3DOMB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 17
structure length 58
sequence length 58
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3domB00
3DGPB 1YDLA 3DOMB 2JNJA
chains in the Genus database with same CATH superfamily
1VGYA 2C2MB 3IO1A 4ZVGA 1UVLA 4LRBA 2I6WA 1IKWB 1X4AA 2VUGA 3RGIA 2CJ9A 4C8YA 2IYGA 2XMWA 3M6WA 4MH8A 2AZ3A 3HSDA 3VCDA 2HMIB 2DGWA 3H0PA 1JLAB 1HNWJ 5EGYA 4X2BA 4FF2A 3QIPA 1RBOB 1M1HA 4ZPBA 1HMVB 3KDOA 3LAKA 3K8VA 2M9KA 1T03A 4XAKA 5EN1A 4F0HA 2DY1A 3PJXA 4YDXA 3BQ1A 4JV5J 1O5JA 2EFGA 4LJMA 3W63A 4JI7F 3JYTB 5ETPA 4FKXA 4F26A 4KAIA 2HHUA 4DG1A 1UA1A 3C46A 4RNMA 4M5LA 2DJWA 3VAJA 2KI2A 4L72B 4IR9A 1TUGB 1A0OB 1F60B 3M2RA 1Q79A 3AFGA 2ZVIA 6FD1A 4NMLA 5KFIA 2GX8A 3ONQA 2IHR1 3C6TA 4WTYA 5BYRA 3CJKA 3CCVS 3W1YC 2OTLS 3L3CA 4QIWD 1IXKA 1U1LA 1PAUB 4USMA 2CPYA 5LJ5Y 4ECYA 4A8OA 1AUDA 1JLQB 3EGNA 4G1PA 4LF7J 5IT0A 1R7IA 1YRUA 1TL7B 2NYIA 4YDDB 1OY8A 2HVZA 3L7UA 3Q8YA 1VLYA 1FWPA 1SQEA 4YY3J 3CMES 3QLHB 2E5LJ 4Y2IA 1A7GE 2G4BA 1PJ5A 3BYRA 4QQBA 3R6LB 1F9FA 2VPZB 1HWIA 3DGVA 1KVIA 1U02A 3M6XA 3WX8A 4LQ9A 3P3DA 1U1RA 4LR8A 1XIQA 2RHQB 1TVRA 3K17A 2OMOA 4IFYA 2OPRB 1R8BA 2WSCC 4UF4A 3HJVA 4DL4A 2YNHB 2ZWOA 3SQGA 4OHZA 3AD9C 2B56A 2JJ4D 3IRWP 3G87A 3KXDA 3FJ2A 1S4EA 2IDLA 4WFNQ 2KYXA 1IKXA 5EWGA 4NA3A 4OYAA 3ILLA 3CCLS 3KMQA 3ENAA 4ZVUB 3US5A 3DLHA 3WZ0A 1WEXA 1FRKA 1H73A 3GCXP 4PEOA 1S57A 1IR2A 2MZQA 3DRYA 3WC2A 5CQGA 2PSZA 2YKQA 3KLEB 4ED5A 1Q82T 3CJTA 1WHYA 3J7AN 4CLLA 1R0AB 1RE1B 3S1TA 3W2WB 3NMRA 2GQCA 3QBCA 3CDAA 4IH7A 1NZ8A 3BKUA 1WF2A 4QBUA 5HMWA 4UOHA 4ZP7A 2VG7B 3TRGA 4CI0B 2ZJQQ 3V2UC 2J6UA 4YN3B 2FJWA 4KV8B 2BXJA 4YMEA 3MM8B 3DYAB 1D8ZA 1VQKS 3A8IA 1YJTA 4NI2A 4ECTA 4FF3A 5J1EB 4PPZA 2U1AA 3SDEB 5A2QY 1NBEB 3CCTA 1EB0A 1GTHA 1QSLA 3BN4A 5CD4A 4GVBB 1P6TA 2N3OA 2XZDB 3FMBA 1E6VB 3M8SA 2DNYA 4A8YA 4LSLA 4P6QA 3SBMA 4U67Q 3FUYA 2RVJA 2HQ3A 3M6VA 3AAWB 1C0UA 5AXMA 5KOWA 3G6YA 4JUZA 3RB6A 2IJNA 2RKIB 1C1BB 4KY3A 2C3YA 4R5PB 5KFZA 3KHRA 3GLJA 4PWDB 1RWOB 1T3OA 4E2FB 4HL9A 2EFQA 2IMOA 3ENVA 4URSA 2GJFA 1S1UB 4WZQA 2B9WA 5IM0B 2ZE2A 5ETOA 3D6TB 2MLXA 4OJ1A 2GHPA 4TQSA 3MM5A 4I2PA 2L9WA 5B0DA 3TVYA 3PO5A 5M2RA 2XZTB 3WIVA 4ZJQA 3JQJA 3AJ1A 3KKFA 5KFQA 1S9GB 2OPQB 1ZOTA 3MR7A 2V4JA 5D3GA 4Y2KA 1PBUA 1S99A 2P6SA 4ED8A 3AODA 3DFEA 3CD7A 2MEWA 3QJJA 1VQSA 2OUGA 3PDNA 1ZYQA 3ICLA 1SC1B 2H54B 3V6DB 1CJTB 3VVUA 4QW8A 3QAUA 4OJGA 3BBCA 2FY8A 3C14B 4P73A 4ECQA 2GMHA 2DCLA 4P9SA 2ZJRQ 1U4BA 2V2VA 3CMQA 4LRFA 1EQMA 2H5JB 2RRAA 3X1LB 2VH7A 5D8HB 4WP3A 2YKMB 1TKTB 3CGIA 1ZETA 1NKEA 3OL9A 4B3MJ 4O3OA 2JC1A 4BC7A 2CADA 4OI4A 4TY9A 3GONA 1N5SA 2MGZB 1JK9B 1TL3B 4ZHRA 2FJDB 2MJNA 1S59A 2VJUA 4ES2A 2I2YA 1X4DA 3BDEA 3TI0A 3GQCA 4A8KA 2WTFA 3THPA 4RLEA 1K1QA 1LW0B 3MMAB 2VQEJ 5LXYA 3SV4A 4RU2A 3BSOA 3LO3A 2CJYB 1NJZA 3GV8B 4B3MF 5CHCB 1LV5A 4NL5A 5KFCA 4ES3A 3DOKA 3H5UA 1IBLJ 2DHSA 2IA0A 1AXQA 1MU2B 3AA9A 1IR1A 2PMHA 5DG8A 3FFIB 1YIJS 2P2CB 2W9AA 4LR9A 2ILYA 1W7WA 2VOOA 5C5JA 4A8WA 2K3KA 4ZDNA 3I82A 3Q24A 4C3LA 2NQPA 2EW9A 3BBBA 2VQEF 2ZFHA 1WUUA 1UJ4A 1JNZB 3AA8A 2HQDA 4QJVA 2IVFB 2Z2MA 1YK9A 4NZ0A 5KAKA 5IQQA 3PV8A 4ZK7M 2VG5A 3M1VA 4NLXA 2IBKA 2XHWA 3IRXA 2B6AA 4RU9A 3ZZTA 3KLFB 4Z37A 1WOSA 2CNKB 4C6AA 2Z30B 2GVZB 4HTIA 2NPIA 4XK8C 3KG0A 4U7UK 5HROB 3M9OB 3Q0AA 3FRYA 3SSSA 1H0HB 3E3XA 1WG1A 5LSOA 1VBZA 3M32A 2YBVA 1N34F 2J0QD 1WTBA 2QA4G 1RHRB 2RE1A 2ILZA 2IY5B 5CAAA 1X4FA 1LWCB 1DTTB 5IT9Y 2MY7A 1KEKA 5J2MA 4XDCA 1VRQC 5F8NA 2JRSA 1S5ZA 2J8SA 2J7UA 1UKUA 3VAHA 2YNGB 1FHTA 4LVNP 3TYTA 5IZHA 3OTDA 2R42A 4Y2CA 2O1PA 1SV5B 5KG3A 1UMJA 4DXLA 2HHQA 4MKBA 4DR7F 1XNRF 2CQ0A 2QTWA 5HMXA 4J9UE 2GFFA 3NXZA 2DTJA 4WU3A 5DG9A 1G6BA 4DR5J 2W24A 2K1RB 1JLBA 4DPWA 2IRYA 3NBPA 3PFOA 1W25A 4N8NA 3J80U 4DSKA 4C0HA 3KLHA 4RUBA 2KJVA 4F4XA 2R7QA 1O8BA 3SFGA 3THTA 2C3MA 1SUQA 3BJYA 2PIIA 2EFPA 1SQGA 1CC7A 3IP0A 4OHWA 1T94A 2UUTA 4USKA 5A6PA 3BH6B 2HNZB 5I42B 2BX6A 1F3FA 4IOCQ 4A47A 4OHVA 2HHHJ 5KFUA 2VJVA 3C6UA 3U1LA 4M1KA 1JJHA 4A46A 1RT7A 3D6HB 3J7A1 1LWEA 4A8MP 4DSEA 1X0FA 2FVRA 3DN9A 1SKRA 1Y3KA 2B9EA 1VYAA 2RNEA 3GYXB 5IV3A 1ZAVA 1JX4A 3A13A 2J0XA 3LP2A 1RKIA 1K47A 5FLXU 1YHQS 3ZTOA 2XGPA 2NCKL 1RT2A 5LMNF 1VQPS 1DFDA 3V6KA 2A0FB 2G2OA 2W8KA 2HFZA 3QJLA 1TK0A 1KOHA 3D1QA 1UPMB 1HARA 5AJ3F 1UVIA 3F0NA 1TKZB 2HHHF 4HR2A 2MDAA 4OJ3A 1CBKA 2DY9A 1AROP 3W8PA 1Y00A 3H42A 2ZH7A 1TUVA 2X1GA 2XS5A 3I6PA 4PQUB 5KFJA 1U47A 3MUMP 4MJKA 5LL6d 4DU7A 1J5OA 1G1XA 5EX0A 2PEBA 4YHHF 4UZBA 5KT4A 1R0CB 3EXCX 1P27B 2DH9A 2G1DA 1JJ2R 4QCLA 3BO3A 9RUBA 3ELHA 2ZC3A 4N41A 2ABYA 4NASA 3GZ7A 4V19J 4DV1F 2M70A 1H98A 1R89A 2DPIA 4B3SF 5F8HA 1NB2A 3H5SA 3BPSP 4FBUA 3V6JA 1KR4A 3G6ES 3UR0A 5AE1A 1HWUA 2HMIA 2FLNA 1FF2A 4CTAA 4ZVOB 3IAM9 2W9CA 1AFIA 3CW2C 3MOJB 3RU0A 1B4SA 1HMVA 1VQ6S 4IG3B 4RNHA 1CPZA 4FYXB 2XLIA 2WONB 2N4DA 3BR9A 3T5KA 3RBZA 8RUCA 3DMJB 2NXCA 1ZA1B 5LMUJ 5EUHA 3KJQB 2QLWA 5I3QA 4O3QA 3RR8A 4DSJA 2RILA 3BGRB 3ZZRA 1DAXA 4CO3A 2IIHA 1U2RA 3JYTA 2HBRB 5DQGA 1D9DA 1SH2A 1S1XA 1X4GA 3MD1A 4PXBA 1ZPWX 4OHXA 2LDYA 4LREA 4CLZA 4W90B 5K5MA 2Q79A 2DR7A 1KLNA 3QZ7A 1IBMJ 2LKZA 4AUKA 1NRKA 4ZITA 1BMQB 1HW8A 4DSLA 5LMUF 4MAKA 4LBIA 2C2NA 5KT5A 2HVDA 3TVKA 2QMXA 5CYQA 1RADB 2R8HA 1TUWA 2R7OA 1GTEA 1H2TZ 5LSLA 4WCEQ 1S9EB 4N7TA 1DLOA 3VAIA 4ER8A 3BS9A 3DDIA 1HQEA 2UUCJ 5LSRA 4IQXA 1RDRA 2UVUA 1FXRA 3UR3C 2AP6A 2EC2A 3SCJE 2H5IB 2W7OA 4ZPWR 2OHDA 3RRGA 2J5AA 4ZCMA 1IBMF 2W2QP 2RMLA 1CJKA 5MLCV 5ETLA 5KFKA 2UXDJ 2OELA 1U48A 1X5OA 1NK6A 2PC6A 1TL5A 1VC5A 1APSA 3B6BA 4CO1A 5DM6Q 2B51A 3M6UA 5HL7Q 4EZ9A 2UUCF 4X62J 4OI2A 4BBYA 3ZZZA 1CJVB 2V8PA 4DSFA 4B9NA 4WXWA 4RW6B 1FVSA 4ILRA 2OPRA 3E2EA 1F5CA 1FT8A 2YNHA 2V94A 3W66A 4JI2F 1RXOB 3NNAA 4K7QA 2ASDA 3BO4A 2JEJA 2FVCA 2PE8A 4M5MA 3W5XA 3D7SB 3JXOA 4MIAA 2D9OA 4UQGA 3AHPA 3FBFA 2ATCB 3I55S 2ZBCA 4P71A 2J9DE 3GTYX 2B7BB 1JLEB 3M8PA 3R6GB 3G6VA 1SJ4P 2WBMA 2HFVA 3WBZA 3MXHP 2F5GA 2GIFA 4LSNB 3ULHA 3R5CA 2OPPA 3O6QA 2AV5A 2BJDA 1FKOA 4LF8F 3PX6A 3CJSA 1WEYA 4XIUA 2J0WA 4EU0A 4IG0B 1SKWA 3PX4A 3G82B 2OEKA 3POTA 2GMLA 4DV0J 1MWZA 2VG7A 4PXCA 4OYMA 3K5LA 3K58A 3TEHB 3VGSA 2H1YA 2ZH8A 3VQTA 4F25A 3LWMA 1OSDA 3CJ4A 2OTJS 3R7SB 4S0MA 5GMEA 3N6NA 1F6TA 3OR2B 4KV8A 2QJ3A 4K4YA 3MM8A 2M4MA 1KHWA 3DYAA 3KTQA 4G65A 1Y10A 3ET6B 1L3VA 3O8WA 3AQPA 4Y6IA 2V9WA 1S49A 5KFPA 1JLFB 1VHFA 3BF4A 4OX6A 2DKOB 1VK3A 3GFXA 2XMMA 4HT5A 9ATCB 1VC0A 2QE5A 7FDRA 1XR7A 4ZPVR 4FNHA 3IGNA 5DG7A 1KD1T 2XSJA 5GAHU 1R31A 1MWQA 3G86A 4ID5B 4USWA 2MHEA 1S6QB 1RJJA 4RWWA 3CJ8A 1RTIA 2NS1B 2IC3B 3F56A 4ILMA 4LRAA 3AD7C 2BE2B 1SI9A 1WI8A 2RKIA 1U6FA 4LFCJ 3IBWA 4MKYA 1W26A 4I2QA 2B3TB 4F3QA 2W4CA 2JSXA 3OFGA 1H7WA 1I5OB 3KK1A 2C3PA 3TAPA 1YZ7A 1KNZA 1V5VA 1FWLA 3PXGa 1RWWB 5E3RA 2F9JA 1HBOB 1S1UA 1HWJA 1RTHB 4A8QA 4H4KA 1VBKA 1VQMS 5FDLB 1KSPA 1SJFA 2I5JB 3T1YF 2FD2A 1YWXA 1FRLA 4DR1J 2EVZA 3HVTA 4YS2A 5KG6A 1AFJA 2KU7A 1IR0A 1S9GA 5M2PA 1GAOA 1SJRA 1WDTA 2QLBB 4DR3J 1EJ7L 1DARA 2F8HA 5L9NA 5IT4A 3NNHA 4CCHA 4M63A 2KM8C 1AYEA 4J9MA 2YWEA 4WZMA 1DY3A 3BDPA 2MZ1A 2UXCJ 1RT4A 3V6DA 5E5NA 1S1VA 3DCAA 3BB5A 3IS9B 2ZZTA 1HFEL 3P5BP 1FKPB 4Q45A 3IAS9 2BOAA 2YKNA 1AT1B 1YVFA 2OAUA 2YNFA 5T41A 2IPOB 3VAGA 1RTDA 4USJC 1VRTB 2XQCA 3ZZYA 3TAQA 1NDPA 4EO8A 3QJPA 2W4DA 3I96A 2ZC4A 1Q8KA 2OPSB 3DLEA 4CO2A 3AXMA 2HHSA 5L8RC 2HBQB 4B9SA 1QDUB 2F63A 2WBRA 1D9FA 3MZIA 4I56A 1F2HA 1T9YA 2AKWB 2ZJPQ 1VLOA 1ZZNA 1U2FA 5IWAF 3OTOJ 2C2OB 4ED3A 1LW0A 3JSBA 3OHAA 3MMAA 1Y9OA 3KK2B 1QUVA 4AYBD 4G1QB 3KK3B 4GC7A 5AXNA 3EJMA 2WSEC 3GR1A 3CC2S 1VK8A 4M94A 2HPUA 5C24A 1K9MT 3HT3A 2R2SA 4B9VA 2DHGA 3JQMA 2LXIA 4IQMA 3D68A 4J9LA 3MEDB 4LF6F 5DLGA 4L74A 2ZH1A 2K3IA 1UEVA 1RWKB 4IR1A 3GPAA 2A6OA 4NLWA 5KT6A 5DDPC 4PKDB 4Q0BA 2D3O1 1B99A 3NS6A 1KQFB 2YWFA 2QX0A 1DTQB 5AE2A 2BZ2A 1RAIB 4OZ0A 3B4DA 4E0DA 4AQYJ 3Q22A 4HKQA 4I7FA 3CMAS 4ZMMA 4WIQA 2BW7A 2ZH6A 2ROGA 1Q5YA 3GJSB 1NJXA 5F8IA 1YBAA 1OY9A 1LK7A 3J81Y 1PC4A 2DGQA 2YQ0A 1OIAA 4RJVA 2FZGB 1IQTA 2Y0SD 1FK9B 2YWWA 4CQ1A 3R5DA 4QYZJ 4OYZA 1R43A 2JC0A 3T6JA 1NDKA 5A76A 5HROA 1G2EA 1SIWB 3K8WA 1G7CB 3RTVA 2VFUA 3W9IA 4DV5J 2LDIA 5EWEA 4C7QA 4QU7A 4DS4A 2W4PA 1ZAXA 2DNKA 1FDAA 2CG4A 4ZPTR 1TK8A 4D3GA 3G6XA 1HD0A 1PJ6A 4X65F 4L75A 4DL3A 2QA4S 2NXUA 1D1UA 2VBYA 3C16B 1DTTA 1VDHA 3IG1B 2R8IA 4MFBB 4WJBA 1C2PA 4W92B 3EM1A 3KJFB 3C19A 1P1TA 4X4PA 4UOFA 4QOTA 1HPZB 3VTIA 3UCUP 4ELTA 1WOPA 1LKZA 1D0EA 1IUJA 4PYDA 2DT9A 3TX8A 2ALYB 1BQMA 1FDDA 2COLA 3TZWA 1BQNA 3M05A 1IM4A 3BQ2A 1NB7A 2MSTA 2AX1A 1EETB 1XWLA 5CABA 2XY7A 4KKOA 3A3PB 4I69A 2K1RA 5D0GA 4TXSA 4WPAA 1RT3B 2KG1A 2MZSA 1YZ6A 2HK2A 2YNIB 4DN0A 1J27A 1SL0A 3GIRA 1QE1A 2MJUA 3RBXA 1W2BR 4HLBA 4WIIA 2AEJA 1UFKA 3UQSA 1ACMB 2OEJA 3IA0A 3R2DJ 2NZCA 2ADCA 2P9EA 4C8NA 3HSJA 4J9KA 1UVKA 2AYMA 3IM8A 4OFZA 4A48A 3ETOA 2DO0A 3GIMA 3DOLB 2XYGB 2W2NP 2FC8A 3UN2A 1YJUA 2ZBPA 3FZ2A 1RT5A 3N9UC 3QRPA 3TJ9A 2VPWB 1HBNA 3RBDA 1DHMA 4CLPA 3R1HA 1LXJA 2JFKA 4KHPF 2UV8G 4KH1B 4KGMA 3GB0A 2NXNA 2FJEB 2B9YA 4B17A 3RW7A 2MLZA 2N4CA 3PTWA 4O4RA 3PYFA 4DL6A 3TANA 4DR6F 4DV7F 4F36A 3ZZPA 2CNNB 3QAEA 1NKBA 3IMQJ 4ED1A 1IKVB 2WOMA 1NDLA 3QGGA 4UZCA 3VAMA 4JI8J 3I4HX 3NGKA 5CZXA 2IM1A 1RWPB 4PQUA 1MMNA 4DUYJ 2B43A 1EIYB 2P8IA 4EZ6A 3GG0A 1UVMA 4DV2F 5DGAA 4DL2A 1RTJB 1RWUA 1KFSA 5F8MA 4ZLLA 2AF6A 1R8AA 2A3JA 3TJ8A 1B64A 3GR0A 2RQMA 3G8SA 4X66J 5AE3A 2AEFA 1LWFA 3RAQA 3BH7B 1S0MA 2F1FA 2KYZA 5ETNA 1VRUA 2HFSA 3D0HE 3RYLA 5L38A 4HACA 3GU0A 4LUBA 1G3OA 1S4FA 2UUBJ 4TNOA 2UUAJ 1X0PA 3TQ1A 3Q83A 3QIPB 4DUYF 1YGYA 2RAQA 3HVAA 4M5DB 2LA6A 2VQFF 4DSIA 2VASA 4ES1A 1T7PA 2H4WB 1H2VZ 5LXRA 4DV3F 4NLYA 2QZ8A 3PYDA 1RUSA 4IG3A 5ETVA 4JBCA 3I56S 4ECWA 5IV4A 1NHUA 1RLCL 5U47A 3ETMA 4WE1A 1UEKA 1GFWB 4ECSA 5ETQA 3R5JB 2HQFA 2DGOA 2AYGA 3DMJA 4F04B 2CJAA 4OZLA 2FHMA 3I0SA 4Q5VA 2CNOB 2LLZA 1S1WA 4DS5A 4FZVA 3T9ZA 1NDCA 4OIXA 3TQEA 1TR0A 4ANEA 1T9XA 1UJ6A 1KS2A 2V2ZA 3QSIA 1XBWA 3EGWB 2DK2A 4DG1B 4YR2A 4PPDA 3PACA 3M8ZA 3TWZA 1I3OB 3EUNA 3LP1B 2Z2ZA 2V50A 3MAAB 1WHVA 2BM1A 2JVOA 1FNOA 3MOZA 3M2RB 4ATNA 3TA2A 3L95X 2BEFA 4YOEA 4NEYA 4OI1A 3C6TB 4KO0A 1SH0A 4N56A 3O5TB 4GKKJ 2GHWA 4O3NA 3CJKB 4Q44A 4ZCIA 3HI9A 2D69A 4ECUA 2QN6B 4DV6J 3H2VE 5F9NA 2DGTA 3FDSA 3A3OB 1F0XA 1S9EA 1D8YA 3DRSB 4EUVA 4RPFA 3PNIA 1RHUB 2ZM6F 3KUGA 3EGVA 3IWLA 4PXDA 2DNLA 2HS4A 3W9HA 3UW1A 5L46A 1FRIA 3M2VB 5LOQA 5KFFA 4MK9A 3NY0A 2CG8A 1SXLA 2AJ1A 2XNRA 3KG4A 3RJMB 3D6FB 4AXJA 2F8MA 5F9LA 3DU5A 1HNXF 4DR2J 4A8FA 1NMEB 2E1AA 3CPWR 1WKKA 4I6YA 4TYBA 1N48A 2UU9F 1TVRB 3EWGA 2HHTA 2HZAA 2AX0A 4X4SA 3CCWA 2AW0A 4KJIA 4LF4F 3SQGB 3W5ZA 2F65A 4RW6A 3HULA 3QFHA 2HIYA 3PR5B 1N56A 1IKXB 1JLCA 2EFNA 3P6YC 1V3SA 2CQPA 1B3TA 2FHKA 1VQ5S 3GSDA 4F4YA 1OPIA 4WWSA 3UCZP 4G3IA 4DI6A 4DR2F 4R25A 1JMTA 4ID8A 4LT6A 4AL5A 1QLNA 1JLEA 3D3BJ 4LFBF 2EI5A 3OJUA 4LSNA 3CB4A 2A10A 2ZHOA 2X51A 2BJEA 2H65B 2DEIA 3CD6S 3MEGA 4C8ZA 4IG0A 4UOGA 4GVLA 2HNYA 2M88A 2RHSB 1WOOA 4H4MA 3D66A 3T3FA 2J6SA 4Y00A 4KFBB 4MIBA 4UOCA 1ULRA 1HBUB 4K5RA 1RYSA 3TUJC 2PFDA 2QO3A 4EFAC 1Q86T 4NXMF 3PRDA 2NXJA 1ZAWA 1YI2S 4N77A 3D2WA 3NEKA 3R7NB 3K57A 1JLFA 4DQRA 3E01A 2I38A 3OXFA 3U1MA 1RB0A 1SBRA 5KFVA 2VFSA 2DNGA 5IFMA 4DV4J 4AL6A 5KFTA 4YB6A 4F67A 4LSLB 3QT7A 3UDEA 3W2VA 4IDKA 1LFPA 1C0UB 4AE5A 4FVCA 4X84A 1YITS 3EZUA 1S6QA 4DLEA 2YPZA 1R6YA 2GQ2A 2MQMA 1LXNA 6FDRA 3W8GA 4UY85 2QRRA 4N76A 2BE2A 1QD1A 3DM2B 1TQLA 3T1HJ 2BR0A 1FWKA 3EX7B 2V68A 2KRRA 2F4VJ 5KFBA 2BKNA 1WC5A 1X5SA 4MYTA 5F8LA 1JQGA 4FN5A 2I9SA 1U8WA 4CP5A 4O23A 5I3UB 4CO4A 5F8GA 2HRYA 3W61A 3B78A 5D4NA 1UCNA 4W98A 1HBOA 5E3QA 1ZTTA 1FX2A 1IJFB 5B0FA 1CC8A 1RTHA 4OV1A 4RWXA 4FP9A 4JV2A 3MM5B 5FDLA 4HHHA 2E44A 2J0SD 4UT4A 1PC5A 2B7CB 4XTTA 2JLFA 4NXNF 5MAOA 3D0GE 4HYKA 2NZ4A 4P74A 1GK8A 3W62A 1TAQA 2ACYA 2V4JB 3CIMA 2JZ5A 4R0JA 2F3JA 1Q5VA 4Z2XA 5T7LA 3CDWA 1PSDA 1XNQF 4D3HA 3I5BA 1ICEB 4LSZB 3BBFA 5JVHQ 1OY6A 1HLWA 2EG1A 5G0RA 1H3DA 3IS9A 1TTHB 4XPEA 4CH1A 4O3PA 1FKPA 2A6MA 5GADI 4TKTA 2CQGA 3KFWX 3SXLA 1CG2A 4O0NA 2XMVA 4IYQA 2HQCA 3J7YI 2VU5A 3MR2A 1WHWA 2RSQA 1EX8A 4HI2A 4JI3F 3MCOA 1NK9A 3UDLA 2MYFA 1PG5B 2OPSA 3PRVA 4K4WA 3AXKA 3J80Y 3IXQA 1VBXA 2CVEA 1DJ0A 1XMQJ 4DQSA 1FJGF 3F41A 2E7VA 4FXVA 2QLFB 1KRPA 2MSSA 2CPFA 1HNZF 1YKWA 4PXEA 1M1KT 1VJQA 5KFSA 1RAFB 1XR5A 4MKAA 4OZ2A 2MKIA 2W7PA 2FJAB 3CCES 2AYBA 3J7ZT 2QYCA 3KK2A 2J7KA 5KT3A 1UZHA 4LQ3A 3NAIA 1RCXB 2RUGA 4TU9A 3DOKB 1GH8A 2V34A 2O3DA 4NMXA 3BREA 2PA3A 2CQHA 4CLFA 2NR0A 1XMQF 2VIHA 1RYRA 4ED2A 1JB0C 1S72S 5E41A 1S6PB 1QAIA 2KFZA 5FLXY 1YTYA 4TU7A 2L9NA 3BGOP 1KC8T 4AT1B 1RABB 3V6HA 2GV1A 1VCTA 4X4UA 3PW4A 2Z0GA 3CUNA 4PYAA 5J1NA 4DUZF 4RW4B 4LFAF 3M1VB 3OJSA 4RUHA 5KG2A 2HG4A 3BSCA 2DGUA 3EXYA 1VISA 1KFDA 3IRXB 4BHQA 1RP5A 1XK8A 2LFVA 3HHLC 2V8HA 3D1HA 3HHLA 5JJBA 4LF1A 2HRUA 2FJBB 2MZRA 1VIOA 2C3OA 3GIJA 2WCXA 2PT0A 4V19X 2VDIA 2IM2A 4I0WA 2RS2A 4B9UA 2RD5C 3LGNA 3H7HB 3JB9k 2MKHA 5B0AA 2UVWA 4NYPA 4DU8A 3C16A 1QAXA 2HFOA 3IG1A 1HD1A 4B3RJ 5J2MB 4MFBA 5HANA 3MR3A 2YTCA 4DX7A 3SV3A 2BKPA 3KHLA 3MM9B 2P9GA 1S79A 1RWXB 2E5IA 1NU4A 1UPPA 2LECA 1REGX 2ROPA 3D28A 4M5KA 2I0XA 2BVZA 5DDQC 2HRTA 2EBGA 1QVFR 1DBDA 3HP6A 4PG8A 3MI7X 5HBMA 3CCJS 4RZRA 1MN9A 3DRXA 4TLQA 1RA7A 3PKYA 1FVQA 4C48A 2VL1A 3KLHB 4F3OA 2PI4A 2KL8A 2R4FA 4TLRA 1NM2A 1MROB 4EBEA 1CJUA 2YNIA 4M5HA 3BKTA 3D67A 3HHKA 2MQQA 4C8MA 1ZBTA 4ZP8A 2D3UA 4GKJF 3ZTSA 2PO4A 3HZGA 4OYWA 3KYLA 4CM0A 3E51A 3LH2S 2XLKA 3C6UB 2EG2A 3L9ZA 2CQDA 2ZOGA 2R7UA 2RU9A 2MXYA 1V9OA 1FEHA 1LWEB 3MCSA 3TW0A 4DCPB 2Y9HA 4YQWA 4K0KF 2MZJA 2YX1A 2EEYA 3MECA 3P45B 2C2EA 2QFJA 1B7FA 1T11A 1CVJA 3UN5A 1JJ4A 3DRPB 2DHAA 2GIRA 4IO9Q 1J5EF 4X64F 1SB6A 4B08A 4CM2A 2LQ9A 4PABA 2ZWPA 1S1TB 5CCLA 3IR5B 4ZN1A 1AZSA 2CPEA 2ZBRA 5J2PA 4CNYA 4JI6J 3KMSA 2O66A 1C4AA 3ENQA 4MMOA 4CO0A 4RKUC 1I51B 1YBUA 3Q8SB 5CH7B 4LR7A 3JAMY 3BGLA 3MPVA 5CA5A 2DXEA 2RDJA 1T05A 2Y8YA 2BJ3A 2NPFA 4TU8A 2D3ZA 4B9LA 2XLJA 4WXOA 4AFFA 1M5SA 1R8HA 2O01C 1PYOB 3HHEA 5ETMA 4U7CA 1XERA 4RW7A 4XDDA 3MFIA 2BANB 3NCPA 1N32F 1U6BA 3OHBA 2LQBA 2HBZB 4DR4J 2IBOA 1SKSA 2F4FA 2R3VA 3MEEA 4CTAB 5DDRC 2W9CB 4DL0C 2MB0B 4M5DA 1FI4A 1XMOJ 1IBKF 4JI4J 4N8OA 3KLIB 1H74A 3M8YA 2M8HA 1WC4A 2DGSA 2PN6A 2MKYA 2HEKA 5HVGA 2EKNA 1HI8A 3EMTA 4CRJA 4NLOA 3AQOA 1HNWF 2ZHBA 1S1XB 3OTEA 4O4GB 2W01A 3BV8A 2W7AA 5D77A 2Z4PA 3MD3A 4C8OA 3LP1A 3NCQA 4KRWA 4P7TA 3MAAA 4ZIVA 1VC6A 2M5YA 1EZZB 2ZZNA 1XQIA 1BQXA 4FYDA 3DGPA 4F0KA 3UDVA 5HMZA 2XMTA 1R8PA 1NPKA 4JV5F 5K8OA 2QA2A 2FPHX 4NA1A 3H4BA 1ZM2A 4NA2A 2EC0A 1BXNA 1QY7A 4DFKA 5HQ8A 5CYQB 2ZEJA 2XGQA 4O0IA 1Q0NA 1Q81T 1NHVA 1HI1A 1DLOB 1F5BA 1NPPA 4DUTA 1HQEB 4URGA 3DRSA 3R5GA 4AD6A 1N5QA 3P49B 2NSCA 2KN4A 2ZBIA 4K2JA 2V8GA 1X31C 3SCKE 3N79A 3HVWA 4DWIA 4DMZA 2X7IA 3M2VA 3TZYA 1CJKB 3TJAA 4ZCKA 3G4SS 5CYMA 1FRMA 3O2IA 1ZM9A 2GC8A 3MURP 4OZ1A 4BWMA 4F50A 3DU6A 1VOMA 2LQ8A 1YRXA 3G8QA 4YR0A 4OX9J 1YJNS 2MPUA 1G4CA 1B70B 1JWWA 1U1QA 3C66A 5HO4A 4LF7F 3CJ2A 4OLPA 4RW8B 4PWUA 1T95A 1NH8A 1LWXA 1Z2ZA 2VPYB 4YY3F 2E5LF 2CQ2A 3T19A 2V2KA 1U7LA 2BW2A 2D7SA 3M8PB 3CWJA 4TN2A 1A6LA 1EP4A 4JI0J 2DNRA 2DXFA 1CULB 2XS7A 2E5GA 2OPPB 3A8KA 1FO1A 1FKOB 2CXEA 2H4YB 1KOOA 3NGTA 4PR6A 4OHYA 1KTQA 2BM0A 2FVQA 3OR1B 2RIJA 2DRBA 1KQGB 3POTB 1X9WA 3HF5A 4NE9C 3H20A 4CWBA 1OJ4A 4K4VA 1M5KC 2A1BA 1V3ZA 3AH6A 3OTBA 4KFBA 4WFZA 1H2UX 4C0BA 3RAMA 3PRBA 5DLFA 4DQPA 3GYGA 2ZDPA 4KTQA 1HBUA 1UW9A 3H8YA 1Q8LA 3K7RA 3UI3A 3QGPA 3W60A 2JEFA 4FXDA 4DPOA 4J90A 2OD4A 3K5OA 2CDQA 4EBDA 3DXBA 2Z2LA 1QUPA 1YLXA 1KBRA 4WF9Q 3I9V9 2MZTA 4K4TA 3GMGA 4L6V3 1ZPVA 2XSJB 2HWHA 3TARA 2N7YA 3GCWP 2VB6A 3Q2TC 2Z56B 4DL5A 1RTIB 2RB7A 1YSJA 2W2PP 1UL3A 3EDRB 2AJFE 2ZD1A 3DM2A 2LVWA 4I2QB 1OQ3A 2G13A 3KK1B 1PILA 2Q1LA 1N54B 3ZTPA 5I3UA 4IRCA 5CCMA 4GO7X 1KP6A 4LRCA 3LPEA 2BQRA 2VG6A 2YH1A 1NK8A 2HIQA 3Q8RB 1Y5IB 1I94J 3BGUA 4KBIA 1WHXA 4YEAA 4QR2A 4Q8EA 2RQCA 3LWLA 2XYPB 3HVTB 4U95A 3K5PA 3CCUS 4NCAA 3CCQS 4U8YA 4KQZA 3KHGA 3QMQA 4ZCLA 4NLUA 4U7UD 1U8SA 2N7CA 4FDFA 1J2VA 2J9CA 2DHHA 1NO8A 2KKHA 2RF2B 4K4UA 4U6PA 2KM8B 2XSFA 2W25A 1RT4B 1SQFA 1M5HA 3K5NA 2WAQD 1S1VB 4A8XA 2JL9A 4ZPDA 3VF0B 4NLPA 3OV7A 2NSBA 2CPIA 5E0OA 5AT1B 2JDJA 1KQSR 4HTJA 2YKNB 2YNFB 1JNRB 5I3PA 2FIUA 2XG8A 1RTDB 1N52B 3CCZA 1ZA2B 3EZOA 1UWBB 1HIYA 2WRMA 4OX8A 3VHQA 2ZH5A 2W2OP 2UXBJ 4NCGA 4QR1A 3GYNA 3DLEB 5BYSA 2Y1JA 4L3NA 3FMWA 1HYSA 4K59A 1WC0A 5C25A 1N33J 3HX9A 1NPRA 3L7OA 4ED4A 2BQ3A 3QYYA 2KH9A 3MHYA 4ECZA 2Y3YA 1YBTA 3EE3A 3KLVA 4TQRA 3MCMA 1WDDA 1T9VA 1RHMB 3MMBB 2C22A 4PG4A 4A4JA 1NKCA 5JVGQ 3VGTA 3ISNC 2GGPB 4JYAJ 3G2XA 5CD4H 3HSZA 5C24B 1KLMB 4DL7A 5DM7Q 1OPZA 1OMSA 1HR0J 5B0CA 1R6VA 1Q78A 3TX0A 3R7BB 4HI1A 4QW9A 3GFHA 4EK2A 1S6PA 3D0IE 3DC2A 3KNAA 5IS2A 3FZBA 4EWTA 4WP8A 4ITSA 1BGXT 1I6JA 4PQAA 1FD2A 4JB8B 3AOCA 3MUVP 4CT8A 4Q0BB 1ITPA 4C97A 3T5HA 4JI5J 1RWVB 2HK3A 4O44B 4I7FB 4RW4A 1IBLF 2BJ7A 2PA8D 1SJ1A 4ZKAA 2MQOA 2HYIB 2B8PA 2O67A 3PW5A 1R27B 1F5AA 4HDHA 2X3GA 1P9YA 2BUNA 2EXUA 2DITA 3CD5A 3MUTP 1MMLA 5J2NB 2Q6BA 3ISND 4ANDA 2LEBA 3ZZ0A 4DN9A 3FC9A 4RBTA 2ZH4A 1O51A 4RO0A 2F7VA 4KH0B 1P8GA 1QAYA 3PJWA 3WQPA 1FESA 4MYUA 2VICA 2DCUB 1WC6A 3FCVA 3PCOB 3FSXA 2HHPA 3PY8A 1U1NA 1OS5A 2DHXA 3IBFB 4QWCA 3R5AA 1FD8A 3MM9A 3FNNA 1BQMB 1B0VA 2HGMA 1BQNB 3ZZOA 2BRLA 5KFRA 1HNIB 4B9MA 3N4WA 3BZQA 2Z57B 4KKOB 3LANA 2FDNA 3UD5A 5KT7A 3DKDA 2XB2D 2POKA 1QE1B 2KHCA 1MROA 3ZXWA 2ZOMA 2OIHA 1VQNS 1YJVA 4DCJB 4KGXB 1RHKB 2KRBA 4ERDA 1SIZA 4ZA1A 3OFFA 1U1KA 2HZCA 1ZZFA 3R2CJ 2AEMA 4DLGA 3V5RA 1TK5A 1N5TA 2GJIA 3MGJA 3HHNB 5KG5A 1YJWS 3QNWB 4DR5F 1TAUA 1RT5B 1JLGB 1HHTP 1HBNB 3DNCA 3EVWA 5KFWA 2QL5B 5D4PA 3T41A 2Y8WA 1N36J 2HHWA 5BJRA 3TP2A 3BSAA 2WVDA 2CPDA 3DRPA 4LF2A 5B7WA 3SMZA 1BUXA 1FA0A 3MEKA 1S1TA 4LF9J 2IVYA 2HHVA 5HK4A 2WOMB 3QRRA 4OZ5A 4J9QA 3M8WA 3Q23A 4HEA9 2GVDB 4I68A 3MWBA 4DQIA 1MNEA 1RAHB 5IOLA 2XC9A 3HM9A 3TNVA 2LQJA 2G9OA 3OLAA 1VHIA 4ZVPB 3JTNA 1SC3B 1PYTA 5DQHA 3DI6A 2GJ2A 3CXCR 2OKQA 1LWFB 3DLGA 2HAFA 5F0WA 2F9DA 4NEZA 3KHHA 1VRUB 3M30A 3LW5C 1IKYA 3GJTB 4HACB 2BANA 1FNXH 1RAOA 2VBZA 2YQ1A 2X1AA 1QM9A 2M0GB 3GJQB 1T9UA 1NJYA 3OFEA 3D6MB 2XWYA 4J9SA 2ERRA 4F4WA 1TELA 4USIA 2YWGA 2IMWP 2FB0A 4ICLA 2FLLA 2QA1A 1LOUA 4J9PA 2HKEA 1R0BG 2PD1A 3QQCD 3VVTA 1IVZA 3NAHA 5K14A 3I31A 3KLIA 3RRHA 4KB7A 4FBTA 4WE1B 4C9DA 3CDEA 1T02A 2KT5A 3QRQA 4NZ7A 4NZ6A 3K89A 3CF5Q 3K0JA 4ZVEA 3I0SB 2EWHA 1RCOB 2VC1A 1S1WB 4Q8FA 3ZTRA 1FX4A 4B3OA 3W64A 3MF5A 1UTAA 2XYHB 2KXNB 1R3NA 3IN5A 2YPYA 3JSRA 2KHDA 4LRDA 4O4GA 3WDOA 2HVIA 4F02A 4B9TA 2DO4A 4G1IA 4URQU 4NWBA 1BHNA 2AIRB 4KO0B 4Y34A 2VKRA 2R9LA 4J5OA 4U8VA 2VFRA 3AT1B 2QG9B 4F2SA 5FJ4A 3I32A 3HFZB 2UVRA 4EYIB 2ADBA 1VQLS 3VV2B 1HQ2A 3IR6B 3FCHA 1NXIA 3ZZUA 2CWKA 2QYGA 2DISA 5C42B 4MT1A 3C2PA 1FJEB 2DB1A 4Y0FA 3TR5A 1F2GA 1U6ZA 3FBBA 3JSYA 4KGVB 3UN3A 3KOAA 1U1PA 3OUYA 2ALZA 3AB2B 4JI7J 3QO9A 5SUHA 2JWNA 1FTCA 2IRUA 2V4QA 2BA9A 3QGHA 1S77D 1HQUA 3R27A 3U1NA 2XMKA 3R5BA 1QTNB 4OZNA 1N5VA 3H25A 1YJRA 1M5OC 3OD2A 3SCIE 1L5UA 4DX6A 5GAHI 4C3MA 4XO0A 2AGPA 5GAEU 1REVB 3I0RA 1NK0A 5F8JA 2E5JA 2ZUAA 4RW8A 3J7Z5 1JLCB 1TMMA 4F8RA 1VI7A 2J9EA 1HKAA 1MW7A 1TFWA 4WKRA 1PYSB 2CZ9A 1B7YB 2UXDF 1X4EA 2EKYA 1S12A 3SQOP 5B0GA 4PCQA 1FNMA 2FC9A 1XMBA 2Y1IA 5KFMA 3DOMB 2GMJA 4OYXA 5BYQA 1N0VC 2DEJA 1YQHA 4JV0A 4X62F 2DBBA 1CULA 2EBEA 2K7JA 3T5LA 3MPYA 1ZM4A 4L3KA 4OQJA 2J8AA 5DETA 3MEGB 3HKZD 3OR1A 4KHMA 1T3NA 2HNYB 1FFSB 3ITHA 3FEYB 4H4MB 1RLDA 1RHJB 4RUCA 2MKCA 3KDNA 3D54A 3QSYB 4ALZA 1K44A 1KQKA 4Q43A 2FY1A 3OXGA 2LP4A 3PIPQ 1SKUB 3LPYA 4C98A 2B0GA 2V69A 2XEXA 4F7VA 2OGUA 2HFNA 3UVJB 4J9OA 1Z1ZA 1PCAA 2QSWA 2ZUGA 5RUBA 1X7VA 3FKBA 2Q3PA 1O6XA 3E01B 1ZS6A 3LA0A 4TY8A 1SVDA 2WHOA 2CQ4A 2CZ4A 1FFWB 2HURA 2M7SA 4USVA 4DV0F 1S10A 3MMCA 4CLKA 1CEZA 2WW4A 1FRHA 3W2VB 3ZC4A 4IDKB 2DR5A 4I64A 2NXEA 3MAQA 5FD1A 4G6VB 4RNOA 2CQ3A 4DEZA 2C1EB 3A1YG 1U24A 2LMIA 2K8GA 3N6LA 4DX8H 1TP7A 3GWCA 4NRUA 1QTMA 5A8WB 2FVSA 1Y5LB 2KZMA 4FVMA 4NYZA 3CJ0A 5I4MA 1X5PA 3M9NB 4WFAQ 2FLOA 2VF3A 1WEZA 2DNPA 3OVSA 2V8DA 4Q2MA 2LCWA 5KG0A 2L48A 5KFYA 2XM3A 1RTZA 3LUYA 2MLYA 2ZZMA 4LFCF 2YKAA 5CYJA 2XBPA 1RK8A 5T7LB 2R8GA 1GX5A 2WVCA 2ASLA 3PJ9A 2EK6A 2RF2A 3SSRA 2FTRA 3NL0A 3QPIA 1GT8A 5KTQA 2AJ0A 4ZP6A 3BPDA 1KVKA 5G0RB 2KFNA 3QFWA 2CIMA 1D9AA 1NSPA 2JLGA 2VOPA 5GMDA 4B3TJ 5J2QA 4K4XA 2FQQB 4DR1F 2APOA 2XO6A 1NHKL 2RH3A 4WU2A 1C4CA 4ZLJA 3TAMB 1UWBA 4DPXA 4QIEA 1EAYC 5KFNA 4DR3F 3PYGA 3NS5A 4DFJA 2NREA 3FK4A 1P9QC 5K8NA 2CJQA 2C28A 1NSKL 2UXCF 2OFHX 3LQVA 4ZIWA 4X4OA 5DDOC 1RT1B 4PUOB 3QZ8A 4B3TF 4P72A 2KT3A 1RKJA 5JMNA 4HT7A 3A3NB 2ZDOA 2LXUA 4X4RA 1KHVA 3DLKA 3MM6B 3MMBA 3RR7A 5M2UA 4KPYA 2E7WA 2RDDA 5DS7A 3G96A 2GGPA 2GAHC 1PO6A 2DR8A 2G0IA 3WC0A 2VODA 3PIOQ 1KLMA 3VZHA 4P2XA 4MKVA 2L3MA 3UFCX 2QL7B 4IOBA 1W2IA 1RT6A 4HH1A 1RU2A 3OTOF 1FJ7A 1YJ9S 2YWKA 2AYEA 3NGRA 4UW2A 3CIZA 1KDNA 4BLGA 4WFBQ 2B5JA 1U26A 3GV7B 2DIUA 1MMDA 4CLSA 2IVMA 4QYZK 4DPYA 3S6EA 4A8SA 5CZVA 2G0CA 4O44A 2FZKB 2CRLA 1F9HA 2DH7A 1IWAA 3HHLB 1T9TA 3EVMA 4ECVA 3HD2A 2FJVA 2D1CA 4QWAA 2HAIA 4YP3A 5CXTA 2FJXA 3W7BA 3GFZA 2AZ1A 2MKJA 4FF4A 5J2NA 4ZJOA 1WELA 5HP1A 1SH3A 3FGVA 5H9EK 3LALA 4H4OB 3L7PA 5HMYA 1NAQA 5B0BA 2OD6A 2VA2A 2G2ZA 4AQYF 2DNOA 3CVKA 3B4MA 3FRZA 4CH7A 5EWFA 1S6UA 3ILOA 5A8RA 3HHDA 5H9EJ 3H2LA 4QWEA 1PBAA 2EFOA 4WP9A 4RX6A 3F44A 3VWSA 2DYAA 2E5HA 2ZVSA 4DV5F 1Y0HA 1DRZA 4CIOA 4RW9B 1JXLA 5HBMB 1HNIA 2CJKA 4Z7YA 2YQ3A 4CT9A 4LBHA 5KG4A 2BRKA 3PZPA 2AMCB 1RAJA 1B0PA 3GG1A 3MM7A 1V3RA 4KSEB 4QPXA 5D4LA 1RQ0A 3HFKA 2IM0A 2AJ2A 4USTA 1S7IA 2WB1D 1CJUB 5E3PA 3V81A 3BR8A 3RW6A 3VGVA 4OZ3A 3NOCA 2IDEA 2LU1A 2PI5A 2XMAA 2Z8QA 4DPUA 1M5VC 1HL6A 2QIFA 3KLGB 1QJHA 1N34J 3H40A 2K7KA 2GA7A 3QATA 5HQMA 1R8CA 4R8UB 3MPDA 4IFVB 3NWRA 4ZS6A 1EARA 4C3KA 3HD1A 2V4RA 2KT2A 3TUIC 1JLGA 1ROFA 1RWMB 2YX4A 3W9JA 3P96A 1TV6A 4ZLPA 3MECB 1HNVA 3N6MA 4YUDA 4RNFA 1SJ3P 1UW4A 3OL6A 1BD6A 2J76E 2HNDB 1EHWA 4JOUA 1IN0A 4NLTA 4CH0S 2DNMA 1BLUA 4DR7J 4J91A 1XNRJ 1WSVA 5KFXA 3CTRA 3PM9A 3TEGA 2MKSA 1SL1A 2LU2A 3ZFVA 2DRAA 5KG1A 3A8JA 1JJCB 1AZSB 3M7VA 5J2PB 4CZCA 1WORA 5IC4B 4P7VA 2HZVA 1QSSA 1M1GA 4UY8T 2ZKTA 3OXLA 2Y1RI 4TVAB 2GVDA 4PAAA 2R7SA 2HGNA 2RU3A 4EEYA 1OYEA 3W3SA 1MN7A 4CLTA 1H38A 3H5XA 5THWA 5LM7E 1GMUA 1IM6A 1ELOA 5KOXA 1T05B 4P52A 3L4BC 1H7XA 4QIFA 4U9RA 1K0VA 3UWTA 5F0UA 2YH0A 4XPCA 1TFYA 2KDOA 2LEAA 1PJ7A 3BEGB 3RZAA 2ASYA 2B4OA 3HJFA 2FUG9 4RW7B 5GAGI 5EHHA 4EGLA 4ED6A 1KN6A 3RAXA 1VQ4S 4JI8F 3AOAA 3MEEB 2CZVC 3C15B 3K59A 1LFWA 4K8RA 4F4KA 3HVRA 2R7TA 1QSYA 2LEPA 2KB2A 5B0EA 3X3UA 3IGVA 4DHVA 4CO5A 4M5JA 5E33A 5LMNJ 3HSGA 1YRTA 3HXMA 4PWWA 3MR5A 3EZ5A 2IM3A 3BM7A 3MTJA 5A8KA 4RUAA 4KT0C 5FIIA 3LOUA 4UQTA 3A8EA 5AJ3J 3LF0A 4ZVSB 4MK7A 1FRJA 3EVOA 3R3TA 3NNCA 1DZ5A 3IWNC 4X66F 1VS3A 2FLPA 2R2RA 2WK4A 4KC5A 5KFGA 4YB7A 2J9DA 2CPZA 3Q8VA 5IC6B 4WFYA 2A18A 3IR7B 1OQ6A 2UUBF 4YHHJ 1Y11A 2UUAF 4NLDA 2CJBA 2K2PA 1UA0A 2CQCA 3NOGA 2BOPA 2D74B 1U0HA 3JQKA 3BYPA 4DV1J 1WF1A 3NLCA 2AGQA 2E1RA 4B3SJ 3DGPB 4PG7A 1E6YB 3NMAA 5HJYA 5HN0A 2W9BB 3B54A 5BR8J 2BE9B 4J37A 3R97A 2I8EA 3M8QB 3GIIA 4I1TA 3RB0A 3OVBA 1S48A 3Q86A 1TL1A 2C2ZB 5J1PA 1YJ7A 3QWPA 1C1CB 1JKHB 2CJXB 1XN9A 5C42A 4X4NA 4DOZA 1X9MA 3OT9A 4HHJA 2ZNZA 3LGHA 2VPXB 1IKWA 2E1MC 5CYMB 3DLLQ 4TYAA 4H54A 5BR8F 2W2MP 2RRNA 4GKKF 4FS1A 2D3OR 1JLAA 3KJVB 2W1BA 4ELUA 3GE9A 2R2UA 4USUA 4FYVB 4DV6F 1VBYA 3I87A 2KFYA 5LT5A 2DR9A 2NLWA 2SXLA 5SZTA 2V67A 1RWNB 4RL1A 1CLFA 4ED7A 1REVA 4WK3A 2KJWA 4J9NA 2PFFB 3EDQB 5DZ6A 3CT9A 5KG7A 1AA1B 3MPWA 1C0TB 4I4BA 2IAJB 4KR0B 1EP4B 4CLYA 1HWLA 3DOMA 4BCAA 4K2XA 2YKPA 5ETKA 2BJ8A 1U0SA 4U96A 2OJ3A 3F73A 1UVJA 1BE4A 2F8EX 4AL7A 4ILLA 3UD3P 3PG9A 3N01A 1UAWA 4ZPCA 1OSCA 5BXIA 1H6KX 2BKOA 2Q6CA 4W4MA 4KYZA 4O3RA 2P6TA 5L1LA 3DHWC 4O3SA 4EO6A 2Z2YB 3Q89A 1X8DA 4ZVRB 2Y1LB 3PYEA 3UVJA 1VFJA 1JLQA 2BMBA 2OLWA 3RB4A 1WKLA 1FTRA 1TL7A 2BACA 3NCRA 4JI2J 2ZOFA 4ZN3A 3DDKA 1RISA 3QLHA 3RBEA 3CCSS 2AHOB 3P4UB 3GJRB 4ZP9A 2HWTA 4HH0A 1Y5NB 2HQIA 2AT1B 1VQ8S 5KFDA 1LW2B 2XY6A 2OP5A 3M2UB 5L1JA 2VBWA 4OYPA 2AWZA 4BWJA 2DIVA 4LF8J 2ZD1B 1Q95G 4NLQA 2GZOA 4DPTA 4IH5A 3JAMU 4KHRA 4RBUA 1TMJA 3PW2A 1GMVA 2NUHA 2GQQA 4MTPA 4NPOA 2HVEA 2WW8A 3AOBA 1X60A 4OI0A 5K8MA 5A8WA 5D0HA 3A4TA 2VG6B 3FVYA 2E1PA 4F2RA 4DV4F 2DNNA 3GIKA 3H98A 3FQKA 1WG4A 2XWXA 2RT3A 3CJ3A 2MKKA 2YWHA 3JS9A 3KLEA 2OO4A 2FGCA 1R0AA 4F4AA 4GO5X 1L3TA 2VHGA 3W2WA 3T1HF 4OYBA 1FRXA 4J7CA 2RRBA 2F4VF 2CVIA 3QT6A 2DPJA 1PKUA 1JXVA 2QMUB 3MDFA 4CLWA 3V4IB 1VR6A 3HDSA 3AD8C 3RRKA 1X4BA 2HLTA 2NUUG 1HWKA 2JX2A 3TUZC 3T5JA 4RR5A 3CDUA 3U02A 2H48B 5HLFB 4JV1A 5K20B 3MPUB 2CFXA 1NSQA 2LXFA 1VIXA 1TU0B 3HZEA 4PRFA 3GSIA 5ETRA 5J1EA 2AJ4A 3LP0B 3SDEA 2IJFA 3BKFA 3TAMA 3DXSX 2C2KB 2N82B 4NCGB 4Y65A 2UP1A 5DZ7A 4BC9A 4LF5J 2UUWA 1HYSB 2QMWA 4GVBA 2JFDA 5C25B 2QEXS 4USHA 1N5YB 5DQIA 1E6VA 3T1YJ 5B08A 2ZH9A 2ACMA 2RDIA 2R8JA 4DF8A 1TKXB 1RT1A 1NK7A 3G71S 1UVNA 4PUOA 7AT1B 3PFEA 3CO9A 1Q7LB 5HVFA 1C1BA 1VQOS 2CKWA 4R5PA 2QSFA 2DRDA 3G8TA 4PWDA 2XMUA 3GP9A 5A6WA 3MM6A 1F1BB 4LBPA 2QL9B 2R7RA 2YKOA 5ETSA 4LF5F 1BY9A 5EX3A 4H4KC 4FS2A 5IM0A 1HBMB 4C11B 2YVSA 3EPGA 2M3DA 2KVQE 3HKWA 3TVZA 1DQ8A 4CNZA 4AXIA 1RGVA 2L41A 3PHEA 4X4QA 1Y7PA 4E98A 4RBVA 3BQ0A 3PVXA 4FPRA 2HS3A 4Q7AA 3ENWA 2ZNYA 3Q8QB 1WNEA 2OPQA 1M5PC 1ZM3A 1U1OA 3NS7B 2CUYA 4EMDA 1FDNA 2MMYA 2DH8A 1S6OA 4I67A 4DFMA 3NG8A 3OL7A 2ATLA 1CJTA 3IWXA 3C14A 1NLKL 1MLAA 5IWAJ 4IOAQ 2V63A 3QT5A 2YKMA 1TKTA 5DGBA 2WVFA 1S0VA 5C7PA 1PAEX 4F0MA 1RA6A 4H4OA 3K2YA 4M5NA 3H2UB 1VJWA 3FEZA 2MGZA 5HQLA 1TL3A 2VC0A 2OI2A 5D0EA 1FXLA 2E9RX 1TL4A 4LF6J 4C0OC 3PHTA 3TA1A 2CQBA 4GMKA 1NH7A 3UE2A 4GRSA 4UUXA 3JTOA 1QAJA 5KFEA 2E29A 4V1Ak 4WFXA 2VFTA 2RQ4A 2W8LA 2XCPA 2VDHA 1HW9A 2VD3A 2C3UA 2CNLB 3RB3A 2V2QA 2LA4A 1Q8IA 5A2QU 4I6WA 4N5SA 4NLGA 4RW9A 2OSQA 3DRRB 2G2YA 3G9CA 1KWMA 1FXDA 1MU2A 3HHLD 4EYHB 1DURA 1L3KA 5D0RA 3CEDA 1BWEA 2G0JA 3CDBA 3FFIA 3CJQA 3DHXA 4B3RF 4F3MA 1FE4A 1HI0P 5LJ3Y 4DDFA 1YX2A 1F9EB 3H90A 4QWBA 4M8LA 3CC4S 2BBEA 1TZ0A 2V6AA 1CQNA 1SPBP 2RQKA 3GV5B 4F4ZA 1URNA 3SSQA 1U45A 2GO8A 5JXSA 3OVAA 3KLGA 2XHCA 1RACB 4X65J 5E3AA 2Q43A 5KFOA 4R8UA 1YDLA 4IFVA 1T9WA 2B9XA 5AXKA 3KLFA 1SCJB 3KG1A 4HHUA 2HWIA 1CSJA 1FFGB 1NK5A 2GVZA 3NGSA 3O3LA 2KO1A 3P5TL 2HNDA 2QV6A 2DGXA 1N8RT 2XMJA 2Y0BB 3QGIA 1Q1KA 2YX7A 1DQ9A 3HPOA 1CS4B 2UVVA 2XULA 4OYIA 2G1HA 1MG7A 1IBCB 3R9LA 2FHJA 2XZWA 4FF1A 4K4SA 3HO1A 2V9KA 4C8LA 1LWCA 4IKAA 4Y28C 2VFVA 1Q7YT 3NP5A 4CYUB 3OSNA 1D3WA 2AD9A 1WJ9A 4QYRA 4DFPA 4WBFA 3C3LA 1UJ5A 1XC9A 1NJIT 4X4VA 2VV5A 3IBCB 1V5IB 3AB4B 2YNGA 1WG5A 4M5IA 1FKAF 2FVPA 1SV5A 3HLUA 4ETZA 4L76A 3DI6B 2KTQA 4UUWA 3T1AA 2I1RA 4ZVQB 3DLGB 3FSYA 2KXHA 5KFHA 3UDCA 1N6QB 1HHSA 2AJQA 3AJDA 3SI8A 5HAOA 3MCNA 3AJ2A 3MMJA 1S0OA 3TZZA 5HATA 3M30B 1IKYB 5A0YB 2AU0A 3I5AA 4WYWA 2L9DA 4ZVTB 4ENOA 4IO1A 4P75A 4JI6F 2WVBA 4KHPJ 2JEIA 3KWMA 3C15A 3NGUA 1MSWD 3EGZA 3PX0A 2MHNA 5T14A 4ICLB 3A12A 3PW0A 3ADAC 2FHJD 4OZJA 2CWXA 5K14B 2Q66A 2ZH2A 3RUBL 1GNKA 4DR6J 4DV7J 3Q8PB 2HNZA 5I42A 3KUEA 2IFXA 3JSMB 3H5YA 2D9PA 1X5TA 1FERA 4LIWA 1NK4A 4B3OB 1L3SA 2HVHA 1U25A 4DR4F 2QFIA 4ZJLA 1OWXA 1YG0A 3I9ZA 2O5DA 1WD6A 1D09B 4DV2J 1U09A 4KE5A 2R2TA 1XMOF 1AW0A 2ZHAA 3D4JA 4JI4F 1JXEA 4K4ZA 3HCXA 1SL2A 1T0TV 4YB1P 1URRA 4LMZA 2MTLA 2E1CA 1TKZA 2RUSA 1SC4B 1E6YA 1U1MA 1EKSA 4CDIA 2XI3A 2W9BA 1Y3JA 3V4MA 4CLUA 2DR6A 1S97A 2CAJA 3SIPB 3TO8A 2FYXA 2FZCB 2VQFJ 3B82A 1XR6A 3M8QA 1RBAA 2FHOB 1U2CA 4PG5A 4FPIA 2DXDA 4DV3J 2HGLA 1Q53A 1P1LA 2PDAA 2GW8A 1HHQA 2M2BA 3HFVA 1V6HA 4DJBA 1C1CA 4ZVHA 1JKHA 1T8EA 3VALA 2MQNA 4K5SA 3OUYB 1B0TA 2U2FA 2H3EB 1OO0B 1GXLA 1UP1A 3QO9B 2QLJB 1X4HA 2CQIA 2OSRA 1HQUB 2V8VA 5IT9U 3NKYA 3KJVA 2N3LA 1GXUA 3SCLE 1AUSL 2XY5A 2QLXA 3D3CJ 2X3DA 1K73T 1T03B 2CDRB 3LTOA 3L09A 3FSIA 1LQ9A 3N0VA 3OW2R 3DLJA 3I0RB 3MTKA 2WONA 2HS0A 1VQ7S 4ELVA 3M9MB 2C2DA 4B02A 2JLEA 4R0EA 3OTCA 4EI2A 3BSNA 4LIRA 4OI6A 3T6BA 3K5MA 4NLVA 3PW7A 3BGRA 1C0TA 4Y2AA 4QPTA 2ZM6J 2IAJA 1ZH5A 4MIWA 3EYZA 2PMWA 1NZAA 5GMKa 1HA1A 3B8HA 1N0UA 4JI1J 4OX9F 5HVHA 4NX9A 3BO2A 3UCGA 1FDBA 3ZO7A 2KVIA 3SZ2A 4J9VA 3KUHA 3UD4P 3ITHB 4WK1A 3CULA 2HLUA 2PGCA 4OMFG 2NYHA 3W5YA 4ZOSA 4Y3CA 3OQ2A 1HNXJ 5D78A 1I1GA 4P10A 2DVIA 4ZLNA 3W65A 5D4OA 2KZZA 2UU9J 2JEGA 5GAGU 1QVGR 3PEHA 4JI0F 2PMZD 4LF4J 2VKZG 4MK8A 4JI1F 4FYWB 3CSKA 3KJNB 2HW3A 4TY8B 2WB4A 5C2CA 1N88A 2BJ1A 2X1FA 4PZVA 3MMCB 3O1LA 2JNJA 2M52A 3S7RA 4QWDA 4KPCA 3CCRS 3N28A 3SYZA 2ZKUA 1GMWA 4ECRA 2IA6A 2VA3A 1LW2A 3M2UA 3Q8UA 8AT1B 4LFBJ 3TUPA 1RHQB 4BS2A 2OEMA 2E66A 3UO0A 6AT1B 2A2CA 2MQLA 2LYVA 4IFYB 4YB5A 1CJVA 1UZDA 2GIQA 4Y2MA 3PEJA 2AGOA 3U27A 4YFUA 2P5VA 4FNIA 3VAFA 4NLRA 3IFEA 4QIGA 4KGZB 5F3ZA 1RZMA 3GILA 3TZXA 3BGFA 2DD8S 2XCAA 3E8OA 1BC6A 2PEHA 4QR0A 2P9CA 2AQ4A 5L1KA 1WACA 5E2QA 5K8PA 4NXMJ 1BWVA 4UTGA 4Z7CA 3VGUA 2E9TA 2BYCA 1FJCA 3M4XA 4ETXA 2CQ1A 1NNDA 4IH6A 4QU6A 2DNZA 3Q2SC 3J81j 5B09A 2VONA 5K9FA 4NCBA 1RI7A 1OYDA 5KT2A 3G82A 4FKYA 4I6AA 3HT0A 1GMWD 2OMLA 3S8SA 2KXFA 2CPHA 2RJZA 3QWUA 3D5MA 2CPXA 3NWGA 5ITHA 3V4IA 2B4PA 1L3UA 1EKRA 1Z2LA 5F41A 3OR2A 3S01A 1I94F 1K0TA 5J2QB 5HLFA 4NI2B 4GC6A 3ET6A 2J7WA 2M8DB 4ECXA 3CJ5A 3FQLA 5G4DA 2GAGC 3WHIA 4EBCA 1NSAA 3LP0A 1RAAB 3ILJA 2X1BA 1O0PA 2R7VA 3AY0A 2QC3A 4OX7A 1Q8BA 4ID5A 3OSPA 2H9ZA 4DQQA 2YXLA 3VQSA 2BDPA 1N5YA 3CCMS 2XO7A 3IC1A 1KVJA 2WZ1A 2H5EA 2IC3A 4DF4A 4NXNJ 2UZAA 1TKXA 2V5HG 3IM9A 4NRTA 2E9ZA 3CC7S 3ZNJ1 1X4CA 3UNGC 1X9SA 2IRXA 4OJHA 1WC3A 1UWAA 2ZBQA 3ISZA 4BDPA 3DLKB 4ANCA 2HFUA 3OFHA 1KONA 1XNQJ 1KTVA 1UEUA 3WIUA 4WTOB 2UXBF 5JUMA 2IJRA 1NUEA 1NEEA 4HVZA 1XEZA 2ZE2B 1JIHA 3VAKA 4ZVFA 1HBMA 1FCAA 2GNKA 4C11A 2CPJA 1N33F 4I2PB 2I5JA 2HHXA 4DZ6A 2Z58B 1VQ9S 5E7OB 3P8BB 2XS2A 1RT6B 1IQZA 2EFVA 5D3GB 5E3CA 2IYIA 4DZDA 4JI3J 2FGOA 2B5JB 1PGZA 4C4WA 4X4TA 4M5GA 1WWHA 3DDNA 3HMJG 1S0NA 4JYAF 5IXUA 1FJGJ 3UNYA 3D1OA 4DBQA 1UFWA 3JTPA 4C2MA 1HR0F 4J9RA 1PIEA 2R7WA 2QGFB 1HNZJ 1GX6A 5F3TA 5ADZA 2BE7D 4OI3A 2A2DA 5DRKA 2JH3A 3ZNUA 4DCOB 4P2MA 4OYOA 4P2SA 1Q16B 1VRTA 1WSRA 5HP1B 2CYYA 3H4DA 1Z4UA 2HQGA 1K8AT 4KGKA 4JI5F 4ZHRB 2J6TA 4NOHA 5A8RB 1N4LA 2EPIA 4K50A 1VMBA 2ASJA 3T9NA 3O44A 1S9FA 4JP8A 2F40A 4YR3A 2GS8A 2LQ5A 1WI6A 2XI2A 4G1QA 3KK3A 4OLOA 3OBIA 4LVOP 1RAGB 4DUZJ 2VZ9A 1Y4ZB 4LFAJ 4IRDA 2C2RA 1WC1A 3PR4A 3DRRA 4FYYB 2XTJP 2B4UA 5C2GA 1KKHA 2GCFA 3MM7B 3ILIA 1LEOA 2MQ8A 3VZIA 4WYLA 1ZTWA 2BABA 3MEDA 4Q2LA 3V81B 1LNQA 2JOQA 1NCLA 3BN7A 1IJEB 2BV3A 2R8KA 1SC6A 3FBEA 1DTQA 5GADU 2MY8A 1WKJA 3FCWA 2VG5B 2CA9A 3R8YA 2B6AB 5KFLA 4ZPAA 3J7YU 5HJXA 3NGDA 4HDGA 3MAHA 1GEHA 3QT8A 1FK9A 2B8QA 2JHEA 1TV6B 2ZITA 1HNVB 2VBXA 3RG6A 2ZH3A 5ETTA 5H1SV 2DGVA 3U7JA 2B4VA 4E8UA 5KFAA 2D41A 2OFGX 2E7XA 3M32B 3M8RA 3CD0A 2KG0A 3NRBA 3OPKA 1UFLA 1S76D 3THVA 1CS4A 3CE8A 2QT7A 3I4PA 1F3VA 2ROEA 2H51B 3OL8A 4PG6A 4CYUA 2V0NA 4QZVB 4N47A 1FEEA 3FEXB 4IUFA 4P2FA 3PKMA 1A9NB 1HPZA 1U49A 5D15A 3ZTQA 1N36F 5L1IA 1XJWB 3DLBA 1K1SA 2DNQA 2HBYB 4GKJJ 4WKYA 2GHVC 7FD1A 4OV6A 1GXTA 2L08A 5H9FK 1RSCA 1EETA 1GQEA 1N6QA 4DX5A 1WF0A 1JLBB 4LF9F 3NBPB 4M95A 3GFYA 5A0YA 4NYOA 3WX4A 3I5CA 3N5BA 1RT3A 1H72C 2BJ9A 4K0KJ 1TKDA 3R1LA 1RAEB 3CO0P 5H9FJ 2GO9A 4KIAA 1FE0A 1DQAA 1SUQB 2C42A 5AXLA 1RU1A 5L9XA 1M0SA 5L39A 2XNQA 3H59A 2R7XA 2YY3A 2EK1A 5HSPA 2OH2A 3QIDA 1CQMA 1J5EJ 4X64J 5A8KB 1S7HA 1AB8A 4L73A 1LK5A 3EPIA 2HSEB 5DJBA 3MFHA 4IRKA 3CJRA 1XTZA 3UPFA 5DO2A 3DOLA 4OL8A 1RT7B 2MQPA 4FXWA 4ED0A 1WTFA 3TOQA 2JVRA 3JSMA 3N5FA 2BQUA 3D9BA 5IQ6A 5HI7A 1UETA 1IWGA 5GAEI 8ATCB 4QIVA 5D6GA 3LP2B 2K06A 5EDWA 3CNQP 3KNGA 1M90T 3LGMA 3SFUA 3EICA 1RT2B 1MWYA 2WSFC 1NJWA 2DNHA 1U0HB 3TA0A 4NLSA 3MR6A 5GVQA 3VR1A 3SEOA 4C8KA 1SJQA 1RBLA 3OLBA 1N32J 1IKVA 4RNNA 2WVEA 2RS8A 1EQ0A 3FBCA 1J5OB 3HK2A 3J81U 1IBKJ 3C8YA 1VQYA 1TL1B 3PO4A 1Q4RA 3LAMA 1RTJA 2UV8A
chains in the Genus database with same CATH topology
3DGPB 1YDLA 3DOMB 2JNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGP B;  1YDL A;  3DOM B;  2JNJ A; 
#chains in the Genus database with same CATH topology
 1VGY A;  2C2M B;  3IO1 A;  4ZVG A;  1UVL A;  4LRB A;  2I6W A;  1IKW B;  1X4A A;  2VUG A;  3RGI A;  2CJ9 A;  4C8Y A;  2IYG A;  2XMW A;  3M6W A;  4MH8 A;  2AZ3 A;  3HSD A;  3VCD A;  2HMI B;  2DGW A;  3H0P A;  1JLA B;  1HNW J;  5EGY A;  4X2B A;  4FF2 A;  3QIP A;  1RBO B;  1M1H A;  4ZPB A;  1HMV B;  3KDO A;  3LAK A;  3K8V A;  2M9K A;  1T03 A;  4XAK A;  5EN1 A;  4F0H A;  2DY1 A;  3PJX A;  4YDX A;  3BQ1 A;  4JV5 J;  1O5J A;  2EFG A;  4LJM A;  3W63 A;  4JI7 F;  3JYT B;  5ETP A;  4FKX A;  4F26 A;  4KAI A;  2HHU A;  4DG1 A;  1UA1 A;  3C46 A;  4RNM A;  4M5L A;  2DJW A;  3VAJ A;  2KI2 A;  4L72 B;  4IR9 A;  1TUG B;  1A0O B;  1F60 B;  3M2R A;  1Q79 A;  3AFG A;  2ZVI A;  6FD1 A;  4NML A;  5KFI A;  2GX8 A;  3ONQ A;  2IHR 1;  3C6T A;  4WTY A;  5BYR A;  3CJK A;  3CCV S;  3W1Y C;  2OTL S;  3L3C A;  4QIW D;  1IXK A;  1U1L A;  1PAU B;  4USM A;  2CPY A;  5LJ5 Y;  4ECY A;  4A8O A;  1AUD A;  1JLQ B;  3EGN A;  4G1P A;  4LF7 J;  5IT0 A;  1R7I A;  1YRU A;  1TL7 B;  2NYI A;  4YDD B;  1OY8 A;  2HVZ A;  3L7U A;  3Q8Y A;  1VLY A;  1FWP A;  1SQE A;  4YY3 J;  3CME S;  3QLH B;  2E5L J;  4Y2I A;  1A7G E;  2G4B A;  1PJ5 A;  3BYR A;  4QQB A;  3R6L B;  1F9F A;  2VPZ B;  1HWI A;  3DGV A;  1KVI A;  1U02 A;  3M6X A;  3WX8 A;  4LQ9 A;  3P3D A;  1U1R A;  4LR8 A;  1XIQ A;  2RHQ B;  1TVR A;  3K17 A;  2OMO A;  4IFY A;  2OPR B;  1R8B A;  2WSC C;  4UF4 A;  3HJV A;  4DL4 A;  2YNH B;  2ZWO A;  3SQG A;  4OHZ A;  3AD9 C;  2B56 A;  2JJ4 D;  3IRW P;  3G87 A;  3KXD A;  3FJ2 A;  1S4E A;  2IDL A;  4WFN Q;  2KYX A;  1IKX A;  5EWG A;  4NA3 A;  4OYA A;  3ILL A;  3CCL S;  3KMQ A;  3ENA A;  4ZVU B;  3US5 A;  3DLH A;  3WZ0 A;  1WEX A;  1FRK A;  1H73 A;  3GCX P;  4PEO A;  1S57 A;  1IR2 A;  2MZQ A;  3DRY A;  3WC2 A;  5CQG A;  2PSZ A;  2YKQ A;  3KLE B;  4ED5 A;  1Q82 T;  3CJT A;  1WHY A;  3J7A N;  4CLL A;  1R0A B;  1RE1 B;  3S1T A;  3W2W B;  3NMR A;  2GQC A;  3QBC A;  3CDA A;  4IH7 A;  1NZ8 A;  3BKU A;  1WF2 A;  4QBU A;  5HMW A;  4UOH A;  4ZP7 A;  2VG7 B;  3TRG A;  4CI0 B;  2ZJQ Q;  3V2U C;  2J6U A;  4YN3 B;  2FJW A;  4KV8 B;  2BXJ A;  4YME A;  3MM8 B;  3DYA B;  1D8Z A;  1VQK S;  3A8I A;  1YJT A;  4NI2 A;  4ECT A;  4FF3 A;  5J1E B;  4PPZ A;  2U1A A;  3SDE B;  5A2Q Y;  1NBE B;  3CCT A;  1EB0 A;  1GTH A;  1QSL A;  3BN4 A;  5CD4 A;  4GVB B;  1P6T A;  2N3O A;  2XZD B;  3FMB A;  1E6V B;  3M8S A;  2DNY A;  4A8Y A;  4LSL A;  4P6Q A;  3SBM A;  4U67 Q;  3FUY A;  2RVJ A;  2HQ3 A;  3M6V A;  3AAW B;  1C0U A;  5AXM A;  5KOW A;  3G6Y A;  4JUZ A;  3RB6 A;  2IJN A;  2RKI B;  1C1B B;  4KY3 A;  2C3Y A;  4R5P B;  5KFZ A;  3KHR A;  3GLJ A;  4PWD B;  1RWO B;  1T3O A;  4E2F B;  4HL9 A;  2EFQ A;  2IMO A;  3ENV A;  4URS A;  2GJF A;  1S1U B;  4WZQ A;  2B9W A;  5IM0 B;  2ZE2 A;  5ETO A;  3D6T B;  2MLX A;  4OJ1 A;  2GHP A;  4TQS A;  3MM5 A;  4I2P A;  2L9W A;  5B0D A;  3TVY A;  3PO5 A;  5M2R A;  2XZT B;  3WIV A;  4ZJQ A;  3JQJ A;  3AJ1 A;  3KKF A;  5KFQ A;  1S9G B;  2OPQ B;  1ZOT A;  3MR7 A;  2V4J A;  5D3G A;  4Y2K A;  1PBU A;  1S99 A;  2P6S A;  4ED8 A;  3AOD A;  3DFE A;  3CD7 A;  2MEW A;  3QJJ A;  1VQS A;  2OUG A;  3PDN A;  1ZYQ A;  3ICL A;  1SC1 B;  2H54 B;  3V6D B;  1CJT B;  3VVU A;  4QW8 A;  3QAU A;  4OJG A;  3BBC A;  2FY8 A;  3C14 B;  4P73 A;  4ECQ A;  2GMH A;  2DCL A;  4P9S A;  2ZJR Q;  1U4B A;  2V2V A;  3CMQ A;  4LRF A;  1EQM A;  2H5J B;  2RRA A;  3X1L B;  2VH7 A;  5D8H B;  4WP3 A;  2YKM B;  1TKT B;  3CGI A;  1ZET A;  1NKE A;  3OL9 A;  4B3M J;  4O3O A;  2JC1 A;  4BC7 A;  2CAD A;  4OI4 A;  4TY9 A;  3GON A;  1N5S A;  2MGZ B;  1JK9 B;  1TL3 B;  4ZHR A;  2FJD B;  2MJN A;  1S59 A;  2VJU A;  4ES2 A;  2I2Y A;  1X4D A;  3BDE A;  3TI0 A;  3GQC A;  4A8K A;  2WTF A;  3THP A;  4RLE A;  1K1Q A;  1LW0 B;  3MMA B;  2VQE J;  5LXY A;  3SV4 A;  4RU2 A;  3BSO A;  3LO3 A;  2CJY B;  1NJZ A;  3GV8 B;  4B3M F;  5CHC B;  1LV5 A;  4NL5 A;  5KFC A;  4ES3 A;  3DOK A;  3H5U A;  1IBL J;  2DHS A;  2IA0 A;  1AXQ A;  1MU2 B;  3AA9 A;  1IR1 A;  2PMH A;  5DG8 A;  3FFI B;  1YIJ S;  2P2C B;  2W9A A;  4LR9 A;  2ILY A;  1W7W A;  2VOO A;  5C5J A;  4A8W A;  2K3K A;  4ZDN A;  3I82 A;  3Q24 A;  4C3L A;  2NQP A;  2EW9 A;  3BBB A;  2VQE F;  2ZFH A;  1WUU A;  1UJ4 A;  1JNZ B;  3AA8 A;  2HQD A;  4QJV A;  2IVF B;  2Z2M A;  1YK9 A;  4NZ0 A;  5KAK A;  5IQQ A;  3PV8 A;  4ZK7 M;  2VG5 A;  3M1V A;  4NLX A;  2IBK A;  2XHW A;  3IRX A;  2B6A A;  4RU9 A;  3ZZT A;  3KLF B;  4Z37 A;  1WOS A;  2CNK B;  4C6A A;  2Z30 B;  2GVZ B;  4HTI A;  2NPI A;  4XK8 C;  3KG0 A;  4U7U K;  5HRO B;  3M9O B;  3Q0A A;  3FRY A;  3SSS A;  1H0H B;  3E3X A;  1WG1 A;  5LSO A;  1VBZ A;  3M32 A;  2YBV A;  1N34 F;  2J0Q D;  1WTB A;  2QA4 G;  1RHR B;  2RE1 A;  2ILZ A;  2IY5 B;  5CAA A;  1X4F A;  1LWC B;  1DTT B;  5IT9 Y;  2MY7 A;  1KEK A;  5J2M A;  4XDC A;  1VRQ C;  5F8N A;  2JRS A;  1S5Z A;  2J8S A;  2J7U A;  1UKU A;  3VAH A;  2YNG B;  1FHT A;  4LVN P;  3TYT A;  5IZH A;  3OTD A;  2R42 A;  4Y2C A;  2O1P A;  1SV5 B;  5KG3 A;  1UMJ A;  4DXL A;  2HHQ A;  4MKB A;  4DR7 F;  1XNR F;  2CQ0 A;  2QTW A;  5HMX A;  4J9U E;  2GFF A;  3NXZ A;  2DTJ A;  4WU3 A;  5DG9 A;  1G6B A;  4DR5 J;  2W24 A;  2K1R B;  1JLB A;  4DPW A;  2IRY A;  3NBP A;  3PFO A;  1W25 A;  4N8N A;  3J80 U;  4DSK A;  4C0H A;  3KLH A;  4RUB A;  2KJV A;  4F4X A;  2R7Q A;  1O8B A;  3SFG A;  3THT A;  2C3M A;  1SUQ A;  3BJY A;  2PII A;  2EFP A;  1SQG A;  1CC7 A;  3IP0 A;  4OHW A;  1T94 A;  2UUT A;  4USK A;  5A6P A;  3BH6 B;  2HNZ B;  5I42 B;  2BX6 A;  1F3F A;  4IOC Q;  4A47 A;  4OHV A;  2HHH J;  5KFU A;  2VJV A;  3C6U A;  3U1L A;  4M1K A;  1JJH A;  4A46 A;  1RT7 A;  3D6H B;  3J7A 1;  1LWE A;  4A8M P;  4DSE A;  1X0F A;  2FVR A;  3DN9 A;  1SKR A;  1Y3K A;  2B9E A;  1VYA A;  2RNE A;  3GYX B;  5IV3 A;  1ZAV A;  1JX4 A;  3A13 A;  2J0X A;  3LP2 A;  1RKI A;  1K47 A;  5FLX U;  1YHQ S;  3ZTO A;  2XGP A;  2NCK L;  1RT2 A;  5LMN F;  1VQP S;  1DFD A;  3V6K A;  2A0F B;  2G2O A;  2W8K A;  2HFZ A;  3QJL A;  1TK0 A;  1KOH A;  3D1Q A;  1UPM B;  1HAR A;  5AJ3 F;  1UVI A;  3F0N A;  1TKZ B;  2HHH F;  4HR2 A;  2MDA A;  4OJ3 A;  1CBK A;  2DY9 A;  1ARO P;  3W8P A;  1Y00 A;  3H42 A;  2ZH7 A;  1TUV A;  2X1G A;  2XS5 A;  3I6P A;  4PQU B;  5KFJ A;  1U47 A;  3MUM P;  4MJK A;  5LL6 d;  4DU7 A;  1J5O A;  1G1X A;  5EX0 A;  2PEB A;  4YHH F;  4UZB A;  5KT4 A;  1R0C B;  3EXC X;  1P27 B;  2DH9 A;  2G1D A;  1JJ2 R;  4QCL A;  3BO3 A;  9RUB A;  3ELH A;  2ZC3 A;  4N41 A;  2ABY A;  4NAS A;  3GZ7 A;  4V19 J;  4DV1 F;  2M70 A;  1H98 A;  1R89 A;  2DPI A;  4B3S F;  5F8H A;  1NB2 A;  3H5S A;  3BPS P;  4FBU A;  3V6J A;  1KR4 A;  3G6E S;  3UR0 A;  5AE1 A;  1HWU A;  2HMI A;  2FLN A;  1FF2 A;  4CTA A;  4ZVO B;  3IAM 9;  2W9C A;  1AFI A;  3CW2 C;  3MOJ B;  3RU0 A;  1B4S A;  1HMV A;  1VQ6 S;  4IG3 B;  4RNH A;  1CPZ A;  4FYX B;  2XLI A;  2WON B;  2N4D A;  3BR9 A;  3T5K A;  3RBZ A;  8RUC A;  3DMJ B;  2NXC A;  1ZA1 B;  5LMU J;  5EUH A;  3KJQ B;  2QLW A;  5I3Q A;  4O3Q A;  3RR8 A;  4DSJ A;  2RIL A;  3BGR B;  3ZZR A;  1DAX A;  4CO3 A;  2IIH A;  1U2R A;  3JYT A;  2HBR B;  5DQG A;  1D9D A;  1SH2 A;  1S1X A;  1X4G A;  3MD1 A;  4PXB A;  1ZPW X;  4OHX A;  2LDY A;  4LRE A;  4CLZ A;  4W90 B;  5K5M A;  2Q79 A;  2DR7 A;  1KLN A;  3QZ7 A;  1IBM J;  2LKZ A;  4AUK A;  1NRK A;  4ZIT A;  1BMQ B;  1HW8 A;  4DSL A;  5LMU F;  4MAK A;  4LBI A;  2C2N A;  5KT5 A;  2HVD A;  3TVK A;  2QMX A;  5CYQ A;  1RAD B;  2R8H A;  1TUW A;  2R7O A;  1GTE A;  1H2T Z;  5LSL A;  4WCE Q;  1S9E B;  4N7T A;  1DLO A;  3VAI A;  4ER8 A;  3BS9 A;  3DDI A;  1HQE A;  2UUC J;  5LSR A;  4IQX A;  1RDR A;  2UVU A;  1FXR A;  3UR3 C;  2AP6 A;  2EC2 A;  3SCJ E;  2H5I B;  2W7O A;  4ZPW R;  2OHD A;  3RRG A;  2J5A A;  4ZCM A;  1IBM F;  2W2Q P;  2RML A;  1CJK A;  5MLC V;  5ETL A;  5KFK A;  2UXD J;  2OEL A;  1U48 A;  1X5O A;  1NK6 A;  2PC6 A;  1TL5 A;  1VC5 A;  1APS A;  3B6B A;  4CO1 A;  5DM6 Q;  2B51 A;  3M6U A;  5HL7 Q;  4EZ9 A;  2UUC F;  4X62 J;  4OI2 A;  4BBY A;  3ZZZ A;  1CJV B;  2V8P A;  4DSF A;  4B9N A;  4WXW A;  4RW6 B;  1FVS A;  4ILR A;  2OPR A;  3E2E A;  1F5C A;  1FT8 A;  2YNH A;  2V94 A;  3W66 A;  4JI2 F;  1RXO B;  3NNA A;  4K7Q A;  2ASD A;  3BO4 A;  2JEJ A;  2FVC A;  2PE8 A;  4M5M A;  3W5X A;  3D7S B;  3JXO A;  4MIA A;  2D9O A;  4UQG A;  3AHP A;  3FBF A;  2ATC B;  3I55 S;  2ZBC A;  4P71 A;  2J9D E;  3GTY X;  2B7B B;  1JLE B;  3M8P A;  3R6G B;  3G6V A;  1SJ4 P;  2WBM A;  2HFV A;  3WBZ A;  3MXH P;  2F5G A;  2GIF A;  4LSN B;  3ULH A;  3R5C A;  2OPP A;  3O6Q A;  2AV5 A;  2BJD A;  1FKO A;  4LF8 F;  3PX6 A;  3CJS A;  1WEY A;  4XIU A;  2J0W A;  4EU0 A;  4IG0 B;  1SKW A;  3PX4 A;  3G82 B;  2OEK A;  3POT A;  2GML A;  4DV0 J;  1MWZ A;  2VG7 A;  4PXC A;  4OYM A;  3K5L A;  3K58 A;  3TEH B;  3VGS A;  2H1Y A;  2ZH8 A;  3VQT A;  4F25 A;  3LWM A;  1OSD A;  3CJ4 A;  2OTJ S;  3R7S B;  4S0M A;  5GME A;  3N6N A;  1F6T A;  3OR2 B;  4KV8 A;  2QJ3 A;  4K4Y A;  3MM8 A;  2M4M A;  1KHW A;  3DYA A;  3KTQ A;  4G65 A;  1Y10 A;  3ET6 B;  1L3V A;  3O8W A;  3AQP A;  4Y6I A;  2V9W A;  1S49 A;  5KFP A;  1JLF B;  1VHF A;  3BF4 A;  4OX6 A;  2DKO B;  1VK3 A;  3GFX A;  2XMM A;  4HT5 A;  9ATC B;  1VC0 A;  2QE5 A;  7FDR A;  1XR7 A;  4ZPV R;  4FNH A;  3IGN A;  5DG7 A;  1KD1 T;  2XSJ A;  5GAH U;  1R31 A;  1MWQ A;  3G86 A;  4ID5 B;  4USW A;  2MHE A;  1S6Q B;  1RJJ A;  4RWW A;  3CJ8 A;  1RTI A;  2NS1 B;  2IC3 B;  3F56 A;  4ILM A;  4LRA A;  3AD7 C;  2BE2 B;  1SI9 A;  1WI8 A;  2RKI A;  1U6F A;  4LFC J;  3IBW A;  4MKY A;  1W26 A;  4I2Q A;  2B3T B;  4F3Q A;  2W4C A;  2JSX A;  3OFG A;  1H7W A;  1I5O B;  3KK1 A;  2C3P A;  3TAP A;  1YZ7 A;  1KNZ A;  1V5V A;  1FWL A;  3PXG a;  1RWW B;  5E3R A;  2F9J A;  1HBO B;  1S1U A;  1HWJ A;  1RTH B;  4A8Q A;  4H4K A;  1VBK A;  1VQM S;  5FDL B;  1KSP A;  1SJF A;  2I5J B;  3T1Y F;  2FD2 A;  1YWX A;  1FRL A;  4DR1 J;  2EVZ A;  3HVT A;  4YS2 A;  5KG6 A;  1AFJ A;  2KU7 A;  1IR0 A;  1S9G A;  5M2P A;  1GAO A;  1SJR A;  1WDT A;  2QLB B;  4DR3 J;  1EJ7 L;  1DAR A;  2F8H A;  5L9N A;  5IT4 A;  3NNH A;  4CCH A;  4M63 A;  2KM8 C;  1AYE A;  4J9M A;  2YWE A;  4WZM A;  1DY3 A;  3BDP A;  2MZ1 A;  2UXC J;  1RT4 A;  3V6D A;  5E5N A;  1S1V A;  3DCA A;  3BB5 A;  3IS9 B;  2ZZT A;  1HFE L;  3P5B P;  1FKP B;  4Q45 A;  3IAS 9;  2BOA A;  2YKN A;  1AT1 B;  1YVF A;  2OAU A;  2YNF A;  5T41 A;  2IPO B;  3VAG A;  1RTD A;  4USJ C;  1VRT B;  2XQC A;  3ZZY A;  3TAQ A;  1NDP A;  4EO8 A;  3QJP A;  2W4D A;  3I96 A;  2ZC4 A;  1Q8K A;  2OPS B;  3DLE A;  4CO2 A;  3AXM A;  2HHS A;  5L8R C;  2HBQ B;  4B9S A;  1QDU B;  2F63 A;  2WBR A;  1D9F A;  3MZI A;  4I56 A;  1F2H A;  1T9Y A;  2AKW B;  2ZJP Q;  1VLO A;  1ZZN A;  1U2F A;  5IWA F;  3OTO J;  2C2O B;  4ED3 A;  1LW0 A;  3JSB A;  3OHA A;  3MMA A;  1Y9O A;  3KK2 B;  1QUV A;  4AYB D;  4G1Q B;  3KK3 B;  4GC7 A;  5AXN A;  3EJM A;  2WSE C;  3GR1 A;  3CC2 S;  1VK8 A;  4M94 A;  2HPU A;  5C24 A;  1K9M T;  3HT3 A;  2R2S A;  4B9V A;  2DHG A;  3JQM A;  2LXI A;  4IQM A;  3D68 A;  4J9L A;  3MED B;  4LF6 F;  5DLG A;  4L74 A;  2ZH1 A;  2K3I A;  1UEV A;  1RWK B;  4IR1 A;  3GPA A;  2A6O A;  4NLW A;  5KT6 A;  5DDP C;  4PKD B;  4Q0B A;  2D3O 1;  1B99 A;  3NS6 A;  1KQF B;  2YWF A;  2QX0 A;  1DTQ B;  5AE2 A;  2BZ2 A;  1RAI B;  4OZ0 A;  3B4D A;  4E0D A;  4AQY J;  3Q22 A;  4HKQ A;  4I7F A;  3CMA S;  4ZMM A;  4WIQ A;  2BW7 A;  2ZH6 A;  2ROG A;  1Q5Y A;  3GJS B;  1NJX A;  5F8I A;  1YBA A;  1OY9 A;  1LK7 A;  3J81 Y;  1PC4 A;  2DGQ A;  2YQ0 A;  1OIA A;  4RJV A;  2FZG B;  1IQT A;  2Y0S D;  1FK9 B;  2YWW A;  4CQ1 A;  3R5D A;  4QYZ J;  4OYZ A;  1R43 A;  2JC0 A;  3T6J A;  1NDK A;  5A76 A;  5HRO A;  1G2E A;  1SIW B;  3K8W A;  1G7C B;  3RTV A;  2VFU A;  3W9I A;  4DV5 J;  2LDI A;  5EWE A;  4C7Q A;  4QU7 A;  4DS4 A;  2W4P A;  1ZAX A;  2DNK A;  1FDA A;  2CG4 A;  4ZPT R;  1TK8 A;  4D3G A;  3G6X A;  1HD0 A;  1PJ6 A;  4X65 F;  4L75 A;  4DL3 A;  2QA4 S;  2NXU A;  1D1U A;  2VBY A;  3C16 B;  1DTT A;  1VDH A;  3IG1 B;  2R8I A;  4MFB B;  4WJB A;  1C2P A;  4W92 B;  3EM1 A;  3KJF B;  3C19 A;  1P1T A;  4X4P A;  4UOF A;  4QOT A;  1HPZ B;  3VTI A;  3UCU P;  4ELT A;  1WOP A;  1LKZ A;  1D0E A;  1IUJ A;  4PYD A;  2DT9 A;  3TX8 A;  2ALY B;  1BQM A;  1FDD A;  2COL A;  3TZW A;  1BQN A;  3M05 A;  1IM4 A;  3BQ2 A;  1NB7 A;  2MST A;  2AX1 A;  1EET B;  1XWL A;  5CAB A;  2XY7 A;  4KKO A;  3A3P B;  4I69 A;  2K1R A;  5D0G A;  4TXS A;  4WPA A;  1RT3 B;  2KG1 A;  2MZS A;  1YZ6 A;  2HK2 A;  2YNI B;  4DN0 A;  1J27 A;  1SL0 A;  3GIR A;  1QE1 A;  2MJU A;  3RBX A;  1W2B R;  4HLB A;  4WII A;  2AEJ A;  1UFK A;  3UQS A;  1ACM B;  2OEJ A;  3IA0 A;  3R2D J;  2NZC A;  2ADC A;  2P9E A;  4C8N A;  3HSJ A;  4J9K A;  1UVK A;  2AYM A;  3IM8 A;  4OFZ A;  4A48 A;  3ETO A;  2DO0 A;  3GIM A;  3DOL B;  2XYG B;  2W2N P;  2FC8 A;  3UN2 A;  1YJU A;  2ZBP A;  3FZ2 A;  1RT5 A;  3N9U C;  3QRP A;  3TJ9 A;  2VPW B;  1HBN A;  3RBD A;  1DHM A;  4CLP A;  3R1H A;  1LXJ A;  2JFK A;  4KHP F;  2UV8 G;  4KH1 B;  4KGM A;  3GB0 A;  2NXN A;  2FJE B;  2B9Y A;  4B17 A;  3RW7 A;  2MLZ A;  2N4C A;  3PTW A;  4O4R A;  3PYF A;  4DL6 A;  3TAN A;  4DR6 F;  4DV7 F;  4F36 A;  3ZZP A;  2CNN B;  3QAE A;  1NKB A;  3IMQ J;  4ED1 A;  1IKV B;  2WOM A;  1NDL A;  3QGG A;  4UZC A;  3VAM A;  4JI8 J;  3I4H X;  3NGK A;  5CZX A;  2IM1 A;  1RWP B;  4PQU A;  1MMN A;  4DUY J;  2B43 A;  1EIY B;  2P8I A;  4EZ6 A;  3GG0 A;  1UVM A;  4DV2 F;  5DGA A;  4DL2 A;  1RTJ B;  1RWU A;  1KFS A;  5F8M A;  4ZLL A;  2AF6 A;  1R8A A;  2A3J A;  3TJ8 A;  1B64 A;  3GR0 A;  2RQM A;  3G8S A;  4X66 J;  5AE3 A;  2AEF A;  1LWF A;  3RAQ A;  3BH7 B;  1S0M A;  2F1F A;  2KYZ A;  5ETN A;  1VRU A;  2HFS A;  3D0H E;  3RYL A;  5L38 A;  4HAC A;  3GU0 A;  4LUB A;  1G3O A;  1S4F A;  2UUB J;  4TNO A;  2UUA J;  1X0P A;  3TQ1 A;  3Q83 A;  3QIP B;  4DUY F;  1YGY A;  2RAQ A;  3HVA A;  4M5D B;  2LA6 A;  2VQF F;  4DSI A;  2VAS A;  4ES1 A;  1T7P A;  2H4W B;  1H2V Z;  5LXR A;  4DV3 F;  4NLY A;  2QZ8 A;  3PYD A;  1RUS A;  4IG3 A;  5ETV A;  4JBC A;  3I56 S;  4ECW A;  5IV4 A;  1NHU A;  1RLC L;  5U47 A;  3ETM A;  4WE1 A;  1UEK A;  1GFW B;  4ECS A;  5ETQ A;  3R5J B;  2HQF A;  2DGO A;  2AYG A;  3DMJ A;  4F04 B;  2CJA A;  4OZL A;  2FHM A;  3I0S A;  4Q5V A;  2CNO B;  2LLZ A;  1S1W A;  4DS5 A;  4FZV A;  3T9Z A;  1NDC A;  4OIX A;  3TQE A;  1TR0 A;  4ANE A;  1T9X A;  1UJ6 A;  1KS2 A;  2V2Z A;  3QSI A;  1XBW A;  3EGW B;  2DK2 A;  4DG1 B;  4YR2 A;  4PPD A;  3PAC A;  3M8Z A;  3TWZ A;  1I3O B;  3EUN A;  3LP1 B;  2Z2Z A;  2V50 A;  3MAA B;  1WHV A;  2BM1 A;  2JVO A;  1FNO A;  3MOZ A;  3M2R B;  4ATN A;  3TA2 A;  3L95 X;  2BEF A;  4YOE A;  4NEY A;  4OI1 A;  3C6T B;  4KO0 A;  1SH0 A;  4N56 A;  3O5T B;  4GKK J;  2GHW A;  4O3N A;  3CJK B;  4Q44 A;  4ZCI A;  3HI9 A;  2D69 A;  4ECU A;  2QN6 B;  4DV6 J;  3H2V E;  5F9N A;  2DGT A;  3FDS A;  3A3O B;  1F0X A;  1S9E A;  1D8Y A;  3DRS B;  4EUV A;  4RPF A;  3PNI A;  1RHU B;  2ZM6 F;  3KUG A;  3EGV A;  3IWL A;  4PXD A;  2DNL A;  2HS4 A;  3W9H A;  3UW1 A;  5L46 A;  1FRI A;  3M2V B;  5LOQ A;  5KFF A;  4MK9 A;  3NY0 A;  2CG8 A;  1SXL A;  2AJ1 A;  2XNR A;  3KG4 A;  3RJM B;  3D6F B;  4AXJ A;  2F8M A;  5F9L A;  3DU5 A;  1HNX F;  4DR2 J;  4A8F A;  1NME B;  2E1A A;  3CPW R;  1WKK A;  4I6Y A;  4TYB A;  1N48 A;  2UU9 F;  1TVR B;  3EWG A;  2HHT A;  2HZA A;  2AX0 A;  4X4S A;  3CCW A;  2AW0 A;  4KJI A;  4LF4 F;  3SQG B;  3W5Z A;  2F65 A;  4RW6 A;  3HUL A;  3QFH A;  2HIY A;  3PR5 B;  1N56 A;  1IKX B;  1JLC A;  2EFN A;  3P6Y C;  1V3S A;  2CQP A;  1B3T A;  2FHK A;  1VQ5 S;  3GSD A;  4F4Y A;  1OPI A;  4WWS A;  3UCZ P;  4G3I A;  4DI6 A;  4DR2 F;  4R25 A;  1JMT A;  4ID8 A;  4LT6 A;  4AL5 A;  1QLN A;  1JLE A;  3D3B J;  4LFB F;  2EI5 A;  3OJU A;  4LSN A;  3CB4 A;  2A10 A;  2ZHO A;  2X51 A;  2BJE A;  2H65 B;  2DEI A;  3CD6 S;  3MEG A;  4C8Z A;  4IG0 A;  4UOG A;  4GVL A;  2HNY A;  2M88 A;  2RHS B;  1WOO A;  4H4M A;  3D66 A;  3T3F A;  2J6S A;  4Y00 A;  4KFB B;  4MIB A;  4UOC A;  1ULR A;  1HBU B;  4K5R A;  1RYS A;  3TUJ C;  2PFD A;  2QO3 A;  4EFA C;  1Q86 T;  4NXM F;  3PRD A;  2NXJ A;  1ZAW A;  1YI2 S;  4N77 A;  3D2W A;  3NEK A;  3R7N B;  3K57 A;  1JLF A;  4DQR A;  3E01 A;  2I38 A;  3OXF A;  3U1M A;  1RB0 A;  1SBR A;  5KFV A;  2VFS A;  2DNG A;  5IFM A;  4DV4 J;  4AL6 A;  5KFT A;  4YB6 A;  4F67 A;  4LSL B;  3QT7 A;  3UDE A;  3W2V A;  4IDK A;  1LFP A;  1C0U B;  4AE5 A;  4FVC A;  4X84 A;  1YIT S;  3EZU A;  1S6Q A;  4DLE A;  2YPZ A;  1R6Y A;  2GQ2 A;  2MQM A;  1LXN A;  6FDR A;  3W8G A;  4UY8 5;  2QRR A;  4N76 A;  2BE2 A;  1QD1 A;  3DM2 B;  1TQL A;  3T1H J;  2BR0 A;  1FWK A;  3EX7 B;  2V68 A;  2KRR A;  2F4V J;  5KFB A;  2BKN A;  1WC5 A;  1X5S A;  4MYT A;  5F8L A;  1JQG A;  4FN5 A;  2I9S A;  1U8W A;  4CP5 A;  4O23 A;  5I3U B;  4CO4 A;  5F8G A;  2HRY A;  3W61 A;  3B78 A;  5D4N A;  1UCN A;  4W98 A;  1HBO A;  5E3Q A;  1ZTT A;  1FX2 A;  1IJF B;  5B0F A;  1CC8 A;  1RTH A;  4OV1 A;  4RWX A;  4FP9 A;  4JV2 A;  3MM5 B;  5FDL A;  4HHH A;  2E44 A;  2J0S D;  4UT4 A;  1PC5 A;  2B7C B;  4XTT A;  2JLF A;  4NXN F;  5MAO A;  3D0G E;  4HYK A;  2NZ4 A;  4P74 A;  1GK8 A;  3W62 A;  1TAQ A;  2ACY A;  2V4J B;  3CIM A;  2JZ5 A;  4R0J A;  2F3J A;  1Q5V A;  4Z2X A;  5T7L A;  3CDW A;  1PSD A;  1XNQ F;  4D3H A;  3I5B A;  1ICE B;  4LSZ B;  3BBF A;  5JVH Q;  1OY6 A;  1HLW A;  2EG1 A;  5G0R A;  1H3D A;  3IS9 A;  1TTH B;  4XPE A;  4CH1 A;  4O3P A;  1FKP A;  2A6M A;  5GAD I;  4TKT A;  2CQG A;  3KFW X;  3SXL A;  1CG2 A;  4O0N A;  2XMV A;  4IYQ A;  2HQC A;  3J7Y I;  2VU5 A;  3MR2 A;  1WHW A;  2RSQ A;  1EX8 A;  4HI2 A;  4JI3 F;  3MCO A;  1NK9 A;  3UDL A;  2MYF A;  1PG5 B;  2OPS A;  3PRV A;  4K4W A;  3AXK A;  3J80 Y;  3IXQ A;  1VBX A;  2CVE A;  1DJ0 A;  1XMQ J;  4DQS A;  1FJG F;  3F41 A;  2E7V A;  4FXV A;  2QLF B;  1KRP A;  2MSS A;  2CPF A;  1HNZ F;  1YKW A;  4PXE A;  1M1K T;  1VJQ A;  5KFS A;  1RAF B;  1XR5 A;  4MKA A;  4OZ2 A;  2MKI A;  2W7P A;  2FJA B;  3CCE S;  2AYB A;  3J7Z T;  2QYC A;  3KK2 A;  2J7K A;  5KT3 A;  1UZH A;  4LQ3 A;  3NAI A;  1RCX B;  2RUG A;  4TU9 A;  3DOK B;  1GH8 A;  2V34 A;  2O3D A;  4NMX A;  3BRE A;  2PA3 A;  2CQH A;  4CLF A;  2NR0 A;  1XMQ F;  2VIH A;  1RYR A;  4ED2 A;  1JB0 C;  1S72 S;  5E41 A;  1S6P B;  1QAI A;  2KFZ A;  5FLX Y;  1YTY A;  4TU7 A;  2L9N A;  3BGO P;  1KC8 T;  4AT1 B;  1RAB B;  3V6H A;  2GV1 A;  1VCT A;  4X4U A;  3PW4 A;  2Z0G A;  3CUN A;  4PYA A;  5J1N A;  4DUZ F;  4RW4 B;  4LFA F;  3M1V B;  3OJS A;  4RUH A;  5KG2 A;  2HG4 A;  3BSC A;  2DGU A;  3EXY A;  1VIS A;  1KFD A;  3IRX B;  4BHQ A;  1RP5 A;  1XK8 A;  2LFV A;  3HHL C;  2V8H A;  3D1H A;  3HHL A;  5JJB A;  4LF1 A;  2HRU A;  2FJB B;  2MZR A;  1VIO A;  2C3O A;  3GIJ A;  2WCX A;  2PT0 A;  4V19 X;  2VDI A;  2IM2 A;  4I0W A;  2RS2 A;  4B9U A;  2RD5 C;  3LGN A;  3H7H B;  3JB9 k;  2MKH A;  5B0A A;  2UVW A;  4NYP A;  4DU8 A;  3C16 A;  1QAX A;  2HFO A;  3IG1 A;  1HD1 A;  4B3R J;  5J2M B;  4MFB A;  5HAN A;  3MR3 A;  2YTC A;  4DX7 A;  3SV3 A;  2BKP A;  3KHL A;  3MM9 B;  2P9G A;  1S79 A;  1RWX B;  2E5I A;  1NU4 A;  1UPP A;  2LEC A;  1REG X;  2ROP A;  3D28 A;  4M5K A;  2I0X A;  2BVZ A;  5DDQ C;  2HRT A;  2EBG A;  1QVF R;  1DBD A;  3HP6 A;  4PG8 A;  3MI7 X;  5HBM A;  3CCJ S;  4RZR A;  1MN9 A;  3DRX A;  4TLQ A;  1RA7 A;  3PKY A;  1FVQ A;  4C48 A;  2VL1 A;  3KLH B;  4F3O A;  2PI4 A;  2KL8 A;  2R4F A;  4TLR A;  1NM2 A;  1MRO B;  4EBE A;  1CJU A;  2YNI A;  4M5H A;  3BKT A;  3D67 A;  3HHK A;  2MQQ A;  4C8M A;  1ZBT A;  4ZP8 A;  2D3U A;  4GKJ F;  3ZTS A;  2PO4 A;  3HZG A;  4OYW A;  3KYL A;  4CM0 A;  3E51 A;  3LH2 S;  2XLK A;  3C6U B;  2EG2 A;  3L9Z A;  2CQD A;  2ZOG A;  2R7U A;  2RU9 A;  2MXY A;  1V9O A;  1FEH A;  1LWE B;  3MCS A;  3TW0 A;  4DCP B;  2Y9H A;  4YQW A;  4K0K F;  2MZJ A;  2YX1 A;  2EEY A;  3MEC A;  3P45 B;  2C2E A;  2QFJ A;  1B7F A;  1T11 A;  1CVJ A;  3UN5 A;  1JJ4 A;  3DRP B;  2DHA A;  2GIR A;  4IO9 Q;  1J5E F;  4X64 F;  1SB6 A;  4B08 A;  4CM2 A;  2LQ9 A;  4PAB A;  2ZWP A;  1S1T B;  5CCL A;  3IR5 B;  4ZN1 A;  1AZS A;  2CPE A;  2ZBR A;  5J2P A;  4CNY A;  4JI6 J;  3KMS A;  2O66 A;  1C4A A;  3ENQ A;  4MMO A;  4CO0 A;  4RKU C;  1I51 B;  1YBU A;  3Q8S B;  5CH7 B;  4LR7 A;  3JAM Y;  3BGL A;  3MPV A;  5CA5 A;  2DXE A;  2RDJ A;  1T05 A;  2Y8Y A;  2BJ3 A;  2NPF A;  4TU8 A;  2D3Z A;  4B9L A;  2XLJ A;  4WXO A;  4AFF A;  1M5S A;  1R8H A;  2O01 C;  1PYO B;  3HHE A;  5ETM A;  4U7C A;  1XER A;  4RW7 A;  4XDD A;  3MFI A;  2BAN B;  3NCP A;  1N32 F;  1U6B A;  3OHB A;  2LQB A;  2HBZ B;  4DR4 J;  2IBO A;  1SKS A;  2F4F A;  2R3V A;  3MEE A;  4CTA B;  5DDR C;  2W9C B;  4DL0 C;  2MB0 B;  4M5D A;  1FI4 A;  1XMO J;  1IBK F;  4JI4 J;  4N8O A;  3KLI B;  1H74 A;  3M8Y A;  2M8H A;  1WC4 A;  2DGS A;  2PN6 A;  2MKY A;  2HEK A;  5HVG A;  2EKN A;  1HI8 A;  3EMT A;  4CRJ A;  4NLO A;  3AQO A;  1HNW F;  2ZHB A;  1S1X B;  3OTE A;  4O4G B;  2W01 A;  3BV8 A;  2W7A A;  5D77 A;  2Z4P A;  3MD3 A;  4C8O A;  3LP1 A;  3NCQ A;  4KRW A;  4P7T A;  3MAA A;  4ZIV A;  1VC6 A;  2M5Y A;  1EZZ B;  2ZZN A;  1XQI A;  1BQX A;  4FYD A;  3DGP A;  4F0K A;  3UDV A;  5HMZ A;  2XMT A;  1R8P A;  1NPK A;  4JV5 F;  5K8O A;  2QA2 A;  2FPH X;  4NA1 A;  3H4B A;  1ZM2 A;  4NA2 A;  2EC0 A;  1BXN A;  1QY7 A;  4DFK A;  5HQ8 A;  5CYQ B;  2ZEJ A;  2XGQ A;  4O0I A;  1Q0N A;  1Q81 T;  1NHV A;  1HI1 A;  1DLO B;  1F5B A;  1NPP A;  4DUT A;  1HQE B;  4URG A;  3DRS A;  3R5G A;  4AD6 A;  1N5Q A;  3P49 B;  2NSC A;  2KN4 A;  2ZBI A;  4K2J A;  2V8G A;  1X31 C;  3SCK E;  3N79 A;  3HVW A;  4DWI A;  4DMZ A;  2X7I A;  3M2V A;  3TZY A;  1CJK B;  3TJA A;  4ZCK A;  3G4S S;  5CYM A;  1FRM A;  3O2I A;  1ZM9 A;  2GC8 A;  3MUR P;  4OZ1 A;  4BWM A;  4F50 A;  3DU6 A;  1VOM A;  2LQ8 A;  1YRX A;  3G8Q A;  4YR0 A;  4OX9 J;  1YJN S;  2MPU A;  1G4C A;  1B70 B;  1JWW A;  1U1Q A;  3C66 A;  5HO4 A;  4LF7 F;  3CJ2 A;  4OLP A;  4RW8 B;  4PWU A;  1T95 A;  1NH8 A;  1LWX A;  1Z2Z A;  2VPY B;  4YY3 F;  2E5L F;  2CQ2 A;  3T19 A;  2V2K A;  1U7L A;  2BW2 A;  2D7S A;  3M8P B;  3CWJ A;  4TN2 A;  1A6L A;  1EP4 A;  4JI0 J;  2DNR A;  2DXF A;  1CUL B;  2XS7 A;  2E5G A;  2OPP B;  3A8K A;  1FO1 A;  1FKO B;  2CXE A;  2H4Y B;  1KOO A;  3NGT A;  4PR6 A;  4OHY A;  1KTQ A;  2BM0 A;  2FVQ A;  3OR1 B;  2RIJ A;  2DRB A;  1KQG B;  3POT B;  1X9W A;  3HF5 A;  4NE9 C;  3H20 A;  4CWB A;  1OJ4 A;  4K4V A;  1M5K C;  2A1B A;  1V3Z A;  3AH6 A;  3OTB A;  4KFB A;  4WFZ A;  1H2U X;  4C0B A;  3RAM A;  3PRB A;  5DLF A;  4DQP A;  3GYG A;  2ZDP A;  4KTQ A;  1HBU A;  1UW9 A;  3H8Y A;  1Q8L A;  3K7R A;  3UI3 A;  3QGP A;  3W60 A;  2JEF A;  4FXD A;  4DPO A;  4J90 A;  2OD4 A;  3K5O A;  2CDQ A;  4EBD A;  3DXB A;  2Z2L A;  1QUP A;  1YLX A;  1KBR A;  4WF9 Q;  3I9V 9;  2MZT A;  4K4T A;  3GMG A;  4L6V 3;  1ZPV A;  2XSJ B;  2HWH A;  3TAR A;  2N7Y A;  3GCW P;  2VB6 A;  3Q2T C;  2Z56 B;  4DL5 A;  1RTI B;  2RB7 A;  1YSJ A;  2W2P P;  1UL3 A;  3EDR B;  2AJF E;  2ZD1 A;  3DM2 A;  2LVW A;  4I2Q B;  1OQ3 A;  2G13 A;  3KK1 B;  1PIL A;  2Q1L A;  1N54 B;  3ZTP A;  5I3U A;  4IRC A;  5CCM A;  4GO7 X;  1KP6 A;  4LRC A;  3LPE A;  2BQR A;  2VG6 A;  2YH1 A;  1NK8 A;  2HIQ A;  3Q8R B;  1Y5I B;  1I94 J;  3BGU A;  4KBI A;  1WHX A;  4YEA A;  4QR2 A;  4Q8E A;  2RQC A;  3LWL A;  2XYP B;  3HVT B;  4U95 A;  3K5P A;  3CCU S;  4NCA A;  3CCQ S;  4U8Y A;  4KQZ A;  3KHG A;  3QMQ A;  4ZCL A;  4NLU A;  4U7U D;  1U8S A;  2N7C A;  4FDF A;  1J2V A;  2J9C A;  2DHH A;  1NO8 A;  2KKH A;  2RF2 B;  4K4U A;  4U6P A;  2KM8 B;  2XSF A;  2W25 A;  1RT4 B;  1SQF A;  1M5H A;  3K5N A;  2WAQ D;  1S1V B;  4A8X A;  2JL9 A;  4ZPD A;  3VF0 B;  4NLP A;  3OV7 A;  2NSB A;  2CPI A;  5E0O A;  5AT1 B;  2JDJ A;  1KQS R;  4HTJ A;  2YKN B;  2YNF B;  1JNR B;  5I3P A;  2FIU A;  2XG8 A;  1RTD B;  1N52 B;  3CCZ A;  1ZA2 B;  3EZO A;  1UWB B;  1HIY A;  2WRM A;  4OX8 A;  3VHQ A;  2ZH5 A;  2W2O P;  2UXB J;  4NCG A;  4QR1 A;  3GYN A;  3DLE B;  5BYS A;  2Y1J A;  4L3N A;  3FMW A;  1HYS A;  4K59 A;  1WC0 A;  5C25 A;  1N33 J;  3HX9 A;  1NPR A;  3L7O A;  4ED4 A;  2BQ3 A;  3QYY A;  2KH9 A;  3MHY A;  4ECZ A;  2Y3Y A;  1YBT A;  3EE3 A;  3KLV A;  4TQR A;  3MCM A;  1WDD A;  1T9V A;  1RHM B;  3MMB B;  2C22 A;  4PG4 A;  4A4J A;  1NKC A;  5JVG Q;  3VGT A;  3ISN C;  2GGP B;  4JYA J;  3G2X A;  5CD4 H;  3HSZ A;  5C24 B;  1KLM B;  4DL7 A;  5DM7 Q;  1OPZ A;  1OMS A;  1HR0 J;  5B0C A;  1R6V A;  1Q78 A;  3TX0 A;  3R7B B;  4HI1 A;  4QW9 A;  3GFH A;  4EK2 A;  1S6P A;  3D0I E;  3DC2 A;  3KNA A;  5IS2 A;  3FZB A;  4EWT A;  4WP8 A;  4ITS A;  1BGX T;  1I6J A;  4PQA A;  1FD2 A;  4JB8 B;  3AOC A;  3MUV P;  4CT8 A;  4Q0B B;  1ITP A;  4C97 A;  3T5H A;  4JI5 J;  1RWV B;  2HK3 A;  4O44 B;  4I7F B;  4RW4 A;  1IBL F;  2BJ7 A;  2PA8 D;  1SJ1 A;  4ZKA A;  2MQO A;  2HYI B;  2B8P A;  2O67 A;  3PW5 A;  1R27 B;  1F5A A;  4HDH A;  2X3G A;  1P9Y A;  2BUN A;  2EXU A;  2DIT A;  3CD5 A;  3MUT P;  1MML A;  5J2N B;  2Q6B A;  3ISN D;  4AND A;  2LEB A;  3ZZ0 A;  4DN9 A;  3FC9 A;  4RBT A;  2ZH4 A;  1O51 A;  4RO0 A;  2F7V A;  4KH0 B;  1P8G A;  1QAY A;  3PJW A;  3WQP A;  1FES A;  4MYU A;  2VIC A;  2DCU B;  1WC6 A;  3FCV A;  3PCO B;  3FSX A;  2HHP A;  3PY8 A;  1U1N A;  1OS5 A;  2DHX A;  3IBF B;  4QWC A;  3R5A A;  1FD8 A;  3MM9 A;  3FNN A;  1BQM B;  1B0V A;  2HGM A;  1BQN B;  3ZZO A;  2BRL A;  5KFR A;  1HNI B;  4B9M A;  3N4W A;  3BZQ A;  2Z57 B;  4KKO B;  3LAN A;  2FDN A;  3UD5 A;  5KT7 A;  3DKD A;  2XB2 D;  2POK A;  1QE1 B;  2KHC A;  1MRO A;  3ZXW A;  2ZOM A;  2OIH A;  1VQN S;  1YJV A;  4DCJ B;  4KGX B;  1RHK B;  2KRB A;  4ERD A;  1SIZ A;  4ZA1 A;  3OFF A;  1U1K A;  2HZC A;  1ZZF A;  3R2C J;  2AEM A;  4DLG A;  3V5R A;  1TK5 A;  1N5T A;  2GJI A;  3MGJ A;  3HHN B;  5KG5 A;  1YJW S;  3QNW B;  4DR5 F;  1TAU A;  1RT5 B;  1JLG B;  1HHT P;  1HBN B;  3DNC A;  3EVW A;  5KFW A;  2QL5 B;  5D4P A;  3T41 A;  2Y8W A;  1N36 J;  2HHW A;  5BJR A;  3TP2 A;  3BSA A;  2WVD A;  2CPD A;  3DRP A;  4LF2 A;  5B7W A;  3SMZ A;  1BUX A;  1FA0 A;  3MEK A;  1S1T A;  4LF9 J;  2IVY A;  2HHV A;  5HK4 A;  2WOM B;  3QRR A;  4OZ5 A;  4J9Q A;  3M8W A;  3Q23 A;  4HEA 9;  2GVD B;  4I68 A;  3MWB A;  4DQI A;  1MNE A;  1RAH B;  5IOL A;  2XC9 A;  3HM9 A;  3TNV A;  2LQJ A;  2G9O A;  3OLA A;  1VHI A;  4ZVP B;  3JTN A;  1SC3 B;  1PYT A;  5DQH A;  3DI6 A;  2GJ2 A;  3CXC R;  2OKQ A;  1LWF B;  3DLG A;  2HAF A;  5F0W A;  2F9D A;  4NEZ A;  3KHH A;  1VRU B;  3M30 A;  3LW5 C;  1IKY A;  3GJT B;  4HAC B;  2BAN A;  1FNX H;  1RAO A;  2VBZ A;  2YQ1 A;  2X1A A;  1QM9 A;  2M0G B;  3GJQ B;  1T9U A;  1NJY A;  3OFE A;  3D6M B;  2XWY A;  4J9S A;  2ERR A;  4F4W A;  1TEL A;  4USI A;  2YWG A;  2IMW P;  2FB0 A;  4ICL A;  2FLL A;  2QA1 A;  1LOU A;  4J9P A;  2HKE A;  1R0B G;  2PD1 A;  3QQC D;  3VVT A;  1IVZ A;  3NAH A;  5K14 A;  3I31 A;  3KLI A;  3RRH A;  4KB7 A;  4FBT A;  4WE1 B;  4C9D A;  3CDE A;  1T02 A;  2KT5 A;  3QRQ A;  4NZ7 A;  4NZ6 A;  3K89 A;  3CF5 Q;  3K0J A;  4ZVE A;  3I0S B;  2EWH A;  1RCO B;  2VC1 A;  1S1W B;  4Q8F A;  3ZTR A;  1FX4 A;  4B3O A;  3W64 A;  3MF5 A;  1UTA A;  2XYH B;  2KXN B;  1R3N A;  3IN5 A;  2YPY A;  3JSR A;  2KHD A;  4LRD A;  4O4G A;  3WDO A;  2HVI A;  4F02 A;  4B9T A;  2DO4 A;  4G1I A;  4URQ U;  4NWB A;  1BHN A;  2AIR B;  4KO0 B;  4Y34 A;  2VKR A;  2R9L A;  4J5O A;  4U8V A;  2VFR A;  3AT1 B;  2QG9 B;  4F2S A;  5FJ4 A;  3I32 A;  3HFZ B;  2UVR A;  4EYI B;  2ADB A;  1VQL S;  3VV2 B;  1HQ2 A;  3IR6 B;  3FCH A;  1NXI A;  3ZZU A;  2CWK A;  2QYG A;  2DIS A;  5C42 B;  4MT1 A;  3C2P A;  1FJE B;  2DB1 A;  4Y0F A;  3TR5 A;  1F2G A;  1U6Z A;  3FBB A;  3JSY A;  4KGV B;  3UN3 A;  3KOA A;  1U1P A;  3OUY A;  2ALZ A;  3AB2 B;  4JI7 J;  3QO9 A;  5SUH A;  2JWN A;  1FTC A;  2IRU A;  2V4Q A;  2BA9 A;  3QGH A;  1S77 D;  1HQU A;  3R27 A;  3U1N A;  2XMK A;  3R5B A;  1QTN B;  4OZN A;  1N5V A;  3H25 A;  1YJR A;  1M5O C;  3OD2 A;  3SCI E;  1L5U A;  4DX6 A;  5GAH I;  4C3M A;  4XO0 A;  2AGP A;  5GAE U;  1REV B;  3I0R A;  1NK0 A;  5F8J A;  2E5J A;  2ZUA A;  4RW8 A;  3J7Z 5;  1JLC B;  1TMM A;  4F8R A;  1VI7 A;  2J9E A;  1HKA A;  1MW7 A;  1TFW A;  4WKR A;  1PYS B;  2CZ9 A;  1B7Y B;  2UXD F;  1X4E A;  2EKY A;  1S12 A;  3SQO P;  5B0G A;  4PCQ A;  1FNM A;  2FC9 A;  1XMB A;  2Y1I A;  5KFM A;  3DOM B;  2GMJ A;  4OYX A;  5BYQ A;  1N0V C;  2DEJ A;  1YQH A;  4JV0 A;  4X62 F;  2DBB A;  1CUL A;  2EBE A;  2K7J A;  3T5L A;  3MPY A;  1ZM4 A;  4L3K A;  4OQJ A;  2J8A A;  5DET A;  3MEG B;  3HKZ D;  3OR1 A;  4KHM A;  1T3N A;  2HNY B;  1FFS B;  3ITH A;  3FEY B;  4H4M B;  1RLD A;  1RHJ B;  4RUC A;  2MKC A;  3KDN A;  3D54 A;  3QSY B;  4ALZ A;  1K44 A;  1KQK A;  4Q43 A;  2FY1 A;  3OXG A;  2LP4 A;  3PIP Q;  1SKU B;  3LPY A;  4C98 A;  2B0G A;  2V69 A;  2XEX A;  4F7V A;  2OGU A;  2HFN A;  3UVJ B;  4J9O A;  1Z1Z A;  1PCA A;  2QSW A;  2ZUG A;  5RUB A;  1X7V A;  3FKB A;  2Q3P A;  1O6X A;  3E01 B;  1ZS6 A;  3LA0 A;  4TY8 A;  1SVD A;  2WHO A;  2CQ4 A;  2CZ4 A;  1FFW B;  2HUR A;  2M7S A;  4USV A;  4DV0 F;  1S10 A;  3MMC A;  4CLK A;  1CEZ A;  2WW4 A;  1FRH A;  3W2V B;  3ZC4 A;  4IDK B;  2DR5 A;  4I64 A;  2NXE A;  3MAQ A;  5FD1 A;  4G6V B;  4RNO A;  2CQ3 A;  4DEZ A;  2C1E B;  3A1Y G;  1U24 A;  2LMI A;  2K8G A;  3N6L A;  4DX8 H;  1TP7 A;  3GWC A;  4NRU A;  1QTM A;  5A8W B;  2FVS A;  1Y5L B;  2KZM A;  4FVM A;  4NYZ A;  3CJ0 A;  5I4M A;  1X5P A;  3M9N B;  4WFA Q;  2FLO A;  2VF3 A;  1WEZ A;  2DNP A;  3OVS A;  2V8D A;  4Q2M A;  2LCW A;  5KG0 A;  2L48 A;  5KFY A;  2XM3 A;  1RTZ A;  3LUY A;  2MLY A;  2ZZM A;  4LFC F;  2YKA A;  5CYJ A;  2XBP A;  1RK8 A;  5T7L B;  2R8G A;  1GX5 A;  2WVC A;  2ASL A;  3PJ9 A;  2EK6 A;  2RF2 A;  3SSR A;  2FTR A;  3NL0 A;  3QPI A;  1GT8 A;  5KTQ A;  2AJ0 A;  4ZP6 A;  3BPD A;  1KVK A;  5G0R B;  2KFN A;  3QFW A;  2CIM A;  1D9A A;  1NSP A;  2JLG A;  2VOP A;  5GMD A;  4B3T J;  5J2Q A;  4K4X A;  2FQQ B;  4DR1 F;  2APO A;  2XO6 A;  1NHK L;  2RH3 A;  4WU2 A;  1C4C A;  4ZLJ A;  3TAM B;  1UWB A;  4DPX A;  4QIE A;  1EAY C;  5KFN A;  4DR3 F;  3PYG A;  3NS5 A;  4DFJ A;  2NRE A;  3FK4 A;  1P9Q C;  5K8N A;  2CJQ A;  2C28 A;  1NSK L;  2UXC F;  2OFH X;  3LQV A;  4ZIW A;  4X4O A;  5DDO C;  1RT1 B;  4PUO B;  3QZ8 A;  4B3T F;  4P72 A;  2KT3 A;  1RKJ A;  5JMN A;  4HT7 A;  3A3N B;  2ZDO A;  2LXU A;  4X4R A;  1KHV A;  3DLK A;  3MM6 B;  3MMB A;  3RR7 A;  5M2U A;  4KPY A;  2E7W A;  2RDD A;  5DS7 A;  3G96 A;  2GGP A;  2GAH C;  1PO6 A;  2DR8 A;  2G0I A;  3WC0 A;  2VOD A;  3PIO Q;  1KLM A;  3VZH A;  4P2X A;  4MKV A;  2L3M A;  3UFC X;  2QL7 B;  4IOB A;  1W2I A;  1RT6 A;  4HH1 A;  1RU2 A;  3OTO F;  1FJ7 A;  1YJ9 S;  2YWK A;  2AYE A;  3NGR A;  4UW2 A;  3CIZ A;  1KDN A;  4BLG A;  4WFB Q;  2B5J A;  1U26 A;  3GV7 B;  2DIU A;  1MMD A;  4CLS A;  2IVM A;  4QYZ K;  4DPY A;  3S6E A;  4A8S A;  5CZV A;  2G0C A;  4O44 A;  2FZK B;  2CRL A;  1F9H A;  2DH7 A;  1IWA A;  3HHL B;  1T9T A;  3EVM A;  4ECV A;  3HD2 A;  2FJV A;  2D1C A;  4QWA A;  2HAI A;  4YP3 A;  5CXT A;  2FJX A;  3W7B A;  3GFZ A;  2AZ1 A;  2MKJ A;  4FF4 A;  5J2N A;  4ZJO A;  1WEL A;  5HP1 A;  1SH3 A;  3FGV A;  5H9E K;  3LAL A;  4H4O B;  3L7P A;  5HMY A;  1NAQ A;  5B0B A;  2OD6 A;  2VA2 A;  2G2Z A;  4AQY F;  2DNO A;  3CVK A;  3B4M A;  3FRZ A;  4CH7 A;  5EWF A;  1S6U A;  3ILO A;  5A8R A;  3HHD A;  5H9E J;  3H2L A;  4QWE A;  1PBA A;  2EFO A;  4WP9 A;  4RX6 A;  3F44 A;  3VWS A;  2DYA A;  2E5H A;  2ZVS A;  4DV5 F;  1Y0H A;  1DRZ A;  4CIO A;  4RW9 B;  1JXL A;  5HBM B;  1HNI A;  2CJK A;  4Z7Y A;  2YQ3 A;  4CT9 A;  4LBH A;  5KG4 A;  2BRK A;  3PZP A;  2AMC B;  1RAJ A;  1B0P A;  3GG1 A;  3MM7 A;  1V3R A;  4KSE B;  4QPX A;  5D4L A;  1RQ0 A;  3HFK A;  2IM0 A;  2AJ2 A;  4UST A;  1S7I A;  2WB1 D;  1CJU B;  5E3P A;  3V81 A;  3BR8 A;  3RW6 A;  3VGV A;  4OZ3 A;  3NOC A;  2IDE A;  2LU1 A;  2PI5 A;  2XMA A;  2Z8Q A;  4DPU A;  1M5V C;  1HL6 A;  2QIF A;  3KLG B;  1QJH A;  1N34 J;  3H40 A;  2K7K A;  2GA7 A;  3QAT A;  5HQM A;  1R8C A;  4R8U B;  3MPD A;  4IFV B;  3NWR A;  4ZS6 A;  1EAR A;  4C3K A;  3HD1 A;  2V4R A;  2KT2 A;  3TUI C;  1JLG A;  1ROF A;  1RWM B;  2YX4 A;  3W9J A;  3P96 A;  1TV6 A;  4ZLP A;  3MEC B;  1HNV A;  3N6M A;  4YUD A;  4RNF A;  1SJ3 P;  1UW4 A;  3OL6 A;  1BD6 A;  2J76 E;  2HND B;  1EHW A;  4JOU A;  1IN0 A;  4NLT A;  4CH0 S;  2DNM A;  1BLU A;  4DR7 J;  4J91 A;  1XNR J;  1WSV A;  5KFX A;  3CTR A;  3PM9 A;  3TEG A;  2MKS A;  1SL1 A;  2LU2 A;  3ZFV A;  2DRA A;  5KG1 A;  3A8J A;  1JJC B;  1AZS B;  3M7V A;  5J2P B;  4CZC A;  1WOR A;  5IC4 B;  4P7V A;  2HZV A;  1QSS A;  1M1G A;  4UY8 T;  2ZKT A;  3OXL A;  2Y1R I;  4TVA B;  2GVD A;  4PAA A;  2R7S A;  2HGN A;  2RU3 A;  4EEY A;  1OYE A;  3W3S A;  1MN7 A;  4CLT A;  1H38 A;  3H5X A;  5THW A;  5LM7 E;  1GMU A;  1IM6 A;  1ELO A;  5KOX A;  1T05 B;  4P52 A;  3L4B C;  1H7X A;  4QIF A;  4U9R A;  1K0V A;  3UWT A;  5F0U A;  2YH0 A;  4XPC A;  1TFY A;  2KDO A;  2LEA A;  1PJ7 A;  3BEG B;  3RZA A;  2ASY A;  2B4O A;  3HJF A;  2FUG 9;  4RW7 B;  5GAG I;  5EHH A;  4EGL A;  4ED6 A;  1KN6 A;  3RAX A;  1VQ4 S;  4JI8 F;  3AOA A;  3MEE B;  2CZV C;  3C15 B;  3K59 A;  1LFW A;  4K8R A;  4F4K A;  3HVR A;  2R7T A;  1QSY A;  2LEP A;  2KB2 A;  5B0E A;  3X3U A;  3IGV A;  4DHV A;  4CO5 A;  4M5J A;  5E33 A;  5LMN J;  3HSG A;  1YRT A;  3HXM A;  4PWW A;  3MR5 A;  3EZ5 A;  2IM3 A;  3BM7 A;  3MTJ A;  5A8K A;  4RUA A;  4KT0 C;  5FII A;  3LOU A;  4UQT A;  3A8E A;  5AJ3 J;  3LF0 A;  4ZVS B;  4MK7 A;  1FRJ A;  3EVO A;  3R3T A;  3NNC A;  1DZ5 A;  3IWN C;  4X66 F;  1VS3 A;  2FLP A;  2R2R A;  2WK4 A;  4KC5 A;  5KFG A;  4YB7 A;  2J9D A;  2CPZ A;  3Q8V A;  5IC6 B;  4WFY A;  2A18 A;  3IR7 B;  1OQ6 A;  2UUB F;  4YHH J;  1Y11 A;  2UUA F;  4NLD A;  2CJB A;  2K2P A;  1UA0 A;  2CQC A;  3NOG A;  2BOP A;  2D74 B;  1U0H A;  3JQK A;  3BYP A;  4DV1 J;  1WF1 A;  3NLC A;  2AGQ A;  2E1R A;  4B3S J;  3DGP B;  4PG7 A;  1E6Y B;  3NMA A;  5HJY A;  5HN0 A;  2W9B B;  3B54 A;  5BR8 J;  2BE9 B;  4J37 A;  3R97 A;  2I8E A;  3M8Q B;  3GII A;  4I1T A;  3RB0 A;  3OVB A;  1S48 A;  3Q86 A;  1TL1 A;  2C2Z B;  5J1P A;  1YJ7 A;  3QWP A;  1C1C B;  1JKH B;  2CJX B;  1XN9 A;  5C42 A;  4X4N A;  4DOZ A;  1X9M A;  3OT9 A;  4HHJ A;  2ZNZ A;  3LGH A;  2VPX B;  1IKW A;  2E1M C;  5CYM B;  3DLL Q;  4TYA A;  4H54 A;  5BR8 F;  2W2M P;  2RRN A;  4GKK F;  4FS1 A;  2D3O R;  1JLA A;  3KJV B;  2W1B A;  4ELU A;  3GE9 A;  2R2U A;  4USU A;  4FYV B;  4DV6 F;  1VBY A;  3I87 A;  2KFY A;  5LT5 A;  2DR9 A;  2NLW A;  2SXL A;  5SZT A;  2V67 A;  1RWN B;  4RL1 A;  1CLF A;  4ED7 A;  1REV A;  4WK3 A;  2KJW A;  4J9N A;  2PFF B;  3EDQ B;  5DZ6 A;  3CT9 A;  5KG7 A;  1AA1 B;  3MPW A;  1C0T B;  4I4B A;  2IAJ B;  4KR0 B;  1EP4 B;  4CLY A;  1HWL A;  3DOM A;  4BCA A;  4K2X A;  2YKP A;  5ETK A;  2BJ8 A;  1U0S A;  4U96 A;  2OJ3 A;  3F73 A;  1UVJ A;  1BE4 A;  2F8E X;  4AL7 A;  4ILL A;  3UD3 P;  3PG9 A;  3N01 A;  1UAW A;  4ZPC A;  1OSC A;  5BXI A;  1H6K X;  2BKO A;  2Q6C A;  4W4M A;  4KYZ A;  4O3R A;  2P6T A;  5L1L A;  3DHW C;  4O3S A;  4EO6 A;  2Z2Y B;  3Q89 A;  1X8D A;  4ZVR B;  2Y1L B;  3PYE A;  3UVJ A;  1VFJ A;  1JLQ A;  2BMB A;  2OLW A;  3RB4 A;  1WKL A;  1FTR A;  1TL7 A;  2BAC A;  3NCR A;  4JI2 J;  2ZOF A;  4ZN3 A;  3DDK A;  1RIS A;  3QLH A;  3RBE A;  3CCS S;  2AHO B;  3P4U B;  3GJR B;  4ZP9 A;  2HWT A;  4HH0 A;  1Y5N B;  2HQI A;  2AT1 B;  1VQ8 S;  5KFD A;  1LW2 B;  2XY6 A;  2OP5 A;  3M2U B;  5L1J A;  2VBW A;  4OYP A;  2AWZ A;  4BWJ A;  2DIV A;  4LF8 J;  2ZD1 B;  1Q95 G;  4NLQ A;  2GZO A;  4DPT A;  4IH5 A;  3JAM U;  4KHR A;  4RBU A;  1TMJ A;  3PW2 A;  1GMV A;  2NUH A;  2GQQ A;  4MTP A;  4NPO A;  2HVE A;  2WW8 A;  3AOB A;  1X60 A;  4OI0 A;  5K8M A;  5A8W A;  5D0H A;  3A4T A;  2VG6 B;  3FVY A;  2E1P A;  4F2R A;  4DV4 F;  2DNN A;  3GIK A;  3H98 A;  3FQK A;  1WG4 A;  2XWX A;  2RT3 A;  3CJ3 A;  2MKK A;  2YWH A;  3JS9 A;  3KLE A;  2OO4 A;  2FGC A;  1R0A A;  4F4A A;  4GO5 X;  1L3T A;  2VHG A;  3W2W A;  3T1H F;  4OYB A;  1FRX A;  4J7C A;  2RRB A;  2F4V F;  2CVI A;  3QT6 A;  2DPJ A;  1PKU A;  1JXV A;  2QMU B;  3MDF A;  4CLW A;  3V4I B;  1VR6 A;  3HDS A;  3AD8 C;  3RRK A;  1X4B A;  2HLT A;  2NUU G;  1HWK A;  2JX2 A;  3TUZ C;  3T5J A;  4RR5 A;  3CDU A;  3U02 A;  2H48 B;  5HLF B;  4JV1 A;  5K20 B;  3MPU B;  2CFX A;  1NSQ A;  2LXF A;  1VIX A;  1TU0 B;  3HZE A;  4PRF A;  3GSI A;  5ETR A;  5J1E A;  2AJ4 A;  3LP0 B;  3SDE A;  2IJF A;  3BKF A;  3TAM A;  3DXS X;  2C2K B;  2N82 B;  4NCG B;  4Y65 A;  2UP1 A;  5DZ7 A;  4BC9 A;  4LF5 J;  2UUW A;  1HYS B;  2QMW A;  4GVB A;  2JFD A;  5C25 B;  2QEX S;  4USH A;  1N5Y B;  5DQI A;  1E6V A;  3T1Y J;  5B08 A;  2ZH9 A;  2ACM A;  2RDI A;  2R8J A;  4DF8 A;  1TKX B;  1RT1 A;  1NK7 A;  3G71 S;  1UVN A;  4PUO A;  7AT1 B;  3PFE A;  3CO9 A;  1Q7L B;  5HVF A;  1C1B A;  1VQO S;  2CKW A;  4R5P A;  2QSF A;  2DRD A;  3G8T A;  4PWD A;  2XMU A;  3GP9 A;  5A6W A;  3MM6 A;  1F1B B;  4LBP A;  2QL9 B;  2R7R A;  2YKO A;  5ETS A;  4LF5 F;  1BY9 A;  5EX3 A;  4H4K C;  4FS2 A;  5IM0 A;  1HBM B;  4C11 B;  2YVS A;  3EPG A;  2M3D A;  2KVQ E;  3HKW A;  3TVZ A;  1DQ8 A;  4CNZ A;  4AXI A;  1RGV A;  2L41 A;  3PHE A;  4X4Q A;  1Y7P A;  4E98 A;  4RBV A;  3BQ0 A;  3PVX A;  4FPR A;  2HS3 A;  4Q7A A;  3ENW A;  2ZNY A;  3Q8Q B;  1WNE A;  2OPQ A;  1M5P C;  1ZM3 A;  1U1O A;  3NS7 B;  2CUY A;  4EMD A;  1FDN A;  2MMY A;  2DH8 A;  1S6O A;  4I67 A;  4DFM A;  3NG8 A;  3OL7 A;  2ATL A;  1CJT A;  3IWX A;  3C14 A;  1NLK L;  1MLA A;  5IWA J;  4IOA Q;  2V63 A;  3QT5 A;  2YKM A;  1TKT A;  5DGB A;  2WVF A;  1S0V A;  5C7P A;  1PAE X;  4F0M A;  1RA6 A;  4H4O A;  3K2Y A;  4M5N A;  3H2U B;  1VJW A;  3FEZ A;  2MGZ A;  5HQL A;  1TL3 A;  2VC0 A;  2OI2 A;  5D0E A;  1FXL A;  2E9R X;  1TL4 A;  4LF6 J;  4C0O C;  3PHT A;  3TA1 A;  2CQB A;  4GMK A;  1NH7 A;  3UE2 A;  4GRS A;  4UUX A;  3JTO A;  1QAJ A;  5KFE A;  2E29 A;  4V1A k;  4WFX A;  2VFT A;  2RQ4 A;  2W8L A;  2XCP A;  2VDH A;  1HW9 A;  2VD3 A;  2C3U A;  2CNL B;  3RB3 A;  2V2Q A;  2LA4 A;  1Q8I A;  5A2Q U;  4I6W A;  4N5S A;  4NLG A;  4RW9 A;  2OSQ A;  3DRR B;  2G2Y A;  3G9C A;  1KWM A;  1FXD A;  1MU2 A;  3HHL D;  4EYH B;  1DUR A;  1L3K A;  5D0R A;  3CED A;  1BWE A;  2G0J A;  3CDB A;  3FFI A;  3CJQ A;  3DHX A;  4B3R F;  4F3M A;  1FE4 A;  1HI0 P;  5LJ3 Y;  4DDF A;  1YX2 A;  1F9E B;  3H90 A;  4QWB A;  4M8L A;  3CC4 S;  2BBE A;  1TZ0 A;  2V6A A;  1CQN A;  1SPB P;  2RQK A;  3GV5 B;  4F4Z A;  1URN A;  3SSQ A;  1U45 A;  2GO8 A;  5JXS A;  3OVA A;  3KLG A;  2XHC A;  1RAC B;  4X65 J;  5E3A A;  2Q43 A;  5KFO A;  4R8U A;  1YDL A;  4IFV A;  1T9W A;  2B9X A;  5AXK A;  3KLF A;  1SCJ B;  3KG1 A;  4HHU A;  2HWI A;  1CSJ A;  1FFG B;  1NK5 A;  2GVZ A;  3NGS A;  3O3L A;  2KO1 A;  3P5T L;  2HND A;  2QV6 A;  2DGX A;  1N8R T;  2XMJ A;  2Y0B B;  3QGI A;  1Q1K A;  2YX7 A;  1DQ9 A;  3HPO A;  1CS4 B;  2UVV A;  2XUL A;  4OYI A;  2G1H A;  1MG7 A;  1IBC B;  3R9L A;  2FHJ A;  2XZW A;  4FF1 A;  4K4S A;  3HO1 A;  2V9K A;  4C8L A;  1LWC A;  4IKA A;  4Y28 C;  2VFV A;  1Q7Y T;  3NP5 A;  4CYU B;  3OSN A;  1D3W A;  2AD9 A;  1WJ9 A;  4QYR A;  4DFP A;  4WBF A;  3C3L A;  1UJ5 A;  1XC9 A;  1NJI T;  4X4V A;  2VV5 A;  3IBC B;  1V5I B;  3AB4 B;  2YNG A;  1WG5 A;  4M5I A;  1FKA F;  2FVP A;  1SV5 A;  3HLU A;  4ETZ A;  4L76 A;  3DI6 B;  2KTQ A;  4UUW A;  3T1A A;  2I1R A;  4ZVQ B;  3DLG B;  3FSY A;  2KXH A;  5KFH A;  3UDC A;  1N6Q B;  1HHS A;  2AJQ A;  3AJD A;  3SI8 A;  5HAO A;  3MCN A;  3AJ2 A;  3MMJ A;  1S0O A;  3TZZ A;  5HAT A;  3M30 B;  1IKY B;  5A0Y B;  2AU0 A;  3I5A A;  4WYW A;  2L9D A;  4ZVT B;  4ENO A;  4IO1 A;  4P75 A;  4JI6 F;  2WVB A;  4KHP J;  2JEI A;  3KWM A;  3C15 A;  3NGU A;  1MSW D;  3EGZ A;  3PX0 A;  2MHN A;  5T14 A;  4ICL B;  3A12 A;  3PW0 A;  3ADA C;  2FHJ D;  4OZJ A;  2CWX A;  5K14 B;  2Q66 A;  2ZH2 A;  3RUB L;  1GNK A;  4DR6 J;  4DV7 J;  3Q8P B;  2HNZ A;  5I42 A;  3KUE A;  2IFX A;  3JSM B;  3H5Y A;  2D9P A;  1X5T A;  1FER A;  4LIW A;  1NK4 A;  4B3O B;  1L3S A;  2HVH A;  1U25 A;  4DR4 F;  2QFI A;  4ZJL A;  1OWX A;  1YG0 A;  3I9Z A;  2O5D A;  1WD6 A;  1D09 B;  4DV2 J;  1U09 A;  4KE5 A;  2R2T A;  1XMO F;  1AW0 A;  2ZHA A;  3D4J A;  4JI4 F;  1JXE A;  4K4Z A;  3HCX A;  1SL2 A;  1T0T V;  4YB1 P;  1URR A;  4LMZ A;  2MTL A;  2E1C A;  1TKZ A;  2RUS A;  1SC4 B;  1E6Y A;  1U1M A;  1EKS A;  4CDI A;  2XI3 A;  2W9B A;  1Y3J A;  3V4M A;  4CLU A;  2DR6 A;  1S97 A;  2CAJ A;  3SIP B;  3TO8 A;  2FYX A;  2FZC B;  2VQF J;  3B82 A;  1XR6 A;  3M8Q A;  1RBA A;  2FHO B;  1U2C A;  4PG5 A;  4FPI A;  2DXD A;  4DV3 J;  2HGL A;  1Q53 A;  1P1L A;  2PDA A;  2GW8 A;  1HHQ A;  2M2B A;  3HFV A;  1V6H A;  4DJB A;  1C1C A;  4ZVH A;  1JKH A;  1T8E A;  3VAL A;  2MQN A;  4K5S A;  3OUY B;  1B0T A;  2U2F A;  2H3E B;  1OO0 B;  1GXL A;  1UP1 A;  3QO9 B;  2QLJ B;  1X4H A;  2CQI A;  2OSR A;  1HQU B;  2V8V A;  5IT9 U;  3NKY A;  3KJV A;  2N3L A;  1GXU A;  3SCL E;  1AUS L;  2XY5 A;  2QLX A;  3D3C J;  2X3D A;  1K73 T;  1T03 B;  2CDR B;  3LTO A;  3L09 A;  3FSI A;  1LQ9 A;  3N0V A;  3OW2 R;  3DLJ A;  3I0R B;  3MTK A;  2WON A;  2HS0 A;  1VQ7 S;  4ELV A;  3M9M B;  2C2D A;  4B02 A;  2JLE A;  4R0E A;  3OTC A;  4EI2 A;  3BSN A;  4LIR A;  4OI6 A;  3T6B A;  3K5M A;  4NLV A;  3PW7 A;  3BGR A;  1C0T A;  4Y2A A;  4QPT A;  2ZM6 J;  2IAJ A;  1ZH5 A;  4MIW A;  3EYZ A;  2PMW A;  1NZA A;  5GMK a;  1HA1 A;  3B8H A;  1N0U A;  4JI1 J;  4OX9 F;  5HVH A;  4NX9 A;  3BO2 A;  3UCG A;  1FDB A;  3ZO7 A;  2KVI A;  3SZ2 A;  4J9V A;  3KUH A;  3UD4 P;  3ITH B;  4WK1 A;  3CUL A;  2HLU A;  2PGC A;  4OMF G;  2NYH A;  3W5Y A;  4ZOS A;  4Y3C A;  3OQ2 A;  1HNX J;  5D78 A;  1I1G A;  4P10 A;  2DVI A;  4ZLN A;  3W65 A;  5D4O A;  2KZZ A;  2UU9 J;  2JEG A;  5GAG U;  1QVG R;  3PEH A;  4JI0 F;  2PMZ D;  4LF4 J;  2VKZ G;  4MK8 A;  4JI1 F;  4FYW B;  3CSK A;  3KJN B;  2HW3 A;  4TY8 B;  2WB4 A;  5C2C A;  1N88 A;  2BJ1 A;  2X1F A;  4PZV A;  3MMC B;  3O1L A;  2JNJ A;  2M52 A;  3S7R A;  4QWD A;  4KPC A;  3CCR S;  3N28 A;  3SYZ A;  2ZKU A;  1GMW A;  4ECR A;  2IA6 A;  2VA3 A;  1LW2 A;  3M2U A;  3Q8U A;  8AT1 B;  4LFB J;  3TUP A;  1RHQ B;  4BS2 A;  2OEM A;  2E66 A;  3UO0 A;  6AT1 B;  2A2C A;  2MQL A;  2LYV A;  4IFY B;  4YB5 A;  1CJV A;  1UZD A;  2GIQ A;  4Y2M A;  3PEJ A;  2AGO A;  3U27 A;  4YFU A;  2P5V A;  4FNI A;  3VAF A;  4NLR A;  3IFE A;  4QIG A;  4KGZ B;  5F3Z A;  1RZM A;  3GIL A;  3TZX A;  3BGF A;  2DD8 S;  2XCA A;  3E8O A;  1BC6 A;  2PEH A;  4QR0 A;  2P9C A;  2AQ4 A;  5L1K A;  1WAC A;  5E2Q A;  5K8P A;  4NXM J;  1BWV A;  4UTG A;  4Z7C A;  3VGU A;  2E9T A;  2BYC A;  1FJC A;  3M4X A;  4ETX A;  2CQ1 A;  1NND A;  4IH6 A;  4QU6 A;  2DNZ A;  3Q2S C;  3J81 j;  5B09 A;  2VON A;  5K9F A;  4NCB A;  1RI7 A;  1OYD A;  5KT2 A;  3G82 A;  4FKY A;  4I6A A;  3HT0 A;  1GMW D;  2OML A;  3S8S A;  2KXF A;  2CPH A;  2RJZ A;  3QWU A;  3D5M A;  2CPX A;  3NWG A;  5ITH A;  3V4I A;  2B4P A;  1L3U A;  1EKR A;  1Z2L A;  5F41 A;  3OR2 A;  3S01 A;  1I94 F;  1K0T A;  5J2Q B;  5HLF A;  4NI2 B;  4GC6 A;  3ET6 A;  2J7W A;  2M8D B;  4ECX A;  3CJ5 A;  3FQL A;  5G4D A;  2GAG C;  3WHI A;  4EBC A;  1NSA A;  3LP0 A;  1RAA B;  3ILJ A;  2X1B A;  1O0P A;  2R7V A;  3AY0 A;  2QC3 A;  4OX7 A;  1Q8B A;  4ID5 A;  3OSP A;  2H9Z A;  4DQQ A;  2YXL A;  3VQS A;  2BDP A;  1N5Y A;  3CCM S;  2XO7 A;  3IC1 A;  1KVJ A;  2WZ1 A;  2H5E A;  2IC3 A;  4DF4 A;  4NXN J;  2UZA A;  1TKX A;  2V5H G;  3IM9 A;  4NRT A;  2E9Z A;  3CC7 S;  3ZNJ 1;  1X4C A;  3UNG C;  1X9S A;  2IRX A;  4OJH A;  1WC3 A;  1UWA A;  2ZBQ A;  3ISZ A;  4BDP A;  3DLK B;  4ANC A;  2HFU A;  3OFH A;  1KON A;  1XNQ J;  1KTV A;  1UEU A;  3WIU A;  4WTO B;  2UXB F;  5JUM A;  2IJR A;  1NUE A;  1NEE A;  4HVZ A;  1XEZ A;  2ZE2 B;  1JIH A;  3VAK A;  4ZVF A;  1HBM A;  1FCA A;  2GNK A;  4C11 A;  2CPJ A;  1N33 F;  4I2P B;  2I5J A;  2HHX A;  4DZ6 A;  2Z58 B;  1VQ9 S;  5E7O B;  3P8B B;  2XS2 A;  1RT6 B;  1IQZ A;  2EFV A;  5D3G B;  5E3C A;  2IYI A;  4DZD A;  4JI3 J;  2FGO A;  2B5J B;  1PGZ A;  4C4W A;  4X4T A;  4M5G A;  1WWH A;  3DDN A;  3HMJ G;  1S0N A;  4JYA F;  5IXU A;  1FJG J;  3UNY A;  3D1O A;  4DBQ A;  1UFW A;  3JTP A;  4C2M A;  1HR0 F;  4J9R A;  1PIE A;  2R7W A;  2QGF B;  1HNZ J;  1GX6 A;  5F3T A;  5ADZ A;  2BE7 D;  4OI3 A;  2A2D A;  5DRK A;  2JH3 A;  3ZNU A;  4DCO B;  4P2M A;  4OYO A;  4P2S A;  1Q16 B;  1VRT A;  1WSR A;  5HP1 B;  2CYY A;  3H4D A;  1Z4U A;  2HQG A;  1K8A T;  4KGK A;  4JI5 F;  4ZHR B;  2J6T A;  4NOH A;  5A8R B;  1N4L A;  2EPI A;  4K50 A;  1VMB A;  2ASJ A;  3T9N A;  3O44 A;  1S9F A;  4JP8 A;  2F40 A;  4YR3 A;  2GS8 A;  2LQ5 A;  1WI6 A;  2XI2 A;  4G1Q A;  3KK3 A;  4OLO A;  3OBI A;  4LVO P;  1RAG B;  4DUZ J;  2VZ9 A;  1Y4Z B;  4LFA J;  4IRD A;  2C2R A;  1WC1 A;  3PR4 A;  3DRR A;  4FYY B;  2XTJ P;  2B4U A;  5C2G A;  1KKH A;  2GCF A;  3MM7 B;  3ILI A;  1LEO A;  2MQ8 A;  3VZI A;  4WYL A;  1ZTW A;  2BAB A;  3MED A;  4Q2L A;  3V81 B;  1LNQ A;  2JOQ A;  1NCL A;  3BN7 A;  1IJE B;  2BV3 A;  2R8K A;  1SC6 A;  3FBE A;  1DTQ A;  5GAD U;  2MY8 A;  1WKJ A;  3FCW A;  2VG5 B;  2CA9 A;  3R8Y A;  2B6A B;  5KFL A;  4ZPA A;  3J7Y U;  5HJX A;  3NGD A;  4HDG A;  3MAH A;  1GEH A;  3QT8 A;  1FK9 A;  2B8Q A;  2JHE A;  1TV6 B;  2ZIT A;  1HNV B;  2VBX A;  3RG6 A;  2ZH3 A;  5ETT A;  5H1S V;  2DGV A;  3U7J A;  2B4V A;  4E8U A;  5KFA A;  2D41 A;  2OFG X;  2E7X A;  3M32 B;  3M8R A;  3CD0 A;  2KG0 A;  3NRB A;  3OPK A;  1UFL A;  1S76 D;  3THV A;  1CS4 A;  3CE8 A;  2QT7 A;  3I4P A;  1F3V A;  2ROE A;  2H51 B;  3OL8 A;  4PG6 A;  4CYU A;  2V0N A;  4QZV B;  4N47 A;  1FEE A;  3FEX B;  4IUF A;  4P2F A;  3PKM A;  1A9N B;  1HPZ A;  1U49 A;  5D15 A;  3ZTQ A;  1N36 F;  5L1I A;  1XJW B;  3DLB A;  1K1S A;  2DNQ A;  2HBY B;  4GKJ J;  4WKY A;  2GHV C;  7FD1 A;  4OV6 A;  1GXT A;  2L08 A;  5H9F K;  1RSC A;  1EET A;  1GQE A;  1N6Q A;  4DX5 A;  1WF0 A;  1JLB B;  4LF9 F;  3NBP B;  4M95 A;  3GFY A;  5A0Y A;  4NYO A;  3WX4 A;  3I5C A;  3N5B A;  1RT3 A;  1H72 C;  2BJ9 A;  4K0K J;  1TKD A;  3R1L A;  1RAE B;  3CO0 P;  5H9F J;  2GO9 A;  4KIA A;  1FE0 A;  1DQA A;  1SUQ B;  2C42 A;  5AXL A;  1RU1 A;  5L9X A;  1M0S A;  5L39 A;  2XNQ A;  3H59 A;  2R7X A;  2YY3 A;  2EK1 A;  5HSP A;  2OH2 A;  3QID A;  1CQM A;  1J5E J;  4X64 J;  5A8K B;  1S7H A;  1AB8 A;  4L73 A;  1LK5 A;  3EPI A;  2HSE B;  5DJB A;  3MFH A;  4IRK A;  3CJR A;  1XTZ A;  3UPF A;  5DO2 A;  3DOL A;  4OL8 A;  1RT7 B;  2MQP A;  4FXW A;  4ED0 A;  1WTF A;  3TOQ A;  2JVR A;  3JSM A;  3N5F A;  2BQU A;  3D9B A;  5IQ6 A;  5HI7 A;  1UET A;  1IWG A;  5GAE I;  8ATC B;  4QIV A;  5D6G A;  3LP2 B;  2K06 A;  5EDW A;  3CNQ P;  3KNG A;  1M90 T;  3LGM A;  3SFU A;  3EIC A;  1RT2 B;  1MWY A;  2WSF C;  1NJW A;  2DNH A;  1U0H B;  3TA0 A;  4NLS A;  3MR6 A;  5GVQ A;  3VR1 A;  3SEO A;  4C8K A;  1SJQ A;  1RBL A;  3OLB A;  1N32 J;  1IKV A;  4RNN A;  2WVE A;  2RS8 A;  1EQ0 A;  3FBC A;  1J5O B;  3HK2 A;  3J81 U;  1IBK J;  3C8Y A;  1VQY A;  1TL1 B;  3PO4 A;  1Q4R A;  3LAM A;  1RTJ A;  2UV8 A; 
#chains in the Genus database with same CATH homology
 3DGP B;  1YDL A;  3DOM B;  2JNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...