 2MZQA 3IS9B 2JWNA 2PA3A 2JX2A 4PYAA 4B3RJ 5HVGA 3VGVA 1URNA 5CZVA 2W7PA 1RT3A 3PCOB 2M52A 4C7QA 1WOOA 4G65A 3F0NA 4X2BA 1U48A 1HQ2A 3G8QA 4PCQA 4C8KA 1VHIA 3GIRA 2RQMA 1JJ2R 1QAXA 2GGPA 4NLPA 4KH0B 2C1EB 3ENVA 1VQKS 3H2LA 3ZFVA 3ENQA 5CYQB 2OO4A 3ZZRA 3M8PA 1O0PA 3FRYA 4F8RA 1WEYA 2XMVA 2ZWOA 4WWSA 1TKXA 2V34A 5KFTA 1HQEB 3FEYB 3JYTB 5AE2A 4E0DA 1XR7A 2J7KA 4LFBF 1Y3KA 1CJTA 2DGUA 5H9FJ 1L3UA 2MKYA 4ER8A 5HQMA 2GJFA 4R0EA 3QJLA 1YVFA 2QZ8A 3I5CA 3TX8A 4KT0C 3RW6A 1RA7A 4A8KA 4LREA 1EQMA 1JLFB 5B09A 1GFWB 1N88A 2UUCJ 1HYSB 5ETQA 1VQYA 1HWUA 2Z57B 4AL5A 1X8DA 3PKMA 3PYDA 4C8MA 4X64F 3EGVA 3A12A 1WHYA 2ZVIA 4QR2A 4WE1B 4F36A 3PVXA 1RB0A 1TP7A 1XNRF 2MKKA 3RBEA 3CMES 4OI4A 1HR0J 2RT3A 4FPRA 3VV2B 2Z30B 5D15A 3KJFB 2XYGB 2C3YA 5E33A 3CCRS 4J9KA 3R1LA 1Y5LB 2MLYA 3ENAA 2UVWA 5DG8A 1T9WA 5D77A 4CLPA 5A6WA 2CJKA 2FYXA 3H2UB 1NJWA 3CIZA 1J5EF 3K57A 4ITSA 2XMMA 3HHLB 3U7JA 3R5BA 2AQ4A 1EAYC 1HNZF 2AMCB 4OHYA 1UVNA 2UV8G 5KOWA 4X65J 1TU0B 1FRHA 2JVRA 1HPZA 1HW8A 2RS8A 3KLHA 4WU2A 2V9WA 4Q0BA 5HVHA 4NPOA 5ITHA 3AA8A 1HBUA 4KKOA 2D74B 4M5HA 1SQGA 4P2XA 1RHKB 1S4FA 2CWXA 2MKIA 2LU2A 4OQJA 3OL6A 3T41A 2ZUAA 4MFBA 1WC3A 1JKHA 3J80U 2LEPA 2LKZA 2K7JA 2ZH4A 1Y4ZB 4DR6J 3QZ8A 2KTQA 2VPZB 4DX7A 3DM2B 1T02A 1OQ6A 3I82A 2RU3A 3RR8A 1WUUA 1VQLS 3LAKA 3C6TB 3SDEB 1S9EA 5K8PA 1YSJA 2RMLA 2VICA 4DQQA 4JP8A 4IFVB 2OTLS 2R7VA 2GO8A 5HO4A 3CC4S 2UUBJ 3QSYB 2Y1IA 1X4CA 4HEA9 4OZNA 1TK5A 2X3DA 2ZJRQ 2W2QP 3J7AN 1HL6A 2H4WB 3ZZYA 3UD3P 2ZNZA 2EI5A 1FE0A 3EZOA 2N7YA 1IBLF 1FNMA 2D9PA 3NGTA 4F25A 2VQFF 2KT5A 4YR3A 5JVHQ 1YJ7A 2LDIA 4FBTA 1TL7A 4ANCA 2NPIA 3MMCA 4I67A 3BQ1A 4HACB 3I9ZA 3ISZA 3POTA 2QEXS 1FD2A 1IWAA 2DNPA 2YNFB 2O66A 3I96A 1X7VA 2HS0A 1FXLA 2PA8D 1JWWA 2VDIA 3PYFA 4P75A 2MKHA 3IP0A 2EFQA 2XMJA 4WXOA 3Q24A 2RKIA 1U09A 3BKUA 3TO8A 1I5OB 3MUVP 1WSRA 5E2QA 2F8EX 2GIQA 2FDNA 5LL6d 2E5LF 2KB2A 2ASYA 1F6TA 1WI8A 5G0RA 1DQ9A 5ETVA 3M2VB 2C2DA 1WDDA 1B0TA 3NLCA 3Q8PB 2H5EA 1TUVA 4Y2IA 4OL8A 2MHEA 4GVBA 2CRLA 3MMJA 4YHHJ 2ZE2A 4TYBA 3SSRA 3I31A 3MPYA 1K0TA 4ELVA 3L9ZA 3MM6A 2JC0A 3GIKA 2HVHA 2DH9A 1RWXB 4M5GA 3BSCA 3JTPA 1V3SA 5I3UA 2QV6A 2AYGA 4N76A 1S79A 4PG5A 5ETMA 5JJBA 4IQXA 1S9GA 2LEAA 4F3QA 3TAMA 3T6JA 1OSDA 5DQIA 1LV5A 4KJIA 1UEUA 1YITS 2HGMA 5KG1A 3UCGA 3MECB 5ETNA 4P9SA 2B7CB 4YQWA 3W2VA 4HHHA 2KVIA 3GJRB 1IKWB 4PZVA 4QU7A 3LPEA 3W65A 2DRDA 2G2ZA 1FFSB 4WCEQ 3GMGA 3QFWA 3DRPB 2XS5A 4FPIA 1OQ3A 3ZZPA 2AZ1A 1VFJA 2BZ2A 3HKWA 5BYRA 2M70A 2WCXA 3HHDA 1S1VB 4Q2LA 2DH7A 4C48A 2GHVC 5IQ6A 1SKWA 2CNKB 4EZ6A 3Q8YA 3CJSA 2HS4A 2NYHA 4LF6F 2F40A 1BQMA 1M5VC 1RT1B 2BJ9A 2BW2A 3L95X 5J2PA 1VQSA 3PO5A 3BEGB 3DI6A 2V2VA 3BQ0A 3EVOA 1JLGB 4DN9A 4QWBA 4GMKA 1WD6A 4WIIA 1UW9A 1H3DA 1K8AT 4CRJA 1G6BA 3X1LB 4IOCQ 3FEXB 2FZKB 5HN0A 3LP0B 3FSIA 4DV1F 4ID5B 4ANDA 1CJVB 2EG2A 2O1PA 3KUHA 2NLWA 2UVRA 1RABB 4I4BA 3OUYA 4LSZB 5DM6Q 4LF8J 4F4KA 4WPAA 3CVKA 4YB5A 4F4YA 2HNYA 1V3ZA 1R8BA 3M05A 2CPXA 2MQMA 2VZ9A 1RDRA 3KLIB 3CC2S 3TR5A 2HHPA 3M2UB 2YNIB 3I5AA 1OPZA 3OFGA 5HJXA 3D9BA 2KYXA 1UMJA 5A8KA 4ZPVR 4P52A 3T5LA 3PHEA 3FDSA 2H9ZA 3SSQA 4OYBA 2CDRB 4I2PA 3EPIA 2KFNA 3C46A 4XDDA 4M8LA 1P1LA 5JVGQ 3QGPA 4ECRA 3BN4A 3AD9C 5K8OA 1RAAB 1R6VA 2R7OA 1NSKL 4IFYB 1G7CB 2C2EA 1FWKA 4ZHRB 4QW9A 3IRXB 4PWDA 3LF0A 3W3SA 4DX5A 1FNXH 1N36J 1JJCB 2OLWA 3DLBA 2ZD1B 1S1WB 3P96A 2I5JA 4C3KA 4DPXA 3C2PA 3M4XA 3EXYA 2QLWA 4JB8B 5F0UA 4P74A 1XNQJ 5RUBA 3FBCA 2E5HA 4RNNA 3CXCR 3DLGB 3SI8A 3EGZA 2E44A 3I87A 4U7UK 4DQIA 2L41A 3MAAB 3MF5A 4JI0J 4Q8EA 2OPSA 3G6YA 1NK9A 3O3LA 1GMWA 4DPTA 2VKRA 3PJXA 1L3VA 3HSJA 3PW5A 2CQ2A 4B3MJ 2OPQA 2QLFB 2E1MC 1RTJB 3G87A 4JI2J 4XAKA 1X0PA 2NXUA 1ULRA 2B56A 4IH5A 3M6UA 1I6JA 3PNIA 3MD1A 2RS2A 3IC1A 2BE2A 1NKBA 4WKRA 3QNWB 4USTA 4A8MP 2UXDJ 4DV0J 5IQQA 1RXOB 1HW9A 1RWPB 3UDEA 1EQ0A 1WKKA 1Y9OA 4LRAA 4DCOB 2RF2A 1T7PA 3ADAC 4RW4A 3IM8A 2OEJA 1ZZNA 3R5GA 1PC4A 4DR2F 2C2MB 3OL9A 2NREA 3EICA 3D0GE 1X4FA 4X4NA 4WZQA 1S97A 2DY1A 4Q44A 2B9WA 3CCES 1DFDA 3VAMA 1TL3B 3VR1A 3TNVA 4KGKA 2RUSA 1N48A 2I9SA 4NCBA 4X4OA 4JI1J 3D0IE 1EP4A 4U96A 2DNGA 5B7WA 2AW0A 2HBZB 3MR3A
chains in the Genus database with same CATH topology
3DOMB 1YDLA 2JNJA 3DGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOM B;  1YDL A;  2JNJ A;  3DGP B; 
#chains in the Genus database with same CATH topology
 1YIJ S;  2RQC A;  4DFK A;  2F9J A;  3T9N A;  3H5Y A;  1WOP A;  2I6W A;  3MWB A;  2P9C A;  2B6A A;  3M8R A;  2HRU A;  3N79 A;  4N56 A;  4ZOS A;  2XUL A;  5JUM A;  1HNV A;  2IA0 A;  2OPP B;  3EUN A;  3QAU A;  4JUZ A;  2GHP A;  1H38 A;  3KLF B;  4TY8 B;  1ZM3 A;  2CAD A;  1VQ9 S;  4FXW A;  3C8Y A;  2DGQ A;  2NXN A;  1PJ6 A;  3H90 A;  3JQM A;  1G3O A;  3IS9 A;  3FC9 A;  4PQU B;  3EVM A;  2HIY A;  1TL1 B;  4CLT A;  1XK8 A;  3QGI A;  4OHZ A;  3ULH A;  4ZVQ B;  4CM2 A;  3NNA A;  1S57 A;  4QWD A;  2UUA J;  5GMD A;  4J7C A;  1FTR A;  4CO0 A;  4KGV B;  3PX0 A;  3LO3 A;  4CZC A;  1S5Z A;  5CYQ A;  2L9N A;  3UQS A;  2ABY A;  3VCD A;  5T7L B;  1WJ9 A;  3ETO A;  4DX6 A;  1N0U A;  5DDR C;  1TTH B;  2LQ8 A;  1HQE A;  5FII A;  3JYT A;  2XZD B;  3K17 A;  3AOD A;  2G0I A;  2WVB A;  3FQL A;  2DH8 A;  1EET B;  2CYY A;  1S48 A;  1U45 A;  2MQL A;  4B9U A;  3QRP A;  4MIB A;  2P9G A;  3BF4 A;  1UW4 A;  2HNZ A;  4EFA C;  3M9O B;  4MKY A;  4QWE A;  1CVJ A;  1JLF A;  4RNF A;  5GAG I;  2LQJ A;  3DFE A;  3T1Y F;  4ZP8 A;  3NBP B;  2H1Y A;  1X9W A;  1XMB A;  4ZCK A;  4WE1 A;  4W92 B;  2RRB A;  4MYU A;  4E2F B;  4DR5 F;  1RAO A;  3FCW A;  4RUB A;  3HHL C;  3M8Z A;  5EWE A;  1P6T A;  3EM1 A;  2MQN A;  3ICL A;  4O4G B;  2FGC A;  1NJI T;  5F8M A;  2WSC C;  4GO7 X;  4EZ9 A;  2YWW A;  1J5E J;  2DNL A;  2DEI A;  2QSW A;  2HBR B;  4KGM A;  1S9F A;  4I64 A;  3U27 A;  1FRJ A;  3R97 A;  1NDC A;  3BM7 A;  4IRC A;  3VGT A;  3HHL A;  4I0W A;  2FVQ A;  3A3N B;  3B8H A;  2AGP A;  3N6M A;  3KK1 B;  3CTR A;  2DK2 A;  1URR A;  3J81 U;  1ZM9 A;  1X4E A;  3UFC X;  3W61 A;  3BV8 A;  2YWG A;  1VYA A;  2Z58 B;  4K7Q A;  2HQF A;  2HHH F;  3R2D J;  3MTJ A;  3MM8 A;  2W7A A;  1X4B A;  2CQH A;  1I51 B;  2CG8 A;  4D3H A;  4LIW A;  2HUR A;  2ZBR A;  3V81 B;  2VOP A;  1I1G A;  1YBT A;  4NI2 B;  3KFW X;  4DUY F;  2FZC B;  2HQD A;  5KT4 A;  3I4P A;  5IT0 A;  4DV7 F;  3GLJ A;  1N54 B;  3DM2 A;  4YR0 A;  3NOG A;  4DUZ J;  4X4S A;  2HHU A;  3OJU A;  3AB2 B;  4M5D B;  3C6T A;  2QMU B;  3SDE A;  2EC2 A;  3K8W A;  2V4Q A;  1K1Q A;  4IFV A;  2FY1 A;  3EGN A;  3J7Z T;  1GXL A;  2XG8 A;  4ZVH A;  2W4D A;  5BR8 J;  1VLY A;  3UDV A;  2BUN A;  4L73 A;  2L9D A;  4KPY A;  3D6H B;  1IBL J;  2ASL A;  3QRQ A;  2VQF J;  2V4J B;  4YY3 F;  1YLX A;  2PI4 A;  3G6V A;  4F02 A;  4DV5 F;  5AE3 A;  2D3U A;  1RAG B;  1IKV A;  1BQX A;  1RWV B;  3OHB A;  3AOC A;  4LSN B;  1RTI B;  4LF5 J;  5B0D A;  3L7P A;  2IY5 B;  4XIU A;  4LF2 A;  2YVS A;  2C42 A;  1FDD A;  1QJH A;  3LAM A;  3IAM 9;  4M1K A;  3TUJ C;  3AFG A;  4HAC A;  4R8U B;  2ZBC A;  1CLF A;  1SBR A;  2RSQ A;  1NH8 A;  3BBF A;  4X4T A;  4NLX A;  5A8R B;  3OHA A;  2VPW B;  2YNF A;  3PX4 A;  3EPG A;  5DGB A;  2WW8 A;  4N5S A;  4DS4 A;  2W1B A;  3DLE B;  3L09 A;  2I1R A;  3QFH A;  2P8I A;  3MPW A;  3H5U A;  1SH2 A;  1IR1 A;  1WF2 A;  3DRS B;  1Q8B A;  5GAH I;  2J8S A;  4LVO P;  4UOF A;  4DR1 F;  2QN6 B;  3FK4 A;  4LJM A;  1NK5 A;  4LF4 F;  2E7V A;  1YI2 S;  1NB7 A;  1W26 A;  3M2V A;  4TU9 A;  4OX6 A;  4URQ U;  1QY7 A;  2KI2 A;  4FF1 A;  4FKY A;  1HBO B;  4AL7 A;  1PBU A;  3DGP B;  2RDD A;  3R3T A;  1JK9 B;  4ZIV A;  3US5 A;  4FYW B;  3F56 A;  3I9V 9;  3NCR A;  3R6G B;  2VKZ G;  3QIP B;  3IGV A;  3R1H A;  4CLF A;  2V2K A;  1NSA A;  1TVR B;  3BSO A;  3FNN A;  5KG4 A;  3UW1 A;  3DU6 A;  4L76 A;  2FB0 A;  3A1Y G;  2HVZ A;  2ZJQ Q;  4USI A;  2M5Y A;  5KFK A;  3M7V A;  5GAG U;  5K20 B;  3MEK A;  5F8I A;  5E3A A;  1U49 A;  3D1O A;  4DUT A;  4LRC A;  3PYE A;  1JXV A;  2VG6 B;  4P10 A;  4G3I A;  4K4U A;  3TEG A;  3MEC A;  1KNZ A;  1GTH A;  1U2F A;  3OV7 A;  1M1H A;  1PSD A;  2RIJ A;  2F5G A;  3N6N A;  4WIQ A;  3IAS 9;  2PI5 A;  2ZH1 A;  2AJ0 A;  5LMU J;  1R6Y A;  4RBU A;  4B9N A;  4W98 A;  1KOO A;  5IXU A;  4O44 B;  4URG A;  2W9B B;  3DRP A;  2Y3Y A;  2YBV A;  1BGX T;  5BJR A;  2BM0 A;  3JSR A;  4FF2 A;  3W9I A;  2MEW A;  2EFV A;  4ZLJ A;  3Q8V A;  4LF6 J;  1Q8I A;  1T9T A;  1WC1 A;  3R27 A;  1Y5I B;  1FRK A;  4Z2X A;  4EYH B;  4KYZ A;  3VAL A;  3CUL A;  1WC0 A;  5CXT A;  2QTW A;  4ATN A;  1KWM A;  1PO6 A;  1W2I A;  4HI1 A;  4YR2 A;  1JLG A;  2WB4 A;  4F4Z A;  1U6F A;  1S0N A;  3BO2 A;  2LVW A;  2XY6 A;  3PW2 A;  4DV1 J;  2DO4 A;  1BE4 A;  4X4Q A;  1JLC B;  2XI3 A;  3LP0 A;  2BE7 D;  1KFS A;  4ZN1 A;  4F4W A;  4ID5 A;  1CJV A;  1U24 A;  2V8P A;  5C2C A;  4LRD A;  3KKF A;  2B4U A;  4LF9 J;  4MT1 A;  1XR6 A;  5KFM A;  3NGK A;  1X9S A;  4NZ6 A;  4G1P A;  3CJK B;  3KLI A;  4HTJ A;  3M2U A;  1Q81 T;  2R2U A;  2YNI A;  4PPD A;  5D78 A;  5A8W B;  4HLB A;  3MXH P;  4O0N A;  1B7Y B;  2HK2 A;  3KK2 B;  3PRV A;  2YH1 A;  2AJ4 A;  2WRM A;  2O5D A;  3KJQ B;  4FNH A;  2MKC A;  4RW7 B;  5JMN A;  2E9T A;  1V5I B;  1MRO B;  1JXL A;  5L1K A;  2BRK A;  2G0J A;  4U67 Q;  4BDP A;  2APO A;  2HLU A;  2KRR A;  2A2C A;  1Q86 T;  4I6W A;  3MR6 A;  4CIO A;  3HXM A;  3A4T A;  2GMH A;  3GYG A;  2PD1 A;  3WX8 A;  1RGV A;  2KDO A;  2OTJ S;  2Z2L A;  1WEZ A;  3IBW A;  3LQV A;  4IFY A;  2C2Z B;  2EKY A;  4ZHR A;  3N0V A;  2CPY A;  1D8Z A;  1S1U B;  4KHP F;  4FP9 A;  1BLU A;  3IRX A;  3UI3 A;  4NA1 A;  3Q86 A;  4KTQ A;  3SQO P;  1WG4 A;  2KJW A;  5HQL A;  1VBZ A;  2X1F A;  4JI5 F;  3ZTO A;  1YJT A;  2G1H A;  4JYA J;  2YQ1 A;  5I42 B;  2LXU A;  2ZD1 A;  3SFU A;  1S1W A;  4RL1 A;  1XTZ A;  2VIH A;  1R7I A;  4IRK A;  3H4D A;  2B9Y A;  2MZ1 A;  2BX6 A;  3D6T B;  2KKH A;  1TR0 A;  4QIW D;  1Z4U A;  3DLG A;  4JI8 F;  4UTG A;  3AOA A;  3LP2 B;  3MAA A;  2W9A A;  3QRR A;  2RRN A;  4A8O A;  5HMW A;  3LW5 C;  2B7B B;  5E3P A;  1K0V A;  1S1X B;  2M8H A;  1UWA A;  1QTN B;  4ANE A;  3BO3 A;  5KT5 A;  2XCA A;  4NEZ A;  5LMN F;  3GQC A;  2RB7 A;  1QAJ A;  1RTJ A;  2FHM A;  3M8S A;  2AIR B;  4U6P A;  3P49 B;  4N77 A;  3T5H A;  3GSD A;  4D3G A;  1FES A;  2M4M A;  3W8G A;  2N3L A;  3V6D B;  3UVJ B;  2R8J A;  1R3N A;  3D6F B;  2XQC A;  5ETK A;  3K59 A;  4M63 A;  4F2R A;  1HNW F;  4K2X A;  1GXU A;  4F0M A;  4K50 A;  4X4P A;  2ZNY A;  3V6K A;  2AT1 B;  4DN0 A;  5KT6 A;  3W60 A;  4O4R A;  2J9D A;  2RHQ B;  1SPB P;  2CAJ A;  3DLK B;  4O3N A;  2HHX A;  2ZVS A;  1Q7Y T;  1AZS B;  1TV6 B;  5LJ5 Y;  1S6U A;  4L75 A;  3AJD A;  3IWN C;  3G4S S;  2R9L A;  2ZM6 F;  4J9U E;  2YH0 A;  4BS2 A;  3HPO A;  3CCM S;  3JXO A;  4IRD A;  2FJV A;  2HFV A;  2F1F A;  2OUG A;  4LFA F;  1TL3 A;  3CNQ P;  2FJX A;  1B0P A;  5D0E A;  1B3T A;  1RT4 B;  2FLP A;  1L3K A;  1WHW A;  2P6T A;  4OZ0 A;  3IR6 B;  1IR2 A;  2ZEJ A;  4NLY A;  4UY8 5;  1CQN A;  3BS9 A;  2WON B;  3C14 B;  5A0Y B;  1AA1 B;  3CPW R;  1R89 A;  2XLJ A;  1SIW B;  1AB8 A;  1KQK A;  4H4M B;  4KE5 A;  1T9U A;  5T41 A;  2ZHB A;  3RR7 A;  1KN6 A;  2OPP A;  1ZM4 A;  4DV3 F;  1RLC L;  5E3Q A;  2DT9 A;  3KLF A;  4TY8 A;  3A13 A;  1N4L A;  4WP3 A;  3RBD A;  1UVJ A;  5CZX A;  1AYE A;  1HAR A;  3J81 j;  4PQU A;  2F3J A;  1VRT B;  1TL1 A;  1UTA A;  3CE8 A;  4TVA B;  4HDG A;  4YFU A;  1RSC A;  4A46 A;  4ZLN A;  2NQP A;  2MPU A;  4LF7 F;  4KQZ A;  9RUB A;  2UUT A;  5KFW A;  5F8J A;  2XTJ P;  5GMK a;  2Y0B B;  1VQ5 S;  4WFB Q;  2GIR A;  4PXD A;  2VJU A;  1T95 A;  1YZ7 A;  3ZTQ A;  1BQN B;  3EE3 A;  4ED1 A;  5T7L A;  4H4K C;  3RBX A;  5J2M B;  1TKZ B;  2CQC A;  2R7S A;  1NCL A;  1EET A;  3IR7 B;  5AT1 B;  2ASJ A;  1I94 J;  1TL5 A;  1NK7 A;  3MGJ A;  3QT7 A;  2V8V A;  2JZ5 A;  4PG7 A;  3ZC4 A;  3T1Y J;  4K5R A;  1JXE A;  1MLA A;  3NY0 A;  4K4T A;  4NLS A;  4DHV A;  3RB0 A;  4H4K A;  2V67 A;  4WYL A;  4OX9 F;  3NBP A;  4WF9 Q;  3RYL A;  1QVF R;  2DEJ A;  3CCW A;  3OT9 A;  2CPI A;  3GV7 B;  4ED6 A;  1TKT B;  2DB1 A;  4HDH A;  1R0B G;  4PPZ A;  1UFW A;  4O4G A;  4QYR A;  1X5T A;  3MOZ A;  3QGH A;  1C1B A;  1TEL A;  5H9F K;  1OMS A;  2VG5 B;  3TZZ A;  2A6M A;  5GAE I;  5BYS A;  4DEZ A;  1SL1 A;  2WB1 D;  4C4W A;  1B7F A;  1ZS6 A;  3IO1 A;  3QSI A;  3PJW A;  1AXQ A;  3OTD A;  3NMA A;  1S0M A;  4TU7 A;  2YKP A;  1FDA A;  2AWZ A;  4O3R A;  2GVD B;  1NZA A;  2HFU A;  3KHL A;  2HFS A;  5HRO B;  4NML A;  2M8D B;  2HHH J;  1EX8 A;  3D66 A;  1FF2 A;  2EC0 A;  4LBH A;  2MQ8 A;  1E6V B;  2IBO A;  3W5Y A;  5F3Z A;  1M1K T;  5LSL A;  2IRY A;  3ZXW A;  3GJS B;  3CJ8 A;  1M1G A;  5KFA A;  3THP A;  5ETO A;  1TKD A;  5KFO A;  2PGC A;  2HMI B;  1N5T A;  1IWG A;  4DUY J;  5AJ3 J;  3TX0 A;  3V81 A;  2R2R A;  4NI2 A;  2DPI A;  4ZS6 A;  2QA1 A;  3PW7 A;  3GP9 A;  4HR2 A;  1VRQ C;  3V2U C;  2IHR 1;  1DY3 A;  2HZV A;  2ZIT A;  1T9V A;  5KG2 A;  1RWK B;  1CEZ A;  4JV1 A;  5KG6 A;  1BHN A;  4FVM A;  5DDQ C;  4M5D A;  1PKU A;  4OZL A;  2XHW A;  5HI7 A;  4EK2 A;  2DVI A;  2KZM A;  3D0H E;  2X1G A;  1F3V A;  1GMU A;  1Q16 B;  3W1Y C;  3HK2 A;  2GQQ A;  2M3D A;  2VDH A;  5CQG A;  4YY3 J;  3DDI A;  4DV5 J;  2LA4 A;  2ACY A;  2J76 E;  2V4J A;  4R0J A;  3MUT P;  3KTQ A;  2NUH A;  4KRW A;  4FYV B;  3CC7 S;  4N8O A;  3HM9 A;  4WK3 A;  1SKS A;  3KJV B;  2KHD A;  4LSN A;  2CQI A;  3K0J A;  2HND B;  2ZHO A;  1RTI A;  1VC5 A;  2E29 A;  1KLM B;  4ZVE A;  2OEM A;  4OJH A;  2G0C A;  3E51 A;  1H6K X;  4DCP B;  1KS2 A;  1QUP A;  2XMT A;  1TAU A;  4R8U A;  4NCG B;  2DIS A;  4WZM A;  2DD8 S;  3W2W B;  4XO0 A;  1NBE B;  4X84 A;  5A8R A;  3VVU A;  2LMI A;  1JLB B;  1MNE A;  3DHX A;  5KFL A;  4RWW A;  7AT1 B;  3DLE A;  5DZ7 A;  1UVI A;  4USH A;  5FLX U;  1N34 F;  4NRU A;  3HF5 A;  1Q4R A;  3DU5 A;  2HHW A;  4CYU B;  3DRS A;  3AJ1 A;  2VOO A;  2VPX B;  1B64 A;  2HQG A;  2KHC A;  3KDN A;  1HIY A;  2GIF A;  1TMJ A;  1FJG F;  2XCP A;  2FHO B;  4PAB A;  4Q2M A;  1HBO A;  3DGP A;  1NXI A;  2BV3 A;  5KAK A;  1N8R T;  4HL9 A;  3M8Q B;  4PWW A;  1K1S A;  1QSL A;  3CJQ A;  1NPR A;  3DRX A;  3QIP A;  2KO1 A;  1SCJ B;  3S01 A;  1TVR A;  1WKL A;  2MQQ A;  2DHH A;  2HVE A;  4TKT A;  2GA7 A;  4MIA A;  2V2Q A;  2IRX A;  4ZPC A;  3CD6 S;  3HO1 A;  1DLO B;  4GRS A;  5D0R A;  4UZC A;  4FYD A;  2VG6 A;  3PG9 A;  3OR2 B;  4B9L A;  1HI1 A;  3D7S B;  1QD1 A;  3CCS S;  3GCW P;  5CH7 B;  2JLG A;  5BXI A;  2B51 A;  2VH7 A;  1MML A;  5EN1 A;  4MH8 A;  4X4R A;  2ERR A;  3DMJ B;  2KFY A;  3ZO7 A;  1OY9 A;  2E5I A;  3THT A;  2IM0 A;  4IDK B;  4QR0 A;  2IJR A;  1NSP A;  1IJE B;  4F0K A;  2KG0 A;  5J2N A;  1U2R A;  4O44 A;  2R8K A;  1AW0 A;  1P8G A;  3W64 A;  4NLW A;  1WHV A;  2W9B A;  5GAE U;  2MZT A;  4YUD A;  2QG9 B;  3IA0 A;  5K8N A;  3UR0 A;  2C3O A;  4F3M A;  2J8A A;  4EI2 A;  3JQJ A;  2AKW B;  2VFV A;  3GSI A;  3B4D A;  3T1H J;  4DR7 J;  1FDN A;  2RU9 A;  2XY7 A;  3DLJ A;  2E5G A;  1MMD A;  3BBB A;  2V94 A;  1N33 F;  2ROG A;  5EUH A;  4I6A A;  2OI2 A;  1H7W A;  4CWB A;  4C6A A;  5J1N A;  5HBM B;  2ATL A;  2MXY A;  4MIW A;  4FNI A;  4O23 A;  5HK4 A;  1JLC A;  2UXC F;  3U1L A;  3CJ3 A;  4W90 B;  2VBY A;  2OAU A;  3I4H X;  4QU6 A;  3GFX A;  5H1S V;  4LQ3 A;  1YRX A;  1KKH A;  1H2T Z;  4RR5 A;  2WAQ D;  3MPD A;  1QAY A;  3H20 A;  1VDH A;  2R8I A;  3LP1 B;  2GAG C;  2Z8Q A;  3DYA B;  1Q1K A;  1BWV A;  2HVI A;  4ZCI A;  1HLW A;  2DNQ A;  3CJK A;  4F04 B;  3ZTS A;  5L9N A;  5DG9 A;  3TI0 A;  5ETS A;  5A8W A;  2HHQ A;  3AD7 C;  4Y2C A;  2HBY B;  1IXK A;  3VAI A;  4YME A;  3E01 B;  2MB0 B;  3DOM B;  1RT5 B;  3KG1 A;  1VQ8 S;  3KK2 A;  1VBY A;  1WC4 A;  2YPZ A;  1Y3J A;  5I3Q A;  2EBE A;  4RW7 A;  1KHV A;  4NA3 A;  4CO5 A;  1QUV A;  1ZTW A;  1MRO A;  3GPA A;  3PRD A;  2EG1 A;  2RDI A;  5ETL A;  1TAQ A;  1VLO A;  3Q2S C;  3M1V B;  3QPI A;  2FVP A;  3AT1 B;  2JC1 A;  2MZS A;  1EAR A;  2DO0 A;  2F4V F;  2KZZ A;  2VON A;  1KR4 A;  1VIS A;  3HZG A;  3BO4 A;  1GK8 A;  3OVA A;  4JV5 F;  2ILY A;  3MAH A;  4L3K A;  2DNO A;  4GKJ F;  1B99 A;  4ED5 A;  3JQK A;  1S1U A;  4NLQ A;  2AHO B;  3R2C J;  4NAS A;  2D3Z A;  4YB7 A;  3CJ5 A;  3ETM A;  2BYC A;  1U8W A;  5LT5 A;  4H4O B;  1WI6 A;  3GII A;  4P7V A;  4ZJL A;  1SXL A;  2YPY A;  4EUV A;  2XBP A;  4RUH A;  2XYH B;  1FKA F;  1PG5 B;  2H51 B;  4KO0 B;  4ZIT A;  2XMW A;  2HFO A;  1NH7 A;  1OJ4 A;  3MMB B;  4K0K F;  4BCA A;  2FHK A;  3CT9 A;  3KOA A;  4TY9 A;  5LMN J;  1WG1 A;  3CGI A;  2QJ3 A;  1S1X A;  1Q79 A;  1YJU A;  5D4P A;  1ZAW A;  2VA3 A;  2LQB A;  4J9N A;  4JV0 A;  1P1T A;  3OBI A;  5HAT A;  4PQA A;  1F2G A;  3IWX A;  2HWH A;  1U4B A;  1UKU A;  2XHC A;  2BOA A;  3IN5 A;  1U1M A;  4PYD A;  1XBW A;  1WTF A;  1HWL A;  2VL1 A;  2XMA A;  3TVZ A;  3V5R A;  5KFZ A;  2VFS A;  2X1A A;  3UCZ P;  3V6D A;  3UVJ A;  3VWS A;  2ZH5 A;  2BBE A;  3L7U A;  2GS8 A;  4R5P B;  2IA6 A;  1R8A A;  4DMZ A;  2ZOF A;  3N6L A;  2JRS A;  3JS9 A;  3I0R A;  4NZ0 A;  3ZZO A;  4FZV A;  3QLH B;  2QA2 A;  1G4C A;  2XO7 A;  3GIL A;  4LFC J;  2VQE F;  3DLK A;  1R0C B;  1AZS A;  1TV6 A;  1N5Q A;  3D1H A;  3HCX A;  2HFZ A;  1DQ8 A;  5EX0 A;  1VQP S;  2R2T A;  4J9O A;  4Z37 A;  2ZM6 J;  4Q8F A;  4HH1 A;  4JI4 J;  4ZIW A;  5K8M A;  4U9R A;  3D5M A;  4EGL A;  1HFE L;  3BR9 A;  2YWH A;  2HEK A;  3D68 A;  2BAN B;  3IXQ A;  4OX7 A;  1RHJ B;  3CCU S;  4DU8 A;  3FJ2 A;  1RCO B;  3R5A A;  1ZBT A;  5EGY A;  4ECV A;  1NK0 A;  3GCX P;  1RT4 A;  4WFY A;  3ISN C;  3O6Q A;  5HMX A;  2ZC4 A;  2J5A A;  4J9L A;  1FXD A;  5LJ3 Y;  2EBG A;  4UQG A;  2WON A;  3C14 A;  5A0Y A;  1UWB B;  4Q43 A;  2CPF A;  2ZBI A;  4H4M A;  9ATC B;  2W9C B;  1HNX F;  4ZP6 A;  5LXR A;  4QYZ J;  2L48 A;  4GC6 A;  4ECQ A;  2C2K B;  1JIH A;  2MTL A;  3C3L A;  3HZE A;  1JLA B;  4ZVT B;  5MAO A;  1VGY A;  1DTT B;  4CH7 A;  1IBM F;  4OYX A;  2V5H G;  4P7T A;  4LF7 J;  1VRT A;  3NWG A;  2HKE A;  5E7O B;  3J7Y I;  4JI3 F;  3V4I B;  3KYL A;  1NJZ A;  1C0T B;  4V1A k;  1XQI A;  3EXC X;  4RBT A;  3DHW C;  1RK8 A;  3MR2 A;  2AV5 A;  3D6M B;  4ILM A;  3VAK A;  4BWM A;  2XEX A;  1LK5 A;  1BQN A;  5A76 A;  3QID A;  2HWI A;  4IO9 Q;  3I0S B;  3UPF A;  2FLN A;  2E1R A;  2DXF A;  5L46 A;  4G1I A;  5J2M A;  2RJZ A;  1TKZ A;  3KK3 B;  1CBK A;  5AXK A;  1FI4 A;  2POK A;  1WG5 A;  1S1T B;  2NSB A;  2OHD A;  3AOB A;  5DDP C;  4DR4 F;  1K47 A;  4O3Q A;  1WNE A;  5A2Q U;  4TU8 A;  4OX8 A;  2DNH A;  4OX9 J;  2EFG A;  4DV2 J;  3FFI B;  1LOU A;  2RE1 A;  3KHG A;  4NRT A;  4DBQ A;  1LWC B;  2JEJ A;  3VGS A;  5B0B A;  4KR0 B;  1UVM A;  1UJ6 A;  4AYB D;  1Q5Y A;  3UDL A;  2J6T A;  2VV5 A;  3UN3 A;  7FDR A;  2WVD A;  2BJ1 A;  4FKX A;  2Z2Z A;  2VC1 A;  4O3S A;  1TKT A;  4DSK A;  3RW7 A;  4AXI A;  4C8O A;  2EK1 A;  3D28 A;  5AXM A;  1VIO A;  3NOC A;  2ACM A;  4X62 J;  3TA0 A;  4ELU A;  3J7A 1;  4RBV A;  3CDW A;  2VG5 A;  2WOM B;  2CWK A;  1V6H A;  3MI7 X;  1N32 F;  5EWG A;  4USW A;  4F50 A;  1X60 A;  1R0A B;  1PYO B;  2ZBQ A;  2GVD A;  3DRY A;  3Q89 A;  3DRR B;  1ICE B;  4MKV A;  5HRO A;  5DG7 A;  1WEL A;  2M88 A;  1F9E B;  1E6V A;  1M90 T;  5HSP A;  1A7G E;  3JTN A;  4I6Y A;  2JDJ A;  2DHX A;  1X4H A;  2DGO A;  2AYE A;  3SEO A;  1F3F A;  4JI7 F;  3A8E A;  3CJ4 A;  2A3J A;  2HMI A;  1SC1 B;  2ALY B;  3DC2 A;  1VR6 A;  2NXC A;  4TQS A;  2DGW A;  1LNQ A;  5KG3 A;  3BKF A;  2YQ3 A;  3BR8 A;  2YKN B;  5J1E B;  1DTQ B;  4M5M A;  1RAF B;  2ZBP A;  3KNA A;  2EFO A;  4NA2 A;  2NSC A;  2UP1 A;  5D0G A;  1SQE A;  3DOK B;  3M30 B;  1HI8 A;  2OPR B;  2WBR A;  1VQN S;  2KVQ E;  4WXW A;  2HW3 A;  2DR9 A;  1NDK A;  5KFY A;  1F60 B;  3TEH B;  1M0S A;  2YWF A;  1FNO A;  1FER A;  1RE1 B;  1VJW A;  1RHM B;  3PY8 A;  1L3T A;  4B3R F;  2HQI A;  2LDY A;  1PCA A;  4X4U A;  4F3O A;  2DGS A;  3NS5 A;  2MQP A;  2B4O A;  2FIU A;  1HMV B;  3PZP A;  4OZ5 A;  3KJV A;  3M8W A;  3UCU P;  2HND A;  1LK7 A;  2GAH C;  1UPM B;  2PEB A;  1KLM A;  1O8B A;  4QPX A;  3W66 A;  4PWU A;  3M8Y A;  3P6Y C;  4ETX A;  4C9D A;  4NCG A;  3KUE A;  3W2W A;  2J9E A;  4CLS A;  3NP5 A;  3TQE A;  1JLB A;  1WSV A;  2D3O R;  2VHG A;  3SCI E;  5B0E A;  1FX4 A;  2JLF A;  3WZ0 A;  1N34 J;  4PR6 A;  5KOX A;  2FVR A;  1ROF A;  4EMD A;  5GAD I;  3TAQ A;  2I2Y A;  1RAC B;  4OFZ A;  3GR0 A;  1S49 A;  2MKS A;  1U02 A;  3U1N A;  1YQH A;  2D69 A;  3OR1 B;  4M5J A;  4HT7 A;  2HRT A;  3J7Y U;  1E6Y B;  4CYU A;  1S0V A;  3RGI A;  3UN5 A;  2N7C A;  1Z2L A;  1NND A;  4OYP A;  5KG7 A;  2UUC F;  4DJB A;  4WFA Q;  2Q43 A;  3QQC D;  3THV A;  2JJ4 D;  3AXM A;  5B08 A;  3M6X A;  4AD6 A;  1RJJ A;  3CDU A;  3LOU A;  3F73 A;  2A1B A;  4DV4 J;  3R5J B;  3DXS X;  3NGU A;  3OL7 A;  2Y8W A;  1D09 B;  1HR0 F;  3M8Q A;  1GMW D;  2NXJ A;  4X4V A;  3LGN A;  2DYA A;  4MMO A;  2E9Z A;  2AU0 A;  5SZT A;  4QBU A;  3HD2 A;  5F9L A;  2WVC A;  1DLO A;  5T14 A;  2BJD A;  4RPF A;  4WKY A;  1JQG A;  1O6X A;  2CG4 A;  3J7Z 5;  3OR2 A;  3KLH B;  3MM5 B;  2GJ2 A;  4HVZ A;  4B9S A;  1HBU B;  3CCZ A;  4KKO B;  3MED B;  2B5J B;  3DMJ A;  1ZH5 A;  2UVV A;  4I56 A;  4IDK A;  1X5S A;  1LQ9 A;  3TJ8 A;  2BE9 B;  3G96 A;  3R8Y A;  2AJ2 A;  2AZ3 A;  1FX2 A;  3TA2 A;  3ILL A;  4ZJQ A;  2A18 A;  1CPZ A;  1T94 A;  4OMF G;  1UJ5 A;  3NL0 A;  3R7N B;  2MQO A;  3EMT A;  2COL A;  2EFN A;  2K8G A;  3N5B A;  4I1T A;  2IMO A;  1R8C A;  3HVT B;  8ATC B;  4DR6 F;  3UE2 A;  3O1L A;  1KVK A;  1MWY A;  4NMX A;  3H40 A;  3BSN A;  4ZVS B;  4U7C A;  3CO0 P;  3ILJ A;  5IT9 Y;  2DIV A;  1T0T V;  2RUG A;  2EXU A;  2QLJ B;  2JH3 A;  1S7I A;  1N56 A;  3FSX A;  3OD2 A;  1QE1 B;  5DZ6 A;  4A48 A;  3RB6 A;  2UUB F;  1RHQ B;  4KIA A;  4RO0 A;  3OTC A;  1CQM A;  1HWJ A;  3CCJ S;  3KLG B;  4CNY A;  5HBM A;  2FQQ B;  4BHQ A;  2LP4 A;  3VVT A;  2OGU A;  5F3T A;  4CLK A;  1PYS B;  3R9L A;  2RH3 A;  3AAW B;  1S72 S;  2VFU A;  2YKO A;  5DQG A;  2VJV A;  4NEY A;  4Y2A A;  3SQG B;  3CSK A;  2EW9 A;  4ZP7 A;  4ENO A;  4ZPA A;  1HQU B;  1W2B R;  3AJ2 A;  1RTH B;  3TP2 A;  4FYX B;  3LP1 A;  5CYJ A;  3KHR A;  4J9P A;  4NLR A;  3JSY A;  4C3L A;  4KY3 A;  5EX3 A;  1VQ7 S;  4OLO A;  3HX9 A;  3R5C A;  3HSZ A;  4LIR A;  4UUW A;  3PW0 A;  4TXS A;  4NWB A;  3TJ9 A;  1VMB A;  2ROP A;  2FC9 A;  3E01 A;  3DOM A;  1RT5 A;  3FEZ A;  1D8Y A;  5SUH A;  3P5B P;  2R2S A;  4ICL B;  3SFG A;  4Y2K A;  1FKP B;  4ETZ A;  1D9F A;  1WHX A;  3PEJ A;  4R25 A;  2BQ3 A;  1Q82 T;  5CD4 A;  5L8R C;  3M2R B;  2F4V J;  2D41 A;  3M1V A;  4I2Q B;  1ZPW X;  3F41 A;  4QWC A;  3MFI A;  1X31 C;  4GVL A;  5HMY A;  1HBM B;  1T3O A;  1DBD A;  2V68 A;  4NLU A;  3MCO A;  2BJE A;  4LBP A;  1CC8 A;  2QFI A;  2QLX A;  4MK7 A;  3I5B A;  3MOJ B;  4YHH F;  3FBF A;  2R42 A;  5D6G A;  4P2M A;  5KFP A;  3CED A;  2J0W A;  4H4O A;  2V8G A;  2R7Q A;  2CIM A;  5AXL A;  2N82 B;  2OKQ A;  2E7X A;  4FF4 A;  3G86 A;  4YEA A;  2OH2 A;  5IT4 A;  4K0K J;  2OMO A;  4CP5 A;  1RHU B;  4NLG A;  2GML A;  2OML A;  3QGG A;  4K4Y A;  4KO0 A;  2IAJ B;  2JHE A;  2YX4 A;  4OYO A;  3MMB A;  3VQS A;  1HD0 A;  3OTO F;  5KFV A;  4ECT A;  4M5I A;  3PW4 A;  2ZKU A;  2YKA A;  3AY0 A;  2HZC A;  3BN7 A;  3FVY A;  4AXJ A;  1FVQ A;  1FWL A;  2I8E A;  4DV6 F;  5JXS A;  2LYV A;  3AH6 A;  5C24 B;  1QSY A;  4DSF A;  1S6P B;  2YNH B;  3HHL D;  1C4A A;  1N52 B;  4C11 B;  4WTY A;  2HHT A;  4LT6 A;  2P2C B;  1FDB A;  8AT1 B;  1F5B A;  1JLQ A;  3HVW A;  5IM0 B;  1ITP A;  5BYQ A;  1RYS A;  2L08 A;  3N28 A;  1YBU A;  2CQB A;  2OEL A;  5L1J A;  2UVU A;  4R5P A;  1RLD A;  1XC9 A;  3QLH A;  3NS6 A;  1X4A A;  1FFW B;  5KFQ A;  3BBC A;  4GKK F;  4HKQ A;  3C6U B;  1S6O A;  1BMQ B;  2PMZ D;  2H3E B;  2JEF A;  4DWI A;  2J7U A;  3TAR A;  5ETT A;  1FRI A;  2BJ3 A;  1WC6 A;  1GAO A;  1YJ9 S;  2FZG B;  1KTV A;  3MUR P;  2FJB B;  2BAN A;  5M2P A;  3KUG A;  1X4D A;  4X66 F;  3DOL B;  3ZNJ 1;  3G8S A;  4OI2 A;  4DR3 J;  3DDN A;  2IC3 B;  3EJM A;  3ZTP A;  4KHM A;  1GX6 A;  2V0N A;  2RDJ A;  1M5S A;  1P9Y A;  1XIQ A;  2AEJ A;  4NCA A;  4WP8 A;  2CQG A;  3SV3 A;  2F65 A;  1H2V Z;  1VS3 A;  3RJM B;  3BGR B;  1R31 A;  1LKZ A;  1IJF B;  2KH9 A;  1UWB A;  1NU4 A;  2YX1 A;  4CLZ A;  2P6S A;  1GMV A;  2RNE A;  4A8Q A;  2W9C A;  4W4M A;  4DL2 A;  3GE9 A;  2W2P P;  1IBM J;  1VQ6 S;  3HVR A;  2PFF B;  1F5A A;  1JLA A;  3GZ7 A;  2OD6 A;  5M2R A;  1JMT A;  1RKJ A;  1DTT A;  1XJW B;  3RTV A;  2OJ3 A;  2B9X A;  1NEE A;  4S0M A;  4B08 A;  3G82 B;  4HH0 A;  4F67 A;  4JI3 J;  2FHJ A;  2ZH7 A;  3WC0 A;  3SYZ A;  2HSE B;  3NXZ A;  1CJK B;  3FUY A;  3UNG C;  4C0B A;  4A8S A;  5H9E J;  3V4I A;  2HPU A;  1C0T A;  2AJF E;  3CCT A;  2K06 A;  4A8F A;  4HT5 A;  4U8V A;  2QIF A;  1JB0 C;  1KTQ A;  1BUX A;  1N36 F;  2KXH A;  4USV A;  3I0S A;  2JEG A;  3PAC A;  1JLE B;  1RQ0 A;  4LSL B;  4DR4 J;  1SIZ A;  3CJT A;  2G9O A;  4KSE B;  3KK3 A;  4FS1 A;  3MPU B;  3K5O A;  1S1T A;  2Q66 A;  2DIU A;  4ED2 A;  3OTE A;  3HHN B;  1XNQ F;  2G13 A;  1O51 A;  2OPS B;  3EVW A;  2PO4 A;  3NS7 B;  3VAH A;  1RT6 B;  4M5L A;  4USJ C;  1U1P A;  4ZVP B;  4NLV A;  2GNK A;  3W5X A;  1RA6 A;  4HYK A;  1D1U A;  4JI0 F;  4K4S A;  1KQF B;  3FFI A;  4WJB A;  1LWC A;  2J0S D;  4DPY A;  2CNO B;  4RKU C;  2QYG A;  2QC3 A;  2NZ4 A;  3K5P A;  4JI2 F;  2AYM A;  2DTJ A;  5GME A;  4LFB J;  2BE2 B;  2W4P A;  1U1K A;  2CPD A;  3D2W A;  5HLF B;  4DG1 B;  3CJ2 A;  4M5N A;  5K5M A;  4OIX A;  3U02 A;  5L1L A;  3W7B A;  2LLZ A;  1BD6 A;  1KDN A;  1KLN A;  2DCU B;  4CO1 A;  1N32 J;  1SJ4 P;  1NHV A;  2WOM A;  1SJR A;  4DV0 F;  4LF1 A;  5I3P A;  1MN9 A;  3BJY A;  2MDA A;  4RW8 B;  4X64 J;  2PDA A;  3BYR A;  1R0A A;  1KD1 T;  2QA4 G;  1HYS A;  1IM4 A;  5A6P A;  1XNR J;  2VUG A;  3LGH A;  3LAL A;  1NPK A;  3DRR A;  1OS5 A;  1FRL A;  4DLG A;  2BMB A;  5KFU A;  1RTD B;  3CD7 A;  4JI7 J;  4MKB A;  3BGO P;  1Q95 G;  3ENW A;  2XS7 A;  1UEV A;  2W24 A;  3N4W A;  1L3S A;  5FDL B;  4ED0 A;  2W8L A;  3H42 A;  4P73 A;  2B3T B;  5B0G A;  2C2R A;  4L3N A;  3UO0 A;  3S6E A;  1JJH A;  4JI1 F;  5KFI A;  1U1L A;  3Q23 A;  1DUR A;  2YKN A;  2JFD A;  1HNZ J;  3O44 A;  5J1E A;  1DTQ A;  5KFX A;  3ZZZ A;  3BDE A;  3OXF A;  4H54 A;  4DZD A;  1HBN B;  1MWQ A;  1UFK A;  3FZB A;  4PXB A;  1VHF A;  3M30 A;  4OYI A;  1AT1 B;  1R8P A;  3HT0 A;  2DR6 A;  2M0G B;  4DSE A;  3T5J A;  2BR0 A;  2ZH3 A;  3C15 B;  4Y3C A;  3TUZ C;  1H98 A;  3SCK E;  1S4E A;  2F7V A;  4PUO B;  3GIM A;  5HVF A;  1EJ7 L;  2M7S A;  4FXV A;  3VF0 B;  1SJF A;  5CYM B;  3I32 A;  2Z2Y B;  2HYI B;  4A8X A;  1VQ4 S;  2Q1L A;  4UOG A;  1HMV A;  2OFG X;  1M5H A;  3E2E A;  2UUA F;  1A0O B;  4ZPB A;  2WBM A;  2N3O A;  1ZAV A;  3N01 A;  4DXL A;  3CIM A;  4L6V 3;  4WFZ A;  1OPI A;  3SCJ E;  4OYW A;  1HKA A;  3WHI A;  2A0F B;  3QMQ A;  1S59 A;  2VOD A;  2HNZ B;  4XPC A;  1S77 D;  2DJW A;  2YKM B;  1YZ6 A;  1RAD B;  4J5O A;  3OR1 A;  4ZVR B;  3HD1 A;  4B3O B;  1E6Y A;  2OSQ A;  3ILI A;  4FF3 A;  1G1X A;  3TA1 A;  4JBC A;  2Z2M A;  4UQT A;  4AUK A;  2AJ1 A;  3OQ2 A;  1VIX A;  1T05 B;  2VF3 A;  2BJ8 A;  5K14 B;  2KFZ A;  2DR8 A;  1TMM A;  3TW0 A;  3GR1 A;  2CNN B;  4BC7 A;  2BKO A;  4MK8 A;  2J0Q D;  3NWR A;  2CQP A;  4NZ7 A;  1DHM A;  2CQ4 A;  1KOH A;  2ZH8 A;  3J80 Y;  4Y00 A;  1RBA A;  2AP6 A;  2VBX A;  3GV8 B;  3SCL E;  1RKI A;  2GVZ B;  3MFH A;  4BWJ A;  3I55 S;  3KWM A;  4M94 A;  2E5L J;  2LFV A;  4FBU A;  4K8R A;  3Q22 A;  4DL5 A;  2V2Z A;  1Y0H A;  1YWX A;  2HG4 A;  2F9D A;  4OHX A;  3RU0 A;  2XZT B;  3MM5 A;  1YJR A;  1IKX B;  1X5P A;  4K5S A;  4ZKA A;  3M6W A;  1NO8 A;  1D9A A;  2OEK A;  3MM8 B;  1GX5 A;  3MED A;  2B5J A;  3HP6 A;  4L72 B;  3EZ5 A;  1Q0N A;  4QIE A;  1S0O A;  2HGN A;  2N4C A;  1FK9 B;  1DRZ A;  4OLP A;  1WAC A;  4KBI A;  1TQL A;  1SL2 A;  3LWL A;  1M5P C;  3DN9 A;  2KYZ A;  4UOC A;  1J27 A;  1UVK A;  2C22 A;  3ILO A;  4KV8 B;  5G4D A;  4EO8 A;  1H7X A;  2MY8 A;  3HVT A;  1KON A;  1AUS L;  3CWJ A;  4IOB A;  2FLO A;  3QJP A;  3M6V A;  4C0O C;  3MCM A;  1APS A;  2HQ3 A;  3QT6 A;  4DUZ F;  1NJY A;  5DET A;  3GIJ A;  4EBE A;  1FJE B;  2C2O B;  1FFG B;  3BGL A;  4AFF A;  4TQR A;  2BEF A;  1PYT A;  1VK8 A;  1IKW A;  2BVZ A;  1QE1 A;  5BR8 F;  1ZZF A;  1J5O B;  3KLG A;  5J2Q B;  4RNH A;  1IKV B;  1B0V A;  3KNG A;  2Z56 B;  2V4R A;  3NNH A;  3FBE A;  4AQY F;  2FTR A;  4KH1 B;  1YJW S;  5KFF A;  3SQG A;  2Q3P A;  4B02 A;  4KHR A;  2DR7 A;  1S1V A;  2HS3 A;  2ILZ A;  3OVS A;  4LF5 F;  1PAE X;  3HDS A;  1HQU A;  4P72 A;  1RTH A;  2DHS A;  3HUL A;  4GO5 X;  4ZDN A;  1IQT A;  3NCQ A;  1IBC B;  1YKW A;  1FD8 A;  3R7B B;  4WK1 A;  1RT1 A;  3CD5 A;  2XI2 A;  3NGR A;  4NYP A;  1YX2 A;  2Y8Y A;  2GQ2 A;  1XR5 A;  1GEH A;  3JTO A;  2H4Y B;  4ICL A;  1KHW A;  1P9Q C;  1FKP A;  3UD5 A;  3MTK A;  4ZA1 A;  4EWT A;  2W8K A;  3RB4 A;  1C4C A;  3M2R A;  4N7T A;  1NZ8 A;  4DF4 A;  4C98 A;  4EEY A;  4I2Q A;  2BJ7 A;  3TVY A;  2G4B A;  1YJV A;  5KG5 A;  2ZOG A;  1HBM A;  1MW7 A;  1O5J A;  2LA6 A;  3VZI A;  2NXE A;  3NCP A;  2HQC A;  1C2P A;  1QTM A;  4ZCL A;  1U25 A;  1I3O B;  2CQD A;  2HFN A;  5HP1 B;  5AXN A;  1PAU B;  2W01 A;  4DSL A;  5DGA A;  2QSF A;  2DBB A;  1NDL A;  4RW9 B;  2PMH A;  2AF6 A;  2JSX A;  2JLE A;  4HI2 A;  3CF5 Q;  4U7U D;  2Z0G A;  4OYM A;  1F1B B;  3OTO J;  2HIQ A;  1XMQ F;  1CC7 A;  3LTO A;  2IAJ A;  2XS2 A;  3M9M B;  3TVK A;  4DV6 J;  7FD1 A;  1ZTT A;  2CJQ A;  3A8I A;  2YTC A;  2W7O A;  1IR0 A;  2NUU G;  3LUY A;  3PRB A;  2CJA A;  5LM7 E;  5C24 A;  1S6P A;  3P3D A;  3FGV A;  2YNH A;  5LMU F;  4ZVF A;  1F9H A;  4C11 A;  2AX0 A;  4JOU A;  3RAM A;  5F0W A;  1Q78 A;  3QO9 B;  4UT4 A;  5F8L A;  1KC8 T;  4Y65 A;  2CNL B;  3OXG A;  1Y11 A;  3CMA S;  5IM0 A;  2HAI A;  1Y7P A;  5E0O A;  5KFN A;  4ES2 A;  5GAH U;  3GYN A;  3PJ9 A;  1KP6 A;  2WW4 A;  3PEH A;  1VC6 A;  4GKK J;  2H5J B;  2XLK A;  2YQ0 A;  2XMK A;  2RHS B;  4MTP A;  4ALZ A;  2X3G A;  4WFN Q;  1LXN A;  3C6U A;  1TL4 A;  3IG1 B;  3OSP A;  1LFP A;  4OHV A;  4ZCM A;  2A6O A;  3VTI A;  2VFR A;  1VRU B;  3OFF A;  2KL8 A;  2B8P A;  1UA0 A;  4EBD A;  1RP5 A;  4X66 J;  1M5O C;  2BOP A;  2HBQ B;  5IWA F;  1YRU A;  2C3U A;  4OJ3 A;  2QE5 A;  3RAX A;  2QGF B;  3DOL A;  2ZUG A;  3Q8S B;  2IC3 A;  3LA0 A;  5CCL A;  4OJG A;  4Y0F A;  5L38 A;  4LF9 F;  1NRK A;  1HHS A;  3BGR A;  2C3M A;  4QJV A;  2HWT A;  4DR2 J;  3CMQ A;  3FRZ A;  2DNK A;  2Y1J A;  5HJY A;  2RRA A;  4NX9 A;  1N5V A;  3K5L A;  1NJX A;  4IR1 A;  3CDA A;  3PDN A;  3IFE A;  4P71 A;  1C0U B;  1ACM B;  1PJ7 A;  3TAN A;  4A8W A;  2DNY A;  2O3D A;  3W8P A;  3OVB A;  3R6L B;  4USM A;  1D3W A;  3ZZT A;  3HMJ G;  1Q8K A;  2MHN A;  3JSB A;  1YHQ S;  3GON A;  3G82 A;  2VBZ A;  2QL7 B;  4Q45 A;  4LR8 A;  1CJK A;  2F8H A;  1JX4 A;  5EWF A;  1PIL A;  1V5V A;  2DPJ A;  2XMU A;  2AGO A;  4IG0 B;  4CM0 A;  1X9M A;  2CVE A;  1Z2Z A;  1PIE A;  1OSC A;  4C97 A;  1MG7 A;  2VD3 A;  1BY9 A;  2UZA A;  3FSY A;  2DIT A;  2IFX A;  4ED3 A;  4Q5V A;  1UJ4 A;  4QYZ K;  4JYA F;  1JLE A;  2Q79 A;  4LSL A;  4DL7 A;  2D1C A;  4JI6 F;  2IVF B;  3HHE A;  2FGO A;  2G2Y A;  4DPU A;  4ES1 A;  5IC4 B;  4LRF A;  3T19 A;  4B9M A;  3SXL A;  3L7O A;  5CD4 H;  4B3S F;  3Q8R B;  3OFE A;  1RT6 A;  4PKD B;  4CT8 A;  1HWI A;  1LWE B;  1U1O A;  2KM8 B;  1UZH A;  3W9J A;  2CZ9 A;  3CO9 A;  2YNG B;  4C2M A;  1NPP A;  1RWN B;  4C8N A;  3JSM B;  2FLL A;  1S76 D;  2AJQ A;  1NB2 A;  3PXG a;  1U1Q A;  2M9K A;  1SKR A;  4ZVG A;  5HLF A;  4DG1 A;  1FKO B;  1VQO S;  3ZTR A;  4BLG A;  1H0H B;  4A8Y A;  4G1Q B;  3RBZ A;  8RUC A;  3IGN A;  2RIL A;  3KG4 A;  2E66 A;  2R3V A;  4WP9 A;  1Y00 A;  2W2O P;  2GX8 A;  4RW8 A;  2JNJ A;  2CKW A;  5DDO C;  4OHW A;  1MU2 B;  1T03 B;  3Q2T C;  5C25 B;  4ZPD A;  2R4F A;  4ECX A;  5AE1 A;  2Y1L B;  4KGZ B;  2MJU A;  2EK6 A;  4DR5 J;  2C2N A;  1YRT A;  1FRM A;  5DS7 A;  1RTD A;  1VJQ A;  1YG0 A;  1RT7 B;  3BH7 B;  3RRK A;  2OD4 A;  3KLE B;  3KLV A;  5FDL A;  1CUL B;  4DLE A;  2VPY B;  2DXE A;  1SJ1 A;  1RYR A;  1SKU B;  2ADB A;  3OFH A;  4HTI A;  2ZZT A;  3M32 B;  5DM7 Q;  4K4V A;  4ZN3 A;  2K3K A;  2XY5 A;  1CSJ A;  3MEG B;  1D0E A;  3MMA B;  4USK A;  1RCX B;  1HBN A;  3BDP A;  4KFB B;  1UAW A;  2DGV A;  2XWY A;  3KK1 A;  4L74 A;  4Y6I A;  2R7T A;  3WIU A;  3CCV S;  2XNR A;  3EGW B;  3UN2 A;  4OZ3 A;  4C8Y A;  1EIY B;  2IDE A;  3C15 A;  4DFJ A;  5IOL A;  2MLZ A;  4LRB A;  1FE4 A;  2CXE A;  1EKS A;  4PUO A;  5B0F A;  1HA1 A;  5CYM A;  2J6S A;  2DY9 A;  1H74 A;  2V69 A;  4KPC A;  2Y9H A;  3PKY A;  4DX8 H;  2HZA A;  5LSO A;  3KMS A;  3HI9 A;  4OV1 A;  5DLG A;  4DV7 J;  4CCH A;  3RRG A;  5FJ4 A;  2F63 A;  3DCA A;  2FVS A;  3RRH A;  4ZMM A;  2DR5 A;  3FCH A;  3MHY A;  3FQK A;  3MPV A;  4J9V A;  1N5Y B;  2FD2 A;  1Q8L A;  4XK8 C;  2HVD A;  5DJB A;  2YWK A;  2L9W A;  2E1A A;  1OO0 B;  1WWH A;  1MMN A;  2CUY A;  2K7K A;  4O0I A;  1UA1 A;  4OI6 A;  5IV3 A;  2YKM A;  5B0A A;  4PRF A;  5KFB A;  1I94 F;  5THW A;  4F7V A;  2ZH6 A;  4C8L A;  4IO1 A;  4CLL A;  4B3O A;  4ILR A;  2UXB F;  4IYQ A;  2PC6 A;  4UW2 A;  1NSQ A;  3J81 Y;  4MAK A;  4LR9 A;  1FT8 A;  2B8Q A;  2MSS A;  4K4X A;  3X3U A;  5M2U A;  3TWZ A;  1GTE A;  3GG0 A;  1T05 A;  3PFO A;  3LWM A;  5K14 A;  3BSA A;  4ELT A;  5J1P A;  2J6U A;  2BQU A;  3NAH A;  4E8U A;  4RW6 B;  1C1B B;  1SL0 A;  1S6Q B;  1DJ0 A;  2MGZ B;  1UET A;  5HAO A;  1GT8 A;  1JNZ B;  3G6E S;  3TUP A;  2CPH A;  4DR1 J;  1WC5 A;  1IUJ A;  2GVZ A;  2X1B A;  3O5T B;  1RU1 A;  1Q7L B;  3G2X A;  4LF4 J;  2KRB A;  2BDP A;  3K2Y A;  3QAT A;  4BC9 A;  2ZWP A;  1FWP A;  3TZY A;  4IQM A;  2BM1 A;  3HKZ D;  1U0H B;  1IKX A;  1RT2 B;  3MM9 B;  3S7R A;  2NZC A;  4EYI B;  1LWX A;  5L9X A;  1KQS R;  3RG6 A;  4YDX A;  1FCA A;  1FK9 A;  1F9F A;  2R7X A;  3HFK A;  2V6A A;  4Z7Y A;  5D8H B;  5AJ3 F;  2XB2 D;  3VGU A;  1XWL A;  1N0V C;  2VFT A;  4I7F B;  3TOQ A;  3WQP A;  2BQR A;  2BKP A;  2HRY A;  4KV8 A;  2R7W A;  2XSJ B;  1UFL A;  3IMQ J;  3TYT A;  4TNO A;  4C8Z A;  1IKY B;  3H8Y A;  1NK6 A;  3RAQ A;  3SIP B;  1XEZ A;  3EDR B;  4RWX A;  4U8Y A;  4Y2M A;  2HAF A;  4A4J A;  3H7H B;  3G8T A;  2ZJP Q;  3VHQ A;  5I4M A;  3E3X A;  3W62 A;  4IG3 B;  2K1R B;  1QSS A;  2VB6 A;  2FJD B;  3GWC A;  1XMO F;  3EWG A;  1J5O A;  4AQY J;  1RU2 A;  2IMW P;  3BPS P;  5J2Q A;  2ZDO A;  3PM9 A;  5L1I A;  2YX7 A;  1DAR A;  2L3M A;  5KFG A;  1A6L A;  5KT3 A;  1NM2 A;  2U1A A;  3CDE A;  3ISN D;  1OWX A;  2HHS A;  2DNZ A;  3GTY X;  4URS A;  3MEE B;  2KT3 A;  3OW2 R;  4EU0 A;  2BXJ A;  3CDB A;  2R7U A;  2CVI A;  4B17 A;  2WSE C;  2DGX A;  4CDI A;  3AHP A;  4FS2 A;  3VQT A;  2H48 B;  1WTB A;  3EDQ B;  3BRE A;  2W4C A;  3HLU A;  2K3I A;  2QYC A;  3H0P A;  4DPO A;  2PN6 A;  1LW0 B;  3DLH A;  1OYE A;  1LFW A;  1ELO A;  4QZV B;  3M9N B;  5F8N A;  3P45 B;  6FD1 A;  1X4G A;  3PO4 A;  1TZ0 A;  4LQ9 A;  2C28 A;  3PIP Q;  1RWM B;  3UD4 P;  4XDC A;  2VU5 A;  2W25 A;  2BAC A;  3ZZU A;  4UOH A;  2HHV A;  3OLA A;  2XC9 A;  2MST A;  5HP1 A;  4A47 A;  2VC0 A;  3MR5 A;  2XGQ A;  4RW9 A;  1XMQ J;  2D7S A;  4NXN F;  1V9O A;  4ZPT R;  1ZAX A;  3BYP A;  3RUB L;  4WTO B;  2DNR A;  4ECU A;  2QRR A;  2OSR A;  1REV B;  3QBC A;  3N9U C;  1TK8 A;  1LW2 B;  2LXF A;  5F41 A;  3K89 A;  2MY7 A;  3CJ0 A;  4PG6 A;  2IM3 A;  3OPK A;  4PG4 A;  4KHP J;  3G71 S;  1SC6 A;  1SUQ B;  4Y34 A;  2BRL A;  3UNY A;  4YP3 A;  2XM3 A;  4DSJ A;  4JI5 J;  5J2N B;  1HNI B;  1VBK A;  3PFE A;  3LPY A;  1H2U X;  2PFD A;  3K58 A;  2Q6C A;  2ROE A;  5KFJ A;  3QO9 A;  3AQP A;  1TFW A;  3PYG A;  2KG1 A;  1NKC A;  2XWX A;  3EX7 B;  3JAM Y;  1QAI A;  2E5J A;  5I42 A;  3HJV A;  3R7S B;  3R5D A;  5B0C A;  1UPP A;  2E9R X;  2QFJ A;  4ILL A;  3OXL A;  4JI8 J;  3HFV A;  3HJF A;  5C42 B;  1MN7 A;  3GB0 A;  1JNR B;  3NKY A;  4EO6 A;  3S1T A;  1HHT P;  1AFJ A;  4HHU A;  3T1H F;  3IBF B;  4UUX A;  4OZJ A;  4NE9 C;  1ZM2 A;  4DR7 F;  4DL3 A;  3ET6 B;  4TN2 A;  4DL0 C;  3LP2 A;  2ZFH A;  2WZ1 A;  3IG1 A;  1YGY A;  4IH6 A;  3V4M A;  4Q7A A;  4LR7 A;  3QJJ A;  4OJ1 A;  2F4F A;  3TJA A;  5IWA J;  3B4M A;  1Z1Z A;  1VRU A;  2B43 A;  1BWE A;  4NYO A;  4O3O A;  4TLR A;  3HSD A;  3WBZ A;  5E3R A;  2XGP A;  3KXD A;  4AE5 A;  2J0X A;  2QX0 A;  3JAM U;  2W2M P;  1HNW J;  2DHG A;  1S10 A;  3MDF A;  5HMZ A;  2ZHA A;  2P5V A;  1MWZ A;  2DKO B;  4V19 X;  1WOR A;  1FJ7 A;  1A9N B;  1H73 A;  4PAA A;  4AT1 B;  2IM1 A;  3I6P A;  1F2H A;  4CT9 A;  4DS5 A;  2UV8 A;  1NKE A;  3EYZ A;  4ZLL A;  6FDR A;  3P5T L;  3OJS A;  1C0U A;  4B9V A;  2CPZ A;  4LFA J;  4J37 A;  2DCL A;  2PT0 A;  1GQE A;  5KFS A;  5KT7 A;  3OTB A;  1EB0 A;  1NUE A;  4MK9 A;  4OYA A;  3I56 S;  3TUI C;  4N41 A;  5DO2 A;  4N8N A;  2H65 B;  1IBK F;  1W7W A;  2LQ5 A;  4YDD B;  5D4L A;  4OV6 A;  1UL3 A;  1SV5 B;  2HK3 A;  2EVZ A;  4CNZ A;  1YTY A;  1C1C B;  4ZVO B;  2UU9 F;  2LEC A;  4CLW A;  2VG7 B;  5CCM A;  4IG0 A;  5LXY A;  3A3P B;  5C2G A;  3OLB A;  4RNM A;  1DQA A;  4DV3 J;  2CJB A;  2CQ3 A;  3CCQ S;  1S99 A;  4XTT A;  3RZA A;  4QWA A;  1CS4 B;  2KM8 C;  1U0S A;  4JI6 J;  2PEH A;  5DQH A;  2R7R A;  3BGF A;  3TQ1 A;  1NAQ A;  4E98 A;  1T11 A;  3B82 A;  1VCT A;  2KT2 A;  1NK4 A;  1F5C A;  4LVN P;  2IDL A;  3Q8Q B;  4B3S J;  3SZ2 A;  5ADZ A;  1FVS A;  4HHJ A;  3MCS A;  2H5I B;  3H25 A;  1NHK L;  3MCN A;  3CUN A;  2VA2 A;  2IYI A;  1LWE A;  2E1C A;  3T5K A;  2LXI A;  3A3O B;  5H9E K;  2CFX A;  1SB6 A;  2P9E A;  4FXD A;  4DOZ A;  2EKN A;  4DQP A;  3KMQ A;  2XZW A;  1J2V A;  3EZU A;  2YNG A;  3JSM A;  3B54 A;  1R27 B;  3KG0 A;  2MMY A;  4CH1 A;  2KJV A;  3V6H A;  2NR0 A;  3D3C J;  2KXN B;  1FKO A;  1DZ5 A;  2ATC B;  4ES3 A;  4NXM F;  4CQ1 A;  4PXE A;  3I0R B;  4G1Q A;  3B6B A;  1S12 A;  1FEE A;  4RU9 A;  1RAJ A;  2I38 A;  4P2F A;  1WF1 A;  1U1R A;  5IS2 A;  4LFC F;  4K59 A;  1SH3 A;  3L3C A;  1MU2 A;  4RUC A;  1T03 A;  1GNK A;  5C25 A;  1SC3 B;  2KU7 A;  2MYF A;  4NLT A;  4B3T F;  3C66 A;  2B9E A;  3PV8 A;  1TFY A;  4NOH A;  4JI4 F;  4FN5 A;  2IPO B;  3TZX A;  2QA4 S;  1Q5V A;  1RZM A;  1QM9 A;  1KQG B;  1RT7 A;  2AEF A;  3KLE A;  2AX1 A;  2DRB A;  1KSP A;  3TAP A;  1CUL A;  5D3G B;  2QL9 B;  5KFE A;  1ARO P;  4ZVU B;  1VK3 A;  2FUG 9;  2B4V A;  1SQF A;  3U1M A;  2GC8 A;  4OI1 A;  3IBC B;  4ZP9 A;  3M32 A;  1W25 A;  4RLE A;  4DF8 A;  1RAI B;  1LWF B;  1F0X A;  4OI0 A;  1S7H A;  3MEG A;  3NNC A;  3HT3 A;  4OZ2 A;  2HGL A;  4YS2 A;  3MMA A;  2WTF A;  3D54 A;  3NEK A;  2ZKT A;  1U2C A;  4ECZ A;  3PR4 A;  4KFB A;  4K4Z A;  3MM7 B;  1CJU B;  2FY8 A;  1B4S A;  5IZH A;  3IWL A;  1BC6 A;  4TYA A;  2CDQ A;  2DNM A;  1N6Q B;  2DHA A;  2R8G A;  1KVI A;  4QPT A;  1X5O A;  2ZDP A;  3NGD A;  3H59 A;  2ZZM A;  3MAQ A;  2ZH9 A;  2ADC A;  4K4W A;  5F8G A;  1RWO B;  2YKQ A;  1P27 B;  2GMJ A;  3D3B J;  4RUA A;  4CTA B;  2DRA A;  2F8M A;  5C5J A;  2CJX B;  3A8K A;  2AYB A;  3ZZ0 A;  5EDW A;  2V8D A;  2CZ4 A;  2B0G A;  3F44 A;  3C16 B;  2SXL A;  3O8W A;  4DFM A;  4CLY A;  1TK0 A;  1FEH A;  2QT7 A;  1N5Y A;  2GHW A;  4IR9 A;  3O2I A;  3ITH B;  3G6X A;  3GFZ A;  1IN0 A;  3QZ7 A;  4WYW A;  2IYG A;  2LU1 A;  2Y1R I;  4U95 A;  1X0F A;  2ZOM A;  4C3M A;  4LBI A;  2JOQ A;  1RT3 B;  5HL7 Q;  2EWH A;  1YBA A;  2RAQ A;  3DKD A;  3FKB A;  3GG1 A;  2UXB J;  4P6Q A;  5DRK A;  3OSN A;  3G9C A;  1KEK A;  4MYT A;  1LXJ A;  2GGP B;  4DV2 F;  3GJT B;  2Z4P A;  2D3O 1;  5FD1 A;  4J91 A;  2GZO A;  3M8P B;  1RWW B;  3QWU A;  3DGV A;  1FRX A;  3H2V E;  1TKX B;  4QW8 A;  1K73 T;  2XO6 A;  4QCL A;  1R8H A;  3D1Q A;  1K9M T;  2CPJ A;  5E41 A;  1CJT B;  4RW6 A;  2GFF A;  1S6Q A;  4F0H A;  3KDO A;  3ONQ A;  4IOA Q;  3WC2 A;  2MGZ A;  3MR7 A;  4X62 F;  2CJY B;  3FZ2 A;  2X7I A;  4OYZ A;  1H72 C;  1YK9 A;  2PII A;  5CHC B;  1SJQ A;  2R8H A;  4USU A;  3KHH A;  2IBK A;  1D9D A;  3VAF A;  2NCK L;  2OP5 A;  5KFH A;  4J90 A;  3BB5 A;  1NDP A;  1VI7 A;  2QMW A;  1FJG J;  2AD9 A;  1ZET A;  2ZC3 A;  1U0H A;  4MJK A;  4FYY B;  1RUS A;  2CQ1 A;  3VZH A;  2MLX A;  1RT2 A;  4FDF A;  3MM9 A;  4J9M A;  3AD8 C;  1PBA A;  3UDC A;  2Q6B A;  1UEK A;  3L4B C;  4JV2 A;  1NK8 A;  3HVA A;  2QL5 B;  2J9D E;  3IR5 B;  4WU3 A;  3CCL S;  1UP1 A;  2CPE A;  2ALZ A;  2YY3 A;  2EEY A;  1CG2 A;  2UUW A;  3GFY A;  2X51 A;  2G1D A;  3NGS A;  2XYP B;  2CQ0 A;  4I7F A;  2V50 A;  2EFP A;  3PTW A;  2XSJ A;  1VBX A;  1VOM A;  2WVF A;  1ZA1 B;  1IKY A;  4DCJ B;  3V6J A;  1HPZ B;  2FJE B;  1M5K C;  2CA9 A;  3AXK A;  1SC4 B;  4X65 F;  4Q0B B;  3OL8 A;  1XMO J;  3WDO A;  2IRU A;  4CLU A;  4M5K A;  3GYX B;  4IG3 A;  2K1R A;  1SVD A;  5FLX Y;  4DZ6 A;  2JEI A;  2A2D A;  2O01 C;  3QAE A;  4MFB B;  3VAJ A;  4RJV A;  1JKH B;  4Y28 C;  2MZR A;  1WDT A;  2IVY A;  4NLD A;  2DGT A;  4XPE A;  1N33 J;  4ID8 A;  1S9E B;  4IH7 A;  3MEE A;  4KGX B;  2FHJ D;  3FMB A;  1U47 A;  5HAN A;  3MZI A;  4ZJO A;  2HLT A;  2Y0S D;  1MSW D;  3DNC A;  3BGU A;  4C0H A;  1TUW A;  4OZ1 A;  2QLB B;  1VC0 A;  1RI7 A;  1NLK L;  2ZH2 A;  2UXC J;  1OY8 A;  4RX6 A;  4NYZ A;  2XLI A;  4DL4 A;  4EBC A;  4QOT A;  1LW0 A;  1T9Y A;  5ETR A;  2O67 A;  3D67 A;  1RAE B;  3AA9 A;  2J9C A;  1TL7 B;  2FVC A;  3MMC B;  3NMR A;  3T9Z A;  3BZQ A;  4PEO A;  1BXN A;  3POT B;  3CJR A;  4AL6 A;  3NAI A;  3DYA A;  2D9O A;  3DDK A;  5IT9 U;  5E5N A;  2IJN A;  3E8O A;  2A10 A;  1PC5 A;  4MKA A;  4DV4 F;  1AUD A;  2FC8 A;  2AGQ A;  4KC5 A;  3SV4 A;  4NXN J;  1RWU A;  2PSZ A;  3FMW A;  4I69 A;  3A8J A;  1AFI A;  4ZK7 M;  2RKI B;  5HQ8 A;  3RB3 A;  3TRG A;  3K8V A;  4F4X A;  1REV A;  2YXL A;  1LEO A;  5F9N A;  1LW2 A;  4PXC A;  5G0R B;  4YN3 B;  4RNO A;  4JV5 J;  2E1P A;  4Z7C A;  4B9T A;  2V8H A;  4GKJ J;  1ZPV A;  3BKT A;  2LQ9 A;  1FA0 A;  3MD3 A;  4GVB B;  4QIG A;  3W63 A;  1SUQ A;  2ZE2 B;  3CB4 A;  2GV1 A;  2RQ4 A;  3BPD A;  4M95 A;  2WSF C;  1KRP A;  3MM6 B;  1NHU A;  1HNI A;  3LH2 S;  1ZA2 B;  1Q53 A;  2PE8 A;  5I3U B;  4NLO A;  2IJF A;  2BW7 A;  5GAD U;  3SBM A;  3GFH A;  4KAI A;  3ELH A;  2AEM A;  1RIS A;  2GJI A;  2MKJ A;  1S9G B;  1U1N A;  1FTC A;  2V63 A;  3TAM B;  1UCN A;  5C42 A;  3C19 A;  1L5U A;  1SH0 A;  3HHK A;  1U8S A;  4N47 A;  4YB1 P;  2MZJ A;  1QDU B;  4F4A A;  3KJN B;  3W2V B;  2I0X A;  3ET6 A;  3VAG A;  4ED8 A;  3QYY A;  1EZZ B;  4CO3 A;  1G2E A;  2W2N P;  3P8B B;  5LSR A;  3NRB A;  1N5S A;  4QIV A;  2JL9 A;  4RZR A;  2RVJ A;  4OI3 A;  3GJQ B;  4FVC A;  5KG0 A;  4LUB A;  4KB7 A;  2NYI A;  4QQB A;  3AQO A;  3IM9 A;  3HSG A;  1Y10 A;  2WK4 A;  5GVQ A;  1GXT A;  3T3F A;  2MJN A;  1QLN A;  5DLF A;  2VQE J;  5KFR A;  3JB9 k;  1DAX A;  3MUM P;  4ED4 A;  3QWP A;  2E7W A;  3Q0A A;  1BQM B;  1JJ4 A;  2RQK A;  3CW2 C;  1WOS A;  5J2P B;  1OIA A;  3DI6 B;  1FHT A;  2QO3 A;  2GW8 A;  4ED7 A;  2XNQ A;  4WBF A;  3B78 A;  4DSI A;  2YWE A;  1YDL A;  3H4B A;  2DXD A;  1IBK J;  1RAH B;  3SMZ A;  2OIH A;  5LOQ A;  2VAS A;  3PIO Q;  6AT1 B;  1SI9 A;  1U6B A;  2UU9 J;  5D4N A;  2OFH X;  1FJC A;  3GU0 A;  3LGM A;  3OUY B;  1PGZ A;  3H5X A;  1SV5 A;  1C1C A;  2HNY B;  2C3P A;  1HI0 P;  3K5N A;  2VG7 A;  3FCV A;  4LF8 F;  2CZV C;  1IVZ A;  2IVM A;  1T3N A;  3BQ2 A;  4YB6 A;  1HNX J;  2GQC A;  5KT2 A;  4DQS A;  1HWK A;  3NG8 A;  4O3P A;  5A8K B;  2KN4 A;  4CH0 S;  4CI0 B;  5D0H A;  4G6V B;  1CS4 A;  3Q83 A;  2IM2 A;  4PG8 A;  4BBY A;  2V9K A;  4I2P B;  2DNN A;  4DL6 A;  5IV4 A;  1K44 A;  2PMW A;  1RHR B;  2NS1 B;  4YOE A;  2K2P A;  2JVO A;  5IFM A;  1WEX A;  1HHQ A;  3S8S A;  1ZYQ A;  1OY6 A;  2H54 B;  1IQZ A;  4CO4 A;  1T8E A;  3PR5 B;  4PWD B;  2KXF A;  4J9S A;  4DDF A;  3H5S A;  4UY8 T;  1TUG B;  3K5M A;  3UWT A;  1Y5N B;  2CJ9 A;  2ZZN A;  2I5J B;  1JLQ B;  1EHW A;  3TZW A;  1FXR A;  4NXM J;  5D4O A;  4ECW A;  2B4P A;  2WHO A;  5KFC A;  5CAB A;  3ZNU A;  4ERD A;  1WKJ A;  2ASD A;  4UZB A;  5ETP A;  4J9R A;  3AB4 B;  1KVJ A;  1UZD A;  4ZLP A;  3W9H A;  5EHH A;  4B3T J;  2BA9 A;  2GO9 A;  1OYD A;  5L39 A;  3PHT A;  2WVE A;  3HFZ B;  4F2S A;  2OPQ B;  4ECS A;  1U26 A;  1IM6 A;  2LCW A;  4TLQ A;  2LEB A;  4IUF A;  4DI6 A;  4B3M F;  1PJ5 A;  4DPW A;  4F26 A;  1U7L A;  4UF4 A;  2J7W A;  4V19 J;  4CO2 A;  3UR3 C;  5D3G A;  4DQR A;  1VQM S;  3FBB A;  3H98 A;  5K9F A;  5F8H A;  5KTQ A;  4LMZ A;  4DR3 F;  5MLC V;  3T6B A;  3BH6 B;  1RTZ A;  2FJA B;  1RBO B;  1U6Z A;  2JFK A;  2UXD F;  1R43 A;  3WIV A;  1KFD A;  1NME B;  2RF2 B;  4QR1 A;  1RBL A;  1LWF A;  3DXB A;  4RW4 B;  3W5Z A;  2FPH X;  2G2O A;  1KBR A;  4QIF A;  4I68 A;  3Q8U A;  2M2B A;  4IKA A;  3SSS A;  5C7P A;  4WFX A;  2GCF A;  3IRW P;  1UVL A;  3MM7 A;  4DFP A;  4ECY A;  1B70 B;  1CJU A;  5CAA A;  3PX6 A;  2IIH A;  5E3C A;  1FO1 A;  3P4U B;  2VBW A;  4NL5 A;  4K2J A;  2N4D A;  4RU2 A;  5U47 A;  2FJW A;  2BKN A;  1ZOT A;  1N6Q A;  5A2Q Y;  3T1A A;  2EPI A;  2NPF A;  3LAN A;  3GV5 B;  3QT5 A;  1EP4 B;  3K7R A;  5IC6 B;  2RD5 C;  1REG X;  3CD0 A;  1EKR A;  1T9X A;  3DLL Q;  2BAB A;  1XER A;  2XSF A;  3N5F A;  2U2F A;  4DU7 A;  1WF0 A;  5CA5 A;  4GC7 A;  2B6A B;  5KFD A;  4J9Q A;  3D4J A;  4CTA A;  1HNV B;  1GH8 A;  3QT8 A;  1QVG R;  3C16 A;  4P2S A;  4ZPW R;  3WX4 A;  3DOK A;  1HD1 A;  1V3R A;  2OPR A;  2QMX A;  1SJ3 P;  3ITH A;  1XN9 A;  1YJN S;  2MZQ A;  3IS9 B;  2JWN A;  2PA3 A;  2JX2 A;  4PYA A;  4B3R J;  5HVG A;  3VGV A;  1URN A;  5CZV A;  2W7P A;  1RT3 A;  3PCO B;  2M52 A;  4C7Q A;  1WOO A;  4G65 A;  3F0N A;  4X2B A;  1U48 A;  1HQ2 A;  3G8Q A;  4PCQ A;  4C8K A;  1VHI A;  3GIR A;  2RQM A;  1JJ2 R;  1QAX A;  2GGP A;  4NLP A;  4KH0 B;  2C1E B;  3ENV A;  1VQK S;  3H2L A;  3ZFV A;  3ENQ A;  5CYQ B;  2OO4 A;  3ZZR A;  3M8P A;  1O0P A;  3FRY A;  4F8R A;  1WEY A;  2XMV A;  2ZWO A;  4WWS A;  1TKX A;  2V34 A;  5KFT A;  1HQE B;  3FEY B;  3JYT B;  5AE2 A;  4E0D A;  1XR7 A;  2J7K A;  4LFB F;  1Y3K A;  1CJT A;  2DGU A;  5H9F J;  1L3U A;  2MKY A;  4ER8 A;  5HQM A;  2GJF A;  4R0E A;  3QJL A;  1YVF A;  2QZ8 A;  3I5C A;  3TX8 A;  4KT0 C;  3RW6 A;  1RA7 A;  4A8K A;  4LRE A;  1EQM A;  1JLF B;  5B09 A;  1GFW B;  1N88 A;  2UUC J;  1HYS B;  5ETQ A;  1VQY A;  1HWU A;  2Z57 B;  4AL5 A;  1X8D A;  3PKM A;  3PYD A;  4C8M A;  4X64 F;  3EGV A;  3A12 A;  1WHY A;  2ZVI A;  4QR2 A;  4WE1 B;  4F36 A;  3PVX A;  1RB0 A;  1TP7 A;  1XNR F;  2MKK A;  3RBE A;  3CME S;  4OI4 A;  1HR0 J;  2RT3 A;  4FPR A;  3VV2 B;  2Z30 B;  5D15 A;  3KJF B;  2XYG B;  2C3Y A;  5E33 A;  3CCR S;  4J9K A;  3R1L A;  1Y5L B;  2MLY A;  3ENA A;  2UVW A;  5DG8 A;  1T9W A;  5D77 A;  4CLP A;  5A6W A;  2CJK A;  2FYX A;  3H2U B;  1NJW A;  3CIZ A;  1J5E F;  3K57 A;  4ITS A;  2XMM A;  3HHL B;  3U7J A;  3R5B A;  2AQ4 A;  1EAY C;  1HNZ F;  2AMC B;  4OHY A;  1UVN A;  2UV8 G;  5KOW A;  4X65 J;  1TU0 B;  1FRH A;  2JVR A;  1HPZ A;  1HW8 A;  2RS8 A;  3KLH A;  4WU2 A;  2V9W A;  4Q0B A;  5HVH A;  4NPO A;  5ITH A;  3AA8 A;  1HBU A;  4KKO A;  2D74 B;  4M5H A;  1SQG A;  4P2X A;  1RHK B;  1S4F A;  2CWX A;  2MKI A;  2LU2 A;  4OQJ A;  3OL6 A;  3T41 A;  2ZUA A;  4MFB A;  1WC3 A;  1JKH A;  3J80 U;  2LEP A;  2LKZ A;  2K7J A;  2ZH4 A;  1Y4Z B;  4DR6 J;  3QZ8 A;  2KTQ A;  2VPZ B;  4DX7 A;  3DM2 B;  1T02 A;  1OQ6 A;  3I82 A;  2RU3 A;  3RR8 A;  1WUU A;  1VQL S;  3LAK A;  3C6T B;  3SDE B;  1S9E A;  5K8P A;  1YSJ A;  2RML A;  2VIC A;  4DQQ A;  4JP8 A;  4IFV B;  2OTL S;  2R7V A;  2GO8 A;  5HO4 A;  3CC4 S;  2UUB J;  3QSY B;  2Y1I A;  1X4C A;  4HEA 9;  4OZN A;  1TK5 A;  2X3D A;  2ZJR Q;  2W2Q P;  3J7A N;  1HL6 A;  2H4W B;  3ZZY A;  3UD3 P;  2ZNZ A;  2EI5 A;  1FE0 A;  3EZO A;  2N7Y A;  1IBL F;  1FNM A;  2D9P A;  3NGT A;  4F25 A;  2VQF F;  2KT5 A;  4YR3 A;  5JVH Q;  1YJ7 A;  2LDI A;  4FBT A;  1TL7 A;  4ANC A;  2NPI A;  3MMC A;  4I67 A;  3BQ1 A;  4HAC B;  3I9Z A;  3ISZ A;  3POT A;  2QEX S;  1FD2 A;  1IWA A;  2DNP A;  2YNF B;  2O66 A;  3I96 A;  1X7V A;  2HS0 A;  1FXL A;  2PA8 D;  1JWW A;  2VDI A;  3PYF A;  4P75 A;  2MKH A;  3IP0 A;  2EFQ A;  2XMJ A;  4WXO A;  3Q24 A;  2RKI A;  1U09 A;  3BKU A;  3TO8 A;  1I5O B;  3MUV P;  1WSR A;  5E2Q A;  2F8E X;  2GIQ A;  2FDN A;  5LL6 d;  2E5L F;  2KB2 A;  2ASY A;  1F6T A;  1WI8 A;  5G0R A;  1DQ9 A;  5ETV A;  3M2V B;  2C2D A;  1WDD A;  1B0T A;  3NLC A;  3Q8P B;  2H5E A;  1TUV A;  4Y2I A;  4OL8 A;  2MHE A;  4GVB A;  2CRL A;  3MMJ A;  4YHH J;  2ZE2 A;  4TYB A;  3SSR A;  3I31 A;  3MPY A;  1K0T A;  4ELV A;  3L9Z A;  3MM6 A;  2JC0 A;  3GIK A;  2HVH A;  2DH9 A;  1RWX B;  4M5G A;  3BSC A;  3JTP A;  1V3S A;  5I3U A;  2QV6 A;  2AYG A;  4N76 A;  1S79 A;  4PG5 A;  5ETM A;  5JJB A;  4IQX A;  1S9G A;  2LEA A;  4F3Q A;  3TAM A;  3T6J A;  1OSD A;  5DQI A;  1LV5 A;  4KJI A;  1UEU A;  1YIT S;  2HGM A;  5KG1 A;  3UCG A;  3MEC B;  5ETN A;  4P9S A;  2B7C B;  4YQW A;  3W2V A;  4HHH A;  2KVI A;  3GJR B;  1IKW B;  4PZV A;  4QU7 A;  3LPE A;  3W65 A;  2DRD A;  2G2Z A;  1FFS B;  4WCE Q;  3GMG A;  3QFW A;  3DRP B;  2XS5 A;  4FPI A;  1OQ3 A;  3ZZP A;  2AZ1 A;  1VFJ A;  2BZ2 A;  3HKW A;  5BYR A;  2M70 A;  2WCX A;  3HHD A;  1S1V B;  4Q2L A;  2DH7 A;  4C48 A;  2GHV C;  5IQ6 A;  1SKW A;  2CNK B;  4EZ6 A;  3Q8Y A;  3CJS A;  2HS4 A;  2NYH A;  4LF6 F;  2F40 A;  1BQM A;  1M5V C;  1RT1 B;  2BJ9 A;  2BW2 A;  3L95 X;  5J2P A;  1VQS A;  3PO5 A;  3BEG B;  3DI6 A;  2V2V A;  3BQ0 A;  3EVO A;  1JLG B;  4DN9 A;  4QWB A;  4GMK A;  1WD6 A;  4WII A;  1UW9 A;  1H3D A;  1K8A T;  4CRJ A;  1G6B A;  3X1L B;  4IOC Q;  3FEX B;  2FZK B;  5HN0 A;  3LP0 B;  3FSI A;  4DV1 F;  4ID5 B;  4AND A;  1CJV B;  2EG2 A;  2O1P A;  3KUH A;  2NLW A;  2UVR A;  1RAB B;  4I4B A;  3OUY A;  4LSZ B;  5DM6 Q;  4LF8 J;  4F4K A;  4WPA A;  3CVK A;  4YB5 A;  4F4Y A;  2HNY A;  1V3Z A;  1R8B A;  3M05 A;  2CPX A;  2MQM A;  2VZ9 A;  1RDR A;  3KLI B;  3CC2 S;  3TR5 A;  2HHP A;  3M2U B;  2YNI B;  3I5A A;  1OPZ A;  3OFG A;  5HJX A;  3D9B A;  2KYX A;  1UMJ A;  5A8K A;  4ZPV R;  4P52 A;  3T5L A;  3PHE A;  3FDS A;  2H9Z A;  3SSQ A;  4OYB A;  2CDR B;  4I2P A;  3EPI A;  2KFN A;  3C46 A;  4XDD A;  4M8L A;  1P1L A;  5JVG Q;  3QGP A;  4ECR A;  3BN4 A;  3AD9 C;  5K8O A;  1RAA B;  1R6V A;  2R7O A;  1NSK L;  4IFY B;  1G7C B;  2C2E A;  1FWK A;  4ZHR B;  4QW9 A;  3IRX B;  4PWD A;  3LF0 A;  3W3S A;  4DX5 A;  1FNX H;  1N36 J;  1JJC B;  2OLW A;  3DLB A;  2ZD1 B;  1S1W B;  3P96 A;  2I5J A;  4C3K A;  4DPX A;  3C2P A;  3M4X A;  3EXY A;  2QLW A;  4JB8 B;  5F0U A;  4P74 A;  1XNQ J;  5RUB A;  3FBC A;  2E5H A;  4RNN A;  3CXC R;  3DLG B;  3SI8 A;  3EGZ A;  2E44 A;  3I87 A;  4U7U K;  4DQI A;  2L41 A;  3MAA B;  3MF5 A;  4JI0 J;  4Q8E A;  2OPS A;  3G6Y A;  1NK9 A;  3O3L A;  1GMW A;  4DPT A;  2VKR A;  3PJX A;  1L3V A;  3HSJ A;  3PW5 A;  2CQ2 A;  4B3M J;  2OPQ A;  2QLF B;  2E1M C;  1RTJ B;  3G87 A;  4JI2 J;  4XAK A;  1X0P A;  2NXU A;  1ULR A;  2B56 A;  4IH5 A;  3M6U A;  1I6J A;  3PNI A;  3MD1 A;  2RS2 A;  3IC1 A;  2BE2 A;  1NKB A;  4WKR A;  3QNW B;  4UST A;  4A8M P;  2UXD J;  4DV0 J;  5IQQ A;  1RXO B;  1HW9 A;  1RWP B;  3UDE A;  1EQ0 A;  1WKK A;  1Y9O A;  4LRA A;  4DCO B;  2RF2 A;  1T7P A;  3ADA C;  4RW4 A;  3IM8 A;  2OEJ A;  1ZZN A;  3R5G A;  1PC4 A;  4DR2 F;  2C2M B;  3OL9 A;  2NRE A;  3EIC A;  3D0G E;  1X4F A;  4X4N A;  4WZQ A;  1S97 A;  2DY1 A;  4Q44 A;  2B9W A;  3CCE S;  1DFD A;  3VAM A;  1TL3 B;  3VR1 A;  3TNV A;  4KGK A;  2RUS A;  1N48 A;  2I9S A;  4NCB A;  4X4O A;  4JI1 J;  3D0I E;  1EP4 A;  4U96 A;  2DNG A;  5B7W A;  2AW0 A;  2HBZ B;  3MR3 A; 
#chains in the Genus database with same CATH homology
 3DOM B;  1YDL A;  2JNJ A;  3DGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...